1SXLA

Resonance assignments and solution structure of the second rna-binding domain of sex-lethal determined by multidimensional heteronuclear magnetic resonance spectroscopy
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
97
structure length
97
Chain Sequence
MSYARPGGESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLSVRLAEEHGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords SEX-LETHAL PROTEIN PROTEIN
publication title Resonance assignments and solution structure of the second RNA-binding domain of sex-lethal determined by multidimensional heteronuclear magnetic resonance.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 8
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 1994-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sxlA00
2CPDA 2NLWA 1U6FA 1JJ2R 1M5KC 3NNCA 1U1OA 2MKKA 4WFBQ 2FC8A 2DGXA 3UCGA 2LYVA 5IFMA 3FEYB 2MKIA 2G1DA 3UE2A 2DHGA 2DO0A 2MJUA 2KU7A 3I55S 1WEZA 2OTJS 3TO8A 3FEXB 3K0JA 2CQ0A 2CQIA 2DNMA 3L3CA 3G71S 2M52A 1N8RT 1YJ9S 3ULHA 2PE8A 4CQ1A 5D78A 5GMKa 3VAGA 2MZTA 2QA4S 3S6EA 1VQMS 1QM9A 2MQPA 2U2FA 1L3KA 2E44A 2YH0A 3UWTA 4EGLA 1VBYA 2MB0B 1U1QA 1KD1T 1YJWS 1HA1A 1S72S 2RNEA 3MUTP 2KM8C 1WG4A 5JVGQ 3ZZZA 1VQPS 2D9PA 4WFAQ 2OSRA 2HGMA 3G6ES 2VOPA 2N3OA 2MJNA 2LQ5A 2QEXS 2M8HA 2CPYA 4C4WA 1HL6A 3THTA 1JJ4A 4PR6A 2JRSA 4QU7A 2L9WA 2MGZA 2KN4A 4LJMA 3THPA 5LJ5Y 5EN1A 2D9OA 2CJKA 1OO0B 3HI9A 2LECA 3DXBA 2AYMA 2O3DA 3P3DA 2LEBA 4IOAQ 1M5OC 4C0OC 1WEXA 4J5OA 2KFYA 2XS2A 3MD1A 1SJ4P 2LKZA 1JJHA 2MYFA 2DNKA 2RT3A 1WF1A 5CA5A 3PIPQ 4IO9Q 2J0SD 1WF0A 3DLLQ 2KXNB 1YIJS 3EGZA 4RU2A 2XS5A 3G9CA 5H1SV 5LSOA 2VOOA 1W2BR 1U1LA 2N82B 4UY8T 3B4DA 1U1RA 2CQBA 1BY9A 1S79A 2U1AA 2RQCA 3CMAS 2OSQA 3OW2R 2MZJA 5DM6Q 1SJFA 3BO3A 1U2FA 4PKDB 3CCQS 3MUVP 1VQLS 2DGVA 2CPIA 3MXHP 3H2UB 3RW6A 1A7GE 4TU9A 3RW7A 1OIAA 1D9AA 5HO4A 1QVGR 4W92B 2DHXA 1H2UX 2KXHA 2XB2D 4WFNQ 3NNAA 2DNOA 1WF2A 3EGNA 1VQ5S 2DH9A 1M90T 3VF0B 1URNA 1HD1A 1OPIA 2M88A 2J8AA 3SXLA 2KRRA 2F9JA 3CF5Q 2LA4A 1WHXA 3BEGB 1O0PA 2MZSA 3SDEB 2ZJRQ 1U1MA 2RVJA 3LQVA 2MKSA 1SJ3P 3TP2A 5DDRC 4IUFA 2G0CA 1VQ6S 1N54B 5LXRA 2M70A 2RU3A 3CCJS 1WWHA 1X4AA 2DNHA 3CPWR 4WF9Q 2KVIA 4QPTA 2HGLA 1R8PA 1X4HA 1VQ8S 2KT5A 2DGQA 4YB1P 3Q2TC 2RRAA 4PRFA 2M7SA 3P49B 2FHOB 2DITA 1N52B 4F25A 1U1PA 5GAEU 1QVFR 2CQHA 1WI8A 3I56S 1FO1A 3D2WA 3HHNB 3CXCR 1VQ9S 3U1LA 5IQQA 2VODA 1FNXH 2J76E 5MLCV 3CCSS 2PEHA 1CVJA 3MDFA 3ZZYA 1FT8A 1M5VC 2MPUA 5BJRA 3VAHA 2X1BA 2E5HA 2E5IA 2ZJQQ 1U1NA 2M2BA 1VQNS 3S7RA 4CH1A 2XNRA 2JVRA 2DNRA 2HZCA 2LEAA 2HYIB 2N3LA 3MD3A 2OTLS 2OJ3A 1PGZA 4TLQA 3CUNA 1HD0A 4BS2A 1DRZA 3G4SS 3H2VE 5IM0B 3CCVS 3CMES 1X4CA 4ED5A 1Q86T 2D3OR 2DGWA 2EVZA 2AYBA 4IOCQ 3CCRS 1YJNS 4QU6A 2A3JA 2LA6A 1WG1A 1P1TA 1Q82T 1DHMA 1UAWA 2EK6A 2ZJPQ 1VC6A 2EK1A 2N7CA 1NU4A 2YKAA 4M5DB 1Q7YT 4C7QA 3CTRA 2L08A 3CULA 2E5GA 2DIVA 2CQCA 2DB1A 2MSSA 5GADU 1RKJA 1R8HA 1DBDA 5DDQC 1FJ7A 5GVQA 2DHAA 3MURP 1RK8A 2CQPA 1X5PA 2L41A 1ZH5A 1U6BA 3G8SA 2AD9A 3CCUS 4U67Q 2K8GA 1VBZA 4FXVA 3IWNC 2DNZA 2JX2A 2MKHA 3BS9A 2CQ3A 3VAJA 3U1MA 2MQLA 3PIOQ 4F02A 3UCZP 1ZZNA 2OIHA 1D8ZA 1B7FA 2KRBA 1WEYA 4YUDA 1UW4A 3VAMA 2LXUA 2MQQA 2BZ2A 1XN9A 1PO6A 3S8SA 1YI2S 4P6QA 1WTBA 4W90B 1FJEB 2CQDA 2CPZA 3NMRA 2G4BA 2K3KA 4OZ1A 5FJ4A 2VONA 2MZ1A 1UFWA 1WELA 2KG0A 2J0QD 2M4MA 2CQ4A 1UP1A 2F9DA 2X1FA 3J7ZT 2Q79A 3CCLS 3UCUP 1SJRA 1X5SA 2KXFA 2MGZB 2AYGA 2KYXA 3V4MA 1KC8T 1WI6A 2B0GA 5D77A 5LSLA 2CQ1A 4QQBA 1K8AT 3NNHA 1M5PC 1KOHA 3B4MA 1X4DA 4A8XA 2RS2A 2NZ4A 2BOPA 4LIRA 1VQOS 3R27A 2KM8B 4TU8A 4WIIA 2MZRA 4ERDA 2AYEA 1VQ7S 3MI7X 2LMIA 2M0GB 1WHWA 3JB9k 1Q81T 2DIUA 1VBXA 2RRBA 5DDPC 1H2TZ 1OWXA 5DM7Q 2JWNA 1K73T 2E5JA 3CD6S 2LXIA 4ZKAA 1VQ4S 1X4FA 5DETA 2YWKA 3CCMS 4V19X 2LCWA 4Y00A 3EX7B 1H2VZ 2DGSA 2DISA 2GO9A 4FXWA 2CQ2A 1SXLA 2CPEA 1A9NB 4YOEA 2M8DB 3S01A 3MUMP 1M1KT 3MOJB 4OZ0A 3LPYA 2MQMA 2KH9A 2DGUA 5LXYA 3CC4S 3VAFA 1X4GA 2CPJA 2MSTA 3VALA 3P6YC 2I38A 2MMYA 2MZQA 5HL7Q 2MQOA 2MY7A 2SXLA 2F3JA 1YTYA 1YITS 2MKCA 2V94A 3SDEA 1X4BA 2MXYA 4UQTA 1X5TA 3J7YU 1ZZFA 2CPHA 2DNNA 2DO4A 3N9UC 2MKJA 4WCEQ 1YWXA 3TYTA 2ADCA 2ADBA 3BO4A 2DH8A 1KOOA 5CXTA 1VC0A 2UP1A 4F26A 2YH1A 3CCES 3CC2S 5JVHQ 3IRWP 1DZ5A 1WHYA 2DNQA 3SMZA 3NS6A 2JVOA 3VAIA 2X1GA 2HGNA 1AUDA 2WBRA 3VAKA 4Z2XA 3G8TA 1FXLA 5ITHA 2DNPA 2DNYA 5GAHU 2KG1A 3R1HA 3Q2SC 2DGTA 2MHNA 1FHTA 2FY1A 4Y0FA 2DH7A 3BO2A 2I2YA 5LJ3Y 1U1KA 1X4EA 2XS7A 1FJCA 5CYJA 3R1LA 2FPHX 2HVZA 1N88A 3UD3P 2CPFA 1VC5A 1VQKS 2XNQA 4WKRA 1KQSR 1P27B 1SJQA 2FC9A 1YHQS 2QFJA 1K9MT 4CIOA 2DNLA 2CQGA 1WG5A 2DHSA 3US5A 1NO8A 1NJIT 1H6KX 2MY8A 3G96A 2M9KA 2KHCA 2RS8A 3CC7S 1JMTA 4LMZA 1X5OA 5IM0A 1X0FA 1G2EA 3UD4P 3P5TL 4CH0S 1IQTA 3NS5A 2CPXA 2ERRA 2MQNA 5GAGU 2GHPA 2X1AA 2DNGA 1WHVA 2DK2A 2RQ4A 2RUGA 2XSFA 5DDOC 1F9FA 2DGOA 2KI2A 4TU7A 2YTCA
chains in the Genus database with same CATH superfamily
1N32J 4IFYA 2AIRB 3NNCA 1S1WB 2OELA 1RT1A 3UCGA 3MEEA 2BE2A 4A8QA 4KPYA 2BACA 1Q8LA 1SIWB 4USVA 1N8RT 4DX8H 2OPRA 2EFGA 3PW5A 2A2CA 1U1QA 1YJWS 3SZ2A 1HA1A 1AT1B 2HBRB 5B09A 2D9PA 4B08A 2O67A 4FKYA 5A8WB 1Y10A 1UWAA 3CDUA 4CYUA 4DV2F 5D3GB 1NH7A 1DTTA 2MGZA 1E6VB 2H5JB 2KZMA 3CIZA 3WIVA 4ALZA 1FKPA 2C3YA 1S12A 2JC1A 4QIEA 3HFZB 3BGLA 2J0SD 5L1KA 4X4PA 4DDFA 4DV0J 4X66J 3FBCA 5HQMA 2OEMA 4LF7J 5D4NA 4NLDA 3TA0A 3MUVP 3A13A 3I9ZA 2CPIA 4DI6A 4TU9A 4ECQA 3BREA 4W92B 3U27A 1H2UX 1FRMA 1W7WA 3G6VA 2HS4A 2HFVA 1NNDA 4RW4B 1VQ5S 2PFFB 4IH6A 5B0GA 4JYAJ 1URNA 1HD1A 2OFHX 3CF5Q 4YQWA 3E8OA 3PDNA 4JI5J 3H40A 2H4YB 1WKJA 3PRBA 4RW6A 2VC1A 1S1XB 3OL7A 4ZVPB 2P9EA 2KVIA 2B8PA 2XZDB 2ZC4A 2BDPA 1N32F 4LSZB 2C2MB 3V81B 2DGQA 4YB1P 3CJSA 2EXUA 2M7SA 2GJ2A 3BBCA 2QLXA 1DLOA 1Q8BA 3BSCA 4KGKA 4AQYJ 3HX9A 2ZOGA 1NKEA 1PJ5A 4I1TA 1GFWB 4NYOA 1M5VC 2D7SA 1E6YA 2RIJA 4CH1A 2I8EA 2HIYA 2N3LA 3P96A 4Q2MA 5KFDA 3N28A 4OFZA 2BANB 1Q86T 1Q5YA 2AYBA 1TV6A 5HVFA 1RA7A 2HQFA 2YPZA 2IM3A 4USHA 2BQUA 5A6WA 2YKAA 1FA0A 4GC7A 3R7BB 4KR0B 3MFHA 2HIQA 3EXCX 1S99A 1DTQB 4DV0F 2Z57B 4X66F 4I6AA 4LF7F 5DJBA 1D8ZA 1WEYA 4ZLLA 1SB6A 3VAMA 4USTA 2C3MA 5J1NA 2PO4A 1WTBA 1JXLA 1LQ9A 2LEPA 1U2CA 2VONA 5CZVA 3NCPA 3R3TA 3KLEB 3DGVA 4L74A 4JYAF 4DL0C 1B3TA 1CC8A 3N6LA 3CJRA 4OYIA 1JLBA 4JI5F 2AJ2A 2ACYA 1K8AT 4BCAA 1EQMA 5C42B 3FRYA 2BX6A 3J81j 3DU6A 5KG7A 3HDSA 3FK4A 4AQYF 3DDNA 5THWA 2HW3A 3NOCA 3IS9A 1QUVA 5EGYA 2ZOMA 2G2YA 2YWKA 2V8GA 4PZVA 4CLKA 4DU7A 4DS4A 4LREA 2Z2ZA 2ZZNA 3V2UC 1RT5B 3OXLA 1DQ9A 4BHQA 2PI5A 3KUGA 3CJ0A 2MQMA 3OQ2A 3GCWP 3M8SA 3KG0A 5J2NB 3CIMA 2H3EB 3VALA 1NPKA 5BYRA 3W9JA 2SXLA 5KFPA 4P71A 4X4NA 5KG4A 2GZOA 3J7YU 2CPHA 1RBLA 2YKQA 3I0SB 2E1RA 4DQIA 2DH8A 1KOOA 1V6HA 2QA1A 4MIWA 5CXTA 4PPZA 4OX7A 1NB2A 3IA0A 2GMHA 4PYAA 5ETSA 2QTWA 1RT2A 5GAHU 3R1HA 3QIPA 5J2QB 3CGIA 5HMZA 2WONB 4Q8FA 2F5GA 4EZ9A 4NMLA 4A8YA 4UW2A 4NOHA 1VRTA 2LQ8A 4KSEB 2YNHB 4Y2AA 2EI5A 4PQAA 4CIOA 1C4AA 4CNYA 3V4IB 2DCLA 2JSXA 3IG1B 5C2CA 4C97A 3KKFA 3TA1A 3IP0A 4LMZA 1KKHA 4OLPA 3I6PA 3KHHA 2FYXA 3DM2B 1WHVA 2YKMB 2GMJA 2RHQB 1AZSA 4ANDA 2YTCA 3M8RA 2F63A 2HFZA 4KQZA 3M2VB 4LFBJ 3SIPB 2UVWA 1U1OA 3D6HB 1JLGA 3LP1B 3JAMY 2FC8A 2LYVA 7AT1B 1XBWA 2MJUA 2F1FA 2JL9A 2OTJS 2OPPB 1VK3A 3RRKA 1YJ9S 1YBAA 2G2ZA 3ZZZA 3H0PA 2OPSA 3B82A 5RUBA 2Y1RI 4C4WA 4LSNA 1M1GA 1JJ4A 3C16A 3MECA 2O66A 1I51B 2PEBA 2D9OA 2HVHA 1N33J 3SCLE 1TL4A 3KLGA 4B17A 3A12A 3T1HF 2MYFA 3OV7A 1YZ7A 1YVFA 3PIPQ 1WKLA 3TEHB 1QJHA 1FTCA 4USIA 3UVJA 1P1LA 2ROEA 4H4KA 3MHYA 3G9CA 2WOMA 3VV2B 4G6VB 1QTNB 3OW2R 2RKIA 4U96A 1EKRA 2IC3A 4MYUA 3D0HE 3H2UB 1NZ8A 1BC6A 3M6WA 3M9OB 2F7VA 3RTVA 1WOOA 4HVZA 3I0RA 1N36J 2YNFB 4ILLA 1RWMB 1XQIA 2MHEA 2VG6A 1IBLJ 2R9LA 3HCXA 1D09B 3KK3B 3FBFA 2HAIA 3CCJS 1X4AA 5B0EA 1Y00A 4QPTA 2HGLA 3HF5A 1BQXA 4LFBF 1VQ8S 3NL0A 1F60B 1YBUA 2DITA 4MFBA 4ZN3A 5EWGA 4P2FA 4DPUA 1NHKL 3ZTRA 2BE7D 2PEHA 2W4PA 1GMVA 5KOWA 1NBEB 3ZZYA 1NJYA 4L3NA 4USUA 3CDBA 2ZJQQ 1S9GA 3FCWA 4KE5A 1UWBA 5ETRA 3MD3A 3ZZOA 1Q95G 5IM0B 5A6PA 3DLEB 2FGCA 1RE1B 2CNNB 2A3JA 2B43A 3SCIE 1SQEA 4N76A 3IM8A 1N33F 4YB7A 1EJ7L 2XTJP 5C24A 1Q5VA 5HLFB 3PEHA 3O2IA 3DRRA 3RAQA 2B4VA 1EETB 4DF8A 3R2DJ 1I5OB 3O44A 3VAJA 3K59A 3DXSX 1WACA 3G2XA 1YK9A 4NEYA 1BQMB 1RU1A 2CJXB 4YUDA 2VA3A 2YNGB 3TZZA 3MAHA 3N5BA 2NR0A 4W90B 1AUSL 2LVWA 1C2PA 1Y3JA 1TU0B 1WELA 4XAKA 2C2NA 4UUWA 1RWXB 1P9QC 1N36F 1RAHB 3RZAA 3B54A 2KXFA 3C6UB 4KV8A 1MU2B 2HEKA 1IBLF 1KSPA 2B0GA 4ZPAA 2IBKA 2WSEC 3D66A 2D74B 3QJLA 4QJVA 4A8MP 1F1BB 2J0WA 2LMIA 1OYDA 3QIDA 4DL5A 1YBTA 3NRBA 3Q8UA 1SH3A 1S6QA 4CLWA 2DR7A 2QLBB 2W7AA 2NPFA 4WFZA 1NHVA 5KFAA 2CZ9A 2OH2A 4TKTA 2CJQA 1N5QA 1UVKA 2ZVIA 3CJQA 3R2CJ 2MZQA 1Z2LA 1GNKA 2V94A 2M3DA 3T6BA 1TVRB 3H98A 2CVEA 2HNDB 1ZZFA 2R7TA 3TYTA 2QL9B 3DOLB 4NPOA 2BE9B 3LWLA 1RBAA 4Y2CA 3KWMA 4I7FA 2QYCA 3Q23A 3Q83A 5KFKA 4M5IA 3EVOA 4NYZA 4IRDA 2DNYA 3OR1A 3G82B 4F7VA 1LWCB 4L72B 1S0OA 3LF0A 1N0VC 3HVAA 3KHRA 5IQ6A 1FNOA 1YRUA 2FC9A 4HDHA 2IRYA 2KFNA 4LF4J 1EKSA 3NCRA 2HNYB 4V19J 2C28A 4X64J 2D1CA 4C3MA 3AY0A 4RBVA 1EZZB 4ELVA 5DDOC 1F9FA 3TEGA 3AJDA 4PG7A 3H20A 1APSA 1REVA 1TUGB 1T9YA 3W1YC 1J5OB 2MKKA 3LAKA 1JLCA 3FEYB 4DQQA 4DN0A 1TAQA 2ROGA 2V0NA 4YR3A 3TO8A 3QWPA 5J2MB 3HT3A 3JXOA 3LUYA 3G71S 1RAEB 4RBTA 2GHWA 2CVIA 2VU5A 4QWCA 3OTEA 1HNIA 3ZTPA 3LALA 1FD8A 1KFSA 4HI1A 1RUSA 1NK6A 2A10A 1FEEA 1FRHA 1TK5A 1UPMB 4E0DA 3TZWA 5EN1A 2R7QA 5DRKA 1I94J 2R2RA 1Z1ZA 3MM8B 2XSJA 1JWWA 1TMMA 2LKZA 3R7SB 3DOKA 1DY3A 2KXNB 1M5SA 4B3OB 2Z0GA 3FCHA 5LSOA 1M5HA 4JOUA 2KFZA 3GP9A 5GADI 4MH8A 1LEOA 1JNRB 3BYRA 1S6PB 3PW4A 1A7GE 5L1IA 3GILA 4FVCA 4WXWA 2KXHA 4GO5X 4LF4F 3EVMA 1UCNA 4C8KA 4PEOA 4FDFA 5I42A 2UVRA 5I3UB 1TQLA 4X64F 5K8OA 1ULRA 2M88A 2P6TA 2J8SA 3G6YA 3DRSA 4RW8A 2RSQA 2XI2A 4O4GB 3LGHA 5HBMB 4DMZA 4AXIA 2GV1A 5IV3A 3GG1A 1QSYA 2E7VA 3NXZA 5F3TA 4H4MA 2H51B 5D0EA 2V6AA 1N52B 4ANEA 2JEJA 3EPGA 2Z56B 5CYMA 1VQ9S 4YMEA 3C6TA 1RT7A 5E3RA 1PAEX 2GAHC 2G2OA 2HQIA 2PA8D 5KAKA 2XNRA 4Y2MA 2XO6A 4G1QB 3RRGA 3CCVS 1JQGA 1F5CA 1SKRA 4CO4A 1HWUA 4AL7A 2IDLA 1I94F 1NSAA 1VC6A 3LH2S 1HR0J 1LOUA 1S49A 1H0HB 2V5HG 2L3MA 1KTVA 4A48A 3KYLA 2CQCA 4F0MA 5AE1A 3ZNUA 5ETNA 3QBCA 2FD2A 2QLWA 3WDOA 3VGSA 3CCUS 1MMNA 4CLZA 2JX2A 1QE1A 4CI0B 2EC0A 1B7FA 3KMSA 3M6XA 2ZNYA 2CJ9A 4ED8A 3PW7A 3LP2A 4AYBD 1RISA 3JS9A 4KAIA 5F0UA 3PYDA 2IYGA 3DDKA 2HHSA 5L1JA 4O3OA 3BYPA 3D9BA 3FVYA 3D4JA 4QQBA 5A0YA 4ZVEA 4OHVA 3RBEA 2YBVA 2CFXA 4B9SA 5HN0A 1RAOA 2Z8QA 1FKOB 3KG1A 3L9ZA 1WJ9A 3MMBA 2PA3A 2P8IA 3MEGA 1T0TV 3CCMS 3HD1A 1JXVA 3UD5A 4CZCA 3UN5A 3K7RA 5C7PA 2C3OA 4RW7B 2OFGX 3W9IA 3FUYA 5IT9U 3KXDA 5HL7Q 4NLUA 1XIQA 2FHJD 3OVAA 3T5KA 3HMJG 3QZ8A 4KGXB 1X9WA 5KFRA 1MROB 3QO9A 4M1KA 1HR0F 3BO4A 3MM5B 3N4WA 3Q8QB 4J9SA 4P10A 2QO3A 2Y1LB 2KJVA 3EDRB 2V9WA 4F3MA 4WE1B 3VAIA 2PC6A 1VR6A 4Z2XA 2PMHA 1NUEA 3NCQA 2DH7A 4MJKA 3M6UA 2JHEA 3QLHB 2H54B 3QRPA 5E2QA 4PYDA 5CYJA 1CS4A 2XCPA 1NSQA 4J9OA 4ZN1A 3R7NB 3H25A 3T3FA 1TL1B 2MY8A 2QL5B 3CC7S 3OTDA 1QLNA 3FGVA 3SQGB 5A8KB 2V50A 3T9ZA 3PTWA 1T95A 4O23A 2GHPA 3TAQA 3JSBA 4HT5A 3K5NA 3CVKA 5F8GA 3FMWA 2VB6A 2ALYB 4YB6A 2DGOA 2B8QA 2XZWA 1M5KC 4DZ6A 4C8ZA 2HHQA 2RD5C 2NXCA 1M1HA 3HSZA 4KBIA 5EUHA 3DLJA 2DO0A 2Y3YA 3FBEA 3VTIA 5K8MA 3BPDA 3UNYA 2CQ0A 4I2QB 3DN9A 1UVLA 2KL8A 4A8SA 1QM9A 1RTDB 2G13A 2VKRA 3EGWB 1XMOJ 4IFVB 4NI2A 3HFVA 1IUJA 1TKXA 4NLYA 3K5LA 3BGRB 1S6OA 4H4KC 4FN5A 2CAJA 4WFAQ 2VV5A 2LQ5A 1G1XA 2JZ5A 3ENQA 2M8HA 1AB8A 3F41A 2IRXA 1K0VA 3W5YA 4CO1A 4C3KA 2VASA 1ZAXA 3TAMB 4IG3B 1SUQB 1D3WA 3NG8A 4LF6J 2V2ZA 1X9SA 2LEBA 4CM2A 3SEOA 1WEXA 4KYZA 1RTIB 3E51A 2AQ4A 2HSEB 4RU2A 1CJUA 1Y11A 4EO6A 4UY8T 3D6FB 1HWIA 5T41A 2IAJA 1LW0A 4DR1J 2WVCA 1YSJA 2MZJA 3BO3A 2XMKA 4PKDB 4NWBA 2JEGA 2JOQA 3E3XA 3ETMA 2V2KA 3KJNB 3NNAA 4CO3A 1RABB 4O3SA 3HSGA 1VJQA 2J8AA 4D3HA 6FD1A 1U1MA 3WIUA 1KP6A 1QDUB 3ETOA 4K59A 2WCXA 4OV1A 4TYAA 3HLUA 1R8PA 2OHDA 1X4HA 2QC3A 4PCQA 2AX1A 5BYSA 1T9XA 1ZYQA 2CJYB 3FDSA 5F9NA 2J76E 1R31A 3U7JA 1XMOF 3IWXA 2HRYA 2FUG9 2DRAA 1NKBA 4IR9A 4G3IA 3R5DA 3CUNA 3EZOA 2ZH4A 3V6DB 1T03B 1XMQJ 4EWTA 3MCMA 4ZVHA 2DGWA 2COLA 3WQPA 1KVIA 4LF6F 1S10A 1Q82T 1B64A 4HKQA 3QSIA 2DEIA 2HMIB 4IFYB 4OYOA 4ANCA 5GVQA 2CQPA 3T1AA 1RT1B 1ZH5A 2BE2B 1NK7A 3D1HA 5ETQA 2MKHA 3ZZ0A 4DR1F 7FD1A 3OBIA 3W3SA 1ZZNA 3PR5B 5D6GA 2OPRB 2BZ2A 1Q78A 2XMMA 2C2RA 4DR4J 2A6OA 5L1LA 4DSEA 3KDNA 2BW7A 3SV4A 2K3KA 4OZ1A 5CABA 1VMBA 4EYIB 4CYUB 3H8YA 2PMWA 3WC2A 3D6MB 3OSPA 1DTTB 4UF4A 2N7YA 4L6V3 2MGZB 3OHAA 1R27B 3A8EA 3BKUA 1VFJA 2R2UA 1ZTTA 5LSLA 4IQXA 3DI6A 1FKPB 4ZHRA 1S5ZA 4LIRA 1GXLA 2E7XA 2AZ3A 2LXFA 4ERDA 2QA4G 1YZ6A 2E5JA 1ZM4A 2ZH1A 3CCZA 3EGVA 4A8FA 4K4YA 1LNQA 1V3SA 2V4RA 3EWGA 2Z30B 3W2WA 1LK5A 3LPYA 1YRXA 5SZTA 1RAGB 2IA6A 1XMQF 2QSFA 3PHTA 5K20B 2F3JA 4UOHA 2MXYA 4NXMJ 1HBOA 1CULA 4RW6B 3I82A 2RQMA 4KY3A 1DZ5A 1WHYA 1DURA 1DLOB 2Z2MA 4RL1A 4L73A 3GFZA 4WJBA 5ITHA 3L09A 1JKHA 4X4RA 3MM9A 3UR0A 4DR4F 4NLPA 1E6YB 3HPOA 2EC2A 2DHSA 1RTHB 1XERA 3A3OB 3EXYA 4OZJA 1N5SA 2R7XA 2HPUA 1K1QA 4JI1J 2EFPA 1IQTA 2JFDA 4DV1J 3K5MA 4ZVRB 1Y0HA 6AT1B 5L38A 2ZKUA 2BJ3A 4M5DA 5H9EJ 2R2TA 2EEYA 2NLWA 3EM1A 2FJBB 3RYLA 4B9UA 5L39A 4EU0A 4H54A 4G1IA 2B3TB 3K0JA 4O3PA 3F0NA 4FS2A 2PE8A 4USMA 3Q8YA 4NL5A 2QL7B 2NSBA 1TL3A 2ZBRA 5KFOA 2VFRA 4B02A 2V34A 5KFGA 4P72A 3UFCX 2ILZA 2VD3A 1CJTA 5CCMA 1JLBB 1YRTA 4OZ5A 5F8LA 4QR2A 2NREA 4NXMF 1IQZA 1WC6A 3MD1A 4IR1A 3KHLA 3EGZA 2XS5A 4K50A 2V4JA 4Y6IA 3MR3A 2UXDJ 1ZA2B 3NP5A 2E66A 3TAPA 3GZ7A 3IS9B 2H1YA 2U1AA 5CHCB 1SJFA 5AXKA 2J7WA 1OIAA 2CRLA 2HRTA 1JLQA 2XB2D 4L3KA 1PYSB 4X4VA 1JIHA 2QX0A 4JI1F 4ED4A 1CJVA 2F9JA 3OLBA 3DLGA 2MZSA 3M4XA 4DV1F 3TP2A 2AEMA 2F40A 1K1SA 3I87A 5E5NA 2CJBA 2M70A 2VPYB 1RWNB 3V6KA 3OXFA 4FYVB 4U7UK 1XNRJ 3I5AA 3M9NB 2YKPA 2FHOB 3M8WA 1T9WA 1WI8A 3GWCA 1RT2B 3CXCR 3QIPB 4YY3J 3FEZA 3CCSS 5EWFA 1RZMA 3D1QA 1ZAWA 3UO0A 1Q8KA 2XLKA 1VRTB 4IYQA 3KNGA 4LRDA 1JLFA 5KFBA 2CIMA 2W9CA 5KT3A 3H2VE 4ED5A 2AHOB 4LFCJ 2D3OR 3H59A 2XULA 4DCJB 3CMQA 3EICA 1J5EJ 5L9XA 1ACMB 1WNEA 3ZO7A 5B0DA 1WC1A 2HLTA 1T05A 2ZH5A 4DV7J 3RAMA 1AZSB 2L08A 2OEJA 2MSSA 3MURP 1JLGB 1RK8A 1X5PA 1XJWB 1K44A 2WVEA 2UXDF 1R0AA 1ZPVA 3BPSP 4CDIA 3D3CJ 3JTPA 4NLXA 3T5JA 3FBBA 2QA2A 2CPZA 1FRIA 1S0VA 2OPSB 3R5GA 4DX7A 4X4SA 4LSNB 2X1FA 2HBZB 4I69A 3C16B 1S1TA 2AW0A 3MECB 3C8YA 3AH6A 4KT0C 4UOCA 1GXTA 3KLGB 4LSLA 1XNRF 3H42A 1MNEA 4BLGA 4ED7A 5HMWA 2IVMA 2QJ3A 4ZPWR 1VQOS 3UVJB 4CNZA 2WOMB 3N6MA 2RDIA 4QYZK 3SBMA 1Q81T 4YY3F 4ILMA 4J37A 3WHIA 3LP0A 2DRBA 2RKIB 3OPKA 4WK3A 4DFKA 1H2VZ 2IC3B 2GO9A 3G8QA 4DUZJ 3S01A 1RWWB 1M1KT 3M05A 2V2VA 4EUVA 1N6QA 3BKTA 2C22A 1YG0A 1H7XA 1Q7LB 4LFCF 4RUHA 4IG0A 3FJ2A 3I0RB 4O3QA 1J5EF 2UXBJ 1X5TA 1C0TA 3VZIA 3W9HA 2ADCA 2VG6B 1UVIA 2G9OA 4PPDA 4DV7F 2PMZD 1VC0A 4ED6A 3J7Z5 3CCES 5DQIA 4ETZA 1RDRA 1RWKB 5D8HB 3BN4A 4AFFA 4MFBB 4PG6A 3CD0A 3A8IA 2HHPA 1U1KA 3W2VA 1P6TA 4P73A 1CPZA 2CPFA 4C8LA 1T94A 3TVYA 1S9GB 1UWBB 3GJSB 2RDDA 3TZXA 2RS8A 2ZFHA 3G86A 5CCLA 3P5TL 2P9CA 2CPXA 1ZAVA 4F3QA 1O51A 3W8PA 2B9WA 2DNGA 2FIUA 2J0XA 2AZ1A 3K17A 4V1Ak 8RUCA 4CH7A 5HQLA 5C24B 1JJ2R 3TVZA 2EG1A 4NRUA 3DRRB 1UW9A 3SI8A 1PJ6A 2AGPA 5E3CA 1KN6A 5F8HA 4B9NA 1XR7A 4E8UA 4AL5A 3U02A 2XHWA 5GMKa 2MZTA 4ZVQB 1RHRB 1VQMS 4F4WA 1RWUA 1SL2A 4HDGA 2MB0B 4R8UA 1SKUB 1ZA1B 4M5LA 3CB4A 1Q1KA 3DNCA 1TKTA 2QN6B 2MJNA 3DYAA 4QWBA 1A6LA 3QZ7A 1VHFA 2UXBF 3Q8PB 1OO0B 2AJ4A 2LQJA 2O3DA 1NK4A 4TNOA 2NUUG 3GSIA 1V3ZA 1SJ4P 2LU2A 2FGOA 2FQQB 3LOUA 1TMJA 1UTAA 1U49A 1W2BR 4OYBA 2D3ZA 1LKZA 5M2RA 1SC6A 2XLIA 1U2FA 1S6QB 1R8AA 1FFSB 2D3UA 1HQUA 2CUYA 3L4BC 3CWJA 4KIAA 4OMFG 5D4PA 1R89A 4OV6A 2DNOA 2AJ0A 3OTBA 2KVQE 3DC2A 4NLVA 4F4ZA 3DU5A 2ZHOA 2KRRA 2LA4A 2FVCA 4MYTA 1BE4A 5AE2A 2OI2A 1N54B 3ISND 1FVQA 3NY0A 3MPDA 5BR8J 4I7FB 2EKYA 4ZA1A 1URRA 1U1PA 1RLCL 1VQSA 2E7WA 2OLWA 2A6MA 5KFTA 3OR1B 4DR2F 1NK9A 4DR3J 3DLKA 3NAIA 4IKAA 2M2BA 2ROPA 2HZCA 2LEAA 5HROA 2OJ3A 3HVTA 2DCUB 5J2PA 4QOTA 1XNQJ 3CMES 2HWTA 4OI2A 4TXSA 4WZQA 2UUWA 1WG1A 2QIFA 2DR6A 3PKMA 2WHOA 1UPPA 3EUNA 4C9DA 5DS7A 1REVB 3UDVA 2R3VA 3MM7B 4LF1A 1RCOB 2ASYA 1JLCB 1U6BA 5IC4B 4U67Q 1VBZA 4DSLA 3BS9A 3HJFA 2JLEA 4F02A 3UCZP 2OIHA 2KRBA 1FKAF 3HKWA 3NWGA 3JYTA 3THVA 2PGCA 2WTFA 1HNIB 3PJWA 4WPAA 4J9LA 3PV8A 2XZTB 2OMLA 4ATNA 3K58A 4K8RA 4FBUA 4OHXA 3RGIA 4NYPA 4DQSA 3TX8A 2HQ3A 2MKYA 3BR9A 1JX4A 4KKOA 3GR1A 1IWGA 2XSJB 4OYWA 2DR9A 1HARA 5BR8F 4UZCA 1BLUA 3DOKB 8ATCB 4A4JA 2FLNA 3R27A 3BKFA 3WX4A 2XC9A 2XWYA 2YY3A 2WSCC 4Q43A 4KJIA 3VGUA 1H2TZ 3LA0A 1VQ4S 3T5LA 2DISA 2KHDA 1OY6A 2AT1B 3QMQA 2VZ9A 3MUMP 3AXKA 2CXEA 3FZ2A 3M8PA 1XNQF 4O0NA 3NS7B 5I42B 2NQPA 1CSJA 1U48A 3ZC4A 2DXEA 4UQTA 4RW8B 2NXEA 2DO4A 3W5XA 2XGQA 2ADBA 5FDLA 2BA9A 4QR0A 2YH1A 1NH8A 4CLSA 1U45A 1IKYA 3SMZA 4K5RA 5T14A 2R4FA 2H5EA 4I0WA 2HGNA 3NKYA 1FXLA 4ID8A 5CYMB 4DV5J 3CEDA 2HAFA 1RT7B 1K47A 1IJEB 4QIGA 4QIVA 1S4FA 1S76D 4PUOA 2QFJA 4NLGA 4EBEA 1X0FA 3J7AN 1U02A 2WB1D 3MPVA 3NS5A 2ZH2A 5E33A 3GIRA 4U8YA 2A1BA 4M94A 5JXSA 1HLWA 1B0TA 2ZUGA 2YWWA 1NRKA 4F2RA 3FQKA 1S9EA 2XI3A 1OMSA 5CD4A 4ZPVR 3JSMA 3BJYA 3TJ8A 2G1DA 1NSKL 1WEZA 1C0UA 4QWDA 3FEXB 1QE1B 3R97A 4HACB 2BRLA 3I4HX 3ULHA 4JUZA 1PBUA 3MMAA 1SL1A 1MN9A 2WAQD 4EGLA 1HNXJ 3CDEA 3LP2B 3NGDA 1WORA 2XY7A 2OSRA 1FRLA 2KDOA 3CCWA 3ZTQA 2BJ8A 2J9DA 1R6YA 4CT9A 5IT4A 4Q7AA 3I9V9 4OHZA 3QQCD 2I9SA 1TKZA 2VQFJ 2VPWB 4OLOA 4M5KA 1VGYA 4IH7A 3GE9A 5A0YB 3BZQA 1LXJA 3AD9C 1RAFB 3TW0A 1TFYA 1WUUA 3QFHA 2N82B 3M8QA 4DV5F 4CLUA 2POKA 1UKUA 3MMBB 3UW1A 2X3GA 2BEFA 3MEGB 1VRUA 3U1NA 1IKWA 5DGAA 3CCQS 1SC4B 4DPWA 3HZGA 3OTOJ 4RW9A 4UT4A 1U47A 4EI2A 1RGVA 1X8DA 1X0PA 4P52A 3M8YA 2HQDA 4DL4A 2V4QA 5M2PA 3HKZD 1OPIA 3QGHA 2Q1LA 1B99A 2J7KA 3W7BA 2ASDA 4RWXA 5DDRC 3N6NA 4DSFA 3QO9B 2PT0A 3TA2A 5LXRA 3C2PA 3R5CA 4IDKA 3AFGA 2ZNZA 5KT6A 3M2RA 2H4WB 4J9VA 2XO7A 4ED3A 1HWLA 3FSIA 4FNIA 4P75A 1VK8A 2QZ8A 2HWIA 4CLTA 1CVJA 1S1UA 5BJRA 1CS4B 4X84A 1HNXF 1HI8A 2NPIA 2FY8A 3B6BA 2JVRA 1QTMA 3G6XA 3CDAA 5G4DA 1VOMA 2HVEA 4O4RA 2EVZA 3CCTA 2IA0A 2ZM6J 2B6AA 1N0UA 3PO5A 3AB4B 1OQ3A 1RHKB 5GMEA 1EB0A 2HFSA 1SL0A 4MKVA 2VQFF 1WTFA 1GAOA 1D8YA 3KFWX 1VRQC 3ZFVA 1Q7YT 5HJXA 5K9FA 5GADU 1R8HA 4XIUA 4DEZA 3D3BJ 2MQLA 2L9DA 3I32A 1R43A 4U6PA 4GVBA 4WU3A 2LXUA 4ZCIA 3TUJC 1RI7A 4MK9A 3HM9A 3OTOF 4NI2B 1TKXB 3GPAA 1GX6A 3X3UA 4NA1A 3QT6A 4X4TA 4Q5VA 5LT5A 3GG0A 4OYPA 2FVSA 2XMWA 5K8PA 2E1AA 1RB0A 4F04B 2FJWA 4I6YA 3NGRA 3NGTA 4RNOA 5GAGI 4DUTA 3GV5B 2F8HA 1RCXB 1GMWD 3Q8RB 2IAJB 2LXIA 4ZCMA 4ZKAA 2GGPA 4KH0B 4V19X 2YNHA 2V8PA 2VG5A 3EX7B 3WC0A 1GMUA 1IM6A 4O44A 2RDJA 4RO0A 4JV5J 4NA2A 2KH9A 1FERA 3LW5C 4J9PA 3VAFA 4XPCA 4C8YA 3GIJA 2ZM6F 5HAOA 4ES3A 3W66A 2VDIA 2VJVA 1BXNA 1FK9A 4J9UE 2MKJA 4RKUC 4TY8A 2KYZA 2EW9A 4IOBA 1MSWD 2A18A 3CT9A 2AV5A 2DNQA 3ZZPA 2ZH7A 4K4TA 1AUDA 5LSRA 2D41A 3M8ZA 2DGTA 1T11A 3PX4A 4YEAA 1I3OB 2CZ4A 1B70B 2B7BB 2XWXA 5AXMA 2VBWA 1KQSR 4DFPA 1IWAA 5DQGA 4JI4J 1WG5A 3ADAC 2FLLA 3BSAA 2RHSB 4LUBA 3R8YA 1HMVA 3GIMA 5KG0A 2KB2A 3I5BA 3RG6A 4MKAA 4LR7A 1U6FA 1PC4A 1TK0A 2QFIA 3IMQJ 3TWZA 3LGMA 3M9MB 3J80U 2ZITA 4FP9A 2QA4S 1RT3A 4NLWA 3UWTA 1YGYA 3EZ5A 4JV5F 1I6JA 4TQSA 1T3OA 2AX0A 1SKSA 4FF2A 4Y28C 3VCDA 4IO1A 4QWEA 1HL6A 4PXEA 4ECVA 2LLZA 3DXBA 2F65A 3C15A 2BQ3A 3DRYA 5H9FJ 3DI6B 3OUYA 3DLBA 4ZHRB 2DNKA 4O0IA 1WF0A 1L3TA 1FTRA 3DLLQ 2V63A 2ZDPA 4XDCA 2O01C 2ZHBA 3MOZA 4GMKA 2UU9J 3FC9A 2DHHA 5T7LA 1QD1A 2BJ1A 5IT9Y 1BY9A 1OYEA 4ZPCA 3DDIA 4ICLB 1U7LA 2E1PA 3LAMA 4YS2A 4JI4F 1IR0A 3W2WB 2QE5A 3QAUA 2DH9A 1HNVA 4PXBA 2XMJA 3POTA 2PSZA 2OKQA 1HKAA 2PIIA 3SV3A 1SJ3P 2VKZG 1HBOB 4YR2A 3CPWR 4HEA9 1CULB 1Q53A 5J1EA 5KFZA 4R0JA 3N79A 1G4CA 3Q2TC 4PRFA 3IRXA 1FDAA 1QVFR 3HHNB 4K5SA 1JKHB 2Y8WA 4Y2KA 2Z2YB 3JSRA 2VH7A 3MM9B 5C5JA 4P2XA 3OJUA 2MPUA 1FX4A 1ZM9A 1B4SA 1Q0NA 1PJ7A 2CNKB 4M95A 2VBYA 4DHVA 3T19A 5JMNA 4K4XA 4NLTA 3TQ1A 1EHWA 2DXFA 1X4CA 3OVBA 1YJNS 4P7VA 5KFCA 5DO2A 4C98A 2QYGA 4G65A 3RB3A 2GQQA 4KO0A 3W8GA 4USJC 4DCPB 4M5DB 3QWUA 4CP5A 3E2EA 4ECRA 3T1HJ 5DDQC 1FJ7A 2W2PP 2UU9F 2BKNA 2UV8A 3W63A 2K8GA 3HULA 4TLRA 4CO2A 2CQ3A 3PACA 3U1MA 3PIOQ 2E9ZA 4WIQA 2GJIA 2BVZA 3S8SA 5L9NA 3PZPA 1AYEA 4DLGA 1D9FA 1BWVA 1TL3B 2ZD1A 5LMUJ 5FJ4A 2MZ1A 3HJVA 3MMCA 2HQCA 2CQ4A 5SUHA 1CJTB 3W65A 1HI0P 2YNIA 3R5JB 2F8MA 4I64A 2LP4A 1S77D 2HZVA 1Y4ZB 4N77A 4A8XA 4QIWD 4Z7YA 1KEKA 1LWCA 2MZRA 3HD2A 1NJZA 2V4JB 4C8NA 1VBXA 2BRKA 4OX9J 3ENVA 2LDYA 3R6GB 4ID5A 2XYGB 1JLQB 1N5VA 5DG8A 2B9XA 4LBIA 4BWJA 1GMWA 4RUCA 2RMLA 2MSTA 3N01A 2MMYA 3GLJA 1PAUB 1CJVB 1U8WA 2BYCA 3DLGB 3V5RA 1F3VA 3PNIA 2GVDA 1QSSA 4LIWA 2DKOB 1LK7A 1VIOA 2OMOA 3MM6A 2R8GA 1JLEA 3K89A 1HBUA 3NS6A 1FWPA 4CLFA 4NXNJ 2KG1A 1NDKA 1L3UA 5LJ3Y 1OSCA 1YLXA 1TZ0A 2OP5A 1KDNA 1P27B 5LMUF 3GQCA 3MF5A 1JLFB 1NO8A 2W9CB 2DEJA 3TZYA 3T41A 4RWWA 5K14A 1NJXA 4OJ3A 4M5NA 4DUYJ 1NM2A 4RBUA 2ATCB 4N47A 1KQGB 3SFGA 5KT2A 3AJ2A 1VJWA 3PG9A 4U8VA 2VIHA 1T05B 2V2QA 5KFVA 1HFEL 3PY8A 5KG1A 3L7UA 2K7JA 3SSQA 5IFMA 2MKIA 3N5FA 3UE2A 3CJTA 2KU7A 1R0AB 2ASLA 3CW2C 4OX9F 1OY8A 4Q45A 2HRUA 1UJ6A 2E44A 4ECXA 2HG4A 5AXLA 3V6HA 4NCBA 3MCSA 1FX2A 1IBCB 2FZKB 1U6ZA 5KFYA 4OI0A 1Y7PA 3THTA 1NDPA 2X51A 1D0EA 1DFDA 1T3NA 3D54A 1WD6A 1S1TB 2LECA 4RNFA 2C2KB 4IOAQ 1M5OC 4EFAC 3VZHA 3TOQA 2ZZMA 4LSLB 2AJ1A 2VG7A 3KJVA 4NZ6A 4NXNF 4P2SA 1U1LA 2AMCB 2AU0A 5JUMA 3KK1A 2VFVA 2RQCA 5DM6Q 3LP0B 2YWEA 2WK4A 4OZNA 3IBCB 4DZDA 3QGGA 2IRUA 2G1HA 1D9AA 1XMBA 4G1QA 5DG7A 1PCAA 3T9NA 3HVRA 3DOMA 1N6QB 1WF2A 5KFFA 4A8OA 1N48A 1NAQA 4IG0B 1IR2A 4DUYF 2GQ2A 3LQVA 3IR5B 1C0TB 2RRNA 1YJVA 4LT6A 4LBHA 2WVBA 5IZHA 2QGFB 1BQNA 2LDIA 3M1VA 1G3OA 3EVWA 2BM1A 3I5CA 1NDLA 1NHUA 3D2WA 4YDDB 1FNXH 4WYLA 1RSCA 3PYGA 3W2VB 2W2NP 4NCGA 1WSRA 3MDFA 4DFMA 2W4CA 2E5HA 2FLOA 4J9NA 2H65B 3O5TB 5KFSA 1DRZA 1FD2A 1F5AA 2VQEJ 3PEJA 2GX8A 3DLHA 2JJ4D 2BBEA 2NYHA 3CTRA 3R5AA 4OHYA 2DD8S 3UNGC 5KT7A 3TNVA 4WK1A 1U0HA 2AD9A 2YX4A 4OZ3A 4DG1A 3IWNC 4J9RA 4ZMMA 3VGVA 1HW9A 2ZEJA 4WP8A 2XLJA 4C0HA 4R8UB 2CQDA 5HK4A 5MAOA 1UFLA 2H48B 2G4BA 1BWEA 1TKTB 3HO1A 1KONA 3DYAB 5AT1B 1LWEA 3T1YJ 4EK2A 1X5SA 4RU9A 1R6VA 5KFWA 1WI6A 1RKIA 3IR6B 4BC9A 2GAGC 2NUHA 2MQ8A 3FFIA 4BDPA 1YX2A 4WIIA 2W8LA 2BUNA 3OL8A 3KLVA 1V3RA 1SC1B 3K5OA 3H5XA 4F2SA 5A8RA 2DIUA 3AA9A 2RRBA 5DM7Q 2YWFA 1K73T 1KLMA 3TUZC 1HNWJ 1H74A 3CD7A 4Y00A 2GIRA 3MCNA 1FXDA 2WRMA 4PAAA 4LVNP 3H4DA 4U7UD 4PWWA 2QMWA 4FXWA 4GRSA 3OVSA 4ZJOA 3ENAA 4K4VA 1HQUB 3ILLA 1K0TA 4ECSA 1X9MA 1X4GA 1OPZA 2DR5A 2VQEF 3GYGA 1HYSA 2UUTA 2K1RA 5F9LA 1S0MA 1WDTA 3N9UC 4ED2A 4NASA 3Q8SB 4ZIWA 3O1LA 4GO7X 2IVYA 2L9NA 3S1TA 5D0HA 1IKXA 4DL2A 4IH5A 1UVNA 3G8TA 3HSDA 3G87A 1CQNA 2BKOA 2FY1A 1YDLA 5DZ6A 4ES2A 3GR0A 3GU0A 5ETPA 2Q6BA 2XS7A 4DSJA 3DLKB 2FDNA 2CJAA 5F41A 3GONA 3OTCA 3VVUA 1AXQA 1RAJA 1RJJA 3IGNA 3HHLD 1EARA 5HROB 3G96A 3HVTB 2M9KA 5HSPA 3T1YF 1RXOB 3CD5A 2K2PA 4FNHA 2DT9A 1CJKA 2RH3A 1HHTP 5F8JA 2RQ4A 4I2PA 1VLYA 1C4CA 2F8EX 3CO9A 2KI2A 3KUEA 1ITPA 2GJFA 3M2UA 4WFBQ 1T8EA 3BB5A 3I55S 1G7CB 3T5HA 1HNWF 3VGTA 3E01A 3VAGA 1REGX 5GAEI 3JYTB 2YX7A 1S72S 3MUTP 1JK9B 2UXCJ 3D0GE 2WVDA 4KPCA 3K8VA 3HHKA 3BQ0A 2GCFA 3AOAA 3CJ5A 3DRXA 2L9WA 2KN4A 2IHR1 1R3NA 1NPPA 4ECUA 4J90A 5AJ3J 1IKVA 5I4MA 4RNNA 4EO8A 5K8NA 3CJKA 4KKOB 1U0SA 1FE4A 4PQUA 1HWJA 3MAAA 1UL3A 1XR6A 4OYZA 1TL7A 4CLYA 3NGSA 2AJFE 1Q16B 1HBNA 1AFJA 5KFUA 3PYEA 1KFDA 3P8BB 4OL8A 2DGVA 4CO0A 1IM4A 3H5YA 3EJMA 2YXLA 4WFNQ 3L95X 3EGNA 3M8PB 3QRQA 2YKNA 1DJ0A 1RACB 5G0RA 2CG8A 2V67A 2RVJA 1N5YB 4I67A 1ICEB 2HHUA 3MPUB 4CTAB 2HK3A 3UQSA 5FDLB 2MLYA 2RU3A 2DNHA 5F8NA 2P5VA 5CZXA 1HBMA 1ZETA 2YPYA 4OIXA 1IKYB 3KLIA 4DLEA 2J6UA 4R5PA 1QSLA 3U1LA 3NBPA 2GIFA 1FT8A 1WC4A 1ZM3A 4JI7J 4E98A 2C3PA 1SV5B 4ZIVA 2E5IA 1SH0A 1VQNS 5F0WA 4PUOB 2UXCF 1PG5B 2HVIA 1UETA 4JV0A 3EMTA 4N7TA 3DHXA 3OSNA 4QWAA 5AJ3F 4GKJJ 4FYWB 3NGUA 1RT6A 4ILRA 4DJBA 1RTJB 1RQ0A 3QSYB 4C8MA 1RKJA 2HHVA 1S9EB 4QZVB 2EG2A 1OJ4A 1SC3B 3JSMB 3G8SA 1XWLA 4WFYA 4A46A 1C0UB 4Y2IA 1TTHB 4DR7J 4Y65A 1U4BA 1IR1A 3MMAB 1TR0A 4ZOSA 1C1BA 3A1YG 2VBZA 3KNAA 1W25A 3NMRA 1Y3KA 1RWOB 2FLPA 1FNMA 1Z4UA 3J7ZT 2Q79A 3AAWB 3D67A 3K5PA 2AEFA 2XBPA 2KYXA 2YWGA 3IWLA 4WTOB 2CQ1A 1TKZB 2W2OP 4NZ7A 4ECZA 3M6VA 3P5BP 3LO3A 4B3MJ 1TP7A 2BOPA 4DPOA 4TU8A 1TELA 1R7IA 3OXGA 1WHWA 3M8QB 2J6TA 3MWBA 1QUPA 1VRUB 2LCWA 3NOGA 1IKWB 2B51A 2Z4PA 4JI7F 4F67A 5L8RC 3PJXA 1RTHA 9RUBA 4YOEA 2VFTA 1WOPA 4RW9B 3KUHA 2EBEA 2L48A 4C0BA 2HNZA 4RNHA 3VVTA 2MQOA 5C25A 1YITS 3ILOA 2Q43A 1HQEA 4GKJF 4WCEQ 1YWXA 4ZS6A 1FRKA 5D0GA 2M5YA 2W24A 1DQAA 4IDKB 5IV4A 3AD7C 3M2RB 3KLHA 1G6BA 2X1GA 2RILA 2AF6A 4DS5A 2IM1A 4DR7F 4JP8A 4Q0BA 4EBDA 3OLAA 1S1UB 1VC5A 4F4YA 1VQKS 1KQFB 4DPYA 3Q86A 1PIEA 2R8HA 1FWLA 1NJIT 1R8CA 1HHSA 5D4OA 2B6AB 2GQCA 3IO1A 4QW8A 5HVGA 4TU7A 3PRVA 3HHLA 2E29A 4PWDA 2RAQA 3PCOB 4URGA 4B3MF 1CEZA 4C48A 5D4LA 2W01A 3C14A 2DHGA 4DR6J 3C46A 2DNMA 5DLFA 4JI3J 2V9KA 1XC9A 5ETTA 3MCOA 4GVBB 3KLFA 2MQPA 2D3O1 4DBQA 3RBZA 1SKWA 5L46A 2RNEA 5LMNJ 1QAIA 1GXUA 3MFIA 3PXGa 4FYYB 1LFPA 2EPIA 4PR6A 1UVJA 4LJMA 2C2ZB 5ETMA 2CJKA 1VHIA 2VHGA 4C0OC 4J5OA 4DCOB 1JJHA 4C2MA 2QT7A 4KFBA 3PR4A 1H7WA 4HI2A 3ZNJ1 5H1SV 4MTPA 4C11A 3LWMA 2IM0A 5I3QA 2GFFA 3ZZUA 4KRWA 1SJ1A 3MEEB 3DGPA 2GGPB 2XYPB 1FI4A 2J9DE 2VG5B 2OUGA 4K4SA 3MXHP 3CO0P 4O44B 2V8HA 4L76A 1U2RA 2K7KA 1SQFA 2H5IB 4K4WA 3IR7B 2LQBA 2CKWA 3LTOA 1M90T 2EKNA 3SXLA 2ZWPA 1Y5NB 2MKSA 2B4PA 3GFXA 1FK9B 2B56A 2G0CA 4GKKJ 4TY8B 3MR2A 3PHEA 4DF4A 2BABA 4F25A 3VHQA 5B7WA 1FDBA 4DR6F 1BHNA 4GVLA 4K2JA 2GO8A 5IQQA 1NDCA 2IBOA 1XTZA 2D69A 2NSCA 4JI3F 4JI6J 2ZUAA 2ZWOA 3VAHA 2X1BA 4YHHJ 2VPZB 2ZOFA 1J27A 5LMNF 1U26A 2OTLS 2N4CA 1TK8A 3G4SS 1HMVB 3DMJA 4PABA 2VA2A 4JV2A 2N7CA 4B9LA 2W25A 3WZ0A 2QLJB 2GVZA 4QPXA 4DU8A 2HWHA 1JLAA 5A2QU 3HFKA 1KVJA 2FHJA 2YWHA 1H3DA 2NCKL 4ES1A 1RT3B 1H73A 1YI2S 4KHRA 2F4FA 3D68A 1PKUA 1FFWB 4FYDA 1UFWA 2Y0SD 2YKOA 3JQJA 4WP9A 2J0QD 5KT5A 1L5UA 1XR5A 1TV6B 4GKKF 1MWQA 3C15B 4WYWA 2Z58B 3OUYB 1C1CA 2QRRA 2XCAA 4WWSA 4TY9A 4FVMA 1BD6A 3HZEA 1UEKA 2V8DA 5T7LB 4F0HA 4JI6F 2E1MC 3MR5A 1KRPA 4KC5A 2DGSA 3GMGA 4FF4A 4ENOA 4J91A 2HZAA 4YHHF 1V5IB 2G0IA 3HP6A 1KBRA 2JNJA 1HPZA 3GYXB 2KKHA 1J2VA 1HNVB 4LF5J 3BQ1A 2DPJA 2MY7A 3POTB 1FWKA 3ZXWA 1IN0A 1EP4A 3RR8A 1VI7A 2LQ9A 4OI6A 2UP1A 4F26A 5J1EB 2OEKA 4DWIA 3IRWP 3CE8A 1UEVA 4CLLA 2JVOA 3IRXB 3JTNA 1X60A 1RBOB 3EE3A 3W60A 1FHTA 2MHNA 4KH1B 3QPIA 4W98A 1M0SA 4M5HA 2FPHX 3HSJA 1KTQA 4ED0A 2XNQA 1KWMA 3NLCA 2RF2A 1SJQA 1YHQS 2AJQA 1UMJA 2CQGA 3US5A 3TUPA 2KHCA 3EYZA 2NYIA 1JMTA 3QFWA 2CG4A 4OI1A 4CH0S 2KTQA 4ZVOB 4HTJA 5GAGU 3AB2B 1RYSA 4OZLA 4KO0B 1AFIA 3W62A 4H4OA 2W1BA 3QYYA 4OZ2A 2EBGA 1JB0C 3IBFB 2R2SA 4ZP6A 2CQIA 4CQ1A 1VYAA 1LWXA 4XO0A 1KD1T 2KM8C 4Z37A 1WG4A 2ZD1B 4MIBA 2VOPA 4FPIA 3MMCB 4LF5F 2WB4A 1S9FA 2ZKTA 2JLFA 5LL6d 1TKDA 1B0PA 4YP3A 2BR0A 3BSOA 3THPA 2YNIB 4NLQA 3HI9A 4DXLA 1XEZA 1RHMB 1WC5A 1WC0A 1PILA 2C3UA 2VOOA 1S1VA 1Y5IB 2OSQA 3FZBA 3OHBA 4M5GA 3AD8C 3J7A1 4TYBA 2DXDA 2FVQA 1U09A 4N41A 3JQKA 4ID5B 1QVGR 3B8HA 5E3AA 4MK8A 4URQU 5IXUA 3IN5A 3PVXA 3DCAA 4HHUA 4P2MA 4B3TJ 1AW0A 2VC0A 1GK8A 2HS0A 4IUFA 2GVDB 4KB7A 3KJFB 3MM7A 4WF9Q 4UUXA 3GJRB 3HXMA 3MM6B 3TJAA 1JLEB 2CYYA 2KT5A 1LW2A 3RBDA 1FJGJ 1HBUB 3PO4A 1FEHA 3VR1A 1S7HA 4QW9A 1FRXA 5MLCV 1CBKA 4AUKA 1Y9OA 3KHGA 1Y5LB 4NX9A 1PYOB 1NK0A 4A8WA 4AD6A 2DRDA 4BS2A 3D5MA 1H38A 5K14B 2DJWA 4QU6A 2KJWA 1MMDA 2B7CB 2Y0BB 5HP1A 4U7CA 1P1TA 1TL5A 3AQPA 3J80Y 2ZJPQ 1NSPA 2V69A 3Q0AA 2OPQA 3GIIA 5ADZA 4MIAA 2O5DA 1NU4A 3D6TB 1NKCA 4C7QA 1VIXA 2DHAA 4RLEA 2ZH6A 4JI8J 5H9EK 4X4UA 3PFEA 1HQ2A 3MGJA 4JI0J 3P4UB 3J81U 2R8JA 1T9VA 2P2CB 1FJEB 3BBBA 1QAYA 5EHHA 5HQ8A 4U9RA 3HVWA 1UP1A 4B3TF 2QG9B 5KT4A 3ET6A 5CYQA 1V9OA 2AYGA 1ZOTA 1LWFA 1NLKL 1RT4A 1KC8T 3KTQA 2MEWA 3SSSA 3NNHA 2R8KA 1EX8A 2RS2A 1FJGF 4WBFA 1UEUA 2BXJA 2VG7B 2B9YA 3KJVB 1VQ7S 2Q3PA 3VQTA 2M0GB 1OWXA 3PYFA 4ZP9A 5IOLA 3KK1B 5DETA 3M30A 3NAHA 4DR2J 4MKBA 4YDXA 4DFJA 3ITHA 2IMOA 2WW8A 1VS3A 3MOJB 1CQMA 2DGUA 1MG7A 3DOMB 4UZBA 4DSKA 1YJTA 2DBBA 1SBRA 3SDEA 2ALZA 1S48A 1RTZA 4YFUA 3SYZA 4KV8B 1YJUA 4LRBA 1BQNB 2WVFA 3M1VB 3RB4A 4HACA 4JI8F 3VAKA 1IVZA 3UDCA 2ZC3A 3QJJA 2I2YA 4JI0F 4WFXA 4F50A 4NCGB 4AXJA 1FJCA 4ZJLA 1GH8A 3HHLC 3HHDA 2RU9A 2B9EA 3MEDA 5KFEA 4NLOA 1N34J 1QAXA 4YB5A 2RB7A 1MMLA 3MMJA 1LFWA 3MPYA 3NMAA 4MAKA 1BGXT 3TRGA 2VBXA 3KG4A 5EX0A 4RUAA 2KT3A 3OR2A 1KVKA 1F5BA 5E41A 1N5TA 2X1AA 4IRCA 2PI4A 4LF8J 2E5LJ 4JBCA 3PFOA 2R7RA 1CG2A 4EEYA 1U0HB 3RRHA 4DG1B 1F6TA 3L3CA 2GA7A 1AA1B 2M52A 2ZDOA 9ATCB 3S6EA 3M7VA 5DZ7A 1OSDA 2EFNA 1GX5A 2IDEA 3TANA 2YH0A 3RB0A 4ECTA 2ZBQA 2ASJA 3SCJE 5JVGQ 1Z2ZA 3OL6A 4NRTA 1NPRA 5F8IA 4I6WA 1LWEB 2K06A 3IM9A 2JRSA 1VLOA 1SPBP 4JI2J 1S0NA 3KK2A 3H4BA 2UV8G 3UPFA 4FYXB 1YKWA 3GFHA 2XYHB 4EMDA 3M32A 2GMLA 5KFNA 3OFHA 4Q8EA 4BC7A 2VFUA 3FFIB 5HVHA 4KGZB 5FLXY 3C19A 2MTLA 3BGUA 2VL1A 3H2LA 2I5JA 3KDOA 5A8RB 5KOXA 4C8OA 3ILIA 3FSYA 1KLMB 1T02A 3RBXA 2XMVA 2B5JA 5EX3A 1W26A 4DPXA 1VQLS 2EFQA 3TX0A 2W9BA 4FS1A 5ETVA 5A76A 1N34F 3BDPA 3DRPA 1SH2A 1U25A 3VF0B 2QV6A 4OYMA 4F3OA 4R0EA 3BSNA 1HYSB 3H90A 2WSFC 3TQEA 2K1RB 2VUGA 4RZRA 4LF8F 3GCXP 2VF3A 3BGFA 4DV4J 2E5LF 5KG3A 3AOCA 2HHHJ 2QMXA 1UZHA 4GC6A 1VISA 3QRRA 4BWMA 1IKXB 2FTRA 3QT7A 4AE5A 5B0FA 4ZVFA 4W4MA 3CJ3A 2F4VJ 3HT0A 5E0OA 2VDHA 1HIYA 4N5SA 2PFDA 2BOAA 1IXKA 4DQRA 3S7RA 1O8BA 2HYIB 4CT8A 3MR6A 1PGZA 3Q89A 1KLNA 1GTHA 1RHUB 2N4DA 2ZE2A 2YVSA 2LA6A 1CJKB 3OT9A 1DHMA 3DRSB 4JI2F 3H5UA 1UAWA 2EK6A 4I2PB 2W2MP 4HLBA 4UOFA 2W9AA 3J7YI 2E5GA 3ZZRA 1S1WA 3CNQP 3DFEA 4OQJA 3C66A 3M2UB 2BKPA 4H4MB 2HLUA 3AJ1A 3NWRA 3QNWB 3MTJA 3KJQB 4UTGA 4UQGA 4F4XA 3E01B 4QR1A 2FHMA 3C6TB 1KHVA 4ZITA 2RJZA 5GAHI 3ONQA 3B78A 2FVRA 3JAMU 4FXDA 4TN2A 5A8WA 3IAM9 7FDRA 1HWKA 2Z2LA 3QJPA 2HFUA 4KGVB 2KG0A 2OGUA 3PJ9A 4M8LA 5D3GA 2K3IA 4WXOA 2IY5B 2APOA 1E6VA 3V4MA 4NCAA 3BH7B 4DV4F 1IKVB 3CJKB 4ZCLA 1HNZJ 2YQ1A 1BUXA 4WTYA 3O6QA 3B4MA 2HHHF 2Y9HA 4PQUB 4ZPTR 1T9TA 3MAAB 2KM8B 4B9VA 1TL7B 4CRJA 5DDPC 2F4VF 2PN6A 3CD6S 3TR5A 1F3FA 1HBNB 4EZ6A 1DAXA 4PXCA 4O3RA 4UOGA 4C6AA 4QBUA 3MEKA 1A9NB 4LF2A 2M8DB 1UZDA 1KQKA 4RW4A 1MWZA 4K4UA 3LGNA 5D0RA 4WP3A 2MKCA 2YKNB 5G0RB 1SIZA 1S97A 2XY5A 4J7CA 1ZPWX 1U24A 4LVOP 1FF2A 3C3LA 1S1XA 4Y34A 3V81A 3IAS9 1HBMB 1D1UA 2XMTA 1UVMA 4P74A 4FPRA 4ZP8A 3KLIB 3FQLA 2DNPA 4R5PB 3NEKA 4Y0FA 4HR2A 4KHMA 4F8RA 3NBPB 2KO1A 1EIYB 5KG6A 3UD3P 2FJXA 4ZCKA 4OHWA 2HFNA 8AT1B 3A3NB 1A0OB 2NZCA 2XY6A 4URSA 5IC6B 2IFXA 2XHCA 1GTEA 2AKWB 3F73A 1X5OA 2BANA 1G2EA 3UD4P 4Y3CA 1RHJB 3CSKA 4ECYA 2ILYA 2ERRA 2CDRB 2MQNA 2VPXB 3AT1B 2RUGA 1T7PA 1PYTA 2XSFA 5K5MA 4KTQA 3D7SB 1HNZF 1RT6B 1WOSA 1UA1A 3QAEA 2MLZA 2HS3A 1OS5A 2YQ3A 1YJRA 1H72C 4DX6A 3OFGA 2XMUA 2DGXA 1DTQA 5CAAA 3Q8VA 2X3DA 2E9TA 2ZH3A 4ICLA 3DHWC 2UUCJ 2AGOA 2WZ1A 4M63A 4ZVTB 4O3NA 2A0FB 3JSYA 3ZTOA 1C1BB 4LQ3A 1O6XA 2HHXA 2R7VA 5C2GA 3G6ES 3KLEA 2N3OA 4M5MA 3GV7B 4PXDA 2JDJA 2ZZTA 3K57A 2R42A 4QU7A 4ZVUB 1FRJA 5B0BA 1OY9A 1RHQB 1SQGA 2KFYA 4QYZJ 5CQGA 5C42A 5U47A 4OX6A 1L3SA 5CA5A 1IBMJ 2B4UA 2BQRA 3BH6B 2WW4A 1JXEA 1CLFA 3RAXA 3AODA 2XG8A 3P45B 1L3VA 2HHWA 1RT5A 4K0KJ 1MLAA 2GS8A 4HH0A 4OYAA 4ETXA 5J2NA 2HNZB 1F9EB 2Y1IA 1TUVA 3FNNA 3BEGB 4L75A 5C25B 2ZJRQ 4F4KA 3N0VA 3I0SA 1HQEB 4B3SJ 2QSWA 2QMUB 4QIFA 2W7OA 3ISZA 1GEHA 3KLHB 2RRAA 5AE3A 5F3ZA 2BJEA 4X4OA 5GAEU 4LRFA 2HURA 5J2QA 3IXQA 3MR7A 4YR0A 1CJUB 2X7IA 1RA6A 1YJ7A 2WONA 5KG5A 2DPIA 2UUCF 2CNOB 4Q0BB 5KFLA 1LW0B 2GHVC 4XTTA 5D15A 4J9KA 3V4IA 3IG1A 3Q22A 2WBMA 1HD0A 4MT1A 2FB0A 5DLGA 4ZP7A 5KG2A 3H7HB 3DM2A 3QGIA 3BQ2A 2YKMA 4Z7CA 3QATA 2R8IA 4LRAA 2CA9A 4CWBA 2Q66A 1LV5A 2E1CA 3HHLB 3M2VA 5E3QA 4PWDB 1IBMF 1NCLA 5E3PA 2DIVA 2DB1A 2DR8A 5ETKA 3LP1A 1DBDA 3K8WA 2ZVSA 1PSDA 2UUBJ 1S4EA 1RWPB 3C14B 4FXVA 3JTOA 2OPPA 1WKKA 2DYAA 3VWSA 4FKXA 1ZS6A 2MQQA 1XN9A 3KLFB 4K4ZA 4P6QA 4K0KF 3PRDA 4HH1A 2IPOB 2R7OA 2BM0A 2I6WA 3TARA 4ZDNA 4FF1A 2M4MA 4OX8A 4TVAB 2IJNA 3CCLS 1ZTWA 4N56A 2HFOA 5D77A 3D0IE 4B3SF 2W8KA 5BYQA 1KOHA 4DX5A 2G0JA 4KFBB 1UA0A 1X4DA 5DG9A 2AWZA 4DL3A 3I96A 2VFSA 3V6JA 3QGPA 2AYEA 3MI7X 2IJFA 2YQ0A 4X65J 2V68A 2VICA 4LR8A 4C11B 4DOZA 4XK8C 3L7PA 2EWHA 4B3RJ 4LRCA 3DGPB 4NA3A 1UFKA 5KFHA 1MN7A 4MK7A 1X31C 5KFJA 3OD2A 2RUSA 4EBCA 4NZ0A 2YNFA 1IBKJ 3BR8A 2XM3A 3BDEA 3KK3A 1ZBTA 2FJAB 4WU2A 4RPFA 2HBQB 5IT0A 1XK8A 4FBTA 1S7IA 2WBRA 2UUBF 2OO4A 2HK2A 2DTJA 2O1PA 4XDDA 3BO2A 4HYKA 2P6SA 2BW2A 1HW8A 2W7PA 1X4EA 4HHHA 1F2GA 3ICLA 2HVZA 2FJVA 1F2HA 2DNLA 4CO5A 1AROP 4MMOA 4K7QA 2IVFB 5IM0A 3DLEA 2FJEB 2KZZA 4M5JA 3AA8A 2FZCB 1RAAB 3ELHA 3DMJB 3W64A 4PG4A 4XPEA 2ABYA 2DK2A 4BBYA 5HLFA 5IWAJ 4P7TA 1NZAA 1KNZA 2Y8YA 1GT8A 1EETA 2GVZB 4X65F 3CJ4A 4X4QA 2R7WA 1JLAB 4AL6A 3BN7A 1BQMA 4B3RF 2OAUA 2YNGA 2C2OB 5LOQA 1VBKA 1L3KA 3D1OA 5FD1A 5ETLA 2AGQA 3FKBA 3GJTB 2GNKA 4ZVSB 1TFWA 1WSVA 2QEXS 1NMEB 1HHQA 4OI4A 5B0AA 3FCVA 1IBKF 4F4AA 4NE9C 1VQYA 3C6UA 1MU2A 4DN9A 3T6JA 2UVVA 2AYMA 1RYRA 3P3DA 2Q6CA 1S57A 2HHTA 4A47A 1C1CB 3F44A 4ITSA 4FF3A 2GIQA 2C2DA 3Q24A 2ATLA 1R0CB 2W4DA 4RR5A 4D3GA 4LQ9A 1S79A 3AXMA 3BGOP 3CMAS 4R25A 2NXNA 4C3LA 3CJ2A 6FDRA 4Q2LA 4CCHA 1HPZB 3HK2A 2PDAA 2AEJA 1RADB 1SVDA 4G1PA 5CH7B 4RJVA 1PBAA 1TVRA 2HNDA 4AT1B 4ZLPA 3GJQB 1QAJA 3MPWA 3X1LB 2DY9A 3UN3A 3DOLA 1EP4B 1FXRA 1SI9A 5J1PA 3HHEA 2UZAA 3LPEA 5IWAF 3P49B 5E7OB 2FHKA 2CQHA 1FO1A 3G82A 3EZUA 5IS2A 5AXNA 1RLDA 4DUZF 3OJSA 3CJ8A 3D28A 1NK8A 3NGKA 3UR3C 4UY85 1U1NA 3GV8B 2RF2B 2IJRA 2H9ZA 2DNRA 2J5AA 5HMXA 1P8GA 2NS1B 2NXUA 4HT7A 2HNYA 1WC3A 4DV6J 5FLXU 2P9GA 2MDAA 2BJDA 3CCRS 5EWEA 4JB8B 2J9EA 5LM7E 3RUBL 2AP6A 4F0KA 2JH3A 4PG8A 4X2BA 4DPTA 2EK1A 4RX6A 4OI3A 2Y1JA 1RU2A 3GSDA 1KR4A 3MZIA 1QY7A 2OD4A 1J5OA 1KS2A 1S6UA 4ED1A 4H4OB 2L41A 5HATA 1RAIB 4YN3B 2RQKA 2DNZA 4EYHB 5J2MA 4S0MA 5CD4H 1ROFA 4F36A 3FRZA 1OQ6A 1Q4RA 1RWVB 4ELTA 3OFFA 4HHJA 3FMBA 1RP5A 2LU1A 1VDHA 3A8KA 2C1EB 3WX8A 2F9DA 3UCUP 4P9SA 2CWKA 3PKYA 4CM0A 3KMQA 3UDEA 3MM8A 4LFAJ 2EFVA 3TVKA 4NMXA 1Q79A 2HBYB 1M5PC 5B0CA 5B08A 2IIHA 3OFEA 4B3OA 1PC5A 2ZBCA 2XQCA 1MW7A 5H9FK 4DR5J 1S1VB 3UDLA 4ZVGA 3AQOA 2UVUA 2XGPA 1LXNA 2RE1A 1S6PA 3BBFA 2CWXA 2CQ2A 1SXLA 4DV3J 4DV6F 3BV8A 3IC1A 2ZBPA 3IFEA 5I3UA 2CPJA 5KFXA 2I38A 4KHPJ 1S59A 5KFIA 4FZVA 1N4LA 4O4GA 2DNNA 4OYXA 5GMDA 5HBMA 3RU0A 4K2XA 1W2IA 1V5VA 1EQ0A 3CC2S 5JVHQ 1LW2B 4ZK7M 3SSRA 2BJ7A 5KFMA 2KT2A 1WDDA 3Q2SC 1TAUA 2VJUA 3TUIC 2UUAJ 3R1LA 1N88A 1CC7A 4WKRA 5DQHA 5HI7A 1K9MT 2EFOA 2CDQA 3RB6A 2DVIA 2GC8A 3PM9A 2W2QP 4USKA 1P9YA 5A2QY 4NLSA 4LBPA 5HP1B 3FSXA 3ISNC 2ACMA 4LFAF 2OPQB 2HVDA 2CNLB 3R6LB 2CPDA 2ZBIA 5KTQA 2FJDB 4JV1A 4IQMA 4DR3F 4DR5F 2OD6A 1FVSA 1FFGB 2DY1A 4ZLJA 2NXJA 5D78A 1JJCB 2U2FA 1VBYA 2CADA 1VQPS 3ZZTA 2HGMA 4DSIA 4DV3F 2CPYA 2J9CA 4KHPF 2BJ9A 1N5YA 4CTAA 4NEZA 3ET6B 3O8WA 5CYQB 5LJ5Y 4U95A 4I68A 3TJ9A 4N8NA 3ILJA 1LWFB 1FDDA 1RT4B 2JLGA 2XS2A 1FCAA 2PD1A 1WF1A 2RT3A 4IO9Q 1YIJS 3UI3A 2FVPA 1FKOA 3B4DA 3R9LA 1U1RA 2CQBA 2MLXA 4I56A 2UUAF 1SV5A 3RJMB 4Q44A 4OJ1A 3M30B 5FIIA 1HI1A 1ZM2A 3RW6A 3LANA 3RW7A 4RW7A 3BF4A 5HO4A 2DHXA 1FESA 3ITHB 2XEXA 1I1GA 3VQSA 1NK5A 1FE0A 3AHPA 3GIKA 2QLFB 1WHXA 1X7VA 1O0PA 1T9UA 3SDEB 4HL9A 2C42A 1DQ8A 2R7SA 3O3LA 3W61A 1MROA 3SCKE 4B9MA 1RTJA 3MM5A 1VQ6S 1WWHA 4TQRA 4J9QA 3W5ZA 1NXIA 4IRKA 4WE1A 3UN2A 3K2YA 3IBWA 2IM2A 3I56S 3F56A 3GYNA 3QT5A 2IMWP 2VODA 4QYRA 3QLHA 2I0XA 3JQMA 4ECWA 4NLRA 2XMAA 1EAYC 1Q8IA 3MEDB 2R7UA 1H98A 2IYIA 2JEFA 1GQEA 1TL1A 4OJGA 4TLQA 3KOAA 2C2EA 4N8OA 1U8SA 1D9DA 3SQGA 5A8KA 3PX6A 4IOCQ 3OR2B 2V8VA 2HKEA 4E2FB 4ZPBA 3WBZA 4LF9J 2ZH9A 2J7UA 3GTYX 1N56A 2BV3A 3I31A 3BM7A 3GFYA 1R8BA 3CULA 1VCTA 2ZHAA 2CZVC 4WZMA 4RUBA 1BMQB 5BXIA 5KFQA 3A8JA 3RR7A 4OJHA 3TI0A 4I2QA 2JEIA 2BMBA 1UW4A 1RTDA 1O5JA 4DL7A 1PO6A 4MKYA 3A3PB 4IFVA 4DL6A 5HJYA 5ETOA 3BGRA 2E9RX 5F8MA 4USWA 3GB0A 3H5SA 1IJFB 4X62J 3AOBA 2FZGB 5J2PB 3EPIA 3TAMA 1F0XA 1SJRA 2HQGA 4IG3A 1SUQA 3OL9A 4KGMA 3KK2B 4I4BA 3MTKA 1RTIA 3MAQA 1YQHA 2YX1A 3M32B 2NZ4A 3PX0A 4ZPDA 2JC0A 3SFUA 1FDNA 4DQPA 2LFVA 3JB9k 4J9MA 2JWNA 2I5JB 1X4FA 1DARA 5JJBA 2B5JB 3QT8A 4PG5A 1MWYA 2W9BB 2CPEA 4ELUA 5M2UA 2JFKA 3R5BA 4OZ0A 2A2DA 4WKYA 3DRPB 5LXYA 3CC4S 1UJ5A 1ELOA 3PW2A 3IGVA 3ZTSA 1NJWA 3P6YC 1YTYA 1X4BA 3A4TA 4DV2J 4QCLA 1UJ4A 1F9HA 3EDQB 5HMYA 1SCJB 4LF9F 1TUWA 1B7YB 1NEEA 4CLPA 4A8KA 3SQOP 3CDWA 4LR9A 4RNMA 4PWUA 3I4PA 4B9TA 1KHWA 2I1RA 2B4OA 4ZLNA 4X62F 3L7OA 1H6KX 1R0BG 2J6SA 4ZJQA 3V6DA 1T03A 2ZE2B 3PW0A 5DGBA 1JNZB 4ER8A 2GW8A 5I3PA 2ZH8A 1B0VA 4HTIA 5HANA 5EDWA 3ENWA 1NB7A 3DKDA 3J81Y 2HMIA
chains in the Genus database with same CATH topology
4IFYA 5KFVA 1HFEL 2NLWA 2FJBB 3NNCA 3PY8A 3RYLA 4B9UA 1S1WB 5KG1A 1RT1A 2K7JA 5L39A 3UCGA 3SSQA 5IFMA 3PFOA 3MEEA 2BE2A 4EU0A 2MKIA 2R7RA 1CG2A 4A8QA 4EEYA 4H54A 2BACA 4KPYA 3N5FA 3UE2A 2KU7A 1Q8LA 4G1IA 1SIWB 3RRHA 1R0AB 2ASLA 4DG1B 2B3TB 3K0JA 4O3PA 3L3CA 2GA7A 2M52A 4FS2A 1N8RT 2PE8A 4OX9F 2ZDOA 4DX8H 4Q45A 2OPRA 3S6EA 1OSDA 4NL5A 2EFNA 2EFGA 2HRUA 3PW5A 1GX5A 2NSBA 1UJ6A 3TANA 2YH0A 2E44A 2A2CA 3RB0A 4ECTA 1U1QA 4ECXA 2HG4A 1YJWS 3SZ2A 1TL3A 5AXLA 1HA1A 3V6HA 2ASJA 3SCJE 5KFOA 5JVGQ 2VFRA 4NCBA 5B09A 1Z2ZA 4B02A 2D9PA 3OL6A 4B08A 3MCSA 2O67A 5A8WB 5KFGA 1U6ZA 4NRTA 5F8IA 4I6WA 5KFYA 3UFCX 1Y7PA 4OI0A 3THTA 1LWEB 2ILZA 3CDUA 2X51A 1D0EA 2VD3A 5CCMA 1DFDA 1T3NA 4DV2F 5D3GB 1NH7A 2JRSA 1DTTA 1JLBB 1YRTA 2MGZA 3D54A 4OZ5A 1WD6A 5F8LA 4QR2A 1S1TB 2LECA 4RNFA 2NREA 4NXMF 1IQZA 1E6VB 1S0NA 3KK2A 2KZMA 3CIZA 4ALZA 3H4BA 4IOAQ 1M5OC 4EFAC 1FKPA 2C3YA 3MD1A 2UV8G 3UPFA 3GFHA 4IR1A 2JC1A 3VZHA 3TOQA 2ZZMA 4LSLB 4QIEA 3M32A 2AJ1A 2GMLA 3BGLA 3OFHA 5KFNA 4Q8EA 2J0SD 5L1KA 2VG7A 3KHLA 4BC7A 3EGZA 2VFUA 3FFIB 4NZ6A 3KJVA 4NXNF 4X4PA 2XS5A 4DDFA 5FLXY 4K50A 2V4JA 4Y6IA 4P2SA 1U1LA 3MR3A 3BGUA 3NP5A 2VL1A 3H2LA 2AU0A 2E66A 2I5JA 5A8RB 3TAPA 3GZ7A 3IS9B 5KOXA 5JUMA 3KK1A 4C8OA 2U1AA 5D4NA 3FSYA 2VFVA 2RQCA 5CHCB 1KLMB 1T02A 4NLDA 5DM6Q 1SJFA 3LP0B 2XMVA 3TA0A 2B5JA 2YWEA 5EX3A 3MUVP 2WK4A 4OZNA 1VQLS 2EFQA 3I9ZA 2W9BA 3QGGA 4FS1A 2IRUA 2CPIA 5AXKA 2J7WA 4TU9A 4ECQA 1OIAA 2CRLA 1D9AA 3BREA 4W92B 3U27A 1XMBA 1N34F 1H2UX 1JLQA 4G1QA 5DG7A 2XB2D 1FRMA 3T9NA 4X4VA 3HVRA 3G6VA 3BDPA 1JIHA 2HS4A 3DRPA 3DOMA 1SH2A 1N6QB 1NNDA 1WF2A 4RW4B 1U25A 5KFFA 4IH6A 1VQ5S 5B0GA 4A8OA 4JI1F 3VF0B 2QV6A 1N48A 1URNA 1NAQA 1HD1A 2OFHX 4F3OA 2F9JA 4YQWA 3CF5Q 4IG0B 3E8OA 4R0EA 3BSNA 1HYSB 3OLBA 4DUYF 3DLGA 2MZSA 2GQ2A 2WSFC 2K1RB 2VUGA 3M4XA 3PDNA 3LQVA 3IR5B 4DV1F 4RZRA 3H40A 1C0TB 2RRNA 1YJVA 3TP2A 2F40A 4LF8F 3PRBA 4LT6A 1K1SA 3I87A 4RW6A 2CJBA 2VC1A 5E5NA 2M70A 2VPYB 3BGFA 2E5LF 5IZHA 1S1XB 3OL7A 2P9EA 2KVIA 2ZC4A 2BDPA 1N32F 5KG3A 3V6KA 1BQNA 3OXFA 3V81B 4U7UK 2DGQA 2LDIA 3M1VA 4YB1P 1G3OA 3I5AA 3M9NB 2QMXA 4GC6A 2BM1A 2YKPA 3I5CA 2M7SA 2GJ2A 2QLXA 1DLOA 1Q8BA 2FHOB 4BWMA 3BSCA 4KGKA 1IKXB 1NHUA 1WI8A 3D2WA 2FTRA 3GWCA 1RT2B 3HX9A 5B0FA 2ZOGA 4ZVFA 4AE5A 3CXCR 4YDDB 1NKEA 1FNXH 3CJ3A 3QIPB 4I1TA 4WYLA 3FEZA 5E0OA 3W2VB 5EWFA 3CCSS 4NCGA 3MDFA 4NYOA 4DFMA 4N5SA 1M5VC 3D1QA 1ZAWA 2D7SA 2W4CA 2XLKA 1E6YA 2E5HA 2FLOA 1VRTB 4IYQA 2RIJA 4J9NA 1IXKA 3KNGA 4DQRA 3S7RA 4CH1A 2I8EA 1O8BA 2HYIB 2N3LA 3O5TB 4CT8A 1JLFA 5KFBA 5KFSA 3P96A 2CIMA 3MR6A 2W9CA 1PGZA 4Q2MA 5KFDA 5KT3A 1DRZA 3N28A 1KLNA 1GTHA 1FD2A 2N4DA 3H2VE 1F5AA 4OFZA 4ED5A 2BANB 2ZE2A 1Q86T 2D3OR 2YVSA 2AYBA 3H59A 2XULA 1TV6A 2LA6A 5L9XA 3PEJA 2GX8A 1WNEA 1DHMA 1RA7A 3DRSB 3H5UA 4JI2F 4X64F 3DLHA 2JJ4D 2IM3A 1UAWA 2BBEA 2EK6A 5B0DA 2HLTA 4I2PB 4USHA 1T05A 2BQUA 2ZH5A 4HLBA 3RAMA 5A6WA 2YKAA 2W9AA 1FA0A 3CTRA 2L08A 4GC7A 3J7YI 2E5GA 3R5AA 3ZZRA 4OHYA 2MSSA 1S1WA 3DFEA 4KR0B 2DD8S 4OQJA 3MFHA 3C66A 3M2UB 3MURP 1JLGB 1RK8A 2HIQA 3UNGC 5KT7A 1X5PA 3EXCX 1S99A 3TNVA 1DTQB 4DV0F 4WK1A 2UXDF 4H4MB 2AD9A 2HLUA 2YX4A 3AJ1A 4X66F 4I6AA 1R0AA 4DG1A 3IWNC 4J9RA 1ZPVA 3MTJA 4LF7F 5DJBA 4ZMMA 4UQGA 4F4XA 1D8ZA 3E01B 1WEYA 4QR1A 1SB6A 2FHMA 3VAMA 3C6TB 1KHVA 1HW9A 2C3MA 3JTPA 2RJZA 4NLXA 5GAHI 5J1NA 3ONQA 3B78A 2XLJA 2PO4A 4C0HA 2FVRA 4R8UB 3T5JA 1WTBA 1JXLA 1LQ9A 2CQDA 4FXDA 2QA2A 5MAOA 2CPZA 1UFLA 2LEPA 1FRIA 2G4BA 2VONA 4TN2A 5A8WA 3IAM9 5CZVA 3NCPA 7FDRA 1HWKA 1TKTB 2Z2LA 3R3TA 1S0VA 3KLEB 3HO1A 3QJPA 1KONA 2OPSB 3DYAB 4JYAF 4DL0C 1LWEA 2KG0A 4M8LA 4X4SA 1CC8A 4LSNB 2X1FA 5D3GA 2K3IA 3N6LA 1JLBA 4I69A 4WXOA 4JI5F 1S1TA 2AW0A 2APOA 3MECB 1X5SA 3C8YA 3AH6A 4RU9A 1E6VA 2ACYA 3V4MA 4KT0C 4NCAA 5KFWA 1WI6A 4UOCA 1GXTA 4DV4F 1IKVB 3KLGB 3CJKB 4ZCLA 1RKIA 3IR6B 1K8AT 4BC9A 2NUHA 4BCAA 4WTYA 5C42B 3FRYA 4LSLA 1XNRF 3O6QA 3B4MA 2HHHF 1MNEA 4ED7A 5HMWA 4PQUB 4ZPTR 2IVMA 4ZPWR 3DU6A 3FFIA 1VQOS 5KG7A 3HDSA 4BDPA 2KM8B 4WIIA 2W8LA 4B9VA 2BUNA 4CNZA 4AQYF 2WOMB 3N6MA 2RDIA 3DDNA 3OL8A 3KLVA 1V3RA 3K5OA 3H5XA 5THWA 2HW3A 4F2SA 5A8RA 1Q81T 2DIUA 3AA9A 2RRBA 3IS9A 5DDPC 1QUVA 2PN6A 5EGYA 2YWFA 2ZOMA 4YY3F 5DM7Q 1K73T 4J37A 2F4VF 3TR5A 3CD6S 4ILMA 1KLMA 3TUZC 3LP0A 1HBNB 2DRBA 2YWKA 3CD7A 2RKIB 4EZ6A 4Y00A 1DAXA 2GIRA 1FXDA 2V8GA 2WRMA 3OPKA 4PXCA 4WK3A 4O3RA 4DFKA 4LVNP 1H2VZ 2IC3B 3H4DA 4DS4A 2GO9A 2QMWA 4FXWA 4QBUA 3G8QA 2ZZNA 3V2UC 1RT5B 3MEKA 3OVSA 3OXLA 1A9NB 1DQ9A 4BHQA 2PI5A 2M8DB 3S01A 4K4VA 1HQUB 1M1KT 3CJ0A 3M05A 1K0TA 2MQMA 4EUVA 4ECSA 3OQ2A 1N6QA 1KQKA 4RW4A 1MWZA 3M8SA 3KG0A 2C22A 1YG0A 5J2NB 1X9MA 1H7XA 1Q7LB 1X4GA 4K4UA 3CIMA 1OPZA 3LGNA 4RUHA 3VALA 2DR5A <