3OFEA

Structured domain of drosophila melanogaster boca p41 2 2 crystal form
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
81
structure length
81
Chain Sequence
b'RTLMTFVSVTGNPTREESDTITKLWQTSLWNNHIQAERYMVDDNRAIFLFKDGTQAWDAKDFLIEQERCKGVTIENKEYPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LDLR chaperone boca
publication title Structural Characterization of the Boca/Mesd Maturation Factors for LDL-Receptor-Type beta-Propeller Domains
rcsb
source organism Drosophila melanogaster
molecule tags Chaperone
total genus 27
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ofeA00
5IS2A 5T41A 2CDQA 1UJ6A 3DDNA 3LUYA 4GO5X 3P96A 3S1TA 3AB4B 3U7JA 3N0VA 4PWUA 5JJBA 3O1LA 2RE1A 3UW1A 1XTZA 2J0XA 3MAHA 2QSWA 3OFGA 3W7BA 2PC6A 3ENWA 2QMWA 4LUBA 1Y7PA 1UJ5A 3LOUA 1ZPVA 3OFHA 2PA3A 1PSDA 1SC6A 1YGYA 2DT9A 2ZHOA 2F1FA 3AAWB 3TUIC 5IT4A 2H9ZA 2QRRA 4NMLA 1KS2A 3OFEA 4GMKA 3IBWA 2J0WA 1UJ4A 2MDAA 1LK7A 3OBIA 3MTJA 3IXQA 2P9CA 3CEDA 4X84A 3OFFA 2DTJA 5IT0A 5FIIA 2FGCA 2P9EA 3NRBA 2RQKA 1M0SA 1RWUA 3DHXA 2JHEA 2QMXA 4IO1A 3HHEA 3K5PA 4GO7X 3ENQA 3DHWC 3MWBA 2P9GA 3KWMA 1LKZA 1O8BA 1YBAA 3TUZC 3ENVA 2KO1A 2I9SA 2LVWA 1LK5A 1U8SA 2RQMA 3TUJC 2LQJA 2NYIA 3AB2B 4M8LA 3L7OA 3DC2A 2F8MA 2JOQA
chains in the Genus database with same CATH superfamily
1WTFA 3BYRA 5T41A 1P9QC 4LREA 3G86A 3LPYA 3G96A 2C2EA 1NB2A 5KOWA 2FJEB 3RR7A 4K4SA 2IVMA 1TZ0A 3HSGA 4I67A 1JX4A 2B56A 5ADZA 4KPYA 3RRKA 4PUOB 3K5NA 3JXOA 1PYOB 3AJ1A 4RW7B 3HD1A 3NGUA 4DL7A 3OFHA 3BBCA 1S4EA 5D15A 1HW9A 2D69A 2EFQA 4FF4A 1VQLS 3VAJA 5D0HA 2ERRA 2VC0A 3CJKA 1RT1A 3HFZB 1PJ6A 4Y2KA 1B4SA 4TNOA 2OFHX 3C6TA 1JJ4A 2KB2A 1NH8A 1X5OA 2FYXA 1XJWB 3NCQA 3D54A 2F8HA 2W4PA 4C0OC 4JV5J 4EGLA 3VZHA 5M2PA 1FNXH 4B3RJ 4TY8B 1EP4B 3FZBA 3DHWC 4ILMA 1ZAWA 1H7XA 4HH1A 3CULA 4K8RA 4IDKB 1XNRJ 2KHDA 4R0JA 2DNYA 3KLHA 1S0MA 3DGPB 2V68A 1UJ6A 2M88A 2GX8A 4C8OA 2DH8A 3BF4A 3PV8A 1QE1A 1XIQA 3SBMA 5DM6Q 2OMOA 3CSKA 2XC9A 1S1VA 1N0VC 4BBYA 3ZNUA 3M2VB 4KGMA 4RLEA 3K7RA 5HLFB 2QEXS 4XO0A 3K0JA 4IRKA 4U8YA 5GAHI 1JJ2R 1EETB 2DGSA 3R2DJ 5DQIA 3VWSA 4RBVA 1PSDA 3NOGA 4LVNP 5ETSA 1S1WB 4F0MA 2C3UA 2HHHF 1F1BB 1FCAA 4X62J 1KS2A 4GMKA 3I9ZA 4MYUA 3KLVA 3ZZOA 2UXDJ 5KFDA 3FNNA 2VG6B 1PJ7A 1N5QA 1Q7LB 1QJHA 3L9ZA 1UZHA 1X0PA 4WJBA 3B8HA 3KHRA 5KFXA 4UZCA 3DHXA 5D6GA 2RH3A 1S6UA 3HT3A 2L08A 4NCBA 3MGJA 1D8ZA 1XR5A 2M8DB 3TUJC 4NI2B 2BKPA 3W9HA 3PYFA 4ELUA 2V9WA 4X65J 4OI0A 4USUA 3NNAA 1ZA2B 2G2ZA 1DTQA 3KDNA 2V6AA 1RT5A 3UR0A 1N34F 3AFGA 4KGXB 4FYYB 2OTLS 3G6YA 3MAHA 3M8QA 4KIAA 3PRDA 2DT9A 2GIQA 5K5MA 1C0TB 3O5TB 2OI2A 2XULA 5KG3A 4ZN3A 2GMLA 4JI7J 5J2QB 3GMGA 2DO4A 3IBWA 3CJRA 4DPYA 1WEZA 3UR3C 1VQ5S 4WTOB 5BJRA 1LWEB 1R0CB 2RKIA 2B4VA 3IGVA 2W4DA 1MU2B 2EK6A 3LA0A 2R2RA 2ZC4A 3K5LA 1RAHB 1PO6A 4TLQA 3MMBA 1Q95G 2OJ3A 2WBMA 1PYTA 3PHTA 4M8LA 2BW2A 1WJ9A 5B08A 1CJUA 5IS2A 5B09A 2VFRA 1HL6A 1M1KT 2DNOA 4GC6A 3Q8PB 1RTIA 3FVYA 3I96A 1VGYA 4R8UA 5DDRC 2DGOA 4V19J 1M5PC 2F4VF 4RPFA 2YX1A 4PXCA 1G1XA 5G0RA 2FY1A 2R7XA 2MTLA 3GJRB 4O0IA 2MYFA 5DM7Q 1VK3A 2KJVA 1VHFA 4USTA 3NEKA 4ZKAA 2FTRA 2W2NP 4WFBQ 1Q79A 4LFBF 3DDIA 3EUNA 2CDRB 2J8AA 1WELA 3UVJB 4C3MA 1UP1A 4TYBA 3VQSA 1RBAA 1U1OA 2J9DE 2A1BA 1X5TA 4N56A 1VDHA 4TKTA 2Y8WA 4PZVA 4DLEA 3J7Z5 4AQYJ 2YPYA 1U8SA 2HBYB 4DN9A 1JK9B 5KFCA 2OUGA 1UA1A 4C2MA 2YNFA 1OIAA 1N32J 2MPUA 5AE1A 3QYYA 2MSSA 4RW6A 3W64A 2ZNYA 5GVQA 5JMNA 4ZJOA 1X60A 2HYIB 4TU9A 1FO1A 2X3DA 1L5UA 4LF2A 4F7VA 1R0AA 1U6ZA 3FJ2A 1N5YA 3P8BB 2RRNA 3HP6A 5KFEA 1TELA 4QWCA 2AIRB 5KT3A 1YZ7A 2P6SA 4KRWA 1K44A 4RKUC 1ZPWX 1J27A 4A8OA 2GHVC 2OPRB 1TAUA 3G8SA 4L6V3 3VF0B 1RT2B 1URRA 5D77A 4GO7X 4ECZA 3OTBA 2QYCA 1FWLA 1HR0F 3I55S 5ETKA 2C2KB 3CCLS 1VHIA 1L3UA 4G65A 1XMOF 4UOCA 6FD1A 2F8MA 4DL2A 1SUQB 1RACB 2HK2A 2AF6A 1B99A 2UV8G 4M5DB 2MKYA 5A8WB 3BR8A 2DR9A 5B0GA 4WU2A 2V4JB 2IVFB 2M52A 3B6BA 3CJ2A 3O1LA 4M5NA 3C6UB 4MKYA 3RZAA 2FPHX 2KXHA 5HN0A 1FRIA 1RSCA 4EBCA 3IG1A 1JLGB 2H5IB 4LF7F 1ELOA 4E2FB 3DLJA 4OYOA 4FF3A 4PQAA 2C1EB 1ZM9A 3ET6B 3HHKA 5IC4B 1PYSB 4ED6A 4TVAB 3C19A 5CYMA 1D9DA 1GMUA 4OYZA 4B9SA 3W8PA 3IN5A 4A48A 1G6BA 4DV4J 3TJ9A 2U1AA 1QVGR 2E1PA 1GK8A 4NE9C 2R4FA 4JV2A 1NZ8A 2OEMA 3T1YF 3OTOF 5GADU 1H98A 4QPTA 4FZVA 1KEKA 1UFWA 5T7LB 4OJ1A 3KK2B 2E9RX 4OYIA 3IM9A 3BH6B 4ZITA 3EZOA 3OR2B 2VL1A 1TKDA 1PG5B 3C16A 2OFGX 4P9SA 2AD9A 3TEHB 2D1CA 2V9KA 2JC0A 4DPXA 3F0NA 2GVDB 1TUVA 3KG4A 2HURA 4OHXA 3LP2A 2RRAA 3HK2A 1TV6A 3CUNA 2K7JA 2W7OA 4BCAA 3MXHP 1RAIB 1PGZA 4LF9J 3B4MA 3EGZA 3RBZA 4DSIA 4DMZA 2R8KA 1SIWB 1D9AA 4FBTA 2AW0A 1WOOA 4RNNA 4DR4F 2G2YA 4A8SA 2HFUA 2Y8YA 4JYAJ 1H74A 1V9OA 3V5RA 4ID5A 4FF1A 3GYNA 4ZVRB 2HMIA 5IZHA 4OHWA 1BQNB 5DGBA 3SQGA 1WI6A 1OQ6A 1GTHA 2EFGA 4K4YA 3D0HE 4NMXA 2ZUAA 1N48A 4X66F 2P8IA 3DXSX 3H25A 2ZOGA 1F3FA 2PDAA 3X3UA 4BDPA 1JLEB 3JQKA 2AKWB 2JLFA 1HFEL 3HD2A 1N36J 4MFBB 5CYQA 1YRXA 2R42A 3UD3P 2LDYA 4RW4B 1U1KA 2W8KA 5HANA 3NMRA 4USJC 3D67A 3K2YA 2X1GA 5DQHA 1U2RA 2G1DA 4ECYA 4G6VB 3JQJA 1F6TA 3GWCA 4CDIA 4CO4A 1T03B 2NZ4A 4EO8A 1RCXB 2YWFA 1ICEB 4ED1A 2B51A 5EWFA 2OLWA 1KVKA 4W90B 5K9FA 3EPIA 4LSNA 2OHDA 5DDPC 4GKJJ 3M30B 3SYZA 4ZHRB 4B9LA 4RNFA 4DV1F 4PG6A 5ETQA 2DXFA 2V8VA 3CO9A 2V2ZA 1RLCL 1N6QA 5GAGI 3TA1A 2Q43A 1NK8A 3GYGA 3PO4A 1IN0A 4OQJA 1S6PA 3I31A 4HI2A 1F2GA 2NYIA 1NSAA 2GZOA 1XR7A 3EX7B 1OPIA 3CC4S 2G0CA 2PIIA 1YJ7A 5M2RA 1H2UX 4JI3F 5BR8J 2HRUA 3PM9A 4OLPA 4X4PA 2HBZB 3QT5A 1KFDA 2DY9A 3MFIA 2PEHA 3CCQS 2YNHB 4NRUA 4Y34A 3JYTB 4ZPTR 4DBQA 4GKKJ 3FDSA 3JQMA 1B3TA 2ZD1B 3NXZA 4A8WA 5I3PA 4HDGA 5HMYA 2CADA 2CWXA 4O3RA 4P74A 1X4DA 4ZCIA 3DYAA 1NPPA 2HQGA 3QWUA 1B0TA 2ZEJA 3PG9A 4H4OB 3H40A 1XNQJ 4MIWA 3O3LA 4QR2A 1VCTA 3CXCR 1R8PA 5D8HB 3GB0A 2WZ1A 2HWHA 2D41A 2GAGC 4LRDA 3NG8A 1X4HA 3PX6A 2UXBF 4I7FB 5E3QA 3OVAA 2MQLA 5JJBA 4B3TJ 1FX4A 2JOQA 5J2NB 1CJKB 3BPDA 2ASLA 4ECSA 2UVUA 1TKZA 4NASA 5H9FK 1VC6A 4LF6J 2JRSA 1DQ9A 2QGFB 3BSAA 4PG5A 3UI3A 4NLVA 4YDDB 1BMQB 2UUAF 4F4YA 3I0SB 4NOHA 2AMCB 1C1BA 3KLGB 1NJZA 1FRKA 5EX3A 2F7VA 3SV3A 1NZAA 4WFAQ 2KTQA 1FJ7A 4P52A 5HP1B 2QA2A 1DBDA 3M8RA 2AEMA 2K3KA 2YXLA 3HHLA 4UUXA 4ED4A 3DMJB 3EYZA 2VPZB 2DR7A 1FFWB 5B7WA 3MMCB 1M90T 1NJXA 3M2UB 1BWVA 1TKTB 2ZKTA 2WHOA 1IKYA 3AY0A 2AX1A 3A1YG 1WKKA 1WC0A 2ZWOA 1YHQS 4GVLA 3W2VA 4ENOA 2Q79A 5F9NA 1YBAA 2RU9A 2JZ5A 2A2CA 2RMLA 2HFVA 1FWPA 1SKWA 3FBFA 3UD5A 2UUBJ 1D1UA 1D09B 3D0IE 4RBTA 4DF8A 3QIPA 3TQ1A 2FC9A 1UPPA 5A2QU 5GMEA 1ACMB 4NLSA 3CJQA 4WK1A 4USIA 2YWEA 4B9UA 1QAJA 5ITHA 2BM0A 3TI0A 1AZSB 2QLJB 3I6PA 2XGPA 4OX6A 4CLYA 2GJFA 1JKHB 3MEKA 4NA3A 2JLEA 4IOBA 3BO3A 2MY7A 3CCSS 4UQGA 5IT9U 2VIHA 1X5PA 3PCOB 1R7IA 4OHYA 2C22A 4JI1F 1PC4A 2CQDA 2HFSA 2WVFA 1REGX 2DH7A 3DLEA 1UVKA 2CQBA 4ANCA 2AT1B 4OJGA 1RHRB 1FD2A 1HWIA 2MHEA 3RGIA 3MOZA 5EHHA 3JAMY 4UZBA 3M6XA 1WEXA 3CJKB 2RDDA 1RT1B 2OPSB 3FRZA 3C6TB 1DARA 3R7SB 3S1TA 1T95A 1U1MA 4IG0A 4PWUA 3HT0A 1VRTB 1VK8A 4X4NA 2MXYA 2C3OA 4I56A 2BEFA 3IR6B 2ZH3A 4ER8A 4KHPJ 1FE4A 5C24B 3M6VA 5H1SV 2Y9HA 2J7WA 1QUVA 3VAKA 3DOKB 2Y1IA 2DBBA 4DV0J 1VRQC 2DIUA 1T9UA 2EG2A 1S57A 1S1TA 1SH0A 2YPZA 4HHJA 3CCES 3PJWA 2I5JA 5B0DA 4KBIA 5DG7A 4MYTA 1MNEA 4NLQA 4O4GA 4PPDA 4ZPDA 1NKCA 3QJPA 2B9EA 1F5BA 3N5BA 2I38A 4QPXA 2VASA 4RL1A 1WUUA 6FDRA 3LP1B 5I3QA 1N52B 5LOQA 5K20B 2A0FB 4EFAC 1YTYA 1U09A 1XN9A 2MQPA 1XEZA 2I2YA 3OFGA 3W7BA 2YWGA 4F50A 1AXQA 4L72B 3PEHA 1FNOA 5EWGA 1KBRA 4OJHA 5CHCB 2CJQA 1QD1A 3V4MA 5K8NA 3MAAA 3G8QA 3LAKA 1SJ4P 1IJEB 2YKNB 2CQIA 5D3GA 3SMZA 1DTQB 4Q43A 1IKWA 4JI8F 3OL7A 2JJ4D 2ZZTA 2ZZNA 3CC7S 3D0GE 1RT3A 4J5OA 1KQFB 3R6GB 1CS4B 2W9BB 2KJWA 3DKDA 2C2DA 1IBCB 1SJQA 3HSZA 3WBZA 4MK9A 2O01C 3F44A 1NMEB 1FX2A 2J76E 4BC9A 3PJ9A 1SL2A 4O44B 4WE1B 1R3NA 4IRCA 1ZTWA 1L3TA 1UEVA 3H0PA 3X1LB 2C28A 3W61A 2B43A 3DRSA 5HVFA 4M5IA 3SDEA 1C4AA 2J0XA 4NXMJ 1RK8A 3Q2TC 2OPPA 1LW2B 2V8GA 1FF2A 5K14A 2CJAA 1CLFA 3U27A 1M5KC 2M9KA 3OL6A 4M5MA 3OFEA 5KFOA 4ZVHA 2AJ0A 3J80Y 2LP4A 2E7VA 4ZVSB 5DDOC 2AJQA 1R43A 1DLOB 1JB0C 2RT3A 5HBMA 5HAOA 4DV5J 3Q89A 3TUPA 1UEUA 4KR0B 2E9TA 2E5JA 4EZ9A 4A47A 4CP5A 2CPXA 1X4EA 4C3KA 2ZH6A 1S59A 3NS5A 2FHJD 3GP9A 3OV7A 1SC6A 2R7OA 1GX5A 1QSYA 3TP2A 4XIUA 1Q4RA 3R8YA 1RHJB 4CI0B 1KVIA 4KYZA 3QZ7A 2PI5A 3IP0A 1YJUA 1FHTA 3UN2A 4CH1A 1X5SA 1DAXA 4J9NA 3U1LA 5A0YA 4N7TA 3OD2A 1Y7PA 5IWAF 2O3DA 4JOUA 1CJVA 3E8OA 2B9YA 2KXNB 2ZHOA 1C1CB 2VQFJ 2MJUA 4LIRA 5KFFA 4TQRA 2FQQB 1TQLA 4A46A 4UQTA 4M95A 3ILIA 2HVEA 3SXLA 1GXTA 3A3OB 2FLOA 1FT8A 4QIEA 4RW6B 5HO4A 4X4TA 5CH7B 4XAKA 3CCUS 4QU7A 2X1BA 2MKSA 2E5LJ 5KFMA 4Q45A 1UVLA 3MFHA 1LXJA 4OL8A 3D6FB 1F9FA 1T3NA 4KHRA 3LTOA 3NBPB 3QQCD 2CZ9A 2CQPA 1R0AB 4QZVB 3TO8A 4OLOA 2EFVA 4JI4F 5EDWA 1WC1A 4ZP6A 5FDLA 2I6WA 1AT1B 2IYIA 1UW4A 5LJ5Y 4CLZA 2Y0BB 2XLIA 2YNGB 3A13A 4K4WA 2G0JA 5D0EA 4C8ZA 1FI4A 3NGKA 1HMVA 3MM8B 1RTJB 3GG0A 1T9VA 1DQAA 2HIYA 1NJWA 3DGVA 2XMKA 4MK7A 4Q2LA 4X4QA 3QSIA 4PYAA 2CJYB 4ATNA 5HSPA 3VGVA 4WU3A 3DU6A 3MUVP 1H3DA 1NK9A 2QMXA 1CJTB 4DR7F 5ETMA 1A6LA 4MKBA 1U6BA 3GTYX 5IQQA 1S7IA 4ES3A 1ZBTA 2LQJA 1VBXA 1YZ6A 1NSPA 3N28A 4U8VA 4P10A 1FFGB 2BBEA 2VB6A 1AA1B 4B08A 2FD2A 3DDNA 1QVFR 1VQOS 3R7NB 3BDPA 3N01A 3F41A 1KONA 2MZJA 2C3PA 1RP5A 3VGUA 3CD0A 1GMWD 3S01A 2IAJA 2Z58B 5U47A 2BZ2A 3BYPA 3PW5A 4B3MF 4LF4J 4CQ1A 2XZDB 3A8EA 1S6QA 2QRRA 1TVRB 3W63A 4L3KA 3RTVA 1UJ4A 3EWGA 4ZVTB 3AHPA 2RDJA 5DDQC 5DZ7A 1NCLA 2DNZA 2HS3A 3QRRA 5AXNA 3H42A 1GH8A 1BLUA 3HCXA 1HNWF 2XSFA 4QU6A 3MPDA 5B0CA 4G1PA 1X7VA 2HHHJ 3LP2B 3ENQA 2HNYB 3IWXA 4URGA 3KLFB 3K5MA 3GFYA 3F56A 3RBDA 3I82A 4WIQA 1XK8A 1HBMB 5ETNA 3FRYA 2CJ9A 4KAIA 4X64J 3AOBA 4EZ6A 5KTQA 4DV2J 2JC1A 5BYRA 3KTQA 2O5DA 3TX8A 1YK9A 1FERA 5C42B 5ETOA 3RB3A 5CD4A 4WF9Q 1WF1A 1RXOB 4Q44A 4EYIB 4OHVA 2YNIB 2M8HA 2CQ1A 2C3MA 1NAQA 2ZBCA 1Q8KA 4ILLA 4I6WA 3CT9A 2B6AB 3FGVA 3PJXA 2PE8A 3ISNC 3CEDA 2I8EA 2OSRA 4LR9A 2XBPA 3T6JA 4F8RA 4USWA 3TJAA 4Q0BA 4Y2AA 2PFFB 5KFWA 3CF5Q 3EZ5A 1HQEB 2P9GA 4IG3A 1R8AA 5THWA 1VQ7S 4J9OA 3F73A 3IBCB 4OI3A 2B4UA 3JSRA 3VAIA 2OEJA 2RRBA 1P1LA 4FXWA 3OW2R 2YWHA 2IRYA 4CIOA 1F0XA 1YKWA 3G2XA 4A8KA 4PKDB 3WX8A 3T9NA 2MQQA 1MG7A 4QIFA 2I0XA 1ZAVA 1V5VA 3DOLB 1SI9A 2QMWA 3BDEA 3TVYA 2WRMA 3TAMA 3IAM9 1RU1A 2ALYB 4ZN1A 4YQWA 4S0MA 4OX9F 2IMWP 4KTQA 5GAEU 1SPBP 5HVHA 2DKOB 3PR5B 2PMZD 1T9TA 5E3PA 4W92B 2VG5A 2WSFC 2EBEA 5KFBA 5E7OB 1W2BR 4WYLA 3OXGA 4KO0A 2FGCA 2PA8D 4DG1A 4Q8EA 2Y1RI 3NY0A 2H3EB 2ILYA 4WCEQ 4EEYA 1YQHA 4DI6A 3CD6S 4H4MA 2CQ0A 2Q6CA 1K0TA 4DR3F 4LFBJ 1NHKL 2P6TA 1C2PA 1RHQB 2QN6B 4KV8A 2B0GA 3WX4A 3BR9A 3HULA 3NGRA 4YR3A 1FDDA 5LMNF 2NLWA 1TL7A 2WOMB 4GC7A 3THPA 4J7CA 1O51A 1UZDA 4DSKA 2R8GA 2IC3B 3FBEA 4LFCJ 4C11A 2UZAA 2ACMA 3C15A 1U26A 1L3SA 3OHBA 4DV7F 4DV6J 1Q53A 3BO4A 1M5VC 3H59A 4HHUA 3BGUA 2MQNA 1VQ8S 2XLKA 4J9PA 5MAOA 3IR5B 3NOCA 5C25B 1HBNB 4NLRA 5AE3A 3NRBA 3ZO7A 4DL0C 3KJVA 1IBKF 1C1BB 1HBUA 3VZIA 2JWNA 1U47A 2EFPA 4ZPVR 4QWDA 3Q8YA 1RAFB 3W5XA 3ADAC 1GMVA 1YJVA 4OI2A 4CNZA 4F0HA 1QM9A 1HBOB 4E98A 3MR6A 1VQKS 2E7XA 2EG1A 2KXFA 2XMJA 3KHHA 4J9MA 3OQ2A 3PR4A 1HR0J 1RKIA 2ZZMA 4KKOB 2KYZA 2WW8A 4O3OA 1RJJA 2MKIA 3W2VB 4NXNJ 4NLUA 2ZJPQ 2AEJA 5IQ6A 1EJ7L 2HRYA 2DGWA 3C14B 3V2UC 4F25A 4L74A 2F63A 5AXMA 4WFXA 2UU9J 4CZCA 3G8TA 4N8OA 5IT0A 4L73A 4H54A 1WSVA 3ZZPA 2ZFHA 2P9EA 5J1EA 2W9CB 4LIWA 3SFGA 1TL1A 5G4DA 3P45B 1XMQJ 4TY9A 2O1PA 3LF0A 1JLCB 1UVJA 4F4WA 3D3BJ 2XZWA 3PKMA 2ZDOA 3CJ3A 1HNVA 1V3RA 2E5IA 4BWJA 5J2PA 5A8KA 1RTHB 3CDBA 1PIEA 3MMAA 2IY5B 1NK7A 4V19X 3RB4A 4ZP8A 3ELHA 3JSMB 4KGVB 4I2PA 4B9TA 4X2BA 3I0RA 1S0NA 3CMES 3T5JA 3DLEB 1C4CA 3G87A 2CJKA 1SV5B 2BR0A 2CG4A 3S8SA 1RBOB 3AD9C 4NYZA 3DI6A 1IKXB 3NAHA 2ACYA 3PYGA 2RNEA 1S1XA 1NPRA 2J0WA 4DF4A 4MKAA 3Q8QB 3R9LA 1RTDB 3D1QA 1XBWA 1H72C 3UN3A 4PRFA 3OFFA 5FIIA 2IJFA 5ETRA 3V6DA 1Q82T 4R25A 2ASYA 4RW9A 2K7KA 1QAYA 4HT7A 4YR2A 1GQEA 4AD6A 4RUBA 3M8YA 4NYOA 1Z2ZA 5A76A 4NZ6A 1KNZA 1I1GA 4QR1A 4JI6J 3BO2A 2DNQA 4J90A 4KJIA 2GV1A 1MROA 2COLA 3Q23A 5MLCV 2LXFA 1S1TB 3UPFA 2R7WA 1OYDA 3OSNA 4C0BA 4ANDA 3H2VE 1RBLA 1VIOA 2DY1A 1VRUB 4RZRA 2QA4G 3IWNC 1AFIA 2MZTA 2RHQB 4ALZA 1NDKA 1V5IB 4K4ZA 1IBMJ 4KFBB 2UXCF 1ZOTA 2AYBA 2AHOB 3D1HA 3WC2A 1SKUB 5L38A 3BSCA 3EGWB 4PR6A 3QPIA 4K2JA 1T8EA 2WTFA 4M5LA 2FJBB 2Q3PA 1EQMA 3IAS9 5F8JA 4ZCLA 4JV5F 3ZZTA 4N41A 5DLGA 4LRAA 2V4RA 4B3RF 2XGQA 3QJJA 1KLMA 2QFIA 1UFLA 4DPOA 2VF3A 3KWMA 4OV1A 4NLOA 8ATCB 1XNRF 2OD4A 3CCMS 4CH0S 5LL6d 4NEYA 3TRGA 1SBRA 2XO7A 2CIMA 3DC2A 1KQKA 4DL4A 4ECXA 3AODA 3MAAB 1RUSA 4DV1J 1TFWA 2GVZA 2YWKA 3KNGA 4K59A 2C2RA 4PQUA 2CJXB 4J9VA 4DFKA 2MSTA 2DNNA 3QSYB 4RNHA 4CLPA 1LOUA 4NZ0A 2EK1A 4DEZA 1PILA 4HACB 1S5ZA 3SZ2A 1J5EF 1YRUA 1RLDA 3QATA 5IM0A 1WKJA 3DRRA 2V8HA 3W1YC 3QMQA 3ETMA 2H48B 2DNMA 1RHMB 3BZQA 3GIIA 3ZTPA 3MHYA 5E41A 2R2TA 2UXDF 2J9EA 3QNWB 1S0OA 5EGYA 4IFVA 1BQXA 3J81j 2DGTA 1FJGJ 1X31C 2BKNA 4EBEA 3T41A 3DLKB 3P3DA 1IBLJ 4B3OA 3DLGB 3ZC4A 4NYPA 3EZUA 3M6UA 3EJMA 1G4CA 4C97A 3J81U 2F4FA 5CCLA 1VC0A 4TLRA 3HVTA 3G82A 1B70B 1Q5YA 4TQSA 2GMHA 5K14B 3D68A 4DN0A 2W7PA 3LP0A 4FKYA 2J5AA 2KO1A 2Q6BA 4OZ1A 2Y1JA 1R89A 1YI2S 4X65F 4ZS6A 2Z57B 2VBYA 3KLIB 5A8RA 3MM7B 2I1RA 2BABA 1F2HA 1U02A 2VOPA 1EHWA 2KG1A 3E01B 1UWBA 2KRRA 3EVMA 4YUDA 2YWWA 3HDSA 4ZMMA 2KH9A 2EC2A 3V81B 2EEYA 5F41A 5CABA 2GCFA 4QIWD 2FHKA 1N33J 3TZZA 3MEGA 4TU8A 3QWPA 1SL1A 1YDLA 4U67Q 4DSLA 3TR5A 2MLZA 3I4PA 1N54B 2Z56B 4ZP7A 3TVKA 3AOCA 4JI7F 4RR5A 2HIQA 2DEIA 5K8OA 7FDRA 2DR6A 3ZTQA 4WZQA 2V4QA 1VJQA 2KFYA 1RHKB 2E7WA 3VGTA 3L7UA 3H2UB 4DPWA 3PX0A 2W9AA 1U45A 1VQNS 1SKSA 3DM2A 1M1HA 5F0UA 3OXFA 2RQKA 1UMJA 2JHEA 3MD3A 1UFKA 1RWNB 2WB1D 3EXYA 4OYPA 2J8SA 1CJVB 1X9MA 1WKLA 5C5JA 2K1RA 1T11A 1U1NA 2IBOA 2VG7B 5IXUA 4G1QB 2CPYA 2CYYA 4IUFA 2LEPA 2ZWPA 3HPOA 1UA0A 2E5GA 3MOJB 2OP5A 3CCTA 2KN4A 3EGNA 3M1VA 1RT4A 4F3QA 3J7AN 1I94J 4K50A 3ZZZA 1CULB 3D3CJ 3W65A 9ATCB 3PACA 4KB7A 5CD4H 1UKUA 1FXDA 3V6KA 1QUPA 3QRQA 1FKPA 3PKYA 2VFTA 1HLWA 4ECTA 2XTJP 1WSRA 3H8YA 4DUYJ 1XQIA 3UNYA 2OSQA 1CVJA 2CZVC 5F3TA 2HGLA 2CVIA 3M8WA 3NNCA 2XB2D 1JIHA 1QTMA 3BGRB 4I4BA 4WK3A 4M1KA 4DL6A 2XWYA 3VVTA 2XMWA 5AT1B 1WWHA 4AQYF 3BS9A 2HLTA 4ED0A 1FEEA 1ZETA 3MEDA 4LR7A 3RAXA 1HMVB 1HNIA 1LWCA 2D74B 1N32F 2V50A 3HVWA 2CQCA 1NHUA 4LT6A 2NYHA 3A8JA 4L3NA 2J7KA 4CLSA 4LF8F 2KFZA 3AB4B 4ERDA 2ZM6J 1YJRA 2VA3A 2R8HA 1D3WA 4DU8A 1L3VA 3L7PA 1LWFB 2BJEA 1WNEA 1H2VZ 1AYEA 5I3UA 2ZH8A 1IR0A 1YGYA 2VJUA 1RGVA 3US5A 3MAQA 3K17A 4YDXA 1ZYQA 4O23A 1KD1T 2ZE2A 2R7SA 2BOAA 3DDKA 1ZZNA 2PMHA 4UY8T 4OJ3A 5ETTA 4P71A 2B3TB 1KTQA 1S99A 1YRTA 1K8AT 2ZBRA 4DR1J 3R2CJ 1Q8LA 4Z37A 5KFZA 5HATA 4PXDA 2IAJB 4URQU 4QBUA 1IUJA 4RJVA 1MLAA 2CAJA 2YQ0A 3P5BP 4ZCMA 1MMDA 3R7BB 4RW7A 3AA9A 1HW8A 2D9OA 2DGXA 4N76A 4NLWA 2DR8A 2FJVA 2YKAA 1RISA 4NEZA 3MPWA 1VLYA 3K8WA 1TKXB 1K73T 2QE5A 5F8LA 3DOMB 1KHWA 3QLHB 1JNZB 5L1IA 4RW8B 4DL5A 1HHQA 2A6OA 3WQPA 3B4DA 4PCQA 1I5OB 2FHJA 3CWJA 3B78A 4FPIA 1EP4A 5E3CA 1AUDA 1GAOA 1NK4A 1X9WA 4DV4F 2OEKA 2M0GB 1EKRA 4IDKA 3SQOP 3U1MA 2BJ8A 3IS9A 3MR7A 2BVZA 2V5HG 3DGPA 1QY7A 1Q5VA 2GJ2A 3MM9B 3P49B 2LU2A 3GU0A 4DOZA 4OIXA 4U7UK 2H51B 2NR0A 2NQPA 3UDVA 2V8PA 4LRBA 3TUZC 2UV8A 1SXLA 3VGSA 1Y9OA 3M2VA 2BE9B 1LW0B 2HFOA 4IRDA 2VKRA 4QCLA 3RJMB 4XPCA 1FA0A 4DCJB 5JUMA 1HQUB 5IFMA 1SC1B 3S6EA 1EETA 3H5SA 4GO5X 3TAPA 1ZS6A 1S1WA 3N0VA 2EBGA 2RVJA 5KG4A 3W8GA 2BX6A 2RE1A 1VQ6S 3BB5A 3MM6B 2UVVA 2M7SA 4K4XA 2XSJA 2QSWA 1ZTTA 2HGMA 2WVBA 2HNZB 4LF9F 2VG6A 4YP3A 1PKUA 4LBIA 1U2FA 1QTNB 1NK6A 2NXUA 3NGDA 4QWEA 4JYAF 2AYMA 1FDAA 2IJRA 4DUZJ 3KNAA 1OMSA 2W8LA 3OUYB 3EDQB 2M5YA 3MEEB 2LQBA 1B7YB 4Y6IA 1S0VA 4D3HA 2FLPA 2NREA 1P8GA 4NI2A 2Y3YA 3AD8C 1FE0A 2BXJA 3H7HB 2D3O1 4UT4A 5F8NA 2C2NA 4IH5A 3GZ7A 2C42A 2FJAB 4LRFA 5LXRA 3ETOA 1SJFA 1UVMA 1BQMB 3NAIA 2AGQA 2LCWA 3KMQA 5KFLA 5LJ3Y 1MSWD 3QJLA 1WHWA 3L95X 1KQGB 1N36F 3D9BA 2BDPA 5F8MA 1WDTA 2U2FA 4ZPCA 1A7GE 4DX5A 1TL3B 3KK1B 5J2QA 1LWEA 1S1UA 2R7VA 2DHGA 2QV6A 1RKJA 1GX6A 2NCKL 2CWKA 4EMDA 1MU2A 5KT7A 2HS0A 1QSSA 2F9DA 4HDHA 3AD7C 3PTWA 2FVCA 4GKJF 4NLPA 5D4NA 5IWAJ 2VV5A 3IWLA 2DNGA 2ASDA 2ZITA 3M8PB 1TFYA 3TW0A 3A12A 2KG0A 3HHLC 1HNZF 1NJIT 2QLWA 4JUZA 1PCAA 4CO3A 1JLFB 2LVWA 1GMWA 2Z2YB 2IBKA 5F8HA 2DGVA 2XHWA 2RQMA 2DIVA 1J5OB 2YQ3A 1HI1A 1BE4A 2LU1A 4X4OA 3PFOA 5BR8F 3ILJA 4DV3J 3E3XA 3T1HJ 1U0HB 5L1JA 2KDOA 1X0FA 1D9FA 1RT7B 3OSPA 2XO6A 4GKKF 4PYDA 5C2CA 3UDLA 2EXUA 2DNLA 5HROB 2CVEA 1UJ5A 2MGZB 2Z8QA 2W4CA 1VOMA 4NLXA 3UVJA 4F4XA 3GLJA 3TZWA 4JI4J 3FMBA 1M1GA 1SQEA 4DZDA 4YY3J 2V2KA 2PD1A 4ICLB 2BE7D 2HHXA 5KFQA 2CQ4A 1REVB 1K0VA 1Q8BA 3Q8VA 1KHVA 1RDRA 2GNKA 3HSJA 1XNQF 2IFXA 1UTAA 2WVCA 2GS8A 4AXJA 1JNRB 2ZC3A 2R9LA 4RNMA 3D1OA 4ETXA 2CQ2A 3JTOA 4FVCA 3EGVA 2C2OB 3AA8A 3RAMA 4DPUA 3PYDA 1LK5A 4B3TF 2DYAA 2AP6A 2HAIA 3W5YA 2X51A 2ZH5A 5EWEA 4LF6F 5B0FA 1HHSA 2AV5A 4OX7A 5IOLA 3EMTA 2KYXA 2APOA 3GFZA 2FJDB 3KK3B 1UEKA 2VD3A 1NJYA 4QW8A 2WONB 1KLNA 2N4CA 5HVGA 3FFIA 4QWBA 3MI7X 4CYUB 3GV7B 3RRGA 1OY6A 1G7CB 4OYBA 5L9XA 2XS5A 3H5XA 1RT2A 4HTJA 1T9WA 1N8RT 4JI2J 4J9SA 4J9LA 2IDLA 4WZMA 2GQQA 5J2PB 1D8YA 3GFXA 4F4ZA 1SQFA 5KFAA 1FK9A 2N7CA 3MMAB 1F5CA 4OZJA 3BKTA 2GIFA 3M9OB 2AQ4A 1KDNA 2N3OA 2FZKB 2WSEC 3IGNA 2F8EX 5L39A 2I9SA 3T5KA 3P6YC 2B7CB 2V4JA 5CZVA 4ZA1A 4U6PA 2DH9A 4JV0A 3CDAA 3CJSA 4I1TA 2UUBF 2Q66A 1RWKB 3C6UA 1U0SA 5KT5A 3OPKA 5JVGQ 3ONQA 1NB7A 4FYXB 1FTRA 1HNWJ 2YQ1A 1JLGA 2GJIA 1UWAA 2XHCA 4DX8H 1N4LA 3THTA 2BJ7A 1M5HA 3OL9A 3AQPA 1GTEA 3S7RA 1LFPA 4DZ6A 3D5MA 4RW9B 3ET6A 3T19A 4WKRA 3O44A 3K5OA 3FSIA 2VU5A 4C3LA 5CCMA 1O5JA 3GJQB 5DZ6A 3EICA 1T02A 2ABYA 3MURP 1I6JA 2JSXA 1RWVB 1FRMA 5KFIA 4PEOA 5LMUJ 4F4AA 2E44A 2LMIA 4B17A 4RWXA 3HHNB 4CO1A 3UDEA 3PIPQ 4CLTA 5FD1A 5T7LA 5KG0A 3KK2A 2VOOA 1URNA 4HVZA 2QA1A 3RG6A 2MZSA 2N82B 3FCHA 2PN6A 1Y0HA 3K57A 2BM1A 2EC0A 1Z2LA 3WHIA 4BWMA 3NKYA 2DHSA 2FLNA 2GVDA 2HG4A 4HKQA 2YTCA 4HHHA 3UE2A 2QT7A 3GFHA 2B7BB 2RQCA 3EE3A 1EQ0A 2BE2A 3M2RA 3IFEA 5E0OA 2V2VA 3H5YA 2GIRA 3L3CA 2HGNA 3HXMA 4RBUA 2IA0A 2DGQA 4R5PB 3I5BA 2VQEJ 4CLWA 4KHPF 2L9DA 1ZAXA 4C4WA 3GILA 2D7SA 3HZEA 2NSBA 1AW0A 2LXIA 3HFKA 5CQGA 3HVRA 3QO9B 2R2SA 2LQ9A 1Q7YT 4DV0F 3POTB 2MLYA 2BV3A 3DRPB 4IR1A 5J1NA 4KGZB 2RHSB 2B9XA 2MMYA 3J7ZT 3CB4A 3GIMA 4ECRA 4Q7AA 2M70A 1FKOB 4KHMA 4DSEA 1K1QA 3L4BC 2C2ZB 5D0RA 4C7QA 1BUXA 4ZPBA 5EX0A 4OX9J 3M7VA 4WFNQ 3GJSB 4RW4A 3GPAA 2HQIA 1HI0P 2VDHA 3HLUA 3I4HX 4NCGB 2CPHA 4I64A 1WG4A 3SCJE 4EUVA 3M8SA 1SB6A 4ZVGA 3QFHA 3LUYA 2HAFA 2GGPB 2W1BA 3AOAA 1Y5IB 2QZ8A 1FVSA 5KFUA 4EYHB 4M5GA 5BYSA 1K1SA 3HVTB 1FRJA 1T03A 3TAQA 1ULRA 2NXEA 2PC6A 4WKYA 3C2PA 1IM4A 3ZNJ1 2K06A 2LECA 3M30A 2DD8S 4ZHRA 1OO0B 1S9EA 1P9YA 1LK7A 2GHWA 3TQEA 4EO6A 2WAQD 4ZLNA 1S9FA 2VFVA 1UWBB 2ASJA 2N3LA 3PDNA 3MF5A 2NUUG 4F4KA 5H9FJ 4DQQA 3D6MB 3HO1A 4A8XA 4LSLB 2LA4A 3V4IB 3AT1B 3VAMA 1T05A 4WP3A 3IRXB 2YNHA 3T5LA 3NWGA 3JYTA 5DQGA 2ZNZA 2CA9A 3DNCA 2KM8C 2ZD1A 5F0WA 1KSPA 4FNHA 3FSYA 3MM5A 4ZJLA 2YBVA 5J2MB 4U9RA 2GFFA 4ZVPB 3DRYA 4NXMF 1Q81T 2BQUA 1S72S 2B8QA 1WEYA 1U1QA 2CJBA 1U6FA 1CG2A 2PSZA 2CQGA 4DR5J 1WORA 4KC5A 3GONA 2HQ3A 3R5DA 2RUSA 4H4KA 4H4OA 1N88A 1QSLA 2KU7A 2YX4A 2XMMA 4A8MP 2K1RB 3OR1B 1PAEX 4UOGA 3NWRA 4ELTA 2EWHA 4DQSA 2HNDB 3LWLA 3QGHA 4DV5F 1S9GB 1VBZA 3CMQA 4I7FA 1CQMA 1N5VA 3VVUA 1Y4ZB 5J2NA 3MTKA 1CJKA 2FC8A 1LV5A 2DCLA 4CT9A 2LKZA 1APSA 3GV5B 1U4BA 3PW4A 2N4DA 1IR1A 4ZVUB 2WK4A 1MMLA 3OLBA 1UL3A 1VLOA 4IFYB 2MY8A 2NZCA 4DDFA 4Y3CA 1HWJA 3GCWP 3I0SA 4NCAA 3KLGA 1VISA 2HZAA 2DGUA 4ZOSA 3CPWR 5HP1A 2VKZG 2YKPA 4PWDB 1P27B 2BYCA 3FZ2A 1HPZB 1Y00A 3DMJA 2AJ4A 3AJDA 5H9EK 3N6LA 4ED2A 3J7A1 3M9MB 2D9PA 2JEFA 1TKTA 2EFNA 5LM7E 1LNQA 1EAYC 3HJVA 2NXCA 1N56A 3LQVA 3CCRS 3KMSA 5HQMA 4P2XA 1WOPA 3O6QA 3P4UB 3LH2S 1UW9A 4WPAA 4O3NA 3GSIA 4ZVOB 1UAWA 2GAHC 2HKEA 1SC3B 2RSQA 1DHMA 5J1PA 4HTIA 1RT6B 3BSNA 3BKFA 3MECA 3ICLA 2JL9A 1TU0B 3BQ1A 2E5LF 2GC8A 4RWWA 2ZDPA 2RS8A 1WD6A 2BJ9A 2NXNA 2PEBA 2W01A 2WBRA 2KT5A 3AXKA 4YHHJ 1NK5A 5IT9Y 1DJ0A 3AB2B 2UUCJ 2CPEA 1IKVB 2BJ1A 1TL5A 4LSZB 1AZSA 4N8NA 1HYSB 2EW9A 1JKHA 5LSOA 1E6VB 4MMOA 4DX6A 3KLEA 4XTTA 3PW0A 2BKOA 4ZLPA 1YIJS 3A8IA 4CLUA 5FJ4A 2LQ5A 3CJ0A 3NCPA 2VDIA 3QRPA 2RDIA 4DSJA 3KUGA 1NBEB 4B02A 2IVYA 2H9ZA 3UNGC 4DQIA 3OLAA 3DRXA 3M6WA 3DN9A 2CNLB 2YKOA 2HHTA 1YJWS 2HK3A 3ZTSA 3BSOA 2QO3A 2DISA 4RUCA 4P2MA 1OS5A 4DHVA 2VBWA 4F2SA 2UXCJ 2OPSA 5JXSA 4IQXA 1KVJA 2FHOB 4FXDA 3MWBA 4DXLA 2LLZA 1RWMB 3SSQA 2XYPB 5L8RC 1VRTA 3R5BA 5B0BA 4FKXA 4DQPA 1TK5A 1H6KX 1NHVA 3QAEA 5LXYA 4MAKA 5C24A 1YBUA 2G9OA 1VQSA 4I6AA 2W25A 3QFWA 4JI0J 3DOKA 5KFHA 4HEA9 1BGXT 4YB5A 2IA6A 3IS9B 3KLHB 1B64A 2ALZA 4DL3A 3J7YI 3AXMA 2G13A 5AJ3J 4HR2A 4LF4F 3NS6A 2H1YA 2FY8A 3RW7A 1QE1B 2WCXA 1S1VB 4PAAA 1Q86T 2IMOA 4PWWA 2CNNB 2HBQB 5KFNA 2JDJA 5L9NA 3FBCA 3OBIA 2MKHA 3QGIA 3PX4A 3FEZA 4LBPA 3R1LA 1J5EJ 4ED8A 4F36A 2J6TA 2PT0A 3BH7B 1VQYA 4USHA 1PAUB 3M05A 2XSJB 2DNKA 3LP1A 2AJ2A 4X4VA 4ZIWA 3DLLQ 2ATLA 3R97A 4X64F 3CIMA 2BJ3A 4DV2F 3HM9A 3D6HB 4AXIA 2RILA 3MCMA 1Y10A 2KRBA 4RNOA 3G71S 2K8GA 3BN4A 5SZTA 3BGFA 3VAHA 3BV8A 4B9NA 4C0HA 4UW2A 1OPZA 2YKNA 4LF5J 2UVWA 2P2CB 4KT0C 1RT5B 2R7RA 2F1FA 5IT4A 3P5TL 2HQDA 2HZVA 1CS4A 2G1HA 2W9BA 1B7FA 3M8QB 3IMQJ 2NPFA 3B54A 2XEXA 4ZDNA 5SUHA 2B4OA 4O44A 4WE1A 1KN6A 3PIOQ 2RKIB 2VBZA 1S1UB 1P6TA 4DCOB 2DNRA 2OTJS 2K2PA 1WTBA 2KZZA 4F0KA 4PABA 4OYWA 3A3PB 1N5TA 3MUTP 1LW2A 4NL5A 3H20A 3EVWA 4YS2A 4L75A 3ZZUA 3CD5A 1EB0A 3TWZA 3MMBB 4O3SA 1HD1A 1VR6A 1H7WA 1R0BG 1CJUB 4LFAJ 4IOAQ 1NK0A 4DLGA 4PXBA 1RTIB 4K5SA 4Y28C 4R8UB 1DLOA 1F60B 2E1MC 1AFJA 1F5AA 4YFUA 1GT8A 3T1AA 4J37A 2HVDA 3KUHA 1ZM4A 5L1KA 2HS4A 5G0RB 2XWXA 4B9MA 3TZXA 3DLHA 1HKAA 3TX0A 2F5GA 4PXEA 2IM0A 3Q86A 4OX8A 2W2PP 2Z30B 4NPOA 4XDDA 4J91A 3M32A 3C66A 1IVZA 4FS2A 2AU0A 1YX2A 1NPKA 5HMWA 3MZIA 4AYBD 1HNXJ 1P1TA 3H4BA 2XY5A 4HLBA 4KGKA 4F2RA 2JX2A 3UD4P 4BS2A 2CDQA 5ETPA 4LMZA 3GCXP 4LJMA 2JH3A 1TMMA 3KHGA 2A6MA 3H4DA 3FQKA 3K59A 1Y5LB 1JLBA 1C1CA 1K9MT 3M9NB 4CLKA 4WXWA 3FK4A 4Z7CA 4DR2F 5A6PA 3DCAA 1W2IA 1KRPA 1SKRA 4TN2A 4LFCF 2KZMA 3LAMA 2YNFB 3VAGA 1GFWB 4DV6F 5GAHU 9RUBA 4LF8J 4TYAA 4JI5F 4K4TA 3W5ZA 1XR6A 4CM2A 4HH0A 2MHNA 3MUMP 2QA4S 2UUTA 4M5HA 1G2EA 2D3ZA 2M3DA 1O0PA 3NBPA 3CJ8A 1LWXA 3GE9A 3FFIB 2FVPA 5E5NA 1FXLA 3K5PA 3IBFB 1N5YB 4MKVA 2XS2A 2FGOA 1FTCA 2E5HA 2BA9A 5L1LA 2AX0A 2YNGA 3B82A 1D0EA 2YH0A 4B3SJ 5ETLA 4UOFA 4HL9A 4ECVA 3LGMA 1NSKL 3MM8A 1RTJA 4O4RA 2J7UA 4ZCKA 3OL8A 4WFYA 4NLYA 2IYGA 1FK9B 4NXNF 3G4SS 1T0TV 1FWKA 2CPFA 1IQTA 2KT2A 1VIXA 1V6HA 1U8WA 3C46A 3MR3A 5GAEI 2UU9F 1YBTA 3FEXB 4K4UA 1CJTA 3MD1A 3FKBA 4F02A 2NS1B 3KUEA 3IG1B 1M5OC 2IJNA 3I5AA 2DK2A 1JLAA 2DVIA 2DHHA 4DQRA 3PVXA 4IH6A 1S4FA 4K0KF 2HVHA 2QX0A 4CTAA 3HHEA 4DS5A 1XMQF 3PFEA 5CYMB 2YKQA 2HRTA 3H90A 3VTIA 4I0WA 4ZVFA 2HEKA 1RAGB 1Y11A 2J9CA 3FMWA 5E33A 8AT1B 1SL0A 1X8DA 2FZGB 2VFUA 1TVRA 5M2UA 5KFSA 3C16B 1QAIA 3ENWA 1N5SA 2IIHA 3LOUA 4O0NA 2D3UA 3TARA 3CCZA 1AROP 1SVDA 3EDRB 5KOXA 3AJ2A 4XK8C 1CQNA 2FB0A 1TV6B 2BE2B 3ITHA 3M2RB 2HNYA 4EWTA 3KLFA 1TK8A 1OJ4A 3SCIE 1HBMA 3FCWA 4ES1A 3CC2S 2VBXA 1UVNA 4ID5B 4P7VA 1NDCA 5EN1A 1RTZA 2VFSA 4JI6F 2HMIB 3SQGB 2ZBPA 2WB4A 2XI3A 3TJ8A 2ZJRQ 4FDFA 2YH1A 5C42A 2FVQA 3R1HA 2VICA 4AL7A 3D4JA 1IXKA 3IA0A 4DFJA 4WTYA 2YNIA 4NZ7A 4E8UA 1NKEA 2QJ3A 2Z2LA 1S79A 2B6AA 1N34J 1I51B 1FDNA 1S6OA 2Y0SD 5I42A 3TANA 1IBMF 2BACA 5CYQB 1YJTA 2VJVA 1IQZA 2VH7A 1NLKL 3JTPA 1JXVA 1LEOA 3CE8A 1HQEA 3NLCA 1YG0A 3PYEA 3KOAA 1DURA 4CLLA 2QTWA 1HWUA 4DR6F 3IO1A 3ZZ0A 1WI8A 1H73A 2CQHA 4LRCA 2E66A 3VQTA 3OVBA 4F3MA 3M8ZA 4CO0A 4LSNB 2XY6A 4K5RA 1U2CA 4QJVA 1C0UA 4J9RA 3T5HA 3DOLA 1U25A 5E3AA 1T94A 1S9EB 4DJBA 2MQ8A 1N6QB 1F3VA 1HNZJ 1S6PB 1WHXA 5E3RA 5KT4A 2F4VJ 1UVIA 2E29A 1T9XA 1IWGA 4NWBA 3BQ2A 2ZH2A 4I2QA 2VA2A 2OKQA 3DU5A 1ZM2A 4RUAA 2CG8A 1T05B 1CSJA 1FJGF 3OTEA 2CPJA 1KC8T 1IBLF 4MTPA 4C6AA 3MTJA 2W24A 4USMA 3I32A 4G3IA 3MM5B 2ZKUA 4Q5VA 5D78A 2OELA 3UN5A 4W4MA 2MZRA 5DS7A 2JLGA 5LSLA 2H4WB 3DYAB 3GIKA 4YMEA 3KG1A 1GXLA 3KJNB 4IO9Q 1JLQA 2Z2ZA 1RAAB 3Q8SB 4U95A 4N5SA 2WOMA 2HPUA 2CKWA 2ZBQA 5HQLA 3I56S 2IC3A 3CMAS 1VBKA 4CRJA 1HQ2A 1H0HB 1DFDA 3PXGa 5KG5A 4KSEB 2CRLA 1VC5A 2XS7A 1AB8A 1N33F 3W9JA 3G6VA 2LDIA 2HVIA 4LR8A 1TKZB 2XMTA 5FLXY 4IKAA 4AE5A 5C25A 2ZH1A 1ZPVA 3Q22A 3T3FA 1HBNA 2HHPA 4NLGA 1KP6A 5DJBA 1Q0NA 2OO4A 1K47A 4ZK7M 2IHR1 4DCPB 2DHXA 1HWLA 3MMJA 3R27A 4FYWB 3SSRA 5D4PA 4EU0A 1FD8A 4AT1B 4ETZA 3BJYA 3HHLB 1WDDA 3SFUA 3KFWX 1RWWB 3MR2A 2JVRA 1HBOA 4QIGA 5CA5A 2HHUA 3RBEA 3HMJG 3ENVA 4ECQA 2F3JA 2NPIA 4ZIVA 2XNQA 4WWSA 2CFXA 1IKYB 4JBCA 4KKOA 3FC9A 4C48A 2IM2A 1KOHA 3G6ES 1XMOJ 1T9YA 4CO2A 4EI2A 3PW2A 4RU2A 2AYEA 1GXUA 4OZ2A 3E2EA 1RA6A 1I94F 2GHPA 4A8FA 3N6NA 5KT6A 1H38A 2VPXB 1RE1B 4Y00A 4K7QA 3C14A 3MECB 1U24A 4QR0A 2O67A 1LFWA 3QIPB 2DPIA 5E2QA 1WHYA 1HIYA 2MQMA 3H2LA 4DUYF 4LF7J 2JFKA 4RX6A 3TZYA 1AUSL 4MJKA 2W9CA 2Y1LB 3T6BA 4DU7A 1LQ9A 2E1AA 2HQFA 3OT9A 2B9WA 4I6YA 2XY7A 3CNQP 2EFOA 5KFKA 2GW8A 3BPSP 1JLCA 4I69A 4TU7A 4N47A 3ISND 2L9NA 4ITSA 5DGAA 3GIJA 4UOHA 3KLEB 2BW7A 4Y65A 4J9UE 2BRLA 2ZBIA 5IV3A 4OYXA 3SV4A 1MMNA 5AE2A 2XCAA 3BREA 1RTHA 4F26A 3TNVA 2J0QD 4P75A 3T1YJ 3OTOJ 5GAGU 2V63A 2XM3A 1R8CA 1E6YA 5C2GA 2DJWA 3HHDA 3JSMA 4K4VA 1B0VA 5BYQA 4PG4A 3NS7B 1NUEA 2H5JB 1U1LA 1SV5A 2ZM6F 5LSRA 5KFTA 3LPEA 2ADCA 1IKXA 2W2MP 1OYEA 1S76D 2MEWA 3PW7A 1RTDA 3PO5A 1IM6A 1X4CA 2WVDA 4CH7A 4OZNA 1X4FA 2PFDA 1A0OB 2LEAA 4IG0B 1GNKA 2JFDA 2V67A 5AXKA 1OSCA 3JAMU 2IPOB 2KHCA 4DX7A 3I9V9 5CYJA 4ZJQA 4DR4J 1Y3JA 3QZ8A 3HKZD 3LALA 3OJSA 2JEGA 2CNOB 1FVQA 4DR1F 1FKAF 3E51A 3KHLA 1J2VA 4Y0FA 4X66J 3CDEA 1T3OA 2UP1A 4X4UA 4OHZA 4P2FA 3ILOA 4QYZJ 2I5JB 3JSBA 3A3NB 4C8KA 5KG2A 1VRUA 2CNKB 4KPCA 3Q8UA 4AUKA 1QAXA 5K8PA 3SIPB 4FYDA 2KT3A 2F9JA 4KFBA 2XQCA 4O4GB 4F67A 1TUGB 4N77A 3SI8A 1RI7A 1WC5A 4LUBA 4FN5A 3PRVA 3QIDA 5HMZA 1TMJA 2MKJA 4RO0A 2DB1A 4YN3B 2OMLA 1XC9A 3T9ZA 3U1NA 1JXLA 4NRTA 4W98A 2XG8A 1H2TZ 3N5FA 2VODA 2V94A 1WOSA 2HHWA 1ZH5A 4DS4A 3WC0A 2J9DA 4DFPA 3MPVA 3R5AA 1PJ5A 2GQ2A 1UCNA 3NCRA 3NNHA 3CCVS 2E9ZA 4FF2A 2DPJA 5KFVA 3OJUA 1OQ3A 4CT8A 5D3GB 1IKWB 3HKWA 3MCOA 3RUBL 1EIYB 2HW3A 3L09A 1RT3B 3CD7A 4HACA 3JTNA 1R31A 2YKMA 1TAQA 4JI3J 3J81Y 4X62F 3MCSA 2Z4PA 1TR0A 1FRHA 5B0EA 4V1Ak 4BC7A 2GQCA 4C8MA 2H65B 3Q83A 2OPQA 4KQZA 2RUGA 3DLKA 3FSXA 3VHQA 2ADBA 1M5SA 3DLGA 3CDUA 1RCOB 1VYAA 3DRSB 2DCUB 4DUZF 4NLTA 3SDEB 2HZCA 3W2WA 3D6TB 2AJFE 2RIJA 2OPPB 5HJYA 3V6HA 8RUCA 2DITA 4URSA 3BKUA 1VJWA 2H54B 3KLIA 3MM7A 4EBDA 1N0UA 2QSFA 1S12A 2JVOA 1R27B 1RWOB 4U7CA 3AQOA 4PG7A 3E01A 4A8QA 5IV4A 2XYHB 5HBMB 1EZZB 2JEJA 1RAOA 2UXBJ 3V81A 2VUGA 4BHQA 2MLXA 3DLBA 4ZP9A 1TP7A 5F9LA 3J80U 2ZJQQ 4ZLJA 1U1RA 2FDNA 3LGNA 2CXEA 4YR0A 1L3KA 1YJNS 3QT7A 2ROEA 3RU0A 3DFEA 2B8PA 2DRAA 1CPZA 4IQMA 3VV2B 1XTZA 3LWMA 1MWQA 3RRHA 2UUAJ 3M32B 2QL9B 4Y2MA 2GO9A 2G2OA 1MN9A 2B5JA 3QT8A 2EVZA 1NDLA 3EVOA 1IR2A 5T14A 1DTTA 2RF2A 2ZVSA 1U7LA 2HWIA 5IC6B 5A0YB 2KKHA 1W7WA 3R5JB 3J7YU 1FFSB 3A8KA 2DO0A 4M63A 2ILZA 1JLBB 1JJCB 3K8VA 3UCGA 3NP5A 2VG7A 1NH7A 3QGGA 1W26A 4G1QA 2QL7B 5KG1A 2QLXA 4ED3A 3ISZA 4RUHA 3LO3A 4CWBA 2D3OR 4JV1A 2X1AA 4DV3F 2KM8B 3T1HF 2HVZA 3QGPA 1SC4B 1CULA 3PZPA 2HLUA 2EKNA 2VPWB 2CZ4A 1WC6A 1SJ3P 1I3OB 4DPTA 4YB7A 2OGUA 1RU2A 1RYRA 3GV8B 2AZ1A 3VCDA 1SIZA 2L41A 2LFVA 3AH6A 2BANA 5K8MA 4C8LA 4QYRA 5FDLB 4C8NA 4YY3F 2FUG9 1W25A 1XERA 1G3OA 4ID8A 3BGRA 4UF4A 4M5KA 5KFPA 3Q2SC 1MW7A 4OZLA 4GVBA 2MZQA 1Q1KA 5EUHA 3FCVA 3I5CA 1NDPA 4CNYA 5HMXA 3SSSA 5HJXA 4MK8A 2BQRA 2FVSA 2PGCA 4JI1J 3TOQA 1RWUA 4WBFA 3GYXB 3CO0P 1NRKA 1S10A 3WIUA 3IC1A 2H4YB 1BY9A 4OFZA 1LWFA 2ZOFA 2XNRA 2QLFB 2AYGA 4DFMA 1JLAB 2AWZA 3Q0AA 4OZ5A 3H98A 3OXLA 4Y2CA 2G0IA 2RU3A 4CTAB 3U02A 3GQCA 4UTGA 2M4MA 3CGIA 5KG6A 4CM0A 2DNPA 4O3QA 4OI6A 2PMWA 1VMBA 4JI2F 4FYVB 1CEZA 3KDOA 3RBXA 3CIZA 3N79A 2DRDA 2MQOA 3W62A 3D28A 2QLBB 3PEJA 2XLJA 2AJ1A 4PUOA 4ED7A 1S6QB 3GIRA 4WP8A 4YB6A 3O8WA 5C7PA 2EKYA 2X3GA 5AXLA 1KKHA 1NNDA 3K89A 4KH0B 1WC3A 1RQ0A 1TKXA 1EARA 2O66A 5F3ZA 1CC8A 3DOMA 2XYGB 1NKBA 5JVHQ 3QLHA 3ITHB 4X4SA 4RW8A 2QYGA 4P6QA 3H5UA 3UFCX 2HBRB 2KVIA 2RD5C 4YB1P 4NLDA 3ZFVA 2L3MA 1VI7A 1SQGA 4QIVA 4QQBA 1CBKA 4TY8A 4M5JA 2R7TA 4FVMA 1WG1A 5LMUF 3AAWB 3MM9A 1V3SA 3ZZYA 2QG9B 3THVA 4K2XA 5HI7A 6AT1B 2JEIA 1IJFB 4ZVQB 4C98A 2ZHAA 3Q8RB 1BWEA 3IXQA 4E0DA 3FBBA 1U48A 4U96A 2A18A 2R7UA 1LW0A 4JI8J 5HLFA 2ZH4A 1HQUA 3V6JA 5CZXA 3D2WA 3D66A 2NSCA 3PHEA 2ROPA 5I42B 2YY3A 1A9NB 2ROGA 4Z7YA 3LANA 4LVOP 2H5EA 4LBHA 5DRKA 2OIHA 3GSDA 2QL5B 2GO8A 2IRXA 2VC1A 1NEEA 2ZH9A 4IYQA 1BD6A 2IDEA 4UUWA 2AZ3A 1WF0A 3MM6A 4Q0BB 2XI2A 3I87A 4F3OA 5KAKA 1R8HA 4IG3B 2HNZA 1UPMB 2VQEF 1U49A 4P2SA 1HD0A 4MT1A 2DHAA 3K58A 4Q2MA 3ZXWA 3HI9A 2MB0B 3OUYA 2C3YA 1VBYA 7FD1A 3MEEA 1UETA 3NGSA 2PA3A 4MIBA 5B0AA 3SCKE 3FQLA 1C0UB 3ZTRA 2UUWA 2MDAA 2PI4A 1DQ8A 1TUWA 1FESA 2XMUA 1BQMA 2B4PA 3OTCA 3TAMB 2R2UA 2HQCA 3MDFA 5KT2A 5HQ8A 3UO0A 3CDWA 4H4KC 4AL5A 4IO1A 5RUBA 1F9HA 1O8BA 4WXOA 2Q1LA 4I2QB 2VG5B 4WP9A 5KG7A 5L46A 2GMJA 1C0TA 2YVSA 2HFZA 1KQSR 4KO0B 3TA0A 2P5VA 1TL3A 4DG1B 3KK1A 4XPEA 1RYSA 4GRSA 4JP8A 2K3IA 1OSDA 3QT6A 4H4MB 3BEGB 1JMTA 2R8IA 4D3GA 3Q24A 2RQ4A 2LXUA 3SEOA 1VQMS 4KV8B 3RR8A 3RYLA 1RAJA 2HHSA 3HZGA 4I68A 1HWKA 2QMUB 1X4BA 1JLQB 2MZ1A 3UCZP 2BMBA 3C8YA 3M8PA 1TL7B 5GADI 1ROFA 1EX8A 3PRBA 3ENAA 3LW5C 4DR2J 3ZTOA 4HT5A 1JLFA 4FBUA 4C11B 4YOEA 2SXLA 4HI1A 5I4MA 1JXEA 3C15B 1RADB 4PPZA 1J5OA 2OAUA 2CUYA 2HSEB 5CAAA 1T7PA 4JI5J 1RB0A 3N4WA 2FLLA 1U0HA 3OHAA 1RT7A 3RAQA 4O3PA 2AGPA 3BGLA 1DY3A 1ZM3A 1VQ9S 1OY8A 1KR4A 2BOPA 3W3SA 3KJQB 3KJVB 5HROA 2POKA 1HBUB 4WFZA 4HYKA 2GA7A 3R5GA 2MGZA 2V2QA 2FIUA 3NL0A 5FLXU 4J9KA 5D4LA 3C3LA 1VS3A 2DEJA 4ICLA 4DR5F 2BJDA 1REVA 3GR0A 4LQ9A 4OI4A 2Z2MA 3W66A 2F65A 1S48A 4LF1A 4XDCA 1S49A 2W2OP 4M94A 2CPZA 2VHGA 2R3VA 3NMAA 1NO8A 1R6YA 2ZH7A 3ULHA 1RAEB 2HWTA 3W9IA 3WIVA 1XMBA 2FJXA 3WZ0A 3FEYB 5D4OA 1WACA 2J6UA 3M4XA 4ED5A 4NA1A 2J0SD 1WHVA 4ZPAA 2MKCA 3CTRA 1RWXB 3UDCA 1LKZA 5BXIA 1Y3KA 5DLFA 1Y5NB 3KK3A 4DR7J 3LGHA 2YX7A 2KFNA 2WONA 5J1EB 1NU4A 2A2DA 4CYUA 2A3JA 4K0KJ 2W2QP 1TL1B 2WVEA 1EKSA 3BM7A 4DWIA 2MKKA 1MN7A 2OPRA 2VZ9A 3ZZRA 1WC4A 1RWPB 1X4AA 3QAUA 1HNVB 1YLXA 4ECUA 4P73A 5A8KB 3R5CA 2OH2A 4TXSA 2DXEA 4MIAA 1FRXA 4FXVA 4NA2A 1E6YB 1FJCA 2EI5A 1SUQA 1RA7A 4B3MJ 4I2PB 4M5DA 3I0RB 1QLNA 4DSFA 5A8WA 2CPIA 2A10A 2P9CA 4YEAA 3DI6B 1HA1A 1YVFA 3HJFA 5F8IA 1FNMA 5DO2A 1S1XB 3MCNA 2CPDA 3GR1A 1NSQA 4YHHF 1MWZA 4DUTA 2V34A 4P7TA 2R8JA 5LT5A 1FEHA 2UUCF 2WSCC 2HFNA 3BN7A 2XMVA 3V6DB 2FVRA 2EPIA 3KKFA 2XCPA 2E1RA 1WG5A 5KFYA 1S7HA 1KFSA 3VAFA 2FHMA 1YWXA 1Q78A 2QIFA 3TEGA 3MR5A 3W60A 2OD6A 3KJFB 3R3TA 1MROB 3G6XA 4IR9A 2HHVA 4MH8A 2ZOMA 3OR2A 3TUIC 5F8GA 2KL8A 3HX9A 2Z0GA 2NXJA 2RJZA 1VQPS 1Z4UA 3PY8A 4A4JA 4G1IA 2C2MB 4BLGA 4ZPWR 2V0NA 1OY9A 2J6SA 3JS9A 3G9CA 5ETVA 1WF2A 2MJNA 2XZTB 3EPGA 1LXNA 2LEBA 4KH1B 4USKA 1F9EB 4FS1A 3RB6A 3PNIA 3HHLD 2ZUGA 4B9VA 3KG0A 1DZ5A 4R5PA 5GMKa 2DXDA 2BUNA 2QC3A 1IWAA 1KLMB 3BBBA 3RB0A 4OI1A 4DR6J 2F40A 4JI0F 3QO9A 2DR5A 3NGTA 1BQNA 4CCHA 3VR1A 1TL4A 3POTA 2WW4A 3DRPA 3HVAA 3KYLA 3JSYA 1Q8IA 2JNJA 2LYVA 4WIIA 4J9QA 5AJ3F 1MWYA 3MPUB 1RHUB 3VALA 1QDUB 2GVZB 4PQUB 4C8YA 3WDOA 2E1CA 3GG1A 2ATCB 1BHNA 1FKOA 4IOCQ 3CJTA 1JLEA 2L48A 4F04B 1BC6A 1SH3A 4QYZK 3BQ0A 1S97A 1JJHA 1SJ1A 5DG9A 1R8BA 2YKMB 3QBCA 4MFBA 5IM0B 3DRRB 2VPYB 4OZ3A 1PC5A 1NXIA 3RW6A 3IR7B 1KWMA 2LA6A 4NCGA 4QW9A 2KI2A 2DRBA 4C9DA 5HK4A 4IFVB 4ELVA 2G4BA 1V3ZA 2OPQB 1JWWA 3OVSA 4UY85 2N7YA 2GGPA 1KOOA 2ZHBA 1FRLA 3D7SB 4B3OB 1GEHA 4L76A 4CO5A 1O6XA 7AT1B 3L7OA 3R6LB 4DR3J 4X4RA 4FP9A 2FJWA 3G82B 4WYWA 3JB9k 3W2WB 3O2IA 4KY3A 3LP0B 3CW2C 4Z2XA 3P96A 1YITS 3U7JA 3N6MA 1SJRA 1KTVA 3EM1A 2X1FA 2AGOA 5LMNJ 5A8RB 3IM8A 4LF5F 4IH7A 4A8YA 3BBFA 3DXBA 1X9SA 3TYTA 2KVQE 3FUYA 4ANEA 2V8DA 2RS2A 1PBAA 3MPYA 4NMLA 4DV7J 1YJ9S 4OV6A 3MEGB 4LSLA 3V4IA 1ITPA 3UWTA 3IRXA 4AFFA 3CCWA 1ZZFA 1VQ4S 5DETA 3A4TA 1XWLA 1PBUA 1FXRA 1IBKJ 5J2MA 4R0EA 4QWAA 2B5JB 1U1PA 1X4GA 2LQ8A 3DM2B 2UVRA 4KE5A 5H9EJ 1TK0A 2W7AA 1NM2A 3UCUP 1DTTB 2RF2B 4FNIA 1R6VA 1JQGA 2VONA 3CJ4A 2CQ3A 3IRWP 4OMFG 1FDBA 3ILLA 4P72A 4LFAF 3TA2A 4RU9A 3OR1A 3KXDA 5A6WA 5GMDA 1DRZA 2HNDA 1S9GA 4ES2A 5CXTA 2RB7A 4ZVEA 4Q8FA 3M1VB 1RT4B 4QOTA 3OTDA 2V69A 2PO4A 2DNHA 4AL6A 1S77D 2X7IA 1FKPB 3HFVA 1HARA 4IFYA 1ZA1B 1HHTP 4Y2IA 1M0SA 3BGOP 1HNXF 2BANB 2M2BA 2BRKA 1CC7A 5DG8A 4PWDA 3HSDA 1YSJA 5KFGA 1HPZA 1OWXA 1Q16B 3CCJS 4OYAA 1SH2A 2HHQA 1SCJB 3MMCA 3UQSA 3M2UA 2VQFF 4FPRA 4GVBB 3GJTB 3MEDB 2ZVIA 4LQ3A 2IRUA 4OZ0A 3CJ5A 4OYMA 1HNIB 1LWCB 4ILRA 3UW1A 2XMAA 3EXCX 4U7UD 5KFJA 4EK2A 5A2QY 1FJEB 4CLFA 4ZLLA 2RAQA 2BQ3A 1B0PA 4JB8B 2NUHA 4ECWA 1RABB 3TVZA 1TTHB 1RT6A 2AEFA 5D0GA 2R7QA 3HF5A 2IM3A 1RZMA 1Z1ZA 3N9UC 5I3UB 2FZCB 4USVA 4X84A 5KFRA 2IM1A 2DTJA 2L9WA 5HL7Q 1IKVA 1BXNA 1HI8A 3CVKA 2ZE2B 1HYSA 1VFJA 3SCLE 1E6VA 2QFJA 4NX9A 4B3SF 4PG8A
chains in the Genus database with same CATH topology
5KT5A 1B0VA 1WTFA 3OPKA 5JVGQ 5BYQA 3ONQA 4PG4A 5T41A 1NB7A 2BBEA 1FTRA 1P9QC 2VB6A 1U1LA 4B08A 2FD2A 1JLGA 3DDNA 1SV5A 3G86A 2GJIA 2ZM6F 3LPYA 5LSRA 3G96A 1VQOS 1QVFR 2C2EA 5KOWA 2FJEB 4DX8H 3RR7A 5KFTA 1N4LA 3THTA 3BDPA 3N01A 4K4SA 3F41A 1M5HA 2ADCA 3OL9A 1IKXA 3AQPA 2IVMA 1GTEA 1KONA 1TZ0A 2MZJA 3S7RA 4I67A 1JX4A 2B56A 1LFPA 5ADZA 4KPYA 3RRKA 3D5MA 4RW9B 4PUOB 1S76D 2C3PA 3K5NA 1RP5A 3T19A 4WKRA 3O44A 3CD0A 3AJ1A 3K5OA 4RW7B 3PW7A 1RTDA 3PO5A 4DL7A 3S01A 3FSIA 2IAJA 4C3LA 1X4CA 4CH7A 4OZNA 3OFHA 5U47A 1X4FA 5CCMA 2BZ2A 1HW9A 1O5JA 3PW5A 2EFQA 2LEAA 4IG0B 1GNKA 3MURP 1T02A 2ABYA 4B3MF 1I6JA 2JSXA 2JFDA 4CQ1A 4FF4A 1VQLS 3A8EA 3VAJA 1FRMA 1S6QA 2QRRA 5KFIA 1TVRB 2ERRA 2VC0A 3CJKA 1RT1A 5AXKA 3RTVA 1OSCA 2E44A 1UJ4A 2LMIA 4Y2KA 4B17A 4RWXA 4TNOA 4CO1A 3HHNB 2OFHX 3C6TA 3PIPQ 2KHCA 3AHPA 1JJ4A 2KB2A 3I9V9 5FD1A 5CYJA 5T7LA 5KG0A 2RDJA 5DDQC 1NH8A 3KK2A 2VOOA 1X5OA 2DNZA 1Y3JA 2HS3A 2QA1A 4HVZA 5AXNA 3HKZD 3QZ8A 1URNA 3LALA 3OJSA 2JEGA 3NCQA 2MZSA 1FVQA 1GH8A 1BLUA 2N82B 3D54A 4DR1F 2F8HA 2W4PA 4C0OC 1HNWF 3FCHA 2XSFA 4EGLA 2PN6A 4QU6A 3VZHA 5M2PA 1FKAF 3E51A 3KHLA 1J2VA 5B0CA 4G1PA 1FNXH 1Y0HA 1X7VA 3LP2B 4Y0FA 4TY8B 3K57A 1EP4B 2BM1A 3ENQA 3FZBA 3DHWC 2EC0A 4ILMA 2HNYB 1Z2LA 1ZAWA 1H7XA 4HH1A 3IWXA 4URGA 3KLFB 4BWMA 3CULA 3NKYA 3K5MA 3GFYA 3F56A 4IDKB 2DHSA 3CDEA 1T3OA 3RBDA 2UP1A 2FLNA 4X4UA 2HG4A 3I82A 2KHDA 4HKQA 4OHZA 2YTCA 1XK8A 1HBMB 3UE2A 3FRYA 2QT7A 3GFHA 4R0JA 4QYZJ 2DNYA 2I5JB 2CJ9A 3JSBA 4KAIA 3KLHA 1S0MA 2B7BB 2RQCA 1UJ6A 2M88A 2BE2A 4EZ6A 2GX8A 4C8OA 3M2RA 5KG2A 4C8KA 1VRUA 4AUKA 2DH8A 3IFEA 1QAXA 3BF4A 5E0OA 5K8PA 5KTQA 3PV8A 4FYDA 3H5YA 2GIRA 2KT3A 2JC1A 1QE1A 2F9JA 5BYRA 3L3CA 5DM6Q 2HGNA 2OMOA 3CSKA 2XC9A 3HXMA 4KFBA 1S1VA 1N0VC 4O4GB 3KTQA 4BBYA 2O5DA 4RBUA 2IA0A 4F67A 2DGQA 3M2VB 4KGMA 4R5PB 3I5BA 3TX8A 4RLEA 4N77A 3K7RA 5HLFB 4KHPF 1FERA 3SI8A 1RI7A 5C42B 2L9DA 2QEXS 4XO0A 1ZAXA 4C4WA 3RB3A 3GILA 3K0JA 4IRKA 2D7SA 3HZEA 4WF9Q 4LUBA 1WF1A 5GAHI 2NSBA 1JJ2R 2LXIA 4Q44A 1EETB 3HFKA 2DGSA 5CQGA 4EYIB 1AW0A 3HVRA 4OHVA 2YNIB 4FN5A 3VWSA 5DQIA 2M8HA 1PSDA 4RBVA 3QIDA 2CQ1A 3QO9B 5HMZA 4LVNP 2R2SA 1S1WB 2C3MA 2C3UA 2LQ9A 1NAQA 1Q7YT 4DV0F 2ZBCA 2MKJA 2HHHF 2DB1A 3POTB 4ILLA 1FCAA 4I6WA 2BV3A 3DRPB 1KS2A 4GMKA 2OMLA 4IR1A 3CT9A 5J1NA 2B6AB 1XC9A 3T9ZA 3FGVA 3U1NA 3I9ZA 1JXLA 4NRTA 3PJXA 4MYUA 3KLVA 2XG8A 1H2TZ 2PE8A 3N5FA 3ZZOA 2B9XA 2MMYA 2VODA 2V94A 5KFDA 3FNNA 3ISNC 3CEDA 3J7ZT 2I8EA 2VG6B 1N5QA 3CB4A 2OSRA 2HHWA 3GIMA 1ZH5A 4ECRA 1Q7LB 4Q7AA 2XBPA 1QJHA 3T6JA 4DS4A 3WC0A 4F8RA 1X0PA 2J9DA 4WJBA 2M70A 1FKOB 4Q0BA 4DFPA 3MPVA 3R5AA 4KHMA 4DSEA 1K1QA 3B8HA 2GQ2A 4Y2AA 3KHRA 5KFXA 3NCRA 3DHXA 3NNHA 3CCVS 5D6GA 2PFFB 5KFWA 4C7QA 3CF5Q 2RH3A 3EZ5A 2E9ZA 1HQEB 4FF2A 1S6UA 3HT3A 4ZPBA 5EX0A 2P9GA 4IG3A 1R8AA 2DPJA 5THWA 2L08A 5KFVA 3OJUA 1VQ7S 4NCBA 4J9OA 1OQ3A 4WFNQ 3F73A 4CT8A 3MGJA 5D3GB 1D8ZA 1IKWB 1XR5A 3HKWA 4OI3A 2B4UA 3JSRA 4RW4A 3VAIA 2M8DB 3TUJC 2HQIA 1HI0P 2RRBA 1P1LA 2HW3A 3L09A 4FXWA 3HLUA 3I4HX 3OW2R 2YWHA 2IRYA 4NCGB 2V9WA 4ELUA 2CPHA 4CIOA 1RT3B 4OI0A 4I64A 1WG4A 3CD7A 3SCJE 4EUVA 3M8SA 1SB6A 3JTNA 1R31A 4ZVGA 2YKMA 3NNAA 1TAQA 3LUYA 1DTQA 1F0XA 1RT5A 2GGPB 3J81Y 3UR0A 4X62F 4A8KA 3MCSA 2Z4PA 1TR0A 1Y5IB 2QZ8A 4PKDB 1FRHA 3T9NA 1N34F 1FVSA 5B0EA 5KFUA 2MQQA 4EYHB 4QIFA 5BYSA 4BC7A 1K1SA 2I0XA 1ZAVA 1FRJA 3HVTB 1T03A 2OTLS 2GQCA 4C8MA 3DOLB 3G6YA 3MAHA 3TAQA 1ULRA 2OPQA 4KQZA 3M8QA 2PC6A 4WKYA 4KIAA 2RUGA 1SI9A 2QMWA 3C2PA 1IM4A 3DLKA 3FSXA 2ADBA 3BDEA 1M5SA 3PRDA 3DLGA 3CDUA 3TVYA 2WRMA 2DT9A 2GIQA 3TAMA 2LECA 5K5MA 3IAM9 1C0TB 3O5TB 2XULA 5KG3A 2GMLA 3M30A 4YQWA 2DD8S 4ZHRA 3DRSB 2DCUB 4DUZF 4NLTA 4OX9F 1OO0B 3SDEB 2HZCA 2IMWP 5J2QB 3GMGA 2DO4A 3W2WA 3IBWA 4KTQA 2AJFE 1WEZA 2OPPB 2RIJA 3UR3C 5GAEU 1S9EA 3V6HA 1VQ5S 5BJRA 1LK7A 1LWEB 2GHWA 2DITA 2RKIA 2B4VA 3PR5B 2PMZD 4URSA 5E3PA 4EO6A 4W92B 2VG5A 2WSFC 2EBEA 3IGVA 2WAQD 2W4DA 5KFBA 5E7OB 1W2BR 4WYLA 1VJWA 3OXGA 1S9FA 4KO0A 2FGCA 1MU2B 2VFVA 2EK6A 2PA8D 1UWBB 2ASJA 2N3LA 4DG1A 4Q8EA 3PDNA 3MF5A 2NUUG 4F4KA 3KLIA 2Y1RI 2ILYA 3MM7A 4EBDA 5H9FJ 4WCEQ 1N0UA 2QSFA 2R2RA 4DQQA 4EEYA 2JVOA 1R27B 2ZC4A 3HO1A 1YQHA 4U7CA 3AQOA 4A8XA 3K5LA 4LSLB 4PG7A 3CD6S 4H4MA 2LA4A 3V4IB 2CQ0A 2Q6CA 3VAMA 1PO6A 4TLQA 1K0TA 3E01A 4A8QA 3MMBA 4DR3F 2OJ3A 1T05A 2WBMA 5HBMB 3IRXB 2JEJA 4M8LA 2BW2A 2YNHA 3T5LA 3NWGA 3V81A 5B08A 2P6TA 2VUGA 3JYTA 4BHQA 5DQGA 5IS2A 5B09A 2VFRA 1C2PA 2ZNZA 1TP7A 4ZP9A 3DLBA 4KV8A 1HL6A 1M1KT 3DNCA 2KM8C 2DNOA 2ZD1A 5F9LA 4GC6A 5F0WA 2B0GA 1KSPA 4FNHA 3FSYA 3Q8PB 3MM5A 3WX4A 2ZJQQ 1RTIA 3FVYA 3I96A 1U1RA 5J2MB 2FDNA 3LGNA 1VGYA 4YR0A 3BR9A 1L3KA 4R8UA 5DDRC 2DGOA 1YJNS 4U9RA 4V19J 1M5PC 2GFFA 2ROEA 3DRYA 4NXMF 2F4VF 4YR3A 1Q81T 3RU0A 1FDDA 2YX1A 4PXCA 5LMNF 3DFEA 1G1XA 2NLWA 2WOMB 2BQUA 1S72S 2DRAA 1CPZA 4IQMA 4GC7A 1XTZA 1WEYA 3THPA 1U1QA 1O51A 5G0RA 3LWMA 2FY1A 2R7XA 3RRHA 4DSKA 3M32B 2CJBA 4Y2MA 1U6FA 4O0IA 1CG2A 2R8GA 2PSZA 2IC3B 2CQGA 2MYFA 2GO9A 5DM7Q 4KC5A 4C11A 1VK3A 2UZAA 2KJVA 2B5JA 2EVZA 2HQ3A 3R5DA 1VHFA 4H4KA 4H4OA 1U26A 1N88A 1L3SA 3OHBA 1QSLA 2KU7A 4DV7F 2YX4A 2XMMA 4A8MP 1Q53A 2K1RB 4ZKAA 3BO4A 1M5VC 5T14A 2FTRA 3H59A 3OR1B 4WFBQ 1DTTA 4ELTA 2RF2A 2ZVSA 1U7LA 2HWIA 3BGUA 1Q79A 5A0YB 2EWHA 2MQNA 1VQ8S 2XLKA 4DQSA 4J9PA 4LFBF 2KKHA 3EUNA 5MAOA 3IR5B 2HNDB 3LWLA 3QGHA 3J7YU 2J8AA 4DV5F 1S9GB 1VBZA 2DO0A 5C25B 1WELA 4M63A 1HBNB 4I7FA 4C3MA 1UP1A 2ILZA 4TYBA 1CQMA 1JLBB 1N5VA 4NLRA 3VQSA 3K8VA 5AE3A 1Y4ZB 3UCGA 3NRBA 4DL0C 3NP5A 2VG7A 1U1OA 2J9DE 5J2NA 1NH7A 2A1BA 3MTKA 3KJVA 3QGGA 1IBKF 1X5TA 2FC8A 1LV5A 1C1BB 4G1QA 4N56A 2DCLA 4TKTA 2LKZA 4CT9A 3GV5B 5KG1A 1APSA 1HBUA 3VZIA 2JWNA 1U4BA 3PW4A 1U47A 2QLXA 4ED3A 2N4DA 2EFPA 4ZPVR 3ISZA 4DLEA 4RUHA 2WK4A 3LO3A 3J7Z5 4QWDA 1MMLA 2D3OR 4JV1A 3OLBA 2X1AA 1U8SA 4DN9A 4DV3F 1UL3A 4IFYB 1JK9B 2MY8A 5KFCA 1YJVA 4DDFA 2KM8B 4OI2A 4Y3CA 1HWJA 3T1HF 3I0SA 4NCAA 2HVZA 3KLGA 4CNZA 3QGPA 3PZPA 1UA1A 2HLUA 4C2MA 2DGUA 2YNFA 2CZ4A 2VPWB 4ZOSA 1OIAA 1QM9A 1HBOB 3CPWR 5HP1A 2MPUA 1SJ3P 2VKZG 4E98A 4YB7A 3MR6A 1VQKS 2YKPA 2E7XA 2EG1A 5AE1A 4PWDB 2KXFA 2XMJA 3KHHA 3QYYA 1P27B 4J9MA 3OQ2A 2BYCA 2MSSA 3FZ2A 3GV8B 1RYRA 3PR4A 4RW6A 1HPZB 1Y00A 1RKIA 2ZZMA 3DMJA 2KYZA 4KKOB 2AJ4A 2WW8A 4O3OA 1RJJA 2ZNYA 2MKIA 3VCDA 3N6LA 1SIZA 5GVQA 4ED2A 3J7A1 3W2VB 2L41A 3M9MB 3AH6A 2BANA 5K8MA 2D9PA 2JEFA 4C8LA 1TKTA 2EFNA 4QYRA 4NLUA 5FDLB 2ZJPQ 4C8NA 5IQ6A 4YY3F 1N56A 2FUG9 2HRYA 2HYIB 1W25A 4TU9A 3LQVA 1XERA 1G3OA 3CCRS 1FO1A 3KMSA 2DGWA 4ID8A 3BGRA 1L5UA 5KFPA 1R0AA 3V2UC 1U6ZA 3FJ2A 4F25A 3O6QA 3Q2SC 1MW7A 3LH2S 4OZLA 5AXMA 4WFXA 1N5YA 2RRNA 4O3NA 2MZQA 1Q1KA 3HP6A 1UAWA 5EUHA 4CZCA 5KFEA 4QWCA 3G8TA 2RSQA 4N8OA 5KT3A 1DHMA 3I5CA 5IT0A 4CNYA 5HMXA 5J1PA 2P6SA 4HTIA 3SSSA 4H54A 4KRWA 4MK8A 4RKUC 1ZPWX 1RT6B 3ZZPA 2ZFHA 3BSNA 2P9EA 4A8OA 2BQRA 5J1EA 3MECA 2FVSA 2GHVC 2OPRB 3ICLA 1TAUA 2PGCA 3G8SA 2JL9A 4L6V3 2W9CB 3BQ1A 3TOQA 3VF0B 1RT2B 1RWUA 2E5LF 1URRA 5D77A 4GO7X 2GC8A 4ECZA 4RWWA 4LIWA 3OTBA 2ZDPA 2QYCA 3SFGA 2RS8A 1TL1A 1WD6A 5G4DA 3GYXB 1NRKA 3I55S 1S10A 1HR0F 2WBRA 2KT5A 4TY9A 2O1PA 3LF0A 1JLCB 3CCLS 1UVJA 1NK5A 4F4WA 5IT9Y 1L3UA 1DJ0A 1XMOF 3IC1A 4UOCA 3AB2B 6FD1A 2CPEA 2F8MA 1IKVB 2XZWA 1BY9A 4DL2A 1SUQB 3PKMA 2AF6A 2ZDOA 4OFZA 1LWFA 1TL5A 3CJ3A 1HNVA 2ZOFA 2UV8G 2XNRA 1V3RA 2E5IA 4M5DB 4N8NA 4BWJA 2AYGA 5A8WB 4DFMA 3BR8A 1HYSB 5J2PA 2EW9A 5A8KA 1RTHB 2DR9A 1JKHA 5B0GA 3CDBA 1JLAB 5LSOA 2AWZA 4WU2A 1E6VB 2V4JB 3MMAA 4MMOA 2IVFB 3Q0AA 3RB4A 1NK7A 4V19X 2M52A 4ZP8A 3KLEA 4OZ5A 3PW0A 3CJ2A 3O1LA 3JSMB 3C6UB 4MKYA 3H98A 3OXLA 4ZLPA 4I2PA 3RZAA 4B9TA 4Y2CA 4X2BA 2FPHX 3I0RA 1S0NA 2KXHA 1YIJS 3CMES 5HN0A 1FRIA 2RU3A 4CTAB 3U02A 3GQCA 4EBCA 3T5JA 3DLEB 3IG1A 1C4CA 1JLGB 5FJ4A 2CJKA 1SV5B 4LF7F 2BR0A 2LQ5A 3CJ0A 3NCPA 2M4MA 2CG4A 3CGIA 3S8SA 2RDIA 5KG6A 4DSJA 1ELOA 4NYZA 4B02A 2DNPA 3DI6A 1IKXB 4O3QA 4OI6A 2IVYA 3DLJA 4FF3A 3NAHA 4PQAA 1ZM9A 2H9ZA 2ACYA 3UNGC 3HHKA 4DQIA 1VMBA 2RNEA 1S1XA 4JI2F 3OLAA 4ED6A 3DRXA 2J0WA 1CEZA 4DF4A 4MKAA 3Q8QB 3M6WA 1RTDB 3DN9A 5CYMA 1D9DA 3D1QA 1XBWA 3CIZA 2YKOA 2HHTA 4B9SA 3N79A 1YJWS 2MQOA 3IN5A 4A48A 4PRFA 1G6BA 3BSOA 3D28A 2QO3A 3OFFA 5FIIA 3PEJA 2IJFA 2DISA 4RUCA 2XLJA 2U1AA<