4GKKJ

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aua-codon in the a-site and paromomycin
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 9
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4gkkJ00
4DV7J 4X64J 1IBMJ 4DR1J 4DV3J 1HR0J 2UUCJ 4JI7J 4X66J 4K0KJ 1XNRJ 2UUBJ 3T1HJ 4NEZA 4X65J 4YY3J 1J5EJ 2ZM6J 5LMUJ 4DV5J 4LFCJ 5FLXU 4JV5J 3J81U 4HHUA 1XMQJ 4OX9J 3D3BJ 4DR6J 1N34J 4DV0J 2MTLA 3R2CJ 2KL8A 4JI1J 4LF6J 1XNQJ 2VQFJ 2E5LJ 4LFAJ 3IMQJ 4LF9J 1IBLJ 3W1YC 4B3MJ 4KY3A 4NXNJ 4DR7J 4DV2J 4B3SJ 1HNWJ 1N32J 2UXBJ 4LF7J 2VQEJ 2MEWA 4LF5J 2F4VJ 4DR2J 4RJVA 3J80U 4LFBJ 4DR4J 1N36J 4GKKJ 4DR5J 4JI4J 4DV6J 4DV4J 5IWAJ 5IT9U 3D3CJ 4DR3J 4X62J 5LMNJ 1HNXJ 4GKJJ 5AJ3J 2UXCJ 4JI8J 4NEYA 4DUZJ 2HHHJ 4LF4J 4JYAJ 3J7AN 4B3TJ 4JI3J 4DUYJ 2KVQE 4YHHJ 4AQYJ 3T1YJ 1XMOJ 2MQ8A 1IBKJ 1I94J 3OTOJ 3JAMU 4DV1J 4JI2J 1N33J 5BR8J 2UXDJ 4KHPJ 4V1Ak 4PWWA 5LM7E 2UUAJ 4B3RJ 4NXMJ 2UU9J 3R2DJ 4JI6J 1HNZJ 4JI5J 1FJGJ 4KYZA 4JI0J 4LF8J 5A2QU
chains in the Genus database with same CATH superfamily
1BD6A 1SKRA 1IKYA 2FUG9 1CQMA 3R1HA 4ZVPB 1OSDA 4K7QA 5JVGQ 2VPZB 4Z7YA 4CO1A 3W2VB 2CQ3A 5K9FA 4ZN3A 1FA0A 3ICLA 3H2VE 4KB7A 4YY3F 4OHZA 1O8BA 1N5SA 1C0TA 1NK6A 3WC0A 2VOOA 3KOAA 2VB6A 1RTJA 1AT1B 3HVRA 3BO3A 2KRBA 2HHXA 3C16A 1UCNA 2YWGA 3SDEA 5DDPC 1S6QB 3IWXA 2NS1B 1UVKA 4PABA 1UPPA 3GFHA 3QGIA 3OFEA 4Q8FA 1QAIA 2HZAA 4GKJF 2VOPA 3LOUA 1KTQA 4CP5A 1B7FA 4DBQA 2DHXA 1M1GA 5C24A 2FLOA 1WUUA 3MECB 4I1TA 5KFQA 1BWEA 2QSWA 3CJSA 4P7VA 4FYVB 3CD7A 3H5SA 3TQEA 1XMQJ 5DQHA 2XM3A 2APOA 1KDNA 1QE1B 3VAMA 5U47A 3PRBA 4B3MF 3CIZA 3MM6A 4PAAA 2ZM6F 3UDLA 2V34A 3U1LA 3O8WA 5LMUF 2RE1A 3DKDA 3BKUA 4ZPWR 3KJVB 2DVIA 2K7KA 3AA9A 3MMCA 4FPRA 5KFTA 1D9DA 2P2CB 1UVLA 2M5YA 1VQ4S 2XZTB 4FXDA 4LF9F 1NSAA 2AGQA 4GKKJ 3SFUA 4EEYA 3BGOP 4ECWA 3TUPA 4P73A 4Q45A 5LJ3Y 2ZFHA 3S01A 1UTAA 1WOSA 3H4DA 1NDCA 3V6JA 3CMES 3GE9A 3T1YJ 3QQCD 1XWLA 4OL8A 2HBZB 5KFRA 4FYDA 2EC0A 2QFJA 5M2UA 5ETOA 2BEFA 3M9MB 4WIIA 1RSCA 1S1WB 1ACMB 2ZBCA 5KFDA 3J7Z5 2W2MP 2DR8A 1G1XA 3D5MA 3MXHP 4M5LA 4URSA 3CCES 1KBRA 4FNIA 4UZCA 2Y1IA 1WOPA 2XYPB 2N82B 3MPYA 2DHSA 4CCHA 3EGWB 2D3ZA 2NCKL 3BYPA 3C15B 3GU0A 1OQ3A 4LF5J 3GWCA 3CPWR 3CJKA 5B0AA 3CXCR 4J7CA 2RIJA 2EFOA 1S1XB 1V3SA 4A8OA 1S9FA 2MJNA 2ZJPQ 1TKDA 4DV4F 3HHLC 2BA9A 1IKXB 2DGUA 1HBMB 1RADB 4KGZB 3BGUA 4AQYF 3KDOA 1H0HB 2BVZA 3D6FB 2JC0A 3DLGA 4DDFA 1RE1B 3DGPB 2GC8A 2GJIA 4X4RA 2FGOA 4HVZA 1L3VA 1HNZF 4M5MA 1CSJA 3M2RB 2X7IA 2DR7A 4C0HA 3NXZA 3WDOA 1FRHA 4GC6A 2E5LJ 8RUCA 2CNNB 1Q81T 1S9GB 4DV2J 1M90T 1PBUA 4A8FA 2V9KA 5IC4B 1DQAA 4CTAA 5I42B 3MAAA 3QGGA 3QJLA 4NLWA 2HHTA 5BYQA 2MZ1A 1ZH5A 4G6VB 3MF5A 2ZHBA 4WK1A 3WHIA 3D3CJ 3S7RA 2AU0A 1F9EB 2PSZA 2CQDA 1VQNS 1RHRB 4HDHA 1YRTA 1H7XA 4NCGB 3M30A 4ZN1A 3EWGA 1JMTA 2W9BA 2AV5A 2R7VA 1CJTB 2HHPA 3HHNB 3EICA 3IXQA 2G13A 2QLWA 2YKQA 3NOGA 3LQVA 1HI8A 2OP5A 4ZIWA 3J7A1 3KJFB 4LRCA 1H74A 3DM2B 4DMZA 2GNKA 2AX0A 5GAEI 5EX3A 1FXDA 3M2VA 2IM2A 3G8SA 1RT1A 5LXYA 3SDEB 3IFEA 4MMOA 1URNA 3Q2TC 3FUYA 1BXNA 2FJEB 3HD2A 3AA8A 1V9OA 2H5IB 2KVIA 2RDIA 2NREA 2KYXA 4OZ0A 2MKYA 1SI9A 2JLFA 2P6TA 1RWNB 2JVRA 3HVAA 3IWLA 2JFKA 3L7PA 3PYGA 3TA0A 3HSJA 3VQTA 3DYAA 1WNEA 5C24B 2A3JA 3IBFB 3IP0A 4NZ6A 3BPSP 5LMNF 1S0OA 4DV1J 1X5TA 5KFLA 1B0TA 3SSQA 1FKPB 2GAHC 1FKAF 1JX4A 2Q6CA 4HT7A 1JKHB 5CYJA 2IAJA 3OJUA 1B4SA 3DOLB 4DOZA 1KNZA 3F56A 4YR0A 5DDRC 4QW9A 4DV5J 3PXGa 9ATCB 2YVSA 2ZNZA 1S1TA 3MGJA 3R5AA 4C6AA 3CD0A 1DHMA 3QFWA 1NLKL 1FKOB 4NZ0A 1AUDA 2HVHA 2LQBA 4DHVA 2DHHA 1SIWB 2AMCB 5T7LB 3HCXA 3DOMA 1LNQA 2J9DA 3IGVA 1YJWS 1Y3JA 3UVJB 1Q78A 3A3OB 3MEDA 2J6TA 1X7VA 2OTLS 4HYKA 2BR0A 2VC1A 5B08A 1QSYA 1VIOA 4J9KA 2HFUA 3C2PA 4MAKA 4YS2A 2VFTA 1L3KA 5A8RB 2HAIA 2HLUA 2DR9A 5E2QA 1DTQA 3QGPA 4RKUC 1JJ4A 2EK1A 4ECTA 1QTMA 4MTPA 4DUZF 4F3QA 2F9JA 2G0JA 2WVDA 3KMSA 2WHOA 1VLYA 4USMA 2LEBA 1JXVA 1SKSA 4WTOB 4ZP8A 2BKPA 3N6NA 2MQNA 2RQCA 4DN0A 2WVFA 2A18A 2ZOGA 3M8PA 3FDSA 3PW7A 2HAFA 4YR3A 1QAXA 5D0EA 3VAGA 1FTRA 1RCXB 2C42A 2DK2A 3I6PA 3LTOA 4ILLA 2E9ZA 2XO6A 1GEHA 4U6PA 3KJQB 2V68A 2B8PA 2B4VA 3A3PB 2BOAA 4OX9F 4AXJA 1JLQA 2XWXA 2IRXA 5H9EJ 3BR9A 2F8HA 2GO8A 2CPJA 1R6VA 4OYBA 3S1TA 3K5OA 2X3GA 3NCRA 2PD1A 4JYAJ 1VQPS 1UMJA 4LFBF 2F9DA 3ENQA 4OZJA 1X4HA 2WB1D 1PCAA 2C1EB 3IG1B 2PE8A 4E98A 4JI8F 4ZVUB 4RW8A 2M8DB 2W24A 5CZVA 5SUHA 3FBFA 3RRHA 2BJ9A 1EHWA 4XDDA 5K8PA 4J91A 2PDAA 1NO8A 1Q7YT 3EVWA 4X4OA 4JI6F 1UA1A 4DU7A 4KKOB 3S8SA 5SZTA 5C5JA 3WIVA 1J2VA 2AYMA 2L9DA 4WFXA 3MM8A 1EKSA 3RRKA 4KFBB 2RJZA 2VD3A 1HARA 1VQOS 1WEYA 4C8LA 2A6OA 2RF2A 2OTJS 1KLNA 1RQ0A 1JNRB 2COLA 5KFSA 4P74A 4NLXA 2AEFA 3N0VA 3RR8A 4JI4J 2MGZB 3UPFA 5DETA 2W9BB 4O3SA 3AT1B 1TQLA 1YJNS 2BACA 1TL5A 2ZNYA 2DIVA 3I82A 4JI3J 2BM1A 5HO4A 4DL3A 2BM0A 1PYSB 1YGYA 4WJBA 3RB6A 4I2PA 3A8JA 3H0PA 3DN9A 4RUHA 4OV6A 2VC0A 2MZTA 3GB0A 2YH1A 4I68A 5AE2A 3M2VB 4OJHA 2HS3A 4F4YA 4B9VA 4U96A 5KFAA 2WB4A 1RT1B 1D9FA 3MFIA 3TA1A 4C48A 4ZCMA 2WSEC 1WWHA 4LF6F 4F4WA 3HLUA 1REVA 3KLHA 2NXNA 3C19A 2P6SA 2XULA 3VV2B 5E33A 5GVQA 1J5EF 3X1LB 3DRSB 4PXDA 1D8ZA 1FD8A 2CJ9A 2PFDA 3D66A 2ZVIA 2MMYA 2CIMA 4F7VA 2MSTA 4BBYA 4C4WA 2FJAB 3LGNA 2YKNB 3GV7B 2HNDA 4HI1A 5HVGA 3PJ9A 2VKRA 4WWSA 1TR0A 4ES1A 1HW8A 4P72A 3BSCA 1I94J 2BJ7A 3FRZA 1RZMA 3BQ2A 4ZVQB 4LSLA 1DURA 4RBUA 5L1JA 1QAJA 5LSLA 4YB1P 4C11A 3RW7A 2GVDB 4YEAA 3MPWA 3EE3A 2HFNA 3VHQA 3MUVP 4K0KJ 3RAQA 3UNYA 3DFEA 1U1LA 1ZM2A 1J5OB 4FS2A 3F0NA 3VR1A 1CULA 1S6UA 2FHJD 2XYGB 3MPUB 2BZ2A 2MLXA 4QYZJ 3U02A 5MAOA 3CC2S 5C2CA 5IM0B 1U4BA 1WDDA 4IH5A 1LV5A 2E5JA 3B4MA 2L9WA 2WTFA 3J81j 2VG5B 3J80U 2RQMA 2IDEA 1KOHA 1TL1B 4DR5J 3L09A 1OWXA 2ASYA 1N5QA 1WC3A 3PCOB 3J80Y 2HHHJ 2Z57B 2QL7B 2B0GA 1HHQA 2F5GA 4B9UA 2HNYA 3KG1A 3H5XA 1NJWA 1QM9A 3I0SB 1VRTA 2GX8A 2XI3A 3M8PB 5B0CA 3CDWA 4EWTA 1U26A 4NA1A 1FJGJ 1RXOB 3BO2A 4DV3J 4A48A 2W8KA 1KP6A 1FF2A 2H4WB 3OQ2A 5AE1A 2FY8A 1JLQB 4ZLLA 5HP1A 4F4KA 5JMNA 4JP8A 3DRYA 1D1UA 4ICLB 2VBXA 3MD1A 1C1BA 5CYQB 3W8PA 5F0UA 1K8AT 3UW1A 2B5JA 5J2MA 5DQGA 1EETA 5KOXA 1TVRA 3UR0A 2DPIA 2LFVA 2NXUA 1FDNA 3KKFA 4Y2KA 4P6QA 4RJVA 2YNGA 4IKAA 1NKBA 2DD8S 3M1VB 3Q89A 5EGYA 3R6GB 4X4PA 1VQ5S 3QIPA 1T9WA 1H3DA 1SH2A 3AOAA 5ETMA 2HQGA 1VIXA 4DG1B 3AOCA 5HMZA 2N7YA 1TKXB 1WD6A 3CJRA 3D67A 2AJQA 3QJJA 3BO4A 3C6TA 2AD9A 3M8SA 2O67A 1S4FA 2MQPA 4DR1F 4IDKA 1AXQA 4F3MA 3GJRB 1NZ8A 5H9FK 3PY8A 2NYIA 4H4OA 3UFCX 2ZD1A 4BHQA 4JI5F 2HFZA 3GCWP 2FLLA 1ZAVA 2RF2B 4ZLPA 4WU2A 4ANEA 2FLNA 1LWEB 2XTJP 3POTB 1IN0A 2MQLA 1LK7A 1OMSA 3OT9A 4DQIA 5H9EK 4KRWA 1YJ9S 1X0FA 1U45A 4PXBA 1V3RA 3G6YA 1YBUA 2B9XA 1UFKA 5F8NA 2MEWA 4IFVA 1WKJA 2OI2A 2QYGA 3HKZD 3WIUA 5KFFA 2MHNA 4I7FB 1U0HB 3TNVA 2J0QD 3AOBA 2VPWB 1SL1A 2JSXA 4CLKA 4JI2J 1SUQB 5LM7E 3R7SB 4QR2A 2CJBA 2I5JA 1REVB 2EKNA 4R25A 3M05A 4JI7J 3CJ2A 1NJXA 1CC7A 4DS4A 4DPUA 4I64A 3GIMA 3GQCA 1QVFR 4CLFA 1XIQA 2DB1A 3FSIA 2KL8A 4HHJA 1EAYC 2VPYB 3RBDA 4HACA 3EVMA 3EXCX 4IRCA 3MM5A 1T8EA 4Q0BA 1MN9A 3IAS9 4A8QA 2HNDB 3PIPQ 1IQZA 2OFGX 5CYMB 2HWTA 2W7OA 2BJ3A 3R5JB 3PHTA 4F4AA 2XMMA 2HGNA 4U7UD 4B3SF 2FJXA 5FDLB 3BEGB 1N32F 3FCVA 2QA4S 4LSLB 2IJRA 4ZVOB 3TEHB 4ILMA 2OMOA 1HNVB 4J9MA 2CQPA 3T3FA 2RU3A 3GJTB 1UVIA 1JLBA 2E7XA 4B9NA 4ZCKA 1TKZB 2XSJA 1CULB 2XLKA 5KFYA 4FBUA 4KYZA 4P2XA 4PWDA 1SQEA 1P27B 4MYTA 5E5NA 4X66J 2LXFA 3C8YA 2CQHA 2JWNA 2FVQA 1U6ZA 1M5SA 4ELTA 3OTBA 4PXEA 1VCTA 4LFCJ 3W2WB 5KFXA 3C6UA 3UDEA 2PA3A 2DR6A 4JI1J 2VQFJ 1KRPA 1VHFA 3HSZA 2MQMA 5C7PA 1F5CA 1FERA 3JYTA 1RUSA 1PILA 1NU4A 3MCMA 2XY5A 5FD1A 3CDUA 2BE2B 2CJYB 1CS4B 4UQTA 1VI7A 4ECQA 4DPWA 4C9DA 2FY1A 1YJTA 5F3ZA 3PW0A 3NL0A 1C1CB 1SV5B 4WXWA 4CNZA 4FP9A 3RB0A 3ZXWA 4Q44A 4NRUA 4D3GA 4C8YA 1VQKS 2GCFA 4MKYA 3J7YU 2QLFB 2RT3A 2HLTA 4KHPJ 4V1Ak 1X4DA 1VYAA 2XLJA 4NCAA 5A0YA 3PTWA 2Z2YB 3IM9A 3G96A 4AYBD 4ZCIA 1C1BB 4NLPA 3G6VA 2D7SA 1VOMA 3KHRA 3ETMA 1X9SA 4OZ3A 4K8RA 3ZTPA 1R8AA 3W7BA 5D0HA 2W01A 2RH3A 4TY8A 1DQ8A 4X64F 4ZOSA 2PMHA 4RX6A 3T1HF 3I5BA 1U2FA 4GVBA 4ER8A 4G1QA 1RT6B 1I5OB 3QIPB 2YKMB 5B0BA 4DI6A 1S5ZA 1U02A 2C2MB 3W8GA 2C2NA 1IBLF 2OPRA 3SYZA 2RS2A 2B4OA 3W63A 3PRVA 3GIIA 2K3IA 2F4VF 3J7AN 1FJCA 2NUHA 1CLFA 5DZ7A 1EQMA 4UUWA 5KT2A 3AXMA 2ZKTA 1AZSB 3ZNUA 2OHDA 3CJ0A 4XAKA 3SSRA 3LGMA 3RG6A 5A6PA 1XMBA 2UUCJ 1SJQA 2UUBJ 2KG1A 1U1RA 4CDIA 2A10A 5ETKA 3M32A 1KC8T 1U1QA 3BJYA 1U25A 5KFNA 1T0TV 4YFUA 3CTRA 3MOJB 3ILLA 5F8GA 2ZDOA 1WJ9A 5CD4A 4CT9A 4DCOB 3OR2A 3NGDA 4IFVB 2DO0A 3IMQJ 3W5ZA 4OYIA 5T41A 3LWLA 4B3MJ 2BABA 3CDEA 2ZDPA 2G0CA 1NNDA 2QT7A 3R5GA 4H4MA 3MPDA 2QA4G 3IM8A 4OV1A 3N5FA 2IJFA 2GA7A 1S1VA 1JJ2R 1HNWF 3GSDA 5D3GA 2WK4A 3ET6A 5ETLA 4QOTA 1TK5A 1GH8A 1KSPA 4KO0B 4PYDA 1JLFB 2BKNA 5F9NA 4DR4F 2I5JB 1RDRA 3KNAA 1VDHA 2ZH8A 2HGLA 3UN5A 1R8HA 4EMDA 2HHSA 2H48B 4P2MA 3NCQA 1HNIA 4LQ9A 3OR1B 2DT9A 4HKQA 1WTBA 4ZHRA 5E41A 4TLRA 4YHHF 3DDIA 4OI2A 1P9YA 2W2PP 2BW2A 2KFNA 2AEJA 1BY9A 4DSIA 2AX1A 4KV8A 1APSA 2W2NP 3DRRB 2W2QP 2OD4A 1S0MA 1XBWA 3BH7B 1ZTTA 2M52A 4BWMA 1I1GA 2ZJRQ 2VG6A 1X4BA 2JDJA 1Q86T 2QV6A 4KT0C 3TUZC 3HO1A 1SH0A 3RTVA 4W90B 3JS9A 3CDBA 4P71A 5FIIA 2FLPA 1SJRA 1W7WA 1JNZB 2AJ0A 2BDPA 3HT0A 4K5SA 1DJ0A 2QL5B 5KFJA 1IKVB 4CQ1A 1NMEB 2XSJB 4EI2A 2KM8C 2DXEA 4IOAQ 1HL6A 1RT7B 4PWDB 1BQXA 2D41A 3HVTA 1IQTA 4TYBA 4RW9B 1T3NA 3CWJA 4L73A 2MQOA 3GJSB 2YNFB 4CH7A 1PYOB 2L3MA 5D4OA 4MIAA 3E3XA 3K58A 2ZE2B 2UV8A 2MZSA 2W7AA 1RT4A 2XI2A 1X31C 3GV8B 1R89A 5I3PA 4KH1B 3QZ8A 1HHSA 3KUGA 3CC7S 2E1RA 4EU0A 2YNIA 1WEXA 3KK3A 1NPPA 1SJ3P 2OD6A 3M8QA 1RLDA 2BBEA 1RTDA 2ASDA 2IYGA 1N36J 3MR7A 3FEZA 2ASLA 1R0CB 4IOCQ 1PGZA 5C42B 2DPJA 1LEOA 2OSRA 1GT8A 4BLGA 1Q8KA 3NEKA 3OSPA 3K8VA 1LOUA 5GAGI 1MNEA 2OJ3A 4KE5A 1JJHA 2QLJB 5GMKa 3FNNA 1TL7A 4U67Q 4IUFA 2V6AA 4DCJB 2YKOA 2XQCA 2K8GA 2JVOA 3ENWA 3BKTA 2HYIB 2V8HA 1C2PA 3ZTOA 1TL4A 5E3QA 4GVBB 1MROA 3D1QA 2O5DA 2AYGA 3PFOA 2N4CA 2FTRA 3G6XA 3RBXA 1VQ8S 3M2UA 2ATLA 1Q1KA 3QT5A 1S6PB 4DL4A 2FJDB 4LIRA 3TAQA 1UPMB 2HS4A 4CM0A 4DV0F 2FB0A 1FK9B 2UVRA 3NGRA 2DCLA 1F1BB 2XMKA 2J9DE 5GMEA 2GMJA 5J2NA 2DJWA 4KGVB 2XCPA 3QJPA 2LXUA 5IWAJ 3TJ8A 1I51B 4AL7A 4OZ1A 4DPYA 4FKYA 2V4JB 3Q8RB 2R7UA 3CJ8A 4M5IA 3BM7A 2NYHA 4QR1A 5KFWA 3BGFA 1PC5A 3ISZA 3RB3A 2DEJA 2DGQA 2LA4A 5C2GA 5BJRA 4J9SA 5G0RA 5D78A 2MKSA 4OZ2A 2RRNA 3DRPA 2U2FA 5DLFA 2QN6B 4QIGA 3MM7A 2LQ8A 4HHUA 1UJ6A 2RILA 1F60B 4USJC 5THWA 1UVNA 1CG2A 3DHWC 3H20A 2Y8WA 2L41A 3HHEA 3FFIB 3CCWA 2BQRA 3QSYB 3GYGA 2VDHA 4JOUA 1NK7A 3P5TL 4JV5F 3U7JA 2QEXS 3K2YA 1WOOA 5KTQA 3Q8QB 2JHEA 4MH8A 4LRAA 1NPRA 1WF1A 2ZH6A 3UD4P 2MZRA 5DQIA 3B82A 3UWTA 5E3AA 3PO5A 3I56S 1SKWA 4ZHRB 5C25B 1IUJA 4OYZA 3I9ZA 4P10A 1RGVA 2D74B 4DUYJ 2MKIA 3CD5A 4WZMA 4HHHA 2MKHA 4CLPA 1S12A 2CQ2A 3IGNA 4PQUA 5LXRA 4D3HA 2DXDA 3FBCA 2DEIA 4C7QA 1Z2LA 3FKBA 2VG6B 4EBEA 2XGPA 4NXMF 4OI6A 2Y1LB 1IJFB 3GV5B 2VIHA 3J81U 2LQ9A 3M4XA 1GMVA 3MFHA 2KT5A 1XNQJ 1YK9A 1YLXA 2DO4A 3CC4S 3J81Y 1H2TZ 4DQSA 4IR1A 1JLCA 1U48A 1NHKL 4IFYA 5JVHQ 3DHXA 4DR2J 3AHPA 2LU2A 2G1HA 2CPXA 1AFIA 5JXSA 1NJZA 1RI7A 2F65A 1SC1B 4X62J 4RW6A 3R3TA 1F5AA 2M9KA 2IDLA 4EYHB 1M5OC 2I1RA 1SBRA 4OYOA 4YDDB 2QG9B 2FC8A 2WCXA 1D3WA 1RT2B 2F4FA 4NWBA 5L38A 2JJ4D 4HTIA 2E1PA 2ZUAA 4C3KA 4K2XA 1WG4A 4HDGA 3QATA 1CQNA 4HEA9 1RT4B 1RTIA 1GX6A 1BQMA 2CJXB 4A8XA 2YNIB 2EEYA 2HQDA 2OFHX 2WSFC 4Y2CA 1PSDA 2QTWA 4ED3A 1EQ0A 2BXJA 1RTDB 1W25A 2M88A 2CPIA 1G2EA 2H1YA 1WF0A 3QO9A 1XEZA 1RWPB 5HQ8A 2BANA 1HW9A 4LF7J 4LFAF 3M6UA 1UEKA 2JC1A 2DY9A 1KEKA 4KTQA 4LIWA 4JV0A 4NXNF 4RU2A 3R9LA 3RBZA 1M5PC 1W2IA 2UXBF 2N4DA 3NP5A 2CNLB 3TAMB 1KQKA 2OGUA 4MYUA 4GRSA 3AJDA 2EFGA 5KT5A 1FWLA 1DTTB 3U27A 2XMUA 3CGIA 3A8IA 3W3SA 3MEKA 5LSRA 5DGAA 4NL5A 1RAJA 2HURA 2H51B 3JQJA 1P8GA 3EUNA 2R8JA 5B0EA 2WONB 3M2UB 2PN6A 3DMJB 5EWFA 3H2UB 2H65B 1H72C 3KK1B 5A8WA 2JRSA 2F3JA 3KDNA 4TU8A 2JEJA 1ZAWA 4J9NA 1EZZB 2QSFA 5H1SV 4KBIA 2LQ5A 4LF6J 1SH3A 1SQFA 2X1FA 4DN9A 3TVZA 2QX0A 3IA0A 2M0GB 4XDCA 4ETXA 2RUSA 5IXUA 2AW0A 2R8GA 2FHKA 5IV4A 1LFPA 3CJ3A 2ACYA 1BHNA 5D4NA 3OW2R 1HYSA 3FVYA 1H7WA 3R5DA 3IN5A 3CIMA 4EO6A 4XTTA 1N6QB 2YWWA 2O1PA 4MK9A 1N33F 1S99A 4K4UA 1TZ0A 4DX8H 4Q43A 2DH8A 1MSWD 4QIVA 1K44A 5HSPA 4LF4F 2HMIB 5J1EA 1KFDA 3PVXA 2ZC3A 2UU9J 2VFUA 1JLEA 2BJEA 3MM7B 3Q8YA 3PKMA 1RT3A 4NMLA 3RZAA 2YWKA 2XGQA 3FCWA 3V6DB 4ED5A 1Q5YA 3D2WA 4ES2A 4J90A 2Z58B 3SFGA 1PAUB 3PHEA 4F25A 5KFGA 5D8HB 3MM9A 2FVPA 1NK8A 2VBZA 3ZFVA 2BJDA 1QVGR 2NXCA 3QWPA 1Q8IA 2CQIA 4IG3B 3HDSA 2ZBQA 1R8PA 2KM8B 3IC1A 2OPPA 2XS2A 3KUEA 1YX2A 2J6UA 5J2PA 3L9ZA 4XPEA 4O0NA 3G8TA 2DBBA 2VG7B 1ZPVA 2YNHB 3M8ZA 3ELHA 4ZPDA 5KG4A 4K4WA 4PQUB 1UEUA 2WBMA 1KKHA 4YB7A 4J9PA 4PZVA 2V2ZA 4OX7A 4NMXA 3DOKB 3CCLS 3T9NA 1E6VA 4DZDA 3CCSS 4O4GA 2IA6A 2CQGA 3AAWB 3ZZYA 3NGUA 3NBPB 2YWHA 1XNRJ 2V69A 2RVJA 1JLCB 4DQRA 3DDNA 1RCOB 3OUYB 1B0VA 1TV6B 5ETRA 4IFYB 3R2CJ 5HBMA 1FFSB 4B9SA 4EZ9A 4LR8A 3D0IE 2O01C 1BE4A 3NLCA 1X9MA 4X2BA 4RUCA 1N0VC 3DLEA 3VGSA 2M4MA 1XMQF 1UP1A 2QMXA 2IY5B 3BDEA 4XIUA 1L3TA 3MMAA 2HEKA 4ELVA 3C14B 2V0NA 1GTEA 1FO1A 3HP6A 2MLZA 1I6JA 5F8IA 4X4QA 2J5AA 3MUTP 4B3TF 5IQQA 4WXOA 4ZVSB 5HMYA 3JSBA 3N9UC 2EBEA 1Q82T 4GKKF 4R8UA 3MR5A 3G6ES 3OV7A 3P3DA 1IBKJ 4FVCA 1TL3B 4ZP9A 3MCSA 1J27A 4AL6A 2HRYA 3PEJA 2J0SD 3V6HA 3V4IA 1WC1A 4WP3A 1NUEA 4M5DB 4DR1J 4LMZA 2OKQA 3R6LB 1QJHA 4IG0A 2RSQA 4ANDA 1HWIA 4ID5A 2LCWA 4ZK7M 4FVMA 5BYSA 2AF6A 1RAHB 1T9YA 2SXLA 2JFDA 1Q5VA 4OX8A 2WSCC 3FC9A 4N5SA 3I0RB 3K5PA 1JXLA 3JTPA 2WRMA 5DGBA 2J0WA 5EHHA 3NNCA 3QPIA 2IFXA 1YKWA 4U9RA 1JK9B 4TQSA 3GIKA 3KG0A 1VQ7S 1OY8A 3Q0AA 3HFVA 4ID8A 4NLUA 4IH7A 3TQ1A 3T6BA 4OZNA 4LF5F 2H3EB 1ZOTA 2V8VA 5DM7Q 3NGKA 5LT5A 4USUA 2ZKUA 1PJ5A 1TFWA 4WKYA 3G87A 1ZZFA 2I8EA 2UUAJ 4NLRA 2CKWA 2BX6A 5CZXA 1FX2A 3W9IA 3PYEA 1OS5A 3R7BB 1N5TA 1FRIA 5CQGA 4NYZA 1RYSA 4B17A 2LQJA 3MOZA 3QSIA 1S9EA 4HTJA 2WOMB 4QWEA 1S1UA 2B3TB 4CO4A 1YJVA 1UA0A 4MK7A 3PRDA 4KY3A 3EDRB 4FZVA 4V19J 2HFVA 2I0XA 4ITSA 3EGNA 3NS5A 4P9SA 4RU9A 4F2SA 2FHMA 2YWFA 4O44B 3FSXA 4EFAC 4QPXA 2HQCA 3Q22A 4DV2F 2VA3A 2E1AA 5E3RA 2HZVA 3BPDA 1MWYA 3CDAA 1R0BG 2K2PA 2GHPA 3CULA 3QBCA 4DX7A 3OVSA 3Q86A 4CZCA 3JTOA 4KHRA 1G6BA 1LWFA 2F40A 5D15A 4F0KA 2Q3PA 4G1IA 3A13A 3LP0B 2L08A 2GMHA 2E29A 4F04B 4UOFA 4WK3A 3IS9B 2OAUA 4OJ3A 5HROA 1N54B 5HJYA 3QLHB 1I3OB 4LQ3A 2V9WA 3SI8A 4W98A 2N7CA 3KLFB 2ZITA 4RW7B 2G4BA 4OQJA 5KG6A 4FXWA 2LEPA 2CVIA 4BCAA 4WF9Q 2QO3A 3D3BJ 1UFWA 2OPPB 4IRKA 3EX7B 1FD2A 2Z2MA 4Y0FA 3P49B 4DUTA 2DITA 6FD1A 1UEVA 1D9AA 1RWVB 4ZJLA 1LW0B 1ZPWX 2HNZA 1RHJB 2F8EX 4Z37A 2KZZA 1EP4A 1KD1T 3IO1A 1ZM9A 2C3MA 2B6AA 5I3UA 1S72S 2B4UA 1VBYA 1T9XA 1N52B 4WZQA 3M6XA 4A8WA 1RLCL 2RKIB 3TEGA 3EZ5A 1E6VB 3A3NB 4HT5A 1H6KX 2R8IA 3S6EA 3CCRS 3R8YA 3KHHA 1MWZA 4ECZA 5DJBA 2AGOA 3VALA 5K14B 3KJNB 4A47A 3FGVA 1TFYA 4O3QA 1HKAA 1IBMJ 4DV1F 3W60A 3OLBA 1U2RA 1XERA 4B9LA 3FBBA 4NEZA 1R27B 3KLEB 3DLEB 2HHVA 5KG5A 3K0JA 2ILYA 2ZH7A 3MMAB 2MQQA 1UKUA 4BC9A 4N8NA 3CT9A 1Y4ZB 4DV5F 4WFNQ 4L75A 2D69A 1A7GE 2CUYA 1TK0A 3HHKA 5KFPA 1S57A 2C2ZB 4RW4A 1U1NA 2CADA 1UWBA 3TUJC 2EW9A 2DGSA 1HBOB 3MMBB 1Z1ZA 1OQ6A 4RNFA 3BGRA 2ADBA 1UZHA 3I9V9 2D3O1 2ABYA 5ITHA 4F4ZA 1QSLA 5ETVA 2HQ3A 3V4IB 3VAHA 2B56A 2Q66A 2FJVA 3NRBA 1VISA 4I56A 4IG0B 4DSLA 3JSMB 4TN2A 3ENVA 1U1OA 3PEHA 1RBLA 2HBRB 5ETSA 2MKKA 2XG8A 3OHBA 3D6MB 3PNIA 1IJEB 2PIIA 4UY85 3B78A 1FEHA 2ROEA 1HWKA 4X4VA 4X65J 3G2XA 1TMMA 4NYOA 3VVTA 2M8HA 2CJAA 4A8YA 3UDVA 2J6SA 2QRRA 2KB2A 2MB0B 1NM2A 1S7HA 3MI7X 1TUWA 1UETA 2AT1B 4PUOB 2GS8A 5J2QB 2GHVC 4J9UE 2VQEJ 2DNPA 2UUWA 3I4HX 4X4SA 5CXTA 4KQZA 4CO0A 3FEYB 3JQMA 1LXNA 3HVWA 5GAHU 4PPDA 1YG0A 3THVA 3UE2A 4RWXA 1HPZA 4DXLA 4PG7A 2E5IA 1U1MA 1U8SA 4H4KA 3MR2A 4NLYA 3T5HA 2UXDF 5KFCA 2BE7D 1WG5A 4HL9A 4UT4A 2XEXA 2W9CA 3N4WA 3TW0A 2LLZA 2EFQA 4JYAF 1AA1B 4FF1A 1RU1A 2EFPA 2DYAA 2MKCA 4MKBA 2ZUGA 5KG1A 3IR5B 1R0AA 3A1YG 5DDQC 4E8UA 2CWXA 2DRDA 4NLSA 5A76A 3IRXB 3TI0A 3DLLQ 3W66A 3KK2A 3HKWA 4K4ZA 4WYWA 4URGA 5CA5A 1YQHA 3RJMB 2DHAA 2AWZA 1HD0A 3V81B 3VAJA 3LP2A 1Y9OA 1W26A 3L7UA 1NB2A 2G2YA 4M95A 3UN3A 2MJUA 2WVCA 1T03B 4EUVA 1FNOA 2WW8A 3IR6B 1NJIT 4ZVEA 4ZDNA 3RR7A 1FRLA 4DJBA 1CJUA 4CT8A 2HQIA 3BZQA 1UVMA 3BDPA 2D9OA 2FJBB 3MAQA 1LWFB 1IKYB 3I4PA 1KLMA 1SC4B 4WFBQ 2ZVSA 3WBZA 1JXEA 4YDXA 4JI4F 2D3OR 1T05A 2XHWA 2XY6A 1GAOA 2VICA 5BR8J 3VTIA 4FDFA 3G82A 2H54B 4AE5A 3QRQA 1VJQA 4YB5A 1C0TB 8ATCB 4JI3F 1JQGA 1RTJB 1WSRA 2OPQA 1NPKA 2R2UA 3AODA 2V2KA 4NLVA 2FC9A 3C16B 1T7PA 2HIQA 4ZA1A 2J8SA 3CCVS 2GGPA 3FZBA 2IIHA 1N34F 2Z56B 3AXKA 2EFVA 4J9OA 2ZC4A 3QIDA 1FT8A 3DLBA 1VRQC 3CEDA 2AZ1A 2B6AB 1FTCA 2EVZA 3SIPB 2UVVA 5I4MA 2UVUA 2FVCA 2B9WA 3GYNA 2OPSA 4ZJQA 3EYZA 3HXMA 5HN0A 2CJKA 4WBFA 4CLTA 3PYDA 2XCAA 2KDOA 3OXGA 1B3TA 1VRUA 2KFZA 2LYVA 2Q1LA 1RWMB 2DY1A 3SEOA 1KQGB 2DNMA 1XMOJ 5DRKA 3SQGA 3EMTA 3MM6B 1UZDA 1EIYB 7AT1B 1NRKA 2FD2A 5HLFA 4DPXA 3OLAA 3MMCB 1LQ9A 3R2DJ 4LSZB 4FYWB 3OTEA 1I94F 4B3OA 1Z4UA 3D68A 4M63A 5JJBA 4FF2A 1V5IB 1WC0A 4R5PA 3TX0A 2MSSA 3GILA 1WKKA 2Y1RI 5K8MA 2BE9B 4M1KA 4OYMA 3ZZZA 4IO9Q 3BN4A 4E2FB 1Y7PA 1P1TA 2VBWA 2NPFA 4K0KF 4ED0A 1PJ6A 2DGVA 4OI3A 2X51A 1RABB 4DPTA 4XO0A 2QA2A 2DRAA 3HJVA 2C2DA 4ZLNA 1F5BA 3M7VA 1ZETA 1N5VA 1GXTA 1TTHB 5KFEA 5KG7A 5DM6Q 1VQLS 2CZVC 2DH7A 1CC8A 1RTZA 4UF4A 1HNXJ 1ULRA 3MEGA 1ZAXA 2L48A 2RRAA 1KVKA 3CVKA 2C3OA 4DR5F 5M2RA 2DNQA 5L9XA 3OTOJ 5CD4H 1H73A 1Y10A 1V6HA 4OX6A 2HHHF 3IAM9 4TLQA 5H9FJ 4JI0F 4ZVGA 2AZ3A 1Q16B 2CDRB 2DGTA 1OYDA 4K4SA 4AXIA 2CPZA 3CJKB 4S0MA 1FHTA 4DSFA 1LKZA 2UV8G 1YRUA 4X84A 3Q8UA 4DV3F 3TZXA 2ZZTA 4QIWD 4WE1A 5F9LA 1S0NA 5HATA 2FVSA 1M5VC 3E2EA 4RBTA 3E01A 3CO9A 4AT1B 1QUPA 2W4DA 3QZ7A 4Z7CA 2VFSA 3EM1A 1F2HA 3VF0B 3DLGB 4YOEA 4M94A 4DEZA 3PACA 2K06A 5IT9U 5GAEU 3HFKA 5AJ3J 1CVJA 4PG6A 2HKEA 4MIWA 3K7RA 3W2VA 2HPUA 3PKYA 1RBOB 3RBEA 5IT9Y 1SKUB 1VS3A 2EI5A 3VAFA 3JAMU 3BH6B 3PO4A 5F3TA 2FPHX 2EG1A 2XC9A 4TQRA 1URRA 3VGTA 1LWXA 4CTAB 1O6XA 3MAAB 3CCZA 3LP2B 3OPKA 4DCPB 2NUUG 1TP7A 2PFFB 1MN7A 2ILZA 1WHXA 2MKJA 1RYRA 1A9NB 3K5LA 3QYYA 4N56A 1NSPA 2P8IA 1RWKB 4TXSA 3NGSA 1FX4A 4PWUA 3EPIA 1IM4A 2EFNA 1GFWB 4FF3A 3K89A 2IMWP 3M30B 2I6WA 5EDWA 4I0WA 1ZM4A 4DR7J 3BR8A 3P45B 3N6LA 3TJ9A 4NLOA 5ETTA 3KG4A 1KLMB 3HT3A 4ANCA 1S4EA 1JLGA 3WC2A 2BRLA 2R3VA 4ZPTR 4CO3A 2BJ1A 1S48A 3FK4A 3MECA 5DZ6A 3DRXA 1YJRA 3HD1A 1C4AA 1IM6A 1GNKA 3F73A 1HMVA 1XR5A 2IRUA 2CNOB 1PG5B 1WDTA 2OPQB 3H90A 2OEKA 3GFYA 4LVNP 2ROGA 3D6HB 3CCUS 2GGPB 3A4TA 4JBCA 3T6JA 4IYQA 3CB4A 2KI2A 2HVZA 4JI2F 3R1LA 4U95A 4LBIA 3CMAS 3AFGA 3MUMP 3FBEA 2NPIA 5ADZA 2KT3A 2H5EA 3KWMA 1QSSA 3DYAB 2W2OP 4JI7F 3EDQB 1FFWB 2I2YA 2MYFA 2C2OB 3A12A 4GMKA 2OPSB 1VBKA 1WHWA 1FDAA 3ULHA 4J9QA 4Y2AA 2WVBA 2BMBA 2IAJB 3V5RA 4TY9A 5KAKA 3WX8A 3SZ2A 3LANA 1S1WA 3UCGA 3G4SS 1JLAA 2CZ9A 2DHGA 4HR2A 2RQ4A 2ZH9A 3GFZA 2VKZG 1S1TB 2ZOFA 1VGYA 1X9WA 3UDCA 3P5BP 2DGWA 5DO2A 4EBCA 4R5PB 1YDLA 2MLYA 3DOMB 1RTHA 2VBYA 4K50A 3OTDA 3C15A 4DL6A 3GTYX 3PR5B 3MEDB 7FDRA 4O3OA 3V2UC 3EVOA 2M3DA 3MZIA 3OXFA 2DGXA 4EBDA 2CQ0A 3AJ2A 3UQSA 1S1XA 3CUNA 2GIRA 4C8ZA 4NA3A 2DNHA 4XK8C 2CQ1A 4DR6J 2CAJA 5HK4A 1Q4RA 1KS2A 2JEIA 3P4UB 4OHXA 4DFMA 1DTQB 3W64A 4OHVA 1EX8A 3CO0P 5DLGA 2YKAA 3V4MA 2HVIA 1IKXA 4LFCF 1HBMA 1TUVA 2QZ8A 2CPEA 3NMAA 3MEGB 4JI1F 1A6LA 2VQFF 2OEMA 4IQMA 4WYLA 4KH0B 3M8WA 4J9RA 1KWMA 3DGPA 2RDDA 4N77A 2CA9A 2KHDA 3QMQA 2GJ2A 3M2RA 3VAKA 2P9GA 3HULA 3ZZTA 4O3RA 2J0XA 1TU0B 1L3SA 4A8SA 3AD8C 2E7WA 1N33J 4M8LA 1OIAA 2DNLA 4EK2A 1OPZA 1SJ4P 1RWUA 2PT0A 5I42A 2HVDA 2GQCA 1WKLA 3NMRA 1RA6A 2EBGA 4P52A 3ZC4A 4KHPF 2HVEA 3FQKA 4QQBA 4ZMMA 5KFHA 3T5JA 5KFMA 3TO8A 3B6BA 4YN3B 1WG1A 2OSQA 3IWNC 2YY3A 3N5BA 1YIJS 4NCGA 1U2CA 1RWOB 2C28A 1TKTA 2YQ3A 3GLJA 3SSSA 3JXOA 5AE3A 3ISND 1X60A 2CPDA 4RW8B 2R7RA 1X5PA 1HWLA 2F8MA 3GCXP 1CJTA 2RHQB 4C3MA 2CDQA 4LBPA 5L9NA 2QL9B 5GAHI 1V3ZA 1P9QC 2EPIA 2DNOA 4ZLJA 4G3IA 1R3NA 5KFIA 4PKDB 1MWQA 1FE4A 3H8YA 3UO0A 4DR3J 4ZVHA 2XS7A 2V4QA 2P9EA 3BREA 3DM2A 3LWMA 4ELUA 4F50A 4GVLA 2E9RX 2R8HA 2O66A 3MM8B 1LXJA 4Z2XA 2YQ1A 3HI9A 1MMNA 4DV7F 3EGVA 1U47A 2VASA 3W65A 2VU5A 2LEAA 1EB0A 3M6WA 4ED4A 3VGVA 4K4TA 2KYZA 3BKFA 4RUBA 4DS5A 1FRMA 3TP2A 2QGFB 3ZZOA 1JLGB 2QA1A 2UUCF 1SL2A 1W2BR 4FF4A 4PEOA 2UUBF 1NJYA 4QIFA 3BS9A 3K57A 4I2PB 1FKPA 4LBHA 1HMVB 4ZS6A 3MCNA 1ZZNA 2PGCA 1JKHA 1WACA 3DOLA 4C3LA 1B99A 1WC4A 1R31A 5D4PA 4FS1A 4ECXA 1Y5LB 1NBEB 1ELOA 2GJFA 3NKYA 3SQOP 3LH2S 1MW7A 2R7SA 4LSNA 4YMEA 3G86A 3EXYA 2G2OA 2UXCJ 4DL2A 3ONQA 2G2ZA 3GR1A 4B3TJ 4CH0S 3TARA 3KLHB 3GJQB 4V19X 1E6YA 1FKOA 1PBAA 3I32A 5HI7A 2J7UA 3W62A 4N47A 4HLBA 4UY8T 5T7LA 3JB9k 2P5VA 3MHYA 4RBVA 1IXKA 3AH6A 3QT6A 1XK8A 4DQQA 3UVJA 2UP1A 4LF8J 1XR7A 3LO3A 2ZZMA 2NZCA 5IT4A 4PR6A 3CJ4A 1NHUA 2W4PA 2P9CA 2ZH1A 1GTHA 5A8RA 3HM9A 5AXKA 1IR1A 2ZJQQ 1NKEA 5KG2A 3H42A 2E66A 5D0RA 1YI2S 1XJWB 1JLAB 2NXEA 1LK5A 1TAQA 2AJ4A 3Q8VA 5I3QA 2W25A 4OFZA 2RQKA 4C11B 2YKPA 3R5CA 3KNGA 3RGIA 3QT8A 4LT6A 1HQUA 1N4LA 1C4CA 4K4XA 2V2QA 1RTHB 4QU7A 1M1KT 2JNJA 4I2QA 2AKWB 4CRJA 4F26A 1NK9A 1S76D 1BMQB 5GMDA 1NEEA 2V8DA 1NZAA 2B9EA 1HR0J 1HFEL 3D54A 1WC5A 5HVHA 2LA6A 3H25A 1K9MT 3H98A 2ZH3A 2HNYB 4ZPVR 3I5CA 3HFZB 3IG1A 2X1GA 1VRTB 3SV3A 3HZGA 2C3YA 3OL7A 2LKZA 1FNXH 2ZH5A 2V50A 5A8KA 4FBTA 1R6YA 4DV6J 1SQGA 2YX7A 4J9VA 2V8GA 1CJKA 4NEYA 1F2GA 4G1PA 5HP1B 3D6TB 4J37A 5CH7B 4KKOA 4DQPA 3CMQA 4FYYB 1N36F 1VHIA 1UAWA 4P75A 2B5JB 5J2MB 2MZQA 1EETB 4KFBA 1U49A 4Y2MA 3MEEA 1Q95G 1TVRB 1GK8A 2RD5C 1KOOA 4KSEB 1K47A 2BV3A 2YNGB 4O3NA 2BJ8A 1RKIA 1TKTB 1S97A 3TOQA 2MGZA 1RWWB 4YY3J 2DNGA 1RHUB 1RAEB 3LW5C 4X4NA 1GQEA 2VODA 4F2RA 3PDNA 3C6TB 1YJ7A 2CVEA 5B0GA 5L39A 1BWVA 2DGOA 2UUTA 5L8RC 3OD2A 2LU1A 3CJ5A 4IDKB 2UZAA 3L95X 2IM0A 5IV3A 5G4DA 1BUXA 4BDPA 4H4OB 1HD1A 1F3FA 4USHA 4UZBA 2ZD1B 4GKJJ 4OYPA 2QYCA 3Q2SC 4PCQA 3GG1A 5IWAF 3GP9A 2E1MC 4DF8A 4LJMA 3DRSA 2E7VA 2XMAA 5LOQA 1KQSR 4MKAA 5RUBA 1VJWA 2XMVA 3UNGC 1UW9A 3E8OA 1WEZA 2M70A 3WX4A 3ZTQA 2J76E 2ZM6J 2YKNA 5LMUJ 3GSIA 3SCLE 1OYEA 4KGMA 4A4JA 5FLXU 1PO6A 1BLUA 3BSAA 5D4LA 3C46A 4QBUA 4KGKA 3BB5A 3ILJA 1T95A 4LF9J 5FLXY 1DZ5A 1GXUA 1U24A 1K0TA 3JSYA 4LSNB 2L9NA 3PJWA 3PW5A 4MFBA 3VGUA 5L1KA 4ZVTB 2GVDA 3LA0A 4DWIA 1E6YB 1X5OA 3HX9A 1G4CA 3RU0A 1NB7A 1J5OA 5ETNA 3Q8SB 3G71S 1M5HA 1Q53A 3D28A 4HH1A 2C2EA 3BGLA 2J7KA 4QWBA 3W5XA 4HACB 2B43A 3E51A 3MM5B 4Q0BB 3FMBA 3X3UA 2OMLA 5IM0A 4F02A 3NY0A 4DUYF 2DISA 5KT3A 2H5JB 2QIFA 4TNOA 4A8KA 3HHLA 2VG5A 1H38A 1NXIA 2Y8YA 1TL1A 1YVFA 3PX0A 5E3PA 2ZWPA 3O2IA 4WFYA 3OXLA 3ITHA 3L7OA 3HSDA 3M8RA 2HBQB 1U6BA 4KAIA 2Y1JA 4Y3CA 1PIEA 2E44A 3I0SA 5HAOA 2YTCA 4I69A 1HQUB 1ZTWA 1JLBB 1C0UA 3D1OA 1F9FA 1Y5NB 5D0GA 3GIJA 3BSNA 1AB8A 3OVBA 2CNKB 2IRYA 1QDUB 1XNQF 5HANA 4I2QB 3UCUP 1RJJA 5KFZA 3MPVA 1CBKA 4WU3A 4DV4J 5M2PA 2KKHA 4OMFG 2MXYA 1SC6A 1T3OA 5CABA 5ETPA 4DR2F 3NWGA 3GFXA 4ICLA 4QYRA 3ZZUA 3C6UB 5CYQA 4OLOA 3K59A 5F8LA 4AQYJ 4B3RF 4X62F 2ZBIA 2UXDJ 2CWKA 3JYTB 1WTFA 4RZRA 3N6MA 2ZZNA 4KIAA 3CCJS 1HNZJ 3AD7C 4I6YA 2XNRA 3M1VA 2EC2A 5KT6A 2BOPA 1NDPA 2PC6A 1FJEB 2FHJA 1VC6A 1MLAA 1AYEA 5BXIA 4DG1A 3O6QA 1TKXA 4CH1A 5A8KB 4YB6A 2FZCB 2LP4A 2XWYA 4ED2A 1CJKB 5A0YB 3PX6A 2M2BA 1RK8A 2KFYA 3AJ1A 3I55S 1T94A 4OJ1A 1HQ2A 3GONA 5L46A 5L1IA 3M8YA 3H40A 2MDAA 1DARA 4RPFA 4LF7F 3MEEB 7FD1A 4TY8B 1YSJA 1D0EA 2KVQE 1S10A 1LWEA 3PR4A 3POTA 3OL9A 4NLQA 5JUMA 1OSCA 2R4FA 1RB0A 4G1QB 1RAIB 3UR3C 3AQOA 4JUZA 3FZ2A 4NPOA 1OO0B 1XR6A 4OI4A 1SL0A 3KLIA 1B7YB 2OPRB 1Y3KA 3BYRA 4IR9A 2FHOB 4L6V3 4TYAA 3ILIA 4Y65A 4TU9A 3CNQP 2IVYA 1FFGB 5B09A 1N34J 4I7FA 1U0HA 3TA2A 3F41A 1H98A 3HHLD 3NAHA 3OVAA 1SUQA 2IYIA 3KMQA 4DPOA 3CJTA 2NZ4A 1U0SA 2HWHA 3JSRA 2WVEA 4Q8EA 4EGLA 2DCUB 5K8NA 1FCAA 1IR0A 4B9TA 3EGZA 2ACMA 4C8NA 4YR2A 4LR9A 3P6YC 5LMNJ 4KPCA 3M32B 3BBFA 1YWXA 4AL5A 5KFOA 1YTYA 3OR2B 5HJXA 1S79A 2GQ2A 4UOGA 2GQQA 4WPAA 1OY9A 1HWJA 4PWWA 4F0HA 2AYEA 3W5YA 4H4MB 5KFVA 1SVDA 2ASJA 5CYMA 4U7UK 3QNWB 4Y00A 1VBXA 3A8EA 4C8KA 2IC3A 3RAMA 1S1VB 5D3GB 5FDLA 2UU9F 1B70B 3VCDA 2C22A 3ET6B 4OIXA 3KLVA 3KLGA 4UW2A 1UVJA 4ZJOA 4AUKA 3OL6A 4Y28C 2R7OA 4N76A 1HNVA 4MFBB 1AUSL 3R97A 3TZZA 4DF4A 4CLYA 2QFIA 4YP3A 1XTZA 3D7SB 4ED8A 2XHCA 5CCLA 2XY7A 1KTVA 1HNIB 3QAUA 2DXFA 3OFFA 1TKZA 4TKTA 1EJ7L 3BF4A 4QIEA 1HBUA 1R8CA 3N01A 2DNYA 2I9SA 3DGVA 4I6AA 4QR0A 2OLWA 2KJWA 4KV8B 2A6MA 1Y0HA 4PYAA 2GV1A 2E9TA 4DUZJ 1OJ4A 1VR6A 5HVFA 3W2WA 2RAQA 3HHLB 1K73T 2HHUA 1UL3A 3M9OB 2GMLA 3MAHA 4NLGA 4NLDA 1RACB 1BQNA 4JV2A 3ITHB 1S77D 2BE2A 1CS4A 2OO4A 4JV1A 4JI0J 4DFJA 1KR4A 3K17A 2CRLA 1KVJA 3RB4A 3ZTSA 1C1CA 4NX9A 5GAGU 1C0UB 1QUVA 3TYTA 2BKOA 1X0PA 1SV5A 2A1BA 4NLTA 4OX9J 5FJ4A 4WKRA 4OLPA 4M5JA 1GX5A 1XNRF 4DFKA 3TUIC 2X1BA 4M5KA 2XO7A 3HVTB 3VQSA 2XSFA 4CO5A 5IFMA 1NH8A 1FJ7A 4I67A 1CJVA 2O3DA 1VMBA 4C8OA 4CWBA 2I38A 1R43A 3HZEA 4LFBJ 1FRXA 3QFHA 4CLZA 5B0DA 1WELA 4QZVB 2VHGA 3ZZRA 3TWZA 4JI8J 3F44A 3GZ7A 5HQLA 1ROFA 3TZWA 2FZGB 2HWIA 1UJ4A 3SCJE 2FIUA 3Q83A 3KK3B 3SV4A 1RT6A 2YKMA 4FYXB 4WP8A 3TRGA 3M8QB 2IVMA 4JI6J 4RWWA 2V63A 1SB6A 1IBKF 1VK8A 4UTGA 4OI0A 2XMJA 1R8BA 2C2KB 1DFDA 3AQPA 1X8DA 3MTKA 4M5HA 2OELA 3TVYA 5DG8A 2RUGA 3P96A 2EK6A 1G3OA 5HMXA 1S59A 4OZLA 3GG0A 1TL7B 4OYWA 1FWPA 1QTNB 3EJMA 1AZSA 2YPZA 1NAQA 1VQSA 2F1FA 4NOHA 3ADAC 1SIZA 1FRJA 2ERRA 3CE8A 2IM1A 3CJQA 2AGPA 4ECUA 3J7YI 1T11A 4X4TA 1BGXT 1UFLA 5IOLA 1MROB 2HG4A 1F6TA 4R0EA 3MCOA 1VBZA 3OTCA 4F36A 2K7JA 2HZCA 3D1HA 3KLIB 4CO2A 3LAMA 3TJAA 2QMWA 2LDIA 3TX8A 3OHAA 5F8HA 3RW6A 2DNNA 2WZ1A 2CQ4A 2D9PA 3QAEA 3RYLA 4QPTA 4RL1A 5J2NB 2UUAF 1T9TA 1N56A 4CYUA 1RAAB 1RAOA 1J5EJ 1LFWA 4ENOA 3J7ZT 2NSBA 4C8MA 1VQYA 2YX4A 4KO0A 1JLFA 4N41A 2D1CA 5HQMA 2JEFA 1VQ9S 2VONA 2PEBA 4L3NA 3PV8A 2PI5A 3OR1A 4NE9C 2GIFA 3DI6A 2VFVA 2W7PA 3NCPA 2KN4A 4Q2LA 3VZIA 2W9AA 4DSEA 5G0RB 2MY7A 1WHYA 1DRZA 2XLIA 1KVIA 3BV8A 3DRPB 3CW2C 2ZWOA 3DRRA 1AFJA 4ILRA 4ECSA 3EZOA 1Q79A 2KXNB 2IC3B 4HI2A 5IQ6A 2DIUA 3NWRA 4EZ6A 2R2SA 3KLGB 4RNHA 3AB2B 4E0DA 3UI3A 1N5YA 2XBPA 4O23A 1LW2A 2WW4A 1RWXB 4I4BA 1WF2A 2HRUA 4QCLA 4L74A 1UWAA 2YWEA 3CF5Q 3I87A 4L76A 4OYXA 2HFOA 3T1AA 1IKVA 4RNNA 3RUBL 1HBUB 3KXDA 1RT7A 1DAXA 3ZO7A 2B7BB 4RW9A 4UOCA 1VQMS 2AEMA 1KHVA 3UD5A 1VLOA 4WP9A 4DX6A 4ECVA 2YNFA 1FVSA 1R7IA 5CHCB 4CLUA 4DL0C 1RHKB 1NKCA 4PRFA 2ZE2A 2QLXA 3NS7B 1BQNB 4NI2A 2R8KA 1XC9A 3AY0A 2ALZA 1OPIA 1RHQB 4MKVA 3HPOA 1S7IA 4USIA 4Q7AA 2JH3A 2W8LA 2XMWA 2PA8D 4ZVFA 2YQ0A 4B9MA 4MK8A 2X3DA 2ALYB 1HWUA 5F0WA 5C42A 4RW6B 1OY6A 1CJVB 1GMUA 2A0FB 1FVQA 2LMIA 1IBMF 2V4RA 1YZ7A 3T5KA 5MLCV 1X4FA 2AJ2A 1GXLA 2JLEA 2CQBA 4GO5X 4R0JA 5LL6d 4W92B 2OUGA 1TELA 4ZPBA 1L5UA 2KG0A 5KG3A 1RTIB 4Y2IA 1BQMB 4QYZK 1NK0A 3GYXB 1A0OB 3DLKA 2CJQA 3RRGA 1RAFB 2PO4A 1PC4A 3LPEA 3CCMS 1CPZA 4C97A 4F8RA 4C0OC 1FDBA 3T1YF 5IC6B 3EZUA 4KPYA 3W9HA 3TANA 5AXMA 4L72B 1S6PA 2B51A 3QO9B 4QWAA 2ADCA 1T9VA 4UUXA 2BANB 1FK9A 1S0VA 4JI5J 1GMWA 4GO7X 4IQXA 4DV7J 2E5HA 2N3OA 3LGHA 1SPBP 3LP1A 4LRFA 2VFRA 2C2RA 2R42A 2U1AA 3VWSA 3LPYA 1X4EA 2V8PA 3DDKA 1WI6A 1SC3B 2V4JA 4X65F 2E1CA 4K4VA 4KR0B 3I31A 4BC7A 1Q7LB 1VK3A 5KT4A 1FEEA 2ZBRA 4AFFA 4UQGA 3CCTA 4LREA 2AHOB 3SBMA 2A2CA 1HI0P 4DLGA 3VVUA 5GADU 2K3KA 2VQEF 1JWWA 5A8WB 2DTJA 4I6WA 1SJFA 2VH7A 3FFIA 5KT7A 2JLGA 4CYUB 3M9NB 4B02A 2FGCA 1QD1A 1NK4A 1IWAA 4LF1A 3HJFA 4RNOA 2BW7A 1HYSB 3H5UA 4WTYA 2XS5A 1Y11A 2M7SA 3MDFA 4F0MA 5EUHA 3DI6B 5C25A 2ZH2A 2E5LF 1ZA2B 4OHWA 2VL1A 3OSNA 4BWJA 4OYAA 1ZYQA 2HHWA 3OFGA 4Q5VA 3R5BA 5D77A 1FXRA 3PW2A 3OFHA 3NAIA 3KYLA 5J1EB 4B3SJ 2Q79A 2VV5A 1N32J 1JLEB 1QLNA 2W4CA 4RLEA 1RT3B 4H4KC 3B54A 1PAEX 1FRKA 5BYRA 5DG7A 4F4XA 1Q8LA 1N5YB 3MM9B 2JEGA 2CPHA 2CQCA 2LDYA 1LW2B 4ECRA 2N3LA 4J5OA 4USTA 3M6VA 3NNAA 3BSOA 1WHVA 1MMDA 1IVZA 3TR5A 4FXVA 2Y3YA 3W61A 4N8OA 1EARA 2R7QA 1WORA 5J2PB 1MG7A 5BR8F 3KTQA 4CNYA 3WQPA 2EKYA 3KFWX 4PG8A 1U6FA 3BQ1A 4QWDA 3T5LA 1ITPA 1HQEA 3LAKA 3UCZP 4LRDA 2X1AA 2K1RA 1HBNA 1PYTA 4B08A 1TK8A 2VJVA 2BQUA 1GMWD 4O4RA 4CI0B 1RT2A 1U09A 4ZIVA 4NI2B 3IBCB 3AD9C 4C2MA 2FYXA 4NA2A 2AP6A 4O4GB 8AT1B 3SCIE 4F67A 4K4YA 3W9JA 1ICEB 3PG9A 2G1DA 4A8MP 2ZEJA 1NSKL 3I5AA 4PG4A 4DU8A 2VDIA 1RT5A 4IO1A 1HA1A 1SXLA 5HBMB 2ROPA 1TUGB 2VJUA 2POKA 3MD3A 4PG5A 4ZPAA 4FKXA 3R27A 3D9BA 2CG4A 4IRDA 2Z2ZA 2YXLA 1XMOF 4C0BA 2Z2LA 6AT1B 5A2QU 4X64J 2IPOB 1YJUA 3T1HJ 5KFUA 5A2QY 2DR5A 4RO0A 4M5GA 2VPXB 3N79A 2GW8A 3TAMA 4GC7A 4ZCLA 4R8UB 2WAQD 4A46A 1MU2A 3WZ0A 2FZKB 2KXHA 5KOWA 4HH0A 4K5RA 1IBLJ 1AW0A 4ECYA 1DTTA 3DLKB 2EXUA 4ZKAA 4ALZA 3FRYA 3U1NA 1P6TA 4NASA 3TZYA 2QJ3A 2R7WA 2WBRA 2F4VJ 5DDOC 3U1MA 3ZZPA 2WONA 3ZNJ1 3ZZ0A 1S49A 3DMJA 5F41A 2R9LA 2KRRA 3DU5A 4ID5B 3KK1A 4P2SA 3CD6S 3BN7A 3NG8A 5F8MA 4F3OA 1WSVA 1SCJB 3HK2A 1HNXF 3LP1B 1U8WA 4RR5A 1HHTP 4WFZA 1O5JA 3DCAA 1H2VZ 1RBAA 1RAGB 3OTOF 3I96A 3SCKE 4EO8A 4USVA 4ZITA 2RS8A 3OL8A 1X4AA 1TMJA 4U8VA 4K2JA 3GIRA 3HMJG 1KONA 1N6QA 1K0VA 3HSGA 3KUHA 3PZPA 2VF3A 2GFFA 1FNMA 2HMIA 1HNWJ 1BC6A 2HQFA 3CSKA 1RU2A 1YITS 1KFSA 2DNZA 3D4JA 2G9OA 4DR4J 3DU6A 3MTJA 3V6DA 4CLSA 2Q6BA 2IJNA 1NHVA 3H2LA 2QMUB 1UJ5A 2HFSA 2YX1A 1S9EB 1NK5A 2F63A 4MT1A 2NSCA 4YHHJ 1S1UB 3O1LA 5EX0A 2DKOB 4G65A 1KHWA 1IKWA 5AJ3F 4IG3A 1X4GA 5EWGA 1S6OA 2ZBPA 1RISA 3SMZA 2HHQA 4NRTA 3QGHA 4C98A 3NGTA 1DQ9A 5J1NA 1VFJA 5LJ5Y 3HF5A 2VG7A 3H4BA 2YNHA 3PW4A 4ED6A 4CM2A 3VAIA 3TAPA 1K1QA 1NH7A 2GIQA 4DL7A 3IR7B 3NNHA 1VQ6S 4QWCA 2IM3A 2QC3A 1ZM3A 4DSJA 2LVWA 3DOKA 2ZHOA 1FWKA 2XNQA 1U1KA 3VZHA 3Q8PB 5HROB 1QAYA 3ZTRA 4DR7F 1KN6A 2IVFB 3NBPA 9RUBA 3LALA 1NDLA 1DY3A 1O0PA 2KTQA 5HL7Q 2EG2A 4UOHA 1EKRA 1YZ6A 4USKA 3FJ2A 3OUYA 1TV6A 3DLHA 1JIHA 2FDNA 4ERDA 3T9ZA 1B64A 2KXFA 2MQ8A 2OIHA 3THTA 6FDRA 2JOQA 3NOCA 3R7NB 1RA7A 1FDDA 2HNZB 4USWA 2GHWA 4B3RJ 3QRRA 4P7TA 3N28A 1EP4B 3D0GE 3HHDA 1HQEB 2K1RB 1HBNB 3QRPA 3C14A 4O0IA 4Y6IA 3C66A 3TVKA 3ILOA 4MJKA 2CPYA 2PMWA 5I3UB 1JJCB 2XZWA 2ZHAA 3L4BC 3Q24A 3T19A 4IOBA 1TL3A 2B8QA 2J8AA 3G8QA 4WCEQ 3T41A 1T02A 3FMWA 3PIOQ 1RT5B 4M5DA 3PYFA 1XN9A 1FXLA 2B4PA 2R2RA 1X4CA 3P8BB 4YQWA 5AXLA 5KFKA 5B7WA 1N0UA 2VA2A 2JX2A 4DX5A 4U7CA 2ZH4A 5K5MA 4URQU 5KFBA 1DLOA 3ISNC 5LSOA 4DLEA 2KZMA 3I0RA 1RKJA 1FI4A 3ENAA 2KJVA 2RU9A 3DXSX 4RW4B 1MU2B 4TU7A 4OZ5A 1UWBB 4CLLA 3KHGA 3K5NA 2C3UA 2CFXA 2GVZA 1LWCA 3BGRB 4N7TA 4LVOP 2DNRA 2BQ3A 3MMJA 1G7CB 2MZJA 1IBCB 4ZP6A 3L3CA 4DV0J 3JQKA 4LRBA 3O44A 2BYCA 1TAUA 1Q8BA 2RNEA 1L3UA 1Y5IB 2AQ4A 1HI1A 1ZA1B 5J1PA 3EPGA 2Z8QA 4DR6F 3GR0A 5F8JA 1WC6A 2CXEA 2FVRA 1NSQA 1NCLA 1PKUA 1AROP 3DLJA 1SJ1A 5T14A 1Z2ZA 4WFAQ 1Q0NA 4NCBA 2WOMA 4O3PA 4ATNA 2E5GA 1FJGF 2DNKA 2Y0BB 5KG0A 2R7TA 2KT2A 2J7WA 1RP5A 4O44A 2B9YA 3IRWP 3DNCA 1O51A 4X4UA 4ETZA 1HPZB 3THPA 3GPAA 2CYYA 3LF0A 4JV5J 2GO9A 3BBCA 2W1BA 2GZOA 2V5HG 4OI1A 5ETQA 1RHMB 3OJSA 3Q23A 3O5TB 4AD6A 2W9CB 3W1YC 4DZ6A 3MR3A 2IBKA 3LP0A 1D09B 2R7XA 1M5KC 4BS2A 3IS9A 2IMOA 1R0AB 3QLHA 2IA0A 2NXJA 3O3LA 1QY7A 5GADI 3NS6A 1FE0A 2YBVA 3G9CA 3KK2B 1IKWB 3KLFA 1ZS6A 2EWHA 4RW7A 4KHMA 2HW3A 1YBAA 3K5MA 1VC5A 2IHR1 3JAMY 5DS7A 2MPUA 1HLWA 2AIRB 3UN2A 2CG8A 2HGMA 2KHCA 2PMZD 5HMWA 2RDJA 4DR3F 1HIYA 2V94A 1LW0A 2QLBB 2RHSB 1S6QA 1U1PA 5AT1B 1VC0A 4ZVRB 2B7CB 4NXMJ 3DC2A 4EYIB 5L1LA 2G0IA 1CJUB 4QW8A 2IBOA 1JB0C 5IT0A 3CCQS 2VZ9A 1N8RT 4ZPCA 2RKIA 3MR6A 1MMLA 2OEJA 4M5NA 1IR2A 1F9HA 4NYPA 5IS2A 1XQIA 1T05B 2BRKA 2ATCB 3G82B 3C3LA 3B8HA 5K14A 3RAXA 2F7VA 2BUNA 1QE1A 1K1SA 2QE5A 2XMTA 3US5A 4CIOA 4Y34A 2HS0A 3PM9A 2C3PA 3KLEA 3KJVA 1UW4A 3FQLA 3H7HB 3IBWA 5IZHA 2AYBA 1U7LA 2H9ZA 4ED7A 4OJGA 3FEXB 4ZP7A 5E0OA 2UXCF 1CEZA 3AB4B 4ED1A 2RRBA 1T9UA 2OH2A 2PEHA 3OBIA 4U8YA 3DXBA 2KH9A 3BQ0A 5D6GA 4RNMA 1IWGA 1B0PA 1HBOA 5DG9A 3MMBA 3KHLA 2VUGA 2AJ1A 3UD3P 3D0HE 1VRUB 4LF8F 4LF2A 2V2VA 2HIYA 2HK2A 2MTLA 4LR7A 3PFEA 2LXIA 4LFAJ 4FPIA 3SQGB 2PI4A 2MHEA 2CZ4A 2H4YB 3JSMA 4NXNJ 4L3KA 5HLFB 3LUYA 2UXBJ 4DSKA 3QT7A 3BBBA 4PQAA 2MY8A 5CCMA 4QU6A 2Q43A 3PJXA 1H2UX 2J9CA 2NR0A 4B3OB 2Y9HA 3MWBA 2Z30B 1DLOB 1Y00A 2HBYB 1YBTA 4Q2MA 2NQPA 3B4DA 2D3UA 4RUAA 1N48A 2FQQB 5E3CA 4W4MA 1NDKA 4TVAB 5AXNA 4FNHA 1REGX 4OHYA 5B0FA 4WIQA 4QJVA 5E7OB 5K20B 3FSYA 2FJWA 4P2FA 4K59A 4PUOA 2DH9A 3PX4A 2GVZB 4J9LA 1LWCB 2XB2D 3GMGA 2RB7A 5K8OA 5J2QA 2YPYA 1D8YA 2KU7A 1F3VA 4MIBA 3H5YA 3ETOA 3K8WA 1FESA 4X66F 1M1HA 2UVWA 4KJIA 1N88A 5A6WA 4PPZA 2R2TA 4JB8B 2LECA 1HR0F 2HK3A 3MURP 5EN1A 2CPFA 3FCHA 4ES3A 2Z0GA 3A8KA 2NLWA 2GAGC 1DBDA 2J9EA 5EWEA 1YRXA 4CLWA 4H54A 2XYHB 4DL5A 4DFPA 4NZ7A 5CAAA 4PXCA 1PJ7A 2A2DA 4XPCA 3IRXA 2HSEB 3H59A 1M0SA 1KQFB 1S9GA 4IH6A 3JTNA 1V5VA 2KO1A 1ZBTA 2XZDB 3V6KA 1P1LA 2YH0A 2AJFE 4LF4J 3V81A 2ZOMA 4LUBA 2V67A 3QWUA 2JZ5A 4DV6F 4WE1B 4KGXB 4KC5A 4YUDA 4FN5A 1T03A 2Z4PA 1WI8A 1X5SA 1F0XA 3E01B 2HRTA 1YHQS 2Y0SD 2RMLA 2JL9A 2DRBA 3SXLA
chains in the Genus database with same CATH topology
4DV7J 4X64J 1IBMJ 4DR1J 4DV3J 1HR0J 2UUCJ 4JI7J 4X66J 4K0KJ 1XNRJ 2UUBJ 3T1HJ 4NEZA 4X65J 4YY3J 1J5EJ 2ZM6J 5LMUJ 4DV5J 4LFCJ 5FLXU 4JV5J 3J81U 4HHUA 1XMQJ 4OX9J 3D3BJ 4DR6J 1N34J 4DV0J 2MTLA 3R2CJ 2KL8A 4JI1J 4LF6J 1XNQJ 2VQFJ 2E5LJ 4LFAJ 3IMQJ 4LF9J 1IBLJ 3W1YC 4B3MJ 4KY3A 4NXNJ 4DR7J 4DV2J 4B3SJ 1HNWJ 1N32J 2UXBJ 4LF7J 2VQEJ 2MEWA 4LF5J 2F4VJ 4DR2J 4RJVA 3J80U 4LFBJ 4DR4J 1N36J 4GKKJ 4DR5J 4JI4J 4DV6J 4DV4J 5IWAJ 5IT9U 3D3CJ 4DR3J 4X62J 5LMNJ 1HNXJ 4GKJJ 5AJ3J 2UXCJ 4JI8J 4NEYA 4DUZJ 2HHHJ 4LF4J 4JYAJ 3J7AN 4B3TJ 4JI3J 4DUYJ 2KVQE 4YHHJ 4AQYJ 3T1YJ 1XMOJ 2MQ8A 1IBKJ 1I94J 3OTOJ 3JAMU 4DV1J 4JI2J 1N33J 5BR8J 2UXDJ 4KHPJ 4V1Ak 4PWWA 5LM7E 2UUAJ 4B3RJ 4NXMJ 2UU9J 3R2DJ 4JI6J 1HNZJ 4JI5J 1FJGJ 4KYZA 4JI0J 4LF8J 5A2QU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV7 J;  4X64 J;  1IBM J;  4DR1 J;  4DV3 J;  1HR0 J;  2UUC J;  4JI7 J;  4X66 J;  4K0K J;  1XNR J;  2UUB J;  3T1H J;  4NEZ A;  4X65 J;  4YY3 J;  1J5E J;  2ZM6 J;  5LMU J;  4DV5 J;  4LFC J;  5FLX U;  4JV5 J;  3J81 U;  4HHU A;  1XMQ J;  4OX9 J;  3D3B J;  4DR6 J;  1N34 J;  4DV0 J;  2MTL A;  3R2C J;  2KL8 A;  4JI1 J;  4LF6 J;  1XNQ J;  2VQF J;  2E5L J;  4LFA J;  3IMQ J;  4LF9 J;  1IBL J;  3W1Y C;  4B3M J;  4KY3 A;  4NXN J;  4DR7 J;  4DV2 J;  4B3S J;  1HNW J;  1N32 J;  2UXB J;  4LF7 J;  2VQE J;  2MEW A;  4LF5 J;  2F4V J;  4DR2 J;  4RJV A;  3J80 U;  4LFB J;  4DR4 J;  1N36 J;  4GKK J;  4DR5 J;  4JI4 J;  4DV6 J;  4DV4 J;  5IWA J;  5IT9 U;  3D3C J;  4DR3 J;  4X62 J;  5LMN J;  1HNX J;  4GKJ J;  5AJ3 J;  2UXC J;  4JI8 J;  4NEY A;  4DUZ J;  2HHH J;  4LF4 J;  4JYA J;  3J7A N;  4B3T J;  4JI3 J;  4DUY J;  2KVQ E;  4YHH J;  4AQY J;  3T1Y J;  1XMO J;  2MQ8 A;  1IBK J;  1I94 J;  3OTO J;  3JAM U;  4DV1 J;  4JI2 J;  1N33 J;  5BR8 J;  2UXD J;  4KHP J;  4V1A k;  4PWW A;  5LM7 E;  2UUA J;  4B3R J;  4NXM J;  2UU9 J;  3R2D J;  4JI6 J;  1HNZ J;  4JI5 J;  1FJG J;  4KYZ A;  4JI0 J;  4LF8 J;  5A2Q U; 
#chains in the Genus database with same CATH topology
 1BD6 A;  1SKR A;  1IKY A;  2FUG 9;  1CQM A;  3R1H A;  4ZVP B;  1OSD A;  4K7Q A;  5JVG Q;  2VPZ B;  4Z7Y A;  4CO1 A;  3W2V B;  2CQ3 A;  5K9F A;  4ZN3 A;  1FA0 A;  3ICL A;  3H2V E;  4KB7 A;  4YY3 F;  4OHZ A;  1O8B A;  1N5S A;  1C0T A;  1NK6 A;  3WC0 A;  2VOO A;  3KOA A;  2VB6 A;  1RTJ A;  1AT1 B;  3HVR A;  3BO3 A;  2KRB A;  2HHX A;  3C16 A;  1UCN A;  2YWG A;  3SDE A;  5DDP C;  1S6Q B;  3IWX A;  2NS1 B;  1UVK A;  4PAB A;  1UPP A;  3GFH A;  3QGI A;  3OFE A;  4Q8F A;  1QAI A;  2HZA A;  4GKJ F;  2VOP A;  3LOU A;  1KTQ A;  4CP5 A;  1B7F A;  4DBQ A;  2DHX A;  1M1G A;  5C24 A;  2FLO A;  1WUU A;  3MEC B;  4I1T A;  5KFQ A;  1BWE A;  2QSW A;  3CJS A;  4P7V A;  4FYV B;  3CD7 A;  3H5S A;  3TQE A;  1XMQ J;  5DQH A;  2XM3 A;  2APO A;  1KDN A;  1QE1 B;  3VAM A;  5U47 A;  3PRB A;  4B3M F;  3CIZ A;  3MM6 A;  4PAA A;  2ZM6 F;  3UDL A;  2V34 A;  3U1L A;  3O8W A;  5LMU F;  2RE1 A;  3DKD A;  3BKU A;  4ZPW R;  3KJV B;  2DVI A;  2K7K A;  3AA9 A;  3MMC A;  4FPR A;  5KFT A;  1D9D A;  2P2C B;  1UVL A;  2M5Y A;  1VQ4 S;  2XZT B;  4FXD A;  4LF9 F;  1NSA A;  2AGQ A;  4GKK J;  3SFU A;  4EEY A;  3BGO P;  4ECW A;  3TUP A;  4P73 A;  4Q45 A;  5LJ3 Y;  2ZFH A;  3S01 A;  1UTA A;  1WOS A;  3H4D A;  1NDC A;  3V6J A;  3CME S;  3GE9 A;  3T1Y J;  3QQC D;  1XWL A;  4OL8 A;  2HBZ B;  5KFR A;  4FYD A;  2EC0 A;  2QFJ A;  5M2U A;  5ETO A;  2BEF A;  3M9M B;  4WII A;  1RSC A;  1S1W B;  1ACM B;  2ZBC A;  5KFD A;  3J7Z 5;  2W2M P;  2DR8 A;  1G1X A;  3D5M A;  3MXH P;  4M5L A;  4URS A;  3CCE S;  1KBR A;  4FNI A;  4UZC A;  2Y1I A;  1WOP A;  2XYP B;  2N82 B;  3MPY A;  2DHS A;  4CCH A;  3EGW B;  2D3Z A;  2NCK L;  3BYP A;  3C15 B;  3GU0 A;  1OQ3 A;  4LF5 J;  3GWC A;  3CPW R;  3CJK A;  5B0A A;  3CXC R;  4J7C A;  2RIJ A;  2EFO A;  1S1X B;  1V3S A;  4A8O A;  1S9F A;  2MJN A;  2ZJP Q;  1TKD A;  4DV4 F;  3HHL C;  2BA9 A;  1IKX B;  2DGU A;  1HBM B;  1RAD B;  4KGZ B;  3BGU A;  4AQY F;  3KDO A;  1H0H B;  2BVZ A;  3D6F B;  2JC0 A;  3DLG A;  4DDF A;  1RE1 B;  3DGP B;  2GC8 A;  2GJI A;  4X4R A;  2FGO A;  4HVZ A;  1L3V A;  1HNZ F;  4M5M A;  1CSJ A;  3M2R B;  2X7I A;  2DR7 A;  4C0H A;  3NXZ A;  3WDO A;  1FRH A;  4GC6 A;  2E5L J;  8RUC A;  2CNN B;  1Q81 T;  1S9G B;  4DV2 J;  1M90 T;  1PBU A;  4A8F A;  2V9K A;  5IC4 B;  1DQA A;  4CTA A;  5I42 B;  3MAA A;  3QGG A;  3QJL A;  4NLW A;  2HHT A;  5BYQ A;  2MZ1 A;  1ZH5 A;  4G6V B;  3MF5 A;  2ZHB A;  4WK1 A;  3WHI A;  3D3C J;  3S7R A;  2AU0 A;  1F9E B;  2PSZ A;  2CQD A;  1VQN S;  1RHR B;  4HDH A;  1YRT A;  1H7X A;  4NCG B;  3M30 A;  4ZN1 A;  3EWG A;  1JMT A;  2W9B A;  2AV5 A;  2R7V A;  1CJT B;  2HHP A;  3HHN B;  3EIC A;  3IXQ A;  2G13 A;  2QLW A;  2YKQ A;  3NOG A;  3LQV A;  1HI8 A;  2OP5 A;  4ZIW A;  3J7A 1;  3KJF B;  4LRC A;  1H74 A;  3DM2 B;  4DMZ A;  2GNK A;  2AX0 A;  5GAE I;  5EX3 A;  1FXD A;  3M2V A;  2IM2 A;  3G8S A;  1RT1 A;  5LXY A;  3SDE B;  3IFE A;  4MMO A;  1URN A;  3Q2T C;  3FUY A;  1BXN A;  2FJE B;  3HD2 A;  3AA8 A;  1V9O A;  2H5I B;  2KVI A;  2RDI A;  2NRE A;  2KYX A;  4OZ0 A;  2MKY A;  1SI9 A;  2JLF A;  2P6T A;  1RWN B;  2JVR A;  3HVA A;  3IWL A;  2JFK A;  3L7P A;  3PYG A;  3TA0 A;  3HSJ A;  3VQT A;  3DYA A;  1WNE A;  5C24 B;  2A3J A;  3IBF B;  3IP0 A;  4NZ6 A;  3BPS P;  5LMN F;  1S0O A;  4DV1 J;  1X5T A;  5KFL A;  1B0T A;  3SSQ A;  1FKP B;  2GAH C;  1FKA F;  1JX4 A;  2Q6C A;  4HT7 A;  1JKH B;  5CYJ A;  2IAJ A;  3OJU A;  1B4S A;  3DOL B;  4DOZ A;  1KNZ A;  3F56 A;  4YR0 A;  5DDR C;  4QW9 A;  4DV5 J;  3PXG a;  9ATC B;  2YVS A;  2ZNZ A;  1S1T A;  3MGJ A;  3R5A A;  4C6A A;  3CD0 A;  1DHM A;  3QFW A;  1NLK L;  1FKO B;  4NZ0 A;  1AUD A;  2HVH A;  2LQB A;  4DHV A;  2DHH A;  1SIW B;  2AMC B;  5T7L B;  3HCX A;  3DOM A;  1LNQ A;  2J9D A;  3IGV A;  1YJW S;  1Y3J A;  3UVJ B;  1Q78 A;  3A3O B;  3MED A;  2J6T A;  1X7V A;  2OTL S;  4HYK A;  2BR0 A;  2VC1 A;  5B08 A;  1QSY A;  1VIO A;  4J9K A;  2HFU A;  3C2P A;  4MAK A;  4YS2 A;  2VFT A;  1L3K A;  5A8R B;  2HAI A;  2HLU A;  2DR9 A;  5E2Q A;  1DTQ A;  3QGP A;  4RKU C;  1JJ4 A;  2EK1 A;  4ECT A;  1QTM A;  4MTP A;  4DUZ F;  4F3Q A;  2F9J A;  2G0J A;  2WVD A;  3KMS A;  2WHO A;  1VLY A;  4USM A;  2LEB A;  1JXV A;  1SKS A;  4WTO B;  4ZP8 A;  2BKP A;  3N6N A;  2MQN A;  2RQC A;  4DN0 A;  2WVF A;  2A18 A;  2ZOG A;  3M8P A;  3FDS A;  3PW7 A;  2HAF A;  4YR3 A;  1QAX A;  5D0E A;  3VAG A;  1FTR A;  1RCX B;  2C42 A;  2DK2 A;  3I6P A;  3LTO A;  4ILL A;  2E9Z A;  2XO6 A;  1GEH A;  4U6P A;  3KJQ B;  2V68 A;  2B8P A;  2B4V A;  3A3P B;  2BOA A;  4OX9 F;  4AXJ A;  1JLQ A;  2XWX A;  2IRX A;  5H9E J;  3BR9 A;  2F8H A;  2GO8 A;  2CPJ A;  1R6V A;  4OYB A;  3S1T A;  3K5O A;  2X3G A;  3NCR A;  2PD1 A;  4JYA J;  1VQP S;  1UMJ A;  4LFB F;  2F9D A;  3ENQ A;  4OZJ A;  1X4H A;  2WB1 D;  1PCA A;  2C1E B;  3IG1 B;  2PE8 A;  4E98 A;  4JI8 F;  4ZVU B;  4RW8 A;  2M8D B;  2W24 A;  5CZV A;  5SUH A;  3FBF A;  3RRH A;  2BJ9 A;  1EHW A;  4XDD A;  5K8P A;  4J91 A;  2PDA A;  1NO8 A;  1Q7Y T;  3EVW A;  4X4O A;  4JI6 F;  1UA1 A;  4DU7 A;  4KKO B;  3S8S A;  5SZT A;  5C5J A;  3WIV A;  1J2V A;  2AYM A;  2L9D A;  4WFX A;  3MM8 A;  1EKS A;  3RRK A;  4KFB B;  2RJZ A;  2VD3 A;  1HAR A;  1VQO S;  1WEY A;  4C8L A;  2A6O A;  2RF2 A;  2OTJ S;  1KLN A;  1RQ0 A;  1JNR B;  2COL A;  5KFS A;  4P74 A;  4NLX A;  2AEF A;  3N0V A;  3RR8 A;  4JI4 J;  2MGZ B;  3UPF A;  5DET A;  2W9B B;  4O3S A;  3AT1 B;  1TQL A;  1YJN S;  2BAC A;  1TL5 A;  2ZNY A;  2DIV A;  3I82 A;  4JI3 J;  2BM1 A;  5HO4 A;  4DL3 A;  2BM0 A;  1PYS B;  1YGY A;  4WJB A;  3RB6 A;  4I2P A;  3A8J A;  3H0P A;  3DN9 A;  4RUH A;  4OV6 A;  2VC0 A;  2MZT A;  3GB0 A;  2YH1 A;  4I68 A;  5AE2 A;  3M2V B;  4OJH A;  2HS3 A;  4F4Y A;  4B9V A;  4U96 A;  5KFA A;  2WB4 A;  1RT1 B;  1D9F A;  3MFI A;  3TA1 A;  4C48 A;  4ZCM A;  2WSE C;  1WWH A;  4LF6 F;  4F4W A;  3HLU A;  1REV A;  3KLH A;  2NXN A;  3C19 A;  2P6S A;  2XUL A;  3VV2 B;  5E33 A;  5GVQ A;  1J5E F;  3X1L B;  3DRS B;  4PXD A;  1D8Z A;  1FD8 A;  2CJ9 A;  2PFD A;  3D66 A;  2ZVI A;  2MMY A;  2CIM A;  4F7V A;  2MST A;  4BBY A;  4C4W A;  2FJA B;  3LGN A;  2YKN B;  3GV7 B;  2HND A;  4HI1 A;  5HVG A;  3PJ9 A;  2VKR A;  4WWS A;  1TR0 A;  4ES1 A;  1HW8 A;  4P72 A;  3BSC A;  1I94 J;  2BJ7 A;  3FRZ A;  1RZM A;  3BQ2 A;  4ZVQ B;  4LSL A;  1DUR A;  4RBU A;  5L1J A;  1QAJ A;  5LSL A;  4YB1 P;  4C11 A;  3RW7 A;  2GVD B;  4YEA A;  3MPW A;  3EE3 A;  2HFN A;  3VHQ A;  3MUV P;  4K0K J;  3RAQ A;  3UNY A;  3DFE A;  1U1L A;  1ZM2 A;  1J5O B;  4FS2 A;  3F0N A;  3VR1 A;  1CUL A;  1S6U A;  2FHJ D;  2XYG B;  3MPU B;  2BZ2 A;  2MLX A;  4QYZ J;  3U02 A;  5MAO A;  3CC2 S;  5C2C A;  5IM0 B;  1U4B A;  1WDD A;  4IH5 A;  1LV5 A;  2E5J A;  3B4M A;  2L9W A;  2WTF A;  3J81 j;  2VG5 B;  3J80 U;  2RQM A;  2IDE A;  1KOH A;  1TL1 B;  4DR5 J;  3L09 A;  1OWX A;  2ASY A;  1N5Q A;  1WC3 A;  3PCO B;  3J80 Y;  2HHH J;  2Z57 B;  2QL7 B;  2B0G A;  1HHQ A;  2F5G A;  4B9U A;  2HNY A;  3KG1 A;  3H5X A;  1NJW A;  1QM9 A;  3I0S B;  1VRT A;  2GX8 A;  2XI3 A;  3M8P B;  5B0C A;  3CDW A;  4EWT A;  1U26 A;  4NA1 A;  1FJG J;  1RXO B;  3BO2 A;  4DV3 J;  4A48 A;  2W8K A;  1KP6 A;  1FF2 A;  2H4W B;  3OQ2 A;  5AE1 A;  2FY8 A;  1JLQ B;  4ZLL A;  5HP1 A;  4F4K A;  5JMN A;  4JP8 A;  3DRY A;  1D1U A;  4ICL B;  2VBX A;  3MD1 A;  1C1B A;  5CYQ B;  3W8P A;  5F0U A;  1K8A T;  3UW1 A;  2B5J A;  5J2M A;  5DQG A;  1EET A;  5KOX A;  1TVR A;  3UR0 A;  2DPI A;  2LFV A;  2NXU A;  1FDN A;  3KKF A;  4Y2K A;  4P6Q A;  4RJV A;  2YNG A;  4IKA A;  1NKB A;  2DD8 S;  3M1V B;  3Q89 A;  5EGY A;  3R6G B;  4X4P A;  1VQ5 S;  3QIP A;  1T9W A;  1H3D A;  1SH2 A;  3AOA A;  5ETM A;  2HQG A;  1VIX A;  4DG1 B;  3AOC A;  5HMZ A;  2N7Y A;  1TKX B;  1WD6 A;  3CJR A;  3D67 A;  2AJQ A;  3QJJ A;  3BO4 A;  3C6T A;  2AD9 A;  3M8S A;  2O67 A;  1S4F A;  2MQP A;  4DR1 F;  4IDK A;  1AXQ A;  4F3M A;  3GJR B;  1NZ8 A;  5H9F K;  3PY8 A;  2NYI A;  4H4O A;  3UFC X;  2ZD1 A;  4BHQ A;  4JI5 F;  2HFZ A;  3GCW P;  2FLL A;  1ZAV A;  2RF2 B;  4ZLP A;  4WU2 A;  4ANE A;  2FLN A;  1LWE B;  2XTJ P;  3POT B;  1IN0 A;  2MQL A;  1LK7 A;  1OMS A;  3OT9 A;  4DQI A;  5H9E K;  4KRW A;  1YJ9 S;  1X0F A;  1U45 A;  4PXB A;  1V3R A;  3G6Y A;  1YBU A;  2B9X A;  1UFK A;  5F8N A;  2MEW A;  4IFV A;  1WKJ A;  2OI2 A;  2QYG A;  3HKZ D;  3WIU A;  5KFF A;  2MHN A;  4I7F B;  1U0H B;  3TNV A;  2J0Q D;  3AOB A;  2VPW B;  1SL1 A;  2JSX A;  4CLK A;  4JI2 J;  1SUQ B;  5LM7 E;  3R7S B;  4QR2 A;  2CJB A;  2I5J A;  1REV B;  2EKN A;  4R25 A;  3M05 A;  4JI7 J;  3CJ2 A;  1NJX A;  1CC7 A;  4DS4 A;  4DPU A;  4I64 A;  3GIM A;  3GQC A;  1QVF R;  4CLF A;  1XIQ A;  2DB1 A;  3FSI A;  2KL8 A;  4HHJ A;  1EAY C;  2VPY B;  3RBD A;  4HAC A;  3EVM A;  3EXC X;  4IRC A;  3MM5 A;  1T8E A;  4Q0B A;  1MN9 A;  3IAS 9;  4A8Q A;  2HND B;  3PIP Q;  1IQZ A;  2OFG X;  5CYM B;  2HWT A;  2W7O A;  2BJ3 A;  3R5J B;  3PHT A;  4F4A A;  2XMM A;  2HGN A;  4U7U D;  4B3S F;  2FJX A;  5FDL B;  3BEG B;  1N32 F;  3FCV A;  2QA4 S;  4LSL B;  2IJR A;  4ZVO B;  3TEH B;  4ILM A;  2OMO A;  1HNV B;  4J9M A;  2CQP A;  3T3F A;  2RU3 A;  3GJT B;  1UVI A;  1JLB A;  2E7X A;  4B9N A;  4ZCK A;  1TKZ B;  2XSJ A;  1CUL B;  2XLK A;  5KFY A;  4FBU A;  4KYZ A;  4P2X A;  4PWD A;  1SQE A;  1P27 B;  4MYT A;  5E5N A;  4X66 J;  2LXF A;  3C8Y A;  2CQH A;  2JWN A;  2FVQ A;  1U6Z A;  1M5S A;  4ELT A;  3OTB A;  4PXE A;  1VCT A;  4LFC J;  3W2W B;  5KFX A;  3C6U A;  3UDE A;  2PA3 A;  2DR6 A;  4JI1 J;  2VQF J;  1KRP A;  1VHF A;  3HSZ A;  2MQM A;  5C7P A;  1F5C A;  1FER A;  3JYT A;  1RUS A;  1PIL A;  1NU4 A;  3MCM A;  2XY5 A;  5FD1 A;  3CDU A;  2BE2 B;  2CJY B;  1CS4 B;  4UQT A;  1VI7 A;  4ECQ A;  4DPW A;  4C9D A;  2FY1 A;  1YJT A;  5F3Z A;  3PW0 A;  3NL0 A;  1C1C B;  1SV5 B;  4WXW A;  4CNZ A;  4FP9 A;  3RB0 A;  3ZXW A;  4Q44 A;  4NRU A;  4D3G A;  4C8Y A;  1VQK S;  2GCF A;  4MKY A;  3J7Y U;  2QLF B;  2RT3 A;  2HLT A;  4KHP J;  4V1A k;  1X4D A;  1VYA A;  2XLJ A;  4NCA A;  5A0Y A;  3PTW A;  2Z2Y B;  3IM9 A;  3G96 A;  4AYB D;  4ZCI A;  1C1B B;  4NLP A;  3G6V A;  2D7S A;  1VOM A;  3KHR A;  3ETM A;  1X9S A;  4OZ3 A;  4K8R A;  3ZTP A;  1R8A A;  3W7B A;  5D0H A;  2W01 A;  2RH3 A;  4TY8 A;  1DQ8 A;  4X64 F;  4ZOS A;  2PMH A;  4RX6 A;  3T1H F;  3I5B A;  1U2F A;  4GVB A;  4ER8 A;  4G1Q A;  1RT6 B;  1I5O B;  3QIP B;  2YKM B;  5B0B A;  4DI6 A;  1S5Z A;  1U02 A;  2C2M B;  3W8G A;  2C2N A;  1IBL F;  2OPR A;  3SYZ A;  2RS2 A;  2B4O A;  3W63 A;  3PRV A;  3GII A;  2K3I A;  2F4V F;  3J7A N;  1FJC A;  2NUH A;  1CLF A;  5DZ7 A;  1EQM A;  4UUW A;  5KT2 A;  3AXM A;  2ZKT A;  1AZS B;  3ZNU A;  2OHD A;  3CJ0 A;  4XAK A;  3SSR A;  3LGM A;  3RG6 A;  5A6P A;  1XMB A;  2UUC J;  1SJQ A;  2UUB J;  2KG1 A;  1U1R A;  4CDI A;  2A10 A;  5ETK A;  3M32 A;  1KC8 T;  1U1Q A;  3BJY A;  1U25 A;  5KFN A;  1T0T V;  4YFU A;  3CTR A;  3MOJ B;  3ILL A;  5F8G A;  2ZDO A;  1WJ9 A;  5CD4 A;  4CT9 A;  4DCO B;  3OR2 A;  3NGD A;  4IFV B;  2DO0 A;  3IMQ J;  3W5Z A;  4OYI A;  5T41 A;  3LWL A;  4B3M J;  2BAB A;  3CDE A;  2ZDP A;  2G0C A;  1NND A;  2QT7 A;  3R5G A;  4H4M A;  3MPD A;  2QA4 G;  3IM8 A;  4OV1 A;  3N5F A;  2IJF A;  2GA7 A;  1S1V A;  1JJ2 R;  1HNW F;  3GSD A;  5D3G A;  2WK4 A;  3ET6 A;  5ETL A;  4QOT A;  1TK5 A;  1GH8 A;  1KSP A;  4KO0 B;  4PYD A;  1JLF B;  2BKN A;  5F9N A;  4DR4 F;  2I5J B;  1RDR A;  3KNA A;  1VDH A;  2ZH8 A;  2HGL A;  3UN5 A;  1R8H A;  4EMD A;  2HHS A;  2H48 B;  4P2M A;  3NCQ A;  1HNI A;  4LQ9 A;  3OR1 B;  2DT9 A;  4HKQ A;  1WTB A;  4ZHR A;  5E41 A;  4TLR A;  4YHH F;  3DDI A;  4OI2 A;  1P9Y A;  2W2P P;  2BW2 A;  2KFN A;  2AEJ A;  1BY9 A;  4DSI A;  2AX1 A;  4KV8 A;  1APS A;  2W2N P;  3DRR B;  2W2Q P;  2OD4 A;  1S0M A;  1XBW A;  3BH7 B;  1ZTT A;  2M52 A;  4BWM A;  1I1G A;  2ZJR Q;  2VG6 A;  1X4B A;  2JDJ A;  1Q86 T;  2QV6 A;  4KT0 C;  3TUZ C;  3HO1 A;  1SH0 A;  3RTV A;  4W90 B;  3JS9 A;  3CDB A;  4P71 A;  5FII A;  2FLP A;  1SJR A;  1W7W A;  1JNZ B;  2AJ0 A;  2BDP A;  3HT0 A;  4K5S A;  1DJ0 A;  2QL5 B;  5KFJ A;  1IKV B;  4CQ1 A;  1NME B;  2XSJ B;  4EI2 A;  2KM8 C;  2DXE A;  4IOA Q;  1HL6 A;  1RT7 B;  4PWD B;  1BQX A;  2D41 A;  3HVT A;  1IQT A;  4TYB A;  4RW9 B;  1T3N A;  3CWJ A;  4L73 A;  2MQO A;  3GJS B;  2YNF B;  4CH7 A;  1PYO B;  2L3M A;  5D4O A;  4MIA A;  3E3X A;  3K58 A;  2ZE2 B;  2UV8 A;  2MZS A;  2W7A A;  1RT4 A;  2XI2 A;  1X31 C;  3GV8 B;  1R89 A;  5I3P A;  4KH1 B;  3QZ8 A;  1HHS A;  3KUG A;  3CC7 S;  2E1R A;  4EU0 A;  2YNI A;  1WEX A;  3KK3 A;  1NPP A;  1SJ3 P;  2OD6 A;  3M8Q A;  1RLD A;  2BBE A;  1RTD A;  2ASD A;  2IYG A;  1N36 J;  3MR7 A;  3FEZ A;  2ASL A;  1R0C B;  4IOC Q;  1PGZ A;  5C42 B;  2DPJ A;  1LEO A;  2OSR A;  1GT8 A;  4BLG A;  1Q8K A;  3NEK A;  3OSP A;  3K8V A;  1LOU A;  5GAG I;  1MNE A;  2OJ3 A;  4KE5 A;  1JJH A;  2QLJ B;  5GMK a;  3FNN A;  1TL7 A;  4U67 Q;  4IUF A;  2V6A A;  4DCJ B;  2YKO A;  2XQC A;  2K8G A;  2JVO A;  3ENW A;  3BKT A;  2HYI B;  2V8H A;  1C2P A;  3ZTO A;  1TL4 A;  5E3Q A;  4GVB B;  1MRO A;  3D1Q A;  2O5D A;  2AYG A;  3PFO A;  2N4C A;  2FTR A;  3G6X A;  3RBX A;  1VQ8 S;  3M2U A;  2ATL A;  1Q1K A;  3QT5 A;  1S6P B;  4DL4 A;  2FJD B;  4LIR A;  3TAQ A;  1UPM B;  2HS4 A;  4CM0 A;  4DV0 F;  2FB0 A;  1FK9 B;  2UVR A;  3NGR A;  2DCL A;  1F1B B;  2XMK A;  2J9D E;  5GME A;  2GMJ A;  5J2N A;  2DJW A;  4KGV B;  2XCP A;  3QJP A;  2LXU A;  5IWA J;  3TJ8 A;  1I51 B;  4AL7 A;  4OZ1 A;  4DPY A;  4FKY A;  2V4J B;  3Q8R B;  2R7U A;  3CJ8 A;  4M5I A;  3BM7 A;  2NYH A;  4QR1 A;  5KFW A;  3BGF A;  1PC5 A;  3ISZ A;  3RB3 A;  2DEJ A;  2DGQ A;  2LA4 A;  5C2G A;  5BJR A;  4J9S A;  5G0R A;  5D78 A;  2MKS A;  4OZ2 A;  2RRN A;  3DRP A;  2U2F A;  5DLF A;  2QN6 B;  4QIG A;  3MM7 A;  2LQ8 A;  4HHU A;  1UJ6 A;  2RIL A;  1F60 B;  4USJ C;  5THW A;  1UVN A;  1CG2 A;  3DHW C;  3H20 A;  2Y8W A;  2L41 A;  3HHE A;  3FFI B;  3CCW A;  2BQR A;  3QSY B;  3GYG A;  2VDH A;  4JOU A;  1NK7 A;  3P5T L;  4JV5 F;  3U7J A;  2QEX S;  3K2Y A;  1WOO A;  5KTQ A;  3Q8Q B;  2JHE A;  4MH8 A;  4LRA A;  1NPR A;  1WF1 A;  2ZH6 A;  3UD4 P;  2MZR A;  5DQI A;  3B82 A;  3UWT A;  5E3A A;  3PO5 A;  3I56 S;  1SKW A;  4ZHR B;  5C25 B;  1IUJ A;  4OYZ A;  3I9Z A;  4P10 A;  1RGV A;  2D74 B;  4DUY J;  2MKI A;  3CD5 A;  4WZM A;  4HHH A;  2MKH A;  4CLP A;  1S12 A;  2CQ2 A;  3IGN A;  4PQU A;  5LXR A;  4D3H A;  2DXD A;  3FBC A;  2DEI A;  4C7Q A;  1Z2L A;  3FKB A;  2VG6 B;  4EBE A;  2XGP A;  4NXM F;  4OI6 A;  2Y1L B;  1IJF B;  3GV5 B;  2VIH A;  3J81 U;  2LQ9 A;  3M4X A;  1GMV A;  3MFH A;  2KT5 A;  1XNQ J;  1YK9 A;  1YLX A;  2DO4 A;  3CC4 S;  3J81 Y;  1H2T Z;  4DQS A;  4IR1 A;  1JLC A;  1U48 A;  1NHK L;  4IFY A;  5JVH Q;  3DHX A;  4DR2 J;  3AHP A;  2LU2 A;  2G1H A;  2CPX A;  1AFI A;  5JXS A;  1NJZ A;  1RI7 A;  2F65 A;  1SC1 B;  4X62 J;  4RW6 A;  3R3T A;  1F5A A;  2M9K A;  2IDL A;  4EYH B;  1M5O C;  2I1R A;  1SBR A;  4OYO A;  4YDD B;  2QG9 B;  2FC8 A;  2WCX A;  1D3W A;  1RT2 B;  2F4F A;  4NWB A;  5L38 A;  2JJ4 D;  4HTI A;  2E1P A;  2ZUA A;  4C3K A;  4K2X A;  1WG4 A;  4HDG A;  3QAT A;  1CQN A;  4HEA 9;  1RT4 B;  1RTI A;  1GX6 A;  1BQM A;  2CJX B;  4A8X A;  2YNI B;  2EEY A;  2HQD A;  2OFH X;  2WSF C;  4Y2C A;  1PSD A;  2QTW A;  4ED3 A;  1EQ0 A;  2BXJ A;  1RTD B;  1W25 A;  2M88 A;  2CPI A;  1G2E A;  2H1Y A;  1WF0 A;  3QO9 A;  1XEZ A;  1RWP B;  5HQ8 A;  2BAN A;  1HW9 A;  4LF7 J;  4LFA F;  3M6U A;  1UEK A;  2JC1 A;  2DY9 A;  1KEK A;  4KTQ A;  4LIW A;  4JV0 A;  4NXN F;  4RU2 A;  3R9L A;  3RBZ A;  1M5P C;  1W2I A;  2UXB F;  2N4D A;  3NP5 A;  2CNL B;  3TAM B;  1KQK A;  2OGU A;  4MYU A;  4GRS A;  3AJD A;  2EFG A;  5KT5 A;  1FWL A;  1DTT B;  3U27 A;  2XMU A;  3CGI A;  3A8I A;  3W3S A;  3MEK A;  5LSR A;  5DGA A;  4NL5 A;  1RAJ A;  2HUR A;  2H51 B;  3JQJ A;  1P8G A;  3EUN A;  2R8J A;  5B0E A;  2WON B;  3M2U B;  2PN6 A;  3DMJ B;  5EWF A;  3H2U B;  2H65 B;  1H72 C;  3KK1 B;  5A8W A;  2JRS A;  2F3J A;  3KDN A;  4TU8 A;  2JEJ A;  1ZAW A;  4J9N A;  1EZZ B;  2QSF A;  5H1S V;  4KBI A;  2LQ5 A;  4LF6 J;  1SH3 A;  1SQF A;  2X1F A;  4DN9 A;  3TVZ A;  2QX0 A;  3IA0 A;  2M0G B;  4XDC A;  4ETX A;  2RUS A;  5IXU A;  2AW0 A;  2R8G A;  2FHK A;  5IV4 A;  1LFP A;  3CJ3 A;  2ACY A;  1BHN A;  5D4N A;  3OW2 R;  1HYS A;  3FVY A;  1H7W A;  3R5D A;  3IN5 A;  3CIM A;  4EO6 A;  4XTT A;  1N6Q B;  2YWW A;  2O1P A;  4MK9 A;  1N33 F;  1S99 A;  4K4U A;  1TZ0 A;  4DX8 H;  4Q43 A;  2DH8 A;  1MSW D;  4QIV A;  1K44 A;  5HSP A;  4LF4 F;  2HMI B;  5J1E A;  1KFD A;  3PVX A;  2ZC3 A;  2UU9 J;  2VFU A;  1JLE A;  2BJE A;  3MM7 B;  3Q8Y A;  3PKM A;  1RT3 A;  4NML A;  3RZA A;  2YWK A;  2XGQ A;  3FCW A;  3V6D B;  4ED5 A;  1Q5Y A;  3D2W A;  4ES2 A;  4J90 A;  2Z58 B;  3SFG A;  1PAU B;  3PHE A;  4F25 A;  5KFG A;  5D8H B;  3MM9 A;  2FVP A;  1NK8 A;  2VBZ A;  3ZFV A;  2BJD A;  1QVG R;  2NXC A;  3QWP A;  1Q8I A;  2CQI A;  4IG3 B;  3HDS A;  2ZBQ A;  1R8P A;  2KM8 B;  3IC1 A;  2OPP A;  2XS2 A;  3KUE A;  1YX2 A;  2J6U A;  5J2P A;  3L9Z A;  4XPE A;  4O0N A;  3G8T A;  2DBB A;  2VG7 B;  1ZPV A;  2YNH B;  3M8Z A;  3ELH A;  4ZPD A;  5KG4 A;  4K4W A;  4PQU B;  1UEU A;  2WBM A;  1KKH A;  4YB7 A;  4J9P A;  4PZV A;  2V2Z A;  4OX7 A;  4NMX A;  3DOK B;  3CCL S;  3T9N A;  1E6V A;  4DZD A;  3CCS S;  4O4G A;  2IA6 A;  2CQG A;  3AAW B;  3ZZY A;  3NGU A;  3NBP B;  2YWH A;  1XNR J;  2V69 A;  2RVJ A;  1JLC B;  4DQR A;  3DDN A;  1RCO B;  3OUY B;  1B0V A;  1TV6 B;  5ETR A;  4IFY B;  3R2C J;  5HBM A;  1FFS B;  4B9S A;  4EZ9 A;  4LR8 A;  3D0I E;  2O01 C;  1BE4 A;  3NLC A;  1X9M A;  4X2B A;  4RUC A;  1N0V C;  3DLE A;  3VGS A;  2M4M A;  1XMQ F;  1UP1 A;  2QMX A;  2IY5 B;  3BDE A;  4XIU A;  1L3T A;  3MMA A;  2HEK A;  4ELV A;  3C14 B;  2V0N A;  1GTE A;  1FO1 A;  3HP6 A;  2MLZ A;  1I6J A;  5F8I A;  4X4Q A;  2J5A A;  3MUT P;  4B3T F;  5IQQ A;  4WXO A;  4ZVS B;  5HMY A;  3JSB A;  3N9U C;  2EBE A;  1Q82 T;  4GKK F;  4R8U A;  3MR5 A;  3G6E S;  3OV7 A;  3P3D A;  1IBK J;  4FVC A;  1TL3 B;  4ZP9 A;  3MCS A;  1J27 A;  4AL6 A;  2HRY A;  3PEJ A;  2J0S D;  3V6H A;  3V4I A;  1WC1 A;  4WP3 A;  1NUE A;  4M5D B;  4DR1 J;  4LMZ A;  2OKQ A;  3R6L B;  1QJH A;  4IG0 A;  2RSQ A;  4AND A;  1HWI A;  4ID5 A;  2LCW A;  4ZK7 M;  4FVM A;  5BYS A;  2AF6 A;  1RAH B;  1T9Y A;  2SXL A;  2JFD A;  1Q5V A;  4OX8 A;  2WSC C;  3FC9 A;  4N5S A;  3I0R B;  3K5P A;  1JXL A;  3JTP A;  2WRM A;  5DGB A;  2J0W A;  5EHH A;  3NNC A;  3QPI A;  2IFX A;  1YKW A;  4U9R A;  1JK9 B;  4TQS A;  3GIK A;  3KG0 A;  1VQ7 S;  1OY8 A;  3Q0A A;  3HFV A;  4ID8 A;  4NLU A;  4IH7 A;  3TQ1 A;  3T6B A;  4OZN A;  4LF5 F;  2H3E B;  1ZOT A;  2V8V A;  5DM7 Q;  3NGK A;  5LT5 A;  4USU A;  2ZKU A;  1PJ5 A;  1TFW A;  4WKY A;  3G87 A;  1ZZF A;  2I8E A;  2UUA J;  4NLR A;  2CKW A;  2BX6 A;  5CZX A;  1FX2 A;  3W9I A;  3PYE A;  1OS5 A;  3R7B B;  1N5T A;  1FRI A;  5CQG A;  4NYZ A;  1RYS A;  4B17 A;  2LQJ A;  3MOZ A;  3QSI A;  1S9E A;  4HTJ A;  2WOM B;  4QWE A;  1S1U A;  2B3T B;  4CO4 A;  1YJV A;  1UA0 A;  4MK7 A;  3PRD A;  4KY3 A;  3EDR B;  4FZV A;  4V19 J;  2HFV A;  2I0X A;  4ITS A;  3EGN A;  3NS5 A;  4P9S A;  4RU9 A;  4F2S A;  2FHM A;  2YWF A;  4O44 B;  3FSX A;  4EFA C;  4QPX A;  2HQC A;  3Q22 A;  4DV2 F;  2VA3 A;  2E1A A;  5E3R A;  2HZV A;  3BPD A;  1MWY A;  3CDA A;  1R0B G;  2K2P A;  2GHP A;  3CUL A;  3QBC A;  4DX7 A;  3OVS A;  3Q86 A;  4CZC A;  3JTO A;  4KHR A;  1G6B A;  1LWF A;  2F40 A;  5D15 A;  4F0K A;  2Q3P A;  4G1I A;  3A13 A;  3LP0 B;  2L08 A;  2GMH A;  2E29 A;  4F04 B;  4UOF A;  4WK3 A;  3IS9 B;  2OAU A;  4OJ3 A;  5HRO A;  1N54 B;  5HJY A;  3QLH B;  1I3O B;  4LQ3 A;  2V9W A;  3SI8 A;  4W98 A;  2N7C A;  3KLF B;  2ZIT A;  4RW7 B;  2G4B A;  4OQJ A;  5KG6 A;  4FXW A;  2LEP A;  2CVI A;  4BCA A;  4WF9 Q;  2QO3 A;  3D3B J;  1UFW A;  2OPP B;  4IRK A;  3EX7 B;  1FD2 A;  2Z2M A;  4Y0F A;  3P49 B;  4DUT A;  2DIT A;  6FD1 A;  1UEV A;  1D9A A;  1RWV B;  4ZJL A;  1LW0 B;  1ZPW X;  2HNZ A;  1RHJ B;  2F8E X;  4Z37 A;  2KZZ A;  1EP4 A;  1KD1 T;  3IO1 A;  1ZM9 A;  2C3M A;  2B6A A;  5I3U A;  1S72 S;  2B4U A;  1VBY A;  1T9X A;  1N52 B;  4WZQ A;  3M6X A;  4A8W A;  1RLC L;  2RKI B;  3TEG A;  3EZ5 A;  1E6V B;  3A3N B;  4HT5 A;  1H6K X;  2R8I A;  3S6E A;  3CCR S;  3R8Y A;  3KHH A;  1MWZ A;  4ECZ A;  5DJB A;  2AGO A;  3VAL A;  5K14 B;  3KJN B;  4A47 A;  3FGV A;  1TFY A;  4O3Q A;  1HKA A;  1IBM J;  4DV1 F;  3W60 A;  3OLB A;  1U2R A;  1XER A;  4B9L A;  3FBB A;  4NEZ A;  1R27 B;  3KLE B;  3DLE B;  2HHV A;  5KG5 A;  3K0J A;  2ILY A;  2ZH7 A;  3MMA B;  2MQQ A;  1UKU A;  4BC9 A;  4N8N A;  3CT9 A;  1Y4Z B;  4DV5 F;  4WFN Q;  4L75 A;  2D69 A;  1A7G E;  2CUY A;  1TK0 A;  3HHK A;  5KFP A;  1S57 A;  2C2Z B;  4RW4 A;  1U1N A;  2CAD A;  1UWB A;  3TUJ C;  2EW9 A;  2DGS A;  1HBO B;  3MMB B;  1Z1Z A;  1OQ6 A;  4RNF A;  3BGR A;  2ADB A;  1UZH A;  3I9V 9;  2D3O 1;  2ABY A;  5ITH A;  4F4Z A;  1QSL A;  5ETV A;  2HQ3 A;  3V4I B;  3VAH A;  2B56 A;  2Q66 A;  2FJV A;  3NRB A;  1VIS A;  4I56 A;  4IG0 B;  4DSL A;  3JSM B;  4TN2 A;  3ENV A;  1U1O A;  3PEH A;  1RBL A;  2HBR B;  5ETS A;  2MKK A;  2XG8 A;  3OHB A;  3D6M B;  3PNI A;  1IJE B;  2PII A;  4UY8 5;  3B78 A;  1FEH A;  2ROE A;  1HWK A;  4X4V A;  4X65 J;  3G2X A;  1TMM A;  4NYO A;  3VVT A;  2M8H A;  2CJA A;  4A8Y A;  3UDV A;  2J6S A;  2QRR A;  2KB2 A;  2MB0 B;  1NM2 A;  1S7H A;  3MI7 X;  1TUW A;  1UET A;  2AT1 B;  4PUO B;  2GS8 A;  5J2Q B;  2GHV C;  4J9U E;  2VQE J;  2DNP A;  2UUW A;  3I4H X;  4X4S A;  5CXT A;  4KQZ A;  4CO0 A;  3FEY B;  3JQM A;  1LXN A;  3HVW A;  5GAH U;  4PPD A;  1YG0 A;  3THV A;  3UE2 A;  4RWX A;  1HPZ A;  4DXL A;  4PG7 A;  2E5I A;  1U1M A;  1U8S A;  4H4K A;  3MR2 A;  4NLY A;  3T5H A;  2UXD F;  5KFC A;  2BE7 D;  1WG5 A;  4HL9 A;  4UT4 A;  2XEX A;  2W9C A;  3N4W A;  3TW0 A;  2LLZ A;  2EFQ A;  4JYA F;  1AA1 B;  4FF1 A;  1RU1 A;  2EFP A;  2DYA A;  2MKC A;  4MKB A;  2ZUG A;  5KG1 A;  3IR5 B;  1R0A A;  3A1Y G;  5DDQ C;  4E8U A;  2CWX A;  2DRD A;  4NLS A;  5A76 A;  3IRX B;  3TI0 A;  3DLL Q;  3W66 A;  3KK2 A;  3HKW A;  4K4Z A;  4WYW A;  4URG A;  5CA5 A;  1YQH A;  3RJM B;  2DHA A;  2AWZ A;  1HD0 A;  3V81 B;  3VAJ A;  3LP2 A;  1Y9O A;  1W26 A;  3L7U A;  1NB2 A;  2G2Y A;  4M95 A;  3UN3 A;  2MJU A;  2WVC A;  1T03 B;  4EUV A;  1FNO A;  2WW8 A;  3IR6 B;  1NJI T;  4ZVE A;  4ZDN A;  3RR7 A;  1FRL A;  4DJB A;  1CJU A;  4CT8 A;  2HQI A;  3BZQ A;  1UVM A;  3BDP A;  2D9O A;  2FJB B;  3MAQ A;  1LWF B;  1IKY B;  3I4P A;  1KLM A;  1SC4 B;  4WFB Q;  2ZVS A;  3WBZ A;  1JXE A;  4YDX A;  4JI4 F;  2D3O R;  1T05 A;  2XHW A;  2XY6 A;  1GAO A;  2VIC A;  5BR8 J;  3VTI A;  4FDF A;  3G82 A;  2H54 B;  4AE5 A;  3QRQ A;  1VJQ A;  4YB5 A;  1C0T B;  8ATC B;  4JI3 F;  1JQG A;  1RTJ B;  1WSR A;  2OPQ A;  1NPK A;  2R2U A;  3AOD A;  2V2K A;  4NLV A;  2FC9 A;  3C16 B;  1T7P A;  2HIQ A;  4ZA1 A;  2J8S A;  3CCV S;  2GGP A;  3FZB A;  2IIH A;  1N34 F;  2Z56 B;  3AXK A;  2EFV A;  4J9O A;  2ZC4 A;  3QID A;  1FT8 A;  3DLB A;  1VRQ C;  3CED A;  2AZ1 A;  2B6A B;  1FTC A;  2EVZ A;  3SIP B;  2UVV A;  5I4M A;  2UVU A;  2FVC A;  2B9W A;  3GYN A;  2OPS A;  4ZJQ A;  3EYZ A;  3HXM A;  5HN0 A;  2CJK A;  4WBF A;  4CLT A;  3PYD A;  2XCA A;  2KDO A;  3OXG A;  1B3T A;  1VRU A;  2KFZ A;  2LYV A;  2Q1L A;  1RWM B;  2DY1 A;  3SEO A;  1KQG B;  2DNM A;  1XMO J;  5DRK A;  3SQG A;  3EMT A;  3MM6 B;  1UZD A;  1EIY B;  7AT1 B;  1NRK A;  2FD2 A;  5HLF A;  4DPX A;  3OLA A;  3MMC B;  1LQ9 A;  3R2D J;  4LSZ B;  4FYW B;  3OTE A;  1I94 F;  4B3O A;  1Z4U A;  3D68 A;  4M63 A;  5JJB A;  4FF2 A;  1V5I B;  1WC0 A;  4R5P A;  3TX0 A;  2MSS A;  3GIL A;  1WKK A;  2Y1R I;  5K8M A;  2BE9 B;  4M1K A;  4OYM A;  3ZZZ A;  4IO9 Q;  3BN4 A;  4E2F B;  1Y7P A;  1P1T A;  2VBW A;  2NPF A;  4K0K F;  4ED0 A;  1PJ6 A;  2DGV A;  4OI3 A;  2X51 A;  1RAB B;  4DPT A;  4XO0 A;  2QA2 A;  2DRA A;  3HJV A;  2C2D A;  4ZLN A;  1F5B A;  3M7V A;  1ZET A;  1N5V A;  1GXT A;  1TTH B;  5KFE A;  5KG7 A;  5DM6 Q;  1VQL S;  2CZV C;  2DH7 A;  1CC8 A;  1RTZ A;  4UF4 A;  1HNX J;  1ULR A;  3MEG A;  1ZAX A;  2L48 A;  2RRA A;  1KVK A;  3CVK A;  2C3O A;  4DR5 F;  5M2R A;  2DNQ A;  5L9X A;  3OTO J;  5CD4 H;  1H73 A;  1Y10 A;  1V6H A;  4OX6 A;  2HHH F;  3IAM 9;  4TLQ A;  5H9F J;  4JI0 F;  4ZVG A;  2AZ3 A;  1Q16 B;  2CDR B;  2DGT A;  1OYD A;  4K4S A;  4AXI A;  2CPZ A;  3CJK B;  4S0M A;  1FHT A;  4DSF A;  1LKZ A;  2UV8 G;  1YRU A;  4X84 A;  3Q8U A;  4DV3 F;  3TZX A;  2ZZT A;  4QIW D;  4WE1 A;  5F9L A;  1S0N A;  5HAT A;  2FVS A;  1M5V C;  3E2E A;  4RBT A;  3E01 A;  3CO9 A;  4AT1 B;  1QUP A;  2W4D A;  3QZ7 A;  4Z7C A;  2VFS A;  3EM1 A;  1F2H A;  3VF0 B;  3DLG B;  4YOE A;  4M94 A;  4DEZ A;  3PAC A;  2K06 A;  5IT9 U;  5GAE U;  3HFK A;  5AJ3 J;  1CVJ A;  4PG6 A;  2HKE A;  4MIW A;  3K7R A;  3W2V A;  2HPU A;  3PKY A;  1RBO B;  3RBE A;  5IT9 Y;  1SKU B;  1VS3 A;  2EI5 A;  3VAF A;  3JAM U;  3BH6 B;  3PO4 A;  5F3T A;  2FPH X;  2EG1 A;  2XC9 A;  4TQR A;  1URR A;  3VGT A;  1LWX A;  4CTA B;  1O6X A;  3MAA B;  3CCZ A;  3LP2 B;  3OPK A;  4DCP B;  2NUU G;  1TP7 A;  2PFF B;  1MN7 A;  2ILZ A;  1WHX A;  2MKJ A;  1RYR A;  1A9N B;  3K5L A;  3QYY A;  4N56 A;  1NSP A;  2P8I A;  1RWK B;  4TXS A;  3NGS A;  1FX4 A;  4PWU A;  3EPI A;  1IM4 A;  2EFN A;  1GFW B;  4FF3 A;  3K89 A;  2IMW P;  3M30 B;  2I6W A;  5EDW A;  4I0W A;  1ZM4 A;  4DR7 J;  3BR8 A;  3P45 B;  3N6L A;  3TJ9 A;  4NLO A;  5ETT A;  3KG4 A;  1KLM B;  3HT3 A;  4ANC A;  1S4E A;  1JLG A;  3WC2 A;  2BRL A;  2R3V A;  4ZPT R;  4CO3 A;  2BJ1 A;  1S48 A;  3FK4 A;  3MEC A;  5DZ6 A;  3DRX A;  1YJR A;  3HD1 A;  1C4A A;  1IM6 A;  1GNK A;  3F73 A;  1HMV A;  1XR5 A;  2IRU A;  2CNO B;  1PG5 B;  1WDT A;  2OPQ B;  3H90 A;  2OEK A;  3GFY A;  4LVN P;  2ROG A;  3D6H B;  3CCU S;  2GGP B;  3A4T A;  4JBC A;  3T6J A;  4IYQ A;  3CB4 A;  2KI2 A;  2HVZ A;  4JI2 F;  3R1L A;  4U95 A;  4LBI A;  3CMA S;  3AFG A;  3MUM P;  3FBE A;  2NPI A;  5ADZ A;  2KT3 A;  2H5E A;  3KWM A;  1QSS A;  3DYA B;  2W2O P;  4JI7 F;  3EDQ B;  1FFW B;  2I2Y A;  2MYF A;  2C2O B;  3A12 A;  4GMK A;  2OPS B;  1VBK A;  1WHW A;  1FDA A;  3ULH A;  4J9Q A;  4Y2A A;  2WVB A;  2BMB A;  2IAJ B;  3V5R A;  4TY9 A;  5KAK A;  3WX8 A;  3SZ2 A;  3LAN A;  1S1W A;  3UCG A;  3G4S S;  1JLA A;  2CZ9 A;  2DHG A;  4HR2 A;  2RQ4 A;  2ZH9 A;  3GFZ A;  2VKZ G;  1S1T B;  2ZOF A;  1VGY A;  1X9W A;  3UDC A;  3P5B P;  2DGW A;  5DO2 A;  4EBC A;  4R5P B;  1YDL A;  2MLY A;  3DOM B;  1RTH A;  2VBY A;  4K50 A;  3OTD A;  3C15 A;  4DL6 A;  3GTY X;  3PR5 B;  3MED B;  7FDR A;  4O3O A;  3V2U C;  3EVO A;  2M3D A;  3MZI A;  3OXF A;  2DGX A;  4EBD A;  2CQ0 A;  3AJ2 A;  3UQS A;  1S1X A;  3CUN A;  2GIR A;  4C8Z A;  4NA3 A;  2DNH A;  4XK8 C;  2CQ1 A;  4DR6 J;  2CAJ A;  5HK4 A;  1Q4R A;  1KS2 A;  2JEI A;  3P4U B;  4OHX A;  4DFM A;  1DTQ B;  3W64 A;  4OHV A;  1EX8 A;  3CO0 P;  5DLG A;  2YKA A;  3V4M A;  2HVI A;  1IKX A;  4LFC F;  1HBM A;  1TUV A;  2QZ8 A;  2CPE A;  3NMA A;  3MEG B;  4JI1 F;  1A6L A;  2VQF F;  2OEM A;  4IQM A;  4WYL A;  4KH0 B;  3M8W A;  4J9R A;  1KWM A;  3DGP A;  2RDD A;  4N77 A;  2CA9 A;  2KHD A;  3QMQ A;  2GJ2 A;  3M2R A;  3VAK A;  2P9G A;  3HUL A;  3ZZT A;  4O3R A;  2J0X A;  1TU0 B;  1L3S A;  4A8S A;  3AD8 C;  2E7W A;  1N33 J;  4M8L A;  1OIA A;  2DNL A;  4EK2 A;  1OPZ A;  1SJ4 P;  1RWU A;  2PT0 A;  5I42 A;  2HVD A;  2GQC A;  1WKL A;  3NMR A;  1RA6 A;  2EBG A;  4P52 A;  3ZC4 A;  4KHP F;  2HVE A;  3FQK A;  4QQB A;  4ZMM A;  5KFH A;  3T5J A;  5KFM A;  3TO8 A;  3B6B A;  4YN3 B;  1WG1 A;  2OSQ A;  3IWN C;  2YY3 A;  3N5B A;  1YIJ S;  4NCG A;  1U2C A;  1RWO B;  2C28 A;  1TKT A;  2YQ3 A;  3GLJ A;  3SSS A;  3JXO A;  5AE3 A;  3ISN D;  1X60 A;  2CPD A;  4RW8 B;  2R7R A;  1X5P A;  1HWL A;  2F8M A;  3GCX P;  1CJT A;  2RHQ B;  4C3M A;  2CDQ A;  4LBP A;  5L9N A;  2QL9 B;  5GAH I;  1V3Z A;  1P9Q C;  2EPI A;  2DNO A;  4ZLJ A;  4G3I A;  1R3N A;  5KFI A;  4PKD B;  1MWQ A;  1FE4 A;  3H8Y A;  3UO0 A;  4DR3 J;  4ZVH A;  2XS7 A;  2V4Q A;  2P9E A;  3BRE A;  3DM2 A;  3LWM A;  4ELU A;  4F50 A;  4GVL A;  2E9R X;  2R8H A;  2O66 A;  3MM8 B;  1LXJ A;  4Z2X A;  2YQ1 A;  3HI9 A;  1MMN A;  4DV7 F;  3EGV A;  1U47 A;  2VAS A;  3W65 A;  2VU5 A;  2LEA A;  1EB0 A;  3M6W A;  4ED4 A;  3VGV A;  4K4T A;  2KYZ A;  3BKF A;  4RUB A;  4DS5 A;  1FRM A;  3TP2 A;  2QGF B;  3ZZO A;  1JLG B;  2QA1 A;  2UUC F;  1SL2 A;  1W2B R;  4FF4 A;  4PEO A;  2UUB F;  1NJY A;  4QIF A;  3BS9 A;  3K57 A;  4I2P B;  1FKP A;  4LBH A;  1HMV B;  4ZS6 A;  3MCN A;  1ZZN A;  2PGC A;  1JKH A;  1WAC A;  3DOL A;  4C3L A;  1B99 A;  1WC4 A;  1R31 A;  5D4P A;  4FS1 A;  4ECX A;  1Y5L B;  1NBE B;  1ELO A;  2GJF A;  3NKY A;  3SQO P;  3LH2 S;  1MW7 A;  2R7S A;  4LSN A;  4YME A;  3G86 A;  3EXY A;  2G2O A;  2UXC J;  4DL2 A;  3ONQ A;  2G2Z A;  3GR1 A;  4B3T J;  4CH0 S;  3TAR A;  3KLH B;  3GJQ B;  4V19 X;  1E6Y A;  1FKO A;  1PBA A;  3I32 A;  5HI7 A;  2J7U A;  3W62 A;  4N47 A;  4HLB A;  4UY8 T;  5T7L A;  3JB9 k;  2P5V A;  3MHY A;  4RBV A;  1IXK A;  3AH6 A;  3QT6 A;  1XK8 A;  4DQQ A;  3UVJ A;  2UP1 A;  4LF8 J;  1XR7 A;  3LO3 A;  2ZZM A;  2NZC A;  5IT4 A;  4PR6 A;  3CJ4 A;  1NHU A;  2W4P A;  2P9C A;  2ZH1 A;  1GTH A;  5A8R A;  3HM9 A;  5AXK A;  1IR1 A;  2ZJQ Q;  1NKE A;  5KG2 A;  3H42 A;  2E66 A;  5D0R A;  1YI2 S;  1XJW B;  1JLA B;  2NXE A;  1LK5 A;  1TAQ A;  2AJ4 A;  3Q8V A;  5I3Q A;  2W25 A;  4OFZ A;  2RQK A;  4C11 B;  2YKP A;  3R5C A;  3KNG A;  3RGI A;  3QT8 A;  4LT6 A;  1HQU A;  1N4L A;  1C4C A;  4K4X A;  2V2Q A;  1RTH B;  4QU7 A;  1M1K T;  2JNJ A;  4I2Q A;  2AKW B;  4CRJ A;  4F26 A;  1NK9 A;  1S76 D;  1BMQ B;  5GMD A;  1NEE A;  2V8D A;  1NZA A;  2B9E A;  1HR0 J;  1HFE L;  3D54 A;  1WC5 A;  5HVH A;  2LA6 A;  3H25 A;  1K9M T;  3H98 A;  2ZH3 A;  2HNY B;  4ZPV R;  3I5C A;  3HFZ B;  3IG1 A;  2X1G A;  1VRT B;  3SV3 A;  3HZG A;  2C3Y A;  3OL7 A;  2LKZ A;  1FNX H;  2ZH5 A;  2V50 A;  5A8K A;  4FBT A;  1R6Y A;  4DV6 J;  1SQG A;  2YX7 A;  4J9V A;  2V8G A;  1CJK A;  4NEY A;  1F2G A;  4G1P A;  5HP1 B;  3D6T B;  4J37 A;  5CH7 B;  4KKO A;  4DQP A;  3CMQ A;  4FYY B;  1N36 F;  1VHI A;  1UAW A;  4P75 A;  2B5J B;  5J2M B;  2MZQ A;  1EET B;  4KFB A;  1U49 A;  4Y2M A;  3MEE A;  1Q95 G;  1TVR B;  1GK8 A;  2RD5 C;  1KOO A;  4KSE B;  1K47 A;  2BV3 A;  2YNG B;  4O3N A;  2BJ8 A;  1RKI A;  1TKT B;  1S97 A;  3TOQ A;  2MGZ A;  1RWW B;  4YY3 J;  2DNG A;  1RHU B;  1RAE B;  3LW5 C;  4X4N A;  1GQE A;  2VOD A;  4F2R A;  3PDN A;  3C6T B;  1YJ7 A;  2CVE A;  5B0G A;  5L39 A;  1BWV A;  2DGO A;  2UUT A;  5L8R C;  3OD2 A;  2LU1 A;  3CJ5 A;  4IDK B;  2UZA A;  3L95 X;  2IM0 A;  5IV3 A;  5G4D A;  1BUX A;  4BDP A;  4H4O B;  1HD1 A;  1F3F A;  4USH A;  4UZB A;  2ZD1 B;  4GKJ J;  4OYP A;  2QYC A;  3Q2S C;  4PCQ A;  3GG1 A;  5IWA F;  3GP9 A;  2E1M C;  4DF8 A;  4LJM A;  3DRS A;  2E7V A;  2XMA A;  5LOQ A;  1KQS R;  4MKA A;  5RUB A;  1VJW A;  2XMV A;  3UNG C;  1UW9 A;  3E8O A;  1WEZ A;  2M70 A;  3WX4 A;  3ZTQ A;  2J76 E;  2ZM6 J;  2YKN A;  5LMU J;  3GSI A;  3SCL E;  1OYE A;  4KGM A;  4A4J A;  5FLX U;  1PO6 A;  1BLU A;  3BSA A;  5D4L A;  3C46 A;  4QBU A;  4KGK A;  3BB5 A;  3ILJ A;  1T95 A;  4LF9 J;  5FLX Y;  1DZ5 A;  1GXU A;  1U24 A;  1K0T A;  3JSY A;  4LSN B;  2L9N A;  3PJW A;  3PW5 A;  4MFB A;  3VGU A;  5L1K A;  4ZVT B;  2GVD A;  3LA0 A;  4DWI A;  1E6Y B;  1X5O A;  3HX9 A;  1G4C A;  3RU0 A;  1NB7 A;  1J5O A;  5ETN A;  3Q8S B;  3G71 S;  1M5H A;  1Q53 A;  3D28 A;  4HH1 A;  2C2E A;  3BGL A;  2J7K A;  4QWB A;  3W5X A;  4HAC B;  2B43 A;  3E51 A;  3MM5 B;  4Q0B B;  3FMB A;  3X3U A;  2OML A;  5IM0 A;  4F02 A;  3NY0 A;  4DUY F;  2DIS A;  5KT3 A;  2H5J B;  2QIF A;  4TNO A;  4A8K A;  3HHL A;  2VG5 A;  1H38 A;  1NXI A;  2Y8Y A;  1TL1 A;  1YVF A;  3PX0 A;  5E3P A;  2ZWP A;  3O2I A;  4WFY A;  3OXL A;  3ITH A;  3L7O A;  3HSD A;  3M8R A;  2HBQ B;  1U6B A;  4KAI A;  2Y1J A;  4Y3C A;  1PIE A;  2E44 A;  3I0S A;  5HAO A;  2YTC A;  4I69 A;  1HQU B;  1ZTW A;  1JLB B;  1C0U A;  3D1O A;  1F9F A;  1Y5N B;  5D0G A;  3GIJ A;  3BSN A;  1AB8 A;  3OVB A;  2CNK B;  2IRY A;  1QDU B;  1XNQ F;  5HAN A;  4I2Q B;  3UCU P;  1RJJ A;  5KFZ A;  3MPV A;  1CBK A;  4WU3 A;  4DV4 J;  5M2P A;  2KKH A;  4OMF G;  2MXY A;  1SC6 A;  1T3O A;  5CAB A;  5ETP A;  4DR2 F;  3NWG A;  3GFX A;  4ICL A;  4QYR A;  3ZZU A;  3C6U B;  5CYQ A;  4OLO A;  3K59 A;  5F8L A;  4AQY J;  4B3R F;  4X62 F;  2ZBI A;  2UXD J;  2CWK A;  3JYT B;  1WTF A;  4RZR A;  3N6M A;  2ZZN A;  4KIA A;  3CCJ S;  1HNZ J;  3AD7 C;  4I6Y A;  2XNR A;  3M1V A;  2EC2 A;  5KT6 A;  2BOP A;  1NDP A;  2PC6 A;  1FJE B;  2FHJ A;  1VC6 A;  1MLA A;  1AYE A;  5BXI A;  4DG1 A;  3O6Q A;  1TKX A;  4CH1 A;  5A8K B;  4YB6 A;  2FZC B;  2LP4 A;  2XWY A;  4ED2 A;  1CJK B;  5A0Y B;  3PX6 A;  2M2B A;  1RK8 A;  2KFY A;  3AJ1 A;  3I55 S;  1T94 A;  4OJ1 A;  1HQ2 A;  3GON A;  5L46 A;  5L1I A;  3M8Y A;  3H40 A;  2MDA A;  1DAR A;  4RPF A;  4LF7 F;  3MEE B;  7FD1 A;  4TY8 B;  1YSJ A;  1D0E A;  2KVQ E;  1S10 A;  1LWE A;  3PR4 A;  3POT A;  3OL9 A;  4NLQ A;  5JUM A;  1OSC A;  2R4F A;  1RB0 A;  4G1Q B;  1RAI B;  3UR3 C;  3AQO A;  4JUZ A;  3FZ2 A;  4NPO A;  1OO0 B;  1XR6 A;  4OI4 A;  1SL0 A;  3KLI A;  1B7Y B;  2OPR B;  1Y3K A;  3BYR A;  4IR9 A;  2FHO B;  4L6V 3;  4TYA A;  3ILI A;  4Y65 A;  4TU9 A;  3CNQ P;  2IVY A;  1FFG B;  5B09 A;  1N34 J;  4I7F A;  1U0H A;  3TA2 A;  3F41 A;  1H98 A;  3HHL D;  3NAH A;  3OVA A;  1SUQ A;  2IYI A;  3KMQ A;  4DPO A;  3CJT A;  2NZ4 A;  1U0S A;  2HWH A;  3JSR A;  2WVE A;  4Q8E A;  4EGL A;  2DCU B;  5K8N A;  1FCA A;  1IR0 A;  4B9T A;  3EGZ A;  2ACM A;  4C8N A;  4YR2 A;  4LR9 A;  3P6Y C;  5LMN J;  4KPC A;  3M32 B;  3BBF A;  1YWX A;  4AL5 A;  5KFO A;  1YTY A;  3OR2 B;  5HJX A;  1S79 A;  2GQ2 A;  4UOG A;  2GQQ A;  4WPA A;  1OY9 A;  1HWJ A;  4PWW A;  4F0H A;  2AYE A;  3W5Y A;  4H4M B;  5KFV A;  1SVD A;  2ASJ A;  5CYM A;  4U7U K;  3QNW B;  4Y00 A;  1VBX A;  3A8E A;  4C8K A;  2IC3 A;  3RAM A;  1S1V B;  5D3G B;  5FDL A;  2UU9 F;  1B70 B;  3VCD A;  2C22 A;  3ET6 B;  4OIX A;  3KLV A;  3KLG A;  4UW2 A;  1UVJ A;  4ZJO A;  4AUK A;  3OL6 A;  4Y28 C;  2R7O A;  4N76 A;  1HNV A;  4MFB B;  1AUS L;  3R97 A;  3TZZ A;  4DF4 A;  4CLY A;  2QFI A;  4YP3 A;  1XTZ A;  3D7S B;  4ED8 A;  2XHC A;  5CCL A;  2XY7 A;  1KTV A;  1HNI B;  3QAU A;  2DXF A;  3OFF A;  1TKZ A;  4TKT A;  1EJ7 L;  3BF4 A;  4QIE A;  1HBU A;  1R8C A;  3N01 A;  2DNY A;  2I9S A;  3DGV A;  4I6A A;  4QR0 A;  2OLW A;  2KJW A;  4KV8 B;  2A6M A;  1Y0H A;  4PYA A;  2GV1 A;  2E9T A;  4DUZ J;  1OJ4 A;  1VR6 A;  5HVF A;  3W2W A;  2RAQ A;  3HHL B;  1K73 T;  2HHU A;  1UL3 A;  3M9O B;  2GML A;  3MAH A;  4NLG A;  4NLD A;  1RAC B;  1BQN A;  4JV2 A;  3ITH B;  1S77 D;  2BE2 A;  1CS4 A;  2OO4 A;  4JV1 A;  4JI0 J;  4DFJ A;  1KR4 A;  3K17 A;  2CRL A;  1KVJ A;  3RB4 A;  3ZTS A;  1C1C A;  4NX9 A;  5GAG U;  1C0U B;  1QUV A;  3TYT A;  2BKO A;  1X0P A;  1SV5 A;  2A1B A;  4NLT A;  4OX9 J;  5FJ4 A;  4WKR A;  4OLP A;  4M5J A;  1GX5 A;  1XNR F;  4DFK A;  3TUI C;  2X1B A;  4M5K A;  2XO7 A;  3HVT B;  3VQS A;  2XSF A;  4CO5 A;  5IFM A;  1NH8 A;  1FJ7 A;  4I67 A;  1CJV A;  2O3D A;  1VMB A;  4C8O A;  4CWB A;  2I38 A;  1R43 A;  3HZE A;  4LFB J;  1FRX A;  3QFH A;  4CLZ A;  5B0D A;  1WEL A;  4QZV B;  2VHG A;  3ZZR A;  3TWZ A;  4JI8 J;  3F44 A;  3GZ7 A;  5HQL A;  1ROF A;  3TZW A;  2FZG B;  2HWI A;  1UJ4 A;  3SCJ E;  2FIU A;  3Q83 A;  3KK3 B;  3SV4 A;  1RT6 A;  2YKM A;  4FYX B;  4WP8 A;  3TRG A;  3M8Q B;  2IVM A;  4JI6 J;  4RWW A;  2V63 A;  1SB6 A;  1IBK F;  1VK8 A;  4UTG A;  4OI0 A;  2XMJ A;  1R8B A;  2C2K B;  1DFD A;  3AQP A;  1X8D A;  3MTK A;  4M5H A;  2OEL A;  3TVY A;  5DG8 A;  2RUG A;  3P96 A;  2EK6 A;  1G3O A;  5HMX A;  1S59 A;  4OZL A;  3GG0 A;  1TL7 B;  4OYW A;  1FWP A;  1QTN B;  3EJM A;  1AZS A;  2YPZ A;  1NAQ A;  1VQS A;  2F1F A;  4NOH A;  3ADA C;  1SIZ A;  1FRJ A;  2ERR A;  3CE8 A;  2IM1 A;  3CJQ A;  2AGP A;  4ECU A;  3J7Y I;  1T11 A;  4X4T A;  1BGX T;  1UFL A;  5IOL A;  1MRO B;  2HG4 A;  1F6T A;  4R0E A;  3MCO A;  1VBZ A;  3OTC A;  4F36 A;  2K7J A;  2HZC A;  3D1H A;  3KLI B;  4CO2 A;  3LAM A;  3TJA A;  2QMW A;  2LDI A;  3TX8 A;  3OHA A;  5F8H A;  3RW6 A;  2DNN A;  2WZ1 A;  2CQ4 A;  2D9P A;  3QAE A;  3RYL A;  4QPT A;  4RL1 A;  5J2N B;  2UUA F;  1T9T A;  1N56 A;  4CYU A;  1RAA B;  1RAO A;  1J5E J;  1LFW A;  4ENO A;  3J7Z T;  2NSB A;  4C8M A;  1VQY A;  2YX4 A;  4KO0 A;  1JLF A;  4N41 A;  2D1C A;  5HQM A;  2JEF A;  1VQ9 S;  2VON A;  2PEB A;  4L3N A;  3PV8 A;  2PI5 A;  3OR1 A;  4NE9 C;  2GIF A;  3DI6 A;  2VFV A;  2W7P A;  3NCP A;  2KN4 A;  4Q2L A;  3VZI A;  2W9A A;  4DSE A;  5G0R B;  2MY7 A;  1WHY A;  1DRZ A;  2XLI A;  1KVI A;  3BV8 A;  3DRP B;  3CW2 C;  2ZWO A;  3DRR A;  1AFJ A;  4ILR A;  4ECS A;  3EZO A;  1Q79 A;  2KXN B;  2IC3 B;  4HI2 A;  5IQ6 A;  2DIU A;  3NWR A;  4EZ6 A;  2R2S A;  3KLG B;  4RNH A;  3AB2 B;  4E0D A;  3UI3 A;  1N5Y A;  2XBP A;  4O23 A;  1LW2 A;  2WW4 A;  1RWX B;  4I4B A;  1WF2 A;  2HRU A;  4QCL A;  4L74 A;  1UWA A;  2YWE A;  3CF5 Q;  3I87 A;  4L76 A;  4OYX A;  2HFO A;  3T1A A;  1IKV A;  4RNN A;  3RUB L;  1HBU B;  3KXD A;  1RT7 A;  1DAX A;  3ZO7 A;  2B7B B;  4RW9 A;  4UOC A;  1VQM S;  2AEM A;  1KHV A;  3UD5 A;  1VLO A;  4WP9 A;  4DX6 A;  4ECV A;  2YNF A;  1FVS A;  1R7I A;  5CHC B;  4CLU A;  4DL0 C;  1RHK B;  1NKC A;  4PRF A;  2ZE2 A;  2QLX A;  3NS7 B;  1BQN B;  4NI2 A;  2R8K A;  1XC9 A;  3AY0 A;  2ALZ A;  1OPI A;  1RHQ B;  4MKV A;  3HPO A;  1S7I A;  4USI A;  4Q7A A;  2JH3 A;  2W8L A;  2XMW A;  2PA8 D;  4ZVF A;  2YQ0 A;  4B9M A;  4MK8 A;  2X3D A;  2ALY B;  1HWU A;  5F0W A;  5C42 A;  4RW6 B;  1OY6 A;  1CJV B;  1GMU A;  2A0F B;  1FVQ A;  2LMI A;  1IBM F;  2V4R A;  1YZ7 A;  3T5K A;  5MLC V;  1X4F A;  2AJ2 A;  1GXL A;  2JLE A;  2CQB A;  4GO5 X;  4R0J A;  5LL6 d;  4W92 B;  2OUG A;  1TEL A;  4ZPB A;  1L5U A;  2KG0 A;  5KG3 A;  1RTI B;  4Y2I A;  1BQM B;  4QYZ K;  1NK0 A;  3GYX B;  1A0O B;  3DLK A;  2CJQ A;  3RRG A;  1RAF B;  2PO4 A;  1PC4 A;  3LPE A;  3CCM S;  1CPZ A;  4C97 A;  4F8R A;  4C0O C;  1FDB A;  3T1Y F;  5IC6 B;  3EZU A;  4KPY A;  3W9H A;  3TAN A;  5AXM A;  4L72 B;  1S6P A;  2B51 A;  3QO9 B;  4QWA A;  2ADC A;  1T9V A;  4UUX A;  2BAN B;  1FK9 A;  1S0V A;  4JI5 J;  1GMW A;  4GO7 X;  4IQX A;  4DV7 J;  2E5H A;  2N3O A;  3LGH A;  1SPB P;  3LP1 A;  4LRF A;  2VFR A;  2C2R A;  2R42 A;  2U1A A;  3VWS A;  3LPY A;  1X4E A;  2V8P A;  3DDK A;  1WI6 A;  1SC3 B;  2V4J A;  4X65 F;  2E1C A;  4K4V A;  4KR0 B;  3I31 A;  4BC7 A;  1Q7L B;  1VK3 A;  5KT4 A;  1FEE A;  2ZBR A;  4AFF A;  4UQG A;  3CCT A;  4LRE A;  2AHO B;  3SBM A;  2A2C A;  1HI0 P;  4DLG A;  3VVU A;  5GAD U;  2K3K A;  2VQE F;  1JWW A;  5A8W B;  2DTJ A;  4I6W A;  1SJF A;  2VH7 A;  3FFI A;  5KT7 A;  2JLG A;  4CYU B;  3M9N B;  4B02 A;  2FGC A;  1QD1 A;  1NK4 A;  1IWA A;  4LF1 A;  3HJF A;  4RNO A;  2BW7 A;  1HYS B;  3H5U A;  4WTY A;  2XS5 A;  1Y11 A;  2M7S A;  3MDF A;  4F0M A;  5EUH A;  3DI6 B;  5C25 A;  2ZH2 A;  2E5L F;  1ZA2 B;  4OHW A;  2VL1 A;  3OSN A;  4BWJ A;  4OYA A;  1ZYQ A;  2HHW A;  3OFG A;  4Q5V A;  3R5B A;  5D77 A;  1FXR A;  3PW2 A;  3OFH A;  3NAI A;  3KYL A;  5J1E B;  4B3S J;  2Q79 A;  2VV5 A;  1N32 J;  1JLE B;  1QLN A;  2W4C A;  4RLE A;  1RT3 B;  4H4K C;  3B54 A;  1PAE X;  1FRK A;  5BYR A;  5DG7 A;  4F4X A;  1Q8L A;  1N5Y B;  3MM9 B;  2JEG A;  2CPH A;  2CQC A;  2LDY A;  1LW2 B;  4ECR A;  2N3L A;  4J5O A;  4UST A;  3M6V A;  3NNA A;  3BSO A;  1WHV A;  1MMD A;  1IVZ A;  3TR5 A;  4FXV A;  2Y3Y A;  3W61 A;  4N8O A;  1EAR A;  2R7Q A;  1WOR A;  5J2P B;  1MG7 A;  5BR8 F;  3KTQ A;  4CNY A;  3WQP A;  2EKY A;  3KFW X;  4PG8 A;  1U6F A;  3BQ1 A;  4QWD A;  3T5L A;  1ITP A;  1HQE A;  3LAK A;  3UCZ P;  4LRD A;  2X1A A;  2K1R A;  1HBN A;  1PYT A;  4B08 A;  1TK8 A;  2VJV A;  2BQU A;  1GMW D;  4O4R A;  4CI0 B;  1RT2 A;  1U09 A;  4ZIV A;  4NI2 B;  3IBC B;  3AD9 C;  4C2M A;  2FYX A;  4NA2 A;  2AP6 A;  4O4G B;  8AT1 B;  3SCI E;  4F67 A;  4K4Y A;  3W9J A;  1ICE B;  3PG9 A;  2G1D A;  4A8M P;  2ZEJ A;  1NSK L;  3I5A A;  4PG4 A;  4DU8 A;  2VDI A;  1RT5 A;  4IO1 A;  1HA1 A;  1SXL A;  5HBM B;  2ROP A;  1TUG B;  2VJU A;  2POK A;  3MD3 A;  4PG5 A;  4ZPA A;  4FKX A;  3R27 A;  3D9B A;  2CG4 A;  4IRD A;  2Z2Z A;  2YXL A;  1XMO F;  4C0B A;  2Z2L A;  6AT1 B;  5A2Q U;  4X64 J;  2IPO B;  1YJU A;  3T1H J;  5KFU A;  5A2Q Y;  2DR5 A;  4RO0 A;  4M5G A;  2VPX B;  3N79 A;  2GW8 A;  3TAM A;  4GC7 A;  4ZCL A;  4R8U B;  2WAQ D;  4A46 A;  1MU2 A;  3WZ0 A;  2FZK B;  2KXH A;  5KOW A;  4HH0 A;  4K5R A;  1IBL J;  1AW0 A;  4ECY A;  1DTT A;  3DLK B;  2EXU A;  4ZKA A;  4ALZ A;  3FRY A;  3U1N A;  1P6T A;  4NAS A;  3TZY A;  2QJ3 A;  2R7W A;  2WBR A;  2F4V J;  5DDO C;  3U1M A;  3ZZP A;  2WON A;  3ZNJ 1;  3ZZ0 A;  1S49 A;  3DMJ A;  5F41 A;  2R9L A;  2KRR A;  3DU5 A;  4ID5 B;  3KK1 A;  4P2S A;  3CD6 S;  3BN7 A;  3NG8 A;  5F8M A;  4F3O A;  1WSV A;  1SCJ B;  3HK2 A;  1HNX F;  3LP1 B;  1U8W A;  4RR5 A;  1HHT P;  4WFZ A;  1O5J A;  3DCA A;  1H2V Z;  1RBA A;  1RAG B;  3OTO F;  3I96 A;  3SCK E;  4EO8 A;  4USV A;  4ZIT A;  2RS8 A;  3OL8 A;  1X4A A;  1TMJ A;  4U8V A;  4K2J A;  3GIR A;  3HMJ G;  1KON A;  1N6Q A;  1K0V A;  3HSG A;  3KUH A;  3PZP A;  2VF3 A;  2GFF A;  1FNM A;  2HMI A;  1HNW J;  1BC6 A;  2HQF A;  3CSK A;  1RU2 A;  1YIT S;  1KFS A;  2DNZ A;  3D4J A;  2G9O A;  4DR4 J;  3DU6 A;  3MTJ A;  3V6D A;  4CLS A;  2Q6B A;  2IJN A;  1NHV A;  3H2L A;  2QMU B;  1UJ5 A;  2HFS A;  2YX1 A;  1S9E B;  1NK5 A;  2F63 A;  4MT1 A;  2NSC A;  4YHH J;  1S1U B;  3O1L A;  5EX0 A;  2DKO B;  4G65 A;  1KHW A;  1IKW A;  5AJ3 F;  4IG3 A;  1X4G A;  5EWG A;  1S6O A;  2ZBP A;  1RIS A;  3SMZ A;  2HHQ A;  4NRT A;  3QGH A;  4C98 A;  3NGT A;  1DQ9 A;  5J1N A;  1VFJ A;  5LJ5 Y;  3HF5 A;  2VG7 A;  3H4B A;  2YNH A;  3PW4 A;  4ED6 A;  4CM2 A;  3VAI A;  3TAP A;  1K1Q A;  1NH7 A;  2GIQ A;  4DL7 A;  3IR7 B;  3NNH A;  1VQ6 S;  4QWC A;  2IM3 A;  2QC3 A;  1ZM3 A;  4DSJ A;  2LVW A;  3DOK A;  2ZHO A;  1FWK A;  2XNQ A;  1U1K A;  3VZH A;  3Q8P B;  5HRO B;  1QAY A;  3ZTR A;  4DR7 F;  1KN6 A;  2IVF B;  3NBP A;  9RUB A;  3LAL A;  1NDL A;  1DY3 A;  1O0P A;  2KTQ A;  5HL7 Q;  2EG2 A;  4UOH A;  1EKR A;  1YZ6 A;  4USK A;  3FJ2 A;  3OUY A;  1TV6 A;  3DLH A;  1JIH A;  2FDN A;  4ERD A;  3T9Z A;  1B64 A;  2KXF A;  2MQ8 A;  2OIH A;  3THT A;  6FDR A;  2JOQ A;  3NOC A;  3R7N B;  1RA7 A;  1FDD A;  2HNZ B;  4USW A;  2GHW A;  4B3R J;  3QRR A;  4P7T A;  3N28 A;  1EP4 B;  3D0G E;  3HHD A;  1HQE B;  2K1R B;  1HBN B;  3QRP A;  3C14 A;  4O0I A;  4Y6I A;  3C66 A;  3TVK A;  3ILO A;  4MJK A;  2CPY A;  2PMW A;  5I3U B;  1JJC B;  2XZW A;  2ZHA A;  3L4B C;  3Q24 A;  3T19 A;  4IOB A;  1TL3 A;  2B8Q A;  2J8A A;  3G8Q A;  4WCE Q;  3T41 A;  1T02 A;  3FMW A;  3PIO Q;  1RT5 B;  4M5D A;  3PYF A;  1XN9 A;  1FXL A;  2B4P A;  2R2R A;  1X4C A;  3P8B B;  4YQW A;  5AXL A;  5KFK A;  5B7W A;  1N0U A;  2VA2 A;  2JX2 A;  4DX5 A;  4U7C A;  2ZH4 A;  5K5M A;  4URQ U;  5KFB A;  1DLO A;  3ISN C;  5LSO A;  4DLE A;  2KZM A;  3I0R A;  1RKJ A;  1FI4 A;  3ENA A;  2KJV A;  2RU9 A;  3DXS X;  4RW4 B;  1MU2 B;  4TU7 A;  4OZ5 A;  1UWB B;  4CLL A;  3KHG A;  3K5N A;  2C3U A;  2CFX A;  2GVZ A;  1LWC A;  3BGR B;  4N7T A;  4LVO P;  2DNR A;  2BQ3 A;  3MMJ A;  1G7C B;  2MZJ A;  1IBC B;  4ZP6 A;  3L3C A;  4DV0 J;  3JQK A;  4LRB A;  3O44 A;  2BYC A;  1TAU A;  1Q8B A;  2RNE A;  1L3U A;  1Y5I B;  2AQ4 A;  1HI1 A;  1ZA1 B;  5J1P A;  3EPG A;  2Z8Q A;  4DR6 F;  3GR0 A;  5F8J A;  1WC6 A;  2CXE A;  2FVR A;  1NSQ A;  1NCL A;  1PKU A;  1ARO P;  3DLJ A;  1SJ1 A;  5T14 A;  1Z2Z A;  4WFA Q;  1Q0N A;  4NCB A;  2WOM A;  4O3P A;  4ATN A;  2E5G A;  1FJG F;  2DNK A;  2Y0B B;  5KG0 A;  2R7T A;  2KT2 A;  2J7W A;  1RP5 A;  4O44 A;  2B9Y A;  3IRW P;  3DNC A;  1O51 A;  4X4U A;  4ETZ A;  1HPZ B;  3THP A;  3GPA A;  2CYY A;  3LF0 A;  4JV5 J;  2GO9 A;  3BBC A;  2W1B A;  2GZO A;  2V5H G;  4OI1 A;  5ETQ A;  1RHM B;  3OJS A;  3Q23 A;  3O5T B;  4AD6 A;  2W9C B;  3W1Y C;  4DZ6 A;  3MR3 A;  2IBK A;  3LP0 A;  1D09 B;  2R7X A;  1M5K C;  4BS2 A;  3IS9 A;  2IMO A;  1R0A B;  3QLH A;  2IA0 A;  2NXJ A;  3O3L A;  1QY7 A;  5GAD I;  3NS6 A;  1FE0 A;  2YBV A;  3G9C A;  3KK2 B;  1IKW B;  3KLF A;  1ZS6 A;  2EWH A;  4RW7 A;  4KHM A;  2HW3 A;  1YBA A;  3K5M A;  1VC5 A;  2IHR 1;  3JAM Y;  5DS7 A;  2MPU A;  1HLW A;  2AIR B;  3UN2 A;  2CG8 A;  2HGM A;  2KHC A;  2PMZ D;  5HMW A;  2RDJ A;  4DR3 F;  1HIY A;  2V94 A;  1LW0 A;  2QLB B;  2RHS B;  1S6Q A;  1U1P A;  5AT1 B;  1VC0 A;  4ZVR B;  2B7C B;  4NXM J;  3DC2 A;  4EYI B;  5L1L A;  2G0I A;  1CJU B;  4QW8 A;  2IBO A;  1JB0 C;  5IT0 A;  3CCQ S;  2VZ9 A;  1N8R T;  4ZPC A;  2RKI A;  3MR6 A;  1MML A;  2OEJ A;  4M5N A;  1IR2 A;  1F9H A;  4NYP A;  5IS2 A;  1XQI A;  1T05 B;  2BRK A;  2ATC B;  3G82 B;  3C3L A;  3B8H A;  5K14 A;  3RAX A;  2F7V A;  2BUN A;  1QE1 A;  1K1S A;  2QE5 A;  2XMT A;  3US5 A;  4CIO A;  4Y34 A;  2HS0 A;  3PM9 A;  2C3P A;  3KLE A;  3KJV A;  1UW4 A;  3FQL A;  3H7H B;  3IBW A;  5IZH A;  2AYB A;  1U7L A;  2H9Z A;  4ED7 A;  4OJG A;  3FEX B;  4ZP7 A;  5E0O A;  2UXC F;  1CEZ A;  3AB4 B;  4ED1 A;  2RRB A;  1T9U A;  2OH2 A;  2PEH A;  3OBI A;  4U8Y A;  3DXB A;  2KH9 A;  3BQ0 A;  5D6G A;  4RNM A;  1IWG A;  1B0P A;  1HBO A;  5DG9 A;  3MMB A;  3KHL A;  2VUG A;  2AJ1 A;  3UD3 P;  3D0H E;  1VRU B;  4LF8 F;  4LF2 A;  2V2V A;  2HIY A;  2HK2 A;  2MTL A;  4LR7 A;  3PFE A;  2LXI A;  4LFA J;  4FPI A;  3SQG B;  2PI4 A;  2MHE A;  2CZ4 A;  2H4Y B;  3JSM A;  4NXN J;  4L3K A;  5HLF B;  3LUY A;  2UXB J;  4DSK A;  3QT7 A;  3BBB A;  4PQA A;  2MY8 A;  5CCM A;  4QU6 A;  2Q43 A;  3PJX A;  1H2U X;  2J9C A;  2NR0 A;  4B3O B;  2Y9H A;  3MWB A;  2Z30 B;  1DLO B;  1Y00 A;  2HBY B;  1YBT A;  4Q2M A;  2NQP A;  3B4D A;  2D3U A;  4RUA A;  1N48 A;  2FQQ B;  5E3C A;  4W4M A;  1NDK A;  4TVA B;  5AXN A;  4FNH A;  1REG X;  4OHY A;  5B0F A;  4WIQ A;  4QJV A;  5E7O B;  5K20 B;  3FSY A;  2FJW A;  4P2F A;  4K59 A;  4PUO A;  2DH9 A;  3PX4 A;  2GVZ B;  4J9L A;  1LWC B;  2XB2 D;  3GMG A;  2RB7 A;  5K8O A;  5J2Q A;  2YPY A;  1D8Y A;  2KU7 A;  1F3V A;  4MIB A;  3H5Y A;  3ETO A;  3K8W A;  1FES A;  4X66 F;  1M1H A;  2UVW A;  4KJI A;  1N88 A;  5A6W A;  4PPZ A;  2R2T A;  4JB8 B;  2LEC A;  1HR0 F;  2HK3 A;  3MUR P;  5EN1 A;  2CPF A;  3FCH A;  4ES3 A;  2Z0G A;  3A8K A;  2NLW A;  2GAG C;  1DBD A;  2J9E A;  5EWE A;  1YRX A;  4CLW A;  4H54 A;  2XYH B;  4DL5 A;  4DFP A;  4NZ7 A;  5CAA A;  4PXC A;  1PJ7 A;  2A2D A;  4XPC A;  3IRX A;  2HSE B;  3H59 A;  1M0S A;  1KQF B;  1S9G A;  4IH6 A;  3JTN A;  1V5V A;  2KO1 A;  1ZBT A;  2XZD B;  3V6K A;  1P1L A;  2YH0 A;  2AJF E;  4LF4 J;  3V81 A;  2ZOM A;  4LUB A;  2V67 A;  3QWU A;  2JZ5 A;  4DV6 F;  4WE1 B;  4KGX B;  4KC5 A;  4YUD A;  4FN5 A;  1T03 A;  2Z4P A;  1WI8 A;  1X5S A;  1F0X A;  3E01 B;  2HRT A;  1YHQ S;  2Y0S D;  2RML A;  2JL9 A;  2DRB A;  3SXL A; 
#chains in the Genus database with same CATH homology
 4DV7 J;  4X64 J;  1IBM J;  4DR1 J;  4DV3 J;  1HR0 J;  2UUC J;  4JI7 J;  4X66 J;  4K0K J;  1XNR J;  2UUB J;  3T1H J;  4NEZ A;  4X65 J;  4YY3 J;  1J5E J;  2ZM6 J;  5LMU J;  4DV5 J;  4LFC J;  5FLX U;  4JV5 J;  3J81 U;  4HHU A;  1XMQ J;  4OX9 J;  3D3B J;  4DR6 J;  1N34 J;  4DV0 J;  2MTL A;  3R2C J;  2KL8 A;  4JI1 J;  4LF6 J;  1XNQ J;  2VQF J;  2E5L J;  4LFA J;  3IMQ J;  4LF9 J;  1IBL J;  3W1Y C;  4B3M J;  4KY3 A;  4NXN J;  4DR7 J;  4DV2 J;  4B3S J;  1HNW J;  1N32 J;  2UXB J;  4LF7 J;  2VQE J;  2MEW A;  4LF5 J;  2F4V J;  4DR2 J;  4RJV A;  3J80 U;  4LFB J;  4DR4 J;  1N36 J;  4GKK J;  4DR5 J;  4JI4 J;  4DV6 J;  4DV4 J;  5IWA J;  5IT9 U;  3D3C J;  4DR3 J;  4X62 J;  5LMN J;  1HNX J;  4GKJ J;  5AJ3 J;  2UXC J;  4JI8 J;  4NEY A;  4DUZ J;  2HHH J;  4LF4 J;  4JYA J;  3J7A N;  4B3T J;  4JI3 J;  4DUY J;  2KVQ E;  4YHH J;  4AQY J;  3T1Y J;  1XMO J;  2MQ8 A;  1IBK J;  1I94 J;  3OTO J;  3JAM U;  4DV1 J;  4JI2 J;  1N33 J;  5BR8 J;  2UXD J;  4KHP J;  4V1A k;  4PWW A;  5LM7 E;  2UUA J;  4B3R J;  4NXM J;  2UU9 J;  3R2D J;  4JI6 J;  1HNZ J;  4JI5 J;  1FJG J;  4KYZ A;  4JI0 J;  4LF8 J;  5A2Q U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...