4RU2A

Crystal structure of a rna-binding protein 39 (rbm39) in complex with fragment of splicing factor (u2af) from mus musculus at 2.20 a resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
111
structure length
111
Chain Sequence
PLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKYSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords RNA-binding protein 39 (RBM39)
publication title Crystal structure of a RNA-binding protein 39 (RBM39) in complex with fragment of splicing factor (U2AF) from Mus musculus at 2.20 A resolution
rcsb
source organism Mus musculus
total genus 32
structure length 111
sequence length 111
chains with identical sequence C, E, G, I, K, M, O, Q
ec nomenclature
pdb deposition date 2014-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ru2A00
2LEAA 1VC6A 4C7QA 5CYJA 1VC0A 1YTYA 1WF1A 2LQ5A 5GVQA 1FJCA 2KU7A 5IM0B 2KXNB 2DGTA 2DO0A 3CCJS 3P5TL 2VONA 2OSQA 2MKCA 5LJ3Y 2LKZA 2YWKA 4CH0S 2MZTA 2AD9A 3VAKA 2QFJA 3HHNB 1WI8A 1M5KC 2MZJA 5MLCV 1H2TZ 2PEHA 3LQVA 2DNOA 3R1LA 2KHCA 1RK8A 3CD6S 3NNHA 1FT8A 1BY9A 2KH9A 4WFNQ 2F3JA 2CQ1A 2RQ4A 1VQ7S 5DDRC 4IUFA 3EGNA 1SJ4P 2ADBA 2JVRA 1X5OA 2KG1A 2HVZA 3DLLQ 5LSOA 1X5TA 2MY8A 2MKSA 2L9WA 1U1OA 3L3CA 2M7SA 4Y00A 2N3OA 3PIPQ 2RS2A 2M4MA 2G1DA 1X5PA 2X1GA 3R1HA 1YJNS 4C4WA 1X4FA 2O3DA 2VOOA 2CPIA 1ZH5A 1X0FA 4RU2A 4W90B 1ZZNA 4WKRA 5CXTA 1VQ8S 1YWXA 2LA4A 1D8ZA 1DBDA 2MYFA 3SXLA 3K0JA 2MZSA 3BO3A 2M8DB 2WBRA 1X5SA 1NU4A 3TP2A 4Y0FA 3Q2TC 2G4BA 5LJ5Y 2A3JA 1X4AA 1PGZA 2X1FA 4YOEA 1OPIA 2N82B 2UP1A 3CMES 2HZCA 2E44A 1P27B 2PE8A 2J0QD 3BO4A 5D77A 2M88A 4OZ0A 3FEXB 3CPWR 5GMKa 2RQCA 1JJ4A 3CMAS 2DNGA 2M70A 2KM8B 3UCZP 5DETA 1K73T 1VQ9S 4Z2XA 1R8PA 1U1QA 2RS8A 4ZKAA 3I55S 2M8HA 2N3LA 1M90T 2DNPA 4BS2A 1X4GA 2RNEA 1U1RA 1S72S 3EX7B 2J76E 3TO8A 2MMYA 2JWNA 2CPXA 4A8XA 3CC7S 3EGZA 4WF9Q 1WF0A 1OWXA 1NO8A 2RRBA 1A7GE 1H6KX 1X4CA 3CCMS 1K9MT 3H2VE 1N54B 2DGUA 2RVJA 2KN4A 2YKAA 2MQLA 3MUTP 2FY1A 3CCQS 2CPDA 1X4BA 4TU8A 5H1SV 3VAFA 1L3KA 1WG5A 2MKIA 1M5VC 2XSFA 3CXCR 3VALA 3LPYA 1VC5A 1VQ4S 3P6YC 1KOOA 2CPJA 2CPYA 2MQNA 1X4HA 1N52B 3P49B 2CPEA 4TU9A 4F02A 4WFBQ 5LXYA 4IOCQ 1DZ5A 1KC8T 2U1AA 3ULHA 2N7CA 1WF2A 1WWHA 3MXHP 1HD1A 1Q86T 2OTJS 2DK2A 3SDEA 2MQOA 1FO1A 3THPA 2CQ3A 2HGMA 4TU7A 2XS5A 1SJFA 2G0CA 1WHXA 3VAIA 1U1KA 2CQPA 5GADU 3S7RA 2XB2D 2CQHA 4C0OC 3CCUS 2MZQA 3SDEB 3PIOQ 3BO2A 2CPHA 1M5OC 3Q2SC 3VAMA 2JRSA 3MURP 1JJHA 1QVGR 5LXRA 5HO4A 2DHGA 1WHWA 2KXFA 2M52A 3S8SA 1A9NB 2ZJRQ 2M0GB 2ZJPQ 2FC9A 2DB1A 4WIIA 2GHPA 2FHOB 3V4MA 2ERRA 1KQSR 2DITA 4IO9Q 2KG0A 3U1MA 2ADCA 2U2FA 1U1MA 3MUMP 1KD1T 3N9UC 5HL7Q 5DDPC 2D3OR 1WG1A 2M9KA 5JVHQ 1NJIT 1UW4A 2V94A 1YI2S 2KXHA 1FJEB 1VBXA 3S01A 5DM7Q 1G2EA 1X4EA 2E5IA 5GAEU 3CCLS 2QA4S 2CQ0A 1SJ3P 3US5A 1OO0B 2AYMA 1VQPS 2KT5A 2DH9A 2OSRA 3IRWP 1F9FA 1WHYA 2QEXS 2NLWA 2YTCA 3JB9k 2RU3A 2LA6A 3ZZZA 4YUDA 2MKKA 2DGOA 3D2WA 1CVJA 2XS2A 3UWTA 3TYTA 2DNMA 4QU7A 2FPHX 3UD4P 2D9OA 2VODA 3HI9A 2MQPA 1WG4A 5IQQA 1HL6A 2DNNA 4J5OA 3R27A 3RW7A 2OTLS 3UE2A 1Q82T 4TLQA 1M5PC 1VQLS 1WEYA 3CCVS 1K8AT 3MDFA 2B0GA 2MQMA 1U6BA 3CC2S 1FNXH 2DHSA 3G4SS 2KFYA 2RT3A 1WELA 1OIAA 4PKDB 3NNAA 5D78A 1U2FA 4WFAQ 3VAHA 5IFMA 4UY8T 2XNRA 2NZ4A 3VAJA 3J7ZT 2MHNA 5GAGU 2DNYA 3H2UB 2E5GA 1YHQS 2L41A 1H2VZ 2F9DA 4QPTA 2MPUA 3G96A 2HGNA 4IOAQ 2M2BA 3MUVP 3VAGA 2DNHA 4V19X 3MOJB 3UD3P 2HGLA 5GAHU 2GO9A 4U67Q 1FHTA 1ZZFA 2LEBA 2DH7A 1U1LA 3U1LA 1B7FA 3FEYB 3OW2R 1Q7YT 3ZZYA 2XNQA 1M1KT 2E5JA 3NS5A 1PO6A 2DNLA 1IQTA 2I38A 2DNKA 2DGSA 5BJRA 5ITHA 2D9PA 2K3KA 2MB0B 2J0SD 1DHMA 2KM8C 3G6ES 4CQ1A 1UAWA 2DIUA 3NS6A 2DGVA 2X1AA 4QU6A 2AYGA 2MKJA 2LMIA 5EN1A 2DH8A 3MI7X 1VQKS 1VQ6S 2X1BA 2J8AA 2L08A 3MD1A 4LIRA 5DDOC 4PRFA 2RUGA 4LJMA 1URNA 2MZ1A 3BEGB 1YJWS 3I56S 2DHAA 3NMRA 2DHXA 2KVIA 2MJNA 2DISA 4PR6A 4LMZA 3G71S 3J7YU 5FJ4A 2EK6A 2CQBA 2DO4A 2EVZA 2BZ2A 1VQNS 3DXBA 2DIVA 4F25A 2FC8A 1KOHA 2AYBA 2DNRA 1HA1A 2ZJQQ 1P1TA 1W2BR 3G8SA 4WCEQ 2EK1A 1UP1A 2MJUA 3CULA 2I2YA 1RKJA 2SXLA 1WEZA 2CQ4A 3B4MA 3P3DA 3UCUP 4YB1P 2RRAA 3IWNC 4M5DB 2DGWA 2KRBA 3S6EA 3BS9A 2CPZA 3G9CA 5DDQC 4OZ1A 4ERDA 1O0PA 1R8HA 2DGXA 2DNQA 3B4DA 3CCES 2MGZA 4FXWA 3CC4S 2YH1A 1HD0A 2KRRA 2KYXA 1QM9A 4FXVA 2K8GA 1S79A 3CUNA 1VQMS 2DGQA 1WTBA 2LYVA 3THTA 2JVOA 2VOPA 2JX2A 2DNZA 1H2UX 2YH0A 2AYEA 1VQOS 1WI6A 1YITS 1VQ5S 1XN9A 2OJ3A 2LXIA 2MXYA 5DM6Q 2MGZB 1Q81T 4CH1A 1VBZA 5LSLA 2HYIB 1U1PA 2CQCA 2MZRA 1N8RT 2KI2A 1WEXA 1FJ7A 2MSTA 2CQGA 2CQDA 3UCGA 4EGLA 3CCSS 2LXUA 2F9JA 1DRZA 1N88A 1SJQA 5JVGQ 2MQQA 1FXLA 1YIJS 1WHVA 1VBYA 1JJ2R 2MY7A 3CF5Q 2CQ2A 2LECA 1QVFR 3CCRS 2CQIA 5CA5A 2CPFA 1UFWA 1D9AA 4QQBA 2MKHA 2MSSA 2BOPA 1U6FA 3MD3A 3VF0B 2OIHA 1YJ9S 2CJKA 2XS7A 4P6QA 3NNCA 4UQTA 2LCWA 5IM0A 3RW6A 3G8TA 4F26A 4ED5A 1X4DA 3CTRA 1JMTA 4W92B 1AUDA 1SXLA 1U1NA 2Q79A 3SMZA 2E5HA 1SJRA 4CIOA
chains in the Genus database with same CATH superfamily
2HWHA 1VC0A 2FHJA 1GMWA 5IM0B 1DARA 1QAIA 2ZC4A 3IM9A 4F50A 2YKNA 4QIEA 2YWKA 4L3KA 1SH2A 1RWXB 4DV6J 1FEEA 3KUHA 1YRUA 2CDQA 4Y2KA 2UUWA 4LRDA 3H5UA 4OYZA 1R3NA 2MKSA 5E3CA 3PIPQ 2G1DA 4DOZA 2IYIA 4H4OA 3HVRA 2ZC3A 2JEJA 1FRMA 1YWXA 4K5RA 4NCGA 1S77D 3SXLA 1XNQJ 1QSYA 3MAHA 1FKPA 4KKOA 3C66A 3IG1A 1R0AB 1PJ5A 1C1CA 3N6LA 1YQHA 4JV2A 1FX2A 4DXLA 3KLIB 3SCIE 2OI2A 4ILLA 3L95X 1NBEB 3HVWA 5AXKA 4UOFA 2B7CB 3MM7A 4DS4A 2ZH8A 1I6JA 1SH3A 3EGZA 4FS2A 1S1TB 1UJ5A 5HSPA 5F0UA 2HS4A 2XLJA 2EFGA 1C1BA 2CUYA 2DGUA 2AW0A 1M5VC 3DOLA 1PJ6A 5EDWA 4GO5X 3JS9A 1UEVA 4NX9A 2MQNA 3RRKA 1T03A 1XEZA 2EFQA 1SC3B 4DUTA 1IJEB 1FCAA 5F3TA 3PJXA 5HBMB 2YQ3A 3OLBA 4AXIA 3K2YA 4K4XA 1VRUB 1T9VA 3MZIA 3CDEA 2FYXA 2ASYA 2UXDJ 3R2DJ 4K4TA 2HHTA 4ER8A 5HO4A 4USWA 1F3FA 5HQ8A 4ZVRB 3BKTA 2VQEF 4RW8B 4Z37A 2QLWA 4YQWA 5KG1A 2GS8A 2MHEA 3K5MA 2G9OA 2C2RA 3W3SA 1VJQA 5IS2A 4EUVA 3CCLS 5GADI 3CJSA 4ID8A 5T7LA 4WTOB 1LWEB 2DH9A 1QTMA 1K0VA 2YKOA 3H5YA 3PW5A 1A6LA 2XY7A 1JKHA 4ZP6A 4ZVQB 5KFJA 6FD1A 3D67A 2FPHX 4YS2A 5E2QA 3TVYA 1FA0A 1EX8A 3T9ZA 2VIHA 1GXLA 1NHVA 3H4BA 2HFUA 4WYWA 3T19A 1NH7A 4CLSA 2PMHA 1OQ6A 4DL6A 1LWFA 3PRVA 4FYXB 4DX5A 3A8IA 4CNZA 2DNHA 3MOJB 1H3DA 3NOCA 1NNDA 1ZZFA 3RB6A 4PG7A 1S6QB 2AJ1A 4QIVA 5J2MA 3HMJG 2RE1A 2HMIA 3NS5A 4CM2A 1PO6A 1U25A 3FDSA 3DLEB 3M4XA 1RTDA 1FFGB 1U0HB 2NYIA 2OHDA 4OV6A 3I32A 5BR8F 1FFWB 1YRXA 1LXJA 2L08A 4RNNA 1V3RA 2CAJA 4M95A 1TFYA 1S4FA 4AE5A 1NMEB 2VDIA 4KB7A 1Q7LB 4OL8A 3IWLA 3UCUP 4LRAA 5JMNA 5DDQC 3GIRA 1KLNA 1WKKA 1XMQF 1QLNA 4FXVA 2Z30B 1VQMS 2DGQA 2FGOA 4QR2A 3TW0A 2VOPA 1NDPA 3M2UB 2VPYB 1RWKB 1VBZA 1YJRA 2PSZA 4EWTA 2YXLA 1LW0A 2MSTA 3CCSS 4FBUA 2F9JA 3EICA 2MQQA 2O67A 3HVTA 2C2EA 2V9KA 2JEFA 3ENQA 3OR2A 3N4WA 2JH3A 4C48A 2LCWA 1QE1A 5HQMA 2PA8D 3PV8A 2E5HA 4KHMA 1SJRA 2M5YA 4WBFA 1MROB 1AW0A 2RMLA 4F4ZA 4XTTA 1RQ0A 2QZ8A 4NLWA 1RWWB 2BQ3A 4LSZB 4ZOSA 2HFSA 3DLHA 3HHNB 3EVMA 3BGRA 4RU9A 1BY9A 4X4VA 1RWPB 1VQ7S 3EGNA 1UPMB 3VVUA 1PYSB 5L39A 4C4WA 3LH2S 1VYAA 1CJKB 1TMJA 5B09A 1HBOA 2ZNYA 1Y5IB 1HMVB 3SIPB 4C8MA 4KGKA 1YKWA 5FD1A 3MPVA 4CLKA 4AUKA 3MCOA 2F4FA 2OPPB 5A8WB 2XC9A 3WQPA 1YK9A 3Q2TC 1HPZB 5BR8J 2G0JA 3P45B 2V2VA 3ILIA 5A6PA 3A8KA 3TJ8A 3HFVA 2W7PA 4GRSA 3MMCA 7AT1B 3RB3A 2X3GA 2MKYA 4Z2XA 2PT0A 4RW6A 2AP6A 3QGGA 3DRPB 4UT4A 1H72C 5D3GB 2XHCA 2HNYA 1APSA 1N54B 1XMQJ 1K47A 2CADA 1TV6B 2R7OA 1N52B 1RJJA 3ZZTA 3IR7B 1S0OA 1KC8T 3KMQA 1D8YA 2AMCB 4DU7A 2ATCB 2AJQA 3ZNUA 3L09A 2H48B 2G0CA 2EC2A 1FVSA 3JAMU 1U8SA 2IRUA 1R8CA 4X4NA 2CJYB 3NGKA 1ZBTA 3SSRA 1S0VA 2XYGB 4C0BA 4EMDA 2DR6A 5KFAA 2ZJPQ 2ZUGA 5HL7Q 4CO1A 2FGCA 3GIIA 5KFQA 4URQU 1DTQB 5JVHQ 1TL7B 1PYTA 2KXHA 4NYOA 3MR5A 5BYRA 2UZAA 3DLKA 2KFZA 1UWBA 4YB6A 2PA3A 2LDIA 2K06A 2XMJA 4ECYA 2L48A 2RU3A 2BUNA 3V81A 3CDUA 5CQGA 3AD7C 4D3HA 2CG4A 2BVZA 3HI9A 5IQQA 1SBRA 3MR3A 2O01C 3MAQA 3DU5A 3VGTA 2UXBF 1M5PC 4CCHA 1CEZA 4EU0A 3CCZA 4ED3A 2BANB 2I9SA 1U2RA 2ZHBA 3VAHA 5IFMA 3QGIA 5KFZA 3QWUA 4JI4F 1OYEA 4ANEA 1FRJA 4RPFA 5J2QB 3UD3P 2OD6A 3TAQA 3TZXA 5GAHU 2GO9A 2BX6A 3OW2R 2V8GA 3GP9A 1M1KT 3UI3A 1VHIA 4C8OA 4CTAB 4DFPA 4RW7B 1QAJA 3I0SA 2HRUA 3EJMA 5DG8A 2BKOA 4U95A 1TAUA 2FD2A 3JYTB 2HAIA 2VFRA 1NB2A 2VG5B 2DISA 4Y2IA 3G71S 4OZ5A 2DIVA 1WC5A 2FQQB 4CM0A 2HWTA 1UP1A 1HNVB 3HSGA 2MJUA 1B7YB 3R8YA 5DGAA 3I9ZA 5HQLA 4GKJJ 5KFWA 2V68A 5U47A 1IM4A 4ERDA 3KWMA 1RHJB 2KRRA 3CUNA 1MG7A 3DRRA 3M2RB 3V2UC 4JV0A 4HVZA 3SQGB 2GMJA 3QNWB 1YITS 5A8RB 2M3DA 1KLMB 2MZRA 3HJVA 1NPKA 3KUGA 1PAUB 1S97A 4DV2F 4DJBA 1FWKA 1FXLA 2GGPA 1EQMA 1YIJS 2VFTA 3RU0A 1HI1A 3CCRS 4OI3A 2Y1JA 5A2QY 4YR3A 1K1SA 2BRKA 1CSJA 3J81U 2HHXA 1KS2A 3T5HA 3M8PB 3E51A 1GEHA 2AIRB 3OTBA 3TJ9A 5CABA 3PZPA 1KTVA 4CIOA 5ETKA 4YB7A 4GKKF 2F8HA 3CT9A 2UXBJ 1KSPA 2GHVC 4CH0S 1YSJA 5H9EK 2A10A 4P71A 4IQXA 2K1RA 3MM5B 2P6TA 4LR8A 3TEHB 4F8RA 5DDRC 1F1BB 1TMMA 4JI4J 1JLBB 3DLLQ 4NLPA 2UUAF 1NK6A 4NLYA 4CLFA 5LL6d 2JFDA 4PXDA 2VOOA 2F65A 1JLEB 2XQCA 3M8WA 1M0SA 4QJVA 5B0EA 5I42A 1FRIA 1KR4A 4WKRA 4DL7A 3RB0A 1RT4B 4U8VA 3PX0A 3PCOB 5HN0A 3T9NA 1KVIA 1AT1B 3FCWA 1VR6A 4DX7A 4KPYA 3FGVA 3LP2A 3ILOA 6AT1B 2Z2MA 1HWJA 2EFOA 4Y3CA 2J7KA 2GVDA 2XG8A 1RT1A 4Q8EA 4KO0B 4A4JA 4I2QA 5KOWA 1P6TA 4ECZA 4WK3A 1LK7A 1SV5A 1JLAA 1ZTTA 3WBZA 5HROB 1SB6A 3GU0A 2YKAA 2OH2A 2R7QA 4A8FA 5AXNA 5HAOA 3CXCR 4E8UA 1L3TA 2HBRB 3BYPA 4WZQA 3N01A 4F02A 2DJWA 2HLUA 4LBPA 2PO4A 1EAYC 4DLGA 2U1AA 3MXHP 1DQAA 2F8EX 1WC0A 3POTB 4H4KC 4DV2J 5LSRA 4Y65A 2GQCA 3PACA 2I0XA 2DR8A 2FTRA 2CQHA 2D3O1 3A8JA 5C24A 2DHHA 2WSEC 4I7FA 4N47A 1MSWD 3M6UA 2FC9A 1S1VA 1RT6A 3PX6A 3HHDA 1S5ZA 3R97A 2V0NA 1RU1A 1CJVA 5MAOA 2E1MC 3QGPA 2ZD1A 2XYHB 4OZJA 2QL5B 4URGA 4GKKJ 3S01A 1G2EA 4LF6F 1X4EA 1X31C 3AFGA 1Q78A 3L7OA 2GZOA 3W60A 5KFVA 1HQ2A 3LP1B 3MEDA 4DSLA 3IBCB 1TUVA 3HHLC 3D2WA 1RT2A 4ED8A 4QU7A 2I5JA 4UY85 2B9WA 4KGVB 4M8LA 1WG4A 3M2VA 1GX5A 1GK8A 3UE2A 1WJ9A 4RW9B 5KG0A 1QAXA 4R0EA 3SEOA 3P4UB 2HFNA 2QYGA 2C2DA 1W25A 3DLBA 2FVCA 3LF0A 1BQMA 3DDNA 5I3UA 3M8QB 3HSZA 3Q8VA 1NCLA 1OS5A 1HLWA 4IDKB 2YNGB 4B9NA 2WVBA 1L3SA 2V4JB 2FHJD 2E5JA 2YNIB 1VQSA 1V6HA 2OELA 1PIEA 1JLGA 4V1Ak 5IQ6A 2DGVA 4QU6A 4DG1B 3FQKA 3RB4A 3D68A 1F9EB 1IBMJ 3TI0A 3C16A 4KR0B 4LJMA 4WU2A 3AOBA 5D0HA 4LF5F 1WOPA 3R5CA 2MJNA 4JB8B 2AJFE 1NJXA 1QY7A 1RLDA 3MEKA 2ZJQQ 2LU2A 2YNHB 4FVCA 3I31A 4ZHRB 1EARA 1MMDA 3T3FA 2JZ5A 4TVAB 4N41A 3BGLA 3PW0A 1IBKF 2DNQA 4ZVEA 2DXEA 1G3OA 1S79A 2VFUA 3CSKA 4LSNA 3LO3A 5D0RA 2V8HA 4NZ6A 2GW8A 2AYEA 3FUYA 1UL3A 4NCGB 4J9UE 5LSLA 1FKPB 3PR4A 3IG1B 3C6TA 1WEXA 1AZSA 2H51B 5BYSA 4H4MB 3FBCA 4ZVFA 1RWUA 1JLCA 1RE1B 2VZ9A 4EI2A 1QVFR 4PG4A 1UFWA 3TEGA 2AGQA 4LF6J 3B8HA 4QQBA 2JOQA 3HT0A 4I0WA 2GJ2A 7FD1A 4DCOB 1ZAXA 3K17A 2KZMA 3IBWA 2QX0A 4WYLA 2GIQA 1HI8A 1SXLA 4K5SA 4OX8A 3ITHA 4DX8H 5IT9U 2E9TA 2P6SA 2HNZB 2W2OP 3R3TA 5HVHA 4MFBA 4X65F 2BQRA 4KC5A 1FJCA 1NEEA 4M5IA 3DOLB 2FJVA 4L76A 3EM1A 2DY9A 1RABB 3RBZA 5KG4A 3MMAB 3OL7A 2QN6B 4ZPWR 3CGIA 2F3JA 5L38A 3HD1A 2HVZA 2L9WA 1RLCL 2QMWA 1NDCA 1Y5LB 4KQZA 2HQIA 2HVEA 4K59A 2XMWA 3NS7B 2YX4A 4USJC 4NLDA 1URRA 3QO9A 3IGNA 1QUVA 5C42A 4PYDA 3U27A 2KZZA 1J5OA 5ADZA 4DR6F 3AH6A 4UW2A 3M32A 2HHSA 3W61A 3BKUA 4LF5J 1T11A 5L9XA 1CULA 5KFYA 4IG3A 2JEIA 3O8WA 2QA2A 3D6TB 1GMVA 5T7LB 4A8KA 2W4DA 1U1RA 5AXMA 4IH6A 4CLWA 3FBBA 1AA1B 1O6XA 2RU9A 1NO8A 3IAS9 4Q5VA 1JKHB 1IBKJ 4AL6A 4OYAA 2AQ4A 4QCLA 2MQLA 5AXLA 5B0FA 3PYEA 1WTFA 1WG5A 3N0VA 4DI6A 2JC0A 1EJ7L 5B0DA 2WSCC 5DLFA 3NL0A 4LREA 1R43A 3ULHA 1MN9A 4HT5A 1IBCB 1BD6A 5LMUF 3PG9A 4LF8J 3M9MB 3H0PA 3BBBA 2HHUA 1WSRA 4DPTA 1W26A 1ZTWA 3W1YC 3A3PB 1NKBA 2V69A 4X62F 1PG5B 3LANA 2KXFA 2M0GB 2BJEA 1RTDB 2EWHA 2U2FA 2FJEB 1AFJA 1CJUA 3O3LA 3W2VB 4ED1A 4X65J 3A3OB 2K3IA 1HNZF 1DY3A 1JLFA 1IKYB 5L9NA 4R25A 3PVXA 4USKA 3W62A 2N4CA 1LKZA 4USTA 3H5SA 3C6UA 3CD0A 4USMA 4F0HA 3VTIA 1JX4A 2OSRA 3QWPA 1SQEA 3C15B 4JI6F 2WK4A 2J9DE 3TUIC 2FJBB 1NDLA 5DQHA 1RU2A 4J5OA 3M30A 1REGX 3W65A 4HHUA 4YDXA 5T41A 4E98A 4J91A 2LVWA 3KG1A 2WCXA 2OP5A 2BJ3A 2UV8A 1U2FA 4NWBA 1HYSA 3KLEB 3GJTB 2WRMA 3ZTOA 5ETNA 4KV8A 1BMQB 4QPTA 1H73A 3Q8SB 4A8YA 3HVTB 2E5LF 2K7JA 3FEYB 1NSPA 3CCWA 2H54B 1U26A 2DGSA 4C8LA 2K3KA 4CT8A 2CXEA 3KLFB 5HMXA 1M1HA 2DIUA 2QE5A 1GTHA 3MI7X 1R89A 2YBVA 1VQ6S 3MD1A 2KVIA 3UR3C 2DO4A 4USIA 3AJ1A 2YKMA 2OPSA 5KG6A 3TZWA 3EZOA 4BCAA 3DGPA 2JLFA 2VPXB 3QLHA 3CJ4A 5LMUJ 4O3SA 3G9CA 2DGXA 4QR1A 4IR9A 2YNFA 5L1KA 1RTJA 5KFUA 4PQAA 4F0KA 4JI0F 1HWKA 4TXSA 1XN9A 4ZPBA 4X62J 5F8JA 4J9MA 3IN5A 2KI2A 1QUPA 2CQDA 5B0GA 1RAGB 3KLHA 4XAKA 1DRZA 2OEJA 5J1PA 4ZPCA 1S7HA 4QIFA 2F8MA 2BJ7A 4KFBB 1HNZJ 4LSLB 2FLPA 3GSIA 4GMKA 4DCJB 1XBWA 4P6QA 4DSIA 2Z2YB 5IM0A 1EETA 4TY8B 4ED5A 4JI6J 2IM2A 2C3PA 1C0TA 3GV5B 3V4IB 4OYOA 4EYIB 4GO7X 4I2PB 1RYRA 3L7UA 3BYRA 2QFJA 4NEYA 2MZJA 3CIZA 3LQVA 1L5UA 2OUGA 3KLGA 3QT8A 4MIAA 4Z7YA 3VZHA 2JVRA 2Q6BA 3JSYA 2BE9B 2ASLA 1SC6A 1R0AA 2CZ4A 2KVQE 2CJXB 3IRXB 2DRAA 3KLIA 1ZA1B 1RHKB 1FEHA 3M8RA 4F4KA 1BQNA 5L46A 3TP2A 3T41A 2C42A 2IRYA 2CNOB 1MMNA 4FXDA 2P9CA 2ZHOA 2VFSA 2R3VA 2J0QD 5D77A 4OZ0A 3MEGA 3HDSA 3TQ1A 3UCZP 1S1TA 5ETOA 5IWAF 3W64A 3DNCA 4ZN1A 1XK8A 1UWBB 2YWFA 4ZN3A 3TO8A 2MMYA 4ANDA 4ZK7M 2VKZG 3J80Y 1CC8A 1K44A 4WXOA 2B6AA 3CCMS 4MK7A 1QDUB 2BV3A 4KPCA 1X4BA 8AT1B 1NK5A 4USHA 4QPXA 4RL1A 2NSCA 3MFHA 2PI4A 3BDEA 5HBMA 3LPYA 3N28A 5D4NA 3OXGA 3F56A 4U6PA 1HQUA 3D5MA 2J6TA 5F8IA 1WWHA 3FBEA 3NAHA 2CQ3A 4OX9F 4N77A 2XI3A 5L8RC 3TR5A 3UDCA 4NXMF 2R7TA 3MMBA 4QWEA 1MWZA 3Q2SC 4RW4B 2JFKA 3R7SB 2ZOFA 5LXRA 2QMUB 3MAAB 1CLFA 4OHYA 1T02A 3KK1A 3I0SB 5IC4B 3HK2A 1LWXA 2DB1A 4NLQA 4IO9Q 4P7TA 3AD8C 2PEBA 4FDFA 4RNFA 3M9NB 1OQ3A 3DMJA 3EXYA 4FNIA 2ZWOA 1LK5A 1WC1A 4OYIA 4AL5A 4X66F 5CD4H 3F44A 3M7VA 2CQ0A 4XPCA 1ICEB 1TP7A 4P72A 2Z58B 4DV7F 5E3PA 1RAOA 1VI7A 2LXFA 3AJDA 4ECSA 3GG0A 3RG6A 3IWXA 1OMSA 5D4LA 2H1YA 2BKNA 2H4WB 2HKEA 5EHHA 3IO1A 3Q24A 1OSCA 3UN2A 3H42A 1M5SA 3N5BA 1D09B 2IVFB 5F8GA 1S9EA 2B8PA 1Q8BA 3CCVS 2PMZD 1PBUA 2W2QP 1VJWA 5D78A 4DL0C 2J8SA 2CNNB 2PGCA 1S6QA 4RR5A 2IY5B 5HP1A 2FVPA 2R9LA 4ZA1A 5KT6A 1S6PB 5KFIA 3OV7A 5IWAJ 2H5JB 1B7FA 4KT0C 3C2PA 3Q83A 2CZVC 5AE3A 1F60B 3GMGA 2I38A 1Y00A 1FNOA 3Q8PB 3BBCA 1H98A 4J9NA 2DH8A 3HFZB 3K58A 1URNA 1YJWS 1RWOB 4Q7AA 2DR9A 4F0MA 2EK6A 3ZZUA 4B9MA 3ZZOA 1U48A 2K1RB 2XWYA 4DR2J 1HR0F 1R8BA 4I1TA 2ZBQA 4OX9J 2G13A 4G1QB 1AROP 4G6VB 3THTA 4NXMJ 5I42B 3PRDA 3VV2B 1UCNA 5IT4A 1MLAA 2YH0A 3SFGA 2BM0A 4KY3A 4DV5F 2GJFA 2OJ3A 1NHKL 4CH1A 2W9AA 1U1PA 1T8EA 2YWWA 3IC1A 2VDHA 2V4QA 1RT7B 4I4BA 2GA7A 1WHVA 3LP2B 2MY7A 3ICLA 2QA4G 1RWNB 1FVQA 1Q4RA 2F63A 2CYYA 1Q0NA 1NPRA 3LPEA 1IN0A 2OIHA 3TJAA 4DV7J 1RT1B 3HVAA 1VK3A 3NEKA 4LFCF 4EZ6A 1Y0HA 2J9EA 4I2QB 3LWLA 1U1NA 5KG7A 1YLXA 1JLAB 2E29A 2FIUA 3MFIA 4LRBA 4ZPVR 2J0XA 4GC7A 3BSNA 3KG0A 5CH7B 5LJ3Y 2H4YB 3IMQJ 1XR6A 5A0YB 5MLCV 4MMOA 2KHCA 1PAEX 1FT8A 1CJKA 2W01A 3R5JB 4OJ1A 1QD1A 2Z0GA 1FDBA 5B0CA 3H4DA 1HMVA 3L3CA 4H54A 4W98A 4CI0B 2OPPA 4K4WA 3HHKA 2V5HG 5ETQA 5K14B 2LFVA 1HNWF 3JTNA 1QSSA 3K0JA 2MZSA 4KE5A 5C24B 3ZXWA 2ZZNA 4WP8A 4ZVSB 2ILYA 2MDAA 1ZETA 2N82B 5A8KB 4C8NA 2HZCA 1NK9A 1P27B 2DEJA 2YX7A 2JC1A 3G6VA 2W7OA 2AJ0A 5FIIA 1AYEA 3R5DA 2IM0A 3DRSB 4KGXB 2W9BA 2KTQA 3HPOA 3FRZA 3OXLA 2COLA 2DYAA 1S72S 1HWUA 3RUBL 4OHVA 2ZVIA 3I4PA 3CJRA 2UVUA 1RKIA 1H6KX 3SV3A 2KN4A 2MLYA 3MUTP 3CCQS 2D1CA 4NMLA 3M2VB 4QWBA 3JQKA 4WP3A 4DV5J 2CRLA 2RH3A 2VFVA 4ANCA 1S48A 2WAQD 2CWXA 2AZ1A 1BQMB 3CD5A 4LR9A 4P2MA 2ZUAA 2RF2A 5I3UB 3TX0A 2IMOA 3GIJA 1F5BA 4WE1A 4OFZA 2A0FB 3S7RA 3A8EA 2R2TA 4C0OC 3BR8A 3SDEB 3D6FB 2AJ4A 5DGBA 3CJ5A 3MURP 2IVMA 4DLEA 4LFCJ 2YKPA 2NPFA 5ETMA 3L7PA 4X4TA 3SQOP 3GG1A 3EDRB 4Q8FA 4NRUA 1ZPWX 2FHOB 2FHKA 3R7NB 4FYVB 5DDPC 3C16B 2HBQB 3TA2A 1U4BA 1D1UA 3M1VA 2D69A 1VBXA 4HH1A 3KTQA 1TU0B 2IAJA 3W8PA 2LQ8A 2BACA 2IMWP 3SSSA 1SIWB 4G65A 2KDOA 4NLVA 3MM9B 2QLBB 2HHPA 1CVJA 3F41A 3GJRB 4J9RA 2ZDOA 3PEHA 2XO7A 4PPZA 2DNNA 3D0GE 1MNEA 3D28A 4QYZK 1TL5A 3Q8YA 1FNXH 1HNWJ 3HM9A 5J2QA 2KO1A 4PKDB 5H9EJ 4LF2A 1KWMA 5GAGU 4WWSA 2EKNA 3P5BP 3W9IA 1H2VZ 2GIFA 4CTAA 4RW7A 4J9KA 5KAKA 4HT7A 3ZFVA 1FHTA 4OLOA 3U1LA 4LUBA 1GAOA 2XNQA 1C0UA 1S1XA 1SKRA 1F2GA 2MKJA 4KYZA 4EBCA 2X1BA 2P5VA 1UW9A 1LW2B 5DDOC 2RUGA 1UVKA 5J1EB 4J90A 1T9WA 1GX6A 1RAEB 5FJ4A 2EVZA 1VQNS 3HZEA 5KG2A 2IM1A 1SI9A 4ZCIA 1NK4A 4UZCA 2YWGA 1WEZA 3BN4A 4IO1A 4ZJQA 3ENVA 2DGWA 3SQGA 1FWLA 1RAAB 2POKA 4BBYA 5A8RA 3LTOA 3FZ2A 2NXEA 4O3PA 2ZHAA 1KLMA 3GONA 5FDLA 3G8QA 3CMQA 4NZ7A 2R7SA 4ZMMA 2DNZA 1S99A 5D4OA 3HZGA 3EXCX 3GYXB 4ECXA 3R5GA 3QO9B 3GPAA 4WJBA 4RWWA 4A8QA 3V6DA 2CQGA 2V8VA 3I9V9 3UNGC 1R27B 5KT5A 2LECA 4FNHA 4Q2MA 1CULB 3F73A 3EDQB 3K8WA 3FSXA 1GTEA 1D0EA 4UOGA 2GC8A 4IG3B 1YJ9S 1B70B 4DR5F 4DSKA 2D3UA 2BA9A 2RDJA 3AB2B 1VMBA 3VVTA 1X4DA 2OEMA 3D1HA 4F36A 4QYRA 1OPZA 2KYZA 3H8YA 4OI1A 1R6YA 3MM5A 1YVFA 5HLFA 1Q53A 2MQ8A 1HBUB 4K2XA 2H9ZA 2LKZA 4EO6A 3VAKA 1WI8A 2H5EA 2X3DA 3OR1B 2W24A 1RK8A 3BM7A 4Q2LA 1FDAA 4IQMA 2CQ1A 4PG8A 1N5SA 2X1GA 1X5PA 1X4FA 2O3DA 1VDHA 1BLUA 2BE2A 3T1HF 3NG8A 4DR4F 1RCOB 1M5HA 1P8GA 4C8YA 2CNKB 2R8JA 3RR7A 2XLIA 4CLTA 4TQRA 1TK0A 4Y0FA 1B3TA 1WKJA 5DG7A 1FI4A 4KO0A 2KHDA 1CJUB 3KJVA 4JBCA 3AD9C 4ZJLA 4OHZA 1VHFA 3FMWA 3EE3A 4HDGA 3N6NA 4ED0A 3WX8A 1VRTB 4BDPA 3Q89A 3OJUA 3PYDA 4CYUA 5KFTA 5H1SV 4DHVA 2XSFA 1RT3B 3VALA 3POTA 1KOOA 2CPJA 1RCXB 4M94A 9ATCB 4QWDA 5HMWA 4FPIA 3ZTSA 3A1YG 1RT5A 1CBKA 3SSQA 3W9HA 2EPIA 1HYSB 3TVKA 4UQGA 2YY3A 1FKAF 3CDWA 4KV8B 3ISNC 1DTTB 2CQPA 3DDKA 2ZH9A 4ECVA 4DSFA 2P9EA 2IA6A 5KT4A 1O8BA 4QWCA 5H9FK 2JRSA 3W8GA 4IRKA 3JTOA 2UXCF 4PQUB 2IIHA 2GHPA 2IDEA 3AOAA 4Q0BB 4BWJA 1VS3A 1YI2S 3BKFA 5D15A 4K4UA 4O23A 3M6XA 3PHTA 4JV1A 1KQKA 2HW3A 2UV8G 2VBZA 2YKMB 2ZOGA 3FJ2A 1SUQB 2XMUA 2JHEA 3DGPB 4C3LA 4FZVA 2R8IA 3DLGA 3OSPA 4RW9A 2FDNA 2DGOA 1N5TA 3PFEA 2XS2A 2E1PA 4LQ9A 1HL6A 2XSJB 2AX1A 2QSFA 2YNFB 3ZC4A 4A8MP 1RBLA 2CZ9A 4NMXA 4DR4J 2MQMA 2XMKA 1WELA 4WFAQ 4UY8T 1SJ1A 2VA3A 4IDKA 2YWHA 1KVJA 1TR0A 2V4JA 1S1WB 2YNIA 2HGNA 2V8DA 1KEKA 3MUVP 3VAGA 1JQGA 4NLUA 4ZVUB 3GV8B 1P1LA 1HW9A 3AJ2A 2LEBA 2VB6A 4DG1A 1ZPVA 1IQTA 4OYMA 5ITHA 2XMMA 4DDFA 1NK7A 1EETB 2KM8C 2X1AA 3T5JA 3PJWA 5EN1A 1S9FA 1C0TB 3TVZA 2YNHA 4RKUC 4DX6A 4ZHRA 1TELA 3W5ZA 2BW7A 3H98A 1ULRA 1HQEA 2BZ2A 2IJFA 2AYBA 3PXGa 5D6GA 4IH7A 1HARA 5ETRA 1VBKA 3CULA 1NM2A 1FTCA 3KLGB 3WC0A 3GB0A 1RAFB 5IOLA 3I5AA 4IRCA 4DPXA 3JQJA 4CO2A 4DQIA 1FRLA 3HKWA 3E8OA 6FDRA 1LWCA 2GCFA 4H4MA 1UFKA 1VQ5S 3K7RA 2UXCJ 2CKWA 4NLRA 4CO3A 1BQNB 4EGLA 2NSBA 3HHEA 3JQMA 3PRBA 4KH1B 3CVKA 3B54A 3TQEA 2HK2A 3LWMA 5HMYA 3MEGB 3RRHA 4MIWA 5CAAA 2HNZA 3FCHA 3FVYA 3VF0B 3GFXA 4DL2A 4UQTA 2E66A 3WIVA 1UJ6A 3EYZA 1FK9B 2DPIA 2KKHA 2QTWA 2Q79A 4QW9A 2B6AB 4JI2J 4YR2A 4C7QA 3UW1A 3MMAA 1X9WA 2KXNB 2I1RA 3B78A 1TL4A 2KT2A 2XZTB 3UNYA 4Q43A 1HQUB 1G7CB 3KJNB 3CD6S 2XTJP 5L1IA 1I1GA 1X7VA 1SJ4P 3QRPA 2BE7D 3FEZA 2ZKUA 4OMFG 4RBTA 2BYCA 3WZ0A 4H4KA 2PIIA 1YG0A 3MMBB 3W9JA 3QRQA 2IC3B 2J5AA 4KHRA 4U7UD 3KHRA 4DL3A 4NZ0A 3KK1B 2G4BA 2OAUA 3H7HB 2HVDA 2B3TB 3CMES 2CJQA 1Y3JA 1Y10A 5F8NA 4C97A 3DMJB 2CDRB 4KSEB 1YDLA 3KJFB 2Z2ZA 3UDEA 2N3LA 2HLTA 1MWQA 4LF7F 1KQFB 2R7UA 4DQPA 2NXUA 2HQDA 4WF9Q 1WF0A 2I8EA 2HPUA 3CE8A 1KVKA 5FLXU 4DFMA 3BBFA 2XY5A 3VAFA 4F2RA 2OEKA 3O6QA 2C3OA 2ZITA 4IG0B 2QA1A 1W7WA 1VC5A 1N36F 1S9EB 4L73A 2R8KA 1VIOA 2CPEA 3WDOA 2ZBIA 1N32F 1MU2B 3KJQB 2Z56B 1Q86T 1N56A 2DK2A 4HACA 3HLUA 5IXUA 5C2CA 1V5VA 3AAWB 1YBTA 3CNQP 4TU7A 5HP1B 4HH0A 1T9UA 2XGQA 3FFIB 1HFEL 1OSDA 4ZCMA 3FNNA 3Q23A 1M5OC 3IS9B 3G86A 2NYHA 3W2VA 2XBPA 1NZAA 2LU1A 4WXWA 1JJHA 1RAJA 2DHGA 3OL6A 2B56A 1IKYA 3S8SA 3HD2A 3FC9A 1PJ7A 3EUNA 2ZBCA 3O5TB 3CJ8A 4OI0A 3C15A 4ZVPB 3UFCX 3NKYA 1UMJA 5J2NA 5DM7Q 1GXTA 1NRKA 5GAEU 3AY0A 5LMNF 2VJVA 1Q16B 5KFMA 2NS1B 2KT5A 2K2PA 3I0RA 1XC9A 2YTCA 4ECRA 3QATA 4B3OA 1WOSA 2DEIA 2MKKA 5KFPA 1VLYA 4HKQA 4P52A 3UD4P 5D0EA 1XWLA 1IKWA 1WD6A 3RW7A 2C3MA 3OHBA 3JXOA 3KLEA 1VQLS 3HX9A 3LA0A 3BJYA 1RYSA 5KFSA 2VQEJ 3CC2S 4C2MA 4PABA 4FKYA 1NH8A 1Y3KA 3QBCA 5HMZA 1FFSB 1RISA 2F9DA 3G96A 4YB5A 3KLFA 4F4YA 3VGVA 3JSMA 4HI1A 2XMTA 4G1IA 3D4JA 2ZH3A 1D9DA 4YMEA 5T14A 1WSVA 2B4PA 3GFYA 2RILA 4Y2MA 4LF7J 3LAKA 1MWYA 4USUA 5SUHA 2LEPA 1E6YB 4F4XA 4Q45A 5RUBA 1ZS6A 3Q8QB 4AL7A 1UA0A 2CQBA 3QSIA 3LALA 1HA1A 4HTIA 4FBTA 2V2QA 1IKXA 1N32J 2QL9B 1JJCB 2I2YA 3B4MA 2PFFB 3C14A 3GIMA 1HD0A 2HG4A 3FBFA 2JVOA 3FRYA 3MCNA 1LEOA 4MYTA 1XMOF 3Q8RB 4O3RA 5HATA 4KFBA 2N7YA 4ITSA 5CYMA 1NB7A 1JXLA 4LSLA 2CQCA 1CC7A 1N8RT 3UO0A 3ZTPA 4NXNF 3IA0A 4U7CA 1FKOA 2FY8A 4UOHA 1JJ2R 3D6MB 4TY8A 3JTPA 3RRGA 2CQIA 3W5XA 3BPDA 4K7QA 4XPEA 2W9BB 5LMNJ 2FVQA 1SC4B 1T9XA 3V4IA 2C2NA 1WUUA 2ZKTA 4F26A 2GNKA 1T05B 1ZM4A 3L9ZA 1IJFB 4I2PA 2BEFA 3QT5A 3CO9A 1OY9A 3RAMA 1T95A 4M5HA 1UJ4A 3IRXA 5LOQA 2XZWA 4K4ZA 2EFNA 1LXNA 1RBAA 4EK2A 4B9TA 1U1OA 2Y0BB 4OQJA 2N3OA 2RF2B 4DU8A 4WE1B 1B64A 1I3OB 4RU2A 2NPIA 3J7AN 2C2OB 2JSXA 4ZVHA 2IJRA 2VH7A 1D8ZA 2MYFA 4RNHA 2HSEB 2B9EA 5HVFA 2WW8A 3KK3B 2J6SA 4P2FA 4BWMA 1KFDA 5GMKa 1S1UB 2F7VA 3DRYA 3M1VB 2YPYA 2GAHC 2IAJB 3I55S 5THWA 1WACA 3OFGA 3EX7B 2JWNA 1FERA 1X0PA 3I5BA 1A7GE 4B17A 4RBUA 2VC0A 2VA2A 2Y8WA 1KONA 2YKQA 1VQ4S 3IR6B 3PW7A 1GNKA 1VRQC 1XMOJ 2KT3A 4TU9A 2VPWB 4FP9A 4J37A 5LXYA 3N5FA 1FD2A 1RAIB 4NXNJ 2OO4A 1H7WA 4NLGA 4URSA 2B4VA 4RW4A 3DLJA 2V2KA 4M5GA 3MAAA 1SL1A 4A8WA 1SJFA 5KFHA 2ABYA 4I56A 3TAMB 3DKDA 2UVWA 3OTOF 3RYLA 4MYUA 3CDBA 1G6BA 4ECQA 2O66A 4CO5A 4PXBA 3PHEA 1C0UB 2AV5A 2NXJA 1S1XB 3V4MA 1KQSR 2DITA 2KG0A 4IR1A 1RHRB 5CD4A 3AB4B 2CA9A 4C8ZA 4J7CA 4XO0A 4QIGA 4HI2A 1RTIB 2E5IA 3EVOA 2DRBA 2E9RX 3GWCA 1X9MA 3LOUA 5J1NA 5B0BA 4DZDA 1S6OA 2HAFA 2PN6A 2Q1LA 3TYTA 3D3CJ 4MK8A 2MQPA 1UKUA 2NZCA 2OLWA 5FDLB 1TL1A 3SI8A 2QC3A 2Z2LA 4CRJA 2ZFHA 1S0MA 1IWAA 1S6PA 3UVJB 4EEYA 2J0WA 4ID5B 2XNRA 2NZ4A 1S7IA 2HS0A 3RBEA 2EXUA 3V6DB 3VZIA 3KG4A 4A48A 4FYYB 2JNJA 2MPUA 3FCVA 2N4DA 5K8OA 3OVAA 4HTJA 4DF8A 2FUG9 4YEAA 2NUUG 3KK2B 1YGYA 3B6BA 2Q6CA 3R6GB 4F7VA 3K89A 2XO6A 4EYHB 5L1LA 3BREA 2DCUB 1IWGA 3ZTRA 3F0NA 4PRFA 2IJNA 4J9VA 4D3GA 1WDDA 1OYDA 1KTQA 4R5PB 3J7YU 2D74B 1KOHA 5HLFB 2L9DA 2XCPA 5GAHI 5DO2A 4G1QA 3DRXA 3W2WA 5F41A 5EX3A 3PR5B 3I5CA 1B0TA 1IUJA 1UVNA 4DPOA 4W4MA 3BS9A 1ZAVA 4KH0B 3TA0A 1JNRB 4FXWA 4X64F 2BE2B 1NSQA 3BQ2A 2B9YA 2AGPA 1RT7A 5HJYA 3MEEA 4DFKA 3NGDA 4NA1A 3EZUA 3OTOJ 4JV5F 2MXYA 4EZ9A 1TQLA 2HWIA 3MR2A 4J9OA 3BSCA 1IVZA 4ECUA 3OQ2A 3OUYA 3HCXA 1UZDA 3KJVB 4ED7A 3PYGA 3N6MA 4P73A 2MKHA 1XNRF 4DMZA 4PYAA 2XS7A 1C4CA 4PWUA 1R0CB 4X4PA 4LBHA 3NOGA 2RDDA 5KFNA 2FZGB 1KKHA 3PDNA 1VC6A 5A0YA 1Y4ZB 4GVLA 5CYJA 4CYUB 5C7PA 3JAMY 1V3SA 2KL8A 3P5TL 3TZYA 2VONA 1XR7A 1X8DA 2WZ1A 5KFXA 2MZTA 2AD9A 4ELVA 2ASJA 2PEHA 5JJBA 4MK9A 5F8LA 1RT5B 3NCRA 2WOMB 1NLKL 2RQ4A 1VOMA 4JUZA 4IUFA 1X5OA 5K14A 3U02A 1IKVB 3NMAA 2E1RA 4PG5A 1VQ8S 5A8KA 4JP8A 4QYZJ 1SPBP 3GTYX 2LLZA 3R5BA 8ATCB 5CZVA 1LFWA 1BWVA 3DRSA 1U24A 4B02A 2RIJA 3OVSA 3GQCA 3NAIA 5F3ZA 1UETA 2W8KA 3G82B 1OPIA 1ACMB 1SKUB 4RNOA 1JNZB 2E44A 2FJXA 1P9YA 2G1HA 3BZQA 3CPWR 3TNVA 2RQCA 4PWDB 4F3QA 2RS8A 1R0BG 3DYAB 3I96A 2UUAJ 1YJUA 4JI1F 2RNEA 3OD2A 3NY0A 2IHR1 4FPRA 3DLGB 2UXDF 4MKBA 4DCPB 1S6UA 1BQXA 4RUCA 3OT9A 4K2JA 3MTKA 4X64J 1RADB 4L72B 4LRFA 3P6YC 4EO8A 1RHMB 4JV5J 4MKVA 3SDEA 2V67A 1SVDA 3NWGA 4J9LA 1B0VA 5HVGA 1HHSA 5GADU 3M8SA 4ED2A 1XERA 4XIUA 4MIBA 3TARA 3BO2A 1XNRJ 3CO0P 1IQZA 1LQ9A 2AZ3A 1Z2LA 3IXQA 5ETTA 2XI2A 2M52A 2FVRA 1U2CA 4RUBA 1BXNA 4DV1F 4L74A 1LV5A 2F40A 4ELTA 2MLXA 4DPYA 4O3NA 4C8KA 2M9KA 3MM9A 2V94A 4RLEA 2PD1A 3K8VA 1HQEB 2WVEA 1SJ3P 2JEGA 2B51A 2IVYA 1KHVA 3IRWP 1WHYA 1WKLA 3QGHA 3BV8A 2NLWA 4B3SF 3ZZZA 1J27A 3OBIA 2J9DA 2BABA 1JLQB 2VODA 4KTQA 5KOXA 3OPKA 4QIWD 4O0NA 5F8MA 2OTLS 5E3QA 1Q5YA 1TKTB 3RR8A 1LWCB 3J81Y 2Y8YA 2FHMA 4A8OA 2OMLA 2VG6B 3BGOP 1SCJB 2AEFA 2YWEA 2G2ZA 5LT5A 2RRNA 3H2UB 1YHQS 5GMEA 3TX8A 2JL9A 4ELUA 3DXSX 1KRPA 1ZM9A 2DH7A 3I82A 4BLGA 3CJKB 1LW2A 5J1EA 1BWEA 1TKZB 4JI1J 2W25A 3OL9A 2EW9A 4IFYB 1VQKS 3IP0A 1HBMA 4PR6A 2E9ZA 1UVMA 4FYDA 3DXBA 5L1JA 4PWWA 2EK1A 1ZOTA 1XR5A 4NEZA 3EVWA 1HNIB 3NBPA 3IWNC 4M5DB 4UZBA 2E7WA 2FJWA 3MM6A 5K20B 3K57A 4Y28C 1QM9A 1WC6A 4ICLA 2JX2A 5M2PA 2NXCA 3UDVA 2ZH4A 2LXIA 1JXEA 4U96A 2WONA 5I3PA 4OJHA 4ZS6A 3NXZA 1R7IA 3G6YA 4DV1J 4HDHA 2LXUA 3PO5A 1N5VA 3GJQB 3J81j 1NUEA 5JVGQ 2R8GA 3PW2A 5G4DA 4CNYA 3QJJA 4B3TF 2HNDB 1O51A 3QIPA 2JLGA 1U6FA 3PFOA 2W2PP 4F2SA 1S9GB 5D4PA 1AXQA 3NNCA 3C19A 3HHLD 5H9FJ 4B3SJ 4FF2A 2WB4A 5A76A 1HBUA 2ALYB 3DCAA 2XZDB 4M5KA 1SQGA 3OR1A 5AT1B 4CP5A 2LQ5A 3CJ3A 3E01B 3HHLB 1Z1ZA 4MJKA 5HI7A 4O0IA 3ZO7A 2MKCA 3UQSA 4BC7A 1PBAA 2EFPA 1ZM2A 2QFIA 1F0XA 4WFNQ 1UFLA 1DJ0A 4PUOA 1U6ZA 4AT1B 1FTRA 4HACB 4CLPA 4PEOA 5CZXA 3DHWC 3MR6A 7FDRA 3DOMA 2M4MA 3K5OA 3H20A 1U45A 3HO1A 4ES3A 1NK0A 3V6JA 4N7TA 2WHOA 1DLOB 4LR7A 2W1BA 2WBRA 1X5SA 4PAAA 4OZNA 3V5RA 3B82A 4CLZA 1X4AA 4YOEA 3QJLA 3P8BB 4AYBD 4TNOA 1T94A 1EKRA 2A1BA 4ED6A 3CMAS 3MPWA 5J2NB 1VRTA 2XEXA 2VQFF 4DQRA 2XGPA 4FN5A 1K73T 1FXRA 3I0RB 4BS2A 2J76E 4WPAA 1RT3A 1OWXA 4B3OB 2CG8A 1X4CA 2JLEA 2RVJA 3GE9A 2FY1A 2XWXA 4TU8A 1EKSA 1L3KA 4CLUA 1IKWB 2PMWA 5EUHA 2BKPA 1RACB 5A2QU 2WVDA 4DR6J 3P49B 4P74A 1DTTA 5BXIA 4P75A 2DXFA 4PZVA 3GSDA 1T9TA 3QRRA 3SZ2A 3THPA 2HGMA 3LAMA 1XQIA 2CVIA 2HQ3A 4PQUA 3JSRA 3KOAA 1WHXA 1U1KA 2IRXA 3JSMB 4EBDA 4B3TJ 2ASDA 3R9LA 5A6WA 2W2NP 5AE2A 3KHLA 4Q0BA 1ZAWA 5KG5A 2DKOB 3HFKA 2UUBF 3VGSA 1R6VA 4QR0A 3N9UC 2C28A 1SUQA 4CDIA 4KBIA 2ZH6A 3RAQA 2XMVA 2FLNA 5KFEA 3RGIA 4AXJA 5C25A 2D7SA 2EG1A 3MM8A 1CJTB 2D41A 1F9FA 2XSJA 2J6UA 1IKXB 3JB9k 1S59A 1NSAA 3EPIA 2OPRA 2DNMA 3C14B 5K5MA 4JI8F 2HQCA 3AT1B 2EG2A 2EC0A 4E2FB 2EI5A 1TL3B 1FDDA 1H7XA 3MDFA 3W66A 1D9FA 1S1WA 2VICA 5ETLA 1CQMA 1OIAA 5KFFA 1NKCA 3NNAA 3Q86A 5CYMB 2C3YA 4YFUA 1JK9B 3VAJA 5IT9Y 2AF6A 3ILJA 2DNYA 3PYFA 2IYGA 4KRWA 2JJ4D 1FKOB 1CS4A 2HGLA 4ZIWA 4N56A 3CJ2A 5JXSA 1U1LA 2VQFJ 4GKJF 4A47A 5F0WA 1VLOA 5DZ6A 1E6VA 2DNKA 5BJRA 1DHMA 1REVB 3EGVA 4CQ1A 4RBVA 3AODA 5CYQB 2CFXA 4ZP9A 4K4YA 2O1PA 2B5JA 3ENAA 1NK8A 2WVCA 1U49A 1RDRA 1IBLF 2ZM6F 3PW4A 4LMZA 1S12A 4F3MA 4TY9A 3GIKA 2DNRA 4DR7F 1P1TA 3KDNA 4LF4F 1T9YA 1FE0A 3OXFA 3ADAC 5EWEA 1F6TA 1T0TV 4ZPTR 2E5LJ 5DLGA 2CJAA 3T6BA 3AQPA 4TYBA 3OLAA 3UDLA 5KFDA 2DTJA 2FVSA 1BGXT 3MTJA 4G3IA 4BHQA 2VG7A 2P2CB 1VQOS 1WI6A 3E3XA 1Q81T 3D3BJ 1RI7A 2Z4PA 2EKYA 1GXUA 2Y1RI 2UUBJ 2YVSA 2VPZB 2RSQA 3GJSB 3D0HE 3FMBA 1KBRA 3QAEA 1H0HB 1VBYA 1NDKA 1VIXA 1FK9A 3NP5A 3PTWA 1TTHB 1RXOB 2CJKA 1FNMA 3ENWA 1PC5A 2OFHX 3KNGA 1AUDA 1HBNB 4LFBF 1LNQA 2Y3YA 4OZ3A 4OYWA 4JI0J 3CIMA 4DL4A 2WSFC 2ZVSA 4KAIA 1IR0A 4JI8J 2DGTA 2V9WA 1KQGB 2APOA 3ZZ0A 4EBEA 4V19J 3H40A 1H2TZ 3D9BA 4B9UA 3D66A 3C46A 2KG1A 4J9SA 5KTQA 2PDAA 2R7VA 4HYKA 2H65B 3MPUB 2IC3A 5E7OB 3MCMA 2PFDA 2E1AA 4CZCA 1ZH5A 1BUXA 2K7KA 3FSYA 1ZZNA 1HWLA 3LGNA 3GCWP 4YY3F 3R6LB 3OTCA 2AX0A 5CCMA 4NPOA 1NJYA 3MOZA 4ZIVA 2KB2A 1WOOA 2PE8A 2EEYA 2R2SA 3FEXB 1IBLJ 4N76A 3K5LA 4ETZA 1JJ4A 3LGHA 2ZM6J 2DNGA 1YX2A 5DETA 1I51B 2RHSB 4DR7J 3C8YA 1R8PA 3O1LA 1RUSA 4LF4J 5G0RB 3SCLE 2DNPA 1N0UA 2F4VF 1J2VA 1F2HA 5ETVA 3TZZA 1Q8LA 4IG0A 4KHPF 3RZAA 1VFJA 3NGTA 1M1GA 2HHQA 1N4LA 1MU2A 4WIQA 2B43A 2MKIA 2GJIA 3IGVA 1I94F 1TL1B 2Q43A 2HHVA 1BHNA 4O44B 2GQ2A 3SCJE 3FFIA 4LVNP 3KUEA 3U1NA 2NCKL 3IS9A 3HJFA 1DURA 3NGSA 2DRDA 1VQYA 4Y6IA 2AWZA 5F8HA 1Q8IA 3CCUS 2CPHA 4M1KA 2NXNA 3VAMA 3H59A 1PCAA 3FSIA 2ZJRQ 2ERRA 3QFHA 4LFBJ 1GH8A 9RUBA 4TQSA 3U1MA 4DWIA 3HSJA 3QAUA 1CG2A 4R0JA 2OPQB 4RO0A 2X7IA 1OY8A 2C1EB 4N8OA 1NJIT 2ZBRA 2GV1A 4IOBA 4MKAA 1B0PA 4OYPA 4RUAA 3BPSP 1OO0B 5ETSA 3W2WB 3UN5A 1I5OB 2L9NA 4MAKA 2LA6A 2ZWPA 1G4CA 1SIZA 1F9HA 4U7UK 3DM2B 4RJVA 2RKIA 2B9XA 1LFPA 4TLQA 1S57A 1SH0A 3BN7A 3MMJA 2BR0A 2Z8QA 1IBMF 1U09A 3K5PA 3MEEB 4YP3A 2RT3A 3FKBA 4I69A 4YY3J 4NCAA 4DPUA 4C3KA 3J7ZT 3RJMB 1N5YB 2MHNA 5IV4A 3CWJA 4X66J 1IR1A 2L41A 1QAYA 4NYPA 3OUYB 2UUCF 3KHGA 3ET6B 3ELHA 3S1TA 1E6YA 5K8MA 5IT0A 2C2MB 2VBXA 3BQ0A 2GIRA 2W8LA 4X2BA 2F4VJ 3A12A 2J0SD 1NKEA 1WORA 1UAWA 3NS6A 4DN9A 4WZMA 2LMIA 4KHPJ 2OD4A 2J8AA 3DOKB 2Y9HA 2AKWB 2GVZA 4AD6A 1I94J 4OZ2A 1JWWA 1W2BR 3NLCA 2HS3A 1VGYA 2EBEA 4ZITA 1RKJA 2SXLA 1UVJA 1RHUB 3QPIA 2VKRA 4WFYA 4X4SA 2RRAA 2CIMA 1HNXF 3S6EA 2B8QA 4Q44A 2LQJA 1FE4A 2E1CA 2KYXA 4MKYA 2VC1A 1V5IB 3A4TA 4ZPDA 3Q8UA 4QOTA 4Y34A 5F9NA 3MF5A 5C5JA 3O2IA 2BDPA 4O4RA 3OFEA 1RP5A 2EFVA 2MGZB 2HYIB 1X60A 2A18A 1SJQA 1ROFA 4DV0F 2KFNA 2HURA 1T05A 4F4AA 1HR0J 1FESA 1NAQA 2ZE2B 3RBDA 1FRKA 2QT7A 3EWGA 3SMZA 1IR2A 1TVRA 1P9QC 4DUYF 1GMWD 2QLFB 4OZLA 2F1FA 3QSYB 4IFVB 2FLLA 3MPDA 4MH8A 2BRLA 3QZ8A 2BJ9A 3CCTA 4R8UA 5KFBA 3QQCD 4F4WA 1XTZA 3Q0AA 4KGZB 3R1LA 2ZH7A 4C11A 1SKWA 4JI5F 2DBBA 2YKNB 3FK4A 3BB5A 3UR0A 2RS2A 3R1HA 2UUCJ 2A6OA 4PXEA 3NGUA 1UVLA 4YN3B 1L3UA 3IBFB 3H5XA 5CXTA 2BQUA 3KK3A 3VHQA 2XY6A 2M8DB 3GYNA 3GR0A 1FWPA 1S76D 1JXVA 1S1UA 3VWSA 3MECA 4H4OB 3WIUA 3GYGA 4DR3F 2FB0A 4FS1A 3SFUA 4JOUA 4NI2A 4JI7F 4ECTA 3BO4A 4KKOB 3T6JA 3KXDA 1C1CB 2R8HA 2QRRA 4LF8F 2QIFA 2W9CA 1U02A 2M8HA 4HHJA 1TZ0A 4DV4F 1M90T 3AOCA 3TUJC 3GR1A 4IYQA 2CPXA 2Q3PA 1HNXJ 5KT7A 5DS7A 4MTPA 4ED4A 2B4OA 2OKQA 2AEMA 3MM7B 2J7WA 1F5AA 1RTHA 2HBYB 3AA8A 2HQGA 1C4AA 2DY1A 4JI3F 2DR7A 4K8RA 1C1BB 4WFBQ 3DI6A 2C3UA 3CW2C 1WF2A 1TK8A 1HD1A 2ACMA 1MMLA 3OFHA 3TAMA 4FF3A 4N5SA 2XS5A 5E41A 2V6AA 4AQYF 2R7XA 1T03B 1N6QA 4DV0J 1UA1A 4MT1A 2LDYA 2XB2D 2IFXA 3TANA 1QVGR 3D0IE 3JSBA 1WHWA 1RHQB 1A9NB 5J2PA 1RTIA 3UN3A 1Q5VA 4J9PA 8RUCA 2RAQA 2A2CA 3GFZA 2QLJB 1U1MA 2VF3A 1K0TA 4DUYJ 1FXDA 3UD5A 2D3OR 4NL5A 5BYQA 1HBMB 2WB1D 1VISA 1FJEB 1TAQA 2MTLA 1XMBA 3US5A 2RHQB 4K4VA 3NRBA 4BC9A 4JI5J 2DR5A 1RB0A 1WNEA 5IV3A 1RA7A 3NBPB 3MM6B 2D9OA 3GCXP 3UVJA 4ID5A 4ETXA 1UZHA 2VL1A 2ZH2A 4ICLB 4HL9A 3QZ7A 4B9VA 2B0GA 4F67A 2V4RA 3M9OB 2WONB 3H90A 2R42A 2WVFA 3J80U 4ZVOB 2E5GA 4DR3J 4OJGA 1LWFB 4JI7J 2M2BA 1BE4A 2F5GA 4V19X 3KK2A 3ETOA 1JIHA 3EMTA 2VJUA 1OY6A 2ZEJA 4ZLLA 3QIPB 2J9CA 1TKXA 1ELOA 2DNLA 4DV4J 3Q22A 4R5PA 4OI4A 1Q95G 3LUYA 3PY8A 4RWXA 4EFAC 5HK4A 3QT6A 5J2MB 4GVBA 3PKYA 2HMIB 5GAGI 2G2OA 2G0IA 1EP4A 2MZ1A 3BEGB 2DHXA 1S10A 2UVVA 4WFXA 4OYXA 2ZZMA 1RA6A 1S0NA 4JI3J 3G8SA 4WCEQ 2HIQA 1MW7A 2AHOB 4K4SA 1EQ0A 2CQ4A 3CDAA 2AGOA 3P3DA 2HZVA 4NCBA 3HULA 4PUOB 4KJIA 5DQGA 2YQ1A 1O0PA 3CCES 4AQYJ 1FJGF 1AUSL 3OTDA 3DOMB 2K8GA 1HWIA 4DFJA 3LGMA 2AEJA 4CLLA 1H2UX 2C22A 4OLPA 4X4UA 4L6V3 4NOHA 3UCGA 4F3OA 1N88A 4OI6A 2HHHF 4DR1F 5CA5A 1D9AA 1LW0B 5EWGA 2XM3A 2MSSA 2BOPA 4OHXA 4M5NA 3I6PA 2HFZA 1NXIA 3VR1A 1N0VC 1RWMB 1AB8A 5KFCA 3CTRA 3L4BC 1TKDA 5CHCB 3CD7A 3OR2B 4K0KF 3ETMA 1QE1B 2WOMA 2ACYA 3A13A 3BQ1A 4DQQA 2IBOA 5M2RA 3AA9A 2V34A 1IKVA 2KH9A 2VASA 2VBWA 5LSOA 4O4GA 4ATNA 4PCQA 4DR5J 5E3AA 3TAPA 4XK8C 3BGRB 1DQ8A 2CPIA 3G82A 4W90B 4KIAA 1FF2A 3GLJA 2KJWA 2R7RA 1HW8A 5KT2A 4PWDA 4RUHA 2OMOA 4Y2CA 2BJDA 3M6WA 3LW5C 4OIXA 2A3JA 4PG6A 4A46A 1PGZA 1HBOB 1GMUA 3DYAA 3R7BB 3H2LA 1H38A 3V6KA 2VBYA 1UVIA 1RWVB 2AT1B 2M70A 2ZH5A 3AXMA 3WX4A 1W2IA 1VQ9S 1NJZA 2CVEA 3LP0A 5C25B 2H5IB 3J7A1 3MM8B 2V8PA 1X4GA 3CC7S 3MMCB 1HHTP 3T1HJ 2OPRB 2NQPA 2ZZTA 4P2SA 3ZZPA 1CPZA 1JB0C 1FJGJ 3OVBA 4ILMA 4RW6B 5ETPA 4WK1A 4X84A 2X51A 3D7SB 3NCPA 2CPYA 1X4HA 2HNYB 2QGFB 4M63A 2ZNZA 3VCDA 2XMAA 4LQ3A 4USVA 1WC4A 5IC6B 1DZ5A 2LP4A 2N7CA 4UTGA 3DN9A 1T3OA 2L3MA 2HBZB 3AQOA 3N79A 2HFOA 4X4OA 3V6HA 4DV3F 3CJ0A 3ISZA 2HHHJ 1CS4B 1YJVA 2ROGA 4DR1J 4C9DA 3D1QA 3SBMA 3HKZD 3MCSA 2IM3A 1YJTA 1E6VB 3ZNJ1 1FDNA 1Y11A 4IRDA 5DJBA 4L75A 2ADCA 1R8AA 3I87A 1KD1T 4B3RF 2B5JB 2IA0A 4K0KJ 3E2EA 2GQQA 3MGJA 5K8NA 5AE1A 4B3MF 1K1QA 1JLQA 2H3EB 1RZMA 2AYMA 1J5EF 2UVRA 1TKTA 3BR9A 2Y1LB 4M5LA 4XDCA 2V2ZA 3DLKB 5E3RA 4DL5A 1U8WA 3GV7B 1PILA 3T1YF 2VG6A 3CEDA 1Q82T 3V81B 3D6HB 1YZ6A 2VG7B 3O44A 1GQEA 1VK8A 4NLTA 1G1XA 4WTYA 2R4FA 4FVMA 3PJ9A 1F3VA 3AHPA 2DPJA 4OHWA 1NSKL 4F04B 3CJKA 1VRUA 2C2ZB 1HHQA 1A0OB 2R2UA 1TKZA 1WDTA 4DR2F 4P9SA 3DDIA 4CLYA 4HHHA 4IFYA 1KNZA 1N48A 2BJ1A 1Q7YT 4ZLJA 2GMHA 3T5KA 4PXCA 1KP6A 1V3ZA 1QTNB 1U47A 4CO4A 2W2MP 4RW8A 1S49A 1ZA2B 3DU6A 4YR0A 1TUGB 2D3ZA 4UF4A 3I56S 3NMRA 1N33F 4B9LA 1HNIA 4NA3A 4M5DA 2CNLB 2FC8A 3ILLA 2HK3A 4ZVGA 1LWEA 4DZ6A 1N5QA 1NJWA 1DFDA 1CQNA 2KRBA 4RNMA 3ISND 4OZ1A 4DQSA 5HANA 1R8HA 5M2UA 4DV3J 3CC4S 5DQIA 2YH1A 1Z4UA 4NLOA 3K59A 4CWBA 2LYVA 2Z57B 4YHHF 4DF4A 1B4SA 3BH6B 2DD8S 2HNDA 1FJ7A 3DRRB 1S9GA 4DS5A 2RD5C 1FRXA 4B3RJ 1ZM3A 3BSOA 4U9RA 5B08A 2C2KB 3KMSA 4B3MJ 4E0DA 2QG9B 1O5JA 2PC6A 3K5NA 5KFKA 4FYWB 2GGPB 1J5EJ 3DLEA 3E01A 5KFGA 3HHLA 1RAHB 1U0HA 2PI5A 3QIDA 2LEAA 4FF1A 3M8ZA 2DT9A 3QYYA 2YX1A 4QZVB 3T1YJ 1WF1A 3VQTA 2DO0A 3CCJS 1QJHA 2OSQA 3M6VA 3DHXA 3GZ7A 3BGFA 5LM7E 1M5KC 2VUGA 3NNHA 2VD3A 3NGRA 4TN2A 2ZOMA 2ADBA 1DLOA 2MY8A 1MN7A 2E7XA 2M7SA 2QLXA 3PO4A 1X0FA 2XCAA 3M2UA 3RBXA 3PNIA 2FJDB 2LA4A 2QYCA 3CJTA 1DBDA 4C98A 1OJ4A 3BO3A 4U8YA 1DQ9A 2GO8A 4A8SA 2UUTA 2HEKA 4S0MA 2V63A 2UP1A 4OV1A 4OJ3A 1F5CA 4HLBA 3SV4A 1N33J 4TYAA 2KM8B 2IBKA 3SCKE 1DAXA 4DSJA 2Y1IA 3OL8A 2QO3A 3CB4A 1BC6A 2CJ9A 5CCLA 3KFWX 4ZKAA 3J7Z5 1TUWA 3BGUA 2DVIA 1VCTA 4C3MA 2RRBA 1Z2ZA 2GVDB 1N34F 1MROA 4B9SA 1KFSA 4ES1A 2CPDA 4ES2A 2RKIB 3KHHA 2ALZA 5K8PA 4YHHJ 1FRHA 4OX7A 5EGYA 3TUZC 3HXMA 1SV5B 2FZCB 3QMQA 4X4RA 3MR7A 2KJVA 2MQOA 4ZP7A 2OFGX 4CH7A 1YZ7A 3OHAA 1FO1A 1D3WA 1KDNA 1ITPA 3EZ5A 4GC6A 4RZRA 3RAXA 5KG3A 4WU3A 3VAIA 2J7UA 4RX6A 3AXKA 3OFFA 1RTZA 2QMXA 2I6WA 1PKUA 3T5LA 1SL2A 3DFEA 5A8WA 2RJZA 4M5JA 1HPZA 1IM6A 2CWKA 3THVA 3MUMP 1N36J 4KGMA 3G6XA 1CJTA 2GHWA 1WG1A 4I7FB 3CJQA 2A6MA 3D1OA 2RQMA 2GVZB 4QBUA 1S1VB 1RT6B 2BMBA 2ZH1A 1R31A 1EIYB 4ZDNA 4LT6A 1VQPS 1CJVB 2ZD1B 3D54A 3R2CJ 2QEXS 1L3VA 3DRPA 1ZYQA 4ECWA 3EGWB 5D3GA 1TL3A 2FLOA 2HQFA 4DPWA 4ILRA 1TV6A 3MEDB 3GFHA 1Q79A 1FX4A 1WEYA 1RT2B 1K8AT 1U6BA 5C2GA 2I5JB 3G4SS 2KFYA 2GX8A 1PSDA 1XJWB 5GAEI 4LF9F 2ROEA 4O3QA 4IOAQ 4ZP8A 1IXKA 1REVA 3ONQA 5CYQA 1FD8A 4N8NA 4C0HA 4DN0A 2RUSA 2MB0B 2ZDPA 3G6ES 5IZHA 2ROPA 2AYGA 5E33A 1N34J 1TVRB 1DTQA 3U7JA 4ZPAA 2BBEA 5F9LA 3A3NB 1TL7A 2QSWA 4ZLPA 1B99A 1JLGB 3TWZA 4F25A 5K9FA 4TLRA 2E7VA 2WW4A 2GAGC 4R8UB 5E5NA 4LF1A 4CT9A 2XHWA 5EX0A 4I64A 4C11B 4YB1P 4FF4A 2HRTA 3B4DA 3T1AA 1Y7PA 4WFZA 4OYBA 1WTBA 4UUXA 3KYLA 2BOAA 5HJXA 5DZ7A 2HRYA 2WTFA 2BANA 2NREA 4DUZF 3X1LB 2EBGA 3MHYA 4I6WA 3MECB 4LSNB 2P9GA 1EZZB 5FLXY 3VQSA 5EWFA 2HIYA 2YPZA 2QL7B 2XYPB 4ZCKA 4NI2B 4DEZA 2GMLA 3CF5Q 3KLVA 1HBNA 2BXJA 5I3QA 2W4PA 3C6TB 1AZSB 2HVHA 2WBMA 2AU0A 4K50A 5AJ3F 5E0OA 3R5AA 2W9CB 1JLCB 3RW6A 3G8TA 4LFAF 2Q66A 1JMTA 1H74A 2HFVA 3IR5B 5B7WA 3BF4A 3GILA 3JYTA 1NZ8A 3EPGA 1YTYA 2VG5A 5GVQA 2KU7A 1V9OA 1RTHB 4Z7CA 3ITHB 3IFEA 2A2DA 4MFBB 3BDPA 1HNVA 4ZJOA 2DNOA 4LF9J 2VV5A 3OTEA 3DI6B 2JDJA 1X5TA 4Y00A 5KFOA 1YJNS 5KFLA 1N6QB 3M2RA 4AFFA 4LIWA 2O5DA 4L3NA 4UUWA 2LQBA 1LOUA 3DGVA 2W4CA 5JUMA 2LQ9A 2NUHA 3NCQA 1NPPA 1NU4A 4I68A 3OJSA 5J2PB 2FJAB 1HIYA 2QV6A 5LJ5Y 2VHGA 2X1FA 2IPOB 1UPPA 5G0RA 3TOQA 2M88A 5C42B 3KNAA 2RB7A 4UOCA 4ENOA 3HT3A 4Y2AA 1SQFA 4YDDB 1J5OB 3WHIA 3UPFA 1U1QA 3M32B 1Q8KA 1YJ7A 3M8PA 5DRKA 2QJ3A 4A8XA 1AFIA 3VGUA 4NE9C 1K9MT 2BW2A 1GFWB 3H2VE 4I6AA 4O44A 2HZAA 4TKTA 5KFRA 3DC2A 2XLKA 4QW8A 5I4MA 2CJBA 4J9QA 4DUZJ 2YQ0A 4IOCQ 2V50A 2OTJS 2B4UA 2P8IA 1JLBA 2G2YA 3G87A 5GMDA 4NASA 1TFWA 3FQLA 1RGVA 4NLSA 4NYZA 1Y9OA 2UU9F 4IKAA 2Y0SD 4JYAF 2DXDA 1JLEA 4LVOP 2MZQA 4NLXA 3HSDA 4WKYA 3PIOQ 4XDDA 1T7PA 5AJ3J 2AJ2A 3IAM9 4B08A 2OPQA 1TKXB 1UEUA 1RT4A 4CO0A 5D8HB 4LFAJ 2MEWA 4WIIA 3MPYA 2BM1A 4QWAA 4GVBB 2XULA 4HR2A 1UW4A 1EP4B 4C6AA 4LRCA 1UTAA 1SC1B 3HF5A 2BJ8A 4I6YA 2QA4S 3DM2A 3RTVA 5B0AA 3W63A 3BH7B 3PX4A 1JLFB 2R2RA 4ALZA 1HI0P 2HHWA 4YUDA 3C6UB 2RDIA 4DSEA 5HROA 1RSCA 3UWTA 3ZZRA 1KHWA 3P96A 3OSNA 3R27A 1N5YA 4P10A 1EB0A 1T3NA 3M05A 4DBQA 2NR0A 4ZLNA 4DV6F 5SZTA 3M8YA 2DHSA 1X9SA 3ET6A 3I4HX 4G1PA 3M30B 4NRTA 5DG9A 2ZBPA 4OI2A 3G2XA 3PKMA 4WP9A 4FKXA 4P7VA 4U67Q 3W5YA 3ZZYA 3MWBA 3BSAA 3DOKA 1XNQF 2D9PA 3QT7A 3X3UA 3TUPA 1TK5A 2GFFA 1UWAA 1Q1KA 1YBAA 4LIRA 1UEKA 2DHAA 4IH5A 3PM9A 2HVIA 1EHWA 4LBIA 1PC4A 3KKFA 3TA1A 4NA2A 3LP1A 2R7WA 4X4QA 1GT8A 2RQKA 4O3OA 2VU5A 3C3LA 2DCLA 1PYOB 2CPZA 3NWRA 5D0GA 3ZTQA 2OPSB 4O4GB 2MGZA 2UU9J 2W7AA 3WC2A 2ILZA 3TRGA 4JYAJ 1HKAA 2ATLA 1C2PA 1U7LA 3QFWA 5KT3A 3QLHB 1WC3A 3PEJA 4JI2F 3J7YI 1XIQA 4P2XA 2FZKB 3QJPA 3H25A 1KN6A 4PPDA 4I67A 5DM6Q 1RTJB 1U0SA 1NHUA 2OGUA 3HP6A 2MLZA 2B7BB 3KDOA 3M8QA 1YBUA 3SYZA 2ZE2A 1S4EA 2CQ2A 2YNGA 1QSLA 1YRTA 2CPFA 3MD3A 3KLHB 1SL0A 2IDLA 1RBOB 1Y5NB 3LP0B 3FZBA 4ZCLA 3IM8A 4IFVA 4W92B 4ZVTB 1SKSA 3W7BA 4OX6A 4HEA9 4M5MA
chains in the Genus database with same CATH topology
2HWHA 4OZLA 3GV5B 1VC0A 2FHJA 3V4IB 3CO9A 2F1FA 5IM0B 1DARA 1QAIA 4IFVB 2FLLA 4MH8A 2ZC4A 2BRLA 3QZ8A 4EYIB 4GO7X 4F50A 2YKNA 3RAMA 1T95A 3CCTA 4QIEA 2YWKA 1SH2A 4R8UA 5KFBA 4I2PB 1RYRA 4F4WA 1FEEA 1XTZA 2QFJA 1YRUA 2CDQA 3Q0AA 2MZJA 3CIZA 3LQVA 4Y2KA 3R1LA 2UUWA 2ZH7A 4C11A 1UJ4A 3KLGA 3IRXA 1L5UA 1SKWA 4JI5F 2XZWA 4K4ZA 2EFNA 1LXNA 4MIAA 3H5UA 3VZHA 2DBBA 2JVRA 2YKNB 4B9TA 3BB5A 1R3NA 2MKSA 1U1OA 5E3CA 4OQJA 2Q6BA 3JSYA 3UR0A 2N3OA 3PIPQ 2RF2B 2RS2A 2G1DA 3R1HA 4DOZA 4PXEA 1SC6A 2ASLA 1R0AA 2IYIA 2CZ4A 4H4OA 1UVLA 3HVRA 3IRXB 4WE1B 1B64A 2ZC3A 2JEJA 1L3UA 2NPIA 4RU2A 2DRAA 3H5XA 3KLIA 1FRMA 2JSXA 2BQUA 5CXTA 1YWXA 4K5RA 4NCGA 4ZVHA 3KK3A 2VH7A 1S77D 1D8ZA 2MYFA 3SXLA 1QSYA 3MAHA 2XY6A 4RNHA 3GYNA 2M8DB 3GR0A 1FKPA 1FEHA 3M8RA 1S76D 4KKOA 3C66A 3IG1A 1R0AB 1S1UA 4F4KA 3VWSA 1BQNA 3MECA 4H4OB 3TP2A 1C1CA 3N6LA 4DR3F 1YQHA 4JV2A 2WW8A 2FB0A 2C42A 3KLIB 4FS1A 2IRYA 3SFUA 3KK3B 2J6SA 1MMNA 4JOUA 4JI7F 4FXDA 2P9CA 2ZHOA 2VFSA 4ECTA 2J0QD 3BO4A 5D77A 4OZ0A 4BWMA 1KFDA 3SCIE 4ILLA 3MEGA 4KKOB 5GMKa 3HDSA 1S1UB 3T6JA 3TQ1A 2F7VA 3DRYA 3UCZP 1S1TA 3M1VB 5IWAF 1C1CB 3L95X 3DNCA 3HVWA 2R8HA 2IAJB 5AXKA 2QRRA 4LF8F 2QIFA 2W9CA 1XK8A 2B7CB 1UWBB 2M8HA 2YWFA 1TZ0A 1WACA 4HHJA 5THWA 3MM7A 3I55S 4DV4F 1M90T 3OFGA 4DS4A 3TUJC 3EX7B 2ZH8A 3TO8A 1I6JA 1SH3A 2JWNA 2MMYA 3GR1A 2VKZG 4IYQA 4ZK7M 3J80Y 1FERA 1CC8A 2CPXA 3EGZA 4FS2A 4WXOA 1S1TB 1X0PA 1UJ5A 5F0UA 2HS4A 2XLJA 2B6AA 2Q3PA 3I5BA 5KT7A 1A7GE 2EFGA 5DS7A 4B17A 3CCMS 4MTPA 4RBUA 1C1BA 2B4OA 4MK7A 2OKQA 2DGUA 2VC0A 2BV3A 2VA2A 3MM7B 1X4BA 1NK5A 2J7WA 4USHA 4QPXA 2AW0A 2NSCA 1F5AA 1M5VC 1RTHA 3MFHA 3AA8A 1KONA 3BDEA 5HBMA 2YKQA 1C4AA 3DOLA 3LPYA 2PI4A 5EDWA 4GO5X 3N28A 5D4NA 3OXGA 3IR6B 1UEVA 1VQ4S 4NX9A 3PW7A 3F56A 4JI3F 1GNKA 4U6PA 1HQUA 2MQNA 3RRKA 2DR7A 2KT3A 4TU9A 2VPWB 1C1BB 3D5MA 1T03A 1XEZA 4FP9A 2J6TA 4J37A 4WFBQ 2EFQA 5LXYA 5F8IA 3DI6A 2C3UA 1IJEB 1FCAA 1WF2A 1WWHA 5F3TA 3N5FA 3PJXA 1FD2A 1TK8A 1HD1A 5HBMB 2OO4A 1MMLA 3NAHA 1H7WA 3OFHA 3TAMA 4FF3A 2YQ3A 4URSA 3OLBA 2B4VA 2CQ3A 3K2YA 4RW4A 4AXIA 4N5SA 4NLGA 3DLJA 4OX9F 4K4XA 2V2KA 4N77A 5E41A 2XS5A 1VRUB 4AQYF 1SL1A 4A8WA 1T03B 1SJFA 2R7XA 1N6QA 5KFHA 2XI3A 2ABYA 3MZIA 5L8RC 3TR5A 1UA1A 3UDCA 2LDYA 2XB2D 2IFXA 3TANA 4NXMF 3CDEA 2R7TA 3MMBA 4QWEA 2ASYA 4I56A 3TAMB 1MWZA 3Q2SC 4RW4B 4K4TA 2UVWA 2HHTA 2JFKA 2ZOFA 1QVGR 3D0IE 5LXRA 5HO4A 3OTOF 3RYLA 1CLFA 4MYUA 3JSBA 3CDBA 1WHWA 1G6BA 4ECQA 2O66A 4CO5A 4OHYA 1A9NB 1T02A 4PXBA 5HQ8A 3I0SB 3PHEA 1C0UB 3KK1A 5J2PA 1RTIA 2AV5A 4J9PA 3HK2A 1S1XB 2DB1A 3V4MA 1KQSR 2DITA 4NLQA 4P7TA 4IO9Q 2A2CA 3GFZA 2KG0A 1U1MA 2VQEF 4IR1A 3AB4B 4RNFA 4RW8B 1K0TA 4C8ZA 4Z37A 3M9NB 1FXDA 2QLWA 4YQWA 2D3OR 5KG1A 4XO0A 1OQ3A 3DMJA 4NL5A 3EXYA 2MHEA 3K5MA 4FNIA 5BYQA 1HBMB 4QIGA 2G9OA 1LK5A 2WB1D 4HI2A 1FJEB 2C2RA 3W3SA 4AL5A 1RTIB 1TAQA 4X66F 2E5IA 5IS2A 5CD4H 3F44A 1XMBA 4EUVA 3CCLS 2CQ0A 5GADI 3US5A 4XPCA 1TP7A 4ID8A 4DV7F 5T7LA 2DRBA 5E3PA 2E9RX 1LWEB 2DH9A 3GWCA 1VI7A 2LXFA 1X9MA 1QTMA 4K4VA 1K0VA 3LOUA 2YKOA 5J1NA 4ECSA 3GG0A 3IWXA 5B0BA 3NRBA 5D4LA 4BC9A 3H5YA 3PW5A 1A6LA 2DR5A 1WNEA 1S6OA 1RA7A 2XY7A 2PN6A 1JKHA 3NBPB 4ZP6A 2Q1LA 6FD1A 5KFJA 5EHHA 3TYTA 2FPHX 3IO1A 5E2QA 3MM6B 2D9OA 4MK8A 2MQPA 1UKUA 3TVYA 1FA0A 1OSCA 3Q24A 3T9ZA 4ID5A 1M5SA 1GXLA 2OLWA 4ETXA 1NHVA 3H4BA 4WYWA 2VL1A 3T19A 3N5BA 5FDLB 1TL1A 2ZH2A 2IVFB 5F8GA 1S9EA 3SI8A 4ICLB 1Q8BA 1NH7A 4HL9A 2Z2LA 2PMHA 1OQ6A 2PMZD 3QZ7A 3CCVS 4DL6A 2B0GA 4B9VA 1LWFA 4F67A 2ZFHA 1S0MA 1S6PA 4EEYA 1VJWA 5D78A 4DL0C 2J0WA 4ID5B 2XNRA 2V4RA 2NZ4A 3M9OB 2HS0A 2WONB 2PGCA 3RBEA 1S6QA 3V6DB 2E5GA 3VZIA 3KG4A 4A48A 4OJGA 2MPUA 1LWFB 5HP1A 2FVPA 2N4DA 4CNZA 2M2BA 2R9LA 2DNHA 4V19X 3MOJB 4ZA1A 3KK2A 5KT6A 1S6PB 5K8OA 3ETOA 3OVAA 1H3DA 4HTJA 1JIHA 5KFIA 1NNDA 1ZZFA 4DF8A 2FUG9 3OV7A 3RB6A 4PG7A 1S6QB 2AJ1A 4QIVA 5J2MA 1B7FA 4KT0C 3HMJG 3C2PA 3QIPB 2CZVC 2RE1A 1F60B 3GMGA 5AE3A 2J9CA 1TKXA 2HMIA 3NS5A 1PO6A 1ELOA 2DNLA 2I38A 4YEAA 1U25A 1Y00A 3FDSA 2NUUG 3KK2B 1YGYA 3Q22A 3DLEB 1FNOA 4R5PA 3M4XA 3Q8PB 2Q6CA 4OI4A 1RTDA 3LUYA 3PY8A 4EYHB 4RWXA 2NYIA 4EFAC 5L1LA 1H98A 3BREA 3I32A 2DCUB 5BR8F 5J2MB 1YRXA 4J9NA 2DH8A 1LXJA 3PKYA 2L08A 2HMIB 3K58A 4PRFA 2IJNA 5GAGI 4RNNA 1V3RA 4D3GA 1EP4A 1URNA 2MZ1A 3BEGB 1KTQA 1YJWS 2DHXA 1S10A 4R5PB 4Q7AA 2DR9A 3J7YU 4WFXA 2UVVA 2EK6A 4M95A 3ZZUA 2ZZMA 1RA6A 2D74B 4B9MA 1KOHA 5HLFB 1TFYA 1S0NA 1S4FA 4AE5A 2L9DA 2XCPA 5GAHI 3ZZOA 5DO2A 3G8SA 4G1QA 4WCEQ 3DRXA 3W2WA 1U48A 2HIQA 5F41A 5EX3A 1MW7A 3PR5B 4K4SA 4KB7A 1Q7LB 3I5CA 2K1RB 4OL8A 2XWYA 1B0TA 2CQ4A 3IWLA 3CDAA 2AGOA 3P3DA 1IUJA 3UCUP 1HR0F 1R8BA 4NCBA 1UVNA 4DPOA 4I1TA 4PUOB 4KJIA 5DQGA 3BS9A 1ZAVA 5DDQC 1KLNA 3TA0A 2G13A 1O0PA 4G1QB 1XMQF 3CCES 1QLNA 1JNRB 4FXWA 1FJGF 3OTDA 4FXVA 2K8GA 4X64F 1HWIA 4DFJA 1VQMS 2DGQA 2FGOA