3CJSA

Minimal recognition complex between prma and ribosomal protein l11
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
59
structure length
58
Chain Sequence
MWVYRLKGTLEALDPILPGLFDGGARGLWEREGEVWAFFPAPVDLPYEGVWEEVGDEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multiple-Site Trimethylation of Ribosomal Protein L11 by the PrmA Methyltransferase.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase/ribosomal protein
molecule keywords Ribosomal protein L11 methyltransferase
total genus 11
structure length 58
sequence length 59
ec nomenclature ec 2.1.1.-:
pdb deposition date 2008-03-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1170 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Sun protein; domain 3 3cjsA00
2NXNA 2B9EA 3CJRA 3CJQA 2ZBPA 2NXCA 2ZBRA 2ZBQA 3EGVA 2NXEA 3CJSA 1UFKA 2NXJA 3A4TA 3AJDA 1SQGA 2YXLA 3CJTA 1SQFA
chains in the Genus database with same CATH superfamily
4R8UB 3EZ5A 3EPIA 3TAPA 2ZKUA 5A2QY 1QAYA 3HFKA 4ID5A 2I8EA 2RIJA 4F50A 1T9YA 3BDEA 1EARA 3A4TA 2V4QA 2HW3A 3ZTQA 1BD6A 2JEIA 1H6KX 2E9RX 4Q45A 3OL6A 1RQ0A 4IRKA 2XB2D 1TMMA 1WHWA 4L76A 2HVEA 2YPZA 2N3LA 2CPDA 4FZVA 5K14A 2R7WA 3T5KA 2CPYA 2RHQB 3CMQA 4IOAQ 2DBBA 4NEZA 5KFIA 4ANEA 1RT3A 2HURA 2RVJA 3MM7A 1VQLS 3IRXA 3M1VA 4FN5A 4CP5A 2BQUA 1X8DA 4QPTA 1XQIA 4N56A 1REGX 3GYGA 3D28A 2NZ4A 3UD5A 3AJ1A 2W9BB 3D1QA 1RHJB 1FE0A 4DR5F 1LW2A 2PMWA 3PKYA 4O3QA 3HHLB 4JI0F 1TR0A 3QRPA 4ILMA 4TLRA 1S0OA 2LU2A 4DFMA 2K8GA 5ETNA 1Y7PA 2DITA 1VIXA 3AFGA 5LSOA 3LF0A 2KXFA 3K57A 2LQ8A 1A7GE 3SV3A 3E01B 4EGLA 3M6UA 1MWZA 1WC5A 4WU2A 3KK3B 3PX0A 4FYDA 1K8AT 3BEGB 2M2BA 4JI6F 2C2DA 2C3YA 2YX4A 4ILRA 2ZITA 3W8GA 3G96A 1LWFB 4LRAA 4AL5A 4N5SA 4PQUA 3SIPB 1TKDA 4NXMF 3MEDB 3T5HA 2YPYA 4DFKA 1D0EA 3MUTP 3GG1A 3IFEA 1BHNA 2OLWA 3PYGA 1WF2A 2C22A 3PACA 2VOOA 2DR8A 1X9WA 1H2VZ 3AB2B 3KKFA 5I4MA 3S8SA 2UUTA 1N33J 3N6MA 3PO5A 1TP7A 1WKJA 1RAFB 3CJ2A 4R25A 4ZHRA 1J2VA 3FNNA 5SUHA 4X4RA 5HBMB 3IC1A 3OHBA 3KG4A 3MR3A 2FGOA 3QYYA 2FVRA 2WK4A 3FCHA 3MUMP 3KUEA 1X5OA 4JI0J 2VD3A 2N7CA 2EC0A 4UTGA 2NPFA 1RK8A 4ZA1A 1QLNA 2GV1A 1KSPA 1C1CB 2AZ3A 3DI6B 2HFZA 1KLNA 1JLGB 4OJ3A 2R7XA 1U8WA 3QSYB 4JI6J 5IQQA 1WG4A 3MOJB 1DQ9A 2MHNA 4DV1F 4OHZA 2W4DA 3IS9A 5KFKA 3T9NA 3TARA 3MM5A 4HL9A 4EYHB 3OXFA 5KFQA 4DL5A 4JYAF 4CYUA 5H1SV 3IR5B 4PG5A 3MR2A 2CPJA 1J5OB 2ZD1A 4UT4A 2DY1A 3UD4P 4ZPCA 2VFRA 3H0PA 4J5OA 1N33F 2NXCA 3MF5A 4FS1A 2J0SD 4G1PA 4QOTA 1F0XA 3Q8UA 3UE2A 4I2PB 2HQGA 1KRPA 3QZ8A 4OYBA 2AW0A 4UZBA 1G1XA 2L48A 4X4PA 4WFYA 3OW2R 2G4BA 1CPZA 1FDDA 4MJKA 3TAMA 3QQCD 3MMBB 2R2TA 1HI1A 1IM6A 2V9KA 1X4GA 2V4JB 1O6XA 4O4RA 1UPMB 4ZKAA 2CNNB 2C3UA 1QTMA 2UXBJ 3FMWA 3GV5B 1AW0A 3EMTA 2E1PA 4KKOB 5J1EB 3CWJA 1RWKB 1N6QA 4L73A 4ED4A 4DV1J 1X9SA 2ALZA 4BDPA 1MROB 1HFEL 4EFAC 3RBDA 1PKUA 1ZYQA 3QFWA 4ES1A 1ELOA 1U45A 4GVBA 1W26A 2LKZA 1WI6A 3CCZA 5B0CA 1OYDA 2M0GB 1CC7A 5M2RA 2H5EA 4ANCA 3CF5Q 2R2UA 2HMIB 1PIEA 2RKIA 2DPJA 5DGAA 4B3SF 1OIAA 2GO8A 3QSIA 5F3ZA 1WSVA 5F8NA 2HG4A 3AOCA 3H2LA 5F0WA 1VDHA 2EK1A 1UJ4A 1W25A 2N4CA 2BYCA 2R3VA 2J0WA 3C6TB 2KTQA 4IFVB 4MKAA 1FFSB 4QW9A 1YHQS 1RAOA 1S1TA 4F4YA 5ETKA 4MAKA 3ISNC 3D2WA 3EGWB 2L9WA 3VR1A 4UOHA 4R5PB 1N54B 2CQ4A 3BGFA 1OQ3A 2HNDA 3OT9A 4RKUC 3C6UA 4XTTA 3RRGA 2DCUB 5HMXA 1TKXA 4KGKA 3EGZA 3GV8B 4OYIA 1VLOA 2CPXA 3M2UB 3M8YA 1URRA 4LF1A 3W9HA 2OGUA 5IM0B 2OSQA 2LXUA 4WFAQ 3BKUA 3PJXA 1FKPA 3TVKA 1TV6A 4H4MA 5F8JA 1VLYA 1HWIA 4QYZK 3TAMB 4C8OA 4IG3B 4ZN1A 3VGSA 1WC4A 2CNOB 2VG5B 3QBCA 4F3MA 2KM8B 3RU0A 2M9KA 2AP6A 1FE4A 1T02A 5FLXU 3IM8A 3DRPB 1FJ7A 1HHSA 2QA4S 1MU2B 3A3OB 1N56A 2EFQA 2FY8A 4Y00A 1SIWB 4C0BA 1IR2A 4JI4J 3OSPA 1YK9A 3M30A 1CBKA 4AT1B 3MUVP 2QT7A 3KHLA 4DX6A 3BF4A 1NJYA 2W7PA 3PEHA 2DR9A 2QL5B 5JJBA 2BE2B 3FZBA 2Y0BB 4OZNA 1T8EA 3NS5A 2DNMA 1YSJA 4WE1B 3TA2A 2XM3A 1JXEA 2HPUA 5DG9A 4DX7A 4TXSA 5HJYA 1SQEA 2V8HA 4LR8A 2DNOA 2W4PA 3GFZA 4P2XA 3PR5B 3H4BA 1UFKA 2KJWA 1W7WA 4M5IA 4USIA 3JSMA 5D3GB 5ADZA 1TVRB 2ZHAA 4DR3J 2IBOA 4RU2A 3LW5C 1KFSA 1SI9A 1D8ZA 1H3DA 2HNZB 3A8EA 4DQQA 2V5HG 2F1FA 2PMHA 2V34A 5EX0A 5KFNA 4M5DA 4O3PA 1S77D 3C16A 3M2VB 3F56A 5HAOA 3F73A 1AXQA 4DPUA 1N32F 1SV5B 2OO4A 2OHDA 2CDRB 4I7FA 4QIFA 3TX0A 1REVA 5DDOC 4EEYA 1TVRA 4NXNJ 2CAJA 5B0DA 2GVZB 2F40A 2RU9A 4C2MA 4LQ9A 4Q8EA 1RP5A 3ICLA 4GVLA 1IWGA 3J7ZT 3R9LA 2YVSA 3FUYA 2DRAA 3PRBA 3D54A 2XI3A 3DOLB 1GEHA 1HNVA 2UXBF 2B4PA 1YRTA 3NCPA 4LIRA 1N34J 2DGVA 2P6SA 2WVEA 3W65A 3GSIA 1WUUA 2JFDA 1AFJA 1HNIA 4J37A 4C6AA 2D9PA 1IR0A 3M2VA 1X31C 1GTHA 5B09A 2YX1A 5C24A 2ZE2A 4Q2LA 3KLEA 1ZOTA 2KVIA 1JX4A 4NLGA 3E8OA 3IA0A 3W9IA 5K14B 5EWGA 1KONA 2I2YA 4E98A 3KDNA 4J9PA 3ZFVA 1N0VC 1SUQB 4IQMA 1T3NA 1BWVA 3ELHA 3LP0B 5CD4A 3CCTA 4USVA 2XS2A 5A0YA 3HT3A 3HFZB 2CXEA 3DGPB 3HZEA 4IH6A 1X7VA 4WFXA 1Q79A 2OSRA 4TQRA 2YWWA 3LALA 3CCMS 1HNXF 4A8FA 3DU5A 4U95A 3P96A 4CWBA 4JI2F 4X62J 2DGOA 3L7UA 3O3LA 1LWCB 1R8PA 4KH1B 4ZJQA 1ZTTA 3K8WA 2F8MA 2QV6A 3JYTA 2ZBCA 4DR7J 9ATCB 3K59A 3QRQA 2JNJA 3ILJA 4Q2MA 5K20B 1TUWA 4P7TA 1JLAB 4OMFG 4Y2IA 1VRQC 4N77A 5U47A 1D09B 1HYSA 3ZTSA 4PXBA 2W7OA 4KGVB 3EYZA 3EVMA 4HHJA 2GHPA 5LSRA 2QLFB 1C0TB 1VC0A 1CC8A 3ETMA 3BKTA 2E9TA 1XC9A 3C14A 3N79A 1NDKA 5DG7A 1Q82T 3GIKA 3ILOA 1TL3A 2CQ2A 4CI0B 4TU9A 1PJ5A 4F67A 2LEAA 3TZZA 1FT8A 4RW9B 5KT2A 5AT1B 2FIUA 2HGLA 2X1FA 4YP3A 2B56A 3OL8A 4WP8A 1M5KC 4KRWA 2CQ1A 2PEBA 3CJKA 1FRMA 5E3CA 3DC2A 4DV3F 1U1OA 3BBCA 5IV4A 4ZP6A 2DPIA 1RT4A 1S9GB 4R5PA 2NZCA 4JI2J 4X62F 2LLZA 3MXHP 3AQOA 1UWBB 3LPEA 2AJ1A 2JLGA 1T03B 2XMWA 3QGPA 2PT0A 3VAFA 2LP4A 5GVQA 4PUOB 2YQ1A 4ZP7A 3U02A 2FHMA 2J9DE 3MECB 1ZTWA 2PEHA 1HARA 3VGUA 1H98A 4B3OA 4PRFA 2B8QA 2RKIB 3FQKA 1R6YA 1P9YA 1C1BB 1VQSA 3P45B 1SKRA 2OPQB 4UZCA 2FGCA 5F8IA 2OH2A 1XR7A 1VGYA 3QJPA 1BUXA 1FVQA 3RB3A 2ASLA 2J9DA 1JJCB 5M2UA 4RUCA 3JSYA 1RHRB 2V0NA 2ABYA 4BC7A 1S1XB 1ZA1B 3TZXA 2DNGA 2HQCA 3JXOA 4MYTA 3W1YC 5KFHA 1S97A 3AHPA 1ZM4A 5D78A 2YH1A 3CMES 5EN1A 5HATA 5GAHU 2FC9A 2Z58B 2KG0A 3KTQA 1LXNA 2QYGA 3G6XA 2GVDB 2C2RA 1XR5A 1SC3B 3OR1B 3WHIA 5F8GA 3N0VA 3TQEA 5J2NA 1S6OA 4TLQA 5ETLA 4LF5F 4PXCA 1IM4A 7FD1A 4DV0F 3GJSB 2MTLA 3RJMB 2E5JA 1YKWA 4A8QA 1KEKA 4U6PA 1OS5A 2VDIA 4OZJA 2Y3YA 1BGXT 1B4SA 2ACMA 1FD2A 2KH9A 1X4AA 2JWNA 2W8KA 2K3IA 2BM0A 4ELTA 2BRKA 2XYHB 3MM5B 5C5JA 1YRXA 3VGVA 5AJ3F 3CD7A 4FXWA 4HHHA 1RA7A 2OTJS 1FWLA 2G0IA 3P6YC 1HL6A 5DETA 4DUZJ 3SZ2A 3V4IA 1R0AB 2O67A 3CC2S 4ZVOB 4KR0B 4V1Ak 4DR4F 3SQGA 3VVUA 3KJVA 1VI7A 4MTPA 2ZOMA 3EGNA 2VZ9A 2R2SA 1FDBA 3O2IA 4GKJF 2NYIA 1JLEB 1TL1B 1RAGB 2MKHA 3MMCA 4RUAA 5DM7Q 1XNQF 4NLTA 4B08A 1VBXA 2XMMA 3RW6A 3ENAA 3KLEB 2MLXA 4DLEA 3OTDA 2JLEA 5A8KA 3BPSP 5B0AA 4ZDNA 4OYXA 5HO4A 1EIYB 1KTVA 3CJ8A 2DEJA 4OZ3A 3I9V9 2IDLA 4M5NA 4MT1A 5CYQB 3BKFA 3EZOA 3PG9A 3MPVA 3QPIA 4DG1A 4EWTA 6AT1B 4O3OA 1R0AA 4NX9A 3NMRA 8AT1B 2WSCC 2JHEA 2VB6A 4ENOA 2NREA 3ADAC 2DJWA 3DLEA 1DY3A 1NHUA 2GVDA 4QIEA 2WVCA 2C2EA 3PYEA 3C15A 2QYCA 3UNYA 1YJTA 5AJ3J 4CT9A 3AD8C 4ED1A 2Q66A 3M6WA 1RYRA 1NPPA 2J6UA 2V50A 2MKJA 1A9NB 2AJQA 2ASYA 2RF2A 2VUGA 3HVTB 3MM6A 3O6QA 2APOA 1CJUA 3CCES 3CCWA 4LJMA 4FS2A 1KLMB 4X4VA 1S9EB 2O5DA 4DN0A 1VQ5S 3D0GE 4ELUA 2CZ4A 2L9DA 5HROB 3D4JA 1GMWA 2KZZA 1SJ4P 2NSBA 3HPOA 3ITHA 2CJKA 3QNWB 1FRIA 2DHAA 3H5SA 4DPXA 2EFVA 5F9NA 2RQCA 1M1KT 3RAQA 3O44A 3DHWC 2RDIA 4WE1A 2HIYA 1FKPB 4O0IA 5L1IA 5ETPA 1TL7A 2D69A 2DO4A 1RCXB 4X4SA 5E41A 3T6JA 3OJUA 4M95A 4ED2A 4EZ9A 5DRKA 1FRHA 3KLIB 1IKVA 1DAXA 1DBDA 2KKHA 1SC1B 4OX9F 4K4TA 2BJDA 2IYGA 3D6HB 4H4KC 2YKAA 3P49B 3DLLQ 1UEVA 2E5LJ 1RT4B 1RHQB 1S9GA 3MEEB 4F7VA 4OHXA 1Q8IA 1RZMA 3I5BA 4DI6A 4NI2B 2N82B 2XG8A 3I56S 2OAUA 4O44A 4CRJA 1WF1A 4PG6A 2FZGB 4L72B 5CQGA 6FDRA 4HI1A 4DL4A 3HVRA 1RUSA 1B0PA 1S1TB 4DJBA 1U1KA 2ZNYA 1KTQA 3Q2SC 3KUGA 1HIYA 3ZC4A 3JTOA 1AROP 3L7OA 3BZQA 4EK2A 1SL0A 4PUOA 1MWQA 5ETRA 4DSIA 3UCGA 1V5VA 4QYZJ 3M8RA 2FDNA 1MMLA 2GCFA 5L39A 3W2WB 3T1HF 4NWBA 4QYRA 1I3OB 1RYSA 4K7QA 3JTNA 4HKQA 1VHIA 2H9ZA 4DR6J 4YUDA 1MROA 3VV2B 4OHWA 1A0OB 1MN9A 2R8KA 1FO1A 2CPFA 3LPYA 3MEEA 3MR7A 3JQKA 4DUYF 4CLTA 2PIIA 1SJ3P 5J2MB 2JJ4D 2R7QA 2XMAA 2D3OR 2UVRA 2R7RA 3V6HA 4OX9J 1XEZA 2CIMA 5A76A 4WFNQ 1N6QB 4LF6J 4NYZA 1Q8BA 3H2UB 2E5LF 4PKDB 4YHHF 3V6DA 1UWAA 4LF4F 1S48A 4P73A 2GIFA 4L6V3 1NSAA 2NS1B 4KB7A 2W9AA 3MM8B 1SKWA 3QJLA 2FPHX 1GK8A 3FMBA 4LF9J 1GFWB 3FBEA 1S12A 3KLFA 1XIQA 2G1HA 3GSDA 2GA7A 1JLAA 4DV4J 4W92B 2ASDA 2CQBA 2J0XA 3RRHA 4E0DA 5DLFA 2CQGA 3J81U 3Q2TC 2JRSA 5KFFA 5IWAJ 1X4DA 1E6VA 2XLIA 1LWEB 4DX5A 2B4VA 1BC6A 2MQMA 2SXLA 5KTQA 2BW2A 4XO0A 1ULRA 3M8ZA 1Y5LB 3K17A 2QLWA 3DGPA 2YY3A 3GFXA 3GPAA 4DPOA 2ZJQQ 1I6JA 1HQUB 2N7YA 2Z8QA 1BE4A 2XZTB 4FYVB 4KT0C 2RRNA 4PWUA 1Q1KA 3VHQA 1B3TA 3D66A 1KC8T 2QTWA 3Q86A 4ZP9A 4N47A 4WKRA 3PR4A 1KLMA 2KL8A 3C16B 4DN9A 1K9MT 1WHVA 3QO9B 1U09A 4LF9F 4QIVA 4C8ZA 2BV3A 2OUGA 3I82A 3G86A 1SJRA 1TKZB 4NCGB 4B3MF 3MWBA 2IM3A 3FRYA 2KRBA 4DV4F 3D9BA 3DLGB 3L95X 1ZPVA 5LMNJ 3D6FB 2CWKA 4CT8A 5HQMA 3VAJA 2NCKL 2VU5A 1F2GA 1JLBB 1RAJA 2HBRB 2DIUA 3PXGa 4B9MA 3NNHA 1PJ6A 4KFBB 1Q8LA 4ED0A 2NUHA 2HHUA 1FRLA 5KOXA 2VJUA 1H7XA 5JXSA 5KFTA 3N4WA 2VICA 2Q1LA 2OJ3A 5CYJA 1UA1A 1RAIB 5ETVA 2HFVA 1ZZNA 1TELA 4DSLA 1HD0A 1U7LA 3BYRA 4CM2A 1DQAA 1KOOA 3SQOP 3AOAA 2W2MP 3QIPA 4OYPA 4GMKA 3MCNA 2AGOA 1CULB 2CPEA 1S72S 4NASA 3V4IB 1P1TA 2EFNA 4IO1A 4USWA 1N36F 1GT8A 4DV6F 2ZBPA 3THTA 1HQUA 2CJAA 3NOCA 3QGIA 1HKAA 1Z2ZA 2CQHA 3BH6B 5KFOA 5A8RA 1LEOA 2WVFA 2XSJB 4USKA 2MJNA 1RT6A 5CH7B 3CCVS 1NJWA 1KFDA 2HWHA 5LMNF 4B3RJ 2MYFA 1U49A 3N5BA 3FEZA 5HMYA 3BQ2A 2A6OA 3CJSA 1KOHA 1IBMF 1RT7B 3I0RB 1QSYA 4RNMA 4ZVRB 2Y1RI 1NJIT 3IBCB 1M5PC 1BQMB 4FBUA 2E1MC 2HHWA 4OZ0A 5EHHA 2UUBF 2CJ9A 3HHLA 3AA9A 3BN7A 2ZWPA 4ID5B 2F5GA 2OEKA 3BREA 4YQWA 2BKOA 1TV6B 4H4MB 2LQBA 3F0NA 3OLBA 3ETOA 2ROGA 3CCSS 2JEGA 2HQIA 2F3JA 4I6WA 2XBPA 2ZOGA 1LW0A 1R8AA 1DTQB 1K0TA 3LAKA 4ZLLA 1H73A 4B9VA 5KFWA 2DR7A 1TFYA 5BXIA 1X4HA 3PW5A 4N8NA 1YJNS 4DF8A 4D3HA 2DT9A 2ZBRA 5HSPA 2MQLA 1VQ4S 1TL4A 2XY6A 3OUYA 1JLCA 2MZSA 4Z7CA 2VHGA 4X65J 4OI6A 1WOOA 5KT6A 3MURP 1RJJA 1IWAA 3GIJA 3NMAA 1S1UA 5C7PA 4LVNP 1IBMJ 1SJ1A 1T9TA 5I3UB 1EP4B 1YJUA 5HL7Q 5CXTA 3NY0A 2DGTA 2C3MA 3JAMY 2ZM6J 4ICLB 1QY7A 4LBIA 1TL3B 5A8WB 3J80U 2VBXA 2W24A 1NJZA 1RADB 3B4DA 5LM7E 2KB2A 2ZC3A 4HVZA 2V67A 4G6VB 3LGHA 4TYAA 1V3SA 4RW8A 5D4LA 2MPUA 1W2BR 1ZZFA 4GVBB 1AB8A 4DFPA 2UUWA 3W66A 4C7QA 1NCLA 1V9OA 5KT4A 1JK9B 3BO2A 4J9VA 4GC6A 2IRYA 4X4NA 4NZ7A 3DRXA 4FVCA 5RUBA 3OUYB 2PE8A 1RWVB 1IKYB 2ILYA 2P5VA 5B08A 4RWXA 2F8EX 2WB1D 2LA4A 4LREA 4URSA 5C2CA 2EKNA 3M05A 4UY8T 1KQSR 2JOQA 3R2DJ 2QLJB 4KHPJ 3DOMA 4LFBJ 2FZKB 1RDRA 3U1NA 4KSEB 5IXUA 3PZPA 5C2GA 2X1AA 5DDQC 1HBOB 2AT1B 1IKXA 1NO8A 3M9OB 2VG7B 3P5BP 4AE5A 4PYDA 2AWZA 2EBEA 4DBQA 2R8GA 1Q78A 2E66A 4ETXA 1N8RT 4I2PA 5B0FA 2PFFB 2I5JA 2ZH4A 4M5KA 4F2SA 1MMNA 2QSFA 2VOPA 1SC4B 4QWBA 4C3LA 5LXYA 2B5JB 4HLBA 2Z2ZA 2MMYA 5CZVA 3TZWA 4F25A 8ATCB 5KFJA 3M2RB 1CJUB 1PAUB 4EBEA 4DSJA 2V2QA 3HM9A 2Y1IA 2GGPA 3RAMA 2IRXA 3KOAA 2VV5A 3DDIA 1BQXA 3VGTA 2RD5C 1KKHA 2XHWA 2G2YA 1JJHA 1HBNB 5EUHA 5BR8F 2HRUA 5A8RB 4LSZB 2HZVA 2QMXA 1BLUA 2B6AA 2LDIA 3JTPA 3THVA 2MY7A 2LEBA 2DNQA 2YKPA 1UW4A 1O51A 3DHXA 3GYNA 3LP0A 3ONQA 3R5AA 3QLHB 4NA1A 3CVKA 5M2PA 4J9RA 5J2QA 1G6BA 3TQ1A 3LP2B 5CZXA 1EKRA 4PQUB 2KVQE 3CO0P 4I7FB 3AD7C 1UZDA 5HANA 1VCTA 3FJ2A 1TAQA 3UN2A 2FJDB 5E7OB 2RT3A 2J5AA 1M5VC 1TKTB 3AOBA 1S0MA 3VTIA 3EUNA 3TNVA 1JLQB 2AJ0A 1BXNA 3P8BB 5GAGI 1S0VA 3IG1B 3TO8A 1CS4B 3DOLA 1GTEA 4X64J 4V19X 4ZHRB 4I67A 1NUEA 1RTHA 4ZVGA 2E5IA 2CJXB 2H48B 1KBRA 3R27A 4OLPA 2X7IA 3SCKE 4QWDA 4IR9A 1R89A 4O3RA 3UR3C 1FKAF 1X4EA 3HLUA 3QGHA 4JI3J 1SXLA 2KM8C 2Y8WA 3WIVA 1GX6A 4UQGA 3PNIA 3VAHA 1CS4A 4ZITA 3G2XA 4M5JA 3M8QB 1LWFA 2VDHA 1TKTA 5B0BA 1RHUB 1RTIB 3U1LA 3EJMA 4LQ3A 1KHVA 4ED3A 2NPIA 1IBKF 3FCWA 4IH7A 5FDLB 5KT3A 1B0VA 2EKYA 3M6VA 5E3PA 4IRDA 1NB7A 3BGRA 2C2NA 3MPDA 2B6AB 2I0XA 1NEEA 4HR2A 2FJEB 5KFLA 2HHHF 2IA0A 4KBIA 1BMQB 1VRTB 1LW2B 3Q8QB 3MI7X 1FDAA 1BWEA 4KHRA 4RR5A 3CO9A 3DLKB 3FVYA 1NSKL 2JSXA 3DOMB 1IJFB 2IMWP 3PJ9A 3W5XA 4X4QA 3SYZA 5F3TA 3DM2A 1F2HA 3ENQA 1WEYA 4ZP8A 2DHXA 3BN4A 4UOFA 2C2MB 3SI8A 4IOBA 2FYXA 3GJQB 3PDNA 4ZVSB 1U0HA 4DHVA 1CLFA 4TYBA 1F5CA 1NZ8A 2F9DA 5L46A 1HLWA 4USMA 4F4XA 2XYPB 2HIQA 3QAUA 2XZWA 5A6WA 4KV8B 4C0OC 4GC7A 1G7CB 1TUVA 2EFOA 1JQGA 3EE3A 3PW0A 3B54A 3TEHB 4M94A 3UVJA 3HO1A 1JB0C 4CH7A 4CTAB 2VG7A 1SJFA 1IBKJ 3HD2A 5F8LA 3D0IE 1Z1ZA 4NPOA 3HDSA 1T11A 2K3KA 3SXLA 4CM0A 2UXCF 2F4VF 3MPWA 1PC5A 4HT5A 3KG0A 1NDCA 2HHHJ 4DPYA 4RW6B 2AYBA 2E44A 2MZTA 3QWUA 2XO6A 2CPHA 5BJRA 3IN5A 5DQHA 2FJVA 1HNWJ 1U1NA 3ZZYA 1XMQJ 1WG1A 1MSWD 5D4NA 3BQ1A 4ATNA 1JJ2R 2YTCA 2Z56B 4Q44A 1FJEB 5LJ5Y 3KLVA 1RBOB 3KJFB 4ALZA 1NKEA 5HMWA 5F8MA 2J7UA 2HBQB 4U67Q 1JWWA 4P72A 2Y0SD 2AU0A 1U4BA 2FJXA 1NK4A 1GH8A 2FHKA 3ENVA 2VA2A 2RRBA 2QIFA 5L1LA 4B9TA 4P6QA 4EU0A 4QWAA 1D1UA 1CJKA 1OO0B 4WU3A 5SZTA 2WTFA 4EYIB 4OV1A 3ZTPA 4KYZA 4Y2MA 3JAMU 1WC6A 2DGWA 2QA2A 2RUSA 3JB9k 1QAIA 2UXDJ 2UXCJ 3BM7A 3P3DA 1UL3A 2FVCA 1S6UA 1Z2LA 2PDAA 5K8PA 4UQTA 1VK3A 1DRZA 2BE7D 2A3JA 4OYWA 5KFVA 1T3OA 4HTIA 2FLNA 3BBFA 4OYOA 3NL0A 4URQU 2CPIA 3RRKA 4YDXA 1MLAA 1P6TA 4U7UK 1WNEA 3H7HB 1XMQF 1M5SA 2P9CA 2R7OA 3PIPQ 1FI4A 5KFCA 4OI2A 4JI8J 3CULA 2NSCA 1HBUB 2C42A 2IAJB 3BGRB 3GP9A 3FEYB 4GO5X 2VODA 2R42A 2R7UA 2U2FA 4LT6A 5ETOA 2A0FB 1CJVB 2RUGA 2D3O1 1UVLA 2JFKA 4ILLA 2FLOA 3EGVA 3LH2S 3PEJA 4LSNB 3ZTOA 3I5CA 1EQ0A 3AA8A 4UUWA 4ECYA 4U7UD 3KK1B 2CG4A 4Z37A 3OR2A 1RLDA 4C8YA 3FSIA 1RU1A 5CA5A 4RNNA 3ET6A 1ZM3A 1RT6B 1AZSA 2CQ3A 3VVTA 3BYPA 4DPTA 3OVBA 2IBKA 5IT9Y 1V3ZA 2H65B 3HI9A 4X66F 2HS3A 2J8SA 4JI1J 2HFNA 4MIBA 3UN3A 1A6LA 3K89A 5AE1A 4A48A 5I42A 4QIWD 2VBWA 4LF7F 5K9FA 2XEXA 2GVZA 2EFPA 2PSZA 2QE5A 2B9WA 3FBFA 4DQIA 4K4ZA 3AT1B 3MAHA 4JI8F 1TK5A 2DISA 3DMJB 4IFYB 2HLTA 5C24B 1TMJA 3M8QA 3MZIA 3RZAA 3FKBA 1FXLA 1CEZA 3AJ2A 4JOUA 1RWXB 2QL7B 3PRDA 4DL2A 3ZZOA 2YWKA 2IC3B 4LFCF 2HS4A 2DNPA 2ZH7A 1XMOJ 1NSQA 3X1LB 1IBCB 2YWFA 3I0SA 3QRRA 1MWYA 2MZRA 2V8GA 1EJ7L 4O3NA 2GJFA 2MY8A 4JUZA 3RYLA 4DPWA 4EBDA 1O0PA 4NCGA 1NKCA 3WBZA 2FQQB 4OX6A 1XJWB 2ATCB 4EO8A 3ZXWA 4OX7A 1UTAA 2XGQA 3KK2A 1VR6A 2E1CA 2OI2A 1VJWA 3R5BA 4XPEA 1QD1A 1HPZA 4P71A 1SVDA 4A8KA 3CC4S 2JLFA 5DZ6A 4O4GA 1Q0NA 4ZCMA 1ICEB 2EXUA 1HBMA 2IDEA 1EX8A 2OP5A 2Q43A 2V63A 1R8BA 2WRMA 3L4BC 2O1PA 4W4MA 4MIWA 2RHSB 2DNRA 1QE1A 5F41A 3W61A 1JMTA 4JI5F 1NHVA 2W9BA 5GMEA 2E7XA 1HBNA 3TJ8A 3OFFA 2HK3A 3G87A 2HYIB 4DL0C 4C8MA 2BM1A 2HAFA 1N5QA 2ZFHA 3A3NB 2VG6A 1FWKA 1ZETA 1RTZA 2VKZG 1VQ7S 4LFCJ 2CJYB 2OKQA 5LMUF 3ZO7A 2UV8A 3H5UA 4Z2XA 5E0OA 1WKKA 1R27B 1RAEB 3I32A 1U0SA 3BS9A 1NNDA 1VOMA 2NLWA 4RW4A 4JV0A 3WX4A 3OLAA 3PO4A 2WONB 3PJWA 4OX8A 2YNHA 2X1BA 4PQAA 4J9NA 1LFPA 1APSA 2OMOA 4OZ5A 1WG5A 2GNKA 3GCWP 4R0JA 1NLKL 2W25A 3FGVA 5KFXA 3G71S 3GV7B 2OPPB 3C6TA 5C42B 3CDWA 3D6MB 1R8HA 1DTTA 4WWSA 4Y28C 3MECA 4HT7A 1NXIA 4NMLA 4J9LA 5J1PA 1YGYA 4TVAB 5G0RB 3L7PA 3KNGA 3LGNA 5I3PA 5K5MA 3VQSA 3LWLA 4P75A 2HMIA 3DRRA 1BY9A 5J2MA 4L74A 1IXKA 3OTOF 1T03A 4P52A 3GILA 3JS9A 4ECTA 4Y34A 4GKKF 1JLCB 2DO0A 2BA9A 4JYAJ 1NHKL 2J7WA 2R9LA 2W1BA 3I55S 1JJ4A 3CW2C 5LMUJ 1SB6A 3D6TB 2Z57B 2V8VA 3MM8A 3PHTA 2D41A 4FYYB 4HACB 2DRBA 2WSFC 1GNKA 1Q53A 1PO6A 4YFUA 2JC0A 2YNIA 1X60A 4LRBA 3I4HX 5DGBA 3N6NA 4BLGA 2MGZA 3FSYA 4KY3A 4NLSA 4CDIA 2K06A 3BGUA 2QSWA 5JUMA 1KNZA 2CADA 4QW8A 4YB5A 2WVBA 4B17A 2LCWA 2MKSA 1V5IB 2MZJA 4DF4A 1QDUB 1YLXA 4D3GA 3NXZA 1VQPS 1OJ4A 1FK9A 3DRSA 4FPRA 4RL1A 3VAMA 4ZPTR 3OTOJ 2Z4PA 2NXJA 1KS2A 4M5MA 1LWCA 1TK0A 2GZOA 1GXTA 2V4JA 2NXNA 3I4PA 1HR0J 4KHMA 3PKMA 1RCOB 1X5SA 1U6FA 2DHSA 2MQNA 3T1AA 2XSJA 3HP6A 3KMQA 5B0EA 3H2VE 2DNKA 4DCOB 4PEOA 4P2SA 4IOCQ 2HFUA 1ZBTA 3IO1A 2HWTA 4TQSA 1WD6A 2XCAA 3V81A 5HROA 2BW7A 2D1CA 3R8YA 1OY8A 5BYQA 1HBMB 1FJGJ 4U8YA 2AJ4A 4F36A 1QTNB 4MFBA 3OSNA 3LWMA 4A8MP 4MH8A 4J9SA 3I5AA 1UP1A 4R0EA 1HWJA 2LFVA 4EBCA 3K5PA 2W4CA 4NZ0A 1U6BA 1FA0A 1IQZA 3SQGB 1YWXA 1TL7B 2LQ9A 2H5JB 2RH3A 4CO1A 3B8HA 1UMJA 3D1HA 4N7TA 3D67A 3MM9A 2WHOA 3R6LB 4H4OA 3O8WA 2E9ZA 2IYIA 3CB4A 2HVIA 1HR0F 1R7IA 2M88A 2ZBIA 5AXKA 4C3MA 4CO2A 4ZMMA 1S10A 3HFVA 5A8KB 1J5EF 5HVFA 1RWUA 2FVPA 3ZTRA 2HVZA 4F0HA 1S79A 2XWXA 5HK4A 4K5SA 4H4KA 3I6PA 4I6AA 3KK2B 2KI2A 3HHLD 3UDVA 4A8SA 1WHXA 5E5NA 5DDPC 4LBPA 5D3GA 2CUYA 1I51B 4TN2A 3VZIA 4MMOA 2DGSA 4KFBA 4J9QA 1UVIA 4NLDA 3T5JA 3ISND 5I42B 2AQ4A 4JI4F 1YRUA 2ROEA 4I4BA 3ZZ0A 3UCZP 1FJCA 3OR1A 4BWMA 5D15A 5KFEA 1NMEB 2XC9A 1KD1T 2W2QP 2YKQA 5CHCB 2E1RA 2QLBB 3UDCA 1REVB 2XGPA 4PXEA 2C28A 4NLXA 3IRXB 5IV3A 4M5GA 2R7SA 4K0KJ 1RBAA 1Q4RA 1PILA 3IXQA 1E6VB 1VMBA 4NLRA 4RPFA 4ES2A 1MN7A 1IBLF 1XR6A 3Q8YA 2Y9HA 3C3LA 3MCOA 1S6PA 3BR8A 2KHDA 3OPKA 1SH3A 4KTQA 1NK6A 2WOMA 5D0RA 2QMUB 1TL5A 2EG1A 3DNCA 2XLJA 3QAEA 1YBUA 4ZCKA 3LQVA 4F3OA 2V2ZA 2YX7A 3R3TA 1RU2A 1DZ5A 2IY5B 3VCDA 2H4WB 1FRKA 3BGOP 1R0CB 5ETTA 2HWIA 3O1LA 5GMDA 4OI0A 3KLGA 3JSBA 4KC5A 1IVZA 3GLJA 3BB5A 4WXOA 3VZHA 1JKHB 4CLSA 3EX7B 4QWCA 3CT9A 2HS0A 1T7PA 2EK6A 1HMVB 4EO6A 1FK9B 2HGNA 3EVOA 5KG3A 4IUFA 5JMNA 2M3DA 3CE8A 5LJ3Y 5KFYA 3HHKA 1H2TZ 1F1BB 4J90A 4LSNA 5T14A 4U8VA 3MEGA 1SJQA 2MKIA 4RBUA 1N34F 3CD6S 3V4MA 4OLOA 2HSEB 1HHTP 2I5JB 3Q8PB 3Q0AA 2BJ9A 2KN4A 4DV5J 3WC2A 3G6YA 4BWJA 1IBLJ 3M4XA 5KAKA 3CJ0A 1ROFA 2QZ8A 4OZ2A 4B3OB 3C66A 2DCLA 4IRCA 1R0BG 1UJ6A 2HQ3A 2ZVSA 3EWGA 2H51B 3AD9C 3PFEA 3Q83A 3TVYA 3RB4A 2A2DA 2GMHA 3NKYA 2DTJA 2ZUAA 4LRCA 4RW7A 4WP3A 4DU8A 4X4TA 1IKYA 2KU7A 3NWRA 3PX4A 2UUAF 3A1YG 1IJEB 1ZPWX 2GS8A 4OZLA 4DV2F 2K7KA 1B99A 3M9NB 3HX9A 4KGXB 2HK2A 4Y2AA 3BSCA 2XYGB 1S7HA 2LQJA 1R43A 2CYYA 3MMJA 4RZRA 2FHJA 2NUUG 5L1KA 1L3SA 1YJ7A 2BANA 4ZPWR 3RBZA 3I87A 1S49A 3DRRB 1X0FA 2VKRA 3GB0A 1OY9A 1MW7A 3P4UB 1N5VA 4WF9Q 1NB2A 4ICLA 3QWPA 3CXCR 1VBYA 1BQNB 1JXVA 1TQLA 3BBBA 2X3DA 3HKWA 4YEAA 5DLGA 5DZ7A 5DO2A 4DCJB 4DV5F 3TEGA 2W9CA 1ITPA 4FKYA 3W2VA 4WTYA 4RLEA 2GQ2A 3D7SB 1GMUA 2P9GA 2V4RA 1X5TA 1GMVA 2CG8A 3DXBA 3KWMA 4PWDA 2XWYA 3H40A 5CCLA 1SL2A 4N76A 1DLOA 2EVZA 5AXNA 5J1EA 2WAQD 5EX3A 3TVZA 3ZNJ1 2UUAJ 2XZDB 2GW8A 2LXFA 3WX8A 4JV2A 1VJQA 1DTTB 3Q8VA 1WOSA 1OWXA 4WKYA 1UA0A 2P8IA 3IWLA 3K8VA 3NP5A 2AKWB 4U96A 4RWWA 4UY85 3OL9A 4NYOA 5CYMA 3OJSA 4O4GB 3HVAA 2WZ1A 3SSQA 3R97A 1UETA 4YOEA 2VC0A 4OHYA 1FX2A 2I6WA 1S6PB 2MSTA 4C11A 2XMKA 4I2QA 1NPKA 2M70A 3CUNA 2HHTA 2B9XA 2V8PA 4U9RA 3PIOQ 2DNZA 3HJVA 2VA3A 3G9CA 2IMOA 2B9YA 2G1DA 1WC0A 2MKYA 2DNNA 2EBGA 2VG6B 3R5DA 1U1PA 1HI8A 1HQEA 1FCAA 2DR5A 3DLEB 3I0SB 2DD8S 2AF6A 2HVHA 2LMIA 1EAYC 1AT1B 2VL1A 3S7RA 4KJIA 1VRUB 2A6MA 1YVFA 2PD1A 2YNGA 4X4OA 2UUCF 3W3SA 2R7TA 4OV6A 4JV5J 4NLWA 3FFIA 2J8AA 4WXWA 4DWIA 1NRKA 4RNFA 1Y5IB 4Y3CA 1WEZA 2ZUGA 3OTEA 1G2EA 4HDGA 3DDNA 1KP6A 5A2QU 3DMJA 4PG8A 1W2IA 3QO9A 1L3VA 4KGZB 3DKDA 2WW8A 5D4OA 5HP1B 1MNEA 2BJEA 1Z4UA 3NCRA 1YITS 3RR7A 5C25A 3S1TA 1OPIA 4PZVA 2XS7A 1VFJA 2KYZA 2V68A 1VRUA 3EM1A 2HHXA 1S76D 1KVKA 1JLBA 4NEYA 4HTJA 1DJ0A 3HHLC 2IC3A 2FUG9 1DQ8A 2VFVA 4WYWA 2AZ1A 5KFDA 3MEDA 3J7YI 4HHUA 2FC8A 4CLKA 1FHTA 1Y0HA 3KDOA 3OR2B 2UVWA 1HI0P 1QVFR 3GJRB 1PAEX 5AXMA 3DGVA 4B3TF 2UUCJ 3BH7B 2WBMA 1RT2B 4YB7A 1S1WB 1M5OC 4DR4J 4JI7J 2MZ1A 3BPDA 3V5RA 1NK8A 2YQ0A 4AQYJ 4GKJJ 1HW9A 3DLJA 3G6ES 1FD8A 2DXEA 3UO0A 2Z2MA 2XO7A 1XNQJ 2E29A 2QGFB 2AHOB 3B82A 1I1GA 3CJQA 3MDFA 3TUZC 1S6QA 1T94A 1LV5A 2IJFA 2HBYB 4IG3A 2VASA 2VQFF 4YR3A 4TU7A 5KG2A 3BSOA 2ASJA 1V3RA 1IQTA 1LWEA 3W9JA 4Q5VA 1M1HA 1DLOB 2BKPA 3AODA 4NLPA 1NK5A 2ZZTA 2V2KA 4YB6A 1HQ2A 4NCAA 2KRRA 3T1YJ 2VBYA 3U27A 4RO0A 3MTKA 1RHMB 3FCVA 3RBEA 2GJIA 2Q79A 5DQGA 3CJKB 4DZ6A 3CCJS 3DRPA 1NJXA 2AGQA 1Y4ZB 1FKOB 1GXUA 4FDFA 4O0NA 2JL9A 4YMEA 3S01A 1SQGA 1WDTA 5JVGQ 4WJBA 4ED6A 2ACYA 2BZ2A 3MGJA 2HFSA 5LT5A 5KT7A 2YBVA 3IAS9 3OD2A 3J7YU 3OXLA 3US5A 4C8NA 3BDPA 3WDOA 4JI7F 3ZZZA 1B7FA 4AQYF 2NR0A 2U1AA 3QJJA 3MEKA 3AAWB 3EDRB 4K4WA 2RRAA 1N5YB 2GO9A 4DLGA 3T6BA 3HZGA 3M2UA 2HFOA 1B0TA 2XMTA 5GAGU 3OFHA 1LQ9A 2BXJA 2CFXA 1RWNB 3FBBA 4J9UE 4E8UA 1S1UB 5L1JA 3UCUP 2VFSA 2MQQA 2NQPA 1HA1A 4J91A 3FRZA 2GIRA 2VQFJ 1HNZJ 1YDLA 2KT2A 2WB4A 3LP1B 1EB0A 2B7BB 4QR2A 2EPIA 4USUA 3H5YA 1S0NA 1VQNS 1KVJA 3FZ2A 4YS2A 2ZH5A 1RWPB 3LO3A 2V9WA 3RGIA 4LR9A 2CWXA 3SEOA 2A1BA 4FYWB 3T1YF 4M63A 1UJ5A 2LEPA 2MDAA 2W7AA 5ITHA 5A8WA 2VC1A 1L3TA 5DS7A 1RT1A 4TNOA 3FK4A 4J9OA 4AYBD 3OL7A 3TWZA 5DM6Q 1S6QB 4GRSA 1PBAA 4KPCA 3CCLS 3BO3A 1T9UA 1NAQA 3UVJB 2JVOA 3AQPA 4L75A 2UVVA 4C8LA 2VFUA 3KJNB 3KHGA 2FLLA 4JP8A 2CQPA 4DSKA 2DKOB 2YNHB 4JBCA 2JEFA 1HYSB 4C4WA 4M5LA 2DH8A 3MEGB 5IQ6A 4NXMJ 3CIMA 4CLWA 4NCBA 4F8RA 4K4VA 1WEXA 4DUTA 4IDKB 1XERA 1YZ6A 1HWKA 2N3OA 1SBRA 3S6EA 1NH8A 1Q7LB 4ANDA 3BJYA 1GX5A 4IO9Q 2QEXS 2GAHC 3LOUA 2BUNA 3AJDA 2E7WA 3ILLA 1UW9A 1RT5A 1VISA 3EICA 1HNZF 3DLKA 4DUYJ 3MMAB 4TY8A 3IWXA 3MAAA 1C4AA 1HW8A 1N88A 5E2QA 4UF4A 3TX8A 3TW0A 1JLGA 4CO4A 5HLFB 3MR5A 3DLBA 3TANA 4Y2CA 1VK8A 3M8PA 2QLXA 2MB0B 2FB0A 1QE1B 3O5TB 4YHHJ 1U1RA 1CG2A 4B9UA 1LOUA 3GIIA 4DX8H 1BQMA 1RT2A 4XDDA 4N41A 3HULA 3OQ2A 1S1VA 2F8HA 1RTIA 1WACA 3F44A 4B9LA 4ZVPB 1U2RA 1HNVB 1T0TV 3C15B 3DRYA 4EMDA 1T95A 5GADI 4ZCIA 4DCPB 1UZHA 4ZJOA 3HKZD 1FWPA 2EWHA 5IWAF 3DCAA 4IR1A 1JLFB 1Q8KA 1U02A 2KDOA 2YKNB 3N01A 2OPRB 2OELA 2OTLS 2BE2A 4XIUA 1FNMA 4FVMA 5FDLA 4KPYA 2DHHA 1F9FA 2D3ZA 2V94A 4KE5A 1TKZA 2X1GA 3JQJA 3W64A 3NNAA 2KFNA 2HHSA 1VYAA 1LNQA 4IFYA 3J80Y 6FD1A 4ED7A 4NA3A 2QA4G 3E01A 1LWXA 1T05A 4AFFA 3UWTA 2AYGA 4PR6A 3KNAA 2MZQA 4NRUA 3GE9A 4WP9A 2Q6BA 4P2FA 4S0MA 2RMLA 2L9NA 3GIMA 2F63A 1RWOB 3SFGA 3QT5A 2IPOB 2YNGB 3V81B 2UZAA 4MKYA 2IIHA 1HBUA 1Q95G 2KXNB 2FJBB 1PYTA 3G8QA 2DNLA 4A47A 1T9WA 3MMAA 4TY8B 1SIZA 3DFEA 3CNQP 2DGQA 5K8NA 4B3MJ 3MCMA 4V19J 3MM7B 2V8DA 1K1QA 4AL7A 2BVZA 4BS2A 3ET6B 1K1SA 2D74B 2XI2A 1FXRA 2WVDA 2CZ9A 4XAKA 2GMLA 4ZOSA 4C11B 4B3SJ 3PFOA 2POKA 3CPWR 1D9AA 1WOPA 4F2RA 4PWDB 3AXMA 3J7A1 1ZAVA 1URNA 1B70B 1C1BA 2C1EB 3CJ3A 3FQLA 3RG6A 4X2BA 2CRLA 1IKXB 3QT7A 3IGNA 4ZIVA 4FF3A 3M32B 2IM0A 2R8JA 2Y1LB 5T7LA 3SDEA 1YQHA 1Y00A 3PM9A 3PX6A 2HHQA 2GFFA 2EEYA 3CD0A 3DU6A 4H54A 1KQKA 2QX0A 3WZ0A 1O5JA 3M2RA 5ETQA 4IDKA 3ZZPA 5EDWA 3Q23A 1Y9OA 3C8YA 3CTRA 3A12A 2RQ4A 3CDBA 5ETSA 2DH7A 4PXDA 4IH5A 1NSPA 5EGYA 3KHHA 3PHEA 4RW8B 3FBCA 3H98A 3OTCA 1YTYA 2H1YA 3UDLA 2CPZA 2HBZB 3G82B 4RU9A 4BHQA 1DARA 2BRLA 5G0RA 3TOQA 4YN3B 3SDEB 1X9MA 3KLHA 1RHKB 2UU9J 2LQ5A 2YKMB 1NKBA 3MMBA 1U24A 3C14B 3CMAS 4NRTA 5H9FJ 5KFMA 2OD6A 2UUBJ 2JC1A 4G1IA 3G82A 3Q22A 2J6TA 1QAJA 4IYQA 2CJQA 1YJWS 2LA6A 2IFXA 2XULA 3HJFA 2BJ3A 2BDPA 5KG6A 4B9SA 2ZDOA 3NGKA 1U0HB 3RTVA 1WC3A 4I68A 4YB1P 4M8LA 1X5PA 3KXDA 1RLCL 5H9EK 2GQQA 2RB7A 2RJZA 4RW7B 4DR2J 1IKVB 2ZWOA 1ZM9A 4ZJLA 4XPCA 2UV8G 3UI3A 4FF2A 1RACB 4UOCA 1LW0B 4QZVB 4A8XA 3T41A 3A3PB 5T7LB 4CTAA 4X65F 4DR3F 3I31A 2IA6A 4B9NA 2CA9A 2UP1A 3UD3P 3UW1A 5L9NA 1X4BA 3BO4A 3SFUA 4HI2A 1N48A 1NDLA 1QUPA 4WIQA 1N32J 4WFBQ 2UU9F 1MG7A 5D0EA 4ZLJA 2ZM6F 2G0CA 4WIIA 1VC5A 4FXVA 4NXNF 4GO7X 4B3RF 2WOMB 3BV8A 5H9FK 1S9EA 1FRJA 1KHWA 2RILA 2P9EA 3AB4B 2M4MA 3A13A 2RF2B 3MM6B 4LFAJ 4AL6A 4WPAA 3RUBL 4E2FB 1D9FA 2J6SA 3HSGA 4IQXA 4DU7A 1Q16B 4NLQA 1QM9A 3VWSA 4CO3A 2NYHA 2W01A 2ZEJA 4HEA9 4TY9A 4G1QB 4F04B 2OPSA 3C46A 3HMJG 4DR2F 4LBHA 5A0YB 2HVDA 3KMSA 2FD2A 4M1KA 5HVGA 1H38A 4LFBF 3KG1A 1RTJB 3QIPB 2NXUA 4F3QA 3GQCA 4USJC 1GXLA 2CQCA 3PW7A 4FBTA 2XMUA 1Q7YT 1E6YA 3H59A 2IM2A 4F4KA 2A10A 2H4YB 4M5HA 2RNEA 1XNRF 1X0PA 3L9ZA 4OFZA 3D0HE 4LIWA 1HNXJ 4PG7A 3L09A 3TA1A 4F4WA 2D9OA 3MTJA 4IG0B 1KQFB 3HHEA 4CH1A 3HHDA 2ZH3A 2R2RA 3JSMB 3WQPA 3TJ9A 2GHWA 1VQ8S 3PW4A 1LK5A 2ZDPA 4FF4A 2H5IB 3MHYA 3MM9B 5LSLA 2W2OP 4G1QA 4ZPDA 1QSSA 3LA0A 1QSLA 2IJNA 2FLPA 4LFAF 4L3NA 4K4UA 2HHVA 1H7WA 1SQFA 2D7SA 5LL6d 2LU1A 4IG0A 5AXLA 3NGTA 3DLGA 4FYXB 5D0GA 1SV5A 5IC6B 4UOGA 4Y0FA 5BR8J 3DXSX 1JLQA 2Q3PA 2DGXA 1E6YB 2IM1A 1JLEA 1TL1A 1YZ7A 2CVEA 2C3OA 3I9ZA 3NLCA 4DR1F 2HQFA 2VQEF 1GQEA 1ZS6A 2XNQA 3N6LA 3PCOB 3AY0A 4MFBB 2W2PP 3CJTA 4NYPA 2Z0GA 4OI4A 2XCPA 1VC6A 5MAOA 1OQ6A 4WFZA 4ELVA 2JH3A 1Q5YA 4PAAA 1XNRJ 4PPZA 1UEUA 1X4CA 3TAQA 3MAAB 4F4AA 1RT1B 5F9LA 3HCXA 3J81j 5KG0A 4DV3J 2QFJA 2PGCA 3N28A 5E33A 4WK3A 3W60A 4DDFA 2XQCA 1EQMA 2GC8A 3GONA 3KFWX 3TYTA 1VBZA 5IM0A 3K2YA 3NGDA 3D1OA 2G9OA 3DRSB 4ECVA 1R3NA 4OZ1A 4JI3F 2Y8YA 3OVSA 3GFYA 1RSCA 4QCLA 1SCJB 5BYRA 3TR5A 4CLYA 4DOZA 2AYEA 2RSQA 4MKVA 4CH0S 4DZDA 1FFWB 5D4PA 3QZ7A 4JB8B 3PYDA 4DFJA 1JIHA 4ZK7M 5KFZA 2MSSA 1AUSL 2O01C 2VG5A 2ZH6A 4P7VA 2ILZA 5D0HA 3DN9A 1G4CA 2R8IA 3RR8A 3GIRA 5IT9U 2V6AA 2J9EA 3EZUA 4DR1J 3IM9A 2VQEJ 1WI8A 2ZBQA 3LGMA 1J27A 3G8TA 1WTBA 2YNIB 4YR0A 4OI1A 3KLHB 3AH6A 1FTCA 3DOKB 2G2ZA 1YJRA 3RBXA 1B64A 5DG8A 4KO0A 3R6GB 3C19A 4Z7YA 4OJGA 1OMSA 4OYZA 1K47A 3NCQA 3MFHA 3DYAA 3LP1A 2HNDB 3CIZA 1LK7A 4QR1A 4K4YA 5B7WA 1QVGR 3POTA 4ID8A 3MR6A 4WTOB 3CGIA 3E2EA 2KG1A 2PN6A 4P74A 4OJ1A 2BQRA 3H8YA 2WSEC 4KKOA 1L3UA 1RTDA 4LF5J 2ZJRQ 3B78A 4TKTA 4DV0J 3OHAA 1I94J 5KG5A 2AX1A 1QUVA 3PY8A 1F60B 1PJ7A 2V69A 1LFWA 5FD1A 1WSRA 4HDHA 3R5JB 3TRGA 4W98A 3JQMA 1C2PA 5F8HA 1ZA2B 4ZIWA 2K7JA 5KG7A 3Q24A 1UWBA 1FX4A 2OD4A 1WTFA 4ZVQB 4QJVA 4LF2A 3CSKA 4NL5A 1C0UA 3R7SB 4ZVEA 2ROPA 1KR4A 4FKXA 3OVAA 2E5HA 2HZAA 4LMZA 2IVYA 2ALYB 2CVIA 3BGLA 3THPA 3W2WA 3EPGA 5EWFA 4DUZF 5CCMA 3SV4A 1J5OA 2ATLA 2FVQA 1EETB 1SPBP 3H42A 4Y65A 5HN0A 1U1LA 1HHQA 3K0JA 1DHMA 1DTQA 1HNWF 5IT0A 1QJHA 5C42A 3BSAA 1PC4A 2XY7A 3GR0A 1S59A 1N5SA 2ZH2A 1K44A 1U47A 4FNIA 4LF8J 3T19A 1OSCA 1R6VA 2C2ZB 3Q8RB 1Q81T 1UEKA 1EKSA 3ISZA 3EXCX 4KAIA 2YXLA 5ETMA 4DSFA 3CJ4A 3NBPB 1ZAXA 2PC6A 4NI2A 5GADU 2AJ2A 1I94F 3IAM9 1JNZB 1SUQA 1XN9A 2CQDA 4EUVA 7FDRA 1RKJA 2XS5A 1WELA 2FHOB 2YKOA 2I1RA 4K5RA 4ZPBA 4F0MA 4IKAA 5D8HB 1EZZB 1RT7A 2AEMA 4P2MA 3D5MA 2MKKA 2ZH9A 2UXDF 2FZCB 1OYEA 3IBFB 4ITSA 2W2NP 3SBMA 5JVHQ 1YIJS 2MLYA 1JLFA 1IKWA 4UUXA 3CD5A 4I56A 1SKSA 5CYQA 1CULA 4DG1B 5D77A 5FIIA 3CJ5A 4ED8A 1VS3A 3PW2A 3Q8SB 2DRDA 4J9KA 3A8KA 1HD1A 1OY6A 2DH9A 1HPZB 1NZAA 1XWLA 1P1LA 1CJTA 3BSNA 4LF8F 2VPWB 1TU0B 5HP1A 2VH7A 2ZE2B 4RBTA 2F65A 3N5FA 4CO0A 4CIOA 3H25A 2ADBA 1ZH5A 1HNIB 2BJ1A 5HQ8A 4MIAA 1U25A 2KXHA 2G0JA 3LP2A 3ENWA 1FEHA 1FXDA 2HRYA 3KJVB 1FFGB 1RAAB 4C3KA 5GMKa 4A8WA 2LECA 4NZ6A 5IFMA 3LAMA 4H4OB 3HHNB 2IVFB 1IKWB 1P9QC 1HQEB 3NS6A 3ZZRA 2OMLA 3U7JA 1YG0A 1LKZA 3GTYX 3PV8A 1AYEA 3NRBA 4J9MA 1NBEB 2HLUA 3OV7A 4K2XA 4F26A 1RT3B 2JZ5A 1SL1A 2B3TB 3MPYA 2JX2A 4O23A 3K5NA 2ZJPQ 4RBVA 2G13A 4RNHA 1UAWA 2I38A 2C2KB 2QRRA 3KJQB 3MMCB 4LF7J 4MKBA 5HQLA 4OJHA 4HH1A 2GHVC 4N8OA 1P8GA 1HWUA 3GU0A 1FERA 3UDEA 1R8CA 3QLHA 4YR2A 3M8PB 4P9SA 5CYMB 1FF2A 3W2VB 1FRXA 1IN0A 2BMBA 2OPSB 3ULHA 1VQOS 4PYAA 3EDQB 3T1HJ 2DR6A 1UFLA 1U2FA 4URGA 1VBKA 4DR6F 4YDDB 3AXKA 4LR7A 1RABB 3V6DB 1N0UA 1PGZA 2KZMA 1S1XA 2O3DA 4CO5A 2VF3A 1XMOF 2FVSA 1YBAA 2BE9B 4LF6F 2E7VA 4B02A 2JEJA 2OEJA 2COLA 4USHA 1TUGB 4NMXA 2ZH8A 1FNXH 2CQ0A 4LF4J 1YJ9S 3NBPA 4QPXA 4ZVHA 3T3FA 2IJRA 2IAJA 1PYOB 3M7VA 5L8RC 2R4FA 4RUBA 3HSDA 4ZLPA 5J2NB 3PVXA 2VIHA 2HQDA 5CD4H 2YNFB 3K7RA 2MGZB 4Q43A 2CJBA 4ECUA 1PBUA 5KG4A 2BABA 4DV7J 5L38A 3J7AN 1AA1B 2CNKB 1T9VA 2XMJA 2IHR1 2RDDA 2BANB 2BJ8A 3NAHA 1VQMS 1D9DA 1OPZA 1Y10A 2QA1A 4AD6A 4JI5J 3HK2A 2B8PA 1TKXB 2VFTA 2VONA 1UPPA 1ZAWA 1WC1A 2FJAB 1RKIA 4ER8A 3QMQA 1VQ9S 3WIUA 2A18A 1DFDA 2DXFA 2H3EB 1C0UB 4EI2A 3VF0B 2QL9B 1UFWA 4ZLNA 3GCXP 2HGMA 3DLHA 2RQKA 4K2JA 3G8SA 3MPUB 4JV1A 2KFZA 1NDPA 4RW6A 4RW9A 1SC6A 2PMZD 1F6TA 3SCLE 3M8WA 4KO0B 2L41A 1VIOA 1RI7A 5HJXA 2MKCA 5IS2A 3CCUS 2M7SA 1D8YA 4Q0BA 1AFIA 3DDKA 3U1MA 2J0QD 1RTDB 1ACMB 1KWMA 4DQPA 5CAAA 2FTRA 3T9ZA 4BBYA 5I3UA 2K1RA 4ZPVR 2JVRA 1WHYA 1TFWA 2Z2LA 3N9UC 3VALA 1NM2A 2MQ8A 3LTOA 2CKWA 2XTJP 4NLUA 1M0SA 2O66A 1Y5NB 3FEXB 4DV7F 1M5HA 2VPZB 1XK8A 2DK2A 3LUYA 3GG0A 3UNGC 4K4XA 4LSLA 3GYXB 3KLIA 2XNRA 3JYTB 5A6PA 2PI4A 1VQKS 4QWEA 2M8HA 1HMVA 3NNCA 2P6TA 3F41A 1GMWD 1RWWB 5D6GA 4CCHA 4GKKJ 3M9MB 2KHCA 2R7VA 2RE1A 1Y3JA 3IP0A 1S4FA 4USTA 3MCSA 5K8MA 1H0HB 2OIHA 3SSSA 3KYLA 3P5TL 3MAQA 3ITHB 2HZCA 8RUCA 5DQIA 3NG8A 5KFPA 2GIQA 4WK1A 5KFBA 3EXYA 1S1WA 3R1HA 3H4DA 2N4DA 3IGVA 1PSDA 3B6BA 5L9XA 2E5GA 3I0RA 2AMCB 1NK0A 1N36J 2DYAA 4DV6J 4ECSA 1CJTB 1P27B 2B43A 1RISA 2DNHA 1IR1A 4CYUB 2QO3A 3HVWA 5THWA 2WBRA 2ERRA 4XDCA 3FFIB 2OPRA 4C48A 3W63A 2QC3A 1TTHB 4YY3F 2HEKA 1VQYA 2PO4A 1U48A 3SCIE 4K50A 2E1AA 2RQMA 1NK7A 4F02A 5KFGA 4ECRA 3OFGA 5C25B 4FXDA 5LOQA 1C1CA 2DY9A 4NLVA 3W7BA 4LRDA 3NEKA 4A8YA 4NLOA 3R7NB 1T05B 1K73T 1S1VB 2FHJD 2YWEA 2YWHA 3NGSA 5E3QA 1L5UA 1KQGB 4Q7AA 2B9EA 2VPYB 1UVKA 3CJRA 3W62A 3CC7S 1AUDA 2L3MA 3IR6B 3MD1A 1H2UX 4K59A 2AV5A 1FJGF 1F3FA 1RTJA 4I0WA 2YKNA 4X4UA 1UKUA 2I9SA 4PG4A 3W8PA 2HHPA 1WF0A 1TAUA 4OQJA 1RTHB 4C0HA 5HVHA 3R1LA 3W5YA 1RT5B 3IG1A 5HMZA 3M6XA 2GX8A 2OEMA 5KFUA 4CZCA 3MD3A 1AZSB 2J9CA 4YY3J 4RJVA 2VBZA 1UVJA 5HI7A 4P10A 2PA3A 4CQ1A 4DL6A 3NS7B 4I2QB 1F3VA 4CLZA 2L08A 5IZHA 2IRUA 3G6VA 1MU2A 2PI5A 1U2CA 4X84A 1ZM2A 4ZVTB 1PG5B 2F9JA 4WYLA 2FJWA 1RAHB 1KDNA 1J5EJ 2BX6A 4KGMA 4A46A 2DGUA 3TA0A 4C9DA 3KLFB 2PA8D 3OBIA 4G65A 4MK8A 4C98A 1M1GA 2M52A 3NGRA 4FNHA 2K1RB 4QBUA 2X3GA 2AJFE 2QJ3A 2YH0A 3GJTB 1Y11A 2OFHX 1F5BA 1H74A 2F4FA 2IVMA 1LXJA 3IBWA 3T5LA 4LVOP 4PCQA 2AD9A 1HBOA 3NAIA 3H5XA 1CSJA 1UVMA 2DB1A 4XK8C 3FC9A 4FP9A 1RXOB 2K2PA 3VQTA 3QGGA 3UPFA 1RA6A 2BJ7A 4CLLA 2MQPA 2A2CA 4PABA 4LSLB 3R2CJ 1XMBA 1U8SA 1UCNA 1K0VA 4CLPA 3UFCX 2B0GA 3IR7B 2KO1A 4KHPF 1S57A 1RBLA 2Q6CA 3MOZA 2GMJA 1FEEA 3VAIA 1S5ZA 1OSDA 2YQ3A 1CJVA 1U26A 4F4ZA 1KN6A 3A8IA 5K8OA 5J1NA 4K0KF 4ECZA 2RS8A 2HRTA 4ZVFA 2GQCA 4EZ6A 2RAQA 3EVWA 5AE2A 5EWEA 1BQNA 5G4DA 1CQMA 1L3KA 4IFVA 1YX2A 3GMGA 5FLXY 3R5GA 2V2VA 1S4EA 1I5OB 3D3BJ 1MMDA 3C2PA 1C0TA 2XMVA 5AE3A 3TUPA 2HNYB 3GR1A 1YJVA 3TZYA 1F9HA 3RB0A 4DS4A 2RDJA 5KFSA 4O44B 1D3WA 2BOAA 2EG2A 2CQIA 2WONA 1RB0A 1FKOA 2XSFA 2ZVIA 4KQZA 4PWWA 1XTZA 4OI3A 5T41A 3UQSA 1S9FA 4K4SA 2Z30B 3C6UB 2BBEA 1FESA 4MK7A 5KG1A 3PRVA 3OXGA 4DS5A 1R31A 2GJ2A 3B4MA 4DEZA 4ECXA 2HNYA 3Q89A 1HWLA 3IWNC 5MLCV 1WJ9A 1SH2A 3TP2A 3MFIA 2ZHBA 3TUJC 2DXDA 2LDYA 4U7CA 2BKNA 1N5TA 2YKMA 2C3PA 4ECWA 4ZS6A 3KLGB 3SSRA 3CCRS 4QU6A 3PTWA 4DL3A 4OL8A 2VJVA 2G2OA 1FVSA 4ZPAA 2F7VA 4KV8A 4NE9C 4C8KA 2WW4A 1WORA 4RW4B 4ED5A 2CNLB 2ZH1A 5IC4B 3CEDA 4ZCLA 4X64F 3VAKA 5KT5A 2KT5A 1U1MA 4FF1A 1EHWA 3SMZA 3ZZTA 3D68A 4F0KA 9RUBA 4DQRA 1CQNA 3I96A 1T9XA 3HVTA 4MYUA 3V6KA 1UVNA 4W90B 5IT4A 3CDAA 3DOKA 3LANA 1F9EB 3RW7A 2RS2A 4DV2J 1S99A 2HKEA 4PPDA 2DIVA 4OHVA 2BEFA 3IS9B 2EFGA 4CNYA 3E51A 2Y1JA 1VRTA 3J7Z5 1U1QA 2M8DB 4OIXA 2XLKA 3UN5A 4DXLA 1QAXA 3HSZA 4DR7F 3ZNUA 1YI2S 3VAGA 4BC9A 3G4SS 1FDNA 3BR9A 2AX0A 4BCAA 1JXLA 4C97A 3R7BB 2KYXA 4WBFA 2RU3A 4O3SA 2CZVC 3HF5A 1O8BA 4M5DB 2AGPA 1VQ6S 2VPXB 5E3RA 3DM2B 4CLUA 4I6YA 2MLZA 4OYMA 1RGVA 1RWMB 2NXEA 3W5ZA 2FY1A 2MHEA 5HBMA 2B51A 2WCXA 2QN6B 5IOLA 4ES3A 4DQSA 1FTRA 3QATA 4MK9A 3SCJE 4AXJA 2EW9A 1TK8A 2OFGX 5I3QA 4ETZA 4DSEA 3TJAA 2B4OA 2DEIA 1G3OA 3E3XA 4Q8FA 2QMWA 2AYMA 2YWGA 3ILIA 4CNZA 2QG9B 1CVJA 3NGUA 3QFHA 3QT6A 3DI6A 5E3AA 2ZNZA 2B7CB 4WCEQ 4WZMA 4UW2A 1JNRB 4ECQA 3KK3A 2HNZA 1Q86T 1TZ0A 2AEFA 5GAHI 1NK9A 1VHFA 2PFDA 2DHGA 2LXIA 3WC0A 4TU8A 1WKLA 2XY5A 2ADCA 2MJUA 3D3CJ 3OFEA 2F4VJ 3CDEA 2ZZMA 2C2OB 3IRWP 1N4LA 4NOHA 3QT8A 2DVIA 3UR0A 1U6ZA 2H54B 5HLFA 4QR0A 5DDRC 1YBTA 1S7IA 3M1VB 2BQ3A 3FDSA 5KFAA 2GGPB 3QIDA 3J81Y 3TI0A 2QFIA 4I1TA 3HT0A 3KHRA 2XHCA 3TUIC 2J76E 4K8RA 3KK1A 4A8OA 5BYSA 3V2UC 2JDJA 4ZVUB 4L3KA 3KUHA 3M30B 4I69A 4I64A 4J7CA 3GWCA 3NWGA 2J7KA 4JV5F 2CDQA 5B0GA 2BACA 2ZC4A 5CABA 2X51A 3HXMA 4ZN3A 5J2QB 2OPQA 3CDUA 3BQ0A 1B7YB 3IMQJ 4HH0A 2MQOA 3OTBA 1Q5VA 2ZOFA 4R8UA 3M8SA 3K5MA 3K58A 2M5YA 1H72C 2ZZNA 4ERDA 2KJVA 2GAGC 2D3UA 1NU4A 2ZKTA 4QU7A 3K5OA 1XBWA 3JSRA 1EETA 2UVUA 1KVIA 1IUJA 4HACA 1C4CA 3PYFA 3X3UA 5KFRA 4A4JA 4QQBA 1X4FA 3H20A 4KH0B 7AT1B 3GFHA 1WDDA 2EC2A 1WWHA 4RNOA 2AEJA 3POTB 2B5JA 4OYAA 4Y2KA 3CCQS 2B4UA 3R5CA 3ZZUA 5H9EJ 2Z2YB 4FPIA 4Y6IA 1N52B 1F5AA 3A8JA 4AXIA 5LXRA 2AIRB 2W8LA 1CJKB 4CLFA 2BOPA 2W9CB 5J2PA 4B3TJ 4AUKA 5FJ4A 1V6HA 1RE1B 4Q0BB 1GAOA 2KFYA 2R8HA 4KIAA 3M32A 4LUBA 4G3IA 4NA2A 5KOWA 3V6JA 3NOGA 2DNYA 1PYSB 4DMZA 2OPPA 2KT3A 2YNFA 1EP4A 3HD1A 3HSJA 3RAXA 3L3CA 4NLYA 1NPRA 5DJBA 5J2PB 5GAEU 2HAIA 1FNOA 1M90T 1SH0A 2EI5A 2LVWA 2ZHOA 2LYVA 3DYAB 2MEWA 4RUHA 4LRFA 4DL7A 4WZQA 4HYKA 4QIGA 4X66J 2BR0A 5GAEI 1Y3KA 4DR5J 2ZD1B 4JI1F 1DURA 4RX6A 5F0UA 3FSXA 3GZ7A 1SKUB 2P2CB 1N5YA 1PCAA 3K5LA 3RB6A 1JKHA 1NH7A 2MXYA 3H90A
chains in the Genus database with same CATH topology
2NXNA 2B9EA 3CJRA 3CJQA 2ZBPA 2NXCA 2ZBRA 2ZBQA 3EGVA 2NXEA 3CJSA 1UFKA 2NXJA 3A4TA 3AJDA 1SQGA 2YXLA 3CJTA 1SQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NXN A;  2B9E A;  3CJR A;  3CJQ A;  2ZBP A;  2NXC A;  2ZBR A;  2ZBQ A;  3EGV A;  2NXE A;  3CJS A;  1UFK A;  2NXJ A;  3A4T A;  3AJD A;  1SQG A;  2YXL A;  3CJT A;  1SQF A; 
#chains in the Genus database with same CATH topology
 4R8U B;  3EZ5 A;  3EPI A;  3TAP A;  2ZKU A;  5A2Q Y;  1QAY A;  3HFK A;  4ID5 A;  2I8E A;  2RIJ A;  4F50 A;  1T9Y A;  3BDE A;  1EAR A;  3A4T A;  2V4Q A;  2HW3 A;  3ZTQ A;  1BD6 A;  2JEI A;  1H6K X;  2E9R X;  4Q45 A;  3OL6 A;  1RQ0 A;  4IRK A;  2XB2 D;  1TMM A;  1WHW A;  4L76 A;  2HVE A;  2YPZ A;  2N3L A;  2CPD A;  4FZV A;  5K14 A;  2R7W A;  3T5K A;  2CPY A;  2RHQ B;  3CMQ A;  4IOA Q;  2DBB A;  4NEZ A;  5KFI A;  4ANE A;  1RT3 A;  2HUR A;  2RVJ A;  3MM7 A;  1VQL S;  3IRX A;  3M1V A;  4FN5 A;  4CP5 A;  2BQU A;  1X8D A;  4QPT A;  1XQI A;  4N56 A;  1REG X;  3GYG A;  3D28 A;  2NZ4 A;  3UD5 A;  3AJ1 A;  2W9B B;  3D1Q A;  1RHJ B;  1FE0 A;  4DR5 F;  1LW2 A;  2PMW A;  3PKY A;  4O3Q A;  3HHL B;  4JI0 F;  1TR0 A;  3QRP A;  4ILM A;  4TLR A;  1S0O A;  2LU2 A;  4DFM A;  2K8G A;  5ETN A;  1Y7P A;  2DIT A;  1VIX A;  3AFG A;  5LSO A;  3LF0 A;  2KXF A;  3K57 A;  2LQ8 A;  1A7G E;  3SV3 A;  3E01 B;  4EGL A;  3M6U A;  1MWZ A;  1WC5 A;  4WU2 A;  3KK3 B;  3PX0 A;  4FYD A;  1K8A T;  3BEG B;  2M2B A;  4JI6 F;  2C2D A;  2C3Y A;  2YX4 A;  4ILR A;  2ZIT A;  3W8G A;  3G96 A;  1LWF B;  4LRA A;  4AL5 A;  4N5S A;  4PQU A;  3SIP B;  1TKD A;  4NXM F;  3MED B;  3T5H A;  2YPY A;  4DFK A;  1D0E A;  3MUT P;  3GG1 A;  3IFE A;  1BHN A;  2OLW A;  3PYG A;  1WF2 A;  2C22 A;  3PAC A;  2VOO A;  2DR8 A;  1X9W A;  1H2V Z;  3AB2 B;  3KKF A;  5I4M A;  3S8S A;  2UUT A;  1N33 J;  3N6M A;  3PO5 A;  1TP7 A;  1WKJ A;  1RAF B;  3CJ2 A;  4R25 A;  4ZHR A;  1J2V A;  3FNN A;  5SUH A;  4X4R A;  5HBM B;  3IC1 A;  3OHB A;  3KG4 A;  3MR3 A;  2FGO A;  3QYY A;  2FVR A;  2WK4 A;  3FCH A;  3MUM P;  3KUE A;  1X5O A;  4JI0 J;  2VD3 A;  2N7C A;  2EC0 A;  4UTG A;  2NPF A;  1RK8 A;  4ZA1 A;  1QLN A;  2GV1 A;  1KSP A;  1C1C B;  2AZ3 A;  3DI6 B;  2HFZ A;  1KLN A;  1JLG B;  4OJ3 A;  2R7X A;  1U8W A;  3QSY B;  4JI6 J;  5IQQ A;  1WG4 A;  3MOJ B;  1DQ9 A;  2MHN A;  4DV1 F;  4OHZ A;  2W4D A;  3IS9 A;  5KFK A;  3T9N A;  3TAR A;  3MM5 A;  4HL9 A;  4EYH B;  3OXF A;  5KFQ A;  4DL5 A;  4JYA F;  4CYU A;  5H1S V;  3IR5 B;  4PG5 A;  3MR2 A;  2CPJ A;  1J5O B;  2ZD1 A;  4UT4 A;  2DY1 A;  3UD4 P;  4ZPC A;  2VFR A;  3H0P A;  4J5O A;  1N33 F;  2NXC A;  3MF5 A;  4FS1 A;  2J0S D;  4G1P A;  4QOT A;  1F0X A;  3Q8U A;  3UE2 A;  4I2P B;  2HQG A;  1KRP A;  3QZ8 A;  4OYB A;  2AW0 A;  4UZB A;  1G1X A;  2L48 A;  4X4P A;  4WFY A;  3OW2 R;  2G4B A;  1CPZ A;  1FDD A;  4MJK A;  3TAM A;  3QQC D;  3MMB B;  2R2T A;  1HI1 A;  1IM6 A;  2V9K A;  1X4G A;  2V4J B;  1O6X A;  4O4R A;  1UPM B;  4ZKA A;  2CNN B;  2C3U A;  1QTM A;  2UXB J;  3FMW A;  3GV5 B;  1AW0 A;  3EMT A;  2E1P A;  4KKO B;  5J1E B;  3CWJ A;  1RWK B;  1N6Q A;  4L73 A;  4ED4 A;  4DV1 J;  1X9S A;  2ALZ A;  4BDP A;  1MRO B;  1HFE L;  4EFA C;  3RBD A;  1PKU A;  1ZYQ A;  3QFW A;  4ES1 A;  1ELO A;  1U45 A;  4GVB A;  1W26 A;  2LKZ A;  1WI6 A;  3CCZ A;  5B0C A;  1OYD A;  2M0G B;  1CC7 A;  5M2R A;  2H5E A;  4ANC A;  3CF5 Q;  2R2U A;  2HMI B;  1PIE A;  2RKI A;  2DPJ A;  5DGA A;  4B3S F;  1OIA A;  2GO8 A;  3QSI A;  5F3Z A;  1WSV A;  5F8N A;  2HG4 A;  3AOC A;  3H2L A;  5F0W A;  1VDH A;  2EK1 A;  1UJ4 A;  1W25 A;  2N4C A;  2BYC A;  2R3V A;  2J0W A;  3C6T B;  2KTQ A;  4IFV B;  4MKA A;  1FFS B;  4QW9 A;  1YHQ S;  1RAO A;  1S1T A;  4F4Y A;  5ETK A;  4MAK A;  3ISN C;  3D2W A;  3EGW B;  2L9W A;  3VR1 A;  4UOH A;  4R5P B;  1N54 B;  2CQ4 A;  3BGF A;  1OQ3 A;  2HND A;  3OT9 A;  4RKU C;  3C6U A;  4XTT A;  3RRG A;  2DCU B;  5HMX A;  1TKX A;  4KGK A;  3EGZ A;  3GV8 B;  4OYI A;  1VLO A;  2CPX A;  3M2U B;  3M8Y A;  1URR A;  4LF1 A;  3W9H A;  2OGU A;  5IM0 B;  2OSQ A;  2LXU A;  4WFA Q;  3BKU A;  3PJX A;  1FKP A;  3TVK A;  1TV6 A;  4H4M A;  5F8J A;  1VLY A;  1HWI A;  4QYZ K;  3TAM B;  4C8O A;  4IG3 B;  4ZN1 A;  3VGS A;  1WC4 A;  2CNO B;  2VG5 B;  3QBC A;  4F3M A;  2KM8 B;  3RU0 A;  2M9K A;  2AP6 A;  1FE4 A;  1T02 A;  5FLX U;  3IM8 A;  3DRP B;  1FJ7 A;  1HHS A;  2QA4 S;  1MU2 B;  3A3O B;  1N56 A;  2EFQ A;  2FY8 A;  4Y00 A;  1SIW B;  4C0B A;  1IR2 A;  4JI4 J;  3OSP A;  1YK9 A;  3M30 A;  1CBK A;  4AT1 B;  3MUV P;  2QT7 A;  3KHL A;  4DX6 A;  3BF4 A;  1NJY A;  2W7P A;  3PEH A;  2DR9 A;  2QL5 B;  5JJB A;  2BE2 B;  3FZB A;  2Y0B B;  4OZN A;  1T8E A;  3NS5 A;  2DNM A;  1YSJ A;  4WE1 B;  3TA2 A;  2XM3 A;  1JXE A;  2HPU A;  5DG9 A;  4DX7 A;  4TXS A;  5HJY A;  1SQE A;  2V8H A;  4LR8 A;  2DNO A;  2W4P A;  3GFZ A;  4P2X A;  3PR5 B;  3H4B A;  1UFK A;  2KJW A;  1W7W A;  4M5I A;  4USI A;  3JSM A;  5D3G B;  5ADZ A;  1TVR B;  2ZHA A;  4DR3 J;  2IBO A;  4RU2 A;  3LW5 C;  1KFS A;  1SI9 A;  1D8Z A;  1H3D A;  2HNZ B;  3A8E A;  4DQQ A;  2V5H G;  2F1F A;  2PMH A;  2V34 A;  5EX0 A;  5KFN A;  4M5D A;  4O3P A;  1S77 D;  3C16 A;  3M2V B;  3F56 A;  5HAO A;  3F73 A;  1AXQ A;  4DPU A;  1N32 F;  1SV5 B;  2OO4 A;  2OHD A;  2CDR B;  4I7F A;  4QIF A;  3TX0 A;  1REV A;  5DDO C;  4EEY A;  1TVR A;  4NXN J;  2CAJ A;  5B0D A;  2GVZ B;  2F40 A;  2RU9 A;  4C2M A;  4LQ9 A;  4Q8E A;  1RP5 A;  3ICL A;  4GVL A;  1IWG A;  3J7Z T;  3R9L A;  2YVS A;  3FUY A;  2DRA A;  3PRB A;  3D54 A;  2XI3 A;  3DOL B;  1GEH A;  1HNV A;  2UXB F;  2B4P A;  1YRT A;  3NCP A;  4LIR A;  1N34 J;  2DGV A;  2P6S A;  2WVE A;  3W65 A;  3GSI A;  1WUU A;  2JFD A;  1AFJ A;  1HNI A;  4J37 A;  4C6A A;  2D9P A;  1IR0 A;  3M2V A;  1X31 C;  1GTH A;  5B09 A;  2YX1 A;  5C24 A;  2ZE2 A;  4Q2L A;  3KLE A;  1ZOT A;  2KVI A;  1JX4 A;  4NLG A;  3E8O A;  3IA0 A;  3W9I A;  5K14 B;  5EWG A;  1KON A;  2I2Y A;  4E98 A;  3KDN A;  4J9P A;  3ZFV A;  1N0V C;  1SUQ B;  4IQM A;  1T3N A;  1BWV A;  3ELH A;  3LP0 B;  5CD4 A;  3CCT A;  4USV A;  2XS2 A;  5A0Y A;  3HT3 A;  3HFZ B;  2CXE A;  3DGP B;  3HZE A;  4IH6 A;  1X7V A;  4WFX A;  1Q79 A;  2OSR A;  4TQR A;  2YWW A;  3LAL A;  3CCM S;  1HNX F;  4A8F A;  3DU5 A;  4U95 A;  3P96 A;  4CWB A;  4JI2 F;  4X62 J;  2DGO A;  3L7U A;  3O3L A;  1LWC B;  1R8P A;  4KH1 B;  4ZJQ A;  1ZTT A;  3K8W A;  2F8M A;  2QV6 A;  3JYT A;  2ZBC A;  4DR7 J;  9ATC B;  3K59 A;  3QRQ A;  2JNJ A;  3ILJ A;  4Q2M A;  5K20 B;  1TUW A;  4P7T A;  1JLA B;  4OMF G;  4Y2I A;  1VRQ C;  4N77 A;  5U47 A;  1D09 B;  1HYS A;  3ZTS A;  4PXB A;  2W7O A;  4KGV B;  3EYZ A;  3EVM A;  4HHJ A;  2GHP A;  5LSR A;  2QLF B;  1C0T B;  1VC0 A;  1CC8 A;  3ETM A;  3BKT A;  2E9T A;  1XC9 A;  3C14 A;  3N79 A;  1NDK A;  5DG7 A;  1Q82 T;  3GIK A;  3ILO A;  1TL3 A;  2CQ2 A;  4CI0 B;  4TU9 A;  1PJ5 A;  4F67 A;  2LEA A;  3TZZ A;  1FT8 A;  4RW9 B;  5KT2 A;  5AT1 B;  2FIU A;  2HGL A;  2X1F A;  4YP3 A;  2B56 A;  3OL8 A;  4WP8 A;  1M5K C;  4KRW A;  2CQ1 A;  2PEB A;  3CJK A;  1FRM A;  5E3C A;  3DC2 A;  4DV3 F;  1U1O A;  3BBC A;  5IV4 A;  4ZP6 A;  2DPI A;  1RT4 A;  1S9G B;  4R5P A;  2NZC A;  4JI2 J;  4X62 F;  2LLZ A;  3MXH P;  3AQO A;  1UWB B;  3LPE A;  2AJ1 A;  2JLG A;  1T03 B;  2XMW A;  3QGP A;  2PT0 A;  3VAF A;  2LP4 A;  5GVQ A;  4PUO B;  2YQ1 A;  4ZP7 A;  3U02 A;  2FHM A;  2J9D E;  3MEC B;  1ZTW A;  2PEH A;  1HAR A;  3VGU A;  1H98 A;  4B3O A;  4PRF A;  2B8Q A;  2RKI B;  3FQK A;  1R6Y A;  1P9Y A;  1C1B B;  1VQS A;  3P45 B;  1SKR A;  2OPQ B;  4UZC A;  2FGC A;  5F8I A;  2OH2 A;  1XR7 A;  1VGY A;  3QJP A;  1BUX A;  1FVQ A;  3RB3 A;  2ASL A;  2J9D A;  1JJC B;  5M2U A;  4RUC A;  3JSY A;  1RHR B;  2V0N A;  2ABY A;  4BC7 A;  1S1X B;  1ZA1 B;  3TZX A;  2DNG A;  2HQC A;  3JXO A;  4MYT A;  3W1Y C;  5KFH A;  1S97 A;  3AHP A;  1ZM4 A;  5D78 A;  2YH1 A;  3CME S;  5EN1 A;  5HAT A;  5GAH U;  2FC9 A;  2Z58 B;  2KG0 A;  3KTQ A;  1LXN A;  2QYG A;  3G6X A;  2GVD B;  2C2R A;  1XR5 A;  1SC3 B;  3OR1 B;  3WHI A;  5F8G A;  3N0V A;  3TQE A;  5J2N A;  1S6O A;  4TLQ A;  5ETL A;  4LF5 F;  4PXC A;  1IM4 A;  7FD1 A;  4DV0 F;  3GJS B;  2MTL A;  3RJM B;  2E5J A;  1YKW A;  4A8Q A;  1KEK A;  4U6P A;  1OS5 A;  2VDI A;  4OZJ A;  2Y3Y A;  1BGX T;  1B4S A;  2ACM A;  1FD2 A;  2KH9 A;  1X4A A;  2JWN A;  2W8K A;  2K3I A;  2BM0 A;  4ELT A;  2BRK A;  2XYH B;  3MM5 B;  5C5J A;  1YRX A;  3VGV A;  5AJ3 F;  3CD7 A;  4FXW A;  4HHH A;  1RA7 A;  2OTJ S;  1FWL A;  2G0I A;  3P6Y C;  1HL6 A;  5DET A;  4DUZ J;  3SZ2 A;  3V4I A;  1R0A B;  2O67 A;  3CC2 S;  4ZVO B;  4KR0 B;  4V1A k;  4DR4 F;  3SQG A;  3VVU A;  3KJV A;  1VI7 A;  4MTP A;  2ZOM A;  3EGN A;  2VZ9 A;  2R2S A;  1FDB A;  3O2I A;  4GKJ F;  2NYI A;  1JLE B;  1TL1 B;  1RAG B;  2MKH A;  3MMC A;  4RUA A;  5DM7 Q;  1XNQ F;  4NLT A;  4B08 A;  1VBX A;  2XMM A;  3RW6 A;  3ENA A;  3KLE B;  2MLX A;  4DLE A;  3OTD A;  2JLE A;  5A8K A;  3BPS P;  5B0A A;  4ZDN A;  4OYX A;  5HO4 A;  1EIY B;  1KTV A;  3CJ8 A;  2DEJ A;  4OZ3 A;  3I9V 9;  2IDL A;  4M5N A;  4MT1 A;  5CYQ B;  3BKF A;  3EZO A;  3PG9 A;  3MPV A;  3QPI A;  4DG1 A;  4EWT A;  6AT1 B;  4O3O A;  1R0A A;  4NX9 A;  3NMR A;  8AT1 B;  2WSC C;  2JHE A;  2VB6 A;  4ENO A;  2NRE A;  3ADA C;  2DJW A;  3DLE A;  1DY3 A;  1NHU A;  2GVD A;  4QIE A;  2WVC A;  2C2E A;  3PYE A;  3C15 A;  2QYC A;  3UNY A;  1YJT A;  5AJ3 J;  4CT9 A;  3AD8 C;  4ED1 A;  2Q66 A;  3M6W A;  1RYR A;  1NPP A;  2J6U A;  2V50 A;  2MKJ A;  1A9N B;  2AJQ A;  2ASY A;  2RF2 A;  2VUG A;  3HVT B;  3MM6 A;  3O6Q A;  2APO A;  1CJU A;  3CCE S;  3CCW A;  4LJM A;  4FS2 A;  1KLM B;  4X4V A;  1S9E B;  2O5D A;  4DN0 A;  1VQ5 S;  3D0G E;  4ELU A;  2CZ4 A;  2L9D A;  5HRO B;  3D4J A;  1GMW A;  2KZZ A;  1SJ4 P;  2NSB A;  3HPO A;  3ITH A;  2CJK A;  3QNW B;  1FRI A;  2DHA A;  3H5S A;  4DPX A;  2EFV A;  5F9N A;  2RQC A;  1M1K T;  3RAQ A;  3O44 A;  3DHW C;  2RDI A;  4WE1 A;  2HIY A;  1FKP B;  4O0I A;  5L1I A;  5ETP A;  1TL7 A;  2D69 A;  2DO4 A;  1RCX B;  4X4S A;  5E41 A;  3T6J A;  3OJU A;  4M95 A;  4ED2 A;  4EZ9 A;  5DRK A;  1FRH A;  3KLI B;  1IKV A;  1DAX A;  1DBD A;  2KKH A;  1SC1 B;  4OX9 F;  4K4T A;  2BJD A;  2IYG A;  3D6H B;  4H4K C;  2YKA A;  3P49 B;  3DLL Q;  1UEV A;  2E5L J;  1RT4 B;  1RHQ B;  1S9G A;  3MEE B;  4F7V A;  4OHX A;  1Q8I A;  1RZM A;  3I5B A;  4DI6 A;  4NI2 B;  2N82 B;  2XG8 A;  3I56 S;  2OAU A;  4O44 A;  4CRJ A;  1WF1 A;  4PG6 A;  2FZG B;  4L72 B;  5CQG A;  6FDR A;  4HI1 A;  4DL4 A;  3HVR A;  1RUS A;  1B0P A;  1S1T B;  4DJB A;  1U1K A;  2ZNY A;  1KTQ A;  3Q2S C;  3KUG A;  1HIY A;  3ZC4 A;  3JTO A;  1ARO P;  3L7O A;  3BZQ A;  4EK2 A;  1SL0 A;  4PUO A;  1MWQ A;  5ETR A;  4DSI A;  3UCG A;  1V5V A;  4QYZ J;  3M8R A;  2FDN A;  1MML A;  2GCF A;  5L39 A;  3W2W B;  3T1H F;  4NWB A;  4QYR A;  1I3O B;  1RYS A;  4K7Q A;  3JTN A;  4HKQ A;  1VHI A;  2H9Z A;  4DR6 J;  4YUD A;  1MRO A;  3VV2 B;  4OHW A;  1A0O B;  1MN9 A;  2R8K A;  1FO1 A;  2CPF A;  3LPY A;  3MEE A;  3MR7 A;  3JQK A;  4DUY F;  4CLT A;  2PII A;  1SJ3 P;  5J2M B;  2JJ4 D;  2R7Q A;  2XMA A;  2D3O R;  2UVR A;  2R7R A;  3V6H A;  4OX9 J;  1XEZ A;  2CIM A;  5A76 A;  4WFN Q;  1N6Q B;  4LF6 J;  4NYZ A;  1Q8B A;  3H2U B;  2E5L F;  4PKD B;  4YHH F;  3V6D A;  1UWA A;  4LF4 F;  1S48 A;  4P73 A;  2GIF A;  4L6V 3;  1NSA A;  2NS1 B;  4KB7 A;  2W9A A;  3MM8 B;  1SKW A;  3QJL A;  2FPH X;  1GK8 A;  3FMB A;  4LF9 J;  1GFW B;  3FBE A;  1S12 A;  3KLF A;  1XIQ A;  2G1H A;  3GSD A;  2GA7 A;  1JLA A;  4DV4 J;  4W92 B;  2ASD A;  2CQB A;  2J0X A;  3RRH A;  4E0D A;  5DLF A;  2CQG A;  3J81 U;  3Q2T C;  2JRS A;  5KFF A;  5IWA J;  1X4D A;  1E6V A;  2XLI A;  1LWE B;  4DX5 A;  2B4V A;  1BC6 A;  2MQM A;  2SXL A;  5KTQ A;  2BW2 A;  4XO0 A;  1ULR A;  3M8Z A;  1Y5L B;  3K17 A;  2QLW A;  3DGP A;  2YY3 A;  3GFX A;  3GPA A;  4DPO A;  2ZJQ Q;  1I6J A;  1HQU B;  2N7Y A;  2Z8Q A;  1BE4 A;  2XZT B;  4FYV B;  4KT0 C;  2RRN A;  4PWU A;  1Q1K A;  3VHQ A;  1B3T A;  3D66 A;  1KC8 T;  2QTW A;  3Q86 A;  4ZP9 A;  4N47 A;  4WKR A;  3PR4 A;  1KLM A;  2KL8 A;  3C16 B;  4DN9 A;  1K9M T;  1WHV A;  3QO9 B;  1U09 A;  4LF9 F;  4QIV A;  4C8Z A;  2BV3 A;  2OUG A;  3I82 A;  3G86 A;  1SJR A;  1TKZ B;  4NCG B;  4B3M F;  3MWB A;  2IM3 A;  3FRY A;  2KRB A;  4DV4 F;  3D9B A;  3DLG B;  3L95 X;  1ZPV A;  5LMN J;  3D6F B;  2CWK A;  4CT8 A;  5HQM A;  3VAJ A;  2NCK L;  2VU5 A;  1F2G A;  1JLB B;  1RAJ A;  2HBR B;  2DIU A;  3PXG a;  4B9M A;  3NNH A;  1PJ6 A;  4KFB B;  1Q8L A;  4ED0 A;  2NUH A;  2HHU A;  1FRL A;  5KOX A;  2VJU A;  1H7X A;  5JXS A;  5KFT A;  3N4W A;  2VIC A;  2Q1L A;  2OJ3 A;  5CYJ A;  1UA1 A;  1RAI B;  5ETV A;  2HFV A;  1ZZN A;  1TEL A;  4DSL A;  1HD0 A;  1U7L A;  3BYR A;  4CM2 A;  1DQA A;  1KOO A;  3SQO P;  3AOA A;  2W2M P;  3QIP A;  4OYP A;  4GMK A;  3MCN A;  2AGO A;  1CUL B;  2CPE A;  1S72 S;  4NAS A;  3V4I B;  1P1T A;  2EFN A;  4IO1 A;  4USW A;  1N36 F;  1GT8 A;  4DV6 F;  2ZBP A;  3THT A;  1HQU A;  2CJA A;  3NOC A;  3QGI A;  1HKA A;  1Z2Z A;  2CQH A;  3BH6 B;  5KFO A;  5A8R A;  1LEO A;  2WVF A;  2XSJ B;  4USK A;  2MJN A;  1RT6 A;  5CH7 B;  3CCV S;  1NJW A;  1KFD A;  2HWH A;  5LMN F;  4B3R J;  2MYF A;  1U49 A;  3N5B A;  3FEZ A;  5HMY A;  3BQ2 A;  2A6O A;  3CJS A;  1KOH A;  1IBM F;  1RT7 B;  3I0R B;  1QSY A;  4RNM A;  4ZVR B;  2Y1R I;  1NJI T;  3IBC B;  1M5P C;  1BQM B;  4FBU A;  2E1M C;  2HHW A;  4OZ0 A;  5EHH A;  2UUB F;  2CJ9 A;  3HHL A;  3AA9 A;  3BN7 A;  2ZWP A;  4ID5 B;  2F5G A;  2OEK A;  3BRE A;  4YQW A;  2BKO A;  1TV6 B;  4H4M B;  2LQB A;  3F0N A;  3OLB A;  3ETO A;  2ROG A;  3CCS S;  2JEG A;  2HQI A;  2F3J A;  4I6W A;  2XBP A;  2ZOG A;  1LW0 A;  1R8A A;  1DTQ B;  1K0T A;  3LAK A;  4ZLL A;  1H73 A;  4B9V A;  5KFW A;  2DR7 A;  1TFY A;  5BXI A;  1X4H A;  3PW5 A;  4N8N A;  1YJN S;  4DF8 A;  4D3H A;  2DT9 A;  2ZBR A;  5HSP A;  2MQL A;  1VQ4 S;  1TL4 A;  2XY6 A;  3OUY A;  1JLC A;  2MZS A;  4Z7C A;  2VHG A;  4X65 J;  4OI6 A;  1WOO A;  5KT6 A;  3MUR P;  1RJJ A;  1IWA A;  3GIJ A;  3NMA A;  1S1U A;  5C7P A;  4LVN P;  1IBM J;  1SJ1 A;  1T9T A;  5I3U B;  1EP4 B;  1YJU A;  5HL7 Q;  5CXT A;  3NY0 A;  2DGT A;  2C3M A;  3JAM Y;  2ZM6 J;  4ICL B;  1QY7 A;  4LBI A;  1TL3 B;  5A8W B;  3J80 U;  2VBX A;  2W24 A;  1NJZ A;  1RAD B;  3B4D A;  5LM7 E;  2KB2 A;  2ZC3 A;  4HVZ A;  2V67 A;  4G6V B;  3LGH A;  4TYA A;  1V3S A;  4RW8 A;  5D4L A;  2MPU A;  1W2B R;  1ZZF A;  4GVB B;  1AB8 A;  4DFP A;  2UUW A;  3W66 A;  4C7Q A;  1NCL A;  1V9O A;  5KT4 A;  1JK9 B;  3BO2 A;  4J9V A;  4GC6 A;  2IRY A;  4X4N A;  4NZ7 A;  3DRX A;  4FVC A;  5RUB A;  3OUY B;  2PE8 A;  1RWV B;  1IKY B;  2ILY A;  2P5V A;  5B08 A;  4RWX A;  2F8E X;  2WB1 D;  2LA4 A;  4LRE A;  4URS A;  5C2C A;  2EKN A;  3M05 A;  4UY8 T;  1KQS R;  2JOQ A;  3R2D J;  2QLJ B;  4KHP J;  3DOM A;  4LFB J;  2FZK B;  1RDR A;  3U1N A;  4KSE B;  5IXU A;  3PZP A;  5C2G A;  2X1A A;  5DDQ C;  1HBO B;  2AT1 B;  1IKX A;  1NO8 A;  3M9O B;  2VG7 B;  3P5B P;  4AE5 A;  4PYD A;  2AWZ A;  2EBE A;  4DBQ A;  2R8G A;  1Q78 A;  2E66 A;  4ETX A;  1N8R T;  4I2P A;  5B0F A;  2PFF B;  2I5J A;  2ZH4 A;  4M5K A;  4F2S A;  1MMN A;  2QSF A;  2VOP A;  1SC4 B;  4QWB A;  4C3L A;  5LXY A;  2B5J B;  4HLB A;  2Z2Z A;  2MMY A;  5CZV A;  3TZW A;  4F25 A;  8ATC B;  5KFJ A;  3M2R B;  1CJU B;  1PAU B;  4EBE A;  4DSJ A;  2V2Q A;  3HM9 A;  2Y1I A;  2GGP A;  3RAM A;  2IRX A;  3KOA A;  2VV5 A;  3DDI A;  1BQX A;  3VGT A;  2RD5 C;  1KKH A;  2XHW A;  2G2Y A;  1JJH A;  1HBN B;  5EUH A;  5BR8 F;  2HRU A;  5A8R B;  4LSZ B;  2HZV A;  2QMX A;  1BLU A;  2B6A A;  2LDI A;  3JTP A;  3THV A;  2MY7 A;  2LEB A;  2DNQ A;  2YKP A;  1UW4 A;  1O51 A;  3DHX A;  3GYN A;  3LP0 A;  3ONQ A;  3R5A A;  3QLH B;  4NA1 A;  3CVK A;  5M2P A;  4J9R A;  5J2Q A;  1G6B A;  3TQ1 A;  3LP2 B;  5CZX A;  1EKR A;  4PQU B;  2KVQ E;  3CO0 P;  4I7F B;  3AD7 C;  1UZD A;  5HAN A;  1VCT A;  3FJ2 A;  1TAQ A;  3UN2 A;  2FJD B;  5E7O B;  2RT3 A;  2J5A A;  1M5V C;  1TKT B;  3AOB A;  1S0M A;  3VTI A;  3EUN A;  3TNV A;  1JLQ B;  2AJ0 A;  1BXN A;  3P8B B;  5GAG I;  1S0V A;  3IG1 B;  3TO8 A;  1CS4 B;  3DOL A;  1GTE A;  4X64 J;  4V19 X;  4ZHR B;  4I67 A;  1NUE A;  1RTH A;  4ZVG A;  2E5I A;  2CJX B;  2H48 B;  1KBR A;  3R27 A;  4OLP A;  2X7I A;  3SCK E;  4QWD A;  4IR9 A;  1R89 A;  4O3R A;  3UR3 C;  1FKA F;  1X4E A;  3HLU A;  3QGH A;  4JI3 J;  1SXL A;  2KM8 C;  2Y8W A;  3WIV A;  1GX6 A;  4UQG A;  3PNI A;  3VAH A;  1CS4 A;  4ZIT A;  3G2X A;  4M5J A;  3M8Q B;  1LWF A;  2VDH A;  1TKT A;  5B0B A;  1RHU B;  1RTI B;  3U1L A;  3EJM A;  4LQ3 A;  1KHV A;  4ED3 A;  2NPI A;  1IBK F;  3FCW A;  4IH7 A;  5FDL B;  5KT3 A;  1B0V A;  2EKY A;  3M6V A;  5E3P A;  4IRD A;  1NB7 A;  3BGR A;  2C2N A;  3MPD A;  2B6A B;  2I0X A;  1NEE A;  4HR2 A;  2FJE B;  5KFL A;  2HHH F;  2IA0 A;  4KBI A;  1BMQ B;  1VRT B;  1LW2 B;  3Q8Q B;  3MI7 X;  1FDA A;  1BWE A;  4KHR A;  4RR5 A;  3CO9 A;  3DLK B;  3FVY A;  1NSK L;  2JSX A;  3DOM B;  1IJF B;  2IMW P;  3PJ9 A;  3W5X A;  4X4Q A;  3SYZ A;  5F3T A;  3DM2 A;  1F2H A;  3ENQ A;  1WEY A;  4ZP8 A;  2DHX A;  3BN4 A;  4UOF A;  2C2M B;  3SI8 A;  4IOB A;  2FYX A;  3GJQ B;  3PDN A;  4ZVS B;  1U0H A;  4DHV A;  1CLF A;  4TYB A;  1F5C A;  1NZ8 A;  2F9D A;  5L46 A;  1HLW A;  4USM A;  4F4X A;  2XYP B;  2HIQ A;  3QAU A;  2XZW A;  5A6W A;  4KV8 B;  4C0O C;  4GC7 A;  1G7C B;  1TUV A;  2EFO A;  1JQG A;  3EE3 A;  3PW0 A;  3B54 A;  3TEH B;  4M94 A;  3UVJ A;  3HO1 A;  1JB0 C;  4CH7 A;  4CTA B;  2VG7 A;  1SJF A;  1IBK J;  3HD2 A;  5F8L A;  3D0I E;  1Z1Z A;  4NPO A;  3HDS A;  1T11 A;  2K3K A;  3SXL A;  4CM0 A;  2UXC F;  2F4V F;  3MPW A;  1PC5 A;  4HT5 A;  3KG0 A;  1NDC A;  2HHH J;  4DPY A;  4RW6 B;  2AYB A;  2E44 A;  2MZT A;  3QWU A;  2XO6 A;  2CPH A;  5BJR A;  3IN5 A;  5DQH A;  2FJV A;  1HNW J;  1U1N A;  3ZZY A;  1XMQ J;  1WG1 A;  1MSW D;  5D4N A;  3BQ1 A;  4ATN A;  1JJ2 R;  2YTC A;  2Z56 B;  4Q44 A;  1FJE B;  5LJ5 Y;  3KLV A;  1RBO B;  3KJF B;  4ALZ A;  1NKE A;  5HMW A;  5F8M A;  2J7U A;  2HBQ B;  4U67 Q;  1JWW A;  4P72 A;  2Y0S D;  2AU0 A;  1U4B A;  2FJX A;  1NK4 A;  1GH8 A;  2FHK A;  3ENV A;  2VA2 A;  2RRB A;  2QIF A;  5L1L A;  4B9T A;  4P6Q A;  4EU0 A;  4QWA A;  1D1U A;  1CJK A;  1OO0 B;  4WU3 A;  5SZT A;  2WTF A;  4EYI B;  4OV1 A;  3ZTP A;  4KYZ A;  4Y2M A;  3JAM U;  1WC6 A;  2DGW A;  2QA2 A;  2RUS A;  3JB9 k;  1QAI A;  2UXD J;  2UXC J;  3BM7 A;  3P3D A;  1UL3 A;  2FVC A;  1S6U A;  1Z2L A;  2PDA A;  5K8P A;  4UQT A;  1VK3 A;  1DRZ A;  2BE7 D;  2A3J A;  4OYW A;  5KFV A;  1T3O A;  4HTI A;  2FLN A;  3BBF A;  4OYO A;  3NL0 A;  4URQ U;  2CPI A;  3RRK A;  4YDX A;  1MLA A;  1P6T A;  4U7U K;  1WNE A;  3H7H B;  1XMQ F;  1M5S A;  2P9C A;  2R7O A;  3PIP Q;  1FI4 A;  5KFC A;  4OI2 A;  4JI8 J;  3CUL A;  2NSC A;  1HBU B;  2C42 A;  2IAJ B;  3BGR B;  3GP9 A;  3FEY B;  4GO5 X;  2VOD A;  2R42 A;  2R7U A;  2U2F A;  4LT6 A;  5ETO A;  2A0F B;  1CJV B;  2RUG A;  2D3O 1;  1UVL A;  2JFK A;  4ILL A;  2FLO A;  3EGV A;  3LH2 S;  3PEJ A;  4LSN B;  3ZTO A;  3I5C A;  1EQ0 A;  3AA8 A;  4UUW A;  4ECY A;  4U7U D;  3KK1 B;  2CG4 A;  4Z37 A;  3OR2 A;  1RLD A;  4C8Y A;  3FSI A;  1RU1 A;  5CA5 A;  4RNN A;  3ET6 A;  1ZM3 A;  1RT6 B;  1AZS A;  2CQ3 A;  3VVT A;  3BYP A;  4DPT A;  3OVB A;  2IBK A;  5IT9 Y;  1V3Z A;  2H65 B;  3HI9 A;  4X66 F;  2HS3 A;  2J8S A;  4JI1 J;  2HFN A;  4MIB A;  3UN3 A;  1A6L A;  3K89 A;  5AE1 A;  4A48 A;  5I42 A;  4QIW D;  2VBW A;  4LF7 F;  5K9F A;  2XEX A;  2GVZ A;  2EFP A;  2PSZ A;  2QE5 A;  2B9W A;  3FBF A;  4DQI A;  4K4Z A;  3AT1 B;  3MAH A;  4JI8 F;  1TK5 A;  2DIS A;  3DMJ B;  4IFY B;  2HLT A;  5C24 B;  1TMJ A;  3M8Q A;  3MZI A;  3RZA A;  3FKB A;  1FXL A;  1CEZ A;  3AJ2 A;  4JOU A;  1RWX B;  2QL7 B;  3PRD A;  4DL2 A;  3ZZO A;  2YWK A;  2IC3 B;  4LFC F;  2HS4 A;  2DNP A;  2ZH7 A;  1XMO J;  1NSQ A;  3X1L B;  1IBC B;  2YWF A;  3I0S A;  3QRR A;  1MWY A;  2MZR A;  2V8G A;  1EJ7 L;  4O3N A;  2GJF A;  2MY8 A;  4JUZ A;  3RYL A;  4DPW A;  4EBD A;  1O0P A;  4NCG A;  1NKC A;  3WBZ A;  2FQQ B;  4OX6 A;  1XJW B;  2ATC B;  4EO8 A;  3ZXW A;  4OX7 A;  1UTA A;  2XGQ A;  3KK2 A;  1VR6 A;  2E1C A;  2OI2 A;  1VJW A;  3R5B A;  4XPE A;  1QD1 A;  1HPZ A;  4P71 A;  1SVD A;  4A8K A;  3CC4 S;  2JLF A;  5DZ6 A;  4O4G A;  1Q0N A;  4ZCM A;  1ICE B;  2EXU A;  1HBM A;  2IDE A;  1EX8 A;  2OP5 A;  2Q43 A;  2V63 A;  1R8B A;  2WRM A;  3L4B C;  2O1P A;  4W4M A;  4MIW A;  2RHS B;  2DNR A;  1QE1 A;  5F41 A;  3W61 A;  1JMT A;  4JI5 F;  1NHV A;  2W9B A;  5GME A;  2E7X A;  1HBN A;  3TJ8 A;  3OFF A;  2HK3 A;  3G87 A;  2HYI B;  4DL0 C;  4C8M A;  2BM1 A;  2HAF A;  1N5Q A;  2ZFH A;  3A3N B;  2VG6 A;  1FWK A;  1ZET A;  1RTZ A;  2VKZ G;  1VQ7 S;  4LFC J;  2CJY B;  2OKQ A;  5LMU F;  3ZO7 A;  2UV8 A;  3H5U A;  4Z2X A;  5E0O A;  1WKK A;  1R27 B;  1RAE B;  3I32 A;  1U0S A;  3BS9 A;  1NND A;  1VOM A;  2NLW A;  4RW4 A;  4JV0 A;  3WX4 A;  3OLA A;  3PO4 A;  2WON B;  3PJW A;  4OX8 A;  2YNH A;  2X1B A;  4PQA A;  4J9N A;  1LFP A;  1APS A;  2OMO A;  4OZ5 A;  1WG5 A;  2GNK A;  3GCW P;  4R0J A;  1NLK L;  2W25 A;  3FGV A;  5KFX A;  3G71 S;  3GV7 B;  2OPP B;  3C6T A;  5C42 B;  3CDW A;  3D6M B;  1R8H A;  1DTT A;  4WWS A;  4Y28 C;  3MEC A;  4HT7 A;  1NXI A;  4NML A;  4J9L A;  5J1P A;  1YGY A;  4TVA B;  5G0R B;  3L7P A;  3KNG A;  3LGN A;  5I3P A;  5K5M A;  3VQS A;  3LWL A;  4P75 A;  2HMI A;  3DRR A;  1BY9 A;  5J2M A;  4L74 A;  1IXK A;  3OTO F;  1T03 A;  4P52 A;  3GIL A;  3JS9 A;  4ECT A;  4Y34 A;  4GKK F;  1JLC B;  2DO0 A;  2BA9 A;  4JYA J;  1NHK L;  2J7W A;  2R9L A;  2W1B A;  3I55 S;  1JJ4 A;  3CW2 C;  5LMU J;  1SB6 A;  3D6T B;  2Z57 B;  2V8V A;  3MM8 A;  3PHT A;  2D41 A;  4FYY B;  4HAC B;  2DRB A;  2WSF C;  1GNK A;  1Q53 A;  1PO6 A;  4YFU A;  2JC0 A;  2YNI A;  1X60 A;  4LRB A;  3I4H X;  5DGB A;  3N6N A;  4BLG A;  2MGZ A;  3FSY A;  4KY3 A;  4NLS A;  4CDI A;  2K06 A;  3BGU A;  2QSW A;  5JUM A;  1KNZ A;  2CAD A;  4QW8 A;  4YB5 A;  2WVB A;  4B17 A;  2LCW A;  2MKS A;  1V5I B;  2MZJ A;  4DF4 A;  1QDU B;  1YLX A;  4D3G A;  3NXZ A;  1VQP S;  1OJ4 A;  1FK9 A;  3DRS A;  4FPR A;  4RL1 A;  3VAM A;  4ZPT R;  3OTO J;  2Z4P A;  2NXJ A;  1KS2 A;  4M5M A;  1LWC A;  1TK0 A;  2GZO A;  1GXT A;  2V4J A;  2NXN A;  3I4P A;  1HR0 J;  4KHM A;  3PKM A;  1RCO B;  1X5S A;  1U6F A;  2DHS A;  2MQN A;  3T1A A;  2XSJ A;  3HP6 A;  3KMQ A;  5B0E A;  3H2V E;  2DNK A;  4DCO B;  4PEO A;  4P2S A;  4IOC Q;  2HFU A;  1ZBT A;  3IO1 A;  2HWT A;  4TQS A;  1WD6 A;  2XCA A;  3V81 A;  5HRO A;  2BW7 A;  2D1C A;  3R8Y A;  1OY8 A;  5BYQ A;  1HBM B;  1FJG J;  4U8Y A;  2AJ4 A;  4F36 A;  1QTN B;  4MFB A;  3OSN A;  3LWM A;  4A8M P;  4MH8 A;  4J9S A;  3I5A A;  1UP1 A;  4R0E A;  1HWJ A;  2LFV A;  4EBC A;  3K5P A;  2W4C A;  4NZ0 A;  1U6B A;  1FA0 A;  1IQZ A;  3SQG B;  1YWX A;  1TL7 B;  2LQ9 A;  2H5J B;  2RH3 A;  4CO1 A;  3B8H A;  1UMJ A;  3D1H A;  4N7T A;  3D67 A;  3MM9 A;  2WHO A;  3R6L B;  4H4O A;  3O8W A;  2E9Z A;  2IYI A;  3CB4 A;  2HVI A;  1HR0 F;  1R7I A;  2M88 A;  2ZBI A;  5AXK A;  4C3M A;  4CO2 A;  4ZMM A;  1S10 A;  3HFV A;  5A8K B;  1J5E F;  5HVF A;  1RWU A;  2FVP A;  3ZTR A;  2HVZ A;  4F0H A;  1S79 A;  2XWX A;  5HK4 A;  4K5S A;  4H4K A;  3I6P A;  4I6A A;  3KK2 B;  2KI2 A;  3HHL D;  3UDV A;  4A8S A;  1WHX A;  5E5N A;  5DDP C;  4LBP A;  5D3G A;  2CUY A;  1I51 B;  4TN2 A;  3VZI A;  4MMO A;  2DGS A;  4KFB A;  4J9Q A;  1UVI A;  4NLD A;  3T5J A;  3ISN D;  5I42 B;  2AQ4 A;  4JI4 F;  1YRU A;  2ROE A;  4I4B A;  3ZZ0 A;  3UCZ P;  1FJC A;  3OR1 A;  4BWM A;  5D15 A;  5KFE A;  1NME B;  2XC9 A;  1KD1 T;  2W2Q P;  2YKQ A;  5CHC B;  2E1R A;  2QLB B;  3UDC A;  1REV B;  2XGP A;  4PXE A;  2C28 A;  4NLX A;  3IRX B;  5IV3 A;  4M5G A;  2R7S A;  4K0K J;  1RBA A;  1Q4R A;  1PIL A;  3IXQ A;  1E6V B;  1VMB A;  4NLR A;  4RPF A;  4ES2 A;  1MN7 A;  1IBL F;  1XR6 A;  3Q8Y A;  2Y9H A;  3C3L A;  3MCO A;  1S6P A;  3BR8 A;  2KHD A;  3OPK A;  1SH3 A;  4KTQ A;  1NK6 A;  2WOM A;  5D0R A;  2QMU B;  1TL5 A;  2EG1 A;  3DNC A;  2XLJ A;  3QAE A;  1YBU A;  4ZCK A;  3LQV A;  4F3O A;  2V2Z A;  2YX7 A;  3R3T A;  1RU2 A;  1DZ5 A;  2IY5 B;  3VCD A;  2H4W B;  1FRK A;  3BGO P;  1R0C B;  5ETT A;  2HWI A;  3O1L A;  5GMD A;  4OI0 A;  3KLG A;  3JSB A;  4KC5 A;  1IVZ A;  3GLJ A;  3BB5 A;  4WXO A;  3VZH A;  1JKH B;  4CLS A;  3EX7 B;  4QWC A;  3CT9 A;  2HS0 A;  1T7P A;  2EK6 A;  1HMV B;  4EO6 A;  1FK9 B;  2HGN A;  3EVO A;  5KG3 A;  4IUF A;  5JMN A;  2M3D A;  3CE8 A;  5LJ3 Y;  5KFY A;  3HHK A;  1H2T Z;  1F1B B;  4J90 A;  4LSN A;  5T14 A;  4U8V A;  3MEG A;  1SJQ A;  2MKI A;  4RBU A;  1N34 F;  3CD6 S;  3V4M A;  4OLO A;  2HSE B;  1HHT P;  2I5J B;  3Q8P B;  3Q0A A;  2BJ9 A;  2KN4 A;  4DV5 J;  3WC2 A;  3G6Y A;  4BWJ A;  1IBL J;  3M4X A;  5KAK A;  3CJ0 A;  1ROF A;  2QZ8 A;  4OZ2 A;  4B3O B;  3C66 A;  2DCL A;  4IRC A;  1R0B G;  1UJ6 A;  2HQ3 A;  2ZVS A;  3EWG A;  2H51 B;  3AD9 C;  3PFE A;  3Q83 A;  3TVY A;  3RB4 A;  2A2D A;  2GMH A;  3NKY A;  2DTJ A;  2ZUA A;  4LRC A;  4RW7 A;  4WP3 A;  4DU8 A;  4X4T A;  1IKY A;  2KU7 A;  3NWR A;  3PX4 A;  2UUA F;  3A1Y G;  1IJE B;  1ZPW X;  2GS8 A;  4OZL A;  4DV2 F;  2K7K A;  1B99 A;  3M9N B;  3HX9 A;  4KGX B;  2HK2 A;  4Y2A A;  3BSC A;  2XYG B;  1S7H A;  2LQJ A;  1R43 A;  2CYY A;  3MMJ A;  4RZR A;  2FHJ A;  2NUU G;  5L1K A;  1L3S A;  1YJ7 A;  2BAN A;  4ZPW R;  3RBZ A;  3I87 A;  1S49 A;  3DRR B;  1X0F A;  2VKR A;  3GB0 A;  1OY9 A;  1MW7 A;  3P4U B;  1N5V A;  4WF9 Q;  1NB2 A;  4ICL A;  3QWP A;  3CXC R;  1VBY A;  1BQN B;  1JXV A;  1TQL A;  3BBB A;  2X3D A;  3HKW A;  4YEA A;  5DLG A;  5DZ7 A;  5DO2 A;  4DCJ B;  4DV5 F;  3TEG A;  2W9C A;  1ITP A;  4FKY A;  3W2V A;  4WTY A;  4RLE A;  2GQ2 A;  3D7S B;  1GMU A;  2P9G A;  2V4R A;  1X5T A;  1GMV A;  2CG8 A;  3DXB A;  3KWM A;  4PWD A;  2XWY A;  3H40 A;  5CCL A;  1SL2 A;  4N76 A;  1DLO A;  2EVZ A;  5AXN A;  5J1E A;  2WAQ D;  5EX3 A;  3TVZ A;  3ZNJ 1;  2UUA J;  2XZD B;  2GW8 A;  2LXF A;  3WX8 A;  4JV2 A;  1VJQ A;  1DTT B;  3Q8V A;  1WOS A;  1OWX A;  4WKY A;  1UA0 A;  2P8I A;  3IWL A;  3K8V A;  3NP5 A;  2AKW B;  4U96 A;  4RWW A;  4UY8 5;  3OL9 A;  4NYO A;  5CYM A;  3OJS A;  4O4G B;  3HVA A;  2WZ1 A;  3SSQ A;  3R97 A;  1UET A;  4YOE A;  2VC0 A;  4OHY A;  1FX2 A;  2I6W A;  1S6P B;  2MST A;  4C11 A;  2XMK A;  4I2Q A;  1NPK A;  2M70 A;  3CUN A;  2HHT A;  2B9X A;  2V8P A;  4U9R A;  3PIO Q;  2DNZ A;  3HJV A;  2VA3 A;  3G9C A;  2IMO A;  2B9Y A;  2G1D A;  1WC0 A;  2MKY A;  2DNN A;  2EBG A;  2VG6 B;  3R5D A;  1U1P A;  1HI8 A;  1HQE A;  1FCA A;  2DR5 A;  3DLE B;  3I0S B;  2DD8 S;  2AF6 A;  2HVH A;  2LMI A;  1EAY C;  1AT1 B;  2VL1 A;  3S7R A;  4KJI A;  1VRU B;  2A6M A;  1YVF A;  2PD1 A;  2YNG A;  4X4O A;  2UUC F;  3W3S A;  2R7T A;  4OV6 A;  4JV5 J;  4NLW A;  3FFI A;  2J8A A;  4WXW A;  4DWI A;  1NRK A;  4RNF A;  1Y5I B;  4Y3C A;  1WEZ A;  2ZUG A;  3OTE A;  1G2E A;  4HDG A;  3DDN A;  1KP6 A;  5A2Q U;  3DMJ A;  4PG8 A;  1W2I A;  3QO9 A;  1L3V A;  4KGZ B;  3DKD A;  2WW8 A;  5D4O A;  5HP1 B;  1MNE A;  2BJE A;  1Z4U A;  3NCR A;  1YIT S;  3RR7 A;  5C25 A;  3S1T A;  1OPI A;  4PZV A;  2XS7 A;  1VFJ A;  2KYZ A;  2V68 A;  1VRU A;  3EM1 A;  2HHX A;  1S76 D;  1KVK A;  1JLB A;  4NEY A;  4HTJ A;  1DJ0 A;  3HHL C;  2IC3 A;  2FUG 9;  1DQ8 A;  2VFV A;  4WYW A;  2AZ1 A;  5KFD A;  3MED A;  3J7Y I;  4HHU A;  2FC8 A;  4CLK A;  1FHT A;  1Y0H A;  3KDO A;  3OR2 B;  2UVW A;  1HI0 P;  1QVF R;  3GJR B;  1PAE X;  5AXM A;  3DGV A;  4B3T F;  2UUC J;  3BH7 B;  2WBM A;  1RT2 B;  4YB7 A;  1S1W B;  1M5O C;  4DR4 J;  4JI7 J;  2MZ1 A;  3BPD A;  3V5R A;  1NK8 A;  2YQ0 A;  4AQY J;  4GKJ J;  1HW9 A;  3DLJ A;  3G6E S;  1FD8 A;  2DXE A;  3UO0 A;  2Z2M A;  2XO7 A;  1XNQ J;  2E29 A;  2QGF B;  2AHO B;  3B82 A;  1I1G A;  3CJQ A;  3MDF A;  3TUZ C;  1S6Q A;  1T94 A;  1LV5 A;  2IJF A;  2HBY B;  4IG3 A;  2VAS A;  2VQF F;  4YR3 A;  4TU7 A;  5KG2 A;  3BSO A;  2ASJ A;  1V3R A;  1IQT A;  1LWE A;  3W9J A;  4Q5V A;  1M1H A;  1DLO B;  2BKP A;  3AOD A;  4NLP A;  1NK5 A;  2ZZT A;  2V2K A;  4YB6 A;  1HQ2 A;  4NCA A;  2KRR A;  3T1Y J;  2VBY A;  3U27 A;  4RO0 A;  3MTK A;  1RHM B;  3FCV A;  3RBE A;  2GJI A;  2Q79 A;  5DQG A;  3CJK B;  4DZ6 A;  3CCJ S;  3DRP A;  1NJX A;  2AGQ A;  1Y4Z B;  1FKO B;  1GXU A;  4FDF A;  4O0N A;  2JL9 A;  4YME A;  3S01 A;  1SQG A;  1WDT A;  5JVG Q;  4WJB A;  4ED6 A;  2ACY A;  2BZ2 A;  3MGJ A;  2HFS A;  5LT5 A;  5KT7 A;  2YBV A;  3IAS 9;  3OD2 A;  3J7Y U;  3OXL A;  3US5 A;  4C8N A;  3BDP A;  3WDO A;  4JI7 F;  3ZZZ A;  1B7F A;  4AQY F;  2NR0 A;  2U1A A;  3QJJ A;  3MEK A;  3AAW B;  3EDR B;  4K4W A;  2RRA A;  1N5Y B;  2GO9 A;  4DLG A;  3T6B A;  3HZG A;  3M2U A;  2HFO A;  1B0T A;  2XMT A;  5GAG U;  3OFH A;  1LQ9 A;  2BXJ A;  2CFX A;  1RWN B;  3FBB A;  4J9U E;  4E8U A;  1S1U B;  5L1J A;  3UCU P;  2VFS A;  2MQQ A;  2NQP A;  1HA1 A;  4J91 A;  3FRZ A;  2GIR A;  2VQF J;  1HNZ J;  1YDL A;  2KT2 A;  2WB4 A;  3LP1 B;  1EB0 A;  2B7B B;  4QR2 A;  2EPI A;  4USU A;  3H5Y A;  1S0N A;  1VQN S;  1KVJ A;  3FZ2 A;  4YS2 A;  2ZH5 A;  1RWP B;  3LO3 A;  2V9W A;  3RGI A;  4LR9 A;  2CWX A;  3SEO A;  2A1B A;  4FYW B;  3T1Y F;  4M63 A;  1UJ5 A;  2LEP A;  2MDA A;  2W7A A;  5ITH A;  5A8W A;  2VC1 A;  1L3T A;  5DS7 A;  1RT1 A;  4TNO A;  3FK4 A;  4J9O A;  4AYB D;  3OL7 A;  3TWZ A;  5DM6 Q;  1S6Q B;  4GRS A;  1PBA A;  4KPC A;  3CCL S;  3BO3 A;  1T9U A;  1NAQ A;  3UVJ B;  2JVO A;  3AQP A;  4L75 A;  2UVV A;  4C8L A;  2VFU A;  3KJN B;  3KHG A;  2FLL A;  4JP8 A;  2CQP A;  4DSK A;  2DKO B;  2YNH B;  4JBC A;  2JEF A;  1HYS B;  4C4W A;  4M5L A;  2DH8 A;  3MEG B;  5IQ6 A;  4NXM J;  3CIM A;  4CLW A;  4NCB A;  4F8R A;  4K4V A;  1WEX A;  4DUT A;  4IDK B;  1XER A;  1YZ6 A;  1HWK A;  2N3O A;  1SBR A;  3S6E A;  1NH8 A;  1Q7L B;  4AND A;  3BJY A;  1GX5 A;  4IO9 Q;  2QEX S;  2GAH C;  3LOU A;  2BUN A;  3AJD A;  2E7W A;  3ILL A;  1UW9 A;  1RT5 A;  1VIS A;  3EIC A;  1HNZ F;  3DLK A;  4DUY J;  3MMA B;  4TY8 A;  3IWX A;  3MAA A;  1C4A A;  1HW8 A;  1N88 A;  5E2Q A;  4UF4 A;  3TX8 A;  3TW0 A;  1JLG A;  4CO4 A;  5HLF B;  3MR5 A;  3DLB A;  3TAN A;  4Y2C A;  1VK8 A;  3M8P A;  2QLX A;  2MB0 B;  2FB0 A;  1QE1 B;  3O5T B;  4YHH J;  1U1R A;  1CG2 A;  4B9U A;  1LOU A;  3GII A;  4DX8 H;  1BQM A;  1RT2 A;  4XDD A;  4N41 A;  3HUL A;  3OQ2 A;  1S1V A;  2F8H A;  1RTI A;  1WAC A;  3F44 A;  4B9L A;  4ZVP B;  1U2R A;  1HNV B;  1T0T V;  3C15 B;  3DRY A;  4EMD A;  1T95 A;  5GAD I;  4ZCI A;  4DCP B;  1UZH A;  4ZJO A;  3HKZ D;  1FWP A;  2EWH A;  5IWA F;  3DCA A;  4IR1 A;  1JLF B;  1Q8K A;  1U02 A;  2KDO A;  2YKN B;  3N01 A;  2OPR B;  2OEL A;  2OTL S;  2BE2 A;  4XIU A;  1FNM A;  4FVM A;  5FDL A;  4KPY A;  2DHH A;  1F9F A;  2D3Z A;  2V94 A;  4KE5 A;  1TKZ A;  2X1G A;  3JQJ A;  3W64 A;  3NNA A;  2KFN A;  2HHS A;  1VYA A;  1LNQ A;  4IFY A;  3J80 Y;  6FD1 A;  4ED7 A;  4NA3 A;  2QA4 G;  3E01 A;  1LWX A;  1T05 A;  4AFF A;  3UWT A;  2AYG A;  4PR6 A;  3KNA A;  2MZQ A;  4NRU A;  3GE9 A;  4WP9 A;  2Q6B A;  4P2F A;  4S0M A;  2RML A;  2L9N A;  3GIM A;  2F63 A;  1RWO B;  3SFG A;  3QT5 A;  2IPO B;  2YNG B;  3V81 B;  2UZA A;  4MKY A;  2IIH A;  1HBU A;  1Q95 G;  2KXN B;  2FJB B;  1PYT A;  3G8Q A;  2DNL A;  4A47 A;  1T9W A;  3MMA A;  4TY8 B;  1SIZ A;  3DFE A;  3CNQ P;  2DGQ A;  5K8N A;  4B3M J;  3MCM A;  4V19 J;  3MM7 B;  2V8D A;  1K1Q A;  4AL7 A;  2BVZ A;  4BS2 A;  3ET6 B;  1K1S A;  2D74 B;  2XI2 A;  1FXR A;  2WVD A;  2CZ9 A;  4XAK A;  2GML A;  4ZOS A;  4C11 B;  4B3S J;  3PFO A;  2POK A;  3CPW R;  1D9A A;  1WOP A;  4F2R A;  4PWD B;  3AXM A;  3J7A 1;  1ZAV A;  1URN A;  1B70 B;  1C1B A;  2C1E B;  3CJ3 A;  3FQL A;  3RG6 A;  4X2B A;  2CRL A;  1IKX B;  3QT7 A;  3IGN A;  4ZIV A;  4FF3 A;  3M32 B;  2IM0 A;  2R8J A;  2Y1L B;  5T7L A;  3SDE A;  1YQH A;  1Y00 A;  3PM9 A;  3PX6 A;  2HHQ A;  2GFF A;  2EEY A;  3CD0 A;  3DU6 A;  4H54 A;  1KQK A;  2QX0 A;  3WZ0 A;  1O5J A;  3M2R A;  5ETQ A;  4IDK A;  3ZZP A;  5EDW A;  3Q23 A;  1Y9O A;  3C8Y A;  3CTR A;  3A12 A;  2RQ4 A;  3CDB A;  5ETS A;  2DH7 A;  4PXD A;  4IH5 A;  1NSP A;  5EGY A;  3KHH A;  3PHE A;  4RW8 B;  3FBC A;  3H98 A;  3OTC A;  1YTY A;  2H1Y A;  3UDL A;  2CPZ A;  2HBZ B;  3G82 B;  4RU9 A;  4BHQ A;  1DAR A;  2BRL A;  5G0R A;  3TOQ A;  4YN3 B;  3SDE B;  1X9M A;  3KLH A;  1RHK B;  2UU9 J;  2LQ5 A;  2YKM B;  1NKB A;  3MMB A;  1U24 A;  3C14 B;  3CMA S;  4NRT A;  5H9F J;  5KFM A;  2OD6 A;  2UUB J;  2JC1 A;  4G1I A;  3G82 A;  3Q22 A;  2J6T A;  1QAJ A;  4IYQ A;  2CJQ A;  1YJW S;  2LA6 A;  2IFX A;  2XUL A;  3HJF A;  2BJ3 A;  2BDP A;  5KG6 A;  4B9S A;  2ZDO A;  3NGK A;  1U0H B;  3RTV A;  1WC3 A;  4I68 A;  4YB1 P;  4M8L A;  1X5P A;  3KXD A;  1RLC L;  5H9E K;  2GQQ A;  2RB7 A;  2RJZ A;  4RW7 B;  4DR2 J;  1IKV B;  2ZWO A;  1ZM9 A;  4ZJL A;  4XPC A;  2UV8 G;  3UI3 A;  4FF2 A;  1RAC B;  4UOC A;  1LW0 B;  4QZV B;  4A8X A;  3T41 A;  3A3P B;  5T7L B;  4CTA A;  4X65 F;  4DR3 F;  3I31 A;  2IA6 A;  4B9N A;  2CA9 A;  2UP1 A;  3UD3 P;  3UW1 A;  5L9N A;  1X4B A;  3BO4 A;  3SFU A;  4HI2 A;  1N48 A;  1NDL A;  1QUP A;  4WIQ A;  1N32 J;  4WFB Q;  2UU9 F;  1MG7 A;  5D0E A;  4ZLJ A;  2ZM6 F;  2G0C A;  4WII A;  1VC5 A;  4FXV A;  4NXN F;  4GO7 X;  4B3R F;  2WOM B;  3BV8 A;  5H9F K;  1S9E A;  1FRJ A;  1KHW A;  2RIL A;  2P9E A;  3AB4 B;  2M4M A;  3A13 A;  2RF2 B;  3MM6 B;  4LFA J;  4AL6 A;  4WPA A;  3RUB L;  4E2F B;  1D9F A;  2J6S A;  3HSG A;  4IQX A;  4DU7 A;  1Q16 B;  4NLQ A;  1QM9 A;  3VWS A;  4CO3 A;  2NYH A;  2W01 A;  2ZEJ A;  4HEA 9;  4TY9 A;  4G1Q B;  4F04 B;  2OPS A;  3C46 A;  3HMJ G;  4DR2 F;  4LBH A;  5A0Y B;  2HVD A;  3KMS A;  2FD2 A;  4M1K A;  5HVG A;  1H38 A;  4LFB F;  3KG1 A;  1RTJ B;  3QIP B;  2NXU A;  4F3Q A;  3GQC A;  4USJ C;  1GXL A;  2CQC A;  3PW7 A;  4FBT A;  2XMU A;  1Q7Y T;  1E6Y A;  3H59 A;  2IM2 A;  4F4K A;  2A10 A;  2H4Y B;  4M5H A;  2RNE A;  1XNR F;  1X0P A;  3L9Z A;  4OFZ A;  3D0H E;  4LIW A;  1HNX J;  4PG7 A;  3L09 A;  3TA1 A;  4F4W A;  2D9O A;  3MTJ A;  4IG0 B;  1KQF B;  3HHE A;  4CH1 A;  3HHD A;  2ZH3 A;  2R2R A;  3JSM B;  3WQP A;  3TJ9 A;  2GHW A;  1VQ8 S;  3PW4 A;  1LK5 A;  2ZDP A;  4FF4 A;  2H5I B;  3MHY A;  3MM9 B;  5LSL A;  2W2O P;  4G1Q A;  4ZPD A;  1QSS A;  3LA0 A;  1QSL A;  2IJN A;  2FLP A;  4LFA F;  4L3N A;  4K4U A;  2HHV A;  1H7W A;  1SQF A;  2D7S A;  5LL6 d;  2LU1 A;  4IG0 A;  5AXL A;  3NGT A;  3DLG A;  4FYX B;  5D0G A;  1SV5 A;  5IC6 B;  4UOG A;  4Y0F A;  5BR8 J;  3DXS X;  1JLQ A;  2Q3P A;  2DGX A;  1E6Y B;  2IM1 A;  1JLE A;  1TL1 A;  1YZ7 A;  2CVE A;  2C3O A;  3I9Z A;  3NLC A;  4DR1 F;  2HQF A;  2VQE F;  1GQE A;  1ZS6 A;  2XNQ A;  3N6L A;  3PCO B;  3AY0 A;  4MFB B;  2W2P P;  3CJT A;  4NYP A;  2Z0G A;  4OI4 A;  2XCP A;  1VC6 A;  5MAO A;  1OQ6 A;  4WFZ A;  4ELV A;  2JH3 A;  1Q5Y A;  4PAA A;  1XNR J;  4PPZ A;  1UEU A;  1X4C A;  3TAQ A;  3MAA B;  4F4A A;  1RT1 B;  5F9L A;  3HCX A;  3J81 j;  5KG0 A;  4DV3 J;  2QFJ A;  2PGC A;  3N28 A;  5E33 A;  4WK3 A;  3W60 A;  4DDF A;  2XQC A;  1EQM A;  2GC8 A;  3GON A;  3KFW X;  3TYT A;  1VBZ A;  5IM0 A;  3K2Y A;  3NGD A;  3D1O A;  2G9O A;  3DRS B;  4ECV A;  1R3N A;  4OZ1 A;  4JI3 F;  2Y8Y A;  3OVS A;  3GFY A;  1RSC A;  4QCL A;  1SCJ B;  5BYR A;  3TR5 A;  4CLY A;  4DOZ A;  2AYE A;  2RSQ A;  4MKV A;  4CH0 S;  4DZD A;  1FFW B;  5D4P A;  3QZ7 A;  4JB8 B;  3PYD A;  4DFJ A;  1JIH A;  4ZK7 M;  5KFZ A;  2MSS A;  1AUS L;  2O01 C;  2VG5 A;  2ZH6 A;  4P7V A;  2ILZ A;  5D0H A;  3DN9 A;  1G4C A;  2R8I A;  3RR8 A;  3GIR A;  5IT9 U;  2V6A A;  2J9E A;  3EZU A;  4DR1 J;  3IM9 A;  2VQE J;  1WI8 A;  2ZBQ A;  3LGM A;  1J27 A;  3G8T A;  1WTB A;  2YNI B;  4YR0 A;  4OI1 A;  3KLH B;  3AH6 A;  1FTC A;  3DOK B;  2G2Z A;  1YJR A;  3RBX A;  1B64 A;  5DG8 A;  4KO0 A;  3R6G B;  3C19 A;  4Z7Y A;  4OJG A;  1OMS A;  4OYZ A;  1K47 A;  3NCQ A;  3MFH A;  3DYA A;  3LP1 A;  2HND B;  3CIZ A;  1LK7 A;  4QR1 A;  4K4Y A;  5B7W A;  1QVG R;  3POT A;  4ID8 A;  3MR6 A;  4WTO B;  3CGI A;  3E2E A;  2KG1 A;  2PN6 A;  4P74 A;  4OJ1 A;  2BQR A;  3H8Y A;  2WSE C;  4KKO A;  1L3U A;  1RTD A;  4LF5 J;  2ZJR Q;  3B78 A;  4TKT A;  4DV0 J;  3OHA A;  1I94 J;  5KG5 A;  2AX1 A;  1QUV A;  3PY8 A;  1F60 B;  1PJ7 A;  2V69 A;  1LFW A;  5FD1 A;  1WSR A;  4HDH A;  3R5J B;  3TRG A;  4W98 A;  3JQM A;  1C2P A;  5F8H A;  1ZA2 B;  4ZIW A;  2K7J A;  5KG7 A;  3Q24 A;  1UWB A;  1FX4 A;  2OD4 A;  1WTF A;  4ZVQ B;  4QJV A;  4LF2 A;  3CSK A;  4NL5 A;  1C0U A;  3R7S B;  4ZVE A;  2ROP A;  1KR4 A;  4FKX A;  3OVA A;  2E5H A;  2HZA A;  4LMZ A;  2IVY A;  2ALY B;  2CVI A;  3BGL A;  3THP A;  3W2W A;  3EPG A;  5EWF A;  4DUZ F;  5CCM A;  3SV4 A;  1J5O A;  2ATL A;  2FVQ A;  1EET B;  1SPB P;  3H42 A;  4Y65 A;  5HN0 A;  1U1L A;  1HHQ A;  3K0J A;  1DHM A;  1DTQ A;  1HNW F;  5IT0 A;  1QJH A;  5C42 A;  3BSA A;  1PC4 A;  2XY7 A;  3GR0 A;  1S59 A;  1N5S A;  2ZH2 A;  1K44 A;  1U47 A;  4FNI A;  4LF8 J;  3T19 A;  1OSC A;  1R6V A;  2C2Z B;  3Q8R B;  1Q81 T;  1UEK A;  1EKS A;  3ISZ A;  3EXC X;  4KAI A;  2YXL A;  5ETM A;  4DSF A;  3CJ4 A;  3NBP B;  1ZAX A;  2PC6 A;  4NI2 A;  5GAD U;  2AJ2 A;  1I94 F;  3IAM 9;  1JNZ B;  1SUQ A;  1XN9 A;  2CQD A;  4EUV A;  7FDR A;  1RKJ A;  2XS5 A;  1WEL A;  2FHO B;  2YKO A;  2I1R A;  4K5R A;  4ZPB A;  4F0M A;  4IKA A;  5D8H B;  1EZZ B;  1RT7 A;  2AEM A;  4P2M A;  3D5M A;  2MKK A;  2ZH9 A;  2UXD F;  2FZC B;  1OYE A;  3IBF B;  4ITS A;  2W2N P;  3SBM A;  5JVH Q;  1YIJ S;  2MLY A;  1JLF A;  1IKW A;  4UUX A;  3CD5 A;  4I56 A;  1SKS A;  5CYQ A;  1CUL A;  4DG1 B;  5D77 A;  5FII A;  3CJ5 A;  4ED8 A;  1VS3 A;  3PW2 A;  3Q8S B;  2DRD A;  4J9K A;  3A8K A;  1HD1 A;  1OY6 A;  2DH9 A;  1HPZ B;  1NZA A;  1XWL A;  1P1L A;  1CJT A;  3BSN A;  4LF8 F;  2VPW B;  1TU0 B;  5HP1 A;  2VH7 A;  2ZE2 B;  4RBT A;  2F65 A;  3N5F A;  4CO0 A;  4CIO A;  3H25 A;  2ADB A;  1ZH5 A;  1HNI B;  2BJ1 A;  5HQ8 A;  4MIA A;  1U25 A;  2KXH A;  2G0J A;  3LP2 A;  3ENW A;  1FEH A;  1FXD A;  2HRY A;  3KJV B;  1FFG B;  1RAA B;  4C3K A;  5GMK a;  4A8W A;  2LEC A;  4NZ6 A;  5IFM A;  3LAM A;  4H4O B;  3HHN B;  2IVF B;  1IKW B;  1P9Q C;  1HQE B;  3NS6 A;  3ZZR A;  2OML A;  3U7J A;  1YG0 A;  1LKZ A;  3GTY X;  3PV8 A;  1AYE A;  3NRB A;  4J9M A;  1NBE B;  2HLU A;  3OV7 A;  4K2X A;  4F26 A;  1RT3 B;  2JZ5 A;  1SL1 A;  2B3T B;  3MPY A;  2JX2 A;  4O23 A;  3K5N A;  2ZJP Q;  4RBV A;  2G13 A;  4RNH A;  1UAW A;  2I38 A;  2C2K B;  2QRR A;  3KJQ B;  3MMC B;  4LF7 J;  4MKB A;  5HQL A;  4OJH A;  4HH1 A;  2GHV C;  4N8O A;  1P8G A;  1HWU A;  3GU0 A;  1FER A;  3UDE A;  1R8C A;  3QLH A;  4YR2 A;  3M8P B;  4P9S A;  5CYM B;  1FF2 A;  3W2V B;  1FRX A;  1IN0 A;  2BMB A;  2OPS B;  3ULH A;  1VQO S;  4PYA A;  3EDQ B;  3T1H J;  2DR6 A;  1UFL A;  1U2F A;  4URG A;  1VBK A;  4DR6 F;  4YDD B;  3AXK A;  4LR7 A;  1RAB B;  3V6D B;  1N0U A;  1PGZ A;  2KZM A;  1S1X A;  2O3D A;  4CO5 A;  2VF3 A;  1XMO F;  2FVS A;  1YBA A;  2BE9 B;  4LF6 F;  2E7V A;  4B02 A;  2JEJ A;  2OEJ A;  2COL A;  4USH A;  1TUG B;  4NMX A;  2ZH8 A;  1FNX H;  2CQ0 A;  4LF4 J;  1YJ9 S;  3NBP A;  4QPX A;  4ZVH A;  3T3F A;  2IJR A;  2IAJ A;  1PYO B;  3M7V A;  5L8R C;  2R4F A;  4RUB A;  3HSD A;  4ZLP A;  5J2N B;  3PVX A;  2VIH A;  2HQD A;  5CD4 H;  2YNF B;  3K7R A;  2MGZ B;  4Q43 A;  2CJB A;  4ECU A;  1PBU A;  5KG4 A;  2BAB A;  4DV7 J;  5L38 A;  3J7A N;  1AA1 B;  2CNK B;  1T9V A;  2XMJ A;  2IHR 1;  2RDD A;  2BAN B;  2BJ8 A;  3NAH A;  1VQM S;  1D9D A;  1OPZ A;  1Y10 A;  2QA1 A;  4AD6 A;  4JI5 J;  3HK2 A;  2B8P A;  1TKX B;  2VFT A;  2VON A;  1UPP A;  1ZAW A;  1WC1 A;  2FJA B;  1RKI A;  4ER8 A;  3QMQ A;  1VQ9 S;  3WIU A;  2A18 A;  1DFD A;  2DXF A;  2H3E B;  1C0U B;  4EI2 A;  3VF0 B;  2QL9 B;  1UFW A;  4ZLN A;  3GCX P;  2HGM A;  3DLH A;  2RQK A;  4K2J A;  3G8S A;  3MPU B;  4JV1 A;  2KFZ A;  1NDP A;  4RW6 A;  4RW9 A;  1SC6 A;  2PMZ D;  1F6T A;  3SCL E;  3M8W A;  4KO0 B;  2L41 A;  1VIO A;  1RI7 A;  5HJX A;  2MKC A;  5IS2 A;  3CCU S;  2M7S A;  1D8Y A;  4Q0B A;  1AFI A;  3DDK A;  3U1M A;  2J0Q D;  1RTD B;  1ACM B;  1KWM A;  4DQP A;  5CAA A;  2FTR A;  3T9Z A;  4BBY A;  5I3U A;  2K1R A;  4ZPV R;  2JVR A;  1WHY A;  1TFW A;  2Z2L A;  3N9U C;  3VAL A;  1NM2 A;  2MQ8 A;  3LTO A;  2CKW A;  2XTJ P;  4NLU A;  1M0S A;  2O66 A;  1Y5N B;  3FEX B;  4DV7 F;  1M5H A;  2VPZ B;  1XK8 A;  2DK2 A;  3LUY A;  3GG0 A;  3UNG C;  4K4X A;  4LSL A;  3GYX B;  3KLI A;  2XNR A;  3JYT B;  5A6P A;  2PI4 A;  1VQK S;  4QWE A;  2M8H A;  1HMV A;  3NNC A;  2P6T A;  3F41 A;  1GMW D;  1RWW B;  5D6G A;  4CCH A;  4GKK J;  3M9M B;  2KHC A;  2R7V A;  2RE1 A;  1Y3J A;  3IP0 A;  1S4F A;  4UST A;  3MCS A;  5K8M A;  1H0H B;  2OIH A;  3SSS A;  3KYL A;  3P5T L;  3MAQ A;  3ITH B;  2HZC A;  8RUC A;  5DQI A;  3NG8 A;  5KFP A;  2GIQ A;  4WK1 A;  5KFB A;  3EXY A;  1S1W A;  3R1H A;  3H4D A;  2N4D A;  3IGV A;  1PSD A;  3B6B A;  5L9X A;  2E5G A;  3I0R A;  2AMC B;  1NK0 A;  1N36 J;  2DYA A;  4DV6 J;  4ECS A;  1CJT B;  1P27 B;  2B43 A;  1RIS A;  2DNH A;  1IR1 A;  4CYU B;  2QO3 A;  3HVW A;  5THW A;  2WBR A;  2ERR A;  4XDC A;  3FFI B;  2OPR A;  4C48 A;  3W63 A;  2QC3 A;  1TTH B;  4YY3 F;  2HEK A;  1VQY A;  2PO4 A;  1U48 A;  3SCI E;  4K50 A;  2E1A A;  2RQM A;  1NK7 A;  4F02 A;  5KFG A;  4ECR A;  3OFG A;  5C25 B;  4FXD A;  5LOQ A;  1C1C A;  2DY9 A;  4NLV A;  3W7B A;  4LRD A;  3NEK A;  4A8Y A;  4NLO A;  3R7N B;  1T05 B;  1K73 T;  1S1V B;  2FHJ D;  2YWE A;  2YWH A;  3NGS A;  5E3Q A;  1L5U A;  1KQG B;  4Q7A A;  2B9E A;  2VPY B;  1UVK A;  3CJR A;  3W62 A;  3CC7 S;  1AUD A;  2L3M A;  3IR6 B;  3MD1 A;  1H2U X;  4K59 A;  2AV5 A;  1FJG F;  1F3F A;  1RTJ A;  4I0W A;  2YKN A;  4X4U A;  1UKU A;  2I9S A;  4PG4 A;  3W8P A;  2HHP A;  1WF0 A;  1TAU A;  4OQJ A;  1RTH B;  4C0H A;  5HVH A;  3R1L A;  3W5Y A;  1RT5 B;  3IG1 A;  5HMZ A;  3M6X A;  2GX8 A;  2OEM A;  5KFU A;  4CZC A;  3MD3 A;  1AZS B;  2J9C A;  4YY3 J;  4RJV A;  2VBZ A;  1UVJ A;  5HI7 A;  4P10 A;  2PA3 A;  4CQ1 A;  4DL6 A;  3NS7 B;  4I2Q B;  1F3V A;  4CLZ A;  2L08 A;  5IZH A;  2IRU A;  3G6V A;  1MU2 A;  2PI5 A;  1U2C A;  4X84 A;  1ZM2 A;  4ZVT B;  1PG5 B;  2F9J A;  4WYL A;  2FJW A;  1RAH B;  1KDN A;  1J5E J;  2BX6 A;  4KGM A;  4A46 A;  2DGU A;  3TA0 A;  4C9D A;  3KLF B;  2PA8 D;  3OBI A;  4G65 A;  4MK8 A;  4C98 A;  1M1G A;  2M52 A;  3NGR A;  4FNH A;  2K1R B;  4QBU A;  2X3G A;  2AJF E;  2QJ3 A;  2YH0 A;  3GJT B;  1Y11 A;  2OFH X;  1F5B A;  1H74 A;  2F4F A;  2IVM A;  1LXJ A;  3IBW A;  3T5L A;  4LVO P;  4PCQ A;  2AD9 A;  1HBO A;  3NAI A;  3H5X A;  1CSJ A;  1UVM A;  2DB1 A;  4XK8 C;  3FC9 A;  4FP9 A;  1RXO B;  2K2P A;  3VQT A;  3QGG A;  3UPF A;  1RA6 A;  2BJ7 A;  4CLL A;  2MQP A;  2A2C A;  4PAB A;  4LSL B;  3R2C J;  1XMB A;  1U8S A;  1UCN A;  1K0V A;  4CLP A;  3UFC X;  2B0G A;  3IR7 B;  2KO1 A;  4KHP F;  1S57 A;  1RBL A;  2Q6C A;  3MOZ A;  2GMJ A;  1FEE A;  3VAI A;  1S5Z A;  1OSD A;  2YQ3 A;  1CJV A;  1U26 A;  4F4Z A;  1KN6 A;  3A8I A;  5K8O A;  5J1N A;  4K0K F;  4ECZ A;  2RS8 A;  2HRT A;  4ZVF A;  2GQC A;  4EZ6 A;  2RAQ A;  3EVW A;  5AE2 A;  5EWE A;  1BQN A;  5G4D A;  1CQM A;  1L3K A;  4IFV A;  1YX2 A;  3GMG A;  5FLX Y;  3R5G A;  2V2V A;  1S4E A;  1I5O B;  3D3B J;  1MMD A;  3C2P A;  1C0T A;  2XMV A;  5AE3 A;  3TUP A;  2HNY B;  3GR1 A;  1YJV A;  3TZY A;  1F9H A;  3RB0 A;  4DS4 A;  2RDJ A;  5KFS A;  4O44 B;  1D3W A;  2BOA A;  2EG2 A;  2CQI A;  2WON A;  1RB0 A;  1FKO A;  2XSF A;  2ZVI A;  4KQZ A;  4PWW A;  1XTZ A;  4OI3 A;  5T41 A;  3UQS A;  1S9F A;  4K4S A;  2Z30 B;  3C6U B;  2BBE A;  1FES A;  4MK7 A;  5KG1 A;  3PRV A;  3OXG A;  4DS5 A;  1R31 A;  2GJ2 A;  3B4M A;  4DEZ A;  4ECX A;  2HNY A;  3Q89 A;  1HWL A;  3IWN C;  5MLC V;  1WJ9 A;  1SH2 A;  3TP2 A;  3MFI A;  2ZHB A;  3TUJ C;  2DXD A;  2LDY A;  4U7C A;  2BKN A;  1N5T A;  2YKM A;  2C3P A;  4ECW A;  4ZS6 A;  3KLG B;  3SSR A;  3CCR S;  4QU6 A;  3PTW A;  4DL3 A;  4OL8 A;  2VJV A;  2G2O A;  1FVS A;  4ZPA A;  2F7V A;  4KV8 A;  4NE9 C;  4C8K A;  2WW4 A;  1WOR A;  4RW4 B;  4ED5 A;  2CNL B;  2ZH1 A;  5IC4 B;  3CED A;  4ZCL A;  4X64 F;  3VAK A;  5KT5 A;  2KT5 A;  1U1M A;  4FF1 A;  1EHW A;  3SMZ A;  3ZZT A;  3D68 A;  4F0K A;  9RUB A;  4DQR A;  1CQN A;  3I96 A;  1T9X A;  3HVT A;  4MYU A;  3V6K A;  1UVN A;  4W90 B;  5IT4 A;  3CDA A;  3DOK A;  3LAN A;  1F9E B;  3RW7 A;  2RS2 A;  4DV2 J;  1S99 A;  2HKE A;  4PPD A;  2DIV A;  4OHV A;  2BEF A;  3IS9 B;  2EFG A;  4CNY A;  3E51 A;  2Y1J A;  1VRT A;  3J7Z 5;  1U1Q A;  2M8D B;  4OIX A;  2XLK A;  3UN5 A;  4DXL A;  1QAX A;  3HSZ A;  4DR7 F;  3ZNU A;  1YI2 S;  3VAG A;  4BC9 A;  3G4S S;  1FDN A;  3BR9 A;  2AX0 A;  4BCA A;  1JXL A;  4C97 A;  3R7B B;  2KYX A;  4WBF A;  2RU3 A;  4O3S A;  2CZV C;  3HF5 A;  1O8B A;  4M5D B;  2AGP A;  1VQ6 S;  2VPX B;  5E3R A;  3DM2 B;  4CLU A;  4I6Y A;  2MLZ A;  4OYM A;  1RGV A;  1RWM B;  2NXE A;  3W5Z A;  2FY1 A;  2MHE A;  5HBM A;  2B51 A;  2WCX A;  2QN6 B;  5IOL A;  4ES3 A;  4DQS A;  1FTR A;  3QAT A;  4MK9 A;  3SCJ E;  4AXJ A;  2EW9 A;  1TK8 A;  2OFG X;  5I3Q A;  4ETZ A;  4DSE A;  3TJA A;  2B4O A;  2DEI A;  1G3O A;  3E3X A;  4Q8F A;  2QMW A;  2AYM A;  2YWG A;  3ILI A;  4CNZ A;  2QG9 B;  1CVJ A;  3NGU A;  3QFH A;  3QT6 A;  3DI6 A;  5E3A A;  2ZNZ A;  2B7C B;  4WCE Q;  4WZM A;  4UW2 A;  1JNR B;  4ECQ A;  3KK3 A;  2HNZ A;  1Q86 T;  1TZ0 A;  2AEF A;  5GAH I;  1NK9 A;  1VHF A;  2PFD A;  2DHG A;  2LXI A;  3WC0 A;  4TU8 A;  1WKL A;  2XY5 A;  2ADC A;  2MJU A;  3D3C J;  3OFE A;  2F4V J;  3CDE A;  2ZZM A;  2C2O B;  3IRW P;  1N4L A;  4NOH A;  3QT8 A;  2DVI A;  3UR0 A;  1U6Z A;  2H54 B;  5HLF A;  4QR0 A;  5DDR C;  1YBT A;  1S7I A;  3M1V B;  2BQ3 A;  3FDS A;  5KFA A;  2GGP B;  3QID A;  3J81 Y;  3TI0 A;  2QFI A;  4I1T A;  3HT0 A;  3KHR A;  2XHC A;  3TUI C;  2J76 E;  4K8R A;  3KK1 A;  4A8O A;  5BYS A;  3V2U C;  2JDJ A;  4ZVU B;  4L3K A;  3KUH A;  3M30 B;  4I69 A;  4I64 A;  4J7C A;  3GWC A;  3NWG A;  2J7K A;  4JV5 F;  2CDQ A;  5B0G A;  2BAC A;  2ZC4 A;  5CAB A;  2X51 A;  3HXM A;  4ZN3 A;  5J2Q B;  2OPQ A;  3CDU A;  3BQ0 A;  1B7Y B;  3IMQ J;  4HH0 A;  2MQO A;  3OTB A;  1Q5V A;  2ZOF A;  4R8U A;  3M8S A;  3K5M A;  3K58 A;  2M5Y A;  1H72 C;  2ZZN A;  4ERD A;  2KJV A;  2GAG C;  2D3U A;  1NU4 A;  2ZKT A;  4QU7 A;  3K5O A;  1XBW A;  3JSR A;  1EET A;  2UVU A;  1KVI A;  1IUJ A;  4HAC A;  1C4C A;  3PYF A;  3X3U A;  5KFR A;  4A4J A;  4QQB A;  1X4F A;  3H20 A;  4KH0 B;  7AT1 B;  3GFH A;  1WDD A;  2EC2 A;  1WWH A;  4RNO A;  2AEJ A;  3POT B;  2B5J A;  4OYA A;  4Y2K A;  3CCQ S;  2B4U A;  3R5C A;  3ZZU A;  5H9E J;  2Z2Y B;  4FPI A;  4Y6I A;  1N52 B;  1F5A A;  3A8J A;  4AXI A;  5LXR A;  2AIR B;  2W8L A;  1CJK B;  4CLF A;  2BOP A;  2W9C B;  5J2P A;  4B3T J;  4AUK A;  5FJ4 A;  1V6H A;  1RE1 B;  4Q0B B;  1GAO A;  2KFY A;  2R8H A;  4KIA A;  3M32 A;  4LUB A;  4G3I A;  4NA2 A;  5KOW A;  3V6J A;  3NOG A;  2DNY A;  1PYS B;  4DMZ A;  2OPP A;  2KT3 A;  2YNF A;  1EP4 A;  3HD1 A;  3HSJ A;  3RAX A;  3L3C A;  4NLY A;  1NPR A;  5DJB A;  5J2P B;  5GAE U;  2HAI A;  1FNO A;  1M90 T;  1SH0 A;  2EI5 A;  2LVW A;  2ZHO A;  2LYV A;  3DYA B;  2MEW A;  4RUH A;  4LRF A;  4DL7 A;  4WZQ A;  4HYK A;  4QIG A;  4X66 J;  2BR0 A;  5GAE I;  1Y3K A;  4DR5 J;  2ZD1 B;  4JI1 F;  1DUR A;  4RX6 A;  5F0U A;  3FSX A;  3GZ7 A;  1SKU B;  2P2C B;  1N5Y A;  1PCA A;  3K5L A;  3RB6 A;  1JKH A;  1NH7 A;  2MXY A;  3H90 A; 
#chains in the Genus database with same CATH homology
 2NXN A;  2B9E A;  3CJR A;  3CJQ A;  2ZBP A;  2NXC A;  2ZBR A;  2ZBQ A;  3EGV A;  2NXE A;  3CJS A;  1UFK A;  2NXJ A;  3A4T A;  3AJD A;  1SQG A;  2YXL A;  3CJT A;  1SQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...