3OFEA

Structured domain of drosophila melanogaster boca p41 2 2 crystal form
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
81
structure length
81
Chain Sequence
RTLMTFVSVTGNPTREESDTITKLWQTSLWNNHIQAERYMVDDNRAIFLFKDGTQAWDAKDFLIEQERCKGVTIENKEYPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LDLR chaperone boca
publication title Structural Characterization of the Boca/Mesd Maturation Factors for LDL-Receptor-Type beta-Propeller Domains
rcsb
source organism Drosophila melanogaster
molecule tags Chaperone
total genus 27
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ofeA00
3HHEA 2LQJA 4M8LA 3IXQA 1YBAA 3O1LA 2PC6A 2FGCA 3LOUA 4X84A 2F1FA 3OFGA 3LUYA 2J0XA 1XTZA 2QMWA 3AB4B 4LUBA 3OFHA 3IBWA 3DHWC 3MTJA 2JHEA 1RWUA 3UW1A 2RQKA 3MAHA 2RE1A 1LKZA 3DDNA 3K5PA 2F8MA 1PSDA 5IS2A 2QSWA 2P9EA 2PA3A 2QRRA 1ZPVA 3L7OA 3KWMA 2I9SA 5T41A 1Y7PA 4NMLA 2LVWA 2CDQA 1LK5A 3AAWB 3P96A 3OFFA 1O8BA 3TUIC 3S1TA 3TUZC 1UJ6A 3ENVA 5FIIA 1M0SA 2RQMA 4GO5X 1U8SA 1SC6A 3AB2B 1YGYA 2NYIA 3MWBA 3NRBA 4IO1A 4PWUA 2P9GA 2DT9A 3ENQA 2J0WA 3TUJC 3DHXA 3N0VA 3OBIA 2KO1A 3OFEA 3W7BA 2QMXA 1UJ4A 3DC2A 1UJ5A 2JOQA 5JJBA 1LK7A 2ZHOA 2MDAA 4GMKA 5IT4A 4GO7X 2P9CA 2DTJA 3U7JA 1KS2A 3ENWA 2H9ZA 3CEDA 5IT0A
chains in the Genus database with same CATH superfamily
2CVEA 2AYGA 1FJ7A 4O3PA 2CQDA 1UZDA 4ECUA 3HJFA 4JI0F 1XTZA 3AB4B 2V4JB 3W2WB 4DI6A 2JHEA 4FZVA 3HT3A 1RAIB 4I0WA 1MN9A 2OPPA 4QW9A 3SZ2A 3UDVA 2W7PA 5LMNJ 3OR2B 4Q2LA 4X66J 4ETXA 1FKPA 3MI7X 4ID8A 5ETTA 3C15B 1S59A 4O23A 3K5OA 2V8GA 4UF4A 4Y65A 2W9CB 2YXLA 3JSBA 3R7NB 1GMWD 4JV5F 1C0TA 4LMZA 2GHVC 2IC3A 4GC6A 1KWMA 4P52A 3QIDA 5LM7E 3GCXP 1NPKA 4IO9Q 5T7LA 4PWUA 2DCUB 2V50A 3D0HE 4RW6A 4M63A 5B0AA 2V8VA 2CQCA 2K8GA 3BO2A 1NSKL 3T6BA 2BJDA 2YX4A 1FKOA 2UUCJ 1CEZA 3F0NA 4BDPA 5E5NA 2MLXA 4DG1A 3AOBA 1VJQA 4C8NA 2DXFA 1MU2A 2YY3A 3M2RB 4ES2A 3NMRA 3VZIA 4N7TA 1CVJA 4OHYA 5HK4A 4P74A 1YVFA 3X1LB 2DIVA 2IM0A 2VU5A 2RKIA 1D9AA 4LF4F 5A6PA 4LFCJ 1M5SA 3J7YU 2BE9B 3RTVA 4UQGA 1S0OA 2W4DA 1RWWB 1F2HA 1GMUA 2HNZB 3R6GB 2DR9A 3AA8A 1E6YB 3M2VA 3BR8A 3HZGA 3SBMA 3MMBB 3EICA 1S7IA 4RBTA 3Q8UA 1X5TA 3ITHA 4DPTA 3UO0A 3PRDA 2YWFA 4P2FA 4ECQA 4PQAA 1Y9OA 1ICEB 3K0JA 3DYAB 5D3GB 1R27B 2VC0A 1SB6A 4OYOA 1N33J 3W63A 1TL4A 5DLFA 3PRVA 4ELUA 2H51B 4OX6A 2CRLA 2WTFA 3QJJA 4AXJA 1LV5A 1RTZA 3A8IA 2EFOA 5ETKA 2NUHA 1YJWS 4LF7J 4NLGA 1NCLA 4QIEA 2RRNA 4O44A 3JQMA 3ZZ0A 2LU2A 1NDCA 3NGSA 2OPQB 2ZH8A 1T8EA 3IFEA 2Z2ZA 3OSPA 4M95A 1WC1A 3T5HA 2KKHA 3FRZA 2NSCA 5HJYA 4DF4A 3UN5A 3TA2A 4UTGA 1AFIA 3NNHA 4C4WA 1WF0A 2GQ2A 3P5TL 2A18A 1EX8A 3KDNA 4OMFG 2R8KA 4CI0B 4LFAF 2D3UA 4KRWA 3H98A 4O3RA 2J0SD 5HMXA 2X51A 5HQMA 2LQBA 2NXNA 2Y1RI 1X7VA 1UJ5A 1IXKA 2XLIA 2HVIA 3MTKA 2GJFA 4Y2AA 5EWGA 4MIAA 2FTRA 3CJ8A 3TANA 2VASA 2ZH5A 4GKJJ 2J6TA 3ET6A 3FCHA 2LQJA 1N5YB 2EI5A 4D3GA 2JEJA 3VZHA 1RKJA 1HQUA 1SKWA 4LRFA 1JLCA 2VF3A 3VGSA 1T3NA 1JKHA 1WSVA 4MKBA 1QAYA 1RYSA 2HFOA 1PGZA 2VPXB 4Q2MA 2ATCB 3D67A 4ZLJA 4OYXA 3CSKA 3D28A 2BRLA 3HF5A 3VQTA 2VA3A 5JVGQ 3PW2A 1WC5A 2FHMA 2I5JA 2NXJA 3M8QB 4I69A 4H4OB 4KO0B 3VAFA 1RTIB 4G3IA 4NXNJ 4DHVA 4ZLNA 2R3VA 2HAFA 3FJ2A 1D09B 1SI9A 2XMWA 3GG0A 3CJKA 4FXWA 2PIIA 3AODA 4J7CA 4NWBA 2X7IA 4IO1A 2AF6A 4YS2A 2DRDA 2XMKA 3LAMA 1SC4B 1N52B 1E6VA 3ULHA 1GEHA 1U1OA 2CJXB 3EDRB 5L1KA 4ANEA 2LKZA 3P45B 4C0HA 4IDKB 2AYEA 5IV3A 2IYIA 3CCJS 1X4DA 5HMZA 2G2OA 3CCUS 1S1UB 3O1LA 3A1YG 3G6YA 1RWNB 1LWFA 1JWWA 1MROB 2OI2A 1RWOB 3KLFB 2Y8WA 1QAIA 1UVIA 4RL1A 1Q7YT 3K5NA 4JI4J 3M1VB 3I82A 4CO3A 1UFLA 3D5MA 5CABA 5D0RA 1RYRA 3CCTA 2E66A 1TV6A 1N32F 4J9RA 3M32B 2CZVC 1CS4B 4P6QA 4F0HA 2IYGA 4DV5J 2OUGA 1FKAF 1SKUB 4IR1A 1SBRA 2E7WA 4B9NA 2J76E 3T1YF 4NE9C 4ZITA 4YHHF 3KG4A 3POTB 2YKPA 4NYPA 2QL7B 2H1YA 1JLFA 2ASDA 4ZCMA 4LF1A 4KY3A 3SI8A 5L1JA 1UKUA 3PEJA 5AXMA 3NOGA 1S9FA 3BSCA 2H9ZA 1BQNA 4MAKA 4XDDA 4LF9J 4KC5A 1N36J 1C1BB 4GKKJ 2ROGA 2C1EB 4EYHB 2BJ1A 1WEZA 3FFIB 1BE4A 2GHWA 2PT0A 3BPDA 5HVFA 3PFOA 5KFAA 3M7VA 4LBHA 2WONA 3SDEA 3H2LA 1EP4B 4Y2KA 3TQ1A 1D8YA 2ADBA 2DEJA 2IA6A 4QR0A 2ZFHA 2ZKUA 2WB4A 2KXHA 3PVXA 3B54A 1CG2A 2BEFA 4R8UA 5LJ5Y 3M8PB 3U1MA 3R5BA 1Q16B 4ZIWA 1KSPA 2XO7A 3R3TA 3GILA 3FBBA 4MKVA 2VL1A 1H38A 3H2UB 3ZZTA 1S0MA 2VG6A 5KFZA 4RPFA 3BDEA 2OPPB 3DC2A 5LMUJ 1VYAA 4OYAA 1N4LA 5HO4A 1VQKS 1HNWJ 4J5OA 4NI2A 2XC9A 1K73T 2MYFA 2FHJA 5K14A 2JRSA 2K3IA 3UD4P 3UCUP 4OHZA 1VQ4S 1IWAA 4BBYA 5C5JA 2PC6A 1NXIA 2V9KA 1S97A 1SPBP 1T11A 3FMWA 1SH0A 1S4FA 4IG3B 4CLLA 2IC3B 4KGVB 4URSA 2AJ1A 4GC7A 5T7LB 5LMNF 2VA2A 2JJ4D 4RW6B 4X66F 1WG1A 3FKBA 4NZ0A 1FVQA 1D9DA 1PJ7A 3I0RA 3OV7A 4RUBA 1FKOB 3H2VE 5GADI 5T41A 5KFQA 3RBDA 3T1AA 3HX9A 3QT8A 4DG1B 4ANDA 1FRJA 4TY8A 2BANA 2G0JA 1MU2B 4WZQA 1TL7A 3TEHB 3MAQA 4M5IA 1YRUA 4DV3J 3PJXA 1X5PA 1JMTA 2F8HA 5KG5A 4P7VA 2UUCF 2OPSA 4KFBA 2IM1A 1VBZA 4JUZA 3KG1A 1FRIA 2RKIB 4Z7YA 2IJFA 4DF8A 2M3DA 3AH6A 2WVCA 1SQFA 3NG8A 3NP5A 4J9PA 3DLGA 4B9LA 2XQCA 3QNWB 4PKDB 2FYXA 3M2VB 4A8FA 4I6WA 4X65F 1FFWB 1SJ3P 4TY9A 2ZZTA 1LW0A 1RA7A 3ITHB 1LKZA 1PCAA 2R7UA 4F3MA 4FKYA 1ZA2B 1H7WA 5IS2A 4J9OA 4LFCF 5HQLA 1U1MA 3CD5A 1N5TA 1PYOB 3UN3A 3ENAA 5D0GA 4RR5A 3M2UB 4JV0A 1UA1A 3D6FB 3I5AA 2OIHA 2ZOGA 2HQDA 3EUNA 1S10A 1NKCA 1UJ6A 3H20A 2B8PA 1U1KA 3C3LA 1RHRB 2ROPA 4WYWA 4IRKA 3BSAA 3QZ8A 2ZZNA 3EVMA 2ZDOA 1NSAA 4DFJA 3T9ZA 1H6KX 3BYRA 2AEFA 2CJQA 5JJBA 3SYZA 1N33F 4ZKAA 2IIHA 3QAUA 2HRTA 4AD6A 4V1Ak 2QA4S 2QX0A 2CNNB 3HHEA 5D15A 1FXRA 1UMJA 2VJUA 4JV1A 1CC8A 1TUWA 4ILRA 5KFDA 1DQ8A 5C2CA 3OVBA 1XNRJ 1RT6B 4IOBA 4NLPA 3C2PA 4DR2F 3DDKA 2P6SA 2ZH7A 2BM0A 3H5UA 1VCTA 5KG3A 2C22A 4A8SA 1ZS6A 4O3SA 1C0UA 3VVUA 3MM8A 3ET6B 2Z57B 3TI0A 2FLOA 4FNHA 3GFHA 2G13A 3K17A 2FVQA 2M0GB 1HQUB 2QA1A 3V4IA 2BKNA 5F9LA 1JKHB 3D7SB 1ZZFA 2RHQB 4EYIB 4ECSA 2XB2D 1RA6A 3DNCA 1SC3B 3MHYA 3RBEA 7FDRA 2VZ9A 4G65A 2VQFF 2V4RA 4NX9A 4DU8A 3PX0A 3BREA 2HKEA 4NRTA 2I5JB 3R1LA 3EZUA 2LXUA 1TU0B 1M1HA 3RR8A 1YJRA 2PE8A 2IBOA 3I55S 3OHBA 2RQCA 4OYBA 4N77A 2AZ3A 1R8HA 2HFVA 5HJXA 3QIPA 5CCLA 4H4KA 3M6VA 2VICA 3C8YA 3HFKA 1HW8A 4FS2A 1UVNA 1OS5A 1E6VB 4ECZA 3DLHA 3QYYA 4RKUC 2ZVIA 2B5JB 2KU7A 1Q8BA 1X5OA 1DQ9A 5EGYA 5DQHA 1KHVA 4NXNF 2DHAA 3W5XA 1CJKB 4RW9B 1PYTA 2OJ3A 1RBOB 4W98A 4ERDA 3GR0A 4G1QB 4OV1A 1AZSB 2IVFB 3TEGA 1S12A 3PHTA 1S1WB 1FRHA 4YR0A 4C8OA 2HGLA 1CC7A 2HBQB 2LECA 1RBLA 1WSRA 3CDEA 2XS7A 3GQCA 2AJQA 4IOCQ 3DHXA 3MM6A 4G6VB 3GSDA 5E7OB 2W25A 4DR4J 5E0OA 1VGYA 5CYMA 1NBEB 3FEZA 3D54A 1KKHA 3HHNB 3QGIA 1M1GA 2ZITA 1APSA 2C2KB 2GGPA 2IRYA 4D3HA 3GIIA 3Q8RB 4FXVA 4J9VA 5I4MA 2CPDA 1ELOA 1Q1KA 2GAHC 1YWXA 5J1EA 3H25A 1RT1A 1YX2A 4URGA 1T03A 3OR1B 1L3SA 1G4CA 3VQSA 4LFBJ 2IA0A 1U8WA 4DV5F 4J9NA 2I9SA 2QFJA 2HMIA 4WK1A 4WPAA 1XMQJ 2RU9A 5K5MA 1M5KC 1BQNB 3CIMA 4OZ2A 3IRXA 2PI4A 5GAHU 4U7CA 2XHCA 1DLOB 3JTNA 2LA4A 1V3RA 4NASA 5DETA 3V6JA 4DEZA 3AB2B 1F9FA 2WONB 3Q2SC 5K8OA 1P27B 3TQEA 4DUZJ 1VMBA 5GMEA 2QLJB 2BE7D 1U47A 3CJQA 2XMAA 4CLUA 2CWXA 1LK7A 2LQ9A 4KHPJ 1T9YA 1GMWA 2XZDB 4LF9F 4F4XA 2VOPA 1AW0A 3B78A 3IN5A 5B0EA 1N36F 1RT4B 2IJNA 4GKKF 3IMQJ 4R8UB 3IGVA 4J90A 4C0OC 1H2TZ 1ZETA 2J8SA 2XZWA 1HLWA 4EK2A 2MSSA 3OTBA 2AEJA 1MMNA 3K8WA 1ZAWA 2OSQA 3FQLA 2PO4A 1EETA 5RUBA 1U6ZA 3C14A 1UVJA 3FDSA 1WOPA 1KVJA 2F9JA 5F3TA 2VG6B 4ZMMA 4NEZA 2B9EA 4LF8J 2W9BA 3Q8QB 2VPWB 1G2EA 2R7OA 3MR6A 3T1HJ 5ETNA 2NCKL 4HR2A 4KGZB 2DNZA 3TYTA 2ILYA 4ED1A 3BQ2A 5I3UB 3BEGB 2F9DA 4NCGA 3OUYA 4QCLA 2BE2B 5THWA 2NYHA 4N47A 3JQJA 2XTJP 5KFJA 4A8KA 5U47A 1Q8KA 2GIQA 4USKA 1N48A 1HNWF 3OT9A 4DR1J 3O3LA 4DS5A 4LSNA 2YVSA 1FVSA 2MZQA 3DI6A 3G82A 4K4UA 5G0RB 3I0RB 3G6XA 3W64A 2ZHBA 4I7FA 5J2MB 1RJJA 1SH2A 1VFJA 4E0DA 4RW7A 4TY8B 2BANB 2CJAA 1TL1B 5L1IA 1NSQA 3M8ZA 1NUEA 2J6SA 1TL7B 3WIVA 1WWHA 1LQ9A 1X4FA 1JLAA 3Q86A 3JSMA 2RE1A 1R8CA 3WIUA 1I1GA 2EWHA 3MOJB 4CNZA 5G4DA 1U1QA 2VOOA 2HHXA 2OPSB 4KFBB 4RWXA 1TMMA 3RW7A 5HN0A 4C3KA 1KNZA 4OJHA 4CLZA 1UWAA 2VPZB 3ZTSA 3BPSP 4WFZA 4DV3F 3BBBA 4HHHA 4CDIA 2OMLA 3KK3A 3MR3A 2DVIA 3AD7C 4HDGA 4Y34A 1LW0B 3JXOA 1DQAA 1X8DA 1FK9A 4NLOA 2HZVA 4Y2MA 1Y0HA 4O0IA 9RUBA 2BQUA 3P4UB 5LOQA 5A2QU 1QAJA 3DLKA 2I1RA 3NBPA 4F8RA 2W2MP 4P72A 3TRGA 4KAIA 5L46A 2JEFA 4ZHRA 3CCZA 4XIUA 2A6MA 3W9JA 2Y0BB 2VB6A 3CWJA 3U02A 1U2FA 1I51B 1NJIT 2PEHA 1F60B 1M5PC 4ICLA 2HK2A 1TMJA 1CULA 1RCXB 3FCVA 4MK7A 3BGFA 4DL7A 4UUXA 4I67A 2HHVA 1RUSA 4WFNQ 5F8HA 1PKUA 1EQ0A 3AD8C 3AY0A 2C2RA 1D1UA 3QRPA 2UVWA 2ASJA 3G6VA 1YKWA 2C2OB 4J37A 3KUGA 3A3OB 1BLUA 2HHPA 2YPZA 5KT6A 4MK8A 4PWWA 1HARA 1X4HA 3MM8B 4JI3J 4IYQA 1T05A 3Q2TC 1XNRF 3FUYA 3J80U 2AP6A 3W5ZA 3V4IB 3DLEA 1NZ8A 2RB7A 4DV4J 3HCXA 4AUKA 5JVHQ 4DUTA 4DS4A 3ILLA 2NS1B 3O44A 4EGLA 1T94A 4NYZA 5H1SV 4CO0A 4CT8A 2EBEA 3FSIA 5KFRA 3D2WA 3U1NA 4MK9A 1VRTB 1Q5VA 3D4JA 4L3KA 3BN7A 4G1IA 1KC8T 1PJ5A 2I0XA 3TUZC 2XMMA 1KQKA 2VODA 2BOPA 4KIAA 2X1FA 2Y1IA 4YEAA 3CDAA 1UVLA 2CKWA 4BWMA 4NLYA 2VHGA 2HBRB 4N76A 3DLJA 1S6UA 4CLTA 5L38A 3ISNC 1RTJB 1YJVA 3A3NB 3GCWP 3MEEA 2E44A 3TA1A 3CNQP 2VG7A 3QGHA 1S0VA 2RDIA 1Q5YA 4OZLA 3A8JA 2RD5C 4ZIVA 3HD1A 3B4DA 4A8OA 1QUVA 3VAGA 4F3OA 3ZXWA 4RBVA 5I42B 3EDQB 1WACA 4OHVA 3OLAA 1ZAXA 5E41A 3K5PA 3T19A 4L76A 3MM6B 3SCLE 2FY8A 2BKPA 3CULA 2NPFA 5E2QA 5DG8A 2D9OA 1EARA 1YQHA 5CYMB 3CXCR 4RUHA 2FZKB 5KAKA 4ITSA 2OGUA 3NWGA 4J9QA 4EO8A 5F8IA 3GYGA 4DPUA 3ZNUA 2I8EA 1S1XB 5C25A 5J2NA 3IO1A 2BZ2A 1RWKB 4QQBA 1JXVA 2XSJA 1J5EF 3QGGA 5J2QA 2QO3A 3AA9A 3KMSA 3IA0A 1GH8A 1RT1B 3K7RA 1X31C 1HYSA 4DX5A 2A3JA 2NXCA 2DNHA 1UTAA 2HMIB 2UVRA 2FUG9 2LLZA 5IFMA 2G9OA 3IRXB 4BC9A 2YKQA 5KFKA 2Y3YA 3M8RA 2A6OA 4F4KA 4KT0C 2P8IA 3PKMA 1HL6A 3N6NA 1NK9A 2IMOA 5C42A 3WBZA 3ETOA 3ADAC 1OY6A 2GMJA 3IAS9 1XMQF 2E1MC 3I9V9 5KFPA 3BH7B 1MNEA 2CUYA 2ZH4A 3KJQB 4ZVSB 4ZP8A 4HTIA 2DNMA 4DBQA 1RTDA 4LT6A 2N4DA 3MM5A 3BKFA 5CQGA 4W4MA 3L3CA 4AQYJ 2ZJPQ 3M9NB 2HVZA 4PQUA 1QUPA 3L4BC 2P9GA 3V6HA 4KHPF 4M5KA 4P2XA 3X3UA 3PW4A 5A76A 1WHVA 4Q0BA 2QN6B 4C7QA 2W9BB 4LQ9A 3MPDA 5F0UA 5BXIA 3D0IE 2YKAA 1L3KA 1EKRA 5GAEI 5HP1A 1TUGB 4NCGB 3DKDA 1NLKL 3MEDB 2GCFA 5C2GA 3QSYB 2XS5A 3EZOA 3PJWA 2LXFA 1NO8A 3T1HF 4DR7J 4OI3A 3FEYB 4LSNB 5D0EA 1SQEA 2CQ2A 5D4LA 1RACB 1TFYA 4DSLA 3DI6B 3G82B 2EK1A 1URNA 3CD0A 1Y7PA 3VAHA 1U0HA 4EEYA 2QYGA 3BGLA 4I7FB 2RU3A 1LW2A 2AGPA 1NM2A 1HBOA 5M2PA 2BYCA 4RW7B 3EJMA 2RQMA 3MECB 3M6UA 4DR1F 3RUBL 2FPHX 1DTQB 3MUTP 3KHRA 1YTYA 5BYRA 4NLUA 1T9TA 1JLAB 3JSMB 3LW5C 3N0VA 2OH2A 2JH3A 5CD4H 3JQKA 2VJVA 1SIWB 4B3TJ 2CQBA 3ENWA 4ZPTR 4W90B 2XEXA 4WCEQ 4RNMA 1FRKA 4O4RA 5DGAA 1DARA 1HBNB 3QZ7A 1U49A 4OHWA 2DRAA 1EKSA 1YJNS 2HVDA 3VAKA 1KVKA 2R7QA 3LGMA 1HWIA 4JI2J 2HRUA 5B0BA 2HFSA 4S0MA 1CSJA 3KK3B 3M9OB 5AXNA 1O6XA 1RAGB 4F4AA 2FVSA 5CH7B 1YHQS 3CW2C 4IKAA 2OO4A 2ZOFA 1FK9B 3I4HX 1F9HA 5E3QA 3K5MA 3IBFB 2VIHA 3UR3C 1LWEA 5IV4A 2K2PA 3QGPA 2KRBA 3DLKB 1D8ZA 4TU8A 2ROEA 4OZJA 4CO2A 3NBPB 1J5OA 3HHKA 3BJYA 4LBIA 1F0XA 3K5LA 1FNXH 2C2NA 2DY1A 4NRUA 3TUJC 5B0FA 3TOQA 3PRBA 3GV7B 4WKYA 2XMVA 1Q8LA 2HNYA 4KYZA 1T9VA 3OTCA 2MB0B 1TKDA 1XWLA 3LA0A 4E8UA 1PC5A 2UU9J 3I56S 4K4VA 2AX0A 1KTVA 4ICLB 2CDRB 3VGVA 4DSEA 1CULB 2GAGC 2ZH3A 5KG6A 1XMBA 3CCLS 5DRKA 5CAAA 3W9IA 1RBAA 4K0KJ 2E5IA 3MCMA 2HS4A 3CPWR 4X4OA 2NLWA 4HDHA 1IKYA 1RB0A 1R43A 2ZC4A 1WOOA 5E3CA 5KG4A 2B51A 2YPYA 2WHOA 3KLEA 3Q0AA 1FA0A 1B4SA 4KSEB 2JLGA 3D1HA 1UWBB 2B6AA 2CNKB 1PAEX 4WF9Q 1T05B 5HQ8A 2R7VA 3G2XA 5CXTA 4PG4A 3UR0A 4FXDA 2DGTA 1RXOB 2DH7A 2GVDA 4DPOA 1REVA 5EWFA 1HBMB 2PN6A 3QLHA 3VTIA 1UA0A 3SV4A 1VQSA 3CCSS 2FHKA 3BKUA 4UOGA 1L3TA 3FZ2A 3K57A 1Q8IA 3CO0P 5FDLA 5KFWA 1S1VB 2R2RA 2ACYA 4DV7J 4JI3F 2VQEJ 4ALZA 1RWVB 1HI0P 5DDPC 4XPCA 3OVAA 4DV4F 1Z2ZA 5CZXA 1RU1A 3OPKA 4NLDA 3TP2A 3AHPA 3PM9A 4DL5A 5HLFA 1B7YB 4OZ3A 1BGXT 1T9WA 3V6KA 2RUSA 2XHWA 1CPZA 1UFWA 3DRPA 4Z7CA 3B82A 1HI1A 3LGNA 2FLPA 2HHTA 1QTMA 2VG7B 2VKRA 4FYXB 1FWLA 4B17A 3CMAS 3FCWA 1X4CA 1C1CA 1FNOA 4J9LA 2KT3A 3MWBA 3IG1A 2XBPA 4TXSA 2KO1A 3OFEA 2XMJA 3K59A 3KJVB 4GVBA 3KK1A 4XPEA 2LA6A 3H4DA 5D0HA 4CTAA 4QR1A 4F0MA 2B7BB 2VC1A 1VRUA 2FGOA 4PABA 2LDYA 3M6XA 3T9NA 4DR3J 2DGUA 1VBKA 1YG0A 4NEYA 3O2IA 4HH0A 1FI4A 2UP1A 5C25B 5J2NB 1NKEA 1PBUA 5KT7A 3KKFA 3SQOP 4ZOSA 1RQ0A 3RB6A 5J2QB 2DO4A 1VHIA 2OEJA 3GIMA 2XCPA 2C3OA 2E5GA 2HBZB 4C2MA 1RGVA 3FMBA 4I2PA 2KG0A 4ZVEA 3V5RA 3CJ5A 1OMSA 3IR5B 3MGJA 1SL2A 2HWTA 1CJUA 4QZVB 1JQGA 4TN2A 2FJWA 1NK8A 2CQ0A 5HAOA 4R25A 3N5BA 2KXNB 3ILIA 5C42B 1NDKA 3GONA 3KOAA 3BGOP 4C3LA 2J0WA 4K59A 1ITPA 2KG1A 4DQQA 4HI2A 2V67A 3MF5A 2GA7A 2BDPA 5E3RA 3CGIA 2CYYA 2BUNA 4YP3A 2YKMA 2LQ5A 2M8HA 3MM7A 3ONQA 3Q83A 2EFNA 1RTDB 1V3ZA 3MM5B 1VBYA 1ZM9A 4F0KA 2MKCA 3HK2A 2QMWA 3Q89A 1LFPA 2PMWA 4XO0A 5IM0B 5L1LA 3CCWA 3I5BA 1HNVA 1NJZA 5DLGA 3E01B 4PQUB 1FE4A 3D66A 4HHUA 1ZH5A 2PA8D 1YZ6A 4DDFA 4BS2A 4CT9A 2Y1JA 2CADA 2FJBB 5SUHA 1NRKA 2IPOB 3UNYA 3HM9A 4RNHA 3I87A 4X64F 4AQYF 2H48B 2O01C 3M30A 3KTQA 3PIPQ 4DQSA 2DISA 2R42A 1FERA 4DSKA 3OW2R 3DGVA 3NRBA 3JS9A 2WAQD 1SH3A 2BJ3A 2HIQA 3H0PA 2KVQE 3H4BA 4USJC 4FDFA 2HYIB 4WIIA 1R0CB 1R6YA 4OZ0A 2ZH6A 2O1PA 1YITS 3NCPA 4WFXA 2L41A 3CT9A 3K58A 3HP6A 2YKNA 1HBOB 1LNQA 2QE5A 3BSNA 1Q0NA 4CYUA 3VV2B 4DR7F 2W7OA 1HA1A 1XC9A 3OD2A 2ADCA 2FVRA 3CE8A 2GS8A 1N34J 1AT1B 5KG7A 4PPDA 4RZRA 1S4EA 1OSDA 2JLFA 2ZM6J 4H4MB 1ZPVA 2CQ1A 4RUCA 3BBCA 1EIYB 2E29A 3AAWB 3LF0A 3CD6S 1DTTA 4OI0A 3VCDA 5ETSA 1DZ5A 3PX6A 4F2RA 2G0IA 2LDIA 4X62J 2XWYA 4U7UD 1RT2A 4DL0C 4X4QA 5DGBA 4QPTA 1MMDA 4B3TF 3RGIA 2Z56B 2FC8A 5L8RC 2GVZA 3IC1A 2DNRA 2ATLA 3OTOJ 1YJUA 5ETMA 2ZBRA 4DOZA 2EC2A 1GXLA 1X9MA 5KFOA 4B9TA 2V2QA 3PYGA 1FWKA 4JI2F 2D9PA 2YBVA 5BYSA 3Q22A 5KFSA 1WF2A 3P6YC 1J5OB 3SIPB 3HI9A 4F25A 1WDTA 5KFCA 2LEBA 5I3QA 1VC6A 3C66A 1RAEB 4M5MA 2LQ8A 2HNYB 4EWTA 4IFVA 1FE0A 1TELA 5BYQA 2JL9A 1DBDA 2MKIA 2BV3A 4I68A 4PXEA 1HMVA 4NMLA 1TK8A 3RAXA 3PFEA 5FLXY 2H4YB 1SUQA 1X0FA 3TUIC 2Q66A 4DL4A 4QIWD 2V9WA 4U6PA 1JXEA 1UCNA 1QE1A 2YWGA 2YWWA 2XI2A 4PUOB 4Q44A 2RSQA 1IKYB 3ELHA 2UU9F 4C98A 4C97A 2V6AA 1KD1T 3KLEB 5MLCV 2J9DE 3T6JA 4WFBQ 4C11A 3NKYA 3EGNA 3L9ZA 5B7WA 4DWIA 4EBEA 5D4PA 2E1PA 4FF4A 2DR6A 3GJSB 1FDNA 1X5SA 4K0KF 4LF2A 2J0QD 3F73A 4C8KA 2X1GA 3BGRA 2GVDB 1REVB 1WOSA 2HQ3A 5M2RA 2V94A 1FEEA 2HIYA 3GIKA 5L9XA 3RBXA 3HPOA 1GX5A 5FDLB 3Q23A 5HBMA 5A6WA 4DV6J 1P8GA 5K20B 3M05A 1Y11A 2BOAA 4RW8A 5CA5A 1P9YA 2NZCA 2PD1A 1N8RT 2F8EX 4HKQA 1G3OA 2CNOB 1VC0A 2Z2YB 4ECTA 5KFNA 1WG4A 4PXDA 2DNOA 1IKVB 1XBWA 2QSFA 5HLFB 1G7CB 2BA9A 3VGUA 4A46A 2HWHA 1XMOJ 4UOHA 2YNFA 5LXYA 1VQYA 2DCLA 1VQMS 4YB7A 2VQEF 3TUPA 2AZ1A 4OYMA 3DOMA 5IZHA 1PILA 2H5JB 2W01A 4Y00A 2VFUA 2RF2A 4DUYF 1HHSA 4KGXB 2CPZA 2GZOA 1JJHA 2WBRA 1FD8A 2MKHA 5A0YA 4ED0A 5HROA 2CQHA 3J7Z5 3JTOA 1C1CB 5KT2A 2G1HA 3IG1B 4ID5A 3W2VB 4KKOB 2RJZA 1ROFA 2LEPA 5F3ZA 3FC9A 3HVWA 1IQTA 4GVBB 3KK1B 2GMLA 3ZZZA 1R8BA 3JAMU 2VG5B 4USMA 1RU2A 4IQXA 1FDAA 1NEEA 2ZH9A 2DNKA 1UW4A 4OI1A 3G96A 3UDCA 2PDAA 2YWKA 4U9RA 3JAMY 5LSLA 3PTWA 1B0VA 2KZZA 4OL8A 3JYTA 1VIOA 1TK5A 1TKXA 2C2ZB 1WI8A 2DJWA 2APOA 1L3VA 1UJ4A 1OO0B 2ALZA 1WI6A 2DITA 4O3NA 4I2PB 4DR3F 4JI6F 1X4EA 1BC6A 1QSYA 1Q7LB 4WKRA 4AT1B 1CJVB 2CPYA 3TAMA 1HHQA 3KNAA 5EN1A 3HLUA 3TJ9A 3WX8A 1FT8A 3DOLB 3KFWX 1VOMA 4ZVUB 1KLMA 4P2SA 4OYZA 3ZO7A 4FN5A 2HFZA 4DV1J 3KYLA 1QY7A 2F8MA 2CA9A 3ZZUA 1VQOS 1NB7A 4K50A 2Y8YA 2YH1A 3DLLQ 4IQMA 2V2VA 1JLGA 3R7BB 3G6ES 3MM7B 4LREA 2C2DA 2OPRA 3V6DA 2AQ4A 1YJ9S 5J2PA 5LJ3Y 4F4WA 3BV8A 2CPEA 3IWXA 1HNVB 2GHPA 5GADU 2IY5B 1UEUA 2BW7A 2QMXA 1K9MT 2JWNA 5ETOA 2AMCB 2F7VA 5DJBA 3NL0A 4WWSA 5KFIA 1KOOA 1Y5IB 2YWHA 2QL9B 3M30B 2WW4A 3LP2A 1D9FA 2LYVA 4MYTA 4N41A 2AYMA 2HHQA 1Q95G 1RWMB 4ZP6A 4Q8FA 2E5LF 2XZTB 1NHUA 5D4NA 2BBEA 2NR0A 2UV8G 2MEWA 1H2UX 4OZ1A 4I1TA 4R0EA 3RW6A 1FX2A 3I32A 2OD6A 3A13A 2H3EB 3TAPA 2B4PA 3HKWA 5LXRA 1T9UA 6AT1B 2DPIA 1SKRA 4CYUB 2VH7A 1IKWA 2UXBF 4DQPA 5AE3A 2V63A 3M4XA 1B0TA 1YLXA 2QFIA 1UPMB 4ECYA 1RAJA 1LEOA 4I56A 1KFDA 1JLQA 1KBRA 5F8GA 2ZDPA 1ZM4A 1JNZB 2C3MA 3G8SA 4YFUA 1YBAA 4ECXA 4F02A 4IH7A 3HHLC 1NK7A 2DNGA 1SJ1A 3I6PA 3IBCB 4ZVPB 4NLVA 3DXBA 1GMVA 4M5NA 4ES3A 3MEGB 1N34F 2F4VJ 1B7FA 2ZM6F 3DGPA 1NDLA 2YWEA 4L3NA 1RT2B 1RT7A 1Z2LA 4PYDA 3D9BA 4WYLA 3BZQA 3G4SS 2V69A 2UZAA 3KK2A 2BQ3A 1OPZA 2HQGA 2ZOMA 4ENOA 3QRRA 3MPUB 4CQ1A 1Y10A 2UUAF 3BN4A 4MJKA 2D69A 2RRBA 5KFLA 1KFSA 1P9QC 3DXSX 3R2DJ 3THPA 5GMDA 1R0AB 1S6OA 3I5CA 3OTOF 3W3SA 2RUGA 1JLBA 3CDWA 4WU3A 1LWCA 3NAHA 1TP7A 1HMVB 1AA1B 4ZDNA 2H5EA 3RJMB 1SUQB 1B3TA 1RI7A 4PWDA 1OY9A 2A0FB 2J5AA 1F5CA 4JI8J 1QE1B 1HBUB 3NXZA 2R7TA 3LTOA 2F5GA 5M2UA 4DX6A 2QRRA 3S8SA 4CLKA 2ZBCA 2J7KA 3CJTA 4C11B 3KXDA 4PG8A 1YSJA 4WE1A 2R7XA 4ZVQB 2B0GA 3J7ZT 3HSJA 2KM8C 3OTDA 2O67A 2B4UA 3AD9C 2KFNA 3TZXA 3JTPA 3GFZA 4CLWA 2ABYA 3UVJA 3N5FA 1WKLA 4KH0B 1WELA 4WP3A 1T95A 3GG1A 4P73A 1BQXA 1LXNA 3BGUA 3LO3A 3NWRA 5HBMB 1WEYA 4OI6A 2MTLA 4I4BA 2UXCJ 4RW8B 4ZN3A 2DEIA 3KLVA 4JI7F 2CAJA 2HQIA 1NJXA 4JYAJ 2MQLA 5K8PA 5AE2A 4LRAA 4F7VA 3HHLD 2HQFA 1F3VA 2COLA 2IDEA 2EG1A 1AUSL 2OELA 2E5HA 4DV6F 4TYAA 1HNIA 3T5LA 3DOMB 1UVKA 4MFBA 4ER8A 3R1HA 3GV5B 1HW9A 4N8NA 2M70A 4LRBA 4ZA1A 3HDSA 1WD6A 3KLHB 2NXEA 1Y3JA 4PG5A 4WTYA 2L9DA 3ZZRA 1BWVA 1G1XA 1Y5LB 1S49A 5A0YB 2R2SA 1XMOF 3PNIA 2P6TA 3W8GA 2DXDA 4WFAQ 3CDUA 3S7RA 2QEXS 4OI4A 1CJTA 4HT5A 1R8AA 3B6BA 4WK3A 4ZPCA 3W65A 3W2WA 3CC4S 2FD2A 3R7SB 1ACMB 1SVDA 2E7XA 4YB1P 1DFDA 2KB2A 3FEXB 3US5A 2RHSB 4NCBA 4G1PA 4XAKA 1U2RA 4DSFA 1MWZA 3I0SA 3JYTB 3MFHA 1TKXB 2I2YA 3MAHA 1F6TA 1OWXA 3CB4A 2VBWA 1V6HA 2AV5A 1N54B 5DM6Q 3K2YA 1IBKJ 4ZJQA 4IRCA 1FFSB 1N5SA 2W8KA 3TAMB 5KFMA 4WXWA 4AE5A 1FKPB 2JEGA 3CJRA 1KLMB 3GP9A 3ENQA 4ZPWR 4USVA 2NSBA 4CH1A 2CQGA 5DM7Q 1C0TB 3VAMA 2OTLS 4ETZA 1IR0A 1H3DA 3PR5B 1T02A 1GAOA 1JLGB 3GB0A 5HSPA 3SMZA 3OSNA 1IR2A 3IR6B 4NCAA 4B3MJ 3V6DB 1RHUB 2X1AA 4YDXA 2C2EA 5ETRA 1VQPS 1U1NA 1FF2A 4DV1F 4ECWA 2Z2LA 4LRCA 5H9FJ 2QYCA 3BO4A 1I6JA 3ZTPA 3W5YA 1E6YA 3CCRS 2FHOB 4EFAC 1UFKA 1CQNA 4Z37A 3KUEA 2E1CA 3Q8SB 4C8LA 3KHHA 3W8PA 4E98A 5B0DA 2QG9B 3GJQB 2EVZA 2IFXA 3LP2B 5EDWA 3RR7A 4UZBA 1IBMJ 3DYAA 1H2VZ 2QGFB 1FDDA 1N6QA 2FB0A 2JOQA 2PMZD 2YKOA 1R6VA 2MHNA 1XQIA 4A8XA 2B4OA 2FLNA 2F63A 4ZK7M 6FD1A 3TAQA 2JLEA 3QJPA 1K1SA 3KHGA 2OPQA 3HJVA 3PZPA 4XTTA 2MGZA 2X3GA 3QATA 2R8IA 1IKWB 2D3O1 1BHNA 5GVQA 1XJWB 2DHGA 2FQQB 5CZVA 2D1CA 4MT1A 4MKAA 2RVJA 4LSZB 3PY8A 3AJ1A 2N7CA 2ASLA 1X9SA 2GQQA 5E3PA 2Q43A 1JLQB 2GNKA 4M5GA 1HNZJ 2K7KA 4O44B 4ZCIA 1KDNA 3FBFA 3MMAA 1M0SA 1NK4A 1IBLJ 3TX0A 1RHMB 3T3FA 3TX8A 4F26A 3DGPB 2IRXA 1DY3A 4RBUA 1WKJA 1RT7B 3UCZP 2HHHJ 2ZE2A 4LF7F 4P10A 2CJBA 1V3SA 4J9MA 3SFGA 2UUWA 5IT0A 3N79A 2HZCA 3WC0A 5DDQC 2R7RA 3ZTOA 1YJTA 2F4VF 4BLGA 2IVMA 2QLXA 3M8QA 4NMXA 1H73A 3TZWA 2DGWA 1IQZA 3QWUA 4HLBA 3KLIA 3NS6A 2K7JA 1IBCB 2BJEA 4DCOB 2QSWA 2X3DA 4J91A 1JLCB 3RB3A 5DG9A 1RAHB 4KBIA 4HVZA 5DS7A 2FJDB 5KTQA 4NOHA 3MD1A 2MQQA 1FESA 4GKJF 3KLGA 4MTPA 4NYOA 1PC4A 4PWDB 4K2JA 4NLXA 2A2DA 2W4PA 3TWZA 2C28A 2BJ9A 3MZIA 4CLFA 2E1AA 4JI5J 5KT5A 1VK8A 2WW8A 3GSIA 5D77A 3MR5A 2VDIA 5IT4A 3CJKB 2WK4A 1SC1B 1C4CA 2H5IB 3T1YJ 3M1VA 3HO1A 3QPIA 1UAWA 1FDBA 2J8AA 3HMJG 1F1BB 2MZ1A 3NY0A 3CCMS 4Y3CA 4JI8F 2Z0GA 4A8YA 3WDOA 2YX7A 1N5QA 1A7GE 3MEKA 1WKKA 4DL6A 3FBEA 2JX2A 1FXDA 4K4SA 1H7XA 2W1BA 2ILZA 5B08A 2K3KA 2QJ3A 2NXUA 2RRAA 1LWFB 3EGVA 4USTA 3E8OA 3QBCA 1ULRA 2AU0A 5KG1A 2ZBQA 3OFFA 4RX6A 3BYPA 2MQPA 2QIFA 3M8YA 3EVOA 1PIEA 1TV6B 2NPIA 4GO5X 1JXLA 2DYAA 1NU4A 1D0EA 3GFXA 3C19A 5IQQA 3NGUA 2VBYA 3FSYA 3FFIA 4ZPVR 1HNIB 4JI4F 3F56A 2UXCF 4MFBB 1NSPA 5IWAJ 2DNYA 4JV2A 3QAEA 5JUMA 4U7UK 3PV8A 4ZLLA 1JLFB 2QA2A 4YOEA 1CBKA 2CQIA 1W7WA 1KP6A 5K8NA 1VQ5S 3DHWC 2H54B 1U48A 1BXNA 2QT7A 2HWIA 2PEBA 4YQWA 3TR5A 3IGNA 2W7AA 1W25A 1VJWA 3NCRA 1CJTB 3GR1A 3PYEA 2C42A 2EFPA 2VBZA 2XO6A 3SDEB 3MD3A 1I5OB 5E33A 3UWTA 2LFVA 4DSIA 1U45A 3MUVP 2LCWA 4I6AA 3DMJA 3AXMA 1GNKA 3NNAA 3FNNA 3I0SB 4KPCA 4DX8H 3B4MA 4C9DA 3A3PB 1RWPB 1S79A 4ZCKA 1HWUA 4X4PA 3OL9A 4IG3A 4OFZA 3TJ8A 2MZJA 3R97A 1EJ7L 1VQ7S 3HSGA 2XI3A 2J9DA 2KJVA 4NI2B 5BJRA 5K14B 1OQ3A 2ZUGA 4LR8A 2MLYA 1IJFB 3CCES 4WIQA 2ASYA 5GAEU 3TA0A 2KYXA 4C48A 1IBKF 5CHCB 3FRYA 1WNEA 4N56A 4ZVGA 3HSZA 2WSCC 2E9RX 5LMUF 2XY7A 2Z2MA 1O8BA 2JDJA 2HFUA 4X65J 3RAQA 4DN9A 2E5JA 5HI7A 1WC3A 1YRTA 3N4WA 2V34A 5GAGU 2I38A 4DFKA 1O5JA 1M5VC 4B02A 2XYPB 1TK0A 2XG8A 2ZHAA 2GO9A 1NH8A 3CJ4A 1VS3A 3EMTA 4PEOA 2HNDA 4JOUA 3WZ0A 5CCMA 5GMKa 3IRWP 4B3MF 3BQ1A 4CLYA 3NGRA 2GW8A 2VBXA 2IAJA 1QSSA 1KLNA 1YK9A 3F44A 1NPRA 1JJ2R 1SV5A 2HBYB 3TJAA 3ZC4A 3M2UA 4V19X 4ELVA 3DOKA 3N01A 3QJLA 3DRRA 5JXSA 1N6QB 2JC1A 1Z4UA 3FQKA 2EBGA 3DLGB 5KG2A 2O66A 3LQVA 4P9SA 5H9FK 4LVOP 5F0WA 1K47A 2WVBA 4QBUA 1T7PA 1IM6A 1J2VA 1PJ6A 2K1RA 2UV8A 2B8QA 3M6WA 1IBMF 4KH1B 5EWEA 4DR2J 4BC7A 4CM2A 4KV8A 2L9WA 2OTJS 2MGZB 1HNXJ 1TKTA 2BQRA 2ERRA 1I94J 1H72C 4K4XA 2DT9A 3LP1A 4F4ZA 1T9XA 4P75A 3QT7A 4LVNP 3R5JB 3TARA 3NS5A 4MIBA 3BDPA 4WZMA 3O6QA 1O0PA 1TKZA 2MLZA 4Q43A 2DTJA 2LEAA 1RT6A 5A2QY 2J7UA 4NLRA 2HPUA 4W92B 3H8YA 2JNJA 2BJ7A 1FEHA 4RO0A 1U4BA 1X4BA 2CWKA 3MMAB 2R9LA 4ED3A 1WC4A 2VQFJ 3GYNA 2V68A 3MTJA 1GT8A 3KUHA 2KL8A 1IM4A 4M5JA 1RT3A 3DDNA 2ZC3A 2RAQA 4OI2A 1VK3A 2MSTA 3R5GA 3MUMP 2ZE2B 1HNZF 2EEYA 2DR7A 2AHOB 4EO6A 4OIXA 2P2CB 1NK6A 1IBLF 4OX9J 1KQGB 2HGMA 1C0UB 2E9ZA 1S9GA 4HI1A 3VR1A 2YQ0A 2WVDA 3HT0A 4M1KA 3MAAA 3CD7A 1TL5A 3I9ZA 2YTCA 3KLIB 2HHHF 5K9FA 3W7BA 1FNMA 3C6TA 4TYBA 3PO5A 3PEHA 4A48A 1DAXA 3A12A 4CIOA 2VFVA 2IRUA 1X0PA 2HEKA 1OY8A 4M8LA 2DR8A 1MLAA 3J80Y 2GIFA 2F1FA 4IH6A 3UN2A 3KLGB 2B5JA 2MQMA 1VDHA 2DNLA 4Q45A 1XR7A 1U6BA 1CJKA 4RW9A 2V4QA 1RZMA 4QR2A 1NJYA 1SJFA 1RKIA 3CIZA 4G1QA 4RW4A 1AZSA 4C0BA 5B09A 1Q86T 3UD3P 1S1WA 3PR4A 2MQOA 1UW9A 4U95A 3AJ2A 4YN3B 3QIPB 2AEMA 3D6HB 1LK5A 4O3QA 3HHLA 2MY7A 1KEKA 4QU7A 1HI8A 4U8YA 3UPFA 1JB0C 2RIJA 4QWAA 2KHDA 4JI5F 4A47A 1RLCL 3QMQA 3GV8B 2DIUA 4PR6A 2FVPA 5H9EJ 2VFSA 3BM7A 1C2PA 3OJSA 8RUCA 3AOCA 2QTWA 2XULA 1UP1A 3W62A 4WP9A 2Q6CA 4PG6A 3OL8A 2BVZA 3OXGA 1K0VA 3OR1A 5F9NA 2AGQA 3P3DA 2YX1A 3LAKA 3MR2A 3PYFA 1JK9B 2MQ8A 3IBWA 3NMAA 3N9UC 5ETQA 3NOCA 3L95X 4DSJA 2QV6A 2D41A 1DLOA 3J81j 3CC2S 2GGPB 1S6PA 2U1AA 2RQ4A 2LVWA 5J1EB 4DR4F 1T03B 2ZBIA 1OJ4A 2ZH1A 2MKSA 2MZSA 3EX7B 3G86A 4TQRA 1RT4A 2J9EA 4DCJB 4ZPBA 1FO1A 4QJVA 5A8RA 4J9KA 5IXUA 3D68A 5IWAF 3EWGA 2DNQA 3KJFB 2CPIA 2ACMA 1JJ4A 1P1LA 4Y6IA 3CJ0A 1ZM3A 4K4ZA 2YQ3A 4ZP7A 4DL3A 4LFBF 1URRA 4KGMA 2ZD1A 2JFKA 3OVSA 1ZTWA 2UXDJ 2GJIA 2ZJRQ 2CVIA 3DMJB 2XNQA 2XMTA 1Y5NB 3H59A 3N28A 1ZBTA 2HHWA 5I3UA 4WU2A 2J7WA 2BE2A 3D6MB 3MPWA 2UUBJ 2H4WB 3O5TB 1I3OB 4DUZF 1EETB 1QJHA 3C14B 1B0PA 3J7AN 4FYWB 1FFGB 3NLCA 3MPYA 2M5YA 1ZYQA 1OIAA 5I3PA 1QVGR 1XK8A 4IH5A 2MPUA 5F8JA 1FJCA 3NS7B 4OLPA 4USHA 5G0RA 4DV0J 3OQ2A 2E1RA 3C46A 5J2MA 3CJSA 3IWNC 4ED6A 2DD8S 3OUYB 3GWCA 2XGQA 2YNIA 2QLWA 5CYQA 2V0NA 2AWZA 1TL1A 2XSFA 4RNFA 3GMGA 4K4YA 1VIXA 3EM1A 4LF8F 1S1TA 2BX6A 1TAUA 1DRZA 3PW5A 4JB8B 3QO9A 2YQ1A 2KH9A 4DLEA 5IT9U 1WJ9A 1JNRB 1VRQC 2KFYA 2BACA 3G87A 2R8GA 3KJNB 3QFWA 2KJWA 5B0GA 1ZTTA 2LMIA 3J7YI 2Q3PA 3IAM9 4NLTA 3NAIA 1YI2S 4A4JA 5IT9Y 3BBFA 2GO8A 3JB9k 4DLGA 2ZNZA 3J7A1 2HNDB 3DM2A 4R0JA 2DNNA 1JLEA 3HZEA 4CO5A 4FVCA 1BMQB 2IAJB 2GC8A 2DO0A 1SV5B 4PXCA 2BKOA 3C6UA 4F36A 4Q5VA 2CZ9A 3V81A 1UEVA 3G9CA 3DOKB 3DRRB 2N4CA 2KHCA 1LFWA 4FPIA 4LIWA 4ZVOB 2KDOA 3TZZA 5F8LA 5J1PA 2QL5B 4CO1A 1X9WA 4X4VA 4I64A 1PO6A 4BWJA 1D3WA 3H7HB 2F3JA 2K1RB 3LANA 4ZPDA 1RDRA 3IXQA 2ZKTA 1RAAB 4ZJLA 4HH1A 3THTA 3WC2A 4KV8B 1TKTB 3QFHA 4QWCA 1TTHB 4M5DA 1A9NB 2CZ4A 3LP1B 4URQU 4Y2CA 4WP8A 3RRGA 4EMDA 2BM1A 1TKZB 2KXFA 1IR1A 4EI2A 4YUDA 1UZHA 4DR6J 5KFFA 1QTNB 4ZHRB 3DDIA 3OJUA 4P2MA 4WJBA 4QW8A 3EYZA 3DN9A 1DHMA 1HR0J 1HNXF 1AXQA 1Y00A 2CXEA 1I94F 1MG7A 1MWQA 1QAXA 4LIRA 1HKAA 5BR8J 4YB5A 1VI7A 1RT3B 1HHTP 4ANCA 3U1LA 3A8EA 4J9SA 3R9LA 4FYYB 4P71A 1CLFA 4TQSA 1NAQA 1BD6A 1YDLA 1FXLA 4IUFA 1FTCA 1FRLA 1LOUA 2N3LA 3R5AA 3EPGA 3QT5A 2HURA 4B3RJ 3AQPA 4NL5A 3UW1A 2MQNA 1S9GB 5DG7A 1TL3A 4PYAA 1VRTA 1IKXA 3MAAB 5F8NA 2CJYB 1RE1B 3CCVS 3C6TB 2D7SA 3DLEB 1K8AT 4DV2J 2BR0A 3SCIE 2OEKA 2AGOA 4Y28C 4OX9F 3E2EA 2C2MB 3ZFVA 4RNNA 1S77D 5FIIA 1RTJA 4YR2A 1NK0A 2G2YA 2DB1A 4UT4A 4CRJA 3K8VA 2DY9A 4RW4B 2ZZMA 5D6GA 3R5CA 1SKSA 3PW0A 5I42A 4YY3J 5DO2A 3HHLB 5DQIA 3S01A 1J5EJ 2C3PA 5LSRA 1TZ0A 2VONA 4MYUA 2XS2A 3MEEB 4Z2XA 5AXKA 5LT5A 4L73A 2MHEA 3FBCA 4LF5J 2XYGB 2M52A 4FPRA 1IJEB 4NXMJ 2M2BA 1S1XA 3KG0A 1WHYA 1R89A 5F8MA 3N6LA 2W9AA 2XM3A 3L7OA 2FJEB 2RNEA 3CDBA 2NQPA 3QSIA 4V19J 4IR9A 3CJ2A 2HVEA 1DURA 3HD2A 1U25A 2HGNA 5IC4B 3UQSA 2CJ9A 3V4MA 3RBZA 4K7QA 3LPYA 2DHSA 1WEXA 2ZHOA 3KMQA 5A8WA 5H9EK 3D0GE 2AKWB 3TO8A 2HHSA 1S6PB 5AXLA 4AXIA 3NCQA 2XSJB 2CFXA 4DU7A 4NA2A 1Y3KA 4DZDA 4O0NA 1HYSB 3OHAA 2D3OR 1UPPA 1A0OB 4OZNA 4LUBA 2XMUA 2IBKA 4NLSA 1SJQA 4CLSA 1GFWB 2JVRA 1H0HB 2BMBA 1TVRA 5A8RB 1T3OA 3TVYA 2N3OA 1MN7A 1HQ2A 4PZVA 1U0SA 2XYHB 2HHUA 4FP9A 2OAUA 2IJRA 1RHJB 4HTJA 4AL5A 2EK6A 2ZD1B 3NGKA 4DXLA 3EE3A 2KM8B 3VHQA 1N5VA 3ENVA 3R8YA 1TQLA 1S6QA 4TNOA 1YGYA 4ZPAA 3SCKE 4NLWA 3PHEA 2EFVA 2WCXA 4B08A 2OLWA 3SSRA 2ZNYA 1HD0A 3MDFA 2B9WA 4MH8A 2QLBB 4B9UA 3MEDA 2AW0A 1WDDA 4ELTA 3THVA 1B99A 1RTHA 5DZ6A 2UXDF 4P7TA 2B9XA 4Q0BB 1GX6A 4DFMA 3SV3A 1ZM2A 1SJRA 1KOHA 3D1OA 5ETLA 3W61A 4C8MA 2DH9A 3LPEA 2UUBF 5EX0A 1NHKL 2DHXA 3GE9A 3H90A 2RH3A 3V2UC 1AYEA 2OEMA 5HP1B 4B9MA 5KFYA 2YNIB 1NDPA 2WOMA 5CYQB 3RG6A 3MECA 1DTQA 2JSXA 3NGTA 4ATNA 1S1TB 2AJ0A 2OFHX 3MMJA 3UDLA 2PSZA 3QRQA 3QO9B 4DV0F 3AQOA 2AYBA 2IHR1 1S5ZA 1VISA 1NJWA 2V2KA 2WB1D 1GTHA 1SC6A 3CMES 2R4FA 3SXLA 4NZ6A 1U0HB 3MCSA 2VD3A 1RADB 1LW2B 1HBNA 5ETPA 2U2FA 4X4RA 3KHLA 2CPHA 3DM2B 4KQZA 3U7JA 2YNHA 5K8MA 1WC0A 3CEDA 4HHJA 7FD1A 1JLEB 4ES1A 3AOAA 3DRSA 1FHTA 2CJKA 4RJVA 4E2FB 5HVHA 1NHVA 4A8MP 2A1BA 2DGQA 4ZVTB 2ZWPA 2QMUB 2MXYA 5FD1A 3TVZA 3GZ7A 3C6UB 2KRRA 2XGPA 4LR7A 4PPZA 3V81B 2E9TA 2RDJA 1NPPA 1MWYA 2Y0SD 5L9NA 3H42A 3A8KA 1K1QA 3GJRB 3GFYA 2GQCA 5HVGA 2DNPA 2R8HA 2AJ2A 2BW2A 4RWWA 4ED5A 4OJGA 3OTEA 2OHDA 1KN6A 2N7YA 1VQ8S 4TU9A 2MY8A 2YNGA 4B3OA 1S72S 3MOZA 4M5DB 5AJ3J 4ZVHA 1LWEB 2ZWOA 4AFFA 3DRYA 4R5PA 1BUXA 4C8YA 2XY5A 4WXOA 3MM9A 1FCAA 4KR0B 3T41A 2AD9A 5KFXA 2XWXA 4ZCLA 3W1YC 5SZTA 1M5HA 4LF6J 2BXJA 2CIMA 2M88A 2MJNA 4NLQA 1HQEA 1EB0A 3IR7B 2KT5A 2JFDA 5AT1B 4UW2A 3OFHA 2R8JA 3AT1B 2EFQA 2VPYB 1TR0A 2FZCB 2RQKA 3HSDA 1UWBA 4FVMA 1K44A 4DR6F 1R8PA 1ZA1B 1S0NA 2PA3A 1HWLA 2HZAA 3GLJA 1HBMA 1UEKA 1HR0F 2BRKA 2J9CA 9ATCB 3DCAA 1W26A 4QWEA 4FF2A 4O4GA 1B70B 1S1VA 3UDEA 4NZ7A 2IM2A 4FBTA 5BR8F 1B64A 5KFGA 1TL3B 3FK4A 3LH2S 1IKXB 2B6AB 4TKTA 3DU5A 2W8LA 4I6YA 4BHQA 1XERA 4DQRA 1RT5A 3AFGA 2OMOA 4A8QA 3ETMA 2KFZA 2Z4PA 3QLHB 1Q82T 3I96A 4B3RF 4OJ1A 3HHDA 4ILLA 4X4TA 3DRXA 3I31A 3ISZA 2GIRA 1KTQA 3IP0A 2MKYA 4JI1J 3HFZB 2XCAA 4ZVFA 4DV2F 1SQGA 2KI2A 3R27A 2Z58B 2RS2A 4QU6A 1JJCB 2JC0A 4B3SJ 4KPYA 4U67Q 3F41A 1RLDA 2UVVA 3CTRA 3UNGC 5DQGA 3LWLA 4DV7F 3MMCA 4QYRA 1S57A 1REGX 3KJVA 3DRPB 3RZAA 2ZJQQ 3ZNJ1 4MKYA 8AT1B 4DL2A 2JVOA 3AXKA 3I4PA 4OYIA 4F3QA 3UI3A 4DPYA 4CM0A 1KR4A 1VBXA 4XK8C 3LP0A 4YY3F 1NNDA 3IS9A 4HEA9 3FGVA 3H5XA 1F5AA 4OYWA 1AUDA 5IC6B 4DR5J 2GJ2A 5EUHA 4DPWA 3MPVA 2GV1A 1KRPA 4M5LA 2EFGA 3MFIA 4X84A 3MR7A 4OX7A 4H54A 1U1LA 3UCGA 2DBBA 1OQ6A 4UOFA 4CTAB 4OZ5A 4LF5F 3GJTB 2FVCA 8ATCB 4NXMF 1VRUB 3ZZPA 3CC7S 2CQ3A 2V2ZA 3PIOQ 5GAHI 2UUTA 4LR9A 1X4AA 1RP5A 4ZJOA 5A8WB 2GFFA 4OQJA 2F65A 1V5IB 1K0TA 3P96A 4JBCA 1TAQA 3SQGA 1U26A 4CH0S 4Y0FA 1VR6A 1J27A 1FX4A 2DGVA 2R7SA 2NREA 3T5JA 4ZP9A 1WUUA 2AT1B 5KOXA 1R0BG 1XN9A 4UY85 3HVTA 4C3MA 1FJGJ 4HACA 1CJUB 1TVRB 1Q4RA 4EZ6A 2FY1A 4X64J 5IM0A 2Q6BA 3MURP 3BH6B 3E01A 1WC6A 2IDLA 4YR3A 3W9HA 4ILMA 2SXLA 1N0UA 2FGCA 2HVHA 3BSOA 1QLNA 1VQNS 3RB4A 1VC5A 4Q8EA 3HVRA 1RHKB 5J1NA 1S6QB 1RSCA 1YBUA 1N88A 1NH7A 2YKMB 4PCQA 4UUWA 5IOLA 4GVLA 3VF0B 2B43A 2HS3A 3ISND 4FS1A 2JZ5A 3RRHA 1S76D 4CP5A 4U96A 2P9EA 2M9KA 1WTBA 1ZZNA 2A10A 1NK5A 2D74B 1RTHB 1VQ6S 1EAYC 3VALA 1NB2A 5MAOA 1HPZA 3AJDA 3KNGA 3L7PA 2Y1LB 2MJUA 2O5DA 2HSEB 1OSCA 1OYDA 1YIJS 3NNCA 4ZN1A 1VLOA 5GAGI 1V5VA 1M1KT 2M7SA 3OXFA 5KFBA 1T0TV 1U6FA 2W4CA 4QIGA 2WOMB 5HMWA 4A8WA 2X1BA 1KS2A 3WQPA 2G0CA 1YRXA 1ZOTA 2KZMA 1Q78A 3Q24A 3EXCX 4IOAQ 5KFHA 1UVMA 3PKYA 3EGWB 3L09A 5KFUA 4H4MA 2N82B 3U27A 3BR9A 1RAFB 1EQMA 1JIHA 1EHWA 2UVUA 4JP8A 1SL1A 1BY9A 3J81U 1U1RA 3BF4A 3LALA 2C3YA 3EPIA 1HFEL 2YKNB 1RHQB 5D4OA 1WG5A 1LXJA 2G4BA 3FZBA 2DHHA 4IFYA 3DU6A 4FF3A 4WTOB 2YNHB 2R2UA 2CPJA 3T5KA 1H98A 3B8HA 3RYLA 3J81Y 4LSLA 2HLTA 5E3AA 4ED2A 3DRSB 5FJ4A 5A8KA 3M8WA 3S1TA 2FLLA 4RUAA 1U1PA 2ZEJA 2DXEA 3ZZOA 3SCJE 1FJEB 3LWMA 1NMEB 1QM9A 2ALYB 4X4NA 4QIVA 3ZTRA 3VGTA 1DTTB 4TU7A 3PG9A 3KDOA 2HRYA 3C16A 4KE5A 2Q1LA 2OD4A 1P6TA 1FWPA 2VDHA 3CO9A 3G8QA 2ZUAA 1N0VC 5KFEA 1RABB 2DGXA 4LBPA 2W2QP 2LU1A 3OFGA 2HAIA 5HL7Q 2J0XA 4KHRA 5EX3A 3GU0A 4LJMA 1P1TA 2GVZB 2B7CB 4UOCA 2B9YA 2YNGB 1KONA 4B3OB 1N56A 1PYSB 4QYZJ 1Y4ZB 4L74A 2HLUA 4X62F 4R5PB 1VQ9S 2VV5A 3MM9B 4PAAA 1XNQJ 2PMHA 3DFEA 5L39A 4DFPA 3KWMA 4FYDA 1CQMA 2DPJA 2Z8QA 4QPXA 5AE1A 4LQ3A 2V8PA 4K5RA 1Q53A 2BJ8A 4PUOA 4USWA 3WHIA 2XLKA 4XDCA 4Y2IA 3WX4A 1HQEB 4IFVB 1HIYA 5AJ3F 3ZTQA 4M94A 1F9EB 1LWXA 5IQ6A 4NA1A 3UD5A 2KT2A 2QC3A 3OBIA 5EHHA 4F4YA 2IMWP 2W2PP 1S9EA 3BKTA 3A4TA 4KHMA 3HFVA 3IM9A 2BABA 1IVZA 3Q8YA 4LF6F 4ECRA 3CCQS 4IG0A 5HMYA 4AL7A 1HWKA 3P49B 3LOUA 5KFVA 2PGCA 4O4GB 2CG8A 4I2QA 3BO3A 1XEZA 3EGZA 1U09A 3PCOB 2MKJA 4TVAB 1O51A 2HQCA 1U2CA 1BQMA 4RU2A 5JMNA 3CF5Q 4DUYJ 3EXYA 4MIWA 4C6AA 3BGRB 1RT5B 1IKVA 2R7WA 1PAUB 2W24A 2RT3A 4ZVRB 4USUA 4U8VA 2CNLB 3TZYA 2P5VA 2QLFB 3E51A 2M4MA 4L75A 2CPXA 4IRDA 4YDDB 4OV6A 3H5YA 3PYDA 2GMHA 2MDAA 1HWJA 1FRMA 7AT1B 1L5UA 4GO7X 2WVEA 5C24A 6FDRA 1A6LA 3W2VA 4KKOA 2YNFB 2L48A 4RLEA 3MMCB 4UY8T 1NZAA 4KTQA 3UFCX 2EG2A 3VVTA 2VG5A 4CNYA 1JX4A 4DX7A 4JI0J 4JI1F 2AJ4A 4DMZA 1WF1A 2Z30B 1H74A 4PXBA 2RF2B 3R6LB 2RDDA 4MMOA 3HULA 2WVFA 1PG5B 2L3MA 4JI6J 4F67A 1XR5A 2F4FA 4B3SF 3S6EA 1Q81T 2DGSA 2ZVSA 4ED8A 4NA3A 1XR6A 3LP0B 5HROB 3MCNA 3IS9B 4FBUA 4ID5B 2OKQA 4TLQA 1SXLA 2WRMA 3K89A 3BS9A 1WORA 4DPXA 4TLRA 2V8DA 2IM3A 2Y9HA 2V4JA 4EU0A 2QA4G 4YB6A 1V9OA 4JV5J 1WHWA 2NYIA 1F2GA 1CJVA 4F04B 2C3UA 3GIRA 1RCOB 1FRXA 2ZH2A 1S7HA 4CH7A 4NPOA 3VAJA 1AB8A 1QDUB 3OR2A 1HD1A 4RNOA 3GPAA 4FYVB 4DR5F 2OFGX 3DOLA 3ILOA 5DDRC 3C15A 4ZLPA 2EKYA 2MZTA 2W9CA 3SQGB 4HT7A 1R7IA 2VKZG 2DGOA 3RAMA 2QZ8A 4F50A 3OLBA 1R3NA 3M9MB 5ITHA 3HVTB 3EVWA 1MW7A 1Q79A 4HACB 3E3XA 2J6UA 3CMQA 2F40A 4EZ9A 1GTEA 2L9NA 2RMLA 2ZBPA 3SSQA 2DH8A 4C8ZA 3IWLA 2FJAB 4DCPB 1S99A 4LF4J 4CWBA 5HANA 4WFYA 1RAOA 1X4GA 3BB5A 2HFNA 4WBFA 2KYZA 3BQ0A 2KVIA 4QOTA 2E5LJ 2FHJD 3M2RA 3W66A 1TFWA 3GYXB 1R31A 1GK8A 2POKA 3D3CJ 1NKBA 1GXUA 4HYKA 4AYBD 2DRBA 2KTQA 1F3FA 1FJGF 3M8SA 2VUGA 1AFJA 3PJ9A 3FSXA 4DN0A 2XLJA 2EW9A 2OPRB 5CD4A 2B56A 2HK3A 1GXTA 5J2PB 4PG7A 4KJIA 2AX1A 4PRFA 2EPIA 2VFRA 5CYJA 4HL9A 3MCOA 1YBTA 1HPZB 2HNZA 1IN0A 4EBDA 1GQEA 1KQSR 2UXBJ 4OX8A 4DZ6A 3QWPA 3MMBA 3PDNA 4J9UE 4K4TA 1OYEA 1XIQA 4OJ3A 5KG0A 2PFFB 3HKZD 1SCJB 1X60A 1QD1A 2HG4A 5D3GA 4ED7A 3D6TB 3L7UA 4CCHA 1VHFA 2L08A 3ILJA 1SIZA 3JSYA 3PW7A 4F2SA 4QWBA 1U7LA 3QT6A 3TNVA 2OSRA 2V5HG 4UQTA 4QWDA 4ED4A 3VAIA 4CO4A 1U8SA 2OP5A 4YMEA 1QSLA 4X4SA 1UETA 3RU0A 2RS8A 3NEKA 1ZAVA 4H4KC 1SL0A 4LFAJ 3G71S 1C4AA 3CVKA 2HS0A 1FD2A 1MMLA 3O8WA 1WHXA 3MEGA 2UUAJ 4IFYB 5F41A 4ECVA 5KT4A 2Q79A 5LL6d 4FF1A 4DQIA 3D1QA 3HXMA 2D3ZA 4LSLB 2NZ4A 4B9VA 1L3UA 5A8KB 4X4UA 4GRSA 1RK8A 1SJ4P 3OL7A 3HVAA 4Q7AA 1KQFB 3P8BB 1W2BR 4LRDA 1M5OC 2JEIA 3R2CJ 1PSDA 3OL6A 3QQCD 5ETVA 1S48A 4L72B 3C16B 3LGHA 1M90T 3CJ3A 2RILA 2MZRA 2DKOB 2FDNA 1U24A 1N5YA 1R0AA 2AJFE 3SFUA 5FLXU 4UZCA 5B0CA 3NGDA 3H5SA 3IM8A 5C7PA 4OLOA 4EUVA 4OHXA 3Q8PB 3KK2B 2CPFA 1RISA 1G6BA 2YH0A 5KOWA 4K4WA 2FC9A 5DZ7A 3PX4A 3SEOA 4K8RA 4OYPA 4BCAA 1DJ0A 2CQ4A 5ADZA 1YJ7A 3EZ5A 2A2CA 3UE2A 4GMKA 2FJXA 2MMYA 1F5BA 4H4OA 4KO0A 1RTIA 1WTFA 1HBUA 3N6MA 4B9SA 2LP4A 3FVYA 2E7VA 3LUYA 3TW0A 1JLBB 3DLBA 1KVIA 2WSFC 2EC0A 2GX8A 1LWCB 3GTYX 1RWUA 3H40A 5DDOC 4QIFA 3OXLA 2XNRA 1XNQF 1OPIA 3SSSA 2MKKA 1AROP 1FTRA 3PO4A 1S9EB 2HW3A 4M5HA 2KN4A 4IDKA 4QYZK 2FJVA 2K06A 4JI7J 3CUNA 1KHWA 1N32J 2I6WA 4FNIA 4IG0B 1S1UA 2WSEC 2CQPA 4X2BA 2AIRB 2R2TA 1MROA 5KFTA 3P5BP 4USIA 3KLFA 1QVFR 4I2QB 1U02A 2CG4A 2EKNA 3D3BJ 2DR5A 2VFTA 4YHHJ 4WE1B 4FKXA 1BQMB 2WZ1A 3M32A 4N8OA 3GIJA 2XY6A 1CS4A 3PACA 4KGKA 4KB7A 3ZZYA 1IUJA 1VLYA 4RU9A 2IVYA 5D78A 2DK2A 3UVJB 3W60A 1MSWD 3G8TA 3RB0A 4CZCA 2W2NP 3JSRA 1IWGA 3R5DA 2B3TB 1VQLS 2NUUG 3POTA 4L6V3 2G2ZA 2EXUA 4DJBA 1PBAA 3KLHA 3TVKA 2PFDA 1Z1ZA 2H65B 3Q8VA 4AL6A 1ZPWX 1EZZB 5C24B 5HATA 2CDQA 4EBCA 5T14A 1C1BA 3PXGa 3RRKA 3MXHP 5LSOA 2V8HA 1TUVA 1RWXB 2PI5A 2WBMA 3VWSA 4O3OA 4N5SA 1BWEA 2W2OP 1EP4A 1YZ7A 5D8HB 4JYAF 1W2IA 2LXIA 2FZGB 2B4VA 5KT3A 4ZS6A 2P9CA 3ICLA 4CLPA 2FIUA 2M8DB 2O3DA 1UL3A 2G1DA 3M8PA 4K2XA 4K5SA
chains in the Genus database with same CATH topology
4AXIA 2CVEA 3NCQA 2XSJB 2LLZA 5IFMA 2AYGA 2G9OA 2CFXA 1FJ7A 3IRXB 4BC9A 2YKQA 4O3PA 2E7XA 2CQDA 5KFKA 4YB1P 4ECUA 4NA2A 3M8RA 3HJFA 4JI0F 1Y3KA 1HYSB 1DFDA 3OHAA 2KB2A 3FEXB 4F4KA 1XTZA 4KT0C 2D3OR 3AB4B 2V4JB 3US5A 4OZNA 4LUBA 3W2WB 4NCBA 4G1PA 4XAKA 3PKMA 1HL6A 1U2RA 3N6NA 4DSFA 1MWZA 2XMUA 1NK9A 2IBKA 3I0SA 2IMOA 2JHEA 4FZVA 3WBZA 5C42A 3ETOA 4NLSA 3JYTB 1SJQA 3HT3A 3MFHA 1TKXB 2I2YA 3MAHA 4I0WA 2OPPA 2JVRA 1H0HB 4QW9A 1OWXA 3SZ2A 2GMJA 1TVRA 5A8RB 3CB4A 2VBWA 2W7PA 3IAS9 1T3OA 1V6HA 2AV5A 1XMQF 1N54B 2E1MC 3I9V9 3OR2B 5KFPA 3TVYA 4Q2LA 2N3OA 5DM6Q 4ETXA 3K2YA 1FKPA 3MI7X 4ID8A 1MNEA 4IRCA 2ZH4A 4ZP8A 4HTIA 2HHUA 1N5SA 2DNMA 4O23A 4DBQA 1RTDA 4FP9A 2OAUA 2N4DA 2V8GA 3K5OA 4LT6A 4Y65A 4HTJA 4AL5A 2EK6A 3MM5A 2W9CB 3JSBA 2W8KA 2ZD1B 3NGKA 3TAMB 4JV5F 2KM8B 1C0TA 5CQGA 1N5VA 5KFMA 4LMZA 3ENVA 2GHVC 4WXWA 1TQLA 3L3CA 1S6QA 2ZJPQ 2IC3A 4TNOA 4AE5A 1FKPB 4GC6A 3M9NB 3QIDA 2JEGA 1YGYA 2HVZA 4ZPAA 3SCKE 4PQUA 4NLWA 3PHEA 4IO9Q 1KLMB 4PWUA 5T7LA 2DCUB 1QUPA 2EFVA 2P9GA 3V6HA 3ENQA 3D0HE 4ZPWR 2WCXA 4B08A 4KHPF 4RW6A 2OLWA 3X3UA 3SSRA 2ZNYA 4M63A 3PW4A 2NSBA 5B0AA 1HD0A 3MDFA 4CH1A 2CQGA 2B9WA 4MH8A 5DM7Q 1WHVA 4Q0BA 2V8VA 1C0TB 4C7QA 2W9BB 3VAMA 2CQCA 2K8GA 3MEDA 2OTLS 4B9UA 4ETZA 2AW0A 4LQ9A 3BO2A 1IR0A 3THVA 4ELTA 1H3DA 5F0UA 3PR5B 3T6BA 3D0IE 1RTHA 2BJDA 2YX4A 2YKAA 1FKOA 1L3KA 1T02A 1GAOA 1JLGB 1CEZA 2UXDF 3GB0A 4BDPA 5E5NA 3SMZA 3OSNA 3IR6B 4P7TA 2B9XA 4NCAA 4DG1A 5GAEI 5HP1A 4NCGB 3V6DB 4C8NA 4Q0BB 1MU2A 2YY3A 3M2RB 3MEDB 2X1AA 1GX6A 4YDXA 4ES2A 2C2EA 2GCFA 4DFMA 1VQPS 3SV3A 1U1NA 1FF2A 1ZM2A 4DV1F 1SJRA 4ECWA 3NMRA 1KOHA 3VZIA 3D1OA 4C8MA 2DH9A 2XS5A 1CVJA 2UUBF 2Z2LA 5EX0A 2DHXA 3PJWA 3GE9A 5H9FJ 4OHYA 2LXFA 1NO8A 2QYCA 2RH3A 3BO4A 3T1HF 1I6JA 4OI3A 3FEYB 3V2UC 5HP1B 4LSNB 4B9MA 1YVFA 5KFYA 3X1LB 2YNIB 1SQEA 2CQ2A 2DIVA 1E6YA 2WOMA 3CCRS 2FHOB 5CYQB 5D4LA 2IM0A 3MECA 4EFAC 1TFYA 4DSLA 3DI6B 2RKIA 2EK1A 1DTQA 1D9AA 4LF4F 5A6PA 1URNA 3CD0A 1CQNA 1M5SA 2JSXA 1Y7PA 4Z37A 3J7YU 3VAHA 3RTVA 4ATNA 4UQGA 1S1TB 2E1CA 2AJ0A 4EEYA 2OFHX 3Q8SB 4C8LA 3BGLA 4I7FB 2RU3A 3MMJA 1LW2A 2W4DA 3KHHA 3UDLA 2PSZA 1S0OA 4E98A 3QO9B 5B0DA 2AGPA 4DV0F 1HBOA 3AQOA 2HNZB 5M2PA 2BYCA 2AYBA 2DR9A 2IHR1 4RW7B 2EVZA 2IFXA 3LP2B 3AA8A 1NJWA 5EDWA 1E6YB 2V2KA 3RR7A 2RQMA 2WB1D 3M2VA 1GTHA 3MECB 3DYAA 1SC6A 3M6UA 4DR1F 3CMES 2FPHX 1H2VZ 2R4FA 1DTQB 3SXLA 3MUTP 3KHRA 3BR8A 3HZGA 1YTYA 5BYRA 3MMBB 4NLUA 4NZ6A 4RBTA 1FDDA 1X5TA 1N6QA 1JLAB 3ITHA 3JSMB 3MCSA 4C8YA 2VD3A 3LW5C 2FB0A 3N0VA 3PRDA 1LW2B 2OH2A 1HBNA 2YWFA 2JOQA 2PMZD 2JH3A 5CD4H 2YKOA 4ECQA 2U2FA 4X4RA 4PQAA 3KHLA 1Y9OA 1SIWB 2CPHA 2MHNA 3DM2B 3K0JA 3DYAB 4KQZA 2CQBA 3U7JA 4A8XA 3ENWA 2YNHA 5K8MA 5D3GB 2B4OA 4ZPTR 4W90B 2FLNA 1R27B 3CEDA 4HHJA 2VC0A 7FD1A 2XEXA 1JLEB 4ES1A 1SB6A 4WCEQ 1TL4A 3DRSA 4ZK7M 6FD1A 4RNMA 5DLFA 3TAQA 1FRKA 4O4RA 2JLEA 1FHTA 3QJPA 1K1SA 5DGAA 2CJKA 1DARA 4ELUA 3KHGA 1HBNB 3QZ7A 1U49A 4OHWA 4OX6A 2CRLA 2OPQA 1NHVA 2WTFA 3PZPA 4A8MP 2A1BA 2DGQA 2DRAA 3QJJA 4AXJA 1YJNS 1LV5A 3VAKA 2R7QA 3LGMA 5FD1A 2MXYA 2MGZA 2EFOA 2X3GA 1HWIA 3TVZA 3GZ7A 2HRUA 5B0BA 2NUHA 1YJWS 3C6UB 2KRRA 2R8IA 2XGPA 1CSJA 3KK3B 1IKWB 5AXNA 4PPZA 3M9OB 4NLGA 3V81B 2E9TA 4QIEA 2RDJA 1MWYA 5GVQA 2FVSA 2RRNA 2DHGA 5CH7B 4O44A 2Y0SD 3ZZ0A 2LU2A 5L9NA 5CZVA 2D1CA 2OPQB 1YHQS 2ZH8A 4MKAA 1K1QA 4IKAA 2OO4A 2RVJA 1T8EA 3PY8A 2ZOFA 3GFYA 3AJ1A 2N7CA 2ASLA 1X9SA 3IFEA 3OSPA 4M95A 3T5HA 2GQQA 1FK9B 2GQCA 3I4HX 5E3QA 2KKHA 3K5MA 5E3PA 2Q43A 1JLQB 3FRZA 2GNKA 2DNPA 2NSCA 2R8HA 2BW2A 3UR3C 1LWEA 2K7KA 2K2PA 3QGPA 4DF4A 4RWWA 4ED5A 3TA2A 4O44B 2KRBA 1AFIA 4OJGA 3NNHA 3DLKB 3OTEA 1WF0A 1D8ZA 4C4WA 4TU8A 2GQ2A 4ZCIA 1KN6A 2ROEA 4OZJA 3P5TL 4CO2A 2A18A 2N7YA 3MMAA 3NBPB 1VQ8S 1J5OA 4TU9A 3HHKA 1M0SA 1NK4A 3BJYA 2MY8A 2YNGA 4OMFG 1F0XA 2R8KA 4B3OA 4CI0B 1S72S 3MOZA 4LFAF 2D3UA 3K5LA 4KRWA 3H98A 1FNXH 3T3FA 3TX8A 4O3RA 2J0SD 5HMXA 4F26A 2X51A 4M5DB 4NRUA 2LQBA 3TUJC 4ZVHA 1LWEB 2Y1RI 5B0FA 2IRXA 3TOQA 1X7VA 4AFFA 3DRYA 3PRBA 4R5PA 1UJ5A 4WKYA 2XMVA 3GV7B 4RBUA 1IXKA 1Q8LA 2HNYA 1RT7B 2XLIA 2XY5A 4WXOA 3MM9A 1FCAA 4KR0B 2HVIA 3UCZP 3MTKA 2AD9A 4Y2AA 5EWGA 4MIAA 2FTRA 2ZE2A 3OTCA 4LF7F 2MB0B 3TANA 1TKDA 2CJBA 1V3SA 1XWLA 4J9MA 4E8UA 2VASA 3SFGA 2UUWA 2ZH5A 1PC5A 2J6TA 5KFXA 5IT0A 2XWXA 3I56S 3FCHA 4ZCLA 3N79A 2HZCA 4K4VA 5SZTA 2AX0A 2LQJA 3WC0A 1KTVA 4ICLB 5DDQC 1N5YB 1M5HA 2EI5A 4D3GA 2R7RA 2JEJA 3VZHA 1YJTA 4DSEA 2BXJA 2CIMA 2M88A 2MJNA 4NLQA 1RKJA 1HQUA 1SKWA 1HQEA 2ZH3A 5KG6A 1JLCA 2F4VF 3IR7B 2IVMA 2KT5A 2JFDA 2QLXA 1XMBA 4UW2A 1T3NA 1JKHA 3OFHA 3CCLS 4MKBA 1QAYA 5DRKA 3M8QA 1RYSA 2R8JA 2EFQA 2HFOA 1PGZA 2VPXB 2VPYB 2E5IA 1TR0A 2DGWA 1IQZA 4Q2MA 2HS4A 3QWUA 3CPWR 4X4OA 2RQKA 4HLBA 2NLWA 3KLIA 3NS6A 2K7JA 1UWBA 4FVMA 4HDHA 3CSKA 1IKYA 2BJEA 3D28A 2BRLA 3HF5A 1R43A 2ZC4A 5E3CA 4DR6F 3VQTA 2VA3A 2QSWA 5JVGQ 1JLCB 3PW2A 1R8PA 5KG4A 3RB3A 2B51A 1S0NA 5DG9A 2FHMA 2PA3A 1HWLA 2WHOA 4KBIA 2I5JA 3KLEA 4HVZA 3Q0AA 3M8QB 5DS7A 2FJDB 1HBMA 1FA0A 1HR0F 4I69A 4H4OB 4KO0B 3VAFA 5KTQA 1RTIB 2BRKA 2J9CA 4KSEB 4NOHA 2JLGA 3D1HA 3MD1A 1UWBB 2MQQA 4G3IA 2B6AA 3DCAA 4DHVA 3FJ2A 4WF9Q 1FESA 1T05B 4QWEA 5HQ8A 4FF2A 4GKJF 3KLGA 4MTPA 4O4GA 2R7VA 1SI9A 2XMWA 3GG0A 4NYOA 5CXTA 4PG4A 3CJKA 1PC4A 1S1VA 3UR0A 2DGTA 4FXWA 4FXDA 4PWDB 2PIIA 4NLXA 4NZ7A 2DH7A 2IM2A 2A2DA 4NWBA 4FBTA 5BR8F 4DPOA 2W4PA 1REVA 5EWFA 1B64A 4IO1A 2C28A 1HBMB 3MZIA 5KFGA 2AF6A 2E1AA 1TL3B 2PN6A 2XMKA 3LH2S 3QLHA 3LAMA 3VTIA 1VQSA 3SV4A 1UA0A 3CCSS 1IKXB 2B6AB 2FHKA 4TKTA 1N52B 5KT5A 1E6VA 1VK8A 2WW8A 3ULHA 3DU5A 3FZ2A 3K57A 1L3TA 1U1OA 1Q8IA 5D77A 3MR5A 2W8LA 5IT4A 5L1KA 4I6YA 5FDLA 4BHQA 1XERA 5KFWA 2LKZA 3CJKB 4DQRA 1S1VB 2R2RA 2ACYA 4C0HA 2WK4A 4JI3F 1RT5A 4IDKB 1C4CA 2AYEA 2IYIA 4ALZA 3CCJS 1X4DA 2OMOA 5HMZA 4A8QA 2KFZA 3CCUS 3M1VA 2Z4PA 3HO1A 3QLHB 1HI0P 3QPIA 1S1UB 3O1LA 1UAWA 1FDBA 1Q82T 3A1YG 3G6YA 3I96A 4B3RF 4OJ1A 2J8AA 5DDPC 4XPCA 3HMJG 3OVAA 1LWFA 1JWWA 3HHDA 2MZ1A 4DV4F 1MROB 1Z2ZA 3CCMS 5CZXA 4Y3CA 4ILLA 4JI8F 2Z0GA 3OPKA 4A8YA 3KLFB 3WDOA 2YX7A 4X4TA 1QAIA 1N5QA 3DRXA 1A7GE 1UVIA 4NLDA 3TP2A 3MEKA 3AHPA 3I31A 3ISZA 4DL6A 2GIRA 3PM9A 4DL5A 1KTQA 1Q7YT 5HLFA 2JX2A 1FXDA 3K5NA 1BGXT 4K4SA 3M1VB 3I82A 3V6KA 1H7XA 4CO3A 2XCAA 4ZVFA 1UFLA 2ILZA 2XHWA 5B08A 2K3KA 3D5MA 4DV2F 1CPZA 2KI2A 2NXUA 1UFWA 3R27A 1LWFB 3DRPA 2RRAA 1RYRA 3CCTA 2RS2A 2E66A 4QU6A 1TV6A 1N32F 3E8OA 2JC0A 4J9RA 1ULRA 3M32B 2AU0A 3B82A 2CZVC 4P6QA 4KPYA 1HI1A 3LGNA 4U67Q 2FLPA 5KG1A 3F41A 2IYGA 2HHTA 1QTMA 2VG7B 2UVVA 3OFFA 2VKRA 3CTRA 3UNGC 1FKAF 4RX6A 4IR1A 5DQGA 3LWLA 4DV7F 3MMCA 4QYRA 1SBRA 2E7WA 3KJVA 4B9NA 2MQPA 2QIFA 2J76E 3DRPB 4B17A 3RZAA 2ZJQQ 1TV6B 2NPIA 3CMAS 4GO5X 3T1YF 1JXLA 4MKYA 1NU4A 1X4CA 1C1CA 3GFXA 1FNOA 4DL2A 1D0EA 2JVOA 3I4PA 4YHHF 4J9LA 2KT3A 3KG4A 3MWBA 5IQQA 3POTB 3IG1A 4F3QA 3UI3A 2YKPA 4NYPA 2VBYA 2XBPA 1KR4A 1JLFA 4TXSA 1VBXA 2KO1A 3OFEA 2ASDA 2XMJA 4ZCMA 3FSYA 4XK8C 3KJVB 3K59A 3KK1A 3SI8A 5L1JA 4XPEA 2LA6A 3FFIA 3H4DA 1UKUA 3PEJA 4ZPVR 5AXMA 4CTAA 3LP0A 4QR1A 1HNIB 4YY3F 1NNDA 4JI4F 1S9FA 3IS9A 3F56A 4HEA9 3FGVA 2UXCF 2B7BB 3H5XA 4MFBB 3BSCA 2H9ZA 2VC1A 1BQNA 1VRUA 2FGOA 1F5AA 2DNYA 1AUDA 4MAKA 4XDDA 2GJ2A 2LDYA 5EUHA 3M6XA 4KC5A 4JV2A 3T9NA 3QAEA 3MPVA 5JUMA 2DGUA 2GV1A 1KRPA 1YG0A 1C1BB 2EFGA 4U7UK 3MFIA 3PV8A 1JLFB 2QA2A 4YOEA 2CQIA 3O2IA 4HH0A 4X84A 4OX7A 4H54A 2ROGA 1U1LA 4EYHB 3UCGA 1WEZA 2DBBA 1OQ6A 3FFIB 2UP1A 5K8NA 5C25B 5J2NB 2GHWA 4CTAB 2PT0A 4OZ5A 1NKEA 1VQ5S 3PFOA 5KFAA 4LF5F 5KT7A 2WONA 3DHWC 2FVCA 3KKFA 1U48A 4NXMF 1VRUB 2QT7A 2HWIA 3SDEA 4YQWA 3TR5A 3H2LA 4ZOSA 3ZZPA 1RQ0A 1EP4B 3RB6A 2CQ3A 4Y2KA 5J2QB 3TQ1A 2DO4A 3CC7S 3IGNA 3PIOQ 2W7AA 5GAHI 2ADBA 1D8YA 1W25A 1VJWA 3GIMA 2XCPA 2C3OA 3NCRA 2IA6A 2UUTA 2E5GA 4QR0A 1X4AA 2ZFHA 3GR1A 4C2MA 1RGVA 1RP5A 2ZKUA 2WB4A 2KXHA 3FMBA 4I2PA 3PVXA 2KG0A 4ZVEA 3V5RA 5A8WB 2GFFA 1CG2A 4OQJA 1K0TA 2C42A 4R8UA 5LJ5Y 3CJ5A 2EFPA 2VBZA 3M8PB 3P96A 3SDEB 3MD3A 4JBCA 3U1MA 1TAQA 3IR5B 5E33A 3MGJA 3SQGA 1SL2A 3UWTA 1U26A 4CH0S 4Y0FA 3R5BA 2HWTA 1Q16B 4DSIA 1U45A 4QZVB 2DGVA 3MUVP 2R7SA 2LCWA 1KSPA 2NREA 4I6AA 2XO7A 3T5JA 3DMJA 4TN2A 3R3TA 4ZP9A 3GILA 2FJWA 2VL1A 1GNKA 1NK8A 5KOXA 1H38A 1XN9A 2CQ0A 3H2UB 4R25A 3ZZTA 3NNAA