1EAYC

Chey-binding (p2) domain of chea in complex with chey from escherichia coli
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
67
structure length
67
Chain Sequence
PRRIILSRLKAGEVDLLEEELGHLTTLTDVVKGADSLSAILPGDIAEDDITAVLCFVIEADQITFET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Two binding modes reveal flexibility in kinase/response regulator interactions in the bacterial chemotaxis pathway.
pubmed doi rcsb
molecule tags Signal transduction complex
molecule keywords CHEY
total genus 15
structure length 67
sequence length 67
chains with identical sequence D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 1998-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09078 CheY-binding CheY binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits CheY-binding domain of CheA 1eayC00
1FFWB 1EAYC 1A0OB 1FWPA 1FFGB 2LP4A 1FFSB
chains in the Genus database with same CATH superfamily
1FRXA 3IXQA 3CCRS 2XS5A 2RHQB 4HACA 4RBVA 3MTJA 4X64F 4CCHA 4PUOB 1OPIA 5D3GA 2Y1RI 2HHXA 4AQYF 1SIZA 3DU6A 2DPIA 3TZXA 2DRBA 1UMJA 1C2PA 2XSJB 3HVTA 2DYAA 4HT7A 3J80Y 2XC9A 1UJ4A 1K73T 4UUWA 1M1GA 1MROB 2M3DA 4C11A 3I5AA 4G1QA 3PVXA 4EBCA 3L9ZA 1D8ZA 2KT5A 4I2QA 2BUNA 5K5MA 5BXIA 3MR3A 2J76E 2QA4G 4QBUA 2ZDPA 1Q16B 4PG4A 4J9NA 5CZVA 4KAIA 1VQ7S 4LFCJ 2YWGA 5T7LA 3MEEA 4JOUA 1LQ9A 3ITHB 5GAEU 4XPEA 4JV5J 1D3WA 5FLXU 1A9NB 4RUHA 2KN4A 5HP1B 5B7WA 4ED1A 1VS3A 1NAQA 3TQEA 3U27A 3TAPA 3FEYB 1WTFA 4CT8A 3UO0A 1EP4A 4WF9Q 1RTHB 3TWZA 4N76A 3OUYB 2EKNA 2Y1JA 3TI0A 1TKZB 1IJFB 1HWJA 2V8GA 3GCWP 4C3MA 3KJFB 3IP0A 5F8MA 2WTFA 3RG6A 4QWAA 1NPRA 2ZKUA 1RT5B 2DEJA 3Q2SC 4K7QA 5D4LA 5AT1B 1M0SA 3RRHA 1VQ9S 3R5CA 1IBLJ 1URNA 3B6BA 3NWGA 4B3MJ 2WSCC 3VZHA 5BYSA 5KFNA 1SKRA 1RHRB 5J1NA 2FVRA 3C6TB 1TL7B 2V50A 5B0FA 1XR7A 3C19A 4JB8B 5JVHQ 2CG8A 1J5OA 2FZKB 1HQUB 1REVA 3CO9A 4LF7J 1TVRB 1IM4A 4KY3A 3AD9C 1VQLS 2J7UA 2IY5B 5F8JA 1N36J 2RRAA 3NOGA 3CD0A 3DRXA 2LQ8A 1HKAA 2P8IA 2AJ4A 4K2JA 4KGVB 3RRKA 3UI3A 3UD3P 1LV5A 4DSIA 2BRLA 2KZMA 2LCWA 2VG6B 2KI2A 3D66A 3A1YG 3IA0A 4YDDB 3AAWB 4IKAA 1ACMB 1F9FA 3BGRA 5FLXY 1HBMA 3PW0A 2XYGB 3QLHB 5KFYA 2HHHF 1C0TB 3JSMA 3L3CA 1RU2A 4K4ZA 3IMQJ 2DNRA 2FHJD 1YRUA 4OZ5A 1Y4ZB 2OD4A 3CJTA 1X5PA 3MMBB 3TVYA 2VZ9A 3MEEB 1BQMA 3MD1A 3IM8A 2G2ZA 4BWMA 2C2RA 1M90T 4LF4F 3IWNC 3K0JA 4L73A 1HYSA 4K5SA 2GHWA 3E51A 3W8PA 5IQ6A 5KFMA 1HNWJ 1R0BG 3D6TB 3Q8UA 2JVRA 5DO2A 4DPYA 1HWLA 3TW0A 3MM6A 4G1QB 4S0MA 4P75A 5C25A 2ZH3A 1RTDA 4FNHA 2V2ZA 4LSNB 4QW9A 2E9RX 2ZBPA 3QFWA 2R7QA 1S0NA 5EGYA 2ASDA 1VQNS 5DM7Q 2OELA 2YVSA 1JKHA 3ENAA 1CLFA 2YNFB 4B3OA 2K7JA 1EP4B 4RW9A 2MQNA 3KUEA 4EU0A 2IBKA 3OR2B 2I1RA 1M5KC 1VR6A 1HHQA 2YKOA 3DDNA 4LBPA 4ID5A 1U8SA 4DV2J 3PO5A 1OQ3A 1Q8IA 2CQPA 1Q53A 2GQ2A 3GG0A 3QIDA 2YKNB 3BBFA 2RU3A 4L76A 3HSDA 3W2WA 2V4RA 1T8EA 1APSA 2HNYA 2VKRA 3RAQA 4CH7A 4YMEA 3NOCA 2FC9A 2ASJA 1Y3KA 3ENVA 2ZBIA 2N82B 2AW0A 1Q7YT 1NB2A 3ETMA 3KG4A 1Q5VA 3QATA 4CLZA 1NK0A 4NYOA 2AF6A 3LGNA 4Z7YA 2N4CA 4P9SA 4X66F 5IQQA 2VOPA 2YKMB 3U1LA 3L4BC 4DR1F 1F9EB 1A7GE 1NLKL 1TVRA 3CDEA 3FEXB 3FGVA 4HHJA 1NH8A 1S6QA 3I4HX 4J90A 4M5GA 4USTA 3ZZOA 4D3HA 1TK0A 1M5SA 3KJNB 3DCAA 2MSTA 2OSRA 2JC0A 2W8LA 4B9VA 4JI8J 1WG1A 2ZH7A 2IMWP 1N5SA 1YJVA 5K8OA 4UOGA 1M5HA 2U2FA 4MT1A 3V4IA 2Z56B 1HNIB 4RUAA 2FVQA 2CVEA 2N7YA 3MPVA 4FKYA 2OFGX 2V2KA 3T5JA 1JJCB 1ZYQA 2DR6A 2GO8A 2V0NA 2BANB 2NYHA 2YNHB 3BKUA 4TYAA 1MSWD 1G3OA 2DGXA 2GVZB 5KG2A 5CABA 4F25A 1WG5A 3D6HB 2DR7A 3FRZA 1GMWA 1GX5A 2C3OA 4Z2XA 2VL1A 2DHHA 4FYVB 4MK8A 2Z2LA 2IMOA 4MYUA 5ADZA 1REGX 2GO9A 2MQPA 1U1PA 1YJUA 1GAOA 4KE5A 4U96A 4QCLA 3CVKA 5A8KB 2QLWA 5E3PA 1LW2A 2FHMA 3ILOA 1WD6A 5CYMA 5KG4A 3ZNJ1 3HKZD 4DU8A 2HRTA 1S79A 3CDUA 4I2QB 3M9MB 4DV2F 1T9TA 3HHEA 3M6VA 4DG1B 5IM0A 4C8KA 3EVMA 4K50A 2DCLA 3C14B 2GHPA 2HFUA 2FJAB 3MOZA 4AD6A 1VC6A 2OMOA 4N8NA 3R5GA 2WW8A 4OI1A 5KTQA 1QLNA 2H65B 2V5HG 4WIQA 4TXSA 3JYTA 3K5OA 3M8PA 4OYBA 5AXKA 3UFCX 4ZJLA 3WBZA 3VVTA 3W2WB 2R8KA 2DRAA 5THWA 3EE3A 4OX6A 4BS2A 2MQMA 3A8IA 1HARA 2YKQA 2G2YA 1WELA 5KFSA 3NCRA 2XQCA 4QWEA 2V9KA 2BW7A 4LF4J 3MEDA 3P5BP 3T19A 4FXWA 3D0IE 4WZQA 1IR2A 3FZ2A 3FK4A 3Q8VA 1S77D 2XLKA 1YZ6A 3W8GA 3M1VB 1S49A 4I69A 2FGCA 3KDOA 3U02A 1DZ5A 4OI0A 1G7CB 2W2MP 2Z4PA 1GK8A 4CLSA 3BO2A 2Q1LA 3AD8C 1WHXA 2F8MA 1WNEA 4N56A 5KT6A 3CULA 3NWRA 2NLWA 2VV5A 1P6TA 4CM0A 5HQLA 2UUBJ 1TV6B 1TL4A 4BWJA 4OX9J 1JWWA 1X0PA 3CEDA 3TAQA 2B6AB 1QE1A 2QLFB 1B0PA 2R9LA 1QY7A 3BB5A 4GO5X 2P5VA 1NK5A 1RT4A 2FVSA 5GMDA 1W2IA 1CS4A 2V8PA 4DUYJ 5F9NA 4LF7F 4FYXB 2XS2A 4UZBA 3QO9B 2VHGA 4X62J 1NHKL 2Z2MA 2XMJA 1NPKA 1BGXT 2QA1A 2B9EA 2CJBA 2ZFHA 3QT5A 2MGZB 2F4VJ 3CNQP 2UXCJ 1QUVA 4B3MF 2J0SD 3GYGA 1UJ6A 2E5IA 2DKOB 4DHVA 1NSAA 2LQJA 3CJSA 4ZP6A 2AJ0A 3O8WA 1TQLA 5K14B 3MUMP 4QW8A 1NZAA 3I0SB 3CF5Q 4LF9J 4AE5A 2CPJA 1FRIA 1VBKA 2H51B 1H7XA 4ANEA 2ZHOA 5J2MA 1V5IB 3TAMB 2X1FA 2IDEA 2PO4A 2R2RA 1UZHA 2O5DA 3ZZ0A 3DOMB 5SUHA 1NJXA 1NJWA 4C8OA 4Q8FA 1Y11A 3A3OB 1U25A 2M9KA 2DNOA 2UU9J 4M5DA 4P52A 4RNFA 1IQZA 1U24A 4RU9A 1VYAA 1WACA 2J9DA 3GR0A 4ELVA 4F02A 1NK6A 5A2QU 1UVNA 2FJDB 5HMXA 5GAGU 1EIYB 3ZO7A 1TKTA 2LEPA 2HPUA 4F2RA 4JI8F 4UY8T 4JI3J 1F5AA 2ZC3A 4CO0A 4EEYA 5ETMA 2VPZB 3MMAB 5JMNA 1U26A 1BD6A 4ZPVR 3Q83A 3NXZA 4Y2MA 3OPKA 1HBUA 3VZIA 3KK2A 3T3FA 1SKSA 1DAXA 2Q66A 2VUGA 3RUBL 3BDPA 4F3QA 1SJ1A 2GIQA 2YBVA 3FFIB 4X66J 4QU7A 5KFQA 3EPGA 4B3OB 2HMIB 1JLBA 1C4AA 4QR0A 3PR4A 4F8RA 3R3TA 1ZS6A 2OPQB 3Q8RB 2H4WB 4PG8A 3AXKA 3AA9A 3GE9A 3LANA 4OYOA 4UW2A 5L9NA 4GKJF 5HSPA 4M5DB 3PACA 3NCPA 4MK7A 4OYWA 4DV4F 4F4WA 1B3TA 4ES3A 3PEHA 1SV5A 2XB2D 3LQVA 1JIHA 1TL1A 1F3FA 1WC1A 4J91A 4JBCA 4EI2A 5C7PA 3H4DA 4P2FA 2XMKA 3GYNA 4P2SA 3K59A 2KXHA 1XTZA 2NCKL 4KYZA 2DIUA 1N33J 5J2MB 2HHWA 3IBCB 3VGVA 4CLKA 1HBUB 3K58A 5EX3A 4CLFA 3ZTOA 3N0VA 3HFKA 3M7VA 3PKYA 2D3ZA 3MCNA 2DR5A 4NXNF 1BWEA 5KFLA 2HFZA 3LF0A 3BO3A 4NLVA 4WFYA 1NK7A 4KGMA 1U1KA 4DPWA 2GGPB 2NXCA 1F2HA 1EQMA 2NXJA 3M8QA 4AFFA 3R5JB 3GLJA 4KSEB 4P7TA 2R4FA 4DR4F 4IFVA 2CWXA 4DQQA 1WC5A 1RT6B 1WKJA 3Q86A 2FB0A 5KFTA 2HLTA 3ET6B 3WX4A 3POTA 2CPYA 3TANA 1G1XA 1JMTA 2DY1A 1DHMA 4WP9A 3DOMA 2MHNA 3QIPA 2GMJA 3LUYA 4LUBA 3S7RA 4NLUA 1NDKA 2LDYA 2Y0SD 3MURP 4LFBJ 1CQMA 2CJAA 4I7FB 4X4OA 4CO2A 1MU2A 3KYLA 1TL7A 2O66A 5D0HA 4GC6A 1Q86T 5L38A 4PEOA 5D0EA 4DL5A 3LP1B 3FBEA 2IM0A 2OUGA 1N5YA 3GPAA 1DTTB 4J9UE 1I1GA 2AP6A 2RUSA 4LREA 1S57A 2GQQA 2NR0A 2OPRB 1X8DA 1RBOB 2A6OA 4C3LA 4ED2A 4R0JA 3DHXA 3DRRA 1N36F 1YDLA 1TKZA 2OHDA 2GVDB 5KT5A 2W1BA 2BE9B 3BGUA 2MZTA 2F3JA 1T0TV 5IV3A 2JDJA 4FKXA 3F0NA 1ZH5A 1YRTA 3FC9A 1HFEL 2AGOA 1DBDA 4DX6A 2J7KA 2KHCA 1RT3A 3P5TL 3PW7A 3TX0A 4FN5A 3DOLB 3OQ2A 4NXMJ 4ZVRB 2Z2YB 3W2VB 2ZWOA 4CT9A 2MJUA 4ZLLA 1K44A 4HEA9 4LSLB 4ID8A 4ZIVA 3M2UA 2ZC4A 2RUGA 1N32F 4LR7A 1RXOB 1RLCL 4WYWA 5KFGA 3RB4A 1RZMA 3DLGA 2HSEB 1N32J 1JXVA 5IFMA 5L1KA 1IKYB 5D15A 4LF8F 2AEJA 1FJ7A 3B4DA 3A8EA 2AT1B 3CW2C 1RTZA 2JNJA 2KRRA 2CZVC 4L3NA 4K8RA 3TARA 1T9VA 2YKPA 4P73A 3TQ1A 2OIHA 2GNKA 3R2CJ 1KOHA 4J9RA 2PSZA 2M4MA 1XK8A 3OR2A 4OYMA 1K8AT 2YWFA 4HH1A 4GVBB 1FT8A 3JXOA 1FKPB 2RJZA 2V63A 4O4GB 4MYTA 2X51A 2WOMB 3ELHA 2FLNA 3TA0A 1RTHA 1YKWA 4WXWA 1KHVA 3X3UA 1P9YA 3ETOA 4KFBA 2N3OA 4NLQA 1ZA1B 1MWYA 1NSKL 2GIFA 2R2TA 4W98A 3HF5A 3B8HA 3ITHA 2GAHC 1DRZA 4WKRA 2K2PA 4PR6A 2FLPA 2QYGA 1VBZA 1O5JA 2MQQA 3IO1A 3MPYA 1H2UX 3JSYA 4I7FA 3T41A 4YS2A 4ED5A 4B17A 1UAWA 2MLYA 2W2OP 5CAAA 2XMAA 1ICEB 1YGYA 3UDVA 4U7UD 4FYWB 4HDGA 2YKMA 3BN7A 1H6KX 4DLEA 1UWBB 4MTPA 1QVFR 4XAKA 3RBXA 3T1AA 4LFBF 1I5OB 2KB2A 4NLWA 3CJ2A 1RJJA 3Q2TC 4O3QA 4ECVA 1LWEB 3MPUB 4CO4A 2KFZA 4GVLA 2W8KA 2VC0A 4GVBA 2BJDA 4OV1A 2YXLA 4O0NA 2K8GA 1RLDA 3NNAA 1VIOA 5LSLA 2VG5B 2OMLA 3QNWB 4W92B 5GAEI 1T05A 2M70A 3HFVA 2PMZD 4FPRA 2C28A 1XR6A 1EETB 4A8FA 4NA2A 2EK6A 6AT1B 4NXNJ 2OPSA 3FSXA 1IM6A 4UY85 2FTRA 1CC8A 3HHLA 4X65F 2LLZA 2VKZG 1J5OB 2UP1A 1S76D 2C3YA 3UCGA 2FLLA 3C6TA 3PTWA 1GMVA 2HVDA 2FY8A 4OI4A 3T1HF 4M5NA 4WBFA 5C24B 4DSJA 4LSLA 2CVIA 2F9JA 2VA2A 1DURA 9RUBA 1RT6A 5JUMA 2XY5A 1P1TA 1X4BA 1AB8A 1FESA 1KQGB 2XNQA 4MFBB 5CYMB 1IBMJ 1CJKA 3LWLA 3QRRA 2RB7A 2CPFA 4WFAQ 1FNMA 5I3UA 3FJ2A 2MKJA 5A6WA 2Y8YA 2ZWPA 1B0VA 3BGOP 3DGPB 3TP2A 4U95A 2G0IA 4WTYA 4ILMA 3R5AA 5KFDA 3GQCA 2UUAJ 3NL0A 2DR9A 1X5OA 2PC6A 3TEGA 3KLEB 1NDPA 2QIFA 3MR7A 2QL7B 3KLFA 3CE8A 2BACA 4AXIA 2MKSA 3F41A 3M30B 3KK2B 3B4MA 1U2RA 2OPRA 3EPIA 4R0EA 4DQRA 1XQIA 4KR0B 4DR2F 1KC8T 2E7XA 2XSFA 2WVEA 1SJQA 2DGUA 2FDNA 3JQMA 3K8WA 5T41A 3H98A 3GWCA 1T3NA 4FBTA 1Q95G 1SJFA 3KNGA 1PO6A 5DDPC 3M32A 4DFPA 4Y28C 2AX1A 3PJWA 4KBIA 1XMOF 4IRCA 1U7LA 4K59A 4WFBQ 1SB6A 1C1BB 2FJWA 3T6BA 4MK9A 4CLLA 4DZ6A 3D0HE 1IKXA 1Q79A 3IM9A 2V4JB 2OPSB 3DRYA 1UP1A 2K3IA 2OPPA 4H4KC 4ZVFA 3ULHA 4C48A 1ZZNA 1S9GB 3UN3A 3QZ7A 1S72S 1NEEA 1XMBA 1OJ4A 3CJ4A 2GAGC 3UDEA 4Q2LA 4OLPA 5C42A 4LIRA 2V8DA 3BGRB 1H3DA 1VC5A 3Q8PB 2JEGA 1UA1A 4EZ6A 5DG9A 1O0PA 2MKKA 4IQMA 1BXNA 1R6YA 2ZBQA 1HI1A 2ZE2B 3LAMA 4LRAA 1X5TA 3ZZRA 3AOBA 2VPXB 5MLCV 2MGZA 3SSQA 1FDDA 2XM3A 3M8WA 3E01B 3HM9A 3V6DB 1LEOA 2UXCF 4KHPJ 3FCWA 1NKEA 2MQLA 4ZP8A 3UR0A 4X62F 1RTIB 3A12A 2O1PA 2DHSA 1BY9A 2YNFA 1TUWA 3G96A 2HRUA 4ECWA 4HYKA 2Q43A 3PKMA 3MEGB 1RTJB 5K8NA 4RZRA 1P8GA 4TKTA 2B0GA 2CPHA 4J9PA 1RWMB 1QDUB 5ETLA 5M2PA 4ZDNA 1QSSA 4GKKF 3BYRA 4OMFG 4TU7A 2KL8A 2C3PA 2B8QA 3VGUA 2V8VA 3HMJG 2WZ1A 3DLEB 2GMLA 3OLAA 2EVZA 1DTQA 3OBIA 1KHWA 5IT0A 1L5UA 3DLLQ 3IR7B 4CO5A 4B9MA 2OSQA 2QN6B 3M1VA 4ECRA 1SBRA 3BQ0A 1HD1A 1PAEX 4JI4F 3MMBA 4RX6A 4C8YA 3N28A 1NJYA 3BGFA 3R2DJ 1KFSA 4Q0BB 2XHCA 4OHZA 3FDSA 3RGIA 2BR0A 4RW7A 4ZITA 2R7VA 1AZSA 1SQGA 5A6PA 2OFHX 3W7BA 4TU9A 3CC2S 1BQXA 3GFZA 3WQPA 1QE1B 2CPEA 3HP6A 4FS2A 2OP5A 5B0AA 5KFIA 1QAXA 5DG8A 2ZD1B 2ZH9A 4CM2A 2AMCB 3GILA 2B7BB 5LM7E 2ZJRQ 2JX2A 2HZCA 1XR5A 3MR5A 3O3LA 4IYQA 2QFIA 3KLIB 3Q8YA 1OSDA 3R8YA 1RT1A 4YY3J 2R7RA 2D1CA 4DLGA 3SCKE 2OEKA 1UPPA 3SYZA 1FKAF 3M6XA 3VALA 1DTQB 2FVPA 1REVB 1HQUA 2R7WA 4DV7F 2HHQA 1C1BA 3FBFA 1NJZA 4ZVUB 1HQ2A 1MMDA 1I51B 4HACB 2E1CA 1UVIA 1YX2A 1RB0A 1VRQC 4FVCA 1C1CB 3IG1A 3KLHB 1NK9A 3MOJB 5E33A 3V5RA 2IM1A 4AYBD 3HXMA 3NGKA 4RW4B 5LMNF 4RNHA 4F0MA 4R8UB 1J5EJ 4B3SJ 1FJCA 1TR0A 3UN2A 5J1EB 1VQOS 2BANA 1R6VA 3OTOJ 4U67Q 2DGQA 1FTCA 2CJYB 3AHPA 2VU5A 5HJYA 1XBWA 3FNNA 2CJQA 2HURA 2IM2A 4F4XA 2JWNA 5HJXA 3BKFA 3OJSA 1T94A 2HIQA 4KGXB 3P6YC 1T9WA 4C8NA 4E0DA 3SCLE 3PG9A 1JJHA 3BSNA 3MM9B 3H20A 2GJ2A 4YN3B 1T7PA 4OHYA 2BQUA 2B9XA 1YLXA 4PXDA 2NSCA 3R1LA 5A76A 3ILJA 1RTJA 3QYYA 3D2WA 1EARA 3CCTA 1X4DA 2WBMA 1JLQB 1T3OA 3NGRA 1CJKB 3KFWX 3OFFA 2V94A 4C11B 1H0HB 2PMHA 1P1LA 1SC1B 2L08A 4IOBA 3ET6A 4IR9A 4CI0B 1WHVA 2HBQB 3VVUA 1RAAB 4YEAA 3QWPA 3ADAC 3GSDA 4WU2A 2RSQA 2CJKA 1Q8KA 3FCHA 3SDEB 1TMMA 3H2LA 3VAMA 4LQ9A 5KT7A 3H2VE 2A1BA 5B0GA 1UEKA 3DOKA 4NCBA 2QV6A 1CJUA 2B43A 2ZITA 3PDNA 2YKNA 4TLQA 1KQSR 2D7SA 2MZRA 5ETRA 5F8HA 2VODA 2VJUA 3O6QA 1FRMA 1ELOA 2W24A 1S1VA 2LKZA 2M8DB 1BLUA 3TZZA 3BSOA 2L41A 4YB7A 2D3O1 5KFVA 2D74B 1VBXA 2HRYA 3DNCA 3K57A 1BQNA 5KFEA 1RWWB 1PJ6A 1BHNA 2XEXA 3PCOB 4I68A 2CADA 5CQGA 1Q4RA 4LRDA 1R27B 4DZDA 1U45A 2ADBA 2PN6A 1XN9A 2AV5A 1TFWA 4NLSA 4G3IA 2AJQA 1RT3B 4MFBA 2JLFA 2HEKA 2UUTA 1U1OA 2I8EA 3MMCB 4IG0B 1NCLA 3M30A 2QL5B 3AJ1A 4Q7AA 1HYSB 4DR3F 3FSYA 4J7CA 4TVAB 4LRFA 2HFVA 3VAGA 3I4PA 2HK3A 4Y3CA 3O5TB 2LXUA 2UUBF 1VCTA 2LFVA 2AQ4A 4JI0J 3QJJA 4C98A 2R7UA 1YRXA 3J7A1 2ZJQQ 3LP2B 2MQOA 5ETSA 1LW0B 1FE0A 4DF8A 1AW0A 4J9LA 1VISA 4LF1A 4ER8A 1AYEA 2QMUB 3NG8A 2JOQA 3DOKB 4B08A 1K9MT 2HHHJ 2X1BA 1IKVA 3ZC4A 2CUYA 1KWMA 1PYOB 2MMYA 2P9CA 3KOAA 4ZPCA 3SSSA 1S5ZA 4ECZA 2BBEA 3F44A 3R27A 2I38A 5EX0A 3DYAA 1C1CA 3IG1B 3VCDA 1XNQJ 5IT9U 1OPZA 2G0JA 5CXTA 3T5HA 4PXEA 8ATCB 5FJ4A 3IR5B 2VOOA 3KJVA 2N4DA 3TVZA 2YX1A 3MPWA 3B82A 5DQGA 4CH1A 1URRA 2WVDA 1IBKJ 4PCQA 2CWKA 2X1GA 5KT2A 1CC7A 2MEWA 2V69A 1UVKA 3N4WA 3LPEA 3NP5A 2WW4A 3GSIA 1R8PA 3DDIA 2LQ9A 3SFUA 1CEZA 1UFLA 2BKNA 4NOHA 2LDIA 2JZ5A 4X4TA 1YBUA 1B4SA 2GA7A 3J81j 1HPZA 3MI7X 4MH8A 7FD1A 2DRDA 2R3VA 1HBOA 3GIIA 3T9NA 4DUZJ 4A8OA 1LWEA 2BM0A 4M94A 1FA0A 2LMIA 1KVIA 1S1WA 1QJHA 3DN9A 1FWLA 3PJ9A 2C22A 5J2NA 2V8HA 2QSFA 4X4RA 4ZPDA 4DQPA 5CZXA 2MKYA 4ZIWA 2Y0BB 3BM7A 2XG8A 3J7ZT 1TL1B 3D4JA 2BQRA 1HBNA 1VK3A 1RAFB 1WOSA 5FIIA 1AA1B 5GMEA 1IBKF 3P45B 3QGPA 1HWIA 1PJ5A 4ERDA 3V6KA 2EKYA 3JSBA 2HW3A 4FYDA 2LXIA 2JEJA 1F3VA 2HNZA 2MLXA 4RW6A 4UZCA 3JS9A 3T6JA 3VQTA 2XLIA 1Q81T 2BJ9A 2RT3A 4YB6A 1Q1KA 3CB4A 1TUVA 2JJ4D 2NXUA 2ZZTA 3EDRB 4EUVA 5HROA 3MM8B 4K0KF 2RKIB 5DETA 2ZH8A 3S8SA 5BYRA 3T9ZA 4AQYJ 4M5IA 5AJ3J 2BABA 1YWXA 1LOUA 2F63A 3IGVA 3NKYA 3EUNA 1KVJA 4KJIA 4Y0FA 2D9PA 2ROPA 2ZVSA 5ETNA 4FF2A 1OO0B 1RAGB 1TP7A 2BE7D 1AZSB 2BJ3A 4F3MA 4HI1A 1TKDA 1X9WA 1HQEA 2DTJA 2XYPB 4V19J 3DLGB 1SC4B 2JFKA 2VIHA 4IR1A 1XNRJ 3SQGB 4RNMA 5LMUJ 2O67A 3D5MA 4NMXA 4PPZA 3AJ2A 1V3SA 1DQAA 5HBMA 3W2VA 3EYZA 3RBEA 1MNEA 2HZVA 2D3UA 5HLFB 4KPCA 2VFTA 1RBLA 1QD1A 1KLMB 2FHKA 3CGIA 3EDQB 1N5VA 4Y2KA 1HHSA 2F40A 3L09A 4JI6F 1FFGB 1YJRA 3I96A 3VQSA 3MR6A 3UD4P 5KFKA 4DUTA 3GONA 4AL6A 1FJGF 1U2FA 1WF0A 2LEAA 2PEBA 4C0BA 4ECQA 1F9HA 1NU4A 2F4FA 3O44A 3W63A 3HT3A 4A8KA 2VICA 4F0HA 2ZDOA 2C2OB 2EW9A 1RT5A 2R7OA 3X1LB 2ZEJA 2ALYB 5DDRC 1R3NA 2FVCA 5F8NA 3POTB 5HK4A 1WKLA 2OKQA 3OUYA 4ES2A 3KK3B 3DLKA 5A8RB 4XDDA 3V4IB 2OD6A 3W3SA 1IWGA 1KD1T 1NBEB 2M88A 2O3DA 5KFXA 4AT1B 4QIFA 1RUSA 2A10A 2C1EB 5HVHA 4M63A 2ZVIA 4KGZB 4OV6A 4Z7CA 5JVGQ 2DCUB 2DNNA 1RWNB 2WSEC 4ZHRB 5L8RC 3MFHA 2E7VA 1WG4A 2V4JA 3LALA 4ZPTR 4DV1J 1Y7PA 2IPOB 1RT2B 2QTWA 2ZUGA 2HGMA 3LO3A 1FFWB 1BUXA 1X7VA 2KM8C 3NGSA 3G8QA 5KFZA 1LFPA 4KT0C 3DMJB 4DL7A 3HVAA 4QR1A 1FFSB 2W9BB 4FF1A 4Y34A 3D1OA 4N41A 5G0RA 3BREA 3D7SB 5B08A 2RQCA 3PIPQ 5F8LA 2YX7A 3W65A 3UNYA 3QJLA 3GMGA 2ATCB 4DV3J 4AL7A 2HHVA 2OEMA 2CNKB 3LP2A 2B51A 3IRXB 4ILRA 5DQIA 1CQNA 4I2PA 5HVFA 3B78A 4RW8B 3CJ8A 1NXIA 3MFIA 1J2VA 2HFOA 4DN0A 3J81U 1VBYA 2MXYA 5D0RA 4IG3B 1Y9OA 4KHMA 1HL6A 2L9NA 3D28A 3DKDA 3N5FA 1RCXB 5KG5A 1CJTB 1OYEA 2MKIA 2M2BA 3UN5A 1KOOA 2PIIA 4OI2A 3DGPA 4A48A 1HR0J 2DNPA 4HR2A 3CUNA 5H9EJ 2OTLS 4ZP7A 3D1QA 4TQRA 3BR8A 5DLGA 3RW7A 4H4MA 4LT6A 2I2YA 1HLWA 3F56A 2DO0A 4O3NA 4LFCF 1LWFB 1RQ0A 3ZXWA 3HSJA 3OD2A 2E5LF 3T1YJ 1OY8A 1DY3A 5IC6B 2V34A 5B0BA 3K7RA 2EK1A 3OFEA 4PWDA 1FERA 1VQSA 4ZJQA 1XMQJ 3DLKB 5A8RA 4USIA 1NNDA 4Y2CA 5LL6d 5KFRA 4DR5F 3RBZA 2GCFA 1RHMB 3M9OB 4JI4J 2DHGA 4ZPWR 1B0TA 5F0UA 4DWIA 3O1LA 4KQZA 5LJ5Y 2WVCA 4NX9A 2YNGB 2L9DA 2QYCA 3MAAA 4UF4A 4W4MA 4F67A 4X64J 2XMUA 4NCGA 2FPHX 5KOXA 1XMQF 3UE2A 4ZN1A 1T9XA 2RS2A 3QO9A 3R7NB 2Z2ZA 1VQ4S 2JRSA 4JI2J 2GS8A 1J27A 1XIQA 2CJXB 4LFAJ 3W64A 2HS0A 2D9OA 3TZYA 1WF1A 1NB7A 4LRCA 2CPZA 1ZAXA 2DNHA 4ILLA 3M2UB 1GMWD 3P4UB 1FK9A 3DLJA 2CDQA 1WC0A 3R5BA 5KFAA 4ZN3A 4KHPF 3BKTA 3D1HA 5IWAF 1UFWA 1RTDB 4JI5F 2V2QA 2APOA 3DXSX 1IXKA 1XERA 2J9EA 2NZ4A 5HMYA 2IBOA 3FQKA 1L3VA 1X4GA 3GU0A 4NLRA 1Y5IB 3G6XA 4DV6J 5ETKA 4K4WA 1YQHA 4LJMA 3OJUA 2DB1A 2NZCA 4DPUA 2CZ9A 3DI6A 3VAHA 2F7VA 5CCMA 2GVZA 2KVIA 3CJ5A 4QIGA 2YKAA 2RQMA 3MEKA 4PAAA 2MZQA 2EG1A 5T7LB 3AT1B 3SQOP 2B6AA 4CLWA 4JV1A 2VG7A 4R25A 4O23A 3S6EA 1U09A 4KGKA 3KLHA 1VQ6S 2DBBA 1RWVB 4IFYA 3DM2B 1M5OC 4I6YA 4XIUA 3J7YU 3ONQA 3PHEA 2DH8A 1XC9A 3W62A 4ZVEA 1HI8A 4MKAA 4QIWD 4C0OC 1PSDA 3UQSA 4DPOA 4Y00A 3KWMA 3MDFA 1O6XA 2IAJB 2KKHA 1K1QA 1RTIA 1PYSB 2MDAA 3PR5B 3T5KA 2P9EA 2NSBA 2KYXA 4MIBA 5KFFA 3FBBA 4ZCIA 2G9OA 1RHUB 4WKYA 4A4JA 1U4BA 1VQKS 2J6SA 1SC6A 3SCJE 1SKWA 2QLBB 2HVZA 1MW7A 3MF5A 3PEJA 1HW9A 5A8WB 2E29A 2E1PA 2F65A 1W26A 3E8OA 3UW1A 2UZAA 4NCGB 4G1PA 4RW7B 4ELUA 1NKCA 3R1HA 1K0TA 3SIPB 1P27B 2HNYB 3CDBA 3NGTA 4TY9A 3PY8A 3I32A 1N52B 4QWBA 5HQ8A 1HWKA 3C14A 1H7WA 3EM1A 4Z37A 1RYSA 4X4SA 4N5SA 1CJVB 4OYPA 4ID5B 1KLNA 2RRBA 3HHNB 4PWDB 3G86A 2BKPA 4NA3A 3ZFVA 1SPBP 2UV8A 2GX8A 4X2BA 1D09B 5DDQC 4DN9A 1SV5B 4CQ1A 1X0FA 2QC3A 1R8AA 1X31C 5F3ZA 2H4YB 3HVWA 2C2NA 2DD8S 1CULA 1RWPB 5I42A 1S6QB 2F8HA 2WBRA 3PXGa 3NNHA 1AROP 1YZ7A 2LA6A 1FRJA 2HNDA 3G82A 4FS1A 1PYTA 1R8HA 4ECSA 3PX4A 1FE4A 1S1UA 1SI9A 1MWZA 2IJFA 3DHWC 3EVOA 2KHDA 1RHQB 2HMIA 1C0UB 1MN9A 1RAOA 2B5JB 1CJVA 2YWWA 3OTEA 3ILLA 4Y6IA 4JUZA 5K8MA 1O51A 1RA6A 3NS7B 5E2QA 2CQ1A 5HP1A 3M8QB 1WDDA 3V2UC 1VI7A 1T11A 1N4LA 1N6QB 2UUCJ 5CCLA 1SQFA 2AIRB 2ZOFA 4J9KA 4PKDB 2DO4A 4I2PB 3TRGA 4RNOA 2DVIA 2BJEA 4PG5A 1YHQS 3FCVA 3LAKA 2WVBA 4YB5A 2QLXA 4WFZA 2R7TA 3CC4S 3D6FB 3FMWA 1IQTA 4U6PA 5E3CA 4ZVSB 4IOCQ 3I9ZA 1V3RA 2VBYA 2HS4A 3CCZA 1SUQA 2QJ3A 3DDKA 4PXBA 4AUKA 4ECYA 1D9FA 5G0RB 2U1AA 5K20B 3AJDA 1EKRA 1YJ7A 2B5JA 3RYLA 3ZZPA 4QYRA 2ZH6A 4QZVB 1UL3A 3MMJA 4OI3A 3MUTP 3K5MA 1VLYA 4DQSA 1QUPA 4DSEA 4IH7A 4J37A 3KHRA 2ZH1A 1NMEB 2VB6A 4NRTA 4M8LA 4F4AA 2UXBJ 2W25A 4I1TA 2E5JA 2NXNA 4LBHA 2AYBA 2FZCB 4ZVPB 3OTCA 3D54A 4WE1B 3UD5A 3H25A 4OJGA 3NEKA 4MKVA 3SMZA 1L3UA 3CDAA 3O2IA 2UUCF 4OYXA 2X7IA 1S12A 3VAFA 4JI7J 1Q7LB 3CJ3A 2G0CA 5RUBA 3CMQA 3PW5A 4P10A 3WC0A 3GJQB 1AFIA 2VJVA 4U9RA 2HAIA 3LTOA 3LWMA 3TR5A 5LSOA 1R43A 1MLAA 1TKXA 1IKWA 5M2UA 3MECA 2L9WA 4OHWA 4E2FB 3GV7B 3PYEA 4USVA 3SEOA 5KG1A 2XY6A 2IYGA 3A8KA 2C2KB 3N6MA 3THPA 3GTYX 3CJ0A 4YB1P 1M5PC 3CIZA 4IRDA 4LF5J 1S7HA 1HIYA 3AH6A 5C2CA 3DRPA 2ASLA 3E2EA 1N33F 4OX7A 3M2VB 1NJIT 4PQUA 2HLUA 2NPFA 2ASYA 4ES1A 4YP3A 5E7OB 1G2EA 1HNZF 4URSA 4K4XA 3D3CJ 3HFZB 1FNOA 4F4YA 2RQKA 2AKWB 3W60A 1F6TA 1YJNS 2QT7A 2RDDA 4E98A 4NI2B 5HBMB 1YVFA 4GKJJ 4N47A 2B3TB 2GIRA 1FWKA 3CJKB 1HBMB 2AD9A 2NS1B 4ZVHA 5L39A 3BF4A 3CJQA 1I94F 4C4WA 2N7CA 3F73A 1CJUB 1T95A 2BVZA 4PUOA 2AZ3A 1W25A 2PFFB 3I56S 2HVHA 4WIIA 1K1SA 1VQPS 1IJEB 4O3RA 2P9GA 1BWVA 5LSRA 2A2DA 3ISND 4Y2IA 1RWXB 1ZPWX 2JH3A 5IXUA 2CXEA 2XGQA 3ENWA 5G4DA 2VFUA 5DQHA 3RRGA 3OVSA 1TU0B 3MCMA 1KSPA 5CHCB 2AEFA 3D3BJ 1RT4B 4WP3A 4ZA1A 5KG7A 3ZNUA 4DI6A 2HGNA 1RT1B 4USHA 2AEMA 2YQ1A 1V5VA 1BE4A 4ZVGA 5HN0A 3B54A 2XLJA 4KB7A 3BO4A 4KPYA 2GZOA 5D6GA 3BQ2A 4I67A 1TTHB 3OR1A 1WKKA 1KP6A 3W5ZA 1GFWB 2XMMA 2MHEA 2CQ0A 5F3TA 4USMA 7AT1B 3KTQA 1FKOB 2MKCA 3MAQA 5F8GA 3DLBA 1X4FA 4JI1J 3CIMA 3MCSA 5EWEA 4RBTA 1HBNB 2ZNZA 4LF6F 1U2CA 4ZVQB 1PBAA 2BE2B 1HNXJ 1KKHA 2XZDB 1FVQA 3MXHP 1JB0C 3VWSA 3U1MA 2XS7A 2XI3A 1F60B 1X4EA 1UKUA 1KDNA 3QPIA 1HWUA 1RADB 4X4NA 3QJPA 4MIWA 3AY0A 2KTQA 2OEJA 4M1KA 2HKEA 3HULA 5HANA 4OJ3A 1GXLA 1SL2A 5AXNA 2W7OA 1DLOB 2DGWA 4PYAA 2PA8D 4KC5A 4ZCKA 4CH0S 1DTTA 5B09A 2PI5A 2GFFA 3OL6A 3JYTB 4A8XA 1JXEA 4HTIA 4ZVTB 4CTAB 2UVVA 4XK8C 4ZLPA 2X1AA 2ZM6J 3GJSB 3VAJA 4ECXA 1FRHA 4M5LA 1S9GA 4QIVA 4JI2F 4O44B 2JFDA 2CA9A 2XZTB 3OXLA 4IDKB 5CYQA 1B99A 1E6VA 2BRKA 5L9XA 2CAJA 1EHWA 2DGVA 5D4PA 3VGTA 3VAIA 4DV5J 1FI4A 2VH7A 3W9JA 4JYAF 4QPTA 1YI2S 4B3TF 4UT4A 3H7HB 5AJ3F 2BV3A 3HO1A 1OY9A 3IS9B 2HG4A 1U0SA 2OTJS 2NXEA 4QR2A 1OWXA 1QVGR 2KYZA 2AX0A 1CJTA 4B9TA 1HNVB 4HKQA 2PT0A 1RKIA 2MKHA 3C15A 2B4UA 4GC7A 4ANCA 4IG3A 1RYRA 1NDLA 3D0GE 1RACB 4KV8A 2YQ0A 1WC3A 2C2ZB 2CRLA 5E5NA 1IKXB 3OTBA 1FXLA 1OYDA 1Y10A 2NQPA 2GMHA 2FYXA 4EK2A 1AUDA 3SCIE 3TUIC 2EG2A 3M32B 2Z57B 4TQSA 1VMBA 4NLYA 3FSIA 4H4MB 3KJQB 3LH2S 3MEGA 4OZNA 2ZH2A 3H59A 5KFUA 5KAKA 4DR7J 1KLMA 4DL4A 1YSJA 4OX8A 1JLCB 3AB4B 2MSSA 2QA4S 1WEYA 3KXDA 5LOQA 4ELTA 4LF9F 5L1IA 1JLBB 3M4XA 2ZUAA 1NK4A 2E5GA 1NRKA 4LVOP 4FBUA 2XO7A 4WTOB 3W66A 1R7IA 5C24A 1BQMB 1WUUA 3ZZYA 4ZLJA 2HAFA 3SQGA 2H5IB 2MZSA 2F4VF 2W4PA 5K8PA 2EC2A 1Z2ZA 2QRRA 4B9UA 3HLUA 2J6TA 2J0QD 4DR7F 2PGCA 5L46A 2HQCA 4ZOSA 2BDPA 3CCES 2V68A 3QLHA 4ZCLA 2IVFB 4DUYF 2ATLA 3L7OA 3HVRA 3CCMS 1UVLA 4DR6J 1U0HB 2AYGA 1OS5A 2EFVA 4Q2MA 3JTPA 2ROGA 3BEGB 5IT9Y 1XNQF 1G6BA 3PX6A 3OHBA 1UW4A 5A0YB 2UVUA 4Q5VA 3DMJA 5HAOA 1B7FA 1T9YA 5JXSA 2BOPA 2IIHA 2IYIA 1UTAA 2CPIA 2VFRA 4WK3A 4N8OA 3AD7C 3J7Z5 1JLQA 4WXOA 2N3LA 5HVGA 4UQGA 2NUHA 1EETA 3M8YA 4B3TJ 4L72B 4OHVA 5K14A 2QMXA 2KH9A 4DV5F 2YH1A 2QEXS 2W9AA 4NLOA 2ZKTA 5E41A 4C97A 3MZIA 4BC7A 3KLEA 1S6OA 1SXLA 3W9HA 2OH2A 2HVEA 4B3RJ 4PABA 2W2QP 5B0EA 2IC3A 4LRBA 2LEBA 4NLXA 1VQ8S 3HHLC 1S1WB 5J1PA 5DJBA 2HQGA 4M95A 4O4GA 3CTRA 3BR9A 2VG6A 3K5PA 2VA3A 4ED4A 3DGVA 5A8WA 4H4OA 1TAQA 1HMVB 3AOAA 5H9EK 4JI6J 3N6LA 3RJMB 2WB1D 5KFJA 4QWCA 1ULRA 3GP9A 2CQDA 1UETA 3GFXA 3I0RB 3VAKA 4ZJOA 3QT6A 1U1LA 3WC2A 3ZTSA 1SJRA 2HIYA 4M5MA 2LYVA 5BJRA 1NO8A 5LMUF 5C2GA 2KM8B 2CNNB 4C8ZA 4USWA 2RF2B 1ITPA 1LNQA 2HBRB 3BN4A 3GFYA 4USJC 2RRNA 3JAMU 4DL2A 2I5JB 1IR0A 3DM2A 3H42A 4IOAQ 1DLOA 1SUQB 4TN2A 2EBEA 3L7PA 3UNGC 2QL9B 2Y1IA 2AYEA 2V9WA 2VC1A 2CFXA 4LR8A 4RJVA 5GAHI 2UV8G 3KK1A 1VJWA 1LWCB 1RT7B 1TL3B 3UCUP 1FDNA 3M8PB 1O8BA 4LF2A 1QAJA 5K9FA 2IDLA 2P2CB 2WVFA 4MMOA 3DI6B 3TUJC 4DPXA 4NASA 4K4UA 2KFYA 1VHFA 4OHXA 4EWTA 4ETXA 8AT1B 4DL6A 3CXCR 3R9LA 2V4QA 3FMBA 2B9WA 3QT8A 1U48A 1FJEB 3J7AN 2DGSA 4QYZK 1S1UB 1LW2B 5AXLA 3NNCA 3W61A 3DLHA 1RA7A 3G82B 2PI4A 4DR6F 4NYPA 3N01A 2LU1A 3MUVP 2CG4A 2RDJA 3UR3C 4OZ0A 2VBXA 4BDPA 3CCVS 1RI7A 2QX0A 3HHDA 4X4VA 2E66A 3PW4A 1OY6A 2IJRA 5LMNJ 3EVWA 4B9SA 1H98A 3HKWA 2R2SA 5D3GB 1I6JA 3V6JA 1WDTA 3KK1B 3EWGA 1IBLF 2AWZA 2AYMA 3I5CA 2Z58B 3FQLA 4OZ1A 2HBZB 2LP4A 1QTNB 2A3JA 1KFDA 2LVWA 2A18A 1HNVA 2DNQA 3M8ZA 4TLRA 4NCAA 1D0EA 1RGVA 1ZPVA 2HQFA 2IA6A 2QO3A 4HT5A 1Y5NB 1SCJB 1PIEA 2EXUA 1X4CA 3EGZA 2KG1A 1FEHA 1FO1A 3IS9A 1M1HA 4HL9A 4DOZA 2H54B 4YY3F 3C6UA 2HZAA 5H9FJ 4IO9Q 1B7YB 3W9IA 4ED3A 2C42A 1WC6A 3TOQA 4WK1A 3CCWA 3OFGA 4Y65A 1VRUB 3HZGA 3A13A 3FKBA 3PM9A 3V81B 1RT2A 3IBWA 4B9LA 4WYLA 4ITSA 4YHHJ 1D1UA 3P8BB 4ZPBA 4NE9C 2NYIA 2WAQD 3M2VA 2IAJA 3R97A 3SZ2A 2IRXA 2DNLA 3ILIA 3W1YC 5JJBA 1S10A 1RHKB 1S7IA 4X84A 4HI2A 5AE3A 3QRQA 1VC0A 4FF4A 3I31A 4TU8A 2F5GA 3OSNA 4EYIB 2VPWB 4J9MA 2KT3A 2ZBCA 1YITS 4F7VA 5BR8J 2EFOA 5HQMA 4LIWA 4MKYA 2GJIA 1OMSA 5CYJA 3GFHA 3UDLA 1N0UA 2FZGB 3RR7A 5FDLB 1LW0A 1GEHA 1R31A 2DT9A 4PPDA 4JI0F 1HW8A 3CDWA 4Q45A 1G4CA 3GG1A 4FPIA 1KEKA 1C0UA 1TELA 2AU0A 3C16B 2CQ4A 1JX4A 4RW8A 3THTA 4DR3J 4TY8A 3KLFB 3GYXB 1VFJA 2W4DA 2ZH4A 3CD5A 1IWAA 1ROFA 4I56A 4PG6A 1GX6A 3EJMA 3J81Y 3PZPA 1LWXA 3MMCA 2K06A 1ZTTA 1SL1A 3Q22A 1H2VZ 1U6BA 5HL7Q 1VRTA 4OLOA 5DGBA 4RO0A 1XEZA 4C8LA 5U47A 3VR1A 2GW8A 3NBPA 1WOPA 3DRSA 3SDEA 2Y3YA 2YY3A 3DU5A 2M5YA 1IKYA 5HLFA 3M8RA 3K8VA 1Y5LB 5EDWA 3HK2A 2B4OA 1FRKA 1N8RT 1JLAB 1WSVA 2AJFE 2YPYA 5KFHA 3K5LA 3V81A 1ZAWA 2GC8A 1U0HA 3ENQA 5GAHU 5BYQA 1U49A 5IS2A 4EZ9A 4I4BA 1JLEB 4DCOB 1RU1A 3A4TA 3RAMA 3QSIA 3M8SA 3CCUS 1NSQA 4A8YA 3RR8A 2YX4A 4AXJA 4R5PB 4RWWA 4JV5F 2MJNA 2EFQA 1T05B 4OZ2A 4NLGA 2EC0A 2V2VA 2YNGA 1QM9A 3LA0A 2CDRB 3JTNA 3MAAB 3OT9A 4KO0A 2XTJP 1MMLA 5MAOA 3MD3A 1XMOJ 2JLGA 5ETPA 4IQXA 3BH6B 4UOFA 1S9EB 1EZZB 4OYZA 5M2RA 2E1RA 2RH3A 4F4ZA 1SJ4P 1BMQB 1RK8A 2ACYA 2CPXA 2AGPA 1KQKA 1D9DA 2VQFF 4NZ7A 1FTRA 4UOCA 1N5YB 2BEFA 2G13A 2BJ1A 3BPDA 3I0SA 3PFOA 2POKA 1EJ7L 4PRFA 1GXUA 4BBYA 3JTOA 4DX8H 3MPDA 4H4OB 4CYUA 5DM6Q 3IRWP 2VASA 2HVIA 5I3QA 2KO1A 1DFDA 4HDHA 2GHVC 2UUAF 3PJXA 1IBCB 3BH7B 3TUPA 4RUBA 3BS9A 4NL5A 3TZWA 2A6MA 2RILA 4X4PA 3TA2A 1ZETA 1J5EF 4B3SF 2B56A 2JEIA 2WK4A 2E1MC 3GV8B 1FHTA 3M6WA 4DDFA 1FNXH 1D9AA 4PWUA 4UQTA 2VF3A 4TNOA 3Q8QB 1LWCA 4IO1A 2J8AA 4ETZA 4C0HA 3GIKA 1HNZJ 3KLVA 5KG3A 3NY0A 2ERRA 2L48A 2DXFA 4NWBA 2IVYA 1E6VB 2QFJA 1B64A 2RKIA 4RR5A 3VV2B 3QMQA 3OHAA 3MM5A 1JLAA 1TL5A 4LR9A 4OJ1A 4YR3A 1GXTA 1Q8BA 4NI2A 3NMRA 5IT4A 2C3MA 2X3GA 2ZZNA 2CQHA 4RW6B 1JLCA 4NPOA 4D3GA 1LXNA 4JI7F 3H5SA 3FUYA 3A3NB 1EAYC 4DX7A 3DOLA 4M5KA 4R5PA 2HBYB 3UDCA 2BOAA 4UUXA 2MYFA 5GADI 4ZP9A 2UXBF 1VJQA 1W7WA 2EFPA 3PFEA 2F8EX 1RDRA 2RD5C 4O0IA 3SSRA 2VQEJ 2XO6A 4DPTA 3MM8A 3KKFA 1VHIA 3MECB 1L3TA 4HH0A 1E6YB 2BZ2A 2XWXA 3UPFA 3MTKA 5FDLA 3BSCA 2R8GA 5D78A 1DARA 3KMQA 1JNRB 1H2TZ 3OXGA 3QZ8A 2HNZB 1ZM4A 4MJKA 1FEEA 4CNYA 4WE1A 5BR8F 2PA3A 3LGMA 3MGJA 2GV1A 4ICLA 2IRUA 2JC1A 4WWSA 4CP5A 2OPPB 4DFJA 1Z2LA 3TVKA 2J0XA 1QSLA 1KRPA 1RKJA 1PG5B 2B8PA 3QWUA 2HK2A 1JLGA 3FVYA 2CQCA 4L74A 6FDRA 1W2BR 1SQEA 1HHTP 1QSYA 1KTVA 3TJ9A 4KH0B 4TY8B 3OVBA 1SVDA 3D9BA 4NEZA 1NH7A 1CVJA 3D68A 4FP9A 2EI5A 4IFVB 4HVZA 4L75A 4ANDA 2MZJA 4CTAA 4ENOA 2ZH5A 4LF8J 5LJ3Y 3BPSP 2RVJA 3FZBA 3GR1A 4P7VA 5I3PA 1NKBA 1R8BA 2DISA 4LSZB 2ZOMA 7FDRA 2C2DA 3M6UA 5DGAA 1HR0F 5AXMA 2DGOA 4DUZF 3VHQA 4B9NA 3US5A 1CSJA 1V6HA 2AHOB 4V1Ak 4O3OA 1MMNA 2NUUG 4O4RA 4NXMF 1IVZA 1I3OB 4DV0F 2KT2A 3UWTA 4RW9B 1TK5A 4CO1A 3KJVB 3M05A 3QRPA 5KT3A 3RZAA 3LP0A 4CNZA 5J2PB 2V6AA 5I3UB 4A8QA 1VK8A 4OIXA 1BC6A 4NYZA 4HLBA 2OJ3A 2DR8A 4DR2J 1Q5YA 3CSKA 3MM9A 2YWEA 2JVOA 3MM6B 2E44A 5L1JA 1UA0A 2HHUA 4K4TA 3MAHA 2CQ3A 3ZTRA 3RB6A 1OQ6A 4DXLA 3KK3A 5F8IA 1FD2A 1FF2A 2VG7B 3N6NA 4LQ3A 3H40A 4H4KA 4QQBA 4DCPB 3AA8A 2VQFJ 2H1YA 1R0AB 2K1RA 2BJ7A 2QA2A 4HTJA 4DV1F 3H5UA 4RW4A 3V6HA 1FWPA 3RB0A 1NHVA 3CC7S 2VPYB 3EXCX 4PWWA 4LSNA 3JSRA 1HBOB 2I0XA 2K7KA 4O3PA 3QBCA 3DC2A 5ETVA 2Z30B 5F41A 1DQ8A 2L3MA 2VBZA 3I5BA 5DS7A 5LXYA 3BBCA 4MIAA 4OJHA 1KONA 2XMTA 2YQ3A 3NGDA 3THVA 2KDOA 4URQU 3KMSA 2RU9A 2KRBA 2NREA 2R8IA 1TZ0A 1XJWB 2YWKA 1UVJA 1AUSL 2DH9A 2J6UA 4RUCA 3PYDA 4QIEA 3JSMB 2YPZA 3VTIA 2IM3A 4F50A 1RT7A 1TL3A 1FJGJ 4J9QA 2EWHA 2XI2A 4JV0A 3TA1A 3WIUA 4FDFA 1UEVA 3QT7A 3I87A 3CMES 1N5TA 1RAHB 1YJTA 3HD2A 2Q6CA 1S1TA 5AE2A 4N7TA 3G71S 3QAUA 5L1LA 5IWAJ 1FRLA 1WSRA 2KU7A 4JI5J 2JHEA 2D3OR 1EB0A 2RE1A 2DNMA 2J8SA 1PJ7A 1EX8A 2JL9A 5B0DA 4FF3A 1UFKA 1OSCA 2XZWA 2DNGA 4P2MA 5F0WA 5EHHA 1R0AA 1XNRF 2UXDF 2KFNA 4EBEA 1YJ9S 1UPMB 1CS4B 1S6UA 1V9OA 2I9SA 1L3SA 4USUA 2W9CA 1S4EA 2ZZMA 1NM2A 1TUGB 1PCAA 4QPXA 1IUJA 3RU0A 3SV3A 1YTYA 1PAUB 2FUG9 4DEZA 4ED7A 3N79A 1F5CA 3OR1B 2CQGA 1KBRA 5C5JA 1WWHA 1RCOB 4XTTA 4ECUA 2LU2A 4K0KJ 1X5SA 2ILZA 1FK9B 4IH5A 2FD2A 4RWXA 4DR5J 3L7UA 4A46A 1E6YA 1SKUB 2ROEA 3HT0A 4OFZA 5F9LA 1S9FA 3JQKA 2K3KA 2ZD1A 4IRKA 2Q79A 3H8YA 3HHKA 2A0FB 4YHHF 1WTBA 3CD6S 3MR2A 4BCAA 5CD4H 1F1BB 4NRUA 4EBDA 4G65A 4WP8A 2KJVA 5D0GA 4DQIA 3C2PA 2NPIA 1N48A 4RLEA 3RTVA 3HSZA 3NS5A 2FJXA 3KG1A 3U7JA 3PX0A 4ALZA 5ITHA 1S6PA 2DXDA 2D41A 3GIJA 2Y9HA 4EGLA 2H5EA 1JLFB 5H1SV 2DJWA 1R89A 3MM5B 4F36A 3DLEA 1UJ5A 2BMBA 5GVQA 5T14A 3NBPB 1ZOTA 3D67A 4K2XA 1N54B 2ACMA 2P6TA 3CD7A 4IFYB 5C25B 3UCZP 1T03B 2MLZA 3TJ8A 3AQPA 3CO0P 3LGHA 5D4OA 4MKBA 5B0CA 2KZZA 1KN6A 1MU2B 1PGZA 2RMLA 1UWAA 2GJFA 2DITA 3TEHB 3KLGB 2P6SA 1HA1A 3S1TA 3MHYA 1PBUA 3CMAS 3ISNC 4ED8A 1UEUA 2E9ZA 2DNKA 2H3EB 2Z0GA 2HFNA 4DSLA 3C16A 2OGUA 2G4BA 5EWFA 2OI2A 1ZM3A 2IA0A 3BGLA 2BXJA 1IKWB 1TKXB 5GMKa 4DJBA 3EZ5A 1U47A 4V19X 4K4SA 3C15B 4C7QA 3DRRB 2E1AA 2HYIB 4Q8EA 4WZMA 2YH0A 4A47A 1KR4A 2IRYA 3IGNA 4NZ0A 4CYUB 4YR2A 1B70B 3AODA 2MB0B 2CIMA 2LQ5A 3AXMA 2ZNYA 3HDSA 4EFAC 3I6PA 4J9VA 1QAIA 1GH8A 3G8TA 4DS4A 3LP1A 4BLGA 3CPWR 4RU2A 2EFNA 4OYIA 4J9SA 1RWKB 3FRYA 3CCLS 4FXDA 5ETQA 2JLEA 2XSJA 4J5OA 3H2UB 1RHJB 1C4CA 1VQYA 4WJBA 2WB4A 3IAM9 3C66A 2W9BA 2CZ4A 3OV7A 1CBKA 1JLFA 2V67A 4H54A 4DL0C 1JQGA 3Q23A 1LK5A 2WCXA 2Y1LB 4KV8B 4EO8A 3GZ7A 3JB9k 3T5LA 4F4KA 5E0OA 5AE1A 1SC3B 3H5XA 3JQJA 2RIJA 4OQJA 2ZM6F 2J5AA 2RQ4A 4UOHA 3OSPA 3KNAA 1Y00A 2G2OA 2OPQA 3MM7A 1S48A 1ZZFA 5C42B 3HHLD 1KNZA 3Q8SB 2VDIA 3CCJS 2EFGA 2ADCA 4YR0A 5KT4A 1XWLA 5SZTA 1S1XA 1HI0P 2DPJA 1R0CB 2QG9B 4OL8A 3FFIA 3G6VA 1N6QA 5EWGA 3G9CA 3GJRB 1U6ZA 4A8MP 1LWFA 1FCAA 4Q0BA 3IAS9 4K5RA 1H73A 2XY7A 1FDAA 4A8WA 5HROB 2QLJB 4WFXA 1RP5A 3IN5A 4DV4J 3KHGA 4LF6J 4KKOB 3SXLA 2DNYA 1FKOA 3RB3A 4U7UK 2PE8A 3BZQA 2IHR1 4K4YA 4OZLA 3M9NB 4B3RF 2IVMA 4EO6A 2QE5A 1AXQA 3P96A 2CYYA 2KJWA 2CPDA 4X4UA 1Q0NA 4TYBA 2LA4A 2BJ8A 2FHOB 2HHTA 2W9CB 4OI6A 3KHLA 3WHIA 3GIRA 3M2RB 5FD1A 4IH6A 3HHLB 1FKPA 4FNIA 3ZZUA 4A8SA 2AJ1A 3ZTPA 1UW9A 5I4MA 1UVMA 3RW6A 1GMUA 5KFBA 1FX2A 1FX4A 2BE2A 2PD1A 5CH7B 5KFPA 2EEYA 4JI3F 2XMVA 1S4FA 4PYDA 1LXJA 2RS8A 4IUFA 2ALZA 2VG5A 3LW5C 1AT1B 3PYFA 4RBUA 4CRJA 2AJ2A 2OAUA 1SH2A 1X4AA 4USKA 2UU9F 3NMAA 3QGGA 5CD4A 3PRBA 3ISZA 2IJNA 4Q44A 2XGPA 1PC4A 3CJKA 3GCXP 4DU7A 4C2MA 1TK8A 3P49B 3CJRA 3CCQS 4EMDA 3TUZC 2FLOA 4QWDA 3CCSS 1D8YA 3OTOF 3DXBA 4NLTA 1OIAA 1Z1ZA 2PMWA 3NGUA 2FJEB 5EUHA 4O44A 4ZK7M 2XBPA 4QJVA 3FEZA 3EX7B 1NZ8A 1KS2A 2COLA 3R6GB 1SJ3P 2ZJPQ 2R42A 3DRPB 3PRVA 3EZUA 4P74A 4WPAA 3OL7A 1U1RA 1UCNA 2MQ8A 1KTQA 2WHOA 4PQAA 3DRSB 3SBMA 4F26A 2G1HA 3WIVA 4XO0A 1FD8A 4OZ3A 2RHSB 3PW2A 1NK8A 4NEYA 2JSXA 4DV7J 4LF5F 2HFSA 4DX5A 1Q82T 4F0KA 2GVDA 2HS3A 3TX8A 3G6ES 3SV4A 2E9TA 1VIXA 3NCQA 3C3LA 5J1EA 2MY8A 4KRWA 3P3DA 1X9MA 3D6MB 4KO0B 3KDNA 1GQEA 2M0GB 3NS6A 2UVRA 1HD0A 4RPFA 1UWBA 2C3UA 4NZ6A 2WONB 3QSYB 2H5JB 1U1MA 1U1NA 1HNWF 1ZM9A 3QFHA 3OVAA 3G4SS 4OX9F 3C46A 2B9YA 4IG0A 4ZKAA 4PQUB 1A0OB 3PRDA 1FXRA 3E3XA 3BSAA 1JLEA 1IN0A 2J9CA 2J7WA 4DBQA 4DFKA 1JK9B 2XULA 4WFNQ 3HPOA 1MWQA 3U1NA 2DHXA 2LXFA 1F0XA 1S9EA 5D77A 3LP0B 5J2PA 1FDBA 4P71A 3VF0B 4ZS6A 3E01A 4DG1A 5IM0B 3BV8A 4JYAJ 2FJBB 3QGIA 4Y2AA 2CQIA 1HQEB 3PO4A 4FYYB 2M7SA 1U6FA 4KHRA 2GQCA 2J0WA 1UZDA 4ZLNA 2DEIA 2YNIA 4GKKJ 3DYAB 1WJ9A 2DIVA 2IFXA 3W5XA 4U7CA 2QGFB 3ZTQA 3IWXA 4Q43A 1RAJA 1JJ2R 2UXDJ 3HZEA 4NLPA 3VGSA 2LECA 1WHYA 2K1RB 2I5JA 1S0VA 2XYHB 4UTGA 2UUWA 4CLPA 2XWYA 5KG6A 4DSFA 2WRMA 4L6V3 1GNKA 3IBFB 4J9OA 4PZVA 2HHSA 5J2QA 2MTLA 2XHWA 4X4QA 1S59A 2C2EA 4F3OA 2HQDA 2EPIA 3EZOA 1M1KT 1VDHA 3ICLA 1CULB 4ZVOB 5I42B 1HNXF 1F2GA 4I0WA 1N56A 1NHUA 3J7YI 2FY1A 5DZ7A 4OYAA 5IC4B 4AL5A 2CNLB 3PHTA 3HD1A 3OL9A 2C2MB 3EGVA 4YOEA 1YJWS 1H38A 1YIJS 4FXVA 3H0PA 3G87A 3SFGA 3K17A 2HQ3A 2RAQA 3C8YA 3L95X 4G6VB 5E3QA 2ZE2A 3GV5B 4I6AA 1C0TA 1P9QC 3K89A 4CLYA 2CJ9A 3NRBA 1SH3A 1SH0A 3H90A 5GADU 1RWUA 4GRSA 3LOUA 5DDOC 4LBIA 1X60A 2R7SA 4ZMMA 5HMWA 3UVJA 3WZ0A 4DR1J 2XCAA 3S01A 2ZBRA 4OZJA 2W2NP 2CQBA 3MWBA 2MPUA 1KQFB 1M5VC 2J9DE 4IDKA 3GJTB 1JLGB 2AZ1A 2VFVA 3TAMA 2XCPA 2A2CA 2B7CB 2RF2A 4DL3A 5J2QB 1I94J 4O3SA 1CPZA 2BW2A 3JAMY 4ZCMA 1TFYA 4ICLB 2RDIA 1PILA 5EN1A 5DLFA 1RISA 4NLDA 4P2XA 3N5BA 2Y8WA 3AB2B 4LMZA 1WORA 2GGPA 4U8VA 4CZCA 2Z8QA 4WU3A 2HGLA 2CNOB 2MZ1A 1IBMF 1CG2A 1WOOA 3I0RA 4DV0J 2BYCA 4ED0A 3EGNA 4I64A 3G6YA 2HWIA 2BM1A 3WX8A 1WEXA 3IR6B 2QSWA 4M5HA 5D4NA 2BKOA 4GMKA 1LK7A 1RWOB 2LQBA 3MCOA 4G1IA 4KH1B 5IZHA 3Q0AA 1EQ0A 1DJ0A 1JNZB 4RNNA 2PDAA 3EMTA 1ZM2A 4CO3A 2VONA 1T02A 5J2NB 5A2QY 1ZBTA 3BDEA 5ETTA 3SI8A 1VLOA 2FC8A 2M52A 2XMWA 1JKHB 1TKTB 1PC5A 4PG7A 5CA5A 1HPZB 4FZVA 3QGHA 3HJVA 3NAHA 5KFCA 1TV6A 2KG0A 4DV6F 2CKWA 2DGTA 4P6QA 1KVKA 3OW2R 1NPPA 2EBGA 1VQMS 3OTDA 4DSKA 4BHQA 1Q8LA 1RABB 4M5JA 1NUEA 4LVNP 1X9SA 1U8WA 2H9ZA 3NLCA 1MROA 4C3KA 4E8UA 3H4BA 4JV2A 1U1QA 2E7WA 3I9V9 3IC1A 1TAUA 4YUDA 1S6PB 4KIAA 5KFWA 5KFOA 3HX9A 3EXYA 4BC9A 3I82A 1Y0HA 3BBBA 2OO4A 3HCXA 4YQWA 3KLIA 1GT8A 3CT9A 2DK2A 5DZ6A 3V6DA 3RBDA 3EGWB 2ZOGA 3AFGA 1WEZA 2QZ8A 2HWHA 2M8HA 1S97A 1VGYA 3HI9A 2VFSA 1TMJA 2OLWA 2W2PP 4JP8A 1ZTWA 3N9UC 3GIMA 4DFMA 3DFEA 1MG7A 1U02A 2G1DA 1YG0A 2AGQA 5ETOA 4WCEQ 3HSGA 2E5HA 1NDCA 1X4HA 2ILYA 1WI8A 2SXLA 3BYPA 4DS5A 2DNZA 8RUCA 1EKSA 2CQ2A 1Z4UA 3EICA 4CLUA 1RE1B 5DG7A 3T1YF 2HQIA 2E5LJ 4W90B 4QOTA 1PKUA 4XDCA 1HMVA 4ED6A 3R5DA 4FVMA 5GAGI 3HJFA 2PFDA 2WONA 4N77A 1A6LA 1JJ4A 1GTEA 1K47A 1ZAVA 6FD1A 3H5YA 3BJYA 3V4MA 1SL0A 3OL8A 2WSFC 1BQNB 2PEHA 1WC4A 1Q78A 2BX6A 1MN7A 2B4VA 2IC3B 1S0OA 5A0YA 4MAKA 4F2SA 3CWJA 3MEDB 1VOMA 3TO8A 1YBAA 3J80U 1S1TB 3PV8A 4L3KA 3OXFA 1IR1A 1FXDA 1S99A 4ATNA 4K4VA 4XPCA 2Q6BA 1AFJA 4P72A 2I6WA 1RAEB 1S1XB 5E3AA 3OLBA 1N88A 2BA9A 2BQ3A 4QYZJ 2HWTA 2O01C 3Q24A 3AOCA 2YNIB 3MM7B 4DV3F 2XNRA 3KUGA 5IOLA 5LXRA 2DY9A 4YFUA 1FVSA 2H48B 3QIPB 2DXEA 1RAIB 2ABYA 4KKOA 5E3RA 4QU6A 3QAEA 2FQQB 2YTCA 4EYHB 4NA1A 2B4PA 3KG0A 2QMWA 3PYGA 3KUHA 3HVTB 4RKUC 4ZPAA 3ZZTA 1F5BA 4KTQA 4NMLA 1N5QA 5CYQB 4CWBA 1JXLA 5D8HB 2HHPA 1YK9A 1V3ZA 3IWLA 1NSPA 1S1VB 3PNIA 3QQCD 4JI1F 3WDOA 1RBAA 1ZA2B 1R8CA 1VRTB 3C6UB 9ATCB 2VQEF 2RNEA 4ECTA 3RAXA 3TJAA 3K5NA 2R2UA 3UVJB 3BQ1A 4URGA 5HATA 1IKVB 2KVQE 2MY7A 4CDIA 3TYTA 4U8YA 5KOWA 4PXCA 1WF2A 2VDHA 3ZZZA 5H9FK 1WI6A 2YNHA 3KHHA 3OFHA 1VQ5S 3M2RA 3R7SB 1N34J 2DH7A 4C8MA 2ZHBA 5HMZA 1RSCA 3G2XA 3T1HJ 2F1FA 1DQ9A 4DR4J 1LKZA 1HNIA 1N0VC 2YWHA 3A3PB 4R8UA 3Q89A 4HHHA 2HNDB 4B02A 4GO7X 5IV4A 1LFWA 1SIWB 2DHAA 3R7BB 4X65J 2R8HA 2FJVA 1YBTA 3NAIA 4CLTA 1Y3JA 2W01A 3G8SA 3AQOA 3IFEA 4RL1A 4YDXA 4F04B 4ZHRA 5A8KA 5HO4A 2W7PA 2UVWA 2FHJA 2R8JA 4C9DA 2KXNB 5HI7A 3GB0A 5LT5A 2D69A 4DCJB 3I55S 1K0VA 5KG0A 1H72C 3K2YA 3R6LB 1S0MA 1L3KA 1T03A 1VRUA 2W7AA 1WHWA 2VBWA 3TNVA 1N34F 2Q3PA 4KFBB 1QTMA 1GTHA 1QAYA 2FIUA 3MMAA 4HHUA 2WOMA 2X3DA 4C6AA 2R7XA 3LPYA 4DMZA 1H74A 3PIOQ 3A8JA 5DRKA 4LFAF 2VD3A 3W5YA 2FGOA 3IRXA 2KXFA 3KLGA 1T9UA 2W4CA 4I6WA 4CIOA 2ZHAA 2JEFA 2F9DA 3FBCA 4DF4A
chains in the Genus database with same CATH topology
1FFWB 1EAYC 1A0OB 1FWPA 1FFGB 2LP4A 1FFSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FFW B;  1EAY C;  1A0O B;  1FWP A;  1FFG B;  2LP4 A;  1FFS B; 
#chains in the Genus database with same CATH topology
 1FRX A;  3IXQ A;  3CCR S;  2XS5 A;  2RHQ B;  4HAC A;  4RBV A;  3MTJ A;  4X64 F;  4CCH A;  4PUO B;  1OPI A;  5D3G A;  2Y1R I;  2HHX A;  4AQY F;  1SIZ A;  3DU6 A;  2DPI A;  3TZX A;  2DRB A;  1UMJ A;  1C2P A;  2XSJ B;  3HVT A;  2DYA A;  4HT7 A;  3J80 Y;  2XC9 A;  1UJ4 A;  1K73 T;  4UUW A;  1M1G A;  1MRO B;  2M3D A;  4C11 A;  3I5A A;  4G1Q A;  3PVX A;  4EBC A;  3L9Z A;  1D8Z A;  2KT5 A;  4I2Q A;  2BUN A;  5K5M A;  5BXI A;  3MR3 A;  2J76 E;  2QA4 G;  4QBU A;  2ZDP A;  1Q16 B;  4PG4 A;  4J9N A;  5CZV A;  4KAI A;  1VQ7 S;  4LFC J;  2YWG A;  5T7L A;  3MEE A;  4JOU A;  1LQ9 A;  3ITH B;  5GAE U;  4XPE A;  4JV5 J;  1D3W A;  5FLX U;  1A9N B;  4RUH A;  2KN4 A;  5HP1 B;  5B7W A;  4ED1 A;  1VS3 A;  1NAQ A;  3TQE A;  3U27 A;  3TAP A;  3FEY B;  1WTF A;  4CT8 A;  3UO0 A;  1EP4 A;  4WF9 Q;  1RTH B;  3TWZ A;  4N76 A;  3OUY B;  2EKN A;  2Y1J A;  3TI0 A;  1TKZ B;  1IJF B;  1HWJ A;  2V8G A;  3GCW P;  4C3M A;  3KJF B;  3IP0 A;  5F8M A;  2WTF A;  3RG6 A;  4QWA A;  1NPR A;  2ZKU A;  1RT5 B;  2DEJ A;  3Q2S C;  4K7Q A;  5D4L A;  5AT1 B;  1M0S A;  3RRH A;  1VQ9 S;  3R5C A;  1IBL J;  1URN A;  3B6B A;  3NWG A;  4B3M J;  2WSC C;  3VZH A;  5BYS A;  5KFN A;  1SKR A;  1RHR B;  5J1N A;  2FVR A;  3C6T B;  1TL7 B;  2V50 A;  5B0F A;  1XR7 A;  3C19 A;  4JB8 B;  5JVH Q;  2CG8 A;  1J5O A;  2FZK B;  1HQU B;  1REV A;  3CO9 A;  4LF7 J;  1TVR B;  1IM4 A;  4KY3 A;  3AD9 C;  1VQL S;  2J7U A;  2IY5 B;  5F8J A;  1N36 J;  2RRA A;  3NOG A;  3CD0 A;  3DRX A;  2LQ8 A;  1HKA A;  2P8I A;  2AJ4 A;  4K2J A;  4KGV B;  3RRK A;  3UI3 A;  3UD3 P;  1LV5 A;  4DSI A;  2BRL A;  2KZM A;  2LCW A;  2VG6 B;  2KI2 A;  3D66 A;  3A1Y G;  3IA0 A;  4YDD B;  3AAW B;  4IKA A;  1ACM B;  1F9F A;  3BGR A;  5FLX Y;  1HBM A;  3PW0 A;  2XYG B;  3QLH B;  5KFY A;  2HHH F;  1C0T B;  3JSM A;  3L3C A;  1RU2 A;  4K4Z A;  3IMQ J;  2DNR A;  2FHJ D;  1YRU A;  4OZ5 A;  1Y4Z B;  2OD4 A;  3CJT A;  1X5P A;  3MMB B;  3TVY A;  2VZ9 A;  3MEE B;  1BQM A;  3MD1 A;  3IM8 A;  2G2Z A;  4BWM A;  2C2R A;  1M90 T;  4LF4 F;  3IWN C;  3K0J A;  4L73 A;  1HYS A;  4K5S A;  2GHW A;  3E51 A;  3W8P A;  5IQ6 A;  5KFM A;  1HNW J;  1R0B G;  3D6T B;  3Q8U A;  2JVR A;  5DO2 A;  4DPY A;  1HWL A;  3TW0 A;  3MM6 A;  4G1Q B;  4S0M A;  4P75 A;  5C25 A;  2ZH3 A;  1RTD A;  4FNH A;  2V2Z A;  4LSN B;  4QW9 A;  2E9R X;  2ZBP A;  3QFW A;  2R7Q A;  1S0N A;  5EGY A;  2ASD A;  1VQN S;  5DM7 Q;  2OEL A;  2YVS A;  1JKH A;  3ENA A;  1CLF A;  2YNF B;  4B3O A;  2K7J A;  1EP4 B;  4RW9 A;  2MQN A;  3KUE A;  4EU0 A;  2IBK A;  3OR2 B;  2I1R A;  1M5K C;  1VR6 A;  1HHQ A;  2YKO A;  3DDN A;  4LBP A;  4ID5 A;  1U8S A;  4DV2 J;  3PO5 A;  1OQ3 A;  1Q8I A;  2CQP A;  1Q53 A;  2GQ2 A;  3GG0 A;  3QID A;  2YKN B;  3BBF A;  2RU3 A;  4L76 A;  3HSD A;  3W2W A;  2V4R A;  1T8E A;  1APS A;  2HNY A;  2VKR A;  3RAQ A;  4CH7 A;  4YME A;  3NOC A;  2FC9 A;  2ASJ A;  1Y3K A;  3ENV A;  2ZBI A;  2N82 B;  2AW0 A;  1Q7Y T;  1NB2 A;  3ETM A;  3KG4 A;  1Q5V A;  3QAT A;  4CLZ A;  1NK0 A;  4NYO A;  2AF6 A;  3LGN A;  4Z7Y A;  2N4C A;  4P9S A;  4X66 F;  5IQQ A;  2VOP A;  2YKM B;  3U1L A;  3L4B C;  4DR1 F;  1F9E B;  1A7G E;  1NLK L;  1TVR A;  3CDE A;  3FEX B;  3FGV A;  4HHJ A;  1NH8 A;  1S6Q A;  3I4H X;  4J90 A;  4M5G A;  4UST A;  3ZZO A;  4D3H A;  1TK0 A;  1M5S A;  3KJN B;  3DCA A;  2MST A;  2OSR A;  2JC0 A;  2W8L A;  4B9V A;  4JI8 J;  1WG1 A;  2ZH7 A;  2IMW P;  1N5S A;  1YJV A;  5K8O A;  4UOG A;  1M5H A;  2U2F A;  4MT1 A;  3V4I A;  2Z56 B;  1HNI B;  4RUA A;  2FVQ A;  2CVE A;  2N7Y A;  3MPV A;  4FKY A;  2OFG X;  2V2K A;  3T5J A;  1JJC B;  1ZYQ A;  2DR6 A;  2GO8 A;  2V0N A;  2BAN B;  2NYH A;  2YNH B;  3BKU A;  4TYA A;  1MSW D;  1G3O A;  2DGX A;  2GVZ B;  5KG2 A;  5CAB A;  4F25 A;  1WG5 A;  3D6H B;  2DR7 A;  3FRZ A;  1GMW A;  1GX5 A;  2C3O A;  4Z2X A;  2VL1 A;  2DHH A;  4FYV B;  4MK8 A;  2Z2L A;  2IMO A;  4MYU A;  5ADZ A;  1REG X;  2GO9 A;  2MQP A;  1U1P A;  1YJU A;  1GAO A;  4KE5 A;  4U96 A;  4QCL A;  3CVK A;  5A8K B;  2QLW A;  5E3P A;  1LW2 A;  2FHM A;  3ILO A;  1WD6 A;  5CYM A;  5KG4 A;  3ZNJ 1;  3HKZ D;  4DU8 A;  2HRT A;  1S79 A;  3CDU A;  4I2Q B;  3M9M B;  4DV2 F;  1T9T A;  3HHE A;  3M6V A;  4DG1 B;  5IM0 A;  4C8K A;  3EVM A;  4K50 A;  2DCL A;  3C14 B;  2GHP A;  2HFU A;  2FJA B;  3MOZ A;  4AD6 A;  1VC6 A;  2OMO A;  4N8N A;  3R5G A;  2WW8 A;  4OI1 A;  5KTQ A;  1QLN A;  2H65 B;  2V5H G;  4WIQ A;  4TXS A;  3JYT A;  3K5O A;  3M8P A;  4OYB A;  5AXK A;  3UFC X;  4ZJL A;  3WBZ A;  3VVT A;  3W2W B;  2R8K A;  2DRA A;  5THW A;  3EE3 A;  4OX6 A;  4BS2 A;  2MQM A;  3A8I A;  1HAR A;  2YKQ A;  2G2Y A;  1WEL A;  5KFS A;  3NCR A;  2XQC A;  4QWE A;  2V9K A;  2BW7 A;  4LF4 J;  3MED A;  3P5B P;  3T19 A;  4FXW A;  3D0I E;  4WZQ A;  1IR2 A;  3FZ2 A;  3FK4 A;  3Q8V A;  1S77 D;  2XLK A;  1YZ6 A;  3W8G A;  3M1V B;  1S49 A;  4I69 A;  2FGC A;  3KDO A;  3U02 A;  1DZ5 A;  4OI0 A;  1G7C B;  2W2M P;  2Z4P A;  1GK8 A;  4CLS A;  3BO2 A;  2Q1L A;  3AD8 C;  1WHX A;  2F8M A;  1WNE A;  4N56 A;  5KT6 A;  3CUL A;  3NWR A;  2NLW A;  2VV5 A;  1P6T A;  4CM0 A;  5HQL A;  2UUB J;  1TV6 B;  1TL4 A;  4BWJ A;  4OX9 J;  1JWW A;  1X0P A;  3CED A;  3TAQ A;  2B6A B;  1QE1 A;  2QLF B;  1B0P A;  2R9L A;  1QY7 A;  3BB5 A;  4GO5 X;  2P5V A;  1NK5 A;  1RT4 A;  2FVS A;  5GMD A;  1W2I A;  1CS4 A;  2V8P A;  4DUY J;  5F9N A;  4LF7 F;  4FYX B;  2XS2 A;  4UZB A;  3QO9 B;  2VHG A;  4X62 J;  1NHK L;  2Z2M A;  2XMJ A;  1NPK A;  1BGX T;  2QA1 A;  2B9E A;  2CJB A;  2ZFH A;  3QT5 A;  2MGZ B;  2F4V J;  3CNQ P;  2UXC J;  1QUV A;  4B3M F;  2J0S D;  3GYG A;  1UJ6 A;  2E5I A;  2DKO B;  4DHV A;  1NSA A;  2LQJ A;  3CJS A;  4ZP6 A;  2AJ0 A;  3O8W A;  1TQL A;  5K14 B;  3MUM P;  4QW8 A;  1NZA A;  3I0S B;  3CF5 Q;  4LF9 J;  4AE5 A;  2CPJ A;  1FRI A;  1VBK A;  2H51 B;  1H7X A;  4ANE A;  2ZHO A;  5J2M A;  1V5I B;  3TAM B;  2X1F A;  2IDE A;  2PO4 A;  2R2R A;  1UZH A;  2O5D A;  3ZZ0 A;  3DOM B;  5SUH A;  1NJX A;  1NJW A;  4C8O A;  4Q8F A;  1Y11 A;  3A3O B;  1U25 A;  2M9K A;  2DNO A;  2UU9 J;  4M5D A;  4P52 A;  4RNF A;  1IQZ A;  1U24 A;  4RU9 A;  1VYA A;  1WAC A;  2J9D A;  3GR0 A;  4ELV A;  4F02 A;  1NK6 A;  5A2Q U;  1UVN A;  2FJD B;  5HMX A;  5GAG U;  1EIY B;  3ZO7 A;  1TKT A;  2LEP A;  2HPU A;  4F2R A;  4JI8 F;  4UY8 T;  4JI3 J;  1F5A A;  2ZC3 A;  4CO0 A;  4EEY A;  5ETM A;  2VPZ B;  3MMA B;  5JMN A;  1U26 A;  1BD6 A;  4ZPV R;  3Q83 A;  3NXZ A;  4Y2M A;  3OPK A;  1HBU A;  3VZI A;  3KK2 A;  3T3F A;  1SKS A;  1DAX A;  2Q66 A;  2VUG A;  3RUB L;  3BDP A;  4F3Q A;  1SJ1 A;  2GIQ A;  2YBV A;  3FFI B;  4X66 J;  4QU7 A;  5KFQ A;  3EPG A;  4B3O B;  2HMI B;  1JLB A;  1C4A A;  4QR0 A;  3PR4 A;  4F8R A;  3R3T A;  1ZS6 A;  2OPQ B;  3Q8R B;  2H4W B;  4PG8 A;  3AXK A;  3AA9 A;  3GE9 A;  3LAN A;  4OYO A;  4UW2 A;  5L9N A;  4GKJ F;  5HSP A;  4M5D B;  3PAC A;  3NCP A;  4MK7 A;  4OYW A;  4DV4 F;  4F4W A;  1B3T A;  4ES3 A;  3PEH A;  1SV5 A;  2XB2 D;  3LQV A;  1JIH A;  1TL1 A;  1F3F A;  1WC1 A;  4J91 A;  4JBC A;  4EI2 A;  5C7P A;  3H4D A;  4P2F A;  2XMK A;  3GYN A;  4P2S A;  3K59 A;  2KXH A;  1XTZ A;  2NCK L;  4KYZ A;  2DIU A;  1N33 J;  5J2M B;  2HHW A;  3IBC B;  3VGV A;  4CLK A;  1HBU B;  3K58 A;  5EX3 A;  4CLF A;  3ZTO A;  3N0V A;  3HFK A;  3M7V A;  3PKY A;  2D3Z A;  3MCN A;  2DR5 A;  4NXN F;  1BWE A;  5KFL A;  2HFZ A;  3LF0 A;  3BO3 A;  4NLV A;  4WFY A;  1NK7 A;  4KGM A;  1U1K A;  4DPW A;  2GGP B;  2NXC A;  1F2H A;  1EQM A;  2NXJ A;  3M8Q A;  4AFF A;  3R5J B;  3GLJ A;  4KSE B;  4P7T A;  2R4F A;  4DR4 F;  4IFV A;  2CWX A;  4DQQ A;  1WC5 A;  1RT6 B;  1WKJ A;  3Q86 A;  2FB0 A;  5KFT A;  2HLT A;  3ET6 B;  3WX4 A;  3POT A;  2CPY A;  3TAN A;  1G1X A;  1JMT A;  2DY1 A;  1DHM A;  4WP9 A;  3DOM A;  2MHN A;  3QIP A;  2GMJ A;  3LUY A;  4LUB A;  3S7R A;  4NLU A;  1NDK A;  2LDY A;  2Y0S D;  3MUR P;  4LFB J;  1CQM A;  2CJA A;  4I7F B;  4X4O A;  4CO2 A;  1MU2 A;  3KYL A;  1TL7 A;  2O66 A;  5D0H A;  4GC6 A;  1Q86 T;  5L38 A;  4PEO A;  5D0E A;  4DL5 A;  3LP1 B;  3FBE A;  2IM0 A;  2OUG A;  1N5Y A;  3GPA A;  1DTT B;  4J9U E;  1I1G A;  2AP6 A;  2RUS A;  4LRE A;  1S57 A;  2GQQ A;  2NR0 A;  2OPR B;  1X8D A;  1RBO B;  2A6O A;  4C3L A;  4ED2 A;  4R0J A;  3DHX A;  3DRR A;  1N36 F;  1YDL A;  1TKZ A;  2OHD A;  2GVD B;  5KT5 A;  2W1B A;  2BE9 B;  3BGU A;  2MZT A;  2F3J A;  1T0T V;  5IV3 A;  2JDJ A;  4FKX A;  3F0N A;  1ZH5 A;  1YRT A;  3FC9 A;  1HFE L;  2AGO A;  1DBD A;  4DX6 A;  2J7K A;  2KHC A;  1RT3 A;  3P5T L;  3PW7 A;  3TX0 A;  4FN5 A;  3DOL B;  3OQ2 A;  4NXM J;  4ZVR B;  2Z2Y B;  3W2V B;  2ZWO A;  4CT9 A;  2MJU A;  4ZLL A;  1K44 A;  4HEA 9;  4LSL B;  4ID8 A;  4ZIV A;  3M2U A;  2ZC4 A;  2RUG A;  1N32 F;  4LR7 A;  1RXO B;  1RLC L;  4WYW A;  5KFG A;  3RB4 A;  1RZM A;  3DLG A;  2HSE B;  1N32 J;  1JXV A;  5IFM A;  5L1K A;  1IKY B;  5D15 A;  4LF8 F;  2AEJ A;  1FJ7 A;  3B4D A;  3A8E A;  2AT1 B;  3CW2 C;  1RTZ A;  2JNJ A;  2KRR A;  2CZV C;  4L3N A;  4K8R A;  3TAR A;  1T9V A;  2YKP A;  4P73 A;  3TQ1 A;  2OIH A;  2GNK A;  3R2C J;  1KOH A;  4J9R A;  2PSZ A;  2M4M A;  1XK8 A;  3OR2 A;  4OYM A;  1K8A T;  2YWF A;  4HH1 A;  4GVB B;  1FT8 A;  3JXO A;  1FKP B;  2RJZ A;  2V63 A;  4O4G B;  4MYT A;  2X51 A;  2WOM B;  3ELH A;  2FLN A;  3TA0 A;  1RTH A;  1YKW A;  4WXW A;  1KHV A;  3X3U A;  1P9Y A;  3ETO A;  4KFB A;  2N3O A;  4NLQ A;  1ZA1 B;  1MWY A;  1NSK L;  2GIF A;  2R2T A;  4W98 A;  3HF5 A;  3B8H A;  3ITH A;  2GAH C;  1DRZ A;  4WKR A;  2K2P A;  4PR6 A;  2FLP A;  2QYG A;  1VBZ A;  1O5J A;  2MQQ A;  3IO1 A;  3MPY A;  1H2U X;  3JSY A;  4I7F A;  3T41 A;  4YS2 A;  4ED5 A;  4B17 A;  1UAW A;  2MLY A;  2W2O P;  5CAA A;  2XMA A;  1ICE B;  1YGY A;  3UDV A;  4U7U D;  4FYW B;  4HDG A;  2YKM A;  3BN7 A;  1H6K X;  4DLE A;  1UWB B;  4MTP A;  1QVF R;  4XAK A;  3RBX A;  3T1A A;  4LFB F;  1I5O B;  2KB2 A;  4NLW A;  3CJ2 A;  1RJJ A;  3Q2T C;  4O3Q A;  4ECV A;  1LWE B;  3MPU B;  4CO4 A;  2KFZ A;  4GVL A;  2W8K A;  2VC0 A;  4GVB A;  2BJD A;  4OV1 A;  2YXL A;  4O0N A;  2K8G A;  1RLD A;  3NNA A;  1VIO A;  5LSL A;  2VG5 B;  2OML A;  3QNW B;  4W92 B;  5GAE I;  1T05 A;  2M70 A;  3HFV A;  2PMZ D;  4FPR A;  2C28 A;  1XR6 A;  1EET B;  4A8F A;  4NA2 A;  2EK6 A;  6AT1 B;  4NXN J;  2OPS A;  3FSX A;  1IM6 A;  4UY8 5;  2FTR A;  1CC8 A;  3HHL A;  4X65 F;  2LLZ A;  2VKZ G;  1J5O B;  2UP1 A;  1S76 D;  2C3Y A;  3UCG A;  2FLL A;  3C6T A;  3PTW A;  1GMV A;  2HVD A;  2FY8 A;  4OI4 A;  3T1H F;  4M5N A;  4WBF A;  5C24 B;  4DSJ A;  4LSL A;  2CVI A;  2F9J A;  2VA2 A;  1DUR A;  9RUB A;  1RT6 A;  5JUM A;  2XY5 A;  1P1T A;  1X4B A;  1AB8 A;  1FES A;  1KQG B;  2XNQ A;  4MFB B;  5CYM B;  1IBM J;  1CJK A;  3LWL A;  3QRR A;  2RB7 A;  2CPF A;  4WFA Q;  1FNM A;  5I3U A;  3FJ2 A;  2MKJ A;  5A6W A;  2Y8Y A;  2ZWP A;  1B0V A;  3BGO P;  3DGP B;  3TP2 A;  4U95 A;  2G0I A;  4WTY A;  4ILM A;  3R5A A;  5KFD A;  3GQC A;  2UUA J;  3NL0 A;  2DR9 A;  1X5O A;  2PC6 A;  3TEG A;  3KLE B;  1NDP A;  2QIF A;  3MR7 A;  2QL7 B;  3KLF A;  3CE8 A;  2BAC A;  4AXI A;  2MKS A;  3F41 A;  3M30 B;  3KK2 B;  3B4M A;  1U2R A;  2OPR A;  3EPI A;  4R0E A;  4DQR A;  1XQI A;  4KR0 B;  4DR2 F;  1KC8 T;  2E7X A;  2XSF A;  2WVE A;  1SJQ A;  2DGU A;  2FDN A;  3JQM A;  3K8W A;  5T41 A;  3H98 A;  3GWC A;  1T3N A;  4FBT A;  1Q95 G;  1SJF A;  3KNG A;  1PO6 A;  5DDP C;  3M32 A;  4DFP A;  4Y28 C;  2AX1 A;  3PJW A;  4KBI A;  1XMO F;  4IRC A;  1U7L A;  4K59 A;  4WFB Q;  1SB6 A;  1C1B B;  2FJW A;  3T6B A;  4MK9 A;  4CLL A;  4DZ6 A;  3D0H E;  1IKX A;  1Q79 A;  3IM9 A;  2V4J B;  2OPS B;  3DRY A;  1UP1 A;  2K3I A;  2OPP A;  4H4K C;  4ZVF A;  3ULH A;  4C48 A;  1ZZN A;  1S9G B;  3UN3 A;  3QZ7 A;  1S72 S;  1NEE A;  1XMB A;  1OJ4 A;  3CJ4 A;  2GAG C;  3UDE A;  4Q2L A;  4OLP A;  5C42 A;  4LIR A;  2V8D A;  3BGR B;  1H3D A;  1VC5 A;  3Q8P B;  2JEG A;  1UA1 A;  4EZ6 A;  5DG9 A;  1O0P A;  2MKK A;  4IQM A;  1BXN A;  1R6Y A;  2ZBQ A;  1HI1 A;  2ZE2 B;  3LAM A;  4LRA A;  1X5T A;  3ZZR A;  3AOB A;  2VPX B;  5MLC V;  2MGZ A;  3SSQ A;  1FDD A;  2XM3 A;  3M8W A;  3E01 B;  3HM9 A;  3V6D B;  1LEO A;  2UXC F;  4KHP J;  3FCW A;  1NKE A;  2MQL A;  4ZP8 A;  3UR0 A;  4X62 F;  1RTI B;  3A12 A;  2O1P A;  2DHS A;  1BY9 A;  2YNF A;  1TUW A;  3G96 A;  2HRU A;  4ECW A;  4HYK A;  2Q43 A;  3PKM A;  3MEG B;  1RTJ B;  5K8N A;  4RZR A;  1P8G A;  4TKT A;  2B0G A;  2CPH A;  4J9P A;  1RWM B;  1QDU B;  5ETL A;  5M2P A;  4ZDN A;  1QSS A;  4GKK F;  3BYR A;  4OMF G;  4TU7 A;  2KL8 A;  2C3P A;  2B8Q A;  3VGU A;  2V8V A;  3HMJ G;  2WZ1 A;  3DLE B;  2GML A;  3OLA A;  2EVZ A;  1DTQ A;  3OBI A;  1KHW A;  5IT0 A;  1L5U A;  3DLL Q;  3IR7 B;  4CO5 A;  4B9M A;  2OSQ A;  2QN6 B;  3M1V A;  4ECR A;  1SBR A;  3BQ0 A;  1HD1 A;  1PAE X;  4JI4 F;  3MMB A;  4RX6 A;  4C8Y A;  3N28 A;  1NJY A;  3BGF A;  3R2D J;  1KFS A;  4Q0B B;  2XHC A;  4OHZ A;  3FDS A;  3RGI A;  2BR0 A;  4RW7 A;  4ZIT A;  2R7V A;  1AZS A;  1SQG A;  5A6P A;  2OFH X;  3W7B A;  4TU9 A;  3CC2 S;  1BQX A;  3GFZ A;  3WQP A;  1QE1 B;  2CPE A;  3HP6 A;  4FS2 A;  2OP5 A;  5B0A A;  5KFI A;  1QAX A;  5DG8 A;  2ZD1 B;  2ZH9 A;  4CM2 A;  2AMC B;  3GIL A;  2B7B B;  5LM7 E;  2ZJR Q;  2JX2 A;  2HZC A;  1XR5 A;  3MR5 A;  3O3L A;  4IYQ A;  2QFI A;  3KLI B;  3Q8Y A;  1OSD A;  3R8Y A;  1RT1 A;  4YY3 J;  2R7R A;  2D1C A;  4DLG A;  3SCK E;  2OEK A;  1UPP A;  3SYZ A;  1FKA F;  3M6X A;  3VAL A;  1DTQ B;  2FVP A;  1REV B;  1HQU A;  2R7W A;  4DV7 F;  2HHQ A;  1C1B A;  3FBF A;  1NJZ A;  4ZVU B;  1HQ2 A;  1MMD A;  1I51 B;  4HAC B;  2E1C A;  1UVI A;  1YX2 A;  1RB0 A;  1VRQ C;  4FVC A;  1C1C B;  3IG1 A;  3KLH B;  1NK9 A;  3MOJ B;  5E33 A;  3V5R A;  2IM1 A;  4AYB D;  3HXM A;  3NGK A;  4RW4 B;  5LMN F;  4RNH A;  4F0M A;  4R8U B;  1J5E J;  4B3S J;  1FJC A;  1TR0 A;  3UN2 A;  5J1E B;  1VQO S;  2BAN A;  1R6V A;  3OTO J;  4U67 Q;  2DGQ A;  1FTC A;  2CJY B;  3AHP A;  2VU5 A;  5HJY A;  1XBW A;  3FNN A;  2CJQ A;  2HUR A;  2IM2 A;  4F4X A;  2JWN A;  5HJX A;  3BKF A;  3OJS A;  1T94 A;  2HIQ A;  4KGX B;  3P6Y C;  1T9W A;  4C8N A;  4E0D A;  3SCL E;  3PG9 A;  1JJH A;  3BSN A;  3MM9 B;  3H20 A;  2GJ2 A;  4YN3 B;  1T7P A;  4OHY A;  2BQU A;  2B9X A;  1YLX A;  4PXD A;  2NSC A;  3R1L A;  5A76 A;  3ILJ A;  1RTJ A;  3QYY A;  3D2W A;  1EAR A;  3CCT A;  1X4D A;  2WBM A;  1JLQ B;  1T3O A;  3NGR A;  1CJK B;  3KFW X;  3OFF A;  2V94 A;  4C11 B;  1H0H B;  2PMH A;  1P1L A;  1SC1 B;  2L08 A;  4IOB A;  3ET6 A;  4IR9 A;  4CI0 B;  1WHV A;  2HBQ B;  3VVU A;  1RAA B;  4YEA A;  3QWP A;  3ADA C;  3GSD A;  4WU2 A;  2RSQ A;  2CJK A;  1Q8K A;  3FCH A;  3SDE B;  1TMM A;  3H2L A;  3VAM A;  4LQ9 A;  5KT7 A;  3H2V E;  2A1B A;  5B0G A;  1UEK A;  3DOK A;  4NCB A;  2QV6 A;  1CJU A;  2B43 A;  2ZIT A;  3PDN A;  2YKN A;  4TLQ A;  1KQS R;  2D7S A;  2MZR A;  5ETR A;  5F8H A;  2VOD A;  2VJU A;  3O6Q A;  1FRM A;  1ELO A;  2W24 A;  1S1V A;  2LKZ A;  2M8D B;  1BLU A;  3TZZ A;  3BSO A;  2L41 A;  4YB7 A;  2D3O 1;  5KFV A;  2D74 B;  1VBX A;  2HRY A;  3DNC A;  3K57 A;  1BQN A;  5KFE A;  1RWW B;  1PJ6 A;  1BHN A;  2XEX A;  3PCO B;  4I68 A;  2CAD A;  5CQG A;  1Q4R A;  4LRD A;  1R27 B;  4DZD A;  1U45 A;  2ADB A;  2PN6 A;  1XN9 A;  2AV5 A;  1TFW A;  4NLS A;  4G3I A;  2AJQ A;  1RT3 B;  4MFB A;  2JLF A;  2HEK A;  2UUT A;  1U1O A;  2I8E A;  3MMC B;  4IG0 B;  1NCL A;  3M30 A;  2QL5 B;  3AJ1 A;  4Q7A A;  1HYS B;  4DR3 F;  3FSY A;  4J7C A;  4TVA B;  4LRF A;  2HFV A;  3VAG A;  3I4P A;  2HK3 A;  4Y3C A;  3O5T B;  2LXU A;  2UUB F;  1VCT A;  2LFV A;  2AQ4 A;  4JI0 J;  3QJJ A;  4C98 A;  2R7U A;  1YRX A;  3J7A 1;  2ZJQ Q;  3LP2 B;  2MQO A;  5ETS A;  1LW0 B;  1FE0 A;  4DF8 A;  1AW0 A;  4J9L A;  1VIS A;  4LF1 A;  4ER8 A;  1AYE A;  2QMU B;  3NG8 A;  2JOQ A;  3DOK B;  4B08 A;  1K9M T;  2HHH J;  2X1B A;  1IKV A;  3ZC4 A;  2CUY A;  1KWM A;  1PYO B;  2MMY A;  2P9C A;  3KOA A;  4ZPC A;  3SSS A;  1S5Z A;  4ECZ A;  2BBE A;  3F44 A;  3R27 A;  2I38 A;  5EX0 A;  3DYA A;  1C1C A;  3IG1 B;  3VCD A;  1XNQ J;  5IT9 U;  1OPZ A;  2G0J A;  5CXT A;  3T5H A;  4PXE A;  8ATC B;  5FJ4 A;  3IR5 B;  2VOO A;  3KJV A;  2N4D A;  3TVZ A;  2YX1 A;  3MPW A;  3B82 A;  5DQG A;  4CH1 A;  1URR A;  2WVD A;  1IBK J;  4PCQ A;  2CWK A;  2X1G A;  5KT2 A;  1CC7 A;  2MEW A;  2V69 A;  1UVK A;  3N4W A;  3LPE A;  3NP5 A;  2WW4 A;  3GSI A;  1R8P A;  3DDI A;  2LQ9 A;  3SFU A;  1CEZ A;  1UFL A;  2BKN A;  4NOH A;  2LDI A;  2JZ5 A;  4X4T A;  1YBU A;  1B4S A;  2GA7 A;  3J81 j;  1HPZ A;  3MI7 X;  4MH8 A;  7FD1 A;  2DRD A;  2R3V A;  1HBO A;  3GII A;  3T9N A;  4DUZ J;  4A8O A;  1LWE A;  2BM0 A;  4M94 A;  1FA0 A;  2LMI A;  1KVI A;  1S1W A;  1QJH A;  3DN9 A;  1FWL A;  3PJ9 A;  2C22 A;  5J2N A;  2V8H A;  2QSF A;  4X4R A;  4ZPD A;  4DQP A;  5CZX A;  2MKY A;  4ZIW A;  2Y0B B;  3BM7 A;  2XG8 A;  3J7Z T;  1TL1 B;  3D4J A;  2BQR A;  1HBN A;  1VK3 A;  1RAF B;  1WOS A;  5FII A;  1AA1 B;  5GME A;  1IBK F;  3P45 B;  3QGP A;  1HWI A;  1PJ5 A;  4ERD A;  3V6K A;  2EKY A;  3JSB A;  2HW3 A;  4FYD A;  2LXI A;  2JEJ A;  1F3V A;  2HNZ A;  2MLX A;  4RW6 A;  4UZC A;  3JS9 A;  3T6J A;  3VQT A;  2XLI A;  1Q81 T;  2BJ9 A;  2RT3 A;  4YB6 A;  1Q1K A;  3CB4 A;  1TUV A;  2JJ4 D;  2NXU A;  2ZZT A;  3EDR B;  4EUV A;  5HRO A;  3MM8 B;  4K0K F;  2RKI B;  5DET A;  2ZH8 A;  3S8S A;  5BYR A;  3T9Z A;  4AQY J;  4M5I A;  5AJ3 J;  2BAB A;  1YWX A;  1LOU A;  2F63 A;  3IGV A;  3NKY A;  3EUN A;  1KVJ A;  4KJI A;  4Y0F A;  2D9P A;  2ROP A;  2ZVS A;  5ETN A;  4FF2 A;  1OO0 B;  1RAG B;  1TP7 A;  2BE7 D;  1AZS B;  2BJ3 A;  4F3M A;  4HI1 A;  1TKD A;  1X9W A;  1HQE A;  2DTJ A;  2XYP B;  4V19 J;  3DLG B;  1SC4 B;  2JFK A;  2VIH A;  4IR1 A;  1XNR J;  3SQG B;  4RNM A;  5LMU J;  2O67 A;  3D5M A;  4NMX A;  4PPZ A;  3AJ2 A;  1V3S A;  1DQA A;  5HBM A;  3W2V A;  3EYZ A;  3RBE A;  1MNE A;  2HZV A;  2D3U A;  5HLF B;  4KPC A;  2VFT A;  1RBL A;  1QD1 A;  1KLM B;  2FHK A;  3CGI A;  3EDQ B;  1N5V A;  4Y2K A;  1HHS A;  2F40 A;  3L09 A;  4JI6 F;  1FFG B;  1YJR A;  3I96 A;  3VQS A;  3MR6 A;  3UD4 P;  5KFK A;  4DUT A;  3GON A;  4AL6 A;  1FJG F;  1U2F A;  1WF0 A;  2LEA A;  2PEB A;  4C0B A;  4ECQ A;  1F9H A;  1NU4 A;  2F4F A;  3O44 A;  3W63 A;  3HT3 A;  4A8K A;  2VIC A;  4F0H A;  2ZDO A;  2C2O B;  2EW9 A;  1RT5 A;  2R7O A;  3X1L B;  2ZEJ A;  2ALY B;  5DDR C;  1R3N A;  2FVC A;  5F8N A;  3POT B;  5HK4 A;  1WKL A;  2OKQ A;  3OUY A;  4ES2 A;  3KK3 B;  3DLK A;  5A8R B;  4XDD A;  3V4I B;  2OD6 A;  3W3S A;  1IWG A;  1KD1 T;  1NBE B;  2M88 A;  2O3D A;  5KFX A;  4AT1 B;  4QIF A;  1RUS A;  2A10 A;  2C1E B;  5HVH A;  4M63 A;  2ZVI A;  4KGZ B;  4OV6 A;  4Z7C A;  5JVG Q;  2DCU B;  2DNN A;  1RWN B;  2WSE C;  4ZHR B;  5L8R C;  3MFH A;  2E7V A;  1WG4 A;  2V4J A;  3LAL A;  4ZPT R;  4DV1 J;  1Y7P A;  2IPO B;  1RT2 B;  2QTW A;  2ZUG A;  2HGM A;  3LO3 A;  1FFW B;  1BUX A;  1X7V A;  2KM8 C;  3NGS A;  3G8Q A;  5KFZ A;  1LFP A;  4KT0 C;  3DMJ B;  4DL7 A;  3HVA A;  4QR1 A;  1FFS B;  2W9B B;  4FF1 A;  4Y34 A;  3D1O A;  4N41 A;  5G0R A;  3BRE A;  3D7S B;  5B08 A;  2RQC A;  3PIP Q;  5F8L A;  2YX7 A;  3W65 A;  3UNY A;  3QJL A;  3GMG A;  2ATC B;  4DV3 J;  4AL7 A;  2HHV A;  2OEM A;  2CNK B;  3LP2 A;  2B51 A;  3IRX B;  4ILR A;  5DQI A;  1CQN A;  4I2P A;  5HVF A;  3B78 A;  4RW8 B;  3CJ8 A;  1NXI A;  3MFI A;  1J2V A;  2HFO A;  4DN0 A;  3J81 U;  1VBY A;  2MXY A;  5D0R A;  4IG3 B;  1Y9O A;  4KHM A;  1HL6 A;  2L9N A;  3D28 A;  3DKD A;  3N5F A;  1RCX B;  5KG5 A;  1CJT B;  1OYE A;  2MKI A;  2M2B A;  3UN5 A;  1KOO A;  2PII A;  4OI2 A;  3DGP A;  4A48 A;  1HR0 J;  2DNP A;  4HR2 A;  3CUN A;  5H9E J;  2OTL S;  4ZP7 A;  3D1Q A;  4TQR A;  3BR8 A;  5DLG A;  3RW7 A;  4H4M A;  4LT6 A;  2I2Y A;  1HLW A;  3F56 A;  2DO0 A;  4O3N A;  4LFC F;  1LWF B;  1RQ0 A;  3ZXW A;  3HSJ A;  3OD2 A;  2E5L F;  3T1Y J;  1OY8 A;  1DY3 A;  5IC6 B;  2V34 A;  5B0B A;  3K7R A;  2EK1 A;  3OFE A;  4PWD A;  1FER A;  1VQS A;  4ZJQ A;  1XMQ J;  3DLK B;  5A8R A;  4USI A;  1NND A;  4Y2C A;  5LL6 d;  5KFR A;  4DR5 F;  3RBZ A;  2GCF A;  1RHM B;  3M9O B;  4JI4 J;  2DHG A;  4ZPW R;  1B0T A;  5F0U A;  4DWI A;  3O1L A;  4KQZ A;  5LJ5 Y;  2WVC A;  4NX9 A;  2YNG B;  2L9D A;  2QYC A;  3MAA A;  4UF4 A;  4W4M A;  4F67 A;  4X64 J;  2XMU A;  4NCG A;  2FPH X;  5KOX A;  1XMQ F;  3UE2 A;  4ZN1 A;  1T9X A;  2RS2 A;  3QO9 A;  3R7N B;  2Z2Z A;  1VQ4 S;  2JRS A;  4JI2 J;  2GS8 A;  1J27 A;  1XIQ A;  2CJX B;  4LFA J;  3W64 A;  2HS0 A;  2D9O A;  3TZY A;  1WF1 A;  1NB7 A;  4LRC A;  2CPZ A;  1ZAX A;  2DNH A;  4ILL A;  3M2U B;  1GMW D;  3P4U B;  1FK9 A;  3DLJ A;  2CDQ A;  1WC0 A;  3R5B A;  5KFA A;  4ZN3 A;  4KHP F;  3BKT A;  3D1H A;  5IWA F;  1UFW A;  1RTD B;  4JI5 F;  2V2Q A;  2APO A;  3DXS X;  1IXK A;  1XER A;  2J9E A;  2NZ4 A;  5HMY A;  2IBO A;  3FQK A;  1L3V A;  1X4G A;  3GU0 A;  4NLR A;  1Y5I B;  3G6X A;  4DV6 J;  5ETK A;  4K4W A;  1YQH A;  4LJM A;  3OJU A;  2DB1 A;  2NZC A;  4DPU A;  2CZ9 A;  3DI6 A;  3VAH A;  2F7V A;  5CCM A;  2GVZ A;  2KVI A;  3CJ5 A;  4QIG A;  2YKA A;  2RQM A;  3MEK A;  4PAA A;  2MZQ A;  2EG1 A;  5T7L B;  3AT1 B;  3SQO P;  2B6A A;  4CLW A;  4JV1 A;  2VG7 A;  4R25 A;  4O23 A;  3S6E A;  1U09 A;  4KGK A;  3KLH A;  1VQ6 S;  2DBB A;  1RWV B;  4IFY A;  3DM2 B;  1M5O C;  4I6Y A;  4XIU A;  3J7Y U;  3ONQ A;  3PHE A;  2DH8 A;  1XC9 A;  3W62 A;  4ZVE A;  1HI8 A;  4MKA A;  4QIW D;  4C0O C;  1PSD A;  3UQS A;  4DPO A;  4Y00 A;  3KWM A;  3MDF A;  1O6X A;  2IAJ B;  2KKH A;  1K1Q A;  1RTI A;  1PYS B;  2MDA A;  3PR5 B;  3T5K A;  2P9E A;  2NSB A;  2KYX A;  4MIB A;  5KFF A;  3FBB A;  4ZCI A;  2G9O A;  1RHU B;  4WKY A;  4A4J A;  1U4B A;  1VQK S;  2J6S A;  1SC6 A;  3SCJ E;  1SKW A;  2QLB B;  2HVZ A;  1MW7 A;  3MF5 A;  3PEJ A;  1HW9 A;  5A8W B;  2E29 A;  2E1P A;  2F65 A;  1W26 A;  3E8O A;  3UW1 A;  2UZA A;  4NCG B;  4G1P A;  4RW7 B;  4ELU A;  1NKC A;  3R1H A;  1K0T A;  3SIP B;  1P27 B;  2HNY B;  3CDB A;  3NGT A;  4TY9 A;  3PY8 A;  3I32 A;  1N52 B;  4QWB A;  5HQ8 A;  1HWK A;  3C14 A;  1H7W A;  3EM1 A;  4Z37 A;  1RYS A;  4X4S A;  4N5S A;  1CJV B;  4OYP A;  4ID5 B;  1KLN A;  2RRB A;  3HHN B;  4PWD B;  3G86 A;  2BKP A;  4NA3 A;  3ZFV A;  1SPB P;  2UV8 A;  2GX8 A;  4X2B A;  1D09 B;  5DDQ C;  4DN9 A;  1SV5 B;  4CQ1 A;  1X0F A;  2QC3 A;  1R8A A;  1X31 C;  5F3Z A;  2H4Y B;  3HVW A;  2C2N A;  2DD8 S;  1CUL A;  1RWP B;  5I42 A;  1S6Q B;  2F8H A;  2WBR A;  3PXG a;  3NNH A;  1ARO P;  1YZ7 A;  2LA6 A;  1FRJ A;  2HND A;  3G82 A;  4FS1 A;  1PYT A;  1R8H A;  4ECS A;  3PX4 A;  1FE4 A;  1S1U A;  1SI9 A;  1MWZ A;  2IJF A;  3DHW C;  3EVO A;  2KHD A;  1RHQ B;  2HMI A;  1C0U B;  1MN9 A;  1RAO A;  2B5J B;  1CJV A;  2YWW A;  3OTE A;  3ILL A;  4Y6I A;  4JUZ A;  5K8M A;  1O51 A;  1RA6 A;  3NS7 B;  5E2Q A;  2CQ1 A;  5HP1 A;  3M8Q B;  1WDD A;  3V2U C;  1VI7 A;  1T11 A;  1N4L A;  1N6Q B;  2UUC J;  5CCL A;  1SQF A;  2AIR B;  2ZOF A;  4J9K A;  4PKD B;  2DO4 A;  4I2P B;  3TRG A;  4RNO A;  2DVI A;  2BJE A;  4PG5 A;  1YHQ S;  3FCV A;  3LAK A;  2WVB A;  4YB5 A;  2QLX A;  4WFZ A;  2R7T A;  3CC4 S;  3D6F B;  3FMW A;  1IQT A;  4U6P A;  5E3C A;  4ZVS B;  4IOC Q;  3I9Z A;  1V3R A;  2VBY A;  2HS4 A;  3CCZ A;  1SUQ A;  2QJ3 A;  3DDK A;  4PXB A;  4AUK A;  4ECY A;  1D9F A;  5G0R B;  2U1A A;  5K20 B;  3AJD A;  1EKR A;  1YJ7 A;  2B5J A;  3RYL A;  3ZZP A;  4QYR A;  2ZH6 A;  4QZV B;  1UL3 A;  3MMJ A;  4OI3 A;  3MUT P;  3K5M A;  1VLY A;  4DQS A;  1QUP A;  4DSE A;  4IH7 A;  4J37 A;  3KHR A;  2ZH1 A;  1NME B;  2VB6 A;  4NRT A;  4M8L A;  4F4A A;  2UXB J;  2W25 A;  4I1T A;  2E5J A;  2NXN A;  4LBH A;  2AYB A;  2FZC B;  4ZVP B;  3OTC A;  3D54 A;  4WE1 B;  3UD5 A;  3H25 A;  4OJG A;  3NEK A;  4MKV A;  3SMZ A;  1L3U A;  3CDA A;  3O2I A;  2UUC F;  4OYX A;  2X7I A;  1S12 A;  3VAF A;  4JI7 J;  1Q7L B;  3CJ3 A;  2G0C A;  5RUB A;  3CMQ A;  3PW5 A;  4P10 A;  3WC0 A;  3GJQ B;  1AFI A;  2VJV A;  4U9R A;  2HAI A;  3LTO A;  3LWM A;  3TR5 A;  5LSO A;  1R43 A;  1MLA A;  1TKX A;  1IKW A;  5M2U A;  3MEC A;  2L9W A;  4OHW A;  4E2F B;  3GV7 B;  3PYE A;  4USV A;  3SEO A;  5KG1 A;  2XY6 A;  2IYG A;  3A8K A;  2C2K B;  3N6M A;  3THP A;  3GTY X;  3CJ0 A;  4YB1 P;  1M5P C;  3CIZ A;  4IRD A;  4LF5 J;  1S7H A;  1HIY A;  3AH6 A;  5C2C A;  3DRP A;  2ASL A;  3E2E A;  1N33 F;  4OX7 A;  3M2V B;  1NJI T;  4PQU A;  2HLU A;  2NPF A;  2ASY A;  4ES1 A;  4YP3 A;  5E7O B;  1G2E A;  1HNZ F;  4URS A;  4K4X A;  3D3C J;  3HFZ B;  1FNO A;  4F4Y A;  2RQK A;  2AKW B;  3W60 A;  1F6T A;  1YJN S;  2QT7 A;  2RDD A;  4E98 A;  4NI2 B;  5HBM B;  1YVF A;  4GKJ J;  4N47 A;  2B3T B;  2GIR A;  1FWK A;  3CJK B;  1HBM B;  2AD9 A;  2NS1 B;  4ZVH A;  5L39 A;  3BF4 A;  3CJQ A;  1I94 F;  4C4W A;  2N7C A;  3F73 A;  1CJU B;  1T95 A;  2BVZ A;  4PUO A;  2AZ3 A;  1W25 A;  2PFF B;  3I56 S;  2HVH A;  4WII A;  1K1S A;  1VQP S;  1IJE B;  4O3R A;  2P9G A;  1BWV A;  5LSR A;  2A2D A;  3ISN D;  4Y2I A;  1RWX B;  1ZPW X;  2JH3 A;  5IXU A;  2CXE A;  2XGQ A;  3ENW A;  5G4D A;  2VFU A;  5DQH A;  3RRG A;  3OVS A;  1TU0 B;  3MCM A;  1KSP A;  5CHC B;  2AEF A;  3D3B J;  1RT4 B;  4WP3 A;  4ZA1 A;  5KG7 A;  3ZNU A;  4DI6 A;  2HGN A;  1RT1 B;  4USH A;  2AEM A;  2YQ1 A;  1V5V A;  1BE4 A;  4ZVG A;  5HN0 A;  3B54 A;  2XLJ A;  4KB7 A;  3BO4 A;  4KPY A;  2GZO A;  5D6G A;  3BQ2 A;  4I67 A;  1TTH B;  3OR1 A;  1WKK A;  1KP6 A;  3W5Z A;  1GFW B;  2XMM A;  2MHE A;  2CQ0 A;  5F3T A;  4USM A;  7AT1 B;  3KTQ A;  1FKO B;  2MKC A;  3MAQ A;  5F8G A;  3DLB A;  1X4F A;  4JI1 J;  3CIM A;  3MCS A;  5EWE A;  4RBT A;  1HBN B;  2ZNZ A;  4LF6 F;  1U2C A;  4ZVQ B;  1PBA A;  2BE2 B;  1HNX J;  1KKH A;  2XZD B;  1FVQ A;  3MXH P;  1JB0 C;  3VWS A;  3U1M A;  2XS7 A;  2XI3 A;  1F60 B;  1X4E A;  1UKU A;  1KDN A;  3QPI A;  1HWU A;  1RAD B;  4X4N A;  3QJP A;  4MIW A;  3AY0 A;  2KTQ A;  2OEJ A;  4M1K A;  2HKE A;  3HUL A;  5HAN A;  4OJ3 A;  1GXL A;  1SL2 A;  5AXN A;  2W7O A;  1DLO B;  2DGW A;  4PYA A;  2PA8 D;  4KC5 A;  4ZCK A;  4CH0 S;  1DTT A;  5B09 A;  2PI5 A;  2GFF A;  3OL6 A;  3JYT B;  4A8X A;  1JXE A;  4HTI A;  4ZVT B;  4CTA B;  2UVV A;  4XK8 C;  4ZLP A;  2X1A A;  2ZM6 J;  3GJS B;  3VAJ A;  4ECX A;  1FRH A;  4M5L A;  1S9G A;  4QIV A;  4JI2 F;  4O44 B;  2JFD A;  2CA9 A;  2XZT B;  3OXL A;  4IDK B;  5CYQ A;  1B99 A;  1E6V A;  2BRK A;  5L9X A;  2CAJ A;  1EHW A;  2DGV A;  5D4P A;  3VGT A;  3VAI A;  4DV5 J;  1FI4 A;  2VH7 A;  3W9J A;  4JYA F;  4QPT A;  1YI2 S;  4B3T F;  4UT4 A;  3H7H B;  5AJ3 F;  2BV3 A;  3HO1 A;  1OY9 A;  3IS9 B;  2HG4 A;  1U0S A;  2OTJ S;  2NXE A;  4QR2 A;  1OWX A;  1QVG R;  2KYZ A;  2AX0 A;  1CJT A;  4B9T A;  1HNV B;  4HKQ A;  2PT0 A;  1RKI A;  2MKH A;  3C15 A;  2B4U A;  4GC7 A;  4ANC A;  4IG3 A;  1RYR A;  1NDL A;  3D0G E;  1RAC B;  4KV8 A;  2YQ0 A;  1WC3 A;  2C2Z B;  2CRL A;  5E5N A;  1IKX B;  3OTB A;  1FXL A;  1OYD A;  1Y10 A;  2NQP A;  2GMH A;  2FYX A;  4EK2 A;  1AUD A;  3SCI E;  3TUI C;  2EG2 A;  3M32 B;  2Z57 B;  4TQS A;  1VMB A;  4NLY A;  3FSI A;  4H4M B;  3KJQ B;  3LH2 S;  3MEG A;  4OZN A;  2ZH2 A;  3H59 A;  5KFU A;  5KAK A;  4DR7 J;  1KLM A;  4DL4 A;  1YSJ A;  4OX8 A;  1JLC B;  3AB4 B;  2MSS A;  2QA4 S;  1WEY A;  3KXD A;  5LOQ A;  4ELT A;  4LF9 F;  5L1I A;  1JLB B;  3M4X A;  2ZUA A;  1NK4 A;  2E5G A;  1NRK A;  4LVO P;  4FBU A;  2XO7 A;  4WTO B;  3W66 A;  1R7I A;  5C24 A;  1BQM B;  1WUU A;  3ZZY A;  4ZLJ A;  2HAF A;  3SQG A;  2H5I B;  2MZS A;  2F4V F;  2W4P A;  5K8P A;  2EC2 A;  1Z2Z A;  2QRR A;  4B9U A;  3HLU A;  2J6T A;  2J0Q D;  4DR7 F;  2PGC A;  5L46 A;  2HQC A;  4ZOS A;  2BDP A;  3CCE S;  2V68 A;  3QLH A;  4ZCL A;  2IVF B;  4DUY F;  2ATL A;  3L7O A;  3HVR A;  3CCM S;  1UVL A;  4DR6 J;  1U0H B;  2AYG A;  1OS5 A;  2EFV A;  4Q2M A;  3JTP A;  2ROG A;  3BEG B;  5IT9 Y;  1XNQ F;  1G6B A;  3PX6 A;  3OHB A;  1UW4 A;  5A0Y B;  2UVU A;  4Q5V A;  3DMJ A;  5HAO A;  1B7F A;  1T9Y A;  5JXS A;  2BOP A;  2IIH A;  2IYI A;  1UTA A;  2CPI A;  2VFR A;  4WK3 A;  4N8O A;  3AD7 C;  3J7Z 5;  1JLQ A;  4WXO A;  2N3L A;  5HVG A;  4UQG A;  2NUH A;  1EET A;  3M8Y A;  4B3T J;  4L72 B;  4OHV A;  5K14 A;  2QMX A;  2KH9 A;  4DV5 F;  2YH1 A;  2QEX S;  2W9A A;  4NLO A;  2ZKT A;  5E41 A;  4C97 A;  3MZI A;  4BC7 A;  3KLE A;  1S6O A;  1SXL A;  3W9H A;  2OH2 A;  2HVE A;  4B3R J;  4PAB A;  2W2Q P;  5B0E A;  2IC3 A;  4LRB A;  2LEB A;  4NLX A;  1VQ8 S;  3HHL C;  1S1W B;  5J1P A;  5DJB A;  2HQG A;  4M95 A;  4O4G A;  3CTR A;  3BR9 A;  2VG6 A;  3K5P A;  2VA3 A;  4ED4 A;  3DGV A;  5A8W A;  4H4O A;  1TAQ A;  1HMV B;  3AOA A;  5H9E K;  4JI6 J;  3N6L A;  3RJM B;  2WB1 D;  5KFJ A;  4QWC A;  1ULR A;  3GP9 A;  2CQD A;  1UET A;  3GFX A;  3I0R B;  3VAK A;  4ZJO A;  3QT6 A;  1U1L A;  3WC2 A;  3ZTS A;  1SJR A;  2HIY A;  4M5M A;  2LYV A;  5BJR A;  1NO8 A;  5LMU F;  5C2G A;  2KM8 B;  2CNN B;  4C8Z A;  4USW A;  2RF2 B;  1ITP A;  1LNQ A;  2HBR B;  3BN4 A;  3GFY A;  4USJ C;  2RRN A;  3JAM U;  4DL2 A;  2I5J B;  1IR0 A;  3DM2 A;  3H42 A;  4IOA Q;  1DLO A;  1SUQ B;  4TN2 A;  2EBE A;  3L7P A;  3UNG C;  2QL9 B;  2Y1I A;  2AYE A;  2V9W A;  2VC1 A;  2CFX A;  4LR8 A;  4RJV A;  5GAH I;  2UV8 G;  3KK1 A;  1VJW A;  1LWC B;  1RT7 B;  1TL3 B;  3UCU P;  1FDN A;  3M8P B;  1O8B A;  4LF2 A;  1QAJ A;  5K9F A;  2IDL A;  2P2C B;  2WVF A;  4MMO A;  3DI6 B;  3TUJ C;  4DPX A;  4NAS A;  4K4U A;  2KFY A;  1VHF A;  4OHX A;  4EWT A;  4ETX A;  8AT1 B;  4DL6 A;  3CXC R;  3R9L A;  2V4Q A;  3FMB A;  2B9W A;  3QT8 A;  1U48 A;  1FJE B;  3J7A N;  2DGS A;  4QYZ K;  1S1U B;  1LW2 B;  5AXL A;  3NNC A;  3W61 A;  3DLH A;  1RA7 A;  3G82 B;  2PI4 A;  4DR6 F;  4NYP A;  3N01 A;  2LU1 A;  3MUV P;  2CG4 A;  2RDJ A;  3UR3 C;  4OZ0 A;  2VBX A;  4BDP A;  3CCV S;  1RI7 A;  2QX0 A;  3HHD A;  4X4V A;  2E66 A;  3PW4 A;  1OY6 A;  2IJR A;  5LMN J;  3EVW A;  4B9S A;  1H98 A;  3HKW A;  2R2S A;  5D3G B;  1I6J A;  3V6J A;  1WDT A;  3KK1 B;  3EWG A;  1IBL F;  2AWZ A;  2AYM A;  3I5C A;  2Z58 B;  3FQL A;  4OZ1 A;  2HBZ B;  2LP4 A;  1QTN B;  2A3J A;  1KFD A;  2LVW A;  2A18 A;  1HNV A;  2DNQ A;  3M8Z A;  4TLR A;  4NCA A;  1D0E A;  1RGV A;  1ZPV A;  2HQF A;  2IA6 A;  2QO3 A;  4HT5 A;  1Y5N B;  1SCJ B;  1PIE A;  2EXU A;  1X4C A;  3EGZ A;  2KG1 A;  1FEH A;  1FO1 A;  3IS9 A;  1M1H A;  4HL9 A;  4DOZ A;  2H54 B;  4YY3 F;  3C6U A;  2HZA A;  5H9F J;  4IO9 Q;  1B7Y B;  3W9I A;  4ED3 A;  2C42 A;  1WC6 A;  3TOQ A;  4WK1 A;  3CCW A;  3OFG A;  4Y65 A;  1VRU B;  3HZG A;  3A13 A;  3FKB A;  3PM9 A;  3V81 B;  1RT2 A;  3IBW A;  4B9L A;  4WYL A;  4ITS A;  4YHH J;  1D1U A;  3P8B B;  4ZPB A;  4NE9 C;  2NYI A;  2WAQ D;  3M2V A;  2IAJ A;  3R97 A;  3SZ2 A;  2IRX A;  2DNL A;  3ILI A;  3W1Y C;  5JJB A;  1S10 A;  1RHK B;  1S7I A;  4X84 A;  4HI2 A;  5AE3 A;  3QRQ A;  1VC0 A;  4FF4 A;  3I31 A;  4TU8 A;  2F5G A;  3OSN A;  4EYI B;  2VPW B;  4J9M A;  2KT3 A;  2ZBC A;  1YIT S;  4F7V A;  5BR8 J;  2EFO A;  5HQM A;  4LIW A;  4MKY A;  2GJI A;  1OMS A;  5CYJ A;  3GFH A;  3UDL A;  1N0U A;  2FZG B;  3RR7 A;  5FDL B;  1LW0 A;  1GEH A;  1R31 A;  2DT9 A;  4PPD A;  4JI0 F;  1HW8 A;  3CDW A;  4Q45 A;  1G4C A;  3GG1 A;  4FPI A;  1KEK A;  1C0U A;  1TEL A;  2AU0 A;  3C16 B;  2CQ4 A;  1JX4 A;  4RW8 A;  3THT A;  4DR3 J;  4TY8 A;  3KLF B;  3GYX B;  1VFJ A;  2W4D A;  2ZH4 A;  3CD5 A;  1IWA A;  1ROF A;  4I56 A;  4PG6 A;  1GX6 A;  3EJM A;  3J81 Y;  3PZP A;  1LWX A;  3MMC A;  2K06 A;  1ZTT A;  1SL1 A;  3Q22 A;  1H2V Z;  1U6B A;  5HL7 Q;  1VRT A;  4OLO A;  5DGB A;  4RO0 A;  1XEZ A;  4C8L A;  5U47 A;  3VR1 A;  2GW8 A;  3NBP A;  1WOP A;  3DRS A;  3SDE A;  2Y3Y A;  2YY3 A;  3DU5 A;  2M5Y A;  1IKY A;  5HLF A;  3M8R A;  3K8V A;  1Y5L B;  5EDW A;  3HK2 A;  2B4O A;  1FRK A;  1N8R T;  1JLA B;  1WSV A;  2AJF E;  2YPY A;  5KFH A;  3K5L A;  3V81 A;  1ZAW A;  2GC8 A;  1U0H A;  3ENQ A;  5GAH U;  5BYQ A;  1U49 A;  5IS2 A;  4EZ9 A;  4I4B A;  1JLE B;  4DCO B;  1RU1 A;  3A4T A;  3RAM A;  3QSI A;  3M8S A;  3CCU S;  1NSQ A;  4A8Y A;  3RR8 A;  2YX4 A;  4AXJ A;  4R5P B;  4RWW A;  4JV5 F;  2MJN A;  2EFQ A;  1T05 B;  4OZ2 A;  4NLG A;  2EC0 A;  2V2V A;  2YNG A;  1QM9 A;  3LA0 A;  2CDR B;  3JTN A;  3MAA B;  3OT9 A;  4KO0 A;  2XTJ P;  1MML A;  5MAO A;  3MD3 A;  1XMO J;  2JLG A;  5ETP A;  4IQX A;  3BH6 B;  4UOF A;  1S9E B;  1EZZ B;  4OYZ A;  5M2R A;  2E1R A;  2RH3 A;  4F4Z A;  1SJ4 P;  1BMQ B;  1RK8 A;  2ACY A;  2CPX A;  2AGP A;  1KQK A;  1D9D A;  2VQF F;  4NZ7 A;  1FTR A;  4UOC A;  1N5Y B;  2BEF A;  2G13 A;  2BJ1 A;  3BPD A;  3I0S A;  3PFO A;  2POK A;  1EJ7 L;  4PRF A;  1GXU A;  4BBY A;  3JTO A;  4DX8 H;  3MPD A;  4H4O B;  4CYU A;  5DM6 Q;  3IRW P;  2VAS A;  2HVI A;  5I3Q A;  2KO1 A;  1DFD A;  4HDH A;  2GHV C;  2UUA F;  3PJX A;  1IBC B;  3BH7 B;  3TUP A;  4RUB A;  3BS9 A;  4NL5 A;  3TZW A;  2A6M A;  2RIL A;  4X4P A;  3TA2 A;  1ZET A;  1J5E F;  4B3S F;  2B56 A;  2JEI A;  2WK4 A;  2E1M C;  3GV8 B;  1FHT A;  3M6W A;  4DDF A;  1FNX H;  1D9A A;  4PWU A;  4UQT A;  2VF3 A;  4TNO A;  3Q8Q B;  1LWC A;  4IO1 A;  2J8A A;  4ETZ A;  4C0H A;  3GIK A;  1HNZ J;  3KLV A;  5KG3 A;  3NY0 A;  2ERR A;  2L48 A;  2DXF A;  4NWB A;  2IVY A;  1E6V B;  2QFJ A;  1B64 A;  2RKI A;  4RR5 A;  3VV2 B;  3QMQ A;  3OHA A;  3MM5 A;  1JLA A;  1TL5 A;  4LR9 A;  4OJ1 A;  4YR3 A;  1GXT A;  1Q8B A;  4NI2 A;  3NMR A;  5IT4 A;  2C3M A;  2X3G A;  2ZZN A;  2CQH A;  4RW6 B;  1JLC A;  4NPO A;  4D3G A;  1LXN A;  4JI7 F;  3H5S A;  3FUY A;  3A3N B;  1EAY C;  4DX7 A;  3DOL A;  4M5K A;  4R5P A;  2HBY B;  3UDC A;  2BOA A;  4UUX A;  2MYF A;  5GAD I;  4ZP9 A;  2UXB F;  1VJQ A;  1W7W A;  2EFP A;  3PFE A;  2F8E X;  1RDR A;  2RD5 C;  4O0I A;  3SSR A;  2VQE J;  2XO6 A;  4DPT A;  3MM8 A;  3KKF A;  1VHI A;  3MEC B;  1L3T A;  4HH0 A;  1E6Y B;  2BZ2 A;  2XWX A;  3UPF A;  3MTK A;  5FDL A;  3BSC A;  2R8G A;  5D78 A;  1DAR A;  3KMQ A;  1JNR B;  1H2T Z;  3OXG A;  3QZ8 A;  2HNZ B;  1ZM4 A;  4MJK A;  1FEE A;  4CNY A;  4WE1 A;  5BR8 F;  2PA3 A;  3LGM A;  3MGJ A;  2GV1 A;  4ICL A;  2IRU A;  2JC1 A;  4WWS A;  4CP5 A;  2OPP B;  4DFJ A;  1Z2L A;  3TVK A;  2J0X A;  1QSL A;  1KRP A;  1RKJ A;  1PG5 B;  2B8P A;  3QWU A;  2HK2 A;  1JLG A;  3FVY A;  2CQC A;  4L74 A;  6FDR A;  1W2B R;  1SQE A;  1HHT P;  1QSY A;  1KTV A;  3TJ9 A;  4KH0 B;  4TY8 B;  3OVB A;  1SVD A;  3D9B A;  4NEZ A;  1NH7 A;  1CVJ A;  3D68 A;  4FP9 A;  2EI5 A;  4IFV B;  4HVZ A;  4L75 A;  4AND A;  2MZJ A;  4CTA A;  4ENO A;  2ZH5 A;  4LF8 J;  5LJ3 Y;  3BPS P;  2RVJ A;  3FZB A;  3GR1 A;  4P7V A;  5I3P A;  1NKB A;  1R8B A;  2DIS A;  4LSZ B;  2ZOM A;  7FDR A;  2C2D A;  3M6U A;  5DGA A;  1HR0 F;  5AXM A;  2DGO A;  4DUZ F;  3VHQ A;  4B9N A;  3US5 A;  1CSJ A;  1V6H A;  2AHO B;  4V1A k;  4O3O A;  1MMN A;  2NUU G;  4O4R A;  4NXM F;  1IVZ A;  1I3O B;  4DV0 F;  2KT2 A;  3UWT A;  4RW9 B;  1TK5 A;  4CO1 A;  3KJV B;  3M05 A;  3QRP A;  5KT3 A;  3RZA A;  3LP0 A;  4CNZ A;  5J2P B;  2V6A A;  5I3U B;  4A8Q A;  1VK8 A;  4OIX A;  1BC6 A;  4NYZ A;  4HLB A;  2OJ3 A;  2DR8 A;  4DR2 J;  1Q5Y A;  3CSK A;  3MM9 A;  2YWE A;  2JVO A;  3MM6 B;  2E44 A;  5L1J A;  1UA0 A;  2HHU A;  4K4T A;  3MAH A;  2CQ3 A;  3ZTR A;  3RB6 A;  1OQ6 A;  4DXL A;  3KK3 A;  5F8I A;  1FD2 A;  1FF2 A;  2VG7 B;  3N6N A;  4LQ3 A;  3H40 A;  4H4K A;  4QQB A;  4DCP B;  3AA8 A;  2VQF J;  2H1Y A;  1R0A B;  2K1R A;  2BJ7 A;  2QA2 A;  4HTJ A;  4DV1 F;  3H5U A;  4RW4 A;  3V6H A;  1FWP A;  3RB0 A;  1NHV A;  3CC7 S;  2VPY B;  3EXC X;  4PWW A;  4LSN A;  3JSR A;  1HBO B;  2I0X A;  2K7K A;  4O3P A;  3QBC A;  3DC2 A;  5ETV A;  2Z30 B;  5F41 A;  1DQ8 A;  2L3M A;  2VBZ A;  3I5B A;  5DS7 A;  5LXY A;  3BBC A;  4MIA A;  4OJH A;  1KON A;  2XMT A;  2YQ3 A;  3NGD A;  3THV A;  2KDO A;  4URQ U;  3KMS A;  2RU9 A;  2KRB A;  2NRE A;  2R8I A;  1TZ0 A;  1XJW B;  2YWK A;  1UVJ A;  1AUS L;  2DH9 A;  2J6U A;  4RUC A;  3PYD A;  4QIE A;  3JSM B;  2YPZ A;  3VTI A;  2IM3 A;  4F50 A;  1RT7 A;  1TL3 A;  1FJG J;  4J9Q A;  2EWH A;  2XI2 A;  4JV0 A;  3TA1 A;  3WIU A;  4FDF A;  1UEV A;  3QT7 A;  3I87 A;  3CME S;  1N5T A;  1RAH B;  1YJT A;  3HD2 A;  2Q6C A;  1S1T A;  5AE2 A;  4N7T A;  3G71 S;  3QAU A;  5L1L A;  5IWA J;  1FRL A;  1WSR A;  2KU7 A;  4JI5 J;  2JHE A;  2D3O R;  1EB0 A;  2RE1 A;  2DNM A;  2J8S A;  1PJ7 A;  1EX8 A;  2JL9 A;  5B0D A;  4FF3 A;  1UFK A;  1OSC A;  2XZW A;  2DNG A;  4P2M A;  5F0W A;  5EHH A;  1R0A A;  1XNR F;  2UXD F;  2KFN A;  4EBE A;  1YJ9 S;  1UPM B;  1CS4 B;  1S6U A;  1V9O A;  2I9S A;  1L3S A;  4USU A;  2W9C A;  1S4E A;  2ZZM A;  1NM2 A;  1TUG B;  1PCA A;  4QPX A;  1IUJ A;  3RU0 A;  3SV3 A;  1YTY A;  1PAU B;  2FUG 9;  4DEZ A;  4ED7 A;  3N79 A;  1F5C A;  3OR1 B;  2CQG A;  1KBR A;  5C5J A;  1WWH A;  1RCO B;  4XTT A;  4ECU A;  2LU2 A;  4K0K J;  1X5S A;  2ILZ A;  1FK9 B;  4IH5 A;  2FD2 A;  4RWX A;  4DR5 J;  3L7U A;  4A46 A;  1E6Y A;  1SKU B;  2ROE A;  3HT0 A;  4OFZ A;  5F9L A;  1S9F A;  3JQK A;  2K3K A;  2ZD1 A;  4IRK A;  2Q79 A;  3H8Y A;  3HHK A;  2A0F B;  4YHH F;  1WTB A;  3CD6 S;  3MR2 A;  4BCA A;  5CD4 H;  1F1B B;  4NRU A;  4EBD A;  4G65 A;  4WP8 A;  2KJV A;  5D0G A;  4DQI A;  3C2P A;  2NPI A;  1N48 A;  4RLE A;  3RTV A;  3HSZ A;  3NS5 A;  2FJX A;  3KG1 A;  3U7J A;  3PX0 A;  4ALZ A;  5ITH A;  1S6P A;  2DXD A;  2D41 A;  3GIJ A;  2Y9H A;  4EGL A;  2H5E A;  1JLF B;  5H1S V;  2DJW A;  1R89 A;  3MM5 B;  4F36 A;  3DLE A;  1UJ5 A;  2BMB A;  5GVQ A;  5T14 A;  3NBP B;  1ZOT A;  3D67 A;  4K2X A;  1N54 B;  2ACM A;  2P6T A;  3CD7 A;  4IFY B;  5C25 B;  3UCZ P;  1T03 B;  2MLZ A;  3TJ8 A;  3AQP A;  3CO0 P;  3LGH A;  5D4O A;  4MKB A;  5B0C A;  2KZZ A;  1KN6 A;  1MU2 B;  1PGZ A;  2RML A;  1UWA A;  2GJF A;  2DIT A;  3TEH B;  3KLG B;  2P6S A;  1HA1 A;  3S1T A;  3MHY A;  1PBU A;  3CMA S;  3ISN C;  4ED8 A;  1UEU A;  2E9Z A;  2DNK A;  2H3E B;  2Z0G A;  2HFN A;  4DSL A;  3C16 A;  2OGU A;  2G4B A;  5EWF A;  2OI2 A;  1ZM3 A;  2IA0 A;  3BGL A;  2BXJ A;  1IKW B;  1TKX B;  5GMK a;  4DJB A;  3EZ5 A;  1U47 A;  4V19 X;  4K4S A;  3C15 B;  4C7Q A;  3DRR B;  2E1A A;  2HYI B;  4Q8E A;  4WZM A;  2YH0 A;  4A47 A;  1KR4 A;  2IRY A;  3IGN A;  4NZ0 A;  4CYU B;  4YR2 A;  1B70 B;  3AOD A;  2MB0 B;  2CIM A;  2LQ5 A;  3AXM A;  2ZNY A;  3HDS A;  4EFA C;  3I6P A;  4J9V A;  1QAI A;  1GH8 A;  3G8T A;  4DS4 A;  3LP1 A;  4BLG A;  3CPW R;  4RU2 A;  2EFN A;  4OYI A;  4J9S A;  1RWK B;  3FRY A;  3CCL S;  4FXD A;  5ETQ A;  2JLE A;  2XSJ A;  4J5O A;  3H2U B;  1RHJ B;  1C4C A;  1VQY A;  4WJB A;  2WB4 A;  3IAM 9;  3C66 A;  2W9B A;  2CZ4 A;  3OV7 A;  1CBK A;  1JLF A;  2V67 A;  4H54 A;  4DL0 C;  1JQG A;  3Q23 A;  1LK5 A;  2WCX A;  2Y1L B;  4KV8 B;  4EO8 A;  3GZ7 A;  3JB9 k;  3T5L A;  4F4K A;  5E0O A;  5AE1 A;  1SC3 B;  3H5X A;  3JQJ A;  2RIJ A;  4OQJ A;  2ZM6 F;  2J5A A;  2RQ4 A;  4UOH A;  3OSP A;  3KNA A;  1Y00 A;  2G2O A;  2OPQ A;  3MM7 A;  1S48 A;  1ZZF A;  5C42 B;  3HHL D;  1KNZ A;  3Q8S B;  2VDI A;  3CCJ S;  2EFG A;  2ADC A;  4YR0 A;  5KT4 A;  1XWL A;  5SZT A;  1S1X A;  1HI0 P;  2DPJ A;  1R0C B;  2QG9 B;  4OL8 A;  3FFI A;  3G6V A;  1N6Q A;  5EWG A;  3G9C A;  3GJR B;  1U6Z A;  4A8M P;  1LWF A;  1FCA A;  4Q0B A;  3IAS 9;  4K5R A;  1H73 A;  2XY7 A;  1FDA A;  4A8W A;  5HRO B;  2QLJ B;  4WFX A;  1RP5 A;  3IN5 A;  4DV4 J;  3KHG A;  4LF6 J;  4KKO B;  3SXL A;  2DNY A;  1FKO A;  3RB3 A;  4U7U K;  2PE8 A;  3BZQ A;  2IHR 1;  4K4Y A;  4OZL A;  3M9N B;  4B3R F;  2IVM A;  4EO6 A;  2QE5 A;  1AXQ A;  3P96 A;  2CYY A;  2KJW A;  2CPD A;  4X4U A;  1Q0N A;  4TYB A;  2LA4 A;  2BJ8 A;  2FHO B;  2HHT A;  2W9C B;  4OI6 A;  3KHL A;  3WHI A;  3GIR A;  3M2R B;  5FD1 A;  4IH6 A;  3HHL B;  1FKP A;  4FNI A;  3ZZU A;  4A8S A;  2AJ1 A;  3ZTP A;  1UW9 A;  5I4M A;  1UVM A;  3RW6 A;  1GMU A;  5KFB A;  1FX2 A;  1FX4 A;  2BE2 A;  2PD1 A;  5CH7 B;  5KFP A;  2EEY A;  4JI3 F;  2XMV A;  1S4F A;  4PYD A;  1LXJ A;  2RS8 A;  4IUF A;  2ALZ A;  2VG5 A;  3LW5 C;  1AT1 B;  3PYF A;  4RBU A;  4CRJ A;  2AJ2 A;  2OAU A;  1SH2 A;  1X4A A;  4USK A;  2UU9 F;  3NMA A;  3QGG A;  5CD4 A;  3PRB A;  3ISZ A;  2IJN A;  4Q44 A;  2XGP A;  1PC4 A;  3CJK A;  3GCX P;  4DU7 A;  4C2M A;  1TK8 A;  3P49 B;  3CJR A;  3CCQ S;  4EMD A;  3TUZ C;  2FLO A;  4QWD A;  3CCS S;  1D8Y A;  3OTO F;  3DXB A;  4NLT A;  1OIA A;  1Z1Z A;  2PMW A;  3NGU A;  2FJE B;  5EUH A;  4O44 A;  4ZK7 M;  2XBP A;  4QJV A;  3FEZ A;  3EX7 B;  1NZ8 A;  1KS2 A;  2COL A;  3R6G B;  1SJ3 P;  2ZJP Q;  2R42 A;  3DRP B;  3PRV A;  3EZU A;  4P74 A;  4WPA A;  3OL7 A;  1U1R A;  1UCN A;  2MQ8 A;  1KTQ A;  2WHO A;  4PQA A;  3DRS B;  3SBM A;  4F26 A;  2G1H A;  3WIV A;  4XO0 A;  1FD8 A;  4OZ3 A;  2RHS B;  3PW2 A;  1NK8 A;  4NEY A;  2JSX A;  4DV7 J;  4LF5 F;  2HFS A;  4DX5 A;  1Q82 T;  4F0K A;  2GVD A;  2HS3 A;  3TX8 A;  3G6E S;  3SV4 A;  2E9T A;  1VIX A;  3NCQ A;  3C3L A;  5J1E A;  2MY8 A;  4KRW A;  3P3D A;  1X9M A;  3D6M B;  4KO0 B;  3KDN A;  1GQE A;  2M0G B;  3NS6 A;  2UVR A;  1HD0 A;  4RPF A;  1UWB A;  2C3U A;  4NZ6 A;  2WON B;  3QSY B;  2H5J B;  1U1M A;  1U1N A;  1HNW F;  1ZM9 A;  3QFH A;  3OVA A;  3G4S S;  4OX9 F;  3C46 A;  2B9Y A;  4IG0 A;  4ZKA A;  4PQU B;  1A0O B;  3PRD A;  1FXR A;  3E3X A;  3BSA A;  1JLE A;  1IN0 A;  2J9C A;  2J7W A;  4DBQ A;  4DFK A;  1JK9 B;  2XUL A;  4WFN Q;  3HPO A;  1MWQ A;  3U1N A;  2DHX A;  2LXF A;  1F0X A;  1S9E A;  5D77 A;  3LP0 B;  5J2P A;  1FDB A;  4P71 A;  3VF0 B;  4ZS6 A;  3E01 A;  4DG1 A;  5IM0 B;  3BV8 A;  4JYA J;  2FJB B;  3QGI A;  4Y2A A;  2CQI A;  1HQE B;  3PO4 A;  4FYY B;  2M7S A;  1U6F A;  4KHR A;  2GQC A;  2J0W A;  1UZD A;  4ZLN A;  2DEI A;  2YNI A;  4GKK J;  3DYA B;  1WJ9 A;  2DIV A;  2IFX A;  3W5X A;  4U7C A;  2QGF B;  3ZTQ A;  3IWX A;  4Q43 A;  1RAJ A;  1JJ2 R;  2UXD J;  3HZE A;  4NLP A;  3VGS A;  2LEC A;  1WHY A;  2K1R B;  2I5J A;  1S0V A;  2XYH B;  4UTG A;  2UUW A;  4CLP A;  2XWY A;  5KG6 A;  4DSF A;  2WRM A;  4L6V 3;  1GNK A;  3IBF B;  4J9O A;  4PZV A;  2HHS A;  5J2Q A;  2MTL A;  2XHW A;  4X4Q A;  1S59 A;  2C2E A;  4F3O A;  2HQD A;  2EPI A;  3EZO A;  1M1K T;  1VDH A;  3ICL A;  1CUL B;  4ZVO B;  5I42 B;  1HNX F;  1F2G A;  4I0W A;  1N56 A;  1NHU A;  3J7Y I;  2FY1 A;  5DZ7 A;  4OYA A;  5IC4 B;  4AL5 A;  2CNL B;  3PHT A;  3HD1 A;  3OL9 A;  2C2M B;  3EGV A;  4YOE A;  1YJW S;  1H38 A;  1YIJ S;  4FXV A;  3H0P A;  3G87 A;  3SFG A;  3K17 A;  2HQ3 A;  2RAQ A;  3C8Y A;  3L95 X;  4G6V B;  5E3Q A;  2ZE2 A;  3GV5 B;  4I6A A;  1C0T A;  1P9Q C;  3K89 A;  4CLY A;  2CJ9 A;  3NRB A;  1SH3 A;  1SH0 A;  3H90 A;  5GAD U;  1RWU A;  4GRS A;  3LOU A;  5DDO C;  4LBI A;  1X60 A;  2R7S A;  4ZMM A;  5HMW A;  3UVJ A;  3WZ0 A;  4DR1 J;  2XCA A;  3S01 A;  2ZBR A;  4OZJ A;  2W2N P;  2CQB A;  3MWB A;  2MPU A;  1KQF B;  1M5V C;  2J9D E;  4IDK A;  3GJT B;  1JLG B;  2AZ1 A;  2VFV A;  3TAM A;  2XCP A;  2A2C A;  2B7C B;  2RF2 A;  4DL3 A;  5J2Q B;  1I94 J;  4O3S A;  1CPZ A;  2BW2 A;  3JAM Y;  4ZCM A;  1TFY A;  4ICL B;  2RDI A;  1PIL A;  5EN1 A;  5DLF A;  1RIS A;  4NLD A;  4P2X A;  3N5B A;  2Y8W A;  3AB2 B;  4LMZ A;  1WOR A;  2GGP A;  4U8V A;  4CZC A;  2Z8Q A;  4WU3 A;  2HGL A;  2CNO B;  2MZ1 A;  1IBM F;  1CG2 A;  1WOO A;  3I0R A;  4DV0 J;  2BYC A;  4ED0 A;  3EGN A;  4I64 A;  3G6Y A;  2HWI A;  2BM1 A;  3WX8 A;  1WEX A;  3IR6 B;  2QSW A;  4M5H A;  5D4N A;  2BKO A;  4GMK A;  1LK7 A;  1RWO B;  2LQB A;  3MCO A;  4G1I A;  4KH1 B;  5IZH A;  3Q0A A;  1EQ0 A;  1DJ0 A;  1JNZ B;  4RNN A;  2PDA A;  3EMT A;  1ZM2 A;  4CO3 A;  2VON A;  1T02 A;  5J2N B;  5A2Q Y;  1ZBT A;  3BDE A;  5ETT A;  3SI8 A;  1VLO A;  2FC8 A;  2M52 A;  2XMW A;  1JKH B;  1TKT B;  1PC5 A;  4PG7 A;  5CA5 A;  1HPZ B;  4FZV A;  3QGH A;  3HJV A;  3NAH A;  5KFC A;  1TV6 A;  2KG0 A;  4DV6 F;  2CKW A;  2DGT A;  4P6Q A;  1KVK A;  3OW2 R;  1NPP A;  2EBG A;  1VQM S;  3OTD A;  4DSK A;  4BHQ A;  1Q8L A;  1RAB B;  4M5J A;  1NUE A;  4LVN P;  1X9S A;  1U8W A;  2H9Z A;  3NLC A;  1MRO A;  4C3K A;  4E8U A;  3H4B A;  4JV2 A;  1U1Q A;  2E7W A;  3I9V 9;  3IC1 A;  1TAU A;  4YUD A;  1S6P B;  4KIA A;  5KFW A;  5KFO A;  3HX9 A;  3EXY A;  4BC9 A;  3I82 A;  1Y0H A;  3BBB A;  2OO4 A;  3HCX A;  4YQW A;  3KLI A;  1GT8 A;  3CT9 A;  2DK2 A;  5DZ6 A;  3V6D A;  3RBD A;  3EGW B;  2ZOG A;  3AFG A;  1WEZ A;  2QZ8 A;  2HWH A;  2M8H A;  1S97 A;  1VGY A;  3HI9 A;  2VFS A;  1TMJ A;  2OLW A;  2W2P P;  4JP8 A;  1ZTW A;  3N9U C;  3GIM A;  4DFM A;  3DFE A;  1MG7 A;  1U02 A;  2G1D A;  1YG0 A;  2AGQ A;  5ETO A;  4WCE Q;  3HSG A;  2E5H A;  1NDC A;  1X4H A;  2ILY A;  1WI8 A;  2SXL A;  3BYP A;  4DS5 A;  2DNZ A;  8RUC A;  1EKS A;  2CQ2 A;  1Z4U A;  3EIC A;  4CLU A;  1RE1 B;  5DG7 A;  3T1Y F;  2HQI A;  2E5L J;  4W90 B;  4QOT A;  1PKU A;  4XDC A;  1HMV A;  4ED6 A;  3R5D A;  4FVM A;  5GAG I;  3HJF A;  2PFD A;  2WON A;  4N77 A;  1A6L A;  1JJ4 A;  1GTE A;  1K47 A;  1ZAV A;  6FD1 A;  3H5Y A;  3BJY A;  3V4M A;  1SL0 A;  3OL8 A;  2WSF C;  1BQN B;  2PEH A;  1WC4 A;  1Q78 A;  2BX6 A;  1MN7 A;  2B4V A;  2IC3 B;  1S0O A;  5A0Y A;  4MAK A;  4F2S A;  3CWJ A;  3MED B;  1VOM A;  3TO8 A;  1YBA A;  3J80 U;  1S1T B;  3PV8 A;  4L3K A;  3OXF A;  1IR1 A;  1FXD A;  1S99 A;  4ATN A;  4K4V A;  4XPC A;  2Q6B A;  1AFJ A;  4P72 A;  2I6W A;  1RAE B;  1S1X B;  5E3A A;  3OLB A;  1N88 A;  2BA9 A;  2BQ3 A;  4QYZ J;  2HWT A;  2O01 C;  3Q24 A;  3AOC A;  2YNI B;  3MM7 B;  4DV3 F;  2XNR A;  3KUG A;  5IOL A;  5LXR A;  2DY9 A;  4YFU A;  1FVS A;  2H48 B;  3QIP B;  2DXE A;  1RAI B;  2ABY A;  4KKO A;  5E3R A;  4QU6 A;  3QAE A;  2FQQ B;  2YTC A;  4EYH B;  4NA1 A;  2B4P A;  3KG0 A;  2QMW A;  3PYG A;  3KUH A;  3HVT B;  4RKU C;  4ZPA A;  3ZZT A;  1F5B A;  4KTQ A;  4NML A;  1N5Q A;  5CYQ B;  4CWB A;  1JXL A;  5D8H B;  2HHP A;  1YK9 A;  1V3Z A;  3IWL A;  1NSP A;  1S1V B;  3PNI A;  3QQC D;  4JI1 F;  3WDO A;  1RBA A;  1ZA2 B;  1R8C A;  1VRT B;  3C6U B;  9ATC B;  2VQE F;  2RNE A;  4ECT A;  3RAX A;  3TJA A;  3K5N A;  2R2U A;  3UVJ B;  3BQ1 A;  4URG A;  5HAT A;  1IKV B;  2KVQ E;  2MY7 A;  4CDI A;  3TYT A;  4U8Y A;  5KOW A;  4PXC A;  1WF2 A;  2VDH A;  3ZZZ A;  5H9F K;  1WI6 A;  2YNH A;  3KHH A;  3OFH A;  1VQ5 S;  3M2R A;  3R7S B;  1N34 J;  2DH7 A;  4C8M A;  2ZHB A;  5HMZ A;  1RSC A;  3G2X A;  3T1H J;  2F1F A;  1DQ9 A;  4DR4 J;  1LKZ A;  1HNI A;  1N0V C;  2YWH A;  3A3P B;  4R8U A;  3Q89 A;  4HHH A;  2HND B;  4B02 A;  4GO7 X;  5IV4 A;  1LFW A;  1SIW B;  2DHA A;  3R7B B;  4X65 J;  2R8H A;  2FJV A;  1YBT A;  3NAI A;  4CLT A;  1Y3J A;  2W01 A;  3G8S A;  3AQO A;  3IFE A;  4RL1 A;  4YDX A;  4F04 B;  4ZHR A;  5A8K A;  5HO4 A;  2W7P A;  2UVW A;  2FHJ A;  2R8J A;  4C9D A;  2KXN B;  5HI7 A;  3GB0 A;  5LT5 A;  2D69 A;  4DCJ B;  3I55 S;  1K0V A;  5KG0 A;  1H72 C;  3K2Y A;  3R6L B;  1S0M A;  1L3K A;  1T03 A;  1VRU A;  2W7A A;  1WHW A;  2VBW A;  3TNV A;  1N34 F;  2Q3P A;  4KFB B;  1QTM A;  1GTH A;  1QAY A;  2FIU A;  3MMA A;  4HHU A;  2WOM A;  2X3D A;  4C6A A;  2R7X A;  3LPY A;  4DMZ A;  1H74 A;  3PIO Q;  3A8J A;  5DRK A;  4LFA F;  2VD3 A;  3W5Y A;  2FGO A;  3IRX A;  2KXF A;  3KLG A;  1T9U A;  2W4C A;  4I6W A;  4CIO A;  2ZHA A;  2JEF A;  2F9D A;  3FBC A;  4DF4 A; 
#chains in the Genus database with same CATH homology
 1FFW B;  1EAY C;  1A0O B;  1FWP A;  1FFG B;  2LP4 A;  1FFS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...