3MI7X

An enhanced repressor of human papillomavirus e2 protein
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
82
structure length
81
Chain Sequence
NTTPIVELKGDANTLKCLRYRFKKHSTLYTAVSSTWHWTGHNVKKSAIVTLTYDSEWQRDQFLSQVKIPKTITVSTGFMSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Regulatory protein E2
publication title Design and characterization of an enhanced repressor of human papillomavirus E2 protein.
pubmed doi rcsb
source organism Human papillomavirus type 16
total genus 19
structure length 81
sequence length 82
ec nomenclature
pdb deposition date 2010-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00511 PPV_E2_C E2 (early) protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3mi7X00
1N88A 4WCEQ 3CC7S 1U1PA 2ZJPQ 1QM9A 1WF0A 2KRBA 1N54B 1X4CA 4WFBQ 1VQ7S 3R1LA 2HYIB 1R8HA 3I55S 3R27A 3CF5Q 2VOOA 2XSFA 2F9JA 1F9FA 3VAJA 1K8AT 1RKJA 2NZ4A 2MKHA 3CUNA 2YWKA 5DM6Q 4TLQA 2XS5A 3SXLA 3U1LA 3PIOQ 3D2WA 1U6FA 1FHTA 1WHYA 2LCWA 1YTYA 5LJ3Y 3DLLQ 4ED5A 1IQTA 1RK8A 2D9PA 1M1KT 2HGLA 5DDOC 2K8GA 3VAFA 4F25A 1S72S 2CQGA 2JWNA 3UD3P 1VQ8S 2LXIA 5JVHQ 2XNRA 3MD1A 2N3OA 2RNEA 1WTBA 1FO1A 4UQTA 1N8RT 3US5A 4IO9Q 4IOCQ 4IUFA 4TU8A 3J7YU 3OW2R 1U2FA 1S79A 2RS2A 1NU4A 3P49B 1M90T 2MGZA 1O0PA 2KVIA 3MUVP 3SMZA 2CPHA 5FJ4A 1VQ4S 4PKDB 5HO4A 2SXLA 3NS6A 1U1NA 2M0GB 3CC4S 1FJ7A 2CPDA 2MQNA 1UP1A 2MKIA 1WHXA 4J5OA 2WBRA 4CH0S 4EGLA 4C0OC 2XB2D 2XS7A 4QU7A 2DNYA 1H2VZ 2LEBA 3SDEB 2KM8C 2KXHA 3TYTA 1U1QA 3MUTP 4FXVA 3ZZYA 3NNAA 3EGZA 4Y00A 2MSTA 1VBXA 2ADCA 2QFJA 3CMAS 1KC8T 1JJ2R 3THPA 2MKJA 2KXFA 1NJIT 2EK1A 2JX2A 4A8XA 4YB1P 3CC2S 1DRZA 1X4BA 2DGWA 5MLCV 1VBYA 3Q2TC 1WG4A 3H2UB 1SJ4P 2MY7A 3IWNC 2KXNB 1X4AA 2U1AA 3U1MA 1OO0B 2K3KA 5EN1A 2MXYA 3CXCR 5IM0B 1U6BA 4WF9Q 1OWXA 3MI7X 1VQOS 1FJEB 1X4FA 1PO6A 2XNQA 2G1DA 2KFYA 2RRBA 3NNHA 1HD1A 3BO2A 1VQ6S 3P6YC 4ERDA 4W90B 2VODA 2YKAA 5DDPC 2DNRA 2FY1A 2DNZA 1M5VC 1YJWS 3UD4P 3G4SS 2MQLA 1Q7YT 3J7ZT 3VAKA 5D77A 5IQQA 2LKZA 1WEXA 1VQKS 2I2YA 2DHSA 2E5GA 4TU9A 3G8TA 2DNHA 2D9OA 3CCES 2M52A 2J0QD 1DBDA 2CQHA 2QEXS 2LEAA 2MB0B 3CCQS 5CA5A 2HVZA 3RW7A 1H2UX 3VAIA 1Q81T 2CQCA 2J0SD 1A7GE 3G71S 2N3LA 2MMYA 1QVFR 5D78A 1W2BR 2RT3A 3G6ES 4QQBA 1ZZNA 2MQQA 4C4WA 1YJNS 2DNKA 2L41A 2BZ2A 5GAGU 3CD6S 2MZJA 3TO8A 2KG1A 1YWXA 1AUDA 4TU7A 2UP1A 2MJNA 3K0JA 1URNA 3FEYB 2KG0A 2J76E 1VQ5S 2DGTA 2Q79A 1YJ9S 3I56S 1K73T 1X5SA 3CMES 3G8SA 2DNQA 2DIVA 2U2FA 4BS2A 3FEXB 2DGXA 2CQPA 1BY9A 3L3CA 3S7RA 3CULA 3V4MA 2FC9A 5DM7Q 2DO0A 3VAGA 2JVOA 1X5PA 3CCJS 3NMRA 1UAWA 1WG1A 2MQPA 2KU7A 3MOJB 2CQDA 2MYFA 2MHNA 4CIOA 2AYEA 3G9CA 2DNMA 4OZ1A 1A9NB 5DDQC 1JJ4A 2X1AA 2BOPA 2CQ0A 3VAHA 2EVZA 4PR6A 2CQ1A 1CVJA 2XS2A 5GAHU 2I38A 2CQIA 1VQ9S 2DNNA 4RU2A 1WELA 3JB9k 5CXTA 5GADU 2L9WA 5LXRA 1P1TA 3CPWR 2NLWA 2JVRA 2RU3A 2B0GA 4M5DB 2CQ2A 2AYBA 1WEYA 1XN9A 2CPYA 5H1SV 4LMZA 1U1MA 1X5TA 2DNPA 3MD3A 1PGZA 1U1KA 2DGVA 2FC8A 1YHQS 2DH9A 3DXBA 2E5IA 2DH8A 3UCUP 2RQ4A 4W92B 2DGSA 4WKRA 2FPHX 3CCLS 2MQMA 2CJKA 1B7FA 2M70A 2MGZB 2KI2A 5DETA 2LECA 2KN4A 3MDFA 1WG5A 2DHXA 3VF0B 1M5PC 1Q86T 4UY8T 2DHAA 2DNLA 2RQCA 2QA4S 1X4DA 2MJUA 3B4DA 5GAEU 2KT5A 2KH9A 2O3DA 2HGMA 1YITS 3P5TL 3CCUS 2MPUA 2D3OR 3TP2A 4QU6A 2X1FA 2DO4A 3CCRS 1SJFA 2DB1A 4YUDA 1WHVA 3Q2SC 4V19X 1H2TZ 3BO3A 3S8SA 5LSOA 1QVGR 4U67Q 1OPIA 2LA4A 2M4MA 2KM8B 1FT8A 4WFNQ 2M8HA 4F26A 2CQ3A 2DHGA 2E44A 1KOHA 1UFWA 1X4HA 3VALA 5LSLA 1HL6A 3UCZP 3EGNA 1X4GA 3HI9A 2E5HA 3H2VE 4C7QA 2LXUA 2OJ3A 2N7CA 2LMIA 5HL7Q 1SJQA 2V94A 3NS5A 1VC6A 1G2EA 1OIAA 4ZKAA 2M9KA 2KYXA 2J8AA 1VBZA 2L08A 1Q82T 2MKCA 1M5OC 2MZQA 2DGQA 1X4EA 2DNOA 2ZJQQ 1KD1T 5LJ5Y 1K9MT 2F3JA 2AYMA 2DIUA 3ULHA 3CCVS 2X1GA 3BS9A 3SDEA 2LYVA 3ZZZA 2VOPA 1N52B 2OTLS 2A3JA 4QPTA 3LPYA 2JRSA 1WI8A 4F02A 3B4MA 2MZTA 2CPIA 1VQPS 3R1HA 1D9AA 1R8PA 3UE2A 5LXYA 1WF1A 4CQ1A 3THTA 1ZH5A 1WWHA 4FXWA 4WIIA 2OSQA 2E5JA 3CTRA 2CPEA 1HA1A 2RUGA 3CCMS 3MURP 1VC0A 3BEGB 2M88A 2EK6A 5IM0A 2DGUA 3VAMA 2LQ5A 1YI2S 2DK2A 1DZ5A 2DISA 4P6QA 2MZSA 3S6EA 1KOOA 2YH0A 5DDRC 3PIPQ 1YIJS 2AYGA 5BJRA 2DH7A 2OIHA 2CQBA 5GVQA 4IOAQ 1NO8A 1JJHA 2LA6A 1H6KX 2N82B 1U1OA 1VQNS 3IRWP 2CPZA 2G4BA 3RW6A 5IFMA 2DGOA 1DHMA 3G96A 2ZJRQ 2RS8A 2RVJA 3N9UC 2YH1A 1SXLA 2G0CA 4PRFA 2CQ4A 2OSRA 1JMTA 4OZ0A 4LIRA 1KQSR 2ADBA 1FJCA 2HGNA 2MKSA 2CPFA 5ITHA 3LQVA 2KHCA 3NNCA 2VONA 2M8DB 2YTCA 4Y0FA 3UCGA 3HHNB 1SJ3P 1HD0A 2CPXA 2AD9A 2KRRA 1VC5A 2FHOB 3MUMP 2GO9A 1UW4A 5JVGQ 1WEZA 2MY8A 1FNXH 1D8ZA 1L3KA 2X1BA 2F9DA 1P27B 1WI6A 2MSSA 1U1LA 3UWTA 1FXLA 2M7SA 1VQMS 1U1RA 2OTJS 2RRAA 2ERRA 2MQOA 1VQLS 1X0FA 4CH1A 4YOEA 1ZZFA 1M5KC 3CCSS 5CYJA 4Z2XA 2PEHA 3P3DA 2DNGA 1SJRA 2PE8A 2CPJA 4LJMA 1X5OA 2GHPA 2MZ1A 2DITA 1WF2A 2MKKA 4WFAQ 3BO4A 5GMKa 3MXHP 3S01A 2M2BA 2HZCA 3EX7B 1WHWA 2MZRA
chains in the Genus database with same CATH superfamily
1GNKA 1WF0A 3M6UA 4J37A 2GX8A 3I9V9 1R8HA 3MR5A 2FIUA 2XTJP 3BGRA 3HCXA 2CZ4A 4CT9A 3VAJA 3HVRA 3HMJG 2QG9B 3AOAA 5EWFA 2VC0A 5L1IA 1FXRA 4M8LA 1WOOA 1V5VA 4ALZA 3NMAA 3PKYA 1DAXA 1JB0C 4O4GA 2RDJA 4QOTA 3DYAA 3CSKA 1RT3A 4G1QA 2G9OA 4DV2J 4DL3A 3J7YU 4A8YA 4ED6A 2RHSB 1RT6A 2UUAF 3F73A 4DZDA 3I0RB 2VFSA 4OZ2A 2LDIA 2BM0A 1SV5B 2DYAA 3PKMA 3MPYA 4N76A 3SQOP 3MMCA 2BJ7A 4HH1A 1YRXA 2E5LJ 4JI6F 2BKNA 2MSTA 3KK1B 3CIZA 1G7CB 3LW5C 1VBKA 1Q0NA 3F56A 1FJGF 2K06A 3G82A 2KXNB 1I3OB 3T1YF 1HMVB 2ZZTA 2PIIA 5E5NA 3SYZA 2D1CA 5IXUA 3MR6A 2UVVA 4ZK7M 1O5JA 2FTRA 1QDUB 4DQRA 1R8BA 2VODA 4FZVA 3C14B 2OPPA 4H54A 1RT7B 4AUKA 4ILMA 4NLSA 2MEWA 4LFAJ 3I5BA 5C24A 2J0QD 1DBDA 2CQHA 3DMJB 4ECTA 4EYIB 2YPZA 2MLXA 2BE9B 4P52A 3BV8A 5KG3A 4QQBA 3ADAC 4ZCKA 1XR6A 4EK2A 3MEGA 4NZ0A 4C8NA 5KFKA 4KFBB 1UEKA 2MJNA 3WDOA 3FEYB 1NB7A 1JLBB 4IQMA 1OQ3A 1X5SA 2HIYA 4QW9A 4K5SA 2DRBA 4KHRA 3A1YG 3L3CA 3PR4A 1CC8A 1J27A 2HZAA 4O3QA 3GIMA 3B78A 3W9IA 4TQSA 1JLGA 3MCSA 3IR5B 4CIOA 2F63A 2VD3A 2IM2A 2J9DE 3QIDA 2IFXA 2DEIA 5KFDA 4J9PA 4MKBA 2BYCA 1S97A 4CLKA 3M8PB 4QCLA 5AXKA 2R7XA 2PC6A 5F9LA 4NMXA 4Q7AA 1CLFA 2B0GA 5B0FA 1U2CA 2DNPA 1TKDA 3MD3A 2B6AA 4RNFA 2ZM6F 1SL1A 4O3NA 4ECYA 5FIIA 2AJ2A 1SBRA 3RJMB 4C3MA 3HHDA 4ZLLA 3PCOB 2MHEA 5HVGA 3VF0B 3AJDA 3MPWA 1RHUB 5ETRA 1D3WA 3QT6A 3GB0A 1RQ0A 3V6HA 1AROP 4DZ6A 4K2XA 4NZ7A 4J9SA 3Q8QB 1WC1A 1N0VC 4B08A 2DHGA 3TA0A 2E44A 4C6AA 3BQ1A 2GJ2A 3H2VE 2LXUA 4ECWA 3IM8A 1FRHA 1UPMB 4WP3A 2Z8QA 4NXNF 4EBDA 5E7OB 3I0RA 3N5FA 5AJ3F 1SV5A 3WC0A 3CCVS 1WD6A 3ZZZA 5BXIA 2A3JA 2HMIB 4LQ9A 3QLHB 3DLHA 3KK1A 1EARA 1OMSA 1Y00A 2PFFB 2OSQA 2PGCA 2HWTA 4NYOA 1VJWA 4C0BA 4OZ5A 3ELHA 4LF2A 3RU0A 1HMVA 2H9ZA 1FNMA 1YI2S 5GMEA 4ZDNA 1W25A 3S6EA 2W9AA 2AYGA 1KQKA 3C14A 2Q3PA 4WKYA 1I94J 4MK8A 1RT7A 1HNVB 1DHMA 4NEYA 4U8VA 2IA6A 1RWKB 3MPUB 1UKUA 3OVBA 3DMJA 1IM6A 2X51A 3UCGA 2HKEA 2CPXA 5JXSA 4GC6A 5H9EK 4M5NA 2R7RA 2CWKA 1K1SA 2GHVC 3OL8A 4AQYF 4KFBA 2F8EX 1NSKL 1U0HB 2R7QA 1JLBA 1X0FA 2R4FA 3MAAB 4Z7CA 2DNGA 1ZM2A 2GHPA 2JH3A 1R7IA 4P71A 2ZJPQ 4NA1A 1WC3A 4ZOSA 3D0HE 3VV2B 3T1HJ 3HHEA 2Z58B 3BGUA 3EXCX 3SXLA 3U1LA 4IRKA 4UZCA 1ITPA 3M8PA 1VK8A 3LAMA 1XR7A 2O67A 3IN5A 1RK8A 4ZHRB 2NXEA 4OV6A 4ZP7A 4TLRA 4CZCA 4B3TJ 3D3BJ 2B56A 4HH0A 4IUFA 4WXOA 1HQEB 4DV1J 2KVIA 2W4CA 3CC4S 4LF6F 2FB0A 3PX6A 4B3MJ 5BR8F 1KTVA 1FDDA 3CIMA 1TV6B 2DY9A 4GVLA 4LF4F 1IR0A 4NL5A 4N5SA 2A0FB 2AJQA 4DR7J 1SJ4P 5F8MA 3W2VB 3VGVA 5IWAF 2ILZA 1RACB 5IQ6A 4FVCA 2Q43A 2ASJA 2E7WA 3VWSA 2DNZA 3W9HA 2HMIA 3K5PA 4I68A 4NXMJ 1OYDA 3VAKA 2ROPA 3T5HA 2LKZA 2Z56B 3QLHA 4OYAA 2G13A 2DNHA 5KFJA 4LRFA 1YZ6A 3BR9A 2IMOA 3QGIA 4CYUB 1GK8A 5F8NA 3I4PA 5KT5A 2Z2ZA 4OJGA 1GAOA 3A13A 1PILA 2WVCA 2UP1A 4QW8A 1SC3B 1NH7A 2KG0A 2OEJA 3FBCA 4CO0A 5IC4B 2LFVA 1RJJA 1HNVA 4AE5A 3FEXB 1BY9A 2QLXA 4I6AA 3CULA 2FC9A 3ZTSA 4DUZF 2ZNYA 2VFTA 3TEHB 3QNWB 3R7NB 1FKOB 4PG5A 4ILLA 3PW5A 3M4XA 1UJ4A 2W7PA 2Q1LA 1NNDA 2B8QA 2ZH2A 2XS2A 2DY1A 2LQ8A 3DLJA 5DQHA 2E29A 1WELA 3CJKB 5E3QA 2BRLA 2AU0A 1RHMB 3CD7A 3FBBA 1U0HA 1CC7A 2G0IA 4X65J 1T03B 3MAAA 4HT5A 1TK0A 2RQ4A 4PXCA 4PEOA 2C3UA 3BKUA 3OFHA 1R0CB 3HSGA 3I6PA 1TL7B 3GSIA 3NWRA 2D3OR 3ENVA 3Q8VA 1BWEA 3N6LA 5EX3A 1VJQA 2ZHAA 4PWUA 4WZQA 3D66A 4KR0B 2M8HA 3M30B 4DCPB 2PMWA 1NB2A 2FZKB 1RBAA 1IUJA 1QTNB 3WX4A 2E5HA 3VTIA 3RG6A 3NBPB 1RYSA 1HQEA 3CDEA 4ZKAA 2VFUA 3SCLE 4OX9J 1XQIA 2OPQB 2L08A 4FYXB 1RU1A 3I96A 2ZJQQ 2OLWA 2W2OP 1X9WA 2QO3A 4NRTA 4NLTA 2X1GA 1TV6A 3V5RA 2BUNA 2DXDA 4QPTA 4F02A 4ANCA 4U7UD 2C2RA 4ZVTB 2IJNA 1HKAA 4NRUA 3OFGA 3Q0AA 2QL7B 3W2VA 2ZD1B 4X4OA 1R3NA 1VC0A 4NZ6A 4USWA 2C3PA 1VIXA 1NO8A 3H0PA 4X4TA 1Q8IA 5LMUJ 8RUCA 2VIHA 2KHDA 1RZMA 2J5AA 3NG8A 2XLKA 1D09B 5D6GA 4DV6J 4DPTA 2NXCA 4CLYA 3BQ0A 4FF3A 2WB4A 2I6WA 3BH6B 1SJ3P 4CYUA 1S9GB 3PTWA 4JI1F 1Y5LB 4N56A 4WP9A 1B0PA 2HAIA 2RAQA 3BJYA 2EFGA 2M7SA 1NCLA 4ECZA 1DTTB 4DU7A 4LF8J 2ZWPA 4ZPTR 3RBDA 2HVIA 1TL1B 2R9LA 4B9SA 5DLGA 3THVA 2QA2A 4KO0B 2H54B 4WFBQ 1D1UA 4USVA 1FKOA 5BYRA 4RBUA 2O66A 3OL7A 2W8LA 2ZWOA 2F9JA 2A18A 3N28A 4F8RA 2K3IA 5ETPA 5T7LB 3FFIB 4TLQA 3BREA 3SCJE 3CJKA 3G8QA 1HBUB 3EVWA 1FHTA 1FCAA 2Y1JA 1YTYA 4G65A 2HRTA 2V4RA 2C3OA 3DGVA 1HNXJ 3IR6B 2RHQB 4NA3A 1FTRA 3DXSX 4Y28C 1P9QC 1S79A 1M90T 1S0VA 5DG7A 1FNOA 2CPHA 1LOUA 4WYWA 3D7SB 4I2PB 2M0GB 1SH2A 1UA0A 4RJVA 5CD4A 1VI7A 3PRVA 3FK4A 2OMOA 4B02A 3O6QA 2P8IA 4JI5J 2BE7D 3IO1A 5D0RA 1U1QA 4JI7F 5M2PA 1LXNA 1N5QA 2ZH8A 3TW0A 3M30A 2BR0A 1RA6A 4HT7A 2N4DA 4OHVA 3Q86A 1KS2A 2WTFA 2AKWB 3NBPA 1OO0B 2MXYA 3CXCR 5IM0B 1BUXA 1OWXA 1S7IA 3FSIA 4C3KA 2OPQA 1IKVB 1X4FA 2FUG9 2RILA 4GKJJ 4YEAA 3NNHA 2BQUA 4B9NA 3QFWA 2XY5A 3PFEA 2I2YA 3IC1A 3HD2A 3KXDA 1R31A 2ZD1A 5D78A 4RLEA 3CJ3A 1VLOA 1PC5A 1XIQA 3IXQA 4JI0F 1R43A 3CGIA 4PQUB 1WTFA 2V8VA 3ONQA 1VQ5S 1YJ9S 2B9EA 1K73T 4J9UE 1RCOB 4RW9B 2H5EA 1HR0J 3V4MA 4DPOA 4XAKA 2LXFA 4FBTA 2DNMA 3NY0A 1XMOJ 2BANB 2QYGA 2L9NA 2VG6B 3K8WA 1S9GA 4ZJOA 1C0TB 1LWEB 1IQZA 4QIEA 4RU2A 4CH7A 1SL2A 4ZLJA 3NP5A 4DX7A 4NASA 3W65A 4XDDA 4OI3A 1DTTA 5KFTA 1TL1A 3OR2B 2HHVA 5KFPA 2XCPA 4KO0A 3IS9B 3N79A 3A12A 5LM7E 4DV4J 5DETA 1IXKA 2XCAA 1ULRA 3C16B 4PQAA 3B4DA 5T7LA 3FFIA 2KH9A 3GIKA 2QTWA 3CCUS 1U8WA 1APSA 3HFVA 1HBUA 4YUDA 3R7SB 1S1UB 2ACMA 3K8VA 4CLFA 2CQ3A 4ECXA 2GAGC 1B7YB 4NMLA 4M94A 3HI9A 4F4WA 2JEFA 4I2PA 5KG2A 1GMWD 3OSPA 4PYDA 3IG1B 3ITHA 1LFPA 3GFHA 1FTCA 1UZHA 3CDBA 3CCWA 1UEVA 1IKYB 1EETB 4X4SA 3JAMU 2Z30B 3GV8B 3KDNA 3LPYA 1Y7PA 3R1HA 4RWWA 1Z1ZA 3UE2A 4ATNA 3OXGA 4K4YA 3KJFB 1AT1B 5HJXA 1HHTP 1HA1A 3NGTA 3CCMS 1XWLA 5IM0A 2DK2A 3OV7A 2MZSA 4DR3F 4ZP8A 3GIRA 1Y10A 4L74A 4NLVA 2DH7A 3IBCB 2CQBA 5K8OA 3W62A 1Y4ZB 1U1OA 5K20B 2DT9A 3N01A 1Q95G 2O1PA 1RAAB 5I42B 1KLNA 1F60B 3M9NB 1L3SA 2IRUA 4WYLA 4URSA 2YWEA 2M8DB 1SH3A 4QPXA 2YQ0A 3QRPA 4M5JA 4HI1A 1FNXH 3HT0A 2BW2A 4DXLA 1NSAA 4RUHA 2IIHA 3TEGA 1HIYA 2YKOA 1Y9OA 1RT4B 5AXLA 4PQUA 1U1RA 1WUUA 4NYZA 3PZPA 4RW9A 4YMEA 3MM9B 4Z2XA 4Y34A 2ALYB 1MWZA 1N33F 2R7WA 1FKPB 3KLIB 1QM9A 5A8WB 3R1LA 4PG7A 2BANA 4RW8B 1L3UA 3MMJA 4A8MP 1SVDA 2VG6A 2XSFA 5K8NA 2XMAA 4IO1A 2WOMB 2NZ4A 2JEJA 3NGKA 1C0TA 1LWEA 2GA7A 2RU9A 1JLCB 5HVHA 1E6VB 4NLPA 5LJ3Y 7FD1A 4ED5A 5ADZA 4KTQA 1HI1A 1SKWA 2QL9B 5KG6A 2NZCA 3OR2A 2CZVC 3L7UA 3GJTB 5HK4A 2N3OA 2CA9A 1HLWA 3IS9A 4ZS6A 4WK1A 3TZWA 3P49B 3PG9A 1IM4A 2BJ9A 4D3GA 1FRIA 1UJ6A 5AXNA 1FD8A 3C16A 3MTJA 5CCLA 5E41A 3SSSA 1S57A 2ZBIA 2BQRA 4JV2A 3DC2A 1UVKA 2XB2D 1RTZA 4FP9A 1U0SA 4HKQA 1HHSA 3NNAA 1VMBA 3QYYA 4RPFA 2ZKTA 4U9RA 5D4OA 1VBXA 1RHRB 3U02A 3LP2B 1RT2B 1KC8T 3CNQP 4KE5A 1JLFB 3CC2S 3Q2TC 4BCAA 5CD4H 5HBMB 2XMKA 4EO6A 2V9WA 2YWFA 3EDQB 1TUWA 2QMXA 3IBWA 2C3MA 3IG1A 2E1PA 2G1DA 3ILLA 1IKYA 3KG1A 1NM2A 1YBTA 1EETA 3AD8C 2V63A 3UD4P 2VJUA 4V19J 5GAEI 5AJ3J 2W9CB 3VAIA 1NSQA 1X9SA 3KMSA 2MQQA 3MAHA 1Q8BA 4L3KA 5GAGU 2MZJA 2WBMA 2FHKA 4X4NA 3AY0A 4YB5A 1CJTB 3O1LA 4YS2A 4P73A 2DGXA 4JV1A 5IT9Y 5I42A 2J9CA 4ES3A 3M2VB 5HN0A 1FRKA 4NPOA 1C4CA 2VUGA 1K0TA 1FE0A 1VRQC 1IJFB 2GVDB 5IV4A 1KEKA 3DHWC 1SC1B 1RHKB 1NPPA 4X4QA 1NH8A 4H4KC 3PVXA 2VU5A 2VBXA 2F5GA 4H4KA 4K7QA 5LXRA 2IM3A 1RT4A 4TYAA 4DR5F 5H9EJ 2VZ9A 3BPSP 2K7KA 3RBZA 2CPYA 3GU0A 3MM9A 5DQIA 1RKIA 1S1WB 1T8EA 3GWCA 1Q8KA 4IH6A 4A46A 5AE3A 4W92B 3J7A1 1FKPA 3KLIA 4WPAA 3AA8A 3CCLS 1HHQA 5A8WA 4XPEA 2QLJB 4RW8A 1DTQB 2DHXA 4E8UA 5LT5A 3N5BA 2WOMA 1QTMA 4X84A 2MPUA 2DO4A 4TN2A 1S59A 4MKYA 1E6VA 2FVRA 1U49A 2FD2A 3VVTA 1OPIA 4DR1J 2C2OB 3KUHA 1IBKF 3CB4A 4F0MA 3Q24A 4A8OA 3D1OA 4KV8B 2J8AA 2H48B 3K5OA 4WFZA 5D8HB 4OLOA 4MKAA 2WHOA 4CO1A 3CDUA 4RO0A 3EGWB 4USHA 3DLKB 4Y2MA 4ED8A 4LF6J 3U7JA 3BBBA 3LP2A 1WWHA 1RT2A 4FXWA 4WIIA 5BR8J 4DSEA 1F5AA 4DQSA 1JLFA 2J9DA 2IPOB 1N36F 1VHIA 4LF4J 5HBMA 3K5LA 2BMBA 2R7OA 5K9FA 1RWOB 2LQ5A 4ZJLA 3N0VA 4QIFA 3PIPQ 4R25A 4TY8B 3NGUA 3KTQA 2XSJB 3NXZA 3BYPA 2LA6A 2R2UA 2LEPA 3IRWP 3C6UB 3MM8B 5IWAJ 2RS8A 3N9UC 4LBPA 3GLJA 1S12A 2W9CA 1BXNA 5I3UB 3LQVA 3ZTQA 5KFIA 3UN2A 4QWDA 1WC5A 4ZVQB 2V0NA 4KBIA 4FPRA 4WXWA 2Y0SD 5K5MA 3VGSA 1TMMA 3EVMA 3TAQA 3TUIC 1CJTA 1Z2ZA 2ERRA 1JX4A 3UN5A 2V8HA 4LVOP 4ZPBA 4CH1A 1GXLA 2IJFA 4F7VA 2FVPA 1SUQB 4OI1A 4DF8A 3AT1B 3VVUA 3L7PA 4EBEA 3S01A 3M2VA 5F8LA 1RAHB 1UVLA 1FE4A 2KRBA 4UQGA 2RE1A 4RW7B 1F6TA 2GVDA 2QMWA 1Q16B 5B0AA 2XYPB 3EJMA 1MSWD 3R3TA 4KQZA 1AA1B 3DGPB 3CUNA 3N6MA 3QJJA 4JI2F 1S6UA 4RBTA 1U09A 1NMEB 1RGVA 2GS8A 3U1NA 3R5CA 1VK3A 1FRMA 2HGLA 3UD3P 1S1WA 1V3ZA 3US5A 4UY85 3JS9A 2ASYA 1PJ6A 1U2FA 5H9FK 2IA0A 3SMZA 3CVKA 5FJ4A 1DTQA 2IC3B 3MR7A 2UVUA 4DR2J 4C0OC 1KVKA 4ZITA 1PCAA 4DV2F 2XYHB 4FXVA 1RP5A 4Z37A 1RT5B 2DVIA 5GADI 1MROB 1X4BA 5HQLA 5CAAA 2DR8A 4DSIA 4KGKA 2VQFJ 3DN9A 1N5VA 2U1AA 1XERA 4KV8A 2XLJA 4WF9Q 3RB0A 4B3RJ 4ECSA 2XNQA 1FWKA 4QWCA 2BDPA 5BYQA 2E5LF 3MGJA 2HBYB 4A4JA 3DLKA 3LANA 3D1QA 1R27B 2DHHA 1Y3KA 3G8TA 4LIWA 4P7TA 2C22A 4LRBA 3D6HB 4OJHA 2R8IA 1WKJA 3CJ4A 4B9VA 4RX6A 1W2BR 3TVKA 5KFFA 1YJNS 3W5ZA 2NR0A 3GIJA 4PAAA 4TY8A 2XSJA 4LFAF 4E2FB 1U7LA 3C6UA 5IOLA 2XO6A 1UA1A 1WOPA 3MM8A 4YDDB 3ETOA 3RB6A 2VA3A 3I5AA 4FN5A 3EPGA 2MHNA 5T14A 2VQEJ 4CLZA 5I3UA 4DS5A 1JJ4A 2ZH5A 2X1AA 5EDWA 2YNHB 2DR9A 1CVJA 1TKXB 4NLOA 3FMWA 1NZAA 3M6WA 3QATA 2HS3A 5I3QA 1V5IB 2R7UA 2W4PA 2AYBA 2BXJA 4QYZK 4ED7A 1S10A 4DWIA 1X7VA 4OJ3A 1SUQA 1VIOA 1YKWA 1VYAA 2RF2B 3SFUA 3BBCA 4RW7A 1J2VA 1CJKB 4KJIA 3A8EA 3MR3A 3DGPA 2GO8A 3GTYX 2OH2A 1SPBP 1S49A 3HSZA 2DB1A 2JL9A 1RWUA 3Q2SC 2Y1IA 4CNZA 4C97A 1HL6A 4PPDA 2FZGB 4LF1A 4RU9A 2GIQA 2ZZNA 3W9JA 3NS5A 4P2MA 3I32A 2IC3A 4FF1A 2Y1LB 4F3OA 1YRTA 2CDRB 4DSFA 2FY8A 3ULHA 3H20A 2COLA 3IAM9 4DBQA 2LYVA 2JRSA 5KFGA 4MK7A 3SSQA 2JHEA 4IRDA 1MW7A 1RT5A 4LSNB 4KGXB 1YVFA 1MROA 1EJ7L 1RLCL 3C6TB 5HMYA 3IP0A 1SIWB 3OTBA 2M88A 2EK6A 4CP5A 3DOLB 1VS3A 1KOOA 4DV3J 1SQFA 4RZRA 2ZHOA 3PV8A 1HWJA 1N34J 2N82B 1VQNS 2A6MA 2XWXA 5A76A 5IFMA 2V2QA 2W7AA 4GVBB 2WVFA 2AW0A 2LLZA 4PRFA 5A0YB 4GMKA 5CZVA 2HNDB 2YVSA 4Y0FA 5KFZA 2XMVA 1HD0A 2KRRA 3MUMP 5EGYA 4DLEA 1GX6A 4J9QA 4N47A 2UV8A 4TVAB 4DUTA 3QGPA 2LVWA 1M5SA 2OEKA 2OTJS 1HI8A 2D7SA 1XBWA 1ZZFA 3IR7B 4DOZA 2AEFA 1IBCB 1X5OA 2DR5A 2A10A 4F3MA 2M2BA 2HZCA 2MZRA 3PACA 5KAKA 1T94A 5IS2A 2YNHA 1TU0B 1DQAA 1TKXA 1T9WA 1NJZA 3MR2A 4USUA 3EZ5A 4AL6A 1CBKA 5DGBA 4F4KA 2B43A 1AZSB 4JUZA 5HATA 3TARA 1FFGB 2HG4A 3KMQA 1EKSA 4UQTA 3T1HF 2RF2A 1RI7A 2KJVA 2QSFA 1U6ZA 3PYDA 4AFFA 2R2RA 1QLNA 4ZVRB 1CJKA 3NS6A 2IAJB 1U1NA 3UDEA 4WZMA 3QGGA 1AXQA 4I0WA 3U27A 3M8WA 2H5JB 3TA2A 2QZ8A 3AD7C 4M5MA 3MUTP 3ZZYA 3TX8A 1NK7A 5ETMA 1RE1B 4NLWA 2XGPA 5GAHI 4DV1F 4LSLA 2DCLA 1DRZA 4MFBB 5B0GA 1RYRA 5J2MB 1RWWB 2FLNA 3LGNA 1QY7A 4QJVA 4B3MF 2HNYB 4OL8A 4ZN3A 3KWMA 4UZBA 5L1LA 2DXFA 1BWVA 4ERDA 4D3HA 5DDPC 1F3VA 3NCPA 3WZ0A 5KT3A 1FXDA 2RH3A 4LSNA 1B3TA 5CA5A 1H2UX 5HI7A 4DFJA 3C6TA 3CO0P 4IR9A 3SEOA 5DG9A 4DQIA 3WX8A 2RT3A 3ZTPA 1DQ9A 2PO4A 3J81Y 3DOLA 5EUHA 5F41A 5CHCB 2ZC3A 2DXEA 3OHAA 4NXMF 5KTQA 2Q79A 2Q6BA 3LOUA 1R8CA 2R7SA 3R97A 3HO1A 1KQFB 3H8YA 4DR3J 4GVBA 2CG4A 5DM7Q 4BBYA 3NMRA 3PYEA 4F3QA 2W1BA 5A0YA 1NK0A 2HNDA 4JI8J 4HL9A 2IHR1 3LTOA 5ETVA 4A8QA 2GJFA 2V2VA 3H42A 3BBFA 3C19A 3FCWA 3MF5A 3C66A 3J80Y 1HWLA 3GV7B 1X5TA 2J6UA 3GFZA 1PJ7A 4QR1A 2G0JA 3JTOA 3H25A 5I4MA 1MWQA 4C8KA 3HHLD 2VV5A 5KT7A 1ZAWA 3DRPB 2C1EB 4IFYB 1ZA1B 5E2QA 1NSPA 5HVFA 2ZBCA 4W98A 1S0OA 1XEZA 1WORA 1N33J 1GQEA 3JYTB 1HBNB 1EZZB 4NOHA 1WOSA 4WFNQ 1RAFB 2A6OA 2ZVIA 1KOHA 5LSLA 2NYHA 2IYGA 2JFKA 2NREA 2JC0A 4RNMA 1S6QB 2QA4G 3OFFA 1UPPA 4P10A 2M9KA 2IAJA 4LREA 4ZLPA 2HNZB 2WW8A 4ELUA 2M5YA 2DNOA 2F3JA 3GV5B 2XGQA 1YQHA 4P2FA 3LPEA 4EMDA 4B9TA 3FSYA 4OX9F 4MFBA 1NLKL 1AYEA 5HJYA 3DRSA 5J2MA 2HNYA 3UNGC 1S9FA 2LDYA 3JSRA 1YIJS 4IOAQ 1YZ7A 3K59A 1XMQJ 3IWLA 4F67A 3H2LA 1U02A 4IR1A 3R2DJ 1ZM4A 3NNCA 2WZ1A 2FJWA 3Q8SB 4OYXA 4UF4A 1UW4A 1KDNA 4DUYF 5LMUF 4YP3A 3H5YA 4Q5VA 3D4JA 2MQOA 4K50A 4OYWA 3FC9A 1JLEB 1RAGB 1ZBTA 1SJRA 1WF2A 3N4WA 3W8GA 4YR0A 4CDIA 1K1QA 1SC6A 2W24A 1TZ0A 1WDDA 2GVZB 1HYSB 2FLOA 2NPFA 1H0HB 4OYOA 1C1BB 4LF8F 1WSVA 2P9EA 3D6TB 3OTCA 3BGLA 3IFEA 4KHMA 2YX4A 4K8RA 1B0TA 1S7HA 1HWUA 2LXIA 1H38A 5HMWA 1YJTA 2VL1A 3DRPA 4IFYA 3BM7A 4M63A 2FLLA 2B4OA 4OYZA 3VCDA 3LALA 1VQ4S 5HO4A 4EWTA 5CYQB 1UEUA 4LVNP 1GTHA 4CH0S 1HNXF 3JYTA 1HBNA 4NCGB 2FJEB 3OTEA 2CRLA 2BE2B 1U8SA 4RL1A 2FHJD 2P9CA 3M05A 2NPIA 2Z2YB 4YB1P 1S4FA 3M1VB 4JI4J 3Q22A 1S6QA 1X4AA 4DPXA 5EN1A 1FJEB 4JI5F 2HNZA 3AODA 4OYMA 9RUBA 3HVAA 2QYCA 3BO2A 1VQ6S 1QJHA 3FEZA 3D67A 4CTAB 3A8IA 1TMJA 1VQKS 5B09A 2E5GA 4TU9A 3CCES 5B0BA 3G6XA 2QEXS 1BC6A 4GKJF 1TL3B 2D3O1 1VISA 1MG7A 2DNKA 4CLSA 2MLZA 5AE2A 3OL9A 1AUDA 1LWFB 2RJZA 3GG0A 2D41A 4RNNA 2DEJA 2EW9A 1F0XA 5IV3A 2JVOA 2DCUB 2KKHA 1JJCB 2VBZA 3MFHA 4YQWA 1H72C 3KJQB 2JNJA 2HBQB 4DV0J 3G9CA 3AHPA 3CJ2A 4IH7A 1EP4B 4R0JA 1CULB 2CQ1A 1VQ9S 2E1MC 2POKA 5CCMA 2L9WA 3CPWR 1HR0F 4Y2KA 3TZZA 5H1SV 4N8OA 1JLEA 2G1HA 3C46A 2FVCA 1XMOF 1NDPA 2NYIA 2E9ZA 1MN9A 1ZM9A 5U47A 2MQMA 3PX4A 2HFSA 2KN4A 3R6LB 2GVZA 1HYSA 2VASA 5DO2A 2W7OA 4ELVA 1C1BA 3TA1A 4QU6A 4USJC 3B6BA 1FRJA 4LT6A 1KN6A 2M4MA 4JI2J 4F26A 4DV4F 3NRBA 1U26A 2A2CA 3KG0A 2B3TB 3EGNA 1QUVA 2Z57B 1PBUA 3HFZB 4Q2LA 1YX2A 1PAUB 3H7HB 4PYAA 4DL4A 5CYQA 3VZHA 2WVDA 4AT1B 3PM9A 1QSSA 4NCGA 2O01C 1GMUA 4NLGA 2BE2A 3EM1A 3CMQA 2PN6A 1ZH5A 1N5TA 2AGQA 3M1VA 1CPZA 1FFSB 3W5XA 4O44B 4Q45A 1DQ8A 1T9TA 2ZBPA 4M5LA 4DL7A 4ENOA 4ZPVR 3W1YC 3JTNA 4CTAA 3TVYA 1FF2A 3G96A 2APOA 2CJ9A 2EC0A 2IDLA 1KQSR 1JXLA 3NLCA 4JBCA 4ZIWA 3TAMB 4A8KA 1TL3A 2KZMA 1UMJA 1VC5A 4DV7J 2MY8A 1ZTWA 4ES2A 4WU3A 1EAYC 3UWTA 1FXLA 3ZZ0A 3FMBA 4RUCA 3QFHA 2V5HG 5HANA 2K7JA 2Y3YA 3R5JB 2D69A 3K57A 3GFXA 2V6AA 4ZA1A 3KK3B 3MXHP 4USTA 3HK2A 2ZNZA 1HNIB 2RDIA 4HACB 1EP4A 1CG2A 2R8KA 1CULA 1YK9A 1F9FA 1RUSA 3OJSA 3GZ7A 4JI3J 4DI6A 4R5PA 3HHKA 1BD6A 1WHYA 3DLLQ 1TVRB 5AT1B 2BEFA 4IG3B 1T05B 4QYZJ 2XNRA 3C8YA 1WTBA 5L38A 3SV3A 2RQKA 1UVNA 4HHHA 4LBIA 3MUVP 3FNNA 3D9BA 4IG0B 1AFJA 4NLDA 2FLPA 2YWWA 2HZVA 4J9LA 1TKZB 1IBMF 2J9EA 4B9MA 2RUSA 3Q8RB 1UVMA 5F0UA 2F4FA 5LMNF 1REVB 3I0SB 1NHUA 3G6YA 4HDGA 2GJIA 3GIIA 2KFYA 2C2NA 4ECVA 5D4NA 3NOGA 4OHZA 2CKWA 3O44A 3G4SS 2V8GA 2V2ZA 4WE1B 4JYAJ 2LEAA 3UR3C 3CCQS 4YB7A 4K4WA 3GYNA 3SQGB 4O44A 2YBVA 5J1PA 1IWGA 5RUBA 4L76A 2BZ2A 2PMZD 3BF4A 3E2EA 2XHWA 1EHWA 4ICLB 1FWLA 3MCMA 3G8SA 6AT1B 3R5AA 3FRYA 2WSCC 1VHFA 4C8MA 4J7CA 1V3RA 1UAWA 1WG1A 3SSRA 2KU7A 3QQCD 1V9OA 3A3PB 3HT3A 3TAMA 4RNOA 2HS0A 4CLWA 2CUYA 1X8DA 4PR6A 2OI2A 2J6SA 2C28A 2I0XA 4M5DB 1IKXB 4DPWA 3DLGB 4QWAA 1PGZA 2LP4A 4OHWA 4TKTA 3GQCA 3KK3A 2A2DA 3JSBA 1R6VA 4DFKA 1HNIA 2CJKA 4CLLA 2AJFE 4OX7A 2VDHA 2LECA 4HACA 1Q86T 2LQBA 3KUEA 1RB0A 4ED1A 5E3AA 4J9VA 4RUBA 4CO2A 2JOQA 1SJFA 1BHNA 4WU2A 1IBLJ 1Y5NB 2D74B 1TVRA 3W66A 5LSOA 4U67Q 4IG3A 1T05A 2HHHJ 1X4HA 4J9RA 2ZITA 3LWLA 3WHIA 2ZOGA 3BDPA 4C7QA 1P6TA 1WC6A 3FZ2A 2LMIA 2V94A 2E7VA 1Q78A 4DG1B 2XQCA 5L39A 3PO5A 1NRKA 2PFDA 2KT2A 3GMGA 1YLXA 1X4EA 4IG0A 4EUVA 2JDJA 4AL5A 1RWVB 2ZOMA 1T3OA 4RNHA 4DR1F 4MAKA 2OTLS 1LK5A 1UFKA 2WONB 2ACYA 1TKZA 2MZTA 5L9NA 5I3PA 4XO0A 4LRDA 1LWCB 1REVA 2E5JA 1VR6A 2RUGA 3I0SA 4PG6A 3W3SA 1FEEA 4ID8A 3GJRB 4OZNA 2YH0A 4OI6A 4WBFA 2PT0A 3FQKA 1JWWA 1M1GA 3OLAA 3V6JA 4Y6IA 2OELA 5CQGA 1KFSA 3KNGA 1BQXA 1DJ0A 4WE1A 5HMZA 2ADBA 5F8HA 4YR2A 4A8SA 2CZ9A 3HHNB 3CD0A 4ETZA 4I6YA 3SQGA 3PDNA 1ROFA 1WEZA 2X1BA 2F9DA 4LR7A 1H7WA 1VQMS 2HHXA 4ICLA 1DARA 4CM0A 3BYRA 2PE8A 4ED2A 4C8OA 1SKUB 1LV5A 1TP7A 2HYIB 1UL3A 5GMDA 1ZA2B 1HPZB 1UVIA 5HSPA 1KRPA 5D15A 2HK2A 2XS5A 4XIUA 1P8GA 1KVJA 1IR1A 3ZZPA 4OIXA 1HARA 4F2RA 3SZ2A 4HR2A 4M5DA 1IKXA 3DLGA 3BSNA 1S6PB 1RWMB 4LFBJ 2VH7A 3P8BB 4LFCJ 1PIEA 3MD1A 5A2QU 1N56A 2R8GA 2RS2A 1NU4A 1XR5A 3LH2S 4WWSA 2ALZA 2HVHA 3CT9A 3CO9A 3ETMA 1VDHA 4Q8FA 2CPDA 2FZCB 2MKIA 2ZZMA 3MEEB 1D9DA 3RR8A 4CCHA 5B0DA 2XS7A 1KTQA 3CD5A 3BH7B 3MCOA 5LOQA 3M7VA 3THPA 1N4LA 3DI6B 3PYFA 1AUSL 4C0HA 3IWNC 4RBVA 2CNOB 1BQMB 4DG1A 4DR2F 3D1HA 3MI7X 1PYSB 4FBUA 3DOKB 4NA2A 1D0EA 1M5VC 2DR6A 4O0IA 1HNWJ 2WONA 2GMJA 3OTOF 4DSKA 3J7ZT 2IY5B 3KDOA 4ILRA 3LP1B 2D3ZA 3CE8A 1WEXA 1C2PA 4ZHRA 2VQFF 4WJBA 2UV8G 4JP8A 1LWCA 3RW7A 4B3RF 5A8KB 2J0SD 4ES1A 4KPYA 4BDPA 1ZZNA 5HLFB 3T1AA 1FVQA 2WAQD 1PSDA 3LF0A 3IWXA 2DGTA 3CMES 3VAGA 4L75A 1W2IA 3MOJB 2CQDA 5LL6d 3RTVA 3BSAA 5HROB 4OZ1A 2XULA 4DR4F 1LQ9A 2ZDPA 2NQPA 2F1FA 2DNNA 1H7XA 3OTDA 4EZ6A 3JB9k 5D3GB 4DR6J 1P1TA 2D3UA 1S77D 3DCAA 2NSCA 2K2PA 2VQEF 4DUYJ 5J1NA 2ZH3A 3UD5A 2LQJA 2DH9A 3KLVA 3FCHA 3TUJC 1NAQA 4AD6A 5D0EA 1J5EF 3UO0A 4BWJA 4KC5A 1HPZA 4A8FA 2QA4S 1X4DA 2MJUA 4DS4A 2H3EB 1FEHA 3W5YA 4ER8A 2X1FA 1XK8A 1R0AB 2EI5A 4HLBA 1QAYA 2ZH4A 3S8SA 4FDFA 1G1XA 2KM8B 1FT8A 2XO7A 4J9OA 1S6PA 2QLWA 3RZAA 2CVEA 4DN9A 4F0KA 1YJUA 1JKHB 4NLUA 1ICEB 3OFEA 3ZNJ1 5HL7Q 1B64A 1QD1A 2N7YA 1Y5IB 4EBCA 3BQ2A 5FLXU 2HS4A 2MKCA 5D4LA 3ZZRA 3MEEA 4ZPDA 3DM2B 1KD1T 1ELOA 2DIUA 4ZP6A 1RADB 2CIMA 4KKOB 1UFLA 3B4MA 3O2IA 1T03A 4ECUA 3DI6A 2E66A 2C2ZB 1BQNB 4KY3A 3UVJB 1WNEA 1UVJA 1BQMA 5THWA 3P96A 3MURP 3BSCA 3EGVA 3OL6A 1YBAA 4QYRA 5DDRC 3DOKA 2VHGA 2OIHA 2QN6B 4Y2AA 1TL7A 2XY6A 1I1GA 5KFBA 2G0CA 3LP1A 2EKYA 4Y2IA 2AX1A 4KGZB 2FGCA 4XTTA 2KHCA 5A8KA 4DV3F 4NX9A 4NCAA 4ZN1A 4KRWA 4PXBA 1Q5VA 1YDLA 4DPUA 1N34F 3KLEB 5ETTA 5HLFA 2VPWB 3E3XA 3ENQA 3IA0A 2UUBJ 1U25A 1VQLS 4YOEA 3HD1A 4Y65A 1M5KC 1Q7LB 1TAQA 3AOBA 2B9YA 2CAJA 4WTYA 5D0HA 1N54B 5HROA 3HHLC 1S4EA 2AJ1A 4FVMA 2VG7B 1XTZA 3MMAB 3KHRA 1RKJA 2ZOFA 4ED0A 2YY3A 3D2WA 3W8PA 5D3GA 1KR4A 3ZTOA 4BHQA 3BB5A 1DURA 1IQTA 1QE1B 4OZJA 5C24B 5DDOC 1RSCA 4F25A 3UFCX 5J2NB 1HW8A 2FVQA 2RNEA 3AOCA 4IOCQ 2KYZA 3SFGA 4E98A 2H5IB 3HVWA 2IYIA 1YJVA 2CJQA 3D6FB 5IT0A 1FRLA 1RBLA 2YNIB 2FDNA 2HWIA 1R0AA 2NSBA 2KM8C 2KXHA 1OY8A 4OYPA 3RR7A 3BZQA 3TJ8A 1KWMA 2UUCJ 4WK3A 1JJ2R 2JX2A 2FJAB 1T9VA 3QWUA 5C2GA 3FQLA 1JKHA 3MOZA 1C0UB 3RRKA 4UOCA 1HWKA 4Q8EA 3OVSA 4QR0A 4PG4A 3M9MB 1NHVA 2QL5B 3PNIA 3DM2A 2Z0GA 2CYYA 4URQU 1QSLA 4ZVEA 3P6YC 1KKHA 1RISA 4TXSA 1YJWS 2E1CA 4KKOA 4DEZA 4ITSA 2JSXA 2M52A 4U96A 1P9YA 3D0IE 4MTPA 1QUPA 1BQNA 3UVJA 2C2MB 4K4TA 2HSEB 1QVFR 2UXBJ 3ET6B 2XI2A 4YHHJ 4P2XA 3L4BC 3ZZOA 4KB7A 2L41A 3RAMA 4DF4A 3H5SA 3JSYA 5ETLA 2GZOA 2JJ4D 4UT4A 3I56S 5HAOA 2BKOA 2DIVA 4L6V3 4BS2A 2MDAA 3CJ0A 2H51B 4OV1A 3S7RA 3VR1A 4ZVPB 4I6WA 1VRUB 5T41A 3B54A 3R5DA 3CJ8A 3R8YA 4WIQA 2IMWP 2W2PP 1UZDA 2HLTA 3K89A 3O5TB 3KLEA 3RBEA 5HQ8A 1YJ7A 2CG8A 1IKVA 4FYVB 2FJDB 3W64A 1REGX 2VFVA 1NKEA 3PJ9A 1TL4A 2N4CA 4JI8F 3G87A 2DGVA 4J91A 2E5IA 3RAXA 5EX0A 3JAMY 2FPHX 1CJUB 4B3OB 3MM6B 2QFIA 3AA9A 4NEZA 2VG7A 3JQKA 5KT2A 2DHAA 4KH1B 1GX5A 3MMAA 5GAEU 4MYTA 4DU8A 4R8UB 2O3DA 2JLFA 3KUGA 3NEKA 3D6MB 1NPRA 4J90A 5F9NA 2OP5A 2XEXA 1WHVA 3AB2B 4PUOB 1QE1A 3R6GB 3Q83A 5J2NA 2B51A 3FDSA 3BSOA 2FHJA 1X4GA 1RABB 2OJ3A 3FRZA 2AF6A 1FX2A 1VC6A 5L8RC 2KYXA 1H3DA 5L1JA 3IRXB 1RHJB 1IJEB 2YNIA 4ZJQA 1JK9B 4DQPA 1AW0A 1RTIB 2DTJA 3HFKA 1M1HA 3QAUA 5LXYA 1RDRA 2KTQA 3W2WB 2R7VA 3UN3A 2J0WA 4JV0A 2HQGA 1MLAA 2V4QA 2C2KB 3V6DB 1IBMJ 1C0UA 2HQFA 1S5ZA 1EX8A 2OGUA 4CO5A 5KFYA 2VPYB 4YY3F 5CABA 1XNQJ 3GYGA 5LMNJ 3J7YI 5GVQA 3JQJA 5B0EA 1T02A 1S0NA 3EWGA 1JXVA 3SBMA 4PCQA 4PG8A 5J2QB 4ED3A 1S1UA 2GFFA 5EWEA 2HGNA 4IRCA 3EZOA 2ATCB 2B7CB 4MYUA 1R6YA 2UXDJ 2FHOB 3OT9A 2GO9A 3ET6A 2PI4A 2EEYA 5KT6A 3HPOA 4Y2CA 1XMQF 1GFWB 1L3KA 2LU1A 2PSZA 3SI8A 1U1LA 3R2CJ 1S99A 1JQGA 2BJ8A 3SCIE 4CO4A 5CYJA 4HTIA 1Q8LA 1YJRA 4ZCLA 1NUEA 2DITA 3O8WA 1YG0A 1S6OA 1VRUA 1N88A 4C9DA 4NCBA 3AD9C 3H4DA 1RWPB 1O8BA 3I55S 5KG5A 3BN4A 4KGMA 2HFZA 1ZPWX 3OHBA 2XM3A 1K0VA 3DLBA 3R9LA 2HW3A 3RAQA 1S9EB 4M1KA 1CSJA 3TAPA 2K8GA 1NHKL 2F7VA 2AGPA 1S72S 1VQ8S 7FDRA 3FBFA 2VPXB 2J7UA 3GSDA 3OW2R 4DLGA 2NXNA 2W4DA 1CJUA 1O0PA 4EO8A 4B3OA 3MM6A 4U6PA 1LW2B 1T11A 1FJ7A 2BV3A 3DNCA 1B4SA 4R8UA 3RB4A 1WHXA 4EGLA 3GJQB 1RTHB 3QSYB 2LEBA 3IGNA 4PUOA 3EGZA 2W9BB 3QRRA 4BC7A 2C42A 3GG1A 1V3SA 3QAEA 1NJIT 1T95A 5HP1B 3H2UB 5KFNA 4C11B 4KH0B 3W61A 4QIGA 2GAHC 1S0MA 4PPZA 3IRXA 4DV5F 2RRBA 3CWJA 2P2CB 4W90B 1GXUA 1PC4A 1WKKA 1JLCA 2E7XA 1RTIA 2J6TA 4MKVA 1G4CA 4JI4F 2PD1A 1HQ2A 1GH8A 1F9EB 2PA3A 3W2WA 3UNYA 5ETOA 1WDTA 2XMMA 2HHQA 3B82A 2HQCA 3V6DA 4O3PA 4QIWD 3TJAA 1Q4RA 3G6ES 2E1RA 3M6XA 4C4WA 1GMVA 4ED4A 1T7PA 4WFYA 4CNYA 2IRXA 3RRGA 2CXEA 4ELTA 2CNLB 5DQGA 4IQXA 4QWBA 3DU6A 1ZETA 3VQTA 4G1PA 1PBAA 1URRA 3OUYB 3KNAA 5J2QA 1X5PA 3K58A 3ILIA 1U45A 1RAEB 2FVSA 3SV4A 2JLEA 1LK7A 4CRJA 3M8QB 1ZYQA 1XNRF 2WW4A 4TNOA 2I38A 1FDBA 5GADU 3RYLA 2GW8A 2HQ3A 2XMTA 1W7WA 3UDVA 4DV0F 4FYDA 4LUBA 2DH8A 2DGSA 2VKRA 5KFWA 3WIVA 4YFUA 4J9KA 1FKAF 3NGRA 2KT5A 2G2OA 4OYIA 1S9EA 4IH5A 1I6JA 1LKZA 5IC6B 2HHPA 1X31C 2I9SA 4OFZA 5B7WA 3LUYA 3EICA 4MIBA 3UCZP 4JV5J 3D0GE 2VA2A 1OIAA 3QMQA 3TJ9A 1LW2A 1TK8A 2UU9F 2BOAA 3TUPA 1LXJA 2MZQA 2BM1A 5LJ5Y 3B8HA 2AYMA 2CNKB 4ZVHA 3DKDA 4RR5A 1RTHA 3IAS9 2P6SA 2VOPA 1GEHA 4P2SA 2W9BA 2WB1D 1WF1A 3QT5A 2WVBA 4ZP9A 4O23A 4U8YA 2YNGB 2I5JB 2AEMA 1EKRA 1PYOB 4HHJA 1H98A 1ZOTA 5HP1A 2AWZA 4OI0A 4C11A 2ATLA 1SC4B 3BEGB 3CJTA 4YR3A 5CZXA 3DDIA 3ZNUA 5CH7B 2KO1A 5K8PA 2QV6A 3MM7B 2BRKA 4ECQA 2EFNA 1N32J 4KGVB 3GR0A 2VDIA 3I87A 5KG7A 4N77A 2OSRA 4OJ1A 2UUTA 3K5NA 5F8IA 1KONA 2V9KA 2HFNA 2CPFA 3FUYA 5KG1A 4W4MA 1NJYA 3OTOJ 4LRCA 3DDKA 1TAUA 4F50A 2KL8A 4C3LA 1D8ZA 1V6HA 3PJXA 1SI9A 5E3RA 3TI0A 2VJVA 1HFEL 2KT3A 4LSZB 4PWWA 3C2PA 2RIJA 2X7IA 4OMFG 4O4RA 2AGOA 2CPJA 2I1RA 3TZXA 3OUYA 4Q2MA 3X3UA 3BO4A 5GMKa 3PYGA 4ETXA 1U1PA 2HHUA 3DOMB 2UUWA 4DV7F 2CNNB 3M8QA 2DPIA 1SL0A 2VOOA 4X62J 3R7BB 2MKHA 3UDLA 2OKQA 2ZE2B 4FS1A 4ZPAA 1TQLA 4DR4J 2HHSA 2HBZB 3A4TA 2EKNA 2RMLA 4DL0C 3VAFA 3HVTB 2CQGA 2JWNA 2ASLA 2BA9A 4DQQA 3F44A 2F4VJ 4HVZA 2GIRA 1NEEA 4JI3F 2HRYA 4L73A 2QSWA 2KFNA 4UOHA 4KYZA 3T5LA 4PKDB 3FJ2A 3TRGA 1UP1A 4FF4A 4K0KF 3CJRA 1J5EJ 1H2VZ 5KG4A 3HSDA 2ZKUA 2YQ1A 5F0WA 5A8RB 2HIQA 5AXMA 1UW9A 3V2UC 4ANEA 2JEGA 1A0OB 2EK1A 4A8XA 2YKNB 4I56A 5G0RB 2F8MA 4C8YA 1NJWA 5C42B 2X3GA 4CM2A 5CYMB 3P5BP 4JOUA 3ENAA 1HD1A 2YQ3A 4NLRA 2HVDA 3D54A 2YKAA 2DNRA 2R3VA 3G2XA 2BQ3A 2UXCF 2R7TA 3O3LA 3HSJA 1TK5A 1LW0B 2BKPA 1SIZA 4OZ3A 4QBUA 3H5UA 4ZCIA 2YNGA 2I5JA 1Z4UA 1FX4A 2J7KA 1Q81T 1IR2A 2QLFB 3BGFA 2AJ4A 4LF9J 3GYXB 4MK9A 2M3DA 1DY3A 4X4RA 2KG1A 3TO8A 4FNHA 3MM7A 5ETQA 1MU2B 4ZVUB 2AJ0A 2EFOA 2J7WA 4UUXA 1OYEA 4FF2A 4LF5F 4JYAF 3T6BA 3T3FA 1UTAA 4ID5B 5F3TA 2XMJA 1PJ5A 2MYFA 2AYEA 5DDQC 3KHLA 3ITHB 4K4XA 2ZFHA 2BOPA 2CQ0A 4IOBA 5GAHU 2RKIB 5CXTA 4N7TA 2W2QP 1C4AA 2JVRA 2XWYA 3QRQA 5DGAA 1KFDA 4EI2A 3KFWX 1NDCA 4QZVB 3MEKA 4HYKA 2OUGA 1BE4A 3W7BA 1YHQS 3DXBA 2CADA 4K5RA 4O3RA 4MIAA 1S48A 4Y3CA 3UW1A 5EWGA 4WKRA 3DOMA 3HP6A 2GV1A 2DRDA 2NXJA 1M5PC 1RTJB 4M5KA 5KFCA 1Q79A 3L7OA 2ZE2A 1YITS 3P5TL 1VRTB 3TP2A 2AQ4A 3VHQA 2EBGA 4C48A 4G1IA 4U95A 1H2TZ 3TQEA 2H4YB 3AQPA 1F1BB 2LA4A 4Z7YA 1SKRA 3HVTA 4JB8B 1ZAVA 4ZCMA 5KG0A 2OHDA 2NUHA 3DU5A 2EG1A 2YX7A 3M9OB 1S1VB 3S1TA 2I8EA 3QWPA 2ZH7A 1IBLF 2V69A 1K9MT 3PR5B 3DDNA 2NUUG 2B4VA 2R8JA 2HHHF 2BBEA 2EFVA 3J81j 5A8RA 2CPIA 1VQPS 2WCXA 2RB7A 3OXLA 4K4UA 2YKNA 3E01B 1O51A 3AB4B 5G0RA 3T5JA 1HBMB 3PXGa 4F4ZA 5C42A 2DGUA 4A8WA 1X60A 4P6QA 3ZO7A 1ZS6A 2ZH9A 7AT1B 5CYMA 1BMQB 1KP6A 2IVFB 4DSJA 1YSJA 2CJBA 2DGOA 4X4UA 3CEDA 3I31A 1UJ5A 1LW0A 4KHPJ 3AJ1A 3JXOA 1HNZJ 3WQPA 5BYSA 1OY6A 3NOCA 3QJPA 1TFYA 1I51B 2Y1RI 1CJVB 3JTPA 3LO3A 4X66F 2OD4A 3D5MA 2YPYA 4DL6A 2VICA 1T9YA 1MU2A 2BVZA 2HURA 2RRAA 4CO3A 4K4SA 2AT1B 1G3OA 2PEHA 4DPYA 2JZ5A 2ZBRA 2IDEA 4ID5A 4LRAA 3QT7A 4P74A 2DBBA 1WHWA 3QZ8A 4CWBA 4RW4B 3AXMA 2EFPA 3V4IB 2ZVSA 1HWIA 3CF5Q 2V8PA 4AXIA 3WC2A 2AMCB 1K8AT 2HLUA 2CWXA 1H74A 2HVEA 2RKIA 2ASDA 2K1RB 2UUAJ 2LCWA 3MPVA 4OZLA 2VC1A 4I64A 4HTJA 3CCZA 3ILJA 1P1LA 3NKYA 1FO1A 2CJYB 1N8RT 4IO9Q 2GC8A 2PEBA 4JI6J 3Q8YA 1L5UA 5M2UA 2P5VA 2PDAA 3KJVB 1RTJA 5AE1A 3HKWA 2MTLA 1FJGJ 2BACA 3T1YJ 1VRTA 1L3VA 1QAIA 3M2RB 4M5HA 4QU7A 3AAWB 4LFBF 4UW2A 2RDDA 4LFCF 2UVWA 3I4HX 2KVQE 1S1XB 4I69A 1FA0A 2KXFA 4S0MA 3A8KA 2Y0BB 1WG4A 2AZ3A 4GO5X 3KYLA 5KFRA 1C1CB 1S1VA 3HJVA 2DD8S 2Y8YA 3I9ZA 1G6BA 3JQMA 3V6KA 4Q44A 3BDEA 4BLGA 4DX5A 1ZTTA 3L9ZA 2DR7A 3PJWA 3KHGA 4LF7F 2ILYA 4HDHA 3SCKE 2XZWA 4F2SA 1AZSA 3H5XA 4V1Ak 2EG2A 2MB0B 5SZTA 3FVYA 5E0OA 3E01A 2J0XA 8AT1B 1OSCA 1XMBA 4QR2A 1HBMA 1RAJA 2ZEJA 3PRBA 1U2RA 3UDCA 1KQGB 2KFZA 1HNWF 1URNA 2J76E 3CDWA 3OXFA 4YY3J 1NK8A 3FZBA 5F8JA 2LU2A 2YKPA 2ZM6J 2P9GA 1R0BG 5DRKA 1TFWA 1B0VA 1FI4A 1KLMB 2XYGB 1NBEB 2EVZA 2YWGA 4NLQA 2ZUAA 1CJVA 1Q53A 1SB6A 4Q43A 2XMUA 9ATCB 2NLWA 1OQ6A 4IKAA 2Y8WA 3EPIA 4MMOA 2CQ2A 2GCFA 3ISND 3CCTA 1JLQB 3GPAA 4B3SF 3P45B 4NE9C 3HULA 5ETNA 2FC8A 3DRRB 2ZC4A 3G86A 4RW4A 2GGPB 3V4IA 3T9NA 2KI2A 2HBRB 2GMHA 4RW6B 4DR6F 3E8OA 4C8ZA 4NXNJ 5IT9U 2K1RA 1RA7A 4P75A 2WSEC 3PRDA 4V19X 5JMNA 3RRHA 1PG5B 3FSXA 4UTGA 3TVZA 3AJ2A 3TQ1A 2VBYA 4HEA9 5KOXA 1U48A 1DFDA 2OFHX 2KDOA 2V34A 1NK9A 3KJVA 4L3NA 3K7RA 1VBZA 1Q82T 1WJ9A 2DGQA 4LR8A 3M2RA 3BS9A 3KLHB 1N52B 3H4BA 2JC1A 1S1XA 2X3DA 1EB0A 5C5JA 3EE3A 2GNKA 2IVMA 2H4WB 2C2DA 1IVZA 1C1CA 3HZGA 1GT8A 1D9FA 1B70B 2FHMA 3H90A 1OJ4A 1RBOB 3J7Z5 3KK2B 1F9HA 4FKYA 3A3NB 3KKFA 1F5BA 2Z2MA 2F8HA 2CPZA 1CQNA 1GMWA 2G4BA 4GKKF 4AQYJ 3RW6A 2C3YA 3H40A 2ZJRQ 4DV5J 4YN3B 4DX8H 1SXLA 3ZZTA 3NS7B 1GTEA 3X1LB 2KJWA 2MKSA 2YWHA 1M5HA 2QLBB 2JLGA 2JEIA 2AD9A 1N5YB 2ZBQA 4ZVGA 4N41A 3A3OB 3GJSB 1RLDA 3AQOA 4U7CA 3T9ZA 1P27B 1WI6A 3QSIA 3SIPB 4X64F 1U47A 3HLUA 3PY8A 2HFUA 4XPCA 1T3NA 4XDCA 1IWAA 1T0TV 3CC7S 4OHYA 5ETSA 1L3TA 2V67A 4PZVA 1UETA 3R27A 1MMLA 3M8YA 1KLMA 3F41A 2UUBF 3HDSA 2HFOA 4I1TA 5DG8A 1HQUB 2B7BB 1R89A 4KAIA 2AEJA 2KB2A 4Q0BB 2HPUA 3OR1B 3E51A 1TTHB 3EDRB 2FJBB 2V68A 1XNRJ 1JLQA 4YB6A 2FJXA 4F36A 5GAGI 5JVHQ 5A6PA 1NDKA 3DRRA 5FD1A 2GGPA 2RRNA 2QJ3A 4RW6A 5K8MA 2AIRB 2YX1A 4USMA 1RTDB 4F4AA 2LQ9A 3QJLA 3BGOP 4EYHB 2AHOB 2QGFB 3TYTA 3QIPB 2ROEA 2HHWA 3W60A 5HMXA 3AH6A 2JFDA 1TUVA 2MKJA 1NK5A 2VKZG 1SH0A 1VBYA 3TZYA 2MY7A 3OJUA 1SJ1A 4QWEA 1VQOS 4OX6A 4URGA 1PO6A 1MMNA 1Y11A 1TUGB 1XJWB 2AP6A 2FY1A 2UUCF 3KLHA 2QT7A 3MTKA 1N0UA 2UU9J 1Q7YT 5D77A 2EWHA 3RGIA 1OSDA 2D9OA 3QPIA 1E6YB 1M0SA 2WVEA 4DUZJ 1VGYA 5KFHA 2BJ1A 1U24A 3MPDA 4TQRA 3VGUA 1KSPA 4OLPA 4DCOB 4TU7A 4K59A 2QRRA 3FKBA 5H9FJ 4B17A 2BX6A 3KK2A 3PHTA 3GILA 1ZM3A 4OQJA 4P72A 2DNQA 2U2FA 2OMLA 2CQPA 3OSNA 3MZIA 2UXBF 2XMWA 3EMTA 3T19A 2HRUA 4YHHF 1N6QB 3NAIA 4DL5A 1NK4A 1Y0HA 3FBEA 1N5YA 4DCJB 3PW7A 1O6XA 2CQIA 2PI5A 2DJWA 2QA1A 3T41A 2B4UA 5B0CA 2RU3A 1WACA 2FGOA 2PMHA 2Z2LA 4ZIVA 1XN9A 2R8HA 3MMBB 1RWXB 4OHXA 3CW2C 2A1BA 1PAEX 2QMUB 3UCUP 4IYQA 3HX9A 3F0NA 2M70A 2VPZB 3DHXA 2MGZB 2F65A 4A48A 3UPFA 2OEMA 2DNLA 4BWMA 4BC9A 5L9XA 1HQUA 2BABA 3CJSA 4Q0BA 3M32B 4NYPA 3OR1A 1MN7A 1LWFA 3POTB 1FD2A 4DFPA 4FS2A 1UFWA 3VALA 3K5MA 4NI2B 5E3CA 1SQGA 4I2QB 1X0PA 1R8AA 3NWGA 1G2EA 3PW2A 2DRAA 3M8SA 2QIFA 1M5OC 3L95X 1RTDA 4I67A 5C25B 1UWBB 1RWNB 3QIPA 1EQMA 3UI3A 1EIYB 2H65B 4K0KJ 4QIVA 3HXMA 1WC4A 4O3OA 3EZUA 4DFMA 2HHTA 3ZFVA 1JLAB 5E33A 3CTRA 2CPEA 1TELA 1NXIA 3M2UB 2IVYA 1ZPVA 1H73A 2GMLA 5J1EB 5KFAA 4EFAC 3Q8UA 4PXEA 2W25A 4JI1J 3VQSA 4PWDB 1H6KX 1LNQA 2Z4PA 5J2PB 4J9NA 2VB6A 1RAOA 3ZC4A 1NJXA 1KHWA 3NCQA 2QE5A 1FVSA 1WKLA 1JMTA 4TYBA 4LIRA 1NDLA 4ZVFA 1FJCA 3OQ2A 3TANA 2WK4A 1XNQF 3PHEA 1E6YA 4AL7A 1T9UA 2UVRA 2YTCA 2UXCJ 1NZ8A 4MJKA 3DRYA 5F8GA 2R2TA 4X4VA 3DRXA 4DHVA 2XY7A 1HW9A 1A6LA 5A6WA 1NKCA 2RQMA 2BJ3A 4LSLB 3FGVA 3HJFA 3QT8A 3P3DA 3C15B 4FYYB 3T5KA 2V8DA 2QC3A 4GO7X 2UXDF 2MKKA 3KHHA 3PW4A 1F5CA 2OD6A 4WCEQ 2J8SA 1X4CA 1VQ7S 1T9XA 1N6QA 4LF5J 2GQQA 2ABYA 4OI4A 4USKA 5DM6Q 4ZPCA 5KFLA 3VGTA 2IM1A 1U6FA 3GONA 4LBHA 3GE9A 3AFGA 4M5IA 2D9PA 3MMBA 1SKSA 1M1KT 5DLFA 2V50A 2ZDOA 3LAKA 4JI7J 2RD5C 3Q8PB 1YBUA 3I5CA 1CQMA 5DJBA 1N48A 5C2CA 2MGZA 3MCNA 3TOQA 2CVIA 1RU2A 3BKTA 3D3CJ 4H4OB 4CI0B 2SXLA 4PXDA 4PABA 5B08A 4AXJA 2MQNA 3MWBA 3MM5B 4ZVSB 3NCRA 2IRYA 1KBRA 2ZH1A 1VCTA 3QO9B 4ZMMA 3M32A 3POTA 3SDEB 5L46A 2EPIA 3WIUA 4CT8A 3OD2A 2OAUA 4Y00A 4EU0A 2NXUA 3CMAS 6FD1A 1PKUA 3Q89A 4NI2A 3C3LA 4I2QA 5KFSA 1VQSA 2ZH6A 3U1MA 2K3KA 1I94F 1YGYA 4GRSA 4I7FB 3UR0A 2BJEA 3KLGB 4WP8A 1NPKA 5C25A 3MFIA 1JIHA 1QSYA 2EC2A 4NLYA 1UWBA 1QAXA 2MQLA 4JI0J 1LWXA 4ZLNA 5IQQA 1S1TB 2DHSA 3GP9A 1F2HA 2HVZA 2DPJA 5IT4A 1CEZA 1JLAA 5HQMA 1CS4B 3G71S 3KLFB 2MMYA 1SQEA 3M2UA 3TNVA 3I82A 3NL0A 5J1EA 1YWXA 3NGDA 4UUWA 3K0JA 1RCXB 2UZAA 2GHWA 4PWDA 1VFJA 5J2PA 1OPZA 4M5GA 4LR9A 3LA0A 4KT0C 4F4XA 2HQIA 2B4PA 2MQ8A 3PX0A 3BN7A 3PEJA 1A9NB 4IDKB 3MECB 4O0NA 2AZ1A 1FESA 3V81B 4DJBA 1BGXT 4B3TF 4O3SA 1LFWA 2EBEA 3Q23A 4LMZA 1U1MA 1W26A 4X66J 3C15A 2YNFB 2VF3A 5JJBA 2EXUA 3DRSB 3J81U 2O5DA 2HFVA 2E9TA 1FFWB 4B9UA 2AX0A 5FDLB 5L1KA 1UWAA 1TKTB 3MDFA 2FJVA 1NKBA 3JSMB 4C2MA 3PO4A 2QX0A 1DLOB 2HGMA 3KOAA 4I4BA 2OPRB 3OPKA 4IFVB 3LGMA 3GCWP 4DR7F 3BO3A 4LQ3A 1QVGR 3HZEA 4F4YA 4HHUA 2MLYA 3AXKA 4M95A 2B5JB 1YRUA 2XHCA 1Q5YA 1Y3JA 5KFXA 2NS1B 2ROGA 1XC9A 1SJQA 3RBXA 4H4OA 3M6VA 1RT1B 4X2BA 3J80U 2VFRA 3TUZC 3MM5A 4UOFA 1KNZA 2XLIA 3QO9A 4FNIA 4CLUA 2CFXA 2VBWA 2XC9A 5KFEA 3SDEA 5K14B 3BKFA 5EHHA 1IKWB 4K4ZA 4JV5F 2Q6CA 2E1AA 2XI3A 3K17A 4FPIA 4AYBD 2ZHBA 5E3PA 4CLPA 1HI0P 4MT1A 3KG4A 3L09A 1N5SA 5KFVA 1K44A 3MEDB 3QBCA 3GFYA 2BW7A 3ZXWA 1J5OB 4I7FA 1F3FA 2BJDA 2IM0A 3KLGA 5BJRA 3EVOA 2XZTB 3WBZA 3DFEA 3A8JA 1HBOB 1VLYA 4C8LA 3LGHA 4H4MB 2YH1A 2RVJA 1S1TA 2CQ4A 4OZ0A 5MAOA 5LSRA 3ZTRA 4USIA 4KIAA 3TX0A 2W2MP 1CS4A 2PA8D 3ZZUA 3KLFA 4LF7J 5A2QY 4XK8C 4X65F 2HK3A 1N32F 1ACMB 3KJNB 2OPSB 3GCXP 3T6JA 4ZPWR 2P6TA 3CJQA 5KFQA 3CCSS 3MAQA 2OFGX 1GXTA 2MZ1A 4L72B 3QZ7A 5KFUA 2L48A 4IDKA 4P7VA 4MH8A 4DDFA 3MECA 2YWKA 3GR1A 3PIOQ 3V81A 1BLUA 3D28A 4X4PA 4DN0A 4CLTA 3CJ5A 2W01A 1KHVA 4DSLA 2YNFA 2IBKA 2R2SA 4DL2A 4FXDA 4X62F 1FERA 5KFMA 3H59A 4TU8A 4K2JA 5KFOA 1IN0A 2YXLA 4B3SJ 8ATCB 5FDLA 3LP0B 1TKTA 4G3IA 1OY9A 3IGVA 5SUHA 3JSMA 3EYZA 3PW0A 3IM9A 3HHLB 1DLOA 2H1YA 2NCKL 3EUNA 4J5OA 2WBRA 3CDAA 2OPRA 2HWHA 4WTOB 2DNYA 4IFVA 2XBPA 4UOGA 2F4VF 5IZHA 4E0DA 3ISZA 2V4JB 2ADCA 2QFJA 1TR0A 4OI2A 2B5JA 3IMQJ 1SCJB 2DGWA 5MLCV 2CDQA 3ILOA 4B9LA 3DLEB 2WRMA 2HEKA 2WSFC 1AFIA 1RT1A 1U6BA 4ANDA 1RAIB 3MHYA 4DV6F 4F04B 1VQYA 1WC0A 5K14A 1IKWA 2KZZA 3HKZD 5ETKA 3NGSA 3VZIA 2B9XA 1RHQB 1FK9B 5D0GA 3LWMA 2CQCA 1A7GE 3MEDA 2N3LA 5F3ZA 2MKYA 1KVIA 2VG5B 4FKXA 4N8NA 4C98A 1J5OA 3CD6S 4G6VB 3M8ZA 1F2GA 4ZVOB 3PFOA 1FDNA 3D68A 2YKMB 2W8KA 2YKQA 3H98A 2ZUGA 4NWBA 3QGHA 3RB3A 4FYWB 1HBOA 3OBIA 4H4MA 2GIFA 2DO0A 2F40A 4DR5J 3CCJS 3IBFB 4LF9F 4DX6A 2MQPA 4OX8A 4U7UK 4GKKJ 2EFQA 3BGRB 3W63A 3VAHA 2GQ2A 2IJRA 4YDXA 5C7PA 4J9MA 4WFXA 4DMZA 2OPSA 4EEYA 1WEYA 5FLXY 2HAFA 4O4GB 3G6VA 4RWXA 2FYXA 3DYAB 1RT3B 1U1KA 3RUBL 1OS5A 1ZAXA 1U4BA 5KOWA 1FDAA 4G1QB 4X64J 2CJAA 1JNZB 4OYBA 1FRXA 1B7FA 1WG5A 1MMDA 2E9RX 3R5BA 1RT6B 4NLXA 4UY8T 2L3MA 2R42A 2RQCA 1IBKJ 4MIWA 4HI2A 3UQSA 1RXOB 3CCRS 4K4VA 5DZ7A 3MMCB 1QAJA 5D4PA 3R5GA 1Z2LA 2IBOA 3BPDA 3N6NA 3ENWA 4RKUC 2Q66A 4KPCA 2G2YA 3G82B 5DS7A 2N7CA 3TR5A 1PYTA 3LP0A 1B99A 4R0EA 2FQQB 5M2RA 1N36J 3NAHA 3HHLA 2B8PA 3FCVA 2AV5A 2OPPB 1AB8A 1WI8A 3K2YA 3PEHA 1D9AA 1R8PA 2V4JA 4CQ1A 4GC7A 3THTA 1EQ0A 3HM9A 2G2ZA 2XG8A 1K47A 2W2NP 3DLEA 1D8YA 5G4DA 6FDRA 4ECRA 2XZDB 2L9DA 3TWZA 3VAMA 1Q1KA 4A47A 4R5PB 1DZ5A 2DISA 3M8RA 3MEGB 1MNEA 2C2EA 2V2KA 1NK6A 1S76D 3HF5A 1JJHA 3OVAA 5JUMA 2B9WA 3ICLA 2GQCA 2DKOB 5KT4A 4EZ9A 2Y9HA 1JLGB 3J7AN 1FK9A 4TY9A 5ITHA 3BR8A 2VONA 3EXYA 4F0HA 1I5OB 2CJXB 1UCNA 2VG5A 1JNRB 5JVGQ 1FWPA 2HQDA 4KSEB 1MWYA 1TL5A 1X9MA 1LEOA 1JXEA 2MSSA 2YKMA 2OO4A 4KHPF 1WSRA 1HNZF 5DZ6A 2B6AB 3ISNC 3P4UB 4RUAA 2RSQA 4LJMA 4WFAQ 3OLBA 4P9SA 3EX7B 1VOMA
chains in the Genus database with same CATH topology
3QZ8A 1LV5A 1UVLA 1FE4A 4RW4B 1GNKA 1WF0A 2KRBA 3M6UA 2EFPA 3V4IB 2ZVSA 2GX8A 4J37A 4UQGA 2RE1A 1TP7A 2HYIB 1UL3A 3I9V9 4RW7B 1R8HA 2QMWA 3MR5A 1HWIA 2FIUA 3CF5Q 1Q16B 3BGRA 5B0AA 3WC2A 4AXIA 2CZ4A 1HPZB 4CT9A 1MSWD 3R3TA 3VAJA 1K8AT 4KQZA 1UVIA 2HLUA 3HVRA 3CUNA 3HMJG 3N6MA 1KRPA 3QJJA 2XS5A 4XIUA 4JI2F 1P8GA 1S6UA 1KVJA 2RKIA 2VC0A 4RBTA 5EWFA 1FXRA 5L1IA 1U09A 2ASDA 2K1RB 1RGVA 3U1NA 4M8LA 3ZZPA 3R5CA 4OIXA 1HARA 4ALZA 4F2RA 1VK3A 2LCWA 3SZ2A 3MPVA 3NMAA 4M5DA 3PKYA 1DAXA 4OZLA 1IKXA 2VC1A 1JB0C 3DLGA 4O4GA 4I64A 1FRMA 2RDJA 4QOTA 2HGLA 3DYAA 3CSKA 3BSNA 1RT3A 1S6PB 4HTJA 3UD3P 1S1WA 1V3ZA 2VH7A 3CCZA 4G1QA 4EBEA 3MD1A 1P1LA 3NKYA 2G9OA 4DL3A 1FO1A 1N56A 1N8RT 3US5A 4IO9Q 2R8GA 4UY85 3J7YU 2GC8A 2ASYA 1U2FA 1L5UA 4A8YA 1NU4A 5M2UA 1XR5A 4ED6A 2RS2A 2P5VA 3LH2S 2IA0A 3SMZA 3CVKA 2PDAA 5FJ4A 2ALZA 1DTQA 2HVHA 3KJVB 3CT9A 1RT6A 2IC3B 3CO9A 2UUAF 1RTJA 5AE1A 3HKWA 2CPDA 4Q8FA 3F73A 2UVUA 2MKIA 3I0RB 3MEEB 2VFSA 1D9DA 2ZZMA 2BACA 3RR8A 4CCHA 2LDIA 2BM0A 1SV5B 1VRTA 5B0DA 1L3VA 1QAIA 3M2RB 4C0OC 2XS7A 3PKMA 4QU7A 1KTQA 3AAWB 4LFBF 4UW2A 3CD5A 3MPYA 4N76A 4LFCF 3MMCA 4DV2F 2UVWA 4HH1A 4FXVA 3I4HX 1RP5A 1YRXA 1S1XB 4JI6F 2MSTA 3KK1B 4I69A 4Z37A 3CIZA 1RT5B 1FA0A 3THPA 1G7CB 1N4LA 2KXFA 3DI6B 3LW5C 2DVIA 5GADI 1MROB 1X4BA 3F56A 4C0HA 1WG4A 1FJGF 3IWNC 4RBVA 4GO5X 2DR8A 4KGKA 4DSIA 2KXNB 1BQMB 3DN9A 3KYLA 1N5VA 2U1AA 5KFRA 1HMVB 3T1YF 1XERA 1C1CB 1S1VA 4DG1A 4KV8A 2PIIA 2XLJA 4DR2F 4WF9Q 3RB0A 3D1HA 3MI7X 2DD8S 4ECSA 5E5NA 2XNQA 3I9ZA 3SYZA 2D1CA 5IXUA 3MR6A 2UVVA 4FBUA 4ZK7M 3DOKB 1O5JA 4QWCA 2FTRA 1G6BA 2BDPA 5BYQA 2E5LF 4DQRA 3V6KA 1R8BA 4Q44A 2VODA 3BDEA 4FZVA 4NA2A 2OPPA 1ZTTA 3MGJA 4H54A 4A4JA 3PJWA 1D0EA 2DR7A 1M5VC 3DLKA 3KHGA 1RT7B 4O0IA 3LANA 2WONA 4AUKA 2GMJA 4NLSA 3D1QA 3OTOF 4DSKA 1R27B 4ILMA 4LF7F 3J7ZT 2ILYA 4ILRA 4HDHA 3LP1B 2D3ZA 3CE8A 3SCKE 1WEXA 1Y3KA 1C2PA 2XZWA 4ZHRA 2VQFF 4F2SA 3I5BA 4WJBA 3G8TA 3H5XA 2EG2A 5C24A 2J0QD 1DBDA 2CQHA 2UV8G 2MB0B 5SZTA 3FVYA 3DMJB 4LIWA 4P7TA 5E0OA 1LWCA 3RW7A 4ECTA 2C22A 4B3RF 4EYIB 3E01A 5A8KB 2J0XA 2J0SD 4ES1A 1OSCA 4OJHA 2R8IA 3CJ4A 4B9VA 4KPYA 1XMBA 4QR2A 1HBMA 4RX6A 5KG3A 4BDPA 1RAJA 1W2BR 3TVKA 4QQBA 5KFFA 1ZZNA 3PRBA 4ZCKA 1XR6A 1YJNS 1U2RA 3MEGA 4NZ0A 3UDCA 4C8NA 5HLFB 1KQGB 2KFZA 5KFKA 4KFBB 3T1AA 1HNWF 1FVQA 2NR0A 2WAQD 3GIJA 4TY8A 2MJNA 1PSDA 3WDOA 1URNA 2XSJA 3FEYB 3LF0A 4LFAF 3IWXA 2J76E 1NB7A 3CDWA 2DGTA 1JLBB 3OXFA 4IQMA 1OQ3A 1X5SA 3CMES 1U7LA 3C6UA 4QW9A 4K5SA 1UA1A 3MM8A 4YDDB 2DRBA 4KHRA 3A1YG 3L3CA 3ETOA 3RB6A 3PR4A 1CC8A 3I5AA 3VAGA 1NK8A 2VA3A 4O3QA 3FZBA 3B78A 3GIMA 4FN5A 4TQSA 5F8JA 2LU2A 1JLGA 3MCSA 3EPGA 3IR5B 1W2IA 3MOJB 2CQDA 5LL6d 2MHNA 3RTVA 3BSAA 5T14A 4CIOA 2YKPA 5HROB 5I3UA 2VD3A 2P9GA 4OZ1A 4DS5A 5DRKA 2XULA 1JJ4A 2IM2A 4DR4F 2J9DE 1TFWA 2ZH5A 1B0VA 3QIDA 2X1AA 5EDWA 1KLMB 2YNHB 2DR9A 2IFXA 1LQ9A 5KFDA 2EVZA 2ZDPA 2YWGA 2NQPA 4J9PA 4NLQA 1CVJA 1TKXB 4NLOA 2F1FA 4MKBA 1Q53A 2BYCA 1S97A 1SB6A 1H7XA 1NZAA 2DNNA 3FMWA 3M6WA 3OTDA 2HS3A 4EZ6A 3JB9k 3M8PB 4QCLA 5AXKA 4Q43A 5D3GB 2XMUA 1P1TA 2NLWA 2PC6A 5I3QA 1OQ6A 2D3UA 2R7UA 4IKAA 2W4PA 5F9LA 2R7XA 1S77D 3DCAA 4Q7AA 3EPIA 1CLFA 2B0GA 4MMOA 2BXJA 2CQ2A 2GCFA 5B0FA 4ED7A 1S10A 2AYBA 4DWIA 2NSCA 3CCTA 1JLQB 3ISND 1X7VA 4OJ3A 2K2PA 4B3SF 2DNPA 1TKDA 3MD3A 2B6AA 4RNFA 2VQEF 5J1NA 2ZH3A 2ZM6F 1SUQA 1VIOA 1SL1A 2FC8A 4O3NA 4ECYA 2LQJA 2DH9A 3DRRB 3KLVA 5FIIA 2ZC4A 1SBRA 2RF2B 3FCHA 3TUJC 3SFUA 3G86A 1NAQA 4RW4A 2GGPB 3V4IA 4C3MA 3HHDA 3T9NA 4RW7A 2KI2A 2MHEA 1J5EF 1J2VA 4BWJA 3VF0B 4KC5A 2GMHA 4RW6B 4DR6F 3MPWA 1HPZA 4KJIA 3A8EA 4A8FA 2QA4S 1X4DA 1D3WA 3MR3A 2MJUA 3DGPA 3E8OA 2GO8A 4DS4A 3GB0A 2OH2A 1RQ0A 4C8ZA 1FEHA 3V6HA 1S49A 2K1RA 2X1FA 1XK8A 1R0AB 1RA7A 2EI5A 2DB1A 1AROP 2WSEC 4HLBA 3PRDA 2JL9A 1RWUA 3Q2SC 4V19X 1QAYA 4K2XA 3RRHA 3FSXA 3S8SA 4NZ7A 2ZH4A 4J9SA 3Q8QB 2KM8B 1G1XA 1FT8A 2XO7A 4J9OA 2Y1IA 1S6PA 3TVZA 4CNZA 1N0VC 2QLWA 3AJ2A 4C97A 4B08A 2DHGA 3TA0A 2E44A 3TQ1A 2VBYA 1HL6A 4HEA9 5KOXA 4PPDA 3RZAA 1U48A 2CVEA 4RU9A 1DFDA 4DN9A 2GIQA 3BQ1A 1YJUA 2GJ2A 2OFHX 1JKHB 3H2VE 2LXUA 4NLUA 4ECWA 1FRHA 2ZZNA 3OFEA 2Z8QA 2KDOA 5HL7Q 3NS5A 1NK9A 4NXNF 1B64A 2N7YA 1Y5IB 4EBCA 3KJVA 4L3NA 4EBDA 3I32A 3BQ2A 2IC3A 3K7RA 2HS4A 1VBZA 1Q82T 2MKCA 5E7OB 5D4LA 3ZZRA 2DGQA 3I0RA 3MEEA 4FF1A 4ZPDA 3N5FA 3DM2B 1KD1T 5AJ3F 1SV5A 1ELOA 1YRTA 4DSFA 4F3OA 3WC0A 2DIUA 3ULHA 3M2RA 4ZP6A 3CCVS 3H20A 3BS9A 2COLA 3KLHB 1WD6A 3IAM9 2CIMA 4DBQA 2LYVA 3ZZZA 1N52B 4KKOB 3H4BA 2A3JA 2HMIB 1UFLA 2JRSA 2JC1A 3B4MA 4LQ9A 3O2IA 5KFGA 1S1XA 4MK7A 5C5JA 3QLHB 3DLHA 3SSQA 2JHEA 3KK1A 1T03A 4ECUA 1Y00A 4IRDA 1MW7A 1RT5A 4LSNB 2PFFB 1YVFA 2OSQA 3DI6A 2GNKA 2PGCA 2HWTA 4NYOA 1MROA 2E66A 1VJWA 4C0BA 1BQNB 2IVMA 4OZ5A 1WNEA 3C6TB 5HMYA 1UVJA 1BQMA 3RU0A 2C2DA 5THWA 1HMVA