1BE4A

Nucleoside diphosphate kinase isoform b from bovine retina
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
151
structure length
151
Chain Sequence
b'ANSERTFIAIKPDGVQRGLMGEIIKRFEQKGFRLVAMKFMRASEDLLKEHYIDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIALWFRPEELVNYKSCAQNWIYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE DIPHOSPHATE TRANSFERASE
publication title Nucleoside diphosphate kinase from bovine retina: purification, subcellular localization, molecular cloning, and three-dimensional structure.
pubmed doi rcsb
source organism Bos taurus
molecule tags Phosphotransferase
total genus 45
structure length 151
sequence length 151
chains with identical sequence B, C
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1998-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1be4A00
1UCNA 3Q89A 1NSQA 3EVOA 5IOLA 3FKBA 1U8WA 1PAEX 4HR2A 3EVWA 3DKDA 1XQIA 3ELHA 1KDNA 1W7WA 1NCLA 3FCWA 3Q86A 2HVDA 4ANDA 1NDCA 4UOGA 1NSPA 4UOFA 5CAAA 1JXVA 1NDPA 4EK2A 1MN9A 4W98A 3Q8UA 1HIYA 1ZS6A 2DYAA 1NLKL 2AZ3A 3EJMA 3EE3A 5CABA 2DXFA 3GPAA 1WKKA 4S0MA 2DY9A 3VVTA 3VGTA 1MN7A 3VGSA 2B8QA 4ANCA 3JS9A 3ZTOA 2BX6A 1WKJA 3R9LA 3Q83A 3Q8YA 3EICA 3GP9A 3NGUA 1VYAA 2AZ1A 3FC9A 3Q8VA 3FCVA 1LWXA 1B99A 3ENAA 4ANEA 3NGRA 3FBBA 1B4SA 3EM1A 3VGUA 3ZTPA 1WKLA 4CP5A 2B8PA 3WX8A 1NHKL 3BH7B 4FKYA 2NCKL 4C6AA 1BHNA 2ZUAA 3PJ9A 1S59A 3L7UA 3NGSA 3EMTA 3FBEA 1HHQA 3BH6B 3G2XA 3VGVA 5C7PA 2HVEA 3ZTQA 3PRVA 2DXEA 1NDKA 1F6TA 4F36A 1NUEA 4KPCA 3VVUA 4DUTA 3NGTA 1EHWA 3BBCA 3DDIA 3ETMA 4WBFA 4DI6A 2BEFA 3BBFA 3FBFA 2DXDA 1S57A 1LEOA 1XIQA 1NB2A 3MPDA 1K44A 4UOHA 1BE4A 2CWKA 1S5ZA 1NSKL 5BXIA 4O0NA 1NDLA 2VU5A 3ZTRA 3B6BA 4F4AA 4DZ6A 1NPKA 1HLWA 3FBCA 1BUXA 3B54A 4ENOA 4FKXA 3ZTSA 1PKUA 3EVMA 1F3FA 2HURA 3BBBA
chains in the Genus database with same CATH superfamily
5FLXY 3QRRA 3LQVA 1QLNA 1VFJA 2E7WA 3CCTA 4QIGA 5A8WA 3TUZC 2H5JB 3RB3A 3MAAB 1BD6A 3UD3P 1YJ9S 4JI1F 4DPXA 3TZXA 3OL9A 1ROFA 2J9DA 2DIUA 1YLXA 3CUNA 3AAWB 4IFVB 2YNHA 1SQGA 2DH9A 4MFBB 2UU9F 2O67A 4CH1A 4KIAA 2BW7A 4CWBA 1N5TA 3CO0P 5HP1A 3E3XA 3EGVA 4K0KJ 5B0FA 3CB4A 1H3DA 2EFVA 1WHWA 3TQ1A 4J90A 3PX0A 1YIJS 3MPVA 5BXIA 4OLOA 1RAEB 2NLWA 3K8WA 5ETTA 3U7JA 2NREA 3CD6S 1IKYB 1M5OC 1KHWA 4WIQA 4OQJA 2COLA 4RNOA 4K4ZA 3IWXA 1Q4RA 1WHXA 4UOGA 1TZ0A 4PZVA 4MYUA 1LV5A 1TR0A 4O3SA 4PQUB 5KFYA 2RQKA 3M05A 1HPZA 3MUMP 5E3CA 4O44A 4RBTA 1WELA 4DF8A 2HAIA 4KV8A 4DR3J 4X84A 4LFAJ 2VKRA 1CEZA 2D69A 1TUGB 3WZ0A 2PDAA 3AA8A 4LBHA 2OPPA 1JNZB 5EWGA 4MMOA 2ATLA 4PPZA 1Q86T 2EFQA 1RZMA 3R97A 2G0IA 2ZUAA 3QMQA 3RUBL 2H1YA 2CPJA 3W63A 1NSAA 4H4OA 2KDOA 4DV6F 2EXUA 2FC9A 2EFNA 1WC6A 2OD4A 2C2MB 4JYAF 3PY8A 5AXNA 1P9QC 4F3OA 2V8VA 2CWKA 1FF2A 2JJ4D 2AX1A 1J5EF 3PHTA 1QTNB 2LXIA 1KRPA 3QFHA 3TJ9A 3ZO7A 2ZHOA 2R9LA 4KFBB 2FVRA 3DOKB 3ELHA 4IDKA 4M8LA 5CYQB 5BR8J 1TV6A 3QZ8A 1HNXF 3LGMA 1FJCA 4QPTA 1JXLA 1RAOA 4NX9A 1SH2A 4GVBB 1SJ3P 1SKSA 2OPRB 4DL2A 2Z57B 3MTKA 2BXJA 4F8RA 2ZE2A 2B56A 1R8CA 3FFIB 1RLDA 3CD7A 3GP9A 4GKKJ 4C8MA 1RTDB 2BQUA 2AU0A 1RU1A 3OL7A 4ANEA 3UWTA 1KC8T 1S7IA 2MZRA 4OJ3A 5EWFA 1VK3A 5LMNJ 5MLCV 4KB7A 1UPMB 2OSRA 1FI4A 1HBOB 2RE1A 5KG3A 2HQCA 4LR8A 4YS2A 3QO9A 1FNOA 3T3FA 4LMZA 4X4OA 2M88A 4OX7A 4F4YA 2OSQA 1QY7A 3GFXA 4RNMA 1R0CB 2AEJA 4LIWA 4G6VB 4I69A 4N56A 5AXKA 5LSLA 1HBMB 5DG9A 1Q8IA 4NLYA 3ZZZA 1Q7LB 1JLFA 4ZVEA 3GCXP 3DC2A 2ADCA 2W4PA 1S1VB 1RISA 2VQFJ 1DY3A 4O3RA 2HNYB 4J9LA 3O6QA 3PKYA 3HVWA 1NLKL 2GGPB 2VG6A 5ETPA 3TZWA 2MZ1A 1KS2A 4HACA 4EU0A 2ZBRA 1GTHA 2V69A 1SKRA 2F5GA 4JI7J 4NRUA 1UZDA 1XTZA 3KLIB 5DLFA 1X5SA 2BM1A 4CT8A 3TW0A 3ZTPA 2B8PA 5J1EA 1VRQC 1RTIB 3H4BA 3UCUP 4DV1J 4YOEA 1FERA 4L3NA 3AD8C 3T5KA 3ZXWA 3TO8A 2DNPA 2QA2A 1NK7A 2EW9A 1H38A 4QZVB 4OX9J 1N88A 4KT0C 5HBMB 3MR6A 4B3TJ 2PMZD 3B6BA 2UXBF 5J2NB 1CJUB 5FDLA 2QN6B 2ZM6J 4HYKA 3OV7A 3AD7C 2BE9B 2UVWA 3QT5A 1CULA 4DL3A 3D68A 1X4AA 5KG1A 1RT5B 4JI6J 4MH8A 4ZJOA 1KOHA 4NLQA 4QQBA 3P6YC 2HLUA 2AZ3A 3M30B 3MMAB 1E6VB 2ZOGA 2C3YA 4DV4J 5IM0A 1EKSA 3GYGA 1WKJA 1HA1A 2JZ5A 2PEBA 2G2ZA 4TQRA 4NYPA 1W26A 3V4IB 1TL1B 2XM3A 5IXUA 3DDKA 2I38A 4B9NA 2XMKA 1EX8A 2CPIA 4EYHB 2VG5A 2D3O1 5C7PA 3U1MA 1LQ9A 3M8PB 1GMWA 5HMYA 3RBDA 2LMIA 5CH7B 3FSXA 4A8YA 1RA6A 2OH2A 5ETRA 3NOGA 3E01B 3MPDA 3QAEA 2Z2ZA 3J7AN 2AP6A 3DLEA 2B9WA 4EZ6A 4NCBA 1I3OB 2XZDB 1SV5A 1YZ6A 3W2WB 2LA4A 4ZHRB 3NKYA 1FK9B 2CAJA 2DNMA 1ZM3A 1K47A 3N9UC 2IC3A 2VFVA 2RQCA 2K2PA 2GQ2A 2FIUA 4M5NA 1FX4A 3FRYA 2MGZB 5JUMA 1R3NA 1NK9A 1S77D 4FPRA 2OTLS 2R8GA 4RUAA 3SFGA 4X62J 3LW5C 1G1XA 1HI0P 2RU9A 4ELTA 1UFKA 1ZETA 3OTOF 3W7BA 3FCVA 1SH0A 1NKCA 3CCMS 3C15B 2ATCB 4USHA 1VK8A 4ILRA 4TN2A 1GMWD 1HNZJ 3C14A 2ZFHA 3BGRB 2RHSB 3ZZOA 3M2VB 5L1IA 2XI3A 4QWEA 4DPTA 4KPCA 4CLWA 4FYYB 4AL7A 1MROB 1JJ2R 3QLHA 5F3TA 5IT0A 3DGPA 3TX0A 4GKJJ 1P8GA 1REVB 3FUYA 2R42A 4RR5A 2KTQA 1EJ7L 1MU2A 1TMMA 3NG8A 3KG4A 2GIFA 4YB7A 3CE8A 1O0PA 2OMOA 1OQ3A 1NU4A 1YK9A 4ANDA 3L4BC 2Q79A 1BQMB 3MXHP 5DRKA 4JI5F 4DX5A 3KYLA 2YVSA 1T05B 1V3RA 1M5SA 1TK8A 1U7LA 4UZCA 4WE1A 3VVTA 1PSDA 1N52B 5I3PA 1RCOB 2MDAA 3IWLA 1S9GA 2G9OA 1JK9B 3CJKB 4RNFA 4CP5A 3LWLA 4R8UB 4C6AA 2XWXA 1WG4A 1JLEA 5K8OA 1GT8A 2MQNA 3PRVA 4KGKA 5HANA 5I3UB 5EWEA 2U2FA 5LSOA 4NI2A 1I94F 2FJBB 1FO1A 4XDCA 2DGVA 3JSMA 5F0UA 5B08A 1VQ4S 2YPYA 5A0YA 2C2DA 1Q8LA 2JLEA 2KHDA 4I64A 2W4DA 3OR2A 5AT1B 1DQAA 3QIPB 3SCKE 4C8OA 1LXJA 1Y11A 3DMJB 3RYLA 2DNOA 3IBFB 4DWIA 3UD5A 5C42A 1RWMB 3VAJA 4K59A 5D0RA 2XC9A 1GEHA 4YDDB 2C3PA 3SQGA 1XN9A 2Q6BA 5SZTA 1ULRA 4AQYJ 2B4PA 5L9NA 3JXOA 1YJUA 3JYTB 3N6LA 1VIXA 1PBUA 4CYUB 1T3NA 1K0VA 4PABA 2CQHA 3HMJG 1RWVB 2AMCB 3PR4A 5B7WA 1RT7B 2FGOA 4Y00A 1VHIA 4F2SA 3WX8A 4CLLA 4U8VA 4Y2KA 1HNIA 1HQUA 2GS8A 2AIRB 4FNHA 4ED0A 4ZJQA 3UNYA 2QV6A 1U49A 4ZJLA 4ETXA 2AJQA 2WB4A 2HK2A 4OJHA 1JLAB 3I32A 1HYSA 4LF9F 4PQAA 2UXDJ 2YX7A 4Q2MA 4Y2CA 4CNZA 3MCMA 2JEJA 1NRKA 4ED3A 1KONA 1RT1A 1SCJB 1YITS 2WAQD 2ZITA 4NA2A 2AJ4A 2K3KA 3DRXA 3SSSA 1KHVA 4TU8A 3IWNC 4IG0A 3WC0A 3FNNA 1SPBP 2NS1B 4CIOA 3JAMU 3M9MB 2FD2A 1TFWA 1IQZA 2G2YA 3LPEA 3SMZA 2MZQA 3AQOA 3NGUA 2XCAA 2FYXA 4BS2A 4DBQA 1LWEB 2KH9A 2HVZA 2ZBQA 2DNZA 2CQDA 1DQ8A 2HG4A 3HKWA 1A0OB 4OYWA 2C2EA 4IR9A 1IJFB 3V6DB 3LALA 1KVJA 2CQPA 3R5GA 4PUOA 1Z1ZA 2YY3A 5A8RB 2AEFA 4HT7A 3DCAA 1QAJA 1JIHA 5GADU 3EVMA 1IBLJ 1Y5NB 2K06A 2KFNA 2QX0A 1MMNA 2RSQA 1UTAA 3D3CJ 2NZ4A 3IG1A 2IRYA 4U9RA 5CABA 3O1LA 2CPYA 3UR3C 1UJ4A 4USJC 1HD1A 4FF1A 2CPHA 4RUCA 2OEJA 2BANB 5KFRA 4RZRA 4CI0B 4DR2J 4RW9A 1U47A 2IAJA 3K89A 4NLGA 1VGYA 1YI2S 1ZM9A 3NCRA 2P6TA 2LEBA 1SC1B 2YNGA 3JSRA 2XLIA 4UQGA 2MY7A 4R0EA 3PYGA 3G8TA 1EB0A 5IQQA 4UUXA 2R3VA 2UUTA 4B08A 1IM4A 2KXFA 1T8EA 2HBQB 3KLEB 3QJPA 5AXLA 2DHHA 1T03A 4C7QA 3GR1A 1ZA2B 1NO8A 1Q0NA 1FRJA 1M5HA 4O0IA 4ICLB 2XNRA 4WFYA 1IKXA 2CFXA 5CYJA 2DITA 1ZM4A 3I82A 3SFUA 4DQIA 1T0TV 1NJWA 4B3RJ 2RD5C 2BQ3A 1EP4A 1LWFA 5KFQA 4E0DA 2V4JB 3DRRA 3LANA 2G0CA 1I1GA 1S0MA 4BLGA 5B0CA 2DPIA 3R2CJ 2Q3PA 3OT9A 1S1TA 5K8NA 1S6OA 1CJVB 1HI8A 1KLMA 2VDIA 3E8OA 4L74A 3LH2S 4LF5F 2KHCA 4N77A 2B9YA 3V6HA 1X9MA 4CH7A 1Q53A 3KKFA 3FBBA 4DV7F 2MSTA 1XMOJ 3DGVA 1LW2B 1S49A 4GKKF 3HHEA 2ZZTA 1V5VA 3KK1B 3MM5A 1EHWA 5GMEA 4IH6A 2FHMA 3DHXA 3VF0B 4TYAA 3PHEA 1S5ZA 1RABB 1KBRA 2WONB 3ICLA 3Q24A 3DM2A 4FKXA 4LRCA 2YWKA 3PYEA 1S6PA 3GB0A 5FIIA 4DFMA 4V19J 3W61A 1QJHA 4M1KA 2GCFA 4CNYA 4B3MF 2R2SA 4QR2A 3EGZA 4IG3A 4DV3F 3NGKA 1HWUA 2AJFE 1VQKS 2R7RA 2ILYA 1QAYA 1FA0A 5K8PA 4WXWA 2XO7A 3V6JA 2RDIA 3PYDA 1CJTA 1N34F 4FYDA 2CG8A 1FJGJ 3PV8A 2CPXA 2BDPA 4MKYA 2DNKA 4TYBA 3AB2B 3VAKA 2CJXB 4QBUA 5A6PA 2IHR1 5E2QA 4Y2MA 2CQ0A 4DFJA 4EZ9A 1JLGB 4NZ6A 3SV4A 3MM6B 2Y1JA 3MECB 2J6SA 2UUWA 5T41A 5ETQA 3MEEB 2GVZA 2XSFA 5K8MA 2DHGA 1PC5A 3CJ3A 4DI6A 2L41A 3KUEA 1XIQA 1BWVA 4TY8B 1R89A 1NKEA 4OHXA 5LXYA 1NPRA 3BGLA 3G9CA 3D28A 1O5JA 4RU2A 3T6JA 4ZP7A 4F4WA 2DO4A 1NPPA 2FVSA 4C8ZA 5KFBA 4OYIA 2XGPA 2O1PA 4GMKA 4CT9A 2KYXA 3HHLB 1X5OA 3CJRA 2X1FA 3BSOA 3ISNC 3MAAA 2FY8A 1V5IB 3U27A 3IXQA 1FESA 1ZPVA 1MMLA 3QT8A 1KLNA 4MYTA 4IFVA 3QWPA 1PJ7A 3LA0A 4MFBA 1NM2A 1N32F 3HFKA 5JVHQ 2CXEA 4LSLB 4EBCA 2XY6A 2QGFB 1LK7A 1F6TA 2IM1A 4LF6F 4PPDA 3D54A 4RWWA 4DR6J 3SYZA 1DZ5A 4DCJB 2DJWA 2NR0A 2VH7A 1YBAA 2ACMA 1KQGB 1FD8A 1RT2B 3P8BB 3DRSB 4R0JA 3W62A 4P2SA 3KDNA 1EQ0A 3HSDA 3Q89A 2D3OR 3R6GB 5A8KB 1IKYA 1XQIA 1MWZA 2XMTA 5DG7A 2YQ0A 3S6EA 3G96A 1TAUA 3UN3A 3KLFB 4ZVUB 5KFZA 2ZH4A 1X9SA 2BX6A 2GIRA 4PQUA 2A2CA 2K8GA 2XI2A 3GE9A 3HSGA 3T9NA 4C97A 1VQSA 3BN4A 3G6YA 4Z37A 2HYIB 1UVMA 4F3MA 1RWKB 4Q8EA 1WG1A 3Q2SC 3W8GA 3QRPA 3H5XA 2VQEF 4KGXB 2R8KA 1RTHB 4BBYA 2FVCA 4URSA 2YWEA 1PC4A 2BEFA 4C8KA 3GCWP 5DO2A 1JB0C 4RNHA 2XS5A 3OTCA 4DL6A 5CXTA 1JLBB 1HLWA 3FBCA 2JH3A 3OSNA 4FBTA 1TK0A 3J7ZT 3R5BA 2W2NP 4BWMA 4DL5A 2V34A 1OMSA 2AV5A 2N7CA 3UD4P 4KFBA 3DOKA 1RK8A 3MI7X 4YP3A 2WVEA 1D09B 2GMJA 2RVJA 4HKQA 3VZIA 4GVBA 4X66J 2YX4A 2V94A 4EGLA 2R8HA 4LFBF 2OPRA 2LU1A 2IYGA 4FYVB 4CRJA 2KZMA 1H0HB 2Z56B 4ZVHA 4EUVA 2AYBA 3KHGA 2CPDA 1RTDA 3MM9B 4WP9A 2CRLA 3G8SA 3EMTA 4NCGA 3DN9A 3OD2A 3U1LA 4W4MA 2RKIB 3A3PB 3TRGA 2QSWA 3VZHA 3RBXA 3SI8A 1HBOA 4RX6A 1M5PC 4C8NA 5IS2A 1KWMA 3UDCA 4OYOA 4K4TA 2C2ZB 5KTQA 3I5AA 2DEJA 5ETLA 3RR8A 1A9NB 4HR2A 5KFUA 1NHVA 1S1XA 1HBMA 5KT4A 2HS0A 1W7WA 4FP9A 3K58A 3PW0A 2E7XA 1A7GE 2VFRA 2G1DA 1U0HB 1UJ5A 1FVQA 4KKOB 1S1VA 2EG2A 2XTJP 4I2PB 3VHQA 1XK8A 2J5AA 2B8QA 3HK2A 3TAQA 3ZZRA 2GGPA 1I51B 2B4UA 5F0WA 1F60B 5I42B 4AQYF 2NYIA 1HR0J 1WG5A 5KG7A 4FF2A 3QNWB 5RUBA 4P52A 3CJ5A 2BRLA 2GA7A 1UWBA 4NLXA 2Q66A 3GSIA 4Q45A 2DH8A 4IH7A 4C11B 1RTIA 1JKHB 2RQMA 2X1GA 3O8WA 4IFYB 5C2GA 5J1NA 2CQGA 4PR6A 2IRUA 1R43A 2VUGA 4QW9A 3UDLA 3K0JA 3HFZB 2Z2MA 1U8SA 2GMHA 1D1UA 2C2NA 5HBMA 2DR6A 2ZWOA 3TUJC 3EZOA 4PWDB 1FKAF 2CA9A 3M6UA 5J2NA 1Y00A 2EFGA 1CJUA 2KT3A 5IV4A 5DETA 3J81j 2LU2A 1VLYA 2HRUA 1U1KA 2NSCA 1RT5A 3PX6A 2DNGA 1FFWB 1IUJA 3OL6A 2DHXA 4M63A 2EFOA 1BY9A 1VC6A 3M30A 3MMAA 4J9RA 1E6VA 2XULA 5LXRA 2ROPA 4YB5A 1FDBA 3LO3A 3QWUA 4U96A 1WDDA 3V4IA 2KL8A 2CJQA 1TL1A 3H25A 2QIFA 3I0SB 2W7AA 3NMAA 3OVAA 1T9UA 4DPOA 1PILA 3P96A 4CO0A 2KFZA 4UOHA 3M8PA 2FHKA 1VBZA 3CMQA 1UA1A 1QE1B 1FEEA 3ILOA 4NZ0A 3HVRA 4NA3A 2VPWB 3E01A 1TKDA 1SIWB 3OXLA 3P49B 2X1BA 5IOLA 4O23A 5KT7A 2XYHB 4F02A 2ZKTA 5IWAF 5U47A 2M9KA 3W2WA 2IIHA 2MKSA 4ZHRA 4N41A 4J9NA 1Y0HA 2ZD1B 1NMEB 3M2UB 1FK9A 4B9MA 2VBZA 2OD6A 2HGLA 3GJTB 2C3MA 4Y6IA 4ZPTR 4URGA 1WC5A 4A8MP 4IRDA 3POTB 1QSYA 3CCSS 2I6WA 4DV2F 2C2RA 1UVNA 4NXMF 2HFOA 2KG1A 3C15A 2C1EB 2ZDOA 1NDKA 3R7NB 1N33F 2BZ2A 3BGRA 2J9CA 1KFDA 1HBNB 3M2VA 2NSBA 2O3DA 4ZVPB 4MK8A 2VG6B 3PW4A 1MROA 1RT3B 2A18A 1XNRJ 3PTWA 4QYZK 1GX6A 1JNRB 3OTDA 3AHPA 3UW1A 2BYCA 3CCJS 3KJVB 2LDIA 1FTRA 2H3EB 4OL8A 1MN9A 1L3VA 4B3RF 2FJAB 3MR3A 1CLFA 3S8SA 3PACA 1BLUA 5J2MB 5FLXU 1BQMA 1W2BR 2IJNA 3IAS9 1T05A 4LF7F 3HCXA 3W66A 5E3RA 4JI2F 2DRDA 2V5HG 1VQ7S 2VODA 2DNNA 3JQJA 3AJDA 3DYAB 4P10A 3SQOP 2XYPB 5HN0A 4WJBA 1CULB 3A1YG 3CJKA 2YKQA 4R8UA 2RF2B 3FBFA 3ULHA 4HDHA 5I3UA 4L75A 2B9EA 4ED8A 3BV8A 3KXDA 2H9ZA 2UU9J 1R0BG 2VFTA 2J6UA 3I4PA 3TJ8A 4IO1A 3BYPA 1HBUB 4DPWA 1T9XA 5AE3A 1SQFA 4DX7A 1VRTB 3TZYA 3DMJA 2QG9B 1R31A 3NP5A 3WIUA 1WF0A 3TNVA 2W24A 2EI5A 4TQSA 4OZ1A 4N7TA 2ZOMA 1VQLS 1S7HA 2ZH2A 2DR5A 2J8SA 4MIWA 3JYTA 5DLGA 1S4FA 1WSVA 3BEGB 5ETSA 1U45A 4Q8FA 2XMMA 2W2PP 3KHLA 3PKMA 1X0FA 1RT7A 1E6YB 4HHHA 2WW8A 3VVUA 4YUDA 2HQIA 1LW0B 4IUFA 3RTVA 2AGQA 3KLGB 4WFZA 5F8MA 2RUGA 1CPZA 2MQLA 1B7YB 2HHPA 4OZNA 2HQ3A 1N56A 4M5MA 1PYTA 4ZMMA 2VHGA 1EETB 3OJSA 2BJ8A 3ISZA 2QLWA 2CQCA 4ZVOB 2I1RA 3SXLA 2LFVA 2ZNZA 5EDWA 4DV6J 3KJFB 4R5PB 4JYAJ 2AEMA 3M8YA 2GHWA 2BM0A 4E98A 2AYGA 4QIEA 3QLHB 3RB6A 4IH5A 4KQZA 5MAOA 3K2YA 2UVUA 1RCXB 1J5EJ 3NWRA 2JEGA 2OO4A 4Y3CA 4YR0A 2KT5A 2QSFA 4NYOA 1DRZA 1YJRA 4TY9A 3ADAC 3N5BA 1OY6A 1LWEA 4P6QA 2FVPA 4F26A 4CO3A 5E3PA 2IBKA 3HPOA 1HNXJ 4M5DB 3H0PA 3R8YA 4C8YA 1J27A 2GAHC 3OLBA 2ZH6A 2QEXS 3ZTRA 1H72C 3IC1A 3C66A 2CJBA 3NGDA 3KK3B 3B78A 1N5VA 4KHRA 2LVWA 2FUG9 1S9GB 1ICEB 2GV1A 1TUVA 3W9HA 3ZZTA 2ZWPA 2WW4A 1RB0A 2YKNB 1VDHA 2CWXA 1U26A 3J80Y 2YXLA 3M32B 2KG0A 3AJ1A 1QSSA 4QU7A 1QVFR 4DL0C 4PAAA 3TA1A 3QATA 4N5SA 1OPIA 4UQTA 5B09A 3IM8A 1OWXA 2MMYA 3HKZD 3UNGC 2HWHA 2JLFA 2AX0A 4YB6A 1N6QB 3RRHA 4RW6B 3I4HX 2NPFA 4EI2A 3B8HA 1ELOA 2VA3A 5G0RB 2HWIA 5C42B 1VQPS 2C2OB 1AA1B 3KDOA 3OUYB 3RAXA 4AD6A 1WOPA 4JV2A 3KLEA 4RWXA 1NDLA 1KTVA 1N36F 1FFSB 3H5UA 3CJTA 5ETKA 5J2PB 5DDRC 4ICLA 1DJ0A 2X3GA 1IXKA 2HIQA 2LQJA 3BO2A 5LM7E 3SIPB 4DUYF 3KMSA 4BWJA 1UAWA 1F5AA 5KG0A 2MKJA 4ZVGA 2W9AA 1C1BB 1CQNA 2XHCA 2V4JA 4CQ1A 4O3QA 1RTJB 3M1VB 2ZNYA 1U1MA 1LK5A 2ZH9A 1QD1A 2UXBJ 3EDRB 4DS5A 2XLJA 2ZUGA 5D3GB 5KFVA 1NHKL 3FQLA 3RAQA 3TUPA 1Q5YA 3GR0A 5ETMA 1V3ZA 1WEZA 5IT9Y 1LW2A 5KFGA 1S57A 2DY1A 2CZ4A 3GILA 3HO1A 1TVRB 3KK1A 2UUCJ 2F1FA 1HWJA 1R8HA 4C3KA 4Z7CA 3QIDA 3D67A 2BE2B 3CJ4A 2WONA 4KRWA 1WHVA 1GTEA 2ZEJA 5EGYA 1CBKA 2ZH7A 4X4VA 4JI0J 1FDDA 2J0WA 2BKOA 1U1LA 2J7WA 1GNKA 2QA4S 4ZN3A 5EN1A 4A8SA 4OJ1A 2E44A 4RLEA 4AL6A 1UFLA 4N47A 5KT3A 1FCAA 1TKZA 2QT7A 3PO4A 1F2GA 4QWDA 2QL5B 2HNDB 2XWYA 2Z2LA 2B6AB 5J2QB 4ZP9A 3L7UA 1RE1B 4CM0A 3EDQB 2RIJA 3NS6A 4MKVA 5ETOA 1JLGA 3MM6A 3N4WA 3ENVA 1VCTA 1YBTA 2IVYA 3MECA 4OYXA 2JFKA 3MEEA 3FJ2A 1KQKA 1WC3A 2N3OA 1M1GA 1U1PA 2HHQA 4DCOB 3I96A 1SL0A 3NMRA 3AT1B 4LRDA 4TY8A 3KNAA 5ETVA 2QMXA 3UN5A 3OTOJ 2JDJA 4PWWA 1S9FA 2V8GA 3NCQA 5T14A 2AT1B 4O3NA 5IC4B 3BR9A 3ILLA 2BBEA 1OS5A 4OV1A 4DR1F 3CC4S 4ECXA 4ZCKA 1N5SA 1N5QA 1KQFB 3RJMB 2HAFA 3TAPA 2R7QA 1KQSR 3HHLA 2KXHA 2F9JA 2FJEB 2AZ1A 3M8ZA 1VMBA 3VR1A 4NLPA 1IKXB 4OHZA 4NLRA 3QRQA 1AT1B 4O4GB 4C98A 4QWAA 3IBCB 2VBYA 2HEKA 2YKPA 3DDNA 4ECUA 1OYDA 2HQGA 3M4XA 2Y3YA 1LWFB 1FXRA 1M5KC 2W4CA 5CD4A 2H5IB 1Q82T 4G3IA 4LSLA 1KKHA 4DLGA 5KFCA 1UKUA 3A8KA 2KM8B 2LA6A 4FF4A 5KG5A 3UI3A 2L08A 1NK6A 1YG0A 5CD4H 3EPGA 4OZ2A 2P2CB 3GV7B 1U1OA 1RT2A 1SKUB 2B5JB 2ZC3A 3BPSP 2WTFA 4G1QB 3ONQA 2WB1D 2O5DA 3ETOA 5M2UA 1KR4A 3M6WA 1RGVA 1NJZA 5A8KA 4I68A 1TTHB 2E1CA 3SSQA 1Q5VA 1XEZA 2JNJA 5HATA 1Y7PA 2MLXA 1I94J 2E29A 2MHNA 2OPQB 4B9VA 3DLGB 3KLFA 4JI3F 3LP1B 3CF5Q 2RRNA 4CLPA 3PFOA 4AXIA 4JI4F 1NZAA 5JMNA 4HDGA 3Q8RB 3I9ZA 2L9DA 2BR0A 4Q0BB 4GC6A 3NNHA 4QOTA 3IR7B 3RRKA 3JQMA 2PMHA 2OMLA 2M3DA 1UETA 1C4CA 3G4SS 2FJWA 4WP8A 2KU7A 4MAKA 1PYOB 3D6MB 3V4MA 1RTHA 4ED7A 2OKQA 1WTFA 5B0EA 2PMWA 5IFMA 3CMAS 3G86A 5GMKa 1MG7A 1AFIA 1R7IA 1YJTA 3M8SA 2H4YB 1JLBA 1XERA 3RG6A 2ASJA 2HFSA 1AUSL 3LAMA 2VASA 3LAKA 2VIHA 1I5OB 4OI3A 2IFXA 4LRFA 3SBMA 3T1HF 4LBPA 3MOZA 2GVZB 4OYAA 3AXKA 3PIPQ 2VZ9A 2OPSA 3A12A 2WVDA 1YJWS 2NZCA 1SC6A 4LF9J 1P1LA 2OI2A 4JOUA 2FLNA 1O8BA 2B3TB 4CO5A 2HMIB 2VV5A 2N82B 3HZEA 3H2LA 2X1AA 9ATCB 1W2IA 3SCLE 4PXCA 5F9NA 1OPZA 3MM9A 2ADBA 3IFEA 4WTOB 4H4KA 2XMWA 2RKIA 2OGUA 3KG1A 2GJ2A 4B9TA 1G2EA 1UVKA 2NXNA 2CJYB 3FCHA 2V9KA 4DFPA 3A8IA 2Z2YB 2MQOA 4A8OA 2OFHX 4KTQA 5KOXA 2GZOA 6AT1B 3CJ0A 3AOBA 4PWUA 1TUWA 1LFWA 4OYZA 1ZS6A 1FEHA 3AY0A 3D4JA 4DEZA 2UUBF 1MW7A 2HFNA 4OYPA 1U0HA 1UJ6A 4QIFA 2AW0A 1SJRA 4KKOA 4I2PA 5HK4A 4K5SA 1WOOA 4X4QA 5C5JA 2LEAA 4QYRA 4CLYA 2CQ3A 1HQEB 4D3GA 2HHWA 4LFCF 2YWGA 4D3HA 3H59A 1X5PA 5I42A 1BQXA 1C0UB 3VQTA 5LSRA 1V3SA 5THWA 4WBFA 2UXCJ 2HZCA 1LXNA 4L6V3 2HFVA 4X4SA 4C11A 1X4HA 4IOAQ 1JKHA 4LBIA 2VA2A 4DZ6A 4IFYA 4C0BA 2KKHA 2ZBIA 2V2VA 1LKZA 2F7VA 5CYMB 5CQGA 3IRWP 4J9SA 2ZOFA 4RBUA 1QAXA 5A2QY 1RYSA 1DTTB 2QZ8A 1DHMA 5HJYA 1S9EA 3K59A 3KK2B 4DR7F 4PWDA 4I7FB 2XMVA 2ERRA 4ALZA 5CZXA 4C0OC 3GTYX 2CADA 2AWZA 4ZIVA 1OY9A 4J9VA 3I0RB 3OPKA 1UFWA 4DUZF 3F73A 3CCUS 5KFKA 2MJNA 1FWPA 5GAGU 1N8RT 3BM7A 4KAIA 2E1MC 5HVHA 2E7VA 5E5NA 2YQ3A 5F9LA 3RAMA 3DRPB 2AHOB 4F36A 4EEYA 1WWHA 1Y5IB 5F8HA 1RDRA 3G6XA 3I0SA 4A8XA 1K44A 2FLOA 2ZVSA 4LF8F 1G3OA 3NAIA 3HSJA 4LF5J 2KM8C 4DV0F 4UZBA 1NHUA 5F8IA 3DFEA 4WK1A 1QE1A 1U8WA 4HT5A 4BHQA 4DV7J 5L1LA 3H20A 3QGGA 2GMLA 1LNQA 1Z4UA 2DB1A 3I9V9 4NCGB 5KFPA 3W3SA 3D6HB 2I0XA 2ZD1A 3M2UA 1X9WA 3HXMA 4UW2A 4PG6A 3UDVA 3ZNUA 1B3TA 2MY8A 3GYXB 1LWCB 3FEXB 3RBEA 2MZTA 2F8MA 2ZZNA 1GMVA 3BGFA 4B3MJ 3POTA 4DV3J 5GAHU 4KY3A 5L8RC 4EBDA 2WVCA 1S1XB 2Y0BB 5F8JA 5C25B 3ETMA 3KTQA 5B0DA 4GRSA 1PG5B 5IC6B 4IQXA 1N34J 3CMES 1T9TA 3AD9C 3DHWC 4PXEA 4LSZB 2Y8WA 3GIMA 4NLDA 2VBXA 4NL5A 1HBNA 2A10A 4DOZA 4IYQA 4PG4A 2B43A 4C3MA 4O4RA 4C0HA 4NLSA 3BB5A 4LIRA 2F4FA 1RT3A 2YNIB 2L3MA 1OYEA 1APSA 4ZLNA 1HW9A 5FD1A 5HMWA 4J9OA 2G4BA 2UV8G 2H65B 4DSJA 1IQTA 4HH0A 1UWBB 2IM0A 2OEKA 3DRYA 5F41A 4RKUC 2F8EX 3KJVA 1GXUA 3OLAA 2W8KA 3MEGB 4ANCA 2BABA 1C0TB 5J2MA 1FKPB 3RBZA 3A3OB 4B9SA 1D9FA 2GNKA 3HVTB 2BA9A 5GADI 2ABYA 4DMZA 2NCKL 1RHRB 3TAMB 3CDEA 4CLSA 2XZTB 4C4WA 1OY8A 4PKDB 3LP2B 4JV5F 3Q0AA 1U1QA 5D15A 4OHWA 3DYAA 4WKYA 4DR4F 1KSPA 4OYMA 4BC7A 3ILIA 1WEYA 3PIOQ 5DJBA 4RW7B 2RF2A 1M0SA 3MD3A 1NPKA 3G6VA 2DT9A 1RUSA 2NXJA 2WVBA 1KP6A 5DM7Q 2E1AA 5L1KA 1WSRA 2I2YA 2VICA 2VF3A 1SJ4P 2UUCF 5D4LA 4K4SA 1G7CB 1F0XA 1X7VA 1N32J 3TVZA 1UVIA 1HBUA 4LF6J 2CYYA 1Y3KA 2BRKA 2G13A 3GPAA 3ILJA 5F8NA 2E5LF 2BOPA 1VRTA 4C8LA 2JL9A 2ASYA 3T9ZA 4JI0F 4ZVSB 1X31C 4XAKA 2UUAF 3GWCA 5B0BA 3FC9A 2ASDA 4WCEQ 2GHVC 4DXLA 4FZVA 5HMXA 5KFIA 2ZH5A 4USMA 5FJ4A 4ID5B 1MMDA 1NUEA 2SXLA 1FT8A 1FNMA 2EK1A 4G65A 1E6YA 3PDNA 3ISND 1XNQJ 2HQDA 4WFXA 2XQCA 2WOMB 2FZKB 2VU5A 4PG7A 1LW0A 1CJKB 4ZLJA 4ZOSA 1CC8A 3KLGA 3H4DA 1F3FA 4OLPA 2F9DA 4WXOA 4Q7AA 2DGQA 2VJVA 1H74A 2YWWA 4WFAQ 5K9FA 3FCWA 5AJ3F 1S6QB 2VQEJ 3N28A 1EETA 3PX4A 4KGMA 2B4OA 4YN3B 1KNZA 3JSBA 3V81B 4A4JA 4HL9A 2R8JA 1ZYQA 2R7UA 2W25A 3VGSA 4HI2A 5ADZA 1NB7A 2CVIA 1N4LA 2J9EA 4A8WA 1IBMF 2V63A 3HSZA 2RHQB 2MEWA 1XR6A 4R5PA 4AYBD 2DEIA 3THPA 2Y1RI 1D8ZA 3FRZA 5DS7A 1N54B 3VAFA 3PRDA 3DLKB 3FBEA 1RJJA 4IQMA 3RB0A 2WK4A 2BOAA 5DZ6A 2R2UA 1XWLA 3GONA 2C42A 3DI6B 1NSKL 4M5DA 5KFTA 3QZ7A 2NQPA 4YHHJ 2XGQA 4PYDA 5KFEA 3US5A 2BV3A 4LFBJ 1TQLA 4ZKAA 3EUNA 4I1TA 2PI4A 2VPXB 2H5EA 4ZPVR 3KK3A 3PNIA 3PRBA 2XY5A 3MR5A 5A6WA 2C28A 2R7TA 1NXIA 3NBPB 1EIYB 4P72A 2IRXA 1NZ8A 1VQ8S 4TVAB 2YKNA 2Y1IA 4OFZA 3K5MA 4A48A 1P27B 2QO3A 1AUDA 3M32A 4E8UA 3EX7B 2M8DB 2Z0GA 3BDPA 4MJKA 1WD6A 4QPXA 4DN0A 2JEIA 1SXLA 3IRXB 4F0MA 4PRFA 2IYIA 3J7YU 4LREA 1UL3A 1G4CA 5DQGA 2L9NA 1N6QA 4U95A 4FXVA 4RW6A 4KSEB 1EQMA 3W1YC 3HJVA 5G0RA 4O3OA 2VFUA 4UY85 3TP2A 4YFUA 4B02A 3OUYA 3FEZA 2FLLA 1RACB 3J81Y 1I6JA 3HULA 3MMBB 4B17A 1VHFA 1HD0A 3IGNA 5J2PA 1NK0A 3MCSA 5KFNA 4ZIWA 3R1HA 4IRKA 3MM7B 5I4MA 3CCZA 4ELUA 1VBYA 2IJFA 1YBUA 4YB1P 1RLCL 1ITPA 4LRBA 2I5JB 5DGBA 1RT6B 3W9JA 1C1BA 3FK4A 2YWFA 4FS2A 1FRLA 5K14B 2RRAA 4WPAA 1Q78A 1RTJA 3M1VA 3R1LA 2QL7B 1YJVA 3QGPA 3TQEA 4DV5F 3L95X 1RSCA 4WFNQ 4KO0B 2E9RX 5D3GA 2RB7A 2AJ0A 3LOUA 3H5YA 1NB2A 1XC9A 1D3WA 2YH0A 4CM2A 2BJ1A 2ILZA 5KFHA 2H54B 4W90B 3VWSA 2J9DE 5J1PA 1OO0B 1TVRA 2HIYA 4DLEA 1Y9OA 1XJWB 2V2ZA 4TKTA 4ID8A 1VRUB 2BE2A 2W2OP 1BWEA 2Z4PA 3Q86A 1B0VA 3KG0A 3MURP 1U6FA 3FGVA 1X60A 3KJQB 4QU6A 3QYYA 3K8VA 2XO6A 4PCQA 5G4DA 3IBWA 4JB8B 3EWGA 2A6MA 4GO7X 2LQ9A 4KH1B 4M5KA 2BJ9A 3H90A 1SQEA 1RKIA 4ECVA 1DFDA 1L3KA 2FJVA 4NXNF 3OXFA 1RAFB 4IOBA 4L72B 3HT0A 2PFFB 3UCGA 5KOWA 5IWAJ 2RU3A 2HNDA 3OVBA 1FNXH 1VOMA 1QSLA 2B6AA 3BKFA 2EC0A 4ED6A 5J2QA 1QM9A 4K8RA 2HW3A 1HFEL 3VAHA 2A3JA 4OZJA 4OIXA 2YKMB 4OZ0A 1B7FA 4J9KA 1NH8A 3A3NB 5CZVA 4ENOA 3NNCA 2JVRA 3ENWA 2UXCF 3ITHA 4ETZA 3NY0A 4UTGA 1VBKA 4ELVA 2DCUB 2HHSA 4DV2J 1JLCB 4NXMJ 3VCDA 4LSNB 4FDFA 2VL1A 5JXSA 1C1CB 3MCOA 1N33J 1SJQA 1FDAA 5HSPA 2OJ3A 4UT4A 4DQQA 2GIQA 2DNHA 4Q43A 4HLBA 3R5JB 2V8PA 2EPIA 1RWPB 3A13A 3D7SB 1Q81T 2ZZMA 4KPYA 1RAAB 2V4RA 3TI0A 3ZTQA 4DSKA 3NS7B 2JOQA 4O4GA 2DR7A 2JWNA 5L1JA 1U25A 3UR0A 3KNGA 3NEKA 4OV6A 3QT7A 4X4UA 2DGSA 2D3UA 2XG8A 4LF7J 1TL7A 2QL9B 2MJUA 4JI2J 4I2QA 4EYIB 1HNWJ 2F40A 8RUCA 4ES3A 3FVYA 4TU9A 5CAAA 5HVGA 4EK2A 2B5JA 3JTPA 1HIYA 3CCRS 4G1QA 3RR7A 1Z2ZA 1DAXA 2RH3A 2DGUA 1S0VA 1U24A 2FDNA 3BQ1A 2BJ7A 2C2KB 3R3TA 4ERDA 4C9DA 4WU2A 2MLZA 1Q16B 1AZSB 1KEKA 1AW0A 2OPQA 3QJJA 3SDEB 3IO1A 3DLGA 5IQ6A 3LP1A 1NBEB 1BQNB 1HMVB 3DOLA 1IBKJ 2GJIA 3CVKA 3HD2A 2BW2A 3CCVS 4ZP8A 4NEYA 4ZVFA 7FD1A 2MKYA 4Q0BA 3LP0B 2YWHA 3EGWB 2HHUA 5GAEU 3WQPA 5KG6A 3R7BB 3CDWA 5DDOC 1YZ7A 2W01A 1M90T 4K4XA 3CGIA 2FB0A 3UFCX 1TKZB 4KC5A 5H1SV 4JBCA 2DO0A 3NNAA 4F04B 4JV1A 3OQ2A 4K7QA 3IGVA 3M2RB 4LF4F 4L76A 3TEGA 3C6UB 2OIHA 2HHHF 1WORA 5K5MA 3G82B 4I6YA 4TLQA 4CLFA 3PEHA 4DPUA 2QA4G 2XCPA 1EAYC 2HMIA 2ZJPQ 3DLBA 3OFHA 1VQNS 3GIRA 2FGCA 2JLGA 3F0NA 1RI7A 5HI7A 3L9ZA 1H2TZ 4ATNA 5E7OB 4JI8F 2GHPA 3AODA 4CTAB 1IM6A 1YGYA 1NKBA 3CNQP 2EEYA 3QQCD 4F0KA 2MKKA 2PA8D 5LMUF 2HZAA 3GU0A 1B0PA 2QMWA 1UEUA 3MAHA 4F50A 3PXGa 1KDNA 5T7LB 3MCNA 2Q1LA 1F1BB 3VTIA 4C2MA 1NDPA 3PR5B 3TANA 3AXMA 3QSYB 2LP4A 1SB6A 1MWYA 3HI9A 4FYWB 2ZJRQ 1ZH5A 1Q95G 2N4CA 1VQ9S 3D2WA 2YH1A 3TJAA 2Z30B 4WZQA 2MTLA 3EICA 2RNEA 3MMCA 2CNLB 1VQ6S 3D1OA 1ZM2A 2AKWB 3ENAA 3J80U 4Y2AA 5ITHA 2BVZA 2UP1A 3I5BA 4K4WA 2LYVA 3T5HA 4NLUA 3BR8A 3BQ2A 2WSFC 1HQEA 3BJYA 2E66A 3MM8B 1FTCA 1C0UA 4ED5A 3R5DA 4CDIA 1HHTP 2HGMA 1FJ7A 3HVAA 5ETNA 3MHYA 3C8YA 3IMQJ 2BKPA 4DX8H 3DXSX 4OMFG 1XNQF 4FN5A 3GV5B 4CO4A 4J9QA 3THVA 2PC6A 4QJVA 5A76A 1GFWB 5CYMA 4DR5F 3TYTA 4CZCA 2Z58B 1K8AT 4FBUA 3D0HE 1DTTA 1S1UB 2KVIA 1QTMA 1RHMB 1SJFA 3K5PA 3IM9A 3KK2A 2BQRA 4UUWA 3TARA 1NJIT 4I7FA 2A6OA 5CA5A 3LGNA 1X4BA 4H4MB 1N36J 1XMBA 3HHNB 2ZC4A 3DLHA 3FEYB 2W8LA 3BS9A 3RZAA 1IKWB 3I0RA 1IBCB 1HNVB 1VQ5S 2IPOB 4ZPCA 3MMJA 3QGHA 4CCHA 3DU5A 5BYRA 4DUYJ 2WZ1A 3D0IE 4DUTA 3NGTA 1YJNS 1D9AA 1N0UA 3DRPA 1EARA 2DXDA 2ASLA 2OAUA 1MSWD 4U67Q 4RNNA 3ENQA 1FRIA 2F4VJ 4KGZB 2H4WB 2OPSB 3B4DA 3KLHB 2YNFB 1TL3B 1T9WA 2QRRA 5IT9U 5D0EA 2WBRA 4I67A 3B4MA 4YHHF 1WI8A 4ZP6A 1VC5A 2MLYA 2DR9A 2CPFA 4FS1A 5HVFA 3MEDB 2KZZA 1FWKA 1UPPA 4NE9C 3JTOA 4KBIA 3LTOA 1FD2A 2QYGA 4EO6A 1V9OA 1AYEA 1WOSA 2BJEA 3DOMB 1U02A 3Q8VA 3KUGA 1FXDA 4ZVRB 4XK8C 2D74B 4EO8A 1WKLA 4F3QA 3EXCX 1LWCA 1FE4A 2XMJA 2ZH8A 3G2XA 3UQSA 1UEKA 4DL4A 4L73A 2UVVA 1RA7A 2FPHX 4RUBA 1Q8BA 1TK5A 7FDRA 2HGNA 2PEHA 4K4YA 4KHPF 1SI9A 4QR0A 1HWKA 5C25A 4PEOA 1S99A 2V0NA 1RWOB 3IR5B 3N6NA 3T5LA 2RQ4A 3KJNB 5H9FJ 2APOA 4MTPA 1X0PA 1S6UA 4Y28C 3I31A 4NWBA 1FXLA 2DGXA 2C22A 2YNIA 4RBVA 2K7KA 1QAIA 2VD3A 2QC3A 1NH7A 2MQ8A 5LOQA 3K5NA 1QUPA 1O51A 4M5HA 3BQ0A 1JX4A 3M9OB 1IWAA 3MEGA 4HHJA 2V9WA 3RGIA 1RBOB 1C0TA 3FQKA 2MQPA 3O5TB 3K5LA 1FKPA 4ZVTB 1HL6A 4NYZA 2DD8S 3OR1B 1HHQA 3HVTA 4KHMA 4NLWA 4EWTA 5D4PA 2GVDB 2OTJS 2P9GA 4DR1J 2PFDA 2XEXA 4B3SF 1S9EB 5D4OA 3TAMA 4Y0FA 5BYSA 1RWWB 2JFDA 3QGIA 3TOQA 1TKTB 1BGXT 3NRBA 2DNLA 3LP2A 4O0NA 4YR3A 3MZIA 4H54A 2IDLA 4EFAC 3MUTP 3H7HB 4NCAA 4F67A 4J9PA 4RW7A 1UCNA 3FKBA 3HHLC 2MQQA 4DJBA 2XMUA 2JHEA 2LQ5A 1SKWA 2CDRB 5D6GA 5SUHA 1Q7YT 1VJQA 2D7SA 3ZNJ1 3A8JA 2QLFB 3V2UC 3H5SA 4X64F 1TMJA 1RWXB 1PAUB 2MKCA 5E3QA 3VGTA 3RRGA 2CPZA 1UMJA 1NK8A 1RHQB 2MQMA 3P5BP 1SC3B 2RS2A 4A8QA 1H6KX 2D9PA 1R27B 5DDPC 2Y8YA 1IVZA 2WSCC 2M0GB 2BJDA 4AE5A 2VDHA 2VKZG 1TELA 4KGVB 2CNOB 1GQEA 2NUHA 3TVYA 5D8HB 4ID5A 4YDXA 1D0EA 4AUKA 3VALA 4F4AA 1FKOB 3VAIA 1VS3A 4DCPB 1HW8A 2IA0A 3RB4A 2HKEA 4JI3J 4RW4B 4OHVA 3W5ZA 1VI7A 1XMQF 2WOMA 4JI4J 1NK4A 1ZZNA 4C3LA 1WJ9A 1CJKA 5D4NA 2YBVA 2AJ2A 1NDCA 3LF0A 1VISA 1FFGB 2ZKUA 4I6AA 2UVRA 2OEMA 2QFJA 3Q8UA 1WDTA 3V6KA 2RDDA 1S6QA 1K9MT 4S0MA 2Y1LB 2IMOA 1KD1T 2K3IA 1YX2A 3PYFA 1MWQA 1PGZA 3V81A 1NJYA 3OW2R 4ZLPA 1UP1A 1IKVB 4M5IA 4YY3F 4DQRA 2KN4A 3BN7A 2VBWA 3R6LB 1T7PA 3N0VA 4QIWD 4ZN1A 3K17A 2AGPA 1F3VA 2XSJA 5IV3A 3W2VA 2ALYB 4P73A 3F44A 3DLKA 1PIEA 3T1HJ 4AXJA 4HVZA 5GVQA 2HHTA 4ILLA 4USIA 4NA1A 4HH1A 1SL2A 3ZTSA 3BSNA 2XS2A 3I56S 4K5RA 3DI6A 2HFZA 1MNEA 5KFJA 2MSSA 1HWIA 4Z2XA 1SIZA 3DKDA 4P9SA 1WF1A 1SBRA 2NXEA 2V2KA 3NS5A 1RBAA 3UE2A 3X1LB 4USTA 2LEPA 2E5HA 3T41A 3WIVA 3T5JA 1IWGA 3CD5A 4X4NA 5HLFB 1HNWF 1VJWA 4QWCA 4DL7A 4FVMA 3Q83A 3NBPA 1FJEB 2VG7B 1URRA 2RJZA 4Q2LA 2KJVA 4BCAA 2LECA 1CC7A 4DG1B 2W1BA 4H4KC 3W8PA 2VB6A 2DKOB 4FPIA 1N5YB 4R25A 4QCLA 2BE7D 1Z2LA 3PO5A 4ED4A 5HQLA 1TL4A 2AYMA 1F9EB 3IRXA 4U8YA 3H8YA 3MDFA 3D0GE 5L9XA 1SC4B 1IBKF 2UUBJ 2BACA 1ZAWA 4QW8A 3QFWA 1WACA 1G6BA 2QYCA 4ZA1A 1B0TA 4NOHA 1D8YA 4MKAA 2LXFA 3Q8QB 3DLJA 2HNZA 1GXTA 1YSJA 1S1WB 4M94A 3V5RA 3VQSA 1O6XA 4K0KF 4LFCJ 2CQ2A 3MMBA 2B4VA 2JX2A 3G71S 1R8BA 2FQQB 2ROGA 5D78A 4ECTA 3LGHA 1IN0A 3P5TL 1PYSB 3MM7A 3QJLA 5DQIA 3G8QA 5A2QU 1UW9A 3DXBA 4WZMA 2I5JA 4L3KA 1RT6A 1LWXA 5KFMA 1X5TA 4G1IA 5K14A 1M5VC 2I9SA 3EYZA 2EBEA 2QMUB 2QA1A 3T6BA 2C3UA 4DR7J 5H9EK 3H42A 3SZ2A 1IJEB 3BZQA 3SEOA 4KO0A 4DR3F 2CG4A 4LFAF 4IRCA 2PT0A 3C3LA 4HI1A 2X3DA 3CCWA 4MK7A 5E33A 2QTWA 4J9MA 3I6PA 3O3LA 4E2FB 4QWBA 4DUZJ 1NJXA 3PJXA 2WSEC 1NSQA 4Q5VA 2J8AA 1UA0A 1ZPWX 1RQ0A 2CQ1A 4WYWA 3JTNA 3AQPA 1EKRA 3KHHA 1DLOB 3L7OA 1U2CA 4DU7A 1VRUA 1B64A 3R2DJ 2RUSA 2DCLA 3QSIA 1LOUA 1CVJA 5KT5A 3ZZPA 3RW6A 2E5JA 2Y0SD 4ZCMA 4OZ3A 4ZVQB 5AE2A 3CWJA 4LF8J 2XMAA 2W2QP 3Q8YA 4DX6A 1FRKA 3IS9B 1NK5A 3I87A 4J5OA 4DV0J 1RAIB 4DU8A 2F3JA 2XYGB 4LJMA 1DQ9A 5BR8F 3P4UB 1T94A 1CSJA 1D9DA 3M8WA 5E3AA 8ATCB 1C4AA 3W9IA 2CQIA 2R7WA 2R2TA 3HP6A 4PG5A 1TP7A 1OJ4A 3N5FA 4M95A 1RXOB 2D41A 1S79A 3N79A 4J37A 1QVGR 4C48A 1VQYA 1LFPA 5KFSA 3E2EA 2W9CB 2YKMA 1JLQB 5LMNF 2F63A 1ZTTA 6FD1A 3O2IA 4MK9A 2M70A 2MZSA 4B3OB 4FVCA 1TKXA 3A4TA 1Y5LB 2OFGX 1WUUA 5AXMA 4QR1A 3HHKA 4NLVA 3AJ2A 3HD1A 1JLCA 1S72S 4K4VA 1ZAVA 4I56A 4LSNA 3IR6B 2JVOA 1C1CA 3CT9A 3GFYA 4GC7A 2E1RA 1VBXA 1JWWA 2W9BB 1VYAA 3IAM9 4CLKA 4K2XA 2R7SA 4MT1A 5F3ZA 3OFEA 2M52A 3MAQA 3VAMA 4OI2A 5C24B 4F0HA 4JV0A 2VQFF 3KLVA 1FE0A 5AE1A 1WC0A 3OTBA 4ZITA 4DPYA 1X4FA 4LVOP 3EGNA 3GJQB 1YDLA 1R0AB 4WTYA 2MKHA 4JI7F 2FC8A 3CJSA 3TR5A 2CIMA 1Y10A 3LPYA 5HL7Q 3CULA 2EG1A 5D0GA 1VQOS 2F4VF 3TWZA 5IT4A 4DV1F 3BPDA 2XS7A 5LJ3Y 2K1RA 2VPZB 3VAGA 4JV5J 1WNEA 1HWLA 4OX9F 2DXFA 3D6FB 1YRUA 4B3TF 4DR4J 1JXEA 4OI4A 1X8DA 4OI6A 1MN7A 3JS9A 5C2CA 2FTRA 1U1NA 5HAOA 2GC8A 4Y65A 2ZM6F 5JVGQ 2EWHA 1S0NA 3JSYA 1WTBA 3S1TA 2QJ3A 1IR1A 3FSYA 3G6ES 2W7OA 3M7VA 4DSEA 3PJ9A 1AZSA 4CO1A 4JI6F 1CQMA 3NL0A 2HVEA 2OLWA 2R7OA 3SDEA 2MYFA 3CC2S 3BBCA 4WWSA 1BQNA 1HMVA 3BBFA 3BSCA 1MLAA 1KN6A 4DV4F 2IA6A 1LEOA 4DDFA 3N01A 3K5OA 3MUVP 2E5LJ 3LP0A 2J7UA 2QFIA 3GIIA 3EXYA 2XBPA 1W25A 1RAHB 2UUAJ 3UVJB 3OVSA 1M1KT 1WF2A 1CS4B 2LXUA 5GAGI 4RW8B 2NXCA 2P9EA 3WBZA 5HROB 2M5YA 3M9NB 2GQCA 3VV2B 2IJRA 2W7PA 2E5GA 1WI6A 1IR2A 2DNQA 4RL1A 3M2RA 5D0HA 4Y2IA 4J7CA 3C6UA 2L9WA 1RWNB 2A1BA 3R27A 1UWAA 1YHQS 2CQ4A 3G82A 1H98A 3VGUA 3ITHB 2DNYA 3C6TB 2JRSA 3AA9A 1NAQA 4IKAA 2CVEA 4YR2A 2KI2A 5AJ3J 4HTJA 3DDIA 3C19A 2J0QD 4A46A 2RAQA 5K20B 4F4XA 2B7BB 2OP5A 1RBLA 3QAUA 4ZS6A 4X62F 3CD0A 2UV8A 1K73T 1YRTA 3GIJA 2ALZA 1S0OA 3WDOA 3KOAA 1L3TA 1FDNA 3ET6B 4ED1A 3H2UB 1IBMJ 4ITSA 5DZ7A 1YTYA 4CTAA 1HNZF 4WF9Q 4USWA 4ZDNA 3EVWA 1J5OB 2DBBA 3M8QB 4WKRA 2N4DA 3GJSB 1NSPA 1RT4B 1DBDA 2VONA 4DF4A 1DTQB 2KYZA 4LR7A 2DYAA 5T7LA 1N0VC 2RT3A 3EE3A 1REGX 3TA2A 5GAHI 2JC1A 4X65J 4Z7YA 2OUGA 4GKJF 2ROEA 1SUQB 5KFAA 4N8OA 2HS3A 3UPFA 4ZCLA 5JJBA 1B99A 5CYQA 3DNCA 2ZHAA 1U6BA 3C16B 3CIZA 1TL7B 2GO8A 4N8NA 4IO9Q 3FZBA 5LL6d 1JJ4A 4I2QB 1TU0B 4USUA 1T02A 3KUHA 2MZJA 1Q8KA 3NWGA 3EZ5A 1HARA 3GG1A 4KJIA 4K50A 3FFIA 2YX1A 3BO3A 3IN5A 1GX5A 2E5IA 3SV3A 3MM8A 2VOPA 3T1AA 2GO9A 1SJ1A 2ACYA 5CCLA 4LQ3A 5A8WB 3Q2TC 2IVMA 3CJ8A 1U4BA 1H7WA 2WVFA 2E1PA 4DQPA 3OBIA 3H40A 1BMQB 2HQFA 3CDUA 3HZGA 4NEZA 5DGAA 2R7XA 2IBOA 3DOLB 4Q44A 1RAGB 2HRTA 1NNDA 1OQ6A 3CJ2A 4ER8A 2YNHB 3J81U 3MPWA 2HSEB 1ZA1B 2ZVIA 3UDEA 3GV8B 4FXWA 2HZVA 1S1UA 3F56A 3IA0A 4DSFA 1ZAXA 5H9EJ 5HP1B 3GG0A 3KWMA 2HBYB 3CEDA 3NAHA 4H4MA 3SCIE 4OHYA 1J2VA 4PG8A 2HNYA 4I0WA 2J7KA 2E9ZA 3X3UA 1IKWA 2F65A 2DHAA 1HNVA 2MHEA 2MXYA 3OXGA 3L3CA 2V50A 2QE5A 5I3QA 2IMWP 3MFIA 1R6YA 1JMTA 3L09A 3KLIA 4U7CA 1YJ7A 4ECZA 3FMWA 4I6WA 4K4UA 1A6LA 1JJCB 2LKZA 3AH6A 5KFFA 4UOCA 4DV5J 3PM9A 2PGCA 3KLHA 2FY1A 2YNFA 1HPZB 1TL3A 2IM3A 3MPYA 3FMBA 3C46A 3GYNA 2QLBB 4O44B 1FHTA 1JXVA 5B0AA 4USKA 4KV8B 5EHHA 3HLUA 2F8HA 3PW2A 2A2DA 1OIAA 3FZ2A 3BO4A 2OPPB 2GFFA 2UXDF 3KFWX 2BUNA 5KFWA 3BKUA 3Q23A 3MEDA 2J76E 2RILA 3K57A 1B4SA 3HM9A 3W60A 1S97A 2RS8A 3EM1A 4YEAA 1RHKB 4H4OB 3GLJA 1T9VA 3DOMA 3NGSA 3W5XA 2M8HA 2ZBCA 2XZWA 3QPIA 1S10A 1RHUB 2M4MA 3OTEA 3OFFA 2CJKA 2XB2D 1QDUB 2DTJA 1BE4A 4P2MA 1Y3JA 5KT6A 1YVFA 4HEA9 3ZZYA 4IDKB 4V1Ak 1PKUA 2FVQA 2YTCA 1TV6B 3MMCB 2PSZA 3JAMY 1PAEX 4NXNJ 4B9UA 2VPYB 2PN6A 1PJ5A 1GMUA 2NYHA 2V6AA 3S7RA 3RW7A 2AQ4A 3F41A 2HVDA 2A0FB 2FJDB 4JP8A 2KO1A 4UOFA 1RU2A 3CXCR 1F5BA 4W98A 1X4CA 4OJGA 5KFLA 2ZE2B 4LUBA 1S12A 3T1YJ 1WKKA 3BKTA 1FX2A 1DARA 2H51B 1U2RA 4ES1A 2EBGA 4NMXA 3THTA 4CO2A 2ZH1A 3D9BA 5F8LA 1VR6A 1UVJA 3MR7A 1IBLF 3MWBA 5E0OA 4LR9A 4RPFA 1C2PA 2FLPA 2B9XA 3QO9B 3BYRA 1R6VA 2LDYA 2HVHA 2MGZA 2RMLA 3M6VA 2HWTA 2K7JA 3UN2A 3CCQS 2GW8A 4U7UD 3OR1A 4W92B 4CH0S 5KFXA 1HHSA 3RU0A 2GVDA 4NMLA 4ECQA 4DR2F 3GZ7A 1JLFB 2DHSA 3CCES 2OHDA 5LT5A 2PD1A 2FZCB 1TKTA 1GH8A 3W5YA 1M1HA 3TA0A 4ED2A 4UF4A 2R7VA 3Q22A 3D1QA 1T11A 3MD1A 1JJHA 2KVQE 4X4TA 1HI1A 2X7IA 5HMZA 2JC0A 2DPJA 4HACB 3MGJA 3B82A 1KTQA 1FRHA 4FYXB 2CQBA 3J7YI 4AFFA 1REVA 8AT1B 4DS4A 5KAKA 3EZUA 3IP0A 4ZCIA 1P9YA 1KVKA 3CJQA 3R5AA 5J1EB 4B9LA 3PEJA 1H2VZ 3PVXA 4P75A 3PW5A 1P6TA 1U1RA 3BF4A 1U09A 4EMDA 2B0GA 5L38A 3CPWR 3KMQA 1VC0A 4P74A 4V19X 4UY8T 2LQBA 5GMDA 4ZPWR 2HVIA 3FDSA 2CZVC 5FDLB 3A8EA 2DK2A 2GAGC 4GO5X 4ZPAA 2ZH3A 3CO9A 4USVA 4ZK7M 1BUXA 3B54A 3NXZA 4U6PA 4F2RA 2YQ1A 1GXLA 2BMBA 4NLOA 1XMOF 1FKOA 3TUIC 1VIOA 3MPUB 4IR1A 2JEFA 4RW4A 1QUVA 2DISA 4JI1J 2ZJQQ 5IM0B 4RU9A 2QLXA 3GJRB 3CDAA 3OSPA 3J7Z5 4FF3A 4Y34A 2V68A 1U2FA 2NUUG 2PI5A 2AF6A 2NPIA 4XO0A 1GAOA 2HLTA 2MB0B 1U6ZA 3BDEA 3QIPA 2P8IA 2VG5B 3ZFVA 3U02A 2FZGB 3BGOP 1S48A 3Q8SB 4NASA 1X4GA 3HFVA 4HTIA 3NOCA 3AFGA 1AB8A 4KR0B 4KYZA 1IKVA 4XPEA 4F4KA 5HO4A 1IR0A 3R5CA 2DGTA 2HRYA 1FRXA 2UZAA 3DLEB 5DM6Q 2CUYA 2KXNB 1FJGF 4LF4J 4I4BA 4JUZA 4M5JA 4CYUA 1SV5B 3CIMA 2HHHJ 2O01C 4NRTA 2IVFB 1KFSA 2W2MP 2IC3B 4AL5A 5L46A 4M5LA 3EPIA 2J0XA 1ACMB 2WCXA 4DFKA 2G2OA 2G0JA 1VLOA 1H2UX 1JLAA 2MPUA 3MF5A 1H7XA 1RYRA 1RHJB 4JI8J 2H48B 2AJ1A 3MFHA 5HLFA 2KRBA 3C14B 1AROP 5IZHA 1FRMA 2PO4A 4MKBA 2CKWA 5LMUJ 2VG7A 3NGRA 4X4PA 3UCZP 1L3SA 1WC4A 1RAJA 1JQGA 1PJ6A 4OZLA 4DG1A 2EFPA 2PA3A 1KVIA 1HKAA 1N5YA 3QT6A 2KB2A 5EUHA 3DGPB 3PG9A 3ZZ0A 4ECRA 2Q43A 4ES2A 2AGOA 4WFBQ 2V8DA 3Q8PB 4OYBA 1MU2B 1BXNA 2XLKA 3BSAA 2BJ3A 2D3ZA 1L5UA 2CJ9A 5HQ8A 1WHYA 2RDJA 1SL1A 4NLTA 3I5CA 3H2VE 1RP5A 3OHAA 3V6DA 1GK8A 3GFHA 1P1TA 4DR6F 4WE1B 1RTZA 4CLTA 3CTRA 2QLJB 2R4FA 3EJMA 4J91A 3D6TB 3CC7S 1S1WA 5A8RA 1AXQA 2POKA 4A8FA 2CNNB 2HHVA 1B70B 2CJAA 4O3PA 2BKNA 4G1PA 1UVLA 3CW2C 4A47A 2M2BA 1JLEB 1X4DA 6FDRA 4YQWA 4BDPA 2HHXA 5HQMA 5EX0A 4CLUA 1PCAA 4NI2B 4TNOA 5BYQA 4XTTA 2FJXA 3JSMB 4DR5J 2P5VA 5A0YB 2BANA 4LF2A 2R8IA 1UZHA 2XNQA 3P3DA 1YQHA 3OR2B 2YPZA 4OX6A 3T19A 2N7YA 4P2FA 3S01A 1XR5A 1F2HA 2P9CA 7AT1B 3EVOA 2G1HA 5EX3A 3WC2A 1V6HA 3M6XA 2JSXA 1SH3A 3SQGB 2YKOA 2B51A 4TXSA 4DN9A 1ZTWA 2NXUA 2XSJB 1R8AA 3W2VB 4ZLLA 3MR2A 1RWUA 2V4QA 1AFJA 5KFDA 3DU6A 1T9YA 1S76D 1DLOA 5GAEI 1ZZFA 3R9LA 2CZ9A 3PCOB 3HT3A 4TU7A 4WU3A 1HNIB 4OI0A 1HQUB 4J9UE 3CDBA 2XY7A 2DR8A 4MIBA 3IS9A 3O44A 4X65F 3HHDA 1BC6A 5CHCB 2WHOA 3TVKA 1S59A 1Y4ZB 1N48A 5KG2A 2LCWA 1CJVA 4FXDA 1HYSB 3W65A 5D77A 4WP3A 2EK6A 2FHJA 4X66F 4RO0A 3LWMA 3GFZA 2VJUA 4OX8A 4F4ZA 2X51A 1RT1B 2V67A 2HK3A 4WK3A 1XBWA 4PXBA 2CPEA 1WEXA 4WIIA 1NEEA 3AOAA 3J7A1 1U48A 3GQCA 3D1HA 4IG0B 5E41A 4LVNP 3JQKA 4F7VA 2W9CA 3OHBA 4X2BA 1JLQA 1Q1KA 1K1QA 1UW4A 3GIKA 4B3OA 3UO0A 4BC9A 2LQ8A 4KHPJ 5LJ5Y 5KFOA 1PO6A 1R8PA 3R7SB 4AT1B 3KHRA 1X4EA 4LQ9A 1KOOA 2OELA 2N3LA 1T95A 2M7SA 2VC0A 2W9BA 3TX8A 4NZ7A 3BH7B 4FKYA 4KE5A 3PZPA 4PUOB 1F9FA 2HNZB 3HJFA 4LRAA 2FHJD 1T3OA 4IOCQ 4ECYA 3G87A 5C24A 2C3OA 3MOJB 3AOCA 5L39A 4MIAA 3OJUA 1TL5A 1YKWA 2XHWA 4LT6A 2PE8A 2YKAA 2PIIA 2Y9HA 4PXDA 5KT2A 2AD9A 2CDQA 3MEKA 3W64A 4DZDA 1UEVA 5DQHA 1R0AA 2D9OA 4QYZJ 1HR0F 4DSIA 3IG1B 2Q6CA 2AYEA 5M2RA 2CNKB 3SCJE 3DLLQ 4CLZA 3GSDA 1K0TA 4NPOA 4ZPBA 2P6SA 4RW9B 3K7RA 1URNA 2IAJB 4B3SJ 4LF1A 3ZZUA 1Q79A 3N6MA 2YNGB 1S4EA 1XR7A 3WHIA 2RRBA 2B7CB 2KT2A 4RUHA 3I55S 2R2RA 2EC2A 3OFGA 3GMGA 4P71A 3HX9A 3TZZA 2KRRA 1RKJA 2HPUA 2I8EA 1T03B 4X4RA 4DSLA 3HDSA 2U1AA 4M5GA 4TLRA 3TEHB 2DGOA 4P7TA 2DXEA 1VQMS 2Z8QA 1FVSA 4XPCA 5CCMA 1TFYA 4X64J 4N76A 2IY5B 2O66A 3NCPA 2DRBA 4ECSA 3M8RA 1U0SA 1K1SA 2ZBPA 1EP4B 2DVIA 3MTJA 2WBMA 3DRRB 3AB4B 1L3UA 4OI1A 4JI5J 3E51A 2DRAA 5BJRA 4U7UK 3UVJA 2D1CA 4DHVA 1S1TB 4OZ5A 3CSKA 4FNIA 5DDQC 1DURA 1KLMB 4URQU 3PW7A 1CS4A 4RW8A 2EVZA 1RADB 3DRSA 5HROA 2VOOA 4ECWA 2GQQA 2IDEA 1YWXA 2IM2A 3ZC4A 2J6TA 5DG8A 4F25A 3T1YF 3HHLD 3FSIA 1XMQJ 2MKIA 3MM5B 1FWLA 1H73A 4DQSA 2HFUA 2ZHBA 3VGVA 2EKNA 2EKYA 3CCLS 4PYAA 1TKXB 3C6TA 4YMEA 3D5MA 1YRXA 3DM2B 3D66A 1F9HA 2V2QA 2V8HA 4QIVA 1S6PB 1CG2A 2L48A 3QBCA 4P2XA 5F8GA 4XDDA 1SVDA 2VC1A 3PJWA 4IG3B 3JB9k 2HURA 3BBBA 2DIVA 1WC1A 5H9FK 4YY3J 5HJXA 4XIUA 3ET6A 2VFSA 3NLCA 1NCLA 1CJTB 4K2JA 4WYLA 3OL8A 3BREA 4A8KA 4KH0B 5M2PA 1J5OA 3M8QA 1OSCA 2LLZA 4RJVA 1RT4A 4ILMA 2DY9A 3U1NA 2HBRB 3SSRA 1DTQA 1ZBTA 3ZTOA 2KJWA 1XNRF 2DNRA 2DGWA 5B0GA 3P45B 2J0SD 2GJFA 1F5CA 3PFEA 4ZPDA 5KG4A 4GVLA 3LUYA 2KFYA 1PBAA 1SUQA 3WX4A 1BHNA 2DH7A 3BH6B 4P7VA 1EZZB 2GX8A 3L7PA 2HBZB 2HS4A 9RUBA 1HQ2A 2FHOB 3C16A 1OSDA 2WRMA 2K1RB 3C2PA 3D3BJ 3HF5A 3BGUA 2ZDPA 4EBEA 4HHUA 2E9TA 3H98A 1TAQA 1ZOTA
chains in the Genus database with same CATH topology
1UCNA 3Q89A 1NSQA 3EVOA 5IOLA 3FKBA 1U8WA 1PAEX 4HR2A 3EVWA 3DKDA 1XQIA 3ELHA 1KDNA 1W7WA 1NCLA 3FCWA 3Q86A 2HVDA 4ANDA 1NDCA 4UOGA 1NSPA 4UOFA 5CAAA 1JXVA 1NDPA 4EK2A 1MN9A 4W98A 3Q8UA 1HIYA 1ZS6A 2DYAA 1NLKL 2AZ3A 3EJMA 3EE3A 5CABA 2DXFA 3GPAA 1WKKA 4S0MA 2DY9A 3VVTA 3VGTA 1MN7A 3VGSA 2B8QA 4ANCA 3JS9A 3ZTOA 2BX6A 1WKJA 3R9LA 3Q83A 3Q8YA 3EICA 3GP9A 3NGUA 1VYAA 2AZ1A 3FC9A 3Q8VA 3FCVA 1LWXA 1B99A 3ENAA 4ANEA 3NGRA 3FBBA 1B4SA 3EM1A 3VGUA 3ZTPA 1WKLA 4CP5A 2B8PA 3WX8A 1NHKL 3BH7B 4FKYA 2NCKL 4C6AA 1BHNA 2ZUAA 3PJ9A 1S59A 3L7UA 3NGSA 3EMTA 3FBEA 1HHQA 3BH6B 3G2XA 3VGVA 5C7PA 2HVEA 3ZTQA 3PRVA 2DXEA 1NDKA 1F6TA 4F36A 1NUEA 4KPCA 3VVUA 4DUTA 3NGTA 1EHWA 3BBCA 3DDIA 3ETMA 4WBFA 4DI6A 2BEFA 3BBFA 3FBFA 2DXDA 1S57A 1LEOA 1XIQA 1NB2A 3MPDA 1K44A 4UOHA 1BE4A 2CWKA 1S5ZA 1NSKL 5BXIA 4O0NA 1NDLA 2VU5A 3ZTRA 3B6BA 4F4AA 4DZ6A 1NPKA 1HLWA 3FBCA 1BUXA 3B54A 4ENOA 4FKXA 3ZTSA 1PKUA 3EVMA 1F3FA 2HURA 3BBBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UCN A;  3Q89 A;  1NSQ A;  3EVO A;  5IOL A;  3FKB A;  1U8W A;  1PAE X;  4HR2 A;  3EVW A;  3DKD A;  1XQI A;  3ELH A;  1KDN A;  1W7W A;  1NCL A;  3FCW A;  3Q86 A;  2HVD A;  4AND A;  1NDC A;  4UOG A;  1NSP A;  4UOF A;  5CAA A;  1JXV A;  1NDP A;  4EK2 A;  1MN9 A;  4W98 A;  3Q8U A;  1HIY A;  1ZS6 A;  2DYA A;  1NLK L;  2AZ3 A;  3EJM A;  3EE3 A;  5CAB A;  2DXF A;  3GPA A;  1WKK A;  4S0M A;  2DY9 A;  3VVT A;  3VGT A;  1MN7 A;  3VGS A;  2B8Q A;  4ANC A;  3JS9 A;  3ZTO A;  2BX6 A;  1WKJ A;  3R9L A;  3Q83 A;  3Q8Y A;  3EIC A;  3GP9 A;  3NGU A;  1VYA A;  2AZ1 A;  3FC9 A;  3Q8V A;  3FCV A;  1LWX A;  1B99 A;  3ENA A;  4ANE A;  3NGR A;  3FBB A;  1B4S A;  3EM1 A;  3VGU A;  3ZTP A;  1WKL A;  4CP5 A;  2B8P A;  3WX8 A;  1NHK L;  3BH7 B;  4FKY A;  2NCK L;  4C6A A;  1BHN A;  2ZUA A;  3PJ9 A;  1S59 A;  3L7U A;  3NGS A;  3EMT A;  3FBE A;  1HHQ A;  3BH6 B;  3G2X A;  3VGV A;  5C7P A;  2HVE A;  3ZTQ A;  3PRV A;  2DXE A;  1NDK A;  1F6T A;  4F36 A;  1NUE A;  4KPC A;  3VVU A;  4DUT A;  3NGT A;  1EHW A;  3BBC A;  3DDI A;  3ETM A;  4WBF A;  4DI6 A;  2BEF A;  3BBF A;  3FBF A;  2DXD A;  1S57 A;  1LEO A;  1XIQ A;  1NB2 A;  3MPD A;  1K44 A;  4UOH A;  1BE4 A;  2CWK A;  1S5Z A;  1NSK L;  5BXI A;  4O0N A;  1NDL A;  2VU5 A;  3ZTR A;  3B6B A;  4F4A A;  4DZ6 A;  1NPK A;  1HLW A;  3FBC A;  1BUX A;  3B54 A;  4ENO A;  4FKX A;  3ZTS A;  1PKU A;  3EVM A;  1F3F A;  2HUR A;  3BBB A; 
#chains in the Genus database with same CATH topology
 5FLX Y;  3QRR A;  3LQV A;  1QLN A;  1VFJ A;  2E7W A;  3CCT A;  4QIG A;  5A8W A;  3TUZ C;  2H5J B;  3RB3 A;  3MAA B;  1BD6 A;  3UD3 P;  1YJ9 S;  4JI1 F;  4DPX A;  3TZX A;  3OL9 A;  1ROF A;  2J9D A;  2DIU A;  1YLX A;  3CUN A;  3AAW B;  4IFV B;  2YNH A;  1SQG A;  2DH9 A;  4MFB B;  2UU9 F;  2O67 A;  4CH1 A;  4KIA A;  2BW7 A;  4CWB A;  1N5T A;  3CO0 P;  5HP1 A;  3E3X A;  3EGV A;  4K0K J;  5B0F A;  3CB4 A;  1H3D A;  2EFV A;  1WHW A;  3TQ1 A;  4J90 A;  3PX0 A;  1YIJ S;  3MPV A;  5BXI A;  4OLO A;  1RAE B;  2NLW A;  3K8W A;  5ETT A;  3U7J A;  2NRE A;  3CD6 S;  1IKY B;  1M5O C;  1KHW A;  4WIQ A;  4OQJ A;  2COL A;  4RNO A;  4K4Z A;  3IWX A;  1Q4R A;  1WHX A;  4UOG A;  1TZ0 A;  4PZV A;  4MYU A;  1LV5 A;  1TR0 A;  4O3S A;  4PQU B;  5KFY A;  2RQK A;  3M05 A;  1HPZ A;  3MUM P;  5E3C A;  4O44 A;  4RBT A;  1WEL A;  4DF8 A;  2HAI A;  4KV8 A;  4DR3 J;  4X84 A;  4LFA J;  2VKR A;  1CEZ A;  2D69 A;  1TUG B;  3WZ0 A;  2PDA A;  3AA8 A;  4LBH A;  2OPP A;  1JNZ B;  5EWG A;  4MMO A;  2ATL A;  4PPZ A;  1Q86 T;  2EFQ A;  1RZM A;  3R97 A;  2G0I A;  2ZUA A;  3QMQ A;  3RUB L;  2H1Y A;  2CPJ A;  3W63 A;  1NSA A;  4H4O A;  2KDO A;  4DV6 F;  2EXU A;  2FC9 A;  2EFN A;  1WC6 A;  2OD4 A;  2C2M B;  4JYA F;  3PY8 A;  5AXN A;  1P9Q C;  4F3O A;  2V8V A;  2CWK A;  1FF2 A;  2JJ4 D;  2AX1 A;  1J5E F;  3PHT A;  1QTN B;  2LXI A;  1KRP A;  3QFH A;  3TJ9 A;  3ZO7 A;  2ZHO A;  2R9L A;  4KFB B;  2FVR A;  3DOK B;  3ELH A;  4IDK A;  4M8L A;  5CYQ B;  5BR8 J;  1TV6 A;  3QZ8 A;  1HNX F;  3LGM A;  1FJC A;  4QPT A;  1JXL A;  1RAO A;  4NX9 A;  1SH2 A;  4GVB B;  1SJ3 P;  1SKS A;  2OPR B;  4DL2 A;  2Z57 B;  3MTK A;  2BXJ A;  4F8R A;  2ZE2 A;  2B56 A;  1R8C A;  3FFI B;  1RLD A;  3CD7 A;  3GP9 A;  4GKK J;  4C8M A;  1RTD B;  2BQU A;  2AU0 A;  1RU1 A;  3OL7 A;  4ANE A;  3UWT A;  1KC8 T;  1S7I A;  2MZR A;  4OJ3 A;  5EWF A;  1VK3 A;  5LMN J;  5MLC V;  4KB7 A;  1UPM B;  2OSR A;  1FI4 A;  1HBO B;  2RE1 A;  5KG3 A;  2HQC A;  4LR8 A;  4YS2 A;  3QO9 A;  1FNO A;  3T3F A;  4LMZ A;  4X4O A;  2M88 A;  4OX7 A;  4F4Y A;  2OSQ A;  1QY7 A;  3GFX A;  4RNM A;  1R0C B;  2AEJ A;  4LIW A;  4G6V B;  4I69 A;  4N56 A;  5AXK A;  5LSL A;  1HBM B;  5DG9 A;  1Q8I A;  4NLY A;  3ZZZ A;  1Q7L B;  1JLF A;  4ZVE A;  3GCX P;  3DC2 A;  2ADC A;  2W4P A;  1S1V B;  1RIS A;  2VQF J;  1DY3 A;  4O3R A;  2HNY B;  4J9L A;  3O6Q A;  3PKY A;  3HVW A;  1NLK L;  2GGP B;  2VG6 A;  5ETP A;  3TZW A;  2MZ1 A;  1KS2 A;  4HAC A;  4EU0 A;  2ZBR A;  1GTH A;  2V69 A;  1SKR A;  2F5G A;  4JI7 J;  4NRU A;  1UZD A;  1XTZ A;  3KLI B;  5DLF A;  1X5S A;  2BM1 A;  4CT8 A;  3TW0 A;  3ZTP A;  2B8P A;  5J1E A;  1VRQ C;  1RTI B;  3H4B A;  3UCU P;  4DV1 J;  4YOE A;  1FER A;  4L3N A;  3AD8 C;  3T5K A;  3ZXW A;  3TO8 A;  2DNP A;  2QA2 A;  1NK7 A;  2EW9 A;  1H38 A;  4QZV B;  4OX9 J;  1N88 A;  4KT0 C;  5HBM B;  3MR6 A;  4B3T J;  2PMZ D;  3B6B A;  2UXB F;  5J2N B;  1CJU B;  5FDL A;  2QN6 B;  2ZM6 J;  4HYK A;  3OV7 A;  3AD7 C;  2BE9 B;  2UVW A;  3QT5 A;  1CUL A;  4DL3 A;  3D68 A;  1X4A A;  5KG1 A;  1RT5 B;  4JI6 J;  4MH8 A;  4ZJO A;  1KOH A;  4NLQ A;  4QQB A;  3P6Y C;  2HLU A;  2AZ3 A;  3M30 B;  3MMA B;  1E6V B;  2ZOG A;  2C3Y A;  4DV4 J;  5IM0 A;  1EKS A;  3GYG A;  1WKJ A;  1HA1 A;  2JZ5 A;  2PEB A;  2G2Z A;  4TQR A;  4NYP A;  1W26 A;  3V4I B;  1TL1 B;  2XM3 A;  5IXU A;  3DDK A;  2I38 A;  4B9N A;  2XMK A;  1EX8 A;  2CPI A;  4EYH B;  2VG5 A;  2D3O 1;  5C7P A;  3U1M A;  1LQ9 A;  3M8P B;  1GMW A;  5HMY A;  3RBD A;  2LMI A;  5CH7 B;  3FSX A;  4A8Y A;  1RA6 A;  2OH2 A;  5ETR A;  3NOG A;  3E01 B;  3MPD A;  3QAE A;  2Z2Z A;  3J7A N;  2AP6 A;  3DLE A;  2B9W A;  4EZ6 A;  4NCB A;  1I3O B;  2XZD B;  1SV5 A;  1YZ6 A;  3W2W B;  2LA4 A;  4ZHR B;  3NKY A;  1FK9 B;  2CAJ A;  2DNM A;  1ZM3 A;  1K47 A;  3N9U C;  2IC3 A;  2VFV A;  2RQC A;  2K2P A;  2GQ2 A;  2FIU A;  4M5N A;  1FX4 A;  3FRY A;  2MGZ B;  5JUM A;  1R3N A;  1NK9 A;  1S77 D;  4FPR A;  2OTL S;  2R8G A;  4RUA A;  3SFG A;  4X62 J;  3LW5 C;  1G1X A;  1HI0 P;  2RU9 A;  4ELT A;  1UFK A;  1ZET A;  3OTO F;  3W7B A;  3FCV A;  1SH0 A;  1NKC A;  3CCM S;  3C15 B;  2ATC B;  4USH A;  1VK8 A;  4ILR A;  4TN2 A;  1GMW D;  1HNZ J;  3C14 A;  2ZFH A;  3BGR B;  2RHS B;  3ZZO A;  3M2V B;  5L1I A;  2XI3 A;  4QWE A;  4DPT A;  4KPC A;  4CLW A;  4FYY B;  4AL7 A;  1MRO B;  1JJ2 R;  3QLH A;  5F3T A;  5IT0 A;  3DGP A;  3TX0 A;  4GKJ J;  1P8G A;  1REV B;  3FUY A;  2R42 A;  4RR5 A;  2KTQ A;  1EJ7 L;  1MU2 A;  1TMM A;  3NG8 A;  3KG4 A;  2GIF A;  4YB7 A;  3CE8 A;  1O0P A;  2OMO A;  1OQ3 A;  1NU4 A;  1YK9 A;  4AND A;  3L4B C;  2Q79 A;  1BQM B;  3MXH P;  5DRK A;  4JI5 F;  4DX5 A;  3KYL A;  2YVS A;  1T05 B;  1V3R A;  1M5S A;  1TK8 A;  1U7L A;  4UZC A;  4WE1 A;  3VVT A;  1PSD A;  1N52 B;  5I3P A;  1RCO B;  2MDA A;  3IWL A;  1S9G A;  2G9O A;  1JK9 B;  3CJK B;  4RNF A;  4CP5 A;  3LWL A;  4R8U B;  4C6A A;  2XWX A;  1WG4 A;  1JLE A;  5K8O A;  1GT8 A;  2MQN A;  3PRV A;  4KGK A;  5HAN A;  5I3U B;  5EWE A;  2U2F A;  5LSO A;  4NI2 A;  1I94 F;  2FJB B;  1FO1 A;  4XDC A;  2DGV A;  3JSM A;  5F0U A;  5B08 A;  1VQ4 S;  2YPY A;  5A0Y A;  2C2D A;  1Q8L A;  2JLE A;  2KHD A;  4I64 A;  2W4D A;  3OR2 A;  5AT1 B;  1DQA A;  3QIP B;  3SCK E;  4C8O A;  1LXJ A;  1Y11 A;  3DMJ B;  3RYL A;  2DNO A;  3IBF B;  4DWI A;  3UD5 A;  5C42 A;  1RWM B;  3VAJ A;  4K59 A;  5D0R A;  2XC9 A;  1GEH A;  4YDD B;  2C3P A;  3SQG A;  1XN9 A;  2Q6B A;  5SZT A;  1ULR A;  4AQY J;  2B4P A;  5L9N A;  3JXO A;  1YJU A;  3JYT B;  3N6L A;  1VIX A;  1PBU A;  4CYU B;  1T3N A;  1K0V A;  4PAB A;  2CQH A;  3HMJ G;  1RWV B;  2AMC B;  3PR4 A;  5B7W A;  1RT7 B;  2FGO A;  4Y00 A;  1VHI A;  4F2S A;  3WX8 A;  4CLL A;  4U8V A;  4Y2K A;  1HNI A;  1HQU A;  2GS8 A;  2AIR B;  4FNH A;  4ED0 A;  4ZJQ A;  3UNY A;  2QV6 A;  1U49 A;  4ZJL A;  4ETX A;  2AJQ A;  2WB4 A;  2HK2 A;  4OJH A;  1JLA B;  3I32 A;  1HYS A;  4LF9 F;  4PQA A;  2UXD J;  2YX7 A;  4Q2M A;  4Y2C A;  4CNZ A;  3MCM A;  2JEJ A;  1NRK A;  4ED3 A;  1KON A;  1RT1 A;  1SCJ B;  1YIT S;  2WAQ D;  2ZIT A;  4NA2 A;  2AJ4 A;  2K3K A;  3DRX A;  3SSS A;  1KHV A;  4TU8 A;  3IWN C;  4IG0 A;  3WC0 A;  3FNN A;  1SPB P;  2NS1 B;  4CIO A;  3JAM U;  3M9M B;  2FD2 A;  1TFW A;  1IQZ A;  2G2Y A;  3LPE A;  3SMZ A;  2MZQ A;  3AQO A;  3NGU A;  2XCA A;  2FYX A;  4BS2 A;  4DBQ A;  1LWE B;  2KH9 A;  2HVZ A;  2ZBQ A;  2DNZ A;  2CQD A;  1DQ8 A;  2HG4 A;  3HKW A;  1A0O B;  4OYW A;  2C2E A;  4IR9 A;  1IJF B;  3V6D B;  3LAL A;  1KVJ A;  2CQP A;  3R5G A;  4PUO A;  1Z1Z A;  2YY3 A;  5A8R B;  2AEF A;  4HT7 A;  3DCA A;  1QAJ A;  1JIH A;  5GAD U;  3EVM A;  1IBL J;  1Y5N B;  2K06 A;  2KFN A;  2QX0 A;  1MMN A;  2RSQ A;  1UTA A;  3D3C J;  2NZ4 A;  3IG1 A;  2IRY A;  4U9R A;  5CAB A;  3O1L A;  2CPY A;  3UR3 C;  1UJ4 A;  4USJ C;  1HD1 A;  4FF1 A;  2CPH A;  4RUC A;  2OEJ A;  2BAN B;  5KFR A;  4RZR A;  4CI0 B;  4DR2 J;  4RW9 A;  1U47 A;  2IAJ A;  3K89 A;  4NLG A;  1VGY A;  1YI2 S;  1ZM9 A;  3NCR A;  2P6T A;  2LEB A;  1SC1 B;  2YNG A;  3JSR A;  2XLI A;  4UQG A;  2MY7 A;  4R0E A;  3PYG A;  3G8T A;  1EB0 A;  5IQQ A;  4UUX A;  2R3V A;  2UUT A;  4B08 A;  1IM4 A;  2KXF A;  1T8E A;  2HBQ B;  3KLE B;  3QJP A;  5AXL A;  2DHH A;  1T03 A;  4C7Q A;  3GR1 A;  1ZA2 B;  1NO8 A;  1Q0N A;  1FRJ A;  1M5H A;  4O0I A;  4ICL B;  2XNR A;  4WFY A;  1IKX A;  2CFX A;  5CYJ A;  2DIT A;  1ZM4 A;  3I82 A;  3SFU A;  4DQI A;  1T0T V;  1NJW A;  4B3R J;  2RD5 C;  2BQ3 A;  1EP4 A;  1LWF A;  5KFQ A;  4E0D A;  2V4J B;  3DRR A;  3LAN A;  2G0C A;  1I1G A;  1S0M A;  4BLG A;  5B0C A;  2DPI A;  3R2C J;  2Q3P A;  3OT9 A;  1S1T A;  5K8N A;  1S6O A;  1CJV B;  1HI8 A;  1KLM A;  2VDI A;  3E8O A;  4L74 A;  3LH2 S;  4LF5 F;  2KHC A;  4N77 A;  2B9Y A;  3V6H A;  1X9M A;  4CH7 A;  1Q53 A;  3KKF A;  3FBB A;  4DV7 F;  2MST A;  1XMO J;  3DGV A;  1LW2 B;  1S49 A;  4GKK F;  3HHE A;  2ZZT A;  1V5V A;  3KK1 B;  3MM5 A;  1EHW A;  5GME A;  4IH6 A;  2FHM A;  3DHX A;  3VF0 B;  4TYA A;  3PHE A;  1S5Z A;  1RAB B;  1KBR A;  2WON B;  3ICL A;  3Q24 A;  3DM2 A;  4FKX A;  4LRC A;  2YWK A;  3PYE A;  1S6P A;  3GB0 A;  5FII A;  4DFM A;  4V19 J;  3W61 A;  1QJH A;  4M1K A;  2GCF A;  4CNY A;  4B3M F;  2R2S A;  4QR2 A;  3EGZ A;  4IG3 A;  4DV3 F;  3NGK A;  1HWU A;  2AJF E;  1VQK S;  2R7R A;  2ILY A;  1QAY A;  1FA0 A;  5K8P A;  4WXW A;  2XO7 A;  3V6J A;  2RDI A;  3PYD A;  1CJT A;  1N34 F;  4FYD A;  2CG8 A;  1FJG J;  3PV8 A;  2CPX A;  2BDP A;  4MKY A;  2DNK A;  4TYB A;  3AB2 B;  3VAK A;  2CJX B;  4QBU A;  5A6P A;  2IHR 1;  5E2Q A;  4Y2M A;  2CQ0 A;  4DFJ A;  4EZ9 A;  1JLG B;  4NZ6 A;  3SV4 A;  3MM6 B;  2Y1J A;  3MEC B;  2J6S A;  2UUW A;  5T41 A;  5ETQ A;  3MEE B;  2GVZ A;  2XSF A;  5K8M A;  2DHG A;  1PC5 A;  3CJ3 A;  4DI6 A;  2L41 A;  3KUE A;  1XIQ A;  1BWV A;  4TY8 B;  1R89 A;  1NKE A;  4OHX A;  5LXY A;  1NPR A;  3BGL A;  3G9C A;  3D28 A;  1O5J A;  4RU2 A;  3T6J A;  4ZP7 A;  4F4W A;  2DO4 A;  1NPP A;  2FVS A;  4C8Z A;  5KFB A;  4OYI A;  2XGP A;  2O1P A;  4GMK A;  4CT9 A;  2KYX A;  3HHL B;  1X5O A;  3CJR A;  2X1F A;  3BSO A;  3ISN C;  3MAA A;  2FY8 A;  1V5I B;  3U27 A;  3IXQ A;  1FES A;  1ZPV A;  1MML A;  3QT8 A;  1KLN A;  4MYT A;  4IFV A;  3QWP A;  1PJ7 A;  3LA0 A;  4MFB A;  1NM2 A;  1N32 F;  3HFK A;  5JVH Q;  2CXE A;  4LSL B;  4EBC A;  2XY6 A;  2QGF B;  1LK7 A;  1F6T A;  2IM1 A;  4LF6 F;  4PPD A;  3D54 A;  4RWW A;  4DR6 J;  3SYZ A;  1DZ5 A;  4DCJ B;  2DJW A;  2NR0 A;  2VH7 A;  1YBA A;  2ACM A;  1KQG B;  1FD8 A;  1RT2 B;  3P8B B;  3DRS B;  4R0J A;  3W62 A;  4P2S A;  3KDN A;  1EQ0 A;  3HSD A;  3Q89 A;  2D3O R;  3R6G B;  5A8K B;  1IKY A;  1XQI A;  1MWZ A;  2XMT A;  5DG7 A;  2YQ0 A;  3S6E A;  3G96 A;  1TAU A;  3UN3 A;  3KLF B;  4ZVU B;  5KFZ A;  2ZH4 A;  1X9S A;  2BX6 A;  2GIR A;  4PQU A;  2A2C A;  2K8G A;  2XI2 A;  3GE9 A;  3HSG A;  3T9N A;  4C97 A;  1VQS A;  3BN4 A;  3G6Y A;  4Z37 A;  2HYI B;  1UVM A;  4F3M A;  1RWK B;  4Q8E A;  1WG1 A;  3Q2S C;  3W8G A;  3QRP A;  3H5X A;  2VQE F;  4KGX B;  2R8K A;  1RTH B;  4BBY A;  2FVC A;  4URS A;  2YWE A;  1PC4 A;  2BEF A;  4C8K A;  3GCW P;  5DO2 A;  1JB0 C;  4RNH A;  2XS5 A;  3OTC A;  4DL6 A;  5CXT A;  1JLB B;  1HLW A;  3FBC A;  2JH3 A;  3OSN A;  4FBT A;  1TK0 A;  3J7Z T;  3R5B A;  2W2N P;  4BWM A;  4DL5 A;  2V34 A;  1OMS A;  2AV5 A;  2N7C A;  3UD4 P;  4KFB A;  3DOK A;  1RK8 A;  3MI7 X;  4YP3 A;  2WVE A;  1D09 B;  2GMJ A;  2RVJ A;  4HKQ A;  3VZI A;  4GVB A;  4X66 J;  2YX4 A;  2V94 A;  4EGL A;  2R8H A;  4LFB F;  2OPR A;  2LU1 A;  2IYG A;  4FYV B;  4CRJ A;  2KZM A;  1H0H B;  2Z56 B;  4ZVH A;  4EUV A;  2AYB A;  3KHG A;  2CPD A;  1RTD A;  3MM9 B;  4WP9 A;  2CRL A;  3G8S A;  3EMT A;  4NCG A;  3DN9 A;  3OD2 A;  3U1L A;  4W4M A;  2RKI B;  3A3P B;  3TRG A;  2QSW A;  3VZH A;  3RBX A;  3SI8 A;  1HBO A;  4RX6 A;  1M5P C;  4C8N A;  5IS2 A;  1KWM A;  3UDC A;  4OYO A;  4K4T A;  2C2Z B;  5KTQ A;  3I5A A;  2DEJ A;  5ETL A;  3RR8 A;  1A9N B;  4HR2 A;  5KFU A;  1NHV A;  1S1X A;  1HBM A;  5KT4 A;  2HS0 A;  1W7W A;  4FP9 A;  3K58 A;  3PW0 A;  2E7X A;  1A7G E;  2VFR A;  2G1D A;  1U0H B;  1UJ5 A;  1FVQ A;  4KKO B;  1S1V A;  2EG2 A;  2XTJ P;  4I2P B;  3VHQ A;  1XK8 A;  2J5A A;  2B8Q A;  3HK2 A;  3TAQ A;  3ZZR A;  2GGP A;  1I51 B;  2B4U A;  5F0W A;  1F60 B;  5I42 B;  4AQY F;  2NYI A;  1HR0 J;  1WG5 A;  5KG7 A;  4FF2 A;  3QNW B;  5RUB A;  4P52 A;  3CJ5 A;  2BRL A;  2GA7 A;  1UWB A;  4NLX A;  2Q66 A;  3GSI A;  4Q45 A;  2DH8 A;  4IH7 A;  4C11 B;  1RTI A;  1JKH B;  2RQM A;  2X1G A;  3O8W A;  4IFY B;  5C2G A;  5J1N A;  2CQG A;  4PR6 A;  2IRU A;  1R43 A;  2VUG A;  4QW9 A;  3UDL A;  3K0J A;  3HFZ B;  2Z2M A;  1U8S A;  2GMH A;  1D1U A;  2C2N A;  5HBM A;  2DR6 A;  2ZWO A;  3TUJ C;  3EZO A;  4PWD B;  1FKA F;  2CA9 A;  3M6U A;  5J2N A;  1Y00 A;  2EFG A;  1CJU A;  2KT3 A;  5IV4 A;  5DET A;  3J81 j;  2LU2 A;  1VLY A;  2HRU A;  1U1K A;  2NSC A;  1RT5 A;  3PX6 A;  2DNG A;  1FFW B;  1IUJ A;  3OL6 A;  2DHX A;  4M63 A;  2EFO A;  1BY9 A;  1VC6 A;  3M30 A;  3MMA A;  4J9R A;  1E6V A;  2XUL A;  5LXR A;  2ROP A;  4YB5 A;  1FDB A;  3LO3 A;  3QWU A;  4U96 A;  1WDD A;  3V4I A;  2KL8 A;  2CJQ A;  1TL1 A;  3H25 A;  2QIF A;  3I0S B;  2W7A A;  3NMA A;  3OVA A;  1T9U A;  4DPO A;  1PIL A;  3P96 A;  4CO0 A;  2KFZ A;  4UOH A;  3M8P A;  2FHK A;  1VBZ A;  3CMQ A;  1UA1 A;  1QE1 B;  1FEE A;  3ILO A;  4NZ0 A;  3HVR A;  4NA3 A;  2VPW B;  3E01 A;  1TKD A;  1SIW B;  3OXL A;  3P49 B;  2X1B A;  5IOL A;  4O23 A;  5KT7 A;  2XYH B;  4F02 A;  2ZKT A;  5IWA F;  5U47 A;  2M9K A;  3W2W A;  2IIH A;  2MKS A;  4ZHR A;  4N41 A;  4J9N A;  1Y0H A;  2ZD1 B;  1NME B;  3M2U B;  1FK9 A;  4B9M A;  2VBZ A;  2OD6 A;  2HGL A;  3GJT B;  2C3M A;  4Y6I A;  4ZPT R;  4URG A;  1WC5 A;  4A8M P;  4IRD A;  3POT B;  1QSY A;  3CCS S;  2I6W A;  4DV2 F;  2C2R A;  1UVN A;  4NXM F;  2HFO A;  2KG1 A;  3C15 A;  2C1E B;  2ZDO A;  1NDK A;  3R7N B;  1N33 F;  2BZ2 A;  3BGR A;  2J9C A;  1KFD A;  1HBN B;  3M2V A;  2NSB A;  2O3D A;  4ZVP B;  4MK8 A;  2VG6 B;  3PW4 A;  1MRO A;  1RT3 B;  2A18 A;  1XNR J;  3PTW A;  4QYZ K;  1GX6 A;  1JNR B;  3OTD A;  3AHP A;  3UW1 A;  2BYC A;  3CCJ S;  3KJV B;  2LDI A;  1FTR A;  2H3E B;  4OL8 A;  1MN9 A;  1L3V A;  4B3R F;  2FJA B;  3MR3 A;  1CLF A;  3S8S A;  3PAC A;  1BLU A;  5J2M B;  5FLX U;  1BQM A;  1W2B R;  2IJN A;  3IAS 9;  1T05 A;  4LF7 F;  3HCX A;  3W66 A;  5E3R A;  4JI2 F;  2DRD A;  2V5H G;  1VQ7 S;  2VOD A;  2DNN A;  3JQJ A;  3AJD A;  3DYA B;  4P10 A;  3SQO P;  2XYP B;  5HN0 A;  4WJB A;  1CUL B;  3A1Y G;  3CJK A;  2YKQ A;  4R8U A;  2RF2 B;  3FBF A;  3ULH A;  4HDH A;  5I3U A;  4L75 A;  2B9E A;  4ED8 A;  3BV8 A;  3KXD A;  2H9Z A;  2UU9 J;  1R0B G;  2VFT A;  2J6U A;  3I4P A;  3TJ8 A;  4IO1 A;  3BYP A;  1HBU B;  4DPW A;  1T9X A;  5AE3 A;  1SQF A;  4DX7 A;  1VRT B;  3TZY A;  3DMJ A;  2QG9 B;  1R31 A;  3NP5 A;  3WIU A;  1WF0 A;  3TNV A;  2W24 A;  2EI5 A;  4TQS A;  4OZ1 A;  4N7T A;  2ZOM A;  1VQL S;  1S7H A;  2ZH2 A;  2DR5 A;  2J8S A;  4MIW A;  3JYT A;  5DLG A;  1S4F A;  1WSV A;  3BEG B;  5ETS A;  1U45 A;  4Q8F A;  2XMM A;  2W2P P;  3KHL A;  3PKM A;  1X0F A;  1RT7 A;  1E6Y B;  4HHH A;  2WW8 A;  3VVU A;  4YUD A;  2HQI A;  1LW0 B;  4IUF A;  3RTV A;  2AGQ A;  3KLG B;  4WFZ A;  5F8M A;  2RUG A;  1CPZ A;  2MQL A;  1B7Y B;  2HHP A;  4OZN A;  2HQ3 A;  1N56 A;  4M5M A;  1PYT A;  4ZMM A;  2VHG A;  1EET B;  3OJS A;  2BJ8 A;  3ISZ A;  2QLW A;  2CQC A;  4ZVO B;  2I1R A;  3SXL A;  2LFV A;  2ZNZ A;  5EDW A;  4DV6 J;  3KJF B;  4R5P B;  4JYA J;  2AEM A;  3M8Y A;  2GHW A;  2BM0 A;  4E98 A;  2AYG A;  4QIE A;  3QLH B;  3RB6 A;  4IH5 A;  4KQZ A;  5MAO A;  3K2Y A;  2UVU A;  1RCX B;  1J5E J;  3NWR A;  2JEG A;  2OO4 A;  4Y3C A;  4YR0 A;  2KT5 A;  2QSF A;  4NYO A;  1DRZ A;  1YJR A;  4TY9 A;  3ADA C;  3N5B A;  1OY6 A;  1LWE A;  4P6Q A;  2FVP A;  4F26 A;  4CO3 A;  5E3P A;  2IBK A;  3HPO A;  1HNX J;  4M5D B;  3H0P A;  3R8Y A;  4C8Y A;  1J27 A;  2GAH C;  3OLB A;  2ZH6 A;  2QEX S;  3ZTR A;  1H72 C;  3IC1 A;  3C66 A;  2CJB A;  3NGD A;  3KK3 B;  3B78 A;  1N5V A;  4KHR A;  2LVW A;  2FUG 9;  1S9G B;  1ICE B;  2GV1 A;  1TUV A;  3W9H A;  3ZZT A;  2ZWP A;  2WW4 A;  1RB0 A;  2YKN B;  1VDH A;  2CWX A;  1U26 A;  3J80 Y;  2YXL A;  3M32 B;  2KG0 A;  3AJ1 A;  1QSS A;  4QU7 A;  1QVF R;  4DL0 C;  4PAA A;  3TA1 A;  3QAT A;  4N5S A;  1OPI A;  4UQT A;  5B09 A;  3IM8 A;  1OWX A;  2MMY A;  3HKZ D;  3UNG C;  2HWH A;  2JLF A;  2AX0 A;  4YB6 A;  1N6Q B;  3RRH A;  4RW6 B;  3I4H X;  2NPF A;  4EI2 A;  3B8H A;  1ELO A;  2VA3 A;  5G0R B;  2HWI A;  5C42 B;  1VQP S;  2C2O B;  1AA1 B;  3KDO A;  3OUY B;  3RAX A;  4AD6 A;  1WOP A;  4JV2 A;  3KLE A;  4RWX A;  1NDL A;  1KTV A;  1N36 F;  1FFS B;  3H5U A;  3CJT A;  5ETK A;  5J2P B;  5DDR C;  4ICL A;  1DJ0 A;  2X3G A;  1IXK A;  2HIQ A;  2LQJ A;  3BO2 A;  5LM7 E;  3SIP B;  4DUY F;  3KMS A;  4BWJ A;  1UAW A;  1F5A A;  5KG0 A;  2MKJ A;  4ZVG A;  2W9A A;  1C1B B;  1CQN A;  2XHC A;  2V4J A;  4CQ1 A;  4O3Q A;  1RTJ B;  3M1V B;  2ZNY A;  1U1M A;  1LK5 A;  2ZH9 A;  1QD1 A;  2UXB J;  3EDR B;  4DS5 A;  2XLJ A;  2ZUG A;  5D3G B;  5KFV A;  1NHK L;  3FQL A;  3RAQ A;  3TUP A;  1Q5Y A;  3GR0 A;  5ETM A;  1V3Z A;  1WEZ A;  5IT9 Y;  1LW2 A;  5KFG A;  1S57 A;  2DY1 A;  2CZ4 A;  3GIL A;  3HO1 A;  1TVR B;  3KK1 A;  2UUC J;  2F1F A;  1HWJ A;  1R8H A;  4C3K A;  4Z7C A;  3QID A;  3D67 A;  2BE2 B;  3CJ4 A;  2WON A;  4KRW A;  1WHV A;  1GTE A;  2ZEJ A;  5EGY A;  1CBK A;  2ZH7 A;  4X4V A;  4JI0 J;  1FDD A;  2J0W A;  2BKO A;  1U1L A;  2J7W A;  1GNK A;  2QA4 S;  4ZN3 A;  5EN1 A;  4A8S A;  4OJ1 A;  2E44 A;  4RLE A;  4AL6 A;  1UFL A;  4N47 A;  5KT3 A;  1FCA A;  1TKZ A;  2QT7 A;  3PO4 A;  1F2G A;  4QWD A;  2QL5 B;  2HND B;  2XWY A;  2Z2L A;  2B6A B;  5J2Q B;  4ZP9 A;  3L7U A;  1RE1 B;  4CM0 A;  3EDQ B;  2RIJ A;  3NS6 A;  4MKV A;  5ETO A;  1JLG A;  3MM6 A;  3N4W A;  3ENV A;  1VCT A;  1YBT A;  2IVY A;  3MEC A;  4OYX A;  2JFK A;  3MEE A;  3FJ2 A;  1KQK A;  1WC3 A;  2N3O A;  1M1G A;  1U1P A;  2HHQ A;  4DCO B;  3I96 A;  1SL0 A;  3NMR A;  3AT1 B;  4LRD A;  4TY8 A;  3KNA A;  5ETV A;  2QMX A;  3UN5 A;  3OTO J;  2JDJ A;  4PWW A;  1S9F A;  2V8G A;  3NCQ A;  5T14 A;  2AT1 B;  4O3N A;  5IC4 B;  3BR9 A;  3ILL A;  2BBE A;  1OS5 A;  4OV1 A;  4DR1 F;  3CC4 S;  4ECX A;  4ZCK A;  1N5S A;  1N5Q A;  1KQF B;  3RJM B;  2HAF A;  3TAP A;  2R7Q A;  1KQS R;  3HHL A;  2KXH A;  2F9J A;  2FJE B;  2AZ1 A;  3M8Z A;  1VMB A;  3VR1 A;  4NLP A;  1IKX B;  4OHZ A;  4NLR A;  3QRQ A;  1AT1 B;  4O4G B;  4C98 A;  4QWA A;  3IBC B;  2VBY A;  2HEK A;  2YKP A;  3DDN A;  4ECU A;  1OYD A;  2HQG A;  3M4X A;  2Y3Y A;  1LWF B;  1FXR A;  1M5K C;  2W4C A;  5CD4 A;  2H5I B;  1Q82 T;  4G3I A;  4LSL A;  1KKH A;  4DLG A;  5KFC A;  1UKU A;  3A8K A;  2KM8 B;  2LA6 A;  4FF4 A;  5KG5 A;  3UI3 A;  2L08 A;  1NK6 A;  1YG0 A;  5CD4 H;  3EPG A;  4OZ2 A;  2P2C B;  3GV7 B;  1U1O A;  1RT2 A;  1SKU B;  2B5J B;  2ZC3 A;  3BPS P;  2WTF A;  4G1Q B;  3ONQ A;  2WB1 D;  2O5D A;  3ETO A;  5M2U A;  1KR4 A;  3M6W A;  1RGV A;  1NJZ A;  5A8K A;  4I68 A;  1TTH B;  2E1C A;  3SSQ A;  1Q5V A;  1XEZ A;  2JNJ A;  5HAT A;  1Y7P A;  2MLX A;  1I94 J;  2E29 A;  2MHN A;  2OPQ B;  4B9V A;  3DLG B;  3KLF A;  4JI3 F;  3LP1 B;  3CF5 Q;  2RRN A;  4CLP A;  3PFO A;  4AXI A;  4JI4 F;  1NZA A;  5JMN A;  4HDG A;  3Q8R B;  3I9Z A;  2L9D A;  2BR0 A;  4Q0B B;  4GC6 A;  3NNH A;  4QOT A;  3IR7 B;  3RRK A;  3JQM A;  2PMH A;  2OML A;  2M3D A;  1UET A;  1C4C A;  3G4S S;  2FJW A;  4WP8 A;  2KU7 A;  4MAK A;  1PYO B;  3D6M B;  3V4M A;  1RTH A;  4ED7 A;  2OKQ A;  1WTF A;  5B0E A;  2PMW A;  5IFM A;  3CMA S;  3G86 A;  5GMK a;  1MG7 A;  1AFI A;  1R7I A;  1YJT A;  3M8S A;  2H4Y B;  1JLB A;  1XER A;  3RG6 A;  2ASJ A;  2HFS A;  1AUS L;  3LAM A;  2VAS A;  3LAK A;  2VIH A;  1I5O B;  4OI3 A;  2IFX A;  4LRF A;  3SBM A;  3T1H F;  4LBP A;  3MOZ A;  2GVZ B;  4OYA A;  3AXK A;  3PIP Q;  2VZ9 A;  2OPS A;  3A12 A;  2WVD A;  1YJW S;  2NZC A;  1SC6 A;  4LF9 J;  1P1L A;  2OI2 A;  4JOU A;  2FLN A;  1O8B A;  2B3T B;  4CO5 A;  2HMI B;  2VV5 A;  2N82 B;  3HZE A;  3H2L A;  2X1A A;  9ATC B;  1W2I A;  3SCL E;  4PXC A;  5F9N A;  1OPZ A;  3MM9 A;  2ADB A;  3IFE A;  4WTO B;  4H4K A;  2XMW A;  2RKI A;  2OGU A;  3KG1 A;  2GJ2 A;  4B9T A;  1G2E A;  1UVK A;  2NXN A;  2CJY B;  3FCH A;  2V9K A;  4DFP A;  3A8I A;  2Z2Y B;  2MQO A;  4A8O A;  2OFH X;  4KTQ A;  5KOX A;  2GZO A;  6AT1 B;  3CJ0 A;  3AOB A;  4PWU A;  1TUW A;  1LFW A;  4OYZ A;  1ZS6 A;  1FEH A;  3AY0 A;  3D4J A;  4DEZ A;  2UUB F;  1MW7 A;  2HFN A;  4OYP A;  1U0H A;  1UJ6 A;  4QIF A;  2AW0 A;  1SJR A;  4KKO A;  4I2P A;  5HK4 A;  4K5S A;  1WOO A;  4X4Q A;  5C5J A;  2LEA A;  4QYR A;  4CLY A;  2CQ3 A;  1HQE B;  4D3G A;  2HHW A;  4LFC F;  2YWG A;  4D3H A;  3H59 A;  1X5P A;  5I42 A;  1BQX A;  1C0U B;  3VQT A;  5LSR A;  1V3S A;  5THW A;  4WBF A;  2UXC J;  2HZC A;  1LXN A;  4L6V 3;  2HFV A;  4X4S A;  4C11 A;  1X4H A;  4IOA Q;  1JKH A;  4LBI A;  2VA2 A;  4DZ6 A;  4IFY A;  4C0B A;  2KKH A;  2ZBI A;  2V2V A;  1LKZ A;  2F7V A;  5CYM B;  5CQG A;  3IRW P;  4J9S A;  2ZOF A;  4RBU A;  1QAX A;  5A2Q Y;  1RYS A;  1DTT B;  2QZ8 A;  1DHM A;  5HJY A;  1S9E A;  3K59 A;  3KK2 B;  4DR7 F;  4PWD A;  4I7F B;  2XMV A;  2ERR A;  4ALZ A;  5CZX A;  4C0O C;  3GTY X;  2CAD A;  2AWZ A;  4ZIV A;  1OY9 A;  4J9V A;  3I0R B;  3OPK A;  1UFW A;  4DUZ F;  3F73 A;  3CCU S;  5KFK A;  2MJN A;  1FWP A;  5GAG U;  1N8R T;  3BM7 A;  4KAI A;  2E1M C;  5HVH A;  2E7V A;  5E5N A;  2YQ3 A;  5F9L A;  3RAM A;  3DRP B;  2AHO B;  4F36 A;  4EEY A;  1WWH A;  1Y5I B;  5F8H A;  1RDR A;  3G6X A;  3I0S A;  4A8X A;  1K44 A;  2FLO A;  2ZVS A;  4LF8 F;  1G3O A;  3NAI A;  3HSJ A;  4LF5 J;  2KM8 C;  4DV0 F;  4UZB A;  1NHU A;  5F8I A;  3DFE A;  4WK1 A;  1QE1 A;  1U8W A;  4HT5 A;  4BHQ A;  4DV7 J;  5L1L A;  3H20 A;  3QGG A;  2GML A;  1LNQ A;  1Z4U A;  2DB1 A;  3I9V 9;  4NCG B;  5KFP A;  3W3S A;  3D6H B;  2I0X A;  2ZD1 A;  3M2U A;  1X9W A;  3HXM A;  4UW2 A;  4PG6 A;  3UDV A;  3ZNU A;  1B3T A;  2MY8 A;  3GYX B;  1LWC B;  3FEX B;  3RBE A;  2MZT A;  2F8M A;  2ZZN A;  1GMV A;  3BGF A;  4B3M J;  3POT A;  4DV3 J;  5GAH U;  4KY3 A;  5L8R C;  4EBD A;  2WVC A;  1S1X B;  2Y0B B;  5F8J A;  5C25 B;  3ETM A;  3KTQ A;  5B0D A;  4GRS A;  1PG5 B;  5IC6 B;  4IQX A;  1N34 J;  3CME S;  1T9T A;  3AD9 C;  3DHW C;  4PXE A;  4LSZ B;  2Y8W A;  3GIM A;  4NLD A;  2VBX A;  4NL5 A;  1HBN A;  2A10 A;  4DOZ A;  4IYQ A;  4PG4 A;  2B43 A;  4C3M A;  4O4R A;  4C0H A;  4NLS A;  3BB5 A;  4LIR A;  2F4F A;  1RT3 A;  2YNI B;  2L3M A;  1OYE A;  1APS A;  4ZLN A;  1HW9 A;  5FD1 A;  5HMW A;  4J9O A;  2G4B A;  2UV8 G;  2H65 B;  4DSJ A;  1IQT A;  4HH0 A;  1UWB B;  2IM0 A;  2OEK A;  3DRY A;  5F41 A;  4RKU C;  2F8E X;  3KJV A;  1GXU A;  3OLA A;  2W8K A;  3MEG B;  4ANC A;  2BAB A;  1C0T B;  5J2M A;  1FKP B;  3RBZ A;  3A3O B;  4B9S A;  1D9F A;  2GNK A;  3HVT B;  2BA9 A;  5GAD I;  2ABY A;  4DMZ A;  2NCK L;  1RHR B;  3TAM B;  3CDE A;  4CLS A;  2XZT B;  4C4W A;  1OY8 A;  4PKD B;  3LP2 B;  4JV5 F;  3Q0A A;  1U1Q A;  5D15 A;  4OHW A;  3DYA A;  4WKY A;  4DR4 F;  1KSP A;  4OYM A;  4BC7 A;  3ILI A;  1WEY A;  3PIO Q;  5DJB A;  4RW7 B;  2RF2 A;  1M0S A;  3MD3 A;  1NPK A;  3G6V A;  2DT9 A;  1RUS A;  2NXJ A;  2WVB A;  1KP6 A;  5DM7 Q;  2E1A A;  5L1K A;  1WSR A;  2I2Y A;  2VIC A;  2VF3 A;  1SJ4 P;  2UUC F;  5D4L A;  4K4S A;  1G7C B;  1F0X A;  1X7V A;  1N32 J;  3TVZ A;  1UVI A;  1HBU A;  4LF6 J;  2CYY A;  1Y3K A;  2BRK A;  2G13 A;  3GPA A;  3ILJ A;  5F8N A;  2E5L F;  2BOP A;  1VRT A;  4C8L A;  2JL9 A;  2ASY A;  3T9Z A;  4JI0 F;  4ZVS B;  1X31 C;  4XAK A;  2UUA F;  3GWC A;  5B0B A;  3FC9 A;  2ASD A;  4WCE Q;  2GHV C;  4DXL A;  4FZV A;  5HMX A;  5KFI A;  2ZH5 A;  4USM A;  5FJ4 A;  4ID5 B;  1MMD A;  1NUE A;  2SXL A;  1FT8 A;  1FNM A;  2EK1 A;  4G65 A;  1E6Y A;  3PDN A;  3ISN D;  1XNQ J;  2HQD A;  4WFX A;  2XQC A;  2WOM B;  2FZK B;  2VU5 A;  4PG7 A;  1LW0 A;  1CJK B;  4ZLJ A;  4ZOS A;  1CC8 A;  3KLG A;  3H4D A;  1F3F A;  4OLP A;  2F9D A;  4WXO A;  4Q7A A;  2DGQ A;  2VJV A;  1H74 A;  2YWW A;  4WFA Q;  5K9F A;  3FCW A;  5AJ3 F;  1S6Q B;  2VQE J;  3N28 A;  1EET A;  3PX4 A;  4KGM A;  2B4O A;  4YN3 B;  1KNZ A;  3JSB A;  3V81 B;  4A4J A;  4HL9 A;  2R8J A;  1ZYQ A;  2R7U A;  2W25 A;  3VGS A;  4HI2 A;  5ADZ A;  1NB7 A;  2CVI A;  1N4L A;  2J9E A;  4A8W A;  1IBM F;  2V63 A;  3HSZ A;  2RHQ B;  2MEW A;  1XR6 A;  4R5P A;  4AYB D;  2DEI A;  3THP A;  2Y1R I;  1D8Z A;  3FRZ A;  5DS7 A;  1N54 B;  3VAF A;  3PRD A;  3DLK B;  3FBE A;  1RJJ A;  4IQM A;  3RB0 A;  2WK4 A;  2BOA A;  5DZ6 A;  2R2U A;  1XWL A;  3GON A;  2C42 A;  3DI6 B;  1NSK L;  4M5D A;  5KFT A;  3QZ7 A;  2NQP A;  4YHH J;  2XGQ A;  4PYD A;  5KFE A;  3US5 A;  2BV3 A;  4LFB J;  1TQL A;  4ZKA A;  3EUN A;  4I1T A;  2PI4 A;  2VPX B;  2H5E A;  4ZPV R;  3KK3 A;  3PNI A;  3PRB A;  2XY5 A;  3MR5 A;  5A6W A;  2C28 A;  2R7T A;  1NXI A;  3NBP B;  1EIY B;  4P72 A;  2IRX A;  1NZ8 A;  1VQ8 S;  4TVA B;  2YKN A;  2Y1I A;  4OFZ A;  3K5M A;  4A48 A;  1P27 B;  2QO3 A;  1AUD A;  3M32 A;  4E8U A;  3EX7 B;  2M8D B;  2Z0G A;  3BDP A;  4MJK A;  1WD6 A;  4QPX A;  4DN0 A;  2JEI A;  1SXL A;  3IRX B;  4F0M A;  4PRF A;  2IYI A;  3J7Y U;  4LRE A;  1UL3 A;  1G4C A;  5DQG A;  2L9N A;  1N6Q A;  4U95 A;  4FXV A;  4RW6 A;  4KSE B;  1EQM A;  3W1Y C;  3HJV A;  5G0R A;  4O3O A;  2VFU A;  4UY8 5;  3TP2 A;  4YFU A;  4B02 A;  3OUY A;  3FEZ A;  2FLL A;  1RAC B;  3J81 Y;  1I6J A;  3HUL A;  3MMB B;  4B17 A;  1VHF A;  1HD0 A;  3IGN A;  5J2P A;  1NK0 A;  3MCS A;  5KFN A;  4ZIW A;  3R1H A;  4IRK A;  3MM7 B;  5I4M A;  3CCZ A;  4ELU A;  1VBY A;  2IJF A;  1YBU A;  4YB1 P;  1RLC L;  1ITP A;  4LRB A;  2I5J B;  5DGB A;  1RT6 B;  3W9J A;  1C1B A;  3FK4 A;  2YWF A;  4FS2 A;  1FRL A;  5K14 B;  2RRA A;  4WPA A;  1Q78 A;  1RTJ A;  3M1V A;  3R1L A;  2QL7 B;  1YJV A;  3QGP A;  3TQE A;  4DV5 F;  3L95 X;  1RSC A;  4WFN Q;  4KO0 B;  2E9R X;  5D3G A;  2RB7 A;  2AJ0 A;  3LOU A;  3H5Y A;  1NB2 A;  1XC9 A;  1D3W A;  2YH0 A;  4CM2 A;  2BJ1 A;  2ILZ A;  5KFH A;  2H54 B;  4W90 B;  3VWS A;  2J9D E;  5J1P A;  1OO0 B;  1TVR A;  2HIY A;  4DLE A;  1Y9O A;  1XJW B;  2V2Z A;  4TKT A;  4ID8 A;  1VRU B;  2BE2 A;  2W2O P;  1BWE A;  2Z4P A;  3Q86 A;  1B0V A;  3KG0 A;  3MUR P;  1U6F A;  3FGV A;  1X60 A;  3KJQ B;  4QU6 A;  3QYY A;  3K8V A;  2XO6 A;  4PCQ A;  5G4D A;  3IBW A;  4JB8 B;  3EWG A;  2A6M A;  4GO7 X;  2LQ9 A;  4KH1 B;  4M5K A;  2BJ9 A;  3H90 A;  1SQE A;  1RKI A;  4ECV A;  1DFD A;  1L3K A;  2FJV A;  4NXN F;  3OXF A;  1RAF B;  4IOB A;  4L72 B;  3HT0 A;  2PFF B;  3UCG A;  5KOW A;  5IWA J;  2RU3 A;  2HND A;  3OVB A;  1FNX H;  1VOM A;  1QSL A;  2B6A A;  3BKF A;  2EC0 A;  4ED6 A;  5J2Q A;  1QM9 A;  4K8R A;  2HW3 A;  1HFE L;  3VAH A;  2A3J A;  4OZJ A;  4OIX A;  2YKM B;  4OZ0 A;  1B7F A;  4J9K A;  1NH8 A;  3A3N B;  5CZV A;  4ENO A;  3NNC A;  2JVR A;  3ENW A;  2UXC F;  3ITH A;  4ETZ A;  3NY0 A;  4UTG A;  1VBK A;  4ELV A;  2DCU B;  2HHS A;  4DV2 J;  1JLC B;  4NXM J;  3VCD A;  4LSN B;  4FDF A;  2VL1 A;  5JXS A;  1C1C B;  3MCO A;  1N33 J;  1SJQ A;  1FDA A;  5HSP A;  2OJ3 A;  4UT4 A;  4DQQ A;  2GIQ A;  2DNH A;  4Q43 A;  4HLB A;  3R5J B;  2V8P A;  2EPI A;  1RWP B;  3A13 A;  3D7S B;  1Q81 T;  2ZZM A;  4KPY A;  1RAA B;  2V4R A;  3TI0 A;  3ZTQ A;  4DSK A;  3NS7 B;  2JOQ A;  4O4G A;  2DR7 A;  2JWN A;  5L1J A;  1U25 A;  3UR0 A;  3KNG A;  3NEK A;  4OV6 A;  3QT7 A;  4X4U A;  2DGS A;  2D3U A;  2XG8 A;  4LF7 J;  1TL7 A;  2QL9 B;  2MJU A;  4JI2 J;  4I2Q A;  4EYI B;  1HNW J;  2F40 A;  8RUC A;  4ES3 A;  3FVY A;  4TU9 A;  5CAA A;  5HVG A;  4EK2 A;  2B5J A;  3JTP A;  1HIY A;  3CCR S;  4G1Q A;  3RR7 A;  1Z2Z A;  1DAX A;  2RH3 A;  2DGU A;  1S0V A;  1U24 A;  2FDN A;  3BQ1 A;  2BJ7 A;  2C2K B;  3R3T A;  4ERD A;  4C9D A;  4WU2 A;  2MLZ A;  1Q16 B;  1AZS B;  1KEK A;  1AW0 A;  2OPQ A;  3QJJ A;  3SDE B;  3IO1 A;  3DLG A;  5IQ6 A;  3LP1 A;  1NBE B;  1BQN B;  1HMV B;  3DOL A;  1IBK J;  2GJI A;  3CVK A;  3HD2 A;  2BW2 A;  3CCV S;  4ZP8 A;  4NEY A;  4ZVF A;  7FD1 A;  2MKY A;  4Q0B A;  3LP0 B;  2YWH A;  3EGW B;  2HHU A;  5GAE U;  3WQP A;  5KG6 A;  3R7B B;  3CDW A;  5DDO C;  1YZ7 A;  2W01 A;  1M90 T;  4K4X A;  3CGI A;  2FB0 A;  3UFC X;  1TKZ B;  4KC5 A;  5H1S V;  4JBC A;  2DO0 A;  3NNA A;  4F04 B;  4JV1 A;  3OQ2 A;  4K7Q A;  3IGV A;  3M2R B;  4LF4 F;  4L76 A;  3TEG A;  3C6U B;  2OIH A;  2HHH F;  1WOR A;  5K5M A;  3G82 B;  4I6Y A;  4TLQ A;  4CLF A;  3PEH A;  4DPU A;  2QA4 G;  2XCP A;  1EAY C;  2HMI A;  2ZJP Q;  3DLB A;  3OFH A;  1VQN S;  3GIR A;  2FGC A;  2JLG A;  3F0N A;  1RI7 A;  5HI7 A;  3L9Z A;  1H2T Z;  4ATN A;  5E7O B;  4JI8 F;  2GHP A;  3AOD A;  4CTA B;  1IM6 A;  1YGY A;  1NKB A;  3CNQ P;  2EEY A;  3QQC D;  4F0K A;  2MKK A;  2PA8 D;  5LMU F;  2HZA A;  3GU0 A;  1B0P A;  2QMW A;  1UEU A;  3MAH A;  4F50 A;  3PXG a;  1KDN A;  5T7L B;  3MCN A;  2Q1L A;  1F1B B;  3VTI A;  4C2M A;  1NDP A;  3PR5 B;  3TAN A;  3AXM A;  3QSY B;  2LP4 A;  1SB6 A;  1MWY A;  3HI9 A;  4FYW B;  2ZJR Q;  1ZH5 A;  1Q95 G;  2N4C A;  1VQ9 S;  3D2W A;  2YH1 A;  3TJA A;  2Z30 B;  4WZQ A;  2MTL A;  3EIC A;  2RNE A;  3MMC A;  2CNL B;  1VQ6 S;  3D1O A;  1ZM2 A;  2AKW B;  3ENA A;  3J80 U;  4Y2A A;  5ITH A;  2BVZ A;  2UP1 A;  3I5B A;  4K4W A;  2LYV A;  3T5H A;  4NLU A;  3BR8 A;  3BQ2 A;  2WSF C;  1HQE A;  3BJY A;  2E66 A;  3MM8 B;  1FTC A;  1C0U A;  4ED5 A;  3R5D A;  4CDI A;  1HHT P;  2HGM A;  1FJ7 A;  3HVA A;  5ETN A;  3MHY A;  3C8Y A;  3IMQ J;  2BKP A;  4DX8 H;  3DXS X;  4OMF G;  1XNQ F;  4FN5 A;  3GV5 B;  4CO4 A;  4J9Q A;  3THV A;  2PC6 A;  4QJV A;  5A76 A;  1GFW B;  5CYM A;  4DR5 F;  3TYT A;  4CZC A;  2Z58 B;  1K8A T;  4FBU A;  3D0H E;  1DTT A;  1S1U B;  2KVI A;  1QTM A;  1RHM B;  1SJF A;  3K5P A;  3IM9 A;  3KK2 A;  2BQR A;  4UUW A;  3TAR A;  1NJI T;  4I7F A;  2A6O A;  5CA5 A;  3LGN A;  1X4B A;  4H4M B;  1N36 J;  1XMB A;  3HHN B;  2ZC4 A;  3DLH A;  3FEY B;  2W8L A;  3BS9 A;  3RZA A;  1IKW B;  3I0R A;  1IBC B;  1HNV B;  1VQ5 S;  2IPO B;  4ZPC A;  3MMJ A;  3QGH A;  4CCH A;  3DU5 A;  5BYR A;  4DUY J;  2WZ1 A;  3D0I E;  4DUT A;  3NGT A;  1YJN S;  1D9A A;  1N0U A;  3DRP A;  1EAR A;  2DXD A;  2ASL A;  2OAU A;  1MSW D;  4U67 Q;  4RNN A;  3ENQ A;  1FRI A;  2F4V J;  4KGZ B;  2H4W B;  2OPS B;  3B4D A;  3KLH B;  2YNF B;  1TL3 B;  1T9W A;  2QRR A;  5IT9 U;  5D0E A;  2WBR A;  4I67 A;  3B4M A;  4YHH F;  1WI8 A;  4ZP6 A;  1VC5 A;  2MLY A;  2DR9 A;  2CPF A;  4FS1 A;  5HVF A;  3MED B;  2KZZ A;  1FWK A;  1UPP A;  4NE9 C;  3JTO A;  4KBI A;  3LTO A;  1FD2 A;  2QYG A;  4EO6 A;  1V9O A;  1AYE A;  1WOS A;  2BJE A;  3DOM B;  1U02 A;  3Q8V A;  3KUG A;  1FXD A;  4ZVR B;  4XK8 C;  2D74 B;  4EO8 A;  1WKL A;  4F3Q A;  3EXC X;  1LWC A;  1FE4 A;  2XMJ A;  2ZH8 A;  3G2X A;  3UQS A;  1UEK A;  4DL4 A;  4L73 A;  2UVV A;  1RA7 A;  2FPH X;  4RUB A;  1Q8B A;  1TK5 A;  7FDR A;  2HGN A;  2PEH A;  4K4Y A;  4KHP F;  1SI9 A;  4QR0 A;  1HWK A;  5C25 A;  4PEO A;  1S99 A;  2V0N A;  1RWO B;  3IR5 B;  3N6N A;  3T5L A;  2RQ4 A;  3KJN B;  5H9F J;  2APO A;  4MTP A;  1X0P A;  1S6U A;  4Y28 C;  3I31 A;  4NWB A;  1FXL A;  2DGX A;  2C22 A;  2YNI A;  4RBV A;  2K7K A;  1QAI A;  2VD3 A;  2QC3 A;  1NH7 A;  2MQ8 A;  5LOQ A;  3K5N A;  1QUP A;  1O51 A;  4M5H A;  3BQ0 A;  1JX4 A;  3M9O B;  1IWA A;  3MEG A;  4HHJ A;  2V9W A;  3RGI A;  1RBO B;  1C0T A;  3FQK A;  2MQP A;  3O5T B;  3K5L A;  1FKP A;  4ZVT B;  1HL6 A;  4NYZ A;  2DD8 S;  3OR1 B;  1HHQ A;  3HVT A;  4KHM A;  4NLW A;  4EWT A;  5D4P A;  2GVD B;  2OTJ S;  2P9G A;  4DR1 J;  2PFD A;  2XEX A;  4B3S F;  1S9E B;  5D4O A;  3TAM A;  4Y0F A;  5BYS A;  1RWW B;  2JFD A;  3QGI A;  3TOQ A;  1TKT B;  1BGX T;  3NRB A;  2DNL A;  3LP2 A;  4O0N A;  4YR3 A;  3MZI A;  4H54 A;  2IDL A;  4EFA C;  3MUT P;  3H7H B;  4NCA A;  4F67 A;  4J9P A;  4RW7 A;  1UCN A;  3FKB A;  3HHL C;  2MQQ A;  4DJB A;  2XMU A;  2JHE A;  2LQ5 A;  1SKW A;  2CDR B;  5D6G A;  5SUH A;  1Q7Y T;  1VJQ A;  2D7S A;  3ZNJ 1;  3A8J A;  2QLF B;  3V2U C;  3H5S A;  4X64 F;  1TMJ A;  1RWX B;  1PAU B;  2MKC A;  5E3Q A;  3VGT A;  3RRG A;  2CPZ A;  1UMJ A;  1NK8 A;  1RHQ B;  2MQM A;  3P5B P;  1SC3 B;  2RS2 A;  4A8Q A;  1H6K X;  2D9P A;  1R27 B;  5DDP C;  2Y8Y A;  1IVZ A;  2WSC C;  2M0G B;  2BJD A;  4AE5 A;  2VDH A;  2VKZ G;  1TEL A;  4KGV B;  2CNO B;  1GQE A;  2NUH A;  3TVY A;  5D8H B;  4ID5 A;  4YDX A;  1D0E A;  4AUK A;  3VAL A;  4F4A A;  1FKO B;  3VAI A;  1VS3 A;  4DCP B;  1HW8 A;  2IA0 A;  3RB4 A;  2HKE A;  4JI3 J;  4RW4 B;  4OHV A;  3W5Z A;  1VI7 A;  1XMQ F;  2WOM A;  4JI4 J;  1NK4 A;  1ZZN A;  4C3L A;  1WJ9 A;  1CJK A;  5D4N A;  2YBV A;  2AJ2 A;  1NDC A;  3LF0 A;  1VIS A;  1FFG B;  2ZKU A;  4I6A A;  2UVR A;  2OEM A;  2QFJ A;  3Q8U A;  1WDT A;  3V6K A;  2RDD A;  1S6Q A;  1K9M T;  4S0M A;  2Y1L B;  2IMO A;  1KD1 T;  2K3I A;  1YX2 A;  3PYF A;  1MWQ A;  1PGZ A;  3V81 A;  1NJY A;  3OW2 R;  4ZLP A;  1UP1 A;  1IKV B;  4M5I A;  4YY3 F;  4DQR A;  2KN4 A;  3BN7 A;  2VBW A;  3R6L B;  1T7P A;  3N0V A;  4QIW D;  4ZN1 A;  3K17 A;  2AGP A;  1F3V A;  2XSJ A;  5IV3 A;  3W2V A;  2ALY B;  4P73 A;  3F44 A;  3DLK A;  1PIE A;  3T1H J;  4AXJ A;  4HVZ A;  5GVQ A;  2HHT A;  4ILL A;  4USI A;  4NA1 A;  4HH1 A;  1SL2 A;  3ZTS A;  3BSN A;  2XS2 A;  3I56 S;  4K5R A;  3DI6 A;  2HFZ A;  1MNE A;  5KFJ A;  2MSS A;  1HWI A;  4Z2X A;  1SIZ A;  3DKD A;  4P9S A;  1WF1 A;  1SBR A;  2NXE A;  2V2K A;  3NS5 A;  1RBA A;  3UE2 A;  3X1L B;  4UST A;  2LEP A;  2E5H A;  3T41 A;  3WIV A;  3T5J A;  1IWG A;  3CD5 A;  4X4N A;  5HLF B;  1HNW F;  1VJW A;  4QWC A;  4DL7 A;  4FVM A;  3Q83 A;  3NBP A;  1FJE B;  2VG7 B;  1URR A;  2RJZ A;  4Q2L A;  2KJV A;  4BCA A;  2LEC A;  1CC7 A;  4DG1 B;  2W1B A;  4H4K C;  3W8P A;  2VB6 A;  2DKO B;  4FPI A;  1N5Y B;  4R25 A;  4QCL A;  2BE7 D;  1Z2L A;  3PO5 A;  4ED4 A;  5HQL A;  1TL4 A;  2AYM A;  1F9E B;  3IRX A;  4U8Y A;  3H8Y A;  3MDF A;  3D0G E;  5L9X A;  1SC4 B;  1IBK F;  2UUB J;  2BAC A;  1ZAW A;  4QW8 A;  3QFW A;  1WAC A;  1G6B A;  2QYC A;  4ZA1 A;  1B0T A;  4NOH A;  1D8Y A;  4MKA A;  2LXF A;  3Q8Q B;  3DLJ A;  2HNZ A;  1GXT A;  1YSJ A;  1S1W B;  4M94 A;  3V5R A;  3VQS A;  1O6X A;  4K0K F;  4LFC J;  2CQ2 A;  3MMB A;  2B4V A;  2JX2 A;  3G71 S;  1R8B A;  2FQQ B;  2ROG A;  5D78 A;  4ECT A;  3LGH A;  1IN0 A;  3P5T L;  1PYS B;  3MM7 A;  3QJL A;  5DQI A;  3G8Q A;  5A2Q U;  1UW9 A;  3DXB A;  4WZM A;  2I5J A;  4L3K A;  1RT6 A;  1LWX A;  5KFM A;  1X5T A;  4G1I A;  5K14 A;  1M5V C;  2I9S A;  3EYZ A;  2EBE A;  2QMU B;  2QA1 A;  3T6B A;  2C3U A;  4DR7 J;  5H9E K;  3H42 A;  3SZ2 A;  1IJE B;  3BZQ A;  3SEO A;  4KO0 A;  4DR3 F;  2CG4 A;  4LFA F;  4IRC A;  2PT0 A;  3C3L A;  4HI1 A;  2X3D A;  3CCW A;  4MK7 A;  5E33 A;  2QTW A;  4J9M A;  3I6P A;  3O3L A;  4E2F B;  4QWB A;  4DUZ J;  1NJX A;  3PJX A;  2WSE C;  1NSQ A;  4Q5V A;  2J8A A;  1UA0 A;  1ZPW X;  1RQ0 A;  2CQ1 A;  4WYW A;  3JTN A;  3AQP A;  1EKR A;  3KHH A;  1DLO B;  3L7O A;  1U2C A;  4DU7 A;  1VRU A;  1B64 A;  3R2D J;  2RUS A;  2DCL A;  3QSI A;  1LOU A;  1CVJ A;  5KT5 A;  3ZZP A;  3RW6 A;  2E5J A;  2Y0S D;  4ZCM A;  4OZ3 A;  4ZVQ B;  5AE2 A;  3CWJ A;  4LF8 J;  2XMA A;  2W2Q P;  3Q8Y A;  4DX6 A;  1FRK A;  3IS9 B;  1NK5 A;  3I87 A;  4J5O A;  4DV0 J;  1RAI B;  4DU8 A;  2F3J A;  2XYG B;  4LJM A;  1DQ9 A;  5BR8 F;  3P4U B;  1T94 A;  1CSJ A;  1D9D A;  3M8W A;  5E3A A;  8ATC B;  1C4A A;  3W9I A;  2CQI A;  2R7W A;  2R2T A;  3HP6 A;  4PG5 A;  1TP7 A;  1OJ4 A;  3N5F A;  4M95 A;  1RXO B;  2D41 A;  1S79 A;  3N79 A;  4J37 A;  1QVG R;  4C48 A;  1VQY A;  1LFP A;  5KFS A;  3E2E A;  2W9C B;  2YKM A;  1JLQ B;  5LMN F;  2F63 A;  1ZTT A;  6FD1 A;  3O2I A;  4MK9 A;  2M70 A;  2MZS A;  4B3O B;  4FVC A;  1TKX A;  3A4T A;  1Y5L B;  2OFG X;  1WUU A;  5AXM A;  4QR1 A;  3HHK A;  4NLV A;  3AJ2 A;  3HD1 A;  1JLC A;  1S72 S;  4K4V A;  1ZAV A;  4I56 A;  4LSN A;  3IR6 B;  2JVO A;  1C1C A;  3CT9 A;  3GFY A;  4GC7 A;  2E1R A;  1VBX A;  1JWW A;  2W9B B;  1VYA A;  3IAM 9;  4CLK A;  4K2X A;  2R7S A;  4MT1 A;  5F3Z A;  3OFE A;  2M52 A;  3MAQ A;  3VAM A;  4OI2 A;  5C24 B;  4F0H A;  4JV0 A;  2VQF F;  3KLV A;  1FE0 A;  5AE1 A;  1WC0 A;  3OTB A;  4ZIT A;  4DPY A;  1X4F A;  4LVO P;  3EGN A;  3GJQ B;  1YDL A;  1R0A B;  4WTY A;  2MKH A;  4JI7 F;  2FC8 A;  3CJS A;  3TR5 A;  2CIM A;  1Y10 A;  3LPY A;  5HL7 Q;  3CUL A;  2EG1 A;  5D0G A;  1VQO S;  2F4V F;  3TWZ A;  5IT4 A;  4DV1 F;  3BPD A;  2XS7 A;  5LJ3 Y;  2K1R A;  2VPZ B;  3VAG A;  4JV5 J;  1WNE A;  1HWL A;  4OX9 F;  2DXF A;  3D6F B;  1YRU A;  4B3T F;  4DR4 J;  1JXE A;  4OI4 A;  1X8D A;  4OI6 A;  1MN7 A;  3JS9 A;  5C2C A;  2FTR A;  1U1N A;  5HAO A;  2GC8 A;  4Y65 A;  2ZM6 F;  5JVG Q;  2EWH A;  1S0N A;  3JSY A;  1WTB A;  3S1T A;  2QJ3 A;  1IR1 A;  3FSY A;  3G6E S;  2W7O A;  3M7V A;  4DSE A;  3PJ9 A;  1AZS A;  4CO1 A;  4JI6 F;  1CQM A;  3NL0 A;  2HVE A;  2OLW A;  2R7O A;  3SDE A;  2MYF A;  3CC2 S;  3BBC A;  4WWS A;  1BQN A;  1HMV A;  3BBF A;  3BSC A;  1MLA A;  1KN6 A;  4DV4 F;  2IA6 A;  1LEO A;  4DDF A;  3N01 A;  3K5O A;  3MUV P;  2E5L J;  3LP0 A;  2J7U A;  2QFI A;  3GII A;  3EXY A;  2XBP A;  1W25 A;  1RAH B;  2UUA J;  3UVJ B;  3OVS A;  1M1K T;  1WF2 A;  1CS4 B;  2LXU A;  5GAG I;  4RW8 B;  2NXC A;  2P9E A;  3WBZ A;  5HRO B;  2M5Y A;  3M9N B;  2GQC A;  3VV2 B;  2IJR A;  2W7P A;  2E5G A;  1WI6 A;  1IR2 A;  2DNQ A;  4RL1 A;  3M2R A;  5D0H A;  4Y2I A;  4J7C A;  3C6U A;  2L9W A;  1RWN B;  2A1B A;  3R27 A;  1UWA A;  1YHQ S;  2CQ4 A;  3G82 A;  1H98 A;  3VGU A;  3ITH B;  2DNY A;  3C6T B;  2JRS A;  3AA9 A;  1NAQ A;  4IKA A;  2CVE A;  4YR2 A;  2KI2 A;  5AJ3 J;  4HTJ A;  3DDI A;  3C19 A;  2J0Q D;  4A46 A;  2RAQ A;  5K20 B;  4F4X A;  2B7B B;  2OP5 A;  1RBL A;  3QAU A;  4ZS6 A;  4X62 F;  3CD0 A;  2UV8 A;  1K73 T;  1YRT A;  3GIJ A;  2ALZ A;  1S0O A;  3WDO A;  3KOA A;  1L3T A;  1FDN A;  3ET6 B;  4ED1 A;  3H2U B;  1IBM J;  4ITS A;  5DZ7 A;  1YTY A;  4CTA A;  1HNZ F;  4WF9 Q;  4USW A;  4ZDN A;  3EVW A;  1J5O B;  2DBB A;  3M8Q B;  4WKR A;  2N4D A;  3GJS B;  1NSP A;  1RT4 B;  1DBD A;  2VON A;  4DF4 A;  1DTQ B;  2KYZ A;  4LR7 A;  2DYA A;  5T7L A;  1N0V C;  2RT3 A;  3EE3 A;  1REG X;  3TA2 A;  5GAH I;  2JC1 A;  4X65 J;  4Z7Y A;  2OUG A;  4GKJ F;  2ROE A;  1SUQ B;  5KFA A;  4N8O A;  2HS3 A;  3UPF A;  4ZCL A;  5JJB A;  1B99 A;  5CYQ A;  3DNC A;  2ZHA A;  1U6B A;  3C16 B;  3CIZ A;  1TL7 B;  2GO8 A;  4N8N A;  4IO9 Q;  3FZB A;  5LL6 d;  1JJ4 A;  4I2Q B;  1TU0 B;  4USU A;  1T02 A;  3KUH A;  2MZJ A;  1Q8K A;  3NWG A;  3EZ5 A;  1HAR A;  3GG1 A;  4KJI A;  4K50 A;  3FFI A;  2YX1 A;  3BO3 A;  3IN5 A;  1GX5 A;  2E5I A;  3SV3 A;  3MM8 A;  2VOP A;  3T1A A;  2GO9 A;  1SJ1 A;  2ACY A;  5CCL A;  4LQ3 A;  5A8W B;  3Q2T C;  2IVM A;  3CJ8 A;  1U4B A;  1H7W A;  2WVF A;  2E1P A;  4DQP A;  3OBI A;  3H40 A;  1BMQ B;  2HQF A;  3CDU A;  3HZG A;  4NEZ A;  5DGA A;  2R7X A;  2IBO A;  3DOL B;  4Q44 A;  1RAG B;  2HRT A;  1NND A;  1OQ6 A;  3CJ2 A;  4ER8 A;  2YNH B;  3J81 U;  3MPW A;  2HSE B;  1ZA1 B;  2ZVI A;  3UDE A;  3GV8 B;  4FXW A;  2HZV A;  1S1U A;  3F56 A;  3IA0 A;  4DSF A;  1ZAX A;  5H9E J;  5HP1 B;  3GG0 A;  3KWM A;  2HBY B;  3CED A;  3NAH A;  4H4M A;  3SCI E;  4OHY A;  1J2V A;  4PG8 A;  2HNY A;  4I0W A;  2J7K A;  2E9Z A;  3X3U A;  1IKW A;  2F65 A;  2DHA A;  1HNV A;  2MHE A;  2MXY A;  3OXG A;  3L3C A;  2V50 A;  2QE5 A;  5I3Q A;  2IMW P;  3MFI A;  1R6Y A;  1JMT A;  3L09 A;  3KLI A;  4U7C A;  1YJ7 A;  4ECZ A;  3FMW A;  4I6W A;  4K4U A;  1A6L A;  1JJC B;  2LKZ A;  3AH6 A;  5KFF A;  4UOC A;  4DV5 J;  3PM9 A;  2PGC A;  3KLH A;  2FY1 A;  2YNF A;  1HPZ B;  1TL3 A;  2IM3 A;  3MPY A;  3FMB A;  3C46 A;  3GYN A;  2QLB B;  4O44 B;  1FHT A;  1JXV A;  5B0A A;  4USK A;  4KV8 B;  5EHH A;  3HLU A;  2F8H A;  3PW2 A;  2A2D A;  1OIA A;  3FZ2 A;  3BO4 A;  2OPP B;  2GFF A;  2UXD F;  3KFW X;  2BUN A;  5KFW A;  3BKU A;  3Q23 A;  3MED A;  2J76 E;  2RIL A;  3K57 A;  1B4S A;  3HM9 A;  3W60 A;  1S97 A;  2RS8 A;  3EM1 A;  4YEA A;  1RHK B;  4H4O B;  3GLJ A;  1T9V A;  3DOM A;  3NGS A;  3W5X A;  2M8H A;  2ZBC A;  2XZW A;  3QPI A;  1S10 A;  1RHU B;  2M4M A;  3OTE A;  3OFF A;  2CJK A;  2XB2 D;  1QDU B;  2DTJ A;  1BE4 A;  4P2M A;  1Y3J A;  5KT6 A;  1YVF A;  4HEA 9;  3ZZY A;  4IDK B;  4V1A k;  1PKU A;  2FVQ A;  2YTC A;  1TV6 B;  3MMC B;  2PSZ A;  3JAM Y;  1PAE X;  4NXN J;  4B9U A;  2VPY B;  2PN6 A;  1PJ5 A;  1GMU A;  2NYH A;  2V6A A;  3S7R A;  3RW7 A;  2AQ4 A;  3F41 A;  2HVD A;  2A0F B;  2FJD B;  4JP8 A;  2KO1 A;  4UOF A;  1RU2 A;  3CXC R;  1F5B A;  4W98 A;  1X4C A;  4OJG A;  5KFL A;  2ZE2 B;  4LUB A;  1S12 A;  3T1Y J;  1WKK A;  3BKT A;  1FX2 A;  1DAR A;  2H51 B;  1U2R A;  4ES1 A;  2EBG A;  4NMX A;  3THT A;  4CO2 A;  2ZH1 A;  3D9B A;  5F8L A;  1VR6 A;  1UVJ A;  3MR7 A;  1IBL F;  3MWB A;  5E0O A;  4LR9 A;  4RPF A;  1C2P A;  2FLP A;  2B9X A;  3QO9 B;  3BYR A;  1R6V A;  2LDY A;  2HVH A;  2MGZ A;  2RML A;  3M6V A;  2HWT A;  2K7J A;  3UN2 A;  3CCQ S;  2GW8 A;  4U7U D;  3OR1 A;  4W92 B;  4CH0 S;  5KFX A;  1HHS A;  3RU0 A;  2GVD A;  4NML A;  4ECQ A;  4DR2 F;  3GZ7 A;  1JLF B;  2DHS A;  3CCE S;  2OHD A;  5LT5 A;  2PD1 A;  2FZC B;  1TKT A;  1GH8 A;  3W5Y A;  1M1H A;  3TA0 A;  4ED2 A;  4UF4 A;  2R7V A;  3Q22 A;  3D1Q A;  1T11 A;  3MD1 A;  1JJH A;  2KVQ E;  4X4T A;  1HI1 A;  2X7I A;  5HMZ A;  2JC0 A;  2DPJ A;  4HAC B;  3MGJ A;  3B82 A;  1KTQ A;  1FRH A;  4FYX B;  2CQB A;  3J7Y I;  4AFF A;  1REV A;  8AT1 B;  4DS4 A;  5KAK A;  3EZU A;  3IP0 A;  4ZCI A;  1P9Y A;  1KVK A;  3CJQ A;  3R5A A;  5J1E B;  4B9L A;  3PEJ A;  1H2V Z;  3PVX A;  4P75 A;  3PW5 A;  1P6T A;  1U1R A;  3BF4 A;  1U09 A;  4EMD A;  2B0G A;  5L38 A;  3CPW R;  3KMQ A;  1VC0 A;  4P74 A;  4V19 X;  4UY8 T;  2LQB A;  5GMD A;  4ZPW R;  2HVI A;  3FDS A;  2CZV C;  5FDL B;  3A8E A;  2DK2 A;  2GAG C;  4GO5 X;  4ZPA A;  2ZH3 A;  3CO9 A;  4USV A;  4ZK7 M;  1BUX A;  3B54 A;  3NXZ A;  4U6P A;  4F2R A;  2YQ1 A;  1GXL A;  2BMB A;  4NLO A;  1XMO F;  1FKO A;  3TUI C;  1VIO A;  3MPU B;  4IR1 A;  2JEF A;  4RW4 A;  1QUV A;  2DIS A;  4JI1 J;  2ZJQ Q;  5IM0 B;  4RU9 A;  2QLX A;  3GJR B;  3CDA A;  3OSP A;  3J7Z 5;  4FF3 A;  4Y34 A;  2V68 A;  1U2F A;  2NUU G;  2PI5 A;  2AF6 A;  2NPI A;  4XO0 A;  1GAO A;  2HLT A;  2MB0 B;  1U6Z A;  3BDE A;  3QIP A;  2P8I A;  2VG5 B;  3ZFV A;  3U02 A;  2FZG B;  3BGO P;  1S48 A;  3Q8S B;  4NAS A;  1X4G A;  3HFV A;  4HTI A;  3NOC A;  3AFG A;  1AB8 A;  4KR0 B;  4KYZ A;  1IKV A;  4XPE A;  4F4K A;  5HO4 A;  1IR0 A;  3R5C A;  2DGT A;  2HRY A;  1FRX A;  2UZA A;  3DLE B;  5DM6 Q;  2CUY A;  2KXN B;  1FJG F;  4LF4 J;  4I4B A;  4JUZ A;  4M5J A;  4CYU A;  1SV5 B;  3CIM A;  2HHH J;  2O01 C;  4NRT A;  2IVF B;  1KFS A;  2W2M P;  2IC3 B;  4AL5 A;  5L46 A;  4M5L A;  3EPI A;  2J0X A;  1ACM B;  2WCX A;  4DFK A;  2G2O A;  2G0J A;  1VLO A;  1H2U X;  1JLA A;  2MPU A;  3MF5 A;  1H7X A;  1RYR A;  1RHJ B;  4JI8 J;  2H48 B;  2AJ1 A;  3MFH A;  5HLF A;  2KRB A;  3C14 B;  1ARO P;  5IZH A;  1FRM A;  2PO4 A;  4MKB A;  2CKW A;  5LMU J;  2VG7 A;  3NGR A;  4X4P A;  3UCZ P;  1L3S A;  1WC4 A;  1RAJ A;  1JQG A;  1PJ6 A;  4OZL A;  4DG1 A;  2EFP A;  2PA3 A;  1KVI A;  1HKA A;  1N5Y A;  3QT6 A;  2KB2 A;  5EUH A;  3DGP B;  3PG9 A;  3ZZ0 A;  4ECR A;  2Q43 A;  4ES2 A;  2AGO A;  4WFB Q;  2V8D A;  3Q8P B;  4OYB A;  1MU2 B;  1BXN A;  2XLK A;  3BSA A;  2BJ3 A;  2D3Z A;  1L5U A;  2CJ9 A;  5HQ8 A;  1WHY A;  2RDJ A;  1SL1 A;  4NLT A;  3I5C A;  3H2V E;  1RP5 A;  3OHA A;  3V6D A;  1GK8 A;  3GFH A;  1P1T A;  4DR6 F;  4WE1 B;  1RTZ A;  4CLT A;  3CTR A;  2QLJ B;  2R4F A;  3EJM A;  4J91 A;  3D6T B;  3CC7 S;  1S1W A;  5A8R A;  1AXQ A;  2POK A;  4A8F A;  2CNN B;  2HHV A;  1B70 B;  2CJA A;  4O3P A;  2BKN A;  4G1P A;  1UVL A;  3CW2 C;  4A47 A;  2M2B A;  1JLE B;  1X4D A;  6FDR A;  4YQW A;  4BDP A;  2HHX A;  5HQM A;  5EX0 A;  4CLU A;  1PCA A;  4NI2 B;  4TNO A;  5BYQ A;  4XTT A;  2FJX A;  3JSM B;  4DR5 J;  2P5V A;  5A0Y B;  2BAN A;  4LF2 A;  2R8I A;  1UZH A;  2XNQ A;  3P3D A;  1YQH A;  3OR2 B;  2YPZ A;  4OX6 A;  3T19 A;  2N7Y A;  4P2F A;  3S01 A;  1XR5 A;  1F2H A;  2P9C A;  7AT1 B;  3EVO A;  2G1H A;  5EX3 A;  3WC2 A;  1V6H A;  3M6X A;  2JSX A;  1SH3 A;  3SQG B;  2YKO A;  2B51 A;  4TXS A;  4DN9 A;  1ZTW A;  2NXU A;  2XSJ B;  1R8A A;  3W2V B;  4ZLL A;  3MR2 A;  1RWU A;  2V4Q A;  1AFJ A;  5KFD A;  3DU6 A;  1T9Y A;  1S76 D;  1DLO A;  5GAE I;  1ZZF A;  3R9L A;  2CZ9 A;  3PCO B;  3HT3 A;  4TU7 A;  4WU3 A;  1HNI B;  4OI0 A;  1HQU B;  4J9U E;  3CDB A;  2XY7 A;  2DR8 A;  4MIB A;  3IS9 A;  3O44 A;  4X65 F;  3HHD A;  1BC6 A;  5CHC B;  2WHO A;  3TVK A;  1S59 A;  1Y4Z B;  1N48 A;  5KG2 A;  2LCW A;  1CJV A;  4FXD A;  1HYS B;  3W65 A;  5D77 A;  4WP3 A;  2EK6 A;  2FHJ A;  4X66 F;  4RO0 A;  3LWM A;  3GFZ A;  2VJU A;  4OX8 A;  4F4Z A;  2X51 A;  1RT1 B;  2V67 A;  2HK3 A;  4WK3 A;  1XBW A;  4PXB A;  2CPE A;  1WEX A;  4WII A;  1NEE A;  3AOA A;  3J7A 1;  1U48 A;  3GQC A;  3D1H A;  4IG0 B;  5E41 A;  4LVN P;  3JQK A;  4F7V A;  2W9C A;  3OHB A;  4X2B A;  1JLQ A;  1Q1K A;  1K1Q A;  1UW4 A;  3GIK A;  4B3O A;  3UO0 A;  4BC9 A;  2LQ8 A;  4KHP J;  5LJ5 Y;  5KFO A;  1PO6 A;  1R8P A;  3R7S B;  4AT1 B;  3KHR A;  1X4E A;  4LQ9 A;  1KOO A;  2OEL A;  2N3L A;  1T95 A;  2M7S A;  2VC0 A;  2W9B A;  3TX8 A;  4NZ7 A;  3BH7 B;  4FKY A;  4KE5 A;  3PZP A;  4PUO B;  1F9F A;  2HNZ B;  3HJF A;  4LRA A;  2FHJ D;  1T3O A;  4IOC Q;  4ECY A;  3G87 A;  5C24 A;  2C3O A;  3MOJ B;  3AOC A;  5L39 A;  4MIA A;  3OJU A;  1TL5 A;  1YKW A;  2XHW A;  4LT6 A;  2PE8 A;  2YKA A;  2PII A;  2Y9H A;  4PXD A;  5KT2 A;  2AD9 A;  2CDQ A;  3MEK A;  3W64 A;  4DZD A;  1UEV A;  5DQH A;  1R0A A;  2D9O A;  4QYZ J;  1HR0 F;  4DSI A;  3IG1 B;  2Q6C A;  2AYE A;  5M2R A;  2CNK B;  3SCJ E;  3DLL Q;  4CLZ A;  3GSD A;  1K0T A;  4NPO A;  4ZPB A;  2P6S A;  4RW9 B;  3K7R A;  1URN A;  2IAJ B;  4B3S J;  4LF1 A;  3ZZU A;  1Q79 A;  3N6M A;  2YNG B;  1S4E A;  1XR7 A;  3WHI A;  2RRB A;  2B7C B;  2KT2 A;  4RUH A;  3I55 S;  2R2R A;  2EC2 A;  3OFG A;  3GMG A;  4P71 A;  3HX9 A;  3TZZ A;  2KRR A;  1RKJ A;  2HPU A;  2I8E A;  1T03 B;  4X4R A;  4DSL A;  3HDS A;  2U1A A;  4M5G A;  4TLR A;  3TEH B;  2DGO A;  4P7T A;  2DXE A;  1VQM S;  2Z8Q A;  1FVS A;  4XPC A;  5CCM A;  1TFY A;  4X64 J;  4N76 A;  2IY5 B;  2O66 A;  3NCP A;  2DRB A;  4ECS A;  3M8R A;  1U0S A;  1K1S A;  2ZBP A;  1EP4 B;  2DVI A;  3MTJ A;  2WBM A;  3DRR B;  3AB4 B;  1L3U A;  4OI1 A;  4JI5 J;  3E51 A;  2DRA A;  5BJR A;  4U7U K;  3UVJ A;  2D1C A;  4DHV A;  1S1T B;  4OZ5 A;  3CSK A;  4FNI A;  5DDQ C;  1DUR A;  1KLM B;  4URQ U;  3PW7 A;  1CS4 A;  4RW8 A;  2EVZ A;  1RAD B;  3DRS A;  5HRO A;  2VOO A;  4ECW A;  2GQQ A;  2IDE A;  1YWX A;  2IM2 A;  3ZC4 A;  2J6T A;  5DG8 A;  4F25 A;  3T1Y F;  3HHL D;  3FSI A;  1XMQ J;  2MKI A;  3MM5 B;  1FWL A;  1H73 A;  4DQS A;  2HFU A;  2ZHB A;  3VGV A;  2EKN A;  2EKY A;  3CCL S;  4PYA A;  1TKX B;  3C6T A;  4YME A;  3D5M A;  1YRX A;  3DM2 B;  3D66 A;  1F9H A;  2V2Q A;  2V8H A;  4QIV A;  1S6P B;  1CG2 A;  2L48 A;  3QBC A;  4P2X A;  5F8G A;  4XDD A;  1SVD A;  2VC1 A;  3PJW A;  4IG3 B;  3JB9 k;  2HUR A;  3BBB A;  2DIV A;  1WC1 A;  5H9F K;  4YY3 J;  5HJX A;  4XIU A;  3ET6 A;  2VFS A;  3NLC A;  1NCL A;  1CJT B;  4K2J A;  4WYL A;  3OL8 A;  3BRE A;  4A8K A;  4KH0 B;  5M2P A;  1J5O A;  3M8Q A;  1OSC A;  2LLZ A;  4RJV A;  1RT4 A;  4ILM A;  2DY9 A;  3U1N A;  2HBR B;  3SSR A;  1DTQ A;  1ZBT A;  3ZTO A;  2KJW A;  1XNR F;  2DNR A;  2DGW A;  5B0G A;  3P45 B;  2J0S D;  2GJF A;  1F5C A;  3PFE A;  4ZPD A;  5KG4 A;  4GVL A;  3LUY A;  2KFY A;  1PBA A;  1SUQ A;  3WX4 A;  1BHN A;  2DH7 A;  3BH6 B;  4P7V A;  1EZZ B;  2GX8 A;  3L7P A;  2HBZ B;  2HS4 A;  9RUB A;  1HQ2 A;  2FHO B;  3C16 A;  1OSD A;  2WRM A;  2K1R B;  3C2P A;  3D3B J;  3HF5 A;  3BGU A;  2ZDP A;  4EBE A;  4HHU A;  2E9T A;  3H98 A;  1TAQ A;  1ZOT A; 
#chains in the Genus database with same CATH homology
 1UCN A;  3Q89 A;  1NSQ A;  3EVO A;  5IOL A;  3FKB A;  1U8W A;  1PAE X;  4HR2 A;  3EVW A;  3DKD A;  1XQI A;  3ELH A;  1KDN A;  1W7W A;  1NCL A;  3FCW A;  3Q86 A;  2HVD A;  4AND A;  1NDC A;  4UOG A;  1NSP A;  4UOF A;  5CAA A;  1JXV A;  1NDP A;  4EK2 A;  1MN9 A;  4W98 A;  3Q8U A;  1HIY A;  1ZS6 A;  2DYA A;  1NLK L;  2AZ3 A;  3EJM A;  3EE3 A;  5CAB A;  2DXF A;  3GPA A;  1WKK A;  4S0M A;  2DY9 A;  3VVT A;  3VGT A;  1MN7 A;  3VGS A;  2B8Q A;  4ANC A;  3JS9 A;  3ZTO A;  2BX6 A;  1WKJ A;  3R9L A;  3Q83 A;  3Q8Y A;  3EIC A;  3GP9 A;  3NGU A;  1VYA A;  2AZ1 A;  3FC9 A;  3Q8V A;  3FCV A;  1LWX A;  1B99 A;  3ENA A;  4ANE A;  3NGR A;  3FBB A;  1B4S A;  3EM1 A;  3VGU A;  3ZTP A;  1WKL A;  4CP5 A;  2B8P A;  3WX8 A;  1NHK L;  3BH7 B;  4FKY A;  2NCK L;  4C6A A;  1BHN A;  2ZUA A;  3PJ9 A;  1S59 A;  3L7U A;  3NGS A;  3EMT A;  3FBE A;  1HHQ A;  3BH6 B;  3G2X A;  3VGV A;  5C7P A;  2HVE A;  3ZTQ A;  3PRV A;  2DXE A;  1NDK A;  1F6T A;  4F36 A;  1NUE A;  4KPC A;  3VVU A;  4DUT A;  3NGT A;  1EHW A;  3BBC A;  3DDI A;  3ETM A;  4WBF A;  4DI6 A;  2BEF A;  3BBF A;  3FBF A;  2DXD A;  1S57 A;  1LEO A;  1XIQ A;  1NB2 A;  3MPD A;  1K44 A;  4UOH A;  1BE4 A;  2CWK A;  1S5Z A;  1NSK L;  5BXI A;  4O0N A;  1NDL A;  2VU5 A;  3ZTR A;  3B6B A;  4F4A A;  4DZ6 A;  1NPK A;  1HLW A;  3FBC A;  1BUX A;  3B54 A;  4ENO A;  4FKX A;  3ZTS A;  1PKU A;  3EVM A;  1F3F A;  2HUR A;  3BBB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...