4RU2A

Crystal structure of a rna-binding protein 39 (rbm39) in complex with fragment of splicing factor (u2af) from mus musculus at 2.20 a resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
111
structure length
111
Chain Sequence
PLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKYSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a RNA-binding protein 39 (RBM39) in complex with fragment of splicing factor (U2AF) from Mus musculus at 2.20 A resolution
rcsb
source organism Mus musculus
molecule tags Rna binding protein
molecule keywords RNA-binding protein 39 (RBM39)
total genus 32
structure length 111
sequence length 111
chains with identical sequence C, E, G, I, K, M, O, Q
ec nomenclature
pdb deposition date 2014-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ru2A00
3HI9A 1X4HA 1K9MT 1X5TA 1WHYA 2SXLA 1VQNS 2XSFA 4CQ1A 1VQ4S 3MUVP 2CQ2A 1FJEB 1WI6A 2D9OA 2MQLA 3EX7B 5EN1A 1H2TZ 2CQDA 3TO8A 2FHOB 2B0GA 5CYJA 2MJUA 1U6FA 1WHWA 3CD6S 4A8XA 4LJMA 4QPTA 2MQMA 5DDPC 3NMRA 3BO4A 1Q81T 1HL6A 5LJ3Y 1D9AA 1YWXA 4CIOA 1G2EA 5ITHA 1AUDA 5H1SV 1VQKS 2PEHA 1YI2S 1YJWS 2G1DA 2DIVA 2JWNA 5DM7Q 2CPYA 2MKJA 1K73T 1N54B 2V94A 1KOHA 1HD0A 1KQSR 3SMZA 4C7QA 3CXCR 1VQMS 1DBDA 2M7SA 2N3LA 1X4EA 1VBZA 1HA1A 1X4CA 1DZ5A 3DXBA 3VAHA 2CQIA 2YWKA 3U1LA 5CA5A 1UAWA 1X4DA 5IM0A 1NO8A 2DNOA 2DGSA 1M5VC 2RQCA 4YOEA 4QU6A 3MUTP 3CUNA 4IOAQ 1D8ZA 2LQ5A 5DETA 3S8SA 4UY8T 2HVZA 2G4BA 1UFWA 2M4MA 2FC9A 3CTRA 3MUMP 1WG5A 2AYGA 2XS7A 2XB2D 2OJ3A 2RS8A 1UW4A 1QVFR 3UD4P 2DHAA 3CC7S 2D9PA 1YTYA 1VQLS 1VQ8S 1VQ7S 3LPYA 1H6KX 2G0CA 2DO4A 3JB9k 2UP1A 2CQ1A 2DGXA 4IO9Q 1X4FA 1QM9A 2DNQA 2XNRA 3G96A 2MZSA 5GVQA 4YB1P 2N82B 3U1MA 1U1KA 1U1QA 3HHNB 2ZJRQ 3I55S 4TLQA 2LXIA 3CCRS 1WWHA 1K8AT 3I56S 1X4AA 1M5KC 2N7CA 2HGMA 2M2BA 1VBYA 2DGWA 3TYTA 4FXWA 1FNXH 2N3OA 5MLCV 1OWXA 1SXLA 2K3KA 2MZTA 2CQGA 2X1BA 1BY9A 2DNKA 4ED5A 2FY1A 2O3DA 2MQPA 2AYBA 3R1LA 2E44A 3S6EA 4W92B 1SJFA 2CQ3A 1FXLA 2KM8C 3H2VE 5BJRA 2I2YA 5DDRC 1JMTA 1VC0A 4PRFA 2GO9A 2KRBA 2MPUA 2RS2A 2KYXA 2KFYA 2DISA 2DITA 5GADU 3CCES 1SJRA 2KXFA 2F3JA 1OIAA 3DLLQ 4CH0S 4F26A 4QU7A 2E5GA 4M5DB 1FJCA 3CCJS 1RKJA 2CPIA 2DH9A 2HGLA 3K0JA 1P1TA 1R8PA 2EK1A 2CPDA 3H2UB 2CQHA 4WFAQ 2CPXA 3BO2A 3R27A 1M5PC 2YTCA 1VQOS 2F9JA 4EGLA 5HO4A 2MYFA 1JJ4A 5HL7Q 1KOOA 3RW6A 3FEYB 4Y0FA 2KN4A 1H2UX 3UCUP 3IWNC 3G9CA 2MKHA 1WEXA 2GHPA 2XS5A 4LMZA 2MKSA 1Q82T 2BZ2A 5LXYA 3THTA 1U1NA 3NNCA 1U6BA 3MURP 2DGUA 2L08A 1X4GA 3VAGA 2XNQA 2RNEA 2CQ0A 4OZ1A 3L3CA 1Q86T 4UQTA 3SXLA 2DGOA 2DHGA 2QFJA 5IQQA 2MKKA 3US5A 1N8RT 2RQ4A 4W90B 2OTLS 1VQ5S 1FO1A 2YH0A 1KC8T 3EGZA 1YJNS 2JX2A 2DH7A 1DHMA 3P5TL 1SJ3P 2K8GA 3PIOQ 1YIJS 2DIUA 2LYVA 2E5HA 2EVZA 3BO3A 1OPIA 2HGNA 2EK6A 1CVJA 2LA4A 2U1AA 3G8SA 2MHNA 2DNRA 5FJ4A 2KI2A 5GMKa 5LJ5Y 4F02A 1M1KT 1OO0B 2AYMA 2MXYA 1A9NB 3VAIA 1VC5A 4WIIA 1NJIT 3V4MA 2KXHA 2ZJPQ 3R1HA 3VF0B 3CCMS 2MGZA 4LIRA 1Q7YT 3ZZZA 2ADBA 2ADCA 4C4WA 3SDEB 2MGZB 3NS6A 2MJNA 2VODA 1VQPS 4QQBA 1ZZNA 1FT8A 2KHCA 3NNHA 1X5OA 5JVHQ 4IOCQ 2MQNA 2YH1A 2X1FA 4J5OA 3CPWR 1X5PA 3CMES 4RU2A 1YITS 2ERRA 2VOPA 2DNZA 3P6YC 5DDQC 2NZ4A 3MI7X 3VAFA 3VALA 2XS2A 2M9KA 2JVRA 3CF5Q 1W2BR 4V19X 2HYIB 3UCZP 1FJ7A 3UD3P 4FXVA 3UCGA 5DDOC 2DNNA 1DRZA 1WI8A 5GAGU 2AYEA 2DNYA 1U1PA 3CCVS 2YKAA 1WTBA 2J8AA 1L3KA 2RVJA 1A7GE 3Q2SC 2MKIA 1S72S 3MD3A 4U67Q 1PGZA 1M90T 2E5IA 2MY8A 2QEXS 4F25A 5IFMA 5LSOA 2DK2A 4WFNQ 1YHQS 1X4BA 3VAKA 1VQ6S 4TU8A 4TU7A 3LQVA 1SJ4P 2CQPA 1WEYA 2DNHA 1X0FA 1JJ2R 2VOOA 5JVGQ 3CC4S 1WHVA 1M5OC 2RRAA 3P3DA 2RRBA 2MZ1A 1KD1T 5CXTA 3NS5A 3MOJB 4CH1A 1UP1A 2MQQA 1WF1A 2LCWA 4ZKAA 2PE8A 2NLWA 2D3OR 2MB0B 3ZZYA 1VBXA 5LXRA 4C0OC 2MZQA 2LXUA 2LMIA 4PKDB 2X1GA 2MMYA 4BS2A 2KVIA 2DHXA 1FHTA 2WBRA 2HZCA 1HD1A 2DNMA 2KG1A 2M8HA 4WKRA 4PR6A 2DB1A 3VAMA 1ZZFA 2KU7A 4WFBQ 3FEXB 2CPJA 3G4SS 2M8DB 2M52A 2BOPA 2J76E 3BEGB 2OIHA 2I38A 3UWTA 3Q2TC 2KG0A 2F9DA 2DHSA 3SDEA 3J7YU 2MZJA 3THPA 2DH8A 4WF9Q 2OSQA 1U1RA 3IRWP 2LECA 1B7FA 2MSSA 5LSLA 2OSRA 2E5JA 3NNAA 3J7ZT 1NU4A 1VC6A 3CCSS 2KXNB 2CPZA 5D78A 1H2VZ 1U1LA 1WELA 2CQCA 4OZ0A 5D77A 2KM8B 1X5SA 3S01A 3CULA 3MD1A 3EGNA 2DGTA 2LEAA 2CQ4A 4IUFA 2DNGA 2CJKA 2MSTA 1YJ9S 3P49B 2KRRA 2FC8A 2KH9A 2CPFA 1F9FA 3OW2R 3TP2A 1RK8A 2OTJS 4WCEQ 2MZRA 2DNLA 2JRSA 2L9WA 1VQ9S 3VAJA 4YUDA 1S79A 2M0GB 2VONA 2M88A 5GAEU 4Y00A 1PO6A 3G8TA 2ZJQQ 3CMAS 3CCQS 1WG4A 2RU3A 3MXHP 1URNA 3CCUS 2DGVA 3UE2A 1R8HA 3MDFA 4TU9A 1WF2A 2J0QD 3ULHA 1N88A 1ZH5A 1WHXA 1JJHA 3CC2S 2MQOA 1U2FA 1WF0A 2LEBA 2QA4S 2CPEA 2LA6A 3N9UC 2RUGA 4P6QA 4Z2XA 3CCLS 2A3JA 2CQBA 5GAHU 1WEZA 1XN9A 3S7RA 2CPHA 2LKZA 3B4MA 2U2FA 5IM0B 2KT5A 1P27B 1U1MA 2DO0A 1IQTA 2X1AA 2J0SD 2Q79A 3B4DA 1SJQA 1WG1A 3D2WA 1N52B 1QVGR 3G71S 3G6ES 2MKCA 4ERDA 2RT3A 1O0PA 1U1OA 2DGQA 3PIPQ 2JVOA 3BS9A 2AD9A 2MY7A 2M70A 2DNPA 5DM6Q 2FPHX 3RW7A 2L41A
chains in the Genus database with same CATH superfamily
3W7BA 1RTHA 2FVPA 4WBFA 4ZVUB 3RGIA 4A8OA 1X5TA 1UPMB 4LFAJ 3NCPA 3D3CJ 3LP1B 4ETXA 5KFQA 1EETB 4LF7F 2RD5C 1S5ZA 3GWCA 3PDNA 4M1KA 2HVHA 3HFKA 1DJ0A 1S1WB 2HFOA 3C16A 2JH3A 2ZE2A 3RB6A 2P9CA 2FHOB 3IG1B 3QMQA 2XGQA 3NMAA 2JC1A 4GC6A 4DPUA 2HMIB 3BKFA 4GO7X 1VRUB 2CNLB 4NZ0A 4QIEA 4JI1J 1F5AA 1TMMA 1NSPA 2B7CB 2FB0A 2GNKA 2YNFA 4WYLA 4DZ6A 4JI8J 1HL6A 3RR7A 2H5EA 2UUTA 5B0DA 3UDLA 4K4SA 1FI4A 5B0CA 2C2NA 5ETTA 1U25A 2M3DA 3AJDA 4I7FA 4XPEA 2DHHA 1YI2S 2H5JB 4DFPA 3PO4A 2DIVA 3QT5A 4LSLB 4N41A 4O4RA 1RAGB 2YKQA 5F8MA 2FLPA 1RJJA 1LK5A 3HKWA 1NBEB 2V94A 2IAJA 3Q8SB 4QOTA 3V81B 2NPIA 2GGPB 1S97A 2IMWP 2ZC4A 4JI4J 2GVZB 2W9BA 4V19J 4LSZB 2HHWA 1UL3A 5KFTA 2M7SA 4H4MA 2GMLA 1RT6A 1N5SA 2XCAA 4KO0A 3AD9C 4NLSA 1X4CA 3KLHB 4DX7A 3H4BA 5I42A 4H4KA 2CQIA 2OPSB 2YWKA 1DZ5A 4KPYA 3J7AN 3OXGA 1RTIB 1NO8A 3GJSB 2DNOA 2QLJB 1RWMB 3FQKA 4KGMA 3UNYA 2DGSA 2CJAA 4F4XA 3T5KA 4LRBA 3I4PA 2XSJB 4EI2A 4A48A 4NLVA 3AB2B 4YOEA 5EWFA 5KG2A 4RU9A 4HH0A 2LQ5A 3GE9A 1LWFA 4UY8T 1FRKA 1SUQA 3OQ2A 1H3DA 1RT2A 4ZIVA 5KFLA 4FNHA 4WP3A 4C2MA 5AJ3J 4X4VA 4ZVHA 4ZPAA 1KKHA 3IXQA 5KFFA 1REVB 4YR0A 1BQMA 2YPZA 4XO0A 3MUMP 2V8HA 3C46A 3FK4A 4JI1F 1PC4A 2OJ3A 3DRPB 1UW4A 4M5JA 4DR5J 5ADZA 3GLJA 1GTEA 4I2QA 4U95A 1FD8A 1HBOA 4KGZB 4FF1A 1QUPA 3VVUA 1UJ6A 1ZA1B 1H6KX 4K5RA 4J9QA 1IKWB 2G0CA 1YJRA 2DO4A 4E98A 2PO4A 3QSIA 3GV7B 2B9EA 3ZZ0A 4IO9Q 1G1XA 4F4YA 4NLXA 1QM9A 2QC3A 3OR1A 3QO9A 4Y2MA 4IRKA 4X62F 3OTBA 4RUAA 2XNRA 2IBOA 3G96A 4PG6A 2V4JA 2DRDA 1K47A 1TAQA 4YFUA 2MZSA 1VS3A 2E1AA 4LQ9A 3WX8A 3DDIA 2JHEA 3QZ8A 4FYYB 3H4DA 4Q8EA 5F0UA 5I3UA 1U1KA 4IFYA 4KQZA 2W7OA 4ZITA 1SC4B 3DOLB 4NWBA 2LP4A 4HTJA 5B0BA 1CPZA 2BQ3A 3CCRS 1OY6A 3MECB 4IFVA 4CNYA 3ZC4A 1K8AT 5GMEA 1KFSA 1T9VA 1HWLA 1M5KC 1RAAB 1MN7A 2H4WB 1AXQA 2M2BA 3VQTA 2N7CA 4DQRA 1MMDA 5J2PA 3M2RA 3W9HA 2E9ZA 1N36F 4OHWA 5C24B 1NUEA 5MLCV 4FPRA 2FVSA 3ELHA 5L38A 2H3EB 1GX6A 1HR0F 3SV3A 3PG9A 4DL5A 2F4VJ 4B9MA 3IRXB 2CQGA 4KC5A 1BY9A 1RABB 2DNKA 2QA2A 2XHWA 4ED5A 4KY3A 4PPDA 1E6YA 5C25A 1OQ6A 2R2SA 4NE9C 3IWXA 4A8MP 2WCXA 2AYBA 3AJ2A 3W62A 2BJ7A 3CCZA 3TQ1A 4F4KA 4U9RA 4DUZJ 1PAUB 5SUHA 4K4YA 3JSBA 2KM8C 3OXFA 4K7QA 5BJRA 4FDFA 1NJWA 2ZOFA 3BBFA 4MIBA 2X51A 2VOPA 2ZH5A 2PGCA 3D0GE 1VC0A 1HFEL 2BE7D 4CT8A 3NBPB 2Y8WA 1U24A 5AXNA 3LO3A 2R2RA 3PX4A 4DG1A 2C2EA 1C1BB 5H9EJ 2Z2YB 2NREA 1EHWA 3K5LA 4DEZA 2AQ4A 1C0TA 2DISA 2DITA 4DSLA 3KJVB 1EIYB 3EZOA 4U7CA 2FHMA 3MTKA 1RT7A 3HZEA 4TXSA 3KG1A 2F3JA 3NAIA 4RW6A 1XNQF 4KHPF 4F26A 2VU5A 3MEDA 4OZ2A 3N79A 2OFGX 1RAJA 2HNZB 3P96A 1DQ8A 2P6TA 3JQJA 3OFHA 4RX6A 1LW0A 4ZP9A 3KK2B 3CCJS 5LMUJ 1S6OA 1D9DA 3J7YI 2OAUA 1U49A 4USWA 3LOUA 1U45A 3AFGA 2Z4PA 3AJ1A 1I51B 5EWEA 4B3MJ 2CYYA 1D1UA 1R8PA 2YNGA 1HWKA 1YKWA 4K4XA 3KOAA 2HQGA 3OFGA 4N77A 4FS2A 4EEYA 1RSCA 1MLAA 1RU1A 2HFVA 1YZ6A 1HNIA 2AKWB 1HNVA 4FKXA 4L3NA 1KVJA 2CPXA 5KG6A 3BO2A 3HJFA 2V2VA 1MWZA 1U8SA 3DRSA 4NLRA 4EBDA 2IVYA 3M6VA 4ZJOA 4F50A 1JJ4A 3BB5A 3GIIA 2F8MA 3RW6A 1S9GA 4ZMMA 5IT0A 5F9LA 1RWXB 4F36A 1H2UX 4NYPA 2GC8A 2LU1A 2XWYA 4P9SA 1EARA 2BBEA 3FZBA 3ITHA 1SI9A 5KFUA 2GHPA 4LMZA 2QLFB 4ECQA 3HHDA 1Q82T 3M1VA 4ECVA 3K5MA 3E3XA 1VQSA 3Q86A 3THTA 1U6BA 1O51A 4X4QA 4ZLLA 4F4AA 2V67A 3CVKA 2FVRA 1X4GA 2FHJA 2FY8A 2CVEA 3FBBA 3HT0A 2KKHA 1TFWA 2CIMA 4XAKA 1S1TB 4QR0A 9RUBA 3FDSA 5EDWA 1VIOA 4OHZA 3SXLA 2DGOA 4X2BA 4DR2F 5D6GA 1LW2A 2FD2A 3DLKA 4AYBD 4X4OA 1NH8A 1JNZB 3GONA 1N8RT 4W90B 4XDDA 4LVNP 1FO1A 3V2UC 1ZS6A 5A2QU 2JX2A 2DH7A 3OFEA 4FF4A 3C15A 2I5JA 2GJ2A 4L3KA 2YKNA 3K7RA 2RB7A 2IHR1 2K8GA 3PIOQ 4JOUA 3PJWA 3N6LA 4LR9A 1SJ3P 3W63A 4HACA 4LF5J 1HNZF 1KHVA 2BJ9A 2VFTA 3LAKA 5BYQA 3BO3A 4P73A 2EFQA 1T05A 4DV2F 1OPIA 2HGNA 3DM2B 4UOFA 1KRPA 3ADAC 2U1AA 4HVZA 4JI3J 3H25A 1Z2LA 3WHIA 5FJ4A 2HFZA 2LQ9A 4DFMA 5GMKa 5KG3A 4CLUA 5U47A 4NCGB 1Q5VA 1QLNA 4NXMF 2AYMA 1O8BA 4K0KJ 5A76A 4UW2A 3VAIA 2R8JA 2ZZMA 1KEKA 7AT1B 3L7UA 3JYTB 4WIIA 4QYZK 2YXLA 3V4MA 5IZHA 4WE1A 2K7JA 4C0HA 2IJNA 3BDEA 1D09B 1A0OB 4QIGA 3EGVA 2BJ8A 4M63A 2RUSA 4ZPDA 4DX5A 4ED0A 2UUBJ 4ZLJA 4DX6A 4ID5A 4R0EA 2NXCA 2DRAA 2VG5A 4MH8A 1HW9A 1IN0A 4HHJA 2C3PA 3VZIA 2EKYA 4HHHA 1FF2A 1RAFB 5E3QA 4AQYJ 4O23A 1ZZNA 1FT8A 4E0DA 2KHCA 2QN6B 4IDKB 4OYWA 2MHEA 2LDYA 3B54A 3C14B 1FRIA 3KHGA 4DQQA 5KG7A 4H4OB 4IR1A 4R8UA 1R0CB 2UUCF 3HLUA 3M2VB 2HVIA 1NK7A 1CQNA 3TA1A 1D8YA 4FF3A 1Y5NB 3TWZA 1Q0NA 3NL0A 4WU2A 4J5OA 1NDCA 1XMBA 2EG2A 3CPWR 1X5PA 1SC6A 1ZBTA 4DS4A 1FKOB 3W64A 2HS4A 1FX4A 2YNIA 5AT1B 5K5MA 2H9ZA 3PW4A 3P6YC 1XR6A 2CKWA 4ZPTR 5DDQC 3BQ0A 3HK2A 4DR4F 2Y1IA 2C2KB 2Y0SD 4V19X 1UETA 2PA8D 3K5PA 1R8CA 4XIUA 3JAMY 4ZVOB 3UD3P 2ZH9A 3UCZP 5DDOC 2DNNA 2HRUA 1Q5YA 5GAGU 4K4UA 1U1PA 4EMDA 4TYAA 4UT4A 1HW8A 2V5HG 1KR4A 4K8RA 5HBMB 3TAMA 3MF5A 3CCVS 2JSXA 1WTBA 1S9EB 3TAPA 1L3KA 3TRGA 5DS7A 1IKXB 3CDEA 3UI3A 4TQRA 5KFDA 1N34J 4DV0J 1LV5A 1MU2B 2Y1JA 5KT7A 1V5VA 1FEHA 3D6HB 2RRNA 3OD2A 4U67Q 5A8KB 4N8OA 2MY8A 4ZOSA 4M5GA 1TP7A 3QBCA 4CH7A 3DOMB 3HSGA 3MCNA 2F8EX 2QL7B 1NB2A 3D1QA 3DOMA 2AT1B 4RJVA 3CIZA 3LF0A 2ZH1A 1NK8A 4JI3F 4GKJF 2VD3A 1N0UA 1RWNB 1CJVB 2R9LA 2AHOB 4RPFA 2KYZA 1JLBA 4DJBA 2DEJA 1HKAA 1TL3B 2E29A 3CJ5A 3QWPA 1X0FA 2VOOA 2EW9A 3D3BJ 3CEDA 1EJ7L 3D7SB 3G87A 1S6PB 2AV5A 3P3DA 1U4BA 2AU0A 4MKVA 4FS1A 1UFKA 3BR9A 3NS5A 4IH7A 4CO0A 2WZ1A 3MAHA 4LRDA 2GCFA 2HG4A 3OR2A 3PRVA 4O0IA 3TARA 2VPYB 1M0SA 3SCLE 5HJYA 2HPUA 3MM8A 4M5IA 3RBEA 2LCWA 5JJBA 2V8GA 4XPCA 2NLWA 2UUAF 4YQWA 1JLEA 4LQ3A 3M8YA 4I6AA 5D4NA 3ZFVA 2HHVA 3GG1A 3ZTPA 5IXUA 2BANA 3IR5B 1RTJB 4PCQA 1LNQA 4C0OC 3OTDA 2QG9B 3ZZOA 2MZQA 3O2IA 2LMIA 4BS2A 2BX6A 1IUJA 3BYPA 1NEEA 4CP5A 4PG8A 4J9OA 3CJKB 4Y3CA 1S49A 1JXLA 4HL9A 1HBUB 4CYUA 2WBRA 3QLHA 3M2VA 5CYMB 1HD1A 1LQ9A 2BEFA 4RUCA 2BR0A 3VAMA 4KJIA 3C14A 1IBCB 3F41A 4TN2A 3NGRA 5F0WA 2XC9A 2CPJA 4F3QA 3EPIA 4A8FA 2F40A 2KB2A 2M52A 3DGPB 1VLOA 4GMKA 2UXCJ 5LL6d 3BEGB 2I38A 2KT3A 2ZNZA 3THVA 1SCJB 1UTAA 2CADA 2F9DA 2DHSA 4OX7A 4D3HA 3DLGA 5KFHA 5DZ7A 5L1IA 3MTJA 3JQMA 1Q79A 1NDKA 1RB0A 2OSQA 2VFRA 5DO2A 3PX0A 1U1RA 1SL0A 4M5NA 4O44A 3CCTA 4NMXA 2AJ2A 3UDVA 4F0HA 5T7LB 4WE1B 3OUYA 3O44A 4KKOB 4DLGA 4G3IA 3PXGa 2MSSA 4NI2A 1QAJA 8AT1B 5BR8F 3OL7A 3PR5B 4LFBJ 3WIUA 3EYZA 1CSJA 4YHHJ 2XO7A 5D3GA 1RDRA 4NCGA 1VC6A 3M32B 2PSZA 4YR3A 3HP6A 3J81j 3M32A 4TYBA 2MLYA 2CQCA 3BREA 5FLXY 3L9ZA 1PKUA 1T05B 4QJVA 1NMEB 4PG4A 1AFJA 3BPSP 4ZLPA 1X5SA 4KKOA 1ZM9A 1SH0A 3FSYA 4X4UA 3MD1A 4LR7A 1VJWA 2DGTA 2D1CA 5AE1A 1X8DA 2CQ4A 3H59A 3GYXB 2DPIA 1CC7A 2CNKB 3OFFA 1QAXA 1VMBA 3AOAA 1CJKB 3SQOP 4AFFA 2DNGA 2F63A 3HHKA 3NS7B 3W2WB 2MSTA 2XZDB 3TUPA 4WKYA 4ZPCA 3R7NB 2KRRA 2AMCB 2FC8A 1C2PA 2CPFA 3B8HA 1AFIA 1NHKL 1F9FA 1R6YA 3TUZC 4DS5A 1RK8A 2ZC3A 3PHTA 5J1NA 1WORA 2MZRA 2VKRA 4P2SA 3AXKA 3TZZA 1ZETA 3VAJA 2HNDB 3OVSA 1CS4A 1RHMB 2QLWA 4KH1B 4RWXA 5ETVA 4YUDA 2ZHOA 1S10A 3JSRA 4FBUA 4PUOA 2JDJA 2VONA 4PXBA 2W7AA 4OYMA 3D6TB 2ZVIA 3CIMA 3CCQS 3NLCA 3CMAS 1JLQB 4C8NA 3F56A 1URNA 2ZBCA 1NXIA 3M1VB 1LFPA 1C4AA 4NLTA 2W4DA 5CZXA 2HHHJ 3TJ9A 4TU9A 1U0HB 3GFZA 1WF2A 2GJIA 3C6UA 4PAAA 3RRHA 4I6YA 3AODA 2HURA 1IVZA 2ILYA 1SC1B 1GQEA 3NOGA 4KAIA 1IR2A 5K8NA 3Q8RB 3CC2S 3MM7A 2MQOA 4P75A 1FNOA 3IM8A 2W2QP 1S1VB 5IWAF 3DU6A 1WC4A 3SCIE 1HNWJ 4EBCA 3HSJA 2QA4S 2LA6A 2F7VA 2WVFA 3I0RB 3N9UC 1WDTA 1HNVB 1Y5IB 2XHCA 2HVEA 4WTOB 1P8GA 1KTQA 4Z37A 2A3JA 4NA2A 5HK4A 3TVYA 4X4TA 1UVJA 1JLBB 5FIIA 5KG5A 1HMVB 2IC3A 2QO3A 3PJXA 1FX2A 4DBQA 4F3MA 3RU0A 3KLVA 4P7TA 2NUHA 3LGMA 5CYQB 2UVRA 4DR1F 1UCNA 2DO0A 1XJWB 1AROP 3POTB 2BA9A 3BGFA 3G6VA 5D0GA 2D74B 5E7OB 2HFUA 2J0SD 2UVUA 1S7IA 2XM3A 5A8KA 1PBUA 2RIJA 1N5YA 4JV1A 3R8YA 2R7OA 2XWXA 4OLOA 4OYPA 4JI2J 4J9NA 2ZKTA 3GV5B 5DG8A 3KWMA 4USUA 4WP9A 4C3LA 4HYKA 2XQCA 4J9VA 1S9EA 3NKYA 1V9OA 1FWLA 1ZPWX 4WFXA 4ED1A 2DTJA 2MY7A 3JS9A 2AP6A 5DM6Q 5HP1A 1CQMA 2PMHA 5IT4A 2V8VA 3H40A 2R42A 2QMWA 1PCAA 3C6TB 3NBPA 1X9MA 1H7WA 2PIIA 3EVMA 1AUSL 2UXDF 3HI9A 3M6WA 1K9MT 3G6YA 4ER8A 1RA6A 1RBAA 1SKSA 2J9CA 1Y0HA 2OELA 2AF6A 4QYRA 3CD0A 2R7RA 4NRUA 2G0IA 3DOKA 2XSFA 4P71A 1HBUA 5HANA 4CO3A 2OPRA 2CQ2A 3HF5A 4A4JA 3QPIA 1KQKA 4CYUB 2MQ8A 4ED3A 1GTHA 2O66A 3R2DJ 4ZCLA 5EN1A 3OT9A 1H2TZ 5K8OA 4UQGA 3OTOJ 5E5NA 1FA0A 1HHTP 3V6HA 2PFFB 2AX1A 2YWEA 2BANB 5G0RA 5CYJA 4IR9A 3CD6S 5BYRA 2WSEC 4LJMA 4QPTA 4USTA 4F0MA 4GRSA 4ANDA 3PFEA 2KL8A 1Q7LB 1GXUA 5D0RA 3SIPB 5DDPC 1L3SA 2A6OA 3BO4A 3KUHA 1IQZA 1Q81T 1D9AA 1YWXA 4CIOA 3HD2A 1WTFA 2NYHA 1G2EA 4X4PA 3RYLA 3PW2A 1PAEX 2VG6B 3V4IB 1AUDA 5H1SV 3OPKA 2G9OA 2PEHA 3UDCA 1PIEA 5D4LA 1BUXA 1HBMA 5LOQA 1J5EF 3KTQA 1DFDA 2JNJA 3TEHB 4Y2IA 1VISA 1L3UA 2CPYA 5KFKA 2MKJA 3SCJE 4FVMA 1N54B 2VF3A 1UA0A 5KFPA 1HD0A 3FSIA 4KGKA 3PCOB 3R5CA 5E3PA 3SMZA 4ALZA 3TI0A 1MNEA 4YDXA 5E33A 4DUYJ 1IM6A 3T1YJ 2XMTA 3BPDA 4DL3A 1X4EA 2UXDJ 2C2ZB 1TUWA 3D1OA 2Q1LA 4YHHF 4ZCMA 4B9VA 2OMLA 1OPZA 4UOGA 5CA5A 1X4DA 2XMJA 5BR8J 3J81Y 1RKIA 2MEWA 1RGVA 4LFBF 3UD5A 3SSSA 4USHA 2V6AA 1RUSA 2WVCA 6FDRA 4CLLA 1M5VC 2W25A 5H9EK 5KFGA 3OHBA 3LWMA 1HHQA 3R5BA 1FESA 1CULA 5CD4A 3MUTP 4AL7A 5J1EA 1X0PA 1O5JA 4GVBB 1BQMB 2HVZA 1BXNA 2M4MA 3LH2S 1DAXA 1DY3A 3MM7B 5B0GA 2HLTA 1UZHA 4CTAA 2W8LA 1RT2B 3GZ7A 2XMMA 4PG5A 2HZVA 2YKOA 2AYGA 2N4DA 3QQCD 4HR2A 1NNDA 2RS8A 5IWAJ 1Y3JA 1FK9B 2ZNYA 3PR4A 2ABYA 4LF6F 4HLBA 2R7WA 3K8VA 3NGTA 2J0XA 3KG4A 2HQFA 2HHQA 2NUUG 1WOOA 2QA1A 4CDIA 4YMEA 2UP1A 3SFGA 2V4RA 1OSDA 2HNDA 1YG0A 2DNQA 2IRYA 5KOWA 2QT7A 3NGUA 2NXEA 4IDKA 4NLDA 4UZCA 2GVZA 1EQ0A 1S12A 4DFKA 2BVZA 4OI1A 3M7VA 1HIYA 1IJEB 2DEIA 3W2WA 4EZ9A 4CT9A 3KMQA 4ATNA 1N32J 1SPBP 4RW4B 3OHAA 2BW2A 5LMNJ 4J9UE 1WWHA 4I7FB 1X4AA 4B02A 1ZTTA 1XTZA 2BXJA 4USKA 1KTVA 3BKTA 1I5OB 1UJ5A 3A4TA 2QRRA 4FXWA 3TYTA 4CI0B 2PMWA 3EDQB 1FNXH 4DR6J 1B64A 4JYAJ 5RUBA 5KTQA 1BC6A 1EQMA 1K1QA 2WBMA 2W2MP 4CLFA 4HKQA 2K06A 1JX4A 4DSEA 2MZTA 3TAQA 2DR8A 2X1BA 3W3SA 3TVKA 2ZHBA 2IY5B 1LW0B 2FY1A 1WKJA 3IG1A 4DU7A 2XO6A 4F2RA 2COLA 1Y4ZB 3FKBA 4H54A 2MQPA 1WC0A 5J1PA 4KTQA 4DR6F 2HHXA 3FSXA 1B70B 4HACB 4RW6B 3HM9A 5T7LA 3OUYB 2L9NA 3H5XA 1SJFA 2DRBA 4O44B 2R7TA 1FXLA 2ZITA 2I5JB 1PILA 3H2VE 1NK0A 3BBCA 4WYWA 5CQGA 1GFWB 2W9CB 5LMNF 1FVQA 5DZ6A 5C7PA 2J6TA 4I67A 2AZ3A 2KDOA 3DCAA 2IDLA 3O3LA 5K14B 3OL6A 3BDPA 4B3SJ 1C1BA 2GO9A 3DLKB 3HKZD 4ES3A 7FD1A 2VQFF 1I94F 2Y3YA 3RG6A 3TZYA 3GG0A 3E2EA 2GV1A 4WJBA 1QE1A 2GMJA 3AQOA 2FLLA 2V8PA 3CGIA 5GADU 1TELA 1SJRA 1WDDA 1S59A 2BRLA 1SQGA 3OTCA 5CYMA 3MMJA 4CLYA 5B0FA 1B3TA 2KXFA 4U7UD 1JXEA 4IH5A 2RF2A 1OIAA 4ZVFA 3NXZA 4CH0S 4DV6J 3L95X 2V2KA 1E6YB 2UUCJ 1RT3B 5KT3A 1RKJA 3AQPA 4EU0A 1ZAXA 2J7WA 4I2PB 3WBZA 3K0JA 1JLEB 4AQYF 2BM1A 4LVOP 2PDAA 4RW7B 3DLEB 2EK1A 4N7TA 2QTWA 3GTYX 2W4PA 3DRSB 4DQPA 2FLOA 1RWUA 1NKEA 1SKWA 4WFAQ 4LFCF 2R7XA 1RT5A 4BCAA 4MK7A 2GO8A 1IBMJ 4ECZA 5KT5A 3L4BC 1X60A 2HNYA 2QLBB 2YTCA 3I32A 2F9JA 4ZCIA 1HNIB 4DV4F 4AT1B 2R8HA 5HO4A 1FCAA 2MYFA 1NK6A 1EX8A 4DHVA 4EFAC 3FEYB 3HSZA 1JLCB 1JB0C 4M5LA 4Y0FA 2YNGB 3NWGA 3ETOA 1B0PA 3DFEA 3UCUP 3IWNC 2BRKA 3BYRA 3ET6A 3NP5A 2KO1A 5KFAA 1G3OA 2MKHA 3MPVA 2Q3PA 1U48A 4B3MF 4RBVA 4JV2A 1VHIA 5ETPA 4EO6A 1T9YA 4TQSA 2HNZA 3U7JA 2M5YA 4OHXA 4AXIA 4IO1A 4LIWA 5LXYA 2XY7A 3RAQA 3NNCA 3KNGA 3KNAA 2IVMA 2D3UA 2DGUA 2XMUA 4OL8A 3DDNA 4FVCA 5DGAA 1RT7B 3IWLA 1IKXA 3TUJC 1KWMA 4KHPJ 2ZBRA 2RNEA 3KJVA 4OZ1A 5CZVA 2FJVA 1MROA 3EUNA 2B9YA 2EFGA 2OEKA 5HI7A 1BQNB 3UVJB 5C2GA 4G1QA 4EYHB 2DHGA 2QFJA 3PY8A 2BJ1A 2CZ9A 3G82B 2CAJA 2VH7A 3VV2B 5IT9Y 3BBBA 4A47A 2OTLS 1D3WA 3ONQA 3EGZA 1S77D 4DV4J 3M4XA 4L74A 4NEZA 1U47A 4JI5F 4NPOA 1KP6A 2IJFA 4G1IA 5EGYA 2BJEA 4LFCJ 3P5TL 3CDUA 1T9XA 3AA9A 1N6QB 2DIUA 1M1HA 2L48A 1F60B 1V5IB 2K7KA 2E5HA 2EVZA 1NSQA 4LBPA 2BACA 1LWEA 2PT0A 2V2QA 2EK6A 1OYDA 4ILRA 1UVNA 2OPSA 3PNIA 3HO1A 2HVDA 3E8OA 4LRAA 4OLPA 5I42B 5KFXA 3KLHA 2AJ4A 1ELOA 3R3TA 2YQ3A 4H4OA 2P2CB 3I0SB 3VQSA 3CJSA 3NEKA 3M2RB 4DXLA 1VC5A 4DPYA 3HHLA 3MOZA 3Q8UA 2R8IA 4WK3A 3ENAA 5KFVA 4DUTA 3VF0B 3OJUA 2ZJPQ 2AJ1A 3CCMS 3R1HA 3D6FB 3VVTA 1HBNB 2B7BB 4OX6A 4OJHA 3R97A 1QSSA 4LSLA 2DR5A 1NKBA 1RWWB 1WSRA 3KDNA 3RZAA 4K0KF 3QIPB 3PKYA 4I0WA 3NS6A 4J9PA 4ILMA 2BJDA 4ILLA 4B3SF 3WZ0A 1NSAA 4QQBA 5HAOA 5GAHI 2W24A 1DQAA 4CLTA 1LK7A 2E7VA 3A3PB 4KPCA 5KFWA 3AY0A 5JVHQ 2ALZA 3DGVA 1XMOF 2JOQA 3FNNA 2YH1A 3RAMA 1XNQJ 3RAXA 1IKWA 1RCXB 2V69A 1XIQA 2RILA 2ZE2B 5GMDA 3CMES 4YY3J 1U1LA 4RU2A 4U6PA 1YITS 3RR8A 1P1LA 1VHFA 4CLZA 4I2QB 4OYAA 1B4SA 2UVVA 2E1CA 2YKNB 3MFHA 2JEFA 3MI7X 4I4BA 3VAFA 3VALA 2M9KA 4FBTA 1NM2A 2XS2A 2C28A 1MN9A 3RUBL 2A2CA 1H98A 1RT4B 2N4CA 2HYIB 2CNNB 1FRLA 2YKMB 4AL6A 2CG4A 1DRZA 3PEJA 2GVDA 1Q4RA 1UKUA 1WI8A 2FJBB 4CO4A 1TKDA 4Q0BB 6FD1A 3UQSA 1SL2A 2B5JA 2HS0A 5ETKA 2FJXA 3CJ0A 1YSJA 1CBKA 3I87A 4WK1A 2QMXA 2FVQA 1BHNA 1VRQC 1RAHB 3LP2B 5A8RB 4PYDA 2RVJA 4OHVA 4ZIWA 2E1RA 1FVSA 1A7GE 5HMWA 1DTQB 2HHHF 1S72S 4PQUB 3CDAA 4ED4A 2V0NA 5C42A 1S4EA 2OEJA 4N8NA 5EUHA 3TW0A 2E5IA 1KLMB 4QWCA 1Q78A 3A8EA 4WFNQ 2OO4A 2DK2A 3O8WA 3D1HA 4TY8A 4KO0B 3FFIB 1YHQS 1HR0J 1H73A 3HZGA 4FXDA 4JI6J 1K1SA 2VFSA 4DR7F 3FFIA 4KBIA 2W9BB 3EZUA 4F04B 1U7LA 4USIA 1KLMA 3V81A 3R7SB 3KUGA 3Q89A 4JB8B 2W01A 3W9IA 5C2CA 2VC1A 3D28A 1JIHA 2JL9A 4RW9B 4U8YA 4AD6A 2IM2A 2ZBQA 1SKRA 3CC4S 2CDRB 3BGRB 2B6AA 3BN7A 1M5OC 2XI3A 2W2NP 1MW7A 1KNZA 2VJVA 2B5JB 4I64A 3I5AA 1Q8KA 5KAKA 2R7VA 2VDHA 5ETRA 3UO0A 3ILJA 5HLFA 2GVDB 2JLFA 4NLUA 1WF1A 4NCAA 1AW0A 3MR5A 3BH6B 3KLFA 2O5DA 4ZKAA 3VTIA 4QZVB 4X66F 3AXMA 5HN0A 3M6XA 1JWWA 1KSPA 3BSCA 5LXRA 4B3TF 2ASJA 3I4HX 3KK2A 1YBAA 3C16B 4PKDB 3BSOA 2DD8S 3MEDB 4TVAB 1RP5A 5HQ8A 3KLGA 4ECSA 4B9NA 4E2FB 2NQPA 2DHXA 5FDLB 2OKQA 1ZA2B 2E9TA 2AGOA 4DR5F 1EAYC 3SBMA 2KG1A 3T3FA 4WKRA 4PR6A 2H4YB 1C0TB 3BGUA 2G1HA 2KU7A 1DTTB 5D8HB 4MFBB 2O67A 4C48A 5AJ3F 5HSPA 3G4SS 3CB4A 4ZLNA 1T02A 5D0HA 1UPPA 2QX0A 2BOPA 4DG1B 3JTOA 3LA0A 3GU0A 5B08A 2LEPA 4OMFG 4LRCA 2RQMA 3UWTA 3T5LA 4I1TA 2KG0A 4PG7A 2OIHA 4J7CA 3Q2TC 5IT9U 3ZZTA 2L3MA 3SDEA 3S1TA 2JLGA 2MZJA 2ZH4A 2DH8A 4WF9Q 1J5EJ 4BDPA 5L1KA 2JJ4D 5A2QY 4C9DA 4DCPB 4OHYA 4IG0B 5A6WA 2EC0A 1U0SA 1ZAWA 3HHEA 4OI2A 4ES2A 3HHLB 3R5DA 5HMZA 1SB6A 4R5PA 1HQ2A 1S6QB 3J7ZT 1NH7A 3I0SA 1TVRA 3IRXA 3I9V9 3SQGA 1UWBA 2CPZA 1M5SA 4ED7A 3CO9A 4ED8A 4DR7J 3Q24A 1S0VA 1ACMB 1O6XA 5C24A 1LWEB 4CLPA 1E6VB 1HWJA 2ZBIA 3QT8A 1VK3A 4RO0A 2HEKA 3E51A 4OI6A 4ANCA 2C2RA 1SJ1A 2E1PA 5J2PB 3QSYB 2UVWA 4GO5X 2VPXB 4K4TA 2XLJA 1M1GA 3DLJA 3S01A 2G2YA 1YBTA 3U27A 3T6BA 2V4QA 4OX9J 4C8OA 1VYAA 3TNVA 4DU8A 3E01B 1T0TV 3IN5A 2AEMA 1NKCA 2CJ9A 4IFYB 2ZUAA 3BQ1A 2V9WA 1SVDA 3R2CJ 2CJKA 2B4OA 1YJ9S 2KVQE 5ETNA 4MYUA 2XLKA 2HBRB 3LTOA 2OH2A 4J9LA 2KH9A 1W2IA 3LGHA 3G6XA 4IG3A 3T6JA 4YR2A 2ACYA 4G1QB 3TP2A 3TOQA 1DTTA 3AD7C 1EP4A 2HIYA 3FCWA 5KOXA 5KFEA 1EKSA 1S57A 4WCEQ 2C2DA 2OTJS 2YX7A 1VQ9S 4O3RA 1S76D 5KFNA 2NCKL 3KLIB 4JI2F 1R43A 1S79A 2VFVA 2M0GB 3W61A 5GAEU 3K89A 4PXEA 4B3TJ 2WVEA 2HS3A 3N28A 1RZMA 4CM0A 1VK8A 4QWDA 4EBEA 4DV0F 3MXHP 5F8JA 2VUGA 4ZDNA 3QRPA 3CCUS 1WOPA 3UE2A 1R8HA 1RU2A 1H72C 1RQ0A 1CC8A 2XMWA 4J37A 1G7CB 3VHQA 3WIVA 2A18A 1BWEA 4USVA 2OD6A 1RA7A 2ROPA 2HSEB 2HQ3A 3QGIA 1JJHA 4QCLA 2YQ0A 3KLFB 2XG8A 1FKPA 1XR5A 2RKIA 3IMQJ 4YB5A 1RWKB 2ROEA 3ZTOA 1TKXB 2B56A 1SUQB 1LFWA 2GHVC 2OHDA 1WF0A 2HNYB 1PYOB 1JLGA 2JZ5A 4I69A 5L1JA 3RB3A 1XK8A 1WC6A 4Q5VA 2CPEA 3KHHA 2LEBA 1TMJA 5EX3A 5F3TA 3V6JA 1BGXT 4DL6A 3UR0A 1PJ7A 3W60A 3GIRA 2UU9J 5ETLA 4AXJA 2CQBA 1ITPA 1HWIA 5GAHU 3BM7A 3DLEA 4DL4A 5DLFA 5DQGA 2VPWB 1CLFA 1GMWA 5BXIA 2HW3A 3RRKA 5KFYA 2YQ1A 2KT5A 2AWZA 2VICA 2KJWA 1RT6B 3HFVA 4H4MB 4Y34A 3M8WA 1OJ4A 3BV8A 3T41A 3SSRA 4TY8B 2OLWA 1JNRB 3TEGA 1NLKL 3HX9A 4DL7A 3D6MB 2ASDA 4ZCKA 1WG1A 3PFOA 3T5JA 3D2WA 4C6AA 1RACB 2RAQA 1QVGR 3G71S 3G6ES 3B82A 3K57A 3H2LA 5DG7A 2ZEJA 2MKCA 2BE2B 4Q2LA 3M8QB 4JI7J 1DTQA 1N5TA 4P7VA 4ZK7M 2VQEF 2HRYA 3LP2A 3CDBA 1HHSA 4PWWA 2JVOA 2JC0A 1YRUA 2IM3A 2CJYB 3PYEA 4JI5J 4JV5F 2M70A 2DNPA 3KHLA 4P2MA 2LQBA 3W5ZA 3QFWA 4EZ6A 1KFDA 4PZVA 4MFBA 3VGTA 3MR2A 2HKEA 4IOCQ 1TL1A 1YLXA 2RU9A 1RBLA 1X4HA 4MK8A 1L3TA 3RBZA 2YX1A 2R4FA 2SXLA 1HYSB 1TR0A 3QZ7A 1SKUB 3K8WA 5J2MB 1VQNS 1HQUB 2J8SA 2G13A 3V6DA 3CT9A 4O4GA 1WI6A 3MZIA 1FJEB 2MQLA 4IH6A 1OY8A 2GIFA 4ZVTB 1L5UA 3MM6B 1S1WA 4FYVB 1GX5A 5D4OA 2B0GA 5BYSA 1T3NA 1GNKA 2MJUA 1U6FA 3PYDA 3CD7A 3W2VB 4A8XA 3T5HA 2UXBJ 2MQMA 1GH8A 1HYSA 2J6UA 1UEKA 3GYGA 3O1LA 5D4PA 4A8YA 1X9SA 4RW8B 1PSDA 1TL1B 1T11A 3TA0A 5LJ3Y 2POKA 1Y9OA 1D0EA 3HVTA 3H0PA 3EZ5A 2RDDA 2HIQA 5ITHA 1FKAF 2J0WA 4P52A 2PN6A 3QIPA 4W98A 4ELTA 1BE4A 2XGPA 1VRTA 4ZP7A 4CRJA 2G1DA 1YJWS 2JWNA 3UPFA 4L75A 2QA4G 1IBMF 4RW4A 3BR8A 3PZPA 4L76A 2LQ8A 1YJTA 1TV6B 1XERA 4RW9A 5DM7Q 3EPGA 2IIHA 1NSKL 1KOHA 1KQSR 3M2UB 4C7QA 3H42A 1IWGA 3A8KA 4RNNA 4ZA1A 3CXCR 3MCMA 3PYGA 1LXJA 2GAHC 2UV8A 4QIWD 3CSKA 1QY7A 1VBZA 3DXBA 3VAHA 2D69A 1TKZB 3EVOA 2YBVA 4I68A 3U1LA 3U02A 5IM0A 4I56A 3MAQA 4GC7A 1KVKA 3BQ2A 3T19A 5C42B 4OV6A 4C3MA 2HBYB 2E66A 2RQCA 4Y28C 1I6JA 2HBZB 4C8ZA 1FK9A 3QWUA 3P4UB 2AIRB 2DT9A 4QU6A 2DPJA 3D0IE 2PI4A 2LDIA 5L46A 3R9LA 4IOAQ 2HZAA 5EX0A 3S8SA 4B9UA 4N76A 2ZFHA 4BBYA 2G4BA 4Q0BA 2VZ9A 3BGOP 1UFWA 2FC9A 2ZWOA 1R8AA 4MIWA 4O3NA 1XMQJ 2FQQB 1RTDA 2LQJA 1WG5A 2KT2A 1Y10A 5A8WA 2AGQA 4IQXA 3MMAA 1DLOA 3ZNUA 2XB2D 2XS7A 1CULB 3SYZA 1BQNA 1QVFR 4Y65A 3ENWA 4J9MA 1H74A 4O3QA 3QATA 3CC7S 1YTYA 1HLWA 3PKMA 2WOMA 3IR6B 4NRTA 3KK1A 2ZH6A 1VQLS 3LPYA 4LF1A 4NLYA 3KFWX 3MEEA 2H5IB 4RNHA 3GILA 4KIAA 3HT3A 3RRGA 1VI7A 4WZQA 4B9LA 1HI1A 1Z2ZA 2CQ1A 2DGXA 2IYGA 1X4FA 5F8GA 2GHWA 4QR2A 4ECUA 4B9SA 2IRXA 1B0TA 4N56A 2E7WA 5CHCB 4RNMA 2APOA 2K1RA 1MSWD 2I1RA 3SFUA 3H90A 3GQCA 1LWXA 3J80Y 1IBKJ 4YB1P 2N82B 2IDEA 3KXDA 2W2PP 3H7HB 1EB0A 4J91A 4PEOA 1U1QA 3HHNB 3I55S 1A6LA 2WONA 2VQEJ 3Q83A 3I6PA 1S7HA 4YP3A 2LXIA 3E01A 4IYQA 1BWVA 2ZDOA 2E5LF 1RBOB 2WW4A 4G1PA 4X4SA 4MKYA 5H9FK 2HHPA 3QRQA 1RLDA 2B51A 4DUZF 3ENQA 3LP0A 2DGWA 1FDAA 3TR5A 1U2CA 1ROFA 1PG5B 4QW9A 5AXKA 5GADI 4RW7A 1Z1ZA 4LSNB 1NJYA 1WOSA 1XQIA 2CRLA 2YY3A 3LGNA 4LBIA 3G2XA 3MWBA 3MR3A 2V9KA 3AOBA 5CAAA 4K4VA 4I2PA 4DV6F 3VGVA 1R3NA 4ED2A 2P8IA 2WHOA 2J7KA 2O3DA 4DCOB 1VOMA 3A8JA 3R1LA 1S0NA 5K9FA 2R3VA 2VDIA 2IJRA 1R27B 3IBFB 3S6EA 4KFBB 2CQ3A 3C2PA 4LF6J 2WTFA 2ZZNA 1S1UA 4QWBA 2LVWA 1Q95G 5KG4A 1JMTA 2GFFA 2ILZA 3PIPQ 1RXOB 1B7YB 3EXCX 2ZH3A 2VQFJ 4DI6A 4ED6A 4PRFA 5CD4H 3C6TA 2Q43A 2XCPA 5M2RA 5LSRA 1IR0A 2RS2A 2Q6CA 1YDLA 1P9YA 4ITSA 3UVJA 2H51B 2GIQA 3P8BB 4RR5A 3HVWA 4U8VA 2KFYA 4X64J 3MGJA 1GXLA 4R0JA 1K44A 4ES1A 1HNZJ 4DSFA 2R7QA 2VBZA 3Q22A 2WVDA 2FTRA 1TU0B 4DV7J 3MM5B 5K8PA 2YNHA 5D0EA 1FFSB 1VR6A 2BKNA 2EFOA 4ZPBA 2AJQA 2EBGA 1APSA 4HDGA 1NPPA 4DMZA 4NXMJ 2DR6A 1FJCA 3TZWA 1FEEA 1IKVA 2CPIA 2GQ2A 1J27A 3PHEA 4PPZA 5A0YB 3GSIA 2B9XA 3GFHA 1P1TA 5CYQA 5KFMA 3ET6B 1YBUA 4DV2J 4DUYF 4ECXA 4XK8C 3PX6A 2IYIA 2RSQA 5E41A 1SIWB 4OYXA 3PW0A 2EG1A 5HLFB 1RHRB 4C0BA 4ICLB 1SV5A 4LF5F 4KT0C 2IM0A 2CQHA 6AT1B 1W26A 2AW0A 1N32F 3R27A 3BGRA 1S1VA 5IV3A 1VQOS 4EGLA 1NHVA 2HQIA 1KOOA 3QFHA 3X1LB 5E3CA 2KN4A 4ZP6A 4RBTA 2RH3A 4MK9A 4ANEA 3G9CA 1SBRA 1AZSB 4G6VB 1EKRA 2XS5A 4OI4A 2C22A 4JI6F 4CLKA 2D7SA 1G6BA 2CJXB 3NY0A 4M5DA 4C3KA 3ZTSA 1R6VA 1PYSB 1U1NA 2D3ZA 4KGXB 1VGYA 2R7SA 4RNFA 3MURP 3FEZA 3W8GA 1LKZA 4OJGA 4N47A 3VAGA 1SIZA 4PXDA 4EWTA 4DF8A 4B3RF 4PQUA 3HHLD 1UJ4A 2WRMA 3CCWA 4QWEA 1IKYA 1N0VC 3L3CA 4F0KA 1Q86T 2EKNA 1T9WA 1TZ0A 3D9BA 4NLOA 5KFCA 3J80U 1FWKA 3MMCB 4JI0F 2C42A 2EFVA 1KQGB 3HSDA 4IQMA 3ENVA 2MKKA 1R8BA 1WC5A 1TFYA 1N48A 1C1CA 2RQ4A 1K0TA 1NHUA 1MMLA 2OEMA 5L39A 1W25A 2IRUA 4MT1A 1VQ5S 1YJNS 4GVBA 3NGDA 4K2JA 1GMWD 3QNWB 1UVLA 2XMAA 2HAFA 1JQGA 4BC9A 3TANA 1YIJS 2FJWA 2LYVA 2FIUA 5J2QA 2JEJA 1F9EB 2XBPA 4RLEA 1C0UA 1NK4A 4Q44A 1ICEB 1D9FA 2HWIA 4C11B 1T03B 1X7VA 1IR1A 2LA4A 3UFCX 3UN2A 3T1YF 2LU2A 4LF7J 3VWSA 1CVJA 2QGFB 4MJKA 4LFAF 5LJ5Y 4D3GA 5T14A 1OO0B 1M1KT 1JKHB 2OMOA 4KYZA 4DR1J 1OSCA 4CO2A 1HNXJ 2KTQA 1JK9B 1GEHA 3CJ2A 4OZNA 2KXHA 4CNZA 2GQCA 2H1YA 4FPIA 2HQDA 2CG8A 4WFYA 1RWVB 5K8MA 3GJTB 4LIRA 4Q7AA 3ZZZA 3WQPA 4B17A 2ADBA 1T9UA 4L72B 3DLGB 3MCOA 1HBNA 4L6V3 4C8YA 2MGZB 2A10A 4KB7A 2VG6A 1XBWA 1ZOTA 3ICLA 4ZVGA 3V4IA 2DR7A 2VODA 4P72A 3FZ2A 2AZ1A 2BQUA 5JUMA 1F1BB 2FYXA 1S99A 2IPOB 5EHHA 4M8LA 2IA0A 1LOUA 3LPEA 1QUVA 4GVLA 1X5OA 4L73A 1QAYA 1XWLA 4DV3J 2X1FA 2EI5A 2PD1A 2P5VA 3DRYA 3LALA 5G0RB 3C19A 4S0MA 3L7PA 2ATCB 2XEXA 3M9NB 5I3QA 1GXTA 1S4FA 5K20B 1S48A 2FGOA 1QTMA 3UNGC 2ERRA 3QGGA 2DNZA 1N6QA 1XC9A 2NZ4A 4OI3A 2DR9A 2AJFE 4F4ZA 2JVRA 3MM9A 3CF5Q 1W2BR 5E3RA 3GFYA 4IKAA 8ATCB 1N36J 3ILOA 1FJ7A 4FXVA 3EXYA 1U8WA 2OPPB 3MM8B 1NJZA 4UY85 5KG0A 1FJGF 3CMQA 3OJSA 3GIMA 3N6MA 4OZ5A 3G82A 4B3OA 4ZVEA 5J1EB 1TK0A 2YKAA 3I31A 3PRDA 3TVZA 3VZHA 1T7PA 4NASA 3OLBA 2EBEA 5DQIA 1H0HB 3AA8A 4DL2A 1RTZA 2F8HA 5THWA 2VBYA 4DV5J 2R7UA 2HBQB 1TUGB 3BSAA 4O3PA 5L9XA 2MKIA 3SI8A 2JEGA 5KFOA 3M8PA 2WB4A 1VBKA 2HFSA 3FCHA 3MD3A 3NOCA 3JSMB 1HWUA 4ZVQB 1PGZA 1C4CA 1RWPB 1YRTA 2QEXS 5LSOA 1XMOJ 2CZVC 1JLFB 3IS9B 1X4BA 1J5OB 3GPAA 3WC2A 3TX8A 5F41A 1JLAA 1JLFA 2F65A 3IS9A 1J5OA 1FXDA 1VQ6S 1SL1A 3AT1B 3CNQP 4YB7A 4A8SA 3TQEA 1HQEB 1ZM3A 3A3NB 1YK9A 2CQPA 3SCKE 1M5HA 3X3UA 1YZ7A 1F9HA 2OPQB 3N5BA 4WP8A 5FLXU 5JVGQ 1HNWF 3WX4A 4BHQA 5J2NA 3N6NA 3WC0A 4XTTA 2RRAA 4O3OA 2DCUB 1R89A 1RT5B 2EC2A 1YX2A 2MDAA 2RRBA 4UUXA 3TAMB 4JBCA 1RYRA 1KD1T 2E7XA 1MWQA 5CXTA 3JQKA 2W8KA 4CH1A 4OZJA 2MQQA 1NDPA 4B08A 2UXCF 2OUGA 2VA3A 4OYBA 4A8QA 2FZGB 1VLYA 2V68A 3EDRB 4WU3A 3OVBA 3K17A 1U0HA 1KBRA 2ZUGA 4Y2CA 3ZZYA 5DG9A 1CEZA 4NL5A 3KLEA 3N4WA 3KDOA 2EPIA 1JLQA 1FE4A 2LXUA 4B3RJ 2MMYA 3PACA 3IBCB 2RF2B 5B0AA 4BC7A 3K58A 4ZVRB 2OPRB 2K3IA 2FGCA 3KJNB 2CDQA 3D66A 2W9AA 3AH6A 2HRTA 2HZCA 2HHSA 2M8HA 1HARA 2W2OP 1FXRA 3DYAB 4R8UB 1P6TA 1CJTA 3OTEA 5B09A 1J2VA 1QE1B 1F3FA 1T95A 1ZZFA 2I9SA 3IGNA 4WFBQ 1IBLJ 2I0XA 3IAM9 2HHTA 3FEXB 4FP9A 1RCOB 3MMBA 4LF8J 2J76E 2V50A 3T1HF 2FHJD 4HT5A 5HP1B 5K14A 3GIJA 5KT4A 3QAEA 2C3YA 4QYZJ 5AXLA 3DNCA 4ID5B 2RDJA 3J7YU 3THPA 2W9CA 2HHUA 1ZPVA 3AOCA 2RQKA 1TK5A 3IRWP 2LECA 1SC3B 4HI2A 4QPXA 4C8LA 2DBBA 1WUUA 1B7FA 5F8IA 1XNRJ 5LSLA 1DQ9A 1YGYA 1UVMA 4YB6A 5HJXA 5D15A 1WKLA 4ECTA 1NU4A 3NCQA 2GJFA 3CJ3A 3POTA 2QZ8A 3IAS9 3CCSS 5A6PA 2O01C 4TKTA 5AE2A 2KXNB 5D78A 1PYTA 4F3OA 2QMUB 3M05A 1H2VZ 1QJHA 4CO5A 1Q8IA 4ENOA 4C11A 5D3GB 5GAGI 5D77A 2JFDA 3BZQA 5DRKA 1SH3A 4DPOA 2JFKA 4OYOA 4KHMA 5I3PA 3J7A1 1AT1B 1UEVA 2AEJA 2F5GA 3CULA 3HD1A 3I0RA 3EM1A 4HDHA 4BWJA 3EGNA 4ZPWR 3JAMU 2YPYA 4OFZA 3OL9A 2P9EA 2LEAA 3AD8C 3GB0A 4X64F 5CABA 3ULHA 1V3ZA 1URRA 3QYYA 1YJUA 1LW2B 1Q1KA 4NEYA 1RT1A 3DGPA 3R5AA 1LEOA 1RAEB 1Y3KA 2QYCA 3D68A 3CD5A 5L9NA 4K4ZA 4M5HA 4USJC 2DNLA 2JRSA 1CJTB 3FVYA 2L9WA 3SEOA 1KLNA 4DR4J 1TTHB 2RMLA 3QLHB 2ALYB 3CJKA 4Y00A 2QYGA 4FNIA 2FJAB 3DLHA 5EWGA 3QJJA 3OVAA 1WG4A 2Y1LB 3RB4A 4J90A 4PUOB 3PRBA 2WK4A 2C2MB 1RTJA 3KLEB 3NGKA 2HQCA 4TNOA 1T8EA 2GA7A 4CZCA 2YWHA 2VPZB 2QL9B 1N88A 3GSDA 1MG7A 2BUNA 3HULA 1P9QC 3QGPA 1VCTA 1S9GB 1UZDA 3HVAA 5KFIA 4CTAB 5HROA 1CJKA 2VKZG 4FN5A 1U2FA 4WIQA 2VL1A 1B99A 5IV4A 1F5BA 3M8SA 4URSA 1FFWB 3OSNA 1S6PA 3I96A 4DLEA 5C5JA 3G86A 3MEKA 4ZS6A 5IOLA 5J2NB 1WJ9A 1NK9A 1UW9A 4DWIA 4GKJJ 2H65B 1XN9A 3S7RA 1GT8A 2BM0A 3P5BP 4JV0A 5DLGA 2LKZA 2U2FA 2ZH2A 4FKYA 1WC3A 2HLUA 1UEUA 3PM9A 2UV8G 1JLAB 1P27B 1U1MA 4Y2KA 1IQTA 3CJTA 1IKVB 1NPRA 2P6SA 5A0YA 3MR6A 3BH7B 4JYAF 1TKTA 4LT6A 2AJ0A 2Q79A 1N34F 3EWGA 4NI2B 1H38A 5IC4B 3H98A 1RHUB 3M8PB 2CXEA 4NLPA 1R0AA 2A1BA 3JTPA 1IXKA 4MTPA 4OX8A 1XNRF 3ETMA 2DXEA 2RT3A 2XZTB 3MHYA 2BKPA 2QLXA 2BMBA 3H5SA 1U2RA 3A12A 1HBMB 3IP0A 1ZM4A 5HQLA 3BS9A 3KKFA 3VR1A 1NB7A 1G4CA 4B3OB 1NDLA 3GR1A 5F9NA 3OBIA 1TUVA 3PTWA 3QIDA 2G2OA 3RW7A 4CWBA 4ETZA 4PQAA 3N01A 4MKAA 2L41A 3KJFB 1YVFA 2DY9A 3CWJA 2V63A 2ZDPA 1RYSA 4C98A 4ZJLA 3DYAA 3HDSA 1WHYA 1QAIA 4DZDA 2Y8YA 4CQ1A 1VQ4S 3MUVP 2VJUA 2IBKA 2D9OA 3JSYA 3GJRB 3EX7B 2CQDA 5C25B 3TO8A 1V3RA 2GS8A 4FYWB 3ISND 5I4MA 2KHDA 1WHWA 2AEFA 4Y6IA 1KS2A 4DCJB 1PBAA 3DOKB 4DN9A 2Z2ZA 4U7UK 1KVIA 3F44A 5L1LA 3NMRA 1V3SA 3N5FA 1TQLA 4X65F 2QJ3A 2IM1A 2O1PA 1R0AB 2ZOMA 2KFNA 2VV5A 3GCWP 2GW8A 2NSBA 2R2UA 4TY9A 3MCSA 1FDDA 4H4KC 5F8HA 1VQKS 2PC6A 2WAQD 2Z2LA 4KHRA 1YRXA 3DOLA 1R31A 3Q8QB 1X31C 5I3UB 2OPQA 5KG1A 3RB0A 3GR0A 3DHWC 3FMWA 5KFBA 1K73T 2GIRA 2EWHA 1N5YB 2I6WA 1HQEA 3JYTA 4FZVA 3NAHA 1IJFB 2V4JB 1PC5A 1TKTB 4QW8A 1VQMS 1DBDA 2N3LA 1EZZB 3LANA 2XZWA 1HA1A 3K5NA 2UXBF 4URQU 2DCLA 2PI5A 1NRKA 3O5TB 3RTVA 3AHPA 1UAWA 1HMVA 2IC3B 4CCHA 3JSMA 4KR0B 1MU2A 1NCLA 3KK1B 1C0UB 2VBXA 2X7IA 3QGHA 1BD6A 3W9JA 4AUKA 1Y00A 1VIXA 2Z0GA 1FTRA 1U26A 1ZM2A 2RJZA 3MPUB 1T3OA 3FRYA 1KDNA 2KFZA 4LF9F 3W5YA 3C15B 3CUNA 1D8ZA 4RUBA 1MMNA 2F4FA 2Y0BB 5DETA 2J9DA 1V6HA 5HMYA 4HI1A 4MYTA 9ATCB 5HROB 4DR2J 2OPPA 3CTRA 4NLGA 2DXFA 1BQXA 4DV1J 1R7IA 3EE3A 4JV5J 3NGSA 3MM9B 4ZPVR 2Q6BA 1FFGB 3C6UB 4WPAA 2K2PA 5CCMA 3UD4P 4AL5A 2DHAA 2OP5A 4X84A 1LXNA 1FKOA 2D9PA 1S1TA 3TX0A 4F4WA 3I5CA 4P74A 4PWUA 3HMJG 1WNEA 3OTOF 1VQ8S 1VQ7S 4HEA9 2ZM6F 1ZAVA 4O0NA 2LFVA 1N33F 1RTIA 2LLZA 1FWPA 3KJQB 4TLRA 3JB9k 4F2SA 5DJBA 3M9MB 4GKKF 3ISNC 3OLAA 1CS4B 3ZO7A 5AXMA 3IR7B 4DSJA 5B7WA 2CNOB 3FGVA 1WACA 1X9WA 3VGUA 1AZSA 3D4JA 1RT1B 3GMGA 5GVQA 5B0EA 3SZ2A 3T9NA 2E1MC 3IM9A 3VCDA 3Q8VA 4I6WA 1IWAA 2GX8A 2VG5B 3U1MA 2UU9F 4EK2A 3NCRA 4NLQA 3A8IA 2ZJRQ 5L8RC 5MAOA 2RHSB 2DKOB 1ZH5A 4TLQA 4MKBA 4ZVSB 3BJYA 3DC2A 3I56S 5IC6B 3BF4A 5JXSA 1Q8BA 4X4RA 4ICLA 2Y1RI 5HATA 2HGMA 1QD1A 5GAEI 3M9OB 2OD4A 1VBYA 1N4LA 2NXUA 2UUWA 2N3OA 4WTYA 4M94A 1JKHA 4LREA 4RW8A 5KT6A 2ZKUA 1FDNA 1OWXA 2XYGB 1SXLA 4HH1A 4FYDA 2NSCA 2QV6A 2BOAA 1VRUA 2K3KA 2GMHA 3CDWA 3RBXA 3TJAA 5HQMA 4X62J 3J81U 1N5VA 4DR3J 2XLIA 2KZZA 3IGVA 1VJQA 3MFIA 1AYEA 4YEAA 2Z58B 3A1YG 3FBCA 2BW7A 2E44A 3TUIC 4O4GB 4W92B 2YNHB 3EICA 3MM5A 5ETQA 4C8MA 3LP1A 3T1AA 1UWAA 4UF4A 1U02A 2I2YA 1KN6A 3VGSA 5DDRC 1RTHB 3N0VA 1JJCB 2HFNA 1Y5LB 3ZZPA 4WZMA 3FRZA 2GAGC 4YDDB 1FJGJ 3V5RA 3DHXA 4OZLA 2KRBA 2VASA 3MMBB 1ULRA 5FD1A 2MPUA 3UW1A 2KYXA 3DXSX 4MMOA 1CJUB 3HCXA 3HHLC 4OYIA 1OMSA 1IKYB 1Q8LA 4DSKA 2ASLA 2XYHB 1OY9A 3CCES 4W4MA 1U09A 4URGA 3DI6A 2J7UA 3AAWB 4ZVPB 3ZZUA 4GKKJ 3DLLQ 4M5MA 3SV4A 2Z2MA 4DV3F 2E5GA 2W4CA 5ETMA 4ECWA 2GZOA 4M5DB 4QU7A 4NLWA 3NRBA 5HVHA 3R6GB 4YY3F 1S0OA 3B6BA 4J9SA 5DGBA 2DH9A 2CJBA 2HGLA 4RKUC 4FF2A 3M8RA 2ZOGA 2BJ3A 3QT6A 2J9DE 5KT2A 2XYPB 4LSNA 3CE8A 3DMJA 4OI0A 2CPDA 4A46A 4JI4F 3OR2B 2QIFA 3W8PA 1FRHA 2Z30B 2FZKB 3W1YC 1WSVA 4LBHA 2A0FB 1TK8A 3H2UB 2XY5A 3QJLA 4LF9J 2Y9HA 4NA3A 4P2FA 1M5PC 4NXNF 2WONB 4NZ6A 3QRRA 1TKXA 5HL7Q 1FKPB 2RE1A 2RKIB 3Q23A 1TL3A 1HNXF 4UOCA 4E8UA 1CJVA 2ZD1A 3GYNA 3D54A 3Q8YA 1REGX 3Q8PB 1HPZB 2K1RB 1UA1A 1WEXA 4DN0A 4Q43A 2HK3A 2MKSA 2ASYA 2NXJA 3IC1A 3A3OB 2BZ2A 3OR1B 4NYZA 5G4DA 5SZTA 3KMSA 3V6KA 3UN3A 2PA3A 2XMKA 3OL8A 3PW7A 2ZWPA 1L3VA 5IQ6A 2L08A 2IMOA 4IOBA 5E0OA 3NG8A 2WOMB 3SSQA 1GK8A 2VIHA 2XNQA 2R8KA 1SQEA 2CQ0A 3MPWA 4RNOA 3T1HJ 1HBOB 2QSFA 2HAIA 2UZAA 4UTGA 4UQTA 1EP4B 2R8GA 4X66J 1YQHA 2JLEA 2Z8QA 2H48B 2B8QA 3F0NA 4FYXB 5HBMA 3FQLA 2B8PA 2CJQA 5A8WB 1DARA 5ETSA 5IQQA 1F6TA 2AGPA 5F8LA 1REVA 3GFXA 3D0HE 2FDNA 4HTIA 4QR1A 3US5A 1BLUA 1FRXA 3JTNA 4JI0J 1YJ7A 1TL4A 2YH0A 4OZ3A 3HXMA 3WDOA 1IM4A 1KC8T 3K59A 1LWFB 3HPOA 1S1UB 2FUG9 1DHMA 3PO5A 4KFBA 1QDUB 2YNIB 4MAKA 1SH2A 4O3SA 1U6ZA 2NS1B 4KV8B 3T9ZA 1S9FA 4IRCA 4P10A 2RHQB 2OI2A 3MPYA 2DYAA 3M30A 1JXVA 4G65A 4DPTA 1TKZA 2MHNA 3G8SA 2DNRA 5J2QB 2BQRA 1UWBB 2KI2A 5DQHA 4DL0C 3GV8B 1TVRB 3DKDA 3O6QA 2UUAJ 4F02A 1S6QA 2P9GA 1GMVA 2HWTA 2MXYA 3P45B 1A9NB 1AB8A 4DSIA 3M2UA 1NJIT 2CA9A 5F3ZA 4A8KA 3PYFA 3K2YA 2CZ4A 1PJ6A 4IG0A 2MKYA 3MPDA 3HFZB 5CH7B 1K0VA 3C3LA 2MGZA 3MECA 4IFVB 3UDEA 1Q16B 1Q7YT 5KFSA 1S6UA 2X3GA 2ADCA 4C4WA 4PWDA 1F2HA 3SDEB 3KG0A 3DLBA 2E5LJ 2D41A 3ZZRA 1F0XA 4JI8F 2MJNA 4DF4A 1VQPS 4DOZA 1RAOA 3GIKA 4U96A 3GCXP 4K4WA 3UN5A 1IBKF 3NNHA 5T41A 3QO9B 4ZN1A 3RBDA 2KJVA 2V2ZA 4USMA 3ILIA 2B4UA 2DY1A 3CJ8A 2XI2A 2MQNA 1RAIB 4OJ3A 3W2VA 4WXWA 2FVCA 2BE9B 3DM2A 1T03A 4V1Ak 2DXDA 2WB1D 3IA0A 3MEEB 3KLGB 4DV7F 2IFXA 4RZRA 3KYLA 4Q2MA 7FDRA 4KSEB 1S1XB 5CCLA 4XDCA 5J2MA 4P2XA 1ZYQA 2PEBA 1DLOB 1FE0A 2ROGA 4CLWA 4K50A 2G2ZA 3FJ2A 2BKOA 4HT7A 2ZVSA 4ID8A 1T94A 1Y11A 1RLCL 3UCGA 1FRJA 4C8KA 4LR8A 3QT7A 3PEHA 1C1CB 2B4PA 4NZ7A 1HI0P 2AYEA 1FD2A 2DNYA 1QSLA 1XMQF 4ZN3A 2WW8A 2B43A 2XTJP 3MMCA 4OIXA 1F5CA 2J8AA 3C8YA 2F4VF 2B6AB 1WKKA 3HVRA 1OYEA 4J9KA 3DRRA 1QTNB 2FZCB 2BE2A 2ZH7A 3B78A 3CO0P 2FJDB 3EVWA 2BV3A 3Q2SC 4ZHRA 2XY6A 2YVSA 5HVGA 1WD6A 4M95A 3H5YA 1FTCA 1RHKB 2MLXA 4DX8H 1OS5A 4BWMA 1M90T 3MAAA 3I82A 2VA2A 4F25A 4Z7CA 5IFMA 2B9WA 1RISA 1F2GA 2RDIA 1W7WA 3VAKA 2A2DA 3EGWB 4NX9A 4LF4J 4TU8A 4TU7A 2CWXA 3LQVA 3ITHB 3M6UA 3MAAB 2BABA 2VB6A 2QL5B 4DQIA 3JXOA 3ZXWA 1SJ4P 2OFHX 1N33J 2DNHA 1WEYA 3LWLA 2ZM6J 4NMLA 1RHQB 4ZHRB 2R2TA 4RL1A 1JJ2R 4UOHA 3MEGB 4WXOA 4KGVB 5KFJA 3QJPA 1TL7B 2NXNA 3D67A 1WHVA 2GQQA 1NJXA 5A8RA 3PV8A 2YX4A 3KK3A 2UUBF 1VRTB 3BKUA 3H5UA 4NA1A 1N56A 1R0BG 4CO1A 2MZ1A 3TZXA 1JLGB 2QSWA 3I5BA 4DV1F 1SV5B 3LAMA 3MOJB 1WC1A 2C2OB 1UP1A 2EFPA 1Q53A 4ZP8A 1KHWA 2MLZA 1MWYA 3HVTB 3ZNJ1 3OV7A 2DVIA 2YKMA 1UFLA 4LF2A 2YNFB 1RT4A 3CW2C 4NOHA 2PE8A 1NPKA 2ZHAA 2D3OR 2MB0B 2XULA 3K5OA 5AE3A 4QIVA 4RWWA 2VG7A 1NZAA 2G0JA 2YWGA 2HMIA 1S1XA 1BMQB 1VBXA 4J9RA 4QWAA 4OJ1A 5ETOA 4IRDA 3EJMA 2XMVA 3EMTA 3L09A 3MM6A 4K5SA 2X1GA 4NYOA 1RADB 1Y7PA 4YN3B 5M2UA 4ECYA 2Q66A 2KVIA 2ZBPA 2F1FA 1HQUA 2V34A 2EEYA 1EETA 1OQ3A 3V6DB 1T9TA 1FHTA 3A13A 2YKPA 4UUWA 2DNMA 3ISZA 1FNMA 2DJWA 4Q45A 2DB1A 4DPWA 2EXUA 4CM2A 2KZMA 4MIAA 3TJ8A 2VHGA 2BDPA 2M8DB 1N5QA 3UR3C 2IVFB 4RBUA 4CLSA 2CUYA 1F3VA 3LUYA 2B3TB 1HI8A 2WSFC 2C3UA 3ILLA 4LF8F 2H54B 5KFRA 3CJQA 4EYIB 5LM7E 1IBLF 4R25A 1I1GA 2W7PA 1DURA 4PWDB 2JEIA 3TA2A 4QBUA 3M8QA 3RJMB 3FBFA 3W66A 2X3DA 4RUHA 1FDBA 1TAUA 3GJQB 3L7OA 2OGUA 3DRXA 4BLGA 4DQSA 2FLNA 4A8WA 4EUVA 4JI7F 5HVFA 3ZTQA 2OSRA 3W5XA 3IBWA 2C1EB 2E5JA 2J9EA 4X65J 2D3O1 2ATLA 3NNAA 1E6VA 3R7BB 4LF4F 3DU5A 3PW5A 8RUCA 3FC9A 2Z56B 1WELA 3M30B 4OZ0A 5LT5A 4X4NA 2KM8B 3PJ9A 4KV8A 2C3MA 3LP0B 4F7VA 3KHRA 4WWSA 5KFZA 4ELUA 4PABA 5F8NA 3D5MA 3R5JB 2B4VA 4YS2A 3C66A 4HHUA 4K2XA 1SQFA 1FRMA 3QAUA 4IUFA 2ZH8A 3R6LB 5IS2A 3GP9A 1I94J 3P49B 1H7XA 4DDFA 4OYZA 4KE5A 5H9FJ 1LWCB 3BGLA 3HJVA 2HWHA 4DR3F 3OW2R 3DDKA 4ELVA 1MROB 4OQJA 2HK2A 5LMUF 2ACMA 1UVKA 1GAOA 4PXCA 2M88A 4DFJA 2C3OA 5FDLA 4Q8FA 1RWOB 5HMXA 2WVBA 1PO6A 3G8TA 3FCVA 2ZJQQ 3KLIA 2A6MA 2RU3A 1RE1B 4N5SA 4F8RA 4OV1A 4DV5F 1VFJA 2DGVA 4C97A 4ECRA 3PVXA 3MR7A 2CVIA 3MDFA 3NWRA 4NCBA 2BYCA 2VG7B 3Q0AA 2J0QD 2FJEB 3DRPA 1HPZA 1PJ5A 1XR7A 2L9DA 1LWCA 3LW5C 3MMAB 3R5GA 4IG3B 2ZD1B 1KONA 1WHXA 2Z57B 3H20A 4KRWA 1GMUA 2PMZD 2CFXA 2E9RX 1XEZA 1JLCA 1RTDB 1UMJA 1YJVA 2WSCC 2EFNA 2IA6A 4WFZA 1NAQA 3BSNA 1B0VA 2QE5A 2W1BA 1NZ8A 2QFIA 3OSPA 4KH0B 2VC0A 2V8DA 2CWKA 5E3AA 2RUGA 3ZTRA 1RHJB 3KK3B 3DN9A 2VBWA 1TL7A 2XSJA 3I9ZA 4P6QA 4EO8A 4JUZA 4Z2XA 1FERA 4AE5A 4ZJQA 3CCLS 3KUEA 3MEGA 1Z4UA 4B9TA 1WEZA 2J5AA 2NYIA 3DMJB 2MTLA 4OX9F 4NXNJ 2PFDA 2CPHA 3M8ZA 1VQYA 3B4MA 2VFUA 5IM0B 3J7Z5 4UZBA 4QIFA 2FHKA 3FBEA 3SQGB 2NR0A 1ZTWA 1NK5A 5M2PA 2X1AA 1RT3A 3AB4B 4R5PB 2AX0A 1AA1B 2GGPA 3FUYA 4DPXA 1QSYA 3B4DA 1SJQA 2IAJB 3F73A 3CJRA 3G8QA 1N52B 3IFEA 3DI6B 1TL5A 4PYAA 1I3OB 1TV6A 3OXLA 3W65A 2J6SA 2YWWA 4M5KA 1S0MA 4ERDA 1O0PA 3DRRB 3U1NA 2LXFA 4LUBA 3IO1A 1U1OA 2DGQA 1CJUA 1VDHA 2NZCA 3BN4A 2I8EA 2YWFA 2N7YA 2ZZTA 4JP8A 4LRFA 4Y2AA 4Z7YA 2NPFA 5JMNA 3H8YA 2AD9A 3CJ4A 5E2QA 1UVIA 4F67A 4K59A 1RI7A 1CG2A 1KQFB 2FPHX 3FMBA
chains in the Genus database with same CATH topology
3W7BA 1RTHA 2FVPA 4A8OA 1X5TA 3NCPA 3LP1B 5KFQA 4ETXA 1EETB 4LF7F 2RD5C 3GWCA 3PDNA 4M1KA 3HFKA 1DJ0A 1S1WB 2HFOA 2JH3A 2ZE2A 3RB6A 2P9CA 2FHOB 3IG1B 3QMQA 2XGQA 3NMAA 2JC1A 4GC6A 2HMIB 4GO7X 1VRUB 4NZ0A 4QIEA 1F5AA 2GNKA 2FB0A 2B7CB 2YNFA 4WYLA 1HL6A 3RR7A 2H5EA 2UUTA 5B0DA 3UDLA 4K4SA 5B0CA 1U25A 2M3DA 4I7FA 4XPEA 1YI2S 4DFPA 3PO4A 2DIVA 4N41A 4LSLB 4O4RA 2YKQA 2FLPA 5F8MA 1RJJA 1LK5A 3HKWA 2V94A 3Q8SB 2IAJA 4QOTA 3V81B 2NPIA 2GGPB 1S97A 2IMWP 2ZC4A 2W9BA 4V19J 2HHWA 1UL3A 5KFTA 2M7SA 4H4MA 2GMLA 1RT6A 1N5SA 2XCAA 4KO0A 4NLSA 3KLHB 1X4CA 3H4BA 5I42A 1DZ5A 4H4KA 2CQIA 2OPSB 2YWKA 4KPYA 3OXGA 1RTIB 1NO8A 2DNOA 3FQKA 4KGMA 2DGSA 2CJAA 4F4XA 3T5KA 3I4PA 2XSJB 4A48A 4NLVA 3AB2B 4YOEA 5EWFA 5KG2A 4RU9A 4HH0A 2LQ5A 3GE9A 1LWFA 4UY8T 1FRKA 1SUQA 3OQ2A 1H3DA 1RT2A 5KFLA 4FNHA 4C2MA 4X4VA 4ZVHA 4ZPAA 3IXQA 5KFFA 3MUMP 1REVB 4YR0A 1BQMA 3C46A 4XO0A 2V8HA 4JI1F 1PC4A 2OJ3A 3DRPB 1UW4A 5ADZA 1GTEA 4I2QA 1FD8A 1HBOA 4FF1A 1QUPA 1UJ6A 1H6KX 4K5RA 4J9QA 1IKWB 2G0CA 1YJRA 2DO4A 4E98A 2PO4A 3GV7B 3ZZ0A 4IO9Q 1G1XA 4F4YA 4NLXA 1QM9A 3OR1A 3QO9A 4Y2MA 4IRKA 4X62F 3OTBA 4RUAA 2XNRA 2IBOA 3G96A 4PG6A 2V4JA 1TAQA 4YFUA 2MZSA 1VS3A 2E1AA 4LQ9A 2JHEA 3QZ8A 3H4DA 4Q8EA 5F0UA 5I3UA 1U1KA 4IFYA 4KQZA 2W7OA 4NWBA 3DOLB 1CPZA 5B0BA 4HTJA 2BQ3A 3CCRS 3MECB 4IFVA 4CNYA 1K8AT 3ZC4A 1KFSA 1HWLA 1M5KC 2N7CA 3VQTA 1AXQA 2M2BA 4DQRA 1MMDA 5J2PA 3M2RA 1N36F 4OHWA 5C24B 5MLCV 2FVSA 4FPRA 5L38A 1GX6A 1HR0F 3SV3A 4DL5A 4B9MA 3IRXB 2CQGA 4KC5A 1BY9A 2DNKA 2QA2A 2XHWA 4ED5A 4PPDA 1E6YA 5C25A 1OQ6A 2R2SA 3IWXA 4A8MP 2WCXA 2AYBA 3AJ2A 3CCZA 3TQ1A 4F4KA 4U9RA 5SUHA 4K4YA 3JSBA 2KM8C 3OXFA 5BJRA 1NJWA 2ZOFA 4MIBA 2X51A 2ZH5A 2PGCA 3D0GE 1VC0A 1HFEL 4CT8A 3NBPB 1U24A 5AXNA 3LO3A 2R2RA 3PX4A 4DG1A 2C2EA 1C1BB 2NREA 3K5LA 4DEZA 2AQ4A 1C0TA 2DISA 2DITA 4DSLA 3KJVB 4U7CA 2FHMA 3MTKA 1RT7A 3HZEA 4TXSA 3KG1A 2F3JA 3NAIA 4RW6A 1XNQF 4KHPF 4F26A 3MEDA 3N79A 2OFGX 1RAJA 2HNZB 3P96A 1DQ8A 2P6TA 3OFHA 4RX6A 4ZP9A 1LW0A 3KK2B 3CCJS 5H9EJ 1D9DA 1S6OA 3J7YI 2OAUA 1U49A 3LOUA 1U45A 2Z4PA 3AJ1A 5EWEA 2CYYA 1D1UA 1R8PA 2YNGA 1HWKA 3KOAA 4K4XA 4N77A 3OFGA 4FS2A 4EEYA 1HNIA 1HNVA 4L3NA 1KVJA 2CPXA 5KG6A 3BO2A 3HJFA 1MWZA 1U8SA 3DRSA 4NLRA 4EBDA 2IVYA 3M6VA 4F50A 1JJ4A 3BB5A 3GIIA 2F8MA 3RW6A 1S9GA 4ZMMA 5IT0A 5F9LA 1H2UX 4NYPA 2GC8A 2LU1A 2XWYA 2BBEA 3ITHA 3FZBA 1SI9A 5KFUA 2GHPA 4LMZA 4ECQA 3HHDA 1Q82T 3M1VA 4ECVA 3K5MA 3E3XA 1VQSA 3THTA 1U6BA 1O51A 4X4QA 3CVKA 2FVRA 1X4GA 2FHJA 2CVEA 2KKHA 1TFWA 2CIMA 4XAKA 1S1TB 4QR0A 3FDSA 5EDWA 1VIOA 4OHZA 3SXLA 2DGOA 4X2BA 4DR2F 5D6GA 1LW2A 2FD2A 3DLKA 4AYBD 4X4OA 1NH8A 1JNZB 1N8RT 4W90B 4XDDA 4LVNP 1FO1A 3V2UC 2JX2A 2DH7A 3OFEA 4FF4A 2I5JA 2GJ2A 2YKNA 3K7RA 2RB7A 2IHR1 2K8GA 3PIOQ 4JOUA 3PJWA 3N6LA 1SJ3P 1KHVA 2VFTA 3LAKA 5BYQA 3BO3A 1T05A 2EFQA 4DV2F 1OPIA 2HGNA 3DM2B 1KRPA 2U1AA 4HVZA 3H25A 1Z2LA 5FJ4A 2HFZA 2LQ9A 4DFMA 5GMKa 5KG3A 5U47A 4NCGB 4NXMF 2AYMA 1O8BA 4UW2A 3VAIA 2R8JA 2ZZMA 1KEKA 3JYTB 4WIIA 3V4MA 5IZHA 4WE1A 2K7JA 4C0HA 2IJNA 3BDEA 4ZPDA 3VR1A 4QIGA 4M63A 4ED0A 4ID5A 4R0EA 2DRAA 2VG5A 4MH8A 1HW9A 1IN0A 4HHJA 2C3PA 3VZIA 2EKYA 1FF2A 5E3QA 4O23A 1ZZNA 1FT8A 4E0DA 2KHCA 4IDKB 2MHEA 2LDYA 3KHGA 4DQQA 1FRIA 5KG7A 4H4OB 4IR1A 4R8UA 2UUCF 3HLUA 3M2VB 2HVIA 1NK7A 1CQNA 3TA1A 1D8YA 4FF3A 1Y5NB 3NL0A 4WU2A 4J5OA 1XMBA 2EG2A 3CPWR 1X5PA 1SC6A 1ZBTA 4DS4A 1FKOB 2HS4A 2YNIA 5K5MA 3P6YC 2H9ZA 3PW4A 2VOPA 1XR6A 2CKWA 4ZPTR 5DDQC 3BQ0A 3HK2A 4DR4F 2Y1IA 2Y0SD 4V19X 1UETA 2PA8D 3K5PA 1R8CA 4XIUA 3JAMY 3UD3P 3UCZP 2ZH9A 5DDOC 2DNNA 2HRUA 5GAGU 4K4UA 1U1PA 4TYAA 1HW8A 2V5HG 1KR4A 5HBMB 3CCVS 3TAMA 3MF5A 1WTBA 2JSXA 1S9EB 3TAPA 1L3KA 3TRGA 5DS7A 1IKXB 3CDEA 3UI3A 4TQRA 5KFDA 1LV5A 1MU2B 2Y1JA 5KT7A 1FEHA 2RRNA 4U67Q 5A8KB 4N8OA 2MY8A 4ZOSA 1TP7A 4CH7A 2F8EX 3D1QA 3DOMA 3CIZA 3LF0A 2ZH1A 1NK8A 4JI3F 4GKJF 2VD3A 1N0UA 2R9LA 5F8GA 2KYZA 1JLBA 4DJBA 1X0FA 3QWPA 1TL3B 2E29A 3CJ5A 2VOOA 2EW9A 3CEDA 1S6PB 2AV5A 3P3DA 1U4BA 2AU0A 4FS1A 3BR9A 3NS5A 4IH7A 4CO0A 3MAHA 2GCFA 2HG4A 3OR2A 4O0IA 3TARA 1R0AA 2VPYB 1M0SA 3SCLE 2HPUA 3MM8A 3RBEA 2LCWA 5JJBA 2V8GA 4XPCA 2NLWA 2UUAF 4YQWA 1JLEA 4LQ3A 4I6AA 3ZFVA 5D4NA 2HHVA 3GG1A 5IXUA 2BANA 3IR5B 1RTJB 4PCQA 4C0OC 3OTDA 3ZZOA 2MZQA 3O2IA 2LMIA 4BS2A 1IUJA 1NEEA 4PG8A 4J9OA 1JXLA 3CJKB 4Y3CA 1S49A 4HL9A 1HBUB 2WBRA 3QLHA 3M2VA 5CYMB 1HD1A 1LQ9A 2BR0A 4RUCA 3VAMA 4KJIA 3F41A 4TN2A 5F0WA 3EPIA 4A8FA 2CPJA 4F3QA 2F40A 2KB2A 2M52A 4GMKA 5LL6d 3BEGB 2I38A 2KT3A 2ZNZA 3THVA 4OX7A 2F9DA 2DHSA 4D3HA 5KFHA 3DLGA 5L1IA 3MTJA 1Q79A 2OSQA 2VFRA 5DO2A 1SL0A 1U1RA 4O44A 3CCTA 2EC0A 4DLGA 5T7LB 4WE1B 3OUYA 3O44A 4KKOB 4G3IA 3PXGa 2MSSA 1QAJA 5BR8F 3OL7A 3PR5B 3EYZA 1CSJA 2XO7A 5D3GA 1RDRA 4NCGA 1VC6A 3M32B 2PSZA 4YR3A 3HP6A 3M32A 4TYBA 2CQCA 3BREA 5FLXY 1T05B 4QJVA 4PG4A 1AFJA 4ZLPA 1X5SA