1SXLA

Resonance assignments and solution structure of the second rna-binding domain of sex-lethal determined by multidimensional heteronuclear magnetic resonance spectroscopy
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
97
structure length
97
Chain Sequence
b'MSYARPGGESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLSVRLAEEHGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SEX-LETHAL PROTEIN PROTEIN
publication title Resonance assignments and solution structure of the second RNA-binding domain of sex-lethal determined by multidimensional heteronuclear magnetic resonance.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Rna binding protein
total genus 8
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 1994-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sxlA00
2DNHA 4BS2A 1X4FA 2MQLA 4J5OA 1U1MA 3SXLA 2AYMA 4M5DB 1FO1A 1BY9A 5GAHU 2RRAA 4EGLA 3CC2S 1NO8A 2MGZA 2X1AA 3IWNC 1U1RA 1FT8A 1UP1A 1X5TA 2F3JA 2MKIA 2RT3A 4WFBQ 1VBZA 2MKSA 3OW2R 3ZZZA 1D9AA 3RW7A 3CC7S 3EGZA 2ADBA 5LXRA 5H1SV 3VAIA 2DH8A 3THTA 3MXHP 1PO6A 3HI9A 1FJCA 1YTYA 2CJKA 2FHOB 2MB0B 2AYEA 2MMYA 1R8PA 4U67Q 3UCUP 1U6FA 4TLQA 3S8SA 2HYIB 2K8GA 3H2UB 2OSRA 2G4BA 1UFWA 2K3KA 2L9WA 1U1OA 2DGSA 2RVJA 2FC8A 3LQVA 2M8HA 3NS5A 2ADCA 2KI2A 1U1NA 2CQGA 1DZ5A 2JVRA 2LXUA 2VODA 2LA4A 2MZQA 5GAGU 2KXNB 3CTRA 2U2FA 1YI2S 3NS6A 1VC6A 1VQMS 2MZTA 2ZJRQ 3MI7X 2KM8B 1U1QA 2ZJPQ 1M90T 2VONA 1FNXH 2CPXA 2M8DB 1H2VZ 2DNYA 1L3KA 5IM0B 2X1GA 3K0JA 3ULHA 1QVFR 2MKCA 3CD6S 4V19X 3CCJS 1N52B 2CQ3A 5LJ3Y 2HGNA 2MZJA 4YOEA 2YWKA 5D77A 1KOOA 4P6QA 2CPYA 2N82B 4WIIA 1X4BA 2MXYA 3SDEB 1VBYA 2RU3A 3Q2SC 2LEAA 1N54B 3I55S 1M5OC 2QEXS 3R1LA 2CPDA 4YUDA 2KT5A 3G4SS 1K9MT 1SXLA 5CYJA 3MUVP 2XS7A 4PKDB 1A9NB 4WFNQ 1WELA 1M1KT 1VQ8S 3J7ZT 2YKAA 1VQKS 2E5GA 2DGXA 3U1MA 1X4AA 3CCES 3TO8A 2MYFA 1YIJS 1X4DA 4FXVA 1WG5A 3G6ES 1DRZA 4IUFA 1B7FA 3NNHA 2LQ5A 2UP1A 2OIHA 3ZZYA 1WWHA 2NZ4A 2RS2A 2MHNA 2D9PA 2DH7A 5JVHQ 2CQ2A 3VAJA 4PR6A 2GO9A 1Q7YT 2E44A 1Q81T 3MDFA 3UE2A 1K73T 2M52A 1WF1A 3S6EA 2YTCA 1VC5A 2KRBA 3UCZP 3P3DA 4ED5A 1SJRA 2XSFA 2XNQA 3CC4S 2F9DA 3SMZA 2DH9A 2KRRA 1QM9A 1N8RT 1R8HA 2MPUA 3B4DA 1HD0A 2AYBA 2CPHA 2B0GA 1H6KX 2G1DA 5CA5A 2D9OA 2J0QD 1WF2A 2YH1A 2X1FA 2LA6A 3UD3P 2DHXA 2DGWA 1YJNS 1RKJA 1W2BR 2MKKA 5DM6Q 2MGZB 1SJQA 3CCUS 3L3CA 4F25A 1H2UX 1X4GA 2QFJA 3VAFA 2KYXA 5HL7Q 3EX7B 2L41A 1Q86T 4LIRA 2M9KA 1YJWS 1U1PA 2MSTA 3UWTA 3IRWP 2DNOA 2KH9A 1FXLA 2BOPA 3EGNA 2MQPA 2KXHA 1ZZNA 2XB2D 1JMTA 2M2BA 2LEBA 3PIPQ 1UAWA 2MQOA 2QA4S 2RS8A 2CPJA 5LJ5Y 1YJ9S 4CQ1A 2RQCA 2DNGA 1HD1A 2CPIA 2KXFA 2YH0A 1KOHA 1K8AT 3G8TA 3NMRA 2DNQA 4YB1P 3J7YU 3BO2A 4IOCQ 4FXWA 1OO0B 5D78A 5GMKa 1VQNS 3VALA 1N88A 4UQTA 3VAHA 1D8ZA 2FPHX 2OJ3A 1U1KA 1OWXA 1S72S 2CQDA 3BEGB 1VBXA 5GAEU 2CPEA 2XNRA 3HHNB 2FC9A 3VAKA 3CCSS 4C7QA 5EN1A 4Z2XA 2DITA 1HL6A 2CQBA 5CXTA 2OTJS 3TP2A 4QU6A 2RQ4A 1U1LA 2VOPA 4LMZA 3US5A 1M5VC 2LYVA 2F9JA 5MLCV 1YITS 3NNAA 1WTBA 3VF0B 2DNRA 5FJ4A 4C4WA 3R1HA 1AUDA 4WF9Q 1F9FA 2HGLA 5GVQA 4CH0S 1X5OA 5DETA 2KM8C 2XS5A 2N3OA 2RNEA 2MQQA 2V94A 3CCLS 2KVIA 1SJ4P 4QQBA 1WEZA 3BO4A 2LECA 1FJEB 1S79A 1WHWA 2DIUA 2DNLA 2GHPA 2O3DA 3BO3A 4W90B 4Y00A 2MKHA 2HGMA 1X4CA 2DGVA 2MQNA 3VAGA 1VQOS 3CCMS 2N7CA 2HZCA 4QU7A 3MD3A 2LMIA 2I38A 3G8SA 2CPZA 1U2FA 5ITHA 4OZ0A 2OTLS 1U6BA 2DNKA 3S7RA 1Q82T 2JVOA 2MJUA 4CIOA 2Q79A 2KU7A 1WF0A 1DHMA 1WHXA 1WEYA 1O0PA 3R27A 4QPTA 5IQQA 5DDRC 2JRSA 5JVGQ 1KC8T 2LKZA 3CMAS 3Q2TC 2E5JA 1FJ7A 4CH1A 1X5SA 4Y0FA 1VQ6S 2KHCA 2U1AA 2OSQA 2E5IA 2JWNA 2KG1A 1UW4A 2KN4A 2DISA 1OIAA 5DDQC 4WFAQ 3PIOQ 3CCRS 3G96A 1X4EA 1VQ7S 1ZH5A 3FEYB 2CQIA 2MSSA 2DGTA 2MKJA 2DHSA 4RU2A 2ZJQQ 3VAMA 4IO9Q 2D3OR 2DGUA 1VQPS 2DHGA 1QVGR 1NJIT 2M70A 2E5HA 1WG4A 3H2VE 3UCGA 4ERDA 3BS9A 5LSOA 3DXBA 2CQHA 4C0OC 2JX2A 2AYGA 1IQTA 2CPFA 2MJNA 3CCQS 2WBRA 5HO4A 5IFMA 3CCVS 2CQ1A 5LSLA 3CPWR 1KQSR 2EK6A 2MZ1A 4LJMA 1JJHA 1RK8A 2LXIA 2HVZA 1WHVA 2BZ2A 1SJ3P 2X1BA 2SXLA 1WI6A 3D2WA 3DLLQ 3I56S 3THPA 1OPIA 2ERRA 1JJ2R 1HA1A 2CQPA 2EVZA 1JJ4A 2RRBA 1A7GE 5GADU 2VOOA 4ZKAA 1VQLS 2DB1A 5IM0A 3JB9k 2A3JA 3CF5Q 1VQ9S 2G0CA 2L08A 2RUGA 2PEHA 1P27B 3CXCR 2DIVA 2MZSA 1G2EA 5DDPC 1SJFA 3MUMP 4WCEQ 1M5PC 2DGQA 2NLWA 2J0SD 3P49B 3TYTA 2AD9A 2DK2A 4WKRA 2CQ0A 1YWXA 4PRFA 1VQ5S 3SDEA 1URNA 2M0GB 5DDOC 1YHQS 2DO4A 2DHAA 4F26A 1VC0A 4F02A 4TU8A 3CUNA 2DGOA 2KFYA 1WG1A 2N3LA 2FY1A 3CULA 1WEXA 2CQCA 3RW6A 3U1LA 1KD1T 4A8XA 3MURP 4UY8T 2MZRA 3MUTP 3NNCA 2MQMA 5DM7Q 1NU4A 1WI8A 2LCWA 2I2YA 4IOAQ 3N9UC 5LXYA 1PGZA 3FEXB 4TU7A 3CMES 2CQ4A 2MY7A 2KG0A 3MOJB 3B4MA 2J76E 3LPYA 3G9CA 1X5PA 1FHTA 3P6YC 2DNZA 1CVJA 4TU9A 2DNNA 3UD4P 3G71S 2M4MA 1WHYA 2MY8A 1VQ4S 1X4HA 1XN9A 3MD1A 1H2TZ 1DBDA 2XS2A 2DO0A 1P1TA 2PE8A 4OZ1A 5BJRA 2J8AA 2M88A 2EK1A 2M7SA 3S01A 2DNPA 1ZZFA 2DNMA 4W92B 1M5KC 1X0FA 3V4MA 3P5TL
chains in the Genus database with same CATH superfamily
3TARA 3DU5A 2FJWA 1JLGA 3BR9A 1RE1B 5GAHU 3E51A 4PG6A 1NO8A 4JI3J 1GTHA 2LVWA 4R0EA 3GR0A 3HI9A 4K4TA 4WZMA 3OTOJ 2ZBPA 4JI1F 2ROEA 2CADA 1RA6A 4F2RA 1SKSA 4NL5A 2K8GA 3H2UB 4Q8FA 4V1Ak 4OHWA 2YNHA 4PPDA 3TA1A 1YJTA 2VFVA 1ZETA 5DJBA 2NCKL 3CW2C 2MZTA 2C2NA 4RO0A 3C3LA 4NCBA 3DOLB 3M6VA 4DR3J 2ZH7A 2D3ZA 4EEYA 1FRJA 3GQCA 4DN0A 3D9BA 4V19X 4M5JA 5LJ3Y 2BA9A 3U1NA 1RT2A 1FKPB 4B3RF 3NGKA 1X4BA 2ZH6A 2MXYA 1XK8A 3Q2SC 2W9BB 2PI5A 3EDRB 2VG7B 2CXEA 4B17A 1RT5A 5CYJA 4DR1J 3C8YA 4RW9B 3IR6B 1WELA 1Z4UA 1EETA 2W2QP 4IUFA 1YBUA 1KVJA 1CJKA 4DWIA 2OKQA 4E98A 1T03B 4Q45A 3MDFA 4J9SA 4NXNF 4M8LA 3UO0A 2V4JB 2B5JA 3D6MB 1RU1A 4OJ3A 3TANA 2V68A 1NK4A 1XQIA 3MEEB 2MPUA 2B0GA 3VGTA 4I68A 3VQTA 3GSIA 1SC1B 5ETRA 3CT9A 4USJC 4CO4A 5L1IA 6AT1B 5DM6Q 4NLDA 4HT7A 4YY3J 3LWMA 4UF4A 3HSZA 4JOUA 1TK0A 2A18A 1EARA 4ZS6A 2RILA 3GR1A 1ZZNA 4ECVA 4NXMF 5E3AA 2CPJA 1BQNB 4KFBB 1TV6A 3DKDA 3NMRA 5KG2A 4A8QA 4DLEA 1N88A 2CKWA 2EFNA 3RBEA 1P8GA 4FYYB 1VBXA 1VRTB 4CO2A 3HHNB 2BDPA 3D0IE 2Z2LA 3TP2A 2GAGC 4LMZA 4NLSA 3A12A 1AFJA 4DPXA 5HROA 4WIQA 2RUSA 2XS5A 1MU2A 2V94A 4ED4A 2BQ3A 4UT4A 2C42A 1FF2A 1FD2A 1WHWA 2HFVA 1NB2A 1J27A 2YQ1A 2XYPB 4QIEA 4W90B 4Y00A 2YNIA 3O44A 1A0OB 2AHOB 1XNRF 4NEZA 5ITHA 1NK8A 2R7RA 5KFRA 2HQDA 4KO0A 4CIOA 3SBMA 4MH8A 4DR2F 3GJRB 3FEZA 3M2RB 5HVFA 4X4VA 1KS2A 1TP7A 3LGHA 3WQPA 2YWHA 4UOCA 2YKMB 4M5DA 5KFTA 1SH0A 3HJFA 2XGPA 1WUUA 2ZJQQ 3LTOA 4M5KA 3SCJE 2DHGA 1GXLA 4O3PA 2ZH1A 2B4UA 4DF8A 1TUWA 4Y2CA 5F0WA 2JX2A 2DVIA 1S1XA 1WSRA 3HVWA 3SYZA 1REVB 2SXLA 1WI6A 4I0WA 3MR5A 4OI3A 3QT7A 4DL5A 2J7KA 1OPIA 1S7HA 1HA1A 4JV5J 4ED6A 4QYRA 1S0MA 4Y34A 2V2KA 3M8RA 4WWSA 3CF5Q 1AZSB 2QTWA 2ZFHA 4ZN1A 2GVZB 2NUUG 1SBRA 4WCEQ 3SSQA 2RB7A 3FBBA 2UVWA 3W9JA 1UVLA 1YHQS 3R5GA 2XCAA 2ATCB 2R9LA 2DRAA 1LXNA 4MYTA 4JI1J 3QRQA 4ZPTR 3G87A 1ZM9A 3MM8A 2IVFB 1QUPA 1NSAA 3HT0A 4Y3CA 4KBIA 4F3OA 5LXYA 2H51B 1S5ZA 1JLBB 1C1BB 1PYSB 3ONQA 2RIJA 2XHWA 4CLYA 1WHYA 1VQ4S 3T1HF 1U0HA 5HAOA 3HSJA 2OO4A 5KFNA 1YBTA 1M5KC 4B3RJ 4Y2KA 3M8QB 3N79A 1WNEA 4DV3F 3AB4B 2PN6A 3UR0A 3HCXA 3RBXA 3V4IB 2K3IA 4RL1A 1HPZA 3IWXA 1REGX 4QWCA 2QSWA 4UUXA 2K7JA 2CJYB 4LRFA 4OI6A 4ZCMA 4AYBD 3E3XA 4KGXB 1VBZA 2QLWA 3SQGB 3EGZA 4WZQA 3FC9A 1NAQA 4PYDA 4BBYA 1U6FA 5A8WA 4CO1A 1C2PA 2QLFB 2L9WA 3TZZA 4O4GA 4WTYA 1U1NA 2H54B 3NS5A 4NXNJ 3UN2A 3DN9A 5KG7A 1B0TA 3IN5A 2KM8B 3MM5B 3KMQA 2BR0A 4Y2AA 3W62A 4IFVA 2K2PA 4C9DA 2H9ZA 4CLPA 3UDCA 1TL7A 1RDRA 2AZ1A 4MMOA 4E8UA 2IRYA 2RU3A 1FNOA 3KLIB 3CJRA 2O67A 2CPDA 2K06A 1ZPWX 2V0NA 2IJRA 3EVOA 4Q7AA 3WC0A 1SQEA 4OZ2A 4NLOA 2HHQA 3A3NB 4NXMJ 4IRKA 3FMWA 4OMFG 2XM3A 5J2PA 3GV7B 2H3EB 3GZ7A 3ZTSA 3K7RA 1S9GB 4YMEA 4MKVA 1IJFB 5IC4B 4QWBA 5L46A 2C2ZB 5KFJA 2RS2A 4CH7A 2E9ZA 1GMWA 1S1TB 2DY9A 3ISNC 2B56A 2X51A 2HHTA 4KV8B 2ZWPA 3H4DA 5KFXA 4ED7A 2ZZNA 2XMVA 1H6KX 5C42A 1JLGB 1FESA 1T9WA 2C3PA 3RRHA 3LAMA 1W2BR 1SJQA 4F25A 2QFJA 5ETQA 3AOAA 2F40A 2J0XA 3J80U 1JNZB 1U2RA 4AL6A 4K4ZA 1U7LA 1XNRJ 1FRMA 2V8HA 2ZITA 1B64A 2CPIA 2V8PA 2YNHB 1U0SA 4LFCF 2IDEA 3B6BA 2QL5B 3VALA 1NSQA 5CH7B 1FVSA 1OWXA 3W2WA 4O4RA 3IAS9 3M8SA 3LW5C 5GAEU 4C7QA 5F3TA 4O0NA 5BXIA 1I94F 1WDDA 2FHJA 3AD8C 4UW2A 2JEJA 3NNAA 1RT2B 1NKCA 5F8IA 5KT4A 2A6MA 2HGLA 1TK5A 1K1SA 3MAAA 1RT5B 3NS7B 4QW9A 3MCMA 2NS1B 3BGLA 5CD4H 1EETB 2CJ9A 2ZH4A 3BO4A 2YQ0A 3E01A 4PABA 2HFUA 1WTFA 3TNVA 4LF8F 2A6OA 2AGOA 2GCFA 4OZ0A 1CJTA 5J1PA 4B9NA 2YWWA 4NZ7A 1Q82T 2V34A 2BQRA 2B5JB 3TZYA 3TAPA 2HFNA 4RBVA 4USKA 3EZUA 1WC3A 2JWNA 3AXMA 3M8WA 4LRCA 4UQGA 5DDQC 3PIOQ 3NLCA 3UPFA 4M5GA 3VAMA 1HNWF 3N4WA 1QVGR 2M5YA 5H9EK 2M70A 3R2DJ 4J9UE 4ZPDA 3MPDA 3D5MA 1UFKA 5I3PA 4BC7A 4RR5A 2CQ1A 2QFIA 3K5OA 4R8UA 4DV5J 2YX4A 1FE4A 3IG1A 1TV6B 2A2CA 3JSBA 3T1HJ 4IR1A 4ZP7A 4HDGA 3THPA 4ID8A 2CYYA 2WVEA 2VOOA 4DV3J 1O6XA 4MK7A 3GSDA 2PEHA 1P27B 1TMMA 3K58A 5BYQA 5HROB 1URNA 1D8YA 2LQBA 4QJVA 3FNNA 1XWLA 1MU2B 2HAFA 4X65J 2OLWA 2NPIA 3OXGA 4JI2F 4P72A 1WI8A 2GIQA 4F2SA 4IOAQ 2E9RX 1HKAA 2MY7A 4KO0B 3H4BA 4I6YA 3P6YC 1S59A 4B9LA 4DXLA 1XTZA 3DRXA 4PZVA 5G4DA 1U8SA 3V81A 2QMUB 4OI2A 2CUYA 4M5DB 1TR0A 1X60A 2R7XA 4NZ6A 4TVAB 2IPOB 1RYSA 3M9OB 4LF2A 3N6LA 1X9MA 3ZZZA 2BJDA 3VAIA 4PXCA 1PO6A 2V2ZA 3BZQA 2L9NA 3BKTA 4AXJA 2MMYA 3AQPA 1VMBA 4ZCKA 1UVJA 1S9EA 2YKQA 5ETPA 4OJ1A 2K3KA 1ZAWA 3MPYA 1KQKA 3V6DA 4KHMA 4IH5A 5KFZA 4F4WA 1RTHA 1WJ9A 1O5JA 3FSYA 4WP9A 4LBHA 2VJVA 2J5AA 2MKCA 2ZKTA 1NH8A 4RNHA 1RCXB 4OYZA 5D0GA 3TUIC 1R31A 3RZAA 2NPFA 3GLJA 3UW1A 4RUCA 2DRBA 3R1LA 4DX7A 4RX6A 5CZVA 1RAOA 3UQSA 4OYOA 1U4BA 3J7ZT 3DLEA 3MM8B 1OQ6A 2ZC4A 3MCOA 2OIHA 1Q8BA 2B43A 3Q8UA 2GO8A 5JVHQ 5BYSA 5KG0A 2ALYB 4C97A 1UCNA 1U0HB 2HNYA 1BGXT 1I94J 1MLAA 2JEFA 2WK4A 1FRHA 1PIEA 3R3TA 4LVNP 4RNFA 3LUYA 1WF2A 1HPZB 2DHXA 2XI2A 2MKKA 1WC4A 3D6HB 3QZ8A 2YNGA 4LF8J 3SFUA 3AXKA 5IQ6A 2J9CA 2YXLA 2IDLA 2CFXA 2I5JA 3J80Y 5A8WB 1S4FA 4CYUB 2GQCA 2ZZMA 1XERA 4O4GB 4FF2A 3AODA 1W2IA 3J7YI 1XMQF 3HHLC 2R8GA 1GMWD 4IFVB 3GE9A 1TL4A 4GKKF 1TL7B 2RQ4A 1HARA 1WKKA 3US5A 3ZZ0A 3DOMA 3PHEA 2E1RA 2HBZB 4WF9Q 1NHUA 2OGUA 2N3OA 1U02A 3V6KA 1FKAF 4U6PA 2QE5A 4EK2A 2HSEB 5DG7A 2I38A 1V3RA 1WDTA 4PQUA 3LOUA 3MWBA 4DL2A 4DV6F 2DR8A 1BWVA 2WVCA 5CZXA 3G2XA 4DPWA 3UNGC 2VPWB 2A2DA 4DZDA 4K4YA 4CLSA 4RWWA 5U47A 2BX6A 2KG1A 1UW4A 3MMCA 5C42B 1UWBA 2FHJD 5KT3A 1SKRA 3BM7A 2DGTA 1NUEA 4ELTA 3H5UA 3CJ3A 1HBUA 1B99A 2C1EB 4DUYF 4FPIA 3BR8A 4JI2J 2PEBA 1W26A 2JZ5A 5FIIA 3CD0A 3OL7A 4C0OC 2OPSA 2XBPA 5HO4A 2VICA 1JJHA 4FPRA 4OYBA 5IT4A 3VQSA 5SZTA 4DQSA 3DLGA 5LMNF 4DBQA 1CSJA 3W2WB 3RBZA 2ASYA 2EVZA 2FUG9 1J5OA 4OYPA 2DCUB 1BE4A 2A3JA 5F0UA 4YR3A 1R7IA 1E6VA 3EVWA 2YX1A 1M5PC 2ZH3A 1GX6A 2XO6A 2W1BA 2V6AA 4OYXA 1H0HB 4NOHA 3E01B 3HSDA 4B9UA 4IDKA 1PGZA 4QIFA 3CMES 1CJTB 2KG0A 2XO7A 2XG8A 3OJUA 3DFEA 5T7LA 3I0RA 4C8ZA 1XR6A 3BJYA 4OI1A 2VJUA 1X4FA 2QSFA 2ZHAA 3BF4A 1IR2A 1U1RA 5DZ6A 5HVGA 2RT3A 4JV0A 5M2RA 1SL0A 2W25A 2LQ9A 4K5RA 3G86A 1RQ0A 4DFKA 1N36F 1YBAA 4U67Q 3QT6A 4R8UB 1R8CA 2MKYA 2RVJA 3IG1B 2KI2A 4A8KA 1R27B 4FBTA 1ZM4A 1FKOA 3CTRA 4KT0C 3PJ9A 2DNYA 3KFWX 3JQMA 1Y11A 3C2PA 1R8AA 1RZMA 1PC5A 3W60A 4WE1A 1LFWA 2N82B 4WIIA 1J2VA 1CG2A 4ZPWR 4NMLA 4ETXA 5FD1A 4AD6A 3QGPA 2ILZA 2LQ8A 1YG0A 3OUYA 3SCIE 3UFCX 4QIGA 2DGXA 2ZM6F 4Q44A 1TUGB 1Q8LA 3K5MA 2UP1A 2IC3A 5B0BA 3GJTB 3PX4A 3TX0A 2XY6A 3QIDA 2DH7A 4NYPA 1XMQJ 2DPIA 1GFWB 5LOQA 2HQCA 3S6EA 2YTCA 4GKKJ 2H5EA 5CABA 3QMQA 2OI2A 3CC4S 4LR8A 2VUGA 1HD0A 2OAUA 3B82A 1URRA 4R5PB 5E5NA 3GFYA 3MMBA 2OPPB 5I42A 4DV0F 2UVVA 1RKJA 4ID5A 3GJSB 3JTPA 3DU6A 3DRPA 4M5LA 3CCZA 1LOUA 4DV1F 4XDDA 1LWCA 5JUMA 1QAXA 1JMTA 2M2BA 3DCAA 4DFMA 1UAWA 2Z2ZA 2YKOA 4DV6J 1S9EB 2RS8A 2DR9A 5LJ5Y 4ECXA 2RQCA 5E33A 2JLFA 2HRUA 5AXKA 3KWMA 3V6DB 2FB0A 4CO0A 5D78A 2ZH8A 2J6TA 2BVZA 2VG6A 1RTHB 3MR7A 3BEGB 4JYAJ 4HTJA 1DJ0A 3N6MA 3RUBL 2P2CB 2FVCA 3I9ZA 2AIRB 4O44A 1IR1A 2YWEA 5ADZA 4DUYJ 1X5OA 5ETKA 1JNRB 1VIOA 4UOHA 4K4WA 4ED2A 1YJVA 3DMJA 1FE0A 1QJHA 1ITPA 1IBKF 3Q8VA 3DLEB 4B9TA 3BO3A 3K5NA 4CP5A 4I56A 3G8SA 2E7XA 4LF6F 5LMNJ 2VKRA 1V3SA 1WF0A 2DR5A 2V50A 1O0PA 2Y3YA 2OPRA 1FRXA 2HNYB 3DYAA 3TJAA 1LEOA 2E5IA 3Q8RB 3N5BA 3WX8A 4K2JA 4NA2A 4IFYA 3OFFA 3C14A 4J9PA 3CGIA 2FJXA 2MKJA 3LPEA 2D3OR 2YNGB 1FTCA 3FZBA 3NP5A 3M8ZA 4CLZA 3EVMA 1NZAA 2YNFA 5HJYA 4F4YA 1AYEA 3HHLA 2I5JB 2MJNA 4DL0C 3G82A 2EK6A 3TAQA 5A8RA 2K7KA 1TL5A 4CO3A 1SIZA 4RUHA 3Q89A 3KUEA 2Y1JA 3D1HA 2EI5A 5L1JA 4ED1A 1RBLA 2VA3A 2V4QA 3BQ0A 5CHCB 1RWVB 4IG3A 3KYLA 1RA7A 3DOMB 3PFOA 2R2TA 3MTJA 3TYTA 3AAWB 4KYZA 3MPUB 1N6QB 4PXBA 1IBMF 2QA1A 4RW6A 4TU8A 3CVKA 1XBWA 5L39A 2RD5C 2Z57B 1IKXA 5J2NA 1N36J 3QAEA 2UXCF 3RW6A 1KLMB 2XCPA 2WSFC 2C2OB 2R7SA 4UY8T 4P2FA 3TUJC 2VZ9A 5FLXU 4PQUB 1RTDA 1QDUB 1AUSL 4P2XA 3MOJB 5DQGA 4I6WA 1X5PA 4I69A 3KDNA 4MK8A 1JB0C 2ABYA 1DBDA 1IN0A 1GQEA 2GFFA 4ZLNA 1HBMA 4O3SA 5K14A 1GNKA 3D67A 3MMCB 1N32F 3DRYA 1U1MA 1P1LA 1UWBB 3M9MB 2BV3A 3GFHA 2XULA 3CC2S 1RAHB 1N0UA 1HBUB 3OVAA 2VFRA 3GYGA 4EZ6A 2CNNB 2OPSB 5B0CA 4UOFA 2Q43A 1VHIA 5IT9U 2DGSA 1RWNB 2O5DA 3DLGB 3DLJA 1FDDA 1FWLA 4P73A 4G65A 1G6BA 4NCGA 3MI7X 1F9HA 2VONA 2KFNA 3FBEA 1J5OB 1CC7A 1TU0B 2UUAF 3FQLA 2F8HA 1E6VB 3OL6A 1N52B 3CJKB 4DV0J 4X4SA 1VR6A 5D77A 4P6QA 5A2QU 2HRTA 1VGYA 4DV1J 1SV5A 4PWWA 4BWJA 4J9LA 3CCTA 2EG1A 4WFYA 3FQKA 2E5GA 1CULA 1EAYC 3TWZA 3ZZOA 2ZDPA 2MYFA 5E3RA 2XMKA 4IDKB 2H1YA 4OI0A 3BGRB 4H4OB 2Q66A 2B9EA 1P6TA 5T7LB 2AEJA 4RW4A 1YVFA 2GO9A 2NYHA 3I0RB 2PT0A 1HW9A 3UR3C 3NGRA 5HQ8A 1BLUA 4M63A 5K8MA 3PFEA 2AJ1A 3PCOB 3SMZA 4F0MA 5CCLA 1VRQC 2CIMA 2OEKA 5EWGA 2QX0A 3QATA 5K8OA 3ILLA 2HQFA 1V5IB 2XY7A 2ZH5A 2DGWA 2RHQB 1IBKJ 3EJMA 1H73A 5HL7Q 1RKIA 2FJEB 3Q8YA 2DNOA 3H90A 1SL2A 2AJFE 2KXHA 1HNXF 1EX8A 3CWJA 4OQJA 4LF6J 4JI7F 5AXLA 3DDNA 2ZUGA 4L72B 1YJ9S 4ZLPA 2AGPA 4B9VA 4ZHRA 4FXWA 1FKOB 3VAHA 3D6TB 1SKUB 5DGBA 3RB0A 4LSZB 1U1LA 3MM6A 3QWUA 4WE1B 2MTLA 5FJ4A 4MTPA 2P8IA 4B9MA 3NGTA 1RB0A 2KKHA 5A8KA 5DETA 5IV4A 4X64F 3OUYB 3W9HA 5HMYA 4ZP6A 2HGMA 2IC3B 4NLTA 3PRBA 4ECSA 2XMMA 4DG1A 4YN3B 4OYAA 1KBRA 1SIWB 2CZ4A 3IMQJ 3ET6A 4EI2A 2F5GA 2IA6A 4JI8F 4DS5A 3LP1B 4F4XA 2H65B 2HBRB 2LXFA 3MMBB 1IBMJ 2FZKB 2AEMA 4J9NA 5I42B 2OPQA 1S49A 4ID5B 4CLKA 2CJBA 5KT6A 1PAEX 4TYAA 2UXCJ 4ECUA 3DRPB 1TMJA 4AQYJ 1PSDA 5KT5A 1GK8A 1S1UA 1WG4A 2GW8A 1KKHA 3MR3A 1RBAA 2XMAA 1HQEA 2WBRA 1TL1A 3J7A1 4LJMA 3DI6A 4A8SA 3O1LA 4LF7F 3U7JA 3CEDA 2KDOA 3DLBA 2R2RA 3I31A 2VG6B 2Z2YB 1IQZA 3ZO7A 3FK4A 1HWLA 4ZP9A 4HI1A 2AT1B 4HHUA 4M95A 1WKLA 2J6SA 4J9QA 3DHXA 2L08A 4ENOA 2GVDA 4KGVB 3T5LA 5IWAF 2QYGA 4O44B 5DQIA 2Y1RI 3GCWP 3C19A 3AY0A 3MMAA 1KN6A 3SDEA 2Y9HA 2RRNA 3HJVA 4FF3A 4F26A 2VHGA 3DMJB 4FNHA 5CCMA 3W64A 2XQCA 3N6NA 4USUA 2GJFA 1GXTA 2MZRA 2V4RA 1DARA 4GKJF 2XGQA 3LAKA 2LCWA 4NA1A 4A48A 2C28A 2RDIA 5FLXY 3LPYA 3I82A 1XNQJ 1TELA 4WFXA 2VKZG 4ALZA 2W9AA 3DYAB 2UUAJ 4USHA 4X4OA 3RAQA 3CO9A 2ZH9A 2HWHA 2QC3A 4XIUA 3P5TL 4IFYB 4BS2A 3C14B 4QW8A 4JV1A 2YY3A 2ASJA 5GAHI 4OI4A 4I6AA 2CNLB 3NAHA 3KHRA 4EYIB 2W24A 8ATCB 4LFBF 4ZITA 5LXRA 2BJ7A 4Z7YA 2YNFB 3OFEA 4WFZA 2CJKA 3HHLB 2V69A 3M2VA 1X9SA 3T1YF 3G82B 1UVNA 4J9RA 2OSRA 4FYDA 4LRBA 2G4BA 3DOKB 2WAQD 3MFIA 2MZQA 5IT9Y 3HHKA 2Q6BA 3OV7A 2RQKA 1ROFA 1RLCL 3V2UC 2AWZA 3CMQA 1RWKB 1DQ8A 1UVMA 1NEEA 4IG3B 5FDLA 3ADAC 1IKWA 1RT7A 1HBOB 4HT5A 2IJFA 3CNQP 4X4NA 3NL0A 1VBYA 4I7FA 4RJVA 1IM6A 4YUDA 4RW6B 4ZLJA 4DUZF 3BDEA 2CAJA 1PYOB 5A2QY 1U45A 3R7BB 1HNXJ 1IKXB 5J2NB 1L3TA 4F50A 4CLUA 2WBMA 1N33F 5ETLA 4ELVA 4JI7J 5EDWA 1Q0NA 5KFEA 2UVRA 4ES3A 1S1VA 4NRUA 1RTDB 2FYXA 2QA4G 3SV4A 2E7VA 2H48B 5DG8A 3KXDA 5KG4A 1WKJA 1DTQA 1FEHA 4H4MA 2KRBA 3PJWA 1HBMB 2F9DA 5K14B 4XK8C 1XMOF 3GYXB 4LRDA 1FFGB 3W5XA 1RWXB 1RACB 2D9OA 2PMWA 4WK1A 1HYSA 1YZ7A 1VK3A 1EB0A 4J90A 3D6FB 4LF9F 3QYYA 3IO1A 1L3SA 5THWA 2HIYA 4ZP8A 2Z8QA 2UXDF 4ATNA 3PIPQ 3EM1A 4KKOA 4RUBA 1GXUA 2QA4S 3CCWA 5K8NA 3RB4A 4F67A 2AQ4A 4O3QA 1AT1B 4AFFA 5GMDA 4OX9F 2B6AA 3TJ9A 4JI8J 1S72S 3DXSX 1NHKL 2JOQA 1RT4A 4Z2XA 1TUVA 3NY0A 2CQBA 4L74A 3J7Z5 2J9EA 3HFVA 1PBUA 5DLGA 2RDJA 1AUDA 3ZTPA 2PMHA 2B4PA 2FGOA 2ZVSA 2ROGA 2HK2A 1CULB 2P6SA 1VCTA 3QT5A 4QU7A 3PXGa 1PC4A 3KNGA 1NHVA 4LF7J 5CD4A 5HMZA 4FF1A 1VK8A 3KLEA 4EBCA 1X0PA 2VU5A 4RW4B 2WB1D 4RPFA 4FYWB 6FDRA 2R8KA 3SFGA 1WEYA 5HI7A 1FXDA 1KC8T 4AXIA 3C15A 4M5HA 1J5EF 2HVHA 5IWAJ 4QPXA 4LSNA 1MROB 2QV6A 1KP6A 2FD2A 1DAXA 3FEYB 2YPZA 3SIPB 2DGUA 1XC9A 2IHR1 5AXMA 3A8KA 1D9DA 4GKJJ 2DKOB 3O5TB 2UXBJ 3MR6A 3ZNUA 4K4XA 3LWLA 3CCVS 1EJ7L 1T9YA 2HHHF 3S1TA 3GTYX 3W8GA 1RK8A 2LXIA 2ZDOA 3CJSA 1SJ3P 2AJ0A 4ZHRB 5HLFA 1M5SA 1NK6A 3OL9A 4KGKA 4EFAC 3JSMA 1UWAA 4J9VA 1T9UA 3JAMU 3AJ1A 2W8LA 2DB1A 3JB9k 2RF2A 4QBUA 2MZSA 3NCPA 1X8DA 1Q4RA 3KJVB 3P49B 4PG7A 1TZ0A 4QR1A 1W7WA 4FDFA 2WW4A 1OY6A 1YWXA 3VVTA 4DPUA 2XMJA 2DHAA 4LFBJ 3W1YC 2KFYA 1FDBA 2D69A 3ZXWA 4HHHA 5E41A 3T1YJ 2C2EA 1UL3A 5MAOA 4ECYA 2NSBA 1OSDA 3MUTP 1SVDA 4JV2A 2G2OA 3B78A 3K8VA 4ZVFA 3QGHA 1N34F 3FRZA 1NCLA 4N7TA 1SQFA 2OP5A 2J76E 1A6LA 4DG1B 4TU9A 4JUZA 3L7OA 5DQHA 4Q2LA 3ET6B 5D8HB 2Z0GA 2PE8A 3GIJA 4OZ1A 4FVCA 2ZOFA 2DNPA 2W7OA 3V4MA 2DNHA 4J9MA 2MLYA 4OZ5A 2OPQB 4DUZJ 3QSIA 3PG9A 2L3MA 2ACYA 1R8BA 3IWNC 3TAMA 3BPDA 2EC2A 1N33J 5DZ7A 2MKSA 4OHXA 3RW7A 4DQIA 3OTCA 4DR5F 5C2GA 2NXJA 3VZHA 4XAKA 1HQEB 2D3UA 1TL1B 3S8SA 2BQUA 3LO3A 1JK9B 1NDCA 3DI6B 4NZ0A 2M8HA 2VODA 1TKZA 2U2FA 3H7HB 2DR7A 4WTOB 4UZCA 1XMOJ 4N77A 3BREA 2GVDB 3ZZTA 2YWKA 1RLDA 3MMAB 5CYQB 2FY8A 3SDEB 3KUGA 1XIQA 1YJ7A 2LEAA 2D1CA 1KNZA 1A9NB 2IYIA 1M1KT 4YB5A 3LGMA 2UXDJ 1VQKS 1GX5A 4PCQA 2OD4A 4URQU 1NH7A 4HTIA 3ITHA 4OX9J 2MHNA 4C8NA 3W2VB 4U96A 2CWXA 3NGUA 4CT8A 2NXNA 1DTTA 1K0TA 2DH9A 5KFVA 4A4JA 5AJ3J 1R0AA 5LMUF 4DEZA 2Q3PA 4LF4J 3PY8A 3L3CA 3CJ8A 2MSTA 1JX4A 4TY8B 1PYTA 2FLLA 3FJ2A 3M2VB 2HHVA 3W66A 4Z37A 1YJUA 2JJ4D 4CQ1A 1HD1A 1CQNA 4ICLA 5HANA 3KLFA 2XI3A 3DC2A 4YB1P 3ELHA 1D8ZA 3ENWA 1J5EJ 2UUTA 1U1KA 3MAQA 2GMJA 4I2PB 1HNIA 2IM0A 3QIPA 1U49A 1IJEB 2CWKA 5GAEI 5FDLB 1D9FA 2VOPA 5F8MA 1C0TA 1RT7B 1ZA1B 4DMZA 4M5IA 5DRKA 4I7FB 4IH7A 5GVQA 3PW4A 2FVQA 2VDIA 3G8QA 3QGGA 2ASDA 3GIMA 1HNVB 4AE5A 4N41A 1N0VC 1FWPA 2DNLA 3IBFB 4IQMA 2HHHJ 2DGVA 3GONA 3KK3B 1VQOS 1S1VB 3EPGA 3RGIA 3CDEA 2LMIA 4DSEA 3ENQA 4ZMMA 1FWKA 3S7RA 2Q79A 2QO3A 4BLGA 1HWUA 1DTQB 5IQQA 5L38A 4DV2F 3PYGA 3HMJG 4NCAA 2OSQA 4OZJA 4JI5F 2M3DA 5ETNA 4CLWA 1HYSB 1Q1KA 3FZ2A 3CCRS 3IBCB 1ZH5A 3O2IA 4QYZJ 1ZPVA 4F4AA 1ZS6A 1N4LA 4CM0A 5DGAA 1N34J 5LSOA 3DXBA 4KKOB 3ENVA 4PXEA 1UETA 2DT9A 1Q79A 4QYZK 1Q95G 1S76D 3GV8B 3Q83A 4CCHA 5JJBA 3I56S 3OR1A 2ZKUA 2V2VA 3IGNA 3QRRA 5C24A 2B6AB 2QT7A 4L3KA 5GADU 3LALA 4ZKAA 3CDBA 3UNYA 3JAMY 4J91A 3MM9A 7AT1B 3QJLA 5CYMA 3FDSA 3KNAA 3RYLA 3TJ8A 1N48A 1DLOB 5IXUA 2J0SD 5J1NA 2RJZA 4TYBA 1T8EA 1U25A 2LP4A 2M0GB 4J37A 3L7UA 2JDJA 1D1UA 2DGOA 4DR5J 4X4RA 2VBXA 4OZLA 1KD1T 4ZIWA 4NLYA 4FP9A 3NNCA 3PX6A 5AE3A 3FEXB 3KLEB 2VASA 5AE2A 4U7UK 2W4CA 2VQFF 2DNZA 4RNOA 3BBFA 2ASLA 3C15B 1QUVA 3MCSA 4ECZA 4O0IA 3T5KA 3GILA 5BYRA 5D4PA 4TLRA 4GC7A 4WP3A 4LSNB 3J81j 5F8LA 3BV8A 4QZVB 2RU9A 2XLJA 3CC7S 3F44A 4RU9A 4OZ3A 3M8YA 4HR2A 2FHOB 2AYEA 2WB4A 3T3FA 3HHDA 1JKHA 4ANDA 3UCUP 3D68A 2ADCA 3QZ7A 5HLFB 2G1HA 3JSMB 2Y0BB 5HBMA 1NM2A 2AGQA 1T3NA 3JYTA 2POKA 2RF2B 5LMUJ 1PJ5A 4IYQA 2HAIA 4M5NA 4UY85 1YQHA 1BWEA 2PFFB 3I55S 4M94A 3KKFA 4DSIA 3M1VA 1B7YB 2XS7A 4KB7A 4QIVA 3OLBA 1RJJA 1V9OA 1MNEA 3MEDA 1BD6A 4DX8H 2KO1A 3MAHA 1EIYB 1JLQA 3CJ4A 2YVSA 3NGDA 1EP4A 4ANEA 3BPSP 3QJJA 1Q7YT 2E44A 1Q81T 1WF1A 1JIHA 4C98A 2IMWP 1W25A 2W2NP 4DOZA 3F41A 4TQRA 2X3GA 2CPHA 2KJVA 2IM3A 2G9OA 2J0QD 4ILMA 5EHHA 4A8WA 1H7WA 3FFIA 3TEGA 3I96A 2DRDA 3TAMB 5D0EA 2D7SA 3PKMA 5F41A 1YJWS 2E1CA 4DV4J 1FXLA 3M30A 4WBFA 1RYRA 4RW8B 3POTA 2KVQE 3D54A 2LDYA 1QTMA 2NXCA 1F0XA 5EGYA 1WSVA 3IRXA 2Z58B 2HIQA 3BO2A 4DV2J 1TKZB 1OO0B 5GMKa 1LQ9A 3IS9B 1ICEB 3AOCA 2FQQB 4JI5J 1VOMA 3K59A 2FC9A 2IVYA 5KFGA 1ELOA 1U2CA 5EN1A 5K9FA 3MEGA 2DITA 5CXTA 4QU6A 4QWAA 4J7CA 2D3O1 2FHKA 3KHHA 4C4WA 3FSXA 5J1EA 3TVKA 3PTWA 3PO4A 2R2UA 2BMBA 1HR0J 3OL8A 3MECA 3QFHA 1JWWA 5H9FJ 1V6HA 3FUYA 2GHPA 1X4CA 3M8PB 4OJHA 2K1RA 3ITHB 5J2QB 3QSYB 4IOBA 2KU7A 1RT6A 2P5VA 2JRSA 3MEKA 2LKZA 4DV5F 5HATA 1X5SA 2U1AA 1XMBA 1DTTB 2UUBJ 1JXEA 1R0AB 1RISA 2ACMA 3LP2B 2C3OA 1VQ7S 3DM2A 2XZTB 5L8RC 1F5CA 4RW7A 1IBLF 3RG6A 5ETVA 3HVTA 2H5IB 4LF5F 1DURA 3KLHA 3IP0A 4X65F 5AXNA 3AQOA 5LSLA 2VQFJ 2BJEA 1BHNA 4ICLB 4L6V3 2HVZA 3KLFB 1OQ3A 4X4UA 4NEYA 2X1BA 2CG8A 1HNIB 1Q5VA 1JJ4A 3QIPB 2EFGA 3EGWB 2RAQA 1RAEB 1Y3KA 5IM0A 1S9FA 5K20B 2DIVA 1C0TB 3TW0A 4ZJOA 2EXUA 4DSLA 1RP5A 1FX4A 3R5CA 3CUNA 4WXWA 2GIFA 1WG1A 1HHTP 4DZ6A 2CQCA 3OBIA 1PKUA 3MURP 1WC1A 1NU4A 3ZTRA 3HD2A 3VR1A 1HLWA 1JLAA 5F9NA 1NPKA 3N01A 2MY8A 2XS2A 2YBVA 3MCNA 4MYUA 4Q2MA 1UZHA 2FTRA 1YLXA 2CDQA 2M7SA 2UV8G 1X0FA 4ZVHA 3TVZA 3FCVA 4AT1B 1FO1A 1OMSA 3KMSA 2PA8D 3UD5A 3HZGA 3EZOA 3EXCX 2MKIA 1H98A 4Q0BA 2JC1A 3M4XA 3MXHP 3AFGA 3I5CA 1Y4ZB 2VFUA 3QQCD 1NK7A 1S6PA 4YHHF 4TLQA 2EWHA 3HP6A 3FMBA 1UFWA 2NXEA 2FC8A 3NRBA 4KGZB 4KIAA 2JVRA 5KT7A 3OR1B 1S99A 5C24B 1YI2S 3NS6A 1U1QA 4DCOB 4YB7A 4KH0B 1L3KA 2BE2A 2HPUA 1JLFA 4GVBA 3MM9B 4PYAA 5CYMB 4LREA 2FLOA 4ELUA 2CPYA 4C8KA 2JC0A 1JLCA 1LNQA 3ISZA 1NKBA 4NRTA 1CLFA 3BYRA 2J9DA 2MLXA 2GHVC 3TO8A 1UA1A 4FXVA 3AB2B 1CJKB 3I5AA 3ZZYA 4USIA 1FVQA 3ILOA 2CQ2A 1R89A 3IBWA 2E7WA 2CJAA 1K73T 3ZZUA 1R43A 4ZA1A 4ED5A 2O1PA 1SJRA 3MEEA 5F8NA 5KFIA 5T14A 1BUXA 5ETSA 2G1DA 2H4WB 2BW7A 2FZGB 3H5XA 1NMEB 1LWXA 1LFPA 1X4GA 4E0DA 1V3ZA 2M9KA 2J6UA 2W9CA 2EEYA 1OY9A 1S6QA 2FJDB 2F63A 1K44A 1JKHB 2BM1A 4CZCA 1BQNA 1RGVA 1CBKA 1FXRA 1LK7A 3A8IA 3QRPA 2GJIA 1S97A 3L9ZA 1GMVA 4C11A 2HHUA 1F2GA 1HBNA 5B09A 2LLZA 3JYTB 1LW2A 2LU1A 3PRDA 5D6GA 1TKXA 2LYVA 2DNRA 3RR7A 3SI8A 1IBLJ 2OUGA 1VRUA 3M1VB 4LF5J 4N5SA 4LR9A 1TKTA 3IAM9 2G0JA 2DPJA 2YKPA 5KTQA 5HSPA 2CA9A 2BKOA 2LECA 2J7UA 3K2YA 3MEDB 4AL7A 3D66A 3HFZB 2BYCA 3UDEA 1MN9A 1HIYA 2YNIB 1EKRA 4KJIA 4KRWA 4J9KA 3HX9A 2Z2MA 1EP4B 2DNKA 4F4KA 1FX2A 2BOAA 1ZAXA 9ATCB 5KFHA 4OHZA 4K4UA 4N47A 3WZ0A 2BJ3A 4U95A 4QPTA 2QN6B 2V5HG 5D0HA 4KC5A 5HMWA 1OIAA 3FFIB 4MKYA 3VVUA 1VQSA 2WZ1A 3PYDA 2G2YA 3K5LA 1KSPA 2VC0A 3C66A 4LT6A 3VGSA 1VIXA 3M30B 3LF0A 2MLZA 2CQHA 4CWBA 4C3KA 3POTB 2AEFA 2CPFA 3OSNA 3D0HE 1S1XB 1Y3JA 2PA3A 2BZ2A 3IRXB 3KJNB 2DD8S 3DLLQ 5B0GA 4LUBA 3F73A 4GMKA 1HHSA 2FZCB 1FNMA 3D3CJ 5LM7E 1AZSA 2VPZB 3IC1A 3MEGB 1NDKA 5F8HA 4X2BA 4PG5A 4F04B 4GC6A 4MKAA 3HHEA 5J1EB 1RSCA 4WPAA 4H4KA 4FKXA 3ENAA 4K50A 1HWIA 2Q1LA 3MECB 2W2PP 3CULA 4ZCIA 4ITSA 1I1GA 4YDXA 3WC2A 2EG2A 1Q16B 3R5AA 4YHHJ 2KFZA 4RBTA 4C2MA 1JLBA 2PIIA 1UKUA 2K1RB 2KZZA 2GQ2A 1I51B 2VQEF 1G1XA 3QNWB 3HLUA 1NZ8A 3MPWA 1RT6B 4C0BA 4YDDB 1H2TZ 3L95X 2J8AA 4XTTA 3GU0A 4W92B 2MDAA 3V4IA 1CPZA 2GIRA 3R8YA 2ALZA 1BY9A 3PW2A 4DSJA 4ZPCA 1NB7A 3DM2B 3RAMA 2RRAA 4EGLA 3C6TA 1ZOTA 4NLXA 2MGZA 2R8IA 3NEKA 1UJ4A 3OW2R 1UZDA 2F65A 4YS2A 3KLHB 2MB0B 3BSCA 3I9V9 3PRVA 1DQAA 2IFXA 1Y9OA 2EW9A 1U1OA 4LF1A 2HURA 2G2ZA 1TKDA 5GAGU 3I87A 1GH8A 1VQMS 5E0OA 1FNXH 4I2QA 4OZNA 2QMXA 2M8DB 1PJ7A 1T9VA 3J81U 5IM0B 3K0JA 3IGVA 5HVHA 1CS4A 5L9XA 4K8RA 2JL9A 2XLIA 3PZPA 2N4CA 3FVYA 2ZNZA 4QWEA 2CJXB 2BKNA 4ILRA 3MPVA 2PSZA 4IG0A 2R3VA 4I67A 3FCHA 2QIFA 2OMLA 3CE8A 3QO9A 2AP6A 2HS4A 3GB0A 1YIJS 1UVIA 1MWYA 4YQWA 1B7FA 1RTIA 1U26A 3NNHA 2PMZD 4CNZA 5J2PB 2VB6A 1FDAA 3RJMB 1NJWA 3TUPA 1WWHA 2AF6A 2BXJA 2D9PA 3NAIA 5CAAA 4NWBA 2NXUA 4DQQA 4B3OA 1K0VA 5HQLA 3UCZP 2VPXB 1N5TA 1Z1ZA 4QIWD 1FFWB 1OY8A 3GFXA 4B08A 3Q8SB 2AYBA 4NLUA 1S0OA 4JYAF 2FJVA 2F8MA 2X1FA 1NJYA 4AL5A 1SUQA 3VAFA 4NX9A 3PW5A 1IBCB 2RKIA 2UUWA 1Q86T 4Q0BB 3R7SB 5IV3A 4DR4F 3D4JA 1EQ0A 1S6PB 2HVEA 3BBCA 2WVDA 3UN5A 4WKYA 3VV2B 2KXFA 4U8YA 4DV7F 5KG6A 1R0BG 1VQNS 4DFJA 2BE2B 3MMJA 1JLFB 3JQKA 4GVBB 1WACA 4KAIA 2R7OA 4ECWA 5KT2A 1FRIA 4CH0S 1JLCB 1OPZA 4C8OA 4CT9A 2XEXA 4K0KF 1Y5LB 3MAAB 4NLWA 4ZLLA 1ZYQA 2DBBA 1RHUB 1WEZA 1HI0P 3V5RA 2HS3A 2NR0A 1Q53A 4NA3A 4F3MA 1T7PA 1OSCA 4GO5X 4DI6A 1C1CA 1T0TV 2O66A 2OH2A 1MMDA 5DDRC 4DU8A 4YFUA 5LL6d 1I3OB 2UVUA 2AX1A 3GG0A 4DN9A 2LQJA 4XPCA 2RHSB 4ECRA 2CZVC 4OLOA 4OV1A 3G96A 2GS8A 4A8FA 4ZVRB 4OHVA 2CQIA 2MSSA 4PEOA 2RE1A 5EWFA 2Z4PA 2W9CB 1WOPA 3BS9A 1S6QB 2XWYA 2APOA 3KDOA 1RAJA 5BR8F 2PI4A 3H5SA 2WONA 1SH3A 2VQEJ 4KGMA 1Q78A 2MZ1A 3Q0AA 2IIHA 2OELA 1KHWA 5M2UA 2OEJA 5RUBA 3D2WA 2QZ8A 4C11B 3NMAA 1HBNB 3T6JA 4EMDA 3PX0A 4KPCA 2KL8A 1RTJA 1YJRA 1LW2B 3OTDA 2IAJA 4DFPA 3BKFA 1FD8A 4N8OA 2G0CA 3A3OB 2W2OP 1U47A 3BH6B 1TKXB 3MUMP 1T11A 3H5YA 2DK2A 1Y5NB 3EPIA 1VQ5S 4F8RA 2HG4A 2AW0A 1VRUB 3CO0P 1TKTB 1R3NA 2FY1A 4J9OA 4K5SA 4JI6F 2BJ9A 2UZAA 3U1LA 4DHVA 3MTKA 4PUOA 5DS7A 2PGCA 4TU7A 2ZHBA 3H42A 1KWMA 2F1FA 1F5BA 2JFDA 1CVJA 5KFMA 2DJWA 1RHJB 1XN9A 1HI8A 3TA0A 2WCXA 3V6JA 2DNMA 2NSCA 2XYGB 3BDPA 1RUSA 4J5OA 1NRKA 3P4UB 1B4SA 3V81B 3NBPA 2HNDA 4LIWA 4P10A 2DXFA 4KE5A 4ZIVA 1EQMA 4B3TF 1SH2A 1D9AA 2ADBA 4PG4A 3ZC4A 3HFKA 4K4VA 5SUHA 1MMNA 1ZTWA 5KFUA 4HHJA 3VZIA 5A6WA 3JTOA 3OPKA 4HVZA 2AJ2A 3OT9A 3LQVA 4IRDA 2V8DA 2KXNB 1QLNA 4IR9A 4CLFA 1KDNA 5HN0A 1HI1A 3DRRA 3OHAA 1RAFB 2QYCA 1RXOB 2OHDA 4PWUA 2DR6A 3J81Y 2MZJA 1KOOA 3DGPA 4JI4F 5HK4A 2KT5A 2IM2A 1SXLA 1K9MT 5L1KA 5E3PA 5C7PA 1NK0A 1JXVA 4DR4J 3EGVA 3UI3A 3JXOA 4DQRA 2FVRA 3G6ES 4RLEA 3P8BB 3NOCA 4DV7J 5KOWA 3H40A 1RAGB 2GC8A 3A13A 4DSFA 3J7AN 4X66F 3MF5A 4C8LA 2EBEA 3GIIA 3VAJA 1I6JA 2EFQA 2P9EA 4G6VB 1IVZA 1NKEA 4F36A 4CTAA 3P3DA 2XSFA 4UOGA 2HZVA 1SC3B 4O23A 5E3CA 2JFKA 1N8RT 4TNOA 1R8HA 2J8SA 2HQGA 3H0PA 4BHQA 2YWGA 2FLPA 1HFEL 3C6TB 2MGZB 4K0KJ 2EPIA 4R0JA 4DX5A 1RHMB 4LIRA 3W65A 3UWTA 1CEZA 3JS9A 2KH9A 1TAUA 2N7YA 5B0EA 2BM0A 3LA0A 2LFVA 4CYUA 2C2DA 1WD6A 4DPOA 3QFWA 5B0FA 2DNGA 5D0RA 3U27A 1NPPA 1JJCB 4IOCQ 2FPHX 3HPOA 3CJ5A 3QAUA 4LVOP 3TX8A 2HZAA 4I2QB 4CO5A 3IM9A 1CS4B 4X4QA 1TVRA 2WW8A 1Q8KA 1YITS 1WTBA 2EFOA 3VF0B 3G6YA 3W5ZA 1S48A 2ZNYA 3UDLA 5KAKA 2W7PA 4IG0B 4FYVB 4MT1A 2RNEA 5KFPA 5KOXA 1C4CA 5BR8J 3QO9B 1Q7LB 1UVKA 4X4TA 3EE3A 2ZUAA 3M2UA 2MQNA 4AQYF 1RTIB 4QOTA 2CNOB 3DDKA 2MJUA 2IRUA 1YSJA 2DHHA 4B3OB 4HL9A 5IZHA 1WHXA 1XR7A 3CMAS 2E5JA 4CH1A 3Q24A 3NWGA 3T5JA 1SQGA 3T6BA 1S4EA 1X4EA 2AMCB 1NLKL 1SUQB 3I32A 3MHYA 3T5HA 3OTBA 4JI6J 2RKIB 1K47A 1FK9A 3GP9A 2VPYB 1RWPB 2E5HA 3ILJA 2W4DA 2PO4A 5DG9A 2GJ2A 4K59A 1FERA 1AA1B 2DTJA 2NREA 2RSQA 2ZE2A 4DR2J 3CPWR 1KQSR 1WHVA 4NYZA 2JLGA 1MW7A 4P2SA 4FYXB 2ERRA 4JP8A 2RRBA 2IBKA 1XNQF 1WOSA 2EFVA 3MZIA 3NKYA 5DDPC 4MIWA 4G3IA 2NLWA 3KJQB 4OLPA 4CNYA 1F3FA 5L1LA 4B3TJ 2DO4A 4GVLA 3H98A 1H38A 1HW8A 3VTIA 1WEXA 3KHGA 2GA7A 3D1QA 1UMJA 3SCLE 2DEJA 1KVKA 3H20A 2VFSA 2FGCA 2CQ4A 5E7OB 4UZBA 5D3GA 3G9CA 3AA9A 1AB8A 2HBYB 4CM2A 5H9EJ 1CQMA 1C1CB 2DNNA 3UD4P 1N5YA 3UDVA 3MD1A 1R6VA 4NI2A 5BJRA 3OR2A 5KFDA 4MK9A 3R7NB 4JI4J 2UUCF 1H74A 1C4AA 1HNZF 1TQLA 4DR7F 1L3VA 1TAQA 2X1AA 2C3YA 3OXFA 5M2PA 2N4DA 3FSIA 4DCPB 1F60B 2I8EA 2X3DA 3C6UA 5F3ZA 2IJNA 4X66J 2WONB 3O6QA 4ZDNA 4NPOA 3I0SA 1IWGA 2ILYA 5DO2A 1RTJB 5HMXA 5LT5A 3IA0A 4MIBA 2IAJB 3TQ1A 1RTZA 4ZVGA 3CDUA 3ULHA 3I6PA 1PAUB 4V19J 2NUHA 3CJ2A 1HWKA 4NLGA 2GX8A 1VFJA 3KG1A 3X3UA 2F4FA 3E2EA 5KFBA 1VDHA 2JSXA 4UTGA 4Y2IA 1S6UA 2D74B 2RDDA 3H59A 2KT3A 3KLVA 1QD1A 3PYEA 1WG5A 4PUOB 1IM4A 2W7AA 2KHDA 2NYIA 3CD5A 3EICA 2VL1A 2IBOA 4ZVQB 2ZOMA 1QTNB 1YDLA 3M32A 2B7CB 2HHPA 4L3NA 1JLEA 3UE2A 2BE9B 1D3WA 1VC5A 4DU7A 3VHQA 4ZPBA 4KQZA 2BEFA 2EBGA 2H4YB 4R5PA 2OPPA 2ZC3A 1MWQA 3R6GB 3HZEA 1VHFA 5KFFA 3NBPB 3PM9A 2YH1A 2HNDB 3ZZPA 2XZWA 4LR7A 3TZXA 4O3RA 3M9NB 3CCUS 3LANA 1ZM3A 4DR6F 2HW3A 4TKTA 2L41A 1N5SA 1U1PA 1R0CB 1VI7A 4ES2A 7FDRA 3QLHA 3PYFA 1T3OA 1V5VA 2XHCA 4OX6A 1WC5A 1LWCB 1EKSA 3JSYA 4A8MP 3CSKA 3BB5A 1BMQB 3CDAA 2VFTA 1YX2A 1KOHA 1K8AT 1BQMA 5B7WA 5I3UA 4P9SA 3BQ1A 3GYNA 1RI7A 2E66A 2F4VF 2W2MP 2HRYA 3DRRB 3CCSS 2Y8YA 3GFZA 2I6WA 4USVA 4RNMA 2HQ3A 4PPZA 4S0MA 3DGPB 4WU3A 1MMLA 4HYKA 5KG1A 1YGYA 1WORA 4TY9A 2QL9B 2OFGX 2E1AA 3HXMA 5KG5A 4QQBA 1S79A 5KG3A 2XWXA 4W4MA 4LFCJ 3HKZD 3CCMS 2N7CA 2HZCA 3MR2A 3Q8PB 1Y10A 2UXBF 1B0PA 2OTLS 4I64A 4YR0A 3OHBA 5JVGQ 3OFGA 4CTAB 3Q2TC 2OPRB 4HDHA 1D0EA 4TXSA 4CDIA 2W4PA 1B70B 2DISA 4ZVSB 3TUZC 3THVA 5KFCA 3HSGA 1Y00A 3WIVA 2MEWA 4RU2A 4FS2A 1F2HA 2C2KB 1U24A 1RADB 4MAKA 1T05A 1S12A 3KK1A 4Q8EA 1L3UA 3EUNA 5EUHA 1UA0A 5IS2A 3CCQS 3DLHA 1E6YA 4DL4A 2XC9A 2FHMA 4CI0B 3CJQA 4MIAA 5A8RB 4DQPA 1NSPA 2A0FB 4ZPVR 2FDNA 1JJ2R 1BXNA 4FBUA 3PEJA 3NWRA 4NLVA 3PW7A 4PWDA 2E1PA 1VQ9S 5GADI 4HEA9 2UUCJ 2IY5B 1HNZJ 1TVRB 1HNWJ 4DR7J 3MGJA 1N6QA 3RAXA 1MG7A 4WKRA 3D3BJ 3W63A 2AX0A 4ECQA 3ZTQA 4HACA 5A76A 1KLMA 3G6VA 1YRTA 2GGPA 3ZFVA 1FJGF 4RZRA 2I1RA 3M2UB 2XMTA 2BANA 2I2YA 2COLA 1IUJA 1BQXA 3B4MA 4Q5VA 3PV8A 5C2CA 4FS1A 4M1KA 1B0VA 1H3DA 5B0AA 2M4MA 4QCLA 3N28A 2E9TA 5ETOA 2J0WA 3BSAA 3D1OA 5KFKA 3NXZA 1P1TA 2M88A 1ZZFA 1IR0A 5B0DA 3P5BP 4DPTA 3D7SB 4KHPF 4TQSA 4B02A 1X5TA 4F3QA 1D09B 2B7BB 1FK9B 4WFBQ 2XMWA 4D3HA 2LU2A 3KG4A 4JB8B 1VJQA 5H1SV 4NYOA 3FBFA 5IOLA 5K5MA 4LFAF 2XSJA 1R8PA 2ZE2B 1L5UA 3Q8QB 1ZTTA 4XO0A 2CQGA 3VWSA 2LXUA 2GZOA 1QE1A 1NPRA 1VC6A 1LKZA 2MQ8A 5EX0A 3WDOA 3NGSA 3O3LA 8RUCA 4NCGB 3CJKA 4A8OA 5E3QA 1GTEA 1UJ5A 1ZBTA 4E2FB 1UJ6A 3GG1A 5IT0A 4DR6J 5JXSA 2C3UA 1HMVA 1QSSA 3UN3A 4PG8A 2PD1A 5AJ3F 4RWXA 2YPYA 2AKWB 4LF4F 1SV5B 2UU9F 2FJBB 2DXEA 2R4FA 3BGRA 1G4CA 1SC4B 1ACMB 5IC6B 4H4OA 1DRZA 3T9ZA 3G6XA 1N56A 4LRAA 2NZ4A 2F8EX 4LSLA 2C2MB 5D3GB 3HDSA 2IYGA 3OVSA 2WSEC 2F4VJ 1Q5YA 3PR5B 1N5YB 1DQ9A 5KFSA 4NI2B 2V9KA 3OR2B 2WRMA 1S77D 2E5LF 2FVPA 4F0KA 2F7VA 4HKQA 4FVMA 4TN2A 4ZCLA 4C6AA 1YJNS 2B4VA 4LQ9A 1UW9A 3EX7B 4URSA 4DL6A 2ZD1A 5AE1A 1NDPA 1BC6A 2VD3A 3BGFA 1SB6A 2HNZA 3C6UB 3HO1A 5D15A 3WIUA 3EXYA 1GEHA 4MJKA 3TOQA 3TEHB 2VBWA 3KG0A 3RB6A 2LEPA 2DNQA 3I0SB 2E29A 4KTQA 4XDCA 3EMTA 1IXKA 2CQDA 3FCWA 3VCDA 1UFLA 2YX7A 1RHKB 3VAKA 5C25A 2BKPA 4K2XA 7FD1A 3IR7B 4OX7A 3VGVA 2XZDB 2CJQA 1NJXA 5F8GA 1KQGB 2AV5A 3MM6B 3QGIA 2XYHB 1F9FA 3BSNA 2FIUA 4ECTA 1SCJB 5A8KB 4USWA 1IKYA 2QJ3A 4USMA 2V9WA 4N76A 4RUAA 1Y7PA 2KVIA 1SJ4P 1F6TA 3IXQA 4A8YA 3BH7B 1GAOA 1S7IA 4WJBA 1AROP 1U09A 2BUNA 3PKYA 3T41A 4ED3A 5KFWA 1N5VA 3M32B 1Y5IB 2BACA 1JLEB 1AFIA 1NDLA 2JH3A 3LP1A 4Y0FA 1OS5A 5D4NA 4USTA 4U7CA 1SL1A 1F9EB 4DLGA 1N5QA 3K89A 2BRLA 2DHSA 5EX3A 5HP1A 1JQGA 5ETMA 3RB3A 1FJGJ 1ZAVA 1KFDA 2B51A 2WHOA 3QLHB 3OSPA 3D0GE 2HHXA 1G7CB 1S1UB 4P74A 3DRSA 1IQTA 4ZVTB 1H72C 2VG5A 3WBZA 2QMWA 4OYWA 1BQMB 3GPAA 3EYZA 5I3UB 1UEVA 2HFZA 2AZ3A 3M6XA 2ZBQA 3BN7A 3ETMA 3Q86A 4JI0F 2BJ1A 1Q8IA 2CVIA 2B9WA 2B8PA 2RUGA 4OJGA 2R7TA 2RMLA 1G2EA 5KFQA 1SJFA 2DGQA 3F0NA 4WK3A 4KHPJ 2AD9A 1NXIA 1UEKA 1R6YA 3R6LB 5DDOC 4G1QA 4OYMA 1VC0A 1EHWA 1O51A 4DL7A 2J9DE 2KJWA 4LFAJ 3M6WA 1S1WA 2HHSA 1RU2A 4CLLA 4LQ3A 2MQMA 1VLOA 2DCLA 3NCQA 3W5YA 4C3MA 1EZZB 3W9IA 1HQUA 1LWFA 1S10A 3P96A 4NLQA 3UVJA 2AU0A 3CJTA 4KH1B 3HVAA 2DO0A 3LGNA 1FRKA 4OFZA 2HFOA 2GMHA 3B54A 3HF5A 1DFDA 3IM8A 1P9YA 2VBYA 3TA2A 4WYWA 3W7BA 4Y28C 5C5JA 5I4MA 2UU9J 1T05B 1FEEA 2DYAA 3FRYA 2C2RA 4KHRA 2R8HA 3KK1B 2DH8A 2W8KA 1AXQA 3ISND 1NJZA 4OIXA 1KTVA 2WTFA 3DOKA 1E6YB 3JTNA 2QLBB 3N0VA 1MWZA 1HQ2A 1TFWA 1LW0A 1P9QC 3GCXP 2OFHX 2ZJPQ 2E1MC 4P52A 1HHQA 3M05A 2H5JB 2HK3A 1H2VZ 2E5LJ 4PWDB 1VJWA 2HMIA 4DUTA 1HBOA 4ETZA 2CQ3A 3SEOA 2GQQA 5F8JA 1KTQA 1IKWB 2BBEA 1M5OC 1VLYA 4ZVEA 4EZ9A 1WC6A 5KFYA 3MUVP 1QAYA 1NK5A 4HACB 3HKWA 2MHEA 2GGPB 3U1MA 1X4AA 4DS4A 4FKYA 2BANB 3CJ0A 1OYEA 4DV4F 4YP3A 3OLAA 5D4OA 4G1IA 4OL8A 3PO5A 3I4PA 2IVMA 3OD2A 4EBEA 2VA2A 4P2MA 1T9XA 1WC0A 2PDAA 2KRRA 4H4MB 3Q23A 4K4SA 2X7IA 5CA5A 3C16A 2GMLA 2VIHA 3UD3P 1ZA2B 1KLNA 2A1BA 2HEKA 2ZM6J 2KYXA 2VDHA 3IRWP 3SSRA 4AUKA 2BOPA 2MQPA 4B9SA 3RTVA 4EO8A 2XB2D 1MSWD 2LEBA 2VC1A 3HD1A 2XSJB 2MQOA 3IFEA 4URGA 1HR0F 3N5FA 4Q43A 2YH0A 4YEAA 3G8TA 3J7YU 1RAIB 4UQTA 1CJUA 1QE1B 2OEMA 4ZJQA 3AH6A 3BN4A 2P9GA 2ZHOA 3FGVA 3SQOP 4RNNA 2JEGA 4WYLA 3PNIA 1HL6A 1RT4B 3DNCA 2HKEA 5EWEA 2ZZTA 3R1HA 4I1TA 1HMVB 1UPPA 4ED8A 2UUBF 1OJ4A 1KONA 3OVBA 2QRRA 1QAIA 2DIUA 3Q22A 3QJPA 4HH0A 3R5JB 2MKHA 3VAGA 4P75A 3BGUA 1LWEA 1GMUA 4ZPAA 3F56A 4LSLB 3OTEA 3OFHA 1UEUA 3D28A 1RT3A 2G0IA 4OHYA 4N56A 4JI0J 3U02A 3OJSA 1NBEB 1RWOB 3KJFB 2OD6A 2BABA 3OXLA 4G1PA 4QR0A 3ICLA 3PACA 3GIRA 2I0XA 1SKWA 1MROA 4NLPA 2CDRB 1UPMB 3KLGA 3L4BC 3NOGA 3IWLA 3SV3A 2CZ9A 5CQGA 2DXDA 2VBZA 3SSSA 2IA0A 4O3NA 2XTJP 4F0HA 2ZD1B 1RHRB 4NASA 2HNZB 3UCGA 4OV6A 2G13A 1PJ6A 4DJBA 4B3MF 4WP8A 2HHWA 2V8VA 3W3SA 3NCRA 1H7XA 2NQPA 3DLKA 2Y8WA 2XMUA 2Y1LB 1TFYA 1VBKA 5C25B 4DF4A 2B3TB 4W98A 3KJVA 5K8PA 3WX4A 1T95A 2ZWOA 1VISA 4DSKA 4U9RA 1IKYB 5J2MA 4EO6A 3M6UA 3TVYA 4L75A 3SCKE 4X84A 4C3LA 1FI4A 1XJWB 4C0HA 1XEZA 2EFPA 3R2CJ 2KB2A 4ZVUB 1U6ZA 2EC0A 4ZVOB 4EBDA 2EK1A 1UTAA 2MQLA 2J7WA 3SXLA 1FRLA 3CIMA 3BKUA 4Z7CA 3TQEA 1U48A 1FT8A 5HP1B 1KRPA 1UP1A 2EKNA 4DDFA 1CJVA 3THTA 3W61A 3CIZA 2Z56B 3QT8A 4NE9C 3DRSB 2Y0SD 3PHTA 2HYIB 2VG5B 4KY3A 3A3PB 2PFDA 1TK8A 2QGFB 2LA4A 3RRKA 1N32J 4XPEA 5GAGI 4MFBA 1M90T 2CPXA 1WOOA 2HWTA 1RT1A 5F9LA 2X1GA 4EUVA 3CDWA 3CCJS 2NZCA 1QSYA 5CYQA 2B8QA 2O01C 2ZVIA 4YOEA 2HLUA 4P7TA 2WOMA 4KPYA 1N54B 3T1AA 4G1QB 5LSRA 4PKDB 5A6PA 4X62F 1KFSA 2R8JA 3ETOA 1S1WB 2YKAA 3GWCA 3CCES 1TL3A 3HHLD 4D3GA 1X4DA 3KK2A 1PILA 1QY7A 3GV5B 4RBUA 3W2VA 4M5MA 4FF4A 1HQUB 1LWFB 4H4KC 3UVJB 5JMNA 3B8HA 2M52A 3ZTOA 2R42A 3BSOA 5A0YA 1NSKL 3V6HA 2XNQA 4PAAA 3PDNA 3K17A 4PXDA 1QM9A 4GO7X 3T9NA 5H9FK 2ZBRA 3B4DA 1S57A 2R7QA 3MM7A 4B3SF 4O3OA 2HBQB 3DDIA 4WXOA 3BQ2A 1H2UX 5G0RA 3BGOP 3JSRA 4TY8A 4C8YA 2VF3A 3EGNA 2RH3A 1F5AA 1LXJA 8AT1B 1X9WA 1LK5A 2IRXA 1X7VA 3TR5A 1RWMB 2KTQA 4KR0B 1T02A 2JEIA 2R7VA 4I2PA 3H25A 1LW0B 4DPYA 1S0VA 4ANCA 3GJQB 2CPEA 4P71A 2XNRA 3LP0A 3AOBA 4U8VA 5KFOA 2HMIB 4I4BA 2OTJS 4A46A 1IWAA 1FCAA 2QA2A 1M5VC 4N8NA 1PCAA 1Z2LA 3KTQA 1C0UA 1I5OB 1KVIA 4L76A 1HNVA 2KM8C 5ETTA 1QSLA 4FXDA 2V67A 4B3MJ 1X31C 3JQJA 1F3VA 3KK3A 1FJEB 2YKNA 2HQIA 2Z30B 1FDNA 1FFSB 3MD3A 4NLRA 4Y2MA 4LBPA 3NG8A 1VQYA 1U2FA 3EDQB 2XLKA 1LV5A 4HI2A 1IKVA 3KOAA 1JXLA 4IQXA 9RUBA 1FJ7A 1VQ6S 2KHCA 4IO1A 4CLTA 5KFLA 2KN4A 4X64J 3C16B 3RBDA 4ZOSA 4WFAQ 1F1BB 4BC9A 4DX6A 2ZOGA 2BRKA 1SJ1A 1VQPS 1KEKA 3O8WA 4X4PA 4EWTA 2VH7A 1RABB 3H2VE 3QWPA 3K57A 1M1HA 2Q6CA 2V63A 1YZ6A 2P6TA 5IFMA 1Y0HA 3FKBA 2IM1A 4F7VA 2GAHC 3QPIA 3R97A 4RKUC 1CJUB 4ER8A 5I3QA 3HT3A 1NK9A 5E2QA 5DLFA 1A7GE 5B08A 3DOLA 3WHIA 3M7VA 1VQLS 2JHEA 4C8MA 1DLOA 2WVBA 2A10A 1FKPA 4PRFA 3RR8A 1RWUA 2HLTA 2W9BA 3PVXA 2VG7A 2B4OA 2FVSA 2XY5A 2QL7B 1YRUA 2N3LA 4RW9A 1GT8A 1VYAA 2BJ8A 3K8WA 4OX8A 2V2QA 2JNJA 1ULRA 4ED0A 4DCJB 1SPBP 3GIKA 1LWEB 4U7UD 3N9UC 1PG5B 2FLNA 4ILLA 4ZVPB 4EYHB 1FHTA 1T03A 1RT3B 3G71S 4C48A 4Y65A 2V4JA 1RBOB 4BCAA 2C22A 3A8EA 3BBBA 1YRXA 2OMOA 3EWGA 4L73A 3CD7A 4NMXA 4HLBA 4R25A 1OYDA 2AYMA 3KLGB 2GNKA 3AT1B 2ROPA 3R9LA 2L48A 4CRJA 4X62J 4GRSA 2ZEJA 1APSA 2F3JA 3OQ2A 4YR2A 2EKYA 2C3MA 1SI9A 1FJCA 3PJXA 1YTYA 3A4TA 3AA8A 1T94A 2FJAB 3QBCA 5AT1B 1K1QA 2KT2A 3EZ5A 1DY3A 3H2LA 3L09A 4IRCA 1Z2ZA 2L9DA 1RWWB 4LBIA 2UV8A 4KFBA 1DZ5A 3DLKB 3SZ2A 3HVRA 3ZZRA 2ZJRQ 4QWDA 1S0NA 3HK2A 1VRTA 5HBMB 1QVFR 4B3SJ 1SC6A 3CD6S 3AJ2A 3TI0A 1RAAB 2HGNA 3IR5B 2QEXS 3G4SS 4ZN3A 3A8JA 4KSEB 5J2MB 3R5DA 4WFNQ 1HWJA 1VQ8S 4JI3F 5HQMA 2ZBCA 1M0SA 2RQMA 3KHLA 1M1GA 3BYPA 4IKAA 2LQ5A 4FN5A 3OTOF 3HULA 2YQ3A 1AW0A 3RRGA 3GMGA 2QLXA 4PR6A 2B9YA 1JLQB 3A1YG 4ES1A 1MN7A 4DL3A 3M2RA 4OYIA 2W01A 2GHWA 2HVIA 3AD9C 4DR3F 2ZH2A 2DEIA 2YKMA 2LA6A 3MOZA 4F4ZA 2QLJB 2KZMA 4EU0A 2WVFA 1RCOB 1FA0A 6FD1A 3L7PA 2ZBIA 3MFHA 1CJVB 2CRLA 4PQAA 4DR1F 4RW8A 3AHPA 4YB6A 3LH2S 1PBAA 2JLEA 2QG9B 3DHWC 3ILIA 3CB4A 1REVA 3IS9A 5KFAA 1KHVA 2KYZA 3AD7C 3W8PA 2OJ3A 2R7UA 1NNDA 4MFBB 2BW2A 2ATLA 4UUWA 2CNKB 1RT1B 3ZNJ1 2HFSA 2LDIA 2F9JA 5MLCV 2GVZA 4LF9J 5D4LA 2WOMB 3HM9A 3PR4A 1S6OA 2BE7D 2R7WA 1KR4A 2MQQA 2DY1A 4FZVA 3DGVA 4YY3F 1B3TA 3CCLS 4A47A 1M5HA 2GV1A 1U8WA 1TL3B 3M8PA 3FBCA 2O3DA 3KK2B 3I5BA 4QR2A 5J2QA 1FTRA 3H8YA 2CPZA 4P7VA 1U6BA 1C1BA 3RU0A 2JVOA 2AJ4A 2HWIA 2P9CA 1DHMA 3R27A 3PW0A 5A0YB 1YKWA 3C46A 3LP2A 3M8QA 3TRGA 4JBCA 3MM7B 2D41A 3TZWA 3T19A 2R2SA 3K5PA 1XR5A 4IO9Q 5G0RB 5GMEA 4IH6A 1NJIT 4RW7B 3KUHA 3SQGA 4ERDA 3AJDA 3HVTB 2IMOA 2AYGA 4K7QA 2AJQA 2I9SA 4MKBA 1T9TA 1QAJA 4HH1A 2CG4A 4H54A 4ZJLA 2CQPA 5T41A 3MM5A 4FNIA 2PC6A 3LP0B 2Y1IA 1VS3A 2V8GA 3R5BA 2CVEA 3CXCR 2B9XA 1C0UB 2CQ0A 2WSCC 1G3OA 3KLIA 1RHQB 1YK9A 4F02A 1KQFB 3VGUA 3PEHA 4WU2A 5L9NA 2YKNB 4A8XA 2HS0A 5DM7Q 4BDPA 4ZK7M 3E8OA 1S9GA 1CC8A 1O8BA 3I4HX 1IKVB 1ZM2A 1JLAB 3P45B 2HVDA 2VV5A 2YWFA 4BWMA 1X4HA 1S1TA 1TTHB 5HJXA 4Y6IA 4KV8A 3S01A 3X1LB 4JV5F
chains in the Genus database with same CATH topology
3TARA 3DRYA 3DU5A 5B0DA 1U1MA 2FJWA 3TVZA 1JLGA 1FO1A 1P1LA 1UWBB 3M9MB 3BR9A 2BV3A 3GFHA 5GAHU 3KMSA 3E51A 4PG6A 2XULA 4KHPF 3CC2S 1NO8A 2PA8D 4TQSA 4B02A 1N0UA 3HZGA 1GTHA 3EXCX 1HBUB 1X5TA 2LVWA 4F3QA 2MKIA 4R0EA 3OVAA 2B7BB 1FK9B 1H98A 4WFBQ 4Q0BA 2XMWA 2VFRA 4D3HA 3GR0A 2LU2A 2JC1A 3KG4A 3M4XA 5H1SV 4NYOA 3MXHP 4EZ6A 3HI9A 3I5CA 4K4TA 4WZMA 5K5MA 4JI1F 2ROEA 2OPSB 4LFAF 1Y4ZB 2VFUA 5B0CA 2XSJA 1NK7A 1R8PA 2ZE2B 1RA6A 1S6PA 4F2RA 1SKSA 4YHHF 4TLQA 4NL5A 1L5UA 2Q43A 2K8GA 3H2UB 2EWHA 4Q8FA 3HP6A 3FMBA 1UFWA 3Q8QB 1ZTTA 4OHWA 2DGSA 4XO0A 2FC8A 2YNHA 2CQGA 3NRBA 2O5DA 3DLGB 3DLJA 4KIAA 2JVRA 3VWSA 2LXUA 4PPDA 3TA1A 5KT7A 1FDDA 1YJTA 3OR1B 1S99A 2VFVA 1ZETA 5DJBA 1QE1A 5C24B 3NS6A 1YI2S 1VC6A 1G6BA 2MZTA 1LKZA 3MI7X 4NCGA 5EX0A 3WDOA 1U1QA 2VONA 3O3LA 4YB7A 3C3LA 2KFNA 4NCBA 3DOLB 3M6VA 4NCGB 1J5OB 1CC7A 1L3KA 3CJKA 4A8OA 2ZH7A 2BE2A 5E3QA 2D3ZA 2HPUA 2UUAF 1JLFA 4EEYA 3FQLA 1FRJA 3MM9B 3GQCA 2F8HA 1GTEA 1E6VB 1UJ5A 4DN0A 3OL6A 4V19X 1N52B 1ZBTA 3CJKB 5LJ3Y 5CYMB 2BA9A 4X4SA 3U1NA 1RT2A 1UJ6A 2FLOA 1FKPB 4B3RF 4ELUA 3GG1A 5D77A 3NGKA 4P6QA 2CPYA 5IT0A 4C8KA 1X4BA 2ZH6A 2MXYA 5JXSA 1XK8A 2C3UA 3Q2SC 1HMVA 2JC0A 2W9BB 2PI5A 1JLCA 2VG7B 1QSSA 3ISZA 1VGYA 4PG8A 4B17A 1RT5A 2PD1A 5CYJA 1NKBA 5AJ3F 4RWXA 4NRTA 1SV5A 4BWJA 3C8YA 4RW9B 3IR6B 4J9LA 3CCTA 1WELA 2EG1A 1Z4UA 1CLFA 4WFYA 4LF4F 1SV5B 2UU9F 2FJBB 1EETA 2J9DA 2GHVC 3FQKA 2E5GA 2R4FA 3BGRA 3TO8A 3ZZOA 2ZDPA 2MYFA 1UA1A 5E3RA 2XMKA 4IDKB 4FXVA 4H4OA 3AB2B 1DRZA 4IUFA 3T9ZA 4OI0A 1KVJA 3G6XA 3BGRB 1N56A 4DWIA 4H4OB 3I5AA 3ZZYA 2NZ4A 2F8EX 4LSLA 2Q66A 5D3GB 3HDSA 2IYGA 4USIA 2OKQA 1FVQA 3OVSA 1P6TA 2WSEC 4E98A 2CQ2A 5T7LB 1T03B 4Q45A 4RW4A 1R89A 3IBWA 1YVFA 2GO9A 3I0RB 2PT0A 3MDFA 3PR5B 2E7WA 4J9SA 2CJAA 4M8LA 1K73T 1DQ9A 2B5JA 1HW9A 2V4JB 1N5YB 5KFSA 3ZZUA 3UR3C 5HQ8A 1BLUA 1R43A 4ZA1A 4ED5A 2O1PA 1SJRA 3MEEA 4OJ3A 2V9KA 4M63A 5K8MA 5F8NA 3PFEA 3OR2B 2AJ1A 3TANA 2WRMA 3SMZA 1S77D 5KFIA 5CCLA 1NK4A 3MEEB 5T14A 2CIMA 2MPUA 2E5LF 2B0GA 2G1DA 2FVPA 4I68A 5EWGA 4HKQA 2F7VA 4FVMA 3VQTA 5K8OA 4TN2A 4ZCLA 3H5XA 3CT9A 2XY7A 4USJC 4CO4A 2ZH5A 5L1IA 2DGWA 1YJNS 2B4VA 5DM6Q 4NLDA 4LQ9A 4HT7A 1LFPA 1X4GA 5HL7Q 3EX7B 3LWMA 1RKIA 4E0DA 4URSA 4JOUA 1V3ZA 2FJEB 2M9KA 4DL6A 2J6UA 2ZD1A 2DNOA 5AE1A 2W9CA 1TK0A 1BC6A 2A18A 2VD3A 3BGFA 2AJFE 1SL2A 1SB6A 2HNZA 2RILA 3C6UB 4ZS6A 2KXHA 3GR1A 1ZZNA 3HO1A 1S6QA 1HNXF 3CWJA 2FJDB 4OQJA 4ECVA 3EXYA 1JKHB 4NXMF 2BM1A 4JI7F 4CZCA 4MJKA 1BQNA 5E3AA 5AXLA 3DDNA 2ZUGA 4L72B 2CPJA 1YJ9S 1RGVA 4ZLPA 2AGPA 3TOQA 4B9VA 2VBWA 1FXRA 1BQNB 3KG0A 3RB6A 1LK7A 4KFBB 2GJIA 1TV6A 2LEPA 1S97A 3NMRA 4ZHRA 2DNQA 5KG2A 3I0SB 4FXWA 1FKOB 4A8QA 4DLEA 2E29A 1N88A 4C11A 2CKWA 3VAHA 4KTQA 4XDCA 2HHUA 2EFNA 1F2GA 3RBEA 1P8GA 1IXKA 1HBNA 5B09A 2LLZA 2CQDA 1VBXA 3VCDA 1UFLA 1VRTB 4CO2A 5DGBA 2YX7A 3JYTB 3HHNB 1LW2A 3VAKA 2BDPA 3D0IE 3RB0A 2LU1A 5C25A 3PRDA 4K2XA 2Z2LA 3TP2A 5D6GA 1U1LA 7FD1A 3IR7B 4OX7A 1TKXA 3MM6A 3QWUA 4LMZA 2LYVA 4WE1B 4NLSA 2CJQA 2DNRA 1NJXA 3SI8A 3RR7A 5FJ4A 4MTPA 5F8GA 1KQGB 2AV5A 3MM6B 4B9MA 3QGIA 1AFJA 1F9FA 5HROA 2KKHA 3BSNA 5A8KA 1VRUA 3M1VB 5DETA 2FIUA 2XS5A 4N5SA 4X64F 1TKTA 4ECTA 5A8KB 3IAM9 1IKYA 1MU2A 2V9WA 2V94A 4N76A 2BQ3A 2DPJA 3OUYB 4RUAA 1Y7PA 2YKPA 2KVIA 2C42A 1FF2A 5KTQA 1SJ4P 3IXQA 1FD2A 2LECA 1WHWA 2J7UA 3K2YA 4A8YA 1GAOA 5HMYA 4QIEA 4ZP6A 3MEDB 4W90B 4Y00A 2HGMA 2YNIA 4AL7A 4WJBA 1AROP 1U09A 2BYCA 2IC3B 3O44A 4NLTA 2BUNA 3PKYA 2YNIB 1XNRF 5ITHA 1NK8A 2R7RA 5KFRA 4KJIA 4KRWA 3PRBA 4J9KA 3HX9A 4ED3A 2Z2MA 5KFWA 1EP4B 4KO0A 2DNKA 4F4KA 4CIOA 4ECSA 2XMMA 1ZAXA 1N5VA 4MH8A 3M32B 4DG1A 1Y5IB 2BACA 4DR2F 5KFHA 4OHZA 4K4UA 1JLEB 4N47A 3WZ0A 1AFIA 4QPTA 1SIWB 2CZ4A 2JH3A 3FEZA 3M2RB 3LP1A 4Y0FA 2V5HG 1OS5A 5D4NA 2IA6A 4JI8F 4DS5A 3LP1B 4F4XA 4X4VA 1KS2A 1TP7A 4KC5A 2YWHA 5HMWA 2LXFA 4U7CA 3MMBB 1OIAA 4UOCA 1SL1A 2YKMB 4M5DA 5KFTA 1SH0A 4J9NA 3FFIB 5I42B 2OPQA 1N5QA 4DLGA 3HJFA 2XGPA 4MKYA 1S49A 2BRLA 1VQSA 2DHSA 5EX3A 2ZJQQ 4ID5B 2CJBA 5KT6A 3SCJE 2DHGA 5HP1A 4TYAA 4ECUA 3DRPB 1GXLA 1PSDA 3K5LA 3RB3A 1KSPA 4O3PA 1ZAVA 2VC0A 5KT5A 1S1UA 1KFDA 3C66A 1WG4A 2B51A 2GW8A 2ZH1A 2WHOA 2B4UA 3QLHB 4LT6A 4DF8A 3OSPA 1VIXA 3D0GE 3M30B 4Y2CA 3MR3A 2HHXA 1G7CB 3LF0A 1S1UB 2CQHA 3DRSA 5F0WA 2JX2A 4C3KA 2DVIA 3POTB 1IQTA 2CPFA 1S1XA 1HQEA 2WBRA 3OSNA 1TL1A 3J7A1 2VG5A 4LJMA 3D0HE 3HVWA 3WBZA 3DI6A 1S1XB 2QMWA 4A8SA 1Y3JA 2PA3A 2BZ2A 3SYZA 1REVB 3IRXB 3O1LA 4LF7F 3U7JA 2SXLA 1WI6A 1BQMB 3CEDA 2KDOA 3EYZA 5I3UB 2DD8S 3DLLQ 4I0WA 3DLBA 5B0GA 3MR5A 4LUBA 4OI3A 2R2RA 3F73A 3I31A 1UEVA 2VG6B 4GMKA 2HFZA 4DL5A 3M6XA 2J7KA 1OPIA 1HHSA 1S7HA 1FNMA 3BN7A 1HA1A 1IQZA 4ED6A 4QYRA 1S0MA 2VPZB 1HWLA 4ZP9A 4HI1A 4JI0F