2EKYA

Crystal structure of hypothetical protein mj1052 from methanocaldococcus jannaschii (form 1)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
97
structure length
97
Chain Sequence
MRKVVAEVSIIPLGKGASVSKYVKKAIEVFKKYDLKVETNAMGTVLEGDLDEILKAFKEAHSTVLNDVDRVVSSLKIDERKDKENTIERKLKAIGEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0045 protein MJ1052
publication title Crystal Structure of hypothetical protein MJ1052 from Methanocaldococcus jannaschii
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Structural genomics, unknown function
total genus 27
structure length 97
sequence length 97
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01910 Thiamine_BP Thiamine-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.930 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ekyA00
1YQHA 2IBOA 1S7HA 1SBRA 2EPIA 1VK8A 1LXNA 1LXJA 2EKYA 1S99A
chains in the Genus database with same CATH superfamily
4UT4A 4MTPA 4DBQA 3DLKB 2G2OA 4WXWA 1HMVB 1TL1A 3RRKA 2AP6A 1XR7A 2XSJB 2QZ8A 1HWKA 4UOGA 2QMUB 5A8WA 4NXMJ 1YZ7A 4J9OA 1FTRA 4ER8A 1LOUA 5C5JA 3TQEA 2LKZA 3DU5A 2VG5A 5KFSA 2DGUA 1EP4B 3D5MA 3HF5A 2GAHC 4A4JA 3G87A 1FO1A 3AA9A 3DXSX 2PC6A 5J2PA 3L95X 3DFEA 2BJ3A 3LW5C 5THWA 4P9SA 5KG3A 4ZK7M 4NOHA 2OAUA 3ZO7A 2NSBA 1KSPA 2CUYA 2H3EB 4LBPA 3IGNA 2P2CB 1WDTA 2B51A 1NEEA 4NL5A 3OXFA 3IGVA 1QJHA 1IBKF 4V1Ak 1PGZA 2V2VA 1UFKA 2IVYA 4TY9A 5IM0B 3Q8UA 3IWNC 4MFBA 3HCXA 4HHHA 5B08A 5CZXA 1LK7A 3RW6A 2M0GB 5KT7A 4IH5A 3AT1B 1E6YB 4YFUA 2XO7A 5DM6Q 3CMES 1RWOB 1LK5A 3VAFA 4DQIA 3Q8VA 1MWQA 3PNIA 4PRFA 3BH6B 2VZ9A 2BX6A 4ZS6A 2F7VA 5IC6B 5ITHA 4EUVA 2ZH1A 3DN9A 2MMYA 2FHMA 2W4DA 4RUBA 2ZDOA 3P3DA 4NXMF 3T5LA 3IR7B 3T41A 4F02A 1T9VA 3D0GE 2MDAA 1AT1B 3HVWA 1ULRA 2FDNA 3DLGA 1ZM2A 2VD3A 5F0UA 2V2KA 3PYGA 3EJMA 3PFEA 4IG3B 4QPTA 3PJWA 2E5GA 3CMQA 1X31C 2GHPA 2KH9A 4L3NA 3V6JA 4KE5A 2W24A 3VAIA 1JXLA 2D41A 3BS9A 3Q8YA 2OP5A 3GFXA 4KKOA 4YUDA 1H6KX 2IJNA 4C8LA 2BM0A 3LF0A 3G82A 2AGPA 2FLLA 2NPFA 1RTDA 2DNKA 3QJLA 2CG8A 3FQKA 1YRXA 4O4GA 2XGQA 4E0DA 5D15A 4ZCMA 2C2OB 1X0FA 1UZDA 2QLJB 3MEGB 1LW2A 2MHNA 4J7CA 1EARA 3M2UA 3FMBA 3W5YA 3Q23A 1SJ3P 3O8WA 4P73A 4K4ZA 2BOPA 4JI4J 1VIXA 4IFVA 4ZPTR 2B4OA 1VCTA 5HATA 1Y7PA 1TL4A 1RTJA 3VQSA 4OI1A 1YJNS 2C2NA 3CDBA 3A13A 5KAKA 4YB6A 1WEZA 2Z2LA 4ES2A 4NYOA 1JLGB 4N41A 5CABA 5E3AA 3KK3B 5HBMB 4ILLA 1RAGB 3EDRB 3OR1A 3UNGC 3HHDA 2GAGC 3TUZC 3Q2SC 5L1KA 2EEYA 5D0GA 3LGHA 3FZ2A 2XS5A 3Q24A 3FCHA 3CDEA 3IA0A 5D4LA 1YVFA 2JLEA 2I0XA 3GYNA 2RDDA 1RT4B 2YQ1A 3QJPA 1CLFA 2F4FA 4BDPA 3I9ZA 1RI7A 2LCWA 4NA3A 1VYAA 4NXNJ 3MEDB 3KLHB 5DDRC 4Y2MA 4MYTA 4ZPAA 1KLNA 3CIMA 3NLCA 1DQ8A 4S0MA 3OUYA 1PKUA 3GIRA 1T8EA 3AJ2A 4DPTA 4HI2A 2B9XA 1HQUA 2OKQA 2NXNA 5J2QA 1IKYB 4C7QA 5I4MA 3CJ2A 1T11A 2B9EA 1RBOB 3LANA 4QIGA 1FNOA 3NGUA 2OEMA 4JI4F 3I87A 2KT3A 4C9DA 1W2IA 2IFXA 4J9SA 5LJ5Y 3ITHA 4K4VA 1F9HA 3L4BC 3MAQA 4P2XA 3N9UC 2CQGA 4CLWA 4NRUA 1Q5YA 3JSMB 2JNJA 2KT5A 3MECB 4PG4A 4U7CA 3CUNA 4PXDA 1JK9B 4J9NA 5IT4A 1UETA 1IR1A 1NDPA 2N7CA 3AQPA 2I2YA 4U6PA 2FQQB 4WP9A 1X9MA 1WC5A 1RYRA 5C7PA 1T0TV 2C2KB 2FLPA 3FVYA 2NXJA 2AX0A 3DNCA 4NLDA 3PM9A 5KFQA 2V50A 5L1LA 4UOHA 3FSIA 1S6QA 4EWTA 4J5OA 4NXNF 2LA6A 3K58A 4B3TJ 2JSXA 1TKDA 3DC2A 1U48A 1XEZA 2JWNA 2PMZD 2B5JB 2C28A 3AY0A 3GJTB 3TAMA 3MR3A 4ZLLA 1AUDA 3NGTA 1YQHA 3NGSA 1BXNA 2WCXA 3EM1A 3L7OA 3FK4A 4DUZJ 3N79A 3R5BA 2YH1A 5GADU 1YJWS 5E0OA 3X1LB 3MXHP 3BQ0A 1Q5VA 1HNVB 2NUHA 1HBNA 2W1BA 2DH9A 2NZCA 2GX8A 4FVMA 3TARA 2EFGA 4HDGA 3JSYA 2BZ2A 4YQWA 4J9KA 3H20A 1Q8BA 4AYBD 1DARA 1MROB 5HVGA 3IM8A 4JI7J 1WG5A 2DNRA 3T5HA 3V81B 4PUOB 4OYOA 4C8ZA 2VFSA 2HRUA 2PD1A 3UR3C 1RZMA 2DHXA 1RAEB 2YQ3A 3CO0P 3N28A 1S48A 4CM0A 3P6YC 4ID8A 1UL3A 4EO6A 5IWAJ 1F1BB 3KK1A 4RBVA 3VWSA 3D0IE 2B9WA 1YJVA 2KXHA 4FZVA 2HVZA 4DPXA 1JJCB 2DNHA 3MPYA 4B3TF 1KQGB 3D67A 4IOBA 2RB7A 3N6NA 1AZSB 1DFDA 2ZC3A 4IQMA 4WU2A 1RT6B 1Y5NB 5KG5A 2GO8A 2GA7A 4OYMA 1R6VA 4LT6A 2ZUGA 1NU4A 1LWEA 4DX7A 2L08A 4DUZF 4FF4A 4Z7CA 4I2QA 1NK8A 4MIBA 2DJWA 3QZ7A 3UVJB 4A48A 3O1LA 4I4BA 2OPRA 4K4YA 4WK1A 1TFYA 2E1MC 3A12A 3Q86A 1NDKA 1UFWA 2KXNB 3R5AA 4AUKA 2M8HA 4ZP7A 6AT1B 4JI7F 5F8GA 5M2RA 4J9VA 1HW9A 4GC7A 2YY3A 1RT7B 2ZOFA 1YLXA 3RUBL 2RQCA 1RTIB 2CRLA 1P6TA 4TU9A 3P4UB 3JQKA 3BM7A 4ILRA 5IWAF 1UMJA 2YX1A 3CCES 1FXDA 1NJIT 3J80Y 2BJDA 2LEPA 3QQCD 3CCUS 3C16B 1TTHB 3N4WA 4DG1B 4GO7X 1RWMB 3NEKA 4ZPCA 2YNFA 4CH0S 2IM1A 1JJHA 3BPDA 4X4NA 2MZQA 1RWNB 2EK1A 1KFSA 4RW8A 1HHSA 3TI0A 3R5JB 4O3OA 4G3IA 7FDRA 4OX8A 2YKMB 2KM8B 2AQ4A 1CVJA 5DDQC 3CJTA 1YRUA 1RLDA 4AL7A 3TX8A 2V63A 3R7NB 1SJ1A 5E3CA 3JYTB 4PAAA 2GV1A 2HZCA 3MTJA 1WORA 1FERA 3CE8A 4MKVA 3DDNA 1GH8A 3TVKA 3QMQA 3KLFA 1KOOA 1S9FA 4U7UK 2GQQA 3SV4A 5KFJA 4NCAA 4PR6A 1PYOB 3HD1A 1VQ5S 1N33J 1XMBA 3PW5A 2XMUA 2AGQA 1RHKB 2F5GA 2JZ5A 4N47A 4XDCA 2F65A 3P49B 1Q4RA 3DOMB 5DQIA 1F60B 1WC6A 4BBYA 3FRZA 4H54A 4TN2A 4CTAA 2B4VA 3BSCA 1FEHA 2AYMA 2V34A 2KHCA 3G6XA 3NNAA 4LBHA 3B4MA 3LP0A 5A0YA 2GMJA 4W4MA 4IR1A 1OYEA 1SJFA 2W9BB 3NS5A 5DETA 5KFBA 3PKMA 4UY8T 3VZHA 3GV8B 1HNWJ 4XPEA 3QIDA 5HVHA 3GPAA 1NSAA 4C8KA 3X3UA 3LP1B 4IFYB 1U2CA 2HYIB 1LFPA 3GIIA 3DGPB 2HS3A 2B9YA 4Q2MA 3CCZA 1S1WA 3EGVA 3OLAA 2M52A 2G13A 4J9PA 2HQ3A 1PBAA 5LM7E 2C3YA 1I1GA 1R6YA 4F3OA 1CJVA 2LQ8A 2GJFA 3OHAA 1K0VA 4DSLA 3AAWB 1Q81T 4HVZA 2CQHA 2RMLA 1Y10A 4KBIA 2P9GA 3D6HB 3K57A 1N33F 2CQDA 2HRYA 4MJKA 2KFNA 2MTLA 4ED8A 4F2RA 2R7WA 2IAJB 1EIYB 2BE2B 1RWVB 2V9WA 2UV8G 3ETMA 4KHPJ 2ZNYA 4PG7A 1S6PA 1RU1A 2EFQA 3UD5A 4KPYA 2UXDJ 2VDHA 4P74A 4HDHA 3M8YA 2OTLS 4H4OB 4LSZB 2Y8YA 3AB4B 5EX3A 5HROA 2VPXB 2NCKL 1J5OB 1TFWA 2CJAA 1HLWA 3N01A 1Q8KA 1RADB 3RU0A 1HNWF 1U25A 4F04B 3RYLA 2M70A 2XSFA 2MXYA 4B3MJ 1FWLA 5J1NA 4L72B 4N77A 3K0JA 3R5DA 2DIVA 5KT5A 4RZRA 3NP5A 1WEYA 4LRDA 5J1EB 3AJ1A 2F3JA 2AYBA 3K59A 1C1BB 3MFIA 3HHNB 2GS8A 3BYPA 4DV1J 2XZDB 3N5FA 1UPMB 5B0BA 4A8WA 3MPDA 4Q45A 2AKWB 5EHHA 4XIUA 2F8MA 3CD5A 3JTOA 1UEVA 2JH3A 3QO9A 1K0TA 2VG6B 4X4UA 2J9CA 2OPPA 5G4DA 2WTFA 4QYZK 2XMMA 3EWGA 2QV6A 3PTWA 2UVRA 4U9RA 2KM8C 4DFPA 4PG5A 1HQ2A 4WFNQ 3H40A 1FK9A 4KHPF 1S7HA 2WOMB 4P71A 4Y3CA 3CC4S 1BQMB 3ONQA 5KFAA 2HHVA 3OW2R 3QATA 2UXDF 2HK3A 3K5MA 2HS0A 2CQ0A 1SBRA 4M5MA 4EZ6A 2GJIA 2VG7B 2AHOB 4OZJA 3FJ2A 4MYUA 2APOA 1N48A 1U6BA 1KDNA 2N7YA 1K73T 1YTYA 2RKIA 4NZ0A 4N8NA 1TL1B 5B09A 3M32A 4B3MF 1UWAA 3GG1A 1RAIB 5A8WB 4OHYA 4FYWB 1YBTA 4TLQA 1G1XA 3ILIA 3BZQA 4LF6J 2UZAA 4RW7A 3OVAA 2VL1A 3NCQA 3C3LA 2LA4A 4B17A 2DYAA 4ID5A 4DV1F 2KZZA 4ZVUB 2FHJA 2AJ1A 2VG5B 2NR0A 3OQ2A 1UEKA 1RSCA 4DR7J 2B3TB 5J2PB 5B0CA 1KLMA 2ATLA 3M2VA 3ICLA 1P8GA 4ECRA 3PY8A 4NLWA 1R3NA 2CDQA 4K4XA 4G1PA 2DGTA 5A6WA 1FX4A 2DCUB 4OI6A 4OZ5A 1SIZA 3NY0A 4CI0B 2XO6A 3HT3A 4K7QA 4DLGA 2A3JA 1JIHA 4LQ3A 1RAJA 1H7XA 3WZ0A 4USJC 4IDKA 1X4BA 4CRJA 2A2CA 2HVEA 3QSYB 4USUA 4MFBB 2IVMA 4DU8A 5FIIA 2OI2A 4WTOB 3B4DA 4NLXA 2W7PA 2KVQE 1U1OA 2H5JB 2DXEA 4HTJA 1TU0B 3Q8SB 2RDIA 3UDVA 2QEXS 1IR0A 4OHVA 3CJ8A 1L3VA 4JP8A 6FDRA 1X4EA 1VJQA 5CCMA 3CCRS 3RAXA 5DZ7A 2ZWOA 1VBZA 4LF6F 1SC4B 2R2SA 3M8SA 4D3GA 3DLGB 3C14A 3TZZA 2W7AA 5C2CA 4DFKA 2Q79A 4DR7F 1FJCA 3HSJA 4TY8A 2NXEA 1WF1A 3PEHA 1QY7A 4ANDA 4AE5A 3CIZA 4HL9A 2XY7A 4CM2A 4LFBJ 1X5PA 4KKOB 2ADCA 4J9QA 2GIFA 4QR2A 1VS3A 1KQSR 1BD6A 3G82B 4DL0C 4YMEA 1RTDB 4FBUA 4O4GB 1VRUA 2FVSA 1Y00A 1GX6A 2LVWA 5D78A 2KJWA 3M6VA 3IFEA 2DNZA 1LW2B 1SB6A 1O5JA 3M2UB 2GMHA 3GONA 4UOCA 4U8VA 4F4AA 1D9DA 3DLLQ 4IFVB 2Q3PA 1RTJB 4ECQA 4M1KA 2EBEA 2DITA 3DMJA 2E1PA 2R8GA 3LTOA 3A8EA 2DVIA 4NA1A 2HAIA 2BANA 2Z56B 1PILA 1GFWB 4CZCA 5C42A 3GSIA 4OYWA 1M1GA 5CYJA 1JJ4A 5GADI 3OR1B 2MPUA 3F41A 4O4RA 2UU9J 2QRRA 2L9DA 1Y0HA 3TR5A 1NB7A 2VFRA 1VDHA 3IMQJ 2Y0BB 4URSA 2FIUA 2DT9A 3TA2A 1FEEA 1R8PA 4MKAA 1C4AA 4KT0C 3HHEA 4PG6A 3DRYA 2R7SA 2HBZB 2ZBPA 5JUMA 2CG4A 2WB1D 4U67Q 4FVCA 5L1JA 4LFBF 1AFJA 1QUPA 2AMCB 3I31A 4DN0A 1YI2S 3HPOA 3T1YJ 3C6TA 3KLVA 1S99A 4FDFA 1YG0A 2KKHA 3BEGB 4LJMA 4W92B 5KFGA 3OUYB 2MLXA 4PABA 3ZZTA 2U2FA 1OY8A 2DTJA 1HQUB 3RBEA 2R8KA 5J2QB 3T1HJ 2ZH2A 3GIKA 1WSRA 1JLBA 3BGLA 2R7VA 2LXIA 4OYPA 3MAHA 5I3UA 2UUAJ 2J6TA 4IYQA 3UW1A 4F0HA 2IC3A 4X4OA 2AIRB 2N3LA 1HW8A 3AXMA 3SV3A 4LF8J 1B70B 3ITHB 2LP4A 4C8OA 3E8OA 3PIOQ 2QA4S 1WKLA 1S72S 1Z1ZA 4FF2A 2VBWA 2XYHB 4DI6A 4OX7A 2ZHBA 3CJQA 2H4WB 4Z37A 3CULA 4A8SA 1RKJA 2UU9F 5CAAA 3KNAA 4LSLA 1QE1A 3GTYX 2GC8A 2DR9A 1RA7A 4PWUA 3SBMA 3Q0AA 1Q79A 3MM8A 5AXNA 3CCVS 2X51A 2YX4A 3NBPA 4OYBA 3NWRA 4O23A 4GRSA 4ZN1A 5HJYA 3KHRA 3WC2A 4G65A 3QFHA 1LWCA 4YDDB 3OVBA 1S6QB 4DV2J 3IBFB 1XR5A 2G9OA 1CJKA 2BKPA 2PA3A 3T1YF 3NS7B 2L9WA 4LFCJ 4ZN3A 4UZBA 1X5OA 4ZVHA 3PRDA 2QG9B 4Y2CA 3TAMB 3KNGA 4CO1A 3QWUA 4NCBA 1O51A 2KT2A 3HXMA 2MSTA 2POKA 4L74A 1W7WA 5KFNA 2XQCA 2IMWP 3T1HF 1KWMA 3H2LA 3G9CA 5HO4A 2MKYA 1YJRA 1NLKL 2HZVA 4CQ1A 3L3CA 3C15A 1NK9A 2KB2A 3NNHA 1PJ5A 5GMEA 2UUAF 5F8IA 4DSFA 3HKZD 2LU2A 4O3PA 1HBNB 2VV5A 2ZHAA 4LF8F 2IA0A 2XWXA 4WF9Q 4CO0A 4OX6A 3DRRA 2GVDA 1ICEB 4I1TA 2DO4A 3VAHA 3JQMA 3OHBA 3HLUA 3TYTA 7AT1B 2Q43A 2MB0B 4C0HA 3R8YA 1KTVA 2CJBA 4DX5A 2J0WA 2ZUAA 2XMVA 3MUVP 3V4IA 1TL7A 4QZVB 2DEJA 4YR0A 5D4OA 2ZHOA 4ZHRA 3QSIA 1OSDA 3KK1B 4NLVA 1YKWA 1FFSB 5ETKA 4ED7A 2LDIA 2HS4A 1UEUA 2GQCA 2P6SA 3MR7A 4X4RA 4DV2F 1KQKA 2HAFA 3R3TA 4KSEB 1Q0NA 3GCWP 1HARA 3I5AA 5SUHA 1D09B 1QAJA 4LFCF 1KHVA 4Y6IA 1X5TA 2L3MA 4NLGA 4BS2A 4P6QA 5AT1B 3BGOP 2CIMA 1PC4A 2EKNA 2RHQB 2XBPA 3IP0A 1NKCA 2ZKTA 4FKYA 1LWEB 4P10A 1NJXA 2F4VJ 1RWWB 4I2QB 3DLHA 1J2VA 1X4FA 3I0RA 4DPWA 1N0VC 5HMWA 5CYQA 4IR9A 3HVRA 3PVXA 5KFUA 3KG1A 1Q86T 4USHA 1WHYA 4HKQA 4LRFA 2OPRB 4OJ3A 1MMNA 3D1QA 1BUXA 1UVNA 4YN3B 3J7A1 1RHUB 1HWUA 4DQSA 4KFBA 2MKIA 2HG4A 4WIIA 1DTTA 2DNPA 2BVZA 1KR4A 5E3RA 2HZAA 1WHVA 1P1TA 1R27B 4YHHJ 3M9OB 3NWGA 3TQ1A 5L39A 3K8VA 2YNFB 4ES1A 1GXTA 3BDPA 2K1RA 1XIQA 2WRMA 4RW8B 2JRSA 4CP5A 3DDIA 2RF2A 2ZBRA 3QGGA 3CD0A 3QRPA 4IUFA 3Q22A 2RD5C 1U4BA 1S9EA 1G7CB 3OJUA 1YJTA 3ZZPA 2F4VF 4PZVA 1I5OB 1S1VA 2DR8A 1CULA 2IYIA 4NYZA 4ITSA 3NL0A 2PEBA 3R2CJ 4DSJA 2E7VA 4ZPBA 3LAMA 3BQ2A 3QYYA 4XDDA 2IIHA 2AEFA 2ZEJA 4OIXA 2OIHA 3RRGA 1NHVA 3KLFB 2AT1B 3CDAA 4OL8A 4RNMA 4MKYA 1U0SA 3CMAS 5KFRA 2B0GA 3KXDA 2EFOA 4NLQA 3MUTP 3AFGA 4OYAA 2FJBB 2IDEA 2BKNA 4CO2A 2YKAA 2ZH7A 3R6GB 4ELUA 2ACMA 2AF6A 2ZC4A 2DNLA 3D9BA 4YHHF 1V3ZA 3QNWB 4CTAB 4HACA 1N5TA 3T6JA 2EBGA 4I56A 5H9EK 2E1RA 3LP0B 4MIWA 4TYBA 5A0YB 3GIMA 2EKYA 1RACB 3WQPA 2WONA 2C2ZB 1HFEL 4P2MA 3SCJE 2GVZA 4ECSA 4C3KA 1R8AA 3KHHA 2CJ9A 1Q1KA 1NHUA 2MJNA 2Y3YA 2W25A 4J9UE 3D4JA 1NM2A 3PEJA 1JJ2R 1HI8A 1ZETA 3CJ0A 1S1WB 5B0GA 2RH3A 4ZCLA 3HX9A 2DRDA 4UOFA 4MKBA 2W8KA 3DRPA 2AJ2A 2BA9A 4RUAA 3HJFA 4FPRA 3PZPA 3PYFA 2JLGA 1RT5A 3CPWR 3SSRA 1JNRB 3KTQA 4TLRA 1F2HA 3R5GA 1P27B 3E2EA 2WVBA 5FLXU 4NZ6A 3IAS9 3IRWP 3MM5A 2VQEJ 4M5GA 4DS5A 1TKTA 2HNYA 1H2UX 2CA9A 2HQCA 1S6PB 4DX8H 4AL6A 2CAJA 5K14A 5BR8J 3KUEA 4I6WA 2MJUA 3WIUA 4B9VA 4C8MA 1T9XA 1TVRA 1H2TZ 5HROB 3OR2A 5B0AA 1K8AT 1WF2A 2FVCA 3SIPB 4K50A 4LQ9A 5HP1A 2Y9HA 1A0OB 3GB0A 4M5HA 4LUBA 1O0PA 2LXFA 2IY5B 2ZH6A 5CD4A 1RU2A 5EWGA 1DTQA 3FEXB 1D8YA 2CKWA 4ECWA 2QYCA 4KGXB 1PJ6A 3PCOB 3MD1A 4JOUA 2HBYB 4OV1A 4ZKAA 3L7UA 3FBBA 1MWZA 2B4PA 2AW0A 3LGMA 3QO9B 1NPKA 2E5JA 2DR7A 2OPPB 3VCDA 3G8QA 4ZLPA 4PUOA 2BDPA 4H4MA 2C3UA 5BJRA 3QGIA 3IR6B 5KFVA 3W62A 2E1CA 1VQ8S 2E66A 3DLJA 4UTGA 2VQEF 1U45A 2BRLA 4A8MP 2XM3A 1FESA 3UD3P 1FK9B 4NLOA 3VZIA 2FY8A 2FYXA 4BWJA 2RQMA 5BR8F 3DHXA 4ZPDA 2P8IA 1PG5B 2LFVA 4AXJA 2JC0A 2KVIA 1ZPVA 3GFZA 1QUVA 3I5BA 1X4GA 2BV3A 2QMWA 4F4XA 3EDQB 1HPZA 4NLUA 3LP2A 5L9XA 2RKIB 1KD1T 3M32B 3DLBA 2RS2A 1QTNB 2VF3A 1UJ4A 3AQOA 1R8BA 2PDAA 4E8UA 1WWHA 4PWDA 1RWKB 2QIFA 1VRQC 4RW7B 4HH0A 1VC6A 1X5SA 5BXIA 3PO5A 1FF2A 1HBOA 2KN4A 4ID5B 1TZ0A 2DHSA 1FJEB 3ZZOA 3KUGA 1KN6A 3ZZZA 5F3TA 4PYDA 1LEOA 1RYSA 1HL6A 1FRMA 1IXKA 1KLMB 1C4CA 2CNOB 2C22A 3BGRA 1M1KT 5IC4B 3T5KA 2DISA 4WYLA 3MR2A 3W7BA 4EZ9A 1VQPS 1XN9A 4K2JA 3PG9A 3NG8A 4RL1A 3E01A 1ZTWA 2IM2A 1HNIA 3I9V9 4RNHA 3QZ8A 3W63A 3Q89A 1BE4A 4JV0A 3EXCX 2D3OR 4DG1A 5HANA 3HSDA 4IDKB 2CJKA 4O0IA 1KOHA 1S79A 4ECZA 4OZLA 2YPZA 3U02A 4F50A 1NB2A 1U1RA 1S4EA 4OYXA 3ZXWA 1NK5A 9RUBA 2NYIA 3RB6A 3DYAA 4HYKA 4YR3A 2XLJA 2W8LA 2P6TA 4RW4A 5ETSA 4DL7A 3FC9A 1RBAA 8ATCB 3J7Z5 1WACA 4B9LA 3M4XA 4JI5J 2FJXA 3J80U 1Y5IB 2G1HA 2PSZA 1QAXA 4DLEA 3G6VA 1H0HB 3BF4A 1VOMA 4ZVQB 3UDEA 3H5XA 3NNCA 3NCRA 4NMXA 3C14B 1NJZA 4JI2J 2ZDPA 4OZ0A 4TY8B 4ZLNA 2XZTB 2WK4A 1G6BA 2NSCA 2IPOB 2E9ZA 3G86A 1W25A 3FZBA 4ZP6A 3R7BB 4EMDA 1V3RA 2C2DA 4KY3A 1SXLA 1YITS 1TUWA 4B3SJ 4BC9A 2HHXA 2V4RA 2J0QD 2XLKA 2DXDA 4WFBQ 1QVFR 2E9TA 4RLEA 1MMLA 2GNKA 3U1MA 1VRUB 5IV4A 1RTHA 4A8OA 5GAEU 3SCLE 2B8PA 5E41A 1GNKA 4FXDA 3HSZA 3TX0A 2J7UA 4C8NA 3FFIA 1LXJA 3J81j 3AD8C 1FRKA 4KC5A 3SQGA 4NCGA 1SC3B 1EKRA 4F25A 2PO4A 1RKIA 3DMJB 1P9YA 1VJWA 3QPIA 2XYGB 2CJYB 2BANB 1WC0A 1NK7A 5C42B 1S12A 4JI5F 3MPWA 3D2WA 3GR1A 2HQIA 2HGNA 4OYZA 5IT0A 1UZHA 3I96A 2HBQB 1GTEA 2YWFA 4F4KA 3NOGA 4M94A 4JI2F 4RU9A 5IQQA 1WC4A 4KR0B 2XCAA 2MY7A 4DS4A 2X3DA 2ALZA 4Q5VA 2VBZA 3ZTSA 3G4SS 4ICLA 1XBWA 1S1TA 2L41A 4CYUA 4LR9A 2RRAA 3O2IA 3OXGA 4E2FB 3GV7B 4ERDA 4B3SF 2BE2A 2JEFA 3C6TB 4FF1A 3NMRA 4ZPWR 2LLZA 2PI5A 1UAWA 4RWWA 2K8GA 3D6MB 3U27A 1SH2A 3PX0A 3GILA 1RCXB 2EPIA 4USVA 2HHHJ 1XWLA 2VDIA 1JLBB 1VQNS 1T9UA 4EU0A 3BO3A 4B9NA 5I3UB 1A9NB 5HVFA 3ULHA 2IC3B 2CQBA 4ES3A 2FZKB 5AXMA 3IC1A 4DPUA 1SH0A 3MDFA 2V8GA 4CLUA 3DRSA 2VC1A 4HR2A 2CQCA 2CZ9A 1V6HA 2P5VA 2Q6CA 2DR6A 3MR6A 2JFDA 1B7FA 1CG2A 2MQQA 1TK0A 5CCLA 3C46A 1NKBA 2NQPA 3S7RA 2BXJA 3FBCA 2DHGA 1KEKA 4LSLB 1QE1B 1C0TA 1TKXA 5E3PA 2PA8D 2DNGA 2F8EX 3QBCA 2QE5A 1VC0A 5EN1A 3MM8B 4F3MA 3NBPB 3SMZA 3CD7A 3D6TB 3PYEA 1AUSL 2DHHA 3AD9C 2DNMA 1ITPA 5LL6d 1YK9A 2K2PA 1LWCB 5ETQA 2ASJA 1SUQA 1CJKB 1G4CA 1ZOTA 2CPIA 2DHAA 2YNIA 1A6LA 5KT2A 3PKYA 3JQJA 4I6AA 3M8PA 4I64A 2X3GA 4L6V3 2F8HA 1V5VA 4WIQA 4I67A 4MK9A 2I1RA 5J2NA 4FF3A 2R7UA 2HHHF 1VHIA 3Q2TC 2DNYA 1VQ9S 3NGKA 1WC3A 3C15B 2XCPA 1KC8T 1TMJA 4CDIA 2L9NA 3IRXA 2K7JA 1P9QC 2OPQA 4OZ1A 2IDLA 2G4BA 1HHTP 4LF4F 5A76A 2HFUA 4B02A 3W9IA 1HA1A 1B64A 3DRRB 3PRBA 3G8TA 1EZZB 2GVDB 1U47A 5HJXA 2HWIA 4R25A 4ANEA 2R8IA 1ZZFA 5I3PA 1R0AA 1RHJB 2E9RX 3M9NB 5GAGU 2QA2A 2MZ1A 4DQRA 1ELOA 1IKWA 3V4IB 1ZZNA 1TL7B 3PR4A 5LMNJ 5ETLA 1HBUA 4EI2A 4ZHRB 3ZZYA 3GCXP 1CC7A 2AZ1A 1K1QA 3VGUA 2D3O1 3QLHA 3GJQB 4K8RA 3SCKE 1SPBP 4J37A 4B9TA 5KFKA 1NPRA 4MIAA 3A3OB 1N8RT 4TVAB 2H1YA 3OL7A 1SL2A 4QYZJ 2DNQA 3RAMA 1X4HA 1PCAA 2KHDA 2CWXA 3L9ZA 2YNGA 4JB8B 2UUWA 1I94J 3KLIA 1OY9A 1S9GA 5MAOA 2W9CA 3TZWA 5ETPA 3IWLA 3I0RB 3RRHA 2OJ3A 5CYQB 2R7RA 2N3OA 5F8NA 4BHQA 2HLTA 3HO1A 4RW9A 2DKOB 3SYZA 4WZQA 4WFXA 3W2VA 2CNNB 1XK8A 3MF5A 3RBZA 2E5HA 2VHGA 2B43A 4UUXA 4DU7A 1LNQA 2QSFA 1D0EA 4KFBB 4DQPA 4CO5A 5GVQA 3M8QA 2YKOA 1DTTB 4UQTA 2FGCA 2ZH9A 2Z30B 5KOWA 4USWA 2VQFJ 3Q8RB 3M6XA 2V4JA 2QGFB 2KFYA 4ZP8A 2R7XA 5LMNF 2VONA 2EI5A 1HIYA 1FTCA 2OMOA 2AWZA 4D3HA 4CNYA 5ETMA 4Y2IA 4DCJB 4N5SA 2OSRA 2X7IA 2CQPA 4F0KA 1JKHA 2VKZG 4DF4A 4QU7A 4DV7J 1YDLA 2K1RB 2AEMA 3M8ZA 1AW0A 4Q7AA 2BQRA 3H5UA 2RF2B 2DY1A 4L3KA 5DZ6A 1U26A 4G1IA 2KDOA 4RBTA 2HIYA 4CO4A 2G2YA 3MOZA 3NCPA 4JV5J 1S9EB 1YX2A 4USKA 1I94F 2RJZA 3H98A 2CYYA 3P8BB 5F9NA 3BQ1A 3CF5Q 2OSQA 5A8RA 1S1VB 3PW2A 1FDBA 1NZAA 1WJ9A 2V8PA 3CDWA 1CULB 4ZVRB 2C2RA 2CQ4A 1WNEA 3W66A 5DG9A 4ED0A 1F2GA 4OV6A 5B0FA 4OQJA 2QLFB 3BKUA 2CPHA 3C2PA 3K8WA 5HMYA 3GYXB 4PG8A 3BSNA 2VASA 2DNNA 1VQ6S 1GK8A 4DZ6A 1SCJB 5EDWA 2H5IB 5LMUJ 2HHQA 2UXCJ 3CT9A 5IOLA 3ZTRA 4OFZA 4P72A 3OSPA 2JJ4D 2VQFF 2RHSB 3V6HA 3OJSA 3IS9A 1NK6A 2O5DA 3ADAC 2RQKA 3DRXA 3CC2S 5KFCA 3S01A 1TL5A 2YKQA 5KFOA 2DGXA 1IVZA 4WZMA 2WVDA 3BBFA 3J7YU 3GSDA 3PO4A 4HACB 2MKCA 1FRJA 4DL2A 2CVEA 4YEAA 3H2VE 1WEXA 1FWKA 2YQ0A 1KQFB 4CH7A 4KGMA 4DV7F 2XLIA 1E6VA 2HKEA 4A8FA 1K44A 2YWGA 2WONB 1I6JA 1DURA 1N6QA 1FRXA 4KPCA 3HK2A 5FLXY 3KWMA 2GVZB 4ECVA 4DCPB 3PIPQ 2J0SD 4JV5F 5FJ4A 2RUSA 3W5XA 1ZM4A 5LSOA 1X4CA 1KVIA 4X66J 4C11A 2V9KA 3PX4A 1WOOA 1SVDA 5L8RC 2K3IA 5D4PA 2CNLB 1S4FA 5B7WA 2Z58B 1LW0A 3DRPB 1NUEA 1VR6A 5D3GA 5D6GA 1RT5B 5F9LA 2ZOGA 4QPXA 5LMUF 1UJ6A 2BJEA 3CEDA 5F8LA 2ZKUA 1YJ7A 3MM5B 2DB1A 3MMCA 3C66A 1TMMA 1BY9A 4DFJA 1TKTB 4F36A 2HNYB 2VA2A 5AE2A 5K14B 1K9MT 2M7SA 3EPIA 1ZAXA 3TW0A 2WW4A 3VGSA 4K4UA 2F9DA 1XQIA 4N76A 2VBYA 2ZBQA 4G6VB 4DV6J 1TVRB 1BWEA 3F73A 3MPUB 1REGX 3A8KA 1NCLA 3OR2B 2YH0A 1FCAA 3H2UB 1NJYA 5HP1B 1ROFA 4W98A 4LSNA 4ZCKA 4BCAA 3FDSA 4ED5A 1R89A 1QSYA 3M1VA 2ZJQQ 3JB9k 2JHEA 2DY9A 1KVJA 4DV0J 3K2YA 4LIRA 2EC2A 2MSSA 4EYIB 3Q83A 3B82A 1DTQB 3CCTA 4X66F 4OZ3A 3DCAA 2MGZA 1N88A 4X84A 2LU1A 3F0NA 2Q66A 4DFMA 1OS5A 2N4DA 4JV2A 2WVCA 2NYHA 1ZM9A 4NA2A 4MAKA 2O66A 1VQLS 3H8YA 3I4PA 4PXBA 1H73A 5IZHA 2D9OA 1NNDA 2ABYA 4C4WA 3GWCA 4H4MB 2D69A 4X4PA 2FVQA 2W4CA 4NASA 3ILLA 1YGYA 2KXFA 4J90A 2YNHA 1YSJA 1U7LA 4F26A 2V2ZA 4EGLA 4O3QA 4RUCA 1QSSA 3UNYA 3UFCX 4AD6A 1DY3A 3VR1A 3S1TA 3AHPA 4DV6F 1DZ5A 3Q8QB 1AYEA 1C1CA 1U02A 3GQCA 1J27A 5HK4A 4L75A 3OV7A 1SIWB 1SL0A 2N4CA 2PE8A 5T14A 2HWTA 1HPZB 3LP2B 4FP9A 1BMQB 2CFXA 2FUG9 4QIVA 3DDKA 2BW2A 4DL6A 2PIIA 4ZA1A 5FD1A 3TO8A 4DV0F 5GAEI 2M5YA 2X1BA 1J5EJ 2XHWA 2OEJA 1AB8A 4PWDB 3J7ZT 4F67A 3O5TB 4BC7A 1SKSA 3PRVA 4ELVA 1GXLA 2XY5A 3J81U 4EBDA 4URQU 3T5JA 2JX2A 2OD6A 4WE1A 1HBOB 1M90T 1JNZB 4KYZA 2G1DA 4M5LA 4WBFA 3HZEA 3THPA 3OL9A 2DGQA 1X7VA 3OFEA 1QSLA 1MN7A 3GP9A 2O01C 1S49A 1ZYQA 3ZNUA 3MM9A 3BGRB 4KRWA 2J76E 3PFOA 2D7SA 1HI1A 5KFXA 3RG6A 1FD8A 2D9PA 2KI2A 3QRQA 4P2SA 4B3RJ 3E01B 4M5JA 1JLEA 1JMTA 1I51B 1HNIB 1SC6A 4GKKJ 2YVSA 1UCNA 1U09A 1FKPA 4RW6B 4FNHA 4WXOA 4HI1A 2HNDA 4AT1B 2Y8WA 3PJ9A 3BSOA 2E5IA 1CPZA 3H7HB 3GZ7A 5SZTA 2EW9A 4H4KA 5E3QA 2FVRA 5CQGA 2FJEB 3W2WA 4PWWA 3O44A 2QT7A 1TKZA 4U7UD 3DYAB 4UW2A 4USIA 1HQEA 5M2PA 2ZVSA 3CGIA 1X9SA 4PQUA 1SV5A 4RW4B 5IQ6A 5K8OA 1VIOA 1IWAA 4ATNA 4KGVB 3WHIA 2G2ZA 1I3OB 4FS2A 4A46A 1RK8A 2XMKA 1J5EF 3HP6A 2G0IA 3HHLD 2ADBA 3IR5B 1Z2LA 2RILA 3KMSA 2O3DA 3E51A 1TP7A 4IKAA 4ZVPB 4JUZA 5CD4H 2QO3A 1HYSA 1W26A 2Y1LB 3MCMA 2K06A 1YJ9S 2BQUA 1GQEA 2OFGX 1KS2A 1FKOA 3M2RA 3CJRA 1HI0P 1Z2ZA 2XMJA 1OMSA 3CJ3A 3BPSP 2ASLA 2RAQA 3W5ZA 2YWKA 3SXLA 3NMAA 1EKSA 4HHJA 4B3RF 3BH7B 4KGZB 2OPSA 3EZ5A 2DXFA 3QAUA 3OTEA 4LF5J 4B3OA 5C24A 2RU3A 3AODA 3GJRB 1GXUA 4DX6A 1LWFA 2G0JA 4Z7YA 2MYFA 1RTHB 1T9TA 4C0BA 2HGLA 2HBRB 2MQLA 4TU8A 3RGIA 3W8GA 2MKKA 4LREA 7FD1A 4I68A 4OI3A 1U2FA 1SJ4P 1RTZA 4M5DA 3FFIB 3K5NA 4RUHA 2BW7A 5F3ZA 3LH2S 1L3KA 3SQGB 3NRBA 4NCGB 4C98A 2CZVC 2FJAB 2DGWA 4OLOA 1CJUA 3NGRA 2VFTA 2Z57B 4U96A 4M8LA 2DGVA 4CH1A 2ROEA 4F4WA 4DV3J 4O44A 4FXVA 3ZNJ1 1XERA 3H25A 3CWJA 2E1AA 3RBDA 1WG1A 5MLCV 4MK8A 2LEAA 2M88A 2LECA 2VICA 1R31A 1EQ0A 4LR7A 4Q44A 1OPZA 1ACMB 5U47A 5KG6A 1FE4A 4ICLB 1B99A 5HAOA 1S1TB 4WKYA 4X4SA 1T95A 4CYUB 4RPFA 1X60A 5GAGI 4B9MA 1B3TA 4UY85 2COLA 4RNNA 3ENVA 1IBCB 5CA5A 2M3DA 1SQGA 2MZJA 2FGOA 5IS2A 1S1XA 4QYRA 4LF5F 3V5RA 3HT0A 4OHZA 4PXEA 5D8HB 2HPUA 2GHWA 3W65A 1CJTA 2FHKA 4FS1A 2I8EA 3SCIE 3D54A 3TJ9A 2EG1A 1KBRA 4ZVSB 1OY6A 2R8HA 4XAKA 2Z0GA 2DRBA 3M9MB 2AV5A 1FXRA 3UN5A 4LF1A 3IM9A 3GR0A 4WCEQ 1RWXB 2BMBA 3KJQB 3MMAA 4IRCA 3SFGA 4B9SA 5H9EJ 2FLNA 3DRSB 2EK6A 1XMOJ 4Q8EA 3CCSS 4WKRA 5AJ3J 3DXBA 3ILOA 2X1FA 2IM3A 2CVIA 4DV3F 1M5SA 4DL4A 3OLBA 1N54B 5JVHQ 4CT8A 2IA6A 1C0TB 1TKXB 3DM2A 2ZD1A 3TP2A 4P2FA 3SDEA 3NS6A 1IBKJ 2RNEA 2OMLA 3R2DJ 4BWMA 2DRAA 1UWBA 2DEIA 4NLPA 4NLTA 2QC3A 2BJ9A 4KIAA 3KK2A 3V6KA 3W64A 1SUQB 2CQ1A 2FVPA 1XNQJ 2FHOB 2B7BB 2V0NA 4NPOA 4M5IA 2YNIB 2U1AA 1T03A 3A3PB 1FKAF 3HDSA 3B8HA 1RT2A 3M8PB 4ED4A 2A0FB 3FNNA 2AJQA 2ZITA 1S1UA 3CW2C 3UR0A 1RE1B 3GYGA 6FD1A 5J2NB 1BWVA 4V19X 3V2UC 4HLBA 1U1MA 1AFIA 3JAMY 3KHLA 1IWGA 3C6UA 1JLQA 5K8NA 3IRXB 5I3QA 4JYAJ 2RRBA 3CCMS 2OPQB 5KG4A 5JMNA 2XULA 1WI8A 2WZ1A 4ETXA 1M5PC 2BKOA 1UPPA 3TVZA 1VQKS 1MW7A 1V5IB 1XMOF 1FWPA 5J1PA 5AJ3F 4ZPVR 3S6EA 1R0AB 1BHNA 5D0RA 3EGZA 2NLWA 3BREA 1UJ5A 3CJKA 1ZBTA 1H98A 1SL1A 1H3DA 1U1QA 5CYMA 1IKWB 3AXKA 4QIWD 1N52B 2DPIA 2HFSA 2W2PP 3N0VA 1TV6A 3HD2A 2D1CA 1HBUB 3RZAA 2C42A 2WBRA 3JS9A 2W2QP 1S0MA 1XNQF 3TWZA 3P96A 3QLHB 3MZIA 4FN5A 5CXTA 2CQIA 1X0PA 4R8UA 4X4TA 3I0SA 4YY3J 1JXEA 4QOTA 2QFIA 3G2XA 3I6PA 4WYWA 4EK2A 3IWXA 2GIRA 3SI8A 1TUVA 2GMLA 3J7YI 3KHGA 3IBWA 2YNGB 1N4LA 1TUGB 3KLGA 3EVMA 1FDAA 3KLIB 3FEYB 3WBZA 1S9GB 2W9CB 3H90A 2KJVA 2Z8QA 2C3PA 4JYAF 3TANA 1NAQA 4ZVFA 2MQPA 3ETOA 3MFHA 1U24A 2DK2A 4CLFA 3FRYA 1N0UA 1V3SA 4K4TA 2VC0A 2XNRA 4RW9B 2WSEC 1TELA 3W2VB 3CJ5A 2KRRA 2C3OA 5G0RA 3W9HA 3D7SB 3OTOJ 4QWCA 1DAXA 5HN0A 2SXLA 3TEGA 5HMXA 2RU9A 1X8DA 3TUJC 3M8QB 2J9EA 1S5ZA 1N5YA 3D1OA 3OT9A 2V4JB 1WTFA 1VRTA 3FSXA 3C8YA 1RGVA 4F4YA 4K5RA 1VISA 3AB2B 3HHLC 3UCGA 1JKHB 3FBFA 1DLOA 1FHTA 5IXUA 5JVGQ 3VAMA 4KO0A 5DS7A 2WHOA 3PDNA 4DSEA 2NZ4A 1REVA 4YY3F 2LMIA 3TAPA 3QT5A 1OYDA 1UA0A 1TQLA 1GMWD 1LKZA 5JXSA 5KFEA 1RQ0A 5DJBA 3GE9A 1KVKA 3AD7C 3MEEA 5A8RB 4LVOP 1NJWA 1YJUA 5DM7Q 3OVSA 2IHR1 2K3KA 3NKYA 2PFFB 3J7AN 4WPAA 3V4MA 2ZBIA 3G6ES 2ZJRQ 4DMZA 3ILJA 2DR5A 4QW8A 3OTOF 1H38A 4C3MA 2A10A 2P9CA 2HHPA 4KHMA 3KOAA 2ZZTA 3EMTA 1TK8A 4O3SA 1VK8A 4KH1B 3L09A 4CLZA 5D0EA 1M1HA 3G96A 3IS9B 2F63A 4WTYA 5DQGA 3DOKA 3ZTOA 5K9FA 4OLPA 2HQDA 3RB3A 4PKDB 1CBKA 2QL7B 2B7CB 3ISZA 1RISA 3C19A 1T94A 2VPYB 5KFDA 1P1LA 3JTNA 1E6VB 4M5NA 2V5HG 5K8MA 5HLFA 1N6QB 3R27A 3VAJA 1JXVA 1KONA 3JSRA 2BE7D 3VVUA 2XHCA 3PXGa 2J7WA 4Z2XA 2J7KA 3BN7A 2H9ZA 1DJ0A 2B8QA 5EUHA 4E98A 2J8SA 4EEYA 2EFVA 2YBVA 4C11B 1XTZA 4C48A 2V8HA 4I7FA 1GEHA 1LW0B 3KMQA 1OIAA 1U8WA 3QJJA 4V19J 3ENAA 5D3GB 3R1HA 3BGUA 4QIFA 4RU2A 4HHUA 2AU0A 4W90B 4HH1A 2IJRA 3UI3A 3UPFA 3MMCB 3RB4A 1CQMA 3M6UA 3WIVA 4X4VA 3CNQP 1GTHA 3FSYA 1RJJA 2HSEB 3HMJG 3D28A 3TUPA 2FLOA 4URGA 3UCZP 3W9JA 4Q2LA 2R3VA 5GMKa 1CC8A 1QAYA 3WDOA 3MM7A 2H65B 2CPZA 2PGCA 3MUMP 4IG0A 2GGPA 2AJ0A 3P5TL 2FJWA 1TL3A 4DWIA 4LSNB 4LRBA 2QLWA 3D68A 2B6AB 2CPEA 3M1VB 1VGYA 3HKWA 1WKKA 3GLJA 2V69A 2EC0A 2ZE2A 2Y1RI 2H54B 4PQAA 4BLGA 4TQSA 3DHWC 3U7JA 4P75A 4PPZA 2MGZB 2F9JA 5L38A 2E29A 5F8MA 2AYEA 4WFZA 4CLTA 1VQSA 2R2TA 2ZNZA 5KFWA 3CJ4A 4ALZA 3T6BA 4FPIA 1MSWD 1R43A 3K5PA 2VFVA 4DUYJ 2YNHB 3HM9A 3G71S 3UN3A 3TRGA 3V6DA 2HHSA 2XC9A 3F44A 2DH8A 2HFNA 4Q0BA 2Y0SD 4DXLA 2JFKA 3MD3A 1GT8A 3RR8A 1F5AA 4ZLJA 3J81Y 5RUBA 2UXBJ 4NEYA 2XZWA 3KJVA 3ZZ0A 3JTPA 2MQ8A 3KG4A 4WK3A 5H1SV 4YB7A 4LIWA 3ZTPA 4J9LA 3BDEA 1C1CB 1A7GE 4CLPA 2E7XA 2Q1LA 2QMXA 5A8KA 2QLBB 2GO9A 3FUYA 1ZTTA 1VC5A 3O3LA 2IRXA 1S7IA 1SKUB 5KG1A 4GKJJ 3N5BA 1UKUA 2FJVA 5AE1A 3OL8A 2KL8A 3EE3A 3FCVA 2W9AA 2EFNA 4HEA9 2Z2ZA 2GZOA 4FNIA 1KFDA 1ZAVA 3BKFA 2GQ2A 1B7YB 4OMFG 2ZBCA 1WELA 4WE1B 1LXNA 2V68A 4UUWA 1EB0A 4A8QA 3LQVA 3LPEA 2ZZMA 5H9FK 3K5LA 5KG7A 2NXUA 1F3VA 2G0CA 2D3ZA 2WW8A 2E44A 3MM9B 2JVOA 1IM4A 1TR0A 2IM0A 4YB1P 1WOPA 4HTIA 2CZ4A 3T19A 4DUYF 3MTKA 1JLEB 5AXKA 4F3QA 5KG2A 2R2UA 2LDYA 3MMBA 1FKPB 3HFVA 4PYAA 1X9WA 4Y2AA 2UVWA 3LALA 2HNDB 1UFLA 3BYRA 3EVOA 2R7OA 1ZAWA 2UXBF 3AJDA 2XEXA 2W7OA 1NMEB 2XI2A 3HVAA 4RO0A 2NXCA 1M5HA 1FX2A 4IQXA 4ZMMA 3D1HA 3W2WB 1TKZB 5HQMA 3UWTA 4ZVEA 4A47A 4XK8C 1NKEA 3VF0B 1NHKL 2BJ1A 1HQEB 2E5LJ 3FGVA 4PQUB 1SV5B 4GKJF 4LR8A 2XMTA 1JB0C 2BACA 3KFWX 1SQEA 1Q8LA 4QBUA 2LQBA 5K8PA 2VBXA 3RW7A 5L9NA 1T3NA 4LMZA 1D3WA 2AJ4A 2JEJA 2LEBA 4J9MA 1QD1A 1OJ4A 2OHDA 4C0OC 2BBEA 3I55S 1F9EB 3POTA 1ZPWX 1HYSB 1ZA1B 2KG0A 1FKOB 3L7PA 3M2RB 5IT9Y 1FNXH 4J9RA 1URNA 1WG4A 1F6TA 1H74A 5B0DA 2YX7A 2J0XA 2MQOA 2CWKA 3QRRA 3ELHA 2IJFA 1SI9A 3ENQA 1RCOB 2FPHX 2OPSB 4F7VA 1S0VA 5HL7Q 2LXUA 4IRKA 2R2RA 5DGAA 4G1QA 1BGXT 2ASYA 4B3OB 5C24B 1U2RA 3MEKA 2PFDA 1SKRA 3W1YC 4DV4J 3BO4A 1LWFB 4B08A 5KFPA 3DU6A 4QCLA 3PJXA 4O3RA 1AROP 4A8YA 2XTJP 1AA1B 1PAEX 2ROGA 5DGBA 3N6MA 5KOXA 2RRNA 1RBLA 4M5DB 2VPWB 4ZVGA 4ZVOB 1C0UA 3HI9A 2E5LF 4QR0A 5L46A 2FC8A 1T7PA 2JC1A 1MMDA 8RUCA 2EXUA 1CJUB 1GX5A 4RWXA 1JQGA 4DZDA 2V2QA 3K89A 1RHQB 1S97A 3RTVA 3U1NA 1B0VA 4Y2KA 3A3NB 3R9LA 2QFJA 4O44B 2PMHA 2I5JA 4ED1A 4KGKA 1YBUA 3MI7X 4ED6A 5DDPC 1JLFA 2F1FA 3VALA 3RAQA 1KKHA 4FKXA 4GO5X 4QWBA 3LGNA 3T9NA 4WJBA 1RAOA 1U6ZA 1HWLA 2HRTA 4NZ7A 2ILYA 1U49A 2VA3A 5DRKA 1SH3A 2CXEA 4HT5A 4HT7A 4FXWA 4O0NA 3JXOA 1FA0A 5T7LA 4AXIA 1ZM3A 1S1XB 2FZCB 1U6FA 1NDLA 3MPVA 2CPXA 4X62J 4DV4F 3IG1A 3HULA 4DSIA 1CJTB 1EAYC 4ZP9A 2BJ8A 1WKJA 2RS8A 3NAHA 1T05A 5DG7A 5K5MA 2CJQA 1DHMA 4QR1A 5J2MA 3QT8A 2HNZA 3ZZRA 2M9KA 1PYTA 3HVTA 3MMAB 3CD6S 2XGPA 3MM6A 3IBCB 2HQGA 2Z4PA 5LOQA 3D0HE 5F8HA 3TA0A 1PSDA 2NREA 4DR3J 2V94A 2HFZA 3ZC4A 3DM2B 1N56A 2ZD1B 3SDEB 3PR5B 5KFZA 2VJUA 3NAIA 3BJYA 4H4KC 1UWBB 2GHVC 1AXQA 2VH7A 1D9AA 4ANCA 2WSFC 4NX9A 3KK2B 2KYZA 5D0HA 5GMDA 1OQ3A 5GAHU 2ZH3A 3AA8A 1B4SA 2W2NP 4PEOA 1T03B 1JLAA 2YKPA 2CQ2A 2MKSA 2ACYA 3K17A 1RT2B 4N8OA 4K4WA 2MY8A 4IOAQ 3I32A 4X62F 1S1UB 1LQ9A 1MNEA 5A2QU 5I42A 1FRHA 2YWHA 4MT1A 3GMGA 3D3BJ 1VBKA 3TZYA 2QA4G 2FZGB 2KU7A 3GU0A 1R8CA 3C6UB 1DRZA 1JLQB 4N7TA 2PI4A 2OGUA 3TVYA 2BEFA 2XY6A 1UW9A 3EYZA 2HMIA 4KH0B 5F0WA 4WFYA 3BV8A 3QIPA 4KV8A 5KFMA 4DPYA 4PXCA 1S76D 3SFUA 2QN6B 2RIJA 1B0TA 2HFOA 2HHWA 3VVTA 1GAOA 2FD2A 2BJ7A 1M5KC 4AQYJ 4OI4A 4JI3J 4DR4J 1V9OA 2IBKA 1F3FA 1APSA 3CJKB 2R7QA 4DR3F 1RT1A 3OSNA 5CYMB 1HNXJ 1MU2A 2XNQA 4Y34A 4DPOA 2HGMA 1EETA 1TV6B 4EBEA 4ED2A 4C8YA 3KDNA 1WSVA 5EWEA 3NGDA 3W3SA 2ERRA 2YTCA 1F0XA 1OSCA 2RVJA 2KG1A 2KFZA 1IUJA 4RW6A 5E5NA 1FJGJ 4R8UB 4DCOB 1ZS6A 3I0SB 4P7TA 1U0HA 5HQLA 4IOCQ 3DLEA 5K20B 4XTTA 3PW0A 1R0CB 2D3UA 1S57A 1RT3A 1FDDA 1XJWB 4R0JA 1O6XA 1N5QA 1JLCA 5KFHA 2MZSA 2GW8A 4F0MA 3KLGB 5KT6A 1LWXA 3TAQA 1RWPB 4NRTA 3VTIA 3D66A 4OHXA 2A18A 1YHQS 2HIQA 3SZ2A 3KJFB 4JI6J 4RNOA 4LBIA 2JDJA 3KLEA 4YP3A 2R8JA 4DN9A 4R0EA 4Y0FA 4KQZA 4OJ1A 3PHEA 2DIUA 2DNOA 1L3TA 4L76A 3GV5B 5G0RB 5M2UA 3G8SA 1VLOA 4AQYF 2GIQA 3QAEA 2J9DA 4JI3F 4DR4F 3SSQA 1SC1B 4YOEA 1R7IA 3PW7A 3HZGA 1S6OA 3THTA 2UVVA 1N5YB 1HNXF 1HWIA 3OTDA 1VRTB 2ZVIA 1BQNA 2QL9B 4X65J 3BBCA 3ET6A 1Y3JA 3R5CA 5DG8A 1FD2A 5KT3A 1M5OC 3MAAA 4LRAA 4RJVA 4QJVA 5C25A 4ENOA 1DLOB 1VHFA 4KO0B 4FBTA 1FJGF 2F40A 2A2DA 1REVB 2BOAA 4GVBA 1CS4A 2Y1IA 1FT8A 3S8SA 4KAIA 5HQ8A 1Q78A 2VIHA 4NLSA 3VAGA 1KP6A 2ZM6J 5DQHA 5C2GA 1S59A 5BYRA 2YXLA 4DEZA 4NI2A 2JLFA 3GIJA 3MEEB 2MHEA 3KG0A 4RKUC 3PACA 4JI6F 4DL5A 3E3XA 3TJ8A 2YKNA 3LPYA 5EWFA 2H48B 1XR6A 1FJ7A 4GVLA 3QWPA 2PEHA 1VQ4S 2J5AA 1UP1A 1N5VA 1IKXA 3ENWA 2VOOA 2LQ9A 4UF4A 2Q6BA 1O8BA 4I2PA 2HLUA 4KJIA 1FI4A 3FQLA 3DOKB 2H4YB 4X65F 2ROPA 3PHTA 2W01A 2VPZB 3DI6A 3TOQA 4CLSA 1VMBA 4GMKA 3NXZA 2UV8A 1U1NA 1UTAA 1PC5A 3FKBA 4UQGA 8AT1B 3I82A 1IKVA 4OX9J 4FYYB 1OPIA 1UVKA 3FEZA 5HLFB 3QGHA 3R1LA 3GFHA 3F56A 3CDUA 1NXIA 4DV5J 2WB4A 2XMAA 1URRA 2ZM6F 3FBEA 1UVMA 2CJXB 2CPFA 2EFPA 1HBMA 5KT4A 3HHLA 2NUUG 2FY1A 1QAIA 2UVUA 4IRDA 4QWEA 5DDOC 1IM6A 4JBCA 3H5SA 4N56A 4RNFA 1Q53A 2JL9A 1DQ9A 4I7FB 1Q7YT 3OFGA 4ZITA 5FDLA 1IJEB 3D6FB 3OD2A 2BM1A 2VODA 2IVFB 1RXOB 2ILZA 3DOLA 4NYPA 3UDLA 2HHUA 2Z2YB 2RE1A 1MWYA 1RP5A 2R4FA 1EX8A 3G6YA 4R5PA 4IH7A 2ATCB 4IH6A 5KFTA 1F5CA 5ETNA 4EO8A 3HSGA 3EGWB 5EX0A 2QTWA 2CPJA 3OTCA 4IO9Q 2GFFA 4FYVB 5F8JA 4DR6J 1HKAA 1UA1A 3M30A 4F2SA 5CH7B 4LF7J 1BQXA 5HI7A 4RX6A 3BO2A 4MH8A 3MM7B 1PJ7A 3DLKA 1OQ6A 4OX9F 4MMOA 1HMVA 1X4DA 3PV8A 3UQSA 4IG0B 2GGPB 3W60A 1HWJA 1TL3B 1T9WA 3EVWA 4JV1A 2XSJA 4ILMA 4Q43A 3ZFVA 2MKJA 4DV5F 2J8AA 2VB6A 2ZE2B 3R97A 2WVFA 1K47A 3DKDA 2V67A 1KHWA 3VGVA 3I5CA 3T9ZA 4F8RA 1EP4A 3ZTQA 4DOZA 3TZXA 1RDRA 3W61A 2H51B 1YIJS 1VLYA 1TAQA 2MLZA 1F5BA 3CXCR 2XS7A 2OELA 5KFLA 2XG8A 2JEGA 4DQQA 2MQNA 4M5KA 4P7VA 3CB4A 1S10A 3QFWA 2LQ5A 1L3SA 4AFFA 1RLCL 4ED3A 3VV2B 3V6DB 4OZNA 1G3OA 4Q0BB 3JAMU 4NWBA 5LSLA 2XWYA 3BBBA 3BSAA 4OYIA 5IM0A 2MKHA 1HD1A 4DR5J 4DR6F 2A6MA 4KB7A 1TK5A 3KJVB 1FFGB 1RAHB 1E6YA 5KFIA 4LF7F 2CPDA 3HHKA 5A8KB 4K59A 5LXRA 1IQZA 4TQRA 5AE3A 1VBXA 2A1BA 2VU5A 5B0EA 2HURA 1S77D 4YS2A 1LFWA 4WU3A 2HEKA 2K7KA 1KNZA 1CSJA 2DBBA 2L48A 2AX1A 2A6OA 1QTMA 3KUHA 3T1AA 1RAAB 4IG3A 5ETOA 2WVEA 4LVNP 5BYSA 5ETVA 2XYPB 2VJVA 1SJRA 4WWSA 1HNZJ 4CLKA 5DO2A 1DQAA 4C2MA 1F9FA 1Y9OA 5CHCB 3H0PA 2B4UA 3BKTA 1IQTA 4OHWA 3MURP 5LXYA 1UVJA 4RR5A 1WC1A 3OXLA 3MMBB 4YDXA 2OD4A 4DHVA 2RSQA 3AOAA 3MEGA 1QM9A 4LFAJ 4DR5F 1EHWA 4DDFA 1XMQJ 2CDRB 2BR0A 1UVIA 2D74B 3N6LA 2I38A 2UP1A 4CWBA 1S6UA 1G2EA 5IV3A 3B54A 3MCOA 1WI6A 4FYDA 1ZA2B 4CLYA 1YBAA 1N34J 2OLWA 3HFKA 5LT5A 4K5SA 2HQFA 1JLGA 3KK3A 5HBMA 4Y28C 4NEZA 1WHWA 2KO1A 4CIOA 1TAUA 1RWUA 2WSCC 4OI0A 1QDUB 4U8YA 4C97A 1H72C 3K5OA 2FB0A 4LF9J 4C6AA 1N32J 5IFMA 3EX7B 4DUTA 3B6BA 2BABA 1SJQA 2Z2MA 3POTB 1D9FA 1WF0A 1VI7A 3H5YA 2AJFE 1OWXA 2KRBA 1HNZF 1VQ7S 1RT4A 2OUGA 3MEDA 3KLHA 4PPDA 4ZDNA 1YRTA 1WTBA 3HFZB 4X2BA 2ZH5A 3QGPA 1W2BR 4M95A 5HMZA 3IAM9 2AZ3A 2EWHA 1IBMJ 2RUGA 4NMLA 4G1QB 3UD4P 1HD0A 1IKYA 5LSRA 5F41A 3EXYA 4USMA 2UUCJ 3A8JA 1B0PA 5JJBA 4LFAF 3AOBA 2MZRA 1FNMA 1HHQA 1QLNA 1T3OA 1XMQF 3ZZUA 3A1YG 3D3CJ 4MK7A 3QT7A 5GAHI 1YWXA 4NLRA 2KTQA 4YB5A 1C0UB 2QLXA 2C3MA 1XNRJ 3MWBA 2JOQA 1CJVB 1N34F 2CQ3A 1FRLA 3JSMA 1T9YA 3MECA 4QWAA 3IXQA 3U1LA 4RBUA 2OEKA 2HK2A 1Q16B 3OFHA 2M4MA 4LF9F 3HJVA 2FHJD 1N32F 3EZOA 2E7WA 2MLYA 2ZJPQ 2QYGA 2I5JB 1JWWA 5D77A 4ETZA 1FVQA 4P52A 4JI1J 1JLFB 5ADZA 2HVDA 2BUNA 2C2EA 1NSKL 3T3FA 2NPIA 4F4ZA 2UXCF 1U1PA 1U1LA 4WP3A 4CLLA 2B5JA 3M8RA 2V4QA 1NRKA 2XB2D 1UVLA 3RJMB 1M0SA 2ASDA 2DO0A 4TU7A 1IBMF 1U8SA 5T7LB 3JSBA 1NK0A 5DLGA 5BYQA 2UUBJ 2KZMA 2UUCF 1GMWA 2W2MP 3IG1B 4EBCA 1HR0J 2OH2A 4Y65A 3TUIC 1RUSA 5A6PA 1SQFA 4ECTA 3FMWA 2OTJS 1CQNA 4USTA 1HNVA 3B78A 1T05B 4DR1J 2LYVA 2PN6A 2M8DB 3H4DA 2I9SA 4CCHA 5J2MB 1XNRF 2HNZB 2B6AA 1YZ6A 2P9EA 1RHMB 3BGFA 3GJSB 1MROA 1FRIA 1DBDA 5ETRA 4ZIWA 3HVTB 2HVHA 2YWEA 3CSKA 3MM6B 4J91A 3RR7A 3V81A 1VQOS 9ATCB 3ISND 5A2QY 1VQYA 1ZH5A 4DL3A 4JI1F 2V8DA 2CADA 1WHXA 1SKWA 4ZVTB 2EG2A 4GC6A 3R7SB 1NPPA 3LAKA 3UO0A 3EPGA 3LO3A 2ZWPA 4DSKA 1T02A 3EICA 1AZSA 2VKRA 3MCNA 3A4TA 4QQBA 4IO1A 1RT6A 1R8HA 4YR2A 3CCQS 3LA0A 1NH8A 2X1AA 1JLAB 4M63A 2XS2A 4EYHB 1N5SA 1L3UA 5KFYA 5E2QA 4QU6A 3IO1A 3RBXA 2UUBF 3CVKA 4DR2J 4KTQA 3US5A 3KYLA 1HR0F 4I6YA 5I42B 1PBUA 2ZH4A 1Y5LB 2HWHA 3RB0A 4ZJQA 2DCLA 5T41A 4DR1F 1L5UA 4UZCA 1IR2A 2BE9B 3UVJA 1GMUA 4CO3A 2W2OP 3KJNB 4KHRA 3AH6A 2HMIB 2I6WA 2MEWA 4TXSA 3TNVA 2XMWA 4ECUA 2J6UA 3QIPB 4KV8B 3M7VA 2IRYA 3SEOA 3M2VB 1U1KA 2HVIA 3GG0A 3UDCA 3SSSA 3OL6A 4CNZA 5DLFA 1RT7A 1Q8IA 4B9UA 3KDOA 4ECYA 2ZOMA 1RTIA 1EJ7L 3VGTA 2PMWA 2FJDB 1RT1B 2ZFHA 4LRCA 2X1GA 1C2PA 3EUNA 3MGJA 1MU2B 2R9LA 2HFVA 2QSWA 3C16A 2WAQD 1KTQA 1FXLA 1EETB 2DGSA 3CC7S 4TNOA 4X64J 4OJGA 1PYSB 4ZJLA 4ZOSA 3UCUP 3MMJA 2YWWA 2YKMA 3I56S 3M8WA 5LJ3Y 1WD6A 1U0HB 2OFHX 3DLEB 4TYAA 1D1UA 1S0NA 1XC9A 5KFFA 1KRPA 4DR2F 1UW4A 2R42A 2MQMA 1X4AA 1RT3B 4C3LA 1Y3KA 2M2BA 4CT9A 1JLCB 1Z4UA 2DGOA 1FVSA 1RA6A 5L1IA 1NO8A 2J6SA 3JYTA 2DD8S 4OI2A 2AGOA 1D8ZA 4A8KA 4XO0A 2ZZNA 1EQMA 1H7WA 1R0BG 3PW4A 2V8VA 3OTBA 2VUGA 2QJ3A 5HSPA 3KLEB 1S0OA 4JI8J 3WC0A 1LV5A 4ELTA 5KG0A 1PO6A 3OFFA 2KYXA 4A8XA 4EFAC 4WP8A 2FTRA 1NSPA 1WUUA 1VBYA 2RDJA 3UE2A 4QW9A 2WBMA 3VHQA 2XI3A 3DOMA 3K7RA 2H5EA 1MG7A 3CCWA 5EGYA 4K0KJ 1OO0B 3FCWA 3OPKA 1BQNB 2IYGA 2C1EB 3ET6B 4X64F 2AD9A 3SQOP 2PT0A 2AYGA 3MAAB 4XPCA 1VQMS 4I69A 5C25B 2W9BA 4Q8FA 1VK3A 4GKKF 5H9FJ 2RQ4A 4QWDA 4GVBB 1IBLJ 3MR5A 5ETTA 1M5VC 3LWMA 3CCLS 1CS4B 1PIEA 3LP1A 4IFYA 4X4QA 2AEJA 4O3NA 3H59A 3O6QA 3TJAA 2GJ2A 3BN4A 2O1PA 4ZJOA 1IN0A 3UN2A 3P5BP 3DGPA 4JI0J 5IT9U 3NOCA 2Y1JA 4NI2B 4OJHA 4ZIVA 1Q82T 2CPYA 5D4NA 5E7OB 4DF8A 1RHRB 3WX4A 1NZ8A 2YKNB 5E33A 1Q7LB 1NK4A 3IN5A 4JI8F 4DJBA 2DPJA 1RABB 4AL5A 1FE0A 4FYXB 3A8IA 2R7TA 5KTQA 3CJSA 2IBOA 2BQ3A 3H4BA 2CNKB 3MHYA 1PAUB 2V6AA 3OBIA 3LUYA 4ECXA 1MLAA 2LQJA 2IAJA 2IRUA 1IKXB 2VOPA 3EGNA 4PCQA 3QT6A 3GFYA 4QIEA 4I2PB 1WDDA 4K0KF 4L73A 3M05A 1MN9A 2N82B 3CCJS 2IMOA 2JVRA 2W4PA 1FDNA 1VFJA 4H4OA 4OZ2A 3DI6B 1N36J 1WOSA 4NLYA 2BYCA 1RB0A 1IJFB 4TKTA 2ALYB 3TEHB 1J5OA 3PYDA 2QL5B 3I4HX 1IBLF 1IKVB 2NS1B 3LWLA 1GMVA 2JEIA 3DGVA 4LF4J 3R6LB 2ZH8A 5CZVA 3WX8A 3MCSA 1Q95G 2OO4A 2HHTA 4U95A 1QVGR 3CO9A 3AOCA 4JI0F 5J1EA 3TA1A 3PX6A 2QA1A 1C1BA 1NBEB 4I0WA 2HW3A 2DH7A 1HBMB 3HHLB 3KKFA 4Y00A 3THVA 4K2XA 1FFWB 2MZTA 2VG6A 1NDCA 2BRKA 3CTRA 5FDLB 2O67A 2C2MB 2UUTA 3VQTA 1JX4A 1BLUA 2QX0A 2VFUA 3H42A 1CEZA 2EVZA 3DOLB 4LF2A 2YPYA 4NE9C 2J9DE 1Y11A 3Q8PB 1RAFB 4WFAQ 3BR9A 5AXLA 4ZCIA 4R5PB 4K4SA 3VAKA 2WOMA 2FC9A 3BR8A 1BQMA 3EZUA 3P45B 2B56A 2GCFA 1NH7A 1K1SA 1Y4ZB 2VG7A 1N36F 3LOUA 3BB5A 2RT3A 3W8PA 3MOJB 3ISNC 3M30B 1NSQA 1H2VZ 1BC6A 3M6WA
chains in the Genus database with same CATH topology
2ABYA 4C4WA 5GAHU 2ZH3A 3GWCA 4MTPA 3AA8A 4DBQA 3DLKB 4H4MB 3DRRA 4OX6A 4WXWA 4X4PA 1HMVB 1TL1A 3RRKA 4I1TA 2AP6A 2FVQA 2DO4A 3VAHA 2W4CA 3OHBA 1T03B 1YGYA 1JLAA 3HLUA 2YKPA 2KXFA 2CQ2A 1XR7A 2MKSA 2YNHA 2XSJB 2QZ8A 1HWKA 2ACYA 3TYTA 5A8WA 1YSJA 1RT2B 2Q43A 1U7LA 4J9OA 1FTRA 4N8OA 2MY8A 4K4WA 4F26A 4IOAQ 4EGLA 2MB0B 4O3QA 4RUCA 4C0HA 1KTVA 2CJBA 3I32A 1QSSA 4X62F 1LOUA 1S1UB 1LQ9A 1MNEA 2J0WA 5C5JA 5I42A 2XMVA 3MUVP 1FRHA 3V4IA 2YWHA 3GMGA 4QZVB 2LKZA 3UFCX 3DU5A 4YR0A 5D4OA 2VG5A 2ZHOA 5KFSA 2DGUA 2QA4G 1EP4B 3D5MA 3HF5A 4ZHRA 3VR1A 4A4JA 1FO1A 1OSDA 2KU7A 3AA9A 3S1TA 3KK1B 3DXSX 4NLVA 1R8CA 3C6UB 3AHPA 1DRZA 4DV6F 2PC6A 1JLQB 1DZ5A 4ED7A 2LDIA 2HS4A 1UEUA 3Q8QB 2GQCA 5J2PA 2PI4A 1C1CA 3L95X 3DFEA 3GQCA 3TVYA 2P6SA 4X4RA 4DV2F 2XY6A 1KQKA 3LW5C 5THWA 1SIWB 3OV7A 3R3TA 4KSEB 5KG3A 3EYZA 1SL0A 2HMIA 4ZK7M 5F0WA 1HARA 2N4CA 4NOHA 4WFYA 2OAUA 2PE8A 2NSBA 5T14A 1KSPA 2HWTA 3I5AA 5SUHA 1HPZB 3QIPA 4KV8A 5KFMA 4PXCA 1QAJA 3LP2B 1S76D 4LFCF 1KHVA 4FP9A 3SFUA 2RIJA 2CFXA 2FUG9 4Y6IA 1B0TA 3IGNA 4QIVA 2HFOA 2HHWA 3DDKA 1GAOA 1X5TA 2BW2A 2FD2A 2L3MA 4DL6A 4NLGA 2PIIA 1M5KC 4ZA1A 2B51A 4BS2A 4OI4A 5FD1A 3TO8A 4DV0F 5GAEI 1NEEA 2M5YA 4P6QA 2X1BA 1V9OA 2IBKA 2CIMA 4NL5A 3OXFA 3IGVA 2XHWA 1PC4A 1APSA 1QJHA 1IBKF 3CJKB 2R7QA 4PWDB 2XBPA 1PGZA 3J7ZT 4DR3F 4F67A 2ZKTA 3O5TB 4BC7A 1LWEB 1RT1A 2IVYA 1SKSA 1NKCA 3OSNA 4ELVA 1GXLA 1NJXA 2XY5A 4TY9A 5CYMB 1MU2A 2XNQA 2JX2A 4URQU 4Y34A 4DPOA 5IM0B 4I2QB 2OD6A 3T5JA 3DLHA 4WE1A 3IWNC 1HBOB 4MFBA 2HGMA 1J2VA 1X4FA 3I0RA 1M90T 1JNZB 2G1DA 1EETA 1N0VC 5B08A 5HMWA 5CZXA 1LK7A 1TV6B 5CYQA 4EBEA 4ED2A 3HZEA 3THPA 3OL9A 4C8YA 2DGQA 1X7VA 5EWEA 4IR9A 3HVRA 3PVXA 5KFUA 3KG1A 3OFEA 3NGDA 3RW6A 2M0GB 5KT7A 1Q86T 4IH5A 1QSLA 2ERRA 1E6YB 1S49A 2O01C 2YTCA 3W3SA 4YFUA 4USHA 2XO7A 5DM6Q 3CMES 1F0XA 1WHYA 4HKQA 1LK5A 3VAFA 4DQIA 2OPRB 1ZYQA 4OJ3A 3PNIA 4PRFA 1MMNA 3MM9A 2VZ9A 3D1QA 3BGRB 4KRWA 2J76E 1OSCA 2RVJA 4ZS6A 3PFOA 2F7VA 2D7SA 5ITHA 1HI1A 2KG1A 5KFXA 1UVNA 3J7A1 2KFZA 4EUVA 1IUJA 2ZH1A 3DN9A 4RW6A 5E5NA 1FD8A 4R8UB 2D9PA 2KI2A 3I0SB 2MMYA 4P7TA 2FHMA 1HWUA 4DQSA 4P2SA 4KFBA 2W4DA 3E01B 2ZDOA 4IOCQ 3P3DA 2MKIA 1JLEA 4NXMF 3DLEA 2HG4A 3T5LA 1JMTA 3IR7B 1HNIB 1SC6A 4F02A 4WIIA 2YVSA 3D0GE 1DTTA 2DNPA 1U09A 1FKPA 2MDAA 4RW6B 2BVZA 3PW0A 1KR4A 2D3UA 1RT3A 1FDDA 4FNHA 3HVWA 4R0JA 4WXOA 4HI1A 1ULRA 2HNDA 2FDNA 5E3RA 3DLGA 1N5QA 1JLCA 1ZM2A 2VD3A 3BSOA 5F0UA 5KFHA 2MZSA 2E5IA 2GW8A 1CPZA 2V2KA 3KLGB 4QPTA 4IG3B 3PFEA 5KT6A 1WHVA 3PJWA 1P1TA 1R27B 3TAQA 3GZ7A 4NRTA 3M9OB 3VTIA 3NWGA 5SZTA 4OHXA 2E5GA 2EW9A 2A18A 4H4KA 2HIQA 5E3QA 1YHQS 2FVRA 5CQGA 3SZ2A 2GHPA 3TQ1A 2KH9A 2FJEB 4L3NA 3W2WA 5L39A 3K8VA 4RNOA 3V6JA 4KE5A 2YNFB 3O44A 2QT7A 1TKZA 2W24A 4ES1A 2JDJA 3VAIA 1JXLA 3DYAB 2D41A 3BS9A 4UW2A 4USIA 4YP3A 2OP5A 1GXTA 3KLEA 2R8JA 4DN9A 2K1RA 3BDPA 1HQEA 4R0EA 5M2PA 2ZVSA 3CGIA 2WRMA 3GFXA 4KKOA 4RW8B 4YUDA 2JRSA 4KQZA 4Y0FA 1H6KX 1SV5A 2IJNA 4OJ1A 3PHEA 4EBDA 1X9SA 4PQUA 4RW4B 2RF2A 2DIUA 2DNOA 1L3TA 4C8LA 2BM0A 3GV5B 5IQ6A 5G0RB 5K8OA 3LF0A 5M2UA 3G8SA 3QGGA 1VIOA 3CD0A 4ATNA 4AQYF 2GIQA 3QAEA 2AGPA 2FLLA 4IUFA 2J9DA 2NPFA 3Q22A 2RD5C 4FS2A 4A46A 1RK8A 1U4BA 4JI3F 4DR4F 2XMKA 1RTDA 3SSQA 2DNKA 1J5EF 3QJLA 3HP6A 4YOEA 1R7IA 1S9EA 3PW7A 3FQKA 3HZGA 1S6OA 1YRXA 3HHLD 4O4GA 3THTA 2ADBA 2UVVA 1G7CB 2XGQA 3OJUA 1N5YB 4E0DA 1YJTA 3IR5B 3ZZPA 2F4VF 1Z2LA 2RILA 4ZCMA 3KMSA 1HNXF 2O3DA 3E51A 1TP7A 4IKAA 1HWIA 3OTDA 1S1VA 1X0FA 2DR8A 1VRTB 4JUZA 5CD4H 3MEGB 1LW2A 2IYIA 4NYZA 4ITSA 2QO3A 1HYSA 3NL0A 1BQNA 2MHNA 3M2UA 1YJ9S 2BQUA 1GQEA 2OFGX 3FMBA 1KS2A 1Y3JA 3R5CA 3Q23A 1FKOA 5DG8A 1SJ3P 3M2RA 3O8WA 4ZPBA 1FD2A 4K4ZA 3LAMA 2BOPA 3BQ2A 3QYYA 4XDDA 1HI0P 1Z2ZA 2XMJA 5KT3A 1VIXA 4IFVA 4ZPTR 1M5OC 3CJ3A 2B4OA 1Y7PA 2ASLA 1TL4A 4OIXA 4QJVA 1RTJA 2OIHA 3RRGA 5C25A 3VQSA 4OI1A 1YJNS 1NHVA 2YWKA 3SXLA 1DLOB 1VHFA 3NMAA 3KLFB 4KO0B 3CDBA 4HHJA 3CDAA 4FBTA 1FJGF 2F40A 2A2DA 4OL8A 5KAKA 1REVB 4YB6A 4RNMA 4B3RF 1WEZA 4MKYA 2Z2LA 4ES2A 3CMAS 4NYOA 2OPSA 1JLGB 2B0GA 5KFRA 4N41A 5E3AA 3KK3B 5HBMB 2Y1IA 4ILLA 2EFOA 1FT8A 4NLQA 3MUTP 3OR1A 3EZ5A 3UNGC 3S8SA 4KAIA 5HQ8A 1Q78A 3HHDA 3VAGA 4NLSA 3QAUA 3OTEA 3TUZC 4B3OA 2FJBB 5C24A 2RU3A 3Q2SC 5L1KA 4CO2A 2YKAA 2ZH7A 1GXUA 5DQHA 4ELUA 1LWFA 5BYRA 3FZ2A 2MYFA 2AF6A 2XS5A 2ZC4A 2DNLA 1RTHB 3Q24A 4C0BA 2HGLA 4DEZA 2JLFA 3GIJA 4YHHF 2MQLA 3FCHA 1V3ZA 3MEEB 2MHEA 4TU8A 3KG0A 4RKUC 3CDEA 3PACA 3IA0A 4CTAB 2MKKA 7FD1A 4JI6F 5D4LA 4I68A 1YVFA 3E3XA 1U2FA 2JLEA 4OI3A 4DL5A 1SJ4P 1N5TA 2I0XA 4M5DA 2YKNA 3FFIB 3GYNA 2EBGA 3LPYA 3T6JA 3K5NA 4RUHA 5F3ZA 4I56A 1RT4B 1L3KA 3LH2S 5EWFA 3QJPA 1CLFA 3SQGB 2E1RA 3NRBA 1XR6A 4NCGB 4BDPA 3I9ZA 1FJ7A 3LP0B 4MIWA 4TYBA 1RI7A 2LCWA 5A0YB 3GIMA 2EKYA 4C98A 4NA3A 3QWPA 2WONA 3MEDB 2CZVC 3KLHB 2FJAB 2PEHA 1HFEL 5DDRC 1VQ4S 4Y2MA 2DGWA 4MYTA 4ZPAA 1KLNA 3SCJE 4OLOA 3CIMA 3NLCA 1DQ8A 2J5AA 4ECSA 2VFTA 4C3KA 1UP1A 3OUYA 4M8LA 1N5VA 1IKXA 1R8AA 1T8EA 2DGVA 3AJ2A 3ENWA 3KHHA 2VOOA 4HI2A 2LQ9A 2B9XA 4CH1A 2CJ9A 1HQUA 1Q1KA 2Q6BA 1NHUA 1O8BA 2MJNA 2ROEA 4F4WA 4I2PA 4O44A 4FXVA 1XERA 2HLUA 2OKQA 5J2QA 2W25A 3H25A 1IKYB 3CWJA 3PEJA 1JJ2R 4KJIA 3FQLA 4C7QA 2E1AA 5I4MA 3RBDA 3CJ2A 1HI8A 1WG1A 3DOKB 1ZETA 5MLCV 4X65F 3CJ0A 4MK8A 1S1WB 2ROPA 5B0GA 2LEAA 3LANA 4QIGA 2RH3A 2M88A 2LECA 4ZCLA 1FNOA 2VPZB 3HX9A 1R31A 3DI6A 3TOQA 1VMBA 4Q44A 1OPZA 4JI4F 5U47A 4MKBA 5KG6A 1FE4A 3I87A 2W8KA 4GMKA 3DRPA 2KT3A 4C9DA 2UV8A 4ICLB 2BA9A 4RUAA 3HJFA 4FPRA 3PZPA 1U1NA 1S1TB 1W2IA 2IFXA 2JLGA 1RT5A 4J9SA 4WKYA 1PC5A 4X4SA 4UQGA 3CPWR 1T95A 5LJ5Y 3SSRA 3ITHA 4K4VA 1JNRB 3I82A 5GAGI 3MAQA 4B9MA 3KTQA 3N9UC 1IKVA 2CQGA 4TLRA 2COLA 4RNNA 4UY85 4NRUA 1P27B 3E2EA 3ENVA 3JSMB 1OPIA 1UVKA 2KT5A 3FEZA 5HLFB 3MECB 4PG4A 4U7CA 3CUNA 4PXDA 5CA5A 2M3DA 4NZ6A 1TFYA 3IAS9 3QGHA 3IRWP 1JK9B 3MM5A 3R1LA 2MZJA 2FGOA 3GFHA 5IT4A 4J9NA 1UETA 3F56A 3CDUA 5IS2A 1S1XA 2N7CA 3AQPA 4QYRA 4LF5F 2I2YA 3V5RA 4DS5A 4OHZA 4U6PA 1TKTA 2WB4A 4PXEA 5D8HB 1URRA 1X9MA 2HNYA 1H2UX 2ZM6F 2HPUA 2GHWA 1RYRA 1UVMA 1S6PB 2CPFA 4DX8H 2FHKA 2EFPA 1HBMA 2I8EA 5KT4A 4FS1A 4AL6A 3HHLA 2NUUG 2FY1A 1QAIA 5K14A 2UVUA 2FLPA 4I6WA 3SCIE 4IRDA 3D54A 4QWEA 2MJUA 3FVYA 2AX0A 5DDOC 4B9VA 2EG1A 4JBCA 4C8MA 3DNCA 4NLDA 3PM9A 3H5SA 4N56A 5KFQA 4RNFA 1Q53A 1TVRA 2JL9A 1DQ9A 4I7FB 2R8HA 1Q7YT 4XAKA 3OFGA 1H2TZ 2Z0GA 5HROB 2DRBA 3M9MB 2AV5A 5L1LA 1FXRA 1S6QA 5FDLA 3FSIA 4EWTA 1IJEB 3OR2A 5B0AA 4J5OA 1K8AT 3GR0A 1WF2A 2BM1A 4WCEQ 4NXNF 2VODA 2FVCA 2LA6A 2IVFB 3K58A 2JSXA 4K50A 4LQ9A 1TKDA 2ILZA 5HP1A 3DOLA 3MMAA 4NYPA 3UDLA 4IRCA 3SFGA 3DC2A 1U48A 1XEZA 4B9SA 2HHUA 5H9EJ 2JWNA 2PMZD 2RE1A 2B5JB 1MWYA 1RP5A 3AY0A 2EK6A 3DRSB 3GB0A 2C28A 2FLNA 4Q8EA 2R4FA 3TAMA 4LUBA 3G6YA 1O0PA 3CCSS 4WKRA 3MR3A 4R5PA 3DXBA 1AUDA 2LXFA 2X1FA 4IH7A 1YQHA 2IM3A 4IH6A 2ZH6A 2CVIA 4DV3F 1M5SA 1F5CA 5KFTA 4DL4A 3OLBA 4EO8A 5EWGA 1DTQA 3FEXB 1N54B 5JVHQ 1D8YA 2CKWA 2WCXA 4CT8A 3EGWB 2IA6A 3L7OA 2QYCA 4ECWA 3N79A 3R5BA 1C0TB 1TKXB 5EX0A 2YH1A 3DM2A 5GADU 2ZD1A 1YJWS 2CPJA 3OTCA 3TP2A 3MD1A 4IO9Q 3SDEA 3NS6A 4JOUA 5E0OA 3X1LB 2RNEA 2GFFA 2OMLA 4OV1A 4ZKAA 3MXHP 5F8JA 4BWMA 3BQ0A 1HNVB 2DRAA 1UWBA 2NUHA 1HBNA 4NLPA 4NLTA 1MWZA 2B4PA 2DH9A 2GX8A 2AW0A 4FVMA 1UA1A 3TARA 3M30A 2EFGA 3LGMA 4HDGA 3JSYA 4KIAA 4F2SA 5CH7B 3KK2A 3QO9B 1BQXA 3V6KA 5HI7A 2E5JA 2DR7A 4RX6A 3BO2A 4MH8A 2BZ2A 2OPPB 1SUQB 2CQ1A 3VCDA 4YQWA 2FVPA 4J9KA 3H20A 2FHOB 1Q8BA 3G8QA 3MM7B 4AYBD 4ZLPA 4PUOA 2B7BB 2BDPA 3DLKA 4H4MA 1OQ6A 2C3UA 5BJRA 2V0NA 1DARA 3QGIA 4OX9F 4MMOA 1HMVA 1X4DA 3IR6B 3UQSA 3PV8A 4NPOA 5KFVA 2YNIB 4IG0B 1MROB 2E1CA 2GGPB 2U1AA 1T03A 1FKAF 1VQ8S 2E66A 1HWJA 1TL3B 3HDSA 4JV1A 2XSJA 3DLJA 1WG5A 4ILMA 4Q43A 2DNRA 3B8HA 1RT2A 3ZFVA 3M8PB 2VQEF 3T5HA 3V81B 2BRLA 1U45A 4PUOB 4C8ZA 4A8MP 2MKJA 2VFSA 4DV5F 1FESA 2J8AA 3FNNA 2VB6A 2HRUA 2AJQA 3UD3P 2ZE2B 1FK9B 2PD1A 4NLOA 2ZITA 3VZIA 3UR3C 1S1UA 3UR0A 6FD1A 5J2NB 2DHXA 4BWJA 2RQMA 1KHWA 2YQ3A 3I5CA 3T9ZA 4V19X 3V2UC 4F8RA 3N28A 1S48A 5BR8F 4HLBA 1U1MA 3DHXA 3P6YC 4ID8A 1EP4A 1UL3A 4ZPDA 4EO6A 1AFIA 4DOZA 3JAMY 3KHLA 1RDRA 3KK1A 3C6UA 1YIJS 4AXJA 1VLYA 1JLQA 5K8NA 2JC0A 3IRXB 5I3QA 1TAQA 4RBVA 2RRBA 3VWSA 2KVIA 3D0IE 3CCMS 1F5BA 2OPQB 1ZPVA 3GFZA 2B9WA 1YJVA 2KXHA 4FZVA 5KG4A 2HVZA 1QUVA 3CXCR 2XS7A 3I5BA 1X4GA 2XULA 1WI8A 2BV3A 2DNHA 3MPYA 2QMWA 4ETXA 4F4XA 1M5PC 5KFLA 4B3TF 1KQGB 2XG8A 3TVZA 1HPZA 1VQKS 2JEGA 4NLUA 4IOBA 3LP2A 2RB7A 3N6NA 4DQQA 2MQNA 1MW7A 1DFDA 2ZC3A 4P7VA 4IQMA 3CB4A 1S10A 5L9XA 2RKIB 4WU2A 1RT6B 2LQ5A 1XMOF 1Y5NB 5KG5A 1L3SA 1KD1T 3M32B 4AFFA 5J1PA 3DLBA 2GO8A 2GA7A 5AJ3F 4ZPVR 2RS2A 3S6EA 1R0AB 4ED3A 3EGZA 4LT6A 2NLWA 1UJ4A 2ZUGA 3AQOA 3BREA 1UJ5A 1R8BA