3LW5C

Improved model of plant photosystem i
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
81
structure length
81
Chain Sequence
MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWGGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title Structure determination and improved model of plant photosystem I
pubmed doi rcsb
molecule tags Photosynthesis
total genus 3
structure length 81
sequence length 81
ec nomenclature ec 1.97.1.12: Photosystem I.
pdb deposition date 2010-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF14697 Fer4_21 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lw5C00
5CHCB 3MMBB 3GYXB 1FD2A 1D3WA 2V2KA 2GMHA 2VPXB 2FJEB 1KQFB 1Q16B 1B0PA 1R27B 1GT8A 1IQZA 1FDAA 1RGVA 2FJAB 1FRIA 1WTFA 2PDAA 1FTCA 1CLFA 7FDRA 1FRHA 3OR2A 3MMAB 2Z8QA 1B0VA 3EXYA 7FD1A 1XERA 2O01C 5BYRA 1G6BA 2WSCC 2VKRA 5CH7B 1BQXA 4Y28C 1PC5A 1C4CA 1F5CA 2Y0SD 3HKZD 2GMJA 3MM9A 1F2GA 1F5BA 1KQGB 2FGOA 2FD2A 1B0TA 1FXRA 1ROFA 2V4JA 3EGWB 2WSFC 1FDDA 4XDCA 2C3UA 1FRXA 3OR2B 1FRKA 1GAOA 1IR0A 3C8YA 3EUNA 1Y5IB 1Y5NB 1H0HB 1H7WA 3IR5B 2PA8D 3MM9B 3MM8A 3OR1A 3MM7A 5BYQA 1FXDA 1FDBA 1A6LA 4XDDA 1JB0C 1FF2A 1H7XA 1Y5LB 2V4JB 2VPYB 2IVFB 1GTEA 3MMCA 4AYBD 4KT0C 4L6V3 1DURA 2C42A 2VPWB 1K0TA 1GTHA 3IR6B 6FD1A 1BWEA 2WSEC 2FDNA 1FRLA 1HFEL 1G3OA 3MM6A 3MM8B 3OR1B 1H98A 2C3YA 4OV1A 3MM7B 1FEHA 3MM5A 5E7OB 1PC4A 4ID8A 2XSJB 3MMCB 2FJBB 2UZAA 1DFDA 2WAQD 2C3MA 1JNZB 2WB1D 4RKUC 5BYSA 4DHVA 2FJDB 2XSJA 1FDNA 3MM6B 5FD1A 2C3OA 2C3PA 1BC6A 3MM5B 1BLUA 2ZVSA 1JNRB 1FCAA 2PMZD 1BD6A 1AXQA 3MMBA 1DAXA 4OMFG 1C4AA 1KEKA 1FRMA 1FERA 4YDDB 1VJWA 1SJ1A 6FDRA 1SIWB 4XK8C 4CI0B 3MMAA 3PNIA 2VPZB 1SIZA 3IR7B 1Y4ZB 3LW5C 1FRJA 5L8RC
chains in the Genus database with same CATH superfamily
4FPRA 2XYGB 1R27B 2JEFA 1O51A 2W9CB 2ZH6A 5DZ7A 1SQFA 2XYPB 3GJTB 3H5SA 3GONA 4DR5J 2J7WA 3MD1A 2G1DA 3RTVA 3GJQB 5MLCV 4NMXA 1UCNA 2CA9A 3MM9B 2KFZA 1OJ4A 2W2PP 4QWDA 4QYZK 2H65B 1VBXA 3G2XA 3PFOA 2FVCA 3OTBA 4X4NA 2MSSA 2BXJA 5A8WA 2CPXA 5EX0A 1R8AA 4DV7J 1UWAA 3TAMB 2HQIA 2HRTA 2YWEA 3OL6A 1WTBA 4DPWA 2YX1A 4ED8A 4WFAQ 3IA0A 1HR0J 4USWA 3FSXA 3M32B 3R2CJ 3PEJA 3KNAA 3G8TA 2ERRA 5M2RA 2HBYB 4LR9A 4F4WA 1YKWA 4M5JA 3QZ8A 3ISNC 1BQMA 1LW2B 5LMUF 1U7LA 3TVKA 3H40A 3H0PA 1SIWB 2VUGA 4ZJOA 5K8MA 1VI7A 3KUEA 3N9UC 3QIPA 3MMBB 4MIAA 4OYZA 3QRPA 2OFGX 1REVA 4ID5B 4IOAQ 4X4QA 4HTJA 2O01C 5BYRA 1FHTA 2F9DA 1WKLA 4YFUA 1X60A 4JI5F 4MMOA 4ZMMA 1N6QA 2BJEA 2E5JA 5RUBA 5EGYA 2VBZA 2OTLS 3C6TA 3VTIA 1TUVA 3C8YA 3J7ZT 2RU3A 2ZD1A 4Y65A 4WXOA 4WZQA 2VPYB 3TOQA 5LOQA 1Q0NA 4MJKA 3M1VA 1DRZA 1MWZA 2ZZMA 3DOLB 1YBAA 4ZCMA 2LKZA 4TU9A 1YSJA 2UV8G 5DDQC 1DFDA 4WYLA 2LYVA 1X5TA 2HS3A 4OX8A 1L3VA 5KG0A 2KM8C 1SKSA 3UN2A 2CQIA 2LFVA 4ED0A 4O0IA 1FERA 2RQMA 2KHDA 5J2NB 1CS4A 4G1QB 3T1HJ 5ETVA 4LF6J 3U02A 4Y0FA 2MKKA 1CC7A 1H73A 2ZH4A 2KVIA 4IQXA 3M6VA 2GCFA 1XMQJ 4UZCA 3AA8A 4CLZA 2CZ9A 4OZ0A 2HMIA 3PYGA 3OPKA 2V9WA 2L3MA 3H25A 4X4PA 3HHLA 3PW2A 4LFBF 3B4MA 4KGKA 3KK3B 4PAAA 4DU7A 4NA1A 3QGGA 3QNWB 3HCXA 1FWPA 3HHLD 3DKDA 4M5LA 5DQIA 4FDFA 5DG8A 1SQEA 2AX1A 4RLEA 3CMES 1QTNB 4B17A 4OLPA 5T7LA 4BS2A 4DQQA 2OPPA 4MKVA 2F65A 4OZLA 1VLYA 2FTRA 1RAJA 4ZIVA 2IY5B 4K4ZA 2DITA 2J0SD 2MZSA 2XHWA 5CCMA 3T9ZA 5CA5A 4IDKB 1CJUA 4AL6A 3T1AA 1VQMS 2RD5C 3D6TB 3H7HB 1SKUB 1MROA 8RUCA 1RTIA 2HHXA 1PYSB 2HWTA 2F3JA 2CQ2A 1H3DA 1T05B 1F5CA 4AFFA 3DRSA 1ZH5A 5J2PB 4ITSA 4TU7A 1UTAA 2DNPA 3PW7A 3QT7A 1NH8A 4B3OA 2VZ9A 2IVFB 3UVJA 4Y2MA 2Q79A 4DV5J 3NEKA 4USUA 4DL7A 4JP8A 1UAWA 2P9CA 2NXJA 3ZNUA 4W98A 4YUDA 4KFBA 1HW8A 2W2QP 2E7XA 3D68A 4ZP9A 4P2MA 5AXNA 1HNZJ 1EP4B 1TKTA 1QD1A 2Q43A 2WCXA 1BGXT 3J7YI 2EFVA 4ZK7M 5K20B 5HANA 4DR4F 1T9YA 2H5JB 2UXCJ 3VAGA 1S1TA 2OIHA 2MGZB 1U26A 3BN4A 1WD6A 3TEHB 3OFEA 2ZZTA 2CJAA 4A8OA 2ZH3A 4AL7A 1ZBTA 4IOCQ 5A0YB 1TZ0A 2DHXA 5AE3A 1T9TA 2PFDA 5HROA 4A4JA 2OPQB 1N5QA 3T5LA 4PR6A 4EBEA 4DPUA 1UFWA 1VQ9S 1M5VC 3I5AA 2Z2YB 2QIFA 1HWIA 1ZM2A 2QLXA 1NHUA 2QL7B 2Z57B 4ECRA 1U1LA 2HBQB 2R7QA 4DQRA 2DNYA 2W9BB 2QSFA 2RB7A 3MM6A 3M8ZA 3DDKA 2A3JA 2FIUA 3DNCA 4RL1A 4JYAJ 2NXNA 1CVJA 4K4WA 3UWTA 2V2QA 1SUQA 4FZVA 3QWPA 3CCZA 3TNVA 1R89A 3ETMA 4OI6A 2V5HG 1APSA 2CPZA 5IT9U 3GV5B 3T19A 1GH8A 4JI3J 4DR2J 1UPPA 1AZSB 3W9JA 1MNEA 1FEEA 1S1WB 2JRSA 2D3UA 3ET6A 2VU5A 2WONB 4TY9A 1MN9A 3QYYA 3KLVA 4F67A 2PDAA 4A47A 1Z2LA 1OO0B 1N34F 2IRUA 2O5DA 2HFUA 3G9CA 2FD2A 3SQGA 1D9FA 2HNDA 1X8DA 2DH8A 1HBUA 2BW2A 1Y5NB 1J2VA 2CUYA 3E8OA 4BCAA 2MQPA 5K8OA 1GQEA 2YX4A 1ZAVA 3N01A 2R7XA 1K0TA 4OYWA 4X62J 3TVZA 4ILMA 1HNVB 1LEOA 1O6XA 2QL9B 1WC0A 4NXNF 1XWLA 2EFPA 4URSA 3DLKB 3X1LB 4IOBA 3KLEB 1SC1B 3F41A 1D0EA 1UVNA 4IR9A 3MM5B 1RISA 1CQMA 4NRTA 3MHYA 1M5OC 5LM7E 2RS8A 1NDLA 3VCDA 3ZTSA 2XZWA 2RDJA 3I0RB 4O3RA 4B3SJ 1SC3B 1U49A 1YDLA 2DPIA 2J6TA 1TK0A 4LBPA 4DV0F 1BMQB 2CWKA 1YJWS 4U7CA 1OY9A 2WTFA 4O44A 1SPBP 2ZNZA 4F26A 2IRXA 4N47A 1Y7PA 5DS7A 4KGVB 4RR5A 4OZ5A 2QG9B 3QGPA 1ZYQA 3N28A 3ZTPA 5F0WA 1NNDA 5E33A 2R7OA 2XCAA 2E44A 2IA0A 1R43A 1UA0A 5H9EK 1EIYB 4DR7F 4EZ6A 3NL0A 4JI7F 1ZAWA 5EWEA 1WI8A 1FJGF 2O1PA 4DUZJ 1X4BA 1Z1ZA 2VFTA 2K1RA 3GYGA 2MSTA 5K9FA 3OVSA 2V2ZA 4DL2A 1HNWF 2WRMA 5A8WB 1NO8A 3Q2TC 3W62A 2AF6A 4J5OA 3PV8A 2HS4A 2GA7A 2I38A 4FNHA 2BUNA 4B9TA 5E3PA 2MEWA 3I32A 2GAGC 2MZRA 4CLPA 1WC1A 3BR8A 2I1RA 3D3CJ 3K17A 1BQMB 1PAUB 2DNZA 2RILA 2F1FA 2OJ3A 4EYHB 3TA2A 1NZAA 2OI2A 3GQCA 3H90A 3T1YJ 3V5RA 3QIPB 3GIJA 1D9DA 3DLGB 3BPDA 4ZPAA 2N3LA 1NJYA 2JEIA 1REVB 4ZVPB 3PW4A 4ED4A 1K1QA 4X4VA 3FK4A 5LXYA 2LCWA 2VOOA 1N6QB 2B9XA 5SZTA 3TRGA 2J8SA 2R8IA 1IXKA 3C6TB 2CAJA 5KOWA 4GMKA 2ZD1B 4JB8B 4UUXA 3A12A 2EW9A 4F4ZA 2UUAJ 2DIVA 1N36J 4OYAA 3M1VB 2IJFA 4LVNP 5KG7A 3SBMA 2XMUA 3A8IA 2MKYA 5KFXA 2COLA 3M8WA 4CO1A 4KH0B 3LAMA 2ZJRQ 3UD5A 5KT2A 1ZOTA 1C1BA 2GX8A 1U8WA 4EBDA 3S01A 2M4MA 3ETOA 5HQMA 2PC6A 1WDTA 1S7HA 2BJ7A 4WPAA 1YJ7A 1D3WA 1IKWA 4DFMA 1KTQA 1RWMB 1R0CB 1CS4B 2ROEA 4JV5F 5L9XA 1I6JA 4ZCIA 2RSQA 4PKDB 1DQAA 3FKBA 1FXRA 1FRXA 4JUZA 3O8WA 3S7RA 2VA3A 2HMIB 3TEGA 2HS0A 1QAJA 3EGZA 4X4RA 4LF9J 3HHLB 4DR1F 4OX9F 1NJWA 4USMA 4ZCLA 5AJ3F 2MZQA 3KJNB 4QPTA 4KO0A 4ZJLA 2P8IA 4J91A 2AYBA 4MKAA 2JLEA 1J27A 4N5SA 3O3LA 3V2UC 3H98A 4ZVFA 5KG5A 1IVZA 5T7LB 3M7VA 3DM2A 4NRUA 3W5XA 2OPPB 2YBVA 3CC4S 4K4UA 2ZBRA 2AYEA 3CO9A 3A1YG 4UQTA 1CPZA 4J7CA 2QT7A 1TUGB 2DH7A 2HZCA 4LFAJ 3IR7B 1JLEA 3CJRA 1KVIA 3CEDA 1WEZA 4FBTA 3M4XA 1SJ3P 1NPKA 4AUKA 1XJWB 1RA7A 3NCPA 2XZDB 1VK3A 1CJUB 3R5GA 4C98A 2EG2A 2XS5A 1EETA 5CD4A 3G8SA 1NK7A 1MROB 2J76E 2XLJA 4P74A 1RTIB 1S1XA 3BEGB 4PWDA 4I6YA 3IO1A 3UQSA 2FZGB 1V5IB 1MW7A 3DRSB 2OO4A 2QA1A 4TNOA 4YDXA 1AUSL 2J6UA 2R9LA 4C2MA 1ZPWX 1FKPA 3O5TB 3I9V9 4B3OB 5LSOA 3UVJB 3N6NA 1XTZA 1YRTA 3E2EA 2UUCF 1N5TA 4H4KC 5IT4A 4ZCKA 3UR0A 4KFBB 5HQ8A 1QSSA 2DT9A 1R31A 3UDEA 3V6JA 2MKIA 1U1QA 2FZKB 1MSWD 4DSLA 5C24A 3RB6A 2CJQA 5LT5A 1GX6A 3GCWP 3VGTA 1RADB 4J9QA 1SL0A 1Q5YA 1TV6A 5K5MA 1R0BG 1S1TB 1OSCA 4DV1J 4LF8J 2BEFA 3EMTA 4DFKA 1KDNA 3OXLA 1B64A 3GZ7A 3I0SA 3P4UB 1ROFA 5HROB 3W64A 1WEYA 4LRBA 2M8DB 3HP6A 5KFWA 3J81j 2BJ9A 2UXDJ 3LGNA 1NPRA 1FF2A 4WCEQ 3D1OA 3IXQA 3AH6A 2X3DA 4FXWA 4LF4J 3ZZPA 2BE2A 1AT1B 2FLPA 3DLJA 2J9DA 1U2CA 5DJBA 4A8YA 3UDVA 1VQ7S 1KBRA 3PM9A 2WAQD 4YR2A 4TYBA 3CDAA 1VQ5S 2CQBA 2VJVA 1VC0A 3MM6B 2X1BA 4DV7F 1U4BA 4EWTA 5HATA 1VISA 2IM1A 3OL9A 1HR0F 1SUQB 3OTOJ 4RNHA 1SJ1A 3L7UA 4M63A 2WOMA 3A3OB 2R2TA 1M0SA 1TVRA 2OEKA 3D6MB 4LBHA 2EXUA 2CPYA 1FI4A 1KONA 3WHIA 2E5GA 3Q83A 2AW0A 1HL6A 5KG6A 3MPDA 4DQSA 3GWCA 2CQHA 2DIUA 2JDJA 3D5MA 4Q44A 2N4CA 3CCTA 3ISND 2NYHA 2OGUA 3AT1B 3DLBA 4NCGA 2PA8D 4ZLNA 1OPZA 3HVRA 2LMIA 3SQGB 3PHTA 4ZPDA 2VBXA 2GHWA 1DARA 2HNDB 2C42A 2IC3A 1GTHA 1HBUB 1SH0A 3NGSA 1RHKB 1CG2A 1S6UA 2QMWA 4HDHA 4FVCA 4EU0A 3ZZOA 2YNHA 1JLBA 2DR7A 4I4BA 3GG0A 2YQ3A 3TI0A 3QATA 3J7AN 2RRAA 4MFBA 2Q1LA 2IMOA 4Q45A 2BOPA 3BB5A 3VZHA 4MK7A 2K3IA 5ADZA 2VG6A 2R8HA 4CYUA 1RWVB 3Q2SC 1U09A 5DM7Q 3PW5A 3MUTP 2HVEA 2IBOA 5KFBA 2AEFA 3CWJA 2VL1A 2W7OA 3T1HF 4LF6F 1EZZB 1XMQF 2YWHA 3W5ZA 2K06A 3K5PA 1RLCL 4O44B 3TZXA 3KMQA 4N77A 4KGMA 3HSZA 1V3RA 4PPDA 4TXSA 4J9NA 1WHYA 1DLOA 1N33J 3OFFA 5JMNA 4CLUA 1UJ6A 5D4OA 2HLTA 3QRRA 3D1HA 3JQMA 3PG9A 1VQNS 1LFWA 1IUJA 4JI2J 4DUYJ 4RWXA 2K1RB 3M8QA 1C2PA 1NRKA 4TQSA 3O6QA 1VJWA 5JVHQ 2VQEJ 4O3PA 3ISZA 2XS2A 5L46A 4CT8A 4DS4A 2A2DA 2ALZA 3CDBA 1CJTA 3PR4A 1G6BA 5C2CA 1S0OA 4B08A 2DTJA 1WG5A 1KFSA 4J37A 4RUAA 3EGWB 4USKA 3D0IE 2UVRA 3CCQS 2N82B 2PGCA 4XDDA 1Y5LB 4PG6A 1GK8A 2CPIA 1T3NA 3UO0A 4UT4A 2FLLA 4ECXA 3QRQA 1HKAA 3O2IA 1XEZA 3GFXA 1EKSA 3BZQA 2JSXA 4DV5F 2WVEA 4ELVA 3HX9A 2ACYA 2BQUA 1LKZA 2NUHA 4LJMA 1HNZF 2GW8A 1Q95G 3BSNA 1N5YA 4G6VB 3B8HA 4WF9Q 3CGIA 2RHSB 1RB0A 1C1BB 2UXCF 2CNKB 2GJIA 2NSBA 4A8FA 4NEYA 2WBMA 1YRUA 3HHNB 1NDPA 5J1NA 1QE1A 2ZH5A 2B51A 4X65J 2NQPA 1IKWB 1NK6A 1B0TA 3P5TL 5DQHA 3QT5A 2XMJA 2OFHX 3Q8RB 2EBEA 1S12A 3OLBA 4NEZA 1UVKA 1S77D 2H51B 4JI8J 1X9MA 5IS2A 1Q82T 2FC9A 4L6V3 5KG2A 4J9SA 4CT9A 2XYHB 1LK7A 1FKOA 1RWOB 3OL8A 3GV7B 2HLUA 3AFGA 4JV0A 4YB1P 2AD9A 3CMAS 1UEKA 3BGFA 1Q4RA 4NLWA 2CQPA 1PYTA 1WOOA 3G6VA 4GC6A 4JYAF 4KO0B 3K89A 2J6SA 2YQ1A 4XPCA 3IAS9 2BYCA 1FE0A 4DV6J 1TKZA 4OYBA 4WP8A 3RAXA 2EK1A 1WG4A 3M2VA 4JI3F 4DR2F 1N8RT 9ATCB 1JLEB 3O44A 5KFUA 2CQCA 2B4VA 4Q0BA 1TKXA 3HT0A 3G86A 3BM7A 3E51A 1WHVA 2BACA 3JB9k 4UY8T 4V1Ak 1EETB 2FYXA 2FB0A 2DNMA 2QE5A 3C46A 2KT2A 5HVGA 3VAIA 1RAOA 1S1XB 4YB7A 5D0EA 3R1HA 1S1UB 4PWDB 1VQYA 3EM1A 3GJSB 4NZ6A 3C14A 1NEEA 1BHNA 2HQCA 4RUBA 3VF0B 4X62F 3MEEA 1FKPB 4ILRA 5FD1A 5DGBA 3SV3A 2IBKA 3DOMA 4FYYB 3PHEA 3DLLQ 5HL7Q 1RHJB 4LIRA 5HJXA 4DSFA 2XCPA 3R8YA 1QSLA 4QR2A 3CE8A 5ETNA 3DRRA 1RAGB 2F4VJ 4NZ0A 4CIOA 5C24B 4W92B 2KFNA 4B3SF 2L9DA 1S10A 3BN7A 2DHSA 3R6LB 4CH0S 1FRHA 1TV6B 4QPXA 3ICLA 1UVLA 1ICEB 2UUBJ 4X64J 1OYDA 2ZC3A 2RDIA 1S9FA 3IRWP 2IM0A 4WK1A 4EK2A 1F3FA 3GB0A 2PD1A 3I0SB 4C9DA 1R6YA 1F60B 4CDIA 3GPAA 3CJ5A 2EBGA 5A8KA 4KGXB 3BBCA 1FEHA 3A3NB 2MZTA 3SFUA 4ZLLA 1HQ2A 3HULA 3KYLA 3Q8QB 2BE2B 4DHVA 4KB7A 2B8PA 4DUZF 2QSWA 3DGVA 1RAEB 4K5SA 2ZEJA 4D3HA 2XGQA 1KVKA 4IKAA 3LF0A 1MMNA 1FRMA 1PJ5A 3C15A 2DGQA 3NG8A 2AJ0A 1LXNA 4BC7A 1HD1A 3IBFB 1IKVA 2JJ4D 2WOMB 1HHSA 3JSRA 4F3OA 3HJFA 3JYTA 1TVRB 3C66A 2LQ9A 4PXCA 3T1YF 3BQ1A 3H5UA 2GIFA 5CZXA 4J9MA 1YTYA 2V2VA 2XMWA 1UFLA 3KHHA 2N3OA 4DX7A 3BBBA 3DRYA 2KI2A 4DN0A 2HKEA 2FUG9 1U0SA 4M5GA 2IC3B 2HBZB 3I55S 3V81A 2LXUA 2DGOA 1K1SA 2BMBA 3DLEA 1BC6A 5KT3A 2DGXA 2UUAF 1N36F 1BQNB 5A76A 2VODA 1S0NA 1RJJA 2J0QD 1Z2ZA 1JLBB 3M05A 1YHQS 1U24A 4MFBB 3W7BA 1I94J 5KG1A 1S76D 1F9EB 2E9RX 2MLXA 4ERDA 1JMTA 2BRKA 2VG6B 4CYUB 2AEMA 3R2DJ 2J5AA 2AJQA 2CKWA 5GMDA 2A1BA 4RW6A 2G0IA 1W2IA 1HHTP 1H74A 4A8MP 4GKKJ 4DSJA 3AAWB 1RTZA 2QYCA 1KS2A 2OTJS 2CDRB 1F0XA 2JX2A 1S49A 4KTQA 3UW1A 3CO0P 5CABA 2R7UA 1FO1A 4XPEA 4B3TJ 5J2QA 3MAHA 2AIRB 4DDFA 1E6VA 2KKHA 3RB3A 4USVA 4WU3A 4LR8A 2XSJA 1RT7A 2H9ZA 3M9MB 8AT1B 2IJNA 2D9OA 4ZPCA 4OI2A 3DGPA 2ZOMA 4BBYA 4NLRA 4RW4A 4XK8C 2QEXS 1T9VA 4LF7J 2ZVIA 4DFJA 4ZLJA 3RB4A 2X3GA 4YEAA 2YWKA 4RNOA 2HFSA 3M8QB 3V6KA 2RH3A 3K5LA 2FJAB 2VFRA 2HIQA 3N79A 4LFAF 4HYKA 2V50A 3LO3A 3NP5A 2HVHA 1NHKL 5KFDA 1F2GA 4O3SA 1KOOA 3UD4P 2DCUB 2C3UA 1BXNA 1CJTB 4B02A 5GAEU 2CJKA 1NSKL 2R7WA 3OJUA 2E29A 4N8OA 1RWXB 2FVPA 2NPIA 3DXBA 1G7CB 4CO0A 2JEGA 1UW4A 2XG8A 2APOA 3T6JA 1YZ7A 2FJBB 4ZOSA 5KFJA 1EHWA 3I82A 4DF8A 1DQ9A 3LH2S 2FJDB 2R42A 2Z30B 1JLFA 3K57A 4FF2A 1B70B 1JJ2R 3L7PA 1QVGR 4QIWD 2K3KA 1YBUA 3ILLA 1HI8A 1U0HA 2RQKA 1JLCA 1NJXA 1FFGB 3R27A 3IRXA 1ZZFA 1N5YB 4DMZA 2OP5A 4K2JA 2M9KA 4LUBA 1PG5B 2JLFA 1SCJB 5D77A 3POTA 4ECSA 2KG1A 4DV1F 4LF8F 2QYGA 2RT3A 4QWAA 1K47A 1VDHA 2Q3PA 2YNFA 1QE1B 1JKHA 2E9TA 1X0PA 5HLFA 2P9GA 1RAFB 3W61A 2BJ1A 2UXDF 1GXTA 1K0VA 2L08A 4PQAA 1ZTWA 4DV4J 3MURP 3AQPA 4LF4F 2EFGA 4Q43A 2ZDPA 3CD7A 2VG5A 1FKOB 5KFLA 2J0WA 5KFNA 4OIXA 4PG8A 3QWUA 3GIIA 3SMZA 4O4RA 1TL1A 4AL5A 6FDRA 4J90A 2ZHAA 1JJCB 2G13A 5LMNF 1BE4A 3OTOF 1PCAA 1S48A 1G1XA 3CDUA 1TKZB 3MEDA 4DQIA 1VRUA 2CQ0A 1X4AA 4ER8A 1KQGB 2JH3A 5DETA 2AJFE 2OPRA 3UDLA 5IV4A 1XC9A 3L9ZA 3MPWA 3TARA 2ADBA 5GADU 3IG1A 2EC0A 1U6BA 4Q0BB 1TKXB 5K8NA 1D8YA 5FLXY 3DRXA 1KQKA 2JL9A 4LF2A 4M5KA 1RT5A 2XSFA 4NYOA 2MHNA 3IR6B 5D6GA 3CCVS 1SKWA 3DMJA 2ASJA 2ZH1A 3UCUP 3BH6B 3HPOA 3HMJG 1FNXH 4K59A 4LQ3A 5KT7A 3NLCA 5I3UA 1R8CA 3C14B 3KG1A 3MEEB 4RBUA 4KRWA 4OMFG 3KNGA 2XO7A 3DOMB 3MPYA 4QW9A 3SSRA 1HLWA 5FJ4A 3VAMA 1U6FA 1FDAA 1XQIA 1C0UA 2ATLA 3RW7A 2DCLA 3DRRB 1FFSB 3GG1A 1N4LA 3CULA 3PXGa 3C16A 3G87A 2KL8A 4ZVSB 2DHAA 2VOPA 4DZDA 1SL2A 4NPOA 3TAPA 3R5DA 3IS9A 4KE5A 2ZH9A 4NMLA 4KHRA 1T03A 4AT1B 2F4FA 2Y9HA 2KU7A 4UTGA 3GFHA 1WUUA 5KT6A 4FXVA 5D8HB 2JLGA 2I2YA 2DR6A 3MR6A 1N33F 4PWUA 4OJ3A 5A8KB 3F0NA 2W4CA 2E5IA 4RZRA 2HNZA 3IBCB 3ADAC 5EUHA 2FQQB 1YGYA 2W7PA 5A2QU 2VDHA 1UVJA 3DU5A 4DPYA 3B82A 1DZ5A 4DUYF 4YMEA 1SQGA 1Y4ZB 1FRJA 5IQQA 3MTJA 5KAKA 2W2OP 3C15B 3RG6A 4DSKA 3LAKA 3SFGA 2VQEF 4DWIA 5KFQA 3QFWA 3I56S 2DR9A 3US5A 1IM6A 4LRFA 5ETQA 1IKVB 2DHGA 2ZWPA 2W1BA 4YS2A 4OHYA 1N0UA 3JYTB 4WBFA 4OX6A 1JXEA 2RKIA 2CNOB 2KYXA 5LJ3Y 5BYQA 3IFEA 3JTNA 5M2UA 4P2XA 1VMBA 4I64A 4FF3A 1H2VZ 2HRUA 2DKOB 5T41A 3L09A 3Q86A 3QAEA 3IWLA 2HHQA 3BGLA 2NSCA 3ZZ0A 3ILJA 1WORA 2FLOA 2RIJA 4O3QA 4A8QA 3V81B 3DLEB 1A0OB 1SC6A 2ZZNA 3CJ4A 1NDCA 3MAAA 1J5OA 2Z56B 1UMJA 1Q16B 3T3FA 3HD2A 2DNLA 3CPWR 2HFOA 3OR2A 1BY9A 3OTDA 2ZOGA 1K73T 3HKZD 4RJVA 3D3BJ 3FEYB 2BX6A 3DYAA 3KLIA 2V4JA 4GO5X 2ABYA 2V4RA 2NLWA 5B0DA 4PXDA 1NK4A 2ACMA 4F4KA 2XEXA 3QLHA 3ZXWA 2PMWA 4X65F 3HT3A 3KHGA 5IC6B 4RW6B 1A6LA 1TAQA 3DN9A 2MDAA 1F2HA 4JI8F 2MZ1A 3HO1A 1P9QC 3KLGA 4EFAC 5B0EA 4DR3J 2HWIA 4FS1A 2G2YA 2KJWA 1RWNB 2XLKA 4EYIB 3T41A 2G9OA 5J2QB 2BE9B 3BO2A 2OELA 1S57A 1QAYA 2V69A 5EWGA 3TVYA 3ZZTA 1E6VB 1NCLA 3R5CA 3QJPA 5HBMA 1RT7B 3DCAA 4LF5J 3R5BA 3TQEA 5KFEA 2ALYB 2RRBA 1FNMA 4DL4A 3DGPB 3OL7A 4OQJA 1Q8BA 1XMBA 3ZTOA 3K2YA 2BW7A 5LXRA 4DV6F 4RW4B 4UOFA 1NK9A 4CWBA 1RABB 3AODA 4DBQA 2BVZA 2ROPA 4WIIA 4F8RA 1KLMA 3OW2R 2HURA 1U1OA 1A9NB 4CLLA 3RRGA 1T0TV 4I7FA 3WC2A 3FCWA 2HAIA 3ENQA 3NBPA 1HWLA 4ZPTR 4H4MA 2YX7A 1RTHA 1NAQA 1EB0A 1S79A 2MJNA 3VR1A 1PILA 3SEOA 3SIPB 5CXTA 1NB2A 4F0KA 2QRRA 4OX7A 4QWEA 7AT1B 4LSNA 2XBPA 2XMVA 3M8SA 1IR1A 1JLFB 4Y6IA 3CMQA 5HO4A 5CYJA 3KJFB 2EI5A 4CI0B 4MYTA 3VZIA 5D0HA 1RKJA 1RLDA 1WC4A 4DLGA 3CW2C 2DY9A 1FRIA 1U0HB 4OJ1A 1JLCB 2E1MC 2O66A 2F4VF 2WZ1A 3IRXB 1FJCA 4ZVOB 1M5HA 1UJ5A 2L41A 3OBIA 4J9UE 1FDDA 3G82A 1L3UA 3OVBA 4NA3A 2H48B 3M9NB 1NHVA 3AD9C 2UUBF 4X64F 4MKBA 3POTB 1FJEB 4H54A 2LXIA 2IRYA 4Q5VA 4DR6J 4LRDA 3THPA 1OPIA 2YNFB 4DS5A 2VG7A 2ROGA 1JKHB 1RKIA 4QZVB 5HLFB 4DQPA 1FNOA 3GTYX 5I4MA 2V4QA 3NGUA 2RNEA 4GO7X 2AZ3A 1DJ0A 2MPUA 4IFVA 2XMTA 1PJ6A 2B5JA 2P6TA 2BANA 4K4SA 4FF4A 3CCUS 1C4AA 1VYAA 2VG5B 4K5RA 4TY8A 4C8MA 5KT5A 3U7JA 1RI7A 5KFAA 2NUUG 1RDRA 1IR2A 3VGUA 5L38A 1GMUA 4MIWA 3I4PA 4NLTA 1T9UA 5KFKA 2ASDA 2WSCC 1RHUB 2BOAA 1Z4UA 4NX9A 2PEBA 3SDEA 4MAKA 1HI0P 2YKMA 1N54B 3MEDB 1NLKL 2JWNA 1P27B 5F9LA 5GMEA 1VRUB 5KFIA 4N8NA 4GVBA 1HQUA 5H9FJ 3OHAA 1SH3A 2Y3YA 5DZ6A 1AFIA 4ZA1A 2OPRB 3OSNA 5KT4A 3W8GA 3MGJA 4USJC 1TK5A 3IG1B 2GJFA 4IYQA 3ULHA 3UN5A 2EWHA 1RT5B 1WI6A 3JXOA 3DMJB 4NOHA 3J80Y 4WK3A 1VIXA 4Y2IA 2FHMA 5I3UB 2UXBJ 3AOCA 3TJ9A 4P7TA 4CLFA 3NRBA 2BJDA 2B4OA 3D7SB 3K7RA 4NLOA 3KHLA 3BKTA 2ZBCA 4HLBA 1JLQA 3I96A 2HSEB 4ZPVR 1WOSA 2XMKA 1KHWA 2HVIA 1DTTA 1U1KA 1LW0A 1M5PC 4ES1A 1VQ8S 1I94F 3TJAA 3D54A 1SV5A 3HSGA 1C0UB 4ANDA 1L3KA 3S6EA 1I3OB 4RNFA 4EUVA 5DQGA 3C16B 2OLWA 1T3OA 3N0VA 2PSZA 3FRYA 4GKKF 5F8HA 1MN7A 3MCNA 2VPWB 2R7VA 3J7A1 2KH9A 3IS9B 3DHXA 3CT9A 2QA4G 3KKFA 1T03B 2Q6BA 1HQEA 3M2UA 2OAUA 4PYDA 4PZVA 4E8UA 2FY1A 3RZAA 3BF4A 4B3TF 2ZDOA 4JV2A 2KZMA 2YKNA 1XR6A 2JEJA 4GC7A 4C0OC 1MLAA 3FVYA 4DI6A 4QW8A 2HYIB 4ZN1A 2DD8S 2B4PA 2R7SA 1CSJA 2HNZB 1ZA2B 4JI4J 3WDOA 1PGZA 2JFKA 3FCHA 1KEKA 5C5JA 2HFNA 1P6TA 3GSIA 3LP2A 1E6YA 2W7AA 3BPSP 4LF7F 7FD1A 2I5JA 3EXYA 2WVBA 2YXLA 1BQXA 1S9EA 3H4DA 5C2GA 1QUVA 1IKXA 3QJJA 2AKWB 3IR5B 4U7UD 4P7VA 1XNQJ 2LU2A 4HI1A 3PO4A 5I3PA 4X4TA 2DPJA 3N5BA 2V94A 2RKIB 4O3NA 3UFCX 3Q8SB 3TQ1A 3M6UA 2ZUGA 2RUSA 4V19X 1MMLA 5D78A 4YHHJ 2V68A 2ZJPQ 1B4SA 2B7BB 3MOJB 3GFZA 3PVXA 2AQ4A 2D74B 2VHGA 1UEUA 4K50A 1ZM9A 4ECYA 1GXUA 3D6FB 3BS9A 3MFIA 1JJ4A 2NZ4A 2QL5B 4IH7A 1FWLA 1KRPA 2XI2A 2YNGA 1X9SA 5IT0A 3VVUA 2LQ8A 1CLFA 2WB4A 3NGDA 1XERA 4Y2KA 2F63A 3MAAB 4KKOA 3TA1A 1J5OB 3FUYA 1N48A 2AT1B 4ED5A 1UL3A 2EFNA 1LQ9A 4K0KJ 3OR2B 1SJQA 3KJVA 2XNQA 2OD4A 3EUNA 2LA4A 1P1LA 4ED7A 3DYAB 2D3ZA 2V4JB 3KLIB 3OFGA 1F9FA 2CRLA 1WHXA 2GV1A 2ZKTA 1MG7A 3BSOA 5DLGA 3K8VA 3QLHB 3MD3A 3CUNA 3WIVA 3GIKA 5GAGU 3Q22A 4CO2A 4NCAA 2GVZA 4P2FA 4AXJA 2EVZA 5A6WA 1XBWA 4DV4F 4Q8FA 3ITHA 1RHQB 2Q66A 1TL3A 4OFZA 2YKOA 3KLGB 1GNKA 2UVWA 4OYPA 1VQ6S 2DXDA 4WFZA 1T7PA 2EPIA 5GAEI 3LWMA 2BR0A 1N56A 3FGVA 3LW5C 3W63A 2LQBA 2P6SA 4ANEA 5HBMB 4RWWA 1ELOA 3RBEA 4G65A 4EI2A 4AQYJ 2BRLA 3ZTRA 4LVOP 2FHKA 1YITS 4KY3A 4WP9A 4WTOB 4IH5A 2ZJQQ 4IG0A 2UVVA 3LP1A 4Q2LA 4WFYA 1N32J 1JK9B 2ADCA 3CCJS 1C0TA 3CVKA 2MY8A 3AD7C 3G6YA 4I7FB 1HFEL 3D66A 1RUSA 2AJ2A 3PKYA 3NBPB 1VLOA 3M8PA 4H4MB 4Z2XA 3D0GE 1RTHB 4QOTA 3ILOA 3K5NA 2DRBA 3N4WA 4BWMA 1B7FA 1WF0A 4YY3J 3AY0A 4KH1B 1SKRA 1SXLA 1GXLA 5AE1A 3KK2A 3OTCA 1TUWA 5LL6d 2I8EA 1FESA 3B6BA 3MF5A 4LSNB 5HMYA 1RU2A 2MQQA 1MU2A 2OUGA 2AMCB 2V34A 3BYRA 4LBIA 1YJNS 2RF2A 4KAIA 1QSYA 2AX0A 4TKTA 1PBUA 1S9GA 3MPVA 3PJ9A 1M1HA 3M2RB 2BKPA 1KQSR 3GU0A 5F8JA 5CQGA 4ES3A 3J81U 1Y5IB 3A13A 3CCSS 2R4FA 4QR1A 1YBTA 3M8RA 2YH1A 1LWEA 2KZZA 1R8PA 3MMCA 3G82B 1HBMA 3JAMU 3TX0A 5F8IA 3PRVA 4HKQA 1WC6A 5HP1A 2ZH8A 3EGVA 3M30A 1OIAA 3Q8PB 1AYEA 2BKOA 5U47A 2VG7B 3AJDA 2YH0A 3FC9A 2N4DA 4HTIA 4CTAA 1RT6A 2CG4A 4TYAA 3IGNA 5A8RA 2J7UA 5IWAJ 5C25A 5H1SV 4EMDA 3DOKA 2JZ5A 4IFVB 4LMZA 1QLNA 5GADI 2B5JB 5AXMA 4GVLA 2BANB 1Q8IA 5IV3A 4J9KA 1T02A 3WX8A 2GQCA 2MKCA 4TY8B 5J2MA 2DGSA 1UFKA 1NH7A 3K59A 1OY6A 2G2ZA 3RYLA 2DVIA 1FK9A 1DHMA 3K58A 4ZVEA 1T94A 1O0PA 1CJKA 4UOHA 2OPSA 4RX6A 1YX2A 2XY7A 1YI2S 3DXSX 3QBCA 3SDEB 2ZWOA 5KG4A 3TA0A 2YKMB 4HHHA 2ZH7A 3AB4B 2FVSA 4GVBB 1HQUB 4ZVRB 4WFXA 5E7OB 1PC4A 2RE1A 4QR0A 3FNNA 4U6PA 1JXLA 4DX6A 4UOGA 3CCWA 3OVAA 4K4TA 1SL1A 1KSPA 2GO9A 2H4WB 1MWYA 1UVMA 1TFYA 2DISA 2L9WA 4FN5A 2HQGA 2RMLA 4X4OA 2LQJA 4OYOA 4OI1A 3LANA 1SBRA 3GIRA 2F9JA 3OFHA 2BQ3A 2C22A 4IDKA 2DH9A 1RT3A 2KG0A 3QSIA 5IT9Y 3UCZP 1R0AA 2WK4A 5ETLA 3FZ2A 3WX4A 4U8YA 4W4MA 3BGRA 1JLQB 1HD0A 5GAHU 3TZZA 1PBAA 2V8DA 3HVTA 3M9OB 2FGOA 1RSCA 4I0WA 2OH2A 2KB2A 5ETRA 1DTTB 2XTJP 1LW0B 1PKUA 1PYOB 5KFOA 2ZM6J 4U9RA 4Y34A 1SV5B 4B9VA 4F3MA 3NS6A 1NM2A 2QTWA 1WC5A 1Q7YT 4A8XA 6FD1A 2OMLA 3QGHA 3HVAA 4ECUA 2QGFB 2UZAA 2ZFHA 2LECA 1G4CA 2KO1A 3BV8A 3PEHA 5E5NA 1NDKA 2CPJA 1OQ3A 2CWXA 4DV3J 1TL4A 2A6MA 3H2LA 3ZFVA 1VIOA 4CLTA 4DX8H 1HQEB 3M2UB 2R3VA 4OLOA 2YTCA 2YWWA 5E3QA 2J7KA 2ZBIA 1ZA1B 4F0HA 1IBMJ 2YKNB 3FQKA 3U1MA 2QMUB 1R6VA 1O8BA 2EG1A 1D8ZA 3ZO7A 2QZ8A 2VPXB 3EX7B 2POKA 2MKHA 4B9MA 1F9HA 2H5EA 4K4XA 2B6AA 3MMJA 2GVDA 8ATCB 1TFWA 4FKYA 1WDDA 3LP2B 1E6YB 5ETSA 1IN0A 3A8EA 3FJ2A 4HDGA 2I5JB 2Z58B 1QDUB 2FHJA 1S9EB 1U2RA 4MH8A 2AHOB 4XO0A 2NYIA 5F3ZA 1LWFA 2CPHA 1LV5A 3UDCA 3MR3A 1IKXB 1FRLA 4A46A 1M90T 4TU8A 3PACA 1HPZA 2FHJD 2PI5A 2QA4S 4PWWA 2CJBA 2GC8A 3Q8UA 4DV2J 4I56A 4JI0F 2X51A 2DNRA 3CD0A 3PW0A 2YWFA 1EQMA 1KD1T 1XK8A 4CQ1A 2B9EA 2HHWA 3M6XA 4P9SA 5KOXA 5AT1B 1CJVA 2MKSA 2HGNA 4PRFA 1SH2A 5BR8J 1CQNA 1OYEA 3CIMA 1KQFB 4LR7A 1X4EA 2GMLA 3AOBA 5EN1A 1V9OA 4OL8A 5IQ6A 2G4BA 2KTQA 3GR0A 2YNGB 4XAKA 3Q23A 5DM6Q 1NJZA 2YVSA 3ZTQA 2R7TA 2I6WA 1H2UX 3FSYA 3EDQB 2AYGA 4ED3A 4KKOB 4Y00A 3I5BA 1YQHA 3BQ2A 1Y10A 2PA3A 1YIJS 3KJVB 2A18A 5H9FK 2DXEA 3MAQA 1QAIA 1RBAA 4NLSA 1TKTB 1S5ZA 4DCOB 3IMQJ 2C3MA 3B78A 3CCLS 3L95X 3NNHA 3QGIA 1IKYA 1Y9OA 1LOUA 4DPOA 3KK1A 1JX4A 2FC8A 3D67A 1JLGA 1RYRA 2GVZB 3IC1A 5F41A 1FFWB 3W3SA 4OHXA 3FMWA 4Y3CA 3ITHB 1TL3B 3RU0A 3OHBA 4IQMA 1M1KT 2V2KA 3X3UA 1IM4A 3TYTA 1R8HA 5E3AA 4DR5F 4C8OA 4M5MA 3QQCD 3OT9A 2W8KA 5JVGQ 1Q86T 5JJBA 1B0VA 1PC5A 1NPPA 3MCMA 2FJXA 2HW3A 4I2QA 4K7QA 3MOZA 2R2UA 1RBLA 5HN0A 4MT1A 1WNEA 3MCOA 1GAOA 4MIBA 2XI3A 3I4HX 4I69A 3OR1A 4IG0B 3MPUB 3HF5A 1YJTA 3CCRS 3LP1B 3MUVP 3AB2B 4P73A 1YK9A 1HBNA 4OHVA 5SUHA 3EPGA 3Q0AA 3NXZA 3PX6A 3GV8B 3PJXA 4WWSA 3VQSA 3KUGA 1C0TB 1VC5A 1U2FA 3ENWA 2Y1LB 2RDDA 5DG7A 2DHHA 1N5SA 1IWAA 1REGX 5BXIA 1K9MT 3M8PB 1D1UA 3WQPA 1B7YB 3ET6B 1SJ4P 3RR7A 1VQLS 2XO6A 1S99A 1RBOB 2UXBF 3Q8YA 3KK2B 2DGUA 3MEKA 1VQPS 5HAOA 4CLYA 2WBRA 2V8HA 1JIHA 4CZCA 1MU2B 3V4IA 2H54B 2DO4A 5G4DA 1S1VA 2RF2B 2KDOA 2QX0A 4UOCA 3KXDA 2L48A 3DLGA 2LDIA 1JJHA 1S9GB 4YB6A 4LF1A 3BDPA 2GNKA 3W9IA 3VALA 1WC3A 4QJVA 2DRAA 1DURA 5KFMA 5L1KA 1Q5VA 1BWEA 1URRA 1RU1A 2PN6A 1LWEB 3MMCB 1OY8A 1HBMB 5E2QA 1JNZB 4L74A 4YR0A 3CJ8A 5HP1B 2ZHOA 3M30B 2D69A 5CZVA 4NLGA 1HYSA 3MR5A 3DFEA 1XIQA 2XM3A 5L39A 1HNXJ 2PEHA 3VGSA 2DEIA 4B3MJ 4F50A 3I6PA 4PPZA 2HWHA 1VRTA 4NLVA 2X1GA 4CTAB 1RT6B 4NL5A 5A8RB 5C25B 4BC9A 3DOKB 5L9NA 4JI4F 1W2BR 4DX5A 2Y0BB 2H1YA 4CO4A 4Y2CA 5J2MB 2J8AA 3EVOA 3KDNA 1Q79A 4RPFA 1I5OB 1FK9B 1S59A 1FXDA 4DLEA 3C2PA 3MR2A 4OHZA 1CJKB 3OV7A 2L9NA 2OPSB 2VA2A 4F2SA 1UWBA 4M5HA 3G96A 1X9WA 1XNQF 4F4YA 1S97A 2DGTA 4JV1A 2PT0A 2CIMA 1RCXB 4H4OA 3NGRA 4LREA 1MMDA 4ELUA 3K5OA 1NBEB 3PYDA 1AA1B 2GIRA 3BREA 3VQTA 2D3O1 4YHHF 3KMSA 2BKNA 3TUPA 3MMAA 5L8RC 5CHCB 3RBDA 5B09A 5L1JA 4OYIA 4OI4A 3KFWX 4ZVUB 1KWMA 1NKBA 4KPYA 3P49B 1U1MA 1YZ6A 3OXFA 3RJMB 3QJLA 3KLHA 3FEZA 2CZVC 4FNIA 2DNQA 1UVIA 1RT3B 1ZZNA 2MLZA 1WACA 1R0AB 4OJHA 2KVQE 4OHWA 5HI7A 3BGRB 4RBTA 4NI2A 2VIHA 3HVTB 3B54A 2BE7D 2CZ4A 5CCLA 4K0KF 5DG9A 1HBOA 4ICLA 1VR6A 4B9SA 4K4VA 1X5OA 3VVTA 1P8GA 3KLFA 4P10A 5KG3A 1NUEA 2DO0A 1GMWA 2HZVA 1NK5A 2PI4A 3TZWA 3CNQP 3DI6A 5F8MA 3BR9A 1D9AA 2Y1RI 2XNRA 3SSQA 2C3PA 4IG3A 2GO8A 2H3EB 5MAOA 3R7SB 5L1LA 1UP1A 1GMWD 5FDLA 2C2ZB 4OZ3A 1Y00A 4O4GA 2F8HA 3C19A 4R0EA 2IVMA 1Y3KA 2KXHA 4ENOA 2H5IB 1W7WA 2JC1A 2LDYA 4P2SA 3CC7S 1X0FA 5F9NA 3I5CA 1UETA 2MTLA 1RTDA 1VQOS 1EQ0A 2E1AA 2AWZA 1NKCA 2GMJA 2QMXA 1VS3A 2VFVA 4NA2A 4Y2AA 4F2RA 4AQYF 2BJ3A 5KFPA 2B6AB 3CJSA 2WVDA 1NK8A 1KFDA 2GVDB 2VQFJ 4CNZA 2MQ8A 1WHWA 4WKYA 5L1IA 4JBCA 4HT5A 2CQ4A 1N32F 2G1HA 2R2SA 3NNAA 4DEZA 1IQTA 4R25A 1R7IA 5HSPA 4CO5A 5CYQA 3CD6S 3O1LA 4HEA9 1LWFB 5T14A 5E41A 2QLWA 2M3DA 4X4UA 4M5IA 3F44A 3DM2B 1KKHA 1HPZB 2YKAA 2LU1A 1BD6A 2HGLA 5CYMA 5HK4A 3OUYA 1NSPA 3UNYA 4URQU 4NYPA 4YY3F 4HI2A 3W60A 4M94A 2VPZB 3SZ2A 4J9LA 1WWHA 2BM1A 2HHSA 4RNNA 3D28A 3QT8A 4RO0A 1CJVB 2VDIA 4R5PA 2KFYA 3T5HA 2NXUA 3PJWA 5GAGI 3BKUA 3UE2A 5AE2A 3ILIA 3HZEA 2AZ1A 2HK2A 1UZDA 4KIAA 4QIEA 1EAYC 3VWSA 2W4PA 4DG1A 1U25A 1FD8A 2CPFA 4R8UA 4U95A 3FBBA 5DDOC 3D9BA 4BWJA 4NXMJ 4WXWA 4RU9A 2YQ0A 1G3OA 4CH7A 2NREA 5HMZA 2C3YA 1ZM4A 4UZBA 2A2CA 2UUWA 1SVDA 4N7TA 1C1CA 1LWXA 3AA9A 3HSDA 1DTQA 4W90B 1U1PA 3Q24A 3RUBL 3CCMS 2J9CA 5KFHA 3CIZA 1FVSA 3SCLE 2IM2A 1AW0A 3RBZA 3THTA 3SQOP 2KRBA 2G2OA 1QY7A 1IKYB 1QUPA 1UJ4A 5IFMA 3OQ2A 3PNIA 2IYIA 1Q8KA 3OTEA 4OYMA 3KK1B 4AE5A 2C2NA 4JOUA 1HWJA 5IWAF 1JLGB 2IA6A 1RHRB 2ZITA 4C11A 4QWCA 1OQ6A 4M1KA 2VD3A 2D9PA 1OSDA 3ZZZA 3W1YC 2HIYA 3J7Z5 3JSMA 1WKKA 2V8PA 3I87A 4M8LA 2BQRA 2AU0A 4M5DA 4I2QB 4L72B 1ZPVA 1IBLJ 1VHIA 5EX3A 3CCES 2B9YA 1AFJA 2M7SA 3OR1B 4WZMA 2QN6B 3VV2B 2OSRA 4HACA 4ZITA 1HBNB 1ZAXA 3HZGA 3IAM9 1KN6A 3I31A 3AJ1A 5BYSA 1G2EA 1FDNA 1DY3A 3BJYA 3LQVA 2UVUA 4FXDA 3R7BB 2YWGA 2LVWA 1RWUA 5ITHA 1T8EA 2KRRA 5A6PA 4ZP6A 2J9EA 4F4XA 4TLRA 1FT8A 2LA6A 4X2BA 2HBRB 1Q8LA 5IOLA 4FP9A 1GX5A 2XQCA 1KTVA 4LSZB 2X1FA 3AXMA 7FDRA 3T5KA 4LT6A 3PR5B 4NASA 2VKRA 1WKJA 1RQ0A 2G0JA 3C6UA 1UPMB 4RW9A 2M52A 4NCGB 2CVEA 3NOCA 4ZKAA 3THVA 1QM9A 4IO9Q 3ZC4A 3RW6A 2B7CB 3V4IB 4PABA 3TP2A 1WG1A 1S1VB 4CLSA 4CM2A 3MFHA 3H5XA 3CTRA 2IHR1 4WKRA 2YPYA 2HVZA 1GEHA 2ZM6F 3WC0A 4L73A 3W65A 2WHOA 1ZTTA 1SJRA 2CADA 4QIVA 4OV1A 4C7QA 3NMRA 4YN3B 2HFVA 4KHPJ 2RS2A 2YNHB 3ENAA 2W25A 2VBWA 2Y8YA 2MLYA 3TZYA 5LJ5Y 2X7IA 3W2WA 1BLUA 3FFIA 2D41A 1FCAA 2PMZD 3CC2S 4NE9C 1LFPA 4ZVGA 1NB7A 4DV3F 2VFSA 1VQSA 1H6KX 1TQLA 4F36A 3JSBA 3SYZA 1HYSB 4ZVTB 1F1BB 3BSAA 1TL5A 4KV8A 1IBMF 3JTPA 2VONA 1VRTB 1I51B 3A3PB 2B9WA 4FKXA 2GGPA 2KN4A 4Y28C 5AXKA 2LEAA 4HT7A 1RXOB 1T9XA 4XTTA 1IR0A 5DDRC 4LF9F 4ECTA 4B3RJ 3CF5Q 4KJIA 1DLOB 4N56A 2W4DA 4C3LA 2K7KA 4PG4A 4ZIWA 4X66J 2CQGA 2Z2ZA 1NXIA 3HD1A 3TX8A 1S72S 5JXSA 4ID8A 3EYZA 5JUMA 3K0JA 4QWBA 4E0DA 4ETZA 1UWBB 2N7YA 6AT1B 3BGOP 3CXCR 2GZOA 2O67A 2OEMA 1RYSA 3MUMP 2MB0B 3ZZRA 5GAHI 3P6YC 3OD2A 4FPIA 4DV2F 2VASA 2VFUA 1NSAA 4H4OB 4PCQA 3KOAA 1M1GA 4FVMA 5E3CA 3LWLA 3QMQA 1L3TA 3BO4A 4GKJJ 1TR0A 1U1NA 3AOAA 4OZJA 2RQ4A 1R8BA 5KFFA 3MMAB 2FLNA 5BR8F 2RU9A 3M6WA 3HK2A 2VH7A 2Y0SD 2AJ4A 4Q8EA 3PY8A 1GFWB 4ECZA 2ZBQA 1FX2A 1PO6A 3ELHA 4WIQA 3KLHB 2E5HA 4O3OA 1H38A 4EO6A 2RHQB 4ZP7A 5F3TA 1Y11A 1YJVA 1N88A 4ZP8A 3GP9A 4NI2B 1MWQA 2KHCA 1S1UA 3PDNA 4NLUA 2CJ9A 1HBOB 4ICLB 3AXKA 4ES2A 2A10A 2E1RA 2XULA 3KLFB 2XS7A 4Q7AA 2BDPA 3DI6B 4YR3A 5ETKA 3FMBA 3D4JA 1BUXA 2FJVA 5DO2A 4IG3B 3ZNJ1 2W9AA 5FDLB 1FD2A 4O4GB 4G1PA 2HQDA 1RGVA 2DEJA 4C8KA 3GR1A 3KG0A 3EJMA 3NGKA 4C8ZA 3PZPA 2QFJA 2WW8A 1UZHA 1RTDB 4DL3A 3VHQA 3CB4A 2C2RA 3R1LA 1JLAA 1X5SA 1WELA 3H2VE 3EE3A 1YJUA 2ILZA 2OKQA 2DYAA 2UP1A 3FQLA 1HARA 3QSYB 1ULRA 1DQ8A 2ZKUA 3OXGA 2W2MP 4QQBA 2K2PA 4OJGA 3VAFA 3JQJA 4WTYA 2Y8WA 4RNMA 1N5VA 1FX4A 3E01A 3AQOA 3P45B 4RW8A 2GJ2A 2HHVA 4ECVA 2AJ1A 5CYQB 2ZVSA 3CJ3A 2CQ3A 3EPIA 4ANCA 1NMEB 3DRPA 2E1CA 1AROP 2DGWA 2DNNA 2DJWA 3M2VB 2RVJA 3WBZA 5CYMB 4MK9A 3OUYB 4C8LA 2RJZA 2V63A 4NCBA 2F40A 1TAUA 4IH6A 2WW4A 4DFPA 3BO3A 4QU6A 2QA2A 2W01A 2ZHBA 5LMNJ 2MHEA 2Z8QA 4V19J 2AP6A 1CC8A 1FWKA 3JSYA 2E66A 5FIIA 4OYXA 2IJRA 4R5PB 1A7GE 3G8QA 4XIUA 2D1CA 2N7CA 3QFHA 3H42A 3V6HA 4TN2A 1VFJA 3MDFA 1CEZA 4AYBD 2M0GB 1X4FA 1W25A 2QFIA 2GHPA 3RR8A 2OEJA 5D4LA 4DG1B 4FYVB 2Y1IA 2E7VA 3V4MA 4R8UB 2XMAA 4L76A 3V6DA 2EKYA 3WZ0A 2CQ1A 2YY3A 5LSRA 1RHMB 2QLFB 2XHCA 1AUDA 2V8GA 2E9ZA 2M8HA 1JNRB 1VHFA 1C1CB 1DTQB 1T9WA 5D4NA 4CO3A 4C8NA 1BQNA 5ETPA 1P1TA 4JI1J 4DL6A 1HNXF 1B0PA 1GT8A 4B3MF 1KHVA 2X1AA 1KVJA 2F5GA 4RW7A 1C4CA 4A8KA 1M5KC 5B0AA 1F5BA 1SC4B 3DDIA 3I9ZA 3IM8A 4XDCA 3H20A 1S0VA 4C11B 2EC2A 4KPCA 4IFYA 3LPYA 1CULA 4G3IA 3GMGA 4ZVQB 3HXMA 4DL5A 4C6AA 5C7PA 1K8AT 2BABA 1SI9A 1NU4A 1KR4A 4LIWA 1XMOJ 3JSMB 1TP7A 3QPIA 4HL9A 2CJXB 2MKJA 4ZVHA 4M5DB 1QJHA 1PAEX 4PG7A 3T6BA 2AGQA 4I2PA 2F8MA 4L3NA 4JI2F 3FSIA 4LFCJ 4PXBA 2QC3A 2VC1A 4HH1A 4HACB 3FBFA 4A48A 3G71S 2ZE2A 4BDPA 3LGMA 3Q8VA 5B0GA 2GFFA 4HHJA 2MMYA 2Z2MA 3GFYA 3P96A 4RBVA 1RAIB 1V3ZA 4IR1A 2HHHJ 1FTCA 1DBDA 2NZCA 3P8BB 5I3QA 4PQUA 3NNCA 3UNGC 1N52B 2HZAA 3HLUA 2FPHX 2E7WA 5I42A 2HNYA 2JHEA 4C48A 4OI0A 4A8WA 4P72A 3LPEA 3C6UB 2HGMA 4RW9B 3D0HE 3R5AA 3QIDA 4ECWA 4ZN3A 4CCHA 5B0FA 3PFEA 3LGHA 2RRNA 3CSKA 3HM9A 2JFDA 3S8SA 4ZPWR 5KFVA 3KUHA 1Y0HA 4DSEA 3RB0A 5F8LA 5B7WA 2BZ2A 1LNQA 2U1AA 4P71A 4X4SA 2G0CA 1DAXA 2YKPA 3BSCA 4AXIA 4JI6J 3W2WB 3FFIB 4ELTA 2DNKA 3HJVA 2DR5A 1VJQA 1ACMB 4QYRA 2HG4A 4ATNA 1YVFA 3P5BP 4O23A 2JOQA 1U8SA 4DL0C 4CLKA 4WYWA 1NK0A 1RZMA 4RU2A 5DDPC 1FTRA 4LSLA 2LXFA 4KV8B 3DHWC 5ETOA 3GILA 2NXCA 3P3DA 4I6WA 2V9KA 4UUWA 1FRKA 2GGPB 2HPUA 4Q2MA 3NY0A 3F73A 1FVQA 1S6PA 1ZS6A 3DU6A 3BYPA 4I6AA 3KDOA 3D6HB 2VQFF 1YJRA 3RAMA 1KC8T 4ZHRA 4DPXA 1VBZA 2XSJB 2RAQA 2HEKA 3E3XA 4QIFA 3HFVA 5GVQA 4TLQA 3PKMA 2H4YB 2B0GA 1V5VA 4PEOA 1AXQA 1HW9A 2YNIA 4KGZB 1T95A 2XB2D 4AD6A 2VC0A 4R0JA 2XZTB 4ILLA 3LUYA 4Z7YA 1VGYA 3UR3C 4LRCA 4NLXA 5HJYA 1U02A 3QZ7A 4G1IA 3SI8A 2FJEB 1RT1A 3IM9A 1S4FA 1IQZA 3NOGA 3H5YA 5A2QY 4K8RA 3GYNA 4KC5A 1RWKB 4DF4A 1FA0A 1H2TZ 1WOPA 1U48A 4J9RA 2IIHA 1U45A 1PSDA 2IMWP 2UU9J 4C4WA 1RAAB 1ZM3A 4F04B 2FDNA 3G6XA 1TKDA 2CPEA 1FKAF 2UV8A 3EXCX 2BA9A 4NXMF 1JXVA 5D4PA 1FXLA 5HQLA 3ONQA 2V6AA 1W26A 3MECA 3AHPA 1HMVA 3D1QA 3CJTA 1IBKJ 3PRBA 1XNRJ 3OJSA 1XN9A 3MCSA 3SCJE 3QO9A 3NS5A 2DK2A 1V3SA 1TTHB 2NCKL 2JVRA 2MY7A 3BDEA 2XY6A 1RP5A 3SXLA 4DN9A 3PRDA 2BJ8A 4EGLA 1D09B 2E5LJ 2VF3A 4P52A 1EKRA 2P2CB 3NCRA 4F7VA 4DPTA 2JC0A 2PE8A 5KFTA 1QAXA 2E1PA 3PX0A 1O5JA 1FDBA 1GTEA 4WU2A 4WFBQ 3NKYA 1JLAB 3N6MA 1J5EJ 3CJQA 1IBLF 2VBYA 5LSLA 4ZDNA 2DXFA 1VBYA 3GLJA 2R8KA 3CJ0A 3E01B 1TL1B 3H59A 1S6OA 4RW8B 1YRXA 4KQZA 4P75A 1X7VA 1KNZA 4X84A 4WE1A 4C0BA 1RT4A 4FS2A 4FF1A 3GIMA 1NJIT 3DRPB 5KTQA 4IUFA 2K7JA 3TUIC 2BV3A 3W2VA 1XR5A 3MR7A 4P6QA 1TL7A 2P9EA 1RAHB 2CJYB 1Y3JA 2HAFA 2IAJA 5HMXA 2EK6A 3L3CA 1L5UA 1TU0B 3TANA 1OMSA 4U7UK 1S7IA 3MM7A 4WJBA 3OSPA 1JB0C 2PO4A 4KSEB 1HNIA 4J9OA 3R7NB 3PIPQ 5K14A 5J1EA 4N41A 2VKZG 3N5FA 2FGCA 2LQ5A 5E0OA 3EZ5A 1ZETA 2AV5A 4DZ6A 5LMUJ 3PYEA 4KHPF 1VC6A 2D7SA 4FYXB 3V6DB 4B9LA 3UN3A 3NCQA 1WJ9A 5ETTA 4CRJA 2F7VA 2V0NA 1HWKA 2IDEA 2NXEA 3FRZA 3PO5A 2GAHC 2U2FA 5ETMA 1RK8A 3BQ0A 4BHQA 1WSVA 2YKQA 4JI5J 1K44A 4RUCA 3HVWA 4EO8A 1I1GA 4ED6A 3WIUA 2HQFA 1H72C 1RTJA 1VBKA 2MQOA 2HVDA 3FZBA 2WSFC 1X5PA 4QYZJ 2ZOFA 3B4DA 2C2DA 2VJUA 3LA0A 1QTMA 4RW7B 1VCTA 5GMKa 2KM8B 4CP5A 5EDWA 2DNOA 2AGPA 2Q6CA 1X4GA 4IFYB 4B3RF 3SCKE 4ED1A 1CULB 2R8GA 4B9UA 3TW0A 2IDLA 3NS7B 4HVZA 2CG8A 2ASYA 2JNJA 3FCVA 5B08A 4Z7CA 4X66F 4U96A 3ENVA 5DGAA 5HVFA 2XWXA 3UPFA 2ATCB 4MTPA 4IO1A 2EKNA 4I2PB 3HSJA 1PIEA 3MI7X 3RGIA 2UUTA 3TR5A 1SIZA 1IBCB 4IRDA 2ZE2B 1SJFA 4YP3A 2XGPA 3EICA 3HHLC 3UD3P 4F4AA 1LWCA 3HI9A 3C3LA 4BLGA 4LFBJ 2MQNA 2R2RA 3J7YU 1TK8A 4GKJF 5HMWA 5FLXU 1NKEA 2GS8A 4NLYA 4L3KA 2C2OB 4MK8A 3SV4A 4J9VA 1N0VC 4DJBA 3QT6A 1RT2A 2CFXA 1VQ4S 3U27A 4PQUB 1ITPA 1H7WA 2KJVA 5D3GA 2CNLB 1VRQC 3HFKA 5I42B 2HNYB 3W9HA 1S6QA 2KT3A 3MXHP 4NWBA 4B9NA 2NS1B 2W2NP 2FY8A 2QLJB 3W66A 1F3VA 2QLBB 3IBWA 5J1PA 1IJFB 1SB6A 1S4EA 5BJRA 4KBIA 4PUOA 3PCOB 2C2KB 2GIQA 3BGUA 4K2XA 4C8YA 3MEGA 3TUJC 3DDNA 3RRKA 1NZ8A 5AXLA 3N6LA 1B99A 4A8SA 1S0MA 3LP0A 2LEPA 1PJ7A 2LLZA 3LTOA 5B0CA 2DR8A 2IFXA 2MQMA 1QVFR 3PTWA 2B56A 3TO8A 2ZH2A 3GSDA 4H4KA 4D3GA 3OLAA 3ZZUA 2XWYA 3BH7B 1OWXA 3EVWA 3H2UB 4UY85 1X4HA 3NWRA 3A4TA 3R6GB 4LSLB 4ECQA 3MM8A 5G0RA 1HIYA 2XC9A 5C42A 1GMVA 2WSEC 2C1EB 3JTOA 4CM0A 5IZHA 1M5SA 4U8VA 1S6PB 4LQ9A 1HI1A 3A8JA 2EEYA 3FDSA 1HWUA 4DR4J 3IN5A 2WB1D 2C2EA 1U47A 2RUGA 4LRAA 4ZHRB 3CJKA 2OHDA 2W8LA 3U1NA 2LEBA 5EWFA 5IM0A 5F8NA 2CXEA 2FHOB 1IJEB 3VAKA 4F0MA 2A0FB 2W9CA 3HHEA 1KLNA 4ETXA 3EGNA 2M5YA 2YNIB 3GYXB 1YWXA 3K5MA 2B43A 2Y1JA 4YOEA 1KP6A 2WVCA 3SSSA 4PYAA 1RCOB 1KLMB 1V6HA 1RT1B 3MM9A 4EEYA 3UI3A 3CDEA 4S0MA 4DU8A 1VOMA 1Q53A 3PX4A 4NZ7A 4HR2A 3T5JA 3FBEA 4FBUA 5KFZA 2EFQA 2Z4PA 2DBBA 3TAMA 1EARA 4KT0C 3TWZA 4MYUA 4USTA 2M2BA 3M32A 3IWXA 2R8JA 4FYDA 3VAJA 1R3NA 2J9DE 4ZJQA 2C2MB 2YPZA 4RKUC 2I0XA 2KXFA 3EZUA 5KFRA 1CBKA 1LW2A 1WSRA 2DB1A 3HHKA 1F5AA 1JQGA 3MMBA 3R9LA 4ALZA 3KJQB 4ID5A 3NWGA 3MECB 4U67Q 2HHTA 2QO3A 2OSQA 3IGVA 3HFZB 1N34J 4O0NA 1HMVB 2DRDA 2JVOA 1UA1A 2DNHA 2VB6A 4F25A 2MQLA 1WTFA 2OMOA 4JI1F 3U1LA 1IWGA 4UW2A 3QO9B 3NAHA 2FZCB 2OD6A 2NR0A 4OI3A 3RBXA 2MJUA 4YB5A 2ZUAA 3EZOA 3PYFA 3DOLA 2IYGA 3M8YA 4NXNJ 2RQCA 3A8KA 1X4CA 2P5VA 3R5JB 3JQKA 2GHVC 4E98A 3MTKA 4L75A 1XMOF 2V8VA 2ILYA 4DXLA 3Q89A 3IWNC 2AEJA 3R3TA 5J2NA 2WVFA 4G1QA 2CNNB 1FJ7A 1EJ7L 1U1RA 4DV0J 4LFCF 2HRYA 2J0XA 4I68A 1LK5A 1XR7A 5CD4H 5DLFA 4QU7A 1RWPB 1UEVA 4M5NA 5F0UA 3TJ8A 4WE1B 4DCPB 3VAHA 1LXJA 1RT4B 3KK3A 1F6TA 3DLHA 5DRKA 2HHHF 4OZNA 2FVRA 5D0GA 4DR7J 3W2VB 2EFOA 2O3DA 1HHQA 3KG4A 4JI7J 2MXYA 2PIIA 1FJGJ 3KHRA 1TL7B 4EZ9A 2IAJB 2CYYA 3R97A 2QJ3A 2B3TB 2V67A 3MM7B 2Z0GA 1HNWJ 4F3QA 3TAQA 3LALA 1HNIB 2GQQA 2HQ3A 2F8EX 4OZ1A 5K14B 4CNYA 1T11A 1RWWB 3L4BC 4NLQA 5J1EB 2C3OA 1YG0A 4C0HA 5F8GA 1Q78A 2Z2LA 5EHHA 4EBCA 4FYWB 2AGOA 1Q1KA 4QBUA 1Q7LB 2DY1A 3QAUA 3RAQA 4C3KA 3CDWA 4USHA 4ED2A 5K8PA 1YJ9S 4I67A 1T05A 4NLDA 4RUHA 4JI6F 4Z37A 2IM3A 5E3RA 4ZLPA 5J2PA 3L7OA 1HA1A 1EX8A 5CH7B 4DOZA 4CH1A 2D3OR 3H4BA 3LOUA 3IP0A 4C97A 3ZZYA 1RE1B 5H9EJ 3KWMA 3F56A 2CDQA 4QIGA 5KFCA 4HH0A 3JS9A 4URGA 2FJWA 5D0RA 1RTJB 4TVAB 4USIA 3W5YA 5KFYA 4UF4A 1P9YA 2DNGA 1EP4A 2DGVA 3J81Y 1KOHA 1H98A 2KYZA 4DR3F 3W8PA 4QCLA 3T9NA 3JAMY 2HHPA 2MGZA 2BM0A 1BWVA 2CPDA 4LF5F 2XY5A 1X4DA 4MKYA 4DCJB 3EVMA 5D15A 1URNA 5A0YA 1U6ZA 4PG5A 5CAAA 2MYFA 3K8WA 4TQRA 2OPQA 2K8GA 4JV5J 2R7RA 3D2WA 1X31C 4WP3A 3GJRB 4IRCA 1NSQA 3EDRB 1FE4A 4IRKA 1VQKS 4KYZA 4I1TA 3VGVA 2BBEA 3NGTA 4K4YA 4ZS6A 4OZ2A 1RA6A 2VV5A 2PFFB 1LWCB 5IC4B 3AD8C 2W9BA 4GRSA 1H0HB 4DR1J 4C3MA 4OX9J 1Q81T 2SXLA 4ZPBA 5AJ3J 3GE9A 5HVHA 2M70A 1RT2B 4OV6A 4PXEA 3CD5A 1TELA 3HDSA 3HHDA 4YQWA 3J80U 3DC2A 5D3GB 2UU9F 2I9SA 1S6QB 1L3SA 3MZIA 2XMMA 3H8YA 3NMAA 3GCXP 2IVYA 3CJ2A 4UQGA 1AZSA 4NYZA 2QV6A 1S1WA 4JI0J 2FVQA 3BBFA 5KFSA 2WONA 3MWBA 1TMMA 3G4SS 4PUOB 2CVIA 2ZNYA 1IBKF 3MEGB 2B4UA 2GMHA 1XNRF 4CLWA 3SCIE 4DUTA 3S1TA 3RRHA 2HFZA 3EWGA 9RUBA 1OS5A 1VK8A 2B8QA 3AJ2A 3LP0B 4KHMA 5THWA 4J9PA 1UKUA 4NLPA 2E5LF 4DR6F 3M2RA 1HNVA 4M95A 1AB8A 2PMHA 2KT5A 1B3TA 1H7XA 3DLKA 3TUZC 4KR0B 3KLEA 1RACB 3BKFA 3FBCA 1YLXA 2CQDA 4F02A 4E2FB 2UUCJ 2LP4A 3MM8B 1JWWA 5G0RB 4N76A 3MM5A 2HHUA 5B0BA 3PIOQ 3NAIA 2NPFA 4WFNQ 2VICA 4DSIA 2MZJA 1WF1A 5C42B 2A6OA 2XLIA 2C28A 2HK3A 1J5EF 3I0RA 2GQ2A 3UCGA 2W24A 3HKWA 2M88A 3FEXB 2ZBPA 1TMJA 5M2PA 4HHUA 1WF2A 2ASLA 5KFGA 4YDDB 3CJKB 2IPOB 1UW9A 3KTQA 2AYMA 1WEXA 2KXNB 5IXUA 5IM0B 3G6ES 2ZC4A
chains in the Genus database with same CATH topology
4C8LA 2RJZA 4NZ0A 4CIOA 5C24B 1YJNS 4NCBA 2F40A 4W92B 2KFNA 4FPRA 1R27B 1TAUA 4B3SF 4IH6A 2JEFA 1O51A 2RF2A 2L9DA 2W9CB 4DFPA 3BO3A 4KAIA 2QA2A 1S10A 4QU6A 3BN7A 2ZH6A 2AX0A 1QSYA 4TKTA 2DHSA 4CH0S 2ZHBA 2MHEA 1S9GA 3H5SA 1FRHA 2Z8QA 1TV6B 4V19J 4QPXA 2AP6A 3ICLA 1CC8A 2J7WA 1UVLA 3MPVA 3MD1A 3JSYA 2G1DA 2E66A 2ZC3A 3M2RB 1KQSR 5FIIA 3RTVA 5F8JA 2RDIA 5CQGA 4ES3A 1S9FA 4R5PB 1A7GE 3G8QA 4XIUA 5MLCV 3IRWP 2D1CA 2N7CA 1Y5IB 2IM0A 4WK1A 3V6HA 3CCSS 4TN2A 1VFJA 3MM9B 2KFZA 3GB0A 2R4FA 3MDFA 2PD1A 1CEZA 3I0SB 4C9DA 4QR1A 3M8RA 4QWDA 2YH1A 1LWEA 2KZZA 1R8PA 1R6YA 3MMCA 4AYBD 2M0GB 1X4FA 1F60B 1VBXA 1W25A 1HBMA 3PFOA 3CJ5A 2EBGA 2GHPA 3RR8A 2FVCA 5A8KA 5D4LA 4DG1B 5F8IA 2Y1IA 3OTBA 4X4NA 2MSSA 4HKQA 3V4MA 2BXJA 4R8UB 5HP1A 1FEHA 5A8WA 2CPXA 5EX0A 2ZH8A 3M30A 1R8AA 1OIAA 2MZTA 3SFUA 3TAMB 2HQIA 3KYLA 2YWEA 3Q8PB 3OL6A 2EKYA 3WZ0A 3V6DA 1WTBA 2CQ1A 2YY3A 5LSRA 2YX1A 4ED8A 3Q8QB 2BE2B 5U47A 2VG7B 4KB7A 4DHVA 4WFAQ 1AUDA 3IA0A 4DUZF 2QSWA 2V8GA 2E9ZA 3FSXA 3M32B 2YH0A 2M8HA 2N4DA 1JNRB 3PEJA 1VHFA 4K5SA 3KNAA 4HTIA 1C1CB 4CTAA 3G8TA 1RT6A 4D3HA 2CG4A 2ERRA 5M2RA 2XGQA 4TYAA 3IGNA 5A8RA 4F4WA 2J7UA 1DTQB 4IKAA 3QZ8A 3LF0A 5D4NA 1MMNA 4CO3A 3ISNC 1FRMA 1BQMA 5C25A 4C8NA 1BQNA 1LW2B 5LMUF 5H1SV 1U7LA 3TVKA 2DGQA 1P1TA 3DOKA 2JZ5A 4IFVB 3H40A 4LMZA 1QLNA 1SIWB 5GADI 2B5JB 2VUGA 5K8MA 5AXMA 4DL6A 1VI7A 3NG8A 2BANB 1Q8IA 3N9UC 2AJ0A 3QIPA 4J9KA 3MMBB 1T02A 1LXNA 4MIAA 2GQCA 4BC7A 1HD1A 1HNXF 1B0PA 1GT8A 2MKCA 2OFGX 4B3MF 1REVA 1KHVA 1IKVA 4TY8B 2X1AA 4ID5B 5J2MA 2DGSA 2JJ4D 2WOMB 1NH7A 4X4QA 1HHSA 4IOAQ 1KVJA 3JSRA 4F3OA 3K59A 4HTJA 3HJFA 2O01C 5BYRA 3JYTA 1FHTA 1TVRB 2F9DA 3RYLA 4YFUA 4RW7A 2DVIA 1C4CA 1FK9A 3C66A 4JI5F 1DHMA 4A8KA 4MMOA 1M5KC 5B0AA 1F5BA 4ZMMA 1N6QA 2BJEA 3K58A 2E5JA 4ZVEA 2LQ9A 1T94A 5EGYA 3I9ZA 2VBZA 4XDCA 2OTLS 3C6TA 3H20A 1S0VA 1O0PA 3VTIA 4PXCA 4C11B 1TUVA 2OPSA 3C8YA 3T1YF 3J7ZT 4IFYA 4RX6A 3LPYA 3BQ1A 3H5UA 5CZXA 4J9MA 2RU3A 4G3IA 2XY7A 1YI2S 3GMGA 3DXSX 1YTYA 2ZD1A 3HXMA 4DL5A 2XMWA 1K8AT 3SDEB 4Y65A 4WXOA 5KG4A 4WZQA 3TA0A 2BABA 2VPYB 1SI9A 3TOQA 1NU4A 1UFLA 1KR4A 2YKMB 3KHHA 4MJKA 2N3OA 2ZH7A 3DRYA 3M1VA 4LIWA 1DRZA 3JSMB 1MWZA 1TP7A 3QPIA 2ZZMA 3AB4B 4HL9A 2MKJA 2FVSA 3DOLB 1YBAA 4ZVHA 1HQUB 4ZCMA 2LKZA 4M5DB 1QJHA 2KI2A 4WFXA 4DN0A 5E7OB 1PC4A 2FUG9 4TU9A 2RE1A 1YSJA 2UV8G 4QR0A 5DDQC 3FNNA 1DFDA 4WYLA 4PG7A 2LYVA 2IC3B 4U6PA 1JXLA 1X5TA 2HS3A 3T6BA 3CCWA 2AGQA 3I55S 4I2PA 4OX8A 3OVAA 3V81A 2F8MA 2LXUA 2DGOA 4L3NA 4JI2F 3FSIA 1K1SA 4PXBA 4K4TA 1L3VA 5KG0A 1SL1A 3DLEA 1KSPA 2GO9A 2KM8C 1SKSA 1BC6A 5KT3A 2DGXA 1MWYA 2VC1A 4HH1A 2UUAF 1N36F 1UVMA 4A48A 3G71S 1BQNB 1TFYA 2DISA 2CQIA 2L9WA 2ZE2A 4BDPA 3LGMA 2VODA 4FN5A 4ED0A 2RMLA 1S0NA 4X4OA 2LQJA 1RJJA 4O0IA 1Z2ZA 2J0QD 1JLBB 1FERA 4OI1A 5B0GA 2RQMA 2KHDA 5J2NB 3M05A 3LANA 1SBRA 2GFFA 4G1QB 1YHQS 4HHJA 1U24A 2F9JA 3OFHA 2MMYA 2Z2MA 4MFBB 3W7BA 5KG1A 3GFYA 3U02A 4Y0FA 3P96A 4RBVA 1CC7A 2MKKA 2BQ3A 1S76D 2ZH4A 2KVIA 2E9RX 1V3ZA 3M6VA 4IQXA 2C22A 2GCFA 4ERDA 4IDKA 1JMTA 2BRKA 2DH9A 3AA8A 1RT3A 2VG6B 4IR1A 2KG0A 1FTCA 1DBDA 5IT9Y 3UCZP 5I3QA 1R0AA 2WK4A 4PQUA 3NNCA 3FZ2A 3WX4A 2J5AA 4OZ0A 2AJQA 3UNGC 2CKWA 1N52B 3BGRA 1JLQB 3HLUA 2HMIA 2FPHX 2A1BA 1HD0A 5GAHU 2V8DA 3HVTA 3M9OB 4RW6A 2FGOA 2E7WA 1HHTP 1W2IA 4I0WA 5I42A 2OH2A 3OPKA 2HNYA 2V9WA 4A8MP 2JHEA 2KB2A 1DTTB 4DSJA 1LW0B 2L3MA 3H25A 4X4PA 3HHLA 3AAWB 3PW2A 3B4MA 4KGKA 4OI0A 3KK3B 4LFBF 4A8WA 4NA1A 5KFOA 4U9RA 4Y34A 1SV5B 4B9VA 4F3MA 3NS6A 3C6UB 2QYCA 2HGMA 1KS2A 2OTJS 4RW9B 3QGGA 1F0XA 3D0HE 3R5AA 2JX2A 1S49A 4KTQA 3UW1A 3QIDA 4ECWA 1Q7YT 4CCHA 5B0FA 2R7UA 4A8XA 6FD1A 3PFEA 1FO1A 2OMLA 3HHLD 3QGHA 4XPEA 5DQIA 5J2QA 2RRNA 3CSKA 3HVAA 1SQEA 3MAHA 5DG8A 2AX1A 4RLEA 3CMES 3HM9A 4ECUA 4B17A 2JFDA 3S8SA 4DDFA 2UZAA 4ZPWR 4OLPA 5KFVA 1E6VA 2KKHA 2ZFHA 5T7LA 2LECA 3RB3A 4BS2A 4WU3A 4DQQA 2KO1A 2XSJA 1RT7A 2OPPA 3PEHA 2H9ZA 1Y0HA 5E5NA 4DSEA 3RB0A 2CPJA 3M9MB 5F8LA 2IJNA 1OQ3A 1TL4A 4OZLA 2D9OA 3H2LA 4ZPCA 5B7WA 2BZ2A 1VLYA 1VIOA 2U1AA 4OI2A 3ZFVA 2FTRA 3DGPA 1RAJA 4DX8H 1HQEB 3M2UB 2G0CA 4X4SA 1DAXA 4OLOA 2YTCA 2YKPA 2ZOMA 3BSCA 4K4ZA 4BBYA 4AXIA 4NLRA 5E3QA 2J7KA 2DITA 2ZBIA 4RW4A 3W2WB 2YKNB 3FFIB 3FQKA 3U1MA 2J0SD 2MZSA 2XHWA 4XK8C 5CCMA 3T9ZA 2QEXS 5CA5A 4ELTA 1O8BA 2EG1A 1D8ZA 4DFJA 4IDKB 2DNKA 2X3GA 3RB4A 4AL6A 4YEAA 2YWKA 4RNOA 2QZ8A 3T1AA 2VPXB 2DR5A 3M8QB 3V6KA 1VQMS 2RH3A 2RD5C 3EX7B 3K5LA 2POKA 4QYRA 2MKHA 2FJAB 2VFRA 4B9MA 1MROA 2HG4A 4ATNA 1RTIA 1YVFA 2HIQA 2HHXA 3N79A 4LFAF 4O23A 2H5EA 2HWTA 4HYKA 2JOQA 4K4XA 2B6AA 3MMJA 2F3JA 1U8SA 4DL0C 2CQ2A 4WYWA 1H3DA 1NK0A 1T05B 3LO3A 4RU2A 1F5CA 1FTRA 3NP5A 4LSLA 2LXFA 5KFDA 4AFFA 5DDPC 1TFWA 2HVHA 1F2GA 3DRSA 3LP2B 4O3SA 1E6YB 4KV8B 1IN0A 1KOOA 3DHWC 3A8EA 3GILA 3UD4P 3FJ2A 3P3DA 2DCUB 2C3UA 4I6WA 1ZH5A 2V9KA 4HDGA 4UUWA 5J2PB 1FRKA 4ITSA 2I5JB 4TU7A 4B02A 2GGPB 5GAEU 2HPUA 2CJKA 2R7WA 2DNPA 4Q2MA 3PW7A 3OJUA 2FHJA 1S9EB 3F73A 1FVQA 2E29A 4N8OA 1U2RA 4MH8A 1NH8A 4B3OA 1S6PA 4XO0A 2NYIA 5F3ZA 2VZ9A 2IVFB 3DU6A 1LWFA 4Y2MA 2CPHA 2Q79A 2FVPA 1LV5A 4I6AA 3UDCA 4DL7A 3MR3A 1IKXB 1UAWA 2NPIA 3DXBA 2P9CA 1FRLA 4A46A 1G7CB 4CO0A 1YJRA 2VQFF 3RAMA 1M90T 2JEGA 1KC8T 4TU8A 1UW4A 4YUDA 4KFBA 3PACA 4ZHRA 1HW8A 2XG8A 1HPZA 2APOA 2FHJD 2XSJB 3T6JA 1VBZA 2E7XA 2PI5A 2FJBB 4ZOSA 5KFJA 2QA4S 4ZP9A 2CJBA 3I82A 4DF8A 1DQ9A 2GC8A 5AXNA 3E3XA 1EP4B 4QIFA 3LH2S 2FJDB 1TKTA 4I56A 2X51A 4JI0F 2DNRA 1JLFA 3CD0A 5GVQA 4TLQA 3K57A 4FF2A 3PW0A 3PKMA 1JJ2R 2Q43A 2B0GA 2WCXA 1BGXT 2YWFA 1KD1T 3J7YI 1XK8A 4CQ1A 1AXQA 1HW9A 2EFVA 2YNIA 3L7PA 4ZK7M 4DR4F 1T95A 1QVGR 3VAGA 2XB2D 2HHWA 3M6XA 1S1TA 2VC0A 5KOXA 4R0JA 4QIWD 2OIHA 4ILLA 2K3KA 3LUYA 2MGZB 1U26A 1VGYA 3BN4A 1HI8A 2RQKA 1WD6A 3UR3C 4NLXA 2MKSA 2HGNA 4PRFA 3OFEA 1JLCA 1NJXA 2CJAA 1SH2A 3QZ7A 1CQNA 4G1IA 4A8OA 2ZH3A 4AL7A 3R27A 1ZBTA 3IRXA 4IOCQ 5A0YB 3CIMA 3SI8A 1TZ0A 1RT1A 2FJEB 1KQFB 1ZZFA 2DHXA 1N5YB 1S4FA 1IQZA 3H5YA 5AE3A 4DMZA 5A2QY 1X4EA 2GMLA 2OP5A 3GYNA 5EN1A 1V9OA 5HROA 4KC5A 4A4JA 2OPQB 2M9KA 4OL8A 4DF4A 1N5QA 1FA0A 5IQ6A 4LUBA 3T5LA 1H2TZ 4PR6A 2JLFA 4EBEA 1UFWA 2G4BA 5D77A 1VQ9S 3POTA 3GR0A 2YNGB 4XAKA 4ECSA 2KTQA 2KG1A 3Q23A 4DV1F 5DM6Q 4LF8F 1M5VC 1NJZA 1U48A 2YVSA 3I5AA 2R7TA 2RT3A 4QWAA 2QIFA 1H2UX 1HWIA 3FSYA 1ZM2A 2QLXA 4J9RA 2AYGA 2Q3PA 4ED3A 2YNFA 1NHUA 4KKOB 1QE1B 4Y00A 3I5BA 1U45A 1JKHA 4ECRA 1YQHA 1X0PA 3BQ2A 2E9TA 1PSDA 1U1LA 2IMWP 5HLFA 2P9GA 2PA3A 2R7QA 1YIJS 4C4WA 4DQRA 2DNYA 2W9BB 3KJVB 1ZM3A 2QSFA 2A18A 2FDNA 3G6XA 1TKDA 2RB7A 2UXDF 3MM6A 2CPEA 1GXTA 1K0VA 3MAQA 1FKAF 1QAIA 3DDKA 2L08A 4PQAA 4NLSA 2UV8A 1ZTWA 1TKTB 2A3JA 2BA9A 2FIUA 3DNCA 3EXCX 3MURP 4NXMF 3AQPA 4LF4F 5D4PA 2EFGA 1CVJA 4K4WA 2C3MA 3UWTA 3B78A 1FXLA 3CCLS 4Q43A 3L95X 3NNHA 2ZDPA 3ONQA 1SUQA 3CD7A 4FZVA 3QWPA 2VG5A 3QGIA 1IKYA 3MECA 3CCZA 1Y9OA 1FKOB 3AHPA 2J0WA 5KFLA 1LOUA 4DPOA 5KFNA 3TNVA 1HMVA 4OIXA 1R89A 4OI6A 3QWUA 3D1QA 4PG8A 3KK1A 1JX4A 2FC8A 2V5HG 1APSA 3PRBA 2CPZA 1JLGA 3OJSA 1RYRA 1XN9A 3IC1A 5F41A 3GIIA 3W3SA 3GV5B 3MCSA 3SMZA 4O4RA 4OHXA 3T19A 1GH8A 1TL1A 4AL5A 3SCJE 3FMWA 6FDRA 4Y3CA 2ZHAA 3ITHB 3QO9A 3NS5A 1MNEA 1FEEA 1TL3B 1S1WB 2DK2A 2JRSA 2D3UA 3RU0A 2G13A 3OHBA 4IQMA 5LMNF 1M1KT 2V2KA 1V3SA 3X3UA 1IM4A 3TYTA 2WONB 4TY9A 1R8HA 2JVRA 2MY7A 3BDEA 5E3AA 3OTOF 3QYYA 1RP5A 3SXLA 3KLVA 4F67A 4DN9A 4DR5F 2XY6A 4C8OA 1S48A 1G1XA 3CDUA 2PDAA 3PRDA 2W8KA 4EGLA 1TKZB 3MEDA 5JVGQ 1Q86T 5JJBA 4A47A 1Z2LA 1OO0B 1N34F 1B0VA 4DQIA 2IRUA 1VRUA 1PC5A 2CQ0A 1X4AA 2O5DA 3G9CA 1KQGB 2FJXA 2HW3A 2FD2A 4I2QA 2JH3A 3NCRA 3SQGA 5DETA 2AJFE 2OPRA 3MOZA 2JC0A 2R2UA 5HN0A 2PE8A 1D9FA 2HNDA 3UDLA 1WNEA 1XC9A 1X8DA 1GAOA 5KFTA 1QAXA 2DH8A</