3LW5C

Improved model of plant photosystem i
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
81
structure length
81
Chain Sequence
MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWGGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title Structure determination and improved model of plant photosystem I
pubmed doi rcsb
total genus 3
structure length 81
sequence length 81
ec nomenclature ec 1.97.1.12: Photosystem I.
pdb deposition date 2010-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF14697 Fer4_21 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lw5C00
3EUNA 1Y5NB 1FRHA 3MM8A 2C42A 1PC4A 3PNIA 1D3WA 2WSCC 2O01C 2PA8D 3GYXB 1FEHA 1Y5LB 3MMBA 4CI0B 5BYSA 2FJAB 1BWEA 3MMCA 1CLFA 1F2GA 1JB0C 1G3OA 1R27B 4OV1A 1Y4ZB 1Y5IB 3HKZD 3OR2B 3MM5B 6FDRA 5BYQA 4YDDB 2FJBB 4XDDA 1FCAA 1FD2A 1FERA 2IVFB 2WAQD 1B0TA 2V2KA 1H0HB 3MM7A 2C3UA 1H7XA 3LW5C 1HFEL 1AXQA 2VPXB 1IR0A 1SJ1A 2VPYB 1KQFB 2UZAA 1GT8A 1K0TA 5BYRA 3MMCB 5CHCB 1DAXA 1FRIA 3MMAB 3MM9B 4ID8A 4AYBD 3OR1A 2XSJB 1FF2A 2C3MA 1FRXA 2Z8QA 1FDAA 2FJDB 3IR7B 1C4CA 3C8YA 2C3PA 1Q16B 3MM6B 1A6LA 1FXDA 1FXRA 1KEKA 4OMFG 2FGOA 3MM7B 1BLUA 1SIZA 3OR2A 1JNZB 5CH7B 3MM8B 1BQXA 2GMHA 3IR5B 1H98A 7FDRA 3IR6B 1RGVA 2V4JA 3MM5A 4L6V3 5E7OB 1GTEA 3MMBB 1DURA 1C4AA 1F5BA 1BC6A 4RKUC 1FDBA 1FDNA 3OR1B 4XDCA 1FTCA 1F5CA 1G6BA 6FD1A 1GAOA 1KQGB 2C3YA 3EXYA 1JNRB 4KT0C 3EGWB 2FDNA 5FD1A 2PDAA 1BD6A 1GTHA 2WSFC 3MM9A 3MMAA 1SIWB 1IQZA 2XSJA 2FD2A 1FDDA 1FRKA 2Y0SD 1B0PA 1PC5A 1ROFA 2V4JB 4XK8C 1FRLA 1DFDA 2VPZB 2PMZD 1FRJA 1WTFA 1H7WA 2WSEC 2ZVSA 2WB1D 5L8RC 1FRMA 4DHVA 1XERA 3MM6A 1B0VA 4Y28C 7FD1A 1VJWA 2GMJA 2VKRA 2VPWB 2FJEB 2C3OA
chains in the Genus database with same CATH superfamily
4DV5F 1FNOA 2OELA 2HVIA 3KLFA 4KO0A 2HQFA 4CP5A 1YBAA 1G7CB 2PT0A 3NWRA 2DH8A 3MEKA 2VODA 1VLOA 3VAFA 1CSJA 2HGNA 2RE1A 3LW5C 5KFKA 2ACYA 3M8WA 5L1LA 4HTIA 3M2RB 4KIAA 4NYOA 2W8KA 1VQKS 1HNZF 4Y2AA 3M6UA 4E2FB 2HHQA 1UKUA 4LJMA 2OD6A 4CH1A 1VQLS 1FXRA 3QGHA 1QSLA 2R8GA 2UXBJ 3UD4P 3CC4S 1UVIA 4G3IA 3D6FB 5CYQA 4L6V3 1U6FA 3L9ZA 4CTAB 1H2UX 4K5SA 5AJ3J 2WCXA 5ETTA 3D54A 4RX6A 3SSSA 2CQ2A 4OZ2A 1U49A 3BBBA 2WVDA 2CPDA 4WU3A 1AUDA 2ASJA 1NH7A 2HFZA 4KQZA 2WW8A 3O2IA 1B7FA 2QL5B 3TYTA 3EGNA 3VV2B 1VQSA 1LFWA 2AJQA 1U0HB 1PC4A 5ADZA 4CLSA 4DX7A 1RT2B 2EK1A 3L09A 5D0EA 3JAMY 3G96A 3J7YI 2VICA 4I6WA 4B9LA 1FVQA 3ONQA 1FERA 4XAKA 1IBLJ 1REVA 2BJ7A 3PY8A 4XPCA 1HQEB 4U7UK 2A2CA 1FWPA 4V19J 4NLOA 5FIIA 5D15A 2HQIA 3CF5Q 2VFUA 1WDTA 3CD6S 4ZCIA 4K4VA 1S10A 1KVJA 1Q1KA 1M5OC 1HBMB 1W26A 4DR6J 3ZXWA 1PSDA 4DFJA 5J2QB 1FDNA 2GO9A 3HVTB 4ILLA 2VC0A 3CE8A 3AOBA 2V67A 3ZZOA 1SIWB 2W25A 4YR2A 5J1PA 4FF4A 3DRRB 4PKDB 4S0MA 5E3RA 4C0OC 4DEZA 1EQ0A 4IQMA 3GMGA 3HVAA 1LW2B 4NLXA 4V19X 4F04B 5F8NA 5D8HB 3DDIA 3CJTA 5LSOA 2KFZA 4TY9A 3ILOA 3OTEA 1RT7B 4J9MA 3FQKA 4A8KA 1G3OA 4WU2A 2R7TA 3BGFA 2QFIA 2ADCA 1WOPA 4B9UA 1X60A 4KGMA 2VV5A 4NCGA 1F1BB 4BWMA 5A8KB 5DZ7A 4DV4F 3EVMA 3DOLA 4I6AA 4ZP9A 3R6LB 1N32F 4IUFA 3OVAA 2DNLA 4L75A 4O3QA 5ETNA 4I6YA 3HFZB 4P75A 3BJYA 4FKYA 2ZH3A 1E6VB 4OZJA 3F0NA 2CVEA 3PW0A 4TNOA 4DLGA 1WJ9A 2Z57B 4QPXA 1UWBA 1N36F 1KQGB 1T02A 2FVQA 2PFDA 5KFNA 5K14B 2E9TA 5DG7A 3DU6A 4DF4A 2YX4A 1P1TA 3NGTA 5KFPA 2PEBA 3C6UB 4KH0B 2QT7A 3U1NA 4RNNA 4YHHF 4EU0A 3M8PA 4ZPWR 1SCJB 1JJ2R 3MTJA 2V8HA 2L08A 1JJHA 1RWKB 4JI0F 4LRFA 4O4RA 3PFOA 3HZEA 1C1BA 4ZPCA 1R8HA 2VDIA 4BS2A 2BEFA 5L9NA 3EXCX 5A6PA 2ZC3A 2MJNA 3T1AA 4DMZA 4ILRA 4F4AA 1HNWJ 3OL6A 5B0AA 1RHKB 4U8VA 5HL7Q 2DNMA 4DQRA 1NJYA 3KUHA 2BE9B 3WX8A 2R8KA 3HHLC 4PQAA 1YJ7A 3OR1B 1FTCA 2UUCF 2M8HA 2AGPA 2HBZB 1KLMB 3N0VA 3K2YA 2WSFC 3AFGA 1KP6A 2V34A 2DPIA 1CJTB 1GQEA 3LF0A 3U02A 5HQLA 1HNXF 2JLFA 5LMUJ 4NPOA 1HA1A 2G1DA 2O1PA 1K73T 2AP6A 1TKXA 1HARA 4B3MF 2HG4A 1D1UA 3CXCR 2B3TB 1NMEB 4AUKA 3HP6A 1K1QA 2CNLB 4Y2MA 2DCLA 4LF5J 2UXCJ 4KKOB 2QO3A 5ETKA 2YKNB 2BR0A 2BJ3A 4ECRA 2VH7A 3ETOA 2DRBA 4RW8A 4C98A 3ULHA 4QYRA 1SV5B 3UI3A 1JLCB 5BYRA 1SJRA 1N0VC 4MIAA 1TV6B 3M9MB 2EEYA 3L95X 4GMKA 1VC6A 1RTHB 1C1CA 4DBQA 4A46A 4DV3J 2HNZA 3HVWA 3W63A 3AB2B 2PMWA 1GX6A 4JI3J 2RNEA 2Z2ZA 2QL7B 3NG8A 1UA0A 5FDLB 4G65A 2DHAA 3O6QA 4L3NA 2MKJA 2CZ9A 2QA4S 5F9LA 4LFAF 1LWCA 1ZPVA 3OL7A 3VAKA 2B51A 3CJ5A 2F1FA 3Q83A 2DGOA 5J2NA 1JJCB 4UZBA 3IS9A 3KJQB 2CQBA 1SUQB 4PXDA 5H1SV 4CO5A 1HR0J 1BWEA 1D0EA 2B5JB 3R5AA 2NREA 1RT3A 4DV7J 2B9WA 2XS7A 4J9RA 1TL5A 3R1HA 2NXUA 2B9YA 3AODA 3LGNA 4RL1A 4DR5J 2V94A 1MN9A 3N6MA 5JXSA 4R0JA 5LJ5Y 4MKYA 1WSVA 1KS2A 3GLJA 5I42B 5KT6A 4R5PB 4Y2IA 2P9CA 2QIFA 4ZMMA 4ED7A 2DIUA 3BO2A 1WSRA 1WKKA 4KH1B 5E7OB 2A18A 3W60A 1IKWA 1FWKA 2RDJA 3JQMA 4F3MA 4KV8B 3ZZ0A 2M52A 1XNRJ 4ZA1A 1N54B 2HIQA 3DLGB 3NGDA 2VONA 1MU2A 4ZLLA 1OS5A 3G8QA 1WC6A 2UU9J 3OBIA 3M8QB 1DHMA 1JXEA 5D4NA 3KLGA 3MECB 5D0HA 5HQ8A 3KYLA 4HL9A 1F3VA 3PRDA 4ZCLA 4N76A 4OI3A 5C24B 5CCLA 3CCVS 3D3CJ 2HW3A 1S6QB 1S4FA 1EKRA 1SL1A 3DM2B 4IYQA 2XNQA 2VPYB 3MEDB 4ID5B 4USMA 3M30B 4EBEA 2E1MC 4DL2A 1TMJA 2LXFA 3NBPB 3M6VA 2C3PA 2L9DA 4QOTA 2P5VA 2XGPA 4I69A 3AXKA 4DG1A 3BR9A 1FX2A 2HWTA 2F9JA 3CCZA 2VJVA 1Y10A 2I2YA 3JAMU 1QD1A 3HXMA 3EGWB 5KT7A 4JI2J 3FSIA 1TVRA 2QA1A 1VBXA 3DLKB 3PJ9A 5IM0A 1Y0HA 2W7PA 2CPYA 4IG3B 4GO5X 4YOEA 2P6TA 1WG4A 2AU0A 5GMKa 3L7PA 3VQSA 1KTVA 3BGRB 3HVRA 2KHCA 4JUZA 1RU1A 3CCUS 4DPOA 3HLUA 3SCLE 2BM0A 4F67A 1GFWB 1MNEA 1L3VA 2ZOMA 3OTOF 2D7SA 4PWUA 1S7IA 1VYAA 3LP0A 2QA2A 5HMWA 1RWOB 1JLQB 3FCVA 3S01A 3ZNJ1 1UEKA 2VQEJ 1WC0A 4CO0A 5BXIA 3BV8A 3MFHA 5A8RA 2AX1A 4IDKB 2GO8A 1SKSA 2DH7A 3AA9A 1S9GB 1Q0NA 1R0AB 1TL7B 1K1SA 3HSGA 4A8WA 1TKZB 2GJFA 2VUGA 2NYIA 2MHEA 4CQ1A 4X64F 1R89A 3ITHB 3IWXA 3D0GE 2YKMB 4WKYA 4ZCKA 2MQMA 4P52A 5HVHA 2CRLA 2EC0A 1W25A 1YDLA 2XLJA 2RHSB 1UA1A 1X4CA 3TRGA 2RF2A 2BJEA 2N3OA 1OJ4A 3HO1A 2FLLA 2K3KA 3D0IE 2CADA 2KI2A 1VQ9S 3FMBA 2YQ1A 2ZH6A 3LUYA 4CLFA 2YWHA 2XY5A 4DSEA 3G6ES 5L46A 2BJDA 2FZKB 3OXGA 4ZVQB 1H38A 1LNQA 1D9DA 2W4PA 1TZ0A 2V63A 3DDKA 2VA2A 3FRZA 4ECTA 1N34J 3GB0A 1SJFA 2R2SA 4K59A 4O3SA 2KO1A 1H7XA 3JSYA 2OEMA 5J2MA 2HURA 2ZH4A 2VG7A 4P2FA 4F2RA 1RQ0A 4RBUA 4HLBA 2B56A 3CO0P 3Q8VA 1X4GA 1NK0A 2QSFA 3BPDA 4LFCJ 3ZFVA 5T14A 3M8ZA 5KG7A 1JLGA 2IC3B 3TVZA 3HD1A 3G87A 2PEHA 1EAYC 1IR0A 4DSFA 3GTYX 3H7HB 4W4MA 3TAQA 3ISND 3C14A 5KAKA 3IM9A 5D4LA 4KGVB 1ZTWA 2JNJA 3B8HA 1RTJB 3IR7B 2Z30B 4O23A 1A6LA 4WP3A 2FJWA 3TJAA 3NP5A 3DGPB 3PEJA 2XCPA 4PG7A 2E7XA 2BKOA 1BC6A 1UWAA 3AJ1A 2IRYA 3W5XA 2JHEA 3QFHA 1OWXA 4B9SA 3LPYA 3M2RA 5JMNA 2F5GA 4IG0B 2HZAA 3MPUB 4LVOP 2IBOA 3I82A 2PMZD 3PHEA 3BGUA 5IT9Y 1NDKA 3CD0A 2AZ3A 3E51A 3C15B 2RQMA 4L74A 2VQFJ 1UEUA 3ADAC 4N5SA 3VGTA 3LANA 1T05B 2XHCA 4CTAA 3T5LA 4NEZA 2O5DA 1G4CA 3BDPA 2HRTA 2PMHA 5ITHA 2MKIA 1IJFB 1APSA 3BYPA 1IKXB 1OPZA 1NKCA 1JLEA 3CPWR 2XY6A 4KRWA 3TR5A 2V0NA 1K8AT 3SV4A 4Q2LA 1NB7A 1U0HA 2FJDB 4J9LA 4X4UA 4YY3J 1HPZB 1RT2A 4OX6A 4OZ5A 2DGTA 1UVMA 1H3DA 2X7IA 1AZSB 1S48A 1WWHA 1S77D 2KB2A 4JI7F 5I3UA 3H42A 3RB0A 5G4DA 3BKTA 4CLWA 3BYRA 4RW6B 1HQEA 4RW9B 3G2XA 2H65B 4HT7A 3UCZP 5I3PA 2D74B 1RAAB 2NSBA 1B99A 1SVDA 3E01B 5L8RC 2CPXA 2PFFB 4LRCA 3EYZA 3V4IB 1HBMA 2IIHA 1D9FA 4CI0B 3CC7S 3G86A 3RAQA 4OZ3A 2X1BA 2A0FB 3DFEA 4OHWA 5J2QA 4LRDA 3PEHA 3KK2A 4F50A 1WHXA 4YB6A 4I56A 2HVEA 2UUAF 4LR9A 3TJ9A 3DRRA 3W66A 3V6JA 1WUUA 4FPRA 2OTLS 2Q6CA 1LW2A 2VDHA 2KKHA 3OFEA 2LQJA 4EK2A 1KVIA 3RJMB 5IQ6A 1O51A 2C22A 1EKSA 3PYDA 1RT7A 2H5EA 2QL9B 4NOHA 5KFFA 4OYIA 2X1FA 1RHQB 3IC1A 1U4BA 4XO0A 2CJXB 4A4JA 4Q44A 3QSYB 3SIPB 3PX6A 2QE5A 3QJPA 5MLCV 5A8KA 4IO1A 3T19A 1RTZA 2NSCA 1NUEA 2V4JB 3OQ2A 1YLXA 1S9EB 4C2MA 1IM6A 4EMDA 4OYAA 3TA0A 1QUPA 2VPWB 4ICLB 4EYIB 3VQTA 2HVZA 5F0UA 1D3WA 1E6VA 1P6TA 4OYPA 2E5LJ 2BYCA 1LW0B 5A0YB 4G1QA 4LF4F 1KN6A 1NK8A 5KG2A 4RNMA 1KWMA 2EFNA 4YDDB 4OX9J 2AIRB 5K14A 1SJ4P 1KQFB 5F8JA 1NSKL 2YVSA 4KFBB 2KT5A 1IBMJ 4M1KA 3C6UA 1H6KX 2CA9A 4OQJA 1U48A 2CG8A 1RAFB 3PM9A 1Q16B 3TA2A 4UOGA 1TL1B 1IKVB 4EO6A 4JB8B 3CCLS 4KBIA 4ZP6A 1WF1A 2R42A 2R9LA 3IG1B 3GIRA 3JTOA 4UUWA 1AFIA 4P71A 1P9QC 5CYMB 2ZH9A 4QZVB 4YEAA 1NNDA 1ZM2A 4DLEA 3W2VB 4JP8A 3W9HA 4ES2A 2CPEA 1IN0A 2LQ9A 1NSPA 1VS3A 3BO4A 2RIJA 1S1WB 3PCOB 4DUYF 2GV1A 1U0SA 3MR3A 2GIFA 3GYXB 3WC2A 1N5SA 4EUVA 3HI9A 4Z7CA 2QLBB 1HNZJ 2ZBCA 2XZWA 2HHUA 1A0OB 1LXNA 1KLMA 1YX2A 5KOXA 1FJEB 5IWAF 3KDNA 4GKJF 1CJTA 2DGVA 2K7JA 4AYBD 5L38A 2CUYA 3G6XA 4JV1A 2NS1B 1T03B 1R0BG 1Q79A 4ZCMA 4Y2CA 2NYHA 7FDRA 3DYAB 4KKOA 3Q2SC 2RDDA 1RSCA 2YKNA 3EPIA 4F8RA 3FCHA 3UE2A 1U7LA 3TW0A 1EP4B 4JI1F 4IR9A 5AE3A 2YNFB 5EDWA 1JLCA 2RUSA 5HP1B 3IMQJ 4DV1F 2CQ0A 2DYAA 3BH7B 1TV6A 1WHWA 3T5JA 1BQNB 2XO6A 3IN5A 2HQGA 4DSIA 1ZAXA 3OLAA 1VCTA 1RTHA 2CAJA 3DN9A 1HLWA 3W5ZA 4OI1A 1S97A 1F2GA 3KOAA 2XLIA 5FDLA 2YKAA 2QLJB 1H0HB 1OMSA 2AJ1A 1AXQA 1RTIB 3VZHA 3PG9A 2HQCA 1F0XA 3GCXP 4FKXA 2NZ4A 2DKOB 3VTIA 2D9OA 2E7VA 1LEOA 4ANEA 3ZZYA 1SUQA 1S9FA 3BH6B 2OPSB 2DNZA 1PKUA 1AYEA 3IFEA 3R9LA 1RADB 4KSEB 2B5JA 1DQ9A 3H8YA 4QPTA 3ZNUA 4U7CA 2EFGA 2YWGA 4FXWA 1AA1B 2MLZA 2JVOA 5GMEA 3CJ3A 2MMYA 2FDNA 5K9FA 1ZM9A 3MUTP 3H2LA 4J9NA 3PX0A 2G2ZA 5I42A 4R5PA 3H98A 3PW7A 3HT0A 3RB6A 1IJEB 1T0TV 4DUZJ 5HMXA 1M5PC 5IQQA 3R3TA 3LP2A 4ECVA 3IA0A 2DBBA 4ES3A 1N32J 4KV8A 4QR1A 3SFGA 5IFMA 1GMVA 2VG6B 5IT0A 2WZ1A 2IY5B 1YZ6A 2V2KA 2C3UA 1LK7A 3DLGA 3G8SA 4DV0J 3W8GA 4Q2MA 1WI8A 2KM8B 3M8QA 3M2UB 2WBRA 2MJUA 3NEKA 3MECA 4HACB 3QIPB 5LSRA 2CJKA 5L39A 4QU7A 1MROB 5CQGA 5IT9U 3M8YA 1S5ZA 1RGVA 5C24A 2EFOA 3UQSA 4B17A 3GWCA 2OHDA 1MWQA 1DURA 2LQ5A 2BXJA 3CO9A 3N5FA 5CXTA 1S6QA 2VU5A 1N33F 3GR1A 3DM2A 3Q86A 1NCLA 4ZP8A 1SBRA 2LCWA 3FEXB 2FVCA 2DTJA 4YHHJ 2CDRB 3MEDA 2JRSA 4ID5A 5DS7A 2QN6B 4I2QB 5KG6A 5E3PA 3M30A 3KHHA 3JTPA 2BX6A 3NBPA 2MQQA 4H4OB 3AD8C 2CPFA 3KHRA 2HVHA 4I64A 2E7WA 2YQ0A 3BB5A 4HHJA 4B9VA 3TAMB 3UN2A 2GJIA 1URRA 2H4YB 3MM7A 3L4BC 3OXFA 1HFEL 3HF5A 3KMQA 5J1NA 2RU3A 1XTZA 3DLKA 3LP1B 4USIA 2VKZG 3MCNA 4NLTA 4YN3B 2UUCJ 1VIOA 1IQTA 4U9RA 4J7CA 2HHHF 3O5TB 3I0RB 1VK8A 2WRMA 3BGRA 5KFJA 3QYYA 5F8GA 3MR7A 3QZ7A 1FXLA 1SB6A 2Z0GA 3K8WA 1IBCB 3AD7C 5H9FJ 4IH5A 4RBTA 4NI2B 2BJ1A 1GMWA 1JLQA 2YKQA 5GAGI 3HFVA 2VBZA 3UDEA 2BANB 1H7WA 2HHXA 1XERA 2BQRA 1CG2A 2PI4A 5DQGA 1RTDB 2HIYA 4IDKA 3I6PA 4P74A 2OMLA 1UJ4A 2CYYA 1S9GA 1R0AA 1TL7A 4URSA 1TKZA 4LR8A 3QATA 3GU0A 1N52B 2Y8YA 3TZYA 1DQAA 5H9FK 5J2PB 3ITHA 1QAYA 1YZ7A 1R3NA 2YKMA 4UTGA 1WC4A 1RP5A 2YPZA 1B64A 4KHPF 3HZGA 2W9CB 4F0HA 3BSNA 3M8RA 2NUHA 4X4RA 5K8OA 2DVIA 1FA0A 4J37A 2M7SA 1X4FA 4ECSA 2AF6A 3TZZA 6FD1A 4O4GB 3AB4B 3RW7A 2UUBJ 3J7YU 4CH7A 3PX4A 1M1HA 3MMJA 3MD3A 1HMVB 2VPZB 3BN7A 4O3RA 3CJ8A 1VHFA 4MMOA 1NBEB 3NCQA 4J5OA 1R8CA 1QAXA 3W2WB 4LF9F 4TYAA 1C0TB 2HMIB 4MH8A 4U67Q 4QU6A 4JV5J 1OO0B 2PD1A 4OYMA 2ZJPQ 4A48A 4LRBA 2BZ2A 1AUSL 2BA9A 4ZIWA 1JIHA 3IAS9 2FVRA 4DR7J 4LBHA 4B9NA 1G1XA 4DR4F 1MSWD 3SV3A 4IH7A 3WZ0A 3LWMA 3SXLA 3I9ZA 4EEYA 2BE2B 4HI1A 2XC9A 1HHSA 2RS2A 2YTCA 2IC3A 3D6TB 2ZNYA 3NGKA 3DXSX 3CMQA 1EJ7L 3U1MA 2V5HG 1Q53A 4LF8F 1S1TA 3TUPA 2FY1A 1FJ7A 1RTJA 2ZD1B 4ELUA 3BDEA 2DY9A 3DRXA 3HULA 3B54A 1YWXA 3ENWA 4ED6A 1S4EA 3DGPA 5D4PA 2PN6A 1RBOB 4DR1J 4DN9A 4NCBA 1W7WA 2HLTA 4OHXA 1KQSR 2LEPA 1M0SA 2ZH1A 3UVJB 4G6VB 1C2PA 4JI6F 2OPPB 2MZQA 4IG0A 3N6LA 1RWPB 2OAUA 4DR2J 1GT8A 2IJRA 3OTDA 5L1JA 4LF6J 3NOGA 5B0EA 3HDSA 1IWGA 4LFBF 4L72B 1V9OA 4OI6A 3VGUA 3C15A 4QQBA 1KEKA 1TKDA 1LWFB 4QW9A 2EVZA 5C7PA 1T05A 3IR5B 1RAEB 1OSCA 4B3SJ 3NWGA 1ZZFA 1XR5A 3DOLB 1FI4A 3MPWA 3I56S 1IKXA 2C3YA 3RYLA 5DJBA 3EZ5A 4KE5A 1RCXB 3TEHB 3O1LA 2GA7A 3TUJC 1RWMB 1HPZA 2M9KA 1WNEA 4Y6IA 2MQPA 2ZE2B 3OTOJ 1BWVA 3GV8B 1N4LA 1AZSA 4ZK7M 1EHWA 2W2NP 1NKEA 1GNKA 4RW6A 1X8DA 4RU2A 4RW9A 5E5NA 1J5EF 1GXTA 1X4EA 2M4MA 2MGZB 3RR7A 1Z2LA 2ABYA 2XO7A 3QT5A 3BO3A 2GIQA 3E01A 3CJQA 4ZPAA 3EVWA 1TQLA 1M5SA 1NZAA 2RQ4A 4K8RA 3BZQA 4XTTA 3V4IA 4DQPA 2XZDB 2DR7A 4I2PB 2BABA 4AQYJ 5H9EK 2KG0A 4M5NA 3IO1A 4DV6F 1LFPA 3G4SS 1I94F 3CCSS 1K47A 5G0RB 3OHBA 2DR8A 2J7KA 3DOMB 1EB0A 4K4XA 1PGZA 3NL0A 5JVHQ 3LAMA 3SZ2A 4NX9A 4X84A 4J9KA 2LDIA 2UUWA 4LF1A 2VKRA 3I55S 2ZUAA 4Q8EA 2DEJA 1S12A 2I5JB 1I6JA 4KYZA 1RA6A 2J9EA 3TUZC 3P45B 1KD1T 3T1YF 1U1MA 1YRUA 2WONB 3KG4A 4FS1A 4F3OA 4LT6A 4U8YA 2C2EA 1CJKB 5JJBA 3K0JA 4NRUA 1UVLA 1TKXB 3N6NA 1S9EA 4DQSA 3S1TA 2CJBA 1ICEB 4ICLA 1Y7PA 3VVTA 1URNA 3LALA 4F4WA 5HROB 1NRKA 2AD9A 1QSYA 1LW0A 5A0YA 1AROP 4QIGA 1OPIA 1SXLA 4DV2F 3V6KA 3PYGA 3ZZTA 2JLEA 4LSZB 4TYBA 3JTNA 5IXUA 1B70B 5FD1A 3BSOA 2XNRA 1U24A 4KFBA 5M2PA 1BHNA 3TUIC 1TL1A 1IKVA 1V3SA 3GIIA 3M1VB 1S79A 3H2VE 5HI7A 1Q8IA 1R27B 4TQRA 3IG1A 4HR2A 3FQLA 3SFUA 1P27B 4USUA 2AJ4A 5CYMA 4OX8A 1YBTA 1YJWS 3QBCA 4CO1A 2H4WB 4USVA 3R2CJ 2BQ3A 2OUGA 3W2VA 1SKRA 3OTCA 2QG9B 2W8LA 4M63A 3EDRB 1NHVA 5F8IA 1S1WA 3L7OA 3ICLA 3ZTQA 1QDUB 2CG4A 1SC3B 3QO9B 3IRWP 1HW8A 4MT1A 4JYAF 5HAOA 1CVJA 2HYIB 2V8GA 2GFFA 1Q95G 2RRAA 3DLHA 5ETMA 2YY3A 2OEKA 4KB7A 4WWSA 5DG9A 4MKVA 3SQGB 2EFVA 3HJFA 2JEGA 3IM8A 4C11B 1T03A 3GJQB 4ZIVA 1H73A 2D69A 2QA4G 2MSTA 3DYAA 2DISA 2W2QP 2KH9A 3V4MA 4JV0A 4TKTA 1KSPA 3HHKA 4PAAA 3T3FA 4NZ7A 2B9XA 3VVUA 1DZ5A 2U2FA 1U02A 4HVZA 2BQUA 2YNFA 4IOBA 5HP1A 1S72S 1XMQJ 1BQNA 1NK5A 4DX8H 1WORA 4DN0A 1NPKA 2DNPA 1FJGF 2E1AA 2IVMA 4IR1A 3VHQA 1R8PA 4USWA 4ZVTB 1CS4B 3RR8A 2C2DA 4PWDA 2KU7A 2QX0A 4FNIA 3KDOA 5F0WA 3W3SA 4JV2A 4PCQA 1RTIA 2EFPA 2XYHB 4YDXA 3AHPA 3DLEB 2FC9A 1GTHA 2J6TA 4KHMA 2RSQA 4WYWA 1DJ0A 1DFDA 2OPSA 3C16B 2IA6A 3BPSP 2OI2A 3EICA 1A9NB 2BOPA 4ZPDA 2BRKA 3A3PB 3KJNB 3GJRB 3IRXB 2W4DA 4NLYA 1RAJA 3CDWA 2YH1A 1TVRB 3P4UB 3QGPA 4D3HA 2FZCB 4B3RJ 4B3OA 2LVWA 3NNHA 1VOMA 4RUAA 2XWYA 2OIHA 3O3LA 2RUGA 2IYGA 3TX0A 4WFBQ 2ZZTA 1XBWA 1RHJB 1HHTP 2F65A 2L9WA 3DXBA 5IOLA 3MXHP 5GAEI 4FYWB 2XMAA 4RU9A 3RB4A 2J76E 2LMIA 4TU8A 2VG6A 3FC9A 2EK6A 1S6OA 2VC1A 4XDCA 4PPDA 2I6WA 2O66A 2IJNA 5F41A 2VB6A 3M2UA 3MCSA 4LF4J 4ZVSB 2IMWP 1WC5A 3Q8SB 4HACA 3QIPA 4QIFA 4DQIA 1HQUB 2F8HA 4ZJQA 3BGLA 3PKMA 4X66J 3OSNA 1MROA 1CJVB 5DQHA 3P5TL 3J81Y 1U45A 2BOAA 4FXVA 1PBUA 3PFEA 2GAGC 4YB7A 2UXBF 2IFXA 4M5GA 5KT5A 5KFLA 3UW1A 1MG7A 3GFXA 2J0SD 4CT8A 1NDPA 5AJ3F 1NKBA 2GAHC 1S7HA 4NXNJ 4I2QA 2D3OR 4WK1A 3FVYA 1RE1B 3QWUA 5GADI 3QPIA 2X51A 3OTBA 1Q5YA 3CDAA 2RVJA 4H4OA 3I87A 2R2RA 5ETSA 1S59A 3G6VA 2MKYA 1NJIT 3WIUA 4JI4J 3CIMA 1C4CA 5ETQA 2APOA 1RBAA 2CNNB 3TAMA 1WDDA 5CH7B 1RA7A 4W98A 3PRBA 2P6SA 3TQEA 3AQPA 2W9BB 1IBLF 1HWLA 2ATLA 2ZM6J 3ILLA 2EC2A 3TOQA 3U7JA 3AOAA 3UDVA 3VAIA 3I0RA 2HFOA 5HATA 1TK8A 2RILA 4DQQA 2M88A 4PXCA 5L1KA 3QRPA 2OPQA 4YR0A 4OX7A 5AE2A 4A8XA 3T1HJ 1TFYA 2CFXA 4NI2A 4ZKAA 2X3GA 5KG4A 4C97A 2ZH2A 4CO2A 4Q0BB 2DR5A 2BANA 4IRDA 3KFWX 1S57A 4DPWA 4P7VA 4JI1J 1RTDA 1J2VA 4OMFG 1Q7LB 1ZM3A 4DV1J 5B09A 2R7QA 4QR0A 1U1NA 1F5AA 1C4AA 2A6OA 3KLHB 4UQGA 1FX4A 2QZ8A 2KVQE 5J2PA 2F7VA 2JC1A 5HMYA 3TX8A 1X4BA 5RUBA 3FK4A 1T9UA 1BMQB 1SL2A 1PC5A 1RCOB 3DOKB 4DCPB 1IWAA 3MPDA 2MZTA 2W9CA 3BF4A 2YQ3A 2R7WA 2WVFA 1X5OA 1RXOB 4HKQA 2BDPA 2Q66A 1JB0C 3T5KA 4RUHA 2I0XA 4O4GA 3EWGA 2IVFB 1KVKA 2KFNA 2VPXB 3CJKB 3QJLA 3D9BA 4EGLA 2PC6A 3FNNA 1GEHA 3S8SA 2O3DA 3S7RA 1FHTA 2ZFHA 2AV5A 3W62A 1HMVA 4FVCA 3EZUA 5THWA 4OYZA 4K2JA 3Q8YA 4ECZA 3C8YA 3W2WA 2V9WA 4X4QA 4WPAA 4P72A 1C0TA 3DRPB 4P10A 2HMIA 3MPVA 1FNMA 1N6QB 2XI3A 4RW7B 4GVBB 1V5IB 5KFGA 3CVKA 4PZVA 1JLEB 3CMAS 2J0XA 4DF8A 4EFAC 4IOCQ 1FDBA 3EDQB 4UOHA 2G0JA 2C2ZB 1FESA 4ECQA 3QZ8A 2R2TA 3Q8RB 2HBYB 4BCAA 2V4QA 1S6PB 1FRLA 9RUBA 5DQIA 3HSJA 2B4PA 1WTFA 5I3UB 3ZZRA 4ETZA 4LRAA 4ED1A 1HNWF 5KFIA 1T94A 4N8NA 5ETPA 4ELTA 2GS8A 3P8BB 2CJ9A 3CCES 2BE2A 3HKZD 3DI6B 4ZLNA 2XYGB 3A8JA 2BRLA 2E29A 3MGJA 4WZQA 5C42B 3UN5A 1SJ1A 2FLOA 3KUEA 1ULRA 3BN4A 4JI5F 2FLNA 4AL7A 2ZD1A 2R7RA 4EBCA 1N33J 5F8LA 5EWGA 1QAJA 5LMUF 3KK2B 3D5MA 1RYSA 1M1GA 3OVBA 3PJXA 3R7NB 2UVVA 3IR6B 4I7FB 1F3FA 4PG4A 4LBIA 2UXCF 3UVJA 5K8PA 2M2BA 2OPPA 1L3TA 3CW2C 3MWBA 3N9UC 3WIVA 2MQLA 2DNRA 1PBAA 4K50A 3IBCB 1QAIA 4KPYA 3T6BA 1JKHB 1F9HA 1M1KT 4LSLB 5HJYA 1LWFA 4LVNP 4MK9A 4R8UB 1R31A 3LQVA 4RW4B 4OI4A 3HT3A 2GCFA 2A3JA 3R5DA 2DT9A 2C2MB 3MM5B 3WX4A 4IRKA 2EI5A 2SXLA 2HHHJ 1RAOA 2IRXA 2JVRA 2DR9A 1I5OB 2XMKA 4F4XA 2BBEA 2GGPB 3MM9B 4G1QB 3NKYA 2J9DE 1KBRA 3PJWA 2DPJA 2ZE2A 2ZH5A 3TARA 4GKKF 3H5XA 2AYEA 2RQKA 1UJ5A 4TQSA 3JQJA 4NASA 1NB2A 4DPTA 3CCQS 1Q8LA 4RZRA 2B6AB 3PV8A 4TN2A 1N48A 2A2DA 3TJ8A 4B9MA 4DV7F 2J5AA 2DXEA 4TLQA 3V2UC 1VBYA 1ITPA 5EX3A 3W7BA 2MGZA 2B7BB 4FZVA 4HEA9 1O0PA 3RGIA 4DR5F 1IQZA 3GG0A 4RBVA 1X0FA 1K0VA 3OPKA 4NMLA 4I2PA 2DRAA 3CEDA 2QLXA 2MB0B 5DLFA 4L73A 3FDSA 3OD2A 4QYZJ 3MR6A 1Q86T 4NXMF 5G0RA 2BACA 6FDRA 3DOMA 1RKJA 3CDEA 3GV7B 2WAQD 4KHPJ 2ZBQA 2E5IA 2UZAA 2IYIA 4OFZA 1XNRF 2GQQA 3D0HE 3CDBA 1NHUA 2I5JA 3TAPA 2YBVA 4U7UD 2WONA 2DY1A 3SCIE 5CYJA 3J81U 4QYZK 3MZIA 3MMBB 3HHLB 3Q89A 1RLDA 1CJKA 3Q23A 1G6BA 3QIDA 4FBTA 3MAAB 1GAOA 2FVPA 3EX7B 2FHMA 4LF9J 2IDLA 3MOZA 3I5CA 1LKZA 2KVIA 2GVZB 2C2RA 5HROA 4CNYA 2OH2A 2Y1IA 1FFGB 4U95A 2F4FA 4FXDA 4K0KJ 4ITSA 1FD8A 3MAHA 4GC6A 2JLGA 1WG5A 1VQPS 4PUOB 3A13A 2J8SA 4O3OA 3CGIA 1VC5A 3S6EA 3ILJA 2MZ1A 3RAMA 3F56A 1YJ9S 3DRSB 3CUNA 1FKPB 4LF2A 3RBXA 3MMAB 4DS4A 4WE1B 5LOQA 3M1VA 1DQ8A 2VOOA 1TK0A 2NXCA 2XSFA 2J9DA 3CJRA 2HBRB 2KFYA 1WC1A 1U1LA 1OY8A 1M5VC 4ZVPB 3PYFA 1FTRA 4MK8A 3EGVA 4QR2A 4O3NA 1JLFB 2CWXA 1VRUB 3NY0A 4CO3A 4RUCA 2AT1B 3I4PA 4DU8A 2HQ3A 1SH2A 1R6VA 2VQEF 4DL6A 1Y5NB 3CD5A 3EMTA 3QO9A 5CZXA 3ELHA 2XMJA 3PIPQ 2UXDF 2KZZA 4WK3A 3MEEB 1S1XB 3DC2A 2XM3A 3D6MB 3RG6A 5B0BA 2HHWA 1GMWD 2ZEJA 3SQGA 1RK8A 3NNCA 4CZCA 4KY3A 1UPPA 3DU5A 4C11A 3LP2B 4KGZB 1HWIA 1R43A 2ALYB 3ZZPA 1LWEB 1RJJA 4OZ0A 3K5OA 2VFRA 1IM4A 2K1RA 1WEZA 3TANA 5IV3A 3UD5A 3VR1A 3EM1A 3LGMA 3PW4A 5KG5A 4RNOA 2RRNA 3FZBA 1RT6B 2ERRA 1D8YA 1F5CA 3M2VB 1U1PA 4PABA 2YKOA 4M5IA 3GFYA 3TA1A 5M2UA 3K7RA 4Q8FA 1PAUB 2LEBA 1X31C 3G9CA 3CD7A 5E0OA 1UFWA 1UVJA 2XB2D 4IKAA 3QLHB 3HM9A 3G71S 2MSSA 1VJWA 3QT8A 1CS4A 2GIRA 4BC9A 1NEEA 1J5EJ 2RS8A 1UCNA 2IDEA 4WKRA 3CCWA 2YX1A 4NYPA 4C3MA 2P8IA 3WDOA 4ZP7A 5I3QA 1S0MA 3T5HA 2FHOB 3DLEA 1H2TZ 2IM3A 6AT1B 1UVKA 1AW0A 4DV6J 3QMQA 4G1PA 1WKLA 1K0TA 1TU0B 3D6HB 1N34F 3C16A 4MFBB 2C3MA 4LSNB 5D3GA 5IZHA 1MN7A 5GAGU 2VBYA 4RUBA 3IRXA 4CLUA 3BGOP 4JI8F 1KONA 4LIRA 3MM7B 1R8BA 5HK4A 1U6BA 4MTPA 2KT2A 5LJ3Y 1JJ4A 4E0DA 1TP7A 4LFCF 4DSJA 4N77A 4Y34A 5DM7Q 4WZMA 5AE1A 2V8DA 2QRRA 4YFUA 3QWPA 3BS9A 8ATCB 3T1YJ 3BSCA 2E1RA 2DNNA 3Q8UA 1F2HA 1WG1A 1UL3A 3KK1B 5E3QA 2JEFA 3RTVA 3PNIA 3NOCA 5DDPC 1UFKA 1WKJA 3M05A 2FQQB 5LXYA 3OR2B 3DNCA 3DGVA 4EBDA 1FKOB 1RHUB 1TTHB 3D7SB 1XK8A 2W24A 1D8ZA 1UW4A 3RAXA 4DV2J 4HDGA 3TI0A 2V69A 4OZLA 1F60B 2KL8A 1HQUA 4WYLA 3MOJB 2VA3A 1CJVA 4X4NA 3OLBA 4FF3A 2JH3A 5DETA 4QWDA 3CCMS 4DR3F 1WF0A 3KJVB 2OFGX 3OL9A 2MLYA 2UVWA 1UZHA 1WEXA 2GHWA 1RT5B 1CQNA 2HK3A 4CRJA 4WCEQ 5CZVA 2PDAA 1W2IA 2CQPA 4I67A 3PR4A 2D3ZA 2QC3A 1DTTB 4MKAA 2R7XA 3AQOA 4YY3F 5KFZA 3I9V9 3MMCA 4ENOA 4WFNQ 4A47A 1JLAB 2W7OA 4NA2A 4K4SA 2FY8A 4WP9A 2N4CA 1XMOJ 1DLOB 2W9BA 4TLRA 1XNQJ 4X62J 3PVXA 1NPPA 3ISZA 1FNXH 1FJCA 2R7OA 4WIQA 4Q5VA 4DFKA 5F9NA 5EUHA 3W64A 3WBZA 3UNYA 3C46A 2HS4A 4J9UE 1U2CA 1XWLA 1UVNA 4MK7A 4C8KA 3R97A 4K4YA 4AD6A 4Q43A 2MY7A 4DSLA 1VRQC 3FEZA 2P2CB 1RBLA 4HH0A 4O44B 1JK9B 4N47A 4M5MA 5HO4A 2LFVA 3ZO7A 4ED3A 4Q0BA 1KNZA 2XQCA 3MURP 2F4VJ 1SL0A 4CLZA 4IRCA 1UTAA 5HBMB 2D41A 4K4WA 1VQ7S 4OV1A 3CDUA 1L3UA 4Q45A 5HANA 1UPMB 5BYSA 2HFNA 3C2PA 3KLHA 1VMBA 2HGMA 1S1TB 4H54A 4X4TA 1XEZA 2VJUA 5KFTA 1P8GA 4QIEA 3TO8A 4F36A 1NAQA 2LXIA 3DOKA 3VCDA 3GG1A 2DK2A 4IFVB 2R4FA 1FXDA 4UF4A 3H20A 3PHTA 1EX8A 2OD4A 2RMLA 2PSZA 1KRPA 4DL5A 2E5LF 1PYSB 3ZTRA 4ZN3A 4F2SA 9ATCB 3E3XA 3CJKA 2HEKA 3B4DA 1YRXA 4DCOB 4K4ZA 2UVRA 1NK9A 5LXRA 4HDHA 1VBZA 2ZBRA 2NLWA 5DG8A 4CLLA 3AJ2A 1IBMF 2CWKA 5K5MA 1HYSB 4ES1A 2QSWA 4HH1A 5KFMA 1GH8A 2D3O1 1T9WA 3DRPA 3D1HA 1N6QA 2EG1A 4RW7A 4EZ6A 3AJDA 4GVBA 2W7AA 4F26A 1T3OA 3IGVA 4ZJOA 4ECUA 2GNKA 2HS3A 5DM6Q 4LIWA 3TWZA 2LA4A 2Z58B 4PWWA 2LECA 1ACMB 4O3PA 2LU1A 3Q8PB 1YI2S 2GHPA 1S6PA 1ZAVA 2Q79A 3W65A 5BR8F 2E5GA 2ZHBA 2XBPA 3BREA 3OJSA 3L7UA 3BQ0A 2L3MA 3K5NA 3J81j 2R7UA 1IKYB 3PTWA 3KJFB 2NXNA 5E33A 3DI6A 3VAJA 2G13A 2V2VA 4CO4A 2HFUA 1RDRA 2IM1A 5C42A 2M5YA 4F25A 4C9DA 5C5JA 1NJXA 1I3OB 2MDAA 3B82A 1R8AA 1RHMB 2IVYA 1RU2A 3R27A 3H2UB 2M3DA 4C8MA 1ZPWX 1FRJA 4X65J 4ER8A 3D2WA 1FRMA 4C8NA 2HGLA 7FD1A 2DD8S 2OGUA 1FRHA 3EE3A 5LSLA 5KFWA 1Q8KA 4CIOA 4I7FA 1RKIA 4HYKA 2ADBA 4FF2A 2GC8A 4DOZA 1OYDA 1KOOA 5JVGQ 1SKWA 3POTB 2DHXA 5C2CA 4DWIA 2E1PA 3GSIA 2CNOB 1JKHA 4C8OA 1VQOS 1KKHA 2IM2A 4DX6A 2LKZA 5KFXA 2AYMA 3NS5A 4LSLA 1W2BR 2PE8A 4R8UA 4RW4A 3W9IA 5D4OA 3IWNC 2OKQA 1U2RA 1IBKF 3V5RA 1YJTA 2ZOGA 2J6SA 3MM5A 1F9EB 1KHVA 1CJUB 1IVZA 4FF1A 5KG0A 3A12A 2E44A 4KT0C 2KJWA 4RNHA 4AT1B 2GGPA 2LYVA 1B3TA 3MM9A 2W2MP 3E8OA 3JS9A 4NZ6A 3T9NA 4CWBA 3RRGA 1CULB 1SH3A 1BGXT 5B0DA 1KR4A 3JSMB 5FLXY 3FKBA 3D3BJ 2OLWA 3C66A 3PW2A 5ETOA 2XI2A 2OSRA 2UVUA 4ZOSA 2B6AA 4FPIA 2KXNB 3DLLQ 4WFAQ 4DFMA 4ZVUB 4ED8A 2VASA 3OHAA 3KUGA 3UDCA 2OO4A 5MAOA 4KTQA 1LXJA 2HLUA 3RZAA 4ZVEA 5A6WA 3THVA 2IAJB 2DNOA 3BR8A 4MIWA 3UPFA 2Q6BA 1HQ2A 2XSJB 1TUWA 3C19A 1IUJA 2AMCB 2Z8QA 5IV4A 3BQ2A 2HNDB 2RU9A 4N7TA 4DV5J 3MM6B 5EN1A 4J9QA 1BE4A 4DUZF 2HRUA 4PEOA 4DL7A 5E3CA 2GZOA 2DJWA 4J9PA 2AGOA 3K89A 1T7PA 2ZDOA 5DGBA 2HHVA 2F3JA 3CULA 5A8WA 1LQ9A 2KRRA 4OHVA 3IBFB 2ASDA 1CQMA 4BLGA 1DTQB 1S1UB 1YJRA 2Y3YA 4DV0F 4C8ZA 1S76D 3J7ZT 2H5JB 2Y1RI 1L3SA 3FFIB 1Z1ZA 2C3OA 2WSCC 4I68A 2GVDB 2WK4A 3MMBA 3HHLA 2DCUB 1N5VA 2MZRA 4FBUA 2ACMA 2EPIA 4PG8A 4USTA 3MAAA 2BUNA 4F02A 2IRUA 5D0GA 2WHOA 3BQ1A 1FVSA 2AX0A 2WTFA 2GVZA 2VG5A 2OFHX 1FE0A 2IMOA 4ZJLA 3HKWA 4GC7A 2D3UA 4Z7YA 1NK7A 3MFIA 1EARA 3M32B 4M5DB 1ZS6A 3RBEA 5ETRA 2F40A 4PUOA 4F7VA 5AXMA 4RNFA 3W5YA 3HFKA 3MCOA 4FP9A 1EETB 2IJFA 4BHQA 4WXWA 1Y3JA 3CNQP 3DRSA 4I0WA 1FKPA 1Q5VA 1UAWA 1HBNB 2GMLA 3MMAA 1WHVA 2LA6A 4PWDB 4WE1A 1XR6A 2Y0SD 4A8SA 2OPRB 3RBDA 4HTJA 2ZVSA 3BEGB 1FK9B 2CQ3A 3M9NB 5DO2A 2N4DA 2NUUG 3H0PA 2KHDA 5EHHA 2KXFA 1GMUA 5GMDA 5GAEU 4JI5J 2Q3PA 1QE1B 1JLFA 2V50A 3GQCA 4FVMA 1VRUA 3EVOA 2E9ZA 1XN9A 2HZCA 3GJSB 3P3DA 3TEGA 2XS5A 4WFYA 2RJZA 3VAGA 5CHCB 3OFGA 4ECXA 1UW9A 2Z56B 5B0CA 3VAHA 4ED2A 2PI5A 4KAIA 3X3UA 4B3OB 4C0HA 1RWXB 4DL0C 3MEEA 2B8QA 3ZZZA 1S1XA 1ZOTA 4WIIA 2KRBA 4OYBA 4UT4A 1N5QA 2H5IB 2MKCA 1OIAA 1I1GA 3A8KA 2CVIA 1V5VA 3KHLA 2Z2YB 4QW8A 4XIUA 4B02A 4B08A 3HSZA 4DUTA 4DV4J 1Y3KA 1Q4RA 1VIXA 1LWEA 3QAEA 3RBZA 1VI7A 3KXDA 2H1YA 5GADU 4Q7AA 3M9OB 5KT4A 1S0NA 1NJZA 5M2RA 4A8YA 5KFRA 4C7QA 2V8VA 3NAHA 3OSPA 2FJAB 3Q24A 3KHGA 2QLFB 3KNGA 4NLDA 2BKPA 1RT6A 3PW5A 1CPZA 2FPHX 1HD1A 3M2VA 3HD2A 2RH3A 4GKKJ 1N36J 2RAQA 2H9ZA 4CM0A 5K20B 2UUBF 2WVEA 5SUHA 1OYEA 2J7UA 3QLHA 1L3KA 2FIUA 5HLFB 1FRIA 3EPGA 4ECYA 4DDFA 2FYXA 1TR0A 1GXUA 3GV5B 3RB3A 2FHJA 2FHKA 4WJBA 3IP0A 2ALZA 4NRTA 1RWVB 1JXLA 4JV5F 1FKAF 4JI0J 2DGSA 4RWWA 5E41A 2P9GA 4OL8A 4AL6A 3LA0A 1U8SA 2PO4A 4MFBA 2C2KB 2DGQA 2CNKB 4DR7F 4NXMJ 4LSNA 1YK9A 1NXIA 2QV6A 2KTQA 3SEOA 3J80Y 5KFVA 4EWTA 3UR0A 1WD6A 2DNYA 1MWZA 1SKUB 1K9MT 5LL6d 5KTQA 2QYGA 3MEGB 4F4KA 2E1CA 3WHIA 2V6AA 1UEVA 1YBUA 4OZ1A 2LLZA 4CDIA 2XCAA 3A8EA 2OPQB 3A8IA 1HNXJ 4RPFA 3KK1A 2OP5A 3R7SB 2YNGB 1PJ6A 1O8BA 3ZC4A 4B3MJ 2CZVC 3OR2A 5L1IA 3Q22A 2XY7A 3NRBA 1H98A 1YITS 1FKOA 2VBWA 4DR1F 1VQ4S 3TP2A 3I5BA 5C25B 4R0EA 1HHQA 3PDNA 2ZOFA 2U1AA 1X9SA 3FSYA 4ZVOB 1CBKA 2ZKTA 2WVCA 1RB0A 1JNRB 3K5LA 3JB9k 2XYPB 4M5LA 4AL5A 4DR2F 4LF6F 2FVSA 4R25A 1VFJA 3EZOA 4OJGA 3KJVA 4P2XA 4ZVFA 4MJKA 4B3TF 2RKIB 1KC8T 2QGFB 1RT5A 1N5YB 3R7BB 4B3SF 3R1LA 3QFWA 1EZZB 2J0QD 1RT1B 1HL6A 2K8GA 5E2QA 4LMZA 4LFAJ 5DZ6A 1PYOB 4RWXA 4UY8T 4CLPA 1DTTA 1C0UB 3BM7A 3W8PA 2XHWA 2AYGA 5LM7E 5FLXU 2EFQA 2D9PA 2LQBA 4ELVA 3A1YG 4ERDA 1JLAA 2H3EB 3DDNA 2G9OA 2CQHA 4Z37A 5CCMA 4OLOA 1DLOA 1D9AA 4RKUC 5L9XA 5K8MA 4ED0A 1V3ZA 2Z2MA 2NPIA 2HHTA 2MHNA 3SI8A 3OUYB 2UXDJ 2AWZA 4NZ0A 3I0SB 1HI0P 3O8WA 2BE7D 5KT2A 1FDDA 2B8PA 1GX5A 2P9EA 4K4UA 1RWNB 3GIMA 3PKYA 3MR2A 1RZMA 3GFHA 4TU9A 3CSKA 1VQ8S 3NMAA 1X5TA 3GP9A 4AQYF 4KJIA 2DO0A 2WOMB 2ZH7A 4O44A 2MQOA 1CC8A 3QNWB 5AXNA 4P2SA 1RAIB 1VQMS 4C3KA 1FD2A 3MTKA 5IS2A 3FEYB 4F4YA 5CA5A 5KFAA 1S1VB 2O67A 1KFDA 2Z2LA 3CCTA 5HBMA 2DGUA 4ID8A 2PIIA 4O0NA 1TL3B 4FDFA 2E66A 1FRXA 2MZSA 2HZVA 2EKNA 3TZWA 2YH0A 4DZDA 1X4DA 1Q8BA 4YMEA 2CJQA 3NS6A 1NM2A 3V81B 1AFJA 2XGQA 5GAHI 5DRKA 3OW2R 3KK3B 1FWLA 2POKA 1HNVB 1Q81T 2RRBA 4PRFA 1X7VA 2LQ8A 5F8HA 4H4MB 5T7LB 2DIVA 3KLIB 2XMTA 1MMLA 1ELOA 1NDCA 1SQGA 5IC6B 3IXQA 1R0CB 4IFVA 3QQCD 3D67A 2BKNA 4K4TA 3A3NB 4DS5A 2C2OB 3DMJB 3H4BA 1PO6A 4NEYA 3LWLA 3B78A 2JEJA 3NXZA 2ZDPA 1T3NA 2EBEA 2QEXS 2R8JA 3UCUP 5LT5A 4NLPA 4QJVA 2QLWA 2HFVA 4JI8J 3I96A 4ANCA 1HYSA 4EYHB 4CLTA 1PJ7A 3NCPA 3UCGA 2X1AA 1FDAA 2G0IA 1YVFA 2Q1LA 2JFKA 3FGVA 3VF0B 2BW2A 2HHSA 2GX8A 1CEZA 1WHYA 2FLPA 3MM8B 3UO0A 4Y3CA 3CJ2A 5KFDA 2L48A 4D3GA 5H9EJ 4DXLA 2VHGA 3A3OB 3DHXA 3ZTOA 1T9VA 1U25A 1I51B 4ZPVR 3CC2S 3FBCA 3HPOA 2WB1D 1IKYA 5B0GA 1VQ6S 5ETVA 5B08A 2RD5C 4ILMA 3CJ4A 4C6AA 2EW9A 2E5HA 3ZZUA 3I32A 1UMJA 2C1EB 3CJ0A 1TKTB 2J6UA 1JLBB 4DR3J 4Z2XA 1YJUA 4Y0FA 1FE4A 4X64J 7AT1B 3K58A 3OV7A 4OHZA 4F0KA 2J9CA 4DPUA 3VGSA 1NH8A 4Y65A 4OHYA 1HWUA 1WF2A 3R5CA 5KFEA 3M6XA 2AKWB 4LREA 1GTEA 2DH9A 3POTA 1NHKL 2UUTA 4DL4A 2KN4A 2C28A 2HFSA 2R8HA 2DITA 3GR0A 5GVQA 3OT9A 4USJC 1XMQF 2HBQB 2A6MA 2JX2A 5I4MA 1LOUA 3LH2S 3AY0A 5E3AA 2A1BA 4OJ3A 1S99A 2R2UA 4NA1A 3GE9A 1OSDA 4USKA 3SQOP 2YPYA 3SCKE 1Y11A 2JC0A 4UQTA 1UETA 2HS0A 3H5UA 3DLJA 4DCJB 1CJUA 5FJ4A 1E6YB 3NCRA 2WB4A 3RRKA 3KNAA 2VF3A 1T8EA 1KQKA 5HVGA 1FCAA 1WI6A 1U1OA 2KJVA 2XLKA 4DPXA 1O5JA 1CULA 3JSMA 1NJWA 2VOPA 2RB7A 2FJVA 3MI7X 4PYAA 2QJ3A 2B4VA 3HVTA 3SBMA 4WXOA 1A7GE 2DR6A 1BLUA 3J80U 1VGYA 3JYTB 5KT3A 3LOUA 5HVFA 2HVDA 2NQPA 4USHA 2ROEA 2MPUA 2KYZA 2F63A 1TMMA 2C2NA 1TELA 4B3RF 3TNVA 4OIXA 4YR3A 2IAJA 1DRZA 4V1Ak 1KDNA 2XSJA 1QLNA 2MY8A 4OZNA 1NSAA 3G82B 3NMRA 2HNDA 3SYZA 3J7A1 2HWIA 2CPZA 1YRTA 1X0PA 1RLCL 3V6DB 3MM6A 1B0VA 1ZBTA 1PCAA 1T95A 2Q43A 2FJEB 2B4OA 2B43A 3Q8QB 3PIOQ 3MPYA 3TVKA 3T41A 2W01A 2G0CA 1N88A 4PR6A 2PGCA 2VIHA 2CPJA 2XULA 3LO3A 3X1LB 1B7YB 3ETMA 3MF5A 1DTQA 3R2DJ 1S1UA 1BQMB 2UV8A 5KG1A 3MD1A 3W61A 4M95A 4FNHA 4TY8B 3HX9A 3FFIA 4KGKA 4X66F 2GVDA 4A8FA 3WC0A 2ROPA 3B6BA 3FJ2A 4O0IA 3THTA 4E8UA 2KG1A 5IT4A 5LMNF 3M4XA 1Y9OA 1WOSA 4U6PA 2EBGA 4NXNF 1QTMA 3VWSA 3W9JA 2K1RB 3LAKA 4F0MA 2WW4A 3QT7A 2AZ1A 2IA0A 3UNGC 4FYVB 3M32A 4M5DA 4ZS6A 2FUG9 4JI4F 3SSRA 2XS2A 2X3DA 5C2GA 3ZTPA 2JWNA 1EETA 5BR8J 1IXKA 2QMXA 4JI7J 3QRRA 1G2EA 4CCHA 4UOFA 2K7KA 1SQEA 2FJBB 3KTQA 4RO0A 1HBNA 1Z4UA 1RWUA 4ZPBA 3R5GA 3FMWA 2HQDA 4DI6A 3SSQA 4MAKA 2JSXA 4ZITA 2OPRA 2ZM6F 3KWMA 4ED4A 5F3TA 1BXNA 3OR1A 4WP8A 1FK9A 4ZPTR 3QRQA 1NLKL 1UP1A 1SQFA 1MWYA 1RAHB 4YQWA 4BC7A 2GW8A 3GONA 1QE1A 2CPIA 3QGGA 1ZH5A 2EXUA 1VRTB 1HI8A 5DDRC 1WTBA 2COLA 4F3QA 2HNYB 3GIJA 2K06A 4MYTA 2MYFA 3KLVA 2DXDA 3M7VA 1H2VZ 5D3GB 3T1HF 4ZVHA 2UUAJ 5CD4H 1YJVA 4K5RA 4KC5A 2NPFA 2HHPA 1JWWA 3CWJA 3MHYA 4K7QA 1FT8A 1T9XA 1YQHA 3QT6A 1S49A 4LF7F 3RU0A 2MQ8A 1QVGR 2XWXA 3TZXA 1SV5A 3ET6B 4ZDNA 4M8LA 4YS2A 2UV8G 1KHWA 2ZWPA 1R6YA 1M90T 3OXLA 4P73A 4J9OA 1IBKJ 2VFVA 1WEYA 1DAXA 5HSPA 2NXJA 2DHGA 1UJ6A 3M8SA 5HN0A 2HSEB 1XMBA 4ZLPA 1D09B 2XMUA 3H25A 2G2OA 2ZNZA 1VJQA 1ZA1B 1LWXA 3DRYA 2XMWA 1VR6A 3FBFA 3OL8A 3HMJG 1K44A 2LXUA 3NGUA 4AE5A 3LTOA 4QWBA 4DJBA 3QAUA 1MW7A 2G2YA 5HLFA 1SJ3P 1SC6A 3MDFA 5CD4A 3GILA 1Z2ZA 1HBUB 2NR0A 4ZVRB 2Y1JA 3H90A 1X5SA 2CQIA 1FEHA 1Y5LB 4BBYA 2AEJA 1Y5IB 3PZPA 4LQ9A 3AOCA 1TAUA 4X4PA 2CZ4A 2HPUA 4XPEA 2NXEA 1X9MA 3ZTSA 3MMCB 2KM8C 2W2PP 2CQDA 1HBOB 4NLUA 4MKBA 1P9YA 4DUYJ 3MEGA 2R7VA 3K17A 2YWEA 1U47A 4IOAQ 2GMHA 2DNQA 1PILA 3P5BP 1VBKA 4IQXA 1HW9A 4ANDA 2XMMA 1R7IA 2V2ZA 3PXGa 2K2PA 4RR5A 1J5OB 4I1TA 3K59A 5IWAJ 4GKJJ 4CYUB 5D77A 3JSRA 1OQ3A 1XC9A 2L41A 4DR6F 2WSEC 2YNGA 5A76A 4TU7A 2VZ9A 1RT4B 1YKWA 1KOHA 1HNIB 1TUGB 4M5HA 4NMXA 4PG5A 5C25A 1HI1A 3ENAA 1OQ6A 3C6TB 4E98A 3G8TA 3GJTB 5JUMA 3SDEB 4I4BA 4AFFA 4RLEA 2JZ5A 5B0FA 1U1RA 4PXEA 3J7Z5 4ATNA 5A2QY 4DX5A 4HHHA 4YP3A 4GVLA 1NSQA 2Y9HA 4IFYB 3U27A 2RKIA 5DLGA 2BW7A 1U26A 3R5BA 1N5YA 1WACA 5F3ZA 4PXBA 3KLEB 4PYDA 2HRYA 2I1RA 3R5JB 2R7SA 3UR3C 3AA8A 4YB5A 2XG8A 2MZJA 1RT1A 2ILYA 2G4BA 1KTQA 3UFCX 2EG2A 4IG3A 1TFWA 2DNHA 4U96A 5CABA 2HAFA 5B7WA 1C0UA 2W1BA 4LUBA 2H51B 4ZHRB 4FYDA 4PQUB 1NPRA 1N8RT 2HAIA 3G6YA 3FUYA 1X5PA 2RHQB 2PA8D 2V2QA 3PO4A 3UN3A 4UZCA 4H4KA 4L76A 1XR7A 2YNHB 3GYNA 1U2FA 4J90A 1U1QA 2DNKA 1H74A 3RRHA 3Q2TC 3CIZA 2FTRA 3OUYA 3CCJS 1QTNB 4EI2A 2M8DB 2I9SA 3I0SA 3TVYA 3PYEA 3UWTA 1AT1B 4OJHA 2YNIB 2CQCA 3TQ1A 5J1EB 3PR5B 2F8MA 4DL3A 1TAQA 3BKUA 2J8AA 4EZ9A 3C3LA 2WOMA 1VISA 2YWWA 3KLFB 3JXOA 4KO0B 1F9FA 3LPEA 4ZN1A 4OYXA 1RI7A 1Y00A 2BM1A 4ALZA 1S1VA 2JJ4D 4NLGA 3QSIA 3N79A 1RHRB 1H72C 1U09A 3K8VA 1BD6A 4WF9Q 3IGNA 1KLNA 1TL3A 4NLRA 1X4AA 1S6UA 1B0PA 4RJVA 3SMZA 4H4KC 4A8OA 2N82B 2ASYA 3EUNA 5KFCA 1MMDA 1FO1A 5DDOC 3V81A 3MCMA 4ECWA 2QFJA 5CYQB 3KK3A 1Q78A 1UFLA 1HNVA 1ZM4A 3UDLA 2ZZNA 2QYCA 3B4MA 3H5SA 3NNAA 2YWFA 4H4MA 1M5KC 5T7LA 1REGX 3KLIA 2CKWA 2YKPA 5KFYA 5KFUA 2MLXA 3BBCA 2KXHA 4P9SA 1EIYB 4OYWA 3O44A 4WBFA 3FRYA 4C4WA 1WELA 5HQMA 4LF5F 5AT1B 2OEJA 1BY9A 3DMJA 4C0BA 1T9TA 2DB1A 4KHRA 4K0KF 3HHLD 2GHVC 1EQMA 2FB0A 3GZ7A 3V6HA 1YHQS 1VDHA 1B4SA 2HK2A 4GO7X 4CH0S 4M94A 1KFSA 2ZHAA 4MYUA 2DO4A 2CDQA 2W4CA 4ETXA 2LEAA 4IO9Q 2B4UA 3US5A 1REVB 4DV3F 4P7TA 4NLSA 2FGCA 2ZBIA 1PJ5A 4JI3F 1RYRA 1IR2A 3N01A 1V6HA 2J7WA 4P2MA 3MM8A 4TXSA 1X9WA 4HI2A 1TK5A 3D68A 1N56A 1VQNS 4NA3A 4QIWD 5DGAA 4OI0A 2OTJS 3UD3P 3GSDA 3RUBL 1PG5B 3P96A 1FEEA 4X2BA 1QUVA 2G1HA 4URGA 4B9TA 1HR0F 2AHOB 3CMES 2HWHA 3NGRA 4C8LA 4IH6A 2AEMA 4TVAB 3ENQA 4HT5A 1HKAA 2JDJA 3KKFA 3AAWB 1SIZA 1VHIA 3E2EA 3H59A 3HCXA 2W2OP 4CLKA 1SJQA 2AJFE 3FSXA 1TKTA 5DDQC 1DBDA 1JLBA 4NYZA 3M6WA 5EWFA 2FZGB 2YWKA 4ZLJA 3EXYA 4NCGB 4B3TJ 4CM2A 4AXJA 2FD2A 1OY6A 1YSJA 2V68A 3NS7B 4OV6A 3ENVA 3GPAA 1ZETA 1RISA 2GMJA 5A8WB 2YXLA 2O01C 2MQNA 2FJXA 3FZ2A 1NU4A 1Y4ZB 3NLCA 4CT9A 3VAMA 1RUSA 5BYQA 2UU9F 1U8WA 4M5KA 2ZJQQ 3N5BA 1B0TA 2CQ1A 1JMTA 4LQ3A 1VC0A 1UWBB 2IBKA 3BKFA 3MR5A 8AT1B 3SCJE 2ZBPA 4EO8A 4A8QA 4QWCA 2PA3A 3WQPA 3BBFA 3HK2A 2BMBA 2CJAA 1SC1B 1RACB 4CNZA 2VFTA 1X4HA 1E6YA 3M8PB 4OI2A 3CT9A 4JBCA 2VG5B 3OVSA 1F5BA 4G1IA 3H4DA 2ZITA 4J9VA 1ZZNA 2LDYA 3BSAA 1C1BB 2H48B 2AW0A 4UY85 2CQ4A 3F44A 1BUXA 4N41A 4DR4J 1JX4A 2DHHA 2ASLA 2CPHA 2Z4PA 5HMZA 2YX7A 2FHJD 2NZCA 3EGZA 3JYTA 3N28A 2RDIA 1TUVA 4J91A 2QMUB 4JI2F 2R8IA 3P49B 3CJSA 1UZDA 2DGWA 1SC4B 4UUXA 2ZUGA 4M5JA 3DHWC 3NGSA 3FCWA 2ROGA 1PAEX 2DEIA 2GJ2A 2X1GA 3G82A 3H5YA 4LF8J 1DY3A 5KG3A 3V6DA 1ZAWA 2KT3A 2MXYA 2Y8WA 1SPBP 1RAGB 4NLWA 1QVFR 3GYGA 1JNZB 3D1QA 1BQXA 3DCAA 2V4JA 3GIKA 3FBBA 5K8NA 8RUCA 3R6GB 3AD9C 4JI6J 2WVBA 1BQMA 3ISNC 5U47A 1U6ZA 2MEWA 4BDPA 2OJ3A 4YUDA 3H40A 5EX0A 4RW8B 4TY8A 4DFPA 5KFHA 1FRKA 1ROFA 3AH6A 4K2XA 1VQ5S 4LFBJ 3I5AA 5ETLA 3N4WA 4Y28C 5A2QU 2DNGA 5T41A 3JQKA 4P6QA 2VD3A 1C1CB 1P1LA 4WTOB 2QMWA 2HNZB 2OSQA 1Q7YT 2XMVA 5EWEA 2ATCB 2B7CB 3D4JA 4OLPA 1XQIA 4X4VA 2F9DA 2BJ8A 5D0RA 2VBXA 1NK6A 4KPCA 4Y2KA 3KG1A 2V9KA 2JL9A 1LWCB 3DLBA 1YIJS 2Y1LB 4PG6A 1FF2A 3A4TA 5J2NB 3W1YC 4Y00A 2KDOA 3IS9B 1RWWB 2XTJP 2JEIA 2RT3A 4ZVGA 3K57A 2D1CA 2BV3A 3DKDA 1VQYA 2F8EX 1JQGA 1QM9A 1WOOA 1RT3B 3OJUA 1XMOF 5F8MA 2WBMA 1XNQF 4NWBA 4X62F 2IM0A 3RW6A 1O6XA 2FC8A 3IAM9 1HWKA 4BWJA 1CC7A 3P6YC 4FN5A 4ED5A 2A10A 4FS2A 3L3CA 1VRTA 1S0VA 5KFBA 4AXIA 1NZ8A 3VZIA 4KR0B 1I94J 2HNYA 1V3RA 2AJ0A 2M70A 3JSBA 1LK5A 3IWLA 2V8PA 1IKWB 2Y0BB 3MUMP 2H54B 4UOCA 3D28A 2I38A 1TL4A 2F4VF 1FFSB 1IR1A 4OJ1A 1MU2B 1EP4A 5EGYA 1NDLA 1T9YA 2IHR1 4DSKA 2N7YA 2N3LA 1NK4A 3KLGB 3ET6A 2ZH8A 1S0OA 4URQU 1MLAA 3PO5A 3QGIA 3D1OA 2ZZMA 3I4HX 3NAIA 2VFSA 2ZHOA 5CAAA 2E5JA 3HHEA 1LV5A 1PIEA 3R8YA 3QJJA 2QTWA 2EWHA 1M5HA 5IC4B 3HHNB 4FYXB 3J7AN 4L3KA 3K5PA 3PRVA 1QJHA 2AGQA 4DG1B 3ILIA 1ZA2B 4PPZA 4W92B 2NCKL 1YJNS 2JFDA 1NO8A 4A8MP 2DXFA 2VQFF 5KFQA 4WFZA 2CQGA 2DRDA 1HBUA 3OFHA 4QCLA 3MAQA 4C48A 4C3LA 3VGVA 3HSDA 5KOWA 1N0UA 5D6GA 2M0GB 4X4OA 5KFOA 1HD0A 5IM0B 3GFZA 3T9ZA 2CJYB 3FBEA 1MMNA 3D66A 4N8OA 2R3VA 2VL1A 3CB4A 1GXLA 4DU7A 3F41A 2W9AA 2GQCA 1HIYA 2MKKA 3KMSA 2BVZA 2KZMA 1DARA 1N5TA 1HBOA 2LU2A 2UP1A 3AT1B 3LP0B 4J9SA 4DHVA 2AYBA 2B9EA 1QSSA 1SH0A 5AXLA 2ILZA 4X4SA 2ZWOA 3EJMA 1XIQA 2OMOA 2J0WA 1WC3A 1QY7A 4F4ZA 1CLFA 4JYAJ 4QWAA 5A8RB 2XEXA 1L5UA 1JXVA 1J5OA 2L9NA 2AQ4A 4QIVA 4CYUA 2BJ9A 4N56A 2DGXA 5GAHU 4NLVA 3F73A 1RABB 2K3IA 1T11A 3LGHA 5LMNJ 4X65F 1RT4A 2ZJRQ 1GK8A 1HNIA 4NCAA 3IBWA 3Q0AA 1ZTTA 2FGOA 3PACA 2MTLA 4QWEA 3MUVP 2ZC4A 4LR7A 5BJRA 3C6TA 1SI9A 3HJVA 5HJXA 3SDEA 4WTYA 2RF2B 1Q82T 4QBUA 4W90B 2AJ2A 2EKYA 2V4RA 2E9RX 2I8EA 1HWJA 4IFYA 3T6JA 4DPYA 4XK8C 1FJGJ 5SZTA 1VK3A 3KG0A 2CXEA 5KFSA 3THPA 4DZ6A 4NL5A 1FFWB 1YGYA 3KLEA 4GRSA 4WFXA 2C42A 3GCWP 3U1LA 3LP1A 4MIBA 3AXMA 4NLQA 1XJWB 2XZTB 4XDDA 3CTRA 2MKHA 2MKSA 1OY9A 2GQ2A 2KYXA 4ZHRA 1YTYA 1J27A 4LBPA 4PQUA 1U1KA 3I31A 2B0GA 2LP4A 4OX9F 2IPOB 2ZKUA 3K5MA 1ZYQA 4HHUA 2AEFA 2HKEA 4OYOA 2YNHA 4CLYA 5J2MB 2N7CA 4NE9C 2RQCA 2VG7B 2DHSA 4KGXB 2CIMA 4LF7J 1F6TA 3OFFA 1PYTA 2ZVIA 1JLGB 2YNIA 5D78A 4JOUA 3CCRS 1VLYA 5J1EA 4C8YA 4UW2A 2JOQA 3VALA 1AB8A 3C14B 4YB1P 5AXKA 3HHDA 4FYYB 1YG0A
chains in the Genus database with same CATH topology
4DL6A 1Y5NB 3CD5A 2E7WA 3QO9A 5CZXA 3SCKE 4DV5F 1FNOA 2XMJA 2JC0A 3PIPQ 2HVIA 4UQTA 3BB5A 3KLFA 2UXDF 2KZZA 4KO0A 1UETA 2HS0A 4HHJA 4B9VA 3H5UA 4WK3A 3DLJA 3TAMB 3MEEB 2GJIA 1YBAA 1G7CB 1URRA 2PT0A 1E6YB 5FJ4A 3NCRA 2DH8A 1S1XB 2WB4A 3RRKA 3KNAA 3DC2A 3MEKA 1T8EA 1KQKA 2VODA 1FCAA 5B0BA 3VAFA 2HHWA 1CSJA 2HGNA 2RE1A 3MM7A 3OXFA 1WI6A 3LW5C 3SQGA 1HFEL 3HF5A 1U1OA 5KFKA 1RK8A 3KMQA 2ACYA 2KJVA 5L1LA 3NNCA 2XLKA 4HTIA 1O5JA 5J1NA 3M2RB 2RU3A 4KIAA 4CZCA 4NYOA 3DU5A 1XTZA 3DLKA 3LP1B 4C11A 2W8KA 3LP2B 3JSMA 1NJWA 4USIA 2VKZG 1VQKS 2VOPA 1HWIA 1HNZF 4Y2AA 1R43A 3M6UA 4NLTA 3ZZPA 1LWEB 2RB7A 2FJVA 1VIOA 2HHQA 1UKUA 1RJJA 3MI7X 4OZ0A 4LJMA 1IQTA 2B4VA 4U9RA 3HVTA 2OD6A 4WXOA 4CH1A 2HHHF 3O5TB 3I0RB 1VQLS 1FXRA 1VK8A 1A7GE 3K5OA 2WRMA 2VFRA 3QGHA 1IM4A 2K1RA 1BLUA 1WEZA 1QSLA 3BGRA 2R8GA 3UD4P 1VGYA 3CC4S 4G3IA 3JYTB 1UVIA 5KT3A 5CYQA 3LOUA 5KFJA 3QYYA 4L6V3 3TANA 3VR1A 3PW4A 3LGMA 5F8GA 2NQPA 4USHA 2ROEA 3QZ7A 5KG5A 4RNOA 2RRNA 1U6FA 2MPUA 1FXLA 3FZBA 1RT6B 2KYZA 1SB6A 2Z0GA 2ERRA 1D8YA 4CTAB 1H2UX 4K5SA 3K8WA 1F5CA 3M2VB 5H9FJ 4IH5A 4RBTA 4B3RF 1U1PA 2WCXA 3TNVA 3D54A 4RX6A 2YKOA 3SSSA 2CQ2A 4OIXA 4YR3A 3GFYA 2IAJA 3TA1A 1U49A 5M2UA 3K7RA 1DRZA 4Q8FA 2CPDA 4WU3A 1AUDA 2LEBA 1JLQA 2YKQA 5GAGI 2ASJA 1NH7A 3G9CA 2XSJA 2HFZA 4KQZA 2WW8A 3O2IA 3CD7A 2MY8A 4OZNA 1UFWA 5E0OA 3TYTA 1UVJA 1QLNA 2VBZA 3EGNA 4IKAA 2XB2D 3NMRA 3QLHB 1VQSA 2HNDA 3SYZA 2HWIA 2BANB 3HM9A 3J7A1 2CPZA 1H7WA 2MSSA 1YRTA 3G71S 2HHXA 1X0PA 3V6DB 1XERA 3MM6A 1B0VA 2BQRA 1ZBTA 1T95A 1VJWA 2Q43A 1LFWA 1CG2A 2FJEB 2GIRA 4BC9A 1NEEA 2PI4A 2RS8A 5DQGA 2AJQA 1PC4A 2B4OA 2B43A 5ADZA 1RTDB 4WKRA 4IDKA 3CCWA 2YX1A 3I6PA 4NYPA 3Q8QB 1RT2B 2OMLA 2EK1A 4C3MA 1UJ4A 2CYYA 3L09A 3WDOA 3JAMY 3MPYA 4ZP7A 3PIOQ 1S9GA 3G96A 3TVKA 1R0AA 5I3QA 4URSA 3J7YI 1S0MA 4I6WA 2G0CA 1TKZA 3T5HA 4B9LA 1FVQA 1N88A 3ONQA 4PR6A 2FHOB 1N52B 2PGCA 2CPJA 3DLEA 2XULA 1FERA 3LO3A 4XAKA 3X1LB 1REVA 3MF5A 1H2TZ 1DQAA 1DTQA 3PY8A 1S1UA 2IM3A 4XPCA 1BQMB 1HQEB 1UVKA 2UV8A 1AW0A 4U7UK 3QMQA 5J2PB 3ITHA 2A2CA 4G1PA 5KG1A 3MD1A 1QAYA 4V19J 1K0TA 1R3NA 1N34F 2YKMA 4M95A 4FNHA 4TY8B 3HX9A 4NLOA 4MFBB 3FFIA 1N5YA 5FIIA 4KGKA 2C3MA 4LSNB 5D3GA 5IZHA 2HQIA 3CF5Q 1RP5A 5GAGU 2VFUA 2VBYA 3CD6S 4X66F 4ZCIA 3IRXA 4A8FA 4JI8F 1KONA 4K4VA 3WC0A 1B64A 4LIRA 3MM7B 4KHPF 1R8BA 2ROPA 3HZGA 2W9CB 1S10A 3BSNA 3M8RA 1KVJA 1Q1KA 1U6BA 2NUHA 4X4RA 3FJ2A 1M5OC 1HBMB 4MTPA 2KT2A 5K8OA 5LJ3Y 4O0IA 1JJ4A 3THTA 4E8UA 2DVIA 2KG1A 5IT4A 1FA0A 4E0DA 4J37A 2M7SA 1PSDA 4DFJA 1X4FA 4ECSA 5J2QB 1FDNA 2AF6A 5LMNF 1TP7A 4LFCF 3M4XA 6FD1A 4O4GB 4DSJA 1Y9OA 4U6PA 4N77A 2GO9A 3AB4B 3RW7A 4Y34A 5DM7Q 4WZMA 3J7YU 5AE1A 4CH7A 2EBGA 2V8DA 3HVTB 4ILLA 2QRRA 4YFUA 2VC0A 3QWPA 4NXNF 3PX4A 1QTMA 3MMJA 3BS9A 3VWSA 3CE8A 2K1RB 3LAKA 3ZZOA 1SIWB 2W25A 4YR2A 3BSCA 2IA0A 5J1PA 4FF4A 3DRRB 4PKDB 2E1RA 3MD3A 3UNGC 1HMVB 2VPZB 5E3RA 4C0OC 2DNNA 4DEZA 4IQMA 3GMGA 3HVAA 3BN7A 4O3RA 3M32A 1LW2B 4M5DA 4NLXA 1VHFA 4V19X 4MMOA 4ZS6A 2FUG9 1WG1A 3NCQA 4JI4F 1UL3A 3KK1B 5E3QA 5F8NA 4J5OA 2JEFA 3SSRA 3RTVA 1R8CA 5D8HB 2XS2A 3PNIA 5LSOA 2KFZA 1QAXA 4TY9A 3OTEA 3W2WB 4LF9F 1RT7B 4J9MA 3FQKA 4TYAA 1C0TB 4A8KA 5DDPC 2JWNA 2HMIB 4MH8A 1EETA 4U67Q 1G3OA 3M05A 5LXYA 4QU6A 3OR2B 1IXKA 2QMXA 3DNCA 4WU2A 2R7TA 3BGFA 4EBDA 1G2EA 1FKOB 4CCHA 1OO0B 2K7KA 1SQEA 2FJBB 2PD1A 2ADCA 4B9UA 1XK8A 2ZJPQ 4KGMA 3KTQA 4A48A 2BZ2A 2VV5A 4NCGA 2W24A 1HBNA 1Z4UA 1D8ZA 1RWUA 2BA9A 4ZPBA 3FMWA 1UW4A 1JIHA 3RAXA 3SSQA 4BWMA 4HDGA 2JSXA 4MAKA 5A8KB 3IAS9 2FVRA 3TI0A 2OPRA 2ZM6F 4DV4F 4OZLA 1F60B 3KWMA 3DOLA 4I6AA 1HQUA 4ZP9A 5F3TA 4B9NA 1G1XA 1N32F 3OR1A 4DR4F 1MSWD 1FK9A 4WYLA 3MOJB 4IUFA 3SV3A 4ZPTR 2VA3A 4X4NA 3OVAA 2DNLA 1UP1A 3OLBA 1MWYA 4YQWA 4IH7A 4O3QA 4FF3A 3WZ0A 2JH3A 4BC7A 2GW8A 5DETA 4I6YA 3LWMA 3SXLA 4QWDA 3CCMS 4DR3F 3BJYA 1WF0A 3I9ZA 3KJVB 1QE1A 2CPIA 2OFGX 3QGGA 1ZH5A 3OL9A 2ZH3A 1VRTB 2UVWA 1HI8A 5DDRC 1E6VB 4EEYA 1WEXA 1WTBA 2BE2B 2COLA 1RT5B 2GHWA 4F3QA 4HI1A 2XC9A 1HHSA 4OZJA 2HNYB 2YTCA 3GIJA 2IC3A 2RS2A 1CQNA 4MYTA 2MYFA 2CVEA 3KLVA 3PW0A 4TNOA 4DLGA 1H2VZ 4QPXA 5D3GB 3T1HF 1UWBA 1N36F 4ZVHA 1KQGB 4WCEQ 5CD4H 1T02A 1YJVA 2ZNYA 3NGKA 4K5RA 3DXSX 4KC5A 5CZVA 2FVQA 2PDAA 2NPFA 5KFNA 5K14B 2HHPA 1W2IA 2CQPA 2V5HG 1Q53A 3U1MA 3CWJA 5DG7A 2E9TA 1JWWA 3DU6A 3MHYA 1FT8A 4I67A 4LF8F 4DF4A 1S1TA 3PR4A 2D3ZA 2FY1A 2YX4A 1P1TA 1YQHA 1FJ7A 1RTJA 2ZD1B 1S49A 4ELUA 5KFPA 3C6UB 4LF7F 1DTTB 4MKAA 3RU0A 3BDEA 3DRXA 2QT7A 3U1NA 4RNNA 4YHHF 4EU0A 2R7XA 1QVGR 3AQOA 2XWXA 1YWXA 3M8PA 3ENWA 4ZPWR 4ED6A 4YY3F 3DGPA 1SV5A 5D4PA 5KFZA 1JJ2R 2PN6A 3I9V9 3MMCA 3MTJA 4ZDNA 2V8HA 4M8LA 4DN9A 4NCBA 4WFNQ 4A47A 2L08A 1JJHA 1JLAB 2HLTA 2W7OA 4NA2A 4OHXA 4JI0F 4O4RA 2UV8G 1KQSR 4K4SA 2LEPA 1KHWA 1M0SA 2N4CA 3PFOA 1DLOB 2W9BA 1R6YA 3HZEA 2ZH1A 4TLRA 1M90T 4G6VB 1C1BA 1C2PA 4JI6F 2OPPB 3OXLA 4ZPCA 1R8HA 3PVXA 4BS2A 3ISZA 1FNXH 2MZQA 4J9OA 4IG0A 2VFVA 1FJCA 2R7OA 4Q5VA 3N6LA 2OAUA 4DFKA 5F9NA 1GT8A 3OTDA 5EUHA 5L9NA 1WEYA 3EXCX 3WBZA 5A6PA 5L1JA 3C46A 1DAXA 2HS4A 2DHGA 1UJ6A 3M8SA 5B0EA 2ZC3A 3HDSA 4LFBF 2MJNA 4L72B 1V9OA 1XWLA 4OI6A 3T1AA 1UVNA 4DMZA 5HN0A 4ZLPA 1XMBA 4ILRA 3H25A 2XMUA 3OL6A 5B0AA 4QQBA 4MK7A 1KEKA 4C8KA 5HL7Q 1TKDA 1LWFB 2DNMA 4QW9A 2EVZA 2ZNZA 1T05A 3IR5B 4DQRA 1OSCA 3DRYA 1NJYA 2XMWA 4K4YA 3NWGA 1ZZFA 4Q43A 2MY7A 4DSLA 1XR5A 3DOLB 3HMJG 3HHLC 3FEZA 4PQAA 3OL8A 2R8KA 3OR1B 4HH0A 4O44B 1FTCA 2UUCF 1JK9B 3MPWA 2LXUA 4N47A 3I56S 1IKXA 2M8HA 5HO4A 2C3YA 2AGPA 3RYLA 1KLMB 4AE5A 3N0VA 4QWBA 4DJBA 3QAUA 3K2YA 4ED3A 4Q0BA 1KNZA 3MURP 1MW7A 2WSFC 5HLFA 1SL0A 1SJ3P 1SC6A 4IRCA 5DJBA 3MDFA 3EZ5A 4KE5A 2DPIA 3O1LA 3GILA 1GQEA 1Z2ZA 2GA7A 5HBMB 3LF0A 1HBUB 2D41A 3U02A 1HNXF 4K4WA 2NR0A 2Y1JA 2JLFA 3TUJC 4NPOA 1HA1A 1VQ7S 2G1DA 1HPZA 2O1PA 1X5SA 4OV1A 2M9KA 1WNEA 4Y6IA 2MQPA 1K73T 2ZE2B 2AP6A 2CQIA 1TKXA 1HARA 4B3MF 3CDUA 2HG4A 3GV8B 1N4LA 1FEHA 1L3UA 1D1UA 3CXCR 1Y5LB 4Q45A 2B3TB 5BYSA 4BBYA 4AUKA 4ZK7M 3HP6A 1Y5IB 1K1QA 2HFNA 3C2PA 4Y2MA 3KLHA 3PZPA 1NKEA 1GNKA 2DCLA 1VMBA 4LQ9A 4KKOB 1TAUA 2HGMA 1S1TB 4RW6A 1X8DA 2QO3A 4H54A 4RU2A 2YKNB 2BR0A 4RW9A 4X4TA 4X4PA 1XEZA 5E5NA 4ECRA 2VH7A 2CZ4A 5KFTA 3ETOA 1J5EF 1P8GA 4QIEA 3TO8A 2DRBA 1GXTA 1X4EA 4RW8A 4C98A 2HPUA 4XPEA 2M4MA 3ULHA 1NAQA 2MGZB 3RR7A 1Z2LA 2ABYA 2XO7A 4QYRA 3BO3A 1SV5B 3UI3A 1JLCB 2GIQA 2LXIA 3E01A 4ZPAA 5BYRA 1X9MA 1SJRA 1N0VC 3MMCB 1TQLA 4MIAA 1M5SA 3DOKA 1NZAA 2KM8C 1TV6B 3M9MB 2RQ4A 2CQDA 3VCDA 1HBOB 3L95X 3GG1A 2DK2A 3BZQA 4GMKA 1VC6A 4NLUA 4IFVB 4MKBA 3V4IA 1B7FA 2R4FA 4DQPA 2DR7A 1FXDA 3H20A 4I2PB 1RTHB 3MEGA 1C1CA 4DBQA 2BABA 2OD4A 4A46A 2R7VA 2KG0A 2YWEA 1U47A 2RMLA 4IOAQ 3IO1A 2HNZA 2GMHA 2PSZA 3HVWA 4DV6F 1KRPA 4DL5A 1LFPA 3AB2B 2E5LF 2DNQA 1PILA 1GX6A 3G4SS 1I94F 2RNEA 4F2SA 4IQXA 1HW9A 2XMMA 3NG8A 1UA0A 3CCSS 3E3XA 5FDLB 1R7IA 5G0RB 2DHAA 3OHBA 2DR8A 3PXGa 3CJKA 2J7KA 2K2PA 3O6QA 4L3NA 2MKJA 3B4DA 1J5OB 1YRXA 4I1TA 3K59A 2QA4S 4K4XA 4K4ZA 5F9LA 1PGZA 2UVRA 3NL0A 5D77A 5JVHQ 1NK9A 4LFAF 1LWCA 1ZPVA 5LXRA 3OL7A 2B51A 3CJ5A 2F1FA 3LAMA 3VAKA 4HDHA 1VBZA 2DGOA 3SZ2A 5J2NA 2NLWA 5DG8A 3JSRA 4NX9A 3AJ2A 1OQ3A 1IBMF 4X84A 3IS9A 5K5MA 4J9KA 1XC9A 2L41A 1HYSB 4DR6F 4ES1A 2LDIA 2QSWA 4HH1A 5KFMA 2WSEC 1GH8A 2YNGA 2UUWA 2CQBA 3DRPA 2VKRA 4TU7A 3I55S 4Q8EA 2VZ9A 3D1HA 1SUQB 1N6QA 2I5JB 1I6JA 1RT4B 4PXDA 2EG1A 4RW7A 4EZ6A 1RA6A 1KOHA 5H1SV 1HNIB 4CO5A 2J9EA 3TUZC 1BWEA 2W7AA 4PG5A 4F26A 1KD1T 1T3OA 5C25A 3T1YF 3IGVA 1U1MA 1YRUA 2WONB 4ECUA 1HI1A 3KG4A 4FS1A 1D0EA 2B5JB 1OQ6A 3R5AA 2GNKA 2NREA 2HS3A 1RT3A 4F3OA 2B9WA 4LT6A 3C6TB 4E98A 3G8TA 5DM6Q 4LIWA 2LA4A 2XS7A 4J9RA 1TL5A 2C2EA 5JUMA 2LECA 3R1HA 2NXUA 2B9YA 4O3PA 3LGNA </