1EAYC

Chey-binding (p2) domain of chea in complex with chey from escherichia coli
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
67
structure length
67
Chain Sequence
PRRIILSRLKAGEVDLLEEELGHLTTLTDVVKGADSLSAILPGDIAEDDITAVLCFVIEADQITFET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signal transduction complex
molecule keywords CHEY
publication title Two binding modes reveal flexibility in kinase/response regulator interactions in the bacterial chemotaxis pathway.
pubmed doi rcsb
total genus 15
structure length 67
sequence length 67
chains with identical sequence D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 1998-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09078 CheY-binding CheY binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits CheY-binding domain of CheA 1eayC00
1FFSB 1A0OB 2LP4A 1FFGB 1FWPA 1EAYC 1FFWB
chains in the Genus database with same CATH superfamily
3T5KA 2BE9B 4K4XA 4YDDB 2FJVA 3MEDA 2ADBA 3E2EA 4I2QA 2OGUA 1S1VB 4LFBJ 4QIGA 5D0HA 2Z4PA 2HBRB 2HIYA 4NA3A 3CCQS 2KT2A 1O5JA 1N5YB 1YK9A 2F8EX 2KU7A 2H5EA 2YNFB 2HFUA 4ICLB 2ZH2A 3P4UB 3HKWA 3OTCA 4FYYB 3N28A 2N4CA 2CQ3A 2YNGA 3CJ2A 5T7LA 2MGZB 2EC0A 4Y65A 3A8IA 5B0AA 5KT3A 2IM3A 2YY3A 1G2EA 1IN0A 4TYBA 3S6EA 1REVA 2GIFA 1FD2A 2C1EB 3IRXB 5BYQA 4TU7A 3EXCX 4Q5VA 2BBEA 2DNNA 4IOCQ 4IYQA 1V3ZA 2BRKA 1U25A 3K5LA 1NBEB 3KK2B 4M5IA 1B0TA 2GIQA 2EKNA 4CH7A 3TEGA 2EFPA 2H3EB 3HFKA 2AV5A 2Q6CA 2L08A 5F3ZA 4X4QA 2HZCA 4BS2A 1SH0A 5D78A 1NM2A 4QW8A 1JXLA 5KFFA 1YDLA 5I42B 4YB7A 1FRIA 4CO1A 2BYCA 3B78A 3EZUA 4KPYA 1MW7A 5FIIA 2HMIA 2ZE2B 4JI0J 2H5IB 2C3PA 1D0EA 1OYEA 5FDLA 1NK9A 1JLCB 4ZITA 2M7SA 2PEHA 2ERRA 2PMZD 3PW2A 4KGKA 3LP0B 2CDQA 4G1PA 4LQ3A 3H2UB 1G1XA 4OJ1A 1F3FA 3CCES 2OIHA 3LGMA 4CNYA 2P5VA 2B8QA 2UZAA 1FNOA 1FFWB 1IXKA 1YBUA 4ZDNA 3THTA 2WW8A 3Q83A 4IO1A 2HVZA 2DIUA 2YH0A 4KKOA 4O23A 4KGZB 4EBDA 3CDWA 3MAAB 1VLOA 5C2CA 2DYAA 3DLBA 1Q53A 1ZZFA 4LF8J 1M5OC 1PC5A 5GAGI 1IKVA 2JRSA 3CMQA 3M1VB 5SZTA 2RF2B 1VIXA 3DM2B 2FVCA 4LR8A 2AYEA 2XCPA 4QIWD 3CDBA 3T5LA 1YBTA 1AUSL 4QJVA 3U7JA 1M0SA 5CD4A 4MK8A 3RB3A 3C19A 1DTQB 3TW0A 3QMQA 5F9NA 2QG9B 4C11A 1TUGB 4F04B 2CPJA 3L95X 3BQ1A 3C14B 4IRCA 2HURA 1VR6A 3V2UC 1L3KA 1DY3A 3F56A 2DK2A 5IXUA 2YNHA 4WIQA 2IBKA 5J1NA 4QWBA 1J5EF 5E7OB 2B6AB 4NI2A 1X4EA 1HBNB 2EFQA 4U7UK 3GE9A 1VBKA 3QIPB 4NXMF 3SQGB 3PJ9A 4NX9A 2UV8G 4NA2A 3LH2S 1EJ7L 1PILA 1T05B 2HFSA 3NWGA 3J7Z5 3H2VE 4I69A 1MROA 2IDEA 2KKHA 1NK5A 3CIMA 1WKJA 3BS9A 1XTZA 1HNZJ 1RTDA 3UDEA 2HPUA 4WFXA 2FJAB 1P27B 1S9GA 1X4GA 1WUUA 3PEHA 2ZH9A 5C2GA 2FY1A 2GNKA 2ZUAA 4DV0F 3GZ7A 4B3OB 3AAWB 3NWRA 2DXEA 4MFBB 3GCXP 5BYSA 3FKBA 3GIIA 1S99A 2AJQA 4QU6A 4CM2A 1VJWA 5IS2A 3ILJA 3KMQA 2VC1A 2FJXA 1B7FA 1Q16B 5KFWA 2CJAA 1N0UA 4UF4A 1KQFB 4OHZA 2CDRB 5D4PA 4TU9A 4X66J 2BOPA 3JTNA 5ETRA 2WHOA 1HBOB 1RTHA 2DRBA 2KXFA 2XMKA 1P8GA 4KFBB 2YX4A 2AJ1A 2W8LA 1TFWA 2YBVA 3RRGA 3CD0A 3HT0A 3QRRA 3M2VB 4GKJJ 2XLKA 4KE5A 4DV6F 2XMVA 1LXNA 3NG8A 1NHVA 1E6VA 3T1HJ 3UD3P 2MZTA 1RWOB 2ZZMA 1UJ4A 3CSKA 4J37A 5B0DA 4R5PB 1C4AA 3KLIB 2OLWA 4C8LA 2ZH1A 4DFPA 1RTJB 1JK9B 1GXUA 2DPJA 1XEZA 1KVJA 2W2QP 5FD1A 3GV7B 1MN9A 3KWMA 4X65F 3GIKA 4ALZA 2E1AA 4PWUA 4JI2F 2D9OA 3BO2A 3DDNA 2AEFA 4WK3A 4ZPWR 3NP5A 2E9ZA 5SUHA 1NXIA 3EMTA 4ECYA 2LA4A 5DZ6A 4H54A 1HNWF 1NK8A 1RWWB 2RE1A 3MPUB 4X84A 3J80U 2DNPA 5G0RB 4LSLA 4NLTA 1HR0J 3BKUA 2KRRA 3LGHA 2NPIA 4X4SA 3C6UB 4N47A 1SV5A 3QBCA 3MUTP 3KXDA 1TK0A 1U1LA 2IIHA 4LF6F 4E0DA 1FXLA 5GMDA 3CJSA 4DR4J 4J9LA 5I3UB 3BYPA 2OSRA 2GQQA 4O4RA 2MPUA 4B08A 4JYAJ 1ICEB 3WIVA 4HLBA 4LBHA 4DQRA 4V1Ak 3JAMU 1HNIA 5BR8J 1RT5B 5D8HB 4HDGA 2Y0BB 3CB4A 2GVZB 4WWSA 3NS7B 2F63A 1HQEA 5A6WA 2DO4A 4JI8F 5ETQA 1SQEA 3QIDA 3C15A 4GVBA 4P2MA 1OQ3A 1U6BA 3W9JA 2MHEA 2L9WA 4QYRA 3ETOA 1PCAA 3QJLA 3FSIA 1FXRA 2O1PA 2E7VA 4RUAA 3LP2A 2ACMA 2I8EA 2K2PA 2V94A 3GSIA 3L7PA 4NCBA 1X0FA 4K2JA 4DSFA 1PJ6A 3OR2B 3PKYA 3SYZA 3R27A 3WIUA 1WI6A 4WJBA 1U1KA 3KLFA 3JSRA 1S6PB 2LVWA 2AEJA 4X64F 4YHHJ 4AL7A 3FZ2A 4QR2A 2B7BB 1UL3A 1IR2A 2LQ5A 2M5YA 5DLFA 4DFMA 2AGQA 3DMJB 2UUCF 4FKXA 3LUYA 3ZZZA 3MCOA 5A8RA 2WONA 3VTIA 2KZZA 3MM5B 2G9OA 3PJXA 2I2YA 2JLEA 2ZVIA 1CJVB 1PO6A 2E1PA 5KFPA 3TANA 1RYSA 2W7PA 3VAJA 3EM1A 3KLEB 4CT9A 4XAKA 3RAQA 5HN0A 2AJ2A 3I6PA 2XYPB 3PW0A 5D4OA 3MECA 4BWJA 4DUZF 3GP9A 1NKCA 1RYRA 5HATA 3K57A 1XMQJ 2X3DA 3HPOA 5J1PA 2R7SA 4OJHA 2LA6A 1SVDA 1JWWA 3DRXA 2J9DA 1YTYA 2OTJS 2RT3A 2IPOB 4MK7A 1CBKA 2QX0A 2AW0A 1WTFA 2V63A 3OUYB 2E9TA 5DDOC 1RTIB 1FNXH 1KWMA 1K0TA 4ZIVA 4JI6F 1IBLJ 2J9CA 5HO4A 2BANB 2A0FB 3GPAA 3UWTA 3OHAA 1QSLA 2GAHC 2LU2A 2OHDA 2RNEA 2DGSA 2WSCC 5KFZA 3LQVA 2DH8A 5IWAJ 1QY7A 2NLWA 1S6OA 4EU0A 1XIQA 3M2RB 3S8SA 2FIUA 1EB0A 3IMQJ 3VQTA 4DV1J 1V6HA 1HNVB 2LQ9A 4PQAA 2OEJA 3OBIA 4OYZA 3MFHA 2HGNA 1HIYA 2XY7A 2OPQB 3R7SB 2QL9B 1RCOB 4LRAA 4M1KA 3W2VB 5EX3A 4NASA 3IA0A 2ZM6J 1SH2A 3SCIE 3R5DA 2EFGA 2EWHA 3WZ0A 3KKFA 4JI5J 1GMUA 3QJJA 2LQ8A 2XYGB 3N6NA 3CTRA 4CO0A 4TLQA 2VPWB 1JJ2R 1Q78A 2Y1LB 3MMBA 2XI3A 4CYUA 4O0NA 1UWAA 3BBFA 5E0OA 1RA6A 4OYAA 2XM3A 3R97A 4ANEA 4DSEA 3EVOA 3FBEA 1B7YB 3ZTOA 2E29A 2VA3A 2XSJB 2KFYA 1RBAA 4UOHA 3A8KA 3MZIA 4ID5B 2I9SA 4NWBA 2DR8A 2E1RA 2Y3YA 2KI2A 1GMWA 2FHOB 5IT4A 1DARA 2GHVC 4DBQA 2DJWA 1AB8A 2B9XA 2KRBA 2MSTA 2HHSA 3QSYB 4ILLA 1HNXF 1QVFR 4C3KA 1NU4A 3IGVA 1HPZA 4ZCLA 3MM6A 4K50A 3RZAA 3UQSA 2DCUB 1LV5A 2MKJA 3DLGB 3GG0A 4M5HA 4JV1A 2UUWA 3S01A 4Z37A 2CPZA 4BBYA 4DS4A 1S0NA 2HVDA 2CQ2A 1B64A 3CIZA 3SBMA 4O44A 4A8WA 3RB0A 3D1OA 3IGNA 4YUDA 4UY8T 2WSEC 3ITHB 1RLDA 4WE1A 3W3SA 2IBOA 2OPSA 3GV5B 3KUGA 2IM0A 2ASJA 4PQUA 4B9SA 1WKKA 1N8RT 2HVIA 4OJGA 5HMXA 3UW1A 1BWEA 1YLXA 1JB0C 3MUMP 1WHXA 3A3OB 4ECSA 4IR1A 2UUAF 3IAM9 2F7VA 4IFYB 2I6WA 3OJSA 3I56S 4RW8A 3L4BC 2QE5A 1RHKB 1WOOA 2AGOA 3A13A 1NUEA 2FDNA 1MSWD 4I68A 4DJBA 3IXQA 1TL3A 4ECQA 1ZZNA 4J5OA 4NLPA 3KHGA 2ZBPA 4CLYA 4ID8A 5F8HA 4QIFA 3J81U 2W8KA 2UV8A 4DFKA 1MN7A 5GAGU 1T3OA 1QAJA 3SSQA 1KVKA 5HVHA 2PT0A 2RKIB 1NJIT 4AE5A 4OI6A 1CS4A 3E01B 2V2QA 2WOMA 3G82A 5I3QA 2G2OA 1PJ7A 1WC6A 5HROA 1H6KX 4BHQA 5F8LA 3V81B 1FNMA 3OVBA 2P9GA 4DS5A 3ET6B 2R2RA 5B0EA 2J7UA 1OWXA 1GQEA 1VJQA 3PIOQ 2VFRA 3E3XA 3AQPA 2HAFA 4DR2J 1UP1A 1I94F 4NRUA 1FRXA 4F4KA 1JLQB 2BV3A 3DRPB 1LWCB 2DT9A 4IH7A 2ZH8A 3HD1A 3TUPA 4KH1B 1HWJA 1DLOB 3V6DA 1C1CA 1LK5A 3N01A 1QJHA 3LALA 4OL8A 1RAJA 2OPPA 3NXZA 3EE3A 3M2UA 1FRKA 3R7BB 1AZSB 4EI2A 3K5OA 4LFCJ 2QMWA 4L6V3 2X3GA 4LBIA 3ULHA 4ZK7M 1SKSA 1EP4B 2RHSB 4WTYA 1FJGJ 3ZZTA 1F0XA 3W60A 4KAIA 3CVKA 1RB0A 1TL5A 3GJSB 2W4CA 2FLPA 1TKZA 1CQMA 2YKMB 5JJBA 2LCWA 3M8SA 1EQMA 3FBBA 2FB0A 1GFWB 2RUGA 1Q8BA 4ZMMA 5EWGA 4RBVA 1FCAA 3GYNA 2JJ4D 4EFAC 1CJUA 2IDLA 2XYHB 4LVOP 2PN6A 2A2DA 3CJTA 4B9MA 3CCVS 2JHEA 4DG1A 4LF1A 4YR3A 4NYOA 3FBCA 2MLXA 5HMZA 2K1RA 1NH8A 4DR3J 2C2RA 4UY85 1RXOB 4O4GA 4A8FA 2FJWA 3OL8A 5J1EA 1J5OB 2OUGA 4OYWA 2VJVA 2CPHA 3TJ8A 2C3MA 1RT4B 2APOA 4M8LA 1ZPWX 1RWKB 3MEKA 4OYPA 4FDFA 3H5UA 1FWLA 3QGPA 4Z7CA 5IV4A 1S9EB 3MM9A 4URSA 2IFXA 3RU0A 4ZHRA 1C0UA 4A8OA 1FO1A 2AZ3A 3DGPB 3E51A 1IQZA 4Y34A 3JSMB 3AA8A 5KT2A 1LWFB 4IG3B 3T1YJ 3FBFA 3POTA 4ED4A 4NLXA 2RQCA 2UP1A 4NXNF 3HSZA 1WC1A 4CO5A 5EGYA 2JFDA 1P9YA 4LF9F 3FEYB 2F4VF 3TVKA 2M3DA 3RUBL 2I5JA 3MTKA 4I64A 2JOQA 4TVAB 1KLMA 3H5SA 1L3SA 1S6QB 3KHHA 1Q79A 4IDKA 2IVMA 4DHVA 2H4YB 4B3MF 1JJ4A 2XO6A 2FVRA 4O3QA 3ILOA 1PBAA 2RDJA 3W9IA 2KL8A 2G2ZA 1U26A 5L1IA 2RVJA 4DU7A 3CCWA 3CD6S 1U45A 2RDDA 2VDIA 3VZIA 3RBDA 1D8YA 1X5TA 1QTMA 1JLEA 4RR5A 2Z0GA 4DLEA 5THWA 5D3GA 1N34J 3FSXA 4PG7A 1CULA 3A12A 3JQMA 2V8DA 1NB7A 2BJ9A 2B4UA 2VG6B 3HHEA 3GIMA 2R2SA 5HLFA 1A0OB 1BD6A 1KBRA 1YJTA 5B0GA 4MKVA 3Q8QB 5I4MA 2VASA 4FPIA 4DUYJ 1F60B 3AJ1A 3MR7A 4RW9B 5D15A 3K59A 2ACYA 3TUZC 4LIRA 1X4DA 2CPDA 2M2BA 3TO8A 4ILRA 3HCXA 3DLKA 3OL6A 4P72A 5HQMA 5EN1A 3D3BJ 3K5MA 4ZP9A 3HHLA 1U47A 4CI0B 4ES2A 1F2HA 5KFRA 1C0TB 5L1LA 2YWHA 4CO2A 3MR3A 2KYXA 1HL6A 1S1XA 1IJEB 4Q7AA 4GKKF 4Y6IA 4NLOA 1OQ6A 2JLFA 5CZXA 4NLSA 1HW8A 1I6JA 3NGKA 2HHVA 2HNDB 1WEXA 3K89A 1DQAA 1WOSA 3HD2A 2IAJA 3KK3B 1RT7A 4WFAQ 1Q95G 1K1SA 2DHHA 2QA4S 3QRPA 2EEYA 3M05A 4DCPB 3PDNA 5IC4B 5C24B 4X4RA 4DV7J 5HP1B 4C8YA 2B43A 1RU2A 4LF2A 3BPDA 1WACA 2VZ9A 3D68A 2DGVA 3BGRA 1UJ6A 2CYYA 1VQPS 5A8KA 2YWEA 4J9UE 1SIZA 2QRRA 4EO6A 2VC0A 2GO8A 5KTQA 3BV8A 3BBCA 4PG5A 1H2VZ 1S0VA 1VC6A 1NMEB 1DHMA 4A4JA 1JMTA 4FF4A 1EQ0A 4PXDA 3CJ8A 2MHNA 1F9HA 1V9OA 4QCLA 4LFBF 1PC4A 5KAKA 1IKXB 3DLEA 1BQXA 3IO1A 4O3RA 3CJ3A 4I67A 2ATLA 3BH6B 3Q23A 2GV1A 1JLBB 1LW0B 4KHPJ 2CRLA 3IM9A 4HTJA 1S1UB 1RHMB 1FRMA 3OTOJ 3RB4A 1UZDA 1KOHA 3R6GB 2Z2MA 1VQMS 2UUBJ 5FDLB 3UPFA 1Z2ZA 1Q8KA 3EDQB 4U6PA 2V34A 1ZH5A 4K4UA 3MM7A 4DQPA 2HK3A 4CWBA 1N56A 2DCLA 3TUIC 3MDFA 4MT1A 3HO1A 2L9DA 4U8VA 4Y2KA 2BW2A 3GQCA 2ZHOA 1UETA 3JYTA 2QLBB 5KFYA 1HI1A 2GZOA 1IQTA 3CNQP 1PBUA 2AEMA 1YGYA 1IBKJ 1NHUA 1BE4A 5J2QA 1SIWB 1VYAA 1Y10A 4WXWA 2WB4A 5C25B 3UR0A 3SV3A 5CCLA 4HH0A 4DLGA 5DGBA 2M9KA 4CZCA 1GX5A 4LQ9A 3H5YA 3MGJA 4PEOA 5K9FA 3SV4A 2RIJA 4PWWA 3QJPA 3FFIA 4JI0F 4E8UA 4LF7J 4D3GA 2HS4A 1UA1A 1FKPA 1S12A 2H9ZA 4OI3A 4A8SA 1PJ5A 2L3MA 2JX2A 1GXTA 2BEFA 2ZJPQ 3PRBA 4RPFA 3VAFA 2XI2A 3TAQA 4OYBA 2E7XA 3GIJA 2V0NA 4QWCA 5HANA 4C7QA 5HVFA 1RT1A 3D0HE 2HGLA 1I5OB 4IUFA 1VRTB 3EUNA 1N32J 3GU0A 5CD4H 1QAIA 4ER8A 4DN9A 4F7VA 1X4AA 1Y00A 2MXYA 2YVSA 3KUHA 1S10A 1XJWB 5ETSA 1RDRA 2CQ0A 3BR8A 1N33F 3C6TA 4LF8F 4ILMA 2HBZB 4G6VB 4RNMA 4EUVA 2YKQA 1RZMA 2AJ0A 4EBCA 2R8HA 3TAMB 4UOGA 1UWBA 4Z7YA 1U1MA 3CUNA 4KY3A 1S9GB 2DNGA 2FHMA 1CLFA 2Z2LA 1M1KT 4EBEA 2DBBA 3OLAA 4W4MA 1NH7A 3HZGA 1FA0A 1FVQA 3OTBA 3CJQA 3MD1A 1EKSA 2JEGA 2Z30B 5KFAA 3MEGB 2DIVA 3D6MB 3QWUA 2FJEB 1S1WB 4A8KA 1RA7A 2YH1A 2GFFA 2V8VA 4G1IA 4ZVEA 4R8UB 3ENWA 3BO4A 2HHHJ 1SUQA 4YP3A 1M1HA 4ED1A 3OR1B 4XO0A 4GO5X 2J6TA 4YS2A 3AH6A 4FF1A 4NCAA 1HNZF 2LDIA 4WIIA 5A0YA 5DQGA 3HHDA 2BQ3A 4I6WA 3BYRA 2IMWP 2G1HA 3SMZA 5K5MA 4ZPBA 3DOMB 2GMLA 2GJFA 2DGWA 4OZJA 3VALA 1QAXA 1FESA 1X7VA 3HP6A 4TXSA 3D6HB 4B9TA 5IM0A 1B0VA 2BQUA 3P5TL 2HWHA 4UZCA 1YRXA 4C8KA 1LQ9A 4CLZA 4L3KA 3UCZP 1TP7A 4DQQA 1CJKA 3GJQB 3UCUP 3WC2A 2YNIA 1VQLS 2VF3A 3QO9A 2VPXB 4F0MA 4DCOB 1YQHA 4C0BA 4LSZB 4LT6A 4RKUC 3VHQA 3I0SA 4LSLB 1NDPA 1YVFA 2NXEA 4Q44A 3NRBA 3NOGA 4LUBA 2B5JA 4X66F 2AF6A 2KHDA 3PO5A 1QVGR 1YJ7A 1D1UA 3MEEA 5DZ7A 2ILYA 3KLGB 2BJ8A 3O8WA 4PWDB 4Y2CA 3IN5A 2MQMA 5DO2A 2X1GA 2LLZA 2XB2D 4GKJF 4TY8B 2UU9J 2OH2A 1H72C 4FS1A 1WTBA 5RUBA 3PRVA 4HR2A 3KOAA 4JB8B 1TKXA 2ZFHA 3I87A 2WBMA 4ZJOA 4ECUA 2OFHX 1BUXA 2U2FA 4OI0A 4Q2LA 1TL1B 2AP6A 2HRYA 2B56A 1FTRA 1TKTB 3S7RA 2GQ2A 4C6AA 3G96A 4PG8A 3O2IA 3VAMA 3OL9A 1IM6A 1HI8A 1CSJA 1KEKA 1U1OA 3NNHA 2RSQA 4ERDA 1JNZB 4KHMA 1HR0F 4MIAA 2QJ3A 2JSXA 4NYPA 4USTA 2B4OA 3CEDA 1QD1A 1K0VA 3PG9A 3HJFA 3I55S 1EETA 5GADU 2HRTA 4IRDA 5FLXU 4WKRA 4DR4F 4C8ZA 2IRXA 1Q82T 1FF2A 1FFGB 2YQ3A 4JV5J 2OD4A 2OP5A 4J9OA 4FZVA 3GCWP 3HDSA 3SFGA 1URRA 4JYAF 1TV6A 4K2XA 3CW2C 5BR8F 1RT6B 3G6YA 2VPYB 3Q8PB 2DGQA 5AE3A 1PYOB 2LMIA 5M2RA 1UZHA 2ZBCA 4ZPAA 5IC6B 2HG4A 2HKEA 5T14A 4WU3A 1HARA 3THVA 1N6QB 4CP5A 3HVTA 2PDAA 5KFCA 1BQNA 2ZEJA 1VHFA 2HBQB 3W64A 2LECA 5E3QA 1UAWA 2PA3A 5DG7A 2ILZA 5A76A 4UUWA 1FT8A 1KKHA 1X31C 5KT6A 1VQKS 4RW4B 4YHHF 1U0HA 4QU7A 1TTHB 4LRFA 4DV4J 2E5JA 2BW7A 1Y11A 4DEZA 4U7CA 1D9FA 3H0PA 6AT1B 1NJWA 5ETKA 1JJCB 3P49B 3I0RA 2MKSA 2FJDB 1UCNA 4QR0A 3GLJA 3N0VA 1T9TA 4YDXA 2O66A 2NPFA 1OPIA 3I4HX 3BPSP 4ZVGA 2VUGA 1WG5A 5KFSA 4NMLA 3EPGA 2GAGC 4QWEA 3ZTPA 3DC2A 2BDPA 2PC6A 5CXTA 1EHWA 2ZBQA 1NSPA 2RU3A 5J2MB 4WK1A 3J7AN 1XMQF 4JOUA 4YB5A 3H7HB 3D6TB 4LRDA 3DYAA 2DNHA 4N8NA 3M6UA 4AXIA 1FRJA 1RAOA 5KG6A 3CDEA 2ROGA 2CPEA 2XS2A 2COLA 4HVZA 3TZYA 1X5PA 4JI7J 4PXBA 3CO9A 1IBLF 2V4JB 1JLGA 5B0FA 4HACA 2FGCA 2AKWB 2QLJB 4OX9J 1RWUA 1FWPA 4CLLA 1H2UX 4MYTA 3US5A 2ZKTA 2GW8A 5DM7Q 4KTQA 1GMWD 3JQJA 2D7SA 4EWTA 4DV1F 1KSPA 3HVWA 3EZOA 4KQZA 3W5ZA 2J0WA 3KJVA 4ZOSA 5M2UA 2KXNB 1HBUB 5K8OA 5KT4A 1NPPA 2H5JB 2MKHA 1F6TA 1S1TB 3ZZRA 3QGHA 1QLNA 3K8WA 3GJTB 2ZM6F 3GWCA 1RWVB 1JKHB 2M8DB 3CD7A 4DZ6A 2LU1A 3X3UA 2R8JA 2HQ3A 3MMCB 1FEHA 4D3HA 2KO1A 2KT5A 3IR6B 3VGTA 2K8GA 3BGOP 1R8HA 2V8GA 2Q43A 1D09B 1G3OA 1KHVA 3MOZA 5KFBA 2C2MB 3OVSA 4X4NA 3RAXA 3CDAA 2B8PA 3V4IB 2WVFA 4LBPA 1S1VA 2MY8A 3LAKA 2EKYA 4PQUB 3HHNB 5HK4A 3LPEA 4QBUA 5J2NB 2CUYA 4OMFG 2DRAA 1OPZA 3N4WA 1T9XA 5KFMA 1SC3B 1L3TA 3FMWA 2C42A 5B09A 1N5YA 2YNFA 4C3MA 3NGRA 1UPPA 5F8GA 3R5CA 4FYDA 3KG4A 4ICLA 1TL7B 2DH7A 2SXLA 3D1QA 3HK2A 4NOHA 2VFVA 3D67A 3FVYA 2DO0A 2MGZA 2QYCA 5KG7A 4CH1A 5CYJA 1BQMB 4F0KA 3RR7A 3D7SB 4PRFA 2ZNZA 2KM8C 1U1NA 3NS6A 2VFTA 1FWKA 3UI3A 3IRXA 4P9SA 5HSPA 3BSAA 2Z56B 2F3JA 3D0GE 3FSYA 5KFJA 1KQSR 3G8SA 3UNYA 2HZVA 3ISZA 2F8MA 1H7WA 4USMA 4CTAB 3FQLA 7FDRA 3KK2A 5E2QA 2XY5A 1SB6A 1W2IA 3AD7C 1G6BA 2Z2ZA 3L7UA 4C2MA 3UD5A 1FD8A 1Q0NA 1HBMB 1RUSA 1Y3KA 2BM0A 3EYZA 3M30A 3QT5A 1JLFB 2KDOA 4F4YA 5I42A 5IOLA 3P6YC 4I4BA 4NMXA 2EFOA 1T9YA 4OQJA 2ZWOA 2ZE2A 3A1YG 5KG5A 1X0PA 2DNYA 2Z2YB 3I4PA 2E9RX 1VQSA 3M8QB 3T9NA 3O44A 3IS9B 3L3CA 2YKPA 1OY8A 1VQNS 1TMJA 3R5JB 1X60A 2R8KA 1LOUA 3LP0A 1UVIA 2DXFA 2P9EA 2VBXA 2P8IA 5IT9U 2DNLA 1UMJA 4O3NA 2M8HA 4OV1A 3ELHA 4WU2A 3DU5A 2QLFB 1TAQA 3HVAA 2HSEB 2RMLA 5B0CA 7FD1A 4OYXA 3KK1B 4GO7X 1R7IA 3MAAA 1SKUB 3V5RA 2QN6B 1SC4B 3AJDA 3X1LB 1SJQA 3CWJA 3M1VA 1VQ4S 2RF2A 3DM2A 2BR0A 4DV5J 2ZHBA 4P10A 2VA2A 1FK9B 3BDPA 2D69A 3DKDA 4C97A 3A8JA 1G7CB 1D3WA 2HZAA 4DR2F 1IBMJ 1DTQA 1R8AA 2WBRA 3MF5A 3FMBA 2D9PA 1F5CA 2OTLS 3C14A 4RNFA 2H54B 2W24A 4DI6A 5DDQC 2JEIA 1P1LA 1SH3A 3C16B 1WNEA 5KG2A 1OSCA 3SCKE 3F41A 4QW9A 1VOMA 4LFCF 1WG1A 3MXHP 3G4SS 3I31A 2B6AA 2XNRA 1FJGF 1P9QC 1TR0A 4O3OA 1HBNA 2ASYA 2QSFA 3QIPA 3CJKB 3KYLA 3SQGA 3J7YI 1T05A 1ZAXA 4OLOA 2L48A 4V19X 1JNRB 3SDEA 2AHOB 2O5DA 3CJRA 2OEKA 3NBPB 1V5IB 1HMVB 2QLXA 4DV6J 2KXHA 4TLRA 1VRUA 2B9WA 1Y5NB 1HWLA 5ADZA 4YB6A 1UPMB 3IWLA 1WJ9A 1K47A 4HI2A 2EXUA 4KR0B 2VFSA 3GFXA 4B3OA 3CE8A 4DR3F 2BX6A 4MFBA 3DOLB 2QGFB 4M5DB 5F0WA 2MQ8A 1GAOA 4NLVA 2XWXA 3M32B 4KV8B 4JI2J 4USKA 3AOBA 1MWQA 5KT5A 3VAGA 3MHYA 3AQOA 1ZPVA 4ED5A 1NRKA 4DQSA 5A6PA 2A18A 2QA4G 2VFUA 4IH5A 3HSJA 3I5AA 3R5GA 3WC0A 4FXDA 3J7ZT 1B99A 1HBOA 4HH1A 3PVXA 1QSYA 4KFBA 4RNOA 1UFWA 2YWGA 4OI4A 2CQPA 5GVQA 4PPDA 1W7WA 4P2XA 2OSQA 2JVOA 1FVSA 2QMXA 1EARA 3T1YF 4OFZA 3M2VA 1R27B 5IT0A 1XWLA 2WVCA 3H90A 4DL0C 1QE1B 5AE2A 3Q22A 4K7QA 4WZQA 3QFHA 3OD2A 6FDRA 4N5SA 4R5PA 3MPDA 2EFVA 2FHJA 3KLIA 1U1QA 3D28A 1WHWA 5GMEA 3B6BA 1VC0A 3PXGa 2FVPA 1WELA 4Q0BB 1RTJA 2BJEA 5K14B 4NPOA 1ZETA 2YXLA 3CULA 2C3YA 2XLJA 2XZTB 1UEUA 1H7XA 1GTEA 4FXWA 4CLSA 3CCTA 1KOOA 2OPRB 2EBEA 5G0RA 3U1NA 2VG7B 2J0XA 5I3PA 5AXMA 1JX4A 3C6UA 4CLTA 1N34F 4ZJQA 4A8XA 4URGA 1F3VA 3AY0A 4I56A 3BDEA 4OYMA 2Y8YA 1S72S 4BC9A 1JLAB 3UN3A 5I3UA 2FLLA 4WYWA 1A6LA 1F5BA 1GX6A 4X64J 1S48A 1RHJB 1V3RA 2N7YA 1OMSA 3ZC4A 5DG8A 4DUYF 3THPA 4J9SA 2ZITA 3BF4A 1KNZA 3FK4A 4Q2MA 2EG2A 2RJZA 1SJFA 1NSAA 2HLUA 4KIAA 3UVJB 1VI7A 2Y1RI 4OV6A 5DRKA 1X4HA 1RT5A 2W9CB 2GMJA 4KSEB 4O3PA 2GVZA 2MJNA 3MR5A 2Q79A 3EICA 5HBMB 1ITPA 4N7TA 1KS2A 5JVHQ 3PX6A 2MLYA 1LWEB 1NDCA 1TK5A 1FI4A 1VIOA 4AL5A 2W4PA 1M5HA 3AJ2A 3MFIA 1U02A 2GS8A 3QRQA 3TNVA 3R3TA 3RRKA 2J8SA 2IA0A 1O8BA 2CJQA 1XBWA 5GAEI 4USHA 4OX7A 4AUKA 4C3LA 3GMGA 1RP5A 3OR2A 3OTEA 1XC9A 2YX1A 2CNNB 1S6PA 5KT7A 4V19J 4DSIA 4DV7F 3UCGA 4G1QB 2N3OA 2JC1A 4UTGA 3D54A 4RO0A 2WVDA 3DMJA 1QUPA 4F2SA 2MSSA 3BGLA 3LANA 3MM5A 1H98A 4QOTA 3AB2B 5L1KA 2XMWA 1CJVA 2BOAA 1YG0A 2HEKA 4OZ5A 2LKZA 3FJ2A 3IP0A 1NJXA 3W2WB 2GMHA 3KLEA 1RISA 3MR2A 5AJ3F 3EX7B 1KP6A 3V6JA 2HNZB 3O3LA 1F9FA 3QZ8A 1RT2B 3Q0AA 1CJTB 1AROP 2YTCA 5KFKA 1M5PC 3Q2TC 4BDPA 5KG3A 4KHPF 1N54B 4RBUA 3RGIA 1T3NA 4DU8A 3OTOF 1S79A 2CQ1A 4M5KA 1RHUB 4O0IA 4L3NA 3OUYA 2RQMA 3NKYA 1RTIA 1T94A 2UUBF 5ETLA 4ZLPA 3HX9A 2KFNA 3DDKA 5JXSA 2BANA 2B4PA 4F4ZA 4FF2A 2CJXB 1WWHA 4DSLA 2A1BA 2RILA 5B7WA 5AXKA 2HFOA 2NUHA 1VCTA 3M2RA 1RT1B 1T9VA 2R7OA 3R2CJ 1HYSB 2NQPA 1AUDA 1RGVA 4B9LA 3FNNA 3JTOA 4UZBA 4NCGB 1OJ4A 2AYGA 1HNVA 1IBKF 1ZOTA 5LSLA 1T03B 3VAIA 3Q8UA 3F73A 4RW6B 2OPQA 2ZDPA 1LW2B 3G8QA 2DY1A 3W2VA 4IQXA 2OMOA 3CC4S 2EW9A 1B3TA 2D1CA 3DOKB 4DL3A 1NLKL 2UVUA 2DHAA 5D77A 1YZ7A 4J7CA 2ZH5A 1JXEA 3W5XA 4NLGA 2ALZA 2LFVA 2N7CA 1RKJA 3N5BA 2FYXA 2FZGB 2XS5A 5CYMA 1S77D 1U6FA 3D6FB 1ZAWA 1WKLA 5KFLA 4ETZA 1TK8A 3GYGA 2DNZA 2NZCA 3BBBA 2R7QA 3NCQA 5HQLA 4PYAA 4WPAA 3P96A 5A2QY 2XSJA 3VAHA 3DHWC 1NPKA 4ID5A 1K73T 4LIWA 3HF5A 2XZDB 4Y2AA 4IH6A 4RL1A 1N32F 2GQCA 1Z2LA 1RWPB 3PJWA 4H4KC 2Y8WA 3J7A1 4KBIA 3MM8B 1ZM9A 1WC4A 3Q2SC 1REGX 2XWYA 2OEMA 4I0WA 4ZA1A 4C8OA 4IR9A 2JZ5A 1CG2A 3QLHB 3PZPA 3CMES 1FDNA 1X4CA 4QYZJ 4OI1A 4HTIA 1ZAVA 1T9WA 3DLGA 1F5AA 1PSDA 3T3FA 3T6JA 4HKQA 1OY6A 3LPYA 4GVLA 4DSKA 3LF0A 3DRSB 4K4YA 3OJUA 2NSCA 2BRLA 2XS7A 2JFKA 2ASLA 3NNAA 3T5JA 1UVJA 3W61A 2YQ1A 3C3LA 3ITHA 2X1FA 2P9CA 1HI0P 3RW7A 2HFZA 1VQOS 4FBTA 3BQ0A 2Y0SD 2D3OR 4E2FB 2PI4A 2EG1A 2IYGA 1SJRA 4IFVB 4Y3CA 2HNYB 2ZH6A 1MWYA 2KFZA 4FPRA 3GYXB 4IG0B 2FC8A 5ETTA 1PIEA 1NK4A 3AB4B 2B9EA 3F0NA 3ILIA 2HHHF 2HQDA 3KFWX 4IFYA 1I94J 5F8NA 2CZ4A 1IUJA 9ATCB 5IV3A 4C0HA 1QUVA 4ATNA 4KO0B 5EWFA 2ZDOA 3UFCX 4M5NA 4NLRA 3TJAA 1I51B 2GCFA 5HQ8A 1W26A 2CG4A 4I1TA 1Q1KA 5MAOA 4DPOA 3GB0A 1BC6A 2FY8A 4USIA 3RAMA 3RG6A 3WDOA 3K5PA 3NOCA 3R5BA 2HVHA 4FYVB 2J7WA 1SJ3P 3AT1B 3KTQA 3QAEA 1E6YB 2J9DE 4EZ6A 1GMVA 1K8AT 4K59A 3GR1A 2V69A 2RKIA 1HHTP 2NS1B 3E01A 1NDLA 1HWKA 1VLYA 2CADA 2IMOA 3IBWA 2VQFJ 2EBGA 3T41A 1XNQF 4WFZA 2G4BA 3FCVA 1RAFB 3V81A 2HHTA 5CYQB 2KT3A 4XDDA 1R8PA 1RT3B 3BM7A 4JV2A 1YRTA 1T9UA 2DNMA 5E3CA 5KFNA 2IVFB 2VG5B 1HWUA 1JLQA 3M8PB 1F1BB 2XY6A 4B3TJ 1O6XA 4IKAA 1D9AA 3DRPA 3FCWA 3PYDA 4R0JA 1LWCA 3CD5A 3PV8A 1DLOA 2QLWA 3DRRB 3R9LA 2PFFB 4CIOA 3H4DA 1AZSA 3MMAB 2UU9F 2WVEA 2DRDA 4DPWA 3IFEA 3J7YU 3MCMA 1EP4A 3HKZD 3O5TB 3OFEA 3KDNA 1XNRJ 1GT8A 3NMRA 2ZKUA 4RW7B 1QAYA 2B4VA 2CWXA 4ZP8A 8ATCB 1FHTA 3V6KA 3Q8RB 5KFVA 4ANDA 5HVGA 4OHYA 2YKMA 4Y00A 2V2ZA 5H1SV 2G2YA 1YJUA 2FLOA 3AHPA 2WVBA 4C98A 3CDUA 4HYKA 3IR7B 1UW9A 2C3OA 3SXLA 1MLAA 2A3JA 1HHSA 3CGIA 2XGPA 3WBZA 3QQCD 4YFUA 1HWIA 4E98A 4Y2MA 3QGIA 1TVRA 3TJ9A 4LF9J 3I5BA 5LXYA 5FJ4A 4J9NA 1J5OA 4B9UA 4ED0A 4OJ3A 1FE4A 1ZTTA 2X1BA 4DL4A 3B8HA 3LWLA 2MMYA 1SQFA 3HI9A 4JV5F 3I32A 3R2DJ 4HL9A 1NZAA 4LFAJ 1RT4A 2AQ4A 3MPWA 3U1LA 2VIHA 2MB0B 5L38A 2XMTA 4NZ6A 5L39A 1NB2A 4RX6A 1S9EA 3OXGA 1OYDA 1N5QA 4RUCA 4XPEA 3U27A 4N77A 3DGPA 1U09A 3BN4A 1H38A 4A8YA 4DV3J 3JSMA 4K4TA 3CF5Q 3H8YA 3BSNA 2GGPB 1RCXB 3EGWB 2FUG9 4DR5J 1S6UA 1LWFA 4IG3A 1JQGA 2DNOA 4HI1A 1VMBA 4MKYA 2AT1B 2Q3PA 1YSJA 4RWXA 4OLPA 1IBCB 4DPXA 3FUYA 5DLGA 5AXNA 3CXCR 3JSYA 2CNKB 4PAAA 1Q86T 1S6QA 1ZM2A 5ETVA 5L46A 4K0KF 2W2MP 1S7IA 5K20B 2BKNA 3DXBA 1IKYB 4OZLA 4RZRA 3BREA 4BLGA 4DV4F 2FGOA 1S7HA 1ZM4A 3SFUA 3GR0A 4USVA 1KHWA 4AQYJ 3A3PB 3KG1A 1TUVA 2XMMA 3KJQB 1Q5VA 2ZWPA 2IA6A 3CCUS 3R5AA 2NXUA 4TQSA 2GIRA 1KC8T 1NJYA 2DGXA 1JJHA 1FX2A 3PEJA 4H4OB 3KJVB 2GO9A 3UO0A 3MCNA 4O3SA 2VG6A 3TRGA 3AD8C 1BWVA 1HW9A 3MMJA 2R7VA 2VJUA 3PCOB 3WHIA 2GHPA 5C5JA 4RW9A 2MKIA 1UKUA 4C8MA 1LFWA 3SQOP 2W9BB 1MWZA 4QYZK 4PUOB 4GC6A 1RQ0A 3C46A 3VV2B 1UW4A 4JI7F 4ED2A 4TQRA 3VGUA 2VV5A 3T6BA 4TU8A 1IVZA 1K1QA 1ROFA 1HQUB 2BVZA 1C0TA 1YJVA 1ZTWA 4OX9F 3UDLA 2BMBA 3I82A 2A6OA 4M5GA 4B3SJ 3EVWA 4ZVFA 4B3RJ 5GAEU 5AT1B 3W63A 2YWKA 3RTVA 1WC3A 1XK8A 3OQ2A 2R42A 1U8WA 3BEGB 2MKCA 2HNDA 1NK6A 2KJVA 3KK3A 3ENAA 3KLHB 3EVMA 2VH7A 3H40A 6FD1A 4M5JA 2A2CA 4FVMA 3MUVP 3T9ZA 5C24A 5HP1A 4ED7A 2UXCF 1WG4A 4A46A 1GTHA 3RBXA 1UVLA 1FE0A 5DJBA 4X4OA 4CCHA 1QTNB 5M2PA 1YJWS 4ZCMA 4LJMA 2NXJA 5JVGQ 4L76A 2QEXS 2BKPA 1EZZB 2KH9A 5C42B 2L41A 5KFXA 1HD0A 4H4MB 2CJKA 2HHPA 1IKXA 2XQCA 3TUJC 3KNGA 4L74A 2RB7A 1FJ7A 2F4FA 4YMEA 1U0SA 3M30B 2G0IA 3DI6B 1JLBA 1LW0A 3FZBA 5LL6d 1S1UA 3M7VA 2Y9HA 4MAKA 1WHVA 1FKOB 2R7TA 2H48B 3HM9A 4ES1A 2DHSA 3M8WA 3ICLA 2BE2B 2O67A 3RJMB 2WW4A 1N36J 1IWGA 1M5KC 2HAIA 4K5SA 4CRJA 5KFOA 2G1DA 1VHIA 4ZIWA 5KG0A 1XR7A 4EZ9A 2M0GB 1GXLA 2ZD1B 2ATCB 5F8JA 3UN2A 2OELA 2UVVA 2R2TA 1AW0A 2HQGA 4USWA 2ALYB 5K8MA 4GC7A 1U2FA 3TVYA 3PY8A 1SL2A 2MJUA 1R89A 1KD1T 3LP1B 1C1BB 4MMOA 5C25A 2AX0A 4YEAA 3EZ5A 1VQ5S 1N33J 1KDNA 5A8WB 2AMCB 3SZ2A 4DFJA 5G4DA 4DR6F 3DLJA 1MU2B 3DXSX 5DQIA 3QPIA 3CC7S 1R0AB 5IZHA 2ADCA 3W65A 4I7FB 2QA2A 1DTTA 1DQ8A 3MD3A 4OHVA 3GTYX 3QT6A 1TQLA 3EJMA 2WTFA 3M9NB 2KJWA 1F9EB 2PO4A 4I2PB 3AXKA 2VBWA 3M4XA 4TY9A 2J0QD 2OD6A 3IG1B 5LMUJ 2HIQA 1KFDA 4OZ0A 1X8DA 1U6ZA 5LT5A 4EO8A 2G0CA 2V67A 2CQCA 3ZTSA 1VRTA 3ZNUA 1APSA 2GVDB 3JTPA 2QYGA 2E44A 1C2PA 3CPWR 4Q8EA 2VODA 2M4MA 3EDRB 2ZNYA 4DMZA 5H9EK 2XEXA 3OXLA 3K5NA 2E5LF 4NEZA 3HZEA 2MZRA 1XMOJ 2YKAA 3SDEB 4P2FA 5J2PB 2AU0A 1VC5A 3TAMA 1NKBA 2YKNA 4DV5F 4ZLJA 2JLGA 1VRUB 1HD1A 4DR7F 3BSCA 3OSPA 2F40A 2X1AA 3BGUA 1WEYA 1IKWB 1UEVA 2Z8QA 2I0XA 4ZKAA 4P6QA 2HHQA 3VZHA 2POKA 3FEXB 3NGDA 1IBMF 4DL2A 2OO4A 2HBYB 3MEDB 3ZZPA 3GILA 2AX1A 2YPZA 2ZH4A 3QAUA 5T41A 4I2QB 1PG5B 4LR7A 4ZVSB 2KG0A 3D1HA 1B70B 2UXDJ 1SXLA 3MEGA 3VWSA 3H98A 1YI2S 1U1PA 2ROPA 4JV0A 4ECWA 3SEOA 4JBCA 1S1WA 4AD6A 3W9HA 1XQIA 2XNQA 3GIRA 4UOFA 4R8UA 4DPUA 1NK7A 2PSZA 1TKDA 3DFEA 3TQEA 4RU2A 3ZZUA 4F02A 2YNGB 2F8HA 5T7LB 4BCAA 2CPXA 4U67Q 3OR1A 2VOOA 5LXRA 3TX0A 4A8MP 1O51A 4WCEQ 4W92B 1PAEX 1ELOA 1OSDA 2NCKL 5JMNA 2MQNA 4KRWA 1NSKL 3QYYA 2IC3A 5CAAA 1P1TA 1REVB 4WP8A 4KB7A 2JWNA 1LFPA 3ETMA 3PHTA 2DD8S 3G8TA 2D74B 3DOMA 2FHJD 1BMQB 4N56A 1CPZA 4F3MA 2IVYA 2BABA 1GK8A 3PTWA 3HXMA 3KJNB 1S9FA 5L9NA 2V6AA 2FLNA 5ETOA 1WOPA 4OX6A 2A6MA 1V5VA 2MLZA 1FKAF 2EC2A 3HSDA 1RAIB 2HMIB 4JI3J 1SC1B 2CAJA 3KJFB 3QT8A 2C2OB 2PMHA 2EVZA 1NO8A 4JI4J 3OHBA 4LSNA 1Q81T 3PACA 2NREA 1S4FA 4YR0A 5E41A 1VFJA 3KLGA 2HQCA 4PWDA 1V3SA 5F8MA 1TFYA 5DGAA 2BM1A 4K4WA 4DF4A 4TY8A 1SKWA 3BZQA 3ISNC 3UDVA 4ZVHA 1RKIA 4G3IA 3VF0B 1SL1A 4KKOB 4QZVB 4NA1A 2CFXA 1FJCA 3BGFA 2R3VA 4M63A 3EGZA 2V2KA 1TL1A 3RBEA 1IKVB 4A48A 3H20A 2VPZB 1RADB 1VQYA 1QM9A 5E5NA 1J2VA 3LO3A 1KVIA 5GAHI 1TKTA 3J80Y 4DX6A 1NKEA 1KQGB 2PGCA 3ENQA 4ZVQB 2PD1A 3HT3A 4J9PA 3IBFB 3PR5B 2IM2A 3CCSS 1B4SA 1I3OB 5EUHA 4U9RA 5LJ5Y 3TA1A 2OAUA 4C11B 2MZQA 4DF8A 2A10A 3GFYA 2DISA 3IWNC 4UQTA 2B3TB 4DR1J 2HWIA 3NL0A 1K44A 4QPXA 2AYBA 5LMNJ 4C4WA 3PNIA 2V9WA 3RW6A 3OVAA 3ENVA 3UD4P 2YNHB 3T1AA 2UVRA 5LSRA 4ANCA 3MPYA 1NAQA 2CQBA 1RWNB 3FRYA 4EEYA 2QO3A 4FBUA 4DL5A 3JAMY 5HJYA 4NI2B 4NZ7A 3G87A 1RE1B 3CJ0A 1AFIA 2ZZTA 1RT6A 2AD9A 1SJ1A 1KR4A 1MROB 5DM6Q 3EGVA 1YJNS 4FKYA 2FVQA 2MQLA 3FRZA 1RTDB 4KPCA 2DTJA 1UVMA 1Q7YT 2IY5B 1AT1B 1R8CA 2HK2A 2CKWA 2NSBA 3W8GA 1N6QA 1S5ZA 5IQQA 4XK8C 3VVTA 3CCJS 2LXUA 4ED3A 4YY3J 3OSNA 5KFEA 3W8PA 3ZFVA 4QIEA 4ELTA 3PYGA 1VQ7S 2FD2A 5ETNA 2V5HG 3FCHA 1CQNA 2HHUA 2LEAA 2R4FA 3NAHA 1FERA 1FRHA 1LWXA 3W62A 4FF3A 4F4XA 3FGVA 3BQ2A 2BQRA 4RW4A 4ECRA 2CG8A 3PKMA 4KGVB 3GV8B 3DLLQ 2FZKB 2XMUA 2CA9A 2CWKA 3C8YA 5K8NA 2F65A 1BXNA 2MZSA 5F0UA 1RTHB 1RK8A 2PIIA 2IRYA 4KC5A 3W1YC 2C2KB 1YZ6A 4P75A 4DUTA 3VR1A 2RAQA 1SL0A 3RB6A 1L5UA 3OV7A 3MPVA 1XR6A 4Z2XA 2HHXA 1RBLA 3HLUA 4MJKA 2HLTA 2C2DA 1S0OA 1E6VB 2J5AA 1UJ5A 3NGUA 1FJEB 3VGSA 2B7CB 4PXCA 5E3RA 4KJIA 3VQSA 1EAYC 5J2MA 1UTAA 2C22A 2GC8A 1Y0HA 1BHNA 3AOAA 4NZ0A 2DHGA 4S0MA 4XTTA 4CNZA 2LEPA 2QV6A 2W25A 2CVIA 5L8RC 1U7LA 3B4DA 1FEEA 2CJYB 2RRAA 3GSDA 5CYMB 1RAGB 2CQGA 1EX8A 1S59A 2V4JA 3U1MA 3MOJB 3H25A 2QIFA 1YHQS 2DH9A 1HQ2A 1SV5B 4QWAA 2UUTA 4B02A 2MEWA 2G0JA 1BLUA 1TAUA 4WZMA 3ZZOA 1WDDA 2CNOB 2V4RA 4C8NA 5BYRA 1X4BA 3NCRA 2Y1IA 2K7KA 3FDSA 1KLNA 5LSOA 4L73A 2IHR1 1VISA 3HVRA 1WF0A 4FP9A 3T1HF 2XO7A 1HBUA 2ZOMA 4DV2J 4WYLA 1Y4ZB 1S1TA 2ROEA 3DU6A 2AJFE 1KFSA 2GA7A 3J81j 5MLCV 1HNIB 4WXOA 1IJFB 2J7KA 3TP2A 1OO0B 3UN5A 1JKHA 4LRBA 3ISND 5F41A 1YIJS 1KN6A 3L9ZA 2QL7B 1YJRA 3U02A 1HQEB 2DEJA 2VD3A 2RQ4A 4WTOB 4B9VA 2IYIA 1UA0A 3MMCA 2OFGX 5LM7E 5E3AA 4IO9Q 2W7OA 3C15B 4GVBB 1CC8A 4I6YA 4PXEA 2WCXA 4OX8A 2HYIB 1WHYA 5B0BA 5H9FJ 2CQ4A 3V4IA 2W7AA 3S1TA 2MDAA 1OS5A 1A7GE 2FC9A 2V9KA 5J2NA 3LP2B 1VK3A 4MKBA 4LF5J 3QT7A 2LEBA 1WSRA 4K8RA 2M52A 4CLUA 1F2GA 2VBYA 3MTJA 4ECXA 3PFEA 2R9LA 1RABB 2R8GA 3KLFB 2QSWA 2V2VA 3QFWA 1TL7A 4N76A 4NEYA 2OJ3A 2QMUB 2UXBJ 1U4BA 4PKDB 2NYIA 2W01A 2VQEJ 4K5RA 4Q8FA 2R2UA 4OZNA 2CQDA 3OXFA 1QSSA 4FYXB 4PR6A 2JVRA 5A8RB 3OL7A 2WONB 4DL7A 1CVJA 4B17A 1BQMA 4YN3B 3VVUA 3TR5A 1UEKA 3HHKA 2MTLA 4OZ3A 4CLPA 3PR4A 4WKYA 2C28A 4U7UD 2KVQE 3LW5C 1X4FA 2XGQA 2IJNA 1N5SA 4ES3A 8RUCA 4CTAA 3P5BP 5DS7A 2WSFC 3MECB 2BZ2A 2ZH7A 2BE7D 2LQBA 3M9MB 4WP9A 3A8EA 3GONA 2VKZG 1HBMA 2CQIA 4UUXA 1RWMB 3RRHA 3ZZ0A 2C2NA 2E5HA 2QTWA 2VHGA 1JLFA 3I9V9 1VBZA 1H0HB 2RUSA 4ZVOB 4ZJLA 3M8QA 3TVZA 3IS9A 3E8OA 2HQFA 5KG1A 2ZHAA 3PYFA 4F26A 3L7OA 3QNWB 3D4JA 4C0OC 3QATA 3DN9A 4LF4J 3J81Y 4TKTA 2EK1A 2HW3A 3N79A 1U49A 4GMKA 4UT4A 3TZZA 1ZBTA 4HHHA 1VQ6S 1VK8A 3KK1A 4X62J 4DQIA 2LYVA 5LOQA 4PZVA 4J90A 4JI1J 1WC5A 3LWMA 2IM1A 3ZNJ1 3NGTA 4J9KA 3ZTRA 1DJ0A 4URQU 2WZ1A 4QPTA 2VQFF 3H5XA 4QWDA 5E3PA 1RU1A 2FVSA 2XZWA 3M8YA 4HEA9 2BA9A 2L9NA 2VB6A 1FK9A 3K2YA 1K9MT 2IRUA 2YKOA 4ELUA 4DWIA 1TVRB 3CJ5A 3MMBB 4CYUB 1Q8LA 2UVWA 4OIXA 2FHKA 2YQ0A 2H65B 2HHWA 3EGNA 2DNKA 4B3TF 4G65A 4AXJA 4DX8H 3G6ES 2ZH3A 1S0MA 2W2OP 4MYUA 2AIRB 3SSRA 1O0PA 4KGXB 5IWAF 3R6LB 3VCDA 4L72B 3C16A 2H4WB 5GADI 1U48A 3P45B 3CCRS 2P6TA 1XNRF 3SI8A 4W98A 4RLEA 2R7WA 1FDAA 3CJKA 3UE2A 3IM8A 3LOUA 2KB2A 2K7JA 1HPZB 3MM6B 3BKTA 2B9YA 3UNGC 4WBFA 4ZPVR 4DL6A 1S49A 4IOAQ 1B0PA 2NZ4A 4F67A 3H59A 3PIPQ 3NBPA 4JI5F 1HMVA 3HFZB 2X7IA 4CH0S 4F50A 4CDIA 3TA2A 2P2CB 2DR6A 1M1GA 4OYOA 4O44B 4OYIA 5KG4A 1JIHA 1NSQA 1DURA 4HDHA 2RS2A 4WE1B 2W2PP 1PAUB 3DOLA 3W7BA 2OPSB 4M5DA 3OT9A 5HI7A 5EWEA 2YWWA 3K8VA 2KYZA 1AA1B 3M32A 4DOZA 4KV8A 5F3TA 2VBZA 4ECZA 4ECTA 2E1MC 2CPYA 4YOEA 3GG1A 4LFAF 4AYBD 3TZXA 3AXMA 3ZZYA 1X9WA 1Z1ZA 4ZPDA 4RW8B 1P6TA 1KTQA 3AD9C 5BJRA 4OI2A 1WF2A 2JEFA 1D9DA 3DDIA 1SBRA 1W25A 1NEEA 1RSCA 2GHWA 4UOCA 2DY9A 4DV3F 1TL3B 3CCLS 2OKQA 4ZCKA 3C2PA 2FJBB 1M5SA 2GJ2A 1DBDA 4C9DA 3PW4A 1GH8A 2WRMA 4DR5F 3KUEA 4ZP7A 1N0VC 1Q4RA 5CQGA 1QE1A 3NS5A 3CMAS 3HHLC 2KHCA 5GAHU 4TYAA 2QFJA 1CS4B 4Q0BA 2XMJA 2WOMB 3G82B 5K14A 2LXFA 1D8ZA 5HROB 3EWGA 5EDWA 1GNKA 2RH3A 3RYLA 3DNCA 2W9AA 1Q8IA 5DETA 1ZYQA 2MKYA 3TWZA 1AXQA 3T19A 3JS9A 3PW5A 4ZLNA 4ZPCA 4AQYF 4EMDA 2OPRA 3QZ7A 4AL6A 1EKRA 2DKOB 5H9FK 2VG7A 3MCSA 1JLCA 1NPRA 4UQGA 1HKAA 4QR1A 3IAS9 1RHRB 5D4NA 4XPCA 3V6DB 1C1CB 3A4TA 2OPPB 3CCMS 3FC9A 3M2UB 2XULA 2O3DA 1JLAA 3TOQA 3RBZA 4J91A 2AGPA 1J5EJ 2DEIA 2AWZA 5K8PA 1MNEA 3D66A 2F1FA 2RS8A 4NXMJ 4KH0B 1Y9OA 3DRYA 1TMMA 3UVJA 4C48A 3UR3C 1TKZB 1Y3JA 1IM4A 4LR9A 3M8RA 3NY0A 4USUA 2ZC4A 2W4DA 2W9CA 3G71S 3CO0P 2E1CA 3K7RA 4P7VA 2ABYA 3W66A 5HBMA 2XTJP 1CJUB 2PFDA 1SC6A 4DCJB 5AJ3J 1LWEA 4FS2A 2ZJRQ 4DG1B 1FDBA 1N48A 4B3SF 4DV0J 4B3RF 3OFHA 2QZ8A 1U2RA 2K1RB 5KFUA 3IC1A 2V68A 1S76D 1YBAA 4ZVUB 4O4GB 2CXEA 1VGYA 4M95A 3N6MA 5J1EB 2JH3A 2H1YA 1PYSB 1YWXA 5KFTA 2HWTA 3NAIA 2BKOA 4LREA 1OY9A 2KVIA 4R25A 1R3NA 4MIWA 2CNLB 4RU9A 1U8SA 3TEHB 1YRUA 4ZN1A 4NLWA 3B54A 3KLVA 1DFDA 4ZS6A 4CM0A 1Y5LB 2R7UA 4CLWA 5HAOA 4G1QA 1WC0A 3SSSA 3M6WA 3ZTQA 3G2XA 3OTDA 3MM9B 3HULA 1T0TV 4B9NA 4ZHRB 1C0UB 2ZOFA 4J9QA 2CVEA 2DPIA 1S4EA 4PG4A 2QL5B 4F0HA 5F8IA 3W2WA 4CQ1A 4ECVA 3POTB 4CO3A 2HNZA 2Z57B 2HS0A 1TELA 4IQMA 1RT2A 3ILLA 2R8IA 4NRTA 4WF9Q 1N5VA 1VRQC 3A3NB 1CJTA 1SI9A 3CCZA 5EX0A 1SCJB 4F3OA 2I5JB 4F4WA 2CPFA 1KLMB 2BJ7A 2ZUGA 5EHHA 3R7NB 1DTTB 4IDKB 4ZP6A 4N8OA 4KYZA 1PYTA 2RHQB 3BO3A 4X65J 4IRKA 4OHWA 3TQ1A 2V50A 3N5FA 1N36F 3AA9A 1HNWJ 1JLEB 4NLUA 1H3DA 1PKUA 5D3GB 4K4ZA 2WB1D 1HA1A 4DX5A 3R1HA 3TAPA 3ONQA 1NZ8A 1CULB 5L9XA 4X2BA 3BB5A 4LF6J 1HYSA 3OFFA 1M5VC 4F25A 2ZOGA 3UDCA 2VKRA 5HLFB 4NCGA 1A9NB 2E7WA 1DAXA 2C2ZB 1ZA2B 1T03A 5D4LA 3P8BB 3PRDA 4RW6A 1UFLA 1LW2A 2QT7A 1ZM3A 3DHXA 4WP3A 1SKRA 2O01C 1H73A 3VGVA 5D0GA 1KQKA 3D3CJ 2MQPA 5DDPC 2YKNB 4RNNA 1BGXT 3RR8A 1HLWA 2AJ4A 5D0EA 4HHJA 3D0IE 3DOKA 3K17A 2KM8B 3DLKB 4FVCA 2J76E 3JXOA 3LA0A 2RQKA 2ZC3A 4JI8J 3HHLD 3M8ZA 2V8PA 3HHLB 4P7TA 2K06A 3BN7A 3I9ZA 4MK9A 3MI7X 5ITHA 3PW7A 2F5GA 4IOBA 4EGLA 3MAHA 1S1XB 2WAQD 3GFHA 1MG7A 4Y28C 5LMUF 2OI2A 1RI7A 1XMBA 2V8HA 2ZJQQ 2Z58B 2MYFA 1KONA 4PABA 1LXJA 5D0RA 4ZPTR 2MY7A 1XR5A 1FX4A 4YR2A 1VBYA 4NLQA 2KZMA 2IAJB 2HFVA 2MKKA 3G6VA 5HMYA 1YKWA 3WX8A 2DR9A 1RT7B 4Y0FA 2QA1A 2N4DA 2JC0A 1R6VA 3MM8A 3N6LA 4QQBA 3NGSA 2DR7A 2NUUG 2F9DA 2U1AA 1YX2A 1NDKA 1XMOF 4I6AA 5GMKa 3P3DA 4KT0C 2UUCJ 3QLHA 3BJYA 3BGRB 4KGMA 4F36A 4PCQA 2IC3B 1VS3A 3QSIA 3KNAA 1URNA 5A8KB 3TI0A 3L09A 2BJ3A 3DCAA 1JXVA 5BXIA 2CJ9A 1TUWA 2BXJA 3DRSA 1KRPA 3PO4A 5KFIA 4ZCIA 3H4BA 4HHUA 5KFGA 3FEZA 3WQPA 5KFHA 4W90B 3TARA 3DLEB 4DUZJ 4DDFA 2UXDF 2XBPA 4IFVA 3D5MA 3BR9A 2HNYA 2YPYA 1XNQJ 2PEBA 3KMSA 2D3O1 4IG0A 1FRLA 3AOCA 2K3KA 1R43A 5AE1A 3PX4A 3KHLA 3C66A 2I1RA 1VQ9S 4JUZA 1R0BG 4XDCA 4LSNB 2C3UA 3Q8VA 4WFYA 4JI6J 1WF1A 1UFKA 3MM7B 4TN2A 2HQIA 4KO0A 2EK6A 2LXIA 3JYTB 1NHKL 2DNQA 4ITSA 2OMLA 3BKFA 3MWBA 3B4MA 4RNHA 8AT1B 3LAMA 4F2RA 3G86A 1N5TA 1WORA 5F9LA 2LP4A 1XN9A 5J2QB 2QC3A 5LJ3Y 1E6YA 3LTOA 4DPTA 1I1GA 2GJIA 2PI5A 2VOPA 3ZO7A 3NNCA 2RU9A 4R0EA 5CA5A 4WFBQ 2E66A 4K4SA 5KFDA 3HJVA 4USJC 3MURP 1XERA 3Q8SB 1Y7PA 5CYQA 2B51A 1RT3A 2DXDA 3FFIB 4JI3F 4JI4F 5CH7B 1FKPB 2VG5A 1EIYB 3M8PA 1M90T 2E5GA 2ZZNA 1S97A 4CLFA 4N41A 3PHEA 1FXDA 4X4VA 2N82B 4Y2IA 2DGTA 4RWWA 1HHQA 2M70A 1R31A 3DRRA 3OFGA 1T95A 3DGVA 1LEOA 1FDDA 4RUBA 1RAEB 3SIPB 1UVKA 3HSGA 3MMAA 1WDTA 2XHWA 4GRSA 4X4UA 5A2QU 2AZ1A 2FPHX 3EPIA 1C4CA 1R0CB 3PFOA 3C6TB 1HNXJ 4RW7A 3QGGA 2DHXA 1MMLA 2BJ1A 2VONA 4TNOA 1UWBB 1T8EA 4P52A 2XMAA 5AXLA 4K4VA 4Q45A 3T5HA 2VL1A 3OLBA 3MR6A 7AT1B 1TL4A 3N9UC 2MQOA 5ETMA 1SJ4P 3R8YA 1RAAB 4ZN3A 4LF7F 4EYIB 5CCMA 4HT7A 1LKZA 2CPIA 4P73A 1LNQA 3IR5B 2P6SA 5FLXY 2QFIA 3F44A 2DR5A 4DR1F 4DN0A 1Z4UA 1RWXB 5LMNF 2C2EA 4AFFA 2F9JA 5CZVA 4X4TA 2ZBIA 1LK7A 1ULRA 3OPKA 2EPIA 4U95A 4K0KJ 5ETPA 3I96A 4J9RA 1GEHA 2KTQA 2IJRA 2CIMA 2J8AA 2KG1A 1CEZA 5U47A 2UUAJ 1SUQB 2R7RA 1ZS6A 4RUHA 3Q86A 4DXLA 3M6VA 2N3LA 3OW2R 2BACA 4F4AA 1WI8A 3TZWA 2FTRA 5A0YB 4H4KA 1AFJA 4LMZA 2W2NP 3KDOA 4XIUA 2EFNA 4P71A 2GGPA 2HGMA 1CC7A 2DITA 2E5IA 4YB1P 4WFNQ 4PPZA 3IRWP 1RACB 4OZ1A 2VU5A 2DGUA 5IM0B 2DNRA 2YX7A 5CHCB 4M5LA 4YY3F 2HVEA 4OZ2A 3AFGA 2LDYA 3KG0A 4ZVRB 3R1LA 3IBCB 1NJZA 1G4CA 2Q66A 5CABA 1RAHB 1NNDA 1CJKB 4NLDA 3PYEA 2YNIB 3QO9B 3HMJG 2CZVC 1IKYA 5KFQA 3I0SB 2DB1A 4AT1B 3NEKA 4FN5A 4HT5A 1SQGA 1T11A 3G6XA 2B5JB 2RRNA 2DGOA 2CZ9A 2H51B 1RBOB 2FQQB 1WD6A 1VBXA 4ENOA 3MEEB 2CQHA 1U24A 1RJJA 2X51A 4FXVA 4H4OA 3Q8YA 1BY9A 2NXCA 1UVNA 3O6QA 2D3ZA 1T7PA 1TKXB 5JUMA 3WX4A 1R6YA 3QWPA 4EYHB 2UXCJ 2ZVSA 1RTZA 2W9BA 1RHQB 3O1LA 4BWMA 4PUOA 2XCAA 4EK2A 2I38A 2AYMA 1T02A 3IWXA 3V6HA 3SCJE 1YJ9S 4P2SA 1IWAA 4MIBA 2D3UA 2JNJA 2ASDA 4CLKA 3ET6A 5DDRC 2VICA 3ZXWA 1HQUA 2M88A 1QDUB 1J27A 4QIVA 5C7PA 3MAQA 3TYTA 1DZ5A 3BH7B 3TA0A 3ADAC 2RDIA 1EETB 3H2LA 2WK4A 1TU0B 4MTPA 3I5CA 2K3IA 2JEJA 2MZJA 1ACMB 4ZVTB 3GJRB 2LQJA 4NE9C 3KLHA 1W2BR 5HL7Q 4YQWA 2XSFA 5HMWA 5DG9A 4DV2F 2XC9A 1TV6B 5IFMA 3JB9k 4M94A 5L1JA 1FFSB 4FNHA 2W1BA 1Q5YA 5IQ6A 2XHCA 4J9MA 1X9MA 1H2TZ 3V4MA 3K58A 4ZLLA 1Q7LB 2GX8A 4FYWB 1DRZA 1NCLA 1DQ9A 5HJXA 3M9OB 5C42A 1Y5IB 4M5MA 1U1RA 2J6SA 4PYDA 3Q89A 1X5SA 4ELVA 4H4MA 2MZ1A 3HVTB 4NXNJ 1BQNB 2YWFA 3D2WA 4ETXA 1IR0A 1X9SA 3M6XA 4LF5F 2F4VJ 4PG6A 4DR6J 1OIAA 3DI6A 4L75A 1WEZA 5DQHA 2BUNA 2NR0A 4Q43A 1X5OA 4KHRA 3DLHA 1FKOA 4B3MJ 2R7XA 2HS3A 1U0HB 1PGZA 2NYHA 4X4PA 2BE2A 1R8BA 1FTCA 1WSVA 2XG8A 2UXBF 3Q24A 5D6GA 4NYZA 2VQEF 3EXYA 4U8YA 1HFEL 2FZCB 2B0GA 5H9EJ 2Q6BA 3I0RB 3D9BA 9RUBA 2ZD1A 1L3UA 4F3QA 4BC7A 2RRBA 2XLIA 4DPYA 5KOXA 1TZ0A 2CJBA 2EI5A 3W5YA 1S57A 3PM9A 2JL9A 1YITS 5KOWA 2VDHA 1MMDA 3LP1A 1C1BA 1VQ8S 1N4LA 2E5LJ 3NLCA 4ZVPB 3PX0A 4LVNP 2J9EA 2J0SD 5A8WA 3JQKA 2J6UA 4DZDA 3B82A 2MQQA 1RLCL 4CO4A 3DYAB 3CJ4A 4A8QA 4F8RA 3CC2S 3KHRA 2NXNA 1SPBP 4NL5A 2JDJA 1MU2A 4ED6A 1R0AA 4DR7J 4LRCA 2ZBRA 3SCLE 4I7FA 1VDHA 1N88A 3JSBA 5B08A 4DX7A 2PE8A 5E33A 4I2PA 1JLGB 4HACB 4ED8A 2RD5C 4FNIA 5IT9Y 3G9CA 2DVIA 3HFVA 1N52B 4DSJA 1MMNA 4GKKJ 3IG1A 4MH8A 2PMWA 4LF4F 2IJFA 2PA8D 4P74A 4OHXA 4RBTA 2GVDA 3H42A 2V4QA 4U96A 3LGNA 2BJDA 2KN4A 4MKAA 4NLYA 4UW2A 2Y1JA 4J9VA 4X62F 4A47A 3VAKA 1H74A 2G13A 3TX8A 1NK0A 2Q1LA 3AODA 3BSOA 4JI1F 4CT8A 3GFZA 3CT9A 4RJVA 5J2PA 1U2CA 2D41A 1IR1A 3FQKA 4JP8A 3NMAA 1AYEA 3K0JA 1L3VA 3NCPA 1KTVA 1ZA1B 2HFNA 2HRUA 1IKWA
chains in the Genus database with same CATH topology
1FFSB 1A0OB 2LP4A 1FFGB 1FWPA 1EAYC 1FFWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FFS B;  1A0O B;  2LP4 A;  1FFG B;  1FWP A;  1EAY C;  1FFW B; 
#chains in the Genus database with same CATH topology
 3T5K A;  2BE9 B;  4K4X A;  4YDD B;  2FJV A;  3MED A;  2ADB A;  3E2E A;  4I2Q A;  2OGU A;  1S1V B;  4LFB J;  4QIG A;  5D0H A;  2Z4P A;  2HBR B;  2HIY A;  4NA3 A;  3CCQ S;  2KT2 A;  1O5J A;  1N5Y B;  1YK9 A;  2F8E X;  2KU7 A;  2H5E A;  2YNF B;  2HFU A;  4ICL B;  2ZH2 A;  3P4U B;  3HKW A;  3OTC A;  4FYY B;  3N28 A;  2N4C A;  2CQ3 A;  2YNG A;  3CJ2 A;  5T7L A;  2MGZ B;  2EC0 A;  4Y65 A;  3A8I A;  5B0A A;  5KT3 A;  2IM3 A;  2YY3 A;  1G2E A;  1IN0 A;  4TYB A;  3S6E A;  1REV A;  2GIF A;  1FD2 A;  2C1E B;  3IRX B;  5BYQ A;  4TU7 A;  3EXC X;  4Q5V A;  2BBE A;  2DNN A;  4IOC Q;  4IYQ A;  1V3Z A;  2BRK A;  1U25 A;  3K5L A;  1NBE B;  3KK2 B;  4M5I A;  1B0T A;  2GIQ A;  2EKN A;  4CH7 A;  3TEG A;  2EFP A;  2H3E B;  3HFK A;  2AV5 A;  2Q6C A;  2L08 A;  5F3Z A;  4X4Q A;  2HZC A;  4BS2 A;  1SH0 A;  5D78 A;  1NM2 A;  4QW8 A;  1JXL A;  5KFF A;  1YDL A;  5I42 B;  4YB7 A;  1FRI A;  4CO1 A;  2BYC A;  3B78 A;  3EZU A;  4KPY A;  1MW7 A;  5FII A;  2HMI A;  2ZE2 B;  4JI0 J;  2H5I B;  2C3P A;  1D0E A;  1OYE A;  5FDL A;  1NK9 A;  1JLC B;  4ZIT A;  2M7S A;  2PEH A;  2ERR A;  2PMZ D;  3PW2 A;  4KGK A;  3LP0 B;  2CDQ A;  4G1P A;  4LQ3 A;  3H2U B;  1G1X A;  4OJ1 A;  1F3F A;  3CCE S;  2OIH A;  3LGM A;  4CNY A;  2P5V A;  2B8Q A;  2UZA A;  1FNO A;  1FFW B;  1IXK A;  1YBU A;  4ZDN A;  3THT A;  2WW8 A;  3Q83 A;  4IO1 A;  2HVZ A;  2DIU A;  2YH0 A;  4KKO A;  4O23 A;  4KGZ B;  4EBD A;  3CDW A;  3MAA B;  1VLO A;  5C2C A;  2DYA A;  3DLB A;  1Q53 A;  1ZZF A;  4LF8 J;  1M5O C;  1PC5 A;  5GAG I;  1IKV A;  2JRS A;  3CMQ A;  3M1V B;  5SZT A;  2RF2 B;  1VIX A;  3DM2 B;  2FVC A;  4LR8 A;  2AYE A;  2XCP A;  4QIW D;  3CDB A;  3T5L A;  1YBT A;  1AUS L;  4QJV A;  3U7J A;  1M0S A;  5CD4 A;  4MK8 A;  3RB3 A;  3C19 A;  1DTQ B;  3TW0 A;  3QMQ A;  5F9N A;  2QG9 B;  4C11 A;  1TUG B;  4F04 B;  2CPJ A;  3L95 X;  3BQ1 A;  3C14 B;  4IRC A;  2HUR A;  1VR6 A;  3V2U C;  1L3K A;  1DY3 A;  3F56 A;  2DK2 A;  5IXU A;  2YNH A;  4WIQ A;  2IBK A;  5J1N A;  4QWB A;  1J5E F;  5E7O B;  2B6A B;  4NI2 A;  1X4E A;  1HBN B;  2EFQ A;  4U7U K;  3GE9 A;  1VBK A;  3QIP B;  4NXM F;  3SQG B;  3PJ9 A;  4NX9 A;  2UV8 G;  4NA2 A;  3LH2 S;  1EJ7 L;  1PIL A;  1T05 B;  2HFS A;  3NWG A;  3J7Z 5;  3H2V E;  4I69 A;  1MRO A;  2IDE A;  2KKH A;  1NK5 A;  3CIM A;  1WKJ A;  3BS9 A;  1XTZ A;  1HNZ J;  1RTD A;  3UDE A;  2HPU A;  4WFX A;  2FJA B;  1P27 B;  1S9G A;  1X4G A;  1WUU A;  3PEH A;  2ZH9 A;  5C2G A;  2FY1 A;  2GNK A;  2ZUA A;  4DV0 F;  3GZ7 A;  4B3O B;  3AAW B;  3NWR A;  2DXE A;  4MFB B;  3GCX P;  5BYS A;  3FKB A;  3GII A;  1S99 A;  2AJQ A;  4QU6 A;  4CM2 A;  1VJW A;  5IS2 A;  3ILJ A;  3KMQ A;  2VC1 A;  2FJX A;  1B7F A;  1Q16 B;  5KFW A;  2CJA A;  1N0U A;  4UF4 A;  1KQF B;  4OHZ A;  2CDR B;  5D4P A;  4TU9 A;  4X66 J;  2BOP A;  3JTN A;  5ETR A;  2WHO A;  1HBO B;  1RTH A;  2DRB A;  2KXF A;  2XMK A;  1P8G A;  4KFB B;  2YX4 A;  2AJ1 A;  2W8L A;  1TFW A;  2YBV A;  3RRG A;  3CD0 A;  3HT0 A;  3QRR A;  3M2V B;  4GKJ J;  2XLK A;  4KE5 A;  4DV6 F;  2XMV A;  1LXN A;  3NG8 A;  1NHV A;  1E6V A;  3T1H J;  3UD3 P;  2MZT A;  1RWO B;  2ZZM A;  1UJ4 A;  3CSK A;  4J37 A;  5B0D A;  4R5P B;  1C4A A;  3KLI B;  2OLW A;  4C8L A;  2ZH1 A;  4DFP A;  1RTJ B;  1JK9 B;  1GXU A;  2DPJ A;  1XEZ A;  1KVJ A;  2W2Q P;  5FD1 A;  3GV7 B;  1MN9 A;  3KWM A;  4X65 F;  3GIK A;  4ALZ A;  2E1A A;  4PWU A;  4JI2 F;  2D9O A;  3BO2 A;  3DDN A;  2AEF A;  4WK3 A;  4ZPW R;  3NP5 A;  2E9Z A;  5SUH A;  1NXI A;  3EMT A;  4ECY A;  2LA4 A;  5DZ6 A;  4H54 A;  1HNW F;  1NK8 A;  1RWW B;  2RE1 A;  3MPU B;  4X84 A;  3J80 U;  2DNP A;  5G0R B;  4LSL A;  4NLT A;  1HR0 J;  3BKU A;  2KRR A;  3LGH A;  2NPI A;  4X4S A;  3C6U B;  4N47 A;  1SV5 A;  3QBC A;  3MUT P;  3KXD A;  1TK0 A;  1U1L A;  2IIH A;  4LF6 F;  4E0D A;  1FXL A;  5GMD A;  3CJS A;  4DR4 J;  4J9L A;  5I3U B;  3BYP A;  2OSR A;  2GQQ A;  4O4R A;  2MPU A;  4B08 A;  4JYA J;  1ICE B;  3WIV A;  4HLB A;  4LBH A;  4DQR A;  4V1A k;  3JAM U;  1HNI A;  5BR8 J;  1RT5 B;  5D8H B;  4HDG A;  2Y0B B;  3CB4 A;  2GVZ B;  4WWS A;  3NS7 B;  2F63 A;  1HQE A;  5A6W A;  2DO4 A;  4JI8 F;  5ETQ A;  1SQE A;  3QID A;  3C15 A;  4GVB A;  4P2M A;  1OQ3 A;  1U6B A;  3W9J A;  2MHE A;  2L9W A;  4QYR A;  3ETO A;  1PCA A;  3QJL A;  3FSI A;  1FXR A;  2O1P A;  2E7V A;  4RUA A;  3LP2 A;  2ACM A;  2I8E A;  2K2P A;  2V94 A;  3GSI A;  3L7P A;  4NCB A;  1X0F A;  4K2J A;  4DSF A;  1PJ6 A;  3OR2 B;  3PKY A;  3SYZ A;  3R27 A;  3WIU A;  1WI6 A;  4WJB A;  1U1K A;  3KLF A;  3JSR A;  1S6P B;  2LVW A;  2AEJ A;  4X64 F;  4YHH J;  4AL7 A;  3FZ2 A;  4QR2 A;  2B7B B;  1UL3 A;  1IR2 A;  2LQ5 A;  2M5Y A;  5DLF A;  4DFM A;  2AGQ A;  3DMJ B;  2UUC F;  4FKX A;  3LUY A;  3ZZZ A;  3MCO A;  5A8R A;  2WON A;  3VTI A;  2KZZ A;  3MM5 B;  2G9O A;  3PJX A;  2I2Y A;  2JLE A;  2ZVI A;  1CJV B;  1PO6 A;  2E1P A;  5KFP A;  3TAN A;  1RYS A;  2W7P A;  3VAJ A;  3EM1 A;  3KLE B;  4CT9 A;  4XAK A;  3RAQ A;  5HN0 A;  2AJ2 A;  3I6P A;  2XYP B;  3PW0 A;  5D4O A;  3MEC A;  4BWJ A;  4DUZ F;  3GP9 A;  1NKC A;  1RYR A;  5HAT A;  3K57 A;  1XMQ J;  2X3D A;  3HPO A;  5J1P A;  2R7S A;  4OJH A;  2LA6 A;  1SVD A;  1JWW A;  3DRX A;  2J9D A;  1YTY A;  2OTJ S;  2RT3 A;  2IPO B;  4MK7 A;  1CBK A;  2QX0 A;  2AW0 A;  1WTF A;  2V63 A;  3OUY B;  2E9T A;  5DDO C;  1RTI B;  1FNX H;  1KWM A;  1K0T A;  4ZIV A;  4JI6 F;  1IBL J;  2J9C A;  5HO4 A;  2BAN B;  2A0F B;  3GPA A;  3UWT A;  3OHA A;  1QSL A;  2GAH C;  2LU2 A;  2OHD A;  2RNE A;  2DGS A;  2WSC C;  5KFZ A;  3LQV A;  2DH8 A;  5IWA J;  1QY7 A;  2NLW A;  1S6O A;  4EU0 A;  1XIQ A;  3M2R B;  3S8S A;  2FIU A;  1EB0 A;  3IMQ J;  3VQT A;  4DV1 J;  1V6H A;  1HNV B;  2LQ9 A;  4PQA A;  2OEJ A;  3OBI A;  4OYZ A;  3MFH A;  2HGN A;  1HIY A;  2XY7 A;  2OPQ B;  3R7S B;  2QL9 B;  1RCO B;  4LRA A;  4M1K A;  3W2V B;  5EX3 A;  4NAS A;  3IA0 A;  2ZM6 J;  1SH2 A;  3SCI E;  3R5D A;  2EFG A;  2EWH A;  3WZ0 A;  3KKF A;  4JI5 J;  1GMU A;  3QJJ A;  2LQ8 A;  2XYG B;  3N6N A;  3CTR A;  4CO0 A;  4TLQ A;  2VPW B;  1JJ2 R;  1Q78 A;  2Y1L B;  3MMB A;  2XI3 A;  4CYU A;  4O0N A;  1UWA A;  3BBF A;  5E0O A;  1RA6 A;  4OYA A;  2XM3 A;  3R97 A;  4ANE A;  4DSE A;  3EVO A;  3FBE A;  1B7Y B;  3ZTO A;  2E29 A;  2VA3 A;  2XSJ B;  2KFY A;  1RBA A;  4UOH A;  3A8K A;  3MZI A;  4ID5 B;  2I9S A;  4NWB A;  2DR8 A;  2E1R A;  2Y3Y A;  2KI2 A;  1GMW A;  2FHO B;  5IT4 A;  1DAR A;  2GHV C;  4DBQ A;  2DJW A;  1AB8 A;  2B9X A;  2KRB A;  2MST A;  2HHS A;  3QSY B;  4ILL A;  1HNX F;  1QVF R;  4C3K A;  1NU4 A;  3IGV A;  1HPZ A;  4ZCL A;  3MM6 A;  4K50 A;  3RZA A;  3UQS A;  2DCU B;  1LV5 A;  2MKJ A;  3DLG B;  3GG0 A;  4M5H A;  4JV1 A;  2UUW A;  3S01 A;  4Z37 A;  2CPZ A;  4BBY A;  4DS4 A;  1S0N A;  2HVD A;  2CQ2 A;  1B64 A;  3CIZ A;  3SBM A;  4O44 A;  4A8W A;  3RB0 A;  3D1O A;  3IGN A;  4YUD A;  4UY8 T;  2WSE C;  3ITH B;  1RLD A;  4WE1 A;  3W3S A;  2IBO A;  2OPS A;  3GV5 B;  3KUG A;  2IM0 A;  2ASJ A;  4PQU A;  4B9S A;  1WKK A;  1N8R T;  2HVI A;  4OJG A;  5HMX A;  3UW1 A;  1BWE A;  1YLX A;  1JB0 C;  3MUM P;  1WHX A;  3A3O B;  4ECS A;  4IR1 A;  2UUA F;  3IAM 9;  2F7V A;  4IFY B;  2I6W A;  3OJS A;  3I56 S;  4RW8 A;  3L4B C;  2QE5 A;  1RHK B;  1WOO A;  2AGO A;  3A13 A;  1NUE A;  2FDN A;  1MSW D;  4I68 A;  4DJB A;  3IXQ A;  1TL3 A;  4ECQ A;  1ZZN A;  4J5O A;  4NLP A;  3KHG A;  2ZBP A;  4CLY A;  4ID8 A;  5F8H A;  4QIF A;  3J81 U;  2W8K A;  2UV8 A;  4DFK A;  1MN7 A;  5GAG U;  1T3O A;  1QAJ A;  3SSQ A;  1KVK A;  5HVH A;  2PT0 A;  2RKI B;  1NJI T;  4AE5 A;  4OI6 A;  1CS4 A;  3E01 B;  2V2Q A;  2WOM A;  3G82 A;  5I3Q A;  2G2O A;  1PJ7 A;  1WC6 A;  5HRO A;  1H6K X;  4BHQ A;  5F8L A;  3V81 B;  1FNM A;  3OVB A;  2P9G A;  4DS5 A;  3ET6 B;  2R2R A;  5B0E A;  2J7U A;  1OWX A;  1GQE A;  1VJQ A;  3PIO Q;  2VFR A;  3E3X A;  3AQP A;  2HAF A;  4DR2 J;  1UP1 A;  1I94 F;  4NRU A;  1FRX A;  4F4K A;  1JLQ B;  2BV3 A;  3DRP B;  1LWC B;  2DT9 A;  4IH7 A;  2ZH8 A;  3HD1 A;  3TUP A;  4KH1 B;  1HWJ A;  1DLO B;  3V6D A;  1C1C A;  1LK5 A;  3N01 A;  1QJH A;  3LAL A;  4OL8 A;  1RAJ A;  2OPP A;  3NXZ A;  3EE3 A;  3M2U A;  1FRK A;  3R7B B;  1AZS B;  4EI2 A;  3K5O A;  4LFC J;  2QMW A;  4L6V 3;  2X3G A;  4LBI A;  3ULH A;  4ZK7 M;  1SKS A;  1EP4 B;  2RHS B;  4WTY A;  1FJG J;  3ZZT A;  1F0X A;  3W60 A;  4KAI A;  3CVK A;  1RB0 A;  1TL5 A;  3GJS B;  2W4C A;  2FLP A;  1TKZ A;  1CQM A;  2YKM B;  5JJB A;  2LCW A;  3M8S A;  1EQM A;  3FBB A;  2FB0 A;  1GFW B;  2RUG A;  1Q8B A;  4ZMM A;  5EWG A;  4RBV A;  1FCA A;  3GYN A;  2JJ4 D;  4EFA C;  1CJU A;  2IDL A;  2XYH B;  4LVO P;  2PN6 A;  2A2D A;  3CJT A;  4B9M A;  3CCV S;  2JHE A;  4DG1 A;  4LF1 A;  4YR3 A;  4NYO A;  3FBC A;  2MLX A;  5HMZ A;  2K1R A;  1NH8 A;  4DR3 J;  2C2R A;  4UY8 5;  1RXO B;  4O4G A;  4A8F A;  2FJW A;  3OL8 A;  5J1E A;  1J5O B;  2OUG A;  4OYW A;  2VJV A;  2CPH A;  3TJ8 A;  2C3M A;  1RT4 B;  2APO A;  4M8L A;  1ZPW X;  1RWK B;  3MEK A;  4OYP A;  4FDF A;  3H5U A;  1FWL A;  3QGP A;  4Z7C A;  5IV4 A;  1S9E B;  3MM9 A;  4URS A;  2IFX A;  3RU0 A;  4ZHR A;  1C0U A;  4A8O A;  1FO1 A;  2AZ3 A;  3DGP B;  3E51 A;  1IQZ A;  4Y34 A;  3JSM B;  3AA8 A;  5KT2 A;  1LWF B;  4IG3 B;  3T1Y J;  3FBF A;  3POT A;  4ED4 A;  4NLX A;  2RQC A;  2UP1 A;  4NXN F;  3HSZ A;  1WC1 A;  4CO5 A;  5EGY A;  2JFD A;  1P9Y A;  4LF9 F;  3FEY B;  2F4V F;  3TVK A;  2M3D A;  3RUB L;  2I5J A;  3MTK A;  4I64 A;  2JOQ A;  4TVA B;  1KLM A;  3H5S A;  1L3S A;  1S6Q B;  3KHH A;  1Q79 A;  4IDK A;  2IVM A;  4DHV A;  2H4Y B;  4B3M F;  1JJ4 A;  2XO6 A;  2FVR A;  4O3Q A;  3ILO A;  1PBA A;  2RDJ A;  3W9I A;  2KL8 A;  2G2Z A;  1U26 A;  5L1I A;  2RVJ A;  4DU7 A;  3CCW A;  3CD6 S;  1U45 A;  2RDD A;  2VDI A;  3VZI A;  3RBD A;  1D8Y A;  1X5T A;  1QTM A;  1JLE A;  4RR5 A;  2Z0G A;  4DLE A;  5THW A;  5D3G A;  1N34 J;  3FSX A;  4PG7 A;  1CUL A;  3A12 A;  3JQM A;  2V8D A;  1NB7 A;  2BJ9 A;  2B4U A;  2VG6 B;  3HHE A;  3GIM A;  2R2S A;  5HLF A;  1A0O B;  1BD6 A;  1KBR A;  1YJT A;  5B0G A;  4MKV A;  3Q8Q B;  5I4M A;  2VAS A;  4FPI A;  4DUY J;  1F60 B;  3AJ1 A;  3MR7 A;  4RW9 B;  5D15 A;  3K59 A;  2ACY A;  3TUZ C;  4LIR A;  1X4D A;  2CPD A;  2M2B A;  3TO8 A;  4ILR A;  3HCX A;  3DLK A;  3OL6 A;  4P72 A;  5HQM A;  5EN1 A;  3D3B J;  3K5M A;  4ZP9 A;  3HHL A;  1U47 A;  4CI0 B;  4ES2 A;  1F2H A;  5KFR A;  1C0T B;  5L1L A;  2YWH A;  4CO2 A;  3MR3 A;  2KYX A;  1HL6 A;  1S1X A;  1IJE B;  4Q7A A;  4GKK F;  4Y6I A;  4NLO A;  1OQ6 A;  2JLF A;  5CZX A;  4NLS A;  1HW8 A;  1I6J A;  3NGK A;  2HHV A;  2HND B;  1WEX A;  3K89 A;  1DQA A;  1WOS A;  3HD2 A;  2IAJ A;  3KK3 B;  1RT7 A;  4WFA Q;  1Q95 G;  1K1S A;  2DHH A;  2QA4 S;  3QRP A;  2EEY A;  3M05 A;  4DCP B;  3PDN A;  5IC4 B;  5C24 B;  4X4R A;  4DV7 J;  5HP1 B;  4C8Y A;  2B43 A;  1RU2 A;  4LF2 A;  3BPD A;  1WAC A;  2VZ9 A;  3D68 A;  2DGV A;  3BGR A;  1UJ6 A;  2CYY A;  1VQP S;  5A8K A;  2YWE A;  4J9U E;  1SIZ A;  2QRR A;  4EO6 A;  2VC0 A;  2GO8 A;  5KTQ A;  3BV8 A;  3BBC A;  4PG5 A;  1H2V Z;  1S0V A;  1VC6 A;  1NME B;  1DHM A;  4A4J A;  1JMT A;  4FF4 A;  1EQ0 A;  4PXD A;  3CJ8 A;  2MHN A;  1F9H A;  1V9O A;  4QCL A;  4LFB F;  1PC4 A;  5KAK A;  1IKX B;  3DLE A;  1BQX A;  3IO1 A;  4O3R A;  3CJ3 A;  4I67 A;  2ATL A;  3BH6 B;  3Q23 A;  2GV1 A;  1JLB B;  1LW0 B;  4KHP J;  2CRL A;  3IM9 A;  4HTJ A;  1S1U B;  1RHM B;  1FRM A;  3OTO J;  3RB4 A;  1UZD A;  1KOH A;  3R6G B;  2Z2M A;  1VQM S;  2UUB J;  5FDL B;  3UPF A;  1Z2Z A;  1Q8K A;  3EDQ B;  4U6P A;  2V34 A;  1ZH5 A;  4K4U A;  3MM7 A;  4DQP A;  2HK3 A;  4CWB A;  1N56 A;  2DCL A;  3TUI C;  3MDF A;  4MT1 A;  3HO1 A;  2L9D A;  4U8V A;  4Y2K A;  2BW2 A;  3GQC A;  2ZHO A;  1UET A;  3JYT A;  2QLB B;  5KFY A;  1HI1 A;  2GZO A;  1IQT A;  3CNQ P;  1PBU A;  2AEM A;  1YGY A;  1IBK J;  1NHU A;  1BE4 A;  5J2Q A;  1SIW B;  1VYA A;  1Y10 A;  4WXW A;  2WB4 A;  5C25 B;  3UR0 A;  3SV3 A;  5CCL A;  4HH0 A;  4DLG A;  5DGB A;  2M9K A;  4CZC A;  1GX5 A;  4LQ9 A;  3H5Y A;  3MGJ A;  4PEO A;  5K9F A;  3SV4 A;  2RIJ A;  4PWW A;  3QJP A;  3FFI A;  4JI0 F;  4E8U A;  4LF7 J;  4D3G A;  2HS4 A;  1UA1 A;  1FKP A;  1S12 A;  2H9Z A;  4OI3 A;  4A8S A;  1PJ5 A;  2L3M A;  2JX2 A;  1GXT A;  2BEF A;  2ZJP Q;  3PRB A;  4RPF A;  3VAF A;  2XI2 A;  3TAQ A;  4OYB A;  2E7X A;  3GIJ A;  2V0N A;  4QWC A;  5HAN A;  4C7Q A;  5HVF A;  1RT1 A;  3D0H E;  2HGL A;  1I5O B;  4IUF A;  1VRT B;  3EUN A;  1N32 J;  3GU0 A;  5CD4 H;  1QAI A;  4ER8 A;  4DN9 A;  4F7V A;  1X4A A;  1Y00 A;  2MXY A;  2YVS A;  3KUH A;  1S10 A;  1XJW B;  5ETS A;  1RDR A;  2CQ0 A;  3BR8 A;  1N33 F;  3C6T A;  4LF8 F;  4ILM A;  2HBZ B;  4G6V B;  4RNM A;  4EUV A;  2YKQ A;  1RZM A;  2AJ0 A;  4EBC A;  2R8H A;  3TAM B;  4UOG A;  1UWB A;  4Z7Y A;  1U1M A;  3CUN A;  4KY3 A;  1S9G B;  2DNG A;  2FHM A;  1CLF A;  2Z2L A;  1M1K T;  4EBE A;  2DBB A;  3OLA A;  4W4M A;  1NH7 A;  3HZG A;  1FA0 A;  1FVQ A;  3OTB A;  3CJQ A;  3MD1 A;  1EKS A;  2JEG A;  2Z30 B;  5KFA A;  3MEG B;  2DIV A;  3D6M B;  3QWU A;  2FJE B;  1S1W B;  4A8K A;  1RA7 A;  2YH1 A;  2GFF A;  2V8V A;  4G1I A;  4ZVE A;  4R8U B;  3ENW A;  3BO4 A;  2HHH J;  1SUQ A;  4YP3 A;  1M1H A;  4ED1 A;  3OR1 B;  4XO0 A;  4GO5 X;  2J6T A;  4YS2 A;  3AH6 A;  4FF1 A;  4NCA A;  1HNZ F;  2LDI A;  4WII A;  5A0Y A;  5DQG A;  3HHD A;  2BQ3 A;  4I6W A;  3BYR A;  2IMW P;  2G1H A;  3SMZ A;  5K5M A;  4ZPB A;  3DOM B;  2GML A;  2GJF A;  2DGW A;  4OZJ A;  3VAL A;  1QAX A;  1FES A;  1X7V A;  3HP6 A;  4TXS A;  3D6H B;  4B9T A;  5IM0 A;  1B0V A;  2BQU A;  3P5T L;  2HWH A;  4UZC A;  1YRX A;  4C8K A;  1LQ9 A;  4CLZ A;  4L3K A;  3UCZ P;  1TP7 A;  4DQQ A;  1CJK A;  3GJQ B;  3UCU P;  3WC2 A;  2YNI A;  1VQL S;  2VF3 A;  3QO9 A;  2VPX B;  4F0M A;  4DCO B;  1YQH A;  4C0B A;  4LSZ B;  4LT6 A;  4RKU C;  3VHQ A;  3I0S A;  4LSL B;  1NDP A;  1YVF A;  2NXE A;  4Q44 A;  3NRB A;  3NOG A;  4LUB A;  2B5J A;  4X66 F;  2AF6 A;  2KHD A;  3PO5 A;  1QVG R;  1YJ7 A;  1D1U A;  3MEE A;  5DZ7 A;  2ILY A;  3KLG B;  2BJ8 A;  3O8W A;  4PWD B;  4Y2C A;  3IN5 A;  2MQM A;  5DO2 A;  2X1G A;  2LLZ A;  2XB2 D;  4GKJ F;  4TY8 B;  2UU9 J;  2OH2 A;  1H72 C;  4FS1 A;  1WTB A;  5RUB A;  3PRV A;  4HR2 A;  3KOA A;  4JB8 B;  1TKX A;  2ZFH A;  3I87 A;  2WBM A;  4ZJO A;  4ECU A;  2OFH X;  1BUX A;  2U2F A;  4OI0 A;  4Q2L A;  1TL1 B;  2AP6 A;  2HRY A;  2B56 A;  1FTR A;  1TKT B;  3S7R A;  2GQ2 A;  4C6A A;  3G96 A;  4PG8 A;  3O2I A;  3VAM A;  3OL9 A;  1IM6 A;  1HI8 A;  1CSJ A;  1KEK A;  1U1O A;  3NNH A;  2RSQ A;  4ERD A;  1JNZ B;  4KHM A;  1HR0 F;  4MIA A;  2QJ3 A;  2JSX A;  4NYP A;  4UST A;  2B4O A;  3CED A;  1QD1 A;  1K0V A;  3PG9 A;  3HJF A;  3I55 S;  1EET A;  5GAD U;  2HRT A;  4IRD A;  5FLX U;  4WKR A;  4DR4 F;  4C8Z A;  2IRX A;  1Q82 T;  1FF2 A;  1FFG B;  2YQ3 A;  4JV5 J;  2OD4 A;  2OP5 A;  4J9O A;  4FZV A;  3GCW P;  3HDS A;  3SFG A;  1URR A;  4JYA F;  1TV6 A;  4K2X A;  3CW2 C;  5BR8 F;  1RT6 B;  3G6Y A;  2VPY B;  3Q8P B;  2DGQ A;  5AE3 A;  1PYO B;  2LMI A;  5M2R A;  1UZH A;  2ZBC A;  4ZPA A;  5IC6 B;  2HG4 A;  2HKE A;  5T14 A;  4WU3 A;  1HAR A;  3THV A;  1N6Q B;  4CP5 A;  3HVT A;  2PDA A;  5KFC A;  1BQN A;  2ZEJ A;  1VHF A;  2HBQ B;  3W64 A;  2LEC A;  5E3Q A;  1UAW A;  2PA3 A;  5DG7 A;  2ILZ A;  5A76 A;  4UUW A;  1FT8 A;  1KKH A;  1X31 C;  5KT6 A;  1VQK S;  4RW4 B;  4YHH F;  1U0H A;  4QU7 A;  1TTH B;  4LRF A;  4DV4 J;  2E5J A;  2BW7 A;  1Y11 A;  4DEZ A;  4U7C A;  1D9F A;  3H0P A;  6AT1 B;  1NJW A;  5ETK A;  1JJC B;  3P49 B;  3I0R A;  2MKS A;  2FJD B;  1UCN A;  4QR0 A;  3GLJ A;  3N0V A;  1T9T A;  4YDX A;  2O66 A;  2NPF A;  1OPI A;  3I4H X;  3BPS P;  4ZVG A;  2VUG A;  1WG5 A;  5KFS A;  4NML A;  3EPG A;  2GAG C;  4QWE A;  3ZTP A;  3DC2 A;  2BDP A;  2PC6 A;  5CXT A;  1EHW A;  2ZBQ A;  1NSP A;  2RU3 A;  5J2M B;  4WK1 A;  3J7A N;  1XMQ F;  4JOU A;  4YB5 A;  3H7H B;  3D6T B;  4LRD A;  3DYA A;  2DNH A;  4N8N A;  3M6U A;  4AXI A;  1FRJ A;  1RAO A;  5KG6 A;  3CDE A;  2ROG A;  2CPE A;  2XS2 A;  2COL A;  4HVZ A;  3TZY A;  1X5P A;  4JI7 J;  4PXB A;  3CO9 A;  1IBL F;  2V4J B;  1JLG A;  5B0F A;  4HAC A;  2FGC A;  2AKW B;  2QLJ B;  4OX9 J;  1RWU A;  1FWP A;  4CLL A;  1H2U X;  4MYT A;  3US5 A;  2ZKT A;  2GW8 A;  5DM7 Q;  4KTQ A;  1GMW D;  3JQJ A;  2D7S A;  4EWT A;  4DV1 F;  1KSP A;  3HVW A;  3EZO A;  4KQZ A;  3W5Z A;  2J0W A;  3KJV A;  4ZOS A;  5M2U A;  2KXN B;  1HBU B;  5K8O A;  5KT4 A;  1NPP A;  2H5J B;  2MKH A;  1F6T A;  1S1T B;  3ZZR A;  3QGH A;  1QLN A;  3K8W A;  3GJT B;  2ZM6 F;  3GWC A;  1RWV B;  1JKH B;  2M8D B;  3CD7 A;  4DZ6 A;  2LU1 A;  3X3U A;  2R8J A;  2HQ3 A;  3MMC B;  1FEH A;  4D3H A;  2KO1 A;  2KT5 A;  3IR6 B;  3VGT A;  2K8G A;  3BGO P;  1R8H A;  2V8G A;  2Q43 A;  1D09 B;  1G3O A;  1KHV A;  3MOZ A;  5KFB A;  2C2M B;  3OVS A;  4X4N A;  3RAX A;  3CDA A;  2B8P A;  3V4I B;  2WVF A;  4LBP A;  1S1V A;  2MY8 A;  3LAK A;  2EKY A;  4PQU B;  3HHN B;  5HK4 A;  3LPE A;  4QBU A;  5J2N B;  2CUY A;  4OMF G;  2DRA A;  1OPZ A;  3N4W A;  1T9X A;  5KFM A;  1SC3 B;  1L3T A;  3FMW A;  2C42 A;  5B09 A;  1N5Y A;  2YNF A;  4C3M A;  3NGR A;  1UPP A;  5F8G A;  3R5C A;  4FYD A;  3KG4 A;  4ICL A;  1TL7 B;  2DH7 A;  2SXL A;  3D1Q A;  3HK2 A;  4NOH A;  2VFV A;  3D67 A;  3FVY A;  2DO0 A;  2MGZ A;  2QYC A;  5KG7 A;  4CH1 A;  5CYJ A;  1BQM B;  4F0K A;  3RR7 A;  3D7S B;  4PRF A;  2ZNZ A;  2KM8 C;  1U1N A;  3NS6 A;  2VFT A;  1FWK A;  3UI3 A;  3IRX A;  4P9S A;  5HSP A;  3BSA A;  2Z56 B;  2F3J A;  3D0G E;  3FSY A;  5KFJ A;  1KQS R;  3G8S A;  3UNY A;  2HZV A;  3ISZ A;  2F8M A;  1H7W A;  4USM A;  4CTA B;  3FQL A;  7FDR A;  3KK2 A;  5E2Q A;  2XY5 A;  1SB6 A;  1W2I A;  3AD7 C;  1G6B A;  2Z2Z A;  3L7U A;  4C2M A;  3UD5 A;  1FD8 A;  1Q0N A;  1HBM B;  1RUS A;  1Y3K A;  2BM0 A;  3EYZ A;  3M30 A;  3QT5 A;  1JLF B;  2KDO A;  4F4Y A;  5I42 A;  5IOL A;  3P6Y C;  4I4B A;  4NMX A;  2EFO A;  1T9Y A;  4OQJ A;  2ZWO A;  2ZE2 A;  3A1Y G;  5KG5 A;  1X0P A;  2DNY A;  2Z2Y B;  3I4P A;  2E9R X;  1VQS A;  3M8Q B;  3T9N A;  3O44 A;  3IS9 B;  3L3C A;  2YKP A;  1OY8 A;  1VQN S;  1TMJ A;  3R5J B;  1X60 A;  2R8K A;  1LOU A;  3LP0 A;  1UVI A;  2DXF A;  2P9E A;  2VBX A;  2P8I A;  5IT9 U;  2DNL A;  1UMJ A;  4O3N A;  2M8H A;  4OV1 A;  3ELH A;  4WU2 A;  3DU5 A;  2QLF B;  1TAQ A;  3HVA A;  2HSE B;  2RML A;  5B0C A;  7FD1 A;  4OYX A;  3KK1 B;  4GO7 X;  1R7I A;  3MAA A;  1SKU B;  3V5R A;  2QN6 B;  1SC4 B;  3AJD A;  3X1L B;  1SJQ A;  3CWJ A;  3M1V A;  1VQ4 S;  2RF2 A;  3DM2 A;  2BR0 A;  4DV5 J;  2ZHB A;  4P10 A;  2VA2 A;  1FK9 B;  3BDP A;  2D69 A;  3DKD A;  4C97 A;  3A8J A;  1G7C B;  1D3W A;  2HZA A;  4DR2 F;  1IBM J;  1DTQ A;  1R8A A;  2WBR A;  3MF5 A;  3FMB A;  2D9P A;  1F5C A;  2OTL S;  3C14 A;  4RNF A;  2H54 B;  2W24 A;  4DI6 A;  5DDQ C;  2JEI A;  1P1L A;  1SH3 A;  3C16 B;  1WNE A;  5KG2 A;  1OSC A;  3SCK E;  3F41 A;  4QW9 A;  1VOM A;  4LFC F;  1WG1 A;  3MXH P;  3G4S S;  3I31 A;  2B6A A;  2XNR A;  1FJG F;  1P9Q C;  1TR0 A;  4O3O A;  1HBN A;  2ASY A;  2QSF A;  3QIP A;  3CJK B;  3KYL A;  3SQG A;  3J7Y I;  1T05 A;  1ZAX A;  4OLO A;  2L48 A;  4V19 X;  1JNR B;  3SDE A;  2AHO B;  2O5D A;  3CJR A;  2OEK A;  3NBP B;  1V5I B;  1HMV B;  2QLX A;  4DV6 J;  2KXH A;  4TLR A;  1VRU A;  2B9W A;  1Y5N B;  1HWL A;  5ADZ A;  4YB6 A;  1UPM B;  3IWL A;  1WJ9 A;  1K47 A;  4HI2 A;  2EXU A;  4KR0 B;  2VFS A;  3GFX A;  4B3O A;  3CE8 A;  4DR3 F;  2BX6 A;  4MFB A;  3DOL B;  2QGF B;  4M5D B;  5F0W A;  2MQ8 A;  1GAO A;  4NLV A;  2XWX A;  3M32 B;  4KV8 B;  4JI2 J;  4USK A;  3AOB A;  1MWQ A;  5KT5 A;  3VAG A;  3MHY A;  3AQO A;  1ZPV A;  4ED5 A;  1NRK A;  4DQS A;  5A6P A;  2A18 A;  2QA4 G;  2VFU A;  4IH5 A;  3HSJ A;  3I5A A;  3R5G A;  3WC0 A;  4FXD A;  3J7Z T;  1B99 A;  1HBO A;  4HH1 A;  3PVX A;  1QSY A;  4KFB A;  4RNO A;  1UFW A;  2YWG A;  4OI4 A;  2CQP A;  5GVQ A;  4PPD A;  1W7W A;  4P2X A;  2OSQ A;  2JVO A;  1FVS A;  2QMX A;  1EAR A;  3T1Y F;  4OFZ A;  3M2V A;  1R27 B;  5IT0 A;  1XWL A;  2WVC A;  3H90 A;  4DL0 C;  1QE1 B;  5AE2 A;  3Q22 A;  4K7Q A;  4WZQ A;  3QFH A;  3OD2 A;  6FDR A;  4N5S A;  4R5P A;  3MPD A;  2EFV A;  2FHJ A;  3KLI A;  1U1Q A;  3D28 A;  1WHW A;  5GME A;  3B6B A;  1VC0 A;  3PXG a;  2FVP A;  1WEL A;  4Q0B B;  1RTJ A;  2BJE A;  5K14 B;  4NPO A;  1ZET A;  2YXL A;  3CUL A;  2C3Y A;  2XLJ A;  2XZT B;  1UEU A;  1H7X A;  1GTE A;  4FXW A;  4CLS A;  3CCT A;  1KOO A;  2OPR B;  2EBE A;  5G0R A;  3U1N A;  2VG7 B;  2J0X A;  5I3P A;  5AXM A;  1JX4 A;  3C6U A;  4CLT A;  1N34 F;  4ZJQ A;  4A8X A;  4URG A;  1F3V A;  3AY0 A;  4I56 A;  3BDE A;  4OYM A;  2Y8Y A;  1S72 S;  4BC9 A;  1JLA B;  3UN3 A;  5I3U A;  2FLL A;  4WYW A;  1A6L A;  1F5B A;  1GX6 A;  4X64 J;  1S48 A;  1RHJ B;  1V3R A;  2N7Y A;  1OMS A;  3ZC4 A;  5DG8 A;  4DUY F;  3THP A;  4J9S A;  2ZIT A;  3BF4 A;  1KNZ A;  3FK4 A;  4Q2M A;  2EG2 A;  2RJZ A;  1SJF A;  1NSA A;  2HLU A;  4KIA A;  3UVJ B;  1VI7 A;  2Y1R I;  4OV6 A;  5DRK A;  1X4H A;  1RT5 A;  2W9C B;  2GMJ A;  4KSE B;  4O3P A;  2GVZ A;  2MJN A;  3MR5 A;  2Q79 A;  3EIC A;  5HBM B;  1ITP A;  4N7T A;  1KS2 A;  5JVH Q;  3PX6 A;  2MLY A;  1LWE B;  1NDC A;  1TK5 A;  1FI4 A;  1VIO A;  4AL5 A;  2W4P A;  1M5H A;  3AJ2 A;  3MFI A;  1U02 A;  2GS8 A;  3QRQ A;  3TNV A;  3R3T A;  3RRK A;  2J8S A;  2IA0 A;  1O8B A;  2CJQ A;  1XBW A;  5GAE I;  4USH A;  4OX7 A;  4AUK A;  4C3L A;  3GMG A;  1RP5 A;  3OR2 A;  3OTE A;  1XC9 A;  2YX1 A;  2CNN B;  1S6P A;  5KT7 A;  4V19 J;  4DSI A;  4DV7 F;  3UCG A;  4G1Q B;  2N3O A;  2JC1 A;  4UTG A;  3D54 A;  4RO0 A;  2WVD A;  3DMJ A;  1QUP A;  4F2S A;  2MSS A;  3BGL A;  3LAN A;  3MM5 A;  1H98 A;  4QOT A;  3AB2 B;  5L1K A;  2XMW A;  1CJV A;  2BOA A;  1YG0 A;  2HEK A;  4OZ5 A;  2LKZ A;  3FJ2 A;  3IP0 A;  1NJX A;  3W2W B;  2GMH A;  3KLE A;  1RIS A;  3MR2 A;  5AJ3 F;  3EX7 B;  1KP6 A;  3V6J A;  2HNZ B;  3O3L A;  1F9F A;  3QZ8 A;  1RT2 B;  3Q0A A;  1CJT B;  1ARO P;  2YTC A;  5KFK A;  1M5P C;  3Q2T C;  4BDP A;  5KG3 A;  4KHP F;  1N54 B;  4RBU A;  3RGI A;  1T3N A;  4DU8 A;  3OTO F;  1S79 A;  2CQ1 A;  4M5K A;  1RHU B;  4O0I A;  4L3N A;  3OUY A;  2RQM A;  3NKY A;  1RTI A;  1T94 A;  2UUB F;  5ETL A;  4ZLP A;  3HX9 A;  2KFN A;  3DDK A;  5JXS A;  2BAN A;  2B4P A;  4F4Z A;  4FF2 A;  2CJX B;  1WWH A;  4DSL A;  2A1B A;  2RIL A;  5B7W A;  5AXK A;  2HFO A;  2NUH A;  1VCT A;  3M2R A;  1RT1 B;  1T9V A;  2R7O A;  3R2C J;  1HYS B;  2NQP A;  1AUD A;  1RGV A;  4B9L A;  3FNN A;  3JTO A;  4UZB A;  4NCG B;  1OJ4 A;  2AYG A;  1HNV A;  1IBK F;  1ZOT A;  5LSL A;  1T03 B;  3VAI A;  3Q8U A;  3F73 A;  4RW6 B;  2OPQ A;  2ZDP A;  1LW2 B;  3G8Q A;  2DY1 A;  3W2V A;  4IQX A;  2OMO A;  3CC4 S;  2EW9 A;  1B3T A;  2D1C A;  3DOK B;  4DL3 A;  1NLK L;  2UVU A;  2DHA A;  5D77 A;  1YZ7 A;  4J7C A;  2ZH5 A;  1JXE A;  3W5X A;  4NLG A;  2ALZ A;  2LFV A;  2N7C A;  1RKJ A;  3N5B A;  2FYX A;  2FZG B;  2XS5 A;  5CYM A;  1S77 D;  1U6F A;  3D6F B;  1ZAW A;  1WKL A;  5KFL A;  4ETZ A;  1TK8 A;  3GYG A;  2DNZ A;  2NZC A;  3BBB A;  2R7Q A;  3NCQ A;  5HQL A;  4PYA A;  4WPA A;  3P96 A;  5A2Q Y;  2XSJ A;  3VAH A;  3DHW C;  1NPK A;  4ID5 A;  1K73 T;  4LIW A;  3HF5 A;  2XZD B;  4Y2A A;  4IH6 A;  4RL1 A;  1N32 F;  2GQC A;  1Z2L A;  1RWP B;  3PJW A;  4H4K C;  2Y8W A;  3J7A 1;  4KBI A;  3MM8 B;  1ZM9 A;  1WC4 A;  3Q2S C;  1REG X;  2XWY A;  2OEM A;  4I0W A;  4ZA1 A;  4C8O A;  4IR9 A;  2JZ5 A;  1CG2 A;  3QLH B;  3PZP A;  3CME S;  1FDN A;  1X4C A;  4QYZ J;  4OI1 A;  4HTI A;  1ZAV A;  1T9W A;  3DLG A;  1F5A A;  1PSD A;  3T3F A;  3T6J A;  4HKQ A;  1OY6 A;  3LPY A;  4GVL A;  4DSK A;  3LF0 A;  3DRS B;  4K4Y A;  3OJU A;  2NSC A;  2BRL A;  2XS7 A;  2JFK A;  2ASL A;  3NNA A;  3T5J A;  1UVJ A;  3W61 A;  2YQ1 A;  3C3L A;  3ITH A;  2X1F A;  2P9C A;  1HI0 P;  3RW7 A;  2HFZ A;  1VQO S;  4FBT A;  3BQ0 A;  2Y0S D;  2D3O R;  4E2F B;  2PI4 A;  2EG1 A;  2IYG A;  1SJR A;  4IFV B;  4Y3C A;  2HNY B;  2ZH6 A;  1MWY A;  2KFZ A;  4FPR A;  3GYX B;  4IG0 B;  2FC8 A;  5ETT A;  1PIE A;  1NK4 A;  3AB4 B;  2B9E A;  3F0N A;  3ILI A;  2HHH F;  2HQD A;  3KFW X;  4IFY A;  1I94 J;  5F8N A;  2CZ4 A;  1IUJ A;  9ATC B;  5IV3 A;  4C0H A;  1QUV A;  4ATN A;  4KO0 B;  5EWF A;  2ZDO A;  3UFC X;  4M5N A;  4NLR A;  3TJA A;  1I51 B;  2GCF A;  5HQ8 A;  1W26 A;  2CG4 A;  4I1T A;  1Q1K A;  5MAO A;  4DPO A;  3GB0 A;  1BC6 A;  2FY8 A;  4USI A;  3RAM A;  3RG6 A;  3WDO A;  3K5P A;  3NOC A;  3R5B A;  2HVH A;  4FYV B;  2J7W A;  1SJ3 P;  3AT1 B;  3KTQ A;  3QAE A;  1E6Y B;  2J9D E;  4EZ6 A;  1GMV A;  1K8A T;  4K59 A;  3GR1 A;  2V69 A;  2RKI A;  1HHT P;  2NS1 B;  3E01 A;  1NDL A;  1HWK A;  1VLY A;  2CAD A;  2IMO A;  3IBW A;  2VQF J;  2EBG A;  3T41 A;  1XNQ F;  4WFZ A;  2G4B A;  3FCV A;  1RAF B;  3V81 A;  2HHT A;  5CYQ B;  2KT3 A;  4XDD A;  1R8P A;  1RT3 B;  3BM7 A;  4JV2 A;  1YRT A;  1T9U A;  2DNM A;  5E3C A;  5KFN A;  2IVF B;  2VG5 B;  1HWU A;  1JLQ A;  3M8P B;  1F1B B;  2XY6 A;  4B3T J;  1O6X A;  4IKA A;  1D9A A;  3DRP A;  3FCW A;  3PYD A;  4R0J A;  1LWC A;  3CD5 A;  3PV8 A;  1DLO A;  2QLW A;  3DRR B;  3R9L A;  2PFF B;  4CIO A;  3H4D A;  1AZS A;  3MMA B;  2UU9 F;  2WVE A;  2DRD A;  4DPW A;  3IFE A;  3J7Y U;  3MCM A;  1EP4 A;  3HKZ D;  3O5T B;  3OFE A;  3KDN A;  1XNR J;  1GT8 A;  3NMR A;  2ZKU A;  4RW7 B;  1QAY A;  2B4V A;  2CWX A;  4ZP8 A;  8ATC B;  1FHT A;  3V6K A;  3Q8R B;  5KFV A;  4AND A;  5HVG A;  4OHY A;  2YKM A;  4Y00 A;  2V2Z A;  5H1S V;  2G2Y A;  1YJU A;  2FLO A;  3AHP A;  2WVB A;  4C98 A;  3CDU A;  4HYK A;  3IR7 B;  1UW9 A;  2C3O A;  3SXL A;  1MLA A;  2A3J A;  1HHS A;  3CGI A;  2XGP A;  3WBZ A;  3QQC D;  4YFU A;  1HWI A;  4E98 A;  4Y2M A;  3QGI A;  1TVR A;  3TJ9 A;  4LF9 J;  3I5B A;  5LXY A;  5FJ4 A;  4J9N A;  1J5O A;  4B9U A;  4ED0 A;  4OJ3 A;  1FE4 A;  1ZTT A;  2X1B A;  4DL4 A;  3B8H A;  3LWL A;  2MMY A;  1SQF A;  3HI9 A;  4JV5 F;  3I32 A;  3R2D J;  4HL9 A;  1NZA A;  4LFA J;  1RT4 A;  2AQ4 A;  3MPW A;  3U1L A;  2VIH A;  2MB0 B;  5L38 A;  2XMT A;  4NZ6 A;  5L39 A;  1NB2 A;  4RX6 A;  1S9E A;  3OXG A;  1OYD A;  1N5Q A;  4RUC A;  4XPE A;  3U27 A;  4N77 A;  3DGP A;  1U09 A;  3BN4 A;  1H38 A;  4A8Y A;  4DV3 J;  3JSM A;  4K4T A;  3CF5 Q;  3H8Y A;  3BSN A;  2GGP B;  1RCX B;  3EGW B;  2FUG 9;  4DR5 J;  1S6U A;  1LWF A;  4IG3 A;  1JQG A;  2DNO A;  4HI1 A;  1VMB A;  4MKY A;  2AT1 B;  2Q3P A;  1YSJ A;  4RWX A;  4OLP A;  1IBC B;  4DPX A;  3FUY A;  5DLG A;  5AXN A;  3CXC R;  3JSY A;  2CNK B;  4PAA A;  1Q86 T;  1S6Q A;  1ZM2 A;  5ETV A;  5L46 A;  4K0K F;  2W2M P;  1S7I A;  5K20 B;  2BKN A;  3DXB A;  1IKY B;  4OZL A;  4RZR A;  3BRE A;  4BLG A;  4DV4 F;  2FGO A;  1S7H A;  1ZM4 A;  3SFU A;  3GR0 A;  4USV A;  1KHW A;  4AQY J;  3A3P B;  3KG1 A;  1TUV A;  2XMM A;  3KJQ B;  1Q5V A;  2ZWP A;  2IA6 A;  3CCU S;  3R5A A;  2NXU A;  4TQS A;  2GIR A;  1KC8 T;  1NJY A;  2DGX A;  1JJH A;  1FX2 A;  3PEJ A;  4H4O B;  3KJV B;  2GO9 A;  3UO0 A;  3MCN A;  4O3S A;  2VG6 A;  3TRG A;  3AD8 C;  1BWV A;  1HW9 A;  3MMJ A;  2R7V A;  2VJU A;  3PCO B;  3WHI A;  2GHP A;  5C5J A;  4RW9 A;  2MKI A;  1UKU A;  4C8M A;  1LFW A;  3SQO P;  2W9B B;  1MWZ A;  4QYZ K;  4PUO B;  4GC6 A;  1RQ0 A;  3C46 A;  3VV2 B;  1UW4 A;  4JI7 F;  4ED2 A;  4TQR A;  3VGU A;  2VV5 A;  3T6B A;  4TU8 A;  1IVZ A;  1K1Q A;  1ROF A;  1HQU B;  2BVZ A;  1C0T A;  1YJV A;  1ZTW A;  4OX9 F;  3UDL A;  2BMB A;  3I82 A;  2A6O A;  4M5G A;  4B3S J;  3EVW A;  4ZVF A;  4B3R J;  5GAE U;  5AT1 B;  3W63 A;  2YWK A;  3RTV A;  1WC3 A;  1XK8 A;  3OQ2 A;  2R42 A;  1U8W A;  3BEG B;  2MKC A;  2HND A;  1NK6 A;  2KJV A;  3KK3 A;  3ENA A;  3KLH B;  3EVM A;  2VH7 A;  3H40 A;  6FD1 A;  4M5J A;  2A2C A;  4FVM A;  3MUV P;  3T9Z A;  5C24 A;  5HP1 A;  4ED7 A;  2UXC F;  1WG4 A;  4A46 A;  1GTH A;  3RBX A;  1UVL A;  1FE0 A;  5DJB A;  4X4O A;  4CCH A;  1QTN B;  5M2P A;  1YJW S;  4ZCM A;  4LJM A;  2NXJ A;  5JVG Q;  4L76 A;  2QEX S;  2BKP A;  1EZZ B;  2KH9 A;  5C42 B;  2L41 A;  5KFX A;  1HD0 A;  4H4M B;  2CJK A;  2HHP A;  1IKX A;  2XQC A;  3TUJ C;  3KNG A;  4L74 A;  2RB7 A;  1FJ7 A;  2F4F A;  4YME A;  1U0S A;  3M30 B;  2G0I A;  3DI6 B;  1JLB A;  1LW0 A;  3FZB A;  5LL6 d;  1S1U A;  3M7V A;  2Y9H A;  4MAK A;  1WHV A;  1FKO B;  2R7T A;  2H48 B;  3HM9 A;  4ES1 A;  2DHS A;  3M8W A;  3ICL A;  2BE2 B;  2O67 A;  3RJM B;  2WW4 A;  1N36 J;  1IWG A;  1M5K C;  2HAI A;  4K5S A;  4CRJ A;  5KFO A;  2G1D A;  1VHI A;  4ZIW A;  5KG0 A;  1XR7 A;  4EZ9 A;  2M0G B;  1GXL A;  2ZD1 B;  2ATC B;  5F8J A;  3UN2 A;  2OEL A;  2UVV A;  2R2T A;  1AW0 A;  2HQG A;  4USW A;  2ALY B;  5K8M A;  4GC7 A;  1U2F A;  3TVY A;  3PY8 A;  1SL2 A;  2MJU A;  1R89 A;  1KD1 T;  3LP1 B;  1C1B B;  4MMO A;  5C25 A;  2AX0 A;  4YEA A;  3EZ5 A;  1VQ5 S;  1N33 J;  1KDN A;  5A8W B;  2AMC B;  3SZ2 A;  4DFJ A;  5G4D A;  4DR6 F;  3DLJ A;  1MU2 B;  3DXS X;  5DQI A;  3QPI A;  3CC7 S;  1R0A B;  5IZH A;  2ADC A;  3W65 A;  4I7F B;  2QA2 A;  1DTT A;  1DQ8 A;  3MD3 A;  4OHV A;  3GTY X;  3QT6 A;  1TQL A;  3EJM A;  2WTF A;  3M9N B;  2KJW A;  1F9E B;  2PO4 A;  4I2P B;  3AXK A;  2VBW A;  3M4X A;  4TY9 A;  2J0Q D;  2OD6 A;  3IG1 B;  5LMU J;  2HIQ A;  1KFD A;  4OZ0 A;  1X8D A;  1U6Z A;  5LT5 A;  4EO8 A;  2G0C A;  2V67 A;  2CQC A;  3ZTS A;  1VRT A;  3ZNU A;  1APS A;  2GVD B;  3JTP A;  2QYG A;  2E44 A;  1C2P A;  3CPW R;  4Q8E A;  2VOD A;  2M4M A;  3EDR B;  2ZNY A;  4DMZ A;  5H9E K;  2XEX A;  3OXL A;  3K5N A;  2E5L F;  4NEZ A;  3HZE A;  2MZR A;  1XMO J;  2YKA A;  3SDE B;  4P2F A;  5J2P B;  2AU0 A;  1VC5 A;  3TAM A;  1NKB A;  2YKN A;  4DV5 F;  4ZLJ A;  2JLG A;  1VRU B;  1HD1 A;  4DR7 F;  3BSC A;  3OSP A;  2F40 A;  2X1A A;  3BGU A;  1WEY A;  1IKW B;  1UEV A;  2Z8Q A;  2I0X A;  4ZKA A;  4P6Q A;  2HHQ A;  3VZH A;  2POK A;  3FEX B;  3NGD A;  1IBM F;  4DL2 A;  2OO4 A;  2HBY B;  3MED B;  3ZZP A;  3GIL A;  2AX1 A;  2YPZ A;  2ZH4 A;  3QAU A;  5T41 A;  4I2Q B;  1PG5 B;  4LR7 A;  4ZVS B;  2KG0 A;  3D1H A;  1B70 B;  2UXD J;  1SXL A;  3MEG A;  3VWS A;  3H98 A;  1YI2 S;  1U1P A;  2ROP A;  4JV0 A;  4ECW A;  3SEO A;  4JBC A;  1S1W A;  4AD6 A;  3W9H A;  1XQI A;  2XNQ A;  3GIR A;  4UOF A;  4R8U A;  4DPU A;  1NK7 A;  2PSZ A;  1TKD A;  3DFE A;  3TQE A;  4RU2 A;  3ZZU A;  4F02 A;  2YNG B;  2F8H A;  5T7L B;  4BCA A;  2CPX A;  4U67 Q;  3OR1 A;  2VOO A;  5LXR A;  3TX0 A;  4A8M P;  1O51 A;  4WCE Q;  4W92 B;  1PAE X;  1ELO A;  1OSD A;  2NCK L;  5JMN A;  2MQN A;  4KRW A;  1NSK L;  3QYY A;  2IC3 A;  5CAA A;  1P1T A;  1REV B;  4WP8 A;  4KB7 A;  2JWN A;  1LFP A;  3ETM A;  3PHT A;  2DD8 S;  3G8T A;  2D74 B;  3DOM A;  2FHJ D;  1BMQ B;  4N56 A;  1CPZ A;  4F3M A;  2IVY A;  2BAB A;  1GK8 A;  3PTW A;  3HXM A;  3KJN B;  1S9F A;  5L9N A;  2V6A A;  2FLN A;  5ETO A;  1WOP A;  4OX6 A;  2A6M A;  1V5V A;  2MLZ A;  1FKA F;  2EC2 A;  3HSD A;  1RAI B;  2HMI B;  4JI3 J;  1SC1 B;  2CAJ A;  3KJF B;  3QT8 A;  2C2O B;  2PMH A;  2EVZ A;  1NO8 A;  4JI4 J;  3OHB A;  4LSN A;  1Q81 T;  3PAC A;  2NRE A;  1S4F A;  4YR0 A;  5E41 A;  1VFJ A;  3KLG A;  2HQC A;  4PWD A;  1V3S A;  5F8M A;  1TFY A;  5DGA A;  2BM1 A;  4K4W A;  4DF4 A;  4TY8 A;  1SKW A;  3BZQ A;  3ISN C;  3UDV A;  4ZVH A;  1RKI A;  4G3I A;  3VF0 B;  1SL1 A;  4KKO B;  4QZV B;  4NA1 A;  2CFX A;  1FJC A;  3BGF A;  2R3V A;  4M63 A;  3EGZ A;  2V2K A;  1TL1 A;  3RBE A;  1IKV B;  4A48 A;  3H20 A;  2VPZ B;  1RAD B;  1VQY A;  1QM9 A;  5E5N A;  1J2V A;  3LO3 A;  1KVI A;  5GAH I;  1TKT A;  3J80 Y;  4DX6 A;  1NKE A;  1KQG B;  2PGC A;  3ENQ A;  4ZVQ B;  2PD1 A;  3HT3 A;  4J9P A;  3IBF B;  3PR5 B;  2IM2 A;  3CCS S;  1B4S A;  1I3O B;  5EUH A;  4U9R A;  5LJ5 Y;  3TA1 A;  2OAU A;  4C11 B;  2MZQ A;  4DF8 A;  2A10 A;  3GFY A;  2DIS A;  3IWN C;  4UQT A;  2B3T B;  4DR1 J;  2HWI A;  3NL0 A;  1K44 A;  4QPX A;  2AYB A;  5LMN J;  4C4W A;  3PNI A;  2V9W A;  3RW6 A;  3OVA A;  3ENV A;  3UD4 P;  2YNH B;  3T1A A;  2UVR A;  5LSR A;  4ANC A;  3MPY A;  1NAQ A;  2CQB A;  1RWN B;  3FRY A;  4EEY A;  2QO3 A;  4FBU A;  4DL5 A;  3JAM Y;  5HJY A;  4NI2 B;  4NZ7 A;  3G87 A;  1RE1 B;  3CJ0 A;  1AFI A;  2ZZT A;  1RT6 A;  2AD9 A;  1SJ1 A;  1KR4 A;  1MRO B;  5DM6 Q;  3EGV A;  1YJN S;  4FKY A;  2FVQ A;  2MQL A;  3FRZ A;  1RTD B;  4KPC A;  2DTJ A;  1UVM A;  1Q7Y T;  2IY5 B;  1AT1 B;  1R8C A;  2HK2 A;  2CKW A;  2NSB A;  3W8G A;  1N6Q A;  1S5Z A;  5IQQ A;  4XK8 C;  3VVT A;  3CCJ S;  2LXU A;  4ED3 A;  4YY3 J;  3OSN A;  5KFE A;  3W8P A;  3ZFV A;  4QIE A;  4ELT A;  3PYG A;  1VQ7 S;  2FD2 A;  5ETN A;  2V5H G;  3FCH A;  1CQN A;  2HHU A;  2LEA A;  2R4F A;  3NAH A;  1FER A;  1FRH A;  1LWX A;  3W62 A;  4FF3 A;  4F4X A;  3FGV A;  3BQ2 A;  2BQR A;  4RW4 A;  4ECR A;  2CG8 A;  3PKM A;  4KGV B;  3GV8 B;  3DLL Q;  2FZK B;  2XMU A;  2CA9 A;  2CWK A;  3C8Y A;  5K8N A;  2F65 A;  1BXN A;  2MZS A;  5F0U A;  1RTH B;  1RK8 A;  2PII A;  2IRY A;  4KC5 A;  3W1Y C;  2C2K B;  1YZ6 A;  4P75 A;  4DUT A;  3VR1 A;  2RAQ A;  1SL0 A;  3RB6 A;  1L5U A;  3OV7 A;  3MPV A;  1XR6 A;  4Z2X A;  2HHX A;  1RBL A;  3HLU A;  4MJK A;  2HLT A;  2C2D A;  1S0O A;  1E6V B;  2J5A A;  1UJ5 A;  3NGU A;  1FJE B;  3VGS A;  2B7C B;  4PXC A;  5E3R A;  4KJI A;  3VQS A;  1EAY C;  5J2M A;  1UTA A;  2C22 A;  2GC8 A;  1Y0H A;  1BHN A;  3AOA A;  4NZ0 A;  2DHG A;  4S0M A;  4XTT A;  4CNZ A;  2LEP A;  2QV6 A;  2W25 A;  2CVI A;  5L8R C;  1U7L A;  3B4D A;  1FEE A;  2CJY B;  2RRA A;  3GSD A;  5CYM B;  1RAG B;  2CQG A;  1EX8 A;  1S59 A;  2V4J A;  3U1M A;  3MOJ B;  3H25 A;  2QIF A;  1YHQ S;  2DH9 A;  1HQ2 A;  1SV5 B;  4QWA A;  2UUT A;  4B02 A;  2MEW A;  2G0J A;  1BLU A;  1TAU A;  4WZM A;  3ZZO A;  1WDD A;  2CNO B;  2V4R A;  4C8N A;  5BYR A;  1X4B A;  3NCR A;  2Y1I A;  2K7K A;  3FDS A;  1KLN A;  5LSO A;  4L73 A;  2IHR 1;  1VIS A;  3HVR A;  1WF0 A;  4FP9 A;  3T1H F;  2XO7 A;  1HBU A;  2ZOM A;  4DV2 J;  4WYL A;  1Y4Z B;  1S1T A;  2ROE A;  3DU6 A;  2AJF E;  1KFS A;  2GA7 A;  3J81 j;  5MLC V;  1HNI B;  4WXO A;  1IJF B;  2J7K A;  3TP2 A;  1OO0 B;  3UN5 A;  1JKH A;  4LRB A;  3ISN D;  5F41 A;  1YIJ S;  1KN6 A;  3L9Z A;  2QL7 B;  1YJR A;  3U02 A;  1HQE B;  2DEJ A;  2VD3 A;  2RQ4 A;  4WTO B;  4B9V A;  2IYI A;  1UA0 A;  3MMC A;  2OFG X;  5LM7 E;  5E3A A;  4IO9 Q;  2W7O A;  3C15 B;  4GVB B;  1CC8 A;  4I6Y A;  4PXE A;  2WCX A;  4OX8 A;  2HYI B;  1WHY A;  5B0B A;  5H9F J;  2CQ4 A;  3V4I A;  2W7A A;  3S1T A;  2MDA A;  1OS5 A;  1A7G E;  2FC9 A;  2V9K A;  5J2N A;  3LP2 B;  1VK3 A;  4MKB A;  4LF5 J;  3QT7 A;  2LEB A;  1WSR A;  4K8R A;  2M52 A;  4CLU A;  1F2G A;  2VBY A;  3MTJ A;  4ECX A;  3PFE A;  2R9L A;  1RAB B;  2R8G A;  3KLF B;  2QSW A;  2V2V A;  3QFW A;  1TL7 A;  4N76 A;  4NEY A;  2OJ3 A;  2QMU B;  2UXB J;  1U4B A;  4PKD B;  2NYI A;  2W01 A;  2VQE J;  4K5R A;  4Q8F A;  2R2U A;  4OZN A;  2CQD A;  3OXF A;  1QSS A;  4FYX B;  4PR6 A;  2JVR A;  5A8R B;  3OL7 A;  2WON B;  4DL7 A;  1CVJ A;  4B17 A;  1BQM A;  4YN3 B;  3VVU A;  3TR5 A;  1UEK A;  3HHK A;  2MTL A;  4OZ3 A;  4CLP A;  3PR4 A;  4WKY A;  2C28 A;  4U7U D;  2KVQ E;  3LW5 C;  1X4F A;  2XGQ A;  2IJN A;  1N5S A;  4ES3 A;  8RUC A;  4CTA A;  3P5B P;  5DS7 A;  2WSF C;  3MEC B;  2BZ2 A;  2ZH7 A;  2BE7 D;  2LQB A;  3M9M B;  4WP9 A;  3A8E A;  3GON A;  2VKZ G;  1HBM A;  2CQI A;  4UUX A;  1RWM B;  3RRH A;  3ZZ0 A;  2C2N A;  2E5H A;  2QTW A;  2VHG A;  1JLF A;  3I9V 9;  1VBZ A;  1H0H B;  2RUS A;  4ZVO B;  4ZJL A;  3M8Q A;  3TVZ A;  3IS9 A;  3E8O A;  2HQF A;  5KG1 A;  2ZHA A;  3PYF A;  4F26 A;  3L7O A;  3QNW B;  3D4J A;  4C0O C;  3QAT A;  3DN9 A;  4LF4 J;  3J81 Y;  4TKT A;  2EK1 A;  2HW3 A;  3N79 A;  1U49 A;  4GMK A;  4UT4 A;  3TZZ A;  1ZBT A;  4HHH A;  1VQ6 S;  1VK8 A;  3KK1 A;  4X62 J;  4DQI A;  2LYV A;  5LOQ A;  4PZV A;  4J90 A;  4JI1 J;  1WC5 A;  3LWM A;  2IM1 A;  3ZNJ 1;  3NGT A;  4J9K A;  3ZTR A;  1DJ0 A;  4URQ U;  2WZ1 A;  4QPT A;  2VQF F;  3H5X A;  4QWD A;  5E3P A;  1RU1 A;  2FVS A;  2XZW A;  3M8Y A;  4HEA 9;  2BA9 A;  2L9N A;  2VB6 A;  1FK9 A;  3K2Y A;  1K9M T;  2IRU A;  2YKO A;  4ELU A;  4DWI A;  1TVR B;  3CJ5 A;  3MMB B;  4CYU B;  1Q8L A;  2UVW A;  4OIX A;  2FHK A;  2YQ0 A;  2H65 B;  2HHW A;  3EGN A;  2DNK A;  4B3T F;  4G65 A;  4AXJ A;  4DX8 H;  3G6E S;  2ZH3 A;  1S0M A;  2W2O P;  4MYU A;  2AIR B;  3SSR A;  1O0P A;  4KGX B;  5IWA F;  3R6L B;  3VCD A;  4L72 B;  3C16 A;  2H4W B;  5GAD I;  1U48 A;  3P45 B;  3CCR S;  2P6T A;  1XNR F;  3SI8 A;  4W98 A;  4RLE A;  2R7W A;  1FDA A;  3CJK A;  3UE2 A;  3IM8 A;  3LOU A;  2KB2 A;  2K7J A;  1HPZ B;  3MM6 B;  3BKT A;  2B9Y A;  3UNG C;  4WBF A;  4ZPV R;  4DL6 A;  1S49 A;  4IOA Q;  1B0P A;  2NZ4 A;  4F67 A;  3H59 A;  3PIP Q;  3NBP A;  4JI5 F;  1HMV A;  3HFZ B;  2X7I A;  4CH0 S;  4F50 A;  4CDI A;  3TA2 A;  2P2C B;  2DR6 A;  1M1G A;  4OYO A;  4O44 B;  4OYI A;  5KG4 A;  1JIH A;  1NSQ A;  1DUR A;  4HDH A;  2RS2 A;  4WE1 B;  2W2P P;  1PAU B;  3DOL A;  3W7B A;  2OPS B;  4M5D A;  3OT9 A;  5HI7 A;  5EWE A;  2YWW A;  3K8V A;  2KYZ A;  1AA1 B;  3M32 A;  4DOZ A;  4KV8 A;  5F3T A;  2VBZ A;  4ECZ A;  4ECT A;  2E1M C;  2CPY A;  4YOE A;  3GG1 A;  4LFA F;  4AYB D;  3TZX A;  3AXM A;  3ZZY A;  1X9W A;  1Z1Z A;  4ZPD A;  4RW8 B;  1P6T A;  1KTQ A;  3AD9 C;  5BJR A;  4OI2 A;  1WF2 A;  2JEF A;  1D9D A;  3DDI A;  1SBR A;  1W25 A;  1NEE A;  1RSC A;  2GHW A;  4UOC A;  2DY9 A;  4DV3 F;  1TL3 B;  3CCL S;  2OKQ A;  4ZCK A;  3C2P A;  2FJB B;  1M5S A;  2GJ2 A;  1DBD A;  4C9D A;  3PW4 A;  1GH8 A;  2WRM A;  4DR5 F;  3KUE A;  4ZP7 A;  1N0V C;  1Q4R A;  5CQG A;  1QE1 A;  3NS5 A;  3CMA S;  3HHL C;  2KHC A;  5GAH U;  4TYA A;  2QFJ A;  1CS4 B;  4Q0B A;  2XMJ A;  2WOM B;  3G82 B;  5K14 A;  2LXF A;  1D8Z A;  5HRO B;  3EWG A;  5EDW A;  1GNK A;  2RH3 A;  3RYL A;  3DNC A;  2W9A A;  1Q8I A;  5DET A;  1ZYQ A;  2MKY A;  3TWZ A;  1AXQ A;  3T19 A;  3JS9 A;  3PW5 A;  4ZLN A;  4ZPC A;  4AQY F;  4EMD A;  2OPR A;  3QZ7 A;  4AL6 A;  1EKR A;  2DKO B;  5H9F K;  2VG7 A;  3MCS A;  1JLC A;  1NPR A;  4UQG A;  1HKA A;  4QR1 A;  3IAS 9;  1RHR B;  5D4N A;  4XPC A;  3V6D B;  1C1C B;  3A4T A;  2OPP B;  3CCM S;  3FC9 A;  3M2U B;  2XUL A;  2O3D A;  1JLA A;  3TOQ A;  3RBZ A;  4J91 A;  2AGP A;  1J5E J;  2DEI A;  2AWZ A;  5K8P A;  1MNE A;  3D66 A;  2F1F A;  2RS8 A;  4NXM J;  4KH0 B;  1Y9O A;  3DRY A;  1TMM A;  3UVJ A;  4C48 A;  3UR3 C;  1TKZ B;  1Y3J A;  1IM4 A;  4LR9 A;  3M8R A;  3NY0 A;  4USU A;  2ZC4 A;  2W4D A;  2W9C A;  3G71 S;  3CO0 P;  2E1C A;  3K7R A;  4P7V A;  2ABY A;  3W66 A;  5HBM A;  2XTJ P;  1CJU B;  2PFD A;  1SC6 A;  4DCJ B;  5AJ3 J;  1LWE A;  4FS2 A;  2ZJR Q;  4DG1 B;  1FDB A;  1N48 A;  4B3S F;  4DV0 J;  4B3R F;  3OFH A;  2QZ8 A;  1U2R A;  2K1R B;  5KFU A;  3IC1 A;  2V68 A;  1S76 D;  1YBA A;  4ZVU B;  4O4G B;  2CXE A;  1VGY A;  4M95 A;  3N6M A;  5J1E B;  2JH3 A;  2H1Y A;  1PYS B;  1YWX A;  5KFT A;  2HWT A;  3NAI A;  2BKO A;  4LRE A;  1OY9 A;  2KVI A;  4R25 A;  1R3N A;  4MIW A;  2CNL B;  4RU9 A;  1U8S A;  3TEH B;  1YRU A;  4ZN1 A;  4NLW A;  3B54 A;  3KLV A;  1DFD A;  4ZS6 A;  4CM0 A;  1Y5L B;  2R7U A;  4CLW A;  5HAO A;  4G1Q A;  1WC0 A;  3SSS A;  3M6W A;  3ZTQ A;  3G2X A;  3OTD A;  3MM9 B;  3HUL A;  1T0T V;  4B9N A;  4ZHR B;  1C0U B;  2ZOF A;  4J9Q A;  2CVE A;  2DPI A;  1S4E A;  4PG4 A;  2QL5 B;  4F0H A;  5F8I A;  3W2W A;  4CQ1 A;  4ECV A;  3POT B;  4CO3 A;  2HNZ A;  2Z57 B;  2HS0 A;  1TEL A;  4IQM A;  1RT2 A;  3ILL A;  2R8I A;  4NRT A;  4WF9 Q;  1N5V A;  1VRQ C;  3A3N B;  1CJT A;  1SI9 A;  3CCZ A;  5EX0 A;  1SCJ B;  4F3O A;  2I5J B;  4F4W A;  2CPF A;  1KLM B;  2BJ7 A;  2ZUG A;  5EHH A;  3R7N B;  1DTT B;  4IDK B;  4ZP6 A;  4N8O A;  4KYZ A;  1PYT A;  2RHQ B;  3BO3 A;  4X65 J;  4IRK A;  4OHW A;  3TQ1 A;  2V50 A;  3N5F A;  1N36 F;  3AA9 A;  1HNW J;  1JLE B;  4NLU A;  1H3D A;  1PKU A;  5D3G B;  4K4Z A;  2WB1 D;  1HA1 A;  4DX5 A;  3R1H A;  3TAP A;  3ONQ A;  1NZ8 A;  1CUL B;  5L9X A;  4X2B A;  3BB5 A;  4LF6 J;  1HYS A;  3OFF A;  1M5V C;  4F25 A;  2ZOG A;  3UDC A;  2VKR A;  5HLF B;  4NCG A;  1A9N B;  2E7W A;  1DAX A;  2C2Z B;  1ZA2 B;  1T03 A;  5D4L A;  3P8B B;  3PRD A;  4RW6 A;  1UFL A;  1LW2 A;  2QT7 A;  1ZM3 A;  3DHX A;  4WP3 A;  1SKR A;  2O01 C;  1H73 A;  3VGV A;  5D0G A;  1KQK A;  3D3C J;  2MQP A;  5DDP C;  2YKN B;  4RNN A;  1BGX T;  3RR8 A;  1HLW A;  2AJ4 A;  5D0E A;  4HHJ A;  3D0I E;  3DOK A;  3K17 A;  2KM8 B;  3DLK B;  4FVC A;  2J76 E;  3JXO A;  3LA0 A;  2RQK A;  2ZC3 A;  4JI8 J;  3HHL D;  3M8Z A;  2V8P A;  3HHL B;  4P7T A;  2K06 A;  3BN7 A;  3I9Z A;  4MK9 A;  3MI7 X;  5ITH A;  3PW7 A;  2F5G A;  4IOB A;  4EGL A;  3MAH A;  1S1X B;  2WAQ D;  3GFH A;  1MG7 A;  4Y28 C;  5LMU F;  2OI2 A;  1RI7 A;  1XMB A;  2V8H A;  2ZJQ Q;  2Z58 B;  2MYF A;  1KON A;  4PAB A;  1LXJ A;  5D0R A;  4ZPT R;  2MY7 A;  1XR5 A;  1FX4 A;  4YR2 A;  1VBY A;  4NLQ A;  2KZM A;  2IAJ B;  2HFV A;  2MKK A;  3G6V A;  5HMY A;  1YKW A;  3WX8 A;  2DR9 A;  1RT7 B;  4Y0F A;  2QA1 A;  2N4D A;  2JC0 A;  1R6V A;  3MM8 A;  3N6L A;  4QQB A;  3NGS A;  2DR7 A;  2NUU G;  2F9D A;  2U1A A;  1YX2 A;  1NDK A;  1XMO F;  4I6A A;  5GMK a;  3P3D A;  4KT0 C;  2UUC J;  3QLH A;  3BJY A;  3BGR B;  4KGM A;  4F36 A;  4PCQ A;  2IC3 B;  1VS3 A;  3QSI A;  3KNA A;  1URN A;  5A8K B;  3TI0 A;  3L09 A;  2BJ3 A;  3DCA A;  1JXV A;  5BXI A;  2CJ9 A;  1TUW A;  2BXJ A;  3DRS A;  1KRP A;  3PO4 A;  5KFI A;  4ZCI A;  3H4B A;  4HHU A;  5KFG A;  3FEZ A;  3WQP A;  5KFH A;  4W90 B;  3TAR A;  3DLE B;  4DUZ J;  4DDF A;  2UXD F;  2XBP A;  4IFV A;  3D5M A;  3BR9 A;  2HNY A;  2YPY A;  1XNQ J;  2PEB A;  3KMS A;  2D3O 1;  4IG0 A;  1FRL A;  3AOC A;  2K3K A;  1R43 A;  5AE1 A;  3PX4 A;  3KHL A;  3C66 A;  2I1R A;  1VQ9 S;  4JUZ A;  1R0B G;  4XDC A;  4LSN B;  2C3U A;  3Q8V A;  4WFY A;  4JI6 J;  1WF1 A;  1UFK A;  3MM7 B;  4TN2 A;  2HQI A;  4KO0 A;  2EK6 A;  2LXI A;  3JYT B;  1NHK L;  2DNQ A;  4ITS A;  2OML A;  3BKF A;  3MWB A;  3B4M A;  4RNH A;  8AT1 B;  3LAM A;  4F2R A;  3G86 A;  1N5T A;  1WOR A;  5F9L A;  2LP4 A;  1XN9 A;  5J2Q B;  2QC3 A;  5LJ3 Y;  1E6Y A;  3LTO A;  4DPT A;  1I1G A;  2GJI A;  2PI5 A;  2VOP A;  3ZO7 A;  3NNC A;  2RU9 A;  4R0E A;  5CA5 A;  4WFB Q;  2E66 A;  4K4S A;  5KFD A;  3HJV A;  4USJ C;  3MUR P;  1XER A;  3Q8S B;  1Y7P A;  5CYQ A;  2B51 A;  1RT3 A;  2DXD A;  3FFI B;  4JI3 F;  4JI4 F;  5CH7 B;  1FKP B;  2VG5 A;  1EIY B;  3M8P A;  1M90 T;  2E5G A;  2ZZN A;  1S97 A;  4CLF A;  4N41 A;  3PHE A;  1FXD A;  4X4V A;  2N82 B;  4Y2I A;  2DGT A;  4RWW A;  1HHQ A;  2M70 A;  1R31 A;  3DRR A;  3OFG A;  1T95 A;  3DGV A;  1LEO A;  1FDD A;  4RUB A;  1RAE B;  3SIP B;  1UVK A;  3HSG A;  3MMA A;  1WDT A;  2XHW A;  4GRS A;  4X4U A;  5A2Q U;  2AZ1 A;  2FPH X;  3EPI A;  1C4C A;  1R0C B;  3PFO A;  3C6T B;  1HNX J;  4RW7 A;  3QGG A;  2DHX A;  1MML A;  2BJ1 A;  2VON A;  4TNO A;  1UWB B;  1T8E A;  4P52 A;  2XMA A;  5AXL A;  4K4V A;  4Q45 A;  3T5H A;  2VL1 A;  3OLB A;  3MR6 A;  7AT1 B;  1TL4 A;  3N9U C;  2MQO A;  5ETM A;  1SJ4 P;  3R8Y A;  1RAA B;  4ZN3 A;  4LF7 F;  4EYI B;  5CCM A;  4HT7 A;  1LKZ A;  2CPI A;  4P73 A;  1LNQ A;  3IR5 B;  2P6S A;  5FLX Y;  2QFI A;  3F44 A;  2DR5 A;  4DR1 F;  4DN0 A;  1Z4U A;  1RWX B;  5LMN F;  2C2E A;  4AFF A;  2F9J A;  5CZV A;  4X4T A;  2ZBI A;  1LK7 A;  1ULR A;  3OPK A;  2EPI A;  4U95 A;  4K0K J;  5ETP A;  3I96 A;  4J9R A;  1GEH A;  2KTQ A;  2IJR A;  2CIM A;  2J8A A;  2KG1 A;  1CEZ A;  5U47 A;  2UUA J;  1SUQ B;  2R7R A;  1ZS6 A;  4RUH A;  3Q86 A;  4DXL A;  3M6V A;  2N3L A;  3OW2 R;  2BAC A;  4F4A A;  1WI8 A;  3TZW A;  2FTR A;  5A0Y B;  4H4K A;  1AFJ A;  4LMZ A;  2W2N P;  3KDO A;  4XIU A;  2EFN A;  4P71 A;  2GGP A;  2HGM A;  1CC7 A;  2DIT A;  2E5I A;  4YB1 P;  4WFN Q;  4PPZ A;  3IRW P;  1RAC B;  4OZ1 A;  2VU5 A;  2DGU A;  5IM0 B;  2DNR A;  2YX7 A;  5CHC B;  4M5L A;  4YY3 F;  2HVE A;  4OZ2 A;  3AFG A;  2LDY A;  3KG0 A;  4ZVR B;  3R1L A;  3IBC B;  1NJZ A;  1G4C A;  2Q66 A;  5CAB A;  1RAH B;  1NND A;  1CJK B;  4NLD A;  3PYE A;  2YNI B;  3QO9 B;  3HMJ G;  2CZV C;  1IKY A;  5KFQ A;  3I0S B;  2DB1 A;  4AT1 B;  3NEK A;  4FN5 A;  4HT5 A;  1SQG A;  1T11 A;  3G6X A;  2B5J B;  2RRN A;  2DGO A;  2CZ9 A;  2H51 B;  1RBO B;  2FQQ B;  1WD6 A;  1VBX A;  4ENO A;  3MEE B;  2CQH A;  1U24 A;  1RJJ A;  2X51 A;  4FXV A;  4H4O A;  3Q8Y A;  1BY9 A;  2NXC A;  1UVN A;  3O6Q A;  2D3Z A;  1T7P A;  1TKX B;  5JUM A;  3WX4 A;  1R6Y A;  3QWP A;  4EYH B;  2UXC J;  2ZVS A;  1RTZ A;  2W9B A;  1RHQ B;  3O1L A;  4BWM A;  4PUO A;  2XCA A;  4EK2 A;  2I38 A;  2AYM A;  1T02 A;  3IWX A;  3V6H A;  3SCJ E;  1YJ9 S;  4P2S A;  1IWA A;  4MIB A;  2D3U A;  2JNJ A;  2ASD A;  4CLK A;  3ET6 A;  5DDR C;  2VIC A;  3ZXW A;  1HQU A;  2M88 A;  1QDU B;  1J27 A;  4QIV A;  5C7P A;  3MAQ A;  3TYT A;  1DZ5 A;  3BH7 B;  3TA0 A;  3ADA C;  2RDI A;  1EET B;  3H2L A;  2WK4 A;  1TU0 B;  4MTP A;  3I5C A;  2K3I A;  2JEJ A;  2MZJ A;  1ACM B;  4ZVT B;  3GJR B;  2LQJ A;  4NE9 C;  3KLH A;  1W2B R;  5HL7 Q;  4YQW A;  2XSF A;  5HMW A;  5DG9 A;  4DV2 F;  2XC9 A;  1TV6 B;  5IFM A;  3JB9 k;  4M94 A;  5L1J A;  1FFS B;  4FNH A;  2W1B A;  1Q5Y A;  5IQ6 A;  2XHC A;  4J9M A;  1X9M A;  1H2T Z;  3V4M A;  3K58 A;  4ZLL A;  1Q7L B;  2GX8 A;  4FYW B;  1DRZ A;  1NCL A;  1DQ9 A;  5HJX A;  3M9O B;  5C42 A;  1Y5I B;  4M5M A;  1U1R A;  2J6S A;  4PYD A;  3Q89 A;  1X5S A;  4ELV A;  4H4M A;  2MZ1 A;  3HVT B;  4NXN J;  1BQN B;  2YWF A;  3D2W A;  4ETX A;  1IR0 A;  1X9S A;  3M6X A;  4LF5 F;  2F4V J;  4PG6 A;  4DR6 J;  1OIA A;  3DI6 A;  4L75 A;  1WEZ A;  5DQH A;  2BUN A;  2NR0 A;  4Q43 A;  1X5O A;  4KHR A;  3DLH A;  1FKO A;  4B3M J;  2R7X A;  2HS3 A;  1U0H B;  1PGZ A;  2NYH A;  4X4P A;  2BE2 A;  1R8B A;  1FTC A;  1WSV A;  2XG8 A;  2UXB F;  3Q24 A;  5D6G A;  4NYZ A;  2VQE F;  3EXY A;  4U8Y A;  1HFE L;  2FZC B;  2B0G A;  5H9E J;  2Q6B A;  3I0R B;  3D9B A;  9RUB A;  2ZD1 A;  1L3U A;  4F3Q A;  4BC7 A;  2RRB A;  2XLI A;  4DPY A;  5KOX A;  1TZ0 A;  2CJB A;  2EI5 A;  3W5Y A;  1S57 A;  3PM9 A;  2JL9 A;  1YIT S;  5KOW A;  2VDH A;  1MMD A;  3LP1 A;  1C1B A;  1VQ8 S;  1N4L A;  2E5L J;  3NLC A;  4ZVP B;  3PX0 A;  4LVN P;  2J9E A;  2J0S D;  5A8W A;  3JQK A;  2J6U A;  4DZD A;  3B82 A;  2MQQ A;  1RLC L;  4CO4 A;  3DYA B;  3CJ4 A;  4A8Q A;  4F8R A;  3CC2 S;  3KHR A;  2NXN A;  1SPB P;  4NL5 A;  2JDJ A;  1MU2 A;  4ED6 A;  1R0A A;  4DR7 J;  4LRC A;  2ZBR A;  3SCL E;  4I7F A;  1VDH A;  1N88 A;  3JSB A;  5B08 A;  4DX7 A;  2PE8 A;  5E33 A;  4I2P A;  1JLG B;  4HAC B;  4ED8 A;  2RD5 C;  4FNI A;  5IT9 Y;  3G9C A;  2DVI A;  3HFV A;  1N52 B;  4DSJ A;  1MMN A;  4GKK J;  3IG1 A;  4MH8 A;  2PMW A;  4LF4 F;  2IJF A;  2PA8 D;  4P74 A;  4OHX A;  4RBT A;  2GVD A;  3H42 A;  2V4Q A;  4U96 A;  3LGN A;  2BJD A;  2KN4 A;  4MKA A;  4NLY A;  4UW2 A;  2Y1J A;  4J9V A;  4X62 F;  4A47 A;  3VAK A;  1H74 A;  2G13 A;  3TX8 A;  1NK0 A;  2Q1L A;  3AOD A;  3BSO A;  4JI1 F;  4CT8 A;  3GFZ A;  3CT9 A;  4RJV A;  5J2P A;  1U2C A;  2D41 A;  1IR1 A;  3FQK A;  4JP8 A;  3NMA A;  1AYE A;  3K0J A;  1L3V A;  3NCP A;  1KTV A;  1ZA1 B;  2HFN A;  2HRU A;  1IKW A; 
#chains in the Genus database with same CATH homology
 1FFS B;  1A0O B;  2LP4 A;  1FFG B;  1FWP A;  1EAY C;  1FFW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...