1RTHB

High resolution structures of hiv-1 rt from four rt-inhibitor complexes
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
436
structure length
420
Chain Sequence
b'SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title High resolution structures of HIV-1 RT from four RT-inhibitor complexes.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 109
structure length 420
sequence length 436
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rthB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rthB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rthB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rthB03
3KK1B 4Y2AA 1FKOA 3Q8QB 1TQLA 4NCGB 2HNYB 4TY9A 3H40A 4F4YA 4DG1A 2YNGB 5J2QA 2YKMA 3DOLA 4YP3A 3PW7A 5F8NA 3T1AA 4M95A 1MMLA 4R5PA 4NLRA 5KG7A 4RNOA 4H4OB 3VQSA 1QAIA 4K4SA 1S1WA 3KK2B 2QV6A 1RYRA 1FKPB 4RU9A 5KFBA 3DLGB 3H5YA 1RT6A 3UQSA 4TYAA 1TP7A 5J2MA 3NKYA 1S9GB 1OS5A 5KFLA 4R0EA 2R8IA 2IBKA 4RZRA 5EWEA 3QGIA 1LW0B 1RT7B 1TV6B 1RT2B 3FQLA 3E01B 2BQUA 4URSA 5L9XA 4DEZA 2OPQA 1REVB 4RW9B 3D5MA 2XC9A 5FDLA 3M9MB 1YVFA 3SI8A 4WXWA 3NAHA 1S9FA 1UWBA 1RA7A 1RDRA 3I5AA 4ZP7A 5EWFA 3CJ3A 4Q8FA 1VRUA 2D3ZA 1RTDB 2WTFA 4EEYA 3D28A 3IG1B 3MR5A 5D3GB 4H4MA 2R2UA 3CIZA 3GILA 4ICLA 2JLEA 3TQ1A 4NLPA 2W8LA 3QIPB 1S97A 4NLOA 2R8JA 5KFNA 2RF2A 5EUHA 4M94A 4DL7A 4ECUA 1HQEA 1T03A 2UUTA 3JYTB 1RAJA 2FVCA 4IG3B 3CWJA 4J9QA 5C5JA 4X2BA 1C1BA 5F8GA 5KG6A 4IOBA 1SUQB 4ZVFA 3IS9B 3QLHA 2XI2A 1CSJA 4K4XA 1N6QB 1R0AB 2V9WA 5KT2A 2I1RA 3ITHB 3DM2A 3HVTB 2FVQA 1DTTA 5KT7A 2QE5A 2AGQA 4QWCA 2FVPA 2HNDA 3QO9A 5K14A 4H54A 3KLFB 3KK3B 3DLEA 3LAKA 5KFJA 4MKAA 1RT1A 1S6QA 4QPXA 1RTJB 3Q8SB 3LAMA 5DGAA 4PUOA 2BQRA 4O4GA 2ZE2A 1IM4A 2R2SA 5HLFA 2XWYA 5KFVA 3V6JA 4RW7A 4NRUA 2BE2A 2FJXA 1IKXB 2ILZA 2IMWP 5C42A 3DI6B 4KSEB 4KV8B 4MFBB 4WE1A 3CO9A 1HPZA 4PQUB 1JKHA 3MTKA 3EPIA 5KFOA 3KJVB 1TL1A 2VG7B 3QZ7A 3KHGA 3T19A 2R8HA 1SH3A 2WOMB 4YMEA 4RUAA 2FLLA 2IAJA 5CYQA 3TAMB 3ICLA 1W25A 1S1UB 2F8EX 3HVAA 3V4IB 3CJ4A 2HMIB 5C25A 3CJ0A 4NLGA 4RW4A 3MEEA 3RB3A 2YKNB 4ECQA 1QUVA 3BSCA 1N48A 4ECZA 3KHRA 3SFUA 1LWFA 2DPJA 3DYAB 3N6NA 4FBTA 1GX5A 2IJFA 1RT4A 3LP1A 4F4XA 3GIKA 2R2RA 2C2DA 1RT3B 1IKVA 1J5OA 4WYLA 4QW9A 2FJVA 3V6KA 5HBMB 3DMJA 3PW5A 3IGNA 2AX1A 4F4ZA 4DL2A 3FRZA 4EBEA 1C0TA 1SH0A 1HNIB 3T5KA 1RTHA 4R8UA 1MU2A 2I5JA 1JLFA 3G6VA 4K4UA 1S10A 1JLGA 3GV8B 3KHHA 4F4WA 3KOAA 4RW6A 3I0RB 4TN2A 4ZHRA 2UVRA 4JV1A 5J2NB 4MIAA 2ASJA 2ASDA 3PW4A 1LWCB 1LW2A 4IKAA 2OPPB 4ZVGA 1S9EA 1FK9A 3KLHA 3Q8PB 2D3UA 3M8QA 5CYMB 4IQXA 1RTIB 5EDWA 4IG0A 4Q0BB 1DTQB 4ECTA 3KLGA 3H5SA 2OPSB 4IFVA 4FS1A 4QWAA 5DQHA 3DLKB 4KKOB 4KO0A 2VG5A 3E51A 3BGRB 4G1QA 2HWHA 1IKYA 2W8KA 2BR0A 1N5YB 2JEFA 2XI3A 4ZPAA 2BQ3A 4MK8A 1QE1A 4O3QA 3BSAA 1JIHA 3DRRA 4QWBA 1JLBB 2RKIB 5KFKA 5J1EA 1C0UA 1TKXB 3C6UA 4O44A 4XPEA 4YR2A 4TQRA 2W7OA 2E9TA 3FFIB 3MECB 3JSMA 1Z4UA 2ZD1A 1FKOB 1TL3A 3ISND 2HAIA 3PW0A 4KAIA 2WK4A 2FVRA 4DG1B 3BREA 5J2QB 2YKMB 3DOLB 3BQ1A 1RT5B 5F8JA 4R5PB 3QZ8A 4ED6A 1HMVA 1BQMA 2RDJA 4TLRA 1S1VA 2AGOA 3KK1A 1S1WB 5KG2A 2C2EA 2B5JA 5JUMA 4TYBA 3CDEA 3H5UA 4K4VA 3QGHA 5J2MB 4NLQA 4RUCA 4G3IA 4RNMA 5KFWA 3GIIA 4ED0A 5I42B 1T05A 4O3OA 3M8PA 4ZMMA 3MR6A 4EBDA 4U7CA 2D41A 3UR0A 1JLQA 2W9BB 3KHLA 5HROA 4F50A 3KLIA 3KLEA 1EETA 1WNEA 3KNAA 1N56A 4KFBA 3DLGA 2OPQB 1S1XA 5KFSA 5DG7A 5FDLB 4O4RA 3OSNA 2BANA 4Y2CA 1UWBB 2AGPA 1VRUB 3OL6A 3QGGA 4ECXA 3IN5A 3MR3A 4H4MB 3NGDA 2YNHA 4ICLB 2IM0A 4ZP8A 2WCXA 2J6SA 2RF2B 2B6AA 4QWDA 3V81A 2VG6B 4O3PA 4RNFA 3DRPA 2ZKUA 1HQEB 4IH7A 4LQ9A 1T03B 4KBIA 4MIBA 2IM1A 3Q8RB 3OSPA 1JLAA 3H2LA 4ED1A 3MEDA 3MEGB 4RW8A 1ZETA 1C1BB 1ZTTA 5L1LA 2OPRA 5KG3A 4WFXA 5F8LA 3RBDA 3KMSA 3EPGA 3QLHB 2JEJA 2E9RX 2IC3A 4NLVA 4WFZA 3PHEA 4EYHB 2V4RA 3GV7B 3QIDA 3BR9A 2ASLA 3DM2B 3V6DA 1EP4A 1DTTB 1QAJA 4ECSA 2BRLA 4J9SA 4JV0A 1TKZA 2HNDB 1S6PA 4I7FA 5K14B 2WRMA 4Q43A 3DLEB 4ZPCA 3IRXA 4TY8B 4K4YA 1HNVA 1RT1B 1S6QB 5DG8A 4K4WA 4LQ3A 3H59A 1S0MA 2FVSA 4PUOB 3LALA 4O4GB 3MFIA 3GIJA 2ZE2B 2YNIA 4TQSA 5HLFB 4JV2A 4I2QA 3PZPA 3PR5B 4RW7B 1S49A 2IA6A 1TVRB 1NNDA 5KFUA 1T3NA 2BE2B 1N4LA 3DOKA 4ID5A 5C24A 4WE1B 1HPZB 4IFYA 1JKHB 1TL1B 3BSOA 3N6LA 4J9LA 3H4BA 1IKWA 1S1TA 1T94A 3PVXA 4URQU 2IAJB 5CYQB 1HQUA 2WONA 4PWDA 2RDIA 4IH5A 3H4DA 3RAXA 2IM2A 1IKXA 4EO6A 5KFYA 4IDKA 3I0SA 3NAIA 5C25B 3NBPA 4RW4B 1K1QA 3MEEB 1DLOA 2W9CA 3H5XA 4EBCA 2GIQA 1XR6A 1BQNA 1GX6A 3LP0B 5KT4A 4YR3A 2ILYA 4HKQA 1LWFB 4NRTA 2J6TA 1C2PA 3CJ2A 1RT4B 3LP1B 1S4FA 2HNZB 3RB4A 3LP2A 2DPIA 1IKVB 4LSNA 4I2PB 5HP1A 1J5OB 3BSNA 4ED2A 4ZP9A 3OL8A 1C1CB 3DMJB 4XO0A 2C22A 1C0TB 4GC7A 2XCAA 1VRTA 1RTHB 2YNFA 2JC0A 4KE5A 3SFGA 4R8UB 4IR1A 4Q8EA 4B3OA 1MU2B 2I5JB 3H98A 2XGQA 2JEGA 4QW8A 4J9PA 1SV5B 4RW6B 4LSLA 3UDLA 5L1JA 2R2TA 2VA2A 4ZHRB 1I6JA 4NZ0A 3NMAA 5KG0A 2FLPA 4Q44A 3GIMA 3MFHA 3UPFA 3CDWA 5KFTA 5J2PA 1S9EB 3KLHB 4K4TA 2UVVA 3I0RA 4IR9A 1JLCB 3C6TA 2O5DA 4EYIB 5KG1A 5KFDA 5DQGA 1LWEA 4IFVB 4KB7A 5KFXA 2B43A 3M9OB 2ALZA 4KO0B 2VG5B 4NYZA 4G1QB 2CJQA 1IKYB 1RTIA 4ECYA 1QE1B 3DRSA 3MF5A 2W7PA 3DRRB 5J1EB 1C0UB 1KHWA 3C6UB 4O44B 2C28A 4O3SA 5I3UA 4QWEA 5DLGA 4MH8A 3JSMB 3BJYA 4ZVEA 2XCPA 2ZD1B 1TL3B 1ZTWA 1TKTA 3PW2A 1JLEA 1HYSA 4YR0A 1KLMA 4Y3CA 5F9NA 4NLUA 3V6HA 4WYWA 4NCGA 1TKXA 2HNYA 3CJ5A 1HMVB 5F8IA 1BQMB 1RT6B 5F8MA 2YNGA 2W9AA 1S0NA 1S1VB 3HKWA 4DL3A 4H4OA 2B5JB 2J6UA 4YQWA 4ZPDA 3ISNC 1XR7A 2EC0A 1RT5A 3KK2A 4RNNA 1FKPA 1T05B 3DDKA 3M8PB 2OH2A 2IM3A 5KFAA 3HHKA 4WZMA 5KFEA 1JLQB 1S9GA 5HROB 3KLIB 3KLEB 4O3NA 1EETB 3FDSA 2AQ4A 1S0OA 2JEIA 4KFBB 1LW0A 2GC8A 1RT7A 1S1XB 1TV6A 1D0EA 1RT2A 2HWIA 3CDUA 3E01A 2BANB 5I42A 3G6XA 3BQ2A 2AU0A 4RNHA 1REVA 2W9BA 4RW9A 3T5LA 1JX4A 3RBEA 2FLNA 5DQIA 5KFZA 5KFCA 5DLFA 1K1SA 2UVUA 3PR4A 5F9LA 5KFQA 4WXOA 2YNHB 1RTDA 2WB4A 3OL7A 3IG1A 2B6AB 1NHUA 3V81B 5D3GA 4NLWA 4IRCA 3DRPB 5KFRA 1D1UA 3QIPA 3M9NB 4NLSA 5KFIA 1JLAB 3OLAA 1HYSB 3MEDB 4RW8B 3G6YA 4FS2A 1S48A 4ED7A 1JXLA 3I5BA 3JYTA 2R8KA 2OPRB 5KG5A 4K4ZA 4IG3A 2VG6A 2IJNA 2IC3B 3QO9B 5L1IA 2ATLA 3GYNA 3V6DB 3RB6A 1EP4B 1SUQA 3IS9A 3MEGA 1N6QA 1R0AA 3QYYA 4DL5A 1TKZB 4I7FB 1S6PB 5F8HA 3BQ0A 2GIRA 3ITHA 3IRXB 3HVTA 3KLVA 1HNVB 4ED8A 5KG4A 3TVKA 4WFYA 4J9RA 3KLFA 3KK3A 2YNIB 5C42B 4MK9A 4I2QB 2AWZA 1RTJA 4KHMA 3GQCA 3DOKB 4ID5B 4ZVHA 4IRDA 4TY8A 2V0NA 4Y34A 5C24B 2C2RA 4ZP6A 4IFYB 3CVKA 1SH2A 3DI6A 4KV8A 1IKWB 4MFBA 3PJWA 1S1TB 4PQUA 4K50A 3T5JA 1TVRA 1HQUB 2WONB 3KJVA 4PWDB 2JC1A 2UUWA 4MKBA 2VG7A 4TXSA 4FBUA 4IDKB 3IGVA 2WOMA 3I0SB 1U09A 3TAMA 3G86A 4NLYA 3NBPB 3OHAA 2W9CB 2VA3A 1DLOB 1S1UA 1HARA 4KHRA 3V4IA 4JUZA 2HMIA 2D7SA 1BQNB 4O3RA 3T5HA 4XPCA 4OL8A 3I5CA 4IRKA 4URGA 2YKNA 5KFPA 4J9KA 3LP2B 4LSNB 5HP1B 3DYAA 4EO8A 3LP0A 2BRKA 1RT3A 5JXSA 1JLFB 3KMQA 5KFGA 1JLGB 5KT3A 5EWGA 5HBMA 2FJWA 1VRTB 2HNZA 2YNFB 4B3OB 4NLXA 5KT6A 4I2PA 3FQKA 1HNIA 4ED3A 1KHVA 4ECVA 4WZQA 4LSLB 1C1CA 4DL4A 1LW2B 4Q45A 1FK9B 5L1KA 5KFFA 3M8QB 5DG9A 3GV5B 4GC6A 2XGPA 4NLDA 2V4QA 4IG0B 3EZUA 3MR2A 5KFMA 4J9MA 3OLBA 5J2PB 5KT5A 4U6PA 4ECRA 3KLGB 4IH6A 1SV5A 5J2NA 3RAQA 3OL9A 1LWCA 3C6TB 2OPPA 3PJXA 1LWEB 5CYMA 2R8GA 2CKWA 2E9ZA 4Q0BA 1DTQA 3NL0A 5DGBA 2OPSA 3OHBA 2AX0A 5KFHA 1RA6A 1JLCA 2WHOA 1XR5A 3N6MA 3DLKA 4KKOA 4ZPBA 3BGRA 4DL6A 3DRSB 4NLTA 2UVWA 1N5YA 4MK7A 4ECWA 4HYKA 3FFIA 1NHVA 4J9OA 5I3UB 1RYSA 3FSIA 3HVWA 5T14A 1JLBA 2RKIA 3RB0A 1TKTB 4J9NA 1JLEB 3LANA 3MECA 1KLMB
chains in the Genus database with same CATH superfamily
3SSRA 1FKOA 3AA8A 3MI7X 3L4BC 1MN7A 5KG7A 2PGCA 2ZWPA 2BMBA 2N82B 4K4SA 1U26A 5BR8F 3ZZPA 3PM9A 4OJGA 2OPQA 1VC5A 2B7CB 1SI9A 3SI8A 4WXWA 3NAHA 4A8OA 2DCLA 1NZ8A 4H4MA 4WZQA 3TQ1A 4RR5A 4LIWA 3IAM9 2XSFA 1RAJA 2KO1A 1YHQS 2XEXA 5F8GA 2BJ8A 5FD1A 2GFFA 5CAAA 4DR2F 3I4PA 1GH8A 1CSJA 2Q3PA 4EGLA 1UAWA 3NY0A 2CG4A 4OQJA 1IQZA 3MR7A 1YWXA 4ZIWA 2UXDF 1RISA 2ZBCA 3BR8A 3PO4A 3T19A 1V6HA 2J7UA 1NKBA 1U6ZA 1R8HA 2MQOA 1Z1ZA 1HBOA 2R7UA 1M5HA 4DV5J 3ZFVA 3M8RA 4LFBJ 3V6KA 3MM9A 2NREA 2K1RB 4K5RA 2I5JA 1CC8A 4RW6A 2ZJQQ 1FJ7A 3P5BP 1OYDA 3JAMU 5J2NB 3S01A 8RUCA 4OLOA 3PW4A 1M5SA 4PG7A 2VB6A 3BO3A 3DLKB 3BH6B 2VG5A 2QA4G 1W26A 2BQ3A 1UFWA 2LCWA 1P27B 3SXLA 4MAKA 2CZ9A 2CQ0A 4KAIA 3UVJA 1RHRB 4FNHA 4P2MA 2EFOA 5LOQA 4B9NA 3LWMA 1NK0A 2XS5A 3ENQA 4P74A 2Z56B 3HD2A 3QGHA 4RUCA 5L39A 3JSBA 3QT5A 3KNAA 1UVNA 4PXBA 3GFXA 4Y2CA 3TVYA 4CLSA 4F2SA 5FLXY 1M1KT 1HBMA 2YNHA 4HDGA 4OHWA 4PWWA 3U02A 1NK4A 3EVOA 1Z2LA 3H2LA 3C14B 3D0IE 3TX0A 2P6SA 3EPGA 2JEJA 2IC3A 2XO7A 1QLNA 2BRLA 4I7FA 3CCUS 2KRBA 3GJRB 2CFXA 1GMUA 4I2QA 3NMRA 3CE8A 4MMOA 1NNDA 4LF5J 1S99A 1PC5A 1HPZB 4Y00A 4ES3A 4OX7A 3N6LA 3G8SA 5CYQB 2V8DA 3RAXA 3ILOA 5HMZA 3NBPA 4ZVOB 1UEVA 4ZPVR 4MT1A 2HNZB 4V19J 1O8BA 2XMTA 5HMXA 2JC0A 4WPAA 1SV5B 3H8YA 1H6KX 2VA2A 4M1KA 4NZ0A 3NMAA 2PA3A 3MFHA 5KFTA 2DH8A 2B43A 1AFJA 2HQGA 3AH6A 1X31C 4ECYA 3MF5A 3RUBL 1OSDA 2W4CA 3G6ES 1HYSA 2M8DB 1LFWA 1WTBA 3FSXA 1HMVB 3CCZA 1RT6B 1XNRJ 1ZZNA 4B3MF 1SIZA 2OH2A 2KZZA 4CLLA 1EETB 2IBOA 1LXJA 2N3LA 4DR7J 4OHYA 5KFCA 4KIAA 4IYQA 1U7LA 4DHVA 1KQFB 1NHUA 3PRDA 2HLTA 5KFRA 4E8UA 1KTQA 4NLSA 3PEJA 3BO4A 1Q8LA 1YZ6A 4USWA 4I4BA 2HHWA 3ILIA 1SUQA 4KH0B 2NPIA 1N52B 4DL5A 1S6PB 1VFJA 2F4VJ 4OI0A 4ZJOA 5HMWA 1C4AA 2KFNA 3U27A 1QM9A 3CDAA 3UN3A 3E3XA 2W2NP 4AUKA 2GQCA 1IKWB 4QYRA 1M90T 1WC3A 2GZOA 2BJDA 4AYBD 3OHAA 2HMIA 4P75A 4CNYA 3J81Y 4URGA 1EB0A 4J91A 2UUBJ 2FJWA 2LU1A 3PIPQ 4OX9F 4CP5A 5CCLA 1NJYA 2HS3A 4HL9A 3NXZA 5AE3A 2NR0A 3OL9A 2XLIA 3H2VE 1LOUA 4E98A 3VAFA 3VTIA 2LDIA 1U25A 1DY3A 4KKOA 4QIFA 1N5YA 4ECWA 4B9TA 2MLZA 3RB0A 3KK1B 3GJTB 2HNYB 3OR2A 1LEOA 2K06A 2Z30B 3DOLA 2C3YA 1DARA 4RNOA 1QAIA 3RG6A 3MM6B 1RYRA 4A4JA 2QLBB 4ATNA 5KFBA 1PBAA 1LNQA 2AHOB 1P6TA 4QCLA 2BQUA 4DEZA 3QJJA 2U1AA 1RA7A 3I5AA 2IVMA 4L73A 3CJSA 3B78A 2XLJA 3ET6B 3P45B 1HQEA 2QMWA 4LF8J 2MHNA 4A46A 3SDEB 2P9GA 3C15A 1DTTA 2L41A 4MKAA 1KQSR 4NRUA 3TI0A 1U8SA 1Q81T 2C1EB 5CQGA 3KJVB 1TL1A 2QLFB 5GAEI 4RUAA 2FLLA 4FYYB 2VBZA 3OR1A 1OYEA 1I1GA 1R6VA 1IWAA 1ITPA 1LWFA 2ZNYA 1GX5A 3ZC4A 3LP1A 1UW4A 1QJHA 3HPOA 4JI6F 2O66A 5HBMB 1C0TA 3W2WA 5D8HB 1CULB 3KHHA 1FRXA 3TZWA 4IKAA 4B02A 2YTCA 2C2NA 3CCRS 2JOQA 2D3OR 3NNAA 3H90A 2R4FA 5IC6B 4PEOA 4HR2A 2DNLA 1FNXH 3C6UA 2CUYA 3ISND 2QYCA 1NH7A 1HNWJ 2KN4A 4DUYJ 4W4MA 2H54B 5SZTA 1HNXJ 4OFZA 3E8OA 2ACYA 3M8PA 5HROA 1U2RA 1S1XA 1DQ9A 2L9WA 3CCMS 5FDLB 2GJFA 1VRUB 3CCES 4W98A 4LRCA 3CDBA 4YB7A 4QWDA 2VG6B 2CJKA 3JQMA 2IM1A 4DPUA 4WFXA 1W2BR 4KQZA 4WFZA 3BR9A 2ASLA 1WACA 4J9SA 4QYZK 1QTNB 3W5ZA 3TEGA 4RWWA 1WKLA 1S49A 5IT9Y 1FFGB 2D3O1 3A8EA 2FPHX 1EARA 4DOZA 3I9V9 5B0DA 2DR8A 2B0GA 2B9EA 2CJXB 3EXYA 1RT4B 3BGFA 5ETVA 3CPWR 4PABA 2MGZB 2A2CA 4P2XA 1TMMA 1TELA 4DN0A 3HT3A 2JEGA 1VQMS 1JXEA 1Q0NA 1Y7PA 2DYAA 4Y2KA 2GA7A 1JLCB 5SUHA 3C6TA 3HKZD 4U9RA 4A8MP 2WBRA 4B3MJ 3IP0A 2W7PA 3W62A 1WC0A 2AEMA 2ZM6J 2X3DA 1FRKA 1RQ0A 5B0EA 1OQ6A 5AJ3F 1CJUA 1NUEA 1RHMB 3UCZP 4P9SA 2J6UA 1WHYA 1AUSL 3PYFA 1TV6A 2V2KA 2GW8A 4KHPF 3N0VA 1REVA 2FLNA 4USVA 4HT7A 1IBLJ 2V94A 3M1VB 4C3MA 3M9NB 3MEDB 1RWUA 3M8YA 4DFMA 3EZOA 1XNQF 2BJEA 3CCLS 3CJQA 1VHFA 1SC3B 2N7YA 4J9RA 1YJNS 3GQCA 2CPDA 3AOBA 3R6LB 1EHWA 2JWNA 2ZHAA 2UUWA 4EI2A 4DSJA 4OX9J 4C11A 1I5OB 3EGNA 3MM5A 3MM9B 5CHCB 2KKHA 1K8AT 1VRTB 2YNFB 4GRSA 1R8BA 9ATCB 3OTBA 1FA0A 5HVFA 3GFHA 4IH6A 3DNCA 4ETZA 1CS4B 1LWCA 4FYVB 3SQGA 2R8GA 4CO5A 3PO5A 5KFHA 1RA6A 1GAOA 2Y9HA 1YJRA 3BPSP 3L7OA 5ETNA 4J9OA 4X62J 5T14A 2YWGA 4X4TA 3CD5A 1VQPS 1TQLA 3F44A 1Q95G 2ZOFA 3EVWA 4B3RF 1MMLA 1LWXA 5AT1B 1GMWD 1N32J 5LMNF 3AD9C 4DV2J 1RT2B 1E6YB 3BF4A 1WJ9A 1GEHA 4Q8FA 3PX4A 2QRRA 3CC4S 3EXCX 4JOUA 3K58A 2RRAA 2ZHBA 3JYTB 3IWLA 4DSLA 3CXCR 1ZA2B 4I56A 4X2BA 1C1BA 3CUNA 2EFGA 2WSEC 2DHXA 3R7NB 3AAWB 3HVTB 3EGWB 3M8WA 2HVIA 3QO9A 1S7HA 1S12A 5HQ8A 2RHQB 2CPXA 1OO0B 4LRBA 4QJVA 1IM6A 2R7XA 3DI6B 4ZVPB 1RCXB 3KHGA 1SC4B 1NJWA 2BW7A 1ZH5A 4FF4A 1CJTA 3IM8A 1E6VA 5A8RB 2AX1A 2EK1A 1CJVB 5IV4A 3AT1B 3B4MA 2RU9A 1QY7A 4NZ7A 4OZ1A 4JBCA 5E7OB 2PEBA 3L95X 3KLHA 4M8LA 1ZPWX 3TJ8A 2DTJA 2XY5A 3T1YJ 1PC4A 4P6QA 3U1NA 4JI1J 3BGRB 4CO1A 4HT5A 1U1QA 2NZ4A 3DRRA 3HX9A 4JI4F 2LVWA 3R5JB 1HWUA 1VJQA 2HHPA 3KG4A 2VF3A 2IIHA 1AYEA 1YJ7A 4C8ZA 3JB9k 1VQ9S 2FQQB 3W2VB 4ZMMA 1C4CA 3QGPA 4N77A 4YY3F 3OSNA 2I0XA 2DNMA 4Y6IA 3NGDA 4ZP8A 4QYZJ 4O3PA 2DNQA 2GHWA 2FLOA 3POTA 1UP1A 5IQQA 5D4NA 3NCPA 5A2QU 3CJKB 5DG8A 1S0MA 2XNRA 4PUOB 3CCWA 4A48A 2AJ1A 1FX2A 5KTQA 4ZLPA 4ID5A 1X4DA 2MZJA 1QSLA 2OMLA 1EIYB 3G87A 2GVZB 2IM2A 2M0GB 1NEEA 1RHJB 3MAQA 1DLOA 3H5XA 1FT8A 2R42A 4HKQA 3C16A 3LTOA 3UDVA 2QGFB 3ELHA 2DNOA 3MMAA 3DMJB 2UUAF 2Q6BA 2GX8A 3U7JA 4LSLA 3GTYX 2M70A 2UVVA 1KR4A 3R7SB 4LF7F 1F5CA 2BA9A 2R7WA 2QA2A 4OV6A 5EX0A 5B0FA 2PMZD 2VFVA 1TL3B 2V8HA 5F9NA 4QZVB 2YNGA 4HHHA 1FX4A 4PYDA 5A8KA 3I4HX 2RAQA 4KC5A 4A8KA 3LPEA 3K8VA 1XNQJ 1LXNA 2WAQD 4ZLJA 4NYPA 1Q8BA 1JJ4A 1K1SA 1Y11A 3IG1A 3EM1A 3W64A 4FS2A 2R8KA 2OPRB 3BN7A 5HSPA 4IG3A 2MYFA 3M32B 6FDRA 2KDOA 2ROPA 2ZZTA 2VFTA 4NXMJ 3TNVA 3IRXB 2Y1LB 2XHCA 4BHQA 4HDHA 3K8WA 3OR1B 2CDRB 4M5HA 3GR1A 4UOFA 3ETOA 2D1CA 1FDNA 3ONQA 2CJ9A 4JUZA 4DUZJ 1K9MT 4OL8A 1BLUA 4RWXA 1QAYA 1VQ7S 2F63A 2D69A 2J8SA 3KMQA 1FEHA 2NCKL 3SV3A 4DI6A 1L3KA 4B3OB 2RS8A 2OMOA 4ECVA 3D6MB 4FF1A 2G0CA 3ETMA 3GG1A 3HZEA 1OY6A 1WEYA 4ECRA 2L9NA 1VQSA 1PCAA 2OO4A 5G4DA 4KGZB 3NGKA 2E9ZA 3CGIA 4DL6A 3FSIA 3HVWA 1FJGJ 2KHCA 1JLEB 4LMZA 1VJWA 4NCBA 5J2QA 1H7XA 4LF4F 2Y1JA 4H4OB 1PJ6A 3GR0A 1S1WA 1Q79A 3GSDA 4LBPA 2XMWA 3IM9A 1OS5A 1IBMJ 2IHR1 3VF0B 2VFRA 2AW0A 3EICA 3DRXA 4ZCLA 1W7WA 2KT5A 2AF6A 2W8LA 4DQSA 3RRHA 4DL7A 2Q43A 2IRUA 2E7XA 3D1QA 5FIIA 4WCEQ 2VZ9A 3IS9B 4ZVFA 1MLAA 2MPUA 2PE8A 1P1LA 5KT7A 3I82A 5K14A 2V69A 1RHQB 1EKSA 3ENVA 2R2SA 3HF5A 4ERDA 1R31A 3HCXA 4KV8B 1RAFB 2R8HA 2VDIA 2HVHA 1J5EF 4DCPB 3MMBB 3BSCA 1RWPB 2MMYA 3NGTA 5ETLA 3DYAB 3N6NA 3OXLA 2FJVA 2DGOA 1SKWA 2MY7A 1HNIB 4X4PA 2RRBA 3WBZA 1MU2A 4K4UA 5ETRA 3KJFB 2FC9A 2XMUA 4IO1A 2KRRA 4JI4J 2ZUAA 5CYMB 3VAGA 1TUWA 1IVZA 4ECTA 2OPSB 1RACB 2C2ZB 1YRUA 4MK8A 5AXKA 1P1TA 4YY3J 4Y2MA 1VI7A 1U1NA 2FB0A 1Y10A 2H48B 4ZPTR 3CDEA 3M30A 3CB4A 3UR0A 1JLQA 5D0EA 1RTZA 1YJUA 2SXLA 4H4KA 1T95A 2J76E 4DV3F 3QGGA 1PSDA 2MZ1A 4WU2A 3Q83A 1WF1A 1RGVA 4LQ9A 3MM7A 5B0AA 1JLAA 3AB2B 4IO9Q 4J9UE 4UQGA 4USJC 1WEXA 2YX4A 3DM2B 2WRMA 3R5AA 1S6QB 2F7VA 1NO8A 2NXJA 5HLFB 4JV2A 1FVQA 1VQNS 3OXFA 1YZ7A 3ILLA 1S1TA 2IAJB 3H0PA 4U7UD 4EO6A 5D78A 5C25B 2B56A 1TTHB 4Y65A 4J90A 4NCAA 1XR6A 4DPYA 2EFQA 2VD3A 4GVLA 2ZDPA 1BWEA 1YG0A 4LF7J 2C2MB 4QW8A 2V50A 2CNLB 1XN9A 2XZWA 4EK2A 2C3PA 3W63A 1MMDA 5EN1A 2DNPA 4IFVB 3JS9A 1KP6A 2HURA 2JSXA 4OZNA 2QFJA 1IKYB 2E5HA 7FDRA 2HZAA 1D9FA 4CO2A 3D4JA 4H4KC 3JSMB 2ZD1B 5LXRA 4Y3CA 4WFNQ 4Q2MA 1FRMA 4J5OA 2VJUA 3NCQA 2J9CA 2MXYA 5HVGA 2B9WA 4I0WA 5JMNA 3OJSA 3E01A 3GMGA 4RW9A 4LSZB 3EGVA 5DLFA 1Y9OA 1VIOA 5F9LA 4WXOA 1RTDA 3D9BA 4NX9A 5RUBA 3V81B 1FDAA 1SVDA 5B0BA 3HHNB 2U2FA 4IUFA 3QO9B 1R0CB 1EP4B 1B7YB 1U49A 2KHDA 4OV1A 3ITHA 1HNVB 1HIYA 4JYAF 4HHUA 3KK3A 3GJQB 1AB8A 3TOQA 2D74B 5HN0A 5EX3A 1URNA 2DGWA 3D6HB 2DGXA 2NQPA 1ZPVA 4EZ6A 1HWIA 3TAMA 1FWLA 1S1UA 2D7SA 2GVDB 2ZH8A 5KFPA 4RJVA 3I31A 2BRKA 3FQKA 3B82A 1NZAA 3J80U 4GC6A 3EZUA 5J2PB 1ZAVA 4YB5A 5GAHU 1DFDA 2A6MA 2AJ0A 2HBRB 2CKWA 5ETMA 2GMJA 2GAGC 1YI2S 4L6V3 3PX6A 5L9NA 2ZJPQ 3CCVS 3PRBA 1NU4A 4FKYA 3MUMP 1F3VA 1TL7B 4F4YA 3T1AA 1V3SA 3WHIA 2IYIA 1X4BA 2VC0A 3I55S 2DR9A 4TYAA 1TP7A 4B9SA 1AZSA 2R8IA 2D9OA 5DDPC 2GGPB 3RBZA 1UWBA 4EEYA 2LYVA 3CIZA 2OTJS 4OYBA 2RF2A 1XWLA 1O51A 2VH7A 3L3CA 3S7RA 1SPBP 2FVPA 4QPXA 1JK9B 2BQRA 1JWWA 2L08A 1U8WA 2FJXA 2ILZA 2IMWP 4LF6F 1FFWB 1FKAF 2RJZA 3HULA 5CYJA 3ICLA 2F8EX 3H25A 2HHUA 3CJ4A 3QSYB 3TVZA 2YKNB 1HLWA 2XMVA 1PKUA 4JV5F 2EVZA 2MKKA 4B9VA 3FSYA 3PW5A 3IGNA 3MAAA 1KFSA 2RILA 3WQPA 3FGVA 4KGXB 1JLFA 1CVJA 2E5LF 1F1BB 1JLGA 4FYWB 1V3RA 3EZ5A 5J1NA 4JI7F 3BKFA 2ZH6A 5B09A 2GHVC 4OYXA 4DV6F 4DR5F 4O3QA 2W7AA 4USIA 1JNRB 3PW0A 2ZITA 2QIFA 1H73A 4CLUA 4PR6A 2RHSB 4DV3J 2PIIA 2EBGA 4ZITA 5D15A 3UCGA 5J2MB 4M5NA 1NK6A 1U24A 4ZJQA 3MR6A 4L74A 1Q7LB 2YWEA 2BANA 4DU8A 4DJBA 4ICLB 1F5AA 2AMCB 1S5ZA 1XEZA 5B08A 1KS2A 3BGLA 2KVIA 3PKYA 2NUHA 2Z2ZA 3GPAA 2IVFB 4CLKA 4EZ9A 3A8IA 4OYMA 2ZE2B 2X3GA 5IV3A 1NPPA 3FBCA 1WI6A 1N4LA 4CT9A 3ZZYA 1WC6A 1XIQA 1L3UA 3H4DA 2RDIA 4F0KA 5ETPA 3I0SA 4MTPA 4C3LA 4WP9A 4RW4B 4PG8A 2W9CA 3CCTA 3J7YI 1T8EA 3G96A 2E5JA 1N34F 2RIJA 1V5IB 3UN5A 3RB4A 1IKVB 1EQ0A 2HYIB 2ZHOA 2WVEA 1RTHB 1YGYA 2MZRA 4BS2A 3P3DA 2R2TA 4DZ6A 4ZHRB 1FF2A 1FTRA 1I6JA 5LSLA 1UWAA 4Q44A 2VOOA 3I0RA 3AA9A 1NB7A 1RU1A 3KUGA 1YITS 2IPOB 1H38A 1NSAA 4DLEA 1MMNA 4A8YA 1T7PA 1WDDA 3M8SA 5K8OA 1XMQJ 4DSKA 1UCNA 3UE2A 3JTOA 3TARA 2WVBA 4PKDB 4NA3A 3PIOQ 3BM7A 5A0YB 3NGSA 2XZTB 3CDUA 1UVIA 2IA0A 5DDOC 3K17A 3T5LA 1M0SA 3CW2C 4F3OA 3PR4A 5KFQA 1BE4A 5GMKa 2VPXB 3D67A 1RLCL 2DY1A 3QRQA 2DB1A 1X0FA 3M2UB 4GO7X 4DBQA 1S79A 2AKWB 1TKZB 4B9UA 3K5MA 2CRLA 2J9DA 3TWZA 2RVJA 2WSCC 3IRWP 1MSWD 1UVMA 4K50A 1FRHA 1SC1B 2WOMA 1U09A 3G86A 3IMQJ 1WEZA 3M8ZA 2I6WA 3W8GA 2K7KA 4ELVA 4LSNB 2B9XA 3CJ8A 1RT3A 5EWGA 1K0VA 3HVRA 4I2PA 2YWFA 2J0QD 4KJIA 4PG5A 4C9DA 2DRAA 3CMAS 4Q2LA 4MYUA 2J0WA 2H5EA 1T0TV 1TK8A 2B4VA 2GO8A 1SKUB 4QIWD 2OPPA 3PJXA 3P4UB 3R9LA 1B0VA 4Q0BA 2RUGA 2X1AA 2M9KA 4K0KJ 4PG4A 1NHVA 3QJPA 2CYYA 1RHUB 2HGNA 4Y2AA 1F9FA 4NCGB 4MYTA 4TY9A 3H40A 2YKMA 3KXDA 2YXLA 5G0RA 1S9GB 5KFLA 1X4CA 2ZOGA 4ZN3A 2XQCA 2CPZA 2PA8D 2EW9A 3A3PB 5IQ6A 1SJ3P 1IR1A 4ZP7A 4UT4A 3MM7B 4GKKF 4WK1A 2M4MA 4RX6A 4F4KA 1HWJA 1WC5A 4CT8A 2DK2A 1JJCB 4Y2IA 2F9DA 2K3KA 3CWJA 2GMHA 4DLGA 3OQ2A 1VS3A 1U1MA 5KT2A 2V2QA 1RWKB 1N8RT 3DLEA 3LAMA 3WC2A 1I94J 3WZ0A 1H2TZ 3WIUA 1Q5YA 3R6GB 3V4IB 3KTQA 4JI3F 2CPIA 1B99A 4ECQA 1X4EA 4EU0A 3SFUA 4JI7J 3KJNB 2UXBJ 2YWWA 4P72A 4X4SA 2G1HA 4LF2A 4F4WA 3OVBA 2W24A 4FF2A 1HBNA 3A4TA 1S9EA 1FK9A 4C8OA 4IG0A 1DTQB 4U7UK 5HO4A 4AL6A 3E51A 1FVSA 4UY8T 2HGMA 2XI3A 5HQLA 1QE1A 3MWBA 3P49B 3OV7A 2RKIB 4TQRA 4CIOA 2W2MP 5T7LA 3QNWB 2G0IA 3FEYB 1F5BA 3BQ1A 2OEJA 4DS4A 3ZO7A 3AQOA 3ILJA 5A6PA 4JI2J 2CPHA 2XO6A 3NEKA 2AGPA 3MPDA 3OL6A 3KUEA 2CPYA 2IM0A 5F3ZA 2WCXA 1MNEA 3U1MA 1NKEA 4QIEA 1T03B 2HEKA 2AZ3A 4ED1A 3HFVA 1MG7A 3BGOP 1TAUA 3BBBA 3V6DA 4FXWA 4NEZA 2WW4A 2HNDB 2OELA 4ZLLA 1RT1B 5IM0A 3C46A 4M5LA 1N34J 3LALA 2YNIA 4TQSA 5CXTA 4EFAC 3Q2SC 2BE2B 4PXEA 2MZQA 3H4BA 4TU9A 1RAEB 1HQUA 3NAIA 4OI4A 1RK8A 4LBIA 1Y00A 2VJVA 1RSCA 1NDCA 1VQ6S 1FO1A 5GAHI 2FY8A 4J9PA 5L1JA 4LIRA 5LSRA 2I2YA 3GIMA 1GT8A 5LL6d 5KG1A 2LEPA 3G2XA 1LWEA 2CQPA 1SB6A 3DGVA 3QAEA 4XAKA 3D0GE 1RTIA 2Z58B 1KVJA 4M5JA 1BD6A 3ZTOA 2CJBA 3CC2S 2VKRA 4YR0A 3BDPA 1F9HA 3HT0A 5F8IA 4DR6F 1S1VB 3R1HA 4G1IA 2HK2A 1PJ5A 1VBZA 3KK2A 3GONA 5DM7Q 3KUHA 2CZ4A 4O3NA 3WX8A 2ZDOA 2R7VA 4A8XA 4ZVTB 1SCJB 2VFSA 5KFZA 3JSYA 1R8AA 2O3DA 4F8RA 5F0WA 2DNKA 1U0HA 3DRPB 2DD8S 3CEDA 4C97A 2KM8B 5BYSA 1GXTA 1S48A 5KG5A 3C66A 2FHKA 1UFKA 2XYHB 3RB6A 3MEKA 1R0AA 4WP8A 2MJNA 4UY85 4X64J 2HHXA 1VHIA 3FCVA 2DNRA 2BV3A 3DOKB 4TY8A 2LQ8A 4PPDA 1IXKA 4MFBA 4ZA1A 2J7KA 5CA5A 3WIVA 3G9CA 1WHWA 1R7IA 1CJKA 4N7TA 1WORA 1FTCA 1Y5NB 1JLFB 4RUHA 1JLGB 3OT9A 4OYOA 4DQPA 3J7AN 2FHJA 4FDFA 2V4QA 5KFMA 3UFCX 3J7ZT 4DV5F 2RUSA 5DGBA 4WTOB 2WHOA 2BEFA 3VAJA 4LFBF 4OX8A 4E0DA 4MKYA 3UN2A 4CH7A 3GE9A 4DS5A 1AXQA 2R7OA 3QWUA 4DV0J 3GFZA 2QLWA 1HBUA 2B51A 2MDAA 4RU9A 2QO3A 4DPWA 2LKZA 3MMCA 1TL4A 3J81j 3Q8VA 4YDDB 1HI8A 3AJ1A 3OXGA 2L3MA 4C98A 3OFEA 3THVA 1TUGB 2MZSA 2HHSA 3QLHA 2XI2A 4YEAA 3I32A 4WP3A 4ZVRB 4WIIA 4JI3J 3B6BA 1UA1A 2YVSA 1VMBA 2A0FB 4KR0B 4GVBB 2XWYA 1D3WA 4WE1A 1K0TA 2DJWA 4YMEA 4N5SA 5FLXU 1NK8A 1MROA 1QUVA 1LK5A 2H9ZA 2XSJA 1J5OA 1N0VC 4LR8A 4LF5F 4EBEA 3GV8B 3I0RB 1A6LA 3FK4A 2CQ2A 2UVRA 2HIYA 2DO0A 1M5OC 4CYUB 4LFAJ 1IJEB 4DR3J 1X5TA 3MCMA 4C3KA 2HWHA 2PSZA 4UZCA 8ATCB 4XPEA 1C0UA 4RBTA 3FZBA 1CG2A 4DG1B 3BREA 3EYZA 1X9MA 4RBUA 4LUBA 2VDHA 4FZVA 4XK8C 1FE0A 5JVHQ 1TKDA 1SL0A 2VICA 4F50A 1IUJA 3KHLA 3BDEA 2CVIA 5CZXA 5CH7B 4LRAA 1G3OA 5U47A 3VGVA 2B6AA 2ZBRA 2OSRA 4KBIA 2YBVA 1XNRF 4RW8A 3J7Z5 1Q8KA 1ZETA 2DNYA 3M2RA 3RBDA 3KMSA 1RBLA 3PHEA 2ZNZA 3HD1A 4EBCA 4DR7F 4KTQA 4K4WA 3H59A 2XMMA 3G82A 3PZPA 3R27A 4RW7B 4RL1A 1SJRA 2QTWA 5DDRC 4C8LA 2HVDA 1NLKL 1X4FA 1T94A 1SQFA 4URQU 4IH5A 4PWDA 2OAUA 2DT9A 5KFYA 3EDRB 1GXUA 3Q2TC 4ES1A 1BQNA 2AYBA 1F60B 2F4VF 1CC7A 4U95A 3LP2A 1NPKA 4I2PB 4R8UB 2Y8WA 2XGQA 2WBMA 2H1YA 2QFIA 3TZZA 3TA0A 1BWVA 2VV5A 5K20B 2O5DA 3MUTP 4DR6J 2VL1A 4CQ1A 3A8KA 4G1QB 5E3QA 3J81U 2UUBF 5I3UA 3VV2B 2QL7B 2XTJP 3V6HA 5ADZA 5D77A 5B7WA 3RW6A 1QVFR 4DL3A 3MGJA 2B5JB 4YQWA 1FKPA 2CPJA 2ZH3A 5KFEA 3KLEB 1R8PA 2BDPA 4KFBB 1RT7A 3G6XA 3DRYA 4HACB 4DDFA 2OIHA 1G7CB 3N79A 4ZS6A 2N4DA 3UNGC 3HK2A 3R2CJ 2YKQA 3SZ2A 1ZOTA 2HHHF 1HW8A 1X8DA 3QYYA 1TAQA 2V68A 1NMEB 5KG4A 3W5YA 4OHXA 2ADCA 2AWZA 2K3IA 4ZVHA 4CNZA 3VAIA 4LF8F 4IDKB 2FHOB 2CNOB 3D6TB 2WVFA 3HHEA 5A8WA 4HEA9 4NI2A 3NGRA 1SXLA 4B9LA 5H9EK 3TA2A 5HP1B 1X4AA 4I68A 4U67Q 2ZEJA 2VC1A 1QSSA 3VHQA 4KRWA 2E5GA 4QQBA 1OPZA 2XMJA 1FK9B 1WOPA 5KFFA 4IG0B 1LK7A 2BOAA 1RWNB 1JXVA 2BUNA 1ZYQA 3BZQA 3N6MA 2IJRA 1HHTP 2G13A 4WJBA 5T7LB 2OGUA 2XWXA 2HVZA 2X1FA 4IOCQ 2KG0A 5HAOA 2RQKA 4R5PA 3UD5A 2FJAB 3MD1A 2E7WA 1LW0B 2VBXA 4URSA 4ZCIA 4LF1A 3D5MA 2XC9A 3HM9A 2PEHA 3QRPA 2QT7A 1UVLA 4YB6A 2ZVSA 5D3GB 3QIPB 3NS6A 1HNWF 4DUYF 2AZ1A 4UW2A 4JI5J 3JTPA 1KLNA 1HNXF 2JLFA 3EMTA 1U45A 5KG6A 4C0BA 2VFUA 1QSYA 2MKCA 2OTLS 2V34A 3CO0P 4H54A 5JVGQ 1RTJB 4V1Ak 1IR2A 1O0PA 3EX7B 1VOMA 3HMJG 2UXCJ 4PQUB 2PMHA 2VG7B 1U6FA 3QZ7A 5C2GA 3DOMA 2VKZG 2Q79A 4NLGA 2E1CA 4GKJJ 2FZGB 1BHNA 5I4MA 1D8ZA 3ZZ0A 2DHSA 1FRLA 5F41A 3QT7A 2P5VA 5IWAJ 2ABYA 2DGUA 2OUGA 2OEKA 3W8PA 3QATA 5IT9U 2BOPA 2FJDB 1RTIB 3M7VA 5M2RA 5CCMA 3UDEA 4PXCA 4OYPA 4IOAQ 1JLBB 5J1EA 4J37A 3MECB 1KVIA 5ITHA 1EZZB 4I6WA 5GADU 3QZ8A 2ZC4A 3PYEA 2AGOA 2C2EA 5JUMA 3H5UA 5KFWA 3OTDA 4B9MA 1T05A 2OD6A 4DQIA 1S6OA 3FBEA 4OJ3A 1NRKA 4X4VA 2A18A 2ZM6F 2MHEA 1EQMA 2XBPA 2DXEA 1U48A 2V4JA 2L48A 4HH0A 2HFOA 3GV7B 4F7VA 2AJFE 1N5QA 5IFMA 4TY8B 3LH2S 4O4GB 3R5DA 3IR5B 1IBLF 5C24A 1JKHB 3Q23A 2W4DA 1NBEB 4USKA 1CJKB 2KTQA 3MEEB 1NH8A 2GIQA 2Y1IA 4CO3A 1S76D 1X4GA 2ILYA 3CIMA 3IAS9 4HH1A 1H98A 1QVGR 5D0RA 1UVKA 2QN6B 1GNKA 1B4SA 3UDLA 2V5HG 2QA1A 4PPZA 4OX6A 4IR9A 4KPCA 2AP6A 2BBEA 4AXIA 3JQKA 1GFWB 4KO0B 2ALZA 2DVIA 1H3DA 2DGTA 3DRSA 2FZKB 4O44B 3MPYA 2CJYB 1ZTWA 1TKTA 4M5DB 3CJ5A 4WYWA 1BQMB 1BUXA 1WKJA 3KLIB 1S0OA 5F3TA 2JEIA 1S0VA 3NLCA 4F3QA 2DEIA 1D0EA 3FMBA 4RNHA 2HHHJ 4X62F 2UVUA 2WB4A 2HQ3A 4X4UA 4DPOA 1N33J 1FHTA 1PYTA 1YLXA 2WZ1A 1FEEA 3SYZA 3PACA 2IJNA 4X65F 1N32F 3IFEA 4DV2F 1GTHA 2MTLA 3R7BB 2W01A 5DS7A 2VIHA 5DO2A 1AW0A 1S7IA 2POKA 3S1TA 3KKFA 4KHMA 1U1LA 4IFYB 3CVKA 5H9EJ 3ZTRA 1QDUB 4UUXA 3PJWA 2WONB 4N56A 2YPZA 1G2EA 2CG8A 1NDLA 1TK0A 2NPFA 2XSJB 1CLFA 3ZTQA 4TNOA 2RNEA 2VPWB 2NYHA 3OUYB 3MCOA 3PYGA 4PYAA 1GQEA 4BWJA 2VQEJ 3TAQA 3JQJA 2N3OA 2K1RA 3OFGA 1C1CA 5HK4A 2CQIA 1T11A 3Q89A 4NZ6A 4HI1A 1WUUA 5J2NA 2GIFA 4KH1B 3N5BA 1U4BA 2RB7A 2W2QP 3NNCA 3DLKA 1T9WA 3QWPA 2UVWA 1DURA 2FYXA 5GMDA 3HHLB 1TMJA 2IDLA 1VCTA 4J9NA 1WC1A 1KLMB 2KYXA 2EKYA 3THTA 4P2FA 3Q8YA 3MMJA 2ALYB 3HP6A 1HR0J 4CO4A 2LP4A 1FWPA 3O2IA 2CA9A 3SSQA 4C2MA 2RH3A 2QV6A 2UUCJ 3ZZRA 3P96A 4CI0B 3T1YF 4JI1F 1N36F 3FQLA 4M5KA 4Q8EA 3PY8A 1V3ZA 4ECUA 3QMQA 4AD6A 2FVCA 1SKSA 2QZ8A 1OIAA 4L72B 3C14A 4CTAB 1N6QB 1U2FA 2F4FA 3KLFB 2HPUA 4LVOP 2KZMA 1P9YA 3M6VA 1YJ9S 2FHJD 1NSQA 3DCAA 4DN9A 2BXJA 1HPZA 1UKUA 1SH3A 3AQPA 3VWSA 5CYQA 4CH0S 2ZH7A 3KDOA 4BCAA 1WKKA 1R8CA 3VQTA 2ZJRQ 2P9CA 3D7SB 4CLPA 2R2RA 5HQMA 3M2VB 2HKEA 1F3FA 1ZM4A 4X4OA 3MM8B 1T9XA 3B8HA 1A7GE 4DR1J 2VPYB 4A8WA 1FXRA 2V67A 2BE7D 1KKHA 2RDDA 3Q8PB 2C42A 2PN6A 2MQ8A 2W8KA 2UU9F 1YKWA 4CLYA 1FD2A 3O5TB 2OI2A 4G1PA 2X1GA 2XZDB 3FFIB 3RRKA 1Z4UA 1FKOB 2FGOA 3B4DA 1HMVA 1VIXA 2MZTA 2JHEA 2Z57B 4F67A 1DAXA 1FXLA 1EETA 1WNEA 4WIQA 2OPQB 1KRPA 5KFSA 1MWZA 2XS7A 3TA1A 3LUYA 3MR3A 2J0XA 4DL0C 4H4MB 3CNQP 2Q1LA 3MOJB 2RT3A 2P9EA 3O6QA 2LQBA 3WX4A 2F65A 4LREA 2OJ3A 4ELTA 2HGLA 5H1SV 2YY3A 1S6PA 1SQEA 1IJFB 2QL5B 1RBAA 3D68A 2QA4S 3VGUA 3F41A 2WVDA 1IKWA 1IKXA 3DKDA 3F73A 1K1QA 5H9FK 1HBOB 4NXMF 5KT4A 4Z7CA 2JZ5A 4HTIA 2KH9A 3L9ZA 4P2SA 1CQNA 4BC7A 3HHLD 2E1RA 2JDJA 1QAXA 2XCAA 2KFYA 3PHTA 2CWXA 2I5JB 4RW6B 3MD3A 2BW2A 2W4PA 2EPIA 4CCHA 2XB2D 1NJZA 2FLPA 4DUZF 3CCQS 1IN0A 1H2VZ 2DISA 4LFCJ 1URRA 2VG5B 4FVMA 2M3DA 3CSKA 4DV7J 4TKTA 1HNZF 1VQYA 1GTEA 3HJFA 3UVJB 1TKXA 2HNYA 1S0NA 2R7RA 2P6TA 3ISNC 5K5MA 4LVNP 2QX0A 3CF5Q 2C3OA 4NWBA 2LXIA 3MCNA 2J9DE 3HO1A 4X65J 2HWIA 2W9BA 1FJGF 1HBMB 2YNHB 4ZLNA 1S72S 2HIQA 3ET6A 1RI7A 2IC3B 1HHSA 1WSRA 4LF9J 3SDEA 1IBMF 2HFZA 4I7FB 4FPRA 4I2QB 2IY5B 2E1PA 1VK3A 1VYAA 3CJRA 3MXHP 2KJVA 4Z7YA 2H4WB 2LXUA 4A47A 3KG1A 3KJVA 3A13A 7AT1B 4YDXA 3NBPB 2EG2A 4N8NA 4KHRA 4ETXA 3TO8A 2AJQA 5MLCV 2Z2LA 1VQOS 2ZKTA 4PZVA 2IRXA 2YKOA 5HBMA 3C2PA 1SL2A 1YJWS 2LA6A 1CULA 1HD0A 2O01C 2DGVA 3RAQA 4U6PA 3ZZOA 3W1YC 2PMWA 2CPEA 2KYZA 1RXOB 3LGHA 2RQMA 3F0NA 1APSA 3TUPA 1WSVA 1DQAA 3GJSB 4HHJA 4CM0A 3MURP 1N36J 1HYSB 4ANCA 1Q86T 4QU6A 4M95A 1X7VA 2G4BA 1ACMB 5AXMA 3W60A 3M6WA 4K5SA 3JXOA 4FP9A 2CNKB 1BXNA 1L3SA 3M9MB 5FDLA 1AROP 3CJ3A 1VRUA 2Q66A 4ILRA 4UOGA 3O1LA 2RRNA 2UUTA 4DPTA 4C8KA 2M2BA 1SUQB 2YH1A 3PNIA 2AGQA 1GMWA 5ETQA 5LXYA 1AFIA 1A9NB 4FF3A 2QLXA 5C42A 1Q78A 3CO9A 3OFHA 2N7CA 3W65A 1VLOA 1DRZA 1W25A 2HMIB 3NP5A 3RB3A 1N48A 4ECZA 3W3SA 2O67A 2M8HA 1RT4A 1RKIA 3X1LB 3T9ZA 2GMLA 3M4XA 2MGZA 1CQMA 4YHHJ 3T5KA 1FNMA 2BE9B 3X3UA 2UU9J 5L38A 1GK8A 2F1FA 3DU6A 3W61A 3LA0A 4PWUA 2Z8QA 2CQ3A 5IT4A 1VQKS 3K5LA 3M8QA 2M52A 4A8FA 2HRTA 3PV8A 4KKOB 1HD1A 4K8RA 1N5YB 1Q5VA 3FMWA 1KQKA 1MN9A 4BWMA 3OR2B 4DMZA 2B3TB 3DOLB 1KVKA 4FPIA 3THPA 2G1DA 2HRYA 4ES2A 3GIIA 4ED0A 4U7CA 4RKUC 4C8MA 2OFGX 2WVCA 2DNNA 4DFJA 1KBRA 2J6SA 2JNJA 3M1VA 1HQEB 5L46A 1B0TA 3MEDA 1TZ0A 1UJ6A 3NOCA 3C15B 3TYTA 4NMXA 1DTTB 4ZPCA 4LQ3A 3SCIE 5H9FJ 4DQRA 2K7JA 4WBFA 2B7BB 3BBFA 1TL1B 3BSOA 2DY9A 2E29A 3DHWC 4DX7A 4X66J 1WHVA 1LWFB 4NRTA 1BMQB 3LP1B 1ZM9A 2R9LA 1YX2A 4ALZA 1C1CB 3RBXA 1C0TB 3W2WB 3MTJA 1VRTA 2YNFA 3R2DJ 3V4MA 1PGZA 3R97A 1HNZJ 4NXNF 2Y0BB 5IS2A 4PCQA 1R27B 5DM6Q 3CDWA 1CS4A 1SJ1A 4KB7A 2AJ2A 4ZVQB 4LR9A 3Q0AA 1WHXA 3KYLA 3O8WA 5LT5A 1KHWA 3C6UB 2LQ9A 2F5GA 4QWEA 3BJYA 2HHVA 2HHQA 4DV1J 4MIWA 2CADA 2YX1A 2W9AA 4TU8A 4ZPDA 3PG9A 1XR7A 3M8PB 2RD5C 2MSSA 5HROB 3UNYA 4ZK7M 1S1XB 2PI4A 1RT2A 1E6YA 1QTMA 1BQXA 2XM3A 1XMOJ 2ZZNA 1FD8A 1UZDA 3L7UA 2Z0GA 5HJXA 1R0BG 4ILLA 4PQAA 3G6YA 2R7TA 1NAQA 3ULHA 3JYTA 4JP8A 1JNZB 3VGTA 3AHPA 3SCLE 3BO2A 5F8HA 1N88A 3PEHA 3KLVA 3HVTA 4ED4A 2EFVA 3GWCA 1YSJA 4AQYF 3BN4A 4F2RA 3B54A 3DI6A 1D9AA 4MJKA 3AD7C 1JQGA 1LV5A 3IC1A 4NLYA 1WI8A 4A8SA 1T9UA 1WD6A 1OJ4A 1A0OB 2ROEA 4USUA 1TFWA 5HI7A 2KT2A 2YWKA 5A8RA 2HG4A 5E3PA 1CJVA 2DHAA 5ETOA 5E0OA 5L1KA 4I64A 4NLDA 1FNOA 5DJBA 1XK8A 3C6TB 3OTCA 3W9HA 2YKPA 2V8PA 2AX0A 4F25A 3BGRA 4FN5A 5HVHA 3CD7A 4MK7A 3LANA 1CJUB 2BZ2A 2A2DA 3Q86A 3UQSA 3NKYA 3W2VA 2K2PA 1TV6B 1RWWB 2HFUA 5L9XA 1REVB 2D3ZA 4RO0A 2PI5A 2X7IA 4ZVSB 1BC6A 2R8JA 5KFNA 3R3TA 4X4QA 4M94A 5HL7Q 2LDYA 3O3LA 5C5JA 2MKHA 4ENOA 5DZ6A 2ROGA 4Q5VA 3CJKA 4RLEA 1H2UX 1NPRA 4KPYA 1FE4A 4PUOA 5KFVA 2VONA 2JRSA 1IKXB 4NEYA 3EGZA 5KFOA 5K8NA 2GVZA 2H65B 4C11B 4CDIA 3FBFA 1ZBTA 2JVOA 3MM5B 3RW7A 3BKTA 2CXEA 2UP1A 4C0OC 2OEMA 3DMJA 3LOUA 4DL2A 2GV1A 3NG8A 2DH9A 2NSCA 3KOAA 2MKYA 2ZC3A 1CEZA 2HVEA 1WOSA 3NWRA 1SJ4P 2ASJA 3G8QA 2ASDA 3CULA 1LWCB 2KG1A 1O5JA 4ID8A 4NASA 3SQGB 3GP9A 2ZH1A 5BR8J 4L3NA 2GS8A 2LXFA 1KTVA 1O6XA 4CZCA 5J1PA 1OY8A 1WG4A 1IWGA 3RGIA 2I8EA 4QWBA 5D4PA 1TKXB 4ANEA 2ZH9A 4YN3B 1TL3A 2WK4A 3EUNA 5F8JA 4AE5A 2RDJA 1FDDA 3OTEA 3LGMA 2V2ZA 3ZNUA 5KG2A 1XQIA 1X5PA 3BH7B 4NLQA 5M2UA 4DR2J 2APOA 1VGYA 2W9BB 3DLGA 3OFFA 4UOHA 5E41A 1XMQF 2HQFA 1KFDA 2UXDJ 2AD9A 3VR1A 3TJ9A 1RU2A 4RPFA 3W66A 1C1BB 2OPRA 5KG3A 3M32A 4OHZA 3SBMA 2E9RX 2FJEB 3IBCB 1XMBA 2CIMA 1U1KA 3DLLQ 3IRXA 3D66A 2LLZA 3EVMA 3PTWA 4W90B 3C8YA 3JAMY 3RZAA 2XULA 3TX8A 3SCKE 4J9LA 3T41A 2LQ5A 1VBKA 1YRXA 1WWHA 4NXNJ 5E3RA 1S4FA 1CJTB 3IWXA 1E6VB 3OL8A 3T6JA 1PAUB 4KE5A 3T6BA 5GMEA 3SFGA 4B3OA 4C4WA 2AV5A 3R1LA 4FKXA 1UEUA 1WTFA 5A6WA 4ANDA 4WKYA 2VBWA 3TUIC 1VK8A 1TFYA 3KLHB 2BJ9A 3BYPA 2DGQA 4EYIB 4CWBA 2GQ2A 3NNHA 2ACMA 2JH3A 2CJQA 4LJMA 5KAKA 3QJLA 3K2YA 3DRRB 1P9QC 5D6GA 1ROFA 1JLEA 2DPJA 2IFXA 4FBTA 3ENAA 3LF0A 2L9DA 2HWTA 3KJQB 4H4OA 1RT5A 3DC2A 2G0JA 2XLKA 1VISA 4K0KF 5I42A 5D4LA 1X5OA 1PYSB 5DQIA 2QL9B 2MB0B 5IXUA 4AQYJ 3POTB 4ED7A 2C3MA 4Y0FA 5L1IA 2PO4A 2M5YA 3GYNA 3IS9A 4EMDA 2GO9A 3BQ0A 2VODA 2J0SD 2CQDA 4WFYA 2DR5A 5C42B 4XTTA 3TJAA 2ADBA 5AXNA 1WDTA 3DU5A 4ID5B 4OZLA 2MJUA 4S0MA 2RSQA 2V0NA 1D8YA 1SH2A 4KV8A 2KVQE 3T5JA 1B70B 1DLOB 1UFLA 1HARA 1VBXA 4AT1B 1CPZA 3C16B 2FGCA 4IRKA 3MMBA 2EKNA 4M5GA 3DYAA 4EO8A 3MMAB 5JXSA 1I94F 3BS9A 1HNIA 4LSLB 3ZTPA 2V8GA 5A76A 3M8QB 3P8BB 3SMZA 3AJ2A 3MPUB 3OLBA 2YH0A 2CDQA 2G2ZA 4Z2XA 3HLUA 5CYMA 1L3VA 2ZBPA 5IZHA 2OPSA 3A12A 4ZPBA 2M7SA 2UXBF 3GYXB 2JLGA 1RYSA 4L3KA 2Y1RI 4G6VB 4OZ5A 2YNGB 3PW7A 2IYGA 5A8KB 4HI2A 4K7QA 4B3SF 2RQCA 3HZGA 3ZZZA 4RZRA 1RZMA 2DIVA 2DRDA 1RHKB 3A3NB 1B3TA 2RMLA 3HI9A 3IG1B 5AXLA 2UZAA 3GILA 1ZM3A 4IG3B 1NSKL 3K0JA 4USTA 2LA4A 3RJMB 4JI2F 3DM2A 5JJBA 2FDNA 2KB2A 5KFJA 3LAKA 3Q8SB 1S6QA 4QR2A 5HLFA 1VLYA 1NB2A 3DDNA 1DHMA 1YTYA 2IAJA 4KGVB 5C25A 3UCUP 2WB1D 4CO0A 2KXNB 4F3MA 2OFHX 5K8MA 4MKVA 4WFAQ 4F4ZA 2QLJB 2XMAA 3G6VA 4EUVA 4TN2A 1PG5B 4JV1A 3VZIA 3R8YA 4MIAA 4KT0C 4IQXA 2DBBA 2AYMA 3KLGA 4IFVA 3N28A 1IKYA 3DGPA 1HW9A 2KL8A 2B9YA 2XY7A 2J8AA 3LPYA 1WC4A 4YR2A 2E9TA 3JSMA 2ZD1A 4DX8H 1SQGA 5J2QB 4N41A 3EE3A 2B4PA 2CZVC 4DX6A 2DNGA 1S1WB 4TYBA 2CVEA 1EJ7L 4RNMA 4LBHA 3L7PA 1KN6A 3VAKA 3BGUA 1N56A 1D9DA 1DQ8A 5ETKA 3PX0A 1PBUA 3G4SS 4ECXA 2V6AA 1PILA 2IRYA 1UA0A 3V81A 1RAAB 4IH7A 5E5NA 5IT0A 1NJIT 1ZTTA 3VVTA 2NXCA 2Y0SD 1EP4A 3DN9A 4ZOSA 2CPFA 3HSZA 4JV0A 5K14B 2DNZA 1K47A 4K4YA 1HNVA 1TK5A 3N01A 1HI1A 2GJIA 4OI2A 3OVAA 1UEKA 3P5TL 4JI6J 5CD4H 1KNZA 1SL1A 2DH7A 3G8TA 4P73A 3MCSA 4N47A 4YB1P 2GVDA 1H0HB 1F2GA 2JFDA 2MLXA 2R7QA 4X64F 4UTGA 3BSNA 2PFDA 4DFPA 3UWTA 2DHGA 3BBCA 5F0UA 4XO0A 2NSBA 3K5NA 2C22A 1ZAXA 2B8PA 3MZIA 1MU2B 3H98A 1FERA 4O0NA 3AODA 3C3LA 2DHHA 2B8QA 3UPFA 4F26A 3I56S 5J2PA 4NYOA 4K4TA 2CQBA 1L3TA 1KQGB 2CJAA 3OJUA 5KOWA 2HLUA 3GSIA 4ZVEA 2DIUA 4C8YA 3BPDA 4CH1A 2A6OA 1TL7A 2R7SA 3AD8C 1NSPA 1RB0A 2ZH2A 3M30B 4RNNA 2OLWA 3DDKA 4WZMA 1W2IA 3HHKA 3IR6B 1JLQB 1HI0P 4AL7A 4R25A 3VAHA 2GGPA 2BACA 3VGSA 1JX4A 3P6YC 3SSSA 3DXSX 2YPYA 4DV0F 2N4CA 5E2QA 1R89A 1JLAB 3OLAA 3FC9A 4V19X 4ZPWR 3IWNC 2EEYA 5BXIA 4ED8A 3HSJA 1J27A 3DDIA 2C2RA 3FEXB 3U1LA 5LMUF 2HK3A 1S1TB 1TVRA 2JC1A 1UZHA 2DNHA 1UETA 4AFFA 2VUGA 3I5CA 1N0UA 2YKNA 3KG0A 2LQJA 3LP0A 3A3OB 3HSDA 5KFGA 4WK3A 1VQ4S 4OJHA 4NLXA 4KGKA 4ITSA 3CC7S 2DGSA 4Q45A 4OYZA 2E44A 4DZDA 4BLGA 4J9MA 1Y3JA 3W7BA 5AJ3J 4BBYA 1UJ4A 3K89A 3D0HE 1FFSB 3TP2A 4ZCKA 4B3SJ 3RTVA 1YDLA 5AE1A 4KHPJ 3A8JA 2FZCB 2QJ3A 5DETA 3Q8QB 2CNNB 3N9UC 3K5PA 1Y5LB 1ICEB 2W25A 4NLRA 2KU7A 1KD1T 4LFAF 4OYIA 2CQHA 4DR3F 1V9OA 2EFNA 3TANA 3DLGB 3H5YA 5J2MA 3MOZA 2IBKA 4R0EA 2Y3YA 2NXNA 3T9NA 3NCRA 3E01B 1RJJA 4RW9B 4QR1A 3BB5A 1YVFA 2E7VA 2P2CB 1RTDB 2E5IA 1X0PA 4QU7A 1KSPA 4U8VA 4ICLA 3UD4P 2I38A 2MQNA 2H51B 5C2CA 3D3CJ 4J9QA 4OHVA 3QT6A 3NGUA 1REGX 2K8GA 1YBUA 3TUZC 1YJVA 2G9OA 4P10A 1H7WA 3TRGA 3ITHB 2FVQA 3KK3B 2EK6A 1Q16B 4FXDA 2XMKA 5MAOA 2ZE2A 1IM4A 4D3HA 4KSEB 2NXEA 1F2HA 1SC6A 1N54B 3TAMB 3PFEA 2G2YA 1S1UB 2HAFA 4OYWA 1G4CA 4RW4A 1HWLA 4I1TA 3J7YU 2X1BA 2Z4PA 1IKVA 2RS2A 5B0GA 3QFHA 1F6TA 1RTHA 1WELA 1RLDA 2FC8A 3QQCD 4ZHRA 5I3QA 3SQOP 3ENWA 3D3BJ 4B3RJ 1LW2A 4ZVGA 4NMLA 5C7PA 5EDWA 2HZVA 2VQFF 5LMNJ 4DR4F 2QYGA 1G6BA 2BR0A 3BYRA 2JEFA 2EG1A 1M5KC 1N5VA 4R0JA 2W7OA 4U96A 3CCSS 4JI0F 2FIUA 2FVRA 3S6EA 1RT5B 4TLRA 5HANA 2A1BA 2AJ4A 1AZSB 1U1RA 5I42B 1VQ8S 4EBDA 3FRYA 1YRTA 5A0YA 1UWBB 1K44A 5GVQA 3VAMA 2RF2B 5GAGU 2E1MC 2WSFC 3G71S 3CD0A 3M2UA 4NLVA 4OZ2A 4EYHB 2V4RA 2OSQA 5ETSA 1TKZA 1LFPA 2FVSA 3RR8A 3GIJA 1OQ3A 1R6YA 1T3NA 1FRIA 2UV8G 3FBBA 2CWKA 8AT1B 1N5SA 1SJFA 2AIRB 1JJ2R 4JB8B 2EC2A 3TZYA 3V2UC 3KDNA 3UI3A 3VCDA 6FD1A 4RU2A 5M2PA 3O44A 4LSNA 4ED2A 2C2OB 1EAYC 3MAAB 3D2WA 4GC7A 4UQTA 4C6AA 4QR0A 2M88A 2DR6A 1M5VC 3PXGa 1EX8A 2MQQA 2B4OA 3E2EA 2HFVA 5DQGA 4USMA 3GCWP 1H72C 1B7FA 2C28A 4MH8A 1YQHA 4BDPA 3NOGA 4NCGA 4WKRA 2XHWA 3HKWA 5A2QY 1OMSA 3HHDA 4OIXA 1M1HA 1S9GA 3TUJC 2NYIA 3FDSA 1UPPA 4UZBA 6AT1B 2GC8A 3OBIA 2BANB 2AU0A 1BY9A 3EJMA 4OI3A 3OL7A 5CZVA 4IRCA 1D1UA 3AB4B 1S6UA 5LMUJ 4K4ZA 4FYXB 3K57A 2ATLA 4L76A 3MEGA 4J9VA 4UUWA 2Z2YB 2HBQB 2UUAJ 4AXJA 2QEXS 2F8MA 5CD4A 1XERA 1CBKA 4JI5F 3I0SB 2DITA 2W9CB 2KFZA 3V4IA 4XPCA 2LEBA 3UO0A 3D1HA 4ED5A 4OZJA 3K59A 4QPTA 3PYDA 1VDHA 3MPWA 4P52A 4ED3A 2UXCF 3IBFB 4DU7A 4DL4A 3H2UB 2DO4A 1UVJA 5KT5A 3KLGB 2BKNA 1ZM2A 4CLWA 4GKJF 3W9JA 4NA1A 3DGPB 3NL0A 1DTQA 2NUUG 4O23A 1MW7A 2MQMA 2BKPA 2RKIA 2GHPA 4B17A 2MLYA 5IWAF 3CT9A 1WF0A 4ILMA 3IR7B 4DSIA 4YP3A 3GYGA 4N8OA 3JSRA 2HZCA 2JX2A 3EWGA 2HBZB 3QGIA 4NA2A 1NHKL 4ZVUB 1ZZFA 4A8QA 1RDRA 5EWFA 5E3CA 3ZZUA 3OTOF 2R2UA 4NLPA 4FNIA 1S97A 1P8GA 5EUHA 2H5IB 1T03A 4DSEA 3AFGA 3QFWA 1RUSA 1NDPA 2LMIA 2HS4A 4IOBA 1U6BA 2MY8A 2I1RA 4P7TA 4CLFA 2HNDA 2LECA 1RT1A 3I87A 3MPVA 3FNNA 3QT8A 1IBCB 2BE2A 2JFKA 1RWMB 3EPIA 2GCFA 3MDFA 2WOMB 3CJ0A 2MQLA 4F02A 5D0HA 5KOXA 5D0GA 3JTNA 3N4WA 3GIKA 1RT3B 4CRJA 2VQFJ 3NS7B 3FRZA 4FVCA 4DR4J 4JI8F 3CD6S 4U8YA 4UOCA 1S10A 3UR3C 3R5CA 1PIEA 1X60A 4P71A 1FRJA 1L5UA 4LF4J 4JI0J 2OPPB 3OVSA 3QPIA 4Q0BB 4FS1A 4HLBA 4QWAA 2BJ7A 3RR7A 1T9TA 4ZPAA 4B08A 3CMQA 5KFKA 4X84A 3CJTA 2HAIA 5D4OA 2YKMB 1S1VA 1HKAA 5G0RB 1YBTA 2V63A 1NXIA 3A1YG 4O3OA 1X5SA 2D41A 3DHXA 2HRUA 3S8SA 3IO1A 3AOCA 2IVYA 3LO3A 4O4RA 3FUYA 1JB0C 1Y5IB 4W92B 1UL3A 5LJ5Y 3D54A 1GXLA 2PC6A 1NK9A 3FEZA 3UD3P 1KC8T 3DRPA 2QMXA 4C8NA 3Q8RB 3PDNA 2GQQA 3NRBA 3LQVA 4L75A 1J5EJ 2A10A 4ECSA 4Q43A 3CMES 3DLEB 2I9SA 2XY6A 2ZWOA 1TVRB 1ELOA 3DOKA 1N33F 7FD1A 5HATA 1PYOB 4LRDA 3SEOA 3W9IA 3M6XA 3I9ZA 2BABA 2VBYA 2R3VA 4D3GA 3GU0A 1UTAA 3RAMA 1GX6A 3LP0B 4ELUA 2J6TA 3BEGB 1JJHA 2YQ1A 4ZP9A 2D9PA 5AE2A 1SIWB 2AYEA 2ZVIA 2KJWA 3RYLA 3AXMA 3ZZTA 4IR1A 3I6PA 1T9VA 3ISZA 5THWA 5KG0A 1HBNB 1S9EB 4O0IA 2AYGA 3UW1A 3VZHA 5KFDA 5KFXA 5CABA 1NDKA 2GNKA 1QE1B 2VQEF 2OD4A 2EI5A 3SV4A 5DLGA 4DUTA 4I67A 1IR0A 1I51B 1FJEB 3L09A 3BV8A 2KM8C 1U02A 1RCOB 2IM3A 5KFAA 2F40A 2HW3A 5HMYA 2NXUA 5K8PA 2QSWA 1UPMB 3BQ2A 1VC0A 4ZKAA 2ATCB 3H20A 4DCJB 3MAHA 1HR0F 1ZAWA 3RRGA 5IC4B 5KFIA 3T3FA 4DXLA 2RQ4A 1JXLA 2YX7A 3ZNJ1 3J7A1 1U2CA 2MKIA 2UUCF 3FZ2A 1Q53A 1XTZA 2J5AA 3PKMA 3V6DB 3ZTSA 2XG8A 5IM0B 3TVKA 2YNIB 4GVBA 4IRDA 1RABB 2DEJA 4KY3A 1TUVA 2C2KB 1HQUB 4TXSA 4ER8A 3IGVA 1FDBA 2X51A 2VA3A 1HHQA 2RU3A 3HFKA 3DFEA 4YOEA 3NWGA 1PAEX 4YS2A 4G65A 3LW5C 2EXUA 3US5A 4TU7A 5KT6A 5B0CA 1LW2B 2QC3A 2ASYA 1Y0HA 3PJ9A 4OYAA 4CYUA 1LWEB 4DFKA 3HSGA 4DF4A 2MKJA 2MSTA 3OHBA 1S59A 2DXDA 4QBUA 1X4HA 1SJQA 4CM2A 1AA1B 4HYKA 2ZBIA 4ZIVA 1OSCA 1R3NA 3QBCA 4XDDA 3DLBA 3TZXA 4DR1F 5EHHA 4DG1A 2VU5A 3OTOJ 1GMVA 3OPKA 3KK2B 5ETTA 4QIVA 5EWEA 4HVZA 5GAGI 4JYAJ 1AUDA 4K59A 1S9FA 2C3UA 3D1OA 2WTFA 4TLQA 4PRFA 2O1PA 3I96A 2HFSA 3MR5A 1U0HB 2JLEA 3CCJS 2DR7A 1OY9A 2VOPA 4ZJLA 1Y4ZB 1OPIA 1VBYA 1U47A 3RU0A 3H42A 1SBRA 2V9WA 1R0AB 3HXMA 4GMKA 2B4UA 2QE5A 2PDAA 2KXFA 5DGAA 2Q6CA 3J80Y 4RW7A 4C7QA 5I3PA 2DXFA 4MFBB 3MTKA 4UF4A 4WFBQ 2OKQA 2JVRA 4RBVA 1ZS6A 4JI8J 2E66A 4OLPA 3QRRA 3HVAA 3AY0A 1EKRA 1WG5A 4F0MA 4DV4F 3NS5A 3D6FB 2XYGB 3TEHB 2FJBB 2KI2A 2IJFA 4F4XA 2OHDA 1T3OA 4OI6A 4OI1A 1SH0A 4R8UA 4PAAA 4ZN1A 3SCJE 4X4RA 1U1PA 4F04B 1M5PC 1DBDA 1HQ2A 2D3UA 2FUG9 1RWXB 5DQHA 4G1QA 4ZDNA 3BSAA 3R5BA 1JIHA 2V2VA 1Q82T 2GAHC 3GFYA 2QMUB 3F56A 4ED6A 1HBUB 2B5JA 3OW2R 1X9WA 4G3IA 2BKOA 2DRBA 4LFCF 3M05A 3MMCB 3KLEA 1HWKA 4KFBA 1RAHB 4DV7F 2CQGA 1RE1B 4WWSA 2LEAA 2G2OA 4HACA 4M63A 2BX6A 2HQCA 3KFWX 2FY1A 2YQ3A 4DCOB 5LJ3Y 4M5MA 4LF6J 2ZH5A 2ZKUA 4MIBA 3OSPA 3MEGB 2HFNA 4LT6A 5L1LA 2UV8A 3QLHB 2AEJA 5BJRA 1QAJA 1KEKA 4K2XA 2HQIA 4TVAB 5BYRA 4JV5J 1NK5A 3PR5B 5KFUA 1F9EB 4OZ3A 4XDCA 4WE1B 3K7RA 2HBYB 5E33A 3SIPB 1RWVB 1YK9A 2E5LJ 4USHA 4N76A 4IDKA 1PJ7A 2LFVA 1MROB 4LF9F 2V9KA 3DLJA 3TQEA 4YR3A 5E3AA 1D09B 4PXDA 3CJ2A 2ZZMA 2XS2A 1VRQC 2A3JA 5HP1A 1J5OB 1RKJA 4DV6J 2XNQA 4DR5J 3T1HF 1ULRA 2NLWA 1DZ5A 4B3TF 1S57A 2DKOB 2HSEB 2RE1A 9RUBA 1N5TA 1KONA 3UDCA 3PRVA 3AXKA 2J7WA 1NM2A 4NYZA 1HL6A 2YKAA 2H4YB 4FXVA 1Q7YT 1C0UB 4O3SA 1I3OB 5LSOA 3WDOA 2JJ4D 3PW2A 4NLUA 1FESA 1IBKF 3QSIA 4FBUA 3AOAA 2EC0A 3VALA 4DX5A 1M1GA 2DCUB 2WW8A 1LW0A 1B64A 2V8VA 4Q7AA 3K5OA 2NZCA 1RADB 1RBOB 3FKBA 1B0PA 1AT1B 4J7CA 2BM1A 1RWOB 1VR6A 1U0SA 2B6AB 1TR0A 5D3GA 3QIPA 3MHYA 2EWHA 3HFZB 4RW8B 3I5BA 4YUDA 3M2RB 2P8IA 4CLZA 3FVYA 1R43A 2GIRA 2OP5A 1RAGB 1WG1A 2FTRA 3G82B 1RTJA 2ZBQA 1YBAA 1KOHA 1G1XA 4ZP6A 4PQUA 5T41A 4PWDB 2CQ4A 4MKBA 2VG7A 1XBWA 5LM7E 3DLHA 4M5IA 1BQNB 4O3RA 3T5HA 1UW9A 1KOOA 3LP2B 1YJTA 2ZFHA 5KT3A 2HNZA 2FHMA 1KHVA 3FJ2A 4I6YA 3GV5B 5IOLA 1T02A 3KWMA 1SV5A 1Q4RA 4DSFA 5K9FA 1SKRA 1XR5A 3VVUA 4YHHF 3GLJA 4ZCMA 4X4NA 5I3UB 2HS0A 1RAIB 1JLBA 3Q24A 3AJDA 3MECA 1J2VA 5F8NA 1H74A 1MWYA 3VQSA 2BVZA 2KXHA 1FKPB 1RT6A 2JL9A 1IQTA 2QSFA 2PT0A 1NK7A 1RT7B 1WF2A 4IQMA 1TU0B 4DPXA 4E2FB 3D28A 2XYPB 4DF8A 4NLOA 1RP5A 5FJ4A 3H7HB 3IBWA 1U1OA 3EDQB 4K4XA 2CQ1A 3DXBA 4QWCA 4DV4J 4O4GA 1JMTA 3V6JA 1DJ0A 1JKHA 2CQCA 2VPZB 5A8WB 4NI2B 2ZUGA 3W5XA 3MEEA 3Q8UA 2VASA 4OJ1A 3KHRA 4C48A 2C2DA 4QW9A 2E1AA 4WYLA 1FCAA 1PO6A 3CTRA 3M6UA 4X66F 2IDEA 4OMFG 2KT3A 3R5GA 1VQ5S 3H5SA 2AT1B 4GO5X 4OZ0A 4KO0A 4LR7A 2BJ1A 1MWQA 4O44A 5DZ7A 2IMOA 4GKKJ 3PCOB 1OWXA 4LRFA 4R5PB 4M5DA 2BYCA 1BQMA 4KYZA 3KK1A 4K4VA 1HFEL 1HA1A 4I6AA 3MM6A 3KLIA 2NS1B 1LKZA 3OD2A 3TW0A 1ZA1B 5DG7A 2YWHA 2Y8YA 3TAPA 1S4EA 4DV1F 3IN5A 1QUPA 1T9YA 4RNFA 1K73T 3KNGA 1TL5A 2F8HA 3N5FA 5F8LA 3QIDA 3ZXWA 1QD1A 2MEWA 3Q22A 5EGYA 3TR5A 3MFIA 2ERRA 2IA6A 3FCHA 1XMOF 4NL5A 4IFYA 1UJ5A 1WOOA 3T1HJ 3PVXA 2WONA 3DOMB 4B3TJ 4DWIA 2GJ2A 3GG0A 1VC6A 5GAEU 1C2PA 2W2OP 3LWLA 3MUVP 2DPIA 3GZ7A 3WC0A 3ADAC 1F0XA 3OUYA 3LGNA 4DQQA 1Q1KA 1FWKA 4WU3A 2MQPA 4F4AA 4YFUA 4I69A 2VHGA 1IBKJ 2H5JB 4RUBA 3M9OB 4KGMA 3C19A 4BC9A 5J1EB 3HHLA 2CAJA 5GADI 2XCPA 3FCWA 2BM0A 1VQLS 1KWMA 2QG9B 4NE9C 2HQDA 1KLMA 4QOTA 2AEFA 5F8MA 2ZH4A 2EFPA 3QAUA 2MKSA 1T05B 1Z2ZA 2EBEA 1FXDA 3IXQA 5BYQA 2PFFB 2AQ4A 3V5RA 2J9EA 3RBEA 4Y28C 1X9SA 1XC9A 4NLWA 1FJCA 5DRKA 2V4JB 4NPOA 4C0HA 1NCLA 2VG6A 1RAOA 2LU2A 1YIJS 4F0HA 4WTYA 4CTAA 4K2JA 1N6QA 4AL5A 4HTJA 1V5VA 4NOHA 2HHTA 1Q8IA 3KLFA 4MK9A 4Y34A 5C24B 3GB0A 4Z37A 4F36A 1UMJA 1NJXA 1BGXT 2BJ3A 4EWTA 2H3EB 5DDQC 2YQ0A 3IA0A 2W1BA 5HJYA 2FD2A 4FYDA 5L8RC 4J9KA 4QIGA 1LQ9A 3GIRA 4XIUA 1XJWB 3M2VA 4CLTA 3PFOA 3MM8A 2F9JA 3HHLC 5DG9A 2XGPA 2ZOMA 3MR2A 1NKCA 3HDSA 1Y3KA 2W2PP 1S77D 2F3JA 4WF9Q 3GCXP 1FI4A 3BKUA 2Z2MA 4P7VA 1JLCA 2PD1A 3DRSB 4NLTA 3HJVA 2COLA 1TKTB 1KDNA 3FFIA 4PG6A
chains in the Genus database with same CATH topology
2EKYA 3SSRA 1FKOA 3THTA 5DETA 3AA8A 3Q8QB 3MUMP 3MI7X 3N9UC 4F4YA 3K5PA 3MMJA 3HP6A 1Y5LB 4CO4A 3T1AA 1V3SA 2W25A 4NLRA 2KU7A 5KG7A 2PGCA 1KD1T 2IYIA 1X4BA 3O2IA 2VC0A 2N82B 3I55S 3SSQA 1U26A 2CQHA 1V9OA 2EFNA 2QV6A 2RH3A 3ZZPA 4C2MA 5BR8F 4DR3F 3TANA 3DLGB 3H5YA 4TYAA 1TP7A 3P96A 5J2MA 3MOZA 3ZZRA 4CI0B 2R8IA 4R0EA 3T1YF 2IBKA 2D9OA 4JI1F 5DDPC 3PM9A 3T9NA 1N36F 3NCRA 3FQLA 2GGPB 3E01B 4OJGA 1RJJA 2OPQA 1VC5A 4RW9B 4QR1A 3BB5A 2B7CB 1SI9A 1YVFA 4WXWA 3NAHA 3SI8A 1UWBA 4Q8EA 4A8OA 2DCLA 1RTDB 4EEYA 2LYVA 3PY8A 2E5IA 1X0PA 4QU7A 4H4MA 3CIZA 1KSPA 4WZQA 4ICLA 3TQ1A 3UD4P 2OTJS 1V3ZA 2RF2A 4ECUA 1XWLA 2I38A 2MQNA 1O51A 3QMQA 3IAM9 4LIWA 2XSFA 1RAJA 2KO1A 2FVCA 4J9QA 1SKSA 4OHVA 2VH7A 1YHQS 2QZ8A 2XEXA 1OIAA 4L72B 5F8GA 5FD1A 2K8GA 2GFFA 4DR2F 3TUZC 3I4PA 3L3CA 4CTAB 1GH8A 1CSJA 1N6QB 3S7RA 1YJVA 2G9OA 1H7WA 3TRGA 2Q3PA 3ITHB 2FVQA 4EGLA 1U2FA 1UAWA 2FVPA 2CG4A 3KLFB 3KK3B 2EK6A 2HPUA 4LVOP 2KZMA 4QPXA 1Q16B 4FXDA 2XMKA 1JK9B 2BQRA 5MAOA 3M6VA 4OQJA 1IQZA 2ZE2A 1IM4A 1YJ9S 2FHJD 1YWXA 1JWWA 2L08A 4DN9A 2FJXA 2ILZA 2BXJA 3DCAA 4D3HA 2IMWP 2UXDF 4KSEB 4LF6F 1HPZA 1FKAF 2RJZA 1RISA 1UKUA 2ZBCA 3BR8A 3PO4A 3T19A 1SH3A 1SC6A 3AQPA 3VWSA 5CYJA 1N54B 5CYQA 3TAMB 3ICLA 3PFEA 1V6HA 1S1UB 2F8EX 2J7UA 4CH0S 3H25A 2ZH7A 3CJ4A 1NKBA 2HHUA 4BCAA 1U6ZA 4RW4A 1HWLA 1R8HA 3TVZA 2MQOA 1R8CA 1Z1ZA 3VQTA 1HBOA 2YKNB 2R7UA 1M5HA 2ZJRQ 2XMVA 4I1TA 3J7YU 2P9CA 2X1BA 3ZFVA 4JV5F 2EVZA 2R2RA 2Z4PA 2MKKA 1IKVA 4B9VA 3M8RA 2RS2A 3FSYA 5B0GA 3V6KA 3MM9A 3PW5A 3IGNA 3M2VB 1KFSA 2NREA 2RILA 1ZM4A 4X4OA 3FGVA 2K1RB 3MM8B 1RTHA 1WELA 3B8HA 4K5RA 1JLFA 2I5JA 1CVJA 2E5LF 1JLGA 1A7GE 1CC8A 2VPYB 4A8WA 4RW6A 2ZJQQ 1FJ7A 1FXRA 2FC8A 4ZHRA 1V3RA 5I3QA 5J2NB 3S01A 3EZ5A 3ENWA 4OLOA 3PW4A 5J1NA 1LW2A 4JI7F 4ZVGA 4NMLA 3Q8PB 1M5SA 5EDWA 2C42A 4PG7A 2VB6A 2ZH6A 2VQFF 5B09A 2PN6A 2GHVC 3BO3A