3LW5C

Improved model of plant photosystem i
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
81
structure length
81
Chain Sequence
b'MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWGGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLAY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title Structure determination and improved model of plant photosystem I
pubmed doi rcsb
molecule tags Photosynthesis
total genus 3
structure length 81
sequence length 81
ec nomenclature ec 1.97.1.12: Photosystem I.
pdb deposition date 2010-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF14697 Fer4_21 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lw5C00
1Y5NB 1BC6A 2V4JA 2WB1D 1Y4ZB 4ID8A 2IVFB 3MM7A 1FRJA 1KQGB 1H7WA 1Y5LB 3MM8A 3GYXB 1JNZB 1R27B 1GAOA 2FDNA 2FJBB 3LW5C 2UZAA 5L8RC 1DFDA 3MM9B 2C3YA 1JNRB 1PC5A 1D3WA 2PDAA 2Z8QA 7FDRA 2XSJA 1FDDA 3OR2B 1DAXA 2C3PA 5BYQA 1XERA 4XDDA 2Y0SD 1FD2A 3OR1A 1DURA 5BYRA 3MM9A 2FGOA 2FJAB 3IR6B 4YDDB 1BLUA 2C42A 1K0TA 2VKRA 3EGWB 4Y28C 2C3MA 2VPXB 1F2GA 3MMCB 2FJDB 1FEHA 1B0VA 5CHCB 3HKZD 1FERA 5E7OB 1BQXA 1SIZA 1FXRA 1KEKA 4KT0C 1JB0C 3MM6B 5CH7B 4AYBD 2WAQD 2GMJA 1F5CA 1WTFA 1B0TA 1AXQA 1FF2A 1KQFB 1BD6A 4CI0B 1VJWA 2FD2A 3MMCA 1GTHA 1PC4A 1FDBA 7FD1A 2WSEC 1RGVA 3IR7B 3OR2A 1FDAA 2ZVSA 2FJEB 1FRHA 1G3OA 3MMAB 3IR5B 3MM5B 4OMFG 1FRXA 2C3OA 2GMHA 3EXYA 1IR0A 5FD1A 1FDNA 1BWEA 2PA8D 3C8YA 3MM6A 1SIWB 1FRMA 1H7XA 4L6V3 2PMZD 1F5BA 1FXDA 4XDCA 1C4AA 1IQZA 1Q16B 1FRLA 1FCAA 3PNIA 2V2KA 3OR1B 2VPWB 4OV1A 1H98A 3MMBB 1CLFA 1C4CA 2V4JB 3MMAA 1GTEA 3MM5A 1H0HB 2O01C 1HFEL 1FRIA 2VPZB 3MM7B 4RKUC 3MM8B 3EUNA 4DHVA 2VPYB 1G6BA 1SJ1A 2WSCC 1A6LA 1B0PA 6FDRA 1GT8A 6FD1A 1Y5IB 1FRKA 4XK8C 5BYSA 1ROFA 2WSFC 1FTCA 3MMBA 2C3UA 2XSJB
chains in the Genus database with same CATH superfamily
4JV2A 4UUXA 2HFNA 3P5BP 3G96A 4EO8A 3GYXB 4C48A 2KXNB 4C0OC 2UZAA 2HWHA 2MSSA 1RTZA 2Z8QA 2OAUA 4MFBB 2C3PA 2LEAA 1C1BB 1TV6A 1S49A 1XERA 3M8YA 1WKLA 3MF5A 2FJAB 3J7AN 1UWAA 4RPFA 2VKRA 3EGWB 3CE8A 2R7XA 1N32F 3KLGA 4DV6F 2ZH2A 2M5YA 2RHSB 4MIBA 4LFBF 2CJAA 3WHIA 3DGPA 4AYBD 2GMJA 4KKOA 4DU8A 3ULHA 2IC3A 2R7OA 1YITS 4F7VA 1FKOA 1VMBA 2HQCA 4OJ1A 4ALZA 4NLPA 3DRPB 1NDLA 1Q95G 5IV3A 4J9MA 3UCGA 4YY3J 1FTRA 3PJ9A 4HHUA 4DV5F 1RDRA 2QT7A 2BQRA 3ENWA 2R8HA 3ZO7A 4RBVA 2HHSA 1QSLA 1MU2A 2XMVA 1BWVA 4QPTA 3CJ3A 5HQ8A 3LWMA 3TNVA 1F2HA 1FA0A 2HBZB 4JYAJ 4DN0A 3LGNA 2FLOA 3DYAB 1Y10A 4EK2A 2AJ4A 3OSNA 2W25A 3D6TB 4EGLA 2EPIA 3NCQA 4LRBA 4LF4J 5HATA 2QGFB 1HQEA 1EETB 3AOAA 4F4AA 2AX0A 4DPXA 4URQU 4OI0A 3NNAA 3NXZA 1KR4A 4LF6J 3G8QA 4J37A 1FX2A 2N4DA 1EIYB 3G6VA 2PIIA 4A47A 3OTOJ 4KHMA 2GJFA 3MZIA 5LT5A 2MZ1A 4OHXA 1HI0P 5B0BA 1H98A 4EWTA 2APOA 4F3QA 1OSDA 1TK8A 3QJJA 3NMAA 1VRTA 5CYMA 1JJHA 5A0YA 1CJTB 2QX0A 3TZYA 3OJSA 1S97A 1YGYA 4UQTA 3J7A1 4IO9Q 3F73A 1FI4A 2F5GA 1MMNA 3TQEA 1N54B 4TKTA 1RHQB 3F44A 2CYYA 2DNLA 3RU0A 2ZZMA 4I4BA 1KONA 3LQVA 3KHGA 1R6YA 3G8SA 3DNCA 1Y00A 3EVMA 1ZTTA 3PY8A 4LRFA 2V2QA 2ZDPA 4GC6A 4FF2A 3CW2C 2OTLS 4K4YA 4YUDA 4IDKA 3I9V9 3GP9A 4G6VB 4TLRA 4ENOA 1U1NA 1UVLA 1M0SA 4ZVSB 2B9WA 2KJWA 4X4PA 3HVWA 2J76E 3LALA 4N47A 3OFFA 4V19J 4Y0FA 2X3DA 2E5GA 5EWFA 2RRBA 1M1KT 1PAUB 4H4KC 3EWGA 3HI9A 3KK1B 3IS9B 4Y2CA 3ZC4A 3C6UA 3TX8A 2XMMA 5KT7A 3KUHA 3OTCA 3UVJA 5AT1B 2Q6BA 1KLNA 1HNVB 2FJBB 5HLFA 2M70A 2GFFA 1MNEA 5LXRA 1CJVA 2DNRA 1VK8A 4GC7A 3CJ4A 3VF0B 2JEIA 5J2MA 2DNHA 4NLYA 3HULA 1WG5A 1TUGB 3K5PA 2YKMB 4LFCF 3CJSA 2JWNA 3UDLA 3FKBA 3R5JB 2MKHA 2DGXA 2IIHA 3CJ2A 1N36F 1YJUA 3FK4A 4C8LA 1JQGA 1YI2S 1JMTA 3IM9A 3BQ0A 1I6JA 5KFJA 2KXHA 2QTWA 1N4LA 2ZBCA 3BN4A 1D0EA 4G65A 4GRSA 2R2TA 2B0GA 3D6HB 2DISA 3NBPB 4DFPA 3Q83A 3SFGA 1XR7A 1DQAA 2JEFA 1SUQB 1UA1A 4EO6A 3SYZA 1GX5A 1RHUB 1SKRA 4ZPAA 4DWIA 4CO0A 4FPRA 3TX0A 1NSPA 2HQGA 3O6QA 5D8HB 2RQCA 2GGPA 4BBYA 3DLLQ 3POTA 3EE3A 3CDAA 3DCAA 4I56A 2CPEA 2MZJA 3D28A 1TKXB 2QSWA 2V68A 4AFFA 2Z2ZA 3ZZOA 1RWVB 3SXLA 3BF4A 1T0TV 2GC8A 3RRGA 4F4XA 2ASYA 2OPRB 3N28A 3TJ9A 4A8QA 4X4TA 4N76A 4IH7A 3W8GA 4IH5A 2HHVA 2DRBA 3C15B 4HACB 2YNGB 1S0OA 1Y0HA 4WZQA 4DDFA 1JLQA 3CD0A 4ECUA 5KOWA 4YN3B 3AH6A 4J7CA 1E6YB 2ZEJA 3W2VA 5FDLB 3GPAA 2WSCC 2PFFB 6FDRA 1ZAVA 2M8DB 2DK2A 1F3VA 2P6TA 2CQPA 3TP2A 4ZPBA 2LDYA 4QZVB 2YWWA 2CWKA 5DETA 2FY1A 4I7FB 1HBUB 4H4OA 2DGQA 3R5BA 1I94J 3BKFA 3I9ZA 3W9JA 2BX6A 4QYRA 4TY8B 3M6WA 4G1IA 2GVDA 4P72A 4P2MA 2LQBA 3T1YJ 1TK0A 3GFYA 2HG4A 2NSBA 4QW9A 1U0SA 3NGRA 2V5HG 3E3XA 2KYXA 3LA0A 2W24A 5E7OB 2HZAA 3IGVA 4KQZA 4GKJJ 2K7JA 2GX8A 3I0SA 2U1AA 3TUPA 3V4MA 2DXDA 2DEJA 3GR0A 4DV3F 3KJFB 3FDSA 5GAEI 2UV8G 2EFNA 3MM6A 5FLXU 3EYZA 5C24A 2ZNYA 4XPEA 1IUJA 3KLHB 1FRLA 1J5OA 1F60B 1G4CA 1Q8IA 3DOMA 3LANA 2VF3A 3BGRB 4O4RA 3SCIE 2RF2A 1NK6A 3R1HA 4W90B 4FYXB 2XSJB 3D67A 4OYMA 1VI7A 2HNZB 5A6PA 1RTJB 2VB6A 3RUBL 3ZTSA 1MLAA 2W2MP 1DQ9A 1WSVA 2HNYB 1VLYA 1KVIA 4QR2A 5HROB 2WK4A 4P7TA 1ZZFA 4OZ1A 4NI2B 3NGUA 4J91A 3GE9A 1RI7A 3I6PA 2BYCA 1RWOB 4A8KA 2FD2A 4AXJA 3W2WA 4NWBA 2ZC4A 1S1UA 4IG3B 3CCZA 1C0TB 3PFOA 2LQ9A 2C3OA 1PYSB 3VVTA 4J9LA 2R7UA 2HQ3A 4F50A 4ZHRA 2MPUA 1GTEA 2GA7A 3FRZA 1K8AT 1Y7PA 3B4MA 2CJXB 2J0WA 2VPYB 1A6LA 5LSLA 4HI1A 4ZLNA 1FXLA 4PWDA 2DNKA 2R7QA 1HWUA 1NMEB 3KJNB 3PR4A 2HHPA 5DDQC 3QATA 3G6XA 3K5MA 1WSRA 1NZAA 3QYYA 4WF9Q 5DM7Q 3D1QA 2DY1A 3OL7A 1T7PA 4QIGA 2ZBRA 3CCMS 1DBDA 5JVHQ 2ZM6F 2FGOA 4ECTA 4ER8A 1OJ4A 4Q45A 4USVA 2WCXA 4CO1A 3NMRA 4YFUA 4GVBB 1SKUB 2OPPB 5KOXA 4DPTA 1FDAA 4RZRA 2BE2A 4R5PA 4DQRA 5KG6A 4P9SA 4LVOP 4P75A 3WBZA 2HFSA 1YKWA 5K8PA 3QFHA 2P9EA 1X4EA 4RNNA 3HJFA 2H4YB 1HFEL 5CD4A 3JTPA 3P96A 2NS1B 3H7HB 4LF9J 3D0GE 4B02A 1KLMB 1T05A 2RDDA 5BYSA 5HBMB 2XO6A 2Y8YA 2HHHF 4JI2J 3KOAA 2YNFB 3EM1A 4RU2A 4I6WA 4DFKA 3DDKA 2QFIA 3HX9A 5HVHA 4OYIA 2YWEA 4DG1B 1VQOS 4X4QA 1UKUA 1YRTA 2X1FA 1UVIA 2C3MA 3MR2A 4YB5A 4A8XA 4YQWA 4DR1F 3G82A 3QT5A 2WSEC 3M8PA 5D0EA 4Z7CA 3MFHA 4B9SA 2IM0A 2KHCA 3OL9A 3CMQA 3EPGA 2XNQA 3QO9A 3R7NB 2CPYA 5KT2A 2VBXA 3A3NB 1UA0A 4G3IA 1JJ2R 3J80U 1QD1A 2FHMA 2JDJA 3W63A 1TL7B 5SZTA 3MAHA 2ZOMA 5IM0A 1LFPA 1RHRB 5IQQA 3CWJA 2UXCF 3MOZA 1PO6A 1G7CB 2CWXA 3R2DJ 1R27B 2B5JB 4NX9A 1JNRB 1I51B 7FDRA 3DRSA 3BDPA 1Q7YT 3BKTA 5K14A 2DR5A 3CDUA 2XSFA 3PYEA 1XTZA 3TEGA 4CP5A 5H9EK 2H5EA 3CMAS 3O8WA 1FEHA 2P9GA 1NDPA 2B6AB 3HKZD 1TU0B 1RWKB 1SQGA 4J90A 3IAS9 1JLGB 2FYXA 2F9DA 2X7IA 1GTHA 2V2VA 3L3CA 1FRHA 4JI4J 3ILIA 1WORA 4CIOA 1S9EB 3K5LA 3PCOB 2PMHA 1F5BA 3HVTB 3GV8B 2HMIB 2V8VA 1CC8A 3FUYA 3PV8A 4JI3F 1F1BB 4NLGA 2DHHA 2V4RA 4CLYA 4EFAC 2YNHB 3CCJS 1UTAA 2OO4A 3BBFA 5L9XA 1XNQJ 1P27B 3GJTB 3KLVA 2DNNA 2P6SA 1P6TA 3M2UA 3T3FA 3X3UA 1TKZA 4KHPJ 2FVCA 4LUBA 5IWAF 3OFGA 2HYIB 3O44A 1LK5A 4FDFA 4ANEA 1N5YB 4J5OA 2R7RA 5BYRA 3N4WA 2LYVA 3TA1A 1U1QA 1LWFB 3SZ2A 4O3PA 4J9NA 1NK9A 1BQMB 3DOKB 1C1BA 2OSQA 5HQMA 1NK8A 1DQ8A 4DU7A 5HMZA 2D3O1 2DEIA 2RQKA 2HGMA 4DPYA 3TVZA 1WD6A 4M5HA 3AODA 2K2PA 3JSMB 5EUHA 3R1LA 1RCOB 3Q22A 5B0AA 2RUGA 5D0GA 2LLZA 2V4JB 4NA2A 3HD1A 5AJ3J 4NLTA 4EZ6A 3DRPA 2MQLA 2UUCF 3OV7A 4NCGB 3MEDB 4DHVA 4MKYA 2F4VF 3GG0A 2ZJQQ 1Y5IB 2GHWA 3CT9A 4DX8H 1R8BA 2WVDA 2H5JB 5F8JA 1NB7A 4WFAQ 5AXKA 3M9NB 3GQCA 1K0VA 1FRJA 2K8GA 3GG1A 1XMOF 3W60A 4DV2J 4NASA 1VQLS 4ETZA 5CZXA 2ASJA 4DPWA 5MAOA 1OO0B 1F6TA 5EWGA 2LA4A 5ETRA 4K4TA 3IWLA 3OTBA 3D2WA 4WKYA 2XYGB 1M90T 4HHHA 3DYAA 4OI1A 3HPOA 4PWUA 1BGXT 3MMCB 3CC7S 5CQGA 1R0BG 1N33F 2C2ZB 1D9FA 3H2VE 4CO3A 1U2CA 3BS9A 4C3KA 1JLBB 4F0KA 4QQBA 4JI6F 3VQSA 1EETA 1B0TA 2VL1A 1UCNA 2I9SA 1EQ0A 2V8GA 1D09B 3U1LA 1RWMB 5BXIA 1XEZA 3UI3A 2YPZA 4TXSA 3HFZB 1XR6A 1FRMA 1LXJA 5CD4H 1NBEB 4RNOA 4M5GA 1Y3JA 1X5OA 1MWYA 3E8OA 3GV5B 3TJAA 1Q5YA 4RKUC 3CSKA 4CQ1A 2GO8A 4DR2J 3AJDA 4DLGA 2AT1B 3W8PA 1MWQA 2FVQA 2VQFF 5BR8J 4LREA 1Y5LB 3HFVA 4KRWA 5KFIA 4CT8A 3UN2A 2K7KA 2IDLA 1X4GA 4ZITA 5ETLA 2MQOA 3AD8C 2MKYA 1CEZA 1GK8A 5J1EB 2HHHJ 1RB0A 4DL4A 4YHHF 3ZXWA 2FVSA 2HKEA 2QMUB 1U1PA 4LIRA 4F4YA 4CH1A 1S10A 4X4OA 2DBBA 3I5AA 2KTQA 4ED8A 3O3LA 4KO0B 2AZ3A 1OQ3A 1N8RT 3BH7B 3UD4P 1VDHA 2IHR1 3MD1A 5D4LA 2J6UA 3DMJB 2VU5A 1EX8A 5KG5A 3OFEA 4K59A 4CLFA 2E5LJ 3MCMA 2I5JB 4NE9C 5J2NB 3QRQA 2CUYA 1R0AB 2E1PA 4ZVQB 3LTOA 3OTDA 5GADI 2XWXA 2WSFC 3TR5A 2DNYA 1RAFB 4Y2AA 1BXNA 4K4SA 2HHUA 2IM2A 4P74A 1HBMB 1RU2A 3PEHA 3KK1A 3IS9A 1FDDA 2XS7A 4N5SA 3G8TA 4LR8A 4OQJA 3HK2A 1A9NB 3UWTA 2MKSA 4V19X 1HNVA 1R89A 2BOPA 3GJQB 1O6XA 2E5HA 1F0XA 2OEMA 2OD4A 3W61A 1HIYA 2IYIA 2L48A 4WZMA 4O4GB 3H40A 3BSNA 1U8SA 4M5MA 4FS2A 1KP6A 3P3DA 2YKMA 2FPHX 2RKIB 1IBLJ 4RUCA 1V3ZA 1X31C 2CNLB 1H6KX 4J9RA 4WTYA 1C4AA 3FZBA 3H4DA 4N56A 4X4SA 3BPSP 1RAGB 3CF5Q 2UV8A 4Q5VA 1L3UA 1T3OA 2R3VA 1Q8KA 2WHOA 1X4AA 4U9RA 1KTVA 3NBPA 3P5TL 5IT9U 5DLFA 3VAGA 3FNNA 4C8NA 4ZVPB 5K5MA 2Y9HA 1SUQA 2GZOA 1O8BA 2AMCB 3GCWP 2YWHA 4ZCKA 1HNXJ 2VA2A 2CQ3A 2MLXA 1ZA1B 2HBYB 3OR2B 4UOCA 3DHWC 1V3RA 2P5VA 2UU9J 1MG7A 1TAQA 4Y2KA 2GS8A 1FD8A 2RRAA 5GAGI 2B9YA 2VBWA 4X4RA 3ZZUA 1YG0A 1YBTA 2RHQB 4UTGA 3LAKA 3L4BC 4DBQA 4M95A 2BKPA 1TKXA 2DPIA 3HT0A 4FXDA 3L7UA 4J9QA 1KOHA 3NS5A 1T9TA 3IR5B 3I0RB 2YTCA 3QAUA 3EXYA 2OPRA 4QBUA 4K50A 3J81U 2HWIA 2K3IA 3OR1B 2GNKA 2A2DA 4WXOA 4YB7A 4PAAA 1N5VA 3MM8B 3C15A 4HACA 2YNGA 5KFHA 2X1AA 4TLQA 2JFDA 5CYQB 2FHJD 1HD1A 2GJ2A 4RNMA 4K4VA 1E6YA 2YQ3A 5FDLA 1RAIB 2XWYA 4UY85 1BY9A 4U7UK 2VZ9A 1RT2B 3PIPQ 4YR0A 3EDRB 2CQ2A 3KDNA 1XMQJ 3PW2A 1M5PC 1SKWA 2J8AA 2UUWA 4I7FA 1HBUA 2MMYA 4ZJLA 3ETOA 4MAKA 3MPVA 3A8KA 1RT5B 2JNJA 4I68A 3CDWA 2HS4A 2ZKTA 2R9LA 1NO8A 2GIFA 1FF2A 4AL6A 4PXDA 2V6AA 5J2QA 3Q2SC 4MTPA 4J9OA 3M2VB 3J7YU 2D3ZA 3NKYA 4W4MA 2KB2A 3P45B 2B4PA 2BVZA 2QFJA 5E2QA 3EGZA 3A8EA 1X4HA 2KFNA 3KLHA 4CLUA 1HHQA 4IYQA 5EX0A 3TVYA 2IYGA 4AL7A 3U1NA 1HNZJ 5LM7E 1HHSA 1DJ0A 1YJTA 1MROB 2YKNB 4QIVA 2RVJA 3ELHA 2XSJA 1SV5A 2C2EA 3UD5A 3KKFA 2MQ8A 2BKOA 4Z7YA 2E29A 4RWWA 1RTHB 2E9TA 5HQLA 2HNZA 3HF5A 1RTJA 3Q89A 3HSZA 5KT5A 3DN9A 2HNYA 3DRYA 1IBMF 3FMWA 4ZVRB 5IQ6A 4E2FB 4DL7A 2P9CA 5HROA 1X7VA 2H54B 3K5OA 2XO7A 2DXEA 1NRKA 3IBFB 1KFSA 4NYOA 1NHVA 1VBKA 4NI2A 3MM5B 1PBUA 1FEEA 2W01A 1WUUA 3H5UA 1ZM9A 3D4JA 2I38A 4RW6B 3V6DB 3AHPA 4IG3A 3S7RA 4QU6A 1C0TA 4UZCA 1WHWA 1DY3A 4RJVA 5KFKA 5C42B 4USHA 4IKAA 4G1PA 2BM1A 3WIUA 3JB9k 3GYNA 3BO2A 1QUPA 1NHKL 2VFRA 1LW2B 1URRA 4CNYA 3SV3A 2IC3B 3CJ5A 1G1XA 3CXCR 2DH7A 2HAIA 2FJXA 2W2PP 3TUJC 4DF4A 3AD7C 4UW2A 3MEGB 2CRLA 3UR3C 3ITHB 4JV5F 2BE7D 3THPA 3TO8A 2OUGA 1HNWJ 2A18A 3VAMA 1T9VA 1UFWA 4ZK7M 3DU5A 4W92B 1MN9A 4U67Q 3QT7A 4ELTA 2V9WA 1KFDA 1PG5B 1HQUA 4GVBA 2NZCA 2ZC3A 2OPPA 2QO3A 4JOUA 3PW0A 2WVEA 4LIWA 2HQIA 2F8EX 3M8RA 2D69A 4LFAJ 3T5LA 3OHBA 2VOPA 4FBTA 2YKAA 1JLCB 1HHTP 5GMKa 4RW7B 2RMLA 6AT1B 5EHHA 3QJLA 1P9YA 1RU1A 4DX7A 2C3UA 4KT0C 4DR3J 1RWNB 1VBZA 3UD3P 2HLTA 2CNNB 1T03B 1RP5A 1KLMA 3E2EA 5E3PA 3CCTA 5HBMA 2C28A 4XIUA 2YNFA 4IOCQ 4KV8B 4GO7X 2UUAF 1UL3A 2AGOA 2KVIA 4DUYF 3R5AA 2Q43A 5ETOA 2V34A 1H73A 1PJ6A 5KG1A 5EGYA 3HHEA 4DG1A 2ZJRQ 5CYMB 4JI7F 5A0YB 1W25A 2QLXA 5B7WA 4OJHA 4KB7A 5AXLA 3CC2S 4TU8A 1QAYA 4FPIA 4LRCA 1RZMA 3THVA 1YZ7A 3BM7A 1XK8A 2C22A 2BRLA 3LGMA 4AXIA 3N79A 1SJFA 1FNXH 1H0HB 2QA4S 3L9ZA 5H1SV 5F8MA 4KGMA 4R8UB 2YBVA 2B56A 2HVIA 4ZDNA 1T9WA 4DV0F 3MCOA 1VJQA 1TP7A 4YMEA 2ROGA 4O0IA 1TL7A 3QRRA 2NUHA 3NCPA 3M2RA 1CPZA 1FHTA 3C16B 3FZ2A 3CD5A 4MKBA 4B3SF 2XS2A 2J7KA 4F4KA 4DR7J 1EKRA 3GSDA 4ZPCA 3EZUA 1B0VA 4F2RA 3MTKA 2YH0A 4U7UD 3I82A 3NGDA 3MR7A 4QU7A 3HSJA 1R8AA 3TW0A 3U7JA 1DTQA 1ZTWA 2XZWA 2B6AA 4PQAA 3R7SB 1JLGA 4ED4A 1R31A 2RU9A 3M05A 4NZ7A 2UVUA 4OYOA 1S9EA 2R7VA 5KTQA 3Q8VA 3HVTA 4CO5A 2HMIA 1I3OB 1Y4ZB 1U25A 4L73A 4BDPA 2YNHA 1NAQA 4X64J 3GJRB 2YXLA 1YRXA 2B8PA 2HNDB 2O5DA 2AJFE 3FBEA 3DGVA 3JXOA 2NR0A 2BJ8A 1AB8A 2VV5A 3J7Z5 4M5NA 2DB1A 3QGPA 2CDRB 2CIMA 3D0IE 1N5YA 2FJDB 2HFVA 4OI6A 2Y1IA 2ZZNA 2W9CB 3M6XA 1LWFA 1ZS6A 1BQMA 3DOKA 2VC1A 1AXQA 1UVKA 4ZP7A 2ZH4A 1HBNB 2EG1A 1JKHB 3I96A 1VQMS 3RW7A 1MMLA 5H9FJ 2DO0A 1Y9OA 2H65B 4K0KJ 4RUHA 1S1XB 3J80Y 2LXUA 1S76D 3JSMA 1J5EJ 4YR2A 4CCHA 2X51A 2BMBA 4GMKA 3VQTA 4I1TA 3LUYA 3RYLA 2ADCA 1NU4A 2V4JA 5E5NA 4PG4A 1TL3B 4WJBA 1O0PA 3KTQA 4NCGA 3MEDA 4ZCMA 3QWPA 4RW4B 4JI5J 3PJWA 5CA5A 2JEGA 4U95A 2HK3A 2MZTA 3PYGA 2UXBF 1DAXA 1VFJA 1C0UB 4PYAA 1NPRA 2JHEA 4ILLA 2HRUA 4O3RA 3LPYA 4LF2A 3OVBA 2DNMA 4DR5F 1YJWS 4WYWA 1R43A 1X5PA 3QJPA 2YWKA 1FKAF 3IFEA 3MMCA 4HI2A 1WACA 3VAIA 4RX6A 2FLPA 1LWEB 2W4CA 3MECB 5KFWA 1JLBA 4C4WA 1IR0A 4M5JA 2RQ4A 1N0VC 4FZVA 2BQ3A 2DTJA 1UVNA 1NK4A 4U6PA 2GHPA 5KFSA 5HK4A 4TU9A 2RH3A 3BBCA 2IVYA 1X4BA 3P6YC 4N7TA 5GMDA 3DDNA 3I0SB 1D3WA 3T5JA 4OI2A 2DGTA 5K8MA 2BE9B 3QT6A 3M6VA 2OSRA 2Z0GA 4I67A 3OFHA 1S6PB 2IJNA 4BWJA 3R5GA 3W65A 4DZDA 3N5BA 4ZPVR 3QWUA 1VRUB 3NGTA 5J1EA 2JLGA 5HMWA 4PG6A 3NL0A 4C11B 5HSPA 2AYGA 3W1YC 1IBCB 5ETQA 2RRNA 1M5HA 4KBIA 2AV5A 4J9KA 1U26A 4IFVB 2W7AA 3SCLE 4KO0A 3ILLA 4EMDA 2BJEA 1PJ5A 4RNHA 4WU3A 2LP4A 2DNOA 3HHLD 4KC5A 3UQSA 4IFYB 1UWBB 4ID5B 1SL0A 3MWBA 1LQ9A 4ZN3A 2I0XA 3DMJA 3G9CA 3H90A 3WC0A 1SC6A 4O23A 1KHVA 1CQMA 2I5JA 3JQKA 4RO0A 1EQMA 4O3NA 5HVFA 5J2NA 1R0AA 3OSPA 4X66J 2YQ0A 3CUNA 4YY3F 1IKVB 4Z37A 4TVAB 1FK9B 2XHCA 2DPJA 1X60A 1FFGB 1NHUA 1E6VB 1W2IA 1TZ0A 4KH1B 1HBMA 4O0NA 1ULRA 4ZHRB 3GIJA 2BABA 1TTHB 4A8WA 3GU0A 1NDKA 3UDVA 4JYAF 3ZTQA 1YJ9S 3C46A 3GFXA 2QMWA 1SQFA 2CNKB 1X9SA 2D7SA 2MJNA 3PHEA 4O4GA 4P6QA 4LF4F 5A8KB 2HQDA 4OYXA 5DQIA 3DHXA 3BGUA 2CQGA 3QLHB 1F9EB 4RR5A 3I56S 1T3NA 4ITSA 4I6YA 2V2KA 2RKIA 3NRBA 1B70B 3N9UC 3D68A 3OHAA 4LF6F 4PKDB 2MHNA 1FWLA 2EC2A 4AQYJ 4ZS6A 3C6TB 4OX7A 2ATLA 3MAQA 4LRDA 2FZKB 3OTOF 3HHLC 2MQQA 2ZFHA 2XMWA 2AF6A 4EYHB 1FKPB 2JL9A 1VQ8S 4Y3CA 1RYRA 1ZZNA 2YVSA 4NYZA 4PUOB 4R5PB 4A8OA 2UVVA 1TFYA 1QAXA 2AZ1A 5DM6Q 4C0HA 3AB2B 4ECZA 4OHYA 1REVB 2NLWA 2YKQA 4OIXA 4KY3A 4DL5A 2JEJA 3OL8A 5F8GA 3BN7A 4ZIWA 4A46A 1UAWA 1EAYC 2MTLA 3PRBA 2J0SD 1LW0A 2IA0A 4F2SA 2OJ3A 1FJ7A 3AA8A 3GIIA 3ENVA 1SPBP 4OX9J 2CZ4A 1PKUA 1JJCB 3I0RA 5KG3A 2V0NA 4YB6A 4DV1F 5D3GB 1P1TA 3BYPA 2Z2YB 4F04B 4C8MA 4N77A 1Y5NB 4WK3A 4YDXA 2GIQA 4MYUA 3MM8A 2ZD1B 4DSEA 2YKOA 1B99A 1RTIB 2JFKA 2C3YA 5CYQA 3B82A 2H5IB 3DLJA 3ZZRA 3MR5A 3PX6A 2E1CA 1SJQA 3SSSA 3GWCA 2UP1A 4FF1A 2AJ1A 4OZJA 3T19A 2CZVC 1H2VZ 3OQ2A 5IC4B 4TQSA 1T95A 3LF0A 2XGQA 1DLOA 1RACB 1RT2A 1VGYA 2KXFA 4QWBA 4QWEA 2BEFA 4PZVA 4J9SA 1FO1A 4LSLB 1NJXA 5CH7B 2PFDA 3IO1A 5D4NA 2RNEA 4DEZA 1T94A 3Q8QB 1RT5A 4ATNA 1QTNB 4PQUB 4ZVFA 4OMFG 3FRYA 3JTNA 3H98A 3AY0A 3AQOA 1BMQB 4HEA9 3MDFA 3M8QB 4HTIA 1B7FA 3I87A 1RXOB 3I4PA 1CS4B 3DI6A 3M2VA 1RAJA 5IT9Y 1M1GA 4NXMJ 4DMZA 2C2KB 3AOBA 3T9ZA 1S79A 1Q78A 3PKMA 3AJ2A 2HFZA 2RDIA 2ZUGA 3HHKA 1FE0A 3TAMB 1U6FA 1ZBTA 2VFSA 4K7QA 3S6EA 3DC2A 3ILJA 2DR7A 2YKNA 1MROA 3K17A 5E3AA 4FYDA 3HDSA 4NXNJ 2IBOA 1GXLA 3SBMA 4TU7A 2DIVA 4XAKA 4WP9A 3IA0A 2PA3A 4ELUA 2KT5A 2PSZA 3VCDA 4WTOB 1BQNB 1NH8A 3VZHA 3FMBA 2Z2LA 3V5RA 2XI3A 3AQPA 5CABA 4IR1A 4OHZA 3J81Y 2PC6A 3UCZP 4F36A 1VIXA 2DGSA 2AKWB 1H74A 5LMNJ 5AXMA 4IOBA 4LT6A 5DLGA 3MM5A 2KU7A 4P2XA 1FRIA 2WZ1A 2CPJA 3TVKA 4X65J 5E41A 2GAHC 1D9AA 4RW6A 2MY8A 3V6DA 1RK8A 2BV3A 4LF5J 2B9XA 4B9LA 4PPZA 5BJRA 5C42A 4PABA 4C98A 3W9IA 2KYZA 3D6FB 3HHNB 2M52A 5E3QA 2ZHOA 2VQEJ 3PRDA 1O5JA 4Q8EA 3B78A 1TL5A 1LW2A 1U49A 3OD2A 1KC8T 4RNFA 1NUEA 1HI1A 2ZH6A 2V63A 2DGUA 4X2BA 3KHLA 2KZMA 2UXDJ 3ISND 4L72B 3MEGA 2LA6A 1I94F 3F0NA 3IRXB 4IRDA 3RBDA 3ITHA 4EUVA 4F02A 2L9DA 4MIWA 2R7SA 4DUZJ 1HWIA 1L3VA 2DRAA 2YKPA 5L46A 3T1YF 3E01B 1FJCA 4JI0J 4CDIA 2MKIA 2HFUA 1LOUA 4ECQA 2AGQA 2C2RA 4LF8J 2U2FA 1YHQS 4NEYA 3BGFA 4GKJF 3QIDA 4WWSA 4ZP8A 3KLEB 1SVDA 1S0NA 3T41A 1KHWA 5ETSA 1KQSR 1WOSA 1D8ZA 4WYLA 4Q44A 1JLCA 2NQPA 4RW7A 4EBDA 2LEBA 3M30B 2IRYA 1SC4B 3IP0A 1T03A 2J6SA 5ADZA 3OW2R 3JTOA 1DARA 3ZTPA 3CIZA 1QJHA 4KV8A 3GILA 2MGZB 2W4DA 2HBRB 3QZ8A 3RBEA 3NNHA 3R6LB 5LL6d 3SSQA 1FNMA 2OKQA 3DXBA 2W8LA 1QTMA 2CPXA 2D41A 5T7LA 3QRPA 2CA9A 4RUBA 3MAAB 4IH6A 3ISNC 3IXQA 1HWKA 2GQCA 5KFYA 1YJNS 1D8YA 5F3TA 4D3HA 1NZ8A 3KNGA 5KG7A 4KGZB 5L1IA 2VICA 1X5SA 4R8UA 4B3OB 2DO4A 2BUNA 3MM9B 2MLYA 1S77D 4R25A 2XB2D 2NXUA 5J1PA 2LDIA 3JYTB 3WC2A 4DV1J 2QG9B 3A3PB 1RT7B 1L3SA 2R42A 3C16A 1F2GA 1WG4A 4MT1A 4FVCA 2SXLA 1F9HA 3R3TA 3IGNA 1H2TZ 2RILA 2R8JA 3W5YA 1KQFB 1EHWA 4DFMA 1FWPA 4B9MA 1RE1B 2Z56B 2CZ9A 2WOMB 2BJ3A 3EJMA 4P2FA 4XDCA 1S0VA 1U45A 3IBCB 2BA9A 2G13A 2RD5C 3I4HX 1SH0A 5KG2A 4KSEB 4DQIA 2XLJA 3P4UB 2BR0A 2NREA 1N5TA 2NXNA 1D9DA 4M94A 1YDLA 1Q79A 1JJ4A 1OIAA 3SQGB 4IR9A 4NLXA 3NEKA 3I55S 1S1VB 2CJ9A 2F8MA 1HR0J 5E3RA 1LV5A 5T41A 5M2PA 5JJBA 4DV4J 4YR3A 2CQHA 2EFGA 2IRXA 3FCWA 4WU2A 4OX8A 1QAJA 2W2OP 2K3KA 3FQLA 1HPZB 2EFVA 3D0HE 4LF9F 2UVRA 2XQCA 2YNIB 4PWWA 3GMGA 8AT1B 4JI2F 2R2UA 1BLUA 4ZPTR 2HNDA 2E7WA 4G1QB 1GEHA 1M5VC 3H20A 3H2LA 5F8IA 1WTBA 2HZCA 2F65A 1Q82T 4FKXA 3MFIA 2W7OA 4P2SA 2BRKA 1RWWB 2OPSB 2W9CA 3N0VA 2AYEA 1VHIA 3VHQA 4K4ZA 3MI7X 1XJWB 5D0HA 3GB0A 3IM8A 4EU0A 1WC6A 1S4FA 1WI8A 5DG8A 3Q2TC 1HBNA 2EK6A 1JKHA 1K73T 4I64A 1UVMA 1IQTA 1R0CB 5HJYA 4QWCA 5H9EJ 1S1XA 4XO0A 1RLCL 5JUMA 2YPYA 4USIA 2YWFA 3R7BB 4CH0S 4LSNB 1B4SA 3AT1B 1C1CB 2RS8A 3VZIA 2W4PA 2VDHA 1TL3A 2MEWA 1R8PA 1NPPA 4UZBA 4RW4A 4PXBA 5L1KA 4WFXA 4KGXB 1FVQA 2DR8A 4IRKA 1C0UA 1MSWD 1VQ5S 4I2QB 2G4BA 5F41A 3QMQA 2ZE2B 1J2VA 1XNRJ 4KH0B 1S0MA 1ZETA 3CB4A 3EZ5A 4DV7J 1ZYQA 3OJUA 2E1RA 2KM8C 4Y2MA 1AZSA 3DU6A 4ZLPA 3R6GB 3G2XA 4H4MB 4HH0A 1N34J 4QIWD 5DGAA 1U47A 3A1YG 1LWEA 1S6OA 3MECA 4K2JA 5GAHI 4P7VA 3CCES 2V8PA 5F9NA 4EZ9A 4ZPDA 2XI2A 4HDGA 3HLUA 4JI4F 1VRQC 2QN6B 3DLEB 1FJGJ 4ETXA 1GXUA 2CVEA 1UEKA 1KD1T 3H59A 1YWXA 1ZM2A 5J2QB 1QVGR 2VBYA 1WNEA 2PI5A 1B7YB 2MSTA 3OVSA 1RSCA 3OXFA 3W5ZA 4B3TJ 1XNQF 2KT3A 1NXIA 4KHPF 4NLUA 2DHSA 2DNQA 1S6PA 2I1RA 2EC0A 1O51A 1F5CA 2JOQA 4OYPA 2M4MA 5HMXA 2XY7A 1VRUA 2MLZA 1OYEA 5HAOA 2GVZB 1KQKA 2Q66A 2XEXA 2PA8D 1S12A 1SI9A 1SV5B 4C11A 3ONQA 4A8MP 2HLUA 1S99A 1SL2A 1ELOA 3NWRA 3MPWA 1KKHA 4E98A 4UT4A 4IFVA 4DI6A 2DGOA 4TY9A 4DQPA 3C19A 1S1TB 2EBGA 1FRKA 2ZNZA 2ZWPA 4IFYA 1UWBA 4ID5A 2FTRA 2YWGA 3A13A 3BPDA 2NSCA 3OLAA 2DNPA 5GAEU 1K44A 2RE1A 5AJ3F 4C9DA 1VLOA 4K5RA 4C8YA 2ZDOA 1N6QB 4M8LA 2K1RB 5M2RA 2AEJA 2B8QA 1IKVA 3M9OB 3PO5A 4YDDB 1FK9A 3R8YA 2GCFA 4U7CA 1TELA 3QIPB 1E6VA 2D9PA 4DV2F 5LMUJ 4WIIA 5ETMA 1V3SA 1ZPVA 2K06A 2RDJA 2BACA 1ACMB 1IKYB 5E0OA 1CJKB 4H54A 2CG4A 4GO5X 3V81B 5IV4A 5HN0A 5DDOC 5IC6B 1WC0A 2ZH5A 1NB2A 4CWBA 3CVKA 1U7LA 4K4XA 5AXNA 3G87A 1EARA 4QJVA 3IG1B 4Q43A 3IRWP 2HW3A 3RZAA 2M3DA 1S7HA 5A8KA 2W9BA 1ZOTA 2N3LA 2MKKA 5U47A 3QLHA 1JLEB 2WVFA 4EBEA 4M63A 4KYZA 2G2OA 1KSPA 2CQBA 3L09A 1CULB 4DL0C 1U4BA 2FLLA 4L74A 1U1MA 3C6TA 3HJVA 3RB0A 1HQUB 4CM2A 4DR2F 2CJKA 5KT6A 1FKPA 1NDCA 2VBZA 1S48A 4FNHA 4ZN1A 1K9MT 2JH3A 5L38A 5BR8F 4B9VA 4PUOA 3KNAA 4R0JA 2QC3A 2DGWA 4QWDA 5CCMA 2MZQA 3CJKB 1PJ7A 2E66A 3KJQB 4H4KA 2CQ0A 7FD1A 1REVA 3TJ8A 4CZCA 2J9DA 1Q8BA 2VC0A 3TARA 3C2PA 4CYUB 3T1HJ 2EK1A 1SH3A 2H4WB 4R0EA 1QM9A 4NCAA 4OLOA 4C7QA 2CADA 1NCLA 3VGTA 4USMA 1QVFR 2LVWA 1EJ7L 3I32A 1HA1A 5D3GA 1OQ6A 2UUTA 3L7OA 4OYWA 2E5LF 2G2YA 1RHKB 4ZLJA 4LVNP 2FC9A 5K20B 1ZAXA 2Z4PA 5BYQA 1Q5VA 2AWZA 2KO1A 2ZD1A 1U2RA 4BLGA 2QA4G 1RTIA 5C7PA 2PT0A 3Q8YA 4B3RJ 2IAJB 3MD3A 3T6BA 2WTFA 3JS9A 4IUFA 3CCLS 1UJ4A 4JI1J 3BB5A 5HVGA 3RR7A 3Q0AA 4QYZK 2ASDA 3QAEA 4BWMA 1RGVA 1UZDA 4CLZA 2Y1JA 2AU0A 2HVDA 4KPYA 4LSLA 4NLOA 3M2RB 1FXDA 2F1FA 1OPIA 3ET6B 4P71A 1DHMA 2HRTA 4PQUA 3SV4A 1Y11A 4CTAB 4CO2A 1OMSA 1G2EA 3ZNUA 1B0PA 3H5YA 4AE5A 3M8QA 1IBLF 4QIEA 1Q53A 2BXJA 5ETKA 1CS4A 3CDEA 1KN6A 2JZ5A 3MOJB 2FDNA 4JI8J 3EGVA 3QQCD 1DTQB 1RTDB 4E8UA 4OHVA 3H25A 3R27A 3M32B 1UPPA 1WC4A 3TAMA 4NA1A 3FSXA 1B3TA 3IBWA 2KRBA 3PM9A 1FNOA 4B3MJ 2KVQE 5ITHA 1HNXF 2YX4A 3ZZTA 2EFPA 2E7XA 2ZUAA 1VBXA 4NYPA 3KG4A 1AYEA 2UU9F 2G9OA 3UDEA 2XBPA 5FD1A 1BQNA 1H7XA 2WB4A 1LXNA 2YX1A 4ERDA 4WP8A 1GQEA 1RBAA 1DTTB 3PXGa 1Z1ZA 2VPZB 1ITPA 5I3UB 4HDHA 2CNOB 2MZRA 3F41A 1J27A 3KLIB 4NRUA 2EFQA 4JUZA 1IJEB 1K1QA 1GX6A 2NYHA 3W3SA 5I42B 1QY7A 4NMLA 2OEJA 3EVWA 3PO4A 4OX6A 4AUKA 4ZJQA 2C42A 1AFIA 3DM2B 2FQQB 1KVKA 3OLBA 4DCJB 4DL2A 2ZBPA 1WTFA 2AHOB 1XMQF 2O67A 3GR1A 1I1GA 5J2PB 1IXKA 4IG0B 4ZCLA 1SL1A 3BYRA 3IRXA 5KFMA 2OTJS 3NOCA 4OV1A 2B51A 4M5DB 4N8NA 3TZZA 1YSJA 1VQYA 3E01A 3HSGA 4JBCA 1V5VA 3G71S 3HD2A 4M1KA 3JSBA 2DYAA 1KRPA 4HT5A 2DH9A 2GMLA 3I31A 3KLEA 4PG7A 2O66A 2PE8A 4GVLA 3OXGA 4RBTA 3KLFB 1HI8A 4USKA 3R97A 3OUYB 3KMQA 2PO4A 3UPFA 4RW9B 1HW9A 4BCAA 1TKDA 3M30A 2V50A 1HNZF 2PD1A 1X0FA 2XC9A 3SQOP 2VODA 1UMJA 1JX4A 2CQCA 1QUVA 1LNQA 4L3KA 2B43A 2M9KA 3HSDA 2WONB 3IMQJ 1NK5A 2MGZA 3HCXA 4WFNQ 3D54A 2ZOGA 3TI0A 3D5MA 5C25B 4X62J 2IPOB 3CCQS 2ATCB 3VAHA 2KL8A 3HO1A 4ZVEA 1L3TA 3K5NA 4LR7A 4Y65A 4X84A 2EXUA 3MAAA 4Q8FA 2DCUB 2Y8WA 2JVRA 4DZ6A 3WDOA 2LQJA 1GXTA 3UN3A 2XNRA 2XCAA 2EKYA 2DCLA 1GAOA 1REGX 1KTQA 2W7PA 4OL8A 4RW8B 3AB4B 4DLEA 3OBIA 2A2CA 4B3OA 2X3GA 1ZA2B 3MM9A 5IS2A 3T6JA 3FGVA 1JLFB 1ZAWA 5KFEA 3UNGC 4NLSA 5KFNA 4C8OA 2HVHA 2FZGB 3JYTA 4FYYB 5FIIA 2B7CB 2KRRA 1N48A 3SMZA 9RUBA 3PTWA 1RT7A 1KEKA 1UEVA 1KNZA 1HMVB 3LP2B 2ILYA 2O3DA 4OZ0A 3K8VA 4L6V3 2DHGA 4PCQA 4TQRA 3KYLA 3PX0A 4ES2A 1RISA 3EDQB 3HM9A 1TVRA 4QR1A 1HNWF 3O1LA 2WOMA 4ZJOA 1GT8A 1N5QA 2C2OB 2HHXA 2Y0BB 1RKIA 3MR6A 2IM3A 3M8SA 5DS7A 2NYIA 1YZ6A 4M5IA 3SDEB 1UETA 3B8HA 3NLCA 4ELVA 1EB0A 3OT9A 3SQGA 4LFAF 3CJTA 1Q8LA 1S1VA 3FCVA 2CKWA 3MPDA 3ZFVA 2V8HA 5L1JA 1OY6A 5ETTA 4CH7A 4DR3F 2MDAA 5I3QA 2J0QD 2DRDA 5GADU 1YJVA 4FYWB 1HPZA 4LQ9A 3GZ7A 2YNIA 5MLCV 1QSSA 4USJC 3N6MA 3VGSA 5JMNA 3CCVS 4G1QA 1EP4B 2MY7A 2HHQA 2J9EA 4PYDA 3BQ2A 4KFBA 2BANB 1TMMA 1RBOB 3NGKA 2M0GB 2KI2A 4PXCA 4OHWA 3X1LB 3KG1A 1FCAA 2FHOB 4XTTA 2OPSA 1UVJA 4ICLB 3P49B 2KJVA 2OP5A 4DR6J 4ILMA 3SCJE 3HP6A 4GKKJ 2VH7A 4OZ5A 1HARA 3LAMA 1RT6B 3AXMA 3VR1A 2PI4A 2IVFB 4M5KA 2HURA 4DSLA 2XS5A 2LQ5A 3H4BA 2IA6A 1VQ6S 2XLKA 3IWXA 1LW0B 4OI4A 1IKXB 2CQ1A 3GJSB 3D6MB 3BGOP 1FFWB 1NK7A 4LSNA 5C5JA 1C1CA 2BW2A 1B64A 3P8BB 2E44A 4QOTA 3TUIC 4EBCA 2B7BB 3ZZ0A 4AL5A 3QSYB 2ZKUA 2ERRA 2J0XA 3ZTOA 4I2QA 2ZE2A 2MKCA 2QL7B 3HMJG 4DR7F 4OYZA 4CLWA 2W1BA 2B4UA 1BE4A 2L3MA 4U96A 3DOLB 1KBRA 3MMBB 3HZEA 2X1BA 5GAGU 2XCPA 1DLOB 4QPXA 1YTYA 1Q0NA 4H4MA 1IBKF 4HR2A 2WW8A 1R8HA 2NXEA 4IOAQ 3UR0A 5A76A 2H3EB 4F25A 4ID8A 5D77A 2QYGA 1N32J 3M4XA 4DV6J 2L08A 5D6GA 4LFBJ 3U1MA 3LGHA 3DLEA 5DJBA 4CRJA 2F8HA 2BZ2A 1ICEB 3MCNA 3GIMA 3EPIA 3C66A 4TNOA 3PYFA 3L7PA 4WKRA 3DI6B 3NNCA 4OZ3A 4HH1A 4X64F 2G0IA 4DV5J 4ES1A 2N4CA 4IQXA 1PIEA 4BS2A 3WIVA 4CI0B 3PW7A 3D9BA 3AXKA 4FBUA 3W62A 1FRXA 2OMLA 2YX7A 2FJWA 1YBUA 1UFKA 1CLFA 4N8OA 4NEZA 1GH8A 2GVZA 5AE1A 3MR3A 3MM7B 4RWXA 2NXJA 1SJ1A 4ZVUB 4OI3A 1YLXA 2VKZG 4I2PB 2DHXA 4PR6A 2ZOFA 2Y1LB 2HWTA 3EXCX 3DLGB 1KQGB 5EX3A 1S1TA 5D15A 1AA1B 5GVQA 4LF7F 2G0CA 4K0KF 3NP5A 3RRHA 5A8RB 1X5TA 1J5EF 1WOOA 2R4FA 1RAEB 3MXHP 2AIRB 3BSAA 4U8VA 4TN2A 4NLWA 3H5XA 2J7UA 3RAQA 4EI2A 2AD9A 3PX4A 3UW1A 4RU9A 1N6QA 5CHCB 2K1RA 3FEXB 3KXDA 1FERA 2VHGA 4JI5F 4EYIB 3QIPA 2OIHA 2CPHA 1S57A 2DY9A 3DLBA 1IKYA 4V1Ak 2RJZA 2JRSA 4RL1A 2HFOA 1CJKA 3D1OA 4ZCIA 1S1WB 1WHXA 3V81A 1HNIA 2GV1A 4LR9A 1TKTB 3CJRA 3D7SB 5HL7Q 2I2YA 2GQQA 4J9PA 3IG1A 4I6AA 1BC6A 1I5OB 4K2XA 1U1LA 2O1PA 2F63A 1JLEA 3G4SS 2JSXA 3BBBA 1RT4B 4DR4F 1CULA 3K59A 5HANA 3MURP 2Y1RI 3PZPA 4C3MA 3FSIA 2C2DA 5B09A 2R7WA 2UUBF 4B9UA 5DZ6A 3R5CA 3AD9C 1GNKA 1F9FA 3KJVB 2HHWA 4ECVA 2HVZA 2MKJA 2M7SA 2IJRA 2OMOA 2OGUA 1QE1B 1TL1B 3BKUA 2AJ2A 2FJEB 3MEEB 3EMTA 4CLTA 2DXFA 3CJKA 1A0OB 2J6TA 1Q81T 1WC3A 3QGIA 1U6BA 2BW7A 2G2ZA 2AGPA 2ALZA 5LJ5Y 2JX2A 2IVMA 4LRAA 2O01C 4OJGA 1N56A 4QWAA 4B17A 3K7RA 4HYKA 2VD3A 3RGIA 2YQ1A 4CYUA 4ZVHA 2D9OA 1TMJA 2MZSA 4ED3A 5K8NA 3GIKA 4U8YA 2XM3A 3GFHA 4LFCJ 1IN0A 1NJZA 2F4FA 1N36J 1U02A 1IWGA 1IM6A 2N82B 1VISA 3BO4A 5T7LB 5K8OA 1LKZA 1NKEA 4F3OA 1WJ9A 4X66F 3NS6A 2FB0A 1WC5A 2E1MC 3RB3A 2A6MA 1RWXB 3GFZA 2OPQB 3K2YA 3NS7B 3HHLB 4AT1B 3UN5A 1APSA 2IAJA 3W64A 3A4TA 3CJ8A 1HD0A 1NM2A 2GMHA 1NH7A 1FDNA 1BWEA 2ACMA 1H38A 1F5AA 4LJMA 5A2QY 2LECA 3Q8PB 3C14A 5I4MA 1S9GB 2DNGA 1U09A 1VR6A 5D4OA 1SJ3P 3ET6A 1U48A 1JXVA 4CTAA 4UOHA 3PYDA 1UW4A 2H51B 4ED1A 1JIHA 1T9YA 2X1GA 1VQ4S 1M5OC 1D1UA 2HSEB 5ETVA 2XYHB 2AW0A 1HBOB 1YVFA 4DN9A 3HT3A 2IFXA 2AP6A 4AQYF 3V6HA 1IBKJ 2CJBA 2HGLA 4NPOA 3TRGA 1VC0A 1CJUB 1U1OA 4DSJA 3K58A 3LP1B 1RTDA 1TFWA 2FZCB 1Z2ZA 3M32A 2XMAA 3TA0A 4X4UA 3M8WA 3OVAA 1JLAB 3WX4A 3RBZA 3VGUA 3FJ2A 2EEYA 4DXLA 1VJWA 5DQHA 3PRVA 2GW8A 4WXWA 2Y3YA 1S9FA 3IR7B 2D3OR 2VG6B 4UOGA 2ROEA 4DCPB 1N52B 2W2QP 1SXLA 4ED2A 4CLLA 1WI6A 1NSAA 2OEKA 1SBRA 2CQ4A 3OXLA 4RUAA 1VK3A 4HLBA 4DX5A 3NAIA 4KGVB 5KFUA 1LWCB 2MQNA 1DTTA 1RAOA 1S4EA 4C8KA 3TEHB 5HP1B 1H7WA 5I3UA 4MK8A 4P73A 2GIRA 2XYPB 1SKSA 4OX9F 1WKJA 2PEBA 3OL6A 4USWA 2XGPA 3KLIA 2CQDA 3GSIA 3NG8A 2FHKA 1W2BR 4DV3J 4QW8A 1WEZA 2GHVC 5I42A 3QFWA 3PIOQ 2WW4A 2H48B 3MEKA 3QGHA 1FWKA 2EBEA 4MIAA 2L41A 2V94A 2GJIA 2JLFA 4LF7J 2LU1A 2PN6A 4ANCA 2KT2A 3ENAA 1WOPA 2PEHA 5EN1A 3JAMU 1V9OA 3DM2A 2Q6CA 5KFBA 4MFBA 2XMTA 1RT3B 5LOQA 4Q2LA 1HW8A 1Y3KA 1BHNA 2W8KA 4K5SA 2I8EA 1HL6A 5F8LA 2ZH8A 1VHFA 2VPWB 1WELA 1UPMB 5J2PA 2F7VA 2FHJA 4IG0A 1M5SA 3JQMA 1GFWB 3US5A 3SCKE 3CTRA 5A8WB 1AUSL 3T9NA 3CJQA 3AAWB 3DLKB 4M5DA 4ED6A 2KHDA 2DD8S 2XZTB 3EX7B 2ILZA 3V6JA 1CC7A 2CVIA 4OJ3A 1UJ5A 2VFTA 2WBMA 1S6QB 1PCAA 3N01A 4ES3A 1AZSB 3H2UB 2VDIA 4NXMF 3VTIA 5KG0A 2VJVA 5KFVA 4J9VA 3CO9A 3LP0B 2G1HA 3LH2S 3KLFA 1MW7A 3OUYA 1HWJA 4UF4A 3A8JA 4RW9A 1XR5A 4ZOSA 4E0DA 1RHJB 2IMOA 4B08A 2J7WA 2EW9A 4CNZA 2VG5B 1S5ZA 2B3TB 1WF2A 1FDBA 2XULA 4MK7A 3SIPB 5T14A 4DR4J 3MMAB 2AQ4A 4NXNF 1FE4A 4WE1B 2W2NP 3UE2A 3ZZYA 4UY8T 2OH2A 3DRRB 2WONA 2UUBJ 2N7CA 2QSFA 5KFCA 5C25A 1T9UA 2ROPA 2XLIA 2ZM6J 2BOAA 2XY6A 4Q2MA 3VAFA 5F3ZA 5HMYA 4UQGA 3T5HA 1XMBA 1P8GA 3IWNC 5KFPA 3G6YA 4ECYA 2E5JA 2GQ2A 5LMNF 4LBPA 2ACYA 2MQPA 4LBIA 2CG8A 4X65F 4RW8A 2HS3A 1OPZA 5KFDA 2HVEA 2ZBQA 2MB0B 1TUWA 1CJTA 4LF5F 3O5TB 1U1KA 4ZVTB 1W7WA 1BQXA 3QBCA 4TYAA 2E5IA 2HRYA 4HL9A 1JLFA 3VALA 2VG7B 2ASLA 1ZH5A 2VQEF 1IKWB 4BC9A 4O3SA 1H72C 4FNIA 2QLWA 1PGZA 3T1AA 4MKAA 4I69A 2OLWA 5KG4A 4C6AA 2OFGX 1SCJB 1HMVA 1NPKA 4B9NA 3LP2A 1IVZA 2UXDF 3T5KA 2C2MB 4B9TA 5E3CA 1RCXB 3CGIA 2DHAA 3BGLA 4CLPA 3EZOA 3LWLA 1S7IA 1S59A 4DUZF 1RT1B 4YEAA 2AYMA 4PXEA 2KG1A 3ZZZA 4A8FA 2CPDA 4JI0F 2CFXA 3LO3A 3FBFA 2NZ4A 4DR1J 2HAFA 4ECXA 4LF8F 3O2IA 1YRUA 3J81j 1WC1A 1FESA 3SDEA 3KG0A 3GYGA 3VAJA 3BV8A 4Y00A 4TYBA 4YOEA 3PVXA 2W9BB 5DRKA 5B08A 4YP3A 1FXRA 3CIMA 2MYFA 3EICA 3LPEA 2W9AA 2J8SA 1GMUA 1WG1A 2NPFA 1RKJA 4PG5A 3W66A 2UXCJ 2ZHAA 3CCWA 3Q86A 2BDPA 5B0CA 3Q23A 1RWUA 2IJFA 1EP4A 1T8EA 1IQZA 2FGCA 4A8YA 2D74B 3D3CJ 2BANA 4ANDA 2MJUA 4UOFA 3FEZA 5IT0A 1V6HA 3BR8A 1SC3B 2IDEA 2HIQA 5SUHA 2NXCA 3N5FA 3DXSX 4ICLA 5DO2A 2WB1D 4Y2IA 5B0DA 2WVBA 4YB1P 1QDUB 2R2RA 5IT4A 3LW5C 4RBUA 1MWZA 1RT6A 5KFLA 1VIOA 4AD6A 2M2BA 2WVCA 4DSFA 3CULA 5IZHA 3WZ0A 2DJWA 5KT4A 3CD7A 4Y28C 5HO4A 2ZBIA 2HPUA 3ISZA 1RUSA 5K9FA 1IKXA 3QT8A 4JI3J 2FC8A 2HBQB 1IR1A 3K57A 4F26A 3S01A 1AW0A 3HXMA 4F8RA 2A6OA 1S72S 3VV2B 3RAXA 1VQ9S 3ENQA 5IWAJ 2Z57B 4DSIA 3UNYA 2VIHA 4FYVB 3KK2B 3V4IB 4NCBA 4Q7AA 2B4OA 4UUWA 2PMWA 3M7VA 2HEKA 3QGGA 2PGCA 2ZITA 3Q8UA 1U0HB 3DRXA 4C97A 1HYSB 4WFBQ 2HK2A 3DOLA 4A48A 3MMBA 3HVRA 1NSKL 3CCUS 5G0RB 2LMIA 1AT1B 3KUGA 2ZVIA 2E9RX 3SEOA 1YBAA 1RAHB 1OWXA 1JNZB 1UP1A 2IM1A 1BUXA 3G6ES 4ZP6A 5E33A 1UZHA 1LWXA 3DKDA 1Z2LA 2HS0A 1IWAA 5AE3A 4KJIA 3UO0A 2ZWOA 1XQIA 4DQSA 1DURA 2KFYA 3BJYA 3J7YI 2FY8A 2AX1A 3QZ7A 4LMZA 4F3MA 2LXIA 5LXYA 4WFYA 2HIYA 3UFCX 1VQSA 2Q3PA 3NCRA 2DNZA 3B6BA 1ZM3A 3W5XA 5KFZA 5IFMA 1HR0F 3B4DA 3NOGA 3EGNA 3S1TA 1NJIT 2EG2A 4DV4F 2UUCJ 5D78A 1WHVA 3D3BJ 1JWWA 3CO0P 2KKHA 5CZVA 1XIQA 1NJYA 2F4VJ 2M88A 4HTJA 2MQMA 5I3PA 4TY8A 1R8CA 3M1VB 4P52A 2QMXA 2KN4A 5KFRA 4Q0BB 1XMOJ 3A3OB 1XN9A 2XG8A 1RYSA 2EI5A 1RBLA 5A6WA 3KFWX 3BEGB 3KK3B 3Q24A 3PR5B 1X8DA 3EVOA 2Z58B 3BSCA 4EEYA 1SJ4P 5KFGA 1VQPS 2MXYA 3L95X 1U24A 2CJYB 3MM7A 3VVUA 2CPZA 1N33J 4M5LA 3CEDA 4FS1A 1URNA 2KM8B 1DFDA 5JXSA 1P9QC 4I2PA 4JI6J 4PEOA 1LK7A 4XDDA 1NNDA 3DLGA 3RB4A 2NPIA 3HHDA 2LCWA 3WX8A 3ZZPA 1TQLA 3BGRA 1FJEB 3F56A 5A8RA 4O44B 1CBKA 3FFIB 3KUEA 5ETNA 3S8SA 3M9MB 4DCOB 3RTVA 4L75A 4USUA 1M1HA 4F0MA 3Q8SB 2QEXS 2F3JA 2ZH9A 4ZVOB 2VQFJ 1QLNA 1JXLA 2B4VA 1CG2A 3CDBA 4X4NA 1SQEA 4WK1A 2VA3A 3CD6S 3G86A 4NLVA 1C4CA 4DS5A 5GMEA 1XNRF 2CQIA 2Z2MA 1IJFB 3J7ZT 2ZH7A 5KFQA 4DV7F 1MMDA 2A10A 2QYCA 1S1WA 1CSJA 2YH1A 4YHHJ 4NMXA 1TV6B 1TKTA 1V5IB 3HKWA 2YY3A 1N34F 1RA7A 1U1RA 3MPUB 2FVRA 2FIUA 5F0WA 1T9XA 5FJ4A 3FCHA 3BZQA 2EKNA 1NJWA 3BREA 3KMSA 3KLGB 4DQQA 4FF3A 2JLEA 1RT4A 3DGPB 4KKOB 3NY0A 4DF8A 1FJGF 4FF4A 2QLFB 1FKOB 3JSRA 2A1BA 2IBKA 1OSCA 2GAGC 1HWLA 2DVIA 2VFUA 3TZXA 3WQPA 2ZJPQ 4JV0A 1YX2A 3NAHA 3GTYX 4C3LA 2AJ0A 3KJVA 4B3TF 5C2GA 1LEOA 2P2CB 1YIJS 2PMZD 1WDDA 1QE1A 1TL1A 3QSIA 4C8ZA 4ILRA 1MU2B 3MEEA 1EZZB 3N6LA 4OYAA 2XMKA 2Q79A 1YK9A 5FLXY 2JJ4D 4ECSA 1C2PA 1WEYA 1OS5A 2AYBA 2ADBA 4W98A 2CPFA 4Y34A 1HQEB 3IAM9 3PKYA 2OHDA 1NKCA 1GMVA 2POKA 2QLBB 5F9LA 1HLWA 4J9UE 3H42A 5KT3A 1VQNS 3PACA 2QRRA 2RQMA 2QLJB 2OPQA 3HHLA 3TUZC 4N41A 2AJQA 5EDWA 5J1NA 4DS4A 1RA6A 1VRTB 4MYTA 4ZMMA 1CVJA 2XTJP 1FX4A 1SH2A 2CXEA 5ETPA 1N88A 2RAQA 3PG9A 5LMUF 2RU3A 2LXFA 3TA2A 5CXTA 4URGA 3CNQP 1Q7LB 9ATCB 2BJ1A 4D3GA 4KR0B 2ALYB 4KGKA 3TAPA 4ZKAA 1GMWA 2G1DA 4QCLA 3VGVA 4DPOA 2IRUA 1AROP 1S9GA 3PW4A 1OY9A 4DPUA 3DDIA 3OTEA 4QIFA 4I0WA 4MJKA 3DLHA 2Y0SD 2RB7A 3R9LA 3JSYA 4KHRA 2R8GA 1HQ2A 2QA1A 3RJMB 4F4WA 5LJ3Y 3A8IA 1TVRB 2NCKL 2VPXB 1HBOA 2BJ7A 4IDKB 2DIUA 2HGNA 3IC1A 2DR9A 3FEYB 1VC6A 4URSA 4NLRA 1IR2A 1CJUA 2ZZTA 4ZVGA 3LP1A 2B5JA 3RW6A 2C2NA 1M5KC 2IY5B 4ZA1A 3CCRS 1Q86T 2F9JA 4MKVA 1G3OA 1TUVA 3BDEA 3GIRA 1U2FA 1JLAA 3AOCA 3KHHA 1H2UX 1Q16B 4O3OA 2RT3A 3V6KA 3BH6B 3C6UB 2VG6A 4OZNA 2CAJA 1FVSA 3MUTP 3UVJB 4NZ6A 4NLQA 1G6BA 4C2MA 3PJXA 4ECRA 2KZZA 1RABB 4A8SA 1YJRA 1U6ZA 4CLSA 5HLFB 2OELA 4ECWA 4KAIA 1CJVB 5J2MB 3ILOA 1LWCA 3T1HF 2D3UA 4DUTA 2FUG9 1PYTA 4KFBB 4QYZJ 1RAAB 3IN5A 2C1EB 2ZHBA 2V8DA 5HP1A 2XHWA 2RSQA 5B0EA 3PFEA 4HT7A 2V67A 2ZH3A 2KH9A 1NEEA 4JP8A 3FBBA 1YQHA 2V9KA 4BHQA 4K4WA 4QR0A 1JB0C 2JC0A 1W26A 4MMOA 1DRZA 1NK0A 3CMES 2H1YA 3CPWR 1BD6A 3ZTRA 1UFLA 1HKAA 5DDPC 4IQMA 1K1SA 4ED0A 1X9MA 5KFFA 2VFVA 2N3OA 3BQ1A 4B3RF 3RBXA 3ICLA 2AEFA 1WWHA 3PHTA 1RT3A 2BQUA 4JI1F 5KFOA 4MK9A 3I5CA 1KVJA 2LEPA 1SC1B 3W7BA 2EWHA 2DITA 3MUMP 2R2SA 4FXVA 2GGPB 3B54A 1IBMJ 4L76A 1PAEX 3POTB 2JC1A 1YJ7A 5A8WA 1F3FA 3MGJA 1VOMA 5DG7A 1ZPWX 3VWSA 3DLKA 4MH8A 5F8HA 3MPYA 2OFHX 2FVPA 1FD2A 1Q1KA 2N7YA 5IXUA 3RG6A 2A0FB 3D66A 3TOQA 3PDNA 3R5DA 2CPIA 3IR6B 1KS2A 5JVGQ 1S6QA 1JXEA 4ED7A 3H0PA 1WF1A 1SIZA 4F4ZA 4JI8F 3LP0A 3FQKA 4OYBA 1RWPB 3KWMA 2HQFA 2LKZA 4K8RA 2HHTA 4WPAA 1JLQB 3MCSA 4DFJA 4Y6IA 3W2VB 4DL6A 2VG5A 1X9WA 4B3MF 2L9NA 4HHJA 3NWGA 4WP3A 1H3DA 3QNWB 3MMAA 4YS2A 5F8NA 4ED5A 4LBHA 4NL5A 2JVOA 4ZIVA 4WE1A 1U8WA 3AA9A 6FD1A 2EVZA 2DKOB 4FKYA 4H4OB 3DRRA 5EWEA 3V2UC 1QAIA 2I6WA 1RLDA 2V4QA 3BO3A 1PBAA 3HFKA 1JK9B 3H8YA 5L1LA 4JV5J 2GVDB 2ZH1A 1N5SA 5L8RC 2EFOA 1FT8A 4ZLLA 2QE5A 4F67A 5LSRA 5CCLA 3TQ1A 3NGSA 2LQ8A 2MHEA 3R2CJ 3U02A 5RUBA 3GV7B 5GAHU 3OPKA 2WRMA 2DGVA 3C3LA 3CC4S 1AFJA 1SB6A 1WDTA 1UJ6A 1L5UA 5KFTA 2RUSA 4NRTA 5F0UA 2H9ZA 1P1LA 3JAMY 2BKNA 3MM6B 3LOUA 1WEXA 5C24B 2VASA 2D1CA 1J5OB 2XZDB 3DOMB 2B9EA 1X4CA 1TR0A 1UW9A 3QPIA 2VG7A 3GONA 1SIWB 2RF2B 4IRCA 1IKWA 5CAAA 4CM0A 5L39A 2QL5B 3ZNJ1 2UUAJ 1VS3A 3E51A 4DUYJ 1R7IA 8RUCA 1FTCA 2NUUG 2KFZA 1XWLA 3RR8A 4JI7J 3FBCA 2J9DE 2KDOA 1NKBA 4PRFA 7AT1B 3K89A 1RT1A 4L3NA 1WF0A 2P8IA 3TAQA 5HJXA 3TYTA 1VQ7S 1K47A 1VCTA 2FJVA 1CQNA 5IOLA 5DG9A 1VQKS 1HNIB 2GO9A 4FVMA 1GMWD 3W2WB 1S1UB 2VOOA 2LFVA 1TK5A 4LF1A 2A3JA 1VYAA 4FP9A 5THWA 2E9ZA 3K0JA 4C0BA 4DOZA 2UVWA 2XY5A 2V2ZA 5A2QU 1PC4A 1R6VA 4DV0J 4OZLA 3RAMA 3ADAC 2Z30B 3W9HA 4A4JA 8ATCB 3PW5A 1N0UA 2OD6A 4PWDB 2QL9B 3FVYA 4K4UA 1KWMA 3DFEA 4B3SJ 1RQ0A 2QA2A 1T02A 3A12A 1ROFA 3FSYA 2DH8A 3D1HA 5AE2A 3FC9A 3HVAA 5L9NA 3PEJA 1XC9A 4X62F 5B0GA 4KPCA 1RADB 2J5AA 2BM0A 2R7TA 1L3KA 2IMWP 4DX6A 2E7VA 2G0JA 4XPCA 2VJUA 4CLKA 4DSKA 3JQJA 2BJ9A 1MN7A 4USTA 1VC5A 2BE2B 2ABYA 3MTJA 1Q4RA 1ZM4A 4O3QA 1LFWA 4OV6A 3OR2A 4Z2XA 5KFXA 2M8HA 3MHYA 3VAKA 5KFAA 1PSDA 3M6UA 3C8YA 2RS2A 1SJRA 4F0HA 2V69A 3TZWA 1T05B 3UCUP 3PNIA 2XMUA 2LU2A 2F40A 2KG0A 1KDNA 3KK2A 3V4IA 5G4DA 1EKSA 1X4DA 3HZGA 1WHYA 5KAKA 1PYOB 4ZP9A 1X0PA 1U0HA 5DDRC 5DZ7A 4DL3A 3TANA 1HYSA 2CJQA 1WKKA 4OFZA 2RIJA 2FLNA 4RLEA 5G0RA 4WBFA 3OR1A 2E1AA 4LQ3A 3CJ0A 5B0FA 3G82B 1FFSB 1K0TA 4IO1A 1OY8A 3H5SA 3C14B 4WFZA 1TAUA 3M8PB 2BBEA 4NLDA 2COLA 4WCEQ 1T11A 1X4FA 2WAQD 4HVZA 3K8WA 3GCXP 5D4PA 4X4VA 3QO9B 4PPDA 2CDQA 1RHMB 1TL4A 1RJJA 3UDCA 2QJ3A 1QSYA 5IM0B 2Q1LA 1S6UA 2UXBJ 3M1VA 1IM4A 1XBWA 3EUNA 4Q0BA 2J9CA 4JV1A 3SFUA 4ZPWR 3GLJA 5DQGA 2DR6A 3DRSB 4NOHA 4DR5J 3BSOA 1NLKL 4NZ0A 3BR9A 3KK3A 5K14B 2HZVA 2BJDA 5CYJA 1KOOA 4DJBA 5H9FK 1PC5A 2PDAA 3AFGA 3RB6A 4KTQA 3KDOA 4LSZB 4CO4A 2VONA 4DR6F 5HI7A 3RRKA 1NSQA 2L9WA 2DT9A 5C2CA 4GKKF 3N6NA 3M8ZA 4P10A 5M2UA 2XMJA 2WBRA 3KHRA 4OLPA 3SI8A 1R3NA 3AJ1A 4KIAA 3THTA 1VBYA 3I5BA 3MUVP 4FXWA 4O44A 2QIFA 2ZVSA 3FFIA 1DZ5A 4PG8A 3TWZA 5DGBA 1Z4UA 1RTHA 4HKQA 1AUDA 4CT9A 1OYDA 3ETMA 3Q8RB 2OI2A 4S0MA 5LSOA 4WIQA 3SSRA 4BC7A 3U27A 2AEMA 1A7GE 3M2UB 4FN5A 2QV6A 4KE5A 2VUGA 4NA3A 1TKZB 4JB8B 5D0RA 2QZ8A 4OZ2A 2R8IA 3MMJA 1UEUA 3CCSS 2R8KA 4XK8C 1PILA
chains in the Genus database with same CATH topology
4IYQA 4M5DA 5EX0A 3TVYA 4JI4F 4JV2A 2IYGA 4UUXA 2HFNA 4AL7A 3DLEB 3U1NA 4ETXA 3G96A 4ED6A 4EO8A 1HHSA 1GXUA 2KHDA 1DJ0A 2CVEA 2DD8S 3GYXB 2KXNB 4C0OC 1KD1T 1YJTA 1MROB 2YKNB 3H59A 2UZAA 4QIVA 1YWXA 2HWHA 2MSSA 3EX7B 2ILZA 1ZM2A 3V6JA 2RVJA 1CC7A 2CVIA 4OJ3A 1UJ5A 5J2QB 2Z8QA 2VFTA 1QVGR 2XSJA 1SV5A 2OAUA 2VBYA 2C2EA 4MFBB 2WBMA 2C3PA 1S6QB 1WNEA 2LEAA 1C1BB 2PI5A 1TV6A 1S49A 2MSTA 3OVSA 1XERA 3KKFA 3N01A 4ES3A 2E29A 4RWWA 1RTHB 3MF5A 2E9TA 3H2UB 2HNZA 3HF5A 1RTJA 3OXFA 4NXMF 3VTIA 5KG0A 5KFVA 2FJAB 3CO9A 3LP0B 3LH2S 3KLFA 1XNQF 1MW7A 2KT3A 5KT5A 2VKRA 2HNYA 3DN9A 3CE8A 3DRYA 3EGWB 1IBMF 3OUYA 1HWJA 3FMWA 2R7XA 1N32F 4KHPF 4NLUA 4RW9A 1XR5A 2DHSA 4ZOSA 5IQ6A 4E0DA 2IMOA 2DNQA 4B08A 2P9CA 4DL7A 3KLGA 1S6PA 4DV6F 2I1RA 2J7WA 2ZH2A 2M5YA 2EC0A 5HROA 1X7VA 4MIBA 4LFBF 3K5OA 2CJAA 2XO7A 1NRKA 3DGPA 2EW9A 4AYBD 1KFSA 2GMJA 1O51A 1F5CA 4KKOA 2JOQA 2VG5B 4NYOA 2B3TB 4CNZA 3ULHA 1NHVA 2IC3A 2M4MA 1WF2A 1FDBA 2XULA 2R7OA 4MK7A 5T14A 1YITS 5HMXA 1FKOA 1VMBA 4ALZA 4OJ1A 2XY7A 1VRUA 3MMAB 3MM5B 2AQ4A 4NLPA 3DRPB 1KQKA 4HKQA 2Q66A 1FEEA 4NXNF 1FE4A 2XEXA 4WE1B 2PA8D 3H5UA 3UE2A 1SI9A 1SV5B 4C11A 3ONQA 4A8MP 2HLUA 3ZZYA 1S99A 4J9MA 4UY8T 1SL2A 3UCGA 1ZM9A 2OH2A 1FTRA 2I38A 2WONA 3DRRB 4RW6B 3V6DB 3AHPA 4IG3A 1ELOA 3S7RA 2N7CA 4QU6A 1C0TA 3MPWA 4E98A 4IFVA 2DGOA 4TY9A 2QSFA 1RDRA 4DV5F 5KFCA 4DQPA 1WHWA 2QT7A 2BQRA 1S1TB 5C25A 3ENWA 2R8HA 5KFKA 4RBVA 2ROPA 5C42B 2XLIA 4USHA 2EBGA 1FRKA 4IKAA 2HHSA 2ZNZA 4G1PA 1QSLA 1MU2A 2XY6A 2XMVA 2BM1A 3JB9k 4Q2MA 4IFYA 1UWBA 3GYNA 4ID5A 3BO2A 3VAFA 1QUPA 5F3ZA 5HMYA 2FTRA 4UQGA 3T5HA 2VFRA 2YWGA 4QPTA 3CJ3A 5HQ8A 3LWMA 1LW2B 1XMBA 3TNVA 1P8GA 1FA0A 1URRA 3IWNC 4CNYA 4DN0A 3SV3A 3LGNA 2FLOA 5KFPA 3G6YA 2IC3B 4ECYA 2E5JA 2GQ2A 3CJ5A 2NSCA 3OLAA 2DNPA 5GAEU 1G1XA 5LMNF 3DYAB 3CXCR 2AJ4A 2DH7A 2RE1A 2ACYA 5AJ3F 4C9DA 2HAIA 2FJXA 3OSNA 2W25A 4K5RA 4C8YA 2MQPA 2ZDOA 3TUJC 4DF4A 1N6QB 4M8LA 2K1RB 4EGLA 4X65F 2EPIA 3NCQA 4UW2A 5M2RA 3MEGB 4RW8A 2HS3A 1OPZA 1IKVA 3M9OB 3PO5A 4YDDB 2CRLA 5KFDA 1FK9A 2MB0B 1HQEA 1EETB 3UR3C 2GCFA 4LF5F 3ITHB 4U7CA 3O5TB 3QIPB 4JV5F 1E6VA 2AX0A 1U1KA 3THPA 2D9PA 3TO8A 4DV2F 4URQU 4OI0A 3NNAA 4WIIA 1BQXA 4TYAA 1V3SA 2A18A 1ZPVA 2RDJA 1KR4A 3VAMA 2E5IA 2HRYA 1UFWA 2BACA 3G8QA 4HL9A 1JLFA 4ZK7M 3VALA 2VG7B 3DU5A 1IKYB 2ASLA 4J37A 4W92B 5E0OA 1ZH5A 4U67Q 4ELTA 2N4DA 2VQEF 2V9WA 1KFDA 1IKWB 4H54A 2CG4A 4GO5X 4BC9A 3G6VA 4O3SA 3V81B 2PIIA 4A47A 5HN0A 5DDOC 4FNIA 2QLWA 1HQUA 1PGZA 3T1AA 4MKAA 4I69A 2OLWA 2ZH5A 5KG4A 4KHMA 2OFGX 3CVKA 1U7LA 3MZIA 4K4XA 2ZC3A 5LT5A 2OPPA 1HMVA 5AXNA 2MZ1A 4OHXA 2QO3A 4QJVA 3IG1B 4JOUA 4Q43A 3IRWP 3PW0A 1HI0P 5B0BA 4B9NA 2HW3A 3LP2A 3RZAA 4LIWA 1H98A 2M3DA 2HQIA 2UXDF 3T5KA 2F8EX 4EWTA 3M8RA 1S7HA 2APOA 4F3QA 1OSDA 1TK8A 5A8KA 3T5LA 4B9TA 3QJJA 2W9BA 1ZOTA 2N3LA 3OHBA 2MKKA 1VRTA 3NMAA 5CYMA 2VOPA 1JJHA 5E3CA 4FBTA 5U47A 2YKAA 1JLCB 3QLHA 1JLEB 5A0YA 5GMKa 1HHTP 3CGIA 2DHAA 4RW7B 3BGLA 4EBEA 2RMLA 3LWLA 5EHHA 4M63A 3QJLA 2C3UA 4KT0C 4DUZF 1RT1B 4YEAA 2AYMA 1KSPA 2CQBA 3L09A 1VBZA 4PXEA 3UD3P 2HLTA 2KG1A 3ZZZA 3OJSA 1S97A 4A8FA 2CPDA 4JI0F 4DL0C 1T03B 1U4BA 1RP5A 1YGYA 1KLMA 2FLLA 3E2EA 5E3PA 3CCTA 2CFXA 5HBMA 1U1MA 3LO3A 4UQTA 2NZ4A 2C28A 3J7A1 3C6TA 4IO9Q 3F73A 4ECXA 4LF8F 1MMNA 4XIUA 2YNFA 3O2IA 1YRUA 4IOCQ 4KV8B 3RB0A 1HQUB 1N54B 4GO7X 1FESA 2UUAF 4TKTA 3SDEA 3KG0A 3F44A 3VAJA 1UL3A 2CYYA 2AGOA 2DNLA 2KVIA 3RU0A 4DR2F 2ZZMA 4DUYF 3R5AA 2Q43A 2CJKA 5KT6A 1FKPA 2VBZA 4I4BA 1KONA 1S48A 3LQVA 3KHGA 4FNHA 1R6YA 5KG1A 3G8SA 3DNCA 1K9MT 2JH3A 5EGYA 5L38A 3HHEA 5BR8F 4B9VA 4Y00A 4TYBA 4PUOA 1Y00A 3KNAA 4YOEA 4R0JA 3PVXA 4DG1A 2W9BB 1ZTTA 3PY8A 2ZJRQ 5CYMB 4JI7F 5DRKA 5A0YB 5B08A 1W25A 2DGWA 2QLXA 2ZDPA 5CCMA 4YP3A 1FXRA 5B7WA 4QWDA 2MZQA 4GC6A 4FF2A 4OJHA 3CIMA 3CJKB 2OTLS 2MYFA 4K4YA 2E66A 4H4KA 4KB7A 2CQ0A 5AXLA 3CC2S 4YUDA 4IDKA 3I9V9 2W9AA 4G6VB 7FD1A 1WG1A 1REVA 4TLRA 2NPFA 1U1NA 1RKJA 4PG5A 1UVLA 1M0SA 4TU8A 1QAYA 2ZHAA 3CCWA 2B9WA 2BDPA 4CZCA 5B0CA 2J9DA 3THVA 1Q8BA 2VC0A 3Q23A 1RWUA 3TARA 2IJFA 2KJWA 3C2PA 4X4PA 3BM7A 1XK8A 1EP4A 1T8EA 1IQZA 2FGCA 4A8YA 2C22A 2D74B 2EK1A 2BRLA 3HVWA 3LGMA 2BANA 2J76E 3LALA 2MJUA 1SH3A 3OFFA 4N47A 4AXIA 4V19J 3N79A 1SJFA 1FNXH 1H0HB 3FEZA 4R0EA 1QM9A 2QA4S 4Y0FA 5F8MA 5H1SV 4OLOA 4NCAA 5IT0A 4KGMA 1V6HA 4C7QA 2E5GA 4R8UB 5EWFA 2RRBA 1M1KT 2B56A 2HVIA 3BR8A 4H4KC 2HIQA 4ZDNA 5SUHA 3HI9A 4DV0F 3N5FA 3DXSX 4ICLA 3KK1B 3IS9B 4Y2CA 5DO2A 1QVFR 3ZC4A 1TP7A 2LVWA 2WB1D 4Y2IA 4YMEA 3C6UA 3TX8A 2XMMA 5B0DA 2ROGA 5KT7A 3OTCA 2Q6BA 1HA1A 3I32A 4YB1P 4O0IA 5D3GA 1KLNA 2R2RA 5IT4A 3LW5C 1HNVB 2FJBB 1OQ6A 2UUTA 4RBUA 3L7OA 2E5LF 1MWZA 2NUHA 1RT6A 3NCPA 2FC9A 4LVNP 5KFLA 2M70A 5HLFA 2GFFA 3M2RA 1ZAXA 1CPZA 1MNEA 1VIOA 2Z4PA 2M2BA 5LXRA 5BYQA 1FHTA 2DNRA 2AWZA 1VK8A 3FZ2A 4GC7A 4DSFA 3CJ4A 2KO1A 3VF0B 3CD5A 1VC5A 3CULA 4MKBA 5IZHA 2ZD1A 4B3SF 3WZ0A 2JEIA 5J2MA 1U2RA 2DNHA 4NLYA 2DJWA 2XS2A 2QA4G 1RTIA 5KT4A 1WG5A 2J7KA 4F4KA 2PT0A 3CD7A 3GSDA 4Y28C 4ZPCA 5HO4A 3K5PA 3EZUA 2YKMB 2IAJB 2ZBIA 2HPUA 3MD3A 3ISZA 1B0VA 5K9FA 4F2RA 1IKXA 3T6BA 4LFCF 3MTKA 2JWNA 2WTFA 3UDLA 4IUFA 3CCLS 1UJ4A 2YH0A 2MKHA 2DGXA 2FC8A 3BB5A 3CJ2A 1N36F 3K57A 4F26A 3I82A 3S01A 3NGDA 3RR7A 1YJUA 1AW0A 4QU7A 3Q0AA 4C8LA 3HXMA 4F8RA 1YI2S 1R8AA 1S72S 3TW0A 3QAEA 3U7JA 2ASDA 4BWMA 1RGVA 1DTQA 1ZTWA 2XZWA 1JMTA 2Y1JA 2B6AA 3BQ0A 4PQAA 2AU0A 1I6JA 5KFJA 2KXHA 4KPYA 1N4LA 1JLGA 4LSLA 3RAXA 2ZBCA 1VQ9S 4NLOA 3BN4A 3ENQA 3M2RB 1FXDA 2F1FA 4DSIA 1D0EA 1OPIA 2R2TA 2B0GA 2DISA 1R31A 2RU9A 3M05A 3KK2B 3V4IB 1DHMA 3NBPB 4DFPA 4NCBA 3SFGA 4Q7AA 2B4OA 4PQUA 4UUWA 1XR7A 3SV4A 4NZ7A 4CTAB 2UVUA 4CO2A 1DQAA 1G2EA 2JEFA 3QGGA 2PGCA 1SUQB 1S9EA 2ZITA 1UA1A 2R7VA 4C97A 3DRXA 5KTQA 1HYSB 1B0PA 4EO6A 3SYZA 3HVTA 4CO5A 4WFBQ 3H5YA 4AE5A 2HMIA 1GX5A 3DOLA 4A48A 3M8QA 3MMBA 1IBLF 3HVRA 1SKRA 3CCUS 4QIEA 4ZPAA 1Q53A 2BXJA 4DWIA 5G0RB 2LMIA 1Y4ZB 4CO0A 4FPRA 1U25A 2E9RX 3SEOA 3CDEA 1KN6A 2JZ5A 1YBAA 1OWXA 1JNZB 1UP1A 2IM1A 4BDPA 3MOJB 3G6ES 2FDNA 3O6QA 2YNHA 4ZP6A 1NAQA 5D8HB 5E33A 1YRXA 1Z2LA 2HS0A 2RQCA 1DTQB 5AE3A 4KJIA 2HNDB 1RTDB 4E8UA 2GGPA 2O5DA 2AJFE 4DQSA 4OHVA 3H25A 4BBYA 3DLLQ 3R27A 1DURA 3POTA 2KFYA 3M32B 3J7YI 3BJYA 2NR0A 2VV5A 2AX1A 3J7Z5 3QZ7A 4LMZA 2DB1A 3TAMA 4NA1A 4F3MA 2LXIA 3FSXA 3QGPA 3CDAA 3DCAA 4I56A 5LXYA 2CPEA 4WFYA 2CIMA 3IBWA 3D0IE 3UFCX 1VQSA 2MZJA 2Q3PA 3NCRA 1N5YA 2KRBA 3PM9A 1FNOA 3D28A 2DNZA 2FJDB 4OI6A 1TKXB 2QSWA 5ITHA 2Y1IA 1ZM3A 4AFFA 2ZZNA 5KFZA 3ZZOA 5IFMA 3SXLA 2W9CB 3BF4A 1HNXF 3M6XA 2GC8A 1HR0F 3B4DA 3RRGA 3EGNA 3S1TA 4F4XA 1NJIT 2EG2A 1LWFA 2YX4A 4DV4F 2ASYA 2OPRB 1WHVA 3N28A 5D78A 3ZZTA 1JWWA 1BQMA 2KKHA 3DOKA 4A8QA 5CZVA 4X4TA 2EFPA 2VC1A 2E7XA 4N76A 1AXQA 1UVKA 1NJYA 4ZP7A 4IH7A 1VBXA 4NYPA 3KG4A 4IH5A 2ZH4A 2M88A 4HTJA 2MQMA 2UU9F 5I3PA 2G9OA 1HBNB 4TY8A 2EG1A 1JKHB 3I96A 2XBPA 2HHVA 1R8CA 1VQMS 5FD1A 3M1VB 3RW7A 2DRBA 2QMXA 1BQNA 1MMLA 2KN4A 5KFRA 2YNGB 4Q0BB 5H9FJ 1S0OA 1H7XA 2DO0A 1Y0HA 2WB4A 1LXNA 4WZQA 2YX1A 4DDFA 4ERDA 1XN9A 1GQEA 1Y9OA 2XG8A 1JLQA 3CD0A 4RUHA 1RYSA 1S1XB 3J80Y 2LXUA 1DTTB 3PXGa 4ECUA 2EI5A 5KOWA 5A6WA 3KFWX 3BEGB 3AH6A 1Z1ZA 2VPZB 1S76D 3KK3B 1E6YB 3W2VA 3JSMA 5I3UB 5FDLB 3Q24A 2WSCC 3PR5B 1X8DA 4YR2A 2PFFB 6FDRA 4HDHA 1ZAVA 4CCHA 2X51A 3BSCA 2M8DB 4GMKA 2DK2A 3VQTA 4EEYA 2P6TA 4I1TA 1SJ4P 2CQPA 3LUYA 3RYLA 5KFGA 2MZRA 1VQPS 2ADCA 3TP2A 2MXYA 4ZPBA 3F41A 3L95X 1NU4A 2V4JA 3KLIB 2LDYA 4NRUA 5E5NA 4QZVB 1U24A 3MM7A 2EFQA 4PG4A 2CPZA 1TL3B 4WJBA 1O0PA 4JUZA 1IJEB 3KTQA 3CEDA 3MEDA 4NCGA 4ZCMA 4FS1A 1K1QA 5DETA 1URNA 2KM8B 3QWPA 4RW4B 2FY1A 1DFDA 4I7FB 1HBUB 3PJWA 1GX6A 4H4OA 2DGQA 5CA5A 2JEGA 3W3SA 5JXSA 1P9