2EKYA

Crystal structure of hypothetical protein mj1052 from methanocaldococcus jannaschii (form 1)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
97
structure length
97
Chain Sequence
b'MRKVVAEVSIIPLGKGASVSKYVKKAIEVFKKYDLKVETNAMGTVLEGDLDEILKAFKEAHSTVLNDVDRVVSSLKIDERKDKENTIERKLKAIGEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0045 protein MJ1052
publication title Crystal Structure of hypothetical protein MJ1052 from Methanocaldococcus jannaschii
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Structural genomics, unknown function
total genus 27
structure length 97
sequence length 97
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01910 Thiamine_BP Thiamine-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.930 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ekyA00
1LXNA 1S99A 1VK8A 1YQHA 1SBRA 1LXJA 2EKYA 2EPIA 1S7HA 2IBOA
chains in the Genus database with same CATH superfamily
4BDPA 3EYZA 3AD9C 1YJWS 4ZVOB 2OPQA 2HW3A 4DZ6A 4K59A 2DR5A 5FJ4A 1JQGA 3PHEA 3HHLB 5KFTA 1U1LA 3MEEB 2ZKTA 2KI2A 2K7JA 1RT4A 2C42A 4MKVA 2E1AA 4Q45A 2Q6BA 3AOCA 3GJRB 3KOAA 5L46A 4XPCA 2CQ3A 5K8PA 3AH6A 2BBEA 5HBMA 2AEFA 4JI7J 4FXVA 2QL7B 3OR2B 1BQMB 1S97A 3FRYA 3TVZA 3KLVA 1NPPA 2C2NA 5FDLB 2VFRA 2AX0A 3LUYA 4M5LA 3EZ5A 3SYZA 3QFWA 2DXDA 1UZDA 3DI6B 2VOPA 3GE9A 1HNXJ 2CQIA 4XIUA 1RU1A 2KXFA 4O3QA 4TY8B 2EG2A 3J81U 5CQGA 1AW0A 2QE5A 5J2MB 3C6UA 5KFDA 5GVQA 4NXMJ 3ENAA 2QMXA 2HWIA 1NPRA 4QOTA 4MAKA 1TV6B 1MW7A 3D0IE 1UW9A 3HKZD 2YBVA 2YNHB 3BSNA 4HYKA 1VRUB 3DRSA 2LEPA 3M9MB 3IN5A 5CAAA 3IGVA 3MM8B 8RUCA 1TFWA 3EGNA 4ES3A 2N82B 1NJIT 1SCJB 4ZLJA 3MR7A 3DCAA 1U7LA 2QG9B 3SCKE 1DRZA 2M0GB 1R0CB 3I82A 1FT8A 1VI7A 2Q6CA 1ZA1B 3KLGB 2B0GA 2B3TB 1VIXA 4ZDNA 1X4CA 4O4RA 2J0XA 3VQTA 5ITHA 2LQ5A 1RWMB 2RHSB 1N48A 1TMJA 3HF5A 1FNMA 1FWLA 3S1TA 3EGZA 3MMCB 1NNDA 2MY7A 4O23A 2QL5B 2FGCA 2F4FA 2HAIA 4TVAB 4F2RA 3V2UC 3VALA 2WVEA 3PW5A 1ZZFA 2M52A 1AA1B 1WD6A 2Z30B 3Q83A 2E7VA 4QQBA 5THWA 3OFHA 4RW7B 1TUVA 5JXSA 1O51A 1SL2A 2DR9A 2OAUA 2V68A 1KLMA 4IG0B 5DDQC 1Q95G 2G2OA 4L74A 4CH1A 3GP9A 4WK3A 3IRXA 1HNVA 4URGA 4H4KC 4RR5A 1TAQA 3NCRA 3I55S 5K5MA 1EP4B 4LR9A 4HL9A 3BBCA 3H5XA 3ET6B 2ZBRA 3DLKA 1X9MA 4FYVB 4PWDA 3HVTB 4HR2A 1S48A 3R7NB 2R7WA 4C8YA 2OI2A 4FZVA 3F44A 1NLKL 4DZDA 6AT1B 3M30A 2HSEB 3C8YA 3K2YA 1NK7A 2HHHF 4DUYJ 3UDEA 2J0WA 3G87A 3CCWA 1S6UA 2AJQA 1CJVB 2YNFB 3W5XA 2ZDOA 2VASA 3MCMA 4PG5A 3ZC4A 1TFYA 2HFVA 2LXIA 2E9ZA 1OQ6A 2HHQA 2XLJA 4X65J 2N4DA 3OL8A 2UXDF 8AT1B 4BLGA 5A0YB 3UQSA 3CCMS 1JLCA 2D9OA 1VMBA 3TR5A 1VYAA 2CQPA 3NNCA 2DH9A 2DISA 2YQ1A 5FLXU 2B56A 1T11A 1NK0A 4ECRA 4ETXA 3ELHA 1ZTTA 4GKKJ 4LF4J 1M90T 4X4QA 2EFNA 2AJ4A 2Z56B 4K5RA 5DG7A 1DTTA 1CJKA 5GADI 5B0AA 1VQLS 3VF0B 1TVRB 3LW5C 1JLFA 2ACMA 2BMBA 1SL1A 3LP1B 5B0BA 2FHJD 3ZZOA 3IS9B 2UXBF 4IFVB 3C15B 1CS4A 1RBAA 3EJMA 1UP1A 2HRUA 1RCXB 3LP2A 2KJVA 4LRBA 1XWLA 1SH2A 2NS1B 2XMTA 4AE5A 1IM6A 1NKCA 1X0PA 3GMGA 3LWLA 4LMZA 2K2PA 4DUZJ 3T19A 3FFIA 1GMVA 5KFIA 4GKJJ 5IQ6A 2C3PA 2WB1D 3DM2B 2CJ9A 2EK6A 4CO1A 4JI1J 3H59A 5B09A 8ATCB 4ZPVR 4AFFA 3FMWA 2EKYA 1HARA 1D0EA 3J81Y 4NLSA 1V3ZA 2CPDA 3DGPB 2A2DA 2MQQA 1KQGB 3UCZP 3MOZA 2M7SA 5LXRA 5L8RC 3H42A 1YRTA 3ZTRA 4TN2A 3NCPA 3W5YA 2VG6B 2NPFA 2IRXA 2W9BA 1VQNS 2MZQA 2OLWA 5DDRC 1RXOB 3HFZB 4GO7X 1RADB 2LCWA 2APOA 4PPZA 1LK7A 3MPWA 4R5PB 5C25B 1FCAA 3WHIA 2ZZNA 2MKIA 2ALYB 4ZVTB 3EX7B 4OZ5A 2P2CB 4OJGA 2RRAA 2LA6A 2ZH9A 2MGZB 3MEDA 3ILIA 2PE8A 2D3O1 1RAOA 1VISA 2IVYA 3R1HA 2DNZA 3F56A 1AZSB 3DOMB 4B9LA 1LWEA 2YNIB 1H98A 3MUVP 3BM7A 3TWZA 4LSLA 4RX6A 1P6TA 3VHQA 1VQ8S 2QLBB 4P71A 3BSCA 2DY1A 2F5GA 4KC5A 1UETA 4OZ1A 4BWJA 5F41A 4ENOA 4NX9A 2DGQA 3BB5A 1KHWA 4DR6F 3L7PA 4TYAA 4PABA 1OO0B 1NKBA 1NUEA 1S9EB 4GRSA 4DCPB 3BGLA 1TL7B 3I0SB 3GZ7A 3MTJA 4MYUA 3PX4A 1LXNA 3C19A 3HHLC 4PWWA 2XZDB 3HSDA 2CPHA 3MM6A 4F4ZA 2B5JA 2VZ9A 4ED0A 3T1AA 4P9SA 2DR6A 1RT5A 3EPGA 4FF4A 3PFOA 5JVGQ 1Y5LB 4J91A 1U45A 4TLRA 3IXQA 5KFGA 3KMSA 5EDWA 1HBUA 4ZMMA 5DGBA 1RTHA 4ANCA 4ED8A 3QFHA 2K1RB 3H25A 4N77A 4MMOA 3PEHA 4DR5F 3CULA 2LU1A 3FSXA 2ASLA 2DY9A 2HHPA 3POTA 2C3MA 3CDEA 3CD0A 2IA0A 2J7WA 3RYLA 3BDEA 4WKRA 1HBOB 2DRDA 2FZGB 3W9JA 4NLTA 2HQGA 1S79A 2CJBA 5GAEI 1E6VA 3DDNA 2J5AA 1QAIA 3OXLA 4QYZJ 1PSDA 5LT5A 1YWXA 3DMJB 4IKAA 3N28A 3VAJA 2FVSA 4X4TA 4WE1B 3CJKB 5FLXY 2KJWA 1NKEA 2QLFB 3O6QA 3ZTPA 1U1NA 3C66A 1H2TZ 5A6PA 2JFKA 4RW9B 3JTOA 3TEHB 2XBPA 1FK9A 1T0TV 1ZM2A 2KU7A 3CDWA 2ZUGA 3CCZA 3H0PA 1TL1A 4PQUA 1N32F 1P8GA 2VJVA 4MFBA 4ELUA 4UT4A 1KKHA 1SH0A 2M8HA 3U02A 2GJ2A 3CJSA 4IQMA 3OFEA 3MPYA 2D74B 1IKYA 1N5QA 4DPTA 3GONA 1WKJA 5KT5A 2L9WA 4OX9J 2QJ3A 2V2ZA 4QWEA 5IWAJ 1MWQA 4N8OA 2BACA 2HVDA 4RZRA 1JLEA 1Y11A 2GV1A 2Z2MA 3MFIA 3AOBA 3JYTA 5RUBA 2XY7A 1FDDA 2R8GA 3QGIA 5HMZA 1B0TA 2IBKA 4KGMA 3PRVA 4A48A 1Z2ZA 2BVZA 4HACA 2ZM6F 3R5DA 2E5GA 4CO4A 1KQFB 2HZAA 4A8QA 2B8QA 4C2MA 2NR0A 1VQMS 1I94F 2HQ3A 4CZCA 1EQ0A 3VR1A 2CZVC 4CLWA 3QT7A 2GFFA 2CWXA 1LW0B 2DGTA 2UVUA 1U1RA 3NRBA 2FY1A 3M8PB 4DPOA 1LXJA 2DHGA 1KD1T 4C8MA 2EBGA 3L7UA 4C0OC 3CCVS 1JLAB 5IT0A 2B6AB 4LRCA 3GR1A 3V6DA 1U8SA 2GCFA 2OPRB 1C1BA 2B9XA 4IOBA 5EX0A 2LEBA 5E0OA 4FVMA 2PFFB 4OYWA 3QSIA 1SH3A 4DMZA 1F3VA 4U7UD 1QDUB 3KHLA 1FRMA 2P9CA 1XC9A 4YY3J 3CEDA 3NMRA 1SJQA 4M5IA 3TA2A 3FQKA 3TI0A 4F50A 5EGYA 2B4OA 4BS2A 2W1BA 2KVIA 1SJ1A 4CIOA 3U1NA 4IDKB 1O0PA 2AV5A 1FD8A 1IBLF 3N6LA 4YMEA 1S1TB 3QJLA 1L3SA 3VGTA 3T6JA 1UA0A 4BBYA 1ZZNA 1VC5A 2IVMA 3B6BA 2BE2A 1CLFA 1ZA2B 4V1Ak 2LQJA 1NRKA 1FRXA 3AXMA 3TOQA 4LF8F 1C4CA 3WX8A 1HQUB 3W2WB 2GS8A 2IDEA 2LVWA 4X64F 3K5MA 2J0QD 2F9JA 1ZTWA 3V81B 1ITPA 1AUSL 2LYVA 3CW2C 4I7FB 1TL3A 2YQ0A 4O0IA 2QSFA 4DF8A 1K8AT 2F1FA 4N5SA 3MD3A 2CPJA 2C3OA 1HIYA 1LWCA 4PXEA 5AXKA 2RIJA 4EU0A 1RTIB 2JDJA 1FWKA 1W7WA 1FXRA 2B9YA 5JUMA 5BR8F 3N5BA 3R5JB 4I0WA 2ZUAA 4H4MB 1YBUA 1FJCA 4OI0A 1HNWJ 5HAOA 3TEGA 4UTGA 4Q7AA 1Q8KA 3OLBA 5F8JA 3H90A 2QEXS 4Y2CA 1HPZA 4LRDA 1WHVA 1O6XA 1GH8A 4C3KA 4G1IA 1VK3A 3QWPA 2V94A 3EM1A 2A10A 2WSEC 2PN6A 1RHMB 1U0HA 4DR7J 1MN7A 3DLEA 3Q8VA 4L6V3 4OYPA 1HWKA 3HCXA 4YHHF 2YTCA 4B9VA 1FVQA 1Q8LA 1BXNA 2WONB 3H4BA 3OFGA 2V2QA 4GC6A 1RT1A 1PJ6A 4YQWA 1Z2LA 3T9NA 5T41A 2OPQB 2VQEJ 1IVZA 2FB0A 3FKBA 3AD8C 1VLYA 5L1KA 3I5BA 2R7OA 5J2PA 2DR7A 4CM0A 3AD7C 1DQ9A 4WFBQ 2VOOA 3ONQA 1NXIA 1VGYA 2RHQB 4JYAJ 5T7LA 2P5VA 4ER8A 5J2QA 1G6BA 4ECUA 1RT4B 4JI7F 4F2SA 1XNRJ 3HHKA 2R42A 1V6HA 4TNOA 4JI6J 2KYXA 4FVCA 3J7A1 3NL0A 2F4VJ 1WORA 1WEZA 4OJ1A 1N34J 3T41A 4DR4J 1VQKS 1NBEB 3G8SA 5HBMB 3P3DA 1N5SA 1NJWA 1WHYA 4DL4A 5ETLA 1D1UA 4OLPA 2ZBPA 2HS0A 4UY8T 3OTEA 4Y28C 2ZH7A 1B4SA 2IC3A 1U47A 4X4OA 3R8YA 2H4YB 4NZ0A 5DLGA 4KV8A 1H72C 4NXMF 2Z57B 2UUTA 1UPMB 3ZTQA 1HR0J 4M5HA 2G0IA 2JZ5A 3M8SA 1IBKJ 4F0HA 1YZ7A 3TJ8A 2R8IA 1RP5A 3HT3A 1UVLA 3T6BA 1WG4A 1KTVA 3FEXB 3C6UB 2OEMA 2VG5B 4JI3J 1VBXA 3MR6A 5HROA 1BUXA 4ID5A 5C2CA 3UE2A 3KUEA 3GCWP 4PWUA 5L9XA 3OFFA 1D3WA 1DQ8A 2NXEA 1MROA 3RGIA 2HVEA 3DRSB 3IR7B 1K47A 2ZFHA 1DAXA 1YI2S 4ERDA 2HWTA 1CPZA 3M8RA 3QATA 2HS4A 4F25A 4WYWA 4X4SA 3W8PA 1RU2A 1LWFA 1UL3A 4WWSA 2HLTA 1NZAA 4RU9A 2MKJA 3M2UA 2B4PA 2AZ1A 5GAGI 2Y8YA 4DR2J 4PYAA 1A7GE 5HSPA 2E5LJ 4ZP7A 5IC4B 4B3MF 1F5AA 3NMAA 1R27B 1WF0A 3FJ2A 2AJ1A 2GNKA 4I64A 3OSNA 4AL7A 1PAUB 4NA1A 3R6GB 2FHKA 4CO2A 5DDPC 4NL5A 1VJWA 4XK8C 3K5LA 5DGAA 2E1PA 3BN7A 1NHVA 2E9TA 1S6QA 2P6SA 1JLQA 2CPZA 4QW8A 4WU2A 1I1GA 3VZIA 3OPKA 3S7RA 3MTKA 1KLMB 3CJQA 4RLEA 4IRKA 4MIAA 3NS7B 3MAAA 1RCOB 3OBIA 2PEBA 3IRXB 1HNVB 1QAYA 4HH0A 1YX2A 4RUAA 2UUBJ 1JWWA 1S6PA 2J6SA 3DRPB 1M5KC 2UUAF 2ZD1A 3DLKB 4DUYF 2KYZA 2WOMA 4L72B 1IXKA 4PWDB 2J7KA 1R31A 1VFJA 2RDDA 2DTJA 4F0KA 2KFNA 1JNZB 4NLUA 1VK8A 1Q79A 1DBDA 2BKPA 2LXFA 1ZM4A 2E1RA 3ITHA 4EZ6A 4RW6A 1GTHA 3LO3A 5JJBA 3P96A 3TNVA 4JI0J 2DGUA 3D2WA 2OIHA 2YPZA 2CJYB 1KFSA 2MTLA 5F9LA 1NK8A 3QJJA 4NPOA 2IM0A 2YX7A 2W7OA 3T1HJ 3B8HA 2DB1A 2PO4A 1VJQA 3I4HX 5ETTA 4LF6F 2N3OA 1V3SA 4LF4F 2DRBA 2V34A 2ZH1A 5AXNA 2QA4S 1KOOA 3IGNA 3HZEA 1JLCB 2XEXA 3E3XA 4DV7J 1S1VA 4USMA 4ZPWR 4K4SA 1WHXA 4OZJA 5EWEA 3VAIA 5CCLA 5KT7A 3HO1A 3KNGA 4NXNJ 3GIMA 2E66A 5KFOA 5J2NA 1T9TA 5AJ3F 1ZBTA 4DV6J 2CQ4A 1SPBP 2XI2A 1T94A 3BR9A 1L3VA 1PIEA 3DXBA 4YP3A 4ANEA 3K89A 4KKOA 3RB6A 2ZWPA 2CWKA 2I8EA 4LIWA 3NGSA 1CJKB 5D4OA 4LF1A 4AXJA 4AYBD 1S0MA 4KB7A 5I42A 3L95X 2GHPA 1JLFB 1ZAXA 4DUZF 1KVKA 1FJ7A 1HLWA 4GKJF 2WSFC 2BJ7A 3IM8A 1HFEL 1CS4B 1WF1A 4AQYJ 3LP2B 5HL7Q 4JV5J 2I9SA 2DNYA 1VQ4S 5AE2A 2KT2A 2PFDA 3BQ1A 3FFIB 3KDOA 4QIFA 4EBDA 3SQGA 2GIQA 1G7CB 2HBRB 4PG4A 1XK8A 2PEHA 1XR6A 4QR2A 3L3CA 1S10A 3ILLA 1M0SA 2MQMA 2HQIA 2FGOA 4ZVQB 5IXUA 2HVIA 1VRTB 2VB6A 3WC0A 4ZVPB 1R8AA 3GFXA 3CPWR 4LFBF 2YWKA 4ZLLA 4EBEA 2CXEA 3SSRA 5IFMA 4DV5F 1T8EA 2W9BB 3DRYA 1S4EA 2ZBQA 2W2NP 1UKUA 1WOOA 2VICA 5A8WB 2CKWA 2DNGA 2N7CA 1CSJA 1HBNA 5J1EA 3HKWA 2KVQE 1E6YA 3Q24A 2CPIA 4MKAA 2VA3A 4WF9Q 1JX4A 4R25A 1SKRA 4DOZA 1MU2A 4C4WA 4OI2A 4ZP8A 1UAWA 2HFZA 1UVIA 3MEDB 1JLGA 1Y5NB 3MCNA 2NCKL 2ZH2A 3QGHA 5ETOA 3KJFB 4F4WA 3AQOA 1WSRA 2VDHA 4I2QA 1SIWB 1YQHA 4ZCIA 1LWEB 2PMWA 2C22A 4F8RA 3HVWA 3M8WA 4LSLB 4OV6A 3ZO7A 1KWMA 1WKLA 5ETPA 2B51A 3BGUA 2J9EA 2W7PA 4DV4F 1UVKA 4ID8A 4OV1A 2QA2A 3HD1A 2VKZG 2L48A 3TARA 2QRRA 5E5NA 5KFHA 1DY3A 4PXBA 4M94A 4FBUA 1CULA 2YQ3A 4JV1A 5MAOA 2QFJA 3OUYA 3OJSA 1D9AA 3UCUP 1UWAA 2MKHA 2DD8S 4QZVB 2Z0GA 2FQQB 2BE7D 1B99A 3SEOA 4ZJOA 5DQIA 4XPEA 4JI4F 3MM6B 1TU0B 4YR0A 1K73T 2G1HA 2B5JB 2VBWA 5D0RA 1NJXA 4RW8A 2RMLA 2D3UA 2VODA 4PXDA 1HBUB 2FJEB 1NB2A 1RTHB 2OTJS 3D54A 4DLEA 1XEZA 2E5HA 2IM2A 3FQLA 1RA7A 1BQXA 4NCGA 1LOUA 4C8NA 2FJDB 4F4YA 3ISNC 5F8IA 2WRMA 1GXLA 1I51B 4IRCA 4FBTA 4JI5J 2FC8A 4DCJB 3V6JA 2BQRA 1S99A 5ETSA 4P7VA 3ZZZA 2AX1A 5KFVA 4PR6A 1A6LA 5EUHA 1V9OA 4LUBA 2O67A 4ED4A 2BRLA 1E6VB 4DR3J 2DXFA 2ZOFA 4Y34A 3OD2A 2GMHA 3LQVA 3RTVA 2CQHA 3AY0A 3BEGB 2ZDPA 2UUCF 2B43A 3C16A 4NYOA 3W61A 4OZNA 3KK2B 2Y1RI 4WXWA 4QYZK 1SUQB 1M5PC 1GXUA 1H6KX 3DOLA 2RQMA 2AGPA 4KJIA 3TAMA 1FDBA 1FK9B 5HMYA 2JNJA 4B3TF 3IBWA 5DZ7A 1TL1B 2J7UA 4HVZA 4PQUB 4OX9F 4IH7A 5IWAF 3TUZC 5CCMA 1NK4A 3MGJA 4LSNA 4MFBB 3DU6A 3TUIC 3KG0A 2K3IA 2VHGA 4L73A 2VPYB 5CD4H 2D9PA 4ZN1A 4HH1A 1IQTA 3OL9A 2P8IA 2E9RX 3J7ZT 1RE1B 1IKYB 2L3MA 4PG6A 5KG6A 1QM9A 2MQ8A 1GT8A 3MDFA 9RUBA 2DNQA 4ECVA 3OLAA 1IBCB 1TMMA 2MPUA 1JLEB 3GFHA 2JJ4D 2ZEJA 4YR3A 3M7VA 1U1QA 2ZE2A 3JYTB 2JLEA 4I68A 5B08A 1SC6A 1S9GA 2DPJA 2VC1A 2M4MA 2HHHJ 3HHEA 3K58A 2XNQA 4B08A 3D1OA 3SCJE 3LP0A 1QUVA 2DHHA 4A8YA 4PZVA 5H9EJ 1HA1A 3J7YU 4HACB 3QBCA 1K1SA 1P9YA 4K4YA 5CYMA 2HS3A 3CD6S 2F65A 4FNIA 3FBBA 3W7BA 4A8MP 1FXLA 4QIEA 2UXDJ 1IKWA 3FEYB 3PZPA 3A3NB 4UUXA 3K7RA 2XM3A 3RB4A 1NCLA 3DHXA 2YWGA 2NSCA 1OSCA 1RAEB 3W66A 4DSFA 3IO1A 3AJ1A 2UV8G 1M1GA 5D0EA 3BGRA 1SIZA 3A8IA 1MWYA 5ETKA 1IR0A 4G6VB 2HHVA 4UUWA 3V6DB 2R7RA 1C1BB 4OI6A 4W4MA 2KN4A 2ATLA 3Q8RB 1X9SA 1VQSA 1N36F 1RHRB 4U6PA 3EWGA 2UXBJ 3QSYB 4C8KA 5DO2A 1X4EA 1NDPA 3EGVA 2BKNA 1PJ7A 1FE4A 3NWRA 4F26A 2CYYA 2Z2ZA 2FJXA 3JTNA 1LEOA 4NRUA 3ENQA 1Q1KA 4K4VA 2PSZA 5DG9A 1WOSA 3IWLA 2BOAA 3NBPA 4KGVB 2Y0BB 1MMDA 3GIIA 2LMIA 3CE8A 4F4AA 2BE2B 1FDAA 4RBTA 4LJMA 1SJ3P 3DU5A 3P49B 4Y65A 2CNNB 1LFPA 1RAHB 1P1TA 1R43A 2W01A 3UFCX 1VLOA 4P2MA 2V2KA 3CCRS 4GVLA 3GYXB 1WG5A 4I69A 3SSQA 1UVNA 3QRRA 3OXGA 1TL3B 4RWWA 5F3ZA 1DQAA 3R97A 3OL6A 2F8MA 1H2VZ 3MD1A 3I5AA 1OY8A 4CDIA 1EKSA 5KFBA 3PO5A 1LWCB 1B70B 1SXLA 3QNWB 5KFXA 3QGGA 2Y3YA 3P5BP 3EUNA 3F73A 2JC1A 1UFWA 4J9VA 1YJ7A 1TELA 3WIVA 2QLXA 4L75A 4KRWA 2R7QA 1Y7PA 2DGWA 1QAXA 4IG3A 2ZHBA 4M95A 3PJ9A 3CIZA 4Q8FA 1HD1A 1HPZB 5HVGA 4NMLA 1FX4A 4IR1A 2JRSA 2K8GA 3UNGC 1BQNB 4I6AA 4A46A 1RABB 4UY85 1DTQA 3PYGA 1MWZA 2AF6A 5KT3A 2AU0A 2JLFA 1PKUA 1UVJA 1U0HB 3MCSA 1AB8A 4QIGA 2VQEF 1R8BA 3CCJS 4ECYA 4DS4A 3SSSA 2XS5A 4USTA 4NI2A 1WF2A 3A1YG 1L3TA 5BYRA 5U47A 4N56A 1X4FA 3KHHA 1RYRA 1RT1B 4JYAF 4NLOA 5DLFA 3M8QA 4WP3A 4P73A 1WG1A 4RNHA 2W9CA 5E3AA 1NJZA 3SQOP 1XNRF 2RF2A 4M5MA 4RW4A 4JI6F 5J2PB 2JH3A 4X2BA 1F5BA 1SC3B 1TK0A 5KG7A 1HWJA 2H51B 4HT5A 1N6QA 4V19J 1N34F 5KFPA 5T7LB 3DHWC 4DU7A 4CO5A 1UJ4A 5J2QB 2HHWA 1S9FA 2D41A 1RAIB 3KLFA 1B3TA 4BC9A 3QZ7A 4C0BA 4DSLA 3G4SS 5KAKA 1V3RA 3GJQB 1D9DA 1GNKA 1R6VA 2FJWA 3OXFA 1YRUA 3TAQA 4FYXB 1JK9B 2EFGA 4DR5J 4IH6A 1GFWB 3J7AN 1HR0F 5D4LA 2RDIA 1F9FA 3KK1A 2Z2LA 2DPIA 2B7CB 2FHJA 4P6QA 2XMMA 1IBKF 1Q0NA 2G1DA 3CCQS 2QYCA 5KFFA 2IC3B 1FERA 4KV8B 1RAGB 4JI3F 5CABA 1HW8A 3ILJA 1IWGA 4HI2A 2PD1A 3BO2A 3PKMA 3NOCA 2MJNA 1KSPA 3UN5A 2WZ1A 1NK9A 3BH7B 5DG8A 2OSQA 5HQLA 3BZQA 1VBKA 4EGLA 4X4VA 3E01A 5E33A 5HROB 1H38A 3OHBA 4ID5B 3CD7A 2JEFA 3BGOP 3LF0A 3H2LA 1ZAVA 4USUA 3B4DA 1MROB 3G82A 4ECQA 4CLPA 3M4XA 3NS5A 2KT3A 3PR5B 4U7CA 3WIUA 1FWPA 2GO9A 2NXUA 4E2FB 1XMBA 4WCEQ 3G6ES 3ZZTA 1LWFB 2QL9B 3AODA 3M2UB 3GILA 2EC0A 2IA6A 3TZWA 2LQ9A 4OJHA 4ZA1A 5I3QA 2RH3A 2AW0A 1R8HA 3EDRB 4J9NA 1Q53A 4USJC 4ELTA 1F6TA 3IG1A 4OYOA 1Q81T 2WVBA 5LM7E 1VR6A 1KEKA 2UXCF 4DL3A 3HT0A 2KDOA 2AZ3A 2KXHA 3PIOQ 2MQPA 1SBRA 5IC6B 1RZMA 2RAQA 1HI8A 2ILZA 2V4JA 4TYBA 4OYAA 3QWUA 1S6QB 2IAJB 5DRKA 2AQ4A 1JLQB 2XMUA 2RU9A 1RK8A 4NLQA 3D4JA 3HULA 4IUFA 5ETNA 2EFOA 2DGVA 4KSEB 2ATCB 2IFXA 2DH8A 1I94J 2BXJA 3MAAB 2JL9A 4I4BA 4B9TA 4ALZA 4W98A 3H5YA 3HSZA 3DLBA 4MIBA 2GIRA 2RRBA 2GAGC 2DO0A 2ZD1B 4ICLA 2VBZA 4Y2MA 1G2EA 2NYHA 1VCTA 3R6LB 4JI0F 3MMBA 2WOMB 1FKAF 1PC5A 1YJNS 1Q7YT 2VBYA 2XY6A 2O5DA 5LMNJ 1FF2A 2ZJPQ 2HMIA 1XN9A 1YKWA 2W2PP 1PYSB 2M70A 2V67A 2C28A 4RW6B 2W8KA 1SQEA 1XMQF 3QYYA 3O5TB 2DHAA 4UF4A 3PEJA 4F0MA 1JKHA 1SI9A 3BH6B 2R7XA 2DNHA 3PDNA 1Y9OA 4DV7F 1H0HB 5H1SV 2BJ3A 5KT2A 1UVMA 3SI8A 5KFZA 2YXLA 2RS8A 5LOQA 4CQ1A 1BHNA 2VKRA 4NA3A 2EI5A 3JS9A 1CQMA 1PC4A 2C2KB 1S1VB 3VAGA 5L1IA 3MXHP 4WYLA 4FS1A 2EFQA 1EJ7L 4EK2A 1RHUB 5J2NB 3QIDA 1M5VC 3AHPA 1WEXA 2NUUG 4LF8J 2JVOA 2DYAA 2CVEA 4ZPAA 2DCUB 1MMNA 2VL1A 2FUG9 2RT3A 4KKOB 4DL5A 4X64J 3JQMA 4P52A 4ZPCA 4Y0FA 3UNYA 1RACB 2FIUA 3NGRA 5GMEA 2NXJA 4ZP9A 1UFLA 3RRKA 3NGUA 2EBEA 3BPDA 1GX5A 5CZXA 1HWUA 1MSWD 4KYZA 4LFAJ 4F3MA 2V9WA 4TU7A 4HHJA 5F8HA 1TP7A 4ZLNA 1D8YA 1KLNA 4D3GA 4LF5F 3HPOA 4W92B 1RKIA 2WB4A 3SQGB 1YSJA 2B4UA 3Q22A 3CO9A 1QLNA 5H9FJ 4ZVRB 4A47A 2GO8A 2XB2D 4QIWD 5EWGA 2QX0A 2PMHA 5A76A 3UDCA 2Z58B 3LA0A 3N4WA 3GB0A 4KQZA 2VG7A 2C2DA 1S12A 3NAHA 4B3RF 4YHHJ 4DX5A 1NU4A 4I67A 1Q8BA 4DPUA 2M3DA 3WDOA 2CPYA 1FHTA 3D1HA 2VPZB 3ETMA 2DNOA 2DGXA 1Q16B 4USWA 2DIUA 1HBNB 5J1EB 3I5CA 1E6YB 3UD3P 3NG8A 2AJ0A 3EGWB 1MU2B 4UOFA 1RUSA 3FBEA 2B8PA 3LOUA 1TR0A 1QVFR 5HP1A 5HLFA 1BE4A 2EC2A 3A12A 3CCUS 4LF7J 4ECXA 4IQXA 1JLGB 1VS3A 4RNMA 4LVNP 4LVOP 2NPIA 4I1TA 3CIMA 1UPPA 2P6TA 4I2QB 2H54B 1D09B 2V4QA 1H7XA 2QMUB 2KB2A 3P4UB 4QWBA 2FPHX 4YR2A 2IBOA 2XMKA 1TK5A 1OY9A 2GJFA 4RUBA 4YUDA 1FKPB 1R8CA 3TQ1A 4M1KA 2CIMA 3GG1A 1KONA 3IC1A 5D3GA 1S1WA 1WC4A 4DQPA 4PUOA 5KFNA 5AXLA 2NXNA 1CULB 3HZGA 1RT3B 3KK3A 4JV2A 3OUYB 3UD4P 2EXUA 1FESA 4CT8A 1N5VA 2BJDA 1F0XA 5HN0A 3GJTB 2IM1A 4O4GA 3O44A 5KFUA 1FKOA 3FCWA 3V6HA 1JXEA 2GVZA 2HEKA 2N7YA 2E44A 2N3LA 1C0TA 1NK5A 3MMCA 1QTNB 4ZPTR 3N5FA 4RW8B 2CNLB 4ZVUB 3MPUB 3MWBA 1DARA 2DBBA 3UPFA 3EXCX 4X84A 4P72A 4JI5F 1CEZA 1U1MA 1W25A 3H8YA 2HLUA 1KDNA 2LQBA 1H2UX 5M2UA 4I2PA 4NCGB 4DR3F 3JAMU 5SUHA 5E3RA 2OGUA 5EWFA 2LDYA 4CH0S 1APSA 1U49A 3I4PA 2F40A 1ZS6A 2NLWA 2MY8A 3OVBA 1WJ9A 3GFYA 2BJ9A 5C24A 3R9LA 2OH2A 3NOGA 2XLKA 2C2EA 3Q2TC 3CMQA 4EMDA 2O66A 2EW9A 1X5OA 4B3MJ 3CDBA 4KY3A 3K8WA 1B7FA 2ZVSA 3HVTA 4DV3J 3C16B 4KGKA 3DKDA 3M2RA 4NEZA 3VGSA 1Q5YA 4LFCF 1Q4RA 3QAUA 1N54B 4DEZA 4PYDA 2XS7A 2I2YA 3DOLB 1S59A 2RQKA 3VAFA 2IIHA 3TAMB 4U9RA 4LBHA 2BJEA 4O44A 2CJKA 2WK4A 2BJ8A 1CJVA 2BEFA 2CJQA 3BQ0A 3SMZA 1X9WA 4LBIA 2NUHA 2FZCB 4UZBA 2SXLA 2XULA 3BBBA 4C48A 4TQRA 2QSWA 4KAIA 5KOXA 2UUAJ 2ZVIA 2ERRA 1WDDA 2FJVA 4J9SA 2RKIB 2E7WA 1TK8A 3UVJA 2J0SD 1NO8A 1YJUA 3R5BA 1JMTA 1DHMA 4FDFA 2FYXA 1T03A 2ZE2B 2FVRA 1G3OA 4FXDA 1S9GB 3RW6A 1OS5A 2OPPA 3LALA 4KH0B 2CNKB 3G96A 1TQLA 3LP0B 3EXYA 1TVRA 1SKSA 5KFEA 1T9UA 1H74A 3VGUA 5CYMB 3GV5B 2V2VA 5KFSA 1WWHA 4CWBA 4R0EA 3PFEA 1JJHA 4LF6J 4ED6A 4KHRA 3S01A 5H9EK 4EI2A 4PPDA 4RNNA 1CBKA 3OTOJ 1R7IA 1ZYQA 3IMQJ 4ZVEA 4DHVA 4JOUA 2MHEA 3DM2A 4CLKA 5BYSA 1CJUA 4LSZB 2VU5A 3MM9A 1REGX 4NRTA 3KHGA 5AJ3J 3BGRB 5G0RA 3UN3A 3EVWA 2KRRA 3KG1A 4DU8A 4JP8A 1TL4A 3C6TA 4NCBA 3RU0A 3U1MA 3K5NA 5A8RA 2R2TA 4OHWA 1NH8A 5DM7Q 1F2HA 3TW0A 2MKSA 3Q8UA 4CYUA 4ZCMA 1XERA 1WTFA 4TY9A 2QIFA 2GQ2A 1FD2A 1KFDA 2K3KA 5IS2A 3GIRA 4U8VA 4ELVA 1YITS 3OSPA 3QT6A 1B7YB 3NBPB 4IO1A 2JEGA 1JLBA 1VQ9S 3QAEA 2KL8A 3VV2B 2DKOB 2U1AA 2NQPA 3M2VA 4IFYA 2KRBA 4G1QA 4YB7A 1UZHA 3U27A 4CLSA 3N79A 1U1KA 1AZSA 3PIPQ 1X60A 5KFKA 4LFBJ 3MAHA 4QU7A 2ZNZA 4F02A 1KS2A 2XGQA 5A2QU 2W2OP 2DVIA 4DV5J 1NK6A 1U48A 1YGYA 1ZETA 1Y10A 5K14A 3AT1B 3VWSA 1VQ6S 5AXMA 4CH7A 3OT9A 2QC3A 2BA9A 2FHMA 2XHWA 5C42A 3ISZA 1P1LA 2LP4A 1RQ0A 3VAMA 3JAMY 2CZ4A 2E29A 4WJBA 3THTA 1RWUA 4Q2LA 3HSJA 1U1PA 3B4MA 2XI3A 4MK9A 4IG3B 3V4IA 2ZITA 5I3UA 1XQIA 4BCAA 2J6TA 3EDQB 3UW1A 2DNNA 3S8SA 3G71S 2ZZTA 1IUJA 1KC8T 1T9VA 1U09A 4HDHA 2PDAA 5IQQA 2OELA 1XMOF 3CDUA 2LFVA 1DTQB 4J90A 1UJ5A 3RW7A 3RBEA 5E7OB 4C98A 2GJIA 3X1LB 4YOEA 3GWCA 4DFKA 2MLZA 1O8BA 2CFXA 3GCXP 2NREA 1ZM3A 4WIQA 4NI2B 4KHMA 4DV4J 2J8AA 3QIPA 2JFDA 2A3JA 3TO8A 2XLIA 3M8QB 3DLLQ 2W9CB 2V9KA 5KFWA 4MK7A 4G65A 2RF2B 5EHHA 3LH2S 2BJ1A 4RW4B 4L76A 2IVFB 2RQ4A 2VIHA 4FN5A 3KWMA 1N6QB 1QY7A 3PRDA 4WU3A 5KT4A 4JI4J 1Y3KA 2L9DA 2HGNA 2YKOA 3KLFB 2GAHC 4Y00A 3PY8A 1IN0A 5CZVA 2X1AA 3A8KA 2HBZB 1I3OB 2IJFA 2HZVA 1N0UA 2MJUA 2UP1A 4NLVA 1T05A 1HBMA 4NOHA 2RILA 1GMUA 3CVKA 4AD6A 1S72S 3KK1B 1YJTA 4KBIA 3M9NB 4KHPJ 4WFZA 4USVA 1XTZA 3L4BC 3PYFA 2JC0A 2R2UA 4DL0C 4E0DA 5E3QA 1FXDA 2RD5C 3GJSB 3Q86A 1N33F 2KG1A 1T02A 5F8MA 2A0FB 4R0JA 4C11A 2EK1A 4DV0F 2NYIA 2RU3A 4QIVA 4QBUA 4OYMA 2W25A 1HQ2A 1RHJB 4B9SA 1X5TA 2WSCC 3IR6B 4O3OA 1Q86T 2UUCJ 3HHNB 5KFCA 2QGFB 4ZPBA 1RAAB 2H4WB 3DYAA 2XSFA 2OSRA 4X4PA 3HHDA 3DDIA 3F0NA 3NWGA 1Z1ZA 1RTDA 3M8YA 1WC1A 3ZXWA 3E01B 3D0HE 2UU9J 4MT1A 3AXKA 4DQIA 4QWDA 4ES2A 3E8OA 4URQU 3HHLD 4B3TJ 1RWKB 1S7HA 4RBVA 2F7VA 4LREA 4C3LA 4NLYA 3C46A 3G82B 1BMQB 3RR7A 1T95A 3MEGA 4KIAA 3ZTSA 2KHCA 1KOHA 4U8YA 1QUPA 5CYJA 1X4AA 4KR0B 4C6AA 2BABA 4KO0A 4U7UK 4KGZB 2FJAB 2WBRA 1C1CA 3M6VA 2ZC4A 4F04B 4RUHA 3W9HA 3VGVA 4E8UA 3MFHA 3JSYA 5HI7A 3IG1B 1U8WA 3KLIA 4Y2AA 3N6MA 3FRZA 2M9KA 1W2BR 2FJBB 1C2PA 1QJHA 3V5RA 2J9DA 3TX0A 1LW2A 3AOAA 2ZH8A 4MJKA 4C8ZA 2V4JB 2POKA 5L9NA 3H5SA 5DQHA 4AUKA 4DXLA 4B9NA 3FBFA 4HHUA 1HNZJ 4JI2F 5A2QY 2Y1JA 1MMLA 2O3DA 1VRQC 2YX4A 2HKEA 5I4MA 2PI4A 5HMWA 3BF4A 3D0GE 2HFSA 3OTDA 2XCPA 2HRYA 2PA3A 5LL6d 4JUZA 1U0SA 2CQBA 5LMNF 4X4NA 4OI1A 1S0VA 3MM7A 3H2VE 1T9XA 4NYPA 4P2FA 3MPDA 4ICLB 3H5UA 3MMBB 3JQKA 1REVA 4WPAA 2EPIA 3PW7A 2AWZA 2NZCA 4X4RA 2BR0A 2XS2A 4Q44A 3AFGA 4CLYA 3RR8A 3O3LA 3UWTA 2HMIB 3KTQA 3C14A 2DCLA 3VAHA 1J5EJ 1HQUA 2VPXB 5E3CA 2YX1A 4A8OA 2LECA 3EICA 2OD4A 3KUGA 1N36J 2P9EA 1JKHB 3QMQA 4N76A 2AYMA 3G2XA 2OHDA 3MM5A 3SDEA 1AROP 3DFEA 1J5OA 1YZ6A 2X3DA 3SBMA 2LEAA 4QYRA 1Q82T 5KG2A 2A1BA 4R8UA 4YB6A 2DXEA 4J9PA 4K4XA 2PA8D 1Y5IB 3BR8A 2MZJA 4CLLA 3FZ2A 4Z7YA 4B3OA 4CLUA 4HT7A 1K1QA 4NE9C 3PR4A 2YKMA 4DF4A 2BE9B 3D68A 4NEYA 3UR3C 2HNYA 3D6FB 4JB8B 2F9DA 2HHSA 5DJBA 4LFAF 2OEKA 1A9NB 2YWHA 1NMEB 2U2FA 3VCDA 1WKKA 1U1OA 1SVDA 3IR5B 3PJXA 5K20B 2R8HA 3ENVA 3OHAA 3I96A 1X7VA 4RU2A 4ED1A 4UQTA 1P27B 1HHTP 3OR1A 1RGVA 1UEUA 1H7WA 2CJXB 2AJFE 1RAFB 4UZCA 2MDAA 2BM1A 3CJTA 4PKDB 3ULHA 2MQLA 4B02A 3SV4A 2HYIB 3J7YI 1YBTA 3SIPB 5HJYA 1X0FA 2RUGA 2YKNA 4OYZA 1WSVA 1HI1A 2IYGA 3ETOA 4DDFA 2WCXA 4J9OA 4I56A 3TUPA 4UW2A 4GO5X 5JVHQ 3DN9A 1BGXT 2MSSA 5H9FK 3CD5A 2VG7B 1OYEA 3CCLS 4QU6A 4EEYA 2ZJQQ 4Q43A 5AE1A 3TZXA 1B64A 1VBYA 2JLGA 1K0TA 4EZ9A 4HTJA 4OHZA 3IA0A 3M05A 1X5PA 2LA4A 2E5IA 2HHUA 2MZSA 2HNZA 4LF7F 3SCLE 3W62A 5L38A 1ICEB 5HQ8A 4FP9A 1VQ5S 1QAJA 1TKXA 1XIQA 2FTRA 3WZ0A 1FX2A 2RDJA 5A8KA 5HP1B 4KTQA 3K17A 5HLFB 1ELOA 3T5JA 2OJ3A 3VAKA 3GYNA 4H54A 4CLZA 4CT9A 1SKWA 3SFUA 5K8NA 1OMSA 1URRA 4QPTA 2VG5A 1IM4A 1TKTA 3JSRA 3D7SB 4OI3A 1O5JA 1HI0P 1X31C 2L9NA 4NCAA 3BYPA 4KT0C 5CYQA 2E7XA 3FMBA 1QSLA 3CDAA 3TANA 3P6YC 1FRIA 2BV3A 5IT9U 1LWXA 5E2QA 1WI6A 4F3OA 1KBRA 2W4PA 5D3GB 2FLPA 1S1WB 1F2GA 2OUGA 3RRGA 4PUOB 4DG1A 3BKUA 3FNNA 3S6EA 4UOCA 2R7UA 3KK3B 2P9GA 3WX4A 4IOAQ 2HAFA 2KG0A 3HM9A 4HDGA 5HK4A 2QO3A 4I6YA 3OJUA 4O4GB 3EMTA 1FKOB 4XTTA 1N52B 4DPXA 1N88A 2GVZB 1U2FA 1NPKA 3OL7A 1C0TB 1HHSA 3FUYA 5ETMA 2RQCA 4OI4A 2ABYA 2KT5A 3E51A 5K8OA 5KT6A 4EYHB 1URNA 5CA5A 2Q79A 5FD1A 2ASJA 5JMNA 1D9FA 3NAIA 2G2YA 2IY5B 4ED7A 2GVDA 5KFAA 2DHSA 1WUUA 4M5JA 3CWJA 4I2PB 5D0HA 1MLAA 3MPVA 1RT6A 3CB4A 2VDIA 4FPRA 4ZITA 2HHXA 2QLJB 4PG8A 2DIVA 3Q89A 4IH5A 2AGOA 2GHWA 4DV3F 1S49A 1TUGB 3BYRA 3TA1A 2Y0SD 5C24B 5EX3A 3U1LA 3HFVA 1J2VA 2RJZA 3DRPA 1BC6A 4LQ3A 5LSLA 3DDKA 5MLCV 4M63A 1PYTA 2GHVC 1HQEA 2UXCJ 1KTQA 1M5SA 1DJ0A 2HIQA 3CUNA 3HSGA 1VC6A 3M2RB 3N0VA 4NZ7A 4DWIA 4LT6A 3MURP 3LANA 4YDDB 2MB0B 3KJNB 1Q8IA 7FD1A 1NSAA 4FS2A 1SV5A 3PW2A 4LF2A 4O44B 3EZOA 1OY6A 4NMXA 2AMCB 1S5ZA 5LSRA 4NLPA 2Q3PA 4Z2XA 4YDXA 2KFYA 3CSKA 3M6XA 3BJYA 3Q8YA 1LNQA 3RB0A 5LXYA 4HTIA 2PIIA 4DPWA 3A13A 3D67A 4G1PA 4FF2A 3EPIA 4ZK7M 3M30B 3U7JA 3ZFVA 4WZQA 4NLGA 2CQ0A 4QPXA 3OTCA 3UVJB 3W2VA 4RBUA 4DL2A 2V50A 4WTYA 1L3UA 1RHKB 2FY8A 1T03B 1NZ8A 4M8LA 4D3HA 2MKYA 2F63A 2AGQA 2JEJA 1VDHA 2OPPB 4N7TA 4GVBA 5F0WA 1XMQJ 3HMJG 3VZHA 3OTOF 3I9ZA 2HQDA 4Z7CA 3GSIA 3MI7X 1V5VA 2KZMA 1GMWA 4Q0BA 2KKHA 2VF3A 4DN0A 4FYYB 1TKZA 4DR1J 3TVYA 1QSYA 4KFBA 3A8EA 3JTPA 1BWEA 4J5OA 3MAQA 2N4CA 3BGFA 3AA9A 3PV8A 3N6NA 4OHYA 3BSAA 4Y2KA 3TJ9A 1DTTB 5J1NA 2CQCA 1F9EB 2AYBA 1CJUB 4EBCA 3MM9B 1RYSA 1Z4UA 4K4ZA 5G0RB 5IT4A 4C7QA 1WOPA 1C0UA 1RI7A 3C6TB 1VRTA 3H20A 5A8RB 1UWBA 2RB7A 1YJ9S 1OIAA 4ZCKA 4CYUB 1SL0A 2DH7A 1FRJA 1WC5A 3IBCB 5GMKa 4H4OA 4ZJQA 5A8WA 5DQGA 3R2DJ 4YEAA 2VQFJ 3W8GA 5IT9Y 4DFMA 1R0BG 2W24A 4OZ0A 4RO0A 3ZTOA 4ZN3A 1NDLA 4LF5J 4CTAA 4Z37A 2XMAA 4NA2A 4DL7A 4AT1B 2AYEA 2NSBA 1JLBB 3DOKA 4E98A 5IOLA 3Q8QB 1B0VA 2JX2A 3CC2S 5HMXA 1RT7A 4K7QA 3M2VB 4IFYB 3MOJB 4K0KJ 3K5PA 5F8LA 4G1QB 4QJVA 4PEOA 2PI5A 5KFQA 2XMJA 2XY5A 3HI9A 1AT1B 2FLNA 4K4WA 2FLOA 4B3RJ 1K9MT 2IYIA 2KM8B 3KJVA 1PILA 2HURA 2YNGA 3H4DA 1X4HA 1EAYC 5B0GA 2UUWA 5ETRA 5K14B 3KFWX 2CPEA 2HNDA 4WFAQ 3RBZA 5C42B 4ZP6A 2DNLA 1U6FA 2Z8QA 2H1YA 2NXCA 2IRUA 2RUSA 2CQ2A 1PO6A 2EVZA 2YWWA 3JSBA 3V4IB 3N9UC 1YIJS 2OEJA 3M9OB 5I3UB 3JSMA 2AKWB 2ZH4A 2JEIA 4WTOB 3EVOA 2W2QP 1HW9A 2BQ3A 1YTYA 1RWPB 4DV2J 4QR1A 4KH1B 4HKQA 5AE3A 1GXTA 1SQFA 4F4KA 2CQDA 3QRQA 1RSCA 2V6AA 1WI8A 2JHEA 2G2ZA 3D9BA 3FCHA 3QIPB 2C2MB 3BKFA 3PW0A 3PYEA 3QZ8A 1RT5B 3P8BB 5M2PA 2HFOA 4K4TA 2MLXA 2LKZA 1UW4A 2MKCA 2A6MA 3FZBA 3Q2SC 4PG7A 3G9CA 1XBWA 1G1XA 4PRFA 3M6UA 4DV1J 1ULRA 1N5YA 1HKAA 3ZZ0A 3D6TB 4X4UA 2Y1LB 2I6WA 3RAMA 4KHPF 1CC8A 3KK2A 2CDQA 5GAHU 1S77D 2C2ZB 1SUQA 3POTB 3CCES 1EZZB 3BREA 3HVRA 4O3PA 4M5NA 3W64A 1Y0HA 3ZZPA 1NJYA 3C3LA 2VFTA 1T05B 1HBMB 3CF5Q 2R8KA 1CJTA 2IM3A 1RA6A 3AB4B 3RUBL 4WBFA 4ECWA 3TA0A 2MMYA 2B4VA 4TKTA 4NWBA 2NZ4A 3G8TA 2GA7A 4NLDA 1T9YA 4WFYA 2COLA 1HD0A 3KDNA 2GGPA 4C11B 2UU9F 4ILRA 1TTHB 3R7BB 5GMDA 4DFPA 2CJAA 2KHDA 1EKRA 1U25A 4CNYA 2X3GA 2MEWA 3CNQP 4RL1A 4CNZA 3M8ZA 1VQPS 1SC4B 2AYGA 5L39A 4OQJA 1WNEA 4OYIA 1HYSA 2D3ZA 3DYAB 4LFCJ 1HL6A 1CVJA 1RTDB 1IQZA 1S1UA 1UMJA 3SV3A 4C0HA 1KHVA 4AL6A 2DITA 3KYLA 4BWMA 4J9MA 4J9RA 4WIIA 2I38A 4YB1P 5L1LA 3MEGB 2V8GA 2BRKA 4AXIA 1PBAA 1GTEA 2BOPA 3GTYX 2M88A 4KO0B 1N0VC 2BUNA 2GC8A 2DEIA 4LR8A 3CJ2A 5D15A 4KGXB 2R2RA 2EG1A 2W4DA 4JI8F 1C1CB 2GQCA 1RWNB 2WVDA 2HWHA 4P2XA 5I3PA 1MG7A 5IV3A 3ISND 2E1MC 3KLIB 4QWAA 1HNZF 4IOCQ 2MZRA 1K0VA 2R7SA 2BX6A 1LW2B 2X1BA 9ATCB 1U2CA 3O8WA 2KTQA 5EN1A 5B0EA 2IJNA 3TZZA 2V0NA 2ZHOA 3BV8A 4DQRA 3HJFA 3MMAA 3R5GA 2DT9A 4CLTA 3I0RA 1HWLA 1KRPA 2V8VA 2HQCA 1LKZA 3GSDA 3WQPA 1QVGR 1IBMF 2XHCA 3MM7B 1J5EF 5ADZA 4QCLA 2WW8A 1EHWA 1XJWB 2QZ8A 1YDLA 2CG8A 5KFRA 3OW2R 2VFVA 1F1BB 1OJ4A 1X4BA 3PO4A 1REVB 4ZVFA 4QW9A 2FVCA 2FVQA 4ILMA 3C14B 1AFJA 2JOQA 3Q23A 1N5TA 2KFZA 3UI3A 3M32A 4P74A 1RAJA 3NNAA 3G86A 3GLJA 4OHVA 2XZTB 3MM5B 3I56S 2OPSA 1T9WA 1JB0C 3SDEB 3LPEA 2YWFA 4OHXA 1J5OB 1RWOB 2IPOB 4TU9A 5C7PA 3UO0A 3DLGA 4WZMA 2BKOA 4X66J 4CCHA 3MCOA 4PAAA 4R8UB 2CG4A 1R3NA 6FDRA 4ZOSA 5KG1A 5E41A 2IJRA 4B3OB 5B7WA 2D7SA 4OL8A 1DFDA 3RB3A 3W60A 2XMWA 4Q2MA 2YKMB 1T3NA 2HNYB 2C2RA 2FVPA 4DX8H 2VH7A 2KXNB 2V69A 4MYTA 2DHXA 4X62F 1BQNA 1NHKL 4CRJA 1M1HA 1KQKA 1FDNA 1EARA 2RNEA 1CQNA 4UOHA 3IP0A 2ADCA 3LGHA 3J81j 1PJ5A 2CQGA 3F41A 1TKDA 4J9QA 2QFIA 2YWEA 3UCGA 4ED5A 1JJ4A 2HBYB 4F67A 4KE5A 1FTCA 1DURA 1V5IB 3GQCA 3OR1B 3OQ2A 4NLWA 1UFKA 3PM9A 1MN9A 2J9DE 1S76D 4A8KA 2Y9HA 1B0PA 2XYPB 4FPIA 1FI4A 5HVHA 3LGMA 3H7HB 1EQMA 2BANA 4DFJA 2V4RA 3DLEB 4J9KA 4RJVA 2WVFA 1WC0A 2UV8A 3KLHA 2GZOA 1NSQA 3QRPA 3UD5A 4HHHA 2Q43A 2YKNB 3ZNUA 4ETZA 2HHTA 5HATA 1PAEX 2FHOB 1XMOJ 3GG0A 2V8DA 2VV5A 4DCOB 4LBPA 2JWNA 5B0DA 4DSIA 3PX0A 1XR7A 2ZC3A 4O3SA 4URSA 1JNRB 2D69A 4LRAA 1HNXF 3ZZUA 3L9ZA 4MKBA 2KM8C 1RTJA 2HQFA 1FFSB 1T7PA 2VFSA 3H2UB 4DSKA 5F3TA 5ETQA 2ZOGA 2HNZB 4GMKA 1RT2A 4S0MA 4ZS6A 4A8SA 4N41A 1R0AA 4WFNQ 1TKXB 4V19X 2PMZD 2BW7A 1FRKA 3T1YJ 1S7IA 3J80U 2OMLA 4JBCA 3B78A 3HX9A 3I6PA 5A8KB 3G6VA 3AJDA 2QN6B 3K5OA 4EYIB 2DNMA 2XC9A 4QR0A 5DM6Q 3PX6A 3P5TL 1S4FA 4MH8A 2W4CA 4B17A 3GIKA 1KN6A 2XWXA 3PYDA 4EO8A 1M1KT 1SKUB 3D6HB 4H4KA 1TKTB 2GW8A 4ED2A 4RUCA 2GX8A 1G4CA 5CYQB 5GADU 3MR3A 1SJFA 1RLCL 1PGZA 3QLHA 3B54A 2YH0A 4N8NA 2W8LA 4ZHRA 1FE0A 3CMAS 3R7SB 3MECA 2G0JA 3ZZRA 4DG1B 2VA2A 3R2CJ 3CJ0A 2ZWOA 4F3QA 1N33J 1SJ4P 3DC2A 2LU2A 4DV0J 3I9V9 4A8FA 4MKYA 1HHQA 1S1XA 2MXYA 3MR5A 2HGLA 5KOWA 2ZNYA 2HFUA 3NY0A 1M5OC 4DX6A 4LRFA 1KVJA 3R3TA 4C9DA 4J9UE 2XSJA 2WAQD 2FLLA 1U6BA 2JVRA 2PT0A 2XMVA 2V8HA 3KG4A 1KNZA 1FNOA 3R5AA 4LIRA 1N8RT 2GVDB 2IAJA 4NYZA 4KPYA 2YH1A 4CM2A 2YKQA 1U24A 3QO9A 4FKXA 1RT6B 1ZAWA 3BSOA 2J6UA 2QTWA 1RDRA 1LV5A 2ILYA 1EETA 1WC3A 3N01A 2VPWB 2LDIA 2XNRA 3TYTA 1IKVA 2ZBIA 3H40A 3CCTA 3UDLA 4O3RA 5IV4A 1FJEB 4OMFG 1VHIA 1HNIA 1HQEB 2H65B 3TRGA 4U67Q 3LAMA 2DJWA 2PGCA 4C8OA 3FSYA 1IKXA 2CUYA 1KR4A 1I6JA 3M1VA 3CT9A 4MK8A 1YBAA 3T3FA 2CQ1A 3A4TA 4X65F 2GIFA 5HANA 1JIHA 5SZTA 1SV5B 4EWTA 3QGPA 1IR1A 1S6PB 4JI2J 3JXOA 5CH7B 1AUDA 2AIRB 3IBFB 3ILOA 4FYDA 3LWMA 3D6MB 5B0FA 3RJMB 3IRWP 4Y3CA 2BQUA 1FTRA 4M5DA 1NH7A 4N47A 2L41A 2HGMA 1WEYA 1RISA 1K44A 2F3JA 1ZH5A 4GKKF 2WVCA 2ZH3A 4F4XA 3CJ5A 3ITHB 4USIA 5F8NA 4JV0A 3K57A 4BHQA 2HBQB 5ETVA 3W2VB 2J76E 4OX7A 1XNQJ 1ACMB 2R7VA 3HDSA 2MZTA 2CPXA 3QQCD 1OQ3A 2BM0A 2QYGA 2I5JA 4DR1F 3FSIA 4ZVHA 4GVBB 2CDRB 4CI0B 2D3OR 4F7VA 3DNCA 2CNOB 3KLEA 2CA9A 1Y4ZB 1F60B 3EVMA 4Q0BB 1GX6A 5F0UA 2J9CA 1H73A 5F9NA 2E1CA 3D5MA 3IM9A 1FJGJ 5BYQA 1BD6A 1TKZB 4ZKAA 3ZNJ1 3PTWA 5LMUJ 4KFBB 4IRDA 4JI1F 3X3UA 4F36A 1ZPVA 2XYHB 2Q66A 2MSTA 2KZZA 1CG2A 1F9HA 2XQCA 1DLOA 1HMVA 4LF9J 2AD9A 4EUVA 4K2XA 4G3IA 5IM0A 1U26A 2XG8A 4XO0A 2H5EA 3RAQA 1PYOB 5I42B 3MZIA 3FK4A 1QE1A 3Q8SB 5C2GA 3DRRA 4L3KA 3DXSX 3J80Y 2ASYA 2K7KA 3D28A 2H48B 2OFGX 3BKTA 5GAEU 4A8XA 3T5HA 1LQ9A 1IJFB 3THPA 4B3SJ 1VQ7S 1C0UB 2JSXA 2VQFF 4LQ9A 2WBMA 1UWBB 3E2EA 3TAPA 3PRBA 4FKYA 3CJRA 3A3OB 3L09A 2WTFA 5L1JA 2K06A 3HHLA 4P10A 5E3PA 2B7BB 4H4OB 3MEEA 3NS6A 4NZ6A 1VQYA 1S6OA 5CXTA 2AJ2A 1YK9A 2RSQA 4K0KF 4DX7A 4EO6A 3A3PB 4CTAB 5IZHA 4K8RA 2VJUA 1UEVA 1Q5VA 2BW2A 1X8DA 4K2JA 4L3NA 4I6WA 5KFLA 3RG6A 2AP6A 3K59A 2G4BA 1X4DA 3BPSP 3DOKB 1TL5A 4P2SA 2XO7A 2WHOA 1NEEA 3CCSS 1RT7B 2DNPA 1NAQA 1FFGB 2QMWA 2ROGA 3OR2A 2FDNA 3JQJA 3QJPA 1IR2A 1RWWB 2HZCA 1BQMA 2RE1A 3MR2A 3NCQA 2Y1IA 3R5CA 4MTPA 5FDLA 4DI6A 3UDVA 2R4FA 2EFVA 5KFMA 2CRLA 2ADBA 1TUWA 3D66A 3DI6A 4ITSA 3KJVB 4RPFA 2YNGB 1BWVA 2D1CA 2HNDB 2CVIA 5M2RA 1FKPA 4TY8A 4U96A 3MMJA 2QA1A 5J2MA 2F8HA 2OO4A 2UVRA 1RT3A 4ZPDA 2V63A 2ZKUA 5FIIA 4WXOA 4DV2F 5HO4A 2I0XA 1Q7LB 2XGPA 2O1PA 4TLQA 1TV6A 4J9LA 1VQOS 3JSMB 2G0CA 1P9QC 1SQGA 3L7OA 2G13A 4OX8A 4ANDA 5DZ6A 3GPAA 3VVTA 3R1LA 2CPFA 2YNHA 2X1FA 1VRUA 3GU0A 1X4GA 3OVSA 5CD4A 3MM8A 4ECZA 3W65A 2UZAA 4EFAC 3I32A 3KJQB 2R2SA 2GQQA 4USKA 3RBXA 4WP9A 1W26A 5KG0A 4FNHA 4WK1A 3KLGA 3US5A 1VC0A 2W2MP 2A18A 1JXLA 3BO3A 1NDKA 2QLWA 3GYGA 1LFWA 1S57A 3VTIA 2ZJRQ 4DV1F 1DZ5A 2OP5A 3TZYA 3VVUA 1F5CA 1U6ZA 1MNEA 2M5YA 3KHRA 5KG3A 3J7Z5 5G4DA 2HRTA 3IFEA 5D4NA 5K8MA 1N5YB 4RW7A 4OIXA 4IG0A 1Y3JA 3PW4A 1YLXA 3KNAA 2GMLA 2I1RA 1ZM9A 2OFHX 3PJWA 1OYDA 4TQSA 3BBFA 4ZCLA 3D1QA 1IJEB 4DBQA 2DNRA 1EP4A 1U4BA 5LSOA 1CJTB 2OD6A 3OVAA 3ET6A 1RB0A 4HI1A 3ADAC 2UVVA 5DS7A 1R6YA 3NNHA 1R89A 4PXCA 2VUGA 3GV8B 4FF1A 2DGSA 3BS9A 2FZKB 1JJCB 4ATNA 2A6OA 2GGPB 4DSJA 5B0CA 3NGDA 3QT5A 2IMWP 2RKIA 2B9WA 4KPCA 1U2RA 1RWXB 7AT1B 1U02A 2YNFA 1NM2A 5J1PA 1YJRA 2G9OA 4Q8EA 4LSNB 1HYSB 2UVWA 3NEKA 2HIYA 1S1UB 2R7TA 3FBCA 1N56A 2OTLS 3T5KA 5A0YA 4FXWA 2CAJA 4DN9A 1SJRA 3PXGa 3CJ4A 1GK8A 1OWXA 2X7IA 2B9EA 1RHQB 4ZVGA 2ZH6A 2V8PA 1XR5A 4GC7A 3ENWA 3I87A 2E5JA 2F8EX 3CMES 1NB7A 3PCOB 2IDLA 4ECSA 3MEKA 1JXVA 1WHWA 2ROPA 1J27A 2XWYA 1N4LA 1FA0A 2KO1A 3LP1A 5K9FA 1NHUA 1VBZA 1EB0A 4YY3F 3IS9A 3UR0A 4IFVA 3HD2A 5D0GA 1RBLA 1YVFA 3C15A 1RJJA 2YVSA 3D3BJ 1IKWB 2ZZMA 4Q5VA 2KH9A 1RLDA 2QT7A 4MIWA 1HWIA 2ZH5A 3JB9k 2VBXA 1T3OA 3RAXA 2DR8A 3FVYA 4NLRA 3EE3A 3MMAB 1PCAA 2Z4PA 3I0RB 2YPYA 1WACA 1UCNA 4RNOA 3W3SA 3OTBA 1ROFA 1H3DA 4A8WA 3DGPA 3PG9A 5CHCB 1OPIA 2DO4A 3SZ2A 2AT1B 3KMQA 5AT1B 2VG6A 2Q1LA 3TP2A 2C2OB 3KUHA 1WELA 3PNIA 3TVKA 4DQSA 3K8VA 4CLFA 4OFZA 4R5PA 5C25A 4DPYA 4X66F 3T5LA 4HLBA 4YB5A 3M32B 3NLCA 4J37A 2YY3A 4LR7A 2EFPA 1KVIA 2XTJP 2W9AA 1UTAA 3LPYA 2OPSB 2DEJA 2DGOA 5KG4A 1Q78A 4AL5A 2OKQA 1HNWF 2DRAA 2MGZA 2J8SA 5C5JA 3D3CJ 3AQPA 3DLGB 4IYQA 4ZLPA 4ZVSB 3P45B 1GQEA 3DOMA 1BY9A 3SCIE 2X51A 4DR7F 2MLYA 2YNIA 4ZJLA 4OZLA 5T14A 2R3VA 5GAGU 2MHNA 3G6YA 5DETA 1RWVB 1SC1B 2X1GA 1FVSA 3PVXA 1YG0A 5LJ5Y 7FDRA 2LXUA 4PQAA 5DDOC 4K4UA 2MYFA 2Y8WA 4K5SA 1VHFA 5LJ3Y 1L5UA 4J7CA 4FF3A 3DLJA 1S9EA 2MQOA 2IRYA 1TL7A 3PHTA 5BJRA 3I0SA 4W90B 3LGNA 2GMJA 3TJAA 2O01C 5KG5A 4DS5A 2HVZA 3CXCR 1RBOB 1IWAA 4DR6J 1QTMA 2FD2A 3BDPA 3OV7A 2ZHAA 4YS2A 4RNFA 3FGVA 2HK2A 2BANB 3MUTP 1UJ6A 1SB6A 1OSDA 5D4PA 3WC2A 1EIYB 3CJ3A 3KLHB 1YJVA 4FYWB 1NSKL 2F4VF 4CO3A 2EWHA 4DR4F 1F3FA 2K1RA 3DGVA 1TAUA 5HJXA 2EEYA 2MZ1A 1RKJA 1YRXA 2ZBCA 4ECTA 1OPZA 2YKAA 2QA4G 2FC9A 4NLXA 3BN4A 4IR9A 3G6XA 1W2IA 2H9ZA 2CZ9A 1D8ZA 4QWCA 3Q8PB 1X5SA 1S0OA 1GMWD 3T9ZA 1HBOA 3G8QA 4RKUC 3T1YF 3MUMP 1GEHA 2C3UA 3H98A 1RTJB 2XYGB 2H5JB 2VONA 4TU8A 4ZIWA 1WTBA 1RT2B 3DMJA 3QPIA 1WDTA 3IWXA 1JJ2R 5D78A 2HG4A 1R0AB 3AAWB 4WE1A 2LLZA 4M5KA 3CJKA 4Y6IA 1GAOA 3CC4S 4WKYA 2VFUA 3EZUA 3CGIA 4C97A 1FEHA 2Z2YB 4RW9A 3B82A 1AYEA 5KFYA 3GIJA 1QSSA 3Q0AA 4OZ3A 3C2PA 3W9IA 3O2IA 1S0NA 4ILLA 4B9MA 1L3KA 3W5ZA 2RS2A 1I5OB 1AXQA 1WC6A 3MHYA 1NSPA 3HVAA 4DSEA 2ALZA 2AEJA 1YHQS 3FCVA 2ASDA 3HLUA 2XZWA 5BXIA 3IWNC 4OLOA 1N32J 1R8PA 3QLHB 4DJBA 4USHA 4Y2IA 4DR2F 5D8HB 5KFJA 1AFIA 4P7TA 1FO1A 2OMOA 3GR0A 3TUJC 4ZHRB 2E5LF 2HK3A 1VIOA 3MECB 4ZIVA 1KP6A 3DRXA 3R27A 5F8GA 4P75A 1QD1A 4IO9Q 2WW4A 1S1XB 1TZ0A 3DLHA 1EX8A 3IAS9 1NDCA 2AEMA 5A6WA 3K0JA 4DUTA 3LAKA 4OJ3A 3V6KA 3THVA 2XSJB 2HFNA 1FRLA 1FFWB 4XDCA 4OX6A 2XCAA 4K50A 1RTZA 3KXDA 4M5GA 3UN2A 2EKNA 1KQSR 2C3YA 2BYCA 2A2CA 4O0NA 2CADA 3FC9A 3GV7B 2ZM6J 3WBZA 3HXMA 1LW0A 3FDSA 2UUBF 4CP5A 2R8JA 3M8PA 3QO9B 1PG5B 3A8JA 2DK2A 2V5HG 2VC0A 2BDPA 3VQSA 1JLAA 4DLGA 2ACYA 4WFXA 1EETB 2B6AA 4JI8J 2OPRA 4OYXA 4DQQA 2MKKA 1IKVB 4PCQA 3RRHA 1HNIB 2QV6A 4ES1A 2H5IB 3CTRA 1CC7A 4ED3A 1IKXB 4NASA 2HPUA 3T1HF 3M1VB 3HP6A 2H3EB 3ICLA 2LQ8A 2DNKA 2IMOA 4O3NA 4YN3B 3MF5A 4IDKA 2PC6A 4TXSA 2C1EB 3TX8A 4RWXA 1S1TA 3BQ2A 4WP8A 3FEZA 3NKYA 4M5DB 2M8DB 2AHOB 3TQEA 1M5HA 4NXNF 3NGKA 5GAHI 1FRHA 2RVJA 1XNQF 3M6WA 4OYBA 4DV6F 3SXLA 4C8LA 1IBMJ 1IBLJ 2RRNA 3W2WA 3RBDA 4UQGA 3NP5A 2R9LA 3V81A 1ZOTA 2L08A 3GFZA 4XDDA 4I7FA 1VOMA 2YKPA 1LK5A 1FNXH 5HVFA 4B9UA 3PKYA 3KKFA 3I31A 1PBUA 3LTOA 1FJGF 3QT8A 3CJ8A 4CO0A 2I5JB 4AQYF 5LMUF 4YFUA 4A4JA 3ZZYA 3O1LA 2M2BA 2HVHA 4U95A 5HQMA 2MQNA 4JV5F 3BO4A 1RTIA 3W63A 3KLEB 1A0OB 3IAM9 4UOGA 4BC7A 1ZPWX 4LF9F 2W7AA 6FD1A 4OZ2A 3NGTA 3RZAA 2VD3A 4H4MA 3AJ2A 2IHR1 3PACA 3SFGA 3HFKA 3AB2B 5D77A 3V4MA 4B3SF 3NXZA 3W1YC 1DLOB 4HEA9 1HMVB 1UA1A 5BR8J 2ZOMA 4C3MA 1FEEA 5IM0B 5KTQA 3CC7S 2BZ2A 1QE1B 3DRRB 1C4AA 1Y00A 2ROEA 1UEKA 4DL6A 2XO6A 3HK2A 1BLUA 3HJVA 4XAKA 5D6GA 2WONA 4X62J 3CO0P 3AA8A
chains in the Genus database with same CATH topology
1UKUA 4BDPA 3EYZA 1NK6A 1U48A 2RNEA 1YJWS 1CQNA 2CKWA 1YGYA 5A8WB 1ZETA 2OPQA 2DNGA 2N7CA 2ADCA 1CSJA 5K14A 1HBNA 2HW3A 3VWSA 5J1EA 1VQ6S 2CQGA 3F41A 3HKWA 5AXMA 4CH7A 1E6YA 1TKDA 4J9QA 3Q24A 2CPIA 4K59A 4MKAA 2VA3A 4WF9Q 2BA9A 1JX4A 2DR5A 4R25A 1SKRA 2FHMA 2YWEA 5FJ4A 3UCGA 4ED5A 2XHWA 3HHLB 3PHEA 5C42A 3ISZA 5KFTA 1JJ4A 1P1LA 4DOZA 4F67A 1RQ0A 1U1LA 4KE5A 1MU2A 1FTCA 3VAMA 1DURA 3JAMY 3GQCA 4C4WA 2CZ4A 2E29A 3OR1B 4WJBA 3MEEB 3THTA 3OQ2A 4NLWA 1RWUA 2ZKTA 4OI2A 3PM9A 2J9DE 4Q2LA 1U1PA 1S76D 4ZP8A 3B4MA 2KI2A 1UAWA 4A8KA 2XI3A 4MK9A 2K7JA 4IG3B 1B0PA 2HFZA 3V4IA 1RT4A 2ZITA 5I3UA 3LGMA 4BCAA 2J6TA 1UVIA 2BANA 3MEDB 4DFJA 1JLGA 1HR0F 3UW1A 2DNNA 2C42A 3DLEB 2V4RA 4J9KA 1Y5NB 3S8SA 3G71S 2ZH2A 2UV8A 2E1AA 3QGHA 3KLHA 1IUJA 1KC8T 4F4WA 3AQOA 2Q43A 1U09A 4Q45A 4HDHA 2YKNB 2Q6BA 4ETZA 2HHTA 4I2QA 1SIWB 2PDAA 1YQHA 5IQQA 3KOAA 4XPCA 4ZCIA 1XMOF 2CQ3A 3CDUA 5K8PA 1LWEB 3AH6A 2FHOB 2BBEA 1DTQB 5HBMA 2C22A 3GG0A 4F8RA 1UJ5A 2V8DA 2VV5A 3HVWA 4FXVA 3RW7A 3RBEA 5E7OB 4C98A 3OR2B 4LSLB 2GJIA 1BQMB 2JWNA 3X1LB 1S97A 3FRYA 3TVZA 4YOEA 2B51A 3BGUA 3KLVA 3GWCA 4DFKA 2J9EA 1O8BA 5B0DA 2W7PA 4DSIA 4DV4F 2CFXA 3PX0A 2NREA 1XR7A 1UVKA 1ZM3A 4ID8A 4OV1A 2ZC3A 5FDLB 2QA2A 2VFRA 4O3SA 2AX0A 4KHMA 3LUYA 2VKZG 4URSA 1JNRB 2L48A 2J8AA 3EZ5A 3TARA 2QRRA 5E5NA 3SYZA 5KFHA 4PXBA 4M94A 4FBUA 1HNXF 3QIPA 2JFDA 3DI6B 2VOPA 2A3JA 3ZZUA 3TO8A 3GE9A 4MKBA 2KM8C 1RTJA 2YQ3A 4JV1A 2XLIA 1T7PA 2CQIA 2VFSA 3M8QB 3H2UB 4DSKA 5MAOA 2QFJA 3DLLQ 3OUYA 5F3TA 2ZOGA 4XIUA 2HNZB 1D9AA 4GMKA 3OJSA 3UCUP 2KXFA 2W9CB 1RT2A 2V9KA 4O3QA 4TY8B 5KFWA 2MKHA 2EG2A 4MK7A 2DD8S 2RF2B 4ZS6A 5EHHA 4A8SA 4N41A 3LH2S 1R0AA 5CQGA 4WFNQ 1TKXB 4QZVB 4V19X 4RW4B 2PMZD 2IVFB 2Z0GA 1AW0A 1FRKA 3SEOA 2RQ4A 5DQIA 2QE5A 4XPEA 5J2MB 4FN5A 3KWMA 5H9EJ 1N6QB 4JI4F 1QY7A 3PRDA 3MM6B 3C6UA 5KFDA 5GVQA 4YR0A 2OMLA 4JBCA 4WU3A 1K73T 5KT4A 1Y3KA 2B5JB 3B78A 2QMXA 3HX9A 2HWIA 3I6PA 5A8KB 3G6VA 2L9DA 2VBWA 3K5OA 4EYIB 4QOTA 2HGNA 2DNMA 4MAKA 2XC9A 4Q8EA 4QR0A 5DM6Q 3PX6A 1TV6B 3P5TL 1MW7A 1NJXA 1S4FA 2YKOA 3D0IE 4RW8A 2RMLA 2D3UA 3KLFB 4MH8A 4Y00A 3PY8A 1IN0A 2W4CA 2VODA 5CZVA 4PXDA 4B17A 2X1AA 3GIKA 1HBUB 2FJEB 1KN6A 2IJFA 2XWXA 1RTHB 1N0UA 3HKZD 4EO8A 2OTJS 2MJUA 1M1KT 3D54A 2UP1A 2YNHB 3BSNA 4HYKA 1VRUB 3DRSA 4H4KA 2LEPA 1TKTB 4DLEA 1XEZA 3M9MB 3IN5A 2GW8A 4NLVA 4ED2A 4RUCA 2E5HA 2IM2A 3IGVA 3MM8B 3FQLA 1RA7A 1BQXA 1HBMA 4NOHA 2RILA 1T05A 2GX8A 4NCGA 1LOUA 3CVKA 4C8NA 1TFWA 2FJDB 1S72S 4F4YA 5CYQB 3KK1B 3EGNA 4ES3A 2N82B 1YJTA 5GADU 3MR3A 1NJIT 4KBIA 3M9NB 1SJFA 3ISNC 3DCAA 1U7LA 3SCKE 1DRZA 1PGZA 5F8IA 2WRMA 4WFZA 2M0GB 1GXLA 3I82A 3QLHA 4IRCA 4FBTA 1FT8A 1XTZA 2FC8A 1VI7A 2Q6CA 2YH0A 3V6JA 2BQRA 3KLGB 1S99A 4N8NA 2W8LA 2B0GA 4P7VA 3ZZZA 2B3TB 2JC0A 4ZHRA 2R2UA 1VIXA 4DL0C 2AX1A 1FE0A 1X4CA 4O4RA 4ZDNA 5KFVA 5E3QA 2J0XA 4E0DA 1FXDA 4PR6A 1A6LA 5EUHA 1V9OA 3VQTA 3MECA 5ITHA 3CMAS 2RD5C 4LUBA 2LQ5A 2O67A 3ZZRA 1T02A 3CJ0A 4DG1B 5F8MA 2KG1A 2VA2A 4R0JA 1N48A 2BRLA 3HF5A 1FNMA 1E6VB 4C11A 4F3QA 1SJ4P 3S1TA 2EK1A 2ZOFA 3DC2A 2LU2A 4DV0F 2NYIA 4Y34A 3EGZA 2GMHA 2RU3A 4QIVA 3LQVA 3RTVA 3MMCB 3I9V9 1NNDA 4QBUA 2CQHA 2MY7A 4A8FA 2W25A 3AY0A 4O23A 3BEGB 2ZDPA 4MKYA 2UUCF 2B43A 4B9SA 2FGCA 2HAIA 4NYOA 1X5TA 1S1XA 2WSCC 3IR6B 4O3OA 1Q86T 3HHNB 5KFCA 4OZNA 3V2UC 4F2RA 3VALA 3KK2B 2MXYA 3MR5A 3PW5A 1ZZFA 2HGLA 4ZPBA 5KOWA 2Y1RI 2ZNYA 4WXWA 2M52A 1M5OC 1SUQB 1WD6A 1M5PC 3DYAA 1KVJA 2XSFA 2OSRA 4X4PA 3HHDA 3NWGA 3R3TA 1GXUA 1Z1ZA 1RTDA 4C9DA 1H6KX 3DOLA 2RQMA 3E01B 2AGPA 3D0HE 4QQBA 4KJIA 2XSJA 3TAMA 5THWA 3OFHA 4DQIA 1FDBA 1FK9B 5HMYA 2WAQD 4QWDA 2FLLA 1U6BA 2JVRA 4RW7B 1TUVA 5JXSA 4ES2A 1O51A 1SL2A 2DR9A 4B3TF 3IBWA 3E8OA 2PT0A 2OAUA 2XMVA 4URQU 3HHLD 1TL1B 1KLMA 2V8HA 4IG0B 2J7UA 4HVZA 5DDQC 4PQUB 3KG4A 4OX9F 1KNZA 1S7HA 4RBVA 4IH7A 5IWAF 3TUZC 2F7VA 1FNOA 5CCMA 1NK4A 3MGJA 3R5AA 4LIRA 4LSNA 4CH1A 4MFBB 3DU6A 4C3LA 1N8RT 4NLYA 3C46A 3TUIC 3RR7A 2IAJA 4WK3A 1T95A 3IRXA 3MEGA 4NYZA 1HNVA 3KG0A 2K3IA 4KPYA 4URGA 2YH1A 4H4KC 4KIAA 2VPYB 1TAQA 5CD4H 3NCRA 2D9PA 3I55S 2YKQA 4HH1A 5K5MA 1IQTA 1EP4B 1U24A 2KHCA 1KOHA 3QO9A 4HL9A 1RT6B 3OL9A 1QUPA 2E9RX 5CYJA 3J7ZT 1ZAWA 1X4AA 4KR0B 3H5XA 1IKYB 2BABA 4KO0A 4U7UK 3BSOA 3DLKA 2J6UA 2L3MA 4PG6A 2FJAB 5KG6A 1QM9A 1RDRA 1X9MA 1LV5A 2WBRA 1C1CA 4PWDA 3M6VA 2ILYA 1EETA 3N01A 3HVTB 2ZC4A 4RUHA 1GT8A 1S48A 3MDFA 2R7WA 4C8YA 4E8UA 2DNQA 4ECVA 4FZVA 2VPWB 2LDIA 3OLAA 3F44A 2XNRA 2MPUA 3MFHA 3TYTA 1JLEB 3GFHA 3JSYA 2JJ4D 1IKVA 2ZBIA 5HI7A 3H40A 3CCTA 3IG1B 3M30A 3UDLA 4O3RA 4YR3A 3KLIA 3C8YA 1FJEB 3K2YA 4Y2AA 1U1QA 2ZE2A 3JYTB 1NK7A 2JLEA 4I68A 5B08A 2HHHF 4OMFG 1HNIA 1SC6A 1S9GA 3N6MA 3FRZA 2M9KA 2DPJA 2VC1A 1HQEB 2M4MA 1W2BR 2FJBB 3HHEA 3K58A 3TRGA 4U67Q 2XNQA 3LAMA 1C2PA 2DJWA 2PGCA 4C8OA 4B08A 2J0WA 3D1OA 3FSYA 1IKXA 1QJHA 2J9DA 3V5RA 3SCJE 3CCWA 3LP0A 1QUVA 1LW2A 1S6UA 2ZH8A 2AJQA 2DR8A 1KR4A 2YNFB 1I6JA 4A8YA 3M1VA 2ZDOA 4MJKA 3CT9A 4C8ZA 2V4JB 1HA1A 2POKA 2VASA 3H5SA 4PG5A 4MK8A 1YBAA 3ZC4A 5L9NA 3J7YU 3T3FA 1TFYA 5DQHA 1K1SA 4K4YA 2CQ1A 5CYMA 4AUKA 2HS3A 2LXIA 3CD6S 2E9ZA 4B9NA 1OQ6A 4FNIA 4X65F 2HHQA 3W7BA 2XLJA 4A8MP 1JIHA 5SZTA 1SV5B 1FXLA 4EWTA 2N4DA 4JI2F 5A2QY 3OL8A 2Y1JA 2UXDF 3QGPA 4QIEA 1S6PB 1MMLA 2O3DA 2YX4A 1IKWA 5CH7B 5A0YB 1AUDA 5I4MA 4FYDA 3UQSA 3LWMA 3CCMS 2PI4A 5B0FA 3IRWP 4Y3CA 3FEYB 3PZPA 2BQUA 1FTRA 5HMWA 3BF4A 3D0GE 1JLCA 1NH7A 4M5DA 2D9OA 1VMBA 4UUXA 4N47A 3OTDA 2L41A 3K7RA 3TR5A 2HGMA 2HRYA 2XCPA 3RB4A 1WEYA 2CQPA 1RISA 3DHXA 2YWGA 3NNCA 2PA3A 2NSCA 5LL6d 4JUZA 2CQBA 5LMNF 1OSCA 2DH9A 2F3JA 2DISA 4X4NA 2B56A 4OI1A 1ZH5A 1NK0A 4DSFA 4GKKF 4ECRA 3IO1A 4ETXA 1S0VA 3MM7A 3H2VE 3AJ1A 2ZH3A 2UV8G 4NYPA 1ZTTA 4F4XA 3CJ5A 3BGRA 1M90T 4ICLB 1SIZA 3ITHB 1MWYA 4USIA 1IR0A 3H5UA 3MMBB 2EFNA 4G6VB 4X4QA 5F8NA 2AJ4A 4JV0A 1REVA 2EPIA 3K57A 4K5RA 2HHVA 4BHQA 5DG7A 4UUWA 2AWZA 3PW7A 4X4RA 3V6DB 1DTTA 2R7RA 5GADI 5B0AA 3W2VB 2J76E 2BR0A 2XS2A 4Q44A 1C1BB 4OX7A 3RR8A 3O3LA 4OI6A 1VQLS 3UWTA 3VF0B 2HMIB 3KTQA 2DCLA 2R7VA 2KN4A 3HDSA 1TVRB 3LW5C 3VAHA 1JLFA 2MZTA 2CPXA 1HQUA 2VPXB 1SL1A 3LP1B 5B0BA 5E3CA 2YX1A 2FHJD 1OQ3A 3ZZOA 4A8OA 2ATLA 3Q8RB 1X9SA 1VQSA 2BM0A 1N36F 3IS9B 2UXBF 2LECA 2I5JA 4IFVB 4U6PA 4DR1F 2OD4A 3FSIA 4ZVHA 1UP1A 2P9EA 1JKHB 3QMQA 2HRUA 4CI0B 2D3OR 3LP2A 4N76A 2AYMA 2KJVA 1XWLA 1SH2A 4C8KA 3DNCA 2NS1B 5DO2A 2XMTA 4AE5A 3MM5A 3KLEA 1X4EA 1Y4ZB 3SDEA 1AROP 3DFEA 1NKCA 1X0PA 1F60B 3GMGA 1FE4A 3LWLA 4F26A 4LMZA 4Q0BB 1GX6A 1J5OA 5F0UA 2K2PA 2CYYA 2J9CA 3T19A 3FFIA 5F9NA 2E1CA 2FJXA 3D5MA 3JTNA 5KFIA 4NRUA 5BYQA 2LEAA 4QYRA 1BD6A 1TKZB 3ENQA 5IQ6A 1Q82T 1Q1KA 4K4VA 2PSZA 4ZKAA 2C3PA 2WB1D 4KFBB 5DG9A 3DM2B 5KG2A 2A1BA 4R8UA 3IWLA 4YB6A 4IRDA 2CJ9A 4JI1F 4J9PA 3NBPA 2EK6A 4K4XA 4CO1A 3X3UA 1ZPVA 2PA8D 1MMDA 1Y5IB 3BR8A 3GIIA 3H59A 5B09A 2Q66A 2MSTA 2KZZA 2MZJA 1CG2A 2LMIA 3CE8A 3FZ2A 4ZPVR 4AFFA 4B3OA 3FMWA 1DLOA 1HARA 1FDAA 2BE2B 2EKYA 1HMVA 4RBTA 4HT7A 2AD9A 4LJMA 1D0EA 1SJ3P 4EUVA 3DU5A 3P49B 4K2XA 4Y65A 1K1QA 5IM0A 3J81Y 4G3IA 1LFPA 1U26A 2XG8A 1P1TA 4XO0A 4NLSA 3PR4A 2YKMA 1V3ZA 4DF4A 2H5EA 3RAQA 2CPDA 1R43A 5I42B 3MZIA 3UFCX 2A2DA 1QE1A 3Q8SB 3UR3C 2HNYA 3DRRA 2MQQA 3DXSX 1KQGB 3J80Y 2F9DA 3UCZP 2ASYA 3MOZA 2K7KA 3D28A 2OFGX 2V2KA 2M7SA 2HHSA 5DJBA 5GAEU 5LXRA 5L8RC 1YRTA 4A8XA 3CCRS 4TN2A 4LFAF 3NCPA 1A9NB 2YWHA 2VG6B 2NPFA 3GYXB 3T5HA 2IRXA 1LQ9A 2W9BA 1VQNS 1IJFB 3THPA 1WG5A 4I69A 2MZQA 3SSQA 2OLWA 2U2FA 3VCDA 5DDRC 1VQ7S 1U1OA 1UVNA 1C0UB 3OXGA 1TL3B 2JSXA 4RWWA 3IR5B 3PJXA 2VQFF 4LQ9A 5F3ZA 4GO7X 1DQAA 2WBMA 3OL6A 1UWBB 3E2EA 2F8MA 3TAPA 1H2VZ 2LCWA 2APOA 3MD1A 4PPZA 3PRBA 1LK7A 3I5AA 2R8HA 3ENVA 3L09A 2WTFA 5KFBA 3OHAA 3PO5A 3MPWA 1LWCB 3I96A 4R5PB 1SXLA 5KFXA 5C25B 5L1JA 1X7VA 1FCAA 3HHLA 2ZZNA 3QGGA 5E3PA 4RU2A 4ED1A 2MKIA 3EUNA 3F73A 2JC1A 1UFWA 4UQTA 1P27B 1HHTP 3EX7B 2B7BB 4H4OB 3OR1A 4OZ5A 1RGVA 3MEEA 3NS6A 4NZ6A 1UEUA 1VQYA 1S6OA 2QLXA 1H7WA 2AJFE 4KRWA 4OJGA 2R7QA 1Y7PA 2DGWA 2RRAA 1QAXA 2MDAA 4IG3A 2LA6A 2BM1A 5CXTA 2ZH9A 2ZHBA 2RSQA 4K0KF 4M95A 4PKDB 3ULHA 2MGZB 4EO6A 2MQLA 3MEDA 4CTAB 5IZHA 4B02A 3SV4A 2PE8A 1UEVA 2HYIB 3J7YI 3CIZA 4Q8FA 2BW2A 1X8DA 2IVYA 3R1HA 1HD1A 1HPZB 1X0FA 2RUGA 2YKNA 2DNZA 3F56A 4I6WA 4L3NA 4NMLA 2AP6A 5KFLA 3K59A 4IR1A 2G4BA 1X4DA 2JRSA 2K8GA 4B9LA 1HI1A 3UNGC 2IYGA 1TL5A 3DOKB 3ETOA 1BQNB 4DDFA 2WCXA 4J9OA 4P2SA 2XO7A 1LWEA 4I6AA 4A46A 2WHOA 4I56A 1NEEA 1DTQA 3CCSS 4UW2A 4GO5X 4UY85 1RT7B 2DNPA 1MWZA 2AF6A 2YNIB 5KT3A 5JVHQ 1H98A 3DN9A 2AU0A 2JLFA 1BGXT 1NAQA 3MUVP 2QMWA 2ROGA 3BM7A 2MSSA 3MCSA 1UVJA 3OR2A 4LSLA 4RX6A 2FDNA 2VG7B 3CD5A 1P6TA 4QIGA 2VQEF 3CCLS 1R8BA 3QJPA 4QU6A 2HZCA 1BQMA 4EEYA 1VQ8S 2ZJQQ 3CCJS 2RE1A 3MR2A