3LW5C

Improved model of plant photosystem i
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
81
structure length
81
Chain Sequence
MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWGGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title Structure determination and improved model of plant photosystem I
pubmed doi rcsb
molecule tags Photosynthesis
total genus 3
structure length 81
sequence length 81
ec nomenclature ec 1.97.1.12: Photosystem I.
pdb deposition date 2010-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF14697 Fer4_21 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lw5C00
1F2GA 3MM6B 2PDAA 2FJBB 1R27B 1CLFA 2C3MA 1BD6A 3OR1A 2WB1D 1BWEA 1FDAA 1AXQA 1B0PA 3MM9A 2WAQD 5FD1A 1PC4A 3IR6B 1HFEL 3OR2A 5BYQA 5L8RC 1H0HB 1GTEA 5CH7B 1Q16B 1K0TA 4L6V3 1G3OA 2FJEB 2C3YA 2VKRA 4XK8C 1SIZA 3MM7A 2IVFB 1H7XA 1C4AA 2XSJA 2C3OA 1C4CA 1H7WA 2FDNA 1FRJA 1GTHA 4AYBD 2PA8D 6FDRA 1Y4ZB 1B0VA 1IQZA 1G6BA 1Y5LB 4Y28C 3OR1B 3EGWB 4KT0C 4OMFG 1Y5NB 1FRMA 2C3PA 1WTFA 2V4JA 3MM9B 2FJDB 2ZVSA 1BQXA 3OR2B 1D3WA 1FRKA 1DAXA 1FRXA 3MMCA 1FF2A 1PC5A 1XERA 1FDBA 2UZAA 2Y0SD 4RKUC 7FD1A 1Y5IB 3MM7B 1IR0A 3MM8A 2WSCC 5CHCB 4YDDB 1KQGB 2XSJB 2GMJA 2WSEC 1SIWB 2VPXB 3MMBA 2O01C 3MM5A 1VJWA 1GAOA 1GT8A 1FXRA 2GMHA 2V4JB 4DHVA 1A6LA 1FDNA 4XDCA 2V2KA 1FEHA 1FRLA 3LW5C 3MMCB 1FERA 3MMAA 7FDRA 1F5BA 1ROFA 4XDDA 3GYXB 3EUNA 3HKZD 2FGOA 1FRHA 3C8YA 3MM8B 1JNZB 1FDDA 1JB0C 1B0TA 4CI0B 1F5CA 5E7OB 1DURA 5BYRA 2VPWB 1H98A 3EXYA 5BYSA 3MMBB 2WSFC 3MM6A 3MM5B 2Z8QA 1BC6A 2VPZB 1KQFB 6FD1A 2PMZD 1FXDA 3PNIA 1FCAA 2FD2A 1SJ1A 3MMAB 4ID8A 2FJAB 1FD2A 1FTCA 1JNRB 1RGVA 1DFDA 1KEKA 1BLUA 3IR7B 3IR5B 2C42A 2C3UA 4OV1A 1FRIA 2VPYB
chains in the Genus database with same CATH superfamily
2FLLA 5B0CA 3G6YA 2GV1A 1JLEB 1J2VA 5A8RB 1E6YA 4OLPA 4XAKA 1MROB 1ZBTA 2AEMA 2H65B 4O3SA 1K0TA 1FXLA 2NUUG 3SZ2A 1AUDA 3JSRA 2VUGA 1B0VA 4YHHF 3K5LA 5HBMB 2JEFA 4JBCA 1KS2A 3MM8A 5I4MA 5CHCB 3G6ES 1WI8A 1EQ0A 3H2VE 1OYDA 3N0VA 4DL4A 3AH6A 4QBUA 5KFEA 2VL1A 1KHVA 4ZVGA 3Q89A 4MYTA 1EETA 5F3ZA 4DV6F 4MTPA 1N33J 4PQAA 2ZWOA 1RDRA 1M5VC 1TTHB 2XS5A 2X1AA 1U1MA 3EXYA 2CVIA 2Y1IA 3D3BJ 2CNLB 1HBNB 1TK0A 3ZTQA 3VAJA 4J5OA 3ENQA 5JXSA 2BRLA 1U0HA 1HNXJ 2OEKA 1KQSR 3CWJA 2ZBCA 4C3KA 2FUG9 3MOJB 2AEFA 3POTA 4DLEA 4JYAF 3BSNA 3ZTPA 3BZQA 3EM1A 2MQQA 2OELA 4TNOA 5E3PA 2KT5A 3CJKA 4R8UB 3SQGB 1H6KX 2O67A 3DM2A 3G82A 4WBFA 4AD6A 1KOOA 3DLBA 4LF8J 2OFGX 4CZCA 4RUAA 4TU7A 3N5FA 2QEXS 2ZOFA 3PW4A 4YMEA 4WFNQ 2VG7B 1FWKA 4Z7CA 2GZOA 1YJNS 2RSQA 2KO1A 3ZNUA 4Z37A 1RJJA 3J7AN 1Z2LA 3QT6A 1RBLA 1M1GA 2JEIA 2R7UA 3H7HB 4Y00A 2CQGA 4M94A 3GV5B 1YKWA 1W2IA 1XK8A 3SYZA 1YJWS 2XZDB 2E5LF 3N79A 4J9MA 4NLOA 4JB8B 4K0KJ 3UO0A 3KLEA 2BJ7A 2QZ8A 3I5BA 3K17A 2B3TB 5KFJA 3MDFA 4NE9C 2BBEA 3IAS9 5F8NA 4USTA 1U24A 1D3WA 1RKJA 1IVZA 1IBKF 2E7WA 4KB7A 3TQEA 1VQMS 2YNIB 3HFZB 1VCTA 3CC7S 2YNIA 1S0NA 1QTMA 4G3IA 1XMOF 2OPPA 2I38A 2G4BA 1EZZB 2GGPB 5B0BA 2GGPA 1B3TA 3PV8A 5CCMA 2CG4A 3NL0A 4M63A 1UWBB 5KG0A 5C7PA 3PZPA 5AXLA 4OI4A 4DR4J 4A46A 1J5OA 1S49A 1SH2A 1N32F 3MEGA 4ZIVA 4QPTA 5KT2A 2D3UA 2MQ8A 2ZM6J 5KFTA 2OD4A 2OSQA 4PQUA 2OUGA 2ZJQQ 5AJ3F 4MKAA 1KBRA 2BV3A 3S1TA 1T9VA 1EIYB 2MGZB 4C8MA 2B9WA 2VFSA 5KFWA 2B0GA 2VKRA 5A0YB 2DVIA 3DU6A 1C4CA 4W92B 2W2MP 1S77D 3QSIA 1FJEB 4DOZA 3MTJA 3GCXP 4URGA 1C0UA 1K8AT 4KRWA 4LMZA 4ZPWR 2RQKA 2XS7A 1ZTWA 1WOSA 2D9PA 3TRGA 4NL5A 1P9YA 2UU9J 4H4OA 3D0HE 2HAFA 4GKJF 1ZS6A 4ETZA 1FKOA 2LXFA 5CQGA 4JI3J 2ZJPQ 3V6KA 5DGBA 1TUWA 2V2KA 3EGVA 5ETSA 4RW9A 1YRUA 2CJQA 2AF6A 3NCPA 2ZVIA 4CH1A 1P27B 2Q3PA 3MZIA 4FDFA 2VFVA 1M0SA 3KHRA 3CCJS 4CO4A 3GYNA 2UXBJ 1ACMB 3QLHB 2HNYA 3MGJA 4UTGA 3M2RB 5IS2A 3JAMY 1WDDA 4PG8A 2XHCA 3KK2A 1RUSA 4F3OA 4ERDA 4RX6A 3TW0A 2NZCA 2H4WB 2EG2A 4P2XA 3LPYA 5IQ6A 3J7ZT 1R8CA 2HPUA 2CQDA 2C28A 2F3JA 1RAEB 1X4FA 1KKHA 2CWKA 1FESA 2WHOA 1S7HA 2PE8A 2OEJA 1NXIA 1PJ7A 4Y65A 2GHPA 1IXKA 2V4JB 1YBTA 1M90T 2F5GA 4ZKAA 3BS9A 3THVA 3JQJA 1MWYA 1YTYA 2CJBA 4Y0FA 3NBPA 1FDDA 2CPYA 2J76E 3MR6A 1TL7B 3AXMA 3R7NB 1WSRA 1FT8A 1HBUB 5D77A 4ECXA 2AMCB 2YKNB 4R5PB 1Y3JA 4YR3A 1N0VC 1BHNA 4U7UK 4DPWA 1KTQA 1JXEA 2DGVA 4ZITA 2QL7B 4DFJA 3KLHB 4WZMA 1R0AA 2F7VA 3NGSA 2K1RA 1QY7A 2KI2A 4JI8F 1YDLA 3DNCA 1RAAB 1VC6A 5HVFA 5U47A 1MNEA 3CD6S 1XWLA 1IWAA 3FC9A 3UD5A 3LA0A 3R2CJ 3BQ2A 4WP9A 2OJ3A 1RXOB 2BANB 2BANA 3BDEA 1IM6A 2CQIA 1U49A 2AGQA 2W9AA 2XWYA 3GE9A 1U26A 3OSPA 4HDGA 1ZYQA 1OSDA 5F3TA 2FC8A 3THPA 4DUYF 1T3OA 1X5TA 4WXOA 5JJBA 4JV2A 5ADZA 2FIUA 2QN6B 4WYLA 3HT0A 4KYZA 2DPJA 1YIJS 3CE8A 3BO2A 2P8IA 3DOKA 3GTYX 3U27A 1SQGA 2KG1A 4R0EA 2AW0A 1MMLA 4HI1A 4DZDA 2M2BA 4P2FA 3CD0A 4DV3J 1K44A 4GKKJ 3CIZA 3RAMA 4FBUA 2C3UA 4QIWD 2QYGA 3BQ1A 3MM6B 1R27B 3SV3A 1RE1B 1GH8A 1DQAA 2OIHA 4C8KA 4UZCA 4O44B 2QE5A 1SUQB 2F4VF 2AJ2A 4DR6F 1XR5A 3PHTA 1NJYA 2LDIA 1U1PA 2J9DA 3PO4A 3QIPA 3JTPA 2OAUA 3FEXB 2WVDA 2KVIA 2VF3A 2UZAA 4DL3A 4RKUC 4J7CA 1KLNA 4HACA 3W8PA 1TKZA 5L1IA 3IS9A 2I8EA 2JL9A 3U1NA 4E0DA 4DHVA 1NNDA 2HRUA 4JI6J 2I5JB 1KWMA 3FCWA 1G4CA 1RYSA 4B9VA 4EEYA 2A2CA 3G4SS 5KFGA 4ER8A 1UEVA 1WC1A 1TL1B 1TL1A 2N82B 4FF3A 3M6XA 4LF4F 1U7LA 4KV8B 1RBAA 2WOMA 2FVRA 3S7RA 2E66A 1UEKA 2DO0A 1HR0F 4DV2F 2MKSA 4ENOA 3M2UB 4UF4A 3JSBA 2AX1A 4I68A 5DZ6A 1AXQA 1WHYA 2ZZNA 1LW0B 2K7KA 2W7PA 4KBIA 2YKPA 4P7TA 2QRRA 4O3NA 4DV0J 3FGVA 2IA0A 2XTJP 1IJEB 2LFVA 3NMAA 4DV7F 4F50A 4LUBA 2GQ2A 2YWWA 1RHJB 3MAAB 1HWKA 1S4EA 1DTQB 4RR5A 4IRDA 5D4OA 4IOAQ 5L1LA 1NKEA 2ZHBA 1X7VA 1I5OB 1BMQB 4LQ9A 3SSRA 3M7VA 3CMQA 4MK7A 4JV1A 1O6XA 3ZTRA 4A48A 1BQNB 5AXMA 5IXUA 3MMBB 5EHHA 1SV5B 4ZMMA 2ADBA 4ILMA 3MEKA 4IFYA 5SZTA 5ETKA 4AL5A 1HBMA 2UUAF 4DX6A 2WVEA 2EFGA 4PKDB 5KFPA 2JNJA 1PAUB 1F2GA 1VIOA 2BE9B 4IH7A 3VALA 4NMLA 3R97A 3HKWA 1RCOB 4PWDB 4PWDA 3BGRB 2XI2A 4RW6A 3DLKA 3BBFA 1NSAA 2ZH7A 1WORA 1Q4RA 4J37A 5DQHA 4JI2J 2KXHA 1RT3B 4K50A 1X8DA 1PC5A 4NLTA 4NLGA 2Y0SD 1UVIA 2HIYA 5AT1B 2WSCC 2I1RA 1QLNA 2CNKB 4QYRA 3CSKA 1PBUA 4S0MA 1QTNB 2JWNA 8RUCA 1N33F 4WXWA 1V5IB 3R5CA 3B82A 1ZZFA 1RHMB 5B08A 4ZVHA 2JLGA 2FGOA 4YY3J 4MMOA 5D4NA 2YKMA 3MPVA 3HHDA 3OFFA 3M1VB 3SSQA 1CC8A 4R25A 4DQRA 1WF1A 2YKQA 2E29A 1HNXF 2BE7D 2CPEA 1C0TA 3U1MA 5C2GA 2XZWA 1YJTA 3IWXA 2W24A 2GFFA 2XYPB 2QJ3A 4DF8A 2BOAA 3OR2A 5I3QA 2HNDB 1R3NA 2DIUA 4Y2AA 2OPQA 1PYTA 3DLGA 5CH7B 4DX8H 1WDTA 4DU7A 3CDUA 2QA4G 3TEGA 2E7VA 3H4DA 1Y3KA 1SJFA 3ICLA 4LF8F 3T6JA 5F8MA 3KJQB 4ECQA 1HYSB 2UXDJ 4WK1A 2UUCF 1YQHA 5LSRA 4CLYA 1Y11A 5KFBA 1WUUA 1U8WA 4H4MB 4H4MA 1WC6A 3AJDA 2BKPA 5GVQA 1XQIA 2D3ZA 1BY9A 2XMAA 2KFNA 3VVTA 4IG0A 1GMWD 2O5DA 5IM0B 1WG4A 1R8BA 2VG6A 5DS7A 2VA3A 1S76D 3DHWC 5K8NA 2HBQB 4PWWA 2G13A 4Q8EA 2IYIA 2IJFA 2HVDA 2BJ3A 3OR1A 4W4MA 3CC2S 5MAOA 1KD1T 4FF2A 3W66A 1UJ4A 5CYQB 3OVSA 5HATA 2BXJA 2H48B 3HLUA 3MCMA 4J9VA 1RLCL 2C3OA 4USUA 3CJTA 5KFQA 1RTJB 4ID5A 2OLWA 4XPEA 2C2ZB 1DY3A 2OPSB 5IT9Y 2OPSA 4DFMA 5D8HB 5J2QA 3CDBA 1JJHA 4DG1B 4DG1A 4FXWA 4A8QA 1DARA 2KM8B 2HHUA 2W4CA 3EGZA 4E98A 4LSLA 2QX0A 1GT8A 2FVSA 1T0TV 2AYBA 3D0IE 3HCXA 2YH1A 4DR4F 1N56A 2GVDB 2AGPA 4DN0A 1LWFB 2CAJA 2L9DA 2IMOA 3AXKA 3DRXA 4ZCMA 2ZM6F 2FD2A 4PPZA 2FQQB 3HVTB 1RT6A 3TUIC 4EBCA 1WEXA 1ZM3A 4ZK7M 1NK9A 4NLVA 3OXFA 3KK3B 1NSPA 1U48A 1T8EA 5ETLA 2YNGB 3O6QA 3MUMP 4DPUA 3MFHA 2EK1A 5BXIA 2R2TA 3ET6B 1VBKA 2UU9F 2W9CB 2B4OA 2W2QP 4OFZA 3JQMA 4RBTA 2B6AB 1SL2A 4ZOSA 3Q8PB 3I6PA 3OVBA 4JI3F 4WZQA 3IRWP 3RAQA 1C1CA 1CVJA 4EBEA 3OPKA 1VQ7S 1RAOA 1F5BA 2DRDA 3W3SA 2IFXA 3GYXB 5IV4A 5E41A 3HSZA 1NHUA 3BPSP 1G2EA 1C1BB 2V2QA 3OJUA 3CIMA 4K4UA 1M5OC 4G1PA 4QIGA 2GIQA 3BGUA 2ZNZA 2UXBF 3BF4A 1U1KA 4JI0J 5DZ7A 3AA9A 3R3TA 1X4HA 1HNZJ 1BWVA 1U1NA 1UWAA 4DR2J 3R5JB 2FHJD 3P45B 3CCTA 3DU5A 4I7FB 1X60A 4C97A 2AQ4A 4X65J 4CM0A 4K4WA 2I6WA 4DR7J 1FRJA 4X84A 4M5MA 2CDRB 5HANA 4NRUA 1S59A 3PX0A 3FFIA 2NR0A 1Q5VA 1CULA 2KZZA 1AZSA 2AP6A 3UE2A 2IVMA 3C14B 2GJIA 2HRYA 4EYHB 1RA6A 1F3VA 5CABA 4DV5F 3GZ7A 4KO0A 1JLBA 1YJRA 2UVRA 3I55S 3FK4A 4WFYA 3HHLB 3GQCA 2EEYA 1TV6B 3HHLA 2HLUA 3CCZA 2DT9A 1Y00A 1RT5B 1QVFR 2VPWB 2IRUA 3QT7A 1RT5A 5CYJA 1HWLA 2GA7A 3BSCA 5KFVA 1S9EA 2C2OB 2WBMA 2YX1A 3H42A 2HWHA 1FKPB 1RT2A 2XI3A 1FKPA 2HGMA 4WIIA 3TAMB 4Q0BB 2VA2A 3M32B 1D9DA 2XCAA 4EYIB 2BA9A 4WTOB 3Q83A 2B7BB 4GVBB 4GVBA 2LYVA 4F3MA 2QMWA 3PFOA 5KFSA 3TUJC 4RU2A 4FPIA 4AYBD 3EYZA 3BDPA 4ELTA 4NI2A 3G96A 3W64A 3OVAA 1TKDA 1FJGJ 4CH0S 1N6QB 2G2OA 4D3GA 1RLDA 2CJ9A 2NLWA 4E2FB 2M7SA 2Q79A 4JI7J 3PDNA 1RTDA 2HS3A 1QJHA 3N5BA 3OT9A 3EXCX 1LQ9A 1RBOB 5JUMA 4DQIA 4Y2KA 1ROFA 2F9JA 3VGTA 4P74A 1S1TB 4LSZB 1S1TA 3KHGA 5HMYA 5BYRA 3SFUA 3FSXA 4DQPA 1EB0A 2VASA 2IJNA 4U8YA 4QW8A 3UCZP 4KHPJ 5KT5A 2V8DA 4DV3F 4GKKF 4P71A 3IWNC 2DNOA 3MD1A 5HI7A 1TELA 1U4BA 3ILJA 4DN9A 3JS9A 4IUFA 3QFHA 4DL5A 2R7SA 1EHWA 4B9MA 1NB2A 1HFEL 4RW8B 2NXUA 1H0HB 2KYZA 1LWEB 4IOCQ 3C46A 5EX0A 4NEZA 1NU4A 4RNFA 2B9EA 1NJZA 1OY8A 4K8RA 3CJ2A 3CULA 2HFZA 2EFQA 1U02A 3HF5A 4NRTA 2MZJA 3AJ1A 1ZPVA 4YQWA 4USIA 3KLFB 2GQCA 3KLFA 3ZZYA 3M2VB 2ZD1A 1QAIA 4URQU 2A18A 4JI6F 4CLKA 2QG9B 1T03A 1A6LA 1IM4A 1ZA2B 1NK5A 5HLFA 3MMAA 4FS2A 1K9MT 3OLBA 4CM2A 1S7IA 2RHSB 3QZ7A 2EBEA 1PGZA 1YZ7A 4P10A 3RZAA 3FSYA 3CUNA 1FFWB 1U1LA 1HNVB 1V5VA 3T5HA 3BB5A 2HNZA 2DISA 3IXQA 1WELA 4HDHA 2DNLA 2W8LA 2O66A 2BEFA 1N88A 3HHKA 3MM9A 2DD8S 3IR6B 3O3LA 3K5MA 4LR8A 2VOOA 2IM2A 3Q24A 4DV0F 2OPRA 1WEYA 2XMUA 4B9UA 2BE2B 2CVEA 2BE2A 4NZ6A 4FVMA 3DRPA 2E44A 4ZIWA 1FX2A 2QFJA 3TJ8A 3DCAA 2WW8A 3UD3P 4ICLB 5IC4B 1B4SA 2KH9A 4DPTA 5KOWA 3LTOA 1HW8A 3J7YI 4I2QB 2I9SA 3KUEA 3JAMU 4NPOA 3R6GB 4RW7A 1DRZA 5GADU 1VLOA 4AE5A 5DJBA 4AQYJ 3KLGB 5LXYA 2LEPA 3RU0A 1VOMA 3NGUA 5I42A 4IRCA 4NOHA 4DSEA 1KFSA 3JTNA 3FSIA 1FKAF 3FRYA 3A12A 2DNPA 3D66A 1N34F 4MKYA 2NCKL 4YB6A 1FE0A 1VQ6S 1VHFA 1E6VB 4WFBQ 1OQ3A 4JI2F 4YDXA 3AFGA 4CP5A 2L9NA 2YKAA 2AIRB 3KHLA 3I31A 5HL7Q 3V6JA 1DAXA 4EFAC 2LXUA 3MEDB 4KPCA 3HK2A 2AJQA 7FD1A 4ZLLA 2VPXB 4OZ1A 1VJWA 5KFLA 3PJ9A 5H1SV 4B17A 4K2JA 2H54B 3LAMA 3KDOA 2B4VA 2F8HA 4YY3F 2ZH6A 3OW2R 1WHWA 1SJRA 1KDNA 4C11B 4U95A 3PM9A 4FYYB 4EO6A 4Q2MA 3T1AA 3HI9A 3NCQA 3BKUA 2UUBJ 4JUZA 5A8KA 1CJUB 2DR8A 3K58A 5KFZA 1ZM2A 4F0KA 5D6GA 1LWCB 1DBDA 1DTTA 2V2VA 1TP7A 2VBZA 3VVUA 2JLEA 4M5JA 4DCJB 4DCOB 2YQ0A 4U9RA 5DGAA 3MF5A 1OY9A 1HBOA 1PSDA 1N5YA 2QA4S 1XMBA 3M8PB 4RNMA 1UVJA 1HHTP 1TKTB 2C1EB 3J80U 1TKTA 3OUYA 2FZKB 1WD6A 3ZZOA 2ATLA 1FRMA 2C2KB 2KYXA 3F56A 4L3NA 5D15A 1FHTA 2UXDF 1IQTA 2Q43A 4I6AA 4WFXA 5D0RA 1L3KA 4ZJLA 3LPEA 1UA1A 3H0PA 5A2QU 3NWGA 2PFDA 3B4MA 2HVZA 1VBYA 3KNAA 1QSYA 1S6QB 3ITHB 1O51A 3ILOA 5I3UA 2R7TA 1B0TA 3HSDA 1NBEB 2R8IA 4PUOB 3GONA 3I0RB 4O4GA 4I2PB 4FPRA 5GAEI 3S6EA 3FDSA 2R7XA 1MU2A 4LREA 4BCAA 5C42B 4OYWA 1H38A 3CDWA 4PYAA 3D5MA 3R7SB 1YG0A 1P1LA 1FE4A 4CIOA 4QR1A 3QAUA 5EWGA 1NO8A 4JI1J 1RT4B 5IT0A 3MM7A 4KY3A 1WOPA 2YNHA 5G4DA 4WFZA 5HQ8A 3FVYA 4YB7A 2O1PA 4PRFA 4ZPVR 3AOBA 4IG3A 1VGYA 3AD8C 2YQ3A 4QWCA 3RB0A 2WSEC 1KLMB 3H5XA 1JLFA 4NZ0A 3B8HA 4R0JA 4YS2A 4A8XA 4F4WA 1GEHA 5J2MA 2L48A 3RB4A 1F5CA 2Y1LB 4ZN1A 4O3RA 2MQLA 4TXSA 1SC4B 1WG1A 2IM1A 5JMNA 1IBCB 4DS4A 1TR0A 4K5RA 2CQ3A 3R1LA 2RH3A 2FGCA 4HI2A 1AROP 4KJIA 4OV1A 1U6FA 1VJQA 1N8RT 3JSYA 1RT1B 1S99A 4KGXB 1WG5A 1QE1A 2VBYA 2XLKA 1XNRJ 4ZLJA 2RHQB 1HMVA 2Z2LA 1REGX 2PO4A 1R0BG 5L1KA 2M3DA 3WHIA 2D74B 2IC3B 2PT0A 2ZEJA 2P6TA 4OZNA 3KJVB 4ZP7A 2HHPA 3MMCA 3TJ9A 1FEEA 1IKWB 1HI0P 1X0FA 3NKYA 5E33A 4LR7A 3ZZRA 1S1UB 1F9FA 3PYDA 4IH5A 1S6PA 4WP3A 5F8LA 1X5OA 1WC5A 4TN2A 1L3UA 3B54A 1GXUA 4YR0A 3W63A 2W9BA 4ZJQA 3Q2SC 1YI2S 3SCIE 4LFBJ 3D1QA 5CYMA 4N47A 3OTCA 3MUVP 4K59A 1S1WA 2CJXB 4JI0F 1XR6A 5LM7E 4BS2A 4WIQA 4A8SA 1HNZF 1EP4B 2CQ1A 4DR2F 1BWEA 2R3VA 3DLJA 5FD1A 4DV1J 2V6AA 3EPIA 2DGTA 4DR7F 4C8ZA 4MK9A 2HFSA 3OL8A 1HARA 2IVYA 3A4TA 3U02A 3E3XA 1TL3B 4A8MP 5KG3A 2AKWB 1F6TA 3PFEA 2XSJB 4ELVA 2LLZA 1H2VZ 2JSXA 4LVOP 3FZBA 2YWHA 2HFUA 1G7CB 3QIDA 3D6HB 2LCWA 4CO3A 1OMSA 4ECWA 5KFUA 1FO1A 3R5BA 3UVJB 3KDNA 1A0OB 3AQPA 4B9NA 2ZHAA 3LP2A 2RQMA 4LBPA 3VZIA 2JLFA 1IWGA 1ZZNA 1MG7A 4TQSA 3BKTA 4ZVTB 4BC7A 4IRKA 2ZKTA 1L3VA 1N54B 1HIYA 5K14A 3ISND 2QMUB 5BJRA 2ALZA 1W2BR 3RB3A 3TUZC 1J5EJ 4KTQA 3TI0A 1Y4ZB 1VK3A 2YNFB 4QZVB 3V81B 1FJGF 2LQ9A 5JVHQ 1HPZA 3WC0A 3GIKA 2NZ4A 4UOFA 3H4BA 1H2TZ 4PXEA 2DKOB 1S12A 4JI7F 5IWAJ 1I3OB 3KXDA 4DR1J 2DITA 2IA6A 2GO9A 1RTHA 4XDCA 3CGIA 2QLWA 3SCKE 4RBUA 2B43A 2CADA 3JQKA 2IAJA 3KFWX 3HVWA 1ZM9A 1HHSA 1X4EA 1Y10A 3HZGA 4KHPF 5DG8A 4ECYA 4ZHRB 5CAAA 4ZHRA 4YB1P 2X3GA 5F0UA 3ZTOA 3OBIA 4FYDA 2UVUA 3MOZA 1QUPA 2CUYA 2E1PA 4HEA9 4OYBA 1YHQS 3G87A 1P9QC 4G1QB 1REVB 3H5YA 3OHBA 3P49B 5KFDA 1MW7A 3DDKA 2C2DA 4XTTA 1AYEA 3MEEA 4X4NA 3R8YA 4UZBA 5LMNJ 4M5DA 4P75A 2DNMA 2AYEA 2RRAA 1IKXB 2Q66A 4AXIA 4HTIA 2CPHA 5J2NB 5A8WB 5J2NA 2RT3A 1FXRA 2GMHA 1VHIA 3HT3A 4A8YA 4P52A 3GFXA 2HMIB 4USVA 2FHMA 2HMIA 1UJ6A 2WW4A 2J8AA 4TU9A 4LRBA 4ZVQB 4QOTA 3MPWA 4AL6A 1NZAA 1Z1ZA 3QT8A 2HLTA 4K2XA 4IO1A 5HAOA 2A3JA 4M5IA 1SJ3P 4CT9A 1CJTB 4PZVA 3D9BA 3M30B 4RLEA 4IO9Q 3M30A 1DFDA 2V0NA 3BBCA 1ZAVA 2ABYA 1NPKA 1ZH5A 2MKKA 2EKYA 4ZVOB 4KHRA 4QU7A 2W1BA 1FNMA 4ED5A 2AGOA 1F5AA 2VZ9A 3JSMA 3P6YC 3C16A 2GNKA 2C22A 2ASJA 1TU0B 4CTAB 1WTFA 4Z7YA 4DX7A 4FNHA 4BC9A 1S9GB 1RAHB 4JP8A 1RTZA 1QSLA 2ZZMA 4OI0A 4F4AA 3KUGA 1YJVA 1VR6A 4B08A 2EPIA 2DGUA 3SQOP 4ZLNA 2OD6A 3CCMS 3AJ2A 2AJ1A 2YBVA 4IDKA 3AAWB 3DI6A 3BR9A 4JV5J 4CLZA 1VI7A 2VB6A 2QTWA 3MPUB 3SCLE 1R7IA 2QSWA 2RE1A 4RNNA 5E7OB 5BYSA 3KOAA 2VC0A 1QDUB 1RWNB 1PCAA 4AQYF 1HNWJ 2COLA 2YVSA 4M5HA 4UOCA 2QL9B 5J1PA 1KVIA 3MPYA 4YFUA 1D09B 3K7RA 3GU0A 4CLPA 4U96A 4LBIA 5ETPA 2C2EA 3B4DA 4A47A 1S6UA 1JLQB 1S1XA 2BJDA 4EUVA 2F63A 2J6SA 1ZAWA 5C25A 4MKVA 2EFPA 1RWPB 2Y9HA 1HHQA 1RHRB 1DLOB 2HWIA 3DXSX 3R5DA 1G6BA 2V63A 5KFMA 2LDYA 2LEBA 3KMQA 1LW2A 3ZXWA 4DF4A 4X4TA 4ANDA 3O8WA 1NAQA 3AD9C 2JVOA 4F2SA 2QA1A 5E3AA 1WNEA 3W9IA 4Q45A 2R7RA 3BR8A 2GW8A 3CO9A 5SUHA 2RS2A 1JLCB 2KVQE 1JLCA 4KAIA 5FLXY 1Q8LA 2V9KA 1HQUB 5DG7A 1TVRB 1HQUA 5G0RB 2BM0A 4DEZA 2UUBF 1T02A 1GMWA 2DH7A 2K06A 2H51B 3BSAA 1B99A 1ZA1B 2HHHJ 5CZXA 2HURA 3R5AA 2A6OA 2VONA 2YX4A 1DJ0A 3IG1A 3KK1A 2GVZB 3QT5A 1NKCA 1SKUB 4CYUA 4QIVA 1RT7A 2AYGA 2ALYB 2DHSA 3FBEA 2R2SA 2QLBB 1AFJA 1NRKA 4B9SA 3N6NA 1CJVB 4P72A 5ETRA 2LEAA 4OI2A 2RS8A 5EWFA 5J1EB 3UD4P 3TO8A 3D6FB 5D3GA 5GAHI 3DLHA 3BQ0A 3JB9k 4OLOA 4CCHA 3KJFB 2M5YA 4CLUA 1SB6A 2IM0A 2MKHA 4ED3A 4O3QA 5HP1B 3W9JA 3Q8VA 5LOQA 1HQEA 4X66J 2JHEA 2R7QA 4F4YA 3AOCA 1UPPA 4WKYA 2ZBRA 5EUHA 3R5GA 2OMOA 2MYFA 5J1NA 2DHAA 2QLXA 4JI4J 3FKBA 4OJGA 3DRSA 1U2FA 4K4ZA 1B0PA 3PIOQ 1GNKA 4AT1B 3A1YG 4JI1F 3W2WB 2DR9A 2OH2A 4ECZA 4L72B 5H9EJ 2VG5B 2RNEA 3D2WA 4B3OB 2JC1A 2VG5A 4K4SA 2LA4A 4Y2MA 3JYTA 4J9SA 2ASYA 5E3QA 1ELOA 4V19X 3W60A 2P6SA 3H98A 3TVYA 1RADB 1S48A 2V34A 1MMNA 2PEHA 1N4LA 4DWIA 3DLEA 3FMBA 1T05B 2PIIA 2GS8A 4Q2LA 1OPIA 5C24B 2FJWA 1JNZB 3L3CA 3RBEA 4BWJA 4K5SA 2IJRA 1JLEA 5A8RA 4F3QA 5M2UA 1GMVA 1N36J 1MROA 1OWXA 1VBZA 2L08A 2EFNA 3HHLC 1G1XA 3NXZA 4MIWA 2FVPA 4FZVA 2H5EA 5HBMA 3Q2TC 1XNRF 1N52B 1NJWA 4P2SA 2CYYA 3V4MA 2C3YA 4X64J 1TAQA 3HZEA 3WDOA 1TFYA 3A8EA 4B3TF 4ILLA 2HQCA 4ZVSB 4OL8A 2XEXA 1HKAA 1GMUA 2GIFA 3GIJA 2ZH8A 1FD8A 1HA1A 4WP8A 1A7GE 2RDIA 2Z56B 1HBNA 5T14A 1QAXA 5GAGI 1RTIB 4I1TA 1V3ZA 5LMUJ 4ALZA 4UT4A 5ETTA 3EUNA 2WB4A 2XY6A 4ANCA 4J91A 4LFBF 2G1DA 3QSYB 1N48A 2DR5A 1JIHA 4ZJOA 1WOOA 2E5GA 2IBKA 3AT1B 4EU0A 3C3LA 5DETA 2ROGA 4R8UA 4USJC 2WB1D 4HHUA 3SQGA 3PO5A 2OSRA 5AE3A 3CCVS 1V6HA 4C98A 2N3LA 2CPFA 4IKAA 2R8JA 4QIFA 1MWQA 2FB0A 3BV8A 2ZH3A 4N41A 4UUXA 3TZXA 4XK8C 2MTLA 3DOLB 1U2CA 3PTWA 3EPGA 2VG7A 2J7WA 2XBPA 1NSKL 2PA8D 1S0VA 2OP5A 4TLQA 4TYBA 1R6YA 1RWUA 1VS3A 3OXGA 1L3TA 3C66A 4DPYA 2W2NP 3CCRS 2HZVA 1S97A 3AOAA 2ZUGA 2UXCJ 1VRTB 1VDHA 3R27A 1VRTA 1U45A 1VK8A 3HPOA 1JJCB 4OZ5A 2JFKA 1TUVA 4M95A 1I51B 1Q78A 1WJ9A 3PYGA 2KN4A 3NCRA 3PR5B 1Q79A 1TL4A 4DDFA 3C6TB 3QO9B 2X1BA 2HQGA 3GSIA 4HT5A 2J0QD 4UQTA 4ECTA 3DRRB 2AJ4A 3LUYA 1VQ9S 4EZ9A 1NM2A 5DO2A 4UQGA 3OL6A 4LIRA 1UVLA 2BQUA 3HDSA 3NAHA 3DFEA 2R7OA 1FVQA 4YOEA 2NPFA 1J5EF 3BKFA 2EC2A 4X4PA 5KFFA 3Q8YA 2HGLA 1Z4UA 3OV7A 2M4MA 1GK8A 2Z30B 4W90B 4KFBB 5LL6d 4KSEB 3WZ0A 4MAKA 1BUXA 5IWAF 4ES2A 1UWBA 2IYGA 1P6TA 2OKQA 4DR1F 1SVDA 2IMWP 4WPAA 3M8SA 4LSNB 5KFYA 4LSNA 1NDLA 4DUTA 2BJ9A 5L38A 2M70A 5FDLB 2FZCB 3LP1B 5FDLA 4L76A 3EZOA 2DEJA 3VCDA 2HQDA 5H9EK 4EWTA 1RZMA 1KHWA 4LF2A 3RR7A 3JTOA 2CQPA 2WBRA 3TAPA 2DCLA 1TMJA 3DN9A 1VMBA 3M4XA 1UZDA 1XNQJ 2MGZA 3AB4B 3FEYB 1JNRB 4DSKA 4CNZA 5A0YA 2KFZA 1S72S 5IOLA 2LU2A 2NXNA 4MH8A 3P4UB 2FJBB 3RAXA 3L4BC 3F73A 5KTQA 2HWTA 1URNA 3DOMB 3V2UC 3FZ2A 4L6V3 4ECSA 1KVKA 2MLYA 2IVFB 1RHKB 5FIIA 2MQMA 1NH8A 1C4AA 1HW9A 2HKEA 4PXDA 3TR5A 5KFIA 1UZHA 1JLGB 2AX0A 1NDPA 3K2YA 2NSCA 8ATCB 4NEYA 3H5SA 3GCWP 2GHWA 2YWEA 1X4BA 2RVJA 4DQSA 2P9EA 2HFNA 2HHXA 3E01B 2D7SA 2UUWA 4PYDA 4N5SA 2BOPA 5CD4H 2UV8A 5DRKA 2K3KA 3MM5B 2HHSA 3QLHA 2DO4A 5F41A 2YWGA 3M2RA 2HHWA 1SKWA 2Q6BA 3T5LA 2V4QA 3M05A 4ID8A 3W61A 2Z58B 4QWAA 5KFCA 1U2RA 3C6UB 1N5QA 4O23A 1LXJA 2C3MA 2WAQD 3HHEA 3BH6B 3K5PA 4TY8B 3VAHA 1GTEA 1CS4B 1RHUB 5KG1A 1RA7A 2FDNA 3KLVA 4DV4J 2V4JA 2VODA 2E5IA 1X5PA 5F9NA 3NMRA 3ENVA 2HQ3A 3CJ0A 4DL7A 1IKYB 3W8GA 4WFAQ 4DSLA 1V3SA 1TL7A 1SH3A 1OY6A 2HBYB 4JV5F 3PJWA 1HBUA 3GYGA 5HO4A 5HROB 4NXNJ 4KKOB 4KKOA 4OHVA 5FJ4A 1U6ZA 2YKNA 2HHVA 4R5PA 2O3DA 4ZVRB 3N6MA 2JRSA 4N76A 2RKIB 2Z2YB 3QZ8A 1HI1A 1HNWF 5KG7A 1HNIB 3KLHA 2K2PA 1SJ1A 2XO7A 1CSJA 1D9FA 3HHNB 3IR5B 3CDEA 4H4KA 2V8HA 4U6PA 2PEBA 4N77A 4C2MA 1XMQJ 2W2OP 1FK9B 4MIAA 3PR4A 1JQGA 2J0SD 3MECB 4B3SJ 1KTVA 2EBGA 4BBYA 3MECA 5LT5A 1VFJA 2V2ZA 2MB0B 1Y9OA 3PYFA 3AHPA 2W25A 4K7QA 2BJ1A 2BKNA 4IFVB 2E9TA 1R89A 1RWWB 3K89A 2CNOB 4WE1B 3IM9A 2JJ4D 1XEZA 3DGPB 2YTCA 4UY85 1Q95G 1R6VA 3F0NA 2EI5A 1VRQC 3CJ3A 4G1IA 4A8OA 3MR3A 2PFFB 3QRQA 1NLKL 1CPZA 2W8KA 3MM6A 3H40A 4CH7A 2KJWA 2ZITA 1FJ7A 4NLQA 2HHHF 4OZLA 2CZ9A 5LSOA 4OX6A 2DXFA 5HJXA 4CDIA 1P8GA 2KHDA 4RW4B 4O44A 1SUQA 5D0GA 2HEKA 2UV8G 1YX2A 2VJUA 2DRAA 1WF0A 4FKYA 4WU2A 1TAUA 5ETOA 3MR5A 2WTFA 5E5NA 3LWMA 4IR1A 2ZNYA 2RD5C 3EGWB 3RRKA 2XWXA 2ACMA 2I5JA 1AB8A 3EICA 4OZ2A 3ZZUA 4P9SA 1VYAA 2KTQA 2FLOA 2XCPA 4KV8A 4YN3B 2HAIA 2F8EX 3EZ5A 2CPIA 1WI6A 1FNOA 1UCNA 1FRHA 4X66F 4KH1B 3VAKA 1N5TA 1SL0A 2RDJA 4ZCIA 3M2UA 1YSJA 2XB2D 5KFRA 3TAQA 1U6BA 2HVEA 3SFGA 1RKIA 1KQFB 5L39A 2XGPA 2BM1A 4G6VB 3IAM9 3D68A 5LJ5Y 2LQ8A 1S4FA 1LW0A 2ZE2B 2N3OA 2ZE2A 4QCLA 3MXHP 2BYCA 2NXEA 4JI4F 1Q86T 3IR7B 2UP1A 4IH6A 2XLIA 5C2CA 3SMZA 3R7BB 1UTAA 3AA8A 3UDLA 4YUDA 2YKOA 4N7TA 3UFCX 3ISZA 4BLGA 4PR6A 3C15B 1G3OA 3MAAA 1OPZA 1DTQA 3GSDA 4ED4A 1UAWA 2HSEB 2MY7A 3OTEA 1Q0NA 1YWXA 4C0BA 2C2NA 1BQNA 2OTJS 3MMBA 2YH0A 1SV5A 3QGIA 3NGRA 3CJRA 2XY7A 2VHGA 2F9DA 3NWRA 3M9NB 2D69A 2IRXA 2J6TA 1WC4A 4RJVA 4ED8A 4KQZA 1RWMB 5KT6A 3HKZD 4F7VA 1MLAA 3K5NA 2ZZTA 4I0WA 4LVNP 1IBLJ 4RU9A 1N36F 3SI8A 4DSFA 3NGTA 3BGRA 4HTJA 3DMJB 3CCLS 4X4RA 1V9OA 2BKOA 3NS7B 4NLPA 4WTYA 2EG1A 1PAEX 2NS1B 2U1AA 2GAHC 4ED0A 3PKYA 2A6MA 2H3EB 1Y7PA 1RT3A 2XQCA 3PEHA 3G71S 2B4PA 4X64F 2ILYA 2A0FB 2ZFHA 2IM3A 3KLIB 2R8KA 4LJMA 3MCNA 1UJ5A 4OIXA 2YPYA 3FCVA 2KG0A 1WACA 3JXOA 4ZCLA 3P5BP 3T1YJ 3RTVA 3OXLA 4C0HA 3GV8B 3M1VA 1SJ4P 1TMMA 5LMUF 3DHXA 1FEHA 2LP4A 2RUSA 3PCOB 2HW3A 2PD1A 1NJXA 3PRBA 1SI9A 5ITHA 3IBCB 1IKVB 2XY5A 2HNDA 4I4BA 4TY9A 4HR2A 5D0EA 4WF9Q 2GC8A 3M6UA 2F8MA 1C2PA 1V3RA 2H9ZA 4C6AA 2V69A 2AWZA 3U1LA 2IY5B 4LF4J 2PA3A 1Q16B 2H4YB 1HYSA 1LFWA 1VQ5S 3QJJA 1K0VA 5FLXU 1VQ4S 4OYPA 1JKHB 2XNRA 1VQOS 3FMWA 2VFUA 2ZVSA 2CJAA 3VGVA 4KH0B 2UXCF 3H8YA 5T7LB 2XMJA 5T7LA 2DNYA 2VBWA 4LFAJ 2O01C 3HD2A 4O0IA 1FJCA 5KAKA 3EVOA 3IWLA 5DDRC 1NDCA 3KYLA 2M8DB 1TFWA 5IM0A 2B8PA 1X9SA 3HSJA 1RAGB 3QATA 2RU3A 4RUBA 4OJ3A 2HK2A 4K0KF 2OTLS 2PMZD 4DU8A 5J2PB 2CPZA 1QM9A 2MKIA 5CYQA 2DY1A 3I0SB 4OHWA 1GFWB 1B7FA 5EX3A 2BW7A 3CEDA 1FVSA 3H25A 1HQ2A 3CCSS 1RTJA 2G2ZA 2B5JB 3V4IB 2B5JA 4A8WA 5KFNA 2QL5B 4RNOA 5AE1A 2PI5A 1FI4A 1GXLA 1UFWA 3K59A 5D4LA 2IRYA 4KGZB 2QSFA 2XZTB 5CXTA 1UFKA 3TOQA 2V67A 1EAYC 3QJLA 4TU8A 3QWUA 4OYAA 1E6YB 3GLJA 2VKZG 1H2UX 2M8HA 3M8YA 1GXTA 3HM9A 1DHMA 3RRHA 5H9FK 4JI5J 2GVDA 1LWFA 3M6WA 3VQSA 1SQFA 2GMJA 3GILA 1MN9A 3WX8A 4Q7AA 1ZAXA 5IFMA 2ZOGA 1WWHA 2ZDPA 3CJ4A 3RW7A 4DPOA 3HVTA 3MM8B 2WK4A 4OI6A 2RQ4A 4CWBA 3CB4A 2GIRA 3KK3A 5E3CA 1Z2ZA 2ROPA 4GC7A 1XNQF 2YNGA 1EETB 4HHHA 4I67A 5M2RA 2U2FA 3GIMA 2DB1A 2GO8A 3K5OA 2DGSA 3ET6A 3WIVA 1LXNA 2XSFA 4GMKA 2W9CA 1RI7A 1U0HB 3GIIA 2B6AA 1YZ6A 4UOGA 2MSTA 1Y5LB 1SCJB 2ZH5A 2DYAA 2GHVC 3SSSA 2LECA 5LXRA 2HRTA 4CQ1A 1LV5A 4OJHA 3POTB 3CD7A 3CMES 2ERRA 2EXUA 4OZ3A 3UDEA 3CJKB 4L3KA 4DL0C 5IQQA 4ELUA 4NCAA 1C1BA 2ZBIA 3DM2B 3M9MB 3G82B 5HMWA 3TP2A 2SXLA 3QPIA 2J9EA 3LP0B 3LP0A 1ULRA 2VBXA 4FVCA 2WRMA 2KJVA 1MSWD 4QPXA 4FKXA 5ETNA 5DM7Q 5B0FA 3L9ZA 2Z57B 2Z8QA 3PIPQ 1LK5A 3QFWA 4FYVB 2MXYA 2UUCJ 2DNRA 4I7FA 4DSIA 1RGVA 1T95A 2JDJA 1KONA 2KT2A 3RBXA 3TZYA 5DLGA 1SKRA 4AL7A 4A8KA 2CQ0A 4PAAA 3LAKA 2E9RX 1QD1A 1GX6A 2HGNA 4DR3J 4IQMA 4CO1A 4F0HA 2RJZA 2PGCA 3TX8A 2PSZA 4CLSA 4F26A 5L9XA 3C14A 4Z2XA 4DV4F 5IV3A 3KJNB 1APSA 3VF0B 1GX5A 1RWVB 1UL3A 3DDIA 4NLWA 4DBQA 3DYAB 3VV2B 3SEOA 3IO1A 3DYAA 3KLEB 1JWWA 1BGXT 1TV6A 2MZQA 4ED6A 1EARA 3NY0A 1SIWB 4NXNF 3MCOA 1RU2A 5K8MA 1FDNA 3I4PA 2QA2A 2MZRA 4HKQA 1X9MA 2Q6CA 2IDLA 3RR8A 3QRRA 3UNGC 2RIJA 4DXLA 2FTRA 3IBFB 3GV7B 3TAMA 4Q0BA 3W7BA 2ZHOA 3NS6A 2OHDA 3M32A 2Z0GA 2OPPB 1M5SA 5T41A 3CF5Q 3ZO7A 2ZH4A 2G0CA 4RZRA 4LF9J 2DJWA 3IGVA 3BBBA 1J5OB 2BX6A 4PG5A 3MEGB 1XMQF 2DPIA 1QAYA 3HVRA 1FWLA 4B3SF 4RWWA 5AE2A 3LGNA 1N6QA 4PQUB 4PEOA 4NXMJ 1RHQB 2RQCA 3CPWR 3FBBA 1JJ4A 4CRJA 1H74A 2KZMA 4KT0C 1KN6A 1WC3A 3HULA 1X5SA 4C8YA 1JXLA 2IDEA 4OX9J 4KIAA 2CDQA 3MWBA 3OLAA 5EN1A 2JEJA 3ADAC 5L1JA 3PW7A 1C0UB 3GJTB 3L09A 4RO0A 1NK4A 5K20B 3OQ2A 3TX0A 2J5AA 1SXLA 3B78A 4XDDA 4GO5X 4QQBA 4H4OB 3P3DA 3UDVA 1FKOB 1FA0A 1IJFB 1VQYA 1HLWA 3BH7B 3HP6A 3H2UB 3W5YA 2CKWA 1FXDA 1W7WA 4RW8A 2FVQA 2MQNA 3N6LA 4DPXA 3FBFA 1LWEA 1YK9A 4RW9B 1X4AA 4N8NA 2D3OR 2AD9A 3V6DB 3V6DA 2BACA 2L41A 3G6XA 4M5KA 1LNQA 4ZPTR 4MFBB 1YLXA 4MFBA 3GG1A 4X4VA 2JEGA 1WF2A 3X3UA 2MHEA 3DXBA 3GB0A 3DDNA 2FJEB 3M2VA 2MY8A 3M9OB 3BYRA 1CBKA 2HNYB 2XULA 4B9TA 5E2QA 5GMKa 3BM7A 3VGSA 2WVCA 2F65A 1NK0A 3KK2B 1UA0A 3QMQA 3KHHA 2WONB 2WONA 3BYPA 4MYUA 3LH2S 1RACB 1TK5A 4AUKA 3WX4A 1SC1B 2MHNA 4KGVB 1TUGB 1HNVA 2DR6A 3J7YU 4C3MA 3TVZA 1NB7A 4OYIA 3BO4A 2GX8A 3ZZPA 3QGHA 4DV5J 1EX8A 4I64A 2PC6A 2DH8A 3I96A 3NBPB 5F8IA 1RB0A 5ETMA 5K8PA 4O0NA 4TLRA 2RUGA 4FXVA 2WVFA 1WHXA 2R7VA 1WEZA 5F8HA 4QYZJ 1Q1KA 4J9QA 4BHQA 2VV5A 3DLLQ 5HQMA 1NK7A 4ICLA 3CMAS 1R0AB 1F9HA 2HQIA 2K1RB 3QGGA 2H1YA 2XLJA 2CNNB 9ATCB 4I2QA 2BMBA 5CCLA 2JZ5A 3R9LA 2WVBA 2FJXA 5ETVA 2OMLA 4LRAA 2HQFA 1K1QA 3KLGA 3NRBA 2CFXA 3MPDA 1IBLF 4ILRA 3H20A 2WSFC 3X1LB 2V8VA 1HWJA 2MPUA 3J81Y 2GQQA 4F8RA 1O0PA 3D54A 3J80Y 1E6VA 3TARA 3DOKB 2H5JB 2LU1A 2K3IA 4M5LA 4C0OC 3OTDA 4ZVEA 5BR8J 4DS5A 3GR0A 5BYQA 5A2QY 2MJNA 2AZ3A 2PN6A 4F02A 1PIEA 3MEDA 1N5SA 2OGUA 2ZJRQ 3LQVA 4TVAB 1GQEA 3SDEB 4NYOA 1IQZA 3SDEA 4ITSA 3EE3A 1T94A 2L9WA 1AFIA 4CNYA 2WZ1A 3PACA 4DMZA 3T1YF 2Y1JA 4HH0A 2P2CB 3G8QA 3EJMA 4LT6A 4LF1A 1U0SA 3SCJE 4C11A 3E2EA 4EZ6A 4WK3A 3NG8A 5EGYA 2IPOB 4OV6A 3GJSB 3QIPB 5KG6A 1D8YA 5B0AA 2M88A 3H2LA 4O3PA 1CJUA 1X9WA 3GR1A 1XJWB 4C48A 4C7QA 4HACB 1TKZB 5F8GA 1VQLS 1QVGR 3IS9B 1LWCA 2XC9A 4F4ZA 2A2DA 1Q8KA 1F60B 1YJUA 1SKSA 5GAEU 2GMLA 3M8WA 3M8PA 3FRZA 1UMJA 3D0GE 3N9UC 3SIPB 5A6PA 1MN7A 1DQ8A 1X31C 2WOMB 3BN7A 2BVZA 2MKCA 4Q43A 4ZPBA 4Y28C 4N56A 3I9ZA 1OSCA 3OSNA 2DHHA 1S6QA 2MKYA 3ITHA 4J90A 3RJMB 2KXNB 4LFAF 3P8BB 2B7CB 2KKHA 1K1SA 1CG2A 1FX4A 4PUOA 3I0RA 4I2PA 3G86A 1RWOB 2CQBA 3T6BA 3VAMA 2B4UA 3ENAA 2VICA 1OS5A 4NLXA 2ZKUA 4FXDA 4RBVA 5C42A 2VDHA 1F0XA 3AY0A 2ZC3A 5CA5A 4HH1A 3MFIA 2FC9A 3KUHA 4V19J 1QAJA 1W25A 1RT4A 3J7Z5 3HD1A 2KHCA 3J81j 2AU0A 4PG6A 1S0OA 3CVKA 3F41A 4IFYB 2A10A 3T1HJ 1RYRA 2GCFA 4WYWA 2RMLA 1TKXB 2LQBA 1TKXA 1HBMB 1YJ9S 1VIXA 5DDPC 2CQ4A 5DQIA 4YP3A 3TNVA 3EDRB 4ZS6A 1H7WA 4PCQA 1NJIT 4J9KA 1KLMA 2J9CA 2C3PA 1VC5A 2R7WA 4F4XA 3FJ2A 1JX4A 2FY1A 4RW6B 4JI5F 3DLKB 1N34J 2VFRA 3W65A 4FF4A 2NXJA 2VIHA 3GP9A 4QIEA 5IC6B 1NKBA 3LO3A 5IZHA 4DJBA 3LOUA 1AA1B 4OI3A 1KSPA 5HJYA 1T9TA 3MAHA 2HFVA 2DGWA 1RT1A 4QYZK 3BPDA 1VQPS 4F4KA 2QT7A 5K5MA 2LVWA 1UPMB 3CC4S 2YKMB 2IC3A 3NEKA 3KJVA 4DUZJ 1C0TB 2E9ZA 4MJKA 2I0XA 4MT1A 2E7XA 1IKWA 4RUCA 1I6JA 1KFDA 4QU6A 4H4KC 3D3CJ 2X1GA 4DFKA 3RGIA 1S1UA 2ZC4A 1YRXA 1VQ8S 2EVZA 2ASLA 3OR2B 2B56A 1S10A 2VFTA 1IR1A 3HJVA 4HT7A 2OPQB 3DLGB 1BQMB 4M8LA 1BQMA 1KR4A 1N5VA 2Q1LA 2MJUA 4K4TA 2MDAA 4QWDA 3ELHA 3Q8RB 2ZUAA 2GJ2A 1D0EA 3I5AA 4F2RA 4LRFA 3AD7C 4MK8A 2RILA 3QRPA 1NZ8A 1EP4A 3LANA 3WC2A 3NLCA 3KMSA 5KG2A 4X65F 4X4QA 1KNZA 5K8OA 4CT8A 4DR3F 1FWPA 1RCXB 4IG0B 4U7UD 3ZC4A 1TL3A 3VHQA 3I4HX 3H5UA 2VG6B 4H54A 5KFXA 3OJSA 3R1HA 2XSJA 2B8QA 3OR1B 5F8JA 2YXLA 4B02A 1PYSB 3W9HA 1AW0A 3GG0A 2NYHA 3A3NB 2JOQA 3UDCA 2HYIB 3UVJA 1GAOA 4ID5B 2ASDA 3G8TA 4KHMA 1ICEB 2FHOB 2RB7A 1NMEB 5J2QB 1M5HA 1RSCA 4ZA1A 3U7JA 3A8KA 4RUHA 4K4XA 4USMA 3KG4A 4LSLB 3EDQB 2NSBA 2E5JA 2F4FA 3TZZA 4CO0A 3E8OA 4ZVFA 4PG4A 2FJAB 1PO6A 5KT7A 2DR7A 4LF9F 3RUBL 4DFPA 3RB6A 4Q5VA 5KFAA 2B51A 2YNFA 2FPHX 3VR1A 3V81A 3S8SA 2LA6A 3R2DJ 2QC3A 3T19A 2QYCA 4NXMF 1RT6B 4NLSA 1SIZA 3LF0A 3A3OB 3PW5A 2DEIA 1LWXA 5KOXA 1PKUA 2C2RA 2V5HG 4MKBA 4OX9F 4CLTA 3Q0AA 1FDBA 4G65A 2FY8A 4ZP6A 3QAEA 2VQFJ 3DC2A 3V6HA 1M1HA 2MMYA 1VC0A 2E1MC 4C3LA 2HHTA 2HIQA 4OQJA 2G0JA 4OYMA 1W26A 3OTOJ 4OYZA 2DNHA 5IT9U 2ROEA 3NNCA 4USHA 1H98A 1A9NB 2C2MB 4DI6A 3M8RA 1C1CB 1U25A 1B64A 2P9GA 2JH3A 3UWTA 4G1QA 1FFGB 1REVA 2YWFA 2VU5A 3TEHB 1FRIA 2D9OA 3T9ZA 3GJQB 3CDAA 3UN5A 1NH7A 1UW4A 2CRLA 1S6OA 2CXEA 1VRUB 1VRUA 2Y1RI 1VISA 4ED1A 1EKSA 3QWPA 1IKXA 1N0UA 2MKJA 3SBMA 3T3FA 3CXCR 2J0XA 5E3RA 2FVCA 4V1Ak 2R42A 5A8WA 4AXJA 3CCUS 4IOBA 3BJYA 5B0GA 1FF2A 1R8HA 1VQSA 2YX7A 1XERA 1Q5YA 2FHKA 3IA0A 1CEZA 4U8VA 4UOHA 2CQHA 3HFKA 1PYOB 3D7SB 3TANA 3IN5A 5HVGA 3FFIB 5GMDA 3LWLA 1CJTA 1CULB 2IIHA 7FDRA 4ZDNA 1AZSB 4ATNA 3HFVA 5D0HA 4CI0B 4M5NA 3DGVA 2CA9A 5EDWA 1U1OA 3C2PA 4Y2CA 4KO0B 1JLBB 3ONQA 2RRNA 3PRVA 2DH9A 3RG6A 4K4VA 1HI8A 1YBUA 2DRBA 5DLFA 2EFOA 4QWEA 1S79A 1KP6A 3L7OA 1CLFA 3HMJG 3MUTP 4CTAA 1S9EB 4CO2A 4J9NA 4ED7A 5HVHA 1S9GA 3KWMA 4LFCJ 2XMKA 1KVJA 1R8AA 1RT2B 4M1KA 4X62J 1L5UA 4C8OA 3O5TB 2HK3A 1HWUA 4EBDA 3A13A 2A1BA 1Q82T 1XBWA 2DGXA 3ISNC 3GPAA 4AFFA 2AJ0A 2GJFA 5D78A 4B3MJ 1KQGB 2KRRA 1QSSA 1XIQA 3G9CA 2M0GB 3I9V9 2IBOA 4NA1A 1O8BA 3ETOA 4NI2B 2VOPA 3FNNA 2LXIA 3FEZA 3QBCA 1I94J 5CD4A 1RTDB 3TYTA 4U7CA 1JLQA 2PI4A 2RU9A 2JC0A 1NEEA 4OHYA 1T7PA 2Z2ZA 4TKTA 4KGMA 2GAGC 3D1OA 1NPRA 7AT1B 5HK4A 2BQRA 2ZBQA 1DLOA 2PDAA 5BR8F 2VQEJ 1KC8T 2DNQA 2OEMA 3W5XA 4ZP8A 3A8IA 1X4GA 4DSJA 3TQ1A 2UVVA 4D3HA 2Y8WA 1RQ0A 4LIWA 4EGLA 3R6LB 4OX8A 3I56S 1CC7A 3T9NA 4B3RJ 1MWZA 3S01A 4ETXA 2AYMA 3WQPA 2XMWA 1TVRA 1T3NA 1H3DA 3F44A 5G0RA 2ATCB 4PG7A 5A76A 4WU3A 2KM8C 1K73T 5GAHU 1B70B 4KGKA 2CPXA 1YJ7A 4DCPB 1M5KC 2F1FA 4USKA 2DGOA 5KFKA 2ZD1B 1F3FA 4USWA 3D6TB 3UPFA 4HL9A 1VQNS 2OFHX 2XGQA 4DZ6A 2B9XA 2HS4A 1T03B 6FD1A 2HBRB 2R4FA 2VC1A 2ZWPA 2XG8A 3A8JA 2GVZA 3MMAB 3THTA 5HLFB 3US5A 4GC6A 2AJFE 2AHOB 4JV0A 5KT3A 1SH0A 1NDKA 3GFYA 1P1TA 2BJ8A 2F40A 3QJPA 1CJVA 3E51A 5RUBA 1UW9A 1S5ZA 1X0PA 2Z4PA 1SBRA 1NSQA 5L46A 2HNZB 2X3DA 3UQSA 3HVAA 4XPCA 5J1EA 2YQ1A 3K57A 1T9UA 1Y5NB 1SQEA 2W2PP 2AEJA 3TJAA 3MM9B 3RRGA 3PYEA 1SC6A 1DQ9A 2POKA 2ZH2A 2E5HA 1IR0A 3UCUP 5HP1A 2OPRB 5M2PA 5DM6Q 1Q8BA 2XHWA 2DBBA 1TK8A 3ETMA 3IGNA 4NLRA 3TA2A 2HZAA 3FCHA 1RABB 2ILZA 2XNQA 3DRPB 2DNZA 2N7CA 2FJVA 3MI7X 3MR7A 2E1AA 2CZ4A 1Q7LB 5HN0A 4LQ3A 4RPFA 3W2WA 1IN0A 2G2YA 5HQLA 4ZPCA 1VLYA 3N01A 2FLNA 3I5CA 4B3OA 2J9DE 2LQ5A 1F9EB 2H5IB 3PXGa 3WBZA 5KFOA 2LKZA 2W01A 3T1HF 4RW7B 3I32A 2J0WA 4ES1A 1CQMA 4CLLA 1H7XA 5I42B 1TL5A 1YGYA 3ZZZA 3PHEA 2CPJA 3H59A 3NGKA 1T05A 1NK8A 2DIVA 1BQXA 2HHQA 3O44A 4ECVA 1O5JA 1JXVA 2J6UA 2VD3A 4WCEQ 5C24A 3LGMA 4OX7A 4FYWB 4ECRA 2PMHA 4LF7J 4KE5A 1U1QA 3Q23A 1T11A 4FP9A 3Q8UA 5GAGU 2JX2A 3OL9A 2DNGA 1R31A 4KR0B 3VTIA 3RBDA 5GADI 3D6MB 2HFOA 3VWSA 3CJQA 3OFHA 4NA3A 4NYPA 1RWXB 4LBHA 2FHJA 4JOUA 1LEOA 1H72C 5K9FA 3BGFA 4OI1A 3D4JA 5KT4A 2ZH1A 3MCSA 2R9LA 1BE4A 4DUZF 4Y6IA 5C5JA 5A8KB 3MURP 4CLFA 1I1GA 2XM3A 1ZTTA 4C8NA 3ZTSA 1DTTB 3BEGB 1M1KT 3MD3A 1AUSL 1JK9B 2VDIA 2HZCA 2NUHA 1RTIA 4PWUA 1HBOB 4I56A 3NOCA 4W98A 5HMXA 1HD1A 1N5YB 3J81U 4IR9A 4UW2A 3QQCD 4YB5A 1EJ7L 4QW9A 3OUYB 3N28A 4XIUA 3EZUA 1FRLA 3ILIA 1UETA 4DR5J 1PILA 2CZVC 4DV1F 1IBMJ 2DNKA 1UFLA 3PNIA 1FCAA 1RISA 1WKJA 4XO0A 1FD2A 3D28A 1SJQA 5KG4A 3C19A 3GJRB 5I3UB 4K4YA 2NYIA 2OO4A 3DOLA 2BUNA 3GFHA 2K7JA 4O4GB 1KQKA 3L95X 2APOA 3I87A 2XO6A 4C9DA 3B6BA 4RNHA 2Y0BB 4FYXB 2MQPA 1MU2B 1XC9A 5EWEA 2XMMA 3K8WA 1NHVA 3NOGA 3MHYA 4YR2A 5ETQA 3UR0A 4LF5J 2NREA 4C8LA 4LRDA 5F0WA 3C6TA 4J9RA 1S57A 3MM7B 3QO9A 5AXNA 1D8ZA 2YNHB 4BWMA 3SXLA 1JJ2R 2AV5A 3DRRA 1S0MA 3BGLA 2QV6A 2CWXA 4LF6J 1NK6A 2B9YA 2V4RA 4IG3B 2XMTA 1T9WA 4PPDA 4P6QA 4PXCA 1JLFB 3AB2B 2QO3A 1NPPA 3T5JA 1HL6A 1FNXH 2JFDA 1FTCA 1OO0B 4NLYA 3ZNJ1 5J2MB 4UY8T 4J9UE 3IFEA 3KKFA 3G8SA 3HXMA 4KC5A 3G6VA 4KFBA 1TQLA 2KDOA 1IUJA 5JVGQ 4GRSA 3NGDA 2IHR1 1UVNA 2V8GA 4ES3A 3EVMA 3A3PB 2J8SA 1QUVA 3PW0A 2WCXA 4YHHJ 3LP1A 1QE1B 1FRXA 3J7A1 3VAGA 1HMVB 3UNYA 4ZVPB 2VQFF 4Y2IA 3AODA 2ACYA 5DG9A 4N8OA 1U47A 5B0EA 4RL1A 2X7IA 4ZVUB 4B3TJ 6AT1B 3OTOF 2MLXA 3TUPA 2CPDA 3MMCB 2V8PA 4X4SA 2RDDA 4DV6J 2D3O1 1S1VB 1S1VA 3VGUA 1ZOTA 1PG5B 2KB2A 1YITS 2RAQA 1S6PB 4FN5A 3DOMA 3ILLA 4F04B 3OFEA 2E1RA 1F2HA 1YVFA 2W9BB 2DK2A 2V9WA 3PEJA 5LMNF 1Q81T 3P5TL 1BD6A 2BW2A 5CYMB 2CJKA 1JLGA 4NWBA 1PC4A 1MMDA 2L3MA 4NYZA 5KG5A 4F36A 1S1WB 4JYAJ 2NPIA 3PY8A 3CNQP 4ZLPA 3KG1A 3E01A 2NQPA 3MTKA 2FJDB 5DDQC 5F9LA 3M8ZA 3D1HA 1PBAA 4X4UA 5B0DA 1RP5A 1U1RA 2W7AA 4EMDA 3Q8QB 3MM5A 2CQCA 4WWSA 1Y0HA 4LRCA 2KFYA 4WJBA 3D67A 3ZZTA 2V50A 1NHKL 3CO0P 3T41A 1R8PA 2HVIA 3C6UA 3OTBA 2XMVA 4FS1A 4NA2A 3GIRA 3MR2A 1LOUA 4TY8A 5B09A 4HYKA 5HMZA 1CS4A 4HHJA 5L9NA 4YEAA 2HS0A 3LALA 3IBWA 4HVZA 1WTBA 3N4WA 1PJ5A 3IRXB 3IRXA 4LFCF 4ZPAA 4ZPDA 4DL2A 3LP2B 2KRBA 2E5LJ 5L8RC 4QR0A 1X4CA 3CT9A 3W2VB 1IKYA 3W2VA 2K8GA 4X62F 1T9XA 1GTHA 2QLFB 4ED2A 1OIAA 2V94A 5K14B 5HROA 2KXFA 2ZBPA 1JLAB 2X51A 1JLAA 3UN3A 3PVXA 2Y8YA 3OFGA 2ZH9A 5I3PA 3EX7B 4B3MF 4CO5A 4M5GA 2N4CA 1RAIB 1EKRA 1XN9A 4EI2A 1IBKJ 3DKDA 1NUEA 2RKIA 4QR2A 5HSPA 4ZP9A 3FQKA 3P96A 1HNIA 4F0MA 1HPZB 3GFZA 5B7WA 1DZ5A 2W4DA 1XMOJ 3CCQS 5DDOC 1D1UA 3UCGA 1I94F 2MZ1A 4NX9A 2OI2A 4ZN3A 1XTZA 5THWA 3PRDA 1RTHB 1N32J 3Q86A 3CCES 1FK9A 1ZETA 2IAJB 3TA1A 3KG0A 1BXNA 2BZ2A 2VQEF 3VAIA 2W4PA 4Q44A 5AJ3J 4C4WA 3CW2C 4OYXA 1VQKS 3TZWA 4F67A 3EMTA 2ADCA 4IFVA 1UEUA 4NASA 3PKMA 4P7VA 4IQXA 2ZOMA 3FUYA 2M52A 3NS5A 3V5RA 4OJ1A 4WE1A 2MLZA 3QYYA 1CJKB 2N7YA 4B3RF 1CJKA 3BREA 3DGPA 4X2BA 2EK6A 1S9FA 1K47A 1WKKA 4J9LA 1UP1A 4I6YA 4QJVA 2G1HA 4L75A 4A4JA 4CLWA 3L7UA 3MEEB 4GKJJ 2W7OA 3UW1A 1WSVA 2X1FA 4M5DB 1RWKB 3EGNA 3K0JA 2G9OA 3C8YA 3ENWA 1JB0C 4RW4A 3T5KA 5KFHA 1DURA 2Y3YA 4A8FA 1F1BB 3EWGA 3HX9A 3H90A 1OJ4A 3GWCA 1RAJA 2EW9A 2QMXA 4TYAA 1U09A 1FTRA 2KT3A 1JMTA 2C42A 5DQGA 2HG4A 1UVMA 1Q8IA 4EK2A 1LK7A 4RWXA 4OHZA 1UKUA 2V68A 4Q8FA 2DCUB 3FBCA 3ZZ0A 1YBAA 5LSLA 1ZPWX 4LR9A 5CZVA 1L3SA 1RU1A 1IR2A 3CTRA 1ITPA 4O4RA 2I2YA 4OMFG 4ZCKA 3JSMB 2CIMA 1Y5IB 3C16B 3OD2A 2NXCA 1PJ6A 3AQOA 3CJSA 2RF2B 2RF2A 1H73A 1TZ0A 3L7PA 3RBZA 3BSOA 2PMWA 2DHGA 2EKNA 3O2IA 4B9LA 5H9FJ 4BDPA 1LFPA 4Y3CA 4I6WA 3HO1A 5D4PA 5MLCV 3CJ5A 3TVKA 4OHXA 4L73A 1WC0A 3MMJA 4OZJA 4IDKB 3DI6B 3CCWA 1VBXA 3IM8A 3UR3C 4NZ7A 3ZFVA 4NCBA 3C15A 2DXDA 3BO3A 3HJFA 3EVWA 2VPYB 2BJEA 2XYGB 3DRYA 3NNHA 3KNGA 4IYQA 1SL1A 3I82A 2R8GA 2D1CA 4DQQA 2BR0A 2M9KA 1FFSB 3HSGA 1KOHA 2KU7A 3M8QB 3M8QA 2AT1B 4JI8J 2YWKA 3UN2A 2FLPA 1NCLA 1WKLA 1S1XB 1SC3B 2DY9A 1FRKA 3PW2A 3VAFA 2HVHA 5C25B 2ZDOA 1R43A 3NAIA 3VZHA 2QLJB 3BN4A 3BGOP 3K8VA 1J27A 1RK8A 4HLBA 2BRKA 2P9CA 3PG9A 4YDDB 4LF7F 3PX6A 4FNIA 4FF1A 3FQLA 4DX5A 2MQOA 3G2XA 4DUYJ 1LW2B 2XS2A 1D9AA 3MAQA 3LW5C 1FERA 3DMJA 3HHLD 1YRTA 4P2MA 3W1YC 4PABA 3TWZA 2G0IA 1HWIA 2CG8A 4NCGB 4GO7X 4NLDA 2MZSA 4NCGA 3Q22A 4P73A 1Q53A 1BC6A 3RW6A 2BABA 4UUWA 2D41A 3NP5A 5A6WA 2DTJA 1SPBP 4TQRA 2DGQA 2EC0A 4U67Q 2DHXA 3KLIA 1R0CB 2FZGB 2XYHB 4NLUA 1OYEA 1Q7YT 3PJXA 4Y34A 4L74A 1RAFB 3NNAA 3W62A 4URSA 9RUBA 3RYLA 3GMGA 1U8SA 1OQ6A 2DNNA 2UUTA 2F4VJ 4DR6J 3IG1B 3UI3A 3KK1B 1CQNA 2QFIA 3VQTA 4I69A 3O1LA 1HD0A 2P5VA 3PX4A 2VJVA 4CYUB 5IT4A 4X4OA 1RT7B 2E1CA 2CJYB 1IKVA 4EO8A 2LMIA 4KPYA 2R2UA 2KL8A 4DR5F 4J9PA 1IBMF 8AT1B 4OZ0A 1WHVA 5D3GB 2VPZB 1EQMA 4MIBA 2YY3A 3CD5A 2Z2MA 1AT1B 4DL6A 4O3OA 2BDPA 4F25A 2EFVA 2R8HA 3QGPA 2CQ2A 4PXBA 2YPZA 1HR0J 1HQEB 3IMQJ 4DV2J 4ANEA 5E0OA 1JKHA 4DLGA 1FDAA 2N4DA 3ULHA 1LKZA 3IP0A 4NMXA 5AXKA 6FDRA 2EWHA 3DRSB 4LF5F 2MEWA 3CJ8A 3TA0A 2MSSA 2QIFA 4FBTA 5LJ3Y 1URRA 2QGFB 4J9OA 2J7KA 3IC1A 3W5ZA 3SV4A 4DV7J 2BQ3A 2LQJA 5GMEA 1B7YB 2HBZB 2RRBA 2JVRA 3Q8SB 3M6VA 2MZTA 3JYTB 3OHAA 5J2PA 1ZM4A 2FYXA 4LF6F 1KRPA 4E8UA 1T9YA 2J7UA 1XR7A 3WIUA 2UVWA 3I0SA 2AZ1A 4OYOA 1M5PC 3LGHA 3DLEB 3V4IA 1UVKA 2R2RA 4ECUA 3OL7A 4GVLA 4QWBA 1KEKA 2DXEA 3QNWB 1BLUA 1X4DA 4WKRA 2UUAJ 2VH7A 3KTQA
chains in the Genus database with same CATH topology
5I42A 4U6PA 5KFAA 2FLLA 4IRCA 2B51A 4NOHA 5B0CA 4DSEA 1KFSA 3JTNA 3FSIA 3G6YA 1FKAF 2YNFA 2FPHX 2GV1A 3FRYA 3VR1A 4N77A 3V81A 1JLEB 3S8SA 1J2VA 2LA6A 2DNPA 1E6YA 5A8RB 1N34F 4OLPA 4MKYA 4YB6A 4C2MA 4XAKA 1FK9B 1FE0A 4MIAA 1VQ6S 3PR4A 1MROB 1ZBTA 3T19A 2J0SD 2QYCA 4NXMF 4O3SA 3MECB 1K0TA 1KTVA 1RT6B 1VHFA 2EBGA 4BBYA 1FXLA 1E6VB 3MECA 4NLSA 1OQ3A 4WFBQ 2NUUG 1SIZA 4JI2F 5LT5A 4YDXA 1VFJA 3SZ2A 3LF0A 3PW5A 1AUDA 3JSRA 2MB0B 2VUGA 1Y9OA 1B0VA 5KOXA 4YHHF 2L9NA 3AHPA 3K5LA 2W25A 2YKAA 5HBMB 3KHLA 3I31A 2C2RA 2V5HG 4MKBA 4OX9F 5HL7Q 3V6JA 1DAXA 4EFAC 2LXUA 4IFVB 3MEDB 2JEFA 2E9TA 3Q0AA 3HK2A 1FDBA 2AJQA 4JBCA 1KS2A 7FD1A 4ZP6A 3QAEA 3MM8A 5I4MA 5CHCB 3G6ES 3DC2A 1WI8A 3H2VE 3V6HA 1R89A 2MMYA 2VPXB 4OZ1A 4WE1B 1VC0A 2E1MC 3N0VA 4C3LA 4DL4A 1VJWA 5KFLA 2HHTA 3AH6A 4QBUA 2HIQA 5KFEA 5H1SV 2VL1A 1KHVA 4OQJA 4ZVGA 4B17A 2JJ4D 1XEZA 3LAMA 2YTCA 2B4VA 4UY85 2F8HA 4MYTA 1EETA 5F3ZA 4DV6F 4YY3F 2ZH6A 4MTPA 4PQAA 2EI5A 3OW2R 1RDRA 3CJ3A 1WHWA 2DNHA 4G1IA 1SJRA 1M5VC 2XS5A 2ROEA 4A8OA 3MR3A 2X1AA 2PFFB 3NNCA 1U1MA 4USHA 3EXYA 1H98A 1CPZA 2CVIA 4C11B 3MM6A 2W8KA 3H40A 2Y1IA 1A9NB 3PM9A 4EO6A 4Q2MA 3T1AA 1HBNB 3M8RA 1C1CB 1TK0A 3HI9A 3NCQA 4CH7A 3VAJA 1U25A 2KJWA 2ZITA 4J5OA 1B64A 2P9GA 1FJ7A 3ENQA 2JH3A 5JXSA 4NLQA 4JUZA 3UWTA 5A8KA 2HHHF 4G1QA 4OZLA 2DR8A 3K58A 5KFZA 1REVA 2BRLA 5LSOA 2YWFA 1ZM2A 4OX6A 1P8GA 2KHDA 4RW4B 5D6GA 4O44A 1LWCB 1DBDA 1FRIA 1DTTA 1SUQA 2D9OA 3T9ZA 1KQSR 3CWJA 1TP7A 2VBZA 2ZBCA 3CDAA 2UV8G 2JLEA 4C3KA 2FUG9 1NH7A 2DRAA 3MOJB 1WF0A 1UW4A 2CRLA 1S6OA 4U9RA 1VRUB 5DGAA 4WU2A 3MF5A 1VRUA 3POTA 4DLEA 2Y1RI 4JYAF 1HBOA 1TAUA 4ED1A 3MR5A 2WTFA 3BSNA 3BZQA 5E5NA 1PSDA 1N5YA 2QA4S 3QWPA 2MQQA 4TNOA 3LWMA 1IKXA 5E3PA 2KT5A 1N0UA 2MKJA 1XMBA 2ZNYA 4IR1A 3M8PB 4RNMA 3CJKA 1UVJA 3T3FA 2RD5C 1HHTP 4R8UB 3CXCR 1TKTB 2J0XA 5E3RA 2FVCA 1TKTA 3OUYA 5A8WA 3SQGB 1H6KX 1WD6A 3EGWB 3RRKA 2O67A 3ZZOA 4AXJA 2ATLA 3DM2A 1FRMA 2XWXA 3CCUS 2KYXA 4IOBA 3F56A 4L3NA 3BJYA 2I5JA 1KOOA 5B0GA 1FF2A 1R8HA 1VQSA 3DLBA 2YX7A 3ZZUA 1FHTA 1XERA 2UXDF 2OFGX 2FHKA 3IA0A 4CZCA 1IQTA 2Q43A 4I6AA 4WFXA 4RUAA 4TU7A 3N5FA 1L3KA 2QEXS 2ZOFA 3PW4A 4YMEA 1CEZA 4WFNQ 1UA1A 2CQHA 2VG7B 2KTQA 3HFKA 3NWGA 2FLOA 2XCPA 3B4MA 2HVZA 1VBYA 3TANA 3IN5A 1YJNS 4KV8A 3FFIB 2RSQA 3LWLA 3KNAA 2HAIA 2F8EX 2KO1A 1QSYA 1S6QB 3EZ5A 7FDRA 3ITHB 2CPIA 4ZDNA 1WI6A 4ATNA 1O51A 4Z37A 1FNOA 1RJJA 1FRHA 5I3UA 4X66F 2R7TA 3VAKA 1B0TA 1N5TA 4CI0B 1SL0A 3UI3A 2RDJA 4ZCIA 3M2UA 2R8IA 1YSJA 4PUOB 2XB2D 3I0RB 5KFRA 5EDWA 3TAQA 4O4GA 1U1OA 3C2PA 1Z2LA 1U6BA 3SFGA 1RKIA 4I2PB 4Y2CA 4FPRA 1KQFB 5L39A 4KO0B 1JLBB 2XGPA 3ONQA 2BM1A 4G6VB 3IAM9 5LJ5Y 1S4FA 1LW0A 2RRNA 2ZE2B 5GAEI 2N3OA 2DH9A 2ZE2A 3S6EA 2JEIA 4K4VA 1HI8A 4QCLA 2R7UA 3MXHP 2BYCA 3FDSA 2R7XA 4Y00A 2DRBA 4JI4F 1MU2A 2CQGA 5DLFA 1Q86T 3IR7B 4BCAA 5C42B 1H38A 2UP1A 3CDWA 2EFOA 4M94A 4QWEA 3GV5B 1W2IA 4IH6A 1S79A 3L7OA 2XLIA 1XK8A 3D5MA 3SYZA 1CLFA 3SMZA 1YG0A 3HMJG 3MUTP 1YJWS 4CTAA 1S9EB 1P1LA 4CO2A 2E5LF 3N79A 4J9NA 1FE4A 4ED7A 4J9MA 3AA8A 3UDLA 4CIOA 4NLOA 4QR1A 1S9GA 3KWMA 3QAUA 4YUDA 3KLEA 5EWGA 1NO8A 2XMKA 2YKOA 3UFCX 3ISZA 2QZ8A 1RT4B 1KVJA 3I5BA 1R8AA 1G3OA 4PR6A 5IT0A 3MM7A 1RT2B 1OPZA 4M1KA 1DTQA 2B3TB 5KFJA 3GSDA 3MDFA 2YNHA 1UAWA 5G4DA 1L5UA 4C8OA 4WFZA 5HQ8A 3FVYA 4YB7A 2BBEA 2MY7A 2O1PA 3IAS9 3OTEA 5F8NA 3O5TB 1YWXA 1HWUA 1D3WA 1U24A 4EBDA 2A1BA 4PRFA 4ZPVR 1Q82T 1XBWA 1RKJA 2DGXA 3ISNC 1IBKF 2E7WA 4AFFA 2AJ0A 4C0BA 5D78A 1KQGB 4IG3A 1VGYA 2KRRA 3RB0A 2YQ3A 1BQNA 4QWCA 2OTJS 2WSEC 4KB7A 1QSSA 3MMBA 3G9CA 2YH0A 2M0GB 1KLMB 1SV5A 3I9V9 3QGIA 2IBOA 4NA1A 1VQMS 3H5XA 2XY7A 1O8BA 2YNIB 3ETOA 1JLFA 3CC7S 2F9DA 2YNIA 4NZ0A 1S0NA 3M9NB 3B8HA 4R0JA 1QTMA 4G3IA 1XMOF 2VOPA 3FNNA 2OPPA 2IRXA 4A8XA 2I38A 2G4BA 2J6TA 2GGPB 5B0BA 2GGPA 4ED8A 4KQZA 3PV8A 5CCMA 5KT6A 2CG4A 3HKZD 4F4WA 3NL0A 4M63A 3K5NA 1UWBB 5J2MA 4I0WA 2L48A 4LVNP 2LXIA 5KG0A 3RB4A 3PZPA 5AXLA 1F5CA 4OI4A 3FEZA 4A46A 4O3RA 2MQLA 4TXSA 1J5OA 1WG1A 2IM1A 1S49A 1SH2A 1N32F 4RU9A 1N36F 1RTDB 3MEGA 3TYTA 4U7CA 4DS4A 3SI8A 1JLQA 4DSFA 2PI4A 1TR0A 4QPTA 2RU9A 2CQ3A 4K5RA 2JC0A 5KT2A 1NEEA 2D3UA 3R1LA 4OHYA 3BGRA 4HTJA 3DMJB 2RH3A 2FGCA 1T7PA 3CCLS 4TKTA 4KGMA 5KFTA 2OD4A 2OSQA 4X4RA 1V9OA 3D1OA 4HI2A 1AROP 4KJIA 4PQUA 4OV1A 4NLPA 2ZJQQ 1U6FA 2BQRA 4WTYA 5AJ3F 2EG1A 4MKAA 2NS1B 1DLOA 1N8RT 2PDAA 2BV3A 2U1AA 5BR8F 3JSYA 1RT1B 4ED0A 1KC8T 3S1TA 3PKYA 1S99A 1Y7PA 1RT3A 2DNQA 3PEHA 3G71S 4ZP8A 1WG5A 1QE1A 2VBYA 2XLKA 2B4PA 2MGZB 4X64F 1HMVA 2ILYA 2Z2LA 2B9WA 2VFSA 4C8MA 5KFWA 1X4GA 2B0GA 2VKRA 2PO4A 5A0YB 2ZFHA 2DVIA 4DSJA 3DU6A 1C4CA 2IM3A 3KLIB 2M3DA 5L1KA 3TQ1A 2UVVA 4W92B 2R8KA 1S77D 4LJMA 1FJEB 4D3HA 2D74B 4DOZA 3MTJA 4URGA 1C0UA 2IC3B 1K8AT 1RQ0A 4KRWA 4LMZA 4LIWA 4EGLA 1UJ5A 4OIXA 3I56S 2PT0A 4OX8A 4ZPWR 2RQKA 1CC7A 2XS7A 2KG0A 2P6TA 4OZNA 3T9NA 3KJVB 4ZP7A 1ZTWA 2HHPA 3MMCA 1MWZA 1WACA 3S01A 4ZCLA 4ETXA 2D9PA 3TRGA 2AYMA 4NL5A 1FEEA 2XMWA 1TVRA 1IKWB 1H3DA 1T3NA 4H4OA 1HI0P 3D0HE 3F44A 1X0FA 4GKJF 3NKYA 3RTVA 3OXLA 5G0RA 4C0HA 4ETZA 1FKOA 4PG7A 5E33A 3GV8B 2LXFA 3M1VA 4WU3A 2KM8C 1SJ4P 5CQGA 1K73T 3ZZRA 5LMUF 3DHXA 1S1UB 5GAHU 2ZJPQ 3V6KA 4KGKA 5DGBA 2V2KA 1FEHA 1F9FA 2CPXA 2HW3A 2PD1A 1NJXA 4IH5A 1M5KC 3PRBA 1S6PA 2F1FA 4RW9A 5F8LA 1X5OA 1SI9A 1YRUA 2CJQA 4TN2A 2DGOA 5KFKA 1L3UA 2ZD1B 1GXUA 5ITHA 4YR0A 2AF6A 3NCPA 3UPFA 4HL9A 1VQNS 3KK1B 2W9BA 2OFHX 4CH1A 2XGQA 3Q2SC 1YI2S 2B9XA 3SCIE 1P27B 1IKVB 2Q3PA 3MZIA 2HS4A 1T03B 2XY5A 6FD1A 2VFVA 3D1QA 5CYMA 4N47A 2R4FA 2VC1A 3THTA 2XG8A 5HLFB 2HNDA 3MMAB 4I4BA 4TY9A 1M0SA 3OTCA 3US5A 3MUVP 4K59A 4WF9Q 4GC6A 1S1WA 2AJFE 3KHRA 3CCJS 2GC8A 4JI0F 3M6UA 2F8MA 1XR6A 4CO4A 4JV0A 5KT3A 4BS2A 1SH0A 1C2PA 3GYNA 4A8SA 1HNZF 1EP4B 1V3RA 2CQ1A 3QLHB 3GFYA 2H9ZA 4DR2F 1BWEA 2HNYA 3MGJA 2AWZA 3DLJA 3M2RB 1P1TA 5FD1A 3U1LA 2F40A 2PA3A 3QJPA 3E51A 5IS2A 2DGTA 3EPIA 3JAMY 1Q16B 4DR7F 4PG8A 1HYSA 1X0PA 2Z4PA 3KK2A 1SBRA 1LFWA 1VQ5S 4F3OA 3QJJA 4ERDA 2HNZB 3UQSA 4C8ZA 4RX6A 3HVAA 3TW0A 1K0VA 4XPCA 2EG2A 5J1EA 4MK9A 3K57A 1VQ4S 3LPYA 5IQ6A 1JKHB 3OL8A 1HARA 2XNRA 1VQOS 1Y5NB 3FMWA 1SQEA 2IVYA 3J7ZT 3U02A 3E3XA 3MM9B 1R8CA 2HPUA 2CQDA 1TL3B 2VFUA 2ZVSA 4A8MP 2F3JA 2C28A 5KG3A 1X4FA 3RRGA 2CJAA 1SC6A 2UXCF 3H8YA 5T7LB 1DQ9A 2XMJA 2POKA 2ZH2A 5T7LA 2E5HA 1FESA 2DNYA 1IR0A 2WHOA 3UCUP 3PFEA 5HP1A 2VBWA 1S7HA 2XSJB 4ELVA 2LLZA 2OPRB 2PE8A 4Y65A 5M2PA 1Q8BA 2O01C 5DM6Q 4O0IA 2XHWA 1H2VZ 2GHPA 2JSXA 1FJCA 2DBBA 1TK8A 4LVOP 5KAKA 1IXKA 3IGNA 2V4JB 3IWLA 5DDRC 3FZBA 1M90T 4ZKAA 2YWHA 4NLRA 3TA2A 3KYLA 2M8DB 1G7CB 3BS9A 1TFWA 3FCHA 3QIDA 5IM0A 3THVA 2ILZA 2LCWA 2XNQA 1X9SA 4CO3A 1MWYA 1YTYA 2CJBA 3DRPB 4ECWA 4Y0FA 5KFUA 3NBPA 1FDDA 2CPYA 2DNZA 2N7CA 2FJVA 2J76E 3MR6A 3MI7X 2RU3A 4OJ3A 1FO1A 2E1AA 3R5BA 2CZ4A 1FT8A 1HBUB 5D77A 4K0KF 2OTLS 1Q7LB 2PMZD 5J2PB 3AQPA 5HN0A 4ECXA 4LQ3A 2CPZA 4B9NA 2YKNB 2ZHAA 1QM9A 1IN0A 3LP2A 3W2WA 2RQMA 4R5PB 2MKIA 1Y3JA 4ZPCA 3VZIA 2JLFA 5CYQA 4YR3A 1VLYA 3N01A 1N0VC 2FLNA 3I0SB 1ZZNA 4OHWA 4U7UK 4TQSA 3I5CA 4B3OA 2J9DE 1B7FA 2LQ5A 1KTQA 5EX3A 3CEDA 1JXEA 2DGVA 4BC7A 3PXGa 3WBZA 4IRKA 2ZKTA 2LKZA 5KFOA 1FVSA 1L3VA 3H25A 3CCSS 3T1HF 1N54B 1RTJA 2B5JB 4RW7B 5K14A 3V4IB 2B5JA 4DFJA 3ISND 3KLHB 4WZMA 4A8WA 5KFNA 1R0AA 3I32A 5BJRA 2ALZA 4RNOA 5AE1A 2PI5A 1GXLA 2F7VA 1W2BR 1UFWA 2J0WA 3K59A 2K1RA 4ES1A 1QY7A 5D4LA 2KI2A 4JI8F 1CQMA 2IRYA 3RB3A 2QSFA 3DNCA 3TUZC 1VC6A 5CXTA 1H7XA 3TOQA 5U47A 5I42B 1TL5A 3TI0A 1YGYA 4KTQA 1MNEA 3CD6S 1XWLA 3ZZZA 3QJLA 1Y4ZB 3PHEA 1VK3A 2YNFB 4QZVB 2CPJA 3H59A 3NGKA 4TU8A 3V81B 1FJGF 3QWUA 2LQ9A 1T05A 1E6YB 1NK8A 3BQ2A 5JVHQ 2OJ3A 2DIVA 2BANB 1BQXA 2VKZG 2HHQA 1H2UX 1HPZA 3O44A 4ECVA 2M8HA</