2RNEA

Solution structure of the second rna recognition motif (rrm) of tia-1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
115
structure length
115
Chain Sequence
GSSGSSGQKKDTSNHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Tia1 protein
publication title Solution structure of the second RNA recognition motif (RRM) domain of murine T cell intracellular antigen-1 (TIA-1) and its RNA recognition mode
pubmed doi rcsb
source organism Mus musculus
total genus 16
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2007-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rneA01
5LJ3Y 4LMZA 2M8DB 3R1LA 2CPXA 2OSRA 1HD1A 1WEZA 1U1NA 2HVZA 1YHQS 4W92B 2DGVA 2XS5A 2M7SA 5IM0B 3CCRS 2LQ5A 3CUNA 3BO3A 4PRFA 2KRBA 1N88A 1U6FA 4LJMA 4TU9A 2MB0B 1VQPS 1UFWA 2G1DA 3V4MA 3EGZA 1A7GE 1KOOA 5ITHA 3CC7S 1WF0A 4FXWA 1K8AT 1FJEB 1A9NB 2DHAA 1CVJA 5HO4A 4WKRA 2MZJA 1G2EA 2V94A 1YI2S 1KC8T 3N9UC 2FPHX 3EGNA 1KD1T 2HGNA 1M90T 2Q79A 2KM8B 2KHCA 2KG0A 4CQ1A 5GAEU 3CULA 2MQNA 2DNLA 2J0QD 2CPJA 2CQ4A 3EX7B 2RQ4A 2RU3A 2BOPA 3MD1A 2CPFA 2M0GB 3TP2A 2JWNA 4U67Q 3L3CA 2VODA 1VBYA 2M52A 2RVJA 2CQ1A 2ZJRQ 2PEHA 3HI9A 3G6ES 3OW2R 4TLQA 2ERRA 3THPA 2XNQA 4IOAQ 2EK6A 3MDFA 2MGZB 5GADU 1U1RA 2LMIA 2SXLA 1U1PA 1JJ2R 2F3JA 2DO4A 5IQQA 2QA4S 1VBXA 2DGUA 2MSTA 2DH9A 3PIPQ 3VALA 1Q81T 3S01A 1X4CA 1VQNS 5GMKa 2CPZA 5DDPC 3MXHP 2EVZA 3G8TA 1F9FA 2MHNA 2CQDA 3U1MA 5D77A 2WBRA 2KXHA 2DK2A 1M5VC 1S79A 2M88A 4UQTA 4IO9Q 1X4GA 2JRSA 3VAKA 1D9AA 2M4MA 1VQLS 2GO9A 4YUDA 1Q7YT 4FXVA 2D9OA 2ADBA 3CCVS 1X4AA 1FJCA 3BS9A 5CXTA 3H2UB 3K0JA 2DGSA 2RS8A 3Q2SC 4CIOA 1X4DA 5CA5A 2DO0A 2KXNB 2YTCA 2AD9A 1X5OA 2DNNA 3G96A 2KU7A 2ADCA 2AYGA 3CD6S 1VC6A 3UWTA 1XN9A 3NS5A 3UE2A 1WHXA 2D3OR 1H2TZ 2E5JA 3RW6A 2L08A 1N54B 1O0PA 2NZ4A 1WEYA 3US5A 4QU7A 3VF0B 5LSLA 2CJKA 4LIRA 1Q86T 1X4BA 1SJQA 3CCQS 1VQOS 2DISA 2MZQA 5LSOA 1WF1A 4YB1P 5DM7Q 2L41A 5IFMA 3CPWR 2HGMA 2MKIA 4QPTA 2MZRA 4J5OA 1PGZA 1KQSR 2E5IA 5FJ4A 2G0CA 3UCZP 2DNZA 1H2UX 5DDQC 2CPYA 3I55S 3MUMP 3VAMA 1K9MT 1OO0B 3DLLQ 2VONA 1HL6A 4PKDB 2JVRA 1VBZA 1X5SA 2A3JA 2DNMA 2RRBA 3CCMS 3UD3P 2N7CA 1SXLA 2HZCA 1OIAA 1FT8A 3CF5Q 1R8PA 2LEAA 2QEXS 2N3LA 2MSSA 3VAIA 2LECA 3IRWP 2FC9A 4OZ1A 2KRRA 2YWKA 2MMYA 3ZZYA 4WF9Q 1PO6A 5DM6Q 4WCEQ 3CCSS 2DGWA 4OZ0A 2X1BA 5LJ5Y 2FY1A 2XB2D 3D2WA 3SXLA 1FNXH 1N52B 2BZ2A 2RNEA 3CC4S 3P3DA 2MKKA 1RKJA 1WEXA 4TU7A 2OTJS 2M9KA 2B0GA 2DH8A 2RS2A 1WI6A 3NNCA 2MQQA 1U6BA 3J7YU 3P49B 1U2FA 2KYXA 1QM9A 1D8ZA 3S7RA 2MYFA 4M5DB 2KXFA 2DH7A 2YKAA 1JMTA 3NS6A 4QU6A 2LEBA 1JJ4A 1FHTA 2RT3A 4P6QA 2MXYA 2MY7A 2OTLS 3B4DA 2XNRA 2MQLA 3RW7A 1M5OC 2JX2A 4V19X 2AYBA 4BS2A 2MJNA 2FHOB 5DETA 2RQCA 3NNAA 1M5PC 1M1KT 3BEGB 3CMAS 1S72S 4C7QA 3R27A 5LXYA 1NO8A 2VOOA 1L3KA 3THTA 2GHPA 4Z2XA 2DNYA 1VQ6S 5EN1A 1DHMA 3DXBA 2DHGA 4WFNQ 2ZJQQ 3SDEA 3Q2TC 1WELA 2KFYA 3UD4P 3LQVA 3P5TL 2DNPA 2UP1A 3S8SA 3ZZZA 2CPHA 4W90B 1U1LA 2L9WA 1IQTA 2M70A 4F26A 1QVFR 1FJ7A 1FO1A 1QVGR 4ERDA 2MKHA 2DGTA 5CYJA 2XSFA 2DIUA 1URNA 1YJ9S 2J8AA 1VQ9S 5IM0A 1OWXA 4F25A 2ZJPQ 2LXUA 2DGQA 2MZ1A 1VC5A 5JVHQ 3UCUP 1VQ7S 2MPUA 2KN4A 5LXRA 3G71S 2CPEA 2RUGA 2OSQA 4RU2A 1ZZNA 2OIHA 3IWNC 2XS2A 2E5GA 2LA6A 4PR6A 3I56S 3VAHA 2DITA 3MI7X 1VQKS 2DNKA 4IOCQ 1X5PA 2HGLA 2I38A 4F02A 5JVGQ 4WIIA 4CH1A 1X0FA 5BJRA 2KH9A 3UCGA 4CH0S 2AYEA 3H2VE 1X4FA 2KM8C 2E44A 1WHVA 1UP1A 2F9DA 2LYVA 1YIJS 3LPYA 2CQCA 4TU8A 1OPIA 2DNHA 3VAJA 3NNHA 2CQBA 1WHWA 2CQ2A 4C0OC 2LCWA 4WFAQ 3VAGA 4ED5A 3J7ZT 1UAWA 2CQHA 2G4BA 2DNGA 2DGXA 2LXIA 1WTBA 2CQPA 1U1MA 2M2BA 2I2YA 1SJFA 3SMZA 2LA4A 3PIOQ 3BO4A 4YOEA 5DDRC 2MGZA 2DHSA 2CQ0A 4ZKAA 1X4HA 2X1AA 3MUVP 4A8XA 3U1LA 3CCUS 1SJ3P 1X5TA 1WF2A 1WG5A 2CQGA 2MQPA 1Q82T 1ZH5A 2DIVA 2K8GA 3FEXB 3CCES 2J0SD 3G9CA 3MURP 2O3DA 3CMES 2D9PA 5GAHU 1YWXA 3CCLS 3HHNB 4IUFA 1VC0A 2DB1A 2MKCA 3NMRA 1VQ5S 1HA1A 3G4SS 1VQ4S 3FEYB 2MZSA 1X4EA 2DHXA 2LKZA 2CPDA 1WWHA 2NLWA 4QQBA 2M8HA 2DNRA 1P1TA 2EK1A 1ZZFA 1BY9A 4C4WA 2YH0A 4UY8T 2CQ3A 2N82B 2U2FA 2VOPA 2AYMA 2E5HA 4Y0FA 1YTYA 4EGLA 5GVQA 3BO2A 1R8HA 5HL7Q 2RRAA 1YJNS 3CC2S 2KVIA 3ULHA 1WG1A 5GAGU 1KOHA 5H1SV 2X1FA 2JVOA 2KG1A 3CTRA 1DBDA 5D78A 2X1GA 2K3KA 1HD0A 3B4MA 2MQOA 1W2BR 1AUDA 3CXCR 2YH1A 1U1KA 1P27B 3G8SA 1DRZA 2KT5A 2U1AA 3JB9k 1WHYA 2MZTA 2PE8A 3MD3A 1SJRA 2XS7A 2DNOA 2N3OA 1U1OA 1YITS 1B7FA 2KI2A 4Y00A 1FXLA 1U1QA 3MUTP 1K73T 3P6YC 1UW4A 1VQ8S 1JJHA 2DGOA 1H2VZ 1WI8A 2HYIB 1NU4A 1DZ5A 2MKJA 1SJ4P 2F9JA 1NJIT 2J76E 4WFBQ 1M5KC 2FC8A 2CQIA 2MY8A 1WG4A 3S6EA 3TO8A 3MOJB 2CPIA 5MLCV 3TYTA 2MJUA 3SDEB 1N8RT 3VAFA 2DNQA 5DDOC 3CCJS 1H6KX 1RK8A 2OJ3A 2QFJA 1VQMS 2MKSA 2MQMA 3R1HA 1YJWS
chains in the Genus database with same CATH superfamily
3M6WA 3BKFA 1NZAA 3R1LA 1FKPA 3CUNA 2YKNA 2HNYB 5F8MA 5F8HA 3BQ0A 3V6JA 2RD5C 1T0TV 2AEMA 2E7WA 2UXBF 1OQ6A 2QLBB 2BBEA 2B43A 3C15B 2MLZA 1W25A 1PIEA 2ZNYA 2J0QD 1BQNA 3DOKB 3V81A 3W65A 3HFVA 2JWNA 4U67Q 2MEWA 2WAQD 3W3SA 5JUMA 4QYZK 1RTIB 4GVBA 2XNQA 2WONB 4O44A 3D3BJ 2XZTB 2LMIA 1FD8A 2UU9F 1Q81T 3M2VB 1MROA 3W64A 3V81B 3N4WA 1S1UB 2XCPA 2R2RA 4ZPTR 2W2PP 2EFGA 2XZDB 1Q7YT 2Q6CA 2YWEA 4IH5A 1X4DA 3OL9A 4QR0A 1TFYA 1LW2A 1MROB 4C2MA 3RW6A 1O0PA 3AD9C 5DZ6A 3RGIA 4RW8A 1FKOB 4N8NA 2HGMA 3CJ3A 4J5OA 4M5NA 4EO6A 2P9GA 2CXEA 3R5BA 3RRGA 1IKXB 3TEGA 4KSEB 1XC9A 2F65A 4DUYF 2NR0A 1KONA 5F8LA 3B6BA 2A3JA 4ID5B 1RWUA 5IWAJ 4Y2KA 4A8WA 2L3MA 1L3TA 3F73A 2LEAA 5J2MA 2H1YA 3ISZA 3VV2B 3AAWB 1YG0A 1UJ5A 2BW7A 5HMXA 2QYGA 1Y4ZB 1REVA 1HBUB 2JFDA 2X1BA 3FK4A 3Q8SB 2XI3A 1RWMB 4J9MA 1JJCB 3E3XA 1D9DA 4LQ3A 2V4JA 4ECZA 3KUGA 2KKHA 1QUVA 3S7RA 5AJ3J 2DH7A 2YKAA 4G1IA 2J5AA 3PCOB 2H5IB 4EUVA 4OYZA 2KZZA 4F4KA 1FHTA 3PEHA 1JLEA 4RWWA 1XMOF 5SZTA 4F2SA 1EIYB 3FRZA 2MJNA 5IT9Y 2D1CA 1M5PC 3PW4A 4X4VA 1YRUA 1L3KA 3AQOA 3BGLA 1JLBB 2HWHA 1RT4B 1GMVA 2HFVA 4CZCA 1WELA 3RAQA 3LGMA 5CYQA 2RKIA 1WJ9A 4G65A 3U7JA 2CADA 2J0WA 2IY5B 5FIIA 3FCVA 2EKNA 4KPCA 1NKBA 5C5JA 4HLBA 2DGQA 1VC5A 3UCUP 1S12A 2PO4A 1MU2B 2KN4A 2HHPA 3MMBB 4ZOSA 2X51A 1XMQJ 3IWNC 3MEKA 3KLFB 3LP0A 5ETQA 3PFEA 1RGVA 4NEYA 1FK9A 1YIJS 3ZZPA 3R7NB 5KOXA 3IS9A 3CIMA 3PTWA 2DNGA 1WTBA 4K59A 5A6WA 4WP9A 3QAEA 4DV7J 1GQEA 1Z4UA 2YVSA 3ZZRA 3QRPA 3GFHA 3U1LA 1X5TA 3OUYB 3KTQA 1FRJA 3DDIA 3H40A 3MMCB 2HBZB 3D3CJ 3QGGA 2V68A 1V3SA 5HMYA 1D09B 3D9BA 3IS9B 1WC3A 1S10A 1SIWB 2DHXA 2LKZA 2LQ9A 3IXQA 2WZ1A 4CM0A 2K3IA 2A2CA 2GJFA 4EGLA 1VRQC 4DQPA 3BKTA 4XO0A 1MG7A 1M5HA 1TAQA 1LNQA 1HQUA 3WC2A 2AKWB 1F5AA 2PE8A 1GTHA 1EX8A 4K0KF 2HBRB 4DU8A 4EI2A 1U1QA 1K73T 2XZWA 5HVGA 3EYZA 2F9JA 2WOMA 1NJIT 2KDOA 2MY8A 4WZQA 4TYBA 2ROGA 4OYBA 5A8WB 3PW0A 1KR4A 5C7PA 3SSRA 4P73A 3HMJG 3R1HA 2JJ4D 4P2SA 3RR7A 1SH2A 3GJTB 2BKNA 5KT4A 2CJBA 3W7BA 5FLXU 4PQUB 1TTHB 1UFWA 2ZM6F 5BYRA 1XNRF 1RT2B 4HT5A 2GW8A 2CA9A 2IAJA 1XTZA 1YI2S 2UXDF 4J9UE 3CB4A 4M5IA 1M90T 4CQ1A 2CIMA 3ZXWA 3BZQA 3RU0A 2QL9B 3MD1A 2CJXB 1XERA 3OW2R 1YBAA 4HDHA 4ES3A 4CO0A 1JQGA 3V6HA 5HP1B 2ZZMA 4ZJQA 3DYAA 2KL8A 2BQUA 1JJ2R 2IIHA 2DGUA 2MSTA 4DUZF 2J7UA 5HN0A 4Y2MA 3MPVA 5IOLA 2ZKUA 2DVIA 3TJ8A 2WBRA 2G2YA 1JWWA 3PJWA 4J9OA 2FVRA 4C11A 4FXVA 2DKOB 2V8PA 4Q43A 1L3VA 5L39A 3KDNA 2YTCA 4LRCA 4YMEA 4LFCJ 2Z8QA 4RUAA 3M30A 2UXCJ 3ILLA 3NS5A 2D7SA 4WFZA 5LSLA 1NRKA 1R0CB 3GIIA 4LREA 3MAAB 4LF4J 4ZJOA 2ZH3A 2CAJA 4IFVB 2DY1A 1X9WA 4USKA 1Y5IB 4LF5F 1TZ0A 2EFQA 3K8WA 1JNRB 3UD3P 1FI4A 2O67A 4BWJA 2BE9B 1QAYA 3Q23A 1UZDA 4IRCA 1BQXA 5AXLA 1N34F 3CMQA 4R0EA 4BWMA 2DXFA 3WX8A 2RNEA 2C28A 1UVMA 4U7UD 3IBCB 1AFJA 2POKA 3GP9A 3GJRB 4K4ZA 5E7OB 3T1HF 4OIXA 1S1WB 5ETOA 4S0MA 3B4DA 1JXLA 4LR9A 2JX2A 2J6UA 1LXJA 5EDWA 3Q0AA 4UUWA 2C2DA 1T03B 3GIRA 3CMAS 1GH8A 1R31A 3LO3A 1G6BA 5L9NA 1N0VC 2HBQB 3RB4A 3OD2A 3OTCA 1E6VB 4TNOA 3BBBA 3JSRA 1Y5LB 2FUG9 2IA0A 1HNIB 2ATLA 1TVRB 2J7KA 4LF1A 1FO1A 1UKUA 1WC0A 2AHOB 5HAOA 4OI4A 1IN0A 2CNLB 1R7IA 2WVEA 1O6XA 5JVHQ 4I67A 4NEZA 4KTQA 5KT3A 4U8YA 3I56S 2H9ZA 1RHMB 2DNKA 3NAHA 4RW6B 4PUOA 4NRTA 1TELA 4TN2A 2W1BA 3FCWA 3BH6B 2LYVA 4NOHA 3SV3A 4EBDA 3NNHA 3DLKA 1TUWA 3SSQA 1U1MA 4KKOA 2PEBA 4CLUA 2O01C 1WORA 4DR7F 2EEYA 2OEKA 5HATA 2K8GA 2J0SD 4DQIA 1CULA 4ETZA 1FTRA 1REGX 3D6HB 1SI9A 4AL7A 1VC0A 2MKCA 3ILJA 1F3FA 3ZTOA 3JQJA 2EK1A 2XSJB 1IBMJ 2VG7A 4IQMA 1RTJA 3PDNA 1VLYA 2U2FA 2GVDB 2A2DA 4DV4F 2AF6A 3CC2S 4PG8A 3CE8A 4KHRA 2HLTA 3P5BP 5D78A 1HBMB 1AUDA 3CXCR 3AJDA 5HSPA 2B5JA 2U1AA 2VDHA 1C0TB 4P74A 1QJHA 2CJYB 3PVXA 1FD2A 4IDKA 4Y6IA 1QDUB 3RTVA 1RTJB 2W9BB 1FRXA 3ENWA 4MT1A 4EK2A 2R8IA 2LEPA 3QIPA 1TP7A 1IXKA 1YBTA 1V5VA 2QTWA 4DSEA 1CQNA 2N4CA 1ZAWA 2OPSB 3GMGA 4KGVB 4ED0A 2RIJA 2NSBA 4N77A 4H4MB 1HD1A 3UDVA 3CCRS 2LQ5A 4PRFA 3RUBL 3TRGA 4YY3J 5KFWA 4B9SA 3SYZA 4AL6A 2D3O1 1L5UA 5ITHA 3MAHA 3ONQA 4J9KA 2V94A 3MHYA 3RAXA 1FWLA 5GAEU 2CNKB 3ICLA 5G0RA 4PWDA 4KHPF 2FHJA 4CLZA 2A18A 2OPPA 4PXCA 4P72A 2XMMA 2WVBA 3PY8A 3EGWB 1LWCB 4YFUA 3TQEA 5D4OA 1JLCB 1FFSB 3KHHA 3FZ2A 3GB0A 4B9TA 1H7WA 2YNHB 2Y0BB 2OELA 2VH7A 4ALZA 1PCAA 2Y0SD 1X4CA 5GMKa 3MCOA 5DDPC 2NCKL 1F9FA 3M32B 4FP9A 2BE7D 4PWDB 1CC7A 2DK2A 4WU3A 1JKHB 1YJ7A 4A8OA 4P2FA 2WTFA 4DL4A 5GMDA 1AZSB 3KFWX 3TEHB 2ZC4A 3W2VA 4X4NA 3GR1A 2KU7A 1SCJB 3VTIA 1PAEX 2AT1B 1NB7A 2D3OR 2I6WA 2L08A 4QU7A 4K2XA 5KFBA 3UD5A 3MFHA 2GQCA 2WW8A 2AJ1A 3K59A 2YPYA 4F4AA 3M8QA 1UWBB 3KLGA 5KT7A 1KP6A 4ZLLA 3AJ1A 5KFPA 5FJ4A 3QO9B 1SPBP 4U7CA 2AJ2A 3UVJA 2UUCJ 4OLPA 3RR8A 4PWUA 4DG1A 1BE4A 2ZEJA 4PKDB 2XO6A 3M9OB 2YPZA 3FKBA 3IGVA 1ZA1B 1LWEA 1RP5A 3HHEA 3HHLB 1TKTA 4UZCA 2ACMA 1F2HA 1B4SA 2F8MA 4A8QA 4IRKA 3VAIA 3BYPA 3THVA 4PXEA 3T6BA 3CJQA 1ZTTA 3ZZYA 5SUHA 4ILRA 1C2PA 1QLNA 1QAXA 3EICA 1Z1ZA 2PFDA 1RT3A 2N4DA 3P3DA 4DI6A 1WEXA 2M9KA 4LRAA 2B0GA 1SC3B 1JLQA 1D0EA 4BHQA 1NMEB 3MM7B 4IG0B 2AX0A 1U2FA 2W8KA 1RAAB 1RABB 4ZLJA 1D8ZA 2HG4A 2KXFA 2P5VA 3QGPA 3NWRA 5KOWA 1JJ4A 3UI3A 3AOAA 3TAPA 5K8PA 1RT1B 3BGUA 1WKLA 3OJUA 5DETA 1KLMB 4XPEA 3GWCA 4M5JA 3QQCD 3D5MA 4RBUA 1HLWA 1FTCA 2DD8S 1VK3A 3M1VA 2GX8A 2DNYA 3DXBA 4WFNQ 1TUGB 2ZH2A 2B4UA 2CUYA 1DAXA 1UVKA 5HQMA 4RU9A 1N36J 2B9YA 2ZOGA 4J9QA 1RXOB 5CZVA 1UEUA 2V2QA 3PKYA 3L95X 1HBOA 5CQGA 3Q89A 5FDLB 2E1AA 5IWAF 5IZHA 1QTNB 2IYGA 3OR1A 5GAGI 4X4RA 3BJYA 1ZAVA 2E44A 2G0JA 2YWGA 3HXMA 4NYOA 3H59A 2XY6A 4CTAB 5IV4A 3GG0A 3O5TB 1S9EB 4I6WA 2G4BA 1SQEA 5J2PA 4ZVEA 2LA4A 1EZZB 3F0NA 4CLTA 5AJ3F 4KC5A 4OJHA 3R2DJ 1NZ8A 3J7Z5 1PBUA 2V8GA 3EVOA 1C0UB 1MWZA 4IOBA 4EU0A 1MMDA 1RT6A 2IRYA 3BSOA 1S1TB 4XDCA 3LALA 3RB3A 3MEDA 1R89A 5A6PA 4JYAJ 1T94A 1TV6A 4D3GA 2BRLA 1Q79A 4NI2B 4U7UK 1NJXA 3Q86A 2W24A 4F3QA 2CNNB 1J27A 1Q95G 3P96A 1U2CA 1XMQF 4P9SA 4NCGB 3W9IA 2M3DA 1WI8A 1F9EB 4F8RA 2V9KA 3V5RA 1Y10A 3LP1A 1TV6B 4A8FA 4MH8A 2LU2A 2ZH4A 1H38A 3VAFA 5DDOC 4X4UA 2UV8A 4KBIA 1Q1KA 3SCIE 2FJBB 1KSPA 3CJKA 1YJWS 1K0VA 2ASLA 2M8DB 1Q7LB 4DV7F 3DHWC 1WC6A 2XS5A 2HWTA 3TNVA 3CDWA 5K8MA 3CGIA 2ALZA 1N88A 3M8RA 4R5PB 3I0RB 3OFGA 1KOOA 1A9NB 3VGSA 3SCKE 1MN7A 2KO1A 2HW3A 1RWOB 2LQ8A 4LQ9A 2KT2A 4NYPA 1NK0A 1IBLJ 4CO1A 1A6LA 4C8KA 2PA3A 2DRAA 2VBWA 1NUEA 4RBVA 3QMQA 2MHEA 1E6YA 2K1RB 3DXSX 2OFHX 2MGZB 2FY8A 2F3JA 5IQQA 4KV8B 3JYTA 2UVUA 3KHGA 1CPZA 2ZOMA 2AJQA 3R5AA 1P8GA 4DSFA 1LEOA 3G2XA 2EFPA 4J9VA 4ID8A 3MMAA 4X4SA 3FEZA 1FJCA 3C14A 4HHHA 2Q3PA 3W2WA 2RS8A 2QYCA 1WC5A 3NMAA 4J9PA 1WHXA 5E2QA 3KHLA 2OLWA 3EVWA 1IKVA 4O3NA 1NDPA 5T41A 4V19J 1OYEA 4USJC 4ZP8A 1JLFA 4WTYA 3C66A 3LWLA 1WF1A 1RWVB 2MKIA 4B3MJ 3G82A 4MK8A 5DDQC 2P8IA 1K9MT 3T41A 1N5YA 4OX7A 1U47A 3UDLA 2OAUA 4OI3A 1JXEA 1WSRA 1RWKB 2BV3A 3PEJA 3HVTB 1OMSA 2HNDA 4XAKA 4LF9J 4W98A 2YWKA 3N01A 4I1TA 3TZWA 4M1KA 3OR2B 4PABA 3JAMU 3T1YJ 4CT9A 5LJ5Y 2FY1A 3D2WA 2VG5B 3CDEA 2FJDB 3NBPB 1RKJA 2BANB 4FF3A 3J7YU 1VRTA 4YS2A 5M2PA 2MYFA 3KK3A 2XCAA 5L1KA 1IKWA 1KVJA 3HP6A 2FJWA 4X64J 4B17A 4DLGA 4LFCF 2UXCF 3TZZA 4USVA 1NO8A 2Z2MA 2VOOA 2A6MA 4PXDA 4Y65A 5EN1A 2ZBIA 5HJYA 3HHLD 3IO1A 3IM8A 3GV5B 4LF4F 1QVFR 1QVGR 1T3NA 3PXGa 3LP2A 1ICEB 2ZZNA 2JC1A 3C6UB 2I8EA 2F7VA 2BOAA 2DITA 2HVEA 4IOCQ 1TL1B 5THWA 1GNKA 3ENQA 4WIIA 2BQRA 5BJRA 8RUCA 2G1HA 4RW7B 2EI5A 2CQCA 1QE1A 2Y8WA 3NKYA 1CJVA 2DGXA 4WXOA 2LXIA 5F8NA 2BACA 1UEKA 2IC3B 1MLAA 4ZPCA 4AQYJ 3AD8C 5D3GB 1P6TA 1YZ6A 2NS1B 4C8LA 4F2RA 1H3DA 2CQGA 2BYCA 3C8YA 2DIVA 1T9XA 2OD4A 1FESA 4OX9J 3QRQA 3T5LA 1TL3B 3A3OB 5KFMA 3D0HE 3IMQJ 1RTHB 4DZ6A 1HA1A 3C16B 4FDFA 1CJVB 2MZSA 3BGFA 5CYMA 1P1TA 4ZHRA 3C3LA 2IMWP 1AFIA 3FBEA 2L48A 2GS8A 3DM2A 2VQEJ 4F0HA 1N33J 2B3TB 4YP3A 5GAGU 1XWLA 1IR2A 1GMWD 4FKYA 5EGYA 3DRRB 4UY85 2HS0A 1PJ7A 3FSIA 4PG5A 2MQOA 1J5OA 1JNZB 1R8AA 4ES2A 4C3KA 3JB9k 1DQAA 2HHSA 3FMBA 3RB6A 3MD3A 4ZDNA 5KFNA 2N3OA 5DGBA 4KQZA 2FVPA 3RBDA 2IM3A 3E01A 3GONA 4U95A 5J1EA 1NJWA 2C2RA 1CJKA 1X9MA 4DOZA 2R7WA 1OSDA 1ZAXA 3HD1A 2OPRA 1IQZA 1EKSA 2VA2A 2DBBA 5C42A 4OLOA 2VBXA 2V6AA 1T3OA 4KH0B 2UUTA 3DDKA 3DRXA 2AU0A 4FXWA 4OQJA 4ECRA 5C2GA 1NPPA 1KC8T 3CEDA 3HO1A 5A8RA 4PYAA 1S0OA 1DLOA 2GCFA 1B3TA 5L38A 4ANEA 1RQ0A 1XQIA 1NK4A 5KFCA 1RT7B 4HDGA 3HF5A 2CPFA 1Y3KA 3TP2A 1IBMF 4AUKA 3PRVA 2RVJA 4ICLA 1SUQA 3QGHA 4OZ3A 4ED1A 1JLAB 4ZVPB 4DR2J 4AYBD 3J7AN 2BJ7A 5L1LA 1MW7A 1CJUA 3NEKA 3DMJA 3CCZA 2B9WA 4TY8A 4LSNB 1VQNS 2YQ0A 3BPSP 4NA2A 4Z7YA 5E3PA 4DS4A 4CDIA 4RW4A 2Y9HA 4DX5A 3DI6A 2GMJA 1Y00A 3KJQB 4ZLPA 3ZZ0A 4OFZA 2LVWA 3B82A 4R25A 4YUDA 5KG7A 3N79A 1YRXA 4WYLA 2ADBA 4LF8J 2VG6B 3H2UB 5D15A 4H4OB 4YR3A 3GYNA 3MECA 2AJ4A 3CD6S 2CZVC 5CABA 2NZ4A 1VQSA 4CWBA 3US5A 2XBPA 4YY3F 1CS4B 1VQOS 2DISA 3KJFB 3MOZA 3CPWR 5K8NA 4AXIA 5F0WA 4OI2A 4E8UA 1H2UX 1HW9A 3NG8A 3RBXA 4ENOA 3VAMA 2KJWA 3AOCA 4DCJB 2DNMA 1T7PA 7FDRA 3T19A 3ILOA 3UR3C 3Q8YA 2JEFA 2FLLA 2KRRA 1FNMA 4F4ZA 1PO6A 5DM6Q 1U0HB 1RAEB 1MWYA 3HSZA 2KTQA 2DYAA 3CC4S 1FXDA 4B9NA 1LK5A 2RS2A 3MEEA 2A0FB 4WP8A 2AMCB 1QM9A 2GGPA 4HH1A 2XM3A 1KS2A 3PZPA 1OY9A 1TL7A 2QZ8A 3Q24A 4LFBJ 2EW9A 4KGKA 3C2PA 4CCHA 2B9EA 3OL7A 2Z4PA 2W2QP 4DV1J 3KOAA 1H74A 1XBWA 5H9EJ 4IR9A 1BWVA 3NP5A 2ROPA 1ELOA 2YKMA 2MKHA 3O8WA 2DGTA 4J9LA 2HZAA 2GJ2A 2UUCF 4YB7A 3ITHA 4MIAA 5H9EK 4LIWA 1U45A 1PC4A 3BGRB 2ZBCA 1GMUA 1AXQA 2HHXA 3IRXA 3ETMA 3IR6B 4ETXA 1FVQA 3LGHA 1IM4A 5HLFA 3ZO7A 1RTDB 2YY3A 2D3ZA 2ZH1A 2XYPB 5KFIA 3IWXA 1U8WA 3E8OA 2XC9A 1MMLA 3IFEA 2UVRA 2F63A 4B9VA 1UFLA 1PYOB 2YNIB 2D9PA 2Y3YA 4H54A 2XI2A 3NOCA 4ITSA 5B09A 1VQ4S 2HHUA 3NY0A 3P45B 4QQBA 4B3OA 4KO0A 4G6VB 2C3PA 1L3UA 5GVQA 2V5HG 1R8HA 1N36F 2ZOFA 3EM1A 1RAHB 3KLEA 4Q7AA 2KT5A 3VQTA 3IBFB 1FRHA 3B78A 2B4PA 3R5JB 1SC4B 3KJNB 3EZ5A 2DR7A 1IVZA 2OMOA 3DGPA 5CH7B 1R0AA 4ZMMA 2F1FA 3W62A 4BC7A 2XYGB 1NJZA 4MIBA 2K7JA 2DNQA 3H5SA 3EE3A 4OJ1A 2ZNZA 1VQMS 2MQMA 1UWAA 2C2NA 5KG2A 5DRKA 4NLXA 1NM2A 2A10A 3EUNA 1S1VB 2AEFA 4LT6A 3RBEA 1RAFB 2GVZA 2E29A 3V4MA 1T05B 4USMA 1CVJA 4HVZA 2B6AA 1T11A 1G2EA 3R5GA 4M5DA 1LWFA 4OZJA 1F9HA 1GEHA 2HGNA 3EPGA 2Q79A 3H5XA 2V50A 4ZN3A 4RLEA 4YDDB 1T9YA 3DLJA 3Q83A 3EGVA 1YJRA 1NCLA 4JYAF 2GVZB 3KK1B 1NDKA 1N48A 5GADU 4OX6A 1TKZB 1SV5A 1RBOB 4JI2J 2DH9A 2YKOA 3VALA 4KRWA 5E3AA 3JTPA 3W63A 2XWXA 3TW0A 2ZE2A 1WOOA 3DOLB 1Y5NB 1IBCB 3DLGB 1PJ5A 1VQLS 3QZ8A 1Q8IA 4P7VA 2XWYA 4DL7A 1HNVA 1RCXB 1X4AA 3TI0A 1HNXJ 4HACA 3VVTA 4MK7A 3H42A 1HI8A 1X5OA 1CBKA 4DDFA 4ECVA 1VC6A 5GAHI 5IT0A 2W9CB 3SQGB 1NJYA 1MSWD 2C3OA 4FKXA 4RWXA 1HMVA 4K4SA 4N56A 4LBPA 1I51B 4ZVRB 5A0YA 2E5IA 3QNWB 3DLBA 2VBYA 4DR1J 4YHHJ 2HEKA 3JTNA 1AT1B 3EWGA 1IBLF 2IM1A 4ED4A 3QT8A 4K4TA 5HVFA 1XNQJ 3POTA 2F4VJ 3JQKA 5E0OA 4OZ1A 1HMVB 5F8JA 2J9DA 1HQEA 3UPFA 1OPZA 1YRTA 3CCSS 4CYUA 2ZH9A 2VL1A 1LW0A 1VMBA 5L46A 4CRJA 4QR1A 2XMWA 1RAGB 2LEBA 3D6MB 1SKUB 3GPAA 5LT5A 3FFIB 2DCUB 1M1GA 1HR0J 3D1HA 3T3FA 2ABYA 1HPZA 4QIFA 1HWJA 3Q2TC 4RO0A 4X4PA 5J2QA 3P5TL 4L75A 2HS3A 1WOPA 3ZZZA 1NLKL 5DQHA 2VIHA 4B3MF 1UW9A 3KJVA 2Z58B 3K5PA 5KFQA 4WIQA 1PYSB 4DL3A 3CJ8A 3ET6B 1RADB 3N6NA 4O3QA 3QSYB 1BWEA 2AQ4A 2OIHA 2RB7A 3FMWA 2LA6A 1HPZB 5DJBA 3MM8B 5KFJA 2HFZA 2I38A 5L9XA 4LF9F 4K2JA 3N28A 2V0NA 3T1YF 1LXNA 1C1CA 2BM1A 2CQ2A 1NK9A 2FB0A 2DR5A 3H5YA 4YOEA 3NS7B 2DHSA 2VPWB 1TL4A 1EETA 3KDOA 4KFBB 1F60B 2RHQB 2HZVA 4K4UA 1TU0B 4X64F 2Q6BA 2HVHA 3HHNB 2JLGA 1VQ5S 2QRRA 5KG5A 1SVDA 1J2VA 3PO5A 4NLWA 2O1PA 4WKYA 3BPDA 6FDRA 2R7VA 4DSKA 4L74A 2ZWPA 1KVKA 1SKWA 3BSAA 3TA1A 4URQU 3SBMA 3CTRA 1FE0A 4ZITA 1FWPA 2ALYB 2X1GA 3AHPA 3OJSA 5I42B 2UUAJ 4Q0BA 3KK2A 5FLXY 4A8SA 2XS7A 2DNOA 3HKZD 3KLHA 1VQ8S 4OI1A 4FF4A 4WFBQ 1M5KC 5J2NA 4ECXA 3TYTA 1FFWB 4LUBA 2P2CB 1WC4A 3M8WA 2ASDA 3HHKA 1Y3JA 4Q0BB 3FQKA 1IWAA 2CPXA 3NAIA 3DOMA 4AQYF 3MPYA 3M2RA 3AY0A 5C25A 3DLHA 4CT8A 2HRUA 2HAIA 1ZS6A 4Q5VA 3OL6A 3OFHA 4I2QA 1Y9OA 2MLYA 4OX9F 1HI1A 4EYHB 2UVWA 4OZLA 2OFGX 3PO4A 2C1EB 5DG7A 2K06A 3DGVA 3TAMA 2CPJA 1Y11A 1C1BA 3KG4A 1RWXB 4I2PA 2VQEF 4TLRA 4MFBB 1R3NA 4DCPB 3PR5B 1N33F 3MM5B 4NA3A 2R8KA 3U27A 4USIA 1U1RA 2QSFA 2V4QA 2HMIB 3X3UA 3S01A 3L4BC 2MHNA 3G8TA 3HVWA 2ACYA 2NQPA 1M5VC 1EKRA 3HPOA 1WUUA 1IKYB 2HFNA 2B9XA 1F2GA 3QLHA 4IG3A 4OZNA 3H90A 2HVDA 4IO9Q 3R9LA 1BD6A 2VPZB 5AE2A 3TZXA 2HHWA 3TUZC 4KGZB 5HBMB 5RUBA 1NKEA 2NXNA 4JI6J 4QIGA 3PX0A 5E41A 3DLEB 2ZUGA 3IG1A 3BDEA 1N54B 1M0SA 2VB6A 1K47A 3VF0B 1NB2A 2ZHOA 4PCQA 2OEJA 1M5SA 4RNNA 3U1NA 3W9HA 1ZA2B 3H8YA 5AT1B 2PFFB 4EEYA 3HT0A 4G3IA 3PFOA 7FD1A 3KNAA 3FRYA 2YNGA 2HFOA 1FDAA 1BQMB 1S6UA 2AWZA 2GIRA 2W2NP 2FDNA 3FGVA 1CQMA 4G1QA 1IJFB 1WKJA 4WU2A 1ITPA 2WB4A 1DTTB 1HIYA 7AT1B 4DR2F 4IKAA 3K5MA 1BC6A 4OI6A 3OSNA 1N32J 4X62J 2K2PA 3V4IA 1P9QC 2F40A 4RL1A 4O4GA 2I5JA 4NXMJ 3NNCA 4I56A 2XO7A 3BBFA 4DU7A 3M2UB 1HWKA 4XDDA 1SJ1A 2ZBPA 2V34A 2NXCA 2MY7A 3BYRA 2A1BA 1CJTA 4WWSA 2MQLA 4LF8F 1YVFA 2BA9A 3EXYA 2LFVA 3DHXA 2J7WA 4C8OA 3L7OA 4DV5J 3THTA 4Z2XA 1BLUA 3HJFA 4K8RA 1YSJA 4TVAB 3RAMA 3JSMA 3MPUB 4ERDA 4B9LA 5JXSA 1KFSA 2J8AA 3PRDA 5E3CA 2HNYA 1S1XB 4ILMA 4O0NA 2CYYA 2E5GA 1KFDA 2JFKA 4OHXA 1U0SA 2BDPA 3C15A 3MWBA 2Z2LA 4AXJA 1UP1A 2IDEA 4WBFA 3DOKA 3CDBA 4NLTA 2R8GA 4NLPA 2ZBQA 4PPDA 4NA1A 1RTIA 1HYSB 3IBWA 2BXJA 4JV5J 1RI7A 3OHAA 2WONA 1VRUB 2E7VA 1S0MA 4MIWA 4TQSA 3KHRA 3M2VA 2HURA 5IC4B 4LFBF 2CJ9A 3DC2A 4JB8B 2O3DA 1S1UA 4ELTA 4DV1F 3JSYA 3CCLS 1N0UA 3CJ5A 2MQ8A 1RT5B 4MJKA 3H7HB 2BMBA 1N5SA 2NLWA 4OZ5A 4RX6A 2YKPA 2AYMA 1ZM4A 2HIQA 1GK8A 1LFPA 3DFEA 1Z2ZA 4WE1B 3A8JA 4H4KC 1FKOA 4M94A 2VQFJ 3ISND 3BDPA 1VHIA 2OD6A 1RISA 2YH1A 2PMZD 3EPIA 1R0BG 2MZTA 5DS7A 5HQ8A 4GMKA 5C24B 3D6TB 3R5DA 5E3RA 3FSYA 1IBKJ 1IKXA 2MTLA 3PW5A 1DZ5A 2NYHA 3UDEA 1NK7A 4DR6J 4ID5A 1H0HB 1NSPA 1WG4A 1IUJA 3S1TA 4B02A 1CEZA 1O8BA 2XMKA 4LRFA 1JLGB 3QJLA 3FNNA 3MF5A 3HFZB 4MYUA 4WJBA 1S57A 2FD2A 1AYEA 1HBUA 5IM0B 1RBLA 5B0FA 2DR8A 5J1NA 4HHUA 4ZCIA 5AXKA 4KGXB 2AV5A 1A7GE 3R6LB 5U47A 2V2VA 3CCWA 2BE2B 3MPWA 4RJVA 3N9UC 3EGNA 4DFPA 2KG0A 3FDSA 3PM9A 4DQQA 2JEIA 2GMLA 5K20B 3CT9A 4ZVTB 2ZHBA 2HQ3A 5D0EA 5KFKA 5EUHA 4UOHA 3BREA 4F36A 1JLBA 5BYQA 1RT4A 3TA2A 4MYTA 2GMHA 1U1PA 1PSDA 3PIPQ 3JTOA 5DLFA 2CPZA 2E9ZA 5KT2A 4H4KA 3QRRA 1VOMA 2E9RX 2FVCA 1Q4RA 2PT0A 1MU2A 3MMBA 3PX6A 4AL5A 5B0BA 2GO9A 3LGNA 1N5QA 2FZCB 3KLFA 4ZP7A 3I9ZA 3CCVS 1K44A 3ZFVA 2C2KB 1ZM3A 1YKWA 4KE5A 3GSDA 4C0BA 1QSLA 4DQRA 2E5LJ 2W9AA 5LL6d 2F8EX 1NBEB 3GIKA 3W9JA 1QAJA 2CZ4A 1YJUA 2EG2A 4C98A 5DM7Q 2B4OA 1VI7A 4E98A 1TFWA 5K14B 2HLUA 4OHYA 2QGFB 4TY9A 2ZH8A 3OUYA 1I3OB 2JVRA 3MMCA 3OVBA 1UVLA 4DR5J 3GV8B 2W2OP 1R8PA 2GNKA 3MPDA 1EJ7L 2PSZA 3PACA 3IRWP 3VWSA 3PKMA 4QYRA 4WF9Q 2IFXA 5I3UB 4QZVB 4HEA9 2WRMA 4B3RJ 3FJ2A 3GR0A 2M5YA 2VPXB 4JI2F 3SXLA 3NL0A 3OBIA 3TJ9A 1SC6A 2OTJS 2RF2B 4QPXA 1YLXA 4M95A 2JZ5A 4QCLA 2NYIA 1J5EJ 4Y34A 2KVQE 3ZNUA 1NH7A 4CI0B 1N5VA 2XY5A 4DSIA 3DRPB 3SIPB 1HNXF 4HI2A 2QA1A 4GC7A 1DTQB 3A13A 5KG1A 5K9FA 1M1KT 4PWWA 1VQ6S 4JI8J 5A8WA 4FYVB 5IV3A 1PYTA 5GAEI 3ETOA 3U02A 2EC2A 3G86A 1U1LA 4DX6A 3NGTA 2L9WA 1Q8LA 1HBNA 1TR0A 1U4BA 3F44A 5JJBA 2QLFB 4IYQA 3L7UA 1JXVA 3DU5A 4PQUA 3A8EA 3PHEA 3NGSA 4DR1F 4YHHF 2HNZB 1RT2A 3G6XA 2CPEA 2QN6B 2ZZTA 1XNQF 1XJWB 2IBOA 1EHWA 5HJXA 2PD1A 3LA0A 2F4VF 3D0IE 5DO2A 3I5CA 1HBNB 2DNHA 4WFXA 4KR0B 2FQQB 1UAWA 3J80U 2V69A 2VFRA 2CQPA 3E2EA 1PKUA 2GQ2A 2GHWA 2O5DA 5HP1A 5A2QU 2QIFA 4ED8A 4CM2A 3J81U 1DURA 2GQQA 1GT8A 1R43A 1FRIA 2RDIA 3GSIA 1UA0A 4QIEA 4RKUC 1QY7A 1S9GB 2J9CA 5ETPA 2WK4A 3MM6A 2W25A 3N6MA 2PA8D 3QT6A 3FEYB 1HR0F 2E9TA 4LFAJ 2VA3A 4FYDA 2XGPA 1HARA 5CHCB 2CQ3A 2VOPA 2YX7A 4Y0FA 3DKDA 3LANA 4HYKA 4LBHA 4HH0A 3MR2A 4L3NA 4QJVA 4J37A 3MM6B 1DRZA 3MAAA 2XMVA 1RB0A 5MAOA 3T9ZA 2KI2A 4IFVA 3MUTP 1NPRA 5T7LB 2HHTA 3IGNA 3SDEB 1N8RT 2C22A 3BSCA 4DFKA 3HSJA 1T9TA 4NLYA 3PG9A 4CLWA 3UN3A 4LMZA 2CZ9A 3VZIA 1RCOB 2R2SA 4USHA 4L3KA 3P4UB 2Z57B 2W8LA 1KHVA 3MEGB 2V8DA 1FJEB 2DHAA 3QWUA 2XG8A 2V2ZA 3RJMB 4UT4A 4FYYB 1VQYA 1S1WA 2XLKA 2FGCA 3TX8A 3H2LA 3K7RA 3L3CA 2VODA 1G4CA 1VBYA 3QJPA 3QATA 1T03A 3GYGA 4ZS6A 3O6QA 5K8OA 2EFVA 2EBGA 4IOAQ 1E6VA 2AW0A 5CAAA 1PBAA 2LDIA 1DY3A 4NCBA 1WD6A 1HNIA 2ZH7A 1NK6A 2UUAF 3IR5B 5ETKA 1TVRA 1DQ8A 4Q44A 1KTQA 4YR0A 4ZCKA 4M5GA 2IRXA 2H65B 4UQTA 2NPIA 4X84A 2HQFA 4JI4J 3I96A 4RW6A 2UVVA 1KQGB 4KT0C 2AD9A 2ADCA 3O1LA 3LH2S 5ETRA 5H9FJ 1XN9A 3KKFA 3WZ0A 2RDDA 2ZD1B 4ATNA 3JAMY 1D9FA 2HK2A 3CCQS 3W61A 2FHMA 2QA4G 4BLGA 5HVHA 2DEIA 4YEAA 1B99A 2UV8G 3KG0A 5H9FK 1HHQA 1S48A 1Q16B 4K50A 4J7CA 4DFMA 4OYOA 4DWIA 2VJVA 1F5BA 2N7CA 4RPFA 4JP8A 4DL0C 1KRPA 1EAYC 2LP4A 1VCTA 1PC5A 3PRBA 4C0HA 2MMYA 1RA6A 4NX9A 2GJIA 2PI4A 2XSJA 2DGWA 4DR3J 4K4YA 2GVDA 4FN5A 2MKKA 1UCNA 4ER8A 1MWQA 3LOUA 4YB6A 4LSZB 4OYWA 3R97A 1VIOA 1HBMA 1U6ZA 4DUTA 1LQ9A 1EQ0A 1C0TA 2YWWA 5KG3A 5CZXA 1Y0HA 3AODA 4ECQA 4PAAA 2OGUA 4JI6F 2W9BA 1S99A 4RNHA 3GLJA 2YX4A 2R9LA 4YB5A 2ZJQQ 2KFYA 3RG6A 3S8SA 4DV3J 1GFWB 3OLAA 2N7YA 2OPSA 2VKZG 2ROEA 1AW0A 1IQTA 2DY9A 3IAM9 4H4MA 2XSFA 3RYLA 1G1XA 4D3HA 2DIUA 1WDTA 1Q53A 2LXUA 4LRDA 5DG8A 1HI0P 5HANA 2MPUA 4DMZA 2QFIA 2F4FA 3AJ2A 1YJTA 3HHLC 4PR6A 3TR5A 4X66J 2VC0A 4QOTA 4AT1B 3UCGA 1P1LA 2AYEA 3H2VE 5F8IA 3HKWA 1ZPVA 4OX8A 4F0MA 2GA7A 3OV7A 2P6TA 4FYWB 3O3LA 1N5TA 1S6PB 4P71A 1N32F 4X62F 2P6SA 4ED5A 4CLPA 3K8VA 4URSA 1LWCA 4LVNP 3HLUA 4NXMF 1JLCA 4ZKAA 2YNHA 3VQSA 4DL2A 4X4TA 4J9NA 3K5LA 3CW2C 1NPKA 1WF2A 2HAFA 3WC0A 1V5IB 3M32A 5D0GA 3Q8PB 3GCXP 5CCLA 1JKHA 1SQFA 4DV5F 4OMFG 1AZSA 2NPFA 5KFXA 2XULA 4I7FB 1T9WA 5HK4A 2LU1A 3I9V9 3WHIA 2YH0A 3ZC4A 4R8UB 2DEJA 3CSKA 2YWFA 4I0WA 1EP4B 4CNZA 4NLDA 2X1FA 5AE3A 2JLFA 3WQPA 1U25A 1UWBA 4KGMA 3OTOJ 2OI2A 2IJRA 3BSNA 1B7YB 1SJRA 3MM9B 3QO9A 2NXUA 3CNQP 4ED6A 3CJTA 3BN4A 4LSLB 3J7YI 1VS3A 1S7HA 2FJXA 3HHLA 3BGOP 4F4YA 4L73A 1KQFB 2RDJA 1PG5B 4ZA1A 2VFVA 4LR7A 1TKXB 3MCNA 4JV5F 2W7PA 3SI8A 2RRNA 3SSSA 1AROP 1FRMA 2HVZA 1UVJA 1SC1B 2HQCA 2A6OA 3BM7A 1VK8A 2J9DE 4Y2AA 4ECYA 1U7LA 3MM7A 3OXLA 4IG0A 4ZVOB 3GJQB 4WKRA 1N6QB 1UJ6A 1HHTP 2KHCA 3CULA 4RUHA 2DNLA 2RQ4A 3R2CJ 4I64A 3EXCX 2WVDA 1RT1A 4IFYB 1KLMA 1ZETA 2HWIA 3G6ES 1UVNA 4JOUA 1NXIA 1HNZJ 2VQFF 1FKAF 5D0HA 2EXUA 3IR7B 4I6YA 2XHWA 2EVZA 3M8YA 3OVSA 2KXHA 3I5AA 2W4DA 1IBKF 4UOCA 4G1PA 2CDRB 2WHOA 2IHR1 3CIZA 1X4GA 2JRSA 2RJZA 4DR6F 5FDLA 4RW9B 2R7RA 4XIUA 2HFUA 3BS9A 4U6PA 3MFIA 4DXLA 4B08A 4QR2A 1GMWA 3K57A 4Y28C 2DNNA 3D28A 4ECTA 1EB0A 3UE2A 2E5JA 1JX4A 4A8MP 4RUBA 4C3MA 4MKYA 4CTAA 1S4EA 2CJKA 1S9EA 4YB1P 2G2ZA 2HSEB 1KQSR 1R27B 4K5RA 3UN2A 3GTYX 3SQOP 4A47A 2VONA 3M6XA 1HKAA 3R5CA 3HZGA 1C0UA 4QYZJ 3D0GE 1RACB 2DJWA 2RRBA 3LWMA 1S0VA 1RU1A 4L6V3 3KG1A 4F3MA 1OIAA 1FT8A 5HROB 3SFUA 3FQLA 1S1TA 3JSBA 5KFVA 2FJEB 1TQLA 2VV5A 1IJEB 1FKPB 4PPZA 4DPWA 1N52B 2BZ2A 2YKNB 3TWZA 1F3VA 3EZUA 3P49B 4NI2A 1WKKA 4DV2J 5LM7E 4F4WA 3ZNJ1 2J8SA 2IA6A 3P8BB 1GX5A 1BQNB 4UQGA 4CO3A 4V19X 4NCGA 2IJFA 3BQ2A 2FHOB 3M05A 2RQCA 4Q2LA 2E5LF 4C7QA 3A4TA 4GVBB 5CD4A 3B54A 2DHGA 2VU5A 1YQHA 1X31C 3UD4P 4O44B 2BX6A 2UP1A 2B8QA 3SFGA 4P7TA 4FBUA 4IR1A 2KZMA 1VQ9S 1OWXA 4F25A 1NEEA 4R5PA 3I0RA 5IQ6A 3TVZA 3DRYA 4DR5F 4NE9C 3D67A 5F9NA 3D68A 2FZGB 4FYXB 1HQ2A 1BHNA 1LW2B 2W7OA 2OPQA 3UO0A 1NK5A 1FJGJ 4GRSA 2CQBA 1NSKL 4RW8B 4B3RF 1IR1A 3VAGA 2BW2A 1IWGA 2K1RA 1B0TA 4C8YA 3QGIA 4ANDA 4OYXA 1SJFA 2KT3A 3EDRB 4USUA 2MGZA 4ECSA 1H72C 1J5EF 1X7VA 2W4PA 4O3SA 4EO8A 2VFTA 4KV8A 3CO0P 2MQPA 1ZH5A 2QX0A 1RU2A 5EX0A 2C2MB 4DSLA 2VUGA 4ZPBA 2OPQB 2H4WB 2DB1A 1H73A 5J2MB 4R0JA 3NMRA 2QA2A 3D66A 5D4PA 1K1QA 2DNRA 1HHSA 4JI8F 1REVB 3GILA 1RJJA 3PYDA 3MMJA 3ZZOA 1YTYA 2H54B 2HPUA 1U02A 2RRAA 2KVIA 2V4JB 1RYRA 4BCAA 4LF6J 4UTGA 1QTMA 2K3KA 1HD0A 3N5BA 4TKTA 3WX4A 1FRLA 3GYXB 1JLEB 1Q8BA 4OYMA 4J9SA 4YR2A 3KMQA 4ED3A 2YBVA 3MTJA 4I6AA 4DN9A 1F6TA 8ATCB 1DJ0A 3MOJB 3SZ2A 5D8HB 1T95A 2X3GA 2IYIA 4OHWA 4O3RA 2X3DA 3HVTA 4NLVA 3CCJS 2ZHAA 5CYQB 5EHHA 3N6LA 2RKIB 1RTZA 4RBTA 2YWHA 3OR2A 1XEZA 1SBRA 1WEZA 1U1NA 2DGVA 1SL0A 2KRBA 2VG5A 3NBPA 2BANA 1Q0NA 4NLOA 2B7CB 2Z56B 1KN6A 3AD7C 2GIQA 1FFGB 3SCJE 3LP0B 4O23A 2IJNA 3PR4A 3UQSA 1XR5A 1Y7PA 4GKJJ 2XEXA 5DGAA 4LFAF 3GFYA 3RZAA 1UL3A 2BOPA 4C3LA 1FK9B 1S6QA 4F3OA 3CWJA 4ZVSB 2PEHA 2XMAA 1ZYQA 4OHVA 2EK6A 1SL2A 3WDOA 2SXLA 2VF3A 2ZDOA 1F0XA 2Y8YA 1FVSA 1PJ6A 4JUZA 2XQCA 5D77A 2G13A 4KB7A 1S79A 1S6QB 2HVIA 3D1QA 2KFNA 5ETSA 3C6UA 2J9EA 5CCMA 1HWIA 2AIRB 5I3PA 4HKQA 1TL1A 3OTEA 5KG0A 4O3OA 4OI0A 3HD2A 1FRKA 4M5LA 1RKIA 4RW7A 4DPTA 4BDPA 2V2KA 3FBBA 3A3NB 3PX4A 1HQUB 1GTEA 2JOQA 1RHQB 2BVZA 2IC3A 1Z2LA 2H5JB 2F8HA 5D3GA 5ADZA 1UJ4A 5F41A 4KPYA 4DLEA 2WOMB 1VBZA 2PI5A 3QJJA 1TL3A 1RTHA 2N3LA 1GAOA 2LECA 3C16A 2FC9A 2OHDA 2I9SA 3PNIA 4UF4A 2VICA 3WBZA 1HWUA 1LK7A 2AEJA 2QC3A 5C2CA 3A12A 2YKQA 4RNFA 1S76D 2PMWA 1S4FA 2QE5A 5KFGA 2WW4A 4BC9A 1N56A 2ZDPA 2KYXA 2IAJB 1RE1B 3DRRA 1V9OA 2BJ3A 2DHHA 3A3PB 3NCPA 2RT3A 4JI4F 3I4PA 2QJ3A 4DHVA 1IM6A 5KFRA 5EWGA 2COLA 1NHVA 3BEGB 4WYWA 3I82A 2GHPA 4AFFA 3W8PA 3DYAB 2DNPA 1Q78A 4W90B 4NLUA 1FJ7A 4EMDA 1URNA 3GE9A 2LQJA 1VFJA 4QW8A 2W7AA 2ZJPQ 1FX4A 2DRBA 3J81j 1WC1A 1VQ7S 2QLWA 2JH3A 5IXUA 5GADI 2R2UA 4B9UA 4C11B 2V67A 2MKYA 4MAKA 3MCSA 2YXLA 4CH1A 1X0FA 2KH9A 2ZVIA 4CH0S 4JI5J 3JS9A 1NAQA 4CO2A 3M30B 1RT7A 4KY3A 2XHCA 4ECWA 4DR3F 4WFAQ 2FLNA 1C4CA 1H7XA 2YQ1A 1JLAA 5B0CA 3K5NA 2ZFHA 3QT5A 4RNMA 5DDRC 2CQ0A 1TUVA 5L8RC 1X4HA 3QSIA 4LSNA 4A8XA 4PEOA 4CO5A 1RBAA 1TK0A 3DN9A 4CO4A 3SEOA 2QL5B 3I32A 3AA9A 1KQKA 3ILIA 1NSAA 1FF2A 2VG6A 4H4OA 3PYGA 2EFNA 2DRDA 4DV3F 2QV6A 4YN3B 3FVYA 1R6YA 1S77D 5KAKA 1YJNS 4OL8A 4V1Ak 5H1SV 2W2MP 3OHBA 4USWA 3JQMA 4X65J 4RNOA 5B0GA 3AQPA 1CS4A 3BKUA 2HS4A 1D8YA 1FCAA 2HQDA 4ES1A 2ZH5A 4X66F 1H2VZ 1B0PA 2R8HA 1TK8A 2MKJA 1SJ4P 5KT5A 2HHHJ 2FC8A 2CQIA 3HCXA 4Q8EA 4A46A 3HDSA 1UFKA 2OJ3A 4NWBA 1U2RA 2QFJA 1APSA 3HVRA 5DLGA 2VJUA 1HNWJ 1TAUA 1FERA 1D1UA 4HTIA 4Z37A 1U0HA 1NDCA 4W92B 3NCQA 3TZYA 1OYDA 4XTTA 5IS2A 4E2FB 4EBCA 4PG6A 4EWTA 3TA0A 4TU9A 5JMNA 5F8GA 1K8AT 2FVQA 1ROFA 5HO4A 4IH6A 4PUOB 2YQ3A 2VKRA 3HVAA 3UNYA 2FJAB 3EX7B 1S6OA 5BYSA 3KMSA 4L76A 3ZTRA 2M52A 1S5ZA 3TUJC 3DLKB 2CQ1A 2ZJRQ 2F5GA 1OS5A 4N8OA 4MKAA 2AGPA 4KKOB 1XMBA 3K89A 3W5ZA 1D3WA 4CNYA 2H4YB 3OTOF 4WXWA 4ELUA 4JI3J 3U1MA 1RYSA 1RAOA 1CULB 2FJVA 1KVIA 2KYZA 2M88A 5LSRA 1EARA 5KT6A 3IA0A 4Y3CA 3IC1A 3VAKA 4WK1A 2BJDA 3BGRA 3UN5A 4HHJA 3K0JA 2VG7B 5CA5A 4UW2A 2RSQA 2UUBJ 3UWTA 4NLSA 3H20A 3BH7B 2DPJA 3UDCA 1WEYA 4UOFA 2R7XA 3OSPA 2XMTA 1RTDA 2B5JB 4LRBA 4PG7A 2L41A 3LAMA 1ZBTA 5A76A 5IFMA 2WVFA 3DU6A 2DNZA 4IDKB 3MUMP 3V6KA 1XR7A 4PG4A 3QIPB 2HKEA 1AA1B 2YNIA 1VBKA 3LUYA 3BN7A 2Z30B 4A8KA 1V3RA 2QEXS 1QSSA 3TOQA 2EFOA 2V9WA 2JNJA 2ATCB 1S49A 1HNZF 4OZ0A 1CG2A 2PGCA 5KFHA 2DH8A 4NRUA 4HR2A 5ETVA 4X2BA 1JMTA 3QYYA 4DL6A 4FVMA 1B70B 4F0KA 1R6VA 2OTLS 5G0RB 3RW7A 3HM9A 2AYBA 2CJQA 2OPPB 3GFXA 4ZVGA 2ASYA 2E1RA 3DNCA 1ACMB 2ILYA 3R27A 3QFHA 3K17A 1ZTWA 1UEVA 3R7SB 4F7VA 1HFEL 2HQIA 1S1VA 1T9VA 1YJ9S 4JI1J 3KNGA 4CH7A 2ZBRA 1KLNA 1EQMA 3G71S 1T05A 5IT9U 3M4XA 2HGLA 3W2VB 3H98A 2RUSA 3B8HA 2VPYB 1RAIB 5F3TA 3LW5C 4IO1A 2K7KA 1U8SA 2CFXA 3M8QB 4PXBA 3H25A 3KK1A 3KLGB 4GKKJ 2I2YA 2WCXA 5F3ZA 4DX7A 1TKZA 4DV2F 3IM9A 1SB6A 4ZVQB 3UVJB 3MUVP 3AOBA 2H48B 4DG1B 3PHTA 5KFOA 3SCLE 1Q82T 4F67A 1LWEB 2VZ9A 1TKTB 3DOLA 1YWXA 1QAIA 2GV1A 2JL9A 2XMUA 3DLGA 4ZVFA 1SKSA 4C8NA 1UMJA 5F9LA 5B08A 2NSCA 5B0EA 2CNOB 3T9NA 1XR6A 4C4WA 1F1BB 1RT3B 3K58A 2W9CA 2R7SA 1JLQB 3SQGA 3LPEA 3Q8RB 2VFSA 2LLZA 3ZTPA 2ZC3A 1FEEA 1YJVA 2P9EA 1PAUB 3O44A 3I5BA 5F0UA 3W60A 1LWXA 4ZLNA 3QZ7A 2J76E 3ISNC 1FA0A 3CD0A 2H5EA 3M1VB 2G2OA 1FJGF 2X7IA 2BM0A 2PC6A 1FDBA 3Q22A 1RAJA 4DPUA 3VZHA 5FD1A 1VR6A 3CJ2A 3EZOA 2YX1A 3C6TA 3GFZA 2M7SA 1FXRA 1KKHA 4WPAA 2EBEA 2G1DA 4IQXA 5D4LA 1HBOB 3X1LB 3OR1B 5AXNA 5BXIA 3HJVA 1OSCA 2Q66A 4FNIA 3C6TB 4F50A 1MNEA 3FFIA 2W01A 2HRTA 4ZPAA 2Z0GA 3O2IA 1VDHA 4TLQA 2DXEA 5KG4A 5J2PB 1MN9A 3GJSB 3MZIA 3W66A 3BBCA 4LF6F 2E1CA 4ED7A 2DO4A 4NXNJ 3MXHP 2FIUA 4OYIA 1UVIA 1GX6A 2BQ3A 5KFLA 3ET6A 3NGRA 2BABA 1RT6B 5ETMA 2FTRA 2PIIA 5DZ7A 3TUIC 3CJ4A 3IN5A 5GMEA 2H3EB 5KFZA 3M6VA 4LF7J 3FC9A 3AB4B 3ENVA 1KWMA 3MM8A 2GAHC 3MEDB 3T5JA 4CLSA 5HMWA 3G96A 4N41A 2JEJA 4MKVA 5M2UA 2MZQA 4W4MA 1RZMA 2EKYA 1SKRA 2BUNA 3KUEA 1JB0C 4M8LA 1U49A 3BR9A 4B3SJ 2G0CA 3H4BA 1S59A 1YZ7A 3GQCA 2KFZA 4NZ6A 4KFBA 1TK5A 1OO0B 4GKJF 2OP5A 3LP1B 1I94J 2DR9A 4P75A 1SXLA 3D6FB 4J91A 1KEKA 5IC6B 1RHKB 3MR5A 3NCRA 2MSSA 4P52A 3CJKB 3QAUA 4ELVA 2LXFA 3NOGA 1FDDA 4QW9A 2QLXA 4A4JA 3SV4A 3RRHA 3TAQA 5AXMA 3TVYA 5B0DA 2IM0A 2GC8A 2MQQA 2XLJA 4TYAA 3F41A 3NS6A 5I42A 4JV1A 2IBKA 1RDRA 2CRLA 1UPPA 2C2OB 1RHUB 4FF2A 3TVKA 5LMNJ 5KTQA 5LMUJ 2KHDA 4B3TJ 3CJSA 3I87A 2WBMA 2RH3A 3OQ2A 1E6YB 5LXYA 3IP0A 2CDQA 4TXSA 1FDNA 1NSQA 3JYTB 4F26A 3J80Y 4HL9A 2XMJA 4IH7A 3GV7B 4JI0J 4DEZA 2V8VA 3MMAB 5A2QY 2BEFA 3ELHA 2VBZA 2BJ8A 2YNFA 1QD1A 3CVKA 3J81Y 3HK2A 4ZCLA 3C14B 3W2WB 1A0OB 1X0PA 2GO8A 5M2RA 2KM8C 2IRUA 1G7CB 2C3YA 2F9DA 5AE1A 4DV6J 4DQSA 3LPYA 1IKVB 4TU8A 1OY8A 4MFBA 2JSXA 3DRSA 1RSCA 3PJ9A 2FHJD 3MM5A 1JLFB 4EFAC 3SMZA 3PIOQ 4MMOA 2YNFB 3G82B 3KUHA 2BR0A 5EX3A 3I31A 2L9NA 2HMIA 5ETLA 4OZ2A 2CVEA 1N5YB 1S9FA 2EPIA 4GO5X 1WG5A 3CD7A 2VHGA 1DARA 2HIYA 1S7IA 4NMXA 1IKYA 4C8MA 3A8KA 2OKQA 4J9RA 1BUXA 3DRSB 2HNDB 3MAQA 2I0XA 1F5CA 3QFWA 3T6JA 5HBMA 3RRKA 4ZK7M 5D4NA 3DLEA 1UTAA 3CD5A 3BO2A 5HL7Q 4F4XA 2BKPA 3ULHA 3DDNA 4ZIVA 1VRTB 4DPXA 1UZHA 2DXDA 3KYLA 3CDUA 3KLVA 4DV0J 3KK3B 2ZITA 1IKWB 5I4MA 1WHYA 3N0VA 3RBZA 1YITS 2NZCA 3UNGC 1BQMA 1KHWA 1UW4A 3L9ZA 2CWKA 4JI5F 5DQIA 3CJRA 2PDAA 2J0XA 4ZVHA 4QIVA 2BJ1A 3FZBA 4KHMA 2CPIA 4USTA 2MJUA 1UPMB 2CVIA 4ZP9A 1L3SA 1AB8A 1DTTA 1H6KX 4DR4J 2MKSA 4URGA 2IVMA 2XYHB 1TKDA 5LJ3Y 2OSRA 1CLFA 2QMXA 5KG6A 1YHQS 3TJAA 4DF8A 3LP2B 1U6FA 4QWCA 4JBCA 4K4VA 3EGZA 1Q8KA 1U48A 2RU9A 2DR6A 3M2UA 4K4WA 1SL1A 2Q43A 4KYZA 4GO7X 3ZTQA 1Q5YA 1RA7A 2KM8B 3EVMA 4AD6A 1R8CA 3M8SA 5DG9A 2OEMA 3A8IA 1XK8A 4JV0A 3D54A 4DFJA 3AH6A 1QE1B 3OXFA 2E1MC 3HI9A 4JI7J 2ERRA 4UZBA 4XPCA 3MDFA 2WSFC 3J7A1 1U26A 4A48A 3R8YA 4X65F 2Z2YB 1T9UA 2B56A 4ANCA 4JV2A 1VIXA 4K4XA 3OVAA 4FS2A 1S1XA 2MDAA 5ETTA 3AXMA 1I1GA 3VGTA 2HHHF 3AB2B 2LDYA 3VGVA 5CYMB 4HT7A 3T1AA 4XK8C 2CG4A 1LOUA 1YK9A 2QMWA 4Y2CA 4ZHRB 3DM2B 3E51A 5DQGA 3FSXA 5KFTA 1S0NA 1HNWF 2XTJP 2NUUG 2ZVSA 2FHKA 1U09A 3EMTA 2B4VA 4NZ7A 1DQ9A 5J1PA 5B0AA 1U24A 1HYSA 1J5OB 1Q86T 1SJQA 3VR1A 1VRUA 1PGZA 2HK3A 3UCZP 3OTDA 3AFGA 3V6DA 2BKOA 2QG9B 2AX1A 5BR8J 1K0TA 3DLLQ 2GZOA 3E01B 2ZWOA 3FBFA 5J1EB 1CJKB 1RUSA 2HZCA 5E5NA 3CF5Q 1ZPWX 1RT5A 2XGQA 3QPIA 3QBCA 2B8PA 2OPRB 2R7TA 1GXUA 2OO4A 5C42B 4P10A 4DN0A 9ATCB 3V6DB 2XB2D 1FNXH 1BGXT 2EG1A 2BRKA 3BV8A 4JI3F 2C3UA 2AZ1A 1U6BA 2HFSA 4WE1A 4X4QA 4Y2IA 5A8RB 2L9DA 1DLOB 5C24A 3BR8A 1M5OC 3GU0A 4I68A 4BS2A 5G4DA 1ZOTA 1AUSL 1I6JA 4PYDA 3NNAA 4ICLB 1SUQB 2UUBF 4K7QA 1VJWA 2RHSB 1NDLA 1X9SA 1SH0A 2RQMA 3D7SB 1CJUB 3DCAA 1DHMA 5A8KA 4NL5A 3DMJB 4PZVA 4OJ3A 1JLGA 2FYXA 3LF0A 4TY8B 2CPHA 2C42A 1MMNA 4LR8A 3QT7A 5E33A 4ILLA 4RW4B 2E7XA 1DFDA 4NMLA 5IM0A 2KB2A 3DI6B 4CLLA 4WTOB 2Y1RI 3BF4A 2JLEA 1SQGA 4RU2A 3KLIA 1RHJB 5K5MA 3VAHA 3MI7X 4C97A 2BE2A 1X5PA 5A8KB 4WFYA 3MECB 4AE5A 4J90A 1CSJA 1HWLA 2AZ3A 6FD1A 5D0RA 3R3TA 2JHEA 4NLGA 1OPIA 1WHWA 2LCWA 1WTFA 2IVFB 2M2BA 3BO4A 1YBUA 3KLIB 3R6GB 3HX9A 2X1AA 1RLCL 1SJ3P 2JDJA 4NASA 4C9DA 2GFFA 3FEXB 3H4DA 3CCES 2G0IA 1SH3A 1VHFA 4U9RA 3CMES 2UXBJ 3M7VA 4RUCA 1T8EA 1K1SA 4NYZA 1X4EA 4A8YA 2CPDA 1WWHA 1W7WA 5T14A 4EBEA 4M5HA 2N82B 5KFUA 2WSCC 4TQRA 3VHQA 4EZ9A 3MEEB 2AJFE 2GGPB 3M6UA 2D74B 2UU9J 4N7TA 1HW8A 1W2BR 1KBRA 4JI1F 1P27B 1TL7B 1U1OA 2EC0A 4Y00A 5KFAA 5K14A 5L1IA 3P6YC 2DGOA 5HMZA 2R7QA 2HYIB 4Z7CA 3BB5A 1FX2A 3EJMA 3S6EA 3TO8A 1FE4A 3G6VA 3VVUA 1M1HA 1RK8A 1GXTA 3KXDA 6AT1B 2BJ9A 1W26A 4GKKF 2RMLA 2FLPA 4KIAA 4RZRA 2YKMB 5I3UA 2QLJB 3M9MB 3BO3A 3W5YA 2MB0B 3ITHB 2RF2A 1WF0A 1OJ4A 4HI1A 2UUWA 2MZJA 3TARA 1Q5VA 3OLBA 1FWKA 1KD1T 3VGUA 3IRXB 4DUYJ 1I5OB 3DRPA 3Q8VA 4ED2A 3ENAA 2M0GB 3IAS9 5HLFB 1DTQA 3WIUA 3GIJA 4DF4A 3W1YC 2GAGC 5I3QA 3HSGA 2GIFA 1WDDA 1VBXA 3TQ1A 4K5SA 3NLCA 3EDQB 3NGDA 3CJ0A 3NGKA 4P2XA 3Q8UA 2HNZA 2V63A 3F56A 2M4MA 1XMOJ 4GVLA 2VASA 4QWBA 4B3OB 1YDLA 4KO0B 1ULRA 2DGSA 4L72B 4ZCMA 4LBIA 3Q2SC 4CIOA 4O4RA 2KXNB 2DO0A 2KJVA 4DSJA 1H2TZ 5EWEA 4U96A 1YGYA 4IRDA 3KLEB 4LIRA 4FBTA 4OV1A 5LSOA 5HI7A 4QPTA 3HSDA 3MTKA 2AP6A 2CPYA 3ZZUA 4CLKA 1HL6A 3DGPB 2E1PA 1R0AB 1GXLA 3D4JA 4U8VA 1X5SA 3CCMS 1S9GA 2CKWA 3HZEA 2VC1A 4DCOB 2DCLA 3FCHA 1QUPA 3LTOA 3C46A 2GHVC 4WCEQ 4DX8H 1G3OA 4NXNF 3UR0A 1SIZA 2W4CA 2QL7B 1RHRB 1WI6A 2B6AB 2RQKA 4M5DB 4CLFA 1LWFB 3ZTSA 2R3VA 4C48A 4NCAA 1KNZA 4P6QA 2MXYA 4N47A 4LF7F 2XNRA 4WK3A 1O5JA 4O3PA 3MR3A 3N5FA 2JEGA 4Q2MA 5T7LA 2I1RA 3SDEA 3M8PA 1SV5B 2OUGA 3I4HX 3PYEA 2H51B 5LOQA 4B3SF 5CYJA 2RILA 2ZE2B 1V6HA 4ZJLA 2MZ1A 4FXDA 2ILZA 4KAIA 3MEGA 2DT9A 5LXRA 1I94F 1ZZNA 4K0KJ 2XS2A 1WOSA 4ZPDA 1HNVB 1VQKS 2R7OA 3GCWP 5KFSA 4DZDA 2NXJA 4F02A 4HACB 3M8PB 4CP5A 2Y1JA 3CO9A 4QWEA 2DPIA 3VAJA 2CJAA 3VCDA 2NXEA 3J7ZT 1URRA 3PW2A 1RWWB 4OJGA 5A0YB 3GIMA 2HHQA 3K2YA 3T5HA 1YX2A 2V4RA 3CCUS 2ZM6J 3C19A 1XNRJ 5LMNF 5LMUF 3MURP 1VLOA 1BXNA 4B3TF 2R42A 1KTVA 1NKCA 2UXDJ 3POTB 2QO3A 5E3QA 2OMLA 1TMJA 1HQEB 1PILA 1ZZFA 4QWDA 1BY9A 1FNOA 4CYUB 2V8HA 1VISA 4FPRA 1T02A 2AGQA 5IT4A 1FEHA 1KOHA 1VJQA 4WZMA 3FUYA 2KG1A 1LW0B 2IDLA 2ZD1A 4JI0F 3KWMA 3B4MA 3G8QA 1U1KA 2B7BB 2R4FA 4DPYA 1VGYA 4UUXA 4DUZJ 1TL5A 2FVSA 4X4OA 1B7FA 4HTJA 4QBUA 1JJHA 4M5MA 2O66A 1CC8A 1NU4A 5EWFA 4DV6F 3T5KA 2C3MA 2NUHA 5J2QB 4ECUA 4KH1B 1LFWA 4DBQA 3OFFA 3KJVB 4I4BA 4RR5A 4LJMA 1VQPS 2EWHA 4N5SA 3CC7S 3OXGA 4E0DA 5B7WA 2AGOA 5L1JA 5CD4H 2FPHX 3TUPA 4MK9A 3OT9A 3PJXA 4LF5J 4FS1A 2MQNA 5KFFA 2MLXA 2CQ4A 3M9NB 2RU3A 3OL8A 3RB0A 9RUBA 1C1CB 3AXKA 2VD3A 4Q8FA 1C4AA 3GG1A 1B0VA 3THPA 2FZKB 1N34J 2APOA 4P2MA 1EETB 2QA4S 4DV0F 1P9YA 2UZAA 4FVCA 3UW1A 4M5KA 3G6YA 4OYPA 3UFCX 2CQDA 2FGOA 4OHZA 3I0SA 4NLQA 3IWLA 3T1HJ 2D41A 1D9AA 3PW7A 2BJEA 2Y1IA 4C6AA 3L09A 2PN6A 2D9OA 2CWXA 5CXTA 3W8GA 2R8JA 2IPOB 5KFDA 4C8ZA 4DR4F 4F04B 2AYGA 4EYIB 4QIWD 4EZ6A 1NNDA 2LQBA 2P9CA 3JXOA 4FPIA 1S6PA 3NXZA 4CLYA 1WSVA 2QSWA 3I0SB 4DS5A 4UOGA 1X4BA 1XIQA 4N76A 1RWNB 3KK2B 4ZPWR 1BMQB 2MZRA 2WVCA 2FLOA 1R8BA 3H5UA 5KFYA 3MR6A 1NH8A 3KLHB 3I55S 3OFEA 2E66A 2G9OA 1V3ZA 5KFEA 2AJ0A 1N4LA 5ETNA 3ZZTA 5J2NB 1X60A 4YQWA 2IM2A 2QT7A 3I6PA 1KDNA 3MR7A 4JI7F 3L7PA 2ZUAA 2NREA 4I7FA 3D1OA 3NRBA 2WSEC 4GC6A 2D69A 1JK9B 1TMMA 1LKZA 1H98A 8AT1B 3DOMB 4LF2A 4OYAA 2HBYB 3M2RB 4ZN1A 4R8UA 5C25B 3HHDA 3CDAA 4TU7A 1EP4A 1RWPB 1RLDA 4ZPVR 4I2QB 4KJIA 3NGUA 1OY6A 3K5OA 4DR7J 1LV5A 4QU6A 4Q45A 1NHUA 3A1YG 3MM9A 4MKBA 3TAMB 1NHKL 2R7UA 1UA1A 1C1BB 3M8ZA 2RAQA 4I2PB 4LSLA 4BBYA 4WP3A 2ZH6A 1S72S 3G87A 3AT1B 1S97A 3LQVA 4M63A 4NZ0A 1TKXA 2HQGA 4DL5A 4DV4J 2HHVA 4LVOP 1UETA 2M70A 3MGJA 1O51A 3R7BB 1NK8A 3NWGA 2PMHA 5BR8F 1W2IA 3QLHB 4IG3B 2RUGA 2OSQA 4NPOA 4PQAA 2Y1LB 2IVYA 2JC0A 3OPKA 2XY7A 1N6QA 2OH2A 3BQ1A 2C2ZB 3PV8A 5JVGQ 2VDIA 3HT3A 3OTBA 3HFKA 4ZVUB 1X4FA 1WHVA 3V2UC 4O0IA 3IG1B 2RE1A 3AA8A 3QIDA 3HULA 4IFYA 5HQLA 4C0OC 1VYAA 3CCTA 3ADAC 3LAKA 2CQHA 3TX0A 4DJBA 1JIHA 4YDXA 2B51A 4FZVA 2YNGB 4MTPA 4OV6A 3FBCA 2R2TA 2VFUA 2WB1D 3H0PA 4G1QB 3G9CA 2C2EA 5GAHU 4ZIWA 2ASJA 4IUFA 1X8DA 3GZ7A 1ZM2A 3G4SS 2Z2ZA 4B9MA 1IR0A 4KHPJ 4RW9A 2M8HA 4ZP6A 1QSYA 4UY8T 2E5HA 3V4IB 2Q1LA 4FNHA 4O4GB 4NLRA 2DTJA 2IMOA 2I5JB 1WG1A 2CG8A 2JVOA 2HRYA 1DBDA 2QMUB 3W5XA 1B64A 3G8SA 2J6SA 2ZKTA 1CJTB 2XLIA 4DPOA 1FXLA 1ZM9A 3Q8QB 1OQ3A 3QWPA 4QWAA 1WACA 3WIVA 5MLCV 5HROA 4I69A 3TANA 4FF1A 3PYFA 2J6TA 3JSMB 1WNEA 3MCMA 2D3UA 5D6GA
chains in the Genus database with same CATH topology
3M6WA 1IQZA 2VA2A 3VZHA 5FD1A 4LMZA 2DBBA 3CJ2A 2YX1A 1NZAA 3C6TA 3VZIA 3R1LA 5C42A 3GFZA 2R2SA 1FKPA 4USHA 2M7SA 4OLOA 3CUNA 2VBXA 1T3OA 1FXRA 2YKNA 2HNYB 5F8MA 2W8LA 1KHVA 2UUTA 5F8HA 2EBEA 3MEGB 2G1DA 3BQ0A 4IQXA 2V8DA 3DDKA 3DRXA 2AU0A 5D4LA 1HBOB 4FXWA 1FJEB 2DHAA 3V6JA 2RD5C 4OQJA 4ECRA 2E7WA 3X1LB 3QWUA 2XG8A 1KC8T 3CEDA 3HO1A 2UXBF 1OQ6A 5A8RA 1S0OA 3OR1B 1DLOA 5AXNA 2BBEA 2B43A 2GCFA 5L38A 1VQYA 1S1WA 1W25A 2ZNYA 1RQ0A 1NK4A 2J0QD 2XLKA 1OSCA 2FGCA 1RT7B 1BQNA 5KFCA 4HDGA 3DOKB 3HF5A 4FNIA 3TX8A 3V81A 2Q66A 2CPFA 3H2LA 1Y3KA 3K7RA 3C6TB 4F50A 1MNEA 3FFIA 3TP2A 2JWNA 4U67Q 4AUKA 2WAQD 3L3CA 1IBMF 2VODA 1VBYA 2RVJA 4ZPAA 3QJPA 5JUMA 4ICLA 2Z0GA 3W3SA 1SUQA 1RTIB 3QGHA 1T03A 4ED1A 4ZS6A 3O2IA 3O6QA 1JLAB 4TLQA 4AYBD 5KG4A 5J2PB 5L1LA 2XNQA 5K8OA 1MW7A 2EBGA 2EFVA 4IOAQ 1E6VA 2WONB 3MZIA 2AW0A 2LDIA 3DMJA 4O44A 3CCZA 2LMIA 1FD8A 2E1CA 2UU9F 4LF6F 4ED7A 2DO4A 2B9WA 4TY8A 4NCBA 1WD6A 1HNIA 4LSNB 2ZH7A 1NK6A 2UUAF 1Q81T 3IR5B 3M2VB 1VQNS 1TVRA 1MROA 3MXHP 4NA2A 1DQ8A 2FIUA 5E3PA 4Q44A 1KTQA 1UVIA 3V81B 4DS4A 3N4WA 1GX6A 4YR0A 4ZCKA 4RW4A 2BQ3A 1S1UB 2IRXA 2XCPA 5KFLA 4UQTA 3DI6A 2GMJA 2NPIA 2BABA 1RT6B 2FTRA 1Y00A 4ZLPA 2R2RA 2PIIA 3ZZ0A 3TUIC 3CJ4A 3IN5A 4OFZA 4ZPTR 2LVWA 5KFZA 3B82A 4X84A 3M6VA 4R25A 4YUDA 5KG7A 3N79A 1YRXA 2EFGA 4WYLA 1Q7YT 2ADBA 2Q6CA 3AB4B 3ENVA 3MM8A 2VG6B 3H2UB 3I96A 4RW6A 4H4OB 3MEDB 3T5JA 4YR3A 2YWEA 3GYNA 4IH5A 5HMWA 1X4DA 1KQGB 3MECA 2AJ4A 4KT0C 2AD9A 2UVVA 3G96A 2ADCA 3O1LA 3OL9A 3LH2S 4N41A 5H9FJ 3CD6S 4QR0A 1TFYA 1LW2A 1XN9A 1MROB 2JEJA 2CZVC 4C2MA 3RW6A 1O0PA 2NZ4A 1VQSA 3KKFA 3WZ0A 3US5A 4RW8A 2ZD1B 1FKOB 4ATNA 2XBPA 4N8NA 3JAMY 4YY3F 1D9FA 3CCQS 5M2UA 1VQOS 2DISA 2MZQA 1SKRA 2EKYA 2FHMA 2QA4G 2BUNA 3MOZA 3CPWR 1JB0C 2HGMA 4M8LA 1U49A 3BR9A 3CJ3A 4J5OA 4AXIA 5F0WA 5K8NA 4EO6A 2P9GA 4YEAA 3R5BA 2G0CA 4OI2A 2UV8G 4E8UA 3RRGA 1H2UX 3H4BA 3KG0A 1HW9A 3NG8A 1IKXB 4KSEB 3GQCA 1S48A 4NZ6A 2KFZA 1Q16B 4KFBA 3VAMA 1XC9A 1TK5A 4K50A 1OO0B 2KJWA 4DUYF 4GKJF 2NR0A 2OP5A 4DFMA 2KZMA 3LP1B 4DWIA 1KONA 5F8LA 2DNMA 2A3JA 4ID5B 1F5BA 1RWUA 7FDRA 2DR9A 4Y2KA 3T19A 4A8WA 2L3MA 1L3TA 2N7CA 1SXLA 1KEKA 3UR3C 3F73A 4DL0C 2LEAA 3MR5A 5J2MA 2JEFA 1KRPA 3NCRA 3ISZA 2MSSA 1PC5A 3AAWB 3PRBA 3CJKB 1YG0A 2FLLA 2KRRA 1FNMA 4C0HA 4F4ZA 2MMYA 1RA6A 4NX9A 1UJ5A 3QAUA 5HMXA 2GJIA 1PO6A 4ELVA 2LXFA 5DM6Q 1FDDA 2PI4A 2XSJA 4QW9A 1Y4ZB 1MWYA 1REVA 1HBUB 2JFDA 2QLXA 4A4JA 2KTQA 2DGWA 2X1BA 4K4YA 3SV4A 3Q8SB 2XI3A 4FN5A 3CC4S 2MKKA 3RRHA 1FXDA 5AXMA 4J9MA 3TAQA 3TVYA 3LOUA 3E3XA 1D9DA 4B9NA 5B0DA 4YB6A 1LK5A 4LQ3A 2IM0A 2V4JA 2RS2A 4ECZA 3MEEA 2GC8A 2MQQA 2XLJA 4TYAA 2KKHA 1QM9A 2GGPA 1QUVA 4HH1A 3S7RA 1KS2A 1VIOA 1HBMA 2DH7A 2YKAA 3F41A 3NS6A 4G1IA 1U6ZA 3PZPA 2J5AA 5I42A 4JV1A 2IBKA 1LQ9A 4EUVA 2KZZA 1RDRA 2QZ8A 2CRLA 4F4KA 1FHTA 3PEHA 3Q24A 1JLEA 4RWWA 1XMOF 1C0TA 4FF2A 2EW9A 3TVKA 4KGKA 3C2PA 5KTQA 4CCHA 3OL7A 5KG3A 5SZTA 5CZXA 4F2SA 2Z4PA 3FRZA 2KHDA 2MJNA 5IT9Y 1Y0HA 3I87A 4ECQA 4JI6F 2WBMA 2W9BA 2RH3A 1S99A 2D1CA 1M5PC 3PW4A 3OQ2A 4RNHA 1E6YB 3KOAA 5LXYA 1XBWA 2CDQA 4X4VA 1YRUA 1L3KA 3AQOA 3BGLA 1JLBB 2HWHA 2YX4A 2R9LA 5H9EJ 4TXSA 1RT4B 1FDNA 4YB5A 2ZJQQ 4CZCA 1WELA 2KFYA 3RAQA 4IR9A 3LGMA 5CYQA 3S8SA 2RKIA 3OLAA 3JYTB 3U7JA 3NP5A 2N7YA 2OPSA 2VKZG 2ROEA 1AW0A 1IQTA 2ROPA 2J0WA 4F26A 1ELOA 5FIIA 3IAM9 2YKMA 2MKHA 3O8WA 4H4MA 2DGTA 3J80Y 4J9LA 2XSFA 4HL9A 3RYLA 1G1XA 2XMJA 2DIUA 4D3HA 1NKBA 4IH7A 3GV7B 1Q53A 2GJ2A 2LXUA 5C5JA 4HLBA 4DEZA 2UUCF 2DGQA 2V8VA 5DG8A 1HI0P 4YB7A 1VC5A 3ITHA 3UCUP 2PO4A 1MU2B 2MPUA 4DMZA 3MMAB 2KN4A 2HHPA 3MMBB 4ZOSA 5A2QY 4MIAA 4LIWA 1PC4A 2X51A 1U45A 2VBZA 3AJ2A 1YJTA 3BGRB 3HHLC 3MEKA 3IWNC 2YNFA 2ZBCA 3KLFB 3CVKA 4PR6A 3J81Y 3TR5A 3HK2A 3LP0A 2VC0A 4ZCLA 1AXQA 4QOTA 2HHXA 3W2WB 3IRXA 3UCGA 1P1LA 2AYEA 3H2VE 5F8IA 1X0PA 3IR6B 2GO8A 3HKWA 4ETXA 1ZPVA 1FVQA 4OX8A 5M2RA 3PFEA 2GA7A 2IRUA 1G7CB 2KM8C 1RGVA 2C3YA 2F9DA 5AE1A 1FK9A 3OV7A 2P6TA 4DQSA 1YIJS 3LPYA 1IM4A 3O3LA 3ZZPA 1IKVB 5HLFA 4TU8A 1N5TA 1S6PB 5KOXA 1N32F 3IS9A 4X62F 2P6SA 4MFBA 2JSXA 4ED5A 3CIMA 3DRSA 3K8VA 4URSA 1RTDB 2DNGA 2YY3A 2D3ZA 2FHJD 3MM5A 1LWCA 1JLFB 1WTBA 4LVNP 4EFAC 3HLUA 2ZH1A 4NXMF 3SMZA 1JLCA 3PIOQ 4K59A 5A6WA 4MMOA 2YNFB 2BR0A 3QAEA 5EX3A 5KFIA 4ZKAA 1GQEA 3I31A 2L9NA 1Z4UA 2YVSA 3IWXA 2YNHA 2HMIA 3E8OA 2XC9A 3VQSA 4DL2A 3ZZRA 3GFHA 4X4TA 1MMLA 2CVEA 4J9NA 3K5LA 1N5YB 3U1LA 3IFEA 1S9FA 2EPIA 4GO5X 2UVRA 1X5TA 3OUYB 1WF2A 3KTQA 1FRJA 1WG5A 4B9VA 3H40A 3MMCB 3CD7A 3WC0A 1UFLA 3M32A 1DARA 3QGGA 1V3SA 5HMYA 3Q8PB 2YNIB 5CCLA 2D9PA 1IKYA 1JKHA 4C8MA 4H54A 4ITSA 2XI2A 2OKQA 3IS9B 5B09A 4J9RA 3DRSB 1VQ4S 2HNDB 1S10A 4DV5F 4OMFG 3MAQA 2HHUA 1SIWB 2NPFA 2DHXA 2I0XA 2LKZA