1EAYC

Chey-binding (p2) domain of chea in complex with chey from escherichia coli
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
67
structure length
67
Chain Sequence
PRRIILSRLKAGEVDLLEEELGHLTTLTDVVKGADSLSAILPGDIAEDDITAVLCFVIEADQITFET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CHEY
publication title Two binding modes reveal flexibility in kinase/response regulator interactions in the bacterial chemotaxis pathway.
pubmed doi rcsb
molecule tags Signal transduction complex
total genus 15
structure length 67
sequence length 67
chains with identical sequence D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 1998-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09078 CheY-binding CheY binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits CheY-binding domain of CheA 1eayC00
1FFGB 1FWPA 1FFWB 1FFSB 1EAYC 1A0OB 2LP4A
chains in the Genus database with same CATH superfamily
3ZNUA 4OZ0A 3PJWA 1X5OA 2Z2ZA 2BW7A 2BABA 4HLBA 2UVWA 2W7AA 1D9DA 2H51B 2JHEA 3BPSP 4MKVA 2PE8A 2VOOA 4F0MA 1MU2A 3CDBA 4NI2B 4JI8F 1RACB 3A3NB 2HQIA 3QWUA 1RABB 2FVCA 4AT1B 2QL7B 1X4GA 2ZVIA 2OLWA 1VRUB 1I51B 3DLEB 1IM6A 1NDKA 2DXEA 4ZLJA 5B0FA 2OTLS 3H2UB 4WFXA 2N3OA 3MEDA 4J9OA 2R4FA 1FE0A 4XO0A 2WRMA 2XSJB 2YWGA 4C8YA 4N47A 1F5CA 2YBVA 2UUAF 1DBDA 2NUHA 2KG1A 1P27B 2VG5A 4B3TJ 3S1TA 3NGTA 1W2BR 4JI4J 2BJ9A 4DEZA 3D0GE 2ROPA 3C14B 3NGRA 4EUVA 1IBCB 1GT8A 4R25A 2J6SA 3KHLA 1KWMA 2HIQA 3CJ0A 1S1XB 3CCLS 2GMHA 2RH3A 2ZH4A 2HKEA 4QIVA 1X5SA 4J9RA 1UFKA 1M5SA 2FB0A 5K20B 2M5YA 3Q89A 3CJRA 5U47A 2YWFA 2ZC3A 4EBDA 1WDDA 2JEGA 2VPZB 1NUEA 1V9OA 2HYIB 4K4WA 2VFVA 4IKAA 1FDAA 4LUBA 2OPQA 2MZRA 2NQPA 3ENQA 3VAIA 4WFBQ 3D7SB 5GADI 3TJ8A 4ERDA 1HNWF 1XERA 2BE2A 3MWBA 1N8RT 4FXVA 3BSOA 3EGNA 2ZH2A 2AT1B 3PHEA 3THTA 5F3ZA 3HD1A 1Q8KA 1Q82T 4C8OA 2RMLA 3O8WA 3LO3A 3FCVA 2RHSB 4E2FB 1IKYB 4DQQA 3DLBA 1EP4A 2B5JA 3CTRA 3DRXA 2FC8A 2HWIA 4X4OA 3K2YA 2DXDA 1LXJA 4LFCJ 2OSQA 2H5EA 3CIMA 3HHLC 1XNRF 2P9EA 4YHHJ 3H40A 3RGIA 5LMNJ 2GC8A 2LQJA 4LREA 3M2RB 4A8XA 2GQQA 2M70A 3CDWA 3J81j 5J2MA 3MF5A 4NXNF 3TJAA 5HBMA 2LQ8A 2D9OA 3QO9A 3GV8B 3KTQA 4QIEA 3EGWB 3DGPA 2FJEB 5IT9U 3IMQJ 1VC5A 4USKA 2ZBCA 4HT5A 1HNIB 1IR2A 1M5VC 3BQ1A 4Q8EA 1PYTA 1Z2ZA 4DJBA 2OKQA 4PXDA 4NYOA 4OX9F 1FDBA 4F26A 1R0AA 3KDNA 4V19X 4P2FA 4L76A 4Y2CA 3QT7A 3CMAS 3OTBA 3R5GA 2CQGA 4TN2A 2FY8A 3M8QB 1T95A 4DQPA 5DJBA 4OHVA 3C15B 1YGYA 4URGA 4L3KA 5L46A 3IM8A 4RLEA 1YBAA 4HHUA 2Z0GA 2WZ1A 3CDAA 3Q23A 4MTPA 2YWHA 1ZS6A 2ASJA 2VOPA 3HHLA 4B3MF 5D0RA 2MY7A 3W9HA 1RT1A 1GEHA 2DNGA 5T41A 2R7XA 4A8FA 4ZVPB 2Y1IA 1LXNA 3A8KA 3BM7A 3ZZRA 2G2ZA 1VQKS 1N6QA 2DISA 4O3OA 1G1XA 3JYTB 1JJ4A 1M1HA 4CRJA 5ETNA 2AKWB 2LFVA 5KG1A 3SCJE 2JOQA 4LSZB 4MH8A 3M2VA 4ED7A 1FI4A 2NUUG 2CQBA 2OEJA 1U25A 3DYAB 2R7UA 5F41A 1U8WA 4NA2A 4UT4A 3PRVA 1RAHB 2M2BA 3ILJA 2QLXA 4ILRA 2XGPA 3ZXWA 3R5AA 2PMHA 4ZVEA 4TLRA 1MN9A 1DQAA 2GAHC 1HWLA 1SQGA 3HHNB 3HJFA 4PXCA 4RBVA 5F3TA 2P5VA 3AQOA 3MOZA 4M5MA 1MWYA 1T9WA 1Q4RA 1BQNB 1RT6A 3FMBA 4LFAF 3QRQA 1JIHA 2HG4A 5F8NA 4TLQA 3CJSA 5LT5A 2FVRA 2BX6A 4CNZA 1TL3A 4W92B 3PCOB 3B78A 3M30A 4DBQA 1X4DA 5I3PA 1CJVA 3HF5A 4L73A 4OI3A 4OX7A 1SL1A 1FJGJ 3NKYA 5J2NB 2CPZA 3KNGA 3I0SB 4ITSA 4KE5A 4HHHA 2VFTA 2F4FA 2FIUA 4IG0A 1FFGB 4R5PA 2L08A 4J9UE 3OR1B 2QC3A 5J1PA 4ECZA 1JLFA 4NZ7A 3RBDA 3VWSA 1DZ5A 4ZHRA 1SQFA 4DI6A 4ZVTB 2AV5A 2GHPA 1RTDB 3WIUA 4JI8J 2H9ZA 2WB4A 2H5IB 3AFGA 1BUXA 2OD6A 2B51A 1OMSA 1WDTA 3MFIA 3DRPA 1I6JA 1GMWD 4TY9A 1SV5A 4B3OB 3GYGA 2AD9A 5GAHI 3H7HB 3GR0A 3SQGA 2DITA 2K06A 2AJ0A 3KOAA 4LF7J 1OS5A 3DLKB 5E41A 3CDEA 1NK6A 2JRSA 2OPRA 3HSZA 1HMVA 1RU2A 3NCPA 3GFHA 5KFNA 3DI6B 1VJQA 3VVTA 2F1FA 2I5JB 1JLCA 1CQNA 2OEMA 3D9BA 1JLBA 2B3TB 3LP2B 3J80U 3K8VA 5IV3A 4RW4B 2CG4A 5JXSA 2GO9A 2YX4A 3US5A 1S9EA 2E9RX 1NCLA 1ZZFA 4USJC 5F8GA 1RYSA 3ILIA 2B9WA 1TKXB 3TAMB 3M32B 1W7WA 2CYYA 3LAKA 4WXOA 2K7KA 1TUGB 2YKOA 3V4IA 3CNQP 4NMLA 3BS9A 1TV6B 3TYTA 1F0XA 1CQMA 4TU7A 4DMZA 4CLPA 1BD6A 1T8EA 3GONA 2IDLA 3U7JA 2CVEA 3RB6A 4JV0A 4F4WA 1UA1A 2RF2B 2Z2LA 2ROGA 2CPFA 3SEOA 3IWXA 4YDXA 2K3KA 1FEHA 3DRSA 2PGCA 3KHGA 2YQ3A 1Y3JA 1PAUB 1VR6A 4RWXA 4PG6A 3NBPB 1HNWJ 3VVUA 1N4LA 3TNVA 3TW0A 4CLLA 2GVDA 2HAFA 2XMUA 4TQSA 1HQUA 2GVZB 1QAJA 4X62F 1NJZA 1BXNA 2VASA 3ZO7A 3NNAA 2HS0A 1GX5A 1JJHA 3CE8A 1AUDA 3FSYA 5DS7A 4EBEA 2RDJA 3SFGA 2ZWPA 3W8GA 4H4MA 1LKZA 4LR9A 5LSOA 1S1WA 2AF6A 4DX8H 4YB1P 1U49A 4TYBA 2HEKA 5C25A 3GR1A 3HSJA 1UJ6A 1TKDA 2P8IA 5KG4A 4P7VA 4J9KA 1QAYA 1TTHB 1Q8BA 4ECTA 4WCEQ 2XY7A 1KQKA 5LSLA 2QEXS 3F73A 5D4NA 2VHGA 4NLXA 4N8OA 3EUNA 3IM9A 3MD3A 4ZJOA 4KGMA 4JV1A 2KRBA 2K8GA 2UXCF 4DV0F 3ILLA 2UUTA 4N8NA 2D3O1 2V2VA 4PWDB 2ZZNA 5B0BA 2MZTA 2X3DA 3K5PA 4USWA 4AFFA 4IFYA 1FVQA 4OX9J 3ZTOA 3KK2B 5LJ5Y 1AA1B 2IHR1 2R7SA 4HVZA 1S79A 3TRGA 2HW3A 3HCXA 3ONQA 4FNHA 1HBMB 2QRRA 3MUVP 2MKKA 1B7FA 4Y0FA 3VV2B 2Z8QA 4HDHA 1K44A 4KHMA 2ALYB 2CJBA 1QAXA 1TL7A 3FBFA 1HQEA 2Q6BA 2KFNA 1H2UX 4CO1A 3AD9C 1K1SA 3QYYA 2FQQB 4NLYA 3UD4P 2MHNA 1FRXA 2F9DA 5H9EJ 5E3PA 4IQXA 1MLAA 3IP0A 1T05A 2BANA 4O0IA 2AX0A 5F8JA 2ZJRQ 3DOMA 1YSJA 4WP9A 2EK1A 1YTYA 1FKPA 4ZPWR 3UD3P 4IUFA 4ZMMA 2NXJA 4M5NA 1WF0A 1N5YA 4TNOA 1F3VA 3PG9A 2DNRA 2HZAA 2OHDA 1BGXT 3OTEA 2HK3A 1F9HA 3D28A 5DQIA 2W2PP 4I2QB 2WBRA 2R8GA 1VMBA 2HPUA 4M8LA 3R9LA 2HNDA 2V5HG 4NZ6A 3KG0A 1Q0NA 5L1JA 3SSQA 3OTCA 3I5AA 3W2WB 1GAOA 4KH0B 4ECXA 1OJ4A 2L41A 4LFAJ 2XG8A 2VZ9A 1U0SA 3MM5A 4HACB 3FGVA 2CPHA 4UF4A 1U0HB 1S6PB 3P8BB 3CO9A 1RWPB 3RB3A 2J0WA 5KG3A 1TL5A 1X60A 1J5EF 4B9TA 4DV2J 5C42B 2M7SA 2ZNZA 4CWBA 1YRUA 4ED5A 1JXEA 3BSCA 2C2ZB 1FESA 3OXGA 4NXMF 5KT4A 1JNZB 1WC5A 1CS4A 2YKMB 3BDEA 3D1QA 4ID5B 3GSDA 4Q2MA 2R8KA 2MZ1A 1CC7A 3N79A 2KZZA 2QA4S 2M4MA 2C2RA 2RS8A 2GQCA 3DFEA 3JTOA 2L9WA 3WHIA 3UNYA 2UUBF 3LWMA 4PUOB 1KNZA 4G3IA 2KM8C 1T3NA 1HHTP 4C7QA 1Q1KA 2MLYA 4MYUA 2LDYA 4PQAA 3PYFA 1I94J 1NM2A 3CJKA 4DSKA 4LVNP 2W9AA 2DNMA 2XNQA 1RLCL 2COLA 4BWJA 1RKJA 1PBAA 4DR5F 1VGYA 3IRXA 4DX6A 4OZ3A 2QYGA 5F8HA 1FHTA 1RAFB 1REGX 3FKBA 5IM0B 2RRAA 4AL6A 3VTIA 3HHDA 3J7YU 3DKDA 3RUBL 2DBBA 3KG4A 3D6TB 5DLFA 1LWFB 3GP9A 1YG0A 2KL8A 1IUJA 4L75A 3THPA 3FBCA 4NLTA 2HGNA 3ENWA 3T5JA 2VG7A 4LF4F 1GNKA 4DV3F 4DV4J 1JJ2R 1ZTWA 2W2MP 3GJSB 1Q7YT 1UVLA 1FX4A 2HBRB 4YP3A 3FCHA 2D3ZA 5B09A 3F0NA 1C1BA 2R3VA 2VG6B 1OQ3A 2N4DA 5I3UB 4FDFA 3M7VA 1KONA 3PDNA 1RT2A 4HI1A 2FHKA 4FPIA 1J5OA 3AXMA 2KTQA 3VHQA 1N34F 3L3CA 3G6VA 2GQ2A 3D6HB 2B7CB 1C0UB 4C8NA 3K58A 3D4JA 1QD1A 4RL1A 4HL9A 2MKJA 2NCKL 4WF9Q 1Y4ZB 2R7QA 5CQGA 1U4BA 1M5OC 2YWWA 2QTWA 3W2VA 2ZOFA 4ZVUB 2ZDPA 5IT4A 4DR4F 3DC2A 1HNZF 2AEJA 2D69A 2HZCA 3OUYA 2GGPA 3OSNA 3V6DB 3DXBA 2G0JA 3K7RA 2DXFA 2DR5A 5KFSA 1H2TZ 2F65A 4RW7A 4PG4A 4FP9A 2N3LA 3QGHA 4M5DA 2NZCA 3JSMA 2AZ3A 1VHFA 5LMUF 3OVSA 3UNGC 1UJ5A 5AXKA 4OYIA 1VRTA 3H5XA 1ZAWA 4OX8A 1ZPVA 2EFQA 4ZP6A 1HNXF 2AGOA 2ZE2B 3OTDA 2KT5A 2ZBQA 5DRKA 4CO2A 3PTWA 5HQMA 2HFSA 1IVZA 1BQMA 3D2WA 5DLGA 2CQDA 4OHXA 1YITS 2CPXA 3OL8A 5JUMA 3OL9A 3TA2A 1H6KX 3DCAA 2E5LJ 3V4MA 1DQ8A 2HHWA 3RAQA 3ZNJ1 2BXJA 3VZHA 5E2QA 1VBYA 2AYEA 2J5AA 4O44B 3KFWX 1NSPA 1KFDA 2HQCA 4KBIA 1ZM4A 4X4RA 3KHHA 5AE2A 3TWZA 4CDIA 4QR0A 2E7VA 4LF6J 3MPVA 3FDSA 3FNNA 1MNEA 3IAM9 1WHWA 3MMAA 2C42A 4JOUA 1Q8LA 3MPDA 4LR8A 5KFVA 4DPWA 4X66F 4WWSA 5KFXA 2GCFA 2G9OA 4FXWA 4UQGA 3LAMA 2GO8A 2GS8A 3VALA 3MD1A 1S57A 4LQ3A 1KOHA 2JLGA 3D6FB 4ICLB 1RT7A 1XMOJ 2R8IA 3EXCX 4RU9A 3WC2A 4EFAC 2HHQA 4JBCA 5A6WA 2AX1A 3RZAA 4A8YA 3PX0A 3H2LA 3GB0A 1M5PC 3DRRB 1NK8A 3GTYX 4ZCKA 2DGWA 2YTCA 2ADCA 1NMEB 5F0UA 5GVQA 1IKXB 4H54A 3VGSA 1T03B 5CZXA 1WF2A 2OTJS 2AZ1A 2C2NA 2MPUA 4X4NA 3AA9A 4ER8A 3BR9A 3W7BA 1HD1A 1N5TA 5BJRA 4H4OA 4E8UA 3QBCA 4RPFA 2D9PA 2XSFA 4GO5X 2V4JA 4ZLLA 3IS9A 1NJXA 4XDCA 4J7CA 2XCAA 1UVKA 1PCAA 5AJ3J 2EEYA 1FRIA 4KPYA 3KMQA 3IXQA 4CTAB 2EVZA 3TX8A 4Q2LA 1TVRB 3NS5A 4NXMJ 2KXHA 4PR6A 2V4QA 2W4PA 1UZDA 1EQ0A 2P6TA 4JV5F 4EO8A 3CCSS 5CYQA 1CJKA 2UUBJ 1S1UA 3V6JA 2VJUA 1T3OA 4PXBA 3CCUS 3MM9B 3Q8YA 1IR0A 2AP6A 5GMEA 5IXUA 3OL7A 3R3TA 1HFEL 4K4YA 2DIUA 4GVBA 1VQPS 2ZOGA 2YNHB 4DR5J 1I5OB 2IC3B 2L9DA 3HHLD 2XULA 3D5MA 4K0KF 4C98A 4N77A 5E7OB 3ETOA 4LRFA 5CAAA 3HP6A 1NZ8A 3MR6A 3W5YA 3GYNA 1FRJA 3NGSA 1N52B 2DYAA 3MMCA 4ECQA 2R7VA 3GMGA 3HT3A 1D9FA 3IBWA 5HK4A 4LIRA 5DQGA 2H1YA 5HP1A 4LF4J 4TY8A 3G86A 1CULB 3MM8A 2XB2D 2CNKB 2PN6A 4N5SA 3AOBA 2XS2A 4DPOA 1NEEA 5J1EA 1DTTB 3IAS9 3IRWP 1UP1A 2KYZA 3ULHA 4KGKA 1JLEA 4KO0B 3R6GB 2IY5B 2GIRA 4FS2A 4MIBA 2Y1RI 2RNEA 3ENVA 3RW7A 2XGQA 2M3DA 4OV6A 5H1SV 1N5QA 2FDNA 3LA0A 3M2UB 4F4ZA 3BB5A 5KOWA 5ETMA 3R2DJ 4Y00A 2W1BA 5F8MA 4DF4A 2E29A 4L72B 1RT5B 1TAQA 2FJVA 4NL5A 4PWWA 4QPTA 4YR3A 2ZHOA 4DR4J 1XBWA 3R97A 1RLDA 3KLGB 1FRLA 4TVAB 2YPZA 5D0EA 5MLCV 2V8PA 1VQ6S 2KO1A 4KB7A 2KJWA 1SB6A 1NHKL 3NWRA 4NCGB 3TVKA 4QR1A 1CBKA 1GMUA 1KTQA 3R7BB 1WI6A 1XJWB 4DR2J 4DFKA 4X4PA 2Q3PA 3I5CA 2GV1A 3AD8C 4FS1A 4ZLNA 2DNQA 2PMZD 1IWAA 2JH3A 1P6TA 2HFVA 3Q8PB 4ZN3A 1JB0C 2P6SA 3FBBA 5DZ6A 1XR7A 2HFOA 3BGFA 3Q24A 4F0KA 2G0IA 2GJ2A 3GIIA 4IRCA 1KD1T 4JI1J 2UU9J 2FZKB 3KUEA 2XYPB 4DG1B 2OPSA 3L7PA 3UPFA 5FDLA 1S97A 4F2SA 1NPKA 2RD5C 3IN5A 3EM1A 3MZIA 1WHXA 3QLHA 4OYOA 4O0NA 2RKIA 1FK9B 2LKZA 3N5BA 3SV4A 3HXMA 4CCHA 2OFHX 4WE1B 3MM6B 3CCES 4DDFA 1NAQA 3MAAA 1GH8A 1JWWA 1G7CB 3TZYA 2FJAB 2JLFA 1R8HA 2CQPA 4U8YA 4LF8F 2YX1A 1QE1A 3HVAA 3HVTB 4K7QA 4X66J 5DGBA 2BKOA 5EDWA 2DGTA 3AOAA 3MEEB 2W01A 3HKWA 2NXEA 3MR2A 2JC1A 3S6EA 5JVGQ 5BYRA 3DN9A 1DRZA 2ZD1B 2Z2YB 3ZZTA 4LSNB 2XI2A 4DR3J 1QTNB 4DCOB 1FWKA 3U1NA 2H5JB 2VBZA 2R7RA 2W4CA 3GWCA 4BDPA 4IO9Q 1BWEA 1H74A 4XPEA 3GILA 2ZEJA 2YNGA 1M90T 1VHIA 3QGGA 2C3UA 4J9NA 3Q8QB 3ISND 4IOAQ 3BBBA 1VQ4S 2E1RA 5H9FK 4F4AA 3RRKA 3MHYA 2KVIA 5AXLA 1ZM2A 1VRUA 1C4CA 3R6LB 5D4LA 3DLEA 1WC0A 3PM9A 1HW8A 1C2PA 1YI2S 3D68A 1KVIA 1UMJA 1U1LA 1VQ8S 2RIJA 4DSJA 2HQGA 2A10A 2E9TA 1S77D 4GRSA 2ZZMA 2XSJA 1HNVB 2W8LA 2RJZA 1F2HA 4TQRA 4F4KA 1IR1A 2E5IA 5C7PA 3C14A 2EK6A 3QT6A 3A12A 3W64A 4KY3A 3BO4A 2R8JA 1SVDA 1S1XA 4OYZA 1MMLA 1W26A 5RUBA 5AXMA 1TL1B 3FEYB 5ETLA 1SC1B 2ZZTA 4QYRA 2VONA 2NR0A 3C66A 3Q2TC 3MUMP 3Q22A 3TARA 4F02A 3MCNA 2GW8A 3LPEA 1FNOA 4OI0A 2MZQA 1SI9A 2BV3A 2WONB 1CJUB 3C3LA 5CXTA 4MMOA 3H98A 2JX2A 4DUZF 1U09A 2ZFHA 3FRZA 2DCLA 3EDRB 2BKPA 1PILA 4B9VA 2A6OA 2NS1B 3GSIA 2Q6CA 3FEZA 2C2OB 4RU2A 4UZCA 5KG5A 3PKYA 1SKSA 3HULA 4DWIA 4ILMA 4U96A 1JKHB 5D6GA 3GCXP 2KT3A 3QT8A 2L48A 2ZKTA 2VQFJ 2HNYB 4JI3J 4A8OA 3MURP 4IG3A 4Z37A 2CQ4A 1UFWA 1HKAA 4OHZA 1IKYA 2MQLA 3CCTA 2FD2A 2GX8A 5HJYA 4Z2XA 3E8OA 3W8PA 3ADAC 3THVA 3HSDA 1N32J 3P6YC 5M2UA 2FJBB 4DR7F 5IC4B 3MCOA 5L9NA 3T1AA 2B4VA 2HFNA 2M52A 1TK8A 4N41A 4KGXB 1VQMS 3M2RA 1O51A 2E7XA 4Y2KA 1KRPA 1IQTA 3ZFVA 2DNNA 4JB8B 3PW2A 4WZMA 2W7PA 2V94A 2E44A 1U1PA 2ZJPQ 1HNIA 1X5PA 2LP4A 2HVZA 2AJ2A 4ZVQB 1NSKL 2H4WB 2G1DA 1N36F 2E7WA 2N82B 4WP3A 4KV8A 2B9XA 4ZPTR 4OHYA 3GFXA 3M8QA 1H7WA 2WW4A 4ES1A 1B4SA 3C15A 2XCPA 1IXKA 1QTMA 1EJ7L 3NRBA 1IWGA 3P96A 3PRDA 2UUWA 2XLKA 4BC7A 3E2EA 1Y5LB 4JI0F 4UY85 3UVJB 2AU0A 3CO0P 3O3LA 4MK9A 2DNLA 3JS9A 1M1KT 1WC6A 2IAJA 1FT8A 3PEHA 3UCZP 3JYTA 1RB0A 1NLKL 2XO7A 1F3FA 1B0TA 2P9CA 2XY5A 4PQUB 5GAGU 4J91A 1KQFB 4XAKA 2X1GA 4B3RJ 4LIWA 3R27A 2XYHB 2X3GA 2YWKA 2XYGB 4UOFA 3LP0A 3BSNA 3DYAA 4W98A 1FX2A 2HRYA 2DR8A 3IWNC 2RQ4A 3E3XA 2W2QP 3ZZOA 1VQSA 2ZH9A 3BKFA 4KSEB 1QY7A 2HFUA 2IRXA 4F8RA 4JI5J 1CEZA 4RW6B 4WIIA 3H4BA 4F50A 3OHAA 1BQNA 1EETB 3G82B 4LSLB 2DPJA 3H5YA 3E51A 4AL7A 4JI2F 3SCLE 1XTZA 4KPCA 2AHOB 2ATCB 3PR4A 2WVEA 4DQSA 2R8HA 1MU2B 5K8NA 5J2NA 2PI5A 3M1VB 3I0SA 2UXDJ 4K8RA 3WX4A 3CCZA 1NDCA 4IO1A 3SSRA 1UW4A 1Q7LB 3HMJG 3OR1A 1NK0A 1H72C 3G2XA 3M8SA 4ANEA 3Q8RB 1XR5A 1A0OB 2DR6A 4KR0B 1KFSA 1JQGA 2CJAA 2POKA 4NRUA 1IKWB 1KC8T 4CH0S 1P8GA 5CH7B 1HW9A 4Q43A 3D6MB 1M0SA 4B3OA 1L5UA 4USIA 1WG1A 5ETVA 3RYLA 5C5JA 3BV8A 2F4VJ 1RHJB 1R31A 1V5IB 4K4VA 4J37A 3DI6A 3H4DA 3D0HE 2I5JA 3GE9A 5EWEA 4OZLA 3MCMA 1O5JA 5E33A 1WG5A 1J27A 3LANA 1S9GA 3RAMA 2FLOA 4RW4A 1KLMB 1YRTA 4ZIVA 5LOQA 1RXOB 4DS5A 3KNAA 1G6BA 1H0HB 1TKXA 3TAMA 1HHQA 2CQIA 3M32A 5A2QU 3C16B 2PDAA 4C6AA 3HK2A 4WK1A 4HHJA 6FDRA 1JLQB 1U1NA 1TV6A 5T14A 7FD1A 9RUBA 4A8KA 1IBMF 4C3MA 1KP6A 2MLXA 2RF2A 2MSTA 4ZPVR 2JNJA 1RWWB 1RT4B 1NK4A 4DUZJ 3CGIA 5BXIA 1ZBTA 3GU0A 3IA0A 4EYHB 2EW9A 4NOHA 1NHUA 3JTPA 2Y1LB 3X3UA 3CCRS 1HWUA 1TUVA 4HH0A 4G1IA 3SSSA 1VQYA 4ENOA 1LK7A 3NBPA 3BQ0A 2XMTA 1IM4A 4V1Ak 5B08A 1WOSA 4YB6A 1FKOB 2AJ4A 8ATCB 2HVIA 4O4RA 3LPYA 3G6YA 3CCJS 2LEAA 4TXSA 1LWCB 3JQMA 2GVZA 1NJIT 2HRTA 1CPZA 5DG7A 1XMQF 4WYWA 3RB4A 2OAUA 3EVOA 3BGRB 4KHRA 3QIDA 2NREA 3ETMA 4DL7A 1FRHA 3HLUA 4U6PA 4UQTA 4ZVFA 3LALA 4ZVOB 3QO9B 4NA1A 2CDRB 4I69A 4O3NA 4K50A 2E9ZA 1A6LA 4J9QA 4ZITA 4LT6A 4U7CA 1TUWA 2VB6A 4NLGA 2YNIB 1WKKA 4I68A 4WTOB 3AJ1A 1N33F 3QJPA 2BE7D 3C2PA 2QE5A 6AT1B 3NOGA 4ZVGA 2VA3A 3S8SA 2CNNB 3UE2A 2OSRA 3N5FA 4KGZB 4PWDA 2MLZA 2DY1A 1DY3A 4WFNQ 3KJVB 5KT3A 3VAHA 3KK2A 2ZUGA 5L38A 5CYJA 2A2DA 1HBMA 2CZVC 2O01C 4FNIA 2DHSA 3KYLA 5ETRA 2YKPA 2FLPA 2MZSA 7FDRA 2PT0A 5DM7Q 2KFZA 3BDPA 2X1FA 2B0GA 2JVRA 5KAKA 5HAOA 2PC6A 1FKAF 4ANDA 2HLUA 4OLOA 4DOZA 4C48A 1MMDA 3OSPA 1DHMA 2ZHAA 3UN2A 3M8ZA 4KRWA 4DN9A 3N6NA 2OP5A 3W5XA 4FN5A 2DIVA 2EKYA 3FVYA 2C3OA 4LJMA 3JSBA 4PRFA 2XNRA 3TEGA 3IWLA 4EZ6A 1RE1B 5CABA 3W63A 1K8AT 1Z4UA 4Q45A 5AE3A 4HTJA 1L3UA 3DDNA 1RT3B 2AYGA 4B9UA 1MWQA 4RNMA 1RT6B 5H9FJ 4I2QA 4C8MA 1OY8A 2MB0B 2FGCA 2FUG9 2J9DA 5B0EA 1FRKA 3PW7A 3CULA 1IN0A 1CJVB 2D3UA 2KJVA 1WTFA 1URRA 3OXLA 3WIVA 1VK8A 3JSYA 3W2WA 5KFKA 1AXQA 4MFBB 3DU5A 3FQLA 1SL2A 2RUSA 3MPYA 2DHGA 2XY6A 4M5JA 2PA3A 3LGHA 2A18A 4K4XA 3CMQA 2IVFB 1F1BB 5EX3A 1U0HA 1S6PA 4L6V3 4ES2A 2NYHA 1TR0A 3NAIA 1RA7A 2AWZA 3CD5A 5C42A 1WTBA 2C2EA 1IBLF 3RBEA 4K5SA 3LP1B 3N28A 4WTYA 2XMWA 4LF9J 2BQUA 3MR7A 2W24A 5I3QA 3FUYA 4C11B 2YKMA 1W2IA 2RRBA 1WELA 1JNRB 5A8WB 4ID5A 1V3ZA 1TFWA 1YJTA 2VC0A 4WU3A 3BH6B 1VRQC 4DXLA 2FHJA 1FDNA 1N54B 2R2UA 4EGLA 4PUOA 4OX6A 2G2YA 4X64F 3D54A 2FYXA 4A8MP 3PACA 3CT9A 4FKXA 2YKNB 3QAUA 1H2VZ 1WUUA 3J80Y 3SI8A 3HT0A 2V9WA 2V50A 3GQCA 5J1NA 2BOAA 1N88A 1NU4A 4C0HA 4ZN1A 2KDOA 1UEVA 4JYAF 2JWNA 2E1MC 3UI3A 5ETKA 2QN6B 2D1CA 3CD7A 3CCMS 2LU2A 3UCGA 1NDPA 1S12A 1LWFA 4AXIA 4YMEA 1RKIA 4DZ6A 2KI2A 1BMQB 1RTHB 3LF0A 3L7UA 2WSFC 1D09B 2IVMA 2CA9A 3KXDA 4G6VB 5KT2A 3DOKB 4QW8A 1Y5IB 1RDRA 5IOLA 1DQ9A 3CC2S 1V6HA 2DH9A 2L9NA 3D3BJ 1LOUA 3QFWA 4OYBA 4ECSA 4OI2A 2VG6A 1LQ9A 2ZH1A 1F9EB 4CIOA 5I3UA 5HLFB 3GCWP 2ZC4A 2EC0A 4QPXA 2DKOB 2CADA 4XTTA 4H4MB 2AW0A 1RBAA 2VQEF 2HSEB 3U27A 2RILA 2J6UA 4NMXA 1C0UA 4DPUA 2GIFA 1WC1A 4J5OA 1WEZA 1YK9A 4B08A 3MFHA 2LA4A 4KHPJ 4IRKA 3NG8A 1Q53A 4ZP7A 4AL5A 2QIFA 4IR9A 5FLXU 3M6WA 2VV5A 3V6DA 2KRRA 2PEBA 1T9UA 5IQQA 4A8WA 1CC8A 4LFBF 4OFZA 2V0NA 4ED2A 2FZCB 1BE4A 1YHQS 2IYGA 2HHHJ 1HBUB 3ET6B 1NK7A 3K59A 2RDIA 3B8HA 2DVIA 2XEXA 3DXSX 3VGVA 4DS4A 4TYAA 3BF4A 5HQLA 2HHPA 1X7VA 2OIHA 1XNQF 2ZE2A 2FLNA 2G13A 3IG1B 2JZ5A 2B8QA 2V8DA 2QL9B 4OMFG 2WW8A 1SCJB 3BGUA 3PNIA 3OR2B 2ASYA 3T41A 3ICLA 4RNNA 2BR0A 4WXWA 1VQNS 2DNOA 2V8VA 2DK2A 3WX8A 2E5GA 5GAHU 5CZVA 3VQTA 5K14B 3Q83A 5EGYA 1UKUA 2V68A 4UW2A 4QOTA 4Q44A 3EXYA 4O44A 5DM6Q 5C24B 1U6FA 3OLBA 2HHTA 2D3OR 3SMZA 1NK9A 1ZOTA 2AEMA 2DO4A 2OO4A 2XMAA 4IQMA 1R0BG 4DCPB 3EVMA 2FHOB 3AH6A 3U1MA 3G6XA 3K8WA 2V8GA 1WNEA 4F3MA 1BC6A 1UWBB 3P45B 2IM3A 2U2FA 2DEJA 4LRDA 4ECYA 2RU9A 1NO8A 1ZYQA 2C2DA 4IH7A 4DR6F 1KTVA 4A8QA 1CJTB 1TAUA 4G1PA 1ZAVA 4ICLA 5D15A 1QAIA 4X2BA 2EPIA 2Y9HA 4CH1A 1EZZB 1SBRA 2YQ1A 2E66A 4OJ3A 3RR8A 3QRPA 3VQSA 2Z57B 2X7IA 5CYMB 3DRRA 2XMVA 4U7UD 2A3JA 1XK8A 2FVQA 2V4RA 3QGIA 1AZSB 3KG1A 4XK8C 3UDVA 3P5BP 1IKXA 2DRDA 4N7TA 1UJ4A 1T03A 3H5SA 5JMNA 3TAPA 3K0JA 3M8PB 3CJ3A 3ZZPA 4IH5A 4X65F 3T19A 1AFIA 1KVJA 1EIYB 4LBHA 5EN1A 3NY0A 3U02A 1GX6A 3TANA 3IBCB 1FXDA 5IC6B 2ZWOA 2BRKA 4LRBA 1IBKF 3UR0A 4NLRA 5KT5A 1IKVB 4FBUA 4JI7F 1F9FA 2IM2A 4DUYF 1QDUB 1X4FA 1WG4A 3I9V9 2C2KB 3UDCA 4J9LA 4CTAA 3MI7X 2MQQA 2GAGC 1VBKA 3R5BA 1TVRA 3AB4B 4DR1F 1KEKA 3OLAA 4CM2A 3NS6A 2X1AA 4B9NA 1F60B 3V2UC 2UXBF 3C46A 2CQ1A 2UV8G 3SQOP 2UUCJ 1NH8A 2JEFA 3DM2B 3PYEA 1PKUA 3OXFA 1RHUB 3T3FA 2V2QA 2P2CB 2CQ0A 4FYYB 2ZBRA 3CF5Q 4DU7A 1RJJA 1NJYA 4AQYF 3TAQA 3MM9A 1V5VA 1SKWA 1YJRA 3D67A 3VGUA 3CCWA 3K5MA 4RX6A 3PY8A 2V34A 2ROEA 2W25A 4ECVA 2EFGA 2ZNYA 2BQ3A 3GIRA 2E5JA 3HVRA 2IC3A 3D1OA 3GYXB 3H0PA 1YLXA 1X4AA 4WFZA 3RAXA 1U2CA 4DHVA 2A1BA 2QLFB 2DCUB 2H4YB 5HVGA 3HSGA 4GKKJ 2ACYA 1Q5VA 3ZTSA 1AW0A 4DPTA 2CJ9A 2C28A 3MM7B 4MAKA 4DV1F 3HI9A 3VZIA 2F63A 3CCQS 3DRYA 1XEZA 5IWAF 1VOMA 4F04B 4O23A 1OYDA 5KG2A 1B0VA 2ADBA 4DFJA 1B99A 1R27B 5B0DA 1CULA 1EB0A 1KN6A 1HR0F 2NPFA 2PSZA 4UZBA 4PG8A 1S6UA 2UV8A 3J7ZT 1X0PA 1V3RA 1DTTA 4DV7F 2IM0A 2V2ZA 4KO0A 2O67A 2DHAA 3MTJA 2A0FB 3TVZA 3OFFA 2KHDA 2YWEA 3KUGA 2K3IA 2GGPB 4FF3A 3M2UA 4IH6A 2DO0A 4OZNA 1RQ0A 3UCUP 3GV5B 2ZH8A 4WYLA 2EXUA 4XDDA 3NGDA 3PZPA 1RT5A 1IJEB 4PEOA 4RNFA 2JDJA 5HROB 5KFLA 4NLSA 2B9EA 3QSIA 3KLGA 2VKZG 3MCSA 2NYIA 3TQ1A 4Y6IA 2MKIA 4KT0C 4LRCA 4NCGA 5DDPC 2YNFB 4DFPA 4J9SA 2BEFA 4U7UK 2UUAJ 1NZAA 3OFHA 2B7BB 1NJWA 2GHVC 3SCIE 1HBOB 3BBFA 1R7IA 1YBTA 4OI1A 5DO2A 3H8YA 4QWCA 1T02A 4BS2A 2HBQB 2Q43A 2ZITA 4AXJA 4Y2AA 4N76A 3FC9A 2HHXA 2MKSA 2DGVA 5A8RB 4DG1A 2HNZB 3DMJB 4RZRA 2Y0SD 2WVFA 1GK8A 4I6YA 2NXCA 1R8PA 1SKRA 3B4MA 1OY9A 1Z1ZA 1U47A 4OZ2A 3G9CA 4WE1A 3MM6A 4ZIWA 5LJ3Y 5EUHA 2DGUA 5A8KA 1SIWB 2RRNA 2B9YA 1T9VA 4C8ZA 3OVBA 1R89A 1BY9A 2W9BB 3KK1B 4M63A 4C0OC 4P2MA 3C6TB 3NCQA 2CPJA 4OQJA 4LVOP 4B17A 3HVTA 2I0XA 4ZPCA 1AT1B 2ERRA 2Y8WA 3MEEA 3RU0A 2O66A 1LEOA 1RTIB 2F9JA 4ES3A 2KG0A 1XNRJ 2ZD1A 3PEJA 3PYDA 3AT1B 4LSNA 1IJFB 4F4YA 2WOMB 4F0HA 2IRUA 2BDPA 1FEEA 2BJ3A 1UCNA 3PVXA 3W66A 3A4TA 1U8SA 1VBZA 4ZVHA 2VICA 3LQVA 3OVAA 4NXNJ 4C0BA 2W9CB 2AGPA 3QJJA 2RB7A 1SKUB 2V4JB 4F2RA 1R0CB 3RBXA 4X65J 2I9SA 3L9ZA 4ZA1A 5T7LB 3HPOA 3OQ2A 2CG8A 2Z30B 2QMUB 5F8IA 2CJKA 4DUTA 4NLPA 1O8BA 3VAFA 1RADB 3M8WA 2E1CA 4JI7J 3H5UA 2UZAA 4CYUB 5HANA 1U2FA 4C8KA 3CSKA 2DNZA 5KFDA 2YKAA 1WSRA 3G4SS 2UP1A 3D3CJ 1CJKB 4DR1J 2R7WA 2LQ5A 3FFIB 4ATNA 4B3MJ 1LW0B 3NGKA 3AB2B 1NPPA 2HLTA 1TQLA 3QZ8A 5IZHA 5CA5A 4NLOA 2RDDA 2GZOA 4GVBB 3HFZB 4QYZK 1TL1A 1FJEB 5KFTA 3CCVS 2JLEA 6FD1A 2MYFA 1UVNA 2J0QD 3J7AN 2B4PA 1TKTB 5D0GA 4WU2A 2KYXA 2DNHA 1W25A 2APOA 1S4FA 3O5TB 1RTJB 2WVDA 1HIYA 3IFEA 4KH1B 5KFEA 1YZ6A 4M5LA 3NOCA 1PYOB 1HPZB 1HARA 3JAMU 2BKNA 3EICA 2FVPA 2Y8YA 1HA1A 1X4EA 3IO1A 3KLEB 2KXFA 2QZ8A 2IJRA 3AJDA 4O3RA 5IWAJ 3M9OB 3MAHA 2HNYA 4BHQA 1X4HA 4RJVA 4ZOSA 2EI5A 4YHHF 2XMMA 1Y10A 3H90A 5LMNF 4FYXB 1HR0J 3F44A 2JEIA 3W9IA 4K5RA 5LSRA 3L7OA 5DG8A 4ED0A 2I1RA 4K2JA 1JK9B 2IDEA 4DL2A 1Q5YA 1LWEB 4DV7J 2MY8A 1R6YA 4ELUA 3QQCD 3SIPB 3PV8A 2HVDA 1WACA 3OJSA 1NKBA 4OZ1A 2CIMA 1VBXA 2HVEA 5GMDA 5J2QA 3N01A 1TZ0A 2DH8A 2V67A 5GAEI 4HDGA 4C3KA 3BEGB 1DARA 1T94A 1RHQB 3FZ2A 1K47A 3PXGa 4K4UA 3LH2S 1X9SA 2HMIB 1X5TA 1B70B 4KKOB 2WSCC 2ILZA 3JSRA 1KHWA 1YJ7A 3M05A 4FYWB 1BWVA 1UZHA 3CMES 4TU8A 5A0YB 5KFRA 1U1MA 1S99A 2MSSA 4L74A 4NASA 5HI7A 5ITHA 1M5KC 1N0VC 3H20A 4RUAA 4LQ9A 5FIIA 1JMTA 3T5HA 4ZVSB 5AXNA 1VI7A 4LMZA 3BO2A 4CLZA 4NEYA 1MW7A 3BKUA 2O5DA 1VLOA 3UVJA 5DDOC 1RBLA 3N0VA 4PPDA 3QMQA 3FRYA 2R2SA 3GV7B 2OH2A 5C2GA 4ZPAA 1UAWA 1U48A 3QIPB 4PQUA 1L3SA 2M8DB 1U7LA 5MAOA 1UEUA 3LGNA 3C6UB 2B6AB 2J9EA 1RU1A 3M8RA 5CCMA 1GMVA 2X51A 1UTAA 3TUZC 1ICEB 1YJ9S 3MTKA 4PYDA 1LW2B 1S5ZA 3G6ES 2QT7A 1FJGF 4X62J 2FTRA 2XM3A 5L1KA 4MT1A 4I6WA 4QCLA 2RHQB 2PI4A 1EETA 1SXLA 4X4VA 3G82A 4LSLA 3KMSA 4NWBA 2OMLA 3PIPQ 2YNGB 3PFOA 4NX9A 3T6JA 2KT2A 3M1VA 1HWKA 3M6XA 4HTIA 2XZTB 4TU9A 1RWOB 2HHUA 5CCLA 3GG0A 3EPIA 5KFZA 1PC5A 2D7SA 3AD7C 4AE5A 5ADZA 1T9YA 4M5HA 3POTB 2JSXA 3J7A1 4LF7F 2XBPA 1TU0B 2VBYA 1OO0B 4MKYA 2Y0BB 2UXCJ 4DV0J 1IKWA 4B9LA 4J9MA 3RRHA 1L3KA 5HVHA 3FSXA 3G8SA 2CNOB 4UY8T 1GXLA 2B4OA 2CQ2A 3CDUA 2WCXA 2LXFA 4USVA 5KFHA 3T1YF 3TO8A 2RAQA 2OPPB 1JXVA 1DLOB 1UETA 4F25A 2QJ3A 3TQEA 1TK5A 5DDRC 2LMIA 1EKSA 2NSBA 4X4QA 1WHVA 1K0VA 1KS2A 4QWBA 2CZ4A 1KLMA 2QFIA 2CZ9A 4P74A 1GXUA 3VCDA 2VFUA 2WHOA 1CLFA 5KT6A 2KU7A 3C16A 4IOBA 4Z7YA 2H48B 3IR5B 5E5NA 2HAIA 1JLQA 3BO3A 2L3MA 2OUGA 2Y1JA 4DSEA 2EBEA 4M5GA 5KFFA 5AT1B 4FVCA 2DNKA 3NAHA 1YRXA 1RT4A 1VQLS 4RO0A 3O44A 5IQ6A 3W61A 3R2CJ 4NLQA 1P9QC 1SUQB 1XWLA 4DL5A 2RQKA 1M1GA 4IG3B 3EPGA 1TP7A 2A6MA 1SJ3P 1S1TB 3MEGB 4AYBD 2QL5B 5IV4A 1OIAA 4V19J 4IDKB 3EGVA 1FKOA 3RRGA 2VPYB 2VC1A 3V81B 3TVYA 1ZAXA 3UO0A 1LWCA 4BCAA 2ZKUA 1NBEB 2C3MA 4ZCLA 4ED8A 4OJ1A 3BGRA 4WIQA 3KUHA 2GNKA 3O2IA 2R2TA 3J7Z5 3EZ5A 3V5RA 2YY3A 1J5EJ 4DLGA 1HYSB 5KG0A 2J0XA 1K9MT 1WKLA 1AFJA 3GJTB 2YNIA 3H42A 3GJQB 5D4PA 4LF5F 2PFDA 2LQBA 4P6QA 3NLCA 1JLGA 2ZDOA 2CPEA 1N56A 4KV8B 5JVHQ 3BGOP 2J6TA 1SC3B 2BE9B 5F8LA 2EFPA 3TJ9A 4I7FB 1RZMA 3KJVA 5HATA 4CI0B 1RK8A 1FTCA 2MJNA 3MECB 2BA9A 2X1BA 2MEWA 1YJWS 3SBMA 1OSDA 5E0OA 2AJFE 2WAQD 4K2XA 1C1CB 5J2PB 1U1OA 2IM1A 3PO5A 5BYQA 1S7IA 4PZVA 4HT7A 2MMYA 4QU6A 3I0RB 1Q79A 1SH0A 2IAJB 2Z56B 4KFBB 1FCAA 1F6TA 4PG5A 4DN0A 4NYPA 1PSDA 2EFNA 2QA2A 2VF3A 2ZUAA 1DTQA 1FFSB 3FZBA 4RW9B 1H7XA 3LP0B 3AHPA 3VAJA 3U1LA 5CD4H 4YR0A 3FSIA 3BQ2A 1RHRB 4DV3J 1S76D 1T7PA 2PEHA 4WBFA 2DTJA 1NHVA 4U8VA 2V8HA 3GZ7A 1EKRA 1WSVA 5HVFA 1QM9A 1CSJA 1SH3A 5KFYA 1RT3A 4N56A 3V6KA 4C8LA 1HWJA 4ED1A 2AIRB 1Y3KA 4M95A 3B6BA 3W3SA 5HMYA 1RI7A 5KFGA 1VC6A 3W65A 4WPAA 3IGNA 1N34J 4P2SA 3LWLA 2J7UA 5E3CA 3BYRA 5I42B 4RR5A 4YB7A 1CG2A 4ZCIA 4MFBA 1REVA 1DURA 1H73A 3DHXA 4IRDA 1S0NA 3K5LA 1Q95G 4PXEA 1RWUA 3JB9k 3W5ZA 4DV2F 1E6YB 3DNCA 2HQDA 3FEXB 1YDLA 1HWIA 1HNZJ 4S0MA 3P4UB 3J81U 2RSQA 4UUXA 4OZ5A 3IR7B 4ZJQA 3H25A 4Z7CA 1Q86T 1WI8A 4D3HA 1OY6A 4YN3B 2NXUA 3LUYA 3MPWA 4F3OA 4KC5A 2QSFA 3LP1A 5I4MA 4Y34A 2CPYA 4Y2IA 1S0MA 5LMUJ 4QYZJ 4RW8A 4UOHA 3GIKA 2FHMA 4DV5F 1AUSL 3KJQB 4C11A 3KK3B 3HO1A 5A8WA 4LBPA 1HNXJ 3QGPA 3N9UC 2WVCA 2JFDA 2YH1A 1EHWA 1I94F 1AYEA 5KFUA 1QVFR 1QSSA 1NSQA 1S0VA 1NKCA 3T1YJ 3MMBB 1S9GB 3GG1A 3BYPA 5KG6A 5DDQC 1F5AA 5C2CA 2WVBA 3DLGB 2YKNA 3ISNC 5M2RA 2CXEA 1PG5B 4WKRA 4YOEA 3KLFB 4DL6A 2PFFB 1YZ7A 5LL6d 1VS3A 1XIQA 2WBMA 3JQKA 4USTA 5A2QY 4E98A 1I3OB 1HBNB 5GMKa 4QIFA 1AROP 2DH7A 1WORA 4HYKA 3CC4S 2CVIA 4DV4F 4IFVB 4A47A 2MZJA 4BLGA 2VH7A 4XPCA 4R0EA 3BR8A 2MQOA 4NLVA 3ZTPA 1U02A 2HBYB 3BGLA 1KDNA 1RTHA 3CD0A 4G65A 1VQ5S 4I2PB 1MN7A 3E01A 4JV2A 3DOKA 5D3GB 2G4BA 1MMNA 3KWMA 1S7HA 1TKZB 3SDEB 2BRLA 4DU8A 5ETPA 5HLFA 3CVKA 3MDFA 2WB1D 4PPZA 1TFYA 3R5CA 2AGQA 2YXLA 3FK4A 1D9AA 4O4GB 1B64A 4Q0BB 4I1TA 3A8JA 4NI2A 3IGVA 3RB0A 2R9LA 5K5MA 1FVSA 1FA0A 3A3OB 1U6BA 4P75A 3CW2C 1FD2A 1C0TB 3MUTP 3AA8A 3NEKA 2WK4A 4GC7A 1WF1A 1TMJA 2QLWA 1MSWD 1YWXA 2MGZB 3CJ2A 3S01A 3OPKA 1FNXH 1GTHA 4ILLA 5DG9A 2GMJA 2C22A 3IC1A 5HMZA 1Y5NB 1JLAB 4ZCMA 1HBUA 2C2MB 3ET6A 2VDHA 1YVFA 3X1LB 1Y00A 2LLZA 1FE4A 4LF5J 5E3QA 2KVQE 3H59A 2LXIA 3DOLB 4U67Q 1RBOB 2J7KA 4JV5J 3D1HA 2E5LF 1KQGB 4AD6A 2F8HA 1FF2A 2I6WA 3IG1A 4R0JA 3FBEA 3HFKA 3KLHB 3OR2A 3KKFA 2YKQA 2GHWA 4EWTA 3TZXA 5B0GA 2CFXA 3ITHB 1NB2A 3OV7A 3PR5B 3QWPA 4LF6F 1MROB 2K1RB 5K14A 2MQNA 1S1VB 4OLPA 8AT1B 4K0KJ 2XS5A 5C24A 1G2EA 4BC9A 2KHCA 2YH0A 4KQZA 1Y7PA 4WFYA 1S6QB 4P9SA 3WQPA 1O6XA 1ROFA 2AQ4A 2EG2A 2AMCB 5KFBA 1UW9A 2H3EB 1ZA1B 3I4PA 1S72S 1XMOF 1J2VA 4K4SA 3ISZA 1UWBA 2EFOA 4WZQA 5HQ8A 2GFFA 2DY9A 3PRBA 1RCXB 3W1YC 2BJ1A 2DR9A 5FD1A 1FTRA 1E6VB 4FPRA 1ZTTA 1CJTA 4P52A 1NH7A 4YY3F 5BYSA 3HFVA 1KLNA 1YJNS 5CYMA 2RT3A 3Q86A 4P73A 3UW1A 4MKBA 1AZSA 4URQU 1N5SA 2VD3A 5KG7A 3R5DA 1ZETA 3EZOA 2Q79A 4RKUC 3T5LA 2GJIA 1QLNA 4YB5A 3M8PA 2PA8D 5AJ3F 1MG7A 2BOPA 4OYWA 4QWEA 1UVJA 1S0OA 5IS2A 2DB1A 4W90B 3OT9A 3TR5A 4ETXA 4QZVB 1IKVA 3PW5A 2V63A 2FPHX 2I8EA 4AUKA 4NE9C 3OTOF 1UL3A 4EMDA 3CXCR 2QX0A 4Q7AA 2CPDA 1XC9A 3OL6A 2JC0A 3QSYB 1G4CA 3VAGA 4R8UB 3ZC4A 4DV5J 4M94A 1S59A 1WOOA 3HZGA 4QW9A 4ECWA 1N5VA 5CHCB 5G0RB 4C2MA 2BQRA 3CC7S 3DM2A 2QLBB 2RE1A 3OD2A 1SIZA 1T11A 1WOPA 1RWXB 1JJCB 3LW5C 3H2VE 2VJVA 5HJXA 4G1QB 4QIGA 3MR3A 1TMMA 2HS4A 2XLIA 1KHVA 2DR7A 3I87A 4DLEA 4UUWA 1R8CA 1PJ7A 2GJFA 4D3GA 2XS7A 4GMKA 2YVSA 5IT0A 1U2RA 3VAKA 3MAQA 3R7NB 3D66A 4DSIA 3G8TA 1FXRA 3KLIB 5KFCA 3HZEA 3EZUA 2QG9B 4QR2A 3R1HA 4YQWA 4ZKAA 4QWDA 2BMBA 2G2OA 4OHWA 4X84A 5EWGA 2DRAA 3UFCX 4LF8J 2R42A 3OJUA 3MM7A 4FF2A 1SPBP 4IR1A 2B56A 1BHNA 4W4MA 5L8RC 3QNWB 4F4XA 2R7OA 2DNYA 2V2KA 4QQBA 5EWFA 1UFLA 3HDSA 4JUZA 2VKRA 2B8PA 4KTQA 4YEAA 1Q78A 3CD6S 2JVOA 3NL0A 3MR5A 2ZOMA 4DF8A 5ETTA 3PHTA 1S10A 1VK3A 3K5NA 1RTDA 4HEA9 4OJGA 1R8AA 1RWVB 4KIAA 2E5HA 2LECA 3N6MA 3RG6A 4ECRA 3RJMB 2WSEC 4LRAA 1RAAB 1ZM3A 4DV6F 1KKHA 3MEDB 5FLXY 2CWXA 3M9NB 2JFKA 5HROA 3I5BA 1R3NA 3AAWB 3DLKA 4DR2F 3K17A 2VG5B 3HHKA 3QRRA 3NXZA 3F56A 2HFZA 3KDOA 3KJNB 4DZDA 4K4TA 1T9TA 2YNFA 3ZZUA 4A4JA 3LP2A 2Q1LA 5ETQA 3EWGA 2LDIA 4DX5A 1L3VA 4JI1F 2OD4A 4MIWA 2UU9F 4MJKA 1UVIA 1HBOA 1UVMA 3R8YA 2XZDB 1F5BA 1YJVA 2FZGB 4CZCA 3ZZZA 1RWNB 1HLWA 1SJQA 2HQ3A 5D8HB 4I6AA 2OPQB 4I56A 2ILYA 1D8YA 3MMJA 3UD5A 4NCBA 5A8RA 1DFDA 2HNZA 4MK8A 3DMJA 1HD0A 2BE2B 4DL3A 3PX6A 1UA0A 4NEZA 5A6PA 4PKDB 2QA4G 1RA6A 3V6HA 1VYAA 1NK5A 5KFIA 1VLYA 2H54B 1HI8A 1ACMB 3UN5A 3NWGA 5JJBA 1EP4B 2QO3A 2B5JB 4O3PA 2IPOB 2KFYA 2W9BA 4QU7A 3KK1A 2MXYA 3A3PB 4P71A 3C6TA 3HVWA 4P2XA 2C1EB 4ED4A 3G71S 4DR3F 2ZBIA 1PJ6A 4UOGA 1URNA 4DSLA 2HQFA 1RTIA 5J2MB 2OJ3A 5HBMB 4DR7J 1RCOB 3DGPB 4YY3J 3DLHA 2WOMA 4CO0A 1UPMB 4B3SF 1NSAA 5EHHA 1P1TA 2W9CA 3K57A 2IBOA 5BR8F 1H38A 1R0AB 2FVSA 3W62A 4MK7A 4EI2A 1IQZA 5KFPA 4NPOA 1NRKA 2LEPA 2YPYA 2FC9A 4QJVA 5T7LA 1PIEA 4NCAA 2VBXA 4NZ0A 3T1HF 1N36J 3DGVA 3FCWA 3TZWA 3CWJA 3J7YI 3QFHA 1LNQA 3CJQA 3HHLB 3TUIC 3CPWR 3OFEA 1RT1B 1GXTA 4CYUA 4U95A 3OTOJ 4CLFA 2VL1A 2MDAA 3ZZYA 3ELHA 2CUYA 3VR1A 4WJBA 4PWUA 2EBGA 4K59A 3BREA 1L3TA 1N6QB 3TX0A 1WEXA 3FFIA 3SYZA 1U26A 1LW0A 4BBYA 1T0TV 3GIMA 4UOCA 4OI6A 2H65B 4JI0J 3M2VB 4NLWA 1DJ0A 3I56S 4KAIA 2CJYB 2LEBA 1TKTA 2R7TA 5SUHA 2HIYA 3CIZA 2YX7A 1VQOS 2FJXA 3F41A 1SH2A 1B0PA 4CP5A 2Y3YA 4LR7A 1RTJA 3NGUA 4B02A 4KJIA 1RWMB 3BBCA 4GKJF 1TELA 2VQFF 1HPZA 4JI3F 3B54A 1PYSB 3I4HX 3C19A 1TL3B 2ATLA 3KLEA 3M30B 4FXDA 5CD4A 3ENAA 4O3QA 1FXLA 3OHBA 1U1KA 1R8BA 4LF2A 2AJ1A 1N32F 2Z58B 1WC4A 3MGJA 1PO6A 1XQIA 2HWHA 1B3TA 2XWYA 2MKCA 3A8EA 4IG0B 4R5PB 2DD8S 3BH7B 4HACA 1JLFB 3MEKA 4JI2J 3LTOA 3SCKE 3PW0A 1Q8IA 3P5TL 4ZHRB 1K1QA 2FJWA 2DGXA 4CO3A 5F9NA 3HKZD 3QAEA 5KFWA 2ASLA 3A1YG 3RBZA 4NA3A 5E3AA 4C9DA 1LWEA 1Y9OA 5HL7Q 4DSFA 2F8EX 2VPXB 3DRPB 5L9XA 2CNLB 1SV5B 3AOCA 1WKJA 4DPXA 3AJ2A 3SQGB 1WJ9A 3A13A 3PW4A 4IOCQ 3FJ2A 2OPRB 1RAEB 3P3DA 2HMIA 1HMVB 1FERA 1SJRA 1FNMA 4M5KA 4TKTA 4CLYA 2I2YA 2LXUA 1JLCB 4DV6J 3L4BC 4KKOA 1JLBB 3N4WA 2VDIA 3KJFB 2IA6A 1GFWB 3VGTA 4CT8A 2G1HA 1S9FA 8RUCA 1V3SA 1S9EB 4HKQA 4C97A 4ZPBA 2W2OP 1ZH5A 1R6VA 4IYQA 5A0YA 2HGMA 3V4IB 1C4AA 3S7RA 4MKAA 1ZM9A 4PYAA 5B0AA 3I82A 3GPAA 4MYTA 3QZ7A 4ECUA 5IM0A 2LYVA 4F36A 3PIOQ 4NYZA 1JXLA 2F5GA 4B3RF 3DRSB 4L3NA 1YIJS 3Q8UA 4NLUA 2MJUA 3I9ZA 1IBMJ 3TA1A 3G96A 4USHA 2CJXB 3QIPA 1RHKB 1EX8A 3EDQB 1SQEA 1KR4A 3GJRB 1Q81T 2ZH6A 3TUPA 1SL0A 4DL0C 4CNYA 3EVWA 1OPIA 3C6UA 3Q8SB 5A8KB 2B6AA 2DGQA 2GVDB 3O1LA 5LXYA 1RTZA 4JI5F 1HQUB 1A7GE 4F67A 3M6VA 4GO7X 1VC0A 2N7YA 1UEKA 1RSCA 2RQMA 2ACMA 4ZDNA 3ZZ0A 4CLKA 1S1WB 2DT9A 3JTNA 1LW2A 5C25B 2VODA 4OYAA 3L09A 1XMQJ 3M4XA 3K5OA 2UXDF 2ZHBA 3B82A 1VQ7S 4FZVA 3TZZA 2RVJA 2IIHA 1H98A 3EYZA 1TK0A 1Z2LA 3HJVA 1VIXA 1NDLA 2SXLA 3G8QA 1T9XA 2J7WA 1FJCA 3GLJA 5KOXA 5KFJA 4FBTA 5KT7A 2VA2A 3TP2A 4B3SJ 1B7YB 5F0WA 1RAIB 1N33J 5D78A 2VUGA 1RHMB 3POTA 1X4BA 4IFYB 5BR8J 3I6PA 1SC4B 5HN0A 4EZ9A 2XHWA 3GFYA 4A8SA 2F4VF 1U1QA 1TL7B 1HQEB 3T1HJ 3PX4A 4OL8A 1NXIA 2DGOA 2HZVA 4ZLPA 2OPPA 1DLOA 4WFAQ 3B4DA 4MIAA 2CAJA 4ZVRB 1VDHA 1U45A 1YKWA 2F7VA 1T05B 4K4ZA 2BANB 4P10A 4YUDA 1UPPA 1U1RA 2KZMA 2XO6A 2V9KA 3DOMB 4RUHA 4EEYA 3I31A 4ZP8A 1FKPB 2J9DE 2J9CA 4CLSA 3HX9A 3DU6A 1LFPA 2NZ4A 1N5YB 4ELTA 2P9GA 5F9LA 1FRMA 1D3WA 3IBFB 1S49A 2F40A 2RU3A 4FYDA 4PCQA 2NPIA 1H3DA 2QFJA 4Q5VA 3K89A 5G4DA 1PC4A 1ELOA 1QVGR 2VBWA 3BJYA 2DHXA 5HMXA 2R2RA 2HBZB 1OPZA 2HNDB 2J0SD 4C4WA 4KYZA 3UDLA 4WP8A 5KFAA 5B7WA 4FKYA 1FWLA 4UTGA 4OI4A 3RW6A 2FLLA 3MOJB 2DEIA 3SXLA 4ZS6A 3JAMY 1SUQA 5ETOA 2VFRA 4GKJJ 1OWXA 4OV1A 2UVRA 5D4OA 4EO6A 2DPIA 3NS7B 4ELVA 3EJMA 1U24A 4F7VA 3MM5B 1S1TA 3MEGA 2HHVA 4QIWD 1OYEA 2HS3A 3UR3C 4CT9A 2PMWA 4IDKA 3TA0A 3JXOA 3KHRA 2ABYA 3V81A 2MHEA 3SZ2A 3M6UA 4ZK7M 3NCRA 2IJNA 4J9VA 3JQJA 2LCWA 1QSLA 3AXKA 4HR2A 1X9WA 4FYVB 4I67A 5J2QB 4Y2MA 3T5KA 1CS4B 2IBKA 4Y65A 2JJ4D 2ZM6F 3BKTA 5LM7E 3T6BA 1HYSA 1Y0HA 1IBLJ 3PO4A 4ED6A 3A8IA 2CPIA 1VISA 4YFUA 2VU5A 1SJFA 2WTFA 3CJ5A 4USMA 5L1IA 4Y28C 3TEHB 2PO4A 1RAOA 3RTVA 2EKNA 4CLUA 1G3OA 3P49B 4DX7A 3PKMA 3CJKB 1S4EA 1BLUA 4PABA 3LGMA 4E0DA 1HI0P 4I7FA 4X64J 5FJ4A 3IRXB 4XIUA 1P1LA 2BW2A 4HI2A 1KQSR 4DL4A 3QT5A 4DPYA 3MECA 4BWMA 5K9FA 4B9MA 4OYPA 1C1CA 3BN7A 3EE3A 5J2PA 4OZJA 4X4TA 5B0CA 2QSWA 2YNHA 1WD6A 3I0RA 3W9JA 2EC2A 4JYAJ 1OQ6A 4KFBA 2HK2A 3DDIA 3D0IE 2VG7B 1K73T 1NNDA 3FMWA 5DQHA 1EARA 2KH9A 4M1KA 2G0CA 3M8YA 2BBEA 1FD8A 4ZPDA 2ZH3A 1HL6A 1HHSA 2CQ3A 5L39A 4RW9A 2XHCA 5M2PA 4H4KC 1C1BB 1PBUA 5KFMA 2KM8B 1RT2B 1J5OB 3CJ4A 3N6LA 4ZJLA 2NSCA 4GVLA 5E3RA 3DLJA 4ETZA 4B9SA 9ATCB 1JX4A 2J8AA 2BACA 2I38A 2MTLA 2OGUA 2DJWA 5KFQA 2VIHA 3CB4A 4RBUA 1X8DA 1I1GA 1YBUA 2AJQA 2FJDB 1RAGB 4URSA 1KBRA 3NNCA 2W2NP 2O3DA 3CUNA 1NKEA 3W2VB 1SC6A 3Q0AA 3OUYB 1ZZNA 1GMWA 2F3JA 2VQEJ 3NMRA 2CDQA 5I42A 2ZVSA 4RW7B 2OELA 1TL4A 2CQHA 1VIOA 4M5DB 2CQCA 5THWA 1E6YA 3JSMB 4O3SA 4J90A 1R43A 2YQ0A 2QMWA 2XI3A 4CQ1A 1OSCA 5A76A 4DFMA 1YQHA 5LXRA 4LF9F 4LF1A 2LVWA 4DQIA 2E1AA 4QWAA 2HURA 1YX2A 1VRTB 4CH7A 4JI6F 3WBZA 4H4KA 4LFBJ 3TOQA 1HQ2A 2XQCA 1O0PA 2KXNB 2MKHA 1F2GA 1BQMB 4HH1A 2Q66A 2HGLA 3NMAA 2PD1A 2CKWA 2XTJP 1N48A 2IMOA 4A46A 2XMKA 3KK3A 2JL9A 1LK5A 5GAEU 1XNQJ 1X31C 2VPWB 7AT1B 2O1PA 3PFEA 2M0GB 4PG7A 1D0EA 1LFWA 3MXHP 3I96A 2ZJQQ 4EYIB 4PAAA 2IYIA 1VFJA 3SFUA 2CJQA 1LV5A 3MMBA 2NXNA 1RAJA 4JP8A 1KOOA 3QJLA 2LQ9A 2A2CA 2LU1A 3DLGA 1DAXA 3MPUB 3TUJC 2D74B 1K0TA 2UVUA 3WZ0A 2VFSA 3W60A 2XLJA 3MMAB 1Y11A 2ALZA 3KLFA 4EK2A 1FK9A 5HO4A 4A48A 4WK3A 1WEYA 1MWZA 2V69A 2JEJA 1QJHA 3O6QA 2QV6A 1HBNA 3EX7B 4WKYA 2DGSA 2BJEA 3UDEA 1D8ZA 3FQKA 5L1LA 3NP5A 4IFVA 4ALZA 1ZPWX 1HI1A 4CO4A 1RT7B 3QPIA 5D0HA 2W4DA 2XC9A 5K8PA 3QATA 4I2PA 4USUA 4DR6J 3PJ9A 4RBTA 1ULRA 3BN4A 2XWXA 5D3GA 4ID8A 3HD2A 3BZQA 1TKZA 3SDEA 4I0WA 2IJFA 2KKHA 1XR6A 1FFWB 2BZ2A 5KFOA 1FDDA 4Y3CA 2QA1A 4O4GA 2OMOA 4P7TA 2M9KA 4KHPF 3EMTA 5DGAA 4OIXA 4Q0BA 4H4OB 2QLJB 1SJ1A 2GMLA 2EG1A 2FY1A 3DLLQ 3IS9B 2IA0A 1D1UA 4RNOA 2XMJA 1LWXA 4LBIA 1U6ZA 3G87A 2OFGX 3KLVA 4FF1A 2E1PA 5SZTA 1C0TA 3C8YA 1GTEA 2HHHF 1S6OA 1WWHA 2IRYA 1IBKJ 2Z2MA 3HM9A 2LA6A 1YJUA 2MGZA 2ZM6J 3RR7A 5IT9Y 4B3TF 4DUYJ 3BSAA 2BUNA 4JI4F 1A9NB 4RNHA 1JLGB 1KVKA 1X9MA 3T9ZA 5CYQB 1XN9A 2RQCA 1JLAA 2W7OA 1S1UB 4EU0A 4GC6A 2BJDA 5GAGI 1HNVA 2XZWA 2AYBA 3Q8VA 5AE1A 2UXBJ 4U9RA 3DOLA 2HWTA 1ZA2B 1FJ7A 1NPRA 2MKYA 4DQRA 2AEFA 2HHSA 2MQMA 4YDDB 2N4CA 2K2PA 3GIJA 2UVVA 3KLHA 2BM1A 4AQYJ 4J9PA 2BYCA 2KN4A 5HMWA 5K8OA 3ZTQA 3L95X 3ITHA 1PAEX 2WONA 4OJHA 1CJUA 1MROA 2K1RA 4YR2A 5ETSA 2RUGA 1S1VA 1DTQB 3MMCB 1APSA 2ZBPA 2J76E 3AODA 2V6AA 1FO1A 2DHHA 4C3LA 5HP1B 4TY8B 1VQ9S 3Q2SC 2N7CA 4NLDA 1RWKB 1XMBA 3MM8B 4OYMA 4RUCA 3VAMA 1S6QA 4CM0A 2IMWP 4KGVB 2CRLA 2F8MA 4DV1J 1CVJA 3TI0A 4ED3A 2Z4PA 3CEDA 1JKHA 2FGOA 2QGFB 2NLWA 5J1EB 4LFCF 2M88A 1FWPA 1JLEB 3WC0A 2CWKA 4X4UA 3GFZA 3M9MB 4DCJB 5KTQA 2B4UA 2AYMA 2IVYA 2MQ8A 1GQEA 2PIIA 4ANCA 2HRUA 1PGZA 1E6VA 4X4SA 2QYCA 1VCTA 5GADU 1REVB 2RS2A 4Q8FA 3HHEA 2EFVA 3DHWC 4RUBA 3OW2R 2M8HA 3R1LA 3EGZA 1RP5A 5EX0A 5K8MA 1ITPA 2ZH7A 3LOUA 2OEKA 4OYXA 3WDOA 4CO5A 3ILOA 3ZTRA 3AQPA 2BM0A 1EQMA 3OBIA 3J81Y 3R7SB 2KB2A 4P72A 4RWWA 3NNHA 4RW8B 2OI2A 5D77A 4F3QA 2BJ7A 3UN3A 4JI6J 1RGVA 3UQSA 4ZP9A 2DNPA 1BQXA 3PJXA 1QSYA 1AB8A 2K7JA 4NRTA 2GIQA 5HSPA 1RYRA 2UUCF 1X4CA 1P9YA 1NB7A 3SV3A 3VF0B 2J8SA 1RUSA 1KSPA 1SJ4P 2W8KA 3PYGA 4R8UA 1S48A 2OPSB 2FHJD 2C3PA 1RISA 1WC3A 5FDLB 3BPDA 1X0FA 5G0RA 1Q16B 1PJ5A 4FVMA 3IR6B 3QLHB 2BJ8A 3I55S 2RKIB 3DDKA 3T9NA 4YS2A 2BVZA 4FF4A 2EWHA 2U1AA 4G1QA 5DZ7A 2MQPA 3MAAB 3R5JB 2DRBA 4QBUA 2IFXA 5IFMA 1QUVA 1WHYA 1UWAA 1N0UA 3CJ8A 4GKKF 5DETA 1EAYC 1QE1B 2D41A 3KLIA 2HVHA 4I64A 3AY0A 4CLTA 4EBCA 2B43A 3I32A 1M5HA 2C3YA 2GA7A 3E01B 5H9EK 4I4BA 2ZH5A 2ASDA 4RW6A 3UWTA 3OFGA 1VJWA 4M5IA 1QUPA 4CLWA 3CJTA 2QMXA
chains in the Genus database with same CATH topology
1FFGB 1FWPA 1FFWB 1FFSB 1EAYC 1A0OB 2LP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FFG B;  1FWP A;  1FFW B;  1FFS B;  1EAY C;  1A0O B;  2LP4 A; 
#chains in the Genus database with same CATH topology
 3ZNU A;  4OZ0 A;  3PJW A;  1X5O A;  2Z2Z A;  2BW7 A;  2BAB A;  4HLB A;  2UVW A;  2W7A A;  1D9D A;  2H51 B;  2JHE A;  3BPS P;  4MKV A;  2PE8 A;  2VOO A;  4F0M A;  1MU2 A;  3CDB A;  4NI2 B;  4JI8 F;  1RAC B;  3A3N B;  2HQI A;  3QWU A;  1RAB B;  2FVC A;  4AT1 B;  2QL7 B;  1X4G A;  2ZVI A;  2OLW A;  1VRU B;  1I51 B;  3DLE B;  1IM6 A;  1NDK A;  2DXE A;  4ZLJ A;  5B0F A;  2OTL S;  3H2U B;  4WFX A;  2N3O A;  3MED A;  4J9O A;  2R4F A;  1FE0 A;  4XO0 A;  2WRM A;  2XSJ B;  2YWG A;  4C8Y A;  4N47 A;  1F5C A;  2YBV A;  2UUA F;  1DBD A;  2NUH A;  2KG1 A;  1P27 B;  2VG5 A;  4B3T J;  3S1T A;  3NGT A;  1W2B R;  4JI4 J;  2BJ9 A;  4DEZ A;  3D0G E;  2ROP A;  3C14 B;  3NGR A;  4EUV A;  1IBC B;  1GT8 A;  4R25 A;  2J6S A;  3KHL A;  1KWM A;  2HIQ A;  3CJ0 A;  1S1X B;  3CCL S;  2GMH A;  2RH3 A;  2ZH4 A;  2HKE A;  4QIV A;  1X5S A;  4J9R A;  1UFK A;  1M5S A;  2FB0 A;  5K20 B;  2M5Y A;  3Q89 A;  3CJR A;  5U47 A;  2YWF A;  2ZC3 A;  4EBD A;  1WDD A;  2JEG A;  2VPZ B;  1NUE A;  1V9O A;  2HYI B;  4K4W A;  2VFV A;  4IKA A;  1FDA A;  4LUB A;  2OPQ A;  2MZR A;  2NQP A;  3ENQ A;  3VAI A;  4WFB Q;  3D7S B;  5GAD I;  3TJ8 A;  4ERD A;  1HNW F;  1XER A;  2BE2 A;  3MWB A;  1N8R T;  4FXV A;  3BSO A;  3EGN A;  2ZH2 A;  2AT1 B;  3PHE A;  3THT A;  5F3Z A;  3HD1 A;  1Q8K A;  1Q82 T;  4C8O A;  2RML A;  3O8W A;  3LO3 A;  3FCV A;  2RHS B;  4E2F B;  1IKY B;  4DQQ A;  3DLB A;  1EP4 A;  2B5J A;  3CTR A;  3DRX A;  2FC8 A;  2HWI A;  4X4O A;  3K2Y A;  2DXD A;  1LXJ A;  4LFC J;  2OSQ A;  2H5E A;  3CIM A;  3HHL C;  1XNR F;  2P9E A;  4YHH J;  3H40 A;  3RGI A;  5LMN J;  2GC8 A;  2LQJ A;  4LRE A;  3M2R B;  4A8X A;  2GQQ A;  2M70 A;  3CDW A;  3J81 j;  5J2M A;  3MF5 A;  4NXN F;  3TJA A;  5HBM A;  2LQ8 A;  2D9O A;  3QO9 A;  3GV8 B;  3KTQ A;  4QIE A;  3EGW B;  3DGP A;  2FJE B;  5IT9 U;  3IMQ J;  1VC5 A;  4USK A;  2ZBC A;  4HT5 A;  1HNI B;  1IR2 A;  1M5V C;  3BQ1 A;  4Q8E A;  1PYT A;  1Z2Z A;  4DJB A;  2OKQ A;  4PXD A;  4NYO A;  4OX9 F;  1FDB A;  4F26 A;  1R0A A;  3KDN A;  4V19 X;  4P2F A;  4L76 A;  4Y2C A;  3QT7 A;  3CMA S;  3OTB A;  3R5G A;  2CQG A;  4TN2 A;  2FY8 A;  3M8Q B;  1T95 A;  4DQP A;  5DJB A;  4OHV A;  3C15 B;  1YGY A;  4URG A;  4L3K A;  5L46 A;  3IM8 A;  4RLE A;  1YBA A;  4HHU A;  2Z0G A;  2WZ1 A;  3CDA A;  3Q23 A;  4MTP A;  2YWH A;  1ZS6 A;  2ASJ A;  2VOP A;  3HHL A;  4B3M F;  5D0R A;  2MY7 A;  3W9H A;  1RT1 A;  1GEH A;  2DNG A;  5T41 A;  2R7X A;  4A8F A;  4ZVP B;  2Y1I A;  1LXN A;  3A8K A;  3BM7 A;  3ZZR A;  2G2Z A;  1VQK S;  1N6Q A;  2DIS A;  4O3O A;  1G1X A;  3JYT B;  1JJ4 A;  1M1H A;  4CRJ A;  5ETN A;  2AKW B;  2LFV A;  5KG1 A;  3SCJ E;  2JOQ A;  4LSZ B;  4MH8 A;  3M2V A;  4ED7 A;  1FI4 A;  2NUU G;  2CQB A;  2OEJ A;  1U25 A;  3DYA B;  2R7U A;  5F41 A;  1U8W A;  4NA2 A;  4UT4 A;  3PRV A;  1RAH B;  2M2B A;  3ILJ A;  2QLX A;  4ILR A;  2XGP A;  3ZXW A;  3R5A A;  2PMH A;  4ZVE A;  4TLR A;  1MN9 A;  1DQA A;  2GAH C;  1HWL A;  1SQG A;  3HHN B;  3HJF A;  4PXC A;  4RBV A;  5F3T A;  2P5V A;  3AQO A;  3MOZ A;  4M5M A;  1MWY A;  1T9W A;  1Q4R A;  1BQN B;  1RT6 A;  3FMB A;  4LFA F;  3QRQ A;  1JIH A;  2HG4 A;  5F8N A;  4TLQ A;  3CJS A;  5LT5 A;  2FVR A;  2BX6 A;  4CNZ A;  1TL3 A;  4W92 B;  3PCO B;  3B78 A;  3M30 A;  4DBQ A;  1X4D A;  5I3P A;  1CJV A;  3HF5 A;  4L73 A;  4OI3 A;  4OX7 A;  1SL1 A;  1FJG J;  3NKY A;  5J2N B;  2CPZ A;  3KNG A;  3I0S B;  4ITS A;  4KE5 A;  4HHH A;  2VFT A;  2F4F A;  2FIU A;  4IG0 A;  1FFG B;  4R5P A;  2L08 A;  4J9U E;  3OR1 B;  2QC3 A;  5J1P A;  4ECZ A;  1JLF A;  4NZ7 A;  3RBD A;  3VWS A;  1DZ5 A;  4ZHR A;  1SQF A;  4DI6 A;  4ZVT B;  2AV5 A;  2GHP A;  1RTD B;  3WIU A;  4JI8 J;  2H9Z A;  2WB4 A;  2H5I B;  3AFG A;  1BUX A;  2OD6 A;  2B51 A;  1OMS A;  1WDT A;  3MFI A;  3DRP A;  1I6J A;  1GMW D;  4TY9 A;  1SV5 A;  4B3O B;  3GYG A;  2AD9 A;  5GAH I;  3H7H B;  3GR0 A;  3SQG A;  2DIT A;  2K06 A;  2AJ0 A;  3KOA A;  4LF7 J;  1OS5 A;  3DLK B;  5E41 A;  3CDE A;  1NK6 A;  2JRS A;  2OPR A;  3HSZ A;  1HMV A;  1RU2 A;  3NCP A;  3GFH A;  5KFN A;  3DI6 B;  1VJQ A;  3VVT A;  2F1F A;  2I5J B;  1JLC A;  1CQN A;  2OEM A;  3D9B A;  1JLB A;  2B3T B;  3LP2 B;  3J80 U;  3K8V A;  5IV3 A;  4RW4 B;  2CG4 A;  5JXS A;  2GO9 A;  2YX4 A;  3US5 A;  1S9E A;  2E9R X;  1NCL A;  1ZZF A;  4USJ C;  5F8G A;  1RYS A;  3ILI A;  2B9W A;  1TKX B;  3TAM B;  3M32 B;  1W7W A;  2CYY A;  3LAK A;  4WXO A;  2K7K A;  1TUG B;  2YKO A;  3V4I A;  3CNQ P;  4NML A;  3BS9 A;  1TV6 B;  3TYT A;  1F0X A;  1CQM A;  4TU7 A;  4DMZ A;  4CLP A;  1BD6 A;  1T8E A;  3GON A;  2IDL A;  3U7J A;  2CVE A;  3RB6 A;  4JV0 A;  4F4W A;  1UA1 A;  2RF2 B;  2Z2L A;  2ROG A;  2CPF A;  3SEO A;  3IWX A;  4YDX A;  2K3K A;  1FEH A;  3DRS A;  2PGC A;  3KHG A;  2YQ3 A;  1Y3J A;  1PAU B;  1VR6 A;  4RWX A;  4PG6 A;  3NBP B;  1HNW J;  3VVU A;  1N4L A;  3TNV A;  3TW0 A;  4CLL A;  2GVD A;  2HAF A;  2XMU A;  4TQS A;  1HQU A;  2GVZ B;  1QAJ A;  4X62 F;  1NJZ A;  1BXN A;  2VAS A;  3ZO7 A;  3NNA A;  2HS0 A;  1GX5 A;  1JJH A;  3CE8 A;  1AUD A;  3FSY A;  5DS7 A;  4EBE A;  2RDJ A;  3SFG A;  2ZWP A;  3W8G A;  4H4M A;  1LKZ A;  4LR9 A;  5LSO A;  1S1W A;  2AF6 A;  4DX8 H;  4YB1 P;  1U49 A;  4TYB A;  2HEK A;  5C25 A;  3GR1 A;  3HSJ A;  1UJ6 A;  1TKD A;  2P8I A;  5KG4 A;  4P7V A;  4J9K A;  1QAY A;  1TTH B;  1Q8B A;  4ECT A;  4WCE Q;  2XY7 A;  1KQK A;  5LSL A;  2QEX S;  3F73 A;  5D4N A;  2VHG A;  4NLX A;  4N8O A;  3EUN A;  3IM9 A;  3MD3 A;  4ZJO A;  4KGM A;  4JV1 A;  2KRB A;  2K8G A;  2UXC F;  4DV0 F;  3ILL A;  2UUT A;  4N8N A;  2D3O 1;  2V2V A;  4PWD B;  2ZZN A;  5B0B A;  2MZT A;  2X3D A;  3K5P A;  4USW A;  4AFF A;  4IFY A;  1FVQ A;  4OX9 J;  3ZTO A;  3KK2 B;  5LJ5 Y;  1AA1 B;  2IHR 1;  2R7S A;  4HVZ A;  1S79 A;  3TRG A;  2HW3 A;  3HCX A;  3ONQ A;  4FNH A;  1HBM B;  2QRR A;  3MUV P;  2MKK A;  1B7F A;  4Y0F A;  3VV2 B;  2Z8Q A;  4HDH A;  1K44 A;  4KHM A;  2ALY B;  2CJB A;  1QAX A;  1TL7 A;  3FBF A;  1HQE A;  2Q6B A;  2KFN A;  1H2U X;  4CO1 A;  3AD9 C;  1K1S A;  3QYY A;  2FQQ B;  4NLY A;  3UD4 P;  2MHN A;  1FRX A;  2F9D A;  5H9E J;  5E3P A;  4IQX A;  1MLA A;  3IP0 A;  1T05 A;  2BAN A;  4O0I A;  2AX0 A;  5F8J A;  2ZJR Q;  3DOM A;  1YSJ A;  4WP9 A;  2EK1 A;  1YTY A;  1FKP A;  4ZPW R;  3UD3 P;  4IUF A;  4ZMM A;  2NXJ A;  4M5N A;  1WF0 A;  1N5Y A;  4TNO A;  1F3V A;  3PG9 A;  2DNR A;  2HZA A;  2OHD A;  1BGX T;  3OTE A;  2HK3 A;  1F9H A;  3D28 A;  5DQI A;  2W2P P;  4I2Q B;  2WBR A;  2R8G A;  1VMB A;  2HPU A;  4M8L A;  3R9L A;  2HND A;  2V5H G;  4NZ6 A;  3KG0 A;  1Q0N A;  5L1J A;  3SSQ A;  3OTC A;  3I5A A;  3W2W B;  1GAO A;  4KH0 B;  4ECX A;  1OJ4 A;  2L41 A;  4LFA J;  2XG8 A;  2VZ9 A;  1U0S A;  3MM5 A;  4HAC B;  3FGV A;  2CPH A;  4UF4 A;  1U0H B;  1S6P B;  3P8B B;  3CO9 A;  1RWP B;  3RB3 A;  2J0W A;  5KG3 A;  1TL5 A;  1X60 A;  1J5E F;  4B9T A;  4DV2 J;  5C42 B;  2M7S A;  2ZNZ A;  4CWB A;  1YRU A;  4ED5 A;  1JXE A;  3BSC A;  2C2Z B;  1FES A;  3OXG A;  4NXM F;  5KT4 A;  1JNZ B;  1WC5 A;  1CS4 A;  2YKM B;  3BDE A;  3D1Q A;  4ID5 B;  3GSD A;  4Q2M A;  2R8K A;  2MZ1 A;  1CC7 A;  3N79 A;  2KZZ A;  2QA4 S;  2M4M A;  2C2R A;  2RS8 A;  2GQC A;  3DFE A;  3JTO A;  2L9W A;  3WHI A;  3UNY A;  2UUB F;  3LWM A;  4PUO B;  1KNZ A;  4G3I A;  2KM8 C;  1T3N A;  1HHT P;  4C7Q A;  1Q1K A;  2MLY A;  4MYU A;  2LDY A;  4PQA A;  3PYF A;  1I94 J;  1NM2 A;  3CJK A;  4DSK A;  4LVN P;  2W9A A;  2DNM A;  2XNQ A;  1RLC L;  2COL A;  4BWJ A;  1RKJ A;  1PBA A;  4DR5 F;  1VGY A;  3IRX A;  4DX6 A;  4OZ3 A;  2QYG A;  5F8H A;  1FHT A;  1RAF B;  1REG X;  3FKB A;  5IM0 B;  2RRA A;  4AL6 A;  3VTI A;  3HHD A;  3J7Y U;  3DKD A;  3RUB L;  2DBB A;  3KG4 A;  3D6T B;  5DLF A;  1LWF B;  3GP9 A;  1YG0 A;  2KL8 A;  1IUJ A;  4L75 A;  3THP A;  3FBC A;  4NLT A;  2HGN A;  3ENW A;  3T5J A;  2VG7 A;  4LF4 F;  1GNK A;  4DV3 F;  4DV4 J;  1JJ2 R;  1ZTW A;  2W2M P;  3GJS B;  1Q7Y T;  1UVL A;  1FX4 A;  2HBR B;  4YP3 A;  3FCH A;  2D3Z A;  5B09 A;  3F0N A;  1C1B A;  2R3V A;  2VG6 B;  1OQ3 A;  2N4D A;  5I3U B;  4FDF A;  3M7V A;  1KON A;  3PDN A;  1RT2 A;  4HI1 A;  2FHK A;  4FPI A;  1J5O A;  3AXM A;  2KTQ A;  3VHQ A;  1N34 F;  3L3C A;  3G6V A;  2GQ2 A;  3D6H B;  2B7C B;  1C0U B;  4C8N A;  3K58 A;  3D4J A;  1QD1 A;  4RL1 A;  4HL9 A;  2MKJ A;  2NCK L;  4WF9 Q;  1Y4Z B;  2R7Q A;  5CQG A;  1U4B A;  1M5O C;  2YWW A;  2QTW A;  3W2V A;  2ZOF A;  4ZVU B;  2ZDP A;  5IT4 A;  4DR4 F;  3DC2 A;  1HNZ F;  2AEJ A;  2D69 A;  2HZC A;  3OUY A;  2GGP A;  3OSN A;  3V6D B;  3DXB A;  2G0J A;  3K7R A;  2DXF A;  2DR5 A;  5KFS A;  1H2T Z;  2F65 A;  4RW7 A;  4PG4 A;  4FP9 A;  2N3L A;  3QGH A;  4M5D A;  2NZC A;  3JSM A;  2AZ3 A;  1VHF A;  5LMU F;  3OVS A;  3UNG C;  1UJ5 A;  5AXK A;  4OYI A;  1VRT A;  3H5X A;  1ZAW A;  4OX8 A;  1ZPV A;  2EFQ A;  4ZP6 A;  1HNX F;  2AGO A;  2ZE2 B;  3OTD A;  2KT5 A;  2ZBQ A;  5DRK A;  4CO2 A;  3PTW A;  5HQM A;  2HFS A;  1IVZ A;  1BQM A;  3D2W A;  5DLG A;  2CQD A;  4OHX A;  1YIT S;  2CPX A;  3OL8 A;  5JUM A;  3OL9 A;  3TA2 A;  1H6K X;  3DCA A;  2E5L J;  3V4M A;  1DQ8 A;  2HHW A;  3RAQ A;  3ZNJ 1;  2BXJ A;  3VZH A;  5E2Q A;  1VBY A;  2AYE A;  2J5A A;  4O44 B;  3KFW X;  1NSP A;  1KFD A;  2HQC A;  4KBI A;  1ZM4 A;  4X4R A;  3KHH A;  5AE2 A;  3TWZ A;  4CDI A;  4QR0 A;  2E7V A;  4LF6 J;  3MPV A;  3FDS A;  3FNN A;  1MNE A;  3IAM 9;  1WHW A;  3MMA A;  2C42 A;  4JOU A;  1Q8L A;  3MPD A;  4LR8 A;  5KFV A;  4DPW A;  4X66 F;  4WWS A;  5KFX A;  2GCF A;  2G9O A;  4FXW A;  4UQG A;  3LAM A;  2GO8 A;  2GS8 A;  3VAL A;  3MD1 A;  1S57 A;  4LQ3 A;  1KOH A;  2JLG A;  3D6F B;  4ICL B;  1RT7 A;  1XMO J;  2R8I A;  3EXC X;  4RU9 A;  3WC2 A;  4EFA C;  2HHQ A;  4JBC A;  5A6W A;  2AX1 A;  3RZA A;  4A8Y A;  3PX0 A;  3H2L A;  3GB0 A;  1M5P C;  3DRR B;  1NK8 A;  3GTY X;  4ZCK A;  2DGW A;  2YTC A;  2ADC A;  1NME B;  5F0U A;  5GVQ A;  1IKX B;  4H54 A;  3VGS A;  1T03 B;  5CZX A;  1WF2 A;  2OTJ S;  2AZ1 A;  2C2N A;  2MPU A;  4X4N A;  3AA9 A;  4ER8 A;  3BR9 A;  3W7B A;  1HD1 A;  1N5T A;  5BJR A;  4H4O A;  4E8U A;  3QBC A;  4RPF A;  2D9P A;  2XSF A;  4GO5 X;  2V4J A;  4ZLL A;  3IS9 A;  1NJX A;  4XDC A;  4J7C A;  2XCA A;  1UVK A;  1PCA A;  5AJ3 J;  2EEY A;  1FRI A;  4KPY A;  3KMQ A;  3IXQ A;  4CTA B;  2EVZ A;  3TX8 A;  4Q2L A;  1TVR B;  3NS5 A;  4NXM J;  2KXH A;  4PR6 A;  2V4Q A;  2W4P A;  1UZD A;  1EQ0 A;  2P6T A;  4JV5 F;  4EO8 A;  3CCS S;  5CYQ A;  1CJK A;  2UUB J;  1S1U A;  3V6J A;  2VJU A;  1T3O A;  4PXB A;  3CCU S;  3MM9 B;  3Q8Y A;  1IR0 A;  2AP6 A;  5GME A;  5IXU A;  3OL7 A;  3R3T A;  1HFE L;  4K4Y A;  2DIU A;  4GVB A;  1VQP S;  2ZOG A;  2YNH B;  4DR5 J;  1I5O B;  2IC3 B;  2L9D A;  3HHL D;  2XUL A;  3D5M A;  4K0K F;  4C98 A;  4N77 A;  5E7O B;  3ETO A;  4LRF A;  5CAA A;  3HP6 A;  1NZ8 A;  3MR6 A;  3W5Y A;  3GYN A;  1FRJ A;  3NGS A;  1N52 B;  2DYA A;  3MMC A;  4ECQ A;  2R7V A;  3GMG A;  3HT3 A;  1D9F A;  3IBW A;  5HK4 A;  4LIR A;  5DQG A;  2H1Y A;  5HP1 A;  4LF4 J;  4TY8 A;  3G86 A;  1CUL B;  3MM8 A;  2XB2 D;  2CNK B;  2PN6 A;  4N5S A;  3AOB A;  2XS2 A;  4DPO A;  1NEE A;  5J1E A;  1DTT B;  3IAS 9;  3IRW P;  1UP1 A;  2KYZ A;  3ULH A;  4KGK A;  1JLE A;  4KO0 B;  3R6G B;  2IY5 B;  2GIR A;  4FS2 A;  4MIB A;  2Y1R I;  2RNE A;  3ENV A;  3RW7 A;  2XGQ A;  2M3D A;  4OV6 A;  5H1S V;  1N5Q A;  2FDN A;  3LA0 A;  3M2U B;  4F4Z A;  3BB5 A;  5KOW A;  5ETM A;  3R2D J;  4Y00 A;  2W1B A;  5F8M A;  4DF4 A;  2E29 A;  4L72 B;  1RT5 B;  1TAQ A;  2FJV A;  4NL5 A;  4PWW A;  4QPT A;  4YR3 A;  2ZHO A;  4DR4 J;  1XBW A;  3R97 A;  1RLD A;  3KLG B;  1FRL A;  4TVA B;  2YPZ A;  5D0E A;  5MLC V;  2V8P A;  1VQ6 S;  2KO1 A;  4KB7 A;  2KJW A;  1SB6 A;  1NHK L;  3NWR A;  4NCG B;  3TVK A;  4QR1 A;  1CBK A;  1GMU A;  1KTQ A;  3R7B B;  1WI6 A;  1XJW B;  4DR2 J;  4DFK A;  4X4P A;  2Q3P A;  3I5C A;  2GV1 A;  3AD8 C;  4FS1 A;  4ZLN A;  2DNQ A;  2PMZ D;  1IWA A;  2JH3 A;  1P6T A;  2HFV A;  3Q8P B;  4ZN3 A;  1JB0 C;  2P6S A;  3FBB A;  5DZ6 A;  1XR7 A;  2HFO A;  3BGF A;  3Q24 A;  4F0K A;  2G0I A;  2GJ2 A;  3GII A;  4IRC A;  1KD1 T;  4JI1 J;  2UU9 J;  2FZK B;  3KUE A;  2XYP B;  4DG1 B;  2OPS A;  3L7P A;  3UPF A;  5FDL A;  1S97 A;  4F2S A;  1NPK A;  2RD5 C;  3IN5 A;  3EM1 A;  3MZI A;  1WHX A;  3QLH A;  4OYO A;  4O0N A;  2RKI A;  1FK9 B;  2LKZ A;  3N5B A;  3SV4 A;  3HXM A;  4CCH A;  2OFH X;  4WE1 B;  3MM6 B;  3CCE S;  4DDF A;  1NAQ A;  3MAA A;  1GH8 A;  1JWW A;  1G7C B;  3TZY A;  2FJA B;  2JLF A;  1R8H A;  2CQP A;  4U8Y A;  4LF8 F;  2YX1 A;  1QE1 A;  3HVA A;  3HVT B;  4K7Q A;  4X66 J;  5DGB A;  2BKO A;  5EDW A;  2DGT A;  3AOA A;  3MEE B;  2W01 A;  3HKW A;  2NXE A;  3MR2 A;  2JC1 A;  3S6E A;  5JVG Q;  5BYR A;  3DN9 A;  1DRZ A;  2ZD1 B;  2Z2Y B;  3ZZT A;  4LSN B;  2XI2 A;  4DR3 J;  1QTN B;  4DCO B;  1FWK A;  3U1N A;  2H5J B;  2VBZ A;  2R7R A;  2W4C A;  3GWC A;  4BDP A;  4IO9 Q;  1BWE A;  1H74 A;  4XPE A;  3GIL A;  2ZEJ A;  2YNG A;  1M90 T;  1VHI A;  3QGG A;  2C3U A;  4J9N A;  3Q8Q B;  3ISN D;  4IOA Q;  3BBB A;  1VQ4 S;  2E1R A;  5H9F K;  4F4A A;  3RRK A;  3MHY A;  2KVI A;  5AXL A;  1ZM2 A;  1VRU A;  1C4C A;  3R6L B;  5D4L A;  3DLE A;  1WC0 A;  3PM9 A;  1HW8 A;  1C2P A;  1YI2 S;  3D68 A;  1KVI A;  1UMJ A;  1U1L A;  1VQ8 S;  2RIJ A;  4DSJ A;  2HQG A;  2A10 A;  2E9T A;  1S77 D;  4GRS A;  2ZZM A;  2XSJ A;  1HNV B;  2W8L A;  2RJZ A;  1F2H A;  4TQR A;  4F4K A;  1IR1 A;  2E5I A;  5C7P A;  3C14 A;  2EK6 A;  3QT6 A;  3A12 A;  3W64 A;  4KY3 A;  3BO4 A;  2R8J A;  1SVD A;  1S1X A;  4OYZ A;  1MML A;  1W26 A;  5RUB A;  5AXM A;  1TL1 B;  3FEY B;  5ETL A;  1SC1 B;  2ZZT A;  4QYR A;  2VON A;  2NR0 A;  3C66 A;  3Q2T C;  3MUM P;  3Q22 A;  3TAR A;  4F02 A;  3MCN A;  2GW8 A;  3LPE A;  1FNO A;  4OI0 A;  2MZQ A;  1SI9 A;  2BV3 A;  2WON B;  1CJU B;  3C3L A;  5CXT A;  4MMO A;  3H98 A;  2JX2 A;  4DUZ F;  1U09 A;  2ZFH A;  3FRZ A;  2DCL A;  3EDR B;  2BKP A;  1PIL A;  4B9V A;  2A6O A;  2NS1 B;  3GSI A;  2Q6C A;  3FEZ A;  2C2O B;  4RU2 A;  4UZC A;  5KG5 A;  3PKY A;  1SKS A;  3HUL A;  4DWI A;  4ILM A;  4U96 A;  1JKH B;  5D6G A;  3GCX P;  2KT3 A;  3QT8 A;  2L48 A;  2ZKT A;  2VQF J;  2HNY B;  4JI3 J;  4A8O A;  3MUR P;  4IG3 A;  4Z37 A;  2CQ4 A;  1UFW A;  1HKA A;  4OHZ A;  1IKY A;  2MQL A;  3CCT A;  2FD2 A;  2GX8 A;  5HJY A;  4Z2X A;  3E8O A;  3W8P A;  3ADA C;  3THV A;  3HSD A;  1N32 J;  3P6Y C;  5M2U A;  2FJB B;  4DR7 F;  5IC4 B;  3MCO A;  5L9N A;  3T1A A;  2B4V A;  2HFN A;  2M52 A;  1TK8 A;  4N41 A;  4KGX B;  1VQM S;  3M2R A;  1O51 A;  2E7X A;  4Y2K A;  1KRP A;  1IQT A;  3ZFV A;  2DNN A;  4JB8 B;  3PW2 A;  4WZM A;  2W7P A;  2V94 A;  2E44 A;  1U1P A;  2ZJP Q;  1HNI A;  1X5P A;  2LP4 A;  2HVZ A;  2AJ2 A;  4ZVQ B;  1NSK L;  2H4W B;  2G1D A;  1N36 F;  2E7W A;  2N82 B;  4WP3 A;  4KV8 A;  2B9X A;  4ZPT R;  4OHY A;  3GFX A;  3M8Q A;  1H7W A;  2WW4 A;  4ES1 A;  1B4S A;  3C15 A;  2XCP A;  1IXK A;  1QTM A;  1EJ7 L;  3NRB A;  1IWG A;  3P96 A;  3PRD A;  2UUW A;  2XLK A;  4BC7 A;  3E2E A;  1Y5L B;  4JI0 F;  4UY8 5;  3UVJ B;  2AU0 A;  3CO0 P;  3O3L A;  4MK9 A;  2DNL A;  3JS9 A;  1M1K T;  1WC6 A;  2IAJ A;  1FT8 A;  3PEH A;  3UCZ P;  3JYT A;  1RB0 A;  1NLK L;  2XO7 A;  1F3F A;  1B0T A;  2P9C A;  2XY5 A;  4PQU B;  5GAG U;  4J91 A;  1KQF B;  4XAK A;  2X1G A;  4B3R J;  4LIW A;  3R27 A;  2XYH B;  2X3G A;  2YWK A;  2XYG B;  4UOF A;  3LP0 A;  3BSN A;  3DYA A;  4W98 A;  1FX2 A;  2HRY A;  2DR8 A;  3IWN C;  2RQ4 A;  3E3X A;  2W2Q P;  3ZZO A;  1VQS A;  2ZH9 A;  3BKF A;  4KSE B;  1QY7 A;  2HFU A;  2IRX A;  4F8R A;  4JI5 J;  1CEZ A;  4RW6 B;  4WII A;  3H4B A;  4F50 A;  3OHA A;  1BQN A;  1EET B;  3G82 B;  4LSL B;  2DPJ A;  3H5Y A;  3E51 A;  4AL7 A;  4JI2 F;  3SCL E;  1XTZ A;  4KPC A;  2AHO B;  2ATC B;  3PR4 A;  2WVE A;  4DQS A;  2R8H A;  1MU2 B;  5K8N A;  5J2N A;  2PI5 A;  3M1V B;  3I0S A;  2UXD J;  4K8R A;  3WX4 A;  3CCZ A;  1NDC A;  4IO1 A;  3SSR A;  1UW4 A;  1Q7L B;  3HMJ G;  3OR1 A;  1NK0 A;  1H72 C;  3G2X A;  3M8S A;  4ANE A;  3Q8R B;  1XR5 A;  1A0O B;  2DR6 A;  4KR0 B;  1KFS A;  1JQG A;  2CJA A;  2POK A;  4NRU A;  1IKW B;  1KC8 T;  4CH0 S;  1P8G A;  5CH7 B;  1HW9 A;  4Q43 A;  3D6M B;  1M0S A;  4B3O A;  1L5U A;  4USI A;  1WG1 A;  5ETV A;  3RYL A;  5C5J A;  3BV8 A;  2F4V J;  1RHJ B;  1R31 A;  1V5I B;  4K4V A;  4J37 A;  3DI6 A;  3H4D A;  3D0H E;  2I5J A;  3GE9 A;  5EWE A;  4OZL A;  3MCM A;  1O5J A;  5E33 A;  1WG5 A;  1J27 A;  3LAN A;  1S9G A;  3RAM A;  2FLO A;  4RW4 A;  1KLM B;  1YRT A;  4ZIV A;  5LOQ A;  1RXO B;  4DS5 A;  3KNA A;  1G6B A;  1H0H B;  1TKX A;  3TAM A;  1HHQ A;  2CQI A;  3M32 A;  5A2Q U;  3C16 B;  2PDA A;  4C6A A;  3HK2 A;  4WK1 A;  4HHJ A;  6FDR A;  1JLQ B;  1U1N A;  1TV6 A;  5T14 A;  7FD1 A;  9RUB A;  4A8K A;  1IBM F;  4C3M A;  1KP6 A;  2MLX A;  2RF2 A;  2MST A;  4ZPV R;  2JNJ A;  1RWW B;  1RT4 B;  1NK4 A;  4DUZ J;  3CGI A;  5BXI A;  1ZBT A;  3GU0 A;  3IA0 A;  4EYH B;  2EW9 A;  4NOH A;  1NHU A;  3JTP A;  2Y1L B;  3X3U A;  3CCR S;  1HWU A;  1TUV A;  4HH0 A;  4G1I A;  3SSS A;  1VQY A;  4ENO A;  1LK7 A;  3NBP A;  3BQ0 A;  2XMT A;  1IM4 A;  4V1A k;  5B08 A;  1WOS A;  4YB6 A;  1FKO B;  2AJ4 A;  8ATC B;  2HVI A;  4O4R A;  3LPY A;  3G6Y A;  3CCJ S;  2LEA A;  4TXS A;  1LWC B;  3JQM A;  2GVZ A;  1NJI T;  2HRT A;  1CPZ A;  5DG7 A;  1XMQ F;  4WYW A;  3RB4 A;  2OAU A;  3EVO A;  3BGR B;  4KHR A;  3QID A;  2NRE A;  3ETM A;  4DL7 A;  1FRH A;  3HLU A;  4U6P A;  4UQT A;  4ZVF A;  3LAL A;  4ZVO B;  3QO9 B;  4NA1 A;  2CDR B;  4I69 A;  4O3N A;  4K50 A;  2E9Z A;  1A6L A;  4J9Q A;  4ZIT A;  4LT6 A;  4U7C A;  1TUW A;  2VB6 A;  4NLG A;  2YNI B;  1WKK A;  4I68 A;  4WTO B;  3AJ1 A;  1N33 F;  3QJP A;  2BE7 D;  3C2P A;  2QE5 A;  6AT1 B;  3NOG A;  4ZVG A;  2VA3 A;  3S8S A;  2CNN B;  3UE2 A;  2OSR A;  3N5F A;  4KGZ B;  4PWD A;  2MLZ A;  2DY1 A;  1DY3 A;  4WFN Q;  3KJV B;  5KT3 A;  3VAH A;  3KK2 A;  2ZUG A;  5L38 A;  5CYJ A;  2A2D A;  1HBM A;  2CZV C;  2O01 C;  4FNI A;  2DHS A;  3KYL A;  5ETR A;  2YKP A;  2FLP A;  2MZS A;  7FDR A;  2PT0 A;  5DM7 Q;  2KFZ A;  3BDP A;  2X1F A;  2B0G A;  2JVR A;  5KAK A;  5HAO A;  2PC6 A;  1FKA F;  4AND A;  2HLU A;  4OLO A;  4DOZ A;  4C48 A;  1MMD A;  3OSP A;  1DHM A;  2ZHA A;  3UN2 A;  3M8Z A;  4KRW A;  4DN9 A;  3N6N A;  2OP5 A;  3W5X A;  4FN5 A;  2DIV A;  2EKY A;  3FVY A;  2C3O A;  4LJM A;  3JSB A;  4PRF A;  2XNR A;  3TEG A;  3IWL A;  4EZ6 A;  1RE1 B;  5CAB A;  3W63 A;  1K8A T;  1Z4U A;  4Q45 A;  5AE3 A;  4HTJ A;  1L3U A;  3DDN A;  1RT3 B;  2AYG A;  4B9U A;  1MWQ A;  4RNM A;  1RT6 B;  5H9F J;  4I2Q A;  4C8M A;  1OY8 A;  2MB0 B;  2FGC A;  2FUG 9;  2J9D A;  5B0E A;  1FRK A;  3PW7 A;  3CUL A;  1IN0 A;  1CJV B;  2D3U A;  2KJV A;  1WTF A;  1URR A;  3OXL A;  3WIV A;  1VK8 A;  3JSY A;  3W2W A;  5KFK A;  1AXQ A;  4MFB B;  3DU5 A;  3FQL A;  1SL2 A;  2RUS A;  3MPY A;  2DHG A;  2XY6 A;  4M5J A;  2PA3 A;  3LGH A;  2A18 A;  4K4X A;  3CMQ A;  2IVF B;  1F1B B;  5EX3 A;  1U0H A;  1S6P A;  4L6V 3;  4ES2 A;  2NYH A;  1TR0 A;  3NAI A;  1RA7 A;  2AWZ A;  3CD5 A;  5C42 A;  1WTB A;  2C2E A;  1IBL F;  3RBE A;  4K5S A;  3LP1 B;  3N28 A;  4WTY A;  2XMW A;  4LF9 J;  2BQU A;  3MR7 A;  2W24 A;  5I3Q A;  3FUY A;  4C11 B;  2YKM A;  1W2I A;  2RRB A;  1WEL A;  1JNR B;  5A8W B;  4ID5 A;  1V3Z A;  1TFW A;  1YJT A;  2VC0 A;  4WU3 A;  3BH6 B;  1VRQ C;  4DXL A;  2FHJ A;  1FDN A;  1N54 B;  2R2U A;  4EGL A;  4PUO A;  4OX6 A;  2G2Y A;  4X64 F;  3D54 A;  2FYX A;  4A8M P;  3PAC A;  3CT9 A;  4FKX A;  2YKN B;  3QAU A;  1H2V Z;  1WUU A;  3J80 Y;  3SI8 A;  3HT0 A;  2V9W A;  2V50 A;  3GQC A;  5J1N A;  2BOA A;  1N88 A;  1NU4 A;  4C0H A;  4ZN1 A;  2KDO A;  1UEV A;  4JYA F;  2JWN A;  2E1M C;  3UI3 A;  5ETK A;  2QN6 B;  2D1C A;  3CD7 A;  3CCM S;  2LU2 A;  3UCG A;  1NDP A;  1S12 A;  1LWF A;  4AXI A;  4YME A;  1RKI A;  4DZ6 A;  2KI2 A;  1BMQ B;  1RTH B;  3LF0 A;  3L7U A;  2WSF C;  1D09 B;  2IVM A;  2CA9 A;  3KXD A;  4G6V B;  5KT2 A;  3DOK B;  4QW8 A;  1Y5I B;  1RDR A;  5IOL A;  1DQ9 A;  3CC2 S;  1V6H A;  2DH9 A;  2L9N A;  3D3B J;  1LOU A;  3QFW A;  4OYB A;  4ECS A;  4OI2 A;  2VG6 A;  1LQ9 A;  2ZH1 A;  1F9E B;  4CIO A;  5I3U A;  5HLF B;  3GCW P;  2ZC4 A;  2EC0 A;  4QPX A;  2DKO B;  2CAD A;  4XTT A;  4H4M B;  2AW0 A;  1RBA A;  2VQE F;  2HSE B;  3U27 A;  2RIL A;  2J6U A;  4NMX A;  1C0U A;  4DPU A;  2GIF A;  1WC1 A;  4J5O A;  1WEZ A;  1YK9 A;  4B08 A;  3MFH A;  2LA4 A;  4KHP J;  4IRK A;  3NG8 A;  1Q53 A;  4ZP7 A;  4AL5 A;  2QIF A;  4IR9 A;  5FLX U;  3M6W A;  2VV5 A;  3V6D A;  2KRR A;  2PEB A;  1T9U A;  5IQQ A;  4A8W A;  1CC8 A;  4LFB F;  4OFZ A;  2V0N A;  4ED2 A;  2FZC B;  1BE4 A;  1YHQ S;  2IYG A;  2HHH J;  1HBU B;  3ET6 B;  1NK7 A;  3K59 A;  2RDI A;  3B8H A;  2DVI A;  2XEX A;  3DXS X;  3VGV A;  4DS4 A;  4TYA A;  3BF4 A;  5HQL A;  2HHP A;  1X7V A;  2OIH A;  1XNQ F;  2ZE2 A;  2FLN A;  2G13 A;  3IG1 B;  2JZ5 A;  2B8Q A;  2V8D A;  2QL9 B;  4OMF G;  2WW8 A;  1SCJ B;  3BGU A;  3PNI A;  3OR2 B;  2ASY A;  3T41 A;  3ICL A;  4RNN A;  2BR0 A;  4WXW A;  1VQN S;  2DNO A;  2V8V A;  2DK2 A;  3WX8 A;  2E5G A;  5GAH U;  5CZV A;  3VQT A;  5K14 B;  3Q83 A;  5EGY A;  1UKU A;  2V68 A;  4UW2 A;  4QOT A;  4Q44 A;  3EXY A;  4O44 A;  5DM6 Q;  5C24 B;  1U6F A;  3OLB A;  2HHT A;  2D3O R;  3SMZ A;  1NK9 A;  1ZOT A;  2AEM A;  2DO4 A;  2OO4 A;  2XMA A;  4IQM A;  1R0B G;  4DCP B;  3EVM A;  2FHO B;  3AH6 A;  3U1M A;  3G6X A;  3K8W A;  2V8G A;  1WNE A;  4F3M A;  1BC6 A;  1UWB B;  3P45 B;  2IM3 A;  2U2F A;  2DEJ A;  4LRD A;  4ECY A;  2RU9 A;  1NO8 A;  1ZYQ A;  2C2D A;  4IH7 A;  4DR6 F;  1KTV A;  4A8Q A;  1CJT B;  1TAU A;  4G1P A;  1ZAV A;  4ICL A;  5D15 A;  1QAI A;  4X2B A;  2EPI A;  2Y9H A;  4CH1 A;  1EZZ B;  1SBR A;  2YQ1 A;  2E66 A;  4OJ3 A;  3RR8 A;  3QRP A;  3VQS A;  2Z57 B;  2X7I A;  5CYM B;  3DRR A;  2XMV A;  4U7U D;  2A3J A;  1XK8 A;  2FVQ A;  2V4R A;  3QGI A;  1AZS B;  3KG1 A;  4XK8 C;  3UDV A;  3P5B P;  1IKX A;  2DRD A;  4N7T A;  1UJ4 A;  1T03 A;  3H5S A;  5JMN A;  3TAP A;  3K0J A;  3M8P B;  3CJ3 A;  3ZZP A;  4IH5 A;  4X65 F;  3T19 A;  1AFI A;  1KVJ A;  1EIY B;  4LBH A;  5EN1 A;  3NY0 A;  3U02 A;  1GX6 A;  3TAN A;  3IBC B;  1FXD A;  5IC6 B;  2ZWO A;  2BRK A;  4LRB A;  1IBK F;  3UR0 A;  4NLR A;  5KT5 A;  1IKV B;  4FBU A;  4JI7 F;  1F9F A;  2IM2 A;  4DUY F;  1QDU B;  1X4F A;  1WG4 A;  3I9V 9;  2C2K B;  3UDC A;  4J9L A;  4CTA A;  3MI7 X;  2MQQ A;  2GAG C;  1VBK A;  3R5B A;  1TVR A;  3AB4 B;  4DR1 F;  1KEK A;  3OLA A;  4CM2 A;  3NS6 A;  2X1A A;  4B9N A;  1F60 B;  3V2U C;  2UXB F;  3C46 A;  2CQ1 A;  2UV8 G;  3SQO P;  2UUC J;  1NH8 A;  2JEF A;  3DM2 B;  3PYE A;  1PKU A;  3OXF A;  1RHU B;  3T3F A;  2V2Q A;  2P2C B;  2CQ0 A;  4FYY B;  2ZBR A;  3CF5 Q;  4DU7 A;  1RJJ A;  1NJY A;  4AQY F;  3TAQ A;  3MM9 A;  1V5V A;  1SKW A;  1YJR A;  3D67 A;  3VGU A;  3CCW A;  3K5M A;  4RX6 A;  3PY8 A;  2V34 A;  2ROE A;  2W25 A;  4ECV A;  2EFG A;  2ZNY A;  2BQ3 A;  3GIR A;  2E5J A;  3HVR A;  2IC3 A;  3D1O A;  3GYX B;  3H0P A;  1YLX A;  1X4A A;  4WFZ A;  3RAX A;  1U2C A;  4DHV A;  2A1B A;  2QLF B;  2DCU B;  2H4Y B;  5HVG A;  3HSG A;  4GKK J;  2ACY A;  1Q5V A;  3ZTS A;  1AW0 A;  4DPT A;  2CJ9 A;  2C28 A;  3MM7 B;  4MAK A;  4DV1 F;  3HI9 A;  3VZI A;  2F63 A;  3CCQ S;  3DRY A;  1XEZ A;  5IWA F;  1VOM A;  4F04 B;  4O23 A;  1OYD A;  5KG2 A;  1B0V A;  2ADB A;  4DFJ A;  1B99 A;  1R27 B;  5B0D A;  1CUL A;  1EB0 A;  1KN6 A;  1HR0 F;  2NPF A;  2PSZ A;  4UZB A;  4PG8 A;  1S6U A;  2UV8 A;  3J7Z T;  1X0P A;  1V3R A;  1DTT A;  4DV7 F;  2IM0 A;  2V2Z A;  4KO0 A;  2O67 A;  2DHA A;  3MTJ A;  2A0F B;  3TVZ A;  3OFF A;  2KHD A;  2YWE A;  3KUG A;  2K3I A;  2GGP B;  4FF3 A;  3M2U A;  4IH6 A;  2DO0 A;  4OZN A;  1RQ0 A;  3UCU P;  3GV5 B;  2ZH8 A;  4WYL A;  2EXU A;  4XDD A;  3NGD A;  3PZP A;  1RT5 A;  1IJE B;  4PEO A;  4RNF A;  2JDJ A;  5HRO B;  5KFL A;  4NLS A;  2B9E A;  3QSI A;  3KLG A;  2VKZ G;  3MCS A;  2NYI A;  3TQ1 A;  4Y6I A;  2MKI A;  4KT0 C;  4LRC A;  4NCG A;  5DDP C;  2YNF B;  4DFP A;  4J9S A;  2BEF A;  4U7U K;  2UUA J;  1NZA A;  3OFH A;  2B7B B;  1NJW A;  2GHV C;  3SCI E;  1HBO B;  3BBF A;  1R7I A;  1YBT A;  4OI1 A;  5DO2 A;  3H8Y A;  4QWC A;  1T02 A;  4BS2 A;  2HBQ B;  2Q43 A;  2ZIT A;  4AXJ A;  4Y2A A;  4N76 A;  3FC9 A;  2HHX A;  2MKS A;  2DGV A;  5A8R B;  4DG1 A;  2HNZ B;  3DMJ B;  4RZR A;  2Y0S D;  2WVF A;  1GK8 A;  4I6Y A;  2NXC A;  1R8P A;  1SKR A;  3B4M A;  1OY9 A;  1Z1Z A;  1U47 A;  4OZ2 A;  3G9C A;  4WE1 A;  3MM6 A;  4ZIW A;  5LJ3 Y;  5EUH A;  2DGU A;  5A8K A;  1SIW B;  2RRN A;  2B9Y A;  1T9V A;  4C8Z A;  3OVB A;  1R89 A;  1BY9 A;  2W9B B;  3KK1 B;  4M63 A;  4C0O C;  4P2M A;  3C6T B;  3NCQ A;  2CPJ A;  4OQJ A;  4LVO P;  4B17 A;  3HVT A;  2I0X A;  4ZPC A;  1AT1 B;  2ERR A;  2Y8W A;  3MEE A;  3RU0 A;  2O66 A;  1LEO A;  1RTI B;  2F9J A;  4ES3 A;  2KG0 A;  1XNR J;  2ZD1 A;  3PEJ A;  3PYD A;  3AT1 B;  4LSN A;  1IJF B;  4F4Y A;  2WOM B;  4F0H A;  2IRU A;  2BDP A;  1FEE A;  2BJ3 A;  1UCN A;  3PVX A;  3W66 A;  3A4T A;  1U8S A;  1VBZ A;  4ZVH A;  2VIC A;  3LQV A;  3OVA A;  4NXN J;  4C0B A;  2W9C B;  2AGP A;  3QJJ A;  2RB7 A;  1SKU B;  2V4J B;  4F2R A;  1R0C B;  3RBX A;  4X65 J;  2I9S A;  3L9Z A;  4ZA1 A;  5T7L B;  3HPO A;  3OQ2 A;  2CG8 A;  2Z30 B;  2QMU B;  5F8I A;  2CJK A;  4DUT A;  4NLP A;  1O8B A;  3VAF A;  1RAD B;  3M8W A;  2E1C A;  4JI7 J;  3H5U A;  2UZA A;  4CYU B;  5HAN A;  1U2F A;  4C8K A;  3CSK A;  2DNZ A;  5KFD A;  2YKA A;  1WSR A;  3G4S S;  2UP1 A;  3D3C J;  1CJK B;  4DR1 J;  2R7W A;  2LQ5 A;  3FFI B;  4ATN A;  4B3M J;  1LW0 B;  3NGK A;  3AB2 B;  1NPP A;  2HLT A;  1TQL A;  3QZ8 A;  5IZH A;  5CA5 A;  4NLO A;  2RDD A;  2GZO A;  4GVB B;  3HFZ B;  4QYZ K;  1TL1 A;  1FJE B;  5KFT A;  3CCV S;  2JLE A;  6FD1 A;  2MYF A;  1UVN A;  2J0Q D;  3J7A N;  2B4P A;  1TKT B;  5D0G A;  4WU2 A;  2KYX A;  2DNH A;  1W25 A;  2APO A;  1S4F A;  3O5T B;  1RTJ B;  2WVD A;  1HIY A;  3IFE A;  4KH1 B;  5KFE A;  1YZ6 A;  4M5L A;  3NOC A;  1PYO B;  1HPZ B;  1HAR A;  3JAM U;  2BKN A;  3EIC A;  2FVP A;  2Y8Y A;  1HA1 A;  1X4E A;  3IO1 A;  3KLE B;  2KXF A;  2QZ8 A;  2IJR A;  3AJD A;  4O3R A;  5IWA J;  3M9O B;  3MAH A;  2HNY A;  4BHQ A;  1X4H A;  4RJV A;  4ZOS A;  2EI5 A;  4YHH F;  2XMM A;  1Y10 A;  3H90 A;  5LMN F;  4FYX B;  1HR0 J;  3F44 A;  2JEI A;  3W9I A;  4K5R A;  5LSR A;  3L7O A;  5DG8 A;  4ED0 A;  2I1R A;  4K2J A;  1JK9 B;  2IDE A;  4DL2 A;  1Q5Y A;  1LWE B;  4DV7 J;  2MY8 A;  1R6Y A;  4ELU A;  3QQC D;  3SIP B;  3PV8 A;  2HVD A;  1WAC A;  3OJS A;  1NKB A;  4OZ1 A;  2CIM A;  1VBX A;  2HVE A;  5GMD A;  5J2Q A;  3N01 A;  1TZ0 A;  2DH8 A;  2V67 A;  5GAE I;  4HDG A;  4C3K A;  3BEG B;  1DAR A;  1T94 A;  1RHQ B;  3FZ2 A;  1K47 A;  3PXG a;  4K4U A;  3LH2 S;  1X9S A;  2HMI B;  1X5T A;  1B70 B;  4KKO B;  2WSC C;  2ILZ A;  3JSR A;  1KHW A;  1YJ7 A;  3M05 A;  4FYW B;  1BWV A;  1UZH A;  3CME S;  4TU8 A;  5A0Y B;  5KFR A;  1U1M A;  1S99 A;  2MSS A;  4L74 A;  4NAS A;  5HI7 A;  5ITH A;  1M5K C;  1N0V C;  3H20 A;  4RUA A;  4LQ9 A;  5FII A;  1JMT A;  3T5H A;  4ZVS B;  5AXN A;  1VI7 A;  4LMZ A;  3BO2 A;  4CLZ A;  4NEY A;  1MW7 A;  3BKU A;  2O5D A;  1VLO A;  3UVJ A;  5DDO C;  1RBL A;  3N0V A;  4PPD A;  3QMQ A;  3FRY A;  2R2S A;  3GV7 B;  2OH2 A;  5C2G A;  4ZPA A;  1UAW A;  1U48 A;  3QIP B;  4PQU A;  1L3S A;  2M8D B;  1U7L A;  5MAO A;  1UEU A;  3LGN A;  3C6U B;  2B6A B;  2J9E A;  1RU1 A;  3M8R A;  5CCM A;  1GMV A;  2X51 A;  1UTA A;  3TUZ C;  1ICE B;  1YJ9 S;  3MTK A;  4PYD A;  1LW2 B;  1S5Z A;  3G6E S;  2QT7 A;  1FJG F;  4X62 J;  2FTR A;  2XM3 A;  5L1K A;  4MT1 A;  4I6W A;  4QCL A;  2RHQ B;  2PI4 A;  1EET A;  1SXL A;  4X4V A;  3G82 A;  4LSL A;  3KMS A;  4NWB A;  2OML A;  3PIP Q;  2YNG B;  3PFO A;  4NX9 A;  3T6J A;  2KT2 A;  3M1V A;  1HWK A;  3M6X A;  4HTI A;  2XZT B;  4TU9 A;  1RWO B;  2HHU A;  5CCL A;  3GG0 A;  3EPI A;  5KFZ A;  1PC5 A;  2D7S A;  3AD7 C;  4AE5 A;  5ADZ A;  1T9Y A;  4M5H A;  3POT B;  2JSX A;  3J7A 1;  4LF7 F;  2XBP A;  1TU0 B;  2VBY A;  1OO0 B;  4MKY A;  2Y0B B;  2UXC J;  4DV0 J;  1IKW A;  4B9L A;  4J9M A;  3RRH A;  1L3K A;  5HVH A;  3FSX A;  3G8S A;  2CNO B;  4UY8 T;  1GXL A;  2B4O A;  2CQ2 A;  3CDU A;  2WCX A;  2LXF A;  4USV A;  5KFH A;  3T1Y F;  3TO8 A;  2RAQ A;  2OPP B;  1JXV A;  1DLO B;  1UET A;  4F25 A;  2QJ3 A;  3TQE A;  1TK5 A;  5DDR C;  2LMI A;  1EKS A;  2NSB A;  4X4Q A;  1WHV A;  1K0V A;  1KS2 A;  4QWB A;  2CZ4 A;  1KLM A;  2QFI A;  2CZ9 A;  4P74 A;  1GXU A;  3VCD A;  2VFU A;  2WHO A;  1CLF A;  5KT6 A;  2KU7 A;  3C16 A;  4IOB A;  4Z7Y A;  2H48 B;  3IR5 B;  5E5N A;  2HAI A;  1JLQ A;  3BO3 A;  2L3M A;  2OUG A;  2Y1J A;  4DSE A;  2EBE A;  4M5G A;  5KFF A;  5AT1 B;  4FVC A;  2DNK A;  3NAH A;  1YRX A;  1RT4 A;  1VQL S;  4RO0 A;  3O44 A;  5IQ6 A;  3W61 A;  3R2C J;  4NLQ A;  1P9Q C;  1SUQ B;  1XWL A;  4DL5 A;  2RQK A;  1M1G A;  4IG3 B;  3EPG A;  1TP7 A;  2A6M A;  1SJ3 P;  1S1T B;  3MEG B;  4AYB D;  2QL5 B;  5IV4 A;  1OIA A;  4V19 J;  4IDK B;  3EGV A;  1FKO A;  3RRG A;  2VPY B;  2VC1 A;  3V81 B;  3TVY A;  1ZAX A;  3UO0 A;  1LWC A;  4BCA A;  2ZKU A;  1NBE B;  2C3M A;  4ZCL A;  4ED8 A;  4OJ1 A;  3BGR A;  4WIQ A;  3KUH A;  2GNK A;  3O2I A;  2R2T A;  3J7Z 5;  3EZ5 A;  3V5R A;  2YY3 A;  1J5E J;  4DLG A;  1HYS B;  5KG0 A;  2J0X A;  1K9M T;  1WKL A;  1AFJ A;  3GJT B;  2YNI A;  3H42 A;  3GJQ B;  5D4P A;  4LF5 F;  2PFD A;  2LQB A;  4P6Q A;  3NLC A;  1JLG A;  2ZDO A;  2CPE A;  1N56 A;  4KV8 B;  5JVH Q;  3BGO P;  2J6T A;  1SC3 B;  2BE9 B;  5F8L A;  2EFP A;  3TJ9 A;  4I7F B;  1RZM A;  3KJV A;  5HAT A;  4CI0 B;  1RK8 A;  1FTC A;  2MJN A;  3MEC B;  2BA9 A;  2X1B A;  2MEW A;  1YJW S;  3SBM A;  1OSD A;  5E0O A;  2AJF E;  2WAQ D;  4K2X A;  1C1C B;  5J2P B;  1U1O A;  2IM1 A;  3PO5 A;  5BYQ A;  1S7I A;  4PZV A;  4HT7 A;  2MMY A;  4QU6 A;  3I0R B;  1Q79 A;  1SH0 A;  2IAJ B;  2Z56 B;  4KFB B;  1FCA A;  1F6T A;  4PG5 A;  4DN0 A;  4NYP A;  1PSD A;  2EFN A;  2QA2 A;  2VF3 A;  2ZUA A;  1DTQ A;  1FFS B;  3FZB A;  4RW9 B;  1H7X A;  3LP0 B;  3AHP A;  3VAJ A;  3U1L A;  5CD4 H;  4YR0 A;  3FSI A;  3BQ2 A;  1RHR B;  4DV3 J;  1S76 D;  1T7P A;  2PEH A;  4WBF A;  2DTJ A;  1NHV A;  4U8V A;  2V8H A;  3GZ7 A;  1EKR A;  1WSV A;  5HVF A;  1QM9 A;  1CSJ A;  1SH3 A;  5KFY A;  1RT3 A;  4N56 A;  3V6K A;  4C8L A;  1HWJ A;  4ED1 A;  2AIR B;  1Y3K A;  4M95 A;  3B6B A;  3W3S A;  5HMY A;  1RI7 A;  5KFG A;  1VC6 A;  3W65 A;  4WPA A;  3IGN A;  1N34 J;  4P2S A;  3LWL A;  2J7U A;  5E3C A;  3BYR A;  5I42 B;  4RR5 A;  4YB7 A;  1CG2 A;  4ZCI A;  4MFB A;  1REV A;  1DUR A;  1H73 A;  3DHX A;  4IRD A;  1S0N A;  3K5L A;  1Q95 G;  4PXE A;  1RWU A;  3JB9 k;  3W5Z A;  4DV2 F;  1E6Y B;  3DNC A;  2HQD A;  3FEX B;  1YDL A;  1HWI A;  1HNZ J;  4S0M A;  3P4U B;  3J81 U;  2RSQ A;  4UUX A;  4OZ5 A;  3IR7 B;  4ZJQ A;  3H25 A;  4Z7C A;  1Q86 T;  1WI8 A;  4D3H A;  1OY6 A;  4YN3 B;  2NXU A;  3LUY A;  3MPW A;  4F3O A;  4KC5 A;  2QSF A;  3LP1 A;  5I4M A;  4Y34 A;  2CPY A;  4Y2I A;  1S0M A;  5LMU J;  4QYZ J;  4RW8 A;  4UOH A;  3GIK A;  2FHM A;  4DV5 F;  1AUS L;  3KJQ B;  4C11 A;  3KK3 B;  3HO1 A;  5A8W A;  4LBP A;  1HNX J;  3QGP A;  3N9U C;  2WVC A;  2JFD A;  2YH1 A;  1EHW A;  1I94 F;  1AYE A;  5KFU A;  1QVF R;  1QSS A;  1NSQ A;  1S0V A;  1NKC A;  3T1Y J;  3MMB B;  1S9G B;  3GG1 A;  3BYP A;  5KG6 A;  5DDQ C;  1F5A A;  5C2C A;  2WVB A;  3DLG B;  2YKN A;  3ISN C;  5M2R A;  2CXE A;  1PG5 B;  4WKR A;  4YOE A;  3KLF B;  4DL6 A;  2PFF B;  1YZ7 A;  5LL6 d;  1VS3 A;  1XIQ A;  2WBM A;  3JQK A;  4UST A;  5A2Q Y;  4E98 A;  1I3O B;  1HBN B;  5GMK a;  4QIF A;  1ARO P;  2DH7 A;  1WOR A;  4HYK A;  3CC4 S;  2CVI A;  4DV4 F;  4IFV B;  4A47 A;  2MZJ A;  4BLG A;  2VH7 A;  4XPC A;  4R0E A;  3BR8 A;  2MQO A;  4NLV A;  3ZTP A;  1U02 A;  2HBY B;  3BGL A;  1KDN A;  1RTH A;  3CD0 A;  4G65 A;  1VQ5 S;  4I2P B;  1MN7 A;  3E01 A;  4JV2 A;  3DOK A;  5D3G B;  2G4B A;  1MMN A;  3KWM A;  1S7H A;  1TKZ B;  3SDE B;  2BRL A;  4DU8 A;  5ETP A;  5HLF A;  3CVK A;  3MDF A;  2WB1 D;  4PPZ A;  1TFY A;  3R5C A;  2AGQ A;  2YXL A;  3FK4 A;  1D9A A;  4O4G B;  1B64 A;  4Q0B B;  4I1T A;  3A8J A;  4NI2 A;  3IGV A;  3RB0 A;  2R9L A;  5K5M A;  1FVS A;  1FA0 A;  3A3O B;  1U6B A;  4P75 A;  3CW2 C;  1FD2 A;  1C0T B;  3MUT P;  3AA8 A;  3NEK A;  2WK4 A;  4GC7 A;  1WF1 A;  1TMJ A;  2QLW A;  1MSW D;  1YWX A;  2MGZ B;  3CJ2 A;  3S01 A;  3OPK A;  1FNX H;  1GTH A;  4ILL A;  5DG9 A;  2GMJ A;  2C22 A;  3IC1 A;  5HMZ A;  1Y5N B;  1JLA B;  4ZCM A;  1HBU A;  2C2M B;  3ET6 A;  2VDH A;  1YVF A;  3X1L B;  1Y00 A;  2LLZ A;  1FE4 A;  4LF5 J;  5E3Q A;  2KVQ E;  3H59 A;  2LXI A;  3DOL B;  4U67 Q;  1RBO B;  2J7K A;  4JV5 J;  3D1H A;  2E5L F;  1KQG B;  4AD6 A;  2F8H A;  1FF2 A;  2I6W A;  3IG1 A;  4R0J A;  3FBE A;  3HFK A;  3KLH B;  3OR2 A;  3KKF A;  2YKQ A;  2GHW A;  4EWT A;  3TZX A;  5B0G A;  2CFX A;  3ITH B;  1NB2 A;  3OV7 A;  3PR5 B;  3QWP A;  4LF6 F;  1MRO B;  2K1R B;  5K14 A;  2MQN A;  1S1V B;  4OLP A;  8AT1 B;  4K0K J;  2XS5 A;  5C24 A;  1G2E A;  4BC9 A;  2KHC A;  2YH0 A;  4KQZ A;  1Y7P A;  4WFY A;  1S6Q B;  4P9S A;  3WQP A;  1O6X A;  1ROF A;  2AQ4 A;  2EG2 A;  2AMC B;  5KFB A;  1UW9 A;  2H3E B;  1ZA1 B;  3I4P A;  1S72 S;  1XMO F;  1J2V A;  4K4S A;  3ISZ A;  1UWB A;  2EFO A;  4WZQ A;  5HQ8 A;  2GFF A;  2DY9 A;  3PRB A;  1RCX B;  3W1Y C;  2BJ1 A;  2DR9 A;  5FD1 A;  1FTR A;  1E6V B;  4FPR A;  1ZTT A;  1CJT A;  4P52 A;  1NH7 A;  4YY3 F;  5BYS A;  3HFV A;  1KLN A;  1YJN S;  5CYM A;  2RT3 A;  3Q86 A;  4P73 A;  3UW1 A;  4MKB A;  1AZS A;  4URQ U;  1N5S A;  2VD3 A;  5KG7 A;  3R5D A;  1ZET A;  3EZO A;  2Q79 A;  4RKU C;  3T5L A;  2GJI A;  1QLN A;  4YB5 A;  3M8P A;  2PA8 D;  5AJ3 F;  1MG7 A;  2BOP A;  4OYW A;  4QWE A;  1UVJ A;  1S0O A;  5IS2 A;  2DB1 A;  4W90 B;  3OT9 A;  3TR5 A;  4ETX A;  4QZV B;  1IKV A;  3PW5 A;  2V63 A;  2FPH X;  2I8E A;  4AUK A;  4NE9 C;  3OTO F;  1UL3 A;  4EMD A;  3CXC R;  2QX0 A;  4Q7A A;  2CPD A;  1XC9 A;  3OL6 A;  2JC0 A;  3QSY B;  1G4C A;  3VAG A;  4R8U B;  3ZC4 A;  4DV5 J;  4M94 A;  1S59 A;  1WOO A;  3HZG A;  4QW9 A;  4ECW A;  1N5V A;  5CHC B;  5G0R B;  4C2M A;  2BQR A;  3CC7 S;  3DM2 A;  2QLB B;  2RE1 A;  3OD2 A;  1SIZ A;  1T11 A;  1WOP A;  1RWX B;  1JJC B;  3LW5 C;  3H2V E;  2VJV A;  5HJX A;  4G1Q B;  4QIG A;  3MR3 A;  1TMM A;  2HS4 A;  2XLI A;  1KHV A;  2DR7 A;  3I87 A;  4DLE A;  4UUW A;  1R8C A;  1PJ7 A;  2GJF A;  4D3G A;  2XS7 A;  4GMK A;  2YVS A;  5IT0 A;  1U2R A;  3VAK A;  3MAQ A;  3R7N B;  3D66 A;  4DSI A;  3G8T A;  1FXR A;  3KLI B;  5KFC A;  3HZE A;  3EZU A;  2QG9 B;  4QR2 A;  3R1H A;  4YQW A;  4ZKA A;  4QWD A;  2BMB A;  2G2O A;  4OHW A;  4X84 A;  5EWG A;  2DRA A;  3UFC X;  4LF8 J;  2R42 A;  3OJU A;  3MM7 A;  4FF2 A;  1SPB P;  4IR1 A;  2B56 A;  1BHN A;  4W4M A;  5L8R C;  3QNW B;  4F4X A;  2R7O A;  2DNY A;  2V2K A;  4QQB A;  5EWF A;  1UFL A;  3HDS A;  4JUZ A;  2VKR A;  2B8P A;  4KTQ A;  4YEA A;  1Q78 A;  3CD6 S;  2JVO A;  3NL0 A;  3MR5 A;  2ZOM A;  4DF8 A;  5ETT A;  3PHT A;  1S10 A;  1VK3 A;  3K5N A;  1RTD A;  4HEA 9;  4OJG A;  1R8A A;  1RWV B;  4KIA A;  2E5H A;  2LEC A;  3N6M A;  3RG6 A;  4ECR A;  3RJM B;  2WSE C;  4LRA A;  1RAA B;  1ZM3 A;  4DV6 F;  1KKH A;  3MED B;  5FLX Y;  2CWX A;  3M9N B;  2JFK A;  5HRO A;  3I5B A;  1R3N A;  3AAW B;  3DLK A;  4DR2 F;  3K17 A;  2VG5 B;  3HHK A;  3QRR A;  3NXZ A;  3F56 A;  2HFZ A;  3KDO A;  3KJN B;  4DZD A;  4K4T A;  1T9T A;  2YNF A;  3ZZU A;  4A4J A;  3LP2 A;  2Q1L A;  5ETQ A;  3EWG A;  2LDI A;  4DX5 A;  1L3V A;  4JI1 F;  2OD4 A;  4MIW A;  2UU9 F;  4MJK A;  1UVI A;  1HBO A;  1UVM A;  3R8Y A;  2XZD B;  1F5B A;  1YJV A;  2FZG B;  4CZC A;  3ZZZ A;  1RWN B;  1HLW A;  1SJQ A;  2HQ3 A;  5D8H B;  4I6A A;  2OPQ B;  4I56 A;  2ILY A;  1D8Y A;  3MMJ A;  3UD5 A;  4NCB A;  5A8R A;  1DFD A;  2HNZ A;  4MK8 A;  3DMJ A;  1HD0 A;  2BE2 B;  4DL3 A;  3PX6 A;  1UA0 A;  4NEZ A;  5A6P A;  4PKD B;  2QA4 G;  1RA6 A;  3V6H A;  1VYA A;  1NK5 A;  5KFI A;  1VLY A;  2H54 B;  1HI8 A;  1ACM B;  3UN5 A;  3NWG A;  5JJB A;  1EP4 B;  2QO3 A;  2B5J B;  4O3P A;  2IPO B;  2KFY A;  2W9B A;  4QU7 A;  3KK1 A;  2MXY A;  3A3P B;  4P71 A;  3C6T A;  3HVW A;  4P2X A;  2C1E B;  4ED4 A;  3G71 S;  4DR3 F;  2ZBI A;  1PJ6 A;  4UOG A;  1URN A;  4DSL A;  2HQF A;  1RTI A;  5J2M B;  2OJ3 A;  5HBM B;  4DR7 J;  1RCO B;  3DGP B;  4YY3 J;  3DLH A;  2WOM A;  4CO0 A;  1UPM B;  4B3S F;  1NSA A;  5EHH A;  1P1T A;  2W9C A;  3K57 A;  2IBO A;  5BR8 F;  1H38 A;  1R0A B;  2FVS A;  3W62 A;  4MK7 A;  4EI2 A;  1IQZ A;  5KFP A;  4NPO A;  1NRK A;  2LEP A;  2YPY A;  2FC9 A;  4QJV A;  5T7L A;  1PIE A;  4NCA A;  2VBX A;  4NZ0 A;  3T1H F;  1N36 J;  3DGV A;  3FCW A;  3TZW A;  3CWJ A;  3J7Y I;  3QFH A;  1LNQ A;  3CJQ A;  3HHL B;  3TUI C;  3CPW R;  3OFE A;  1RT1 B;  1GXT A;  4CYU A;  4U95 A;  3OTO J;  4CLF A;  2VL1 A;  2MDA A;  3ZZY A;  3ELH A;  2CUY A;  3VR1 A;  4WJB A;  4PWU A;  2EBG A;  4K59 A;  3BRE A;  1L3T A;  1N6Q B;  3TX0 A;  1WEX A;  3FFI A;  3SYZ A;  1U26 A;  1LW0 A;  4BBY A;  1T0T V;  3GIM A;  4UOC A;  4OI6 A;  2H65 B;  4JI0 J;  3M2V B;  4NLW A;  1DJ0 A;  3I56 S;  4KAI A;  2CJY B;  2LEB A;  1TKT A;  2R7T A;  5SUH A;  2HIY A;  3CIZ A;  2YX7 A;  1VQO S;  2FJX A;  3F41 A;  1SH2 A;  1B0P A;  4CP5 A;  2Y3Y A;  4LR7 A;  1RTJ A;  3NGU A;  4B02 A;  4KJI A;  1RWM B;  3BBC A;  4GKJ F;  1TEL A;  2VQF F;  1HPZ A;  4JI3 F;  3B54 A;  1PYS B;  3I4H X;  3C19 A;  1TL3 B;  2ATL A;  3KLE A;  3M30 B;  4FXD A;  5CD4 A;  3ENA A;  4O3Q A;  1FXL A;  3OHB A;  1U1K A;  1R8B A;  4LF2 A;  2AJ1 A;  1N32 F;  2Z58 B;  1WC4 A;  3MGJ A;  1PO6 A;  1XQI A;  2HWH A;  1B3T A;  2XWY A;  2MKC A;  3A8E A;  4IG0 B;  4R5P B;  2DD8 S;  3BH7 B;  4HAC A;  1JLF B;  3MEK A;  4JI2 J;  3LTO A;  3SCK E;  3PW0 A;  1Q8I A;  3P5T L;  4ZHR B;  1K1Q A;  2FJW A;  2DGX A;  4CO3 A;  5F9N A;  3HKZ D;  3QAE A;  5KFW A;  2ASL A;  3A1Y G;  3RBZ A;  4NA3 A;  5E3A A;  4C9D A;  1LWE A;  1Y9O A;  5HL7 Q;  4DSF A;  2F8E X;  2VPX B;  3DRP B;  5L9X A;  2CNL B;  1SV5 B;  3AOC A;  1WKJ A;  4DPX A;  3AJ2 A;  3SQG B;  1WJ9 A;  3A13 A;  3PW4 A;  4IOC Q;  3FJ2 A;  2OPR B;  1RAE B;  3P3D A;  2HMI A;  1HMV B;  1FER A;  1SJR A;  1FNM A;  4M5K A;  4TKT A;  4CLY A;  2I2Y A;  2LXU A;  1JLC B;  4DV6 J;  3L4B C;  4KKO A;  1JLB B;  3N4W A;  2VDI A;  3KJF B;  2IA6 A;  1GFW B;  3VGT A;  4CT8 A;  2G1H A;  1S9F A;  8RUC A;  1V3S A;  1S9E B;  4HKQ A;  4C97 A;  4ZPB A;  2W2O P;  1ZH5 A;  1R6V A;  4IYQ A;  5A0Y A;  2HGM A;  3V4I B;  1C4A A;  3S7R A;  4MKA A;  1ZM9 A;  4PYA A;  5B0A A;  3I82 A;  3GPA A;  4MYT A;  3QZ7 A;  4ECU A;  5IM0 A;  2LYV A;  4F36 A;  3PIO Q;  4NYZ A;  1JXL A;  2F5G A;  4B3R F;  3DRS B;  4L3N A;  1YIJ S;  3Q8U A;  4NLU A;  2MJU A;  3I9Z A;  1IBM J;  3TA1 A;  3G96 A;  4USH A;  2CJX B;  3QIP A;  1RHK B;  1EX8 A;  3EDQ B;  1SQE A;  1KR4 A;  3GJR B;  1Q81 T;  2ZH6 A;  3TUP A;  1SL0 A;  4DL0 C;  4CNY A;  3EVW A;  1OPI A;  3C6U A;  3Q8S B;  5A8K B;  2B6A A;  2DGQ A;  2GVD B;  3O1L A;  5LXY A;  1RTZ A;  4JI5 F;  1HQU B;  1A7G E;  4F67 A;  3M6V A;  4GO7 X;  1VC0 A;  2N7Y A;  1UEK A;  1RSC A;  2RQM A;  2ACM A;  4ZDN A;  3ZZ0 A;  4CLK A;  1S1W B;  2DT9 A;  3JTN A;  1LW2 A;  5C25 B;  2VOD A;  4OYA A;  3L09 A;  1XMQ J;  3M4X A;  3K5O A;  2UXD F;  2ZHB A;  3B82 A;  1VQ7 S;  4FZV A;  3TZZ A;  2RVJ A;  2IIH A;  1H98 A;  3EYZ A;  1TK0 A;  1Z2L A;  3HJV A;  1VIX A;  1NDL A;  2SXL A;  3G8Q A;  1T9X A;  2J7W A;  1FJC A;  3GLJ A;  5KOX A;  5KFJ A;  4FBT A;  5KT7 A;  2VA2 A;  3TP2 A;  4B3S J;  1B7Y B;  5F0W A;  1RAI B;  1N33 J;  5D78 A;  2VUG A;  1RHM B;  3POT A;  1X4B A;  4IFY B;  5BR8 J;  3I6P A;  1SC4 B;  5HN0 A;  4EZ9 A;  2XHW A;  3GFY A;  4A8S A;  2F4V F;  1U1Q A;  1TL7 B;  1HQE B;  3T1H J;  3PX4 A;  4OL8 A;  1NXI A;  2DGO A;  2HZV A;  4ZLP A;  2OPP A;  1DLO A;  4WFA Q;  3B4D A;  4MIA A;  2CAJ A;  4ZVR B;  1VDH A;  1U45 A;  1YKW A;  2F7V A;  1T05 B;  4K4Z A;  2BAN B;  4P10 A;  4YUD A;  1UPP A;  1U1R A;  2KZM A;  2XO6 A;  2V9K A;  3DOM B;  4RUH A;  4EEY A;  3I31 A;  4ZP8 A;  1FKP B;  2J9D E;  2J9C A;  4CLS A;  3HX9 A;  3DU6 A;  1LFP A;  2NZ4 A;  1N5Y B;  4ELT A;  2P9G A;  5F9L A;  1FRM A;  1D3W A;  3IBF B;  1S49 A;  2F40 A;  2RU3 A;  4FYD A;  4PCQ A;  2NPI A;  1H3D A;  2QFJ A;  4Q5V A;  3K89 A;  5G4D A;  1PC4 A;  1ELO A;  1QVG R;  2VBW A;  3BJY A;  2DHX A;  5HMX A;  2R2R A;  2HBZ B;  1OPZ A;  2HND B;  2J0S D;  4C4W A;  4KYZ A;  3UDL A;  4WP8 A;  5KFA A;  5B7W A;  4FKY A;  1FWL A;  4UTG A;  4OI4 A;  3RW6 A;  2FLL A;  3MOJ B;  2DEI A;  3SXL A;  4ZS6 A;  3JAM Y;  1SUQ A;  5ETO A;  2VFR A;  4GKJ J;  1OWX A;  4OV1 A;  2UVR A;  5D4O A;  4EO6 A;  2DPI A;  3NS7 B;  4ELV A;  3EJM A;  1U24 A;  4F7V A;  3MM5 B;  1S1T A;  3MEG A;  2HHV A;  4QIW D;  1OYE A;  2HS3 A;  3UR3 C;  4CT9 A;  2PMW A;  4IDK A;  3TA0 A;  3JXO A;  3KHR A;  2ABY A;  3V81 A;  2MHE A;  3SZ2 A;  3M6U A;  4ZK7 M;  3NCR A;  2IJN A;  4J9V A;  3JQJ A;  2LCW A;  1QSL A;  3AXK A;  4HR2 A;  1X9W A;  4FYV B;  4I67 A;  5J2Q B;  4Y2M A;  3T5K A;  1CS4 B;  2IBK A;  4Y65 A;  2JJ4 D;  2ZM6 F;  3BKT A;  5LM7 E;  3T6B A;  1HYS A;  1Y0H A;  1IBL J;  3PO4 A;  4ED6 A;  3A8I A;  2CPI A;  1VIS A;  4YFU A;  2VU5 A;  1SJF A;  2WTF A;  3CJ5 A;  4USM A;  5L1I A;  4Y28 C;  3TEH B;  2PO4 A;  1RAO A;  3RTV A;  2EKN A;  4CLU A;  1G3O A;  3P49 B;  4DX7 A;  3PKM A;  3CJK B;  1S4E A;  1BLU A;  4PAB A;  3LGM A;  4E0D A;  1HI0 P;  4I7F A;  4X64 J;  5FJ4 A;  3IRX B;  4XIU A;  1P1L A;  2BW2 A;  4HI2 A;  1KQS R;  4DL4 A;  3QT5 A;  4DPY A;  3MEC A;  4BWM A;  5K9F A;  4B9M A;  4OYP A;  1C1C A;  3BN7 A;  3EE3 A;  5J2P A;  4OZJ A;  4X4T A;  5B0C A;  2QSW A;  2YNH A;  1WD6 A;  3I0R A;  3W9J A;  2EC2 A;  4JYA J;  1OQ6 A;  4KFB A;  2HK2 A;  3DDI A;  3D0I E;  2VG7 B;  1K73 T;  1NND A;  3FMW A;  5DQH A;  1EAR A;  2KH9 A;  4M1K A;  2G0C A;  3M8Y A;  2BBE A;  1FD8 A;  4ZPD A;  2ZH3 A;  1HL6 A;  1HHS A;  2CQ3 A;  5L39 A;  4RW9 A;  2XHC A;  5M2P A;  4H4K C;  1C1B B;  1PBU A;  5KFM A;  2KM8 B;  1RT2 B;  1J5O B;  3CJ4 A;  3N6L A;  4ZJL A;  2NSC A;  4GVL A;  5E3R A;  3DLJ A;  4ETZ A;  4B9S A;  9ATC B;  1JX4 A;  2J8A A;  2BAC A;  2I38 A;  2MTL A;  2OGU A;  2DJW A;  5KFQ A;  2VIH A;  3CB4 A;  4RBU A;  1X8D A;  1I1G A;  1YBU A;  2AJQ A;  2FJD B;  1RAG B;  4URS A;  1KBR A;  3NNC A;  2W2N P;  2O3D A;  3CUN A;  1NKE A;  3W2V B;  1SC6 A;  3Q0A A;  3OUY B;  1ZZN A;  1GMW A;  2F3J A;  2VQE J;  3NMR A;  2CDQ A;  5I42 A;  2ZVS A;  4RW7 B;  2OEL A;  1TL4 A;  2CQH A;  1VIO A;  4M5D B;  2CQC A;  5THW A;  1E6Y A;  3JSM B;  4O3S A;  4J90 A;  1R43 A;  2YQ0 A;  2QMW A;  2XI3 A;  4CQ1 A;  1OSC A;  5A76 A;  4DFM A;  1YQH A;  5LXR A;  4LF9 F;  4LF1 A;  2LVW A;  4DQI A;  2E1A A;  4QWA A;  2HUR A;  1YX2 A;  1VRT B;  4CH7 A;  4JI6 F;  3WBZ A;  4H4K A;  4LFB J;  3TOQ A;  1HQ2 A;  2XQC A;  1O0P A;  2KXN B;  2MKH A;  1F2G A;  1BQM B;  4HH1 A;  2Q66 A;  2HGL A;  3NMA A;  2PD1 A;  2CKW A;  2XTJ P;  1N48 A;  2IMO A;  4A46 A;  2XMK A;  3KK3 A;  2JL9 A;  1LK5 A;  5GAE U;  1XNQ J;  1X31 C;  2VPW B;  7AT1 B;  2O1P A;  3PFE A;  2M0G B;  4PG7 A;  1D0E A;  1LFW A;  3MXH P;  3I96 A;  2ZJQ Q;  4EYI B;  4PAA A;  2IYI A;  1VFJ A;  3SFU A;  2CJQ A;  1LV5 A;  3MMB A;  2NXN A;  1RAJ A;  4JP8 A;  1KOO A;  3QJL A;  2LQ9 A;  2A2C A;  2LU1 A;  3DLG A;  1DAX A;  3MPU B;  3TUJ C;  2D74 B;  1K0T A;  2UVU A;  3WZ0 A;  2VFS A;  3W60 A;  2XLJ A;  3MMA B;  1Y11 A;  2ALZ A;  3KLF A;  4EK2 A;  1FK9 A;  5HO4 A;  4A48 A;  4WK3 A;  1WEY A;  1MWZ A;  2V69 A;  2JEJ A;  1QJH A;  3O6Q A;  2QV6 A;  1HBN A;  3EX7 B;  4WKY A;  2DGS A;  2BJE A;  3UDE A;  1D8Z A;  3FQK A;  5L1L A;  3NP5 A;  4IFV A;  4ALZ A;  1ZPW X;  1HI1 A;  4CO4 A;  1RT7 B;  3QPI A;  5D0H A;  2W4D A;  2XC9 A;  5K8P A;  3QAT A;  4I2P A;  4USU A;  4DR6 J;  3PJ9 A;  4RBT A;  1ULR A;  3BN4 A;  2XWX A;  5D3G A;  4ID8 A;  3HD2 A;  3BZQ A;  1TKZ A;  3SDE A;  4I0W A;  2IJF A;  2KKH A;  1XR6 A;  1FFW B;  2BZ2 A;  5KFO A;  1FDD A;  4Y3C A;  2QA1 A;  4O4G A;  2OMO A;  4P7T A;  2M9K A;  4KHP F;  3EMT A;  5DGA A;  4OIX A;  4Q0B A;  4H4O B;  2QLJ B;  1SJ1 A;  2GML A;  2EG1 A;  2FY1 A;  3DLL Q;  3IS9 B;  2IA0 A;  1D1U A;  4RNO A;  2XMJ A;  1LWX A;  4LBI A;  1U6Z A;  3G87 A;  2OFG X;  3KLV A;  4FF1 A;  2E1P A;  5SZT A;  1C0T A;  3C8Y A;  1GTE A;  2HHH F;  1S6O A;  1WWH A;  2IRY A;  1IBK J;  2Z2M A;  3HM9 A;  2LA6 A;  1YJU A;  2MGZ A;  2ZM6 J;  3RR7 A;  5IT9 Y;  4B3T F;  4DUY J;  3BSA A;  2BUN A;  4JI4 F;  1A9N B;  4RNH A;  1JLG B;  1KVK A;  1X9M A;  3T9Z A;  5CYQ B;  1XN9 A;  2RQC A;  1JLA A;  2W7O A;  1S1U B;  4EU0 A;  4GC6 A;  2BJD A;  5GAG I;  1HNV A;  2XZW A;  2AYB A;  3Q8V A;  5AE1 A;  2UXB J;  4U9R A;  3DOL A;  2HWT A;  1ZA2 B;  1FJ7 A;  1NPR A;  2MKY A;  4DQR A;  2AEF A;  2HHS A;  2MQM A;  4YDD B;  2N4C A;  2K2P A;  3GIJ A;  2UVV A;  3KLH A;  2BM1 A;  4AQY J;  4J9P A;  2BYC A;  2KN4 A;  5HMW A;  5K8O A;  3ZTQ A;  3L95 X;  3ITH A;  1PAE X;  2WON A;  4OJH A;  1CJU A;  1MRO A;  2K1R A;  4YR2 A;  5ETS A;  2RUG A;  1S1V A;  1DTQ B;  3MMC B;  1APS A;  2ZBP A;  2J76 E;  3AOD A;  2V6A A;  1FO1 A;  2DHH A;  4C3L A;  5HP1 B;  4TY8 B;  1VQ9 S;  3Q2S C;  2N7C A;  4NLD A;  1RWK B;  1XMB A;  3MM8 B;  4OYM A;  4RUC A;  3VAM A;  1S6Q A;  4CM0 A;  2IMW P;  4KGV B;  2CRL A;  2F8M A;  4DV1 J;  1CVJ A;  3TI0 A;  4ED3 A;  2Z4P A;  3CED A;  1JKH A;  2FGO A;  2QGF B;  2NLW A;  5J1E B;  4LFC F;  2M88 A;  1FWP A;  1JLE B;  3WC0 A;  2CWK A;  4X4U A;  3GFZ A;  3M9M B;  4DCJ B;  5KTQ A;  2B4U A;  2AYM A;  2IVY A;  2MQ8 A;  1GQE A;  2PII A;  4ANC A;  2HRU A;  1PGZ A;  1E6V A;  4X4S A;  2QYC A;  1VCT A;  5GAD U;  1REV B;  2RS2 A;  4Q8F A;  3HHE A;  2EFV A;  3DHW C;  4RUB A;  3OW2 R;  2M8H A;  3R1L A;  3EGZ A;  1RP5 A;  5EX0 A;  5K8M A;  1ITP A;  2ZH7 A;  3LOU A;  2OEK A;  4OYX A;  3WDO A;  4CO5 A;  3ILO A;  3ZTR A;  3AQP A;  2BM0 A;  1EQM A;  3OBI A;  3J81 Y;  3R7S B;  2KB2 A;  4P72 A;  4RWW A;  3NNH A;  4RW8 B;  2OI2 A;  5D77 A;  4F3Q A;  2BJ7 A;  3UN3 A;  4JI6 J;  1RGV A;  3UQS A;  4ZP9 A;  2DNP A;  1BQX A;  3PJX A;  1QSY A;  1AB8 A;  2K7J A;  4NRT A;  2GIQ A;  5HSP A;  1RYR A;  2UUC F;  1X4C A;  1P9Y A;  1NB7 A;  3SV3 A;  3VF0 B;  2J8S A;  1RUS A;  1KSP A;  1SJ4 P;  2W8K A;  3PYG A;  4R8U A;  1S48 A;  2OPS B;  2FHJ D;  2C3P A;  1RIS A;  1WC3 A;  5FDL B;  3BPD A;  1X0F A;  5G0R A;  1Q16 B;  1PJ5 A;  4FVM A;  3IR6 B;  3QLH B;  2BJ8 A;  3I55 S;  2RKI B;  3DDK A;  3T9N A;  4YS2 A;  2BVZ A;  4FF4 A;  2EWH A;  2U1A A;  4G1Q A;  5DZ7 A;  2MQP A;  3MAA B;  3R5J B;  2DRB A;  4QBU A;  2IFX A;  5IFM A;  1QUV A;  1WHY A;  1UWA A;  1N0U A;  3CJ8 A;  4GKK F;  5DET A;  1EAY C;  1QE1 B;  2D41 A;  3KLI A;  2HVH A;  4I64 A;  3AY0 A;  4CLT A;  4EBC A;  2B43 A;  3I32 A;  1M5H A;  2C3Y A;  2GA7 A;  3E01 B;  5H9E K;  4I4B A;  2ZH5 A;  2ASD A;  4RW6 A;  3UWT A;  3OFG A;  1VJW A;  4M5I A;  1QUP A;  4CLW A;  3CJT A;  2QMX A; 
#chains in the Genus database with same CATH homology
 1FFG B;  1FWP A;  1FFW B;  1FFS B;  1EAY C;  1A0O B;  2LP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...