3OFEA

Structured domain of drosophila melanogaster boca p41 2 2 crystal form
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
81
structure length
81
Chain Sequence
RTLMTFVSVTGNPTREESDTITKLWQTSLWNNHIQAERYMVDDNRAIFLFKDGTQAWDAKDFLIEQERCKGVTIENKEYPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords LDLR chaperone boca
publication title Structural Characterization of the Boca/Mesd Maturation Factors for LDL-Receptor-Type beta-Propeller Domains
rcsb
source organism Drosophila melanogaster
total genus 27
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ofeA00
3N0VA 3LUYA 1XTZA 1PSDA 2FGCA 3TUZC 4IO1A 3IXQA 3ENQA 2PC6A 3K5PA 1RWUA 5IT4A 3LOUA 4PWUA 1ZPVA 1UJ5A 2RQKA 2PA3A 1YGYA 2F1FA 3O1LA 3W7BA 3UW1A 2KO1A 2QMXA 4GO5X 3HHEA 3MTJA 2DT9A 1U8SA 2J0XA 3MWBA 5T41A 3MAHA 2P9EA 3AB4B 3U7JA 3AB2B 1M0SA 1LKZA 1LK5A 5IS2A 4LUBA 2JHEA 2P9CA 5IT0A 2MDAA 2DTJA 1UJ6A 3AAWB 2F8MA 2JOQA 3OFHA 2RQMA 2I9SA 2QRRA 5FIIA 3S1TA 2CDQA 4X84A 1Y7PA 2ZHOA 3CEDA 3ENWA 2NYIA 4M8LA 1UJ4A 3DDNA 3ENVA 3DHWC 2QSWA 2QMWA 3L7OA 2LQJA 3DC2A 3OFGA 3DHXA 3OBIA 4NMLA 3TUIC 3OFEA 3OFFA 2LVWA 2P9GA 4GO7X 1KS2A 3TUJC 2RE1A 1SC6A 1LK7A 3KWMA 3NRBA 2J0WA 3IBWA 3P96A 4GMKA 5JJBA 1O8BA 2H9ZA 1YBAA
chains in the Genus database with same CATH superfamily
1REGX 4C8OA 3FMWA 5LSLA 4ILLA 5LT5A 1UVNA 1Y5IB 1P1TA 3W8GA 3S6EA 1UWBA 2BKPA 5F0UA 4UUXA 8RUCA 4IOCQ 5I3UA 4KC5A 3BSCA 3F0NA 4N41A 2ZE2A 4Y00A 3IWXA 2L08A 5ADZA 1S1VA 2A6MA 2V2ZA 2YNHB 1RT7A 4CO5A 1RWKB 3N79A 4DHVA 3ONQA 3CVKA 2R8JA 3ZZYA 4JB8B 1RU1A 2W9BB 1C1CA 2AGPA 3UNGC 4DV5J 2ZKUA 3M8RA 2ACYA 1R8BA 3G71S 2YWHA 2HHUA 2VG6B 5ETNA 2FHOB 2MJUA 5A2QY 4ECYA 2E44A 3AH6A 1NNDA 1RTHB 4ZPBA 4NCGA 2RUSA 4A8SA 1CQMA 1UWBB 1DTQA 2UUAJ 2DR5A 2HNZA 1YJUA 3E01A 3I9V9 3MM7B 1B0PA 3I5BA 2PEBA 1S1VB 9RUBA 3TA0A 3GR1A 3PYFA 4JOUA 1RT7B 1H6KX 4F7VA 3NCRA 3HT3A 2CNNB 4CWBA 1TK5A 2RQKA 4IDKA 5L38A 4QIFA 3W7BA 4LF9F 3O2IA 2Z2ZA 1T9WA 5IC6B 5BYRA 3HSJA 1SJ1A 2R2TA 3H59A 1L5UA 3DGVA 4XK8C 1C1CB 5DRKA 4WK3A 1T02A 4PCQA 2EFGA 2Q43A 3KMQA 4C9DA 5IFMA 1R6VA 3ET6A 2J8AA 4O3QA 2CJBA 3AAWB 3Q22A 3W63A 4DV6J 2CJAA 1YZ6A 2LQBA 3SSQA 4B3MJ 3BF4A 3OW2R 4Y65A 4M5NA 2A18A 4YMEA 1DTQB 4M63A 1TMJA 1FI4A 2HNZB 5LXRA 4DZDA 3E01B 4AL7A 1VC6A 4WBFA 1VRQC 2WSEC 3GTYX 3FNNA 2W24A 1IR1A 2IM1A 2XWYA 3MMBB 3OFFA 4KT0C 4Z7CA 1VQ4S 2OEKA 2AYBA 3D3BJ 4LRCA 1S4EA 1WUUA 3UPFA 5GVQA 2CQ2A 4M94A 1WNEA 1B4SA 3LA0A 1MW7A 4IH5A 5DZ7A 5ETQA 3KLVA 2WAQD 2A6OA 4P72A 2W1BA 5IWAJ 1N5YA 4MH8A 4DL5A 4GVLA 2VUGA 4WK1A 3OXGA 1X4BA 2AZ3A 2MZQA 1LWXA 3LOUA 2KG0A 1IBMJ 5DGAA 2VODA 5CZXA 4QYZJ 1TL4A 4L72B 3E3XA 3G8TA 1X31C 3W9IA 5DGBA 3H2UB 2VPZB 2HNYA 3AFGA 4TQRA 1S1XA 2MB0B 1WELA 1D3WA 4DX5A 1T0TV 2HLTA 5CCLA 2C2ZB 3UD3P 1NK8A 2RU9A 1X9MA 4F36A 1UCNA 3ZZPA 2KXHA 4OZLA 2JEGA 3GV7B 2BW7A 2MSSA 5GAEU 1RCXB 5KT4A 4IR1A 3Q89A 4IRCA 3IWNC 2W2PP 1GK8A 3A8IA 4OHVA 1N5YB 4X4PA 4P74A 5LXYA 4DZ6A 5K9FA 3VAJA 2ZOMA 3W1YC 2QTWA 4C4WA 5JJBA 4X64F 3VAIA 3BGRB 4RNFA 1SJQA 1WF2A 4ZP9A 1MU2A 4KJIA 2OPRA 5D6GA 1YJVA 5A6PA 1WC0A 3QGHA 3OTOF 3CMES 1UA1A 2OEJA 2HNYB 1PAUB 3PEJA 1DQ8A 2FJDB 2L3MA 4ED3A 1Q53A 3Q8UA 4RW8A 1N4LA 4I6AA 5CZVA 2AYMA 3I0SA 2KI2A 2QG9B 4CDIA 4NRUA 3VAHA 1SKRA 3IR7B 3QNWB 3GCWP 3HK2A 2UXDF 4P7TA 4OYBA 2V9KA 3VVTA 1RWOB 5J1NA 1XR6A 3IR5B 1WTBA 3DOKA 2ROEA 4M5LA 1BWEA 3AQOA 2VFTA 1Y0HA 3QT7A 1NHUA 3FVYA 2CPDA 4NLDA 5DQIA 4KGVB 1DZ5A 4KY3A 3VAMA 2Z0GA 2FY1A 5K8MA 3M7VA 3C16A 4WF9Q 2RDDA 2W8LA 4DF4A 1N5QA 3MPYA 2R7WA 2KTQA 3Q8VA 4P10A 2OH2A 3TUIC 3M2RA 2OPRB 4PQUB 1DQAA 1NHVA 1VHFA 4U95A 4QWCA 2QLWA 1K47A 2MQNA 5C42A 4RW8B 2JNJA 3W9HA 2LQ9A 3BEGB 4GKKJ 1FJCA 4URGA 3BR8A 1Q79A 3Q8PB 2IJFA 2DITA 2HFVA 4OYZA 2VQEJ 3GFXA 2HAIA 2DXEA 1U2RA 3O1LA 4OFZA 2E29A 2BKNA 1TR0A 3M2UA 2GS8A 3ZFVA 2VQFJ 3BREA 1XMOF 2UUCF 1UPMB 1MROA 2WRMA 4PXCA 4ANEA 3DRRB 4OI2A 2VFRA 5GMEA 2O01C 2QJ3A 3C16B 4UY8T 2OKQA 2HPUA 3EPGA 1AROP 3LP2A 1XQIA 4MYUA 2FHJD 1IBLJ 5K14A 1XNQF 5G4DA 2YWFA 2ZM6J 3VGTA 4Y2AA 5AXNA 5MAOA 2EEYA 2UUBJ 4DQIA 5FLXU 2DR6A 5C42B 2H5EA 4YR0A 2ZKTA 2GHWA 2X1AA 2OPPA 4I2QA 1U6FA 2FJEB 5CQGA 4KTQA 3PIPQ 4RUHA 3PV8A 5HROB 3R6GB 3M4XA 2V68A 4ZK7M 2W7OA 4YQWA 1HWIA 1GAOA 4PPDA 2W2MP 4UQGA 2PMHA 1TAUA 4NA1A 1J5OB 4F04B 4G1QA 1WHYA 3LP2B 3MOZA 2UXBJ 1JX4A 1BQNA 1RWPB 4A47A 4YR3A 1LK5A 4DEZA 1HW9A 4KPYA 3HHNB 1KSPA 4ES1A 3FBFA 1SQGA 4DPOA 5CYMA 2DHGA 2H1YA 3RU0A 4F4YA 5D3GB 4OHXA 3MURP 2AKWB 4I2QB 3QJLA 1WG5A 1DTTB 4TU8A 2VG7A 3M2VA 4FKXA 1GQEA 6FD1A 4F4ZA 1ZM2A 1FWKA 2HK3A 1SVDA 4DF8A 3T1HF 2ZDPA 3D68A 4UTGA 1GTHA 2WSFC 4I69A 1V5IB 1IKXA 4DV0J 3GLJA 3KUGA 1U24A 3M1VA 2JVOA 4DR1F 3QWUA 2UU9F 2HS3A 5KFQA 3LGMA 1QDUB 5DLGA 3UO0A 3EVMA 2YWKA 4YY3F 3MUTP 3H40A 1HWUA 1BY9A 2BOAA 2K7JA 1F60B 1D8ZA 4C3KA 4KAIA 2IYGA 1YJ7A 1L3SA 3K7RA 5IS2A 2LLZA 3M2VB 2Z58B 3WIVA 5G0RB 5CD4A 1JB0C 3ZZUA 1PBUA 5B0BA 1S6QA 1LWFB 2AX1A 1VQPS 2C2NA 4HT7A 2CNKB 5A76A 3CCVS 3BM7A 3SV4A 2CJQA 2XNQA 2HBQB 1KTQA 4LFCJ 4K4UA 3UE2A 2H4YB 4DX6A 3J7A1 4KHPF 4X62F 2J8SA 3EZ5A 3TZXA 5JVGQ 1QE1B 3N9UC 4C0OC 4IRKA 3HX9A 2VU5A 5BYQA 2RDIA 2GQCA 2OMLA 2PFDA 4RWWA 1RACB 1M5OC 1K0TA 2HS4A 3W3SA 2AMCB 2D3OR 3X1LB 3HKZD 2KO1A 2QV6A 4JV5F 3LQVA 1VOMA 4I64A 3NS5A 4ED4A 2HS0A 5J2QB 4NPOA 1F6TA 2R2SA 4NYPA 2CDRB 4OI3A 2NUUG 3D6MB 2AD9A 3CDBA 4LF6F 2N7YA 1RWWB 2R42A 2VB6A 2QFIA 2IC3A 2MKYA 1X4HA 4UZBA 2ZVSA 4CYUA 5KFSA 5KFLA 4NI2A 1CJUB 4LIWA 3PIOQ 2C42A 1TKXA 3C19A 3MCMA 4KB7A 4ZVTB 4XAKA 2QLXA 2XZDB 4RW6A 1FK9A 4AXIA 2OMOA 3NL0A 1HW8A 2SXLA 3BYRA 3MM5A 4KV8A 5D77A 4CNYA 2O5DA 1Q82T 1FEEA 5M2UA 4B3OB 4ICLA 2EC0A 5K5MA 3FEYB 3CDEA 5HQLA 1Q0NA 3OJSA 3GPAA 4C0HA 1X8DA 2ZHAA 4J91A 1BXNA 3W8PA 2ZH8A 4RUAA 4B9UA 2XLIA 2HHPA 3MEDA 2MZTA 3M6VA 3GFZA 4NI2B 2H4WB 1VDHA 1TKXB 4JP8A 4LREA 2NXNA 1BQMA 3GONA 4IQXA 3RR7A 1XMBA 1OWXA 1O0PA 3KUHA 1ZPWX 4RW6B 4URQU 1FK9B 4I6WA 3M05A 3T5JA 2D3UA 3X3UA 1HIYA 4TKTA 5ETMA 1EP4A 3MM5B 2KYZA 4KV8B 2VFUA 5BR8J 3DOLA 1UPPA 3OVAA 1HI1A 4ZJLA 2DH7A 3A1YG 2CPZA 3Q2TC 4ICLB 5CCMA 4B9LA 1RA6A 1FDAA 4G1PA 3RB3A 4Y3CA 2EG2A 4CLZA 5HVHA 2YWEA 2VJVA 3DLGB 4MT1A 1ZAXA 4QQBA 4ECUA 3H4DA 1S0NA 4JYAJ 2ATLA 3G9CA 4K4VA 3HVRA 5SUHA 3UQSA 4CLLA 4GO5X 2R2UA 4K50A 1O51A 3RUBL 5DJBA 1N56A 1WF1A 2JFDA 1FDBA 1CEZA 3DOLB 3QMQA 1ZETA 1U1PA 3ISND 5BXIA 2A3JA 2QGFB 4X84A 2BJ8A 1WKJA 4NCAA 2L48A 1KQGB 2D7SA 3N6NA 4NRTA 3OR2B 2IJNA 2XI2A 1KQSR 3QIPA 1GXLA 2Y0SD 2V0NA 1F9HA 1R3NA 3TJAA 4IYQA 1S49A 1Q4RA 2L9NA 2FJXA 4NZ0A 1VC0A 1CJTB 2W9CA 4LBIA 5F8MA 3DDIA 3Q83A 4YHHF 1AA1B 5DETA 4ZPCA 3ISNC 3JQJA 1NJWA 1P27B 2DNRA 3W66A 4X66J 3SCKE 3D67A 4RX6A 4HT5A 4NXNJ 1JJ4A 3KLFA 1UAWA 2DK2A 4KGZB 2ASLA 3DU5A 4C3MA 1HBNA 1CBKA 3N01A 4CO1A 1LW2A 3TRGA 2OTLS 1NK5A 4PG4A 1SBRA 4C98A 4WKYA 1S97A 2R7OA 3PNIA 1URRA 1V3SA 2B9YA 3PY8A 1NDKA 4ECSA 3R9LA 1SUQB 4ED7A 2B9EA 1TTHB 4Y2MA 3J81Y 3CIMA 2FHKA 5U47A 5D0EA 2B4UA 5CD4H 3KKFA 4B3TJ 4DXLA 2LFVA 2PEHA 1RCOB 1YWXA 3R2DJ 3AOBA 4HKQA 2F7VA 4XPCA 5GAGU 2UUAF 2FUG9 1U49A 4P2SA 6FDRA 3L7UA 3BSOA 3KLFB 1AW0A 3UCZP 1X5OA 2HIYA 1NK4A 4NYOA 1HBNB 3IXQA 2Z8QA 1FRXA 1KBRA 4QIGA 3Q23A 2ZZNA 2F1FA 4LF8F 2OUGA 2KG1A 3HMJG 2B7BB 2ROGA 3VAFA 1EQ0A 3GIKA 3FSYA 1T8EA 1QUPA 2CRLA 1LXJA 1HMVB 2CADA 3AOCA 1VFJA 3KMSA 3UFCX 4Y2CA 4GC7A 2HQIA 5KFGA 4DV6F 1NZ8A 2F40A 4B3MF 3VZIA 4YFUA 5D0GA 1KLNA 4F2SA 1YG0A 3FC9A 1FDDA 1S1TA 5IM0B 1M90T 1BWVA 4XTTA 1MNEA 3T6JA 2DH9A 5KT7A 2D41A 4KGKA 4IRDA 3B54A 4OMFG 5IWAF 2AF6A 2LYVA 2MKJA 1D0EA 1WC1A 2KJVA 3H5UA 3UDCA 1UJ5A 1IXKA 2BX6A 4RNOA 2E7VA 3POTA 3G6VA 2EXUA 3BN7A 2GMLA 3ITHA 4LRDA 2HQ3A 5HSPA 4L73A 1KHWA 4OZ0A 3HULA 2AEMA 2HEKA 2YXLA 1EETA 3E2EA 2NUHA 3UDLA 3TUPA 3BR9A 3MM8A 3QZ7A 2AJ2A 3CJ5A 2FY8A 3D4JA 3MPWA 3IP0A 3T19A 2AJFE 1S6PB 2M88A 1XMQF 1RT4A 3TAMA 2GC8A 3AJDA 3VR1A 1M1KT 1XN9A 1MMDA 2XQCA 4LR8A 1OIAA 2IRXA 2AHOB 3POTB 3TVZA 3AD8C 2VOPA 2ZH1A 2BDPA 2EFOA 3ITHB 2V5HG 1RT3B 4EZ6A 1RT1A 3EX7B 4DFPA 1AUDA 3M8QB 1X4FA 1EETB 2M52A 1Y00A 2Y8YA 4OX7A 4MK7A 3OTEA 2KZZA 2R7QA 3MM8B 1FXLA 4OYMA 3L3CA 2HBYB 3NEKA 2XYPB 1YI2S 4EMDA 4HL9A 3BPDA 4WCEQ 4WPAA 4WFZA 5CYJA 1RT4B 4FNHA 1JIHA 4C8MA 1FERA 4S0MA 1SKWA 2IPOB 4K59A 3RB4A 4IG0A 2HRYA 3LAKA 4EUVA 3AA9A 1T3NA 3DRSA 2VV5A 2BE2A 4F0KA 2PE8A 4C8LA 3AT1B 2X3DA 3WQPA 1VQSA 5A8RA 4C8ZA 1S9FA 1RUSA 1RJJA 1O8BA 2E5IA 5D4PA 3BZQA 3VAGA 3SCJE 1H98A 3MECA 4WTYA 3R5JB 5HMXA 3FCWA 4IH7A 3SSSA 2YKMB 4GKKF 2O3DA 2HGMA 1OMSA 3NKYA 3NS6A 1VQOS 2H3EB 9ATCB 4ZLNA 2CFXA 5DDRC 3QAUA 5L1IA 3BGUA 3MAHA 3U7JA 3CJ0A 1TP7A 4Q0BA 4OYAA 4JI0F 4ZVQB 4KBIA 1IJEB 1HBUA 5KFBA 2BE2B 4R8UB 2D9OA 2FVQA 4ZCIA 1KFSA 2RF2B 3AHPA 3HO1A 3OPKA 4LR7A 5DO2A 1TVRB 3IAM9 5A8RB 3ENVA 1W7WA 3MAQA 2YWGA 2DNNA 2YWWA 2RHSB 2MLYA 5A0YA 1CULA 2HQGA 1TELA 2LU2A 2CQ3A 3DCAA 3PYEA 1I6JA 1KD1T 1N34J 5HN0A 1F9EB 2ZUGA 2NPFA 4X4RA 4USHA 2FLNA 4UT4A 1N32J 4FYDA 2JJ4D 3BGOP 2B51A 3RBXA 4Q0BB 4LRAA 1UFKA 4LSLB 5E7OB 2HVIA 5HBMB 3GQCA 2B6AA 4CLUA 1ZM9A 4ED0A 1RTZA 3MGJA 3UDVA 1HBUB 3FCVA 1M1HA 2W8KA 2GJ2A 3HDSA 2NZ4A 2Y1LB 2H65B 1M5SA 4AFFA 1U26A 4DL6A 3QLHB 1U6BA 5A0YB 3B8HA 4IO9Q 1H2UX 2AV5A 2ZH2A 3V6DA 1S9EB 3QSIA 5KG6A 3Q8QB 1M5VC 1UVKA 4K4XA 4LRFA 2AJQA 4PZVA 1FF2A 1K9MT 4KHRA 3J80U 3R5GA 3KLEA 3RB6A 1CC8A 4C6AA 2MY7A 3KLGA 2E1MC 2MQQA 2V94A 4RW7B 2R9LA 1ZA1B 3ZNUA 2J0WA 1SH3A 4FYYB 3ILLA 2H9ZA 4QIEA 2B6AB 4DV0F 1EQMA 2CPYA 1YJWS 1FNOA 5JXSA 1HNVA 3V2UC 4PWWA 3RR8A 2JLFA 5J1EB 4DV3F 3HD1A 2HYIB 2MQOA 4JI2J 3H8YA 4CLWA 1N54B 1Q1KA 3KJVA 4KRWA 4JI8J 3ZXWA 5F8NA 3MR7A 4CTAA 3V6DB 5IC4B 2XS2A 1CS4A 2MZJA 4LF2A 3D0GE 3H2LA 1D9DA 1S0VA 1XK8A 3L95X 5DG8A 3HI9A 4D3GA 2PA8D 3KLGB 1RWVB 5ETSA 1AXQA 1TL1A 1JXVA 3K5NA 1Q5YA 1YJTA 1R8CA 4I4BA 4QPXA 4WYLA 3V6KA 4KO0A 4LFCF 2MHNA 1E6VB 1LV5A 3TUJC 3U1LA 1IM6A 1LWEA 4ATNA 1FJ7A 3D1QA 2C1EB 1VJWA 3KJVB 3NGSA 3FGVA 2GW8A 5ETRA 3I32A 4OHWA 4F67A 4CTAB 3N4WA 2VH7A 2CQPA 3EGNA 4PAAA 2E66A 4YB6A 1CS4B 1VLOA 2WTFA 3ADAC 3M8YA 2IBKA 2IBOA 2FPHX 3DLLQ 2VC1A 1U0HA 1JLCB 4WXOA 3J7YU 2CPFA 4X4VA 1UMJA 1B3TA 3ZNJ1 4LFAF 1DJ0A 5CAAA 1TL1B 2ZBCA 4WZMA 3OVSA 4P2FA 1VRUA 3TO8A 2A1BA 3MM6B 2UVUA 2IM0A 1KONA 5A2QU 4KO0B 2GQQA 1VRTB 1NSKL 2XMJA 3OTBA 3TVYA 3FRYA 1JXLA 1B64A 3HD2A 2HZAA 2KDOA 1JLBA 1LWEB 2XLKA 4LBPA 1XIQA 2W4DA 2WW8A 4JI4J 2WSCC 3K89A 3A12A 1X4AA 2FD2A 4B9NA 2CPIA 3CULA 2NXEA 2NXUA 3QGGA 3UVJB 3JXOA 2J6TA 1HNIB 2E5HA 4AXJA 3MCSA 3PDNA 4NLVA 5HVGA 2LXIA 4F3QA 3N28A 2GJIA 2Y1RI 4CLFA 3JQMA 3C14A 4DV7J 1N36J 3VTIA 4LVOP 3QAEA 3VCDA 5ETVA 3UWTA 1RE1B 2HZCA 1TQLA 2CQDA 1KQFB 3VAKA 2CZVC 3HVWA 2BACA 1U47A 1GEHA 2LP4A 4Z37A 5LMNJ 1IUJA 2DNZA 4ED6A 1EHWA 1QM9A 4NASA 4XIUA 1S1WB 2EBEA 3SIPB 4ILMA 2XMWA 1PG5B 3VALA 2APOA 2KHCA 4PQAA 3ZZ0A 2MHEA 2GVZA 3QATA 2ZH5A 2KM8B 2VJUA 3JAMU 1X4EA 2DHHA 2VKRA 2D1CA 3HP6A 3SDEB 5BR8F 3MCNA 3NBPA 1S57A 1RAGB 2CVIA 4P75A 3PACA 2VBYA 3RAQA 3C14B 4R0EA 1WG4A 1FDNA 1HYSA 2MSTA 5KG1A 2FGCA 1Y9OA 2GA7A 4KHMA 3ENQA 1UVMA 3HJFA 1RHKB 4JYAF 1ZAWA 2XYHB 4K4TA 3Q8RB 4PWDA 2QMXA 8ATCB 2IFXA 2GVZB 2DYAA 3MPVA 1M0SA 4DS5A 4O4RA 3M9OB 3IS9B 4BBYA 5KG5A 2J6UA 3BV8A 4G1IA 3PX4A 2XZWA 1ZTTA 3K2YA 3W5ZA 1PO6A 1WC3A 1G6BA 4UUWA 3DDKA 3CCRS 5C25A 3A8KA 1T9XA 1TKDA 2HQDA 5HLFA 2CQ0A 1HYSB 1RWNB 1T9YA 4HACB 2L9DA 1U1RA 1VHIA 5D0RA 2CNOB 5I4MA 2B5JB 2V8PA 2WBRA 3A13A 3THVA 2XSJA 3NWRA 4X65J 3A3NB 1KR4A 1TL7A 3R7SB 2PMZD 2M8DB 1PSDA 1K73T 3EUNA 1DRZA 3CC7S 4ECQA 4ZVOB 4A8YA 3BS9A 2KVQE 4X66F 3DYAA 4NXNF 2PD1A 2GGPA 3HHEA 2BE7D 1RYRA 4I0WA 2G0IA 2HKEA 1TL3A 4Q5VA 2HQFA 5C25B 2BJ7A 5HLFB 2U2FA 1SQEA 2DGUA 2X1GA 3CDAA 2HVZA 1VS3A 4CH7A 3TAQA 2XY7A 4C11A 4ZDNA 1CJVA 1Y7PA 2PI5A 5KTQA 1Q7LB 2XSJB 4UF4A 5IOLA 4K5RA 1TL7B 2C28A 4MMOA 3W65A 4B3TF 4G6VB 3M30A 4DR2F 2E5LJ 3V5RA 2NYHA 2XMKA 4LMZA 5EX3A 2FVPA 4J7CA 3DOMB 4FKYA 4QYRA 3SFGA 1QTNB 3DYAB 1X9WA 4FS2A 1T9VA 3OQ2A 4QU7A 3LP0A 3OSPA 2GO9A 1TL3B 1U1NA 4ES2A 2WVDA 1TK8A 4R0JA 2RS8A 2YKNB 3MXHP 1FESA 4WP9A 2QLBB 4C11B 1CJVB 4LF4J 4NYZA 3DI6B 1JKHB 2MDAA 3TQ1A 3MD3A 4DSEA 2RQMA 4DR6J 2UXCJ 3J7Z5 3C2PA 4CO3A 4ENOA 2NYIA 2FLLA 3M8SA 4EBEA 3BYPA 1F3VA 1G2EA 5I42B 3LP0B 4KFBB 3BQ0A 2LVWA 4GO7X 4Y2KA 4Y6IA 2MGZB 1S72S 2BQ3A 2Q1LA 4DI6A 1H0HB 3KG4A 4F8RA 3CW2C 1UW9A 2MKKA 3GG0A 2DR9A 1HQUA 1FKOA 3FDSA 2MKCA 4U7UK 3GZ7A 4TYAA 1U1KA 3AXKA 1H72C 2BYCA 3G86A 3LO3A 4DG1A 4M1KA 2R7SA 3KYLA 4OZ1A 2DGWA 2XY5A 2DPJA 2E1RA 4OYIA 1GX6A 2QL7B 4FVMA 4QR1A 3G82B 2PN6A 2P9EA 2GZOA 3F73A 5J2PA 1FTCA 1S0MA 2RDJA 2DGXA 1WF0A 3EZUA 4ZHRA 1RLCL 2R8IA 1FE0A 4OYWA 1REVA 4WWSA 3G96A 2K3KA 3U27A 1QY7A 1A9NB 2LEAA 1HQUB 3KLIA 4OL8A 1R0CB 3R27A 5KFPA 1U8WA 1Y4ZB 1NCLA 2HHXA 4YN3B 5KFWA 2V50A 4DG1B 1B0VA 4K8RA 2YX1A 5F8GA 1ULRA 4J9RA 4GVBB 2FZKB 1FT8A 1C0UB 5M2PA 3G6YA 4NOHA 2ZBRA 2DGTA 1BE4A 4C7QA 4J37A 1H74A 3I5CA 4ETXA 1WC5A 3I5AA 4ED5A 3UD5A 4DBQA 3D6FB 4ZHRB 1KLMA 1NPKA 4EO6A 4B08A 3C15A 4TY9A 1REVB 3IRXA 3VQSA 1U09A 4HLBA 2BUNA 4QPTA 3W5YA 4CM2A 1S5ZA 3TJ8A 1VQNS 2ZOGA 2EWHA 1YJNS 4TY8A 3ZTSA 4CO4A 1L3TA 1RT6A 3PO4A 1UP1A 4Q7AA 4FVCA 1NUEA 1M5PC 1G7CB 4CP5A 1LW0A 4ZPAA 3CC2S 2PSZA 3GSDA 2KU7A 4TYBA 2VG5B 1YRTA 2RQCA 2ZUAA 1SQFA 1GXTA 4A8KA 3ISZA 1NH8A 3SQOP 4DLEA 3R3TA 1V9OA 4V19J 4F2RA 4DCJB 1Z2LA 1S76D 5A8WB 2GIFA 1KLMB 1WG1A 3MI7X 1RB0A 3C15B 4HDHA 5KT5A 3T5HA 3IRXB 3IWLA 1QSLA 5C2GA 4JV0A 3T41A 1F2HA 3H5YA 1T03A 3W2WA 3K8WA 2GNKA 3S01A 1JLGB 2FIUA 2IDLA 2P9CA 3ZTPA 2BJ3A 2QC3A 2EBGA 2AQ4A 4QJVA 1VIOA 3CDWA 4WFYA 4LF7J 2QRRA 2KFNA 3ZZOA 2I1RA 2UVVA 3C8YA 4C8YA 5K8PA 3OL7A 3CEDA 5B08A 4H4KC 2OD4A 2LQ5A 1B7YB 2CG8A 1VR6A 5L9NA 2GVDB 3TEHB 3DRYA 1WHXA 1JJ2R 4EWTA 1XBWA 2B43A 1IN0A 2ZH6A 2B0GA 1NXIA 1N34F 2RRAA 1FFWB 1UZHA 2E7XA 2PFFB 3JQKA 4QCLA 4MKVA 1CJKA 4JI1F 1PILA 1N32F 5IV3A 3W2WB 3TANA 5KG3A 1PJ7A 1PGZA 2DBBA 4JI6J 4KYZA 1GFWB 4K4YA 1IBCB 4J9PA 3RZAA 4WIQA 2C3YA 3HHDA 4AD6A 4BC7A 1SCJB 2V4QA 4RU9A 1FTRA 1RZMA 4FYVB 3NY0A 3BDEA 1H73A 4C48A 2DCUB 2QMUB 4YR2A 2DVIA 2Y3YA 1QAYA 2D9PA 4WU3A 3JYTB 1UL3A 3EE3A 4WE1B 4DV2F 2LA4A 4IH6A 4YOEA 3IO1A 4FYXB 4D3HA 2ADCA 2B4OA 3GIIA 1N5SA 2JEJA 4UZCA 4WFXA 2J9DE 2PDAA 2JWNA 1MSWD 3GR0A 1IBKJ 1OO0B 4LSZB 1CPZA 2K2PA 3CMQA 3VV2B 1VIXA 2PI4A 2ZBIA 4HDGA 3SFUA 1ELOA 3KDOA 1WC4A 2ZFHA 3O6QA 5F3TA 3V4IB 1SIWB 3QPIA 4DUZJ 4DQSA 3IAS9 4RBUA 4J5OA 5KAKA 3PZPA 1NEEA 1I3OB 2VDHA 4DX7A 1YJRA 2DISA 4LBHA 3MTJA 4OYXA 3LWLA 3MPDA 3ILIA 2YNHA 1Q8IA 5T41A 4B9TA 1N0UA 2YNIA 3HSGA 2NR0A 1PYOB 2XG8A 2M2BA 1OPZA 1F0XA 2DIVA 2W9BA 4DUTA 1U2CA 2R7TA 2G2OA 5FIIA 1GMWD 4I67A 5KFOA 2VA3A 2ZHOA 2Y1IA 2VG6A 2KL8A 2HRTA 1RKIA 3HSDA 2NQPA 1V3RA 3OBIA 1FCAA 3MAAA 1RTHA 4DQQA 1AFIA 4Y2IA 5KOXA 3G8SA 1TUVA 2UUTA 4CO2A 2BVZA 2RAQA 4F25A 5HJYA 4PG5A 3MM7A 4YB5A 4ZPWR 2DD8S 3GJSB 1WOOA 3OV7A 2DGQA 2DHAA 2B7CB 3CJTA 3CCWA 2ZNZA 4UOGA 2NSCA 4XDCA 1B70B 2YNIB 5KFZA 5B0CA 4PG7A 2KFYA 4B9VA 2MKHA 1AB8A 3KHHA 1HBOB 3T3FA 3DFEA 3LH2S 2DT9A 5K20B 1IKVB 4LFBJ 3VVUA 3UN5A 1RA7A 1YK9A 3ULHA 2AGQA 5HP1A 1BLUA 3J81U 2AP6A 3NNCA 1NAQA 3MAAB 2VA2A 4P9SA 5IQQA 1HNXF 4RL1A 5ETKA 1N0VC 4DR4J 2BBEA 4I56A 3U1NA 1HR0J 3MEGB 2ZH9A 4NXMJ 3NGTA 1MN7A 1NKCA 3I4HX 3MMBA 4DFMA 3FQKA 3P4UB 2P9GA 2KFZA 2C2DA 3DLHA 4P71A 3JB9k 2XULA 2FZCB 2WB4A 1JLAB 3PTWA 1QVFR 3LUYA 1XR5A 2VKZG 1X0FA 2MZSA 2YNGB 1YBUA 3MEEA 2ASYA 2BZ2A 4ZN1A 5HP1B 4RZRA 4DV7F 4OX6A 5EGYA 3SCLE 3H42A 2ZZTA 1BUXA 1F2GA 1TFYA 3SYZA 3RTVA 1LKZA 2KRRA 1DLOA 2WVBA 2FVRA 3PRBA 5GADI 5LMNF 5DM7Q 3H4BA 3KK3A 3JAMY 5KT2A 3LPYA 2VDIA 2JDJA 3T6BA 1Y3KA 3TX0A 2UVRA 5D4NA 2G9OA 2YX4A 4ILRA 2I6WA 4N5SA 5KG2A 5LM7E 2ADBA 3MEEB 1I1GA 3RJMB 2HURA 4R5PA 1VQ7S 5CA5A 2RMLA 3GCXP 1FJGJ 3BGRA 2EFVA 3UDEA 4DPTA 2XMUA 1ZA2B 3OLAA 4ED1A 1F3FA 4OJHA 5DDQC 5IT4A 1DLOB 3KK3B 3EVWA 1RAAB 2GMJA 5HAOA 3BBFA 2ASDA 4L76A 1FXDA 1ZM3A 3NGDA 2CPJA 2DJWA 3AJ1A 1YX2A 3H90A 1P6TA 5HO4A 5CABA 3MDFA 3NAHA 2Q6CA 3ZZZA 3PM9A 3M6UA 5E0OA 1I94J 3EXYA 3P5TL 5LOQA 3DGPA 3T5LA 3OJUA 3FRZA 4R5PB 2C22A 2HW3A 2WBMA 3CD5A 3AY0A 4L6V3 4RUBA 1HWKA 2OELA 4PQUA 1YDLA 3QJPA 2AJ0A 1GTEA 1H38A 4X65F 1OPIA 1SI9A 4DR7J 2XMVA 2MLZA 1F9FA 1S9GA 5D8HB 3CC4S 3W5XA 2V2QA 2Z56B 4ZJQA 4YDXA 4DL0C 2PA3A 4UQTA 4PG6A 4FBTA 1VBYA 4X64J 1S77D 1FKAF 1UWAA 4KKOA 2B56A 7FD1A 2XGPA 2VZ9A 3DRRA 3EM1A 2VPXB 3DGPB 3RYLA 2CPEA 1QAJA 1FNXH 4DL4A 4NCBA 1X5SA 4H4OA 1IM4A 4TNOA 2C3UA 3D0IE 2G2YA 2WHOA 1Q5VA 1RSCA 4ZJOA 4N56A 2BJDA 3OFGA 3M32A 1VK8A 1SC4B 4HHJA 5L1LA 3VGVA 5LJ3Y 2R2RA 4DPXA 4Q2MA 4M95A 4QWBA 1S9GB 2NREA 1Y3JA 3UN2A 4ECXA 3KHRA 2XGQA 1WDDA 3UN3A 5HROA 4BWMA 1HD1A 1TL5A 3F44A 4KKOB 2PGCA 4NA2A 5LSRA 2BANA 1J5OA 1AFJA 4PYAA 1IVZA 1RAJA 1JLQA 2HBRB 2EFNA 2E5JA 1UVJA 2IHR1 2AZ1A 3HZEA 4OZJA 4H4OB 4E8UA 1NPRA 3CCSS 1PAEX 3T9NA 1KKHA 1R43A 3CO0P 3OL8A 5E5NA 3HFZB 1CLFA 2OPQA 2JHEA 1LWCB 4P6QA 5IT0A 2ZJPQ 1QAIA 4P73A 1CVJA 4B3SF 3M32B 2BXJA 1HHSA 3WC0A 5D3GA 2XCPA 4DR6F 4NLSA 1WEZA 4AYBD 4MYTA 1ZZNA 2C2RA 2UXCF 1XMOJ 5KT3A 2XMAA 1DTTA 5HJXA 2ROPA 3IA0A 1SH2A 4ZLPA 1EKSA 4GKJJ 4DLGA 4C8NA 1FD2A 2H51B 1NJXA 1IKWB 1XNQJ 2HWIA 1JK9B 2G13A 2OPSB 2MTLA 2AWZA 2BANB 4FN5A 2XO6A 1JLQB 2Z2MA 2V4JA 4BDPA 2BABA 1S1UA 5GAHI 1RT5A 3R1HA 2DGVA 5B0FA 4KGXB 3K5PA 2NS1B 3WHIA 2XSFA 1SPBP 4QW8A 3HHLD 2OPQB 5CHCB 3GIRA 4W4MA 3FJ2A 2J0XA 3PKMA 3MWBA 4RNMA 5JUMA 3N5BA 2M70A 3QZ8A 2IA0A 1RTIA 2AGOA 4KH1B 2ASJA 5T7LB 4ER8A 4RJVA 4IUFA 5G0RA 4LSNB 1D9AA 2XZTB 3GV5B 2CPHA 1LWFA 3PJ9A 4X4TA 2RQ4A 4DR3J 2BR0A 2OD6A 3HHLC 1FXRA 2JSXA 2V4JB 3CJKA 5LMUJ 2BEFA 4ZLLA 1S1UB 3D66A 2ZVIA 3R7BB 4A48A 3Q8SB 1RT5B 1QE1A 1UEVA 3RW7A 1V5VA 2KVIA 3R8YA 3G87A 2E1AA 3NGRA 4GMKA 1TKZA 3OD2A 5I3PA 2D69A 1WOPA 2NXJA 2C2OB 3T1HJ 3V81B 4NLYA 1TU0B 3PW7A 1RTIB 2FJBB 1S10A 4CRJA 2NZCA 5J2QA 2CG4A 1C2PA 4B9MA 1P8GA 5KFTA 2HBZB 1KOHA 4EYHB 2QIFA 2EG1A 3VGUA 3CJKB 1HPZA 2L9WA 2DTJA 4ELVA 3KG0A 2VPWB 1HBMB 4QW9A 5D4LA 2RJZA 2NLWA 3DRXA 5JMNA 3DDNA 1CJUA 4OI1A 1NSPA 5IQ6A 1TKZB 4USWA 2GIQA 4JI7F 4U96A 3WX8A 2IMWP 3CCQS 4Q2LA 3CT9A 1RAIB 1UA0A 2JH3A 2MMYA 5F9LA 4ZPVR 3HKWA 3IGVA 4KH0B 4ED8A 3M8ZA 3HVAA 3ZTRA 2JC1A 1CQNA 2IVMA 1LXNA 4X62J 4B3OA 2F9DA 2V2KA 2D3O1 4Q45A 2F3JA 1HWJA 5E41A 2QX0A 2KKHA 3AODA 5I3QA 1HPZB 1MWZA 1RU2A 1R89A 3LP1B 2W7PA 1GNKA 2XMMA 4QZVB 1HNZJ 1VGYA 1RHUB 1H2VZ 1S6UA 3I56S 2PT0A 3KLHB 4JI3J 2VOOA 2FLOA 3QFWA 2VASA 2CQ1A 4KR0B 2JRSA 1X4DA 2G1DA 3LF0A 2UUWA 2HSEB 4LF7F 3ZTOA 5MLCV 3HZGA 3P8BB 2BRLA 2M8HA 2YBVA 3PJWA 4HVZA 2FDNA 3OTCA 4LR9A 4NLQA 1XNRJ 1GMVA 2LU1A 2YNFB 3VGSA 2FQQB 1BC6A 5LSOA 2EW9A 3D7SB 3L4BC 3DLGA 4EBCA 2JL9A 2QFJA 1N6QA 4HH0A 1RWUA 2DEIA 2B9XA 4JI6F 4F4AA 2I2YA 3A8JA 3GYXB 4O4GA 1AUSL 3FZ2A 4AL5A 1FWLA 3BBCA 2B4VA 3MZIA 5J2NB 2BQUA 3NOGA 2KYXA 2W4PA 2GHVC 1OYDA 5LJ5Y 3QBCA 2RUGA 1XEZA 3JTOA 3TW0A 3KHGA 2IDEA 1OY8A 3NGKA 4I2PB 2CUYA 3C6UB 3R5DA 2DGSA 1NDCA 4YB1P 3MUVP 4RKUC 1UJ4A 4FPRA 4DU8A 3H25A 1FJEB 4ZVHA 4A8FA 3OR2A 2VIHA 4J9KA 4DUYJ 4QOTA 2HNDB 4IG3A 4HYKA 4RNNA 1N6QB 2Z2YB 1KVJA 4IFVB 1U25A 1OQ6A 2EK1A 1LOUA 3KDNA 4HI1A 2FVCA 3UCGA 2CKWA 4O4GB 2MJNA 3I96A 4AL6A 1CJTA 4MIWA 2VICA 5AXMA 4CH0S 4TU7A 2YQ1A 5D78A 3ZTQA 2Y8WA 4U8YA 3J7ZT 2XMTA 4DUZF 2F9JA 4E2FB 5L39A 4J9LA 4UOCA 4B17A 4WP3A 3UW1A 4ZOSA 1CG2A 4RU2A 2J7UA 3FEXB 2QA1A 5CH7B 4N8OA 3WIUA 2WCXA 3QSYB 2O66A 4O3PA 3I9ZA 1UVIA 2VONA 2HVHA 2AJ1A 5DM6Q 4ZVFA 1NK9A 1SUQA 4IG3B 4QU6A 4U7UD 3QRQA 1IR0A 2VFVA 2GMHA 2R8KA 1FVSA 3DXBA 4DV4F 3C6TA 1LNQA 4OZNA 1R8AA 4U6PA 1HWLA 2QE5A 1WHWA 5GMDA 3GB0A 3GWCA 1QVGR 3NRBA 3PR5B 3LGNA 5IZHA 4A8QA 4TQSA 1JNZB 3PYDA 5AJ3J 3DLJA 1SJFA 2L41A 3BH7B 4I68A 4PPZA 4NLWA 4OJGA 1ZH5A 1VBXA 1V3ZA 1RTDA 5D0HA 2BJEA 1WSVA 3BQ1A 1YQHA 3IM8A 2MXYA 3FBCA 2GCFA 2CNLB 2K7KA 3U02A 5ETTA 4YHHJ 2Q3PA 1R6YA 4LVNP 4LFBF 4DV5F 1X60A 2HHSA 1HMVA 4MIAA 4OQJA 4XDDA 2UP1A 1EIYB 3BO2A 4ECWA 3C6TB 3DN9A 3H20A 2CZ4A 1JLEB 5D4OA 1EAYC 4NEZA 3MMAA 3P3DA 3QYYA 4EBDA 4EU0A 1HQEB 4X4SA 4DR4F 3IGNA 3TVKA 3TQEA 3ILOA 1R7IA 1HR0F 1GT8A 4MFBB 4NXMF 4RNHA 3JSMB 2DKOB 1FD8A 2RIJA 5IM0A 2RT3A 3BO3A 2ZD1B 1NHKL 4WP8A 1RTDB 3JSRA 4H4MA 3W62A 1NMEB 1T7PA 3SI8A 1UEKA 4DX8H 2X1BA 3I6PA 1MG7A 3MMCA 1RT2A 3FEZA 1FX4A 1ZBTA 5I3UB 4CQ1A 1MLAA 2CPXA 1NB7A 1VBZA 2ZE2B 2WVFA 5AE3A 5AXLA 3GYGA 2HHHJ 2BW2A 1O5JA 3CB4A 2XYGB 3MMAB 3AB2B 3D6HB 2RH3A 3HCXA 2F63A 2K06A 4K2JA 3D3CJ 4LF8J 5L1JA 1UETA 2E5GA 3F41A 3BQ2A 4QIVA 4WKRA 2CYYA 3QT8A 5E3CA 3MOJB 4FP9A 3RBDA 4W98A 2R8HA 2NXCA 2DRBA 4H4MB 1D09B 4U9RA 4WJBA 2LQJA 3B4MA 3TYTA 1U1QA 1IWAA 2C2EA 1S6PA 1UKUA 4WYWA 2QZ8A 3MMCB 4NCGB 1NO8A 2ZC4A 1RT2B 1VQ6S 4ZVRB 5KG7A 2BKOA 1IBMF 4YS2A 2E9RX 3G4SS 1FJGF 1N5VA 1Q78A 2HK2A 4EK2A 2EVZA 1RT3A 4TN2A 3RAMA 3CCJS 4NLTA 4O3SA 2HFUA 4LT6A 1KFDA 3M8QA 4HEA9 4IDKB 4DN9A 2Y0BB 4P52A 3QFHA 1JWWA 1MWQA 2MKSA 2C3OA 1U1LA 2QA2A 2WONA 3R5CA 5H1SV 4DFKA 4RLEA 3ET6B 3TI0A 2CZ9A 1WACA 1ACMB 3TNVA 1I94F 4IKAA 4MAKA 2CDQA 1RAHB 1QLNA 5AE2A 3A3OB 4X4UA 1WKKA 3TP2A 4O0NA 4JV1A 4N77A 4NA3A 2JX2A 2YPYA 1JLFA 2H54B 1XERA 2XLJA 5FJ4A 2DEJA 3NNHA 4AT1B 3MR2A 2X1FA 3KUEA 5BYSA 1OJ4A 2CQBA 4KE5A 3MFHA 4NX9A 1VISA 3TUZC 4LF5J 2YKMA 4OHYA 3CCZA 4DR7F 1XMQJ 2MYFA 4OZ3A 2WONB 3JS9A 4RO0A 4Q8EA 1HA1A 1ZOTA 3VZHA 4ZIWA 1X0PA 4F4KA 3TX8A 2ABYA 2K3IA 2XHCA 1WD6A 2RS2A 3KTQA 2IIHA 2XB2D 2OP5A 1RADB 2DGOA 2EC2A 2HG4A 3L09A 1S1XB 1JLFB 1OYEA 2FZGB 3AJ2A 1IKYA 4R8UA 3LTOA 3DNCA 2YVSA 2I9SA 3KK1A 2RF2A 4P2XA 1DAXA 1TVRA 3TAPA 2BJ1A 4F26A 2RILA 2MPUA 2LEPA 4USKA 3OHBA 2YQ3A 4F0MA 4NWBA 2G1HA 1KS2A 2VQEF 5DQGA 2F4VJ 4DV1J 2DR7A 3T5KA 1O6XA 4V19X 1HLWA 3QGPA 2ZZMA 4I1TA 3W9JA 1MU2B 2VQFF 4R25A 4J9OA 2CQIA 4QWAA 1K44A 2E1PA 2N82B 4F4XA 3H2VE 1DARA 2P8IA 4LSLA 5HBMA 2F4FA 2FJAB 2B4PA 4EO8A 2J7KA 1IKYB 1IBLF 4C2MA 3I0SB 3KK1B 4QIWD 4LRBA 5B0AA 5IT9U 2ZM6F 3L9ZA 4X2BA 2F8HA 4X4QA 3IRWP 4K0KJ 2I0XA 1NKEA 2UUBF 3CCMS 3QLHA 3GYNA 2V9WA 3OL9A 3OFHA 3QT6A 3DOKB 2LXFA 1S9EA 3P45B 3FZBA 2Y1JA 1UFLA 3HHKA 2XBPA 1U45A 5HK4A 1N52B 5AT1B 4JI0J 3J81j 3OVBA 3K8VA 1NBEB 2AX0A 3GJQB 1RDRA 3IFEA 3DHXA 3CD6S 1JMTA 1B99A 4GKJF 3M2RB 3UCUP 4CLSA 3BBBA 4ZMMA 4RW7A 3OLBA 2ERRA 4JV2A 5EUHA 4OLPA 2CA9A 3OHAA 4PYDA 2VHGA 4Y0FA 2JVRA 2UXBF 3K0JA 1J5EJ 3BB5A 2NSBA 4NLRA 1NH7A 5J1EA 4ZP8A 2YKOA 4P7VA 1EARA 3I55S 4MTPA 5IV4A 1NU4A 3BO4A 3M2UB 1RHMB 1YIJS 4Z7YA 1Q95G 1Q81T 2V34A 1Q86T 3CDUA 1MROB 2DNPA 5KOWA 3H5SA 2K1RA 4M5DA 1WORA 5F0WA 3MR5A 3N6MA 2QEXS 2JOQA 3L7PA 5EX0A 3O3LA 1N33J 4ZP6A 5K14B 4MKBA 2QYCA 3C46A 5D15A 1WJ9A 3ELHA 4DR3F 4FXWA 3PW2A 2RSQA 2QLFB 2XHWA 4WFBQ 1I5OB 4F3MA 1HQ2A 3BSAA 2OTJS 5LMUF 1XWLA 1E6VA 2OSQA 5DS7A 1U4BA 4FF4A 3CJ8A 2J6SA 4CO0A 2OPPB 4DL2A 3PG9A 1N48A 1SXLA 3D1OA 1UVLA 4ANDA 3PYGA 3MFIA 3HXMA 1RBAA 3KJNB 2EI5A 2BJ9A 2FHMA 2J0SD 3TA2A 4QR0A 2K1RB 1NLKL 3CMAS 4G1QB 4M5DB 1F5AA 1VQMS 2GFFA 5KFCA 3B78A 5EWEA 1JLCA 4HTIA 5E3QA 4J90A 2R7UA 4ED2A 1FNMA 3V4MA 1BQNB 1R31A 1IJFB 2CIMA 4AE5A 1RTJA 4BCAA 1IWGA 3LW5C 4DV3J 2XM3A 2Z4PA 3MM6A 2BOPA 3JSYA 1UEUA 4C0BA 1B7FA 5CYMB 1VRTA 3O8WA 3H0PA 2HWHA 3ZO7A 2BM0A 2IMOA 1W2BR 2C2KB 4B3RJ 3NOCA 3CSKA 2X3GA 3N6LA 1R8PA 2R8GA 4TLQA 2MZ1A 2FVSA 2VG7B 4Q43A 3HPOA 1T3OA 1WSRA 2AYGA 1N88A 3CPWR 1RI7A 3CJ4A 2IAJA 3LWMA 4DSIA 5AXKA 2FLPA 3UVJA 4QR2A 1HNIA 1S7HA 3U1MA 2LCWA 1HHQA 1IKXB 4DU7A 2OLWA 2DNQA 4F4WA 2YH1A 1UTAA 4FF1A 3MCOA 2ZBPA 3V6JA 3M1VB 3ENAA 2NCKL 2WB1D 1RTJB 3QRPA 5A6WA 3R97A 1OQ3A 3D54A 2I38A 3N5FA 1ROFA 2JFKA 2W25A 3RRGA 1HNZF 1JNRB 5B0EA 2HLUA 4JI3F 4CNZA 2E1CA 2V8HA 4CM0A 4FF2A 1S1WA 1S0OA 2OGUA 3G8QA 4CT9A 1UJ6A 3HF5A 1P1LA 1PJ5A 2ZHBA 1KHVA 4FPIA 3OL6A 4WIIA 1RGVA 1S6QB 2IAJB 3D28A 4AUKA 2RRNA 1U1MA 3RRKA 4PRFA 2HRUA 2Q66A 2HZVA 4M8LA 4LFAJ 3SXLA 2C2MB 3SDEA 4OX9J 2LXUA 2VD3A 1SJ4P 4DSJA 1NJZA 3RG6A 2HWTA 1XNRF 1AT1B 3TZZA 1T95A 2J76E 2OSRA 4NLXA 4UOFA 1RHRB 2W9AA 2GX8A 3GJRB 3K17A 1XTZA 1PKUA 1PCAA 1PJ6A 4ANCA 2CWXA 1CSJA 3Q24A 1DHMA 4X4OA 5CYQA 2ZJRQ 4RW4A 1RP5A 2W2QP 3H7HB 5HL7Q 2V4RA 1R8HA 5E3PA 2HHVA 3H5XA 5KFMA 2DRAA 2V63A 2MKIA 3IS9A 5DDOC 4NZ6A 1KQKA 3CUNA 1SIZA 2IY5B 2KRBA 4MK8A 1SKUB 2MZRA 1ITPA 5A8KA 1VK3A 5THWA 3GIMA 4ZPTR 1N8RT 1EKRA 3EICA 1VCTA 4F50A 4ZCKA 5EWGA 5B09A 2IC3B 3W64A 4B02A 4RBVA 2DNOA 5HANA 4CYUB 3J7AN 1H7WA 2FJWA 4W90B 2FJVA 3AOAA 4DUYF 4HACA 3PEHA 1GX5A 3LGHA 2DNYA 4M5MA 3IMQJ 2B5JA 4BHQA 3THPA 3ZZTA 5C2CA 1Q8BA 4HHUA 4N47A 3AXMA 4PEOA 3QGIA 3SBMA 3IBWA 3SV3A 5CYQB 2ALYB 2W01A 4RW4B 2IVFB 3A8EA 2M7SA 1PC5A 1WEYA 4EEYA 4UOHA 1VQ9S 3EGZA 4J9MA 3TEGA 3LANA 3CGIA 1QD1A 3PCOB 1NRKA 5A8KB 4BS2A 5RUBA 3VWSA 2ZH7A 4OJ3A 3CCES 2RVJA 3MEDB 1KP6A 2CJYB 2ZITA 3I82A 5L46A 2YPZA 1TV6A 2KXFA 2X7IA 1BQMB 1ICEB 3O5TB 5DLFA 1FHTA 2AEFA 2DY1A 4WFAQ 2AW0A 2QL5B 1RAOA 1EP4B 4MK9A 4JI5J 1FRIA 3IBFB 3T1YJ 3DXSX 2VBWA 1MMLA 3MR3A 3SSRA 3HJVA 3QT5A 3H98A 3LALA 2ALZA 2FB0A 4ECZA 3DOMA 2M9KA 3I87A 1TAQA 3KWMA 1P9YA 4XO0A 3HT0A 2AEJA 5AJ3F 2LQ8A 2D74B 2WK4A 2PC6A 4RWXA 2MEWA 3M9MB 4B9SA 3PR4A 4FYWB 5DG7A 4DCOB 2LA6A 1S48A 1DBDA 1TV6B 3FSIA 2YKNA 2HFNA 4A8XA 2CJKA 1X5PA 1EJ7L 3NNAA 1VJQA 4DMZA 1P9QC 4ZVSB 3ICLA 2DNKA 3UR0A 3DI6A 1JKHA 2DCLA 4USVA 2CQGA 5GAEI 3Q0AA 3RBZA 2HGNA 4RUCA 2XO7A 3M6XA 2E9TA 3CE8A 5F8JA 1APSA 4O3RA 2DO0A 2GV1A 4HHHA 4E98A 1FFGB 4ZVUB 3BKUA 3HFVA 5GADU 3IC1A 2E9ZA 5I42A 4KFBA 3PRVA 4DR5J 2FC9A 2ZWPA 2LDYA 4NZ7A 1SJRA 1XC9A 3QIPB 5BJRA 2MGZA 1F5BA 4OV1A 2CQCA 3K5OA 1Q16B 3EVOA 2HFZA 4O23A 3V6HA 2W9CB 3RB0A 2HHWA 3D2WA 1TMMA 4NL5A 4EZ9A 2ACMA 4DR2J 5CXTA 2AIRB 3UD4P 2ZH3A 3NP5A 2KH9A 3G82A 3B6BA 1ZZFA 1J2VA 3JSBA 2HHHF 3RRHA 1EB0A 1RHQB 1M5KC 1VQLS 1LW2B 2D3ZA 2JZ5A 3O44A 1H2TZ 2GJFA 3GSIA 3OUYA 1Y10A 5HMWA 3S1TA 1HI8A 3MUMP 2DB1A 1FFSB 1W2IA 4BC9A 1HFEL 2Z30B 1DFDA 4F3OA 3MM9A 1RWXB 4PR6A 2AT1B 1Z4UA 2R7XA 1XJWB 3P5BP 1FRLA 4KSEB 4KQZA 3I4PA 1JJHA 2Y9HA 2OIHA 4M5GA 2ZBQA 3S7RA 4GVBA 3TR5A 1C0UA 2JEIA 2B8PA 4V1Ak 5L8RC 1T9UA 3GMGA 1WHVA 2RHQB 3KFWX 4J9UE 5DZ6A 5T14A 2YX7A 1ZPVA 2CXEA 2QYGA 1WTFA 4QBUA 1HKAA 1QTMA 4NLGA 1WOSA 3OUYB 1B0TA 2QO3A 3PFOA 2B9WA 1GMUA 4PKDB 1FA0A 3DMJA 1FRJA 3MM9B 4LQ9A 4YEAA 1M5HA 4K4SA 2OFGX 1FRMA 4K2XA 4OIXA 2ZDOA 3DRPA 3DKDA 2LEBA 4USIA 2XS5A 1S1TB 2RNEA 2VG5A 2R7VA 4U7CA 4JUZA 2OFHX 1AYEA 1RKJA 2M5YA 1KWMA 1SJ3P 1YITS 1OSCA 2YKPA 5A8WA 4L75A 1QAXA 4LF5F 4NLOA 2Q6BA 3GU0A 4MJKA 3KJQB 1FRHA 2JLEA 1SL1A 1PIEA 5E3RA 1KEKA 2OI2A 1SC3B 5FDLA 5L9XA 1NM2A 1ZAVA 2ILYA 3DMJB 3I0RA 3QO9A 3CO9A 3MEKA 5DQHA 4Y34A 2U1AA 1WI6A 3NS7B 2G2ZA 2MQPA 1JLGA 1KTVA 3AQPA 4A8MP 4ZLJA 1NSQA 3DRPB 4EGLA 3WZ0A 1HHTP 2W2NP 4ZVGA 1HNWJ 4O44A 3NMRA 1EZZB 3IBCB 1E6YA 3D9BA 2QMWA 2WW4A 2GVDA 1Q7YT 1QJHA 1RQ0A 2PIIA 3TAMB 2F4VF 1URNA 1LK7A 4DV1F 2VPYB 1X9SA 5FDLB 4ECTA 2VC0A 4Q44A 5EN1A 2VBZA 3I0RB 3QO9B 4Q8FA 1UW4A 3SEOA 5KFVA 2IA6A 4F0HA 2J7WA 3R5BA 4A46A 3RBEA 2IVYA 1X7VA 1RT1B 1KVKA 3CWJA 4QWEA 7FDRA 5IT9Y 1U02A 1K8AT 3M9NB 4CI0B 4CIOA 5GAHU 3K5MA 3AB4B 2DPIA 1NJYA 4O44B 4K0KF 4FXDA 1E6YB 2YTCA 1H3DA 2ZNYA 2HAFA 3JYTA 4WE1A 2F8MA 3JTPA 1MWYA 4KIAA 3M6WA 1NZAA 1D1UA 3CNQP 4U67Q 4IG0B 4M5KA 2FYXA 5FD1A 3D1HA 1L3UA 2XEXA 3DRSB 2UVWA 3NG8A 1SC1B 1DURA 3DLKA 3GFHA 4HH1A 1SKSA 1GXUA 3CJ2A 3GG1A 1W26A 3PXGa 2IJRA 4NLUA 2G0JA 1OSDA 5FLXY 3SQGA 5H9FK 3P6YC 1R0AA 2J9DA 3ETOA 3QIDA 3V4IA 3MECB 5KFRA 5ETOA 1J5EF 4DDFA 1FE4A 1SH0A 4ZIVA 2XTJP 4OJ1A 1YBTA 4OX8A 4YB7A 3F56A 5H9EK 2HFSA 5J2MA 4MKYA 1PC4A 4JI1J 1U8SA 5B0DA 4N76A 5HATA 4ZITA 1OY9A 2IYIA 4DQPA 1BMQB 2KZMA 1HARA 2KXNB 4DCPB 3LAMA 3G6ES 3DLKB 3EWGA 1N33F 3KXDA 2W2OP 5KFXA 3RGIA 3ENWA 3SQGB 1S7IA 1R0AB 2W4CA 4H4KA 2DHXA 3CD0A 3FKBA 3DLBA 2V8DA 3L7OA 3W2VA 1WWHA 4DV2J 2JEFA 4OI6A 1CULB 4AQYJ 1YLXA 1R0BG 4JI2F 3WX4A 1KOOA 1RYSA 4WU2A 3ETMA 2J5AA 2DNGA 3MTKA 1N5TA 5EHHA 4JI8F 3K5LA 2HMIA 5J2MB 3KNAA 2QLJB 1FO1A 4CLYA 3M8WA 4K7QA 5M2RA 4ZVEA 3NLCA 1JJCB 2GHPA 2WZ1A 2ZJQQ 1NDPA 4CLPA 5E2QA 4I7FA 3PKYA 1F5CA 3SMZA 3K59A 1HBOA 3IM9A 3TOQA 2KT5A 3FSXA 1D9FA 3TZWA 3BKFA 1IKVA 3D6TB 3R7NB 5C5JA 1YTYA 4LUBA 5KFAA 4ID8A 4J9SA 1U1OA 2BE9B 3GV8B 1PYTA 3I31A 1L3KA 3W2VB 3FQLA 3IN5A 1T05A 2HHTA 4FZVA 4KPCA 1R27B 4B3RF 1S12A 1S59A 2A0FB 3OR1A 3MEGA 3CJSA 4ZKAA 4USTA 1TK0A 3P49B 3ILJA 2HMIB 5KFEA 3KLEB 7AT1B 2KM8C 4I6YA 3DLEA 2KN4A 1M1GA 1SC6A 4USMA 4EYIB 4NLPA 2KT3A 3CCLS 2DR8A 4I7FB 4UY85 1JLAA 4LIRA 1ZTWA 5DG9A 4MIBA 2GQ2A 3NXZA 5KFJA 1HNVB 3C66A 1OY6A 2X51A 2YNGA 5LL6d 1VC5A 1OS5A 4CH1A 3BKTA 3CCTA 2WOMA 2N3LA 3CTRA 5KFYA 1XR7A 2ILZA 4ZPDA 2R3VA 2HVDA 1LQ9A 2OEMA 1DY3A 1T05B 1LFWA 4KGMA 3TJ9A 4CCHA 3OR1B 4NMXA 2POKA 4PUOA 4JI4F 4ZCMA 5KFDA 4IOAQ 4IQMA 3QQCD 2DNMA 2K8GA 2DNLA 5KG0A 1QSSA 4OZ2A 1RABB 5HI7A 3MD1A 3DLEB 3CJRA 8AT1B 3EMTA 2DIUA 2QSWA 2BA9A 4URSA 2F8EX 4OX9F 3BSNA 3HSZA 1EX8A 5HQMA 5KFNA 5ETLA 1LFPA 5F9NA 4EI2A 1HNXJ 2CJ9A 2BM1A 1FRKA 2WOMB 2MLXA 4QWDA 1QSYA 1N36F 3LPEA 2LKZA 4DSLA 3N0VA 1KN6A 2VBXA 3IR6B 3R1LA 1G3OA 2HIQA 3EDQB 2A10A 2R7RA 2ZWOA 4WXWA 1GH8A 1GMWA 2EPIA 2MQMA 4PUOB 4LF9J 4N7TA 1U0HB 1NDLA 5L1KA 4USUA 3K58A 4M5IA 3NMAA 4UW2A 4GC6A 3RAXA 4NE9C 3CJ3A 1VRUB 1NJIT 2I5JA 4DSKA 3Q2SC 2GO8A 3US5A 3GILA 4DL3A 5GAGI 3OSNA 4ES3A 1RLDA 1NB2A 1JLBB 3PVXA 2DRDA 1Q8LA 2M0GB 2DNHA 4QYZK 1HD0A 3DC2A 4ZP7A 4WFNQ 1U2FA 2H5IB 3HLUA 4ZVPB 4DPYA 3THTA 4ZS6A 2QSFA 2V8GA 3GE9A 3NCQA 4PABA 3JTNA 5EDWA 3P96A 4J9NA 2AJ4A 1NSAA 4K5SA 2CAJA 5F41A 2RU3A 1VI7A 1K1QA 2O67A 2V67A 2XC9A 2COLA 4G65A 1HI0P 4IR9A 3TZYA 1Y11A 2I5JB 3DM2A 3A4TA 3A3PB 1SV5A 5B7WA 3HM9A 3PX0A 4MKAA 3EGWB 1TUWA 3GJTB 2FGOA 2KT2A 1FVQA 4OYPA 2DXFA 3W60A 1YRUA 2UV8G 2RB7A 3FK4A 1YSJA 4OV6A 4NEYA 2LMIA 1RBLA 3DHWC 4CT8A 5IXUA 5KG4A 3NAIA 2ZOFA 5HMZA 1V6HA 4JI5F 4RR5A 3GP9A 5ITHA 3G6XA 3T1YF 3NBPB 4L3NA 4NMLA 2YKQA 1U0SA 3KNGA 3CF5Q 1PYSB 4WTOB 5F8IA 1YBAA 4A4JA 3GIJA 4OYOA 1K1SA 5KFIA 3DM2B 2J0QD 2XWXA 1SV5B 2Z57B 3OTOJ 2I8EA 1Y5NB 4F02A 4C97A 4PWUA 2OO4A 2IRUA 5E3AA 2ZH4A 4PWDB 3WC2A 3S8SA 4IFYA 4C3LA 3T9ZA 4ERDA 3K57A 1RAFB 3VQTA 1JXEA 4ECVA 1WC6A 3FBBA 5ETPA 1LWCA 2UXDJ 3FCHA 1BHNA 1FWPA 3PO5A 3CD7A 5HQ8A 2BV3A 2XI3A 4Z2XA 5JVHQ 5F3ZA 1LEOA 2E5LF 3KOAA 3UR3C 4CLKA 2F5GA 2OAUA 4U8VA 4HR2A 4HTJA 2V8VA 3R5AA 4W92B 2EFPA 5GMKa 4H54A 2CJXB 3ZZRA 3VF0B 2XS7A 1IKWA 1FKPA 2LDIA 4FNIA 4DR5F 4RW9A 1VQ5S 2OPSA 1H7XA 3BDPA 4O3NA 3M8PA 2DHSA 2XNRA 1D8YA 2V6AA 2HQCA 4CZCA 3NGUA 3MMJA 4IFYB 1SL2A 1C4CA 1DQ9A 3SCIE 5B0GA 3TA1A 2UZAA 4LF4F 2YY3A 1U48A 3HFKA 3SZ2A 3PW0A 2GGPB 1S6OA 2F65A 2P6SA 2VL1A 1J27A 2WVEA 2N4DA 2IM2A 2UUCJ 1FEHA 3AD7C 5T7LA 3HVTA 3QJJA 2JLGA 3EZOA 4LSNA 1VQKS 3TWZA 4G3IA 3OXFA 5C24A 3R2CJ 1FKPB 4RW9B 4ETZA 2V69A 4DFJA 3CJQA 3QRRA 3M8PB 3FBEA 1Y5LB 2DO4A 2Q79A 2CWKA 4B3SJ 1Z1ZA 4USJC 1NK7A 2PO4A 3GFYA 1YVFA 3M30B 4O3OA 3EGVA 1QUVA 4OHZA 4M5HA 3PHEA 4ID5A 2M3DA 1TKTA 2V2VA 4BLGA 3V81A 4FXVA 2FTRA 2OJ3A 4OLOA 1Z2ZA 4WZQA 2JC0A 3HVTB 1NPPA 4CLTA 3B4DA 2ATCB 2C3MA 1VQ8S 2QT7A 3OXLA 4ZCLA 3KK2A 3BN4A 2MY8A 5C24B 4YP3A 1CC7A 2XCAA 4OI0A 3EDRB 2WVCA 1WDTA 1YRXA 2RD5C 2ZC3A 4PG8A 2VFSA 2R4FA 2G0CA 1F1BB 4PXEA 1C0TA 1HBMA 3TARA 2P5VA 3OT9A 2E7WA 3AD9C 2BRKA 4RPFA 2AYEA 4ID5B 2GIRA 1ZM4A 1TKTB 2HGLA 1ZYQA 4ITSA 1VBKA 2AU0A 2YQ0A 2FHJA 1S79A 3G2XA 4OI4A 5J1PA 4ZN3A 4DS4A 2HFOA 4FBUA 5KT6A 3RW6A 2MQLA 3MHYA 2YH0A 3KK2B 3CXCR 2EKYA 2H5JB 3BGLA 2N3OA 1FKOB 3FMBA 4IO1A 3VHQA 1UFWA 1AZSA 4DR1J 1BQXA 2A2CA 2UU9J 2FC8A 4LJMA 5F8HA 1KNZA 2P6TA 4DL7A 4YY3J 1YZ7A 4X4NA 1KDNA 3LP1A 3PX6A 4C8KA 4FDFA 1C0TB 3MF5A 3ZC4A 3Q8YA 2GAGC 2YKAA 4M5JA 2A2DA 5J2PB 3KLHA 3UNYA 4L74A 4OZ5A 2OHDA 4FF3A 1KVIA 5DDPC 2M4MA 1RK8A 1WKLA 5KFUA 5KFHA 2CQ4A 5AE1A 2BMBA 2RKIA 4HI2A 3QWPA 3C3LA 1HNWF 5SZTA 1A0OB 2XY6A 4LF1A 1JQGA 3E8OA 2N7CA 5KFFA 3HHLA 2J9CA 2EKNA 3W61A 3KLIB 3KHLA 4YUDA 1C4AA 4KHPJ 4PXDA 1AZSB 2DH8A 3BJYA 3NCPA 3IG1A 2NPIA 2YNFA 3PJXA 3E51A 2KJWA 4ZA1A 1IR2A 1A7GE 2EFQA 1K0VA 2MQ8A 4JI7J 1X4CA 3PW4A 2BQRA 3NWGA 4ELTA 1NK0A 4YDDB 1MN9A 1TFWA 3EJMA 1X4GA 1G4CA 5J2NA 4JV5J 2O1PA 2HVEA 1RBOB 2RKIB 1U6ZA 1T11A 1U7LA 3MR6A 5K8OA 3D0HE 1ZS6A 3PHTA 2N4CA 3CIZA 3WBZA 4LF6J 3HHLB 1VQYA 4I2PA 4EFAC 1WI8A 4TXSA 3C6UA 3BGFA 2QL9B 4TY8B 2GAHC 2B8QA 3IG1B 1PBAA 1C1BA 2UV8A 3KG1A 4ECRA 1IQTA 5K8NA 1RT6B 1TZ0A 2HNDA 3PW5A 1SL0A 1LW0B 1T94A 4GRSA 3D5MA 3PFEA 4IFVA 5KFKA 4DOZA 4DQRA 2IM3A 2G4BA 1W25A 4Y28C 4P2MA 1S99A 4O0IA 4XPEA 1RHJB 3J7YI 4K4ZA 2P2CB 3FUYA 2IRYA 1TUGB 3Q86A 1G1XA 4J9VA 1YKWA 1KRPA 2J9EA 2QA4G 1YGYA 3CCUS 2ZEJA 1VMBA 2VF3A 3AA8A 4J9QA 5F8LA 1IQZA 1T03B 4DSFA 4TVAB 4ELUA 1C1BB 3UI3A 1VLYA 4LQ3A 3BH6B 4A8OA 2H48B 1SB6A 2DY9A 5H9FJ 2DXDA 1NK6A 4TU9A 2LECA 4DJBA 1UZDA 1IBKF 1T9TA 2KHDA 2KB2A 4RBTA 4K4WA 3FFIA 3PRDA 5E33A 4E0DA 1VYAA 3R6LB 2C3PA 4L3KA 5EWFA 2CVEA 5H9EJ 3OFEA 4A8WA 3KJFB 4AQYF 1RXOB 1YHQS 1A6LA 1X5TA 2CQHA 3J80Y 6AT1B 2PMWA 4IOBA 2Z2LA 1MMNA 1HL6A 1CJKB 4FS1A 4N8NA 1RAEB 4BWJA 3MPUB 1FX2A 1BD6A 4DPWA 1RISA 1KC8T 5C7PA 1Q8KA 4JBCA 2RRBA 2EK6A 3EXCX 3FFIB 4DWIA 4DN0A 1WEXA 3WDOA 1I51B 1NKBA 3B82A 2QA4S 1JLEA 4ALZA 3BPSP 1HQEA 4TLRA 1S4FA 4MFBA 5HVFA 2W7AA 3JSMA 3DU6A 3EYZA 4DPUA 2B3TB 1RWMB 4PXBA 3OTDA 2ZD1A 1L3VA 2RE1A 2HHQA 1YJ9S 3T1AA 5HMYA 2QN6B 4DV4J 1BGXT 3EPIA
chains in the Genus database with same CATH topology
4DV0F 2BABA 2W9CB 4C8OA 2CPYA 1S1UA 1YJWS 3FMWA 1FNOA 5LSLA 4ILLA 3RB0A 2HHWA 5JXSA 5GAHI 5LT5A 3D2WA 1HNVA 4NL5A 1UVNA 1Y5IB 1P1TA 3V2UC 1RT5A 3R1HA 4EZ9A 2DGVA 5B0FA 3S6EA 3RR8A 1UWBA 3K5PA 2JLFA 5CXTA 2NS1B 4UUXA 5F0UA 4IOCQ 3UD4P 5J1EB 2ZH3A 4DV3F 2XSFA 5I3UA 4QW8A 2HYIB 3HHLD 2OPQB 2MQOA 3H8YA 3NP5A 4KC5A 3BSCA 2KH9A 1N54B 4N41A 5CHCB 2ZE2A 1Q1KA 3KJVA 4Y00A 3IWXA 4KRWA 2L08A 5ADZA 1S1VA 3FJ2A 5F8NA 1ZZFA 1J2VA 3JSBA 2HHHF 3RRHA 2J0XA 3PKMA 3MWBA 4RNMA 5JUMA 2YNHB 1RT7A 2M70A 3N5BA 4CO5A 4CTAA 3QZ8A 3V6DB 1VQLS 1M5KC 1LW2B 2IA0A 3N79A 1RTIA 2AGOA 2XS2A 2D3ZA 2MZJA 3D0GE 3H2LA 5T7LB 2ASJA 2JZ5A 3O44A 4DHVA 3ONQA 3CVKA 1D9DA 2R8JA 1S0VA 3ZZYA 1H2TZ 4IUFA 5G0RA 4LSNB 1D9AA 1XK8A 3GV5B 3L95X 2W9BB 3OUYA 5DG8A 3HI9A 5HMWA 2CPHA 3S1TA 1LWFA 4D3GA 1C1CA 1HI8A 2PA8D 4X4TA 3UNGC 3KLGB 3MUMP 2AGPA 2DB1A 2ZKUA 1W2IA 2RQ4A 4BC9A 3M8RA 1AXQA 1R8BA 2ACYA 3G71S 2YWHA 1TL1A 2VG6B 2BR0A 2HHUA 1HFEL 2FHOB 3K5NA 1YJTA 2MJUA 2OD6A 1R8CA 3HHLC 1FXRA 5A2QY 1DFDA 2JSXA 4ECYA 2V4JB 3CJKA 4I4BA 4QPXA 4F3OA 3MM9A 4WYLA 1S1UB 2E44A 3AH6A 4KO0A 3V6KA 4LFCF 1NNDA 4PR6A 1RTHB 1Z4UA 2MHNA 1E6VB 4ZPBA 4NCGA 4A48A 3Q8SB 1RT5B 4A8SA 1LV5A 1QE1A 1UEVA 2R7XA 1CQMA 1FRLA 1UWBB 3TUJC 4KSEB 1DTQA 4KQZA 3RW7A 3U1LA 3I4PA 2KVIA 1LWEA 4ATNA 2DR5A 1FJ7A 1JJHA 2HNZA 2OIHA 3D1QA 1YJUA 2E1AA 3E01A 4GMKA 3I9V9 1TKZA 3S7RA 1VJWA 3MM7B 5I3PA 3TR5A 3KJVB 1B0PA 3I5BA 1C0UA 3FGVA 2GW8A 2JEIA 1S1VB 5L8RC 3GMGA 1WHVA 3I32A 3TA0A 3GR1A 4OHWA 4F67A 3V81B 4JOUA 4NLYA 1RT7B 1H6KX 3KFWX 4CTAB 3N4WA 3PW7A 2VH7A 2CQPA 3NCRA 3HT3A 1RTIB 5T14A 3EGNA 2E66A 2YX7A 4YB6A 1ZPVA 2FJBB 1S10A 1TK5A 2RQKA 2WTFA 4IDKA 5L38A 1WTFA 4QIFA 4QBUA 3W7BA 1QTMA 2IBKA 4LF9F 4NLGA 2IBOA 2FPHX 3DLLQ 3O2IA 5J2QA 2VC1A 2CG4A 1JLCB 1C2PA 4WXOA 3OUYB 4B9MA 5BYRA 1P8GA 2R2TA 1SJ1A 5KFTA 3H59A 3J7YU 1L5UA 2CPFA 4XK8C 1B0TA 1C1CB 1KOHA 5DRKA 2QO3A 4WK3A 3PFOA 1T02A 4PCQA 4X4VA 1UMJA 4EYHB 2B9WA 2EFGA 2QIFA 2Q43A 3KMQA 4LFAF 1DJ0A 4PKDB 1TL1B 2ZBCA 4WZMA 4C9DA 3OVSA 5IFMA 2EG1A 1VRUA 3TO8A 1FA0A 2A1BA 3MM6B 2J8AA 3CJKB 1HPZA 2L9WA 4O3QA 2DTJA 2CJBA 3DMJA 1FRJA 3AAWB 3MM9B 2UVUA 2IM0A 3Q22A 1KONA 4LQ9A 4ELVA 4KO0B 4YEAA 3KG0A 2GQQA 2CJAA 1VRTB 2VPWB 1HBMB 2LQBA 2XMJA 3OTBA 3SSQA 3BF4A 3OW2R 4Y65A 3TVYA 3FRYA 2A18A 1JXLA 1B64A 4YMEA 1M5HA 2KDOA 1DTQB 4QW9A 4M63A 5D4LA 1JLBA 4K4SA 2RJZA 1LWEB 2NLWA 3DRXA 2OFGX 3DDNA 1FRMA 4OI1A 2HNZB 2XLKA 5LXRA 2W4DA 3E01B 4AL7A 4K2XA 1TKZB 2WW8A 2ZDOA 4OIXA 5IQ6A 3DRPA 2WSCC 2GIQA 1VC6A 2LEBA 4JI7F 2WSEC 2IMWP 4USIA 2XS5A 1X4AA 2W24A 3FNNA 3CCQS 2FD2A 4Q2LA 1S1TB 2RNEA 2IM1A 2VG5A 2XWYA 3CT9A 3MMBB 3OFFA 4KT0C 4U7CA 4B9NA 1VQ4S 4JUZA 2R7VA 2CPIA 3CULA 2OFHX 1RKJA 2M5YA 1SJ3P 2AYBA 1UA0A 2JH3A 2MMYA 5F9LA 2NXUA 4ZPVR 3UPFA 3HKWA 1YITS 3QGGA 1OSCA 3IGVA 5GVQA 2J6TA 1HNIB 2CQ2A 2E5HA 4AXJA 4ED8A 4M94A 1WNEA 1MW7A 2YKPA 3MCSA 4IH5A 3PDNA 4NLVA 3HVAA 5A8WA 2LXIA 2JC1A 1CQNA 3KLVA 2WAQD 1QAXA 2IVMA 4F3QA 4LF5F 3N28A 4NLOA 1LXNA 2Q6BA 1N5YA 4B3OA 2F9DA 2GJIA 2V2KA 2Y1RI 4MH8A 4MJKA 4DL5A 2VUGA 1FRHA 4WK1A 3OXGA 1X4BA 2JLEA 4Q45A 2MZQA 2F3JA 5E3RA 1SL1A 3LOUA 1HWJA 2KG0A 1KEKA 5E41A 3VTIA 5FDLA 4LVOP 2KKHA 3QAEA 5L9XA 5DGAA 2VODA 5CZXA 3VCDA 1ZAVA 5I3QA 3UWTA 1HPZB 1MWZA 2ILYA 4QYZJ 1R89A 3DMJB 1TL4A 3I0RA 4L72B 3LP1B 3QO9A 3E3XA 2W7PA 3G8TA 1GNKA 3CO9A 3MEKA 5DQHA 2HZCA 4Y34A 5DGBA 2XMMA 4QZVB 1VGYA 1TQLA 2U1AA 2CQDA 1KQFB 3H2UB 1WI6A 2VPZB 3VAKA 1H2VZ 2CZVC 3HVWA 2BACA 1U47A 2HNYA 2MQPA 4Z37A 1JLGA 1S6UA 4TQRA 3I56S 1S1XA 2PT0A 2MB0B 3KLHB 1KTVA 2VOOA 1WELA 3AQPA 1IUJA 2FLOA 1D3WA 4A8MP 2DNZA 4ED6A 1QM9A 2VASA 2CQ1A 3DRPB 4XIUA 1S1WB 4EGLA 2HLTA 2EBEA 4KR0B 2JRSA 5CCLA 1X4DA 3WZ0A 4ILMA 2XMWA 3UD3P 3VALA 2G1DA 2APOA 2UUWA 2KHCA 3LF0A 4PQAA 1NK8A 4LF7F 1HHTP 3ZZ0A 2MHEA 2RU9A 1X9MA 4ZVGA 3ZZPA 2ZH5A 2KM8B 2KXHA 4OZLA 5MLCV 1X4EA 3HZGA 4O44A 2JEGA 3GV7B 3NMRA 2BRLA 2M8HA 1E6YA 2VKRA 2MSSA 3PJWA 2D1CA 2QMWA 5GAEU 3HP6A 3SDEB 4HVZA 5KT4A 5BR8F 3NBPA 2FDNA 4IR1A 2CVIA 1Q7YT 3OTCA 4IRCA 1QJHA 3IWNC 3PACA 4NLQA 4OHVA 1RQ0A 2PIIA 2VBYA 1N5YB 3TAMB 4X4PA 5LXYA 3RAQA 5K9FA 3VAJA 2ZOMA 2F4VF 4R0EA 1LK7A 2LU1A 1URNA 1WG4A 2YNFB 4DV1F 1BC6A 1FDNA 5LSOA 2VPYB 4C4WA 5JJBA 2EW9A 1X9SA 5FDLB 4X64F 2VC0A 3VAIA 4ECTA 1HYSA 4Q44A 5EN1A 3BGRB 4RNFA 1SJQA 2MSTA 1WF2A 2VBZA 3I0RB 5KG1A 3DLGA 4ZP9A 4EBCA 3QO9B 2FGCA 1MU2A 2JL9A 1Y9OA 4Q8FA 4KJIA 1UW4A 2GA7A 3SEOA 5KFVA 2IA6A 2OPRA 4KHMA 2QFJA 5D6GA 1YJVA 3ENQA 2J7WA 1N6QA 3R5BA 1UVMA 5A6PA 3QGHA 3OTOF 4A46A 3RBEA 2IVYA 3CMES 4HH0A 1UA1A 3HJFA 1RWUA 2HNYB 4JI6F 2B9XA 4JYAF 1ZAWA 2I2YA 3GYXB 1X7VA 1DQ8A 1RT1B 2FJDB 3PEJA 4O4GA 3Q8RB 4K4TA 3FZ2A 4PWDA 2L3MA 3CWJA 4ED3A 4QWEA 4AL5A 1Q53A 2B4VA 2QMXA 4RW8A 7FDRA 5IT9Y 1N4LA 4I6AA 1K8AT 2IFXA 3MZIA 5CZVA 5J2NB 3M9NB 2AYMA 3I0SA 2BQUA 2KI2A 4CI0B 4CIOA 5GAHU 2KYXA 3K5MA 4NRUA 3VAHA 1SKRA 3IR7B 3MPVA 2W4PA 3AB4B 2DPIA 1M0SA 4DS5A 2GHVC 1NJYA 4O44B 4O4RA 4K0KF 3HK2A 4FXDA 3M9OB 3IS9B 2UXDF 4BBYA 4P7TA 1E6YB 2V9KA 2YTCA 5LJ5Y 5KG5A 2J6UA 2RUGA 4G1IA 1H3DA 2ZNYA 3JYTA 5J1NA 1XEZA 3JTOA 1XR6A 3TW0A 3KHGA 3PX4A 4WE1A 3IR5B 2F8MA 3NGKA 4I2PB 1WTBA 2XZWA 3JTPA 3K2YA 1ZTTA 3DOKA 2ROEA 1PO6A 1G6BA 1BWEA 4UUWA 3AQOA 2VFTA 1Y0HA 1MWYA 3DDKA 4KIAA 1NHUA 3CCRS 3C6UB 3FVYA 3R5DA 2DGSA 2CPDA 5C25A 4NLDA 5DQIA 1DZ5A 3VAMA 4YB1P 3M6WA 4RKUC 1NZAA 2Z0GA 1UJ4A 3MUVP 4FPRA 5K8MA 1D1UA 3H25A 1FJEB 2FY1A 4U67Q 4ZVHA 1TKDA 4A8FA 4WF9Q 4IG0B 5HLFA 2CQ0A 1HYSB 3OR2A 2W8LA 1N5QA 3MPYA 5FD1A 2R7WA 4J9KA 4DF4A 3D1HA 4QOTA 2HNDB 1L3UA 2XEXA 3DRSB 2KTQA 2UVWA 4IG3A 3NG8A 2OH2A 4HYKA 1DURA 3DLKA 3GFHA 3TUIC 3M2RA 4RNNA 2L9DA 4HH1A 2OPRB 1U1RA 1SKSA 4PQUB 1DQAA 1NHVA 1GXUA 3CJ2A 3GG1A 1N6QB 3PXGa 1KVJA 4IFVB 1U25A 5I4MA 1OQ6A 2EK1A 1LOUA 1VHFA 4HI1A 2B5JB 4NLUA 1OSDA 2FVCA 2WBRA 3SQGA 5FLXY 4QWCA 3UCGA 3P6YC 2CKWA 4O4GB 1R0AA 3THVA 2XSJA 2MJNA 2J9DA 3I96A 2QLWA 4AL6A 3ETOA 2MQNA 4MIWA 5C42A 4RW8B 1KR4A 3QIDA 2PMZD 2M8DB 1PSDA 5AXMA 4CH0S 3V4IA 1K73T 3MECB 5KFRA 4TU7A 1J5EF 2LQ9A 3BEGB 5D78A 1FJCA 4DDFA 4URGA 3BR8A 3EUNA 1Q79A 1DRZA 3Q8PB 1FE4A 4ECQA 3CC7S 1SH0A 3J7ZT 2IJFA 2XMTA 4DUZF 2DITA 2F9JA 4A8YA 3GFXA 3BS9A 4OJ1A 5L39A 2HAIA 4OX8A 4J9LA 4UOCA 4B17A 4X66F 1U2RA 3F56A 3DYAA 3O1LA 4YB7A 3UW1A 4NXNF 2PD1A 4OFZA 2GGPA 2E29A 3HHEA 5J2MA 4MKYA 1PC4A 4ZOSA 1CG2A 1RYRA 4RU2A 1TR0A 3M2UA 2J7UA 4I0WA 3FEXB 1U8SA 5B0DA 3ZFVA 3BREA 2QA1A 5CH7B 1XMOF 1TL3A 4N76A 4Q5VA 4N8OA 5C25B 2UUCF 1MROA 2WRMA 2IYIA 4DQPA 2KZMA 4PXCA 1HARA 2WCXA 3DRRB 2KXNB 4OI2A 2VFRA 2O01C 4UY8T 2OKQA 2HPUA 2O66A 4O3PA 3I9ZA 3EPGA 5HLFB 1AROP 3LP2A 2U2FA 1SQEA 2DGUA 1UVIA 2VONA 3LAMA 2HVHA 2AJ1A 5DM6Q 2X1GA 3CDAA 4ZVFA 1NK9A 4MYUA 2FHJD 1SUQA 4IG3B 2HVZA 3G6ES 3DLKB 1VS3A 5K14A 1XNQF 4CH7A 1N33F 5G4DA 2YWFA 3TAQA 4QU6A 2XY7A 4C11A 4ZDNA 1IR0A 1Y7PA 4Y2AA 5KFXA 2VFVA 3ENWA 5AXNA 3SQGB 5MAOA 2PI5A 2GMHA 1R0AB 2R8KA 5KTQA 2W4CA 1Q7LB 1FVSA 2XSJB 3DXBA 4H4KA 2DHXA 3CD0A 3DLBA 4DQIA 2V8DA 4DV4F 3L7OA 5C42B 3C6TA 2H5EA 4K5RA 3W2VA 2C28A 4MMOA 4YR0A 4OZNA 1WWHA 2JEFA 1R8AA 4OI6A 4B3TF 4G6VB 4U6PA 1HWLA 3M30A 2QE5A 2ZKTA 2GHWA 4DR2F 2X1AA 2OPPA 2XMKA 4I2QA 1U6FA 3V5RA 4LMZA 1WHWA 5EX3A 2FJEB 5CQGA 2FVPA 3GB0A 3GWCA 4JI2F 3PIPQ 1QVGR 4KTQA 4RUHA 3NRBA 3WX4A 1KOOA 3LGNA 4QYRA 3PR5B 3SFGA 1RYSA 5IZHA 3PV8A 4WU2A 3DYAB 1X9WA 4FS2A 4TQSA 4A8QA 5HROB 2J5AA 1JNZB 2DNGA 1N5TA 3MTKA 5EHHA 3DLJA 1SJFA 3OQ2A 4JI8F 3K5LA 2HMIA 5J2MB 2L41A 3KNAA 4I68A 3M4XA 4PPZA 3LP0A 4NLWA 4OJGA 4ZK7M 4QU7A 2W7OA 1FO1A 3OSPA 1ZH5A 2GO9A 4YQWA 1HWIA 1GAOA 1TL3B 4PPDA 4ZVEA 1V3ZA 5M2RA 4ES2A 1U1NA 1RTDA 4UQGA 2BJEA 2PMHA 3NLCA 2ZJQQ 2GHPA 4NA1A 1TAUA 3BQ1A 1J5OB 5E2QA 1YQHA 4G1QA 4I7FA 3PKYA 1F5CA 1WHYA 1TK8A 2MXYA 4R0JA 3SMZA 2RS8A 3LP2B 1HBOA 2YKNB 3TOQA 3K59A 3MXHP 3MOZA 2KT5A 3FSXA 1JX4A 2GCFA 2K7KA 3U02A 1D9FA 1IKVA 1BQNA 2Q3PA 1R6YA 1FESA 4LVNP 4LFBF 4A47A 5C5JA 4DV5F 4C11B 1YTYA 4YR3A 1LK5A 4NYZA 2HHSA 4LUBA 5KFAA 1HMVA 4MIAA 1HW9A 4OQJA 4XDDA 4ID8A 4DEZA 4J9SA 4KPYA 2UP1A 1U1OA 3DI6B 1JKHB 3GV8B 3I31A 3HHNB 3BO2A 2MDAA 4ECWA 1L3KA 3MD3A 4ES1A 3TQ1A 1KSPA 3C6TB 4DSEA 3W2VB 4DPOA 5CYMA 3DN9A 2DHGA 3H20A 2RQMA 2CZ4A 3RU0A 4F4YA 5D3GB 1JLEB 4OHXA 3MURP 5D4OA 3FQLA 3IN5A 1T05A 3MMAA 3P3DA 4FZVA 3J7Z5 2HHT