1RTHB

High resolution structures of hiv-1 rt from four rt-inhibitor complexes
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
436
structure length
420
Chain Sequence
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title High resolution structures of HIV-1 RT from four RT-inhibitor complexes.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 109
structure length 420
sequence length 436
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rthB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rthB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rthB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rthB03
3E51A 1TQLA 4WFZA 1FKOB 3KLVA 1LW0A 4NLVA 5DQIA 2QV6A 2C2DA 2B43A 1S1WA 1S0OA 5F9LA 3MFIA 1C1CB 4RW9B 4PQUA 1JLBA 3LAMA 1T05B 4ECUA 4OL8A 4TY9A 5KFRA 2BANB 2VG7A 3KK1B 1SV5B 3V4IA 2CKWA 1ZTWA 4TY8B 3KLHA 2C2RA 2FLPA 1YVFA 5HROB 1D1UA 3TAMA 4KFBB 4NLRA 5KFFA 3Q8QB 4NLTA 5L9XA 2W9BA 5L1JA 2YKMB 1N4LA 4PUOB 2BRKA 1S10A 3QIDA 1S6PB 4TQRA 1QAIA 5D3GA 4Y34A 3DOLA 2YNHA 5J1EA 4Q44A 5KG0A 1RAJA 3GILA 3KK2A 2IM3A 4ZHRB 4Q45A 2C2EA 3LP1A 3NGDA 5KFZA 3JYTB 2J6UA 2WONA 3BSAA 4TYAA 2D41A 5KT3A 3KNAA 1LWEA 3BGRA 1RT1A 3KOAA 4O4GB 3G6XA 4JV0A 1S9EA 4TXSA 4ZP7A 1LW0B 4IRCA 2ZE2B 4NLWA 4Q8FA 2ZD1B 4IDKA 5C24A 2R2SA 4K4VA 4ECWA 1JLQA 1LWCB 4ZP6A 4ED8A 3PW0A 2AGQA 3C6TB 2UVUA 2BRLA 4LSLB 4PQUB 1JLBB 3M9OB 1JLAB 3HVTA 3CJ4A 1JLEA 4WFXA 4RUAA 1C2PA 4ECRA 4IKAA 1RT4B 2WTFA 2AQ4A 1XR5A 3NBPA 4I7FA 4DL6A 3MEDB 4XPCA 1JIHA 1S1TB 3DRSA 3MECA 3EPGA 4ED0A 1EP4A 4KHRA 2E9ZA 5KFYA 5F8LA 3T19A 1VRTA 3BSOA 1N48A 3OL8A 2DPIA 5KFNA 2AX1A 2RKIB 2F8EX 3NKYA 1J5OB 4HYKA 3RAQA 3H59A 4K4SA 1Z4UA 5KFBA 5KG7A 5KFSA 4ZP9A 5I3UA 5D3GB 3QGGA 2IMWP 2OPSA 3DOLB 2YNHB 3MEGB 3KK2B 1QE1B 2IAJA 3DI6A 5F9NA 3MR3A 3UQSA 3MEEA 2CJQA 4KKOA 3PR5B 4KB7A 2V4QA 2WONB 3GQCA 4IG3A 5C42B 2YNFB 1JKHA 1LWEB 2IJFA 4J9OA 4H54A 3SI8A 1TVRA 1DTTA 4R8UA 4IDKB 5C24B 1T3NA 5KT6A 4JV2A 2GIQA 3QZ7A 1JLQB 3OLAA 4B3OA 4IOBA 1C1BA 1ZTTA 3DDKA 3MF5A 3MR2A 1RTJB 4F4YA 1IKXB 1JLEB 3FSIA 1TKXA 3V81B 2HMIA 1FK9A 4ZVGA 3DRRB 3CJ3A 2JEFA 1N5YA 4I7FB 4PWDA 3DOKB 2O5DA 4ECTA 4IQXA 1WNEA 5EWFA 4LQ9A 1S49A 4HKQA 1VRTB 5KFLA 3C6UA 4J9RA 2HNDB 5J2NB 5F8MA 3G6VA 1TKZA 1FKPA 4RZRA 1U09A 3H5XA 4K50A 1RTIA 2IBKA 4DL3A 2OPSB 4IH6A 4RNFA 5CYQB 4MKAA 1T03B 4K4YA 3GV5B 2FLLA 4JUZA 3BSCA 1QAJA 1RTDA 3DI6B 2ATLA 2VG5A 1TL3A 4YP3A 4F4ZA 4WYWA 4NCGA 2HWHA 1JLGB 3HVAA 4EO6A 1IKYA 3BQ2A 4IG0A 3DLEA 1S0MA 3IG1A 4Y3CA 5DLFA 3V6KA 1DTTB 2FJXA 1SH3A 3H98A 4URSA 3I0RB 4WE1A 4ZVHA 4ZPDA 1RT2A 5KG1A 5KG3A 1N56A 1BQMB 1RT5B 2W9AA 3RB4A 2UVVA 5DGBA 1CSJA 3NAIA 2OPPB 3FQLA 2E9RX 2FLNA 4KHMA 1TKXB 2W7OA 1FK9B 3LP2A 3LP0B 3KLFA 4RNHA 4GC7A 3KHRA 4KV8A 1N5YB 4IR1A 4RUCA 3DRPA 3BR9A 4MKBA 1TL1B 1SUQB 2YKNA 3C6UB 2UVRA 4I2PB 1ZETA 4RW8B 1FKPB 3FRZA 2RDJA 5DQGA 5DQHA 3DMJB 1R0AA 2WCXA 3D28A 4O4RA 3GIJA 4MIBA 1HMVA 1S4FA 5C25A 1MU2A 4NLXA 3RBDA 4Y2CA 3ITHA 2AX0A 1TL3B 2JC0A 1S1XA 4ED3A 4K4UA 4LQ3A 2RF2B 3PVXA 3IS9A 4NLDA 1IKYB 4KE5A 4QWEA 3DLEB 3Q8PB 4M94A 5J2QA 5KFJA 5HBMB 3IG1B 1RYSA 3T5LA 1HNVB 4MK9A 3BJYA 2DPJA 4K4TA 4ZVEA 5F8NA 4WE1B 2B5JA 1LW2A 5HLFA 4NYZA 4ECZA 1N6QA 3LALA 3KLGA 2XI3A 4XPEA 4R0EA 4EBCA 3HKWA 4QW8A 4H4MA 3HVWA 3BSNA 2B6AA 5KFUA 2FVRA 4RNMA 4J9KA 4RW7A 2HNYB 1SH2A 2WB4A 4YMEA 2ALZA 3DLKA 3QGIA 2V4RA 3DYAB 4ECYA 2YKNB 3UDLA 3MR6A 4J9MA 4NLOA 3CIZA 4ICLA 1S1UA 1IKWA 4FS1A 2XGPA 3H40A 1S9GA 3CDEA 3IN5A 2JLEA 3IRXA 1I6JA 1HMVB 3QIPA 1S1WB 3SFUA 4YQWA 4LSNA 2R2TA 4Q0BA 2XI2A 4TN2A 5KT5A 3Q8RB 2V9WA 1S1XB 3IS9B 3RB3A 4RU9A 2VG7B 3V4IB 4WXWA 2AGPA 3BQ1A 3KLHB 3OHAA 3T5JA 2J6SA 3KLEA 3RB6A 4JV1A 4WYLA 2C22A 2W7PA 2OH2A 4XO0A 3TAMB 5KFWA 2B5JB 4KSEB 5HLFB 5KFCA 4K4XA 1REVA 1RT6A 1RT3A 1LWFA 1T94A 1GX6A 1W25A 2W9BB 4O3RA 3CWJA 3GIIA 2ASLA 4H4MB 3FFIA 5KFXA 5J1EB 4NLUA 2IM1A 3LANA 1IKVA 2R2RA 3JSMA 1KHWA 5DLGA 3QO9A 3RAXA 4IFYA 4WZQA 3LP1B 4J9SA 4J9NA 4IFVA 4O3SA 4NLQA 5F8IA 2VA3A 3RB0A 4IRDA 3BGRB 2WOMA 4R5PA 1RT1B 4DG1A 2ILYA 4RNNA 1IKWB 1S9EB 2JEJA 1BQNA 4QWAA 4F4XA 1QUVA 1S9GB 5F8JA 1JLFA 1K1SA 4KO0A 3IRXB 2AWZA 4YR2A 5KFGA 4RW4A 5K14A 1RDRA 4FBUA 1HQUA 3KHGA 4IRKA 3ICLA 3HVTB 1RT7A 3PW5A 2BQ3A 5KT4A 4U7CA 3DLGA 4O3NA 3EZUA 1C0UA 4WZMA 3NBPB 3MTKA 4M95A 3CJ2A 3GIMA 3DRSB 3MECB 2XCPA 3GV8B 1EP4B 2JEGA 3KJVA 1RT6B 5KG6A 3OHBA 2I5JA 2HAIA 5KG4A 1JXLA 4YR0A 3OSPA 1D0EA 4MH8A 3FFIB 5I3UB 2FJVA 4WXOA 3I0SA 1DTQA 4FBTA 2VG6A 3FQKA 2RDIA 5KFOA 1IKVB 3KHHA 2IAJB 3JSMB 4QWCA 3QO9B 3T1AA 5HP1A 5CYMA 5KFPA 3MEEB 4KKOB 4FS2A 4TQSA 1RTHA 4IFVB 2IJNA 4IG3B 5DG9A 3V6JA 4ZMMA 4O44A 2EC0A 1JKHB 3TVKA 1S6QA 3E01A 4H4OA 4DL4A 4DL2A 3PZPA 1BQNB 3UPFA 2BQUA 2E9TA 1TKTA 1TVRB 1JLFB 4R8UB 3QLHA 1HQEA 4KO0B 1XR6A 3KLIA 4RW4B 1S1VA 5K14B 4B3OB 3IGVA 4NRUA 1HNIA 1C1BB 1FKOA 5J2MA 3PHEA 2WK4A 3ISNC 2HMIB 3H5UA 5L1KA 1C0UB 3I5BA 2W9CA 4PWDB 3CJ0A 4RW9A 1JLCA 1HPZA 2YNGA 1KHVA 4G3IA 4ZPBA 3KK3A 1RYRA 2D7SA 2BANA 3KJVB 3KK1A 1SV5A 4NLYA 4TY8A 1TKZB 1KLMA 5J2PA 3SFGA 5KG2A 2XGQA 4F4WA 1RTIB 2ASDA 2R8KA 5JUMA 3I0SB 1DTQB 4KFBA 2VG6B 2WHOA 2OPQA 5EWEA 1RTDB 3OL6A 4ED2A 2YKMA 2VG5B 5CYMB 5HP1B 1RA6A 4NCGB 5KFAA 4QW9A 3CO9A 3G6YA 4O44B 3UR0A 4IG0B 2R8JA 1S6QB 3E01B 4H4OB 3NAHA 4DL5A 3T5HA 4KAIA 5I42A 3KLIB 2I1RA 4KBIA 1RT2B 2IA6A 5DGAA 1HYSA 1HNIB 4O4GA 3BREA 5J2MB 2ZE2A 1S9FA 2ZD1A 1VRUA 3CVKA 5EUHA 4EYIB 2D3UA 5KFQA 3TQ1A 3LP2B 3MFHA 3KLFB 1LWCA 3OLBA 4KV8B 3PR4A 5KFMA 2W9CB 3C6TA 1JLCB 4LSLA 3DRPB 1HPZB 2FVCA 4WFYA 2HNZA 1JLAA 2YNGB 3CDWA 4I2QA 3KK3B 4MK7A 2BE2A 5F8HA 5KT7A 3QZ8A 1RT4A 2D3ZA 3N6NA 1DLOA 1KLMB 5J2PB 3CJ5A 4ECSA 3MEDA 2WRMA 1R0AB 1S1TA 1IM4A 2UUTA 4G1QA 2OPRA 5C25B 3CDUA 5KFEA 1MU2B 2OPQB 3PW4A 2RKIA 1S0NA 4QWBA 3ITHB 1J5OA 2IM0A 3BQ0A 3H5SA 4ECXA 3KHLA 3MR5A 4IH5A 3FDSA 3MEGA 3GV7B 5J2QB 1QE1A 3IGNA 1NHUA 3N6MA 4YR3A 3T5KA 4MK8A 4J9PA 3PW7A 3ISND 4ID5A 5C5JA 4URQU 5I42B 5C42A 1LW2B 2YNFA 3NMAA 1N6QB 4ZPCA 3H2LA 5JXSA 3KLGB 1HYSB 3OL7A 2JC1A 1VRUB 4ZVFA 1UWBA 3QYYA 2HWIA 2B6AB 5KFDA 4IR9A 2R2UA 3H5YA 2C28A 4RW7B 3H4DA 2BQRA 1NHVA 1S97A 3DLKB 2VA2A 1RTJA 4TYBA 2YNIA 2HNZB 2FVQA 4I2QB 5EWGA 1IKXA 3V81A 2AGOA 2BE2B 1GX5A 3DRRA 4RW6A 1DLOB 3KMQA 2FVSA 4ICLB 1S1UB 4NLGA 3DOKA 2XWYA 1RA7A 4ED7A 4ZP8A 5L1LA 4GC6A 4G1QB 4RNOA 2OPRB 1EETA 4QPXA 3QIPB 3M8QA 2HNDA 4MFBA 1C0TA 4LSNB 5FDLA 5J2NA 4Q0BB 3Q8SB 2FJWA 1NNDA 5DG7A 2W8KA 5KFHA 4ED1A 5CYQA 3RBEA 1T03A 5KFIA 2ZKUA 5F8GA 5KFTA 1OS5A 5L1IA 2J6TA 3DM2A 4Q8EA 3KLEB 3PW2A 4ID5B 1TV6A 1JLGA 4EBDA 1REVB 3GIKA 1RT3B 1LWFB 3V6DA 2R8GA 1HARA 2IC3A 4J9QA 2UUWA 4ZPAA 1UWBB 3PJWA 3I0RA 1XR7A 4NZ0A 1K1QA 3M8PA 2BR0A 4NLSA 1BQMA 1RT5A 3M9NB 4IFYB 3D5MA 4EEYA 3LAKA 2OPPA 1JX4A 2YNIB 2AU0A 4O3QA 3I5AA 4QWDA 3LP0A 5KFVA 5KG5A 2WOMB 4RW6B 4R5PB 4EBEA 3EPIA 4DG1B 2FVPA 4U6PA 1SH0A 2ILZA 2R8IA 2GIRA 5DG8A 5EDWA 4ECVA 2UVWA 1TL1A 1SUQA 3GYNA 1EETB 4URGA 3M8QB 4I2PA 4MFBB 1C0TB 5FDLB 5KFKA 4RW8A 2R8HA 1HQUB 3DMJA 3QGHA 2QE5A 1RT7B 2V0NA 4O3PA 4K4ZA 3G86A 3OSNA 3DLGB 5KT2A 3DM2B 1TP7A 1C1CA 1T05A 4Q43A 2RF2A 4DL7A 1TV6B 3VQSA 2XCAA 4ECQA 3PJXA 4MIAA 4X2BA 3V6DB 2I5JB 3V6HA 4TLRA 5HBMA 4K4WA 3HHKA 4ED6A 5HROA 3M9MB 1HNVA 2IC3B 3I5CA 4NRTA 2JEIA 2XC9A 2GC8A 3M8PB 4EYHB 2W8LA 4J9LA 4F50A 4PUOA 4Y2AA 4NLPA 1MMLA 4O3OA 2IM2A 1RTHB 1S6PA 4EO8A 4DEZA 2HNYA 2ASJA 1S48A 4IH7A 4ZHRA 5T14A 3NL0A 1TKTB 3JYTA 3N6LA 3QLHB 1HQEB 3DYAA 3OL9A 3H4BA 1S1VB 3KMSA
chains in the Genus database with same CATH superfamily
3K5OA 2DRAA 2RU3A 1RWPB 1ITPA 4NLVA 4PWWA 1H2TZ 2DNGA 3AFGA 3Q2SC 4KTQA 2XY5A 4UUXA 1T0TV 5FIIA 2CG8A 4N5SA 3IO1A 3O8WA 3Q8QB 1S10A 2GHVC 3NS7B 4ED4A 5IQQA 4OLPA 1H6KX 3O2IA 3MM7A 4O4GB 5GAEU 4WPAA 3X3UA 3HMJG 3M9OB 3BO3A 1VIOA 3CJ4A 1F1BB 3IR7B 4ECRA 2H48B 1E6VA 5H9EJ 3PFEA 4I7FA 1KVJA 3EPGA 1YJ9S 5KFYA 3T19A 4N77A 2AYBA 2RHSB 2XZWA 3DOMB 1UEKA 5EX3A 5CCMA 3GMGA 3W9IA 4J9OA 4WFBQ 2R7UA 3MM5A 2XY7A 4B3OA 4PG8A 3ENAA 1NM2A 2H51B 3M32B 3AD7C 3BV8A 3UN5A 4PWDA 4FKYA 4C97A 1MLAA 3MCOA 1DQ9A 2IBKA 1P9YA 4YP3A 1S99A 1SJ1A 3IG1A 4F3QA 2FHOB 2YQ0A 1U49A 3BYRA 4WE1A 2AZ1A 2MKHA 1DRZA 2Y1JA 2FLNA 2VZ9A 4CH1A 2IFXA 4IR1A 4ILRA 4TNOA 2MKYA 4JI4F 1VK8A 2IYIA 5K20B 1F3FA 2DEIA 2JC0A 3PVXA 1CS4A 3CJKA 4NLDA 3MUMP 3DLEB 4K4TA 4ZVTB 1X9SA 2XMMA 5CXTA 4WIQA 2J8SA 4PCQA 1WEXA 2V2VA 2B6AA 1U26A 2ALZA 2Z4PA 1SQEA 2QA2A 2NYIA 2RU9A 1UJ6A 1KFDA 1BUXA 1S9GA 2VH7A 4WU2A 7FDRA 2XI2A 1NSQA 4RUHA 3W5ZA 1NRKA 2XMKA 3RB6A 4DR5F 1IBKF 1X4EA 1LWFA 3NWGA 5F41A 2V2QA 5F0WA 1AUSL 2IM1A 2GMLA 3L7UA 2OJ3A 2KYZA 3AJDA 4ELTA 2DR7A 1RHKB 2MKCA 4I56A 2YWEA 1L3VA 4FBUA 3PACA 2KKHA 4O3NA 3DRSB 2E66A 3OR1B 1O0PA 1T9XA 1N52B 2GMHA 2Y3YA 3TZXA 4FBTA 2RDIA 4QWCA 2BW7A 5FLXU 1TR0A 1HNZJ 3Q8UA 1SIWB 1U45A 3B82A 3BGLA 1EAYC 1OYEA 1WC6A 2QEXS 2P5VA 5LSRA 4IUFA 4CTAB 2RUGA 1HBOB 3I5BA 1T02A 5B0DA 2XB2D 5DS7A 4DN9A 2H54B 3KJVB 2RRBA 4NLYA 2HFSA 2CQ2A 5J2PA 4RKUC 2VG6B 2PEHA 4NCGB 5HI7A 1ZAVA 4OMFG 3G6YA 2DNQA 3G71S 2K7KA 1CG2A 1SJFA 2Y1RI 3M6UA 3RG6A 4CZCA 5E2QA 2IIHA 2XTJP 3AOCA 1RT4A 2E7XA 1KLMB 3CJ5A 3KKFA 2N7YA 3I96A 2NUUG 1S0NA 2X1AA 4LF7F 3MEGA 3GV7B 3WX8A 3HZEA 3VAMA 4LFAF 5C5JA 4AFFA 2DHHA 3G82A 1UWBA 2C28A 4LSZB 3V81A 2XYGB 1VBKA 3MAHA 4QBUA 3QJJA 1OMSA 2VV5A 3M6WA 2N7CA 1NB7A 3CF5Q 3M2UB 3IBWA 3MM9A 4QIGA 2ZH1A 4F2RA 1K1QA 3W65A 4EEYA 4O3QA 2FVPA 1M1KT 4M5NA 1FD8A 4MFBB 4U9RA 1HQUB 3R5DA 1B7FA 2CQHA 2VC1A 2GVDA 3T3FA 1F9EB 3HHKA 4ED6A 4Y65A 2R4FA 3THTA 1M1HA 3RTVA 3T9NA 2YTCA 2W8LA 4DV1F 4YFUA 4OFZA 3RRHA 1NJYA 4DSJA 1S0OA 1RK8A 1HR0F 4LR7A 2CADA 1FXRA 1SV5B 1HIYA 2C2MB 4DLGA 3LO3A 1DQAA 2HLUA 1MN7A 4BWJA 4UF4A 1T9WA 4C8KA 2BEFA 3FBEA 4DQSA 2W1BA 2ZOGA 3DOMA 5M2RA 4ER8A 1NO8A 1I5OB 2YH1A 2D74B 4Q8FA 2QN6B 3PW0A 2M2BA 1LEOA 2OD4A 1JLBB 2V8HA 1ZAXA 2LEAA 4F7VA 1FJGF 2P9GA 3TZWA 5KG7A 3G96A 4S0MA 1EX8A 3D66A 4UOHA 1L3KA 4IG3A 2YNFB 3ZZPA 1WWHA 3RZAA 5KT6A 1Q86T 4ZN1A 2HQ3A 3HSGA 3A4TA 4V1Ak 3DRRB 3CJ3A 3VF0B 3LF0A 1F5CA 2HNDB 2EKYA 1C4CA 4DL3A 4RNFA 1VQOS 2VPWB 2DGUA 1RTDA 2A6MA 3J7ZT 3OQ2A 4DR4J 3DLEA 3ZZRA 3NNCA 4EWTA 4JBCA 7AT1B 1OQ3A 1S4EA 5HQLA 3LP2A 2I38A 5IM0B 4P7VA 4IOCQ 2DNNA 4Y00A 2BABA 3CW2C 5J2QA 3T5LA 4MAKA 4ZVEA 2ZJQQ 1YJUA 5DZ6A 4OHVA 2HHWA 2DRDA 3BSNA 2QYGA 3AQOA 3GSIA 3ZXWA 4DR6J 3IN5A 4JI2F 1X9MA 1I6JA 4C8OA 1UPPA 4TN2A 1RWWB 1ZBTA 2KT5A 2GO9A 3OHAA 3ILOA 2HBYB 2ROGA 4UZBA 3OR1A 5GAGU 5M2PA 1LQ9A 5LOQA 1GX6A 2VBXA 4F36A 3FZBA 3CCVS 1KHWA 2R2RA 3ENQA 4UQGA 3QT8A 2AJ2A 4DG1A 2G2YA 5LSLA 3DLHA 2QO3A 2CIMA 3D1QA 1V6HA 2OGUA 3NBPB 3MTKA 3CJ2A 3VR1A 4B08A 3KJVA 4X65F 2I5JA 3A8KA 3EVOA 3FBCA 3FJ2A 2VG6A 3I82A 2KH9A 4CT8A 2DGQA 1SJRA 1RTHA 1J2VA 1YWXA 1JWWA 3M30B 2E9TA 4BC7A 1BQNB 4B17A 5D15A 1XC9A 1VBYA 1FD2A 3GG0A 3ZZTA 2R7TA 4MJKA 4NXNF 2HSEB 1KLMA 1VQ5S 2XGQA 3BDEA 3AD9C 3VAGA 3OL6A 3VALA 1MG7A 2OSQA 2HYIB 4ED5A 5KFAA 4IG0B 4USUA 1RT2B 3D4JA 4LR8A 3N4WA 3CVKA 4FYVB 3EUNA 3D0IE 5KT7A 1KBRA 5C2CA 1KTQA 4L6V3 4K59A 5GAEI 4MYUA 4C3MA 5I3PA 3N9UC 1XEZA 4C0BA 4IH5A 2CG4A 3E8OA 5BYQA 4DUZJ 4RU2A 2DEJA 2MKKA 3NMAA 3AQPA 3CMQA 1NHVA 2ZM6J 3NOCA 3DLKB 3BKTA 2DH8A 2JFDA 4XTTA 4QOTA 1J5EJ 2RMLA 3CCUS 3TJ8A 4NLGA 2F1FA 1U2RA 1U1MA 4ED7A 4MFBA 4LSNB 2VASA 3MCSA 3UR3C 2LU2A 5J1PA 4Q8EA 4C3LA 4D3GA 3PW2A 4ID5B 1MWYA 4LF4F 1OSCA 1NDPA 4A47A 2G0CA 2DO0A 2E5GA 1N88A 5G4DA 1Q16B 3UCUP 3M8QB 1R0CB 1IXKA 3C8YA 3BPDA 4Q43A 2XCAA 4E0DA 2B4UA 3L9ZA 3OTDA 4KHPJ 1YJNS 2V2KA 4F50A 4DEZA 3N6LA 2J0QD 3UCGA 2HAIA 2QMWA 2EG1A 2QV6A 4TU7A 5FLXY 1JLBA 3TA0A 3C46A 1R8AA 1YVFA 3VAJA 2XULA 4B3TF 4CM2A 2BM0A 3PG9A 5IXUA 2F8MA 2ZH5A 5B0GA 4PG7A 1S76D 3LP1A 4HT7A 3PX4A 1SPBP 5KT3A 4N7TA 2EEYA 3OTOF 1RT1A 2YWKA 1F6TA 2K3KA 2XZDB 1REGX 4LSLB 2KXNB 1CEZA 4BWMA 4X4PA 3HO1A 3TR5A 3JSYA 3MECA 2HHTA 4KHRA 4PPDA 2OFHX 1J5OB 4LFBF 2E29A 3CC7S 3BPSP 2V34A 4X4VA 2XSJA 4DR3F 1ZM4A 2V8VA 1M5HA 3N5FA 2QLBB 1KQGB 3VAFA 1UVJA 1H2UX 4U7UD 3R5GA 3MAAA 3D1OA 5IM0A 5E7OB 4LQ9A 4NE9C 3W2VB 2OD6A 3PIPQ 3TQEA 2MKIA 2Z2MA 1TKZA 2JDJA 1RHJB 3TAQA 1UFLA 5A8RB 4Y2KA 4NOHA 4B9NA 3LTOA 1WKLA 1F60B 1PGZA 2VKRA 3BKFA 4RPFA 2LFVA 1U02A 2M52A 1KVKA 3W8PA 1RT5B 2ZBPA 2E1RA 2E9RX 1IBLF 1FK9B 4X66F 4RNHA 5D0HA 3FRYA 1KS2A 1WHYA 3C6UB 1ZETA 2PN6A 2F4VF 2IA0A 2XMJA 2NPFA 4ED3A 2ZZTA 4HI1A 4MK9A 1FESA 2HFUA 4JI4J 3CDBA 3HHLB 2VL1A 4WWSA 2HNYB 5DZ7A 4OLOA 1FX4A 1Y3JA 1DHMA 3KG4A 2XS2A 3TUZC 4G6VB 3BGUA 2ZOMA 4Q5VA 4PWUA 3HKZD 1RAIB 2V4JB 4DR5J 1IBKJ 2VICA 2B0GA 3GLJA 1BQNA 2HFOA 3GCWP 2E5JA 1VBZA 4IRKA 2J7UA 1RT7A 2LU1A 4AL5A 2MY7A 2CPJA 2XCPA 2UXDF 2DGVA 1TL7A 2XG8A 1IWAA 3TOQA 4C98A 4HTJA 3CCWA 1MNEA 2EPIA 3ILLA 1TVRB 2ZWPA 2FJEB 3HZGA 2WK4A 3ZNJ1 3I4PA 1GK8A 5L1KA 1WC5A 4DSIA 4W92B 1LFWA 4ZPBA 5JUMA 2P2CB 3FBBA 4C3KA 2JNJA 4OI1A 1JJCB 3KTQA 1PILA 4LBPA 4B9TA 3S7RA 1RWXB 1MN9A 1MROA 1HNIB 1RHRB 1UETA 2OHDA 1X4AA 2CDRB 4X4UA 3OBIA 2JZ5A 1N0VC 2EXUA 2DNHA 3LWLA 4CM0A 2ADCA 2YKQA 1VRQC 4J7CA 2I0XA 4XK8C 1HBNB 4J9PA 2HW3A 4ID5A 2RH3A 2OKQA 3TVYA 4NYOA 4B9VA 1H2VZ 3RAMA 2J0SD 3IBFB 4ZVFA 2VJUA 4RW7B 1OO0B 2Z8QA 2MLZA 1TZ0A 4TYBA 1Z2LA 2RRAA 2FVQA 1B70B 4LFAJ 4X4TA 1VFJA 2CQBA 3OFEA 4RNOA 1CJTB 4I6YA 3EVWA 3M8QA 1R8PA 3EE3A 2HS3A 1CBKA 3O44A 1OS5A 3PKMA 4EBDA 3EWGA 1RT3B 4FXWA 4HACB 2V69A 4NZ0A 2MQLA 1WOPA 2KFZA 1FCAA 4DFPA 2OPPA 2YNIB 1PIEA 4K5SA 1VC6A 3I5AA 2HK3A 4I6AA 3MXHP 3N28A 5GMKa 4RW6B 1QSSA 3RBXA 2HBRB 1NJXA 4PG4A 1EETB 4URGA 3RGIA 3W64A 3V4MA 3OR2B 4DV3F 2G2ZA 4DL7A 1DAXA 5SZTA 2DR5A 1BHNA 1F2GA 5HBMA 1L3SA 3SZ2A 2DIVA 2CJBA 1AFJA 5AE2A 3KWMA 4NLPA 3WC2A 2IM2A 4NX9A 3NL0A 1NBEB 4ZIVA 1HQEB 3W66A 2YX7A 1MMDA 3Q22A 4B3SF 2AZ3A 3UD3P 4WFZA 4DV1J 1KSPA 2C2DA 1UA1A 2JJ4D 5IV3A 2VG7A 2VBZA 3KLHA 1KVIA 1VQ9S 2HEKA 2DT9A 3HFKA 5EN1A 9ATCB 1HR0J 4Y34A 1FKAF 2YX4A 2W25A 4ZHRB 5ETPA 2C2EA 4A46A 5GAGI 1H98A 4JV0A 4TXSA 3UE2A 4M5DB 3NY0A 1YI2S 3BM7A 4WFXA 1E6YB 1RHUB 1EP4A 5B7WA 3NKYA 3RAQA 3QGGA 3ZZUA 5F9NA 3NGSA 2PIIA 1FJGJ 1YKWA 2W01A 1YDLA 3CCLS 2ZBIA 3FSIA 4U7UK 1FK9A 1IBCB 4RWXA 1TL5A 2UUAJ 2DJWA 5ETRA 1SXLA 3C6UA 5J2NB 3G6VA 2M7SA 5DO2A 2DGTA 3NLCA 4I69A 2HWHA 3AB2B 2FJXA 2LEBA 1ZA2B 4ZPDA 5DGBA 3MI7X 2GMJA 3NAIA 2CUYA 3TNVA 3HHLA 1CLFA 3CIMA 3KHRA 4WTYA 2BVZA 2HS4A 4MKBA 5U47A 1HHSA 4I2PB 2H65B 2MGZB 1N36F 1AXQA 1Q53A 4JYAF 2RF2B 1YJRA 4O0IA 1RYSA 3Q8YA 4ITSA 4USKA 3BJYA 4DPWA 4M8LA 2KJWA 1FDDA 1RTZA 5F3ZA 4QW8A 2HFNA 4J9KA 2YQ1A 2VPYB 3SIPB 5LMUJ 3CDEA 2JLEA 1HWKA 2RQCA 2V9WA 1IQZA 2CZ4A 2LMIA 4NZ7A 3T5JA 4WYLA 2FC9A 5I3QA 3TAMB 1D8YA 4PYDA 4KSEB 2ZUAA 4JI2J 3HHDA 2DH9A 3FVYA 3HD1A 1RAAB 5B0EA 1RHQB 1RCOB 3DXBA 4J9NA 1IKWB 4ZJLA 4TKTA 2ZJRQ 3BYPA 1XTZA 2POKA 2XWXA 1KD1T 3H2UB 2K2PA 2BDPA 4HHHA 2XMAA 4USHA 3S01A 4FDFA 2IDLA 5A76A 4WXOA 3IFEA 2NQPA 2NS1B 3EZ5A 1EZZB 4E8UA 1WC0A 3I87A 3JTPA 3ADAC 4KGXB 4DL4A 3L3CA 5CHCB 1HNIA 3MD3A 3DCAA 1WG1A 2BKOA 2HMIB 3H5UA 2BANA 3KK1A 2QSFA 1PYOB 5L46A 2BBEA 2FIUA 4TY8A 4C11B 4CP5A 1DY3A 1RTIB 2R8KA 4M5IA 4CLSA 3PY8A 3BGOP 2HZAA 1HBNA 4NXNJ 2Z2YB 2J7KA 4F26A 4I4BA 5KFQA 1EHWA 4KV8B 2W9CB 3BO4A 3QATA 3J7YU 3EJMA 2AEJA 1CC7A 2MDAA 3UN3A 4FN5A 3PJ9A 2MMYA 1CJTA 5KFEA 1MU2B 2ASYA 3BQ0A 3H5SA 4W98A 4FF1A 3GJSB 2F9DA 3DFEA 2KXHA 3BBFA 4N56A 5C7PA 2CPFA 3G4SS 4HACA 4ATNA 2BJ9A 5KFDA 1K0TA 2BQRA 3I31A 4YB6A 3FCHA 2YNIA 2CPHA 4RW6A 3OXFA 1SJ4P 3W3SA 4ICLB 1GTEA 4LJMA 1EETA 3QIPB 5K8PA 2FJWA 4C8ZA 4DUYF 2ROPA 3OR2A 4JP8A 3ZNUA 1S0VA 2R8GA 3OXGA 3RW6A 1PJ7A 2KRRA 1JX4A 2DCLA 2PE8A 4OX6A 2N4CA 4B9SA 2EC2A 1P6TA 2FY8A 2C2ZB 4LF4J 3UVJB 3MEKA 4FPRA 3MD1A 5KFKA 2OI2A 2H5JB 3OSNA 4NXMF 2VFUA 3DHWC 2WVEA 1ELOA 3PJXA 4GKJF 2JLFA 2DGXA 4LVNP 5IT9U 5D77A 4ZHRA 3QLHB 2XO7A 4HDHA 3ZZ0A 4BLGA 3GONA 4M5DA 3SSQA 3JSRA 4GKKF 1C1CB 4DZDA 5HL7Q 4ZVQB 4C6AA 2MXYA 4KFBB 4A8FA 3UDEA 2YKMB 4DX7A 3BH6B 3TP2A 2IM3A 1NJZA 1FEEA 3NGDA 4J5OA 2MTLA 1PJ6A 4CDIA 4B3TJ 1FERA 2ZE2B 4LRCA 4QQBA 1G4CA 4ED8A 4LF5F 1JLAB 4PR6A 3TAPA 2CYYA 2AQ4A 2OMOA 3OTOJ 3LPEA 3BSOA 5A8WB 3OL8A 3D0GE 2MLXA 4ZP9A 3NCPA 4UY8T 1F0XA 2ZZMA 3FGVA 4R8UA 4MIWA 3NCRA 2CPZA 2VBYA 4LFBJ 1UJ5A 2BE7D 2C2KB 3PRBA 4DR3J 2MHNA 2VOPA 2VF3A 2LP4A 3QRQA 3P45B 4JV5F 1UCNA 4K4YA 4F2SA 5AXKA 4DLEA 1XMBA 4X64F 4F4ZA 3HT3A 3Q2TC 1UWAA 5DLFA 1WD6A 1SH3A 5EHHA 3I0RB 1A7GE 2HHHF 1SIZA 3FQLA 3AXKA 3A1YG 3PEHA 4UTGA 4OX9F 4RW8B 5DQGA 4RL1A 3D28A 1FNOA 1IBLJ 1FO1A 4X66J 2DY1A 5KFJA 1HLWA 2FHKA 4FP9A 3T6BA 2F4VJ 4R0EA 4DV0J 5L38A 1NZ8A 4CLTA 5KFUA 4WFAQ 7FD1A 3BDPA 4OYWA 3Q83A 4CYUB 1G2EA 3PFOA 1IKWA 4F3OA 2EFNA 4ZKAA 4LT6A 1O51A 2HKEA 2KTQA 1GMVA 3CJRA 2JHEA 2K1RB 1H74A 2E5HA 1QSLA 5J1EB 1MMNA 3M8SA 5D4PA 2VA3A 3JAMU 4F4XA 1NPPA 2VONA 3TX8A 3QNWB 4A4JA 3DGPA 5KT4A 4WZMA 3ET6B 3L7PA 3KDNA 5JJBA 3U27A 4C11A 2FJVA 3AY0A 3FEZA 1O8BA 2DNLA 1LOUA 4A8XA 2LXUA 3PKYA 2UXDJ 3SCLE 2HVEA 2E5IA 2C1EB 2W9CA 2V63A 4M5MA 1FDNA 3K89A 1N32F 1VS3A 3EXYA 4YOEA 4KAIA 3EYZA 4OYIA 3UD4P 1KOHA 2UU9F 4ZLNA 2H3EB 4LR9A 1KQFB 2U2FA 4P71A 1R0AB 4CRJA 4ZCIA 1VOMA 3M8RA 3CCMS 3QWPA 1NHKL 4FVMA 1GNKA 2RJZA 4P2SA 3IGNA 1TKDA 3AAWB 1FI4A 2XLKA 1RWOB 1HYSB 2MKSA 1ZH5A 4CIOA 4ZCLA 2VB6A 4B3RF 3R8YA 1IKXA 1U8WA 3KMQA 4OJHA 4Q7AA 2FTRA 1YRTA 1IR2A 1O5JA 5GVQA 5HMYA 2PMZD 4L75A 3ZC4A 1LKZA 2BACA 2A0FB 2RS2A 3G2XA 1SB6A 1VQ6S 1SC4B 4KY3A 2MJUA 2AMCB 3D5MA 4DN0A 4QR1A 2WOMB 3T1YJ 3TUJC 2GIRA 4ECVA 1FRIA 4IYQA 2ZH7A 4WIIA 2QE5A 1KNZA 4ANEA 3DLGB 4LUBA 1C1CA 3I9V9 1R43A 2XY6A 1Q7LB 4OI4A 4WP8A 4O3OA 4DV3J 1HI8A 2UP1A 4P6QA 4IH7A 1IR0A 5T7LB 1U6BA 4OX7A 1ROFA 2QIFA 1NH8A 4F0KA 3RR7A 4F02A 4X4QA 2GZOA 2R7QA 3KDOA 5KFRA 4OQJA 1UVNA 1SKRA 5HROB 2BJ8A 4X84A 5A8WA 4NLTA 2ZH8A 1B7YB 1YZ7A 2DR9A 4UUWA 2ZH4A 4Q44A 2V67A 2HFZA 4Y6IA 1Q8LA 5ADZA 4NZ6A 1VMBA 3KOAA 1S9EA 2KO1A 9RUBA 1HBMB 1WTBA 3THVA 4K4VA 1N5VA 1QAYA 2Q79A 4PQUB 4FYWB 2RIJA 2HVZA 5BXIA 4E2FB 2DIUA 5F8LA 1V9OA 3P8BB 3A8EA 5KFBA 5KFSA 4ZLLA 4QU7A 4DWIA 2XO6A 3PYFA 1UVIA 1RAEB 3M8YA 4H54A 3PNIA 2ZHOA 3MMCB 2GIQA 3DDKA 5RUBA 3ENVA 1JLEB 3DOKB 4IQXA 4FF2A 3MWBA 3CGIA 4J9RA 2AIRB 3H5XA 3HI9A 2GFFA 1G7CB 3A3PB 3WC0A 1JLGB 4Q2MA 5MLCV 1LV5A 2Q1LA 3Q8VA 2GS8A 2CQ0A 1Y10A 5ETNA 1PO6A 4ZITA 2VOOA 5B0FA 4DV6F 1Q7YT 4RBTA 4JI6F 3K8WA 1PSDA 3A3OB 2VUGA 4K4UA 3J7YI 1IKYB 1RGVA 5ETLA 3KJFB 2K1RA 4FYDA 2RRNA 1NAQA 1N36J 2UV8A 1N6QA 2ZJPQ 4XPEA 3HKWA 4J90A 2IRXA 1WOSA 1KONA 4JYAJ 2ACYA 1VISA 4HL9A 2VDHA 3K59A 4ECYA 4J9MA 2KB2A 3MTJA 1X60A 2LQ8A 4CQ1A 4ELUA 5IT9Y 3CCRS 3MPYA 6AT1B 2GO8A 3ET6A 2ZBCA 2DGSA 2OP5A 2C3UA 2R7OA 4NLUA 3T9ZA 2ACMA 2RQ4A 1MW7A 4IRDA 1K73T 3THPA 5EX0A 5KFGA 4OHZA 2YH0A 2CZVC 1TUGB 3FCWA 2HVHA 3VGVA 5KG6A 5IZHA 1A6LA 2FD2A 3CCTA 2X7IA 4OJ3A 1XBWA 5I3UB 3KHHA 3SDEA 1WJ9A 1HWJA 2JFKA 5HMZA 1URNA 3HD2A 4CO3A 4RW4B 3BO2A 2DTJA 2VPXB 2PDAA 3EXCX 1C0UB 2PEBA 2QA4S 1KHVA 2D7SA 1NSKL 2F40A 4CLLA 5KG2A 1D09B 1RADB 4IO1A 2ZH9A 3I0SB 2KG1A 1X5TA 1PBAA 2A6OA 2CAJA 1CJVB 1L5UA 2AYGA 1HYSA 1WSVA 1S9FA 3B6BA 1KOOA 3NGUA 2GNKA 1OY8A 3N6NA 3SQGB 4DFKA 4X4OA 5HJXA 4ECSA 1IM4A 1NPKA 3ITHB 4ECXA 1U2CA 2MB0B 4I64A 1K9MT 2QLWA 3D6HB 3LGMA 4DPYA 4LBIA 1NLKL 4K7QA 2RS8A 4N76A 4ZCKA 3OJSA 1KEKA 1GXUA 1FA0A 5KFIA 5L1IA 1CJUB 3KLEB 1FRKA 3OFFA 1X4HA 4FZVA 4LF1A 2UXBF 2XBPA 1VK3A 4AL7A 2BR0A 1HD1A 4DUYJ 2H4YB 2QG9B 2G13A 4FF4A 3J81j 2B4VA 5T7LA 1NK0A 3GYXB 2MLYA 2VODA 4WU3A 1YG0A 1OIAA 3JAMY 1TV6B 2DGWA 3NRBA 3V6DB 2CQGA 2BX6A 5HROA 1OYDA 3CTRA 5BR8F 3QGPA 2ATCB 4J9UE 2FLOA 4NXMJ 3ENWA 2A2CA 4A8QA 2ZH6A 1S48A 4GKJJ 3VZHA 4FNIA 1HBMA 3IWLA 5DQIA 2ZEJA 4DV4J 5F9LA 1WKKA 2KFNA 4PQUA 3V4IA 4QZVB 1RBAA 3PRDA 1S6PB 1QAIA 2P8IA 3GILA 2RNEA 4F04B 4GMKA 1G6BA 3M1VB 3BGRA 3MMCA 2ZD1B 2SXLA 3HVRA 4WBFA 3MCNA 1SKSA 1JLEA 4DJBA 4QU6A 2YWHA 4LFCF 4HI2A 3ILIA 3G8TA 4DSEA 1QY7A 2BKPA 3GE9A 1P8GA 2WB1D 2BOAA 2LQBA 1JKHA 2PSZA 1T3NA 4DZ6A 3K5MA 1B0PA 2HGMA 4E98A 2N3LA 1RTJB 1R8HA 3KNGA 2XSFA 4NMXA 1SL0A 2KJVA 4P73A 2HHQA 4U8YA 3QRRA 3R6LB 4AXIA 2FLLA 4DR1F 3NGRA 2HRYA 5GAHU 4EO6A 1IKYA 4DCJB 4H4KC 4ZJOA 1NK4A 3V6KA 1FFSB 4URSA 3M2VB 1UPMB 3L09A 1RZMA 4GC7A 1S57A 3HULA 4OHXA 1FWLA 4HVZA 1SVDA 1TL1B 2YX1A 3US5A 2DR8A 3M8ZA 2HHHJ 2ZWOA 4DV2F 4NLXA 2GGPB 1P27B 4OZ0A 2AX0A 2CDQA 2QLFB 2EWHA 4O23A 4RUBA 4OX9J 4XDCA 1OPZA 5HAOA 1LW2A 1HBUB 5E3AA 4J9VA 2UZAA 4OHWA 4EU0A 2LLZA 3UDLA 3I6PA 3DRXA 3H40A 1WC3A 2EFVA 3IM8A 3QMQA 1FNMA 4R0JA 2XLJA 4Z2XA 2W7PA 2CQ1A 5HLFB 1ULRA 1REVA 1ZA1B 3I55S 2ZZNA 4IFYA 5F8IA 1AUDA 1KLNA 1FTRA 2G4BA 4RW4A 1Q8KA 3DKDA 4CO1A 4ZIWA 2RDDA 3ICLA 2F7VA 3EZUA 1C0UA 1TELA 2FGOA 3AA9A 2PO4A 3H8YA 3ULHA 3GTYX 4A8KA 3I0SA 1IKVB 2BUNA 2JH3A 1VLYA 5CH7B 3MEEB 2ZDOA 1CJVA 2KRBA 3UPFA 4MT1A 5KOWA 2EG2A 2H5IB 1XIQA 4N8NA 1VQKS 4F0HA 4RW9A 3AB4B 1KQSR 1HQ2A 1P1TA 2G0JA 2BE9B 3SQGA 4F4WA 1Q81T 5CCLA 4OZ3A 5CYMB 1RXOB 4RO0A 3R27A 4K2JA 3NAHA 3PX6A 2VBWA 2A18A 1GMWD 5AE1A 4YDDB 3TJAA 1U47A 1SC6A 1N32J 3B4MA 1WC4A 1NJWA 3LH2S 3WIUA 2UU9J 1HHQA 2RVJA 4DPXA 1FXLA 3SV3A 2WSCC 3FDSA 1CJUA 2J76E 1BGXT 3KLGB 4P2FA 2JC1A 1VRUB 2R2UA 3H5YA 3W1YC 4WKRA 1IUJA 5D4OA 1ZZFA 3G8QA 1HNXF 1S1UB 3F56A 5L1LA 5LJ3Y 3Q8SB 2AJFE 4B3RJ 4LREA 2JSXA 3QSIA 2LQJA 1TV6A 4UOFA 4I1TA 3V6DA 3W9JA 4EUVA 4J9QA 3OTCA 1YTYA 2L9DA 3FSXA 2MJNA 1WF2A 3LP0A 2DKOB 5KG5A 2D9PA 3KUGA 5A6PA 4U6PA 2O01C 1SUQA 1APSA 1IBMF 2F65A 4PXCA 1T9UA 1KDNA 3PX0A 4MIAA 2DRBA 3R97A 3CUNA 1HNVA 2IC3B 1CQNA 5GMDA 4Y2AA 4A48A 1IVZA 1S6PA 1Z1ZA 3H90A 3D6FB 1TKTB 3DYAA 2V94A 3M1VA 1RWKB 3D68A 2R7WA 3FZ2A 2V9KA 2CJAA 1Q4RA 4IOAQ 3MM8A 3FBFA 3B8HA 4OL8A 1QD1A 3OUYB 1PAEX 3CJTA 1SL2A 2FB0A 4ZVOB 2XMVA 1VC0A 3F44A 2Q6CA 2WW8A 1U1RA 1ZPWX 3CMAS 1LWCB 3C6TB 4ELVA 1ZPVA 4IKAA 3MEDB 1PYSB 1S1TB 3N0VA 1NSPA 1NEEA 3GFYA 3H59A 5D3GB 1HD0A 3AOBA 5HJYA 5JVHQ 3MR3A 1FRXA 4DX6A 1A0OB 4KB7A 1KQKA 2BJ7A 1RB0A 1CULA 2NXCA 4IDKB 3QZ7A 1BQXA 4B3MF 3MR2A 1N54B 2ALYB 5ITHA 2I2YA 4L72B 1AYEA 1S49A 1TK0A 2V8GA 1Y9OA 3KJNB 5F8MA 4EI2A 1DZ5A 2E5LF 3KUEA 3HX9A 5CYQB 1T03B 2JL9A 2GGPA 2VG5A 4WYWA 2HQIA 5LXYA 2F9JA 2LDIA 2UVVA 1BQMB 3LGNA 2WVBA 4QIWD 1X5PA 2BMBA 5AJ3J 1KFSA 3DRPA 3FRZA 3DMJB 4O4RA 2ZBRA 4MIBA 5C25A 1S59A 2YVSA 5CAAA 4P2MA 2NXEA 3DLLQ 3LUYA 4DV6J 2FDNA 2F5GA 1AW0A 3BR8A 2CPEA 2M4MA 2E1AA 4JI6J 5HLFA 2XHCA 2KDOA 2AT1B 1JJ2R 2YKNB 3MR6A 3SXLA 5IS2A 2NPIA 1U0HA 4KYZA 1S1WB 2EFOA 4EZ6A 2MPUA 2RE1A 4WXWA 3GFZA 3CT9A 2OH2A 4O3RA 4KPYA 2W9BB 3H7HB 4CO4A 1RABB 3CWJA 3CD6S 1IKVA 3AT1B 3C3LA 3IRXB 2OMLA 1R31A 3HVTB 2YWGA 3VHQA 3OTEA 3W2WB 3SBMA 3EMTA 4X62J 3LPYA 1IR1A 2A1BA 2IAJB 3M05A 5CYMA 3MM6A 4KKOB 3TVKA 1X5SA 3D6TB 2JLGA 5LM7E 1S1VA 4NRUA 1C1BB 1Q78A 3OD2A 4LRBA 3VV2B 3PIOQ 4G1IA 4NL5A 3RJMB 1GAOA 2NXUA 1SKWA 5EWEA 2GJ2A 3TA1A 2IRYA 4EMDA 1YZ6A 2C3MA 1U6ZA 3KLIB 4O4GA 2L9NA 1VRUA 3R3TA 3KLFB 4M5KA 2GJFA 3TWZA 1W2IA 2YNGB 5M2UA 2O3DA 1B4SA 3CDUA 4YY3F 3K5NA 1WF1A 4CCHA 5FJ4A 2KFYA 4EK2A 1HNWF 1GQEA 1WACA 4C9DA 3IXQA 2FJBB 3D67A 5CYJA 2BE2B 3M32A 3NMRA 2MQOA 1WSRA 2YWFA 4Q0BB 1RLDA 3UO0A 1PC5A 2GW8A 1AFIA 3U1LA 4I6WA 3E3XA 1HARA 2F4FA 3TARA 2IC3A 5E5NA 4ZPAA 1XR7A 2E7WA 1AZSB 5D78A 2HHUA 5GAHI 2HVDA 4R5PB 3WDOA 3EPIA 3MPWA 2ILZA 2KT3A 1BWEA 2UXBJ 1R6YA 1QTMA 4F4KA 3QGHA 1OPIA 2V0NA 4K4ZA 4DSLA 4ECQA 3OUYA 4U95A 4TLRA 1YX2A 5IC4B 3QAUA 3MPDA 3AJ1A 1O6XA 2JEIA 1ZAWA 1HA1A 3A3NB 2ZHAA 1YLXA 3KMSA 1FKOB 2O1PA 2WZ1A 2KXFA 4ECUA 5ETOA 4XDDA 2X51A 5KTQA 2MSSA 3EVMA 3EDRB 2DY9A 5D3GA 2DYAA 1RBLA 1U8SA 4TYAA 1U25A 1HL6A 3CCQS 3KNAA 3AOAA 3UWTA 2EVZA 4IDKA 1N33F 2AGQA 5IFMA 4RUAA 2OEJA 3Q89A 4XPCA 4QIFA 3DRSA 1R3NA 2RKIB 1Q8IA 1S12A 1QE1B 1SI9A 4LFCJ 4DV5F 3K17A 2XLIA 5C42B 3POTB 3AD8C 2HQFA 1T8EA 3R1LA 3ZZZA 4CTAA 1KRPA 2RUSA 1S0MA 3T41A 1X31C 1HBOA 2NZCA 4DX8H 1PCAA 1J27A 2V68A 1QTNB 1WNEA 3CPWR 2IRUA 2IVFB 1YJTA 4CO2A 3ONQA 3TYTA 1U09A 2FZCB 4MKAA 4FKXA 3PYEA 1GXLA 5K8MA 4NCGA 2KHCA 3OXLA 4L73A 3VGUA 5KG3A 1CSJA 2R7RA 4DR1J 2HZCA 2E1PA 3KUHA 1XJWB 2YKNA 1CQMA 2HHPA 2RDJA 2N82B 3QJLA 2R7VA 5D0EA 3BN7A 1TL3B 1NDLA 3CCJS 1F9HA 1HW8A 4OI2A 1XK8A 4HHJA 4C8YA 4DV2J 3O5TB 1D9AA 3LGHA 4MTPA 2V4RA 4AXJA 2EBEA 3JQJA 2A3JA 5B0AA 4FS1A 2Y0SD 4GO5X 3IRXA 2KI2A 3GR0A 1H38A 3I56S 4L3KA 1Y00A 1M5KC 1NK7A 3W2WA 3CJQA 4OZJA 3M2UA 4L74A 2B5JB 1CJKB 5KFCA 1T94A 2EFGA 2ASLA 1FWKA 4NWBA 4DQRA 1H73A 3BF4A 3MM7B 4R25A 2ILYA 3NGTA 1RAOA 2JEJA 4QWAA 5F8JA 1HQUA 1S5ZA 1XERA 2W4CA 3R9LA 3PW5A 1E6VB 1X4CA 4M5GA 4TU8A 3HDSA 1YQHA 1FE0A 2DD8S 3OSPA 5FD1A 1BE4A 1SKUB 5HMWA 5L8RC 3JSMB 5B08A 1U7LA 3A13A 3MM5B 4QPTA 5G0RB 3KLIA 4B3OB 2BJEA 4CLUA 1D8ZA 3SV4A 4PWDB 4DXLA 2YNGA 1FE4A 4LRDA 1SV5A 1VQYA 2DCUB 5DDPC 2NR0A 2J5AA 4OHYA 4ERDA 4QW9A 1S6QB 4H4OB 1R7IA 3RU0A 1XMQF 1VQNS 3JXOA 4QYZJ 5J2MB 2Q66A 4U96A 2B9WA 2QMUB 3HK2A 3KK3B 2BE2A 1X7VA 4PAAA 3MMBB 1S7HA 2MHEA 3OFGA 4YN3B 4USMA 4QWBA 1F9FA 3CJKB 2WSFC 2C42A 2LVWA 3TANA 3CB4A 3N6MA 2F63A 2VQEF 2HQCA 2P6TA 5HSPA 3T1HF 1TK5A 2YNFA 1UVMA 3H2LA 2NSBA 5HQMA 3M8WA 2F8HA 1JXEA 4KIAA 2B6AB 2YKPA 4IR9A 3R2CJ 1AZSA 2HNZB 2HZVA 2O66A 4W90B 3DRRA 4ZVPB 4QIEA 2HNDA 3VZIA 2W8KA 2GVZB 1HNXJ 2Q6BA 2AJ1A 4KH1B 1I3OB 2M8HA 1LWFB 5JMNA 2W2OP 2UUWA 2KG0A 3KFWX 4I67A 2ZFHA 2AU0A 3DN9A 1T7PA 2Z0GA 3CNQP 3UFCX 4EBEA 5E3CA 3GSDA 2WVDA 3L4BC 2AW0A 1U6FA 2M9KA 3NCQA 2JWNA 5IT4A 2QYCA 1M5SA 3HJFA 1IBMJ 3LQVA 4HH1A 5CZXA 3M4XA 1FJCA 1RUSA 1TQLA 2WVFA 2WW4A 2XHWA 1I51B 4CH7A 2NLWA 5D4NA 3GFXA 1D1UA 2LQ9A 3MMJA 1H72C 4OI6A 4G1PA 4JI7F 1R0BG 5KFZA 1J5EF 2NSCA 3RW7A 4LF9F 3POTA 2RSQA 3EGWB 4PPZA 3C16B 3SSRA 2UVUA 3RRGA 3KYLA 3ZFVA 2LA4A 1RT4B 1B64A 3NBPA 3RYLA 1JIHA 1N48A 1FNXH 2QLXA 4BS2A 1PKUA 1NZAA 3MEGB 4ZPVR 2CPIA 2EFPA 1NPRA 2WONB 1QLNA 2F3JA 3M30A 3HFZB 3G82B 4WP3A 2X1BA 3W62A 2AEMA 2EK6A 3V81B 2JEFA 2HIQA 2W4DA 4ECTA 3JB9k 5LMNF 2FY1A 1GTHA 4B3MJ 3ZTQA 3V2UC 3LW5C 2ATLA 1TL3A 4LMZA 3BQ2A 4NI2B 3W63A 4IG0A 1VJWA 4N47A 1RT2A 2E5LJ 2H4WB 5KG1A 5AT1B 2AF6A 1T95A 2CQ4A 1G3OA 4AQYF 4F0MA 3GIJA 2GVDB 4WF9Q 1YK9A 4IO9Q 3AODA 4M94A 2D3OR 4X4NA 2B5JA 1CJKA 3HLUA 1JJHA 3GIRA 3NS5A 2OSRA 1Y0HA 3UI3A 3J7Z5 3DLKA 1VCTA 2GAGC 4UZCA 2DNRA 2X1FA 2G1DA 5LXRA 3EM1A 2D1CA 4ZVSB 6FD1A 4YQWA 4LSNA 2R2TA 1EB0A 2GJIA 3IS9B 3O1LA 3FKBA 5IV4A 2YBVA 3EDQB 2XMUA 1K0VA 4LF7J 3JSMA 3H20A 4DPTA 3SQOP 3FEXB 4NLQA 5JVGQ 1SBRA 5G0RA 3FMBA 3GJRB 3KHGA 3J81U 3MPUB 3MOZA 2W2PP 4U7CA 4U8VA 2NXNA 1Q0NA 2JEGA 3FFIB 2J0WA 5KFOA 1MSWD 2CA9A 2B56A 2U1AA 4IG3B 4ZMMA 1S6QA 4H4OA 3FSYA 4DSFA 2ZVSA 2KVIA 4KPCA 1VGYA 2Y8WA 4M5JA 4P7TA 5J2MA 3PHEA 1PC4A 5E3PA 4CWBA 3CJ0A 3IMQJ 2RT3A 4G3IA 2FHJD 3KK3A 3Q86A 4D3HA 3MMBA 4CO5A 1VQ7S 5ETTA 1RU2A 2A10A 2DISA 1RTDB 1Q1KA 2P6SA 4HH0A 2R8JA 3PHTA 2B8PA 3C14B 4TLQA 2I1RA 2IA6A 3MGJA 3BREA 3LP2B 5K5MA 4LSLA 2HNZA 4MK7A 1GT8A 2PI5A 2Z30B 2G2OA 3QT7A 2CVIA 1J5OA 3KHLA 5DM7Q 5J2QB 2GVZA 1NHUA 4YR3A 3S1TA 2VFSA 5I42B 3OL7A 4YY3J 2PC6A 4DOZA 5H9FK 3JTNA 1I94F 4B02A 3D0HE 1Q8BA 1HNWJ 2UUCF 2HQGA 2FVSA 2X3DA 2L08A 4ZP8A 3W2VA 1V5IB 1X4BA 4RLEA 1NNDA 5A8RA 1RSCA 4OZNA 5F8GA 3CJ8A 4L3NA 4ZN3A 2HIYA 3PDNA 1IWGA 2GAHC 2E44A 3NOGA 1LXJA 5IT0A 2YWWA 2HAFA 4M63A 1T3OA 3M9NB 1RT5A 1Y4ZB 2VKZG 4B9UA 3QWUA 4P9SA 4DG1B 4PG5A 2DNOA 2DNZA 2R8IA 5DG8A 5FDLB 1TL4A 3UDCA 4HEA9 2MZRA 1WKJA 1KWMA 2I5JB 3MPVA 3I5CA 2IBOA 2GC8A 1FRJA 2CPYA 1RTHB 4C7QA 5AXNA 2HNYA 2ASJA 5ETQA 2IYGA 3QJPA 1ACMB 3C16A 1T05B 3BBBA 3GYGA 4TY9A 3DDIA 4DS5A 2FLPA 2HHVA 2OAUA 1T9YA 3IM9A 2J0XA 1RE1B 1VR6A 5KG0A 2V4JA 2J6UA 5A6WA 2WONA 1LW0B 4NLWA 1ZYQA 2PFFB 2R2SA 3B78A 4KH0B 4PEOA 1C2PA 3HF5A 1K47A 3P6YC 1GFWB 5D0GA 4BCAA 4USTA 2E9ZA 1N33J 5KFNA 4HYKA 4LIWA 4XIUA 2YNHB 4ILLA 3KK2B 4NCAA 2V4QA 2CJQA 4CLWA 1PBUA 3TEGA 1LK7A 4NI2A 1LWEB 1TVRA 5C24B 3A12A 1UVLA 2DNMA 4F3MA 1YSJA 4HHUA 3KG0A 4F4YA 4DV5J 3FNNA 3C15B 1DURA 2C3YA 4HKQA 3DXSX 1VRTB 3HCXA 4DI6A 1FFGB 4K50A 1VQ4S 4YDXA 1FRLA 3GV5B 3VAKA 3BGFA 4X65J 1SQGA 2V5HG 3H2VE 1N5SA 4NMLA 3WHIA 1UW9A 4DSKA 4ZDNA 4JI8F 1N5QA 2IVMA 2QX0A 2V2ZA 3BR9A 1NSAA 1FKPB 3UDVA 3FEYB 3H25A 1JNZB 2W2QP 5ETVA 2ZNYA 4ES2A 3IS9A 2XZTB 4JI3F 2DPJA 2IHR1 4QYZK 4DF4A 3LALA 4TVAB 3Q24A 3D54A 4RW7A 2B7CB 4YMEA 2WB4A 2UV8G 1JMTA 5E33A 4GVLA 1W7WA 2CNOB 1Y5LB 2NUHA 1S6OA 3CIZA 5IWAF 5KAKA 3LOUA 1U48A 1TK8A 1WOOA 3KXDA 1YIJS 3OVSA 1FRMA 2MQ8A 1VQMS 1VBXA 3VAHA 3ZTOA 1RT3A 1W25A 3FFIA 5KFXA 2EBGA 3NWRA 4C8MA 5DLGA 3Q23A 3LP1B 2Z58B 3UN2A 2UUAF 2EI5A 4C8NA 1RT1B 2JX2A 3P96A 2AWZA 1U4BA 3QAEA 4EFAC 5HVFA 2GHWA 2ZH2A 1EQMA 3EGNA 3QPIA 5CQGA 3MECB 1LXNA 3OHBA 3GFHA 4MH8A 2XSJB 4ILMA 2BXJA 2EC0A 5AXMA 2DITA 1HQEA 3C14A 4OYBA 2FPHX 3EGVA 3I4HX 3ISNC 2PA8D 3U1MA 2KHDA 3AHPA 1U2FA 3MAAB 3WIVA 1NU4A 4RWWA 4MKYA 1UEVA 3OT9A 1TKZB 4JI5F 2WHOA 3HSDA 2CQDA 2DK2A 1NK8A 4P74A 4ED2A 1RA6A 5BYSA 3P5BP 3UR0A 1NDKA 4QCLA 2HGLA 4DL5A 2DNKA 2A2DA 3T5HA 5I42A 4ZVRB 5LMUF 4C0OC 5THWA 3KJQB 2D3UA 4X4RA 3MFHA 3PR4A 4WFYA 4PG6A 5E41A 1E6YA 1QSYA 1XMQJ 2UUTA 4LRFA 2COLA 1H3DA 1WG5A 3T5KA 3PW7A 2H5EA 4URQU 3W5YA 2CJKA 1KN6A 2HWIA 4YB5A 4DPOA 4I0WA 3WBZA 5EWGA 3FUYA 5CD4A 2VQEJ 2Z57B 3T1HJ 2NYHA 4GC6A 2CNKB 3A8IA 4G1QB 2OPRB 4QPXA 5J2NA 3QT6A 5FDLA 2B51A 1UZDA 2J6TA 2MSTA 1RAGB 5D4LA 2VDIA 1FJEB 1NMEB 3LA0A 4NLSA 2M88A 4YUDA 2HHSA 2MZJA 1URRA 4OYOA 1X8DA 3TO8A 4Z37A 4I2PA 1X4DA 2MGZA 3R5JB 1RT7B 4O3PA 4U67Q 2BJ1A 4AE5A 2KZZA 4OI3A 1T05A 2RF2A 1TL7B 3V6HA 1SQFA 3J81Y 4J9LA 3K0JA 4ALZA 1GMWA 4A8YA 3FC9A 2MZQA 2VHGA 2HVIA 3OTBA 1LW0A 1EKRA 3SCKE 1RAHB 2VFRA 1N34F 4YB7A 2QSWA 4YEAA 3DRYA 1ZTWA 5EGYA 3TAMA 5KFFA 2KU7A 2BRKA 3QIDA 2YNHA 3V5RA 3KK2A 2QZ8A 4Q45A 1UW4A 1MROB 1LWEA 5A2QU 5C24A 3BEGB 2HBZB 3TI0A 2DB1A 4KGZB 3MUTP 5H9EK 4JI7J 2WTFA 1XR5A 3C15A 4LF9J 2CNLB 2ZDPA 1VRTA 2W2NP 2OTLS 2PFDA 1M5PC 2F8EX 5HK4A 2IMOA 1HKAA 2AV5A 1ZOTA 3IC1A 2I8EA 3QBCA 3R5AA 2APOA 4ZS6A 3B54A 3SI8A 5LL6d 4JV2A 4MYTA 4RX6A 2HMIA 2BYCA 3GPAA 2M0GB 4FXDA 1WELA 1D3WA 1FKPA 1RTIA 3RRKA 4OI0A 2ZNZA 3FMWA 5LMNJ 2VQFF 3NNHA 2P9CA 3CD5A 3K7RA 2VFTA 5K9FA 4ZVHA 2K7JA 4RR5A 2E1MC 1KTVA 3PYDA 2OPPB 1M90T 1TKXB 2DR6A 4P2XA 4KV8A 2RQMA 2PT0A 1FTCA 2GA7A 3JTOA 1RWNB 4K5RA 4CNYA 1MU2A 2CNNB 5GADU 4DHVA 4QWEA 1S79A 5HBMB 4AQYJ 1CC8A 5J1NA 3R2DJ 1OJ4A 2AD9A 3IR5B 2MYFA 1EKSA 3F0NA 1H7XA 2Y8YA 4RNMA 3HJVA 2CQCA 3Q0AA 4PKDB 3BH7B 4UQTA 3K57A 2OEMA 4ICLA 3QIPA 1ZS6A 3SFUA 1NK9A 1TAUA 2FYXA 5ETSA 2XMTA 2YPYA 2VG7B 1RHMB 3KLHB 2K06A 2QMXA 3VTIA 3W7BA 1DBDA 4BC9A 2L41A 3DLBA 5HN0A 2V8PA 1NK6A 2V50A 2ROEA 5E3QA 5D6GA 2FJDB 4OJGA 2WAQD 3J7A1 4UOCA 4OIXA 1VQ8S 3RUBL 1K1SA 3UVJA 1NXIA 3G8SA 1U1LA 4CLKA 8ATCB 4MKVA 2BQ3A 4LF6F 1EP4B 5I4MA 3QFWA 3MMAB 4YR0A 1LNQA 3S6EA 5KFPA 5HVGA 2QJ3A 1EIYB 1RU1A 4RBUA 3PZPA 3QLHA 4KO0B 1XNQF 4WCEQ 2D69A 5D8HB 3P5TL 3PEJA 1L3TA 4DCOB 2CRLA 5DDOC 4UOGA 2L9WA 4KFBA 1DTQB 4DV0F 3ILJA 3TZYA 1HFEL 4DU8A 2YKMA 5HP1B 2B9XA 3PM9A 4HT5A 3UNYA 2R9LA 3CC4S 2YPZA 5DJBA 1NUEA 3C19A 2ZE2A 4C0HA 1VDHA 2IVYA 1JLAA 5KOXA 2VU5A 4B3SJ 2D3O1 4G1QA 2OPRA 3TUPA 4GO7X 2XMWA 3M2RB 3MR5A 3GR1A 5F3TA 4Y0FA 1UFWA 3ZO7A 2ZC4A 2OO4A 3ZZYA 1S97A 1UP1A 3K5LA 2AGOA 3HP6A 1I1GA 1TMMA 1UAWA 1XMOF 2AHOB 1WDDA 3G9CA 3CDAA 5KFHA 4ED1A 1I94J 5HANA 2UUCJ 3KG1A 3GZ7A 4CT9A 3F41A 5K8OA 3MCMA 4F67A 3PJWA 3I0RA 4USJC 2ZC3A 2JVRA 3X1LB 4QWDA 3VAIA 1RWUA 3GYNA 3EICA 4RW8A 2BA9A 3CXCR 1KP6A 2CQ3A 4DQPA 3BB5A 1TP7A 3VGSA 1K8AT 2ZBQA 4K4WA 2XC9A 1Y5IB 3J7AN 3SMZA 4KGVB 1MMLA 3MHYA 5E3RA 4EO8A 2J9CA 3R5BA 3U02A 4RBVA 3H4BA 3PO5A 4CYUA 4PXDA 4J91A 3E51A 3KLVA 2R7SA 1M5OC 2Y1IA 1R8CA 2BANB 3KK1B 4TY8B 2C2RA 2XYHB 1FVQA 5L9XA 2N4DA 4PXEA 5J1EA 1M0SA 1ZM3A 3TZZA 3LWMA 1U1PA 1DJ0A 1RWMB 1M1GA 4ZP7A 2FZGB 3IWXA 2BRLA 4NPOA 4CLPA 3J80U 3BKUA 2C2OB 2DHGA 3DHXA 1Q5YA 3PYGA 4NEZA 1PYTA 4PZVA 4J37A 2DPIA 3K2YA 2UXCF 2QL7B 3ISZA 3SSSA 1ZM2A 4WP9A 2IMWP 3DOLB 4QR2A 3R7NB 3TA2A 3D9BA 3CCES 3T1YF 2X1GA 2ZUGA 4P72A 1JLQB 4K0KF 2Z56B 5LJ5Y 1VLOA 1TKXA 4OYMA 1FEHA 1MWZA 5EWFA 1IM6A 1U1OA 2DNYA 2M70A 1NKEA 5HATA 2Q43A 3PV8A 2XNRA 1BY9A 4Y3CA 3MOJB 4ETXA 2EKNA 1DFDA 1N56A 2W9AA 2XM3A 4UY85 2W7OA 2HURA 3CMES 1N5YB 4RUCA 1HWUA 1DARA 2UVRA 5DQHA 1R0AA 2P9EA 1RQ0A 1X0FA 4AUKA 2HPUA 4JI1F 4PQAA 4JI8J 1BXNA 1GMUA 1WF0A 1OY6A 4NA1A 1KC8T 1JK9B 4WTOB 4ECZA 1OY9A 3HVWA 2DVIA 1PAUB 2BM1A 1SJ3P 3W9HA 5F0UA 4Y28C 4JOUA 3L7OA 4JI3J 2I6WA 4OYAA 2KM8B 2HQDA 5DETA 2J6SA 2QLJB 4JV1A 4XO0A 5KFWA 3UNGC 3JS9A 1R8BA 1QAXA 5IWAJ 3MMAA 4A8OA 4H4MB 2YY3A 1P1LA 3LANA 3R5CA 1Q82T 2FJAB 2WOMA 3PCOB 4MMOA 4KO0A 4CH0S 1FVSA 3TW0A 3M6XA 1FFWB 2Z2LA 1JXVA 2MZTA 1WC1A 3DLGA 2XYPB 3G6ES 5A2QY 1RT6B 2R7XA 1YRXA 1D0EA 4AL6A 1DTQA 3FQKA 3ETOA 4M1KA 1YBAA 3QO9B 2KVQE 3CD0A 5HP1A 4FS2A 4KRWA 4YHHF 2ZVIA 3GP9A 3TX0A 2CWKA 3OW2R 4R8UB 5K14B 4L76A 3ELHA 4RJVA 3CCSS 2OTJS 4AYBD 4NCBA 4WKYA 8AT1B 4GVBB 1WI6A 3SFGA 1VHIA 3CCZA 1HHTP 1BLUA 4JI0F 1WHXA 2AYMA 1KKHA 3OVAA 2RILA 3TRGA 3M2RA 2Y0BB 2B9YA 2VFVA 1JNRB 3U1NA 5DDRC 4KBIA 1R6VA 5L39A 5DGAA 4JI5J 1U1KA 5EUHA 2ZH3A 3OLBA 2C3OA 4CLYA 1JLCB 2FVCA 1HPZB 4H4KA 4DU7A 3C2PA 2J7WA 1GH8A 2OPQB 3PW4A 4C8LA 1YJ7A 4GKKJ 1XNRF 1CVJA 2HRUA 3DDNA 3ISND 3HHEA 3VWSA 1WDTA 3JSBA 3NG8A 5AE3A 1CPZA 4USVA 1VQSA 3H4DA 3ETMA 3W8GA 2DXFA 3DOKA 3I32A 1XN9A 1Y11A 2ZKTA 3QT5A 3VVTA 1YGYA 5DG7A 4FYYB 4LF5J 3HHLC 2ZKUA 5KFTA 4FXVA 1SCJB 4A8WA 2LEPA 2E1CA 4I68A 1JLGA 1UVKA 2CQPA 3GJTB 2LQ5A 2AP6A 1V5VA 3DC2A 4AD6A 1X5OA 3PXGa 1ZZNA 4PXBA 3LAKA 4BHQA 1OQ6A 4ZA1A 1OWXA 4OZ1A 4KGKA 3E2EA 4B9MA 3MR7A 1QUPA 5EDWA 2UVWA 1H0HB 2LECA 1Q95G 1WEZA 3DGPB 1RACB 3G86A 2HG4A 2B3TB 3D2WA 1R27B 3BBCA 4CNZA 3HSJA 3M8PB 4JV5J 2AJ4A 3R1HA 1WORA 4X64J 4DR7F 5GADI 1X0PA 3WX4A 5IOLA 3EGZA 4PABA 2MQPA 3CC2S 1TU0B 2CKWA 1FF2A 1YBUA 1FDAA 4LF2A 4KGMA 2XNQA 1N34J 1D9DA 4TQRA 4CO0A 3DOLA 1RAJA 3TEHB 2HK2A 4DR2F 4WJBA 4PYAA 1QDUB 2D41A 4W4MA 4IRCA 2J9EA 1RWVB 1UTAA 2LA6A 1JLQA 3PTWA 3GJQB 2QGFB 2L3MA 4DL6A 1EQ0A 1NK5A 2G1HA 1Z4UA 5I3UA 1AA1B 4USWA 4NA3A 2FQQB 5K8NA 2LKZA 3OLAA 4IOBA 3K8VA 1G1XA 3A8JA 1IKXB 3GU0A 2K8GA 2KN4A 1T9VA 1N5YA 2O5DA 4QIVA 4OJ1A 4DS4A 5DDQC 5L9NA 4A8SA 1S72S 3CE8A 4OV6A 1Y3KA 4IH6A 2B9EA 1QAJA 4NEYA 4KR0B 2NXJA 4DDFA 4GRSA 3OJUA 4F8RA 4O0NA 3R7BB 1U24A 5D0RA 4DX5A 3RB4A 1N8RT 2E7VA 4DV4F 4KHMA 4LF8F 2VQFJ 3BS9A 3GG1A 1X4FA 2H9ZA 2GHPA 2VIHA 4F4AA 3RBDA 3FCVA 2BKNA 4Y2CA 3ITHA 3N5BA 2HFVA 2FC8A 4KE5A 3RBZA 3AXMA 3P3DA 5F8NA 2VC0A 4NYZA 3D1HA 2GQ2A 2BOPA 3W60A 4H4MA 1FX2A 1Q5VA 4OYPA 3AA8A 4ETZA 2UUBF 4NLOA 3QRPA 1S6UA 2KL8A 5B0BA 3RB3A 4FNHA 2B7BB 4ZLJA 5B0CA 3KLEA 1IQTA 4K4XA 1RT6A 1A9NB 3GIIA 2W24A 1RISA 3H0PA 3QO9A 2DO4A 1S9EB 2MQMA 1XWLA 5K14A 2BV3A 1RDRA 1BC6A 2KZMA 3SCJE 4KT0C 2HRTA 3CO0P 3BN4A 3GV8B 1RKJA 4GVBA 1EJ7L 3EZOA 1U0SA 1JXLA 3IP0A 4ANDA 2QFIA 1V3RA 2BZ2A 3J80Y 3T1AA 1B3TA 2KM8C 4TQSA 5DG9A 3V6JA 4LF6J 2EK1A 3QQCD 2BQUA 2WSEC 2W4PA 1NJIT 3GWCA 3NS6A 1JLCA 1HPZA 2C3PA 1F2HA 2PMWA 1RYRA 1RKIA 1XNQJ 1RP5A 2AJQA 2AEFA 2QL5B 4QYRA 2OPQA 4G65A 3CO9A 3E01B 2BJ3A 1GXTA 2CFXA 2MQQA 3DU6A 4FF3A 2K3IA 2ZD1A 1B0VA 2PGCA 1YBTA 5KFMA 5F8HA 1T11A 1UEUA 3PRVA 2AKWB 2IM0A 2HWTA 3VVUA 3SYZA 1Y7PA 1U1NA 5CZVA 2LCWA 1N6QB 4ZPCA 2WBRA 5JXSA 1WEYA 2MZ1A 2HGNA 3D3CJ 1QVGR 1RTJA 2OEKA 4DFJA 2XS5A 1GX5A 3IAS9 2CXEA 1DLOB 2CQIA 2XWYA 3N79A 1RA7A 2CVEA 5CABA 1X4GA 1BD6A 5HO4A 1JQGA 4P75A 2Q3PA 2ZITA 3GB0A 4OZ2A 4HTIA 1XMOJ 3DLJA 3DU5A 2QRRA 1JJ4A 3M8PA 3M2VA 1NKCA 4PRFA 4WK1A 1IJFB 2YXLA 1TL1A 4DV7F 2PI4A 1C0TB 1WHWA 2FHJA 3P49B 2MY8A 2JRSA 1QM9A 2EW9A 4Z7CA 1RBOB 2DBBA 3MURP 2MZSA 5HMXA 4X2BA 1UL3A 1RI7A 2OUGA 4IQMA 4EGLA 4EYHB 1HBUA 1R89A 5SUHA 1PJ5A 3SDEB 4ES1A 3W5XA 1YITS 3HPOA 1B0TA 3HT0A 1SC1B 2IY5B 4TU9A 2QC3A 2B43A 4KC5A 2GX8A 3MFIA 1C4AA 3MAQA 1TMJA 1WHVA 1U1QA 2RHQB 4NLRA 3AJ2A 5L1JA 4PUOB 1RAFB 3DNCA 3JYTB 4NA2A 3BSAA 4A8MP 5HVHA 2IDEA 1VQLS 2W2MP 2HLTA 4ZP6A 3VQTA 4ECWA 1RLCL 2MQNA 2DHAA 1QVFR 4C2MA 4BBYA 2LYVA 2CWXA 2KYXA 3IBCB 3PO4A 4K4SA 3P4UB 2X3GA 3UQSA 3MEEA 4DL0C 2ADBA 1VYAA 4ENOA 2UXCJ 3WZ0A 3VCDA 3MF5A 2ABYA 4ZVGA 2M8DB 3IWNC 3NNAA 2XEXA 5KFLA 1D9FA 1HWLA 2I9SA 4X4SA 4K0KJ 5B09A 4C48A 2OPSB 2LXIA 3BSCA 3DI6B 1JB0C 3HVAA 5C2GA 1DTTB 2NCKL 4CI0B 1W26A 1TTHB 1UKUA 4LVOP 4ZJQA 1S7IA 2OIHA 1Z2ZA 2NZ4A 1Y5NB 2WCXA 1WI8A 4LQ3A 1V3ZA 1YHQS 3Q8PB 4DF8A 2JVOA 3KLGA 4LIRA 4EBCA 3N01A 2BW2A 1PG5B 4JI1J 1TAQA 1SH2A 1FT8A 4B9LA 1S1UA 4V19X 1EARA 5DM6Q 1HMVB 4ZPWR 1QJHA 1S1XB 1M5VC 4RU9A 3V4IB 1RCXB 2AGPA 2GIFA 3BQ1A 4OYZA 4Y2IA 2C22A 1H7WA 1HI0P 1HI1A 4WZQA 3SEOA 3RAXA 2O67A 1RJJA 4J9SA 1FXDA 3TUIC 3BGRB 1KR4A 4RNNA 4UW2A 4DCPB 2CJXB 3T6JA 2ERRA 2JOQA 6FDRA 1HNZF 3GIMA 4DQQA 2J9DA 4IFVB 2IJNA 2QA1A 2V6AA 5AJ3F 1JKHB 1SL1A 3E01A 4K8RA 5BYRA 1TKTA 1JLFB 1TFWA 1T9TA 3AH6A 3U7JA 2N3OA 1S77D 2PD1A 4YHHJ 2BJDA 2CPDA 4C4WA 5H1SV 3HM9A 1B99A 2QTWA 2Z2ZA 3HSZA 1Q79A 4O44B 1NKBA 1NH7A 3UW1A 3HXMA 4USIA 2RB7A 1NB2A 5BR8J 4JI0J 4EYIB 3MZIA 2KT2A 4P52A 2GCFA 1LWCA 4M5HA 3ZTPA 1ICEB 3C6TA 2VPZB 1DLOA 2HBQB 4ZLPA 2B4OA 3MEDA 2WRMA 1S1TA 4ZOSA 1UJ4A 1WUUA 5E0OA 1NCLA 1WG4A 1VIXA 2WVCA 4K2XA 2HS0A 4MK8A 1LW2B 1LWXA 3JQKA 1UA0A 1XNRJ 4I2QB 5H9FJ 2D9OA 4X62F 3M6VA 4F25A 2EFQA 3HFVA 1C0TA 3ZZOA 2LDYA 2DH7A 2PA3A 5CYQA 1T03A 4DBQA 2MEWA 5CD4H 2DNPA 2PMHA 1REVB 3GIKA 3OV7A 1FJ7A 2G9OA 1BQMA 1DQ8A 4IFYB 5KFVA 1SH0A 4OX8A 4Z7YA 2M5YA 4DFMA 2QL9B 2DHXA 5DRKA 2R8HA 2OLWA 2W7AA 3DMJA 3VGTA 4OYXA 3DM2B 4FVCA 5T41A 3VQSA 2C2NA 5HQ8A 3M9MB 4NRTA 4P10A 5A8KB 4PUOA 3R7SB 3WQPA 4ES3A 2FUG9 5T14A 3JYTA 3D7SB 1NDCA 3HHLD 3OL9A 1FDBA 4M5LA 1AB8A 2YKOA 1S1WA 1MWQA 4RW9B 4DR7J 3LAMA 1UZHA 1FRHA 1VHFA 1L3UA 4DUTA 5LSOA 1VJQA 2R42A 5A0YB 4ZK7M 3M7VA 2W9BA 3K5PA 1N4LA 2L48A 2V8DA 4HR2A 4OV1A 1V3SA 2NREA 4OZ5A 2WBMA 2CZ9A 2FGCA 3D3BJ 3G6XA 2IPOB 1FWPA 3NP5A 5MAOA 3HVTA 4DR2J 3K58A 1XQIA 4ED0A 3IA0A 4KJIA 2Y1LB 4ID8A 5ETMA 2AX1A 5ETKA 2AYEA 2OPSA 5LT5A 4QJVA 2IAJA 2G0IA 3DI6A 3PR5B 5IQ6A 3C66A 4KKOA 3GQCA 2IJFA 3NEKA 3B4DA 1DTTA 1ZM9A 3RR8A 1C1BA 1ZTTA 1TUVA 4EZ9A 4I7FB 4DR4F 4LRAA 1IJEB 3UD5A 3L95X 4RZRA 1VC5A 3NGKA 2GQQA 4JUZA 1F5AA 2FZKB 4WK3A 1TUWA 2IJRA 2QT7A 4UT4A 2RD5C 4CLFA 2GQCA 3SCIE 3H98A 4OZLA 4NYPA 3TJ9A 3LP0B 3KLFA 1SUQB 4WFNQ 1HMVA 1S4FA 1S1XA 3QSYB 1FHTA 4LF8J 2J9DE 5BJRA 2MKJA 2DXDA 3IG1B 1HNVB 2QA4G 4WE1B 2HHXA 2XS7A 4Q2LA 4DR6F 2XI3A 4ZCMA 3O3LA 2AJ0A 5IC6B 3O6QA 2FVRA 3QGIA 2B4PA 3DYAB 3IRWP 1VI7A 3GCXP 1UMJA 4HDGA 2XGPA 1LFPA 4Q0BA 3MM8B 3Q8RB 5KT5A 1P9QC 1CS4B 2UUBJ 1AT1B 3ZTSA 3QFHA 4IFVA 4O3SA 3RB0A 4R5PA 3W61A 1QUVA 1S9GB 3R6GB 1JLFA 4YR2A 4FYXB 3F73A 4ANCA 4N8OA 4ZPTR 4ZVUB 1N0UA 4HLBA 1OSDA 4M95A 2H1YA 3JQMA 2CJ9A 1LK5A 5KG4A 1TFYA 3BZQA 3H42A 1GEHA 3UCZP 3CEDA 4FPIA 4O44A 2R3VA 2VD3A 4DL2A 1CULB 1XR6A 3IGVA 1N5TA 1FKOA 3OVBA 1BMQB 2ZOFA 1VQPS 2DHSA 3CULA 2B8QA 4LBHA 4KQZA 4QR0A 3MDFA 2ASDA 1YJVA 4YS2A 2GV1A 2VG5B 2YKAA 2XQCA 2OELA 2YQ3A 1HW9A 4BDPA 4DMZA 3OFHA 3TQ1A 1F3VA 2QFJA 3DRPB 5CA5A 5GMEA 3CDWA 4I2QA 3DGVA 3IAM9 3TVZA 3D6MB 2Y9HA 4DUZF 3QZ8A 2D3ZA 5J2PB 2OFGX 5AXLA 5C25B 2RKIA 3G87A 2ZM6F 1QE1A 5C42A 1K44A 3S8SA 2RAQA 2RQKA 3QYYA 2VA2A 1W2BR 8RUCA 1YRUA 3I9ZA 1AROP 1BWVA 1U0HB 4CLZA 1SC3B 1IN0A 3FK4A 4DPUA 3RBEA 4NASA 3DM2A 4YB1P 3EX7B 2VJVA 2M3DA 2DGOA 1UWBB 5A8KA 3CD7A 1F5BA 2ZHBA 3NXZA 4V19J 3IR6B 2J8AA 1WTFA 2LXFA 3ZTRA 4N41A 4JB8B 4KHPF 4AT1B 1X9WA 3CSKA 3MUVP 1YJWS 5KT2A 3HHNB 4XAKA 2DXEA 3MM9B 2CJYB 4DV7J 5A0YA 1SJQA 3OPKA 4DQIA 3CJSA 3MM6B 1UFKA 4Y2MA 1HWIA 2CPXA 1S1VB 2FHMA
chains in the Genus database with same CATH topology
3E51A 3K5OA 3KLVA 1FKOB 2RU3A 2O1PA 2DRAA 2KXFA 4NLVA 4M5DA 3SSQA 2R7SA 1H2TZ 3JSRA 1M5OC 2DNGA 3Q2SC 4GKKF 1C1CB 2Y1IA 4ECUA 4KTQA 4XDDA 2X51A 5KTQA 1R8CA 2BANB 3KK1B 2XY5A 4TY8B 4UUXA 2C2RA 5HL7Q 2MSSA 1FVQA 5FIIA 4N5SA 2MXYA 4KFBB 4A8FA 3IO1A 3O8WA 3Q8QB 5L9XA 2YKMB 2N4DA 1S10A 2GHVC 4PXEA 5D3GA 5J1EA 3TP2A 2IM3A 5IQQA 1FEEA 1NJZA 1U8SA 4OLPA 1H6KX 1M0SA 1ZM3A 3NGDA 4J5OA 4TYAA 1U25A 3O2IA 1HL6A 3LWMA 3CCQS 1U1PA 1DJ0A 3KNAA 3MM7A 3UWTA 2EVZA 4O4GB 1FERA 5GAEU 4ZP7A 2ZE2B 4IDKA 1N33F 4QQBA 3X3UA 3IWXA 4ED8A 2AGQA 3HMJG 2BRLA 5IFMA 4NPOA 4LF5F 3M9OB 1JLAB 4PR6A 1VIOA 3BO3A 4RUAA 3CJ4A 3IR7B 4ECRA 3TAPA 1E6VA 2DHGA 2CYYA 2AQ4A 5H9EJ 3PFEA 4I7FA 3DHXA 2OMOA 1KVJA 4XPCA 4QIFA 3DRSA 3EPGA 1YJ9S 5KFYA 4J37A 3T19A 1R3NA 3BSOA 5A8WB 3OL8A 2DPIA 3K2YA 2UXCF 2RKIB 3D0GE 3ISZA 4N77A 2AYBA 3SSSA 1Q8IA 1ZM2A 4ZP9A 2IMWP 3DOLB 2XZWA 4QR2A 1QE1B 3NCPA 4UY8T 1SI9A 3TA2A 4DV5F 5EX3A 5CCMA 2XLIA 3GMGA 3CCES 1F0XA 2ZZMA 5C42B 3POTB 3T1YF 2X1GA 4J9OA 4WFBQ 2ZUGA 2R7UA 3FGVA 3MM5A 4R8UA 2XY7A 4MIWA 3NCRA 2CPZA 2VBYA 1JLQB 1UJ5A 4K0KF 4B3OA 1T8EA 4PG8A 5LJ5Y 3R1LA 3ZZZA 4CTAA 1KRPA 1S0MA 1TKXA 3M32B 1HBOA 3PRBA 4DX8H 4PWDA 4C97A 2MHNA 2VOPA 1WNEA 1FEHA 3CPWR 1MWZA 2IRUA 5EWFA 2IVFB 1YJTA 1DQ9A 1U1OA 2DNYA 4CO2A 3ONQA 2M70A 3TYTA 1U09A 1NKEA 4JV5F 2IBKA 4K4YA 4MKAA 4F2SA 5AXKA 4DLEA 1GXLA 1XMBA 4X64F 5K8MA 4YP3A 3HT3A 4F4ZA 4NCGA 2Q43A 3Q2TC 1S99A 3PV8A 1SJ1A 2XNRA 1BY9A 3IG1A 4Y3CA 5DLFA 3MOJB 1WD6A 2KHCA 4ETXA 4F3QA 2FHOB 1SH3A 5EHHA 1U49A 3OXLA 3I0RB 4WE1A 5KG3A 2MKHA 1DRZA 1N56A 1DFDA 2W9AA 1A7GE 2HHHF 1CSJA 1SIZA 2Y1JA 3FQLA 2R7RA 2HZCA 2FLNA 3A1YG 4UY85 2W7OA 2VZ9A 4CH1A 2IFXA 1N5YB 3PEHA 3CMES 4IR1A 4RUCA 1HWUA 4ILRA 2YKNA 1DARA 4OX9F 1CQMA 4TNOA 2HHPA 2UVRA 4RW8B 2RDJA 2N82B 4JI4F 5DQGA 5DQHA 1VK8A 1R0AA 3D28A 2P9EA 1RQ0A 1X0FA 2IYIA 3QJLA 2R7VA 4AUKA 1FNOA