2RNEA

Solution structure of the second rna recognition motif (rrm) of tia-1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
115
structure length
115
Chain Sequence
GSSGSSGQKKDTSNHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tia1 protein
publication title Solution structure of the second RNA recognition motif (RRM) domain of murine T cell intracellular antigen-1 (TIA-1) and its RNA recognition mode
pubmed doi rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 16
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2007-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rneA01
2N3OA 3THTA 1YIJS 4TU8A 1M5VC 2XNRA 2KG1A 2FPHX 2OIHA 1WF0A 3PIPQ 3DXBA 1VQPS 3N9UC 4IOCQ 3IRWP 2L08A 4C4WA 1BY9A 4C7QA 1WG5A 2LCWA 5CXTA 3DLLQ 1YJNS 3CMES 2KXFA 4TU7A 3MURP 3US5A 1YJ9S 3S8SA 2L41A 3K0JA 2JVOA 1VQMS 2OTJS 2CQ0A 2RNEA 2DHSA 4LMZA 1M5PC 2KRRA 4ERDA 1WELA 1WF2A 2O3DA 3CCVS 3SDEB 1FT8A 2MZTA 2MYFA 1D8ZA 2VODA 2DO0A 4FXVA 4IO9Q 1H2VZ 4P6QA 1VQ6S 2MJUA 2CQ2A 3CC7S 5FJ4A 1KC8T 1KQSR 2LMIA 1VBXA 2MY8A 4LIRA 2KXHA 2DHGA 2MSTA 4UY8T 1PO6A 2XS7A 2M88A 2RS2A 4WFAQ 3B4MA 2DGVA 2D9PA 2OJ3A 1D9AA 4CIOA 3VAIA 4J5OA 1CVJA 2DGQA 1WEYA 2MSSA 1SXLA 3NNHA 2DH7A 1WI8A 2X1BA 1X4DA 5MLCV 5LXYA 2DNRA 2ZJQQ 2LEBA 2MQQA 1QVGR 1VQOS 2X1GA 1L3KA 3MUVP 3MD1A 1DHMA 2KRBA 3ULHA 4WKRA 2X1AA 2CQGA 5DDOC 2KI2A 3HI9A 4CH0S 5ITHA 3NMRA 2DGSA 3CC4S 3ZZZA 1HD1A 3RW6A 5JVHQ 2OSRA 2K8GA 2QFJA 1FO1A 4WFBQ 4F25A 4Z2XA 2F3JA 1SJ4P 3CULA 2RS8A 4CH1A 2J0QD 2JWNA 2RT3A 1UP1A 3UD3P 1U1OA 2YH1A 2J76E 1IQTA 2DNGA 1KD1T 1FJ7A 2ZJRQ 3P6YC 3BO2A 1Q81T 1X4AA 4PKDB 2DK2A 2YTCA 2A3JA 3G71S 2G1DA 2VOPA 2UP1A 1M90T 1WG4A 1H2TZ 3S7RA 1PGZA 2MKSA 3HHNB 2KVIA 5LJ3Y 2M9KA 3I55S 2OSQA 2LEAA 4M5DB 4F26A 2MQOA 1RKJA 1HL6A 5DDPC 4WF9Q 2DH9A 3VAHA 3SMZA 1OIAA 1RK8A 3J7YU 3CCMS 2XNQA 1R8PA 2DNKA 2MKCA 4Y00A 2ADCA 4QPTA 2CQ4A 1XN9A 2MY7A 2DNQA 3Q2SC 1U2FA 2EVZA 2E44A 2HGMA 2HGLA 1AUDA 1OPIA 3VAKA 1SJQA 4LJMA 2KFYA 2MZRA 2M8HA 5DETA 2DGWA 2FY1A 2DGXA 2M70A 1O0PA 2RUGA 5CA5A 1X4EA 2GO9A 5D77A 5IQQA 2MJNA 2MB0B 3MUTP 1Q86T 1FNXH 1X5TA 2M52A 2U1AA 1U1KA 1DRZA 1WWHA 2DNHA 2AYGA 5GAHU 1P1TA 2KXNB 2M8DB 2J0SD 2YKAA 2CPYA 3CCES 5HL7Q 3R1LA 1X4FA 1VC0A 2HVZA 1KOHA 2CJKA 3S6EA 2DGOA 2DHXA 1N88A 2GHPA 2Q79A 1W2BR 2G0CA 3MDFA 2DHAA 5D78A 1WHXA 2PE8A 1QVFR 1WG1A 4OZ1A 1VBYA 3H2VE 2CPXA 3Q2TC 1A7GE 3MD3A 3FEXB 1U1PA 4QQBA 2MQLA 1VQ9S 2JRSA 1JJ4A 1KOOA 3UCZP 5IFMA 3CCSS 2N82B 2KU7A 2HGNA 2FC9A 2RQCA 1H2UX 2JX2A 2CQIA 3R1HA 1F9FA 2DB1A 4PRFA 1DBDA 1HD0A 2MXYA 2QA4S 3CF5Q 1VQ8S 4IOAQ 2DNLA 5GAGU 1YJWS 2DIUA 1U6BA 5GADU 2XS2A 3CMAS 2CQPA 3CCJS 2CPZA 5IM0B 3VALA 2DH8A 2AD9A 1VQKS 1SJ3P 1JMTA 4BS2A 3L3CA 2RQ4A 4WIIA 1VQNS 4TLQA 2MKHA 4C0OC 3VF0B 4WFNQ 4W90B 2MPUA 1URNA 5GAEU 2D3OR 3BO4A 1H6KX 2F9JA 1U1QA 1G2EA 1FXLA 2MGZB 2VOOA 4ZKAA 2DGTA 2KHCA 2LKZA 1A9NB 1X5OA 1M1KT 2QEXS 1U1NA 1P27B 2MZJA 3R27A 1X4GA 2L9WA 3J7ZT 2MZQA 3PIOQ 2J8AA 1OO0B 1ZZNA 3UWTA 2E5HA 3CCRS 1K73T 3I56S 4CQ1A 1X4HA 2VONA 3UCGA 2I2YA 2KN4A 3V4MA 2M4MA 2CQ3A 2XB2D 2BZ2A 1U1MA 4OZ0A 2KT5A 3LQVA 2DNYA 3NNAA 2LA4A 4F02A 3G9CA 2LXIA 4ED5A 2K3KA 2MKKA 1M5OC 1WF1A 5DM7Q 1X5PA 3UE2A 3RW7A 2E5JA 3CUNA 2AYEA 3MUMP 1B7FA 5JVGQ 1VC6A 3MOJB 2DISA 1WHWA 4PR6A 1VQ4S 5DDQC 3U1LA 3VAGA 1VQ7S 2LECA 1YHQS 1VQLS 1U6FA 2PEHA 5DM6Q 2OTLS 2RRAA 2DGUA 2CQDA 1S72S 2YH0A 2XS5A 3CTRA 2AYMA 4TU9A 2RU3A 2MHNA 2N3LA 3D2WA 2M7SA 3CPWR 2CPEA 5DDRC 2MKIA 3BS9A 2ERRA 1K9MT 2BOPA 1X4CA 2CPDA 2E5GA 3CCLS 1YI2S 2EK6A 1Q82T 3CCUS 3G6ES 2CQHA 2I38A 3G8SA 1FJCA 5GVQA 2LA6A 3EX7B 3TYTA 1OWXA 3P5TL 1HA1A 1FJEB 5BJRA 1NJIT 3SXLA 4EGLA 2G4BA 3NNCA 3JB9k 1X0FA 2DITA 3UD4P 3EGZA 2MZSA 2CQ1A 4YB1P 3EGNA 2U2FA 1R8HA 4Y0FA 2KH9A 1U1RA 1WHVA 2DNZA 1NU4A 1NO8A 5EN1A 3U1MA 3BO3A 1N8RT 3TP2A 1U1LA 1UAWA 1VBZA 2ADBA 3SDEA 2MQPA 2FC8A 3VAJA 3NS5A 3G8TA 2M0GB 2M2BA 1JJHA 4FXWA 4YUDA 2N7CA 3BEGB 3MXHP 5CYJA 3OW2R 3UCUP 3NS6A 2D9OA 3CXCR 4W92B 1ZH5A 2V94A 3CCQS 2RRBA 2AYBA 2JVRA 2YWKA 1YITS 1DZ5A 2NZ4A 2F9DA 2FHOB 1S79A 2HZCA 3VAFA 2CQBA 5H1SV 4A8XA 4WCEQ 1UW4A 2LQ5A 1N54B 4U67Q 2XSFA 1JJ2R 3B4DA 2E5IA 1YWXA 3LPYA 3P49B 4YOEA 2MKJA 1UFWA 3CD6S 3H2UB 1SJRA 3MI7X 2DO4A 2WBRA 2KM8B 1QM9A 2DIVA 5GMKa 1SJFA 2LYVA 1X4BA 1M5KC 1WHYA 2RVJA 2CPIA 2NLWA 5LSLA 2X1FA 4QU7A 1X5SA 5IM0A 3ZZYA 1N52B 3FEYB 2KM8C 2KG0A 3CC2S 2HYIB 2DNOA 2CPFA 4IUFA 2DNMA 4RU2A 3G96A 1K8AT 3P3DA 1FHTA 2LXUA 1YTYA 2KYXA 1WTBA 1ZZFA 2MQMA 2B0GA 2CPJA 2EK1A 3VAMA 1WI6A 2MMYA 2DNNA 2ZJPQ 2CQCA 5HO4A 1VC5A 2MQNA 3TO8A 3IWNC 2MGZA 5LSOA 2DNPA 5LJ5Y 2MZ1A 4QU6A 4UQTA 3G4SS 1Q7YT 1WEZA 4V19X 3S01A 5LXRA 1WEXA 2CPHA 1VQ5S 3THPA 2SXLA
chains in the Genus database with same CATH superfamily
2ZE2B 1NXIA 4IOCQ 3ITHA 2YPZA 2XLJA 1TVRB 1N56A 5KFRA 3MF5A 4PXCA 4RJVA 3MECB 2CZ9A 3FQLA 1UJ5A 2O67A 1WELA 1U0HB 3LGNA 2EFNA 4DLEA 1VR6A 3DLHA 3LF0A 1A0OB 2AJ2A 4MK9A 2R8HA 1VBXA 3TX0A 1PO6A 4ECVA 2XS7A 4USJC 4KPCA 5HJXA 2DGVA 4LVOP 3EZUA 3L7PA 3V4IB 3JSRA 4IYQA 1WI8A 1X4DA 3NGTA 4QR2A 2B6AB 4CLPA 5KFHA 2R7VA 2WW4A 3D28A 1I51B 4CO3A 4QR0A 3KJQB 1UW9A 2B9XA 2EFVA 2QX0A 5ITHA 2HS4A 1RAHB 2Z58B 3BPDA 1RHUB 3Q8YA 3NAIA 4FYDA 1L3UA 3V6JA 4JV0A 1YVFA 2XGQA 4ES1A 3OV7A 4HKQA 4GVLA 5K8MA 2OPRB 4KQZA 2JWNA 4G65A 2YH1A 2RE1A 2R7QA 2VH7A 2W4CA 1V5VA 4DR2F 2CVEA 1NDLA 4MKAA 4M94A 1V9OA 2J6UA 1F3VA 4JI2J 5L39A 4DL3A 4FBTA 1JLAB 4TNOA 3EXCX 2W7AA 3TX8A 2E44A 2J9EA 3M4XA 1GK8A 1RDRA 2NSBA 2W4PA 2WB1D 3HF5A 2M70A 4Q2MA 1DTTB 4UUWA 2RRNA 1Q86T 3BDPA 2CYYA 5KG6A 2LQ9A 1FK9B 1Y00A 3X3UA 5HMXA 1N36J 4HT5A 4JV2A 2HNZB 4EO6A 1RGVA 2KYZA 4C8LA 3T1HJ 1C4AA 3HVTA 2HNDB 1WHXA 2PE8A 2BANB 4MMOA 1VBYA 3M8QA 4MKYA 1YBUA 4PCQA 2YQ3A 1CQMA 1VQ9S 2RQMA 3TAMB 4IG3B 5IFMA 3FRZA 4NL5A 1H2UX 3OT9A 6FD1A 3GFYA 4C9DA 5F41A 2X3GA 3C15A 3M1VB 4F0HA 2AD9A 4F04B 1DQAA 1C0TB 2DR6A 2OPQB 4QYZK 3CJKB 4NLDA 3A13A 3E3XA 3QPIA 5KAKA 1AYEA 4I68A 3QZ8A 3CJ0A 3EZ5A 2V4JA 1FDAA 3DLEA 3W62A 1K1SA 4NLOA 3GIIA 1HQEB 3CCRS 3PRDA 2BZ2A 2E1CA 4YS2A 2HPUA 2LA4A 4R5PB 1U2RA 1VLYA 4QJVA 2K3KA 3FRYA 4NXMF 3IR7B 1E6VA 2WOMA 3OTEA 1BQNA 1VRQC 3DOMA 3IR5B 4GC6A 3MAHA 4A46A 1HBNB 2IAJA 2OTLS 2CQDA 1WKJA 1FD2A 2B5JB 2XO7A 2HHTA 1JLQB 2LDIA 4M5DA 5BYSA 2DXDA 3SBMA 3FC9A 2QA2A 4AQYF 3ONQA 3CCLS 1HQ2A 2DXEA 2EBEA 2F1FA 5GVQA 3J81Y 2IRXA 3DLKA 1E6YB 4WYLA 1HA1A 3RTVA 1RAGB 3M2RA 3SXLA 3GFZA 3BYPA 4RUCA 2VFSA 1SKUB 3MMAB 3LTOA 3R9LA 1EQMA 4CYUA 4DCOB 4RKUC 1UWAA 2ADBA 4ZVRB 1K0TA 2AGPA 3CVKA 2BQUA 4OJ1A 4DR6J 2H54B 1KHWA 3OW2R 4OMFG 1MMNA 2YWKA 1CJUB 1NSKL 2HK2A 4J90A 1VHFA 3IGVA 1S6PB 3LPYA 2UU9J 3BBCA 3GJRB 4UOCA 4LBPA 3MI7X 3JAMY 4PUOB 2AJQA 4K0KF 3C14A 1HNWF 4CLYA 2DPIA 4GKKF 2G1HA 2CPIA 4EFAC 3CIMA 3HMJG 2KG0A 3MM8A 2G9OA 2JJ4D 3LWMA 3OJUA 2DNNA 1IXKA 2K7KA 3B82A 1S7IA 3BB5A 5J1PA 4DS4A 2K1RB 3MPUB 1T94A 3ENAA 1XQIA 1TKXB 2FHMA 4KHMA 4MH8A 4ECSA 2YQ0A 4TYBA 4YDXA 4GKJJ 1JXVA 1ZAXA 3PW7A 5IT9Y 5HSPA 4RBTA 1J5OB 4RW7A 4OI6A 1BWEA 1BC6A 1MU2B 1QD1A 1T9VA 2XMKA 3OSPA 1AZSB 2IJFA 4UUXA 1KQSR 3BN7A 5I3PA 3DRPB 5JXSA 2W2PP 4HHJA 5F9NA 4A8SA 4ELVA 1WEYA 1NKEA 1B3TA 1RKIA 2B9EA 2DH7A 2BW7A 3C66A 1LOUA 2VG6B 3NL0A 4DV1J 2UXCF 1QE1B 4LF8F 2HK3A 1BQXA 4WE1A 1UJ4A 1HNXF 5HP1A 3MD1A 2YNGB 3UN2A 4N5SA 2VG7A 3HXMA 4DG1A 3RW6A 1G1XA 2LVWA 2PIIA 2JEJA 2Y1LB 5A8KB 4Q8FA 3UVJB 1TQLA 2DXFA 3I87A 4F36A 4DSEA 3MCSA 1JLCA 2ZJRQ 3P6YC 1Q81T 2I9SA 2UUCJ 2WAQD 3G71S 2RKIA 3BPSP 5B0GA 4HEA9 4N8NA 2PMWA 1N0UA 1LW2B 3DOLB 2M9KA 4EU0A 3MEGA 4IH6A 2MQOA 4CCHA 1RWVB 1RK8A 4CP5A 3KOAA 3FCHA 4C0HA 3KJNB 3KLHB 5ETKA 1KVKA 4DF4A 1YRXA 1U0SA 3M32A 1X4EA 2WBMA 3KK2A 4X66F 3MUTP 3FZ2A 3DI6B 5CYMB 4KHRA 4WPAA 1P1TA 2JH3A 2X51A 4ZHRB 3CDBA 2NXCA 4TY8B 1KOHA 1JLFB 1BGXT 2G0CA 2WK4A 3AJDA 1LK5A 2YNFA 2YKOA 3UNGC 4KE5A 3EE3A 1HBOA 3V6DA 4XO0A 3CCSS 3P5BP 2V8VA 1V3SA 2QZ8A 5DJBA 2FZKB 4UZCA 1NHVA 3LA0A 4G1QA 1MMDA 3D3BJ 1Y4ZB 2DHHA 1D8YA 4JB8B 2ZEJA 5HROA 4BS2A 4ZIVA 2ZUGA 4PPDA 2F4FA 5E3QA 3GG0A 2IHR1 2XM3A 3M2UB 2XYPB 1H6KX 5IQ6A 2GAHC 2O66A 1VBKA 2VOOA 3D6TB 3OPKA 2XLKA 1RBOB 3H59A 1X4GA 3GJSB 2VICA 4UW2A 1RHJB 3ITHB 4OZ0A 2ZC4A 3ENWA 4A8MP 3LQVA 2VQFF 4ED5A 1WF1A 1U6ZA 1FEEA 4ELTA 2F63A 4LF5F 4DQIA 4S0MA 1KNZA 1S57A 8ATCB 1BUXA 1VQ4S 3TI0A 4JI3J 1YHQS 2ZBIA 1Y5LB 2DGUA 2VFTA 3D67A 1R8CA 3W63A 3V6KA 3KK3A 1F0XA 2C3YA 3WQPA 1LKZA 4ED6A 2EK6A 4K59A 1P6TA 3CCUS 5BYRA 3G8SA 3C3LA 2CNLB 4B08A 2GNKA 1ZTWA 3P5TL 1LK7A 1YJ7A 4FPIA 1VQSA 2UUBF 4I56A 2KTQA 3DXSX 4I2QA 3KXDA 4PXEA 5KFQA 3AQPA 3J80Y 4PPZA 3R6GB 1IBCB 4FKYA 2UXDJ 1RCOB 5HJYA 3MXHP 4K4WA 3UCUP 5RUBA 4B9UA 2FLLA 4JI6J 3B78A 3K8WA 4RW6A 1NHKL 1RAEB 3W66A 4URSA 2QLWA 4YOEA 1UFWA 1UPPA 3SYZA 3M8WA 1S0VA 3C2PA 2AWZA 2LYVA 1SPBP 1GEHA 3PR5B 1GMVA 2QL9B 5KFGA 1SQGA 3P3DA 4DV5J 3KUGA 1TR0A 4C6AA 3AB2B 3UDVA 5F8LA 5AXNA 3QGPA 1SIZA 3A4TA 3UR3C 2KJWA 4QU6A 3L4BC 4OIXA 1FRXA 3DLGB 4JI8J 2N4CA 2EWHA 4USTA 4F4WA 4TU8A 2FVPA 3IBFB 4OI4A 4LBHA 4DF8A 1J2VA 3GFXA 2GHVC 3DXBA 2IDLA 2L08A 3LW5C 3M8QB 4B3SJ 1SKWA 4XPCA 3PV8A 4IFYA 2PA8D 5T7LA 4X62J 4HT7A 1ZOTA 3DM2B 2R8JA 3HVRA 1XWLA 2DHSA 4G1PA 1M5PC 1X8DA 2RUSA 4RWXA 4DV0F 3E01A 4I67A 1H2VZ 1WKKA 3MTJA 2FLPA 1RAJA 2GVDA 2PI5A 3HSZA 3T1AA 1RTZA 1ICEB 4FKXA 2HVHA 3QWPA 2OJ3A 3QGIA 4J9NA 4DV6F 3JSBA 5IT0A 1SXLA 4F8RA 3LWLA 2HWHA 2V4JB 1P8GA 1H7XA 3DLEB 2ZBPA 2XY6A 3BBBA 2BM1A 1YJVA 1WSVA 1XR5A 3F44A 4DSIA 1NSPA 3T1YJ 2W7PA 1NK0A 4KR0B 1XMOJ 3CULA 3A3NB 1Z4UA 5KFFA 3HHDA 2PO4A 1T9XA 2PFDA 1UP1A 1E6VB 2WOMB 2XLIA 1BQNB 3DOMB 4Q2LA 3GJTB 1UKUA 1UFLA 4ZVOB 4ANDA 2B9YA 2J7WA 1GT8A 3W61A 3AFGA 4P73A 4M5DB 5D3GA 1VGYA 3CJTA 2QGFB 4KGXB 1YQHA 1NSAA 2XHCA 4QPTA 2FJAB 3PW0A 1HWUA 3M2RB 5C24B 1OPIA 3VAKA 2CWKA 2J7UA 3MMBA 3H20A 3I32A 4YMEA 5CA5A 4ZVPB 2GO9A 1C4CA 4CYUB 1N0VC 1S48A 4DUYF 2M8DB 4DR2J 1ZM4A 3MM9A 3BM7A 2UVVA 2CPYA 3MPVA 2VIHA 3R7SB 1LFPA 2CJKA 2FLNA 4OYZA 1KN6A 1C2PA 5D78A 4O3OA 3V5RA 4WXWA 3GSIA 2XY5A 4MTPA 2AQ4A 5BYQA 1FF2A 3T3FA 2N82B 2AW0A 2HGNA 2FC9A 5KFCA 1XMQF 3KG0A 2DB1A 3LOUA 3C14B 2W2OP 1SH2A 1VQ8S 2DNLA 4FS1A 2DIUA 5EWFA 5GADU 1R0CB 3VALA 2LQ8A 1SJ3P 1RTHA 1OSDA 4B3RJ 1Q0NA 3NMAA 1QAXA 4J9PA 3JSMA 1IUJA 4IOBA 4EYIB 2WHOA 3AY0A 4X4QA 3PO4A 1YRTA 4M95A 1H74A 2YKPA 4L75A 2HW3A 3FGVA 4A8OA 1KS2A 2P9GA 5DGBA 1LWEA 3LAKA 1XC9A 1PCAA 2HMIB 3UE2A 1U48A 3MUMP 1B7FA 3WDOA 4G6VB 4EBDA 1FVQA 4I7FA 1ULRA 1Q5VA 3A3OB 5DM6Q 3NXZA 5IXUA 1RLCL 1U02A 5G0RA 1WNEA 1OMSA 1Z2ZA 2Q43A 4UF4A 1WTFA 5ADZA 4GC7A 2R7XA 3AHPA 2HBRB 2CIMA 3RUBL 3A8EA 3KLGB 2XC9A 4ECYA 3VGVA 4H4OA 4WE1B 1FXDA 2H65B 5HP1B 2VG7B 4GO5X 1P9YA 3HT0A 2BYCA 4RUBA 4FNHA 8RUCA 1TKDA 3EPGA 3DFEA 4NCBA 1N33F 2D9OA 4OHXA 4AQYJ 2F9DA 4PWWA 2HVEA 3F0NA 1NM2A 3GJQB 1SKSA 2RKIB 3QAEA 3IFEA 2MDAA 1U47A 3KLFB 3CD6S 4HYKA 2HFUA 1T11A 3MEGB 1MN9A 1SJFA 1NZ8A 2V2KA 3KFWX 3QRRA 4PXDA 4QU7A 3U1NA 9ATCB 4QWDA 3FBFA 1FRJA 3PHEA 3ZO7A 3M32B 4QIGA 1TFYA 1UVMA 3KK2B 4LSNA 4QWAA 1VK3A 4C8NA 1M1HA 1ZYQA 2GCFA 5HMYA 2MGZA 1OQ6A 4DSFA 5B7WA 2IFXA 2HQ3A 2ZNYA 2QMXA 1D1UA 2GMLA 2UXBF 4RW4A 4ZLNA 2K7JA 1IJFB 2ZHAA 4K0KJ 3PIPQ 3CWJA 3BSCA 1HNWJ 4C8ZA 2GA7A 1Q53A 5E3AA 3DOKA 5C2GA 1LWXA 3EM1A 2KJVA 3PY8A 5IV4A 2KXFA 1NK8A 3PACA 1YJ9S 2GZOA 2L41A 1Z1ZA 4W4MA 1S9EA 3V6DB 4LMZA 5F9LA 2QT7A 1FDBA 1PYTA 4J91A 4G1QB 3OL6A 5B0BA 4JUZA 5JUMA 2AJ4A 3NBPA 3NGKA 2DT9A 5HROB 2Z8QA 3PJXA 2BQRA 4J7CA 5D4LA 4E98A 1PC5A 3CNQP 4TY9A 1BMQB 3WIVA 3QQCD 3BN4A 3E8OA 3D4JA 5LXYA 2ZJQQ 1UCNA 2MQQA 3K2YA 3K5LA 4FP9A 1QDUB 1NK6A 3PJ9A 4QBUA 2DVIA 2KI2A 1UPMB 4JBCA 5DG8A 3BZQA 3HHLA 2QFJA 1FA0A 4F25A 2C2MB 1SJ4P 2FTRA 1OQ3A 4U95A 4ES2A 2JFDA 3BO2A 5CCLA 1X4AA 1N32J 4CO1A 2NZCA 3W5ZA 2BEFA 1Q7LB 3J7AN 2UXCJ 3ILOA 3I55S 4LF8J 1PILA 3KK3B 3PYGA 1HNXJ 5KG0A 3CCMS 3P96A 1JLEA 2E9TA 2HGLA 1RT1B 4N76A 1S1UA 3QFHA 1X7VA 2EI5A 3NAHA 4X4VA 5D77A 4PAAA 2NPIA 5LT5A 3MAQA 2R42A 3RYLA 1YGYA 2AX0A 4B3TF 4R8UA 5E3PA 1O51A 2PI4A 2R8KA 1IBLF 2AGOA 2HVZA 3J81U 4FVCA 2EFOA 2EG1A 4IFVA 5IWAJ 4KJIA 3QGHA 4ES3A 4DL5A 1FJGJ 3NGSA 3HSDA 4RW6B 4KT0C 4QQBA 2VF3A 2PFFB 2KU7A 4DOZA 2RQCA 2Q3PA 2LQBA 4ID5A 2BKPA 1NMEB 1GH8A 3LP1A 2CQPA 2CPZA 1VQKS 1QUVA 1RWMB 1G2EA 2JFKA 3JAMU 2LKZA 2D3O1 1C0UA 2Q6BA 4OZNA 3J7ZT 2ZH6A 1TTHB 2DRAA 4RW8A 4I2PB 4HDHA 1F2HA 1K73T 3BKFA 3O2IA 2CQ3A 1U1MA 3K5PA 1AB8A 5LMUF 2PA3A 1N4LA 1HQUA 5FDLA 4IFYB 4J9VA 5T7LB 5F8MA 2AYEA 1L3VA 1RI7A 5KFEA 3EGVA 3U1LA 2CG4A 5I42A 1TMJA 1VRTA 1EP4A 1TP7A 2BJ9A 3BV8A 4DR4F 4NLXA 4PZVA 3Q86A 2E5GA 1Q82T 3EX7B 4ZPAA 5IT9U 4OYXA 2NSCA 4M5MA 3JB9k 1SVDA 2QE5A 4C3MA 2C2NA 4K4YA 2XMTA 1WC1A 3TP2A 3I0RA 2C1EB 2LFVA 3IM8A 3QT5A 3RZAA 4B9SA 1F3FA 2NUUG 1RISA 2V94A 2JVRA 2NZ4A 2VQEJ 1VISA 2HZCA 5H1SV 2BE2A 4DN9A 3DYAA 3HHKA 2A0FB 1LFWA 4WKYA 2ASLA 1NUEA 1VDHA 3OJSA 1WKLA 4MYUA 4TXSA 5D3GB 4PG4A 4WP9A 3OUYA 2ZH7A 4A8WA 3ZZYA 4OZ5A 3TEGA 3BGRA 3MMBB 1VYAA 4B9TA 1KRPA 2YX1A 3NWGA 4ZMMA 2ZZNA 2HWTA 3G4SS 4DEZA 4PXBA 2VPXB 3NG8A 4LRDA 4RWWA 2CAJA 2DRBA 4FYWB 2FPHX 7FD1A 1S1XA 3KHGA 1BLUA 4OYWA 1SQEA 3GWCA 4WTOB 3CMES 3MURP 2YNHA 2XG8A 1NLKL 3N5FA 2O3DA 4X65F 3CJ5A 5KT5A 5KT4A 1WOSA 2RHQB 2LQJA 2LMIA 2MY8A 4DBQA 1RTHB 4O4GA 2FVSA 5U47A 1JNZB 3VAIA 4RL1A 1WOOA 2HQGA 3ILJA 4AXIA 2ZHOA 1T03A 3GIMA 3HD2A 2HIYA 2LEBA 1RA7A 1Q5YA 2EFGA 2BR0A 1EB0A 4Q8EA 4RW9A 4ED0A 2AHOB 4NX9A 1NSQA 1Y5NB 1LWEB 4NYOA 1JLGB 2J76E 1KVJA 4USMA 3M9NB 4DV6J 4PKDB 5E0OA 2AU0A 4I7FB 3QWUA 4DQPA 1TK5A 1JWWA 3RAQA 2MKSA 2MQ8A 3GP9A 1NHUA 4OHWA 3HP6A 4NLGA 2XBPA 4IQXA 3RBZA 2LU1A 4M5LA 4OZ2A 3OHAA 4HACB 4HH1A 2V6AA 4ED1A 2BJDA 2NS1B 1M0SA 4ZCLA 1P1LA 1HNVA 2ROEA 3D3CJ 5KFAA 1DRZA 2L3MA 2JOQA 4NYZA 5J1EA 1HNZF 1HLWA 3AOCA 4DUZF 2R7SA 5GMEA 2HFVA 3P4UB 1RB0A 1ZM3A 3NEKA 1C1BB 1U25A 3VQSA 4ZCIA 2BMBA 2C2DA 3POTB 3BKUA 3D66A 3W1YC 2YVSA 3J80U 3TVKA 1CJKA 2JX2A 3R1HA 3BJYA 2WW8A 1RHKB 5ETNA 4M5HA 4DUYJ 3T5KA 3TVYA 1YJWS 3ET6A 5KFDA 3Q0AA 2J6SA 3UPFA 3KK1A 2XZWA 2VBWA 4LFCF 1NAQA 4MFBB 1HR0F 2HFNA 3H5YA 1HI1A 1FXLA 3CJSA 4HR2A 2MGZB 1TAUA 4A8QA 2HVIA 3OVBA 4RW4B 2DEIA 2ASYA 2QSFA 3KMQA 3UCGA 4A8KA 1T05A 2VJUA 3ADAC 3G9CA 1H3DA 1DQ8A 1NB2A 1S9EB 4NMLA 3ZTSA 3SV3A 2I5JA 3W9HA 1S0OA 3RR7A 2V8DA 5DDQC 3VAGA 3N0VA 4RUAA 3MFIA 2PEHA 1SL2A 3GR0A 1S72S 2V8GA 4UOFA 4ZLLA 4QIEA 3GIJA 3NBPB 2E1PA 4P7VA 1EZZB 4N47A 3DKDA 1PJ6A 4ED8A 2EW9A 2VJVA 3DHWC 3JXOA 4FPRA 4L3KA 3IN5A 4R25A 1N8RT 5KFLA 1FVSA 3T9ZA 2AV5A 3OTOJ 3HHLB 4TKTA 4M5KA 1LNQA 4KBIA 2CDRB 5KT3A 1DZ5A 5G4DA 2APOA 2OP5A 1UW4A 2F65A 3PTWA 4C8OA 1F1BB 4Y2CA 2IVMA 3WHIA 5HMWA 1VRUA 1RT7A 1JLEB 2HLTA 1WOPA 3CC2S 1U4BA 1S1UB 2LXUA 4WU3A 2B0GA 2EK1A 3CO0P 3VAMA 3WX8A 2MMYA 3J81j 3EZOA 1R3NA 4U8VA 5KFVA 1YBAA 5HN0A 4ZP8A 1XNQF 3IAM9 3C19A 1Q7YT 4LSLA 1RWWB 2AP6A 5BXIA 2FHJD 3AT1B 1RHMB 4ZPCA 2ZM6F 4O0IA 4JI0J 1RT3B 4Y6IA 3KNGA 1JKHB 4IFVB 2FJDB 1L3SA 2LCWA 1W7WA 2WVEA 2HQIA 1VQMS 3TA2A 2FQQB 1XK8A 1TUVA 4AUKA 1Y9OA 1ITPA 2W2MP 1HWJA 4PYAA 3CC7S 2IJNA 3TA0A 4KRWA 4WXOA 4TQSA 1O5JA 3DRSB 5D4PA 3FBCA 2IM2A 2GC8A 1MG7A 4X4PA 4QR1A 4RR5A 2NPFA 2VPYB 3MEEA 2DNRA 1YK9A 4IQMA 1GTEA 1FESA 4F4AA 2HHHF 4Y65A 1EHWA 4OX9F 2XI2A 4WKRA 4O4RA 2QMUB 1ZBTA 2M5YA 4OI2A 2C3PA 3GSDA 5KFKA 4LRFA 1FO1A 2BRLA 1GMWD 5FDLB 2J0QD 1REVA 1HPZA 1HWLA 1KD1T 1IBKJ 3H40A 3TQ1A 2G1DA 5I42B 1M90T 2CNOB 2IRYA 3CJ2A 2IYGA 1VRTB 4M5NA 2VC1A 2VD3A 1LEOA 5E5NA 4LFBJ 3PX4A 1T7PA 3VGTA 1BXNA 2YQ1A 3OL7A 5KFWA 1PC4A 2OFHX 2BUNA 3Q2SC 2EVZA 2I0XA 2X7IA 4NZ0A 2OH2A 5DZ7A 4DR7J 2KO1A 3GR1A 5HBMA 4X84A 1S1WA 4N7TA 1IR2A 5MAOA 4CZCA 3I0RB 1H73A 4OYIA 4OI1A 4KB7A 3CJ4A 2WVFA 4IRCA 4P9SA 5LMNF 4C48A 1RAFB 3R97A 1EARA 3ZZUA 4EI2A 2BE2B 3OFHA 3DYAB 4DPUA 2VBZA 4NLQA 4RX6A 4HLBA 1HBMA 3PZPA 4WJBA 1S49A 4JYAJ 3D54A 4J9UE 4CLSA 3C6UA 4OX7A 1NKCA 1SQFA 3PYDA 2W8KA 2BM0A 1Q95G 4F2SA 3WIUA 2ZBQA 2E66A 3BGRB 5EGYA 1IBLJ 4OYAA 1AXQA 2ZHBA 7AT1B 4WFNQ 1URNA 3PX0A 2R2TA 4LBIA 3GCWP 3SZ2A 5DZ6A 4P7TA 1ZM9A 2XMUA 2EG2A 4J9SA 4WFXA 1FFWB 1X5OA 5EX0A 3MM5B 3P45B 2CA9A 1WC0A 2NUHA 1FI4A 2QYCA 4HTIA 1S1XB 4M5JA 4M1KA 4FF1A 2KT5A 5B0EA 2YNHB 1R8BA 2HZVA 1AFJA 1G4CA 4XDDA 3Q89A 2W2NP 3W65A 1KQFB 1EX8A 3FSYA 2W7OA 5CCMA 3M30A 4HTJA 3H2LA 1JJCB 1YJRA 4O4GB 1K9MT 2AGQA 2YKNA 1K0VA 5L1JA 2GAGC 1RLDA 1OWXA 3K57A 1DFDA 2W4DA 4F0MA 2DD8S 1Y5IB 2GQ2A 1X0FA 1T03B 3EGZA 5LMUJ 3NLCA 5GAHI 2U2FA 4FYXB 2RDDA 3GV5B 2DNZA 4RBUA 2QL5B 2LP4A 2H1YA 4RW9B 2DR7A 1O6XA 3RAXA 2YPYA 4K2JA 2AMCB 2NXJA 2OD6A 4DR4J 4JI7F 3CXCR 3R7BB 1RQ0A 4PYDA 2RRBA 3CCQS 3FVYA 4LF6J 3EWGA 4QIVA 2LQ5A 2WVCA 3B4DA 2E5IA 2VFVA 2AZ3A 2HS3A 2OEJA 2VG5B 3AJ2A 1VJWA 4O44B 1KONA 3DHXA 2DR9A 2V9KA 1M5KC 3UNYA 3KUHA 3OFGA 1X5SA 1U7LA 1N52B 1BHNA 3MEDA 3SSSA 2KM8C 5LSRA 2HYIB 2YWEA 4RU2A 1K8AT 2R4FA 2B4OA 3KNAA 1FE0A 1T9WA 1N6QA 2ZJPQ 2CQCA 2HLUA 4ILLA 1HNVB 2CUYA 2MZ1A 3PEJA 4UQTA 4CLFA 1Q16B 5J1EB 2JLGA 4NCGA 3ZTQA 2VA2A 3QBCA 5LXRA 1M5VC 2P5VA 4ZN3A 3HFVA 1IKXA 1RAIB 3FEZA 3IRWP 2J9CA 3GE9A 2BACA 2PMZD 4BC9A 2VDHA 4TU7A 4ZA1A 4Z37A 4RNFA 3TNVA 1CJKB 4KH1B 3TJAA 3SDEB 1FT8A 3JTPA 3A8KA 2MZTA 1NK9A 4MKBA 4P6QA 3L95X 4ED7A 3W5XA 1SC4B 2MJUA 4BC7A 1S5ZA 3ET6B 2Y9HA 1GTHA 3KK1B 4O23A 1XBWA 3QJJA 2Y1RI 1G7CB 2Y0SD 3S1TA 2D9PA 3QNWB 1CJVA 4RZRA 2MLXA 1YJUA 1I3OB 2OKQA 5M2PA 4WFZA 4OJHA 3SI8A 2QRRA 2FUG9 4Y2MA 2BA9A 3M7VA 1L3KA 5F8HA 4X65J 2CQGA 2JL9A 1ZPWX 3QFWA 2DGSA 1HD1A 2OMOA 4EBCA 3K59A 5JVHQ 3Q8VA 4DZDA 1T05B 3A3PB 5HI7A 3GPAA 1TL7A 4KC5A 1Q8IA 1JX4A 3JS9A 5IZHA 2F5GA 2AX1A 4MIBA 4ZDNA 3MR2A 2E1AA 2QYGA 4B3OA 2I5JB 2YTCA 4ENOA 2DRDA 3D0IE 2VOPA 4YR3A 2C22A 3HVAA 2YWHA 4GRSA 4F50A 4O3QA 4J9RA 1TL3A 5THWA 1RKJA 2I6WA 3WX4A 2VL1A 3PKMA 2QG9B 2F8EX 3HKZD 3OTBA 4O0NA 5D4OA 1TK0A 1YDLA 1SJQA 5KT2A 4JV5F 2GJ2A 4ZVSB 1A6LA 3IBWA 5AXKA 3L7OA 1FNXH 4LFAF 4ZJQA 2XULA 3BYRA 2AYGA 4YY3F 5KG7A 3H5UA 4LF7F 4P2MA 4DPXA 2FB0A 1I94F 2DHXA 4BWMA 3KLVA 1SCJB 2DY1A 3BH7B 1V6HA 1CS4A 2CRLA 1JJ4A 3KWMA 4DCPB 4IH5A 2NXUA 2D41A 3MM7A 3QGGA 1VRUB 3I82A 3NCRA 3NKYA 4IOAQ 1RHQB 2IM0A 3SCKE 4DHVA 3CCJS 2XMAA 1HNZJ 4FVMA 2L9NA 4HHHA 2RQ4A 1VQNS 4OL8A 4W90B 3PXGa 4NMXA 2HBQB 5C42A 1DTQA 3M05A 3EUNA 4N77A 3NOGA 4ZKAA 2DGTA 1FKOB 1B0VA 1M1KT 2QEXS 4LSLB 1P27B 1WC6A 4AFFA 3U02A 2AZ1A 1T9UA 1ZZNA 2AEFA 5IS2A 1YZ7A 2WVDA 1U8WA 4Y2IA 2G0IA 3R2DJ 2B4UA 1HFEL 1NPPA 4EEYA 1GQEA 3PX6A 3CJRA 3QIPA 5T14A 1URRA 4K2XA 2B3TB 5KFYA 5JVGQ 2W8LA 1HR0J 1FKPB 3QZ7A 3DRYA 4WIQA 2RSQA 2YH0A 4H4MA 5J2NA 1QTNB 3A12A 4P10A 3QRQA 1FJEB 2QLXA 2ZDOA 3TR5A 3MEEB 3T6BA 1VS3A 4OJ3A 2Y1IA 1F2GA 4F3MA 3KJVA 2LXFA 2UUAF 4DPTA 1NU4A 1QSLA 1NKBA 3M6WA 4NE9C 2GS8A 2EC0A 3NRBA 1V3RA 3FCVA 1Q4RA 4LQ3A 2M0GB 3LP0A 2W01A 4O3NA 2C2ZB 2YKMA 1REVB 4DFPA 1HPZB 2GIRA 1YITS 2ZDPA 3KDOA 2CQBA 4WCEQ 2XSFA 2Q1LA 1YWXA 5KFPA 5AJ3J 3MMCA 5GAGI 3VV2B 2DIVA 2FJEB 3RB4A 1Z2LA 4KGKA 5LSLA 2I8EA 1SC1B 3G86A 4EUVA 3GV7B 5K5MA 1WTBA 3F41A 3I9V9 3TANA 2CPJA 3EVMA 2OELA 2JSXA 5HO4A 2DR5A 5HBMB 4LR8A 1KTQA 2VKRA 1S1WB 1FDDA 3M6VA 2QLBB 4N8OA 1HMVB 1T0TV 4DV2F 2V69A 2PSZA 1X9MA 3KLEA 3BF4A 2W9CA 4DX5A 4YB6A 2LLZA 1ZAWA 2OFGX 3WZ0A 1S1TA 3MCNA 4ZK7M 1MROA 1HBMB 3ISZA 3W8PA 4PWDA 2VODA 3PKYA 3G82B 4C11A 3C6UB 4PG5A 1XNQJ 1YG0A 3IP0A 4IDKA 1N34F 1F9EB 2ZM6J 4HI1A 4Q45A 2QA4G 4OX6A 3AD8C 2MSSA 1VLOA 2YBVA 2X1BA 2V9WA 3LP2B 1QVGR 4LR7A 4CO5A 4RUHA 2OEKA 1ROFA 5GMDA 2XCPA 4DWIA 4Y3CA 2GJFA 3C16A 4CH1A 2ILZA 5SUHA 1FJ7A 1RTJA 1NB7A 4ETXA 1YBTA 3OR1B 1FERA 1IVZA 3M30B 2C2EA 3IC1A 4UTGA 1UEUA 4Y2AA 2LEAA 4IR1A 4WF9Q 1HL6A 2V4RA 3GV8B 4WZQA 4OX9J 3D5MA 2ZWPA 2W25A 2ZZMA 2YKNB 2XNQA 1R8PA 4DR5F 4ECXA 2HEKA 2ZD1B 2MLZA 3VZHA 3ZC4A 1RYSA 2ZBCA 1KKHA 3MM6A 5DQHA 5CD4A 2XI3A 5CYQA 2V63A 2W9BB 1WWHA 2DNHA 2QJ3A 1PBAA 5I3QA 2R7TA 2VKZG 5A8RA 2J0SD 1D09B 4WK1A 3FMBA 3T5LA 1QAJA 1VC0A 4DMZA 1N88A 3UN3A 3IS9A 4G1IA 4EYHB 4OZ1A 3D6MB 2V2VA 3UI3A 2VFUA 3ZZ0A 1JQGA 1PSDA 1U1PA 3PRVA 3EICA 3NCPA 1KOOA 3BKTA 3DDNA 1FNMA 2CQIA 2BJ8A 2W2QP 4OHVA 4USVA 4DN0A 3G2XA 2BJ7A 3MEDB 3M6XA 6FDRA 1OY8A 3PDNA 1M5SA 5I4MA 5LMNJ 2LDYA 3RBDA 1IBMJ 2JEIA 3CGIA 3TRGA 2V8HA 4NCGB 1N36F 2BE9B 4LRBA 1FFSB 4QW8A 3I9ZA 4DX7A 4IG0A 1IKXB 4KV8A 2YY3A 3ISNC 2LEPA 1FRKA 1NDCA 3HZEA 2AIRB 1W2IA 2HHVA 4Z7YA 3T41A 1NK5A 1D3WA 1S4FA 3OR2A 2Z2LA 3QLHA 1V3ZA 4I64A 3TZWA 4PR6A 3SFUA 1MWYA 1U6FA 2R7WA 1OYDA 1S0NA 2AYMA 2J7KA 2WSCC 2V2QA 3W7BA 1APSA 5J2PA 5DDRC 2P2CB 3O8WA 2RAQA 4CLWA 1CJVB 4OX8A 2H3EB 1KLMB 3H90A 1NJIT 3TEHB 4XTTA 3OSNA 1R31A 4WFYA 2GVZB 5E3RA 3DGVA 4OI3A 1RADB 2R7OA 4QWEA 4MT1A 2Y8YA 1S12A 1RCXB 1U8SA 1S77D 4FXWA 2RILA 4UY85 2OEMA 4C8MA 4A8YA 1GMUA 4F4XA 4ZP6A 1QSYA 1WC3A 3I96A 4PG8A 1KP6A 5LL6d 3DRRB 2J6TA 3SV4A 2DCUB 3F56A 1UVLA 2KM8B 4NXNF 3DU6A 5BR8F 4IR9A 4DV4J 4ZVGA 2RVJA 2X1FA 1UA0A 1OY9A 5IM0A 4CNYA 2L48A 2CPFA 3MR5A 1Q1KA 1SL1A 1PG5B 3V2UC 4JI7J 3FJ2A 4DR1F 1WI6A 3TA1A 4MK7A 1NK7A 1RT4A 1S9FA 3SIPB 4B3MF 4NLUA 4V19X 2Y1JA 3RU0A 3MHYA 2N3OA 3X1LB 4DR6F 2BKOA 1NJXA 3KDNA 3MAAB 2QIFA 3GYXB 1HHSA 1CPZA 2RF2A 4RNMA 2B4VA 4CO4A 2A6OA 3HZGA 2FYXA 2Z2MA 1MMLA 2JVOA 1GFWB 2ZBRA 1XNRF 3T6JA 3CCVS 2KT3A 1DTTA 3I0SA 5B0DA 2MYFA 3MM7B 3K7RA 1OS5A 4DPOA 3BR8A 1UZDA 3QYYA 4HH0A 4ATNA 4KO0A 1SKRA 4UY8T 5SZTA 3B4MA 2P9CA 4KGZB 4O3RA 1OSCA 4AXJA 4X64F 2GW8A 1T3NA 5C42B 1DTQB 2RJZA 4WP8A 3ZTPA 4KFBB 4FYYB 3CJQA 4CRJA 4AD6A 3PYFA 1EQ0A 1EETA 2UVWA 1QY7A 2HHUA 2P9EA 1DHMA 3QT6A 2X1AA 3HI9A 3P8BB 5KOXA 3THVA 3GU0A 3R5AA 3M1VA 3QIPB 4GKJF 1VMBA 1PBUA 2LU2A 1IQTA 2BXJA 2VHGA 2DK2A 4YQWA 2YNIA 3R8YA 2ATCB 2XY7A 5DQGA 1N5YA 1SC6A 4ZVHA 1PGZA 3Q83A 4EZ6A 2ALYB 5DDPC 2R2UA 4XK8C 2J0WA 2DNKA 4DV3J 2MKCA 5KFOA 2R7UA 2QO3A 2XWYA 1U2FA 4NLWA 2HGMA 1AUDA 2A10A 2CFXA 4CLTA 4NLYA 4KYZA 3KJVB 1UEVA 3H8YA 4GVBA 3EJMA 4LF4F 2E9RX 5GAHU 5D0RA 2YKAA 5KFMA 4ID8A 2J5AA 2COLA 4LR9A 4QWBA 3M6UA 3HHEA 3LP0B 3LH2S 1W2BR 5KG3A 5E7OB 1JLQA 2YKMB 3VGSA 4IRKA 2HAFA 3H2VE 3NY0A 3FZBA 1E6YA 3M8YA 4JV5J 2IBKA 3CCTA 3CW2C 2I1RA 4AL5A 1NBEB 5H9EK 4YY3J 1R43A 4DX6A 4W98A 1J5EF 1NPKA 4JI4F 3UDLA 4Q44A 5B0CA 4OZ3A 2B7BB 4CLKA 1I94J 2CJ9A 3GYNA 4ZPDA 5EUHA 3KYLA 1TAQA 3OHBA 2F9JA 2Z2YB 4ECUA 5KFSA 1CC7A 5L9XA 4DR3J 4M63A 4DQRA 5A8WA 3QIDA 1T9TA 1RBLA 5HK4A 3R27A 1ELOA 3KLEB 3V81A 2XB2D 2W9CB 3G6YA 4FF3A 4KTQA 2Z0GA 3H4BA 1YLXA 1IN0A 2MKKA 5DM7Q 3CUNA 3RW7A 1S1TB 4YDDB 4ZLJA 1MROB 1RAAB 1OJ4A 2DY9A 4CT8A 2GMJA 3J7YI 3HVTB 2K1RA 4IDKB 2CPEA 2ERRA 1NH8A 1KHVA 2ZVIA 3G6ES 2CQHA 1LV5A 5ETVA 4I6AA 2DITA 3CT9A 2FZGB 2WVBA 2C3OA 4CWBA 1B4SA 1R8HA 2HAIA 1JXLA 2WB4A 1HIYA 1IKYA 3C15B 2UZAA 3U1MA 4MJKA 1MU2A 2MQPA 2ABYA 2R8IA 1AZSA 2KVQE 3PFOA 1SB6A 2JC0A 3HM9A 3C16B 2D3ZA 1MNEA 1S0MA 4U67Q 3T9NA 2ZOMA 5L9NA 7FDRA 2A18A 4ZP9A 3B8HA 2DO4A 4ECTA 1RBAA 2WBRA 2CJYB 1HW8A 1YKWA 2F8MA 2HBYB 3D1HA 1WC4A 1Y11A 2NLWA 4K4TA 1RAOA 3TVZA 2ZWOA 5GAEI 2OD4A 3FEYB 3W5YA 1YTYA 3MM6B 2MQMA 3B6BA 1KVIA 4NLSA 2IAJB 5CYQB 3O5TB 2RMLA 5A8RB 2IVYA 3AH6A 2FGCA 4L73A 5E33A 1JLBA 3DLKB 2UXDF 3IS9B 4XAKA 2HHSA 4C4WA 4K50A 3E2EA 3DLLQ 2VASA 3N6MA 3KJFB 4ZPVR 4JI6F 1EKRA 3KLHA 1U09A 2DKOB 4ZJLA 2OTJS 3R5DA 3JQKA 4ECWA 1CBKA 3HFKA 2IYIA 2N7YA 3UQSA 1U24A 1UJ6A 4DFKA 2UV8G 3UW1A 3GONA 2DO0A 4FXVA 4IO9Q 3RB0A 4OLPA 5FJ4A 4LIRA 3PM9A 3VVTA 3CMQA 3TJ8A 4ZS6A 1FEHA 2VBYA 5A6PA 5E41A 4V19J 1WACA 3TAQA 2F4VF 2B51A 1S7HA 1RUSA 3MR6A 2AJ0A 3DDIA 2X1GA 4D3HA 4JI8F 4IG0B 3K8VA 2R7RA 1UVIA 4OV1A 2AF6A 4NPOA 3CC4S 3MM8B 2K8GA 2BRKA 4PEOA 1DAXA 2DBBA 2DEJA 2F3JA 4Q5VA 4B3SF 1N34J 1TL4A 4U7CA 4X62F 3EPIA 1WORA 1FWKA 3OR2B 4DL0C 2KZMA 3QLHB 4LSZB 3ZZOA 2HZAA 4FNIA 3TJ9A 2RDIA 1DURA 1M1GA 1PJ5A 4F7VA 2YWFA 4P74A 5J2PB 2CJAA 3FCWA 2XHWA 2BVZA 4Y00A 4NLRA 4NLTA 4P71A 1B7YB 2VBXA 5ETSA 4RW7B 4LJMA 2KFYA 5DETA 2RUGA 2EKYA 4KIAA 4HDGA 2R9LA 1U1KA 5KFBA 5C7PA 3KKFA 3LAMA 1ZTTA 4QPXA 4B02A 3I4HX 2E29A 3T1YF 1S6QA 2DGOA 5CD4H 1XMOF 3R5JB 4I1TA 2DHAA 1I1GA 1RU1A 4YP3A 4DR5J 1UWBA 1V5IB 3HJVA 4NXMJ 4NI2A 3OQ2A 1KR4A 3IRXA 3IO1A 3OXFA 3FFIA 3A1YG 3TUPA 5CAAA 4DG1B 2BE7D 2BJEA 3H5XA 2MXYA 5DG9A 3G6VA 5GAGU 2ATLA 4ZLPA 4YHHF 5IM0B 3OLAA 2DH8A 2CWXA 3BSNA 1JLCB 2IC3A 4J9OA 3HHLC 4C0OC 3VF0B 2D3OR 5LM7E 4NWBA 4KHPF 3AD7C 4B9VA 1RT4B 5AE1A 2NXNA 1F60B 1A9NB 1S4EA 1JK9B 5K8OA 2XYHB 1EAYC 3PIOQ 3MGJA 4U7UK 5KG4A 3UWTA 4PQUA 1R0AA 1RT5A 4CQ1A 2I2YA 2QLJB 4L76A 3EDRB 3LGHA 1WC5A 4L74A 4NASA 2DNYA 4LIWA 2RF2B 1QJHA 3I6PA 1M5OC 5CZVA 3UFCX 2V4QA 4NZ6A 1PYOB 4OV6A 3FNNA 4QCLA 5B0FA 4FF4A 3IM9A 4B9LA 3I0SB 2LECA 2BW2A 1KLNA 5A2QY 3GMGA 3W9JA 2XS5A 2PT0A 4KO0B 1AA1B 2A2DA 4GKKJ 4CT9A 3OXLA 3TWZA 3DLGA 2BJ3A 3BS9A 3BBFA 2YNFB 1FJCA 3HHLD 4YR0A 4B3RF 4UOHA 5B09A 1HBOB 2G4BA 4ED4A 4DU7A 4R0JA 3JTOA 1ZPVA 4D3GA 1EETB 2QL7B 3PW5A 2QMWA 3DM2A 2G2ZA 1RT2A 2C2KB 5F8NA 2O01C 4F4ZA 2XEXA 1QAIA 4QW9A 3KHLA 2CDQA 1FRMA 5B0AA 4EO8A 3VAJA 5T41A 3OL8A 4C97A 3D0HE 2UUTA 1TL5A 2M2BA 4YEAA 1HNIA 5HVHA 2PN6A 1PAUB 3VHQA 1S79A 5KFJA 1DARA 3H7HB 2NR0A 2IIHA 4B17A 2YNIB 3VCDA 1N5YB 5DLFA 3MEKA 1SJRA 1Y3KA 4CDIA 4F67A 3NP5A 5GMKa 2D7SA 1WHYA 4PABA 4NEZA 1B99A 5ETQA 1LXJA 6AT1B 3TUIC 2DNMA 5C2CA 1O8BA 3G96A 2ZITA 2KYXA 2V5HG 5HQMA 5L1LA 1MN7A 1HKAA 4N56A 4GVBB 4LQ9A 1VC5A 3CE8A 3W9IA 2KT2A 3IWNC 3PJWA 3M9MB 3N79A 4BLGA 1AW0A 5D8HB 4KGMA 3W60A 1VQ5S 4DS5A 1FE4A 4OYBA 3HD1A 4NXNJ 5B08A 5BR8J 2JHEA 4I69A 4I2QB 1YJTA 3RBXA 3US5A 1F5AA 3K0JA 1BWVA 2OAUA 5C24A 1P9QC 4DR1J 2Z4PA 4HL9A 4X4NA 3MTKA 4B3MJ 2FJVA 1KC8T 3D6HB 1XEZA 2FLOA 2RS2A 1DY3A 3G8QA 2C2OB 4J5OA 2QTWA 3BH6B 2CJQA 4HHUA 1HI8A 5AE3A 5M2RA 3WC0A 1CG2A 3FKBA 4EWTA 3ZTRA 4X66J 5A8WB 2J9DE 3HVWA 1KWMA 1NJWA 1XNRJ 2X3DA 4F0KA 2NCKL 4HI2A 2PMHA 3V81B 1FTRA 3B54A 4X4SA 2OSRA 4A48A 1NDKA 4EK2A 3Q8UA 3HO1A 1UVJA 1SC3B 2RT3A 2JNJA 4QIWD 5KFNA 3HT3A 2EFQA 3H98A 3TUZC 4X64J 4WP3A 1H2TZ 2KVIA 3VAHA 3L09A 1UMJA 4OHZA 1NNDA 1RWKB 1CJTA 3BSAA 4DL2A 4LF9F 4K5RA 4DUTA 3FK4A 3E01B 2HMIA 1IKYB 1KQGB 5L46A 2GVDB 3MMJA 2YXLA 2QA1A 2KXNB 5KFTA 2GHPA 1EJ7L 4CO0A 2JLFA 4P2FA 3CD5A 2VQFJ 2YX4A 3KHRA 3Q2TC 3MD3A 1N32F 4LF5J 2MQLA 2BDPA 2PGCA 4DFMA 3KLGA 1G6BA 3K5NA 1GX6A 2ALZA 3DU5A 3KG1A 3CO9A 4LF4J 5KG1A 2MKYA 2IM1A 5FLXY 3CCWA 4EMDA 2FJBB 5CHCB 4RNNA 4J9MA 1SUQA 3R3TA 1H38A 2UUBJ 5HQ8A 1K47A 4H4KC 1NPRA 5AT1B 2HRTA 1X9SA 2EKNA 2WZ1A 5HMZA 4DSLA 4UQGA 3KLFA 1JLBB 2KDOA 1TUGB 3R6LB 2GQQA 2VONA 4L3NA 2B8PA 2HQDA 5DG7A 5IWAF 2RQKA 3M9OB 1J5EJ 4JI4J 1FJGF 2VZ9A 1X5PA 1JXEA 4LVNP 3MM9B 1YX2A 4KH0B 2ZNZA 3CD7A 3ZZTA 2UV8A 2N3LA 2D69A 2M7SA 2E1RA 2MKIA 2BOPA 1X4CA 2RH3A 4CH7A 2H5EA 5HVFA 2ZH3A 4U8YA 1R6YA 5J1NA 4AL6A 2CQ1A 1GNKA 5KFIA 1VCTA 1XR7A 5DO2A 1UAWA 2CJXB 1L5UA 1WDTA 3NS5A 1RTDA 5E3CA 2N7CA 2WSEC 3OVAA 5CYJA 3EMTA 1AFIA 4DL4A 3GFHA 4NA1A 1R7IA 3SSQA 3JSMB 1RWUA 3MPWA 2A6MA 3DC2A 1KQKA 3PHTA 3IA0A 1FNOA 2HQCA 5DQIA 1CC8A 4K4ZA 4I6WA 4DV0J 4ZPTR 1X4BA 1S97A 1HHQA 2DJWA 5DS7A 2UVRA 1FRLA 3FUYA 2OPPA 4H4KA 2VU5A 5HANA 5IV3A 4DQSA 5HLFA 3CEDA 5G0RB 2V8PA 4U96A 2UUWA 5KTQA 2FJXA 4FF2A 3GCXP 1XJWB 3S01A 4WTYA 3NGRA 1CQNA 3Q24A 4Y34A 3THTA 1YIJS 1S6QB 2KG1A 4NZ7A 3AA8A 1SJ1A 1UWBB 4JI5F 1Y3JA 5IC4B 2BKNA 1DJ0A 2VQEF 4QYRA 4ICLA 2M3DA 4H4OB 4NI2B 3IRXB 2XZDB 4K5SA 4X4TA 2ROPA 3FFIB 4AE5A 1RT1A 1QAYA 1RE1B 9RUBA 1D0EA 3QMQA 1CSJA 5KT7A 1D8ZA 2L9DA 1SH0A 4DV7F 3Q8RB 4YN3B 4QIFA 2KXHA 2DHGA 3BDEA 2ZVSA 2AJFE 4USIA 2IC3B 2ZUAA 4CIOA 1CVJA 2Z57B 3MR3A 1U2CA 2G13A 1WDDA 1NZAA 3HSJA 1YRUA 4J9KA 3C6TA 5ETPA 4C3LA 4PQUB 1R0AB 1RT5B 5DGAA 5ETTA 2ZH9A 3TQEA 1XERA 4Z2XA 1M5HA 5F0UA 2RS8A 3N6LA 1X0PA 4LSNB 4ZJOA 3K58A 4FZVA 4DPYA 2UP1A 3D7SB 4ECQA 2F4VJ 2XYGB 1XMQJ 1UFKA 4CLLA 2ZOGA 2V50A 1N5VA 1J27A 1OIAA 3J7YU 3DOKB 1QTMA 3O6QA 4I2PA 1B64A 2ADCA 2CQ4A 2DNQA 4C0BA 4P2XA 2K2PA 5J2QA 3U7JA 4U6PA 4DLGA 4J37A 2FY1A 5D0GA 4ER8A 3QSYB 3R5GA 3PNIA 2M52A 5F3ZA 1RT2B 3RBEA 1Y0HA 5EX3A 3MPYA 4CNZA 1PAEX 1TL1A 2VB6A 4C2MA 4J9QA 2Q79A 4LT6A 4O3SA 1HNIB 3PVXA 4DSJA 3OD2A 3D1QA 3LO3A 3QAUA 2VA3A 4DU8A 2DTJA 2WCXA 1ZAVA 3OVSA 3ELHA 5IT4A 1MSWD 5J2MA 2PC6A 3H5SA 2QA4S 2JDJA 1LQ9A 3E51A 1RT6A 4CI0B 4WIIA 2H4YB 5L1KA 5GAEU 2CVIA 4RU9A 4RNOA 4JOUA 3A8IA 1N5QA 2OO4A 4HVZA 3PO5A 2KHCA 1UTAA 4ECZA 1IJEB 4CLZA 2FGOA 1FKAF 2FZCB 1N5TA 2VPWB 2M4MA 2W24A 4O3PA 2F8HA 4OYPA 4UT4A 1H7WA 4YHHJ 1N33J 1S99A 1W26A 3ZXWA 3Q23A 2POKA 4DFJA 3GLJA 3JSYA 1REGX 4R8UB 5E2QA 4KHPJ 1ACMB 2B43A 2CNKB 4Y28C 4YB7A 1T9YA 3D2WA 3CPWR 2OMLA 1T95A 2B4PA 2CPDA 1SV5A 2I38A 2ZH2A 2H51B 1RSCA 5EWEA 2IRUA 2ZC3A 1LW0A 3AB4B 3NNCA 2CZ4A 4DDFA 2GX8A 1IWGA 5F3TA 4ID5B 2KH9A 1U1RA 3HX9A 1Y10A 3RAMA 5KFUA 4JI1F 4RLEA 3KG4A 1R6VA 3BGLA 3LP1B 1HYSA 3GZ7A 2UXBJ 3BGUA 2FC8A 2D3UA 1BD6A 1HARA 3G8TA 5DLGA 2VDIA 4W92B 4ZIWA 4F4YA 1CULA 2NQPA 1T8EA 4ZVQB 4A8XA 2OUGA 2C3UA 1C0UB 2V34A 5AXLA 4MYTA 4RW8B 5I3UA 2AKWB 3EGWB 2GGPA 4E2FB 1HQUB 5C25A 1TMMA 3Q8PB 2JZ5A 1S6OA 2DNOA 1S9GA 4U7UD 1CJTB 4V1Ak 2V0NA 2IA6A 4ZVTB 1KEKA 1JLGA 3KTQA 2MQNA 5LSOA 1EP4B 3T5HA 3PRBA 1AUSL 5LJ5Y 4YFUA 1EIYB 4DXLA 2MTLA 1WEXA 1IKVA 3OTOF 2KL8A 1VQPS 3O3LA 1LWFA 2HURA 2WRMA 2FVCA 3KHHA 4B9MA 3S8SA 1K1QA 2ROGA 3QO9A 2CQ0A 2KRRA 2YWWA 4ED3A 4HACA 4RO0A 1VI7A 1VQ6S 5K14A 5ETRA 3MOZA 2PEBA 2M88A 3JTNA 1W25A 2ACYA 2D1CA 1D9AA 2Y0BB 1SUQB 4IKAA 3ZZRA 3NNHA 3GTYX 2B8QA 1C1BA 1MWQA 3SFGA 3J7A1 2EPIA 3POTA 1YSJA 1Q78A 5HVGA 4L6V3 3ULHA 3OUYB 4PG7A 4B3TJ 4JI0F 5K8PA 1FWPA 3QSIA 3ZZZA 4MIWA 2E9ZA 1RACB 2XSJA 1VIXA 1TV6A 3BQ0A 1D9FA 3O1LA 1B70B 1VJQA 3BGOP 4MFBA 5KFZA 1MW7A 2KFNA 3OBIA 3N01A 3SMZA 3FBEA 5CZXA 1ZA2B 4KY3A 5KG2A 2HNYA 4CTAA 1WD6A 4QWCA 2JEFA 2MEWA 3SCLE 3W2VA 2FJWA 3CDWA 2MJNA 5A2QU 2MB0B 1X5TA 3K17A 3N6NA 3BQ2A 1T02A 1N5SA 2HHQA 5CABA 1RTDB 4BCAA 2HIQA 3AJ1A 3MDFA 3HPOA 2E5LF 1TU0B 1WG1A 3VZIA 4K8RA 5HAOA 1IBKF 2OGUA 2QFIA 2IBOA 4ELUA 3V6HA 1TKZA 3NS7B 4CO2A 2FY8A 4LF9J 1TKTA 3CSKA 1KFSA 4PRFA 4LFBF 4USKA 3DMJA 1GXUA 3CF5Q 2GJIA 1U6BA 1Q8LA 1S6UA 2OPPB 5JMNA 2IY5B 2W9AA 2KB2A 4OFZA 3OFEA 3BO4A 4DR7F 1KBRA 3VVUA 4ANCA 4OZLA 5HLFB 1Q8KA 2QSWA 1B0TA 2L9WA 3PW4A 2E1MC 2J8AA 3HJFA 2E5HA 4Q0BA 1RA6A 3J7Z5 1XTZA 2A2CA 3LGMA 1F6TA 3D68A 4ICLB 4YR2A 4M5GA 2EEYA 3UDEA 4Q7AA 4F3OA 4ZP7A 5EWGA 3UD5A 1LWCA 2RRAA 4JYAF 3D1OA 3DLJA 2GQCA 1VHIA 4ZOSA 3Q22A 1S76D 1CEZA 1UVNA 8AT1B 3AAWB 1QSSA 1YI2S 4PG6A 2E7XA 1RT3A 2R2SA 4DQQA 5BJRA 3MFHA 1RWNB 1JKHA 1FX2A 4JV1A 4YB1P 3EGNA 3H42A 3EXYA 3QJPA 3WC2A 5D4NA 2XWXA 3G87A 3C6TB 2G2YA 2H4WB 1PIEA 2HSEB 3H0PA 3ENQA 5CH7B 2V67A 4KAIA 3NGDA 3BEGB 2QC3A 2Y3YA 2PD1A 3D9BA 3NS6A 3N4WA 2FHOB 3DRSA 1N54B 4ZPBA 1JJ2R 2HRYA 4WWSA 2HFOA 2XGPA 4WBFA 1U45A 2FD2A 1U49A 2RDJA 1VOMA 1NK4A 4X2BA 2K06A 5J2QB 2BOAA 2GO8A 3MPDA 4KKOA 4BBYA 1FHTA 3ZNJ1 1VFJA 4P2SA 3DN9A 2HBZB 1R0BG 2FHKA 2OI2A 2CG8A 3OXGA 2HWIA 3UDCA 2GHWA 4LREA 2MLYA 2A1BA 1TL1B 2SXLA 3GIKA 1L3TA 2OIHA 1WF0A 1H72C 4C7QA 2C28A 2CZVC 4LF6F 3SSRA 4DJBA 3CD0A 3NCQA 5J2MB 2ZFHA 1SIWB 3IMQJ 3M8PA 3DCAA 1RT6B 2EFPA 2KZZA 5IOLA 2GMHA 2XZTB 4TVAB 1TZ0A 4NLPA 4ILRA 4DL6A 4JI5J 4RNHA 5MLCV 3NWRA 2HHXA 2JC1A 4TYAA 2ZH4A 1TK8A 2IJRA 3K5OA 3PR4A 2C3MA 1VQOS 3RG6A 1RT7B 2EXUA 3AXMA 5FLXU 2VV5A 4CH0S 5F0WA 4DV7J 1NEEA 4WFBQ 3TOQA 3U27A 1WSRA 3TUJC 1DLOA 4DUZJ 4EZ9A 2KHDA 4K4SA 4BDPA 1RYRA 3MCOA 2R3VA 1RABB 1XR6A 2H48B 1K44A 4Z7CA 1U26A 1PYSB 4F2RA 1XIQA 5LJ3Y 3H25A 3HFZB 1X60A 2WONA 1D9DA 1RP5A 3MM5A 3AA9A 4FBUA 2RIJA 1SV5B 1H0HB 1MLAA 4DCJB 1I6JA 3H4DA 3OTDA 4LFCJ 1LW0B 4CLUA 1Y7PA 3DGPA 2Q6CA 4ETZA 2M8HA 3TAPA 2DGXA 1O0PA 3VGUA 4FXDA 5IQQA 1HBUA 2CJBA 2OPSA 1HYSB 4FS2A 3IG1A 2H5JB 3FSXA 4A47A 3CCES 4OI0A 5K8NA 3RRHA 3S6EA 4OJGA 3UR0A 3JQMA 1EKSA 1QVFR 1CULB 3IR6B 1A7GE 1CLFA 4NRTA 1BQMA 3L7UA 4K4XA 5I3UB 4X4RA 2NYHA 1RTIA 1HD0A 2GGPB 5K9FA 3ETOA 5C25B 3HDSA 2ZKTA 3AOBA 1JMTA 5A76A 4ILMA 1S9GB 3L3CA 1RJJA 2MKHA 1FDNA 4PWUA 3SCJE 2B56A 2IMOA 3OTCA 2G0JA 1FTCA 1U1NA 1S59A 1IKVB 3HLUA 2VG5A 2HRUA 4GO7X 1OO0B 3CDUA 2Y8WA 4O44A 1LWFB 3R2CJ 4ZPWR 3I4PA 1WJ9A 3VR1A 4LRAA 3TZYA 3UN5A 3M8SA 2QV6A 3OFFA 1MWZA 3QO9B 2XMJA 4EBEA 1R8AA 3MOJB 2DISA 2J8SA 3K5MA 4P72A 1VQ7S 4URQU 4ZN1A 3CTRA 5K14B 1ZETA 2B7CB 2J9DA 3LANA 2DCLA 1OY6A 3FDSA 4USWA 1IM6A 2C42A 2OLWA 3MR7A 3FMWA 3TYTA 2EBGA 4H54A 1S1VA 4EGLA 3QT8A 1TFWA 5D0HA 2MZSA 4ECRA 4NOHA 3RGIA 4C98A 2NREA 3SCIE 4IRDA 4DSKA 3M2VA 2F40A 4NCAA 1U1LA 3SDEA 2XCAA 4XIUA 3KMSA 1JJHA 1JB0C 3RR8A 2XSJB 1KTVA 1TV6B 3IBCB 4GMKA 5D15A 3CCZA 1UL3A 5LOQA 3SQGA 3P49B 2EC2A 4ZVFA 5ETMA 1JIHA 2NXEA 2E7VA 3R5BA 1QM9A 2O5DA 1DQ9A 4BWJA 4ZVEA 5AXMA 4JI1J 3KUEA 1SH3A 3ENVA 2VC0A 2HNYB 4MAKA 3IAS9 4CTAB 3QJLA 3HK2A 3W2VB 4G3IA 4USHA 5H9EJ 3QRPA 1RWPB 3CJ3A 4MK8A 2ZOFA 2DNPA 5ETLA 2AJ1A 1WEZA 2HHHJ 2IM3A 3AOAA 2XNRA 3GB0A 5HQLA 1BY9A 4J9LA 1WG5A 5CXTA 1UA1A 3MZIA 1TKZB 1GXTA 2RNEA 5AJ3F 1IKWA 1TKTB 1I5OB 4N41A 3HKWA 1R27B 2BX6A 4TN2A 3DMJB 3EDQB 5FIIA 2J0XA 2ZKUA 2E7WA 3Q8QB 3BR9A 3L9ZA 1FCAA 1HW9A 4X4OA 3W2WA 4DI6A 2DGQA 2KKHA 3ICLA 1JNRB 1R89A 4C8KA 5KOWA 3PCOB 5KFXA 2PDAA 2AEJA 4K7QA 4LF2A 4JI2F 2GIQA 5DDOC 4Q0BB 3C8YA 3HULA 4F4KA 4OHYA 2GV1A 5L38A 2Z30B 3CDEA 1N6QB 1BE4A 3HCXA 1S10A 1SI9A 3R7NB 1VK8A 4NRUA 1XMBA 4ANEA 5A6WA 3CJ8A 4WZMA 4U9RA 2MHEA 1LWCB 3QATA 1WG4A 4RPFA 3S7RA 1GX5A 1KFDA 3D0GE 3T1HF 1FKOA 1C1CA 4F26A 2VUGA 1Q8BA 2D74B 2JEGA 3JYTA 1XN9A 1T3OA 3DRXA 4UOGA 2MZRA 3KLIA 3N5BA 1NDPA 1VQYA 3HSGA 2U1AA 4M5IA 3OLBA 4CM0A 3G6XA 4DPWA 1FKPA 5A0YA 2JLEA 1FX4A 2K3IA 2ZE2A 3PEHA 3FBBA 4RBVA 2RU9A 1TVRA 2ZZTA 3K89A 3I5BA 3ZZPA 4BHQA 2HVDA 4M8LA 4ZITA 1G3OA 3MECA 1NJZA 5L8RC 3UCZP 2C2RA 4L72B 2HHWA 1GXLA 1U0HA 4IO1A 1F9FA 1GAOA 2FHJA 1NRKA 1FFGB 4AT1B 1TL7B 4Q43A 3ISND 4ALZA 2XS2A 3W64A 1N48A 4XDCA 1UVKA 2FDNA 4KKOB 4B3OB 2XTJP 2KFZA 2MPUA 4UZBA 3V4IA 4K4VA 2E5LJ 2WSFC 2B6AA 1TL3B 4NA3A 2MZJA 5K20B 1NCLA 2WTFA 2NYIA 2QN6B 3SQOP 4ZCKA 1F5BA 3I56S 5AE2A 2KN4A 2RB7A 1FRHA 4F02A 3M8RA 2LXIA 1UZHA 3GIRA 2OPRA 1SBRA 3VTIA 3RRGA 1VC6A 1WHWA 1QLNA 1VQLS 5F8IA 2FIUA 3EYZA 5H9FJ 3M8PB 2RU3A 2BABA 1RZMA 2GIFA 2RD5C 4PQAA 1TELA 1HMVA 3TZZA 1JLAA 1RHRB 1GMWA 2XMMA 3TZXA 1CS4B 1IBMF 3GILA 2UU9F 2BJ1A 3EVOA 3VWSA 4Y0FA 1IQZA 1WUUA 2HS0A 4NYPA 1NO8A 5EN1A 1FK9A 1FXRA 3IWXA 3BO3A 1VBZA 1IWAA 2HNZA 1HHTP 4DX8H 3BQ1A 1RU2A 2IMWP 3G82A 4C3KA 4YUDA 1DLOB 2R8GA 4I4BA 4P52A 2HNDA 1OPZA 2AYBA 2BANA 1IM4A 4A8FA 3RJMB 1B0PA 3FQKA 3GQCA 4QZVB 3TAMA 3PW2A 4IG3A 2VPZB 2MKJA 3H2UB 4OQJA 1Q79A 3LP2A 2QLFB 2WONB 4B9NA 5EHHA 3T5JA 2XQCA 2V68A 4C8YA 3AD9C 4OZJA 3BSOA 3UO0A 3ILIA 4IUFA 1C0TA 2GFFA 3DGPB 1ZZFA 2OPQA 4WK3A 3CJKA 2CKWA 2H9ZA 2DR8A 5M2UA 2IA0A 1HBUB 3TO8A 3CDAA 4H4MB 2OPSB 5J2NB 3TARA 3IG1B 3OR1A 4MIAA 2P6TA 5CQGA 1ZM2A 1KDNA 3AQOA 1HQEA 4OLOA 1IR1A 3FSIA 3N9UC 3BGFA 4R5PA 4QOTA 3ZTOA 1YJNS 2YWGA 4DV1F 1RWXB 3BREA 2ZD1A 1BQMB 3M8ZA 2N4DA 4R0EA 2HG4A 4ERDA 1WF2A 1HBNA 3GYGA 1HI0P 1RTIB 3I5CA 4DV4F 2CQ2A 2B5JA 3DLBA 2W9BA 4URGA 2MSTA 3NGUA 4WFAQ 3MCMA 3IGNA 2DYAA 2UVUA 2UUCF 2CXEA 4USUA 2HFZA 4OYMA 4WU2A 3MMCB 3MMAA 1QUPA 3D6FB 2HQFA 3ILLA 3JQJA 1FWLA 4LFAJ 4FYVB 3MUVP 5L1IA 2Z56B 2KRBA 4LF7J 4K4UA 4AL7A 3NMRA 2R2RA 1SL0A 4YB5A 4TQRA 1UEKA 4CM2A 3A8JA 5KT6A 2ILYA 1IR0A 1FD8A 3UD3P 1U1OA 2DNGA 1CJUA 3PYEA 4AYBD 2CNNB 2A3JA 2XMWA 4ITSA 1S6PA 4MKVA 3AXKA 1KSPA 3R5CA 3HHNB 4A4JA 4PUOA 2AT1B 2OHDA 5D0EA 3Q8SB 2OSQA 3DNCA 4FN5A 2DH9A 4QYZJ 4E8UA 4JP8A 4OYOA 3O44A 2MY7A 3T19A 3I31A 1S1VB 4NEYA 5F8JA 2DGWA 2ASJA 3GG1A 3OL9A 2O1PA 4PWDB 4C11B 3M2VB 3TW0A 2FVRA 1X9WA 1VIOA 3WBZA 5HL7Q 4DL7A 3R1LA 1X4FA 2Z2ZA 1TKXA 4KGVB 3I5AA 4NA2A 4FDFA 3W3SA 4KSEB 2CPXA 2IDEA 3FEXB 1KLMA 4I6YA 1NH7A 3LALA 4KPYA 1J5OA 2JRSA 3SQGB 2ZH1A 3PFEA 1RWOB 2GVZA 1DBDA 2HHPA 2ASDA 3SEOA 1PKUA 3QT7A 2G2OA 3RB6A 2AEMA 4DV3F 5FD1A 1NJYA 3CMAS 3DRPA 4ZCMA 3IXQA 2BV3A 1RTJB 3ZFVA 4TLQA 1RXOB 4E0DA 2HKEA 5IC6B 3RRKA 4JI3F 4Y2KA 1U1QA 5DRKA 5ETOA 2VG6A 3F73A 3VQTA 2Q66A 1FRIA 1QE1A 2UUAJ 3DRRA 2MZQA 2YNGA 3LPEA 4ZVUB 4ED2A 1UETA 1X4HA 3V4MA 1F5CA 3W8GA 2IPOB 3NNAA 3CB4A 1X31C 5A8KA 5JJBA 2E5JA 3UVJA 1ZS6A 1IKWB 4LRCA 1YZ6A 4LF1A 5D6GA 4TU9A 1LW2A 2MHNA 3DOLA 4LUBA 5HATA 1LXNA 3RB3A 3ZNUA 1AT1B 2LA6A 2P6SA 2P8IA 4F3QA 3W2WB 2H5IB 3MWBA 3UD4P 3MAAA 1OYEA 5EDWA 2FVQA 3C46A 4DR3F 1H98A 2HFSA 4X4UA 1WHVA 1TUWA 3DI6A 2F7VA 3NOCA 2RHSB 5CYMA 2ACMA 4ZHRA 2W1BA 4WYWA 3DDKA 4DV2J 1PJ7A 2YX7A 2XO6A 1HWIA 4P75A 4TY8A 4DV5F 1JLFA 3ETMA 2BBEA 2ZH5A 2VFRA 2YKQA 3N28A 1ZH5A 3AODA 2CADA 3CIZA 2V2ZA 3VAFA 3EVWA 4I0WA 1ZA1B 4XPEA 2DPJA 4KFBA 5GADI 3LUYA 1C1CB 4IH7A 2XMVA 1F9HA 4KV8B 3PG9A 5KG5A 5H9FK 4NLVA 5C5JA 3JYTB 5F8GA 3IWLA 2BQ3A 3KLIB 2IVFB 3M2UA 2ZH8A 2B9WA 1AROP 5A0YB 4DZ6A 1HWKA 4TLRA 2CPHA 3THPA
chains in the Genus database with same CATH topology
3MHYA 4RWWA 2ZE2B 2N3OA 3OTOF 2DRBA 3X1LB 4DR6F 2FPHX 7FD1A 1NJXA 1VQPS 4IOCQ 3O3LA 1LWFA 1S1XA 3ITHA 3KHGA 1BLUA 1SQEA 3GWCA 2QIFA 2XLJA 1TVRB 3GYXB 1HHSA 2WRMA 2FVCA 3KHHA 1CPZA 2RF2A 4RNMA 1N56A 2B4VA 3CMES 4B9MA 4CO4A 3HZGA 3MURP 2YNHA 5KFRA 3MF5A 2Z2MA 4PXCA 2XG8A 3S8SA 1K1QA 1MMLA 3MECB 2JVOA 2ROGA 3QO9A 1XNRF 2CQ0A 3FQLA 3N5FA 1UJ5A 2O67A 2KRRA 3T6JA 1WELA 2O3DA 4X65F 3LGNA 3CCVS 4ED3A 2EFNA 2KT3A 4DLEA 1DTTA 3I0SA 5B0DA 3DLHA 2MYFA 3MM7B 1VI7A 3LF0A 3K7RA 3CJ5A 1OS5A 5KT5A 5KT4A 4DPOA 1VQ6S 3BR8A 3QYYA 4MK9A 5K14A 4HH0A 4ATNA 2LQJA 4KO0A 2R8HA 2LMIA 3MOZA 2MY8A 1VBXA 1SKRA 4UY8T 1PO6A 4DBQA 4ECVA 2XS7A 1RTHB 5SZTA 2M88A 3B4MA 4USJC 2P9CA 3JTNA 1W25A 4O4GA 2FVSA 5U47A 4O3RA 2DGVA 1OSCA 2ACYA 2D1CA 4LVOP 1D9AA 1JNZB 4AXJA 4X64F 3VAIA 1SUQB 3EZUA 3L7PA 2GW8A 4IKAA 3V4IB 3ZZRA 1T3NA 4AXIA 5C42B 1DTQB 3JSRA 2RJZA 2ZHOA 3NNHA 4IYQA 4KFBB 1WI8A 1T03A 3GIMA 1X4DA 1C1BA 4QR2A 3SFGA 3J7A1 2B6AB 2EPIA 3POTA 1YSJA 5KFHA 2R7VA 2LEBA 3D28A 1EETA 1RA7A 2EFGA 2UVWA 1Q78A 2BR0A 1QY7A 2HHUA 2P9EA 4CO3A 4L6V3 1DHMA 3ULHA 3OUYB 4QR0A 2B9XA 2X1AA 4PG7A 4Q8EA 4RW9A 2EFVA 4JI0F 5K8PA 3HI9A 2HS4A 5ITHA 5KOXA 4ED0A 3THVA 3ZZZA 4MIWA 3NAIA 4FYDA 4NX9A 2E9ZA 1Y5NB 1L3UA 3V6JA 3R5AA 4JV0A 1YVFA 1LWEB 2XSJA 4NYOA 1JLGB 2XGQA 1VIXA 4ES1A 3OV7A 4HKQA 3M1VA 5K8MA 2OPRB 3QIPB 4KQZA 4GKJF 2JWNA 1TV6A 3BQ0A 2YH1A 1VMBA 2J76E 2LU2A 2RE1A 1D9FA 1IQTA 2BXJA 1KVJA 3O1LA 3M9NB 2R7QA 4PKDB 2DK2A 4YQWA 5E0OA 2AU0A 2YNIA 4I7FB 3QWUA 2VH7A 2W4CA 4MFBA 4DR2F 2XY7A 4DQPA 1TK5A 5DQGA 1N5YA 1JWWA 1SC6A 2CVEA 4ZVHA 3RAQA 1PGZA 2MKSA 4MKAA 5KFZA 1MW7A 4M94A 2KFNA 1V9OA 2J6UA 1NHUA 3OBIA 4EZ6A 5L39A 5DDPC 2R2UA 4XK8C 3N01A 4DL3A 3SMZA 4FBTA 1JLAB 4OHWA 4TNOA 3EXCX 5CZXA 2J0WA 2DNKA 3HP6A 2MKCA 5KG2A 4NLGA 5KFOA 2R7UA 2W7AA 2XBPA 4IQXA 2HNYA 3TX8A 2QO3A 2XWYA 1U2FA 4NLWA 2E44A 2HGMA 1WD6A 2J9EA 2LU1A 3M4XA 4CTAA 4QWCA 1AUDA 2JEFA 2A10A 1RDRA 2NSBA 2CFXA 2W4PA 2WB1D 3SCLE 3W2VA 3OHAA 3HF5A 4NLYA 2M70A 4HH1A 4ED1A 2BJDA 4Q2MA 1DTTB 2NS1B 1M0SA 4UUWA 4ZCLA 2FJWA 1P1LA 3CDWA 2RRNA 3KJVB 2MJNA 1UEVA 3H8YA 2MB0B 1Q86T 3BDPA 1X5TA 1HNVA 2CYYA 2ROEA 5KFAA 5KG6A 2LQ9A 1DRZA 1FK9B 4LF4F 1Y00A 3N6NA 5GAHU 3BQ2A 2E9RX 1T02A 1N5SA 3X3UA 5HMXA 2L3MA 2JOQA 4NYZA 5J1EA 4HT5A 1HNZF 2HHQA 4JV2A 2YKAA 2HNZB 4EO6A 1RGVA 5KFMA 1RTDB 4ID8A 2J5AA 2COLA 4BCAA 4QWBA 2KYZA 3M6UA 2HIQA 3HHEA 4C8LA 3LP0B 1C4AA 3HVTA 3LH2S 1W2BR 3AJ1A 2HNDB 3MDFA 5KG3A 5E7OB 1JLQA 3HPOA 4DUZF 2YKMB 2E5LF 1WHXA 2R7SA 2PE8A 2BANB 1ZM3A 4IRKA 1C1BB 1U25A 1WG1A 3VQSA 4ZCIA 4MMOA 3VZIA 1VBYA 3H2VE 3M8QA 2C2DA 3POTB 1IBKF 4MKYA 2IBOA 4PCQA 3FZBA 1E6YA 2YQ3A 3V6HA 4ELUA 1CQMA 1TKZA 1VQ9S 2RQMA 2YVSA 3TAMB 2IBKA 3CCTA 4IG3B 5IFMA 4CO2A 3TVKA 3FRZA 4NL5A 1TKTA 1H2UX 2JX2A 3CSKA 3R1HA 1KFSA 2I1RA 3BJYA 4PRFA 2WW8A 3GFYA 6FD1A 4LFBF 4C9DA 3DMJA 1GXUA 5F41A 4AL5A 3CF5Q 3T5KA 2X3GA 2GJIA 3TVYA 1YJWS 1R43A 1U6BA 5KFDA 1Q8LA 3Q0AA 2J6SA 3UPFA 3M1VB 1J5EF 1S6UA 3KK1A 3UDLA 2AD9A 4JI4F 2XZWA 4Q44A 5B0CA 2VBWA 4LFCF 2OPPB 1DQAA 1C0TB 2B7BB 2OPQB 1NAQA 2CJ9A 3CJKB 4NLDA 2KB2A 2W9AA 4MFBB 1HR0F 4OFZA 3OFEA 3E3XA 3GYNA 3BO4A 4ZPDA 5EUHA 4DR7F 2HFNA 3KYLA 1TAQA 3OHBA 3QPIA 1HI1A 2F9JA 5KAKA 3H5YA 4I68A 1FXLA 4OZLA 5HLFB 4ECUA 1TAUA 2MGZB 5KFSA 3QZ8A 1CC7A 3CJ0A 5L9XA 4M63A 3EZ5A 2QSWA 2V4JA 4DQRA 5A8WA 1FDAA 3QIDA 1B0TA 3DLEA 3R27A 4A8QA 2HVIA 3OVBA 2L9WA 4RW4B 3PW4A 2E1MC 1K1SA 4NLOA 2J8AA 3GIIA 2ASYA 2QSFA 1ELOA 3HJFA 1HQEB 2E5HA 3KLEB 3CCRS 3V81A 3PRDA 3KMQA 3UCGA 4Q0BA 4A8KA 2XB2D 2W9CB 2BZ2A 3G6YA 2E1CA 1RA6A 3J7Z5 1XTZA 2A2CA 3LGMA 4FF3A 2HPUA 1T05A 2Z0GA 4KTQA 3H4BA 2LA4A 4R5PB 1U2RA 3G9CA 1IN0A 1VLYA 2K3KA 4ICLB 4QJVA 2MKKA 3FRYA 4NXMF 1H3DA 3IR7B 4YR2A 5DM7Q 3CUNA 3RW7A 1S1TB 1DQ8A 4YDDB 1E6VA 2WOMA 1S9EB 3OTEA 1BQNA 1MROB 3DOMA 3IR5B 4Q7AA 4NMLA 4GC6A 4F3OA 3SV3A 4ZP7A 1S10A 2I5JA 1S0OA 3RR7A 3MAHA 2V8DA 5DDQC 4A46A 5EWGA 3VAGA 1HBNB 3N0VA 4RUAA 3MFIA 1LWCA 2IAJA 2PEHA 2OTLS 2RRAA 4CT8A 4JYAF 2GMJA 3J7YI 1SL2A 3GR0A 2CQDA 3D1OA 1S72S 1FD2A 3HVTB 2B5JB 3DLJA 2GQCA 2V8GA 2XO7A 4QIEA 3GIJA 2K1RA 2HHTA 3NBPB 1JLQB 2LDIA 4M5DA 4ZOSA 4IDKB 5BYSA 3Q22A 1S76D 4P7VA 1CEZA 2CPEA 2QA2A 4N47A 2ERRA 1UVNA 4AQYF 1NH8A 3ONQA 3AAWB 3CCLS 1QSSA 1YI2S 1KHVA 4PG6A 3G6ES 2CQHA 2EBEA 2F1FA 5GVQA 2E7XA 3J81Y 1LV5A 1RT3A 2IRXA 3DLKA 1E6YB 4WYLA 2R2SA 4DQQA 1HA1A 3RTVA 5BJRA 3M2RA 3SXLA 3GFZA 3MFHA 1JKHA 4I6AA 4RUCA 2DITA 2VFSA 3CT9A 4ED8A 4JV1A 2C3OA 4YB1P 2EW9A 3EGNA 3MMAB 1R8HA 2HAIA 3EXYA 1JXLA 2WB4A 3QJPA 3WC2A 3DHWC 1IKYA 5D4NA 4FPRA 3IN5A 2XWXA 4R25A 3C6TB 2UZAA 4RKUC 3U1MA 1N8RT 4MJKA 5KFLA 1MU2A 2ADBA 1FVSA 2ABYA 2MQPA 2R8IA 1K0TA 3T9ZA 2AGPA 2AV5A 3CVKA 3HHLB 2BQUA 4OJ1A 4TKTA 3ENQA