1BE4A

Nucleoside diphosphate kinase isoform b from bovine retina
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
151
structure length
151
Chain Sequence
ANSERTFIAIKPDGVQRGLMGEIIKRFEQKGFRLVAMKFMRASEDLLKEHYIDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIALWFRPEELVNYKSCAQNWIYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE DIPHOSPHATE TRANSFERASE
publication title Nucleoside diphosphate kinase from bovine retina: purification, subcellular localization, molecular cloning, and three-dimensional structure.
pubmed doi rcsb
source organism Bos taurus
molecule tags Phosphotransferase
total genus 45
structure length 151
sequence length 151
chains with identical sequence B, C
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1998-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1be4A00
3GP9A 1PAEX 4F36A 1NHKL 2BX6A 3EVWA 2AZ1A 2DXDA 3NGTA 1NSPA 3VVTA 1WKJA 3GPAA 3L7UA 1BUXA 3FBBA 2NCKL 1S5ZA 3DDIA 1HHQA 4W98A 4KPCA 4WBFA 3ZTRA 2CWKA 3BH7B 3JS9A 1NSKL 4ENOA 2BEFA 3WX8A 3FBEA 1NSQA 1WKLA 1NDLA 3Q89A 2DXEA 3EJMA 1UCNA 4ANCA 3ZTQA 4ANEA 1MN7A 3FBFA 4UOFA 3VGUA 1NPKA 2DYAA 3DKDA 3ZTSA 1XIQA 1NLKL 3B6BA 4EK2A 3VVUA 3ELHA 1NB2A 1F6TA 1XQIA 2B8PA 1VYAA 1B99A 3EE3A 5CABA 1EHWA 1S59A 4O0NA 2HURA 3ZTPA 3EM1A 4S0MA 1JXVA 5CAAA 3PRVA 1BHNA 2AZ3A 1NDKA 1LWXA 1ZS6A 3BH6B 1HIYA 1NUEA 2ZUAA 3FKBA 5IOLA 3BBBA 3BBCA 3G2XA 2HVEA 3VGTA 1PKUA 4UOHA 2VU5A 4HR2A 3Q8YA 3Q86A 4C6AA 3FCVA 3VGVA 3Q83A 3EMTA 3NGUA 3Q8UA 2B8QA 1NCLA 3ENAA 3BBFA 2DXFA 3B54A 1MN9A 4CP5A 3MPDA 1B4SA 3VGSA 4DZ6A 1HLWA 1BE4A 4ANDA 1KDNA 1WKKA 1NDPA 3EVOA 3Q8VA 3FBCA 3R9LA 3NGSA 2HVDA 4F4AA 4FKYA 3EVMA 1F3FA 4FKXA 4DUTA 1S57A 2DY9A 3EICA 1NDCA 5C7PA 3ZTOA 3ETMA 3PJ9A 3FC9A 5BXIA 4DI6A 3FCWA 4UOGA 1W7WA 3NGRA 1U8WA 1LEOA 1K44A
chains in the Genus database with same CATH superfamily
1PJ5A 5ETSA 2ILYA 1LXNA 1HBUA 2VQEJ 2YNGB 2AJ4A 4AL5A 1N5YA 4NXMJ 2KB2A 3BSCA 2LXFA 3JTPA 3BH7B 4GO7X 2E7XA 5L9XA 1V9OA 4BWJA 1ZOTA 3RZAA 3OXGA 4MK7A 1RUSA 3TOQA 2I8EA 4FF1A 4ECRA 1DRZA 1VHIA 5K8NA 1RCXB 4DF8A 2C3OA 5IWAJ 1RT2A 4UT4A 2HVEA 3VGTA 2YQ1A 1EZZB 2UV8G 1FE4A 2W9CB 2R8GA 3US5A 2MYFA 3RJMB 3OL6A 5LXRA 2XQCA 1UWAA 4F02A 2DD8S 3KYLA 1ZZFA 2ZH4A 5AE3A 4R0EA 2ZBIA 3EPGA 1T11A 5J2NA 2IM2A 5F9NA 3M8RA 1CS4B 3I4PA 2XSJA 3PO5A 4L6V3 1WHXA 2GQQA 2M70A 3MUMP 2B4PA 2VFSA 4DPUA 2IJFA 1VQ4S 4G3IA 3FCHA 3K5MA 1S6PA 4CLUA 2QMWA 1GMWA 2OH2A 1RAGB 2W7AA 2VHGA 1WACA 2UVUA 4OZ0A 1R0AA 2I1RA 1SJQA 2DGXA 2DYAA 1UEKA 3H5UA 5J1PA 1NO8A 1FDDA 2W7OA 2WB4A 2ZJQQ 3MEGA 1ZAVA 2AV5A 1APSA 2BBEA 3EGVA 3NY0A 3S7RA 4LR7A 4YN3B 2X1GA 5IT4A 3RBEA 2JC0A 2KO1A 5E3RA 4EBCA 3K5OA 5IC6B 2YKOA 4C6AA 2BZ2A 4HI2A 3OVBA 1TV6B 3BDEA 3HSJA 1IM4A 1NJYA 3QRPA 4K4ZA 3HSGA 5KG2A 3VAKA 1JLFB 1UW9A 3K57A 4LT6A 3K89A 1NK9A 3H42A 5F8LA 9ATCB 3W64A 4XPEA 4JI0F 5HP1B 5KFMA 5KFZA 2CQ3A 3HT0A 3QO9B 1N0VC 4KYZA 3PEJA 1UETA 1U0HB 5C25A 4QIFA 1RU1A 1NBEB 3SIPB 4M63A 5D4PA 1IBMF 5D4OA 3X3UA 1S1TB 4FXVA 1ZPWX 4D3HA 3MURP 1N6QB 4R8UB 1S0VA 1FCAA 2QSWA 2PN6A 4O23A 4ERDA 2VOPA 4DLGA 4AT1B 3Q86A 1F2HA 5AJ3F 2RU3A 1RHMB 3P4UB 4TN2A 1T9WA 4WXOA 1HHSA 3CF5Q 4DSKA 3HVAA 4JBCA 3I0SA 2D41A 4OX9F 4O3OA 3EWGA 3HVWA 4QIVA 2FZCB 1OPZA 3IBFB 4DR5F 5B0DA 2RIJA 2P8IA 2YNIA 5KG0A 4NLGA 2GC8A 3H4DA 3FSXA 3H2VE 4ED2A 2V2QA 1QTMA 3GFZA 4M1KA 4ILMA 3MMAB 1ACMB 5KFKA 2W25A 4J9VA 3O6QA 2KH9A 1NMEB 2MSTA 3BO2A 3QSYB 1NZAA 5M2PA 3MXHP 4WP3A 5DDRC 4OHZA 2B8PA 1VYAA 2FGOA 4IRDA 3VZHA 2QRRA 2BW2A 1IWGA 4ECWA 1YRUA 4RUCA 1HA1A 3H0PA 4ZPCA 3QIPB 4YR2A 3EMTA 2M7SA 2MZSA 1WI8A 4DUZJ 1X9SA 5ETQA 4KIAA 3B54A 4CH7A 4DJBA 4WK3A 5D8HB 3BQ1A 3QIDA 2NPFA 3C3LA 2QMXA 3MM5A 2ZBCA 1B7FA 4QIEA 3G8TA 2W8KA 1XR7A 2HIYA 2LFVA 4DV5F 4RNFA 3EDRB 4USJC 4F36A 1DLOB 4ZVSB 1MROA 2DGUA 3L7UA 4FYYB 1U1LA 4DR4J 3CWJA 4ITSA 2VQFJ 3V4MA 3GR0A 1QM9A 3R97A 1S0OA 1OJ4A 2ZOFA 3M8ZA 2A3JA 4U7UD 2UVRA 3IG1B 3KK1A 2CPYA 1FHTA 2BEFA 1XMQF 3DOMA 1N34F 1C4AA 4DQPA 3ZTQA 1M5VC 1URRA 1T3NA 3ZZ0A 2BJ1A 3C8YA 4OI0A 1L3UA 4O3SA 5A8KA 1TL1B 2KRRA 3TAMA 1REVA 2B9XA 2ZH6A 1P1LA 2BE7D 1VBZA 1TZ0A 2FC8A 1WI6A 1KLNA 3HHDA 2PI5A 4LRCA 1UVIA 1YWXA 2ZH8A 3MECB 1NRKA 4XIUA 1KD1T 5KOWA 3CGIA 1MN9A 4QR1A 4KSEB 2IHR1 2HS0A 1H2TZ 2W7PA 1JLBB 2CQ1A 2BE2A 1XMOJ 3HX9A 2OPPA 1U8WA 5KFHA 4LF9J 1B3TA 2PMZD 4LSLB 2CNLB 3ZZUA 3TANA 1FKOA 3FFIA 3ZTRA 4NWBA 1ZTWA 2DNRA 3CDWA 1T9XA 2O5DA 3T19A 3WBZA 1EP4B 3PX0A 3DOKB 4B3TF 3RW7A 2Z4PA 1FJEB 4NLWA 4C8MA 1Y0HA 3OR1A 2F3JA 1WF0A 2B4VA 3ELHA 5I3PA 1RTJB 4OYIA 1Y5NB 4E8UA 4RX6A 1VQ9S 2CPHA 1TKZA 8RUCA 3N6NA 4ZJQA 1FVQA 2POKA 1RLCL 3TUIC 4WJBA 1C1CA 2K3IA 2D9OA 4X4TA 1MSWD 3MUVP 2JRSA 3UFCX 1IKWA 1TTHB 3DU5A 4CP5A 2WVEA 3M2RB 1KQKA 1SKRA 5GAHI 1S9FA 5U47A 3EVMA 3KG0A 2W9BA 2R2UA 3HZEA 4PEOA 2KYZA 2V94A 3OSPA 3FEXB 4B17A 1IXKA 1N5YB 2N3OA 2J0QD 4UY8T 3VVTA 1EIYB 5F3TA 2UUBJ 4F4ZA 1NK5A 1GTEA 4KQZA 7FDRA 3BS9A 5J1EA 4PQAA 3OTCA 4A8YA 1HD1A 3T9NA 1TAUA 4X65F 2HHXA 1IBLJ 5HATA 1M1GA 2IJNA 1MWZA 2HS3A 5IT9Y 2FQQB 3PRDA 3OVSA 3PRVA 2FHJD 1MLAA 4UOHA 3CJRA 2PFFB 2DK2A 2QO3A 2FVQA 1UWBB 4K4SA 1SPBP 3LP0A 3TNVA 3UNYA 2WSFC 5J2NB 4IQXA 3KG4A 1REGX 5L1LA 5D3GB 2XSJB 1VQSA 3NNHA 3R9LA 3SMZA 2GJIA 5GAEU 2CQHA 2EC0A 4RNHA 4FF3A 1NDCA 1OY9A 4P73A 2IBKA 5E3CA 4Z2XA 1NHKL 4DSLA 1RXOB 3K17A 3HI9A 2KRBA 1Q53A 4HH1A 4N5SA 2NCKL 4YOEA 4Y3CA 2BOPA 1R0AB 1SUQA 1B0TA 2V4RA 2DKOB 3AODA 4QJVA 3ZZYA 2QFJA 4ELVA 1NHUA 2IVYA 3MEGB 2ZM6J 4K4XA 3B6BA 1FWPA 3CO0P 2B3TB 3CXCR 1F1BB 3EM1A 1S76D 2VKZG 4DV7J 5A2QY 8AT1B 2OPRA 3S6EA 3UD4P 2Z8QA 2HWHA 4F4YA 4Q7AA 3THTA 5I3UA 1QAYA 4KTQA 3LQVA 4JB8B 1N54B 1RAEB 3HO1A 1XK8A 3MHYA 3E2EA 1S6UA 2IRXA 5G0RA 1Q8IA 4OZLA 1OSDA 1QVGR 1P8GA 4BLGA 5GAGI 2Q66A 2XY6A 3CD6S 4MK8A 2G2YA 4Y6IA 5E3QA 2V0NA 3NG8A 2ZOGA 5C25B 2ZBRA 1D8YA 3IAS9 4ZOSA 3BSOA 4NLRA 2V9WA 3MFHA 2M9KA 1YK9A 3PYFA 2H5IB 1CJUB 2R7WA 4RUHA 3W61A 4K2XA 5HSPA 3HDSA 5B0EA 2YX4A 1NK0A 5B0GA 2FJEB 2BJ7A 5J2PA 2AIRB 3JQKA 3GG1A 3KK2A 1DURA 2E5HA 4N8NA 5A8WB 5JXSA 1VRUA 2ZUGA 2YKMA 1UFWA 1H73A 1PG5B 2QLFB 2CZ9A 1J2VA 3I0SB 2VFUA 4TY8B 1TVRA 1S49A 3MPDA 2RAQA 2AWZA 2J7KA 3KFWX 2E29A 2GCFA 1FO1A 1RK8A 4FKYA 3J7Z5 4ZCMA 5LMNJ 3GV8B 4ZN1A 5EX3A 4TLQA 1RA6A 1JJCB 2YNIB 1VQMS 1CQNA 4K7QA 2ASYA 4W92B 4IH7A 3G6VA 2YKNA 1DTQA 4KAIA 5MAOA 3CVKA 4DL3A 4H4KA 3OV7A 1JQGA 4JI8F 1PSDA 1IUJA 3DHXA 2V4QA 1WJ9A 2FPHX 2MKKA 1AZSA 4ED3A 4OJ1A 2CXEA 3MF5A 2AEJA 1XIQA 4AUKA 3TVYA 1X4GA 1ZA1B 2KZMA 1EJ7L 2KG1A 1RAFB 3NP5A 3BBBA 1GQEA 2FY8A 4ZA1A 5GVQA 1PKUA 2LXUA 5AXKA 4DL0C 2UXDF 1TL4A 2GAHC 4TNOA 3VAHA 1N4LA 2FYXA 4CLPA 3LWLA 3TA0A 1RU2A 3VAGA 4JI6J 2RHSB 2R8JA 4WFZA 1B4SA 2FLNA 2IYGA 1N36J 3OL8A 4PWDB 4CO0A 4NOHA 2Z0GA 1U1OA 2RSQA 2VD3A 3SQOP 4DSEA 1ELOA 2OHDA 5HBMA 1HBNB 4QIGA 2DGQA 3EVWA 2CVEA 2VONA 2ZH2A 2N4DA 2JWNA 1UMJA 3DOMB 4C0HA 4AE5A 3PKYA 1X7VA 1BXNA 2RKIA 5DGBA 2A2CA 2X1BA 4GVBB 1TR0A 2HAFA 1B7YB 3WX8A 2GJ2A 2HWTA 2Y8WA 3MFIA 2DHSA 3BM7A 3TAMB 1REVB 4DF4A 4JI7J 5F9LA 2CQ0A 3QNWB 4IUFA 1N32F 4Y2AA 1NH7A 3OJSA 4MK9A 1SB6A 4EUVA 3CO9A 3Q8YA 4A8OA 1OSCA 1A7GE 3PZPA 1RWPB 4QU7A 4UUWA 3DLBA 1SL0A 2AX1A 2OTLS 3NCQA 5KFAA 5EWGA 5ETLA 4H4OA 2OPPB 4K4WA 2BJ3A 4J9MA 1OS5A 2HZAA 4F26A 1G7CB 3MR5A 1RHRB 4LQ9A 1FKOB 3FFIB 2YQ3A 3DNCA 2DH8A 2ROEA 2PC6A 2B5JB 3KXDA 3W1YC 1OQ6A 1TK5A 4HI1A 1LQ9A 2MJUA 3QRRA 2FVRA 3OSNA 1SJ3P 3OR1B 2NXNA 3BV8A 4JV0A 1DQ9A 3BGRA 3N4WA 3VGUA 1HI0P 1FX2A 1C1CB 3ZTPA 1MU2B 1VC5A 5KG5A 2C2EA 1IKWB 3FKBA 1RQ0A 4NXMF 3D54A 4F8RA 1RTDA 3ZNUA 2BQ3A 2LQ9A 3BGOP 3LUYA 1AFJA 2ZBPA 1BQMB 2W9BB 5DG9A 3AAWB 3H2LA 4P9SA 2COLA 3UE2A 3FQLA 5ETMA 4HH0A 1BQNA 4PZVA 3TWZA 3VAIA 1E6YA 2V2ZA 1IKVA 1H7WA 4DQSA 2HQCA 4ED4A 3A3PB 5IWAF 1SH3A 1BMQB 1FEHA 3EGWB 2XGQA 3BSNA 3CT9A 5J1EB 3I0RA 3SCJE 4EFAC 3F73A 4ED7A 2HHWA 2X7IA 2NREA 1R8BA 1UFKA 3OBIA 4CM0A 3OR2A 3D2WA 3IM8A 4CLSA 2AGOA 5ADZA 1S1WA 1LV5A 4I6WA 4MYTA 4NZ0A 1S59A 3D7SB 4HACA 2F65A 1UVLA 3I55S 3LP0B 1ZZNA 2UZAA 1S72S 2JDJA 4RLEA 1RYSA 2YWFA 1S10A 4C11A 2DNGA 2E7VA 4KHPJ 1G4CA 4DZ6A 1QAIA 4RU2A 2NUHA 2RHQB 2J9CA 4OYPA 4HYKA 3J81j 4NZ6A 3U1NA 2HNZA 1RT3B 1YJNS 2R7VA 3CCQS 2YWEA 1U1RA 4QPXA 2EKYA 1SUQB 1UKUA 4M5KA 2V8DA 2NXJA 4ZKAA 1N48A 2ZOMA 1MW7A 3LGHA 1R8AA 4QWAA 2OAUA 3MOZA 3O8WA 5DQHA 2XWXA 1VK8A 4FF2A 1ITPA 1ROFA 3QT7A 5K8MA 2BXJA 4NCAA 4ETZA 3B78A 1SV5A 4DL2A 3LPEA 3KJFB 3CJ0A 2BOAA 4X2BA 2PFDA 2W9AA 5I3UB 3RAQA 3CE8A 1HWJA 2Y1LB 4CDIA 2WRMA 4YS2A 4L3NA 3DFEA 5IC4B 4JI5J 3IWLA 3QZ7A 4X4QA 4X64J 4OYAA 4DN9A 2ZEJA 1KVKA 1KS2A 2Z58B 4B9TA 4OZ2A 2ZDOA 2CQCA 1KVJA 2IYIA 2HLUA 5SUHA 3DLHA 3PYDA 4DU8A 2XMJA 2KVQE 4YB6A 1D0EA 4DR2F 3SI8A 2WOMB 4B9LA 2YKAA 2QLXA 1WEYA 3QAEA 2RB7A 2V63A 4FXDA 2YNHA 1NJIT 3W65A 5J2PB 4KKOA 3AOCA 4O4RA 2V5HG 2FJAB 3KK2B 1JXVA 2YKMB 3ONQA 4IR1A 2V69A 4PPZA 4U7CA 3SBMA 4UZBA 1TVRB 2JEFA 5D4NA 4DCOB 2AYEA 3M8YA 3HVTA 2GX8A 3M8WA 3BR8A 3M2VA 3N5BA 3CMAS 3GZ7A 3M9NB 2QL5B 4TXSA 4NLDA 1DHMA 2XO6A 3L9ZA 2MKYA 3JSMB 3MAHA 2U1AA 3N0VA 4RU9A 4UTGA 2Y0BB 1VS3A 1F5AA 4C48A 3VAFA 1T94A 4DQQA 2MQNA 1PJ6A 2JVOA 3TAPA 4QPTA 4DV6J 3PR4A 2E5IA 1AUDA 1HYSA 3D6HB 3MCSA 2EVZA 4E2FB 2R8IA 5L46A 2LU2A 4ZIWA 1TFWA 1NSKL 1SKUB 2DCUB 3GILA 4LFAJ 4J37A 4LJMA 4EYIB 1RAAB 5EGYA 2FVSA 4WFYA 1VC0A 1UPPA 2DEJA 4G6VB 1M90T 2DPIA 3K7RA 4ZVEA 1T7PA 3HF5A 4BDPA 3NBPA 1KR4A 1PO6A 2VQFF 1KLMA 4CO2A 4O3RA 2CQDA 5D0GA 1K8AT 3DYAA 5M2RA 2RRAA 5DGAA 5HBMB 3D3CJ 4F3QA 4J9LA 4IR9A 4F0MA 1NK4A 2YWGA 2WW4A 2ZNYA 1QVFR 1Y00A 4MYUA 5IQQA 4JOUA 2CUYA 3J7YU 3QGGA 2UVWA 4MMOA 3FZ2A 4WBFA 1BLUA 2J76E 3O3LA 2GAGC 2F40A 1EETA 1SQEA 4WU2A 2Q3PA 2GV1A 1F3VA 1TK0A 3O5TB 4OI4A 2WAQD 4NXNJ 2EFQA 1TQLA 4RPFA 1IKYA 1HPZB 3KUHA 1XMOF 3TP2A 4KR0B 2BM0A 4OFZA 1OWXA 4L75A 3QYYA 4LF9F 2XCAA 1SC1B 4Z37A 2G4BA 3CCUS 2E1AA 1V5IB 1WC4A 1ZPVA 1WOSA 2XMMA 4HVZA 4H4OB 4WE1A 4FDFA 1QLNA 1WELA 1T9UA 4FKXA 5LSOA 3MEDA 4QW8A 4F4XA 1M1HA 1M5KC 1JLCA 3H59A 2YPYA 3NGRA 1HQEA 3GP9A 5D4LA 2HQFA 2JEJA 3RBXA 3T5LA 3EXYA 2E9TA 3TJ8A 1DQAA 1WNEA 1Q79A 3BGRB 3W2VA 4QWCA 1R8PA 1IKXA 2B9EA 2VG7A 4TU8A 2IVFB 4I2PA 4B3OA 3D5MA 3Q2SC 1U6BA 1RYRA 1VQLS 4USIA 3V4IA 1YBAA 2HVZA 2WONA 2GHWA 3OD2A 2HFZA 1HFEL 1NUEA 3PM9A 2VIHA 4NPOA 3GYXB 4OYOA 1IBMJ 3KLFA 2UUBF 2C3MA 3NGUA 1JJ2R 2RU9A 5HMZA 4ECSA 3CIMA 2IAJB 3T6JA 3CD5A 4B9NA 3K58A 1E6YB 2IJRA 5EHHA 1IKVB 3N01A 1FJGJ 3BYRA 1IVZA 2HQDA 5F8NA 2VG5A 3HFVA 3GLJA 3AH6A 1YG0A 1IBLF 1S57A 2GVZA 4DBQA 4K50A 3HPOA 4I56A 1KTQA 3V6DB 1MNEA 3BEGB 9RUBA 1PYOB 3DGPA 4OX9J 3DRSB 3PVXA 1KN6A 1LXJA 1VQPS 4W98A 4ZVPB 3OR2B 2W2OP 7FD1A 4ED6A 1NKBA 1S1WB 5LXYA 1FFWB 1YIJS 1IJEB 4DR5J 1C4CA 4OI1A 4F4KA 3H5SA 3PR5B 3RB6A 4GO5X 2YPZA 2DNMA 3M7VA 4UZCA 4ZVHA 2KFZA 2V8PA 1H98A 3LP2A 2FUG9 2J0WA 2ZZMA 3D1QA 4C11B 3J80U 5HQLA 5F0WA 5A6WA 4NX9A 2XY7A 3W8PA 3CMES 4ZITA 2H9ZA 3AA8A 3FK4A 3PW7A 5KT2A 2IC3A 1JWWA 1HNVA 3AOBA 5IZHA 2V34A 2D69A 4KT0C 2HNZB 1QSLA 2PGCA 2CFXA 4F4AA 2ZM6F 4CLKA 2FHOB 1PC5A 1GXLA 4FVMA 3BKTA 3WHIA 4O3NA 4DV7F 3A1YG 3W2WA 4HT7A 3I32A 2Z57B 2J9EA 4ID8A 4CWBA 4C2MA 1TL3B 1CEZA 2RQ4A 1JLGA 1PBAA 1S5ZA 4LVNP 1HI1A 4A4JA 1HHTP 3G87A 1SH0A 4WIQA 4UW2A 4DEZA 4DV5J 2BKPA 3J7AN 4G1IA 2W4CA 2B6AA 4BWMA 2K1RA 4P71A 4ELTA 3UPFA 2P2CB 1SV5B 3CCSS 2VBXA 1C0TB 4KHRA 1KSPA 2HQIA 5D0HA 2DHGA 1RJJA 4H4KC 3PHTA 2QT7A 2SXLA 4LF6J 4DG1A 5HK4A 1XMQJ 1N34J 1HWUA 1OQ3A 2KJVA 3QSIA 4USHA 3QWUA 2RD5C 1C0UB 1GMVA 4NLOA 5DZ6A 1QD1A 4QU6A 1S79A 2XWYA 2XS7A 1RA7A 4QR2A 4PUOA 2E5JA 1R27B 4DCJB 2GQCA 2YWWA 3POTA 3A8IA 2DNQA 1ICEB 3D6TB 5DQIA 3DLJA 5BXIA 1CVJA 2C1EB 3NOCA 1VJWA 2MQMA 3FGVA 4RW4B 2ZJPQ 4J9QA 3VCDA 2OEJA 2IFXA 3M8PB 4CT9A 4M5LA 2AZ1A 1KRPA 2OIHA 4DMZA 5K5MA 3EPIA 1BUXA 3TA1A 3M32A 3DDIA 4ZJOA 2UXBJ 4KPCA 2VG6A 2YNHB 1T9TA 1HNXF 3DN9A 5B08A 4KKOB 4P75A 4NYPA 3ICLA 2QC3A 2DR7A 3FQKA 3DOLA 2M5YA 2GMJA 4O0NA 2GW8A 3OTBA 2BYCA 3C6UA 3FCVA 1W25A 1K0TA 3M2VB 5F41A 4X66J 2CPDA 3Q8UA 4KH1B 1V3ZA 2DR9A 4N47A 2HRYA 4USKA 3KJVA 3IN5A 3R6LB 3NL0A 4RUAA 1K1QA 3E01A 3FRZA 4H4MA 3WZ0A 2MLYA 4PPDA 2KHCA 3RU0A 3R6GB 3UDCA 1HYSB 5LSRA 2KN4A 3M1VA 2PA8D 1LEOA 3L09A 2XS2A 1S99A 4X4RA 4CIOA 1LW0A 1UL3A 4YUDA 3CJKA 4CCHA 4E98A 2EFVA 2GGPB 2NLWA 3VQSA 4JI6F 2BANA 4I64A 1TUGB 4RJVA 3VHQA 2D1CA 1N36F 2V8GA 4OV1A 2PI4A 3AT1B 1SC4B 4ZCIA 1TKDA 3IAM9 1R0BG 1UP1A 2I9SA 5F8HA 3NBPB 1RT1A 1NK6A 3N6LA 3R5AA 5A8RA 3MMCA 2XMUA 3IR7B 5KG7A 1FKPA 4DV1J 4PG4A 4X65J 4MIWA 3R5CA 3DYAB 4ZJLA 2BUNA 2D3O1 1C1BA 2G0CA 3PCOB 2UU9J 1WHYA 3BPSP 3CC7S 1NH8A 5JJBA 4DPTA 4HLBA 1WTBA 2KFNA 2DTJA 4OZ5A 5J2MA 2HVDA 1Z4UA 3K8VA 5FJ4A 2MHNA 4ILRA 3FRYA 3I87A 2MQQA 3GMGA 4HHJA 4JV1A 2DNHA 4K5RA 4PCQA 2EG2A 4FPIA 2F8HA 1PCAA 2EK6A 2G2ZA 1UW4A 5LOQA 1YDLA 1JIHA 3ENVA 3N79A 1TMMA 1XTZA 1EETB 1Y5IB 2JZ5A 4FN5A 2A1BA 5AT1B 1WHVA 3CCRS 1X4BA 4LR9A 1VBYA 2LVWA 1IKYB 4C3KA 3UI3A 1K73T 1RTHA 3JYTB 2K7KA 1P9QC 4C3LA 2BDPA 4O3QA 5L8RC 4EMDA 3MZIA 4J5OA 3TX8A 1I1GA 3PEHA 5KFYA 4KGKA 1RTIB 1YZ7A 4PAAA 4IFYA 1J5OA 3MEDB 1WKKA 3CDEA 3H5XA 1D8ZA 1N33J 3V81A 2KT2A 4OYZA 4O44A 2C2ZB 4OI2A 3P5TL 5ETTA 1Q8KA 3ZZOA 1HQEB 1KP6A 4HDHA 2HVIA 4LR8A 4QR0A 2AJQA 3TI0A 2HHTA 3KHGA 5KT6A 4IFVA 3CCJS 5ETKA 3MR2A 1VDHA 4OL8A 3W2VB 2XMAA 4CLTA 4YR0A 2RVJA 3HHLA 2VG7B 3QBCA 1YJ9S 4I2PB 2PD1A 1UZHA 2NXUA 2F63A 4DL7A 3GR1A 1GTHA 3V4IB 3G82A 4UQTA 5KFXA 2WONB 1QDUB 3N9UC 2PEHA 5H9EJ 4WKRA 3TARA 1XNRF 2GA7A 3KLFB 5A6PA 5IQ6A 1RGVA 3HFKA 3B4DA 2GFFA 2QA2A 2KU7A 3QGIA 2WBMA 2M4MA 4ZIVA 2AQ4A 2VG5B 3NNCA 2OMLA 2XLJA 1TP7A 3HXMA 1RWXB 6FDRA 3J7ZT 2ZITA 3W62A 1XWLA 4PWWA 5KFBA 2CPEA 1R89A 2BJ8A 3DGPB 1SJRA 3CDUA 2LECA 5E2QA 3UCGA 2M52A 4E0DA 3T6BA 1FD8A 3KHLA 4U67Q 2V4JA 4U8VA 3NCRA 1SIZA 3MPWA 4ECXA 3HZGA 4FNHA 2YY3A 4KHPF 2C42A 1X8DA 4DPXA 5FIIA 2YKQA 4X4PA 1FFGB 2ZH5A 3DGVA 4LRAA 3QLHA 3LP2B 3OUYA 2EW9A 2I6WA 1L5UA 2F8EX 2G0IA 1N5TA 3KLGA 2IC3B 1R31A 1HNWJ 4DL6A 2VZ9A 4JV5F 5KFVA 4I4BA 5L1IA 1O8BA 5CYQA 5AXMA 2XMVA 3N28A 1D9AA 3G8QA 2MMYA 1U26A 5F8MA 3W5XA 4F0HA 2FY1A 2R2RA 5BYQA 1H6KX 2R7QA 3TA2A 3NGKA 4DFPA 5CCMA 3AD9C 1UJ4A 5MLCV 2WCXA 4WCEQ 3W2WB 3R7BB 5IV3A 1JKHA 1VBXA 4OHYA 5CH7B 4ETXA 5J1NA 1JLGB 1VMBA 5DDPC 1S6OA 1SQGA 4QWDA 2O66A 2PDAA 1HNZJ 1HQUA 3GB0A 2HBYB 4ZMMA 1Q7LB 1CQMA 5HJYA 1RAHB 2B6AB 2K1RB 5CYMA 1Y7PA 2HYIB 3MOJB 3WQPA 2DIUA 2EFOA 4JI5F 1ZM3A 3AJ1A 4URQU 3GIKA 4QYZJ 1O0PA 4X64F 1IJFB 3C14A 1DARA 4DG1B 1U0SA 1Q8BA 4CNYA 4PR6A 4ED8A 3KLIB 2QV6A 1NM2A 1S9EA 4NA3A 2KL8A 4AXJA 4PUOB 5C2CA 3EDQB 3J7YI 1TAQA 2RT3A 3BPDA 3POTB 1F9HA 4C8YA 2B51A 2DO0A 4ECVA 3TX0A 6AT1B 5T41A 4ZVTB 1YI2S 5KFCA 3FMWA 3UVJA 2B4OA 3CC4S 4B9SA 1TL7A 5K8OA 4I1TA 1Q8LA 2AHOB 2VFVA 2XG8A 4YB5A 5E41A 4PABA 2D3UA 2VG6B 2YNFA 2VICA 5KFSA 2AW0A 2OKQA 2VH7A 3T5JA 4Z7CA 3H98A 4A8XA 2FVPA 3CJ3A 3FSIA 3UR3C 4YFUA 2CA9A 4Z7YA 3A3OB 3CDAA 2RQCA 4DQRA 3W8GA 1SQFA 1IR1A 1AROP 3LTOA 4K4TA 1SJFA 5KFWA 1NZ8A 3MPVA 3C6UB 3PYGA 2BM1A 2G9OA 3PJXA 1IN0A 4LF8J 4DV6F 2XGPA 2VV5A 4A48A 3PHEA 4JUZA 5EN1A 1WF2A 3CJQA 1NU4A 3W9JA 2F9JA 1VGYA 2E9ZA 4LFAF 3E01B 4H4MB 2RDIA 1VIXA 5EX0A 3S01A 2WSCC 2C3PA 1EARA 1R43A 4L74A 2N4CA 2OD6A 2RJZA 4IDKA 3M1VB 5HAOA 3OHAA 5E7OB 2VJVA 1VRTA 1LW0B 1WHWA 1S1VB 1X9WA 2BANB 4KB7A 4YDDB 3SFUA 1JB0C 3Q8SB 3ZFVA 5KTQA 2D3ZA 5HLFA 2CWKA 4FYWB 1VI7A 3KNGA 3ITHA 3LW5C 4GMKA 2LQ8A 3RR7A 2PMHA 1RT1B 2XNQA 4KO0A 1CPZA 3UDVA 3MMCB 2W2NP 1FKPB 1NJZA 3ZZRA 2M3DA 1EHWA 4YHHJ 5HVFA 3U02A 3W3SA 2MZJA 2C3UA 4ECTA 2MKCA 2VODA 3NMAA 4KPYA 4WTYA 1IQTA 4F2SA 1S9GA 2WHOA 5IV4A 4Q8EA 3MAAA 2EBGA 5J2MB 2ASDA 1SXLA 3OFEA 1N52B 1FKAF 4K5SA 4X4NA 3IO1A 2X1AA 1C2PA 1AT1B 4ECYA 4NXNF 1W2IA 2O01C 1QE1A 4RNOA 2PA3A 2LU1A 3ETMA 3E51A 2HMIA 2FJBB 1FEEA 4NMLA 4NEYA 5LM7E 3VTIA 5DQGA 4DUYJ 3TR5A 2EG1A 1AXQA 4MT1A 1QAXA 2WW8A 5HROA 1JLEA 2CJAA 4CLWA 2GMHA 4N41A 2OFHX 3S1TA 1WOOA 4EO8A 1V3SA 5RUBA 1R8CA 4X62F 1ZAXA 3TAQA 3HD2A 3GIJA 2HIQA 1LWCA 5KG3A 4OZNA 4FVCA 2CJQA 4XDCA 1NKCA 1X4AA 5LSLA 2XMKA 3OJUA 4IFYB 5DLGA 1J5OB 3G86A 4OHVA 3V81B 3RG6A 4O44B 3DXBA 1FRHA 2KI2A 5IFMA 2Z56B 2YWHA 1Q82T 1FRKA 2GIRA 4J90A 3VF0B 5KFUA 1RBLA 2ZE2B 3FC9A 2FLLA 4IFVB 1CJTA 5KT4A 4HL9A 5HN0A 4NEZA 1HMVB 4C97A 1KVIA 4JI4F 1NSPA 3OTOF 3NAIA 3HLUA 3GJSB 5CCLA 3QQCD 2PEBA 1VQ5S 3SXLA 3G82B 4Q44A 5F8GA 5DLFA 4NYZA 1FJGF 1CC7A 3GQCA 1RHUB 2KT3A 2DXEA 2IY5B 2ZJRQ 4U9RA 1DQ8A 3ADAC 2BV3A 4AQYJ 4KY3A 4EK2A 4DR2J 3QFWA 3GYNA 2MDAA 4NRTA 2EI5A 4ZCLA 5A0YA 3GFXA 4NMXA 1VQ8S 1YGYA 2FHKA 3BBCA 2DBBA 3BO3A 2NZ4A 4DQIA 2DNLA 1RT7A 1ZM4A 4ZPBA 2RRNA 4NLQA 1URNA 3H90A 3W63A 2KFYA 2JLFA 3OVAA 1NKEA 4EU0A 2HAIA 2V50A 2EWHA 1XNQF 3R7NB 4TY9A 1PC4A 3R5BA 2P9GA 2VPWB 3HSDA 1U2RA 2M8DB 4DFJA 3IS9A 3BN7A 1I94J 4DV4J 5EWFA 1X5TA 5B7WA 4MIBA 1NB7A 2CQ2A 1YKWA 2OGUA 5JUMA 2XZTB 3QLHB 3MMJA 5C24A 3H4BA 3J80Y 3IGVA 2LA6A 2J8AA 1H7XA 1NPKA 4PG7A 3KLGB 2IM1A 2BW7A 2K3KA 2OELA 2BJ9A 1HQ2A 4X84A 5CYQB 4LRBA 2EKNA 3MPUB 5KFRA 3PV8A 4ZLPA 4ZPDA 2IM3A 2MLXA 5KFNA 4M5GA 1WG4A 3GIMA 3OQ2A 1WC3A 4J7CA 4NCGA 3NAHA 5H9EK 1R6YA 1ZM9A 2AMCB 2HG4A 5D77A 4ID5B 1Q1KA 2JC1A 3ZNJ1 3NXZA 2LQ5A 1HQUB 4LF6F 2AJFE 3U1MA 2XLKA 1I5OB 3ZZTA 5L9NA 4PYDA 2BMBA 2RF2A 2VBYA 2DGWA 3JXOA 3LH2S 2Q43A 3K0JA 4IQMA 3IWNC 2CZVC 1JK9B 3MEKA 2UUCJ 2B7BB 2HGNA 4B3SF 4R5PB 2HNYA 4TYBA 1UJ5A 3A4TA 2W2MP 1UZDA 3W5ZA 1B0VA 4WWSA 2HPUA 1S9EB 1VLYA 4ZVFA 2ZD1A 1U02A 3C2PA 2R7OA 3TZXA 2HWIA 2JJ4D 2VASA 2ZUAA 1TFYA 3MEEA 3PFOA 1IBKJ 2UXBF 4PXEA 3QATA 1WSRA 4HTIA 3L95X 2VPXB 1U1MA 2NPIA 1Q5YA 4NLPA 3KK3A 2BJEA 2BRLA 2JHEA 2Q6CA 1T8EA 4IO9Q 3PO4A 1X60A 1WTFA 3UNGC 4DUTA 1RWUA 2JFKA 3DXSX 3GYGA 4UUXA 3PJ9A 1QAJA 2ZHBA 3EXCX 3LAMA 3BGLA 3LP1B 4KGVB 4DR3F 1PAUB 2UUAF 2H5EA 2W9CA 2H3EB 4JP8A 3EGZA 4X66F 1XC9A 4YB1P 2KG0A 1E6VB 4FBTA 3H20A 4ENOA 3CCWA 2V2VA 5K9FA 3FUYA 4FS1A 1LOUA 1TK8A 1PYSB 1VRQC 1NJXA 3T5HA 5CZXA 1GH8A 3SDEA 3MM7B 2XZWA 1U48A 4WP8A 3P8BB 2Y1IA 4AXIA 3ULHA 3SFGA 3I5CA 2Z2LA 4KHMA 2ZNZA 4WZQA 2L9WA 2FGCA 2VU5A 2KZZA 1FWKA 4DV3F 4K59A 2LMIA 3IXQA 1HBUB 2ROGA 5CQGA 4IDKB 3ZC4A 4QYZK 3R5JB 3JSBA 2E7WA 2W4DA 1VRTB 2Y0SD 4LIRA 1TMJA 2FB0A 4A8QA 4LRFA 4DL4A 3G9CA 4P74A 2CPXA 2L3MA 3CNQP 4USVA 3F41A 1JJ4A 4I7FA 1F9EB 2UVVA 4DV1F 3CMQA 4U7UK 2MTLA 1YX2A 1GAOA 5FDLA 2UU9F 2VBWA 1RT2B 3ITHB 4YY3J 4RW7A 2AJ2A 3N6MA 1RHQB 4F4WA 3OW2R 4KO0B 5H1SV 2AJ1A 1U8SA 1U6ZA 2LYVA 1WKLA 2ZZNA 4XO0A 1JLFA 1KHVA 3LAKA 4Y2MA 3QRQA 3AB2B 2CNKB 2V6AA 3U27A 4OI6A 3LA0A 3HHLC 2CPFA 2HHUA 1S9GB 2XB2D 3QO9A 3MAAB 2DNZA 2IDEA 1JNRB 4L73A 4P2FA 4QYRA 2AYBA 3G2XA 2MZ1A 2HGMA 1YJUA 1U0HA 2P5VA 4FYVB 3LOUA 2CG4A 2IIHA 3C16A 1S6PB 1K47A 2N7CA 4I6AA 3Q8RB 2WBRA 3P96A 5D15A 2VDIA 2HMIB 1MWQA 2BQUA 2A6OA 1RCOB 2YX7A 1N6QA 4I2QA 2MY8A 5H9FJ 5G4DA 2ROPA 2PT0A 5BR8F 1FRMA 5HROB 2IRUA 2OO4A 1JLEB 3M6XA 2DXDA 4MKAA 2RILA 2RNEA 1FJCA 1OIAA 5ETNA 4KE5A 3B8HA 1NK8A 3D0IE 5F8IA 3RRHA 2IA0A 2DGTA 1FDBA 2OPQA 3FSYA 3Q89A 1LWCB 3KLEA 1RADB 3EJMA 1N33F 2V8VA 3C6TA 4DR7J 3DRRA 2MZTA 5DM7Q 2AP6A 1BQXA 2AX0A 2G0JA 3BO4A 1HD0A 4C98A 2RS2A 3GJTB 2PIIA 1YBTA 2F1FA 1FRIA 1M5SA 4CO4A 2RH3A 3NS7B 4O4GA 4A46A 2BVZA 4DV2F 2GJFA 1CJTB 1Y5LB 2A0FB 3AXKA 3PKMA 3THVA 3BGUA 3JSRA 3V6KA 2RQMA 3HD1A 4USUA 1AA1B 1W26A 2ASJA 4OX6A 4V1Ak 1X5OA 2MKHA 1XBWA 3G6ES 1IQZA 1WG5A 4USWA 1K9MT 3UR0A 1UAWA 4WU3A 5A0YB 2XULA 2BKOA 2GS8A 3THPA 1U4BA 3MAQA 1FXLA 1U7LA 4GC7A 1BD6A 2QL9B 3DM2A 3RBDA 1HNXJ 2DNOA 4Q2MA 4B3MF 1Y4ZB 2MPUA 5J2QA 1ULRA 3TRGA 4B9UA 4DS5A 3R7SB 1T03A 1AYEA 2ATCB 4ER8A 2NS1B 4NLYA 4ZPVR 1RSCA 4C9DA 2XCPA 1UFLA 2B9YA 4YDXA 3DRXA 3X1LB 3AQOA 3CEDA 4HEA9 5IXUA 1RTZA 5AE2A 1RWWB 4NLTA 1FESA 4LF2A 3FCWA 4K8RA 1N5SA 5C42A 2CJKA 3G8SA 3A3NB 2NZCA 2Y9HA 3IS9B 1HNWF 2HVHA 1Q78A 2HK3A 3UDEA 4M5NA 3LGMA 2R8HA 2QEXS 4WFNQ 5C24B 1S48A 4RW6A 2AT1B 4IKAA 2DCLA 4OZ3A 1NSQA 4H54A 4ANEA 3BKUA 1J5EJ 2O3DA 3CCTA 2QLJB 1AUSL 3I96A 1HW8A 4G1QA 3UQSA 4QQBA 3MM5B 4FXWA 5LMUJ 1HNZF 2N3LA 2G2OA 2X1FA 4NCGB 4YQWA 2Z2MA 3H5YA 1MROB 3QJJA 2DIVA 2R7SA 3T1HJ 1MG7A 2FTRA 1HNIA 3SQGA 2QA1A 1T3OA 1DY3A 4JI3F 3KK1B 1LWEA 3E8OA 4URGA 2OEKA 3ZTOA 2P6SA 4DI6A 2RF2B 3VAJA 2L48A 4M8LA 4ED1A 4A8KA 4L72B 4OMFG 3MTJA 2YQ0A 3VZIA 5A8KB 3MWBA 3SEOA 1Q95G 3M2RA 3EZOA 4AD6A 3MR6A 3PIOQ 2HK2A 2MLZA 2WB1D 4KRWA 5AXNA 2AYGA 1F5BA 1OY6A 2BR0A 2GZOA 1B64A 2ZD1B 2LCWA 4ZPAA 4RW9A 3CW2C 4WF9Q 2HKEA 3C66A 4Y34A 3K59A 3G6YA 1O51A 3V2UC 3MEEB 3Q2TC 5F8JA 2E1PA 2K2PA 2NUUG 2BE2B 1NNDA 4YB7A 4GKJF 4M5MA 3VGVA 5FLXU 4LF4J 3UW1A 2XHWA 2PE8A 3KK3B 1UJ6A 2Q79A 1HWLA 4NI2A 6FD1A 4CLZA 3K5NA 2DRBA 2LQBA 1WG1A 5SZTA 4DDFA 3MR3A 2G13A 4CZCA 2HFUA 4ZP6A 1Y3JA 3EYZA 3WDOA 4HDGA 2CYYA 3PACA 3D68A 2IDLA 1F0XA 4Y0FA 1S6QA 1W7WA 2CQGA 4LF8F 4L3KA 2LDYA 1UWBA 4DU7A 2FVCA 1KFDA 1O5JA 4OV6A 4DLEA 3BZQA 1TKZB 2NSCA 2OSRA 3HFZB 5D3GA 3KUGA 1TKTA 2H1YA 1S1XA 3ISNC 4Q0BA 4PG5A 2G1HA 3SDEB 2DPJA 4F7VA 5CYJA 4JI1J 3R5DA 3UO0A 4F50A 4K4VA 3M6UA 3OT9A 2CQPA 5KFJA 3M9OB 5CA5A 3HJFA 4ES2A 4C0OC 3OFHA 1UPMB 2D7SA 2ZH3A 5KFDA 1RLDA 1FD2A 2FLPA 4CLLA 2O1PA 3DLEA 1XNRJ 4ILLA 1CULA 2NQPA 3ENWA 1KDNA 1NDPA 4I7FB 2EEYA 3D1HA 3M2UA 4M95A 4ED5A 4J9NA 4YHHF 4C3MA 2RUSA 3G4SS 3PYEA 5FDLB 4P7TA 1T05A 2F5GA 4RW7B 3GJQB 4DSIA 2DR6A 3SV4A 3CJ5A 1KFSA 3PRBA 5JVHQ 4BS2A 1RAOA 1VK3A 1VISA 4DSJA 3AOAA 4CO3A 2CJYB 2J7UA 1FRXA 2QLWA 4DZDA 2QN6B 1OY8A 2FDNA 1F2GA 2LLZA 3C16B 4DUYF 2MHEA 1WSVA 4G1PA 4ZDNA 3PY8A 2OI2A 3CIZA 1LK5A 1VQ6S 1AB8A 2L9DA 4PXBA 2D3OR 2OUGA 4I2QB 3ILIA 1RAIB 5ETRA 5C2GA 1CJUA 5KAKA 2IM0A 4QWBA 4JV5J 4B02A 3LPYA 3GU0A 4USMA 1FTRA 2R42A 4DR6J 1FRLA 4DSFA 4NA1A 1H72C 5A8WA 4AL6A 1VBKA 3RAXA 2QLBB 3EUNA 2UUWA 5KFFA 4TY8A 2OPQB 1RT5A 5HI7A 2OPRB 3KLEB 4BHQA 1YJVA 2DJWA 1SVDA 2E1RA 3C6TB 4LQ3A 3BB5A 4Y2CA 3M6WA 3DRRB 3AD7C 2AF6A 5E3AA 2L08A 4P2SA 4PXDA 1KQFB 2HHHJ 2ZFHA 3IP0A 2FZGB 4J9OA 1T02A 1TU0B 3UWTA 5G0RB 1BHNA 2AZ3A 2ALYB 3UD3P 2VF3A 4CYUA 1ZH5A 1S77D 1FWLA 3NS5A 3PXGa 5BYRA 4O4GB 2HLTA 1Q5VA 1SBRA 2DGSA 2W24A 4B3RJ 5AXLA 5HVGA 3CDBA 2C2OB 2XZDB 3JB9k 4FNIA 5M2UA 2J5AA 1DFDA 3CB4A 3Q8VA 4M5HA 1VJQA 4AFFA 4AQYF 2KXNB 3AY0A 2GHPA 1EB0A 2GMLA 2XNRA 2YTCA 5BYSA 1SI9A 5D78A 3MMBA 1X0FA 3KMQA 3PDNA 1X31C 2G1DA 1XR5A 2JEGA 4GRSA 1LWFA 4C8OA 1NXIA 5ITHA 2BQRA 4PWDA 5KFOA 1RP5A 1T0TV 1VRUB 4LF7J 3BR9A 2ABYA 1NDLA 1NK7A 3ILLA 5H9FK 3WC2A 1HBNA 3DM2B 2HFSA 4NLXA 3A8KA 4QWEA 3EX7B 1WOPA 1K0VA 4JI2J 4S0MA 1L3KA 1RKJA 5CAAA 1U24A 5J2QB 2QA4G 3GONA 1YJWS 1WDTA 3FNNA 4GVBA 1T03B 5B0AA 1I94F 4DV4F 1ZA2B 5EDWA 5CHCB 2E66A 2YKNB 1DTQB 1WC0A 2KDOA 2DISA 1RACB 5C42B 2Z30B 1AZSB 2AEMA 3KHHA 4TKTA 2RE1A 2I38A 4LRDA 4QBUA 4LIWA 2EC2A 2DHAA 4Q5VA 2C2NA 3W60A 4RW6B 4F3OA 3H2UB 3NGTA 2P9CA 2W2QP 4BCAA 3M9MB 5F0UA 4DPWA 2W4PA 1X4DA 2MB0B 2R7XA 4Q8FA 3OFGA 1U45A 2J9DE 4G1QB 3IBCB 5F3ZA 5T14A 2ERRA 1FX4A 2W1BA 5IM0A 4HTJA 2ZH9A 2B5JA 1S0MA 2J0XA 4CNZA 2WVDA 3BH6B 3IC1A 2Q1LA 4CRJA 1HNIB 1RI7A 3SQGB 2UUCF 1NCLA 2BACA 5HL7Q 2CJBA 2EXUA 1LWEB 5DM6Q 1VIOA 1YZ6A 3QFHA 3KOAA 4XDDA 2RKIB 2R9LA 3B82A 1MU2A 2Q6BA 4DV0J 3BREA 3QT5A 5K20B 2DHHA 3CJSA 4LREA 1JMTA 3QGPA 4WFBQ 1BQMA 1IBKF 1FNMA 5GAEI 4QCLA 3NEKA 4RW9B 3JQMA 4PKDB 2F4VJ 2AJ0A 4NLSA 4OJ3A 3QMQA 1MN7A 4HT5A 4MFBA 1F6TA 3AHPA 5DS7A 1GX6A 1L3SA 5KT7A 3JQJA 4NI2B 2JVRA 4NASA 1M5PC 3D6FB 4X62J 2MQPA 4P10A 4WYLA 3KKFA 2GO8A 2DRAA 4C8KA 1Y9OA 5KFGA 2AD9A 5I42A 5K8PA 5ETOA 2R8KA 3MM9A 1JLQA 1S6QB 2J6TA 3MDFA 2CNOB 2ACYA 1NHVA 3L7PA 4M5IA 3D3BJ 2RDJA 1L3VA 3ZZZA 4ZVOB 4ZPWR 4WPAA 4U95A 2LA4A 1MMDA 2E5GA 1TKTB 1S1XB 2DRDA 4IG0A 3FBBA 4Q0BB 2EBEA 1QUPA 1Q0NA 4LSNA 2QFIA 1SIWB 4LFBJ 1RTDB 2C2DA 4TLRA 1BC6A 2VKRA 1RT3A 2CAJA 4JI4J 3OTOJ 1RZMA 2QTWA 3WC0A 2XHCA 3RB4A 3OXFA 5KG4A 4DR1J 2UXCF 3C15A 1WC1A 5DO2A 1BQNB 2DGVA 3CULA 4A47A 1UEUA 2J0SD 2GIFA 2B4UA 2JNJA 3NGDA 2C2MB 3CCLS 2PO4A 1PBUA 1H3DA 3DLEB 3EZUA 4JV2A 2AYMA 4RR5A 2R3VA 4XTTA 2OMOA 4URSA 4ELUA 2ZH7A 4YY3F 1CULB 3HHEA 4WK1A 3ENAA 3DCAA 3IMQJ 4X4OA 3I0RB 1A6LA 1CC8A 3M2UB 2GNKA 4CLFA 1RAJA 2KXFA 4ZVUB 1RKIA 1QSSA 1SJ1A 1KKHA 1YRXA 1D3WA 2D9PA 2DY9A 4NYOA 1T05B 1MMNA 4UOGA 4GC6A 3HHLD 2BA9A 3EGNA 4HACB 3MGJA 4NA2A 3UCUP 3CCZA 1GFWB 4RZRA 5L39A 1XNQJ 2E5LJ 1X4CA 5B0BA 3TUJC 2ATLA 4X4VA 3D67A 4BBYA 1UVKA 1I3OB 5D0EA 1WWHA 2UUTA 3HULA 3J81U 4WTOB 3DLKA 4ZPTR 1RT6A 4DOZA 1N5QA 3QWPA 5I3QA 3LF0A 3FZBA 4X4UA 4EBEA 1PGZA 3HVRA 2WOMA 1RDRA 4RBVA 5IOLA 2NXEA 3R8YA 2KTQA 4ED0A 4EI2A 4ATNA 1VQKS 1R7IA 2KVIA 2KM8B 1S1UA 4IYQA 1YSJA 4LSZB 2F4FA 4TQRA 1SH2A 4LF1A 3GE9A 4DR7F 1D1UA 1F3FA 4FF4A 3W9IA 2LQJA 3VV2B 4DN0A 1Y11A 1D9DA 4P52A 3KNAA 3GIRA 1WORA 2K7JA 1R0CB 1P6TA 1RT5B 2CVIA 4B9VA 3CCMS 4B9MA 3HHNB 5K14A 4FZVA 3JSMA 2XC9A 3DU6A 2ILZA 3P45B 4NCBA 3CC2S 4N77A 1YJRA 3F44A 4EYHB 2R7UA 3TQ1A 4USTA 2DEIA 2CQ4A 3F56A 4CYUB 4B3SJ 4A8SA 1V5VA 1LWXA 2VC0A 1YRTA 3SCIE 2V9KA 1HARA 4O0IA 1G2EA 2B8QA 4ZVGA 1TKXA 2QMUB 1KBRA 2CG8A 2HFVA 5D0RA 8ATCB 2XMWA 3LALA 1HWIA 4BC7A 1XMBA 4EZ9A 2AGQA 3MMBB 4A8FA 1X5PA 4ZCKA 3TW0A 4P2XA 4ZLJA 3T5KA 1MWYA 4GKKF 2HHVA 1LWFB 1PILA 3DRYA 3RB3A 5DDOC 1RWNB 1OPIA 3TZYA 1U1NA 3T1YF 3OFFA 4A8MP 5E5NA 4J9UE 1OYEA 4DR3J 4ICLA 4ZHRA 2UUAJ 4FPRA 4XAKA 4ZP8A 3HVTB 3DLGA 3K8WA 5DRKA 4TVAB 3V6JA 2FZKB 2R7TA 4OJGA 2OPSA 2CPIA 5KFIA 4ZP7A 1V3RA 4WZMA 3O1LA 3KLVA 2X3DA 4RNNA 2DR5A 1GX5A 4LFCJ 1IWAA 2DVIA 5LL6d 5L38A 1D9FA 3HKZD 4NZ7A 2DXFA 2DT9A 4ANDA 1HPZA 2DHXA 2YWKA 2HEKA 1J5EF 3I5BA 4DV3J 3I9V9 1BWVA 2B56A 4I0WA 3D66A 1FI4A 3PW4A 4OX7A 3MD1A 5LMUF 4C8ZA 3AFGA 2PMWA 3CUNA 3AB4B 2YKPA 2MQ8A 4CH1A 2I2YA 2L41A 1SJ4P 3CJ2A 2MEWA 1EAYC 3T1HF 1HKAA 1KLMB 3FBEA 4CLYA 5LJ5Y 3HT3A 1UA1A 5IM0B 1M5HA 3CJTA 4LUBA 3AXMA 2MZQA 4K0KJ 4FYXB 4C8NA 4NRUA 5GADU 2HURA 3N5FA 2HQ3A 1FDNA 5KG1A 5LT5A 3FVYA 3WIVA 2CDRB 5GMEA 2KYXA 2CZ4A 3HP6A 4PRFA 4LF5J 4ZP9A 3BDPA 1FA0A 1HBOA 1P27B 3V5RA 1ZETA 3I56S 2FHJA 1X9MA 3PW5A 1FXDA 2VQEF 3T3FA 4M5DA 1G6BA 3K2YA 3CPWR 1G3OA 5FD1A 2R7RA 4KFBA 2EFGA 2MQOA 1T9YA 3GG0A 5HVHA 4CTAA 4C7QA 2IAJA 2GHVC 2C28A 4LF4F 5BJRA 3E3XA 1Q81T 3PX6A 1UTAA 3G96A 4HHUA 3M8QA 4EGLA 5BR8J 1IR2A 4MFBB 2CQBA 1R6VA 2W2PP 4WE1B 3V6DA 3TUZC 2LXIA 2H51B 4JYAJ 4CM2A 4OI3A 5FLXY 3W9HA 1DZ5A 4WYWA 2ZH1A 3W66A 2ADBA 1RISA 3DRSA 2KHDA 4IG3A 4V19J 1HIYA 1NPPA 3OL9A 2R2TA 1JLCB 3IGNA 4DXLA 1X4FA 4W4MA 2X3GA 4CT8A 5I42B 5HMXA 2HQGA 3MM9B 1JLQB 1RWKB 3PJWA 1UA0A 4CQ1A 2HFNA 2ZBQA 5C5JA 2GO9A 1SC3B 3ISND 1UVMA 3B4MA 4JI1F 2OFGX 3CD7A 1FF2A 1HI8A 3L4BC 2DNNA 3KUEA 1X0PA 2J6SA 2K8GA 3O44A 2WSEC 1IKXB 4X4SA 3NWGA 3SZ2A 4B3OB 1JJHA 4IG0B 2GQ2A 2FD2A 1PAEX 1RWVB 1YHQS 2W8LA 4DV2J 4LSNB 2HW3A 4C0BA 2KM8C 1RBAA 2CNNB 3DDNA 1SCJB 3VWSA 3D0HE 3BN4A 1A9NB 3R2DJ 3F0NA 3RUBL 3IFEA 4LBIA 5HANA 7AT1B 4IRKA 4ZN3A 3K5PA 2ZWPA 2M0GB 2F9DA 1DJ0A 3C15B 1F5CA 3RW6A 2L9NA 2B43A 3T41A 2XYGB 1WEZA 5L1KA 1A0OB 3AA9A 4J9RA 4DX7A 5B0CA 1P1TA 1WD6A 1TL3A 1LFWA 2OTJS 1KNZA 2E44A 2GVZB 1H0HB 3QJPA 1WEXA 1X4EA 4KGZB 4IH5A 4DFMA 1CJVA 2HZVA 5HMYA 2DGOA 2H54B 3QZ8A 3NNAA 1YITS 1EKRA 4I68A 2XLIA 1C0TA 3HMJG 3QT8A 5DG7A 1Z2ZA 3KDNA 4B3MJ 4WFXA 4RO0A 4FS2A 3W7BA 1SC6A 1VCTA 3P5BP 4OHXA 4ES1A 2DO4A 1HR0J 2FIUA 3OTEA 3J7A1 1QSYA 3Q24A 4KGMA 1C0UA 4J9KA 2VPZB 2LEPA 2J6UA 4EBDA 2KJWA 3L7OA 3GV5B 2APOA 1U6FA 1YQHA 1U1PA 1VQ7S 3TVKA 2A2DA 1JNZB 3GSDA 1DBDA 3DLKB 1HNVB 1B0PA 1N88A 3MM8A 2CRLA 1RT6B 1U25A 2DNPA 2CQIA 4UOCA 1N0UA 1NLKL 4DR6F 4RW4A 1U49A 2C2KB 3M8PA 3HHKA 4GVLA 1CJKA 1FNXH 2KKHA 2WK4A 1S12A 3JAMU 1FDAA 4M94A 1YJ7A 4P6QA 1S1UB 3H8YA 2JFDA 2WTFA 2OD4A 1U2CA 1RE1B 3JTOA 2DY1A 2XMTA 3GIIA 2W01A 1VOMA 2VPYB 1YBUA 3NRBA 1HLWA 2QGFB 3CCVS 2I5JA 3OL7A 3Q23A 4F3MA 4BC9A 5HQMA 4OQJA 1YLXA 5KT5A 2HHHF 1RB0A 5KG6A 2JH3A 2HHSA 2M2BA 5K14B 5IT0A 3CJ8A 3OTDA 1DTTA 2OLWA 2VDHA 5DG8A 2OEMA 3IR5B 3RRGA 1OMSA 1U2FA 3HK2A 2XI2A 2ZDPA 4JI3J 1RWMB 4U96A 3KLHA 2MKSA 1T95A 2RDDA 4B3RF 3OHBA 2C3YA 4P2MA 4HKQA 4DPOA 2Y3YA 3D4JA 2YH1A 2BABA 3JTNA 2OSQA 3DKDA 3MR7A 4ZK7M 4DUZF 3PG9A 5KFTA 2VA3A 4ZLNA 2EFPA 3M8SA 1WF1A 1XN9A 4Y00A 2MKJA 3TJ9A 2FHMA 2GGPA 1TKXB 1SKSA 2VJUA 1FK9A 3U7JA 4MH8A 2K06A 4RKUC 3BF4A 1KEKA 1Z2LA 4LMZA 2N82B 4LF7F 4TQSA 3M32B 2MSSA 1PJ7A 4GKJJ 2JL9A 1IR0A 1M5OC 4DR4F 1D09B 5B0FA 4JI2F 3MTKA 3DOLB 4ES3A 1R3NA 4MKBA 4ICLB 4ZHRB 2NR0A 3Q8PB 3IRWP 3DLGB 3GSIA 2R4FA 1S7HA 2CPZA 4ECQA 3PW0A 3NS6A 4OIXA 3D1OA 3G6XA 2OPSB 3NCPA 2YBVA 1LW2A 3KJVB 5T7LA 4AYBD 4F67A 3TYTA 2AGPA 1NB2A 4V19X 1GNKA 3DDKA 4L76A 3UDLA 4B08A 3AJ2A 1H2UX 2YXLA 1TUVA 4YMEA 1WC6A 2QIFA 3ET6A 3SSRA 3KDOA 3SV3A 3WIUA 3OXLA 3MM6A 3GV7B 4UF4A 3EZ5A 4DX6A 4ZS6A 4P72A 3DRPA 3JYTA 3CJKB 1CSJA 2AKWB 3LGNA 3K5LA 4IOCQ 3KJNB 4OLPA 5KOXA 3VAMA 3OLAA 3BSAA 1N56A 1FRJA 1N8RT 1VLOA 3OPKA 3UN3A 5I4MA 1RTIA 4W90B 5A8RB 4FP9A 4YEAA 3NMRA 1C1BB 4ZVQB 3JS9A 4J9PA 2ZKUA 2RMLA 3C19A 1VHFA 3MCMA 2I0XA 5E3PA 4EEYA 3LO3A 2MGZA 2A10A 4DV0F 2VUGA 3DC2A 5HJXA 2HNDA 2ZVIA 1HBOB 2J9DA 4JI0J 1NSAA 2VA2A 2U2FA 1NPRA 4PG6A 4M5DB 4CO5A 3CCES 3CD0A 3IRXA 2F4VF 3T9ZA 4PQUA 3GJRB 2H65B 3I82A 5DZ7A 2C2RA 5KFPA 1L3TA 2FJVA 4KFBB 5CD4H 2ZVSA 4PWUA 1S7IA 2XM3A 4CTAB 1RTHB 2DNYA 4QW9A 2M88A 3A8JA 1RT4A 2EK1A 3V6HA 2NXCA 3QPIA 2OJ3A 4RW8A 1AW0A 3R5GA 4DX5A 3I4HX 3M8QB 5AJ3J 2P6TA 4UY85 4OZJA 4RL1A 3R1LA 3CTRA 2ZHOA 3GWCA 3FMBA 1JX4A 2V8HA 4IO1A 1U09A 4ANCA 3DMJA 4I69A 2B9WA 2ZZTA 3ZZPA 4LBHA 1Q86T 1KOHA 4IG3B 3VVUA 5ETPA 1SL2A 1Q7YT 1G1XA 2CWXA 1JLAA 2XI3A 1IBCB 2GVDA 4DFKA 1QUVA 1H2VZ 3CJ4A 2CJ9A 2DITA 4Y2IA 1LKZA 5KFLA 4IOAQ 3QT6A 5DDQC 1HL6A 1Y10A 3S8SA 3M30A 2E9RX 4LFBF 4DHVA 4PXCA 5E0OA 4D3GA 3HHLB 2JLEA 2QSFA 4R25A 4DR1F 5C7PA 5ETVA 2LKZA 1NAQA 5KT3A 2IRYA 1FFSB 5EWEA 4G65A 2IMWP 3PFEA 3VQTA 1KWMA 3GTYX 1YJTA 5GMDA 2XTJP 4J9SA 1LNQA 2IBOA 1T9VA 1UCNA 3UN5A 1FJ7A 4MTPA 1YTYA 5HO4A 1XQIA 1UEVA 3NKYA 2XEXA 2MKIA 1S97A 2UP1A 3FJ2A 2QE5A 1ZAWA 2ACMA 4K2JA 4YR3A 1CJVB 2BE9B 2HSEB 1PIEA 1V6HA 2HRUA 5KFQA 4MKVA 1FXRA 5HMWA 3ENQA 4RBUA 1S4EA 2E5LF 2FJXA 3KMSA 1IM6A 2V4JB 1Q16B 2P9EA 2F8MA 3SSQA 2LEBA 1HW9A 4IRCA 4NE9C 2H4YB 3MPYA 4QIWD 1I6JA 4OYBA 3KLIA 3FEZA 4Q2LA 1X5SA 3D28A 2NYIA 3OUYB 4OHWA 1GMUA 4F0KA 3DI6A 1YVFA 2BX6A 4AL7A 3P6YC 3SCLE 3GPAA 1FVSA 1JXLA 3D0GE 3KWMA 4PYAA 3MM8B 3J81Y 1RHJB 3G71S 4NLUA 2M8HA 4ALZA 3NOGA 2RRBA 4MIAA 1KC8T 2CADA 3FBFA 3AJDA 1OO0B 3HSZA 3ZTSA 1M1KT 1CJKB 2Y8YA 4KV8A 1X4HA 4WFAQ 4TU7A 2H4WB 2HHQA 1JKHB 2Z2YB 5DJBA 1J27A 4EO6A 2DNKA 4U6PA 5HQ8A 2QX0A 2I5JB 5LJ3Y 5LMNF 2JX2A 3I6PA 3QAUA 4N76A 3AQPA 4OX8A 1TUWA 2CDQA 1SL1A 4B3TJ 5CZVA 1U1QA 3FBCA 2DB1A 2B7CB 5CYMB 1DTTB 4DL5A 4MKYA 3EICA 2JSXA 1HBMA 4F25A 1KTVA 4CH0S 4EWTA 3C14B 2RQKA 2D74B 2DH9A 1SKWA 1PYTA 1K44A 1GK8A 5GADI 4DCPB 3KLHB 3CSKA 3RB0A 4DS4A 5DETA 2VC1A 2EFNA 1RHKB 2HHPA 1MMLA 1EQ0A 2IPOB 2YNGA 3U1LA 2HBQB 2QL7B 2OP5A 1Z1ZA 2DH7A 1FNOA 1QY7A 2LP4A 2LDIA 4N8OA 1JXEA 1M0SA 4OLOA 1S1VA 3KJQB 1B70B 2JLGA 5CXTA 5JMNA 2RS8A 3QJLA 1W2BR 3UVJB 3PX4A 2ZWOA 1UVJA 1N5VA 4R0JA 1TL7B 4OJHA 3IBWA 1FK9B 4TYAA 1GEHA 3ISZA 4ECZA 5IS2A 2BJDA 1FE0A 4I67A 5THWA 4J91A 4HR2A 1Y3KA 2C22A 2VL1A 3FEYB 3GFYA 4OYWA 5IT9U 2YNFB 2YVSA 2XS5A 3BBFA 2IMOA 1ZBTA 2VFRA 1NEEA 1ZTTA 1CG2A 1BE4A 2RUGA 3I5AA 2XYPB 3RBZA 3KG1A 3UCZP 3OLBA 3TJAA 3QGHA 2ZC4A 2NSBA 4OYMA 3SCKE 2A6MA 4MJKA 1CS4A 3R1HA 4LFCF 2ZHAA 4JI7F 4O3PA 3P3DA 3TEGA 3TEHB 3DLLQ 1LW2B 5T7LB 1S0NA 2J8SA 2YX1A 3PW2A 2MJNA 2E1MC 4KBIA 4KGXB 1H38A 3M05A 4NL5A 4YP3A 3H7HB 4WXWA 3ET6B 1F60B 4Y2KA 2V2KA 3ETOA 1BY9A 3MM6B 3RTVA 2QA4S 3DHWC 3NLCA 4C8LA 4DWIA 4EZ6A 3TQEA 3DRPB 2QJ3A 3UN2A 4Y28C 2CJXB 1XJWB 2QYGA 5B09A 2UXCJ 1EX8A 1LK7A 4ZVRB 3VR1A 5A2QU 2V67A 5HLFB 4KJIA 3MD3A 3TVZA 3NGSA 1TV6A 4Q43A 4K0KF 3C46A 1XR6A 2HZCA 2Y1JA 2E1CA 2V68A 2LEAA 1KQSR 3BKFA 3UD5A 2MXYA 2HBRB 4IOBA 2FJWA 4HHHA 2EPIA 3LANA 3HKWA 3D6MB 2ZC3A 1WKJA 4LF5F 3RGIA 1ZYQA 3VALA 4WP9A 2H48B 5KFEA 3L3CA 4RUBA 3HCXA 5GAHU 5HP1A 1GMWD 2NYHA 4IH6A 1RBOB 2MGZB 2HS4A 5D6GA 1WC5A 3RAMA 3WX4A 5JVGQ 2ZE2A 3HM9A 1FTCA 4UOFA 2HNDB 3O2IA 1KQGB 2BRKA 2FJDB 1HMVA 4RNMA 1EQMA 4K4UA 4M5JA 1QE1B 2CKWA 4UQGA 1CBKA 2ZKTA 4LVOP 3FDSA 1DAXA 1ZS6A 4CO1A 1S1TA 2J7WA 3I9ZA 4R8UA 3IRXB 3Q83A 4PQUB 2UV8A 1QJHA 2GIQA 1FT8A 4RWWA 2XBPA 2Y1RI 2FLOA 2QG9B 3VGSA 4I6YA 2XSFA 2KT5A 1RT4B 3T1AA 4JYAF 1VFJA 1VQYA 4RW8B 4QOTA 1HWKA 3A12A 2MY7A 2HFOA 3ZXWA 1GXUA 3R3TA 3H40A 3ILOA 2YH0A 4C4WA 1XERA 3IWXA 2WZ1A 1S4FA 2QYCA 1R8HA 1HHQA 1VR6A 2WVBA 2H5JB 3DMJB 1Q4RA 2IVMA 3AD8C 4QZVB 2N7YA 1BWEA 3Q0AA 1AFIA 2Z2ZA 2WVFA 1JLAB 2GVDB 3GFHA 4F2RA 3MMAA 3W5YA 5A76A 3EE3A 2IA6A 3LWMA 2VFTA 4FBUA 4CI0B 5CD4A 3M30B 2DR8A 1LFPA 4XK8C 1I51B 4OZ1A 1VC6A 1XEZA 2XYHB 4Y65A 3QIPA 3M6VA 3RRKA 1OYDA 1ZM2A 3IM9A 4JI8J 1RWOB 2ASLA 3SYZA 3BQ0A 3BQ2A 3IR6B 1O6XA 1KOOA 2VBZA 1GT8A 1U1KA 5L1JA 4FYDA 3PTWA 1F9FA 2R2SA 2UXDJ 4NLVA 1DLOA 2ADCA 1P9YA 3KHRA 3RYLA 4GKKJ 3P49B 1VQNS 3I31A 3TZZA 3BYPA 4ID5A 2VOOA 1RT7B 2HGLA 2HRTA 3BGFA 2MQLA 5GAGU 2AU0A 3GCXP 3RR8A 3IG1A 5AE1A 3T1YJ 3MUTP 5EUHA 2BKNA 3PIPQ 1HR0F 3A13A 2CPJA 1CLFA 1NDKA 3SSSA 4A8WA 1TELA 2B0GA 1NJWA 1TL1A 4K4YA 4DX8H 4R5PA 3ILJA 1TL5A 2F7VA 4KC5A 4P7VA 4DPYA 4TU9A 3R27A 2VB6A 3IA0A 3MECA 3EVOA 3R2CJ 5E33A 4RWXA 3DI6B 2FC9A 3Q22A 2XO7A 4N7TA 1N32J 2A18A 1JLBA 3BJYA 3KTQA 4RBTA 2XY5A 4XPCA 3D9BA 2KXHA 1UVNA 3ZO7A 3TZWA 3M4XA 2QZ8A 4WKYA 1WDDA 1GXTA 4LSLA 4ECUA 1U47A 4U8YA 3TO8A 2PSZA 4OYXA 4KV8B 1VQOS 3LP1A 2ALZA 1BGXT 3A8EA 3JAMY 4LBPA 1EP4A 3DOKA 4ZLLA 1B99A 5CABA 2AEFA 3NWRA 3MI7X 4Q45A 4F04B 4N56A 1RABB 1RTJA 2JEIA 1FERA 1E6VA 2O67A 3TUPA 1H74A 4WIIA 1K1SA 2MZRA 4KH0B 1KONA 2JOQA 1KHWA 2X51A 1EKSA 3JSYA 1WUUA 4MAKA 1HBMB 1QTNB 3MM7A 2CIMA 3MCOA 3PNIA 2WVCA 2HNYB 2HBZB 5GMKa 3HJVA 4PG8A 3H25A 3GCWP 3MCNA 3Q8QB
chains in the Genus database with same CATH topology
3GP9A 1PAEX 4F36A 1NHKL 2BX6A 3EVWA 2AZ1A 2DXDA 3NGTA 1NSPA 3VVTA 1WKJA 3GPAA 3L7UA 1BUXA 3FBBA 2NCKL 1S5ZA 3DDIA 1HHQA 4W98A 4KPCA 4WBFA 3ZTRA 2CWKA 3BH7B 3JS9A 1NSKL 4ENOA 2BEFA 3WX8A 3FBEA 1NSQA 1WKLA 1NDLA 3Q89A 2DXEA 3EJMA 1UCNA 4ANCA 3ZTQA 4ANEA 1MN7A 3FBFA 4UOFA 3VGUA 1NPKA 2DYAA 3DKDA 3ZTSA 1XIQA 1NLKL 3B6BA 4EK2A 3VVUA 3ELHA 1NB2A 1F6TA 1XQIA 2B8PA 1VYAA 1B99A 3EE3A 5CABA 1EHWA 1S59A 4O0NA 2HURA 3ZTPA 3EM1A 4S0MA 1JXVA 5CAAA 3PRVA 1BHNA 2AZ3A 1NDKA 1LWXA 1ZS6A 3BH6B 1HIYA 1NUEA 2ZUAA 3FKBA 5IOLA 3BBBA 3BBCA 3G2XA 2HVEA 3VGTA 1PKUA 4UOHA 2VU5A 4HR2A 3Q8YA 3Q86A 4C6AA 3FCVA 3VGVA 3Q83A 3EMTA 3NGUA 3Q8UA 2B8QA 1NCLA 3ENAA 3BBFA 2DXFA 3B54A 1MN9A 4CP5A 3MPDA 1B4SA 3VGSA 4DZ6A 1HLWA 1BE4A 4ANDA 1KDNA 1WKKA 1NDPA 3EVOA 3Q8VA 3FBCA 3R9LA 3NGSA 2HVDA 4F4AA 4FKYA 3EVMA 1F3FA 4FKXA 4DUTA 1S57A 2DY9A 3EICA 1NDCA 5C7PA 3ZTOA 3ETMA 3PJ9A 3FC9A 5BXIA 4DI6A 3FCWA 4UOGA 1W7WA 3NGRA 1U8WA 1LEOA 1K44A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GP9 A;  1PAE X;  4F36 A;  1NHK L;  2BX6 A;  3EVW A;  2AZ1 A;  2DXD A;  3NGT A;  1NSP A;  3VVT A;  1WKJ A;  3GPA A;  3L7U A;  1BUX A;  3FBB A;  2NCK L;  1S5Z A;  3DDI A;  1HHQ A;  4W98 A;  4KPC A;  4WBF A;  3ZTR A;  2CWK A;  3BH7 B;  3JS9 A;  1NSK L;  4ENO A;  2BEF A;  3WX8 A;  3FBE A;  1NSQ A;  1WKL A;  1NDL A;  3Q89 A;  2DXE A;  3EJM A;  1UCN A;  4ANC A;  3ZTQ A;  4ANE A;  1MN7 A;  3FBF A;  4UOF A;  3VGU A;  1NPK A;  2DYA A;  3DKD A;  3ZTS A;  1XIQ A;  1NLK L;  3B6B A;  4EK2 A;  3VVU A;  3ELH A;  1NB2 A;  1F6T A;  1XQI A;  2B8P A;  1VYA A;  1B99 A;  3EE3 A;  5CAB A;  1EHW A;  1S59 A;  4O0N A;  2HUR A;  3ZTP A;  3EM1 A;  4S0M A;  1JXV A;  5CAA A;  3PRV A;  1BHN A;  2AZ3 A;  1NDK A;  1LWX A;  1ZS6 A;  3BH6 B;  1HIY A;  1NUE A;  2ZUA A;  3FKB A;  5IOL A;  3BBB A;  3BBC A;  3G2X A;  2HVE A;  3VGT A;  1PKU A;  4UOH A;  2VU5 A;  4HR2 A;  3Q8Y A;  3Q86 A;  4C6A A;  3FCV A;  3VGV A;  3Q83 A;  3EMT A;  3NGU A;  3Q8U A;  2B8Q A;  1NCL A;  3ENA A;  3BBF A;  2DXF A;  3B54 A;  1MN9 A;  4CP5 A;  3MPD A;  1B4S A;  3VGS A;  4DZ6 A;  1HLW A;  1BE4 A;  4AND A;  1KDN A;  1WKK A;  1NDP A;  3EVO A;  3Q8V A;  3FBC A;  3R9L A;  3NGS A;  2HVD A;  4F4A A;  4FKY A;  3EVM A;  1F3F A;  4FKX A;  4DUT A;  1S57 A;  2DY9 A;  3EIC A;  1NDC A;  5C7P A;  3ZTO A;  3ETM A;  3PJ9 A;  3FC9 A;  5BXI A;  4DI6 A;  3FCW A;  4UOG A;  1W7W A;  3NGR A;  1U8W A;  1LEO A;  1K44 A; 
#chains in the Genus database with same CATH topology
 1PJ5 A;  5ETS A;  2ILY A;  1LXN A;  1HBU A;  2VQE J;  2YNG B;  2AJ4 A;  4AL5 A;  1N5Y A;  4NXM J;  2KB2 A;  3BSC A;  2LXF A;  3JTP A;  3BH7 B;  4GO7 X;  2E7X A;  5L9X A;  1V9O A;  4BWJ A;  1ZOT A;  3RZA A;  3OXG A;  4MK7 A;  1RUS A;  3TOQ A;  2I8E A;  4FF1 A;  4ECR A;  1DRZ A;  1VHI A;  5K8N A;  1RCX B;  4DF8 A;  2C3O A;  5IWA J;  1RT2 A;  4UT4 A;  2HVE A;  3VGT A;  2YQ1 A;  1EZZ B;  2UV8 G;  1FE4 A;  2W9C B;  2R8G A;  3US5 A;  2MYF A;  3RJM B;  3OL6 A;  5LXR A;  2XQC A;  1UWA A;  4F02 A;  2DD8 S;  3KYL A;  1ZZF A;  2ZH4 A;  5AE3 A;  4R0E A;  2ZBI A;  3EPG A;  1T11 A;  5J2N A;  2IM2 A;  5F9N A;  3M8R A;  1CS4 B;  3I4P A;  2XSJ A;  3PO5 A;  4L6V 3;  1WHX A;  2GQQ A;  2M70 A;  3MUM P;  2B4P A;  2VFS A;  4DPU A;  2IJF A;  1VQ4 S;  4G3I A;  3FCH A;  3K5M A;  1S6P A;  4CLU A;  2QMW A;  1GMW A;  2OH2 A;  1RAG B;  2W7A A;  2VHG A;  1WAC A;  2UVU A;  4OZ0 A;  1R0A A;  2I1R A;  1SJQ A;  2DGX A;  2DYA A;  1UEK A;  3H5U A;  5J1P A;  1NO8 A;  1FDD A;  2W7O A;  2WB4 A;  2ZJQ Q;  3MEG A;  1ZAV A;  2AV5 A;  1APS A;  2BBE A;  3EGV A;  3NY0 A;  3S7R A;  4LR7 A;  4YN3 B;  2X1G A;  5IT4 A;  3RBE A;  2JC0 A;  2KO1 A;  5E3R A;  4EBC A;  3K5O A;  5IC6 B;  2YKO A;  4C6A A;  2BZ2 A;  4HI2 A;  3OVB A;  1TV6 B;  3BDE A;  3HSJ A;  1IM4 A;  1NJY A;  3QRP A;  4K4Z A;  3HSG A;  5KG2 A;  3VAK A;  1JLF B;  1UW9 A;  3K57 A;  4LT6 A;  3K89 A;  1NK9 A;  3H42 A;  5F8L A;  9ATC B;  3W64 A;  4XPE A;  4JI0 F;  5HP1 B;  5KFM A;  5KFZ A;  2CQ3 A;  3HT0 A;  3QO9 B;  1N0V C;  4KYZ A;  3PEJ A;  1UET A;  1U0H B;  5C25 A;  4QIF A;  1RU1 A;  1NBE B;  3SIP B;  4M63 A;  5D4P A;  1IBM F;  5D4O A;  3X3U A;  1S1T B;  4FXV A;  1ZPW X;  4D3H A;  3MUR P;  1N6Q B;  4R8U B;  1S0V A;  1FCA A;  2QSW A;  2PN6 A;  4O23 A;  4ERD A;  2VOP A;  4DLG A;  4AT1 B;  3Q86 A;  1F2H A;  5AJ3 F;  2RU3 A;  1RHM B;  3P4U B;  4TN2 A;  1T9W A;  4WXO A;  1HHS A;  3CF5 Q;  4DSK A;  3HVA A;  4JBC A;  3I0S A;  2D41 A;  4OX9 F;  4O3O A;  3EWG A;  3HVW A;  4QIV A;  2FZC B;  1OPZ A;  3IBF B;  4DR5 F;  5B0D A;  2RIJ A;  2P8I A;  2YNI A;  5KG0 A;  4NLG A;  2GC8 A;  3H4D A;  3FSX A;  3H2V E;  4ED2 A;  2V2Q A;  1QTM A;  3GFZ A;  4M1K A;  4ILM A;  3MMA B;  1ACM B;  5KFK A;  2W25 A;  4J9V A;  3O6Q A;  2KH9 A;  1NME B;  2MST A;  3BO2 A;  3QSY B;  1NZA A;  5M2P A;  3MXH P;  4WP3 A;  5DDR C;  4OHZ A;  2B8P A;  1VYA A;  2FGO A;  4IRD A;  3VZH A;  2QRR A;  2BW2 A;  1IWG A;  4ECW A;  1YRU A;  4RUC A;  1HA1 A;  3H0P A;  4ZPC A;  3QIP B;  4YR2 A;  3EMT A;  2M7S A;  2MZS A;  1WI8 A;  4DUZ J;  1X9S A;  5ETQ A;  4KIA A;  3B54 A;  4CH7 A;  4DJB A;  4WK3 A;  5D8H B;  3BQ1 A;  3QID A;  2NPF A;  3C3L A;  2QMX A;  3MM5 A;  2ZBC A;  1B7F A;  4QIE A;  3G8T A;  2W8K A;  1XR7 A;  2HIY A;  2LFV A;  4DV5 F;  4RNF A;  3EDR B;  4USJ C;  4F36 A;  1DLO B;  4ZVS B;  1MRO A;  2DGU A;  3L7U A;  4FYY B;  1U1L A;  4DR4 J;  3CWJ A;  4ITS A;  2VQF J;  3V4M A;  3GR0 A;  1QM9 A;  3R97 A;  1S0O A;  1OJ4 A;  2ZOF A;  3M8Z A;  2A3J A;  4U7U D;  2UVR A;  3IG1 B;  3KK1 A;  2CPY A;  1FHT A;  2BEF A;  1XMQ F;  3DOM A;  1N34 F;  1C4A A;  4DQP A;  3ZTQ A;  1M5V C;  1URR A;  1T3N A;  3ZZ0 A;  2BJ1 A;  3C8Y A;  4OI0 A;  1L3U A;  4O3S A;  5A8K A;  1TL1 B;  2KRR A;  3TAM A;  1REV A;  2B9X A;  2ZH6 A;  1P1L A;  2BE7 D;  1VBZ A;  1TZ0 A;  2FC8 A;  1WI6 A;  1KLN A;  3HHD A;  2PI5 A;  4LRC A;  1UVI A;  1YWX A;  2ZH8 A;  3MEC B;  1NRK A;  4XIU A;  1KD1 T;  5KOW A;  3CGI A;  1MN9 A;  4QR1 A;  4KSE B;  2IHR 1;  2HS0 A;  1H2T Z;  2W7P A;  1JLB B;  2CQ1 A;  2BE2 A;  1XMO J;  3HX9 A;  2OPP A;  1U8W A;  5KFH A;  4LF9 J;  1B3T A;  2PMZ D;  4LSL B;  2CNL B;  3ZZU A;  3TAN A;  1FKO A;  3FFI A;  3ZTR A;  4NWB A;  1ZTW A;  2DNR A;  3CDW A;  1T9X A;  2O5D A;  3T19 A;  3WBZ A;  1EP4 B;  3PX0 A;  3DOK B;  4B3T F;  3RW7 A;  2Z4P A;  1FJE B;  4NLW A;  4C8M A;  1Y0H A;  3OR1 A;  2F3J A;  1WF0 A;  2B4V A;  3ELH A;  5I3P A;  1RTJ B;  4OYI A;  1Y5N B;  4E8U A;  4RX6 A;  1VQ9 S;  2CPH A;  1TKZ A;  8RUC A;  3N6N A;  4ZJQ A;  1FVQ A;  2POK A;  1RLC L;  3TUI C;  4WJB A;  1C1C A;  2K3I A;  2D9O A;  4X4T A;  1MSW D;  3MUV P;  2JRS A;  3UFC X;  1IKW A;  1TTH B;  3DU5 A;  4CP5 A;  2WVE A;  3M2R B;  1KQK A;  1SKR A;  5GAH I;  1S9F A;  5U47 A;  3EVM A;  3KG0 A;  2W9B A;  2R2U A;  3HZE A;  4PEO A;  2KYZ A;  2V94 A;  3OSP A;  3FEX B;  4B17 A;  1IXK A;  1N5Y B;  2N3O A;  2J0Q D;  4UY8 T;  3VVT A;  1EIY B;  5F3T A;  2UUB J;  4F4Z A;  1NK5 A;  1GTE A;  4KQZ A;  7FDR A;  3BS9 A;  5J1E A;  4PQA A;  3OTC A;  4A8Y A;  1HD1 A;  3T9N A;  1TAU A;  4X65 F;  2HHX A;  1IBL J;  5HAT A;  1M1G A;  2IJN A;  1MWZ A;  2HS3 A;  5IT9 Y;  2FQQ B;  3PRD A;  3OVS A;  3PRV A;  2FHJ D;  1MLA A;  4UOH A;  3CJR A;  2PFF B;  2DK2 A;  2QO3 A;  2FVQ A;  1UWB B;  4K4S A;  1SPB P;  3LP0 A;  3TNV A;  3UNY A;  2WSF C;  5J2N B;  4IQX A;  3KG4 A;  1REG X;  5L1L A;  5D3G B;  2XSJ B;  1VQS A;  3NNH A;  3R9L A;  3SMZ A;  2GJI A;  5GAE U;  2CQH A;  2EC0 A;  4RNH A;  4FF3 A;  1NDC A;  1OY9 A;  4P73 A;  2IBK A;  5E3C A;  4Z2X A;  1NHK L;  4DSL A;  1RXO B;  3K17 A;  3HI9 A;  2KRB A;  1Q53 A;  4HH1 A;  4N5S A;  2NCK L;  4YOE A;  4Y3C A;  2BOP A;  1R0A B;  1SUQ A;  1B0T A;  2V4R A;  2DKO B;  3AOD A;  4QJV A;  3ZZY A;  2QFJ A;  4ELV A;  1NHU A;  2IVY A;  3MEG B;  2ZM6 J;  4K4X A;  3B6B A;  1FWP A;  3CO0 P;  2B3T B;  3CXC R;  1F1B B;  3EM1 A;  1S76 D;  2VKZ G;  4DV7 J;  5A2Q Y;  8AT1 B;  2OPR A;  3S6E A;  3UD4 P;  2Z8Q A;  2HWH A;  4F4Y A;  4Q7A A;  3THT A;  5I3U A;  1QAY A;  4KTQ A;  3LQV A;  4JB8 B;  1N54 B;  1RAE B;  3HO1 A;  1XK8 A;  3MHY A;  3E2E A;  1S6U A;  2IRX A;  5G0R A;  1Q8I A;  4OZL A;  1OSD A;  1QVG R;  1P8G A;  4BLG A;  5GAG I;  2Q66 A;  2XY6 A;  3CD6 S;  4MK8 A;  2G2Y A;  4Y6I A;  5E3Q A;  2V0N A;  3NG8 A;  2ZOG A;  5C25 B;  2ZBR A;  1D8Y A;  3IAS 9;  4ZOS A;  3BSO A;  4NLR A;  2V9W A;  3MFH A;  2M9K A;  1YK9 A;  3PYF A;  2H5I B;  1CJU B;  2R7W A;  4RUH A;  3W61 A;  4K2X A;  5HSP A;  3HDS A;  5B0E A;  2YX4 A;  1NK0 A;  5B0G A;  2FJE B;  2BJ7 A;  5J2P A;  2AIR B;  3JQK A;  3GG1 A;  3KK2 A;  1DUR A;  2E5H A;  4N8N A;  5A8W B;  5JXS A;  1VRU A;  2ZUG A;  2YKM A;  1UFW A;  1H73 A;  1PG5 B;  2QLF B;  2CZ9 A;  1J2V A;  3I0S B;  2VFU A;  4TY8 B;  1TVR A;  1S49 A;  3MPD A;  2RAQ A;  2AWZ A;  2J7K A;  3KFW X;  2E29 A;  2GCF A;  1FO1 A;  1RK8 A;  4FKY A;  3J7Z 5;  4ZCM A;  5LMN J;  3GV8 B;  4ZN1 A;  5EX3 A;  4TLQ A;  1RA6 A;  1JJC B;  2YNI B;  1VQM S;  1CQN A;  4K7Q A;  2ASY A;  4W92 B;  4IH7 A;  3G6V A;  2YKN A;  1DTQ A;  4KAI A;  5MAO A;  3CVK A;  4DL3 A;  4H4K A;  3OV7 A;  1JQG A;  4JI8 F;  1PSD A;  1IUJ A;  3DHX A;  2V4Q A;  1WJ9 A;  2FPH X;  2MKK A;  1AZS A;  4ED3 A;  4OJ1 A;  2CXE A;  3MF5 A;  2AEJ A;  1XIQ A;  4AUK A;  3TVY A;  1X4G A;  1ZA1 B;  2KZM A;  1EJ7 L;  2KG1 A;  1RAF B;  3NP5 A;  3BBB A;  1GQE A;  2FY8 A;  4ZA1 A;  5GVQ A;  1PKU A;  2LXU A;  5AXK A;  4DL0 C;  2UXD F;  1TL4 A;  2GAH C;  4TNO A;  3VAH A;  1N4L A;  2FYX A;  4CLP A;  3LWL A;  3TA0 A;  1RU2 A;  3VAG A;  4JI6 J;  2RHS B;  2R8J A;  4WFZ A;  1B4S A;  2FLN A;  2IYG A;  1N36 J;  3OL8 A;  4PWD B;  4CO0 A;  4NOH A;  2Z0G A;  1U1O A;  2RSQ A;  2VD3 A;  3SQO P;  4DSE A;  1ELO A;  2OHD A;  5HBM A;  1HBN B;  4QIG A;  2DGQ A;  3EVW A;  2CVE A;  2VON A;  2ZH2 A;  2N4D A;  2JWN A;  1UMJ A;  3DOM B;  4C0H A;  4AE5 A;  3PKY A;  1X7V A;  1BXN A;  2RKI A;  5DGB A;  2A2C A;  2X1B A;  4GVB B;  1TR0 A;  2HAF A;  1B7Y B;  3WX8 A;  2GJ2 A;  2HWT A;  2Y8W A;  3MFI A;  2DHS A;  3BM7 A;  3TAM B;  1REV B;  4DF4 A;  4JI7 J;  5F9L A;  2CQ0 A;  3QNW B;  4IUF A;  1N32 F;  4Y2A A;  1NH7 A;  3OJS A;  4MK9 A;  1SB6 A;  4EUV A;  3CO9 A;  3Q8Y A;  4A8O A;  1OSC A;  1A7G E;  3PZP A;  1RWP B;  4QU7 A;  4UUW A;  3DLB A;  1SL0 A;  2AX1 A;  2OTL S;  3NCQ A;  5KFA A;  5EWG A;  5ETL A;  4H4O A;  2OPP B;  4K4W A;  2BJ3 A;  4J9M A;  1OS5 A;  2HZA A;  4F26 A;  1G7C B;  3MR5 A;  1RHR B;  4LQ9 A;  1FKO B;  3FFI B;  2YQ3 A;  3DNC A;  2DH8 A;  2ROE A;  2PC6 A;  2B5J B;  3KXD A;  3W1Y C;  1OQ6 A;  1TK5 A;  4HI1 A;  1LQ9 A;  2MJU A;  3QRR A;  2FVR A;  3OSN A;  1SJ3 P;  3OR1 B;  2NXN A;  3BV8 A;  4JV0 A;  1DQ9 A;  3BGR A;  3N4W A;  3VGU A;  1HI0 P;  1FX2 A;  1C1C B;  3ZTP A;  1MU2 B;  1VC5 A;  5KG5 A;  2C2E A;  1IKW B;  3FKB A;  1RQ0 A;  4NXM F;  3D54 A;  4F8R A;  1RTD A;  3ZNU A;  2BQ3 A;  2LQ9 A;  3BGO P;  3LUY A;  1AFJ A;  2ZBP A;  1BQM B;  2W9B B;  5DG9 A;  3AAW B;  3H2L A;  4P9S A;  2COL A;  3UE2 A;  3FQL A;  5ETM A;  4HH0 A;  1BQN A;  4PZV A;  3TWZ A;  3VAI A;  1E6Y A;  2V2Z A;  1IKV A;  1H7W A;  4DQS A;  2HQC A;  4ED4 A;  3A3P B;  5IWA F;  1SH3 A;  1BMQ B;  1FEH A;  3EGW B;  2XGQ A;  3BSN A;  3CT9 A;  5J1E B;  3I0R A;  3SCJ E;  4EFA C;  3F73 A;  4ED7 A;  2HHW A;  2X7I A;  2NRE A;  1R8B A;  1UFK A;  3OBI A;  4CM0 A;  3OR2 A;  3D2W A;  3IM8 A;  4CLS A;  2AGO A;  5ADZ A;  1S1W A;  1LV5 A;  4I6W A;  4MYT A;  4NZ0 A;  1S59 A;  3D7S B;  4HAC A;  2F65 A;  1UVL A;  3I55 S;  3LP0 B;  1ZZN A;  2UZA A;  1S72 S;  2JDJ A;  4RLE A;  1RYS A;  2YWF A;  1S10 A;  4C11 A;  2DNG A;  2E7V A;  4KHP J;  1G4C A;  4DZ6 A;  1QAI A;  4RU2 A;  2NUH A;  2RHQ B;  2J9C A;  4OYP A;  4HYK A;  3J81 j;  4NZ6 A;  3U1N A;  2HNZ A;  1RT3 B;  1YJN S;  2R7V A;  3CCQ S;  2YWE A;  1U1R A;  4QPX A;  2EKY A;  1SUQ B;  1UKU A;  4M5K A;  2V8D A;  2NXJ A;  4ZKA A;  1N48 A;  2ZOM A;  1MW7 A;  3LGH A;  1R8A A;  4QWA A;  2OAU A;  3MOZ A;  3O8W A;  5DQH A;  2XWX A;  1VK8 A;  4FF2 A;  1ITP A;  1ROF A;  3QT7 A;  5K8M A;  2BXJ A;  4NCA A;  4ETZ A;  3B78 A;  1SV5 A;  4DL2 A;  3LPE A;  3KJF B;  3CJ0 A;  2BOA A;  4X2B A;  2PFD A;  2W9A A;  5I3U B;  3RAQ A;  3CE8 A;  1HWJ A;  2Y1L B;  4CDI A;  2WRM A;  4YS2 A;  4L3N A;  3DFE A;  5IC4 B;  4JI5 J;  3IWL A;  3QZ7 A;  4X4Q A;  4X64 J;  4OYA A;  4DN9 A;  2ZEJ A;  1KVK A;  1KS2 A;  2Z58 B;  4B9T A;  4OZ2 A;  2ZDO A;  2CQC A;  1KVJ A;  2IYI A;  2HLU A;  5SUH A;  3DLH A;  3PYD A;  4DU8 A;  2XMJ A;  2KVQ E;  4YB6 A;  1D0E A;  4DR2 F;  3SI8 A;  2WOM B;  4B9L A;  2YKA A;  2QLX A;  1WEY A;  3QAE A;  2RB7 A;  2V63 A;  4FXD A;  2YNH A;  1NJI T;  3W65 A;  5J2P B;  4KKO A;  3AOC A;  4O4R A;  2V5H G;  2FJA B;  3KK2 B;  1JXV A;  2YKM B;  3ONQ A;  4IR1 A;  2V69 A;  4PPZ A;  4U7C A;  3SBM A;  4UZB A;  1TVR B;  2JEF A;  5D4N A;  4DCO B;  2AYE A;  3M8Y A;  3HVT A;  2GX8 A;  3M8W A;  3BR8 A;  3M2V A;  3N5B A;  3CMA S;  3GZ7 A;  3M9N B;  2QL5 B;  4TXS A;  4NLD A;  1DHM A;  2XO6 A;  3L9Z A;  2MKY A;  3JSM B;  3MAH A;  2U1A A;  3N0V A;  4RU9 A;  4UTG A;  2Y0B B;  1VS3 A;  1F5A A;  4C48 A;  3VAF A;  1T94 A;  4DQQ A;  2MQN A;  1PJ6 A;  2JVO A;  3TAP A;  4QPT A;  4DV6 J;  3PR4 A;  2E5I A;  1AUD A;  1HYS A;  3D6H B;  3MCS A;  2EVZ A;  4E2F B;  2R8I A;  5L46 A;  2LU2 A;  4ZIW A;  1TFW A;  1NSK L;  1SKU B;  2DCU B;  3GIL A;  4LFA J;  4J37 A;  4LJM A;  4EYI B;  1RAA B;  5EGY A;  2FVS A;  4WFY A;  1VC0 A;  1UPP A;  2DEJ A;  4G6V B;  1M90 T;  2DPI A;  3K7R A;  4ZVE A;  1T7P A;  3HF5 A;  4BDP A;  3NBP A;  1KR4 A;  1PO6 A;  2VQF F;  1KLM A;  4CO2 A;  4O3R A;  2CQD A;  5D0G A;  1K8A T;  3DYA A;  5M2R A;  2RRA A;  5DGA A;  5HBM B;  3D3C J;  4F3Q A;  4J9L A;  4IR9 A;  4F0M A;  1NK4 A;  2YWG A;  2WW4 A;  2ZNY A;  1QVF R;  1Y00 A;  4MYU A;  5IQQ A;  4JOU A;  2CUY A;  3J7Y U;  3QGG A;  2UVW A;  4MMO A;  3FZ2 A;  4WBF A;  1BLU A;  2J76 E;  3O3L A;  2GAG C;  2F40 A;  1EET A;  1SQE A;  4WU2 A;  2Q3P A;  2GV1 A;  1F3V A;  1TK0 A;  3O5T B;  4OI4 A;  2WAQ D;  4NXN J;  2EFQ A;  1TQL A;  4RPF A;  1IKY A;  1HPZ B;  3KUH A;  1XMO F;  3TP2 A;  4KR0 B;  2BM0 A;  4OFZ A;  1OWX A;  4L75 A;  3QYY A;  4LF9 F;  2XCA A;  1SC1 B;  4Z37 A;  2G4B A;  3CCU S;  2E1A A;  1V5I B;  1WC4 A;  1ZPV A;  1WOS A;  2XMM A;  4HVZ A;  4H4O B;  4WE1 A;  4FDF A;  1QLN A;  1WEL A;  1T9U A;  4FKX A;  5LSO A;  3MED A;  4QW8 A;  4F4X A;  1M1H A;  1M5K C;  1JLC A;  3H59 A;  2YPY A;  3NGR A;  1HQE A;  3GP9 A;  5D4L A;  2HQF A;  2JEJ A;  3RBX A;  3T5L A;  3EXY A;  2E9T A;  3TJ8 A;  1DQA A;  1WNE A;  1Q79 A;  3BGR B;  3W2V A;  4QWC A;  1R8P A;  1IKX A;  2B9E A;  2VG7 A;  4TU8 A;  2IVF B;  4I2P A;  4B3O A;  3D5M A;  3Q2S C;  1U6B A;  1RYR A;  1VQL S;  4USI A;  3V4I A;  1YBA A;  2HVZ A;  2WON A;  2GHW A;  3OD2 A;  2HFZ A;  1HFE L;  1NUE A;  3PM9 A;  2VIH A;  4NPO A;  3GYX B;  4OYO A;  1IBM J;  3KLF A;  2UUB F;  2C3M A;  3NGU A;  1JJ2 R;  2RU9 A;  5HMZ A;  4ECS A;  3CIM A;  2IAJ B;  3T6J A;  3CD5 A;  4B9N A;  3K58 A;  1E6Y B;  2IJR A;  5EHH A;  1IKV B;  3N01 A;  1FJG J;  3BYR A;  1IVZ A;  2HQD A;  5F8N A;  2VG5 A;  3HFV A;  3GLJ A;  3AH6 A;  1YG0 A;  1IBL F;  1S57 A;  2GVZ A;  4DBQ A;  4K50 A;  3HPO A;  4I56 A;  1KTQ A;  3V6D B;  1MNE A;  3BEG B;  9RUB A;  1PYO B;  3DGP A;  4OX9 J;  3DRS B;  3PVX A;  1KN6 A;  1LXJ A;  1VQP S;  4W98 A;  4ZVP B;  3OR2 B;  2W2O P;  7FD1 A;  4ED6 A;  1NKB A;  1S1W B;  5LXY A;  1FFW B;  1YIJ S;  1IJE B;  4DR5 J;  1C4C A;  4OI1 A;  4F4K A;  3H5S A;  3PR5 B;  3RB6 A;  4GO5 X;  2YPZ A;  2DNM A;  3M7V A;  4UZC A;  4ZVH A;  2KFZ A;  2V8P A;  1H98 A;  3LP2 A;  2FUG 9;  2J0W A;  2ZZM A;  3D1Q A;  4C11 B;  3J80 U;  5HQL A;  5F0W A;  5A6W A;  4NX9 A;  2XY7 A;  3W8P A;  3CME S;  4ZIT A;  2H9Z A;  3AA8 A;  3FK4 A;  3PW7 A;  5KT2 A;  2IC3 A;  1JWW A;  1HNV A;  3AOB A;  5IZH A;  2V34 A;  2D69 A;  4KT0 C;  2HNZ B;  1QSL A;  2PGC A;  2CFX A;  4F4A A;  2ZM6 F;  4CLK A;  2FHO B;  1PC5 A;  1GXL A;  4FVM A;  3BKT A;  3WHI A;  4O3N A;  4DV7 F;  3A1Y G;  3W2W A;  4HT7 A;  3I32 A;  2Z57 B;  2J9E A;  4ID8 A;  4CWB A;  4C2M A;  1TL3 B;  1CEZ A;  2RQ4 A;  1JLG A;  1PBA A;  1S5Z A;  4LVN P;  1HI1 A;  4A4J A;  1HHT P;  3G87 A;  1SH0 A;  4WIQ A;  4UW2 A;  4DEZ A;  4DV5 J;  2BKP A;  3J7A N;  4G1I A;  2W4C A;  2B6A A;  4BWM A;  2K1R A;  4P71 A;  4ELT A;  3UPF A;  2P2C B;  1SV5 B;  3CCS S;  2VBX A;  1C0T B;  4KHR A;  1KSP A;  2HQI A;  5D0H A;  2DHG A;  1RJJ A;  4H4K C;  3PHT A;  2QT7 A;  2SXL A;  4LF6 J;  4DG1 A;  5HK4 A;  1XMQ J;  1N34 J;  1HWU A;  1OQ3 A;  2KJV A;  3QSI A;  4USH A;  3QWU A;  2RD5 C;  1C0U B;  1GMV A;  4NLO A;  5DZ6 A;  1QD1 A;  4QU6 A;  1S79 A;  2XWY A;  2XS7 A;  1RA7 A;  4QR2 A;  4PUO A;  2E5J A;  1R27 B;  4DCJ B;  2GQC A;  2YWW A;  3POT A;  3A8I A;  2DNQ A;  1ICE B;  3D6T B;  5DQI A;  3DLJ A;  5BXI A;  1CVJ A;  2C1E B;  3NOC A;  1VJW A;  2MQM A;  3FGV A;  4RW4 B;  2ZJP Q;  4J9Q A;  3VCD A;  2OEJ A;  2IFX A;  3M8P B;  4CT9 A;  4M5L A;  2AZ1 A;  1KRP A;  2OIH A;  4DMZ A;  5K5M A;  3EPI A;  1BUX A;  3TA1 A;  3M32 A;  3DDI A;  4ZJO A;  2UXB J;  4KPC A;  2VG6 A;  2YNH B;  1T9T A;  1HNX F;  3DN9 A;  5B08 A;  4KKO B;  4P75 A;  4NYP A;  3ICL A;  2QC3 A;  2DR7 A;  3FQK A;  3DOL A;  2M5Y A;  2GMJ A;  4O0N A;  2GW8 A;  3OTB A;  2BYC A;  3C6U A;  3FCV A;  1W25 A;  1K0T A;  3M2V B;  5F41 A;  4X66 J;  2CPD A;  3Q8U A;  4KH1 B;  1V3Z A;  2DR9 A;  4N47 A;  2HRY A;  4USK A;  3KJV A;  3IN5 A;  3R6L B;  3NL0 A;  4RUA A;  1K1Q A;  3E01 A;  3FRZ A;  4H4M A;  3WZ0 A;  2MLY A;  4PPD A;  2KHC A;  3RU0 A;  3R6G B;  3UDC A;  1HYS B;  5LSR A;  2KN4 A;  3M1V A;  2PA8 D;  1LEO A;  3L09 A;  2XS2 A;  1S99 A;  4X4R A;  4CIO A;  1LW0 A;  1UL3 A;  4YUD A;  3CJK A;  4CCH A;  4E98 A;  2EFV A;  2GGP B;  2NLW A;  3VQS A;  4JI6 F;  2BAN A;  4I64 A;  1TUG B;  4RJV A;  3VHQ A;  2D1C A;  1N36 F;  2V8G A;  4OV1 A;  2PI4 A;  3AT1 B;  1SC4 B;  4ZCI A;  1TKD A;  3IAM 9;  1R0B G;  1UP1 A;  2I9S A;  5F8H A;  3NBP B;  1RT1 A;  1NK6 A;  3N6L A;  3R5A A;  5A8R A;  3MMC A;  2XMU A;  3IR7 B;  5KG7 A;  1FKP A;  4DV1 J;  4PG4 A;  4X65 J;  4MIW A;  3R5C A;  3DYA B;  4ZJL A;  2BUN A;  2D3O 1;  1C1B A;  2G0C A;  3PCO B;  2UU9 J;  1WHY A;  3BPS P;  3CC7 S;  1NH8 A;  5JJB A;  4DPT A;  4HLB A;  1WTB A;  2KFN A;  2DTJ A;  4OZ5 A;  5J2M A;  2HVD A;  1Z4U A;  3K8V A;  5FJ4 A;  2MHN A;  4ILR A;  3FRY A;  3I87 A;  2MQQ A;  3GMG A;  4HHJ A;  4JV1 A;  2DNH A;  4K5R A;  4PCQ A;  2EG2 A;  4FPI A;  2F8H A;  1PCA A;  2EK6 A;  2G2Z A;  1UW4 A;  5LOQ A;  1YDL A;  1JIH A;  3ENV A;  3N79 A;  1TMM A;  1XTZ A;  1EET B;  1Y5I B;  2JZ5 A;  4FN5 A;  2A1B A;  5AT1 B;  1WHV A;  3CCR S;  1X4B A;  4LR9 A;  1VBY A;  2LVW A;  1IKY B;  4C3K A;  3UI3 A;  1K73 T;  1RTH A;  3JYT B;  2K7K A;  1P9Q C;  4C3L A;  2BDP A;  4O3Q A;  5L8R C;  4EMD A;  3MZI A;  4J5O A;  3TX8 A;  1I1G A;  3PEH A;  5KFY A;  4KGK A;  1RTI B;  1YZ7 A;  4PAA A;  4IFY A;  1J5O A;  3MED B;  1WKK A;  3CDE A;  3H5X A;  1D8Z A;  1N33 J;  3V81 A;  2KT2 A;  4OYZ A;  4O44 A;  2C2Z B;  4OI2 A;  3P5T L;  5ETT A;  1Q8K A;  3ZZO A;  1HQE B;  1KP6 A;  4HDH A;  2HVI A;  4LR8 A;  4QR0 A;  2AJQ A;  3TI0 A;  2HHT A;  3KHG A;  5KT6 A;  4IFV A;  3CCJ S;  5ETK A;  3MR2 A;  1VDH A;  4OL8 A;  3W2V B;  2XMA A;  4CLT A;  4YR0 A;  2RVJ A;  3HHL A;  2VG7 B;  3QBC A;  1YJ9 S;  4I2P B;  2PD1 A;  1UZH A;  2NXU A;  2F63 A;  4DL7 A;  3GR1 A;  1GTH A;  3V4I B;  3G82 A;  4UQT A;  5KFX A;  2WON B;  1QDU B;  3N9U C;  2PEH A;  5H9E J;  4WKR A;  3TAR A;  1XNR F;  2GA7 A;  3KLF B;  5A6P A;  5IQ6 A;  1RGV A;  3HFK A;  3B4D A;  2GFF A;  2QA2 A;  2KU7 A;  3QGI A;  2WBM A;  2M4M A;  4ZIV A;  2AQ4 A;  2VG5 B;  3NNC A;  2OML A;  2XLJ A;  1TP7 A;  3HXM A;  1RWX B;  6FDR A;  3J7Z T;  2ZIT A;  3W62 A;  1XWL A;  4PWW A;  5KFB A;  2CPE A;  1R89 A;  2BJ8 A;  3DGP B;  1SJR A;  3CDU A;  2LEC A;  5E2Q A;  3UCG A;  2M52 A;  4E0D A;  3T6B A;  1FD8 A;  3KHL A;  4U67 Q;  2V4J A;  4U8V A;  3NCR A;  1SIZ A;  3MPW A;  4ECX A;  3HZG A;  4FNH A;  2YY3 A;  4KHP F;  2C42 A;  1X8D A;  4DPX A;  5FII A;  2YKQ A;  4X4P A;  1FFG B;  2ZH5 A;  3DGV A;  4LRA A;  3QLH A;  3LP2 B;  3OUY A;  2EW9 A;  2I6W A;  1L5U A;  2F8E X;  2G0I A;  1N5T A;  3KLG A;  2IC3 B;  1R31 A;  1HNW J;  4DL6 A;  2VZ9 A;  4JV5 F;  5KFV A;  4I4B A;  5L1I A;  1O8B A;  5CYQ A;  5AXM A;  2XMV A;  3N28 A;  1D9A A;  3G8Q A;  2MMY A;  1U26 A;  5F8M A;  3W5X A;  4F0H A;  2FY1 A;  2R2R A;  5BYQ A;  1H6K X;  2R7Q A;  3TA2 A;  3NGK A;  4DFP A;  5CCM A;  3AD9 C;  1UJ4 A;  5MLC V;  2WCX A;  4WCE Q;  3W2W B;  3R7B B;  5IV3 A;  1JKH A;  1VBX A;  4OHY A;  5CH7 B;  4ETX A;  5J1N A;  1JLG B;  1VMB A;  5DDP C;  1S6O A;  1SQG A;  4QWD A;  2O66 A;  2PDA A;  1HNZ J;  1HQU A;  3GB0 A;  2HBY B;  4ZMM A;  1Q7L B;  1CQM A;  5HJY A;  1RAH B;  2B6A B;  2K1R B;  5CYM A;  1Y7P A;  2HYI B;  3MOJ B;  3WQP A;  2DIU A;  2EFO A;  4JI5 F;  1ZM3 A;  3AJ1 A;  4URQ U;  3GIK A;  4QYZ J;  1O0P A;  4X64 F;  1IJF B;  3C14 A;  1DAR A;  4DG1 B;  1U0S A;  1Q8B A;  4CNY A;  4PR6 A;  4ED8 A;  3KLI B;  2QV6 A;  1NM2 A;  1S9E A;  4NA3 A;  2KL8 A;  4AXJ A;  4PUO B;  5C2C A;  3EDQ B;  3J7Y I;  1TAQ A;  2RT3 A;  3BPD A;  3POT B;  1F9H A;  4C8Y A;  2B51 A;  2DO0 A;  4ECV A;  3TX0 A;  6AT1 B;  5T41 A;  4ZVT B;  1YI2 S;  5KFC A;  3FMW A;  3UVJ A;  2B4O A;  3CC4 S;  4B9S A;  1TL7 A;  5K8O A;  4I1T A;  1Q8L A;  2AHO B;  2VFV A;  2XG8 A;  4YB5 A;  5E41 A;  4PAB A;  2D3U A;  2VG6 B;  2YNF A;  2VIC A;  5KFS A;  2AW0 A;  2OKQ A;  2VH7 A;  3T5J A;  4Z7C A;  3H98 A;  4A8X A;  2FVP A;  3CJ3 A;  3FSI A;  3UR3 C;  4YFU A;  2CA9 A;  4Z7Y A;  3A3O B;  3CDA A;  2RQC A;  4DQR A;  3W8G A;  1SQF A;  1IR1 A;  1ARO P;  3LTO A;  4K4T A;  1SJF A;  5KFW A;  1NZ8 A;  3MPV A;  3C6U B;  3PYG A;  2BM1 A;  2G9O A;  3PJX A;  1IN0 A;  4LF8 J;  4DV6 F;  2XGP A;  2VV5 A;  4A48 A;  3PHE A;  4JUZ A;  5EN1 A;  1WF2 A;  3CJQ A;  1NU4 A;  3W9J A;  2F9J A;  1VGY A;  2E9Z A;  4LFA F;  3E01 B;  4H4M B;  2RDI A;  1VIX A;  5EX0 A;  3S01 A;  2WSC C;  2C3P A;  1EAR A;  1R43 A;  4L74 A;  2N4C A;  2OD6 A;  2RJZ A;  4IDK A;  3M1V B;  5HAO A;  3OHA A;  5E7O B;  2VJV A;  1VRT A;  1LW0 B;  1WHW A;  1S1V B;  1X9W A;  2BAN B;  4KB7 A;  4YDD B;  3SFU A;  1JB0 C;  3Q8S B;  3ZFV A;  5KTQ A;  2D3Z A;  5HLF A;  2CWK A;  4FYW B;  1VI7 A;  3KNG A;  3ITH A;  3LW5 C;  4GMK A;  2LQ8 A;  3RR7 A;  2PMH A;  1RT1 B;  2XNQ A;  4KO0 A;  1CPZ A;  3UDV A;  3MMC B;  2W2N P;  1FKP B;  1NJZ A;  3ZZR A;  2M3D A;  1EHW A;  4YHH J;  5HVF A;  3U02 A;  3W3S A;  2MZJ A;  2C3U A;  4ECT A;  2MKC A;  2VOD A;  3NMA A;  4KPY A;  4WTY A;  1IQT A;  4F2S A;  1S9G A;  2WHO A;  5IV4 A;  4Q8E A;  3MAA A;  2EBG A;  5J2M B;  2ASD A;  1SXL A;  3OFE A;  1N52 B;  1FKA F;  4K5S A;  4X4N A;  3IO1 A;  2X1A A;  1C2P A;  1AT1 B;  4ECY A;  4NXN F;  1W2I A;  2O01 C;  1QE1 A;  4RNO A;  2PA3 A;  2LU1 A;  3ETM A;  3E51 A;  2HMI A;  2FJB B;  1FEE A;  4NML A;  4NEY A;  5LM7 E;  3VTI A;  5DQG A;  4DUY J;  3TR5 A;  2EG1 A;  1AXQ A;  4MT1 A;  1QAX A;  2WW8 A;  5HRO A;  1JLE A;  2CJA A;  4CLW A;  2GMH A;  4N41 A;  2OFH X;  3S1T A;  1WOO A;  4EO8 A;  1V3S A;  5RUB A;  1R8C A;  4X62 F;  1ZAX A;  3TAQ A;  3HD2 A;  3GIJ A;  2HIQ A;  1LWC A;  5KG3 A;  4OZN A;  4FVC A;  2CJQ A;  4XDC A;  1NKC A;  1X4A A;  5LSL A;  2XMK A;  3OJU A;  4IFY B;  5DLG A;  1J5O B;  3G86 A;  4OHV A;  3V81 B;  3RG6 A;  4O44 B;  3DXB A;  1FRH A;  2KI2 A;  5IFM A;  2Z56 B;  2YWH A;  1Q82 T;  1FRK A;  2GIR A;  4J90 A;  3VF0 B;  5KFU A;  1RBL A;  2ZE2 B;  3FC9 A;  2FLL A;  4IFV B;  1CJT A;  5KT4 A;  4HL9 A;  5HN0 A;  4NEZ A;  1HMV B;  4C97 A;  1KVI A;  4JI4 F;  1NSP A;  3OTO F;  3NAI A;  3HLU A;  3GJS B;  5CCL A;  3QQC D;  2PEB A;  1VQ5 S;  3SXL A;  3G82 B;  4Q44 A;  5F8G A;  5DLF A;  4NYZ A;  1FJG F;  1CC7 A;  3GQC A;  1RHU B;  2KT3 A;  2DXE A;  2IY5 B;  2ZJR Q;  4U9R A;  1DQ8 A;  3ADA C;  2BV3 A;  4AQY J;  4KY3 A;  4EK2 A;  4DR2 J;  3QFW A;  3GYN A;  2MDA A;  4NRT A;  2EI5 A;  4ZCL A;  5A0Y A;  3GFX A;  4NMX A;  1VQ8 S;  1YGY A;  2FHK A;  3BBC A;  2DBB A;  3BO3 A;  2NZ4 A;  4DQI A;  2DNL A;  1RT7 A;  1ZM4 A;  4ZPB A;  2RRN A;  4NLQ A;  1URN A;  3H90 A;  3W63 A;  2KFY A;  2JLF A;  3OVA A;  1NKE A;  4EU0 A;  2HAI A;  2V50 A;  2EWH A;  1XNQ F;  3R7N B;  4TY9 A;  1PC4 A;  3R5B A;  2P9G A;  2VPW B;  3HSD A;  1U2R A;  2M8D B;  4DFJ A;  3IS9 A;  3BN7 A;  1I94 J;  4DV4 J;  5EWF A;  1X5T A;  5B7W A;  4MIB A;  1NB7 A;  2CQ2 A;  1YKW A;  2OGU A;  5JUM A;  2XZT B;  3QLH B;  3MMJ A;  5C24 A;  3H4B A;  3J80 Y;  3IGV A;  2LA6 A;  2J8A A;  1H7X A;  1NPK A;  4PG7 A;  3KLG B;  2IM1 A;  2BW7 A;  2K3K A;  2OEL A;  2BJ9 A;  1HQ2 A;  4X84 A;  5CYQ B;  4LRB A;  2EKN A;  3MPU B;  5KFR A;  3PV8 A;  4ZLP A;  4ZPD A;  2IM3 A;  2MLX A;  5KFN A;  4M5G A;  1WG4 A;  3GIM A;  3OQ2 A;  1WC3 A;  4J7C A;  4NCG A;  3NAH A;  5H9E K;  1R6Y A;  1ZM9 A;  2AMC B;  2HG4 A;  5D77 A;  4ID5 B;  1Q1K A;  2JC1 A;  3ZNJ 1;  3NXZ A;  2LQ5 A;  1HQU B;  4LF6 F;  2AJF E;  3U1M A;  2XLK A;  1I5O B;  3ZZT A;  5L9N A;  4PYD A;  2BMB A;  2RF2 A;  2VBY A;  2DGW A;  3JXO A;  3LH2 S;  2Q43 A;  3K0J A;  4IQM A;  3IWN C;  2CZV C;  1JK9 B;  3MEK A;  2UUC J;  2B7B B;  2HGN A;  4B3S F;  4R5P B;  2HNY A;  4TYB A;  1UJ5 A;  3A4T A;  2W2M P;  1UZD A;  3W5Z A;  1B0V A;  4WWS A;  2HPU A;  1S9E B;  1VLY A;  4ZVF A;  2ZD1 A;  1U02 A;  3C2P A;  2R7O A;  3TZX A;  2HWI A;  2JJ4 D;  2VAS A;  2ZUA A;  1TFY A;  3MEE A;  3PFO A;  1IBK J;  2UXB F;  4PXE A;  3QAT A;  1WSR A;  4HTI A;  3L95 X;  2VPX B;  1U1M A;  2NPI A;  1Q5Y A;  4NLP A;  3KK3 A;  2BJE A;  2BRL A;  2JHE A;  2Q6C A;  1T8E A;  4IO9 Q;  3PO4 A;  1X60 A;  1WTF A;  3UNG C;  4DUT A;  1RWU A;  2JFK A;  3DXS X;  3GYG A;  4UUX A;  3PJ9 A;  1QAJ A;  2ZHB A;  3EXC X;  3LAM A;  3BGL A;  3LP1 B;  4KGV B;  4DR3 F;  1PAU B;  2UUA F;  2H5E A;  2W9C A;  2H3E B;  4JP8 A;  3EGZ A;  4X66 F;  1XC9 A;  4YB1 P;  2KG0 A;  1E6V B;  4FBT A;  3H20 A;  4ENO A;  3CCW A;  2V2V A;  5K9F A;  3FUY A;  4FS1 A;  1LOU A;  1TK8 A;  1PYS B;  1VRQ C;  1NJX A;  3T5H A;  5CZX A;  1GH8 A;  3SDE A;  3MM7 B;  2XZW A;  1U48 A;  4WP8 A;  3P8B B;  2Y1I A;  4AXI A;  3ULH A;  3SFG A;  3I5C A;  2Z2L A;  4KHM A;  2ZNZ A;  4WZQ A;  2L9W A;  2FGC A;  2VU5 A;  2KZZ A;  1FWK A;  4DV3 F;  4K59 A;  2LMI A;  3IXQ A;  1HBU B;  2ROG A;  5CQG A;  4IDK B;  3ZC4 A;  4QYZ K;  3R5J B;  3JSB A;  2E7W A;  2W4D A;  1VRT B;  2Y0S D;  4LIR A;  1TMJ A;  2FB0 A;  4A8Q A;  4LRF A;  4DL4 A;  3G9C A;  4P74 A;  2CPX A;  2L3M A;  3CNQ P;  4USV A;  3F41 A;  1JJ4 A;  4I7F A;  1F9E B;  2UVV A;  4DV1 F;  3CMQ A;  4U7U K;  2MTL A;  1YX2 A;  1GAO A;  5FDL A;  2UU9 F;  2VBW A;  1RT2 B;  3ITH B;  4YY3 J;  4RW7 A;  2AJ2 A;  3N6M A;  1RHQ B;  4F4W A;  3OW2 R;  4KO0 B;  5H1S V;  2AJ1 A;  1U8S A;  1U6Z A;  2LYV A;  1WKL A;  2ZZN A;  4XO0 A;  1JLF A;  1KHV A;  3LAK A;  4Y2M A;  3QRQ A;  3AB2 B;  2CNK B;  2V6A A;  3U27 A;  4OI6 A;  3LA0 A;  3HHL C;  2CPF A;  2HHU A;  1S9G B;  2XB2 D;  3QO9 A;  3MAA B;  2DNZ A;  2IDE A;  1JNR B;  4L73 A;  4P2F A;  4QYR A;  2AYB A;  3G2X A;  2MZ1 A;  2HGM A;  1YJU A;  1U0H A;  2P5V A;  4FYV B;  3LOU A;  2CG4 A;  2IIH A;  3C16 A;  1S6P B;  1K47 A;  2N7C A;  4I6A A;  3Q8R B;  2WBR A;  3P96 A;  5D15 A;  2VDI A;  2HMI B;  1MWQ A;  2BQU A;  2A6O A;  1RCO B;  2YX7 A;  1N6Q A;  4I2Q A;  2MY8 A;  5H9F J;  5G4D A;  2ROP A;  2PT0 A;  5BR8 F;  1FRM A;  5HRO B;  2IRU A;  2OO4 A;  1JLE B;  3M6X A;  2DXD A;  4MKA A;  2RIL A;  2RNE A;  1FJC A;  1OIA A;  5ETN A;  4KE5 A;  3B8H A;  1NK8 A;  3D0I E;  5F8I A;  3RRH A;  2IA0 A;  2DGT A;  1FDB A;  2OPQ A;  3FSY A;  3Q89 A;  1LWC B;  3KLE A;  1RAD B;  3EJM A;  1N33 F;  2V8V A;  3C6T A;  4DR7 J;  3DRR A;  2MZT A;  5DM7 Q;  2AP6 A;  1BQX A;  2AX0 A;  2G0J A;  3BO4 A;  1HD0 A;  4C98 A;  2RS2 A;  3GJT B;  2PII A;  1YBT A;  2F1F A;  1FRI A;  1M5S A;  4CO4 A;  2RH3 A;  3NS7 B;  4O4G A;  4A46 A;  2BVZ A;  4DV2 F;  2GJF A;  1CJT B;  1Y5L B;  2A0F B;  3AXK A;  3PKM A;  3THV A;  3BGU A;  3JSR A;  3V6K A;  2RQM A;  3HD1 A;  4USU A;  1AA1 B;  1W26 A;  2ASJ A;  4OX6 A;  4V1A k;  1X5O A;  2MKH A;  1XBW A;  3G6E S;  1IQZ A;  1WG5 A;  4USW A;  1K9M T;  3UR0 A;  1UAW A;  4WU3 A;  5A0Y B;  2XUL A;  2BKO A;  2GS8 A;  3THP A;  1U4B A;  3MAQ A;  1FXL A;  1U7L A;  4GC7 A;  1BD6 A;  2QL9 B;  3DM2 A;  3RBD A;  1HNX J;  2DNO A;  4Q2M A;  4B3M F;  1Y4Z B;  2MPU A;  5J2Q A;  1ULR A;  3TRG A;  4B9U A;  4DS5 A;  3R7S B;  1T03 A;  1AYE A;  2ATC B;  4ER8 A;  2NS1 B;  4NLY A;  4ZPV R;  1RSC A;  4C9D A;  2XCP A;  1UFL A;  2B9Y A;  4YDX A;  3DRX A;  3X1L B;  3AQO A;  3CED A;  4HEA 9;  5IXU A;  1RTZ A;  5AE2 A;  1RWW B;  4NLT A;  1FES A;  4LF2 A;  3FCW A;  4K8R A;  1N5S A;  5C42 A;  2CJK A;  3G8S A;  3A3N B;  2NZC A;  2Y9H A;  3IS9 B;  1HNW F;  2HVH A;  1Q78 A;  2HK3 A;  3UDE A;  4M5N A;  3LGM A;  2R8H A;  2QEX S;  4WFN Q;  5C24 B;  1S48 A;  4RW6 A;  2AT1 B;  4IKA A;  2DCL A;  4OZ3 A;  1NSQ A;  4H54 A;  4ANE A;  3BKU A;  1J5E J;  2O3D A;  3CCT A;  2QLJ B;  1AUS L;  3I96 A;  1HW8 A;  4G1Q A;  3UQS A;  4QQB A;  3MM5 B;  4FXW A;  5LMU J;  1HNZ F;  2N3L A;  2G2O A;  2X1F A;  4NCG B;  4YQW A;  2Z2M A;  3H5Y A;  1MRO B;  3QJJ A;  2DIV A;  2R7S A;  3T1H J;  1MG7 A;  2FTR A;  1HNI A;  3SQG A;  2QA1 A;  1T3O A;  1DY3 A;  4JI3 F;  3KK1 B;  1LWE A;  3E8O A;  4URG A;  2OEK A;  3ZTO A;  2P6S A;  4DI6 A;  2RF2 B;  3VAJ A;  2L48 A;  4M8L A;  4ED1 A;  4A8K A;  4L72 B;  4OMF G;  3MTJ A;  2YQ0 A;  3VZI A;  5A8K B;  3MWB A;  3SEO A;  1Q95 G;  3M2R A;  3EZO A;  4AD6 A;  3MR6 A;  3PIO Q;  2HK2 A;  2MLZ A;  2WB1 D;  4KRW A;  5AXN A;  2AYG A;  1F5B A;  1OY6 A;  2BR0 A;  2GZO A;  1B64 A;  2ZD1 B;  2LCW A;  4ZPA A;  4RW9 A;  3CW2 C;  4WF9 Q;  2HKE A;  3C66 A;  4Y34 A;  3K59 A;  3G6Y A;  1O51 A;  3V2U C;  3MEE B;  3Q2T C;  5F8J A;  2E1P A;  2K2P A;  2NUU G;  2BE2 B;  1NND A;  4YB7 A;  4GKJ F;  4M5M A;  3VGV A;  5FLX U;  4LF4 J;  3UW1 A;  2XHW A;  2PE8 A;  3KK3 B;  1UJ6 A;  2Q79 A;  1HWL A;  4NI2 A;  6FD1 A;  4CLZ A;  3K5N A;  2DRB A;  2LQB A;  1WG1 A;  5SZT A;  4DDF A;  3MR3 A;  2G13 A;  4CZC A;  2HFU A;  4ZP6 A;  1Y3J A;  3EYZ A;  3WDO A;  4HDG A;  2CYY A;  3PAC A;  3D68 A;  2IDL A;  1F0X A;  4Y0F A;  1S6Q A;  1W7W A;  2CQG A;  4LF8 F;  4L3K A;  2LDY A;  1UWB A;  4DU7 A;  2FVC A;  1KFD A;  1O5J A;  4OV6 A;  4DLE A;  3BZQ A;  1TKZ B;  2NSC A;  2OSR A;  3HFZ B;  5D3G A;  3KUG A;  1TKT A;  2H1Y A;  1S1X A;  3ISN C;  4Q0B A;  4PG5 A;  2G1H A;  3SDE B;  2DPJ A;  4F7V A;  5CYJ A;  4JI1 J;  3R5D A;  3UO0 A;  4F50 A;  4K4V A;  3M6U A;  3OT9 A;  2CQP A;  5KFJ A;  3M9O B;  5CA5 A;  3HJF A;  4ES2 A;  4C0O C;  3OFH A;  1UPM B;  2D7S A;  2ZH3 A;  5KFD A;  1RLD A;  1FD2 A;  2FLP A;  4CLL A;  2O1P A;  3DLE A;  1XNR J;  4ILL A;  1CUL A;  2NQP A;  3ENW A;  1KDN A;  1NDP A;  4I7F B;  2EEY A;  3D1H A;  3M2U A;  4M95 A;  4ED5 A;  4J9N A;  4YHH F;  4C3M A;  2RUS A;  3G4S S;  3PYE A;  5FDL B;  4P7T A;  1T05 A;  2F5G A;  4RW7 B;  3GJQ B;  4DSI A;  2DR6 A;  3SV4 A;  3CJ5 A;  1KFS A;  3PRB A;  5JVH Q;  4BS2 A;  1RAO A;  1VK3 A;  1VIS A;  4DSJ A;  3AOA A;  4CO3 A;  2CJY B;  2J7U A;  1FRX A;  2QLW A;  4DZD A;  2QN6 B;  1OY8 A;  2FDN A;  1F2G A;  2LLZ A;  3C16 B;  4DUY F;  2MHE A;  1WSV A;  4G1P A;  4ZDN A;  3PY8 A;  2OI2 A;  3CIZ A;  1LK5 A;  1VQ6 S;  1AB8 A;  2L9D A;  4PXB A;  2D3O R;  2OUG A;  4I2Q B;  3ILI A;  1RAI B;  5ETR A;  5C2G A;  1CJU A;  5KAK A;  2IM0 A;  4QWB A;  4JV5 J;  4B02 A;  3LPY A;  3GU0 A;  4USM A;  1FTR A;  2R42 A;  4DR6 J;  1FRL A;  4DSF A;  4NA1 A;  1H72 C;  5A8W A;  4AL6 A;  1VBK A;  3RAX A;  2QLB B;  3EUN A;  2UUW A;  5KFF A;  4TY8 A;  2OPQ B;  1RT5 A;  5HI7 A;  2OPR B;  3KLE B;  4BHQ A;  1YJV A;  2DJW A;  1SVD A;  2E1R A;  3C6T B;  4LQ3 A;  3BB5 A;  4Y2C A;  3M6W A;  3DRR B;  3AD7 C;  2AF6 A;  5E3A A;  2L08 A;  4P2S A;  4PXD A;  1KQF B;  2HHH J;  2ZFH A;  3IP0 A;  2FZG B;  4J9O A;  1T02 A;  1TU0 B;  3UWT A;  5G0R B;  1BHN A;  2AZ3 A;  2ALY B;  3UD3 P;  2VF3 A;  4CYU A;  1ZH5 A;  1S77 D;  1FWL A;  3NS5 A;  3PXG a;  5BYR A;  4O4G B;  2HLT A;  1Q5V A;  1SBR A;  2DGS A;  2W24 A;  4B3R J;  5AXL A;  5HVG A;  3CDB A;  2C2O B;  2XZD B;  3JB9 k;  4FNI A;  5M2U A;  2J5A A;  1DFD A;  3CB4 A;  3Q8V A;  4M5H A;  1VJQ A;  4AFF A;  4AQY F;  2KXN B;  3AY0 A;  2GHP A;  1EB0 A;  2GML A;  2XNR A;  2YTC A;  5BYS A;  1SI9 A;  5D78 A;  3MMB A;  1X0F A;  3KMQ A;  3PDN A;  1X31 C;  2G1D A;  1XR5 A;  2JEG A;  4GRS A;  1LWF A;  4C8O A;  1NXI A;  5ITH A;  2BQR A;  4PWD A;  5KFO A;  1RP5 A;  1T0T V;  1VRU B;  4LF7 J;  3BR9 A;  2ABY A;  1NDL A;  1NK7 A;  3ILL A;  5H9F K;  3WC2 A;  1HBN A;  3DM2 B;  2HFS A;  4NLX A;  3A8K A;  4QWE A;  3EX7 B;  1WOP A;  1K0V A;  4JI2 J;  4S0M A;  1L3K A;  1RKJ A;  5CAA A;  1U24 A;  5J2Q B;  2QA4 G;  3GON A;  1YJW S;  1WDT A;  3FNN A;  4GVB A;  1T03 B;  5B0A A;  1I94 F;  4DV4 F;  1ZA2 B;  5EDW A;  5CHC B;  2E66 A;  2YKN B;  1DTQ B;  1WC0 A;  2KDO A;  2DIS A;  1RAC B;  5C42 B;  2Z30 B;  1AZS B;  2AEM A;  3KHH A;  4TKT A;  2RE1 A;  2I38 A;  4LRD A;  4QBU A;  4LIW A;  2EC2 A;  2DHA A;  4Q5V A;  2C2N A;  3W60 A;  4RW6 B;  4F3O A;  3H2U B;  3NGT A;  2P9C A;  2W2Q P;  4BCA A;  3M9M B;  5F0U A;  4DPW A;  2W4P A;  1X4D A;  2MB0 B;  2R7X A;  4Q8F A;  3OFG A;  1U45 A;  2J9D E;  4G1Q B;  3IBC B;  5F3Z A;  5T14 A;  2ERR A;  1FX4 A;  2W1B A;  5IM0 A;  4HTJ A;  2ZH9 A;  2B5J A;  1S0M A;  2J0X A;  4CNZ A;  2WVD A;  3BH6 B;  3IC1 A;  2Q1L A;  4CRJ A;  1HNI B;  1RI7 A;  3SQG B;  2UUC F;  1NCL A;  2BAC A;  5HL7 Q;  2CJB A;  2EXU A;  1LWE B;  5DM6 Q;  1VIO A;  1YZ6 A;  3QFH A;  3KOA A;  4XDD A;  2RKI B;  2R9L A;  3B82 A;  1MU2 A;  2Q6B A;  4DV0 J;  3BRE A;  3QT5 A;  5K20 B;  2DHH A;  3CJS A;  4LRE A;  1JMT A;  3QGP A;  4WFB Q;  1BQM A;  1IBK F;  1FNM A;  5GAE I;  4QCL A;  3NEK A;  4RW9 B;  3JQM A;  4PKD B;  2F4V J;  2AJ0 A;  4NLS A;  4OJ3 A;  3QMQ A;  1MN7 A;  4HT5 A;  4MFB A;  1F6T A;  3AHP A;  5DS7 A;  1GX6 A;  1L3S A;  5KT7 A;  3JQJ A;  4NI2 B;  2JVR A;  4NAS A;  1M5P C;  3D6F B;  4X62 J;  2MQP A;  4P10 A;  4WYL A;  3KKF A;  2GO8 A;  2DRA A;  4C8K A;  1Y9O A;  5KFG A;  2AD9 A;  5I42 A;  5K8P A;  5ETO A;  2R8K A;  3MM9 A;  1JLQ A;  1S6Q B;  2J6T A;  3MDF A;  2CNO B;  2ACY A;  1NHV A;  3L7P A;  4M5I A;  3D3B J;  2RDJ A;  1L3V A;  3ZZZ A;  4ZVO B;  4ZPW R;  4WPA A;  4U95 A;  2LA4 A;  1MMD A;  2E5G A;  1TKT B;  1S1X B;  2DRD A;  4IG0 A;  3FBB A;  4Q0B B;  2EBE A;  1QUP A;  1Q0N A;  4LSN A;  2QFI A;  1SIW B;  4LFB J;  1RTD B;  2C2D A;  4TLR A;  1BC6 A;  2VKR A;  1RT3 A;  2CAJ A;  4JI4 J;  3OTO J;  1RZM A;  2QTW A;  3WC0 A;  2XHC A;  3RB4 A;  3OXF A;  5KG4 A;  4DR1 J;  2UXC F;  3C15 A;  1WC1 A;  5DO2 A;  1BQN B;  2DGV A;  3CUL A;  4A47 A;  1UEU A;  2J0S D;  2GIF A;  2B4U A;  2JNJ A;  3NGD A;  2C2M B;  3CCL S;  2PO4 A;  1PBU A;  1H3D A;  3DLE B;  3EZU A;  4JV2 A;  2AYM A;  4RR5 A;  2R3V A;  4XTT A;  2OMO A;  4URS A;  4ELU A;  2ZH7 A;  4YY3 F;  1CUL B;  3HHE A;  4WK1 A;  3ENA A;  3DCA A;  3IMQ J;  4X4O A;  3I0R B;  1A6L A;  1CC8 A;  3M2U B;  2GNK A;  4CLF A;  1RAJ A;  2KXF A;  4ZVU B;  1RKI A;  1QSS A;  1SJ1 A;  1KKH A;  1YRX A;  1D3W A;  2D9P A;  2DY9 A;  4NYO A;  1T05 B;  1MMN A;  4UOG A;  4GC6 A;  3HHL D;  2BA9 A;  3EGN A;  4HAC B;  3MGJ A;  4NA2 A;  3UCU P;  3CCZ A;  1GFW B;  4RZR A;  5L39 A;  1XNQ J;  2E5L J;  1X4C A;  5B0B A;  3TUJ C;  2ATL A;  4X4V A;  3D67 A;  4BBY A;  1UVK A;  1I3O B;  5D0E A;  1WWH A;  2UUT A;  3HUL A;  3J81 U;  4WTO B;  3DLK A;  4ZPT R;  1RT6 A;  4DOZ A;  1N5Q A;  3QWP A;  5I3Q A;  3LF0 A;  3FZB A;  4X4U A;  4EBE A;  1PGZ A;  3HVR A;  2WOM A;  1RDR A;  4RBV A;  5IOL A;  2NXE A;  3R8Y A;  2KTQ A;  4ED0 A;  4EI2 A;  4ATN A;  1VQK S;  1R7I A;  2KVI A;  2KM8 B;  1S1U A;  4IYQ A;  1YSJ A;  4LSZ B;  2F4F A;  4TQR A;  1SH2 A;  4LF1 A;  3GE9 A;  4DR7 F;  1D1U A;  1F3F A;  4FF4 A;  3W9I A;  2LQJ A;  3VV2 B;  4DN0 A;  1Y11 A;  1D9D A;  4P52 A;  3KNA A;  3GIR A;  1WOR A;  2K7J A;  1R0C B;  1P6T A;  1RT5 B;  2CVI A;  4B9V A;  3CCM S;  4B9M A;  3HHN B;  5K14 A;  4FZV A;  3JSM A;  2XC9 A;  3DU6 A;  2ILZ A;  3P45 B;  4NCB A;  3CC2 S;  4N77 A;  1YJR A;  3F44 A;  4EYH B;  2R7U A;  3TQ1 A;  4UST A;  2DEI A;  2CQ4 A;  3F56 A;  4CYU B;  4B3S J;  4A8S A;  1V5V A;  1LWX A;  2VC0 A;  1YRT A;  3SCI E;  2V9K A;  1HAR A;  4O0I A;  1G2E A;  2B8Q A;  4ZVG A;  1TKX A;  2QMU B;  1KBR A;  2CG8 A;  2HFV A;  5D0R A;  8ATC B;  2XMW A;  3LAL A;  1HWI A;  4BC7 A;  1XMB A;  4EZ9 A;  2AGQ A;  3MMB B;  4A8F A;  1X5P A;  4ZCK A;  3TW0 A;  4P2X A;  4ZLJ A;  3T5K A;  1MWY A;  4GKK F;  2HHV A;  1LWF B;  1PIL A;  3DRY A;  3RB3 A;  5DDO C;  1RWN B;  1OPI A;  3TZY A;  1U1N A;  3T1Y F;  3OFF A;  4A8M P;  5E5N A;  4J9U E;  1OYE A;  4DR3 J;  4ICL A;  4ZHR A;  2UUA J;  4FPR A;  4XAK A;  4ZP8 A;  3HVT B;  3DLG A;  3K8W A;  5DRK A;  4TVA B;  3V6J A;  2FZK B;  2R7T A;  4OJG A;  2OPS A;  2CPI A;  5KFI A;  4ZP7 A;  1V3R A;  4WZM A;  3O1L A;  3KLV A;  2X3D A;  4RNN A;  2DR5 A;  1GX5 A;  4LFC J;  1IWA A;  2DVI A;  5LL6 d;  5L38 A;  1D9F A;  3HKZ D;  4NZ7 A;  2DXF A;  2DT9 A;  4AND A;  1HPZ A;  2DHX A;  2YWK A;  2HEK A;  1J5E F;  3I5B A;  4DV3 J;  3I9V 9;  1BWV A;  2B56 A;  4I0W A;  3D66 A;  1FI4 A;  3PW4 A;  4OX7 A;  3MD1 A;  5LMU F;  4C8Z A;  3AFG A;  2PMW A;  3CUN A;  3AB4 B;  2YKP A;  2MQ8 A;  4CH1 A;  2I2Y A;  2L41 A;  1SJ4 P;  3CJ2 A;  2MEW A;  1EAY C;  3T1H F;  1HKA A;  1KLM B;  3FBE A;  4CLY A;  5LJ5 Y;  3HT3 A;  1UA1 A;  5IM0 B;  1M5H A;  3CJT A;  4LUB A;  3AXM A;  2MZQ A;  4K0K J;  4FYX B;  4C8N A;  4NRU A;  5GAD U;  2HUR A;  3N5F A;  2HQ3 A;  1FDN A;  5KG1 A;  5LT5 A;  3FVY A;  3WIV A;  2CDR B;  5GME A;  2KYX A;  2CZ4 A;  3HP6 A;  4PRF A;  4LF5 J;  4ZP9 A;  3BDP A;  1FA0 A;  1HBO A;  1P27 B;  3V5R A;  1ZET A;  3I56 S;  2FHJ A;  1X9M A;  3PW5 A;  1FXD A;  2VQE F;  3T3F A;  4M5D A;  1G6B A;  3K2Y A;  3CPW R;  1G3O A;  5FD1 A;  2R7R A;  4KFB A;  2EFG A;  2MQO A;  1T9Y A;  3GG0 A;  5HVH A;  4CTA A;  4C7Q A;  2IAJ A;  2GHV C;  2C28 A;  4LF4 F;  5BJR A;  3E3X A;  1Q81 T;  3PX6 A;  1UTA A;  3G96 A;  4HHU A;  3M8Q A;  4EGL A;  5BR8 J;  1IR2 A;  4MFB B;  2CQB A;  1R6V A;  2W2P P;  4WE1 B;  3V6D A;  3TUZ C;  2LXI A;  2H51 B;  4JYA J;  4CM2 A;  4OI3 A;  5FLX Y;  3W9H A;  1DZ5 A;  4WYW A;  2ZH1 A;  3W66 A;  2ADB A;  1RIS A;  3DRS A;  2KHD A;  4IG3 A;  4V19 J;  1HIY A;  1NPP A;  3OL9 A;  2R2T A;  1JLC B;  3IGN A;  4DXL A;  1X4F A;  4W4M A;  2X3G A;  4CT8 A;  5I42 B;  5HMX A;  2HQG A;  3MM9 B;  1JLQ B;  1RWK B;  3PJW A;  1UA0 A;  4CQ1 A;  2HFN A;  2ZBQ A;  5C5J A;  2GO9 A;  1SC3 B;  3ISN D;  1UVM A;  3B4M A;  4JI1 F;  2OFG X;  3CD7 A;  1FF2 A;  1HI8 A;  3L4B C;  2DNN A;  3KUE A;  1X0P A;  2J6S A;  2K8G A;  3O44 A;  2WSE C;  1IKX B;  4X4S A;  3NWG A;  3SZ2 A;  4B3O B;  1JJH A;  4IG0 B;  2GQ2 A;  2FD2 A;  1PAE X;  1RWV B;  1YHQ S;  2W8L A;  4DV2 J;  4LSN B;  2HW3 A;  4C0B A;  2KM8 C;  1RBA A;  2CNN B;  3DDN A;  1SCJ B;  3VWS A;  3D0H E;  3BN4 A;  1A9N B;  3R2D J;  3F0N A;  3RUB L;  3IFE A;  4LBI A;  5HAN A;  7AT1 B;  4IRK A;  4ZN3 A;  3K5P A;  2ZWP A;  2M0G B;  2F9D A;  1DJ0 A;  3C15 B;  1F5C A;  3RW6 A;  2L9N A;  2B43 A;  3T41 A;  2XYG B;  1WEZ A;  5L1K A;  1A0O B;  3AA9 A;  4J9R A;  4DX7 A;  5B0C A;  1P1T A;  1WD6 A;  1TL3 A;  1LFW A;  2OTJ S;  1KNZ A;  2E44 A;  2GVZ B;  1H0H B;  3QJP A;  1WEX A;  1X4E A;  4KGZ B;  4IH5 A;  4DFM A;  1CJV A;  2HZV A;  5HMY A;  2DGO A;  2H54 B;  3QZ8 A;  3NNA A;  1YIT S;  1EKR A;  4I68 A;  2XLI A;  1C0T A;  3HMJ G;  3QT8 A;  5DG7 A;  1Z2Z A;  3KDN A;  4B3M J;  4WFX A;  4RO0 A;  4FS2 A;  3W7B A;  1SC6 A;  1VCT A;  3P5B P;  4OHX A;  4ES1 A;  2DO4 A;  1HR0 J;  2FIU A;  3OTE A;  3J7A 1;  1QSY A;  3Q24 A;  4KGM A;  1C0U A;  4J9K A;  2VPZ B;  2LEP A;  2J6U A;  4EBD A;  2KJW A;  3L7O A;  3GV5 B;  2APO A;  1U6F A;  1YQH A;  1U1P A;  1VQ7 S;  3TVK A;  2A2D A;  1JNZ B;  3GSD A;  1DBD A;  3DLK B;  1HNV B;  1B0P A;  1N88 A;  3MM8 A;  2CRL A;  1RT6 B;  1U25 A;  2DNP A;  2CQI A;  4UOC A;  1N0U A;  1NLK L;  4DR6 F;  4RW4 A;  1U49 A;  2C2K B;  3M8P A;  3HHK A;  4GVL A;  1CJK A;  1FNX H;  2KKH A;  2WK4 A;  1S12 A;  3JAM U;  1FDA A;  4M94 A;  1YJ7 A;  4P6Q A;  1S1U B;  3H8Y A;  2JFD A;  2WTF A;  2OD4 A;  1U2C A;  1RE1 B;  3JTO A;  2DY1 A;  2XMT A;  3GII A;  2W01 A;  1VOM A;  2VPY B;  1YBU A;  3NRB A;  1HLW A;  2QGF B;  3CCV S;  2I5J A;  3OL7 A;  3Q23 A;  4F3M A;  4BC9 A;  5HQM A;  4OQJ A;  1YLX A;  5KT5 A;  2HHH F;  1RB0 A;  5KG6 A;  2JH3 A;  2HHS A;  2M2B A;  5K14 B;  5IT0 A;  3CJ8 A;  3OTD A;  1DTT A;  2OLW A;  2VDH A;  5DG8 A;  2OEM A;  3IR5 B;  3RRG A;  1OMS A;  1U2F A;  3HK2 A;  2XI2 A;  2ZDP A;  4JI3 J;  1RWM B;  4U96 A;  3KLH A;  2MKS A;  1T95 A;  2RDD A;  4B3R F;  3OHB A;  2C3Y A;  4P2M A;  4HKQ A;  4DPO A;  2Y3Y A;  3D4J A;  2YH1 A;  2BAB A;  3JTN A;  2OSQ A;  3DKD A;  3MR7 A;  4ZK7 M;  4DUZ F;  3PG9 A;  5KFT A;  2VA3 A;  4ZLN A;  2EFP A;  3M8S A;  1WF1 A;  1XN9 A;  4Y00 A;  2MKJ A;  3TJ9 A;  2FHM A;  2GGP A;  1TKX B;  1SKS A;  2VJU A;  1FK9 A;  3U7J A;  4MH8 A;  2K06 A;  4RKU C;  3BF4 A;  1KEK A;  1Z2L A;  4LMZ A;  2N82 B;  4LF7 F;  4TQS A;  3M32 B;  2MSS A;  1PJ7 A;  4GKJ J;  2JL9 A;  1IR0 A;  1M5O C;  4DR4 F;  1D09 B;  5B0F A;  4JI2 F;  3MTK A;  3DOL B;  4ES3 A;  1R3N A;  4MKB A;  4ICL B;  4ZHR B;  2NR0 A;  3Q8P B;  3IRW P;  3DLG B;  3GSI A;  2R4F A;  1S7H A;  2CPZ A;  4ECQ A;  3PW0 A;  3NS6 A;  4OIX A;  3D1O A;  3G6X A;  2OPS B;  3NCP A;  2YBV A;  1LW2 A;  3KJV B;  5T7L A;  4AYB D;  4F67 A;  3TYT A;  2AGP A;  1NB2 A;  4V19 X;  1GNK A;  3DDK A;  4L76 A;  3UDL A;  4B08 A;  3AJ2 A;  1H2U X;  2YXL A;  1TUV A;  4YME A;  1WC6 A;  2QIF A;  3ET6 A;  3SSR A;  3KDO A;  3SV3 A;  3WIU A;  3OXL A;  3MM6 A;  3GV7 B;  4UF4 A;  3EZ5 A;  4DX6 A;  4ZS6 A;  4P72 A;  3DRP A;  3JYT A;  3CJK B;  1CSJ A;  2AKW B;  3LGN A;  3K5L A;  4IOC Q;  3KJN B;  4OLP A;  5KOX A;  3VAM A;  3OLA A;  3BSA A;  1N56 A;  1FRJ A;  1N8R T;  1VLO A;  3OPK A;  3UN3 A;  5I4M A;  1RTI A;  4W90 B;  5A8R B;  4FP9 A;  4YEA A;  3NMR A;  1C1B B;  4ZVQ B;  3JS9 A;  4J9P A;  2ZKU A;  2RML A;  3C19 A;  1VHF A;  3MCM A;  2I0X A;  5E3P A;  4EEY A;  3LO3 A;  2MGZ A;  2A10 A;  4DV0 F;  2VUG A;  3DC2 A;  5HJX A;  2HND A;  2ZVI A;  1HBO B;  2J9D A;  4JI0 J;  1NSA A;  2VA2 A;  2U2F A;  1NPR A;  4PG6 A;  4M5D B;  4CO5 A;  3CCE S;  3CD0 A;  3IRX A;  2F4V F;  3T9Z A;  4PQU A;  3GJR B;  2H65 B;  3I82 A;  5DZ7 A;  2C2R A;  5KFP A;  1L3T A;  2FJV A;  4KFB B;  5CD4 H;  2ZVS A;  4PWU A;  1S7I A;  2XM3 A;  4CTA B;  1RTH B;  2DNY A;  4QW9 A;  2M88 A;  3A8J A;  1RT4 A;  2EK1 A;  3V6H A;  2NXC A;  3QPI A;  2OJ3 A;  4RW8 A;  1AW0 A;  3R5G A;  4DX5 A;  3I4H X;  3M8Q B;  5AJ3 J;  2P6T A;  4UY8 5;  4OZJ A;  4RL1 A;  3R1L A;  3CTR A;  2ZHO A;  3GWC A;  3FMB A;  1JX4 A;  2V8H A;  4IO1 A;  1U09 A;  4ANC A;  3DMJ A;  4I69 A;  2B9W A;  2ZZT A;  3ZZP A;  4LBH A;  1Q86 T;  1KOH A;  4IG3 B;  3VVU A;  5ETP A;  1SL2 A;  1Q7Y T;  1G1X A;  2CWX A;  1JLA A;  2XI3 A;  1IBC B;  2GVD A;  4DFK A;  1QUV A;  1H2V Z;  3CJ4 A;  2CJ9 A;  2DIT A;  4Y2I A;  1LKZ A;  5KFL A;  4IOA Q;  3QT6 A;  5DDQ C;  1HL6 A;  1Y10 A;  3S8S A;  3M30 A;  2E9R X;  4LFB F;  4DHV A;  4PXC A;  5E0O A;  4D3G A;  3HHL B;  2JLE A;  2QSF A;  4R25 A;  4DR1 F;  5C7P A;  5ETV A;  2LKZ A;  1NAQ A;  5KT3 A;  2IRY A;  1FFS B;  5EWE A;  4G65 A;  2IMW P;  3PFE A;  3VQT A;  1KWM A;  3GTY X;  1YJT A;  5GMD A;  2XTJ P;  4J9S A;  1LNQ A;  2IBO A;  1T9V A;  1UCN A;  3UN5 A;  1FJ7 A;  4MTP A;  1YTY A;  5HO4 A;  1XQI A;  1UEV A;  3NKY A;  2XEX A;  2MKI A;  1S97 A;  2UP1 A;  3FJ2 A;  2QE5 A;  1ZAW A;  2ACM A;  4K2J A;  4YR3 A;  1CJV B;  2BE9 B;  2HSE B;  1PIE A;  1V6H A;  2HRU A;  5KFQ A;  4MKV A;  1FXR A;  5HMW A;  3ENQ A;  4RBU A;  1S4E A;  2E5L F;  2FJX A;  3KMS A;  1IM6 A;  2V4J B;  1Q16 B;  2P9E A;  2F8M A;  3SSQ A;  2LEB A;  1HW9 A;  4IRC A;  4NE9 C;  2H4Y B;  3MPY A;  4QIW D;  1I6J A;  4OYB A;  3KLI A;  3FEZ A;  4Q2L A;  1X5S A;  3D28 A;  2NYI A;  3OUY B;  4OHW A;  1GMU A;  4F0K A;  3DI6 A;  1YVF A;  2BX6 A;  4AL7 A;  3P6Y C;  3SCL E;  3GPA A;  1FVS A;  1JXL A;  3D0G E;  3KWM A;  4PYA A;  3MM8 B;  3J81 Y;  1RHJ B;  3G71 S;  4NLU A;  2M8H A;  4ALZ A;  3NOG A;  2RRB A;  4MIA A;  1KC8 T;  2CAD A;  3FBF A;  3AJD A;  1OO0 B;  3HSZ A;  3ZTS A;  1M1K T;  1CJK B;  2Y8Y A;  4KV8 A;  1X4H A;  4WFA Q;  4TU7 A;  2H4W B;  2HHQ A;  1JKH B;  2Z2Y B;  5DJB A;  1J27 A;  4EO6 A;  2DNK A;  4U6P A;  5HQ8 A;  2QX0 A;  2I5J B;  5LJ3 Y;  5LMN F;  2JX2 A;  3I6P A;  3QAU A;  4N76 A;  3AQP A;  4OX8 A;  1TUW A;  2CDQ A;  1SL1 A;  4B3T J;  5CZV A;  1U1Q A;  3FBC A;  2DB1 A;  2B7C B;  5CYM B;  1DTT B;  4DL5 A;  4MKY A;  3EIC A;  2JSX A;  1HBM A;  4F25 A;  1KTV A;  4CH0 S;  4EWT A;  3C14 B;  2RQK A;  2D74 B;  2DH9 A;  1SKW A;  1PYT A;  1K44 A;  1GK8 A;  5GAD I;  4DCP B;  3KLH B;  3CSK A;  3RB0 A;  4DS4 A;  5DET A;  2VC1 A;  2EFN A;  1RHK B;  2HHP A;  1MML A;  1EQ0 A;  2IPO B;  2YNG A;  3U1L A;  2HBQ B;  2QL7 B;  2OP5 A;  1Z1Z A;  2DH7 A;  1FNO A;  1QY7 A;  2LP4 A;  2LDI A;  4N8O A;  1JXE A;  1M0S A;  4OLO A;  1S1V A;  3KJQ B;  1B70 B;  2JLG A;  5CXT A;  5JMN A;  2RS8 A;  3QJL A;  1W2B R;  3UVJ B;  3PX4 A;  2ZWO A;  1UVJ A;  1N5V A;  4R0J A;  1TL7 B;  4OJH A;  3IBW A;  1FK9 B;  4TYA A;  1GEH A;  3ISZ A;  4ECZ A;  5IS2 A;  2BJD A;  1FE0 A;  4I67 A;  5THW A;  4J91 A;  4HR2 A;  1Y3K A;  2C22 A;  2VL1 A;  3FEY B;  3GFY A;  4OYW A;  5IT9 U;  2YNF B;  2YVS A;  2XS5 A;  3BBF A;  2IMO A;  1ZBT A;  2VFR A;  1NEE A;  1ZTT A;  1CG2 A;  1BE4 A;  2RUG A;  3I5A A;  2XYP B;  3RBZ A;  3KG1 A;  3UCZ P;  3OLB A;  3TJA A;  3QGH A;  2ZC4 A;  2NSB A;  4OYM A;  3SCK E;  2A6M A;  4MJK A;  1CS4 A;  3R1H A;  4LFC F;  2ZHA A;  4JI7 F;  4O3P A;  3P3D A;  3TEG A;  3TEH B;  3DLL Q;  1LW2 B;  5T7L B;  1S0N A;  2J8S A;  2YX1 A;  3PW2 A;  2MJN A;  2E1M C;  4KBI A;  4KGX B;  1H38 A;  3M05 A;  4NL5 A;  4YP3 A;  3H7H B;  4WXW A;  3ET6 B;  1F60 B;  4Y2K A;  2V2K A;  3ETO A;  1BY9 A;  3MM6 B;  3RTV A;  2QA4 S;  3DHW C;  3NLC A;  4C8L A;  4DWI A;  4EZ6 A;  3TQE A;  3DRP B;  2QJ3 A;  3UN2 A;  4Y28 C;  2CJX B;  1XJW B;  2QYG A;  5B09 A;  2UXC J;  1EX8 A;  1LK7 A;  4ZVR B;  3VR1 A;  5A2Q U;  2V67 A;  5HLF B;  4KJI A;  3MD3 A;  3TVZ A;  3NGS A;  1TV6 A;  4Q43 A;  4K0K F;  3C46 A;  1XR6 A;  2HZC A;  2Y1J A;  2E1C A;  2V68 A;  2LEA A;  1KQS R;  3BKF A;  3UD5 A;  2MXY A;  2HBR B;  4IOB A;  2FJW A;  4HHH A;  2EPI A;  3LAN A;  3HKW A;  3D6M B;  2ZC3 A;  1WKJ A;  4LF5 F;  3RGI A;  1ZYQ A;  3VAL A;  4WP9 A;  2H48 B;  5KFE A;  3L3C A;  4RUB A;  3HCX A;  5GAH U;  5HP1 A;  1GMW D;  2NYH A;  4IH6 A;  1RBO B;  2MGZ B;  2HS4 A;  5D6G A;  1WC5 A;  3RAM A;  3WX4 A;  5JVG Q;  2ZE2 A;  3HM9 A;  1FTC A;  4UOF A;  2HND B;  3O2I A;  1KQG B;  2BRK A;  2FJD B;  1HMV A;  4RNM A;  1EQM A;  4K4U A;  4M5J A;  1QE1 B;  2CKW A;  4UQG A;  1CBK A;  2ZKT A;  4LVO P;  3FDS A;  1DAX A;  1ZS6 A;  4CO1 A;  1S1T A;  2J7W A;  3I9Z A;  4R8U A;  3IRX B;  3Q83 A;  4PQU B;  2UV8 A;  1QJH A;  2GIQ A;  1FT8 A;  4RWW A;  2XBP A;  2Y1R I;  2FLO A;  2QG9 B;  3VGS A;  4I6Y A;  2XSF A;  2KT5 A;  1RT4 B;  3T1A A;  4JYA F;  1VFJ A;  1VQY A;  4RW8 B;  4QOT A;  1HWK A;  3A12 A;  2MY7 A;  2HFO A;  3ZXW A;  1GXU A;  3R3T A;  3H40 A;  3ILO A;  2YH0 A;  4C4W A;  1XER A;  3IWX A;  2WZ1 A;  1S4F A;  2QYC A;  1R8H A;  1HHQ A;  1VR6 A;  2WVB A;  2H5J B;  3DMJ B;  1Q4R A;  2IVM A;  3AD8 C;  4QZV B;  2N7Y A;  1BWE A;  3Q0A A;  1AFI A;  2Z2Z A;  2WVF A;  1JLA B;  2GVD B;  3GFH A;  4F2R A;  3MMA A;  3W5Y A;  5A76 A;  3EE3 A;  2IA6 A;  3LWM A;  2VFT A;  4FBU A;  4CI0 B;  5CD4 A;  3M30 B;  2DR8 A;  1LFP A;  4XK8 C;  1I51 B;  4OZ1 A;  1VC6 A;  1XEZ A;  2XYH B;  4Y65 A;  3QIP A;  3M6V A;  3RRK A;  1OYD A;  1ZM2 A;  3IM9 A;  4JI8 J;  1RWO B;  2ASL A;  3SYZ A;  3BQ0 A;  3BQ2 A;  3IR6 B;  1O6X A;  1KOO A;  2VBZ A;  1GT8 A;  1U1K A;  5L1J A;  4FYD A;  3PTW A;  1F9F A;  2R2S A;  2UXD J;  4NLV A;  1DLO A;  2ADC A;  1P9Y A;  3KHR A;  3RYL A;  4GKK J;  3P49 B;  1VQN S;  3I31 A;  3TZZ A;  3BYP A;  4ID5 A;  2VOO A;  1RT7 B;  2HGL A;  2HRT A;  3BGF A;  2MQL A;  5GAG U;  2AU0 A;  3GCX P;  3RR8 A;  3IG1 A;  5AE1 A;  3T1Y J;  3MUT P;  5EUH A;  2BKN A;  3PIP Q;  1HR0 F;  3A13 A;  2CPJ A;  1CLF A;  1NDK A;  3SSS A;  4A8W A;  1TEL A;  2B0G A;  1NJW A;  1TL1 A;  4K4Y A;  4DX8 H;  4R5P A;  3ILJ A;  1TL5 A;  2F7V A;  4KC5 A;  4P7V A;  4DPY A;  4TU9 A;  3R27 A;  2VB6 A;  3IA0 A;  3MEC A;  3EVO A;  3R2C J;  5E33 A;  4RWX A;  3DI6 B;  2FC9 A;  3Q22 A;  2XO7 A;  4N7T A;  1N32 J;  2A18 A;  1JLB A;  3BJY A;  3KTQ A;  4RBT A;  2XY5 A;  4XPC A;  3D9B A;  2KXH A;  1UVN A;  3ZO7 A;  3TZW A;  3M4X A;  2QZ8 A;  4WKY A;  1WDD A;  1GXT A;  4LSL A;  4ECU A;  1U47 A;  4U8Y A;  3TO8 A;  2PSZ A;  4OYX A;  4KV8 B;  1VQO S;  3LP1 A;  2ALZ A;  1BGX T;  3A8E A;  3JAM Y;  4LBP A;  1EP4 A;  3DOK A;  4ZLL A;  1B99 A;  5CAB A;  2AEF A;  3NWR A;  3MI7 X;  4Q45 A;  4F04 B;  4N56 A;  1RAB B;  1RTJ A;  2JEI A;  1FER A;  1E6V A;  2O67 A;  3TUP A;  1H74 A;  4WII A;  1K1S A;  2MZR A;  4KH0 B;  1KON A;  2JOQ A;  1KHW A;  2X51 A;  1EKS A;  3JSY A;  1WUU A;  4MAK A;  1HBM B;  1QTN B;  3MM7 A;  2CIM A;  3MCO A;  3PNI A;  2WVC A;  2HNY B;  2HBZ B;  5GMK a;  3HJV A;  4PG8 A;  3H25 A;  3GCW P;  3MCN A;  3Q8Q B; 
#chains in the Genus database with same CATH homology
 3GP9 A;  1PAE X;  4F36 A;  1NHK L;  2BX6 A;  3EVW A;  2AZ1 A;  2DXD A;  3NGT A;  1NSP A;  3VVT A;  1WKJ A;  3GPA A;  3L7U A;  1BUX A;  3FBB A;  2NCK L;  1S5Z A;  3DDI A;  1HHQ A;  4W98 A;  4KPC A;  4WBF A;  3ZTR A;  2CWK A;  3BH7 B;  3JS9 A;  1NSK L;  4ENO A;  2BEF A;  3WX8 A;  3FBE A;  1NSQ A;  1WKL A;  1NDL A;  3Q89 A;  2DXE A;  3EJM A;  1UCN A;  4ANC A;  3ZTQ A;  4ANE A;  1MN7 A;  3FBF A;  4UOF A;  3VGU A;  1NPK A;  2DYA A;  3DKD A;  3ZTS A;  1XIQ A;  1NLK L;  3B6B A;  4EK2 A;  3VVU A;  3ELH A;  1NB2 A;  1F6T A;  1XQI A;  2B8P A;  1VYA A;  1B99 A;  3EE3 A;  5CAB A;  1EHW A;  1S59 A;  4O0N A;  2HUR A;  3ZTP A;  3EM1 A;  4S0M A;  1JXV A;  5CAA A;  3PRV A;  1BHN A;  2AZ3 A;  1NDK A;  1LWX A;  1ZS6 A;  3BH6 B;  1HIY A;  1NUE A;  2ZUA A;  3FKB A;  5IOL A;  3BBB A;  3BBC A;  3G2X A;  2HVE A;  3VGT A;  1PKU A;  4UOH A;  2VU5 A;  4HR2 A;  3Q8Y A;  3Q86 A;  4C6A A;  3FCV A;  3VGV A;  3Q83 A;  3EMT A;  3NGU A;  3Q8U A;  2B8Q A;  1NCL A;  3ENA A;  3BBF A;  2DXF A;  3B54 A;  1MN9 A;  4CP5 A;  3MPD A;  1B4S A;  3VGS A;  4DZ6 A;  1HLW A;  1BE4 A;  4AND A;  1KDN A;  1WKK A;  1NDP A;  3EVO A;  3Q8V A;  3FBC A;  3R9L A;  3NGS A;  2HVD A;  4F4A A;  4FKY A;  3EVM A;  1F3F A;  4FKX A;  4DUT A;  1S57 A;  2DY9 A;  3EIC A;  1NDC A;  5C7P A;  3ZTO A;  3ETM A;  3PJ9 A;  3FC9 A;  5BXI A;  4DI6 A;  3FCW A;  4UOG A;  1W7W A;  3NGR A;  1U8W A;  1LEO A;  1K44 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...