3CJSA

Minimal recognition complex between prma and ribosomal protein l11
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
59
structure length
58
Chain Sequence
MWVYRLKGTLEALDPILPGLFDGGARGLWEREGEVWAFFPAPVDLPYEGVWEEVGDEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/ribosomal protein
molecule keywords Ribosomal protein L11 methyltransferase
publication title Multiple-Site Trimethylation of Ribosomal Protein L11 by the PrmA Methyltransferase.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 11
structure length 58
sequence length 59
ec nomenclature ec 2.1.1.-:
pdb deposition date 2008-03-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1170 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Sun protein; domain 3 3cjsA00
2NXJA 3EGVA 3CJRA 3CJQA 3CJTA 1UFKA 1SQGA 2NXNA 3CJSA 2B9EA 2ZBQA 2ZBPA 2YXLA 2NXEA 2ZBRA 2NXCA 1SQFA 3AJDA 3A4TA
chains in the Genus database with same CATH superfamily
1NUEA 3UNYA 4DR3F 3KFWX 1WKJA 3T1YJ 3JS9A 2MZSA 5GAGU 2ZHOA 1TKZA 3GYXB 4X66J 2W4PA 2GMHA 2V63A 4F3QA 1EKSA 3BN7A 3LO3A 3I0SB 2ROPA 2JLGA 1IJEB 1HNVB 2GW8A 2KO1A 3JQJA 3U1NA 4LVNP 1JX4A 3R3TA 1LW0B 5IQ6A 1RAHB 2W7OA 4NEZA 5KG5A 5HL7Q 1HA1A 4F02A 2FC9A 1WACA 4K0KF 1HWUA 3KLEA 5HSPA 3NGTA 3MEDB 1HR0F 2HS4A 1U1NA 2DVIA 4HKQA 1RT2A 1HNZJ 2IRYA 1M1KT 2F8MA 2HQFA 1JLAA 4CDIA 3VGTA 5G0RA 3GU0A 3FBFA 2EKYA 1FT8A 1TQLA 1HI0P 1IR2A 2G13A 3LOUA 1B7FA 2BVZA 2AU0A 4H4MB 4JOUA 3AY0A 1DJ0A 3MR2A 1RTJB 2YWEA 5IQQA 3CTRA 3A3OB 2KM8C 2FUG9 1AT1B 2LEAA 2OSRA 1BMQB 1KLMB 1WSVA 2HRYA 4LFCF 1H3DA 2R7SA 1TL1A 2PA3A 2RD5C 2W4DA 1X4DA 2KRBA 3HZGA 4EGLA 3MZIA 5A8RA 3EPGA 2KU7A 4NYPA 3ETMA 2OPPA 2R2RA 2AEJA 2CNNB 1NHUA 4ETZA 2G1HA 2YBVA 5FLXY 2DITA 1RT1A 2N82B 3TQEA 4JI2J 5CH7B 3QWUA 2D9OA 1FE4A 1Q5YA 4O0NA 2EFPA 3M2RB 1GQEA 1JJHA 3GB0A 4NWBA 2R8HA 4HVZA 1HMVA 2J76E 1MW7A 3A8JA 4QYRA 4U7CA 3NOGA 4E98A 3QT5A 2YNFA 4JI4J 3KG4A 3KK2A 1RYRA 3GP9A 1IM4A 1PAUB 3P8BB 3N6MA 2FPHX 2YKMA 2CVEA 1AROP 2PMWA 2W9CA 3CUNA 2V4QA 1NDPA 2ZBCA 3QFWA 3BREA 3LANA 4PXEA 1DTQB 3DOMA 2LYVA 3BGFA 4USKA 2UUCJ 4ITSA 1SC6A 4MH8A 2UU9J 1X5TA 2F4VJ 5F8MA 3W8PA 2IYIA 1X4HA 3T1YF 3HHLD 1ICEB 3D1HA 4ZVRB 1JWWA 4X66F 3UDVA 3V2UC 3BKUA 4A46A 4C8KA 3HT0A 2DHGA 1EQMA 3MPDA 2QL5B 1QAIA 1C1CA 4IG3B 1T05B 4I2QB 5IZHA 2E5IA 1U2CA 4ECRA 1FKPB 3ET6B 4GVBB 3Q8SB 2NZCA 3CO9A 2XGQA 3C3LA 1UEUA 2EWHA 2MSTA 1FFGB 2ZM6J 2DO4A 1U6BA 3UDCA 4XDDA 1HW9A 2CRLA 1DQ8A 1JLEB 4DV4F 3L3CA 3LWMA 3SSRA 2W8LA 2YX1A 3KLFB 2R8JA 3JQMA 4Q8FA 1S76D 2F4FA 3QSYB 2ZBPA 2FLLA 2GGPA 2WB4A 3I32A 3TAPA 1WF0A 2H5JB 1GXUA 2KYXA 3T41A 3VAFA 5T14A 1M5VC 2VG7B 3SQGB 3AFGA 2D3UA 1YJ7A 3K7RA 4DQPA 1PBAA 2VU5A 1L3SA 3K57A 3ZXWA 4ECWA 1KONA 3NOCA 2HVHA 4XK8C 1VDHA 5HATA 5K14A 1NK8A 1PJ6A 5B0AA 2KHCA 2DHXA 2P6SA 1VK8A 1VHIA 4ZPCA 3HSGA 2M70A 3G87A 4DOZA 2VPYB 1IKYA 4ZK7M 4TNOA 2AWZA 5I4MA 1HBUB 1OWXA 2A2DA 2LEPA 1SBRA 1LWFA 3M6UA 4JI2F 2KM8B 4A8QA 1XMBA 3CC4S 4G1QB 5I42B 4U7UD 1YRUA 2IY5B 1XJWB 4QJVA 3NBPA 1FK9B 2DR9A 2JC1A 3DLKB 1RT4B 1M5OC 2V67A 4JI4F 3MM5B 1H73A 2XMVA 3CDBA 2J7KA 1T8EA 2OKQA 1APSA 1HNIB 4KBIA 2DGVA 3DHWC 1JXEA 1DZ5A 2C3MA 4P73A 3OTOF 4H4KA 3TZWA 4RBUA 2UUCF 2RUSA 2BABA 2DNLA 3GR0A 2CYYA 5D4LA 2RU9A 2W2QP 2A18A 3R27A 3C6TB 4DSLA 2Z57B 2PC6A 4L3NA 1RSCA 2ZDPA 5AE2A 2FTRA 2KVIA 3RR7A 4CO1A 2VG5B 2V68A 1ZZNA 1SUQA 4DL7A 3ZC4A 2HIYA 2HHQA 3AXKA 3CJ5A 4ZDNA 1PG5B 4ZVTB 3UO0A 4PRFA 2A1BA 2K3KA 3M8QA 2NYIA 3MTKA 1TFWA 3VCDA 4OL8A 4YDXA 4N47A 1BQNA 2ALYB 2GVZB 3R6LB 2FQQB 2HFOA 1L3KA 4RW6B 2ZM6F 4KO0B 2P9CA 4F3OA 5HJXA 2XSJB 4F4WA 2GHWA 3GQCA 1VFJA 1S48A 1TU0B 2EKNA 1NSPA 5J1NA 4B3TJ 4UOFA 3GIKA 1T95A 1OYEA 1RT5B 2GIQA 3UD5A 5BJRA 3NCRA 4ID5A 4J9NA 4K2JA 4U67Q 5ETLA 4B02A 3A8IA 2HAFA 3MPUB 5LXRA 1HLWA 3W62A 4IOBA 1Q7YT 1HWIA 4ZVEA 1HQ2A 4UTGA 4BBYA 3U7JA 4ZVFA 1FKOB 5F9LA 3TJAA 5BXIA 2YTCA 1V5VA 2JEFA 3Q2SC 1QLNA 4KQZA 1FRIA 3BV8A 1V5IB 1NZ8A 2LXFA 1NXIA 1TFYA 2L9DA 4KV8A 3I5BA 3DRSB 2VKRA 1X4GA 1FD8A 4JI6J 3ZTSA 3GFZA 4A8XA 2UXCF 3OV7A 1U1PA 2XS7A 2HZAA 2DO0A 3CVKA 5HQLA 1GX6A 1JB0C 4B9VA 2YKNB 1ZZFA 4A8KA 5IT4A 5KFVA 2DNNA 2YQ1A 2K1RB 4QWBA 3DOKA 2OFGX 3C16A 2VA3A 3C6UA 3DNCA 2AW0A 4KKOB 1ZA1B 1S79A 1C0TB 4KR0B 4J9SA 4HACA 1GTEA 3RAXA 4IQMA 4DG1B 3D5MA 3T1AA 5CQGA 2B3TB 4M5GA 1UJ6A 1REGX 1RAAB 1VQ4S 3W9HA 2WVBA 3ZTQA 2NXNA 4CYUA 3M8ZA 1X4FA 1XTZA 3VGVA 2QO3A 4CTAB 1TL3B 3K2YA 2CQCA 2RHSB 3QGIA 4CLTA 4OX9J 3WC2A 3TA1A 1RWOB 3UNGC 3NY0A 4NXNJ 2NUHA 3ITHA 4C11A 2RB7A 2QJ3A 1S7HA 2ZHBA 3MAAA 2ZJRQ 3ETOA 2QFJA 3NNCA 1RISA 4P2FA 2AJ4A 4X4TA 4L6V3 2K8GA 2HW3A 1TKTB 1SC1B 4F0MA 2O67A 1WC0A 2KYZA 2AX0A 3HSJA 1G7CB 3FMBA 3Q22A 2DH9A 1DTTA 1RB0A 3PCOB 2JFDA 3G96A 5KT2A 4TXSA 4LFBJ 4RW4A 4GKKJ 2BJ7A 3GJTB 1VQMS 2GIRA 7AT1B 3OFFA 3H0PA 3VWSA 3IR7B 4DV5J 3MR3A 4HDHA 1UA1A 4XPCA 1FHTA 2X51A 4C8MA 1X9SA 1Q81T 3H25A 2MSSA 4Z7YA 2VG6B 4NLPA 2HVEA 2IM0A 3O8WA 1FRLA 2HSEB 5CA5A 3RBEA 3ISZA 5HVFA 3IAM9 3TQ1A 4NEYA 4FP9A 3R5AA 2E5HA 1FRXA 1DQAA 4USMA 2R42A 1IKVA 1HQUA 3M2UB 2UV8G 3DOLA 4USWA 3CDWA 1CJVA 4MKBA 2CNOB 4G1IA 2F3JA 1ZPWX 2W25A 3QPIA 2XS5A 1IWGA 1AA1B 4LFAF 2KXFA 5ETVA 2DJWA 1I6JA 3Q8RB 4Q0BB 1JLBA 5E2QA 4JV1A 4OZNA 1RWNB 5J2QB 3KJNB 2V9WA 4DBQA 2UP1A 3KLIA 2XLKA 5C24A 4A4JA 4WZMA 4K4WA 1U48A 3KHLA 3CJTA 4I1TA 3H2LA 2VQFJ 5ETQA 4QW9A 1B0PA 1PBUA 1VQOS 1S6QA 3EGZA 2IRUA 4EUVA 1CJTA 1EETA 1LXJA 2E7VA 3AQPA 2HIQA 3LGHA 2ATCB 4M5HA 4K4SA 4WBFA 1WHXA 1FCAA 1GT8A 3J80U 4PWUA 2VJVA 2RE1A 2QA4S 5C25B 2UVWA 5EWFA 1D1UA 1VQNS 1L3UA 4OX9F 2PDAA 2H3EB 2ADBA 4NLTA 2MB0B 1FTCA 1ZTTA 4FNHA 4DUZF 2PFFB 3JYTB 3D54A 4WE1A 2ZD1A 1NJXA 1UPMB 2QSWA 4JUZA 4ZKAA 5CYMB 3ZTPA 2FZGB 4C97A 2JEIA 1Q8IA 4J9QA 2Z56B 4KGZB 3UR3C 2WRMA 4NMXA 2ZNYA 1VC0A 3BSNA 4DZ6A 4KRWA 4LFBF 4P71A 4PQUB 4KYZA 3J7YI 2VC1A 3T3FA 4GKKF 3NGSA 4ECQA 4PXBA 5D77A 1NKCA 4DS4A 2ACYA 3SQOP 1OSCA 2NREA 3J7A1 4MYUA 1FFWB 3B4DA 5KFCA 2BM1A 1M5PC 2FVRA 2RKIB 4K7QA 4X4OA 1RUSA 2HNYA 3DRXA 4OYPA 1JKHB 3SMZA 1KVKA 4OLOA 2YNGA 4ZOSA 2DNQA 6FD1A 3V6JA 2C28A 2ZBIA 4ELVA 2Z8QA 5F8JA 4XTTA 4WU2A 3AB4B 5A2QU 4OJ3A 5L46A 2PMHA 1X9WA 3SFUA 5DETA 4ZS6A 4WKYA 3DGPB 3DLLQ 4TYBA 1TMJA 4JI7J 5BYQA 3SYZA 3SCLE 5LXYA 2YNIB 3LQVA 4OJGA 1JK9B 1SI9A 1N5VA 3M8RA 2LQ8A 2OELA 3DDIA 3PO4A 4PG7A 5A6WA 3KK3B 4LF7J 4DX5A 1S5ZA 3I96A 1NB2A 2WVEA 1MMNA 1BE4A 4BLGA 1HI1A 3C19A 2R7TA 1RBAA 1WWHA 2IRXA 5ETMA 5CYQA 5F3ZA 2EG1A 2AGPA 4JI3F 5HMYA 3UW1A 4P7TA 1RTIA 1W2BR 2VQFF 2MQOA 1Y4ZB 2MLZA 2LXUA 1VQ7S 3MM6B 4DR2F 5HP1B 4ES1A 1RHQB 2AJ2A 2LQ9A 2QLXA 1VLOA 3C15B 1A9NB 2YPZA 1Q79A 3BBFA 2E1PA 3MMAB 2PI5A 3E2EA 5K9FA 1GFWB 4QWEA 1YJ9S 1S1TB 4F4YA 3NP5A 1N48A 3M30A 1EQ0A 3SV3A 2NXEA 3DLBA 3MURP 1EJ7L 3D0GE 4DJBA 4ED4A 4L73A 2OEJA 2C2KB 2KXHA 4QWCA 3PYFA 1HQEB 4DZDA 1JLQB 4FYDA 4UZBA 3THPA 1F9HA 4DL3A 1QAYA 3FC9A 2V8DA 3DKDA 3IMQJ 1WI6A 4DV6J 1QVGR 2GC8A 5KG4A 3R7NB 2A2CA 4P7VA 3DMJA 4NLQA 1KRPA 1L3VA 2IC3A 3TZZA 1N33J 2KH9A 1S1VA 5D4NA 4L72B 4I67A 4M5KA 3PX6A 3POTA 2O3DA 3R97A 3W2VB 3GWCA 1NZAA 4AL5A 5CD4H 2AP6A 1KFSA 1UA0A 3C8YA 4RL1A 4OFZA 5KG3A 1ZAXA 1UCNA 2IVFB 5KFZA 5DG8A 1FE0A 1REVA 1GAOA 2YH1A 2WCXA 5DGAA 3R2DJ 1YDLA 2FHJD 2B9YA 4I2PA 1YJVA 3BR8A 4ZP9A 2ZE2A 1VIXA 3IG1B 2JSXA 2XQCA 3RB4A 1N36F 1JQGA 3HD1A 1RT3A 4HH1A 2WSCC 5LMNJ 4PYDA 2EFQA 1B0TA 2V2VA 4JI7F 1FI4A 4B3SJ 3CCJS 5KFEA 4EYIB 3ZNJ1 1FXRA 1DLOB 3W2WB 1X31C 1F60B 2IAJB 1WF2A 2CA9A 5CZVA 2CPJA 4ZLLA 4IO9Q 4AXJA 4OZJA 5CXTA 3LW5C 2O5DA 3VAJA 4RR5A 1WSRA 4ETXA 4DR5F 3ENAA 1S9GA 2CJBA 3KK1A 4FBUA 2R7VA 4DF4A 2E1RA 3CGIA 3BJYA 3B8HA 4LIWA 4FBTA 2H51B 2DY1A 1H2TZ 3JSBA 1N6QA 2HWHA 4DLEA 2ZKTA 2VPXB 4URGA 1LFWA 4ELUA 1CULB 4R8UA 1BD6A 4U96A 5A0YB 2DNYA 3CB4A 3MMBB 2ZITA 3F41A 2FVCA 1AZSB 2B8PA 5BR8J 1DAXA 1X4BA 4OI2A 4Y6IA 2QV6A 4E0DA 4DL0C 2FJWA 2XNQA 3IS9B 2QIFA 3A4TA 5H9FJ 3D6HB 4LT6A 3MDFA 4CP5A 4Y34A 5H9FK 1HNWF 2VICA 5B0BA 1RTHB 3RR8A 3FKBA 3M6XA 2XC9A 3ZNUA 2IMOA 2ZDOA 3MFIA 2QA2A 4ICLA 1U8SA 4R5PB 2VFSA 5IFMA 5KFJA 2XMJA 3RU0A 2FJEB 4F50A 3IRWP 1XIQA 2DB1A 3GZ7A 4KE5A 1WTFA 2KVQE 1N33F 3QO9A 1BQMA 1FDNA 1TTHB 5GAHU 1RA6A 3TUZC 3OSNA 4FDFA 2DGWA 3N0VA 4ZVOB 5FD1A 2KI2A 4IFYA 3THVA 2ALZA 1X9MA 4Z2XA 1SIZA 2LU2A 2M2BA 1CBKA 3KLGA 1RHJB 3IRXA 2HKEA 2FC8A 4D3GA 2C1EB 5B0EA 5B09A 3H5YA 3CULA 1CC8A 4ZJQA 1YLXA 3CCWA 1V9OA 1Y5NB 2KL8A 3EX7B 1ZPVA 2XO6A 4DX6A 3RRGA 4OI1A 1ZAVA 1TKZB 4NLGA 2F9JA 3HVRA 5LMNF 1GMWD 2DEJA 2DNMA 1XK8A 2BA9A 4CLWA 4RPFA 3FSXA 4DV0J 4B3SF 4ED8A 3HSDA 4DFPA 2PA8D 4USVA 1RHRB 4CLSA 1KBRA 2HVZA 3SEOA 2YKPA 2E66A 4PABA 1IUJA 2AHOB 2FJBB 1Q4RA 4FYYB 2CKWA 5ETKA 5F0WA 3MWBA 3KLEB 2B9XA 2BJ1A 2VOPA 3WQPA 4CM0A 1D0EA 3P49B 1VI7A 3TJ9A 4UOHA 4KHPJ 4YHHJ 1RT2B 3GV5B 2DNRA 1P6TA 2DTJA 1JLAB 2EW9A 1TUGB 5G0RB 2EVZA 1NPPA 3MOZA 4A48A 3ILIA 5CAAA 2GO8A 2BQUA 3TW0A 4ZP8A 3UCZP 2VASA 1C1BA 1RP5A 3HFZB 2QLWA 2YY3A 1CEZA 2AZ3A 3RAMA 5DZ6A 2H4WB 2HQIA 4PPDA 3Q8QB 1Q82T 4LF2A 1TL1B 1JJ2R 3BKFA 1T9XA 1P9QC 3ICLA 3OR2A 3PY8A 1TUWA 2HHHJ 5A8RB 1HKAA 4OI3A 5EN1A 7FDRA 5DQIA 3R9LA 2HLUA 3HZEA 1ZM4A 2OPPB 3BO3A 4RU2A 4HR2A 5HAOA 5AT1B 2J0XA 3IM9A 4H4KC 4QIFA 1RT1B 5KFDA 4G6VB 5KFBA 3QQCD 1WG5A 3AJDA 2C42A 1LWCA 1HWKA 1HMVB 5KOWA 3OVAA 2IFXA 1FEHA 3AOCA 1BGXT 2YNFB 3A8EA 1HIYA 1R43A 2YKMB 3P3DA 1KVIA 2Y0BB 3DLEA 2QT7A 1M0SA 2XY6A 2BE2A 1R0CB 4DFMA 4RW7A 1LWXA 4M63A 3QWPA 2OLWA 4FYWB 1H38A 5I3QA 3M6WA 3DHXA 2BBEA 1EP4A 4PG8A 2OGUA 3D6FB 4C8YA 4CLUA 2FJAB 2B4OA 2MQMA 1UMJA 5DZ7A 1KQKA 2R7WA 1MN9A 2RQMA 4DV0F 1NH8A 1C1CB 4P72A 3US5A 4O0IA 3EDQB 4Y28C 2BJ9A 4LF6J 2XY5A 4KSEB 1FRHA 4QOTA 3BGRB 5LL6d 2P9EA 2DRAA 5HMZA 1KSPA 5D0GA 3BH6B 2CNKB 1YZ7A 4C3LA 4F67A 4YHHF 4NZ6A 3ZTRA 2KG1A 3QNWB 9ATCB 3K8VA 2GGPB 3CJQA 1RABB 1UW9A 1RU2A 3BGLA 4OYOA 2QC3A 3L7OA 3UDLA 4K4VA 5T7LA 3MD1A 2HK2A 1KQSR 4ED2A 3N5BA 1VQYA 2BJEA 5J2PB 1F6TA 4DF8A 5F8NA 2ZHAA 1N56A 4YR3A 4Q43A 1MU2A 1UVLA 2XB2D 2YH0A 4WWSA 1FFSB 4KJIA 3K5LA 2WW4A 5J1EB 2VFTA 4A8OA 4KC5A 2VH7A 3LUYA 1WC6A 2BJDA 3TZXA 4CO2A 1Q1KA 3GYNA 2HHHF 4D3HA 4DSEA 2GFFA 5JVHQ 1VISA 2UZAA 1G4CA 3HO1A 2ZC4A 2C2RA 5DG7A 2HHVA 1IQZA 1LWFB 3R5BA 2F8HA 3EE3A 4QIEA 1RHUB 4J9LA 2EXUA 1SPBP 4O44B 3NBPB 2DCUB 3DLHA 3PM9A 5KOXA 1BHNA 4DCPB 3NMRA 2NXCA 2QTWA 4UW2A 4P10A 4JYAF 1U2RA 1C4CA 2NXJA 4J91A 2HQGA 3AQOA 1UVKA 1XMOJ 4C8NA 3W66A 4MFBA 5G4DA 2BMBA 3S01A 2B43A 1TVRA 4OZLA 2DPIA 4ILLA 4QPXA 4YN3B 5M2UA 2VDIA 5KT5A 4UQTA 3D6MB 4HTIA 4RBTA 1ULRA 1FWKA 1U25A 4JB8B 1SUQB 2QA4G 2AJ0A 4L3KA 2YX4A 1DQ9A 2DNHA 4DV3J 2ATLA 4V19X 4IRKA 4RKUC 3MM7B 3M8QB 2CQBA 4NYZA 3S1TA 1VCTA 2V2ZA 2FHMA 4LF6F 1BQNB 2ZZNA 3T6BA 3HKWA 2ZJPQ 3L7PA 4OZ5A 2CJXB 2RQKA 1XNRJ 1CVJA 3NGRA 5E3AA 2I0XA 4ID5B 3MAQA 3CMAS 1O5JA 4J7CA 4M1KA 2QMUB 2KG0A 4LR7A 4CRJA 2D3ZA 2XMWA 1AUSL 2Q66A 4LQ9A 6FDRA 4WZQA 3QT7A 4YB7A 3CF5Q 4CLKA 2WONA 2CWKA 4X4NA 3H42A 3L09A 2MPUA 2DYAA 1RAGB 1S9EA 3JTNA 4M5JA 4YQWA 4CT9A 4KV8B 2JLEA 4TU9A 5U47A 2R8IA 4WU3A 1YJWS 1BWVA 1WKKA 2D41A 3NAHA 4P74A 2XY7A 3HMJG 3RG6A 4IH5A 1YG0A 2RDDA 2GMLA 2QRRA 4C8ZA 4LF1A 1W26A 1UP1A 3DOKB 3C16B 4RJVA 3M32A 3C6UB 1ZS6A 2EFOA 4RBVA 3AA9A 3OQ2A 3W65A 3OFEA 4HACB 4AL6A 1BXNA 4C6AA 1NK0A 1URNA 3FVYA 4O3PA 1KD1T 4K4UA 8AT1B 3NNAA 2ZOGA 5AXNA 4LMZA 5KFNA 1GXLA 5FJ4A 3M05A 3WHIA 4CYUB 4X62J 3CMQA 3NLCA 1HPZA 2ZZMA 3TARA 3WX4A 1HYSA 3DC2A 5CHCB 3X3UA 3LP0A 2KZMA 4DPXA 4OV1A 3Q23A 3ZTOA 3ITHB 4C11B 4OX6A 1F0XA 3BPSP 1R7IA 3MAAB 2OIHA 1K8AT 3H2UB 4ZMMA 2JH3A 1JMTA 3CT9A 1JLFA 3MUMP 3MUTP 5IT0A 2G9OA 4IR1A 2KZZA 3G9CA 4OZ0A 4QQBA 3HFVA 3PIOQ 1KFDA 2B0GA 1DARA 1DTTB 3Q8VA 5BYSA 3W8GA 3NCQA 4RW4B 2V34A 1WOOA 2ZH9A 1XNRF 3GG0A 2XCPA 4CLPA 1MWYA 4AD6A 2MJUA 3OFGA 1FJ7A 4V19J 2BZ2A 4C9DA 2XCAA 1XBWA 1FJGF 4PKDB 4M5MA 2A0FB 8RUCA 4EK2A 3TVKA 4J90A 2AGOA 2PIIA 2K06A 2DEIA 3K58A 1XNQJ 3DRPA 2H4YB 3CCUS 1Q7LB 4X64F 1K73T 4ZCLA 1IKVB 2C2EA 4I7FA 1HQUB 4ZN1A 1FWPA 3DOLB 1IKXA 4EMDA 1CJVB 4RO0A 1PYTA 2Y1JA 4YB5A 3MEGA 3OR1A 4O3SA 1FO1A 4ZPVR 2B5JA 4PG5A 1YGYA 1MROA 3NGDA 3BYRA 1VLYA 2QLBB 3SCIE 2LA6A 3ILJA 4ANEA 5E3QA 1JLBB 2DIUA 1Q8KA 4OHXA 4OX8A 2IA0A 3D0IE 4FF2A 1NSKL 2K3IA 3CJ2A 5DS7A 4ED5A 1CQNA 1NJZA 5C24B 4ZLPA 2J7WA 3TAQA 3R5CA 2E7WA 1IVZA 1KHVA 1S6QB 5D0RA 1FD2A 4LBPA 5KAKA 1CJTB 1EETB 2XI3A 4BC9A 2I6WA 2DNGA 1YI2S 2YWWA 3E3XA 1NH7A 4DQSA 4X62F 3AT1B 3V4IA 1J2VA 4QIVA 2DK2A 1GXTA 4BHQA 1W2IA 2M3DA 3OTEA 2CPIA 2JEJA 4Y00A 1U4BA 1VGYA 4XAKA 2F40A 4DI6A 2R7UA 4IOAQ 1K44A 5KFGA 1U0HA 3DLGA 4Y2CA 9RUBA 4CQ1A 4UY8T 4F8RA 4IDKA 4ES2A 5GMDA 4WE1B 2ZD1B 3OL7A 2Z4PA 2N3OA 1Q78A 4USTA 2K2PA 3AODA 2I1RA 1NDCA 2J9DA 5JUMA 4B3OA 1ELOA 5L1KA 3NS6A 3HF5A 3Q8PB 2BEFA 1U6ZA 4NCAA 1ZM3A 2OTJS 4HYKA 1JLCA 5E3RA 2W9BB 4NASA 3BQ1A 4KT0C 2EC2A 1EHWA 2LFVA 2XNRA 3QIPA 3BDPA 2IBOA 3KJFB 1JIHA 3OXGA 1WG1A 2IM1A 4MKAA 1IM6A 4N76A 2WAQD 2LLZA 1DHMA 3E8OA 2DIVA 4Y0FA 4GO5X 2HNDA 1SXLA 3WBZA 4CCHA 1DURA 4F3MA 2XSFA 4IRCA 3BO2A 1T3NA 2HNYB 5GMKa 2YNGB 4MAKA 3HHEA 1HHTP 2LDYA 3H4DA 5HI7A 3SFGA 2L08A 3EVMA 1KLMA 1T3OA 4MK7A 3SCKE 3UWTA 3EYZA 1RAOA 2FVPA 2YQ3A 1O6XA 2BACA 3K5OA 1WNEA 1CJKA 2PFDA 2EK1A 1Z2LA 2EPIA 4Q2MA 3JSRA 1HD1A 4LSZB 1WDDA 2PD1A 2PN6A 5GAGI 1VK3A 3EZUA 5DDOC 1SKRA 2KN4A 3H4BA 3KHRA 5LSRA 3MPWA 2UVVA 3ZZOA 4UUXA 3AB2B 4X84A 4I6WA 1HI8A 3KLVA 3NMAA 1S1XA 4DV7F 1YBUA 2P6TA 5CYQB 1TZ0A 2EC0A 5F8HA 2ACMA 2H5IB 1RHKB 1HD0A 3GIRA 1RTIB 1NKBA 3R7SB 2EFVA 3ZZ0A 1U0SA 4Q7AA 3C2PA 2ZWPA 4PAAA 5IS2A 4F36A 1RTDA 2N7YA 3IFEA 2LKZA 2V4JA 3MFHA 3EUNA 3E01A 1U02A 3PACA 5K8OA 3JB9k 1QD1A 2PO4A 1EKRA 4LRDA 2ROGA 4YDDB 2MQNA 4N41A 1F5AA 3ILOA 2Y1RI 2Y0SD 1G1XA 2HHTA 3M30B 1QUVA 2DT9A 3N4WA 1S0VA 5AXLA 5D0EA 2RVJA 5K8MA 2QEXS 1ZETA 3C14A 5AE3A 4N5SA 1SQGA 4LF8J 1T9VA 2CZ4A 2CJAA 2M4MA 1LV5A 2ZNZA 1NU4A 4DX7A 3BR9A 1LQ9A 5LJ5Y 2NSCA 2M5YA 4Y65A 1ZOTA 3GJSB 1VQLS 3QGHA 2M9KA 1RWKB 2HQ3A 2XLJA 5GMEA 3VQTA 2ASYA 3V6KA 4LRAA 3PHEA 2AGQA 1Z1ZA 3GIJA 1YRXA 2W2NP 1K0TA 3DMJB 1YTYA 1Q16B 3QJJA 5AJ3J 4OZ3A 2IC3B 4ZCKA 4OV6A 5A2QY 5DGBA 1S1VB 3RAQA 3QZ8A 4ECVA 1NDKA 4R0JA 3POTB 4LF9F 2W7AA 4JI1F 1IBLF 3RZAA 4F04B 3PW2A 4NOHA 1N34J 2I5JA 4HI1A 3FNNA 3LP2A 1QJHA 3B6BA 3T1HJ 2CPFA 1YKWA 1VS3A 4NCBA 2W2MP 2YX7A 2KJWA 2Z2MA 3CJSA 1U1LA 1NEEA 2C2ZB 4CM2A 1REVB 4P2MA 2DNOA 5KFSA 3TP2A 5E3CA 4USHA 3FRYA 1OY9A 4YR2A 4I2PB 1P9YA 1DFDA 1UVIA 2ZE2B 3DN9A 4DDFA 1RT3B 3WDOA 4IO1A 5B0FA 1J5OA 2HHWA 2HVDA 2FJXA 1ZAWA 2AJ1A 5ETNA 4ZVQB 2YVSA 5CCMA 2ERRA 2G2ZA 2X3DA 5RUBA 4C4WA 2OUGA 1NAQA 3TJ8A 4LF4F 3GTYX 1K9MT 3PG9A 4UOCA 1BC6A 2CQ0A 3CJ8A 5EUHA 3PV8A 4BWJA 1NJIT 1VBXA 2E5GA 2AYBA 5D8HB 4EO8A 2AEFA 4PUOA 1IR1A 4B3RF 2LVWA 4DR4F 1S9GB 3U1LA 1TK0A 1QE1A 5IM0A 3KK1B 2RMLA 1IJFB 2VJUA 4W92B 3VZHA 2OPSA 3D3CJ 4GKJJ 1G3OA 1PC5A 3W9IA 3VQSA 4CH1A 1N6QB 4H4OA 3KJQB 2PSZA 4N8NA 3BPDA 4R8UB 4CLZA 5DJBA 1O51A 4L75A 5E41A 1VJQA 1IBMJ 3FBBA 3S7RA 2DRDA 4AT1B 5T41A 4IFVA 1M5KC 1SH0A 4DR7J 5LM7E 4TY8A 1NHKL 4CNYA 1X5PA 3ENWA 2XZTB 3D9BA 2RUGA 1VRQC 2IM2A 1CG2A 3VAGA 1U6FA 4ICLB 3UCUP 4WKRA 4DUYJ 4P6QA 1S6UA 3FDSA 5ETTA 4CH7A 4KFBA 4DR6J 4GMKA 2DHAA 2VBYA 3IWXA 2QYCA 4OQJA 3V6DA 3TAMA 1WHWA 3HPOA 1RXOB 2GJIA 3SI8A 2OHDA 5AJ3F 4B3MF 5CABA 3QO9B 2C2DA 1BQMB 3R1HA 2ZVSA 3F44A 3RB0A 1FX2A 5B7WA 5L38A 2BR0A 4IFYB 4WFAQ 3UN2A 5KT6A 2HAIA 4FS1A 3IRXB 1N34F 3HJFA 4OI4A 4HHHA 3OTCA 2PE8A 4QR0A 2H54B 4DL2A 2NZ4A 3CJKB 2GS8A 2BRKA 5D15A 1N5QA 1R3NA 4NLRA 3PVXA 4ZJOA 1BQXA 5JMNA 3I9V9 1FJEB 3V81A 2H65B 4FKXA 3NRBA 2MQ8A 4OI6A 4G1PA 2OEKA 1KOOA 2DRBA 3NS7B 4A8YA 5K5MA 2M52A 2Q43A 2APOA 1RAJA 2X3GA 3G4SS 2R7QA 4BWMA 1RWUA 4QZVB 3D1OA 2XEXA 4PXCA 5DQGA 1RT7A 5KTQA 2XI2A 4HHJA 4HT5A 1H72C 5IWAJ 1FXLA 4QW8A 3H20A 1K1QA 1WC1A 1HBOA 5D6GA 2QMXA 1HHSA 3R1LA 4TU7A 3B4MA 4DSJA 3LTOA 2ZUAA 2H5EA 4UT4A 5KFFA 3AH6A 3B54A 3MPYA 4RUBA 4USUA 3AXMA 1PCAA 4TVAB 2ASDA 1KR4A 1XQIA 3W1YC 5E5NA 1S72S 2V50A 2NUUG 1WEZA 3FBCA 1KOHA 1L5UA 3IWLA 1T9UA 2R4FA 2J6SA 1IBMF 4F7VA 2W7PA 1QSSA 1HNZF 2AEMA 5AXMA 3NGKA 2ZC3A 1C1BB 4LF5J 5IV4A 1SIWB 4I4BA 4B9MA 1QSLA 4FXVA 5IT9U 4RUAA 4TYAA 2WHOA 1S0NA 5KFHA 5AXKA 1SC3B 3GV7B 5L9XA 1J27A 4ED0A 5F3TA 3C66A 2XO7A 3OR2B 3CJRA 1U1KA 4E8UA 4PWWA 2LQBA 4EBDA 1LK7A 5IC4B 4DUYF 5K8PA 1RKIA 3D2WA 2GCFA 2OI2A 3CSKA 4DU7A 3MCMA 2HG4A 4DR6F 2OSQA 1OMSA 2X1BA 3PFEA 2N7CA 3FCWA 1LWCB 4QIWD 4DWIA 4Q44A 3VAKA 2QYGA 4OMFG 1PAEX 2J8AA 4KHMA 1VJWA 1HNXJ 4WYWA 1Y3KA 5I3PA 2GQQA 1R0BG 4C98A 1GNKA 1K47A 2JL9A 1VRTA 3DLEB 2IHR1 2BE2B 1FNOA 1D9AA 4RW7B 4ANCA 3G2XA 4URSA 4RWWA 4KH1B 2D1CA 2RT3A 2KT5A 1EP4B 3ILLA 2J6UA 1LK5A 4DQRA 3EZ5A 1HBMA 1OY6A 4DHVA 2L41A 5DDQC 3QGPA 4MIAA 2GAGC 4U6PA 3MCSA 3OJSA 2HBYB 3HVTA 2Z30B 4G3IA 5HBMA 3IN5A 3CD0A 4ZPDA 4K4TA 4OYZA 2UU9F 3J81U 4BDPA 2F4VF 3PJXA 4TN2A 2YWHA 3KYLA 3JTPA 3FEYB 3O1LA 2HVIA 4O4GA 2RH3A 3BEGB 4OJHA 4RLEA 2RU3A 2AT1B 4ILMA 3DRRA 4RU9A 1M1HA 2EBEA 4Q45A 4CLLA 1XWLA 3PJ9A 3PEHA 4FF1A 1U1OA 2VPZB 5IWAF 5IOLA 4WTYA 4X2BA 2AX1A 1SV5A 1S9FA 2NYHA 4F4XA 4KAIA 2YXLA 4EYHB 2V8VA 3ELHA 1FDDA 2WTFA 4RX6A 1N32J 2KFZA 1NLKL 3PW5A 1YJUA 2P2CB 3V6HA 2VB6A 3Q8UA 2VPWB 5KFUA 4KGMA 5CZXA 2HURA 1X0FA 2L3MA 4IYQA 1SL1A 3J7Z5 3QJPA 5T7LB 2NS1B 2BJ3A 4DR1J 4AE5A 1Q8LA 5HLFA 1W25A 4NE9C 3IWNC 3EXCX 1T9WA 3OW2R 3TZYA 5J2NB 3JYTA 1MU2B 3MR5A 1N8RT 2E29A 3CCQS 3T6JA 3PZPA 3EZOA 2U2FA 3QIDA 2OMOA 3PDNA 4BCAA 2W2OP 1ROFA 2DGOA 2VFRA 3JSYA 3PX4A 3N01A 2BUNA 1NNDA 4DSKA 1U09A 2QL7B 2MQQA 3FEZA 3NWGA 3VF0B 3PYEA 3KUEA 4USJC 1NK6A 1MN7A 2C3OA 1CPZA 2CPHA 1R0AA 1P27B 1ZH5A 2ILZA 4I0WA 5ETRA 3QRRA 4WF9Q 3KNGA 3SSSA 2DY9A 3M6VA 1FF2A 5HROA 3I5AA 3D1QA 2ILYA 4IRDA 2NPIA 2UXBJ 2HRUA 5F41A 1MMLA 2X1FA 2VV5A 3IBFB 2LECA 1QSYA 2KXNB 1AXQA 4F26A 1D3WA 3TUJC 1KLNA 1F1BB 3GFYA 4TY9A 2LU1A 1FNMA 3QJLA 1XC9A 2DKOB 4MFBB 1TKXA 1YQHA 1TELA 3TX0A 2CQIA 2R7RA 1TVRB 2R8KA 2XULA 2CVIA 3QBCA 2IA6A 3TOQA 3W5XA 5LSOA 3VAHA 4J9OA 1YSJA 2FDNA 1RBOB 4WYLA 1UKUA 2RDIA 1RHMB 1RGVA 3Q2TC 1TAUA 2DR6A 4IG0A 4OJ1A 5KG1A 2ZH6A 3M8WA 2YNHA 1VOMA 2XGPA 3PIPQ 1GMWA 1ITPA 3RBXA 4E2FB 3K5NA 3UE2A 1YWXA 3W7BA 3IXQA 4B17A 1KVJA 5EGYA 4DS5A 3W61A 2AKWB 4OHWA 2R2UA 4NRUA 3CXCR 3U02A 2FHOB 4J37A 4OYBA 3ZO7A 2WB1D 2HZCA 3F0NA 1G2EA 2M7SA 4DQIA 4PPZA 1D8YA 4HTJA 4JI5J 3C15A 4WXWA 8ATCB 3KOAA 1RBLA 1S57A 2V9KA 2J9EA 2V5HG 4BS2A 2XMTA 2DD8S 2A6MA 2B56A 3ZZZA 4JV0A 2BKOA 4B3TF 4FYVB 4NLWA 2W2PP 4DR1F 1IBCB 3QAEA 1S97A 2LXIA 4X4PA 3G86A 2AD9A 1RAIB 2MKHA 1MLAA 2I38A 3EPIA 3KHHA 1VRUA 2WONB 2PI4A 4QWAA 2WVFA 1S9EB 3H59A 3P5TL 5LOQA 1ZTWA 1V3RA 1WOSA 3MUVP 1PKUA 2VIHA 3SDEA 4Z37A 1J5EJ 1AFJA 2ZH3A 3HVWA 1NSAA 3GV8B 4WK3A 4QWDA 4ILRA 3W63A 1U1MA 4C0BA 4P2SA 4C0OC 2J9DE 1RWXB 2Y3YA 3M32B 4JI6F 1N5TA 2DXFA 2L48A 3CCRS 1SJRA 3H98A 3M7VA 1YITS 3GILA 1RKJA 5A76A 4OHZA 2OTLS 4P2XA 3MHYA 3CCZA 5KG6A 2D3O1 2AJQA 3NKYA 1BWEA 3HHKA 1HPZB 3AD9C 4Y2KA 4DR3J 1G6BA 1RLDA 3CCES 1N54B 3OXFA 4AYBD 3I31A 1I51B 4NCGA 1YHQS 3K59A 2DNPA 1AW0A 1HYSB 2VFUA 3JXOA 3LP0B 4W98A 4DL4A 5KG0A 4I6AA 3CCMS 3ENQA 5KFWA 4MYTA 3G6ES 1S59A 5DRKA 2K7JA 1Y0HA 3V4MA 5SUHA 4OYMA 2HZVA 1KTQA 4M95A 4IUFA 2RIJA 3FMWA 4UZCA 5E0OA 2CQGA 3HSZA 4J9RA 1JLFB 1CS4A 1NMEB 3OSPA 5IC6B 4NXNF 4C48A 3MAHA 2VD3A 3CCLS 4I68A 3RRHA 3OL8A 1NDLA 4I6YA 4CNZA 3LH2S 2CPDA 1XR7A 3D67A 4ZCIA 5JVGQ 5A0YA 4JI5F 1D09B 4WIIA 1XR5A 1T02A 4YY3J 1OYDA 4JP8A 3MTJA 1WC3A 4I56A 4Y3CA 4QYZJ 2HFSA 3VTIA 2E9ZA 3A3PB 2W8KA 5LMUJ 2YQ0A 2OEMA 3MGJA 4DV5F 4TLQA 3AHPA 5L1JA 4QYZK 3QGGA 1GTHA 3DRPB 4JV2A 3CEDA 5SZTA 4NLOA 3K8WA 4LFCJ 4ED7A 3VALA 3R5GA 4I7FB 3MI7X 2E1CA 1IKXB 2OPRA 2OPQA 4ZPTR 5DM6Q 3MEGB 3OR1B 2SXLA 1RLCL 1MMDA 2B5JB 2JNJA 5EWGA 3WIUA 1UTAA 3LWLA 2ZH8A 1YJNS 2UUAJ 1SH2A 2B6AA 1Z2ZA 2ZVIA 5A6PA 1QAXA 1WG4A 4ZN3A 2P5VA 4IQXA 4A8SA 2FVSA 1UEVA 1F3FA 2E9TA 4M5IA 2EFGA 2PT0A 2JHEA 1C0UA 4DL5A 5M2PA 3KLHA 1UVJA 3WIVA 1B70B 3T5JA 3FBEA 2RNEA 3V4IB 1F3VA 2AYMA 4HH0A 2MKIA 4DPOA 3T5LA 3UPFA 4RW8A 3A3NB 4X4VA 2CPXA 3FUYA 3NCPA 3MMJA 1R8HA 4O3NA 3KTQA 1LNQA 1PC4A 3UCGA 3VGSA 1R8BA 1GK8A 1S7IA 1SJQA 1U0HB 3DLGB 1KKHA 2ZBQA 4IDKB 2B9WA 3AJ1A 3FSYA 2QLJB 4ZVSB 2F65A 1EIYB 3T5HA 3ZZUA 2VQEJ 4DV4J 4ZVUB 1GX5A 1RYSA 4B3OB 1IKWA 2WSEC 2CQ2A 1URRA 1IR0A 3G8SA 2F8EX 4DSIA 1JLCB 3JQKA 4EO6A 1V6HA 3LAKA 2BE7D 3IR6B 1Q86T 3QIPB 2R2SA 2RSQA 5HVGA 3WZ0A 2BW2A 4CH0S 2N3LA 1KC8T 3P6YC 3QSIA 3HKZD 2P9GA 4YY3F 4M94A 2QE5A 2HNDB 1WELA 5GAHI 3W5ZA 4NLSA 2FLPA 1T03A 3TEHB 4CO5A 4NX9A 1TL4A 3KUGA 5LMUF 1QUPA 2RRBA 3OJUA 1B7YB 3BGOP 1X60A 1P1TA 1D9FA 4Q2LA 1SB6A 1UJ5A 3GFXA 2M8DB 1CJKB 1F2GA 1TL7B 5L8RC 3CCSS 1D8ZA 3HLUA 1SKSA 1KS2A 3ZZPA 3IC1A 3MCNA 1F9EB 1Y7PA 3ZZRA 4ECTA 3K0JA 1YZ6A 2AQ4A 2UUAF 1GEHA 3D0HE 5K8NA 4AQYJ 5EHHA 4P75A 2GIFA 4K5SA 1T94A 3KG0A 1SJ1A 4DSFA 2CPZA 3NL0A 1B64A 1S1XB 4KIAA 3PEJA 3H5UA 2V94A 4DPYA 2FD2A 1HBNA 2V8GA 1RAFB 4IKAA 1ACMB 3I4HX 2WZ1A 4LF7F 2EBGA 4WFNQ 2UXDJ 2RF2A 2B4UA 3OTOJ 3FFIA 5LT5A 3PNIA 4KGKA 3UFCX 4B9SA 4J9VA 1RTDB 3H5XA 3BQ2A 4A8WA 3MEEA 2V4JB 5M2RA 1C2PA 5KFTA 1S77D 3SBMA 3E01B 5D4PA 2JFKA 1R8PA 5F9NA 4FXDA 4CO4A 3MOJB 1WI8A 2ZKUA 2H9ZA 1GMUA 1VYAA 3RUBL 2JX2A 3QRQA 1KEKA 4B9UA 2BQ3A 1X4EA 4QIGA 4C2MA 2A3JA 2A6OA 2CJKA 4ER8A 2CNLB 4KB7A 5B0GA 1Y5LB 1LKZA 1SL2A 2CQDA 2QA1A 5C5JA 4WJBA 3FQKA 3C14B 3BGRA 1EX8A 4J5OA 3SCJE 2UUTA 2CFXA 2MEWA 5A8WA 3M2VA 3QATA 2VQEF 2BW7A 1S1WA 5L9NA 2DGQA 1FESA 3G8TA 4W90B 2CG8A 2NR0A 2HFUA 2EEYA 4ELTA 3IBCB 3PR5B 2CZVC 4WP3A 3OLAA 1OPIA 2HGLA 2CIMA 1NHVA 4YEAA 1N5SA 3TI0A 3IR5B 1RTZA 5J2PA 2E1MC 2MDAA 3PRBA 4DV6F 3SZ2A 2PEHA 2B8QA 2NXUA 2I5JB 3EICA 3SIPB 5F8LA 3LP2B 1F5BA 4CZCA 2FGOA 2W4CA 5J1EA 2RHQB 3M1VA 4O4RA 3HCXA 4ZHRA 2DXEA 2G0JA 2WBRA 2RS2A 1IWAA 3MECA 2JZ5A 3IA0A 5F0UA 5FIIA 2UXCJ 4QR2A 3I6PA 4F4ZA 1J5OB 2CJYB 1RA7A 2FY8A 4OYAA 5EX0A 3W5YA 3AJ2A 2VUGA 3W60A 5H9EJ 3PKMA 2E7XA 5LSLA 4AQYF 4DPWA 3Q24A 5EWEA 2CWXA 5H9EK 1AB8A 1JLGA 2QFIA 4O44A 1HFEL 1X5OA 3CMES 1QTNB 1QAJA 2GHVC 2XZWA 1H7WA 5E7OB 4DX8H 2GAHC 4PUOB 1OIAA 1QE1B 5IM0B 3ISNC 4X4QA 4OYWA 2OPSB 2HQCA 1U24A 2UXDF 4LIRA 1K1SA 5B0CA 3NS5A 4H4OB 3ZZTA 4GO7X 2XZDB 2ZH7A 5IV3A 5J2MA 3ONQA 2VDHA 2Y1LB 1WF1A 2RS8A 1NK7A 2V2KA 3LP1A 3CIMA 2FIUA 3GSDA 5KG2A 2W01A 4IFVB 1S10A 1UVMA 1Q53A 3FCVA 4BC7A 4XIUA 3CD6S 2HGNA 4TY8B 1YBAA 2UUWA 2Q6CA 2M88A 3MM7A 3A8KA 3VVUA 5BR8F 4I64A 3F56A 3GLJA 1UPPA 1DRZA 4KY3A 3DDNA 3EJMA 2DPJA 2RJZA 3CJ3A 1O8BA 2XWYA 1H7XA 1T9TA 4KFBB 4LJMA 2MQPA 3BBBA 3V6DB 1NM2A 3TAMB 4NZ0A 3DDKA 2E44A 4XPEA 2MY7A 3I4PA 3Q8YA 3CC7S 4C8LA 4U95A 4K5RA 2E9RX 1KQFB 2GA7A 4LSLA 3UD4P 1EZZB 3O3LA 1MWQA 2VBWA 2RQCA 3CDAA 2ASLA 1S1UA 3I5CA 3KK2B 3HK2A 4O3RA 3HXMA 2VC0A 4ZPWR 4LFAJ 1KHWA 2LQ5A 2CPYA 2W9CB 1H98A 3V81B 1KWMA 1TL5A 1NRKA 1AUDA 3EGWB 1U8WA 2I2YA 3DOMB 4PXDA 2W9AA 4ZLNA 3OUYA 1TAQA 3EXYA 5GAEI 1I3OB 4OYXA 4N8OA 1QDUB 2PGCA 2JEGA 1F5CA 1UAWA 1R27B 4IH6A 2VFVA 1RT7B 3A1YG 4GC7A 4M5DA 4ECUA 3BF4A 3FZBA 2WOMA 4MMOA 3MR6A 2HHXA 3Q89A 2X7IA 4DFJA 1HBOB 3BKTA 2V69A 3KMQA 1T11A 2OH2A 1YK9A 3MPVA 3GSIA 3ZFVA 3TX8A 3PKYA 3DLJA 1Y00A 1VQ6S 2HS3A 2V6AA 4C3KA 1OJ4A 3OT9A 1S6PA 3X1LB 3DI6A 1JNRB 3OLBA 4NLXA 3HP6A 1R6VA 4EZ6A 1I5OB 2B9EA 4KHPF 2CQ3A 2DNZA 5KFQA 3EMTA 4N56A 4DV1J 1R8AA 4DUZJ 2V0NA 3I82A 5A8KA 1KTVA 2VBZA 5C2GA 3H2VE 3PO5A 2HK3A 4YUDA 5THWA 1NK9A 4HI2A 1CJUA 3MMCA 5HO4A 1LW2A 3AD7C 2BYCA 2PMZD 2ZH1A 2OP5A 2OJ3A 2LQJA 4C7QA 5K14B 1HL6A 2M8HA 3LPYA 3GMGA 3EGVA 1OQ6A 2MKKA 2HFZA 2VBXA 3BN4A 3MM8A 1NPRA 1FDBA 2FVQA 3CNQP 4MJKA 3EWGA 2MZQA 4Z7CA 2G1DA 3ENVA 1IKYB 4ZLJA 3L95X 3MD3A 2GQ2A 3SXLA 1S0OA 4O3QA 1EB0A 2XMMA 3CPWR 4LR8A 4AXIA 1PO6A 1VRTB 4UUWA 1WEYA 5MLCV 3FK4A 4ECZA 2DR7A 3M8YA 3V5RA 4NZ7A 2MMYA 4CIOA 4LREA 1LWEA 4NA2A 4LSNA 2UVRA 3VZIA 4CO3A 2EFNA 4MIBA 2JLFA 3IO1A 1RCOB 1HBMB 4J9KA 2IYGA 2EG2A 3ADAC 4F4KA 1IN0A 3DU5A 3EM1A 1X5SA 3CD7A 4X4RA 1FTRA 1N5YA 3AOBA 2MKJA 3HVTB 5D3GA 5HBMB 3I0RA 3RW7A 3CWJA 2FHKA 2FY1A 5DDPC 1YX2A 4DN0A 3G8QA 4C3MA 1Q0NA 1NCLA 3G82A 5GADI 2DGXA 4X65J 4O4GB 1LOUA 5ETPA 1FVSA 4V1Ak 2MHNA 3DRRB 4JI3J 2CZ9A 4NL5A 4ZVPB 2R7OA 3D68A 3O5TB 2FLNA 4FPIA 1E6VA 3DM2A 1SV5B 4DR2J 2MHEA 2AYEA 3LGNA 1KDNA 2F1FA 4Q5VA 3QZ7A 4DMZA 3KDOA 5IT9Y 1YJTA 1SVDA 3UN3A 4U7UK 1FA0A 2HHSA 4ZP6A 2BANA 3J7ZT 3GFHA 3LGMA 3NG8A 1ZA2B 4DU8A 5BYRA 5HLFB 1UW4A 1KNZA 4DV1F 4K4XA 4R25A 3KMSA 2HMIA 4UY85 4FVMA 3TO8A 1RI7A 1M5SA 3TEGA 2IDEA 7FD1A 1FERA 1UWAA 2QX0A 1T0TV 1R89A 2ASJA 2ZJQQ 2XWXA 1ZM2A 4B9TA 4DLGA 3QLHA 2W9BA 1DBDA 1UFKA 4ATNA 1M90T 5HMWA 1YIJS 2IMWP 1R0AB 1FRJA 4F0HA 2Z0GA 4DUTA 3HD2A 4ZA1A 2FJDB 3OTBA 3W9JA 3SSQA 4MKVA 5HROB 5ETSA 1RWVB 5FDLA 2JRSA 3MF5A 2R8GA 1TV6A 4G65A 2X1AA 2IJFA 2GNKA 4ZJLA 3DYAA 2IVYA 1VQ5S 1T9YA 3KJVA 1A7GE 3PXGa 3JAMU 5C42A 3MCOA 2HBZB 4NA3A 2KRRA 2ZUGA 3WX8A 4RNHA 1ZYQA 2RQ4A 1S4FA 4ECYA 3J81Y 3UDEA 1N36J 1KP6A 1TKXB 3LPEA 3MM9A 2BJ8A 4IR9A 3L7UA 4NXMJ 3KHGA 4RUCA 1FDAA 1RT6A 3PX0A 1XMOF 2LP4A 4IG0B 1PYOB 1WUUA 1VHFA 2YNHB 2BQRA 4HL9A 4X65F 4DR5J 1N0UA 3ZZYA 4K4ZA 2J0WA 3HJVA 5B0DA 3R5DA 3OVBA 4L76A 3BBCA 5C7PA 4ZITA 3HHLA 4DV3F 2HNZA 1U1RA 3TA2A 4WPAA 4HLBA 2CUYA 4PCQA 1UWBA 4TU8A 1PSDA 1P1LA 3PW7A 2DGTA 4PWDA 4DPTA 1E6YA 2FZCB 4EBEA 3UR0A 1EARA 3S6EA 2DGUA 4LRBA 4WFZA 2UUBJ 3ISND 3HM9A 1SKUB 2YWFA 5KT4A 2CDRB 2IIHA 5KFRA 3N79A 5DQHA 3N6LA 2Y8WA 3P5BP 1RADB 2DCLA 1VRUB 4Q8EA 2BXJA 2ZH2A 1JXVA 2MGZA 1HNWJ 3DU6A 2VF3A 4TQSA 1GH8A 2KTQA 3LAMA 3TWZA 5HQMA 4NRTA 3KXDA 3M8PA 4LQ3A 3SDEB 2QLFB 2XM3A 4QR1A 2R2TA 2G2YA 5I3UA 2GVDA 3QMQA 4RNFA 4NI2A 4ECXA 1FXDA 1H2UX 2C2MB 3THTA 4A8MP 2CQPA 1KN6A 3UVJA 1OQ3A 2YKQA 3Q0AA 4ED3A 2POKA 3GYGA 5DG9A 2Q6BA 3T19A 5C2CA 3JSMA 3J7YU 2D69A 4HT7A 2QL9B 4RW9A 4DXLA 4YP3A 5CD4A 3EVWA 4YS2A 1MNEA 2XHWA 3KLIB 5HANA 1T7PA 2JOQA 2ROEA 2PEBA 3LF0A 1VR6A 2OFHX 3MEKA 1X8DA 2FGCA 5FLXU 1VIOA 4NCGB 3OHAA 2DISA 4TQRA 4J9MA 2MKSA 3QFHA 2R7XA 1R8CA 2GQCA 4RUHA 3GR1A 3IBWA 4NXMF 1NK5A 5KFAA 1KQGB 1L3TA 4FF3A 3EVOA 2B7CB 1CS4B 1TP7A 2FLOA 1I94J 2KFYA 1N88A 3CDEA 3I0SA 4ZPBA 4OI0A 4JI0J 1HNVA 2HRTA 3D7SB 2MZ1A 1LW0A 1V3SA 3K5PA 5J1PA 4F2SA 1S12A 4GVLA 5HK4A 2BKPA 1RE1B 2KB2A 3MEDA 2WSFC 3J81j 2COLA 4EI2A 1TK8A 4S0MA 2FJVA 5E33A 1RJJA 3HI9A 2F5GA 1X0PA 2UUBF 1FNXH 4UOGA 4IOCQ 3GIMA 1LXNA 2CADA 1Q5VA 2JJ4D 3NGUA 3G6VA 4H4MA 2IVMA 2C3UA 4CLYA 2D7SA 2LCWA 1TR0A 4J9UE 1SC4B 4OZ2A 2QZ8A 1RTJA 1TKDA 1D9DA 2BM0A 2OPRB 1RWMB 5DDRC 4WXOA 2OPQB 1H2VZ 3N6NA 5B08A 2XLIA 2DH8A 1XNQF 4LR9A 1F9FA 2DNKA 4ERDA 2O66A 2WBMA 2GJ2A 1U26A 1WEXA 2HFNA 4MK9A 1WC5A 5KFIA 2CQ1A 2B6AB 4U9RA 2ADCA 1ZBTA 5EX3A 4A47A 2RDJA 2C3PA 1U47A 3R6GB 4I69A 5KFKA 1WC4A 4O3OA 4Y2MA 1GMVA 1SH3A 3M2RA 2H48B 3HFKA 4R0EA 1C0UB 2JWNA 3CJKA 1YVFA 3PTWA 1X4CA 3HX9A 1EAYC 3KLHB 4A8FA 3J80Y 2H1YA 2D9PA 1HWJA 2J0QD 3BQ0A 2BKNA 3T5KA 4HHUA 3UI3A 5ETOA 4RW8B 2OAUA 5H1SV 5D0HA 3A13A 1DTQA 1JJ4A 3P45B 2Z2YB 4ANDA 3RBZA 2OD6A 5L39A 1LEOA 3BS9A 3QT6A 2G0CA 3E51A 1VC6A 4EWTA 5KT7A 1UJ4A 1I94F 4PEOA 4RNOA 3S8SA 4DN9A 4IG3A 1T05A 3OFHA 2ZEJA 4JI0F 4I2QA 1IKWB 3K89A 2C2NA 1FKPA 3ET6A 3N28A 3OL6A 4GVBA 2CXEA 4LVOP 1A6LA 1VBZA 3M9MB 1JLEA 2Y8YA 2QSFA 1WDTA 2MJNA 4Y2AA 3KLFA 2XMUA 4ZIVA 4OLPA 1WJ9A 2Z58B 4XO0A 4MT1A 4WP8A 1Y11A 3F73A 1T03B 2XMKA 3PJWA 3BZQA 2CJQA 1N52B 3FRZA 2VG7A 3OPKA 3SQGA 4FN5A 4PG6A 2J0SD 5DLGA 3CCTA 3OHBA 3GIIA 4K8RA 2L9NA 3M8SA 2IM3A 3GJRB 2DH7A 4QBUA 1Z4UA 2HGMA 4P9SA 1SCJB 3D3BJ 2DR5A 2CQHA 2RRAA 4RNMA 2YKAA 4DV2J 4DL6A 4DCJB 5LJ3Y 1UL3A 4KGXB 2VODA 1XR6A 1VBYA 5CCLA 1HBUA 3D28A 2HEKA 3O6QA 2OD4A 4JI8J 1WORA 4LBIA 1HBNB 2B4VA 2X1GA 4G1QA 2WW8A 4JYAJ 1MWZA 3DGVA 5I42A 1PYSB 3H40A 2RF2B 4N77A 1FK9A 1S49A 2KKHA 2P8IA 3HHNB 3TUIC 3FFIB 3DLKA 1RT4A 3MM5A 4X4SA 3CIZA 2L9WA 3H7HB 3MEEB 3DXBA 1RWWB 1HNIA 2G2OA 4QU6A 1PILA 2BE9B 4JBCA 2HYIB 1PGZA 3DCAA 1LFPA 2WVCA 3WC0A 3RBDA 4AFFA 3UQSA 2IJRA 5IXUA 3C6TA 3GONA 2R9LA 4YMEA 2XTJP 4WTOB 2Q79A 2OMLA 2ZOFA 4KGVB 4YR0A 2NPFA 4KPCA 3VVTA 2VG5A 2OO4A 4RZRA 3OVSA 3HDSA 4WFYA 1FWLA 4B9LA 5A8WB 1QY7A 3M2VB 1NJYA 1NBEB 3TRGA 2NQPA 2ZZTA 1S1WB 2GVZA 4WP9A 3C46A 2N4DA 4EBCA 4RW6A 4KO0A 2KFNA 4LF8F 5KG7A 2BV3A 2XSJA 3RRKA 3TVYA 2LDIA 4F4AA 3PYDA 2BDPA 5KT3A 2AYGA 1FRMA 1RT5A 3H8YA 4K2XA 2E5LJ 3RTVA 3AOAA 4NPOA 1BLUA 3PYGA 1VQ9S 2DHHA 5J2NA 2CAJA 1Y5IB 4UQGA 4PYAA 4NYOA 4AUKA 1SJFA 3Q86A 4F25A 2HHUA 3M1VB 3TANA 4TKTA 4ZHRB 4MTPA 2ABYA 1FKOA 1FJCA 2FB0A 5D4OA 1A0OB 1U1QA 3DRYA 1RDRA 3KLGB 2XS2A 3FZ2A 3KG1A 3MECB 3T1HF 2NCKL 3KWMA 1NSQA 4ZVGA 2DXDA 3N9UC 3TA0A 4X4UA 1WHVA 3DRSA 1VQ8S 2ZFHA 3NWRA 3QT8A 1HARA 4DV2F 3KDNA 5HN0A 1R6YA 5F8GA 4DFKA 3RW6A 1JLGB 3IM8A 2HWTA 3BSCA 3BDEA 3HT3A 2F9DA 2KDOA 2YPYA 3UN5A 2J9CA 2YKNA 1X4AA 4JI8F 3G6YA 3BSAA 2K1RA 1VMBA 2WK4A 2ZH5A 4ZP7A 1TMMA 1Q95G 4KKOA 4USIA 4RNNA 1C0TA 1OS5A 1BY9A 4U8YA 4YB6A 4DG1A 1HWLA 3D4JA 2MY8A 5J2MB 5KFMA 1B99A 2C3YA 3CJ0A 4WIQA 3CO0P 3LP1B 2HPUA 4GKJF 5AE1A 2KT3A 3NEKA 5K20B 2KJVA 4FZVA 4CTAA 4DPUA 5GAEU 1TL3A 2VKZG 4K4YA 3BH7B 3OXLA 1NB7A 4NMLA 3I9ZA 1S4EA 2MTLA 4GRSA 3CC2S 1XEZA 3OL9A 1XERA 3AD8C 4F0KA 2Q1LA 2HQDA 1IXKA 3KNAA 4DR7F 2CJ9A 3M9OB 3CJ4A 3N5FA 3K5MA 1TKTA 4GC6A 5KFYA 4NLVA 1UFWA 1UETA 2GO9A 2QN6B 4JV5J 4EEYA 2ZBRA 1UEKA 2QG9B 3T9NA 2N4CA 3H5SA 4ECSA 2CDQA 3BGUA 4FS2A 1MG7A 4RWXA 3M9NB 4WK1A 3KUHA 1FJGJ 3PW0A 4AL7A 2E5LF 2XYHB 2VONA 2M0GB 4LSLB 3TUPA 4X64J 2VG6A 4KH0B 2CG4A 1N4LA 4YB1P 1NJWA 3U1MA 1CC7A 1S1UB 1YRTA 4PZVA 2YKOA 2LA4A 2MLXA 3DFEA 2AMCB 2A10A 2GZOA 5GVQA 4UF4A 1RAEB 2HLTA 2F63A 5DLFA 4HDGA 3NAIA 1B0VA 4FPRA 4PG4A 5L1IA 3M2UA 3R7BB 4DEZA 3P4UB 1WTBA 1QVFR 2D74B 1RU1A 1BUXA 2J7UA 3OUYB 2J8SA 1AYEA 1ZM9A 2DBBA 2DHSA 5HJYA 1VBKA 1UZHA 3QAUA 2LMIA 4K59A 2MYFA 3O2IA 1NK4A 2BX6A 3H90A 1Y9OA 1MSWD 2VA2A 4M5DB 1R31A 2GJFA 4B08A 4Q0BA 1SL0A 4ED1A 2BRLA 3FCHA 2G0IA 2FHJA 2KHDA 1RCXB 4OZ1A 2WOMB 2VOOA 2NLWA 2JC0A 5J2QA 3KKFA 2AF6A 4YFUA 1RK8A 2E1AA 3SV4A 1SQEA 4K50A 2QGFB 6AT1B 4OYIA 3OBIA 2XG8A 1V3ZA 3PRDA 1S6PB 2RRNA 3O44A 3DI6B 3T9ZA 1TUVA 4DQQA 4NA1A 4ES3A 4LRFA 1YJRA 2XHCA 5CYJA 1VQPS 2HHPA 5C25A 4QCLA 1SJ4P 1TK5A 1OPZA 5A8KB 4TLRA 2BOAA 2J5AA 5GADU 3FQLA 4C0HA 1QM9A 2Y1IA 3BYPA 1CJUB 3MMCB 4M5LA 4FF4A 1LW2B 5KFOA 4LF5F 3RJMB 4ZPAA 3QYYA 1XMQJ 1H6KX 5HVHA 2V8PA 2GHPA 3FSIA 1H74A 1RACB 5CYMA 4CWBA 4ENOA 4QPTA 1Y3JA 2AIRB 4JV5F 1O0PA 4WCEQ 3MM8B 1NPKA 4MIWA 1AFIA 3HULA 1WHYA 2C22A 1N0VC 3ULHA 4PQUA 2J6TA 3R5JB 3VAMA 1PIEA 2DR8A 3P96A 2MZJA 4N7TA 1IBKJ 3CE8A 3EDRB 4W4MA 2MKCA 2EK6A 2RKIA 4WFXA 2NSBA 1NKEA 1F2HA 1RWPB 1UZDA 1DY3A 2U1AA 3RB3A 1S0MA 4FNIA 2E5JA 1JKHA 3Q83A 1LWEB 4EU0A 4LBHA 1HNXF 3GJQB 4LSNB 4F2RA 4H54A 3HHLC 4Y2IA 3MXHP 3GCWP 4J9PA 2O01C 3GG1A 2BOPA 2Z2LA 3AAWB 1QTMA 3G6XA 1N5YB 5HQ8A 5D3GB 3I0RB 2FYXA 3CD5A 2ZOMA 4WFBQ 3DGPA 2JDJA 5JXSA 5EDWA 3G82B 5KFPA 4DV7J 3R8YA 2RILA 2YNIA 1U2FA 2F7VA 2LEBA 5KFLA 3PW4A 3PHTA 3KK3A 1WD6A 1E6VB 4LUBA 3DM2B 4FYXB 2FZKB 3RB6A 2W24A 1B4SA 3EGNA 2B4PA 3IGNA 3A12A 1WOPA 3VHQA 2C2OB 1P8GA 2MKYA 3MM6A 5HP1A 2HBRB 2KT2A 2BANB 3BO4A 2VZ9A 3U27A 1N32F 2DGSA 3MMAA 1SJ3P 5D78A 3B82A 2HMIB 3TNVA 3FJ2A 3JTOA 1FKAF 2GMJA 3TVZA 3VR1A 1S1TA 1U49A 1B3TA 4M5NA 1M1GA 3RGIA 1PJ5A 4ZCMA 2JVOA 4OX7A 4C8OA 1XN9A 1XMQF 3QLHB 1FEEA 3W64A 4OHYA 2XBPA 3GCXP 3J7AN 1JNZB 1HQEA 2GX8A 3VV2B 1JLQA 3FGVA 2B51A 2R3VA 2AV5A 4LF9J 4JI1J 2D3OR 5FDLB 1H0HB 2I9SA 1RZMA 1IBLJ 2HWIA 2UVUA 1TV6B 2AJFE 3DYAB 1VQKS 1VC5A 1IBKF 4OIXA 3D66A 3KJVB 2MQLA 5JJBA 2I8EA 4MKYA 3L9ZA 4MK8A 5C42B 3W3SA 3W2VA 2MXYA 3TYTA 4ED6A 1FRKA 1CSJA 4PR6A 2UXBF 4QU7A 1UFLA 4EZ9A 2YWGA 2B7BB 1TL7A 4U8VA 5L1LA 3I87A 3D6TB 1YBTA 2Y9HA 3MM9B 3B78A 3I56S 2Z2ZA 2RAQA 5HMXA 4KTQA 3RYLA 5MAOA 1S6OA 4M8LA 1RT6B 3I55S 1RQ0A 3IG1A 3HHDA 2ZH4A 4LF4J 4HEA9 4URQU 4EFAC 5DM7Q 1OSDA 3LALA 3FEXB 1K0VA 1X7VA 4B9NA 2IJNA 1FVQA 2W1BA 1WKLA 2MLYA 3MR7A 2CQ4A 3IGVA 4B3RJ 4DR4J 3LA0A 4ZIWA 1DLOA 3W2WA 3HVAA 2IAJA 4OHVA 3HHLB 2HNZB 2HBQB 1HW8A 2XYPB 2AZ1A 4ALZA 4DCOB 4YOEA 4K0KJ 4NLUA 1UWBB 3NNHA 1SKWA 1HR0J 3M4XA 4CI0B 2EI5A 4IH7A 3OD2A 5F8IA 1UVNA 1NO8A 4PWDB 4KHRA 3QRPA 2K7KA 1E6YB 2GV1A 5DO2A 2IBKA 4CT8A 2VHGA 1JXLA 3PR4A 1CULA 2ZWOA 1PJ7A 2MZRA 3TR5A 3MMBA 2XYGB 4CO0A 1Y10A 2QMWA 1Q8BA 2IPOB 4CLFA 2UV8A 5KFXA 1AZSA 1W7WA 1I1GA 3CCVS 4NLYA 2MGZB 1VQSA 2WVDA 2G4BA 3L4BC 1CLFA 3IS9A 3CDUA 5ADZA 3GE9A 2V4RA 4FXWA 3M8PB 2Q3PA 3OTDA 3BSOA 5ITHA 2JVRA 4FVCA 2HFVA 5I3UB 2IDLA 3BM7A 4ZVHA 1RTHA 4O23A 4KPYA 3R2CJ 4ID8A 2GVDB 4NI2B 2YWKA 3JAMY 4B3MJ 1MROB 4R5PA 3UVJB 3VAIA 2V8HA 3IAS9 1J5EF 4PQAA 3JSMB 1CQMA 3K17A 3AA8A 3IP0A 4FKYA 4RW9B 3DXSX 1S99A 4NLDA 3CW2C 1JJCB 4L74A 3G71S 1U45A 1OY8A 1U7LA 3GPAA 3BB5A 3VGUA 2XMAA 2VL1A 1HHQA 1C4AA 3PFOA 1FX4A 1M5HA 5E3PA 2O1PA 3UD3P 3PRVA 4P52A 1IQTA 2HS0A 1OO0B 2MZTA 3NXZA 4XDCA 1SQFA 2V2QA 4LRCA 2CPEA
chains in the Genus database with same CATH topology
2NXJA 3EGVA 3CJRA 3CJQA 3CJTA 1UFKA 1SQGA 2NXNA 3CJSA 2B9EA 2ZBQA 2ZBPA 2YXLA 2NXEA 2ZBRA 2NXCA 1SQFA 3AJDA 3A4TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NXJ A;  3EGV A;  3CJR A;  3CJQ A;  3CJT A;  1UFK A;  1SQG A;  2NXN A;  3CJS A;  2B9E A;  2ZBQ A;  2ZBP A;  2YXL A;  2NXE A;  2ZBR A;  2NXC A;  1SQF A;  3AJD A;  3A4T A; 
#chains in the Genus database with same CATH topology
 1NUE A;  3UNY A;  4DR3 F;  3KFW X;  1WKJ A;  3T1Y J;  3JS9 A;  2MZS A;  5GAG U;  2ZHO A;  1TKZ A;  3GYX B;  4X66 J;  2W4P A;  2GMH A;  2V63 A;  4F3Q A;  1EKS A;  3BN7 A;  3LO3 A;  3I0S B;  2ROP A;  2JLG A;  1IJE B;  1HNV B;  2GW8 A;  2KO1 A;  3JQJ A;  3U1N A;  4LVN P;  1JX4 A;  3R3T A;  1LW0 B;  5IQ6 A;  1RAH B;  2W7O A;  4NEZ A;  5KG5 A;  5HL7 Q;  1HA1 A;  4F02 A;  2FC9 A;  1WAC A;  4K0K F;  1HWU A;  3KLE A;  5HSP A;  3NGT A;  3MED B;  1HR0 F;  2HS4 A;  1U1N A;  2DVI A;  4HKQ A;  1RT2 A;  1HNZ J;  2IRY A;  1M1K T;  2F8M A;  2HQF A;  1JLA A;  4CDI A;  3VGT A;  5G0R A;  3GU0 A;  3FBF A;  2EKY A;  1FT8 A;  1TQL A;  1HI0 P;  1IR2 A;  2G13 A;  3LOU A;  1B7F A;  2BVZ A;  2AU0 A;  4H4M B;  4JOU A;  3AY0 A;  1DJ0 A;  3MR2 A;  1RTJ B;  2YWE A;  5IQQ A;  3CTR A;  3A3O B;  2KM8 C;  2FUG 9;  1AT1 B;  2LEA A;  2OSR A;  1BMQ B;  1KLM B;  1WSV A;  2HRY A;  4LFC F;  1H3D A;  2R7S A;  1TL1 A;  2PA3 A;  2RD5 C;  2W4D A;  1X4D A;  2KRB A;  3HZG A;  4EGL A;  3MZI A;  5A8R A;  3EPG A;  2KU7 A;  4NYP A;  3ETM A;  2OPP A;  2R2R A;  2AEJ A;  2CNN B;  1NHU A;  4ETZ A;  2G1H A;  2YBV A;  5FLX Y;  2DIT A;  1RT1 A;  2N82 B;  3TQE A;  4JI2 J;  5CH7 B;  3QWU A;  2D9O A;  1FE4 A;  1Q5Y A;  4O0N A;  2EFP A;  3M2R B;  1GQE A;  1JJH A;  3GB0 A;  4NWB A;  2R8H A;  4HVZ A;  1HMV A;  2J76 E;  1MW7 A;  3A8J A;  4QYR A;  4U7C A;  3NOG A;  4E98 A;  3QT5 A;  2YNF A;  4JI4 J;  3KG4 A;  3KK2 A;  1RYR A;  3GP9 A;  1IM4 A;  1PAU B;  3P8B B;  3N6M A;  2FPH X;  2YKM A;  2CVE A;  1ARO P;  2PMW A;  2W9C A;  3CUN A;  2V4Q A;  1NDP A;  2ZBC A;  3QFW A;  3BRE A;  3LAN A;  4PXE A;  1DTQ B;  3DOM A;  2LYV A;  3BGF A;  4USK A;  2UUC J;  4ITS A;  1SC6 A;  4MH8 A;  2UU9 J;  1X5T A;  2F4V J;  5F8M A;  3W8P A;  2IYI A;  1X4H A;  3T1Y F;  3HHL D;  1ICE B;  3D1H A;  4ZVR B;  1JWW A;  4X66 F;  3UDV A;  3V2U C;  3BKU A;  4A46 A;  4C8K A;  3HT0 A;  2DHG A;  1EQM A;  3MPD A;  2QL5 B;  1QAI A;  1C1C A;  4IG3 B;  1T05 B;  4I2Q B;  5IZH A;  2E5I A;  1U2C A;  4ECR A;  1FKP B;  3ET6 B;  4GVB B;  3Q8S B;  2NZC A;  3CO9 A;  2XGQ A;  3C3L A;  1UEU A;  2EWH A;  2MST A;  1FFG B;  2ZM6 J;  2DO4 A;  1U6B A;  3UDC A;  4XDD A;  1HW9 A;  2CRL A;  1DQ8 A;  1JLE B;  4DV4 F;  3L3C A;  3LWM A;  3SSR A;  2W8L A;  2YX1 A;  3KLF B;  2R8J A;  3JQM A;  4Q8F A;  1S76 D;  2F4F A;  3QSY B;  2ZBP A;  2FLL A;  2GGP A;  2WB4 A;  3I32 A;  3TAP A;  1WF0 A;  2H5J B;  1GXU A;  2KYX A;  3T41 A;  3VAF A;  5T14 A;  1M5V C;  2VG7 B;  3SQG B;  3AFG A;  2D3U A;  1YJ7 A;  3K7R A;  4DQP A;  1PBA A;  2VU5 A;  1L3S A;  3K57 A;  3ZXW A;  4ECW A;  1KON A;  3NOC A;  2HVH A;  4XK8 C;  1VDH A;  5HAT A;  5K14 A;  1NK8 A;  1PJ6 A;  5B0A A;  2KHC A;  2DHX A;  2P6S A;  1VK8 A;  1VHI A;  4ZPC A;  3HSG A;  2M70 A;  3G87 A;  4DOZ A;  2VPY B;  1IKY A;  4ZK7 M;  4TNO A;  2AWZ A;  5I4M A;  1HBU B;  1OWX A;  2A2D A;  2LEP A;  1SBR A;  1LWF A;  3M6U A;  4JI2 F;  2KM8 B;  4A8Q A;  1XMB A;  3CC4 S;  4G1Q B;  5I42 B;  4U7U D;  1YRU A;  2IY5 B;  1XJW B;  4QJV A;  3NBP A;  1FK9 B;  2DR9 A;  2JC1 A;  3DLK B;  1RT4 B;  1M5O C;  2V67 A;  4JI4 F;  3MM5 B;  1H73 A;  2XMV A;  3CDB A;  2J7K A;  1T8E A;  2OKQ A;  1APS A;  1HNI B;  4KBI A;  2DGV A;  3DHW C;  1JXE A;  1DZ5 A;  2C3M A;  4P73 A;  3OTO F;  4H4K A;  3TZW A;  4RBU A;  2UUC F;  2RUS A;  2BAB A;  2DNL A;  3GR0 A;  2CYY A;  5D4L A;  2RU9 A;  2W2Q P;  2A18 A;  3R27 A;  3C6T B;  4DSL A;  2Z57 B;  2PC6 A;  4L3N A;  1RSC A;  2ZDP A;  5AE2 A;  2FTR A;  2KVI A;  3RR7 A;  4CO1 A;  2VG5 B;  2V68 A;  1ZZN A;  1SUQ A;  4DL7 A;  3ZC4 A;  2HIY A;  2HHQ A;  3AXK A;  3CJ5 A;  4ZDN A;  1PG5 B;  4ZVT B;  3UO0 A;  4PRF A;  2A1B A;  2K3K A;  3M8Q A;  2NYI A;  3MTK A;  1TFW A;  3VCD A;  4OL8 A;  4YDX A;  4N47 A;  1BQN A;  2ALY B;  2GVZ B;  3R6L B;  2FQQ B;  2HFO A;  1L3K A;  4RW6 B;  2ZM6 F;  4KO0 B;  2P9C A;  4F3O A;  5HJX A;  2XSJ B;  4F4W A;  2GHW A;  3GQC A;  1VFJ A;  1S48 A;  1TU0 B;  2EKN A;  1NSP A;  5J1N A;  4B3T J;  4UOF A;  3GIK A;  1T95 A;  1OYE A;  1RT5 B;  2GIQ A;  3UD5 A;  5BJR A;  3NCR A;  4ID5 A;  4J9N A;  4K2J A;  4U67 Q;  5ETL A;  4B02 A;  3A8I A;  2HAF A;  3MPU B;  5LXR A;  1HLW A;  3W62 A;  4IOB A;  1Q7Y T;  1HWI A;  4ZVE A;  1HQ2 A;  4UTG A;  4BBY A;  3U7J A;  4ZVF A;  1FKO B;  5F9L A;  3TJA A;  5BXI A;  2YTC A;  1V5V A;  2JEF A;  3Q2S C;  1QLN A;  4KQZ A;  1FRI A;  3BV8 A;  1V5I B;  1NZ8 A;  2LXF A;  1NXI A;  1TFY A;  2L9D A;  4KV8 A;  3I5B A;  3DRS B;  2VKR A;  1X4G A;  1FD8 A;  4JI6 J;  3ZTS A;  3GFZ A;  4A8X A;  2UXC F;  3OV7 A;  1U1P A;  2XS7 A;  2HZA A;  2DO0 A;  3CVK A;  5HQL A;  1GX6 A;  1JB0 C;  4B9V A;  2YKN B;  1ZZF A;  4A8K A;  5IT4 A;  5KFV A;  2DNN A;  2YQ1 A;  2K1R B;  4QWB A;  3DOK A;  2OFG X;  3C16 A;  2VA3 A;  3C6U A;  3DNC A;  2AW0 A;  4KKO B;  1ZA1 B;  1S79 A;  1C0T B;  4KR0 B;  4J9S A;  4HAC A;  1GTE A;  3RAX A;  4IQM A;  4DG1 B;  3D5M A;  3T1A A;  5CQG A;  2B3T B;  4M5G A;  1UJ6 A;  1REG X;  1RAA B;  1VQ4 S;  3W9H A;  2WVB A;  3ZTQ A;  2NXN A;  4CYU A;  3M8Z A;  1X4F A;  1XTZ A;  3VGV A;  2QO3 A;  4CTA B;  1TL3 B;  3K2Y A;  2CQC A;  2RHS B;  3QGI A;  4CLT A;  4OX9 J;  3WC2 A;  3TA1 A;  1RWO B;  3UNG C;  3NY0 A;  4NXN J;  2NUH A;  3ITH A;  4C11 A;  2RB7 A;  2QJ3 A;  1S7H A;  2ZHB A;  3MAA A;  2ZJR Q;  3ETO A;  2QFJ A;  3NNC A;  1RIS A;  4P2F A;  2AJ4 A;  4X4T A;  4L6V 3;  2K8G A;  2HW3 A;  1TKT B;  1SC1 B;  4F0M A;  2O67 A;  1WC0 A;  2KYZ A;  2AX0 A;  3HSJ A;  1G7C B;  3FMB A;  3Q22 A;  2DH9 A;  1DTT A;  1RB0 A;  3PCO B;  2JFD A;  3G96 A;  5KT2 A;  4TXS A;  4LFB J;  4RW4 A;  4GKK J;  2BJ7 A;  3GJT B;  1VQM S;  2GIR A;  7AT1 B;  3OFF A;  3H0P A;  3VWS A;  3IR7 B;  4DV5 J;  3MR3 A;  4HDH A;  1UA1 A;  4XPC A;  1FHT A;  2X51 A;  4C8M A;  1X9S A;  1Q81 T;  3H25 A;  2MSS A;  4Z7Y A;  2VG6 B;  4NLP A;  2HVE A;  2IM0 A;  3O8W A;  1FRL A;  2HSE B;  5CA5 A;  3RBE A;  3ISZ A;  5HVF A;  3IAM 9;  3TQ1 A;  4NEY A;  4FP9 A;  3R5A A;  2E5H A;  1FRX A;  1DQA A;  4USM A;  2R42 A;  1IKV A;  1HQU A;  3M2U B;  2UV8 G;  3DOL A;  4USW A;  3CDW A;  1CJV A;  4MKB A;  2CNO B;  4G1I A;  2F3J A;  1ZPW X;  2W25 A;  3QPI A;  2XS5 A;  1IWG A;  1AA1 B;  4LFA F;  2KXF A;  5ETV A;  2DJW A;  1I6J A;  3Q8R B;  4Q0B B;  1JLB A;  5E2Q A;  4JV1 A;  4OZN A;  1RWN B;  5J2Q B;  3KJN B;  2V9W A;  4DBQ A;  2UP1 A;  3KLI A;  2XLK A;  5C24 A;  4A4J A;  4WZM A;  4K4W A;  1U48 A;  3KHL A;  3CJT A;  4I1T A;  3H2L A;  2VQF J;  5ETQ A;  4QW9 A;  1B0P A;  1PBU A;  1VQO S;  1S6Q A;  3EGZ A;  2IRU A;  4EUV A;  1CJT A;  1EET A;  1LXJ A;  2E7V A;  3AQP A;  2HIQ A;  3LGH A;  2ATC B;  4M5H A;  4K4S A;  4WBF A;  1WHX A;  1FCA A;  1GT8 A;  3J80 U;  4PWU A;  2VJV A;  2RE1 A;  2QA4 S;  5C25 B;  2UVW A;  5EWF A;  1D1U A;  1VQN S;  1L3U A;  4OX9 F;  2PDA A;  2H3E B;  2ADB A;  4NLT A;  2MB0 B;  1FTC A;  1ZTT A;  4FNH A;  4DUZ F;  2PFF B;  3JYT B;  3D54 A;  4WE1 A;  2ZD1 A;  1NJX A;  1UPM B;  2QSW A;  4JUZ A;  4ZKA A;  5CYM B;  3ZTP A;  2FZG B;  4C97 A;  2JEI A;  1Q8I A;  4J9Q A;  2Z56 B;  4KGZ B;  3UR3 C;  2WRM A;  4NMX A;  2ZNY A;  1VC0 A;  3BSN A;  4DZ6 A;  4KRW A;  4LFB F;  4P71 A;  4PQU B;  4KYZ A;  3J7Y I;  2VC1 A;  3T3F A;  4GKK F;  3NGS A;  4ECQ A;  4PXB A;  5D77 A;  1NKC A;  4DS4 A;  2ACY A;  3SQO P;  1OSC A;  2NRE A;  3J7A 1;  4MYU A;  1FFW B;  3B4D A;  5KFC A;  2BM1 A;  1M5P C;  2FVR A;  2RKI B;  4K7Q A;  4X4O A;  1RUS A;  2HNY A;  3DRX A;  4OYP A;  1JKH B;  3SMZ A;  1KVK A;  4OLO A;  2YNG A;  4ZOS A;  2DNQ A;  6FD1 A;  3V6J A;  2C28 A;  2ZBI A;  4ELV A;  2Z8Q A;  5F8J A;  4XTT A;  4WU2 A;  3AB4 B;  5A2Q U;  4OJ3 A;  5L46 A;  2PMH A;  1X9W A;  3SFU A;  5DET A;  4ZS6 A;  4WKY A;  3DGP B;  3DLL Q;  4TYB A;  1TMJ A;  4JI7 J;  5BYQ A;  3SYZ A;  3SCL E;  5LXY A;  2YNI B;  3LQV A;  4OJG A;  1JK9 B;  1SI9 A;  1N5V A;  3M8R A;  2LQ8 A;  2OEL A;  3DDI A;  3PO4 A;  4PG7 A;  5A6W A;  3KK3 B;  4LF7 J;  4DX5 A;  1S5Z A;  3I96 A;  1NB2 A;  2WVE A;  1MMN A;  1BE4 A;  4BLG A;  1HI1 A;  3C19 A;  2R7T A;  1RBA A;  1WWH A;  2IRX A;  5ETM A;  5CYQ A;  5F3Z A;  2EG1 A;  2AGP A;  4JI3 F;  5HMY A;  3UW1 A;  4P7T A;  1RTI A;  1W2B R;  2VQF F;  2MQO A;  1Y4Z B;  2MLZ A;  2LXU A;  1VQ7 S;  3MM6 B;  4DR2 F;  5HP1 B;  4ES1 A;  1RHQ B;  2AJ2 A;  2LQ9 A;  2QLX A;  1VLO A;  3C15 B;  1A9N B;  2YPZ A;  1Q79 A;  3BBF A;  2E1P A;  3MMA B;  2PI5 A;  3E2E A;  5K9F A;  1GFW B;  4QWE A;  1YJ9 S;  1S1T B;  4F4Y A;  3NP5 A;  1N48 A;  3M30 A;  1EQ0 A;  3SV3 A;  2NXE A;  3DLB A;  3MUR P;  1EJ7 L;  3D0G E;  4DJB A;  4ED4 A;  4L73 A;  2OEJ A;  2C2K B;  2KXH A;  4QWC A;  3PYF A;  1HQE B;  4DZD A;  1JLQ B;  4FYD A;  4UZB A;  3THP A;  1F9H A;  4DL3 A;  1QAY A;  3FC9 A;  2V8D A;  3DKD A;  3IMQ J;  1WI6 A;  4DV6 J;  1QVG R;  2GC8 A;  5KG4 A;  3R7N B;  2A2C A;  4P7V A;  3DMJ A;  4NLQ A;  1KRP A;  1L3V A;  2IC3 A;  3TZZ A;  1N33 J;  2KH9 A;  1S1V A;  5D4N A;  4L72 B;  4I67 A;  4M5K A;  3PX6 A;  3POT A;  2O3D A;  3R97 A;  3W2V B;  3GWC A;  1NZA A;  4AL5 A;  5CD4 H;  2AP6 A;  1KFS A;  1UA0 A;  3C8Y A;  4RL1 A;  4OFZ A;  5KG3 A;  1ZAX A;  1UCN A;  2IVF B;  5KFZ A;  5DG8 A;  1FE0 A;  1REV A;  1GAO A;  2YH1 A;  2WCX A;  5DGA A;  3R2D J;  1YDL A;  2FHJ D;  2B9Y A;  4I2P A;  1YJV A;  3BR8 A;  4ZP9 A;  2ZE2 A;  1VIX A;  3IG1 B;  2JSX A;  2XQC A;  3RB4 A;  1N36 F;  1JQG A;  3HD1 A;  1RT3 A;  4HH1 A;  2WSC C;  5LMN J;  4PYD A;  2EFQ A;  1B0T A;  2V2V A;  4JI7 F;  1FI4 A;  4B3S J;  3CCJ S;  5KFE A;  4EYI B;  3ZNJ 1;  1FXR A;  1DLO B;  3W2W B;  1X31 C;  1F60 B;  2IAJ B;  1WF2 A;  2CA9 A;  5CZV A;  2CPJ A;  4ZLL A;  4IO9 Q;  4AXJ A;  4OZJ A;  5CXT A;  3LW5 C;  2O5D A;  3VAJ A;  4RR5 A;  1WSR A;  4ETX A;  4DR5 F;  3ENA A;  1S9G A;  2CJB A;  3KK1 A;  4FBU A;  2R7V A;  4DF4 A;  2E1R A;  3CGI A;  3BJY A;  3B8H A;  4LIW A;  4FBT A;  2H51 B;  2DY1 A;  1H2T Z;  3JSB A;  1N6Q A;  2HWH A;  4DLE A;  2ZKT A;  2VPX B;  4URG A;  1LFW A;  4ELU A;  1CUL B;  4R8U A;  1BD6 A;  4U96 A;  5A0Y B;  2DNY A;  3CB4 A;  3MMB B;  2ZIT A;  3F41 A;  2FVC A;  1AZS B;  2B8P A;  5BR8 J;  1DAX A;  1X4B A;  4OI2 A;  4Y6I A;  2QV6 A;  4E0D A;  4DL0 C;  2FJW A;  2XNQ A;  3IS9 B;  2QIF A;  3A4T A;  5H9F J;  3D6H B;  4LT6 A;  3MDF A;  4CP5 A;  4Y34 A;  5H9F K;  1HNW F;  2VIC A;  5B0B A;  1RTH B;  3RR8 A;  3FKB A;  3M6X A;  2XC9 A;  3ZNU A;  2IMO A;  2ZDO A;  3MFI A;  2QA2 A;  4ICL A;  1U8S A;  4R5P B;  2VFS A;  5IFM A;  5KFJ A;  2XMJ A;  3RU0 A;  2FJE B;  4F50 A;  3IRW P;  1XIQ A;  2DB1 A;  3GZ7 A;  4KE5 A;  1WTF A;  2KVQ E;  1N33 F;  3QO9 A;  1BQM A;  1FDN A;  1TTH B;  5GAH U;  1RA6 A;  3TUZ C;  3OSN A;  4FDF A;  2DGW A;  3N0V A;  4ZVO B;  5FD1 A;  2KI2 A;  4IFY A;  3THV A;  2ALZ A;  1X9M A;  4Z2X A;  1SIZ A;  2LU2 A;  2M2B A;  1CBK A;  3KLG A;  1RHJ B;  3IRX A;  2HKE A;  2FC8 A;  4D3G A;  2C1E B;  5B0E A;  5B09 A;  3H5Y A;  3CUL A;  1CC8 A;  4ZJQ A;  1YLX A;  3CCW A;  1V9O A;  1Y5N B;  2KL8 A;  3EX7 B;  1ZPV A;  2XO6 A;  4DX6 A;  3RRG A;  4OI1 A;  1ZAV A;  1TKZ B;  4NLG A;  2F9J A;  3HVR A;  5LMN F;  1GMW D;  2DEJ A;  2DNM A;  1XK8 A;  2BA9 A;  4CLW A;  4RPF A;  3FSX A;  4DV0 J;  4B3S F;  4ED8 A;  3HSD A;  4DFP A;  2PA8 D;  4USV A;  1RHR B;  4CLS A;  1KBR A;  2HVZ A;  3SEO A;  2YKP A;  2E66 A;  4PAB A;  1IUJ A;  2AHO B;  2FJB B;  1Q4R A;  4FYY B;  2CKW A;  5ETK A;  5F0W A;  3MWB A;  3KLE B;  2B9X A;  2BJ1 A;  2VOP A;  3WQP A;  4CM0 A;  1D0E A;  3P49 B;  1VI7 A;  3TJ9 A;  4UOH A;  4KHP J;  4YHH J;  1RT2 B;  3GV5 B;  2DNR A;  1P6T A;  2DTJ A;  1JLA B;  2EW9 A;  1TUG B;  5G0R B;  2EVZ A;  1NPP A;  3MOZ A;  4A48 A;  3ILI A;  5CAA A;  2GO8 A;  2BQU A;  3TW0 A;  4ZP8 A;  3UCZ P;  2VAS A;  1C1B A;  1RP5 A;  3HFZ B;  2QLW A;  2YY3 A;  1CEZ A;  2AZ3 A;  3RAM A;  5DZ6 A;  2H4W B;  2HQI A;  4PPD A;  3Q8Q B;  1Q82 T;  4LF2 A;  1TL1 B;  1JJ2 R;  3BKF A;  1T9X A;  1P9Q C;  3ICL A;  3OR2 A;  3PY8 A;  1TUW A;  2HHH J;  5A8R B;  1HKA A;  4OI3 A;  5EN1 A;  7FDR A;  5DQI A;  3R9L A;  2HLU A;  3HZE A;  1ZM4 A;  2OPP B;  3BO3 A;  4RU2 A;  4HR2 A;  5HAO A;  5AT1 B;  2J0X A;  3IM9 A;  4H4K C;  4QIF A;  1RT1 B;  5KFD A;  4G6V B;  5KFB A;  3QQC D;  1WG5 A;  3AJD A;  2C42 A;  1LWC A;  1HWK A;  1HMV B;  5KOW A;  3OVA A;  2IFX A;  1FEH A;  3AOC A;  1BGX T;  2YNF B;  3A8E A;  1HIY A;  1R43 A;  2YKM B;  3P3D A;  1KVI A;  2Y0B B;  3DLE A;  2QT7 A;  1M0S A;  2XY6 A;  2BE2 A;  1R0C B;  4DFM A;  4RW7 A;  1LWX A;  4M63 A;  3QWP A;  2OLW A;  4FYW B;  1H38 A;  5I3Q A;  3M6W A;  3DHX A;  2BBE A;  1EP4 A;  4PG8 A;  2OGU A;  3D6F B;  4C8Y A;  4CLU A;  2FJA B;  2B4O A;  2MQM A;  1UMJ A;  5DZ7 A;  1KQK A;  2R7W A;  1MN9 A;  2RQM A;  4DV0 F;  1NH8 A;  1C1C B;  4P72 A;  3US5 A;  4O0I A;  3EDQ B;  4Y28 C;  2BJ9 A;  4LF6 J;  2XY5 A;  4KSE B;  1FRH A;  4QOT A;  3BGR B;  5LL6 d;  2P9E A;  2DRA A;  5HMZ A;  1KSP A;  5D0G A;  3BH6 B;  2CNK B;  1YZ7 A;  4C3L A;  4F67 A;  4YHH F;  4NZ6 A;  3ZTR A;  2KG1 A;  3QNW B;  9ATC B;  3K8V A;  2GGP B;  3CJQ A;  1RAB B;  1UW9 A;  1RU2 A;  3BGL A;  4OYO A;  2QC3 A;  3L7O A;  3UDL A;  4K4V A;  5T7L A;  3MD1 A;  2HK2 A;  1KQS R;  4ED2 A;  3N5B A;  1VQY A;  2BJE A;  5J2P B;  1F6T A;  4DF8 A;  5F8N A;  2ZHA A;  1N56 A;  4YR3 A;  4Q43 A;  1MU2 A;  1UVL A;  2XB2 D;  2YH0 A;  4WWS A;  1FFS B;  4KJI A;  3K5L A;  2WW4 A;  5J1E B;  2VFT A;  4A8O A;  4KC5 A;  2VH7 A;  3LUY A;  1WC6 A;  2BJD A;  3TZX A;  4CO2 A;  1Q1K A;  3GYN A;  2HHH F;  4D3H A;  4DSE A;  2GFF A;  5JVH Q;  1VIS A;  2UZA A;  1G4C A;  3HO1 A;  2ZC4 A;  2C2R A;  5DG7 A;  2HHV A;  1IQZ A;  1LWF B;  3R5B A;  2F8H A;  3EE3 A;  4QIE A;  1RHU B;  4J9L A;  2EXU A;  1SPB P;  4O44 B;  3NBP B;  2DCU B;  3DLH A;  3PM9 A;  5KOX A;  1BHN A;  4DCP B;  3NMR A;  2NXC A;  2QTW A;  4UW2 A;  4P10 A;  4JYA F;  1U2R A;  1C4C A;  2NXJ A;  4J91 A;  2HQG A;  3AQO A;  1UVK A;  1XMO J;  4C8N A;  3W66 A;  4MFB A;  5G4D A;  2BMB A;  3S01 A;  2B43 A;  1TVR A;  4OZL A;  2DPI A;  4ILL A;  4QPX A;  4YN3 B;  5M2U A;  2VDI A;  5KT5 A;  4UQT A;  3D6M B;  4HTI A;  4RBT A;  1ULR A;  1FWK A;  1U25 A;  4JB8 B;  1SUQ B;  2QA4 G;  2AJ0 A;  4L3K A;  2YX4 A;  1DQ9 A;  2DNH A;  4DV3 J;  2ATL A;  4V19 X;  4IRK A;  4RKU C;  3MM7 B;  3M8Q B;  2CQB A;  4NYZ A;  3S1T A;  1VCT A;  2V2Z A;  2FHM A;  4LF6 F;  1BQN B;  2ZZN A;  3T6B A;  3HKW A;  2ZJP Q;  3L7P A;  4OZ5 A;  2CJX B;  2RQK A;  1XNR J;  1CVJ A;  3NGR A;  5E3A A;  2I0X A;  4ID5 B;  3MAQ A;  3CMA S;  1O5J A;  4J7C A;  4M1K A;  2QMU B;  2KG0 A;  4LR7 A;  4CRJ A;  2D3Z A;  2XMW A;  1AUS L;  2Q66 A;  4LQ9 A;  6FDR A;  4WZQ A;  3QT7 A;  4YB7 A;  3CF5 Q;  4CLK A;  2WON A;  2CWK A;  4X4N A;  3H42 A;  3L09 A;  2MPU A;  2DYA A;  1RAG B;  1S9E A;  3JTN A;  4M5J A;  4YQW A;  4CT9 A;  4KV8 B;  2JLE A;  4TU9 A;  5U47 A;  2R8I A;  4WU3 A;  1YJW S;  1BWV A;  1WKK A;  2D41 A;  3NAH A;  4P74 A;  2XY7 A;  3HMJ G;  3RG6 A;  4IH5 A;  1YG0 A;  2RDD A;  2GML A;  2QRR A;  4C8Z A;  4LF1 A;  1W26 A;  1UP1 A;  3DOK B;  3C16 B;  4RJV A;  3M32 A;  3C6U B;  1ZS6 A;  2EFO A;  4RBV A;  3AA9 A;  3OQ2 A;  3W65 A;  3OFE A;  4HAC B;  4AL6 A;  1BXN A;  4C6A A;  1NK0 A;  1URN A;  3FVY A;  4O3P A;  1KD1 T;  4K4U A;  8AT1 B;  3NNA A;  2ZOG A;  5AXN A;  4LMZ A;  5KFN A;  1GXL A;  5FJ4 A;  3M05 A;  3WHI A;  4CYU B;  4X62 J;  3CMQ A;  3NLC A;  1HPZ A;  2ZZM A;  3TAR A;  3WX4 A;  1HYS A;  3DC2 A;  5CHC B;  3X3U A;  3LP0 A;  2KZM A;  4DPX A;  4OV1 A;  3Q23 A;  3ZTO A;  3ITH B;  4C11 B;  4OX6 A;  1F0X A;  3BPS P;  1R7I A;  3MAA B;  2OIH A;  1K8A T;  3H2U B;  4ZMM A;  2JH3 A;  1JMT A;  3CT9 A;  1JLF A;  3MUM P;  3MUT P;  5IT0 A;  2G9O A;  4IR1 A;  2KZZ A;  3G9C A;  4OZ0 A;  4QQB A;  3HFV A;  3PIO Q;  1KFD A;  2B0G A;  1DAR A;  1DTT B;  3Q8V A;  5BYS A;  3W8G A;  3NCQ A;  4RW4 B;  2V34 A;  1WOO A;  2ZH9 A;  1XNR F;  3GG0 A;  2XCP A;  4CLP A;  1MWY A;  4AD6 A;  2MJU A;  3OFG A;  1FJ7 A;  4V19 J;  2BZ2 A;  4C9D A;  2XCA A;  1XBW A;  1FJG F;  4PKD B;  4M5M A;  2A0F B;  8RUC A;  4EK2 A;  3TVK A;  4J90 A;  2AGO A;  2PII A;  2K06 A;  2DEI A;  3K58 A;  1XNQ J;  3DRP A;  2H4Y B;  3CCU S;  1Q7L B;  4X64 F;  1K73 T;  4ZCL A;  1IKV B;  2C2E A;  4I7F A;  1HQU B;  4ZN1 A;  1FWP A;  3DOL B;  1IKX A;  4EMD A;  1CJV B;  4RO0 A;  1PYT A;  2Y1J A;  4YB5 A;  3MEG A;  3OR1 A;  4O3S A;  1FO1 A;  4ZPV R;  2B5J A;  4PG5 A;  1YGY A;  1MRO A;  3NGD A;  3BYR A;  1VLY A;  2QLB B;  3SCI E;  2LA6 A;  3ILJ A;  4ANE A;  5E3Q A;  1JLB B;  2DIU A;  1Q8K A;  4OHX A;  4OX8 A;  2IA0 A;  3D0I E;  4FF2 A;  1NSK L;  2K3I A;  3CJ2 A;  5DS7 A;  4ED5 A;  1CQN A;  1NJZ A;  5C24 B;  4ZLP A;  2J7W A;  3TAQ A;  3R5C A;  2E7W A;  1IVZ A;  1KHV A;  1S6Q B;  5D0R A;  1FD2 A;  4LBP A;  5KAK A;  1CJT B;  1EET B;  2XI3 A;  4BC9 A;  2I6W A;  2DNG A;  1YI2 S;  2YWW A;  3E3X A;  1NH7 A;  4DQS A;  4X62 F;  3AT1 B;  3V4I A;  1J2V A;  4QIV A;  2DK2 A;  1GXT A;  4BHQ A;  1W2I A;  2M3D A;  3OTE A;  2CPI A;  2JEJ A;  4Y00 A;  1U4B A;  1VGY A;  4XAK A;  2F40 A;  4DI6 A;  2R7U A;  4IOA Q;  1K44 A;  5KFG A;  1U0H A;  3DLG A;  4Y2C A;  9RUB A;  4CQ1 A;  4UY8 T;  4F8R A;  4IDK A;  4ES2 A;  5GMD A;  4WE1 B;  2ZD1 B;  3OL7 A;  2Z4P A;  2N3O A;  1Q78 A;  4UST A;  2K2P A;  3AOD A;  2I1R A;  1NDC A;  2J9D A;  5JUM A;  4B3O A;  1ELO A;  5L1K A;  3NS6 A;  3HF5 A;  3Q8P B;  2BEF A;  1U6Z A;  4NCA A;  1ZM3 A;  2OTJ S;  4HYK A;  1JLC A;  5E3R A;  2W9B B;  4NAS A;  3BQ1 A;  4KT0 C;  2EC2 A;  1EHW A;  2LFV A;  2XNR A;  3QIP A;  3BDP A;  2IBO A;  3KJF B;  1JIH A;  3OXG A;  1WG1 A;  2IM1 A;  4MKA A;  1IM6 A;  4N76 A;  2WAQ D;  2LLZ A;  1DHM A;  3E8O A;  2DIV A;  4Y0F A;  4GO5 X;  2HND A;  1SXL A;  3WBZ A;  4CCH A;  1DUR A;  4F3M A;  2XSF A;  4IRC A;  3BO2 A;  1T3N A;  2HNY B;  5GMK a;  2YNG B;  4MAK A;  3HHE A;  1HHT P;  2LDY A;  3H4D A;  5HI7 A;  3SFG A;  2L08 A;  3EVM A;  1KLM A;  1T3O A;  4MK7 A;  3SCK E;  3UWT A;  3EYZ A;  1RAO A;  2FVP A;  2YQ3 A;  1O6X A;  2BAC A;  3K5O A;  1WNE A;  1CJK A;  2PFD A;  2EK1 A;  1Z2L A;  2EPI A;  4Q2M A;  3JSR A;  1HD1 A;  4LSZ B;  1WDD A;  2PD1 A;  2PN6 A;  5GAG I;  1VK3 A;  3EZU A;  5DDO C;  1SKR A;  2KN4 A;  3H4B A;  3KHR A;  5LSR A;  3MPW A;  2UVV A;  3ZZO A;  4UUX A;  3AB2 B;  4X84 A;  4I6W A;  1HI8 A;  3KLV A;  3NMA A;  1S1X A;  4DV7 F;  1YBU A;  2P6T A;  5CYQ B;  1TZ0 A;  2EC0 A;  5F8H A;  2ACM A;  2H5I B;  1RHK B;  1HD0 A;  3GIR A;  1RTI B;  1NKB A;  3R7S B;  2EFV A;  3ZZ0 A;  1U0S A;  4Q7A A;  3C2P A;  2ZWP A;  4PAA A;  5IS2 A;  4F36 A;  1RTD A;  2N7Y A;  3IFE A;  2LKZ A;  2V4J A;  3MFH A;  3EUN A;  3E01 A;  1U02 A;  3PAC A;  5K8O A;  3JB9 k;  1QD1 A;  2PO4 A;  1EKR A;  4LRD A;  2ROG A;  4YDD B;  2MQN A;  4N41 A;  1F5A A;  3ILO A;  2Y1R I;  2Y0S D;  1G1X A;  2HHT A;  3M30 B;  1QUV A;  2DT9 A;  3N4W A;  1S0V A;  5AXL A;  5D0E A;  2RVJ A;  5K8M A;  2QEX S;  1ZET A;  3C14 A;  5AE3 A;  4N5S A;  1SQG A;  4LF8 J;  1T9V A;  2CZ4 A;  2CJA A;  2M4M A;  1LV5 A;  2ZNZ A;  1NU4 A;  4DX7 A;  3BR9 A;  1LQ9 A;  5LJ5 Y;  2NSC A;  2M5Y A;  4Y65 A;  1ZOT A;  3GJS B;  1VQL S;  3QGH A;  2M9K A;  1RWK B;  2HQ3 A;  2XLJ A;  5GME A;  3VQT A;  2ASY A;  3V6K A;  4LRA A;  3PHE A;  2AGQ A;  1Z1Z A;  3GIJ A;  1YRX A;  2W2N P;  1K0T A;  3DMJ B;  1YTY A;  1Q16 B;  3QJJ A;  5AJ3 J;  4OZ3 A;  2IC3 B;  4ZCK A;  4OV6 A;  5A2Q Y;  5DGB A;  1S1V B;  3RAQ A;  3QZ8 A;  4ECV A;  1NDK A;  4R0J A;  3POT B;  4LF9 F;  2W7A A;  4JI1 F;  1IBL F;  3RZA A;  4F04 B;  3PW2 A;  4NOH A;  1N34 J;  2I5J A;  4HI1 A;  3FNN A;  3LP2 A;  1QJH A;  3B6B A;  3T1H J;  2CPF A;  1YKW A;  1VS3 A;  4NCB A;  2W2M P;  2YX7 A;  2KJW A;  2Z2M A;  3CJS A;  1U1L A;  1NEE A;  2C2Z B;  4CM2 A;  1REV B;  4P2M A;  2DNO A;  5KFS A;  3TP2 A;  5E3C A;  4USH A;  3FRY A;  1OY9 A;  4YR2 A;  4I2P B;  1P9Y A;  1DFD A;  1UVI A;  2ZE2 B;  3DN9 A;  4DDF A;  1RT3 B;  3WDO A;  4IO1 A;  5B0F A;  1J5O A;  2HHW A;  2HVD A;  2FJX A;  1ZAW A;  2AJ1 A;  5ETN A;  4ZVQ B;  2YVS A;  5CCM A;  2ERR A;  2G2Z A;  2X3D A;  5RUB A;  4C4W A;  2OUG A;  1NAQ A;  3TJ8 A;  4LF4 F;  3GTY X;  1K9M T;  3PG9 A;  4UOC A;  1BC6 A;  2CQ0 A;  3CJ8 A;  5EUH A;  3PV8 A;  4BWJ A;  1NJI T;  1VBX A;  2E5G A;  2AYB A;  5D8H B;  4EO8 A;  2AEF A;  4PUO A;  1IR1 A;  4B3R F;  2LVW A;  4DR4 F;  1S9G B;  3U1L A;  1TK0 A;  1QE1 A;  5IM0 A;  3KK1 B;  2RML A;  1IJF B;  2VJU A;  4W92 B;  3VZH A;  2OPS A;  3D3C J;  4GKJ J;  1G3O A;  1PC5 A;  3W9I A;  3VQS A;  4CH1 A;  1N6Q B;  4H4O A;  3KJQ B;  2PSZ A;  4N8N A;  3BPD A;  4R8U B;  4CLZ A;  5DJB A;  1O51 A;  4L75 A;  5E41 A;  1VJQ A;  1IBM J;  3FBB A;  3S7R A;  2DRD A;  4AT1 B;  5T41 A;  4IFV A;  1M5K C;  1SH0 A;  4DR7 J;  5LM7 E;  4TY8 A;  1NHK L;  4CNY A;  1X5P A;  3ENW A;  2XZT B;  3D9B A;  2RUG A;  1VRQ C;  2IM2 A;  1CG2 A;  3VAG A;  1U6F A;  4ICL B;  3UCU P;  4WKR A;  4DUY J;  4P6Q A;  1S6U A;  3FDS A;  5ETT A;  4CH7 A;  4KFB A;  4DR6 J;  4GMK A;  2DHA A;  2VBY A;  3IWX A;  2QYC A;  4OQJ A;  3V6D A;  3TAM A;  1WHW A;  3HPO A;  1RXO B;  2GJI A;  3SI8 A;  2OHD A;  5AJ3 F;  4B3M F;  5CAB A;  3QO9 B;  2C2D A;  1BQM B;  3R1H A;  2ZVS A;  3F44 A;  3RB0 A;  1FX2 A;  5B7W A;  5L38 A;  2BR0 A;  4IFY B;  4WFA Q;  3UN2 A;  5KT6 A;  2HAI A;  4FS1 A;  3IRX B;  1N34 F;  3HJF A;  4OI4 A;  4HHH A;  3OTC A;  2PE8 A;  4QR0 A;  2H54 B;  4DL2 A;  2NZ4 A;  3CJK B;  2GS8 A;  2BRK A;  5D15 A;  1N5Q A;  1R3N A;  4NLR A;  3PVX A;  4ZJO A;  1BQX A;  5JMN A;  3I9V 9;  1FJE B;  3V81 A;  2H65 B;  4FKX A;  3NRB A;  2MQ8 A;  4OI6 A;  4G1P A;  2OEK A;  1KOO A;  2DRB A;  3NS7 B;  4A8Y A;  5K5M A;  2M52 A;  2Q43 A;  2APO A;  1RAJ A;  2X3G A;  3G4S S;  2R7Q A;  4BWM A;  1RWU A;  4QZV B;  3D1O A;  2XEX A;  4PXC A;  5DQG A;  1RT7 A;  5KTQ A;  2XI2 A;  4HHJ A;  4HT5 A;  1H72 C;  5IWA J;  1FXL A;  4QW8 A;  3H20 A;  1K1Q A;  1WC1 A;  1HBO A;  5D6G A;  2QMX A;  1HHS A;  3R1L A;  4TU7 A;  3B4M A;  4DSJ A;  3LTO A;  2ZUA A;  2H5E A;  4UT4 A;  5KFF A;  3AH6 A;  3B54 A;  3MPY A;  4RUB A;  4USU A;  3AXM A;  1PCA A;  4TVA B;  2ASD A;  1KR4 A;  1XQI A;  3W1Y C;  5E5N A;  1S72 S;  2V50 A;  2NUU G;  1WEZ A;  3FBC A;  1KOH A;  1L5U A;  3IWL A;  1T9U A;  2R4F A;  2J6S A;  1IBM F;  4F7V A;  2W7P A;  1QSS A;  1HNZ F;  2AEM A;  5AXM A;  3NGK A;  2ZC3 A;  1C1B B;  4LF5 J;  5IV4 A;  1SIW B;  4I4B A;  4B9M A;  1QSL A;  4FXV A;  5IT9 U;  4RUA A;  4TYA A;  2WHO A;  1S0N A;  5KFH A;  5AXK A;  1SC3 B;  3GV7 B;  5L9X A;  1J27 A;  4ED0 A;  5F3T A;  3C66 A;  2XO7 A;  3OR2 B;  3CJR A;  1U1K A;  4E8U A;  4PWW A;  2LQB A;  4EBD A;  1LK7 A;  5IC4 B;  4DUY F;  5K8P A;  1RKI A;  3D2W A;  2GCF A;  2OI2 A;  3CSK A;  4DU7 A;  3MCM A;  2HG4 A;  4DR6 F;  2OSQ A;  1OMS A;  2X1B A;  3PFE A;  2N7C A;  3FCW A;  1LWC B;  4QIW D;  4DWI A;  4Q44 A;  3VAK A;  2QYG A;  4OMF G;  1PAE X;  2J8A A;  4KHM A;  1VJW A;  1HNX J;  4WYW A;  1Y3K A;  5I3P A;  2GQQ A;  1R0B G;  4C98 A;  1GNK A;  1K47 A;  2JL9 A;  1VRT A;  3DLE B;  2IHR 1;  2BE2 B;  1FNO A;  1D9A A;  4RW7 B;  4ANC A;  3G2X A;  4URS A;  4RWW A;  4KH1 B;  2D1C A;  2RT3 A;  2KT5 A;  1EP4 B;  3ILL A;  2J6U A;  1LK5 A;  4DQR A;  3EZ5 A;  1HBM A;  1OY6 A;  4DHV A;  2L41 A;  5DDQ C;  3QGP A;  4MIA A;  2GAG C;  4U6P A;  3MCS A;  3OJS A;  2HBY B;  3HVT A;  2Z30 B;  4G3I A;  5HBM A;  3IN5 A;  3CD0 A;  4ZPD A;  4K4T A;  4OYZ A;  2UU9 F;  3J81 U;  4BDP A;  2F4V F;  3PJX A;  4TN2 A;  2YWH A;  3KYL A;  3JTP A;  3FEY B;  3O1L A;  2HVI A;  4O4G A;  2RH3 A;  3BEG B;  4OJH A;  4RLE A;  2RU3 A;  2AT1 B;  4ILM A;  3DRR A;  4RU9 A;  1M1H A;  2EBE A;  4Q45 A;  4CLL A;  1XWL A;  3PJ9 A;  3PEH A;  4FF1 A;  1U1O A;  2VPZ B;  5IWA F;  5IOL A;  4WTY A;  4X2B A;  2AX1 A;  1SV5 A;  1S9F A;  2NYH A;  4F4X A;  4KAI A;  2YXL A;  4EYH B;  2V8V A;  3ELH A;  1FDD A;  2WTF A;  4RX6 A;  1N32 J;  2KFZ A;  1NLK L;  3PW5 A;  1YJU A;  2P2C B;  3V6H A;  2VB6 A;  3Q8U A;  2VPW B;  5KFU A;  4KGM A;  5CZX A;  2HUR A;  1X0F A;  2L3M A;  4IYQ A;  1SL1 A;  3J7Z 5;  3QJP A;  5T7L B;  2NS1 B;  2BJ3 A;  4DR1 J;  4AE5 A;  1Q8L A;  5HLF A;  1W25 A;  4NE9 C;  3IWN C;  3EXC X;  1T9W A;  3OW2 R;  3TZY A;  5J2N B;  3JYT A;  1MU2 B;  3MR5 A;  1N8R T;  2E29 A;  3CCQ S;  3T6J A;  3PZP A;  3EZO A;  2U2F A;  3QID A;  2OMO A;  3PDN A;  4BCA A;  2W2O P;  1ROF A;  2DGO A;  2VFR A;  3JSY A;  3PX4 A;  3N01 A;  2BUN A;  1NND A;  4DSK A;  1U09 A;  2QL7 B;  2MQQ A;  3FEZ A;  3NWG A;  3VF0 B;  3PYE A;  3KUE A;  4USJ C;  1NK6 A;  1MN7 A;  2C3O A;  1CPZ A;  2CPH A;  1R0A A;  1P27 B;  1ZH5 A;  2ILZ A;  4I0W A;  5ETR A;  3QRR A;  4WF9 Q;  3KNG A;  3SSS A;  2DY9 A;  3M6V A;  1FF2 A;  5HRO A;  3I5A A;  3D1Q A;  2ILY A;  4IRD A;  2NPI A;  2UXB J;  2HRU A;  5F41 A;  1MML A;  2X1F A;  2VV5 A;  3IBF B;  2LEC A;  1QSY A;  2KXN B;  1AXQ A;  4F26 A;  1D3W A;  3TUJ C;  1KLN A;  1F1B B;  3GFY A;  4TY9 A;  2LU1 A;  1FNM A;  3QJL A;  1XC9 A;  2DKO B;  4MFB B;  1TKX A;  1YQH A;  1TEL A;  3TX0 A;  2CQI A;  2R7R A;  1TVR B;  2R8K A;  2XUL A;  2CVI A;  3QBC A;  2IA6 A;  3TOQ A;  3W5X A;  5LSO A;  3VAH A;  4J9O A;  1YSJ A;  2FDN A;  1RBO B;  4WYL A;  1UKU A;  2RDI A;  1RHM B;  1RGV A;  3Q2T C;  1TAU A;  2DR6 A;  4IG0 A;  4OJ1 A;  5KG1 A;  2ZH6 A;  3M8W A;  2YNH A;  1VOM A;  2XGP A;  3PIP Q;  1GMW A;  1ITP A;  3RBX A;  4E2F B;  3K5N A;  3UE2 A;  1YWX A;  3W7B A;  3IXQ A;  4B17 A;  1KVJ A;  5EGY A;  4DS5 A;  3W61 A;  2AKW B;  4OHW A;  2R2U A;  4NRU A;  3CXC R;  3U02 A;  2FHO B;  4J37 A;  4OYB A;  3ZO7 A;  2WB1 D;  2HZC A;  3F0N A;  1G2E A;  2M7S A;  4DQI A;  4PPZ A;  1D8Y A;  4HTJ A;  4JI5 J;  3C15 A;  4WXW A;  8ATC B;  3KOA A;  1RBL A;  1S57 A;  2V9K A;  2J9E A;  2V5H G;  4BS2 A;  2XMT A;  2DD8 S;  2A6M A;  2B56 A;  3ZZZ A;  4JV0 A;  2BKO A;  4B3T F;  4FYV B;  4NLW A;  2W2P P;  4DR1 F;  1IBC B;  3QAE A;  1S97 A;  2LXI A;  4X4P A;  3G86 A;  2AD9 A;  1RAI B;  2MKH A;  1MLA A;  2I38 A;  3EPI A;  3KHH A;  1VRU A;  2WON B;  2PI4 A;  4QWA A;  2WVF A;  1S9E B;  3H59 A;  3P5T L;  5LOQ A;  1ZTW A;  1V3R A;  1WOS A;  3MUV P;  1PKU A;  2VIH A;  3SDE A;  4Z37 A;  1J5E J;  1AFJ A;  2ZH3 A;  3HVW A;  1NSA A;  3GV8 B;  4WK3 A;  4QWD A;  4ILR A;  3W63 A;  1U1M A;  4C0B A;  4P2S A;  4C0O C;  2J9D E;  1RWX B;  2Y3Y A;  3M32 B;  4JI6 F;  1N5T A;  2DXF A;  2L48 A;  3CCR S;  1SJR A;  3H98 A;  3M7V A;  1YIT S;  3GIL A;  1RKJ A;  5A76 A;  4OHZ A;  2OTL S;  4P2X A;  3MHY A;  3CCZ A;  5KG6 A;  2D3O 1;  2AJQ A;  3NKY A;  1BWE A;  3HHK A;  1HPZ B;  3AD9 C;  4Y2K A;  4DR3 J;  1G6B A;  1RLD A;  3CCE S;  1N54 B;  3OXF A;  4AYB D;  3I31 A;  1I51 B;  4NCG A;  1YHQ S;  3K59 A;  2DNP A;  1AW0 A;  1HYS B;  2VFU A;  3JXO A;  3LP0 B;  4W98 A;  4DL4 A;  5KG0 A;  4I6A A;  3CCM S;  3ENQ A;  5KFW A;  4MYT A;  3G6E S;  1S59 A;  5DRK A;  2K7J A;  1Y0H A;  3V4M A;  5SUH A;  4OYM A;  2HZV A;  1KTQ A;  4M95 A;  4IUF A;  2RIJ A;  3FMW A;  4UZC A;  5E0O A;  2CQG A;  3HSZ A;  4J9R A;  1JLF B;  1CS4 A;  1NME B;  3OSP A;  5IC6 B;  4NXN F;  4C48 A;  3MAH A;  2VD3 A;  3CCL S;  4I68 A;  3RRH A;  3OL8 A;  1NDL A;  4I6Y A;  4CNZ A;  3LH2 S;  2CPD A;  1XR7 A;  3D67 A;  4ZCI A;  5JVG Q;  5A0Y A;  4JI5 F;  1D09 B;  4WII A;  1XR5 A;  1T02 A;  4YY3 J;  1OYD A;  4JP8 A;  3MTJ A;  1WC3 A;  4I56 A;  4Y3C A;  4QYZ J;  2HFS A;  3VTI A;  2E9Z A;  3A3P B;  2W8K A;  5LMU J;  2YQ0 A;  2OEM A;  3MGJ A;  4DV5 F;  4TLQ A;  3AHP A;  5L1J A;  4QYZ K;  3QGG A;  1GTH A;  3DRP B;  4JV2 A;  3CED A;  5SZT A;  4NLO A;  3K8W A;  4LFC J;  4ED7 A;  3VAL A;  3R5G A;  4I7F B;  3MI7 X;  2E1C A;  1IKX B;  2OPR A;  2OPQ A;  4ZPT R;  5DM6 Q;  3MEG B;  3OR1 B;  2SXL A;  1RLC L;  1MMD A;  2B5J B;  2JNJ A;  5EWG A;  3WIU A;  1UTA A;  3LWL A;  2ZH8 A;  1YJN S;  2UUA J;  1SH2 A;  2B6A A;  1Z2Z A;  2ZVI A;  5A6P A;  1QAX A;  1WG4 A;  4ZN3 A;  2P5V A;  4IQX A;  4A8S A;  2FVS A;  1UEV A;  1F3F A;  2E9T A;  4M5I A;  2EFG A;  2PT0 A;  2JHE A;  1C0U A;  4DL5 A;  5M2P A;  3KLH A;  1UVJ A;  3WIV A;  1B70 B;  3T5J A;  3FBE A;  2RNE A;  3V4I B;  1F3V A;  2AYM A;  4HH0 A;  2MKI A;  4DPO A;  3T5L A;  3UPF A;  4RW8 A;  3A3N B;  4X4V A;  2CPX A;  3FUY A;  3NCP A;  3MMJ A;  1R8H A;  4O3N A;  3KTQ A;  1LNQ A;  1PC4 A;  3UCG A;  3VGS A;  1R8B A;  1GK8 A;  1S7I A;  1SJQ A;  1U0H B;  3DLG B;  1KKH A;  2ZBQ A;  4IDK B;  2B9W A;  3AJ1 A;  3FSY A;  2QLJ B;  4ZVS B;  2F65 A;  1EIY B;  3T5H A;  3ZZU A;  2VQE J;  4DV4 J;  4ZVU B;  1GX5 A;  1RYS A;  4B3O B;  1IKW A;  2WSE C;  2CQ2 A;  1URR A;  1IR0 A;  3G8S A;  2F8E X;  4DSI A;  1JLC B;  3JQK A;  4EO6 A;  1V6H A;  3LAK A;  2BE7 D;  3IR6 B;  1Q86 T;  3QIP B;  2R2S A;  2RSQ A;  5HVG A;  3WZ0 A;  2BW2 A;  4CH0 S;  2N3L A;  1KC8 T;  3P6Y C;  3QSI A;  3HKZ D;  2P9G A;  4YY3 F;  4M94 A;  2QE5 A;  2HND B;  1WEL A;  5GAH I;  3W5Z A;  4NLS A;  2FLP A;  1T03 A;  3TEH B;  4CO5 A;  4NX9 A;  1TL4 A;  3KUG A;  5LMU F;  1QUP A;  2RRB A;  3OJU A;  1B7Y B;  3BGO P;  1X60 A;  1P1T A;  1D9F A;  4Q2L A;  1SB6 A;  1UJ5 A;  3GFX A;  2M8D B;  1CJK B;  1F2G A;  1TL7 B;  5L8R C;  3CCS S;  1D8Z A;  3HLU A;  1SKS A;  1KS2 A;  3ZZP A;  3IC1 A;  3MCN A;  1F9E B;  1Y7P A;  3ZZR A;  4ECT A;  3K0J A;  1YZ6 A;  2AQ4 A;  2UUA F;  1GEH A;  3D0H E;  5K8N A;  4AQY J;  5EHH A;  4P75 A;  2GIF A;  4K5S A;  1T94 A;  3KG0 A;  1SJ1 A;  4DSF A;  2CPZ A;  3NL0 A;  1B64 A;  1S1X B;  4KIA A;  3PEJ A;  3H5U A;  2V94 A;  4DPY A;  2FD2 A;  1HBN A;  2V8G A;  1RAF B;  4IKA A;  1ACM B;  3I4H X;  2WZ1 A;  4LF7 F;  2EBG A;  4WFN Q;  2UXD J;  2RF2 A;  2B4U A;  3OTO J;  3FFI A;  5LT5 A;  3PNI A;  4KGK A;  3UFC X;  4B9S A;  4J9V A;  1RTD B;  3H5X A;  3BQ2 A;  4A8W A;  3MEE A;  2V4J B;  5M2R A;  1C2P A;  5KFT A;  1S77 D;  3SBM A;  3E01 B;  5D4P A;  2JFK A;  1R8P A;  5F9N A;  4FXD A;  4CO4 A;  3MOJ B;  1WI8 A;  2ZKU A;  2H9Z A;  1GMU A;  1VYA A;  3RUB L;  2JX2 A;  3QRQ A;  1KEK A;  4B9U A;  2BQ3 A;  1X4E A;  4QIG A;  4C2M A;  2A3J A;  2A6O A;  2CJK A;  4ER8 A;  2CNL B;  4KB7 A;  5B0G A;  1Y5L B;  1LKZ A;  1SL2 A;  2CQD A;  2QA1 A;  5C5J A;  4WJB A;  3FQK A;  3C14 B;  3BGR A;  1EX8 A;  4J5O A;  3SCJ E;  2UUT A;  2CFX A;  2MEW A;  5A8W A;  3M2V A;  3QAT A;  2VQE F;  2BW7 A;  1S1W A;  5L9N A;  2DGQ A;  1FES A;  3G8T A;  4W90 B;  2CG8 A;  2NR0 A;  2HFU A;  2EEY A;  4ELT A;  3IBC B;  3PR5 B;  2CZV C;  4WP3 A;  3OLA A;  1OPI A;  2HGL A;  2CIM A;  1NHV A;  4YEA A;  1N5S A;  3TI0 A;  3IR5 B;  1RTZ A;  5J2P A;  2E1M C;  2MDA A;  3PRB A;  4DV6 F;  3SZ2 A;  2PEH A;  2B8Q A;  2NXU A;  2I5J B;  3EIC A;  3SIP B;  5F8L A;  3LP2 B;  1F5B A;  4CZC A;  2FGO A;  2W4C A;  5J1E A;  2RHQ B;  3M1V A;  4O4R A;  3HCX A;  4ZHR A;  2DXE A;  2G0J A;  2WBR A;  2RS2 A;  1IWA A;  3MEC A;  2JZ5 A;  3IA0 A;  5F0U A;  5FII A;  2UXC J;  4QR2 A;  3I6P A;  4F4Z A;  1J5O B;  2CJY B;  1RA7 A;  2FY8 A;  4OYA A;  5EX0 A;  3W5Y A;  3AJ2 A;  2VUG A;  3W60 A;  5H9E J;  3PKM A;  2E7X A;  5LSL A;  4AQY F;  4DPW A;  3Q24 A;  5EWE A;  2CWX A;  5H9E K;  1AB8 A;  1JLG A;  2QFI A;  4O44 A;  1HFE L;  1X5O A;  3CME S;  1QTN B;  1QAJ A;  2GHV C;  2XZW A;  1H7W A;  5E7O B;  4DX8 H;  2GAH C;  4PUO B;  1OIA A;  1QE1 B;  5IM0 B;  3ISN C;  4X4Q A;  4OYW A;  2OPS B;  2HQC A;  1U24 A;  2UXD F;  4LIR A;  1K1S A;  5B0C A;  3NS5 A;  4H4O B;  3ZZT A;  4GO7 X;  2XZD B;  2ZH7 A;  5IV3 A;  5J2M A;  3ONQ A;  2VDH A;  2Y1L B;  1WF1 A;  2RS8 A;  1NK7 A;  2V2K A;  3LP1 A;  3CIM A;  2FIU A;  3GSD A;  5KG2 A;  2W01 A;  4IFV B;  1S10 A;  1UVM A;  1Q53 A;  3FCV A;  4BC7 A;  4XIU A;  3CD6 S;  2HGN A;  4TY8 B;  1YBA A;  2UUW A;  2Q6C A;  2M88 A;  3MM7 A;  3A8K A;  3VVU A;  5BR8 F;  4I64 A;  3F56 A;  3GLJ A;  1UPP A;  1DRZ A;  4KY3 A;  3DDN A;  3EJM A;  2DPJ A;  2RJZ A;  3CJ3 A;  1O8B A;  2XWY A;  1H7X A;  1T9T A;  4KFB B;  4LJM A;  2MQP A;  3BBB A;  3V6D B;  1NM2 A;  3TAM B;  4NZ0 A;  3DDK A;  2E44 A;  4XPE A;  2MY7 A;  3I4P A;  3Q8Y A;  3CC7 S;  4C8L A;  4U95 A;  4K5R A;  2E9R X;  1KQF B;  2GA7 A;  4LSL A;  3UD4 P;  1EZZ B;  3O3L A;  1MWQ A;  2VBW A;  2RQC A;  3CDA A;  2ASL A;  1S1U A;  3I5C A;  3KK2 B;  3HK2 A;  4O3R A;  3HXM A;  2VC0 A;  4ZPW R;  4LFA J;  1KHW A;  2LQ5 A;  2CPY A;  2W9C B;  1H98 A;  3V81 B;  1KWM A;  1TL5 A;  1NRK A;  1AUD A;  3EGW B;  1U8W A;  2I2Y A;  3DOM B;  4PXD A;  2W9A A;  4ZLN A;  3OUY A;  1TAQ A;  3EXY A;  5GAE I;  1I3O B;  4OYX A;  4N8O A;  1QDU B;  2PGC A;  2JEG A;  1F5C A;  1UAW A;  1R27 B;  4IH6 A;  2VFV A;  1RT7 B;  3A1Y G;  4GC7 A;  4M5D A;  4ECU A;  3BF4 A;  3FZB A;  2WOM A;  4MMO A;  3MR6 A;  2HHX A;  3Q89 A;  2X7I A;  4DFJ A;  1HBO B;  3BKT A;  2V69 A;  3KMQ A;  1T11 A;  2OH2 A;  1YK9 A;  3MPV A;  3GSI A;  3ZFV A;  3TX8 A;  3PKY A;  3DLJ A;  1Y00 A;  1VQ6 S;  2HS3 A;  2V6A A;  4C3K A;  1OJ4 A;  3OT9 A;  1S6P A;  3X1L B;  3DI6 A;  1JNR B;  3OLB A;  4NLX A;  3HP6 A;  1R6V A;  4EZ6 A;  1I5O B;  2B9E A;  4KHP F;  2CQ3 A;  2DNZ A;  5KFQ A;  3EMT A;  4N56 A;  4DV1 J;  1R8A A;  4DUZ J;  2V0N A;  3I82 A;  5A8K A;  1KTV A;  2VBZ A;  5C2G A;  3H2V E;  3PO5 A;  2HK3 A;  4YUD A;  5THW A;  1NK9 A;  4HI2 A;  1CJU A;  3MMC A;  5HO4 A;  1LW2 A;  3AD7 C;  2BYC A;  2PMZ D;  2ZH1 A;  2OP5 A;  2OJ3 A;  2LQJ A;  4C7Q A;  5K14 B;  1HL6 A;  2M8H A;  3LPY A;  3GMG A;  3EGV A;  1OQ6 A;  2MKK A;  2HFZ A;  2VBX A;  3BN4 A;  3MM8 A;  1NPR A;  1FDB A;  2FVQ A;  3CNQ P;  4MJK A;  3EWG A;  2MZQ A;  4Z7C A;  2G1D A;  3ENV A;  1IKY B;  4ZLJ A;  3L95 X;  3MD3 A;  2GQ2 A;  3SXL A;  1S0O A;  4O3Q A;  1EB0 A;  2XMM A;  3CPW R;  4LR8 A;  4AXI A;  1PO6 A;  1VRT B;  4UUW A;  1WEY A;  5MLC V;  3FK4 A;  4ECZ A;  2DR7 A;  3M8Y A;  3V5R A;  4NZ7 A;  2MMY A;  4CIO A;  4LRE A;  1LWE A;  4NA2 A;  4LSN A;  2UVR A;  3VZI A;  4CO3 A;  2EFN A;  4MIB A;  2JLF A;  3IO1 A;  1RCO B;  1HBM B;  4J9K A;  2IYG A;  2EG2 A;  3ADA C;  4F4K A;  1IN0 A;  3DU5 A;  3EM1 A;  1X5S A;  3CD7 A;  4X4R A;  1FTR A;  1N5Y A;  3AOB A;  2MKJ A;  3HVT B;  5D3G A;  5HBM B;  3I0R A;  3RW7 A;  3CWJ A;  2FHK A;  2FY1 A;  5DDP C;  1YX2 A;  4DN0 A;  3G8Q A;  4C3M A;  1Q0N A;  1NCL A;  3G82 A;  5GAD I;  2DGX A;  4X65 J;  4O4G B;  1LOU A;  5ETP A;  1FVS A;  4V1A k;  2MHN A;  3DRR B;  4JI3 J;  2CZ9 A;  4NL5 A;  4ZVP B;  2R7O A;  3D68 A;  3O5T B;  2FLN A;  4FPI A;  1E6V A;  3DM2 A;  1SV5 B;  4DR2 J;  2MHE A;  2AYE A;  3LGN A;  1KDN A;  2F1F A;  4Q5V A;  3QZ7 A;  4DMZ A;  3KDO A;  5IT9 Y;  1YJT A;  1SVD A;  3UN3 A;  4U7U K;  1FA0 A;  2HHS A;  4ZP6 A;  2BAN A;  3J7Z T;  3GFH A;  3LGM A;  3NG8 A;  1ZA2 B;  4DU8 A;  5BYR A;  5HLF B;  1UW4 A;  1KNZ A;  4DV1 F;  4K4X A;  4R25 A;  3KMS A;  2HMI A;  4UY8 5;  4FVM A;  3TO8 A;  1RI7 A;  1M5S A;  3TEG A;  2IDE A;  7FD1 A;  1FER A;  1UWA A;  2QX0 A;  1T0T V;  1R89 A;  2ASJ A;  2ZJQ Q;  2XWX A;  1ZM2 A;  4B9T A;  4DLG A;  3QLH A;  2W9B A;  1DBD A;  1UFK A;  4ATN A;  1M90 T;  5HMW A;  1YIJ S;  2IMW P;  1R0A B;  1FRJ A;  4F0H A;  2Z0G A;  4DUT A;  3HD2 A;  4ZA1 A;  2FJD B;  3OTB A;  3W9J A;  3SSQ A;  4MKV A;  5HRO B;  5ETS A;  1RWV B;  5FDL A;  2JRS A;  3MF5 A;  2R8G A;  1TV6 A;  4G65 A;  2X1A A;  2IJF A;  2GNK A;  4ZJL A;  3DYA A;  2IVY A;  1VQ5 S;  1T9Y A;  3KJV A;  1A7G E;  3PXG a;  3JAM U;  5C42 A;  3MCO A;  2HBZ B;  4NA3 A;  2KRR A;  2ZUG A;  3WX8 A;  4RNH A;  1ZYQ A;  2RQ4 A;  1S4F A;  4ECY A;  3J81 Y;  3UDE A;  1N36 J;  1KP6 A;  1TKX B;  3LPE A;  3MM9 A;  2BJ8 A;  4IR9 A;  3L7U A;  4NXM J;  3KHG A;  4RUC A;  1FDA A;  1RT6 A;  3PX0 A;  1XMO F;  2LP4 A;  4IG0 B;  1PYO B;  1WUU A;  1VHF A;  2YNH B;  2BQR A;  4HL9 A;  4X65 F;  4DR5 J;  1N0U A;  3ZZY A;  4K4Z A;  2J0W A;  3HJV A;  5B0D A;  3R5D A;  3OVB A;  4L76 A;  3BBC A;  5C7P A;  4ZIT A;  3HHL A;  4DV3 F;  2HNZ A;  1U1R A;  3TA2 A;  4WPA A;  4HLB A;  2CUY A;  4PCQ A;  1UWB A;  4TU8 A;  1PSD A;  1P1L A;  3PW7 A;  2DGT A;  4PWD A;  4DPT A;  1E6Y A;  2FZC B;  4EBE A;  3UR0 A;  1EAR A;  3S6E A;  2DGU A;  4LRB A;  4WFZ A;  2UUB J;  3ISN D;  3HM9 A;  1SKU B;  2YWF A;  5KT4 A;  2CDR B;  2IIH A;  5KFR A;  3N79 A;  5DQH A;  3N6L A;  2Y8W A;  3P5B P;  1RAD B;  2DCL A;  1VRU B;  4Q8E A;  2BXJ A;  2ZH2 A;  1JXV A;  2MGZ A;  1HNW J;  3DU6 A;  2VF3 A;  4TQS A;  1GH8 A;  2KTQ A;  3LAM A;  3TWZ A;  5HQM A;  4NRT A;  3KXD A;  3M8P A;  4LQ3 A;  3SDE B;  2QLF B;  2XM3 A;  4QR1 A;  2R2T A;  2G2Y A;  5I3U A;  2GVD A;  3QMQ A;  4RNF A;  4NI2 A;  4ECX A;  1FXD A;  1H2U X;  2C2M B;  3THT A;  4A8M P;  2CQP A;  1KN6 A;  3UVJ A;  1OQ3 A;  2YKQ A;  3Q0A A;  4ED3 A;  2POK A;  3GYG A;  5DG9 A;  2Q6B A;  3T19 A;  5C2C A;  3JSM A;  3J7Y U;  2D69 A;  4HT7 A;  2QL9 B;  4RW9 A;  4DXL A;  4YP3 A;  5CD4 A;  3EVW A;  4YS2 A;  1MNE A;  2XHW A;  3KLI B;  5HAN A;  1T7P A;  2JOQ A;  2ROE A;  2PEB A;  3LF0 A;  1VR6 A;  2OFH X;  3MEK A;  1X8D A;  2FGC A;  5FLX U;  1VIO A;  4NCG B;  3OHA A;  2DIS A;  4TQR A;  4J9M A;  2MKS A;  3QFH A;  2R7X A;  1R8C A;  2GQC A;  4RUH A;  3GR1 A;  3IBW A;  4NXM F;  1NK5 A;  5KFA A;  1KQG B;  1L3T A;  4FF3 A;  3EVO A;  2B7C B;  1CS4 B;  1TP7 A;  2FLO A;  1I94 J;  2KFY A;  1N88 A;  3CDE A;  3I0S A;  4ZPB A;  4OI0 A;  4JI0 J;  1HNV A;  2HRT A;  3D7S B;  2MZ1 A;  1LW0 A;  1V3S A;  3K5P A;  5J1P A;  4F2S A;  1S12 A;  4GVL A;  5HK4 A;  2BKP A;  1RE1 B;  2KB2 A;  3MED A;  2WSF C;  3J81 j;  2COL A;  4EI2 A;  1TK8 A;  4S0M A;  2FJV A;  5E33 A;  1RJJ A;  3HI9 A;  2F5G A;  1X0P A;  2UUB F;  1FNX H;  4UOG A;  4IOC Q;  3GIM A;  1LXN A;  2CAD A;  1Q5V A;  2JJ4 D;  3NGU A;  3G6V A;  4H4M A;  2IVM A;  2C3U A;  4CLY A;  2D7S A;  2LCW A;  1TR0 A;  4J9U E;  1SC4 B;  4OZ2 A;  2QZ8 A;  1RTJ A;  1TKD A;  1D9D A;  2BM0 A;  2OPR B;  1RWM B;  5DDR C;  4WXO A;  2OPQ B;  1H2V Z;  3N6N A;  5B08 A;  2XLI A;  2DH8 A;  1XNQ F;  4LR9 A;  1F9F A;  2DNK A;  4ERD A;  2O66 A;  2WBM A;  2GJ2 A;  1U26 A;  1WEX A;  2HFN A;  4MK9 A;  1WC5 A;  5KFI A;  2CQ1 A;  2B6A B;  4U9R A;  2ADC A;  1ZBT A;  5EX3 A;  4A47 A;  2RDJ A;  2C3P A;  1U47 A;  3R6G B;  4I69 A;  5KFK A;  1WC4 A;  4O3O A;  4Y2M A;  1GMV A;  1SH3 A;  3M2R A;  2H48 B;  3HFK A;  4R0E A;  1C0U B;  2JWN A;  3CJK A;  1YVF A;  3PTW A;  1X4C A;  3HX9 A;  1EAY C;  3KLH B;  4A8F A;  3J80 Y;  2H1Y A;  2D9P A;  1HWJ A;  2J0Q D;  3BQ0 A;  2BKN A;  3T5K A;  4HHU A;  3UI3 A;  5ETO A;  4RW8 B;  2OAU A;  5H1S V;  5D0H A;  3A13 A;  1DTQ A;  1JJ4 A;  3P45 B;  2Z2Y B;  4AND A;  3RBZ A;  2OD6 A;  5L39 A;  1LEO A;  3BS9 A;  3QT6 A;  2G0C A;  3E51 A;  1VC6 A;  4EWT A;  5KT7 A;  1UJ4 A;  1I94 F;  4PEO A;  4RNO A;  3S8S A;  4DN9 A;  4IG3 A;  1T05 A;  3OFH A;  2ZEJ A;  4JI0 F;  4I2Q A;  1IKW B;  3K89 A;  2C2N A;  1FKP A;  3ET6 A;  3N28 A;  3OL6 A;  4GVB A;  2CXE A;  4LVO P;  1A6L A;  1VBZ A;  3M9M B;  1JLE A;  2Y8Y A;  2QSF A;  1WDT A;  2MJN A;  4Y2A A;  3KLF A;  2XMU A;  4ZIV A;  4OLP A;  1WJ9 A;  2Z58 B;  4XO0 A;  4MT1 A;  4WP8 A;  1Y11 A;  3F73 A;  1T03 B;  2XMK A;  3PJW A;  3BZQ A;  2CJQ A;  1N52 B;  3FRZ A;  2VG7 A;  3OPK A;  3SQG A;  4FN5 A;  4PG6 A;  2J0S D;  5DLG A;  3CCT A;  3OHB A;  3GII A;  4K8R A;  2L9N A;  3M8S A;  2IM3 A;  3GJR B;  2DH7 A;  4QBU A;  1Z4U A;  2HGM A;  4P9S A;  1SCJ B;  3D3B J;  2DR5 A;  2CQH A;  2RRA A;  4RNM A;  2YKA A;  4DV2 J;  4DL6 A;  4DCJ B;  5LJ3 Y;  1UL3 A;  4KGX B;  2VOD A;  1XR6 A;  1VBY A;  5CCL A;  1HBU A;  3D28 A;  2HEK A;  3O6Q A;  2OD4 A;  4JI8 J;  1WOR A;  4LBI A;  1HBN B;  2B4V A;  2X1G A;  4G1Q A;  2WW8 A;  4JYA J;  1MWZ A;  3DGV A;  5I42 A;  1PYS B;  3H40 A;  2RF2 B;  4N77 A;  1FK9 A;  1S49 A;  2KKH A;  2P8I A;  3HHN B;  3TUI C;  3FFI B;  3DLK A;  1RT4 A;  3MM5 A;  4X4S A;  3CIZ A;  2L9W A;  3H7H B;  3MEE B;  3DXB A;  1RWW B;  1HNI A;  2G2O A;  4QU6 A;  1PIL A;  2BE9 B;  4JBC A;  2HYI B;  1PGZ A;  3DCA A;  1LFP A;  2WVC A;  3WC0 A;  3RBD A;  4AFF A;  3UQS A;  2IJR A;  5IXU A;  3C6T A;  3GON A;  2R9L A;  4YME A;  2XTJ P;  4WTO B;  2Q79 A;  2OML A;  2ZOF A;  4KGV B;  4YR0 A;  2NPF A;  4KPC A;  3VVT A;  2VG5 A;  2OO4 A;  4RZR A;  3OVS A;  3HDS A;  4WFY A;  1FWL A;  4B9L A;  5A8W B;  1QY7 A;  3M2V B;  1NJY A;  1NBE B;  3TRG A;  2NQP A;  2ZZT A;  1S1W B;  2GVZ A;  4WP9 A;  3C46 A;  2N4D A;  4EBC A;  4RW6 A;  4KO0 A;  2KFN A;  4LF8 F;  5KG7 A;  2BV3 A;  2XSJ A;  3RRK A;  3TVY A;  2LDI A;  4F4A A;  3PYD A;  2BDP A;  5KT3 A;  2AYG A;  1FRM A;  1RT5 A;  3H8Y A;  4K2X A;  2E5L J;  3RTV A;  3AOA A;  4NPO A;  1BLU A;  3PYG A;  1VQ9 S;  2DHH A;  5J2N A;  2CAJ A;  1Y5I B;  4UQG A;  4PYA A;  4NYO A;  4AUK A;  1SJF A;  3Q86 A;  4F25 A;  2HHU A;  3M1V B;  3TAN A;  4TKT A;  4ZHR B;  4MTP A;  2ABY A;  1FKO A;  1FJC A;  2FB0 A;  5D4O A;  1A0O B;  1U1Q A;  3DRY A;  1RDR A;  3KLG B;  2XS2 A;  3FZ2 A;  3KG1 A;  3MEC B;  3T1H F;  2NCK L;  3KWM A;  1NSQ A;  4ZVG A;  2DXD A;  3N9U C;  3TA0 A;  4X4U A;  1WHV A;  3DRS A;  1VQ8 S;  2ZFH A;  3NWR A;  3QT8 A;  1HAR A;  4DV2 F;  3KDN A;  5HN0 A;  1R6Y A;  5F8G A;  4DFK A;  3RW6 A;  1JLG B;  3IM8 A;  2HWT A;  3BSC A;  3BDE A;  3HT3 A;  2F9D A;  2KDO A;  2YPY A;  3UN5 A;  2J9C A;  2YKN A;  1X4A A;  4JI8 F;  3G6Y A;  3BSA A;  2K1R A;  1VMB A;  2WK4 A;  2ZH5 A;  4ZP7 A;  1TMM A;  1Q95 G;  4KKO A;  4USI A;  4RNN A;  1C0T A;  1OS5 A;  1BY9 A;  4U8Y A;  4YB6 A;  4DG1 A;  1HWL A;  3D4J A;  2MY8 A;  5J2M B;  5KFM A;  1B99 A;  2C3Y A;  3CJ0 A;  4WIQ A;  3CO0 P;  3LP1 B;  2HPU A;  4GKJ F;  5AE1 A;  2KT3 A;  3NEK A;  5K20 B;  2KJV A;  4FZV A;  4CTA A;  4DPU A;  5GAE U;  1TL3 A;  2VKZ G;  4K4Y A;  3BH7 B;  3OXL A;  1NB7 A;  4NML A;  3I9Z A;  1S4E A;  2MTL A;  4GRS A;  3CC2 S;  1XEZ A;  3OL9 A;  1XER A;  3AD8 C;  4F0K A;  2Q1L A;  2HQD A;  1IXK A;  3KNA A;  4DR7 F;  2CJ9 A;  3M9O B;  3CJ4 A;  3N5F A;  3K5M A;  1TKT A;  4GC6 A;  5KFY A;  4NLV A;  1UFW A;  1UET A;  2GO9 A;  2QN6 B;  4JV5 J;  4EEY A;  2ZBR A;  1UEK A;  2QG9 B;  3T9N A;  2N4C A;  3H5S A;  4ECS A;  2CDQ A;  3BGU A;  4FS2 A;  1MG7 A;  4RWX A;  3M9N B;  4WK1 A;  3KUH A;  1FJG J;  3PW0 A;  4AL7 A;  2E5L F;  2XYH B;  2VON A;  2M0G B;  4LSL B;  3TUP A;  4X64 J;  2VG6 A;  4KH0 B;  2CG4 A;  1N4L A;  4YB1 P;  1NJW A;  3U1M A;  1CC7 A;  1S1U B;  1YRT A;  4PZV A;  2YKO A;  2LA4 A;  2MLX A;  3DFE A;  2AMC B;  2A10 A;  2GZO A;  5GVQ A;  4UF4 A;  1RAE B;  2HLT A;  2F63 A;  5DLF A;  4HDG A;  3NAI A;  1B0V A;  4FPR A;  4PG4 A;  5L1I A;  3M2U A;  3R7B B;  4DEZ A;  3P4U B;  1WTB A;  1QVF R;  2D74 B;  1RU1 A;  1BUX A;  2J7U A;  3OUY B;  2J8S A;  1AYE A;  1ZM9 A;  2DBB A;  2DHS A;  5HJY A;  1VBK A;  1UZH A;  3QAU A;  2LMI A;  4K59 A;  2MYF A;  3O2I A;  1NK4 A;  2BX6 A;  3H90 A;  1Y9O A;  1MSW D;  2VA2 A;  4M5D B;  1R31 A;  2GJF A;  4B08 A;  4Q0B A;  1SL0 A;  4ED1 A;  2BRL A;  3FCH A;  2G0I A;  2FHJ A;  2KHD A;  1RCX B;  4OZ1 A;  2WOM B;  2VOO A;  2NLW A;  2JC0 A;  5J2Q A;  3KKF A;  2AF6 A;  4YFU A;  1RK8 A;  2E1A A;  3SV4 A;  1SQE A;  4K50 A;  2QGF B;  6AT1 B;  4OYI A;  3OBI A;  2XG8 A;  1V3Z A;  3PRD A;  1S6P B;  2RRN A;  3O44 A;  3DI6 B;  3T9Z A;  1TUV A;  4DQQ A;  4NA1 A;  4ES3 A;  4LRF A;  1YJR A;  2XHC A;  5CYJ A;  1VQP S;  2HHP A;  5C25 A;  4QCL A;  1SJ4 P;  1TK5 A;  1OPZ A;  5A8K B;  4TLR A;  2BOA A;  2J5A A;  5GAD U;  3FQL A;  4C0H A;  1QM9 A;  2Y1I A;  3BYP A;  1CJU B;  3MMC B;  4M5L A;  4FF4 A;  1LW2 B;  5KFO A;  4LF5 F;  3RJM B;  4ZPA A;  3QYY A;  1XMQ J;  1H6K X;  5HVH A;  2V8P A;  2GHP A;  3FSI A;  1H74 A;  1RAC B;  5CYM A;  4CWB A;  4ENO A;  4QPT A;  1Y3J A;  2AIR B;  4JV5 F;  1O0P A;  4WCE Q;  3MM8 B;  1NPK A;  4MIW A;  1AFI A;  3HUL A;  1WHY A;  2C22 A;  1N0V C;  3ULH A;  4PQU A;  2J6T A;  3R5J B;  3VAM A;  1PIE A;  2DR8 A;  3P96 A;  2MZJ A;  4N7T A;  1IBK J;  3CE8 A;  3EDR B;  4W4M A;  2MKC A;  2EK6 A;  2RKI A;  4WFX A;  2NSB A;  1NKE A;  1F2H A;  1RWP B;  1UZD A;  1DY3 A;  2U1A A;  3RB3 A;  1S0M A;  4FNI A;  2E5J A;  1JKH A;  3Q83 A;  1LWE B;  4EU0 A;  4LBH A;  1HNX F;  3GJQ B;  4LSN B;  4F2R A;  4H54 A;  3HHL C;  4Y2I A;  3MXH P;  3GCW P;  4J9P A;  2O01 C;  3GG1 A;  2BOP A;  2Z2L A;  3AAW B;  1QTM A;  3G6X A;  1N5Y B;  5HQ8 A;  5D3G B;  3I0R B;  2FYX A;  3CD5 A;  2ZOM A;  4WFB Q;  3DGP A;  2JDJ A;  5JXS A;  5EDW A;  3G82 B;  5KFP A;  4DV7 J;  3R8Y A;  2RIL A;  2YNI A;  1U2F A;  2F7V A;  2LEB A;  5KFL A;  3PW4 A;  3PHT A;  3KK3 A;  1WD6 A;  1E6V B;  4LUB A;  3DM2 B;  4FYX B;  2FZK B;  3RB6 A;  2W24 A;  1B4S A;  3EGN A;  2B4P A;  3IGN A;  3A12 A;  1WOP A;  3VHQ A;  2C2O B;  1P8G A;  2MKY A;  3MM6 A;  5HP1 A;  2HBR B;  2KT2 A;  2BAN B;  3BO4 A;  2VZ9 A;  3U27 A;  1N32 F;  2DGS A;  3MMA A;  1SJ3 P;  5D78 A;  3B82 A;  2HMI B;  3TNV A;  3FJ2 A;  3JTO A;  1FKA F;  2GMJ A;  3TVZ A;  3VR1 A;  1S1T A;  1U49 A;  1B3T A;  4M5N A;  1M1G A;  3RGI A;  1PJ5 A;  4ZCM A;  2JVO A;  4OX7 A;  4C8O A;  1XN9 A;  1XMQ F;  3QLH B;  1FEE A;  3W64 A;  4OHY A;  2XBP A;  3GCX P;  3J7A N;  1JNZ B;  1HQE A;  2GX8 A;  3VV2 B;  1JLQ A;  3FGV A;  2B51 A;  2R3V A;  2AV5 A;  4LF9 J;  4JI1 J;  2D3O R;  5FDL B;  1H0H B;  2I9S A;  1RZM A;  1IBL J;  2HWI A;  2UVU A;  1TV6 B;  2AJF E;  3DYA B;  1VQK S;  1VC5 A;  1IBK F;  4OIX A;  3D66 A;  3KJV B;  2MQL A;  5JJB A;  2I8E A;  4MKY A;  3L9Z A;  4MK8 A;  5C42 B;  3W3S A;  3W2V A;  2MXY A;  3TYT A;  4ED6 A;  1FRK A;  1CSJ A;  4PR6 A;  2UXB F;  4QU7 A;  1UFL A;  4EZ9 A;  2YWG A;  2B7B B;  1TL7 A;  4U8V A;  5L1L A;  3I87 A;  3D6T B;  1YBT A;  2Y9H A;  3MM9 B;  3B78 A;  3I56 S;  2Z2Z A;  2RAQ A;  5HMX A;  4KTQ A;  3RYL A;  5MAO A;  1S6O A;  4M8L A;  1RT6 B;  3I55 S;  1RQ0 A;  3IG1 A;  3HHD A;  2ZH4 A;  4LF4 J;  4HEA 9;  4URQ U;  4EFA C;  5DM7 Q;  1OSD A;  3LAL A;  3FEX B;  1K0V A;  1X7V A;  4B9N A;  2IJN A;  1FVQ A;  2W1B A;  1WKL A;  2MLY A;  3MR7 A;  2CQ4 A;  3IGV A;  4B3R J;  4DR4 J;  3LA0 A;  4ZIW A;  1DLO A;  3W2W A;  3HVA A;  2IAJ A;  4OHV A;  3HHL B;  2HNZ B;  2HBQ B;  1HW8 A;  2XYP B;  2AZ1 A;  4ALZ A;  4DCO B;  4YOE A;  4K0K J;  4NLU A;  1UWB B;  3NNH A;  1SKW A;  1HR0 J;  3M4X A;  4CI0 B;  2EI5 A;  4IH7 A;  3OD2 A;  5F8I A;  1UVN A;  1NO8 A;  4PWD B;  4KHR A;  3QRP A;  2K7K A;  1E6Y B;  2GV1 A;  5DO2 A;  2IBK A;  4CT8 A;  2VHG A;  1JXL A;  3PR4 A;  1CUL A;  2ZWO A;  1PJ7 A;  2MZR A;  3TR5 A;  3MMB A;  2XYG B;  4CO0 A;  1Y10 A;  2QMW A;  1Q8B A;  2IPO B;  4CLF A;  2UV8 A;  5KFX A;  1AZS A;  1W7W A;  1I1G A;  3CCV S;  4NLY A;  2MGZ B;  1VQS A;  2WVD A;  2G4B A;  3L4B C;  1CLF A;  3IS9 A;  3CDU A;  5ADZ A;  3GE9 A;  2V4R A;  4FXW A;  3M8P B;  2Q3P A;  3OTD A;  3BSO A;  5ITH A;  2JVR A;  4FVC A;  2HFV A;  5I3U B;  2IDL A;  3BM7 A;  4ZVH A;  1RTH A;  4O23 A;  4KPY A;  3R2C J;  4ID8 A;  2GVD B;  4NI2 B;  2YWK A;  3JAM Y;  4B3M J;  1MRO B;  4R5P A;  3UVJ B;  3VAI A;  2V8H A;  3IAS 9;  1J5E F;  4PQA A;  3JSM B;  1CQM A;  3K17 A;  3AA8 A;  3IP0 A;  4FKY A;  4RW9 B;  3DXS X;  1S99 A;  4NLD A;  3CW2 C;  1JJC B;  4L74 A;  3G71 S;  1U45 A;  1OY8 A;  1U7L A;  3GPA A;  3BB5 A;  3VGU A;  2XMA A;  2VL1 A;  1HHQ A;  1C4A A;  3PFO A;  1FX4 A;  1M5H A;  5E3P A;  2O1P A;  3UD3 P;  3PRV A;  4P52 A;  1IQT A;  2HS0 A;  1OO0 B;  2MZT A;  3NXZ A;  4XDC A;  1SQF A;  2V2Q A;  4LRC A;  2CPE A; 
#chains in the Genus database with same CATH homology
 2NXJ A;  3EGV A;  3CJR A;  3CJQ A;  3CJT A;  1UFK A;  1SQG A;  2NXN A;  3CJS A;  2B9E A;  2ZBQ A;  2ZBP A;  2YXL A;  2NXE A;  2ZBR A;  2NXC A;  1SQF A;  3AJD A;  3A4T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...