3CJSA

Minimal recognition complex between prma and ribosomal protein l11
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
59
structure length
58
Chain Sequence
b'MWVYRLKGTLEALDPILPGLFDGGARGLWEREGEVWAFFPAPVDLPYEGVWEEVGDEW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal protein L11 methyltransferase
publication title Multiple-Site Trimethylation of Ribosomal Protein L11 by the PrmA Methyltransferase.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase/ribosomal protein
total genus 11
structure length 58
sequence length 59
ec nomenclature ec 2.1.1.-:
pdb deposition date 2008-03-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1170 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Sun protein; domain 3 3cjsA00
2NXNA 3CJSA 2YXLA 3CJQA 1UFKA 2NXEA 3A4TA 3CJRA 1SQFA 2ZBRA 3CJTA 2NXJA 2ZBQA 2ZBPA 2B9EA 2NXCA 3AJDA 1SQGA 3EGVA
chains in the Genus database with same CATH superfamily
3UVJB 1RWNB 4MKYA 5KG4A 5KOXA 3MAQA 3Q8VA 1SVDA 3UFCX 3R5AA 2FJWA 4TQRA 1VQ6S 2QGFB 2VHGA 1YX2A 2B7BB 5IC6B 1VRUB 5F3TA 4MK9A 4X62J 2CRLA 3SQOP 1NB7A 2D3UA 2W9CB 4YB5A 3KG0A 2YWWA 2DHXA 3EVOA 2D69A 1WOOA 4OL8A 4YP3A 3X1LB 2G13A 2D3O1 3NOGA 4K4XA 3C46A 4BCAA 2J0QD 3BQ2A 2Z2MA 3UW1A 2HNZB 4NLSA 3T1HJ 1P27B 4OHYA 2VPYB 2YKMB 1N0VC 3G8QA 1RTHB 4H4MB 2ZD1B 4QWDA 2Q3PA 4CLPA 5BR8J 2CQPA 2H54B 4WFYA 4CLWA 4J9NA 4DR7J 1L3VA 5I3UA 4LRBA 2MKIA 3FVYA 4QWAA 3VAIA 4DFKA 4ZCMA 1IWGA 4ZKAA 1H0HB 3TNVA 1UP1A 4EYHB 2PD1A 3DFEA 2D74B 2XO6A 3KLGA 4F4XA 3BZQA 1UETA 3BSCA 3PYDA 1JLGB 2RSQA 4IOAQ 1RWOB 3I0SB 3NCPA 4KGZB 1Q82T 4OZJA 3O1LA 4FPIA 2C2KB 3ZNUA 1ZYQA 1RTDA 1MG7A 2DNNA 1AROP 4IG0B 4IQMA 1OWXA 3WIUA 1R0AB 3OL6A 4N8NA 4AXIA 3QATA 5KT5A 1VC6A 4ZPTR 1F5AA 5CYJA 4GRSA 2RHSB 2XNQA 3PYEA 2W7OA 3OTBA 3D6TB 4W90B 2YNIB 1U1NA 4DV4J 4Q2MA 3IGVA 1N8RT 2VA3A 3W9JA 4OJ3A 4NZ7A 4ZVSB 1YWXA 3I55S 4K4UA 5EX0A 4OYOA 2EK6A 4NCAA 3RB4A 3DGPB 5DM6Q 5L1IA 3CMQA 1HI8A 2GA7A 4KHPF 2PE8A 4FKYA 4K4YA 3TP2A 4X4OA 4GC7A 1XK8A 3ELHA 5J1PA 2LEAA 2OUGA 1CULA 2XM3A 1C1CA 2FGOA 1RWUA 1BQNA 1OPZA 2GQCA 2UUBJ 4ERDA 3AOCA 2XY5A 4OJHA 1G4CA 1RTIB 5ETSA 2J5AA 4KGMA 2ZUAA 3MDFA 2CPIA 1VYAA 1CG2A 3BO2A 4FYXB 4DUYJ 3W2VB 4JOUA 1VFJA 1XMQJ 4QR0A 1W25A 1RT7A 3OUYB 4KT0C 4D3HA 2EI5A 4DV2F 5G4DA 4DSIA 2C3MA 3PX0A 2VG5B 4UY8T 3R2DJ 1DZ5A 4USJC 3DLLQ 2IIHA 2C2DA 1S1UA 3B4DA 4MIBA 4IG3B 2VOOA 3LP1A 3BS9A 3D3BJ 3KLEB 4KBIA 2I9SA 3BBBA 4RUAA 1VC5A 1ZM2A 3MMBB 2H5JB 4KH1B 3MEKA 1NK4A 1Q81T 1N34F 1YG0A 4PWDB 1SJ4P 4LBPA 4NXNF 3GONA 3QQCD 3PYGA 2V2ZA 3HXMA 2NSBA 2J6TA 3HI9A 3IR7B 4M5DA 2FLPA 4DSLA 1ZAWA 2LFVA 2YWGA 4F3QA 1SB6A 3GV5B 2YWHA 4LRAA 3HT3A 1GXUA 4GKKJ 2QX0A 2GIRA 3DLKA 4MT1A 4LSLA 3GLJA 2KG0A 3EJMA 4DL4A 3S7RA 5J2PB 1V5VA 3K8WA 4KGKA 4I2QA 5E2QA 2WSFC 2JEGA 3ITHA 4M5JA 5F8MA 4ATNA 3AJ1A 1CJUB 2BXJA 3G87A 2HHUA 2IYGA 2V4QA 4U7UD 2MPUA 3LAMA 1JKHB 4IFVA 1UMJA 4IH6A 2W2OP 3CDEA 2PT0A 3Q22A 2G9OA 4HACB 2H4WB 3CIMA 1VK8A 4RO0A 3KMQA 2C2ZB 5IS2A 1YHQS 4PPZA 1DAXA 1HD0A 2I6WA 3AFGA 3HP6A 2NPFA 4K2JA 2UZAA 3IM9A 3EMTA 1WG4A 2FC9A 1KTVA 3DLJA 1HA1A 2FY1A 2O01C 2HSEB 3THVA 4LFAJ 2YWKA 4L73A 3IM8A 1PC4A 2QL9B 1XNQJ 1VQ7S 5F8IA 1R3NA 1HHTP 1A6LA 3FNNA 4K4ZA 4EYIB 3HVAA 3LGHA 2VC0A 2W8KA 4ZLJA 2GZOA 1FRXA 5H9FJ 4PEOA 5T7LA 4F3MA 3QJLA 3TVKA 3RB0A 5T41A 4IO9Q 3Q83A 4QWCA 1LWXA 5J2QB 1GX5A 3OFEA 3BR8A 1TK8A 1WC4A 3D54A 1OS5A 1YBAA 2B9YA 1PAEX 4NRTA 2VDHA 3M2VB 4R8UB 3VR1A 3R27A 1S1VB 4LIWA 4JI4F 3ZZTA 1FXDA 3MEDA 3TQEA 1RAAB 4ZVEA 3LW5C 3V6HA 3KHLA 4IH7A 3O5TB 1LNQA 5GVQA 2UXBJ 1MU2A 1HPZB 3IWLA 4I2PA 2Q79A 1S6QA 1WC5A 3PFOA 2GQ2A 1Y3KA 2PI4A 1SKWA 1B64A 2LP4A 1RT6A 1N5TA 3CCSS 3ADAC 1T95A 1KWMA 1VI7A 2LQ5A 3CSKA 3ZZPA 3MM6A 3MAHA 1TKZB 1KBRA 1SV5B 4B3SJ 3DRRB 2UUAF 4X4SA 3ET6A 1WF1A 3BN4A 2VA2A 3BR9A 3MCOA 3WQPA 1NK6A 1S9FA 4B3MJ 5DGAA 2LQBA 2YH1A 3HPOA 2MY7A 4OV1A 2HVEA 1K9MT 5KOWA 4KPCA 2BM0A 3EDQB 1X0PA 1F0XA 2GW8A 5IT4A 2XGQA 3QGGA 1ZA2B 4DU8A 3M30A 4RPFA 2UVWA 5IV3A 4ED3A 2W9BA 4C3MA 1FNOA 4PZVA 4FP9A 2NXNA 5D6GA 4DBQA 5L38A 4K7QA 3ZC4A 5EWEA 4Q8EA 5B0FA 1B7YB 5CYMB 4DR5F 2J7UA 9ATCB 3SQGB 2YPYA 6AT1B 1F5BA 4DLGA 1RBAA 3J7YI 1MROB 2DGXA 4DV3J 2YKQA 2AGQA 3TAMB 3CJ8A 3ISND 3TQ1A 1SBRA 1IVZA 4FVCA 1SI9A 2DGOA 4USVA 1GNKA 5EHHA 5ETRA 1X4HA 3MF5A 1H73A 4QWEA 3HX9A 2MQPA 2IM1A 3BREA 4MAKA 1WSVA 3VF0B 1UWBB 3EGWB 3T5KA 2YNGA 2JC1A 1IKXA 3W9HA 3TOQA 3ZZYA 4X4QA 2C3OA 3SFGA 4RUHA 2PMHA 1SH0A 1XC9A 1NJWA 4OI3A 2L9DA 4F02A 3SCKE 3T3FA 1T05A 5A8KA 3KXDA 4GVBA 2WRMA 2KRBA 3KNGA 3AJ2A 1ZOTA 4LSNA 3IRXA 1I6JA 2Y9HA 2QEXS 2CNOB 2Z8QA 1U6ZA 3VAHA 3P4UB 4Q44A 1P1TA 2JH3A 2ZH3A 4LF7J 4QIVA 5B0CA 1XMBA 2I5JA 4DSJA 4Q2LA 3C6TB 1D09B 2XBPA 4RW9A 2IPOB 3VTIA 1VQMS 1Q1KA 4NLVA 3BGRA 3L7UA 4K5SA 3OR1A 4RBTA 1FJ7A 3A1YG 3FBEA 2QSWA 3CCES 1F60B 3QSIA 1FDBA 1GMWA 4WFXA 4DL5A 4EK2A 4LR7A 3TEHB 3MWBA 3Q8SB 4O0NA 3C66A 4OJ1A 2HQGA 2KT3A 4ZVUB 5AXMA 3DKDA 1D8YA 3TEGA 4DV7J 3PKMA 3BH6B 3KJVB 5A76A 2W1BA 3KK1A 2ZZMA 4LF6F 5GAGI 2YQ1A 3OPKA 1VJQA 2YNHB 3SI8A 1FE4A 4LJMA 1ZBTA 1OSDA 4FS2A 2YX4A 2MYFA 1P9QC 2B4VA 2GO9A 2QA4G 3DHWC 3NS6A 2LA4A 5K8OA 2VQEF 5HN0A 3MXHP 2NXUA 1K0TA 1LFWA 2CJQA 3R5CA 2QSFA 1U0HB 3QT6A 4KJIA 2DB1A 1RT3B 2VQFF 3GILA 3ZTPA 2ZKUA 3EYZA 1CJVB 3N9UC 4YB6A 4LF8F 3DOMB 3TZXA 1FKAF 3ENVA 1NEEA 3SCLE 4JYAF 2L9WA 3KUEA 1VR6A 2BA9A 1JLCB 5HVHA 1J5OB 2ACYA 3KTQA 1WJ9A 2EBEA 4DF4A 2HIQA 2DPJA 4LVOP 1PAUB 2HZCA 3T1YF 2IM2A 1AFJA 1HBNB 4Y2CA 4ZCLA 3J80Y 5LSLA 3GQCA 4DG1A 4OX6A 2MY8A 2V2KA 2ZNZA 3G2XA 2WTFA 2BM1A 2JEIA 4YOEA 3M32B 1I94J 3GIKA 2DY9A 2D3ZA 4X65J 1UTAA 1R6YA 3C6UB 4X62F 3MHYA 1N36F 4F2RA 4UTGA 2QA1A 2EFNA 1UJ4A 4ZA1A 4BC9A 2CQBA 1DTTA 3GJQB 1L3KA 1YBTA 4DL7A 2PGCA 1FD8A 4OHXA 5AJ3F 3Q8QB 1FD2A 2K2PA 4WKRA 1TFYA 2WW8A 1GMWD 5KG5A 5LM7E 2ADCA 1JJHA 2BJ1A 4CWBA 2A3JA 4PXEA 2R8KA 2VUGA 2JZ5A 4X2BA 1U48A 2ZC3A 1DHMA 4F4ZA 2J9EA 1N6QA 3ONQA 4ICLA 3V4IA 3MR2A 1TKTB 4F50A 5KFSA 1ZPWX 2HNDB 2XMMA 4B3OB 1X0FA 3M6VA 4L72B 2D41A 4MFBB 5HQ8A 4L74A 2ZH7A 2AYEA 3QPIA 4CTAB 3DI6B 3D2WA 2IHR1 2H9ZA 1IWAA 3V81A 2ZE2A 2VPZB 3FJ2A 3D9BA 1FVSA 3LTOA 4P7VA 4ZPBA 5IT9Y 4V19J 1U1OA 2YWEA 4JI7J 1VQYA 1DRZA 1REGX 3RYLA 5F0WA 3MM9A 2JLEA 3JQMA 3TO8A 2BJ8A 1IQZA 1FEHA 2YBVA 3BDPA 3D67A 4DXLA 4IOBA 4QYZJ 1P8GA 3O6QA 2R8HA 2VPWB 2HWHA 4A8WA 5C25A 4J9UE 3WC2A 1QSYA 1IKVA 3J7AN 2BE2B 2J9DA 1Y11A 1T9VA 3FCHA 1T9UA 2E5JA 2KB2A 2PA8D 1WKJA 3OD2A 4FYVB 2Y1RI 3Q2TC 3L3CA 4RUBA 2C28A 2GHPA 3CJ4A 1PKUA 4OYXA 2YNFB 2JJ4D 2DGQA 3PJWA 4MJKA 2R8GA 2PC6A 2JRSA 1C2PA 4YB7A 4YHHF 5ETVA 4P10A 2EFVA 4O3OA 5KFLA 1RTHA 2V4JB 1Q8KA 3D1QA 2VFSA 2PO4A 1S1XB 4DUYF 2KHDA 2O66A 4J9VA 1KLMB 3JAMY 3BSNA 4HLBA 2VOPA 3OFFA 2VL1A 1GXTA 3TX8A 3N28A 4OIXA 3DLEB 4HT7A 3M2UB 3ILOA 1HNXF 4ZVHA 4O0IA 2CJXB 1SPBP 3QNWB 4KSEB 1CJKA 1QD1A 1UA1A 2MXYA 3NAHA 1FTRA 1ZETA 4TYAA 1UCNA 1MSWD 2W4PA 4TKTA 3CCJS 1LXJA 3C14A 1PBAA 3OR2B 2DGTA 1T9TA 3VWSA 2QC3A 3AA8A 3NCRA 2AT1B 2LEPA 5GMDA 3CD7A 1OYEA 2HK3A 1DQ8A 4PAAA 3GFZA 4DSFA 3DC2A 1DTQB 1FKOB 2G1DA 2CIMA 2GNKA 4UQTA 1NKCA 4C7QA 4JUZA 1HHSA 1H38A 1TZ0A 2OMLA 2KM8B 2UUCJ 4F2SA 1VQ4S 2B0GA 4RW8B 1SC6A 2IJFA 1OJ4A 3AB2B 2XS2A 4HEA9 3WBZA 2OAUA 2QG9B 2WB1D 3WX4A 4JI5F 1JJ4A 3CDAA 3FZ2A 2G4BA 5L9XA 1EB0A 4B9UA 3VCDA 1LQ9A 4K50A 4UUWA 1JXLA 3QJJA 3W5XA 4GVLA 2OMOA 2Z4PA 3NXZA 5M2UA 4UZBA 3RRGA 5GAHU 1NJXA 2R7QA 5E33A 4ZLNA 1NK5A 4ANEA 3CMAS 3CD5A 3NGDA 3POTA 4YDDB 5KFNA 3EVWA 1T9YA 1PJ5A 1V3RA 3N01A 4A4JA 2VIHA 2OPPB 3LQVA 3AXKA 2KG1A 3GJSB 4DV0F 1TMJA 2HHSA 2BKOA 2ERRA 2EVZA 1C1BA 2VG5A 3BN7A 1Y10A 4BWJA 1T8EA 2CADA 4ZVGA 4HVZA 4TLQA 1U2RA 4LQ9A 1XR7A 3PCOB 2BJEA 4PWUA 1UZDA 5HI7A 4AQYF 4LVNP 2BANB 1VRQC 3V4MA 1QUPA 5IXUA 4F26A 5M2PA 4Y2KA 1LK5A 5KG6A 5KG0A 4RU2A 3SV4A 4ZP8A 1PYSB 2DR9A 1YJRA 1HI1A 3OL7A 2OSQA 5E5NA 2C2EA 2FZKB 4MIWA 4J9OA 4OYIA 1LW2A 4PWDA 2NS1B 1HWJA 4J5OA 2QYCA 1HQEB 4ZIVA 3GFXA 5KFUA 3UO0A 1NDLA 2IVYA 2I8EA 1HWIA 1TL3B 4KV8B 1K73T 5K9FA 1XTZA 1PILA 3PX4A 3HVRA 3UN5A 2E7VA 3CDBA 4WE1A 3HSGA 1A0OB 5FDLB 1S9GB 3H20A 3JSMA 4WP3A 1YRXA 3N5FA 3G71S 2Q6CA 3OQ2A 2OD6A 3BV8A 3DLHA 4B3RF 4Y2AA 2X1BA 1TVRA 3PHEA 3LP2B 3R5JB 1U1MA 4BHQA 1UZHA 1KEKA 1GTHA 4N56A 2E9RX 5B0BA 1S77D 4BC7A 4BDPA 2D3OR 4JI2J 1WC0A 4DF8A 1JB0C 4DR2F 3IO1A 3LGNA 1RWPB 2QFIA 4MKVA 3NCQA 4DFPA 3QYYA 3M4XA 3BYPA 1HBMB 1WD6A 3AQOA 4C0OC 1CVJA 5LMUF 2MZRA 2J7KA 5FD1A 2HBYB 4B3MF 1T03B 2HW3A 3FUYA 1X7VA 4NX9A 1RBOB 2VFTA 2DNOA 4YS2A 1V9OA 3DM2B 1N54B 4M94A 2LU2A 4RW7B 2AYGA 4NCGA 4RNNA 1U1QA 1UA0A 1WOPA 3MR6A 1BE4A 3V6DA 1VC0A 5A0YB 4X4NA 3CJ3A 3VAKA 3O8WA 2QTWA 3AD7C 3KJNB 4RNFA 2YX7A 2LMIA 3IWXA 2KHCA 3HK2A 2YQ0A 5J2QA 1H72C 4DUTA 1UFLA 3GV7B 4NE9C 2EW9A 1NPKA 5DG8A 1VDHA 4RBVA 5BJRA 4BLGA 5IQQA 2UVUA 2XULA 3H2LA 1AYEA 3K5LA 1TKDA 4LR8A 1T7PA 3CMES 3PACA 1EKRA 2DH9A 4ECUA 1RCXB 1Y4ZB 5J2MB 2JFKA 4DZ6A 2VPXB 1X4DA 1SKUB 1GTEA 1QE1B 1NRKA 1QM9A 5HJXA 2YVSA 1FDNA 4JB8B 3M2RA 3DHXA 1TQLA 1WDDA 4URSA 1XN9A 4RUCA 3QRRA 2A6MA 4I64A 1U2CA 4QIGA 4AL5A 2W01A 1TKZA 1SV5A 1KVIA 3QGIA 3HFVA 3DRRA 2DNKA 2JWNA 2MQ8A 7AT1B 5KFAA 1JLBA 3D6MB 4WU2A 4N76A 1HMVA 4KC5A 3CEDA 1BWVA 2G1HA 3FEYB 4NLTA 4LT6A 1RZMA 3F73A 4W92B 3Q24A 4DV6J 2K3IA 1YJVA 4LUBA 4WIIA 1WC6A 2EFPA 4O23A 4LFBJ 3LGMA 5I3UB 2IFXA 3HT0A 1XERA 2RRBA 1WORA 1NDKA 3JB9k 3FFIB 3TJ9A 3BKTA 3H5YA 3RU0A 1TK5A 3BYRA 3KLGB 4NLQA 4C3LA 1LWFA 3PVXA 3VGTA 4USKA 4C8KA 3DOKA 1N52B 1YRUA 4ES3A 4GO5X 4CI0B 4Z7CA 1UPPA 1RTDB 2R7RA 2AIRB 3CCZA 4OX9J 4ENOA 1MROA 4BBYA 3ZZZA 4RBUA 4NCBA 3THTA 4I4BA 4Z7YA 1RK8A 5MAOA 3DRSB 4LIRA 3KYLA 1MMLA 1BHNA 3FBBA 3TUPA 3D68A 3I4HX 4KHRA 1UWBA 1UPMB 1SJQA 5E3CA 3HVWA 3BSOA 3CCMS 3LP0A 5B0AA 3TA1A 4KE5A 1UW4A 1UFKA 2B56A 3OTEA 2IC3A 1JX4A 4DR6F 3S01A 4NZ6A 3KHHA 1G1XA 1S57A 2D7SA 2P6SA 2Y1IA 2N4CA 1WHWA 4PXBA 3AODA 4Q5VA 2AHOB 4DR3J 2FVSA 4DMZA 3FZBA 3I96A 4YY3J 4CLFA 1YRTA 5D4LA 2CQIA 1BQNB 1MWZA 5KFJA 3OJSA 4BWMA 3OFGA 4JI6F 2Z2LA 5D78A 5LMNF 4JBCA 4IRCA 1GH8A 3NAIA 1FHTA 4O4GA 1U49A 1SL2A 1NUEA 3P5TL 4PKDB 4NYOA 4ZPAA 4RR5A 3IP0A 5BXIA 1BD6A 4QW9A 4KAIA 5F9NA 2WONA 1S1UB 3BGLA 1I94F 1RHRB 3JQJA 1BUXA 4Y00A 4LF9F 2OFGX 3SIPB 3LP1B 3MECA 4FS1A 3SCIE 1S0OA 3KJVA 1KVKA 1RAIB 3J80U 3TI0A 3VGUA 4ZK7M 4EZ9A 3Q8UA 1SKSA 4PG5A 2R7VA 4DL0C 2E5IA 2O67A 1U47A 1S6PA 2OGUA 3CULA 2RS2A 1T94A 3C8YA 3T19A 2KT2A 1X5OA 3IN5A 4UOCA 1AXQA 2DR8A 1PYTA 3OTOJ 1WI8A 1PSDA 2XLIA 1JNRB 3CO0P 4M5DB 1TR0A 4ED2A 4DS5A 3AQPA 5ITHA 2BDPA 2H5EA 5DLGA 1RAGB 1IJEB 3LANA 2LYVA 2PIIA 3DLKB 4ZCKA 4LSLB 2CVEA 1TL4A 1Q0NA 3H40A 1FDDA 1Q16B 3ITHB 1JWWA 5KFZA 4Z37A 4ECTA 2VG6A 2QMWA 2RNEA 1QTMA 4NLDA 3D6FB 2AKWB 4OFZA 3D6HB 3US5A 4XPCA 2KL8A 5HQMA 2BV3A 1HR0F 5D77A 1NBEB 4IFVB 2LKZA 3MPWA 5JVHQ 1LWEA 3KMSA 3MUMP 1E6YA 2DR7A 1M5KC 1YJNS 4F8RA 4MH8A 2E9TA 1VJWA 2DR5A 2XMWA 4TLRA 4NLRA 2HWIA 1H2TZ 4K4SA 3BPDA 5H9FK 3V6KA 8AT1B 1HNIA 2L48A 2MEWA 4USWA 4J9MA 2XWXA 5GMKa 5IT9U 3PIPQ 3KLFA 2GQQA 3OV7A 1LKZA 4A46A 5GADI 2I1RA 2XHWA 2P9EA 3MD1A 1OSCA 1IM6A 3EDRB 2EK1A 2BYCA 4RLEA 1U1LA 1QLNA 1H7WA 1I3OB 4NLWA 2YKPA 1I5OB 3CO9A 2CQDA 4I6WA 4UUXA 5DDRC 4GMKA 1R8CA 2VKZG 2ZWPA 4ILRA 2KJWA 3KHRA 1BQMB 4OZ0A 1IBKF 2XTJP 2HHTA 1KD1T 1RAHB 1ROFA 5LJ3Y 1WG5A 2HFVA 4X66J 2CQ4A 1HD1A 4NEYA 3J81j 1S49A 2HKEA 2MJNA 1F3FA 2QLJB 1HKAA 3MURP 3RB6A 3EX7B 3MEDB 3W8PA 1KRPA 1FRHA 1HWUA 3GG0A 3K57A 1PJ7A 1SC4B 1H6KX 3EUNA 1MU2B 4CH1A 4I2PB 3R5BA 3LWMA 1S6QB 2RF2A 3MOJB 1RT6B 1SQFA 1M1KT 3W8GA 2HLTA 4UY85 1WWHA 3JAMU 2HBRB 4P2SA 3MM6B 3QSYB 1VCTA 4DR1F 4ZOSA 1F5CA 2HHHJ 5MLCV 2E9ZA 2Y1LB 3BDEA 3ET6B 2AZ3A 3KHGA 3I9V9 2F4VJ 1NH7A 4WBFA 4EBDA 3I87A 4CNYA 3KWMA 1FRMA 3EM1A 1S76D 2FZGB 2F8MA 1MN7A 4DOZA 3OVSA 1FRJA 4PUOA 2Z56B 4K2XA 2Q66A 3EVMA 4JV5F 2BJ3A 1VISA 4AUKA 3T9NA 1VBZA 2DPIA 5THWA 3C15A 3L7PA 2RU9A 3M30B 4DI6A 1RWWB 2W9BB 2QLWA 4NLXA 4QBUA 2KDOA 4CH0S 4R0JA 3UDCA 3UR3C 5D3GA 3OL9A 1TFWA 3NGKA 3DLBA 4DPOA 1BXNA 3NMRA 2C3PA 1JMTA 3G96A 1G2EA 4EO8A 3BQ1A 2RMLA 1UEKA 1WEYA 1RCOB 4B9LA 2M0GB 3IBWA 1R27B 4E0DA 2N3LA 2BJ7A 4UW2A 1S6UA 3C19A 9RUBA 5CCLA 2OEMA 4QR1A 3RTVA 1U45A 3I0RA 2C2OB 2C22A 1NJYA 2V2VA 2POKA 4CO4A 1O8BA 4PWWA 1VS3A 3GIMA 1M5HA 4DSKA 1YK9A 2O5DA 1B70B 2YNGB 2CYYA 1IKXB 4FF3A 3NRBA 2KXHA 3DNCA 5F8NA 3AB4B 3ICLA 2XS5A 2QIFA 1VHIA 3PR5B 5CA5A 4C8YA 1T05B 2B5JA 2B4PA 5A8KB 3PJXA 3J7ZT 2FVCA 2ZJQQ 4GVBB 3OR2A 3OBIA 5I42B 3V2UC 2V68A 4LSNB 3IRXB 2BW7A 1FKPA 4NA3A 4I0WA 4Z2XA 2RH3A 5KFWA 2Z0GA 4RU9A 2ROPA 3IS9A 2R42A 2BQUA 2XI3A 5IM0A 1RLDA 5J2NA 2ALZA 5HANA 2XCPA 4K59A 4KB7A 2I5JB 1OO0B 1TUVA 2FY8A 4OZ3A 2F5GA 4RW9B 2R9LA 3IR5B 2RU3A 1J27A 1NAQA 3CC2S 3ZTRA 3BGRB 3OR1B 2KN4A 4DV5J 4A8FA 5CZXA 2V63A 2J6UA 3A8EA 1O5JA 1G3OA 4OZ2A 4FXDA 3L4BC 1HNWJ 5CQGA 4FPRA 3IXQA 4OI6A 1FNXH 2OPQA 1VQOS 2AMCB 4NYZA 4JI2F 4WZQA 3KK1B 5DZ6A 2X3DA 3NGUA 3LA0A 3FKBA 3K8VA 3L9ZA 1TL7B 2HURA 3CUNA 2GHVC 4DQRA 2OPPA 2W7PA 3K59A 1QVFR 2IY5B 3HHDA 1VBYA 3CGIA 2M9KA 2RILA 4DLEA 4ED5A 1VQSA 1N4LA 2VDIA 3TZYA 3Q89A 4K5RA 3HKZD 3NG8A 2J7WA 3H2UB 3VAJA 2V67A 1VOMA 2EEYA 2J0WA 2HPUA 1S99A 2EWHA 3KUGA 4GKJJ 2YY3A 3SMZA 1HLWA 2YKOA 2X1FA 4UOHA 4AYBD 4DSEA 4ZPWR 4OX8A 4KTQA 2R7OA 2QL5B 3DRPA 1D9DA 3PO4A 2LLZA 4IOCQ 4QPTA 1UWAA 3MD3A 3HHLC 3M8WA 3KKFA 3IAS9 3VGSA 1WI6A 3PO5A 2K1RA 2Y8YA 3DLGA 7FD1A 2DHGA 1HL6A 5AE3A 3C16A 2DNLA 3MPDA 1XJWB 2JVOA 4LFCJ 3D3CJ 3E01A 4NYPA 4LF5F 1UEVA 1NJIT 1DLOA 2DISA 2Y0SD 4DG1B 1JLQB 3H4BA 3NWRA 2KYXA 2CQ1A 1VBKA 2ZOGA 4XO0A 1CS4A 4H54A 4H4OA 2HQIA 3SSSA 2HFOA 1DURA 3EE3A 3PW7A 5HLFA 5EWGA 1YJUA 5HL7Q 1RB0A 1RHJB 4C11B 3MM8A 3HF5A 4ELTA 2DCUB 4DL6A 3ETMA 2P8IA 2BW2A 1OY9A 5KTQA 1DTTB 5KFOA 4JI0J 1T9WA 4I67A 2VBWA 3GFYA 1WOSA 1R7IA 1D8ZA 1N88A 5KFIA 2V34A 2V8PA 3E2EA 3D1HA 4NXMF 1AUDA 1WHXA 2GAGC 4OMFG 1N6QB 3JTPA 1C4AA 2AP6A 4LFBF 2KVIA 1K0VA 2BR0A 4ICLB 3V4IB 4M5GA 1FJGJ 4B9TA 3QAEA 2VONA 1UAWA 2CA9A 3IFEA 3I9ZA 3CCRS 1F3VA 4XIUA 4DFJA 2F40A 2BUNA 4F4KA 3K89A 3NWGA 2XYGB 1XR5A 4FN5A 4IFYA 2UV8A 2HVHA 3V81B 5J1EA 4JI3J 2ZE2B 3B4MA 5KFGA 1XNRJ 3HSDA 5ADZA 4D3GA 2FYXA 4OX9F 2A18A 4U6PA 3MFHA 2ZBQA 3OSNA 2OI2A 1X4AA 3MM9B 4TU9A 1IKYA 1Y3JA 1Z4UA 1Z2ZA 2ZEJA 3MPUB 3ZNJ1 3KK2A 2XWYA 1SIWB 2IBOA 2F1FA 2L41A 2NXCA 5F9LA 2P9GA 4ECYA 2HRUA 5C25B 3T5HA 1QE1A 2OKQA 1IKVB 1NU4A 1JLEA 1C0TA 4J9LA 2HGLA 4OZ1A 4CLLA 3DRXA 4OYWA 1FX4A 3BSAA 5L1KA 2EFOA 4EU0A 3Q8RB 4G3IA 2XMVA 2UU9F 3RW6A 1X31C 4B17A 2HQFA 1IBMJ 1MWYA 4YY3F 3LH2S 4CDIA 1L3UA 1K1SA 2B43A 3PEJA 2VH7A 3FGVA 4J90A 2HEKA 2C1EB 1FFSB 3SDEA 3RBZA 2R7TA 1XQIA 1KQFB 3CJKA 1NB2A 3W65A 3UN2A 1Q5YA 4XAKA 2EG1A 4ZJQA 3UN3A 4ED6A 4R5PA 3HLUA 2JHEA 3GG1A 1R8HA 3UR0A 4DQIA 4LF4F 1UL3A 1UJ6A 1NSKL 1YIJS 1CC7A 4ITSA 3FFIA 3CT9A 4WTOB 3W66A 1BQXA 2LECA 1ZH5A 1V3ZA 4YR3A 1CJKB 3IG1A 3ENQA 2XLJA 1M5OC 3OHAA 2WVBA 3PFEA 3JYTA 2HYIB 2WZ1A 1ICEB 3C14B 3KDNA 2ABYA 2LA6A 4QWBA 1YZ6A 1N56A 1C0UA 4TU7A 2XQCA 2U2FA 3JS9A 5KG1A 4OYZA 2BKNA 3DRSA 1LWCA 5A8RA 2W7AA 2G0CA 5CD4A 4HHJA 3T1AA 3M1VA 3OTDA 4O44A 1CSJA 4P2XA 3IBCB 2KKHA 8RUCA 1RA6A 5E7OB 3ILLA 3Q23A 3PKYA 5DQHA 4HI1A 3R97A 4X84A 2W2NP 2QL7B 2OTLS 3D66A 2M70A 2IRYA 2WSEC 3GYGA 2CWKA 4DPXA 3UDLA 4MYUA 2ZDPA 3NEKA 1VK3A 3O44A 4CO5A 4O3QA 1PJ6A 1H98A 2BOPA 2NREA 5KT7A 4C2MA 4K0KJ 4ANDA 2HVZA 4M5LA 1IR1A 3POTB 3SBMA 5KT6A 2R8JA 2IVMA 2WAQD 1ZPVA 4MKBA 2KZZA 1V5IB 2CFXA 3G6YA 1FI4A 1IKWA 5E3QA 4MTPA 2F4FA 2NYIA 2XCAA 3DU5A 1CBKA 2X3GA 2XSJA 4G6VB 2RS8A 4X64F 1R43A 3HJFA 1W2IA 2J8SA 2B9EA 1C1BB 3G9CA 2UP1A 3BGUA 1LK7A 4CZCA 2BX6A 2H65B 3M9MB 4C4WA 1S1WA 4GC6A 3ZXWA 4C0HA 2QT7A 4TY8A 2PDAA 3QWUA 3RAXA 5GAEI 2CQCA 1KONA 4FXWA 4L76A 1U09A 2HQDA 1GMVA 4RL1A 2B9XA 2QA4S 1V3SA 1LW2B 2HS0A 2YKNA 4DV1J 2DO0A 4NMXA 4B9VA 4N5SA 2OTJS 1VQ8S 4XTTA 2DXDA 3GZ7A 4ER8A 4X66F 4ECQA 3NLCA 2WHOA 4OYAA 1X5PA 2PA3A 1M5SA 2YXLA 4WE1B 2IAJB 2K06A 5B0EA 2Z57B 2X51A 1NK7A 3M8ZA 3JSMB 3FSXA 2CZ4A 1HIYA 2AGPA 1QJHA 3QT8A 2XNRA 1SC3B 3RGIA 2RDJA 1DBDA 1TVRB 1HYSA 2RKIB 4ED7A 2MZTA 3CJ5A 1D9FA 1J5EF 3CXCR 3AT1B 2LXFA 4ID8A 3GJTB 3EGZA 1FK9B 4OJGA 4X4VA 2XY7A 1SQGA 4DV2J 2VFVA 3NGSA 1RBLA 3WHIA 1U1PA 1LV5A 4ZCIA 3HZEA 2HGNA 1K8AT 3QWPA 5IZHA 4ZLPA 1X4CA 4QJVA 5D0HA 2E1CA 1RTZA 2F3JA 5T14A 3MTKA 1CQNA 1RI7A 2CPEA 1DQ9A 3EGNA 5J1NA 2Y8WA 4CRJA 2Z58B 4U96A 1N34J 3G4SS 4TVAB 4O3NA 2RDIA 3BBCA 4NXNJ 4NCGB 1N5SA 2EPIA 4WKYA 3DOLA 3V6DB 4KQZA 1X5TA 4A8XA 2IMOA 3OVBA 2GGPA 5HBMB 1QUVA 2R2RA 3B6BA 3MM7A 3JSRA 5KG2A 1Y5IB 1RTJA 5KFYA 1BQMA 4TXSA 2KRRA 3KG4A 2L3MA 2BBEA 2XMTA 2ZVIA 4PG7A 4KR0B 5KFFA 3S1TA 1RU1A 1QY7A 2ZJRQ 3CDWA 3UWTA 3LAKA 2MZJA 3R7NB 5B08A 3G6VA 5A6PA 5IQ6A 2Q43A 4OZLA 4W98A 1S5ZA 2BQ3A 3AH6A 2V8VA 1S79A 3GR0A 3SCJE 2VV5A 1REVA 5KT2A 4ZVPB 4DCPB 3JSYA 3Q2SC 3M2RB 4RX6A 5CYQA 5EDWA 3DRYA 1JXEA 4CO1A 5C42A 5DO2A 4C8OA 2CNNB 3AXMA 4F0MA 2OSRA 4G1QA 1H2VZ 1QTNB 2E5LF 1AW0A 2OPRA 2E5GA 5HATA 1JLBB 1N0UA 3GTYX 1HMVB 4U9RA 2HFUA 4IRKA 5HAOA 2BVZA 1QAYA 3QLHA 3GIRA 4X4PA 1J2VA 2B9WA 1ZTWA 2HNYB 5HSPA 5DG7A 3F41A 5HMYA 3BEGB 5IWAJ 1B7FA 3J7YU 3JSBA 3UCGA 1P1LA 2CDQA 5LJ5Y 3JTOA 1DQAA 3IA0A 3FRYA 3D5MA 3EPIA 4A8KA 5D4NA 1TUGB 2AYMA 1T9XA 3HD1A 1NK0A 3JXOA 4Q45A 1SL1A 5HMZA 3LWLA 3R6LB 5F8JA 1LWFB 2CQHA 4I69A 1EZZB 3DOKB 1LOUA 2NZ4A 4JI4J 1KVJA 1SUQA 3G6ES 1RWKB 1WUUA 5DRKA 4KRWA 2MQQA 2XC9A 2FLLA 2KJVA 1RT4A 2YX1A 4ED1A 1ELOA 2PN6A 3UD3P 2UXCF 4I1TA 2GJ2A 2FJEB 1IBCB 2V6AA 1GFWB 4O3PA 4IKAA 3MCSA 2MKCA 4K8RA 4P2MA 3LP0B 3EXYA 2E1PA 2HWTA 3M8QA 3R7BB 2GVDA 2IC3B 3N6NA 3H42A 4F67A 4YUDA 4M8LA 2FTRA 2R8IA 2ZM6F 2AX0A 4C48A 3CDUA 5G0RA 5I42A 2B8QA 4WZMA 2D9OA 3MPVA 1TV6A 1PBUA 3VGVA 4HYKA 4M5MA 5FLXY 1OYDA 2XS7A 1IUJA 2CJAA 1IJFB 2CWXA 1X9WA 2VICA 2NYHA 3HULA 2JLGA 3MGJA 3VQTA 3G86A 5LT5A 1KN6A 1Q79A 4PQUA 2Z2YB 4O4GB 2A2DA 4PABA 5GAGU 4LFCF 2V0NA 2FVPA 2V5HG 4DR5J 1S9EA 3W2WA 3VVTA 2G2YA 2G0JA 2HHWA 5GMEA 1HFEL 1OQ6A 1NCLA 5JVGQ 2AJ0A 1Z2LA 1RA7A 2DGWA 1FE0A 4HHUA 4WYWA 1T3NA 4PRFA 2WONB 4AL6A 2B4OA 3NY0A 1HNZJ 4ELUA 1EP4A 4AFFA 1N33F 2N3OA 5K14B 3MECB 3RBXA 3O2IA 3TJAA 1KFSA 3KG1A 3W60A 2W9AA 1XWLA 5C7PA 1VGYA 1S6PB 2RQMA 2XHCA 2CJBA 3WC0A 4FKXA 1D9AA 1TL7A 4V19X 1VQPS 2HGMA 4IDKB 1IBLJ 1WELA 5LOQA 3T5LA 4PG8A 3WIVA 3GPAA 4DDFA 5AXNA 1PYOB 1FJGF 3CCLS 2MQLA 3A3NB 3MMCA 2CG8A 2CPZA 1GMUA 1WEXA 5E41A 4J37A 4EEYA 2VG6B 1FT8A 1V6HA 2LXUA 2GS8A 2QA2A 3MR7A 4B08A 2YKAA 1RKJA 4NI2A 4YQWA 3KDOA 1LWEB 1E6YB 2W2QP 4CLUA 1RP5A 4M95A 1FJCA 5IOLA 2ATCB 3VZIA 1N32F 4PG4A 4JI8F 2GAHC 1ZAVA 2UUTA 3D7SB 3QO9B 3W5ZA 1Q7YT 1JLQA 1HNIB 3A4TA 2AZ1A 5K8PA 2QV6A 2WSCC 3MAAA 3BKUA 5HO4A 1R31A 4DHVA 1Y5NB 3MOZA 3KLFB 4LF6J 2O3DA 2AU0A 2AW0A 2E66A 1MMDA 2DITA 5B0DA 4RNOA 1SQEA 4DPTA 1HWKA 3AHPA 3SYZA 4EO6A 5KG3A 2Q6BA 4C11A 4QR2A 2MQNA 4R25A 5BYSA 4XDDA 3QJPA 2VQEJ 3SEOA 1B3TA 2DR6A 2GMLA 2DRDA 3HHLA 1X4EA 3R6GB 2V8GA 3T1HF 1WTBA 5AE1A 5KFQA 1M1GA 3DYAB 4C8ZA 3BH7B 5KAKA 1X4BA 5IFMA 2VQFJ 4EBCA 1YQHA 2QLXA 5BR8F 2MKSA 4DCOB 4DR7F 4LF8J 3FBCA 3E3XA 4ZVFA 1LW0A 3RJMB 3HKWA 2AGOA 4JYAJ 4WFBQ 3GV8B 3OTCA 3M9NB 2H1YA 3ZFVA 4OZNA 2NSCA 2WOMA 4RW4A 1U0SA 4FF1A 3PV8A 1OMSA 4HT5A 3A12A 3CJRA 4ZITA 3H90A 2ATLA 1OIAA 4O4RA 2GJFA 3W5YA 3KK3B 2RF2B 2RHQB 3QT7A 1R89A 1TK0A 2EXUA 4CIOA 3NL0A 1UW9A 5DZ7A 4ZHRA 5SZTA 2KTQA 2VBXA 1GQEA 2V94A 3L09A 3BO3A 5E3AA 4QU6A 1NDPA 4CLZA 4FYDA 2V8HA 1ZM4A 4FBUA 1JNZB 1N36J 1JJCB 4DV4F 2U1AA 3CNQP 4PUOB 3IRWP 2ZNYA 2F65A 2J8AA 3W1YC 1K47A 2DGVA 3U1NA 1NHVA 2P5VA 5AJ3J 3C15B 3HSJA 3VHQA 3K5NA 1R0CB 1KQSR 1G7CB 3I5CA 5ETKA 1JLAA 2MSTA 1F9EB 5D3GB 5HK4A 2WVEA 3NGTA 1FRIA 5A8WA 4F7VA 4KO0A 3AOBA 2CPYA 2OD4A 3L95X 3CCQS 2M8DB 3MZIA 2OP5A 5KFVA 1ZM9A 1WKLA 4RW6A 1KQGB 2UUBF 3R5DA 2PMWA 4K0KF 3PX6A 2Z2ZA 3UQSA 2BACA 2FHMA 4LRCA 3UDVA 2ALYB 2OHDA 1N5YA 1W26A 2A10A 2GO8A 2P6TA 3QIPA 1RT2A 1FWPA 1RQ0A 2M5YA 4A8QA 2HHQA 1BC6A 1UVJA 1NMEB 2XMUA 3I0RB 1XMQF 2CQ2A 5FJ4A 2XY6A 4P7TA 2R7SA 3MPYA 2IM3A 2MGZA 2CKWA 4I7FA 4R0EA 5C24A 3FK4A 2HZAA 3H8YA 2ZITA 2CVIA 1TMMA 3HHLD 3JQKA 5KFCA 3U1MA 4Y65A 5L8RC 2CG4A 2IDEA 2NQPA 4ZJOA 2XB2D 2B5JB 2J9DE 4LBIA 2C2NA 4DX8H 1G6BA 1PCAA 3B8HA 5B7WA 1XBWA 1I51B 4NWBA 3RAMA 2ZJPQ 4ID5A 2FLOA 1BMQB 1FKPB 4NOHA 2OIHA 2DNPA 2F8EX 4HHHA 3K58A 4K4WA 2BE7D 4DV1F 1BY9A 1RHMB 2R3VA 3IS9B 1RAEB 2VFUA 5IM0B 3CC7S 5KFXA 2DH8A 5J2NB 2ROEA 4F0HA 1RAJA 4NMLA 2MMYA 2XYPB 4HH1A 3JTNA 1FDAA 2IRXA 4RZRA 5KFEA 2QRRA 4J9SA 1I1GA 1FFWB 3THPA 4GKKF 4H4KC 3A13A 2EBGA 5HQLA 3RRHA 1SJ3P 1N5QA 1FO1A 2NXEA 2V9KA 2DBBA 2QZ8A 4YHHJ 4RWXA 2Y1JA 2FLNA 3IGNA 1YLXA 4FYWB 2FC8A 4CYUA 2Z30B 2C3UA 1NKBA 3FCVA 3I5AA 5HROB 2OPQB 3MMAA 1URNA 4LMZA 4E8UA 4ALZA 2Y0BB 4UZCA 1FWLA 4OYPA 1FERA 1GAOA 5IC4B 3DMJA 3HHKA 2PI5A 4LBHA 2DIVA 1HNXJ 1W2BR 4URGA 2EC0A 5K8MA 3H4DA 4QCLA 1S1TA 4M5NA 4EWTA 3BGFA 4DQPA 3TZWA 2PMZD 1JXVA 1WHVA 4XK8C 1SCJB 2CNKB 3TVYA 2WK4A 3G82A 4TNOA 4LFAF 2A6OA 1PG5B 4MIAA 4W4MA 4RNHA 4N41A 2VJUA 1DFDA 2KXFA 3KJFB 2HBZB 5RUBA 3BO4A 1XNQF 1FTCA 1C4CA 2VKRA 4A47A 3GYNA 1YZ7A 2L08A 2J0SD 1UVKA 4DWIA 3UE2A 1MW7A 5LL6d 1RT1A 1UVNA 3GU0A 4U8VA 3WDOA 4EI2A 2C2RA 3DRPB 1XR6A 2HAFA 2G0IA 1RT5A 3K2YA 3OXFA 4NRUA 1AZSA 1A9NB 1B0PA 4ZVQB 2AWZA 3OT9A 4CQ1A 3GCXP 1NPPA 3EPGA 2K1RB 5CHCB 2CPXA 3DLGB 5LXYA 2CJKA 4K4TA 4JI5J 3DDIA 3RR7A 1HWLA 2VZ9A 4HR2A 3UDEA 3C16B 2IJNA 2AX1A 3CJQA 4KKOB 5L1JA 2DGSA 4IRDA 2BRLA 3E01B 2IAJA 3PRVA 1SKRA 1JIHA 2VG7A 3NNAA 1DLOB 2RUGA 2MSSA 4QZVB 2QMUB 5LXRA 2JEFA 3NGRA 2LQ8A 2ZKTA 1T11A 2XZTB 3QBCA 1CS4B 3GIIA 2UXBF 4H4OB 3PW0A 5KFRA 1FX2A 2FHKA 2RKIA 2FHJA 2CPHA 1WSRA 3CJ0A 3ZZOA 1SJ1A 1D0EA 4DJBA 5HLFB 2BRKA 1RADB 3MM8B 4DV0J 5D0EA 1FK9A 4RKUC 4B3SF 1TAQA 1S97A 4O3RA 4CCHA 3NS7B 4IYQA 2AJ4A 4ETXA 1H7XA 3FQKA 5F3ZA 3J7Z5 3QT5A 4AQYJ 1AB8A 4DQSA 3N6MA 3R2CJ 1VMBA 2R2TA 1HBOA 3VQSA 3B54A 5IWAF 1NPRA 4J9PA 2DNQA 2KZMA 2CQGA 4ZPVR 1X60A 3I82A 1RXOB 5EX3A 1MMNA 1VQ5S 2XMJA 5L46A 2W8LA 5HBMA 1X4GA 3LO3A 3CJ2A 4IFYB 2D1CA 5J1EB 1HQ2A 2JOQA 1CC8A 3CF5Q 2GMJA 1FXLA 3BPSP 3M6WA 4N7TA 5KFHA 4NEZA 3I5BA 3TAQA 5L9NA 1JLFA 3QRQA 4ES1A 4DV3F 2RRNA 1B99A 3ZZRA 2KXNB 1KOOA 3BGOP 1HBUA 1NO8A 3H5SA 4B3RJ 2CPJA 4DN9A 3F44A 1IKYB 2GFFA 3K0JA 3KK2B 2UUWA 4ECWA 2FJXA 2DJWA 2WBRA 3HCXA 1PC5A 4DR2J 1KSPA 2APOA 1ZZFA 2N7CA 2JX2A 3PW5A 3M8PA 5DDPC 4JI1J 1FRKA 2CQ3A 2HAIA 3MEEA 1JLEB 1C0TB 1DJ0A 3NNCA 1RWVB 4KH0B 3RBEA 4FZVA 5LMUJ 2UVVA 3C3LA 3MEGB 1VRTA 4NA2A 4KY3A 5F8LA 2DVIA 1QAIA 3KLIA 1RGVA 1RLCL 1R8BA 3FSYA 2E44A 3PXGa 1PO6A 1NZAA 3PTWA 2YTCA 1AUSL 4ZVTB 1PGZA 1SL0A 3SDEB 3J7A1 4ZP7A 4I6AA 5DDOC 4LF7F 3CJKB 1M90T 4OI1A 4KFBA 2R7WA 2V9WA 2HNYA 2JFDA 2FHJD 3FEXB 4OQJA 4O3SA 4N77A 4R5PB 3M05A 3NBPA 5FLXU 2XMKA 2WVDA 4P74A 5EGYA 3VALA 1TU0B 2RQ4A 4ECVA 2ZH5A 3DGVA 1HNZF 2HFSA 5DS7A 3IG1B 3W61A 1YJ7A 3ETOA 3AA9A 4DV7F 3JYTB 3DCAA 3RUBL 2J0XA 2JLFA 2V8DA 2K8GA 1C0UB 3OXGA 3PRBA 4LR9A 3NOCA 3FBFA 1U6BA 1E6VA 4JV2A 1IXKA 1LWCB 1IBLF 3PRDA 2HS3A 1D1UA 5A8RB 1QDUB 4WIQA 2DRBA 2AJ1A 2NUHA 2BEFA 3D0HE 5KFMA 2X1GA 1MWQA 1FA0A 5CCMA 4M5HA 2ZUGA 3M1VB 4O44B 4YB1P 1S72S 2FHOB 3A3PB 5D0GA 3H7HB 2B6AA 2N7YA 4DFMA 5ETNA 4Y28C 4J9RA 4ED4A 5F41A 4EUVA 1HARA 4WF9Q 3DDKA 2QYGA 1KTQA 2CJ9A 3KLHA 5EWFA 4IUFA 5DQGA 3TWZA 2RB7A 1WF2A 1NNDA 3IBFB 2F9JA 4WFNQ 4FNHA 4FYYB 2CPFA 4DU7A 2XSFA 2EFGA 2KYZA 2QFJA 1QAXA 2LQ9A 2VODA 3SZ2A 3EWGA 1HNVA 4AT1B 5BYRA 5K20B 1IKWB 3DXBA 4FF4A 2C2MB 3QIDA 3NP5A 2VD3A 2KU7A 2XSJB 2PEHA 3GE9A 3PHTA 1EIYB 3KNAA 2NPIA 5KFKA 2LXIA 4URQU 1TKXB 1FFGB 3F56A 3KJQB 4L6V3 1FESA 1EHWA 1NXIA 4X65F 3P49B 1EAYC 1FEEA 3DU6A 5K14A 1S1WB 2CXEA 2V69A 4C97A 1Y9OA 3A8JA 1O51A 4NLUA 1ZM3A 4TY8B 2XO7A 2EFQA 5L39A 3CB4A 3ZO7A 3MR3A 5CXTA 2VFRA 3PEHA 2LEBA 2ZH8A 3K5PA 2YKNB 4F3OA 4IDKA 5HMWA 1SIZA 1Q53A 2LU1A 4DR6J 4NPOA 3QFHA 2ZWOA 3I32A 3DDNA 2HVDA 2P9CA 3ZTSA 2WVFA 3CW2C 4UOFA 3AD8C 2EG2A 4I56A 4PPDA 2ZH9A 2FDNA 3P5BP 4OI0A 1GEHA 3HVTB 1NDCA 4JI6J 3H5UA 5LMNJ 2WVCA 3QMQA 2ZH4A 2FGCA 3U02A 5D8HB 2M4MA 3AJDA 3I6PA 1HYSB 1KR4A 1VLYA 3WZ0A 4OLPA 2VJVA 4KGXB 4DUZJ 5GADU 4ES2A 2ZHOA 4ZLLA 4K4VA 4QIEA 2LQJA 1FWKA 2CQ0A 3UD4P 4I68A 1OPIA 1Y7PA 3GFHA 3HHNB 4JI7F 2FVQA 1WHYA 3CD6S 4KGVB 3MR5A 1YITS 4LF9J 3ENWA 5LSRA 4CO0A 2BJ9A 3QO9A 4Y34A 1WG1A 3CIZA 2MHEA 2FIUA 5I3QA 2MB0B 2WBMA 2J76E 4WP8A 2OH2A 3M8SA 3OLBA 2B7CB 2H3EB 3J81Y 4ZS6A 2ZBPA 3BJYA 5HMXA 3MTJA 2L9NA 3A8IA 4P72A 3DOLB 2VBZA 1OY8A 3RB3A 2GGPB 2NUUG 3MM7B 2MDAA 1VQNS 5CABA 4Y0FA 2OFHX 1ZS6A 1RTJB 1WDTA 2HG4A 3TUJC 3N0VA 3O3LA 1RACB 1AT1B 1U2FA 3MM5A 2GCFA 3DYAA 4U67Q 4C9DA 2DCLA 1FRLA 4WJBA 3SSRA 4CO3A 1HQUA 2ZZNA 4ECXA 4FVMA 1RSCA 1U6FA 4NLGA 2HFNA 4CH7A 2BZ2A 2OPSA 4KHMA 1SH2A 4EFAC 1HR0J 5E3RA 1S7HA 1BWEA 4QYRA 1REVB 4RNMA 3AY0A 3OHBA 2X7IA 4HDHA 5CYQB 5B09A 4ECRA 1YGYA 1D3WA 1TL1A 5A6WA 3KK3A 6FD1A 1IN0A 3S8SA 4M5IA 5C42B 4X4RA 4PXDA 2GVZA 2HMIA 5HP1A 4C0BA 4G1QB 4CT9A 2DEIA 3A8KA 3CTRA 1KDNA 2OPRB 3UVJA 4HKQA 2UXDJ 5FIIA 4LF2A 2I38A 3E8OA 4NASA 1HI0P 2QN6B 4CP5A 4WK3A 2E1RA 2ROGA 3QLHB 1VRUA 2CDRB 1S59A 2W9CA 2YQ3A 2YWFA 1QVGR 4WFAQ 3CC4S 1RWMB 4NLPA 3PNIA 5CD4H 2UUCF 4P52A 2ZDOA 4MKAA 1N48A 1TUWA 4XPEA 2VBYA 1U26A 1IBKJ 1XMOJ 2HK2A 1X9SA 2HNZA 4A48A 1VBXA 2YKMA 3CWJA 4C8LA 4H4MA 2H51B 2ZD1A 3NNHA 3CJSA 2HS4A 2KM8C 2ASLA 4OZ5A 3PIOQ 2CNLB 5IT0A 4F0KA 2DEJA 1SUQB 2H48B 5AE2A 2FQQB 2HHXA 1ACMB 1H2UX 5D15A 3EXCX 3KUHA 2V4RA 3F0NA 4J91A 5AT1B 2CZVC 3R9LA 1JLGA 1RT4B 3I0SA 2HVIA 2MJUA 3NKYA 3HHEA 4IG0A 1F2HA 4DR1J 2J6SA 1YJWS 1R0AA 2ZOFA 4CM0A 3GYXB 1K44A 3M8QB 2GVDB 1RAFB 2JL9A 2M2BA 1U4BA 3K17A 4QQBA 1RKIA 4USMA 2YNIA 5G0RB 3W62A 4CLYA 4J7CA 5F8GA 3EICA 2C3YA 4JV5J 1TV6B 1O6XA 2BOAA 1SC1B 2GMHA 5ETLA 1BGXT 4Q8FA 1VQ9S 3DGPA 1UVIA 5JUMA 2LCWA 4A8MP 4OI2A 2Y3YA 2MLZA 1WF0A 4YR2A 4PQUB 4U95A 3CVKA 3M6UA 2ILYA 6FDRA 2AJFE 4FDFA 3IAM9 4C6AA 1Y5LB 2RQCA 1S9EB 3W2WB 1Q78A 4TN2A 2RJZA 2FJAB 2B3TB 1T02A 1RHQB 4CLKA 4DZDA 2DNGA 3E51A 1DARA 1EETB 1RTIA 4QW8A 5ETPA 4P9SA 3PY8A 3FQLA 4ZP9A 1EP4B 3FMBA 3RW7A 4PXCA 2W4DA 2B4UA 2KVQE 5C5JA 3BF4A 3W2VA 3CCVS 3LF0A 3MUVP 5HROA 2XMAA 3OUYA 3GJRB 1RE1B 4FBTA 1RHKB 2RDDA 2KI2A 3D4JA 3FSIA 2RD5C 1PIEA 2V2QA 1IQTA 2ZBRA 2OLWA 5GAHI 4JP8A 3RZAA 4AL7A 4IG3A 1KOHA 5D4PA 4M5KA 2RUSA 2ZC4A 3QAUA 3KLEA 3LUYA 2IA6A 3PZPA 3MMBA 2DK2A 4H4KA 4FF2A 1AA1B 3QZ7A 3OFHA 3MMCB 2XEXA 4WXOA 2DIUA 3U1LA 2IYIA 1KP6A 3OJUA 2KFNA 1S6OA 4DPWA 4RJVA 2N82B 4LF1A 1WC3A 4E98A 1F6TA 4G1IA 5LSOA 2DXEA 2O1PA 3LPYA 4EZ6A 4DEZA 4MK8A 5D0RA 2ASDA 2BMBA 4C98A 1RABB 2BJDA 4NI2B 2PFFB 4BS2A 3M8RA 5J2PA 3EZ5A 3GB0A 2QLBB 3AOAA 3ZTOA 2RE1A 1YBUA 4KKOA 1Q7LB 1NKEA 1CJUA 2E29A 1S0MA 2DNRA 4HL9A 1YVFA 1JKHA 4F36A 3MAAB 3P96A 4C8NA 4ED0A 4HACA 3ISZA 4JI1F 3IC1A 5CAAA 1ZA1B 1ZTTA 1Q8LA 3PW4A 3CCTA 3TARA 4XDCA 5HVFA 3MFIA 2UV8G 3R1LA 2DO4A 4EMDA 1Q95G 4X4TA 1YJTA 5H9EK 4TYBA 3K5OA 2XI2A 3M8YA 4B3TJ 1RDRA 1TELA 3HHLB 3MI7X 3W63A 1BLUA 3H5XA 5HVGA 1T0TV 3P3DA 1KHVA 4DV6F 2FJBB 1VIXA 2DNZA 4ECZA 3H0PA 2EC2A 4USHA 4WFZA 3Q0AA 2K7JA 5ETMA 2XGPA 2NCKL 1LW0B 2DNYA 3N79A 1K1QA 5ETTA 2WOMB 4RW4B 5D4OA 4Q0BB 2NR0A 2JVRA 1B4SA 3Q86A 3KLVA 4DR4J 2OELA 3QRPA 2ZBCA 3SV3A 1X8DA 1F1BB 3UCUP 4A8SA 5IV4A 3M2VA 3H98A 2R2SA 4R8UA 1NK8A 2KO1A 3G8TA 2FPHX 1KLNA 1S1VA 4A8OA 2UVRA 4LF5J 4B9SA 1SH3A 5KFTA 1CJTB 4C8MA 4ZHRB 5I4MA 4OLOA 4ANCA 1S7IA 3T9ZA 4CO2A 4UOGA 4IO1A 4E2FB 2LVWA 1HPZA 1P6TA 2MZ1A 2ASYA 3A3OB 1R0BG 3PW2A 2MKKA 2PEBA 2R7XA 2RRAA 4U8YA 2FZCB 3RAQA 3N5BA 4HTJA 4OHWA 2RIJA 3MUTP 4WK1A 1N5VA 4CNZA 4TY9A 3TR5A 3KOAA 1GK8A 3HFZB 3NS5A 2MTLA 3ZZ0A 4YMEA 1LEOA 2QO3A 3DN9A 1XIQA 5E3PA 2GV1A 2QMXA 1F9HA 2DYAA 4IH5A 1JLAB 1KHWA 3MEGA 2ZFHA 4PYAA 2RT3A 4NXMJ 3X3UA 4PG6A 1LFPA 1S10A 4HH0A 5A8WB 4DR3F 4NLYA 4KO0B 2DXFA 2H5IB 4N47A 3TUZC 2ACMA 2M52A 2P2CB 4P2FA 3BQ0A 4F04B 4RW6B 1H3DA 3HSZA 5KFBA 3PYFA 1UVLA 1L5UA 3RR8A 4ILLA 1NJZA 1N5YB 4NL5A 2ZHAA 2XG8A 4EBEA 1ITPA 3QIPB 1RT2B 4CLSA 1OQ3A 1RWXB 5JJBA 4M63A 3OW2R 4P6QA 2MLXA 5CYMA 3SQGA 3ZTQA 5A2QY 2MGZB 1T3OA 4I7FB 1QSSA 4G65A 5C24B 5EN1A 3HD2A 3TAMA 2A0FB 1GX6A 2X1AA 1KS2A 3LOUA 3MMJA 2E1AA 2WB4A 2IA0A 1YDLA 2VASA 3TYTA 3LALA 1YI2S 3IWNC 1Z1ZA 4ZDNA 2HHPA 1TAUA 5B0GA 2DT9A 4WXWA 2MQOA 2A2CA 4ID5B 1WKKA 4KYZA 4J9QA 3BM7A 3K5MA 2ILZA 1Q86T 1NSAA 3OTOF 2MKYA 3EGVA 1VQLS 4EGLA 3LPEA 2UU9J 3SXLA 4TQSA 4NZ0A 1CULB 3VVUA 1C1CB 3GR1A 2DD8S 5JXSA 4ZVRB 1HW8A 2MKHA 2HZVA 4CYUB 1TTHB 4DCJB 2E7WA 4ZPCA 4N8OA 4P71A 1WACA 3IR6B 3C6TA 4DUZF 2VC1A 3MMAB 4LF4J 1RT7B 4OI4A 5DJBA 1F2GA 1KKHA 4V1Ak 2DNMA 2I0XA 2PSZA 7FDRA 3UPFA 2HLUA 2W25A 1QSLA 1EARA 4ZN3A 3DMJB 4IR9A 5GAEU 5JMNA 1S1TB 1JK9B 2DNHA 3EZOA 5DETA 4Q7AA 4WPAA 3G82B 2R7UA 1M5VC 2IBKA 3U27A 3H25A 3MCNA 2R4FA 1TKXA 1M5PC 2IJRA 2AV5A 2YNHA 5DQIA 2D9PA 3W64A 2WW4A 1Y0HA 5K8NA 5KT3A 1S48A 1RT1B 4DN0A 5H1SV 3FC9A 2C42A 5KFDA 4PR6A 3TW0A 3R7SB 1U24A 1CPZA 2N4DA 5HJYA 1RT5B 1S4FA 3J81U 2OO4A 4F4AA 1AZSB 3FEZA 2PFDA 1U25A 4PCQA 1U0HA 3ISNC 1X5SA 2F9DA 2M8HA 5KFPA 4AE5A 4NA1A 2CPDA 3R8YA 4I2QB 4Y2MA 1RT3A 4P75A 4KHPJ 5M2RA 1CJVA 4CLTA 3T41A 1RYSA 2KH9A 3DOMA 2VG7B 3I4PA 3HVTA 3UNGC 2SXLA 1JLCA 1UKUA 2DGUA 1J5OA 1YJ9S 2JNJA 4QOTA 3GSDA 3QGHA 2QLFB 2BKPA 2IM0A 2MKJA 4F4WA 4JV0A 1WNEA 1VIOA 1EQ0A 2FB0A 4DL2A 1MN9A 5DDQC 1HBNA 3TANA 1IR0A 4X64J 2ZZTA 4QIWD 2E1MC 2ZVSA 2JSXA 3BBFA 2HHHF 1RHUB 4ZN1A 2UXDF 1NSPA 1QAJA 2F4VF 2MZSA 3DXSX 3W3SA 3M32A 3CE8A 3VAMA 2NXJA 4P73A 2VF3A 4YEAA 4I6YA 3C6UA 1NHKL 1S12A 3VZHA 2RVJA 1KNZA 2ZOMA 3HFKA 5K5MA 5T7LB 1HBOB 1U7LA 4M1KA 3UD5A 1DY3A 4OYMA 2AF6A 1KC8T 3T6BA 3B82A 3UI3A 1NLKL 4YR0A 4NLOA 4FNIA 4Y3CA 4USIA 1R8PA 1EJ7L 1XMOF 5SUHA 1S0NA 4GO7X 2GX8A 2AQ4A 1MNEA 2AJQA 2DHAA 1B0VA 3L7OA 3TRGA 4DPYA 2CJYB 3QFWA 3H59A 2HQCA 1F9FA 3RG6A 2RQKA 1TKTA 1M0SA 1TP7A 2HNDA 5F0UA 4WYLA 4B3OA 4YDXA 1MLAA 3D1OA 1JLFB 1Q8BA 2HRYA 4MFBA 1EKSA 4Q43A 1HBUB 2XLKA 1AFIA 1HW9A 2NZCA 2W24A 4CTAA 3DI6A 4CM2A 4ZMMA 1ZAXA 1J5EJ 1VLOA 3T6JA 4UT4A 1FF2A 2CAJA 2W4CA 2W2PP 2AD9A 4L75A 2OEKA 1W7WA 3B78A 2XYHB 2XZWA 3M8PB 3GP9A 3N6LA 3HO1A 3MEEB 4AXJA 1JJ2R 4Y6IA 2NLWA 1GXLA 2ZH6A 2A1BA 1VHFA 2KT5A 1VRTB 4U7UK 3ZZUA 5L1LA 1GT8A 3IMQJ 2ZH2A 3KLIB 1NK9A 3R3TA 1Q8IA 2GIFA 2DRAA 2IDLA 1OY6A 2BE2A 3WX8A 2OJ3A 1URRA 2AJ2A 4A8YA 3VAGA 3V6JA 3GCWP 5CH7B 4KFBB 4QU7A 3TA0A 2B8PA 1L3TA 2YNFA 5DM7Q 1Q5VA 3NBPB 5EUHA 5DLFA 2AEFA 2ASJA 3CJTA 4OHZA 5F8HA 4DV5F 4MMOA 4DX7A 4ZVOB 3ILIA 1NM2A 5AXLA 2CUYA 3V5RA 3BB5A 2V4JA 1HNWF 1S1XA 4LRFA 1KQKA 5CZVA 4L3NA 1KLMA 2ADBA 1U02A 2GIQA 2FUG9 1WEZA 3VAFA 3OSPA 5C2GA 3D28A 1JQGA 1FVQA 4C3KA 4ELVA 4B02A 2K3KA 3DLEA 2AYBA 3M2UA 2DHHA 2FVRA 4DQQA 1RYRA 2VB6A 3S6EA 1E6VB 3AD9C 3KFWX 1RUSA 3H2VE 3TJ8A 1VQKS 2M7SA 3GSIA 2ZBIA 4LQ3A 3N4WA 3R5GA 3PJ9A 2XZDB 5KG7A 1NH8A 2E7XA 1FJEB 3RRKA 2UUAJ 2E5LJ 2DY1A 2FJVA 2B6AB 2H4YB 4OYBA 4ILMA 3P45B 2GC8A 4ZJLA 4GKJF 1DTQA 1FKOA 3FDSA 1FXRA 4QIFA 1UVMA 1X9MA 1R6VA 3SSQA 2RAQA 2IVFB 1L3SA 1U1RA 8ATCB 3Q8YA 1IR2A 3KLHB 5ETOA 3G8SA 1LXNA 2HBQB 4RW8A 3W9IA 4AD6A 4YFUA 1P9YA 3I31A 1R8AA 3HZGA 4USUA 4J9KA 3UCZP 1SJFA 1HNVB 3CCWA 2ZHBA 2R2UA 3RBDA 4PYDA 3HJVA 2HQ3A 2WCXA 1B0TA 3EZUA 5C2CA 3U7JA 3GMGA 3D0GE 3CPWR 2I2YA 4HDGA 1X4FA 2JEJA 3R1HA 1RU2A 1IM4A 1EQMA 3TA2A 2MZQA 1EETA 1RJJA 3GIJA 3NMAA 5KT4A 2F7VA 3OL8A 3TAPA 4PQAA 4S0MA 3AAWB 2ZH1A 2F8HA 3SFUA 2AEMA 3VV2B 4WWSA 1KFDA 1O0PA 2KFZA 2UXCJ 3P6YC 3ENAA 2M88A 2MHNA 4B9MA 2CZ9A 4JI0F 4IR1A 4OV6A 2YPZA 3OXLA 3D0IE 4IQXA 1WTFA 2FD2A 2VU5A 4B3TF 1UJ5A 2BANA 4ETZA 4DX6A 3UNYA 1YKWA 2BABA 2Q1LA 5I3PA 2J9CA 5ETQA 4ZPDA 1S0VA 2ZM6J 2BE9B 3OLAA 3ILJA 1CEZA 1YSJA 2YH0A 3PM9A 3TX0A 1RISA 5BYQA 2IMWP 4DS4A 4LSZB 3TZZA 2JC0A 3G6XA 3HM9A 1HQEA 1Y00A 4DR4F 2EKYA 1S4EA 4ZP6A 4X4UA 4KIAA 4WCEQ 4HTIA 2QE5A 3I56S 1TL3A 2LDYA 4KV8A 5DGBA 1HHQA 3M6XA 3ULHA 4G1PA 3CD0A 2GHWA 1UEUA 3MCMA 4F25A 4U7CA 3FMWA 3M7VA 4JV1A 4JI3F 4KPYA 1U8SA 4F4YA 1XNRF 2KFYA 5FDLA 5E0OA 1S9GA 2AEJA 2W2MP 4ED8A 4CT8A 2EKNA 4WTYA 2F63A 1SJRA 1FCAA 2DH7A 3GWCA 1M1HA 2COLA 2HHVA 3LP2A 2G2OA 1N33J 4B9NA 3PG9A 2GJIA 3FCWA 2OEJA 4LRDA 2HRTA 3TUIC 2HFZA 3W7BA 4DPUA 4DL3A 2DHSA 4UF4A 1NSQA 3FRZA 1HBMA 4OHVA 2K7KA 4OX7A 5DG9A 2LDIA 3PDNA 4WU3A 1U1KA 5AXKA 3PR4A 1T03A 1IBMF 3QGPA 4LREA 3TVZA 1ULRA 1WC1A 3M9OB 3DM2A 1FNMA 1ZZNA 1Q4RA 1YTYA 2DTJA 2JDJA 3MM5B 4RW7A 3HDSA 1EX8A 2B51A 3K7RA 3T5JA 2V50A 2HIYA 4MK7A 4WP9A 4ECSA 2BQRA 2QJ3A 3P8BB 5A0YA 5U47A 1HQUB 4UQGA 2MQMA 3QZ8A 4ZIWA 4TU8A 2OPSB 4DX5A 5H9EJ 4YN3B 2IRUA 4QYZK 3C2PA 1TL5A 3BKFA 4Q0BA 1XEZA 4QPXA 1RAOA 1CLFA 1H74A 4L3KA 2DKOB 1U8WA 4Y2IA 2MLYA 1APSA 2G2ZA 3Q8PB 2E5HA 2M3DA 2FJDB 1TL1B 4MYTA 3CCUS 1UFWA 3T1YJ 1N32J 4USTA 4JI8J 2GVZB 1CJTA 1SXLA 5A2QU 2HMIB 1NZ8A 1CQMA 1NHUA 5HP1B 3OVAA 1A7GE 3HMJG 5J2MA 4FXVA 4RWWA 4HI2A
chains in the Genus database with same CATH topology
2NXNA 3CJSA 2YXLA 3CJQA 1UFKA 2NXEA 3A4TA 3CJRA 1SQFA 2ZBRA 3CJTA 2NXJA 2ZBQA 2ZBPA 2B9EA 2NXCA 3AJDA 1SQGA 3EGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NXN A;  3CJS A;  2YXL A;  3CJQ A;  1UFK A;  2NXE A;  3A4T A;  3CJR A;  1SQF A;  2ZBR A;  3CJT A;  2NXJ A;  2ZBQ A;  2ZBP A;  2B9E A;  2NXC A;  3AJD A;  1SQG A;  3EGV A; 
#chains in the Genus database with same CATH topology
 3UVJ B;  1RWN B;  4MKY A;  5KG4 A;  5KOX A;  3MAQ A;  3Q8V A;  1SVD A;  3UFC X;  3R5A A;  2FJW A;  4TQR A;  1VQ6 S;  2QGF B;  2VHG A;  1YX2 A;  2B7B B;  5IC6 B;  1VRU B;  5F3T A;  4MK9 A;  4X62 J;  2CRL A;  3SQO P;  1NB7 A;  2D3U A;  2W9C B;  4YB5 A;  3KG0 A;  2YWW A;  2DHX A;  3EVO A;  2D69 A;  1WOO A;  4OL8 A;  4YP3 A;  3X1L B;  2G13 A;  2D3O 1;  3NOG A;  4K4X A;  3C46 A;  4BCA A;  2J0Q D;  3BQ2 A;  2Z2M A;  3UW1 A;  2HNZ B;  4NLS A;  3T1H J;  1P27 B;  4OHY A;  2VPY B;  2YKM B;  1N0V C;  3G8Q A;  1RTH B;  4H4M B;  2ZD1 B;  4QWD A;  2Q3P A;  4CLP A;  5BR8 J;  2CQP A;  2H54 B;  4WFY A;  4CLW A;  4J9N A;  4DR7 J;  1L3V A;  5I3U A;  4LRB A;  2MKI A;  3FVY A;  4QWA A;  3VAI A;  4DFK A;  4ZCM A;  1IWG A;  4ZKA A;  1H0H B;  3TNV A;  1UP1 A;  4EYH B;  2PD1 A;  3DFE A;  2D74 B;  2XO6 A;  3KLG A;  4F4X A;  3BZQ A;  1UET A;  3BSC A;  3PYD A;  1JLG B;  2RSQ A;  4IOA Q;  1RWO B;  3I0S B;  3NCP A;  4KGZ B;  1Q82 T;  4OZJ A;  3O1L A;  4FPI A;  2C2K B;  3ZNU A;  1ZYQ A;  1RTD A;  1MG7 A;  2DNN A;  1ARO P;  4IG0 B;  4IQM A;  1OWX A;  3WIU A;  1R0A B;  3OL6 A;  4N8N A;  4AXI A;  3QAT A;  5KT5 A;  1VC6 A;  4ZPT R;  1F5A A;  5CYJ A;  4GRS A;  2RHS B;  2XNQ A;  3PYE A;  2W7O A;  3OTB A;  3D6T B;  4W90 B;  2YNI B;  1U1N A;  4DV4 J;  4Q2M A;  3IGV A;  1N8R T;  2VA3 A;  3W9J A;  4OJ3 A;  4NZ7 A;  4ZVS B;  1YWX A;  3I55 S;  4K4U A;  5EX0 A;  4OYO A;  2EK6 A;  4NCA A;  3RB4 A;  3DGP B;  5DM6 Q;  5L1I A;  3CMQ A;  1HI8 A;  2GA7 A;  4KHP F;  2PE8 A;  4FKY A;  4K4Y A;  3TP2 A;  4X4O A;  4GC7 A;  1XK8 A;  3ELH A;  5J1P A;  2LEA A;  2OUG A;  1CUL A;  2XM3 A;  1C1C A;  2FGO A;  1RWU A;  1BQN A;  1OPZ A;  2GQC A;  2UUB J;  4ERD A;  3AOC A;  2XY5 A;  4OJH A;  1G4C A;  1RTI B;  5ETS A;  2J5A A;  4KGM A;  2ZUA A;  3MDF A;  2CPI A;  1VYA A;  1CG2 A;  3BO2 A;  4FYX B;  4DUY J;  3W2V B;  4JOU A;  1VFJ A;  1XMQ J;  4QR0 A;  1W25 A;  1RT7 A;  3OUY B;  4KT0 C;  4D3H A;  2EI5 A;  4DV2 F;  5G4D A;  4DSI A;  2C3M A;  3PX0 A;  2VG5 B;  4UY8 T;  3R2D J;  1DZ5 A;  4USJ C;  3DLL Q;  2IIH A;  2C2D A;  1S1U A;  3B4D A;  4MIB A;  4IG3 B;  2VOO A;  3LP1 A;  3BS9 A;  3D3B J;  3KLE B;  4KBI A;  2I9S A;  3BBB A;  4RUA A;  1VC5 A;  1ZM2 A;  3MMB B;  2H5J B;  4KH1 B;  3MEK A;  1NK4 A;  1Q81 T;  1N34 F;  1YG0 A;  4PWD B;  1SJ4 P;  4LBP A;  4NXN F;  3GON A;  3QQC D;  3PYG A;  2V2Z A;  3HXM A;  2NSB A;  2J6T A;  3HI9 A;  3IR7 B;  4M5D A;  2FLP A;  4DSL A;  1ZAW A;  2LFV A;  2YWG A;  4F3Q A;  1SB6 A;  3GV5 B;  2YWH A;  4LRA A;  3HT3 A;  1GXU A;  4GKK J;  2QX0 A;  2GIR A;  3DLK A;  4MT1 A;  4LSL A;  3GLJ A;  2KG0 A;  3EJM A;  4DL4 A;  3S7R A;  5J2P B;  1V5V A;  3K8W A;  4KGK A;  4I2Q A;  5E2Q A;  2WSF C;  2JEG A;  3ITH A;  4M5J A;  5F8M A;  4ATN A;  3AJ1 A;  1CJU B;  2BXJ A;  3G87 A;  2HHU A;  2IYG A;  2V4Q A;  4U7U D;  2MPU A;  3LAM A;  1JKH B;  4IFV A;  1UMJ A;  4IH6 A;  2W2O P;  3CDE A;  2PT0 A;  3Q22 A;  2G9O A;  4HAC B;  2H4W B;  3CIM A;  1VK8 A;  4RO0 A;  3KMQ A;  2C2Z B;  5IS2 A;  1YHQ S;  4PPZ A;  1DAX A;  1HD0 A;  2I6W A;  3AFG A;  3HP6 A;  2NPF A;  4K2J A;  2UZA A;  3IM9 A;  3EMT A;  1WG4 A;  2FC9 A;  1KTV A;  3DLJ A;  1HA1 A;  2FY1 A;  2O01 C;  2HSE B;  3THV A;  4LFA J;  2YWK A;  4L73 A;  3IM8 A;  1PC4 A;  2QL9 B;  1XNQ J;  1VQ7 S;  5F8I A;  1R3N A;  1HHT P;  1A6L A;  3FNN A;  4K4Z A;  4EYI B;  3HVA A;  3LGH A;  2VC0 A;  2W8K A;  4ZLJ A;  2GZO A;  1FRX A;  5H9F J;  4PEO A;  5T7L A;  4F3M A;  3QJL A;  3TVK A;  3RB0 A;  5T41 A;  4IO9 Q;  3Q83 A;  4QWC A;  1LWX A;  5J2Q B;  1GX5 A;  3OFE A;  3BR8 A;  1TK8 A;  1WC4 A;  3D54 A;  1OS5 A;  1YBA A;  2B9Y A;  1PAE X;  4NRT A;  2VDH A;  3M2V B;  4R8U B;  3VR1 A;  3R27 A;  1S1V B;  4LIW A;  4JI4 F;  3ZZT A;  1FXD A;  3MED A;  3TQE A;  1RAA B;  4ZVE A;  3LW5 C;  3V6H A;  3KHL A;  4IH7 A;  3O5T B;  1LNQ A;  5GVQ A;  2UXB J;  1MU2 A;  1HPZ B;  3IWL A;  4I2P A;  2Q79 A;  1S6Q A;  1WC5 A;  3PFO A;  2GQ2 A;  1Y3K A;  2PI4 A;  1SKW A;  1B64 A;  2LP4 A;  1RT6 A;  1N5T A;  3CCS S;  3ADA C;  1T95 A;  1KWM A;  1VI7 A;  2LQ5 A;  3CSK A;  3ZZP A;  3MM6 A;  3MAH A;  1TKZ B;  1KBR A;  1SV5 B;  4B3S J;  3DRR B;  2UUA F;  4X4S A;  3ET6 A;  1WF1 A;  3BN4 A;  2VA2 A;  3BR9 A;  3MCO A;  3WQP A;  1NK6 A;  1S9F A;  4B3M J;  5DGA A;  2LQB A;  2YH1 A;  3HPO A;  2MY7 A;  4OV1 A;  2HVE A;  1K9M T;  5KOW A;  4KPC A;  2BM0 A;  3EDQ B;  1X0P A;  1F0X A;  2GW8 A;  5IT4 A;  2XGQ A;  3QGG A;  1ZA2 B;  4DU8 A;  3M30 A;  4RPF A;  2UVW A;  5IV3 A;  4ED3 A;  2W9B A;  4C3M A;  1FNO A;  4PZV A;  4FP9 A;  2NXN A;  5D6G A;  4DBQ A;  5L38 A;  4K7Q A;  3ZC4 A;  5EWE A;  4Q8E A;  5B0F A;  1B7Y B;  5CYM B;  4DR5 F;  2J7U A;  9ATC B;  3SQG B;  2YPY A;  6AT1 B;  1F5B A;  4DLG A;  1RBA A;  3J7Y I;  1MRO B;  2DGX A;  4DV3 J;  2YKQ A;  2AGQ A;  3TAM B;  3CJ8 A;  3ISN D;  3TQ1 A;  1SBR A;  1IVZ A;  4FVC A;  1SI9 A;  2DGO A;  4USV A;  1GNK A;  5EHH A;  5ETR A;  1X4H A;  3MF5 A;  1H73 A;  4QWE A;  3HX9 A;  2MQP A;  2IM1 A;  3BRE A;  4MAK A;  1WSV A;  3VF0 B;  1UWB B;  3EGW B;  3T5K A;  2YNG A;  2JC1 A;  1IKX A;  3W9H A;  3TOQ A;  3ZZY A;  4X4Q A;  2C3O A;  3SFG A;  4RUH A;  2PMH A;  1SH0 A;  1XC9 A;  1NJW A;  4OI3 A;  2L9D A;  4F02 A;  3SCK E;  3T3F A;  1T05 A;  5A8K A;  3KXD A;  4GVB A;  2WRM A;  2KRB A;  3KNG A;  3AJ2 A;  1ZOT A;  4LSN A;  3IRX A;  1I6J A;  2Y9H A;  2QEX S;  2CNO B;  2Z8Q A;  1U6Z A;  3VAH A;  3P4U B;  4Q44 A;  1P1T A;  2JH3 A;  2ZH3 A;  4LF7 J;  4QIV A;  5B0C A;  1XMB A;  2I5J A;  4DSJ A;  4Q2L A;  3C6T B;  1D09 B;  2XBP A;  4RW9 A;  2IPO B;  3VTI A;  1VQM S;  1Q1K A;  4NLV A;  3BGR A;  3L7U A;  4K5S A;  3OR1 A;  4RBT A;  1FJ7 A;  3A1Y G;  3FBE A;  2QSW A;  3CCE S;  1F60 B;  3QSI A;  1FDB A;  1GMW A;  4WFX A;  4DL5 A;  4EK2 A;  4LR7 A;  3TEH B;  3MWB A;  3Q8S B;  4O0N A;  3C66 A;  4OJ1 A;  2HQG A;  2KT3 A;  4ZVU B;  5AXM A;  3DKD A;  1D8Y A;  3TEG A;  4DV7 J;  3PKM A;  3BH6 B;  3KJV B;  5A76 A;  2W1B A;  3KK1 A;  2ZZM A;  4LF6 F;  5GAG I;  2YQ1 A;  3OPK A;  1VJQ A;  2YNH B;  3SI8 A;  1FE4 A;  4LJM A;  1ZBT A;  1OSD A;  4FS2 A;  2YX4 A;  2MYF A;  1P9Q C;  2B4V A;  2GO9 A;  2QA4 G;  3DHW C;  3NS6 A;  2LA4 A;  5K8O A;  2VQE F;  5HN0 A;  3MXH P;  2NXU A;  1K0T A;  1LFW A;  2CJQ A;  3R5C A;  2QSF A;  1U0H B;  3QT6 A;  4KJI A;  2DB1 A;  1RT3 B;  2VQF F;  3GIL A;  3ZTP A;  2ZKU A;  3EYZ A;  1CJV B;  3N9U C;  4YB6 A;  4LF8 F;  3DOM B;  3TZX A;  1FKA F;  3ENV A;  1NEE A;  3SCL E;  4JYA F;  2L9W A;  3KUE A;  1VR6 A;  2BA9 A;  1JLC B;  5HVH A;  1J5O B;  2ACY A;  3KTQ A;  1WJ9 A;  2EBE A;  4DF4 A;  2HIQ A;  2DPJ A;  4LVO P;  1PAU B;  2HZC A;  3T1Y F;  2IM2 A;  1AFJ A;  1HBN B;  4Y2C A;  4ZCL A;  3J80 Y;  5LSL A;  3GQC A;  4DG1 A;  4OX6 A;  2MY8 A;  2V2K A;  2ZNZ A;  3G2X A;  2WTF A;  2BM1 A;  2JEI A;  4YOE A;  3M32 B;  1I94 J;  3GIK A;  2DY9 A;  2D3Z A;  4X65 J;  1UTA A;  1R6Y A;  3C6U B;  4X62 F;  3MHY A;  1N36 F;  4F2R A;  4UTG A;  2QA1 A;  2EFN A;  1UJ4 A;  4ZA1 A;  4BC9 A;  2CQB A;  1DTT A;  3GJQ B;  1L3K A;  1YBT A;  4DL7 A;  2PGC A;  1FD8 A;  4OHX A;  5AJ3 F;  3Q8Q B;  1FD2 A;  2K2P A;  4WKR A;  1TFY A;  2WW8 A;  1GMW D;  5KG5 A;  5LM7 E;  2ADC A;  1JJH A;  2BJ1 A;  4CWB A;  2A3J A;  4PXE A;  2R8K A;  2VUG A;  2JZ5 A;  4X2B A;  1U48 A;  2ZC3 A;  1DHM A;  4F4Z A;  2J9E A;  1N6Q A;  3ONQ A;  4ICL A;  3V4I A;  3MR2 A;  1TKT B;  4F50 A;  5KFS A;  1ZPW X;  2HND B;  2XMM A;  4B3O B;  1X0F A;  3M6V A;  4L72 B;  2D41 A;  4MFB B;  5HQ8 A;  4L74 A;  2ZH7 A;  2AYE A;  3QPI A;  4CTA B;  3DI6 B;  3D2W A;  2IHR 1;  2H9Z A;  1IWA A;  3V81 A;  2ZE2 A;  2VPZ B;  3FJ2 A;  3D9B A;  1FVS A;  3LTO A;  4P7V A;  4ZPB A;  5IT9 Y;  4V19 J;  1U1O A;  2YWE A;  4JI7 J;  1VQY A;  1DRZ A;  1REG X;  3RYL A;  5F0W A;  3MM9 A;  2JLE A;  3JQM A;  3TO8 A;  2BJ8 A;  1IQZ A;  1FEH A;  2YBV A;  3BDP A;  3D67 A;  4DXL A;  4IOB A;  4QYZ J;  1P8G A;  3O6Q A;  2R8H A;  2VPW B;  2HWH A;  4A8W A;  5C25 A;  4J9U E;  3WC2 A;  1QSY A;  1IKV A;  3J7A N;  2BE2 B;  2J9D A;  1Y11 A;  1T9V A;  3FCH A;  1T9U A;  2E5J A;  2KB2 A;  2PA8 D;  1WKJ A;  3OD2 A;  4FYV B;  2Y1R I;  3Q2T C;  3L3C A;  4RUB A;  2C28 A;  2GHP A;  3CJ4 A;  1PKU A;  4OYX A;  2YNF B;  2JJ4 D;  2DGQ A;  3PJW A;  4MJK A;  2R8G A;  2PC6 A;  2JRS A;  1C2P A;  4YB7 A;  4YHH F;  5ETV A;  4P10 A;  2EFV A;  4O3O A;  5KFL A;  1RTH A;  2V4J B;  1Q8K A;  3D1Q A;  2VFS A;  2PO4 A;  1S1X B;  4DUY F;  2KHD A;  2O66 A;  4J9V A;  1KLM B;  3JAM Y;  3BSN A;  4HLB A;  2VOP A;  3OFF A;  2VL1 A;  1GXT A;  3TX8 A;  3N28 A;  4OIX A;  3DLE B;  4HT7 A;  3M2U B;  3ILO A;  1HNX F;  4ZVH A;  4O0I A;  2CJX B;  1SPB P;  3QNW B;  4KSE B;  1CJK A;  1QD1 A;  1UA1 A;  2MXY A;  3NAH A;  1FTR A;  1ZET A;  4TYA A;  1UCN A;  1MSW D;  2W4P A;  4TKT A;  3CCJ S;  1LXJ A;  3C14 A;  1PBA A;  3OR2 B;  2DGT A;  1T9T A;  3VWS A;  2QC3 A;  3AA8 A;  3NCR A;  2AT1 B;  2LEP A;  5GMD A;  3CD7 A;  1OYE A;  2HK3 A;  1DQ8 A;  4PAA A;  3GFZ A;  4DSF A;  3DC2 A;  1DTQ B;  1FKO B;  2G1D A;  2CIM A;  2GNK A;  4UQT A;  1NKC A;  4C7Q A;  4JUZ A;  1HHS A;  1H38 A;  1TZ0 A;  2OML A;  2KM8 B;  2UUC J;  4F2S A;  1VQ4 S;  2B0G A;  4RW8 B;  1SC6 A;  2IJF A;  1OJ4 A;  3AB2 B;  2XS2 A;  4HEA 9;  3WBZ A;  2OAU A;  2QG9 B;  2WB1 D;  3WX4 A;  4JI5 F;  1JJ4 A;  3CDA A;  3FZ2 A;  2G4B A;  5L9X A;  1EB0 A;  4B9U A;  3VCD A;  1LQ9 A;  4K50 A;  4UUW A;  1JXL A;  3QJJ A;  3W5X A;  4GVL A;  2OMO A;  2Z4P A;  3NXZ A;  5M2U A;  4UZB A;  3RRG A;  5GAH U;  1NJX A;  2R7Q A;  5E33 A;  4ZLN A;  1NK5 A;  4ANE A;  3CMA S;  3CD5 A;  3NGD A;  3POT A;  4YDD B;  5KFN A;  3EVW A;  1T9Y A;  1PJ5 A;  1V3R A;  3N01 A;  4A4J A;  2VIH A;  2OPP B;  3LQV A;  3AXK A;  2KG1 A;  3GJS B;  4DV0 F;  1TMJ A;  2HHS A;  2BKO A;  2ERR A;  2EVZ A;  1C1B A;  2VG5 A;  3BN7 A;  1Y10 A;  4BWJ A;  1T8E A;  2CAD A;  4ZVG A;  4HVZ A;  4TLQ A;  1U2R A;  4LQ9 A;  1XR7 A;  3PCO B;  2BJE A;  4PWU A;  1UZD A;  5HI7 A;  4AQY F;  4LVN P;  2BAN B;  1VRQ C;  3V4M A;  1QUP A;  5IXU A;  4F26 A;  5M2P A;  4Y2K A;  1LK5 A;  5KG6 A;  5KG0 A;  4RU2 A;  3SV4 A;  4ZP8 A;  1PYS B;  2DR9 A;  1YJR A;  1HI1 A;  3OL7 A;  2OSQ A;  5E5N A;  2C2E A;  2FZK B;  4MIW A;  4J9O A;  4OYI A;  1LW2 A;  4PWD A;  2NS1 B;  1HWJ A;  4J5O A;  2QYC A;  1HQE B;  4ZIV A;  3GFX A;  5KFU A;  3UO0 A;  1NDL A;  2IVY A;  2I8E A;  1HWI A;  1TL3 B;  4KV8 B;  1K73 T;  5K9F A;  1XTZ A;  1PIL A;  3PX4 A;  3HVR A;  3UN5 A;  2E7V A;  3CDB A;  4WE1 A;  3HSG A;  1A0O B;  5FDL B;  1S9G B;  3H20 A;  3JSM A;  4WP3 A;  1YRX A;  3N5F A;  3G71 S;  2Q6C A;  3OQ2 A;  2OD6 A;  3BV8 A;  3DLH A;  4B3R F;  4Y2A A;  2X1B A;  1TVR A;  3PHE A;  3LP2 B;  3R5J B;  1U1M A;  4BHQ A;  1UZH A;  1KEK A;  1GTH A;  4N56 A;  2E9R X;  5B0B A;  1S77 D;  4BC7 A;  4BDP A;  2D3O R;  4JI2 J;  1WC0 A;  4DF8 A;  1JB0 C;  4DR2 F;  3IO1 A;  3LGN A;  1RWP B;  2QFI A;  4MKV A;  3NCQ A;  4DFP A;  3QYY A;  3M4X A;  3BYP A;  1HBM B;  1WD6 A;  3AQO A;  4C0O C;  1CVJ A;  5LMU F;  2MZR A;  2J7K A;  5FD1 A;  2HBY B;  4B3M F;  1T03 B;  2HW3 A;  3FUY A;  1X7V A;  4NX9 A;  1RBO B;  2VFT A;  2DNO A;  4YS2 A;  1V9O A;  3DM2 B;  1N54 B;  4M94 A;  2LU2 A;  4RW7 B;  2AYG A;  4NCG A;  4RNN A;  1U1Q A;  1UA0 A;  1WOP A;  3MR6 A;  1BE4 A;  3V6D A;  1VC0 A;  5A0Y B;  4X4N A;  3CJ3 A;  3VAK A;  3O8W A;  2QTW A;  3AD7 C;  3KJN B;  4RNF A;  2YX7 A;  2LMI A;  3IWX A;  2KHC A;  3HK2 A;  2YQ0 A;  5J2Q A;  1H72 C;  4DUT A;  1UFL A;  3GV7 B;  4NE9 C;  2EW9 A;  1NPK A;  5DG8 A;  1VDH A;  4RBV A;  5BJR A;  4BLG A;  5IQQ A;  2UVU A;  2XUL A;  3H2L A;  1AYE A;  3K5L A;  1TKD A;  4LR8 A;  1T7P A;  3CME S;  3PAC A;  1EKR A;  2DH9 A;  4ECU A;  1RCX B;  1Y4Z B;  5J2M B;  2JFK A;  4DZ6 A;  2VPX B;  1X4D A;  1SKU B;  1GTE A;  1QE1 B;  1NRK A;  1QM9 A;  5HJX A;  2YVS A;  1FDN A;  4JB8 B;  3M2R A;  3DHX A;  1TQL A;  1WDD A;  4URS A;  1XN9 A;  4RUC A;  3QRR A;  2A6M A;  4I64 A;  1U2C A;  4QIG A;  4AL5 A;  2W01 A;  1TKZ A;  1SV5 A;  1KVI A;  3QGI A;  3HFV A;  3DRR A;  2DNK A;  2JWN A;  2MQ8 A;  7AT1 B;  5KFA A;  1JLB A;  3D6M B;  4WU2 A;  4N76 A;  1HMV A;  4KC5 A;  3CED A;  1BWV A;  2G1H A;  3FEY B;  4NLT A;  4LT6 A;  1RZM A;  3F73 A;  4W92 B;  3Q24 A;  4DV6 J;  2K3I A;  1YJV A;  4LUB A;  4WII A;  1WC6 A;  2EFP A;  4O23 A;  4LFB J;  3LGM A;  5I3U B;  2IFX A;  3HT0 A;  1XER A;  2RRB A;  1WOR A;  1NDK A;  3JB9 k;  3FFI B;  3TJ9 A;  3BKT A;  3H5Y A;  3RU0 A;  1TK5 A;  3BYR A;  3KLG B;  4NLQ A;  4C3L A;  1LWF A;  3PVX A;  3VGT A;  4USK A;  4C8K A;  3DOK A;  1N52 B;  1YRU A;  4ES3 A;  4GO5 X;  4CI0 B;  4Z7C A;  1UPP A;  1RTD B;  2R7R A;  2AIR B;  3CCZ A;  4OX9 J;  4ENO A;  1MRO A;  4BBY A;  3ZZZ A;  4RBU A;  4NCB A;  3THT A;  4I4B A;  4Z7Y A;  1RK8 A;  5MAO A;  3DRS B;  4LIR A;  3KYL A;  1MML A;  1BHN A;  3FBB A;  3TUP A;  3D68 A;  3I4H X;  4KHR A;  1UWB A;  1UPM B;  1SJQ A;  5E3C A;  3HVW A;  3BSO A;  3CCM S;  3LP0 A;  5B0A A;  3TA1 A;  4KE5 A;  1UW4 A;  1UFK A;  2B56 A;  3OTE A;  2IC3 A;  1JX4 A;  4DR6 F;  3S01 A;  4NZ6 A;  3KHH A;  1G1X A;  1S57 A;  2D7S A;  2P6S A;  2Y1I A;  2N4C A;  1WHW A;  4PXB A;  3AOD A;  4Q5V A;  2AHO B;  4DR3 J;  2FVS A;  4DMZ A;  3FZB A;  3I96 A;  4YY3 J;  4CLF A;  1YRT A;  5D4L A;  2CQI A;  1BQN B;  1MWZ A;  5KFJ A;  3OJS A;  4BWM A;  3OFG A;  4JI6 F;  2Z2L A;  5D78 A;  5LMN F;  4JBC A;  4IRC A;  1GH8 A;  3NAI A;  1FHT A;  4O4G A;  1U49 A;  1SL2 A;  1NUE A;  3P5T L;  4PKD B;  4NYO A;  4ZPA A;  4RR5 A;  3IP0 A;  5BXI A;  1BD6 A;  4QW9 A;  4KAI A;  5F9N A;  2WON A;  1S1U B;  3BGL A;  1I94 F;  1RHR B;  3JQJ A;  1BUX A;  4Y00 A;  4LF9 F;  2OFG X;  3SIP B;  3LP1 B;  3MEC A;  4FS1 A;  3SCI E;  1S0O A;  3KJV A;  1KVK A;  1RAI B;  3J80 U;  3TI0 A;  3VGU A;  4ZK7 M;  4EZ9 A;  3Q8U A;  1SKS A;  4PG5 A;  2R7V A;  4DL0 C;  2E5I A;  2O67 A;  1U47 A;  1S6P A;  2OGU A;  3CUL A;  2RS2 A;  1T94 A;  3C8Y A;  3T19 A;  2KT2 A;  1X5O A;  3IN5 A;  4UOC A;  1AXQ A;  2DR8 A;  1PYT A;  3OTO J;  1WI8 A;  1PSD A;  2XLI A;  1JNR B;  3CO0 P;  4M5D B;  1TR0 A;  4ED2 A;  4DS5 A;  3AQP A;  5ITH A;  2BDP A;  2H5E A;  5DLG A;  1RAG B;  1IJE B;  3LAN A;  2LYV A;  2PII A;  3DLK B;  4ZCK A;  4LSL B;  2CVE A;  1TL4 A;  1Q0N A;  3H40 A;  1FDD A;  1Q16 B;  3ITH B;  1JWW A;  5KFZ A;  4Z37 A;  4ECT A;  2VG6 A;  2QMW A;  2RNE A;  1QTM A;  4NLD A;  3D6F B;  2AKW B;  4OFZ A;  3D6H B;  3US5 A;  4XPC A;  2KL8 A;  5HQM A;  2BV3 A;  1HR0 F;  5D77 A;  1NBE B;  4IFV B;  2LKZ A;  3MPW A;  5JVH Q;  1LWE A;  3KMS A;  3MUM P;  1E6Y A;  2DR7 A;  1M5K C;  1YJN S;  4F8R A;  4MH8 A;  2E9T A;  1VJW A;  2DR5 A;  2XMW A;  4TLR A;  4NLR A;  2HWI A;  1H2T Z;  4K4S A;  3BPD A;  5H9F K;  3V6K A;  8AT1 B;  1HNI A;  2L48 A;  2MEW A;  4USW A;  4J9M A;  2XWX A;  5GMK a;  5IT9 U;  3PIP Q;  3KLF A;  2GQQ A;  3OV7 A;  1LKZ A;  4A46 A;  5GAD I;  2I1R A;  2XHW A;  2P9E A;  3MD1 A;  1OSC A;  1IM6 A;  3EDR B;  2EK1 A;  2BYC A;  4RLE A;  1U1L A;  1QLN A;  1H7W A;  1I3O B;  4NLW A;  2YKP A;  1I5O B;  3CO9 A;  2CQD A;  4I6W A;  4UUX A;  5DDR C;  4GMK A;  1R8C A;  2VKZ G;  2ZWP A;  4ILR A;  2KJW A;  3KHR A;  1BQM B;  4OZ0 A;  1IBK F;  2XTJ P;  2HHT A;  1KD1 T;  1RAH B;  1ROF A;  5LJ3 Y;  1WG5 A;  2HFV A;  4X66 J;  2CQ4 A;  1HD1 A;  4NEY A;  3J81 j;  1S49 A;  2HKE A;  2MJN A;  1F3F A;  2QLJ B;  1HKA A;  3MUR P;  3RB6 A;  3EX7 B;  3MED B;  3W8P A;  1KRP A;  1FRH A;  1HWU A;  3GG0 A;  3K57 A;  1PJ7 A;  1SC4 B;  1H6K X;  3EUN A;  1MU2 B;  4CH1 A;  4I2P B;  3R5B A;  3LWM A;  1S6Q B;  2RF2 A;  3MOJ B;  1RT6 B;  1SQF A;  1M1K T;  3W8G A;  2HLT A;  4UY8 5;  1WWH A;  3JAM U;  2HBR B;  4P2S A;  3MM6 B;  3QSY B;  1VCT A;  4DR1 F;  4ZOS A;  1F5C A;  2HHH J;  5MLC V;  2E9Z A;  2Y1L B;  3BDE A;  3ET6 B;  2AZ3 A;  3KHG A;  3I9V 9;  2F4V J;  1NH7 A;  4WBF A;  4EBD A;  3I87 A;  4CNY A;  3KWM A;  1FRM A;  3EM1 A;  1S76 D;  2FZG B;  2F8M A;  1MN7 A;  4DOZ A;  3OVS A;  1FRJ A;  4PUO A;  2Z56 B;  4K2X A;  2Q66 A;  3EVM A;  4JV5 F;  2BJ3 A;  1VIS A;  4AUK A;  3T9N A;  1VBZ A;  2DPI A;  5THW A;  3C15 A;  3L7P A;  2RU9 A;  3M30 B;  4DI6 A;  1RWW B;  2W9B B;  2QLW A;  4NLX A;  4QBU A;  2KDO A;  4CH0 S;  4R0J A;  3UDC A;  3UR3 C;  5D3G A;  3OL9 A;  1TFW A;  3NGK A;  3DLB A;  4DPO A;  1BXN A;  3NMR A;  2C3P A;  1JMT A;  3G96 A;  1G2E A;  4EO8 A;  3BQ1 A;  2RML A;  1UEK A;  1WEY A;  1RCO B;  4B9L A;  2M0G B;  3IBW A;  1R27 B;  4E0D A;  2N3L A;  2BJ7 A;  4UW2 A;  1S6U A;  3C19 A;  9RUB A;  5CCL A;  2OEM A;  4QR1 A;  3RTV A;  1U45 A;  3I0R A;  2C2O B;  2C22 A;  1NJY A;  2V2V A;  2POK A;  4CO4 A;  1O8B A;  4PWW A;  1VS3 A;  3GIM A;  1M5H A;  4DSK A;  1YK9 A;  2O5D A;  1B70 B;  2YNG B;  2CYY A;  1IKX B;  4FF3 A;  3NRB A;  2KXH A;  3DNC A;  5F8N A;  3AB4 B;  3ICL A;  2XS5 A;  2QIF A;  1VHI A;  3PR5 B;  5CA5 A;  4C8Y A;  1T05 B;  2B5J A;  2B4P A;  5A8K B;  3PJX A;  3J7Z T;  2FVC A;  2ZJQ Q;  4GVB B;  3OR2 A;  3OBI A;  5I42 B;  3V2U C;  2V68 A;  4LSN B;  3IRX B;  2BW7 A;  1FKP A;  4NA3 A;  4I0W A;  4Z2X A;  2RH3 A;  5KFW A;  2Z0G A;  4RU9 A;  2ROP A;  3IS9 A;  2R42 A;  2BQU A;  2XI3 A;  5IM0 A;  1RLD A;  5J2N A;  2ALZ A;  5HAN A;  2XCP A;  4K59 A;  4KB7 A;  2I5J B;  1OO0 B;  1TUV A;  2FY8 A;  4OZ3 A;  2F5G A;  4RW9 B;  2R9L A;  3IR5 B;  2RU3 A;  1J27 A;  1NAQ A;  3CC2 S;  3ZTR A;  3BGR B;  3OR1 B;  2KN4 A;  4DV5 J;  4A8F A;  5CZX A;  2V63 A;  2J6U A;  3A8E A;  1O5J A;  1G3O A;  4OZ2 A;  4FXD A;  3L4B C;  1HNW J;  5CQG A;  4FPR A;  3IXQ A;  4OI6 A;  1FNX H;  2OPQ A;  1VQO S;  2AMC B;  4NYZ A;  4JI2 F;  4WZQ A;  3KK1 B;  5DZ6 A;  2X3D A;  3NGU A;  3LA0 A;  3FKB A;  3K8V A;  3L9Z A;  1TL7 B;  2HUR A;  3CUN A;  2GHV C;  4DQR A;  2OPP A;  2W7P A;  3K59 A;  1QVF R;  2IY5 B;  3HHD A;  1VBY A;  3CGI A;  2M9K A;  2RIL A;  4DLE A;  4ED5 A;  1VQS A;  1N4L A;  2VDI A;  3TZY A;  3Q89 A;  4K5R A;  3HKZ D;  3NG8 A;  2J7W A;  3H2U B;  3VAJ A;  2V67 A;  1VOM A;  2EEY A;  2J0W A;  2HPU A;  1S99 A;  2EWH A;  3KUG A;  4GKJ J;  2YY3 A;  3SMZ A;  1HLW A;  2YKO A;  2X1F A;  4UOH A;  4AYB D;  4DSE A;  4ZPW R;  4OX8 A;  4KTQ A;  2R7O A;  2QL5 B;  3DRP A;  1D9D A;  3PO4 A;  2LLZ A;  4IOC Q;  4QPT A;  1UWA A;  3MD3 A;  3HHL C;  3M8W A;  3KKF A;  3IAS 9;  3VGS A;  1WI6 A;  3PO5 A;  2K1R A;  2Y8Y A;  3DLG A;  7FD1 A;  2DHG A;  1HL6 A;  5AE3 A;  3C16 A;  2DNL A;  3MPD A;  1XJW B;  2JVO A;  4LFC J;  3D3C J;  3E01 A;  4NYP A;  4LF5 F;  1UEV A;  1NJI T;  1DLO A;  2DIS A;  2Y0S D;  4DG1 B;  1JLQ B;  3H4B A;  3NWR A;  2KYX A;  2CQ1 A;  1VBK A;  2ZOG A;  4XO0 A;  1CS4 A;  4H54 A;  4H4O A;  2HQI A;  3SSS A;  2HFO A;  1DUR A;  3EE3 A;  3PW7 A;  5HLF A;  5EWG A;  1YJU A;  5HL7 Q;  1RB0 A;  1RHJ B;  4C11 B;  3MM8 A;  3HF5 A;  4ELT A;  2DCU B;  4DL6 A;  3ETM A;  2P8I A;  2BW2 A;  1OY9 A;  5KTQ A;  1DTT B;  5KFO A;  4JI0 J;  1T9W A;  4I67 A;  2VBW A;  3GFY A;  1WOS A;  1R7I A;  1D8Z A;  1N88 A;  5KFI A;  2V34 A;  2V8P A;  3E2E A;  3D1H A;  4NXM F;  1AUD A;  1WHX A;  2GAG C;  4OMF G;  1N6Q B;  3JTP A;  1C4A A;  2AP6 A;  4LFB F;  2KVI A;  1K0V A;  2BR0 A;  4ICL B;  3V4I B;  4M5G A;  1FJG J;  4B9T A;  3QAE A;  2VON A;  1UAW A;  2CA9 A;  3IFE A;  3I9Z A;  3CCR S;  1F3V A;  4XIU A;  4DFJ A;  2F40 A;  2BUN A;  4F4K A;  3K89 A;  3NWG A;  2XYG B;  1XR5 A;  4FN5 A;  4IFY A;  2UV8 A;  2HVH A;  3V81 B;  5J1E A;  4JI3 J;  2ZE2 B;  3B4M A;  5KFG A;  1XNR J;  3HSD A;  5ADZ A;  4D3G A;  2FYX A;  4OX9 F;  2A18 A;  4U6P A;  3MFH A;  2ZBQ A;  3OSN A;  2OI2 A;  1X4A A;  3MM9 B;  4TU9 A;  1IKY A;  1Y3J A;  1Z4U A;  1Z2Z A;  2ZEJ A;  3MPU B;  3ZNJ 1;  3KK2 A;  2XWY A;  1SIW B;  2IBO A;  2F1F A;  2L41 A;  2NXC A;  5F9L A;  2P9G A;  4ECY A;  2HRU A;  5C25 B;  3T5H A;  1QE1 A;  2OKQ A;  1IKV B;  1NU4 A;  1JLE A;  1C0T A;  4J9L A;  2HGL A;  4OZ1 A;  4CLL A;  3DRX A;  4OYW A;  1FX4 A;  3BSA A;  5L1K A;  2EFO A;  4EU0 A;  3Q8R B;  4G3I A;  2XMV A;  2UU9 F;  3RW6 A;  1X31 C;  4B17 A;  2HQF A;  1IBM J;  1MWY A;  4YY3 F;  3LH2 S;  4CDI A;  1L3U A;  1K1S A;  2B43 A;  3PEJ A;  2VH7 A;  3FGV A;  4J90 A;  2HEK A;  2C1E B;  1FFS B;  3SDE A;  3RBZ A;  2R7T A;  1XQI A;  1KQF B;  3CJK A;  1NB2 A;  3W65 A;  3UN2 A;  1Q5Y A;  4XAK A;  2EG1 A;  4ZJQ A;  3UN3 A;  4ED6 A;  4R5P A;  3HLU A;  2JHE A;  3GG1 A;  1R8H A;  3UR0 A;  4DQI A;  4LF4 F;  1UL3 A;  1UJ6 A;  1NSK L;  1YIJ S;  1CC7 A;  4ITS A;  3FFI A;  3CT9 A;  4WTO B;  3W66 A;  1BQX A;  2LEC A;  1ZH5 A;  1V3Z A;  4YR3 A;  1CJK B;  3IG1 A;  3ENQ A;  2XLJ A;  1M5O C;  3OHA A;  2WVB A;  3PFE A;  3JYT A;  2HYI B;  2WZ1 A;  1ICE B;  3C14 B;  3KDN A;  2ABY A;  2LA6 A;  4QWB A;  1YZ6 A;  1N56 A;  1C0U A;  4TU7 A;  2XQC A;  2U2F A;  3JS9 A;  5KG1 A;  4OYZ A;  2BKN A;  3DRS A;  1LWC A;  5A8R A;  2W7A A;  2G0C A;  5CD4 A;  4HHJ A;  3T1A A;  3M1V A;  3OTD A;  4O44 A;  1CSJ A;  4P2X A;  3IBC B;  2KKH A;  8RUC A;  1RA6 A;  5E7O B;  3ILL A;  3Q23 A;  3PKY A;  5DQH A;  4HI1 A;  3R97 A;  4X84 A;  2W2N P;  2QL7 B;  2OTL S;  3D66 A;  2M70 A;  2IRY A;  2WSE C;  3GYG A;  2CWK A;  4DPX A;  3UDL A;  4MYU A;  2ZDP A;  3NEK A;  1VK3 A;  3O44 A;  4CO5 A;  4O3Q A;  1PJ6 A;  1H98 A;  2BOP A;  2NRE A;  5KT7 A;  4C2M A;  4K0K J;  4AND A;  2HVZ A;  4M5L A;  1IR1 A;  3POT B;  3SBM A;  5KT6 A;  2R8J A;  2IVM A;  2WAQ D;  1ZPV A;  4MKB A;  2KZZ A;  1V5I B;  2CFX A;  3G6Y A;  1FI4 A;  1IKW A;  5E3Q A;  4MTP A;  2F4F A;  2NYI A;  2XCA A;  3DU5 A;  1CBK A;  2X3G A;  2XSJ A;  4G6V B;  2RS8 A;  4X64 F;  1R43 A;  3HJF A;  1W2I A;  2J8S A;  2B9E A;  1C1B B;  3G9C A;  2UP1 A;  3BGU A;  1LK7 A;  4CZC A;  2BX6 A;  2H65 B;  3M9M B;  4C4W A;  1S1W A;  4GC6 A;  3ZXW A;  4C0H A;  2QT7 A;  4TY8 A;  2PDA A;  3QWU A;  3RAX A;  5GAE I;  2CQC A;  1KON A;  4FXW A;  4L76 A;  1U09 A;  2HQD A;  1GMV A;  4RL1 A;  2B9X A;  2QA4 S;  1V3S A;  1LW2 B;  2HS0 A;  2YKN A;  4DV1 J;  2DO0 A;  4NMX A;  4B9V A;  4N5S A;  2OTJ S;  1VQ8 S;  4XTT A;  2DXD A;  3GZ7 A;  4ER8 A;  4X66 F;  4ECQ A;  3NLC A;  2WHO A;  4OYA A;  1X5P A;  2PA3 A;  1M5S A;  2YXL A;  4WE1 B;  2IAJ B;  2K06 A;  5B0E A;  2Z57 B;  2X51 A;  1NK7 A;  3M8Z A;  3JSM B;  3FSX A;  2CZ4 A;  1HIY A;  2AGP A;  1QJH A;  3QT8 A;  2XNR A;  1SC3 B;  3RGI A;  2RDJ A;  1DBD A;  1TVR B;  1HYS A;  2RKI B;  4ED7 A;  2MZT A;  3CJ5 A;  1D9F A;  1J5E F;  3CXC R;  3AT1 B;  2LXF A;  4ID8 A;  3GJT B;  3EGZ A;  1FK9 B;  4OJG A;  4X4V A;  2XY7 A;  1SQG A;  4DV2 J;  2VFV A;  3NGS A;  1RBL A;  3WHI A;  1U1P A;  1LV5 A;  4ZCI A;  3HZE A;  2HGN A;  1K8A T;  3QWP A;  5IZH A;  4ZLP A;  1X4C A;  4QJV A;  5D0H A;  2E1C A;  1RTZ A;  2F3J A;  5T14 A;  3MTK A;  1CQN A;  1RI7 A;  2CPE A;  1DQ9 A;  3EGN A;  5J1N A;  2Y8W A;  4CRJ A;  2Z58 B;  4U96 A;  1N34 J;  3G4S S;  4TVA B;  4O3N A;  2RDI A;  3BBC A;  4NXN J;  4NCG B;  1N5S A;  2EPI A;  4WKY A;  3DOL A;  3V6D B;  4KQZ A;  1X5T A;  4A8X A;  2IMO A;  3OVB A;  2GGP A;  5HBM B;  1QUV A;  2R2R A;  3B6B A;  3MM7 A;  3JSR A;  5KG2 A;  1Y5I B;  1RTJ A;  5KFY A;  1BQM A;  4TXS A;  2KRR A;  3KG4 A;  2L3M A;  2BBE A;  2XMT A;  2ZVI A;  4PG7 A;  4KR0 B;  5KFF A;  3S1T A;  1RU1 A;  1QY7 A;  2ZJR Q;  3CDW A;  3UWT A;  3LAK A;  2MZJ A;  3R7N B;  5B08 A;  3G6V A;  5A6P A;  5IQ6 A;  2Q43 A;  4OZL A;  4W98 A;  1S5Z A;  2BQ3 A;  3AH6 A;  2V8V A;  1S79 A;  3GR0 A;  3SCJ E;  2VV5 A;  1REV A;  5KT2 A;  4ZVP B;  4DCP B;  3JSY A;  3Q2S C;  3M2R B;  4RX6 A;  5CYQ A;  5EDW A;  3DRY A;  1JXE A;  4CO1 A;  5C42 A;  5DO2 A;  4C8O A;  2CNN B;  3AXM A;  4F0M A;  2OSR A;  4G1Q A;  1H2V Z;  1QTN B;  2E5L F;  1AW0 A;  2OPR A;  2E5G A;  5HAT A;  1JLB B;  1N0U A;  3GTY X;  1HMV B;  4U9R A;  2HFU A;  4IRK A;  5HAO A;  2BVZ A;  1QAY A;  3QLH A;  3GIR A;  4X4P A;  1J2V A;  2B9W A;  1ZTW A;  2HNY B;  5HSP A;  5DG7 A;  3F41 A;  5HMY A;  3BEG B;  5IWA J;  1B7F A;  3J7Y U;  3JSB A;  3UCG A;  1P1L A;  2CDQ A;  5LJ5 Y;  3JTO A;  1DQA A;  3IA0 A;  3FRY A;  3D5M A;  3EPI A;  4A8K A;  5D4N A;  1TUG B;  2AYM A;  1T9X A;  3HD1 A;  1NK0 A;  3JXO A;  4Q45 A;  1SL1 A;  5HMZ A;  3LWL A;  3R6L B;  5F8J A;  1LWF B;  2CQH A;  4I69 A;  1EZZ B;  3DOK B;  1LOU A;  2NZ4 A;  4JI4 J;  1KVJ A;  1SUQ A;  3G6E S;  1RWK B;  1WUU A;  5DRK A;  4KRW A;  2MQQ A;  2XC9 A;  2FLL A;  2KJV A;  1RT4 A;  2YX1 A;  4ED1 A;  1ELO A;  2PN6 A;  3UD3 P;  2UXC F;  4I1T A;  2GJ2 A;  2FJE B;  1IBC B;  2V6A A;  1GFW B;  4O3P A;  4IKA A;  3MCS A;  2MKC A;  4K8R A;  4P2M A;  3LP0 B;  3EXY A;  2E1P A;  2HWT A;  3M8Q A;  3R7B B;  2GVD A;  2IC3 B;  3N6N A;  3H42 A;  4F67 A;  4YUD A;  4M8L A;  2FTR A;  2R8I A;  2ZM6 F;  2AX0 A;  4C48 A;  3CDU A;  5G0R A;  5I42 A;  2B8Q A;  4WZM A;  2D9O A;  3MPV A;  1TV6 A;  1PBU A;  3VGV A;  4HYK A;  4M5M A;  5FLX Y;  1OYD A;  2XS7 A;  1IUJ A;  2CJA A;  1IJF B;  2CWX A;  1X9W A;  2VIC A;  2NYH A;  3HUL A;  2JLG A;  3MGJ A;  3VQT A;  3G86 A;  5LT5 A;  1KN6 A;  1Q79 A;  4PQU A;  2Z2Y B;  4O4G B;  2A2D A;  4PAB A;  5GAG U;  4LFC F;  2V0N A;  2FVP A;  2V5H G;  4DR5 J;  1S9E A;  3W2W A;  3VVT A;  2G2Y A;  2G0J A;  2HHW A;  5GME A;  1HFE L;  1OQ6 A;  1NCL A;  5JVG Q;  2AJ0 A;  1Z2L A;  1RA7 A;  2DGW A;  1FE0 A;  4HHU A;  4WYW A;  1T3N A;  4PRF A;  2WON B;  4AL6 A;  2B4O A;  3NY0 A;  1HNZ J;  4ELU A;  1EP4 A;  4AFF A;  1N33 F;  2N3O A;  5K14 B;  3MEC B;  3RBX A;  3O2I A;  3TJA A;  1KFS A;  3KG1 A;  3W60 A;  2W9A A;  1XWL A;  5C7P A;  1VGY A;  1S6P B;  2RQM A;  2XHC A;  2CJB A;  3WC0 A;  4FKX A;  1D9A A;  1TL7 A;  4V19 X;  1VQP S;  2HGM A;  4IDK B;  1IBL J;  1WEL A;  5LOQ A;  3T5L A;  4PG8 A;  3WIV A;  3GPA A;  4DDF A;  5AXN A;  1PYO B;  1FJG F;  3CCL S;  2MQL A;  3A3N B;  3MMC A;  2CG8 A;  2CPZ A;  1GMU A;  1WEX A;  5E41 A;  4J37 A;  4EEY A;  2VG6 B;  1FT8 A;  1V6H A;  2LXU A;  2GS8 A;  2QA2 A;  3MR7 A;  4B08 A;  2YKA A;  1RKJ A;  4NI2 A;  4YQW A;  3KDO A;  1LWE B;  1E6Y B;  2W2Q P;  4CLU A;  1RP5 A;  4M95 A;  1FJC A;  5IOL A;  2ATC B;  3VZI A;  1N32 F;  4PG4 A;  4JI8 F;  2GAH C;  1ZAV A;  2UUT A;  3D7S B;  3QO9 B;  3W5Z A;  1Q7Y T;  1JLQ A;  1HNI B;  3A4T A;  2AZ1 A;  5K8P A;  2QV6 A;  2WSC C;  3MAA A;  3BKU A;  5HO4 A;  1R31 A;  4DHV A;  1Y5N B;  3MOZ A;  3KLF B;  4LF6 J;  2O3D A;  2AU0 A;  2AW0 A;  2E66 A;  1MMD A;  2DIT A;  5B0D A;  4RNO A;  1SQE A;  4DPT A;  1HWK A;  3AHP A;  3SYZ A;  4EO6 A;  5KG3 A;  2Q6B A;  4C11 A;  4QR2 A;  2MQN A;  4R25 A;  5BYS A;  4XDD A;  3QJP A;  2VQE J;  3SEO A;  1B3T A;  2DR6 A;  2GML A;  2DRD A;  3HHL A;  1X4E A;  3R6G B;  2V8G A;  3T1H F;  1WTB A;  5AE1 A;  5KFQ A;  1M1G A;  3DYA B;  4C8Z A;  3BH7 B;  5KAK A;  1X4B A;  5IFM A;  2VQF J;  4EBC A;  1YQH A;  2QLX A;  5BR8 F;  2MKS A;  4DCO B;  4DR7 F;  4LF8 J;  3FBC A;  3E3X A;  4ZVF A;  1LW0 A;  3RJM B;  3HKW A;  2AGO A;  4JYA J;  4WFB Q;  3GV8 B;  3OTC A;  3M9N B;  2H1Y A;  3ZFV A;  4OZN A;  2NSC A;  2WOM A;  4RW4 A;  1U0S A;  4FF1 A;  3PV8 A;  1OMS A;  4HT5 A;  3A12 A;  3CJR A;  4ZIT A;  3H90 A;  2ATL A;  1OIA A;  4O4R A;  2GJF A;  3W5Y A;  3KK3 B;  2RF2 B;  2RHQ B;  3QT7 A;  1R89 A;  1TK0 A;  2EXU A;  4CIO A;  3NL0 A;  1UW9 A;  5DZ7 A;  4ZHR A;  5SZT A;  2KTQ A;  2VBX A;  1GQE A;  2V94 A;  3L09 A;  3BO3 A;  5E3A A;  4QU6 A;  1NDP A;  4CLZ A;  4FYD A;  2V8H A;  1ZM4 A;  4FBU A;  1JNZ B;  1N36 J;  1JJC B;  4DV4 F;  2U1A A;  3CNQ P;  4PUO B;  3IRW P;  2ZNY A;  2F65 A;  2J8A A;  3W1Y C;  1K47 A;  2DGV A;  3U1N A;  1NHV A;  2P5V A;  5AJ3 J;  3C15 B;  3HSJ A;  3VHQ A;  3K5N A;  1R0C B;  1KQS R;  1G7C B;  3I5C A;  5ETK A;  1JLA A;  2MST A;  1F9E B;  5D3G B;  5HK4 A;  2WVE A;  3NGT A;  1FRI A;  5A8W A;  4F7V A;  4KO0 A;  3AOB A;  2CPY A;  2OD4 A;  3L95 X;  3CCQ S;  2M8D B;  3MZI A;  2OP5 A;  5KFV A;  1ZM9 A;  1WKL A;  4RW6 A;  1KQG B;  2UUB F;  3R5D A;  2PMW A;  4K0K F;  3PX6 A;  2Z2Z A;  3UQS A;  2BAC A;  2FHM A;  4LRC A;  3UDV A;  2ALY B;  2OHD A;  1N5Y A;  1W26 A;  2A10 A;  2GO8 A;  2P6T A;  3QIP A;  1RT2 A;  1FWP A;  1RQ0 A;  2M5Y A;  4A8Q A;  2HHQ A;  1BC6 A;  1UVJ A;  1NME B;  2XMU A;  3I0R B;  1XMQ F;  2CQ2 A;  5FJ4 A;  2XY6 A;  4P7T A;  2R7S A;  3MPY A;  2IM3 A;  2MGZ A;  2CKW A;  4I7F A;  4R0E A;  5C24 A;  3FK4 A;  2HZA A;  3H8Y A;  2ZIT A;  2CVI A;  1TMM A;  3HHL D;  3JQK A;  5KFC A;  3U1M A;  4Y65 A;  5L8R C;  2CG4 A;  2IDE A;  2NQP A;  4ZJO A;  2XB2 D;  2B5J B;  2J9D E;  4LBI A;  2C2N A;  4DX8 H;  1G6B A;  1PCA A;  3B8H A;  5B7W A;  1XBW A;  1I51 B;  4NWB A;  3RAM A;  2ZJP Q;  4ID5 A;  2FLO A;  1BMQ B;  1FKP B;  4NOH A;  2OIH A;  2DNP A;  2F8E X;  4HHH A;  3K58 A;  4K4W A;  2BE7 D;  4DV1 F;  1BY9 A;  1RHM B;  2R3V A;  3IS9 B;  1RAE B;  2VFU A;  5IM0 B;  3CC7 S;  5KFX A;  2DH8 A;  5J2N B;  2ROE A;  4F0H A;  1RAJ A;  4NML A;  2MMY A;  2XYP B;  4HH1 A;  3JTN A;  1FDA A;  2IRX A;  4RZR A;  5KFE A;  2QRR A;  4J9S A;  1I1G A;  1FFW B;  3THP A;  4GKK F;  4H4K C;  3A13 A;  2EBG A;  5HQL A;  3RRH A;  1SJ3 P;  1N5Q A;  1FO1 A;  2NXE A;  2V9K A;  2DBB A;  2QZ8 A;  4YHH J;  4RWX A;  2Y1J A;  2FLN A;  3IGN A;  1YLX A;  4FYW B;  2FC8 A;  4CYU A;  2Z30 B;  2C3U A;  1NKB A;  3FCV A;  3I5A A;  5HRO B;  2OPQ B;  3MMA A;  1URN A;  4LMZ A;  4E8U A;  4ALZ A;  2Y0B B;  4UZC A;  1FWL A;  4OYP A;  1FER A;  1GAO A;  5IC4 B;  3DMJ A;  3HHK A;  2PI5 A;  4LBH A;  2DIV A;  1HNX J;  1W2B R;  4URG A;  2EC0 A;  5K8M A;  3H4D A;  4QCL A;  1S1T A;  4M5N A;  4EWT A;  3BGF A;  4DQP A;  3TZW A;  2PMZ D;  1JXV A;  1WHV A;  4XK8 C;  1SCJ B;  2CNK B;  3TVY A;  2WK4 A;  3G82 A;  4TNO A;  4LFA F;  2A6O A;  1PG5 B;  4MIA A;  4W4M A;  4RNH A;  4N41 A;  2VJU A;  1DFD A;  2KXF A;  3KJF B;  2HBZ B;  5RUB A;  3BO4 A;  1XNQ F;  1FTC A;  1C4C A;  2VKR A;  4A47 A;  3GYN A;  1YZ7 A;  2L08 A;  2J0S D;  1UVK A;  4DWI A;  3UE2 A;  1MW7 A;  5LL6 d;  1RT1 A;  1UVN A;  3GU0 A;  4U8V A;  3WDO A;  4EI2 A;  2C2R A;  3DRP B;  1XR6 A;  2HAF A;  2G0I A;  1RT5 A;  3K2Y A;  3OXF A;  4NRU A;  1AZS A;  1A9N B;  1B0P A;  4ZVQ B;  2AWZ A;  3OT9 A;  4CQ1 A;  3GCX P;  1NPP A;  3EPG A;  2K1R B;  5CHC B;  2CPX A;  3DLG B;  5LXY A;  2CJK A;  4K4T A;  4JI5 J;  3DDI A;  3RR7 A;  1HWL A;  2VZ9 A;  4HR2 A;  3UDE A;  3C16 B;  2IJN A;  2AX1 A;  3CJQ A;  4KKO B;  5L1J A;  2DGS A;  4IRD A;  2BRL A;  3E01 B;  2IAJ A;  3PRV A;  1SKR A;  1JIH A;  2VG7 A;  3NNA A;  1DLO B;  2RUG A;  2MSS A;  4QZV B;  2QMU B;  5LXR A;  2JEF A;  3NGR A;  2LQ8 A;  2ZKT A;  1T11 A;  2XZT B;  3QBC A;  1CS4 B;  3GII A;  2UXB F;  4H4O B;  3PW0 A;  5KFR A;  1FX2 A;  2FHK A;  2RKI A;  2FHJ A;  2CPH A;  1WSR A;  3CJ0 A;  3ZZO A;  1SJ1 A;  1D0E A;  4DJB A;  5HLF B;  2BRK A;  1RAD B;  3MM8 B;  4DV0 J;  5D0E A;  1FK9 A;  4RKU C;  4B3S F;  1TAQ A;  1S97 A;  4O3R A;  4CCH A;  3NS7 B;  4IYQ A;  2AJ4 A;  4ETX A;  1H7X A;  3FQK A;  5F3Z A;  3J7Z 5;  3QT5 A;  4AQY J;  1AB8 A;  4DQS A;  3N6M A;  3R2C J;  1VMB A;  2R2T A;  1HBO A;  3VQS A;  3B54 A;  5IWA F;  1NPR A;  4J9P A;  2DNQ A;  2KZM A;  2CQG A;  4ZPV R;  1X60 A;  3I82 A;  1RXO B;  5EX3 A;  1MMN A;  1VQ5 S;  2XMJ A;  5L46 A;  2W8L A;  5HBM A;  1X4G A;  3LO3 A;  3CJ2 A;  4IFY B;  2D1C A;  5J1E B;  1HQ2 A;  2JOQ A;  1CC8 A;  3CF5 Q;  2GMJ A;  1FXL A;  3BPS P;  3M6W A;  4N7T A;  5KFH A;  4NEZ A;  3I5B A;  3TAQ A;  5L9N A;  1JLF A;  3QRQ A;  4ES1 A;  4DV3 F;  2RRN A;  1B99 A;  3ZZR A;  2KXN B;  1KOO A;  3BGO P;  1HBU A;  1NO8 A;  3H5S A;  4B3R J;  2CPJ A;  4DN9 A;  3F44 A;  1IKY B;  2GFF A;  3K0J A;  3KK2 B;  2UUW A;  4ECW A;  2FJX A;  2DJW A;  2WBR A;  3HCX A;  1PC5 A;  4DR2 J;  1KSP A;  2APO A;  1ZZF A;  2N7C A;  2JX2 A;  3PW5 A;  3M8P A;  5DDP C;  4JI1 J;  1FRK A;  2CQ3 A;  2HAI A;  3MEE A;  1JLE B;  1C0T B;  1DJ0 A;  3NNC A;  1RWV B;  4KH0 B;  3RBE A;  4FZV A;  5LMU J;  2UVV A;  3C3L A;  3MEG B;  1VRT A;  4NA2 A;  4KY3 A;  5F8L A;  2DVI A;  1QAI A;  3KLI A;  1RGV A;  1RLC L;  1R8B A;  3FSY A;  2E44 A;  3PXG a;  1PO6 A;  1NZA A;  3PTW A;  2YTC A;  1AUS L;  4ZVT B;  1PGZ A;  1SL0 A;  3SDE B;  3J7A 1;  4ZP7 A;  4I6A A;  5DDO C;  4LF7 F;  3CJK B;  1M90 T;  4OI1 A;  4KFB A;  2R7W A;  2V9W A;  2HNY A;  2JFD A;  2FHJ D;  3FEX B;  4OQJ A;  4O3S A;  4N77 A;  4R5P B;  3M05 A;  3NBP A;  5FLX U;  2XMK A;  2WVD A;  4P74 A;  5EGY A;  3VAL A;  1TU0 B;  2RQ4 A;  4ECV A;  2ZH5 A;  3DGV A;  1HNZ F;  2HFS A;  5DS7 A;  3IG1 B;  3W61 A;  1YJ7 A;  3ETO A;  3AA9 A;  4DV7 F;  3JYT B;  3DCA A;  3RUB L;  2J0X A;  2JLF A;  2V8D A;  2K8G A;  1C0U B;  3OXG A;  3PRB A;  4LR9 A;  3NOC A;  3FBF A;  1U6B A;  1E6V A;  4JV2 A;  1IXK A;  1LWC B;  1IBL F;  3PRD A;  2HS3 A;  1D1U A;  5A8R B;  1QDU B;  4WIQ A;  2DRB A;  2AJ1 A;  2NUH A;  2BEF A;  3D0H E;  5KFM A;  2X1G A;  1MWQ A;  1FA0 A;  5CCM A;  4M5H A;  2ZUG A;  3M1V B;  4O44 B;  4YB1 P;  1S72 S;  2FHO B;  3A3P B;  5D0G A;  3H7H B;  2B6A A;  2N7Y A;  4DFM A;  5ETN A;  4Y28 C;  4J9R A;  4ED4 A;  5F41 A;  4EUV A;  1HAR A;  4WF9 Q;  3DDK A;  2QYG A;  1KTQ A;  2CJ9 A;  3KLH A;  5EWF A;  4IUF A;  5DQG A;  3TWZ A;  2RB7 A;  1WF2 A;  1NND A;  3IBF B;  2F9J A;  4WFN Q;  4FNH A;  4FYY B;  2CPF A;  4DU7 A;  2XSF A;  2EFG A;  2KYZ A;  2QFJ A;  1QAX A;  2LQ9 A;  2VOD A;  3SZ2 A;  3EWG A;  1HNV A;  4AT1 B;  5BYR A;  5K20 B;  1IKW B;  3DXB A;  4FF4 A;  2C2M B;  3QID A;  3NP5 A;  2VD3 A;  2KU7 A;  2XSJ B;  2PEH A;  3GE9 A;  3PHT A;  1EIY B;  3KNA A;  2NPI A;  5KFK A;  2LXI A;  4URQ U;  1TKX B;  1FFG B;  3F56 A;  3KJQ B;  4L6V 3;  1FES A;  1EHW A;  1NXI A;  4X65 F;  3P49 B;  1EAY C;  1FEE A;  3DU6 A;  5K14 A;  1S1W B;  2CXE A;  2V69 A;  4C97 A;  1Y9O A;  3A8J A;  1O51 A;  4NLU A;  1ZM3 A;  4TY8 B;  2XO7 A;  2EFQ A;  5L39 A;  3CB4 A;  3ZO7 A;  3MR3 A;  5CXT A;  2VFR A;  3PEH A;  2LEB A;  2ZH8 A;  3K5P A;  2YKN B;  4F3O A;  4IDK A;  5HMW A;  1SIZ A;  1Q53 A;  2LU1 A;  4DR6 J;  4NPO A;  3QFH A;  2ZWO A;  3I32 A;  3DDN A;  2HVD A;  2P9C A;  3ZTS A;  2WVF A;  3CW2 C;  4UOF A;  3AD8 C;  2EG2 A;  4I56 A;  4PPD A;  2ZH9 A;  2FDN A;  3P5B P;  4OI0 A;  1GEH A;  3HVT B;  1NDC A;  4JI6 J;  3H5U A;  5LMN J;  2WVC A;  3QMQ A;  2ZH4 A;  2FGC A;  3U02 A;  5D8H B;  2M4M A;  3AJD A;  3I6P A;  1HYS B;  1KR4 A;  1VLY A;  3WZ0 A;  4OLP A;  2VJV A;  4KGX B;  4DUZ J;  5GAD U;  4ES2 A;  2ZHO A;  4ZLL A;  4K4V A;  4QIE A;  2LQJ A;  1FWK A;  2CQ0 A;  3UD4 P;  4I68 A;  1OPI A;  1Y7P A;  3GFH A;  3HHN B;  4JI7 F;  2FVQ A;  1WHY A;  3CD6 S;  4KGV B;  3MR5 A;  1YIT S;  4LF9 J;  3ENW A;  5LSR A;  4CO0 A;  2BJ9 A;  3QO9 A;  4Y34 A;  1WG1 A;  3CIZ A;  2MHE A;  2FIU A;  5I3Q A;  2MB0 B;  2WBM A;  2J76 E;  4WP8 A;  2OH2 A;  3M8S A;  3OLB A;  2B7C B;  2H3E B;  3J81 Y;  4ZS6 A;  2ZBP A;  3BJY A;  5HMX A;  3MTJ A;  2L9N A;  3A8I A;  4P72 A;  3DOL B;  2VBZ A;  1OY8 A;  3RB3 A;  2GGP B;  2NUU G;  3MM7 B;  2MDA A;  1VQN S;  5CAB A;  4Y0F A;  2OFH X;  1ZS6 A;  1RTJ B;  1WDT A;  2HG4 A;  3TUJ C;  3N0V A;  3O3L A;  1RAC B;  1AT1 B;  1U2F A;  3MM5 A;  2GCF A;  3DYA A;  4U67 Q;  4C9D A;  2DCL A;  1FRL A;  4WJB A;  3SSR A;  4CO3 A;  1HQU A;  2ZZN A;  4ECX A;  4FVM A;  1RSC A;  1U6F A;  4NLG A;  2HFN A;  4CH7 A;  2BZ2 A;  2OPS A;  4KHM A;  1SH2 A;  4EFA C;  1HR0 J;  5E3R A;  1S7H A;  1BWE A;  4QYR A;  1REV B;  4RNM A;  3AY0 A;  3OHB A;  2X7I A;  4HDH A;  5CYQ B;  5B09 A;  4ECR A;  1YGY A;  1D3W A;  1TL1 A;  5A6W A;  3KK3 A;  6FD1 A;  1IN0 A;  3S8S A;  4M5I A;  5C42 B;  4X4R A;  4PXD A;  2GVZ A;  2HMI A;  5HP1 A;  4C0B A;  4G1Q B;  4CT9 A;  2DEI A;  3A8K A;  3CTR A;  1KDN A;  2OPR B;  3UVJ A;  4HKQ A;  2UXD J;  5FII A;  4LF2 A;  2I38 A;  3E8O A;  4NAS A;  1HI0 P;  2QN6 B;  4CP5 A;  4WK3 A;  2E1R A;  2ROG A;  3QLH B;  1VRU A;  2CDR B;  1S59 A;  2W9C A;  2YQ3 A;  2YWF A;  1QVG R;  4WFA Q;  3CC4 S;  1RWM B;  4NLP A;  3PNI A;  5CD4 H;  2UUC F;  4P52 A;  2ZDO A;  4MKA A;  1N48 A;  1TUW A;  4XPE A;  2VBY A;  1U26 A;  1IBK J;  1XMO J;  2HK2 A;  1X9S A;  2HNZ A;  4A48 A;  1VBX A;  2YKM A;  3CWJ A;  4C8L A;  4H4M A;  2H51 B;  2ZD1 A;  3NNH A;  3CJS A;  2HS4 A;  2KM8 C;  2ASL A;  4OZ5 A;  3PIO Q;  2CNL B;  5IT0 A;  4F0K A;  2DEJ A;  1SUQ B;  2H48 B;  5AE2 A;  2FQQ B;  2HHX A;  1ACM B;  1H2U X;  5D15 A;  3EXC X;  3KUH A;  2V4R A;  3F0N A;  4J91 A;  5AT1 B;  2CZV C;  3R9L A;  1JLG A;  1RT4 B;  3I0S A;  2HVI A;  2MJU A;  3NKY A;  3HHE A;  4IG0 A;  1F2H A;  4DR1 J;  2J6S A;  1YJW S;  1R0A A;  2ZOF A;  4CM0 A;  3GYX B;  1K44 A;  3M8Q B;  2GVD B;  1RAF B;  2JL9 A;  2M2B A;  1U4B A;  3K17 A;  4QQB A;  1RKI A;  4USM A;  2YNI A;  5G0R B;  3W62 A;  4CLY A;  4J7C A;  5F8G A;  3EIC A;  2C3Y A;  4JV5 J;  1TV6 B;  1O6X A;  2BOA A;  1SC1 B;  2GMH A;  5ETL A;  1BGX T;  4Q8F A;  1VQ9 S;  3DGP A;  1UVI A;  5JUM A;  2LCW A;  4A8M P;  4OI2 A;  2Y3Y A;  2MLZ A;  1WF0 A;  4YR2 A;  4PQU B;  4U95 A;  3CVK A;  3M6U A;  2ILY A;  6FDR A;  2AJF E;  4FDF A;  3IAM 9;  4C6A A;  1Y5L B;  2RQC A;  1S9E B;  3W2W B;  1Q78 A;  4TN2 A;  2RJZ A;  2FJA B;  2B3T B;  1T02 A;  1RHQ B;  4CLK A;  4DZD A;  2DNG A;  3E51 A;  1DAR A;  1EET B;  1RTI A;  4QW8 A;  5ETP A;  4P9S A;  3PY8 A;  3FQL A;  4ZP9 A;  1EP4 B;  3FMB A;  3RW7 A;  4PXC A;  2W4D A;  2B4U A;  2KVQ E;  5C5J A;  3BF4 A;  3W2V A;  3CCV S;  3LF0 A;  3MUV P;  5HRO A;  2XMA A;  3OUY A;  3GJR B;  1RE1 B;  4FBT A;  1RHK B;  2RDD A;  2KI2 A;  3D4J A;  3FSI A;  2RD5 C;  1PIE A;  2V2Q A;  1IQT A;  2ZBR A;  2OLW A;  5GAH I;  4JP8 A;  3RZA A;  4AL7 A;  4IG3 A;  1KOH A;  5D4P A;  4M5K A;  2RUS A;  2ZC4 A;  3QAU A;  3KLE A;  3LUY A;  2IA6 A;  3PZP A;  3MMB A;  2DK2 A;  4H4K A;  4FF2 A;  1AA1 B;  3QZ7 A;  3OFH A;  3MMC B;  2XEX A;  4WXO A;  2DIU A;  3U1L A;  2IYI A;  1KP6 A;  3OJU A;  2KFN A;  1S6O A;  4DPW A;  4RJV A;  2N82 B;  4LF1 A;  1WC3 A;  4E98 A;  1F6T A;  4G1I A;  5LSO A;  2DXE A;  2O1P A;  3LPY A;  4EZ6 A;  4DEZ A;  4MK8 A;  5D0R A;  2ASD A;  2BMB A;  4C98 A;  1RAB B;  2BJD A;  4NI2 B;  2PFF B;  4BS2 A;  3M8R A;  5J2P A;  3EZ5 A;  3GB0 A;  2QLB B;  3AOA A;  3ZTO A;  2RE1 A;  1YBU A;  4KKO A;  1Q7L B;  1NKE A;  1CJU A;  2E29 A;  1S0M A;  2DNR A;  4HL9 A;  1YVF A;  1JKH A;  4F36 A;  3MAA B;  3P96 A;  4C8N A;  4ED0 A;  4HAC A;  3ISZ A;  4JI1 F;  3IC1 A;  5CAA A;  1ZA1 B;  1ZTT A;  1Q8L A;  3PW4 A;  3CCT A;  3TAR A;  4XDC A;  5HVF A;  3MFI A;  2UV8 G;  3R1L A;  2DO4 A;  4EMD A;  1Q95 G;  4X4T A;  1YJT A;  5H9E K;  4TYB A;  3K5O A;  2XI2 A;  3M8Y A;  4B3T J;  1RDR A;  1TEL A;  3HHL B;  3MI7 X;  3W63 A;  1BLU A;  3H5X A;  5HVG A;  1T0T V;  3P3D A;  1KHV A;  4DV6 F;  2FJB B;  1VIX A;  2DNZ A;  4ECZ A;  3H0P A;  2EC2 A;  4USH A;  4WFZ A;  3Q0A A;  2K7J A;  5ETM A;  2XGP A;  2NCK L;  1LW0 B;  2DNY A;  3N79 A;  1K1Q A;  5ETT A;  2WOM B;  4RW4 B;  5D4O A;  4Q0B B;  2NR0 A;  2JVR A;  1B4S A;  3Q86 A;  3KLV A;  4DR4 J;  2OEL A;  3QRP A;  2ZBC A;  3SV3 A;  1X8D A;  1F1B B;  3UCU P;  4A8S A;  5IV4 A;  3M2V A;  3H98 A;  2R2S A;  4R8U A;  1NK8 A;  2KO1 A;  3G8T A;  2FPH X;  1KLN A;  1S1V A;  4A8O A;  2UVR A;  4LF5 J;  4B9S A;  1SH3 A;  5KFT A;  1CJT B;  4C8M A;  4ZHR B;  5I4M A;  4OLO A;  4ANC A;  1S7I A;  3T9Z A;  4CO2 A;  4UOG A;  4IO1 A;  4E2F B;  2LVW A;  1HPZ A;  1P6T A;  2MZ1 A;  2ASY A;  3A3O B;  1R0B G;  3PW2 A;  2MKK A;  2PEB A;  2R7X A;  2RRA A;  4U8Y A;  2FZC B;  3RAQ A;  3N5B A;  4HTJ A;  4OHW A;  2RIJ A;  3MUT P;  4WK1 A;  1N5V A;  4CNZ A;  4TY9 A;  3TR5 A;  3KOA A;  1GK8 A;  3HFZ B;  3NS5 A;  2MTL A;  3ZZ0 A;  4YME A;  1LEO A;  2QO3 A;  3DN9 A;  1XIQ A;  5E3P A;  2GV1 A;  2QMX A;  1F9H A;  2DYA A;  4IH5 A;  1JLA B;  1KHW A;  3MEG A;  2ZFH A;  4PYA A;  2RT3 A;  4NXM J;  3X3U A;  4PG6 A;  1LFP A;  1S10 A;  4HH0 A;  5A8W B;  4DR3 F;  4NLY A;  4KO0 B;  2DXF A;  2H5I B;  4N47 A;  3TUZ C;  2ACM A;  2M52 A;  2P2C B;  4P2F A;  3BQ0 A;  4F04 B;  4RW6 B;  1H3D A;  3HSZ A;  5KFB A;  3PYF A;  1UVL A;  1L5U A;  3RR8 A;  4ILL A;  1NJZ A;  1N5Y B;  4NL5 A;  2ZHA A;  2XG8 A;  4EBE A;  1ITP A;  3QIP B;  1RT2 B;  4CLS A;  1OQ3 A;  1RWX B;  5JJB A;  4M63 A;  3OW2 R;  4P6Q A;  2MLX A;  5CYM A;  3SQG A;  3ZTQ A;  5A2Q Y;  2MGZ B;  1T3O A;  4I7F B;  1QSS A;  4G65 A;  5C24 B;  5EN1 A;  3HD2 A;  3TAM A;  2A0F B;  1GX6 A;  2X1A A;  1KS2 A;  3LOU A;  3MMJ A;  2E1A A;  2WB4 A;  2IA0 A;  1YDL A;  2VAS A;  3TYT A;  3LAL A;  1YI2 S;  3IWN C;  1Z1Z A;  4ZDN A;  2HHP A;  1TAU A;  5B0G A;  2DT9 A;  4WXW A;  2MQO A;  2A2C A;  4ID5 B;  1WKK A;  4KYZ A;  4J9Q A;  3BM7 A;  3K5M A;  2ILZ A;  1Q86 T;  1NSA A;  3OTO F;  2MKY A;  3EGV A;  1VQL S;  4EGL A;  3LPE A;  2UU9 J;  3SXL A;  4TQS A;  4NZ0 A;  1CUL B;  3VVU A;  1C1C B;  3GR1 A;  2DD8 S;  5JXS A;  4ZVR B;  1HW8 A;  2MKH A;  2HZV A;  4CYU B;  1TTH B;  4DCJ B;  2E7W A;  4ZPC A;  4N8O A;  4P71 A;  1WAC A;  3IR6 B;  3C6T A;  4DUZ F;  2VC1 A;  3MMA B;  4LF4 J;  1RT7 B;  4OI4 A;  5DJB A;  1F2G A;  1KKH A;  4V1A k;  2DNM A;  2I0X A;  2PSZ A;  7FDR A;  3UPF A;  2HLU A;  2W25 A;  1QSL A;  1EAR A;  4ZN3 A;  3DMJ B;  4IR9 A;  5GAE U;  5JMN A;  1S1T B;  1JK9 B;  2DNH A;  3EZO A;  5DET A;  4Q7A A;  4WPA A;  3G82 B;  2R7U A;  1M5V C;  2IBK A;  3U27 A;  3H25 A;  3MCN A;  2R4F A;  1TKX A;  1M5P C;  2IJR A;  2AV5 A;  2YNH A;  5DQI A;  2D9P A;  3W64 A;  2WW4 A;  1Y0H A;  5K8N A;  5KT3 A;  1S48 A;  1RT1 B;  4DN0 A;  5H1S V;  3FC9 A;  2C42 A;  5KFD A;  4PR6 A;  3TW0 A;  3R7S B;  1U24 A;  1CPZ A;  2N4D A;  5HJY A;  1RT5 B;  1S4F A;  3J81 U;  2OO4 A;  4F4A A;  1AZS B;  3FEZ A;  2PFD A;  1U25 A;  4PCQ A;  1U0H A;  3ISN C;  1X5S A;  2F9D A;  2M8H A;  5KFP A;  4AE5 A;  4NA1 A;  2CPD A;  3R8Y A;  4I2Q B;  4Y2M A;  1RT3 A;  4P75 A;  4KHP J;  5M2R A;  1CJV A;  4CLT A;  3T41 A;  1RYS A;  2KH9 A;  3DOM A;  2VG7 B;  3I4P A;  3HVT A;  3UNG C;  2SXL A;  1JLC A;  1UKU A;  2DGU A;  1J5O A;  1YJ9 S;  2JNJ A;  4QOT A;  3GSD A;  3QGH A;  2QLF B;  2BKP A;  2IM0 A;  2MKJ A;  4F4W A;  4JV0 A;  1WNE A;  1VIO A;  1EQ0 A;  2FB0 A;  4DL2 A;  1MN9 A;  5DDQ C;  1HBN A;  3TAN A;  1IR0 A;  4X64 J;  2ZZT A;  4QIW D;  2E1M C;  2ZVS A;  2JSX A;  3BBF A;  2HHH F;  1RHU B;  4ZN1 A;  2UXD F;  1NSP A;  1QAJ A;  2F4V F;  2MZS A;  3DXS X;  3W3S A;  3M32 A;  3CE8 A;  3VAM A;  2NXJ A;  4P73 A;  2VF3 A;  4YEA A;  4I6Y A;  3C6U A;  1NHK L;  1S12 A;  3VZH A;  2RVJ A;  1KNZ A;  2ZOM A;  3HFK A;  5K5M A;  5T7L B;  1HBO B;  1U7L A;  4M1K A;  3UD5 A;  1DY3 A;  4OYM A;  2AF6 A;  1KC8 T;  3T6B A;  3B82 A;  3UI3 A;  1NLK L;  4YR0 A;  4NLO A;  4FNI A;  4Y3C A;  4USI A;  1R8P A;  1EJ7 L;  1XMO F;  5SUH A;  1S0N A;  4GO7 X;  2GX8 A;  2AQ4 A;  1MNE A;  2AJQ A;  2DHA A;  1B0V A;  3L7O A;  3TRG A;  4DPY A;  2CJY B;  3QFW A;  3H59 A;  2HQC A;  1F9F A;  3RG6 A;  2RQK A;  1TKT A;  1M0S A;  1TP7 A;  2HND A;  5F0U A;  4WYL A;  4B3O A;  4YDX A;  1MLA A;  3D1O A;  1JLF B;  1Q8B A;  2HRY A;  4MFB A;  1EKS A;  4Q43 A;  1HBU B;  2XLK A;  1AFI A;  1HW9 A;  2NZC A;  2W24 A;  4CTA A;  3DI6 A;  4CM2 A;  4ZMM A;  1ZAX A;  1J5E J;  1VLO A;  3T6J A;  4UT4 A;  1FF2 A;  2CAJ A;  2W4C A;  2W2P P;  2AD9 A;  4L75 A;  2OEK A;  1W7W A;  3B78 A;  2XYH B;  2XZW A;  3M8P B;  3GP9 A;  3N6L A;  3HO1 A;  3MEE B;  4AXJ A;  1JJ2 R;  4Y6I A;  2NLW A;  1GXL A;  2ZH6 A;  2A1B A;  1VHF A;  2KT5 A;  1VRT B;  4U7U K;  3ZZU A;  5L1L A;  1GT8 A;  3IMQ J;  2ZH2 A;  3KLI B;  1NK9 A;  3R3T A;  1Q8I A;  2GIF A;  2DRA A;  2IDL A;  1OY6 A;  2BE2 A;  3WX8 A;  2OJ3 A;  1URR A;  2AJ2 A;  4A8Y A;  3VAG A;  3V6J A;  3GCW P;  5CH7 B;  4KFB B;  4QU7 A;  3TA0 A;  2B8P A;  1L3T A;  2YNF A;  5DM7 Q;  1Q5V A;  3NBP B;  5EUH A;  5DLF A;  2AEF A;  2ASJ A;  3CJT A;  4OHZ A;  5F8H A;  4DV5 F;  4MMO A;  4DX7 A;  4ZVO B;  3ILI A;  1NM2 A;  5AXL A;  2CUY A;  3V5R A;  3BB5 A;  2V4J A;  1HNW F;  1S1X A;  4LRF A;  1KQK A;  5CZV A;  4L3N A;  1KLM A;  2ADB A;  1U02 A;  2GIQ A;  2FUG 9;  1WEZ A;  3VAF A;  3OSP A;  5C2G A;  3D28 A;  1JQG A;  1FVQ A;  4C3K A;  4ELV A;  4B02 A;  2K3K A;  3DLE A;  2AYB A;  3M2U A;  2DHH A;  2FVR A;  4DQQ A;  1RYR A;  2VB6 A;  3S6E A;  1E6V B;  3AD9 C;  3KFW X;  1RUS A;  3H2V E;  3TJ8 A;  1VQK S;  2M7S A;  3GSI A;  2ZBI A;  4LQ3 A;  3N4W A;  3R5G A;  3PJ9 A;  2XZD B;  5KG7 A;  1NH8 A;  2E7X A;  1FJE B;  3RRK A;  2UUA J;  2E5L J;  2DY1 A;  2FJV A;  2B6A B;  2H4Y B;  4OYB A;  4ILM A;  3P45 B;  2GC8 A;  4ZJL A;  4GKJ F;  1DTQ A;  1FKO A;  3FDS A;  1FXR A;  4QIF A;  1UVM A;  1X9M A;  1R6V A;  3SSQ A;  2RAQ A;  2IVF B;  1L3S A;  1U1R A;  8ATC B;  3Q8Y A;  1IR2 A;  3KLH B;  5ETO A;  3G8S A;  1LXN A;  2HBQ B;  4RW8 A;  3W9I A;  4AD6 A;  4YFU A;  1P9Y A;  3I31 A;  1R8A A;  3HZG A;  4USU A;  4J9K A;  3UCZ P;  1SJF A;  1HNV B;  3CCW A;  2ZHB A;  2R2U A;  3RBD A;  4PYD A;  3HJV A;  2HQ3 A;  2WCX A;  1B0T A;  3EZU A;  5C2C A;  3U7J A;  3GMG A;  3D0G E;  3CPW R;  2I2Y A;  4HDG A;  1X4F A;  2JEJ A;  3R1H A;  1RU2 A;  1IM4 A;  1EQM A;  3TA2 A;  2MZQ A;  1EET A;  1RJJ A;  3GIJ A;  3NMA A;  5KT4 A;  2F7V A;  3OL8 A;  3TAP A;  4PQA A;  4S0M A;  3AAW B;  2ZH1 A;  2F8H A;  3SFU A;  2AEM A;  3VV2 B;  4WWS A;  1KFD A;  1O0P A;  2KFZ A;  2UXC J;  3P6Y C;  3ENA A;  2M88 A;  2MHN A;  4B9M A;  2CZ9 A;  4JI0 F;  4IR1 A;  4OV6 A;  2YPZ A;  3OXL A;  3D0I E;  4IQX A;  1WTF A;  2FD2 A;  2VU5 A;  4B3T F;  1UJ5 A;  2BAN A;  4ETZ A;  4DX6 A;  3UNY A;  1YKW A;  2BAB A;  2Q1L A;  5I3P A;  2J9C A;  5ETQ A;  4ZPD A;  1S0V A;  2ZM6 J;  2BE9 B;  3OLA A;  3ILJ A;  1CEZ A;  1YSJ A;  2YH0 A;  3PM9 A;  3TX0 A;  1RIS A;  5BYQ A;  2IMW P;  4DS4 A;  4LSZ B;  3TZZ A;  2JC0 A;  3G6X A;  3HM9 A;  1HQE A;  1Y00 A;  4DR4 F;  2EKY A;  1S4E A;  4ZP6 A;  4X4U A;  4KIA A;  4WCE Q;  4HTI A;  2QE5 A;  3I56 S;  1TL3 A;  2LDY A;  4KV8 A;  5DGB A;  1HHQ A;  3M6X A;  3ULH A;  4G1P A;  3CD0 A;  2GHW A;  1UEU A;  3MCM A;  4F25 A;  4U7C A;  3FMW A;  3M7V A;  4JV1 A;  4JI3 F;  4KPY A;  1U8S A;  4F4Y A;  1XNR F;  2KFY A;  5FDL A;  5E0O A;  1S9G A;  2AEJ A;  2W2M P;  4ED8 A;  4CT8 A;  2EKN A;  4WTY A;  2F63 A;  1SJR A;  1FCA A;  2DH7 A;  3GWC A;  1M1H A;  2COL A;  2HHV A;  3LP2 A;  2G2O A;  1N33 J;  4B9N A;  3PG9 A;  2GJI A;  3FCW A;  2OEJ A;  4LRD A;  2HRT A;  3TUI C;  2HFZ A;  3W7B A;  4DPU A;  4DL3 A;  2DHS A;  4UF4 A;  1NSQ A;  3FRZ A;  1HBM A;  4OHV A;  2K7K A;  4OX7 A;  5DG9 A;  2LDI A;  3PDN A;  4WU3 A;  1U1K A;  5AXK A;  3PR4 A;  1T03 A;  1IBM F;  3QGP A;  4LRE A;  3TVZ A;  1ULR A;  1WC1 A;  3M9O B;  3DM2 A;  1FNM A;  1ZZN A;  1Q4R A;  1YTY A;  2DTJ A;  2JDJ A;  3MM5 B;  4RW7 A;  3HDS A;  1EX8 A;  2B51 A;  3K7R A;  3T5J A;  2V50 A;  2HIY A;  4MK7 A;  4WP9 A;  4ECS A;  2BQR A;  2QJ3 A;  3P8B B;  5A0Y A;  5U47 A;  1HQU B;  4UQG A;  2MQM A;  3QZ8 A;  4ZIW A;  4TU8 A;  2OPS B;  4DX5 A;  5H9E J;  4YN3 B;  2IRU A;  4QYZ K;  3C2P A;  1TL5 A;  3BKF A;  4Q0B A;  1XEZ A;  4QPX A;  1RAO A;  1CLF A;  1H74 A;  4L3K A;  2DKO B;  1U8W A;  4Y2I A;  2MLY A;  1APS A;  2G2Z A;  3Q8P B;  2E5H A;  2M3D A;  2FJD B;  1TL1 B;  4MYT A;  3CCU S;  1UFW A;  3T1Y J;  1N32 J;  4UST A;  4JI8 J;  2GVZ B;  1CJT A;  1SXL A;  5A2Q U;  2HMI B;  1NZ8 A;  1CQM A;  1NHU A;  5HP1 B;  3OVA A;  1A7G E;  3HMJ G;  5J2M A;  4FXV A;  4RWW A;  4HI2 A; 
#chains in the Genus database with same CATH homology
 2NXN A;  3CJS A;  2YXL A;  3CJQ A;  1UFK A;  2NXE A;  3A4T A;  3CJR A;  1SQF A;  2ZBR A;  3CJT A;  2NXJ A;  2ZBQ A;  2ZBP A;  2B9E A;  2NXC A;  3AJD A;  1SQG A;  3EGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...