1N8RT

Structure of large ribosomal subunit in complex with virginiamycin m
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 23S ribosomal RNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
total genus 20
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2002-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n8rT00
1JJ2R 2MQQA 1M5KC 2CPDA 2CQ2A 3THTA 3CCRS 2DGXA 2KHCA 2DHXA 1L3KA 1NU4A 2DGTA 3VAGA 2CQ4A 3G96A 1KC8T 1U1LA 3DLLQ 3VALA 4LMZA 2DISA 5CA5A 1Q82T 3CF5Q 2DNMA 2EK6A 4FXVA 2ADBA 1DRZA 2LEBA 2JVRA 3J7ZT 1S72S 2E44A 3I55S 3G71S 1URNA 1DZ5A 3CCVS 1M5PC 2KRBA 1M90T 3THPA 1YIJS 4ZKAA 3D2WA 2QA4S 1W2BR 2I2YA 3S8SA 4ED5A 1M5OC 3NS6A 1H2VZ 2XS5A 5CYJA 3VAIA 3UCZP 2MZSA 2KU7A 4YB1P 1YHQS 2DNOA 1SJ4P 3TP2A 4QU7A 4TLQA 2JRSA 3B4DA 3EGZA 2DNPA 5IQQA 2KG1A 2XNQA 3DXBA 3BS9A 5GAEU 4TU8A 2L08A 3MUVP 2DNLA 2MSSA 2HGNA 3G4SS 3OW2R 3VAKA 2WBRA 2ZJQQ 2KN4A 2DNQA 1WEZA 2FHOB 3FEYB 1WELA 2J76E 3CPWR 1VBYA 1U1MA 4CQ1A 3H2UB 1N8RT 1X5SA 3CCMS 2KRRA 1U1NA 4C0OC 4WFBQ 2MGZA 1OWXA 2DHSA 4A8XA 3VAFA 3NMRA 5ITHA 4IUFA 2N3OA 1WEYA 2CPEA 2YWKA 1N88A 3L3CA 1CVJA 3IWNC 1FJ7A 2OSQA 5CXTA 4EGLA 1X4DA 2EVZA 2RU3A 1FO1A 2J8AA 2MGZB 2RQCA 3CCJS 5D78A 2MQOA 5LJ5Y 2MYFA 3CCUS 5LXYA 3R1HA 4LIRA 1WF1A 1X4BA 1HD0A 3NNCA 3BO4A 3MXHP 1VQ7S 2YKAA 2MKIA 1SJ3P 3S6EA 1Q86T 2DH8A 3SXLA 5H1SV 2HGLA 2CPZA 1UFWA 2VOPA 1VQ9S 3NS5A 1WG1A 1X4GA 3UD4P 1K8AT 1OO0B 1RK8A 4CH0S 2ERRA 2CPIA 2KFYA 1WI6A 5IM0A 4J5OA 1VQ4S 1VQMS 4CH1A 1VC0A 1F9FA 2LCWA 2MQNA 4LJMA 2Q79A 3MUMP 4BS2A 5GVQA 3FEXB 2G1DA 3CCSS 2VOOA 2CQGA 2N7CA 2KXHA 2MKJA 2HYIB 2OTJS 2MMYA 1O0PA 4F26A 1OPIA 2DNNA 2EK1A 2M52A 2E5IA 2KT5A 1NJIT 3ULHA 2RRAA 3CCLS 4F02A 2N82B 5DETA 1K73T 3UD3P 2CQ1A 5DDRC 3CTRA 2RS2A 3TYTA 2X1AA 2VODA 3P5TL 2KXNB 2F3JA 1WG4A 4P6QA 2MKCA 2X1FA 1Q7YT 1DBDA 2MY7A 3MI7X 4UQTA 2YTCA 1HD1A 5LSLA 1N52B 1U1OA 1JJ4A 3G6ES 3UE2A 1U6FA 2RVJA 5GADU 4F25A 2DO0A 2F9DA 2M0GB 1KOHA 2CQIA 4U67Q 2M88A 2A3JA 5DDOC 1BY9A 1YTYA 3K0JA 3LQVA 5DM7Q 1SJFA 3ZZZA 2KI2A 2LQ5A 3CC7S 2BZ2A 2CPYA 2M2BA 2AYMA 4WKRA 2LKZA 4QQBA 2KYXA 1WG5A 5HL7Q 2J0SD 1VBXA 1A7GE 2XS2A 3MOJB 4PRFA 1G2EA 2RNEA 2CPHA 5IFMA 2LA4A 1A9NB 3H2VE 2UP1A 5GAGU 2DHGA 2PEHA 2NLWA 3MURP 2CPJA 2QFJA 4YOEA 3MDFA 4OZ0A 4C4WA 2MZJA 2OIHA 2DNGA 2OJ3A 3VF0B 1PO6A 2CQ0A 3N9UC 2MKKA 3U1MA 3CXCR 2ZJRQ 1FJCA 4M5DB 3CMAS 5DDPC 1VQ8S 3RW6A 2DGUA 2U1AA 3CMES 3NNHA 3TO8A 2MJUA 3BO2A 5MLCV 1VC5A 2M7SA 2MY8A 4IOAQ 1FHTA 4IOCQ 1WF0A 2LXIA 2DNRA 2CQCA 1K9MT 2CQBA 2JWNA 3EX7B 2AD9A 2MKSA 1U1RA 2RQ4A 1N54B 3SDEB 4QPTA 4V19X 2D3OR 2RT3A 1YJWS 3SMZA 3G8TA 2JX2A 3MD3A 3VAHA 3UCGA 5DDQC 1RKJA 2MPUA 2RS8A 4QU6A 1SJRA 1UW4A 3ZZYA 5EN1A 2M8DB 2DIUA 3CULA 1XN9A 2OTLS 4Z2XA 2L41A 3MUTP 1B7FA 2FC9A 2LMIA 2K3KA 1QVFR 2LA6A 2O3DA 2XNRA 2GO9A 2E5HA 4OZ1A 2D9PA 1VQOS 4YUDA 2HZCA 1WHYA 5GMKa 1X4AA 2CJKA 4Y00A 4IO9Q 1U2FA 3J7YU 1VBZA 2I38A 1P1TA 3G9CA 2KH9A 2X1BA 4W92B 1U1KA 2DH7A 2DNZA 5DM6Q 2N3LA 1WWHA 2LYVA 1VQNS 1X4FA 1U1PA 2KXFA 3HHNB 1WF2A 2F9JA 2KVIA 1YI2S 2DITA 2FPHX 2DIVA 3UWTA 2E5JA 2GHPA 2ADCA 1QVGR 1FJEB 2XB2D 1KOOA 2MQPA 2DGWA 1YITS 2BOPA 1AUDA 4WCEQ 5LXRA 2HVZA 2LECA 1SXLA 1X4EA 1X0FA 3UCUP 1UAWA 1ZH5A 1IQTA 1X4CA 3CCQS 2MB0B 3CC4S 3G8SA 3B4MA 5LJ3Y 1U1QA 1NO8A 1YJNS 3S01A 1UP1A 2DH9A 2DGVA 1WHWA 2QEXS 3NNAA 2RRBA 4WIIA 2M4MA 2RUGA 4W90B 2DHAA 2CQ3A 2CPXA 1FT8A 4TU7A 2MQLA 2AYGA 4PKDB 5D77A 3PIPQ 3BEGB 4CIOA 1X5TA 2D9OA 1X5PA 2CPFA 2XS7A 2G4BA 1VQPS 2DGOA 5GAHU 1WTBA 1WHVA 2AYBA 3MD1A 2DB1A 2U2FA 4RU2A 2VONA 3Q2SC 1VQLS 1SJQA 2L9WA 4PR6A 2CQPA 3EGNA 2PE8A 4FXWA 1D9AA 2ZJPQ 2DGQA 2LEAA 3V4MA 3CUNA 1PGZA 3US5A 2MKHA 4ERDA 2CQDA 3I56S 3P6YC 2AYEA 2XSFA 1VQ6S 1KD1T 3SDEA 2DO4A 2G0CA 1QM9A 3CC2S 2FC8A 1Q81T 3CD6S 2M9KA 2MXYA 1H6KX 2MZRA 2B0GA 2V94A 3VAJA 3Q2TC 3IRWP 3PIOQ 3R27A 2DNKA 2MZ1A 1HA1A 1WI8A 4Y0FA 1HL6A 1JJHA 3VAMA 4WFNQ 1U6BA 4UY8T 1OIAA 2DGSA 1D8ZA 1FXLA 3RW7A 1VC6A 2J0QD 3S7RA 1FNXH 2MSTA 1M5VC 1M1KT 4WFAQ 2M70A 2KM8B 5JVHQ 2MJNA 1DHMA 3CCES 2SXLA 1WHXA 1H2UX 2M8HA 3LPYA 2JVOA 2MZQA 1JMTA 3R1LA 2X1GA 3P3DA 4C7QA 1R8HA 4WF9Q 2K8GA 2HGMA 2MZTA 2DNHA 5FJ4A 3P49B 2CQHA 1X4HA 3BO3A 2YH0A 1ZZNA 5HO4A 2KG0A 1VQ5S 1P27B 3U1LA 2E5GA 1X5OA 2DNYA 2FY1A 2NZ4A 2KM8C 5LSOA 2MHNA 5JVGQ 3JB9k 4TU9A 1S79A 1R8PA 1H2TZ 2MQMA 1KQSR 2DK2A 1YJ9S 1YWXA 1ZZFA 1WEXA 2LXUA 2OSRA 3HI9A 5BJRA 5IM0B 2YH1A 1VQKS
chains in the Genus database with same CATH superfamily
3I4HX 1S6UA 4A46A 1M5KC 4RKUC 2HFUA 2RRNA 2ZBPA 2CG8A 2CQ4A 2VH7A 3G96A 5D0EA 1PIEA 4KAIA 3V6DB 2B9WA 4FYWB 1RT3B 2BRKA 3UR0A 3A13A 1ZM2A 4X66J 4DWIA 1WC5A 2V2KA 3V2UC 3QT6A 1QAIA 1FESA 1TQLA 4ZKAA 4MK7A 3AA9A 4BDPA 5CYJA 1RT6A 5KG6A 2DNOA 1FE4A 3QBCA 4HI1A 4ZVRB 5T14A 3M1VB 2Y8YA 4UUWA 2C2OB 1S6OA 3EYZA 2FVQA 2JLGA 1PBUA 4ER8A 2PD1A 1UZDA 4XAKA 2PEBA 3QGHA 1HARA 4F04B 1DLOA 5C42A 2MGZA 2EG1A 4ELVA 2GAHC 1N88A 1NH7A 1Q78A 3O3LA 1HR0F 1FVQA 1ELOA 5A2QY 3MM9A 4O4GB 2YWHA 4UUXA 4FF1A 3KK1B 3R1HA 1TL7A 1JLFB 2QV6A 2ZVSA 3MFIA 2HAIA 1BC6A 2VOPA 1RWPB 1Y11A 4IFYB 4CLUA 4IFVA 2ERRA 9RUBA 4WKYA 3FEXB 4DXLA 1BWEA 3V6DA 1RT3A 3ULHA 3RR8A 3UD3P 2ACMA 3RR7A 2FVSA 1MG7A 1NPKA 2UZAA 1SV5B 4MAKA 2K7KA 2F5GA 1DY3A 1CJTB 2BA9A 2ZUGA 3M1VA 4JI4J 2M88A 4KB7A 2KL8A 2BVZA 3EZUA 2PIIA 2B9XA 4KHMA 2DT9A 2F65A 2J9DE 4A47A 4L6V3 4OV6A 2LA4A 3HD2A 3KNGA 4NLTA 3H90A 4RW9A 2NR0A 3JS9A 3OJSA 3T9NA 4ZJLA 3TA0A 4WK3A 1NSPA 3D1OA 2CQ0A 1RAIB 4JI8J 3U1MA 3CXCR 1YRTA 4M5JA 3KK1A 1VK3A 4NLPA 3OTOF 1JLFA 4DL0C 1R6VA 3QGPA 4OQJA 4OIXA 1S76D 2LXIA 4IFYA 1S5ZA 1JX4A 2UXBF 2MKSA 3DRPB 1REVA 2LLZA 4YS2A 3ENQA 2QA2A 1C2PA 3SMZA 3EVWA 1WDDA 2OGUA 1TTHB 3OTCA 4C2MA 3ZZYA 2ZE2B 2OPPA 1DQAA 4JI3F 4OJHA 1OYEA 1GEHA 2WTFA 2K3KA 1QVFR 4NCBA 2VA2A 4DUZJ 2V4RA 2FUG9 4CLKA 1SV5A 3PRBA 4IO9Q 2C2ZB 3PR4A 3T1HF 4TKTA 2I38A 2O1PA 2A6MA 3W3SA 4BWJA 4M94A 1CJTA 4V19J 1WWHA 1X4FA 3N5FA 4RNFA 5D4PA 1UVLA 4ATNA 1Q16B 2Z56B 2RSQA 2WOMB 3UDVA 1SXLA 1S57A 3ICLA 3GLJA 2VQFF 1RLCL 2MB0B 3HULA 2QTWA 1NO8A 2QJ3A 2K1RA 3HT0A 2HQ3A 1ZTWA 5IC4B 2ZH8A 3KLVA 3K5MA 3PO4A 3D6TB 2AYBA 4LSLA 2B7CB 2HEKA 2U2FA 2QFIA 4ZK7M 3TZZA 3KHGA 1YK9A 3H4BA 2NUHA 3K2YA 3GILA 3DRPA 3C2PA 2MHEA 1QTNB 2KHDA 1UETA 3J7A1 4NLOA 1S77D 4XPEA 4DV3F 2IDLA 5HQLA 3TQ1A 3IXQA 4DSLA 3Q8PB 1LNQA 1RAGB 1U47A 4MIBA 1DHMA 4KHPJ 4NYOA 3ZTOA 4DMZA 3QLHA 1RBOB 1R8HA 3EE3A 2VBZA 3IMQJ 1XQIA 1YRUA 4LF9F 2ILYA 3SCLE 4HH0A 4ANCA 5LOQA 3KMQA 3A1YG 2UUAF 3W66A 3KJNB 2LQJA 3U1LA 3PZPA 2MLZA 5LSOA 1G6BA 3PM9A 1RTIA 2FHMA 3P45B 3D66A 2DRDA 1FWPA 3FRYA 1SQFA 3KYLA 5IM0B 4HLBA 2WOMA 1SL2A 1Y3KA 1N5YB 4ID8A 2DGXA 1NU4A 3AB4B 1C1BB 2AW0A 1VK8A 4ZIWA 5AXKA 1MSWD 3DM2B 3PEJA 3D2WA 2I2YA 1VMBA 3CJSA 3NS6A 3KLEA 1RZMA 3OL9A 2YX4A 5SUHA 4B3OB 2Z0GA 4TU8A 4TQRA 1VBKA 4AFFA 4BC9A 2VFSA 2XY5A 2KN4A 3KLHB 1NBEB 2GVZB 4H4OA 1K44A 3U7JA 2XG8A 4YHHF 5ETLA 2N4CA 2LFVA 4DR4J 3K5NA 3GONA 4IUFA 4WU2A 2ZC4A 5IV3A 3NXZA 5KFAA 3TZYA 1DJ0A 1WF1A 2OMOA 3AJDA 3MEGB 3BO4A 3MXHP 1FERA 2ZWOA 3DC2A 3JSYA 2WBMA 1ICEB 4ZVEA 5K8MA 3JSMB 2YKQA 4XO0A 2KFYA 4WP9A 5IM0A 1C4CA 4P7TA 3BQ2A 2I6WA 1YQHA 3MZIA 2Q79A 1N5YA 3QZ7A 2KXHA 3NLCA 4FXDA 1C1BA 5M2PA 5DETA 3C19A 4A48A 4KIAA 5I3QA 5KFJA 4U96A 1HI0P 3DM2A 1KHWA 4DV7F 2HHQA 5HVFA 4ALZA 3DOMB 3MI7X 2ALYB 4K0KJ 1U6FA 2KFZA 3EZ5A 2P9GA 2RD5C 3Q23A 2DCUB 1KHVA 3C8YA 3J80Y 3WX4A 3UN5A 4B3OA 2RB7A 2W24A 3HKWA 1YTYA 1SJFA 4UY85 2GVZA 4G6VB 3G6YA 4OI0A 3PR5B 1WG5A 2B9YA 4NE9C 3LP0B 2NZCA 1A9NB 2XGPA 2UP1A 1RB0A 3K5PA 4YOEA 3KG4A 1RTJB 4G1IA 2OJ3A 3UN3A 1CEZA 4JI7F 3B6BA 4K4UA 1RYRA 3R7SB 2MKKA 2LU2A 4DZDA 1FJCA 3K5LA 1UZHA 3KLIB 3FEZA 1IWAA 2DGUA 3MEGA 1U48A 2YWWA 4I69A 1IVZA 2AQ4A 1SJ1A 1FHTA 2ASYA 4IYQA 2B43A 5K8OA 3JSMA 2JWNA 1KKHA 3IM8A 5BR8F 2ZH2A 2F1FA 3VAHA 2W7PA 3UCGA 3BBCA 2XMWA 2DIUA 2ZD1B 3RB0A 4J9OA 2QRRA 3AXMA 2LP4A 3UPFA 1S6QB 4M5MA 3DOMA 2CJKA 2ZFHA 4G3IA 1U2FA 2JC1A 3MMCB 1R89A 3TA2A 2DYAA 3PJXA 4TLRA 3BJYA 5DGAA 1PC5A 3UWTA 3OFEA 1KOOA 2DGWA 4USTA 3MCSA 3R7NB 5FLXY 3D1HA 2YXLA 3LP0A 3CDUA 4IQMA 4KGXB 1YJNS 1QUPA 1RTJA 2CA9A 4OJ1A 1IBLF 4P2FA 2HWIA 4Z37A 1TP7A 4ZMMA 4J9SA 1X5PA 3KLIA 4PPZA 4RU2A 2VBWA 4ELTA 4ZVPB 2XMTA 4B9VA 1RCXB 4OHZA 2DGQA 5I3PA 2FC8A 3W2WB 3VAJA 2OD6A 3TR5A 2XYPB 3AODA 3M32A 1U8WA 2MZ1A 4XPCA 5E3AA 5HJXA 1YBTA 1SH2A 2ZD1A 1RTHB 2IJRA 1SL1A 2E5LF 1U0HB 3CGIA 4ED6A 3FVYA 1S6QA 1EB0A 3KLFB 2XWXA 3MMCA 4DQPA 4TYBA 5F3TA 1FI4A 3CJ4A 4P73A 1YLXA 4KYZA 4F0HA 1R8PA 4USVA 4TN2A 1WEXA 4ZITA 4LF7J 3HI9A 1SPBP 2MQQA 2EXUA 3G82B 4Q2MA 2UUCJ 2QG9B 3ZZPA 1APSA 1DQ9A 4EU0A 3MAAB 3BDEA 4ETZA 1WOSA 1W2IA 4NZ7A 1ZS6A 2E44A 3QIPA 2A18A 2HURA 4B9NA 1W2BR 3S8SA 3IR5B 4DX6A 4CH7A 1EIYB 3X3UA 4DV6F 2YBVA 5L1JA 2JRSA 2YNHB 1FKPB 1RE1B 2ZJQQ 4IO1A 3W2WA 2R7VA 1DURA 3CPWR 1R3NA 1VBYA 3K58A 1FFSB 1N8RT 3H5UA 3L3CA 1CVJA 3IWNC 1FJ7A 3EVOA 4P52A 3KLFA 2YNIA 5D78A 3ETOA 1NPPA 5LJ5Y 1GTHA 2KFNA 1K1QA 2B8QA 1NKCA 3UD5A 4KKOB 2F4FA 3IBWA 2OD4A 4PG5A 4N5SA 1YBUA 4I56A 3FCWA 2UUBF 1VQ4S 4CNYA 5DZ6A 3G82A 1T94A 4BHQA 2N7CA 3MAAA 5DJBA 4WJBA 3FMWA 2RU9A 5IWAF 4YR0A 2XTJP 5JUMA 4B9SA 2FY8A 4O3OA 3ITHB 2LQBA 1IUJA 3I9V9 5GAGI 1HD1A 3MGJA 1N52B 1RQ0A 1WSVA 3BGUA 3CB4A 2PA3A 3D3CJ 4PWWA 4RNNA 5E2QA 4JI3J 2XCPA 4X4TA 2IRXA 4HTIA 2YNHA 1FKPA 4OYXA 3HX9A 4WP3A 4WKRA 1VJWA 3T1HJ 1AFJA 2D69A 2E7VA 3J81U 4ZPCA 4EO6A 2FGCA 1RHKB 4IG0B 5C25B 3TNVA 2NCKL 2HFVA 2R7XA 2QFJA 3MURP 2CPJA 4DUTA 3HD1A 1ZA1B 1RAEB 4B3RF 2QC3A 1SC4B 4CNZA 5ETSA 3DLGB 2HIYA 4KFBB 4H4KC 4M5DB 3L7UA 1B70B 1GXLA 4KKOA 3BO2A 2IVYA 1RU2A 2DNRA 2CQBA 2UXDF 4O4RA 4ZS6A 4HVZA 4FS1A 3G8TA 4I6WA 4C11A 4QU6A 1R8BA 4MKVA 4C0BA 4ZN1A 4DQQA 1U0SA 4OZ1A 1WNEA 3C6TB 1HQ2A 3QRQA 2HZCA 1Q95G 4QIFA 1UPMB 5GMKa 2P9EA 3KTQA 2DY1A 2EKYA 3M2VB 2LYVA 4USHA 1XNQF 3PFEA 4UW2A 5KFLA 3I5BA 3HJFA 3CDEA 5KOWA 2BANB 5AT1B 4LF9J 2E9TA 1XERA 3G6XA 1X4EA 4PG6A 3ZTRA 5KG0A 4QYRA 1IQTA 4PAAA 2ACYA 3CCQS 5C25A 1NDPA 3QZ8A 2KB2A 1U1QA 4DR6F 2FZKB 2VJVA 3SSRA 1I5OB 4KC5A 4I0WA 2CNNB 5F8GA 2OEJA 2BACA 3DLGA 4KFBA 4M5DA 1G4CA 1IBMF 4OI6A 4CO3A 1N4LA 2ZH6A 4DHVA 2PO4A 4FF3A 1SVDA 3Q2TC 3VGSA 1MU2B 2JL9A 5EGYA 3NKYA 2Q6BA 2OPQB 5F9NA 2HNYB 1TKZB 1UW9A 3C6TA 4BC7A 4C0HA 2JVOA 2MZQA 2RMLA 3R1LA 2X1GA 1GK8A 3IGNA 2MZTA 1S1TB 3DU6A 3TRGA 3QT8A 3M2VA 5D6GA 2P6SA 3CIZA 2F4VF 4MKBA 4HKQA 1KQSR 2H48B 4U9RA 3UNYA 1SQGA 2JLFA 1FX4A 5IT9U 2IM0A 4M63A 2Z2ZA 4DZ6A 3Q8VA 1VI7A 4P74A 3MCNA 4DS5A 3VAGA 2FIUA 1Q82T 4UZCA 3M9OB 4X4NA 2ADBA 4F3OA 1RAFB 2JVRA 2G1HA 1FDNA 2VA3A 2VC0A 5E3RA 2FLOA 3KLGB 2BKPA 5D0GA 1OY9A 4F36A 3IGVA 4R25A 3GJRB 3H20A 3BS9A 3V6KA 4IRCA 2WBRA 4GC7A 2OO4A 4ED0A 2ZZMA 4K7QA 3NS7B 4DV7J 2DD8S 4PG7A 1MU2A 3D3BJ 2VBYA 2J76E 3C6UB 4Y2AA 4CQ1A 1E6YB 2R7QA 2V69A 4DV4F 2OPQA 3ZTSA 2KRRA 1U1NA 4IKAA 3W9HA 2CJAA 2HNYA 1TKZA 2ZOFA 5EDWA 3VAFA 2HMIA 3IS9B 3NMRA 5HMWA 2N3OA 5DGBA 2BYCA 3W62A 4EGLA 1JNRB 2AGPA 2HHHF 3BKTA 2BQ3A 3PX6A 4FKXA 3NNCA 1KRPA 4CLWA 2I1RA 4KPCA 2HGLA 3CJKA 1O51A 4Y2CA 4J5OA 4JI7J 1OY6A 3DFEA 3W60A 2CWKA 2B8PA 3MUMP 4BS2A 2HVDA 3ONQA 2MKJA 2GAGC 4P2XA 3U02A 3IC1A 4B3SF 4Y2KA 7AT1B 2FTRA 1M5SA 4NL5A 5BR8J 1CPZA 3KLGA 1WG4A 1JLGB 1F0XA 3C15A 4WTOB 1U1OA 1HW8A 5EX0A 3Q8YA 2DO0A 1TVRB 2DY9A 2VPYB 3RJMB 4XIUA 3QWUA 1HNXF 2GMLA 2WK4A 1TUVA 3H5YA 3HHLB 2LKZA 3C6UA 1GMUA 2XS2A 2OAUA 3ENAA 3CJTA 2C2EA 5GAGU 3VVTA 1Q8BA 4JI5J 2HHPA 3IS9A 2ATLA 1QAYA 4X65F 4QIWD 1OQ3A 4J9PA 4L3NA 4DL6A 3TX0A 4ECYA 4PWUA 3OTDA 3W2VB 1SC6A 2Q66A 2WVEA 3DDKA 4DL2A 2YKMB 1CG2A 4E0DA 3TO8A 4OYWA 2MY8A 3OVSA 4WP8A 1HNVB 4J7CA 4CWBA 1IBLJ 3QFWA 4ZHRA 2ZDOA 3N6NA 1NEEA 1IKVB 1RAJA 2W4CA 1IM4A 5ETMA 3OFFA 1QUVA 1SJRA 1MNEA 3R5CA 1QAXA 2NXJA 2MDAA 4I68A 2HRUA 3JTNA 1S4EA 3AD7C 1JLGA 2F8HA 3M8YA 3G9CA 3NGRA 5HAOA 1TVRA 2IM2A 3ILLA 3MM7B 4JV0A 3GQCA 3BSCA 4OLOA 1YGYA 1RHQB 4MKYA 3BH6B 1VOMA 3HHLA 1AUDA 1D9FA 1IR2A 5B0FA 4U8VA 2VG5B 3E8OA 2RHSB 3VGUA 1SKSA 2BKOA 3DLKB 5C7PA 1WUUA 3TARA 4KE5A 2ZBCA 2JEJA 1VCTA 2W9CB 5F8LA 5HLFB 3E3XA 3UVJB 1PYTA 3W2VA 4YR3A 5IV4A 1VQPS 2P8IA 2YKMA 4UTGA 5HJYA 3NRBA 4Z7YA 4WWSA 3EGNA 6FDRA 4F4XA 2JFKA 2MXYA 1HBMA 2V94A 2B0GA 1IKVA 3JSBA 1FF2A 2YX7A 4DV6J 1UA1A 4HTJA 4Y0FA 2GVDB 4C8MA 3R5JB 1ZPWX 1VRTA 4PEOA 3PG9A 1L3UA 2E9RX 4EMDA 2J0QD 3S7RA 2QYGA 3CJ5A 4OYBA 4ECUA 1H2UX 4ED2A 2Z8QA 4DX5A 2K8GA 5KFKA 3LA0A 3DCAA 4X62J 1LW2A 4YR2A 2KG0A 2E5GA 2L48A 3MM7A 4DR7F 4JI6J 2BE9B 4X4QA 1FRXA 5RUBA 4O3SA 2LXUA 1FX2A 2VG5A 2AEFA 2PI4A 2KZZA 2IBKA 1SIWB 3A3OB 2DGTA 3CNQP 3DLKA 3CO9A 3VALA 4RX6A 1IXKA 1EZZB 4Q0BB 2R8JA 2W9CA 4LRDA 1QE1B 2UUBJ 4OI1A 1KVIA 4DL7A 5KFVA 2RQKA 4DF4A 3L7PA 3WDOA 1OMSA 3CVKA 5B0GA 3TI0A 2Y3YA 5KFMA 1ZAVA 3DXBA 4OX8A 2VZ9A 1ZA2B 3HHLD 2Y0BB 1RTDB 1WDTA 2WZ1A 1RAOA 5CCMA 4FDFA 1R0CB 2GVDA 1V6HA 1X5SA 3MEKA 3Q8QB 1N32J 3VZHA 1SUQB 3HSZA 5CXTA 2QLWA 4QIGA 3F44A 1S7IA 2GIFA 3BF4A 2EBEA 1VQ7S 1NM2A 3NWRA 5B09A 2AHOB 5KAKA 4HDHA 2NXCA 4JI0J 4B3RJ 1FRJA 3MWBA 2GIRA 4N76A 1H74A 1NZ8A 4IH7A 1Z2LA 2EFGA 1ITPA 1U25A 1L3VA 2RRAA 4Q0BA 4JV5F 1K73T 2B5JB 3TVYA 4KH0B 2UXDJ 3DI6B 1GXUA 1QE1A 2X1AA 2CDRB 2XHWA 1ZETA 4P6QA 2CVEA 4J9RA 3T19A 3VTIA 2DXDA 1N5VA 1X7VA 2M0GB 3ZTPA 1KOHA 3GJQB 2H5JB 2W2OP 3ZZZA 1RTDA 1UCNA 2AYMA 2Y0SD 2KYXA 1I94J 2R2UA 1CQMA 1A7GE 3CE8A 2BQUA 2L3MA 1WORA 4ECSA 3H2VE 1IN0A 1HW9A 2NLWA 1SUQA 4OZ0A 2DNGA 1OSCA 1WC3A 3TX8A 5A0YB 2CXEA 3KHRA 1OPZA 4I6YA 1SC3B 4OZ5A 3NNHA 4IR1A 3SIPB 2HKEA 2P9CA 2GQ2A 2M7SA 3I32A 2XO6A 1B7YB 4DR6J 2CAJA 2CZVC 4FPIA 5CYMB 1FK9B 4DCPB 4EYHB 2JX2A 3MD3A 2NREA 3M8QB 2FVCA 4Q8FA 1JIHA 4N41A 3KK3B 3GFZA 1UJ5A 2B5JA 4R0JA 2BE2B 3MCOA 1DTQB 3DI6A 3NP5A 2E5HA 2Y1JA 4IR9A 5CD4H 2UVVA 1EAYC 4NLYA 3R8YA 2ZITA 3T1YF 3BREA 2DNZA 1VDHA 2DCLA 4OV1A 3LO3A 4P71A 4X84A 4F50A 3DRXA 2KXFA 4LF2A 4DI6A 2XB2D 4C3LA 1EETB 3RAXA 1TK0A 1BD6A 5L46A 4RW7B 1XJWB 1X4CA 3LGHA 2X3GA 4AYBD 3OD2A 3S01A 2DHAA 1UWAA 5A0YA 2CPXA 2J6TA 4PKDB 4ENOA 4KSEB 2VPXB 3HZEA 2YPZA 1WC0A 4DX7A 3IRXB 4KGZB 2I8EA 2J9DA 4DV0F 3NGDA 3V4MA 1RADB 4Q7AA 2VDHA 1T9YA 1Q81T 5CYMA 1FK9A 2MZRA 3CDAA 4RNOA 1X9WA 1WI8A 4NZ6A 4K4XA 5ETNA 3GSDA 4UY8T 2C2RA 1NHUA 2YY3A 4OX9F 3GB0A 2BE2A 1DTQA 3D6MB 4NXMJ 3LPYA 2HZVA 1UMJA 4WF9Q 2HHSA 3SZ2A 3MF5A 4OI3A 4JI2F 1IR1A 3I0RB 5HO4A 1S0MA 4DV4J 5A8WA 1F2GA 1N48A 3I6PA 4ZLLA 4BBYA 3JB9k 1YZ6A 2OPSB 1VRQC 1EETA 1VRUB 2V67A 3VHQA 4M5IA 2HHHJ 2C2MB 2GJ2A 4RW7A 1JXLA 4NA3A 4RUAA 4P72A 5C5JA 2V6AA 3CF5Q 2DR9A 4K5SA 1AROP 2YQ0A 3FKBA 2KRBA 3IR6B 1CLFA 2IM3A 2E1AA 2B4OA 1B0VA 2H51B 4C3KA 4LSNA 3GIJA 1CJVB 1KTVA 2RDJA 1SJ4P 2I0XA 1ZM3A 3IRXA 4WFYA 2H4WB 3BM7A 3JXOA 1M5HA 3ZNJ1 2L08A 2VQEF 5DG7A 4B3SJ 3RBZA 2HGNA 1X9SA 1S0VA 3QSIA 4MK8A 1KEKA 3R5GA 1SH0A 1NK7A 3GP9A 4ILLA 3IAS9 2XCAA 1EKSA 4E2FB 2D3O1 4QWBA 1LWEB 4I2PB 1U2RA 4I4BA 4OYAA 1X8DA 2IYIA 1S9GB 2ZBRA 3I0RA 3CCWA 3K5OA 3K7RA 3C16B 1X4BA 3IN5A 2HZAA 4F8RA 2D1CA 1RGVA 2H4YB 1KONA 2JOQA 4CO5A 2OPSA 4UT4A 2F63A 2VG6B 1QJHA 1VRUA 1UVIA 3BBBA 2PDAA 4FNIA 1UEVA 4FNHA 1VC0A 4I2QB 4PUOB 1HWJA 2EFQA 5CCLA 2ALZA 4AE5A 4LRFA 1RACB 3LPEA 3I96A 2HWHA 4QIEA 4DPWA 4RUBA 4PWDB 1JLBB 3JTOA 3AAWB 4NYZA 2LDYA 2WONA 3SFUA 3D67A 4J37A 4LVOP 2FZCB 1N34J 3KJVB 3AB2B 2AKWB 1F5AA 2NXEA 3AD8C 5G0RB 2AZ1A 2CPYA 2IDEA 3J81Y 4E8UA 1Q4RA 2NPIA 4HYKA 4LF8J 5DQGA 2IRUA 1LWEA 4I2PA 4QR1A 1S12A 3WQPA 4LF6J 3HF5A 4CLZA 3BSNA 2JHEA 5IZHA 4DV1J 1S9GA 5J1NA 2HK3A 3C16A 3NAIA 2U1AA 2W4DA 3GIIA 2MJUA 2O66A 4NLVA 3R5BA 2DR7A 2VG6A 3KOAA 4CT8A 4DL4A 1HFEL 1UEKA 4I2QA 2UVUA 4F0KA 2QZ8A 1GH8A 3OR1B 2L9NA 2XWYA 3CULA 2QGFB 2ATCB 1Y4ZB 4PWDA 1JLBA 1K47A 3DNCA 1PC4A 1WKLA 1KLMA 1R8AA 3MPVA 3RBXA 4OHWA 3TAPA 4Y00A 3PX0A 2ZHAA 3KJVA 4Y3CA 2F8MA 1G7CB 4OI4A 4FKYA 5G0RA 2EI5A 5DS7A 3TJ9A 2XY7A 2OFGX 1TUGB 4JB8B 4BWMA 2GIQA 4NOHA 1YKWA 2K06A 5FD1A 5J1PA 1Q0NA 4EI2A 3MMBA 4ECXA 3TJAA 1PJ6A 2ROPA 3OHBA 4Q5VA 3KUHA 4CLFA 3SV3A 1FFWB 3ILOA 3C3LA 1TL1B 2V34A 1FDBA 4ES3A 2DB1A 2MEWA 3R7BB 3Q2SC 1SJQA 1S48A 1D9AA 1H3DA 2A2CA 3US5A 2FLPA 4XDCA 1NMEB 3PW5A 3CD6S 2VJUA 2N4DA 2ROGA 2DNKA 5AJ3F 4XK8C 3OR1A 1JLAB 3RTVA 2DGSA 2BJDA 2BOAA 1D8ZA 2H5IB 3T6JA 4ED1A 5HMYA 3IBFB 3LTOA 2C3PA 4A8FA 1FKOB 2V8HA 3P3DA 4F4WA 2QX0A 1RT5B 3P49B 4EEYA 4ZCKA 1RT4B 2IJNA 1Y5IB 4I6AA 4B9MA 4J9KA 5IT9Y 3RB6A 4OFZA 4TY9A 4ZJOA 4ID5B 2HBRB 3IG1A 3M6UA 2CQ2A 1XWLA 4GVLA 1IBCB 2KJVA 1FTRA 3AQPA 2EK6A 3M2UA 1KTQA 2R2SA 2VASA 1M5PC 3NGUA 2MQ8A 3UW1A 4ECTA 1SC1B 4P7VA 4W4MA 1J5EJ 1PILA 1Q8IA 3V6HA 1S0OA 1GTEA 1RBLA 5CZVA 3TOQA 3ET6A 1C0UB 4JV5J 2DNLA 2GO8A 3TW0A 1WEZA 2R7TA 3QT7A 1T11A 2IBOA 3RUBL 3QJJA 2VUGA 3H2UB 2BM0A 2JFDA 1JLAA 1SB6A 3ISND 4DR2F 3EJMA 2GA7A 1FKOA 1JB0C 2IJFA 2J8AA 4O3QA 3MM6B 1RT5A 4RR5A 3OSNA 2IHR1 1XR7A 4PZVA 4DPOA 1RT4A 4HH1A 2CRLA 2DTJA 2VG7B 1RHJB 2X7IA 4CI0B 1RAHB 3HJVA 2DH8A 2ROEA 4URQU 3NS5A 2B9EA 3TZXA 2C42A 1JNZB 5K5MA 2CKWA 2B3TB 1IM6A 3LW5C 3GZ7A 5THWA 4DUYF 4ID5A 3M9NB 5D4OA 5GVQA 2G1DA 2ASDA 3LGMA 1OPIA 2EK1A 1XMQF 2KT5A 4F02A 4A8QA 4LVNP 3D4JA 4HHHA 1TELA 1R0BG 1RCOB 5I3UB 2RVJA 2F9DA 1C0UA 4U67Q 3O8WA 2A3JA 3OVAA 1RWWB 4LQ9A 2R8GA 5IC6B 4WFZA 2Z58B 2HQFA 2AMCB 2YVSA 3POTA 5HMZA 1J2VA 2R3VA 2J0SD 1RTZA 4DFKA 2VFTA 2HQCA 2IPOB 4JYAJ 2AGQA 1FD8A 1LK7A 3W1YC 1BGXT 2QN6B 1PO6A 4LUBA 3MM6A 1I1GA 4IH6A 5B0BA 4HT7A 2VG7A 2X51A 4USIA 4F4KA 2V5HG 2NYIA 2OLWA 5DLGA 4F4YA 4B3TF 1FA0A 3MPDA 3ZO7A 1Z2ZA 1KQGB 4B02A 1N54B 4KR0B 3N28A 1NNDA 3K89A 3M6WA 3HK2A 4U8YA 4IOBA 2HQGA 3HSJA 2NPFA 1MWZA 1VQYA 2RJZA 3FMBA 3PYGA 5FIIA 5KT2A 3EGWB 2G2YA 3CWJA 5CAAA 2HHUA 2XNRA 5I3UA 5HI7A 2ZH9A 2AJ4A 4O44A 5FDLB 2GS8A 3IO1A 5T7LB 1D1UA 3PW4A 4LF5F 4OX9J 2L9DA 1VJQA 3B54A 2DITA 2FPHX 5GAHI 2VDIA 4N56A 4DV5J 5KFSA 4J9VA 3OSPA 2LXFA 2K2PA 3HO1A 4JI2J 3TANA 3MMAB 2A1BA 1TFYA 5KG5A 3W8GA 1WHWA 4X64F 5KFNA 8RUCA 1KDNA 1F1BB 3H4DA 2DGOA 1XTZA 5L1LA 1KSPA 2EFNA 1HQEB 1VLOA 1WC6A 4RBVA 2R8KA 2QMUB 2CQDA 5E3CA 1LXNA 7FD1A 2V4QA 5D8HB 4EK2A 1U09A 4UOCA 1XMOF 5KFDA 4J9MA 4RZRA 5K9FA 3GYNA 1HWIA 3VAMA 1U6BA 2Z2YB 2KO1A 2CJBA 2BJ7A 3CCES 2R7OA 3OR2A 4DFPA 4QOTA 3DOKB 2C2NA 5FDLA 2DBBA 3WIUA 3PCOB 5T7LA 3PHEA 2R7RA 5IT0A 3H59A 4DX8H 3C46A 1RWVB 2QLXA 5CABA 3AOCA 3LWMA 1K1SA 4Y2IA 5BJRA 4KGMA 4MIAA 3MMAA 4F2SA 1R0AB 4FYYB 3PO5A 2ZC3A 2HFNA 4DSEA 3GJTB 1UKUA 1LWFB 5KFBA 2QE5A 4WE1B 2VKZG 1GAOA 2J8SA 1OS5A 3LALA 4DN9A 4ES1A 1YIJS 5A8KB 3KK2B 2HS3A 2C1EB 1V9OA 2IVMA 2XS5A 3UNGC 2BR0A 1XNRJ 2KU7A 1RBAA 1HQEA 4K59A 2Q43A 3FZ2A 1VHIA 3H25A 3EGZA 2WAQD 2V4JB 3MEDB 3EPGA 4B08A 1TR0A 3MUVP 6AT1B 2ABYA 3H5XA 3OFHA 2RF2B 3DDNA 2GQQA 2CVIA 2XLIA 3OQ2A 5E3QA 1X31C 2HFZA 5L39A 2Z30B 4O4GA 2NXNA 2CPEA 5A76A 2JNJA 3QT5A 3DOKA 2RU3A 5A8RB 2G2ZA 4K4TA 4GKKJ 2DRAA 2YWGA 4NPOA 3CCUS 2UVRA 2VC1A 3RU0A 3R2CJ 4QIVA 1MROB 1NKBA 3HVAA 5LMNJ 3SXLA 5H1SV 2KZMA 3PW2A 5HVHA 1WG1A 1Y7PA 1I6JA 3WBZA 1HYSB 2EWHA 5IT4A 3L95X 2YKPA 1T95A 4Q2LA 1R0AA 1ZAWA 3C14B 2HQIA 3PYDA 3BDPA 3H40A 1LWFA 5CD4A 1HI8A 4WE1A 3O6QA 1NK9A 4DPUA 3N01A 4OHVA 1U2CA 2BUNA 4Y2MA 5A8KA 3KK2A 1NXIA 2G0IA 1DBDA 3MFHA 4DR1J 1SI9A 1IWGA 1FTCA 1KQKA 2V4JA 3MEDA 3N79A 2ZHBA 2GGPB 1S9FA 3CC7S 1FRLA 4C9DA 2HNDB 3VQSA 5CZXA 4NLXA 3P96A 2CPHA 3NBPB 4CRJA 3HSDA 4D3HA 4EBEA 3LWLA 4OZNA 5A8RA 2G9OA 3K57A 2HS4A 2FQQB 4MJKA 3CDBA 3HM9A 1MROA 4AQYJ 1T3OA 2V9WA 1VC5A 3E01B 5KFRA 4C3MA 4B3MF 1HYSA 3GV8B 5JJBA 2LQ8A 5LMUF 1QAJA 2BBEA 2ZE2A 3FC9A 3C14A 1ACMB 1TL5A 2B7BB 3MR5A 1OQ6A 4F4ZA 2LEPA 2Q3PA 4YY3J 3D28A 3JTPA 3RB4A 3QSYB 3RRHA 1Y5NB 1RYSA 2PMZD 4J90A 3GYXB 5KFEA 3F56A 3J81j 1P8GA 4BCAA 4ZPWR 4BLGA 1VIXA 2IMOA 2KH9A 1HNZF 2HWTA 1LV5A 4CZCA 5J2PB 5T41A 2R2TA 4F2RA 2GGPA 1V5VA 1AFIA 2HK2A 3RBDA 2GHPA 3DKDA 3PJ9A 1YITS 3T1AA 2GFFA 1T9WA 1RI7A 2HNDA 1HPZB 3J80U 2LECA 3HT3A 4N8OA 1X0FA 1HI1A 2HQDA 3VGVA 2ZBQA 1UAWA 2EW9A 3NBPA 4OJGA 4DV2F 2FDNA 2QSFA 1RT2B 3NNAA 4RW4B 4NI2B 3O1LA 4ES2A 5KT7A 2KT2A 1KBRA 2H9ZA 5KFIA 2CPFA 1NK6A 4QR2A 2QL5B 5GAHU 4YFUA 1RSCA 1AXQA 2JLEA 3E01A 2IM1A 3VCDA 1N33F 4CLTA 4ERDA 1U49A 3P6YC 5K14B 3L9ZA 2ZOMA 3Q89A 1KD1T 1NRKA 3ZNUA 3HXMA 1HBNB 5JXSA 2E7WA 2DJWA 1JJHA 3CJ2A 3TQEA 4CM2A 4IRDA 1ZYQA 1FD2A 4XTTA 3KJQB 1JMTA 5H9FK 3K59A 3FGVA 4RWXA 3CJ3A 3PXGa 2IA0A 3BO3A 4AT1B 3GG0A 3KDNA 3I82A 5J2PA 1X5OA 2FY1A 2OFHX 2CJYB 4JI1J 1SBRA 3OTEA 1GXTA 1LWXA 2DEJA 4RPFA 3A8JA 1N56A 2YH1A 2PSZA 4WXWA 4GO5X 1YG0A 3T3FA 1R7IA 2W7AA 5EHHA 1RT2A 2ZUAA 4FXVA 4NI2A 4DR3J 4CTAB 3JAMY 3DLBA 3CCVS 5ETVA 1IJEB 2QA4S 3FBFA 4NXNF 4KJIA 1VIOA 4ZVUB 1H2VZ 2MZSA 3RGIA 3KLHA 5GMDA 4TLQA 2BW2A 4P10A 4PABA 3NCPA 4PPDA 5K14A 3BGFA 3D0HE 3FBBA 4FBTA 2YNGB 1Y00A 1U26A 1HBNA 4F3QA 3R5DA 1NCLA 5E5NA 1LW0B 4JUZA 4ZCIA 4WK1A 1CJKB 3CCJS 4FYXB 1NZAA 3LOUA 2PT0A 1WTFA 3RYLA 4OX6A 1TFWA 2CPZA 1NB7A 2QIFA 4DSFA 1WSRA 1NSKL 4CO4A 2PMHA 3UFCX 3LUYA 2DEIA 3KJFB 1KS2A 4NLGA 1JKHB 3W5XA 2OI2A 2HYIB 3EZOA 5KT6A 2BEFA 2E5IA 5AXMA 2KVQE 4CTAA 4MMOA 1JLCB 4YQWA 1YVFA 4KQZA 1N6QB 3DU5A 3D6FB 2AEMA 1U45A 3CIMA 1T8EA 1FCAA 2MLXA 4LBHA 4AL6A 2Y1LB 2DR5A 3W9IA 1U6ZA 2YNGA 2XZDB 2KI2A 1DTTB 4RW6B 4KHPF 2ZZNA 4USWA 2QMXA 4PRFA 2K3IA 5G4DA 4LF5J 2E1MC 2JJ4D 3CO0P 1LW0A 4YDXA 3MDFA 4W98A 3GFXA 3ZTQA 2W1BA 1B0TA 1YZ7A 1CJKA 3N9UC 1ZOTA 2Q1LA 3N5BA 2D7SA 5DZ7A 2HHVA 4IOCQ 1E6VB 3SQGB 4GO7X 1K9MT 2C28A 4ECRA 5KFTA 1U1RA 1QLNA 3SDEB 2O67A 3OVBA 2XMJA 4HI2A 1JKHA 2HVIA 3I4PA 2RS8A 2QL7B 4UZBA 3UDLA 2AJ2A 4LFBF 3H7HB 3HHDA 5KFOA 1B0PA 4LRCA 2LVWA 1IQZA 4IG3B 1EQ0A 2GO9A 3GG1A 1N6QA 4DQIA 1RWKB 1F60B 1B64A 1SIZA 2V8DA 1XMOJ 3Q83A 3UDCA 4H4MB 4F67A 5DM6Q 1NKEA 1HR0J 4J91A 3ZZ0A 1V3SA 1UFLA 1T7PA 4ILMA 1T9XA 3SCJE 2DIVA 1DTTA 4URGA 4RW6A 2RUSA 2FLLA 3PYFA 1PCAA 1A6LA 3CD0A 3EWGA 3HMJG 2Z2LA 4MT1A 2HG4A 1TU0B 4NMLA 2QEXS 2E1PA 3EMTA 5D77A 2XS7A 2W2QP 2D74B 4XDDA 4U7UD 4ZPVR 4N47A 1E6VA 3SQGA 4M8LA 4KY3A 1Q79A 2LEAA 1PGZA 3QMQA 3TUPA 2ILZA 1FWLA 3GR0A 1Y3JA 2HFSA 2DO4A 3SDEA 4WPAA 4NLUA 1RTHA 1YSJA 2WVDA 1U0HA 4O0NA 2J0WA 1T9TA 1RAAB 1D0EA 4K0KF 1VHFA 1HNIB 2MJNA 1NK5A 3HHEA 4IG3A 1WHXA 3HP6A 1BQNB 1YJTA 1RA7A 3BB5A 2RKIB 4H4MA 2J6UA 3TJ8A 4M5KA 2HBYB 3D54A 1WKJA 2IMWP 1BWVA 1YJ9S 3OTOJ 3UQSA 5K8PA 3DOLB 1M1GA 3DLEB 3QAEA 1AZSB 2UXBJ 4EYIB 3DLLQ 3VGTA 2MKYA 3F73A 3EVMA 4U7UK 1RA6A 3PJWA 3GV5B 3O5TB 1WD6A 4LREA 4YEAA 3OL8A 5U47A 4RNMA 1Q8LA 3VAIA 3UCZP 5ETKA 5HBMB 5M2UA 4ECQA 2KG1A 2XNQA 1UWBB 4C8YA 2MSSA 4K5RA 2EC2A 2DPIA 2RHQB 4MIWA 3FEYB 2E1CA 2FJBB 1AT1B 5H9FJ 4OYMA 1R8CA 4I64A 4CYUB 1DAXA 3TAMB 4NA1A 4FS2A 3CW2C 4WFBQ 3AH6A 1OWXA 2YWEA 4PXCA 2FJAB 5JMNA 3D6HB 1Q53A 2VQFJ 3JQMA 2MGZB 3Q86A 3ELHA 4U7CA 3B8HA 1ZTTA 1QDUB 3WX8A 2RKIA 4DL3A 4LIRA 2R7SA 4QR0A 3MM9B 1Q86T 4AD6A 3G8QA 4DCJB 3BQ1A 1OO0B 3QRPA 2QA4G 3AQOA 5GADI 5C2GA 3CEDA 3OXGA 3Q8SB 5KG7A 1KNZA 2AX0A 3DOLA 3SQOP 2JEFA 3DLEA 2H3EB 2MQNA 4LJMA 3QJPA 1HHSA 4RL1A 1UFKA 3ITHA 1AZSA 1W25A 3NG8A 2QO3A 3FSYA 5ETOA 3CCLS 1F9EB 4B3MJ 3CTRA 2EG2A 4DV3J 4K4WA 3W65A 5J2QB 5B0AA 5LMUJ 3TUJC 2MY7A 1HQUB 4DF8A 4LSZB 5HBMA 1O5JA 4YMEA 1MN9A 2CQIA 2ZH7A 1UWBA 3FDSA 3V4IB 1S59A 2XMAA 4V1Ak 3LQVA 3GR1A 2R9LA 2EFPA 2UUAJ 1RUSA 1XR5A 1NLKL 4IG0A 1B3TA 1DQ8A 4CYUA 3AA8A 1LWCB 3UI3A 3TAMA 3ZFVA 1HNZJ 5KFQA 1L5UA 4J9QA 5B0EA 1PYSB 5GMEA 1HLWA 3BZQA 1MN7A 4ZCMA 3HFZB 1N0UA 5AE1A 2E7XA 4RW9B 3TWZA 3NCQA 4CCHA 4KHRA 2GMJA 5F8MA 4OI2A 1VQ8S 4LF7F 4YB5A 1PJ7A 4DV2J 2UUCF 1WF0A 2IAJB 1XEZA 4PXDA 1VLYA 3MEEB 4TY8B 2W9BB 1QSYA 4L72B 5ETTA 5F8JA 5DDQC 3SBMA 1REVB 3ZZRA 3WC2A 1XN9A 3OXFA 3MUTP 4R5PB 1N33J 2VHGA 2UVWA 4YHHJ 5ETPA 2D9PA 1VQOS 2FJVA 1BMQB 5J2QA 4B9UA 2OPPB 5HN0A 1RHMB 1HQUA 3TEHB 4DJBA 3M8PB 3TVZA 1U1KA 2WVFA 4H54A 2N3LA 1KQFB 5KFFA 4ZOSA 2BANA 3V4IA 4DU7A 2BDPA 2AT1B 2B4PA 2F9JA 3ILIA 1YI2S 4O3NA 2PN6A 4CLPA 2W01A 3DLHA 3GYGA 3FRZA 1KLNA 2EFOA 1NDKA 1AA1B 1LWCA 2XYHB 3PNIA 1LOUA 3BQ0A 1FFGB 3FQKA 2BJ1A 4WIIA 2J7UA 2CQ3A 4A8KA 1UVKA 3FK4A 4IH5A 1REGX 5L8RC 4YP3A 1EQMA 2C22A 1RKIA 1X5TA 2K1RB 2GCFA 3HHLC 1LKZA 1JLEB 1P9YA 2IAJA 2VIHA 4LSLB 3MEEA 4TY8A 1I51B 2W9BA 3QQCD 1QM9A 3ILJA 3BSAA 4Q43A 1FEEA 3NOGA 4NXNJ 1EARA 4A8YA 3F0NA 2R7UA 2XY6A 2VBXA 3KUGA 5KFHA 1P6TA 4G1PA 1BE4A 4R5PA 1M5VC 4WFAQ 5IOLA 3W63A 2ZH4A 2UXCF 1S1TA 1UJ4A 1UVJA 3I5AA 2VU5A 3IWXA 2HGMA 2GX8A 3M8PA 3HFKA 2V2VA 4CLYA 1VQ5S 3QLHB 1T05B 2NZ4A 4GRSA 3DMJB 2IC3B 4WYLA 2J7WA 2HSEB 4M5NA 2WCXA 4CT9A 1RTIB 1PSDA 4RU9A 5B0CA 3NOCA 3TZWA 3IA0A 3V81B 4ZVOB 4JV1A 1T02A 2AP6A 1R6YA 1DRZA 2WSEC 2LEBA 2GMHA 1S72S 4AXJA 3HCXA 3Q22A 4NLQA 2ZH3A 2FGOA 1O6XA 3L4BC 5I42B 1QSLA 1EP4B 4YB1P 1JLEA 3A8EA 3TP2A 2BE7D 1FNMA 2DNPA 2CNLB 3NGKA 3KLEB 7FDRA 4FVMA 3OW2R 3VAKA 1E6YA 1URRA 3PDNA 2W25A 2I5JB 1S49A 3I9ZA 5KFUA 5B08A 4H4OB 3CCMS 4IQXA 1ULRA 5KFPA 3JYTB 4ELUA 1P1LA 3VWSA 1RHUB 3KMSA 4GVBB 5LXYA 3T6BA 1UL3A 4Q44A 2YKAA 1T05A 2V8VA 3BR8A 3DMJA 2NQPA 1VQ9S 1NH8A 1H7WA 3I87A 2BXJA 4DG1B 3UD4P 3MECB 2H54B 2YQ3A 3R6LB 2JC0A 2IC3A 4FP9A 4NRUA 2A6OA 1CS4B 4ICLB 3V81A 5F8IA 2MMYA 1O0PA 4A8WA 2BRLA 2DNNA 3WC0A 3IBCB 2XLKA 1XK8A 1EX8A 2DPJA 2V8PA 2YKNB 4OL8A 4YB7A 5K20B 4GC6A 4RLEA 1SKWA 4P2MA 3P5TL 2F3JA 2HHTA 4DFMA 2C3OA 4UQTA 5I42A 2E5LJ 1EP4A 3M4XA 1TMJA 3MOZA 5GADU 4F25A 4KRWA 1M1HA 1Q5YA 4C8ZA 1F3VA 1VGYA 4LFBJ 3QRRA 4KGKA 3KHHA 2BV3A 3PV8A 2I5JA 2BZ2A 4UOFA 4WU3A 5KFYA 3CJ0A 3MOJB 3DLJA 1G2EA 1X0PA 2RNEA 3CCTA 2CNOB 3CJ8A 4LFCF 5F41A 2PEHA 3JYTA 2XYGB 5EWGA 1JK9B 3LANA 1D8YA 4WIQA 1W7WA 2MZJA 3VV2B 1J5OB 2IA6A 5KFWA 3T5HA 3GTYX 4GVBA 1UVNA 1XBWA 2CG4A 1HNVA 1T9VA 3CMAS 1H38A 1JXVA 4JBCA 4K4VA 4WTYA 4DG1A 3MECA 1HWKA 3EX7B 2AD9A 1JLQB 2VF3A 4DU8A 4LRAA 5KTQA 4LR7A 3NEKA 3J7Z5 2YQ1A 4ED3A 1CS4A 2BJ3A 4ICLA 4WYWA 3EGVA 2HVHA 3QO9B 4NWBA 1C1CB 4KO0B 2XGQA 2YKNA 2GZOA 1NJZA 2HLTA 5F9LA 4CO2A 5HMXA 2LDIA 4OYIA 3NMAA 3H5SA 2HIQA 3N6LA 5F0UA 5KT3A 4WZMA 1QVGR 4RWWA 6FD1A 2ZNZA 3QNWB 1TZ0A 1VISA 4EZ9A 4PYAA 4MFBB 3UCUP 5HLFA 3UVJA 3D5MA 5BYRA 1JWWA 1PYOB 3OLBA 4OYOA 2DH9A 4UOHA 2RRBA 5F8NA 1J5OA 5EX3A 1UVMA 3FCHA 2XLJA 5IWAJ 4JOUA 2G4BA 4ZIVA 1BQMB 4Z7CA 5KFCA 1FDDA 2HVEA 1FXDA 2ZJPQ 1UEUA 1JLQA 3I56S 4N7TA 3OL6A 3N0VA 3PTWA 3IRWP 3W9JA 4RW8B 5E3PA 2V50A 1V5IB 4WFNQ 3QO9A 1PKUA 1C1CA 2M70A 3M32B 4PXBA 4KO0A 3VZIA 2XO7A 1X9MA 1N5QA 2WB4A 1YDLA 3UR3C 2ZWPA 2QLBB 3LH2S 3Q24A 1ZZNA 1P27B 3T9ZA 1S1VB 1YJUA 3M6XA 4TU9A 2W2MP 3HVTB 2DK2A 3QATA 1WJ9A 2BABA 4JI5F 1IBKF 1WACA 3HLUA 3QFHA 1Q1KA 3KHLA 3THTA 4MFBA 5LL6d 1C4AA 2E9ZA 2HRTA 2W8LA 3AJ2A 2BMBA 3MAQA 3P5BP 4EBDA 3AXKA 4K4ZA 3G71S 1DZ5A 1F5CA 5F8HA 2C3UA 3AY0A 1BQMA 4USUA 3QIPB 1GNKA 3EDRB 5B0DA 2DKOB 1L3TA 2AJFE 1JXEA 3IWLA 3NGSA 1ZM4A 1KN6A 3SV4A 4K2XA 2HW3A 2A2DA 2EC0A 3BSOA 4RW8A 1XNQJ 4LBPA 4OLPA 4MKAA 3DRYA 1WEYA 2RQMA 1LFPA 4OHXA 2OSQA 2CJXB 2KTQA 1Y5LB 3W5YA 2N7YA 2XC9A 1WOPA 3SFGA 2WB1D 4O3PA 3NCRA 1HWLA 2G13A 3MAHA 2MKIA 1S1VA 4Q45A 1CJUB 2YNIB 1T9UA 5LM7E 4AL5A 1X4GA 3HVTA 4TQSA 1QD1A 3DHWC 1IBMJ 2OEKA 1FKAF 4CH1A 1N36F 2FVPA 3TUZC 1RDRA 1CBKA 4F0MA 2P5VA 2LU1A 3KG1A 3OV7A 3W61A 2CQ1A 4DPXA 5DDRC 2C3YA 3M6VA 2CZ4A 3L09A 2W8KA 2F8EX 5DG9A 3G6ES 4OX7A 3BR9A 2MLYA 3UO0A 3GCWP 1ZBTA 4ILRA 2H65B 3IM9A 1RJJA 2R8IA 4ZPAA 3M8ZA 2UUWA 4A8MP 4YB6A 1ZAXA 2XQCA 5D4NA 2F4VJ 3DHXA 4GKJF 5IFMA 3RG6A 1O8BA 1FRHA 4X62F 8ATCB 2BX6A 2FZGB 2OIHA 4AXIA 2ZHOA 1PJ5A 4JI6F 2NSCA 3A3PB 4PQUB 1WKKA 3OHAA 2ZOGA 1S0NA 4KV8B 4LR8A 4IOAQ 1CJUA 4EUVA 3IFEA 1N5SA 3J7YI 1B4SA 3RAMA 3M8QA 1NUEA 3G86A 3OBIA 3KK3A 3B78A 4NYPA 3NGTA 3TAQA 1HHQA 2MPUA 3D0GE 3EM1A 2OTLS 4FN5A 4Z2XA 1B7FA 2FC9A 4C11B 4QBUA 4RJVA 4ZVQB 4DDFA 3ZC4A 1EKRA 4DOZA 2FHKA 2AJ0A 2AIRB 2X1BA 3TUIC 2VL1A 4G65A 1NJWA 3BKUA 3GU0A 1U1PA 3AOBA 3N6MA 4PQAA 2KVIA 2UXCJ 2XMVA 2ADCA 3EPIA 2MQPA 1Z1ZA 4WCEQ 5LXRA 3HZGA 1N32F 3BGLA 1PAUB 4O23A 1UA0A 1D9DA 1WC4A 2AEJA 1TKTB 5A6WA 3G8SA 4WZQA 1RT7B 1FEHA 4NA2A 2C2DA 2AWZA 4OZLA 4ZDNA 4E98A 3NWGA 2JEGA 3BEGB 3F41A 4CIOA 2XSJB 4PQUA 1WHVA 3RAQA 2PI5A 3MD1A 4JI0F 2HRYA 2V63A 4KV8A 3JSRA 1NK0A 1S9EB 3E2EA 1I3OB 4ZLNA 2FJXA 2J9EA 2XI2A 1VQ6S 3ISNC 4ZP7A 5SZTA 2YWFA 1BXNA 1HL6A 1HNXJ 2APOA 3BGRB 1FRKA 1VC6A 1FNXH 1M1KT 2A0FB 3SI8A 2OH2A 4C48A 2DVIA 3R3TA 4MYTA 2GJFA 5FJ4A 1FRIA 2IFXA 1NSQA 4ANDA 3G87A 3FBCA 4L3KA 4X65J 4JV2A 3Q8UA 1I94F 4LFAF 8AT1B 4ECWA 4HHJA 2UV8G 3MM8B 4B9TA 2Z4PA 3M8WA 1CC7A 1JJ2R 2UV8A 3CJRA 2AV5A 1EJ7L 3HKZD 1UTAA 2VD3A 3CCRS 2CUYA 3DGPB 4CDIA 3PEHA 1TKTA 2H5EA 4LMZA 3TVKA 5CA5A 1RT7A 1FNOA 1CJVA 3ENWA 3NL0A 5E7OB 3EUNA 3GFYA 1S10A 3MR3A 2Y9HA 4O3RA 2XSJA 2ZNYA 3R2DJ 2AJ1A 4IRKA 4LQ3A 1S9EA 2Y1RI 4L74A 1R43A 4LF1A 4DLGA 4M5GA 2M3DA 2FHOB 4WXOA 5AE3A 3KWMA 4Q8EA 1WELA 2NS1B 2IY5B 2EKNA 2BJ9A 2WW4A 3BGRA 3ETMA 3PKYA 2DHSA 1F9HA 5ITHA 2RILA 3D1QA 2VICA 4QWAA 3W64A 1P9QC 2RQCA 1IKYB 1TV6B 2ZM6F 2HMIB 1XR6A 5DQIA 2IYGA 4FF4A 2Z57B 1JQGA 4LFCJ 2HFOA 4UOGA 1UFWA 4PUOA 3MM8A 2HNZB 3I5CA 4OYPA 2V2ZA 4CH0S 3LAKA 1H98A 1FJGF 3CJKB 4G1QB 2QT7A 3FJ2A 3DGPA 4PXEA 4DSKA 5IS2A 1NPRA 3FNNA 4J9UE 3H2LA 4MK9A 4HT5A 2GHWA 3GJSB 3TYTA 1GT8A 3VR1A 2MKCA 1KFSA 1TK5A 3R6GB 3AFGA 2CFXA 5DO2A 3C15B 4P75A 4QCLA 2VPZB 4H4KA 3OTBA 1LFWA 4M5HA 1MWYA 2OP5A 4DSJA 4DR7J 3OPKA 4NXMF 3QJLA 3HVWA 1QTMA 3DRRB 3JQKA 1YJVA 2AGOA 1F3FA 3FBEA 5KG3A 2E66A 4QW8A 1IKYA 5ADZA 1TV6A 2FLNA 4ZA1A 2B6AB 3CMES 2K7JA 1T03B 4ED7A 1R27B 2HNZA 2EBGA 2XMKA 3LP1B 4DPYA 3R9LA 4LF4F 2C3MA 2AJQA 9ATCB 4DR5F 4LRBA 3QWPA 2RT3A 2CNKB 1YJWS 3QIDA 2V0NA 4G1QA 1FDAA 4ZHRB 3EDQB 3H8YA 2FJWA 2BM1A 3IR7B 4S0MA 1B99A 2W7OA 1KR4A 1WOOA 2KKHA 1NJYA 2G2OA 3J7YU 3K8WA 5LT5A 1IKWB 5LSRA 4R0EA 4QZVB 4ZP9A 3A8IA 2EEYA 1DARA 3THVA 3MPYA 3DGVA 2J9CA 4JP8A 2E5JA 1ROFA 2BOPA 4RNHA 1VYAA 3AT1B 3JQJA 5HSPA 1L3SA 4OZ2A 3FFIB 3SYZA 4Y28C 1TL1A 3D7SB 1OYDA 1AYEA 3DRRA 3FQLA 1PG5B 1KVJA 5F0WA 3U27A 4OHYA 1YJRA 2KT3A 2JZ5A 1IBKJ 3MR6A 1R31A 1WTBA 4DL5A 2B6AA 3RBEA 1T03A 5L1KA 2CQPA 2R7WA 4N77A 3R5AA 3LP1A 4OZJA 1S99A 1EHWA 3CC2S 1U02A 2M9KA 1H6KX 2IIHA 1SH3A 5KFZA 4P2SA 4ECZA 1HBMB 1OSDA 2XHCA 3RW7A 4WBFA 5L1IA 4X4OA 2EFVA 3GFHA 3MMJA 2SXLA 1N34F 2M8HA 1VRTB 4ZVTB 1AB8A 4MTPA 4NEYA 2ZVIA 2Y1IA 1IKWA 4MH8A 4NCAA 2PC6A 4K8RA 2KM8C 5HK4A 2MHNA 5L9XA 3SCIE 1BHNA 4HEA9 3WZ0A 2PGCA 2POKA 1LW2B 1K0TA 1H2TZ 2BQRA 4LF8F 2J5AA 1YWXA 1MMDA 3EXCX 1VQKS 3CMQA 4R8UB 4DSIA 3BPSP 4USJC 3GV7B 1IR0A 4LF6F 3FFIA 2KHCA 5DG8A 1RT1B 4DV1F 3ZXWA 3PY8A 5C2CA 1KC8T 1U1LA 1KP6A 4ZPDA 4RBTA 2CJ9A 4KBIA 3D9BA 2YNFB 1WC1A 1U4BA 3Q8RB 1D3WA 4QWDA 1N36J 4ED5A 1YJ7A 1GQEA 3G6VA 2QMWA 2QSWA 1UJ6A 5A6PA 5AXNA 4ED8A 3E51A 2PFDA 2CDQA 2NUUG 4FZVA 3BBFA 4Y6IA 2HS0A 3C66A 1N0VC 3T1YJ 1CSJA 4LBIA 4RO0A 4NLDA 1U1MA 5HP1B 2UUTA 2O5DA 4M1KA 3IAM9 1GX6A 4KH1B 4A8XA 2ZH5A 3V5RA 2OELA 2I9SA 4L73A 3QAUA 4OYZA 2GQCA 4QPXA 2IRYA 3W8PA 4NASA 5A2QU 4GKJJ 1SJ3P 5F3ZA 2M5YA 2OHDA 4K50A 1Y10A 2J6SA 2ASJA 1K8AT 3P8BB 4CLLA 1NAQA 4C8NA 4ZN3A 1WI6A 3NY0A 2JH3A 4R8UA 3TA1A 3I31A 2VV5A 2D41A 4X2BA 4U6PA 4NLWA 4DV0J 3MR2A 1VQSA 5DQHA 4P9SA 2RE1A 4F26A 1RT1A 3D0IE 2VPWB 2BKNA 2M52A 4C6AA 1NJIT 4IDKB 2GHVC 2N82B 3N4WA 1X60A 2YNFA 3MPUB 2KXNB 3UDEA 2CJQA 3MTJA 2YTCA 2AZ3A 1TK8A 4DEZA 3UN2A 4DQSA 3LGNA 2Y8WA 3GCXP 1UPPA 2R42A 5KG2A 3K0JA 1RWMB 3FSXA 4ZCLA 2FD2A 5HATA 5E41A 3PHTA 5HP1A 1VBXA 1TL4A 1T0TV 3KDOA 2WVBA 1U24A 2H1YA 1G1XA 2QL9B 1MW7A 4FF2A 2C2KB 2IVFB 2ZJRQ 1OJ4A 3RW6A 3EICA 3HHKA 5MLCV 2UU9F 1W26A 3P4UB 4Y34A 4CP5A 4QPTA 5CYQB 2VQEJ 2ZZTA 3FSIA 1J5EF 5EN1A 4IDKA 5H9EK 2WHOA 5B7WA 1NHKL 2WVCA 3CCZA 4YUDA 4ITSA 3SSSA 1V3ZA 1VBZA 1S1UB 3VVUA 2YX1A 3V6JA 3DN9A 1RLDA 4A4JA 3ZZUA 2V8GA 1BLUA 3OUYB 5KT5A 2HVZA 3L7OA 3TEGA 2ASLA 4B9LA 3MM5B 3OT9A 1MWQA 4RUCA 1RU1A 1C0TB 3GIRA 4QYZK 2FYXA 4K2JA 4LFAJ 3R97A 3KKFA 2M4MA 2RUGA 5ETRA 2QLFB 2OEMA 4TU7A 2AYGA 3PIPQ 3LF0A 2HPUA 2D9OA 1SQEA 2QA1A 3M8SA 2V68A 2QYCA 5EUHA 2VONA 3CT9A 2XZTB 1VQLS 1YBAA 1AUSL 3OFGA 4ZVGA 2L9WA 3BYRA 3CDWA 2COLA 1RXOB 3DDIA 3LAMA 2AYEA 2XSFA 5ETQA 2G0CA 2Q6CA 1NB2A 4OJ3A 2VFRA 4ED4A 3PIOQ 3W5ZA 1RWUA 2ZDPA 5CYQA 3CD7A 1LK5A 4C8OA 2J0XA 1OIAA 2PFFB 4TYAA 2HBZB 3QYYA 3W7BA 5JVHQ 5L38A 1FE0A 4CM0A 2QLJB 4FVCA 1PBAA 3T5JA 4C97A 4DBQA 1S1UA 2V2QA 2XM3A 3QPIA 2ZBIA 2XI3A 2R2RA 1IKXB 2XMMA 2B56A 4OZ3A 1HNWF 2E29A 3S1TA 1TL3B 3OUYA 4LIWA 1ZZFA 5A8WB 2B51A 4JYAF 2ZM6J 1GMWA 3MM5A 5IXUA 5GAEI 4LR9A 2PA8D 1C0TA 4ZPTR 4ZLPA 3HDSA 1L3KA 4C8LA 1HHTP 3AOAA 1A0OB 4NRTA 4C98A 3J7ZT 3ISZA 4KT0C 1M90T 2GW8A 2KJWA 1TMMA 3M8RA 1M5OC 4ETXA 1FJGJ 4EO8A 2VFUA 4C8KA 1KWMA 2RF2A 3BKFA 1LQ9A 4QU7A 1S1WB 5IQQA 3DXSX 4LSNB 2Z2MA 3G4SS 4ZVSB 2AU0A 4NLRA 1J27A 4ZJQA 2V9KA 3KG0A 1NK4A 1Y9OA 2CZ9A 3U1NA 4C0OC 4X4SA 2BJEA 3HPOA 3I0SB 2YWKA 4ZPBA 4NCGB 3RZAA 3O44A 1XMBA 3PACA 5KOXA 2DHHA 3A12A 2MYFA 3VQTA 3T5LA 4HHUA 1HD0A 1IKXA 2J7KA 4DV5F 4AUKA 3S6EA 2W2NP 3PRVA 4X66F 1TL3A 1RK8A 2CPIA 1VQMS 2HLUA 4NLSA 3M2RB 4QWEA 5J2NB 2VOOA 5HQ8A 2HAFA 3A4TA 1NHVA 3AD9C 1RP5A 2NSBA 2XMUA 1F6TA 2GV1A 5AJ3J 4I7FB 2RS2A 4LF4J 1TKXB 5D15A 4L76A 2VODA 1VS3A 1HBOB 4DR5J 5HQMA 2OKQA 1Q7YT 3KNAA 3ZZTA 5LSLA 2NYHA 3GPAA 3T5KA 1S1WA 3JAMU 4A8SA 2YKOA 2YPYA 1GX5A 2WONB 1RWOB 4ANEA 3M30B 4X4UA 1FWKA 4K4YA 1MLAA 1VFJA 2M2BA 1GMWD 3M9MB 2RH3A 3B82A 4F7VA 2R4FA 5HL7Q 2A10A 2AF6A 1U8SA 3MR7A 2KYZA 1VR6A 3K17A 1OY8A 2DHGA 1MMNA 4Y65A 2ZKTA 3I0SA 2P2CB 4C4WA 4NCGA 1H72C 3PKMA 3ENVA 3VF0B 2FJEB 3AHPA 5HVGA 4QJVA 5DDPC 5AXLA 4FYVB 4D3GA 3K8VA 4FYDA 4X4PA 1TUWA 2CQCA 3GMGA 3RRKA 2DXFA 1U7LA 4V19X 2D3OR 3M2RA 3A8KA 5J2NA 1RKJA 3GIMA 1QSSA 4JI4F 2M8DB 2L41A 1XNRF 2LMIA 3CSKA 4I7FA 2LA6A 2O3DA 3PRDA 1TKXA 1QY7A 1HBOA 3H98A 1WHYA 5DLFA 3O2IA 1X4AA 4DN0A 4NZ0A 1YRXA 1PAEX 5L9NA 4DR2J 4LT6A 1Q7LB 1KLMB 2DH7A 1IJFB 1S4FA 1VQNS 5KT4A 1HPZA 2B4UA 3HHNB 2BW7A 3M30A 2O01C 3OLAA 1N5TA 5HROB 3GSIA 2D3ZA 1SL0A 1FVSA 4JI8F 4ZVFA 4RW4A 5C24B 2G0JA 5KFGA 1ZH5A 1TKDA 1CQNA 1S97A 4GKKF 5FLXU 4F4AA 2RDDA 4I67A 3B4MA 1UP1A 4DUYJ 2DGVA 2XZWA 3MMBB 4W90B 1SKRA 5LMNF 2XBPA 4N8NA 4USMA 3WIVA 1XMQJ 1H0HB 1AW0A 2GC8A 1BQXA 1ZM9A 1D09B 3HFVA 3BV8A 1T3NA 3SEOA 3PW7A 5CH7B 3PVXA 2MKHA 1NK8A 4DUZF 5H9EJ 4F3MA 4YN3B 1HIYA 1HA1A 4PYDA 2LQ9A 5J1EB 4HDGA 1NSAA 2VB6A 1CC8A 2WSFC 4EBCA 2MSTA 4DR1F 2CWXA 2NXUA 4KGVB 2VFVA 3BYPA 5DRKA 5M2RA 4A8OA 2CQHA 4J9LA 4X4VA 4HL9A 4M95A 4QYZJ 5K8NA 2MTLA 5KG4A 3HVRA 1XC9A 5HROA 1CULB 4EFAC 2B4VA 3WHIA 1GFWB 3PYEA 2CPDA 3BN4A 4B3TJ 5C24A 1S1XB 2RIJA 2DHXA 1FXRA 3GWCA 2FVRA 2X3DA 2DISA 2CADA 3IG1B 1Y0HA 2DNMA 3SSQA 3BN7A 3I55S 1URNA 3KXDA 4AQYF 3OJUA 3MTKA 3THPA 1S6PB 3AJ1A 3OL7A 3M2UB 1HWUA 1NJXA 2KDOA 1YHQS 4FBUA 1RWXB 5D0HA 3B4DA 2WRMA 3IP0A 5GAEU 4NMXA 4J9NA 4M5LA 1FRMA 2DNQA 3ADAC 3BGOP 4YY3F 3ET6B 1RWNB 5BXIA 3DYAB 5J1EA 1KVKA 2D3UA 3A3NB 2VKRA 1NDLA 2F40A 1Q5VA 5IQ6A 1RISA 3PW0A 3T41A 2FHJA 1LXJA 1ZPVA 1X4DA 2EVZA 1GMVA 3BH7B 1FO1A 5EWFA 4AL7A 3X1LB 4DPTA 2DR8A 1G3OA 3KFWX 2MQOA 5BYSA 4K4SA 5KFXA 2OUGA 2GJIA 4X64J 4GMKA 4YDDB 2W2PP 3QGIA 1CULA 3M7VA 4OMFG 3NAHA 4ZP6A 1YX2A 1F9FA 2LCWA 1S1XA 1H7XA 3Q0AA 3CCSS 2CQGA 1LEOA 1JLCA 2OTJS 2DRBA 2UU9J 4KTQA 2JSXA 2DR6A 1F2HA 1K0VA 1S6PA 2HBQB 3PX4A 2JEIA 2X1FA 4CLSA 1JJ4A 4L75A 2E1RA 3UE2A 4I1TA 3J7AN 2HHXA 5MAOA 4HACB 2GNKA 4DR4F 2DXEA 1KFDA 2W9AA 3PFOA 5KG1A 5DDOC 1BY9A 3FUYA 5DM7Q 2LQ5A 1Q8KA 4QQBA 3G2XA 2OPRB 3DYAA 4TNOA 4DFJA 1DFDA 2F7VA 4RBUA 3D68A 4DCOB 2ZEJA 3RB3A 3POTB 4EZ6A 1M0SA 2ZH1A 2P6TA 4NEZA 4O0IA 4JI1F 2XEXA 3CJQA 3FCVA 2W4PA 3KUEA 3QGGA 3OXLA 3DRSB 4PCQA 2FB0A 3RRGA 2RQ4A 4FPRA 4DR3F 5D4LA 2R8HA 1UW4A 2BJ8A 4DS4A 5EWEA 1XIQA 1HMVB 2EPIA 5I4MA 5E0OA 2FHJD 5J2MB 1H73A 1RHRB 2OMLA 2CIMA 5CQGA 5AE2A 4QWCA 2ZKUA 3LP2B 5D3GB 4DLEA 1P1TA 4X4RA 4ZVHA 1BUXA 4HACA 5HANA 4W92B 2WW8A 4DQRA 2PMWA 4PG8A 1JJCB 1HBUB 1RABB 2RDIA 5BYQA 4O44B 4CO1A 5D0RA 1WF2A 4NX9A 4URSA 4KPYA 1FJEB 1TAUA 2OPRA 3CD5A 2WSCC 3H42A 3FZBA 3CC4S 4ZLJA 5LJ3Y 1SKUB 1HNWJ 5CHCB 2FJDB 4QW9A 4MYUA 1HKAA 1FT8A 2HHWA 2MQLA 3EXYA 3H0PA 1RT6B 5E33A 3DRSA 1S7HA 4PR6A 4CO0A 2PE8A 4HR2A 4FXWA 3SCKE 3CUNA 4WFXA 2RAQA 3R27A 1HNIA 1V3RA 2AX1A 4PG4A 1Z4UA 3BPDA 1BQNA 1HMVA 4TXSA 1FXLA 1DLOB 4ECVA 5C42B 3M05A 2KM8B 5J2MA 2CYYA 3GE9A 4ZP8A 4B17A 4UF4A 4C7QA 2JDJA 3LP2A 1F5BA 1TAQA 4UQGA 5D3GA 2DNHA 1X4HA 2YH0A 3OR2B 3GIKA 1TL7B 4EWTA 1HBUA 2DNYA 4RUHA 2XULA 3HSGA 5JVGQ 1MMLA 3MHYA 4USKA 1NDCA 1S79A 3ZZOA 2MQMA 4TVAB 4IFVB 1SCJB 4U95A 3MPWA 2OSRA 3MCMA
chains in the Genus database with same CATH topology
3I4HX 1JJ2R 1S6UA 4A46A 4GO5X 2UV8A 1M5KC 2VG5A 2AV5A 3HKZD 4RKUC 2RRNA 2PI4A 2KZZA 2VD3A 3CCRS 1YG0A 3T3FA 2IBKA 1R7IA 1SIWB 2W7AA 3PEHA 2DGTA 3DLKA 3CO9A 1TKTA 2H5EA 2CQ4A 2VH7A 3G96A 4LMZA 3VALA 3TVKA 4RX6A 5CA5A 1RT2A 4KAIA 5EHHA 1RT7A 1FNOA 1IXKA 2B9WA 3V6DB 4FXVA 1RT3B 4Q0BB 2BRKA 3UR0A 1ZM2A 3ENWA 4DWIA 2R8JA 4CTAB 2V2KA 3V2UC 3JAMY 2W9CA 3DLBA 3NL0A 5E7OB 3CCVS 1QE1B 3EUNA 3GFYA 1S10A 1QAIA 4OI1A 1IJEB 3MR3A 1KVIA 1FESA 1TQLA 4ZKAA 2QA4S 4DL7A 5KFVA 4MK7A 2RQKA 4O3RA 4NXNF 4DF4A 2XSJA 3L7PA 4KJIA 2ZNYA 1VIOA 3AA9A 3WDOA 1H2VZ 4BDPA 3CVKA 5B0GA 5CYJA 1RT6A 3TI0A 2MZSA 2AJ1A 4IRKA 5KG6A 2DNOA 1FE4A 4HI1A 3KLHA 4LQ3A 4TLQA 2BW2A 5T14A 1S9EA 3M1VB 5KFMA 2Y1RI 1ZAVA 3DXBA 4OX8A 3NCPA 2VZ9A 1R43A 4UUWA 4PPDA 5K14A 3BGFA 3D0HE 4FBTA 1S6OA 2YNGB 3HHLD 4DLGA 1Y00A 2M3DA 2FHOB 4WXOA 5AE3A 3KWMA 3EYZA 1RTDB 2FVQA 2JLGA 4Q8EA 1U26A 1WELA 2NS1B 1HBNA 5CCMA 2PD1A 4XAKA 1V6HA 3QGHA 1X5SA 1HARA 3BGRA 3MEKA 4F3QA 3R5DA 3PKYA 1DLOA 5C42A 2MGZA 2EG1A 2DHSA 5E5NA 5ITHA 1LW0B 4ELVA 2RILA 3Q8QB 3VZHA 1N88A 1SUQB 3D1QA 1NH7A 1Q78A 3O3LA 4JUZA 4ZCIA 5CXTA 4WK1A 2QLWA 4QIGA 4QWAA 1HR0F 1FVQA 1P9QC 1ELOA 3F44A 3CCJS 5A2QY 1IKYB 2RQCA 1TV6B 3MM9A 4O4GB 2ZM6F 2YWHA 1NZAA 4UUXA 4FF1A 2HMIB 1XR6A 5DQIA 2IYGA 3KK1B 4FF4A 3R1HA 3BF4A 3LOUA 2EBEA 1JLFB 2PT0A 1WTFA 3RYLA 1VQ7S 4OX6A 2QV6A 2ZVSA 1TFWA 3MFIA 2HAIA 2HFOA 1BC6A 2CPZA 1UFWA 4PUOA 2VOPA 1NB7A 5B09A 3MM8A 4IFYB 2HNZB 5KAKA 2QIFA 3I5CA 4IFVA 4HDHA 4DSFA 4CH0S 2ERRA 4CO4A 3LAKA 2PMHA 3UFCX 1H98A 1FRJA 3MWBA 3LUYA 2GIRA 1FJGF 3CJKB 4G1QB 4N76A 2QT7A 4WKYA 1KS2A 3FEXB 4NLGA 3FJ2A 1JKHB 1BWEA 3DGPA 4PXEA 4DSKA 2HYIB 4IH7A 1Z2LA 2EFGA 5IS2A 5KT6A 3FNNA 2E5IA 5AXMA 3V6DA 3H2LA 1U25A 1RT3A 1L3VA 3ULHA 2RRAA 4Q0BA 3RR8A 4JV5F 1K73T 4MK9A 2B5JB 3UD3P 3TVYA 4CTAA 2FVSA 3RR7A 3DI6B 4HT5A 1GXUA 2GHWA 4MMOA 1JLCB 1QE1A 3TYTA 4YQWA 2X1AA 1GT8A 3VR1A 1YVFA 2UZAA 4KQZA 1N6QB 3DU5A 2XHWA 1ZETA 1SV5B 4MAKA 4P6QA 2CVEA 2MKCA 4J9RA 3T19A 2K7KA 3VTIA 1KFSA 1U45A 1TK5A 1N5VA 3CIMA 1X7VA 1T8EA 1FCAA 2M0GB 2BA9A 2ZUGA 2CFXA 3M1VA 1KOHA 5DO2A 2M88A 4AL6A 2DR5A 4KB7A 1U6ZA 4QCLA 2VPZB 2YNGA 3OTBA 4H4KA 3ZZZA 2BVZA 2KI2A 1DTTB 1LFWA 1RTDA 4RW6B 2AYMA 3EZUA 1MWYA 2Y0SD 2OP5A 2PIIA 2B9XA 2KYXA 4KHMA 2DT9A 4DSJA 4KHPF 2ZZNA 2R2UA 1CQMA 3OPKA 4NXMF 1A7GE 2QMXA 3QJLA 3CE8A 2BQUA 2J9DE 2L3MA 4A47A 4PRFA 4ECSA 4L6V3 2LA4A 2K3IA 3HVWA 3KNGA 3H2VE 5G4DA 1QTMA 4NLTA 2E1MC 4RW9A 2NR0A 1IN0A 2JJ4D 3DRRB 3OJSA 3T9NA 1HW9A 1LW0A 2NLWA 4YDXA 3TA0A 1SUQA 3MDFA 3GFXA 1YJVA 4OZ0A 4WK3A 2DNGA 1OSCA 2AGOA 1B0TA 3TX8A 5KG3A 3D1OA 5A0YB 2E66A 3KHRA 4QW8A 1IKYA 2CQ0A 1TV6A 5ADZA 2FLNA 3N9UC 3U1MA 3CXCR 1OPZA 1YRTA 4I6YA 3KK1A 1ZOTA 1VK3A 4NLPA 4OZ5A 1JLFA 3OTOF 4ZA1A 2Q1LA 2B6AB 3CMES 3N5BA 4DL0C 4IR1A 3NNHA 3QGPA 2K7JA 4OQJA 2D7SA 2P9CA 4OIXA 2GQ2A 2M7SA 3I32A 1T03B 1S76D 2HHVA 4IOCQ 2LXIA 1E6VB 3SQGB 4GO7X 4IFYA 4ED7A 1R27B 2HNZA 1K9MT 2C28A 2EBGA 2XMKA 3LP1B 1JX4A 4ECRA 2UXBF 2CZVC 4LF4F 2MKSA 2C3MA 5KFTA 1U1RA 3DRPB 1REVA 1QLNA 3SDEB 2LLZA 2O67A 2AJQA 3ENQA 5CYMB 1FK9B 2QA2A 4DR5F 1C2PA 3OVBA 3QWPA 2RT3A 4EYHB 1YJWS 3QIDA 2V0NA 4G1QA 2JX2A 3SMZA 2XMJA 3MD3A 4HI2A 1FDAA 1JKHA 2HVIA 3I4PA 4ZHRB 2NREA 2RS8A 3M8QB 2FVCA 4Q8FA 3OTCA 4C2MA 1JIHA 3ZZYA 2ZE2B 3UDLA 2OPPA 1DQAA 3KK3B 4JI3F 3H8YA 4N41A 4OJHA 3GFZA 4LFBF 1UJ5A 3HHDA 5KFOA 2FJWA 1B0PA 2B5JA 4R0JA 2BE2B 1DTQB 3DI6A 2BM1A 3IR7B 2WTFA 2K3KA 2LVWA 3NP5A 1QVFR 1IQZA 4IG3B 2W7OA 2GO9A 4NCBA 2E5HA 2VA2A 3GG1A 1KR4A 2KKHA 2V4RA 2FUG9 1N6QA 4DQIA 1F60B 1NJYA 1B64A 1SV5A 2Y1JA 4IR9A 5CD4H 2UVVA 3PRBA 1SIZA 4IO9Q 2V8DA 3PR4A 3T1HF 4NLYA 3J7YU 3K8WA 5LT5A 4TKTA 2I38A 2ZITA 2O1PA 1IKWB 5LSRA 3T1YF 3UDCA 3W3SA 4BWJA 4H4MB 3BREA 4R0EA 4F67A 4M94A 2DNZA 4QZVB 5DM6Q 2DCLA 4ZP9A 1NKEA 4V19J 4OV1A 1WWHA 3LO3A 1DARA 4X84A 4F50A 3DRXA 1X4FA 3ZZ0A 3THVA 1V3SA 2KXFA 3N5FA 3MPYA 4RNFA 1UFLA 5D4PA 1T7PA 2J9CA 4ILMA 1UVLA 3SCJE 4ATNA 2DIVA 2E5JA 1DTTA 4URGA 4RW6A 2XB2D 1Q16B 1ROFA 4C3LA 1EETB 2RSQA 3RAXA 2FLLA 2BOPA 4RNHA 2WOMB 1TK0A 1BD6A 1SXLA 1L3SA 3ICLA 3FFIB 1A6LA 3CD0A 4RW7B 2VQFF 3SYZA 4Y28C 3HMJG 1X4CA 2Z2LA 1TL1A 2X3GA 2MB0B 2HG4A 4AYBD 3DRRA 1NO8A 3S01A 3FQLA 4NMLA 1KVJA 2QEXS 2K1RA 5F0WA 3U27A 4OHYA 1YJRA 2DHAA 5A0YA 2CPXA 2KT3A 2HQ3A 2JZ5A 1ZTWA 2J6TA 4PKDB 5D77A 3MR6A 2ZH8A 3KLVA 2XS7A 4KSEB 3K5MA 3PO4A 1R31A 1WTBA 2AYBA 4LSLA 2B7CB 2B6AA 2D74B 4DL5A 2U2FA 4XDDA 2VPXB 4ZK7M 3HZEA 3KHGA 4ZPVR 3H4BA 3RBEA 4N47A 5L1KA 1T03A 2NUHA 2CQPA 3IRXB 2R7WA 1E6VA 2I8EA 2J9DA 4N77A 3SQGA 4DV0F 3R5AA 4M8LA 1Q79A 3NGDA 2LEAA 3LP1A 3V4MA 4OZJA 1S99A 3QMQA 1PGZA 2ILZA 3K2YA 3GILA 3DRPA 3C2PA 2MHEA 4Q7AA 3GR0A 1Y3JA 3SDEA 2DO4A 3CC2S 1Q81T 5CYMA 1FK9A 2KHDA 2M9KA 1UETA 3J7A1