4GKKJ

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aua-codon in the a-site and paromomycin
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
total genus 9
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4gkkJ00
1HR0J 2UXDJ 1HNWJ 5IT9U 4JI3J 4AQYJ 4DV3J 1FJGJ 2MTLA 4DV2J 1HNXJ 3T1HJ 1IBLJ 4NEYA 1HNZJ 4JI0J 4X66J 4JI7J 4NEZA 4LFAJ 4X64J 5A2QU 4DV4J 4DV5J 2UU9J 3D3BJ 2MEWA 4GKJJ 4PWWA 4LF5J 4DUYJ 2KVQE 4DUZJ 2E5LJ 4DV1J 3J7AN 4JI1J 4K0KJ 4DR4J 4B3MJ 2F4VJ 4LF8J 4DV7J 4KHPJ 4B3RJ 4DR6J 4KYZA 4B3SJ 4JV5J 1XNQJ 1J5EJ 4X65J 4DR3J 4LF4J 4NXNJ 4LFBJ 4LFCJ 3JAMU 2HHHJ 4B3TJ 3IMQJ 5FLXU 4JI8J 4X62J 4LF9J 2ZM6J 1N36J 4JI2J 4JI4J 5IWAJ 1XNRJ 4GKKJ 2KL8A 3T1YJ 1XMQJ 2MQ8A 1N34J 1IBMJ 2UXBJ 1N33J 4HHUA 3W1YC 2VQFJ 5LM7E 3R2DJ 4JI6J 4DV6J 4V1Ak 3D3CJ 5BR8J 4JI5J 5LMUJ 5LMNJ 4KY3A 2UUAJ 4RJVA 4DR1J 4DR2J 4DR5J 4OX9J 4LF6J 1XMOJ 1I94J 2UUBJ 4DR7J 3R2CJ 4YY3J 5AJ3J 1IBKJ 3J80U 4NXMJ 2UUCJ 4LF7J 4YHHJ 4JYAJ 2VQEJ 1N32J 2UXCJ 4DV0J 3J81U 3OTOJ
chains in the Genus database with same CATH superfamily
4HHJA 3AY0A 5GAGI 1WDTA 4NZ7A 2JH3A 1TK5A 4XO0A 1FDAA 3OR2A 4XTTA 1NPRA 5KT4A 1XTZA 2I5JA 3CC7S 2AD9A 2BJDA 1DHMA 2VFVA 3A13A 3MMAA 2V5HG 2NXNA 1H7XA 1KC8T 2CQ3A 4NXNF 2RE1A 2GQQA 3HD1A 2ZM6J 1U1QA 1RK8A 4X84A 4GKKJ 4A8QA 1OIAA 4ILMA 4Z7YA 2FZCB 1IBMJ 2UXBF 1R8PA 4JYAF 2XMUA 3H4DA 4C98A 3GIIA 3CIMA 3OUYB 2XO7A 4QR1A 4ED3A 3K0JA 4LF6J 1UVMA 1M5KC 1LWCB 3F0NA 3HVTA 2BXJA 3E01B 2VQEJ 5F41A 3OHAA 1JLFB 4J9RA 4OV6A 2GHPA 3GIKA 4NE9C 4K5RA 4P75A 1FJGJ 4F02A 2W4PA 1NK9A 1WC0A 3UNGC 4R0JA 4CDIA 3EM1A 5JXSA 4U96A 5A8KB 2FY8A 1WHXA 8ATCB 5C42B 3OL7A 2RU3A 4FF1A 2HVEA 2HS4A 2LVWA 2GJFA 3GJQB 5FLXU 2HHTA 3G96A 2N7YA 4F3QA 4X62J 1YJWS 1NB7A 4CWBA 4JUZA 2XI3A 2Z8QA 5ETLA 1F9EB 3WHIA 4OJ3A 3NS7B 2QV6A 4DV6J 5IT4A 1F2GA 1NCLA 3EDQB 4PQAA 3NOGA 2G9OA 2NXJA 2R7XA 2YH1A 1PCAA 3FCWA 1ZYQA 5EGYA 1FE0A 2B7BB 1U49A 2GVDB 3DHWC 1GFWB 2Y9HA 1Y5NB 4EYHB 3CDWA 5D3GB 2MB0B 2NXUA 2AJ2A 3MPVA 3IBWA 2XYPB 3LGNA 2FUG9 1RHQB 1LWCA 3KMQA 2PFDA 4KGVB 4CO5A 3VZIA 3GWCA 2ZOFA 5A0YA 3E01A 4CCHA 4WTYA 4TYAA 1JLFA 4QU7A 3MEEB 4RW9B 3H90A 3MM8B 3ONQA 2WVEA 3H40A 4B9TA 3MMBB 1RAJA 1UFLA 3KJNB 5K5MA 3K89A 4K0KJ 1RUSA 3PR5B 1B3TA 5ADZA 2KG0A 3GFYA 5A8KA 3PYGA 4LFBJ 3ZXWA 1GX6A 1XJWB 1XN9A 2VG5B 3WBZA 2FJWA 2PGCA 3CIZA 4LRBA 4XIUA 4KRWA 4RW7B 4LSLB 4WFXA 4P9SA 5EDWA 4OZ5A 1F60B 3BBBA 4OX7A 2GQ2A 5E2QA 3HFVA 1AXQA 1PO6A 2UXDF 2CJAA 1Y00A 2A2DA 2DIVA 2J7WA 5ETOA 4KO0B 1QLNA 4C0HA 2QL7B 4CM2A 2FJVA 1P6TA 4CO1A 2UUCF 3EZUA 2M0GB 1WSRA 2YY3A 3MD1A 2CRLA 3CMAS 2CPHA 4M5DB 2JL9A 4RO0A 4HR2A 3ZTSA 3JSRA 1HNVA 2QYGA 2DNNA 5D3GA 5LJ3Y 5H9FK 1F2HA 3QO9A 1LW2A 1S10A 1PC5A 2RVJA 3HT3A 2WCXA 3FSXA 4PWDA 2E7VA 2CPDA 2B4OA 4P73A 4CTAB 3E2EA 3MEEA 2FC8A 3MM8A 4U67Q 2FHOB 4B3RJ 1GXLA 4HHHA 2KZZA 1JNZB 1AW0A 4F4ZA 1HWKA 4LFCJ 1T9VA 3CJ3A 2FJAB 3D6TB 4FPRA 2JEFA 3KHHA 1OWXA 4CO0A 1MLAA 4ZCMA 2G0IA 2ALYB 2MQPA 1RCOB 2B4PA 4B9UA 4RW7A 1R8HA 4LSLA 1V3SA 1H3DA 3BGRB 2HYIB 2N4DA 2L9NA 5EWFA 3ZTQA 4TY8B 3BF4A 4NL5A 4ZP6A 4RBUA 1ZBTA 3W62A 4DV0J 4I67A 4USKA 3KJQB 1Y5LB 4PXDA 5HQ8A 2WTFA 2PI5A 2XMKA 2MZRA 1KTQA 3TRGA 2HMIB 4KO0A 4G3IA 4NRTA 1DQ9A 4LF2A 2IJNA 4HDGA 1UETA 2HQ3A 4M5DA 3O1LA 4WBFA 2OSQA 3UFCX 4L75A 3G2XA 1Q5YA 2ZM6F 3AH6A 5I3QA 2GIFA 3I87A 2ADBA 4J5OA 3RBEA 3OW2R 4FN5A 1WG1A 3KK3B 2MYFA 1IBMF 2DCUB 1HARA 4L3KA 3DNCA 4B9NA 3OLBA 2CDQA 4A8FA 3J81Y 4LF6F 4OHVA 4XPEA 2NREA 3DLEB 4NOHA 1UVLA 2AF6A 3BQ1A 2AJ0A 1S6QA 4U95A 1KFDA 3HJFA 2CQBA 4DN9A 3H59A 2KO1A 3UR0A 2MZQA 4LF1A 3BGRA 4UW2A 3A1YG 4DWIA 2MSTA 1LWEB 4TY8A 5J2NB 2R2RA 3PW0A 5K8MA 1YVFA 1HNWJ 3PACA 2EFNA 2V4RA 3GCWP 4DV2J 4DMZA 1RWVB 5KFCA 5L8RC 4DV4J 2HMIA 3V4IA 3BSAA 1F6TA 1MMDA 3VAKA 3HHLC 4X62F 1VBXA 4Y65A 3TEGA 4U7CA 4J9OA 1SUQA 2U1AA 2ZNYA 1MSWD 5C24B 3TX0A 4DV6F 2HG4A 2Y0SD 5CZXA 2W01A 3G6VA 2OPSB 1FXRA 1CBKA 3WZ0A 3MD3A 1FCAA 3Q8RB 1UEKA 4EMDA 2IDLA 4CO3A 1WSVA 4W92B 1WF1A 5AXMA 4J9SA 3C8YA 5D15A 1RLCL 5GAGU 2H5JB 4WTOB 1UMJA 3FFIA 3DLEA 4O4RA 2OUGA 1HI1A 3A8KA 1NHUA 1I94J 2GAGC 2AYMA 2J8SA 3PRVA 4NLDA 2HWHA 5IT9U 4K0KF 2MTLA 4U7UD 2K3KA 2AGOA 2ZOMA 1LWEA 3GYGA 5J2NA 3MR2A 4X64J 4LFBF 3PV8A 2L41A 3DDKA 1U2FA 1NH8A 1FWKA 3DU6A 3CCSS 2CNLB 1NXIA 2JLFA 1DFDA 3NWRA 1K0VA 4B3OB 2KFZA 5C24A 5HN0A 3HF5A 3CPWR 2DNMA 2OPSA 1SJ1A 1HD1A 3Q8SB 3PX4A 3KTQA 4YB6A 2CZVC 1TV6B 4ECXA 2V4QA 1L3TA 3VAJA 1V6HA 3RBZA 1WJ9A 4OX8A 4XDCA 3LA0A 3MF5A 2EG1A 3OXGA 1LFWA 3NS5A 2AZ1A 2DNOA 4B3RF 3D2WA 2RJZA 3JQJA 4LFCF 2XY7A 2XSFA 2OP5A 1E6VB 4ED7A 4PRFA 4PPZA 5KFLA 1ZTTA 4JI1J 3TI0A 3VGTA 1H2VZ 1EKSA 5D0HA 1PYOB 2IAJB 1RJJA 2MY8A 1X8DA 1XK8A 3C14A 2ACMA 3PW2A 2F3JA 1JXEA 2ZBQA 1U2RA 5J2QA 3PRDA 3CC4S 5KG0A 4B3OA 4DV0F 5I4MA 4WKYA 1D1UA 3CJ5A 4OYXA 3PEJA 4EZ9A 1BD6A 3V6DB 3AD7C 5B0EA 2BABA 3M9MB 1TV6A 5HATA 4RL1A 2NYIA 5H1SV 3AODA 4I6AA 5DO2A 2BUNA 1JLAB 3LALA 4OYPA 4A8YA 1ZETA 1WEYA 1SI9A 3RRGA 2RQCA 4ELUA 4N56A 4Q8FA 1X4HA 4BWJA 5GAHI 4RZRA 1BMQB 1H74A 3ILOA 1XIQA 4Y2MA 2J7KA 2POKA 3J7YI 2HVDA 2AT1B 2I8EA 2KI2A 2H5EA 1E6VA 2CQDA 1Q8BA 2GQCA 2W2PP 3FQLA 5ETVA 3I5BA 5B0BA 1RAEB 3GYNA 1YSJA 2XWYA 4DL7A 2QRRA 2IMOA 1WTFA 4DL4A 4O0NA 4CLYA 2QLXA 4YN3B 5EX0A 1NB2A 1S9FA 3A4TA 4LSNB 1HNWF 3O3LA 2LQ9A 2GC8A 1TK8A 4DS5A 2HBZB 2XLKA 4UZCA 3DDIA 1N32J 1Q1KA 4RUHA 2FHMA 1RAHB 5M2PA 4DV4F 3NNHA 1FRMA 4CYUB 2GMHA 1T05B 1Q7YT 2JDJA 1RU1A 3TARA 1JLEB 5DM7Q 3MUTP 3RW7A 2XO6A 3M32B 1RWOB 2ALZA 3SYZA 1JLAA 1PGZA 2DKOB 1WKKA 1B0PA 1FJ7A 1ZM9A 3H7HB 2ZH9A 4ZJQA 2XCPA 4UY8T 2BV3A 5KFQA 2VOPA 4RPFA 3ILJA 3K7RA 4RU9A 2ZH2A 3P4UB 1FXLA 2MQOA 2NZ4A 1I94F 4IFYB 3VWSA 5KT5A 3BM7A 4DOZA 3BR8A 4V19J 3BDEA 1S0NA 4ZCKA 2CJXB 3I4HX 2DR6A 1JB0C 3SIPB 3QAEA 2VIHA 3G82B 2AV5A 2VG6A 4LSNA 3EGZA 2HQFA 4WU2A 2KM8C 2BM0A 4DHVA 2YWKA 4K4TA 1FX4A 3BEGB 4G6VB 2FZGB 2C22A 1U8SA 2DO0A 3DRXA 1RAAB 1R31A 2O3DA 4KBIA 2J0XA 3QLHA 3PDNA 4FBUA 2I38A 3TUZC 3LOUA 3MR5A 1RWWB 4CYUA 1DTQB 1JWWA 1T05A 3VHQA 1WEZA 2ZKUA 3BN7A 1JLEA 4RU2A 2P2CB 1OPIA 4TQSA 1FKOB 1RE1B 2GHWA 2HS3A 3M32A 3KK2B 1FRJA 4C0BA 4OYIA 3LWMA 5MAOA 5CQGA 4ZPAA 3FZBA 2ATCB 3M6UA 3Q8QB 2BACA 1N36J 1FDNA 2HLUA 2CYYA 2MLXA 3HSZA 3Q8UA 2DNKA 1YLXA 2E29A 1RT7B 2L08A 4O3OA 3HP6A 1TKTB 3U1MA 3T5JA 2V68A 4X4QA 2JFDA 1UJ6A 3R3TA 2J9CA 4C8KA 3W7BA 4ZVHA 3QFHA 2DITA 2DH8A 4EBCA 1HWLA 1CC8A 3IM8A 3R5JB 1VJWA 1ZPWX 3G82A 3MM7B 2RU9A 4JI1F 4K2JA 3CD0A 4ETXA 4KC5A 3W2VA 4LT6A 3BN4A 4RBVA 4ILRA 3CJTA 3NS6A 5E33A 3CD7A 2BRLA 3CJKA 1YJUA 2B0GA 3TJAA 2F4VF 3HVAA 1DTQA 1FXDA 5L1KA 4J9QA 3X1LB 3FRZA 1UA0A 1FKOA 3D66A 1U6BA 2E9ZA 2Q3PA 2OPPA 3UW1A 3KK2A 3NGRA 3P3DA 1NSQA 1WHWA 2O66A 3QGIA 5THWA 1KVIA 5BJRA 1SH3A 6AT1B 1WOSA 4MYTA 1NK6A 4C8LA 3CJ0A 4ZJLA 1YGYA 4AL6A 1VISA 2XMWA 2IM0A 1S72S 2PSZA 5DZ6A 3LGHA 2D69A 2QE5A 2PC6A 4OJGA 1AT1B 2YX1A 3RTVA 3J80U 1WNEA 2PT0A 3D6MB 4C11B 2O01C 5CCMA 3PM9A 6FDRA 3NRBA 1VRQC 2I0XA 3IO1A 4AQYF 2KKHA 5DS7A 4OHWA 3FKBA 2JEIA 4ZVEA 1RA6A 2N7CA 4JI7J 1ZZNA 2CG4A 4OHXA 2H4YB 3MM7A 2UUTA 1DTTA 1VK8A 2A6OA 3G4SS 1OY6A 5HAOA 3GB0A 1NZAA 4F04B 3WQPA 1IJFB 2DPJA 2RS2A 2IFXA 3L7OA 1S1UB 3MPUB 4A48A 1S59A 2YWWA 2FY1A 2ZBRA 3BYRA 5HMZA 2W8KA 2DGSA 2NSCA 3MAAB 3L7UA 1MMLA 5H9FJ 2CIMA 2J9DA 1S77D 3WC2A 3VAHA 1N32F 4Z2XA 3RUBL 1VDHA 4C3KA 2V2KA 2GMLA 5B0CA 4FS1A 3J80Y 4FYYB 4A8OA 3M30B 2FZKB 4DR1J 1NSPA 3TP2A 2BYCA 4CZCA 3Q0AA 3H98A 1SPBP 1TL3A 2UXCJ 3KLIB 1LFPA 1B7FA 3TZYA 4WZMA 5J1EB 3F44A 4BBYA 2ZBIA 3IG1B 1LV5A 3U27A 1IBCB 2ROEA 3DLLQ 3AOAA 2VDHA 3RB0A 1UAWA 4NEZA 4DLEA 2V0NA 1FK9B 3BBCA 1RHMB 2DNRA 3TA2A 4TNOA 1JLQB 1LKZA 3MPYA 1U26A 4ZVUB 4QBUA 2D3O1 3N4WA 4X65J 4DQSA 2NXCA 2LA6A 3KJVB 3QQCD 4LBPA 1G7CB 2LMIA 3SQGB 4P6QA 1HWUA 4G1IA 2CUYA 3KYLA 1WC4A 3DGPB 2J0QD 2B51A 1HWJA 2GO9A 3IN5A 4WPAA 2HQGA 4RJVA 4I56A 2RB7A 4ZHRA 4O44B 3B8HA 2VOOA 2B3TB 4WF9Q 3M6WA 5GAHU 1ZS6A 1O51A 2QMWA 3UPFA 3Q83A 1ZOTA 3KUHA 2XLJA 3J7YU 2LLZA 3PIPQ 4RNHA 3H2VE 3KLIA 2CVIA 4OHZA 2YKQA 4JI0J 5J1EA 3IS9B 4ERDA 3W8PA 3IG1A 5T7LB 5IT0A 4ZN3A 4FF3A 2ZHBA 2DNYA 2KVQE 1N36F 4LREA 1FDDA 3H5YA 3KHLA 2IM1A 2HVHA 4JV1A 1RWPB 1FK9A 1B4SA 1CJKB 4F7VA 1BXNA 4LF4J 5LL6d 4PG6A 4F67A 3PR4A 2JHEA 1NDLA 3EUNA 4FYWB 4ALZA 4H4KC 4NA3A 4PYDA 3KJVA 1VBYA 3EX7B 1N33J 2PO4A 5B7WA 1FI4A 4YDXA 4RW6A 3SQGA 4NLXA 2W9CB 1HI0P 2DB1A 1HIYA 3IXQA 2EC0A 2XYHB 1ROFA 3QWPA 3CCMS 2QLWA 1SXLA 5LSRA 1Q16B 1GTEA 2XEXA 2WONB 2CQPA 4WJBA 2VB6A 2G0JA 2HHWA 2OLWA 2X1BA 4O44A 4RW8B 3W8GA 2JC0A 1DJ0A 3AQPA 5CD4H 5KFNA 5HLFB 3IBCB 3IR6B 3ELHA 3G71S 4DV5J 3MCOA 4F0KA 2J6SA 1YZ7A 1GTHA 2ABYA 3R97A 1X0PA 3MPWA 4RNMA 3I6PA 3LP0A 2RS8A 5T7LA 3DRPB 2FJXA 3E8OA 1J2VA 4X4NA 4F4WA 3GP9A 4N7TA 5FDLA 1CJKA 5L38A 1U02A 2UV8G 2K2PA 4DX6A 3ITHB 1T9TA 2IA0A 4I64A 4A8MP 4J9UE 5A8WA 4PG4A 2QLJB 1M5HA 3ZZPA 4HI2A 4O3QA 1RQ0A 1QAJA 1FT8A 3OL8A 1RA7A 2WK4A 2XY6A 2LQBA 3CNQP 2CJYB 4P2FA 2YNGA 4JI7F 2W9CA 4NMLA 4WIQA 3GPAA 2V2QA 2WONA 4YMEA 1K8AT 1N6QB 1UWBB 4RW8A 4B9VA 3BPSP 3Q86A 4IG0B 3R8YA 1VI7A 3JXOA 3O2IA 4L72B 4C8MA 1IWGA 2RQKA 2ZH6A 5E3AA 5HLFA 3HSGA 1RBAA 5GMDA 2ROGA 1WTBA 3IAM9 1U7LA 4OZLA 4HH1A 4DR3J 3LO3A 3KWMA 4IH7A 2DGWA 2F5GA 4DR1F 3RR8A 2Z58B 2VD3A 4OYMA 1Q79A 3DRPA 3KKFA 1IVZA 1OS5A 5HJXA 2KYZA 1HBNB 2RT3A 2K7KA 2UXCF 2QIFA 2BKPA 4LQ3A 2JOQA 4NLUA 1QJHA 1S12A 3CDBA 3ITHA 5HQLA 1PYSB 3AAWB 2W2NP 2XHCA 1HBOB 3MR7A 1RT1B 1RP5A 2HFNA 1IBKF 1FNOA 5JVGQ 3UD5A 2ZDOA 2ATLA 2KRBA 4OFZA 2VICA 2QN6B 2E44A 2UVUA 3D0GE 3GONA 1T9WA 4UQGA 1Y4ZB 1IKYB 3K2YA 2YNFA 5HJYA 3OJUA 2E9TA 2Y8WA 3JS9A 1VBKA 1UWBA 2RAQA 3GSIA 2W9AA 3PXGa 2HIYA 3M8SA 2FJDB 3KXDA 4B02A 2D3OR 4YQWA 2OFGX 3TVZA 3FEZA 1U1RA 2YKNB 3RU0A 2XYGB 4JI4J 1IQZA 3CSKA 2CQ2A 3LAKA 3QRPA 3CO9A 2LU2A 3CCQS 4P52A 1JJHA 2OEJA 3QJPA 1RT2B 4OLOA 1HBNA 3PYDA 2J7UA 4QZVB 1K9MT 4AD6A 5L46A 4J90A 2B9YA 4JBCA 4JI0F 2U2FA 5L1JA 1VC0A 1HBOA 4K4UA 1R3NA 3AA8A 2OSRA 4F4AA 4I68A 3M8PB 1PBUA 2RH3A 2E66A 2J6UA 4I0WA 4HLBA 1BQNB 1N48A 4H4MA 1RAIB 3I9ZA 4AL5A 2GS8A 1VHFA 2MEWA 4FP9A 2X3GA 4C97A 1IKYA 2XS5A 3HHEA 4ZVQB 1VIOA 4YP3A 5AT1B 4NI2B 2V50A 4PG7A 1PYTA 1N33F 1FE4A 2BDPA 2PA3A 4LMZA 3JYTB 1TMMA 1VLOA 3RAXA 1UPPA 5DGBA 1H38A 1Q7LB 2HBYB 2R7SA 3T1YJ 2ZH1A 4Y2AA 2DHHA 5LM7E 2YKNA 2JEJA 2VPWB 4ZIVA 3DYAB 2VASA 5KG2A 4ZVTB 5CYMB 2VH7A 1TVRB 3ZTRA 5FJ4A 1VRUB 1C1CB 4QU6A 4NCBA 1IKWB 1RT2A 1N54B 4DV5F 3RB6A 1M1GA 4HL9A 1G6BA 4NLYA 4ELTA 3IRXB 5DJBA 1QDUB 4DV3J 5HVGA 1NLKL 3OVSA 4P10A 3HVRA 2HNDB 1U25A 3EE3A 2R7WA 3K57A 1OMSA 2HBQB 4DU7A 1HMVB 2EI5A 5L9XA 4PQUA 2Q43A 4DL6A 3CO0P 3IMQJ 4F8RA 3RB4A 1RKIA 3G86A 2E5GA 3A3OB 3LH2S 3HVWA 3JYTA 3CVKA 1R0AB 2VQFJ 2V69A 4QYRA 3DLGA 4Q2MA 3HHKA 2AJ4A 4UOGA 3B4MA 3MURP 1WDDA 2JZ5A 4ZPDA 4P7TA 1LEOA 3DXSX 4E2FB 4DS4A 2BKNA 4MKAA 2AHOB 3DYAA 1MWZA 1T3OA 3O5TB 3T41A 2KVIA 5KFKA 4NX9A 3FZ2A 2OGUA 2DH9A 2J76E 2CPIA 4DSJA 5GAEI 1TVRA 3G87A 1VRUA 4KFBB 4Z37A 1SV5A 2F65A 1U48A 1U0HB 2X1GA 3OLAA 4FNIA 2DISA 3CWJA 4DR3F 3IRXA 3H5XA 2RQMA 3D3BJ 3N6MA 2I1RA 1OO0B 1EB0A 5A76A 3U02A 4DG1B 2HNDA 3GFXA 1HQ2A 1YX2A 5KT7A 2IJRA 1HMVA 2BE2A 3G8QA 3DOKB 3AFGA 3MM9A 2F4FA 4F3MA 1HLWA 3MEGB 2NCKL 2VA3A 4F3OA 3BZQA 3A8EA 4F0MA 3SXLA 5LXYA 4YB7A 1TAQA 3HHLA 3R1LA 2Z30B 4CO4A 2PMZD 3IR5B 4AE5A 4UZBA 1JLGA 1GAOA 3W64A 4DR5J 1R0AA 1RXOB 3TVYA 2ZNZA 1UWAA 4DQQA 4LF7J 1M1KT 1T7PA 2AIRB 2MKHA 2H51B 4KR0B 2GAHC 3SDEB 1YKWA 1UZHA 3DRRB 5ETSA 4FS2A 3TQ1A 2A6MA 1TL7B 1W26A 4M94A 4NA2A 3DLKB 2NQPA 2J0SD 1GXUA 2IM2A 4KFBA 1WF2A 4HKQA 3MTKA 2H1YA 3ZZRA 1N5TA 1U0HA 4CLPA 3KLFB 4JI4F 4PABA 2V2ZA 2E7XA 4KPCA 2XZWA 1J5EJ 4UOCA 2ROPA 4X4RA 2CDRB 3WDOA 2R7TA 3RRHA 4ETZA 1H98A 3R9LA 1R7IA 2KXFA 1SB6A 4OJ1A 4HH0A 1QY7A 3W5ZA 2RHSB 3DOKA 1C0UB 1NJXA 1RDRA 2CQHA 2VONA 3OR1B 4Q7AA 1S9EA 3VV2B 3OT9A 1LK7A 5LMNF 2BE9B 4M63A 1RT3B 5HMXA 3C46A 5B0GA 1K47A 5I42A 3FBFA 2OPRA 2HZCA 5CCLA 2DNQA 1YDLA 3TA0A 2B9XA 4EZ6A 1FWPA 2D3UA 3NNCA 3T5HA 3BQ2A 1VQ6S 3PCOB 4Y34A 3SDEA 3UCZP 3RW6A 2M3DA 2AMCB 1RT4B 4ANEA 4WYWA 3DRRA 2GZOA 2CJQA 1U24A 4LJMA 2VC1A 3KUEA 3M8QB 5DDPC 1VYAA 1UA1A 4ECWA 3TWZA 4IG3A 1SQFA 3T1YF 3VAFA 4DLGA 4O3PA 2BMBA 1X4FA 1KQSR 4K50A 1BQMB 3QZ7A 4DPTA 1HYSB 1S1TB 2FIUA 2OTJS 3IGVA 4QJVA 4QWDA 3OTEA 2Y1IA 1RT5B 2X3DA 4PG5A 2EW9A 2WVBA 1C0UA 1U1NA 3DRSB 3Q8PB 3Q2SC 3OR1A 2EPIA 3UVJB 2HWIA 3M6XA 2ZUGA 3MM6B 5D4PA 1SKUB 1VQYA 3THPA 3MDFA 1FDBA 4IFVB 3KNGA 3B4DA 1V5IB 4CIOA 1L3UA 2V2VA 4QIWD 3LW5C 3K8WA 3VVTA 1HFEL 4LVOP 4FXDA 3HT0A 3SFGA 2R2UA 3CJSA 3RRKA 5SUHA 2SXLA 2ZJRQ 2K1RB 3CCVS 2Z0GA 3IAS9 2WOMA 3HD2A 3UWTA 3IGNA 1X0FA 4LRFA 4NXNJ 1RTZA 5KFIA 2BQUA 3R5DA 1KEKA 4TU9A 1F0XA 1VLYA 3BPDA 1Y11A 4BCAA 3KK1B 2YWGA 2LDYA 2EWHA 3ENQA 3N6LA 1BQMA 5K20B 4ZK7M 2UXBJ 2HWTA 1KOHA 4FPIA 1WG4A 2QZ8A 2G2ZA 4G1QB 4J9NA 1QUPA 1S1TA 2JNJA 3KNAA 2KTQA 2R4FA 4QCLA 3QWUA 1REGX 2BKOA 3EJMA 2IRXA 1WC3A 1S6PA 3QRRA 9RUBA 2NUUG 5HSPA 4XAKA 2JVOA 1D8YA 1TKXB 2OD6A 2DGUA 5IFMA 1RT5A 3AQOA 1BGXT 1NDCA 1PBAA 3AJDA 2GO8A 3UVJA 2KZMA 3D1OA 2IMWP 1NMEB 2J0WA 3HDSA 2BRKA 4IFVA 4M5GA 3PZPA 4KH1B 1FRHA 2IYIA 4QR0A 4DV1J 2BQRA 1RHKB 2K1RA 3CULA 1JNRB 2C2NA 4OMFG 5E41A 1UVIA 2E1CA 4DR5F 2OI2A 1FEEA 3MPDA 4ZVPB 3MEDA 3POTB 4HHUA 2DT9A 3I0RB 4LF7F 2IVMA 4J9KA 1MNEA 4V1Ak 1S48A 3KK1A 1AA1B 2DGOA 1QTNB 2MZTA 1RWUA 2B5JB 2BQ3A 3IWNC 3LF0A 2VJVA 1WI8A 2HGMA 2L3MA 2H54B 4G1QA 1BLUA 4Y2IA 2BW7A 3SSSA 2ZD1A 2IDEA 9ATCB 2E1MC 5KT2A 4IR9A 1TKXA 5KG7A 2WVCA 5KFSA 4PXCA 1T9YA 2XI2A 3O44A 1J5EF 1FX2A 1S7HA 1TR0A 2ZWOA 3IC1A 1KP6A 4JOUA 3TAMA 4R0EA 1X9MA 2CFXA 3CE8A 1CSJA 1AZSB 4KGXB 4G1PA 4DR6J 1TP7A 3S7RA 1SC6A 4O4GB 2YPYA 4CH0S 2OD4A 1YG0A 5HBMA 1T9XA 3ZZUA 3MGJA 5GAEU 2DH7A 3UO0A 5IC4B 5E7OB 5M2UA 3OR2B 5C5JA 2HK2A 2R8JA 3W9IA 5KFZA 3F73A 2I5JB 3POTA 3LANA 2NZCA 3UI3A 3DC2A 5KFYA 2E1AA 3NWGA 1TUVA 3KG0A 3QJLA 2UUCJ 3SEOA 1DZ5A 3SCJE 2BE7D 2KFNA 4M95A 4WFNQ 1JLCB 1FRLA 4ZIWA 1VJQA 4OYBA 1V3ZA 2HEKA 3OL9A 1RI7A 4IOCQ 2QL9B 2HGNA 3A8IA 3FMWA 1IUJA 2AGQA 2XNRA 2RRAA 2KFYA 3R6GB 1Q0NA 4MIWA 3K58A 2V8GA 3C6UA 3GU0A 1IQTA 4BC7A 4C2MA 3FBBA 3EDRB 3HVTB 2ZH5A 3SV3A 1UTAA 4J9PA 2G1HA 4C3LA 3CTRA 3J7A1 4F50A 2MMYA 4AXIA 2YWEA 1TU0B 3J7Z5 4O4GA 3KLEA 1WC1A 4IO1A 2R7VA 2RSQA 4NCAA 1VQKS 2YBVA 4YFUA 2VC0A 1RWNB 1R0CB 8RUCA 4OZ0A 1HL6A 2MHEA 1RTHB 2HBRB 5F8JA 3BQ0A 2XY5A 2M8DB 3GYXB 4KKOA 1Q78A 4F26A 1RHUB 4DZDA 3ZTPA 1JLCA 4QIEA 1A7GE 3V6HA 2HVZA 3D5MA 4DSLA 1SL2A 3RAMA 4QW8A 3GQCA 1KN6A 2J9EA 2DR5A 2MKJA 1U1KA 4YR2A 3N5BA 1X4EA 2D3ZA 3D6FB 2NUHA 4QR2A 3CMES 4ITSA 2EK6A 2FDNA 2EFOA 2BW2A 5A0YB 2DGXA 1HBUA 4DQPA 2LQ8A 4CLWA 3AJ2A 1LXNA 5DRKA 1MMNA 4EI2A 2NLWA 5D78A 1UVJA 3J7ZT 1DQ8A 1FJEB 2AGPA 1Q8KA 4ZPTR 1SL1A 4JI3J 4DV1F 4LVNP 2LKZA 2PMWA 4NASA 1RTHA 2MZJA 3R7NB 2VPXB 5F8NA 1ZPVA 1HNIB 1RYRA 4IO9Q 4WWSA 4FDFA 4NLPA 3BB5A 5BYSA 1P8GA 1VIXA 1C4AA 4DX8H 2QA1A 2HKEA 1EQ0A 5ETPA 5HP1A 2XMMA 4ZCLA 3FNNA 2UVVA 3R5GA 1DURA 1W7WA 3S8SA 5K14B 2JX2A 4JI2J 2ILZA 5T14A 1YBAA 3PFOA 1U45A 2KRRA 1IR1A 2MQ8A 1U1MA 2CQIA 2RUGA 3BGFA 1HNVB 2FTRA 3ZZ0A 5LSLA 4OI4A 3QO9B 2C42A 1LW2B 5DLGA 1B99A 2LQ5A 3M8WA 4ED4A 4USHA 1EHWA 3BSOA 3R27A 4C8NA 1SJRA 4DR2J 4PWDB 3JSYA 3CUNA 2YNIA 2WVFA 2HFVA 3ULHA 1JJ2R 3DLHA 3MR6A 5HVFA 4LSZB 4EU0A 1HW8A 3MR3A 1V5VA 1U0SA 5ITHA 5FLXY 2KJWA 3MCSA 4LIRA 5KG1A 3HHLD 4DR6F 1I5OB 1UW9A 3PRBA 3TUJC 5GMKa 1FKAF 2X1FA 1K1QA 3AJ1A 3O8WA 4NYOA 2NPIA 1XC9A 3MMCB 2VDIA 3M8RA 1PKUA 1HNIA 2HQCA 2QYCA 4IH6A 1TK0A 3RYLA 2DCLA 4TU7A 3MZIA 3HX9A 3R6LB 2ASLA 5LSOA 5L1IA 2R42A 5D77A 4I4BA 4F4KA 3W1YC 2UUWA 1NAQA 1V3RA 5K14A 5C2GA 1VGYA 1FO1A 5KOXA 5HVHA 2FJEB 5L9NA 4IQXA 5K8OA 3E51A 2HZVA 1SVDA 1NDPA 3VAGA 2G4BA 2AJFE 3ISNC 1N4LA 2Y3YA 1PJ7A 4L3NA 3M8ZA 2ZZTA 2AYBA 3Q2TC 1QD1A 1HHSA 2W1BA 4ZPBA 2HURA 4NEYA 3W65A 1NKBA 1IBLF 2YXLA 2RDDA 5HI7A 1KHVA 4PYAA 4CH1A 3ILIA 3JSMB 5C2CA 5JJBA 2MXYA 3HMJG 1S6QB 3S01A 4M5JA 2DPIA 2HRTA 1ELOA 1Y3KA 4R25A 1X60A 2V9KA 4DCPB 4FNHA 2PEBA 1RWXB 2MKYA 4F25A 5CAAA 1YJRA 4I2QB 3MMCA 3OVBA 3GJTB 2ZWPA 3ICLA 3VAIA 2V63A 3V2UC 4MH8A 4ED2A 1NU4A 2QTWA 3LUYA 3MECB 4KSEB 2B9EA 1ZAXA 5DG9A 1UFKA 3UCUP 3V4IB 4OIXA 2FJBB 2RF2A 3W9HA 1HI8A 3SBMA 3FJ2A 3NAHA 2JSXA 1SUQB 1TFWA 3T19A 4QYZK 3HCXA 1D3WA 1HR0J 1RT6B 3QT6A 2W7PA 3TZZA 4KIAA 3GR1A 5KT6A 2YVSA 1LK5A 3T1HF 2DEIA 1EKRA 5KFVA 3M05A 2IJFA 2ZBCA 3SCIE 1QAIA 1RKJA 4IYQA 1KRPA 4MKBA 1UVKA 3GSDA 2PIIA 1ZA2B 4HT7A 4Y2CA 3FFIB 4B3MJ 2HHXA 3OD2A 4AT1B 4CT9A 1HWIA 3JSMA 1KOOA 5GADI 2Z4PA 1OPZA 4WZQA 1H72C 1S7IA 3I56S 2A2CA 1OY8A 3N0VA 1CJTA 2RDIA 4FVCA 1IM4A 4I2QA 3ZZOA 3NCPA 2C2DA 5A6WA 1IM6A 5LJ5Y 2LFVA 3VAMA 4JI3F 2V8VA 3HPOA 4ZITA 1YJ9S 3DOMB 3T3FA 3MECA 1I1GA 5EWEA 4M5NA 1SJQA 1F3FA 1M5SA 2KHCA 4KT0C 3QGGA 2XCAA 1X7VA 3WIVA 3RG6A 4WU3A 1Q86T 5EHHA 3CDEA 2MQQA 3KLHB 3OL6A 1S1XA 2DRBA 1NSAA 3M2RA 4P2XA 1RT6A 1OSDA 1N5SA 4WE1B 2Z2ZA 2CPFA 1CLFA 3N79A 1RWMB 3NP5A 3PW7A 2A0FB 4HTIA 3DOLB 1VK3A 3THTA 3D67A 1WORA 2C3UA 4JI2F 2C3MA 4MK9A 3J7AN 4NMXA 1FFSB 1K73T 4HI1A 2MJUA 4FF4A 1G3OA 2E7WA 4H54A 3TNVA 2BJ3A 1GQEA 4W90B 4DR2F 4IQMA 1XNRJ 2YKOA 3BDPA 1ULRA 3TUPA 2HHSA 1X9SA 5LMUJ 1HA1A 4GVBB 2GV1A 4XDDA 4PXEA 4DSKA 4A8XA 2MLZA 2OELA 3AOBA 2DY9A 3EGNA 3LP1A 4V19X 4C3MA 3OV7A 4Q0BA 2HFSA 4G65A 5KFFA 3DOMA 1S0OA 1Z4UA 4Q5VA 3C14B 2ILYA 4PKDB 1V9OA 4P71A 2BJ1A 2XSJB 3QYYA 3P8BB 5J2QB 1RAGB 1U1PA 1F1BB 4E0DA 1JJ4A 5DLFA 4DX7A 3KLHA 5HO4A 3RJMB 4DR4J 2UV8A 4LRAA 4WE1A 3NAIA 3BKTA 3EPIA 2ZVSA 3QZ8A 2JWNA 3DOLA 5IXUA 4OQJA 4QWAA 4MK8A 3JTPA 1FD2A 3IP0A 1C1BB 5IT9Y 3TANA 2IM3A 4KHMA 2OAUA 1PC4A 4DPWA 5DZ7A 1DLOB 4W98A 1B64A 1VQ5S 2W7OA 4MIAA 3US5A 4CLSA 2F8MA 2HNYB 3V6JA 4GVBA 2G2YA 1N5YA 4WP9A 1SBRA 4MJKA 2MY7A 4O3NA 1Y3JA 5KFXA 4J7CA 1BY9A 4RUBA 3W2WB 1FERA 1HNXF 4YOEA 1XBWA 2ZZNA 1YK9A 2XWXA 3EXYA 2W25A 4ZLJA 3U7JA 4FF2A 4GKJJ 1WF0A 3CCZA 2IPOB 1X4CA 2ZC4A 2XSJA 1TAUA 1G4CA 2F4VJ 2OPQB 1LWXA 3PFEA 3HK2A 1YJ7A 1L3KA 2GJ2A 3D0HE 3N6NA 4EEYA 2CA9A 2E1PA 5ETTA 2M70A 3T6JA 2HHVA 1SKSA 4TXSA 4EFAC 2HIQA 3UD4P 3K5PA 2Y1LB 4ED1A 4TU8A 1Y0HA 4K4SA 3QRQA 1VS3A 5DQIA 2Q1LA 4Q2LA 1HR0F 2QLFB 1RBOB 1C1BA 1RTIA 1S6OA 3GJSB 4TLQA 4OX9J 5J1PA 2XZTB 4UY85 1TMJA 4WXOA 2R2TA 1RYSA 1EP4B 4YR0A 2AZ3A 4IRDA 4WP3A 1VOMA 5KFUA 1NJYA 1DLOA 1Q4RA 2FGOA 1Z2LA 3UDCA 1WG5A 5DETA 1DRZA 1NBEB 4ZPWR 4AQYJ 2PI4A 2HNYA 4ZVGA 4B3MF 3OSPA 1QVFR 2VU5A 2OEKA 4UT4A 5K9FA 2BANA 1CC7A 3DLJA 4FBTA 3FCHA 3KG4A 4P74A 1OQ3A 1DAXA 3W2WA 2VBXA 2ZDPA 5KG3A 2DR8A 3D1HA 1WD6A 2FC9A 1WI6A 2D7SA 3FUYA 3K5LA 4N47A 1R6YA 2VG6B 1KD1T 4ANCA 2OPQA 1KQKA 1AFJA 3P49B 4KHRA 1Y7PA 3OFFA 4CT8A 1XQIA 3PG9A 1IWAA 3QATA 3QLHB 2IHR1 2PMHA 1YBUA 4ZCIA 1S4EA 5E3CA 1M0SA 3H8YA 2R7QA 2YKPA 2BX6A 4NLTA 1WACA 4ES2A 4NXMF 2NYHA 3UCGA 4YHHF 3DHXA 1TZ0A 4DUTA 1FRIA 4EO8A 3ZNUA 3AB4B 2CQCA 3L95X 2OFHX 3DM2B 1EP4A 1X5OA 2UVRA 3GG0A 3Q22A 2BJ8A 3HO1A 1P27B 1O8BA 4FKYA 4ZN1A 3H0PA 5LOQA 1PJ5A 1K1SA 2MHNA 4X4VA 3DI6B 5E0OA 4ID5B 1XNRF 4KHPJ 3EGWB 3HFZB 3Q8VA 2WB4A 4ES1A 2IIHA 4K4XA 1TKZB 3NKYA 3MHYA 3NMAA 5LMUF 3U1NA 1RABB 3W3SA 4F36A 2XBPA 1X5PA 3PW4A 3ETOA 2DR9A 4ZMMA 2HAFA 2M52A 1ZH5A 2CNNB 3HHNB 5KAKA 1MG7A 4IRCA 1YJNS 4JI5J 3GIJA 3W2VB 1DY3A 2ZHOA 4USMA 4XPCA 3P96A 2UUAF 2FLNA 1PILA 2LU1A 3CJKB 4TLRA 2FHJD 1X5TA 3VF0B 1AUDA 1FJCA 3TYTA 2WVDA 1FNMA 2E5HA 2C3OA 5GADU 4DR4F 3ET6B 3R1HA 3C3LA 2OPPB 3G9CA 1RU2A 4BHQA 4UOHA 1YTYA 2A18A 3VCDA 3RAQA 4OLPA 2GGPB 3DM2A 3PJWA 5E3PA 1XWLA 4ICLA 1S9GA 2GVZA 4KGZB 2JVRA 1WC6A 2W2QP 3JSBA 4PXBA 3DKDA 2QA4S 4K5SA 2KHDA 2N3OA 5A6PA 1F9HA 3DI6A 1KQFB 4ID5A 5BYQA 3GG1A 5RUBA 2XMTA 2QA4G 2WW4A 3ENVA 3BGUA 2P8IA 4DEZA 2PD1A 4IDKB 1TKZA 1NK8A 1ZM4A 3R5CA 5HMWA 1N34F 1VQ9S 1QSYA 5EN1A 3WC0A 4IR1A 1DTTB 3K5OA 2DGTA 1XMOJ 1L3VA 4Q44A 3RZAA 1VQNS 1UCNA 1FKPB 1CPZA 4K4YA 3TQEA 4C8YA 1D09B 4ECQA 4FYDA 4GKJF 1OQ6A 2GIRA 1SCJB 1S4FA 2P9CA 4CNYA 1E6YB 5LT5A 1HNZJ 2VBZA 1SIWB 2N82B 1Y10A 4Y6IA 4Y2KA 1VQSA 5A8RA 2YNHB 2K06A 3ET6A 3HHDA 4M1KA 4XK8C 1HPZA 1P9YA 2DNGA 2GGPA 3I0SB 2EEYA 3AA9A 3ZNJ1 1NJZA 5HQMA 1FFGB 3AOCA 2DTJA 2MDAA 3M6VA 4I6WA 5JUMA 3D6HB 1S99A 1TL3B 2DNLA 1EETB 3CXCR 1T94A 2C1EB 1X4GA 4OX9F 4OJHA 1ZM2A 1SIZA 3D68A 3NGKA 1Q95G 4TVAB 2DEJA 1XEZA 3EYZA 4OZ2A 4MTPA 4YDDB 4IDKA 4Q8EA 3CJRA 5D0GA 3OFGA 3M7VA 4DCJB 3FMBA 2ADCA 1D8ZA 3A8JA 4MYUA 3FDSA 2ZBPA 3IA0A 2IRYA 3HSDA 5MLCV 1FKPA 4EK2A 2XMAA 2FLPA 5HK4A 3OUYA 4Z7CA 7AT1B 1E6YA 2VPYB 4LF5J 4L76A 1LWFB 4EBDA 2YH0A 1U1LA 2D1CA 2YNHA 3PJ9A 4ZHRB 1DARA 2C2OB 1N56A 2HS0A 1RTJB 2NPFA 5J1NA 4KB7A 3I0SA 4LR7A 4KJIA 1R6VA 2RD5C 3PW5A 1MN9A 2E5IA 4DX5A 3OBIA 1R8AA 2XS2A 1EETA 1HHTP 1MU2B 3EVOA 2L9WA 2QL5B 1GT8A 1NNDA 3GJRB 4QIFA 5C42A 1B0TA 3HM9A 3SSQA 2HHUA 1ITPA 5AJ3J 1IBKJ 2K8GA 2R2SA 1VQ8S 4ZPCA 4CLUA 3VZHA 4ER8A 4NYPA 1YBTA 4QOTA 3KMSA 5I3UB 3OVAA 3OTBA 2HFUA 2Z57B 2FD2A 3KHRA 4KHPF 3P45B 4LFAJ 4R8UB 1FTCA 1D0EA 2C2MB 4MK7A 4LQ9A 4K4ZA 3IBFB 2GVDA 1CQMA 1TKDA 1ZA1B 4RW6B 5I3PA 2ZH3A 5IV4A 4QYZJ 2QX0A 4JV5J 2WSFC 3NXZA 4N8OA 1LWFA 3BR9A 3Q8YA 5DM6Q 4C9DA 4JI5F 1F3VA 1QUVA 3K8VA 3RR7A 2MLYA 2KT5A 1YI2S 4RW9A 1RTJA 3MMBA 1I6JA 5IV3A 2GCFA 3B6BA 2EXUA 2IBOA 2JC1A 2B8QA 1SJFA 4LBIA 2XMVA 2HNZB 1MU2A 3TUIC 2VG5A 4WKRA 3LP0B 3J81U 4OI3A 2AJ1A 2LYVA 5BXIA 2DHAA 1YRTA 4IRKA 5FDLB 2Q66A 2Z2LA 4F0HA 3CCWA 3MEKA 3CEDA 5I3UA 3AHPA 3J81j 2G13A 4DPYA 5A8WB 3UDEA 1KLMB 4YEAA 2ZVIA 4DF4A 2F9DA 4GC7A 2B4UA 2XC9A 2FLLA 2YKAA 2MJNA 2BR0A 4R8UA 2OHDA 1AUSL 2M2BA 1CULB 2YNGB 1URRA 2UP1A 3GIRA 4M5MA 1XMOF 4DZ6A 4GKKF 3UN5A 3TVKA 4ECRA 4HDHA 3R2DJ 1RHJB 4DU8A 3T5KA 1FTRA 4CTAA 4RUAA 3H42A 3CCUS 2BZ2A 2CAJA 3C66A 1J27A 1JK9B 2FVRA 3PY8A 1HNZF 1KFSA 3DDNA 5F3TA 5CYQB 3QT5A 2HFZA 5C7PA 2VQEF 1XERA 1H0HB 4X2BA 2HNZA 3GV7B 2RHQB 4O3RA 4AXJA 4E98A 1FJGF 4YUDA 1BWEA 3DFEA 3BS9A 3D7SB 2XULA 1KONA 2ASYA 1JJCB 1MN7A 3JB9k 3OSNA 4C8OA 3PVXA 2HQDA 2W9BB 2VODA 4BS2A 3IWLA 4FZVA 3UD3P 3V6KA 2J9DE 2FYXA 4P2MA 2LEBA 2ASDA 1KLMA 1PAEX 4QPXA 3T5LA 2H65B 3FQKA 4WIIA 1W2BR 4NZ0A 3CF5Q 3I82A 5AE2A 2DVIA 2EK1A 2WAQD 3G6YA 1U8WA 3WX8A 3MCMA 1CULA 2DGQA 3QBCA 2DGVA 1YJVA 4D3GA 4ECSA 1NPKA 4KV8B 4EUVA 2YNFB 2DO4A 2EKYA 5DQHA 4M5LA 2DY1A 3QGPA 5FIIA 5FD1A 3KK3A 1N0VC 5DQGA 2CPJA 1D9FA 1UL3A 3CD6S 3G8SA 1T3NA 3FBEA 4LF5F 3LQVA 4WCEQ 4UTGA 1VMBA 5CYQA 2MZSA 1BQXA 2ZHAA 1L3SA 3SFUA 3QNWB 3TZWA 2PN6A 2JEGA 1T95A 4KTQA 8AT1B 2ZH8A 2PE8A 2FVQA 2XMJA 3W63A 5F8HA 4ZA1A 2V8PA 4RNOA 3MAHA 1XNQJ 2AW0A 4YB5A 4X4OA 3G6ES 3NLCA 2W9BA 5ETNA 3T9ZA 2HAIA 7FDRA 1RGVA 1KVJA 2Z2YB 2QMXA 2HLTA 3HLUA 4EYIB 1GK8A 4QW9A 3MUVP 2D9PA 4KH0B 5AJ3F 1XMQJ 3ZZYA 4OI2A 1EIYB 2P6TA 3ZTOA 1Q82T 3FSYA 2LXFA 4A8KA 5KFPA 3X3UA 2CPYA 5IZHA 3V4MA 4H4MB 5F8IA 1KTVA 1SKRA 2VL1A 4KV8A 3D0IE 3AD9C 2MQMA 4ED0A 4LFAF 2CQ4A 4CM0A 3VTIA 4DPOA 1KHWA 3T9NA 1GH8A 5F9NA 2OJ3A 6FD1A 1AROP 2QT7A 2XS7A 1U1OA 5D8HB 2UVWA 4X4SA 2OH2A 4PEOA 4JV5F 3ZO7A 1NUEA 3HSJA 3Q24A 2F8EX 4DUYJ 3LPYA 4ZDNA 5G0RB 5L1LA 3GZ7A 5GMEA 3BV8A 4OZJA 1SC3B 3H2LA 1T03B 2QFJA 1NKEA 4I2PB 2AYGA 3I32A 3ENWA 4M5KA 2XM3A 1RBLA 4U6PA 1KLNA 5LMNJ 4NPOA 3Q23A 4CP5A 4EBEA 5ETQA 1VCTA 4URGA 4C7QA 4PQUB 5KFMA 2OO4A 1NK7A 3BO3A 1REVB 1T0TV 2IC3B 4FVMA 2EBGA 4OL8A 3WX4A 3GCXP 5D4LA 5KFGA 1FNXH 1MW7A 5A2QU 4E8UA 2JJ4D 2M7SA 5D0RA 3CJ8A 2APOA 3DLGB 4M5IA 4U7UK 2R7UA 2E9RX 1IKVB 3R5AA 2IY5B 3WIUA 4B3SJ 5HL7Q 4MAKA 1HQEB 5G0RA 2WBRA 2QGFB 3HKZD 2Y8YA 4NLRA 2RMLA 2CQ1A 3IWXA 3VQTA 4MMOA 4K2XA 1T03A 1IR2A 1SV5B 2DNZA 1C4CA 3KDNA 4I2PA 1Y9OA 1HW9A 4AUKA 5U47A 5B09A 3M2UB 4IOBA 2H9ZA 4DL2A 2R7OA 2Y0BB 4NLQA 3V81B 1TL5A 4A8SA 1VRTB 2IAJA 4J9VA 2R8GA 5AXKA 3LGMA 1VC6A 4DL5A 4DPUA 2VF3A 2P6SA 2QJ3A 1KVKA 1QAXA 4F4YA 1RAFB 5GVQA 2BJ9A 1HBMB 2YQ1A 2QG9B 2BE2B 2PEHA 5A2QY 1JIHA 1AFIA 3MM9B 4DJBA 3D28A 1FF2A 4DV2F 3FVYA 4FXWA 1REVA 3W5XA 2DR7A 2IC3A 4B9MA 4DFPA 1NH7A 3V6DA 1CJVB 1O6XA 3HHLB 2MKSA 5ETMA 2ZJQQ 3BGLA 4I6YA 2B9WA 1JLGB 2CADA 2KN4A 4MFBB 4NLGA 2AEFA 2CNKB 4DL3A 4LR9A 1IKVA 1PG5B 1BC6A 2DHSA 3RBXA 4ATNA 1R89A 1O0PA 2B8PA 1QVGR 1P9QC 5J2PB 1HQEA 1OY9A 3A12A 1N5QA 3NGDA 4NYZA 3HJVA 5AE1A 2VFTA 1YWXA 3BREA 4KY3A 4F4XA 3H5UA 4RWWA 4DCOB 3GIMA 4HEA9 2L48A 1SKWA 1T8EA 3M2UA 1NM2A 3SZ2A 3A3NB 4PG8A 4GVLA 3N9UC 1PIEA 3V81A 1D9AA 1VRTA 4ECYA 4L6V3 4O0IA 3VGUA 2XQCA 5D4NA 5DG7A 2QA2A 1S0VA 2OKQA 1XNQF 4YS2A 3DN9A 4GRSA 5BYRA 3N01A 4X64F 1HBMA 4IKAA 5KFWA 1Z2ZA 3E3XA 3MWBA 3MMJA 4Y0FA 1HQUB 2XHWA 1S9EB 1GNKA 3NOCA 1XMQF 1RADB 1CJVA 2G1DA 4ZP9A 5I42B 1NK0A 2HHHJ 2OPRB 3I5CA 3NY0A 3OJSA 3HFKA 2EKNA 2N4CA 2EVZA 3TR5A 2RKIB 1QE1B 5B0FA 4MFBA 2M88A 1H73A 2RNEA 4ZLPA 4HYKA 3MFHA 4AYBD 2VUGA 4JI6J 3W60A 3GE9A 1N5VA 4L74A 4WFAQ 2CQGA 1U09A 5J2PA 2C28A 3DXBA 1ICEB 2F7VA 2CG8A 4R5PB 1GMUA 3FC9A 1GMWA 3GFZA 2LA4A 2YQ0A 4WK1A 2LP4A 1X9WA 4CLLA 5AE3A 2VKRA 3LP2B 4IG3B 3W66A 4PPDA 4IFYA 4DUYF 3UDLA 4USJC 2MZ1A 3I55S 5H9EK 4JP8A 3ADAC 3NNAA 2NR0A 2R8HA 5IOLA 4A47A 4CRJA 1D9DA 2BBEA 3GLJA 5ETRA 2RILA 2C2EA 2B7CB 2E5LJ 3JQKA 3FEYB 2IYGA 4LF8J 3SCLE 4YR3A 3EVMA 1SC4B 3UQSA 4DSEA 2AKWB 1HQUA 2COLA 2V34A 1UKUA 3OXLA 2DJWA 1N0UA 3K59A 1SL0A 4URQU 2CQ0A 3VR1A 2XB2D 4D3HA 1RISA 2RKIA 5AXNA 1ZTWA 1UJ5A 2XNQA 1QE1A 2DHXA 2MSSA 4QQBA 3GFHA 2WSCC 4B17A 2V8HA 3GV8B 4YY3J 2BM1A 2J8AA 4PUOB 2WOMB 3DCAA 3NEKA 1YZ6A 4R5PA 4P7VA 3UDVA 2JLGA 3MOZA 1KNZA 2V4JB 1Q8IA 3LP2A 5KFEA 4K4VA 2R8IA 4USUA 1KBRA 2JRSA 4B3SF 1RT7A 2W8LA 1FVSA 5JVHQ 1TKTA 3D9BA 5KFBA 2WRMA 4J9LA 2F9JA 4ZVFA 1FA0A 1FVQA 4BWMA 2DD8S 5KTQA 1S6PB 4JB8B 4K4WA 2YTCA 1A9NB 2RRBA 1EQMA 4ED6A 1X4DA 3CC2S 4M8LA 3G8TA 4RNNA 4ZVOB 5K8NA 3FRYA 2OMOA 4C8ZA 5B08A 3ZZTA 2GW8A 3BJYA 4OZ1A 1Z1ZA 4NRUA 4ZS6A 2HGLA 3A3PB 2DIUA 1S5ZA 3THVA 4RBTA 3FSIA 2P9EA 2ZJPQ 3SSRA 4DR7J 2C3PA 1MWYA 2QEXS 4JV2A 1KQGB 1WEXA 4OYOA 2FVPA 5F8LA 5AXLA 2W24A 1N8RT 2IA6A 4PUOA 4CLFA 3I9V9 4I7FB 4LR8A 1W2IA 3EWGA 4DN0A 2AP6A 2N3LA 2Q79A 4NZ6A 2DK2A 1PJ6A 3MEDB 1DBDA 2V4JA 1H7WA 1AYEA 5CABA 2K3IA 1G1XA 2A3JA 4RLEA 2YQ3A 2HVIA 1Q5VA 1S79A 2RRNA 4C6AA 4WP8A 4ZP7A 2MKCA 2DYAA 4C11A 1VQMS 3CB4A 4O23A 1FRKA 1UJ4A 4I69A 4KAIA 1IN0A 1UFWA 4RX6A 2CKWA 2PDAA 2FGCA 2IRUA 4OYAA 4CLTA 4N8NA 2ZD1B 4UOFA 1RB0A 2V6AA 2VA2A 3OPKA 2MPUA 1RHRB 4KQZA 4HVZA 5BR8J 3KJFB 2EFQA 1PSDA 2HSEB 3B54A 1LOUA 2OTLS 3BKUA 1ACMB 4PWUA 2DBBA 3TAMB 1SQEA 1R8CA 2XTJP 2HHQA 3NCQA 2OIHA 2ZH7A 1S1UA 2LECA 3DMJB 2H48B 2GFFA 3IR7B 3PKMA 2KM8B 3S1TA 4QWEA 2KB2A 1LNQA 1TL4A 1BWVA 4M5HA 3MAAA 4ZJOA 1M1HA 1M5VC 2VFRA 2ACYA 5HBMB 3UE2A 1R27B 1NPPA 2FHKA 3L7PA 3M30A 2HHHF 4N77A 2UU9J 1NEEA 1ZZFA 1IKXB 3OTCA 4I7FA 2HHPA 2ZE2B 1H2TZ 3MFIA 3ZC4A 2XG8A 1S0MA 2O1PA 1RWKB 4QIVA 4ANDA 1WOOA 2WZ1A 4JI6F 3QGHA 1XMBA 4RNFA 4CQ1A 1ZAWA 3HKWA 1I51B 3ZFVA 1A0OB 2CWXA 4DSIA 1UPMB 1KR4A 1JLQA 3CJ2A 2EFVA 3BO4A 4NCGB 2ZKTA 1UP1A 2CJKA 3OFEA 1N88A 3I5AA 4NLSA 3KDOA 2Q6CA 2NSBA 3KFWX 3BKFA 2XGQA 3C6UB 2DXFA 3BH6B 3F41A 4X4TA 2E5LF 4WYLA 3DGPA 3DMJA 4LF8F 2VFUA 1TL1B 4P2SA 3KLGB 2DNHA 1NO8A 4RKUC 2WW8A 5CZVA 3LTOA 2P5VA 3GV5B 3KLEB 1FHTA 3PO5A 3EGVA 1SC1B 3AT1B 3TAPA 1VBZA 2DXEA 2QLBB 3SI8A 4DFKA 3GILA 3FBCA 4TN2A 5HROB 1IKXA 3CW2C 5KFTA 1G2EA 4TY9A 2ZOGA 3PKYA 2HFOA 2ZE2A 4RUCA 1H6KX 3T1AA 3EICA 2Z2MA 2OMLA 1JXVA 2V67A 4K8RA 2WBMA 1QAYA 2C2KB 4USIA 3IS9A 5IWAJ 5B0DA 3PX0A 1APSA 5JMNA 3JTNA 3B82A 4YY3F 5KFDA 1Q8LA 2F40A 4KKOB 1S76D 2W2MP 2RQ4A 3W9JA 2VHGA 1C0TB 3MM5B 4ZLLA 1N52B 4OZ3A 4EO6A 1NKCA 2KH9A 2QC3A 5F9LA 4LUBA 4NCGA 1NJIT 3NGUA 5DDOC 3BGOP 3ZZZA 1GEHA 1ZAVA 3CMQA 1CJUB 4DFMA 2WB1D 1U4BA 3TOQA 4H4OB 3PO4A 1X5SA 1IBLJ 2AU0A 3SMZA 1SJ4P 2VG7B 1UW4A 5KFJA 1HBUB 3BBFA 1TL1A 3VVUA 2YKMB 3KLGA 3CDAA 3EPGA 4CNZA 3G6XA 3QT7A 1WWHA 2HQIA 4URSA 1HHQA 5HROA 3QAUA 1GMVA 3FEXB 4AFFA 4ELVA 4DR7F 2WSEC 2A1BA 3PYEA 4ES3A 1CS4B 2M5YA 3ISND 2CZ9A 1KSPA 3DU5A 1SQGA 2G0CA 3B78A 1C0TA 3MM5A 5SZTA 1GXTA 2RDJA 2Y1RI 1RACB 3PTWA 5HP1B 1HD0A 2L9DA 3JTOA 4OI6A 4FXVA 3T1HJ 1SH2A 3UN3A 4CH7A 4X66J 1CJUA 3NL0A 2X7IA 4USWA 4H4OA 2MGZB 2Y1JA 3QT8A 4DUZJ 1P1TA 2GJIA 2KU7A 3FK4A 1QTMA 1JX4A 1LXJA 2VG7A 1YRUA 2VBWA 3UNYA 4X65F 2YNIB 3BO2A 2KJVA 2YKMA 1R0BG 3QIPB 4B3TJ 2AEMA 5BR8F 1XR6A 4JI8J 1RLDA 1Y5IB 2YPZA 4Y3CA 1H2UX 2BEFA 1N6QA 4YB1P 3SV4A 4IG0A 4OYWA 2VJUA 2LQJA 4BDPA 2BOAA 4DXLA 3D3CJ 2FVCA 1R43A 3FCVA 1NHKL 2V94A 1OYEA 5F8MA 3VQSA 4U9RA 1JLBB 4MIBA 1CS4A 2UUBJ 4OX6A 1FFWB 1VHIA 3UR3C 2OEMA 1U6ZA 5DDRC 2XZDB 2KDOA 1XR7A 2FQQB 3GTYX 1I3OB 3D4JA 4CLKA 2UU9F 2DNPA 4QIGA 2EG2A 2UZAA 1KKHA 5G4DA 4PZVA 2V8DA 2GHVC 2BJ7A 4FKXA 1VQOS 2FHJA 4HTJA 4ID8A 1NZ8A 2GA7A 4KE5A 2CPEA 2QMUB 1URNA 1RAOA 2CPXA 1RT1A 1T02A 4ED5A 3EMTA 5CH7B 2LEAA 4U8VA 2MGZA 1KDNA 4ZVSB 3W61A 2V9WA 2X51A 4LF4F 1U2CA 4GMKA 4JV0A 2D9OA 4C0OC 5CXTA 3QIPA 1ZM3A 3P6YC 3L3CA 2J6TA 4ILLA 3TJ9A 3R5BA 4N5SA 3CCES 5CYJA 1U47A 4NLOA 1RZMA 2GNKA 2J5AA 4UUXA 3IM9A 3QPIA 4FYVB 1U6FA 4MKVA 3OTOJ 1JLBA 2E5JA 3H4BA 4OZNA 3SCKE 3RGIA 1YRXA 1LW0B 3TAQA 1WUUA 5KOWA 5EWGA 4RR5A 2R8KA 4DPXA 2ZITA 2AJQA 1F9FA 1TQLA 4IH5A 1UEUA 4KGKA 3H5SA 1EAYC 3GR0A 4Q43A 1QSSA 1GMWD 5IWAF 4DV7J 2ZC3A 4DSFA 2CJ9A 2RF2B 4K7QA 2MKIA 5M2RA 1YITS 4RWXA 2D74B 2AEJA 3M8PA 3QJJA 4DF8A 2GMJA 2F1FA 2QO3A 2M9KA 3UN2A 2P9GA 2X1AA 1BQNA 2B56A 2KT2A 2QSWA 1CQNA 5E3RA 2ASJA 4H4KA 4NLWA 2YX4A 3HZGA 2WHOA 4NI2A 3NG8A 1WKLA 3BH7B 2VZ9A 2GIQA 2HRYA 3QSYB 4ENOA 1IR0A 2I2YA 2Z56B 3QSIA 1NRKA 3P5BP 1IXKA 1M5PC 3D1QA 1PAUB 2G2OA 1HNXJ 1CJTB 1BHNA 1WOPA 2DHGA 3AD8C 1LW0A 2W4CA 3BYPA 5CYMA 4K59A 1RSCA 2FB0A 3EVWA 1VQ7S 3C6TB 1C1CA 2W7AA 1IKWA 3CCLS 3TW0A 1S1VB 4C48A 2CJBA 3M2VB 1VQPS 4X4PA 2M4MA 3CJ4A 5IQ6A 1OJ4A 4ZPVR 5DGAA 3AXKA 3AXMA 2IVYA 5F8GA 1JKHB 3CGIA 1TUGB 5H9EJ 4IUFA 4MT1A 1S1XB 4I1TA 4TYBA 1VQLS 1UEVA 4DBQA 1VR6A 4IOAQ 3M2RB 1YHQS 4DI6A 3VGVA 5IC6B 2MKKA 2LXUA 3C16B 3OHBA 4WFZA 1FD8A 3I96A 4ZP8A 4USTA 5EX3A 3RBDA 1X31C 3PX6A 3C15B 4QPTA 4X66F 1KWMA 3NGSA 4UUWA 2VBYA 4DUZF 3ILLA 1W25A 5D0EA 3M4XA 2BVZA 1EZZB 1KS2A 3DRYA 3NCRA 3OFHA 3CCTA 1FWLA 3QFWA 4A46A 4B3TF 2YWFA 4JI8F 2DRAA 2ZH4A 2MQNA 3PHEA 2YWHA 2CXEA 1GX5A 1AB8A 3CCRS 1WHVA 2CVEA 3IFEA 5J2MB 3DLBA 4J91A 4ZLNA 3M8YA 4C4WA 3LP1B 2C2RA 3L4BC 3C6TA 3L09A 1B70B 3U1LA 2EFPA 2BOPA 2O67A 1S97A 1S1VA 1OSCA 4OI0A 4LF9J 4Q0BB 3M2VA 3ETMA 4BLGA 3T6BA 2IBKA 2KXHA 2UUBF 3W5YA 1CG2A 4P72A 3AB2B 2HK3A 3LPEA 4B9LA 4DG1A 2QFIA 1JKHA 2D41A 3DGVA 3NGTA 4WXWA 5K8PA 2CNOB 1UZDA 1C2PA 5HMYA 4NXMJ 3HULA 4EGLA 4YHHJ 4U8YA 3C16A 3MEGA 4UF4A 1BUXA 3M9NB 2M8HA 3C15A 1Q81T 3QIDA 1M5OC 2VKZG 5KFRA 1B0VA 4HT5A 4S0MA 1TELA 3PHTA 2JLEA 3D54A 4DDFA 4PAAA 1VC5A 2ZEJA 3PNIA 4F2RA 1K44A 3QMQA 2YX7A 5DG8A 2AWZA 1FRXA 4KGMA 1JQGA 1TUWA 3JAMU 1MWQA 3PEHA 2NS1B 2AX1A 3CDUA 1TL7A 1N5YB 5J2MA 3DLKA 3HI9A 1LQ9A 1F5AA 3NBPB 2HW3A 2FLOA 7FD1A 4NA1A 3OTOF 5KG6A 4AL7A 3KLFA 2UUAJ 4OHYA 3I4PA 2KG1A 4KPYA 2AX0A 3MI7X 4X4UA 1NK4A 2ZFHA 3TZXA 2BJEA 3R7SB 1TFYA 2CWKA 4Q45A 4L73A 2KYXA 1HKAA 4DV3F 3EXCX 3TJ8A 4DV7F 1RCXB 4LBHA 2ZZMA 2C3YA 3HZEA 3PJXA 5HANA 5L39A 3N28A 2H5IB 4LRDA 1NK5A 1RT3A 3S6EA 5DDQC 5IQQA 1WKJA 3Q89A 3JAMY 1R8BA 1RTIB 2DXDA 3CD5A 1MROB 2ERRA 2C2ZB 5LXRA 4W4MA 4ED8A 1OYDA 3OTDA 2RIJA 3N5FA 1NSKL 4QWCA 1F5CA 3O6QA 4OYZA 4CO2A 4PR6A 1RT4A 5KT3A 1N34J 2VQFF 3M8QA 1RTDB 2BA9A 1QM9A 3L9ZA 1S1WB 2FVSA 1P1LA 3NBPA 4NLVA 2BANB 3OQ2A 4ZKAA 3BSCA 4HACB 5ETKA 1YQHA 1B7YB 5KFOA 1NDKA 2W2OP 4Y28C 2VPZB 4JYAJ 1S49A 1HYSA 1K0TA 1UVNA 3FGVA 5F3ZA 1JMTA 2HZAA 2R3VA 2Q6BA 5EUHA 3HXMA 1VFJA 4NWBA 2K7JA 4DQRA 1NHVA 3I31A 3OXFA 1WHYA 2DRDA 4TQRA 1NJWA 3ENAA 5D4OA 5KFAA 3M1VB 3MXHP 3MTJA 4B08A 3CCJS 5KG4A 2E1RA 3P5TL 3C19A 2EC2A 4N41A 3K5MA 3DRSA 2B43A 2PA8D 4OI1A 2HRUA 1Q53A 4KYZA 3MM6A 3KG1A 2IVFB 4MKYA 2JFKA 5IS2A 1YJTA 1F5BA 1MROA 3RB3A 4LIWA 5CA5A 4USVA 5IM0B 3MOJB 4CLZA 3TO8A 2ZUAA 1O5JA 3F56A 4BC9A 4LRCA 4QWBA 4WK3A 4J9MA 5CD4A 3K5NA 3M9OB 4A8WA 2QSFA 1RTDA 1CVJA 1S1WA 4WFBQ 2RUSA 2VV5A 2EBEA 1WELA 1X4AA 3H2UB 1SJ3P 3R7BB 4HACA 3MAQA 3KOAA 3VGSA 2I9SA 2AYEA 5KFHA 4RW4B 2R7RA 4A4JA 2B4VA 1A6LA 4PCQA 4PWWA 1DQAA 4ECVA 2B6AB 4LF9F 3M1VA 1CEZA 4ZOSA 4TKTA 3BSNA 3KLVA 4F2SA 2LDIA 5C25B 4DQIA 3EZOA 4GC6A 4J37A 4CI0B 2HPUA 4OV1A 3JQMA 3EZ5A 2KL8A 3LWLA 1EARA 2XLIA 2FPHX 3MUMP 3KUGA 4GO7X 3GMGA 3ISZA 5D6GA 4B9SA 1J5OB 2EFGA 2A10A 2W4DA 5IM0A 4N76A 3TA1A 5E3QA 1SH0A 5F0UA 1T11A 4ICLB 5E5NA 3R2CJ 1S9GB 2VFSA 2GVZB 3H20A 1S57A 1FESA 1EJ7L 5B0AA 4O3SA 3C2PA 2UXDJ 2O5DA 4ECZA 2CZ4A 3CT9A 4EWTA 3H25A 4WFYA 3NMRA 2H3EB 3TX8A 4ECUA 4ZVRB 3I0RA 2LXIA 4GO5X 5KG5A 4UQTA 2KXNB 1JXLA 2MQLA 3PYFA 3KHGA 3MMAB 2F8HA 5T41A 2B5JA 3IRWP 1TTHB 1EX8A 4RW4A 5F0WA 1FEHA 1WC5A 4Y00A 2PFFB 2R9LA 1VQ4S 2NXEA 3CJQA 2B6AA 3MCNA 4ECTA 1IJEB 2H4WB 3K17A 4DL0C 5C25A 2LEPA 3VALA 1T9UA 1X4BA 2GX8A 1S6UA 2I6WA 3TEHB 3PIOQ 2KT3A 1BE4A 3V5RA 1AZSA 5A8RB 3SQOP 1L5UA 1QSLA 5CHCB 2XGPA 1HPZB 1M90T 1XR5A 4DFJA 2LCWA 1J5OA 3LAMA 2F63A 1YIJS 4FYXB 2AQ4A 2CPZA
chains in the Genus database with same CATH topology
1HR0J 2UXDJ 1HNWJ 5IT9U 4JI3J 4AQYJ 4DV3J 1FJGJ 2MTLA 4DV2J 1HNXJ 3T1HJ 1IBLJ 4NEYA 1HNZJ 4JI0J 4X66J 4JI7J 4NEZA 4LFAJ 4X64J 5A2QU 4DV4J 4DV5J 2UU9J 3D3BJ 2MEWA 4GKJJ 4PWWA 4LF5J 4DUYJ 2KVQE 4DUZJ 2E5LJ 4DV1J 3J7AN 4JI1J 4K0KJ 4DR4J 4B3MJ 2F4VJ 4LF8J 4DV7J 4KHPJ 4B3RJ 4DR6J 4KYZA 4B3SJ 4JV5J 1XNQJ 1J5EJ 4X65J 4DR3J 4LF4J 4NXNJ 4LFBJ 4LFCJ 3JAMU 2HHHJ 4B3TJ 3IMQJ 5FLXU 4JI8J 4X62J 4LF9J 2ZM6J 1N36J 4JI2J 4JI4J 5IWAJ 1XNRJ 4GKKJ 2KL8A 3T1YJ 1XMQJ 2MQ8A 1N34J 1IBMJ 2UXBJ 1N33J 4HHUA 3W1YC 2VQFJ 5LM7E 3R2DJ 4JI6J 4DV6J 4V1Ak 3D3CJ 5BR8J 4JI5J 5LMUJ 5LMNJ 4KY3A 2UUAJ 4RJVA 4DR1J 4DR2J 4DR5J 4OX9J 4LF6J 1XMOJ 1I94J 2UUBJ 4DR7J 3R2CJ 4YY3J 5AJ3J 1IBKJ 3J80U 4NXMJ 2UUCJ 4LF7J 4YHHJ 4JYAJ 2VQEJ 1N32J 2UXCJ 4DV0J 3J81U 3OTOJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HR0 J;  2UXD J;  1HNW J;  5IT9 U;  4JI3 J;  4AQY J;  4DV3 J;  1FJG J;  2MTL A;  4DV2 J;  1HNX J;  3T1H J;  1IBL J;  4NEY A;  1HNZ J;  4JI0 J;  4X66 J;  4JI7 J;  4NEZ A;  4LFA J;  4X64 J;  5A2Q U;  4DV4 J;  4DV5 J;  2UU9 J;  3D3B J;  2MEW A;  4GKJ J;  4PWW A;  4LF5 J;  4DUY J;  2KVQ E;  4DUZ J;  2E5L J;  4DV1 J;  3J7A N;  4JI1 J;  4K0K J;  4DR4 J;  4B3M J;  2F4V J;  4LF8 J;  4DV7 J;  4KHP J;  4B3R J;  4DR6 J;  4KYZ A;  4B3S J;  4JV5 J;  1XNQ J;  1J5E J;  4X65 J;  4DR3 J;  4LF4 J;  4NXN J;  4LFB J;  4LFC J;  3JAM U;  2HHH J;  4B3T J;  3IMQ J;  5FLX U;  4JI8 J;  4X62 J;  4LF9 J;  2ZM6 J;  1N36 J;  4JI2 J;  4JI4 J;  5IWA J;  1XNR J;  4GKK J;  2KL8 A;  3T1Y J;  1XMQ J;  2MQ8 A;  1N34 J;  1IBM J;  2UXB J;  1N33 J;  4HHU A;  3W1Y C;  2VQF J;  5LM7 E;  3R2D J;  4JI6 J;  4DV6 J;  4V1A k;  3D3C J;  5BR8 J;  4JI5 J;  5LMU J;  5LMN J;  4KY3 A;  2UUA J;  4RJV A;  4DR1 J;  4DR2 J;  4DR5 J;  4OX9 J;  4LF6 J;  1XMO J;  1I94 J;  2UUB J;  4DR7 J;  3R2C J;  4YY3 J;  5AJ3 J;  1IBK J;  3J80 U;  4NXM J;  2UUC J;  4LF7 J;  4YHH J;  4JYA J;  2VQE J;  1N32 J;  2UXC J;  4DV0 J;  3J81 U;  3OTO J; 
#chains in the Genus database with same CATH topology
 4HHJ A;  3AY0 A;  5GAG I;  1WDT A;  4NZ7 A;  2JH3 A;  1TK5 A;  4XO0 A;  1FDA A;  3OR2 A;  4XTT A;  1NPR A;  5KT4 A;  1XTZ A;  2I5J A;  3CC7 S;  2AD9 A;  2BJD A;  1DHM A;  2VFV A;  3A13 A;  3MMA A;  2V5H G;  2NXN A;  1H7X A;  1KC8 T;  2CQ3 A;  4NXN F;  2RE1 A;  2GQQ A;  3HD1 A;  2ZM6 J;  1U1Q A;  1RK8 A;  4X84 A;  4GKK J;  4A8Q A;  1OIA A;  4ILM A;  4Z7Y A;  2FZC B;  1IBM J;  2UXB F;  1R8P A;  4JYA F;  2XMU A;  3H4D A;  4C98 A;  3GII A;  3CIM A;  3OUY B;  2XO7 A;  4QR1 A;  4ED3 A;  3K0J A;  4LF6 J;  1UVM A;  1M5K C;  1LWC B;  3F0N A;  3HVT A;  2BXJ A;  3E01 B;  2VQE J;  5F41 A;  3OHA A;  1JLF B;  4J9R A;  4OV6 A;  2GHP A;  3GIK A;  4NE9 C;  4K5R A;  4P75 A;  1FJG J;  4F02 A;  2W4P A;  1NK9 A;  1WC0 A;  3UNG C;  4R0J A;  4CDI A;  3EM1 A;  5JXS A;  4U96 A;  5A8K B;  2FY8 A;  1WHX A;  8ATC B;  5C42 B;  3OL7 A;  2RU3 A;  4FF1 A;  2HVE A;  2HS4 A;  2LVW A;  2GJF A;  3GJQ B;  5FLX U;  2HHT A;  3G96 A;  2N7Y A;  4F3Q A;  4X62 J;  1YJW S;  1NB7 A;  4CWB A;  4JUZ A;  2XI3 A;  2Z8Q A;  5ETL A;  1F9E B;  3WHI A;  4OJ3 A;  3NS7 B;  2QV6 A;  4DV6 J;  5IT4 A;  1F2G A;  1NCL A;  3EDQ B;  4PQA A;  3NOG A;  2G9O A;  2NXJ A;  2R7X A;  2YH1 A;  1PCA A;  3FCW A;  1ZYQ A;  5EGY A;  1FE0 A;  2B7B B;  1U49 A;  2GVD B;  3DHW C;  1GFW B;  2Y9H A;  1Y5N B;  4EYH B;  3CDW A;  5D3G B;  2MB0 B;  2NXU A;  2AJ2 A;  3MPV A;  3IBW A;  2XYP B;  3LGN A;  2FUG 9;  1RHQ B;  1LWC A;  3KMQ A;  2PFD A;  4KGV B;  4CO5 A;  3VZI A;  3GWC A;  2ZOF A;  5A0Y A;  3E01 A;  4CCH A;  4WTY A;  4TYA A;  1JLF A;  4QU7 A;  3MEE B;  4RW9 B;  3H90 A;  3MM8 B;  3ONQ A;  2WVE A;  3H40 A;  4B9T A;  3MMB B;  1RAJ A;  1UFL A;  3KJN B;  5K5M A;  3K89 A;  4K0K J;  1RUS A;  3PR5 B;  1B3T A;  5ADZ A;  2KG0 A;  3GFY A;  5A8K A;  3PYG A;  4LFB J;  3ZXW A;  1GX6 A;  1XJW B;  1XN9 A;  2VG5 B;  3WBZ A;  2FJW A;  2PGC A;  3CIZ A;  4LRB A;  4XIU A;  4KRW A;  4RW7 B;  4LSL B;  4WFX A;  4P9S A;  5EDW A;  4OZ5 A;  1F60 B;  3BBB A;  4OX7 A;  2GQ2 A;  5E2Q A;  3HFV A;  1AXQ A;  1PO6 A;  2UXD F;  2CJA A;  1Y00 A;  2A2D A;  2DIV A;  2J7W A;  5ETO A;  4KO0 B;  1QLN A;  4C0H A;  2QL7 B;  4CM2 A;  2FJV A;  1P6T A;  4CO1 A;  2UUC F;  3EZU A;  2M0G B;  1WSR A;  2YY3 A;  3MD1 A;  2CRL A;  3CMA S;  2CPH A;  4M5D B;  2JL9 A;  4RO0 A;  4HR2 A;  3ZTS A;  3JSR A;  1HNV A;  2QYG A;  2DNN A;  5D3G A;  5LJ3 Y;  5H9F K;  1F2H A;  3QO9 A;  1LW2 A;  1S10 A;  1PC5 A;  2RVJ A;  3HT3 A;  2WCX A;  3FSX A;  4PWD A;  2E7V A;  2CPD A;  2B4O A;  4P73 A;  4CTA B;  3E2E A;  3MEE A;  2FC8 A;  3MM8 A;  4U67 Q;  2FHO B;  4B3R J;  1GXL A;  4HHH A;  2KZZ A;  1JNZ B;  1AW0 A;  4F4Z A;  1HWK A;  4LFC J;  1T9V A;  3CJ3 A;  2FJA B;  3D6T B;  4FPR A;  2JEF A;  3KHH A;  1OWX A;  4CO0 A;  1MLA A;  4ZCM A;  2G0I A;  2ALY B;  2MQP A;  1RCO B;  2B4P A;  4B9U A;  4RW7 A;  1R8H A;  4LSL A;  1V3S A;  1H3D A;  3BGR B;  2HYI B;  2N4D A;  2L9N A;  5EWF A;  3ZTQ A;  4TY8 B;  3BF4 A;  4NL5 A;  4ZP6 A;  4RBU A;  1ZBT A;  3W62 A;  4DV0 J;  4I67 A;  4USK A;  3KJQ B;  1Y5L B;  4PXD A;  5HQ8 A;  2WTF A;  2PI5 A;  2XMK A;  2MZR A;  1KTQ A;  3TRG A;  2HMI B;  4KO0 A;  4G3I A;  4NRT A;  1DQ9 A;  4LF2 A;  2IJN A;  4HDG A;  1UET A;  2HQ3 A;  4M5D A;  3O1L A;  4WBF A;  2OSQ A;  3UFC X;  4L75 A;  3G2X A;  1Q5Y A;  2ZM6 F;  3AH6 A;  5I3Q A;  2GIF A;  3I87 A;  2ADB A;  4J5O A;  3RBE A;  3OW2 R;  4FN5 A;  1WG1 A;  3KK3 B;  2MYF A;  1IBM F;  2DCU B;  1HAR A;  4L3K A;  3DNC A;  4B9N A;  3OLB A;  2CDQ A;  4A8F A;  3J81 Y;  4LF6 F;  4OHV A;  4XPE A;  2NRE A;  3DLE B;  4NOH A;  1UVL A;  2AF6 A;  3BQ1 A;  2AJ0 A;  1S6Q A;  4U95 A;  1KFD A;  3HJF A;  2CQB A;  4DN9 A;  3H59 A;  2KO1 A;  3UR0 A;  2MZQ A;  4LF1 A;  3BGR A;  4UW2 A;  3A1Y G;  4DWI A;  2MST A;  1LWE B;  4TY8 A;  5J2N B;  2R2R A;  3PW0 A;  5K8M A;  1YVF A;  1HNW J;  3PAC A;  2EFN A;  2V4R A;  3GCW P;  4DV2 J;  4DMZ A;  1RWV B;  5KFC A;  5L8R C;  4DV4 J;  2HMI A;  3V4I A;  3BSA A;  1F6T A;  1MMD A;  3VAK A;  3HHL C;  4X62 F;  1VBX A;  4Y65 A;  3TEG A;  4U7C A;  4J9O A;  1SUQ A;  2U1A A;  2ZNY A;  1MSW D;  5C24 B;  3TX0 A;  4DV6 F;  2HG4 A;  2Y0S D;  5CZX A;  2W01 A;  3G6V A;  2OPS B;  1FXR A;  1CBK A;  3WZ0 A;  3MD3 A;  1FCA A;  3Q8R B;  1UEK A;  4EMD A;  2IDL A;  4CO3 A;  1WSV A;  4W92 B;  1WF1 A;  5AXM A;  4J9S A;  3C8Y A;  5D15 A;  1RLC L;  5GAG U;  2H5J B;  4WTO B;  1UMJ A;  3FFI A;  3DLE A;  4O4R A;  2OUG A;  1HI1 A;  3A8K A;  1NHU A;  1I94 J;  2GAG C;  2AYM A;  2J8S A;  3PRV A;  4NLD A;  2HWH A;  5IT9 U;  4K0K F;  2MTL A;  4U7U D;  2K3K A;  2AGO A;  2ZOM A;  1LWE A;  3GYG A;  5J2N A;  3MR2 A;  4X64 J;  4LFB F;  3PV8 A;  2L41 A;  3DDK A;  1U2F A;  1NH8 A;  1FWK A;  3DU6 A;  3CCS S;  2CNL B;  1NXI A;  2JLF A;  1DFD A;  3NWR A;  1K0V A;  4B3O B;  2KFZ A;  5C24 A;  5HN0 A;  3HF5 A;  3CPW R;  2DNM A;  2OPS A;  1SJ1 A;  1HD1 A;  3Q8S B;  3PX4 A;  3KTQ A;  4YB6 A;  2CZV C;  1TV6 B;  4ECX A;  2V4Q A;  1L3T A;  3VAJ A;  1V6H A;  3RBZ A;  1WJ9 A;  4OX8 A;  4XDC A;  3LA0 A;  3MF5 A;  2EG1 A;  3OXG A;  1LFW A;  3NS5 A;  2AZ1 A;  2DNO A;  4B3R F;  3D2W A;  2RJZ A;  3JQJ A;  4LFC F;  2XY7 A;  2XSF A;  2OP5 A;  1E6V B;  4ED7 A;  4PRF A;  4PPZ A;  5KFL A;  1ZTT A;  4JI1 J;  3TI0 A;  3VGT A;  1H2V Z;  1EKS A;  5D0H A;  1PYO B;  2IAJ B;  1RJJ A;  2MY8 A;  1X8D A;  1XK8 A;  3C14 A;  2ACM A;  3PW2 A;  2F3J A;  1JXE A;  2ZBQ A;  1U2R A;  5J2Q A;  3PRD A;  3CC4 S;  5KG0 A;  4B3O A;  4DV0 F;  5I4M A;  4WKY A;  1D1U A;  3CJ5 A;  4OYX A;  3PEJ A;  4EZ9 A;  1BD6 A;  3V6D B;  3AD7 C;  5B0E A;  2BAB A;  3M9M B;  1TV6 A;  5HAT A;  4RL1 A;  2NYI A;  5H1S V;  3AOD A;  4I6A A;  5DO2 A;  2BUN A;  1JLA B;  3LAL A;  4OYP A;  4A8Y A;  1ZET A;  1WEY A;  1SI9 A;  3RRG A;  2RQC A;  4ELU A;  4N56 A;  4Q8F A;  1X4H A;  4BWJ A;  5GAH I;  4RZR A;  1BMQ B;  1H74 A;  3ILO A;  1XIQ A;  4Y2M A;  2J7K A;  2POK A;  3J7Y I;  2HVD A;  2AT1 B;  2I8E A;  2KI2 A;  2H5E A;  1E6V A;  2CQD A;  1Q8B A;  2GQC A;  2W2P P;  3FQL A;  5ETV A;  3I5B A;  5B0B A;  1RAE B;  3GYN A;  1YSJ A;  2XWY A;  4DL7 A;  2QRR A;  2IMO A;  1WTF A;  4DL4 A;  4O0N A;  4CLY A;  2QLX A;  4YN3 B;  5EX0 A;  1NB2 A;  1S9F A;  3A4T A;  4LSN B;  1HNW F;  3O3L A;  2LQ9 A;  2GC8 A;  1TK8 A;  4DS5 A;  2HBZ B;  2XLK A;  4UZC A;  3DDI A;  1N32 J;  1Q1K A;  4RUH A;  2FHM A;  1RAH B;  5M2P A;  4DV4 F;  3NNH A;  1FRM A;  4CYU B;  2GMH A;  1T05 B;  1Q7Y T;  2JDJ A;  1RU1 A;  3TAR A;  1JLE B;  5DM7 Q;  3MUT P;  3RW7 A;  2XO6 A;  3M32 B;  1RWO B;  2ALZ A;  3SYZ A;  1JLA A;  1PGZ A;  2DKO B;  1WKK A;  1B0P A;  1FJ7 A;  1ZM9 A;  3H7H B;  2ZH9 A;  4ZJQ A;  2XCP A;  4UY8 T;  2BV3 A;  5KFQ A;  2VOP A;  4RPF A;  3ILJ A;  3K7R A;  4RU9 A;  2ZH2 A;  3P4U B;  1FXL A;  2MQO A;  2NZ4 A;  1I94 F;  4IFY B;  3VWS A;  5KT5 A;  3BM7 A;  4DOZ A;  3BR8 A;  4V19 J;  3BDE A;  1S0N A;  4ZCK A;  2CJX B;  3I4H X;  2DR6 A;  1JB0 C;  3SIP B;  3QAE A;  2VIH A;  3G82 B;  2AV5 A;  2VG6 A;  4LSN A;  3EGZ A;  2HQF A;  4WU2 A;  2KM8 C;  2BM0 A;  4DHV A;  2YWK A;  4K4T A;  1FX4 A;  3BEG B;  4G6V B;  2FZG B;  2C22 A;  1U8S A;  2DO0 A;  3DRX A;  1RAA B;  1R31 A;  2O3D A;  4KBI A;  2J0X A;  3QLH A;  3PDN A;  4FBU A;  2I38 A;  3TUZ C;  3LOU A;  3MR5 A;  1RWW B;  4CYU A;  1DTQ B;  1JWW A;  1T05 A;  3VHQ A;  1WEZ A;  2ZKU A;  3BN7 A;  1JLE A;  4RU2 A;  2P2C B;  1OPI A;  4TQS A;  1FKO B;  1RE1 B;  2GHW A;  2HS3 A;  3M32 A;  3KK2 B;  1FRJ A;  4C0B A;  4OYI A;  3LWM A;  5MAO A;  5CQG A;  4ZPA A;  3FZB A;  2ATC B;  3M6U A;  3Q8Q B;  2BAC A;  1N36 J;  1FDN A;  2HLU A;  2CYY A;  2MLX A;  3HSZ A;  3Q8U A;  2DNK A;  1YLX A;  2E29 A;  1RT7 B;  2L08 A;  4O3O A;  3HP6 A;  1TKT B;  3U1M A;  3T5J A;  2V68 A;  4X4Q A;  2JFD A;  1UJ6 A;  3R3T A;  2J9C A;  4C8K A;  3W7B A;  4ZVH A;  3QFH A;  2DIT A;  2DH8 A;  4EBC A;  1HWL A;  1CC8 A;  3IM8 A;  3R5J B;  1VJW A;  1ZPW X;  3G82 A;  3MM7 B;  2RU9 A;  4JI1 F;  4K2J A;  3CD0 A;  4ETX A;  4KC5 A;  3W2V A;  4LT6 A;  3BN4 A;  4RBV A;  4ILR A;  3CJT A;  3NS6 A;  5E33 A;  3CD7 A;  2BRL A;  3CJK A;  1YJU A;  2B0G A;  3TJA A;  2F4V F;  3HVA A;  1DTQ A;  1FXD A;  5L1K A;  4J9Q A;  3X1L B;  3FRZ A;  1UA0 A;  1FKO A;  3D66 A;  1U6B A;  2E9Z A;  2Q3P A;  2OPP A;  3UW1 A;  3KK2 A;  3NGR A;  3P3D A;  1NSQ A;  1WHW A;  2O66 A;  3QGI A;  5THW A;  1KVI A;  5BJR A;  1SH3 A;  6AT1 B;  1WOS A;  4MYT A;  1NK6 A;  4C8L A;  3CJ0 A;  4ZJL A;  1YGY A;  4AL6 A;  1VIS A;  2XMW A;  2IM0 A;  1S72 S;  2PSZ A;  5DZ6 A;  3LGH A;  2D69 A;  2QE5 A;  2PC6 A;  4OJG A;  1AT1 B;  2YX1 A;  3RTV A;  3J80 U;  1WNE A;  2PT0 A;  3D6M B;  4C11 B;  2O01 C;  5CCM A;  3PM9 A;  6FDR A;  3NRB A;  1VRQ C;  2I0X A;  3IO1 A;  4AQY F;  2KKH A;  5DS7 A;  4OHW A;  3FKB A;  2JEI A;  4ZVE A;  1RA6 A;  2N7C A;  4JI7 J;  1ZZN A;  2CG4 A;  4OHX A;  2H4Y B;  3MM7 A;  2UUT A;  1DTT A;  1VK8 A;  2A6O A;  3G4S S;  1OY6 A;  5HAO A;  3GB0 A;  1NZA A;  4F04 B;  3WQP A;  1IJF B;  2DPJ A;  2RS2 A;  2IFX A;  3L7O A;  1S1U B;  3MPU B;  4A48 A;  1S59 A;  2YWW A;  2FY1 A;  2ZBR A;  3BYR A;  5HMZ A;  2W8K A;  2DGS A;  2NSC A;  3MAA B;  3L7U A;  1MML A;  5H9F J;  2CIM A;  2J9D A;  1S77 D;  3WC2 A;  3VAH A;  1N32 F;  4Z2X A;  3RUB L;  1VDH A;  4C3K A;  2V2K A;  2GML A;  5B0C A;  4FS1 A;  3J80 Y;  4FYY B;  4A8O A;  3M30 B;  2FZK B;  4DR1 J;  1NSP A;  3TP2 A;  2BYC A;  4CZC A;  3Q0A A;  3H98 A;  1SPB P;  1TL3 A;  2UXC J;  3KLI B;  1LFP A;  1B7F A;  3TZY A;  4WZM A;  5J1E B;  3F44 A;  4BBY A;  2ZBI A;  3IG1 B;  1LV5 A;  3U27 A;  1IBC B;  2ROE A;  3DLL Q;  3AOA A;  2VDH A;  3RB0 A;  1UAW A;  4NEZ A;  4DLE A;  2V0N A;  1FK9 B;  3BBC A;  1RHM B;  2DNR A;  3TA2 A;  4TNO A;  1JLQ B;  1LKZ A;  3MPY A;  1U26 A;  4ZVU B;  4QBU A;  2D3O 1;  3N4W A;  4X65 J;  4DQS A;  2NXC A;  2LA6 A;  3KJV B;  3QQC D;  4LBP A;  1G7C B;  2LMI A;  3SQG B;  4P6Q A;  1HWU A;  4G1I A;  2CUY A;  3KYL A;  1WC4 A;  3DGP B;  2J0Q D;  2B51 A;  1HWJ A;  2GO9 A;  3IN5 A;  4WPA A;  2HQG A;  4RJV A;  4I56 A;  2RB7 A;  4ZHR A;  4O44 B;  3B8H A;  2VOO A;  2B3T B;  4WF9 Q;  3M6W A;  5GAH U;  1ZS6 A;  1O51 A;  2QMW A;  3UPF A;  3Q83 A;  1ZOT A;  3KUH A;  2XLJ A;  3J7Y U;  2LLZ A;  3PIP Q;  4RNH A;  3H2V E;  3KLI A;  2CVI A;  4OHZ A;  2YKQ A;  4JI0 J;  5J1E A;  3IS9 B;  4ERD A;  3W8P A;  3IG1 A;  5T7L B;  5IT0 A;  4ZN3 A;  4FF3 A;  2ZHB A;  2DNY A;  2KVQ E;  1N36 F;  4LRE A;  1FDD A;  3H5Y A;  3KHL A;  2IM1 A;  2HVH A;  4JV1 A;  1RWP B;  1FK9 A;  1B4S A;  1CJK B;  4F7V A;  1BXN A;  4LF4 J;  5LL6 d;  4PG6 A;  4F67 A;  3PR4 A;  2JHE A;  1NDL A;  3EUN A;  4FYW B;  4ALZ A;  4H4K C;  4NA3 A;  4PYD A;  3KJV A;  1VBY A;  3EX7 B;  1N33 J;  2PO4 A;  5B7W A;  1FI4 A;  4YDX A;  4RW6 A;  3SQG A;  4NLX A;  2W9C B;  1HI0 P;  2DB1 A;  1HIY A;  3IXQ A;  2EC0 A;  2XYH B;  1ROF A;  3QWP A;  3CCM S;  2QLW A;  1SXL A;  5LSR A;  1Q16 B;  1GTE A;  2XEX A;  2WON B;  2CQP A;  4WJB A;  2VB6 A;  2G0J A;  2HHW A;  2OLW A;  2X1B A;  4O44 A;  4RW8 B;  3W8G A;  2JC0 A;  1DJ0 A;  3AQP A;  5CD4 H;  5KFN A;  5HLF B;  3IBC B;  3IR6 B;  3ELH A;  3G71 S;  4DV5 J;  3MCO A;  4F0K A;  2J6S A;  1YZ7 A;  1GTH A;  2ABY A;  3R97 A;  1X0P A;  3MPW A;  4RNM A;  3I6P A;  3LP0 A;  2RS8 A;  5T7L A;  3DRP B;  2FJX A;  3E8O A;  1J2V A;  4X4N A;  4F4W A;  3GP9 A;  4N7T A;  5FDL A;  1CJK A;  5L38 A;  1U02 A;  2UV8 G;  2K2P A;  4DX6 A;  3ITH B;  1T9T A;  2IA0 A;  4I64 A;  4A8M P;  4J9U E;  5A8W A;  4PG4 A;  2QLJ B;  1M5H A;  3ZZP A;  4HI2 A;  4O3Q A;  1RQ0 A;  1QAJ A;  1FT8 A;  3OL8 A;  1RA7 A;  2WK4 A;  2XY6 A;  2LQB A;  3CNQ P;  2CJY B;  4P2F A;  2YNG A;  4JI7 F;  2W9C A;  4NML A;  4WIQ A;  3GPA A;  2V2Q A;  2WON A;  4YME A;  1K8A T;  1N6Q B;  1UWB B;  4RW8 A;  4B9V A;  3BPS P;  3Q86 A;  4IG0 B;  3R8Y A;  1VI7 A;  3JXO A;  3O2I A;  4L72 B;  4C8M A;  1IWG A;  2RQK A;  2ZH6 A;  5E3A A;  5HLF A;  3HSG A;  1RBA A;  5GMD A;  2ROG A;  1WTB A;  3IAM 9;  1U7L A;  4OZL A;  4HH1 A;  4DR3 J;  3LO3 A;  3KWM A;  4IH7 A;  2DGW A;  2F5G A;  4DR1 F;  3RR8 A;  2Z58 B;  2VD3 A;  4OYM A;  1Q79 A;  3DRP A;  3KKF A;  1IVZ A;  1OS5 A;  5HJX A;  2KYZ A;  1HBN B;  2RT3 A;  2K7K A;  2UXC F;  2QIF A;  2BKP A;  4LQ3 A;  2JOQ A;  4NLU A;  1QJH A;  1S12 A;  3CDB A;  3ITH A;  5HQL A;  1PYS B;  3AAW B;  2W2N P;  2XHC A;  1HBO B;  3MR7 A;  1RT1 B;  1RP5 A;  2HFN A;  1IBK F;  1FNO A;  5JVG Q;  3UD5 A;  2ZDO A;  2ATL A;  2KRB A;  4OFZ A;  2VIC A;  2QN6 B;  2E44 A;  2UVU A;  3D0G E;  3GON A;  1T9W A;  4UQG A;  1Y4Z B;  1IKY B;  3K2Y A;  2YNF A;  5HJY A;  3OJU A;  2E9T A;  2Y8W A;  3JS9 A;  1VBK A;  1UWB A;  2RAQ A;  3GSI A;  2W9A A;  3PXG a;  2HIY A;  3M8S A;  2FJD B;  3KXD A;  4B02 A;  2D3O R;  4YQW A;  2OFG X;  3TVZ A;  3FEZ A;  1U1R A;  2YKN B;  3RU0 A;  2XYG B;  4JI4 J;  1IQZ A;  3CSK A;  2CQ2 A;  3LAK A;  3QRP A;  3CO9 A;  2LU2 A;  3CCQ S;  4P52 A;  1JJH A;  2OEJ A;  3QJP A;  1RT2 B;  4OLO A;  1HBN A;  3PYD A;  2J7U A;  4QZV B;  1K9M T;  4AD6 A;  5L46 A;  4J90 A;  2B9Y A;  4JBC A;  4JI0 F;  2U2F A;  5L1J A;  1VC0 A;  1HBO A;  4K4U A;  1R3N A;  3AA8 A;  2OSR A;  4F4A A;  4I68 A;  3M8P B;  1PBU A;  2RH3 A;  2E66 A;  2J6U A;  4I0W A;  4HLB A;  1BQN B;  1N48 A;  4H4M A;  1RAI B;  3I9Z A;  4AL5 A;  2GS8 A;  1VHF A;  2MEW A;  4FP9 A;  2X3G A;  4C97 A;  1IKY A;  2XS5 A;  3HHE A;  4ZVQ B;  1VIO A;  4YP3 A;  5AT1 B;  4NI2 B;  2V50 A;  4PG7 A;  1PYT A;  1N33 F;  1FE4 A;  2BDP A;  2PA3 A;  4LMZ A;  3JYT B;  1TMM A;  1VLO A;  3RAX A;  1UPP A;  5DGB A;  1H38 A;  1Q7L B;  2HBY B;  2R7S A;  3T1Y J;  2ZH1 A;  4Y2A A;  2DHH A;  5LM7 E;  2YKN A;  2JEJ A;  2VPW B;  4ZIV A;  3DYA B;  2VAS A;  5KG2 A;  4ZVT B;  5CYM B;  2VH7 A;  1TVR B;  3ZTR A;  5FJ4 A;  1VRU B;  1C1C B;  4QU6 A;  4NCB A;  1IKW B;  1RT2 A;  1N54 B;  4DV5 F;  3RB6 A;  1M1G A;  4HL9 A;  1G6B A;  4NLY A;  4ELT A;  3IRX B;  5DJB A;  1QDU B;  4DV3 J;  5HVG A;  1NLK L;  3OVS A;  4P10 A;  3HVR A;  2HND B;  1U25 A;  3EE3 A;  2R7W A;  3K57 A;  1OMS A;  2HBQ B;  4DU7 A;  1HMV B;  2EI5 A;  5L9X A;  4PQU A;  2Q43 A;  4DL6 A;  3CO0 P;  3IMQ J;  4F8R A;  3RB4 A;  1RKI A;  3G86 A;  2E5G A;  3A3O B;  3LH2 S;  3HVW A;  3JYT A;  3CVK A;  1R0A B;  2VQF J;  2V69 A;  4QYR A;  3DLG A;  4Q2M A;  3HHK A;  2AJ4 A;  4UOG A;  3B4M A;  3MUR P;  1WDD A;  2JZ5 A;  4ZPD A;  4P7T A;  1LEO A;  3DXS X;  4E2F B;  4DS4 A;  2BKN A;  4MKA A;  2AHO B;  3DYA A;  1MWZ A;  1T3O A;  3O5T B;  3T41 A;  2KVI A;  5KFK A;  4NX9 A;  3FZ2 A;  2OGU A;  2DH9 A;  2J76 E;  2CPI A;  4DSJ A;  5GAE I;  1TVR A;  3G87 A;  1VRU A;  4KFB B;  4Z37 A;  1SV5 A;  2F65 A;  1U48 A;  1U0H B;  2X1G A;  3OLA A;  4FNI A;  2DIS A;  3CWJ A;  4DR3 F;  3IRX A;  3H5X A;  2RQM A;  3D3B J;  3N6M A;  2I1R A;  1OO0 B;  1EB0 A;  5A76 A;  3U02 A;  4DG1 B;  2HND A;  3GFX A;  1HQ2 A;  1YX2 A;  5KT7 A;  2IJR A;  1HMV A;  2BE2 A;  3G8Q A;  3DOK B;  3AFG A;  3MM9 A;  2F4F A;  4F3M A;  1HLW A;  3MEG B;  2NCK L;  2VA3 A;  4F3O A;  3BZQ A;  3A8E A;  4F0M A;  3SXL A;  5LXY A;  4YB7 A;  1TAQ A;  3HHL A;  3R1L A;  2Z30 B;  4CO4 A;  2PMZ D;  3IR5 B;  4AE5 A;  4UZB A;  1JLG A;  1GAO A;  3W64 A;  4DR5 J;  1R0A A;  1RXO B;  3TVY A;  2ZNZ A;  1UWA A;  4DQQ A;  4LF7 J;  1M1K T;  1T7P A;  2AIR B;  2MKH A;  2H51 B;  4KR0 B;  2GAH C;  3SDE B;  1YKW A;  1UZH A;  3DRR B;  5ETS A;  4FS2 A;  3TQ1 A;  2A6M A;  1TL7 B;  1W26 A;  4M94 A;  4NA2 A;  3DLK B;  2NQP A;  2J0S D;  1GXU A;  2IM2 A;  4KFB A;  1WF2 A;  4HKQ A;  3MTK A;  2H1Y A;  3ZZR A;  1N5T A;  1U0H A;  4CLP A;  3KLF B;  4JI4 F;  4PAB A;  2V2Z A;  2E7X A;  4KPC A;  2XZW A;  1J5E J;  4UOC A;  2ROP A;  4X4R A;  2CDR B;  3WDO A;  2R7T A;  3RRH A;  4ETZ A;  1H98 A;  3R9L A;  1R7I A;  2KXF A;  1SB6 A;  4OJ1 A;  4HH0 A;  1QY7 A;  3W5Z A;  2RHS B;  3DOK A;  1C0U B;  1NJX A;  1RDR A;  2CQH A;  2VON A;  3OR1 B;  4Q7A A;  1S9E A;  3VV2 B;  3OT9 A;  1LK7 A;  5LMN F;  2BE9 B;  4M63 A;  1RT3 B;  5HMX A;  3C46 A;  5B0G A;  1K47 A;  5I42 A;  3FBF A;  2OPR A;  2HZC A;  5CCL A;  2DNQ A;  1YDL A;  3TA0 A;  2B9X A;  4EZ6 A;  1FWP A;  2D3U A;  3NNC A;  3T5H A;  3BQ2 A;  1VQ6 S;  3PCO B;  4Y34 A;  3SDE A;  3UCZ P;  3RW6 A;  2M3D A;  2AMC B;  1RT4 B;  4ANE A;  4WYW A;  3DRR A;  2GZO A;  2CJQ A;  1U24 A;  4LJM A;  2VC1 A;  3KUE A;  3M8Q B;  5DDP C;  1VYA A;  1UA1 A;  4ECW A;  3TWZ A;  4IG3 A;  1SQF A;  3T1Y F;  3VAF A;  4DLG A;  4O3P A;  2BMB A;  1X4F A;  1KQS R;  4K50 A;  1BQM B;  3QZ7 A;  4DPT A;  1HYS B;  1S1T B;  2FIU A;  2OTJ S;  3IGV A;  4QJV A;  4QWD A;  3OTE A;  2Y1I A;  1RT5 B;  2X3D A;  4PG5 A;  2EW9 A;  2WVB A;  1C0U A;  1U1N A;  3DRS B;  3Q8P B;  3Q2S C;  3OR1 A;  2EPI A;  3UVJ B;  2HWI A;  3M6X A;  2ZUG A;  3MM6 B;  5D4P A;  1SKU B;  1VQY A;  3THP A;  3MDF A;  1FDB A;  4IFV B;  3KNG A;  3B4D A;  1V5I B;  4CIO A;  1L3U A;  2V2V A;  4QIW D;  3LW5 C;  3K8W A;  3VVT A;  1HFE L;  4LVO P;  4FXD A;  3HT0 A;  3SFG A;  2R2U A;  3CJS A;  3RRK A;  5SUH A;  2SXL A;  2ZJR Q;  2K1R B;  3CCV S;  2Z0G A;  3IAS 9;  2WOM A;  3HD2 A;  3UWT A;  3IGN A;  1X0F A;  4LRF A;  4NXN J;  1RTZ A;  5KFI A;  2BQU A;  3R5D A;  1KEK A;  4TU9 A;  1F0X A;  1VLY A;  3BPD A;  1Y11 A;  4BCA A;  3KK1 B;  2YWG A;  2LDY A;  2EWH A;  3ENQ A;  3N6L A;  1BQM A;  5K20 B;  4ZK7 M;  2UXB J;  2HWT A;  1KOH A;  4FPI A;  1WG4 A;  2QZ8 A;  2G2Z A;  4G1Q B;  4J9N A;  1QUP A;  1S1T A;  2JNJ A;  3KNA A;  2KTQ A;  2R4F A;  4QCL A;  3QWU A;  1REG X;  2BKO A;  3EJM A;  2IRX A;  1WC3 A;  1S6P A;  3QRR A;  9RUB A;  2NUU G;  5HSP A;  4XAK A;  2JVO A;  1D8Y A;  1TKX B;  2OD6 A;  2DGU A;  5IFM A;  1RT5 A;  3AQO A;  1BGX T;  1NDC A;  1PBA A;  3AJD A;  2GO8 A;  3UVJ A;  2KZM A;  3D1O A;  2IMW P;  1NME B;  2J0W A;  3HDS A;  2BRK A;  4IFV A;  4M5G A;  3PZP A;  4KH1 B;  1FRH A;  2IYI A;  4QR0 A;  4DV1 J;  2BQR A;  1RHK B;  2K1R A;  3CUL A;  1JNR B;  2C2N A;  4OMF G;  5E41 A;  1UVI A;  2E1C A;  4DR5 F;  2OI2 A;  1FEE A;  3MPD A;  4ZVP B;  3MED A;  3POT B;  4HHU A;  2DT9 A;  3I0R B;  4LF7 F;  2IVM A;  4J9K A;  1MNE A;  4V1A k;  1S48 A;  3KK1 A;  1AA1 B;  2DGO A;  1QTN B;  2MZT A;  1RWU A;  2B5J B;  2BQ3 A;  3IWN C;  3LF0 A;  2VJV A;  1WI8 A;  2HGM A;  2L3M A;  2H54 B;  4G1Q A;  1BLU A;  4Y2I A;  2BW7 A;  3SSS A;  2ZD1 A;  2IDE A;  9ATC B;  2E1M C;  5KT2 A;  4IR9 A;  1TKX A;  5KG7 A;  2WVC A;  5KFS A;  4PXC A;  1T9Y A;  2XI2 A;  3O44 A;  1J5E F;  1FX2 A;  1S7H A;  1TR0 A;  2ZWO A;  3IC1 A;  1KP6 A;  4JOU A;  3TAM A;  4R0E A;  1X9M A;  2CFX A;  3CE8 A;  1CSJ A;  1AZS B;  4KGX B;  4G1P A;  4DR6 J;  1TP7 A;  3S7R A;  1SC6 A;  4O4G B;  2YPY A;  4CH0 S;  2OD4 A;  1YG0 A;  5HBM A;  1T9X A;  3ZZU A;  3MGJ A;  5GAE U;  2DH7 A;  3UO0 A;  5IC4 B;  5E7O B;  5M2U A;  3OR2 B;  5C5J A;  2HK2 A;  2R8J A;  3W9I A;  5KFZ A;  3F73 A;  2I5J B;  3POT A;  3LAN A;  2NZC A;  3UI3 A;  3DC2 A;  5KFY A;  2E1A A;  3NWG A;  1TUV A;  3KG0 A;  3QJL A;  2UUC J;  3SEO A;  1DZ5 A;  3SCJ E;  2BE7 D;  2KFN A;  4M95 A;  4WFN Q;  1JLC B;  1FRL A;  4ZIW A;  1VJQ A;  4OYB A;  1V3Z A;  2HEK A;  3OL9 A;  1RI7 A;  4IOC Q;  2QL9 B;  2HGN A;  3A8I A;  3FMW A;  1IUJ A;  2AGQ A;  2XNR A;  2RRA A;  2KFY A;  3R6G B;  1Q0N A;  4MIW A;  3K58 A;  2V8G A;  3C6U A;  3GU0 A;  1IQT A;  4BC7 A;  4C2M A;  3FBB A;  3EDR B;  3HVT B;  2ZH5 A;  3SV3 A;  1UTA A;  4J9P A;  2G1H A;  4C3L A;  3CTR A;  3J7A 1;  4F50 A;  2MMY A;  4AXI A;  2YWE A;  1TU0 B;  3J7Z 5;  4O4G A;  3KLE A;  1WC1 A;  4IO1 A;  2R7V A;  2RSQ A;  4NCA A;  1VQK S;  2YBV A;  4YFU A;  2VC0 A;  1RWN B;  1R0C B;  8RUC A;  4OZ0 A;  1HL6 A;  2MHE A;  1RTH B;  2HBR B;  5F8J A;  3BQ0 A;  2XY5 A;  2M8D B;  3GYX B;  4KKO A;  1Q78 A;  4F26 A;  1RHU B;  4DZD A;  3ZTP A;  1JLC A;  4QIE A;  1A7G E;  3V6H A;  2HVZ A;  3D5M A;  4DSL A;  1SL2 A;  3RAM A;  4QW8 A;  3GQC A;  1KN6 A;  2J9E A;  2DR5 A;  2MKJ A;  1U1K A;  4YR2 A;  3N5B A;  1X4E A;  2D3Z A;  3D6F B;  2NUH A;  4QR2 A;  3CME S;  4ITS A;  2EK6 A;  2FDN A;  2EFO A;  2BW2 A;  5A0Y B;  2DGX A;  1HBU A;  4DQP A;  2LQ8 A;  4CLW A;  3AJ2 A;  1LXN A;  5DRK A;  1MMN A;  4EI2 A;  2NLW A;  5D78 A;  1UVJ A;  3J7Z T;  1DQ8 A;  1FJE B;  2AGP A;  1Q8K A;  4ZPT R;  1SL1 A;  4JI3 J;  4DV1 F;  4LVN P;  2LKZ A;  2PMW A;  4NAS A;  1RTH A;  2MZJ A;  3R7N B;  2VPX B;  5F8N A;  1ZPV A;  1HNI B;  1RYR A;  4IO9 Q;  4WWS A;  4FDF A;  4NLP A;  3BB5 A;  5BYS A;  1P8G A;  1VIX A;  1C4A A;  4DX8 H;  2QA1 A;  2HKE A;  1EQ0 A;  5ETP A;  5HP1 A;  2XMM A;  4ZCL A;  3FNN A;  2UVV A;  3R5G A;  1DUR A;  1W7W A;  3S8S A;  5K14 B;  2JX2 A;  4JI2 J;  2ILZ A;  5T14 A;  1YBA A;  3PFO A;  1U45 A;  2KRR A;  1IR1 A;  2MQ8 A;  1U1M A;  2CQI A;  2RUG A;  3BGF A;  1HNV B;  2FTR A;  3ZZ0 A;  5LSL A;  4OI4 A;  3QO9 B;  2C42 A;  1LW2 B;  5DLG A;  1B99 A;  2LQ5 A;  3M8W A;  4ED4 A;  4USH A;  1EHW A;  3BSO A;  3R27 A;  4C8N A;  1SJR A;  4DR2 J;  4PWD B;  3JSY A;  3CUN A;  2YNI A;  2WVF A;  2HFV A;  3ULH A;  1JJ2 R;  3DLH A;  3MR6 A;  5HVF A;  4LSZ B;  4EU0 A;  1HW8 A;  3MR3 A;  1V5V A;  1U0S A;  5ITH A;  5FLX Y;  2KJW A;  3MCS A;  4LIR A;  5KG1 A;  3HHL D;  4DR6 F;  1I5O B;  1UW9 A;  3PRB A;  3TUJ C;  5GMK a;  1FKA F;  2X1F A;  1K1Q A;  3AJ1 A;  3O8W A;  4NYO A;  2NPI A;  1XC9 A;  3MMC B;  2VDI A;  3M8R A;  1PKU A;  1HNI A;  2HQC A;  2QYC A;  4IH6 A;  1TK0 A;  3RYL A;  2DCL A;  4TU7 A;  3MZI A;  3HX9 A;  3R6L B;  2ASL A;  5LSO A;  5L1I A;  2R42 A;  5D77 A;  4I4B A;  4F4K A;  3W1Y C;  2UUW A;  1NAQ A;  1V3R A;  5K14 A;  5C2G A;  1VGY A;  1FO1 A;  5KOX A;  5HVH A;  2FJE B;  5L9N A;  4IQX A;  5K8O A;  3E51 A;  2HZV A;  1SVD A;  1NDP A;  3VAG A;  2G4B A;  2AJF E;  3ISN C;  1N4L A;  2Y3Y A;  1PJ7 A;  4L3N A;  3M8Z A;  2ZZT A;  2AYB A;  3Q2T C;  1QD1 A;  1HHS A;  2W1B A;  4ZPB A;  2HUR A;  4NEY A;  3W65 A;  1NKB A;  1IBL F;  2YXL A;  2RDD A;  5HI7 A;  1KHV A;  4PYA A;  4CH1 A;  3ILI A;  3JSM B;  5C2C A;  5JJB A;  2MXY A;  3HMJ G;  1S6Q B;  3S01 A;  4M5J A;  2DPI A;  2HRT A;  1ELO A;  1Y3K A;  4R25 A;  1X60 A;  2V9K A;  4DCP B;  4FNH A;  2PEB A;  1RWX B;  2MKY A;  4F25 A;  5CAA A;  1YJR A;  4I2Q B;  3MMC A;  3OVB A;  3GJT B;  2ZWP A;  3ICL A;  3VAI A;  2V63 A;  3V2U C;  4MH8 A;  4ED2 A;  1NU4 A;  2QTW A;  3LUY A;  3MEC B;  4KSE B;  2B9E A;  1ZAX A;  5DG9 A;  1UFK A;  3UCU P;  3V4I B;  4OIX A;  2FJB B;  2RF2 A;  3W9H A;  1HI8 A;  3SBM A;  3FJ2 A;  3NAH A;  2JSX A;  1SUQ B;  1TFW A;  3T19 A;  4QYZ K;  3HCX A;  1D3W A;  1HR0 J;  1RT6 B;  3QT6 A;  2W7P A;  3TZZ A;  4KIA A;  3GR1 A;  5KT6 A;  2YVS A;  1LK5 A;  3T1H F;  2DEI A;  1EKR A;  5KFV A;  3M05 A;  2IJF A;  2ZBC A;  3SCI E;  1QAI A;  1RKJ A;  4IYQ A;  1KRP A;  4MKB A;  1UVK A;  3GSD A;  2PII A;  1ZA2 B;  4HT7 A;  4Y2C A;  3FFI B;  4B3M J;  2HHX A;  3OD2 A;  4AT1 B;  4CT9 A;  1HWI A;  3JSM A;  1KOO A;  5GAD I;  2Z4P A;  1OPZ A;  4WZQ A;  1H72 C;  1S7I A;  3I56 S;  2A2C A;  1OY8 A;  3N0V A;  1CJT A;  2RDI A;  4FVC A;  1IM4 A;  4I2Q A;  3ZZO A;  3NCP A;  2C2D A;  5A6W A;  1IM6 A;  5LJ5 Y;  2LFV A;  3VAM A;  4JI3 F;  2V8V A;  3HPO A;  4ZIT A;  1YJ9 S;  3DOM B;  3T3F A;  3MEC A;  1I1G A;  5EWE A;  4M5N A;  1SJQ A;  1F3F A;  1M5S A;  2KHC A;  4KT0 C;  3QGG A;  2XCA A;  1X7V A;  3WIV A;  3RG6 A;  4WU3 A;  1Q86 T;  5EHH A;  3CDE A;  2MQQ A;  3KLH B;  3OL6 A;  1S1X A;  2DRB A;  1NSA A;  3M2R A;  4P2X A;  1RT6 A;  1OSD A;  1N5S A;  4WE1 B;  2Z2Z A;  2CPF A;  1CLF A;  3N79 A;  1RWM B;  3NP5 A;  3PW7 A;  2A0F B;  4HTI A;  3DOL B;  1VK3 A;  3THT A;  3D67 A;  1WOR A;  2C3U A;  4JI2 F;  2C3M A;  4MK9 A;  3J7A N;  4NMX A;  1FFS B;  1K73 T;  4HI1 A;  2MJU A;  4FF4 A;  1G3O A;  2E7W A;  4H54 A;  3TNV A;  2BJ3 A;  1GQE A;  4W90 B;  4DR2 F;  4IQM A;  1XNR J;  2YKO A;  3BDP A;  1ULR A;  3TUP A;  2HHS A;  1X9S A;  5LMU J;  1HA1 A;  4GVB B;  2GV1 A;  4XDD A;  4PXE A;  4DSK A;  4A8X A;  2MLZ A;  2OEL A;  3AOB A;  2DY9 A;  3EGN A;  3LP1 A;  4V19 X;  4C3M A;  3OV7 A;  4Q0B A;  2HFS A;  4G65 A;  5KFF A;  3DOM A;  1S0O A;  1Z4U A;  4Q5V A;  3C14 B;  2ILY A;  4PKD B;  1V9O A;  4P71 A;  2BJ1 A;  2XSJ B;  3QYY A;  3P8B B;  5J2Q B;  1RAG B;  1U1P A;  1F1B B;  4E0D A;  1JJ4 A;  5DLF A;  4DX7 A;  3KLH A;  5HO4 A;  3RJM B;  4DR4 J;  2UV8 A;  4LRA A;  4WE1 A;  3NAI A;  3BKT A;  3EPI A;  2ZVS A;  3QZ8 A;  2JWN A;  3DOL A;  5IXU A;  4OQJ A;  4QWA A;  4MK8 A;  3JTP A;  1FD2 A;  3IP0 A;  1C1B B;  5IT9 Y;  3TAN A;  2IM3 A;  4KHM A;  2OAU A;  1PC4 A;  4DPW A;  5DZ7 A;  1DLO B;  4W98 A;  1B64 A;  1VQ5 S;  2W7O A;  4MIA A;  3US5 A;  4CLS A;  2F8M A;  2HNY B;  3V6J A;  4GVB A;  2G2Y A;  1N5Y A;  4WP9 A;  1SBR A;  4MJK A;  2MY7 A;  4O3N A;  1Y3J A;  5KFX A;  4J7C A;  1BY9 A;  4RUB A;  3W2W B;  1FER A;  1HNX F;  4YOE A;  1XBW A;  2ZZN A;  1YK9 A;  2XWX A;  3EXY A;  2W25 A;  4ZLJ A;  3U7J A;  4FF2 A;  4GKJ J;  1WF0 A;  3CCZ A;  2IPO B;  1X4C A;  2ZC4 A;  2XSJ A;  1TAU A;  1G4C A;  2F4V J;  2OPQ B;  1LWX A;  3PFE A;  3HK2 A;  1YJ7 A;  1L3K A;  2GJ2 A;  3D0H E;  3N6N A;  4EEY A;  2CA9 A;  2E1P A;  5ETT A;  2M70 A;  3T6J A;  2HHV A;  1SKS A;  4TXS A;  4EFA C;  2HIQ A;  3UD4 P;  3K5P A;  2Y1L B;  4ED1 A;  4TU8 A;  1Y0H A;  4K4S A;  3QRQ A;  1VS3 A;  5DQI A;  2Q1L A;  4Q2L A;  1HR0 F;  2QLF B;  1RBO B;  1C1B A;  1RTI A;  1S6O A;  3GJS B;  4TLQ A;  4OX9 J;  5J1P A;  2XZT B;  4UY8 5;  1TMJ A;  4WXO A;  2R2T A;  1RYS A;  1EP4 B;  4YR0 A;  2AZ3 A;  4IRD A;  4WP3 A;  1VOM A;  5KFU A;  1NJY A;  1DLO A;  1Q4R A;  2FGO A;  1Z2L A;  3UDC A;  1WG5 A;  5DET A;  1DRZ A;  1NBE B;  4ZPW R;  4AQY J;  2PI4 A;  2HNY A;  4ZVG A;  4B3M F;  3OSP A;  1QVF R;  2VU5 A;  2OEK A;  4UT4 A;  5K9F A;  2BAN A;  1CC7 A;  3DLJ A;  4FBT A;  3FCH A;  3KG4 A;  4P74 A;  1OQ3 A;  1DAX A;  3W2W A;  2VBX A;  2ZDP A;  5KG3 A;  2DR8 A;  3D1H A;  1WD6 A;  2FC9 A;  1WI6 A;  2D7S A;  3FUY A;  3K5L A;  4N47 A;  1R6Y A;  2VG6 B;  1KD1 T;  4ANC A;  2OPQ A;  1KQK A;  1AFJ A;  3P49 B;  4KHR A;  1Y7P A;  3OFF A;  4CT8 A;  1XQI A;  3PG9 A;  1IWA A;  3QAT A;  3QLH B;  2IHR 1;  2PMH A;  1YBU A;  4ZCI A;  1S4E A;  5E3C A;  1M0S A;  3H8Y A;  2R7Q A;  2YKP A;  2BX6 A;  4NLT A;  1WAC A;  4ES2 A;  4NXM F;  2NYH A;  3UCG A;  4YHH F;  3DHX A;  1TZ0 A;  4DUT A;  1FRI A;  4EO8 A;  3ZNU A;  3AB4 B;  2CQC A;  3L95 X;  2OFH X;  3DM2 B;  1EP4 A;  1X5O A;  2UVR A;  3GG0 A;  3Q22 A;  2BJ8 A;  3HO1 A;  1P27 B;  1O8B A;  4FKY A;  4ZN1 A;  3H0P A;  5LOQ A;  1PJ5 A;  1K1S A;  2MHN A;  4X4V A;  3DI6 B;  5E0O A;  4ID5 B;  1XNR F;  4KHP J;  3EGW B;  3HFZ B;  3Q8V A;  2WB4 A;  4ES1 A;  2IIH A;  4K4X A;  1TKZ B;  3NKY A;  3MHY A;  3NMA A;  5LMU F;  3U1N A;  1RAB B;  3W3S A;  4F36 A;  2XBP A;  1X5P A;  3PW4 A;  3ETO A;  2DR9 A;  4ZMM A;  2HAF A;  2M52 A;  1ZH5 A;  2CNN B;  3HHN B;  5KAK A;  1MG7 A;  4IRC A;  1YJN S;  4JI5 J;  3GIJ A;  3W2V B;  1DY3 A;  2ZHO A;  4USM A;  4XPC A;  3P96 A;  2UUA F;  2FLN A;  1PIL A;  2LU1 A;  3CJK B;  4TLR A;  2FHJ D;  1X5T A;  3VF0 B;  1AUD A;  1FJC A;  3TYT A;  2WVD A;  1FNM A;  2E5H A;  2C3O A;  5GAD U;  4DR4 F;  3ET6 B;  3R1H A;  3C3L A;  2OPP B;  3G9C A;  1RU2 A;  4BHQ A;  4UOH A;  1YTY A;  2A18 A;  3VCD A;  3RAQ A;  4OLP A;  2GGP B;  3DM2 A;  3PJW A;  5E3P A;  1XWL A;  4ICL A;  1S9G A;  2GVZ A;  4KGZ B;  2JVR A;  1WC6 A;  2W2Q P;  3JSB A;  4PXB A;  3DKD A;  2QA4 S;  4K5S A;  2KHD A;  2N3O A;  5A6P A;  1F9H A;  3DI6 A;  1KQF B;  4ID5 A;  5BYQ A;  3GG1 A;  5RUB A;  2XMT A;  2QA4 G;  2WW4 A;  3ENV A;  3BGU A;  2P8I A;  4DEZ A;  2PD1 A;  4IDK B;  1TKZ A;  1NK8 A;  1ZM4 A;  3R5C A;  5HMW A;  1N34 F;  1VQ9 S;  1QSY A;  5EN1 A;  3WC0 A;  4IR1 A;  1DTT B;  3K5O A;  2DGT A;  1XMO J;  1L3V A;  4Q44 A;  3RZA A;  1VQN S;  1UCN A;  1FKP B;  1CPZ A;  4K4Y A;  3TQE A;  4C8Y A;  1D09 B;  4ECQ A;  4FYD A;  4GKJ F;  1OQ6 A;  2GIR A;  1SCJ B;  1S4F A;  2P9C A;  4CNY A;  1E6Y B;  5LT5 A;  1HNZ J;  2VBZ A;  1SIW B;  2N82 B;  1Y10 A;  4Y6I A;  4Y2K A;  1VQS A;  5A8R A;  2YNH B;  2K06 A;  3ET6 A;  3HHD A;  4M1K A;  4XK8 C;  1HPZ A;  1P9Y A;  2DNG A;  2GGP A;  3I0S B;  2EEY A;  3AA9 A;  3ZNJ 1;  1NJZ A;  5HQM A;  1FFG B;  3AOC A;  2DTJ A;  2MDA A;  3M6V A;  4I6W A;  5JUM A;  3D6H B;  1S99 A;  1TL3 B;  2DNL A;  1EET B;  3CXC R;  1T94 A;  2C1E B;  1X4G A;  4OX9 F;  4OJH A;  1ZM2 A;  1SIZ A;  3D68 A;  3NGK A;  1Q95 G;  4TVA B;  2DEJ A;  1XEZ A;  3EYZ A;  4OZ2 A;  4MTP A;  4YDD B;  4IDK A;  4Q8E A;  3CJR A;  5D0G A;  3OFG A;  3M7V A;  4DCJ B;  3FMB A;  2ADC A;  1D8Z A;  3A8J A;  4MYU A;  3FDS A;  2ZBP A;  3IA0 A;  2IRY A;  3HSD A;  5MLC V;  1FKP A;  4EK2 A;  2XMA A;  2FLP A;  5HK4 A;  3OUY A;  4Z7C A;  7AT1 B;  1E6Y A;  2VPY B;  4LF5 J;  4L76 A;  1LWF B;  4EBD A;  2YH0 A;  1U1L A;  2D1C A;  2YNH A;  3PJ9 A;  4ZHR B;  1DAR A;  2C2O B;  1N56 A;  2HS0 A;  1RTJ B;  2NPF A;  5J1N A;  4KB7 A;  3I0S A;  4LR7 A;  4KJI A;  1R6V A;  2RD5 C;  3PW5 A;  1MN9 A;  2E5I A;  4DX5 A;  3OBI A;  1R8A A;  2XS2 A;  1EET A;  1HHT P;  1MU2 B;  3EVO A;  2L9W A;  2QL5 B;  1GT8 A;  1NND A;  3GJR B;  4QIF A;  5C42 A;  1B0T A;  3HM9 A;  3SSQ A;  2HHU A;  1ITP A;  5AJ3 J;  1IBK J;  2K8G A;  2R2S A;  1VQ8 S;  4ZPC A;  4CLU A;  3VZH A;  4ER8 A;  4NYP A;  1YBT A;  4QOT A;  3KMS A;  5I3U B;  3OVA A;  3OTB A;  2HFU A;  2Z57 B;  2FD2 A;  3KHR A;  4KHP F;  3P45 B;  4LFA J;  4R8U B;  1FTC A;  1D0E A;  2C2M B;  4MK7 A;  4LQ9 A;  4K4Z A;  3IBF B;  2GVD A;  1CQM A;  1TKD A;  1ZA1 B;  4RW6 B;  5I3P A;  2ZH3 A;  5IV4 A;  4QYZ J;  2QX0 A;  4JV5 J;  2WSF C;  3NXZ A;  4N8O A;  1LWF A;  3BR9 A;  3Q8Y A;  5DM6 Q;  4C9D A;  4JI5 F;  1F3V A;  1QUV A;  3K8V A;  3RR7 A;  2MLY A;  2KT5 A;  1YI2 S;  4RW9 A;  1RTJ A;  3MMB A;  1I6J A;  5IV3 A;  2GCF A;  3B6B A;  2EXU A;  2IBO A;  2JC1 A;  2B8Q A;  1SJF A;  4LBI A;  2XMV A;  2HNZ B;  1MU2 A;  3TUI C;  2VG5 A;  4WKR A;  3LP0 B;  3J81 U;  4OI3 A;  2AJ1 A;  2LYV A;  5BXI A;  2DHA A;  1YRT A;  4IRK A;  5FDL B;  2Q66 A;  2Z2L A;  4F0H A;  3CCW A;  3MEK A;  3CED A;  5I3U A;  3AHP A;  3J81 j;  2G13 A;  4DPY A;  5A8W B;  3UDE A;  1KLM B;  4YEA A;  2ZVI A;  4DF4 A;  2F9D A;  4GC7 A;  2B4U A;  2XC9 A;  2FLL A;  2YKA A;  2MJN A;  2BR0 A;  4R8U A;  2OHD A;  1AUS L;  2M2B A;  1CUL B;  2YNG B;  1URR A;  2UP1 A;  3GIR A;  4M5M A;  1XMO F;  4DZ6 A;  4GKK F;  3UN5 A;  3TVK A;  4ECR A;  4HDH A;  3R2D J;  1RHJ B;  4DU8 A;  3T5K A;  1FTR A;  4CTA A;  4RUA A;  3H42 A;  3CCU S;  2BZ2 A;  2CAJ A;  3C66 A;  1J27 A;  1JK9 B;  2FVR A;  3PY8 A;  1HNZ F;  1KFS A;  3DDN A;  5F3T A;  5CYQ B;  3QT5 A;  2HFZ A;  5C7P A;  2VQE F;  1XER A;  1H0H B;  4X2B A;  2HNZ A;  3GV7 B;  2RHQ B;  4O3R A;  4AXJ A;  4E98 A;  1FJG F;  4YUD A;  1BWE A;  3DFE A;  3BS9 A;  3D7S B;  2XUL A;  1KON A;  2ASY A;  1JJC B;  1MN7 A;  3JB9 k;  3OSN A;  4C8O A;  3PVX A;  2HQD A;  2W9B B;  2VOD A;  4BS2 A;  3IWL A;  4FZV A;  3UD3 P;  3V6K A;  2J9D E;  2FYX A;  4P2M A;  2LEB A;  2ASD A;  1KLM A;  1PAE X;  4QPX A;  3T5L A;  2H65 B;  3FQK A;  4WII A;  1W2B R;  4NZ0 A;  3CF5 Q;  3I82 A;  5AE2 A;  2DVI A;  2EK1 A;  2WAQ D;  3G6Y A;  1U8W A;  3WX8 A;  3MCM A;  1CUL A;  2DGQ A;  3QBC A;  2DGV A;  1YJV A;  4D3G A;  4ECS A;  1NPK A;  4KV8 B;  4EUV A;  2YNF B;  2DO4 A;  2EKY A;  5DQH A;  4M5L A;  2DY1 A;  3QGP A;  5FII A;  5FD1 A;  3KK3 A;  1N0V C;  5DQG A;  2CPJ A;  1D9F A;  1UL3 A;  3CD6 S;  3G8S A;  1T3N A;  3FBE A;  4LF5 F;  3LQV A;  4WCE Q;  4UTG A;  1VMB A;  5CYQ A;  2MZS A;  1BQX A;  2ZHA A;  1L3S A;  3SFU A;  3QNW B;  3TZW A;  2PN6 A;  2JEG A;  1T95 A;  4KTQ A;  8AT1 B;  2ZH8 A;  2PE8 A;  2FVQ A;  2XMJ A;  3W63 A;  5F8H A;  4ZA1 A;  2V8P A;  4RNO A;  3MAH A;  1XNQ J;  2AW0 A;  4YB5 A;  4X4O A;  3G6E S;  3NLC A;  2W9B A;  5ETN A;  3T9Z A;  2HAI A;  7FDR A;  1RGV A;  1KVJ A;  2Z2Y B;  2QMX A;  2HLT A;  3HLU A;  4EYI B;  1GK8 A;  4QW9 A;  3MUV P;  2D9P A;  4KH0 B;  5AJ3 F;  1XMQ J;  3ZZY A;  4OI2 A;  1EIY B;  2P6T A;  3ZTO A;  1Q82 T;  3FSY A;  2LXF A;  4A8K A;  5KFP A;  3X3U A;  2CPY A;  5IZH A;  3V4M A;  4H4M B;  5F8I A;  1KTV A;  1SKR A;  2VL1 A;  4KV8 A;  3D0I E;  3AD9 C;  2MQM A;  4ED0 A;  4LFA F;  2CQ4 A;  4CM0 A;  3VTI A;  4DPO A;  1KHW A;  3T9N A;  1GH8 A;  5F9N A;  2OJ3 A;  6FD1 A;  1ARO P;  2QT7 A;  2XS7 A;  1U1O A;  5D8H B;  2UVW A;  4X4S A;  2OH2 A;  4PEO A;  4JV5 F;  3ZO7 A;  1NUE A;  3HSJ A;  3Q24 A;  2F8E X;  4DUY J;  3LPY A;  4ZDN A;  5G0R B;  5L1L A;  3GZ7 A;  5GME A;  3BV8 A;  4OZJ A;  1SC3 B;  3H2L A;  1T03 B;  2QFJ A;  1NKE A;  4I2P B;  2AYG A;  3I32 A;  3ENW A;  4M5K A;  2XM3 A;  1RBL A;  4U6P A;  1KLN A;  5LMN J;  4NPO A;  3Q23 A;  4CP5 A;  4EBE A;  5ETQ A;  1VCT A;  4URG A;  4C7Q A;  4PQU B;  5KFM A;  2OO4 A;  1NK7 A;  3BO3 A;  1REV B;  1T0T V;  2IC3 B;  4FVM A;  2EBG A;  4OL8 A;  3WX4 A;  3GCX P;  5D4L A;  5KFG A;  1FNX H;  1MW7 A;  5A2Q U;  4E8U A;  2JJ4 D;  2M7S A;  5D0R A;  3CJ8 A;  2APO A;  3DLG B;  4M5I A;  4U7U K;  2R7U A;  2E9R X;  1IKV B;  3R5A A;  2IY5 B;  3WIU A;  4B3S J;  5HL7 Q;  4MAK A;  1HQE B;  5G0R A;  2WBR A;  2QGF B;  3HKZ D;  2Y8Y A;  4NLR A;  2RML A;  2CQ1 A;  3IWX A;  3VQT A;  4MMO A;  4K2X A;  1T03 A;  1IR2 A;  1SV5 B;  2DNZ A;  1C4C A;  3KDN A;  4I2P A;  1Y9O A;  1HW9 A;  4AUK A;  5U47 A;  5B09 A;  3M2U B;  4IOB A;  2H9Z A;  4DL2 A;  2R7O A;  2Y0B B;  4NLQ A;  3V81 B;  1TL5 A;  4A8S A;  1VRT B;  2IAJ A;  4J9V A;  2R8G A;  5AXK A;  3LGM A;  1VC6 A;  4DL5 A;  4DPU A;  2VF3 A;  2P6S A;  2QJ3 A;  1KVK A;  1QAX A;  4F4Y A;  1RAF B;  5GVQ A;  2BJ9 A;  1HBM B;  2YQ1 A;  2QG9 B;  2BE2 B;  2PEH A;  5A2Q Y;  1JIH A;  1AFI A;  3MM9 B;  4DJB A;  3D28 A;  1FF2 A;  4DV2 F;  3FVY A;  4FXW A;  1REV A;  3W5X A;  2DR7 A;  2IC3 A;  4B9M A;  4DFP A;  1NH7 A;  3V6D A;  1CJV B;  1O6X A;  3HHL B;  2MKS A;  5ETM A;  2ZJQ Q;  3BGL A;  4I6Y A;  2B9W A;  1JLG B;  2CAD A;  2KN4 A;  4MFB B;  4NLG A;  2AEF A;  2CNK B;  4DL3 A;  4LR9 A;  1IKV A;  1PG5 B;  1BC6 A;  2DHS A;  3RBX A;  4ATN A;  1R89 A;  1O0P A;  2B8P A;  1QVG R;  1P9Q C;  5J2P B;  1HQE A;  1OY9 A;  3A12 A;  1N5Q A;  3NGD A;  4NYZ A;  3HJV A;  5AE1 A;  2VFT A;  1YWX A;  3BRE A;  4KY3 A;  4F4X A;  3H5U A;  4RWW A;  4DCO B;  3GIM A;  4HEA 9;  2L48 A;  1SKW A;  1T8E A;  3M2U A;  1NM2 A;  3SZ2 A;  3A3N B;  4PG8 A;  4GVL A;  3N9U C;  1PIE A;  3V81 A;  1D9A A;  1VRT A;  4ECY A;  4L6V 3;  4O0I A;  3VGU A;  2XQC A;  5D4N A;  5DG7 A;  2QA2 A;  1S0V A;  2OKQ A;  1XNQ F;  4YS2 A;  3DN9 A;  4GRS A;  5BYR A;  3N01 A;  4X64 F;  1HBM A;  4IKA A;  5KFW A;  1Z2Z A;  3E3X A;  3MWB A;  3MMJ A;  4Y0F A;  1HQU B;  2XHW A;  1S9E B;  1GNK A;  3NOC A;  1XMQ F;  1RAD B;  1CJV A;  2G1D A;  4ZP9 A;  5I42 B;  1NK0 A;  2HHH J;  2OPR B;  3I5C A;  3NY0 A;  3OJS A;  3HFK A;  2EKN A;  2N4C A;  2EVZ A;  3TR5 A;  2RKI B;  1QE1 B;  5B0F A;  4MFB A;  2M88 A;  1H73 A;  2RNE A;  4ZLP A;  4HYK A;  3MFH A;  4AYB D;  2VUG A;  4JI6 J;  3W60 A;  3GE9 A;  1N5V A;  4L74 A;  4WFA Q;  2CQG A;  1U09 A;  5J2P A;  2C28 A;  3DXB A;  1ICE B;  2F7V A;  2CG8 A;  4R5P B;  1GMU A;  3FC9 A;  1GMW A;  3GFZ A;  2LA4 A;  2YQ0 A;  4WK1 A;  2LP4 A;  1X9W A;  4CLL A;  5AE3 A;  2VKR A;  3LP2 B;  4IG3 B;  3W66 A;  4PPD A;  4IFY A;  4DUY F;  3UDL A;  4USJ C;  2MZ1 A;  3I55 S;  5H9E K;  4JP8 A;  3ADA C;  3NNA A;  2NR0 A;  2R8H A;  5IOL A;  4A47 A;  4CRJ A;  1D9D A;  2BBE A;  3GLJ A;  5ETR A;  2RIL A;  2C2E A;  2B7C B;  2E5L J;  3JQK A;  3FEY B;  2IYG A;  4LF8 J;  3SCL E;  4YR3 A;  3EVM A;  1SC4 B;  3UQS A;  4DSE A;  2AKW B;  1HQU A;  2COL A;  2V34 A;  1UKU A;  3OXL A;  2DJW A;  1N0U A;  3K59 A;  1SL0 A;  4URQ U;  2CQ0 A;  3VR1 A;  2XB2 D;  4D3H A;  1RIS A;  2RKI A;  5AXN A;  1ZTW A;  1UJ5 A;  2XNQ A;  1QE1 A;  2DHX A;  2MSS A;  4QQB A;  3GFH A;  2WSC C;  4B17 A;  2V8H A;  3GV8 B;  4YY3 J;  2BM1 A;  2J8A A;  4PUO B;  2WOM B;  3DCA A;  3NEK A;  1YZ6 A;  4R5P A;  4P7V A;  3UDV A;  2JLG A;  3MOZ A;  1KNZ A;  2V4J B;  1Q8I A;  3LP2 A;  5KFE A;  4K4V A;  2R8I A;  4USU A;  1KBR A;  2JRS A;  4B3S F;  1RT7 A;  2W8L A;  1FVS A;  5JVH Q;  1TKT A;  3D9B A;  5KFB A;  2WRM A;  4J9L A;  2F9J A;  4ZVF A;  1FA0 A;  1FVQ A;  4BWM A;  2DD8 S;  5KTQ A;  1S6P B;  4JB8 B;  4K4W A;  2YTC A;  1A9N B;  2RRB A;  1EQM A;  4ED6 A;  1X4D A;  3CC2 S;  4M8L A;  3G8T A;  4RNN A;  4ZVO B;  5K8N A;  3FRY A;  2OMO A;  4C8Z A;  5B08 A;  3ZZT A;  2GW8 A;  3BJY A;  4OZ1 A;  1Z1Z A;  4NRU A;  4ZS6 A;  2HGL A;  3A3P B;  2DIU A;  1S5Z A;  3THV A;  4RBT A;  3FSI A;  2P9E A;  2ZJP Q;  3SSR A;  4DR7 J;  2C3P A;  1MWY A;  2QEX S;  4JV2 A;  1KQG B;  1WEX A;  4OYO A;  2FVP A;  5F8L A;  5AXL A;  2W24 A;  1N8R T;  2IA6 A;  4PUO A;  4CLF A;  3I9V 9;  4I7F B;  4LR8 A;  1W2I A;  3EWG A;  4DN0 A;  2AP6 A;  2N3L A;  2Q79 A;  4NZ6 A;  2DK2 A;  1PJ6 A;  3MED B;  1DBD A;  2V4J A;  1H7W A;  1AYE A;  5CAB A;  2K3I A;  1G1X A;  2A3J A;  4RLE A;  2YQ3 A;  2HVI A;  1Q5V A;  1S79 A;  2RRN A;  4C6A A;  4WP8 A;  4ZP7 A;  2MKC A;  2DYA A;  4C11 A;  1VQM S;  3CB4 A;  4O23 A;  1FRK A;  1UJ4 A;  4I69 A;  4KAI A;  1IN0 A;  1UFW A;  4RX6 A;  2CKW A;  2PDA A;  2FGC A;  2IRU A;  4OYA A;  4CLT A;  4N8N A;  2ZD1 B;  4UOF A;  1RB0 A;  2V6A A;  2VA2 A;  3OPK A;  2MPU A;  1RHR B;  4KQZ A;  4HVZ A;  5BR8 J;  3KJF B;  2EFQ A;  1PSD A;  2HSE B;  3B54 A;  1LOU A;  2OTL S;  3BKU A;  1ACM B;  4PWU A;  2DBB A;  3TAM B;  1SQE A;  1R8C A;  2XTJ P;  2HHQ A;  3NCQ A;  2OIH A;  2ZH7 A;  1S1U A;  2LEC A;  3DMJ B;  2H48 B;  2GFF A;  3IR7 B;  3PKM A;  2KM8 B;  3S1T A;  4QWE A;  2KB2 A;  1LNQ A;  1TL4 A;  1BWV A;  4M5H A;  3MAA A;  4ZJO A;  1M1H A;  1M5V C;  2VFR A;  2ACY A;  5HBM B;  3UE2 A;  1R27 B;  1NPP A;  2FHK A;  3L7P A;  3M30 A;  2HHH F;  4N77 A;  2UU9 J;  1NEE A;  1ZZF A;  1IKX B;  3OTC A;  4I7F A;  2HHP A;  2ZE2 B;  1H2T Z;  3MFI A;  3ZC4 A;  2XG8 A;  1S0M A;  2O1P A;  1RWK B;  4QIV A;  4AND A;  1WOO A;  2WZ1 A;  4JI6 F;  3QGH A;  1XMB A;  4RNF A;  4CQ1 A;  1ZAW A;  3HKW A;  1I51 B;  3ZFV A;  1A0O B;  2CWX A;  4DSI A;  1UPM B;  1KR4 A;  1JLQ A;  3CJ2 A;  2EFV A;  3BO4 A;  4NCG B;  2ZKT A;  1UP1 A;  2CJK A;  3OFE A;  1N88 A;  3I5A A;  4NLS A;  3KDO A;  2Q6C A;  2NSB A;  3KFW X;  3BKF A;  2XGQ A;  3C6U B;  2DXF A;  3BH6 B;  3F41 A;  4X4T A;  2E5L F;  4WYL A;  3DGP A;  3DMJ A;  4LF8 F;  2VFU A;  1TL1 B;  4P2S A;  3KLG B;  2DNH A;  1NO8 A;  4RKU C;  2WW8 A;  5CZV A;  3LTO A;  2P5V A;  3GV5 B;  3KLE B;  1FHT A;  3PO5 A;  3EGV A;  1SC1 B;  3AT1 B;  3TAP A;  1VBZ A;  2DXE A;  2QLB B;  3SI8 A;  4DFK A;  3GIL A;  3FBC A;  4TN2 A;  5HRO B;  1IKX A;  3CW2 C;  5KFT A;  1G2E A;  4TY9 A;  2ZOG A;  3PKY A;  2HFO A;  2ZE2 A;  4RUC A;  1H6K X;  3T1A A;  3EIC A;  2Z2M A;  2OML A;  1JXV A;  2V67 A;  4K8R A;  2WBM A;  1QAY A;  2C2K B;  4USI A;  3IS9 A;  5IWA J;  5B0D A;  3PX0 A;  1APS A;  5JMN A;  3JTN A;  3B82 A;  4YY3 F;  5KFD A;  1Q8L A;  2F40 A;  4KKO B;  1S76 D;  2W2M P;  2RQ4 A;  3W9J A;  2VHG A;  1C0T B;  3MM5 B;  4ZLL A;  1N52 B;  4OZ3 A;  4EO6 A;  1NKC A;  2KH9 A;  2QC3 A;  5F9L A;  4LUB A;  4NCG A;  1NJI T;  3NGU A;  5DDO C;  3BGO P;  3ZZZ A;  1GEH A;  1ZAV A;  3CMQ A;  1CJU B;  4DFM A;  2WB1 D;  1U4B A;  3TOQ A;  4H4O B;  3PO4 A;  1X5S A;  1IBL J;  2AU0 A;  3SMZ A;  1SJ4 P;  2VG7 B;  1UW4 A;  5KFJ A;  1HBU B;  3BBF A;  1TL1 A;  3VVU A;  2YKM B;  3KLG A;  3CDA A;  3EPG A;  4CNZ A;  3G6X A;  3QT7 A;  1WWH A;  2HQI A;  4URS A;  1HHQ A;  5HRO A;  3QAU A;  1GMV A;  3FEX B;  4AFF A;  4ELV A;  4DR7 F;  2WSE C;  2A1B A;  3PYE A;  4ES3 A;  1CS4 B;  2M5Y A;  3ISN D;  2CZ9 A;  1KSP A;  3DU5 A;  1SQG A;  2G0C A;  3B78 A;  1C0T A;  3MM5 A;  5SZT A;  1GXT A;  2RDJ A;  2Y1R I;  1RAC B;  3PTW A;  5HP1 B;  1HD0 A;  2L9D A;  3JTO A;  4OI6 A;  4FXV A;  3T1H J;  1SH2 A;  3UN3 A;  4CH7 A;  4X66 J;  1CJU A;  3NL0 A;  2X7I A;  4USW A;  4H4O A;  2MGZ B;  2Y1J A;  3QT8 A;  4DUZ J;  1P1T A;  2GJI A;  2KU7 A;  3FK4 A;  1QTM A;  1JX4 A;  1LXJ A;  2VG7 A;  1YRU A;  2VBW A;  3UNY A;  4X65 F;  2YNI B;  3BO2 A;  2KJV A;  2YKM A;  1R0B G;  3QIP B;  4B3T J;  2AEM A;  5BR8 F;  1XR6 A;  4JI8 J;  1RLD A;  1Y5I B;  2YPZ A;  4Y3C A;  1H2U X;  2BEF A;  1N6Q A;  4YB1 P;  3SV4 A;  4IG0 A;  4OYW A;  2VJU A;  2LQJ A;  4BDP A;  2BOA A;  4DXL A;  3D3C J;  2FVC A;  1R43 A;  3FCV A;  1NHK L;  2V94 A;  1OYE A;  5F8M A;  3VQS A;  4U9R A;  1JLB B;  4MIB A;  1CS4 A;  2UUB J;  4OX6 A;  1FFW B;  1VHI A;  3UR3 C;  2OEM A;  1U6Z A;  5DDR C;  2XZD B;  2KDO A;  1XR7 A;  2FQQ B;  3GTY X;  1I3O B;  3D4J A;  4CLK A;  2UU9 F;  2DNP A;  4QIG A;  2EG2 A;  2UZA A;  1KKH A;  5G4D A;  4PZV A;  2V8D A;  2GHV C;  2BJ7 A;  4FKX A;  1VQO S;  2FHJ A;  4HTJ A;  4ID8 A;  1NZ8 A;  2GA7 A;  4KE5 A;  2CPE A;  2QMU B;  1URN A;  1RAO A;  2CPX A;  1RT1 A;  1T02 A;  4ED5 A;  3EMT A;  5CH7 B;  2LEA A;  4U8V A;  2MGZ A;  1KDN A;  4ZVS B;  3W61 A;  2V9W A;  2X51 A;  4LF4 F;  1U2C A;  4GMK A;  4JV0 A;  2D9O A;  4C0O C;  5CXT A;  3QIP A;  1ZM3 A;  3P6Y C;  3L3C A;  2J6T A;  4ILL A;  3TJ9 A;  3R5B A;  4N5S A;  3CCE S;  5CYJ A;  1U47 A;  4NLO A;  1RZM A;  2GNK A;  2J5A A;  4UUX A;  3IM9 A;  3QPI A;  4FYV B;  1U6F A;  4MKV A;  3OTO J;  1JLB A;  2E5J A;  3H4B A;  4OZN A;  3SCK E;  3RGI A;  1YRX A;  1LW0 B;  3TAQ A;  1WUU A;  5KOW A;  5EWG A;  4RR5 A;  2R8K A;  4DPX A;  2ZIT A;  2AJQ A;  1F9F A;  1TQL A;  4IH5 A;  1UEU A;  4KGK A;  3H5S A;  1EAY C;  3GR0 A;  4Q43 A;  1QSS A;  1GMW D;  5IWA F;  4DV7 J;  2ZC3 A;  4DSF A;  2CJ9 A;  2RF2 B;  4K7Q A;  2MKI A;  5M2R A;  1YIT S;  4RWX A;  2D74 B;  2AEJ A;  3M8P A;  3QJJ A;  4DF8 A;  2GMJ A;  2F1F A;  2QO3 A;  2M9K A;  3UN2 A;  2P9G A;  2X1A A;  1BQN A;  2B56 A;  2KT2 A;  2QSW A;  1CQN A;  5E3R A;  2ASJ A;  4H4K A;  4NLW A;  2YX4 A;  3HZG A;  2WHO A;  4NI2 A;  3NG8 A;  1WKL A;  3BH7 B;  2VZ9 A;  2GIQ A;  2HRY A;  3QSY B;  4ENO A;  1IR0 A;  2I2Y A;  2Z56 B;  3QSI A;  1NRK A;  3P5B P;  1IXK A;  1M5P C;  3D1Q A;  1PAU B;  2G2O A;  1HNX J;  1CJT B;  1BHN A;  1WOP A;  2DHG A;  3AD8 C;  1LW0 A;  2W4C A;  3BYP A;  5CYM A;  4K59 A;  1RSC A;  2FB0 A;  3EVW A;  1VQ7 S;  3C6T B;  1C1C A;  2W7A A;  1IKW A;  3CCL S;  3TW0 A;  1S1V B;  4C48 A;  2CJB A;  3M2V B;  1VQP S;  4X4P A;  2M4M A;  3CJ4 A;  5IQ6 A;  1OJ4 A;  4ZPV R;  5DGA A;  3AXK A;  3AXM A;  2IVY A;  5F8G A;  1JKH B;  3CGI A;  1TUG B;  5H9E J;  4IUF A;  4MT1 A;  1S1X B;  4I1T A;  4TYB A;  1VQL S;  1UEV A;  4DBQ A;  1VR6 A;  4IOA Q;  3M2R B;  1YHQ S;  4DI6 A;  3VGV A;  5IC6 B;  2MKK A;  2LXU A;  3C16 B;  3OHB A;  4WFZ A;  1FD8 A;  3I96 A;  4ZP8 A;  4UST A;  5EX3 A;  3RBD A;  1X31 C;  3PX6 A;  3C15 B;  4QPT A;  4X66 F;  1KWM A;  3NGS A;  4UUW A;  2VBY A;  4DUZ F;  3ILL A;  1W25 A;  5D0E A;  3M4X A;  2BVZ A;  1EZZ B;  1KS2 A;  3DRY A;  3NCR A;  3OFH A;  3CCT A;  1FWL A;  3QFW A;  4A46 A;  4B3T F;  2YWF A;  4JI8 F;  2DRA A;  2ZH4 A;  2MQN A;  3PHE A;  2YWH A;  2CXE A;  1GX5 A;  1AB8 A;  3CCR S;  1WHV A;  2CVE A;  3IFE A;  5J2M B;  3DLB A;  4J91 A;  4ZLN A;  3M8Y A;  4C4W A;  3LP1 B;  2C2R A;  3L4B C;  3C6T A;  3L09 A;  1B70 B;  3U1L A;  2EFP A;  2BOP A;  2O67 A;  1S97 A;  1S1V A;  1OSC A;  4OI0 A;  4LF9 J;  4Q0B B;  3M2V A;  3ETM A;  4BLG A;  3T6B A;  2IBK A;  2KXH A;  2UUB F;  3W5Y A;  1CG2 A;  4P72 A;  3AB2 B;  2HK3 A;  3LPE A;  4B9L A;  4DG1 A;  2QFI A;  1JKH A;  2D41 A;  3DGV A;  3NGT A;  4WXW A;  5K8P A;  2CNO B;  1UZD A;  1C2P A;  5HMY A;  4NXM J;  3HUL A;  4EGL A;  4YHH J;  4U8Y A;  3C16 A;  3MEG A;  4UF4 A;  1BUX A;  3M9N B;  2M8H A;  3C15 A;  1Q81 T;  3QID A;  1M5O C;  2VKZ G;  5KFR A;  1B0V A;  4HT5 A;  4S0M A;  1TEL A;  3PHT A;  2JLE A;  3D54 A;  4DDF A;  4PAA A;  1VC5 A;  2ZEJ A;  3PNI A;  4F2R A;  1K44 A;  3QMQ A;  2YX7 A;  5DG8 A;  2AWZ A;  1FRX A;  4KGM A;  1JQG A;  1TUW A;  3JAM U;  1MWQ A;  3PEH A;  2NS1 B;  2AX1 A;  3CDU A;  1TL7 A;  1N5Y B;  5J2M A;  3DLK A;  3HI9 A;  1LQ9 A;  1F5A A;  3NBP B;  2HW3 A;  2FLO A;  7FD1 A;  4NA1 A;  3OTO F;  5KG6 A;  4AL7 A;  3KLF A;  2UUA J;  4OHY A;  3I4P A;  2KG1 A;  4KPY A;  2AX0 A;  3MI7 X;  4X4U A;  1NK4 A;  2ZFH A;  3TZX A;  2BJE A;  3R7S B;  1TFY A;  2CWK A;  4Q45 A;  4L73 A;  2KYX A;  1HKA A;  4DV3 F;  3EXC X;  3TJ8 A;  4DV7 F;  1RCX B;  4LBH A;  2ZZM A;  2C3Y A;  3HZE A;  3PJX A;  5HAN A;  5L39 A;  3N28 A;  2H5I B;  4LRD A;  1NK5 A;  1RT3 A;  3S6E A;  5DDQ C;  5IQQ A;  1WKJ A;  3Q89 A;  3JAM Y;  1R8B A;  1RTI B;  2DXD A;  3CD5 A;  1MRO B;  2ERR A;  2C2Z B;  5LXR A;  4W4M A;  4ED8 A;  1OYD A;  3OTD A;  2RIJ A;  3N5F A;  1NSK L;  4QWC A;  1F5C A;  3O6Q A;  4OYZ A;  4CO2 A;  4PR6 A;  1RT4 A;  5KT3 A;  1N34 J;  2VQF F;  3M8Q A;  1RTD B;  2BA9 A;  1QM9 A;  3L9Z A;  1S1W B;  2FVS A;  1P1L A;  3NBP A;  4NLV A;  2BAN B;  3OQ2 A;  4ZKA A;  3BSC A;  4HAC B;  5ETK A;  1YQH A;  1B7Y B;  5KFO A;  1NDK A;  2W2O P;  4Y28 C;  2VPZ B;  4JYA J;  1S49 A;  1HYS A;  1K0T A;  1UVN A;  3FGV A;  5F3Z A;  1JMT A;  2HZA A;  2R3V A;  2Q6B A;  5EUH A;  3HXM A;  1VFJ A;  4NWB A;  2K7J A;  4DQR A;  1NHV A;  3I31 A;  3OXF A;  1WHY A;  2DRD A;  4TQR A;  1NJW A;  3ENA A;  5D4O A;  5KFA A;  3M1V B;  3MXH P;  3MTJ A;  4B08 A;  3CCJ S;  5KG4 A;  2E1R A;  3P5T L;  3C19 A;  2EC2 A;  4N41 A;  3K5M A;  3DRS A;  2B43 A;  2PA8 D;  4OI1 A;  2HRU A;  1Q53 A;  4KYZ A;  3MM6 A;  3KG1 A;  2IVF B;  4MKY A;  2JFK A;  5IS2 A;  1YJT A;  1F5B A;  1MRO A;  3RB3 A;  4LIW A;  5CA5 A;  4USV A;  5IM0 B;  3MOJ B;  4CLZ A;  3TO8 A;  2ZUA A;  1O5J A;  3F56 A;  4BC9 A;  4LRC A;  4QWB A;  4WK3 A;  4J9M A;  5CD4 A;  3K5N A;  3M9O B;  4A8W A;  2QSF A;  1RTD A;  1CVJ A;  1S1W A;  4WFB Q;  2RUS A;  2VV5 A;  2EBE A;  1WEL A;  1X4A A;  3H2U B;  1SJ3 P;  3R7B B;  4HAC A;  3MAQ A;  3KOA A;  3VGS A;  2I9S A;  2AYE A;  5KFH A;  4RW4 B;  2R7R A;  4A4J A;  2B4V A;  1A6L A;  4PCQ A;  4PWW A;  1DQA A;  4ECV A;  2B6A B;  4LF9 F;  3M1V A;  1CEZ A;  4ZOS A;  4TKT A;  3BSN A;  3KLV A;  4F2S A;  2LDI A;  5C25 B;  4DQI A;  3EZO A;  4GC6 A;  4J37 A;  4CI0 B;  2HPU A;  4OV1 A;  3JQM A;  3EZ5 A;  2KL8 A;  3LWL A;  1EAR A;  2XLI A;  2FPH X;  3MUM P;  3KUG A;  4GO7 X;  3GMG A;  3ISZ A;  5D6G A;  4B9S A;  1J5O B;  2EFG A;  2A10 A;  2W4D A;  5IM0 A;  4N76 A;  3TA1 A;  5E3Q A;  1SH0 A;  5F0U A;  1T11 A;  4ICL B;  5E5N A;  3R2C J;  1S9G B;  2VFS A;  2GVZ B;  3H20 A;  1S57 A;  1FES A;  1EJ7 L;  5B0A A;  4O3S A;  3C2P A;  2UXD J;  2O5D A;  4ECZ A;  2CZ4 A;  3CT9 A;  4EWT A;  3H25 A;  4WFY A;  3NMR A;  2H3E B;  3TX8 A;  4ECU A;  4ZVR B;  3I0R A;  2LXI A;  4GO5 X;  5KG5 A;  4UQT A;  2KXN B;  1JXL A;  2MQL A;  3PYF A;  3KHG A;  3MMA B;  2F8H A;  5T41 A;  2B5J A;  3IRW P;  1TTH B;  1EX8 A;  4RW4 A;  5F0W A;  1FEH A;  1WC5 A;  4Y00 A;  2PFF B;  2R9L A;  1VQ4 S;  2NXE A;  3CJQ A;  2B6A A;  3MCN A;  4ECT A;  1IJE B;  2H4W B;  3K17 A;  4DL0 C;  5C25 A;  2LEP A;  3VAL A;  1T9U A;  1X4B A;  2GX8 A;  1S6U A;  2I6W A;  3TEH B;  3PIO Q;  2KT3 A;  1BE4 A;  3V5R A;  1AZS A;  5A8R B;  3SQO P;  1L5U A;  1QSL A;  5CHC B;  2XGP A;  1HPZ B;  1M90 T;  1XR5 A;  4DFJ A;  2LCW A;  1J5O A;  3LAM A;  2F63 A;  1YIJ S;  4FYX B;  2AQ4 A;  2CPZ A; 
#chains in the Genus database with same CATH homology
 1HR0 J;  2UXD J;  1HNW J;  5IT9 U;  4JI3 J;  4AQY J;  4DV3 J;  1FJG J;  2MTL A;  4DV2 J;  1HNX J;  3T1H J;  1IBL J;  4NEY A;  1HNZ J;  4JI0 J;  4X66 J;  4JI7 J;  4NEZ A;  4LFA J;  4X64 J;  5A2Q U;  4DV4 J;  4DV5 J;  2UU9 J;  3D3B J;  2MEW A;  4GKJ J;  4PWW A;  4LF5 J;  4DUY J;  2KVQ E;  4DUZ J;  2E5L J;  4DV1 J;  3J7A N;  4JI1 J;  4K0K J;  4DR4 J;  4B3M J;  2F4V J;  4LF8 J;  4DV7 J;  4KHP J;  4B3R J;  4DR6 J;  4KYZ A;  4B3S J;  4JV5 J;  1XNQ J;  1J5E J;  4X65 J;  4DR3 J;  4LF4 J;  4NXN J;  4LFB J;  4LFC J;  3JAM U;  2HHH J;  4B3T J;  3IMQ J;  5FLX U;  4JI8 J;  4X62 J;  4LF9 J;  2ZM6 J;  1N36 J;  4JI2 J;  4JI4 J;  5IWA J;  1XNR J;  4GKK J;  2KL8 A;  3T1Y J;  1XMQ J;  2MQ8 A;  1N34 J;  1IBM J;  2UXB J;  1N33 J;  4HHU A;  3W1Y C;  2VQF J;  5LM7 E;  3R2D J;  4JI6 J;  4DV6 J;  4V1A k;  3D3C J;  5BR8 J;  4JI5 J;  5LMU J;  5LMN J;  4KY3 A;  2UUA J;  4RJV A;  4DR1 J;  4DR2 J;  4DR5 J;  4OX9 J;  4LF6 J;  1XMO J;  1I94 J;  2UUB J;  4DR7 J;  3R2C J;  4YY3 J;  5AJ3 J;  1IBK J;  3J80 U;  4NXM J;  2UUC J;  4LF7 J;  4YHH J;  4JYA J;  2VQE J;  1N32 J;  2UXC J;  4DV0 J;  3J81 U;  3OTO J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...