1BE4A

Nucleoside diphosphate kinase isoform b from bovine retina
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
151
structure length
151
Chain Sequence
ANSERTFIAIKPDGVQRGLMGEIIKRFEQKGFRLVAMKFMRASEDLLKEHYIDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIALWFRPEELVNYKSCAQNWIYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Phosphotransferase
molecule keywords NUCLEOSIDE DIPHOSPHATE TRANSFERASE
publication title Nucleoside diphosphate kinase from bovine retina: purification, subcellular localization, molecular cloning, and three-dimensional structure.
pubmed doi rcsb
source organism Bos taurus
total genus 45
structure length 151
sequence length 151
chains with identical sequence B, C
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1998-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1be4A00
3FCWA 3Q8YA 1NSQA 2DXDA 3BBFA 3JS9A 3EVWA 3GPAA 1BHNA 1HHQA 2AZ1A 3GP9A 3MPDA 3BH7B 1MN9A 2DXEA 3VGTA 1W7WA 1HLWA 3B54A 2CWKA 4ENOA 3EM1A 4EK2A 3BH6B 1JXVA 3FBBA 1XQIA 1NB2A 2BX6A 3EVMA 1NPKA 1NDKA 1BUXA 3EVOA 3FKBA 3PJ9A 3L7UA 3ZTOA 5IOLA 2B8QA 3FBFA 1S57A 4F4AA 1WKKA 1XIQA 4HR2A 4UOFA 3VVUA 1KDNA 3ZTPA 1PAEX 2HVEA 3VVTA 1NHKL 3EJMA 4F36A 5CAAA 1MN7A 3ETMA 2DXFA 2HURA 3FBEA 4C6AA 3FBCA 3NGSA 3R9LA 4CP5A 3Q83A 5C7PA 1WKJA 1F6TA 1LEOA 1WKLA 1BE4A 4KPCA 1UCNA 4UOHA 3DDIA 1HIYA 1B99A 1LWXA 4UOGA 2HVDA 3PRVA 4O0NA 3VGVA 1NLKL 3DKDA 4ANEA 2DY9A 3ENAA 1F3FA 4ANDA 3NGTA 1S59A 3B6BA 3Q89A 1ZS6A 2BEFA 4DI6A 5BXIA 3BBCA 1U8WA 3Q8VA 3NGRA 3G2XA 3VGUA 3EE3A 3NGUA 1NUEA 4WBFA 1K44A 1NCLA 4W98A 4DZ6A 1NDLA 3FC9A 4FKXA 1NSKL 2VU5A 1PKUA 5CABA 4ANCA 2DYAA 1S5ZA 3VGSA 2B8PA 2NCKL 1NDPA 3EICA 3BBBA 4FKYA 1B4SA 3ZTRA 3ZTSA 3EMTA 1EHWA 2AZ3A 1NDCA 1NSPA 3Q86A 3FCVA 2ZUAA 3WX8A 3ZTQA 3ELHA 1VYAA 4S0MA 4DUTA 3Q8UA
chains in the Genus database with same CATH superfamily
1VK8A 1HHQA 4LSLB 1YZ6A 3LQVA 4IFVA 4KGXB 5G0RA 3GJRB 4CO2A 2BBEA 1S76D 1OSCA 4I56A 4B3RJ 2AF6A 1VLYA 3UD4P 1G1XA 2GHWA 3TA0A 3SSQA 3W65A 4F4AA 3FZBA 3M8RA 2QA2A 3IGVA 2NXEA 2BMBA 4KR0B 3PR5B 4X64F 2FHKA 3PG9A 3PYEA 4TQSA 4Q8EA 4H4OB 3D0GE 1WF2A 3U1MA 3UNGC 3MXHP 3CMQA 1RTJA 2XY6A 2HW3A 1CS4B 2BEFA 4OYXA 3K17A 3NKYA 4XAKA 3C16A 3E01B 2NQPA 4UQGA 3GG1A 2D3ZA 4NRTA 5IC4B 4N7TA 2HBRB 4WFYA 5T14A 4X4PA 2WCXA 4YHHF 2R42A 1NK9A 4P73A 1VMBA 2FTRA 3MM6B 1TU0B 2ZOMA 1IR0A 1JLBA 4DQRA 2W4CA 5L1JA 2UUBF 3AB4B 5B0DA 4IQXA 1U49A 3SV3A 4RWXA 1FESA 2N7YA 1Y11A 3KLEA 3ADAC 4K4UA 5CZVA 2G0CA 4DSIA 1VRQC 4DZDA 4Q0BB 3MZIA 3UE2A 2GO8A 2GV1A 2Y1LB 1UFKA 3QATA 1WWHA 2DT9A 3R2CJ 1TUGB 1RGVA 1YZ7A 1FTCA 1NBEB 3PX4A 2B4PA 2HGMA 2L08A 4JI4F 3NAHA 2PD1A 4ZVGA 2ZKUA 2WBMA 2BKOA 2CPYA 4FS1A 5A8KB 2IDLA 4DPYA 5F9LA 1K44A 1X4GA 1S1VA 1YSJA 4O3RA 3H98A 2EG2A 1RQ0A 2C42A 4J9RA 2KT5A 2L9DA 2VBZA 4QWCA 1M5KC 2FLOA 2N3LA 1Y7PA 2HHPA 2Z56B 2E44A 4DQQA 2RT3A 1J2VA 2F63A 3GYGA 1N6QB 1IKWA 2ZE2A 4L76A 4CO0A 1RAFB 4MYUA 4N8OA 5FJ4A 2BACA 1QE1A 1TMMA 4OZ5A 1TKXB 5ETRA 2DNNA 1C0TB 1N8RT 3MWBA 5ETSA 4ZVUB 3OTCA 4ITSA 4FYDA 2W24A 4ZP6A 5RUBA 1K1SA 2HWTA 4WIQA 3JTNA 5KG0A 3IWXA 3Q83A 3Q2TC 1PILA 2CJBA 3P96A 1J27A 2KTQA 3G8SA 4RUCA 4Y2CA 2QG9B 3PIPQ 1IWGA 1P8GA 1TZ0A 3F44A 1U1KA 1P27B 2CAJA 3EWGA 4KHPF 4RBVA 2HWIA 3ULHA 3W5ZA 4AXIA 4K0KJ 3UR0A 3CDBA 3PHEA 1YITS 2X1GA 3HLUA 1Y0HA 2R4FA 2I2YA 4RUBA 3VAMA 3SEOA 4MYTA 4I7FA 5DO2A 2HK3A 5HP1B 1NSPA 2DNMA 4L75A 1DJ0A 4M95A 4LQ3A 1Z2ZA 1H2UX 3Q24A 3R5GA 4DSEA 4OL8A 3C6TB 1RWOB 3I31A 1SIWB 2MTLA 4J9NA 3QT6A 3NS5A 3U7JA 4FVCA 3W63A 5I42B 3QIPB 2DGVA 4ECRA 4OHWA 4ETXA 2X3GA 2H5EA 3A8KA 4X65F 2PFDA 5F8IA 1RWVB 4PWUA 4LSZB 1LQ9A 3JSRA 4LF7F 1VBYA 4LF6J 3NWGA 1M0SA 3OTOJ 3UDCA 3NGUA 5AJ3F 2DNRA 3CCJS 2MZTA 4KYZA 3OJSA 2HS3A 2GAHC 2IPOB 1P9QC 3AXKA 3UNYA 2YX4A 5D8HB 2VPZB 4X62J 2XMMA 3VAHA 3D1OA 2DNZA 2IAJA 1Y5NB 3DOLA 1NSQA 3V81B 1JLGA 4RWWA 1PJ6A 3V6JA 1AA1B 2R2SA 1KVIA 2VFTA 1RAEB 4KGZB 5D0EA 4DV1J 5J2NB 3AT1B 1LW2B 4HI2A 2FJVA 1CQMA 5KG3A 2B56A 1FTRA 3OLBA 3A8JA 2APOA 4M5HA 5GMKa 4I1TA 3M2UB 4X4QA 3G6VA 3PY8A 1G3OA 2VG7A 3GZ7A 3QRPA 3UVJB 3CD6S 1NK8A 3KUGA 2QA4S 2BANB 4C8KA 3CT9A 1EAYC 4IR1A 2GW8A 1U24A 2H9ZA 2B4VA 2BJDA 1BQNA 2MKYA 3D0IE 1R6YA 3G2XA 3CC2S 5LSOA 2RE1A 4ZLJA 3FC9A 3K5MA 3DLEA 2QYGA 2OAUA 5C25B 4JI5F 4TY9A 1S97A 3RBXA 4HH1A 3GU0A 1S1WB 2JHEA 5L1IA 4DR2J 2ZUAA 1DTQB 1AFIA 3TUJC 2OKQA 4URQU 4LUBA 4DLEA 1I5OB 4ID5A 2MGZA 5L46A 3MDFA 5JVHQ 2AYGA 2Z57B 3FBBA 2P6TA 2E1PA 1QM9A 3GMGA 3WBZA 2XLJA 2R7TA 4KSEB 2GJIA 3P8BB 3Q23A 5E33A 5B0BA 4ID8A 1NK0A 3E3XA 1UCNA 5IWAJ 2OPQB 1YJVA 1TL3A 1KONA 3M8PA 3MOJB 3RB3A 5BYSA 2R2TA 4C11A 2JX2A 4YMEA 4UW2A 4Q5VA 2A2CA 4ZVPB 3M8WA 2MHEA 1WOOA 2OELA 2V2ZA 2YQ3A 1OPIA 1VJQA 2O01C 3N4WA 2GHVC 3H4DA 3KLVA 5DRKA 2M9KA 2ACYA 2G1DA 2N4CA 4YR2A 2WRMA 2AW0A 3J7A1 1AUSL 1FO1A 4GVLA 3NS7B 2UXCJ 2LECA 4B3TJ 2CYYA 4KY3A 3BSAA 3EPGA 5HQLA 2QRRA 3GB0A 2B7CB 2OPPA 3C66A 1KLMA 3DRRB 1D9AA 3V6KA 3FKBA 4P2FA 1CEZA 3OBIA 4DR1J 2ATCB 3M6UA 1RK8A 1HBUB 1ZBTA 3HHLA 2RUGA 4DU7A 1KRPA 4QJVA 1B0PA 1NJXA 4DV7F 1JLFB 2DBBA 2DH7A 4I6AA 2C1EB 3UCZP 1DQ8A 4M5DA 4L3NA 1FEHA 4LT6A 4HT7A 4P71A 3PEJA 2ZH2A 4B3MF 1D09B 4EGLA 4AE5A 4QOTA 3T9ZA 3BB5A 3QWUA 4QIEA 2WOMA 1HQEA 2M7SA 2GZOA 4B3OA 4N76A 1SXLA 1W25A 4ED7A 1KQSR 5C2GA 1KHWA 5KFTA 4ER8A 4J5OA 1YX2A 2F9JA 2H5IB 1AUDA 2BM0A 4H54A 5T7LB 3PACA 2DXEA 1YJNS 2V67A 3I0RA 3R8YA 4LF5J 1KQKA 3R5CA 1N0UA 2R7WA 1V9OA 2GVZA 7AT1B 3I4PA 2IRXA 4ZVFA 4OYPA 4ZDNA 2YNIA 2BOAA 2FZCB 1NPRA 4YOEA 5AXMA 2DVIA 1S6OA 4MJKA 2QL7B 4C9DA 2X1FA 4IH6A 3HVRA 1VS3A 3DDIA 4AL5A 4F02A 1SCJB 4JI2J 5CA5A 3HO1A 2RRBA 5BR8J 2E66A 1TL7A 3O8WA 2XMKA 1KN6A 4OHXA 3T5JA 4RBUA 4CLZA 1VJWA 1VBZA 3RR7A 4DX5A 4ZPDA 4UF4A 3TAQA 2VKZG 2V0NA 1NK7A 9RUBA 1VQLS 2NR0A 2QIFA 2VBYA 3Q22A 3DU6A 2H51B 5FDLA 1JLBB 4KKOA 3R27A 2UV8A 2P5VA 3HD1A 4O44A 3UCUP 2EFPA 4WIIA 2YKQA 1MMLA 4NPOA 1MWYA 4JI8J 1MWQA 2XTJP 2RU9A 4EBDA 1FE0A 4ZCMA 2HVEA 2FHJD 1S6QA 1W2BR 4ZKAA 1L3SA 2MXYA 1G2EA 4DV5J 5DJBA 4F7VA 3M9MB 3JB9k 2HAFA 4DV6J 3QRQA 3I0SB 5F8LA 3NXZA 5ETNA 1UVIA 2QL5B 1ZM2A 1ZYQA 3ZZ0A 5GAGI 3IBFB 3C15B 4DL0C 3PO4A 3KOAA 4IG0A 4ZVSB 1VC0A 3NBPA 3W9JA 1PJ7A 4ANCA 3DOKA 3NNCA 4K4ZA 3CIZA 1VQPS 1S1XB 1T3OA 2BQRA 2ZE2B 2UUTA 2HMIA 5K8NA 4O3SA 2VONA 5EWFA 3GILA 1S6PA 2IM1A 3TJ9A 2Z2ZA 2BQUA 5IS2A 4PUOA 1Q1KA 3OLAA 4CI0B 2HFZA 2VPWB 2YBVA 4XO0A 3MFIA 1R27B 2XS7A 4NZ7A 2YKMA 3ZZUA 2OEKA 3M8SA 2NYIA 2E9RX 1SC3B 4F4KA 3W7BA 4A8KA 3LP1A 2KHDA 4HT5A 9ATCB 1PSDA 1YIJS 2DHSA 1R0AA 1SI9A 2W7OA 4DV1F 3M05A 3KNAA 2KDOA 4EZ6A 2DGSA 2JFDA 2RQCA 2CZ9A 1GEHA 3ET6B 4DSKA 4DU8A 4KFBB 2XO6A 4ED3A 1NPPA 1FDBA 4DV2F 1HBNB 1FRXA 5I4MA 4QYZK 4U7UD 4J9LA 4DR7F 1OYEA 3LO3A 2CQDA 1XNRJ 1NH7A 3OR1A 1KQFB 3FEZA 4LJMA 1JKHA 4MK7A 3CCZA 3Q8YA 2R2RA 1VQMS 2VG5B 4NYZA 3NG8A 5CYQA 4DV0J 4WCEQ 1HI1A 4G1QB 2EK1A 1XMQJ 5D0GA 1WC6A 3RAMA 4LMZA 2B8QA 4NA1A 1VDHA 1J5OA 5F8JA 3DYAA 3IRWP 4DR2F 4DS4A 1JLQA 5E5NA 1MU2A 3H90A 3UPFA 5GMDA 1SV5B 2V8GA 2YWHA 1TR0A 1MWZA 3PW0A 1HMVA 4DQSA 4ZOSA 4OIXA 2FJEB 4FNIA 2UXBJ 4JOUA 4Q8FA 1VRUB 2AD9A 2MKIA 4CRJA 3W5XA 1RACB 2GIRA 4Y2KA 3JQMA 2FLLA 4RW6A 1DLOA 2PA3A 3RRGA 3EXYA 1XNQF 5AE2A 5LOQA 4L73A 2AYBA 1U2FA 3D2WA 1Q7YT 2XB2D 4P2SA 3HVAA 4LIRA 3PXGa 1RT4B 1LKZA 3JS9A 2JFKA 1RWPB 2QYCA 2ZDPA 4DCJB 5SUHA 1S4EA 1HYSB 1RHMB 3MM8B 3OPKA 3HPOA 1FK9A 1Q0NA 2O67A 3M8QA 4K5RA 3AH6A 5C24A 4FP9A 1U1PA 1JXVA 4A8YA 3SQGB 3EVOA 3BREA 2P8IA 3T1YF 1ICEB 2H1YA 4WE1A 4CCHA 2WVEA 2OTJS 4B9TA 4LBHA 1SQGA 1SJ1A 3JAMU 3RRHA 1RKIA 5LSLA 1RWKB 3DU5A 1FI4A 2MSSA 3PKMA 4KTQA 4DR1F 2P9CA 2MQLA 4Q43A 2NPIA 3W9HA 1VBXA 2C3YA 5K8OA 1X9SA 1HPZA 2IM2A 1RB0A 1NDLA 3OSNA 3VR1A 2V6AA 3IMQJ 1YRTA 3G82A 1RHKB 3DLKB 3H4BA 4ZJLA 5DLFA 1ZZNA 1V6HA 5KT7A 1C1CB 3T1HJ 4KGVB 2KG0A 3I32A 3CUNA 3AFGA 3CO0P 1S0MA 1V3ZA 3W66A 3AOAA 4NXNJ 1F0XA 2RVJA 3SZ2A 2AJ4A 4DN9A 4QW8A 4NL5A 5HK4A 5DGAA 4B9SA 2HQFA 1UETA 5IV4A 3EUNA 2DR5A 1K9MT 1FFWB 4R25A 4UZCA 1XEZA 2G4BA 1U48A 4ED5A 2G9OA 1SL1A 3OXLA 3R6LB 1LOUA 3M8PB 4A46A 3MM5A 4DN0A 4HLBA 2MKKA 2XCPA 5BYQA 5F3TA 2J5AA 2QGFB 3FJ2A 4WTYA 4BC7A 1A7GE 1F3FA 3NP5A 2ZHAA 5IZHA 4WU3A 1T95A 3E51A 3DRSA 2AGQA 2OH2A 5EGYA 2UUCF 3K89A 2D9PA 3KLIB 1TQLA 3GFYA 3MTKA 2PEBA 2KO1A 2ZEJA 2MLYA 4IKAA 1FXLA 3DM2B 1EP4B 1N5YA 1E6VB 5KFQA 4AD6A 3I9ZA 1PAUB 2HFVA 2J6TA 4RBTA 3SYZA 4P75A 3A3NB 3IG1B 1AB8A 3KKFA 4F36A 1IXKA 2YXLA 4QYRA 1U1QA 3DNCA 2XZTB 3RW6A 4LRDA 4JI8F 3IBWA 4UQTA 2RF2B 2VICA 3UFCX 4LVNP 4DFPA 3T6JA 2C2OB 3RRKA 3W8GA 5ETMA 1S9GA 1UZDA 2R8JA 2DR8A 2DNOA 4PQUA 2WW4A 5DM7Q 3IRXB 4H4MA 1WTFA 1U2RA 2GA7A 4DDFA 1XC9A 1IKYA 3CE8A 4FPIA 1F5BA 4C3MA 2EFNA 1FJGJ 4JB8B 1RT6A 2V94A 4I2QB 1VQNS 1U1NA 2DGUA 4BS2A 3CPWR 4I6YA 5E3RA 4B02A 2W8KA 1Q82T 2JEFA 3MAHA 4OZ1A 1VQYA 3CJQA 4CO3A 2QEXS 2XSJA 4NCGB 1S1TB 3C6UA 1B70B 2LLZA 2DD8S 1AFJA 2AJ1A 3M2RA 1IBKJ 3TVKA 1HWIA 1H38A 5J2PA 4CP5A 3BSNA 2PSZA 1WKJA 1AYEA 1DTTB 1FDNA 3M1VA 1SJQA 1WC4A 4YDXA 1GH8A 5EHHA 2XMAA 3MAAB 3EGVA 3H25A 2VF3A 4DZ6A 3V4MA 3X3UA 3MM7A 1S5ZA 3OXFA 3OHAA 3RB0A 2RQKA 5B0FA 3JTPA 2CUYA 5HMYA 8RUCA 2DNHA 1QSSA 2V8DA 1SKRA 2B4OA 3KK3B 4ZVHA 2QLBB 2L48A 4Q44A 4KHMA 4O0IA 2HGNA 2VFUA 4F3QA 1IKVA 1CG2A 1TL4A 3POTA 1OYDA 3CCWA 1QY7A 4KRWA 2EKYA 1FERA 1X4CA 1GNKA 4O3OA 4LFCF 2ZZNA 3BQ0A 3FFIA 5KFMA 3D1HA 2ROPA 2EXUA 2XGQA 4RUHA 1PBAA 5CCMA 1NEEA 4O4GB 4JI6J 1G6BA 3QMQA 1X5OA 2FY8A 1YGYA 4RZRA 4O0NA 3BGRA 3ISND 1O51A 2JEJA 3OUYB 3JTOA 2FZGB 2PMZD 2YNFB 4KQZA 3NBPB 1U0HA 2HNYA 4EBEA 2VDHA 4R5PA 1RKJA 3DLGA 4ZMMA 4X4OA 2MJNA 1S48A 2HNDB 4DX8H 2XEXA 1P6TA 2DK2A 5CABA 2NUHA 2HHHJ 3RAXA 3DLJA 4WWSA 1FRMA 4CNYA 1FKOA 3L7PA 1HWKA 3AJ2A 2BA9A 2J0XA 3Q8UA 1SKWA 4EEYA 2E5HA 1JLEA 3F41A 3QLHB 1DQ9A 5H9EK 2V4QA 1HBOB 2FHJA 5C42A 3RBDA 3FDSA 3ZZTA 3HZGA 3OL8A 1OS5A 2A6OA 4PXEA 3QBCA 4LF8F 4ICLA 1T9YA 4FYWB 3OXGA 3IR6B 3IC1A 3MEEB 1UL3A 2J9DE 2AQ4A 1PYTA 1RBOB 4RNFA 4YUDA 1RT2A 4JI1J 3TAPA 1VK3A 1XTZA 2JWNA 1G7CB 2EG1A 1V3SA 2EK6A 5KFCA 1T7PA 5FIIA 5A8RA 1LFPA 5H1SV 1SJ4P 4NLTA 1UPPA 3BYRA 1HHSA 2HYIB 4IG3A 3UCGA 1X9MA 2XS5A 1MROA 4OMFG 3OR2B 4WP8A 1O0PA 2JVRA 3RW7A 2GFFA 2WAQD 3IAM9 3W5YA 5HBMB 2ASLA 1SBRA 1F5AA 1QLNA 1JKHB 3LP0A 4ZIWA 4KPYA 4FBTA 2K1RB 1S12A 3M7VA 3Q86A 2EFGA 1RWWB 4CH1A 4TYBA 3WZ0A 2PFFB 2YWFA 4LFAF 4ES3A 5KFJA 2R7SA 1U6FA 3GTYX 3MD3A 1WC3A 2NXJA 3DOMA 1LWCA 2MB0B 2QO3A 5DDRC 2VG6A 1XMBA 3DMJB 2KH9A 4D3HA 3C3LA 1T9XA 4BC9A 1FRHA 2KT3A 3QO9B 1VQ4S 2JC0A 1RABB 1NHKL 3BZQA 4HKQA 3UW1A 1WHVA 2XC9A 3BV8A 4NXMF 4QIGA 3HKWA 1JLCB 4DSLA 3I9V9 3SSSA 5I3UB 3LP2B 3HF5A 7FD1A 1RWMB 1UMJA 5A0YB 1U8WA 3C46A 3BEGB 4OLPA 2Q6CA 4OV1A 4ZP8A 3GLJA 4OZLA 4N8NA 1YBAA 1LV5A 2CPDA 1N54B 4Q2LA 1NDCA 2JJ4D 3HZEA 1VQ6S 3U1NA 2MY7A 2V2QA 4DCOB 2XI3A 1IBLJ 2DXDA 1IKXA 2YTCA 3KJVB 3HJFA 5D4LA 4IFYB 3QSYB 3EVMA 1IM6A 3ENQA 1ULRA 4CDIA 2E5LF 3CCES 3HSZA 4UUWA 2LU2A 1RT1A 2ROEA 2YQ1A 5B09A 3D28A 2ZWPA 3LUYA 1Q8IA 3D0HE 3VAGA 2HLUA 2A3JA 3D7SB 2W2PP 5CYJA 3SCJE 5A8WA 1VRTB 1FWPA 1KLNA 4QWDA 2B5JB 4UOHA 1TUVA 4KO0B 1XR6A 3BKFA 3GWCA 3DI6A 4PG5A 1HPZB 2VPXB 3BSCA 1YG0A 4I68A 3BN4A 4NX9A 5IFMA 4OX7A 1HR0F 3D4JA 2B6AB 1T94A 1OQ3A 2UVRA 3WQPA 5B0CA 4CH0S 3HT3A 3BR8A 2DRAA 4OHVA 1R8CA 1KKHA 2M0GB 3DGVA 3N01A 1S0NA 1U0SA 1KTVA 3W2WA 1TKTA 5CD4A 1RTHB 1Z1ZA 2LDIA 4LIWA 1JXLA 2PC6A 2YNGA 4DV3J 3CDAA 5J2QB 2VFRA 3VAJA 3CDEA 1XMOF 2R7VA 1WJ9A 3J7AN 3RG6A 1NZAA 5F9NA 3UD5A 1XBWA 2Y0SD 1Q95G 4DPWA 3SXLA 4UOGA 2W1BA 4ZK7M 2ZUGA 1L3TA 5HMWA 2B0GA 5KFOA 1IBKF 1SL2A 2LEBA 1Q8BA 1M5OC 3KLHA 3V6DA 1DHMA 4OX6A 3PEHA 3M2VB 3FMBA 2ZHOA 2W7PA 2OJ3A 2FJDB 2DEJA 5ETPA 2QV6A 2W4PA 3GFXA 3BBFA 3GPAA 2X1BA 1IVZA 6FDRA 1IWAA 3B54A 1RXOB 2WHOA 3HDSA 4QR1A 2KM8B 1XWLA 4TNOA 2OSQA 1CQNA 2IMWP 3RYLA 2BUNA 4K4XA 4G1PA 5KFLA 1ZM4A 3KMSA 2NSCA 1IR1A 1RCXB 2BJ9A 3FGVA 4LREA 1WD6A 1EKSA 4MAKA 3U27A 3FBCA 2C28A 2KJWA 2JRSA 4ZPWR 5HMZA 4F2SA 4B9MA 1Y9OA 4TY8B 3HULA 3PRBA 1VFJA 2EWHA 4NLSA 1PO6A 3PJWA 4DUYF 5KTQA 3NGRA 4I64A 2YKOA 4JV5F 4AUKA 5KFWA 2KXNB 1BGXT 4DHVA 1YJTA 3MHYA 4JI6F 2VC0A 3LPYA 2Z2YB 3WHIA 1DQAA 5LSRA 2OEMA 3JAMY 4FNHA 5IM0B 2KHCA 4B17A 1HQUB 2C3UA 3KK2B 4DF8A 2ZBIA 1KOOA 3I56S 5F0UA 4YY3J 2HHHF 2GGPB 2DNYA 1N48A 1HWUA 3ITHB 3E2EA 3E8OA 2QC3A 3UDVA 2DR9A 2VBXA 4C0HA 4YB7A 2PEHA 2VASA 5LMNJ 1CBKA 3W62A 2DXFA 2FHMA 1HNVA 1RA7A 1S4FA 3PFEA 4ZP9A 3A12A 2MZSA 3L7OA 2AEFA 4CQ1A 2HVDA 1RCOB 2H65B 1YBTA 2AHOB 4CLPA 1Y4ZB 2YKNB 2Z2MA 1GK8A 5K8PA 2ZC3A 1N34F 1X4HA 2UUAF 1NO8A 4X64J 1FFGB 3PIOQ 3C19A 2E1CA 2FJXA 1RDRA 1S9FA 3ZZPA 2BKNA 2YWEA 3MMBB 3PTWA 1N52B 2MPUA 1D8YA 1IKVB 2DITA 1HLWA 1TL5A 3NOGA 1JIHA 2IRUA 2ZNZA 1H72C 4KV8A 2PE8A 4FXWA 3TVZA 4A47A 2XWYA 2HWHA 5KG6A 2O66A 1UVJA 3FSYA 2BE2B 4EO6A 2YNHB 4YHHJ 1KVKA 2YKAA 3O3LA 4UT4A 4P52A 1NSAA 2YVSA 3BGRB 3K5LA 4ECZA 2FHOB 3DGPA 2Z4PA 2VC1A 3VZHA 2UUBJ 3X1LB 4OI4A 4CTAB 4G1IA 1ACMB 2D3O1 2UXDF 3EXCX 1S1UA 4NLOA 4L3KA 2EKNA 2YH1A 3GCXP 4PWDB 1T9VA 2AT1B 2YPYA 4Y2AA 2RNEA 4Q2MA 1DBDA 2V9KA 3G96A 5ADZA 1RAAB 1BWEA 3MCOA 3NMAA 3BO2A 2C2NA 5AXLA 1DARA 4ZIVA 2RDIA 2V2KA 4JI4J 1HI8A 3EVWA 1Q79A 1D9FA 1DFDA 3LPEA 1KEKA 2MY8A 2RKIB 5KFEA 1WELA 2NXCA 2CQ0A 2XY5A 2BZ2A 3IS9B 1Z2LA 3LW5C 2I6WA 4L72B 2DCUB 5CYMB 3HSGA 4FN5A 1ZTWA 2I5JA 1FVQA 4FS2A 4ILRA 4D3GA 2K3IA 2WONA 3KLGB 1UEUA 2DIVA 3QGHA 4Y2MA 2EPIA 2PT0A 1N88A 5J2MB 2W8LA 1LEOA 1BE4A 3M30B 2X1AA 2DTJA 1JJ2R 1JLAA 4KE5A 4HHHA 2K3KA 4ZPAA 2ZH4A 3KNGA 3R1HA 3BBCA 2GIQA 2YX7A 1HNZF 3HP6A 1FWLA 4WZQA 4NASA 1EETB 2EEYA 4J9VA 2HBZB 4B9VA 1TMJA 4PYAA 1AZSB 4CO5A 2NLWA 4FYVB 4JUZA 1WEXA 4GKJF 3DOMB 3SCKE 4ZVRB 3DXBA 1X4FA 4KHPJ 3TRGA 4RW8A 3CJSA 1RP5A 2HGLA 1FKAF 1Y3KA 4X84A 1XERA 2QE5A 2BX6A 4EFAC 5HQ8A 5F3ZA 3FBFA 2DRBA 2FVPA 4RL1A 1CJKB 4HVZA 3G8TA 4DG1A 4QBUA 2KU7A 4F8RA 4OYWA 2PMWA 2OLWA 4IDKA 4PABA 4F3MA 1F2GA 4B3SF 1QTNB 4WZMA 3EDQB 2DGOA 1KFDA 2L41A 4USJC 4ANEA 3MEDA 2V4JA 4OLOA 4WF9Q 3BO3A 2XNRA 1GX6A 1MW7A 1RSCA 5D3GB 4DQIA 4ZJQA 1R7IA 2EW9A 4X65J 4FXDA 4PZVA 1S7HA 1E6YA 5DG8A 2ASYA 2XYPB 4PG4A 2CQ2A 4F04B 4LF7J 3G9CA 1R8AA 4PG7A 1TFYA 2E5GA 1T0TV 5AJ3J 1RZMA 4NEZA 3UI3A 2CNKB 2FVQA 4KGKA 3R5BA 3QWPA 3FCHA 4DXLA 2VV5A 3EGNA 1A6LA 2ZWOA 1RTIA 1S99A 1UEKA 3MCNA 3KLFB 1IQZA 4PQAA 4P2XA 3G71S 2YX1A 4TLQA 1UA0A 3ISNC 3RJMB 3MEGA 3K2YA 3RAQA 4F2RA 4YB5A 3TARA 2GVDB 1UWBB 3CB4A 2V50A 3AA9A 3CSKA 3BM7A 2OO4A 2HK2A 3VGUA 5LXRA 2ZD1B 2KT2A 4ECSA 2F40A 3KDNA 2QL9B 1YVFA 1HI0P 1NJWA 3SFGA 1GXUA 1CJTB 1GTEA 3HHEA 2CJQA 3LWMA 4R0EA 4NEYA 4K4SA 5GAGU 2CNNB 5KFUA 1NJYA 2DHAA 1FNMA 5KFIA 5HANA 3HHNB 2D9OA 1NM2A 1RTDA 2CZ4A 2F4VF 3O6QA 2XULA 2KVQE 4JYAJ 4R8UB 2XZDB 4BBYA 4HEA9 2WVCA 4MK9A 4LBIA 2Y8WA 4DFMA 1EB0A 3KFWX 2JH3A 5HO4A 4ZCIA 1LWEB 1I94F 5KFPA 4NLDA 2GS8A 1WF1A 1TTHB 4MK8A 5FLXU 3GONA 1RJJA 2PN6A 5FD1A 2OD6A 3S1TA 3IBCB 1L3KA 3C14B 3KUEA 4N56A 4KAIA 1SH2A 2V34A 3ILLA 3WC2A 1TVRB 2ZH8A 4FF1A 2MKSA 3MM9B 2HNZA 3VV2B 4H4KA 2LXIA 1NKCA 4JBCA 2HLTA 1OSDA 1M1HA 5HVHA 1WG5A 4HH0A 4OYIA 4DCPB 2AMCB 4Z2XA 1R0CB 3JYTB 3EZOA 2E5JA 2Z8QA 4GO7X 2LMIA 3TZYA 5B08A 1M1KT 1NDKA 1BUXA 4CLKA 4KH1B 2ADBA 1C1BA 5M2UA 2KB2A 4HHJA 1U1LA 2IA0A 1DRZA 1QAXA 4PAAA 4NOHA 4LF4F 2OHDA 4USMA 3AAWB 5IT4A 3TWZA 3M6XA 4MKVA 4WK1A 2DKOB 3WIVA 4X4RA 4PPZA 4FZVA 2DHGA 3CO9A 4OI6A 1N5QA 3THPA 2BW7A 1S9EA 2AJ2A 4DV7J 2J0WA 5G4DA 3VTIA 1FD8A 2F9DA 2OI2A 3LWLA 2JLFA 5K14A 1N33F 3RR8A 3L9ZA 1B4SA 1U1OA 3IAS9 1H74A 4B3MJ 4WFZA 1JJCB 2EFOA 1UP1A 4KB7A 4LF2A 4LSNA 4ZVOB 4NWBA 4WXOA 4NMXA 5IQQA 5IC6B 4HDGA 4J9QA 3DDKA 5LMUF 1S57A 1X4AA 1WKKA 4QPTA 1FKPA 2OPSB 2XSFA 4DL6A 3CTRA 3GQCA 2RD5C 3C2PA 2DHXA 5MLCV 2QJ3A 1RT3A 3RZAA 3DCAA 3JSMB 1B99A 4YB6A 2XNQA 2MKJA 2HVIA 2X3DA 3UO0A 3W60A 4GVBB 1FRLA 1TV6B 3AQOA 4F0HA 2IJFA 2F1FA 5F8NA 1VHIA 4RW7A 1SL0A 1NSKL 1CULB 2J7UA 2XG8A 1LW0A 4PXBA 5LXYA 2J9DA 3PDNA 2N7CA 1ZPWX 3W2VA 3WX8A 3MMAA 2M3DA 1RT7B 4OZJA 1PGZA 3HVTA 4NI2B 1Q8LA 5HLFA 3IR7B 4DR6F 1TKZB 2D69A 2MDAA 3FZ2A 3SMZA 1T05B 5ETKA 3CCUS 3LAKA 3LAMA 3EGZA 2WVDA 5K5MA 2IY5B 1T03B 2JNJA 3HHKA 1CC7A 4Z37A 1REVB 3MCMA 5CHCB 2WSEC 2B9XA 4DWIA 3R97A 4GO5X 3MECA 1FX2A 2AEMA 3ETMA 1NK6A 1X4EA 5B7WA 2ZC4A 4USIA 4IH7A 4XTTA 1OIAA 3CVKA 1HNIB 2HZVA 1Q7LB 4DPUA 4GC7A 1HBMB 3PJXA 4K50A 1Z4UA 1WUUA 4ZVEA 4ECWA 2VBWA 4CO1A 5LJ3Y 4K5SA 2VU5A 4HL9A 3L09A 5KG5A 1RAIB 3V4IB 3D9BA 4ZPVR 2IRYA 4LR8A 1HWJA 3MPUB 3MPVA 2R8HA 4M5NA 2ASJA 4ECTA 2CFXA 2MZ1A 3G6ES 2GQQA 3EGWB 3V2UC 1CJUB 5JXSA 2ALYB 5KFXA 2C2RA 2CWKA 2I5JB 2GO9A 2J0SD 1FDDA 1V3RA 2R7UA 4NYOA 1NHVA 3BQ2A 4DL5A 4MFBB 4B9UA 3P45B 4MMOA 4DR5J 1NZ8A 1X5SA 3M32B 3VVTA 2AIRB 3CJKB 3TAMA 1TP7A 4LSLA 4P6QA 4DJBA 4RUAA 3N0VA 1CLFA 4X4SA 1LWFB 1NLKL 5IXUA 2KFZA 2RDJA 3M8ZA 4HACB 4CYUB 2O3DA 5DZ6A 4RX6A 1RT5B 3SSRA 3CJ2A 1VC6A 5HATA 2V2VA 4I2PB 4QWBA 2AYMA 3NRBA 4H4OA 2AZ3A 4DUZJ 3DRPA 4M63A 1RI7A 3QGGA 4JI7F 3M9NB 2ZH6A 4URSA 1T02A 2AZ1A 3GP9A 5M2PA 4ED6A 3D3CJ 5GMEA 2VH7A 4IYQA 2A0FB 2HBYB 4MKAA 4CM0A 2DNQA 4TN2A 4DV2J 2LQJA 4DG1B 3E01A 5ETVA 4X4NA 2P6SA 6AT1B 4DR7J 4XIUA 5EWGA 1X5PA 3WX4A 1UKUA 3CCRS 1SB6A 4X4VA 3UWTA 4NLWA 2F8HA 2VB6A 4PR6A 2XYGB 2ZFHA 2V8VA 3MM6A 4K4VA 3ZXWA 4OZ0A 3AOBA 3GFZA 1CJVB 2HHUA 5KFDA 4JYAF 3NGTA 5EX3A 4KC5A 3KHRA 4LF9F 4Q0BA 5E7OB 1VQ7S 1BC6A 4OZNA 5J1EB 3R7NB 2G0JA 1TL1A 1WF0A 3MMCB 2L9NA 4PXCA 1BQMB 3BBBA 3JQJA 2K7JA 1KNZA 3CNQP 1VYAA 3TJ8A 3JSBA 4A8MP 5MAOA 4U95A 1C0UB 3BH7B 2AEJA 1IM4A 3T41A 3KJQB 5A8KA 1NU4A 1T9UA 3KDOA 2BM1A 1XNQJ 2KZZA 3BSOA 2M4MA 1VQOS 3D68A 5D0HA 4HR2A 2E9TA 2NZ4A 1ZH5A 4MKBA 3AY0A 2R9LA 1HW9A 1N6QA 3B78A 1OPZA 4ZVQB 4ZHRB 3TX8A 3H5SA 4PKDB 3J81j 3L4BC 2J9CA 2CQCA 1FXRA 3CCTA 1VBKA 4YFUA 2K7KA 4J9MA 2CDQA 1TKXA 3T1YJ 3D66A 3I55S 4EZ9A 4J9PA 5H9FJ 2PO4A 2BJ8A 2HIYA 3S01A 2MZJA 4W98A 5HROB 2CQBA 3F0NA 4TVAB 2P9GA 1PKUA 4F4XA 4FKYA 1RAHB 2J7WA 4WYWA 2BXJA 2VJVA 2HQGA 1U6BA 4NLYA 5EUHA 4ZJOA 3V5RA 2FUG9 2UP1A 3CCVS 2BOPA 1EIYB 3NLCA 2VUGA 4O23A 2C2KB 5KT5A 2CZVC 4RW9B 2WSCC 5AXKA 4DV4F 2CRLA 5HP1A 3PNIA 5D4NA 3GV7B 2HFSA 2GMJA 2PIIA 4HTJA 4AFFA 3I4HX 3GR1A 2OPRB 2QSWA 4J9SA 2IYIA 2CA9A 2XLIA 3KJFB 1YQHA 3UDEA 3C6TA 4IFVB 5G0RB 5I42A 4M5JA 3QIPA 2RDDA 1IUJA 3MR7A 3GV5B 1J5EJ 3ETOA 2CPIA 4X66F 1M5VC 1WC0A 4DEZA 3EZUA 3HFKA 3CJ4A 2FJWA 5GAHI 4B08A 3KMQA 3Q8RB 3ELHA 3BGLA 1Y5IB 2OEJA 1BHNA 4LQ9A 1R31A 1W7WA 4O3QA 4WKYA 1MNEA 4K4WA 5JVGQ 1C1BB 1VGYA 3CDWA 1RTJB 1L3UA 1Y3JA 2GCFA 2F65A 2HQ3A 2UUCJ 3SCLE 3VWSA 1YJRA 3TZZA 3N5FA 1JB0C 3I5BA 4AXJA 1RAOA 2KXHA 3C16B 4CWBA 3V81A 2RAQA 1H2TZ 3BDPA 1GXTA 1N32F 4P2MA 3OT9A 4I67A 1LWXA 1VLOA 1NK4A 1AROP 1F1BB 3FQLA 8AT1B 1LW2A 2R7RA 1K0VA 3N6LA 3H5YA 5JUMA 3AOCA 4OYOA 3M2UA 4ZCLA 3MR5A 1QDUB 3KLEB 1SH0A 3PW5A 4ILMA 4PXDA 3UVJA 3EMTA 3D5MA 2BANA 4O3PA 1U02A 4FYYB 1S77D 1IN0A 1HWLA 2GQ2A 2H5JB 4R0JA 4XK8C 4TU8A 2ZHBA 4OV6A 1YK9A 3QZ7A 4DS5A 3MPDA 3WDOA 3TNVA 3M8YA 4ZLLA 1BWVA 2Y1IA 2I8EA 2JOQA 3HHLC 5ETTA 1T3NA 3ZZZA 3K8WA 4WP3A 2LP4A 1B64A 4X4TA 3R5DA 3TJAA 1T9WA 2HFNA 1DTQA 1S1VB 1RT3B 4DLGA 4IRKA 3N9UC 1X0PA 2GNKA 4URGA 5D4PA 1R3NA 2AWZA 1ZAWA 2M8HA 3HKZD 1C4CA 4QZVB 4ZN1A 3MAQA 4C8NA 2MLXA 3KK1A 3D6HB 3OTBA 2JL9A 1IKWB 1M5SA 2IDEA 5ITHA 4DR5F 3GIMA 1QTMA 5HSPA 4Y6IA 4LFBF 4QIWD 2N4DA 4ES1A 2Z0GA 1QE1B 2HS0A 4CLYA 3W2VB 2ZOGA 2VA3A 2JEGA 1YRXA 2LVWA 1EHWA 5DGBA 4IO9Q 1M5HA 2OPQA 8ATCB 2H54B 4F50A 3AJDA 3CC4S 2QSFA 3OFEA 4LRFA 1WI8A 3D6FB 5FLXY 3HVWA 3HX9A 1N0VC 1I1GA 3BO4A 5EX0A 5K20B 1C4AA 3H42A 2YWGA 3B4DA 4E0DA 4DUZF 3A3OB 2DGXA 2CNLB 5KFGA 3JQKA 1P1LA 3EPIA 3PYFA 5CCLA 3K58A 4I7FB 4MT1A 1SJFA 2PDAA 3PM9A 3CJ3A 2VJUA 3DRRA 1U25A 3ENAA 2KYZA 1HD1A 2XMVA 3ZO7A 1UW4A 3SDEA 1HBUA 3IXQA 2ZKTA 2MJUA 5F0WA 2DGQA 1L3VA 2MYFA 4AL6A 2G2OA 3T6BA 4J9UE 1PC5A 4LFCJ 3MOZA 2HHVA 2G13A 1JLFA 3FQKA 5F8GA 1UA1A 1X7VA 2W2NP 4USHA 3SCIE 4OZ2A 4CLWA 1FFSB 1HA1A 2G0IA 3NOCA 3G86A 2MQOA 1SKUB 4I6WA 5E0OA 1B3TA 3Q0AA 2H3EB 3O2IA 1ZTTA 2ACMA 4E98A 5KAKA 3PW2A 3FRYA 3MR6A 1WC5A 4ALZA 2Y0BB 1S72S 1REGX 4OHYA 5B0AA 3TAMB 1MMDA 1OO0B 1PYOB 1YJ7A 3GJSB 1M1GA 4XPCA 1FCAA 1RADB 2FJBB 2UUWA 1B0TA 1HARA 1JNRB 2ZM6F 3C8YA 5T7LA 2DGTA 4FDFA 4ED2A 1FVSA 1ZAXA 1PIEA 2KRRA 4LF8J 2IAJB 2I1RA 3IM8A 2XCAA 2MQPA 3DOLB 2AKWB 1JLGB 5D6GA 2F5GA 1RAJA 2QTWA 4FF4A 3DRPB 3S7RA 3O5TB 1N4LA 3NCRA 2C2MB 3KJNB 4L74A 2GIFA 4LRBA 2QLXA 5HAOA 3PR4A 4C48A 3Q8QB 1ZAVA 1QJHA 2VG7B 3D3BJ 3RGIA 3M9OB 3R2DJ 3PX6A 1ZETA 3Q8SB 1ZA1B 3MPWA 3PW4A 5K8MA 3WIUA 1BQNB 4ECUA 3AJ1A 4DFKA 3K5OA 2XZWA 3LOUA 2WZ1A 4N77A 4KT0C 3D6MB 5KFNA 5A2QU 2QA1A 3DLEB 4LFAJ 3TP2A 2R7QA 1F6TA 1QD1A 2OGUA 5KT3A 3QGPA 2MQQA 2DNKA 4CO4A 2F8EX 3BN7A 4ID5B 4YDDB 2UU9J 2MGZB 1TL1B 3B4MA 2ZJRQ 5SZTA 2KFYA 1GT8A 1S79A 3EYZA 3BPSP 3K7RA 3KG4A 5DM6Q 1TAUA 1SC1B 2EBGA 4PWWA 4DR3F 2GHPA 2DYAA 4JI0F 3T5LA 2BYCA 4NXMJ 3VQTA 4DX6A 2Q1LA 3I0SA 3IFEA 3LALA 3FCWA 4RR5A 1UWAA 3EZ5A 3SFUA 1MN9A 3FK4A 2IHR1 2IVMA 2RS2A 1ZA2B 1X9WA 3DRXA 1J5EF 3C15A 1K8AT 1SVDA 1S0OA 1TL3B 3CCQS 1WTBA 3NMRA 4C11B 2OFHX 2VZ9A 2VD3A 3ILJA 1RA6A 4C7QA 1S1XA 2CPZA 2GQCA 5K9FA 2CPEA 2RUSA 2HAIA 4HYKA 1HL6A 2OUGA 2HURA 1H2VZ 2CQ4A 1NH8A 2KKHA 3P6YC 5DS7A 2LXFA 2HVHA 4XDDA 4I69A 4NYPA 2E5LJ 4X2BA 4LF1A 2VHGA 3T19A 4E8UA 1FJ7A 3TA1A 2XMUA 1KWMA 4USTA 2OPPB 1WG1A 1KLMB 3A8EA 2E7XA 2DIUA 1R43A 2RILA 4JI3F 4W4MA 5AE1A 4LR9A 1RBAA 2A2DA 4DR4J 3HHLB 2AJQA 3MCSA 3J7YU 1FHTA 2VQFF 3ET6A 4M5DB 4KFBA 1TKDA 1HR0J 3GJQB 3I96A 1O6XA 4UZBA 1YJWS 2W2MP 4IOAQ 2G2YA 1HBNA 4AYBD 1SC6A 4BLGA 5D0RA 4IQMA 2WOMB 3QYYA 1HQEB 5DQHA 4NA2A 4B3OB 1FNOA 4WXWA 2VG5A 2NPFA 4ZN3A 2CIMA 2NYHA 3KTQA 2D3OR 4G1QA 1H73A 4AQYF 1FX4A 3DKDA 3OD2A 4U8YA 1T11A 1UPMB 5KOWA 3I0RB 4RU2A 4KH0B 1SV5A 5KG4A 1XMOJ 2XI2A 4FKXA 3K5PA 2GVZB 2ZDOA 3VGSA 4Q7AA 2AU0A 3QJJA 5HJXA 2XLKA 1VRUA 2YNIB 1A9NB 3AD7C 1I6JA 1PCAA 3TX0A 4GKKF 4FBUA 2ATLA 4BHQA 2HZCA 1PJ5A 1SPBP 3P49B 3T5KA 3GIKA 1NPKA 2YY3A 4V19X 5IT9U 1TL7B 4RW4A 1BQXA 1NK5A 2FQQB 1X8DA 5J1PA 2EI5A 2DR6A 4BDPA 3AD8C 5E41A 1RT4A 4EYHB 5CAAA 3DHXA 4ELVA 1XN9A 2LEPA 3FEYB 1HYSA 3MM8A 1VC5A 2R8KA 3D54A 5FDLB 3IO1A 1FNXH 3SQGA 3P4UB 4KKOB 4K4YA 4PG8A 3ZNUA 3OTDA 4P72A 2QFIA 5A6PA 1S6UA 1RU2A 4A8WA 4NE9C 4O44B 1IBMF 3GE9A 4CLSA 2OMLA 1NXIA 5L39A 2BW2A 3R7SB 3GIIA 3ZNJ1 3TUPA 1S6QB 4FF2A 1VQ9S 2M8DB 1HNXF 2RQ4A 1O8BA 4DL7A 4ED4A 1WHWA 1OMSA 1KSPA 2NUUG 3IR5B 3CW2C 4DUYJ 4NLGA 5F41A 2FY1A 2K06A 4JV5J 1RHRB 2FC9A 2P9EA 1S10A 2V69A 3PRDA 3TR5A 2DCLA 3IWNC 5DDQC 3J81U 1RISA 5L38A 1H7WA 3DLKA 2WB4A 4EUVA 1C1CA 1KDNA 3QFHA 3RU0A 5LJ5Y 4IG0B 3NS6A 2BDPA 3FBEA 3TOQA 3GYXB 3DOKB 1GMWD 1TFWA 2FIUA 1YRUA 4EI2A 4V1Ak 2J0QD 2ZH5A 1R0BG 4OHZA 3KK1B 2HMIB 5GAEI 2LU1A 2BKPA 5GADU 1S59A 1YKWA 5JJBA 1S6PB 3PFOA 2JDJA 1BD6A 2WBRA 2C3MA 5KFYA 3CJ8A 4PUOB 2C2DA 2B7BB 1NCLA 1R8PA 4NLVA 3T9NA 4B3RF 3ENWA 4ZP7A 4RJVA 3KXDA 4EMDA 3N5BA 1Q8KA 3M4XA 3FSXA 2YKMB 4DL3A 3FNNA 3ZTQA 3GV8B 2HHWA 1YJ9S 1AT1B 3LP1B 4C8MA 2JEIA 1R8HA 1N34J 2WTFA 1RWUA 1R0AB 2ZBRA 3H0PA 2UUAJ 2RRNA 1ZOTA 4QWAA 2JC1A 2CJAA 2NXUA 4P74A 1H98A 4CNZA 3G6XA 2W9BA 3AODA 1NB7A 3CCLS 1ROFA 3HMJG 4ED8A 3KLIA 4A8XA 4JV0A 1SH3A 4USVA 3QSIA 2HQIA 3AB2B 3TW0A 1WKLA 4KPCA 3OR1B 3SDEB 3DM2A 4NZ6A 3PW7A 1EP4A 1PG5B 2E1MC 1E6VA 4WJBA 3QFWA 4C0BA 3MUMP 4BWMA 5HN0A 5CYQB 4NLRA 2PGCA 3HJVA 4QU6A 3IG1A 3LA0A 1HHTP 4PPDA 3RTVA 1J5OB 2FVSA 3DYAB 4F4WA 4MIWA 3CD7A 1JLQB 1MU2B 3A13A 2K8GA 3HXMA 2UXDJ 4ZLNA 1IQTA 2UU9F 1HMVB 5HJYA 1GFWB 1GMVA 2GC8A 4G6VB 4DBQA 2RF2A 3BYPA 3T1AA 4KIAA 4OJ3A 2E9ZA 2VODA 2Y1RI 3UDLA 4WU2A 2BRLA 5B0GA 3OTEA 3CULA 1W26A 3IRXA 4RW6B 4ED0A 2LQ9A 3JXOA 1DLOB 3S8SA 4B9LA 3BQ1A 2LQBA 4IR9A 2CVEA 2Y3YA 4QR2A 1IJEB 4I2QA 2J6UA 2CPJA 2IBKA 3CCSS 2E1RA 1VOMA 2PI4A 3NGKA 3OL7A 3H2UB 2I38A 1WEZA 2Y1JA 1T8EA 2HRYA 4NCGA 4K4TA 1S1TA 3Q8VA 3HSDA 1FK9B 3M8QB 2CQ3A 4J7CA 5C24B 5DQIA 3J7Z5 1H3DA 2DNLA 4UTGA 3IA0A 2BR0A 2KI2A 3W3SA 4WE1B 1FJEB 1KD1T 1SJRA 1QSLA 1DTTA 4OI0A 2D3UA 5ETQA 2HQCA 1WOSA 1RAGB 1VIOA 2W7AA 2E7WA 1HNZJ 5DQGA 3MAAA 1SQEA 2CQIA 2R7XA 3NL0A 3IM9A 2LKZA 4DR4F 1GX5A 1HNWJ 3BKTA 2HRUA 4K0KF 2VOPA 3THTA 1UVLA 4WPAA 3KHLA 2DNGA 3J7ZT 4GKJJ 2JVOA 4YEAA 3G82B 1FRKA 3RB4A 3KK3A 4U6PA 3F73A 4C8OA 3MURP 2IA6A 3FEXB 2J76E 3ILOA 1UVMA 1UAWA 2CNOB 1BLUA 3OVBA 2R2UA 2HHSA 1A0OB 2CPXA 4DPXA 2QLFB 2LFVA 2AJFE 2MMYA 3RBZA 2A1BA 1U47A 3SV4A 2RH3A 1U2CA 3PZPA 3J80U 2NXNA 3QPIA 3P5BP 1F9FA 4CLTA 2OD4A 3CGIA 2IVFB 3CMAS 2B8PA 2UVWA 2AYEA 4B3SJ 4IRDA 4C8ZA 2JZ5A 2VFVA 4O4GA 1KS2A 2QT7A 4OYAA 1WHXA 2N3OA 3OUYA 2FDNA 2YNFA 4RNNA 1RWNB 3HCXA 4K7QA 3MM5B 4PCQA 2XYHB 2B9YA 4ZS6A 4EK2A 2DISA 1FF2A 2HNDA 2FC8A 3O44A 1QAJA 2B51A 4UOFA 1F9HA 1Y5LB 4LF6F 2WK4A 3KHHA 2HVZA 4Y3CA 4DX7A 2HG4A 1URRA 3OTOF 2DEIA 1KQGB 5B0EA 1MN7A 3QLHA 4I0WA 2QX0A 3DRSB 2DPIA 1HBOA 3MFHA 2DH9A 5C7PA 5KFRA 4X62F 1GTHA 3NCPA 2H4WB 3OL9A 2FLPA 2ZH9A 3VGVA 2DGWA 2IC3A 3MEEA 4OFZA 3LTOA 2IBOA 2KN4A 3DDNA 2HS4A 3MI7X 5DDPC 3TI0A 1RBLA 4P9SA 4JV2A 1KR4A 3BKUA 1N5YB 2A6MA 3CJ0A 5A76A 1UVKA 4MKYA 1U1MA 3H7HB 1YBUA 3GSDA 2ZBQA 2L9WA 1RTZA 4J9KA 5KFFA 1NJIT 2F3JA 3OR2A 4QWEA 3JSYA 2CXEA 1EQMA 1RHJB 4U7CA 3GJTB 1D1UA 5HBMA 4IO1A 5KFBA 2HZAA 2ZVIA 4W92B 4BWJA 2BRKA 1NB2A 2NS1B 5DDOC 1ZPVA 3UQSA 3MEKA 4UOCA 1NAQA 3KWMA 5DG9A 1JJHA 1TK0A 2B9WA 4OZ3A 3I5AA 1RU1A 2K1RA 4LRCA 1S0VA 2ABYA 3UN3A 5F8HA 1S9GB 2SXLA 4C2MA 2YPZA 4PQUB 1LFWA 2RHSB 3ZZOA 1LXNA 3NAIA 4MTPA 3NGSA 3MGJA 4ECXA 4H4MB 2LEAA 1IKYB 3G8QA 2CVIA 2ZH1A 2M52A 1R8BA 1RT6B 2F4VJ 3DMJA 3SIPB 3G4SS 2W01A 4F3OA 2CWXA 5C2CA 4U96A 4QQBA 2V9WA 3QO9A 1GMUA 3N6NA 1TUWA 1X0FA 2YH0A 5KT2A 5IT0A 1I94J 2XSJB 2Y8YA 1NDPA 3EICA 3ZTRA 3C6UB 1YI2S 2CJYB 1TAQA 2WB1D 1JLCA 1X60A 2VOOA 3IWLA 3M2RB 4A8QA 3LF0A 1DY3A 5A2QY 4ZCKA 1NKBA 3DLBA 5I3UA 3HM9A 4WTOB 3LP2A 2WSFC 5J2PB 4QYZJ 1JK9B 5A0YA 1F60B 4RW4B 2C2EA 5IWAF 4OYZA 2KG1A 4CT9A 3M1VB 4E2FB 2RSQA 2HQDA 1EX8A 2C3OA 3RUBL 4LR7A 1MSWD 2AX0A 2DPJA 1PBUA 5L8RC 3I87A 5D78A 3SQOP 3ONQA 4A8SA 3TVYA 4OJ1A 3B8HA 2Y9HA 4I4BA 2XWXA 4DMZA 1BMQB 3MM7B 4RKUC 3KJVA 1GQEA 1R89A 2HIQA 3D6TB 4IFYA 5HMXA 1UJ4A 3BPDA 4ZITA 2WVBA 1MG7A 3A8IA 3Q89A 1D0EA 3DXSX 2UXCF 4DI6A 4B3TF 5HVGA 3Q2SC 3TZXA 4DF4A 1FXDA 3BGFA 2E5IA 3NNHA 4FVMA 4ECVA 4ECQA 1VRTA 2IMOA 3HSJA 1VISA 3POTB 4LF4J 3HI9A 4F0KA 2B5JA 2LA4A 1B0VA 1U09A 3VF0B 4KO0A 4S0MA 3CCMS 2UV8G 4U8VA 2G2ZA 3FFIB 2YWWA 5CQGA 4XPEA 2ALZA 4EU0A 4GMKA 2B6AA 1FA0A 3VAFA 4WFXA 4C97A 3MUVP 2QMWA 1JXEA 1UFWA 2D7SA 2COLA 5IOLA 1N33J 2EBEA 1P1TA 1U0HB 2HNYB 1HD0A 3MTJA 4R5PB 3DLHA 4USWA 3DLGB 4F67A 5HL7Q 1N36J 4N5SA 1S7IA 1FKOB 1RTHA 3ZC4A 5C5JA 2DH8A 3KG1A 3H20A 4TYAA 1JLEB 4K2JA 5LMUJ 3P5TL 2YKPA 2ROGA 5C42B 2Z30B 5J2QA 3DC2A 1M90T 1ITPA 3HD2A 4LF5F 3RBEA 3TA2A 2M88A 2UVVA 4ICLB 2ERRA 1KHVA 4USKA 2BE9B 2NCKL 2YWKA 4M5IA 1RT2B 4TQRA 3PYGA 2I0XA 3DN9A 2CQGA 3AA8A 4J90A 3TYTA 5A8RB 1IBCB 3K59A 4A8OA 3TZWA 4YB1P 3L95X 4IG3B 4DSJA 3QQCD 2W9BB 1S49A 2QA4G 2LQ5A 4JI2F 1MROB 1GMWA 2M2BA 2W9CA 5BR8F 3M2VA 2ZBPA 1EARA 1H0HB 2CDRB 3GR0A 1BY9A 3T5HA 1RLCL 2XY7A 3Q8PB 2MLZA 1WDDA 3LP0B 2AGOA 4DR6J 2XMWA 2I9SA 2R8GA 4UUXA 2QZ8A 2V63A 3HT0A 2LQ8A 2O5DA 1HNWF 2W4DA 2V5HG 3TEHB 2A18A 2GAGC 1SKSA 2E7VA 3LGNA 5BXIA 2B43A 4HDHA 3QIDA 1LWCB 2GMHA 5IT9Y 2VG6B 4ETZA 3AD9C 1K0TA 1SUQA 1YLXA 1UVNA 2HPUA 5CZXA 3I82A 5ETLA 1JX4A 3R3TA 2FLNA 4TY8A 4AT1B 3OJUA 2CQ1A 4DV5F 4Y28C 4GRSA 3CIMA 3H40A 4F25A 4NLQA 4C8YA 4DV6F 1RLDA 3I5CA 1KC8T 1U1RA 3KUHA 2PMHA 1P9YA 2MQ8A 3OHBA 2GMLA 4YS2A 4Q45A 1XIQA 1WORA 3PV8A 4J37A 1N5SA 4M5MA 2EVZA 4P10A 2AJ0A 2XMTA 3ZZRA 4CZCA 3VQSA 4WK3A 5GAHU 3EJMA 3G6YA 2ILYA 5IM0A 2IM0A 2ZNYA 4WFNQ 1EJ7L 1XJWB 4EO8A 3W61A 2BABA 1HQUA 1VCTA 3KK2A 2XQCA 1XK8A 4NCBA 1ZZFA 2GGPA 1IKXB 3ITHA 3PCOB 3BJYA 2XGPA 1MMNA 3TQEA 3TUZC 3J81Y 3PYDA 1OY9A 2MHNA 1CC8A 2NZCA 4B9NA 1UW9A 1L5UA 1RT1B 4KHRA 1OQ6A 4A8FA 2L3MA 1B7FA 4M5KA 2B4UA 5A8WB 2RU3A 3PHTA 2YKNA 5F8MA 1JJ4A 2UZAA 2AP6A 2DHHA 4A4JA 3DI6B 2IJRA 1F9EB 2CADA 2FPHX 4K8RA 1VIXA 5AXNA 3BR9A 4JI7J 3K8VA 5EWEA 1EZZB 4ELUA 3MMBA 1XNRF 5GVQA 3PO5A 1HIYA 3GIJA 1RHUB 1H7XA 3GG0A 1N5VA 1IR2A 4DFJA 1DAXA 2KM8C 3W2WB 1TKTB 2C2ZB 4FPRA 4MIBA 5L1KA 3MF5A 2BE2A 2YNHA 4DV0F 2KL8A 1XMQF 2YNGB 2ZOFA 5EN1A 2MSTA 2C3PA 2VDIA 3R1LA 1LXJA 1KP6A 1NRKA 5DLGA 3NCQA 4CTAA 5KT4A 5KFKA 4ECYA 3VALA 5D15A 4DUTA 1Q5YA 4BCAA 4OI1A 3NNAA 3EX7B 3QNWB 1X31C 2FD2A 3ISZA 2J8SA 2JSXA 1WACA 5L1LA 2EC2A 1VQKS 4PWDA 4LF9J 2UXBF 4ZPCA 5E3QA 2DO0A 2DB1A 3ZTOA 4N41A 1HKAA 1FD2A 5E2QA 5KFSA 1DURA 1G4CA 4OYMA 3KLHB 1WC1A 4CH7A 3V6DB 2N82B 5KFZA 6FD1A 2R8IA 4Z7CA 3K0JA 3N28A 2RKIA 3H2LA 2CPHA 1QAIA 2IC3B 4TKTA 5A6WA 3IS9A 3BGOP 3A3PB 2CKWA 5KG7A 2RHQB 4OYBA 5CYMA 4RO0A 3AQPA 3QAEA 4IOBA 3K5NA 4HHUA 4U7UK 3KLGA 4ZVTB 3QRRA 1H6KX 4NZ0A 1GAOA 1R6VA 2ZJQQ 4NLUA 1Q5VA 1HQ2A 5J2MA 4RNMA 4ED1A 4IRCA 3M30A 1OJ4A 5D4OA 5AE3A 2MZQA 2DRDA 1HFEL 3CJTA 2XO7A 5I3PA 4FYXB 1OWXA 4O3NA 1EETA 4PEOA 5H9EJ 2Q6BA 2RQMA 3MR2A 3KHGA 1AZSA 1QUVA 1Q4RA 1QUPA 1I3OB 2QMUB 2Q3PA 2LDYA 5HVFA 4TU9A 1U45A 5BJRA 5U47A 2J7KA 3T1HF 2F7VA 3TO8A 2IVYA 3QT5A 2FJAB 4WFBQ 2JLGA 3HFVA 4NXNF 1T9TA 3PKYA 2ASDA 2P2CB 5CH7B 1CJKA 4DQPA 4DV4J 3OFFA 1NUEA 1N36F 3D1QA 1F3VA 2W2OP 4V19J 3OL6A 1FRIA 2NSBA 3R5AA 2KYXA 2C22A 2MKHA 3DFEA 1HW8A 1AW0A 2KVIA 2PA8D 2IFXA 4Y00A 4UY85 1VQ5S 1WDTA 1OY6A 3A1YG 1HNVB 1UJ5A 2BVZA 4QW9A 3VGTA 3PVXA 3PX0A 3M6VA 7FDRA 3NY0A 1UTAA 2OFGX 5D3GA 1F5CA 2YQ0A 4X66J 2VL1A 3NGDA 5KFVA 4EYIB 1PAEX 4M5LA 4NMLA 3J80Y 3CJRA 4G65A 5IV3A 3FRZA 1NKEA 2LYVA 1DZ5A 2W2QP 5HI7A 1U6ZA 2BJ7A 3CF5Q 1Q78A 3PRVA 4UY8T 2XBPA 3M6WA 2GJFA 1VR6A 5CXTA 2KXFA 4Y34A 1CVJA 3AHPA 3T3FA 3CD0A 3HHDA 3ILIA 3BF4A 2J6SA 4H4KC 1JWWA 4CT8A 3IN5A 3KLFA 4KV8B 5DG7A 4NLPA 3OV7A 1X5TA 3CWJA 3GFHA 1N32J 2ZH3A 1W2IA 2RJZA 1WSVA 3N79A 4LBPA 4ZPBA 3ENVA 2GVDA 1FWKA 2O1PA 1UWBA 5KOXA 2K2PA 2W25A 3VAKA 2MQMA 3R5JB 3DGPB 1NNDA 2V4RA 3TQ1A 3EM1A 5E3PA 2ZD1A 3H59A 2DO4A 1K73T 1XQIA 4P7TA 1S1UB 3GSIA 4RPFA 2WVFA 4YP3A 3VVUA 1X4BA 2GJ2A 1MLAA 4HTIA 2R3VA 2CG4A 1CJTA 4DL4A 4PYDA 2QFJA 5E3CA 3IP0A 2F8MA 1APSA 3OW2R 3QJPA 4O4RA 3THVA 2QN6B 1KVJA 1FJGF 4RNHA 5BYRA 2IYGA 1WOPA 2VPYB 1CSJA 4R8UA 4N47A 2VIHA 2RB7A 2HFOA 2Q66A 1QVFR 2AV5A 4GC6A 1YJUA 4G3IA 2HEKA 2HBQB 1LWEA 2HHQA 3LH2S 1SC4B 2DNPA 1Q86T 2WONB 2KFNA 3VCDA 2ZH7A 4ELTA 4WYLA 3C14A 4NRUA 4FXVA 3QT8A 2VQEJ 4LFBJ 2W9CB 2W9AA 3NEKA 2VFSA 1TVRA 4ZLPA 2KZMA 1JLAB 2IM3A 3TUIC 4CLLA 3MM9A 3OFHA 1X4DA 4J91A 1WG4A 1U26A 3N6MA 5KG1A 1NJZA 4IH5A 5KFHA 2PI5A 2BJEA 2U2FA 4WKRA 3JYTA 2KJVA 4Y2IA 1EKRA 4YN3B 1VQSA 3R6GB 3US5A 2V8PA 3B6BA 4RW8B 4YQWA 1M5PC 3F56A 3H8YA 4OQJA 1SUQB 4WBFA 4YR0A 4C98A 1NHUA 1CS4A 1JNZB 2JLEA 2XMJA 4Y0FA 2HFUA 4JP8A 2HHXA 3MR3A 1QSYA 1Y00A 2BJ1A 2LXUA 2ZZMA 1KTQA 1VHFA 2XHCA 4IDKB 2RMLA 4ZPTR 4OJGA 3BGUA 4EWTA 2EFQA 3S6EA 4X4UA 2BQ3A 5CD4H 1U4BA 4ENOA 4ATNA 3BH6B 3V6HA 2EFVA 3O1LA 4F4ZA 3HK2A 4C8LA 1JQGA 3MEDB 2HKEA 2J8AA 2IIHA 2V4JB 4K2XA 4CIOA 4OX9J 4RU9A 3GYNA 2LCWA 1BXNA 4U67Q 1UZHA 1B7YB 4TU7A 2H4YB 2ILZA 1WHYA 5H9FK 2B3TB 4ZA1A 1E6YB 2FYXA 1FEEA 1WEYA 1YDLA 3FMWA 2Q79A 1RYRA 1VQ8S 1RE1B 2D1CA 5I3QA 4IOCQ 4ANDA 5D77A 1Y10A 5DZ7A 3H5UA 2OPSA 1N56A 3U1LA 2ZM6J 1D3WA 2CJXB 1V5IB 1TK5A 3OVSA 2Z2LA 2NREA 3CJ5A 4JI1F 1RTIB 1Q16B 3JSMA 1Q53A 4GVBA 1TV6A 3CEDA 3MEGB 4MIAA 4F4YA 4LVOP 1Q81T 1CULA 1U8SA 4NCAA 2D74B 3DRYA 4JV1A 2EC0A 4IUFA 3IGNA 2DR7A 2OMOA 4M5GA 5KFAA 2H48B 1C0TA 3D67A 1KFSA 1RT7A 5JMNA 1YTYA 4NI2A 4QIFA 3P3DA 2GX8A 2FGOA 5THWA 3QZ8A 1TKZA 3CDUA 3LANA 3LGMA 1T05A 2MZRA 4WP9A 4EBCA 3QJLA 1CPZA 4OX8A 1T03A 1REVA 4KJIA 4DPTA 4QU7A 5KG2A 1RYSA 3CD5A 1RTDB 3J7YI 2B9EA 4FF3A 1K1QA 3VHQA 3G87A 2X51A 3L3CA 4F26A 3KYLA 5GAEU 2CG8A 1WSRA 2RIJA 1HNIA 2R7OA 3VZIA 2E1AA 1HBMA 1TK8A 1SQFA 2DY1A 2ZBCA 4DR3J 4TLRA 1WI6A 4JI0J 1ZM3A 3FVYA 3LGHA 3OFGA 3V4IA 1K47A 2CJ9A 1C2PA 2CPFA 5T41A 5AT1B 4DSFA 4C3LA 1WNEA 5IQ6A 2HNZB 1VI7A 2OTLS 2MQNA 2Z58B 3U02A 1CJUA 2XS2A 3CXCR 1SIZA 3FSIA 4CM2A 1NMEB 1FJCA 4ES2A 5LT5A 5HQMA 1IBLF 2DY9A 1FE4A 4MFBA 3I6PA 2FGCA 4ERDA 2V8HA 3R7BB 2HRTA 3M32A 3W1YC 4C0OC 3CJKA 2ZITA 1LWFA 2WW8A 3GCWP 1RUSA 3TANA 2BV3A 4C4WA 4HACA 4CYUA 3HFZB 2MEWA 4RNOA 1RT5A 1URNA 2DJWA 2UVUA 4I2PA 4JI3J 2M70A 3BDEA 2XHWA 1V5VA 3ZTPA 2CJKA 4XDCA 5J2NA 1S9EB 5EDWA 1UJ6A 2V68A 1PC4A 4PRFA 3BS9A 1U7LA 2VQFJ 3UD3P 3MPYA 5K14B 4ILLA 3R9LA 4J9OA 4QCLA 3A4TA 1OY8A 2QLWA 2OIHA 2ADCA 2QLJB 1D9DA 3UN2A 3QAUA 4U9RA 3ZZYA 4AL7A 3SI8A 1KOHA 4LSNB 5L9NA 4YR3A 4OJHA 3EE3A 2AGPA 2A10A 4HI1A 1QVGR 4CLFA 2J9EA 4DV3F 4MH8A 3VAIA 1FKPB 4W90B 1CJVA 4K59A 1TELA 3H2VE 4AQYJ 3MMJA 5C25A 3ZFVA 3SBMA 2AX1A 2X7IA 3DLLQ 2XM3A 1XR7A 1UFLA 1S1WA 4C3KA 4DOZA 1ELOA 3W9IA 3OVAA 5J1EA 3B82A 2BE7D 1QAYA 3KG0A 3MMCA 1YWXA 4QPXA 3L7UA 3OQ2A 1BQMA 2VA2A 5KT6A 4NLXA 1XR5A 5E3AA 2RRAA 2POKA 1FT8A 2OP5A 4RW7B 2CQHA 3MD1A 1LW0B 1FDAA 2VQEF 1C0UA 1UEVA 4USUA 4GKKJ 5GADI 3NWRA 4LRAA 3HHLD 3MMAB 4KBIA 1LK7A 3HVTB 1LK5A 5HLFB 1ZS6A 2FZKB 4QIVA 2MKCA 3W64A 2D41A 4F0MA 1AXQA 4A48A 2F4FA 5LL6d 4ZHRA 3K57A 2E29A 3ZTSA 3RB6A 3GIRA 3MECB 3QT7A 5LM7E 3CMES 5L9XA 2FB0A 3W8PA 5DETA 4RLEA 2ZJPQ 4M1KA 1IBMJ 3DHWC 2FVRA 4Y65A 2ZVSA 5HROA 4PG6A 1N5TA 2CQPA 4OI3A 2RS8A 1O5JA 4CLUA 3H5XA 3PJ9A 3CC7S 3UR3C 4QR0A 4KGMA 2BJ3A 1I51B 4L6V3 3MUTP 2QMXA 4Z7YA 2M5YA 3UN5A 1HNXJ 3ICLA 5ETOA 3TEGA 3FUYA 2OSRA 3OSPA 1D8ZA 4DPOA 3WC0A 2Q43A 4C6AA 1SJ3P 1RWXB 2LA6A 4WFAQ 4JI5J 4NA3A 2U1AA 2HHTA 1FRJA 1KBRA 1JMTA 1PYSB 2IJNA 4M8LA 4OI2A 1LNQA 4OX9F 1EQ0A 2ZZTA 3EDRB 1YHQS 4DL2A 4RW9A 2KRBA 3AXMA 1GXLA 2FVCA 1ZM9A 2VKRA 2G1HA 4YY3F 4M94A 2OPRA 5M2RA 4P7VA 1IJFB 1F2HA 5J1NA 4TXSA 3QGIA 3FCVA 2HSEB 1RHQB 5LMNF
chains in the Genus database with same CATH topology
3FCWA 3Q8YA 1NSQA 2DXDA 3BBFA 3JS9A 3EVWA 3GPAA 1BHNA 1HHQA 2AZ1A 3GP9A 3MPDA 3BH7B 1MN9A 2DXEA 3VGTA 1W7WA 1HLWA 3B54A 2CWKA 4ENOA 3EM1A 4EK2A 3BH6B 1JXVA 3FBBA 1XQIA 1NB2A 2BX6A 3EVMA 1NPKA 1NDKA 1BUXA 3EVOA 3FKBA 3PJ9A 3L7UA 3ZTOA 5IOLA 2B8QA 3FBFA 1S57A 4F4AA 1WKKA 1XIQA 4HR2A 4UOFA 3VVUA 1KDNA 3ZTPA 1PAEX 2HVEA 3VVTA 1NHKL 3EJMA 4F36A 5CAAA 1MN7A 3ETMA 2DXFA 2HURA 3FBEA 4C6AA 3FBCA 3NGSA 3R9LA 4CP5A 3Q83A 5C7PA 1WKJA 1F6TA 1LEOA 1WKLA 1BE4A 4KPCA 1UCNA 4UOHA 3DDIA 1HIYA 1B99A 1LWXA 4UOGA 2HVDA 3PRVA 4O0NA 3VGVA 1NLKL 3DKDA 4ANEA 2DY9A 3ENAA 1F3FA 4ANDA 3NGTA 1S59A 3B6BA 3Q89A 1ZS6A 2BEFA 4DI6A 5BXIA 3BBCA 1U8WA 3Q8VA 3NGRA 3G2XA 3VGUA 3EE3A 3NGUA 1NUEA 4WBFA 1K44A 1NCLA 4W98A 4DZ6A 1NDLA 3FC9A 4FKXA 1NSKL 2VU5A 1PKUA 5CABA 4ANCA 2DYAA 1S5ZA 3VGSA 2B8PA 2NCKL 1NDPA 3EICA 3BBBA 4FKYA 1B4SA 3ZTRA 3ZTSA 3EMTA 1EHWA 2AZ3A 1NDCA 1NSPA 3Q86A 3FCVA 2ZUAA 3WX8A 3ZTQA 3ELHA 1VYAA 4S0MA 4DUTA 3Q8UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FCW A;  3Q8Y A;  1NSQ A;  2DXD A;  3BBF A;  3JS9 A;  3EVW A;  3GPA A;  1BHN A;  1HHQ A;  2AZ1 A;  3GP9 A;  3MPD A;  3BH7 B;  1MN9 A;  2DXE A;  3VGT A;  1W7W A;  1HLW A;  3B54 A;  2CWK A;  4ENO A;  3EM1 A;  4EK2 A;  3BH6 B;  1JXV A;  3FBB A;  1XQI A;  1NB2 A;  2BX6 A;  3EVM A;  1NPK A;  1NDK A;  1BUX A;  3EVO A;  3FKB A;  3PJ9 A;  3L7U A;  3ZTO A;  5IOL A;  2B8Q A;  3FBF A;  1S57 A;  4F4A A;  1WKK A;  1XIQ A;  4HR2 A;  4UOF A;  3VVU A;  1KDN A;  3ZTP A;  1PAE X;  2HVE A;  3VVT A;  1NHK L;  3EJM A;  4F36 A;  5CAA A;  1MN7 A;  3ETM A;  2DXF A;  2HUR A;  3FBE A;  4C6A A;  3FBC A;  3NGS A;  3R9L A;  4CP5 A;  3Q83 A;  5C7P A;  1WKJ A;  1F6T A;  1LEO A;  1WKL A;  1BE4 A;  4KPC A;  1UCN A;  4UOH A;  3DDI A;  1HIY A;  1B99 A;  1LWX A;  4UOG A;  2HVD A;  3PRV A;  4O0N A;  3VGV A;  1NLK L;  3DKD A;  4ANE A;  2DY9 A;  3ENA A;  1F3F A;  4AND A;  3NGT A;  1S59 A;  3B6B A;  3Q89 A;  1ZS6 A;  2BEF A;  4DI6 A;  5BXI A;  3BBC A;  1U8W A;  3Q8V A;  3NGR A;  3G2X A;  3VGU A;  3EE3 A;  3NGU A;  1NUE A;  4WBF A;  1K44 A;  1NCL A;  4W98 A;  4DZ6 A;  1NDL A;  3FC9 A;  4FKX A;  1NSK L;  2VU5 A;  1PKU A;  5CAB A;  4ANC A;  2DYA A;  1S5Z A;  3VGS A;  2B8P A;  2NCK L;  1NDP A;  3EIC A;  3BBB A;  4FKY A;  1B4S A;  3ZTR A;  3ZTS A;  3EMT A;  1EHW A;  2AZ3 A;  1NDC A;  1NSP A;  3Q86 A;  3FCV A;  2ZUA A;  3WX8 A;  3ZTQ A;  3ELH A;  1VYA A;  4S0M A;  4DUT A;  3Q8U A; 
#chains in the Genus database with same CATH topology
 1VK8 A;  1HHQ A;  4LSL B;  1YZ6 A;  3LQV A;  4IFV A;  4KGX B;  5G0R A;  3GJR B;  4CO2 A;  2BBE A;  1S76 D;  1OSC A;  4I56 A;  4B3R J;  2AF6 A;  1VLY A;  3UD4 P;  1G1X A;  2GHW A;  3TA0 A;  3SSQ A;  3W65 A;  4F4A A;  3FZB A;  3M8R A;  2QA2 A;  3IGV A;  2NXE A;  2BMB A;  4KR0 B;  3PR5 B;  4X64 F;  2FHK A;  3PG9 A;  3PYE A;  4TQS A;  4Q8E A;  4H4O B;  3D0G E;  1WF2 A;  3U1M A;  3UNG C;  3MXH P;  3CMQ A;  1RTJ A;  2XY6 A;  2HW3 A;  1CS4 B;  2BEF A;  4OYX A;  3K17 A;  3NKY A;  4XAK A;  3C16 A;  3E01 B;  2NQP A;  4UQG A;  3GG1 A;  2D3Z A;  4NRT A;  5IC4 B;  4N7T A;  2HBR B;  4WFY A;  5T14 A;  4X4P A;  2WCX A;  4YHH F;  2R42 A;  1NK9 A;  4P73 A;  1VMB A;  2FTR A;  3MM6 B;  1TU0 B;  2ZOM A;  1IR0 A;  1JLB A;  4DQR A;  2W4C A;  5L1J A;  2UUB F;  3AB4 B;  5B0D A;  4IQX A;  1U49 A;  3SV3 A;  4RWX A;  1FES A;  2N7Y A;  1Y11 A;  3KLE A;  3ADA C;  4K4U A;  5CZV A;  2G0C A;  4DSI A;  1VRQ C;  4DZD A;  4Q0B B;  3MZI A;  3UE2 A;  2GO8 A;  2GV1 A;  2Y1L B;  1UFK A;  3QAT A;  1WWH A;  2DT9 A;  3R2C J;  1TUG B;  1RGV A;  1YZ7 A;  1FTC A;  1NBE B;  3PX4 A;  2B4P A;  2HGM A;  2L08 A;  4JI4 F;  3NAH A;  2PD1 A;  4ZVG A;  2ZKU A;  2WBM A;  2BKO A;  2CPY A;  4FS1 A;  5A8K B;  2IDL A;  4DPY A;  5F9L A;  1K44 A;  1X4G A;  1S1V A;  1YSJ A;  4O3R A;  3H98 A;  2EG2 A;  1RQ0 A;  2C42 A;  4J9R A;  2KT5 A;  2L9D A;  2VBZ A;  4QWC A;  1M5K C;  2FLO A;  2N3L A;  1Y7P A;  2HHP A;  2Z56 B;  2E44 A;  4DQQ A;  2RT3 A;  1J2V A;  2F63 A;  3GYG A;  1N6Q B;  1IKW A;  2ZE2 A;  4L76 A;  4CO0 A;  1RAF B;  4MYU A;  4N8O A;  5FJ4 A;  2BAC A;  1QE1 A;  1TMM A;  4OZ5 A;  1TKX B;  5ETR A;  2DNN A;  1C0T B;  1N8R T;  3MWB A;  5ETS A;  4ZVU B;  3OTC A;  4ITS A;  4FYD A;  2W24 A;  4ZP6 A;  5RUB A;  1K1S A;  2HWT A;  4WIQ A;  3JTN A;  5KG0 A;  3IWX A;  3Q83 A;  3Q2T C;  1PIL A;  2CJB A;  3P96 A;  1J27 A;  2KTQ A;  3G8S A;  4RUC A;  4Y2C A;  2QG9 B;  3PIP Q;  1IWG A;  1P8G A;  1TZ0 A;  3F44 A;  1U1K A;  1P27 B;  2CAJ A;  3EWG A;  4KHP F;  4RBV A;  2HWI A;  3ULH A;  3W5Z A;  4AXI A;  4K0K J;  3UR0 A;  3CDB A;  3PHE A;  1YIT S;  2X1G A;  3HLU A;  1Y0H A;  2R4F A;  2I2Y A;  4RUB A;  3VAM A;  3SEO A;  4MYT A;  4I7F A;  5DO2 A;  2HK3 A;  5HP1 B;  1NSP A;  2DNM A;  4L75 A;  1DJ0 A;  4M95 A;  4LQ3 A;  1Z2Z A;  1H2U X;  3Q24 A;  3R5G A;  4DSE A;  4OL8 A;  3C6T B;  1RWO B;  3I31 A;  1SIW B;  2MTL A;  4J9N A;  3QT6 A;  3NS5 A;  3U7J A;  4FVC A;  3W63 A;  5I42 B;  3QIP B;  2DGV A;  4ECR A;  4OHW A;  4ETX A;  2X3G A;  2H5E A;  3A8K A;  4X65 F;  2PFD A;  5F8I A;  1RWV B;  4PWU A;  4LSZ B;  1LQ9 A;  3JSR A;  4LF7 F;  1VBY A;  4LF6 J;  3NWG A;  1M0S A;  3OTO J;  3UDC A;  3NGU A;  5AJ3 F;  2DNR A;  3CCJ S;  2MZT A;  4KYZ A;  3OJS A;  2HS3 A;  2GAH C;  2IPO B;  1P9Q C;  3AXK A;  3UNY A;  2YX4 A;  5D8H B;  2VPZ B;  4X62 J;  2XMM A;  3VAH A;  3D1O A;  2DNZ A;  2IAJ A;  1Y5N B;  3DOL A;  1NSQ A;  3V81 B;  1JLG A;  4RWW A;  1PJ6 A;  3V6J A;  1AA1 B;  2R2S A;  1KVI A;  2VFT A;  1RAE B;  4KGZ B;  5D0E A;  4DV1 J;  5J2N B;  3AT1 B;  1LW2 B;  4HI2 A;  2FJV A;  1CQM A;  5KG3 A;  2B56 A;  1FTR A;  3OLB A;  3A8J A;  2APO A;  4M5H A;  5GMK a;  4I1T A;  3M2U B;  4X4Q A;  3G6V A;  3PY8 A;  1G3O A;  2VG7 A;  3GZ7 A;  3QRP A;  3UVJ B;  3CD6 S;  1NK8 A;  3KUG A;  2QA4 S;  2BAN B;  4C8K A;  3CT9 A;  1EAY C;  4IR1 A;  2GW8 A;  1U24 A;  2H9Z A;  2B4V A;  2BJD A;  1BQN A;  2MKY A;  3D0I E;  1R6Y A;  3G2X A;  3CC2 S;  5LSO A;  2RE1 A;  4ZLJ A;  3FC9 A;  3K5M A;  3DLE A;  2QYG A;  2OAU A;  5C25 B;  4JI5 F;  4TY9 A;  1S97 A;  3RBX A;  4HH1 A;  3GU0 A;  1S1W B;  2JHE A;  5L1I A;  4DR2 J;  2ZUA A;  1DTQ B;  1AFI A;  3TUJ C;  2OKQ A;  4URQ U;  4LUB A;  4DLE A;  1I5O B;  4ID5 A;  2MGZ A;  5L46 A;  3MDF A;  5JVH Q;  2AYG A;  2Z57 B;  3FBB A;  2P6T A;  2E1P A;  1QM9 A;  3GMG A;  3WBZ A;  2XLJ A;  2R7T A;  4KSE B;  2GJI A;  3P8B B;  3Q23 A;  5E33 A;  5B0B A;  4ID8 A;  1NK0 A;  3E3X A;  1UCN A;  5IWA J;  2OPQ B;  1YJV A;  1TL3 A;  1KON A;  3M8P A;  3MOJ B;  3RB3 A;  5BYS A;  2R2T A;  4C11 A;  2JX2 A;  4YME A;  4UW2 A;  4Q5V A;  2A2C A;  4ZVP B;  3M8W A;  2MHE A;  1WOO A;  2OEL A;  2V2Z A;  2YQ3 A;  1OPI A;  1VJQ A;  2O01 C;  3N4W A;  2GHV C;  3H4D A;  3KLV A;  5DRK A;  2M9K A;  2ACY A;  2G1D A;  2N4C A;  4YR2 A;  2WRM A;  2AW0 A;  3J7A 1;  1AUS L;  1FO1 A;  4GVL A;  3NS7 B;  2UXC J;  2LEC A;  4B3T J;  2CYY A;  4KY3 A;  3BSA A;  3EPG A;  5HQL A;  2QRR A;  3GB0 A;  2B7C B;  2OPP A;  3C66 A;  1KLM A;  3DRR B;  1D9A A;  3V6K A;  3FKB A;  4P2F A;  1CEZ A;  3OBI A;  4DR1 J;  2ATC B;  3M6U A;  1RK8 A;  1HBU B;  1ZBT A;  3HHL A;  2RUG A;  4DU7 A;  1KRP A;  4QJV A;  1B0P A;  1NJX A;  4DV7 F;  1JLF B;  2DBB A;  2DH7 A;  4I6A A;  2C1E B;  3UCZ P;  1DQ8 A;  4M5D A;  4L3N A;  1FEH A;  4LT6 A;  4HT7 A;  4P71 A;  3PEJ A;  2ZH2 A;  4B3M F;  1D09 B;  4EGL A;  4AE5 A;  4QOT A;  3T9Z A;  3BB5 A;  3QWU A;  4QIE A;  2WOM A;  1HQE A;  2M7S A;  2GZO A;  4B3O A;  4N76 A;  1SXL A;  1W25 A;  4ED7 A;  1KQS R;  5C2G A;  1KHW A;  5KFT A;  4ER8 A;  4J5O A;  1YX2 A;  2F9J A;  2H5I B;  1AUD A;  2BM0 A;  4H54 A;  5T7L B;  3PAC A;  2DXE A;  1YJN S;  2V67 A;  3I0R A;  3R8Y A;  4LF5 J;  1KQK A;  3R5C A;  1N0U A;  2R7W A;  1V9O A;  2GVZ A;  7AT1 B;  3I4P A;  2IRX A;  4ZVF A;  4OYP A;  4ZDN A;  2YNI A;  2BOA A;  2FZC B;  1NPR A;  4YOE A;  5AXM A;  2DVI A;  1S6O A;  4MJK A;  2QL7 B;  4C9D A;  2X1F A;  4IH6 A;  3HVR A;  1VS3 A;  3DDI A;  4AL5 A;  4F02 A;  1SCJ B;  4JI2 J;  5CA5 A;  3HO1 A;  2RRB A;  5BR8 J;  2E66 A;  1TL7 A;  3O8W A;  2XMK A;  1KN6 A;  4OHX A;  3T5J A;  4RBU A;  4CLZ A;  1VJW A;  1VBZ A;  3RR7 A;  4DX5 A;  4ZPD A;  4UF4 A;  3TAQ A;  2VKZ G;  2V0N A;  1NK7 A;  9RUB A;  1VQL S;  2NR0 A;  2QIF A;  2VBY A;  3Q22 A;  3DU6 A;  2H51 B;  5FDL A;  1JLB B;  4KKO A;  3R27 A;  2UV8 A;  2P5V A;  3HD1 A;  4O44 A;  3UCU P;  2EFP A;  4WII A;  2YKQ A;  1MML A;  4NPO A;  1MWY A;  4JI8 J;  1MWQ A;  2XTJ P;  2RU9 A;  4EBD A;  1FE0 A;  4ZCM A;  2HVE A;  2FHJ D;  1S6Q A;  1W2B R;  4ZKA A;  1L3S A;  2MXY A;  1G2E A;  4DV5 J;  5DJB A;  4F7V A;  3M9M B;  3JB9 k;  2HAF A;  4DV6 J;  3QRQ A;  3I0S B;  5F8L A;  3NXZ A;  5ETN A;  1UVI A;  2QL5 B;  1ZM2 A;  1ZYQ A;  3ZZ0 A;  5GAG I;  3IBF B;  3C15 B;  4DL0 C;  3PO4 A;  3KOA A;  4IG0 A;  4ZVS B;  1VC0 A;  3NBP A;  3W9J A;  1PJ7 A;  4ANC A;  3DOK A;  3NNC A;  4K4Z A;  3CIZ A;  1VQP S;  1S1X B;  1T3O A;  2BQR A;  2ZE2 B;  2UUT A;  2HMI A;  5K8N A;  4O3S A;  2VON A;  5EWF A;  3GIL A;  1S6P A;  2IM1 A;  3TJ9 A;  2Z2Z A;  2BQU A;  5IS2 A;  4PUO A;  1Q1K A;  3OLA A;  4CI0 B;  2HFZ A;  2VPW B;  2YBV A;  4XO0 A;  3MFI A;  1R27 B;  2XS7 A;  4NZ7 A;  2YKM A;  3ZZU A;  2OEK A;  3M8S A;  2NYI A;  2E9R X;  1SC3 B;  4F4K A;  3W7B A;  4A8K A;  3LP1 A;  2KHD A;  4HT5 A;  9ATC B;  1PSD A;  1YIJ S;  2DHS A;  1R0A A;  1SI9 A;  2W7O A;  4DV1 F;  3M05 A;  3KNA A;  2KDO A;  4EZ6 A;  2DGS A;  2JFD A;  2RQC A;  2CZ9 A;  1GEH A;  3ET6 B;  4DSK A;  4DU8 A;  4KFB B;  2XO6 A;  4ED3 A;  1NPP A;  1FDB A;  4DV2 F;  1HBN B;  1FRX A;  5I4M A;  4QYZ K;  4U7U D;  4J9L A;  4DR7 F;  1OYE A;  3LO3 A;  2CQD A;  1XNR J;  1NH7 A;  3OR1 A;  1KQF B;  3FEZ A;  4LJM A;  1JKH A;  4MK7 A;  3CCZ A;  3Q8Y A;  2R2R A;  1VQM S;  2VG5 B;  4NYZ A;  3NG8 A;  5CYQ A;  4DV0 J;  4WCE Q;  1HI1 A;  4G1Q B;  2EK1 A;  1XMQ J;  5D0G A;  1WC6 A;  3RAM A;  4LMZ A;  2B8Q A;  4NA1 A;  1VDH A;  1J5O A;  5F8J A;  3DYA A;  3IRW P;  4DR2 F;  4DS4 A;  1JLQ A;  5E5N A;  1MU2 A;  3H90 A;  3UPF A;  5GMD A;  1SV5 B;  2V8G A;  2YWH A;  1TR0 A;  1MWZ A;  3PW0 A;  1HMV A;  4DQS A;  4ZOS A;  4OIX A;  2FJE B;  4FNI A;  2UXB J;  4JOU A;  4Q8F A;  1VRU B;  2AD9 A;  2MKI A;  4CRJ A;  3W5X A;  1RAC B;  2GIR A;  4Y2K A;  3JQM A;  2FLL A;  4RW6 A;  1DLO A;  2PA3 A;  3RRG A;  3EXY A;  1XNQ F;  5AE2 A;  5LOQ A;  4L73 A;  2AYB A;  1U2F A;  3D2W A;  1Q7Y T;  2XB2 D;  4P2S A;  3HVA A;  4LIR A;  3PXG a;  1RT4 B;  1LKZ A;  3JS9 A;  2JFK A;  1RWP B;  2QYC A;  2ZDP A;  4DCJ B;  5SUH A;  1S4E A;  1HYS B;  1RHM B;  3MM8 B;  3OPK A;  3HPO A;  1FK9 A;  1Q0N A;  2O67 A;  3M8Q A;  4K5R A;  3AH6 A;  5C24 A;  4FP9 A;  1U1P A;  1JXV A;  4A8Y A;  3SQG B;  3EVO A;  3BRE A;  2P8I A;  3T1Y F;  1ICE B;  2H1Y A;  4WE1 A;  4CCH A;  2WVE A;  2OTJ S;  4B9T A;  4LBH A;  1SQG A;  1SJ1 A;  3JAM U;  3RRH A;  1RKI A;  5LSL A;  1RWK B;  3DU5 A;  1FI4 A;  2MSS A;  3PKM A;  4KTQ A;  4DR1 F;  2P9C A;  2MQL A;  4Q43 A;  2NPI A;  3W9H A;  1VBX A;  2C3Y A;  5K8O A;  1X9S A;  1HPZ A;  2IM2 A;  1RB0 A;  1NDL A;  3OSN A;  3VR1 A;  2V6A A;  3IMQ J;  1YRT A;  3G82 A;  1RHK B;  3DLK B;  3H4B A;  4ZJL A;  5DLF A;  1ZZN A;  1V6H A;  5KT7 A;  1C1C B;  3T1H J;  4KGV B;  2KG0 A;  3I32 A;  3CUN A;  3AFG A;  3CO0 P;  1S0M A;  1V3Z A;  3W66 A;  3AOA A;  4NXN J;  1F0X A;  2RVJ A;  3SZ2 A;  2AJ4 A;  4DN9 A;  4QW8 A;  4NL5 A;  5HK4 A;  5DGA A;  4B9S A;  2HQF A;  1UET A;  5IV4 A;  3EUN A;  2DR5 A;  1K9M T;  1FFW B;  4R25 A;  4UZC A;  1XEZ A;  2G4B A;  1U48 A;  4ED5 A;  2G9O A;  1SL1 A;  3OXL A;  3R6L B;  1LOU A;  3M8P B;  4A46 A;  3MM5 A;  4DN0 A;  4HLB A;  2MKK A;  2XCP A;  5BYQ A;  5F3T A;  2J5A A;  2QGF B;  3FJ2 A;  4WTY A;  4BC7 A;  1A7G E;  1F3F A;  3NP5 A;  2ZHA A;  5IZH A;  4WU3 A;  1T95 A;  3E51 A;  3DRS A;  2AGQ A;  2OH2 A;  5EGY A;  2UUC F;  3K89 A;  2D9P A;  3KLI B;  1TQL A;  3GFY A;  3MTK A;  2PEB A;  2KO1 A;  2ZEJ A;  2MLY A;  4IKA A;  1FXL A;  3DM2 B;  1EP4 B;  1N5Y A;  1E6V B;  5KFQ A;  4AD6 A;  3I9Z A;  1PAU B;  2HFV A;  2J6T A;  4RBT A;  3SYZ A;  4P75 A;  3A3N B;  3IG1 B;  1AB8 A;  3KKF A;  4F36 A;  1IXK A;  2YXL A;  4QYR A;  1U1Q A;  3DNC A;  2XZT B;  3RW6 A;  4LRD A;  4JI8 F;  3IBW A;  4UQT A;  2RF2 B;  2VIC A;  3UFC X;  4LVN P;  4DFP A;  3T6J A;  2C2O B;  3RRK A;  3W8G A;  5ETM A;  1S9G A;  1UZD A;  2R8J A;  2DR8 A;  2DNO A;  4PQU A;  2WW4 A;  5DM7 Q;  3IRX B;  4H4M A;  1WTF A;  1U2R A;  2GA7 A;  4DDF A;  1XC9 A;  1IKY A;  3CE8 A;  4FPI A;  1F5B A;  4C3M A;  2EFN A;  1FJG J;  4JB8 B;  1RT6 A;  2V94 A;  4I2Q B;  1VQN S;  1U1N A;  2DGU A;  4BS2 A;  3CPW R;  4I6Y A;  5E3R A;  4B02 A;  2W8K A;  1Q82 T;  2JEF A;  3MAH A;  4OZ1 A;  1VQY A;  3CJQ A;  4CO3 A;  2QEX S;  2XSJ A;  4NCG B;  1S1T B;  3C6U A;  1B70 B;  2LLZ A;  2DD8 S;  1AFJ A;  2AJ1 A;  3M2R A;  1IBK J;  3TVK A;  1HWI A;  1H38 A;  5J2P A;  4CP5 A;  3BSN A;  2PSZ A;  1WKJ A;  1AYE A;  1DTT B;  1FDN A;  3M1V A;  1SJQ A;  1WC4 A;  4YDX A;  1GH8 A;  5EHH A;  2XMA A;  3MAA B;  3EGV A;  3H25 A;  2VF3 A;  4DZ6 A;  3V4M A;  3X3U A;  3MM7 A;  1S5Z A;  3OXF A;  3OHA A;  3RB0 A;  2RQK A;  5B0F A;  3JTP A;  2CUY A;  5HMY A;  8RUC A;  2DNH A;  1QSS A;  2V8D A;  1SKR A;  2B4O A;  3KK3 B;  4ZVH A;  2QLB B;  2L48 A;  4Q44 A;  4KHM A;  4O0I A;  2HGN A;  2VFU A;  4F3Q A;  1IKV A;  1CG2 A;  1TL4 A;  3POT A;  1OYD A;  3CCW A;  1QY7 A;  4KRW A;  2EKY A;  1FER A;  1X4C A;  1GNK A;  4O3O A;  4LFC F;  2ZZN A;  3BQ0 A;  3FFI A;  5KFM A;  3D1H A;  2ROP A;  2EXU A;  2XGQ A;  4RUH A;  1PBA A;  5CCM A;  1NEE A;  4O4G B;  4JI6 J;  1G6B A;  3QMQ A;  1X5O A;  2FY8 A;  1YGY A;  4RZR A;  4O0N A;  3BGR A;  3ISN D;  1O51 A;  2JEJ A;  3OUY B;  3JTO A;  2FZG B;  2PMZ D;  2YNF B;  4KQZ A;  3NBP B;  1U0H A;  2HNY A;  4EBE A;  2VDH A;  4R5P A;  1RKJ A;  3DLG A;  4ZMM A;  4X4O A;  2MJN A;  1S48 A;  2HND B;  4DX8 H;  2XEX A;  1P6T A;  2DK2 A;  5CAB A;  2NUH A;  2HHH J;  3RAX A;  3DLJ A;  4WWS A;  1FRM A;  4CNY A;  1FKO A;  3L7P A;  1HWK A;  3AJ2 A;  2BA9 A;  2J0X A;  3Q8U A;  1SKW A;  4EEY A;  2E5H A;  1JLE A;  3F41 A;  3QLH B;  1DQ9 A;  5H9E K;  2V4Q A;  1HBO B;  2FHJ A;  5C42 A;  3RBD A;  3FDS A;  3ZZT A;  3HZG A;  3OL8 A;  1OS5 A;  2A6O A;  4PXE A;  3QBC A;  4LF8 F;  4ICL A;  1T9Y A;  4FYW B;  3OXG A;  3IR6 B;  3IC1 A;  3MEE B;  1UL3 A;  2J9D E;  2AQ4 A;  1PYT A;  1RBO B;  4RNF A;  4YUD A;  1RT2 A;  4JI1 J;  3TAP A;  1VK3 A;  1XTZ A;  2JWN A;  1G7C B;  2EG1 A;  1V3S A;  2EK6 A;  5KFC A;  1T7P A;  5FII A;  5A8R A;  1LFP A;  5H1S V;  1SJ4 P;  4NLT A;  1UPP A;  3BYR A;  1HHS A;  2HYI B;  4IG3 A;  3UCG A;  1X9M A;  2XS5 A;  1MRO A;  4OMF G;  3OR2 B;  4WP8 A;  1O0P A;  2JVR A;  3RW7 A;  2GFF A;  2WAQ D;  3IAM 9;  3W5Y A;  5HBM B;  2ASL A;  1SBR A;  1F5A A;  1QLN A;  1JKH B;  3LP0 A;  4ZIW A;  4KPY A;  4FBT A;  2K1R B;  1S12 A;  3M7V A;  3Q86 A;  2EFG A;  1RWW B;  4CH1 A;  4TYB A;  3WZ0 A;  2PFF B;  2YWF A;  4LFA F;  4ES3 A;  5KFJ A;  2R7S A;  1U6F A;  3GTY X;  3MD3 A;  1WC3 A;  2NXJ A;  3DOM A;  1LWC A;  2MB0 B;  2QO3 A;  5DDR C;  2VG6 A;  1XMB A;  3DMJ B;  2KH9 A;  4D3H A;  3C3L A;  1T9X A;  4BC9 A;  1FRH A;  2KT3 A;  3QO9 B;  1VQ4 S;  2JC0 A;  1RAB B;  1NHK L;  3BZQ A;  4HKQ A;  3UW1 A;  1WHV A;  2XC9 A;  3BV8 A;  4NXM F;  4QIG A;  3HKW A;  1JLC B;  4DSL A;  3I9V 9;  3SSS A;  5I3U B;  3LP2 B;  3HF5 A;  7FD1 A;  1RWM B;  1UMJ A;  5A0Y B;  1U8W A;  3C46 A;  3BEG B;  4OLP A;  2Q6C A;  4OV1 A;  4ZP8 A;  3GLJ A;  4OZL A;  4N8N A;  1YBA A;  1LV5 A;  2CPD A;  1N54 B;  4Q2L A;  1NDC A;  2JJ4 D;  3HZE A;  1VQ6 S;  3U1N A;  2MY7 A;  2V2Q A;  4DCO B;  2XI3 A;  1IBL J;  2DXD A;  1IKX A;  2YTC A;  3KJV B;  3HJF A;  5D4L A;  4IFY B;  3QSY B;  3EVM A;  1IM6 A;  3ENQ A;  1ULR A;  4CDI A;  2E5L F;  3CCE S;  3HSZ A;  4UUW A;  2LU2 A;  1RT1 A;  2ROE A;  2YQ1 A;  5B09 A;  3D28 A;  2ZWP A;  3LUY A;  1Q8I A;  3D0H E;  3VAG A;  2HLU A;  2A3J A;  3D7S B;  2W2P P;  5CYJ A;  3SCJ E;  5A8W A;  1VRT B;  1FWP A;  1KLN A;  4QWD A;  2B5J B;  4UOH A;  1TUV A;  4KO0 B;  1XR6 A;  3BKF A;  3GWC A;  3DI6 A;  4PG5 A;  1HPZ B;  2VPX B;  3BSC A;  1YG0 A;  4I68 A;  3BN4 A;  4NX9 A;  5IFM A;  4OX7 A;  1HR0 F;  3D4J A;  2B6A B;  1T94 A;  1OQ3 A;  2UVR A;  3WQP A;  5B0C A;  4CH0 S;  3HT3 A;  3BR8 A;  2DRA A;  4OHV A;  1R8C A;  1KKH A;  2M0G B;  3DGV A;  3N01 A;  1S0N A;  1U0S A;  1KTV A;  3W2W A;  1TKT A;  5CD4 A;  1RTH B;  1Z1Z A;  2LDI A;  4LIW A;  1JXL A;  2PC6 A;  2YNG A;  4DV3 J;  3CDA A;  5J2Q B;  2VFR A;  3VAJ A;  3CDE A;  1XMO F;  2R7V A;  1WJ9 A;  3J7A N;  3RG6 A;  1NZA A;  5F9N A;  3UD5 A;  1XBW A;  2Y0S D;  1Q95 G;  4DPW A;  3SXL A;  4UOG A;  2W1B A;  4ZK7 M;  2ZUG A;  1L3T A;  5HMW A;  2B0G A;  5KFO A;  1IBK F;  1SL2 A;  2LEB A;  1Q8B A;  1M5O C;  3KLH A;  3V6D A;  1DHM A;  4OX6 A;  3PEH A;  3M2V B;  3FMB A;  2ZHO A;  2W7P A;  2OJ3 A;  2FJD B;  2DEJ A;  5ETP A;  2QV6 A;  2W4P A;  3GFX A;  3BBF A;  3GPA A;  2X1B A;  1IVZ A;  6FDR A;  1IWA A;  3B54 A;  1RXO B;  2WHO A;  3HDS A;  4QR1 A;  2KM8 B;  1XWL A;  4TNO A;  2OSQ A;  1CQN A;  2IMW P;  3RYL A;  2BUN A;  4K4X A;  4G1P A;  5KFL A;  1ZM4 A;  3KMS A;  2NSC A;  1IR1 A;  1RCX B;  2BJ9 A;  3FGV A;  4LRE A;  1WD6 A;  1EKS A;  4MAK A;  3U27 A;  3FBC A;  2C28 A;  2KJW A;  2JRS A;  4ZPW R;  5HMZ A;  4F2S A;  4B9M A;  1Y9O A;  4TY8 B;  3HUL A;  3PRB A;  1VFJ A;  2EWH A;  4NLS A;  1PO6 A;  3PJW A;  4DUY F;  5KTQ A;  3NGR A;  4I64 A;  2YKO A;  4JV5 F;  4AUK A;  5KFW A;  2KXN B;  1BGX T;  4DHV A;  1YJT A;  3MHY A;  4JI6 F;  2VC0 A;  3LPY A;  2Z2Y B;  3WHI A;  1DQA A;  5LSR A;  2OEM A;  3JAM Y;  4FNH A;  5IM0 B;  2KHC A;  4B17 A;  1HQU B;  2C3U A;  3KK2 B;  4DF8 A;  2ZBI A;  1KOO A;  3I56 S;  5F0U A;  4YY3 J;  2HHH F;  2GGP B;  2DNY A;  1N48 A;  1HWU A;  3ITH B;  3E2E A;  3E8O A;  2QC3 A;  3UDV A;  2DR9 A;  2VBX A;  4C0H A;  4YB7 A;  2PEH A;  2VAS A;  5LMN J;  1CBK A;  3W62 A;  2DXF A;  2FHM A;  1HNV A;  1RA7 A;  1S4F A;  3PFE A;  4ZP9 A;  3A12 A;  2MZS A;  3L7O A;  2AEF A;  4CQ1 A;  2HVD A;  1RCO B;  2H65 B;  1YBT A;  2AHO B;  4CLP A;  1Y4Z B;  2YKN B;  2Z2M A;  1GK8 A;  5K8P A;  2ZC3 A;  1N34 F;  1X4H A;  2UUA F;  1NO8 A;  4X64 J;  1FFG B;  3PIO Q;  3C19 A;  2E1C A;  2FJX A;  1RDR A;  1S9F A;  3ZZP A;  2BKN A;  2YWE A;  3MMB B;  3PTW A;  1N52 B;  2MPU A;  1D8Y A;  1IKV B;  2DIT A;  1HLW A;  1TL5 A;  3NOG A;  1JIH A;  2IRU A;  2ZNZ A;  1H72 C;  4KV8 A;  2PE8 A;  4FXW A;  3TVZ A;  4A47 A;  2XWY A;  2HWH A;  5KG6 A;  2O66 A;  1UVJ A;  3FSY A;  2BE2 B;  4EO6 A;  2YNH B;  4YHH J;  1KVK A;  2YKA A;  3O3L A;  4UT4 A;  4P52 A;  1NSA A;  2YVS A;  3BGR B;  3K5L A;  4ECZ A;  2FHO B;  3DGP A;  2Z4P A;  2VC1 A;  3VZH A;  2UUB J;  3X1L B;  4OI4 A;  4CTA B;  4G1I A;  1ACM B;  2D3O 1;  2UXD F;  3EXC X;  1S1U A;  4NLO A;  4L3K A;  2EKN A;  2YH1 A;  3GCX P;  4PWD B;  1T9V A;  2AT1 B;  2YPY A;  4Y2A A;  2RNE A;  4Q2M A;  1DBD A;  2V9K A;  3G96 A;  5ADZ A;  1RAA B;  1BWE A;  3MCO A;  3NMA A;  3BO2 A;  2C2N A;  5AXL A;  1DAR A;  4ZIV A;  2RDI A;  2V2K A;  4JI4 J;  1HI8 A;  3EVW A;  1Q79 A;  1D9F A;  1DFD A;  3LPE A;  1KEK A;  2MY8 A;  2RKI B;  5KFE A;  1WEL A;  2NXC A;  2CQ0 A;  2XY5 A;  2BZ2 A;  3IS9 B;  1Z2L A;  3LW5 C;  2I6W A;  4L72 B;  2DCU B;  5CYM B;  3HSG A;  4FN5 A;  1ZTW A;  2I5J A;  1FVQ A;  4FS2 A;  4ILR A;  4D3G A;  2K3I A;  2WON A;  3KLG B;  1UEU A;  2DIV A;  3QGH A;  4Y2M A;  2EPI A;  2PT0 A;  1N88 A;  5J2M B;  2W8L A;  1LEO A;  1BE4 A;  3M30 B;  2X1A A;  2DTJ A;  1JJ2 R;  1JLA A;  4KE5 A;  4HHH A;  2K3K A;  4ZPA A;  2ZH4 A;  3KNG A;  3R1H A;  3BBC A;  2GIQ A;  2YX7 A;  1HNZ F;  3HP6 A;  1FWL A;  4WZQ A;  4NAS A;  1EET B;  2EEY A;  4J9V A;  2HBZ B;  4B9V A;  1TMJ A;  4PYA A;  1AZS B;  4CO5 A;  2NLW A;  4FYV B;  4JUZ A;  1WEX A;  4GKJ F;  3DOM B;  3SCK E;  4ZVR B;  3DXB A;  1X4F A;  4KHP J;  3TRG A;  4RW8 A;  3CJS A;  1RP5 A;  2HGL A;  1FKA F;  1Y3K A;  4X84 A;  1XER A;  2QE5 A;  2BX6 A;  4EFA C;  5HQ8 A;  5F3Z A;  3FBF A;  2DRB A;  2FVP A;  4RL1 A;  1CJK B;  4HVZ A;  3G8T A;  4DG1 A;  4QBU A;  2KU7 A;  4F8R A;  4OYW A;  2PMW A;  2OLW A;  4IDK A;  4PAB A;  4F3M A;  1F2G A;  4B3S F;  1QTN B;  4WZM A;  3EDQ B;  2DGO A;  1KFD A;  2L41 A;  4USJ C;  4ANE A;  3MED A;  2V4J A;  4OLO A;  4WF9 Q;  3BO3 A;  2XNR A;  1GX6 A;  1MW7 A;  1RSC A;  5D3G B;  4DQI A;  4ZJQ A;  1R7I A;  2EW9 A;  4X65 J;  4FXD A;  4PZV A;  1S7H A;  1E6Y A;  5DG8 A;  2ASY A;  2XYP B;  4PG4 A;  2CQ2 A;  4F04 B;  4LF7 J;  3G9C A;  1R8A A;  4PG7 A;  1TFY A;  2E5G A;  1T0T V;  5AJ3 J;  1RZM A;  4NEZ A;  3UI3 A;  2CNK B;  2FVQ A;  4KGK A;  3R5B A;  3QWP A;  3FCH A;  4DXL A;  2VV5 A;  3EGN A;  1A6L A;  2ZWO A;  1RTI A;  1S99 A;  1UEK A;  3MCN A;  3KLF B;  1IQZ A;  4PQA A;  4P2X A;  3G71 S;  2YX1 A;  4TLQ A;  1UA0 A;  3ISN C;  3RJM B;  3MEG A;  3K2Y A;  3RAQ A;  4F2R A;  4YB5 A;  3TAR A;  2GVD B;  1UWB B;  3CB4 A;  2V50 A;  3AA9 A;  3CSK A;  3BM7 A;  2OO4 A;  2HK2 A;  3VGU A;  5LXR A;  2ZD1 B;  2KT2 A;  4ECS A;  2F40 A;  3KDN A;  2QL9 B;  1YVF A;  1HI0 P;  1NJW A;  3SFG A;  1GXU A;  1CJT B;  1GTE A;  3HHE A;  2CJQ A;  3LWM A;  4R0E A;  4NEY A;  4K4S A;  5GAG U;  2CNN B;  5KFU A;  1NJY A;  2DHA A;  1FNM A;  5KFI A;  5HAN A;  3HHN B;  2D9O A;  1NM2 A;  1RTD A;  2CZ4 A;  2F4V F;  3O6Q A;  2XUL A;  2KVQ E;  4JYA J;  4R8U B;  2XZD B;  4BBY A;  4HEA 9;  2WVC A;  4MK9 A;  4LBI A;  2Y8W A;  4DFM A;  1EB0 A;  3KFW X;  2JH3 A;  5HO4 A;  4ZCI A;  1LWE B;  1I94 F;  5KFP A;  4NLD A;  2GS8 A;  1WF1 A;  1TTH B;  4MK8 A;  5FLX U;  3GON A;  1RJJ A;  2PN6 A;  5FD1 A;  2OD6 A;  3S1T A;  3IBC B;  1L3K A;  3C14 B;  3KUE A;  4N56 A;  4KAI A;  1SH2 A;  2V34 A;  3ILL A;  3WC2 A;  1TVR B;  2ZH8 A;  4FF1 A;  2MKS A;  3MM9 B;  2HNZ A;  3VV2 B;  4H4K A;  2LXI A;  1NKC A;  4JBC A;  2HLT A;  1OSD A;  1M1H A;  5HVH A;  1WG5 A;  4HH0 A;  4OYI A;  4DCP B;  2AMC B;  4Z2X A;  1R0C B;  3JYT B;  3EZO A;  2E5J A;  2Z8Q A;  4GO7 X;  2LMI A;  3TZY A;  5B08 A;  1M1K T;  1NDK A;  1BUX A;  4CLK A;  4KH1 B;  2ADB A;  1C1B A;  5M2U A;  2KB2 A;  4HHJ A;  1U1L A;  2IA0 A;  1DRZ A;  1QAX A;  4PAA A;  4NOH A;  4LF4 F;  2OHD A;  4USM A;  3AAW B;  5IT4 A;  3TWZ A;  3M6X A;  4MKV A;  4WK1 A;  2DKO B;  3WIV A;  4X4R A;  4PPZ A;  4FZV A;  2DHG A;  3CO9 A;  4OI6 A;  1N5Q A;  3THP A;  2BW7 A;  1S9E A;  2AJ2 A;  4DV7 J;  2J0W A;  5G4D A;  3VTI A;  1FD8 A;  2F9D A;  2OI2 A;  3LWL A;  2JLF A;  5K14 A;  1N33 F;  3RR8 A;  3L9Z A;  1B4S A;  1U1O A;  3IAS 9;  1H74 A;  4B3M J;  4WFZ A;  1JJC B;  2EFO A;  1UP1 A;  4KB7 A;  4LF2 A;  4LSN A;  4ZVO B;  4NWB A;  4WXO A;  4NMX A;  5IQQ A;  5IC6 B;  4HDG A;  4J9Q A;  3DDK A;  5LMU F;  1S57 A;  1X4A A;  1WKK A;  4QPT A;  1FKP A;  2OPS B;  2XSF A;  4DL6 A;  3CTR A;  3GQC A;  2RD5 C;  3C2P A;  2DHX A;  5MLC V;  2QJ3 A;  1RT3 A;  3RZA A;  3DCA A;  3JSM B;  1B99 A;  4YB6 A;  2XNQ A;  2MKJ A;  2HVI A;  2X3D A;  3UO0 A;  3W60 A;  4GVB B;  1FRL A;  1TV6 B;  3AQO A;  4F0H A;  2IJF A;  2F1F A;  5F8N A;  1VHI A;  4RW7 A;  1SL0 A;  1NSK L;  1CUL B;  2J7U A;  2XG8 A;  1LW0 A;  4PXB A;  5LXY A;  2J9D A;  3PDN A;  2N7C A;  1ZPW X;  3W2V A;  3WX8 A;  3MMA A;  2M3D A;  1RT7 B;  4OZJ A;  1PGZ A;  3HVT A;  4NI2 B;  1Q8L A;  5HLF A;  3IR7 B;  4DR6 F;  1TKZ B;  2D69 A;  2MDA A;  3FZ2 A;  3SMZ A;  1T05 B;  5ETK A;  3CCU S;  3LAK A;  3LAM A;  3EGZ A;  2WVD A;  5K5M A;  2IY5 B;  1T03 B;  2JNJ A;  3HHK A;  1CC7 A;  4Z37 A;  1REV B;  3MCM A;  5CHC B;  2WSE C;  2B9X A;  4DWI A;  3R97 A;  4GO5 X;  3MEC A;  1FX2 A;  2AEM A;  3ETM A;  1NK6 A;  1X4E A;  5B7W A;  2ZC4 A;  4USI A;  4IH7 A;  4XTT A;  1OIA A;  3CVK A;  1HNI B;  2HZV A;  1Q7L B;  4DPU A;  4GC7 A;  1HBM B;  3PJX A;  4K50 A;  1Z4U A;  1WUU A;  4ZVE A;  4ECW A;  2VBW A;  4CO1 A;  5LJ3 Y;  4K5S A;  2VU5 A;  4HL9 A;  3L09 A;  5KG5 A;  1RAI B;  3V4I B;  3D9B A;  4ZPV R;  2IRY A;  4LR8 A;  1HWJ A;  3MPU B;  3MPV A;  2R8H A;  4M5N A;  2ASJ A;  4ECT A;  2CFX A;  2MZ1 A;  3G6E S;  2GQQ A;  3EGW B;  3V2U C;  1CJU B;  5JXS A;  2ALY B;  5KFX A;  2C2R A;  2CWK A;  2I5J B;  2GO9 A;  2J0S D;  1FDD A;  1V3R A;  2R7U A;  4NYO A;  1NHV A;  3BQ2 A;  4DL5 A;  4MFB B;  4B9U A;  3P45 B;  4MMO A;  4DR5 J;  1NZ8 A;  1X5S A;  3M32 B;  3VVT A;  2AIR B;  3CJK B;  3TAM A;  1TP7 A;  4LSL A;  4P6Q A;  4DJB A;  4RUA A;  3N0V A;  1CLF A;  4X4S A;  1LWF B;  1NLK L;  5IXU A;  2KFZ A;  2RDJ A;  3M8Z A;  4HAC B;  4CYU B;  2O3D A;  5DZ6 A;  4RX6 A;  1RT5 B;  3SSR A;  3CJ2 A;  1VC6 A;  5HAT A;  2V2V A;  4I2P B;  4QWB A;  2AYM A;  3NRB A;  4H4O A;  2AZ3 A;  4DUZ J;  3DRP A;  4M63 A;  1RI7 A;  3QGG A;  4JI7 F;  3M9N B;  2ZH6 A;  4URS A;  1T02 A;  2AZ1 A;  3GP9 A;  5M2P A;  4ED6 A;  3D3C J;  5GME A;  2VH7 A;  4IYQ A;  2A0F B;  2HBY B;  4MKA A;  4CM0 A;  2DNQ A;  4TN2 A;  4DV2 J;  2LQJ A;  4DG1 B;  3E01 A;  5ETV A;  4X4N A;  2P6S A;  6AT1 B;  4DR7 J;  4XIU A;  5EWG A;  1X5P A;  3WX4 A;  1UKU A;  3CCR S;  1SB6 A;  4X4V A;  3UWT A;  4NLW A;  2F8H A;  2VB6 A;  4PR6 A;  2XYG B;  2ZFH A;  2V8V A;  3MM6 A;  4K4V A;  3ZXW A;  4OZ0 A;  3AOB A;  3GFZ A;  1CJV B;  2HHU A;  5KFD A;  4JYA F;  3NGT A;  5EX3 A;  4KC5 A;  3KHR A;  4LF9 F;  4Q0B A;  5E7O B;  1VQ7 S;  1BC6 A;  4OZN A;  5J1E B;  3R7N B;  2G0J A;  1TL1 A;  1WF0 A;  3MMC B;  2L9N A;  4PXC A;  1BQM B;  3BBB A;  3JQJ A;  2K7J A;  1KNZ A;  3CNQ P;  1VYA A;  3TJ8 A;  3JSB A;  4A8M P;  5MAO A;  4U95 A;  1C0U B;  3BH7 B;  2AEJ A;  1IM4 A;  3T41 A;  3KJQ B;  5A8K A;  1NU4 A;  1T9U A;  3KDO A;  2BM1 A;  1XNQ J;  2KZZ A;  3BSO A;  2M4M A;  1VQO S;  3D68 A;  5D0H A;  4HR2 A;  2E9T A;  2NZ4 A;  1ZH5 A;  4MKB A;  3AY0 A;  2R9L A;  1HW9 A;  1N6Q A;  3B78 A;  1OPZ A;  4ZVQ B;  4ZHR B;  3TX8 A;  3H5S A;  4PKD B;  3J81 j;  3L4B C;  2J9C A;  2CQC A;  1FXR A;  3CCT A;  1VBK A;  4YFU A;  2K7K A;  4J9M A;  2CDQ A;  1TKX A;  3T1Y J;  3D66 A;  3I55 S;  4EZ9 A;  4J9P A;  5H9F J;  2PO4 A;  2BJ8 A;  2HIY A;  3S01 A;  2MZJ A;  4W98 A;  5HRO B;  2CQB A;  3F0N A;  4TVA B;  2P9G A;  1PKU A;  4F4X A;  4FKY A;  1RAH B;  2J7W A;  4WYW A;  2BXJ A;  2VJV A;  2HQG A;  1U6B A;  4NLY A;  5EUH A;  4ZJO A;  3V5R A;  2FUG 9;  2UP1 A;  3CCV S;  2BOP A;  1EIY B;  3NLC A;  2VUG A;  4O23 A;  2C2K B;  5KT5 A;  2CZV C;  4RW9 B;  2WSC C;  5AXK A;  4DV4 F;  2CRL A;  5HP1 A;  3PNI A;  5D4N A;  3GV7 B;  2HFS A;  2GMJ A;  2PII A;  4HTJ A;  4AFF A;  3I4H X;  3GR1 A;  2OPR B;  2QSW A;  4J9S A;  2IYI A;  2CA9 A;  2XLI A;  3KJF B;  1YQH A;  3UDE A;  3C6T A;  4IFV B;  5G0R B;  5I42 A;  4M5J A;  3QIP A;  2RDD A;  1IUJ A;  3MR7 A;  3GV5 B;  1J5E J;  3ETO A;  2CPI A;  4X66 F;  1M5V C;  1WC0 A;  4DEZ A;  3EZU A;  3HFK A;  3CJ4 A;  2FJW A;  5GAH I;  4B08 A;  3KMQ A;  3Q8R B;  3ELH A;  3BGL A;  1Y5I B;  2OEJ A;  1BHN A;  4LQ9 A;  1R31 A;  1W7W A;  4O3Q A;  4WKY A;  1MNE A;  4K4W A;  5JVG Q;  1C1B B;  1VGY A;  3CDW A;  1RTJ B;  1L3U A;  1Y3J A;  2GCF A;  2F65 A;  2HQ3 A;  2UUC J;  3SCL E;  3VWS A;  1YJR A;  3TZZ A;  3N5F A;  1JB0 C;  3I5B A;  4AXJ A;  1RAO A;  2KXH A;  3C16 B;  4CWB A;  3V81 A;  2RAQ A;  1H2T Z;  3BDP A;  1GXT A;  1N32 F;  4P2M A;  3OT9 A;  4I67 A;  1LWX A;  1VLO A;  1NK4 A;  1ARO P;  1F1B B;  3FQL A;  8AT1 B;  1LW2 A;  2R7R A;  1K0V A;  3N6L A;  3H5Y A;  5JUM A;  3AOC A;  4OYO A;  3M2U A;  4ZCL A;  3MR5 A;  1QDU B;  3KLE B;  1SH0 A;  3PW5 A;  4ILM A;  4PXD A;  3UVJ A;  3EMT A;  3D5M A;  2BAN A;  4O3P A;  1U02 A;  4FYY B;  1S77 D;  1IN0 A;  1HWL A;  2GQ2 A;  2H5J B;  4R0J A;  4XK8 C;  4TU8 A;  2ZHB A;  4OV6 A;  1YK9 A;  3QZ7 A;  4DS5 A;  3MPD A;  3WDO A;  3TNV A;  3M8Y A;  4ZLL A;  1BWV A;  2Y1I A;  2I8E A;  2JOQ A;  3HHL C;  5ETT A;  1T3N A;  3ZZZ A;  3K8W A;  4WP3 A;  2LP4 A;  1B64 A;  4X4T A;  3R5D A;  3TJA A;  1T9W A;  2HFN A;  1DTQ A;  1S1V B;  1RT3 B;  4DLG A;  4IRK A;  3N9U C;  1X0P A;  2GNK A;  4URG A;  5D4P A;  1R3N A;  2AWZ A;  1ZAW A;  2M8H A;  3HKZ D;  1C4C A;  4QZV B;  4ZN1 A;  3MAQ A;  4C8N A;  2MLX A;  3KK1 A;  3D6H B;  3OTB A;  2JL9 A;  1IKW B;  1M5S A;  2IDE A;  5ITH A;  4DR5 F;  3GIM A;  1QTM A;  5HSP A;  4Y6I A;  4LFB F;  4QIW D;  2N4D A;  4ES1 A;  2Z0G A;  1QE1 B;  2HS0 A;  4CLY A;  3W2V B;  2ZOG A;  2VA3 A;  2JEG A;  1YRX A;  2LVW A;  1EHW A;  5DGB A;  4IO9 Q;  1M5H A;  2OPQ A;  8ATC B;  2H54 B;  4F50 A;  3AJD A;  3CC4 S;  2QSF A;  3OFE A;  4LRF A;  1WI8 A;  3D6F B;  5FLX Y;  3HVW A;  3HX9 A;  1N0V C;  1I1G A;  3BO4 A;  5EX0 A;  5K20 B;  1C4A A;  3H42 A;  2YWG A;  3B4D A;  4E0D A;  4DUZ F;  3A3O B;  2DGX A;  2CNL B;  5KFG A;  3JQK A;  1P1L A;  3EPI A;  3PYF A;  5CCL A;  3K58 A;  4I7F B;  4MT1 A;  1SJF A;  2PDA A;  3PM9 A;  3CJ3 A;  2VJU A;  3DRR A;  1U25 A;  3ENA A;  2KYZ A;  1HD1 A;  2XMV A;  3ZO7 A;  1UW4 A;  3SDE A;  1HBU A;  3IXQ A;  2ZKT A;  2MJU A;  5F0W A;  2DGQ A;  1L3V A;  2MYF A;  4AL6 A;  2G2O A;  3T6B A;  4J9U E;  1PC5 A;  4LFC J;  3MOZ A;  2HHV A;  2G13 A;  1JLF A;  3FQK A;  5F8G A;  1UA1 A;  1X7V A;  2W2N P;  4USH A;  3SCI E;  4OZ2 A;  4CLW A;  1FFS B;  1HA1 A;  2G0I A;  3NOC A;  3G86 A;  2MQO A;  1SKU B;  4I6W A;  5E0O A;  1B3T A;  3Q0A A;  2H3E B;  3O2I A;  1ZTT A;  2ACM A;  4E98 A;  5KAK A;  3PW2 A;  3FRY A;  3MR6 A;  1WC5 A;  4ALZ A;  2Y0B B;  1S72 S;  1REG X;  4OHY A;  5B0A A;  3TAM B;  1MMD A;  1OO0 B;  1PYO B;  1YJ7 A;  3GJS B;  1M1G A;  4XPC A;  1FCA A;  1RAD B;  2FJB B;  2UUW A;  1B0T A;  1HAR A;  1JNR B;  2ZM6 F;  3C8Y A;  5T7L A;  2DGT A;  4FDF A;  4ED2 A;  1FVS A;  1ZAX A;  1PIE A;  2KRR A;  4LF8 J;  2IAJ B;  2I1R A;  3IM8 A;  2XCA A;  2MQP A;  3DOL B;  2AKW B;  1JLG B;  5D6G A;  2F5G A;  1RAJ A;  2QTW A;  4FF4 A;  3DRP B;  3S7R A;  3O5T B;  1N4L A;  3NCR A;  2C2M B;  3KJN B;  4L74 A;  2GIF A;  4LRB A;  2QLX A;  5HAO A;  3PR4 A;  4C48 A;  3Q8Q B;  1ZAV A;  1QJH A;  2VG7 B;  3D3B J;  3RGI A;  3M9O B;  3R2D J;  3PX6 A;  1ZET A;  3Q8S B;  1ZA1 B;  3MPW A;  3PW4 A;  5K8M A;  3WIU A;  1BQN B;  4ECU A;  3AJ1 A;  4DFK A;  3K5O A;  2XZW A;  3LOU A;  2WZ1 A;  4N77 A;  4KT0 C;  3D6M B;  5KFN A;  5A2Q U;  2QA1 A;  3DLE B;  4LFA J;  3TP2 A;  2R7Q A;  1F6T A;  1QD1 A;  2OGU A;  5KT3 A;  3QGP A;  2MQQ A;  2DNK A;  4CO4 A;  2F8E X;  3BN7 A;  4ID5 B;  4YDD B;  2UU9 J;  2MGZ B;  1TL1 B;  3B4M A;  2ZJR Q;  5SZT A;  2KFY A;  1GT8 A;  1S79 A;  3EYZ A;  3BPS P;  3K7R A;  3KG4 A;  5DM6 Q;  1TAU A;  1SC1 B;  2EBG A;  4PWW A;  4DR3 F;  2GHP A;  2DYA A;  4JI0 F;  3T5L A;  2BYC A;  4NXM J;  3VQT A;  4DX6 A;  2Q1L A;  3I0S A;  3IFE A;  3LAL A;  3FCW A;  4RR5 A;  1UWA A;  3EZ5 A;  3SFU A;  1MN9 A;  3FK4 A;  2IHR 1;  2IVM A;  2RS2 A;  1ZA2 B;  1X9W A;  3DRX A;  1J5E F;  3C15 A;  1K8A T;  1SVD A;  1S0O A;  1TL3 B;  3CCQ S;  1WTB A;  3NMR A;  4C11 B;  2OFH X;  2VZ9 A;  2VD3 A;  3ILJ A;  1RA6 A;  4C7Q A;  1S1X A;  2CPZ A;  2GQC A;  5K9F A;  2CPE A;  2RUS A;  2HAI A;  4HYK A;  1HL6 A;  2OUG A;  2HUR A;  1H2V Z;  2CQ4 A;  1NH8 A;  2KKH A;  3P6Y C;  5DS7 A;  2LXF A;  2HVH A;  4XDD A;  4I69 A;  4NYP A;  2E5L J;  4X2B A;  4LF1 A;  2VHG A;  3T19 A;  4E8U A;  1FJ7 A;  3TA1 A;  2XMU A;  1KWM A;  4UST A;  2OPP B;  1WG1 A;  1KLM B;  3A8E A;  2E7X A;  2DIU A;  1R43 A;  2RIL A;  4JI3 F;  4W4M A;  5AE1 A;  4LR9 A;  1RBA A;  2A2D A;  4DR4 J;  3HHL B;  2AJQ A;  3MCS A;  3J7Y U;  1FHT A;  2VQF F;  3ET6 A;  4M5D B;  4KFB A;  1TKD A;  1HR0 J;  3GJQ B;  3I96 A;  1O6X A;  4UZB A;  1YJW S;  2W2M P;  4IOA Q;  2G2Y A;  1HBN A;  4AYB D;  1SC6 A;  4BLG A;  5D0R A;  4IQM A;  2WOM B;  3QYY A;  1HQE B;  5DQH A;  4NA2 A;  4B3O B;  1FNO A;  4WXW A;  2VG5 A;  2NPF A;  4ZN3 A;  2CIM A;  2NYH A;  3KTQ A;  2D3O R;  4G1Q A;  1H73 A;  4AQY F;  1FX4 A;  3DKD A;  3OD2 A;  4U8Y A;  1T11 A;  1UPM B;  5KOW A;  3I0R B;  4RU2 A;  4KH0 B;  1SV5 A;  5KG4 A;  1XMO J;  2XI2 A;  4FKX A;  3K5P A;  2GVZ B;  2ZDO A;  3VGS A;  4Q7A A;  2AU0 A;  3QJJ A;  5HJX A;  2XLK A;  1VRU A;  2YNI B;  1A9N B;  3AD7 C;  1I6J A;  1PCA A;  3TX0 A;  4GKK F;  4FBU A;  2ATL A;  4BHQ A;  2HZC A;  1PJ5 A;  1SPB P;  3P49 B;  3T5K A;  3GIK A;  1NPK A;  2YY3 A;  4V19 X;  5IT9 U;  1TL7 B;  4RW4 A;  1BQX A;  1NK5 A;  2FQQ B;  1X8D A;  5J1P A;  2EI5 A;  2DR6 A;  4BDP A;  3AD8 C;  5E41 A;  1RT4 A;  4EYH B;  5CAA A;  3DHX A;  4ELV A;  1XN9 A;  2LEP A;  3FEY B;  1HYS A;  3MM8 A;  1VC5 A;  2R8K A;  3D54 A;  5FDL B;  3IO1 A;  1FNX H;  3SQG A;  3P4U B;  4KKO B;  4K4Y A;  4PG8 A;  3ZNU A;  3OTD A;  4P72 A;  2QFI A;  5A6P A;  1S6U A;  1RU2 A;  4A8W A;  4NE9 C;  4O44 B;  1IBM F;  3GE9 A;  4CLS A;  2OML A;  1NXI A;  5L39 A;  2BW2 A;  3R7S B;  3GII A;  3ZNJ 1;  3TUP A;  1S6Q B;  4FF2 A;  1VQ9 S;  2M8D B;  1HNX F;  2RQ4 A;  1O8B A;  4DL7 A;  4ED4 A;  1WHW A;  1OMS A;  1KSP A;  2NUU G;  3IR5 B;  3CW2 C;  4DUY J;  4NLG A;  5F41 A;  2FY1 A;  2K06 A;  4JV5 J;  1RHR B;  2FC9 A;  2P9E A;  1S10 A;  2V69 A;  3PRD A;  3TR5 A;  2DCL A;  3IWN C;  5DDQ C;  3J81 U;  1RIS A;  5L38 A;  1H7W A;  3DLK A;  2WB4 A;  4EUV A;  1C1C A;  1KDN A;  3QFH A;  3RU0 A;  5LJ5 Y;  4IG0 B;  3NS6 A;  2BDP A;  3FBE A;  3TOQ A;  3GYX B;  3DOK B;  1GMW D;  1TFW A;  2FIU A;  1YRU A;  4EI2 A;  4V1A k;  2J0Q D;  2ZH5 A;  1R0B G;  4OHZ A;  3KK1 B;  2HMI B;  5GAE I;  2LU1 A;  2BKP A;  5GAD U;  1S59 A;  1YKW A;  5JJB A;  1S6P B;  3PFO A;  2JDJ A;  1BD6 A;  2WBR A;  2C3M A;  5KFY A;  3CJ8 A;  4PUO B;  2C2D A;  2B7B B;  1NCL A;  1R8P A;  4NLV A;  3T9N A;  4B3R F;  3ENW A;  4ZP7 A;  4RJV A;  3KXD A;  4EMD A;  3N5B A;  1Q8K A;  3M4X A;  3FSX A;  2YKM B;  4DL3 A;  3FNN A;  3ZTQ A;  3GV8 B;  2HHW A;  1YJ9 S;  1AT1 B;  3LP1 B;  4C8M A;  2JEI A;  1R8H A;  1N34 J;  2WTF A;  1RWU A;  1R0A B;  2ZBR A;  3H0P A;  2UUA J;  2RRN A;  1ZOT A;  4QWA A;  2JC1 A;  2CJA A;  2NXU A;  4P74 A;  1H98 A;  4CNZ A;  3G6X A;  2W9B A;  3AOD A;  1NB7 A;  3CCL S;  1ROF A;  3HMJ G;  4ED8 A;  3KLI A;  4A8X A;  4JV0 A;  1SH3 A;  4USV A;  3QSI A;  2HQI A;  3AB2 B;  3TW0 A;  1WKL A;  4KPC A;  3OR1 B;  3SDE B;  3DM2 A;  4NZ6 A;  3PW7 A;  1EP4 A;  1PG5 B;  2E1M C;  1E6V A;  4WJB A;  3QFW A;  4C0B A;  3MUM P;  4BWM A;  5HN0 A;  5CYQ B;  4NLR A;  2PGC A;  3HJV A;  4QU6 A;  3IG1 A;  3LA0 A;  1HHT P;  4PPD A;  3RTV A;  1J5O B;  2FVS A;  3DYA B;  4F4W A;  4MIW A;  3CD7 A;  1JLQ B;  1MU2 B;  3A13 A;  2K8G A;  3HXM A;  2UXD J;  4ZLN A;  1IQT A;  2UU9 F;  1HMV B;  5HJY A;  1GFW B;  1GMV A;  2GC8 A;  4G6V B;  4DBQ A;  2RF2 A;  3BYP A;  3T1A A;  4KIA A;  4OJ3 A;  2E9Z A;  2VOD A;  2Y1R I;  3UDL A;  4WU2 A;  2BRL A;  5B0G A;  3OTE A;  3CUL A;  1W26 A;  3IRX A;  4RW6 B;  4ED0 A;  2LQ9 A;  3JXO A;  1DLO B;  3S8S A;  4B9L A;  3BQ1 A;  2LQB A;  4IR9 A;  2CVE A;  2Y3Y A;  4QR2 A;  1IJE B;  4I2Q A;  2J6U A;  2CPJ A;  2IBK A;  3CCS S;  2E1R A;  1VOM A;  2PI4 A;  3NGK A;  3OL7 A;  3H2U B;  2I38 A;  1WEZ A;  2Y1J A;  1T8E A;  2HRY A;  4NCG A;  4K4T A;  1S1T A;  3Q8V A;  3HSD A;  1FK9 B;  3M8Q B;  2CQ3 A;  4J7C A;  5C24 B;  5DQI A;  3J7Z 5;  1H3D A;  2DNL A;  4UTG A;  3IA0 A;  2BR0 A;  2KI2 A;  3W3S A;  4WE1 B;  1FJE B;  1KD1 T;  1SJR A;  1QSL A;  1DTT A;  4OI0 A;  2D3U A;  5ETQ A;  2HQC A;  1WOS A;  1RAG B;  1VIO A;  2W7A A;  2E7W A;  1HNZ J;  5DQG A;  3MAA A;  1SQE A;  2CQI A;  2R7X A;  3NL0 A;  3IM9 A;  2LKZ A;  4DR4 F;  1GX5 A;  1HNW J;  3BKT A;  2HRU A;  4K0K F;  2VOP A;  3THT A;  1UVL A;  4WPA A;  3KHL A;  2DNG A;  3J7Z T;  4GKJ J;  2JVO A;  4YEA A;  3G82 B;  1FRK A;  3RB4 A;  3KK3 A;  4U6P A;  3F73 A;  4C8O A;  3MUR P;  2IA6 A;  3FEX B;  2J76 E;  3ILO A;  1UVM A;  1UAW A;  2CNO B;  1BLU A;  3OVB A;  2R2U A;  2HHS A;  1A0O B;  2CPX A;  4DPX A;  2QLF B;  2LFV A;  2AJF E;  2MMY A;  3RBZ A;  2A1B A;  1U47 A;  3SV4 A;  2RH3 A;  1U2C A;  3PZP A;  3J80 U;  2NXN A;  3QPI A;  3P5B P;  1F9F A;  4CLT A;  2OD4 A;  3CGI A;  2IVF B;  3CMA S;  2B8P A;  2UVW A;  2AYE A;  4B3S J;  4IRD A;  4C8Z A;  2JZ5 A;  2VFV A;  4O4G A;  1KS2 A;  2QT7 A;  4OYA A;  1WHX A;  2N3O A;  3OUY A;  2FDN A;  2YNF A;  4RNN A;  1RWN B;  3HCX A;  4K7Q A;  3MM5 B;  4PCQ A;  2XYH B;  2B9Y A;  4ZS6 A;  4EK2 A;  2DIS A;  1FF2 A;  2HND A;  2FC8 A;  3O44 A;  1QAJ A;  2B51 A;  4UOF A;  1F9H A;  1Y5L B;  4LF6 F;  2WK4 A;  3KHH A;  2HVZ A;  4Y3C A;  4DX7 A;  2HG4 A;  1URR A;  3OTO F;  2DEI A;  1KQG B;  5B0E A;  1MN7 A;  3QLH A;  4I0W A;  2QX0 A;  3DRS B;  2DPI A;  1HBO A;  3MFH A;  2DH9 A;  5C7P A;  5KFR A;  4X62 F;  1GTH A;  3NCP A;  2H4W B;  3OL9 A;  2FLP A;  2ZH9 A;  3VGV A;  2DGW A;  2IC3 A;  3MEE A;  4OFZ A;  3LTO A;  2IBO A;  2KN4 A;  3DDN A;  2HS4 A;  3MI7 X;  5DDP C;  3TI0 A;  1RBL A;  4P9S A;  4JV2 A;  1KR4 A;  3BKU A;  1N5Y B;  2A6M A;  3CJ0 A;  5A76 A;  1UVK A;  4MKY A;  1U1M A;  3H7H B;  1YBU A;  3GSD A;  2ZBQ A;  2L9W A;  1RTZ A;  4J9K A;  5KFF A;  1NJI T;  2F3J A;  3OR2 A;  4QWE A;  3JSY A;  2CXE A;  1EQM A;  1RHJ B;  4U7C A;  3GJT B;  1D1U A;  5HBM A;  4IO1 A;  5KFB A;  2HZA A;  2ZVI A;  4W92 B;  4BWJ A;  2BRK A;  1NB2 A;  2NS1 B;  5DDO C;  1ZPV A;  3UQS A;  3MEK A;  4UOC A;  1NAQ A;  3KWM A;  5DG9 A;  1JJH A;  1TK0 A;  2B9W A;  4OZ3 A;  3I5A A;  1RU1 A;  2K1R A;  4LRC A;  1S0V A;  2ABY A;  3UN3 A;  5F8H A;  1S9G B;  2SXL A;  4C2M A;  2YPZ A;  4PQU B;  1LFW A;  2RHS B;  3ZZO A;  1LXN A;  3NAI A;  4MTP A;  3NGS A;  3MGJ A;  4ECX A;  4H4M B;  2LEA A;  1IKY B;  3G8Q A;  2CVI A;  2ZH1 A;  2M52 A;  1R8B A;  1RT6 B;  2F4V J;  3DMJ A;  3SIP B;  3G4S S;  2W01 A;  4F3O A;  2CWX A;  5C2C A;  4U96 A;  4QQB A;  2V9W A;  3QO9 A;  1GMU A;  3N6N A;  1TUW A;  1X0F A;  2YH0 A;  5KT2 A;  5IT0 A;  1I94 J;  2XSJ B;  2Y8Y A;  1NDP A;  3EIC A;  3ZTR A;  3C6U B;  1YI2 S;  2CJY B;  1TAQ A;  2WB1 D;  1JLC A;  1X60 A;  2VOO A;  3IWL A;  3M2R B;  4A8Q A;  3LF0 A;  1DY3 A;  5A2Q Y;  4ZCK A;  1NKB A;  3DLB A;  5I3U A;  3HM9 A;  4WTO B;  3LP2 A;  2WSF C;  5J2P B;  4QYZ J;  1JK9 B;  5A0Y A;  1F60 B;  4RW4 B;  2C2E A;  5IWA F;  4OYZ A;  2KG1 A;  4CT9 A;  3M1V B;  4E2F B;  2RSQ A;  2HQD A;  1EX8 A;  2C3O A;  3RUB L;  4LR7 A;  1MSW D;  2AX0 A;  2DPJ A;  1PBU A;  5L8R C;  3I87 A;  5D78 A;  3SQO P;  3ONQ A;  4A8S A;  3TVY A;  4OJ1 A;  3B8H A;  2Y9H A;  4I4B A;  2XWX A;  4DMZ A;  1BMQ B;  3MM7 B;  4RKU C;  3KJV A;  1GQE A;  1R89 A;  2HIQ A;  3D6T B;  4IFY A;  5HMX A;  1UJ4 A;  3BPD A;  4ZIT A;  2WVB A;  1MG7 A;  3A8I A;  3Q89 A;  1D0E A;  3DXS X;  2UXC F;  4DI6 A;  4B3T F;  5HVG A;  3Q2S C;  3TZX A;  4DF4 A;  1FXD A;  3BGF A;  2E5I A;  3NNH A;  4FVM A;  4ECV A;  4ECQ A;  1VRT A;  2IMO A;  3HSJ A;  1VIS A;  3POT B;  4LF4 J;  3HI9 A;  4F0K A;  2B5J A;  2LA4 A;  1B0V A;  1U09 A;  3VF0 B;  4KO0 A;  4S0M A;  3CCM S;  2UV8 G;  4U8V A;  2G2Z A;  3FFI B;  2YWW A;  5CQG A;  4XPE A;  2ALZ A;  4EU0 A;  4GMK A;  2B6A A;  1FA0 A;  3VAF A;  4WFX A;  4C97 A;  3MUV P;  2QMW A;  1JXE A;  1UFW A;  2D7S A;  2COL A;  5IOL A;  1N33 J;  2EBE A;  1P1T A;  1U0H B;  2HNY B;  1HD0 A;  3MTJ A;  4R5P B;  3DLH A;  4USW A;  3DLG B;  4F67 A;  5HL7 Q;  1N36 J;  4N5S A;  1S7I A;  1FKO B;  1RTH A;  3ZC4 A;  5C5J A;  2DH8 A;  3KG1 A;  3H20 A;  4TYA A;  1JLE B;  4K2J A;  5LMU J;  3P5T L;  2YKP A;  2ROG A;  5C42 B;  2Z30 B;  5J2Q A;  3DC2 A;  1M90 T;  1ITP A;  3HD2 A;  4LF5 F;  3RBE A;  3TA2 A;  2M88 A;  2UVV A;  4ICL B;  2ERR A;  1KHV A;  4USK A;  2BE9 B;  2NCK L;  2YWK A;  4M5I A;  1RT2 B;  4TQR A;  3PYG A;  2I0X A;  3DN9 A;  2CQG A;  3AA8 A;  4J90 A;  3TYT A;  5A8R B;  1IBC B;  3K59 A;  4A8O A;  3TZW A;  4YB1 P;  3L95 X;  4IG3 B;  4DSJ A;  3QQC D;  2W9B B;  1S49 A;  2QA4 G;  2LQ5 A;  4JI2 F;  1MRO B;  1GMW A;  2M2B A;  2W9C A;  5BR8 F;  3M2V A;  2ZBP A;  1EAR A;  1H0H B;  2CDR B;  3GR0 A;  1BY9 A;  3T5H A;  1RLC L;  2XY7 A;  3Q8P B;  2MLZ A;  1WDD A;  3LP0 B;  2AGO A;  4DR6 J;  2XMW A;  2I9S A;  2R8G A;  4UUX A;  2QZ8 A;  2V63 A;  3HT0 A;  2LQ8 A;  2O5D A;  1HNW F;  2W4D A;  2V5H G;  3TEH B;  2A18 A;  2GAG C;  1SKS A;  2E7V A;  3LGN A;  5BXI A;  2B43 A;  4HDH A;  3QID A;  1LWC B;  2GMH A;  5IT9 Y;  2VG6 B;  4ETZ A;  3AD9 C;  1K0T A;  1SUQ A;  1YLX A;  1UVN A;  2HPU A;  5CZX A;  3I82 A;  5ETL A;  1JX4 A;  3R3T A;  2FLN A;  4TY8 A;  4AT1 B;  3OJU A;  2CQ1 A;  4DV5 F;  4Y28 C;  4GRS A;  3CIM A;  3H40 A;  4F25 A;  4NLQ A;  4C8Y A;  4DV6 F;  1RLD A;  3I5C A;  1KC8 T;  1U1R A;  3KUH A;  2PMH A;  1P9Y A;  2MQ8 A;  3OHB A;  2GML A;  4YS2 A;  4Q45 A;  1XIQ A;  1WOR A;  3PV8 A;  4J37 A;  1N5S A;  4M5M A;  2EVZ A;  4P10 A;  2AJ0 A;  2XMT A;  3ZZR A;  4CZC A;  3VQS A;  4WK3 A;  5GAH U;  3EJM A;  3G6Y A;  2ILY A;  5IM0 A;  2IM0 A;  2ZNY A;  4WFN Q;  1EJ7 L;  1XJW B;  4EO8 A;  3W61 A;  2BAB A;  1HQU A;  1VCT A;  3KK2 A;  2XQC A;  1XK8 A;  4NCB A;  1ZZF A;  2GGP A;  1IKX B;  3ITH A;  3PCO B;  3BJY A;  2XGP A;  1MMN A;  3TQE A;  3TUZ C;  3J81 Y;  3PYD A;  1OY9 A;  2MHN A;  1CC8 A;  2NZC A;  4B9N A;  1UW9 A;  1L5U A;  1RT1 B;  4KHR A;  1OQ6 A;  4A8F A;  2L3M A;  1B7F A;  4M5K A;  2B4U A;  5A8W B;  2RU3 A;  3PHT A;  2YKN A;  5F8M A;  1JJ4 A;  2UZA A;  2AP6 A;  2DHH A;  4A4J A;  3DI6 B;  2IJR A;  1F9E B;  2CAD A;  2FPH X;  4K8R A;  1VIX A;  5AXN A;  3BR9 A;  4JI7 J;  3K8V A;  5EWE A;  1EZZ B;  4ELU A;  3MMB A;  1XNR F;  5GVQ A;  3PO5 A;  1HIY A;  3GIJ A;  1RHU B;  1H7X A;  3GG0 A;  1N5V A;  1IR2 A;  4DFJ A;  1DAX A;  2KM8 C;  3W2W B;  1TKT B;  2C2Z B;  4FPR A;  4MIB A;  5L1K A;  3MF5 A;  2BE2 A;  2YNH A;  4DV0 F;  2KL8 A;  1XMQ F;  2YNG B;  2ZOF A;  5EN1 A;  2MST A;  2C3P A;  2VDI A;  3R1L A;  1LXJ A;  1KP6 A;  1NRK A;  5DLG A;  3NCQ A;  4CTA A;  5KT4 A;  5KFK A;  4ECY A;  3VAL A;  5D15 A;  4DUT A;  1Q5Y A;  4BCA A;  4OI1 A;  3NNA A;  3EX7 B;  3QNW B;  1X31 C;  2FD2 A;  3ISZ A;  2J8S A;  2JSX A;  1WAC A;  5L1L A;  2EC2 A;  1VQK S;  4PWD A;  4LF9 J;  2UXB F;  4ZPC A;  5E3Q A;  2DO0 A;  2DB1 A;  3ZTO A;  4N41 A;  1HKA A;  1FD2 A;  5E2Q A;  5KFS A;  1DUR A;  1G4C A;  4OYM A;  3KLH B;  1WC1 A;  4CH7 A;  3V6D B;  2N82 B;  5KFZ A;  6FD1 A;  2R8I A;  4Z7C A;  3K0J A;  3N28 A;  2RKI A;  3H2L A;  2CPH A;  1QAI A;  2IC3 B;  4TKT A;  5A6W A;  3IS9 A;  3BGO P;  3A3P B;  2CKW A;  5KG7 A;  2RHQ B;  4OYB A;  5CYM A;  4RO0 A;  3AQP A;  3QAE A;  4IOB A;  3K5N A;  4HHU A;  4U7U K;  3KLG A;  4ZVT B;  3QRR A;  1H6K X;  4NZ0 A;  1GAO A;  1R6V A;  2ZJQ Q;  4NLU A;  1Q5V A;  1HQ2 A;  5J2M A;  4RNM A;  4ED1 A;  4IRC A;  3M30 A;  1OJ4 A;  5D4O A;  5AE3 A;  2MZQ A;  2DRD A;  1HFE L;  3CJT A;  2XO7 A;  5I3P A;  4FYX B;  1OWX A;  4O3N A;  1EET A;  4PEO A;  5H9E J;  2Q6B A;  2RQM A;  3MR2 A;  3KHG A;  1AZS A;  1QUV A;  1Q4R A;  1QUP A;  1I3O B;  2QMU B;  2Q3P A;  2LDY A;  5HVF A;  4TU9 A;  1U45 A;  5BJR A;  5U47 A;  2J7K A;  3T1H F;  2F7V A;  3TO8 A;  2IVY A;  3QT5 A;  2FJA B;  4WFB Q;  2JLG A;  3HFV A;  4NXN F;  1T9T A;  3PKY A;  2ASD A;  2P2C B;  5CH7 B;  1CJK A;  4DQP A;  4DV4 J;  3OFF A;  1NUE A;  1N36 F;  3D1Q A;  1F3V A;  2W2O P;  4V19 J;  3OL6 A;  1FRI A;  2NSB A;  3R5A A;  2KYX A;  2C22 A;  2MKH A;  3DFE A;  1HW8 A;  1AW0 A;  2KVI A;  2PA8 D;  2IFX A;  4Y00 A;  4UY8 5;  1VQ5 S;  1WDT A;  1OY6 A;  3A1Y G;  1HNV B;  1UJ5 A;  2BVZ A;  4QW9 A;  3VGT A;  3PVX A;  3PX0 A;  3M6V A;  7FDR A;  3NY0 A;  1UTA A;  2OFG X;  5D3G A;  1F5C A;  2YQ0 A;  4X66 J;  2VL1 A;  3NGD A;  5KFV A;  4EYI B;  1PAE X;  4M5L A;  4NML A;  3J80 Y;  3CJR A;  4G65 A;  5IV3 A;  3FRZ A;  1NKE A;  2LYV A;  1DZ5 A;  2W2Q P;  5HI7 A;  1U6Z A;  2BJ7 A;  3CF5 Q;  1Q78 A;  3PRV A;  4UY8 T;  2XBP A;  3M6W A;  2GJF A;  1VR6 A;  5CXT A;  2KXF A;  4Y34 A;  1CVJ A;  3AHP A;  3T3F A;  3CD0 A;  3HHD A;  3ILI A;  3BF4 A;  2J6S A;  4H4K C;  1JWW A;  4CT8 A;  3IN5 A;  3KLF A;  4KV8 B;  5DG7 A;  4NLP A;  3OV7 A;  1X5T A;  3CWJ A;  3GFH A;  1N32 J;  2ZH3 A;  1W2I A;  2RJZ A;  1WSV A;  3N79 A;  4LBP A;  4ZPB A;  3ENV A;  2GVD A;  1FWK A;  2O1P A;  1UWB A;  5KOX A;  2K2P A;  2W25 A;  3VAK A;  2MQM A;  3R5J B;  3DGP B;  1NND A;  2V4R A;  3TQ1 A;  3EM1 A;  5E3P A;  2ZD1 A;  3H59 A;  2DO4 A;  1K73 T;  1XQI A;  4P7T A;  1S1U B;  3GSI A;  4RPF A;  2WVF A;  4YP3 A;  3VVU A;  1X4B A;  2GJ2 A;  1MLA A;  4HTI A;  2R3V A;  2CG4 A;  1CJT A;  4DL4 A;  4PYD A;  2QFJ A;  5E3C A;  3IP0 A;  2F8M A;  1APS A;  3OW2 R;  3QJP A;  4O4R A;  3THV A;  2QN6 B;  1KVJ A;  1FJG F;  4RNH A;  5BYR A;  2IYG A;  1WOP A;  2VPY B;  1CSJ A;  4R8U A;  4N47 A;  2VIH A;  2RB7 A;  2HFO A;  2Q66 A;  1QVF R;  2AV5 A;  4GC6 A;  1YJU A;  4G3I A;  2HEK A;  2HBQ B;  1LWE A;  2HHQ A;  3LH2 S;  1SC4 B;  2DNP A;  1Q86 T;  2WON B;  2KFN A;  3VCD A;  2ZH7 A;  4ELT A;  4WYL A;  3C14 A;  4NRU A;  4FXV A;  3QT8 A;  2VQE J;  4LFB J;  2W9C B;  2W9A A;  3NEK A;  2VFS A;  1TVR A;  4ZLP A;  2KZM A;  1JLA B;  2IM3 A;  3TUI C;  4CLL A;  3MM9 A;  3OFH A;  1X4D A;  4J91 A;  1WG4 A;  1U26 A;  3N6M A;  5KG1 A;  1NJZ A;  4IH5 A;  5KFH A;  2PI5 A;  2BJE A;  2U2F A;  4WKR A;  3JYT A;  2KJV A;  4Y2I A;  1EKR A;  4YN3 B;  1VQS A;  3R6G B;  3US5 A;  2V8P A;  3B6B A;  4RW8 B;  4YQW A;  1M5P C;  3F56 A;  3H8Y A;  4OQJ A;  1SUQ B;  4WBF A;  4YR0 A;  4C98 A;  1NHU A;  1CS4 A;  1JNZ B;  2JLE A;  2XMJ A;  4Y0F A;  2HFU A;  4JP8 A;  2HHX A;  3MR3 A;  1QSY A;  1Y00 A;  2BJ1 A;  2LXU A;  2ZZM A;  1KTQ A;  1VHF A;  2XHC A;  4IDK B;  2RML A;  4ZPT R;  4OJG A;  3BGU A;  4EWT A;  2EFQ A;  3S6E A;  4X4U A;  2BQ3 A;  5CD4 H;  1U4B A;  4ENO A;  4ATN A;  3BH6 B;  3V6H A;  2EFV A;  3O1L A;  4F4Z A;  3HK2 A;  4C8L A;  1JQG A;  3MED B;  2HKE A;  2J8A A;  2IIH A;  2V4J B;  4K2X A;  4CIO A;  4OX9 J;  4RU9 A;  3GYN A;  2LCW A;  1BXN A;  4U67 Q;  1UZH A;  1B7Y B;  4TU7 A;  2H4Y B;  2ILZ A;  1WHY A;  5H9F K;  2B3T B;  4ZA1 A;  1E6Y B;  2FYX A;  1FEE A;  1WEY A;  1YDL A;  3FMW A;  2Q79 A;  1RYR A;  1VQ8 S;  1RE1 B;  2D1C A;  5I3Q A;  4IOC Q;  4AND A;  5D77 A;  1Y10 A;  5DZ7 A;  3H5U A;  2OPS A;  1N56 A;  3U1L A;  2ZM6 J;  1D3W A;  2CJX B;  1V5I B;  1TK5 A;  3OVS A;  2Z2L A;  2NRE A;  3CJ5 A;  4JI1 F;  1RTI B;  1Q16 B;  3JSM A;  1Q53 A;  4GVB A;  1TV6 A;  3CED A;  3MEG B;  4MIA A;  4F4Y A;  4LVO P;  1Q81 T;  1CUL A;  1U8S A;  4NCA A;  2D74 B;  3DRY A;  4JV1 A;  2EC0 A;  4IUF A;  3IGN A;  2DR7 A;  2OMO A;  4M5G A;  5KFA A;  2H48 B;  1C0T A;  3D67 A;  1KFS A;  1RT7 A;  5JMN A;  1YTY A;  4NI2 A;  4QIF A;  3P3D A;  2GX8 A;  2FGO A;  5THW A;  3QZ8 A;  1TKZ A;  3CDU A;  3LAN A;  3LGM A;  1T05 A;  2MZR A;  4WP9 A;  4EBC A;  3QJL A;  1CPZ A;  4OX8 A;  1T03 A;  1REV A;  4KJI A;  4DPT A;  4QU7 A;  5KG2 A;  1RYS A;  3CD5 A;  1RTD B;  3J7Y I;  2B9E A;  4FF3 A;  1K1Q A;  3VHQ A;  3G87 A;  2X51 A;  3L3C A;  4F26 A;  3KYL A;  5GAE U;  2CG8 A;  1WSR A;  2RIJ A;  1HNI A;  2R7O A;  3VZI A;  2E1A A;  1HBM A;  1TK8 A;  1SQF A;  2DY1 A;  2ZBC A;  4DR3 J;  4TLR A;  1WI6 A;  4JI0 J;  1ZM3 A;  3FVY A;  3LGH A;  3OFG A;  3V4I A;  1K47 A;  2CJ9 A;  1C2P A;  2CPF A;  5T41 A;  5AT1 B;  4DSF A;  4C3L A;  1WNE A;  5IQ6 A;  2HNZ B;  1VI7 A;  2OTL S;  2MQN A;  2Z58 B;  3U02 A;  1CJU A;  2XS2 A;  3CXC R;  1SIZ A;  3FSI A;  4CM2 A;  1NME B;  1FJC A;  4ES2 A;  5LT5 A;  5HQM A;  1IBL F;  2DY9 A;  1FE4 A;  4MFB A;  3I6P A;  2FGC A;  4ERD A;  2V8H A;  3R7B B;  2HRT A;  3M32 A;  3W1Y C;  4C0O C;  3CJK A;  2ZIT A;  1LWF A;  2WW8 A;  3GCW P;  1RUS A;  3TAN A;  2BV3 A;  4C4W A;  4HAC A;  4CYU A;  3HFZ B;  2MEW A;  4RNO A;  1RT5 A;  1URN A;  2DJW A;  2UVU A;  4I2P A;  4JI3 J;  2M70 A;  3BDE A;  2XHW A;  1V5V A;  3ZTP A;  2CJK A;  4XDC A;  5J2N A;  1S9E B;  5EDW A;  1UJ6 A;  2V68 A;  1PC4 A;  4PRF A;  3BS9 A;  1U7L A;  2VQF J;  3UD3 P;  3MPY A;  5K14 B;  4ILL A;  3R9L A;  4J9O A;  4QCL A;  3A4T A;  1OY8 A;  2QLW A;  2OIH A;  2ADC A;  2QLJ B;  1D9D A;  3UN2 A;  3QAU A;  4U9R A;  3ZZY A;  4AL7 A;  3SI8 A;  1KOH A;  4LSN B;  5L9N A;  4YR3 A;  4OJH A;  3EE3 A;  2AGP A;  2A10 A;  4HI1 A;  1QVG R;  4CLF A;  2J9E A;  4DV3 F;  4MH8 A;  3VAI A;  1FKP B;  4W90 B;  1CJV A;  4K59 A;  1TEL A;  3H2V E;  4AQY J;  3MMJ A;  5C25 A;  3ZFV A;  3SBM A;  2AX1 A;  2X7I A;  3DLL Q;  2XM3 A;  1XR7 A;  1UFL A;  1S1W A;  4C3K A;  4DOZ A;  1ELO A;  3W9I A;  3OVA A;  5J1E A;  3B82 A;  2BE7 D;  1QAY A;  3KG0 A;  3MMC A;  1YWX A;  4QPX A;  3L7U A;  3OQ2 A;  1BQM A;  2VA2 A;  5KT6 A;  4NLX A;  1XR5 A;  5E3A A;  2RRA A;  2POK A;  1FT8 A;  2OP5 A;  4RW7 B;  2CQH A;  3MD1 A;  1LW0 B;  1FDA A;  2VQE F;  1C0U A;  1UEV A;  4USU A;  4GKK J;  5GAD I;  3NWR A;  4LRA A;  3HHL D;  3MMA B;  4KBI A;  1LK7 A;  3HVT B;  1LK5 A;  5HLF B;  1ZS6 A;  2FZK B;  4QIV A;  2MKC A;  3W64 A;  2D41 A;  4F0M A;  1AXQ A;  4A48 A;  2F4F A;  5LL6 d;  4ZHR A;  3K57 A;  2E29 A;  3ZTS A;  3RB6 A;  3GIR A;  3MEC B;  3QT7 A;  5LM7 E;  3CME S;  5L9X A;  2FB0 A;  3W8P A;  5DET A;  4RLE A;  2ZJP Q;  4M1K A;  1IBM J;  3DHW C;  2FVR A;  4Y65 A;  2ZVS A;  5HRO A;  4PG6 A;  1N5T A;  2CQP A;  4OI3 A;  2RS8 A;  1O5J A;  4CLU A;  3H5X A;  3PJ9 A;  3CC7 S;  3UR3 C;  4QR0 A;  4KGM A;  2BJ3 A;  1I51 B;  4L6V 3;  3MUT P;  2QMX A;  4Z7Y A;  2M5Y A;  3UN5 A;  1HNX J;  3ICL A;  5ETO A;  3TEG A;  3FUY A;  2OSR A;  3OSP A;  1D8Z A;  4DPO A;  3WC0 A;  2Q43 A;  4C6A A;  1SJ3 P;  1RWX B;  2LA6 A;  4WFA Q;  4JI5 J;  4NA3 A;  2U1A A;  2HHT A;  1FRJ A;  1KBR A;  1JMT A;  1PYS B;  2IJN A;  4M8L A;  4OI2 A;  1LNQ A;  4OX9 F;  1EQ0 A;  2ZZT A;  3EDR B;  1YHQ S;  4DL2 A;  4RW9 A;  2KRB A;  3AXM A;  1GXL A;  2FVC A;  1ZM9 A;  2VKR A;  2G1H A;  4YY3 F;  4M94 A;  2OPR A;  5M2R A;  4P7V A;  1IJF B;  1F2H A;  5J1N A;  4TXS A;  3QGI A;  3FCV A;  2HSE B;  1RHQ B;  5LMN F; 
#chains in the Genus database with same CATH homology
 3FCW A;  3Q8Y A;  1NSQ A;  2DXD A;  3BBF A;  3JS9 A;  3EVW A;  3GPA A;  1BHN A;  1HHQ A;  2AZ1 A;  3GP9 A;  3MPD A;  3BH7 B;  1MN9 A;  2DXE A;  3VGT A;  1W7W A;  1HLW A;  3B54 A;  2CWK A;  4ENO A;  3EM1 A;  4EK2 A;  3BH6 B;  1JXV A;  3FBB A;  1XQI A;  1NB2 A;  2BX6 A;  3EVM A;  1NPK A;  1NDK A;  1BUX A;  3EVO A;  3FKB A;  3PJ9 A;  3L7U A;  3ZTO A;  5IOL A;  2B8Q A;  3FBF A;  1S57 A;  4F4A A;  1WKK A;  1XIQ A;  4HR2 A;  4UOF A;  3VVU A;  1KDN A;  3ZTP A;  1PAE X;  2HVE A;  3VVT A;  1NHK L;  3EJM A;  4F36 A;  5CAA A;  1MN7 A;  3ETM A;  2DXF A;  2HUR A;  3FBE A;  4C6A A;  3FBC A;  3NGS A;  3R9L A;  4CP5 A;  3Q83 A;  5C7P A;  1WKJ A;  1F6T A;  1LEO A;  1WKL A;  1BE4 A;  4KPC A;  1UCN A;  4UOH A;  3DDI A;  1HIY A;  1B99 A;  1LWX A;  4UOG A;  2HVD A;  3PRV A;  4O0N A;  3VGV A;  1NLK L;  3DKD A;  4ANE A;  2DY9 A;  3ENA A;  1F3F A;  4AND A;  3NGT A;  1S59 A;  3B6B A;  3Q89 A;  1ZS6 A;  2BEF A;  4DI6 A;  5BXI A;  3BBC A;  1U8W A;  3Q8V A;  3NGR A;  3G2X A;  3VGU A;  3EE3 A;  3NGU A;  1NUE A;  4WBF A;  1K44 A;  1NCL A;  4W98 A;  4DZ6 A;  1NDL A;  3FC9 A;  4FKX A;  1NSK L;  2VU5 A;  1PKU A;  5CAB A;  4ANC A;  2DYA A;  1S5Z A;  3VGS A;  2B8P A;  2NCK L;  1NDP A;  3EIC A;  3BBB A;  4FKY A;  1B4S A;  3ZTR A;  3ZTS A;  3EMT A;  1EHW A;  2AZ3 A;  1NDC A;  1NSP A;  3Q86 A;  3FCV A;  2ZUA A;  3WX8 A;  3ZTQ A;  3ELH A;  1VYA A;  4S0M A;  4DUT A;  3Q8U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...