1RTHB

High resolution structures of hiv-1 rt from four rt-inhibitor complexes
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
436
structure length
420
Chain Sequence
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution structures of HIV-1 RT from four RT-inhibitor complexes.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 109
structure length 420
sequence length 436
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rthB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rthB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rthB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rthB03
2F8EX 1RYRA 4F4YA 2GIQA 4O4GA 3NMAA 2ZKUA 5KG1A 3OSNA 3QIPB 3NAHA 3M9NB 1HPZB 5JXSA 4YR0A 3RB0A 2IJNA 2R2UA 4XPCA 2BRLA 1J5OA 2OPRB 5KFWA 5HROB 1N5YB 3OSPA 4MKAA 3V4IA 3QIDA 3MEDA 1DLOA 3LP0A 4WFXA 1S1XA 4I2PA 3FRZA 1RA6A 5CYMB 5KFJA 4PQUA 3DRSA 1S1VA 3IS9B 3HVTB 3DOLB 2D3UA 2FLNA 4JV2A 3RB4A 4URQU 4IH6A 4RW4A 4QWDA 3TAMB 2D41A 4KO0A 3FFIB 3Q8RB 3PVXA 3BR9A 4RW7A 2AX0A 4FS2A 1RTJA 4J9RA 5KFOA 2YNGA 2WHOA 1VRTA 2XC9A 4EYHB 1DTQB 5EUHA 5KT4A 3M8PA 3C6TB 4ICLB 1T05B 3C6UB 1REVB 4RW6A 3GV8B 1RT7B 4X2BA 3LP1B 4I7FA 3V81B 1S9EB 1LW2B 1JLFA 1VRUB 2BQ3A 4IG0B 4TYBA 3DRRA 3MTKA 2B43A 5DQGA 4Q44A 3H4DA 2RDJA 4Q43A 2RKIA 2O5DA 5F8NA 3IG1A 1HQUA 2WOMB 5HLFA 4KHRA 3SFUA 2XGQA 5K14B 1RT1B 2IC3B 4ZHRA 3KLVA 4LQ9A 3BQ1A 3V6JA 3ISNC 5FDLB 1C0TB 1JKHB 2XGPA 5J2NB 4ECSA 4NLRA 3V6DA 1N48A 3HVWA 2E9RX 5KT2A 4JUZA 2IM2A 2FLLA 1R0AA 2W9CA 4YP3A 2E9ZA 1IKXA 4TY9A 3KJVB 1HYSA 4IR1A 5J2PB 1LW0A 1QE1A 3H5UA 4WFZA 2AU0A 3LP2B 1LWCB 5HBMA 4RW8A 1I6JA 1YVFA 5F8IA 1TL3B 5EWGA 5L9XA 2BR0A 1WNEA 1IKWA 1JLEA 2EC0A 4MKBA 1TKTB 3I0RB 5KFLA 4MH8A 3DMJB 5HP1A 4PWDB 1NHUA 3PR5B 4ECRA 3KLFB 1N6QA 3CWJA 2HNDA 4ZP8A 1TKZA 2W9BB 4MK8A 4NYZA 5C25B 1RT4B 5KT3A 2HMIA 3GIKA 1UWBA 1FKPA 3QGGA 2B6AA 4H4MA 2FVQA 3TQ1A 4LSLB 5I42A 1S4FA 1UWBB 3I5AA 3PJXA 4TY8B 2CJQA 1HMVB 3QGIA 2HWIA 3BQ0A 5I3UB 2ZD1B 2UUWA 1TKZB 1S49A 1DTTA 3JSMB 3NAIA 5HP1B 3QZ8A 3IN5A 4ECVA 4KKOA 5F9LA 5D3GA 4IFVB 3N6MA 3ITHB 1S0NA 1TL1B 2HNYB 4K50A 3M9MB 1KLMA 2B5JA 3G6VA 1TL1A 4I2QB 4KV8B 1FKOB 4ED0A 2AQ4A 2DPIA 5KG4A 2VG6B 3PW2A 1HNVB 1W25A 4RZRA 2C2EA 4IDKA 3GYNA 1JLGA 4OL8A 4TQSA 4IFVA 5D3GB 3DM2A 5C42A 2ILYA 2V0NA 1T03A 4KKOB 1T94A 3MF5A 4J9KA 1IM4A 2ILZA 4J9QA 3RB6A 3UPFA 2IC3A 3H5YA 3VQSA 4J9OA 2C2RA 3OL7A 5HLFB 2HNZB 4RUCA 3IG1B 4U7CA 3IGVA 3RAXA 4KE5A 1BQNA 3M8QA 1S1UB 4Q8FA 1MU2A 3KOAA 2OPPB 3DRPA 1S1TA 2YNHA 3MR5A 3G6XA 2BQUA 4R8UA 1JX4A 2YKNB 4QWAA 4ECUA 3QYYA 3BGRA 4QW8A 2BQRA 1BQMA 2R8IA 4ZVEA 2YNGB 1JXLA 1RT2A 3LAMA 2YKNA 4ECYA 4Y3CA 3KLEB 4ZP7A 1IKVB 1IKWB 1JLEB 3DYAA 4IFYA 3MECB 3MR6A 3IRXB 1RA7A 4JV0A 4ED7A 3PW5A 1C1BA 4KFBA 3T5LA 3KJVA 2ZE2A 4O3OA 4F50A 1C0UB 2AGPA 4EBDA 2C2DA 3HVAA 3RAQA 5C5JA 2FVPA 2I5JB 4WYLA 4RUAA 4TQRA 4Q0BA 1RT6B 5KFFA 2QV6A 3V6DB 5F8MA 4EBEA 2JEIA 4ED3A 4NRTA 3SI8A 3DOKB 3T19A 2WRMA 4ECTA 4MIBA 2FJXA 2VG6A 3HKWA 4ZVHA 4I2QA 4KV8A 1C0UA 3DOKA 2IM1A 1XR7A 3UQSA 5KFPA 1TQLA 2R8JA 3KK2B 5F8GA 3Q8QB 1C1BB 4O3RA 4URGA 4ZP9A 3PZPA 4IH5A 1CSJA 2XCPA 2R2RA 4GC7A 4Q0BB 4LSNA 3T5HA 2I5JA 2OPSB 3V81A 3CJ4A 3KHLA 5KG3A 1IKVA 2WK4A 1FKOA 1T05A 2BE2A 5L1LA 2B5JB 5L1KA 3M8PB 1XR6A 4URSA 4WZMA 2W8KA 2W8LA 4GC6A 1LWFA 4ZVFA 4MFBB 2RDIA 2DPJA 5DGBA 4ZP6A 3JYTA 4NLGA 4RNHA 4FS1A 4ED1A 3NL0A 2R2SA 1S1UA 1JLQB 2IAJA 5J2QB 4WE1A 4DL2A 3DOLA 3BGRB 1T3NA 5I3UA 3IS9A 3ICLA 3E51A 3KMQA 2JC1A 5F8JA 4I2PB 4IG3B 1S1XB 2IAJB 5KFTA 5KG2A 4DL5A 2OPQB 2YNFA 3BREA 3DMJA 4PWDA 4NLOA 4O3NA 1MU2B 3CJ3A 1TKTA 4YR3A 1T03B 3H40A 3M8QB 3JYTB 4Y2CA 4ZPAA 2OPRA 5KFXA 5KFMA 2J6UA 4IRCA 4K4SA 4IDKB 2V9WA 5C25A 4MFBA 5DLFA 2HNZA 1LWCA 5HBMB 4MK9A 1HYSB 3GV7B 2BE2B 2HNYA 4YQWA 4KBIA 3EPIA 4TLRA 1TL3A 1C2PA 4F4ZA 4K4VA 3KLGA 4NRUA 4HYKA 4LQ3A 4EO6A 2UVWA 3KK2A 1HARA 5J2PA 1ZTWA 3HHKA 1IKYA 5DQIA 1IKXB 4NLUA 5DLGA 3H5XA 4ZPCA 4FBUA 1SH3A 5DG9A 1HMVA 3OLAA 2HWHA 4DL3A 4TY8A 1S9FA 1NHVA 5KFSA 4ED6A 2FJWA 1RT6A 4MK7A 2OPQA 2YNFB 4WXWA 1QUVA 1HQEB 2IJFA 3TVKA 2ZD1A 4EO8A 4TXSA 3Q8SB 5KFHA 2ZE2B 4NLTA 1JLQA 4R0EA 3KLFA 3KHGA 4IR9A 2E9TA 3OHBA 4LSLA 5I42B 1S1WA 4QPXA 3H4BA 3CDUA 4H4MB 1RTJB 1SH0A 3DYAB 4IFYB 4WYWA 5KG6A 4K4XA 2HMIB 4H54A 5KFZA 4U6PA 4RW6B 3KLEA 1Z4UA 3EZUA 4NLYA 2C28A 3C6TA 4F4XA 1DTQA 1N6QB 2W9BA 2AGQA 1S6PB 4NLWA 4DEZA 5EWEA 3LALA 1R0AB 2W9CB 2AWZA 3H2LA 4R8UB 4K4YA 3FFIA 2UUTA 1RTDA 3RB3A 4RW4B 4LSNB 1XR5A 3MEDB 4WZQA 4RW8B 5KFNA 2XI3A 4ZVGA 3EPGA 1JKHA 5KFUA 3GIJA 4ECXA 5FDLA 3DI6A 2ATLA 3HVTA 4ZHRB 1EETA 2IM3A 4NLQA 3BJYA 5K14A 2W7OA 3MFIA 2ALZA 2IBKA 4IKAA 1S0MA 3QIPA 3G86A 3KMSA 3PW7A 2QE5A 2RKIB 4K4WA 4EEYA 4ED2A 3DM2B 5C42B 3CJ2A 4IG0A 3H5SA 5KFQA 1JLGB 5KFAA 3GILA 3V6KA 1S97A 4DG1A 4K4ZA 1TP7A 4KAIA 1RT7A 1QAIA 3D28A 3QO9A 3QZ7A 4ICLA 4MIAA 5KFKA 1KLMB 3T1AA 4KFBB 4HKQA 2YKMA 3ITHA 3DRRB 1RDRA 3IRXA 1JLFB 1LW2A 3QLHA 1SV5B 2R2TA 3MECA 4Y34A 1S9EA 2JEJA 2VG5B 4I7FB 1TV6A 3TAMA 3KK1A 4XPEA 3FDSA 1RYSA 2RF2A 1RT2B 1OS5A 3BSAA 2FVCA 4ECWA 1BQMB 1NNDA 3UDLA 1C1CA 2IMWP 1TKXB 5KG0A 1HNIA 5KFRA 2FJVA 4H4OA 5J2MA 5DG7A 1S1TB 2YNHB 4O3QA 2J6TA 1EP4A 1GX5A 2OPPA 3DRPB 4TYAA 2XCAA 2GIRA 1S0OA 5KFBA 1K1QA 4O3SA 1BQNB 1J5OB 1RT4A 3GIIA 3M9OB 4K4TA 3LANA 1HPZA 4EYIB 2HNDB 3GIMA 1DLOB 3LP0B 3DLKA 1RTHB 4ED8A 2VA2A 4IQXA 4NZ0A 3I0RA 4QWBA 1RTHA 3CO9A 4ECQA 3CVKA 3PW4A 4O4GB 3CJ5A 4Q45A 1JLBB 1K1SA 1HNVA 5F8HA 3T5KA 2ASDA 2UVUA 3Q8PB 3OLBA 3BSOA 1JLAB 3KHHA 3H98A 2UVVA 1S48A 2AGOA 3KLIA 2R8GA 5KFYA 4IRKA 1SH2A 5C24A 2CKWA 1TKXA 3E01B 1JIHA 5J2NA 1LWEB 1C0TA 5J1EA 3KK3B 1D1UA 4KHMA 5F8LA 2W7PA 3I5BA 3JSMA 1DTTB 5KFVA 2J6SA 2WTFA 1RT3B 3T5JA 3GV5B 4RNNA 1RTIA 1S9GA 4ZMMA 4QW9A 3D5MA 3OL8A 2FLPA 3PJWA 4QWEA 2HAIA 4IRDA 2D7SA 4B3OB 4RNFA 3RBEA 1VRUA 1TVRA 2B6AB 4JV1A 3QO9B 1U09A 1FKPB 2VG7B 4ZPBA 3H59A 3DLEB 3LP1A 4J9LA 1REVA 3C6UA 4DG1B 5T14A 1FK9A 4KSEB 2BANA 4NLXA 4R5PB 4K4UA 2WONB 1JLCB 3PR4A 2UVRA 4O44A 4TN2A 4G1QA 2OH2A 1RT5A 4ID5A 4RW7B 3PW0A 4KO0B 2XI2A 5L1IA 3CDWA 3FSIA 3NBPB 4RW9B 3MR3A 3MFHA 1S6QA 4PUOA 5DG8A 4QWCA 3LP2A 3DDKA 1QE1B 1LW0B 5CYQB 4G3IA 1S6QB 4M94A 4PUOB 4RW9A 5DQHA 3DRSB 4PQUB 4H4OB 5CYMA 3DLGB 3DLGA 5J2MB 3NGDA 1HNIB 2FVSA 1RT5B 4YMEA 3MEEB 5KT7A 4O44B 2V4QA 4J9MA 4DL4A 1S6PA 4WXOA 4O3PA 5HROA 1N5YA 3I0SB 2I1RA 4NLDA 5KT5A 2JEGA 3N6LA 1MMLA 1RAJA 5KFGA 1RT1A 3SFGA 2W9AA 2ASLA 3CDEA 2VG7A 2WOMA 5KT6A 1HQUB 2V4RA 3KHRA 4KB7A 5KFDA 1S1WB 1SUQA 1SUQB 3CIZA 4IOBA 4R5PA 1QAJA 3CJ0A 5KFIA 2BANB 2JEFA 3V6HA 4FBTA 2WB4A 2ASJA 1HQEA 2JC0A 4F4WA 4NLPA 4J9PA 1TVRB 3I0SA 5JUMA 3PHEA 4YR2A 4EBCA 4NLVA 1VRTB 1S9GB 3GQCA 2GC8A 4DL7A 2IA6A 3UR0A 4J9SA 3KNAA 5KG7A 1EETB 4M95A 3DI6B 3KK3A 5J1EB 5EDWA 1JLAA 4O4RA 3MEEA 3OHAA 3KLGB 2C22A 3NBPA 3OL6A 1S1VB 5C24B 5L1JA 1RTDB 1KHWA 5KG5A 1KHVA 4WFYA 2IM0A 3IGNA 1GX6A 4Q8EA 5KFCA 3V4IB 3FQKA 5CYQA 3OL9A 3DLKB 1JLCA 1N56A 2D3ZA 4NLSA 3KLHB 2AX1A 2R8KA 1FK9B 2XWYA 1JLBA 3KLHA 3I5CA 2VA3A 5DGAA 4ID5B 3ISND 4RNMA 4G1QB 4B3OA 2WONA 3G6YA 4IG3A 3BQ2A 3FQLA 1RTIB 4ZPDA 3N6NA 5F9NA 1RT3A 2FVRA 3NKYA 4J9NA 3RBDA 3DLEA 1C1CB 3LAKA 4WE1B 2YNIA 3MEGB 5J2QA 2R8HA 1N4LA 1S10A 1D0EA 2WCXA 1EP4B 4RNOA 1LWEA 2BRKA 4DL6A 4RU9A 4IH7A 4NCGA 1ZETA 1TV6B 1ZTTA 4ECZA 5KFEA 2VG5A 1SV5A 3QLHB 3MR2A 3QGHA 5EWFA 1LWFB 2JLEA 4NCGB 3BSCA 2YKMB 3KLIB 4Y2AA 4XO0A 1IKYB 2RF2B 3KK1B 3MEGA 2YNIB 3E01A 2OPSA 3BSNA
chains in the Genus database with same CATH superfamily
1YJ9S 1NO8A 3HFVA 1UVIA 5ETKA 5JJBA 1X5PA 3TOQA 3NMAA 1HWJA 3NXZA 3W61A 1CJUB 3MOZA 3CCWA 2BKNA 2BJ3A 5KG1A 3OSNA 2NZCA 3M9NB 4DXLA 2O1PA 4YR0A 3RB0A 2VOPA 2UUBF 1CG2A 2H54B 5LSRA 4NASA 2QJ3A 4KC5A 2BRLA 3C14B 1IJFB 2MGZA 5LXYA 4LSZB 5D0GA 2HFZA 3TA1A 2V69A 1FRXA 4AFFA 2HFSA 2EBGA 1D3WA 3NY0A 3TP2A 1OQ6A 1DLOA 4RUBA 2HHXA 4EUVA 3BV8A 5H9EK 3UNGC 4PQUA 3GMGA 1S1VA 1D9AA 5D0HA 5K8PA 3HVTB 4NEZA 4ZIVA 2XM3A 1PGZA 2FLNA 2OD4A 1U26A 2J9EA 1NPPA 3QJLA 3E2EA 3GJSB 3ZZYA 4ATNA 4IH6A 1WD6A 3IBCB 2D41A 4USVA 3FFIB 2HVZA 3GE9A 3PVXA 1UP1A 2AX0A 1RTJA 2IMOA 3D6TB 2FJDB 2RVJA 3OXFA 4ZS6A 2XC9A 4EYHB 4CNYA 3C6TB 4ICLB 1Y00A 1T05B 3C6UB 3JQJA 4RW6A 1CJVA 2KHCA 2O3DA 1GMWD 2A1BA 3R7BB 4I7FA 3TEGA 2BE9B 1Y0HA 2MSSA 4PR6A 2W2PP 2XMAA 1H74A 2MMYA 2W4CA 2BQ3A 1GQEA 4IG0B 4TYBA 2LU1A 4UF4A 2B43A 4JI5F 2KZMA 4K4ZA 4OLPA 1WHVA 2GQQA 2RDDA 3VALA 3PRDA 3QWUA 3EGZA 2ZZMA 1C4AA 3IG1A 2F9DA 2E44A 3A3PB 2K1RB 5K14B 1RT1B 1IUJA 3D6FB 3ZZZA 2BBEA 4PG8A 4HH1A 3MMCA 5DDPC 3S1TA 2B7CB 1VQ8S 3TZYA 4G1PA 2MKIA 1NPKA 2IM2A 5EX3A 3RW7A 5DJBA 4LRCA 1VQMS 2E1RA 4DLGA 2DR9A 4DS4A 4OI2A 5CZVA 3KJVB 4IR1A 1WF1A 2ZKTA 4WFZA 2A2CA 3LP2B 4XK8C 4F3OA 4RW8A 3FCWA 1OYEA 2PD1A 2YX1A 3M2RB 1QSLA 2BR0A 5L9XA 2L9NA 3NP5A 1Q8KA 1JLEA 1FNMA 4HHHA 4U67Q 3FUYA 2H51B 2IRUA 3I0RB 1KONA 2XMMA 4I1TA 2GX8A 1IM6A 3DMJB 1NHUA 4ZP8A 1N6QA 2HNDA 2OEKA 4RKUC 3CPWR 1VQ6S 2MQQA 4NYZA 1PYSB 2CNOB 3MM7A 2XMTA 5F3TA 5KT3A 2VFVA 3R7SB 3QGGA 1U7LA 1NU4A 2K7KA 5B0GA 2FVQA 3C15A 2HVDA 1I94F 2MZJA 3AY0A 5HN0A 1WF0A 4OJGA 3CCLS 2CPDA 3PJXA 4O23A 3B78A 1VLOA 1HMVB 2B0GA 2F4FA 2MJNA 4I0WA 4QPTA 4ED5A 1DTTA 5DM7Q 2DNMA 2AJ1A 2E5LF 2YQ0A 5DS7A 5F9LA 2MKSA 4OYZA 4EGLA 5GADI 5D3GA 4IFVB 2DNLA 4USJC 1HI8A 3NLCA 1R8CA 2RU9A 3BBBA 4M5DA 3M32B 3SSSA 4KH1B 2HYIB 1K44A 1S0NA 4ZPTR 2HNYB 4K50A 3N28A 3M9MB 3T9NA 1KLMA 2L48A 5H1SV 2ZH9A 3C46A 2JSXA 1E6YA 1RGVA 1FKOB 2AQ4A 2NUHA 1K9MT 1JWWA 2QIFA 1NSQA 2HHSA 3O8WA 3Q8YA 4I6WA 4ANDA 4RZRA 3CCMS 4IDKA 4ES2A 1IBLJ 2HVIA 4TQSA 4B3TF 1KFDA 2BJ7A 1LOUA 3EVOA 4C97A 3RB6A 1T94A 1HWIA 2VDIA 2ILZA 4P6QA 3VZHA 2Q6CA 2BW2A 3H5YA 2HHUA 1MLAA 4J9OA 2BJ8A 1AW0A 2CPHA 3DHXA 2CG8A 3IG1B 3L09A 3C19A 1YDLA 2GAHC 1KWMA 2FLOA 1FE0A 2XWXA 3QT8A 5E3CA 3CJKA 2DGQA 2Z30B 1MU2A 2PFDA 4EFAC 3K8VA 5A8KB 4OX9J 2DHXA 2FJAB 2JVOA 3KOAA 4RWWA 1S1TA 5HJXA 1WKLA 1X9MA 1DZ5A 1RLCL 3T5JA 1X4EA 4OZLA 4QW8A 4X64J 3G6ES 3ILIA 4ZVEA 2DEIA 5ETNA 3R9LA 2PA3A 2YKNA 1E6VB 1UTAA 3MMBA 2MKJA 3BKTA 4Y28C 4ECYA 3BPDA 1IKWB 2N82B 3OVBA 3HT3A 3VHQA 3DYAA 1FE4A 2YWKA 4ZVSB 1TUWA 3M2RA 3ZZPA 4NEYA 1UEUA 3QFWA 4QQBA 1GMWA 4FDFA 2ZM6F 4ED7A 1OMSA 3PW5A 4QU7A 2ZE2A 4AL5A 4LF8F 1NPRA 2CXEA 4NOHA 1IBLF 2JWNA 4DPWA 3HVAA 5C5JA 1NRKA 1Z1ZA 3RAMA 2NPFA 4Q0BA 5HO4A 3OTOJ 3BGOP 3TJ8A 2WB1D 3RG6A 3CEDA 3DOKB 2U1AA 1LXJA 1Q78A 4CI0B 3SCJE 4ECTA 1Q7YT 3CUNA 3HHNB 2V8HA 2VKRA 3L9ZA 4QCLA 4FYXB 5BYSA 4DUYJ 5IT4A 5KFPA 1XR7A 3UQSA 2IYGA 5AE2A 2APOA 5F8GA 2R8JA 3PZPA 1CSJA 3R7NB 2GAGC 3K5LA 1Z2ZA 4LSNA 3K5OA 2AEMA 4ZK7M 4CZCA 2EG1A 2HQIA 1FKOA 2Z2LA 3ETMA 3SCLE 2MZ1A 1AZSA 1U4BA 1FDDA 4URSA 3A4TA 4PXDA 4GC6A 1QD1A 4C11B 4ZVFA 2DNRA 3FCHA 1QTMA 4PXBA 4WPAA 1U1PA 2DPJA 4JI1J 3AOAA 3EICA 4MT1A 4NLGA 2PC6A 1UFKA 4LVOP 5E3PA 3VGSA 5D4LA 4XDCA 3D2WA 4ED1A 3R5BA 1QAYA 1UMJA 2KM8C 2IAJA 5J2QB 1T11A 2FZKB 4NYOA 4ZJQA 3W5ZA 2M52A 3HX9A 3ULHA 4O0IA 3VGVA 2VFRA 3HVRA 1S57A 4LQ3A 5F8JA 3JSRA 4JI4J 3PX6A 1VLYA 5T7LA 3I9V9 3WBZA 1XJWB 2UUAJ 4FF2A 2OPRA 3RZAA 5KFMA 1CS4A 1DAXA 2V9WA 2DGUA 2HNZA 3M30A 1YJRA 4LREA 3MXHP 4NMLA 2YWHA 1LWCA 1KQGB 1S72S 2V50A 3FMWA 4LF9F 4TVAB 2CQ0A 4MK9A 4BC7A 1A0OB 3EZ5A 2HS4A 2LCWA 3CCUS 2CDQA 3GSDA 4PAAA 5LOQA 4Y0FA 4OYAA 2AZ3A 2YQ1A 4NRUA 4YDXA 4CTAB 4EO6A 2WVDA 3DN9A 2M5YA 2OAUA 3P96A 5J2PA 9RUBA 5DLGA 3G6YA 1N5SA 4LFCJ 1IKXB 4WF9Q 1RB0A 2VBWA 3DKDA 1SJRA 3NOGA 3KTQA 3NWGA 1SH3A 5EHHA 4OX7A 2MKYA 4LRBA 4I69A 2HWHA 2ZBRA 2R7RA 3GP9A 1JB0C 2JH3A 2LKZA 4DV4F 4AL6A 2EFNA 4MK7A 4QIEA 3W1YC 2OPQA 2YNFB 4UUXA 2EG2A 2IJFA 2XSJB 4EO8A 1A7GE 1RTZA 2HFVA 1D8YA 3UR3C 2XYGB 3P4UB 5THWA 3HM9A 4HHUA 3HO1A 2DXFA 1B7YB 4L74A 4R0EA 5GAHI 2E9TA 4LSLA 2B7BB 4QPXA 3EM1A 1SH0A 1JQGA 3L4BC 1HLWA 4DV5F 4H54A 5A76A 5ETOA 2C28A 4NLYA 2IJRA 3FCVA 3C6TA 3PEJA 4WWSA 2VH7A 1UAWA 2X1BA 3WZ0A 2R9LA 1SL0A 1I94J 2GMHA 1S6PB 1IJEB 3LW5C 4NLWA 4PYAA 5IZHA 3Q23A 2HZVA 2DRBA 4C0BA 2HBZB 4W90B 4OX6A 4WKYA 4K4YA 2UV8A 4AXIA 1RTDA 1RBOB 2ZHBA 4RW4B 1AB8A 1XR5A 1BWEA 4PZVA 4RW8B 3GG0A 2J7WA 5KFNA 3EPGA 2QA4S 1BC6A 4NZ7A 1SC6A 1JNZB 2RNEA 3DI6A 4DUZF 4CQ1A 2IBKA 2P6SA 3N5FA 2RRNA 5D4PA 3MFIA 2ALZA 4DR2F 1QVFR 1S4EA 2DIUA 1S5ZA 2MLYA 4K4WA 2QLWA 4EEYA 4ED2A 1SJFA 3AD9C 1U6ZA 2QFIA 2P9GA 3CJ2A 3HSJA 3OR1A 2OO4A 4I6AA 3V6KA 1S97A 2Q6BA 3JTNA 4J7CA 5B7WA 2KG1A 4NYPA 4YUDA 1GT8A 1QAIA 3D28A 2DNOA 3QO9A 2AJ4A 1TL5A 1YRTA 2D74B 2XBPA 2ZZTA 1MWZA 5D4NA 3X1LB 1CJUA 4WTOB 3BKUA 2E5HA 1FHTA 3CCVS 2KZZA 3IRXA 1JLFB 3IAS9 5CAAA 1UVLA 3AB4B 3IXQA 3W66A 5LSLA 2ZH1A 1WACA 3MAAA 3TAMA 2ADCA 4A8MP 1NKEA 4XPEA 2NYHA 3FDSA 1RYSA 3BSAA 1OS5A 3TJAA 5CCLA 1BQMB 1EQMA 1TR0A 4DR4F 1NNDA 1HD1A 4IUFA 1WG4A 1V3RA 4USTA 4EZ6A 3RRHA 1T8EA 1S1TB 2BDPA 4TYAA 4O3SA 4A46A 4X62F 1MNEA 1J5OB 1FDAA 2MQLA 3R6GB 2LDIA 4OZ5A 3GIIA 4DQIA 2HPUA 5L8RC 4CYUB 1HPZA 3QNWB 3L7UA 2HNDB 3UO0A 3LP0B 4WZQA 1RTHB 4OI1A 1KTQA 1VQYA 4NZ0A 4EU0A 2G4BA 3CO9A 4C3LA 1TTHB 4DI6A 3CVKA 4OZ0A 4PQAA 1FEHA 1X5OA 2GJIA 4USHA 2YBVA 3PW4A 3AJ2A 3IR7B 3D0GE 1GAOA 3CW2C 5F8HA 1X4CA 3PG9A 3AODA 3OLBA 4ZIWA 1IVZA 1Q7LB 4USKA 5T41A 2LP4A 3FK4A 4FF3A 2XS2A 4ZCKA 4E2FB 3KLIA 1VQ4S 1U2RA 4E8UA 1UZHA 4X4TA 1QY7A 2OTLS 4IRKA 5C24A 1BXNA 1OJ4A 1TKXA 3E01B 3UDCA 1J5EF 3MPWA 3Q22A 5J2NA 1NCLA 1LWEB 1ELOA 1TZ0A 2D3O1 1XBWA 1YJUA 2H1YA 3I5BA 3JSMA 1M5SA 2G0CA 4CT8A 2I2YA 2AJQA 2D69A 4TU9A 4RNNA 4QOTA 1WSVA 3CDBA 3D5MA 3GWCA 3SQGB 4QW9A 3BDPA 4B3OB 8RUCA 3QO9B 2DJWA 3DNCA 1U09A 1FKPB 4MTPA 2XMVA 5J1PA 3DLEB 2BOAA 4J9LA 2XS5A 2AJFE 3FEXB 1NH8A 1LNQA 4C0OC 4CO0A 5RUBA 4NLXA 4R5PB 4NXMF 2WONB 2AYMA 2BJ1A 4Z2XA 3MCMA 4FP9A 4O44A 2NCKL 2XZTB 4OJHA 4TN2A 2LQBA 3NS6A 1RT5A 2OH2A 3RW6A 3VGTA 1SPBP 2M3DA 4KO0B 2Q79A 3CO0P 2CNKB 2B8QA 1WC0A 3CDWA 2B9YA 3R8YA 5K8MA 4RW9B 1KRPA 2DNPA 1R27B 3MFHA 2OELA 3IA0A 1OPIA 2F40A 1UJ5A 3DGVA 1FRLA 4WK3A 3HLUA 2RD5C 2UP1A 4B3SF 1FNXH 3CD6S 1ZZFA 2VFSA 4OHZA 1S7IA 5DQHA 3LWMA 4PQUB 1SJ1A 1ZH5A 2YX4A 2G9OA 4QIVA 4HR2A 2EFVA 3WIVA 3VAGA 1U2CA 4CLYA 1W2IA 3M8SA 7FDRA 3R27A 4F67A 1NJZA 3M6XA 2HHWA 1V3SA 1NJYA 3GFXA 4O3PA 5HROA 3D66A 2J7KA 3C14A 4X4VA 2NZ4A 2W9AA 4TNOA 5HVFA 1XMQF 4B3MF 3OVAA 2VQEF 3BYRA 3CDEA 4LF7F 5KT6A 1HQUB 2QA1A 3R5JB 5HSPA 4UQGA 3HDSA 4YHHJ 3CULA 3PYFA 3D1OA 2BANB 1XTZA 2FY1A 1URRA 3D7SB 1JNRB 2OEJA 2WB4A 6AT1B 2ZH4A 2UUCJ 5ETQA 2X3DA 1U0HA 4F4WA 4NLPA 4J9PA 2G2YA 2YX7A 3OFFA 5IV3A 5JUMA 2XMJA 4EBCA 3DHWC 3K7RA 1S9GB 5B0DA 1PJ6A 1VIXA 3R5DA 4FYVB 2DHSA 2V94A 2RQMA 3LGHA 3Q89A 4HLBA 2IA6A 3KNAA 2H65B 3MI7X 1SIWB 2M2BA 3F0NA 4TLQA 1WC5A 3GONA 3HZGA 2QT7A 3QQCD 4M5LA 4OFZA 2KJWA 3TVZA 3PKMA 1XQIA 1WKJA 4O4RA 1AFJA 2FTRA 3MEEA 4HEA9 4PPDA 3KLGB 4P75A 4OJ3A 1RACB 3HD1A 2VF3A 1GXLA 4A8SA 2LLZA 3T3FA 1KHWA 4WFYA 3C2PA 2IM0A 3IGNA 1OQ3A 1RHMB 3V4IB 1FWKA 1CJKA 1VQLS 3DLKB 1JLCA 3W5XA 5M2RA 1KQKA 2R8KA 3CTRA 4MYTA 4DPUA 5CXTA 3KLHA 3CJSA 5DGAA 1IBMJ 1ZA2B 2ZDOA 1FXDA 2FJEB 4DUZJ 3J81U 1TAQA 4LF8J 1RHUB 2WONA 2RRBA 3M8ZA 2AF6A 4P2XA 3SBMA 1NJWA 1F2HA 3FQLA 3W2WB 3BPSP 2HVHA 3FRYA 1RT3A 4J9NA 5BJRA 3PYDA 3W9IA 4DV5J 3RBDA 1NDLA 3MEGB 2MHEA 2R8HA 2V34A 5CCMA 1YX2A 3D6MB 1EP4B 5LMNJ 2QRRA 1GK8A 2AP6A 5KFEA 2GVZA 3UCUP 1OWXA 1SV5A 5FLXY 2D9PA 2R7OA 4DR7F 1LWFB 2P2CB 1O5JA 2JLEA 2CQ3A 4NCGB 2GVDA 4G65A 3KLIB 2GHVC 3MWBA 4U8YA 1EAYC 4OQJA 2RU3A 2RF2B 2E5IA 1O6XA 1SJQA 3GR0A 4B9NA 1TAUA 3KK1B 3GTYX 2YNIB 3T9ZA 4C8ZA 4V19X 2B9XA 1Y11A 3BDEA 4FKXA 2MY7A 1RYRA 3ONQA 9ATCB 2GIQA 4O4GA 2MQMA 1WEZA 4I6YA 2PT0A 4MAKA 4C3KA 3BGUA 4JP8A 3ENQA 1SQGA 2CNLB 3QIPB 2R7WA 3T1HJ 5CH7B 1V9OA 2EBEA 2QYGA 4X4PA 2R2UA 1KQFB 2VJVA 4MKYA 1TFWA 1XNQF 4KGZB 4LIRA 1HR0F 3AJDA 1S99A 3BN7A 3G2XA 3UW1A 4IOCQ 3V4IA 2FD2A 4QIWD 1PBAA 1S1XA 2VU5A 3JSYA 1RA6A 5D0EA 4UY85 3DRSA 3IS9B 2R3VA 2UXCJ 1FJ7A 4HDHA 4BHQA 1WUUA 3RB4A 1V5VA 2UXDJ 2V68A 4BS2A 1T9XA 5A6WA 4RW4A 1FXRA 4QWDA 4YDDB 4OZNA 2XQCA 2C2ZB 1YBTA 4J9RA 2DH9A 3IM8A 2YNGA 1TELA 5KFOA 4X66J 1YK9A 5KT4A 1AZSB 2WW4A 4WCEQ 1BE4A 1L3TA 1NM2A 1W7WA 3QGPA 3OTDA 3W8GA 3LP1B 2V8DA 1IBKF 4X2BA 2IIHA 3D68A 3M1VA 5AE1A 4OYOA 2OSQA 1LW2B 1JLFA 1UW4A 1WDTA 2P8IA 2ZNYA 3MTKA 1H73A 5BYQA 2RDJA 3PO5A 4K7QA 2RKIA 2O5DA 3UNYA 3FSXA 4EK2A 3NGRA 1DURA 2QLFB 3CE8A 1HQUA 2WOMB 1DARA 1XNQJ 3SFUA 1SI9A 2HQFA 2XGQA 4C2MA 1CLFA 2X3GA 1UCNA 2K7JA 4J37A 3KLVA 3G82A 2ZJPQ 4LQ9A 2LEPA 2XGPA 5J2NB 2E9RX 1N48A 3HVWA 5KOWA 3BH7B 4JUZA 1F5BA 3AFGA 3HK2A 4ZVQB 3GYGA 5CA5A 3AA9A 4X65F 3CIMA 4YP3A 1TKDA 2AYGA 4OI0A 5J2PB 3OT9A 4P2SA 3TR5A 1ZZNA 1ZAXA 5HBMA 4ZOSA 4NZ6A 2XLIA 1AT1B 3M32A 2Y0BB 1YVFA 1TL3B 1P9QC 2LQ9A 3HPOA 1WNEA 1KP6A 3T1HF 2EC0A 2H5IB 2XYPB 4DV7F 4CT9A 4LBIA 4FYYB 1Q8LA 2V2QA 3GZ7A 2W9BB 1TKZA 3G71S 3EZOA 2E5JA 4WIIA 4C8LA 4CO1A 4F0MA 1CS4B 3KDOA 3GIKA 3G4SS 4F02A 4X66F 3DOMA 1TMMA 2B6AA 3FBCA 1LV5A 3R5GA 4LSLB 2ZH8A 1S4FA 1VJQA 1KQSR 4GKJF 3K5PA 3PEHA 1IR2A 3I5AA 2H9ZA 3QGIA 1PAUB 3VR1A 2HWIA 3X3UA 4XDDA 4DQRA 1VQOS 1IWGA 3JSMB 1G1XA 4E0DA 5K9FA 1D9DA 4KKOA 2DNHA 3M2VB 4ZCLA 5DDQC 1H38A 3M2UB 5GADU 2W2OP 3N6MA 1F3FA 1SC3B 2MZTA 3CCQS 4LR7A 3MOJB 2RQ4A 5A2QY 1FJGF 4DPYA 2F1FA 1WC1A 3ITHB 1IR1A 2QSFA 3QSIA 5M2UA 1R6VA 1TK8A 1Q5VA 1YTYA 4KV8B 4ED0A 3GR1A 2IRXA 1FKAF 3OFEA 4OI6A 2VBYA 3BM7A 2C2EA 3GYNA 4HT5A 3GJRB 3VAHA 1NKCA 2AMCB 4IFVA 5D3GB 3DM2A 1T95A 2ILYA 2Z56B 2OP5A 2YKOA 3I4HX 2MZQA 2CWKA 3OXGA 3KFWX 4J9QA 3QRQA 1FFGB 4OHWA 4C9DA 2Z2YB 1WG1A 2YWEA 3VQSA 2K1RA 4AD6A 2IRYA 1U1LA 5HLFB 1VFJA 1GNKA 2DNZA 4RUCA 5D15A 4U7CA 5I3QA 3PY8A 1S1UB 1F9FA 4EWTA 7AT1B 4Q8FA 3N5BA 4PXEA 2JFKA 2HBYB 2OPPB 3DRPA 1ZAWA 3ZFVA 1CQMA 1FWPA 2YNHA 1XMBA 3NEKA 4K2JA 3IC1A 1YWXA 2KKHA 2CWXA 2MJUA 2YKNB 3MMBB 4Y00A 3QYYA 1S79A 1U1MA 4N8NA 2BQRA 2CJXB 2MKHA 1BQMA 4C98A 2R8IA 4PRFA 1UFWA 1JXLA 3RR7A 1U6BA 2E1PA 3KLEB 2JNJA 4ZP7A 4A8WA 2E1CA 1JLEB 3DU6A 3LWLA 5ETRA 1TL4A 2GCFA 3RUBL 5MAOA 2VIHA 3DDIA 5E3RA 3O6QA 4PWUA 3Q2TC 3ILOA 2CQGA 2Z58B 3T5LA 4O3OA 4F50A 1C0UB 1Q5YA 4EBDA 2VC1A 1YJWS 2KT5A 4OLOA 2FVPA 2I5JB 4WYLA 2EFQA 3ZC4A 4RUAA 5KFFA 3PYEA 2JDJA 3D67A 3V6DB 3C3LA 1HBOB 4OYXA 4QIGA 2FJBB 4DQQA 3VZIA 2QYCA 3SI8A 4W92B 1BUXA 3I56S 4DSFA 3FGVA 3HKWA 1YITS 4F2RA 5U47A 1E6YB 4HACA 1W2BR 3WC0A 2I0XA 2HQCA 3UN5A 1TQLA 1K0VA 3ISZA 4WU3A 2HKEA 4CLUA 3Q8QB 4KRWA 4FPRA 3K59A 3V2UC 4G6VB 1O0PA 3W5YA 4JI7J 4Q0BB 3UDEA 2UXCF 4K5SA 2OPSB 4I68A 4BDPA 2DGOA 4WJBA 1IKVA 2WK4A 5KG3A 3TARA 2UUCF 3QJJA 1E6VA 1OY9A 5IT9U 1XR6A 4YEAA 1ZM9A 2GQ2A 3WIUA 3DU5A 1IXKA 2W8KA 2FGOA 1LWFA 4YB1P 4CO3A 4P73A 4CNZA 4MFBB 1T0TV 3BGFA 3THTA 2ZFHA 4CLZA 3HSZA 1TUVA 3HMJG 3PJ9A 1NMEB 2FZCB 1U2FA 4Y2IA 3TUIC 1H7XA 4RNHA 1R0CB 2ATCB 2AEJA 2JX2A 4PKDB 3NL0A 4EMDA 3EX7B 1JLQB 4OHXA 4B3MJ 1Y9OA 2LEAA 3QT5A 3ICLA 3MCNA 1RZMA 1YZ6A 3E51A 3HHDA 2KFNA 1S1XB 2GQCA 2MB0B 4W4MA 4NA3A 5C2GA 3WX8A 2OPQB 2YNFA 3CJ8A 3DMJA 4O3NA 3MMJA 4NLOA 1OY8A 3CJ3A 2ZH2A 1TKTA 2QTWA 1T03B 1P1TA 4Y2CA 4ZPAA 5ETPA 2FLLA 2J6UA 4K4SA 2DHGA 2VC0A 1NK6A 4IDKB 5I4MA 4IRCA 4MFBA 1RU1A 2HGNA 2RSQA 2EC2A 4K5RA 3MM9B 4YS2A 1RLDA 3A8JA 3ZNJ1 1YQHA 2BABA 1R43A 2QA4G 4LF5F 2BE2B 4KBIA 3EPIA 1F9HA 4CTAA 1NDPA 1VRQC 1X5SA 2KXFA 2Z57B 1WEYA 3HJVA 4KGMA 3OR2B 4NI2A 1WC4A 5A8WB 4X4SA 4F4ZA 1N32J 2PGCA 4K4VA 1DFDA 4FXWA 1OYDA 5HMZA 4HYKA 3TI0A 2NXUA 2QA2A 3IWXA 2D1CA 2UVWA 1WEXA 1EKRA 2RE1A 2BV3A 2CPXA 3FC9A 4ZPCA 2J0QD 1Q0NA 1FEEA 1BGXT 1WJ9A 2KL8A 3MPYA 2DGWA 3JAMU 1R6YA 4C8MA 5DG9A 1HMVA 1HBUB 4RLEA 5HMWA 5ITHA 3OLAA 2R7QA 4TY8A 3HJFA 1UPPA 1NHVA 1XIQA 2HEKA 1WOPA 1FRHA 2IVFB 1DHMA 3CD7A 1QUVA 1JJ4A 3TVKA 2ZD1A 2DGVA 3EVWA 2IY5B 1GEHA 3N4WA 4M5IA 2ERRA 3Q8SB 4NLTA 1RWNB 3NNHA 1G3OA 3LQVA 1YZ7A 4FPIA 4NL5A 5I42B 1NB2A 3OPKA 3W9HA 3H4BA 3C15B 2MSTA 2CPZA 1RTJB 3R2CJ 1VQSA 2CRLA 4DV2F 5KG6A 5KFZA 3EZUA 1Z4UA 4DN0A 3D3BJ 1X60A 2B4OA 2HHHF 1DTQA 4CH7A 1N6QB 4I67A 2J0SD 1FRMA 2XS7A 2J9DA 2BACA 4H4KC 4KYZA 4DEZA 5EWEA 4WFAQ 3LALA 2J7UA 4A4JA 1ICEB 1FWLA 3H20A 3FFIA 2UUTA 3HHLA 4I4BA 4DL0C 3RB3A 4DOZA 3D4JA 4YOEA 2XI3A 3US5A 1T3OA 1RWOB 1JKHA 3PRVA 3GIJA 3TUPA 1B7FA 4KY3A 2QZ8A 3B8HA 4DHVA 2ATLA 3G82B 3IMQJ 4NLQA 1LKZA 3I82A 5E2QA 3M8RA 3MM6A 2N7CA 3KMSA 2QE5A 2RKIB 1G2EA 4ITSA 2E7XA 2E1AA 1ZPVA 1O51A 3DM2B 3FZBA 2MGZB 3GILA 1QLNA 1JLGB 2GJ2A 4DG1A 5JMNA 2LFVA 1FDNA 5CD4H 1SQEA 4OMFG 4N56A 4RO0A 1U24A 4NPOA 1VBKA 1Z2LA 4ZN3A 2CJKA 1KLNA 2ZVIA 3JTOA 1U45A 1YRXA 1KLMB 2DIVA 2KN4A 4KFBB 1DQ8A 2DY9A 3ITHA 2NPIA 4LRFA 1NKBA 4WBFA 3BKFA 2JEJA 2ZC4A 2HS3A 2GVZB 3FZ2A 3M1VB 3H25A 4I7FB 3TEHB 2BMBA 1VISA 2HHVA 4W98A 4DFMA 1RT2B 3V5RA 3RR8A 1DQAA 5BR8J 1C1CA 2V8GA 1TKXB 4NA1A 4DFPA 3LTOA 3HT0A 2XY5A 4FNHA 2NSCA 2MZSA 4H4OA 5J2MA 2AT1B 3CD5A 4PABA 2YNHB 2MYFA 4O3QA 2M8DB 3P6YC 3MCSA 2W7AA 1HNWJ 2GIRA 2KM8B 1DQ9A 3EUNA 3VF0B 2CJBA 3LO3A 4PCQA 3CCES 2IA0A 4ANCA 3NGTA 2BOPA 2X1GA 2XLKA 2OI2A 4DCOB 3W2WA 3CB4A 5IV4A 3M9OB 4K4TA 3MPUB 2F7VA 3OXLA 3W60A 1DLOB 3A8KA 1Q53A 4EYIB 5D4OA 3UD4P 2VA2A 4F4AA 1HNXJ 4QWBA 3I0RA 2A3JA 1RTHA 3CCSS 3S7RA 4A8FA 2FIUA 4LF7J 3CJ5A 4Q45A 1K1SA 1HNVA 4FZVA 3TJ9A 3T5KA 4YHHF 1UL3A 3BSOA 1JLAB 4XTTA 3KHHA 1B0PA 2BVZA 2J76E 3H98A 4OYBA 2UVVA 1FI4A 3AAWB 3GIRA 4ZVPB 2AGOA 2UU9J 2R8GA 4X4NA 3F44A 1YBAA 5KFYA 1TUGB 4X4OA 4B3SJ 2NS1B 3BO2A 2F5GA 2W24A 1AROP 4NXNF 1JIHA 1HWKA 1SBRA 2GZOA 6FDRA 2VKZG 1R8AA 5J1EA 4B9SA 2LEBA 4NXNJ 3GJTB 5D78A 4KJIA 5D8HB 1N8RT 4KT0C 3F73A 1NEEA 3MAAB 5A0YB 1EARA 3QRRA 1RWKB 2OUGA 2OMLA 3GV5B 1KKHA 1NHKL 1RJJA 1RTIA 2B4PA 3J80U 2L41A 4K0KJ 2LDYA 3OL8A 1REGX 5AJ3F 1HNZF 2FLPA 4X62J 1R31A 2HAIA 4QWEA 2V8VA 5MLCV 1ITPA 4JV1A 4UQTA 3VAKA 4ZPBA 2X7IA 3QAEA 3VAIA 4P52A 4DG1B 3GSIA 1T9UA 1F3VA 5T14A 1FRKA 2W2QP 2GS8A 3PR4A 2UVRA 1VBXA 2XNRA 2YKAA 3HF5A 3ADAC 3NCRA 3LPYA 4G1QA 2X1FA 4JYAJ 3KNGA 2PA8D 2JOQA 1U8SA 3SYZA 2FHKA 2XI2A 3B54A 5DO2A 1U1QA 3VAMA 1SKSA 4RPFA 4HTIA 3OTCA 1S6QA 4PUOA 4IO1A 5ETMA 4ALZA 5DG8A 3W9JA 1BHNA 4YB6A 3ET6B 4OX8A 4N7TA 2OTJS 3VQTA 1FJGJ 3IBFB 2B8PA 1NK5A 4B9UA 2XHCA 1HNIB 3GJQB 4DR5J 4O0NA 5HAOA 3PM9A 1RT5B 2ZZNA 2LECA 4IQMA 5KT7A 2V4QA 3JSBA 4DL4A 3HZEA 1SL2A 1S6PA 1XEZA 3UD5A 1N5YA 5HATA 4LFBJ 4NLDA 1DJ0A 5GAGI 3G96A 4RBTA 5KFGA 1RT1A 4JV5J 2AZ1A 2ASLA 1D9FA 3JB9k 5FD1A 3PO4A 2I6WA 2V4RA 1P8GA 2WOMA 4DJBA 3KHRA 1VQ5S 4CLWA 2RH3A 1MSWD 4KB7A 1S1WB 1JJCB 5A8RB 5E0OA 1AXQA 3O1LA 2JZ5A 3MEKA 5KFIA 4PG4A 3V6HA 4CH1A 2LYVA 2EFGA 1RUSA 3A8EA 4DV1J 5A0YA 2ZOFA 1P27B 3M6VA 4DSJA 4GVLA 3ZTPA 4N47A 4LJMA 3I0SA 1X0FA 4RX6A 2KXNB 4B3RJ 3OR1B 1P1LA 4UOGA 1VRTB 1RAIB 5A8RA 1Q4RA 4D3HA 5IFMA 4FKYA 3TNVA 3GQCA 1VHIA 1ZA1B 3LOUA 1N34F 3S01A 4KHPF 3IM9A 4DV0J 2VPWB 2V2ZA 3H0PA 4ZPVR 4UT4A 7FD1A 5KG7A 3N0VA 1EETB 3CCTA 3ELHA 4ZVRB 2ZH7A 4M95A 3U27A 5EDWA 4FXVA 1RHRB 1PC4A 5IM0A 2K3IA 4P10A 2C22A 2KI2A 4KGVB 1S1VB 2C1EB 5C24B 5L1JA 5E33A 1YLXA 2MPUA 1KHVA 3AT1B 3TZZA 1VJWA 1GX6A 2ZEJA 1RBAA 4N5SA 1W26A 5CYQA 3OL9A 4PG7A 1MWQA 2F8MA 2C3UA 4FN5A 5B0AA 4JB8B 2QLXA 4NLSA 2AX1A 3DGPB 3ZTOA 4N76A 2XWYA 2LQ8A 1JLBA 1B99A 1MG7A 2V9KA 1XC9A 2VA3A 4N41A 2Y9HA 2EW9A 2CQCA 5DDOC 2X51A 3B4MA 1J27A 3EJMA 3SSRA 3U1NA 4RNMA 3CC7S 4B3OA 1HL6A 2VONA 2CVEA 2ACMA 2CQBA 2LXUA 2ZOMA 3G87A 3KUEA 3MD3A 3MPDA 4JI8F 4ZPDA 3SV3A 5F9NA 2XB2D 2RHQB 3NKYA 1HA1A 2FC9A 3ZO7A 3MCOA 4DU8A 3A13A 5FIIA 1S10A 2XSFA 2ACYA 3NGUA 5LJ3Y 2B9WA 4DL6A 3HKZD 4NCGA 2KVQE 4BWMA 1TV6B 4NE9C 2ZC3A 2VG5A 3VV2B 4QYZK 1FX4A 3POTA 2VQEJ 1RCXB 1S7HA 2L9DA 4XO0A 1IKYB 2CPFA 3PFEA 5GVQA 1KS2A 2CQHA 1XNRJ 1U0HB 3MEGA 2CVIA 1ZM4A 4J90A 1N36F 1WTFA 2OPSA 1NSKL 3BGLA 3QPIA 1S77D 3MM5B 5H9FJ 3GB0A 4F4YA 2MHNA 4GC7A 2ZKUA 1RABB 2HK2A 4LMZA 1S76D 5GMKa 1S0VA 2CQ2A 3J7ZT 4U9RA 2MZRA 4LF1A 2LXIA 2N3LA 4F2SA 3CGIA 4B02A 3B82A 1WWHA 1HI0P 1MROB 2CG4A 3SQOP 4CCHA 1X7VA 3HHLC 2J9DE 3EXCX 3T41A 5KFWA 5HROB 4MJKA 1RWVB 2VB6A 5L9NA 3JQMA 3TYTA 3P8BB 3HD2A 4MKAA 3OSPA 5D77A 1CEZA 3E3XA 5SUHA 4DBQA 4WFXA 4ED4A 3GYXB 4I2PA 2H4WB 2KT3A 2GJFA 1FFSB 2HZAA 3KWMA 4N8OA 4FVMA 5GMDA 2O01C 3DOLB 3MDFA 4JV2A 4BCAA 4X65J 1RAEB 2J5AA 4URQU 1HNWF 3GPAA 1FDBA 2WW8A 1MN9A 5GAGU 4DR7J 4KO0A 4LUBA 1IQZA 3BR9A 2G13A 4RW7A 3IWLA 3KXDA 1VBZA 4FS2A 2HS0A 4DR6J 1QSSA 4CRJA 3G8QA 5HQMA 4Z37A 2VOOA 5HANA 4CIOA 2RJZA 5EUHA 3M8PA 2AU0A 4RBUA 3GV8B 4C8OA 2RQCA 1RT7B 1JK9B 1U0SA 3KG0A 2AV5A 2XSJA 1S9EB 1UVJA 1MMNA 3D6HB 1VRUB 3KKFA 5DQGA 3DRRA 2CQPA 1HW9A 2A0FB 2AHOB 2I8EA 3SQGA 3H4DA 4Q43A 3PKYA 5G0RA 2XY7A 2FY8A 2KYZA 2ZJQQ 3HULA 5HLFA 4KHRA 3AD8C 3NCPA 2IC3B 4ZHRA 2E66A 4M5GA 3BQ1A 4M5KA 3V6JA 2RRAA 1C0TB 1FD2A 2XO6A 4NLRA 3V6DA 1AYEA 4AYBD 2OIHA 2E7VA 3LH2S 5KT2A 4JI3J 4QR2A 3W62A 5A8WA 2FHMA 3OR2A 2A6OA 1HHQA 1ZAVA 1GH8A 3QFHA 3UN2A 4AQYJ 3NNAA 2UXDF 1BD6A 2HIQA 1HYSA 1R3NA 3H5UA 1VCTA 1NDKA 1KVJA 3MUTP 2K8GA 1LWCB 1I6JA 2P9CA 1H2TZ 3OD2A 1CPZA 4X4UA 2GMJA 5F8IA 4LF4J 3MUMP 4OI4A 2DNNA 2HHHJ 1RAAB 4TKTA 4OYPA 3A8IA 5KFLA 1NH7A 4ELUA 4PWDB 4F0KA 3PR5B 3CWJA 1RE1B 1YRUA 3EXYA 3WX4A 2PI4A 4MK8A 4CLFA 1N33J 5C25B 3T6BA 2MQOA 5C2CA 3OJUA 3HP6A 3O44A 3NNCA 3AB2B 3EDQB 1FKPA 1KD1T 3I6PA 3NS7B 2VQFF 3OW2R 4H4MA 3Q86A 4ANEA 3UI3A 3NMRA 5I42A 2HFOA 2GIFA 2HRYA 5CYJA 5AXNA 4GMKA 2CPIA 1UWBB 2DGTA 2YKQA 4L76A 2CJQA 2MLZA 1YJ7A 1HHTP 2ZBCA 1CVJA 2DHHA 3K89A 2ZD1B 5HK4A 4LR8A 1TKZB 1S49A 2W01A 4GKKF 2DTJA 2DITA 3M7VA 3SZ2A 1CULA 1EZZB 2XNQA 1PG5B 3NGSA 3QZ8A 3IN5A 3D0HE 4DV1F 2VPYB 2GGPB 1YGYA 1L3UA 3R97A 4PWWA 1AFIA 1UPMB 1XMQJ 4FVCA 4DR2J 1U1NA 1OY6A 1TL1B 2PSZA 3M05A 2CFXA 2ZJRQ 2R7VA 3SCIE 2B5JA 3G6VA 4L6V3 1NUEA 4I2QB 5ETTA 1DY3A 5J1NA 3U02A 1PO6A 2VG6B 2R7SA 5H9FK 2G0JA 3CCZA 3EGVA 2CNNB 2DH7A 3KUHA 2VFUA 4NI2B 2Q43A 2E5GA 4A48A 3M2UA 4J9KA 4FBTA 4DR4J 4F7VA 3MF5A 3SIPB 1IM4A 1J2VA 1CULB 4Z7CA 4FYWB 2IC3A 2KH9A 2HWTA 3FBBA 4OYMA 3KYLA 3DRXA 3UDVA 4M8LA 4QJVA 2HBQB 3OL7A 2C2RA 4DV7J 3TQEA 2XZWA 3RAXA 2EKYA 2U2FA 4KE5A 3M8QA 1HQ2A 2Y0SD 2AIRB 3Q24A 3U1MA 2V5HG 5AXLA 3MR5A 3G8TA 1XK8A 4UZCA 2DRAA 3LF0A 4FXDA 1HHSA 4WK1A 1P6TA 4QWAA 4DN9A 3BGRA 1EHWA 2MKCA 3BZQA 2HAFA 2C3MA 2VFTA 2EFPA 3ETOA 2HURA 2HVEA 1FCAA 4LBPA 4DX6A 4K2XA 5ETVA 4DCPB 4WP9A 5IQ6A 4DSKA 3QJPA 1IKVB 1YIJS 5IC6B 4DQSA 5D6GA 3QBCA 3MR6A 2FHOB 2GV1A 2ROEA 3IRXB 1RA7A 5LXRA 2DRDA 5A8KA 2DR7A 2NREA 3DFEA 3SXLA 3ZXWA 1C1BA 3SCKE 4KFBA 5CD4A 1XMOJ 4UW2A 3KJVA 3Q83A 1NAQA 1RI7A 3I96A 5ETLA 2KU7A 5F41A 1J5EJ 4OYWA 3TANA 4DCJB 4A8OA 1EB0A 2AD9A 1Q8BA 4TQRA 4DF4A 4RJVA 5F8MA 2JL9A 1GXUA 2CUYA 3IP0A 1QAXA 1TL7B 3QATA 4ENOA 2IVMA 3T19A 3DCAA 2WRMA 5K8OA 4MIBA 2R7UA 1WG5A 2VG6A 1ZM3A 4ZVHA 4F3QA 3MUVP 4KV8A 1C0UA 3H2UB 1HW8A 5F0WA 5IQQA 4C8NA 3TX8A 3CXCR 3K5MA 1NBEB 4O3RA 1C1BB 1RU2A 4L3KA 4ZP9A 4X4RA 4IH5A 1YI2S 2XCPA 2H5EA 3T5HA 4M5DB 4KGXB 3V81A 4YB7A 3KHLA 2OFHX 2ROPA 1HR0J 2DCLA 4K8RA 4QR0A 1UZDA 1T05A 2BE2A 3B4DA 3LGMA 4ES1A 3M8PB 5L1LA 4A8QA 4ERDA 1Y5LB 4USWA 5DRKA 4WZMA 2W8LA 1KSPA 2RUGA 1PILA 3MHYA 4DUTA 5DGBA 2ZBQA 4LRAA 3JYTA 4P7TA 3H2VE 4ZP6A 3DLJA 1UVNA 5M2PA 1RSCA 2CQ1A 5B08A 3RTVA 4NXMJ 1S12A 1KVIA 1LFWA 1WORA 4BWJA 1T3NA 3DOLA 1CC8A 5I3UA 4ES3A 2NXNA 3IS9A 4M1KA 3ZTRA 3C8YA 1I5OB 2EEYA 4JI5J 2JC1A 1IQTA 4I2PB 4J9UE 5IC4B 5KFTA 3RYLA 3ZZ0A 2EPIA 2JVRA 1TU0B 1ZOTA 3PIPQ 1AUSL 1V3ZA 3PX0A 1MU2B 1FRJA 8ATCB 2CPEA 4YR3A 3M8QB 5KFXA 2IPOB 1N5QA 1JXVA 2W2MP 4J5OA 2EK1A 4ZDNA 4B3TJ 1QSYA 3OTOF 2XEXA 3D9BA 3ZZOA 4ETZA 2DEJA 2HZCA 2XLJA 2QN6B 4U96A 1U48A 3OFHA 1GTHA 1N34J 2WVEA 4TLRA 3PV8A 1EIYB 2P9EA 1TL3A 1C2PA 2YWFA 1X9WA 3KLGA 2E7WA 3ILLA 5EGYA 2DNGA 1VBYA 4EZ9A 1M1GA 4B3RF 1WI8A 1M5KC 3JXOA 3KK2A 1HARA 3ILJA 3R3TA 3SDEA 5DQIA 3H5XA 5EX0A 4NLUA 2C3OA 2M4MA 3POTB 1RKJA 4CO4A 4M5MA 3AJ1A 4CM2A 4J91A 2VODA 1B3TA 5LMUJ 2BKOA 4CLLA 3J7YU 3CC4S 3C66A 4U8VA 3DLLQ 1S9FA 5KFSA 2FJWA 4OZ3A 5GAEI 3CJRA 3FEZA 5B0EA 2GA7A 4WXWA 4USUA 1HQEB 1M0SA 2OD6A 3MPVA 1KOHA 3LPEA 4NWBA 2CYYA 1JLQA 5AXKA 3KLFA 3PDNA 3IAM9 3BF4A 4OV1A 1RHQB 1S1WA 2BE7D 2DD8S 4H4MB 2MDAA 5L38A 4IFYB 2DH8A 2Z8QA 4OJ1A 4WYWA 2HMIB 4K4XA 4B9LA 1RAFB 5AXMA 4QBUA 4YY3F 4RL1A 2W9BA 5K5MA 5FLXU 2AGQA 1X31C 3PTWA 3W7BA 3OVSA 2WAQD 2AWZA 3H2LA 4R8UB 3T1YF 3R1LA 4I64A 3KJQB 1RK8A 1U25A 4LSNB 1OSDA 3MEDB 4BBYA 5LT5A 3EMTA 4Y2KA 1SKWA 4CO5A 4ECXA 5IWAF 5FDLA 4BLGA 4DV6F 3HVTA 4ZHRB 1RAOA 1JMTA 2IM3A 2VUGA 5K14A 4UZBA 2W7OA 1S0MA 3QIPA 3ZNUA 1N0VC 3G86A 2M9KA 2ZUGA 3NCQA 3PW7A 5G0RB 2VV5A 3H5SA 1HWUA 4JI4F 2LVWA 2E5LJ 3BS9A 1YSJA 1PSDA 1TP7A 2Z4PA 3HI9A 4KAIA 2DO0A 4ZLLA 4JI2J 1UVMA 4FYDA 1YJNS 1GMUA 4KGKA 4ICLA 5KFKA 4ZN1A 4OX9F 3QZ7A 3T1AA 2CQ4A 2NYIA 4GVBA 1SKRA 1Y5NB 2AEFA 1YG0A 4F0HA 1R0BG 1VS3A 3QLHA 4HT7A 2QLBB 1S9EA 2BUNA 2VG5B 4WU2A 4X84A 5E3AA 5B09A 1U49A 2UU9F 4M5JA 3KK1A 2HK3A 3I31A 3TZXA 1VQKS 1N5VA 2LA4A 2FVCA 5FJ4A 2I9SA 3MMAA 3Q2SC 1UKUA 1LK7A 3PIOQ 1BQXA 2GVDB 4ECWA 2CQDA 4ER8A 4USMA 2IMWP 1PAEX 4RBVA 4F25A 1M5PC 4CLTA 3K58A 2FJVA 1XERA 2VBZA 4UOHA 5DG7A 4C3MA 1GX5A 2OPPA 3DRPB 1RP5A 1X9SA 1NK9A 4ZJLA 1M5HA 1I51B 1VC5A 4HI2A 4Y65A 4DR6F 1NB7A 3DRYA 2BYCA 1X4FA 2WVFA 1QVGR 2R42A 3OFGA 2ROGA 4ED8A 2L08A 8AT1B 3L3CA 3GIMA 3DLKA 3CC2S 2YVSA 4IQXA 2QMWA 3I4PA 4ECQA 1M5VC 1KNZA 4JI0F 2CZ4A 4O4GB 3M8YA 2ZWOA 5F0UA 1JLBB 1UW9A 2DB1A 1H6KX 3GLJA 1YKWA 2H3EB 3I9ZA 4LIWA 3FBEA 4DUYF 1XN9A 2CJAA 5IM0B 4DR3F 2D9OA 3K0JA 2KYXA 1M90T 1SIZA 1CJKB 1S48A 2J9CA 5CZXA 2HLTA 1TMJA 2GFFA 2KVIA 3CMQA 3HSDA 3J7A1 3W3SA 1N5TA 3MM8A 2CKWA 1GTEA 2FUG9 2GHWA 3BN4A 6FD1A 1VC6A 3VWSA 1NK8A 4B17A 2GGPA 5HMYA 2OLWA 2XY6A 2AJ2A 2HQDA 1C0TA 2G2OA 5B0CA 3GCWP 4KHMA 4QYZJ 4P2FA 5G4DA 2P5VA 2ZM6J 5KFVA 1Y3JA 1DTTB 2FHJD 1SQFA 1X4GA 2J6SA 4DPXA 1RT3B 4P72A 1ZM2A 1X0PA 2HFNA 1IBKJ 3H42A 4JV5F 1X4DA 3M4XA 1LQ9A 3PJWA 3K8WA 1ULRA 1JJ2R 2D7SA 4CDIA 2OJ3A 3RBEA 1TVRA 2B6AB 1HBMA 4YN3B 4CLKA 5KAKA 2W1BA 3LUYA 3H59A 1OSCA 4ILMA 2CZ9A 2NLWA 3A3OB 1FK9A 3OL6A 1AUDA 2BXJA 1JLCB 2WVBA 4GO7X 3CDAA 2B4VA 1APSA 4NX9A 2ZDPA 3BO4A 3EE3A 2ZBIA 1T9VA 2MQ8A 4PG5A 2CPJA 3FSIA 1JXEA 3NBPB 3D3CJ 5LM7E 3MR3A 2VQFJ 5HMXA 1FESA 5BYRA 4ID8A 4QWCA 4C8KA 3LP2A 2GMLA 3DXBA 3DDKA 1BWVA 3O3LA 5CYQB 1S6QB 4M94A 4PUOB 2M88A 3FNNA 4ILLA 1N54B 3DRSB 3UWTA 3H7HB 4H4OB 5CYMA 5J2MB 1BLUA 2BJDA 2DGSA 4LRDA 5IOLA 3NGDA 4DR3J 2KJVA 3UFCX 4DS5A 3WDOA 3MEEB 4YMEA 4O44B 4J9MA 1ZPWX 2DXEA 2V2VA 2YH1A 5KT5A 4R0JA 1SXLA 2JEGA 1L3KA 1F2GA 3EGWB 1YBUA 2XMKA 2NXEA 3KJFB 2VG7A 3GFHA 1UA0A 1PCAA 2SXLA 2BZ2A 4LFCF 2JJ4D 3KDNA 1SUQA 1SUQB 1M1HA 4GVBB 3H8YA 4IOBA 3CJ0A 1R8BA 1CC7A 1UVKA 4FNIA 4P7VA 2L3MA 3VGUA 4LF5J 1VGYA 3ZTSA 3J80Y 1HNZJ 1SKUB 3HFZB 1HFEL 1VIOA 2CIMA 1PYTA 1PBUA 4B08A 4A8KA 1U1KA 3IWNC 3PHEA 4YR2A 1Y3KA 5HQLA 2VJUA 4LF9J 5EN1A 1SJ3P 2E29A 3THPA 3W8PA 1IN0A 2V8PA 4A8YA 4DL7A 3C16A 1HKAA 1FVQA 4UOFA 5C7PA 1N36J 4LF6F 2A10A 2MTLA 3I32A 1N32F 4DX7A 3W2VA 3OTEA 3KK3A 1RXOB 2XZDB 4DU7A 2UXBF 2XYHB 4ELTA 3TW0A 4YB5A 2UV8G 5L46A 4U7UD 2V4JA 4USIA 3L95X 3GG1A 2KB2A 3VVTA 3HHLB 5L39A 5KOXA 2OGUA 4Q8EA 4LFBF 5IWAJ 4DV6J 5IXUA 2PFFB 2IYIA 1VQ9S 2YH0A 3HFKA 2D3ZA 4DF8A 1N56A 2KDOA 2PDAA 2F4VJ 5GAEU 4JYAF 5F3ZA 3TA0A 4CWBA 2QMUB 3DGPA 1K8AT 1T9TA 3J7YI 4G1QB 3L7PA 5T7LB 1ZYQA 4C7QA 4XAKA 1U02A 1CJTB 4E98A 3QMQA 4CLSA 1RTIB 4RUHA 2FVRA 3DLEA 5K20B 4WE1B 5J2QA 1OPZA 1RCOB 2C3PA 2H48B 1N4LA 2N4CA 1ZS6A 4JI7F 2DO4A 2WCXA 2LXFA 2YPZA 1VOMA 1QM9A 2J0WA 4RU9A 4IH7A 5B0FA 4RNOA 1ZTTA 4ECZA 2DR6A 1PC5A 3MURP 1PIEA 3QLHB 2AJ0A 5EWFA 4C11A 3BSCA 2CQIA 2YKMB 1UWAA 4WP8A 1WC3A 4Y2AA 1CQNA 2DYAA 4P71A 1QTNB 2NXCA 2LQJA 2F8EX 1K47A 4DV3J 1Q1KA 3UD3P 2IVYA 2J0XA 4NA2A 4OV6A 2HRTA 4ZVOB 1RWPB 1RWUA 1U1OA 1H72C 2QLJB 1R8PA 4GO5X 3P49B 3MM6B 2JFDA 2QL5B 4HACB 2NQPA 5IT9Y 4JOUA 3NAHA 1HPZB 5JXSA 4ZVTB 2IJNA 2QEXS 1HD0A 1G6BA 4KPYA 4XPCA 1M5OC 2FZGB 5E3QA 1J5OA 2OPRB 2LMIA 1N5YB 2GO8A 2ASYA 3AXKA 2JLFA 3NGKA 4L3NA 4LF6J 2DBBA 3QIDA 3MEDA 4WTYA 3LP0A 2N4DA 4PPZA 3HXMA 3FRZA 2YTCA 3A12A 2A6MA 5CYMB 2C42A 5KFJA 1FA0A 2DNKA 3IRWP 1TK0A 1IBMF 1R8HA 4DR1F 4AE5A 4DWIA 2V4JB 1F0XA 2D3UA 5BXIA 4JI1F 4V1Ak 3AQOA 2OKQA 4JI8J 1F6TA 3TAMB 3S6EA 3SEOA 1MMDA 3Q8RB 5LL6d 3UVJA 1PYOB 2DNQA 3F56A 2QC3A 2WHOA 5HQ8A 1VRTA 1IBCB 1RAHB 1X4BA 1U47A 1DTQB 2M70A 4D3GA 2HGMA 1KFSA 2RILA 2R7TA 1REVB 2K06A 3V4MA 1UA1A 2AW0A 4G1IA 2XG8A 3V81B 2EXUA 2L9WA 3ENWA 1RKIA 2ALYB 2WBMA 4C8YA 1KR4A 1NDCA 1SC1B 2PMWA 3NS5A 4ZLNA 3CJKB 2H5JB 4Q44A 2RAQA 4N77A 4DFJA 3ENVA 4MKVA 2KHDA 5F8NA 1MW7A 1Q8IA 1L3VA 3NOCA 1RQ0A 3K2YA 4ZCIA 1S6OA 2Z2ZA 3ISNC 5FDLB 4NMXA 3ZZTA 3OBIA 1JKHB 1C4CA 2J8AA 4ECSA 3VVUA 1U1RA 4ZKAA 4F26A 1RHJB 3TWZA 2JLGA 4EI2A 4RU2A 3NRBA 4NCBA 1R0AA 1FFWB 3I55S 2J8SA 2W9CA 1IKXA 3O5TB 4TY9A 4F36A 2QL9B 4FF4A 2E9ZA 1LW0A 1QE1A 2H4YB 1FTRA 1QDUB 4BC9A 4ZVUB 3UCGA 4WFNQ 4HL9A 3G9CA 1HIYA 4V19J 3FEYB 4YFUA 5EWGA 1RWMB 1N52B 1XWLA 5JVGQ 2C3YA 1WC6A 1IKWA 4X64F 3EVMA 2FHJA 4MKBA 4AT1B 4DV3F 1TKTB 4Q2MA 5A6PA 4MH8A 5HP1A 4ECRA 3THVA 1VYAA 3KLFB 1VDHA 2EI5A 4DV4J 1EX8A 2OSRA 2VD3A 1R7IA 2QX0A 3QT7A 1YJTA 2CPYA 2ZVSA 5D0RA 1FJEB 3KG4A 1RT4B 4MYUA 2HMIA 2FPHX 1UWBA 3CMAS 5SZTA 5LSOA 1F60B 3JAMY 4OIXA 3PACA 2FC8A 3TQ1A 1FJCA 3CJQA 4ZJOA 1X4HA 1B70B 3KJNB 2QL7B 4TY8B 1L5UA 1Y4ZB 4UOCA 1F5AA 3BQ0A 4DV2J 5I3UB 2UUWA 4HTJA 2OEMA 3NAIA 1NK4A 3TRGA 2VASA 2ZUAA 5HP1B 1YJVA 2C2KB 3PNIA 4ECVA 3SDEB 2MEWA 2VZ9A 1X4AA 3VAFA 3TUJC 4Y2MA 4OI3A 3FMBA 4DX5A 3Q8UA 1SCJB 2O66A 2HGLA 2COLA 2DR8A 1TL1A 3RBZA 4UTGA 2DPIA 5KG4A 2KFYA 3PW2A 4NCAA 2KTQA 1FX2A 3AHPA 2B51A 1HNVB 1W25A 1P9YA 3AXMA 4A8XA 3W64A 3OUYB 1JLGA 4OL8A 2DK2A 5DM6Q 2YPYA 5C42A 4ZLJA 4ETXA 2V0NA 1T03A 4KKOB 3M2VA 1B4SA 3FVYA 3AOBA 4IYQA 1YHQS 3UPFA 2EK6A 1NSPA 2ADBA 3MM9A 5HVGA 2WSEC 1WTBA 2HNZB 3M30B 3VCDA 4ZPWR 2VHGA 4AL7A 3IGVA 4M63A 1VQ7S 1BQNA 1NZAA 2DNYA 3KUGA 4HDGA 2BJ9A 5DZ7A 3TO8A 4CH0S 3TZWA 1T02A 4LVNP 4QZVB 1V5IB 2F9JA 3BR8A 3G6XA 3PCOB 2DXDA 1U8WA 1UEVA 2V63A 2BQUA 4OHYA 4R8UA 1JX4A 3ENAA 4ECUA 3IBWA 1HNXF 4IOAQ 4OHVA 1DBDA 1FT8A 4ELVA 4P2MA 2GW8A 3MMAB 4DZDA 2YNGB 1RT2A 3LAMA 3BBFA 4WP3A 4Y3CA 2Q66A 3P3DA 4FF1A 5BR8F 4GKKJ 3SSQA 4C48A 4IFYA 1WOSA 3MECB 1B0VA 1A9NB 1K0TA 4L75A 4JV0A 2PMHA 1RISA 2R4FA 5LJ5Y 2AGPA 3ZZUA 1KBRA 2C2DA 5E7OB 2GO9A 4F8RA 2F4VF 3RAQA 2VICA 3P5BP 3DLBA 4U7UK 3N9UC 4KPCA 2BJEA 1RT6B 3IO1A 1N33F 2QV6A 3IR6B 4EBEA 2JEIA 3QRPA 3JS9A 2VPZB 4NRTA 4ED3A 2NSBA 5LMNF 2VL1A 2P6TA 4F3MA 2YWWA 3WC2A 2FJXA 5GAHU 3BH6B 4I2QA 3DOKA 2C2MB 2IM1A 2POKA 3OTBA 3R6LB 4DSLA 3KK2B 4URGA 2IHR1 5DZ6A 3W63A 2DKOB 3JTPA 2R2RA 1Y5IB 2C2OB 1WOOA 2PEHA 3PFOA 3MM5A 2CA9A 2ZOGA 2I5JA 3ZZRA 3FBFA 1I3OB 3CJ4A 3AH6A 3SMZA 4DR1J 3GCXP 3RRGA 1KC8T 1QJHA 5LMUF 3PXGa 3VTIA 5L1KA 2B5JB 2HSEB 5B0BA 3P45B 1EJ7L 1F5CA 1Y7PA 2MQNA 2VPXB 3CSKA 3HHLD 2QGFB 4LBHA 1QUPA 2DVIA 1VHFA 2HHQA 1Q79A 5JVHQ 2NXJA 2RDIA 2Q3PA 2ZWPA 2HQ3A 5IS2A 2R7XA 1Q16B 4FS1A 2F65A 1L3SA 2M8HA 4JI6F 2R2SA 2G1HA 3DOMB 1S1UA 5IT0A 4WE1A 4DL2A 5H9EJ 3BGRB 2WZ1A 3T6JA 2YQ3A 2BM1A 2MY8A 4ZCMA 4X4QA 1SVDA 3TVYA 3KMQA 3FJ2A 1UEKA 3WHIA 2AYEA 4WKRA 5KG2A 4IG3B 2IAJB 5AT1B 4DL5A 1CJTA 3BREA 4PWDA 3MGJA 1X8DA 4KTQA 3CD0A 3H40A 2XULA 3JYTB 1IR0A 3NG8A 2ZNZA 4DLEA 2Y1LB 2QFJA 3QSYB 2D3OR 5C25A 2PI5A 5DLFA 5HBMB 4DR5F 5CQGA 1HYSB 4OZJA 4UUWA 1PKUA 4HH0A 3GV7B 4YQWA 2HNYA 1VC0A 2B4UA 4QIFA 4DV0F 4JBCA 2DCUB 5DDRC 2V67A 1Y10A 2Z2MA 3OUYA 2QSWA 4PG6A 4WFBQ 1TK5A 3HHKA 1ZTWA 3IR5B 1IKYA 1ZBTA 2G0IA 3D54A 2CADA 5A2QU 1NZ8A 4FBUA 4Q5VA 1VI7A 3C16B 2KT2A 3QT6A 5E5NA 2HLUA 2DR5A 4DL3A 3UN3A 1TL7A 4ED6A 1HBOA 1RAGB 2OMOA 2Q1LA 3GU0A 3MMCB 1RT6A 4HVZA 3WQPA 4DQPA 3B6BA 3BB5A 1KOOA 4P74A 1O8BA 1H3DA 1BMQB 1N0UA 3MM7B 4MMOA 4TXSA 2IDLA 5KFHA 3N79A 4JI2F 2ZE2B 1VK8A 2FGCA 3U7JA 3KHGA 2UUAF 4IR9A 3Q8VA 3OHBA 2UXBJ 3CDUA 2RB7A 1I1GA 1ROFA 2B9EA 3OJSA 2DGXA 3DYAB 1FXLA 3FKBA 3EDRB 4U6PA 3DDNA 1URNA 4RW6B 3KLEA 1CJVB 3LGNA 3MR7A 4KH0B 4CLPA 5DETA 4F4XA 4ZA1A 2MKKA 2KFZA 5ADZA 3SV4A 3KG1A 4CP5A 2LA6A 1R0AB 2EFOA 3AD7C 3UVJB 3W65A 2W9CB 1VQPS 1M1KT 2NUUG 3BEGB 4UY8T 3HHEA 1H2VZ 2LU2A 3ET6A 3N01A 4Y6IA 4ZVGA 4B9VA 1WI6A 5KFUA 1D09B 2G1DA 4PEOA 3W2VB 2IBOA 2RS8A 4AXJA 2N3OA 1EETA 4AUKA 3BJYA 1A6LA 4IKAA 3D0IE 4OZ1A 2QMXA 3MAQA 3R2DJ 1U6FA 4LR9A 4QYRA 3CT9A 1VR6A 1PJ7A 5C42B 2ZBPA 1T9YA 4IG0A 1HBNB 1UFLA 5KFQA 1BY9A 5KFAA 1KTVA 5K8NA 1FVSA 1KVKA 2LQ5A 4K0KF 2KG0A 2ABYA 4TU8A 2NR0A 1LFPA 2ZH6A 1RT7A 1NJIT 3CCRS 3M8WA 2HG4A 4MIAA 4OZ2A 1PJ5A 4HKQA 1SB6A 2YKMA 1G4CA 2RS2A 3DRRB 1H2UX 4LF2A 1RDRA 5ETSA 3AA8A 3PYGA 1LW2A 2R2TA 1SV5B 3LA0A 3MECA 2WSCC 3R5CA 4Y34A 5I3PA 2XHWA 1XNRF 1TV6A 2HFUA 1B64A 4HHJA 1FRIA 4C0HA 2V6AA 2HBRB 3P5TL 2RF2A 4DSEA 2W2NP 2RT3A 1WHYA 3F41A 4PYDA 1FERA 2HIYA 3UDLA 2Y8YA 2EKNA 5KG0A 2KXHA 2UZAA 1HNIA 1KEKA 1UJ4A 1RWWB 3R5AA 5KFRA 3CMES 2UUBJ 2J6TA 1WF2A 3CNQP 4DMZA 1EP4A 2DHAA 4J9VA 2XCAA 2WBRA 1S0OA 1WHWA 5KFBA 1K1QA 3HCXA 1BQNB 3K57A 3IFEA 1RT4A 2CAJA 2JHEA 1S59A 2EWHA 5HI7A 3M6WA 3G8SA 3LANA 2I38A 1FF2A 2K3KA 2PO4A 1MWYA 2XO7A 1HI1A 3A1YG 1Q86T 3O2IA 3S8SA 3BBCA 2CDRB 2BA9A 4M5HA 1Q81T 4B9MA 4DSIA 2F63A 1GFWB 2WSFC 2X1AA 2XMWA 2ASDA 3Q8PB 2UVUA 1F1BB 1WELA 4LT6A 2FQQB 3U1LA 4YY3J 4K59A 2FYXA 2HQGA 4DX8H 2N7YA 1NLKL 2A18A 2PE8A 3RRKA 3TAPA 1SH2A 4Z7YA 4C4WA 3GFZA 2A2DA 1GXTA 3T1YJ 1D1UA 5F8LA 2W7PA 3KK3B 2FB0A 1X5TA 4JI3F 1NXIA 2OHDA 4L72B 4A47A 4LF4F 1RADB 1S6UA 1G7CB 1IWAA 2E1MC 4Q2LA 2WTFA 1R89A 3QAUA 2BM0A 3RU0A 4KR0B 1FNOA 1S9GA 2WVCA 1WHXA 4ZMMA 3PX4A 2B3TB 2HHTA 4IRDA 1F9EB 2RHSB 4RNFA 1VRUA 1LWXA 1CBKA 4DZ6A 3DC2A 1H0HB 2VG7B 4XIUA 2KO1A 5CHCB 5AE3A 3LP1A 3TAQA 1NK7A 1VMBA 1REVA 3C6UA 3PRBA 4S0MA 4KSEB 2BANA 4GRSA 4JI6J 2CZVC 2PMZD 2B56A 4TU7A 2MXYA 3J81j 4K4UA 3K5NA 2HHPA 3MD1A 1EKSA 2PEBA 2RMLA 4ID5A 4RW7B 2Y1RI 2YXLA 3I87A 4QR1A 3PW0A 5CABA 2BEFA 1SJ4P 4C6AA 4Q7AA 4RR5A 2F8HA 5L1IA 1NJXA 1FTCA 1SL1A 3CJTA 1NSAA 3DLHA 2XTJP 3VAJA 4GKJJ 3ZTQA 2KRBA 1QE1B 1LW0B 2IFXA 3CCJS 4G3IA 4M5NA 2IDEA 4QU6A 4RW9A 2W4DA 2RIJA 3RGIA 3HSGA 5HVHA 3DLGB 3DLGA 2HW3A 2FVSA 1KDNA 1OIAA 1D8ZA 4ZITA 1JJHA 2PN6A 2GNKA 2VDHA 2W4PA 2ZH5A 3Q0AA 4F04B 1GMVA 1T9WA 3E8OA 4WXOA 4CO2A 3J7Z5 2ZH3A 3I0SB 2C2NA 2I1RA 3AOCA 3N6LA 1MMLA 1MN7A 3FSYA 1MROA 1RAJA 3PHTA 4F4KA 3SFGA 1H98A 2QG9B 3MZIA 2KRRA 2AYBA 4KQZA 1VQNS 1TFYA 1HBMB 5E41A 1B0TA 5KFDA 3M6UA 2BW7A 4ZLPA 1WKKA 3CIZA 4R5PA 1QAJA 1FD8A 2CJYB 5HL7Q 2W25A 2JEFA 1DRZA 2RQKA 4JI0J 2ASJA 2DT9A 2YWGA 5GMEA 1HQEA 2HRUA 3A3NB 2JC0A 2M0GB 4LFAJ 3BO3A 2Y1IA 1TVRB 1HBNA 1EQ0A 2OFGX 4ILRA 4NLVA 3MAHA 5HJYA 3UCZP 2F3JA 2GHPA 2K2PA 1SC4B 2GC8A 3H90A 2MLXA 3AQPA 3UR0A 4J9SA 1Q82T 4CM0A 4R25A 4MIWA 4I56A 3DI6B 1Q95G 1AA1B 5J1EB 1FO1A 3RJMB 5AJ3J 3TX0A 1JLAA 2Z0GA 2PIIA 3OHAA 3OV7A 3NBPA 2DISA 3K17A 4HI1A 3MM8B 4P9SA 2FDNA 3BYPA 1RTDB 3UE2A 2XMUA 5KTQA 2DY1A 4OYIA 1RHKB 4RWXA 5KG5A 1KN6A 2BX6A 1ACMB 5KFCA 3FQKA 1LXNA 3D1QA 3JQKA 2RUSA 2Y3YA 4H4KA 3MTJA 2M7SA 3R1HA 2Y8WA 3KLHB 2EVZA 1FK9B 4PXCA 3I5CA 1WDDA 2YY3A 3DXSX 3QWPA 3EWGA 4ID5B 3ISND 3EGNA 2AKWB 3OQ2A 4U95A 3EYZA 1XMOF 4B9TA 1V6HA 2ZITA 1H7WA 4IG3A 3RBXA 4LFAF 4L73A 3BQ2A 4CYUA 4DPTA 3N6NA 2YKPA 1UETA 2BKPA 1C1CB 3LAKA 1HWLA 2YNIA 4DDFA 1K73T 4DFKA 1NK0A 3D1HA 1D0EA 1RWXB 3TUZC 3GFYA 1LWEA 1OO0B 2BRKA 4IO9Q 2O67A 1ZETA 3J7AN 2CJ9A 1HBUA 1RBLA 1VK3A 2Y1JA 1UJ6A 2QO3A 1WSRA 3L7OA 2ZHOA 3NWRA 3QGHA 4KIAA 4WIQA 3TA2A 2MQPA 2V2KA 3MR2A 1LEOA 3CF5Q 2ZHAA 2VBXA 2G2ZA 4KHPJ 3J81Y 1N88A 2JRSA 4DPOA 1T7PA 1LK5A 3E01A 4AQYF 3BSNA
chains in the Genus database with same CATH topology
1YJ9S 1NO8A 1UVIA 5JJBA 1X5PA 3TOQA 3NMAA 1HWJA 3MOZA 3CCWA 5KG1A 3OSNA 3M9NB 2O1PA 4YR0A 3RB0A 2VOPA 2UUBF 1CG2A 5LSRA 4KC5A 2BRLA 1IJFB 2MGZA 5LXYA 2HFZA 3TA1A 4AFFA 1FRXA 2EBGA 1D3WA 3TP2A 1OQ6A 1DLOA 2HHXA 4EUVA 3UNGC 4PQUA 3GMGA 1S1VA 1D9AA 5K8PA 3HVTB 1PGZA 2FLNA 2OD4A 1U26A 2J9EA 3QJLA 3E2EA 3ZZYA 4ATNA 4IH6A 1WD6A 2D41A 3FFIB 2HVZA 3GE9A 3PVXA 1UP1A 2AX0A 1RTJA 2IMOA 2FJDB 2RVJA 3OXFA 4ZS6A 2XC9A 4EYHB 4CNYA 3C6TB 4ICLB 1Y00A 1T05B 3C6UB 4RW6A 2KHCA 2O3DA 2A1BA 4I7FA 2MSSA 1Y0HA 4PR6A 2MMYA 2W4CA 2BQ3A 1GQEA 4IG0B 4TYBA 2LU1A 4JI5F 2B43A 2KZMA 4OLPA 1WHVA 2GQQA 3VALA 3PRDA 3QWUA 3EGZA 2ZZMA 1C4AA 3IG1A 2F9DA 2E44A 2K1RB 5K14B 1RT1B 1IUJA 3ZZZA 2BBEA 4PG8A 4HH1A 3MMCA 5DDPC 3S1TA 2B7CB 1VQ8S 4G1PA 2MKIA 2IM2A 5EX3A 3RW7A 5DJBA 1VQMS 2E1RA 4DLGA 2DR9A 4DS4A 4OI2A 5CZVA 3KJVB 4IR1A 1WF1A 2ZKTA 4WFZA 2A2CA 3LP2B 4XK8C 4F3OA 4RW8A 2PD1A 2YX1A 3M2RB 1QSLA 2BR0A 5L9XA 2L9NA 3NP5A 1JLEA 1FNMA 4U67Q 2IRUA 2XMMA 3I0RB 1KONA 4I1TA 2GX8A 3DMJB 1NHUA 4ZP8A 1N6QA 2HNDA 4RKUC 3CPWR 1VQ6S 2MQQA 4NYZA 3MM7A 2XMTA 5F3TA 5KT3A 2VFVA 3QGGA 1U7LA 1NU4A 2K7KA 5B0GA 2FVQA 1I94F 2MZJA 3AY0A 5HN0A 1WF0A 4OJGA 2CPDA 3PJXA 4O23A 3B78A 1HMVB 2B0GA 2MJNA 4I0WA 4QPTA 4ED5A 1DTTA 5DM7Q 2DNMA 2AJ1A 2E5LF 5DS7A 5F9LA 2MKSA 4EGLA 5GADI 5D3GA 4IFVB 2DNLA 4USJC 1HI8A 3NLCA 1R8CA 2RU9A 4M5DA 3M32B 3SSSA 2HYIB 1S0NA 4ZPTR 2HNYB 4K50A 3N28A 3M9MB 3T9NA 1KLMA 2L48A 5H1SV 2ZH9A 3C46A 2JSXA 1E6YA 1RGVA 1FKOB 2AQ4A 2NUHA 1K9MT 1JWWA 2QIFA 2HHSA 3O8WA 4I6WA 4RZRA 3CCMS 2HVIA 4IDKA 4ES2A 4TQSA 4B3TF 1KFDA 1LOUA 4C97A 3RB6A 1T94A 1HWIA 2ILZA 4P6QA 3VZHA 2Q6CA 2BW2A 3H5YA 2HHUA 4J9OA 1AW0A 2CPHA 3DHXA 3IG1B 3L09A 5E3CA 2XWXA 2FLOA 1FE0A 3CJKA 2DGQA 4EFAC 1MU2A 3KOAA 5A8KB 3K8VA 2DHXA 2FJAB 2JVOA 4RWWA 1S1TA 1X9MA 1DZ5A 1X4EA 4OZLA 4QW8A 3G6ES 4ZVEA 2PA3A 2YKNA 1E6VB 3MMBA 4Y28C 2MKJA 4E