2EKYA

Crystal structure of hypothetical protein mj1052 from methanocaldococcus jannaschii (form 1)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
97
structure length
97
Chain Sequence
MRKVVAEVSIIPLGKGASVSKYVKKAIEVFKKYDLKVETNAMGTVLEGDLDEILKAFKEAHSTVLNDVDRVVSSLKIDERKDKENTIERKLKAIGEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of hypothetical protein MJ1052 from Methanocaldococcus jannaschii
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Structural genomics, unknown function
molecule keywords UPF0045 protein MJ1052
total genus 27
structure length 97
sequence length 97
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01910 Thiamine_BP Thiamine-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.930 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ekyA00
1LXNA 1VK8A 1S99A 1YQHA 1LXJA 2IBOA 2EPIA 1SBRA 1S7HA 2EKYA
chains in the Genus database with same CATH superfamily
3TJ9A 4DSJA 1U8SA 1CJTA 5HJXA 2EK6A 2VPZB 2VF3A 3GSDA 4JOUA 1WEYA 1NPKA 1T03B 1M5VC 4Y65A 3J81j 5D3GA 1FNOA 1ZAXA 3DRXA 2HQIA 4IH5A 4LSLB 4O3PA 5DLGA 5D3GB 2H3EB 1XK8A 4Y34A 1QJHA 4O3QA 2VG7B 2NSCA 4KB7A 3RB4A 1SH3A 2VG5B 3CNQP 1HNWF 1YBUA 2YX4A 3X3UA 1TKZB 2VPYB 3SQGB 4YHHF 1Y10A 4ED4A 4FPIA 3KJVA 1WEZA 1RAAB 2RSQA 1WWHA 2XC9A 2W7AA 3N79A 5CABA 1F0XA 4KR0B 4MT1A 2DGVA 1RYSA 1LV5A 3WQPA 5CYQB 2KYZA 1EZZB 5DZ7A 5AXMA 5J2NA 4P2FA 4ZCIA 3JYTB 3HHLA 1BE4A 1NPPA 1UA1A 1E6VB 4PZVA 2R2UA 4PWDB 4KBIA 3HD2A 4B9TA 2J0WA 4F4KA 3SIPB 1TMMA 1FRXA 2DH8A 3UI3A 3BV8A 4KT0C 3TAMB 2CPFA 1D8ZA 1WEXA 5HROA 1YRXA 1V5IB 3FRYA 1NJYA 2H5EA 4B3MJ 1WC0A 2CXEA 2V0NA 4HTJA 3T5HA 4RU2A 2XGPA 1J5OB 4GKKJ 1U2FA 1I1GA 1ZM3A 2FGOA 2OO4A 2IM1A 3GFXA 1S12A 3HT0A 4USWA 2FZGB 5HATA 4E98A 2XLJA 3VVUA 4K2JA 4MKYA 5FJ4A 1CS4B 1T95A 2HHWA 1BY9A 5CZVA 3AHPA 3DLGA 3H42A 5HJYA 1HMVA 3UFCX 2DBBA 4FNIA 3K2YA 1SPBP 1CJUB 5KG6A 1RWOB 3BSOA 4LFAF 4CRJA 4QU7A 2W8LA 2F7VA 3GB0A 1HI8A 2CVIA 2U1AA 3OR2B 4KO0A 4ZP8A 5C7PA 3B4DA 4ATNA 4PQUA 2XSJA 2HFSA 4ZLLA 4ER8A 2DNPA 4B9UA 3ITHA 3GIRA 2CG8A 3AT1B 4NPOA 4JI7F 1N52B 4NLSA 2KYXA 4G1IA 1R43A 1HQUA 1Y0HA 3FEYB 4OYXA 4K0KF 2RRBA 1GXTA 1Y9OA 2Z0GA 2K3IA 3LAMA 5F8LA 1XJWB 3CE8A 3CDEA 9ATCB 3MM7B 2ASYA 1M0SA 1VQYA 1FXLA 2W7OA 2BOPA 2HHXA 3T5LA 4LRCA 3HHNB 3R5JB 4DBQA 3I5BA 2OGUA 1NB2A 3DNCA 3WBZA 5ETMA 2ATCB 2VFVA 3IR7B 3D68A 2ADBA 4F3OA 3UNGC 2O66A 5E7OB 2HBQB 5HVGA 1JNRB 1ZAWA 2BQ3A 1RZMA 2W2OP 2GGPA 1T05B 2XY6A 1OY8A 2B7CB 2W1BA 1BHNA 2CQ3A 3CCSS 2OPRB 1FX4A 2MQOA 4ECTA 3OFFA 3MMBA 3KKFA 3HVRA 1TL5A 3H59A 2QT7A 4GVBA 4AXIA 4UY85 4Y00A 2DB1A 4WFNQ 2H4YB 5GMEA 2PO4A 3SFGA 3M2RA 2KRRA 2HS4A 4DV5F 3QJLA 4C0HA 1TL3A 2IC3A 3HVAA 4L75A 4ZHRA 1HQEA 4OZ2A 4KV8B 4TU8A 1EQ0A 5L39A 2JOQA 1X5TA 5C5JA 2KU7A 1IR1A 2BJ9A 4OIXA 2MKIA 4FS2A 2QA2A 3BSAA 3BJYA 1HR0F 1DARA 1LXJA 2BJDA 2EC2A 3NAHA 3CCQS 4G6VB 1G3OA 4USHA 3GCXP 4P10A 3RBZA 2JFKA 5LL6d 1CULA 1NHUA 3DDNA 2BR0A 1LWXA 1UEVA 1RT1B 2AJ2A 1IVZA 2X1BA 4FYWB 4QWCA 1Q86T 1QDUB 5DQGA 1FWPA 1ZA1B 3EWGA 4R8UB 1APSA 2E1AA 1VQSA 1WC3A 4M5LA 3KHLA 4E2FB 1U49A 3MM8A 3L7OA 3G8TA 4QW8A 5CH7B 2YWHA 2C2RA 1OPIA 4NLWA 2B6AA 1CC7A 1SUQA 5IXUA 1VQ7S 5T14A 2YTCA 2LVWA 1WJ9A 3MAAB 3GFYA 4JI8F 2HGMA 2M52A 2RJZA 4CLZA 1IKYB 2XZTB 4J9VA 4LF8J 4Y2AA 2JZ5A 3BM7A 4U6PA 1D9DA 4YB7A 2J6UA 1LW0B 1WC1A 1YBTA 4F0HA 5I3UA 5A8KB 4OX9J 2ZOGA 4ZHRB 1VBKA 5E5NA 1HLWA 1REVA 3R5CA 2JEIA 4JI4J 4OJ1A 2GX8A 1VFJA 3FCHA 1RHQB 4MIAA 4EI2A 3HI9A 1DQAA 1KD1T 5ETRA 2FZCB 5IM0B 5L1IA 1B7FA 2HFOA 3TWZA 3OJSA 1NZ8A 3FBEA 4EYHB 5IT0A 1ZTWA 2RMLA 1B3TA 4DV3F 4DV7J 2DH7A 2XMUA 2RAQA 2CWXA 2QO3A 4IFVB 5J2MB 1NK9A 4TKTA 2RQMA 3C16A 4C8MA 1EKRA 2JHEA 2M8HA 1AROP 1TL3B 4OZ1A 1Q82T 1PILA 4NLRA 4RW7B 3CJQA 1NO8A 4A8WA 1CJKA 5JUMA 4QYZJ 5K5MA 1OYEA 3H25A 3MPYA 2GQCA 3G6XA 1W2BR 1SQEA 3I0RA 4LR7A 4NRUA 2CQ2A 1D09B 5C42B 5J2QA 2GVZA 4DS4A 1FRLA 4WE1A 4ELVA 2JRSA 2GJFA 4K4WA 4CZCA 3MTKA 3MM7A 4RWXA 1VR6A 4Q43A 3MD3A 1LK5A 5SZTA 1NU4A 3M2UA 5KFZA 2A10A 3UVJB 1UTAA 2J8AA 3JSMB 2R4FA 2KVIA 2GGPB 2GCFA 2AJ0A 3LGMA 1PBAA 3LP2A 3CCMS 5HVFA 4QW9A 4A8OA 2FY1A 3UD5A 1B0PA 1QAYA 1RWXB 4TY8B 5B0GA 1FKPA 3QQCD 4S0MA 5GAHI 4J9NA 4K4TA 3IWLA 2HYIB 1AXQA 4IG0A 4B9MA 2AYEA 2G2ZA 5L1LA 1HNXF 3DI6A 2ALZA 3BR8A 2XG8A 4USMA 3MEKA 4HYKA 3QJJA 2DNYA 4QCLA 2AGQA 2QMWA 4ECYA 4NLPA 2GAHC 3C14A 2XHCA 1VRUB 2MKYA 3CCLS 2F4VJ 3PYEA 5E3RA 4EZ9A 4DFKA 1FDNA 3C15A 2UXBF 4DQRA 1CC8A 1FVQA 3D6FB 3QLHB 5LJ3Y 5I42B 1NKCA 1UFWA 1NJIT 1U1QA 1WHXA 4QPXA 1CG2A 2DJWA 4TXSA 1VQLS 2DGQA 4NXNF 3G82B 1ZAVA 1SUQB 4ZK7M 2ATLA 3JTPA 4NLVA 3TUPA 4IOAQ 1HBUA 3EDRB 2MZTA 2AJQA 4Y2MA 1SH0A 2J7UA 1X4AA 2DHGA 4URGA 4PG7A 1IKVB 3DLEA 3T9NA 3ZO7A 1X4FA 2G4BA 2KG1A 3EX7B 3AH6A 2D9PA 1LWFB 2AW0A 2BANA 4TQRA 1RT1A 1Y4ZB 4WFZA 4CP5A 3CDWA 3U1MA 3UN5A 2JC0A 1RT2B 2YWEA 4LFAJ 4DSIA 1YRUA 2HZAA 5CYJA 3O8WA 2ZUAA 3HVWA 4KPCA 2WTFA 4UOCA 5D15A 4JYAJ 1A0OB 1WKJA 1Z4UA 5KFUA 5KFNA 3EPIA 4O3SA 4K50A 3OVSA 2GA7A 2GIQA 3IP0A 1Q5VA 1QE1B 1S1TB 1YJRA 3DOMA 1URRA 2KM8B 4KGMA 3LANA 3GV8B 4MYTA 4CNYA 2A2DA 2D69A 2E9RX 4W92B 3X1LB 3GIKA 1P9YA 4PWUA 2VG7A 3LWMA 4X62F 4UY8T 3E01A 1MMLA 5M2PA 4RU9A 2XEXA 2HWIA 3MMCB 1S7IA 2H5IB 1NLKL 2OI2A 2Q6BA 1MN7A 3CW2C 2ALYB 2F8HA 2V68A 3MEEA 4OYZA 1IM4A 2IRYA 5D0HA 1ZPVA 2XHWA 1JLEA 3PHTA 4MKBA 4U96A 5HMYA 3Q22A 1YITS 1IBKJ 3HSGA 4H4OA 4YR0A 1KEKA 1B0TA 2BE2B 4I2QA 4OLPA 4P74A 2YQ3A 4LBPA 5DQIA 4YHHJ 1YJNS 1UW4A 2DO4A 5B0FA 4WTYA 2DR6A 1VQOS 4PXBA 3MM9B 2UVRA 1QTMA 4EBDA 4X4VA 2OPPA 6FD1A 4B3TF 4LF6J 4EEYA 4LSLA 3PYFA 1BQNB 1UVMA 4OL8A 4WZMA 3BF4A 4DR3F 1T8EA 3JS9A 2DIUA 3EZUA 1Q81T 1VI7A 4IQMA 3W63A 3QSYB 3IG1B 3OTEA 2B7BB 3HF5A 3GIMA 2Q43A 2XI2A 1FJGJ 2OKQA 1FRIA 2DEIA 3VAMA 1HIYA 3BS9A 4JI7J 3IAM9 3OT9A 2ZH9A 3N5FA 3ILOA 4YOEA 3MR6A 1SBRA 3I5CA 3LGNA 3QFWA 1RK8A 1S6PA 2XTJP 2OAUA 3GU0A 2YNHA 5KFQA 1E6YB 2A0FB 2MKCA 4KKOB 2OP5A 3V4IB 3MAHA 1DTQA 3RYLA 2GHWA 1S9FA 4DV0F 3CB4A 2CFXA 5K8MA 3K17A 1LW2B 1U1PA 5BYQA 2MLYA 2IAJA 2X51A 3DGPB 3FBFA 3FDSA 3D6HB 2MKHA 3L09A 4FKYA 2V2VA 4LRAA 4OYPA 5KFGA 5H9FJ 4O4RA 2HHHF 4TY8A 1QUVA 3CJ4A 2MJNA 3RBXA 1M90T 3T5KA 3DMJA 3ZXWA 4M94A 2XMTA 3SSRA 4QIFA 4HEA9 4U8YA 3UO0A 3ZFVA 5HO4A 1CQMA 1EP4B 2CPXA 2BW7A 3CCTA 2DNMA 1TL1B 3GR1A 3HFKA 5JVHQ 4FS1A 3H98A 3MR2A 1N56A 1CJUA 4ECSA 1T9UA 2B5JB 3TJ8A 4RBTA 1VRUA 3H5SA 3L7PA 2G13A 3JQMA 1R31A 1FFWB 3I56S 2K06A 1RHMB 1N5QA 2RS2A 1N8RT 1SJRA 1RADB 3R5BA 3RUBL 3OJUA 2OPSA 1N4LA 4JI5J 2FJDB 4BWJA 3FK4A 5JXSA 2L3MA 3PCOB 4O3RA 2EBGA 1U1OA 1GEHA 3PYDA 2AX1A 3KJNB 1SQFA 3M8RA 2J6TA 1FE4A 2G2OA 3MEEB 3ZZOA 1RP5A 2C3PA 3CD6S 1EETA 2HBRB 1EKSA 1M1GA 2GNKA 3KLEA 3CJKB 2X3GA 2HHSA 5KFFA 1OSCA 2OSQA 5LJ5Y 2MZRA 1HWJA 5EHHA 2IJNA 3CDUA 5GVQA 5LSRA 5LXRA 2IM2A 4UQGA 1FKAF 3R2DJ 3ZNJ1 1MLAA 3C66A 3LO3A 3OLBA 4XDCA 1HL6A 5DQHA 1HBOA 3MUVP 3CPWR 3SV4A 4HH1A 3GYGA 3MEDA 4J9UE 1N33J 2NREA 1Q8IA 1S7HA 1SC1B 2OEMA 3BSCA 3KG1A 1Q8BA 1TL4A 5HLFB 3HKWA 5BYRA 2Q3PA 1XR6A 4H54A 3U1LA 4DR2F 4GKJF 3MMCA 2F40A 2CDQA 1KOHA 3O1LA 3E01B 2RQ4A 2HPUA 3UDEA 1HQ2A 4DX6A 4JV5F 4A4JA 1PJ6A 1PCAA 3HULA 3A8EA 2DNNA 1U1RA 2IVMA 2GQ2A 1J5EJ 3RB0A 1DJ0A 4NX9A 4Z7CA 3GJRB 4MKAA 3HHEA 2CPIA 1LOUA 3FBCA 3W7BA 1VC5A 3W5YA 2K3KA 2AYGA 3AAWB 1GMUA 1M5OC 2LLZA 3IRXB 1ZTTA 2ZE2B 1SIWB 2PMHA 3OXFA 3PJXA 1RCXB 1RLCL 2F63A 2RKIB 1X60A 3LOUA 3UE2A 3A3OB 3W9HA 5ETTA 2WVDA 2YNIA 4A47A 2BRKA 3EPGA 1U6FA 3BN4A 1FFSB 1VISA 4LREA 3ICLA 3H2UB 3DDIA 3HSDA 5D4NA 2HNYA 2VFSA 3SZ2A 3HZEA 1HBUB 1LWEB 2F5GA 4GVBB 2KN4A 4ZPTR 4ZDNA 2QMXA 5T7LA 3W8PA 4ZLPA 2ERRA 1FDAA 1YG0A 4U7UK 4Q0BB 1MROB 3LTOA 1OQ6A 2HAFA 3R5GA 3J7AN 1W25A 3UNYA 3M8PA 4F2RA 3SCJE 3EXCX 2UP1A 1J2VA 3I32A 3NGSA 4FN5A 4IH7A 4DX5A 2I2YA 2HHVA 1SL1A 2O1PA 2R7VA 3IR5B 4KV8A 1Y5IB 5A2QU 3HT3A 2M0GB 2OPSB 4DL5A 3NKYA 5LSOA 5D0GA 1NNDA 3E8OA 5B0AA 1DURA 3MR7A 1GXLA 2OMLA 4CLUA 1L3SA 5EWFA 4URSA 2AKWB 3MCMA 2DXFA 2YKOA 1U1LA 2FHOB 3QSIA 4OJHA 3Q83A 2UUBF 3RTVA 3VAIA 1C1CA 2CNKB 1TL1A 2V4QA 2VUGA 4OX6A 1GXUA 1FTRA 4CLLA 1C4CA 3FEXB 2VBYA 4DV2F 1KSPA 4OV1A 3Q8YA 5DRKA 3IGVA 3VAKA 3GLJA 2CQHA 4MYUA 3SSSA 4DPYA 2E1CA 3CC7S 3QRRA 3QO9B 4DR3J 1RKJA 1M1KT 5D4OA 3H40A 3T1AA 2IA6A 3RRGA 3QATA 5KFEA 2VDHA 4ED0A 2GO8A 1LNQA 5IQQA 3QIDA 2OJ3A 2FJAB 1Y3JA 3BZQA 1IBLJ 3R97A 4DV1F 2KZMA 3ZZZA 4JI4F 1R6VA 1ZZFA 3T3FA 2BJEA 5A0YB 1O0PA 3TX0A 2BE9B 1X4BA 1LQ9A 3BGFA 1XR7A 3BPDA 3SDEB 2VBWA 1KRPA 4OYOA 2QIFA 3EGNA 5HK4A 5IV4A 2B4VA 2ZH2A 1OMSA 5DLFA 3JTOA 4C8YA 3ZZRA 3AB2B 5IM0A 2ZZTA 2JC1A 3KLIB 2FYXA 2ZZNA 2DKOB 1NDKA 1NSAA 3ET6A 1HW9A 4ED6A 3HO1A 1D0EA 4LMZA 4F50A 2B4PA 1C4AA 2W2PP 2DD8S 1DFDA 3DXSX 1ZBTA 5KFCA 2XCPA 1S97A 2P9EA 2AEFA 1ZS6A 4P72A 3FSXA 4RNMA 5CQGA 4ERDA 1E6VA 1PBUA 2V63A 1FO1A 3M4XA 1NDLA 3MXHP 1EB0A 2CJAA 4CO0A 5HMXA 4GC7A 3K7RA 4JI1J 3EICA 1NKEA 1MU2B 5DETA 2EFNA 3IBCB 2B6AB 4F2SA 4OZ0A 2MSSA 1F3FA 1GNKA 2EXUA 4IO9Q 5KT2A 4QOTA 1XNQJ 2E5JA 3DLKA 3KWMA 5H1SV 5LMUJ 1VC6A 3NNAA 4OQJA 2ILYA 4L76A 4F4ZA 4DV1J 1TELA 5KFHA 5ADZA 2I5JB 3PO4A 4Z37A 1AFIA 5KG5A 3EVOA 2CQGA 5FIIA 2WOMB 2LA6A 4C11A 2V94A 1LKZA 2R7SA 1FRJA 4TN2A 3QIPB 1X0FA 2NYHA 2AD9A 4JI2F 3TUIC 2M9KA 1TKDA 5GAGI 2LQ8A 3DDKA 4ZVQB 2Z2MA 2YXLA 5KFLA 1YJWS 4FF2A 1HHQA 2KT3A 4NE9C 3DRRB 5DDOC 1FD8A 3S1TA 3V2UC 3TUZC 4KSEB 3G6ES 1F5CA 1YTYA 5EX0A 1VC0A 5ETOA 3D3CJ 4O44B 2YPYA 3FC9A 3FZ2A 4CLKA 2DO0A 3RW7A 1CEZA 3VAGA 1NK8A 4ZPBA 2HNDB 3MMBB 5E3AA 4JV0A 1RAEB 1O6XA 4RW8B 3TOQA 3G6VA 4DR6F 3ISNC 2BANB 2QA4G 5HANA 2UUAF 4KPYA 1R0CB 4FVMA 2CZ9A 1QVFR 2OD4A 4NOHA 1TK5A 4JI3J 4ETZA 2Z2ZA 2MYFA 4K59A 5E41A 2D3OR 4EMDA 3NLCA 5D77A 2HBYB 2AX0A 3HSZA 5CD4H 1S72S 4B9SA 3K5MA 1NHVA 1N5YB 2LP4A 1GX5A 4GRSA 5DJBA 4WF9Q 4OYAA 5LMNJ 2CJQA 1LWCB 4C7QA 2K8GA 2VJVA 3THTA 1R27B 3ENVA 2M4MA 1R8HA 5FD1A 2I6WA 2B56A 2JEJA 2B9EA 4M5NA 2J0SD 3HSJA 3AD9C 5CAAA 5KFWA 1HD1A 1WG4A 2Y8YA 4ZVGA 1QY7A 4R5PA 2W2MP 1PC4A 1XMBA 4PABA 2GHVC 3TVKA 5CXTA 1KQFB 2EFGA 4LT6A 4J9SA 2G1HA 3BGRB 4X66F 3VAFA 1RI7A 2CYYA 2V2ZA 5FDLB 3TP2A 1TKXA 4JI6F 4N8NA 4LVOP 4P52A 2KHCA 3W2VA 4UT4A 1XC9A 1AZSB 2ZNYA 4PQUB 3ILJA 2YKQA 2ZFHA 4USUA 3KK3B 3HZGA 4WE1B 3A1YG 1TU0B 4X64F 2ACMA 4OI4A 5A0YA 3US5A 1FVSA 2OPQB 3B4MA 3C14B 4GKJJ 3TJAA 2LXUA 1N32J 1HNWJ 3L9ZA 1VLYA 4DL4A 1RQ0A 3OFGA 4AQYF 4NCBA 1FWKA 1U09A 2RVJA 1U26A 2MLZA 3R5AA 3W65A 4ECRA 3CMES 3FCVA 1KS2A 3P3DA 1H38A 2DNHA 2HSEB 4J9RA 2D74B 4J7CA 3FVYA 3MURP 1WF1A 2CG4A 2H5JB 3M2VB 2YKMB 4NLXA 3IG1A 4PPDA 4UOGA 3HM9A 3OL9A 4DZDA 2VKRA 4K4UA 2XNRA 1HD0A 2DY9A 2V8PA 2G2YA 3QT5A 3I82A 1VJQA 1KFDA 4DR7F 3K0JA 3HHLB 4URQU 1F2GA 4O44A 4DSLA 1V5VA 4OI2A 1X0PA 3UR3C 1VBYA 2VOPA 1U4BA 5D4PA 2BE2A 4I2QB 3ZZPA 3PIPQ 4U67Q 4KGXB 3CCRS 5J1NA 4EWTA 4AQYJ 2QFJA 4DWIA 4G65A 3HK2A 5KFIA 1RT7B 2XWXA 3CT9A 4A8XA 2FLLA 1Q78A 1S0NA 4ZITA 2DHHA 2ROGA 3QGIA 3SI8A 5HQ8A 4NL5A 2IM0A 2ZE2A 5KT5A 1U47A 3WX4A 1X4EA 3W2WA 3FQLA 3FZBA 2CUYA 3ADAC 2CJ9A 3FSYA 3VTIA 2F8MA 2NXNA 3ENWA 2V2QA 4MFBB 3T19A 3BQ0A 4K4SA 1WF2A 3Q8RB 2P5VA 5U47A 2DPJA 2HRUA 3MUMP 2CQPA 3RR7A 5KFDA 1RB0A 5ITHA 3M9NB 2Y0BB 1DTTA 1X9MA 2HS3A 2ZJQQ 2B8PA 1QSLA 2LXFA 1S6QA 4HT7A 4ZVEA 1VCTA 2HNZB 1OY6A 3LPYA 3V6KA 2RRNA 1N34J 3IS9A 4HI1A 5HLFA 3WZ0A 1S99A 4CT8A 4DV6F 3UPFA 3ULHA 4WWSA 4LRFA 1IBKF 1JJCB 4HDHA 2VICA 5F8JA 4WCEQ 4I2PB 4USVA 5DGAA 2RHQB 4X4UA 2FHJD 4ED5A 4RW9B 1KONA 2OEKA 2DGUA 3D5MA 3GYXB 5LM7E 3KHGA 3GFHA 1JWWA 1N5SA 4CTAB 4LF9J 1IWGA 3ISND 3MTJA 3CJKA 4Q5VA 4P75A 4X62J 4XPEA 2UVUA 2BUNA 2KO1A 4AYBD 5K9FA 2BABA 2WVCA 1PAEX 1S57A 3TZYA 4P2MA 5I42A 1JKHB 2LDIA 2XBPA 5D0RA 1EJ7L 1NDCA 2WBMA 1DAXA 2Y1JA 1S1WB 4Y2IA 5C2CA 3MEDB 3HCXA 2UUCF 4DR7J 3DI6B 2W7PA 1UVJA 2PSZA 3IA0A 4M5DA 4WXOA 3RB6A 1JLFB 1UA0A 3GJTB 2R8IA 1V3ZA 3AQOA 1YJUA 2J7WA 3T6JA 3PRBA 3BGUA 3C46A 1SQGA 5HQMA 3KLEB 5D78A 1RTDB 4Q8EA 3U7JA 2FIUA 1URNA 1U2CA 1REGX 3M2UB 1IM6A 2AZ1A 3M8PB 3OVBA 1LEOA 4IO1A 5CZXA 1X5OA 3N6LA 4TLRA 3QYYA 4YDDB 2R2SA 2RE1A 3DOKB 5H9EK 4OMFG 1NK6A 1MWZA 3NP5A 1HWLA 4QIEA 5KOXA 4ZJLA 1VHFA 3R7SB 1XIQA 1G7CB 2AJ4A 3DGPA 3CCVS 3V6DA 5J1PA 1F3VA 3IM8A 4CLTA 2R2TA 2RIJA 1RU2A 2W9CB 4WK1A 1YWXA 1K0TA 1S1XB 4QIGA 5H9FK 1R8CA 3O44A 5J2MA 1HMVB 4NZ7A 4KFBB 2ZC3A 6AT1B 5GAHU 1JJ4A 3QZ8A 2VG6A 2YVSA 2VFTA 4YB1P 1OPZA 1RE1B 1HWIA 3LP1B 1NXIA 1UFKA 1VS3A 1L5UA 5T7LB 5CCMA 1QVGR 1FJ7A 4DV4J 1FEHA 2EBEA 2UVWA 2LU1A 1RKIA 2DY1A 2XYHB 1UVKA 1HWUA 4OI1A 1PGZA 1HBNB 4PWWA 4DV4F 5A8RB 2FVQA 3IWNC 2MPUA 4NASA 4B02A 1CLFA 4O3OA 2ZDOA 1S9EA 4PQAA 4NMLA 2J9EA 5B0CA 1KVKA 2Q1LA 3DC2A 3R2CJ 4J9MA 2FB0A 3AOCA 3EVMA 3MM9A 4ZS6A 2A18A 5GADI 2G0CA 1I94F 2YWFA 5ETKA 3M9MB 2HQ3A 2HURA 1XERA 3V81A 1C0UB 5IFMA 3KLFB 1NSKL 4LR9A 3DRRA 2ZH6A 4DLEA 2HW3A 1RWPB 1WKLA 2LCWA 3M8SA 1X9SA 2ASJA 3R6GB 1KR4A 3OW2R 2DYAA 2HQFA 3LP0A 2QJ3A 3QBCA 4W98A 1RWNB 1HI1A 2JH3A 4UTGA 4TU9A 2HFVA 2FTRA 2KT5A 4CYUA 3QRPA 2RHSB 3CULA 1RAJA 3WIUA 3QMQA 1C2PA 4KGVB 1D9FA 3OHBA 1F5BA 1RWUA 3TI0A 5JVGQ 1FX2A 2BEFA 4HT5A 2IM3A 1XMQF 1FF2A 2DNKA 2LFVA 1SKUB 3SBMA 1TQLA 1V3SA 1XNQF 2RILA 3DHWC 3DXBA 4ZVHA 5IS2A 4AL6A 2ZC4A 3FFIB 3RAXA 4CO1A 3BGLA 1HYSB 1OY9A 1PYTA 3PJ9A 2N4DA 2Q66A 2XLKA 3Q8UA 4ID5B 4N77A 1S1UA 3CJ5A 3HFVA 3G71S 4CQ1A 4ZKAA 1QTNB 4ITSA 1SCJB 1RT6A 3CO0P 3NGUA 5ETNA 1JB0C 2QA4S 1ITPA 1VQ8S 4P2SA 2GVDA 1RAIB 4DCJB 2EPIA 2HWTA 3C6UB 3MPVA 4N56A 3I9V9 1N33F 1FI4A 3GFZA 4ELTA 1VQ6S 2IYGA 1DBDA 4LSNA 2CJYB 2HKEA 2RF2A 1JLCB 2QC3A 4DV3J 4JI5F 3BB5A 1BQMB 2H48B 3LP0B 3H90A 3OV7A 5J1EA 1TKXB 3RZAA 4CWBA 4GC6A 4C8OA 2NUUG 1F1BB 4P2XA 4EFAC 2OELA 5DDPC 2JX2A 3O2IA 1P1TA 4BWMA 1TK8A 2EKYA 3LAKA 3KLGB 2AJFE 2Q6CA 3CDAA 1RWKB 3HHDA 1FJEB 2MHEA 3ILLA 1H6KX 2FVSA 4KH1B 2ZBPA 2ZEJA 5HQLA 2QEXS 4NCAA 2BKOA 1VIXA 3BSNA 2XB2D 3K57A 4IRKA 1UZHA 5F3TA 4K5RA 1S6PB 2PE8A 5KFBA 1AZSA 3EMTA 1UJ4A 3M6VA 4FF4A 2V69A 3DMJB 1M5HA 3EGWB 3R7BB 4HHUA 2WRMA 3LWLA 3ELHA 4OHVA 1JLBB 4WFAQ 4K5SA 4J9KA 2Z2LA 2BQUA 2MY8A 2W2NP 2HK2A 1IXKA 1RAFB 3MECA 4ZPDA 1FDDA 4I6YA 4CT9A 4ALZA 2FPHX 3MEGA 1IKXB 4ZVRB 3CIZA 1S59A 4ZLNA 2RRAA 4LUBA 1K44A 2J7KA 2YQ0A 4F4XA 2PA3A 3C15B 4XPCA 1OYDA 5KFYA 5H9EJ 1NSPA 1SH2A 2XCAA 3JYTA 2AIRB 2DEJA 4NLQA 5CYQA 2FQQB 1NMEB 4FXVA 4WU2A 5DG8A 5FLXY 1A9NB 4PUOB 4FXDA 3PFOA 3OHAA 1DZ5A 4F8RA 2ZD1B 3IO1A 3QO9A 4C0OC 4I1TA 4LF5F 2HHUA 2P6SA 2RS8A 1J5OA 4NLYA 1RSCA 3NRBA 2WAQD 3BDPA 1VQ4S 2K2PA 4LQ3A 4RBVA 4FP9A 4MMOA 5J2PB 2C28A 2AF6A 4Y2KA 2BM0A 4YEAA 3MOJB 1KLMA 2FDNA 1MW7A 2OPPB 1Z2LA 2DCUB 3IM9A 1RT3A 3NCPA 2XMVA 2RD5C 1RT6B 3CEDA 3F41A 3NEKA 1JLAA 1S1UB 3M7VA 4BLGA 4F0MA 1RCOB 2XO6A 5THWA 2IIHA 3SYZA 2Y1RI 2Z30B 4LF6F 4ZMMA 1XTZA 4IH6A 1QAXA 1QE1A 1OJ4A 1S1TA 1IJFB 1P6TA 1WOSA 2B4UA 3DOMB 5ETPA 3V81B 1RTIA 4Z2XA 1C0TA 2H9ZA 2J9CA 2U2FA 3GTYX 4IFVA 5CYMA 3SQOP 3MM5A 4ED8A 4Y3CA 4JI8J 1CSJA 2NSBA 3ZZYA 2VQEF 1KN6A 1U2RA 2J6SA 2WCXA 2ZHBA 1R8AA 4KHPF 4Q0BA 4OJ3A 1QSSA 3EZ5A 3CTRA 2FVCA 4LRDA 1YRTA 2HWHA 3D3BJ 4X65J 3FNNA 1JNZB 2YY3A 2KB2A 3FQKA 4HACB 2UVVA 3PW2A 2XS2A 2APOA 1PO6A 2NXJA 2HHPA 5KT6A 3EGVA 5CHCB 2N3OA 3MFIA 4DL7A 2YWKA 4JV1A 1JJHA 3W9JA 3M8QA 4O0IA 1Q7LB 2NUHA 2ZITA 3KK1A 3OVAA 1R0AB 1KTQA 3TNVA 2OSRA 4EBEA 2BACA 2P8IA 1FEEA 3E3XA 3KNGA 1YZ7A 3L7UA 3PV8A 4IKAA 2AQ4A 4ZCKA 1F9FA 4YY3J 4TVAB 2DGSA 4L74A 3TZWA 5HBMB 4DFPA 1DHMA 2AV5A 1SJFA 1TR0A 3MWBA 2JLFA 2DPIA 3VQSA 4U8VA 3U27A 1WSRA 2VASA 4CI0B 3PXGa 3QRQA 4RBUA 4WIQA 1UVLA 1TAUA 4FBTA 2UV8G 3T1HJ 2IDLA 2BQRA 1S0VA 2J0QD 3LALA 4DU7A 1Q7YT 1YJ7A 2R8GA 1HNIB 5ETQA 3W66A 2MHNA 2QFIA 2CJBA 2OPRA 5B08A 3CF5Q 1RJJA 1KVJA 3F0NA 2UXBJ 5IT4A 1MG7A 2BRLA 3NGKA 4H4MB 2E5LF 3P6YC 4W90B 2WVEA 3CWJA 4AFFA 1UP1A 1XN9A 2FHMA 5GADU 3KTQA 3JQKA 4JB8B 4F02A 1KWMA 1T9YA 3V6DB 1SKRA 3MMAB 1M5PC 2VODA 1VYAA 1OO0B 2BZ2A 3VV2B 4EO6A 4OYWA 2YKNA 4NI2A 2DRDA 2PI5A 2BV3A 2QA1A 2OPQA 3IBWA 2ZVIA 1YGYA 2DH9A 4MIBA 2C3OA 4PG6A 3WHIA 1GK8A 4JI6J 2KFNA 5BXIA 2GHPA 3CJ8A 3Q8PB 1RT5A 2LQBA 3QNWB 3UN2A 1EP4A 3BREA 1RUSA 1EAYC 1U48A 3OSPA 1ZH5A 2DHXA 4IFYB 1HHSA 2V4JB 3DYAB 3HXMA 1HQUB 3AY0A 4M5KA 4Y28C 4KIAA 2EG2A 3BDEA 3FSIA 3CGIA 4NLUA 4JV2A 4RJVA 4AL5A 2R3VA 4USJC 4KTQA 1D8YA 5F8NA 2WONB 4CLFA 2POKA 2QLWA 3OTCA 4I2PA 4DSKA 4M95A 1ZM9A 1CPZA 2DHSA 3D0GE 3KUEA 1S48A 4DV7F 1KOOA 1NRKA 1Z2ZA 5AXLA 4BC7A 4J9PA 4DF8A 1FJCA 3DLGB 3G9CA 1F9EB 1R89A 4PAAA 3DRPA 5KTQA 3POTA 2MLXA 4I0WA 4DR4J 1U0HB 2V5HG 4DQQA 3NGDA 3K5PA 1P8GA 3K58A 3M8QB 3T5JA 2QSFA 4ZVPB 4ZPAA 2XS5A 2M70A 2WVBA 2ZBRA 4X4SA 2OIHA 2FLOA 2C22A 5EUHA 2DGTA 2C2NA 5FLXU 3TA2A 4DL2A 3HP6A 3BPSP 4OJGA 5HBMA 2HNDA 2PFDA 4DPOA 4DPTA 5BYSA 5DG9A 1WTBA 2Y1LB 2D1CA 2B8QA 1EQMA 4PXEA 2BKPA 5J2NB 4QYRA 4I4BA 4CNZA 2UZAA 3RGIA 2A3JA 1SIZA 1KDNA 2RT3A 2MXYA 2DGOA 4BDPA 4M1KA 4H4OB 2KRBA 5J1EB 4RW4A 4CH1A 2E5HA 3GWCA 5KFAA 5HMWA 3OL8A 4LFBF 3TQEA 2W2QP 2GMHA 4BHQA 4DHVA 1TL7A 3TAMA 2NR0A 4JP8A 1OWXA 1TZ0A 1YK9A 3WC0A 2QZ8A 1C1BA 3TZZA 2W9BA 4JI2J 1S76D 1W2IA 1JK9B 2HZCA 1P9QC 1EETB 3J7YI 2AJ1A 2Y8WA 3LUYA 5D4LA 1VMBA 3JAMY 1T02A 3DOLA 5EGYA 2I5JA 4Y0FA 3KMQA 2ASLA 2IBOA 3D1OA 3NAIA 4O0NA 3K8VA 2WVFA 5F0UA 4TU7A 4ECZA 4MK8A 4A48A 3PDNA 3TAQA 3A12A 1N6QB 3SQGA 1UWAA 2N3LA 1PYOB 3D66A 4I68A 4CLSA 1FXRA 3CD5A 3DLBA 2QLBB 4HHHA 4DUYF 4M5JA 1VOMA 2G1DA 2EI5A 1FERA 2Z58B 2VPWB 4H4KC 4FYVB 4HTIA 2HVZA 5EX3A 4LF9F 2ZH3A 2CPHA 3QT8A 4DI6A 1X8DA 5J2PA 4NXMJ 1T03A 4ELUA 1FDBA 1K73T 3A8JA 1HBNA 1UEUA 1FRMA 1V3RA 4OHXA 4L3KA 2HVDA 1UL3A 1FESA 1UPPA 4X65F 2YH0A 3K59A 1IBMJ 5KG3A 4UQTA 2VDIA 4CO3A 2ZD1A 4UUWA 4ICLB 2XM3A 2NXUA 1FFGB 2VL1A 3POTB 3TRGA 3PHEA 4DCPB 4X4QA 2MZQA 3Q8QB 4RO0A 3W64A 2HK3A 5IWAJ 1AA1B 1LW2A 1CJVB 4I64A 1UEKA 2VOOA 2UXCJ 2V50A 1SL2A 2EEYA 4KHMA 3BBBA 2KKHA 4LF8F 3SSQA 1IKWA 5KFKA 2JWNA 4J5OA 2O67A 4HH0A 4DLGA 2DHAA 3DGVA 1L3TA 1T11A 4OZ3A 1SKWA 3N5BA 3OFEA 4MTPA 1L3VA 2RUSA 4B9VA 4WKRA 2LDYA 3D9BA 3MECB 3W2VB 2MQMA 3S6EA 3IGNA 2G0JA 2I9SA 1UVNA 3Q24A 1G4CA 3CJRA 1X31C 3LP1A 2DNZA 1U25A 4JBCA 1G1XA 1S4FA 2P9CA 3PX6A 2KTQA 1M1HA 2UU9F 3EM1A 3ZTRA 1X4GA 2QL7B 2PA8D 2ASDA 2XSFA 2V6AA 5KFSA 3KLHA 3CMQA 2ZH4A 4DV0J 3R7NB 1HI0P 2BA9A 3TO8A 2IY5B 1VRTA 1P27B 2ZVSA 1FXDA 1LWCA 3CVKA 3W62A 5B0BA 2MB0B 2AMCB 3PRVA 1WD6A 2LYVA 2NYIA 4OX7A 3P8BB 5GAGU 3HHKA 5M2UA 1N34F 1N6QA 5DZ6A 2R42A 4F4WA 2FJEB 3LQVA 3CD0A 5F9NA 3S01A 1NK7A 2VV5A 1TKTA 1U8WA 1JLCA 4RX6A 4LF4J 1QUPA 4Y6IA 1KHWA 1WORA 4ES3A 5GAEU 2HRYA 3WIVA 2KI2A 2PI4A 3ILIA 2B9YA 1NK4A 4K4VA 1IQZA 4PWDA 4IDKB 4RUBA 1NH7A 2HZVA 1TL7B 1NAQA 2N4CA 2HNYB 4FZVA 3BYPA 4U7CA 2ABYA 2MDAA 2W4PA 3M6XA 4M5DB 2L08A 1HNZF 2B0GA 4RW7A 5L1JA 5C24A 4F4YA 4C9DA 3M1VA 1CJTB 3DLKB 3U02A 5KG4A 5I3UB 3DCAA 1HNZJ 5A8WB 2CPEA 3THPA 2E1MC 1RHRB 4DL0C 2MQNA 2LECA 5SUHA 4U9RA 4WKYA 4DPWA 3MFHA 4HLBA 1JMTA 3SCIE 3WDOA 3DLJA 8AT1B 4DSFA 2QTWA 3I0SB 3JB9k 2MGZA 2M2BA 1C1BB 2DNRA 4ECWA 4CYUB 1Q8KA 2GO9A 2XQCA 2AZ3A 4HR2A 5DDQC 1KHVA 4RW9A 3EE3A 5IV3A 2EVZA 1R6YA 3O3LA 4HKQA 3C2PA 2DK2A 3AJ2A 4U95A 4DR4F 4FYDA 1OS5A 3EUNA 2EW9A 3IFEA 3ISZA 1T9TA 2VHGA 3W3SA 5A6WA 4ETXA 3AFGA 1O8BA 4YR2A 4PXCA 3DLLQ 1UZDA 4I56A 1S9GB 2O5DA 2MSTA 4JI0J 3QLHA 1WI6A 1MWYA 2E5IA 3CDBA 3ZZ0A 4DUZJ 1RT2A 4N41A 1GTEA 1NM2A 4Q45A 1MWQA 1WG5A 4OI0A 4FYXB 3NWGA 2KM8C 4NEZA 8ATCB 4ZPVR 2BE7D 1DQ9A 1YJVA 3NBPB 4PR6A 1RHJB 2UUAJ 2RH3A 1IKVA 2XULA 2GAGC 3AD8C 3F44A 3N6MA 1RWMB 3JSYA 4KAIA 3AOBA 3IR6B 3VGUA 4YDXA 2SXLA 5JJBA 5D8HB 1CULB 2YKAA 3Q8VA 3LP2B 1U24A 5K8NA 1U1NA 3K8WA 4WTOB 1HHTP 3KNAA 2C2OB 1FWLA 3D1HA 2V4RA 1C1CB 3CJSA 4B3SF 1S1XA 3EJMA 1R8BA 3RBDA 3VWSA 1RWVB 4DQIA 2IYIA 5KFMA 1RAHB 3G87A 1WKKA 1WDDA 3RAQA 2ADCA 2BDPA 4ES1A 3PIOQ 2NZCA 3N6NA 3I4PA 2EFVA 4P7VA 2DRBA 5A2QY 4ANEA 2FJXA 2OHDA 2ZJPQ 3H8YA 2MQPA 3BBCA 1H72C 2ZHOA 3VR1A 1FK9A 5LSLA 3ZTSA 3BH6B 4ED2A 1M5KC 2CQIA 2B3TB 2W4DA 4H4MA 1KNZA 4Z7YA 1GAOA 4OZJA 1Q8LA 1T7PA 2KVQE 4A8YA 3QWPA 1X5SA 2OLWA 3TX8A 4NCGA 2HFNA 2GMJA 1QAJA 5LOQA 4Q2MA 2BJ7A 3OUYA 3O5TB 2XMWA 3D0HE 4PKDB 4CTAA 2DISA 1TAQA 2D9OA 5A6PA 2OH2A 2IJRA 2OD6A 2W8KA 4MAKA 3MMAA 2YWWA 3V5RA 4C4WA 3R5DA 2A1BA 4K8RA 3T9ZA 2V8DA 3OL7A 1BD6A 3MPWA 4F7VA 1TFYA 1RHKB 2B5JA 2PEHA 3Q86A 1V9OA 5EWGA 4ZOSA 3CXCR 3D1QA 1TUGB 3NXZA 2FLNA 4KY3A 1PG5B 2HGLA 2LXIA 5D0EA 2RQKA 3OTOF 1SJ1A 1HNIA 2L9NA 2HNZA 4R25A 2QYGA 4PYDA 5K20B 2XMMA 4ZVSB 5BR8J 3PW7A 3VQTA 3W9IA 3RRKA 5HMZA 4J91A 2HAIA 3IN5A 3ENAA 4O3NA 3C6TB 4PPZA 5KFRA 1CVJA 4K4YA 1XMOJ 3TVYA 2NCKL 2PFFB 4D3GA 4DF4A 2MZJA 4QR0A 4R0JA 4RUCA 2R7RA 1KKHA 1FE0A 2E1RA 4UOFA 3C6UA 4OX9F 4U7UD 1CJVA 1P1LA 2EFPA 1RTZA 3DU6A 4LBIA 3PKMA 2E1PA 1WHYA 3R8YA 3KYLA 3CSKA 3KK2B 2DT9A 2VFRA 2XWYA 3N28A 2CZVC 4M5HA 3KK1B 3UN3A 4NWBA 2GZOA 1ULRA 2PIIA 4TY9A 1VJWA 3CJ0A 2IVFB 5K8OA 3R1LA 2C2EA 2MEWA 5DM7Q 1HNXJ 1TMJA 5HVHA 3HJFA 3GE9A 1ZM4A 1N5TA 1WUUA 3DOLB 3ZTOA 1J5EF 3F56A 1NDPA 4B3SJ 2K7KA 3EDQB 1RBLA 4V19X 3NNHA 4ES2A 3OXGA 2N7CA 4JV5J 3NOGA 2CPDA 4K7QA 2R7UA 4X66J 5EN1A 2BJ3A 1F6TA 3R6LB 1SXLA 1N5VA 1BXNA 3UD3P 4DCOB 2AP6A 1NKBA 5HAOA 5KG2A 4ID5A 3A8KA 3AD7C 1N0UA 5AXKA 3W8GA 4CM0A 2BMBA 1HQEB 2GFFA 3IAS9 1IR0A 1NPRA 2E7VA 2DNOA 1MU2A 3G86A 1RBAA 5AT1B 1O5JA 1PKUA 2EG1A 3MHYA 4OHZA 1MNEA 3K89A 4KE5A 6FDRA 5L38A 1PJ7A 5B0EA 3BYRA 3PTWA 1KLMB 3AA9A 2R2RA 5JMNA 2ZWPA 4IYQA 4WBFA 4B3OB 1S0OA 4B3RJ 3P49B 3TYTA 1Q95G 3O6QA 1T3NA 2NXCA 2I38A 3DM2B 1B70B 1IBCB 4KQZA 3M2VA 4N5SA 4K4XA 2QGFB 4RNFA 2ZOMA 3CIMA 3DRSA 3KDOA 1FT8A 2Y0SD 3AXMA 4IRCA 4KC5A 3MZIA 4A8KA 1U0SA 3BN7A 4LIWA 1RA6A 4PUOA 3KG0A 4ILLA 2PDAA 4USKA 3DHXA 2ILZA 2QMUB 2HVEA 3EXYA 2A6OA 4ZVUB 2FGCA 5KOWA 3W61A 2LMIA 1CQNA 1KQKA 3UR0A 4J9OA 3MDFA 3KJQB 1SV5A 4CDIA 4C8ZA 3CJ3A 3MMJA 1S9EB 2RQCA 1O51A 3G2XA 5E3CA 2C3UA 3HX9A 2AGOA 3K5LA 4ZN3A 2X3DA 2CQ4A 2LA4A 3ETOA 3C6TA 1JLQB 7AT1B 2AU0A 2NZ4A 3DLEB 2IDEA 1K8AT 2V9WA 4LFCJ 4NMXA 2LEAA 3TA1A 3E51A 3PX4A 3RJMB 3DOKA 3OUYB 4CO2A 1RISA 4H4KA 3TA0A 1VQNS 1NHKL 1FRHA 2D3ZA 2VPXB 5L46A 4EBCA 2HGNA 3M30A 2HHHJ 3H5YA 4LSNB 2GIRA 4R5PB 4NYOA 3L4BC 4F3MA 3D2WA 2F1FA 3I87A 3G96A 2FD2A 2RNEA 1IKWB 4WIIA 4P73A 3K5OA 4WXWA 1TUVA 5KT3A 3SFUA 1S1VA 5A76A 4F25A 3MCOA 1AB8A 4DUYJ 1LXNA 4R0EA 2B4OA 3J80U 2YNHB 1NH8A 4L72B 2HG4A 1FA0A 4C48A 3D6TB 3KLGA 1CJKB 3BEGB 1PYSB 2E9TA 2K1RB 4G1QB 2H51B 2ZUGA 4L73A 2HVIA 2QE5A 3VGSA 4B9LA 1NJXA 4WZQA 3KJVB 4EYIB 3DN9A 2VKZG 1I3OB 1KQSR 1JXLA 2UUWA 1UWBA 2FZKB 2R8KA 1HNVA 1XNRF 4NCGB 4FF3A 2HHTA 1GMWD 3IC1A 1YSJA 1WTFA 2ACYA 3LPEA 3QPIA 1T9WA 2FC8A 5F41A 2CDRB 1RT4A 1RTJA 4C11B 3UDLA 3D54A 5IOLA 2GVDB 1S0MA 4A8FA 2C2ZB 4DZ6A 1FKOB 4IOCQ 3AODA 4BS2A 4YB6A 1VBZA 2G0IA 2VONA 3I5AA 3RW6A 3ETMA 4B9NA 1V6HA 5T41A 3UQSA 2HLUA 3CO9A 4L3NA 1C0UA 2IMWP 2JEGA 3C16B 2WSEC 2O01C 4EZ6A 2W4CA 4RR5A 3M8WA 1UCNA 3L3CA 4V19J 4TLQA 2QLFB 3MOZA 4RNHA 1Q53A 4E8UA 2PEBA 3NMAA 4A8SA 4IG3B 3ONQA 3B8HA 2PT0A 2D3UA 4FPRA 1YLXA 4ZPWR 5MLCV 1DTTB 2QLXA 2V2KA 3HDSA 4FDFA 2JNJA 2E5GA 2IPOB 1PSDA 4OHWA 3TANA 2WSFC 1NJZA 1M5SA 1WHVA 2IJFA 2YPZA 1EARA 2QX0A 3Q2TC 3V4MA 3J7ZT 4MFBA 1T9XA 3RB3A 4BBYA 3BO2A 2DXEA 2J0XA 2EKNA 3KK2A 4DV6J 1QD1A 1YVFA 3GSIA 2RKIA 3TQ1A 2KT2A 3CC4S 2HIQA 1ELOA 2QG9B 3CJ2A 4QPTA 5EDWA 3EZOA 2VIHA 1RTHB 2DNQA 1IWAA 1PIEA 2YWGA 3GJSB 1W7WA 1BUXA 1S6QB 3M6UA 1LK7A 3AJ1A 1R0AA 1SL0A 2ZKUA 3NCRA 1SVDA 3GIJA 3TARA 2ZWOA 2ZM6J 5F8HA 2D41A 3K5NA 2DNGA 2WB4A 2CPJA 3ET6B 1SJ4P 2AHOB 5AXNA 3SXLA 1K1QA 5GAEI 1I6JA 4O4GA 4RWWA 2Z56B 4GKKF 1UW9A 4LF1A 1PJ5A 3M32A 3I4HX 4ID8A 4NA2A 2CJKA 3JSMA 4NA1A 1RAOA 1S6OA 1VK3A 2IHR1 5DDRC 4P7TA 2KH9A 3NL0A 4KHPJ 3J7A1 3D67A 4QWDA 2H54B 3TZXA 2ZH8A 3PJWA 4Q2LA 5C42A 2FY8A 3N01A 2MKKA 1UWBB 5AE2A 1F9HA 3I0RB 3PEHA 4N8OA 3ZC4A 2OTJS 2YKNB 1LFPA 4NI2B 2YQ1A 2YX7A 4QR1A 4ECXA 1KVIA 1XR5A 3JXOA 4MKVA 2J9DA 3GIIA 3OFHA 4I6AA 2CQDA 1B0VA 2BBEA 3R27A 4GMKA 5K14B 3VHQA 1VRTB 1RT3B 4IOBA 1NBEB 2VH7A 2KZZA 3V6JA 4DX7A 3NS6A 3PG9A 4DDFA 4YMEA 2YH1A 1NCLA 2F9JA 1K1SA 3FBBA 2GIFA 1UAWA 2YBVA 2CVEA 2UV8A 4NZ0A 1ROFA 5GMKa 4RZRA 3RBEA 2FVRA 2EC0A 4QYZK 2IA0A 3MEGB 1YHQS 3PM9A 2L9DA 4WFXA 4NRTA 1SI9A 4BC9A 5J2QB 2YNGB 4EK2A 3Q89A 4CLYA 3VZHA 5HN0A 2DGXA 4PG5A 4AD6A 1TV6A 1T9VA 2F65A 5I3QA 7FD1A 2WB1D 1RU1A 4DUZF 4N47A 1WHWA 2WW8A 4MIWA 1FTCA 4OZLA 1RABB 1X4HA 2KXFA 4CLWA 4ZIWA 1REVB 4J9LA 2VBZA 1YQHA 5A8KA 1JXVA 2CNOB 1H7WA 2AWZA 5EWEA 2AYMA 3AQPA 4DEZA 4AT1B 4UOHA 2LEBA 1IUJA 2MY7A 3HFZB 3N0VA 1GMWA 4NEYA 2VQFJ 1IKXA 5LXYA 3ZTPA 1MROA 2PN6A 4KJIA 4WK3A 1CS4A 2HFUA 1AT1B 2E29A 4M63A 2NPFA 5KFTA 1B64A 2C3MA 4ICLA 5HSPA 2CNLB 2IRXA 2JJ4D 4EU0A 2CQ0A 2HBZB 3DRSB 2ROPA 2CKWA 3FGVA 4MJKA 3HKZD 2C2MB 5MAOA 2BXJA 3CMAS 3OD2A 1H0HB 2CQ1A 1H2UX 2Z57B 3HVTB 1OSDA 3I55S 3GILA 4UW2A 4B3MF 2I1RA 4HVZA 3U1NA 3R1HA 3C19A 3UDCA 1HA1A 2UXDF 4TQSA 2Y3YA 1HARA 2HIYA 3MCSA 3LH2S 3OBIA 1BMQB 1OIAA 2CPZA 3DRYA 5CYMB 4F26A 2FLPA 3MCNA 1WC4A 3R3TA 5B0DA 3H5XA 1PC5A 1VQKS 4AXJA 4DUTA 3FMWA 4JI3F 2AGPA 1DY3A 2CJXB 4A8QA 4LR8A 3T1HF 1JLAB 2V8HA 2VJUA 1U1KA 1XMOF 5B09A 3VAJA 4AL7A 1WF0A 3TVZA 1IQTA 1TP7A 4HDGA 3UWTA 1F2HA 4X4TA 1DLOB 4Q44A 2KL8A 2M7SA 4LF2A 3W2WB 4IQXA 3GG1A 3CCUS 1B99A 5KFJA 4LFCF 4NXMF 3M8YA 1R3NA 1WC6A 4NXNJ 3W5XA 3MM5B 4ED7A 1H2TZ 2COLA 3ZZUA 2XS7A 2MKJA 2XY5A 2VFUA 4OX8A 2CQBA 1H2VZ 2XNQA 4C0BA 2OTLS 2HQDA 3R9LA 3L95X 1HBOB 4NA3A 4WFBQ 4XIUA 2RDJA 2Z2YB 4FNHA 3GMGA 1JLEB 4G1QA 4J37A 2EFQA 3F73A 4C6AA 1FKOA 5G0RA 2GC8A 1BLUA 4KGKA 4DV5J 1HKAA 2E44A 4I7FB 1PAUB 2B43A 3G4SS 2XZDB 2VD3A 4I69A 5RUBA 4LF7J 5CCLA 3E2EA 2E9ZA 3VVTA 2ZKTA 2XI3A 2XMKA 1QSYA 1WG1A 2V67A 1ZM2A 2JLGA 1LWFA 2XLIA 2V9KA 4ILMA 5F3ZA 4IRDA 4YP3A 4B3RF 4RLEA 2L41A 1JLBA 5KG1A 4WPAA 2B9XA 3J7Z5 1Y3KA 2ZHAA 3SV3A 2VC0A 4JI1F 2UXCF 2J8SA 4QQBA 4CH7A 1WELA 3PZPA 3PRDA 2PMWA 1XQIA 4ANDA 2IAJB 2NS1B 2CQCA 3OR2A 4KO0B 4RW6B 2X7IA 3NOCA 1KQGB 1VK8A 2CNNB 3A13A 1LFWA 5KFOA 2VQEJ 2Y9HA 2QL9B 4QJVA 1S49A 1N36F 4C2MA 1YX2A 4OI6A 3KUHA 2RUGA 1Y00A 4DQSA 3LA0A 2JLEA 4ZCMA 1RLDA 2OMOA 3SEOA 1ACMB 3VCDA 1KBRA 4YN3B 4X4PA 2FJVA 2J9DE 2PC6A 3CJTA 4ZP9A 1H7XA 1FD2A 1TV6B 4DMZA 4JUZA 2V4JA 3OXLA 3BGRA 2KXNB 1HWKA 5IQ6A 3FMBA 3H7HB 5E3PA 3PFEA 5IC4B 3IRWP 4D3HA 2CPYA 3B82A 3UVJA 1GX6A 5K8PA 1NK5A 2Z4PA 1RXOB 3S8SA 3PY8A 1Q1KA 2A6MA 1SV5B 1UKUA 2YNFB 3JTNA 3KJFB 1DTQB 4L6V3 4LJMA 2HVHA 1HBMA 1IN0A 1R7IA 4DU8A 4DPUA 3NG8A 4PG8A 1W26A 4A46A 4RNNA 4WJBA 2ZBQA 3QZ7A 3GONA 1S6UA 4GO5X 3UW1A 1TTHB 4FYYB 2X1FA 2F8EX 2GS8A 4ZPCA 4CIOA 1HYSA 4ECVA 4DG1B 3BR9A 4ANCA 2GMLA 3V4IA 2D7SA 3PACA 3BO3A 3B54A 3DM2A 3PW4A 1JKHA 4XAKA 2IVYA 1U7LA 2BW2A 3NGTA 1VQ5S 2UUBJ 2I8EA 1G6BA 2ZBCA 5IT9Y 1UJ5A 4K4ZA 1BQNA 5BR8F 4NLDA 3M32B 2PD1A 4NLGA 5DO2A 1LWEA 4OYMA 1YZ6A 3MD1A 1Y5NB 4RNOA 2ZH7A 5G0RB 1YKWA 3DKDA 3NBPA 3J81U 1K47A 3GV7B 4RW4B 1GT8A 1N88A 3MM6A 4YR3A 2MTLA 3KDNA 2RU3A 2M8DB 3BKTA 4OZ5A 4Q7AA 3NS7B 4EO8A 3H0PA 1EX8A 1I94J 1AUDA 1IR2A 4DS5A 4XK8C 3PR5B 3N4WA 4OV6A 3H20A 1DLOA 3A4TA 2WOMA 2FVPA 3KHRA 4J90A 4QIWD 4TNOA 4DR5J 1FNMA 5B7WA 3UCUP 1U1MA 2EFOA 3HD1A 5GMDA 3J7YU 3EVWA 5L8RC 3A8IA 1EHWA 3IWXA 3PX0A 2MQLA 4J9QA 4ZLJA 3TAPA 4DPXA 3CD7A 2YNIB 4Q8FA 2DITA 1G2EA 2P2CB 1NJWA 4IG3A 3THVA 5E2QA 3HHLC 4ILRA 2HMIB 1VIOA 2WHOA 1D3WA 3SDEA 2KJWA 2CWKA 3IS9B 3RRHA 4X64J 2XYGB 1RTIB 3JQJA 5C25A 2AYBA 2DR5A 3HVTA 4YFUA 4C8NA 1RT7A 3D28A 3M05A 3DFEA 4LQ9A 3MM6B 3P96A 5KAKA 2KFZA 3BH7B 1N32F 3M1VB 4HI2A 2ZOFA 4C3MA 4ECQA 1BWEA 2GJ2A 2JDJA 1IJEB 4R8UA 3Q23A 4DR1J 1RAGB 1X4CA 3I31A 2MKSA 4C3KA 2N82B 4NYZA 5F8MA 3H4BA 3T1YJ 2LEPA 3T41A 4MK9A 3PW0A 3FEZA 3TEHB 1U0HA 5CD4A 2MGZB 3KG4A 2R9LA 1Q16B 1N54B 3QFHA 3EGZA 4FVCA 2BX6A 2VG6B 2CRLA 2R7QA 4OFZA 2DCLA 3KUGA 4UZBA 1RT5B 3M9OB 2MQQA 1C0TB 2KJVA 3QWUA 2F3JA 2L9WA 3H2VE 3AB4B 4LVNP 5G4DA 3KHHA 3D0IE 1WOOA 2F4FA 1U45A 1BQXA 3NNCA 5LMNF 2E5LJ 2F9DA 3NY0A 1SB6A 1GQEA 2V8VA 2PMZD 3H4DA 3CUNA 4M5GA 5IWAF 3GQCA 1XBWA 4YB5A 5KG0A 1ZYQA 1RWWB 1JX4A 3CCWA 2ZZMA 3FJ2A 4OYBA 2CA9A 2E66A 4M5IA 2EK1A 2V34A 4QWBA 2FJBB 1VDHA 3LF0A 2IRUA 1RT4B 1RTJB 2OUGA 5M2RA 1U02A 2CIMA 4N7TA 2AEJA 3P5TL 3KK3A 1T0TV 1AYEA 1TFWA 1JJ2R 4IUFA 3SMZA 1KTVA 3D6MB 4DN9A 2H1YA 1TVRA 1GMVA 3OR1A 3FUYA 1H98A 3BQ1A 1SJ3P 2RB7A 2VU5A 1MMNA 4YY3F 3Q8SB 1B7YB 1JLQA 2P9GA 5KG7A 4HL9A 1VBXA 2AT1B 1HR0J 1NB7A 3BBFA 3PVXA 4FKXA 1MMDA 3TEGA 3KLVA 1S4EA 4LRBA 4TYAA 1S1WA 4V1Ak 5DG7A 4YS2A 4DX8H 2ZBIA 3SCKE 2B51A 1J27A 2LQJA 5IZHA 5E33A 2HHQA 1NSQA 4KGZB 4X4OA 3GYNA 3OLAA 2DR9A 4QWEA 1YDLA 2J76E 3IBFB 3GCWP 1AW0A 4ZA1A 4X4NA 1WI8A 4C8LA 3SCLE 4BCAA 4CH0S 2ZDPA 3JAMU 2VBXA 3ZTQA 1YJTA 4AUKA 4KRWA 2IMOA 3P5BP 4ZN1A 1VQMS 3AA8A 3VAHA 3NWRA 3OSNA 4LF4F 3QGPA 4DR1F 3VF0B 4HACA 2BJ8A 3KFWX 1QAIA 2KXHA 4DL6A 1FRKA 3KMSA 2QL5B 2QLJB 4KH0B 4F3QA 5C25B 1RTHA 3D7SB 4X4RA 2DR7A 4RUAA 1HPZA 4PCQA 3MAQA 3RR8A 1WNEA 1Q5YA 2H4WB 4LBHA 4P6QA 4YQWA 2XMAA 4RW6A 2XY7A 4WYLA 1BGXT 4DXLA 5LMUF 4PYAA 2JEFA 1F5AA 2HQGA 4QR2A 2QN6B 3FCWA 4NYPA 3OQ2A 1VHIA 1RA7A 2VB6A 1S10A 2JFDA 1FJGF 3GZ7A 3IMQJ 3MM8B 1CBKA 1RHUB 1TKZA 9RUBA 5IC6B 2GV1A 2JSXA 2N7YA 2M3DA 2HQCA 2MZ1A 3LGHA 2BKNA 3QT7A 1R8PA 3Q2SC 4MH8A 3EYZA 1FNXH 3QGGA 4B3TJ 4B3OA 2HLTA 4DR5F 4FBUA 5L9XA 3B6BA 4K2XA 3UCGA 3C3LA 3G8SA 4DR6J 3QGHA 5KT4A 4E0DA 3MF5A 4F36A 1R0BG 3CC2S 3HJVA 3ZNUA 3QAUA 4HHJA 1F60B 4QBUA 2W9AA 4WP8A 2C42A 5LT5A 4DL3A 4LF5J 3M2RB 1H73A 2KHDA 2VG5A 3UD4P 5I4MA 8RUCA 1ZPWX 1SJQA 1KFSA 4LIRA 3QAEA 2FJWA 4RKUC 2DIVA 4ZJQA 2I0XA 2YNFA 4EUVA 2X1AA 2XZWA 4A8MP 2DNLA 1IBMF 3DLHA 1EIYB 1T94A 4DN0A 3RG6A 2R7XA 1SC6A 2ZNZA 1ZA2B 2JVOA 1JXEA 2YKMA 4KYZA 2C2KB 1TKTB 5F8GA 2YKPA 2XGQA 2MJUA 3FKBA 3TW0A 3UDVA 3MR3A 4OYIA 4UZCA 2FHKA 3B78A 4B17A 2HEKA 4M8LA 3PR4A 1WDTA 4N76A 1ZOTA 4DQPA 3AJDA 3ITHB 2K1RA 2LQ5A 2BOAA 1Q79A 4DJBA 5L9NA 2ROEA 3CCES 1XWLA 2GJIA 4ZP6A 4ZJOA 1XNRJ 2FUG9 4P71A 2P6TA 1YBAA 4KFBA 1NZAA 4OI3A 4WU3A 4F04B 1HPZB 2HFZA 3KXDA 1S1VB 1D1UA 1N0VC 4RPFA 2QV6A 4NLTA 3J80Y 4RL1A 1L3UA 4C8KA 3G8QA 1RACB 4JYAF 5DS7A 3NS5A 2ZH5A 3M8ZA 1SKSA 4ZVFA 2KFYA 2RDDA 1N48A 3GJQB 4I6WA 2WW4A 3CCZA 3KLIA 5ETVA 4MK7A 4DFMA 2WSCC 1L3KA 2HS0A 1NUEA 2YNGA 5HP1A 1BQMA 2V8GA 3OTBA 4XTTA 1QLNA 1UPMB 3M6WA 4LFBJ 1NK0A 2GQQA 3OL6A 4DSEA 1NEEA 1MN9A 3QJPA 2AEMA 2F4VF 5F0WA 3QT6A 1A7GE 2A2CA 3GP9A 4C98A 3BKUA 4GVLA 4QIVA 3HMJG 4ECUA 2NPIA 4CLPA 4NZ6A 1JLFA 4LF7F 2KDOA 4CM2A 2M88A 3P45B 2GW8A 4OLOA 1XMQJ 1KLNA 4GO7X 2X1GA 3W1YC 3MGJA 1RGVA 3NMRA 3FFIA 4WYWA 2WK4A 2C2DA 3AOAA 1I51B 5BJRA 1SC4B 4USTA 3OTDA 4ZCLA 1TVRB 3W60A 3BO4A 1VQ9S 2FC9A 4ED3A 2UU9J 5HROB 2UUTA 4LSZB 3FRZA 1S5ZA 3HLUA 1Z1ZA 1DQ8A 3QIPA 2XO7A 4QWAA 4DR2J 2DR8A 4RW8A 5AJ3J 1VLOA 2W9BB 1RYRA 1Q0NA 2CZ4A 4PG4A 1K9MT 2VZ9A 5F8IA 4CO4A 2MQ8A 4TYBA 1UMJA 1T3OA 3MI7X 4WFYA 5K14A 2CADA 4P9SA 4PXDA 4NLOA 4WP3A 1AFJA 1Y11A 3JSBA 3VALA 3KLFA 3N9UC 4FXWA 5AE3A 1VRQC 2C3YA 3OPKA 3VGVA 2PGCA 3PNIA 3W5ZA 4CCHA 2HMIA 1IKYA 2DTJA 2DXDA 3MPUB 3TR5A 1TK0A 1YI2S 1RBOB 2IFXA 2DGWA 5E0OA 3CCJS 1H3DA 4USIA 2HRTA 5ETSA 2R7WA 3UCZP 5A8RA 3LW5C 1JLGB 1X5PA 2DVIA 2NQPA 1JLGA 2Y1IA 2XYPB 2OEJA 2EWHA 3ENQA 3GR0A 1YJ9S 4ZVOB 2QRRA 1H74A 2KG0A 4OHYA 5KFXA 3I0SA 5HL7Q 3MR5A 4IR9A 1JIHA 3DRPB 2LKZA 1U6ZA 2OFGX 1N36J 2VA2A 4XO0A 3A3NB 2R7OA 3MPDA 3J81Y 1JQGA 1AUSL 1X4DA 4Y2CA 1VGYA 3C8YA 4PEOA 4ZP7A 4C97A 7FDRA 2W9CA 1TUWA 2G9OA 1DRZA 1MSWD 4B08A 1QM9A 1XEZA 2WONA 1K0VA 1GFWB 1WSVA 3PYGA 5KFVA 2MMYA 3BGOP 3VGTA 3PEJA 5DGBA 2RDIA 2ZH1A 2BYCA 3BKFA 1HW8A 5KFPA 2ZJRQ 3GPAA 2BM1A 3DYAA 4IDKA 2ZM6F 4F67A 3MUTP 3AXKA 2D3O1 3OTOJ 4IFYA 3G82A 1BWVA 4F0KA 4ZIVA 5AE1A 5DM6Q 4F4AA 3H2LA 5ETLA 1U6BA 1Y5LB 2H65B 4KHRA 4ZVTB 4AE5A 3PO5A 1Q4RA 2B9WA 2GVZB 1B4SA 2VQFF 4I67A 3BQ2A 1HNVB 3PKYA 1Y7PA 3GG0A 3I96A 5A8WA 3WX8A 3V6HA 2R7TA 3G6YA 2IC3B 1BC6A 4IR1A 4G3IA 1WACA 4DOZA 5C24B 2W25A 3HPOA 1I5OB 1UFLA 1A6LA 2WBRA 4IG0B 4EGLA 3PW5A 2K7JA 1FKPB 5E3QA 2YX1A 2OFHX 4G1PA 1HBMB 1OQ3A 2QYCA 2UUCJ 4FF1A 2JVRA 2Z8QA 3OR1B 1ZETA 2WZ1A 4X2BA 1FHTA 1KC8T 2DRAA 4QZVB 2CAJA 2E7XA 2VC1A 5HI7A 3NCQA 3VZIA 3ZZTA 4PRFA 3M30B 1SC3B 3JSRA 4OZNA 1WOPA 1RTDA 3KOAA 1T05A 1X9WA 1ICEB 3NGRA 4DG1A 1FK9B 2W24A 4O4GB 2JL9A 5FDLA 4RUHA 2NLWA 3WC2A 5C2GA 4QU6A 3P4UB 2BJ1A 1HFEL 5CA5A 2M5YA 2O3DA 2RU9A 4C3LA 2Q79A 1RDRA 4UF4A 2IBKA 2J5AA 3I9ZA 4M5MA 1ZZNA 3KLHB 1GH8A 3GV5B 3I6PA 2W01A 3S7RA 1VQPS 2UXDJ 1E6YA 4KKOA 4UUXA 4YUDA 3IRXA 3H5UA 4X84A 2R8HA 2LU2A 1WC5A 4DV2J 2FHJA 3HHLD 4CO5A 1D9AA 5HP1B 4ENOA 1N5YA 5AJ3F 4W4MA 5KT7A 2R8JA 1UVIA 4XDDA 3TUJC 4WP9A 1S77D 2C1EB 1YIJS 2XSJB 4ED1A 2RF2B 2MZSA 1UETA 1S79A 3A3PB 3T1YF 4K0KJ 1GTHA 2VA3A 5IT9U 3T6BA 1LW0A 5D6GA 2L48A 3IXQA 4JI0F 2BVZA 3RAMA 2NXEA 4I7FA 1FCAA 1UJ6A 2LQ9A 1S9GA 2QSWA 4O23A 3RU0A 1KP6A 3D4JA 5F9LA 3Q0AA 4DFJA 1IBLF 5L1KA 2XMJA 5I3PA 3MAAA 3DU5A 1X7VA 2E7WA
chains in the Genus database with same CATH topology
4DSJA 1U8SA 2EK6A 2VPZB 3GSDA 4JOUA 1WEYA 1T03B 1M5VC 4Y65A 5D3GA 1FNOA 1ZAXA 3DRXA 2HQIA 4IH5A 4LSLB 4O3PA 5DLGA 5D3GB 1XK8A 4Y34A 1QJHA 4O3QA 2VG7B 2NSCA 4KB7A 3RB4A 1SH3A 2VG5B 1HNWF 2YX4A 3X3UA 1TKZB 2VPYB 3SQGB 4YHHF 3KJVA 1WEZA 2RSQA 1WWHA 2XC9A 2W7AA 3N79A 1F0XA 4KR0B 2DGVA 1RYSA 1LV5A 5CYQB 2KYZA 5AXMA 5J2NA 4ZCIA 3JYTB 3HHLA 1UA1A 4PWDB 1E6VB 2R2UA 4KBIA 4B9TA 2J0WA 4F4KA 1FRXA 2DH8A 3UI3A 4KT0C 3TAMB 2CPFA 1D8ZA 1WEXA 5HROA 1YRXA 3FRYA 1NJYA 2H5EA 2V0NA 4HTJA 3T5HA 4RU2A 2XGPA 1J5OB 1U2FA 1I1GA 1ZM3A 2FGOA 2OO4A 2IM1A 3GFXA 4E98A 2XLJA 4MKYA 5FJ4A 1T95A 2HHWA 1BY9A 5CZVA 3AHPA 3DLGA 1HMVA 3UFCX 2DBBA 4FNIA 3K2YA 5KG6A 3BSOA 4LFAF 4QU7A 2W8LA 2F7VA 3GB0A 1HI8A 2CVIA 2U1AA 3OR2B 4KO0A 4ZP8A 3B4DA 4ATNA 4PQUA 2XSJA 4B9UA 2DNPA 3ITHA 4NPOA 4JI7F 1N52B 4NLSA 2KYXA 4G1IA 1R43A 1HQUA 1Y0HA 3FEYB 4K0KF 2RRBA 1GXTA 1Y9OA 2Z0GA 2K3IA 3LAMA 5F8LA 3CDEA 3CE8A 3MM7B 2ASYA 1M0SA 1VQYA 1FXLA 2W7OA 2BOPA 2HHXA 3T5LA 3HHNB 4DBQA 3I5BA 3DNCA 3WBZA 2VFVA 3IR7B 2ADBA 4F3OA 3UNGC 2O66A 5E7OB 1JNRB 1ZAWA 2BQ3A 2GGPA 1T05B 2XY6A 2B7CB 2CQ3A 3CCSS 2OPRB 2MQOA 3OFFA 3MMBA 3KKFA 3HVRA 1TL5A 3H59A 2QT7A 4AXIA 4UY85 4Y00A 2DB1A 4WFNQ 2PO4A 3SFGA 3M2RA 2KRRA 2HS4A 4DV5F 3QJLA 4C0HA 1TL3A 2IC3A 3HVAA 4ZHRA 1HQEA 4KV8B 4TU8A 5L39A 2JOQA 1X5TA 5C5JA 2KU7A 4OIXA 2MKIA 4FS2A 2QA2A 3BSAA 3BJYA 1HR0F 1DARA 1LXJA 2BJDA 3CCQS 3NAHA 4G6VB 1G3OA 4USHA 2JFKA 5LL6d 3DDNA 1NHUA 2BR0A 1UEVA 1RT1B 2X1BA 4QWCA 1Q86T 5DQGA 1APSA 4R8UB 2E1AA 1VQSA 3KHLA 1U49A 3MM8A 3L7OA 3G8TA 4QW8A 5CH7B 2YWHA 2C2RA 1OPIA 4NLWA 2B6AA 1CC7A 1SUQA 5IXUA 1VQ7S 5T14A 2YTCA 2LVWA 3GFYA 4JI8F 2HGMA 2M52A 2RJZA 1IKYB 4Y2AA 2JZ5A 3BM7A 4U6PA 1D9DA 4YB7A 2J6UA 1LW0B 5I3UA 5A8KB 2ZOGA 4ZHRB 5E5NA 2JEIA 1REVA 3R5CA 4OJ1A 2GX8A 1VFJA 3FCHA 4MIAA 3HI9A 1DQAA 1KD1T 5IM0B 5L1IA 1B7FA 2HFOA 3OJSA 4EYHB 1ZTWA 5IT0A 2RMLA 4DV3F 2DH7A 2XMUA 2QO3A 5J2MB 4IFVB 1NK9A 4TKTA 2RQMA 4C8MA 2JHEA 2M8HA 1AROP 1TL3B 4OZ1A 1Q82T 1PILA 4NLRA 4RW7B 1NO8A 4A8WA 4QYZJ 5JUMA 5K5MA 3H25A 3MPYA 2GQCA 3G6XA 1SQEA 3I0RA 4NRUA 2CQ2A 5C42B 5J2QA 4ELVA 4DS4A 1FRLA 4WE1A 2JRSA 4K4WA 1QAIA 4CZCA 3MTKA 3MM7A 4RWXA 4Q43A 4DQPA 3MD3A 1LK5A 5SZTA 1NU4A 3M2UA 5KFZA 2A10A 2J8AA 3JSMB 2R4FA 2KVIA 2GGPB 2GCFA 2AJ0A 3LGMA 3LP2A 3CCMS 2FY1A 4QW9A 4A8OA 1B0PA 1QAYA 4TY8B 5B0GA 4J9NA 1FKPA 5GAHI 4K4TA 3IWLA 2HYIB 1AXQA 4IG0A 4B9MA 2AYEA 5L1LA 1HNXF 3DI6A 2ALZA 3BR8A 2XG8A 4HYKA 3MEKA 3QJJA 4QCLA 2DNYA 2AGQA 2QMWA 4ECYA 4NLPA 3CCLS 1VRUB 5E3RA 4EZ9A 4DFKA 1FDNA 2UXBF 4DQRA 1CC8A 1FVQA 5LJ3Y 3QLHB 5I42B 1NKCA 1NJIT 1UFWA 1U1QA 1WHXA 4QPXA 1CG2A 2DJWA 4TXSA 1VQLS 2DGQA 4NXNF 1ZAVA 1SUQB 4ZK7M 2ATLA 3JTPA 4NLVA 4IOAQ 1HBUA 2MZTA 2AJQA 4Y2MA 1SH0A 2J7UA 1X4AA 2DHGA 4URGA 4PG7A 1IKVB 3DLEA 3T9NA 2G4BA 1X4FA 2KG1A 3EX7B 3AH6A 2D9PA 1LWFB 2AW0A 2BANA 4TQRA 1RT1A 1Y4ZB 4WFZA 3CDWA 3U1MA 2JC0A 1RT2B 2YWEA 4DSIA 1YRUA 5CYJA 3O8WA 3HVWA 2WTFA 4UOCA 4O3SA 5KFUA 1Z4UA 5KFNA 3EPIA 4K50A 3OVSA 2GA7A 2GIQA 1QE1B 1S1TB 1YJRA 3DOMA 1URRA 2KM8B 4KGMA 3LANA 3GV8B 4MYTA 4CNYA 2A2DA 2E9RX 4W92B 3X1LB 3GIKA 4PWUA 3LWMA 2VG7A 4X62F 4UY8T 3E01A 1MMLA 5M2PA 4RU9A 2XEXA 2HWIA 3MMCB 2Q6BA 2F8HA 3MEEA 1IM4A 2IRYA 1ZPVA 2XHWA 1JLEA 4MKBA 5HMYA 1YITS 3Q22A 4H4OA 4YR0A 1KEKA 1B0TA 2BE2B 4I2QA 4OLPA 2YQ3A 5DQIA 1YJNS 1UW4A 2DO4A 5B0FA 4WTYA 1VQOS 4PXBA 3MM9B 2UVRA 1QTMA 4EBDA 4X4VA 2OPPA 6FD1A 4B3TF 4EEYA 4LSLA 4OL8A 1BQNB 1UVMA 4WZMA 3BF4A 4DR3F 1T8EA 2DIUA 3EZUA 1Q81T 1VI7A 4IQMA 3IG1B 3OTEA 2B7BB 3HF5A 3GIMA 2Q43A 2XI2A 2OKQA 1FRIA 3VAMA 3BS9A 3IAM9 2ZH9A 3N5FA 4YOEA 3MR6A 1SBRA 3I5CA 3LGNA 1RK8A 1S6PA 1CEZA 2OAUA 5KFQA 2YNHA 1E6YB 2MKCA 4KKOB 3V4IB 2OP5A 3MAHA 1DTQA 3RYLA 2GHWA 1S9FA 4DV0F 3CB4A 2CFXA 5K8MA 1LW2B 1U1PA 5BYQA 2IAJA 2X51A 3FDSA 3L09A 2MKHA 5H9FJ 4O4RA 2HHHF 4TY8A 1QUVA 3CJ4A 2MJNA 1M90T 3T5KA 3DMJA 4M94A 2XMTA 3SSRA 4QIFA 4HEA9 3ZFVA 5HO4A 1CQMA 1EP4B 2CPXA 3CCTA 3GR1A 2DNMA 1TL1B 3HFKA 5JVHQ 4FS1A 3H98A 3MR2A 1N56A 4ECSA 2B5JB 4RBTA 1VRUA 3H5SA 3L7PA 2G13A 1R31A 3I56S 1N5QA 2RS2A 1N8RT 1SJRA 3R5BA 3OJUA 1N4LA 2OPSA 2FJDB 4BWJA 4O3RA 5JXSA 2L3MA 2EBGA 1U1OA 2J6TA 2AX1A 3M8RA 1FE4A 3ZZOA 3MEEB 1RP5A 2C3PA 3CD6S 1EETA 2GNKA 3KLEA 3CJKB 2X3GA 2HHSA 5KFFA 1OSCA 2OSQA 5LJ5Y 2MZRA 1HWJA 5EHHA 2IJNA 3CDUA 5GVQA 5LSRA 5LXRA 2IM2A 4UQGA 1FKAF 3C66A 3LO3A 3OLBA 4XDCA 1HL6A 5DQHA 1HBOA 3MUVP 3CPWR 3SV4A 4HH1A 3MEDA 2NREA 1Q8IA 1S7HA 3BSCA 3KG1A 1Q8BA 1TL4A 5HLFB 3HKWA 5BYRA 2Q3PA 1XR6A 4H54A 3U1LA 4DR2F 4GKJF 3MMCA 2F40A 2CDQA 1KOHA 3O1LA 3E01B 2RQ4A 2HPUA 4JV5F 4A4JA 3A8EA 2DNNA 1U1RA 2IVMA 2GQ2A 3RB0A 1DJ0A 4NX9A 4MKAA 3HHEA 2CPIA 1LOUA 3W7BA 1VC5A 2K3KA 2AYGA 3AAWB 1M5OC 2LLZA 3IRXB 1ZTTA 2ZE2B 1SIWB 2PMHA 3OXFA 3PJXA 2RKIB 3UE2A 3LOUA 4A47A 2YNIA 3EPGA 2BRKA 1U6FA 3BN4A 3ICLA 3H2UB 5D4NA 2HNYA 2VFSA 3SZ2A 3HZEA 1HBUB 1LWEB 4ZPTR 4ZDNA 2KN4A 5T7LA 4ZLPA 2QMXA 2ERRA 1FDAA 1YG0A 4U7UK 4Q0BB 1MROB 1OQ6A 1W25A 3M8PA 4F2RA 3SCJE 3EXCX 2UP1A 1J2VA 3I32A 4FN5A 4IH7A 2I2YA 2HHVA 1SL1A 2O1PA 2R7VA 3IR5B 4KV8A 1Y5IB 3HT3A 2M0GB 2OPSB 4DL5A 3NKYA 5LSOA 1NNDA 3E8OA 5B0AA 1DURA 1GXLA 2OMLA 1L3SA 5EWFA 4URSA 1U1LA 2YKOA 2FHOB 4OJHA 2UUBF 3RTVA 3VAIA 1C1CA 1TL1A 2V4QA 2VUGA 4OX6A 1GXUA 1FTRA 4DV2F 1C4CA 3FEXB 2VBYA 1KSPA 4OV1A 5DRKA 3IGVA 3VAKA 3SSSA 2CQHA 4MYUA 2E1CA 3CC7S 3QO9B 1M1KT 5D4OA 3H40A 3T1AA 2IA6A 3RRGA 5KFEA 4ED0A 2GO8A 5IQQA 2OJ3A 3QIDA 2FJAB 1Y3JA 3BZQA 4DV1F 2KZMA 3ZZZA 4JI4F 1ZZFA 3T3FA 2BJEA 5A0YB 1O0PA 1X4BA 1LQ9A 3BGFA 1XR7A 3SDEB 1KRPA 2VBWA 2QIFA 3EGNA 2B4VA 2ZH2A 5DLFA 3JTOA 4C8YA 3ZZRA 3AB2B 5IM0A 2JC1A 3KLIB 2ZZNA 1HW9A 4ED6A 3HO1A 1D0EA 4LMZA 4F50A 2B4PA 1C4AA 1DFDA 2DD8S 3DXSX 1ZBTA 5KFCA 2XCPA 1S97A 2P9EA 4RNMA 3FSXA 5CQGA 4ERDA 1E6VA 3M4XA 1FO1A 3MXHP 2CJAA 4CO0A 5HMXA 4GC7A 3K7RA 1NKEA 1MU2B 5DETA 2EFNA 2B6AB 4F2SA 4OZ0A 2MSSA 1GNKA 4IO9Q 5KT2A 4QOTA 2E5JA 3DLKA 3KWMA 5H1SV 3NNAA 1VC6A 4OQJA 2ILYA 4F4ZA 5KFHA 5ADZA 2I5JB 3PO4A 4Z37A 1AFIA 5KG5A 2CQGA 5FIIA 2WOMB 2LA6A 4C11A 2V94A 1LKZA 2R7SA 1FRJA 4TN2A 3QIPB 1X0FA 2AD9A 4JI2F 3TUIC 2M9KA 1TKDA 5GAGI 3DDKA 5KFLA 1YJWS 2Z2MA 4FF2A 2KT3A 3DRRB 5DDOC 1FD8A 3S1TA 3V2UC 3TUZC 4KSEB 3G6ES 1F5CA 1YTYA 5EX0A 1VC0A 4O44B 3FZ2A 2DO0A 3RW7A 3VAGA 1NK8A 4ZPBA 2HNDB 3MMBB 5E3AA 4JV0A 4RW8B 3TOQA 3G6VA 4DR6F 3ISNC 2BANB 2QA4G 2UUAF 4KPYA 1QVFR 4FVMA 2OD4A 4NOHA 1TK5A 4ETZA 4K59A 2MYFA 5E41A 2D3OR 3NLCA 5D77A 2AX0A 5CD4H 1S72S 4B9SA 3K5MA 1NHVA 1N5YB 5DJBA 1GX5A 4WF9Q 2CJQA 1LWCB 4C7QA 2K8GA 3THTA 1R27B 3ENVA 2M4MA 1R8HA 5FD1A 2JEJA 2B56A 2J0SD 5KFWA 1HD1A 1WG4A 4ZVGA 1QY7A 4R5PA 1PC4A 1XMBA 2GHVC 3TVKA 5CXTA 1KQFB 2EFGA 4LT6A 4J9SA 3VAFA 3BGRB 4X66F 1RI7A 2CYYA 3TP2A 5FDLB 1TKXA 4JI6F 4N8NA 4LVOP 2KHCA 3W2VA 1XC9A 2ZNYA 4PQUB 2YKQA 2ZFHA 3KK3B 3HZGA 4WE1B 3A1YG 4X64F 4OI4A 5A0YA 3US5A 1FVSA 2OPQB 3B4MA 2LXUA 1VLYA 4DL4A 1RQ0A 3OFGA 4AQYF 4NCBA 1U09A 2RVJA 4ECRA 1U26A 3R5AA 3CMES 1H38A 1KS2A 3P3DA 2DNHA 4J9RA 2D74B 3FVYA 3MURP 1WF1A 2CG4A 3M2VB 2YKMB 4NLXA 3IG1A 4PPDA 3HM9A 3OL9A 4K4UA 2VKRA 2XNRA 1HD0A 3I82A 1KFDA 3K0JA 3HHLB 4URQU 1F2GA 4O44A 4DSLA 1VBYA 4OI2A 1X0PA 3UR3C 2VOPA 1U4BA 5D4PA 2BE2A 4I2QB 3ZZPA 3PIPQ 4U67Q 3CCRS 4DWIA 5J1NA 4EWTA 3HK2A 2QFJA 5KFIA 1RT7B 2XWXA 3CT9A 4A8XA 2FLLA 1Q78A 2ROGA 3QGIA 3SI8A 5HQ8A 4NL5A 2IM0A 2ZE2A 5KT5A 1U47A 3WX4A 1X4EA 3W2WA 3FQLA 3FZBA 2CJ9A 3FSYA 3VTIA 2F8MA 3ENWA 4MFBB 3BQ0A 3T19A 4K4SA 1WF2A 3Q8RB 2P5VA 5U47A 2DPJA 2HRUA 3MUMP 2CQPA 3RR7A 5KFDA 5ITHA 3M9NB 1DTTA 1X9MA 2HS3A 2ZJQQ 1QSLA 2LXFA 1S6QA 4HT7A 4ZVEA 2HNZB 3V6KA 3LPYA 2RRNA 3IS9A 4HI1A 5HLFA 3WZ0A 1S99A 4CT8A 4DV6F 3UPFA 3ULHA 1IBKF 5F8JA 4HDHA 4WCEQ 4I2PB 5DGAA 4X4UA 2FHJD 4ED5A 4RW9B 1KONA 2DGUA 3D5MA 3GYXB 3KHGA 1JWWA 3GFHA 1N5SA 4CTAB 3ISND 3MTJA 3CJKA 4Q5VA 4XPEA 2UVUA 2BUNA 2KO1A 4AYBD 5K9FA 2BABA 5I42A 1JKHB 2LDIA 2XBPA 2WBMA 1DAXA 2Y1JA 1S1WB 4Y2IA 3MEDB 2UUCF 3DI6B 2W7PA 1UVJA 2PSZA 3IA0A 4M5DA 4WXOA 3RB6A 1JLFB 1UA0A 2R8IA 1V3ZA 3AQOA 1YJUA 2J7WA 3T6JA 3PRBA 3BGUA 3C46A 4Q8EA 3KLEB 1URNA 5D78A 1RTDB 3U7JA 2FIUA 3M2UB 3OVBA 3M8PB 4IO1A 5CZXA 1X5OA 3N6LA 4TLRA 3QYYA 4YDDB 2R2SA 2RE1A 3DOKB 1NK6A 4OMFG 1MWZA 3NP5A 1HWLA 4QIEA 5KOXA 1VHFA 1G7CB 2AJ4A 3DGPA 3CCVS 3V6DA 5J1PA 2R2TA 2RIJA 2W9CB 4WK1A 1YWXA 1K0TA 1S1XB 4QIGA 1R8CA 3O44A 5J2MA 1HMVB 4NZ7A 4KFBB 2ZC3A 1JJ4A 3QZ8A 2VG6A 2YVSA 2VFTA 4YB1P 1OPZA 1HWIA 3LP1B 1VS3A 1L5UA 5T7LB 5CCMA 1QVGR 1FJ7A 1FEHA 2EBEA 2UVWA 2LU1A 1RKIA 1UVKA 1HWUA 4OI1A 1PGZA 1HBNB 4DV4F 3IWNC 5A8RB 2FVQA 2MPUA 4B02A 1CLFA 4O3OA 2ZDOA 1S9EA 4PQAA 4NMLA 2J9EA 5B0CA 2Q1LA 3DC2A 4J9MA 2FB0A 4ZS6A 3MM9A 2A18A 5GADI 2G0CA 1I94F 2YWFA 3M9MB 2HQ3A 1XERA 3V81A 1C0UB 5IFMA 3KLFB 2ZH6A 3DRRA