1SXLA

Resonance assignments and solution structure of the second rna-binding domain of sex-lethal determined by multidimensional heteronuclear magnetic resonance spectroscopy
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
97
structure length
97
Chain Sequence
MSYARPGGESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLSVRLAEEHGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SEX-LETHAL PROTEIN PROTEIN
publication title Resonance assignments and solution structure of the second RNA-binding domain of sex-lethal determined by multidimensional heteronuclear magnetic resonance.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Rna binding protein
total genus 8
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 1994-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sxlA00
4W90B 4TU8A 2YTCA 2DITA 5DM7Q 3LQVA 2SXLA 3P5TL 4WFAQ 3VAKA 2E5IA 1U1LA 1M5PC 1U2FA 3P49B 2RQ4A 2DIVA 2MKHA 3MXHP 2CQPA 2RT3A 1JMTA 3UCGA 1RK8A 3S01A 3ULHA 4BS2A 3CUNA 3CCVS 4WF9Q 2QFJA 5IM0A 1HD0A 2ZJQQ 3CCSS 2O3DA 2MPUA 1SJQA 1X5OA 2EK6A 4TLQA 5LXRA 1H2VZ 2MJUA 4EGLA 3MUTP 3NNAA 4C0OC 2MZRA 3ZZYA 3R27A 2MGZB 2CQIA 2MHNA 2VONA 2M2BA 2YWKA 3BEGB 4F25A 2U2FA 2XNRA 1PGZA 3HHNB 2F3JA 1FO1A 1OPIA 2MSTA 3NS5A 2NLWA 1DRZA 2MMYA 5GAGU 2LKZA 2CPZA 2DGTA 2DHXA 5DETA 3H2VE 2KT5A 1WHYA 3H2UB 2AYGA 1O0PA 1WEXA 1VC5A 2RUGA 2KH9A 3JB9k 1U1NA 3VAJA 2X1AA 3UD4P 5DDPC 2HGLA 2E5JA 2G1DA 2XS7A 2KN4A 1OWXA 4IOAQ 4PRFA 2DNHA 4ZKAA 2K3KA 2E5HA 1D8ZA 2CQ1A 3EX7B 2KXNB 5LJ5Y 5DM6Q 1U1RA 2KXFA 2CQHA 2J0QD 2FC8A 2ADCA 2LMIA 1U1OA 1N54B 2RU3A 2DH7A 3EGZA 3MOJB 4CH1A 3US5A 2FC9A 4F02A 2J8AA 4YB1P 2CPFA 3BS9A 1NO8A 3VF0B 1M5KC 1L3KA 2AD9A 2OSRA 2AYEA 3G8SA 3CPWR 4QU7A 2DIUA 1X4AA 2DGVA 3RW7A 3VALA 1NJIT 3VAGA 1YJ9S 2KYXA 1VC6A 3R1HA 2MGZA 1YJNS 2LXUA 1K9MT 2RQCA 5ITHA 4CIOA 2KM8B 1WHWA 2CQBA 1FXLA 2G0CA 2MY7A 3CC2S 4PKDB 2LECA 1VQ7S 2G4BA 2LXIA 1WF0A 1U1QA 3CTRA 1VQ5S 3L3CA 4IO9Q 1NU4A 3CC4S 1WG5A 2XSFA 3BO3A 1KOHA 5BJRA 1DBDA 5DDQC 4UQTA 2RS8A 2MZSA 2MQOA 2M8HA 1YTYA 1DHMA 2N3LA 2MQNA 4P6QA 2LCWA 1YIJS 4M5DB 2MZ1A 2QA4S 4W92B 5D78A 3OW2R 1PO6A 1X5TA 2HGNA 2DGQA 3THPA 1RKJA 2M9KA 1VQ9S 1QVFR 2HGMA 2A3JA 1YWXA 1WG4A 2J0SD 2I2YA 2JWNA 2Q79A 2CPHA 4ED5A 3UE2A 4C4WA 2GO9A 3THTA 3I55S 1F9FA 2E5GA 2OSQA 2K8GA 2LA6A 1SXLA 1VQKS 2KU7A 2VOOA 2X1GA 2V94A 3CD6S 5CXTA 4YUDA 2HVZA 4PR6A 3UCUP 2VOPA 2RRBA 3IRWP 1VQ8S 3TYTA 1S72S 3SDEB 4QQBA 1H6KX 1KC8T 1G2EA 5JVGQ 1U1PA 4Y00A 5IFMA 1SJRA 1W2BR 1WF2A 3NNCA 2MZQA 5CA5A 2ZJRQ 1BY9A 4C7QA 1JJ4A 2MQPA 1OO0B 2DNQA 4Z2XA 2CPYA 1KD1T 1ZZFA 3HI9A 3CCQS 1IQTA 2MKIA 1SJFA 2RRAA 2AYBA 4A8XA 2F9JA 2MZJA 1P1TA 5GMKa 1ZH5A 5EN1A 5GADU 4OZ1A 2J76E 3CC7S 2MXYA 1U1KA 2LA4A 2L08A 5CYJA 1R8HA 2CQCA 1WELA 3G9CA 1YJWS 2PEHA 1WTBA 2DGXA 3CCJS 1YI2S 2M8DB 3P3DA 3TO8A 3PIOQ 2MZTA 2BOPA 1M90T 1HA1A 2M4MA 3DLLQ 1KOOA 2CQ3A 3CCUS 2UP1A 1HD1A 3EGNA 3U1LA 1WF1A 4OZ0A 1M5OC 4J5OA 5GVQA 4FXWA 2F9DA 1FHTA 2PE8A 2DHAA 2CPDA 3J7ZT 1M1KT 3MD3A 2LYVA 1UFWA 5D77A 1FJCA 2DNZA 2MQQA 1KQSR 3MI7X 3B4MA 3FEYB 2BZ2A 3NS6A 1VBZA 2N82B 3CCMS 2KXHA 1K73T 2OTLS 1WHVA 1FJ7A 2CPXA 3SDEA 2X1FA 3G6ES 3IWNC 2N3OA 3I56S 1YHQS 3CULA 2MB0B 4LIRA 1X5PA 3NNHA 1WG1A 2CPJA 2NZ4A 3CCLS 2CQ4A 5IM0B 2HYIB 3MD1A 3CXCR 4V19X 3CMES 3SMZA 1OIAA 2ZJPQ 1SJ3P 2OIHA 2LQ5A 1QVGR 1WWHA 1UW4A 3MDFA 3VAHA 3P6YC 2DH8A 2KG1A 5DDOC 1X4FA 2YH0A 1WEZA 3S8SA 1ZZNA 2M0GB 4LJMA 2MKKA 1U6FA 2VODA 4WCEQ 2DGOA 5IQQA 3MURP 3VAFA 4RU2A 5LXYA 2CQ2A 1VQPS 3CMAS 2GHPA 1X4GA 2DGSA 1XN9A 2DO4A 1FJEB 2DISA 3CF5Q 3MUVP 2D3OR 2CQ0A 3G4SS 2WBRA 5FJ4A 1VC0A 1K8AT 3G71S 5MLCV 2JVOA 2M7SA 1A9NB 2ERRA 2MKCA 4IUFA 2D9PA 2DGWA 1QM9A 1VQ6S 2M70A 1B7FA 1SJ4P 2KM8C 3S7RA 2MQLA 3D2WA 1YITS 4CQ1A 4TU9A 4WFBQ 2MY8A 2CJKA 2D9OA 3BO4A 1X4BA 2M88A 2LEAA 2MSSA 2CPIA 3FEXB 3J7YU 4QU6A 4WIIA 1VQNS 2FHOB 3CCES 1JJHA 3K0JA 3ZZZA 2KG0A 2E44A 2MJNA 5LJ3Y 2YKAA 2EVZA 4F26A 2KHCA 3DXBA 1Q82T 1M5VC 2DHGA 1A7GE 1X5SA 2HZCA 3S6EA 1Q7YT 3TP2A 1H2TZ 3PIPQ 4WKRA 3LPYA 1CVJA 2RS2A 1Q86T 2KRRA 5HO4A 2DGUA 2JX2A 2OTJS 2DNNA 2OJ3A 1N8RT 3UD3P 5JVHQ 3CCRS 2FY1A 2KFYA 2XS5A 1WEYA 4QPTA 1U1MA 4Y0FA 4ERDA 1D9AA 1WHXA 3V4MA 2XNQA 2MKSA 1JJ2R 3VAIA 2N7CA 1R8PA 3SXLA 3Q2SC 5GAHU 2YH1A 4U67Q 2DB1A 3UWTA 1UAWA 2I38A 3BO2A 2DNMA 2DNPA 2CPEA 2KI2A 1DZ5A 4WFNQ 2DNGA 1X4CA 5LSOA 2EK1A 2LEBA 2DNOA 1VQOS 1HL6A 1WI8A 3VAMA 1VBYA 2XS2A 1U6BA 2X1BA 2KVIA 4TU7A 1FT8A 2MKJA 2DK2A 3MUMP 1N88A 2DH9A 2MYFA 3N9UC 1X4DA 2RNEA 2DNLA 1VBXA 1N52B 2DO0A 2DNYA 5H1SV 2DNRA 3B4DA 2QEXS 4YOEA 2U1AA 1URNA 1WI6A 3R1LA 1X4EA 2XB2D 2DHSA 2KRBA 5GAEU 4CH0S 1P27B 2DNKA 2CQGA 2L41A 5DDRC 2B0GA 3Q2TC 2L9WA 3UCZP 3NMRA 1X0FA 2JVRA 1AUDA 1Q81T 1S79A 5HL7Q 4LMZA 1VQ4S 2JRSA 3RW6A 2FPHX 1FNXH 2MQMA 2M52A 1VQMS 3U1MA 1H2UX 3G96A 1UP1A 4IOCQ 1VQLS 1X4HA 2ADBA 2AYMA 2RVJA 4FXVA 4UY8T 3G8TA 5LSLA 2CQDA
chains in the Genus database with same CATH superfamily
1RADB 4ZIVA 4F0KA 2J9DA 4KR0B 3GB0A 1SC1B 4P2MA 4UUWA 4BDPA 1B4SA 1DQAA 2J7UA 1P9YA 3ULHA 3KYLA 1R0AB 3HVTB 1HNWJ 4GO5X 4C8KA 2W8LA 2B4VA 2B5JA 2MTLA 3OJUA 1RTIA 1BD6A 4FYVB 3IBWA 2C3PA 3V6HA 2G0JA 3KK3B 3PVXA 2CQIA 4UOFA 4PQUB 4LUBA 3ZTQA 1NNDA 4RW9A 2R7UA 1CC7A 3WHIA 5GAGU 2WTFA 5KFJA 1Q0NA 3M6VA 5CCMA 3PZPA 5HLFB 4WTOB 1UVJA 3QGIA 2GIQA 1U1NA 3HZGA 1CSJA 4OFZA 3W1YC 2DNHA 2ZZMA 2E1RA 4ANEA 1S1UA 1MN7A 3MMAA 2DH7A 3CDUA 4ZVRB 4OZLA 4B3OB 4YN3B 2OEJA 2W2NP 2YPYA 4RW7B 2VJVA 1T02A 1U2CA 2KM8B 1HQ2A 5HROB 4DQSA 3GJQB 4NA2A 4G6VB 4DV1F 3CTRA 3OR2B 2RHQB 3KDOA 2GCFA 4LSNA 3M6UA 2HQDA 2UVUA 2ZKTA 1HWKA 3Q86A 4FF2A 1FRKA 1OYEA 4UTGA 5B08A 4RW6B 3O5TB 4NXNJ 1HLWA 3D9BA 4PCQA 1LW2B 1NK5A 4JI3J 2QLFB 4J9MA 1WG4A 5T7LA 2GO9A 1S4FA 3TEGA 2R8HA 2BXJA 4CRJA 4JV5F 3DRSB 3AJDA 2OHDA 4Y2AA 5ETOA 4F50A 3ZZ0A 1BC6A 1NK8A 1SPBP 5L1IA 1DTTB 1SV5A 4CYUA 3M2UB 3Q8UA 4Y00A 4LR7A 1H3DA 3HHEA 2ZJRQ 4C7QA 4Y3CA 4P73A 1X9SA 2JSXA 5KFRA 4OZ1A 2ZH1A 2L08A 5CYJA 4X4TA 4DV1J 1YI2S 3TVZA 4I0WA 2CNLB 4U9RA 1V3ZA 2F8EX 3LAKA 1QTMA 3MD3A 5D0HA 1TL3A 1VRUA 3F56A 3B4MA 3MR6A 3CEDA 3ICLA 3ISNC 4DS5A 3MFHA 2IPOB 1YVFA 1SL2A 1UPPA 3KLGA 4Y6IA 1SJ3P 2Z58B 1HHTP 1UW4A 1S4EA 2EW9A 1RT6B 3K8WA 2CNOB 3MAHA 5LXYA 3G82A 1TL7B 4OV1A 3K58A 1F3VA 5HP1B 1FJEB 1R7IA 3MAAB 1RHUB 4CTAB 1EKSA 3KFWX 1ZOTA 2ILYA 1FKOB 1YK9A 2R7VA 2YNIB 1RT3B 2B7CB 3HHLA 4IUFA 2VKRA 3OJSA 5EX0A 4PG4A 3CD5A 3FSYA 4A8OA 2MQLA 1UFKA 1MMLA 2YPZA 4O3SA 5A8RB 4LIWA 3R3TA 3G87A 1RKIA 3J7YU 1RTJB 4USTA 5LJ3Y 1BQMB 4KKOB 4DG1B 1IVZA 5HBMB 1X5SA 3M2VA 1Q7YT 4ZJQA 2HNYB 5HK4A 1CVJA 4XDDA 3QRQA 2CFXA 5J2QB 2ZD1A 3SQGB 2GVDA 1LNQA 4U7CA 3PXGa 3KLFB 3VAIA 4Y34A 4ECSA 2IHR1 4NLWA 2EXUA 5IXUA 2C1EB 3VZIA 1PJ7A 1L3SA 3MZIA 3DC2A 1KNZA 4OMFG 3BN4A 2BRKA 5L39A 2QRRA 4WZQA 3M8YA 3AJ2A 3EZUA 4HH1A 1S9GB 4RPFA 4IR1A 4ILLA 2XULA 3LWMA 2MDAA 1ZYQA 1TQLA 4P2SA 3Q8SB 2ZBQA 3DM2B 2DNKA 4C3LA 3NMRA 2HNDB 1Q81T 3G8QA 1N36J 1SKSA 4NXMJ 3LTOA 3RRKA 3IBFB 1YRUA 1RZMA 2AYMA 5L9NA 3KWMA 4B9VA 3C14A 1U1LA 2YNHB 3AQOA 4JOUA 5F8IA 2FHKA 4RNNA 1FX4A 3T5HA 4RW4B 3ETOA 1VK8A 1SH3A 3T6BA 3PO5A 3R5DA 3W65A 2PA8D 2N4CA 3CIZA 4P2FA 5HN0A 3UN3A 4O44B 1Y5NB 3QO9A 2Y3YA 2IA0A 4HTIA 4KO0B 1R8CA 3CE8A 3ITHB 3H2VE 3FCVA 4ZVUB 2G1DA 3MR7A 5IT0A 2JEGA 4PG8A 1RT5B 3EX7B 2K06A 1RBLA 1IKVB 3KJVB 3OL6A 2CPFA 4JI0J 5B0FA 5RUBA 4DFJA 3GFYA 3AOCA 2FGCA 4RW8A 1FRMA 1S9FA 2BA9A 2E5LF 5LM7E 3CPWR 1MWYA 1AFJA 3GG1A 3RW7A 4NASA 4IG0A 2KYXA 1NHVA 2JEIA 3OFGA 1WHWA 4B3MF 2G0CA 1VQ7S 5H9EK 2EFGA 2IY5B 2A0FB 2V6AA 2BW7A 2KDOA 3BO3A 1MROB 3N5FA 1RWMB 4LQ9A 4TY9A 3IWXA 2ZH6A 4ELUA 3CGIA 1S7HA 4NLRA 3G6XA 1CQMA 4DQRA 3TANA 4F4AA 2W4PA 3BR9A 3PY8A 5D0EA 3WDOA 2PFFB 3BZQA 4K8RA 4I6YA 4OYAA 5KG6A 2OPQB 4OI2A 5I3PA 4L3NA 1T05A 4DR1J 2V2QA 4U95A 2VH7A 2D74B 4RBUA 4K7QA 2QL7B 3QWUA 2E5LJ 2Z30B 1RA7A 1BQXA 1IQTA 5ETVA 1JK9B 2WW8A 4F2RA 2MZJA 1S1VA 1IM6A 3OPKA 2HHHF 2HFSA 1WELA 4NYPA 1YJWS 3P3DA 3D54A 3ILIA 3MM5B 4HHJA 2UP1A 4EBDA 1S1TB 2N4DA 2VKZG 5KG2A 3SSQA 2DHAA 4WU2A 1M1KT 1VQYA 4ID5A 1RTZA 3DFEA 2OEMA 4JYAF 3MMCB 5K8OA 2AMCB 9RUBA 4N41A 4AL6A 2X1FA 1T9UA 2N3OA 2MB0B 3BDPA 2NZ4A 2BYCA 3R5BA 5A8WB 2GJ2A 3RB3A 3AD8C 4X4UA 3HSZA 3LWLA 1NSAA 3OVAA 1VRTA 1RXOB 4RR5A 3KUHA 5KFGA 5ETRA 3NRBA 1W25A 4QWEA 3H40A 3NY0A 4M5GA 5HMXA 3W2WA 3Q89A 3ENQA 5BR8F 5B0DA 4DR6J 2JJ4D 3MUVP 3KG0A 4QIGA 1QD1A 4GVBA 3TR5A 2JFKA 2GVZA 3R2DJ 1KFDA 3UFCX 4JBCA 3IWLA 2FUG9 3M7VA 4DL0C 3QGPA 3TJAA 1T03A 1RAGB 3BDEA 2CJKA 3D67A 4NZ6A 2FYXA 3BO4A 2LDIA 1X4BA 3F44A 3JTPA 4B02A 2DBBA 2VU5A 3TARA 2F4FA 1EZZB 2VPWB 4M95A 4C48A 2NXCA 2KHCA 3A1YG 4RJVA 3JQJA 1Q86T 2G9OA 2APOA 5G0RA 2JZ5A 3IA0A 1B99A 3D28A 1X0PA 1CJKA 1B64A 4AE5A 1UVLA 1PKUA 3OXGA 2XNQA 2MKSA 4FYDA 2WSFC 3SXLA 3NGTA 1TAQA 3MM9B 3JSMB 2YH1A 1QUPA 2HKEA 3D4JA 5BR8J 3D0HE 1V3RA 3LAMA 5F8JA 3EZOA 4WFNQ 1MSWD 1VQOS 5BYRA 1N88A 1TVRA 2BM0A 4I56A 4TXSA 1SL1A 1SBRA 2C2ZB 3AD7C 2QX0A 3I4HX 4B9LA 2QLBB 7FDRA 1HI1A 1KDNA 4DU7A 4F8RA 4RBTA 4Q8EA 4IKAA 1FDNA 5CAAA 4NA1A 4FF3A 1RUSA 3JSYA 1Y5IB 4B9NA 2IVFB 1RE1B 3VAKA 2XZTB 1U2FA 2VFSA 4G1QA 1VS3A 1FERA 1JMTA 3BB5A 3OSPA 2B4OA 3D6MB 3FEZA 3N6LA 3MOZA 2MPUA 2QA1A 2IRXA 1XC9A 2VONA 2D1CA 3GYGA 4F25A 2U2FA 3KLGB 4NOHA 2UXCJ 4I7FA 2W9BB 2J6SA 1MU2A 4H4MB 3CJKB 3NCRA 1TMMA 4RUBA 1VC5A 3UD4P 4HHUA 2XS7A 2XGPA 3CO0P 3T9ZA 2FC8A 4ZK7M 2R9LA 2YWGA 2CRLA 2G2OA 3R97A 1NDPA 4YB1P 1BE4A 3OL9A 1JLEB 3BGLA 1M5KC 3DOMB 1S0NA 4QU7A 1S6QB 4H4OA 2KHDA 3OT9A 4USMA 2V4QA 4EMDA 1JLAA 3TNVA 2QMUB 2ZOFA 2HHWA 2RDJA 2R8GA 3L3CA 3D7SB 1S5ZA 2BJEA 3OFEA 3SFGA 4DI6A 1SH0A 2J7KA 3Q23A 3G6VA 1DHMA 3MM8B 1YX2A 2IIHA 3BM7A 3DRPA 2H9ZA 4MH8A 3QQCD 1HWJA 4WBFA 2HQCA 2M5YA 2CPHA 3I0RB 3I55S 1TUWA 1F9FA 3THVA 1LXNA 1VQKS 2MQ8A 4UOGA 3TZWA 3V6DA 2B43A 4CP5A 5CD4A 1FI4A 4HI1A 2R8JA 5IV3A 3RG6A 1NCLA 2HS3A 2VIHA 3CJ4A 5AE1A 1SJFA 2JLFA 3E01A 1JLQA 2J76E 4K59A 4OQJA 3UI3A 4LT6A 4ZCMA 3RZAA 4M5DA 4NA3A 4P75A 2HW3A 3M8QB 4IRCA 3PEHA 1T0TV 2LYVA 3WZ0A 1H7XA 5M2UA 2AX0A 3C14B 2LLZA 3MI7X 5KG3A 1DFDA 4ZLJA 1VBZA 1K73T 2VDHA 3OL8A 2RF2A 3H90A 2FJVA 3DHWC 1YHQS 1D8YA 2G0IA 8AT1B 1HBOA 4OX8A 3DCAA 2OPPA 4WTYA 1GX5A 3U1NA 3RAMA 1QVGR 2KYZA 3GR0A 2XO6A 2AEFA 3ILLA 4IFVB 1ZZNA 4LJMA 4WCEQ 2GHVC 1VQPS 3POTB 4URGA 2QV6A 4X65F 4PG7A 3LP2A 2P9EA 4ZVEA 4AYBD 2CZ4A 4NZ7A 1I1GA 3MTJA 4ZPWR 1SJ4P 5IC4B 1S97A 4MKAA 1MNEA 4KGMA 4N7TA 1NBEB 2NYIA 2RILA 2BANB 5C24B 1WC5A 4EBCA 4RW8B 1M1HA 2A10A 5FLXU 2W7OA 1RWWB 3KHRA 5DGAA 2WVCA 1RTDA 2IA6A 2DHGA 7FD1A 1S9EA 3HSJA 4KHPF 4WKRA 2L9DA 3UDVA 1SKUB 1DTQB 3K89A 3DLJA 1HWLA 3W61A 4QPTA 4QJVA 4R8UB 4B3TJ 1JJ2R 2N7CA 3D1HA 2RE1A 1EAYC 1AB8A 1QAIA 1UETA 2UXDF 1AA1B 5AXMA 3UPFA 3I4PA 2JFDA 1VBYA 3EVMA 4B17A 4PG6A 1RISA 2MYFA 2RH3A 3GFXA 3R7SB 3PX6A 1VBXA 2E66A 1Z2ZA 2VV5A 4EBEA 5E5NA 4HEA9 1Z2LA 2OKQA 4R5PB 4LSLA 2RKIB 1Y9OA 1S79A 3J80Y 2PDAA 1E6YA 1RB0A 4NYZA 2MQMA 2HWTA 2IVMA 5KT3A 3G8TA 2NR0A 2B8QA 2H65B 3R7BB 3MFIA 3CW2C 2AF6A 2VQEJ 1U26A 2DIVA 2MKHA 1IKYB 4HYKA 2MHEA 1HNZF 2W8KA 3LO3A 5HQMA 3CCVS 1NK0A 3CDAA 3IAS9 2I0XA 3QT5A 3GLJA 3UN2A 3TZXA 1RBOB 2LQJA 3N79A 5K14B 3DMJA 2UXDJ 4CLSA 1PYSB 1IBKF 3PACA 2MSTA 3NL0A 3RYLA 3JB9k 1TU0B 3VWSA 2KN4A 2E5HA 4AL5A 1FWPA 2KXNB 3PW7A 2O1PA 1HBNA 2V9WA 3R7NB 1HI8A 2HQGA 4DOZA 1NJIT 1QDUB 3A8JA 3R1HA 1SC6A 5ETKA 4ES2A 1OMSA 3GJRB 3L09A 2UXBF 2V8DA 1NPRA 3M6WA 2YWHA 2UVVA 3W9HA 1VQ5S 4C3KA 2WZ1A 2R2UA 4CM0A 3OSNA 2XMUA 2C3MA 2NSBA 5KT2A 1AW0A 2J6UA 3DRRA 3W62A 1WOSA 4WXWA 1FRHA 5J2MB 4ZIWA 2N3LA 4C11B 4LRBA 4LF5F 1GH8A 4LF9J 3PDNA 4DQQA 5KFHA 1QVFR 1RHKB 1ELOA 3G2XA 1UTAA 3RB4A 1LW0A 3KNAA 3AXKA 3THTA 4AFFA 1Q78A 4USIA 2OSQA 5E3AA 2P9GA 4ZVPB 2XEXA 2R2TA 1CPZA 4USKA 3D0GE 1KC8T 4YHHF 3BBFA 3KLVA 2J9CA 1S7IA 5E7OB 4UF4A 4F67A 3FVYA 1OO0B 1VI7A 4RX6A 2DEIA 2IJNA 3IFEA 3CCQS 2RRAA 1RCXB 2K2PA 5J2PA 3DXSX 4QIEA 2YKMA 3W5XA 2GIRA 5F8GA 2HHPA 1GT8A 4FF1A 1C0UB 4J7CA 3TO8A 1RHJB 1NEEA 1WSVA 2ZH7A 3I0SA 2Q1LA 4JI7F 4DX6A 3H59A 1M5OC 4J5OA 4FXWA 2F9DA 4BWJA 1FJCA 3P8BB 4USVA 2BVZA 3C46A 3LP0A 4OZ3A 3H4BA 3NGDA 1HQUA 4ZHRB 4H4KC 1LFWA 4PYAA 5LSRA 3NNHA 4AQYF 1O5JA 3L7OA 2W4CA 2JDJA 3ISND 4ZN3A 4WFXA 6FD1A 3TUIC 1Z1ZA 2XZDB 5A2QY 2PSZA 4HDGA 2VG7A 5EDWA 5B0GA 3KG4A 5ADZA 4J9RA 3LGHA 4DL7A 3JSRA 2P6SA 2MLXA 1SKWA 4YDXA 2RU9A 4NLTA 2XY6A 2O66A 3NBPA 4A8YA 3KUEA 2ZC4A 3PR5B 4WP3A 3PV8A 1RT1B 1EB0A 1FE4A 1SIWB 5DZ7A 3EDRB 3VR1A 2OPSB 3BGFA 1RT7B 3BN7A 5FDLA 4F4KA 4H54A 3FC9A 1B0VA 4C8OA 3MPVA 1I94F 3DLKA 3EGWB 5KFIA 2HHTA 3HHKA 1U0HB 1Q16B 3UNGC 5J2NA 3RAXA 2OH2A 1CS4B 2RMLA 4OV6A 4ER8A 3H5XA 1XMOF 1RT4B 3LPEA 2W7AA 2KTQA 4ZPBA 2BQ3A 4LR9A 2EFNA 2ZH5A 1FDAA 4X64J 1DZ5A 4MIAA 2QL9B 5HVHA 3JYTB 4A8FA 3VAMA 4LFCF 4NLQA 3R6LB 3B6BA 4DF4A 4DUYF 1DURA 1JIHA 1HNXJ 2W9CA 2DO0A 2B6AB 2ZOGA 1B0TA 3M9OB 2XB2D 3PW2A 2J0WA 1YZ6A 4NI2A 2LP4A 4TYBA 4ZJOA 1GTHA 4OJ3A 2VDIA 3EVOA 1UP1A 3AOBA 2ZNZA 3V4IA 2ADBA 1I94J 4D3HA 1WC6A 4NLVA 3GV5B 4J90A 1RP5A 2RAQA 4B3SF 4CO3A 3MR2A 4DZDA 2J8SA 3CD7A 5SUHA 1D9FA 3GE9A 5H9FK 3LF0A 1P9QC 2UUTA 3B78A 1RWUA 1U09A 2B9WA 3ZC4A 4DPWA 2DR6A 4G1IA 3NAIA 3HM9A 2CYYA 3OVBA 4DV7F 2JHEA 4NCBA 2YXLA 4NLUA 4DSJA 4LFCJ 1F9EB 3DI6A 4DUYJ 3Q0AA 3HFKA 5A76A 2BKPA 2UUWA 3KDNA 2PO4A 4DXLA 1KVKA 5DETA 5A6PA 2KH9A 4ZOSA 2X1AA 1R0BG 1W2IA 8RUCA 1RT2A 2VD3A 3WIVA 1HWUA 5E41A 2VBXA 4L76A 2BV3A 2W24A 3H8YA 1UJ4A 4K4WA 4UZBA 3W7BA 2CZVC 2R7OA 1R27B 1PILA 3PTWA 5KT7A 5IWAJ 1YJNS 2EKYA 2HBQB 4DPYA 1F60B 2C3UA 5DLFA 3O6QA 3HJVA 4M1KA 1QSSA 2DHHA 2AWZA 4DV7J 2Y1LB 1EP4B 5D0GA 1CQNA 1XNRJ 2VA3A 1N5TA 3N5BA 4CT9A 4J9UE 5IZHA 2XYHB 4O4GA 4TLRA 2MZ1A 3NS7B 2AEJA 4MK9A 5E3QA 2KT2A 3THPA 3HXMA 4IOBA 4KGXB 4DPTA 3T19A 5BXIA 2C22A 1OQ6A 2POKA 4GKJJ 1JX4A 2WVFA 4DU8A 1VDHA 3L7PA 5HANA 1FX2A 2LFVA 2XLIA 1H6KX 3PW4A 1ZAWA 4B9UA 1U1PA 4HT7A 3Q8VA 2MZQA 2DPJA 2KJVA 3JXOA 2PD1A 2DEJA 3MCOA 2D69A 3C8YA 5IT9U 4MIBA 2ASJA 3BYRA 2AJFE 2RQMA 2DGXA 4KFBA 3X3UA 2XY5A 3PIOQ 2MZTA 2BOPA 1GFWB 1HA1A 4N76A 1CJUA 1N32J 4O3OA 1IR0A 4FZVA 2PE8A 2AZ3A 2R7QA 1N33F 4TQSA 2BR0A 3W64A 4BCAA 2HPUA 3FEYB 5HAOA 3C3LA 4IQMA 3SDEA 1ZM2A 3OHBA 4DQIA 4R0EA 2V8GA 1EIYB 4ANCA 1XBWA 5IOLA 1KTVA 4Y2IA 2IAJB 4ECUA 3PKMA 3SMZA 4ED1A 1ZM3A 2WBMA 1S49A 4ZVQB 1S76D 2VFVA 4J9SA 1HNIB 4Q5VA 3P6YC 1Q8LA 5DDOC 1SUQA 1WEZA 4NWBA 1HBMA 2HFNA 1JWWA 5IQQA 1HQEA 4JI8F 2WVEA 3Q8PB 4ED3A 1UA1A 2DY1A 2WB1D 1Q95G 1FRXA 3GZ7A 3AH6A 1DQ8A 2WBRA 5KT6A 2HWHA 2Q6BA 4YS2A 4OYXA 4AL7A 4EI2A 4Q8FA 4DR4F 5D15A 4WFBQ 4USWA 4EYIB 1IR1A 1SI9A 2BE2A 5F8LA 3HDSA 2MSSA 1YBTA 3IR6B 2X3GA 1SC3B 4RBVA 2KL8A 5KFZA 3GJSB 2Y1RI 2VZ9A 5K8PA 4KY3A 3EYZA 1YZ7A 3TP2A 3HD2A 3VV2B 1S1XB 3ZNJ1 4ECTA 1KP6A 1JLFB 3UD3P 2ZVSA 2LQBA 3AA9A 4FKXA 2AGQA 4I2PB 1V5VA 1F5AA 2HURA 4JI8J 1YJTA 3A8EA 2I38A 3KLIA 3QAEA 3C15B 2HFOA 2B9YA 1T94A 1IKWB 3WC2A 2R4FA 4IRKA 2DNGA 2HG4A 2NUHA 2ZOMA 5LSOA 4BC7A 2BDPA 2DY9A 4I6WA 4CLFA 2XS2A 3SCLE 3FZ2A 3T1HF 2OMLA 3IS9A 1HR0F 2DNLA 1WC3A 4DV2F 1SVDA 2FZCB 4DR4J 1WI6A 2CQGA 2F4VF 5DDRC 1GMWD 2I5JA 3OL7A 4IQXA 3MECA 1ZS6A 4L74A 1RU2A 1H2UX 4ZN1A 5L1JA 4L3KA 3GP9A 4CO0A 1RWXB 3K17A 2NQPA 1IKXB 2WSEC 4W90B 5DM7Q 1WD6A 5KFQA 3TZYA 4DR2F 4V19J 4OI4A 2IRYA 2ALZA 3ZZRA 5F0UA 2QFJA 3SCKE 5F8NA 4QWCA 2C2KB 4TLQA 2GQCA 3LP0B 3MUTP 4WPAA 1J27A 1S1WB 4A8KA 1GAOA 2C2RA 2D3O1 2LQ9A 4OX9J 1FK9B 3OVSA 2ZE2A 3NP5A 1HNVA 2HMIA 4URQU 1DRZA 4ZP6A 1HR0J 1EHWA 3PO4A 4DFPA 2CPZA 4IG3A 2QSWA 4RNMA 4JI6F 4O23A 4WYWA 4N5SA 4DL6A 4ZITA 2ZH4A 1N5VA 4B9TA 4Q0BB 3A3PB 2YWWA 2PC6A 3FBEA 3FKBA 2LU2A 2R3VA 4ENOA 1KQKA 2AT1B 1S6PB 1R0AA 3GPAA 4BC9A 3HVTA 1LEOA 3PKYA 2QSFA 1WORA 4A8SA 2YKQA 1NO8A 1J5OB 3KG1A 3PRDA 4ZLPA 4LRCA 4HLBA 3GCWP 1X4AA 5GAGI 5HI7A 3KK3A 3ILJA 4PQUA 2HHVA 5JUMA 4LF4J 5KFSA 1Q5VA 3QJLA 4WFZA 3QJPA 5HLFA 1VJQA 2ZWOA 3AHPA 3AB4B 3NAHA 2RS8A 2EBGA 3BBBA 2LCWA 3RJMB 4L6V3 2ASDA 3NG8A 4J37A 3E51A 2A3JA 4I6AA 5T41A 2UUCF 4B3OA 4OZJA 2P9CA 4DFMA 3PCOB 4RW7A 1MMNA 4RWXA 3MPDA 4NRTA 4EUVA 2H5JB 1WC0A 3NLCA 4LF7J 5HROA 1APSA 3O44A 1N5QA 4RO0A 3OR2A 5LT5A 2EFOA 1KD1T 4HHHA 3EGVA 2UU9F 4DUZJ 3JSBA 4DCOB 2Z2YB 4OX7A 4NYOA 4RW6A 2CQCA 3HT3A 2F8MA 2M8DB 4JP8A 3CCJS 5C2CA 3DLLQ 4Q2LA 1LW2A 2XMAA 3RBZA 3U1LA 4EWTA 2FB0A 2WVBA 3TVYA 2Y0BB 3DRSA 4HTJA 2MQQA 3PX4A 2IM1A 3QIPB 1S0OA 1NM2A 1UCNA 2KZZA 3M2UA 2GV1A 2HHXA 5HSPA 3H2LA 2J0XA 4WIQA 2CQ4A 3BSNA 3H42A 4ECVA 1QSYA 1UJ6A 5GMDA 3CT9A 4LFAF 1GQEA 4MT1A 4YMEA 4OL8A 1D9DA 2NPFA 1J5EJ 3AXMA 4Q44A 1XMBA 3UN5A 2V2VA 4I64A 3G4SS 4ZP8A 4C9DA 2BM1A 3SIPB 1F2HA 1W7WA 5E3PA 4ZPTR 4FF4A 3CJ0A 1G7CB 1H7WA 5CH7B 4CQ1A 5F8HA 2YQ0A 2QT7A 2OLWA 3TX8A 3ZZPA 2UUBF 3CJTA 4WIIA 1PAUB 1FTRA 2GMHA 2R8IA 1RT6A 2MJNA 4TN2A 3C2PA 3I5BA 2R7WA 4LRAA 4ZPCA 3I31A 3MAQA 4KBIA 4KPYA 5KFDA 5HO4A 5AJ3F 5HP1A 1NPKA 1JJCB 3MAAA 4CTAA 2LDYA 1WEYA 1U1MA 3RBDA 3I9V9 1FKOA 1E6VB 4O3RA 1EQMA 2YNIA 4ANDA 1N34F 1RT3A 2QN6B 1R8PA 4YB7A 3IAM9 4QR1A 1RLDA 1UAWA 3K59A 3KJQB 3J7YI 2PA3A 4G1PA 3A4TA 5FD1A 1RAJA 4ZP7A 3O1LA 5A8RA 5KT5A 2VPZB 2ZEJA 3MUMP 1VISA 1XNQJ 5C5JA 1DQ9A 1RTJA 3VHQA 1TL5A 5LMNF 1BQMA 2DR5A 4DG1A 1TKDA 1X4EA 3CJ3A 5HBMA 2XC9A 2L9WA 2CAJA 2Y1JA 4F4ZA 1NH8A 2HNYA 1WTFA 3MEDB 5J2QA 1SQEA 2NCKL 3SQGA 2RVJA 4TY8B 2VASA 4K4ZA 3KLFA 4WFAQ 2Z4PA 3P49B 2EFPA 3UCGA 4I2QB 1XEZA 3IRXB 3CUNA 3FMWA 3MPUB 4F4YA 2O3DA 1X5OA 1KFSA 2BEFA 2HVEA 1VBKA 1S9GA 2CZ9A 3CCTA 1P8GA 1TL4A 5KFCA 3DM2A 1TKXA 2HNDA 2XI3A 3N01A 3MEEB 3NS5A 4QIWD 3KLEB 2CUYA 1RWOB 4GKKF 2DGTA 5KFWA 2ZDOA 2CG8A 2W1BA 2F40A 4MKYA 4NLOA 4USHA 4QYZK 2K3KA 3GILA 1S6OA 1GXTA 4RW4A 4LBHA 1R6YA 4TYAA 2M3DA 2QLWA 2J8AA 4QBUA 2AD9A 2H5EA 1ZM4A 1K47A 2C42A 4OYMA 4JI2J 3DYAB 3SSSA 3FSIA 2Y0SD 2HS4A 1YJ9S 1O8BA 1YBAA 1LQ9A 1B3TA 1N6QA 4O44A 1R6VA 4N8NA 4PKDB 2LXIA 4KO0A 5ETPA 2XSFA 1UW9A 2O5DA 5F0WA 3ITHA 4PXDA 2JEJA 4ELVA 3MMJA 5DDQC 2M8HA 2MQNA 4P6QA 4PUOB 4P74A 1RT5A 1QSLA 3HX9A 2ZM6J 1AZSB 1T9VA 1QAYA 3K57A 1IBLF 3OTOF 1IKVA 2EPIA 4X4NA 5GAEI 3HO1A 3D6HB 2V94A 3PM9A 2WSCC 1QAXA 4OZ2A 4LFBJ 2XCAA 2VOPA 3M2RB 1S72S 3E3XA 4DSLA 4X66J 7AT1B 2O01C 2FTRA 3CJ5A 1RHMB 1EQ0A 2DNQA 4Z2XA 3HI9A 3DHXA 2AYBA 1C1BB 1MROA 5EN1A 2VJUA 4ZCLA 3DNCA 3W3SA 1U1KA 4ECWA 2HK3A 1FFSB 4OYIA 4ES3A 2W2PP 2FY8A 5I3UB 3Q8QB 1HNWF 4C8NA 1BGXT 2EBEA 3BQ1A 2VL1A 5D77A 3K5MA 1KQSR 2H51B 2I9SA 2YKNB 2OPQA 4C8YA 1CBKA 4B9MA 1C4CA 3TI0A 3AOAA 2ZZNA 5AE2A 3QIDA 2O67A 2A6MA 2DH8A 1NK6A 2QA2A 4DBQA 2VODA 1U0SA 2RDDA 1NJYA 3RGIA 2B4PA 3MM5A 1S1TA 1WKJA 2D3OR 1RA6A 3QT8A 3C66A 4UT4A 4ICLB 2F1FA 3VQTA 1Y3KA 2AQ4A 3MMCA 2ZH8A 1ZPWX 2XSJB 4WK1A 2E1MC 3QT7A 1DY3A 2X51A 3K5OA 3IP0A 4GMKA 4CDIA 1YJRA 3MM7B 3BBCA 4AXIA 5A8WA 3GIJA 1LV5A 1QLNA 3OFHA 1FVSA 2AEMA 1S59A 4DR7J 1NSQA 2IFXA 5EWGA 3DXBA 3GFZA 2VUGA 3EDQB 4UQGA 4NXNF 1KSPA 2DT9A 2KRRA 2OTJS 4JI3F 1TK0A 3D5MA 4ECZA 1WHXA 2VF3A 1S12A 5CCLA 1AROP 4K50A 2CJQA 3GIKA 3MCNA 3A8KA 1SC4B 2DR7A 2G1HA 3T1YJ 1X4CA 2LEBA 1Q1KA 3QJJA 1S99A 3OUYB 4KGVB 2X1BA 3JQMA 3SBMA 4ZPDA 1FTCA 1XJWB 4IH5A 4L72B 2DNYA 3B4DA 4W4MA 2V0NA 2RB7A 4DV0J 1JLGB 4WYLA 4ZPVR 4CH0S 2JEFA 3RAQA 1X0FA 2JRSA 2FIUA 1VQMS 1ZAXA 3G96A 2ABYA 1TUVA 5LSLA 4RLEA 2AJ0A 1FJGJ 3EMTA 3NWRA 3MM9A 3JSMA 1CULB 3EICA 4ZVGA 1MW7A 3MXHP 1Y4ZB 2V69A 2CQPA 4DV4J 2QYGA 1TAUA 3X1LB 1BWEA 2EI5A 1NHUA 5IM0A 1H98A 1RDRA 3DLBA 2FGOA 4CNYA 1NH7A 2BKNA 3VVUA 2LQ8A 3ET6B 2NREA 1S48A 2VC0A 1K0VA 1CJVA 5DZ6A 1LOUA 4OYPA 1PBUA 3RTVA 1CJTB 2DRAA 1AFIA 5E3CA 4JV1A 4OYOA 1NJWA 2DHXA 4MJKA 3PNIA 2BQUA 1WEXA 2QYCA 2WRMA 3ELHA 2ADCA 2LMIA 1ZETA 2ZH2A 2JLGA 3PX0A 1U25A 4MFBB 2AYEA 3GJTB 3G8SA 3HJFA 1JLCB 5HJXA 4C98A 5L46A 1WSRA 1RLCL 2FVSA 2FLLA 2B51A 2W9BA 2B3TB 1RWVB 3DOLA 5GAHI 3S1TA 1PJ6A 3EUNA 2V4RA 1WG5A 1RAFB 2VG6B 2WK4A 4H4MA 3CJKA 4DX7A 3OTDA 1KOHA 1Y11A 1NAQA 3D6TB 1NDLA 5C25B 2FJBB 4OI6A 1VQ9S 1YRTA 1YWXA 4IRDA 2HBZB 2NPIA 1JLEA 3MM6B 4GRSA 2GZOA 3DOMA 2KB2A 1RAHB 2VG5B 3QZ7A 1B70B 2AJ4A 1S6QA 2AHOB 3TAQA 1KKHA 1WF2A 3E2EA 1NSKL 1HI0P 1JJ4A 1C1CB 2W9AA 4ILRA 1N36F 3GV8B 1VRQC 4B3RJ 4NXMF 3J81U 3M8PB 1JNZB 3Q8RB 4ITSA 2NXEA 2LA4A 1VJWA 4CLTA 5K20B 3MM8A 5FIIA 3L4BC 2R7XA 5C42B 3LALA 3J7ZT 3I0RA 4ZLLA 4FNHA 2DNZA 1G1XA 2FVPA 5KG0A 1MLAA 3CCMS 1WHVA 4P9SA 3MF5A 2ATLA 4NCGB 3QGHA 4LIRA 1KLNA 4KV8B 2BE7D 3FJ2A 2ATCB 2RHSB 3AA8A 4DSFA 4P2XA 3UQSA 1PC5A 1LWCB 1TKXB 2AW0A 1HYSB 1GMUA 1U02A 2GHPA 3M8QA 3LGMA 2GMLA 1X8DA 4NLXA 2QA4G 3C6TB 2G2YA 4JI0F 2XO7A 3I5CA 2ERRA 2KT3A 3AJ1A 2UUAJ 3KMQA 1Q79A 2YWFA 1RQ0A 1G6BA 1I5OB 2QLJB 3TA1A 2GIFA 2ASLA 3CCES 3BSCA 4IFVA 4Q7AA 3OTEA 4DPOA 1Q82T 3J7A1 1N6QB 5KT4A 3EVWA 1U8WA 5D8HB 1C0TA 2BABA 3POTA 2FZKB 4LF6J 2D3UA 3GFHA 1MWZA 1PCAA 1D9AA 4M5IA 4DLGA 1UWAA 2AJ1A 2I1RA 3LOUA 1FD8A 3OTBA 4QR2A 3GQCA 1QY7A 5GADI 4RU9A 4DR1F 4DR5J 3NOCA 1R89A 2BANA 5C24A 4TU7A 4ZJLA 2AKWB 4QWAA 3PYFA 2ACMA 1XR5A 1V9OA 2ILZA 4IFYB 2QEXS 5GMEA 1IBCB 2KRBA 5GAEU 2YX4A 4KRWA 2PIIA 4K2JA 4HACA 2R2RA 5DJBA 3W5ZA 4AUKA 4IOCQ 1DTQA 1VQLS 2HK2A 4OI0A 3KJFB 5J1EB 1FKPB 2ZDPA 4X4QA 2CQDA 1WNEA 4R8UA 4ZDNA 2RQ4A 2KFZA 2VBZA 5AXNA 4JI5J 1ITPA 4BS2A 3P96A 4WJBA 4DR3J 1TKTB 2EK6A 3BPDA 2ZBIA 4U7UD 1RAEB 2W25A 2QGFB 5A8KB 1TFYA 5KOWA 5EUHA 1WDTA 4R5PA 3AB2B 3TWZA 2RKIA 5D6GA 3VTIA 2NLWA 4MAKA 1KWMA 3AT1B 4DR6F 4O3PA 3H2UB 4QWDA 1O0PA 2RUGA 4JI4F 1IKYA 2XMMA 5ETTA 5LJ5Y 5DM6Q 1G3OA 2BMBA 1F0XA 4A48A 3M32B 5KFAA 5IT4A 3JQKA 4JI1J 3US5A 1BLUA 1L3KA 1FRLA 5A0YA 2GX8A 3I5AA 1QJHA 2YQ1A 5K14A 1VC6A 1WJ9A 3GYXB 4FP9A 1YLXA 3MMBB 5SZTA 1U6ZA 2MY7A 1WF0A 3J7Z5 3QRRA 3TJ8A 2P2CB 1TELA 4UQTA 3TEHB 1XMQJ 1UWBB 2W4DA 5D78A 2QG9B 1NXIA 4C2MA 3OW2R 1T3NA 3OQ2A 3L7UA 4PZVA 5B0EA 3AQPA 2VOOA 2X1GA 3DU5A 3RBXA 3W8GA 4JI4J 4PR6A 3UCUP 2RRBA 2BBEA 3R5CA 4A46A 2LVWA 4LQ3A 1HMVB 4KQZA 4NLDA 4C0BA 2GFFA 2RJZA 4LF8J 2MQPA 2CPYA 1FXRA 4FYXB 4A8XA 1P1TA 2YKPA 2ASYA 3BPSP 4DV6F 4C8ZA 4NCAA 4QYZJ 3CC7S 2MXYA 1IUJA 5J2MA 2FJWA 4C11A 3G9CA 1WTBA 2K1RB 4G3IA 4FVCA 2OGUA 4PXBA 3RU0A 1FESA 5AXKA 3TUPA 3IG1B 3C16B 4DF8A 3GCXP 1UFWA 4NLPA 1JXVA 3MEKA 1ICEB 4KJIA 3P4UB 1BWVA 4I67A 3DKDA 4PABA 1BQNB 3D1OA 1X5PA 1EX8A 1HKAA 3CB4A 5IM0B 2AGPA 3IM9A 1OQ3A 5ETSA 2UXCF 3HCXA 1YRXA 2HAIA 2IC3B 2OI2A 1PG5B 1CJVB 5DGBA 2PGCA 4DUTA 1C0UA 3CMAS 1R0CB 3BGRB 1XN9A 3CF5Q 4UZCA 3T5KA 4DV6J 1ZA2B 5KTQA 4NRUA 3M05A 1PYTA 1GTEA 4DSEA 4ZCKA 5IV4A 2CDQA 2E9ZA 4ZVTB 4ZHRA 3BH6B 4DZ6A 3D2WA 2WB4A 1YITS 4K5SA 1M1GA 3OXFA 4O4RA 2PMZD 2MY8A 2E9TA 3K7RA 3K2YA 3FEXB 1VQNS 4EZ6A 2YKAA 4F26A 1M5VC 3OBIA 4NX9A 2OO4A 2HZCA 2QO3A 3DOLB 2RS2A 3C6UA 4NPOA 2JX2A 2I6WA 2GA7A 3DN9A 4K0KF 5GAHU 3IGNA 2V9KA 4BWMA 1RT1A 1DARA 3SV4A 1T9YA 1C2PA 2OPSA 1RT7A 1H0HB 1WI8A 1H74A 2J7WA 4ETZA 3RR8A 2YWEA 2E1PA 4ID8A 2BACA 4U7UK 1U0HA 1B0PA 3AY0A 1U49A 3R1LA 3PJ9A 3HULA 4XAKA 1WACA 1P27B 2DXEA 3M6XA 1CS4A 3IR5B 2JC0A 1RT4A 1S6UA 4OHZA 4IDKB 3H98A 2OUGA 5CYMB 5A6WA 3JAMU 4TU8A 2ZBRA 3HHLC 2OMOA 1S0VA 3QLHB 1RK8A 3ZXWA 4K0KJ 2ZHBA 3M4XA 4RUCA 3JYTA 4Y65A 4EGLA 2AJQA 2YNGB 1C4AA 1UKUA 1I6JA 2OD6A 1HBUB 4RZRA 2GGPB 2B6AA 3R27A 5CZVA 1UMJA 2Y8WA 1FA0A 1YGYA 2MGZB 1J2VA 2MHNA 2BJ1A 2V4JB 1PSDA 4KSEB 2WOMB 6AT1B 4MKVA 4I4BA 2LKZA 4V1Ak 5KFOA 1T7PA 2F7VA 1PBAA 3M9MB 4CLZA 3O2IA 2Q66A 4K4UA 2C2MB 3BJYA 1K1SA 4WKYA 2J0QD 2EKNA 3EGZA 1AXQA 4F02A 3N0VA 1V5IB 3W9IA 3VZHA 2X7IA 1GNKA 1IBMJ 2B7BB 4PWDB 5B0AA 3VALA 2BW2A 3FGVA 2LXUA 2QMWA 5DG7A 1P1LA 4GC6A 1FXLA 2HFVA 1RTHB 3NEKA 2A1BA 5KG1A 3SQOP 3CC4S 2E7WA 3F41A 4FPIA 3GU0A 1DBDA 5U47A 4QPXA 5D3GB 1UL3A 4B3TF 1RYSA 1YIJS 4W92B 1C0TB 3GSIA 1RKJA 2M9KA 3CJ2A 2HGMA 2C2EA 2XTJP 1T9TA 3CSKA 3T3FA 4NZ0A 5CXTA 4K4TA 4YUDA 4MYTA 3CDEA 2J5AA 3T6JA 1VK3A 2PMHA 1U45A 5IFMA 1SJRA 2GC8A 4KIAA 3GG0A 1NDCA 1KLMB 3DOKA 5DS7A 1IQZA 2XWXA 2DR9A 5E3RA 2IM2A 5T14A 3AD9C 5FLXY 1EP4A 1LWFA 5GADU 2BQRA 4WFYA 2ZFHA 4X4VA 4YEAA 1LWEB 1S57A 4HACB 4YY3J 2VQEF 2R8KA 1N0VC 4BBYA 2GAHC 3CCUS 3VGSA 3LUYA 4OYBA 3I82A 3CNQP 3TA2A 2OP5A 2BX6A 3M1VB 2ZVIA 1SQGA 2BZ2A 4QIFA 2OAUA 3R5JB 2OTLS 2JNJA 1XQIA 2CKWA 2CPJA 2F5GA 2A2CA 1TL1B 4P71A 3MDFA 1GMWA 4J9NA 2UV8A 4NLGA 4EO6A 4DCJB 3S8SA 2M0GB 5KFNA 4WE1B 2WONB 2IM0A 4LBIA 3V81B 3OLBA 4E0DA 1L3UA 3CDWA 4QYRA 2HHUA 4HL9A 1HPZB 2YKOA 2WHOA 1GEHA 2GJFA 1A9NB 1URRA 1YJ7A 4PG5A 3DDIA 1UZDA 3UR0A 2IM3A 2IAJA 3QBCA 2D41A 1SJ1A 2CDRB 2M88A 2CPIA 5A0YB 1N56A 4PPDA 1HNIA 4USUA 3TRGA 4X2BA 1CEZA 5KFMA 4E98A 3FFIA 4LF9F 4DEZA 3BQ2A 1N8RT 4IO1A 3CCRS 2XS5A 4K4XA 3K5NA 3CMQA 2FLPA 3Q2SC 3TQ1A 3FQLA 1U24A 2DNMA 4ZP9A 1SL0A 2KI2A 4GO7X 4JV5J 3T5JA 2IJRA 1TKZB 1WOPA 1TUGB 5D4LA 1TV6B 5E33A 1JQGA 2IJFA 2L41A 1Y3JA 1T95A 1D3WA 3FZBA 1S1XA 3SCIE 3GMGA 3U1MA 1JLFA 3DLGB 2MEWA 1NJZA 4UY8T 4Q43A 2XY7A 4P72A 4I2PA 3DLEA 3KLHB 3LQVA 3P5TL 4BLGA 3CJRA 2E5IA 1M5PC 4EZ9A 3U7JA 3C15A 3ZO7A 1IKWA 1TMJA 1Y00A 2IMOA 5L9XA 4KPCA 2FJDB 2E29A 3WX4A 3QT6A 1F6TA 8ATCB 3BQ0A 3ENWA 3CCSS 3FBFA 5LXRA 3R8YA 1H2VZ 2MJUA 2UZAA 3NNAA 4C0OC 1WC1A 1PIEA 1H38A 2PEBA 2EG2A 3R5GA 3DU6A 3FUYA 2F3JA 5B0BA 1JKHB 1FO1A 3TAMB 3M8RA 3EZ5A 4J9PA 5AXLA 1RGVA 1BUXA 4M94A 3MWBA 2KT5A 1WHYA 1IKXA 3MCMA 3W2VB 2J6TA 4WWSA 3EM1A 4CM2A 3PYGA 2CQ1A 4M8LA 2XWYA 2HNZB 3H5YA 4CH1A 4XO0A 1IJEB 2DKOB 4EU0A 3CCZA 2VC1A 3MR3A 4J9LA 3L95X 1S1WA 5H9EJ 1FK9A 2CQBA 4HT5A 2DRDA 4E2FB 4TNOA 2XHCA 2RSQA 1JLBB 4Q0BA 1H72C 3DGPB 1K0TA 4PWUA 2YNFB 2QA4S 1S6PA 4ZPAA 3DLHA 1PO6A 2HGNA 3C6UB 3P45B 3EJMA 5CZXA 1OS5A 3OR1B 3D3BJ 2J0SD 4X64F 1CLFA 4LR8A 1J5OA 3O3LA 5CYQB 2HVDA 4PAAA 4RNOA 2FLOA 4ETXA 3TYTA 1HNXF 2CVIA 1F1BB 3KTQA 1LXJA 1W2BR 2XBPA 5CA5A 1H73A 4PXCA 1M0SA 1FDBA 1TTHB 2VFUA 4PYDA 3R5AA 3GR1A 4OJ1A 3PFEA 3WQPA 1FCAA 4OYWA 5KFTA 1SKRA 3MGJA 4F7VA 4YDDB 3DRYA 1NUEA 2X3DA 2A2DA 3OFFA 2V8PA 1ULRA 2FVRA 2CQ3A 5EWFA 5EHHA 5F3TA 1R31A 4CO4A 3KXDA 3V6JA 3UVJB 1N5YB 2Q6CA 1RU1A 1ZPVA 4ATNA 1UEVA 3MEGB 2XI2A 3DGVA 2G2ZA 5DG9A 4N47A 4FVMA 2E7VA 3CXCR 4HI2A 2CG4A 4N8OA 3B8HA 5IS2A 3T1AA 3Q22A 3GIRA 3A3NB 3KK1B 3RR7A 5DLGA 2ZBPA 3N6MA 2DGOA 3P5BP 3WIUA 5B09A 2CQ0A 1D09B 4LRFA 1QTNB 2GW8A 1SH2A 1VC0A 1K8AT 4KGKA 1ZBTA 3FSXA 3QIPA 5K5MA 2DGWA 3S7RA 2IDEA 2KVQE 5IWAF 5EWEA 3M30B 3BGOP 2XG8A 4RKUC 2MLYA 2B9EA 4UY85 4XK8C 1EETB 1XNRF 3G86A 4B3MJ 1NSPA 4PXEA 2ZWPA 5JJBA 3PIPQ 4KTQA 4R25A 2DGUA 5I3QA 1XK8A 2ACYA 5JVHQ 3M8WA 2KFYA 4RL1A 4Y0FA 3V4MA 1T8EA 4DL5A 2ZHOA 3KK2A 4GKJF 1K44A 2DNPA 3TUJC 4OI3A 1NK7A 3KOAA 2XMWA 2FHJD 3OV7A 2B5JB 1U6BA 1RTIB 1U7LA 2P8IA 1UVKA 4K4VA 2OELA 2U1AA 3EXCX 2DHSA 1RHRB 3DOKB 4RW9B 2XGQA 4UOCA 2JVRA 4LMZA 2FPHX 1T9XA 3HT0A 2IVYA 1N32F 2IBKA 1LWFB 2HHHJ 1E6VA 1OJ4A 4MK7A 2C2NA 2DJWA 2E9RX 1WC4A 3QFHA 4XDCA 2QC3A 3WC0A 1S1UB 3S01A 2GQ2A 3MMAB 2HHSA 5D4PA 4A8QA 1HD0A 1FWKA 4JYAJ 2NSCA 4I1TA 4OI1A 3GWCA 3ZZYA 4DX8H 1V3SA 5HQ8A 2Y1IA 4LRDA 2HIQA 4P10A 1F5BA 1Q5YA 3DDKA 5ETQA 2NXUA 3MEDA 3QATA 4LSNB 2EFQA 5F41A 1A0OB 4TY8A 2BJ3A 2EWHA 1Q53A 4N77A 2AYGA 3RB6A 1VIXA 1KN6A 3VAJA 5DDPC 5IT9Y 2HGLA 3PEJA 1OWXA 2OFHX 2C3YA 5ETLA 4M5HA 4I2QA 3AAWB 3IRXA 1U1OA 1RSCA 1RHQB 5T7LB 3BS9A 1ZA1B 4RWWA 2OSRA 4CLUA 2VBWA 2ZBCA 4ECXA 5HMWA 1SV5B 4CYUB 3VCDA 4H4KA 3QWPA 1S0MA 2LECA 3MEEA 1U1QA 1QE1A 3KLEA 2P6TA 3PJXA 3NCPA 4IO9Q 5KFLA 5DG8A 3HFZB 4U6PA 5BJRA 2Y8YA 3FK4A 4AXJA 4K5RA 2HWIA 3NKYA 3FFIB 1NK9A 1X5TA 3TZZA 1F3FA 2JC1A 1LKZA 3UE2A 4O0IA 2AGOA 2NZCA 1TL3B 2B4UA 1VYAA 2IRUA 1VRUB 4OZNA 3DYAA 3T5LA 2HVZA 5AE3A 1VGYA 2Z56B 1RWKB 4DL4A 1G2EA 1ACMB 3BYPA 5I42A 3FMBA 4Y2CA 2HQIA 3ILOA 2E1CA 1NKEA 5GMKa 2CJXB 1VFJA 5B7WA 4DSIA 4F3QA 4J9VA 1R8HA 4PUOA 3G82B 1M90T 1RYRA 4NLYA 1AZSA 1U2RA 4HDHA 3EGNA 4HVZA 1WF1A 4P7TA 3TW0A 2GJIA 3DLEB 3JTNA 1HARA 3HHLB 3M2RA 2N82B 2KXHA 3IWNC 4FYWB 3QGGA 4HR2A 1KS2A 4D3GA 4OX9F 3JTOA 1JB0C 3ZZUA 3VGUA 1OIAA 2EFVA 3WBZA 3PHEA 2H4WB 4CO5A 3HFVA 3NGUA 1C1BA 2COLA 3VAHA 2KG1A 1X4FA 2A6OA 3BSOA 4W98A 3OD2A 4OIXA 4QWBA 4X4SA 3MURP 3VAFA 3M2VB 4LVOP 2RD5C 1GK8A 1KRPA 2HRYA 4BHQA 2DO4A 5I3UA 2ZD1B 1N48A 2GVDB 4CLYA 1RACB 1F9HA 1BXNA 4DX5A 4DV3F 2M7SA 1LK5A 1JNRB 3V2UC 2FZGB 4ED4A 3MTKA 2YKNA 1B7FA 4FDFA 4FS2A 1KHVA 3QSIA 3NGKA 4LF4F 2D9OA 5L38A 5KAKA 2HAFA 4JV2A 2WCXA 4LF2A 1M5HA 4MKBA 1NJXA 1VR6A 2EVZA 4FN5A 3IO1A 4CT8A 4QW8A 2VBYA 1A7GE 2EG1A 2ZHAA 2CJ9A 3LPYA 2OPRA 2DRBA 1VQSA 4LF1A 3M8SA 3IXQA 4ICLA 3ENVA 2KO1A 2XSJA 4U67Q 3UWTA 4YR0A 2NUUG 1KR4A 4CWBA 2Z0GA 1YJUA 3TA0A 5D0RA 1Y10A 3MM7A 4LF7F 2ROEA 2BJ8A 1HL6A 4LSZB 4DV3J 2W01A 2KVIA 1FT8A 3A13A 2DH9A 4X4OA 4AT1B 3NMAA 5IQ6A 1N52B 3HMJG 3EXYA 1CC8A 4DUZF 3KHGA 1YJVA 4M5MA 1XR7A 5ETMA 3R2CJ 1TZ0A 4O3QA 5HL7Q 3QO9B 3RW6A 1UVIA 5K8MA 1GXLA 3EPIA 5B0CA 2JLEA 1X4HA 1TP7A 3K5LA 4O0NA 1RCOB 4Z37A 3R9LA 2HVIA 4EYHB 3U02A 4ZVHA 2SXLA 4TKTA 2RDIA 1CG2A 1TK8A 1NZAA 1TR0A 3HHLD 4U8YA 2CADA 4OHXA 4WF9Q 5ETNA 3OUYA 3HHDA 2HHQA 3N6NA 4J9KA 4A8MP 2XYGB 4ZMMA 1UEUA 3HSDA 4C8LA 4IG0B 1JLGA 4FNIA 5IC6B 1FE0A 3QFWA 4IH7A 1R8BA 1GX6A 4FBTA 1J5EF 1FNOA 4F4WA 4G65A 1OY9A 3MHYA 2F63A 1IWAA 3FRZA 1QUVA 4CLPA 4DL2A 1CULA 4PRFA 4M5KA 2WW4A 1WKKA 4X65J 3BH7B 1N54B 2HIYA 3BKFA 4KHMA 3MOJB 4UOHA 3QMQA 1FEEA 4KHRA 3TX0A 4EO8A 3ET6A 2DIUA 2A18A 3HSGA 3EWGA 4PPZA 2RQCA 1T05B 2G4BA 1CJTA 3J80U 2BJ9A 3CD0A 3HVAA 2XHWA 4C8MA 1S1VB 5CABA 1BHNA 4QR0A 3LGNA 3HKZD 1YQHA 4CO1A 4KHPJ 3H25A 1KHWA 1Y5LB 4CZCA 4KAIA 1FKAF 2MLZA 3QRPA 3D68A 4ILMA 4MFBA 5D4OA 4DDFA 3DRXA 4ID5B 2K8GA 2LA6A 1SXLA 4ECRA 3KK2B 2AX1A 2ZC3A 3ZTOA 1XNQF 3AODA 4F0MA 2YBVA 1JLCA 3A3OB 3FDSA 5KFKA 4QQBA 5F3ZA 2R7SA 5JVGQ 4DPUA 2YY3A 4DN9A 1FEHA 3H20A 2MKIA 1VRTB 2VG6A 3QZ8A 4DHVA 2CNNB 4ED0A 3W2WB 2PEHA 4X4PA 3PW5A 5C25A 2IYGA 4U8VA 4QCLA 2NYHA 2BOAA 3H4DA 4DJBA 4GVBB 2V34A 3MM6A 2GVZB 3ZZTA 5K8NA 3W8PA 2VG5A 3VQSA 3ZTPA 1TFWA 1HNZJ 3EE3A 1X9MA 1UVNA 3G6ES 1RAAB 3OXLA 1VLOA 1T03B 2HYIB 4V19X 1C1CA 4Z7CA 4X62F 2GQQA 2LQ5A 3W66A 1RAOA 2QMXA 3M8PA 4ECYA 3BGUA 3RB0A 2RRNA 4C0HA 1IBKJ 1U6FA 2GAGC 3PRVA 5M2PA 4RU2A 3A8IA 1OYDA 4K4YA 3HLUA 1X4GA 2XMKA 2QIFA 1NKCA 1ZTTA 4URSA 2DISA 5G0RB 5C42A 3KNGA 1CJKB 2XM3A 3I6PA 5FJ4A 3HPOA 3G71S 5MAOA 3VGVA 2KJWA 2D9PA 4JI2F 2UV8G 1VQ6S 4NCGA 2CWKA 2M70A 1NRKA 4KV8A 2BJ7A 1TVRB 1DJ0A 2LEAA 3M8ZA 1VOMA 3CDBA 3HKWA 3K0JA 5HVFA 3ZZZA 2KG0A 4M5NA 2VPXB 4DQPA 5KFUA 4L75A 4MMOA 3NGRA 1LWCA 4L73A 1RABB 2UXBJ 4F36A 1HYSA 4NLSA 3QPIA 4X62J 4XPCA 4ZCIA 1QE1B 3N28A 3HVRA 1REGX 4U96A 2ZM6F 2DNNA 4DPXA 5CHCB 2H54B 3PFOA 4J9QA 3C6TA 4ERDA 2P5VA 5EGYA 3ETMA 5KG5A 4LF5J 2YX1A 3TVKA 3D1QA 1S10A 2IMWP 4G1QB 3U27A 4LFBF 3FRYA 2CPEA 3HF5A 4X66F 2GS8A 2EK1A 4ED7A 3G6YA 3FCWA 1KONA 5A2QU 3EPGA 2YVSA 1IM4A 4YHHJ 4YOEA 3SEOA 2Q3PA 4ED8A 5I42B 2GNKA 3I87A 1KTQA 2B0GA 5HMYA 3UCZP 3W9JA 1VQ4S 2VQFF 4I7FB 1FNXH 1FD2A 4TQRA 2IDLA 4KT0C 1MU2B 4Z7YA 1DLOA 4NMLA 4LREA 3N4WA 3K8VA 3HK2A 2YTCA 4DS4A 3PR4A 1HIYA 1WDDA 4MK8A 3UO0A 4NMXA 5H9FJ 9ATCB 1X60A 2RT3A 4JI7J 2YX7A 5BYQA 3L9ZA 5HJYA 4EEYA 2HEKA 4UUXA 2J9DE 5KFXA 3V6KA 4F2SA 4IFYA 2XMVA 1XWLA 3QAUA 4JUZA 5JMNA 2G13A 4H4OB 4AQYJ 4KC5A 2VA2A 1ZM9A 3BEGB 3R6GB 1JLAB 1PGZA 3MR5A 1ROFA 2V68A 1RWPB 1VCTA 5J1EA 1FKPA 5L1LA 2V2ZA 1REVA 2AJ2A 2F65A 1BMQB 1NDKA 4OJGA 3H5UA 3UR3C 1Q4RA 1Q8IA 1LWXA 3QNWB 2UVWA 2EC2A 4TVAB 2VQFJ 1D8ZA 3DRPB 2PI5A 2CJBA 2KXFA 1U1RA 1M5SA 4QZVB 3RRGA 1OSDA 3MCSA 2BE9B 2XYPB 4YR2A 1TKTA 1VIOA 3V6DB 2VB6A 2DGVA 3VAGA 5A8KA 2HRUA 4WU3A 4DR7F 1Q8BA 1K9MT 1YKWA 5CD4H 3CC2S 3HZEA 2K7KA 5DO2A 1NU4A 1HHQA 3E01B 2V50A 3LANA 2BUNA 1JLQB 2B8PA 2MZSA 2MQOA 1YTYA 3PHTA 4M5DB 1NB2A 3CJQA 2OPRB 1RAIB 1XMOJ 3KKFA 5E2QA 2AU0A 1IJFB 3M32A 2DCUB 2I2YA 3F0NA 3T1YF 5KG7A 3IMQJ 4DMZA 2R42A 2VICA 4B9SA 3TJ9A 1U47A 4ES1A 2D3ZA 4Y2KA 2GO8A 2CWXA 3H7HB 2RF2B 2W7PA 4B08A 4DV0F 3D0IE 3MMBA 3NNCA 1N4LA 1HBOB 2DVIA 4PQAA 2BJDA 2DXFA 2OPPB 5F9LA 3LH2S 2QL5B 1UWBA 4OHWA 1FJGF 4Y28C 3HP6A 1JXEA 3BR8A 2JL9A 1KOOA 2EC0A 2HQ3A 1RI7A 4DV4F 2Z2MA 4KGZB 1FFGB 3SV3A 4B3SJ 4KYZA 3QYYA 3LP2B 3J81j 2Y9HA 4ALZA 1U48A 1DAXA 4ZVSB 3Q8YA 2HFUA 1HMVA 4RNHA 1PJ5A 1L5UA 4KH1B 2HBRB 2DTJA 2PI4A 4Y2MA 3WX8A 2ZJPQ 2KFNA 1UJ5A 4CNZA 5DQGA 4S0MA 2HVHA 3BF4A 1SQFA 2WVDA 2LEPA 1RTDB 4MTPA 3GYNA 2K1RA 1S9EB 2FVCA 3PJWA 4USJC 2AP6A 2IBOA 3IG1A 3C16A 1KVJA 3FQKA 1KBRA 1Q7LB 5MLCV 2B56A 2JVOA 2QFIA 1BQNA 4CH7A 1HWIA 3RBEA 3KHLA 2KM8C 3NCQA 4ELTA 4RNFA 5THWA 3ZTRA 5BYSA 2IC3A 1HW9A 4QIVA 5J1PA 2E44A 1KVIA 1YBUA 4WZMA 1L3TA 4LSLB 4P7VA 3BGRA 1E6YB 2GMJA 3I96A 5G4DA 3BV8A 1FRIA 4K2XA 1ZTWA 1W26A 3LP1A 1P6TA 4QOTA 3KHHA 1AYEA 3Q83A 4M63A 3BO2A 4ZLNA 4CCHA 3VVTA 2DNOA 2HRTA 2ZUAA 1D0EA 1Q8KA 3SSRA 2DK2A 2E1AA 3N9UC 1X4DA 4B3RF 4F04B 4CLLA 4LVNP 1S77D 5LMUF 3DMJB 3ISZA 4GC7A 1MN9A 4ED6A 2JOQA 5KG4A 2FQQB 4YQWA 3IGVA 1U4BA 4DN0A 4EK2A 2LU1A 5EX3A 3QSYB 2L3MA 2DITA 2FVQA 2ZKUA 3SFUA 3ZTSA 4PEOA 2H3EB 3SI8A 2R7RA 1MG7A 1HBNB 4DLEA 1N33J 2D7SA 3PYDA 3T9NA 2B9XA 3GIMA 2MZRA 1YDLA 2FHMA 3IC1A 1I3OB 2DR8A 3HHNB 3H5SA 2MMYA 3GSDA 3OHAA 4IDKA 1JXLA 3J81Y 5LMUJ 1R3NA 3W60A 4EFAC 5CYMA 1GMVA 4WP9A 3DRRB 5HVGA 2LXFA 2E5JA 4HH0A 4IOAQ 1FDDA 3BKTA 3OTCA 2BRLA 2L48A 1NPPA 2UUAF 4OZ5A 3QLHA 2XMJA 2C28A 3KUGA 5I4MA 1LW0B 2ROGA 2RU3A 2E7XA 2EEYA 2CIMA 2F8HA 3BREA 3VF0B 2W2QP 3CVKA 2MKYA 2YNGA 5J1NA 1HBUA 2GGPA 2H4YB 2PMWA 1MMDA 2MGZA 4CIOA 1EKRA 2V4JA 4WK3A 1O51A 3J7AN 2H48B 2WOMA 2JH3A 4LBPA 4FKYA 2CNKB 4LF6F 4J91A 4UW2A 2ZZTA 1XTZA 5J2PB 4XTTA 2CXEA 2YKMB 3LW5C 3TAPA 1VMBA 4XIUA 1RJJA 1YSJA 4CO2A 3I0SB 5KFEA 2JWNA 2Q79A 4ED5A 4C4WA 3D6FB 4DR5F 3UD5A 3RRHA 1UVMA 2KU7A 4PWDA 3MPWA 5KFPA 3IRWP 1VQ8S 1HQUB 1YG0A 4GVLA 4J9OA 5C7PA 3PYEA 1RTHA 1BY9A 3T1HJ 3ZFVA 1ZZFA 1I51B 4DV2J 2F9JA 2VG7B 2PT0A 2Z57B 5F9NA 1ZH5A 4M5JA 3JS9A 2F4VJ 5D3GA 2PFDA 2V63A 3TQEA 1EARA 1T11A 1Z4UA 2M4MA 2HFZA 2L9NA 3CO9A 4JI5F 2N7YA 4OZ0A 2CPDA 1DLOB 3GTYX 3NBPB 4DR3F 1PAEX 4OJHA 4I68A 2Q43A 5JXSA 4DR2J 1K1QA 1FJ7A 2CPXA 1R43A 4DCPB 1LFPA 2XLKA 2R2SA 1WG1A 4JB8B 2ALYB 1KLMA 3CCLS 4DSKA 3MD1A 5L1KA 3O8WA 1FWLA 3FNNA 2C3OA 3CMES 5FDLB 2CVEA 1FF2A 4YR3A 1WWHA 2HZVA 3DLKB 5LOQA 2V2KA 1AUSL 1LWEA 3NGSA 5J2NB 1WOOA 4ED2A 4JI6J 2WAQD 1KQFB 4YB6A 4JI1F 1REVB 1IR2A 1NMEB 3M1VA 2ZUGA 1UA0A 3SCJE 2FLNA 4K4SA 5LL6d 4YFUA 4TU9A 4ZA1A 1FRJA 2DYAA 1XIQA 4C6AA 4JV0A 1IXKA 1VHIA 1WUUA 4F3OA 3D66A 4QU6A 2RUSA 2ZNYA 3B54A 1TL1A 5E0OA 1IN0A 1JJHA 2W9CB 3PW0A 3AFGA 3NXZA 2H1YA 2XMTA 1FFWB 3VGTA 4NI2B 4WE1A 1XMQF 2WONA 3V81A 1H2TZ 2OJ3A 3V4IB 1HPZA 4Q2MA 3KJNB 3GONA 1VHFA 2QE5A 4Q45A 2XQCA 5HQLA 1DTTA 4IH6A 1SIZA 4KH0B 4FS1A 2UUCJ 1IWGA 5C2GA 3KMSA 4P52A 1UZHA 3A12A 3GIIA 3E8OA 3F73A 2MKJA 2PN6A 4LF8F 2RNEA 1R8AA 5H1SV 2DNRA 4FPRA 1T3OA 5KOXA 5KFVA 2H5IB 4F0HA 2FJEB 3Q24A 4I69A 3DDNA 2ZH9A 3DI6B 1AUDA 1V6HA 3SYZA 2DPIA 2UU9J 1NHKL 2VHGA 4FXVA 4RUAA 3NOGA 3W63A 2AV5A 3I9ZA 4MYUA 3UNYA 2OEKA 2Z2LA 3UW1A 1RT2B 4OHYA 4XPEA 1B7YB 2YQ3A 4O3NA 3W5YA 5HATA 4NEYA 4ZS6A 4F3MA 3MPYA 2ZJQQ 1L3VA 1OY8A 2V67A 1SJQA 1TKZA 2Z2ZA 1X31C 1OPZA 2QTWA 3ZNUA 4KB7A 1TV6A 3FBCA 2DD8S 2M2BA 2YWKA 2XNRA 2QLXA 1TL7A 1OPIA 2FDNA 3FBBA 4AD6A 3DLGA 4LFAJ 2FJAB 2R7TA 3KLHA 1LK7A 2NXJA 3HVWA 1OSCA 4O4GB 5M2RA 4ZKAA 1ZAVA 2UVRA 5HMZA 2CQHA 2VFTA 4DWIA 2FC9A 1X9WA 3NWGA 5F8MA 2AZ1A 4QW9A 2XZWA 1N0UA 1UPMB 4OHVA 2HQFA 4KKOA 4CI0B 3RUBL 5ITHA 3D3CJ 2CJAA 1NKBA 2W2OP 1JKHA 3B82A 3V5RA 3TAMA 3K5PA 2UUBJ 1HW8A 2QJ3A 1U8SA 2C2OB 2HLTA 2C2DA 2ROPA 3W2VA 1SCJB 2IYIA 4KFBB 1WKLA 5AJ3J 2DGQA 1D1UA 1X7VA 1FVQA 1CJUB 5KFYA 2HNZA 3LA0A 3IBCB 4X84A 2E5GA 1N34J 3LP1B 3CD6S 1F2GA 2J9EA 3IR7B 2NXNA 1TK5A 4ZVFA 3SDEB 2HLUA 1Y0HA 2KKHA 4FYYB 4DL3A 4KE5A 1OY6A 5KFBA 1T9WA 2I8EA 3I32A 1FNMA 3TOQA 4OX6A 4WXOA 4ECQA 2V5HG 1NK4A 5LMNJ 3T41A 2HS0A 4DFKA 1JLBA 1KQGB 2AIRB 4NE9C 3UDCA 1SUQB 3DGPA 1HBMB 2CJYB 4F4XA 2YNFA 1HQEB 2QZ8A 1NLKL 2YNHA 5DQIA 2DXDA 4PWWA 4IR9A 3ENAA 3OR1A 1HD1A 5GVQA 1FHTA 4FXDA 4N56A 4A4JA 5CYQA 2BKOA 3H0PA 3IM8A 1GXUA 1VLYA 4C3MA 2K3IA 1PC4A 1XR6A 3NS6A 2FHJA 4DV5F 4IYQA 1NB7A 3I56S 3CULA 4R0JA 4ZVOB 2XCPA 4CLKA 2BE2B 4NEZA 2XLJA 2OIHA 4E8UA 4RUHA 2ZH3A 2OD4A 2FD2A 4YP3A 3ONQA 3ZZOA 2YH0A 2MKKA 1QAJA 4YB5A 2CQ2A 1NZ8A 2W2MP 2DGSA 4GKKJ 2HBYB 4OYZA 1A6LA 3UDEA 3SZ2A 6FDRA 3KJVA 3CWJA 2Z8QA 3JAMY 3UVJA 1N5YA 1IBMF 1FXDA 2KZMA 2MKCA 4MIWA 2HSEB 1QM9A 3KLIB 3MEGA 1RBAA 3TUZC 5D4NA 3UDLA 1MWQA 2DCLA 3ADAC 1O6XA 1EJ7L 4A8WA 1HFEL 3IS9B 2FHOB 4DV5J 3CCWA 3KK1A 3HD1A 2GHWA 1UFLA 3FCHA 3S6EA 3BKUA 2I5JB 5KFFA 2VFRA 3MECB 3OLAA 1SB6A 2VPYB 3BSAA 4X4RA 3CIMA 1N5SA 3M9NB 2FY1A 4WP8A 3PRBA 1UEKA 2OFGX 2ZITA 2V8VA 1G4CA 4FBUA 2DB1A 2RQKA 1IBLJ 3OTOJ 2NS1B 1AT1B 5DRKA 2RIJA 5K9FA 1XERA 2K7JA 2CA9A 5DQHA 3CJ8A 1F5CA 3M30A 4OLOA 1EETA 5L8RC 1PYOB 1RWNB 4OLPA 3CJSA 1URNA 2FJXA 5AT1B 4A47A 1Y7PA 4CLWA 3GV7B 2V8HA 3C19A 3Q2TC 4NL5A 4HKQA 3IN5A 3PG9A 2ZE2B 4M5LA 4YY3F 1HNVB 2HZAA 2HMIB 2M52A 1HHSA 5CQGA 4IG3B 4C97A 1KEKA
chains in the Genus database with same CATH topology
1WNEA 4NLVA 3GV5B 2HVIA 2J9DA 4R8UA 1RP5A 4EYHB 4KR0B 4B3SF 3U02A 4ZVHA 2SXLA 3GB0A 4ZDNA 4UUWA 4CO3A 4TKTA 3MR2A 2RQ4A 2KFZA 2VBZA 4BDPA 2RDIA 1CG2A 1DQAA 2J7UA 3CD7A 1TK8A 5AXNA 1NZAA 1TR0A 5SUHA 3ULHA 3KYLA 1R0AB 1D9FA 3HVTB 4BS2A 3GE9A 3HHLD 3P96A 4GO5X 3LF0A 4C8KA 4OHXA 1P9QC 4WJBA 2UUTA 2W8LA 4WF9Q 3B78A 2B4VA 2B5JA 1RWUA 1U09A 3OUYA 3HHDA 2HHQA 3OJUA 2B9WA 3N6NA 1RTIA 1TKTB 2EK6A 4J9KA 3ZC4A 1BD6A 4A8MP 2ZBIA 4G1IA 3NAIA 4ZMMA 3HM9A 2W25A 1UEUA 3IBWA 2C3PA 3V6HA 2CYYA 4C8LA 3OVBA 3KK3B 4DV7F 2JHEA 4IG0B 5A8KB 4NCBA 1TFYA 3PVXA 1JLGA 4NLUA 2CQIA 4PQUB 5KOWA 4LUBA 5EUHA 4FNIA 4DSJA 1NNDA 4RW9A 2R7UA 1CC7A 1FE0A 4R5PA 3AB2B 4IH7A 3DI6A 1R8BA 2RKIA 5D6GA 1GX6A 3Q0AA 4FBTA 3HFKA 3VTIA 2NLWA 2UUWA 1J5EF 2PO4A 5GAGU 2WTFA 1FNOA 4MAKA 5KFJA 5CCMA 3M6VA 3PZPA 4F4WA 5HLFB 5DETA 4DR6F 5A6PA 4O3PA 3MHYA 3H2UB 4QWDA 1UVJA 1O0PA 3QGIA 2RUGA 2GIQA 3FRZA 2KH9A 4ZOSA 2X1AA 3HZGA 1U1NA 1QUVA 1CSJA 1W2IA 4DL2A 4OFZA 4PRFA 2DNHA 2ZZMA 1RT2A 2E1RA 4JI4F 1IKYA 2VD3A 2XMMA 5LJ5Y 5DM6Q 1G3OA 1S1UA 1F0XA 3MMAA 4A48A 3M32B 5KFAA 1N54B 5IT4A 2DH7A 1HWUA 3CDUA 3MOJB 4OZLA 4KHMA 3US5A 1BLUA 5E41A 4B3OB 2VBXA 3QMQA 1FEEA 1L3KA 1WTBA 4KHRA 1FRLA 2BV3A 2W24A 3H8YA 1UJ4A 5A0YA 4EO8A 4RW7B 2GX8A 4K4WA 3W7BA 2DIUA 3I5AA 2A18A 2CZVC 2R7OA 1R27B 1QJHA 4PPZA 1T02A 1PILA 5K14A 1VC6A 5KT7A 3GYXB 1YJNS 2EKYA 1F60B 4FP9A 2RQCA 1T05B 2C3UA 2KM8B 5DLFA 3MMBB 5SZTA 5HROB 3O6QA 1U6ZA 4DQSA 2MY7A 2G4BA 1WF0A 4NA2A 3CD0A 4G6VB 3HVAA 4DV1F 3CTRA 3OR2B 4M1KA 2GCFA 4LSNA 1QSSA 3M6UA 2XHWA 3J7Z5 2AWZA 4C8MA 1EP4B 1S1VB 2UVUA 2ZKTA 1CQNA 1HWKA 4QR0A 3LGNA 3HKZD 4UQTA 4FF2A 1FRKA 1YQHA 2VA3A 5B08A 4RW6B 1N5TA 3N5BA 4CT9A 5IZHA 4O4GA 1UWBB 2W4DA 3O5TB 4TLRA 4CO1A 1KHWA 2MZ1A 3H25A 5D78A 4C2MA 3OW2R 4MK9A 5E3QA 1T3NA 2KT2A 3OQ2A 4PCQA 1Y5LB 3THPA 4CZCA 4KAIA 3HXMA 1FKAF 1LW2B 1NK5A 4IOBA 4J9MA 1WG4A 5B0EA 5T7LA 3T19A 4ILMA 4MFBA 5D4OA 4DDFA 2GO9A 2C22A 1OQ6A 1S4FA 2R8HA 2BXJA 3AQPA 3DRXA 4ID5B 2K8GA 4JV5F 2LA6A 1SXLA 4ECRA 2POKA 3DRSB 3KK2B 2VOOA 1JX4A 2AX1A 2X1GA 2ZC3A 4Y2AA 4F50A 3DU5A 3L7PA 3ZZ0A 1XNQF 1BC6A 4PR6A 2XLIA 3UCUP 1NK8A 2RRBA 5L1IA 1DTTB 1JLCA 2BBEA 3FDSA 1SV5A 5KFKA 4QQBA 1H6KX 3R5CA 3M2UB 4A46A 5F3ZA 3PW4A 2LVWA 1ZAWA 5JVGQ 4B9UA 1U1PA 4HT7A 1HMVB 4Y00A 4LQ3A 4KQZA 4NLDA 4C0BA 2GFFA 1H3DA 2MZQA 2YY3A 3HHEA 2ZJRQ 2DPJA 4DN9A 4C7QA 2RJZA 1FEHA 4Y3CA 3H20A 2MQPA 2KJVA 2CPYA 1FXRA 2PD1A 2MKIA 1VRTB 4A8XA 2VG6A 1P1TA 3QZ8A 2YKPA 1X9SA 2JSXA 2ASYA 5KFRA 4DV6F 4DHVA 4NCAA 4OZ1A 3C8YA 2ZH1A 4C8ZA 4QYZJ 3CC7S 2MXYA 2L08A 1IUJA 4MIBA 5CYJA 5J2MA 2ASJA 4ED0A 3W2WB 2FJWA 4C11A 2AJFE 4X4TA 3G9CA 2PEHA 2RQMA 2DGXA 4X4PA 2K1RB 5C25A 3TVZA 3PW5A 4KFBA 1YI2S 3X3UA 4G3IA 4FVCA 2XY5A 4PXBA 4I0WA 2MZTA 3RU0A 3PIOQ 1FESA 2BOPA 4U9RA 1HA1A 5AXKA 1V3ZA 4N76A 2IYGA 2F8EX 4O3OA 4QCLA 3LAKA 1IR0A 4FZVA 2PE8A 3IG1B 1QTMA 3H4DA 3MD3A 4DJBA 4DF8A 4NLPA 1UFWA 3MEKA 3MM6A 2R7QA 1N33F 1TL3A 4TQSA 3ZZTA 2BR0A 4KJIA 4BCAA 5K8NA 1VRUA 2VG5A 3F56A 2HPUA 3VQSA 1TFWA 4I67A 3B4MA 3FEYB 3MR6A 3CEDA 1BQNB 3C3LA 3ICLA 3ISNC 4IQMA 1X9MA 3D1OA 3SDEA 3MFHA 4DS5A 3G6ES 1UVNA 1ZM2A 3OHBA 4DQIA 4R0EA 1X5PA 3OXLA 1YVFA 1SL2A 2V8GA 1XBWA 1KTVA 3CB4A 4Y2IA 2IAJB 3KLGA 1T03B 5IM0B 4ECUA 2AGPA 1OQ3A 4Y6IA 2HYIB 4V19X 3PKMA 1C1CA 3SMZA 1SJ3P 2UXCF 4ED1A 1ZM3A 4X62F 2GQQA 2WBMA 1S49A 1S76D 2LQ5A 1YRXA 2VFVA 2HAIA 2IC3B 2QMXA 3M8PA 4J9SA 1HHTP 1UW4A 1HNIB 4Q5VA 2EW9A 4ECYA 3P6YC 1Q8LA 1RT6B 3BGUA 3RB0A 5DDOC 1SUQA 2RRNA 2PGCA 4C0HA 1WEZA 3K8WA 5DGBA 4NWBA 1U6FA 1HBMA 2HFNA 3MAHA 5IQQA 1JWWA 1C0UA 5M2PA 4RU2A 5LXYA 1HQEA 4OV1A 4JI8F 4K4YA 3CMAS 3K58A 3HLUA 3Q8PB 1X4GA 2XMKA 2QIFA 3BGRB 4ED3A 1UA1A 1NKCA 1XN9A 2WB1D 5HP1B 1FJEB 1R7IA 4URSA 1ZTTA 2DISA 5G0RB 3CF5Q 5C42A 3KNGA 1FRXA 3KFWX 4CTAB 3GZ7A 3T5KA 3AH6A 1ZOTA 1DQ8A 3I6PA 2WBRA 5KT6A 2HWHA 5FJ4A 2ILYA 2Q6BA 3HPOA 1FKOB 5KTQA 3G71S 5MAOA 2R7VA 2YNIB 4NRUA 1RT3B 3M05A 1GTEA 4DSEA 2B7CB 4ZCKA 2KJWA 3HHLA 4IUFA 2D9PA 2VKRA 4JI2F 2UV8G 3OJSA 1VQ6S 2CDQA 5EX0A 2E9ZA 4PG4A 4ZHRA 3CD5A 4NCGA 4AL7A 2M70A 3FSYA 1NRKA 4A8OA 2MQLA 2WB4A 3D2WA 1MMLA 1YITS 4K5SA 4Q8FA 4DR4F 3OXFA 4O4RA 4WFBQ 2PMZD 2MY8A 4KV8A 4EYIB 4O3SA 5A8RB 1SI9A 2BE2A 2E9TA 4LIWA 3K7RA 3R3TA 1RKIA 5F8LA 3HDSA 3K2YA 1TVRB 1DJ0A 2LEAA 2MSSA 3FEXB 3J7YU 1VOMA 1VQNS 3IR6B 4EZ6A 3CDBA 3HKWA 2X3GA 3K0JA 4RBVA 3ZZZA 2KG0A 1RTJB 2VPXB 5KFZA 2Y1RI 5LJ3Y 1BQMB 2YKAA 4KKOB 4DQPA 2VZ9A 4F26A 5KFUA 4DG1B 5K8PA 4MMOA 3OBIA 1M5VC 1LWCA 4NX9A 5HBMB 2OO4A 1X5SA 2HZCA 3M2VA 3EYZA 1Q7YT 1HYSA 3TP2A 4NLSA 2QO3A 3QPIA 4XPCA 2HNYB 4ZCIA 1QE1B 1CVJA 3N28A 3DOLB 3HVRA 1S1XB 3C6UA 4NPOA 2RS2A 4XDDA 4ECTA 2JX2A 1JLFB 2DNNA 2ZM6F 2CFXA 5J2QB 5CHCB 2GA7A 3UD3P 3DN9A