3LW5C

Improved model of plant photosystem i
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
81
structure length
81
Chain Sequence
MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWGGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure determination and improved model of plant photosystem I
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
total genus 3
structure length 81
sequence length 81
ec nomenclature ec 1.97.1.12: Photosystem I.
pdb deposition date 2010-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF14697 Fer4_21 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lw5C00
1VJWA 1PC5A 2WB1D 1IR0A 1H7WA 1F2GA 1Y4ZB 1SIZA 2FGOA 2WSEC 5BYQA 2VPXB 1FEHA 1WTFA 3MM5A 2GMJA 3OR1A 3MM9A 1G3OA 3PNIA 2PMZD 3C8YA 1FRIA 3MMBA 1GTEA 1FXDA 1H98A 3MMAB 3LW5C 3IR6B 4CI0B 4KT0C 1K0TA 1F5CA 2FJEB 3MMCA 1FRKA 5FD1A 5BYRA 1FRXA 7FD1A 1F5BA 1FRMA 1FRLA 1KEKA 1DURA 1Y5NB 2UZAA 2VPZB 2FJAB 1FTCA 2XSJA 1DAXA 1AXQA 1FDNA 1FERA 2IVFB 4ID8A 4XDDA 2ZVSA 2C3YA 5CHCB 1SIWB 2V4JB 4L6V3 3MM8A 3GYXB 3MM7B 2VKRA 5BYSA 6FD1A 2PDAA 3MM6A 4AYBD 1G6BA 5E7OB 3OR2A 2VPWB 4OMFG 1HFEL 1FDAA 1R27B 2C3OA 1KQFB 1Y5IB 2C3MA 1PC4A 2FJBB 6FDRA 1B0TA 2PA8D 2WAQD 2O01C 1H0HB 1FDDA 1FDBA 1JNZB 1Q16B 3MM5B 1FCAA 1A6LA 2C3PA 3OR1B 3MM9B 1B0VA 4YDDB 4XK8C 3MMBB 2Y0SD 1BWEA 1BC6A 2C42A 3EXYA 4DHVA 1XERA 1GAOA 7FDRA 1FF2A 3MMAA 2WSFC 4XDCA 1GTHA 2FDNA 2XSJB 3MMCB 2V2KA 1KQGB 1FXRA 4OV1A 1BLUA 1H7XA 2FD2A 2V4JA 1FD2A 3MM8B 1D3WA 4RKUC 5L8RC 2C3UA 3HKZD 2GMHA 3IR7B 3OR2B 2Z8QA 1FRHA 1DFDA 2WSCC 1BQXA 1JB0C 1B0PA 1IQZA 3MM7A 1CLFA 3IR5B 3EGWB 1Y5LB 3EUNA 1SJ1A 3MM6B 1C4CA 1JNRB 1RGVA 5CH7B 1C4AA 2VPYB 1GT8A 1FRJA 4Y28C 2FJDB 1ROFA 1BD6A
chains in the Genus database with same CATH superfamily
1Y10A 3GJSB 3MECB 4FNHA 2QA4G 4ZVRB 5D4PA 1TL3B 3V2UC 4QR0A 2COLA 4O4RA 4I64A 1RZMA 3ZTQA 1HW9A 2XM3A 2HVDA 2VG6A 2VPXB 3GG0A 1M1HA 1NBEB 2GIFA 1VOMA 3I87A 4FVMA 2JLFA 5K14B 4WU3A 3EM1A 5CYMB 3OR1A 1VQNS 4FYYB 4F0MA 2IAJA 2XCAA 3CXCR 1N36J 1Q8BA 2ZKUA 3CCLS 1JX4A 1VIOA 2R7SA 1WG4A 2UU9J 5KTQA 4LF7F 1N5SA 4MT1A 3D3BJ 4TQSA 3R1HA 4D3GA 2FQQB 4CI0B 4K4WA 4NLRA 1L5UA 3NLCA 3PEHA 3L09A 1IJFB 1Q8KA 4ZVHA 2EKNA 1RA6A 4JI7J 2FUG9 3CT9A 4DX8H 3QWUA 5BR8J 1HYSA 1K1QA 3HLUA 2IA0A 2A10A 1OMSA 4E8UA 4QYZJ 3PXGa 1S1XA 3RW7A 4Z7CA 2GJIA 1T05A 2DPJA 1S0VA 1Q4RA 1UVKA 3THTA 4ITSA 4QZVB 1AT1B 1NB2A 4JUZA 1QAXA 1Q7LB 4WP3A 3RZAA 3H90A 4NLOA 2N7CA 4B9LA 2ZJQQ 1GNKA 2LU2A 2CG4A 4ZPCA 4L6V3 3H25A 4OZ2A 2IJFA 3GPAA 1UWBA 4UQTA 4QR2A 3DC2A 3ZNUA 1FXLA 2L48A 3MM6A 4NPOA 4DPWA 1RK8A 3RBEA 4LRCA 4ZITA 3UVJA 1QSYA 4HI2A 5ETRA 4E0DA 3ISNC 3PRVA 2RMLA 3LAKA 4M5KA 1LV5A 4YS2A 2W8KA 1XNRJ 5AXMA 2F65A 3K5OA 4X4PA 2W2NP 4Q7AA 3PHTA 1S4EA 3BF4A 3QO9B 3OV7A 2IMWP 2MGZB 3DHXA 1S79A 3CJSA 2IY5B 1RUSA 2EBGA 2DGUA 4QYRA 2D3OR 2KM8C 2FZGB 4TY8B 2R8KA 2NR0A 3CCJS 4ED5A 1WSRA 3DDKA 2NQPA 1FJGF 2Z0GA 1XNRF 2AGQA 2CXEA 2Z2ZA 4B9UA 1BGXT 3QYYA 5F8HA 2LECA 1WKLA 1MG7A 2OUGA 1GMUA 2CKWA 2O5DA 2X1BA 3EMTA 5F8GA 1NKCA 3CDBA 1RHUB 4ECQA 2BJ3A 4MYTA 4C0BA 3GILA 5B08A 5D0GA 1KP6A 3MCNA 1YJ7A 5G0RA 2AJ2A 4QIWD 4CH7A 1I51B 1FKAF 1NLKL 4KPCA 3B82A 3M2UA 1S6PA 1HHSA 2P9GA 2XMTA 3HVWA 4O0NA 1FJEB 2BKNA 1IKVA 1Z2ZA 2E1AA 2POKA 5J1EB 2OPPA 5KFQA 3OUYB 1G1XA 2ZH6A 1RI7A 2FC9A 1RBOB 2E5LF 2BE9B 2DTJA 1GTHA 2ZJPQ 3RR8A 1HHQA 4ZP8A 2X1GA 3I4HX 3LA0A 2QA4S 1M5HA 4RL1A 4F4WA 4ECXA 3FFIA 3FBBA 3ICLA 4OYWA 5ADZA 2OFGX 3CJ0A 4HTIA 2BXJA 1D3WA 4OZ0A 2E5HA 3UD4P 1TK5A 1S0MA 2XMJA 2XS5A 3H5YA 1XMOF 2W4CA 3THVA 1REVA 3KK1A 2ZH2A 4ZPBA 1M90T 1X4EA 2GJFA 5LXYA 2OLWA 2VDHA 1D1UA 1X5SA 1S99A 5E3QA 1Y5LB 1LK5A 3ETMA 3GJRB 2ZE2B 4W98A 2FHOB 5KFWA 1X0PA 3OXLA 5CH7B 3WDOA 2X1AA 4WXOA 3IBCB 1RT6A 2K3IA 3JS9A 1NKBA 3T1AA 1HNWF 1HWKA 3X3UA 1QUVA 2X3DA 1TKZB 2HIYA 5ETQA 2IBOA 2MZRA 4FXDA 2G2ZA 3LPYA 4TYBA 4KBIA 4U8YA 4ZA1A 5ETMA 1RWKB 2AZ3A 2Z4PA 4KO0B 3KYLA 1GXTA 2JEFA 1PIEA 3AD7C 2QFIA 3M6WA 1TKXA 2ZC4A 1TV6B 1UL3A 2A2CA 2XBPA 3MR7A 3OXGA 4BC7A 1MW7A 4ZN1A 2HFNA 1JLEA 4DPYA 3MOZA 2LDYA 5LSOA 1MN9A 3HKWA 3MMBA 5HMZA 3K5MA 2W1BA 2RU9A 2XULA 2J7KA 4DCPB 1P27B 1H2TZ 5C25B 5HSPA 3TA1A 3KLIA 2JNJA 1F5CA 2CQ3A 1HNVA 4ZPTR 1C0UA 5BYRA 2MHEA 5IS2A 5F8JA 3UE2A 1J5OA 2UXDF 3TEGA 3GV7B 3TAQA 2ACMA 4JV0A 1S12A 1V9OA 4KY3A 2UZAA 2AYBA 1X60A 3N28A 4X4VA 3NY0A 2KVQE 1NK8A 2H54B 4IFYB 3JSMB 3V6HA 2O66A 2HVIA 1NH7A 3BSCA 2LXUA 2HHQA 2WBMA 2WONA 3I32A 4I2PB 4ZP6A 2EFNA 3PIPQ 3MM8A 4FXWA 1H73A 2DH7A 3GYXB 3M2RA 3MM7B 1EETB 4NYZA 1C1BB 5CXTA 3JQJA 1X9WA 1XR7A 4NCBA 2ZZNA 4CLLA 3RW6A 4ED6A 1KVKA 1Q0NA 1X4BA 1WF2A 3V6JA 2ALYB 3MHYA 1K1SA 4P6QA 2KHCA 3AY0A 3CWJA 1NK5A 2C2NA 4LQ9A 4Q44A 2KRBA 4DJBA 1KKHA 4PG7A 1QTMA 4CWBA 4OHWA 4YHHF 4M5DA 2HS3A 2HQGA 2CWKA 3FC9A 3BR9A 2J76E 2RRBA 2XS7A 2M9KA 4RX6A 3GMGA 4USUA 4GC6A 1HBMA 1FNXH 5E3PA 4USWA 4FYXB 4DG1B 4K4SA 2GQQA 2OEJA 2R7OA 4RW8A 3M6UA 2AGPA 1WDTA 2ZITA 2YNGA 3BGOP 4H4OA 4LSZB 3KLEA 1TL4A 1MMNA 5K14A 1QAYA 1SJ4P 4B17A 2XG8A 2DR6A 1SV5B 2DXDA 4TLRA 4XAKA 2B5JA 3JQKA 1J27A 2ROPA 5DG8A 5C24A 4L72B 3OT9A 5KFFA 2BMBA 2GVDB 1UW4A 4QW8A 4IOCQ 2OSRA 1EX8A 1U26A 3GP9A 1WJ9A 1JLCA 1PO6A 1KRPA 1Y11A 4DQPA 4KTQA 5IV4A 2OPQB 2KT3A 1N52B 1FWLA 2A2DA 1U02A 1R6VA 4UOCA 5D4LA 1R8CA 2RILA 4UOGA 1JLQB 3Q8VA 4KQZA 4ZCKA 2BJ1A 4K4XA 4QBUA 2CJYB 3T1YJ 1IWGA 2XHCA 3UDCA 2NREA 4RKUC 1Q95G 3R5BA 1D09B 2PO4A 1JLGB 2FVRA 2KJWA 1S59A 2CQBA 2XNQA 3UR3C 3NCPA 2Z56B 3GWCA 1AUSL 4DR7F 1CJVB 2VF3A 2VQEF 2AT1B 1SH0A 3H0PA 2G4BA 3MPDA 3D9BA 2NYIA 1OS5A 4Q2MA 4X4UA 2GHVC 2AEJA 2YNIB 2HAFA 4NXNJ 5FJ4A 2LFVA 1TP7A 2UP1A 1UVNA 4EK2A 2MEWA 2VPYB 3TI0A 4OX9J 4CM2A 1IKWA 4I6YA 2E9RX 3QSYB 1F6TA 2KFYA 5AE3A 2AX1A 3SXLA 4DV7F 1UETA 4AXIA 2DXFA 2DNQA 8ATCB 2MGZA 1T03B 1B70B 3BDEA 5A8KA 2W9CB 3FMBA 4ED1A 4B3OB 2V9WA 2XGQA 4WYWA 4X65J 3F73A 3ETOA 1NRKA 3DLGB 3FEXB 3MPWA 4CLYA 4FF3A 2CZ4A 4DL0C 4WE1A 4J9NA 3V6DB 2O1PA 2FY1A 4YEAA 3HZGA 1L3SA 4F02A 2W7OA 4H4MB 2V2VA 5A2QY 4EYIB 1GTEA 2VASA 3TUPA 4O44B 2DT9A 2MKKA 4ER8A 1EP4B 2F5GA 2OFHX 5G0RB 1N56A 1WC5A 2WW8A 3QGIA 1I6JA 5FIIA 1N54B 5D4NA 1G2EA 1S6PB 1Z4UA 5GAHU 1T9UA 2DHGA 4X2BA 2OD6A 2ATCB 2WCXA 4KGVB 3D1QA 3CUNA 1VBZA 2PMHA 5F8MA 2D3O1 2C28A 1FA0A 2V68A 2DY1A 4HT7A 8AT1B 2IJNA 2EXUA 2DRDA 5F41A 1S6QA 4ZLJA 5CCLA 3C46A 1XR6A 4PWWA 1VHFA 4MFBB 3MFIA 4FYDA 1WC6A 4OX6A 3TUJC 4CO3A 3VAJA 4BHQA 4WIQA 2IRUA 5HBMA 5KFDA 1T0TV 4GRSA 4NEZA 3U7JA 1PJ6A 4MKVA 2XQCA 3CCES 3OSPA 5RUBA 2PDAA 2YTCA 4NLSA 1SL1A 4ZPWR 5E7OB 4ECUA 1YRXA 2N7YA 3ITHA 3LTOA 3O6QA 1F1BB 1ZM2A 5L9XA 1KNZA 2MPUA 1SPBP 4OMFG 1S49A 3KLHA 1A0OB 3AA9A 4UQGA 3KJVA 2D7SA 3G2XA 3PX4A 2HHHF 2KJVA 5LOQA 2BEFA 1FD8A 1CS4A 3VQTA 5KT3A 4LBHA 1UA0A 3IRXA 2BJ8A 4JI3J 4DX7A 2FPHX 1YG0A 4P72A 5M2UA 3BKFA 3RR7A 1ZM3A 1AROP 2AYMA 1GXLA 4P2FA 4EZ6A 1S5ZA 3R9LA 5KFGA 1FK9B 3Q2TC 1AB8A 1DQAA 2ZHOA 4DPUA 1TKTA 5KG7A 3VALA 3AJDA 5J2NA 2HHSA 4GVLA 2FJXA 4NCAA 2VH7A 4LSNA 1KLNA 5KT5A 4J9SA 3QRRA 3T9NA 2AEFA 1TKXB 2K2PA 3AOAA 3UDVA 1R0AA 3JTPA 3OHBA 2JL9A 1OSCA 2ZOMA 2UV8A 4OX8A 4DPTA 3BO3A 3BGFA 4RW4A 2HKEA 3IGNA 1GAOA 3N6LA 4I69A 2ASJA 1Y3KA 1DRZA 1ELOA 2CPEA 1U8WA 2DCLA 3RU0A 5DQIA 1RQ0A 3HFVA 4DV0J 4DR2F 3IS9A 3U1MA 2B4OA 2YQ0A 1HNVB 3BBBA 4U6PA 2ZH7A 3RTVA 1IKYA 4ZLLA 2WVEA 1YBUA 4N41A 1J5OB 2GA7A 4C6AA 3BKUA 3KMQA 2GAGC 4OFZA 5K8PA 2QX0A 1SBRA 2C3UA 3LAMA 9ATCB 7AT1B 2ZD1A 4ZVOB 3KHGA 2GX8A 3IAS9 2DYAA 2Y8WA 1M1GA 2RUGA 2WONB 1X5PA 4I2PA 5HROB 4F4YA 4L74A 4PWDB 3U02A 2BQ3A 4ZS6A 4RW7B 3D54A 4R0EA 2V9KA 3MM7A 4NA1A 4NLTA 1U6ZA 1IBLJ 3GSIA 1ZBTA 2C2MB 4DV2J 3LP2B 3KLVA 2RF2A 1RGVA 1NDPA 2A3JA 1OY8A 5EX3A 1HI8A 4NE9C 4DDFA 4Q43A 2ZH9A 1NK7A 2HBRB 2D74B 2HGLA 3POTB 5GAEI 2XMKA 3RBXA 1RBLA 3KOAA 4B3RJ 4DR6F 2VG5B 4GVBA 2GO9A 4QQBA 4KGXB 4M5DB 1H7WA 4I7FB 2ZH5A 4PXDA 4NLUA 4U7CA 1RABB 2MY8A 3T19A 2R7TA 1U1RA 5BYQA 1MU2B 2F8MA 4B02A 4OZNA 5A0YA 1RE1B 3LANA 2RKIB 2IFXA 4DR6J 3UR0A 1R8AA 2LDIA 4IOBA 4C11B 3PR5B 1IXKA 2IYGA 2C2RA 1M5KC 2PSZA 5J1NA 5IT0A 3HX9A 2OEMA 1H74A 4NCGA 5F0UA 3KHLA 2R7WA 3IA0A 5G4DA 1H98A 3NKYA 1VC6A 4JI5J 4U8VA 3IM9A 3M30B 4KT0C 1MWQA 2QE5A 1Y00A 5DS7A 4LFCJ 3IG1A 5C24B 2BQUA 3GYNA 1HNWJ 3LF0A 4EUVA 2Z57B 3SMZA 3MEGA 1GH8A 2VA2A 5HVHA 3HJVA 1WEXA 1JLCB 2MY7A 3I5CA 1KWMA 2N4CA 4HLBA 2WW4A 4OYAA 2BR0A 3KHRA 4IG3B 3VQSA 1RWXB 2KYZA 1UEVA 3HD1A 4UY8T 1XJWB 2LQBA 3Q8QB 5L1LA 4JYAJ 2X51A 2ZH3A 3FMWA 5EUHA 2RS8A 3D2WA 3KUGA 3MTJA 3WC2A 1CVJA 4MH8A 2KM8B 2IVMA 2AWZA 3S01A 2V67A 2XY7A 4LF4J 2VV5A 4ENOA 1FDAA 4LIRA 5MAOA 3MAHA 2QLBB 4Y65A 1L3UA 3CC7S 1R0BG 2C3MA 4TU8A 4EI2A 1B0TA 3B6BA 4ZVFA 2MKCA 5L46A 1R8PA 2O01C 2KL8A 2K1RA 5L1JA 5J2MA 1NK0A 2EEYA 2DNGA 1CJTB 2KU7A 3AT1B 3MM5B 1RSCA 2C3PA 3NGDA 5C42A 5H9EJ 2CADA 2UUWA 4ZJOA 1KQSR 2MLYA 3MM9B 3T5HA 4NASA 2R7RA 3HSJA 1B0VA 4YDDB 1SB6A 1UCNA 5LMUJ 4OX7A 4DBQA 4EBEA 5KFVA 4K8RA 2KG1A 2UV8G 5E0OA 3BH7B 4I6WA 2IHR1 3TVZA 2HFSA 3OTDA 1W26A 4ES2A 4ED2A 3MCSA 4J5OA 4FPIA 1NDCA 4FN5A 5DG7A 2R8GA 2OMOA 2V8HA 1VJQA 1Q86T 4O44A 2AJQA 4R8UA 1RT3B 3WX8A 3CCUS 1NUEA 1RKIA 2WVDA 1REGX 1YSJA 2H3EB 5C7PA 2BABA 2DGOA 3D1HA 2V2KA 4IG0A 4DR1J 2QZ8A 2H65B 2ACYA 1IUJA 2QN6B 2NPIA 2FC8A 4LVOP 2VFSA 1VK8A 5IM0A 4ZCIA 3Q83A 1S6QB 4DFJA 1YZ7A 3JB9k 2MYFA 3MF5A 2JJ4D 5KG2A 2MB0B 2ZOGA 1ITPA 4U96A 3LH2S 2VA3A 2UUAF 1FRHA 4KKOB 3MUMP 1BQXA 2J6SA 2EKYA 1B0PA 2UVVA 1LWCB 2ZM6F 2HRYA 1HMVA 3IR5B 2BBEA 1HR0J 1FI4A 5B0BA 4RBUA 4DUZF 2I5JA 1NU4A 3NS6A 1VCTA 2FY8A 4F50A 1N0UA 1G7CB 1WDDA 3FNNA 4H54A 2E1PA 2BACA 2V5HG 4OV6A 2XGPA 2Q66A 1X4AA 1D8YA 5CYJA 4LFAF 3EVWA 1LWEA 3DLEB 3P5BP 4YOEA 2IDEA 4A8KA 1VQOS 1TL5A 4YUDA 5J2QA 4OL8A 1X4FA 2FGOA 3L7UA 3IP0A 2N3OA 3SZ2A 3QRQA 3B78A 4Y2KA 4NX9A 2R9LA 3I5AA 4IQXA 4U95A 2JEJA 3ENWA 5ETKA 2OPSB 4YB1P 1DQ8A 1R0CB 1FWPA 2P6TA 2VBWA 3BGRA 2PMWA 4X4OA 4DV4J 4FP9A 5A8WA 1TK8A 2CDQA 3FCVA 4P52A 1RWPB 1P1LA 4NYOA 3ET6A 4RBVA 4LUBA 5HMXA 2RU3A 3MWBA 2VDIA 4ETXA 4H4KC 1U1NA 2J0SD 5A76A 3M2VA 2UXCF 2FJWA 2HBZB 3ZZ0A 1IN0A 3FBFA 1VBKA 2I38A 3T9ZA 2D9OA 3M4XA 2XB2D 1ZETA 2VPZB 2F1FA 2ZZTA 5GAGU 1XMBA 2FZCB 3IS9B 5KFHA 3DLKB 5LXRA 2AX0A 3J81j 2UXBJ 3Q8SB 2HGNA 1NK9A 4ELTA 2N4DA 5A2QU 3KG0A 1SUQB 2CIMA 3SYZA 5AXLA 3C19A 4A8FA 4OLPA 3M1VB 2ZD1B 2DKOB 4B3TF 1M1KT 5CD4H 3G6XA 2ILZA 2V8DA 2HRTA 4OIXA 4YY3F 1CBKA 2G0JA 5HN0A 3LWLA 5K8OA 3V81B 4RWWA 3ZNJ1 3VAKA 1VQKS 2LEPA 1BE4A 3FRYA 1H3DA 1NSPA 1P8GA 2HZAA 4OI6A 5GADI 4AD6A 4X66F 3AXKA 3LP2A 4EFAC 4DL4A 4B9NA 5HMWA 3SSRA 3DCAA 4LFBJ 1FO1A 2ZBCA 2YWWA 2YKNB 3POTA 3QAEA 4TU7A 1VIXA 1A6LA 2WRMA 4B3SJ 2V63A 3UN2A 2VG5A 4GVBB 6AT1B 3DMJA 3MD3A 5D8HB 2C2KB 2EC2A 3H20A 1S7IA 2VL1A 4ES1A 2VFTA 1IBKF 2ZC3A 3CJ3A 1RU2A 3C66A 3OLBA 1BQNB 4JI4F 4FDFA 1HWLA 3R1LA 1YX2A 2RB7A 4DN9A 2J9CA 4ZKAA 4UY85 1RLDA 1OQ6A 4IDKB 5D3GA 3J81U 3BQ2A 5KFJA 2R7QA 1VC5A 3AXMA 2KG0A 4G6VB 1NSQA 3M9MB 3G8QA 3PTWA 3HFKA 3OL6A 2EC0A 1SC1B 2OH2A 1F9EB 1IM4A 1KLMA 3IWXA 4DEZA 2CDRB 2LA4A 2W24A 4J9PA 2CQIA 3TZZA 4B3RF 4WIIA 1RDRA 1FKPB 2YPYA 4CT8A 1VQ7S 3R5AA 1SJFA 4DL5A 3EYZA 1C1CA 3MEGB 3W1YC 2G9OA 1I5OB 1E6YB 2F40A 2VODA 1R8HA 2VUGA 2MKIA 4CLWA 1D9DA 1MROB 2FVSA 2LKZA 1XQIA 5KFZA 4LF8J 2HS4A 4FYVB 3TJ9A 3BDPA 2B9YA 4F3OA 1LKZA 3OBIA 1RADB 3TAPA 2J9DA 5CA5A 1JK9B 4JI5F 4KHPF 2L9DA 4GKJF 4LF9J 4K7QA 1GX5A 1CG2A 4LF5F 3DOKA 4IH6A 2EVZA 3SCLE 3CB4A 4JI2F 1Q5YA 1CJUA 2QSFA 1Q1KA 2J7UA 1VFJA 2ZH1A 3AA8A 3HO1A 3NOCA 2DEJA 5A8RA 4DOZA 3QNWB 3I0RA 2RQ4A 4NRUA 1RA7A 3TNVA 1T8EA 5E3AA 2YQ1A 4L3KA 2CUYA 3G86A 5E3CA 3NGUA 3R5DA 3G8TA 1KN6A 2AGOA 1IBCB 4KH1B 4P2SA 2B8PA 2CNOB 1QJHA 1UEUA 2B7CB 4I2QA 1S77D 2DY9A 4UTGA 1WTFA 3MM5A 1SKSA 1TKDA 2KXNB 3NAIA 4WU2A 4OHYA 3DKDA 2BKOA 4XTTA 3Q89A 1K8AT 2KZZA 1I3OB 3GE9A 4ZJQA 4DV3J 2YWGA 3C8YA 4Q2LA 4CT9A 4K4ZA 1Z2LA 2YQ3A 3CDAA 2EPIA 3M32B 3MMAB 1DLOB 3IR6B 3DRYA 3LW5C 1QLNA 1N36F 1I1GA 1VQ4S 2BV3A 1R31A 3IGVA 3TVKA 3JAMY 4YP3A 4JI1F 2HNZA 5B0EA 4OYOA 4O3NA 3PYDA 4EBCA 4DQIA 1RT4A 1YITS 1FFSB 2XMUA 1XMOJ 2OIHA 3J7Z5 3W5ZA 1URRA 3BB5A 1PJ7A 2BE7D 2XSJA 1AZSB 3MEEB 1FDNA 1FERA 4KPYA 3CDEA 1WACA 3N9UC 4IG0B 4DR2J 1QUPA 4M5JA 2OPRA 2MMYA 1VRUB 2IJRA 4YB7A 2EWHA 3CJKB 4DMZA 2AJ1A 4DU8A 2VQFJ 2MQPA 1GX6A 2HEKA 2Z58B 1TZ0A 4LRBA 4OQJA 3W2VB 4ALZA 3SQGA 1UZHA 2RDJA 1S0NA 2EI5A 2L08A 4B9TA 1N8RT 1MLAA 3QLHA 5JMNA 4CO0A 2HK3A 2HQ3A 3DOLA 4N7TA 1ZTTA 5HLFB 4IYQA 4LF2A 1AA1B 4C3MA 2MQNA 3IWLA 2J6TA 1RHRB 2BZ2A 3IO1A 3CJQA 2V0NA 3BO2A 2ERRA 2CQDA 4WYLA 2DGWA 2I5JB 3PKYA 2QLFB 1HW8A 1B7YB 4GMKA 1ZPWX 2B4PA 1RTDA 2PC6A 4OZJA 3BV8A 4OI0A 4TYAA 1JNZB 1IBLF 3V4IB 2KFNA 4DQQA 1X0FA 3VR1A 1GFWB 5IV3A 1LWEB 1WORA 4CTAA 2HK2A 3OFFA 4O23A 3VGTA 4G1QB 3W9IA 3ZXWA 2DR9A 2UVRA 2FHJA 1YGYA 1LQ9A 1JLFA 3BREA 3C15B 3PDNA 4XK8C 3R97A 4A8MP 2J7WA 3M8QA 1S10A 4XPCA 5HO4A 2ZBRA 2MLXA 1WEZA 1S9EB 2DIUA 2V2QA 1RHKB 4CO4A 4F3QA 2Y1JA 4KC5A 3W60A 3CDUA 2OPSA 3K17A 3OLAA 1VRTA 5DQGA 4ZMMA 3CJTA 1JKHA 1U0HA 5AE2A 5IT9U 4AFFA 2JWNA 3AB2B 1WF0A 2C2EA 3K8WA 1PBAA 5KFIA 4DZDA 3C16B 3AD9C 2QT7A 3TA2A 4PXBA 5AJ3J 2YKAA 3D68A 5HL7Q 4RNMA 3CD5A 3DXBA 2OO4A 1NSKL 3K8VA 4IQMA 3QRPA 4OV1A 1BLUA 5A6PA 2DISA 4ID5B 3GFZA 2XY6A 1L3KA 5JUMA 4UUWA 3EJMA 5ETPA 2ASLA 4JI7F 2DGVA 4D3HA 2R42A 5BR8F 2JC0A 5LSLA 5H9EK 3CDWA 2LP4A 2XZWA 3M8ZA 2FLPA 3GG1A 4CQ1A 3SFGA 5KFOA 1BWVA 4AXJA 5BXIA 4HEA9 2HW3A 2HGMA 3IXQA 5AJ3F 4LF7J 3PRBA 3QQCD 4ZVTB 4XIUA 2DIVA 3PFEA 1HQUA 1C4AA 2YBVA 5DG9A 2LVWA 1DY3A 1YJUA 3J80U 3DLJA 3MUTP 4A8QA 2I1RA 1RTZA 4FPRA 1LK7A 3JAMU 1RTHA 3SI8A 1U6BA 2KTQA 4DUYJ 1CPZA 3PG9A 4EMDA 3IC1A 5F9NA 2MXYA 1M5VC 2WOMA 2HZVA 4USJC 4Q0BB 2ZZMA 1KVJA 2V69A 2HNYB 5ITHA 5DGBA 3EDQB 4OX9F 5LJ3Y 2YWHA 4Y3CA 5CD4A 2L41A 4I4BA 1W2BR 3KLGA 3C6UB 1QTNB 3RBZA 3T5JA 3R7NB 3QFWA 4USMA 5KFLA 5HVGA 1FNMA 2EG2A 2Q6CA 2NUHA 1FRIA 1T3OA 4OJ1A 2QMWA 1LFWA 2CJ9A 5CCMA 5DZ6A 3HVRA 4FF1A 3G82B 1WWHA 2VC0A 4IDKA 3G8SA 1EKSA 2CVIA 5KFBA 3QZ7A 1VK3A 1M5SA 1OSDA 3DRXA 3LALA 1SKUB 2A0FB 3LGHA 3OD2A 3OTCA 3EPGA 2R4FA 4DV5J 1NJZA 4I0WA 1FRMA 1NK4A 1KLMB 1V3ZA 3PR4A 3TX0A 4ZN3A 3AOBA 2ABYA 1RAGB 3A1YG 3BS9A 5ETOA 4DLGA 1AFJA 1NK6A 2YKOA 3QT8A 4DSKA 1U6FA 4LF9F 1FFWB 1DAXA 3P3DA 4XDDA 4FS1A 1C0TB 5GAHI 3TA0A 2FHJD 4TKTA 3UFCX 1F3FA 3FUYA 2QGFB 1HLWA 3OVSA 4HHJA 1MROA 1QD1A 3W62A 3IAM9 2XMWA 3J7A1 4TU9A 3I56S 4NMLA 1S76D 4ECZA 5HK4A 4MKYA 2PT0A 5ETSA 2AD9A 2UU9F 1IM6A 1PILA 3HVTA 2DVIA 1NCLA 1OJ4A 1S9GA 4PG4A 4WK1A 2NXUA 4AE5A 3SBMA 2KXFA 3SQOP 4EYHB 2GC8A 3K7RA 3QAUA 3KNAA 2DR5A 3AFGA 2E7XA 2R7XA 1H0HB 3NG8A 2PD1A 1YWXA 3R8YA 5A8RB 2ZHAA 4FVCA 3OQ2A 2UUCF 1NDKA 2RIJA 3OJSA 2ZUAA 1B99A 3I6PA 3OR1B 4N76A 1ICEB 1WHYA 2L3MA 4QIFA 3L4BC 4WFNQ 3T5LA 3RB6A 3CCVS 2FB0A 3NMAA 1UFWA 2X3GA 3KDOA 3QGGA 2CQPA 3W9JA 1KOHA 2V4QA 2MKSA 1NJXA 1WKKA 4K0KF 1X4HA 2NPFA 1JIHA 1LWXA 2D3ZA 2IYIA 2MKJA 4OYMA 2DGTA 2K7JA 2DCUB 1U47A 2E29A 2IC3A 4I1TA 2DITA 2FVCA 2V4RA 4QWBA 2ZWOA 3KWMA 1T95A 1S1UB 3DGVA 3QGHA 2V6AA 2ZEJA 3CF5Q 1S1VA 1VQYA 3ZTPA 4ATNA 1N5TA 2FTRA 2HMIB 4FKYA 4QCLA 4X66J 4PKDB 1IR2A 5KFUA 4CH1A 1T05B 2IA6A 2B0GA 3VAHA 2ZNYA 3BYRA 1Q53A 5LM7E 4DWIA 1OY6A 3BPDA 4DI6A 4EBDA 2OKQA 3PW2A 3C6TA 2MQOA 4DV4F 2HNZB 1NJIT 2DHAA 2K7KA 4ZVGA 4QIGA 1RT4B 3NRBA 1H7XA 4YB5A 1ZYQA 4NZ0A 4M63A 2E1CA 2UUTA 3HXMA 2IDLA 2DO4A 3L95X 2JLGA 2YKQA 4PPZA 2ZBPA 2ZJRQ 1AZSA 1RXOB 2MDAA 2XMMA 4ZK7M 1FNOA 3M6VA 4J90A 3RAQA 4BS2A 3IR7B 2C2DA 3CJKA 3K5PA 1RWUA 2FGCA 5I3PA 1SKRA 4W92B 1F9FA 1VISA 3OVBA 4LFBF 3SQGB 2BJDA 2OD4A 3PW0A 2PEBA 1EARA 2JC1A 4RPFA 1N32J 3QLHB 3D1OA 2CPZA 2RS2A 3ZZZA 1U49A 3DOLB 4QU6A 1EB0A 1LFPA 1WUUA 3BEGB 1T11A 4TY8A 4XO0A 3OTOJ 3HHKA 3BO4A 1UFLA 5EWEA 5I4MA 4MAKA 1H2VZ 1L3TA 5IT9Y 2NSCA 3HHDA 1VJWA 3ZTOA 1N48A 1PC5A 3BBCA 4LREA 4K4UA 3MPYA 3BN4A 3CGIA 2QMXA 2QYGA 2F7VA 4GO5X 3ULHA 1U1KA 2FIUA 2KB2A 4A48A 1D0EA 4Y2AA 1F3VA 4C2MA 3V4IA 1LW2B 4GKKJ 5IWAF 1X8DA 1WG1A 4WXWA 3JSBA 2M8DB 3M2UB 4G1QA 1UJ5A 3RRGA 2KFZA 3C15A 3H42A 1IKVB 3D6TB 3N0VA 4GO7X 3DOMA 1U24A 2MZJA 4P71A 5U47A 4F7VA 3M8QB 4LF5J 4GKJJ 3DRRA 3UPFA 2ZH4A 1P9QC 4KGMA 1S9EA 4DCOB 1UKUA 3DLHA 5DDQC 4N5SA 4BCAA 4Z7YA 3PV8A 5EX0A 4U7UD 3BKTA 3I5BA 3M8WA 5KT2A 2I6WA 2PFFB 1KOOA 4TNOA 3NOGA 4Q5VA 1U0HB 2EK1A 3P49B 4DUZJ 5FLXU 4DQSA 2GIRA 1Y5NB 3PJ9A 4JB8B 3MOJB 3C16A 4ZIWA 1RAJA 4DSFA 1QAIA 1FJ7A 1U1LA 2EFPA 3ZZRA 3E3XA 3NEKA 2H5JB 5ETNA 5AT1B 4U67Q 3M9OB 4BBYA 4NLDA 4CO5A 2DNZA 1VRQC 1HBUA 5CHCB 1QE1A 2V34A 1VS3A 3OJUA 1RYRA 2HNDB 3NL0A 6FD1A 4NWBA 4LSLA 1APSA 2MSSA 4WTYA 2HRUA 4ED8A 5L1IA 2UUBF 5THWA 1RT6B 1WHVA 4PAAA 1NPKA 4IO1A 2XYPB 3C2PA 2W2QP 2RUSA 3LGMA 2CNLB 1PC4A 5LL6d 3V6KA 2PA8D 1MSWD 4N8NA 1B64A 2WAQD 1HD0A 1S97A 1HQUB 3SV4A 3QIPB 1W7WA 3EVMA 1CJKA 1X31C 3BN7A 4OZ5A 2R2TA 1S0OA 5DDOC 4JBCA 4LF4F 4F36A 1UPMB 2PIIA 3TO8A 3MCMA 3G6ES 2VQFF 2W4DA 2HNYA 4ZPVR 4WCEQ 3D6MB 3K2YA 2JVOA 2Y0SD 1X4GA 5CQGA 5H1SV 3KLGB 2O67A 3S7RA 1VQ5S 4FYWB 1C0UB 3EXYA 1RTIA 3U1NA 2R8IA 1YLXA 3B54A 1TFYA 2OELA 3MD1A 4DV7J 2MQ8A 2WSFC 3QMQA 2Y8YA 1F5AA 1NZ8A 4OI2A 1HNXJ 4PWUA 4QIEA 4G65A 4GC7A 3O5TB 2I8EA 4DSEA 1PGZA 2FZKB 8RUCA 2XNRA 4KH0B 4KFBA 3DRPA 1FXRA 3VV2B 2W01A 1R7IA 3LOUA 2DNRA 2Y3YA 3Q0AA 5DRKA 5B09A 1SJRA 3PRDA 3MM8B 3X1LB 4DF4A 1C1BA 3HKZD 2Y1IA 1FKOA 3TRGA 4V19J 2R7UA 3A4TA 2ZVIA 1HKAA 2DNKA 3DXSX 1C0TA 2ZWPA 3CTRA 2GS8A 1U1MA 5IT4A 1UVLA 3LGNA 4JI0J 1PYOB 2F63A 2JEGA 4C4WA 1GQEA 1IQZA 3KJNB 1RLCL 3AJ1A 3UCGA 4JI8J 1UVMA 2HHVA 3PW7A 3DN9A 3EUNA 1SJ1A 3VGSA 2RD5C 3NWRA 4ED4A 1RT5A 5KFKA 3KK3A 4F4KA 1XR5A 1F2HA 2ZOFA 1UVJA 2XY5A 1OQ3A 3H2VE 4K5SA 5KFSA 1HBMB 1N88A 1NH8A 3D0IE 4O0IA 1NJWA 1ROFA 4CO1A 4C3KA 5I3UB 4M5LA 3Q86A 1FVSA 4IFVA 4IH7A 4PQUB 2EG1A 3CCTA 1M5OC 1ZZFA 3HZEA 1V5IB 1WG5A 4H4OB 4PYAA 3TWZA 2DRBA 3H7HB 2J0QD 5D0RA 2B3TB 4DR5F 2XZTB 3GV5B 1ZH5A 1T3NA 4PG6A 3OXFA 1SV5A 4NLQA 4UOHA 4LR9A 1BMQB 2QYCA 4DV1J 3GIIA 4KHPJ 1G3OA 4C98A 2W7AA 5L9NA 2QRRA 4JI1J 4WZQA 3VWSA 2GVDA 2ASDA 2CQ1A 4KV8A 2DXEA 2GAHC 1PYTA 3W2WA 2JFDA 3F44A 3Q2SC 4I56A 2IC3B 4TXSA 4URGA 5IXUA 4RW6B 3M9NB 3CCQS 3QZ8A 3KTQA 4LMZA 4N47A 2CPXA 3S8SA 2XC9A 1VQMS 4O3SA 1JLQA 1S1UA 1F5BA 1MWYA 3AQPA 3SDEA 2DD8S 3U27A 5DLFA 3D5MA 4MKAA 1VR6A 5HP1A 4K59A 4PG5A 4MIAA 3HT3A 5KG1A 3TQEA 3W64A 3CIMA 4PCQA 3W9HA 1JQGA 1YBTA 1S57A 5HQMA 1S9FA 2DR8A 2IMOA 3A8JA 1SCJB 3LQVA 5FDLA 4WFYA 4OJ3A 2XCPA 3ENVA 5DJBA 3PO4A 2JHEA 1JJ4A 4LR8A 1DJ0A 1CJVA 3GIRA 2CPJA 3PIOQ 1RKJA 1QSLA 3RG6A 3T1HF 3GB0A 3W7BA 4DL7A 2ZH8A 2XSFA 4NEYA 3JYTB 1IJEB 3BQ0A 1TL1A 3W66A 1U45A 3J7YI 2U2FA 5JJBA 3TQ1A 4KGKA 2VC1A 5KAKA 4TN2A 5KFNA 4M95A 2H4YB 3HHLC 2C22A 3R2DJ 1UMJA 3OPKA 4MTPA 3FCWA 4CLPA 4J9LA 2QL7B 3RBDA 5A8KB 2LLZA 1T03A 3ENAA 5E33A 4C8LA 1I94F 2AKWB 3L3CA 3GIKA 3MTKA 3O1LA 4ES3A 1Q16B 5LSRA 3DLGA 4HH0A 1X4CA 2FHKA 1PJ5A 1PSDA 1EHWA 2CPFA 2F4VJ 4WE1B 3GFHA 4O4GA 3V6DA 2M4MA 2X1FA 2B56A 4H4MA 1A7GE 3T3FA 1BQMA 1X5OA 5KG0A 3HT0A 3MR6A 4FBTA 1M0SA 1ZPVA 2HSEB 1LW2A 3VVTA 1EP4A 4PXEA 3W61A 4MJKA 2FJVA 4W90B 3GLJA 2ALZA 1DTTB 2WVCA 2DGSA 4JI8F 2YNHA 3FK4A 2ILYA 2DB1A 1LOUA 4WWSA 4F25A 2DGXA 1HIYA 4YMEA 3KKFA 4X4QA 2HBYB 3FQKA 2Y1LB 3DRRB 4L76A 4YN3B 4UZBA 3VAGA 2PI4A 2NCKL 2SXLA 4N77A 4CZCA 4USHA 2QJ3A 2ZKTA 3DYAB 3R5JB 1PAUB 2IM3A 3HD2A 3NGKA 4MFBA 1ZS6A 5GVQA 2YH1A 4JV1A 2HHXA 3PW4A 3KLFA 2FD2A 3K0JA 1FD2A 4IUFA 1T9YA 2L9NA 3QT6A 5DQHA 1SL0A 3BSNA 3N79A 4IR1A 4X64J 1PG5B 2B43A 1OY9A 1TMMA 3G87A 4ERDA 3ITHB 3Q8RB 2MJNA 1KFSA 1YI2S 2OSQA 3I0SB 4NA2A 2W2PP 4QWCA 2CVEA 2HHUA 3KJVB 1QE1B 3VAMA 1KTQA 3F41A 4KHMA 4DF8A 3G4SS 2JDJA 4KSEB 1OPZA 3EGWB 2YWEA 4OYIA 4DS4A 4LSLB 1FE0A 2MKHA 4YB6A 5C2CA 4DR4F 1HI1A 4NYPA 3W63A 1N6QA 4CLSA 1XTZA 2CJKA 4RJVA 2H4WB 4CCHA 1HNIB 1RAHB 4Y00A 1URNA 2QO3A 1VDHA 4B08A 5LMNJ 3H40A 2F4FA 4PR6A 2GW8A 1VQ6S 4HDGA 5KFTA 1SH2A 5J2NB 3NNHA 1DTQA 1IVZA 3L9ZA 2LXFA 3J7AN 1WC4A 2E44A 2KT5A 4F4AA 3N6MA 2AJFE 2GMJA 1LNQA 1RAAB 3DGPB 4F0KA 3IM8A 4N8OA 3HF5A 1R0AB 3QJPA 3RB4A 1YQHA 2J8SA 1W2IA 4RW4B 1U0SA 2F3JA 5MLCV 4QYZK 3I9V9 4O3QA 2UUBJ 4IOAQ 1N32F 3CEDA 3FEZA 3AJ2A 3CD7A 4RUAA 3J80Y 4DL6A 3PX0A 4URSA 2YX1A 1HNXF 4FF4A 1K0TA 2KYXA 3CD6S 4MKBA 2FJEB 3MZIA 1FRKA 4FKXA 4C48A 5CAAA 1RTIB 3EZOA 3P6YC 1IKYB 3UCZP 3FSIA 1HPZB 2IVYA 4J9MA 4ZVUB 3HSGA 2OP5A 2DPIA 2XZDB 1U48A 3OW2R 2FJAB 2R2SA 2VHGA 2GMLA 4E2FB 4PUOA 4ID8A 5E3RA 4JI0F 1XIQA 2E7WA 3DRPB 1KS2A 1MMDA 4KFBB 3TW0A 4QWAA 4DUYF 5HROA 1X9MA 4F2RA 5F8NA 4JV5F 2QC3A 4QWEA 4JV2A 4RW7A 3FVYA 4LBIA 2HVEA 2KVIA 4OYPA 2E1MC 5B0AA 4L3NA 2YWKA 2AU0A 1L3VA 1FKOB 1KHVA 4BWJA 1TTHB 3ZTSA 3SV3A 4ZIVA 1RWMB 4TY9A 4OI1A 2FLOA 2LQ5A 4LIWA 1HFEL 1JLAB 2GQ2A 2AZ1A 2B4VA 2I0XA 4W4MA 1LW0B 4N56A 4USIA 1T7PA 2JEIA 4C7QA 5A6WA 3EGNA 1YJNS 1RT5B 3PZPA 2YKMB 1NM2A 3HSDA 2KZMA 2CJBA 5KOWA 3CMQA 2WHOA 2IM2A 4MK7A 2VICA 2KN4A 2RKIA 1FCAA 2HLTA 2V50A 3N4WA 4HACA 3MECA 1G4CA 5AE1A 2CQHA 4IFVB 1ULRA 4RNHA 4CNZA 1TL3A 3CCSS 2RDIA 4PZVA 1CQMA 2LMIA 5CZVA 5SUHA 1N5VA 1RP5A 5KG5A 4ZJLA 1H2UX 2VG6B 4F26A 3K5LA 2DNLA 4KE5A 2HHHJ 2V8PA 3PFOA 1QVGR 3M30A 1BWEA 1B4SA 1J5EJ 1UPPA 2IAJB 3IG1B 1U8SA 2A1BA 3SIPB 1OWXA 2R3VA 4A8WA 4F04B 1FTRA 1FF2A 3B4DA 3Q8UA 3VVUA 4X4TA 2BRLA 3W8PA 3TZXA 2DBBA 2ZFHA 3M8PA 4Y2MA 5B0CA 1KHWA 1EQMA 5KFYA 4IG3A 1T9TA 5DDRC 4KYZA 5IOLA 3C14B 3SDEB 4PPDA 2FLNA 1LXNA 2RQCA 1HYSB 2Y0BB 4DR7J 2RRAA 3EZ5A 2HQIA 1S1XB 2DO0A 4NLXA 4RO0A 4C0OC 4DV6J 1WC0A 2Q1LA 3D0HE 4YDXA 5GMKa 1KTVA 5SZTA 2OTLS 4C8YA 3PW5A 2GMHA 4ANCA 4RZRA 2D9PA 2HPUA 2M2BA 3PEJA 2W9BB 4DFKA 1BHNA 1FFGB 2FHMA 2HWIA 3I4PA 3N5FA 1UWBB 5HQLA 4HYKA 1YJ9S 1Y3JA 1UA1A 1QAJA 4BDPA 3QJLA 3MM6B 2XO6A 3JYTA 4CLZA 4PQAA 2MZQA 4DUTA 1S1TB 1JLBA 1TL1B 2HYIB 4G3IA 4K50A 1F0XA 5J2MB 1FRJA 3NBPB 4ECWA 1E6VB 2VD3A 5IC6B 1CJTA 1VBYA 5F0WA 2W25A 5C42B 3H4BA 2MLZA 3LUYA 3QO9A 2K8GA 3DRSA 2VFUA 4A47A 1RYSA 3NNCA 2VZ9A 1SI9A 2OEKA 2EFVA 3SFUA 3WZ0A 2OTJS 2B51A 1F2GA 4C0HA 1Q5VA 2XEXA 4KGZB 4P10A 4CLKA 4NLPA 2B8QA 4ZLPA 4DR3F 1FEHA 1J5EF 1RT7A 3VZHA 2A6MA 2DH9A 4Q45A 4QW9A 3OL8A 3KK2B 3QATA 5GMEA 3RB0A 1V6HA 2LYVA 1UVIA 4ZVQB 3KUHA 1B7FA 2D1CA 1T9WA 1MNEA 4A46A 1RISA 1TR0A 2YX4A 3CVKA 2A6OA 3PHEA 1FXDA 4R8UB 1RT3A 3TAMB 2DNHA 2KH9A 2DNNA 3ENQA 3C3LA 1LWFA 5LT5A 1KQKA 5GMDA 4LF1A 1DTTA 2CQ0A 3W65A 4WK3A 2YNHB 5L38A 1RWVB 3GR1A 5JVGQ 1Z1ZA 5J1EA 1KEKA 5HP1B 3PJXA 1RT2B 1DURA 2E7VA 2RDDA 3KDNA 4HDHA 3RUBL 3BQ1A 4B3SF 4R25A 2H51B 2A18A 2R2UA 2IM0A 3FFIB 5D0EA 3MAQA 2HQFA 1SIWB 3DI6A 3MPVA 4DV5F 1LWCA 2D3UA 3PJWA 1HARA 3VZIA 3W5YA 5CABA 4UF4A 1XK8A 3AB4B 4FZVA 3KMSA 4C3LA 3JTNA 3HSZA 4AYBD 2FVPA 4LQ3A 4FF2A 2XYHB 1REVB 2VB6A 2YY3A 3UI3A 3KK1B 4B9MA 1TFWA 1IWAA 1WHWA 1S48A 1UP1A 2O3DA 3I0SA 2Z2MA 3UQSA 4OJGA 4A8XA 1HL6A 3TUZC 3TZYA 4J9VA 1HA1A 1ZAWA 2H48B 3DLEA 2YNFB 3M8RA 2ZE2A 2PFDA 3D6FB 2E5LJ 2ADBA 3PYEA 1N6QB 1TUGB 3TEHB 4ECYA 1Q82T 1KBRA 1HNIA 1JXEA 1TKZA 4CYUB 5KOXA 3EVOA 5EDWA 2XMAA 5EWGA 4NZ7A 5KFRA 1TL7A 4RUCA 3GTYX 3Q23A 3CCRS 4OJHA 3HK2A 5J2PB 2AHOB 3IBWA 3BGRB 3Q8YA 3T1HJ 3AQOA 4DV0F 4X4NA 1U1OA 1ZM9A 4NI2B 3ET6B 4ZVPB 2L9WA 1SH3A 3TYTA 1Q7YT 2GFFA 3D0GE 1BC6A 1TV6A 2J8AA 3R6LB 1NEEA 3H59A 2CQCA 3EDRB 3M2VB 4PEOA 1JLEB 1T94A 1XMQJ 2CAJA 3LP1B 7FDRA 5I42B 3J7ZT 4BC9A 2W9AA 1XWLA 1RACB 3H5XA 3GZ7A 1X5TA 5CZXA 2HLUA 3SCJE 2CJAA 2HQCA 3KLIB 3TZWA 3Q24A 4DR3J 2FVQA 3DLKA 3TOQA 3CJ2A 3B8HA 1HPZA 4PG8A 2MTLA 3SSSA 2QA2A 2DHHA 3K59A 1RCOB 3BH6B 1SUQA 5L8RC 2I9SA 2BANB 2MHNA 3KJQB 4JOUA 3J81Y 1XNQF 1YRUA 4PUOB 3NMRA 2ZBIA 3FBCA 4X65F 3V81A 4F67A 1N0VC 2QL5B 2WVFA 3BGUA 1WF1A 2JH3A 2BM1A 4AQYJ 3BM7A 2E5JA 4J91A 1YRTA 1C4CA 2IM1A 1WTBA 1VHIA 4M1KA 4ZVEA 1RWWB 1JXVA 5B0GA 1FX2A 2M5YA 2YKNA 4WP8A 5KG4A 1LW0A 2PGCA 4LRFA 4ECRA 2KRRA 4DL2A 3PO5A 2F8EX 3DMJB 2RJZA 4LJMA 1TU0B 3O8WA 1O51A 3GIMA 2OJ3A 4M94A 4NRTA 1R6YA 2AJ4A 1FX4A 3P45B 1U4BA 1BY9A 5I42A 4X62J 2ATLA 5D6GA 1EKRA 4JV5J 3BSOA 3VCDA 3WQPA 1PAEX 4DG1A 5C2GA 3H5UA 3R7SB 4EO8A 1YK9A 2J9EA 1F60B 4RW8B 2K3KA 3R5CA 3AHPA 2DNPA 2YNGB 1S6UA 1DARA 4AUKA 3KLEB 3A3OB 2VKZG 3A3PB 5EN1A 2BJ7A 1UZDA 3TUIC 2CYYA 2ADCA 2B5JB 1KD1T 1FKPA 2CQ4A 2BW2A 2WTFA 2R2RA 3PKMA 3EGZA 1E6YA 4J9OA 3NCRA 4DS5A 1SVDA 3M8PB 4LVNP 4TQRA 3TARA 4Q8EA 2OPQA 4OHZA 4OHVA 3FDSA 4WFAQ 2ZHBA 2K06A 3C14A 1UW9A 4LFAJ 2ZVSA 5K8NA 5KG6A 4DFMA 3MAAB 3R6GB 2E66A 3CC2S 1WD6A 3R7BB 4ZOSA 4DX5A 1JLGA 1SJQA 2BUNA 1Q8LA 1VMBA 2D69A 5HAOA 1XMQF 2G2YA 5LMNF 3WBZA 1FE4A 3CIZA 2N3LA 3VF0B 1JJHA 3F0NA 2N82B 4OHXA 3GFXA 1OYEA 2B9WA 2AJ0A 2P5VA 2C3OA 1ACMB 2QL9B 4NLWA 1Y5IB 2W9BA 4RNNA 1N34F 2XWYA 1S1WA 2YNIA 1U7LA 3GCXP 2UUAJ 4DSLA 2XI2A 2JSXA 5T41A 3G6VA 1PYSB 4JI4J 1S1TA 1JLBB 1ZTWA 5HQ8A 1WC1A 4I2QB 1RWNB 1IKWB 1FDBA 1GMVA 3NBPA 1E6VA 3CMES 1NO8A 2NXNA 3BR8A 3DDIA 3T1YF 1D8ZA 4ELVA 3DRSB 2AW0A 4ZPAA 2BE2A 5IFMA 2MSTA 1VQPS 4RU2A 1NMEB 2W9CA 4RWXA 2DR7A 3R2CJ 4B3OA 2MQLA 1TELA 3UDLA 3PY8A 4C97A 1BUXA 3J7YU 1RT7B 2GCFA 4QPTA 2EFGA 5K9FA 3KK2A 2QLWA 3OHAA 4AQYF 4MMOA 4RW9B 2B9EA 3KJFB 3LPEA 1HNZJ 4YY3J 4J9QA 1CULB 2W2OP 1I94J 1VGYA 4AL7A 2B9XA 2LCWA 4UW2A 4LF8F 3TAMA 2ZBQA 4LRAA 3BZQA 5GAEU 2XLKA 1LWFB 2XSJB 3MEEA 2CJXB 5F9LA 4WF9Q 1XEZA 3KXDA 4YR2A 4C9DA 1VRUA 3HPOA 2B4UA 1RT2A 4LT6A 2QG9B 4YQWA 1H6KX 3IFEA 4MYUA 2X7IA 3EICA 4O3PA 1W25A 3KG1A 4G1IA 1IBMJ 1N5QA 2RT3A 2WVBA 4GKKF 4YHHJ 4USKA 3RGIA 1KDNA 2EFQA 2Z8QA 1VQ8S 3ISND 3H4DA 2F4VF 4RNFA 5HBMB 2DHSA 4EU0A 3DI6B 2HURA 5KT6A 3I82A 1YTYA 1NB7A 2J6UA 1CEZA 3CPWR 4ECVA 2D41A 3KNGA 2HFZA 4I6AA 1N4LA 3TJAA 1HQEA 1KONA 1Q79A 2CPDA 1U09A 3QWPA 3ILOA 3OFHA 5DO2A 1RTDB 2IRYA 3JSRA 4A8SA 2Y1RI 3KLHB 2CWXA 1D9FA 4IRCA 4LF6J 3CSKA 4ZP9A 3FRZA 3ILLA 3US5A 5T14A 4JYAF 2PE8A 1CS4B 2YNFA 4K2JA 3OFGA 3MMJA 3IRXB 5AXNA 3FSXA 1DHMA 1HBOA 3HFZB 1JLFB 1JJCB 4NOHA 1YZ6A 1CC8A 1SIZA 2WSEC 4JP8A 4MK8A 1GMWD 4Z2XA 4V19X 4IH5A 1UAWA 4PYDA 4U7UK 4CYUA 1FK9A 2GGPA 2HS0A 3RAMA 1TL7B 1P9YA 2M88A 2LXIA 2OGUA 2BYCA 1TKTB 4ETZA 5K8MA 3UDEA 1VRTB 3EGVA 4KHRA 4RU9A 5J2PA 1JKHB 2MZTA 2VBZA 4LSNB 4QR1A 4OYBA 2GNKA 2AIRB 3DU6A 1DBDA 4FNIA 4NI2A 5D78A 1RAEB 1K9MT 4CM0A 3MUVP 1R3NA 1BXNA 3ELHA 3QSIA 3UO0A 3WIUA 2B7BB 1FRXA 1K73T 1Y0HA 4K4YA 3GCWP 1FRLA 1Q78A 3HHEA 3LP1A 3CW2C 4HVZA 2PN6A 3HHLA 2G1DA 2MQMA 4ID5A 4Z37A 2RQMA 3MR3A 2RSQA 3JQMA 2CZ9A 1RHJB 3ZZTA 3QBCA 1FTCA 1WEYA 1AXQA 1X4DA 2Z2LA 2HHWA 3MEKA 4AL6A 2KO1A 2M7SA 4RNOA 2G1HA 2H5IB 1S72S 3IWNC 4K0KJ 4X4SA 2UVUA 2VBXA 4P7TA 4P9SA 1NPRA 2GIQA 2BANA 4OZ1A 4J9RA 1U2FA 3NS7B 4DXLA 3BJYA 2HVZA 4B3MJ 3DLBA 2GZOA 4LR7A 2GQCA 2J0WA 4F0HA 4LBPA 3TANA 2BM0A 2VG7B 4HACB 3N01A 1QVFR 4EGLA 2G0CA 4PWDA 1QDUB 1H72C 1RTHB 3BSAA 3TP2A 2BA9A 2XYGB 2BJEA 5E41A 2Q6BA 3Q22A 2RF2B 1HBNB 2XWXA 2F8HA 2NXJA 1VQLS 3WX4A 3AAWB 4I68A 1FDDA 3MEDB 3IN5A 1R43A 5D77A 1NXIA 1J2VA 1PBUA 1RU1A 2QLXA 5JVHQ 3ZC4A 3C6UA 3GJQB 3NAHA 3BGLA 1TVRA 3EE3A 4URQU 4O3OA 1F9HA 2CZVC 2DEIA 3VTIA 4I7FA 2MZ1A 1ZAVA 1N34J 3I9ZA 1PKUA 1B3TA 3K89A 1MU2A 5A0YB 2CNNB 4NXMF 2HBQB 3G82A 3PVXA 2GV1A 4C11A 3S1TA 1VYAA 4H4KA 4KB7A 3MXHP 3H8YA 4A4JA 1HI0P 2R7VA 1YDLA 2ZM6J 1NJYA 4EO6A 5C5JA 1NAQA 3D7SB 4NCGB 4ZHRA 4NXMJ 4C8MA 3G9CA 3RYLA 2LA6A 5D15A 4ILMA 2YKPA 3OTOF 5T7LA 2QSWA 2W7PA 4J9KA 3FEYB 2KT2A 1GEHA 2P9CA 3BBFA 3QPIA 4ILLA 4C8ZA 1X9SA 2V4JA 2CRLA 1GMWA 3A8IA 2B6AB 2DHXA 3D3CJ 4DZ6A 4QOTA 2GHWA 2CA9A 3BYPA 3CCZA 4RUBA 2QFJA 2GJ2A 1FJCA 4USTA 4HH1A 4CO2A 5KT4A 4QIVA 3CJ5A 2MJUA 3MCOA 1D9AA 2LQ9A 4MK9A 2AEMA 2P9EA 2WSCC 3MAAA 5IC4B 1JB0C 3OL7A 2KDOA 2JX2A 4ZCMA 4IR9A 1SKWA 3CJ8A 2G2OA 4ZCLA 1NHVA 3GONA 4RLEA 3D4JA 2E5IA 2HQDA 5HI7A 5J1PA 1GT8A 5LMUF 2UXCJ 2FJDB 4QWDA 1O0PA 3WC0A 1NPPA 3HHLD 1HWJA 3KFWX 1S1WB 3G96A 5D4OA 1K47A 4YFUA 1GXUA 2DNOA 3LP0A 1HR0F 3UD5A 3NNAA 2K1RB 1XN9A 2GO8A 1JWWA 4K5RA 1WHXA 4Y2IA 4F8RA 1AFIA 2GVZA 4B9VA 1UJ4A 1RAFB 1N5YB 3MM9A 3DDNA 3VHQA 2E1RA 2BE2B 1S1VB 2HMIA 4JI6F 1QSSA 2QMUB 2W8LA 2PI5A 3TR5A 4DV2F 5FLXY 1YVFA 4MIWA 1TAUA 3FGVA 1HWUA 1T9XA 4DR1F 2HHTA 3SCIE 3MMCA 1WI6A 2RVJA 2CG8A 2Z30B 2C1EB 3C6TB 4NMXA 4RW9A 5FD1A 3S6EA 3UNYA 4HL9A 1CULA 2HIQA 3N6NA 2RNEA 2C2ZB 3O3LA 2XI3A 1NZAA 3T6JA 3RJMB 3HCXA 2JLEA 1NHUA 4ANDA 1SC4B 1PCAA 3D6HB 4DPOA 3G71S 4JI6J 3MR5A 5CYQB 2QV6A 1ZA2B 3A8KA 4ZP7A 3TX8A 3KG4A 2C3YA 1MMLA 4ECSA 1UJ6A 3KUEA 5ETVA 2DK2A 1RCXB 1FVQA 2OI2A 2Q43A 3EXCX 3NXZA 4IRDA 1GK8A 5BYSA 5IM0B 3RB3A 3WIVA 1EAYC 2YXLA 1G6BA 2Z2YB 4TVAB 5L1KA 3A8EA 4P75A 1U2RA 4CLTA 3D67A 2R8JA 1YKWA 3K57A 1U1PA 4C8OA 2VPWB 3D28A 4KIAA 5KFAA 3DFEA 4KKOA 4OYZA 3QT5A 4E98A 3VAFA 1H38A 2AYEA 2HZCA 4DSIA 2HFUA 1HMVB 2NUUG 1SL2A 1ZA1B 2LQJA 1NKEA 1NNDA 2FJBB 3QIDA 1IBMF 2UVWA 4CLFA 4ELUA 1HQEB 4V1Ak 2P6SA 4PABA 2HWHA 2VFRA 1WELA 1RTJB 5HJYA 5DM7Q 3CULA 3PYFA 3NCQA 3HM9A 1NSAA 3V4MA 1S6OA 1V3RA 2VFVA 5LJ5Y 3OVAA 1OPIA 3D66A 3E51A 3N5BA 4KAIA 5B0DA 1HBOB 2NS1B 3OSNA 3H2UB 1ZZNA 1SC6A 3P8BB 2BX6A 3DOMB 4J9UE 5J2QB 4WPAA 2NZ4A 2QEXS 2RE1A 1VLOA 3QGPA 2QA1A 4DR4J 4WKRA 2GGPB 1S7HA 3FKBA 4CDIA 3O2IA 2C42A 3T41A 4CP5A 1SQFA 3ZTRA 2AQ4A 2J9DE 2P8IA 1YBAA 1UEKA 2HFVA 2PEHA 3AD8C 2QIFA 2AF6A 3A13A 1IKXA 3VGUA 4DHVA 4ICLA 5A8WB 2APOA 3M8SA 2R8HA 3DHWC 4FS2A 3UD3P 4S0MA 5IWAJ 1DZ5A 4KR0B 3W3SA 5JXSA 4DU7A 4EWTA 3E01A 4HR2A 4UZCA 4WFBQ 1RAOA 5E2QA 4LF6F 5I3QA 1DQ9A 4OYXA 1CC7A 3E2EA 4NZ6A 4OI4A 2RHSB 1U2CA 1KVIA 1HBUB 4HHHA 3SCKE 3HHLB 3MDFA 2LEAA 2HNDA 1KR4A 5M2PA 4DV3F 3R3TA 2VJVA 3ZZPA 3OR2B 1AW0A 4ILRA 5K5MA 2DNYA 5DGAA 1TAQA 2HWTA 4F4XA 4I67A 4OLOA 1P1TA 4DSJA 4B9SA 1OO0B 3ZZYA 1JNRB 3PCOB 2V2ZA 2XLJA 3M1VA 2J0XA 1RHMB 1O6XA 1UWAA 3R5GA 4KRWA 4BWMA 3QIPA 2VG7A 3HDSA 3VGVA 3NWGA 1TMJA 4Y28C 1CJKB 2DH8A 2BOAA 2XMVA 3EZUA 2YH0A 4CLUA 4AT1B 1EIYB 4OZ3A 3GV8B 4JI2J 2YWFA 2YPZA 3W5XA 2KI2A 3P96A 2BQRA 2EK6A 1HBNA 4M5GA 1RB0A 5EHHA 4ZPDA 1Y4ZB 1HNZF 2PA3A 2NLWA 3MEDA 1WC3A 3GQCA 2BVZA 4Q8FA 3UN3A 4R5PA 3M05A 4P2XA 4C8KA 1HD1A 2JRSA 5DLGA 5B7WA 2BKPA 4DL3A 1N33J 1TVRB 3PNIA 3M6XA 1K44A 2DGQA 3HHNB 4KJIA 1RT1A 4WTOB 3RRHA 4G1PA 3K58A 1BQNA 1C2PA 2Q3PA 3BPSP 3PACA 1V5VA 2F9DA 4DPXA 4IRKA 4BLGA 5D3GB 1RWOB 1O8BA 4WFXA 4F4ZA 3GFYA 2IRXA 1P6TA 3CO0P 3HP6A 4HKQA 2BJ9A 4PRFA 4K4TA 3TJ8A 4ZHRB 1VI7A 3JXOA 4ZVSB 1SC3B 2ZUGA 3SEOA 3RAXA 3DM2A 3E8OA 1EZZB 1WOOA 3MGJA 5HVFA 1A9NB 4J7CA 1HQ2A 5KT7A 2XS2A 3NP5A 5T7LB 3FQLA 4IO9Q 5HJXA 2KKHA 1FT8A 1C1CB 5IQ6A 2U1AA 1ZAXA 1CQNA 2V4JB 3H2LA 5AXKA 3CNQP 3FCHA 3GJTB 3I96A 2KXHA 2LQ8A 2VKRA 2B6AA 3HI9A 1KFDA 2XHWA 4M5IA 4Y6IA 3EX7B 1HHTP 3KK3B 1EQ0A 2E9ZA 2M70A 2NZCA 1CSJA 2EW9A 4ED0A 2M0GB 1SXLA 5EGYA 1YJTA 3L7PA 1OIAA 2LEBA 3MR2A 2CQGA 5HMYA 1R27B 3O44A 2NXCA 4NLGA 1NDLA 3MURP 5I3UA 3GU0A 1T02A 1XBWA 1U25A 3H98A 4LFCF 4O3RA 3DOKB 1WOPA 2H1YA 6FDRA 4PQUA 1Y7PA 4A8OA 3IRWP 1CJUB 2KHDA 3WHIA 4OZLA 2VONA 2ZDPA 3NS5A 3IBFB 3AOCA 3LWMA 2DNMA 3I0RB 2CPYA 1M5PC 5CYMA 2W2MP 2WBRA 2YVSA 4M5MA 3AODA 4L73A 1JJ2R 3PM9A 4LRDA 2IPOB 3CCWA 2WZ1A 1TUWA 1V3SA 2LU1A 3LP0B 4DX6A 5F8LA 4UOFA 1VQSA 4KV8B 5M2RA 4CH0S 3Q8PB 2UXBF 2JFKA 3FSYA 5KFEA 3W2WB 3ZO7A 2C2OB 3CJ4A 2GVZB 3EWGA 2GHPA 4RW6A 3MI7X 3T6BA 2IIHA 5DETA 4X62F 5DM6Q 3CCMS 4DQRA 1N5YA 4NXNF 1HWIA 3JSYA 2V94A 2RHQB 2ROEA 2OMLA 3M32A 3MMAA 1DLOA 3EPIA 4USVA 4WJBA 2FDNA 5F3ZA 2XTJP 2HAIA 4X4RA 3LO3A 2E9TA 2F9JA 3RRKA 5FDLB 4DLEA 3MMCB 4OI3A 3R27A 4AL5A 1UTAA 2BW7A 2FYXA 1RJJA 3JTOA 1FJGJ 2W4PA 4M5NA 3T5KA 1WOSA 4FXVA 2AYGA 1Q81T 2I2YA 3AH6A 4PXCA 5HATA 2NXEA 4CRJA 2VIHA 2HVHA 4ED3A 2HG4A 5CYQA 3HJFA 1N33F 3IMQJ 3UVJB 2UXDJ 5H9FK 3I31A 3ZZUA 3QT7A 4IKAA 2OPRB 2V8VA 3L7OA 4NL5A 5K20B 4FBUA 1SQGA 1S4FA 3THPA 1R89A 2HFOA 3OTEA 3W2VA 5IZHA 4XPEA 1YJWS 1WI8A 2MKYA 2RH3A 1UFKA 1VBXA 2HHPA 5HLFA 3ZZOA 4P7VA 5KG3A 5KFCA 1TK0A 3DNCA 1KC8T 2FLLA 3GR0A 1T9VA 1MWZA 1WSVA 5KFXA 4O4GB 2ZNZA 2WB1D 3G6YA 3DLLQ 4ZDNA 1IR0A 3UCUP 3K5NA 3H5SA 2H5EA 1OYDA 3NGRA 2EFOA 1BQMB 1RTJA 2OAUA 5EWFA 2DJWA 1WNEA 1FESA 4HI1A 3OFEA 4CTAB 1K0VA 1FWKA 4P74A 3P4UB 4WZMA 2PMZD 5KFMA 3UWTA 2G0IA 1LXJA 2OPPB 2MZSA 2QLJB 4F3MA 3OUYA 3GYGA 3VAIA 2OHDA 3NGTA 5DDPC 4Y2CA 4JI3F 2V8GA 1VLYA 3FJ2A 2JOQA 3CE8A 4WP9A 2MQQA 3ILJA 4X64F 3DYAA 7FD1A 3MPUB 2M8HA 4A8YA 1IKXB 3GSDA 4Y34A 4ICLB 3KLFB 1EJ7L 4K2XA 4DR5J 2VJUA 1TQLA 3FBEA 5KFPA 1SQEA 3E01B 4NLVA 5F8IA 2CPIA 2IVFB 2QTWA 4NA3A 3PYGA 3UW1A 2AMCB 2CPHA 4WBFA 2VQEJ 3M8YA 1YJRA 4B3TJ 4NLYA 4QPXA 1MN7A 1JMTA 1RAIB 3FZBA 1Y9OA 3ADAC 4YR3A 4C8NA 1RHQB 1FHTA 4DN0A 1QY7A 4K4VA 4ECTA 2RAQA 2WB4A 2NSBA 3A12A 2J5AA 3GIJA 2CNKB 4RR5A 3OR2A 1AYEA 3NGSA 5ETLA 1XC9A 1KQFB 5DZ7A 3HMJG 4WKYA 4R0JA 3A3NB 2CFXA 2M3DA 1IR1A 1X7VA 3CO9A 2VU5A 2EBEA 1DTQB 4ANEA 4DV6F 3CD0A 2VOOA 1QM9A 4KO0A 1FEEA 4X84A 2ZDOA 3QFHA 3ZFVA 1SJ3P 2CQ2A 2M52A 1YIJS 4EEYA 5H9FJ 3DGPA 3TVYA 3KHHA 3ONQA 1YJVA 4P2MA 1XNQJ 2UUCJ 2JZ5A 3M7VA 3CMAS 4MIBA 1Q8IA 2AP6A 2WOMB 3MMBB 3V5RA 5L39A 4WFZA 4J37A 2BRKA 3F56A 4P73A 4Q0BA 3HULA 4R5PB 2BOPA 4YR0A 1O5JA 3DU5A 3HVAA 3OTBA 3UN5A 5C25A 2IBKA 2Q79A 2VOPA 2VBYA 4B3MF 2XO7A 3ILIA 4HHUA 4QJVA 1RT1B 4ZLNA 1KSPA 1XERA 4RBTA 3OL9A 1R8BA 3PX6A 1WKJA 2JVRA 4M5HA 4XDCA 5BJRA 4F2SA 3CJRA 4CNYA 3QJJA 4QU7A 3MFHA 4IFYA 3JSMA 4RUHA 1IQTA 1NHKL 4Y0FA 1VQ9S 2AV5A 3P5TL 1KQGB 2H9ZA 5D0HA 5IQQA 4DFPA 2DRAA 4UT4A 1VC0A 4TLQA 5ETTA 1AUDA 4HT5A 4EZ9A 3DM2B 5GAGI 3M2RB 1LEOA 1ZOTA 1EETA 2ROGA 3B4MA 2P2CB 2XLIA 1IBKJ 4UUXA 2NYHA 1TUVA 1U1QA 4M8LA 2G13A 1YHQS 2YX7A 1ZM4A 5HANA 1DFDA 5F3TA 4DCJB 1JLAA 2CJQA 9RUBA 4HTJA 4CIOA 3CC4S 3I55S 1CLFA 1RBAA 3ISZA 2WK4A 2BDPA 4DV1F 1JXLA 2ASYA 2RQKA 2YKMA 4L75A 5E5NA 3SSQA 2E5GA 5B0FA 3HVTB 4ED7A 4U9RA 3U1LA 3UNGC 3W8GA 1S9GB 3FZ2A 5GADU 1BD6A 2RRNA 2Y9HA
chains in the Genus database with same CATH topology
4FNHA 3MECB 2QA4G 5D4PA 1TL3B 3V2UC 4QR0A 2COLA 4O4RA 4I64A 2WTFA 4DV4F 1HW9A 2VPXB 2VG6A 3GG0A 3I87A 4FVMA 5K14B 1VOMA 2JLFA 4WU3A 5CYMB 1VQNS 3OR1A 2XCAA 2IAJA 3CXCR 1Q8BA 2ZKUA 3CCLS 1JX4A 1VIOA 2R7SA 1WG4A 5KTQA 4LF7F 1N5SA 4TQSA 3R1HA 4D3GA 4CI0B 4K4WA 4NLRA 1L5UA 3NLCA 3PEHA 3L09A 1IJFB 4ZVHA 1RA6A 2FUG9 3CT9A 4DX8H 3QWUA 1HYSA 1K1QA 3HLUA 2IA0A 2A10A 4E8UA 4QYZJ 3PXGa 1S1XA 3RW7A 2GJIA 1T05A 2DPJA 1S0VA 1Q4RA 1UVKA 3THTA 4ITSA 4QZVB 4JUZA 1QAXA 1Q7LB 3RZAA 4NLOA 4B9LA 2ZJQQ 1GNKA 2LU2A 2CG4A 4ZPCA 4L6V3 3H25A 2IJFA 1UWBA 4UQTA 4QR2A 3DC2A 1FXLA 2L48A 3MM6A 4NPOA 1RK8A 3RBEA 1QSYA 4HI2A 4E0DA 3ISNC 2RMLA 3LAKA 1LV5A 2W8KA 5AXMA 3K5OA 4X4PA 4Q7AA 3QO9B 3OV7A 2IMWP 2MGZB 3DHXA 1S79A 2EBGA 2DGUA 4QYRA 2D3OR 2KM8C 4TY8B 2R8KA 2NR0A 4ED5A 3CCJS 3DDKA 2NQPA 1FJGF 2Z0GA 1XNRF 2AGQA 4B9UA 1BGXT 3QYYA 5F8HA 2LECA 2X1BA 2O5DA 2CKWA 1NKCA 5F8GA 3CDBA 4ECQA 4MYTA 4C0BA 3GILA 5B08A 1FKAF 4CH7A 5G0RA 4QIWD 3B82A 3M2UA 1S6PA 1HHSA 2P9GA 2XMTA 3HVWA 1FJEB 1IKVA 1Z2ZA 2E1AA 2POKA 5J1EB 2OPPA 5KFQA 3OUYB 1G1XA 2ZH6A 1RI7A 2FC9A 2E5LF 2DTJA 3RR8A 1GTHA 2ZJPQ 4ZP8A 2X1GA 3I4HX 2QA4S 4F4WA 1M5HA 4ECXA 3FFIA 3ICLA 5ADZA 2OFGX 3CJ0A 4HTIA 2BXJA 1D3WA 4OZ0A 2E5HA 3UD4P 1TK5A 1S0MA 2XMJA 2XS5A 3H5YA 1XMOF 2W4CA 3THVA 1REVA 3KK1A 2ZH2A 4ZPBA 1M90T 1X4EA 5LXYA 2OLWA 1D1UA 1X5SA 1S99A 5E3QA 1Y5LB 1LK5A 2ZE2B 2X1AA 2FHOB 5KFWA 1X0PA 3OXLA 5CH7B 3WDOA 4WXOA 1RT6A 2K3IA 1NKBA 3T1AA 1HNWF 1HWKA 3X3UA 1QUVA 1TKZB 2IBOA 2MZRA 3LPYA 4TYBA 4KBIA 4ZA1A 4KO0B 2Z4PA 3KYLA 1GXTA 2JEFA 3M6WA 1TKXA 2ZC4A 1TV6B 1UL3A 2A2CA 2XBPA 3OXGA 4BC7A 1MW7A 2HFNA 1JLEA 3MOZA 2LDYA 5LSOA 3HKWA 3MMBA 5HMZA 3K5MA 2RU9A 2XULA 2J7KA 1P27B 1H2TZ 5C25B 3TA1A 3KLIA 1F5CA 2CQ3A 4ZPTR 1HNVA 5BYRA 1C0UA 5IS2A 2MHEA 5F8JA 3UE2A 1J5OA 2UXDF 3GV7B 3TAQA 4JV0A 1V9OA 2UZAA 2AYBA 3N28A 4X4VA 1NK8A 4IFYB 3JSMB 3V6HA 2O66A 2HVIA 1NH7A 3BSCA 2LXUA 2HHQA 2WBMA 2WONA 3I32A 4I2PB 4ZP6A 2EFNA 3PIPQ 3MM8A 4FXWA 2DH7A 3GYXB 3M2RA 3MM7B 5CXTA 1EETB 4NYZA 1C1BB 1X9WA 1XR7A 4NCBA 3RW6A 4ED6A 1X4BA 1WF2A 3V6JA 3MHYA 1K1SA 4P6QA 2KHCA 3AY0A 3CWJA 1NK5A 4Q44A 4LQ9A 2KRBA 4DJBA 4PG7A 1QTMA 4OHWA 4YHHF 4M5DA 2HS3A 3BR9A 2J76E 2RRBA 2XS7A 2M9KA 4RX6A 3GMGA 4GC6A 1HBMA 1FNXH 5E3PA 4DG1B 4K4SA 2GQQA 2R7OA 4RW8A 3M6UA 2AGPA 2ZITA 2YNGA 4H4OA 3KLEA 1TL4A 1MMNA 5K14A 1QAYA 1SJ4P 4B17A 2XG8A 1SV5B 4TLRA 4XAKA 2B5JA 2ROPA 5DG8A 5C24A 4L72B 5KFFA 4QW8A 1UW4A 4IOCQ 2OSRA 1U26A 1JLCA 1PO6A 1KRPA 4KTQA 4DQPA 2OPQB 2KT3A 1N52B 4UOCA 2A2DA 5D4LA 1R8CA 2RILA 1JLQB 4KQZA 4ZCKA 4QBUA 2NREA 3UDCA 4RKUC 3R5BA 2PO4A 2FVRA 1JLGB 2KJWA 2CQBA 2XNQA 3UR3C 3NCPA 3GWCA 4DR7F 2VQEF 1SH0A 2G4BA 2NYIA 1OS5A 4Q2MA 4X4UA 2GHVC 2YNIB 5FJ4A 1TP7A 2UP1A 1UVNA 2VPYB 3TI0A 1IKWA 4I6YA 2E9RX 2KFYA 5AE3A 2AX1A 3SXLA 4DV7F 1UETA 4AXIA 2MGZA 2DNQA 1T03B 3BDEA 5A8KA 2W9CB 4ED1A 3FMBA 4B3OB 2V9WA 2XGQA 4WYWA 3F73A 3ETOA 1NRKA 3DLGB 3FEXB 3MPWA 4FF3A 2CZ4A 4DL0C 4WE1A 4J9NA 3V6DB 2O1PA 2FY1A 4YEAA 3HZGA 1L3SA 4F02A 2W7OA 4H4MB 5A2QY 4EYIB 1GTEA 2VASA 4O44B 2DT9A 2MKKA 1EP4B 2OFHX 1N56A 5G0RB 1I6JA 2WW8A 3QGIA 5FIIA 1N54B 5D4NA 1G2EA 1S6PB 1Z4UA 5GAHU 2DHGA 4X2BA 2OD6A 2WCXA 3D1QA 3CUNA 1VBZA 2PMHA 5F8MA 2C28A 1FA0A 2ZZNA 4HT7A 5CCLA 2IJNA 5F41A 1S6QA 1XR6A 1VHFA 4MFBB 3MFIA 4FYDA 3TUJC 4OX6A 4CO3A 3VAJA 4BHQA 5HBMA 2IRUA 5KFDA 3U7JA 3CCES 3OSPA 2PDAA 2YTCA 4NLSA 1SL1A 4ZPWR 5E7OB 4ECUA 1YRXA 2N7YA 3ITHA 3O6QA 1ZM2A 5L9XA 1KNZA 2MPUA 4OMFG 1S49A 3KLHA 4UQGA 3AA9A 3KJVA 3PX4A 2D7SA 2HHHF 2KJVA 3VQTA 1FD8A 5KT3A 1UA0A 3IRXA 2FPHX 1YG0A 5M2UA 3RR7A 1ZM3A 1AROP 2AYMA 1GXLA 4EZ6A 5KFGA 1FK9B 3Q2TC 1DQAA 2ZHOA 1TKTA 5KG7A 3VALA 2HHSA 5J2NA 2FJXA 4NCAA 2VH7A 4LSNA 1KLNA 5KT5A 4J9SA 3T9NA 1TKXB 2K2PA 1R0AA 3JTPA 3OHBA 2JL9A 1OSCA 2UV8A 2ZOMA 4OX8A 3BO3A 3BGFA 4RW4A 3IGNA 1GAOA 3N6LA 4I69A 2ASJA 1Y3KA 1DRZA 1ELOA 2CPEA 3RU0A 2DCLA 4DR2F 5DQIA 1RQ0A 1VQ4S 3IS9A 3U1MA 2B4OA 3RTVA 1HNVB 4U6PA 2ZH7A 1IKYA 4N41A 1J5OB 2GA7A 4OFZA 5K8PA 1SBRA 2C3UA 3LAMA 2ZD1A 3KHGA 2GX8A 3IAS9 2RUGA 2WONB 1X5PA 4I2PA 5HROB 4F4YA 4PWDB 3U02A 2BQ3A 4ZS6A 4RW7B 3D54A 4R0EA 2V9KA 3MM7A 4NA1A 4NLTA 1U6ZA 1ZBTA 3LP2B 3KLVA 2RF2A 1RGVA 2A3JA 5EX3A 4DDFA 4Q43A 1HI8A 2ZH9A 1NK7A 2D74B 2HGLA 3POTB 5GAEI 2XMKA 3KOAA 4DR6F 2VG5B 4QQBA 2GO9A 4M5DB 1H7WA 4I7FB 2ZH5A 4PXDA 4NLUA 4U7CA 3T19A 2MY8A 2R7TA 1U1RA 5BYQA 1MU2B 2F8MA 4B02A 4OZNA 5A0YA 3LANA 2RKIB 2IFXA 3UR0A 1R8AA 2LDIA 4IOBA 4C11B 3PR5B 1IXKA 2IYGA 2C2RA 1M5KC 2PSZA 5J1NA 5IT0A 3HX9A 5F0UA 4NCGA 3KHLA 2R7WA 3IA0A 5G4DA 1H98A 3NKYA 1VC6A 3M30B 4KT0C 2QE5A 1Y00A 5DS7A 3IG1A 5C24B 2BQUA 3GYNA 3LF0A 4EUVA 3SMZA 3MEGA 1GH8A 2VA2A 1WEXA 1JLCB 2MY7A 3I5CA 2N4CA 2BR0A 4HLBA 3KHRA 4IG3B 3VQSA 2KYZA 1UEVA 4UY8T 3Q8QB 2LQBA 5L1LA 2X51A 2ZH3A 3FMWA 5EUHA 2RS8A 3MTJA 3WC2A 1CVJA 4MH8A 2KM8B 2IVMA 2AWZA 3S01A 2XY7A 2VV5A 1FDAA 4LIRA 5MAOA 3MAHA 4Y65A 1L3UA 3CC7S 2C3MA 4TU8A 1B0TA 4ZVFA 2MKCA 1R8PA 2O01C 2K1RA 5L1JA 5J2MA 1NK0A 2KU7A 2DNGA 3MM5B 3NGDA 3KMQA 2C3PA 5C42A 5H9EJ 2UUWA 1KQSR 3MM9B 3T5HA 2R7RA 1B0VA 4YDDB 1SB6A 4OX7A 4DBQA 4EBEA 5KFVA 2KG1A 2UV8G 5E0OA 4I6WA 2IHR1 3TVZA 3OTDA 4ES2A 4ED2A 3MCSA 4J5OA 2R8GA 4FN5A 5DG7A 2OMOA 2V8HA 1Q86T 4O44A 2AJQA 4R8UA 1RT3B 3CCUS 1RKIA 1YSJA 2BABA 2DGOA 3D1HA 2V2KA 4IG0A 2QZ8A 2ACYA 1IUJA 2NPIA 2FC8A 4LVOP 2VFSA 1VK8A 5IM0A 4ZCIA 1S6QB 4DFJA 3JB9k 2MYFA 3MF5A 2JJ4D 5KG2A 2MB0B 2ZOGA 3LH2S 2VA3A 2UUAF 1FRHA 4KKOB 3MUMP 1BQXA 2J6SA 2EKYA 1B0PA 2UVVA 1LWCB 2ZM6F 2HRYA 1HMVA 3IR5B 2BBEA 5B0BA 4RBUA 4DUZF 2I5JA 1NU4A 3NS6A 4F50A 1N0UA 1G7CB 3FNNA 4H54A 2XGPA 2BACA 2V5HG 2Q66A 1X4AA 1D8YA 5CYJA 4LFAF 1LWEA 3DLEB 4YOEA 4A8KA 1VQOS 1TL5A 4YUDA 5J2QA 4OL8A 1X4FA 2FGOA 2N3OA 3SZ2A 3B78A 4Y2KA 4NX9A 2R9LA 3I5AA 4IQXA 2JEJA 3ENWA 2OPSB 4YB1P 1DQ8A 4X4OA 2P6TA 2VBWA 3BGRA 4FP9A 5A8WA 1TK8A 2CDQA 4NYOA 1P1LA 4RBVA 4LUBA 5HMXA 2RU3A 3MWBA 1U1NA 4ETXA 4H4KC 2J0SD 2UXCF 4X4NA 3M2VA 2FJWA 3ZZ0A 1IN0A 2I38A 3T9ZA 2D9OA 3M4XA 2XB2D 1ZETA 2VPZB 2F1FA 5GAGU 1XMBA 3IS9B 5KFHA 3DLKB 5LXRA 2AX0A 3Q8SB 2HGNA 1NK9A 4ELTA 2N4DA 3KG0A 1SUQB 2CIMA 3SYZA 5AXLA 4A8FA 4OLPA 3M1VB 2ZD1B 4B3TF 1M1KT 5CD4H 3G6XA 2ILZA 2V8DA 4OIXA 3LWLA 4YY3F 5HN0A 1U47A 5K8OA 3V81B 4RWWA 1VQKS 3VAKA 2LEPA 3FRYA 1H3DA 1P8GA 4B9NA 4OI6A 5GADI 4X66F 4EFAC 3LP2A 4DL4A 5HMWA 3SSRA 3DCAA 1FO1A 2ZBCA 2YKNB 3POTA 3QAEA 4TU7A 1VIXA 1A6LA 2WRMA 2VG5A 5D8HB 3DMJA 3MD3A 4ES1A 3H20A 2VL1A 2VFTA 1IBKF 2ZC3A 3CJ3A 3C66A 3OLBA 1BQNB 4JI4F 1HWLA 3R1LA 2RB7A 4ZKAA 4DN9A 2J9CA 4UY85 5D3GA 4IDKB 1OQ6A 3BQ2A 5KFJA 2R7QA 1VC5A 2KG0A 4G6VB 3M9MB 3G8QA 3HFKA 3OL6A 2EC0A 2OH2A 1KLMA 1IM4A 3IWXA 4DEZA 2LA4A 2W24A 4J9PA 2CQIA 4WIIA 1RDRA 1FKPB 4CT8A 1VQ7S 3R5AA 1SJFA 4DL5A 3EYZA 1C1CA 3MEGB 2G9OA 2F40A 1E6YB 2VODA 1R8HA 2VUGA 2MKIA 1D9DA 1MROB 2FVSA 2LKZA 5KFZA 2HS4A 3BDPA 2B9YA 4F3OA 1LKZA 3OBIA 3TAPA 4KHPF 2J9DA 5CA5A 1JK9B 4JI5F 4FXDA 2L9DA 4GKJF 1GX5A 1CG2A 4LF5F 3DOKA 4IH6A 2EVZA 3SCLE 3CB4A 4JI2F 2QSFA 1Q1KA 2J7UA 1VFJA 2ZH1A 3AA8A 3HO1A 4DOZA 5A8RA 3I0RA 2RQ4A 4NRUA 1RA7A 3TNVA 1T8EA 5E3AA 3G86A 5E3CA 3R5DA 3G8TA 1KN6A 2AGOA 4P2SA 1QJHA 1UEUA 2B7CB 4I2QA 1S77D 1WTFA 3MM5A 1SKSA 1TKDA 2KXNB 3NAIA 4WU2A 4OHYA 1K8AT 2KZZA 3GE9A 2YWGA 3C8YA 4Q2LA 4CT9A 4K4ZA 1Z2LA 2YQ3A 3CDAA 2EPIA 3M32B 3MMAB 1DLOB 3IR6B 3DRYA 3LW5C 1QLNA 1N36F 1I1GA 2BV3A 1R31A 3IGVA 3TVKA 3JAMY 4YP3A 4JI1F 2HNZA 5B0EA 4O3NA 4EBCA 4DQIA 1RT4A 1YITS 2XMUA 2OIHA 3J7Z5 1URRA 3BB5A 2XSJA 3MEEB 4KPYA 1FDNA 1FERA 3CDEA 1WACA 3N9UC 4IG0B 1QUPA 2OPRA 2MMYA 1VRUB 3CJKB 4YB7A 2EWHA 4DMZA 2AJ1A 2MQPA 1GX6A 4OQJA 2RDJA 1TZ0A 3W2VB 1S0NA 4ALZA 3SQGA 4B9TA 2EI5A 2L08A 1N8RT 3QLHA 4CO0A 1ZTTA 2HQ3A 3DOLA