1EAYC

Chey-binding (p2) domain of chea in complex with chey from escherichia coli
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
67
structure length
67
Chain Sequence
b'PRRIILSRLKAGEVDLLEEELGHLTTLTDVVKGADSLSAILPGDIAEDDITAVLCFVIEADQITFET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CHEY
publication title Two binding modes reveal flexibility in kinase/response regulator interactions in the bacterial chemotaxis pathway.
pubmed doi rcsb
molecule tags Signal transduction complex
total genus 15
structure length 67
sequence length 67
chains with identical sequence D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 1998-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09078 CheY-binding CheY binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits CheY-binding domain of CheA 1eayC00
1EAYC 1FFWB 1A0OB 1FWPA 1FFSB 2LP4A 1FFGB
chains in the Genus database with same CATH superfamily
4HL9A 3GTYX 1VQ8S 2DD8S 1Y5IB 1TQLA 1VRTB 9RUBA 3MFHA 3FRYA 3M6WA 1IWAA 2CPXA 1R3NA 2VD3A 5CYJA 5J2PB 4Y2IA 2YQ1A 3MD1A 3KDNA 4WU2A 3VGSA 1QY7A 1FHTA 1S7IA 1XNQJ 2MHNA 3AJDA 2EK6A 4J91A 1U1LA 1CJVA 5D4OA 2W8LA 2XMUA 1SI9A 2GO9A 3PX6A 4CH7A 1IBLJ 2VKRA 2MQQA 2AJQA 5DZ6A 1R89A 3K0JA 5J2QA 2NQPA 5C24A 1T02A 1JLEB 1YJ9S 4ZVQB 1F2GA 3K57A 5GVQA 1RACB 4USKA 1M90T 2L3MA 2QLFB 3I4HX 3BGUA 3V6KA 3J7A1 4X4VA 4HACB 4YP3A 2IDLA 2KG0A 2DT9A 3M8QA 3DLGB 1VQKS 1TVRA 1R27B 1W2IA 2PD1A 1VQSA 5E41A 2HGMA 4ZS6A 2DGVA 4R0JA 3CC4S 3NY0A 2F1FA 4DV6F 2HNDA 4I1TA 1S6OA 5HMYA 3H5SA 3N5FA 4DQSA 1P1TA 4ZPWR 1FD8A 3DMJA 3D7SB 2IY5B 2ZHOA 1LWEA 5GADU 2BJDA 1QJHA 1D9FA 4B08A 4OJHA 4UOCA 1IQTA 4CLUA 2KRRA 4ED3A 2P6SA 1S0NA 4BWMA 2WONA 3FEZA 3OL7A 2FVRA 3UQSA 2XLJA 2V2ZA 2W9CA 1N56A 3DOLB 2G2YA 4NEZA 4PWUA 2E7WA 5ETLA 1RT7A 2LU1A 5IXUA 3VV2B 2BABA 2YX7A 3M8SA 4K5RA 2KJWA 3A13A 3C16A 2J0QD 4C3KA 1YGYA 2FJBB 1TL5A 1VR6A 4KGKA 2CIMA 2U2FA 3M6UA 3R5DA 2J9DE 3KK2A 2PMZD 1KONA 3KHRA 3D68A 3FFIB 2AYMA 4N8NA 1IM4A 2IMWP 2GVZB 3CCSS 2XS5A 1OY9A 1GMWA 2DNOA 4KH1B 1OSCA 5KT6A 2FZCB 8AT1B 3WX8A 4PRFA 2AKWB 2M52A 3KUHA 2V34A 3I31A 5KFLA 4LIRA 1E6VA 3GPAA 3DNCA 3W5XA 5J2MB 1NSQA 4CO1A 3I0RA 2DJWA 3W9JA 3M9MB 3Q2SC 1B70B 1RTJB 1FF2A 4LFBJ 3NNCA 4DN0A 2XSFA 4PYDA 2ZZMA 3QSIA 5F9LA 1KKHA 1S5ZA 2N82B 3MTKA 3PJXA 5L46A 1KHVA 3TA0A 4TVAB 2V8DA 1KFSA 4QWDA 3BREA 4I2PB 1UTAA 4ED7A 1DTTB 2V69A 4ZN1A 2CG4A 2LEBA 4CLFA 2D3ZA 4DR6F 4O3QA 3I55S 5C42A 3FC9A 1KDNA 4A48A 4OI4A 2V50A 1G1XA 3D67A 2JOQA 3IMQJ 3ZZRA 4MYUA 2XZDB 2LYVA 4LF8J 3U7JA 5A8WA 4P7TA 4ZVSB 2YXLA 4RZRA 4UQGA 3KLIA 1C0TB 2PA8D 2NR0A 2C2NA 3GFHA 3MPVA 1VC5A 2H3EB 4IFYA 7FDRA 2CXEA 1RAFB 1UW9A 4ECWA 2FLOA 4MK7A 4F3QA 3D6MB 1J5EF 4CQ1A 3ZZ0A 3PM9A 4WIQA 2FVSA 1S79A 3K8WA 2UUWA 2YH0A 1HWJA 4DS4A 1F1BB 4B9NA 2ZBPA 1MN9A 3I9ZA 2VFSA 1U49A 3C15A 4PG5A 3WHIA 2L48A 3MM5B 1XMBA 2EFOA 4R25A 4F4AA 1FRXA 4C8MA 5HMXA 3M9OB 4IRKA 4YHHJ 4KHPJ 4RPFA 3JQJA 2CDRB 2P5VA 2GMHA 1R0AA 2ZNZA 2YNGA 4F4XA 1FKOB 2OPSA 4DG1A 2IYIA 5DQIA 4ZIWA 4WP3A 3THPA 4PG8A 2EFGA 3HHKA 5EWEA 3HSJA 2R8GA 2X1FA 5KG7A 1RHUB 3LO3A 4X64J 3WIUA 1S99A 1YWXA 1SJ3P 2ZE2A 3GIRA 3TW0A 3SSRA 4DL3A 2VJVA 3TUZC 2PI5A 3UVJA 3DOMA 1V5VA 4O3OA 1YZ7A 2H5IB 1XWLA 1IUJA 4ZVHA 3CCES 1UZHA 1RHJB 4ZJQA 2RT3A 3U1MA 2CZ4A 2YPZA 3BJYA 4DV3F 3M8PB 1EB0A 3UR3C 4DR4F 4NLOA 3JSRA 3QGIA 4X2BA 2KXHA 2MZSA 1NPKA 1BWEA 3OR2B 4BDPA 1ZZNA 1TELA 1YX2A 1XR7A 2FDNA 4J90A 3G4SS 1XR6A 4DUZF 3Q24A 3AH6A 4QCLA 4AYBD 2MLXA 1GH8A 2Z2ZA 1U4BA 1UP1A 3MDFA 4P74A 3BGRB 2I38A 2CNNB 4NI2A 3AA8A 4ERDA 2ZFHA 3OFFA 1NNDA 4IQMA 2Y0SD 4IDKB 1TKTA 3R5GA 2J0SD 4UUWA 3GWCA 3VGUA 4MMOA 4DLEA 1WF2A 3MPUB 4LBPA 3M2VA 3FBFA 3KNGA 2KTQA 3AJ2A 4PPZA 4B9VA 3J81U 1X4DA 1S9EB 5ETRA 1WC4A 1Q4RA 2HNYA 5HQLA 5J2NA 4RBUA 3B82A 4FBTA 1N4LA 3RB0A 1GX5A 2BM1A 4B9SA 3POTA 4DU8A 1XERA 3MAHA 3Q8RB 5AE3A 2A2DA 1U2RA 3MR6A 2VV5A 4J9SA 5E3CA 2KHCA 1FDAA 3EZUA 3IG1B 2VU5A 5JMNA 4V19X 2VPYB 1TK8A 1PYTA 2AYEA 3AQPA 1HW9A 3DXBA 2VFVA 4P2SA 1J5OB 3LP0A 1VJWA 1AZSB 4ED4A 4QR1A 1IKVB 3OXGA 3R6LB 1ZA1B 2CQ1A 4YDDB 4UUXA 3CD7A 3AD7C 3M30A 1EETB 4Q2LA 3GJQB 2BE9B 1RGVA 1FDBA 1P1LA 2OPPA 3IRWP 2BV3A 4JV5J 5LJ3Y 4KFBA 3HDSA 4K8RA 2KFYA 4EBDA 5KFKA 2HFOA 2JFKA 2Q43A 1UJ4A 5H9FJ 1DAXA 3H0PA 2ZNYA 9ATCB 4K4VA 1XNRJ 5F0UA 2WB1D 1VQMS 2UUTA 1RXOB 1PCAA 2GHPA 5C5JA 2XNRA 1JJHA 1SQFA 2C3MA 2LQJA 1OYDA 1WEXA 3TQ1A 3G8QA 3CJSA 3M2UB 4CT9A 3V5RA 5THWA 2DY9A 2ZH9A 4GRSA 2XULA 4LSLB 4HYKA 1K1QA 2ZJQQ 2HBRB 2J7KA 1RSCA 4MKVA 2KI2A 4L73A 4LRAA 4X4NA 2HPUA 1SVDA 2CAJA 4LBIA 3RW7A 1HNXF 5C25B 2LKZA 5HLFA 4NOHA 2HFSA 1IM6A 3QFHA 2ZVIA 4PABA 2CWKA 3WZ0A 5L1LA 2ZWPA 3I6PA 2E5GA 4GKJJ 5KFQA 2IYGA 1PGZA 4DSJA 1DLOA 5K8OA 2RKIA 2HHVA 1NUEA 4H54A 2OH2A 3H8YA 3W3SA 3MHYA 1K1SA 1RAGB 4KO0A 4N76A 4S0MA 4X65F 4WF9Q 4HT7A 4FXWA 2ZH2A 2ERRA 3L3CA 2Q1LA 4U9RA 3TEHB 1S6PA 3CJ8A 4F25A 4O3NA 2B56A 3DDNA 3I5CA 4MIBA 2RDJA 3R9LA 3K5PA 4QR2A 1S49A 3CJTA 3A4TA 1NK8A 1LWXA 1OIAA 4OYXA 3PO4A 4ZJOA 1EIYB 2VASA 1N34J 3GV8B 5KOWA 3A8IA 4NXMJ 2M70A 3AD9C 4U95A 5KFCA 3N6LA 4DJBA 1YRTA 3ENWA 4LSNB 3SDEB 3Q89A 3TP2A 1H2TZ 2J0WA 4AXIA 3TAMA 2O66A 4DSFA 4CIOA 1ZYQA 1CS4B 2PFFB 1TFWA 3QJLA 2DXFA 4UT4A 4NLDA 1PAUB 3QJJA 2OPRA 1RB0A 2BACA 3PFOA 1EKSA 1JLQA 4WFXA 5D0EA 2HFNA 2M9KA 1LV5A 5KFIA 4JYAJ 3Q23A 1ZAWA 4IH5A 3NXZA 3IR7B 2MQMA 3M7VA 1L3SA 2HRUA 1T9UA 4ZKAA 2R7XA 1A9NB 1U1QA 4R5PB 3QO9A 1U48A 4JI2F 2AMCB 1GTHA 4XAKA 2WOMA 4USMA 1WDTA 1H6KX 1VFJA 3M8WA 4X4TA 5D3GA 1H73A 5F41A 2R2SA 1N48A 4YB5A 1HHQA 3DRRB 2GX8A 3E3XA 2D1CA 1U8WA 4XPEA 2IM3A 2LXUA 5I3UB 4HH1A 5GADI 3N28A 3MAAB 3TX8A 1N33F 1UETA 4CM0A 2XY5A 5IOLA 3HKWA 1EAYC 3OJUA 4CI0B 4W4MA 4ZPTR 5AJ3F 2X1BA 1S1UB 3KOAA 4Z2XA 4OQJA 4ER8A 2CZ9A 3GONA 4JI1F 3Q8QB 4RNNA 1FFSB 4B3SJ 1RLCL 3BSOA 3KFWX 3QGGA 1D9DA 4IYQA 1Z1ZA 2NYIA 1WEZA 2ZKTA 3HJVA 3W9IA 2X1AA 2K7KA 2B9EA 2H1YA 3CDEA 4LF5J 1Y00A 4LIWA 2AQ4A 3VF0B 2I0XA 3SCJE 1F5CA 2IM2A 3GR1A 2GZOA 2H5EA 5F8JA 3HX9A 3FJ2A 3GJRB 1DRZA 2BJEA 4L76A 2MZ1A 4NA1A 1JLCA 1GTEA 3VQSA 5E3QA 1RWPB 3R3TA 2QSFA 3RBEA 1FT8A 3OLAA 2HFVA 3J80Y 3JXOA 3R5AA 4ICLA 1DHMA 5GMEA 2AW0A 1U1PA 4OHVA 4OJGA 2VG7B 4ZPCA 3MMAA 1WEYA 2IC3B 3JYTA 1SJ1A 1XR5A 5K14B 3HF5A 1KC8T 3PX4A 2FD2A 2PT0A 3ILLA 3P6YC 1WG5A 3ZTPA 4LFCF 3VAMA 1P27B 2WVFA 3L95X 3FZBA 3KLFA 5F8GA 2LECA 3R97A 5CYQA 1MN7A 4I2QA 2AX1A 2KFZA 2CPDA 1RI7A 4HT5A 3OV7A 1FXDA 1MU2B 1HWIA 3IAS9 5HROB 4PCQA 2KM8B 1W25A 2IAJB 2ZM6F 3V6DB 3X1LB 2FHOB 1ZM2A 3VZIA 1GXLA 4HI1A 3CJQA 2KXFA 1C1CB 1N54B 3ILJA 1HA1A 2VQFF 4OX9J 1UWAA 4DUTA 1FFGB 4TLQA 4PZVA 2CDQA 3HI9A 2F8EX 2YKMA 4C11A 1SC3B 2FHJA 2J9EA 1JLGB 1NZAA 5J1PA 2FYXA 1TZ0A 4YR0A 4CLKA 4K4XA 3DRPA 4B3OB 2J9CA 1H2VZ 3GIKA 2XMJA 2GNKA 3HZGA 3C8YA 2HYIB 1TKDA 3MD3A 2QYGA 4DV5J 3ITHA 4OYOA 3DDIA 4DV2F 5EGYA 5KAKA 2OMOA 1R6YA 4NLRA 2D74B 2FJXA 4OLOA 1TTHB 3IM8A 1PO6A 3GYNA 2SXLA 3JSMA 1NSKL 5D15A 1S1XA 2DO0A 1CULB 3PR5B 2FY1A 1ZOTA 2ZH7A 1QTNB 2BOPA 2JC0A 5JVGQ 3TUIC 2WSEC 1FDDA 3MEGA 2P8IA 2VPWB 2XMMA 1OS5A 4EO6A 4RW4B 4A8XA 1K0TA 1UW4A 3K59A 1NEEA 4QWAA 4NL5A 1FX2A 3QIDA 3R8YA 4AFFA 1N36F 1PYOB 4ID8A 1IBMF 4N5SA 3J7YU 2D3O1 1BHNA 3NWGA 2RDDA 1KHWA 2C3OA 5A6WA 3ZTOA 3CCZA 2OTLS 5KFNA 1UFWA 3C66A 3OHBA 2V2KA 1FK9A 5CYMA 4C8LA 3B8HA 5BYQA 4M5DA 1IKYB 4IG3B 2B4UA 3OD2A 3AB2B 4DEZA 1NJYA 3CF5Q 5AT1B 2FJVA 4FP9A 2P9EA 3I0SA 1FKPA 2OPQA 4W92B 1DY3A 1MG7A 4RNOA 2E29A 3Q83A 3CCVS 4IFVA 3J81j 4GVBB 4ZDNA 1B4SA 1L3VA 5IQ6A 3RAMA 4ILMA 2F5GA 2VKZG 4F0KA 1FD2A 1ZPVA 1AA1B 3KJVB 4HI2A 4NZ7A 3LP2A 1KQFB 3K58A 4F2RA 4RW6A 2JVRA 5IC6B 2C2RA 2MY7A 2QL7B 4Y28C 4OYMA 3JSYA 3TJ8A 3KDOA 5KG1A 2BRKA 2VFUA 4X62J 4MK9A 2OHDA 2AT1B 1FX4A 4LFAF 4DZ6A 1CJUA 3J7ZT 2HK3A 2AIRB 2CWXA 2MZQA 3G8TA 1PJ5A 1LNQA 1WOOA 4YY3F 1KQKA 4RU2A 2RSQA 4QJVA 2EFVA 1QM9A 3VAFA 5HBMB 4HDHA 3CULA 4DLGA 3BM7A 4RW9A 2VICA 2YPYA 1HPZB 2ZH8A 2XZTB 3M05A 3C2PA 2EG2A 2VA2A 3LW5C 4WZMA 1FNXH 4O0IA 5ETTA 4DR3F 3SV4A 4I7FB 5MLCV 1NH7A 4B02A 2G4BA 1RT2A 3MM9B 1T94A 1XMOF 3MMBB 4TY9A 3V81B 1I6JA 3OTOJ 2YQ3A 1F2HA 4U6PA 2IVYA 3LWMA 2DNYA 5ETNA 2IHR1 2JLEA 2FUG9 3H4DA 2HWTA 1RWUA 1YBTA 2EI5A 4Q45A 4M5KA 2CJYB 1NZ8A 5K8MA 3QQCD 2YTCA 3R2CJ 1F3FA 3OBIA 1KVKA 5FD1A 3M6VA 3QJPA 2V2QA 1TL7B 3PY8A 1LWFA 4L6V3 2J5AA 1N5SA 2I8EA 2ZD1B 2COLA 1QAYA 1YJVA 3IRXB 1Q1KA 2PIIA 5G0RA 4DXLA 2MSSA 3QT7A 3BSNA 4LREA 4JV1A 2AF6A 1BXNA 3BN7A 3NP5A 5HQ8A 3DLEA 5IT0A 2AGOA 1P6TA 2VQEJ 1GEHA 4RR5A 2J6TA 5IQQA 1VLOA 2VG6A 3FK4A 3MM7B 2DGSA 2J9DA 5DG9A 5HSPA 4O0NA 1N5YA 1LW2B 4DQRA 4Z37A 4DWIA 1QE1A 4NCGA 2N4CA 2BYCA 2IA0A 3ONQA 2C2MB 4JI5F 4J9UE 1KTQA 2MKHA 4QU6A 5HP1B 4K4SA 4YMEA 1OSDA 2CQDA 1XTZA 3EM1A 1RAHB 4HTIA 3QATA 3EGVA 1G7CB 2DEIA 3ENQA 2JNJA 1ZM4A 1CJKB 3TEGA 3CDAA 2CQGA 4Q8EA 3W2WB 4JI6J 3BYPA 4AQYF 1T7PA 2F8HA 4DCJB 2H48B 2HK2A 2ADBA 3FRZA 2ASDA 2W1BA 4KGVB 3TZWA 1U1NA 3MR2A 2X3GA 3RR7A 1VI7A 5F8NA 2W2OP 5A2QY 3EPGA 1WOSA 1HBNB 2DGWA 1E6YB 1VQYA 3EGZA 1RDRA 2E9TA 1MSWD 4LR8A 3PYDA 1HNZF 3DCAA 3HT0A 1Q0NA 4PQUA 2OKQA 4A47A 5A76A 4KSEB 1S6QB 4FF1A 1S97A 1CJTB 4F4ZA 2HQCA 4CTAA 3ZTSA 2O1PA 3DRSB 4QWBA 3JAMU 1H7WA 1NKCA 3OTEA 4K4ZA 2E5HA 4C6AA 4CZCA 3NNAA 4DCOB 1C2PA 3T9ZA 3MM6A 3RBZA 3A3OB 3M1VA 1UMJA 1NDCA 2GMJA 1LWCB 2KKHA 4AUKA 5B0BA 3Q0AA 4DUYF 4Y3CA 4ED8A 3RUBL 2DR7A 4FF3A 4R0EA 4FF2A 4BC9A 4QQBA 5GMDA 4DL7A 1RBLA 3BQ1A 3OHAA 2DY1A 3NMRA 1RTDA 5RUBA 5CA5A 4A8OA 2ATLA 2GW8A 1V3RA 2HVHA 2CKWA 1RU2A 3PW2A 3A3NB 4A8WA 4A8MP 4KV8B 1OY8A 1VHFA 1X0FA 5BR8J 2WVEA 1Q16B 3UI3A 4NWBA 3G87A 1MLAA 2C1EB 1TL3A 2KRBA 3L4BC 3W2VA 2UXCF 5IT9U 1T9VA 2GIQA 3HP6A 3MM8B 3FCHA 5KFSA 2AEFA 4P7VA 3QPIA 3CMES 2ZH3A 2QG9B 2YKOA 1ZTWA 5L9XA 3F56A 4CNYA 1RBAA 1QVGR 2QV6A 5KFGA 4DFMA 2F4VF 3T1YF 1ZAXA 1SJQA 4ED6A 4ECZA 4LFCJ 2PO4A 2OUGA 3H4BA 3HJFA 3UFCX 5JVHQ 1GQEA 2R8IA 4DN9A 2OI2A 3BO4A 2WZ1A 1XC9A 1R6VA 4AXJA 2DISA 3M6XA 4L72B 4NCAA 2YNHA 2A1BA 1WTFA 4NRTA 4Z7YA 3E01A 2B6AB 3KLGB 4J9NA 5CCLA 3R5BA 1RTIB 4U67Q 2P9GA 2KVIA 5KFZA 5GAGU 1WG4A 4Q44A 4TYAA 5EWGA 1Q7YT 1I3OB 2BE7D 3C14B 3QGPA 3O6QA 1O0PA 1H3DA 1HMVA 3HVRA 3Q8YA 4WPAA 2HAFA 4N7TA 5IM0A 3MECB 2ZHAA 2Y1IA 3OTDA 3ISZA 4BHQA 4HACA 3G6YA 3Q22A 4CLPA 4YDXA 1K73T 4HHJA 3NGUA 2OFHX 1JWWA 3DLGA 2C2KB 1KVJA 4PXDA 2OIHA 1RTZA 3R7BB 2B9YA 4C8KA 2M2BA 2W9BA 2JEIA 2CJQA 4WIIA 3NGDA 1QUPA 3GE9A 4QIEA 1T11A 1VMBA 3NBPA 3CCJS 4WK3A 4ECTA 4K59A 2HBQB 4YR3A 3I32A 2NXJA 1W2BR 1K44A 2HQFA 1G6BA 3DM2A 1VYAA 2M88A 1VQ4S 2E5JA 2VH7A 2Z8QA 1H2UX 4ED2A 2F3JA 2ZBQA 3MPDA 2V4QA 1N6QA 1R8PA 1N32J 2LA4A 2DNZA 2WW8A 1L3KA 1VC6A 2NSCA 3UW1A 2KO1A 5LJ5Y 2UUAJ 2LQ8A 5KFFA 2OLWA 4DR2F 3S1TA 5LMNF 2U1AA 4WKRA 4ITSA 2RU9A 2LDIA 3GIMA 4FYVB 5J1NA 2YNFA 1YSJA 3IS9B 2O01C 4IRCA 1HNIB 2LP4A 2Z57B 1FJCA 4CLTA 2I9SA 2GC8A 2C3UA 5SZTA 1JX4A 1RK8A 1SQEA 2E9RX 4J9PA 5ETVA 1CJVB 5LOQA 4USTA 2KM8C 3PR4A 2ZZTA 5FIIA 3TZZA 2WSFC 3AD8C 2B5JA 4FYXB 2QZ8A 2CJKA 2AWZA 2EXUA 3ILOA 2XWXA 3LUYA 2YQ0A 4EGLA 5J2QB 4RUAA 5ETPA 3PRDA 5C24B 3TYTA 2VC0A 3NCRA 3IN5A 3C6UB 4MH8A 4XDCA 2LA6A 2QLXA 5K8NA 4JOUA 2JC1A 2JDJA 3N9UC 3P5BP 1A0OB 1OMSA 2UU9F 2DHAA 1RA7A 1YJUA 2EVZA 4I4BA 2GJ2A 3D1HA 3FEXB 5EX3A 3WX4A 3BR9A 4U7CA 2YKPA 1SH3A 1TVRB 1Q86T 5FJ4A 4ZN3A 4JB8B 4YB1P 4DPUA 2G2ZA 3RR8A 1D3WA 3MCMA 2AHOB 1U6BA 2WW4A 3LPYA 1H74A 2HNDB 1F9HA 1K47A 3PYEA 4P2FA 3MURP 1WC6A 2GO8A 1C4AA 3TA2A 3DMJB 1N0UA 4TU7A 1LWEB 4J37A 1TU0B 1TK5A 4AE5A 1WTBA 2VFTA 3KUGA 1BLUA 1IR0A 1C0TA 3TANA 3E2EA 1XMOJ 2HVEA 2HVIA 1AUSL 2MPUA 4JI0J 4ZP9A 3ZZUA 2HW3A 1NSAA 3PVXA 4K4YA 2I6WA 4B3TJ 2MKJA 1NH8A 4YQWA 4AL7A 3C16B 4WFBQ 3NEKA 2ZH6A 1IBKJ 1WHWA 3K5NA 3KK2B 1RYRA 4LRFA 1PILA 1FO1A 4WU3A 3CDUA 3VVTA 2N3LA 4NXNJ 3UNYA 2EFPA 4PG6A 2O67A 1OYEA 1NKBA 2E5LJ 3SXLA 3E51A 3R2DJ 4OZLA 1UVNA 2X7IA 2DNKA 1HBMA 3FEYB 2HKEA 4K2XA 3BDEA 2OEKA 4KIAA 3G6VA 1LFPA 2CQBA 4NYOA 2JEJA 4OX8A 4H4MA 5CD4A 3H42A 2GCFA 3GSIA 2V8GA 3DI6A 3H5YA 5HAOA 1KFDA 3HSZA 3QYYA 2PN6A 2YKNB 1MNEA 1KSPA 4F3OA 1KEKA 3OVSA 4CO3A 4C48A 1SKRA 2OEJA 1LOUA 1TUGB 4R8UB 1AW0A 3I82A 1NRKA 2FJAB 2BKOA 2KXNB 3T5HA 4WXOA 5CD4H 3SCIE 2XSJA 1WF1A 1X4GA 2FJWA 2HQDA 2ZJPQ 5B0GA 2V4JA 4G1IA 1HWUA 4UY85 5KFRA 3ZTRA 2ZH4A 4JI4J 3CC2S 4K50A 1VRUA 2GGPA 4Y65A 2J8AA 3M8PA 3PFEA 2HLUA 3GZ7A 5K5MA 3IBCB 1FCAA 4M1KA 4B3MJ 1R31A 5A8WB 2KDOA 1S9GA 4G1QA 1YITS 3KLIB 3CJ4A 1S7HA 3IGVA 3SEOA 3FSYA 2MTLA 4IFYB 3AHPA 4FNHA 4NLTA 2KZZA 1VQNS 2MSTA 1TUVA 2XYPB 3HO1A 2YWEA 1JLBA 2Z4PA 4OYWA 1CQNA 4CNZA 4MFBA 1RKIA 4FYDA 2BA9A 3G6ES 4I67A 2H5JB 1GAOA 1VC0A 3KG0A 4WKYA 2HVZA 2ABYA 2XYGB 4DL4A 1JXEA 4ZHRA 3UO0A 1WUUA 2V6AA 1RWVB 3C15B 1M5VC 5I42A 1Y5NB 2RDIA 4CP5A 5A8KB 3M2RA 1RQ0A 4ELVA 1S4FA 2B9WA 3CXCR 2LVWA 4C8NA 2R2UA 1R0AB 1QSLA 2DK2A 2YNGB 3CMAS 4C8ZA 4IOBA 2OPSB 4LF7J 4ILRA 1F6TA 3MUMP 2OSQA 4C8YA 3SQOP 3NGRA 4X4OA 3G6XA 3CVKA 3B4MA 5A0YA 3K5OA 5LSLA 2EK1A 4MAKA 2C2OB 1WHXA 4LR7A 2X51A 2DGQA 4WCEQ 1HBUA 3TUJC 2V63A 1PAEX 3KK3A 4FYYB 1VK3A 4LF4J 1KP6A 3IG1A 4B3RF 2DHSA 4ES1A 4G1PA 1BGXT 1FI4A 2ZE2B 1U1MA 4DV1J 4H4OB 4ED1A 4DV0J 5BYSA 3CB4A 3OPKA 2BOAA 3DOMB 1P9QC 4OI6A 2UVUA 3CE8A 2JFDA 3CCRS 3KK1A 2HQGA 2FVCA 3OL8A 1PYSB 4O4GB 5A8RA 1IKVA 3DRYA 4DPTA 3K89A 1VHIA 3UWTA 3OTCA 1RAIB 4LF9J 4OZJA 4C3LA 2QN6B 4L75A 2AJFE 4M5JA 3LF0A 2UXBF 2XI3A 3MAQA 1P8GA 2R3VA 4NLGA 3LQVA 1LFWA 3MPYA 1IWGA 4OFZA 2MJUA 2C42A 3A3PB 4NI2B 1VBYA 2IJFA 1NDLA 4LMZA 4J7CA 2XQCA 1I94F 4UOGA 4RNFA 2PEHA 5DQHA 2P2CB 1ZAVA 3K7RA 4LQ9A 5E5NA 1C0UA 2DH8A 4IG0A 3FGVA 2BQRA 4USHA 2HNZB 4BCAA 4B9UA 4H4KC 1LEOA 4RWWA 2UUBF 2RIJA 2CYYA 3W66A 2UXDJ 4EBCA 3ET6A 3LWLA 5J1EB 5IWAF 3EDQB 2PC6A 1V9OA 2JJ4D 3W1YC 3F44A 1YK9A 2EWHA 1UEKA 1VOMA 2R7OA 2Y8YA 4BC7A 4USIA 2R8JA 1HI1A 1QVFR 1PJ6A 2QL9B 3W9HA 1HNVA 4DDFA 3RAXA 3RRGA 2FGOA 1NO8A 4TU8A 1DQAA 3VAHA 4KKOA 3POTB 2G0CA 1RT3A 3F73A 3BH7B 3GG1A 2MZTA 2W2MP 1U47A 1B7FA 4OI3A 4LF6J 1FXRA 3EXYA 1NJWA 1PSDA 4F50A 3ZO7A 4EEYA 3HD1A 1U24A 4J9QA 4FBUA 4ALZA 2WTFA 2ALYB 3GJSB 3MWBA 5KFUA 1S1VA 2IM0A 1M1GA 1VS3A 4XK8C 4OIXA 4CYUB 1GK8A 3UD5A 4DQIA 5D4LA 1ELOA 2BDPA 3M30B 4Y2CA 2IBOA 1U25A 1Q78A 3BF4A 1WJ9A 2OPPB 3MEDB 3JQMA 3JTPA 1TV6A 1D8ZA 3Q8SB 3H5UA 3QRPA 3UD4P 2E9ZA 2QYCA 4KFBB 2CQCA 3TZXA 2Q6CA 3QZ8A 1M5PC 4KPYA 1Y3JA 2EKYA 3SDEA 4L3KA 2POKA 3CJ5A 4Q7AA 2C28A 3PX0A 4Q5VA 1HR0J 2P9CA 1JJCB 5GAEU 5GAGI 4DR1J 5ITHA 3HHNB 1V3ZA 3PG9A 3SQGB 2AYBA 1VK8A 3DLLQ 3EYZA 1URRA 1R0BG 4IOAQ 2R4FA 1BY9A 4QU7A 4ZIVA 3Q2TC 4DFJA 2DHGA 3KG1A 4DR5F 2J8SA 4IRDA 8ATCB 3T1HJ 1QAIA 4YN3B 3D1QA 1FXLA 4DV7F 4HVZA 4OYAA 1J27A 4DU7A 4IO1A 5H9EK 4R5PA 1RWMB 3UPFA 2UUCF 1LKZA 4K0KF 1M1HA 2G0JA 5HLFB 2K8GA 1RAEB 2VDHA 2FGCA 3KKFA 4DL2A 2BQUA 5I3UA 4JI3F 4ZCIA 2VUGA 3MAAA 3H2LA 2CQ2A 1KD1T 1Y3KA 1JNZB 2YNIA 1DLOB 3AT1B 2RKIB 3CJKA 1YTYA 2DR6A 3W65A 3C46A 4EBEA 5CXTA 4DV4F 2R7QA 4LJMA 1NPPA 2MXYA 4ECYA 4KO0B 1SXLA 4N47A 4ZVEA 4CLWA 4NA2A 3GP9A 4I64A 2XM3A 1S6PB 3JB9k 1R7IA 1C1BA 3PKMA 4OZ2A 4ZITA 2XHCA 3TI0A 4NRUA 2FZKB 3SZ2A 2CG8A 3KLHA 5ETMA 2JVOA 1ZM9A 3BQ2A 3LP1B 2NZCA 2YWKA 3BSAA 4C98A 5KG2A 1OWXA 1QTMA 1WORA 2HHHF 1NBEB 1JIHA 4X4PA 1Y10A 2OEMA 3BKUA 1RT5A 3EX7B 4U8YA 5EDWA 1RWWB 4TU9A 3TAMB 4OL8A 2GMLA 1IXKA 3AODA 2DPIA 5BXIA 2RS8A 3B78A 2MEWA 4CRJA 2QLWA 1KOHA 2MZJA 4D3HA 5C2CA 2FY8A 1PC5A 5DLFA 5EN1A 1WKJA 2BX6A 2BJ3A 2C2DA 2RJZA 3TWZA 3R1HA 1N8RT 5LL6d 4O4RA 2MKCA 2IC3A 2DNNA 2ZITA 1FE4A 4OI0A 5BJRA 2CJXB 3NG8A 4I69A 4ATNA 3NOGA 1X4AA 4ES3A 1WOPA 4GVLA 1QD1A 3BZQA 4X84A 4M5NA 2CPFA 1YDLA 5D3GB 4WJBA 2OTJS 2MKSA 5CZVA 4Q43A 4C2MA 2XLKA 2BRLA 1RHKB 2R9LA 1F0XA 4A46A 4J9OA 1VQPS 2JLFA 1DQ8A 1RT4B 1VQ9S 1TL1A 2MGZA 2EFNA 1CQMA 2RB7A 3US5A 1RBOB 2HS3A 5LM7E 2Z2YB 1U6FA 2J7UA 4OHYA 2CNLB 4UF4A 1APSA 5KG4A 4WFAQ 3BYRA 2XNQA 1FJGF 4J9MA 4CLZA 4QYRA 4DPOA 4ECVA 1F5AA 2FLNA 4ZLJA 2HHQA 2APOA 8RUCA 4P10A 1JLGA 5KG3A 2EG1A 2NXEA 1T05A 5H1SV 2R8KA 4G65A 1AT1B 5CCMA 4DCPB 2DR9A 4ELUA 4B3OA 4CT8A 1DZ5A 1G3OA 4QYZK 4M94A 3MEEB 1UFLA 1RADB 5I3PA 3A8JA 3TOQA 2W2PP 4IKAA 1RU1A 3R7NB 3TARA 1PKUA 1ROFA 4NCBA 5DG8A 1YI2S 1JLCB 4UQTA 1KLMB 3SI8A 2XZWA 1CULA 2O3DA 4JI7J 4B17A 5C2GA 3CO9A 2BW7A 4X66J 4DPYA 1X8DA 3OXFA 4MKAA 5HJYA 4G3IA 1BC6A 1X9WA 3RW6A 3O5TB 3PIPQ 3S7RA 5ETQA 3CCLS 4GKKJ 4PYAA 4RUHA 3K2YA 2ZUAA 3JYTB 1XBWA 3R5CA 3HXMA 2XCAA 3OL9A 2WVDA 1ZPWX 3EICA 5KT7A 4DBQA 3KLFB 1YBAA 3BPSP 4WFZA 5IS2A 3MF5A 1XNQF 4IG3A 4CH0S 1U1OA 4HHHA 5KG5A 5ETSA 5DDRC 3HVTB 2B3TB 1XQIA 1WD6A 1HBOA 3BDPA 4GVBA 1YZ6A 3IM9A 3SBMA 2H65B 1N5QA 4KTQA 2N7YA 4URSA 1IBLF 5E0OA 3J7AN 4EFAC 2LXFA 1YJTA 4ZVUB 1RP5A 4F4KA 3KTQA 3OQ2A 1FEEA 1YJWS 1NPRA 3T5JA 4RBVA 2JEFA 1GXUA 5D0RA 1U1RA 2YKMB 4U96A 2ZJRQ 2VIHA 4UW2A 1EP4A 3BBBA 2A3JA 4OI2A 1WC0A 3GILA 4A8FA 4X4RA 3WC2A 1YHQS 2QTWA 2OD6A 4FPRA 1Q5YA 1FRIA 1DTQB 2IVFB 3I56S 2OO4A 2V5HG 1FRJA 3SFGA 2VL1A 2EC2A 1S0MA 4Y34A 3C6TA 2VG5A 2PFDA 3JSMB 1A6LA 7AT1B 3AFGA 5EWFA 1S1XB 3HHDA 1Q82T 2IRXA 3DLHA 2RE1A 3CD5A 1SV5A 3OFGA 1D1UA 3UR0A 4USUA 5L9NA 3GR0A 3I9V9 4LVOP 3B54A 4F0HA 2HIYA 4I7FA 4FF4A 3HHEA 3MM9A 2KZMA 4IH7A 4RUBA 1HI8A 3NOCA 2KYZA 1GFWB 1RJJA 1TKZA 2GIRA 2J0XA 2Q3PA 4FS2A 5DG7A 2ALZA 2X3DA 3PTWA 3IWXA 5LMUJ 2Q6BA 1UKUA 5SUHA 3HFVA 4N8OA 3VVUA 4OYBA 4DX8H 1OO0B 1TL7A 1XMQJ 1FK9B 5CYMB 2RQ4A 4RWXA 2IIHA 4M5DB 3CC7S 2ZD1A 3IRXA 3N4WA 2BE2B 5D0HA 1Z2LA 1FKPB 2OPQB 3P3DA 4PWDA 1FVQA 2GHWA 4JI8J 3VTIA 4IFVB 2NYHA 2GV1A 4AL5A 1KWMA 3HULA 1REVA 3MM7A 4CLLA 2FHJD 2I5JA 1U02A 2B7CB 4DPXA 4F67A 2A6MA 1KQGB 2IJNA 1C4CA 3LP2B 4DR7J 4LFBF 5M2RA 1KVIA 3MUVP 4RW6B 1Z2ZA 4PQAA 1R8AA 1BQNA 4M63A 2A18A 3PEJA 1VQ7S 3MOJB 2QA4S 5HP1A 1YKWA 1ZS6A 2YVSA 1MROB 4ZPAA 5AXKA 2W4DA 2EBGA 5EHHA 2ZBRA 4WWSA 1S1TB 1UCNA 3NL0A 1L5UA 1CJUB 2C3PA 3ISND 3F41A 5B0EA 1N52B 3KWMA 4KGMA 4Y6IA 5KT3A 3PW0A 4WTOB 5U47A 4RW9B 2R7RA 2BVZA 5KFWA 1QSSA 3P5TL 2E1RA 3AOCA 4PWWA 3MI7X 1TAQA 2RD5C 2DITA 4NLUA 4WYLA 5DO2A 2JWNA 2WVCA 5KFBA 4LF8F 2G1DA 1BMQB 3R7SB 1S48A 2MQPA 1WWHA 4TNOA 1S6QA 3T6JA 3T3FA 1CJTA 1NM2A 3D3CJ 5DDQC 1T9WA 6FD1A 3D1OA 5KT5A 2R7WA 2XTJP 2GHVC 2LXIA 1KNZA 3R27A 1LWFB 1RABB 1WELA 4HDGA 1LWCA 3IBWA 2DRDA 3NCPA 3JTOA 3ZFVA 4DV6J 2V9KA 1ZZFA 4Y0FA 3UDLA 5CQGA 3OJSA 1RA6A 3DLEB 4LRBA 2W01A 4RO0A 3SMZA 3ZNJ1 1S1WA 1JLAB 4HEA9 1RISA 1VJQA 3D66A 1SBRA 4GC6A 3ELHA 1N5YB 4YHHF 1S0OA 1LK5A 2L41A 4KHPF 3TO8A 2VJUA 1RCXB 1QE1B 2ZWOA 3A12A 1UA0A 4NCGB 4ZVFA 4KV8A 2F40A 1FWLA 4IR9A 3BBCA 1TP7A 2CQ0A 4M5IA 1URNA 4RKUC 4PG4A 5GAEI 2BJ1A 5A6PA 4ANEA 1SCJB 3L09A 3D28A 4DFKA 1SH2A 3MM8A 2VC1A 2KL8A 4ZPBA 4X64F 5FLXY 3DGVA 2YWWA 4ZA1A 2HURA 2VZ9A 3U27A 2JH3A 2HHUA 1T3OA 5L8RC 4KGXB 4OMFG 2E1MC 3ZZTA 3BQ0A 5L1JA 5G4DA 3A8EA 4ZP8A 3HCXA 1U2FA 5CH7B 5GAHU 6FDRA 2W2QP 1RAAB 3VZHA 2QEXS 3MFIA 1KBRA 3CCUS 3K17A 1Q8IA 4PQUB 1B7YB 2BR0A 1GXTA 4ECSA 1NHUA 5KTQA 2DBBA 3HHLA 2DIVA 2R8HA 4O23A 2MKYA 3V4IB 2YWFA 2BQ3A 4C9DA 3WDOA 2L9NA 1IKWB 2B6AA 1UEVA 4PXEA 3KLGA 2VONA 3PDNA 3R6GB 1RAJA 1RTIA 5B0FA 5HMZA 2Y1JA 4QIVA 1L3TA 4RNHA 2RNEA 3QIPA 2DKOB 2NXUA 2DPJA 3H20A 4DR6J 1D9AA 2A10A 4JBCA 3RU0A 3QWUA 1JJ4A 4HTJA 1OJ4A 4PUOB 3P4UB 5KFMA 1RTDB 2K7JA 4WTYA 4TQSA 1S77D 2VB6A 1DBDA 4X4QA 1Q79A 2ZH5A 5I4MA 1UVLA 2HQIA 2KG1A 4YB7A 1I51B 4E2FB 4P71A 2DRAA 2K3KA 1H72C 2CJ9A 2XHWA 3TVKA 5E3PA 2FLLA 1DURA 2D7SA 3PXGa 3W2VB 4ED5A 1J5EJ 2LU2A 4L3NA 4PKDB 2YH1A 3HFKA 3GIIA 3D0IE 2XLIA 1G4CA 1U26A 4NLQA 4NASA 2XMKA 4KT0C 2PGCA 1NK9A 2OMLA 2IMOA 2HWIA 3GYGA 3NWRA 1JLFB 1WKLA 5D6GA 3MR3A 3IS9A 4XTTA 1HNIA 1J2VA 2F8MA 2CNKB 3IR6B 1RT6B 2D3UA 4LQ3A 3CEDA 3KLEB 3TVYA 3PIOQ 3AXMA 2UV8A 1FRKA 4E98A 2AJ4A 2YNHB 4NLSA 4JV5F 5F9NA 2DO4A 1MWZA 1ICEB 4DOZA 3G9CA 1QDUB 1NXIA 5KT2A 1VIXA 3IBFB 4O3PA 3E01B 1FDNA 3A1YG 1BQMB 2PI4A 2ZVSA 3J80U 5M2UA 1IJEB 1O6XA 1FKAF 3OVBA 3N6NA 3TJ9A 2QT7A 1XNRF 3BKFA 3C6UA 1Z4UA 3NS5A 1DFDA 4LSZB 1HMVB 3CIMA 3W8PA 5B0AA 4OZ1A 1SPBP 1NB2A 5IM0B 3MXHP 1UEUA 1MW7A 5HMWA 5M2PA 2CPJA 4DV3J 3H7HB 4DR4J 2DH7A 3BGLA 5E3AA 3JS9A 3VAIA 4TY8A 1T8EA 4ETXA 2ROPA 1U1KA 4B9LA 3QLHA 2W9BB 4DS5A 3HKZD 3BB5A 2H4YB 1NDKA 4LRDA 1WI8A 5F3TA 1M5KC 4DUZJ 4ZJLA 2ZDOA 4NLPA 3NBPB 3KLVA 3Q86A 1LW0A 3BV8A 4J5OA 2V9WA 1PBAA 4UZBA 1WHYA 1YJRA 3M8RA 4IR1A 4WP8A 2XGPA 4P73A 3DM2B 3FSIA 3DOKB 4TKTA 3MR5A 2RQKA 4HLBA 2VFRA 2GVDB 4DFPA 2WSCC 3D6TB 1UWBA 3SCLE 2PEBA 4FXVA 4NLVA 3LPEA 1N6QB 4GKJF 1HQ2A 4ZVGA 1JKHA 1R0CB 2NLWA 2NXCA 3W64A 3T5KA 4Q2MA 3TAPA 2QJ3A 2CJBA 2L08A 2NXNA 1NK0A 3MCSA 1FRHA 4J9RA 4F04B 2YNFB 1B99A 3QSYB 4QR0A 3OW2R 2R42A 1TMMA 1ZM3A 4XO0A 2H54B 3LGHA 2PA3A 4U8VA 2YBVA 1L3UA 1T03A 4C7QA 3N6MA 2QFIA 4RLEA 2CADA 5D0GA 3AY0A 1N34F 2OGUA 2IRYA 2KN4A 4NXMF 1XJWB 3HT3A 2B5JB 2KT3A 1RE1B 2ZC4A 2QA2A 4EI2A 2ACYA 1VBKA 3U1LA 2DVIA 3D2WA 1Y0HA 5DM7Q 2JRSA 1NMEB 4NYPA 4PEOA 2CPYA 2BEFA 3N01A 1AFIA 1B64A 2XEXA 4FYWB 3DRXA 3S01A 5HVHA 2JSXA 2FQQB 1KTVA 2YKNA 3W5YA 3OR1A 1U8SA 2LFVA 3DGPA 2HAIA 3IWLA 2ZOMA 3FDSA 3DYAA 4JYAF 3BGFA 2MLYA 4R8UA 4RU9A 1UVJA 1F5BA 2V8HA 3V6JA 3KHHA 5HI7A 2I1RA 1EARA 1AB8A 4OYZA 3LA0A 4ANDA 2IJRA 1SQGA 5KFOA 3S6EA 2K2PA 3EWGA 5LSOA 2ZUGA 3ISNC 5E3RA 1SJ4P 3BSCA 5F3ZA 1FTCA 2Y3YA 2BANB 2NUUG 4XDDA 3LALA 2DR5A 4ID5A 1QLNA 2QMWA 4K7QA 4LF1A 5AXNA 1IR1A 1TKXA 5L1KA 4OJ3A 4DX6A 2KU7A 2VODA 1YG0A 2E7VA 3D0HE 4IQXA 2LEPA 1JB0C 1FRLA 3PNIA 1HIYA 1H38A 3FQLA 4UOFA 2GJIA 4B3SF 1X5PA 1ULRA 3BPDA 3DKDA 2RVJA 3EVWA 1I5OB 2F9DA 3K5LA 1M1KT 1I1GA 2CA9A 3DN9A 3D3BJ 2ZZNA 4LF5F 3V2UC 4PPDA 4QIWD 3EZOA 3EXCX 3MMJA 1HNXJ 3A8KA 4PG7A 3U1NA 1X4HA 4Q0BB 3KG4A 4USWA 2W2NP 3CMQA 5KFXA 2XS7A 5A8KA 4MIWA 1GX6A 1RUSA 2CZVC 3EZ5A 2W9AA 5D4PA 2AGPA 1HBMB 2CQ3A 2UVWA 5K8PA 2HMIA 4OZ5A 2YY3A 4UTGA 1T9XA 2DGUA 4EU0A 4M5HA 2K1RB 2ZC3A 2GQQA 4H4MB 5T7LA 3DI6B 5FDLA 4X65J 3CGIA 2FJDB 3DXSX 2G1HA 2XS2A 1RWOB 4NYZA 3EGNA 3G82A 4ZCLA 4F2SA 3QRQA 2DRBA 1T3NA 3H98A 5D8HB 2EFQA 4O44B 4YFUA 4H4OA 2XSJB 2V4JB 4KJIA 3D9BA 1U0SA 2E1PA 3JSBA 3ZZYA 1RCOB 4MK8A 4W90B 5HQMA 2N4DA 3W60A 4O4GA 1IKXB 3PKYA 4UZCA 1VRUB 3OUYA 2AEMA 2KFNA 2GGPB 2XMAA 3WIVA 1SIZA 4TYBA 3NKYA 4WE1A 5DZ7A 3HVAA 2RRAA 4YS2A 3NGTA 1S9GB 5H9EJ 1Y9OA 4G1QB 3CTRA 2ZHBA 3FSXA 3PO5A 3FBBA 4LUBA 3PV8A 4K2JA 2V8VA 5KFYA 2GA7A 2E1CA 1U09A 3PCOB 3UD3P 4OX9F 2UVRA 4RL1A 1HQEA 3ETMA 2WVBA 1JLBB 1SUQB 3DLKA 3I4PA 1IR2A 4MFBB 3DDKA 3NMAA 3RGIA 3CD6S 4K4WA 1X5OA 2Y1LB 4QBUA 3QRRA 2MQNA 4KY3A 2DCLA 2ILYA 2HNZA 4FKYA 3J81Y 4ECQA 3G8SA 4JI2J 1ZH5A 4ZHRB 1FNOA 2G0IA 1RAOA 2GQCA 4GC7A 2EBEA 1HYSB 5I42B 4KPCA 4DV5F 5J1EA 1NU4A 5A2QU 4QW8A 5DQGA 3M2RB 4TQRA 1K9MT 2QRRA 3MTJA 5IZHA 1F3VA 1N33J 1DJ0A 4IOCQ 1ITPA 2ZH1A 5HJXA 2MB0B 2DTJA 3H5XA 3CIZA 1DQ9A 1MWYA 3AJ1A 5HVGA 4TLRA 5AJ3J 3T19A 5JJBA 2VF3A 2E66A 1FVSA 5IC4B 1WSRA 5A0YB 5KFJA 3MPWA 3UNGC 3RRKA 1U6ZA 1SJFA 5IT4A 1SH0A 4JI1J 2KVQE 1HBUB 4ZMMA 2QMUB 1JJ2R 3KK3B 3FCVA 2RUSA 4QWEA 3BH6B 1HQUB 3MMCA 4FN5A 2D9PA 2CQHA 4CDIA 2CNOB 4RW7A 2NCKL 5CAAA 1CSJA 4A4JA 3HM9A 3OSPA 3RZAA 2DHXA 1UVIA 2KT2A 3QT5A 5AE2A 3RRHA 1RWNB 1RZMA 2DGOA 2J6SA 3LTOA 3KK1B 4J9VA 4OHZA 4IO9Q 2BKNA 3TUPA 4CYUA 5A8RB 2AX0A 3QAEA 2FJEB 5GAHI 2BJ9A 2BUNA 4ELTA 1SB6A 1VBZA 1RT1B 1VLYA 4CO4A 2RRNA 2ZBIA 3MEDA 4NX9A 2AYGA 1U0HA 4K4UA 2UV8G 4PXBA 2ZBCA 4ECRA 4FNIA 1HFEL 2FZGB 2B8QA 4F4WA 1PG5B 3M32B 2QL5B 2RF2B 1FFWB 4F7VA 1IQZA 2ATCB 1LXNA 3SQGA 1VRTA 1C0UB 4IG0B 3DHWC 3F0NA 3LH2S 4X62F 4ZLNA 1YRUA 5J2PA 2OSRA 3OL6A 1HD0A 2E1AA 3DFEA 3ET6B 4OYIA 4ZPDA 3TA1A 2QIFA 1YQHA 3O3LA 4P6QA 3IA0A 1SKSA 1D0EA 1FNMA 2Z0GA 2ZM6J 4C97A 1FERA 4KHMA 2AJ2A 3RBXA 2GFFA 5D78A 4F02A 1HNVB 2CRLA 3IP0A 4QYZJ 2IDEA 2C2ZB 4URGA 5B09A 3O44A 3VGVA 5F8HA 1NLKL 2VQFJ 3CW2C 4ANCA 1M5OC 4KKOB 3GQCA 2QSWA 4U7UK 2HBZB 1RT3B 2VOPA 1JLEA 2JLGA 2HIQA 4QZVB 3OTOF 1QUVA 4CM2A 1F9EB 1RTHB 3SIPB 2EW9A 4M95A 2YKQA 4X4UA 3GCXP 2ZEJA 1P9YA 1QSYA 2LDYA 1FWKA 3UCZP 4RW8B 1Q7LB 1S1VB 1TUWA 1SJRA 4DV2J 3GMGA 3BN4A 3CUNA 3FKBA 2RQCA 5F8MA 4OX6A 1OQ6A 2QA1A 3TAQA 4ZOSA 5DDPC 1T9YA 2MLZA 2VQEF 2XYHB 1TV6B 3LP1A 3R5JB 3UCGA 4NLYA 2J7WA 2JHEA 1SC1B 4DL6A 3EPIA 1W26A 4OHWA 2HS0A 4DL5A 3T5LA 4JV0A 1AFJA 3CPWR 3UCUP 4NZ0A 1TL4A 2GS8A 3HPOA 3H2VE 3NAHA 2FIUA 2N7CA 3DOLA 1N36J 1IBMJ 3CDBA 3D4JA 4ED0A 1K0VA 4NEYA 4ES2A 1QAJA 3UDCA 3UDVA 3I96A 4CLYA 1SIWB 1SKWA 2ROGA 3LOUA 3FBCA 2IFXA 3VCDA 1NK7A 3C3LA 4EMDA 2ZOFA 3FFIA 4JI6F 3FUYA 3TX0A 1CPZA 2GVZA 3LGNA 4NMXA 4YOEA 1T9TA 2ZOGA 3C19A 4P52A 1Q81T 2XI2A 5J2MA 3K5MA 1Q53A 5IFMA 3TQEA 4E0DA 1YBUA 1RTJA 2W7AA 4JV2A 2QX0A 2WHOA 5IV4A 5DGAA 2AV5A 3TJAA 2KYXA 1Q8LA 1RT4A 3FZ2A 3T9NA 2HHXA 2YNIB 3CJKB 2RUGA 2PMHA 5KFDA 2KHDA 1WKKA 3P45B 2M3DA 3M8QB 1KLNA 1XK8A 4KE5A 4LFAJ 3RB3A 2ACMA 4I2PA 5KG0A 3D0GE 1DTTA 4YY3J 4LF2A 3CJ3A 1HKAA 5KFHA 3RB4A 1C1BB 1X4EA 3DU6A 2IBKA 4XIUA 2HZCA 4K5SA 3KLHB 4C0OC 2DGTA 2LMIA 1CBKA 2C2EA 4MT1A 1IVZA 3P49B 3CCTA 4BS2A 4DR3J 2CPIA 2FHMA 3MEEA 1RT5B 2WONB 1EQ0A 5CHCB 1VRQC 4RBTA 5BR8F 2W9CB 1EJ7L 3KHGA 1KLMA 5I3QA 1RT7B 2UZAA 3NS7B 3AAWB 1ACMB 2QLJB 1YRXA 2MDAA 4Z7CA 2NSBA 3TRGA 2HSEB 3PW7A 4V1Ak 2Q79A 3GCWP 4UY8T 1X31C 2WB4A 2MJNA 4DF8A 4MKYA 2Y0BB 4ZVPB 4KQZA 2DNGA 1HWKA 1NSPA 4DI6A 2OJ3A 4OV6A 3MM5A 1HWLA 1E6VB 1EHWA 4ECUA 3I0RB 2K3IA 1X0PA 2R2RA 5HANA 4URQU 3UDEA 1FKOA 4DL0C 2EC0A 4JI5J 2XY7A 2V4RA 1CG2A 4DF4A 1JK9B 2AEJA 4EZ6A 3HVTA 1FEHA 4OX7A 1TL1B 2MGZB 5KFEA 2QGFB 1GMVA 2DNQA 2XO7A 2B4OA 1HD1A 4HKQA 4ZP7A 2PMWA 2BW2A 2HRYA 4OZ3A 3N5BA 3FVYA 4F3MA 2D41A 1YIJS 3IXQA 2HQ3A 2J6UA 1CLFA 3BEGB 4AQYJ 1Q8BA 1VDHA 3KMQA 2M7SA 2WAQD 5C42B 4C0HA 3BS9A 4ZP6A 1GNKA 3D54A 2OAUA 4KC5A 1T05B 3L9ZA 2L9DA 3QMQA 3IFEA 4YB6A 1HNZJ 1WSVA 3GYXB 1Q5VA 2JL9A 4KBIA 1DTQA 1CC8A 4N41A 3GG0A 1XEZA 4F26A 2LEAA 3OR2A 3UN2A 3CNQP 1IN0A 5EUHA 4ECXA 5GMKa 4EYIB 3M4XA 2P6TA 3EVMA 2LQBA 1D09B 1QAXA 1U45A 3BGRA 2E5IA 1OQ3A 1TK0A 3CT9A 2W4CA 1YVFA 4A8SA 3RB6A 1B0TA 2N3OA 1GMWD 5EX0A 2G9OA 4J9KA 1BE4A 1FA0A 3WBZA 3PACA 1MMLA 4DUYJ 4IDKA 3O2IA 1N32F 2OP5A 1N0VC 5D4NA 2FVQA 1NHKL 1VGYA 2UUAF 1HHSA 2J76E 4KGZB 1UZDA 2JX2A 4I6YA 4FXDA 4ETZA 2XMVA 1S9EA 1FTRA 5DS7A 1R8BA 2XY6A 2RU3A 3GV7B 1VBXA 2BE2A 4C4WA 4DG1B 2W7OA 3DHXA 3ZC4A 2DB1A 4WK1A 4CO0A 1CC7A 1G2EA 1HBOB 2FPHX 4I6WA 2UXCJ 5K9FA 2B4PA 1KRPA 2RS2A 4JP8A 4I68A 3PYGA 2RAQA 4PAAA 4ENOA 4USJC 2G13A 3EMTA 3LGMA 3CD0A 4FKXA 1HI0P 2CPEA 2CQPA 3UVJB 4AT1B 2F4VJ 2XC9A 3T1YJ 4M5GA 2HFUA 4NPOA 4L74A 1X9MA 4P75A 1Y4ZB 1J5OA 1TMJA 2DR8A 3KYLA 1X5SA 3RBDA 1AZSA 1MROA 1EP4B 3D6HB 5E7OB 1WNEA 1S1TA 1EETA 1TAUA 1KQSR 3X3UA 3T6BA 1Q8KA 1SC4B 1NAQA 4QPXA 4M5MA 2NREA 3C6TB 4YEAA 2VG5B 4TN2A 4CO5A 1UPPA 3FBEA 3G71S 2FTRA 1PC4A 2CQIA 1NB7A 1SV5B 3TR5A 2WK4A 1VIOA 2RHQB 3NGSA 4GO5X 1UPMB 4P2MA 2ASYA 5KOXA 2HBYB 1S4EA 3Q8PB 2VBYA 2V68A 4KYZA 1Q95G 1UL3A 3GB0A 4GMKA 2F4FA 1YJNS 1TKTB 3EDRB 5C7PA 2VBWA 3I5BA 3KJQB 4JI0F 3OVAA 3M2UA 1TKZB 1S72S 3GU0A 4B3TF 3M2VB 4QPTA 3ETOA 4LSLA 2ASJA 4KB7A 3NRBA 3OLBA 3E8OA 3VAJA 5KFTA 2DNMA 1ZBTA 1IBKF 5BYRA 2MZRA 2W24A 2HNYB 3J7Z5 2QA4G 1BQXA 4OYPA 2MMYA 2DNPA 3MOZA 5J2NB 2VOOA 2AJ1A 2GAHC 4U7UD 3HSGA 4PWDB 3AXKA 4NXNF 5DJBA 3WC0A 2E7XA 3HVWA 4DQPA 2RMLA 5C25A 4TXSA 2HEKA 3RYLA 5E33A 3ICLA 2E5LF 2BBEA 4NLXA 1REVB 2H4WB 2HZVA 3GIJA 1JLAA 2I5JB 2DYAA 3CDWA 3QFWA 5B0DA 3Q8VA 1KN6A 2EKNA 3ZXWA 2CJAA 3GFYA 2IRUA 3N79A 2OELA 2DGXA 1VQ6S 3SSSA 1RYSA 2JEGA 1WI6A 3W62A 4KH0B 2RH3A 4MYTA 4DX7A 1BQNB 1V6HA 4DR2J 2Z2LA 3LP0B 5LMNJ 3DLBA 1RHMB 3ZTQA 2RHSB 2HS4A 1UVMA 3W8GA 4PR6A 2DH9A 1S6UA 4HR2A 2GQ2A 1Y7PA 3PRVA 2AU0A 2QLBB 1XN9A 3HMJG 3ILIA 4P2XA 1V3SA 3G2XA 4OZ0A 1H7XA 2MQLA 2Z58B 3CJ2A 5ETOA 4JI4F 1WF0A 3KJNB 4LSNA 3I87A 1HW8A 4OJ1A 1S9FA 2R7TA 4V19J 4QW9A 4USVA 2R7VA 3GFZA 4OLPA 3JAMY 4B3MF 1CS4A 4N56A 4CO2A 2AD9A 4RJVA 3V4IA 2NPIA 2UU9J 3FNNA 2BJ8A 2RRBA 3H59A 2UP1A 1NK4A 3IC1A 4P9SA 2FC8A 1IKWA 1SKUB 4LRCA 4HHUA 3U02A 3D6FB 1S12A 5L39A 1M0SA 1RKJA 4F0MA 3RJMB 5DM6Q 1X60A 4FDFA 2AJ0A 2B51A 4LR9A 3OXLA 3H2UB 4WBFA 3IWNC 2M0GB 2VBXA 4M8LA 4RUCA 2V94A 3CO0P 3L7OA 1F60B 1LQ9A 2JZ5A 4EO8A 4PUOA 1S59A 6AT1B 3DRRA 1OY6A 3MGJA 1S1WB 2BKPA 4I6AA 1HLWA 3L7UA 5ADZA 5T41A 5T14A 4ZVOB 3BGOP 2HFZA 2Y8WA 2Y1RI 3DLJA 5IT9Y 2R7SA 2D69A 3ZZOA 2XO6A 4LF7F 2XWYA 3HZEA 1HNWF 3T41A 1S1UA 2AP6A 3Q8UA 2UVVA 1CVJA 4P72A 5F8LA 2YX4A 2YWGA 3CCQS 5KG6A 3OFEA 4JUZA 1O51A 5E2QA 1VCTA 4LF4F 3W5ZA 5KFAA 2XBPA 2QFJA 1SL2A 4LVNP 2XB2D 4DV1F 4DV0F 3P96A 4Y2MA 3R1LA 4I56A 1NJIT 1UAWA 2O5DA 3MEKA 4DSKA 3VWSA 1BUXA 4EK2A 1RHQB 3AOAA 3MR7A 3IO1A 1JLFA 3SSQA 4K4TA 2A6OA 1FESA 1S10A 3JTNA 2W4PA 1RWKB 2QO3A 3EGWB 3PEHA 1RT6A 4LF9F 1N88A 3KLEA 1REGX 7FD1A 2R2TA 3I5AA 3OTBA 4A8KA 1JQGA 1ZTTA 1B0VA 1V5IB 3HHLB 1A7GE 4ZLLA 2OPRB 1AYEA 2C22A 3FQKA 4I0WA 1SC6A 2CPHA 1O8BA 1VISA 1Y5LB 3NGKA 5HATA 4DX5A 1JLQB 2BXJA 1BQMA 4BWJA 4Y2AA 4ZK7M 2W8KA 2VG7A 5K14A 1FWPA 2HHTA 4X4SA 3CCWA 1R43A 1KS2A 3QIPB 4AD6A 1WHVA 3QO9B 1S76D 2CVIA 2OD4A 3QT8A 2WOMB 1NKEA 3VAGA 3B6BA 3HFZB 2UXDF 2NPFA 4OV1A 1MU2A 3CJRA 3EE3A 5HROA 5B0CA 1D8YA 2IAJA 5DETA 3V6DA 3RG6A 5H9FK 4C3MA 2XMWA 3KJFB 1RWXB 5D77A 1LK7A 1HL6A 2DIUA 1C1CA 4B9MA 1DARA 1M5HA 2VPZB 1PBUA 4F4YA 3ULHA 4M5LA 1H98A 3IR5B 2V0NA 2LQ9A 1UJ5A 2MQOA 1EQMA 3DOKA 2YX1A 2GVDA 2VA3A 4G6VB 4KAIA 2FHKA 3AB4B 4PXCA 5L38A 4LF6F 2YKAA 1LXJA 1TFYA 2V2VA 3NS6A 4ZCMA 1EX8A 2H9ZA 2HHSA 3AQOA 4MIAA 2IVMA 1O5JA 3H90A 4DPWA 3D5MA 1WDDA 2X1GA 3CJ0A 3HHLD 4QIGA 1BD6A 4QWCA 5HN0A 5DDOC 3RAQA 3FMWA 4D3GA 2LCWA 5LXYA 3SFUA 2GJFA 4MKBA 2WRMA 3CCMS 3NNHA 4C0BA 1VQLS 2RILA 2BZ2A 5LT5A 4RW4A 4CLSA 2MY8A 4DMZA 4ICLB 3K8VA 3VHQA 4EYHB 3H25A 3W61A 5K20B 2MYFA 3MMAB 2QC3A 2PE8A 1NK5A 4B3RJ 2B9XA 3L7PA 1HR0F 4DR1F 4NLWA 4IH6A 4LBHA 4EUVA 4KRWA 2DEJA 1X7VA 3THTA 2EPIA 3GJTB 4YR2A 4A8YA 2F9JA 3M8ZA 2BMBA 5CYQB 2ROEA 3OSNA 2HHWA 4I2QB 3M9NB 2BJ7A 3HSDA 4OZNA 4A8QA 1IKYA 2IPOB 2M8HA 4DSIA 3GSDA 2NZ4A 2K06A 4TY8B 3T1HF 4B9TA 2NUHA 3QLHB 5F8IA 2UXBJ 4FPIA 2ASLA 1AROP 3P8BB 1LW0B 5LSRA 3KJVA 2HGLA 1X5TA 4Q8FA 4DZDA 1OPIA 3DU5A 1I94J 2DHHA 3QBCA 2EEYA 3LAKA 3VGTA 4C11B 2M4MA 3MZIA 1UWBB 4WZQA 4O3RA 2ZKUA 5B08A 2WBMA 2BANA 3ZZZA 1WG1A 3HK2A 3DRPB 1JKHB 2UUBJ 2G2OA 2Y9HA 3AOBA 2CUYA 5IV3A 3KXDA 1K8AT 1B3TA 3QGHA 3ITHB 5IWAJ 3CSKA 4ZCKA 2ZDPA 3PRBA 3J7YI 2C3YA 5AXLA 5HBMA 2Q66A 3ADAC 2MKKA 2CPZA 2B8PA 3GFXA 4CWBA 3BR8A 1HPZA 2RQMA 2D3OR 3WQPA 1T03B 5JXSA 1HARA 1R8HA 3OFHA 2Z56B 1T95A 3MEGB 2HG4A 3GV5B 3W63A 2VBZA 2FC9A 3FMBA 4Q0BA 2DXEA 1WC3A 5HL7Q 3JQKA 2DXDA 3MMBA 3V81A 4XPCA 1AXQA 2B0GA 5F0WA 3MCNA 1UFKA 2K1RA 2MHEA 3VQTA 1ZA2B 1X4CA 5DLGA 4FVCA 4OI1A 1BWVA 2Z30B 2DNHA 3OR1B 3DGPB 2W7PA 3CWJA 3I0SB 4Y2KA 3DYAB 2FVPA 3KNAA 4NMLA 2M8DB 5AE1A 3VAKA 2VDIA 3OT9A 1ZETA 1VQOS 2V67A 4O44A 1X4BA 4N77A 3T1AA 3G96A 2KB2A 1M5SA 4EZ9A 1LW2A 3VALA 2I2YA 2CFXA 2WBRA 1IKXA 2OFGX 4HH0A 1TR0A 3MUTP 4IUFA 1SL1A 5DGBA 2D9OA 3NLCA 4Y00A 3HLUA 5DRKA 4MJKA 4ID5B 2YWHA 4W98A 1N5VA 1MMNA 1S57A 5HO4A 1KR4A 3QT6A 1CJKA 4KR0B 1GT8A 3B4DA 4RNMA 1WACA 2HVDA 1TKXB 4BLGA 4YUDA 1N5TA 3W2WA 2CVEA 3V4MA 3PW5A 1SUQA 4DR5J 3PJWA 2HLTA 2XMTA 3SYZA 1XIQA 1MMDA 2Z2MA 2B4VA 2ILZA 2HRTA 3ZNUA 1NHVA 3UE2A 4DV7J 2VHGA 2MKIA 4AL6A 3NAIA 1HBNA 2IA6A 1NK6A 1E6YA 2L9WA 3N0VA 1CEZA 2UUCJ 4DQQA 4K0KJ 3IGNA 4WYWA 1U2CA 1HYSA 2HGNA 3KMSA 2XCPA 3KUEA 4CH1A 2FLPA 1RT2B 3UN5A 2IM1A 1F9FA 2NS1B 2CQ4A 2WCXA 4JI3J 3DRSA 2HMIB 3O1LA 1RHRB 2B43A 2H51B 4JI7F 1UA1A 4DV4J 1HNWJ 2E44A 1UVKA 5T7LB 4X66F 3FCWA 1S0VA 5FDLB 1UJ6A 4UOHA 1T0TV 3PYFA 5HK4A 3SCKE 4NE9C 4QIFA 2XGQA 3G82B 2BM0A 1Y11A 5G0RB 2F65A 4H4KA 2HWHA 2GIFA 4ZPVR 2B7BB 2M5YA 4GKKF 3QNWB 4DHVA 4WFNQ 1HQUA 3V6HA 1EKRA 1IJFB 4F36A 3THVA 2KT5A 1JMTA 3SV3A 3BBFA 2VG6B 3TZYA 2LLZA 4WFYA 1R8CA 4QOTA 3KHLA 3PHTA 1PJ7A 3TVZA 3S8SA 2HHHJ 2PDAA 3IAM9 1JXVA 1SL0A 1JNRB 4LT6A 5CZXA 3OUYB 3ENAA 3PJ9A 4WE1B 1FJ7A 1RT1A 1EZZB 3MCOA 1HHTP 4J9LA 1FJEB 1NCLA 4ILLA 2DNRA 5JUMA 5ETKA 2DCUB 4MTPA 4ZLPA 4C8OA 3EJMA 5KFVA 3QZ7A 3QAUA 2A2CA 2MQ8A 4RX6A 3GLJA 2ADCA 2KJVA 3DC2A 4WP9A 2F63A 1HQEB 2XG8A 1PIEA 5B7WA 2AZ3A 3DLKB 4DSEA 3NCQA 5FLXU 3M32A 4DSLA 1MWQA 2RF2A 4ZVTB 1JXLA 5HVFA 1H0HB 4EWTA 4NZ6A 1IBCB 1FRMA 1YJ7A 4FS1A 1AUDA 3LAMA 5MAOA 2V8PA 1VQ5S 3BO3A 4FZVA 2AGQA 1KOOA 3ENVA 5CABA 4CTAB 3EUNA 4NA3A 2PSZA 2F7VA 3UN3A 5LXRA 4E8UA 3EVOA 1FE0A 3AA9A 3MM6B 2KH9A 1GMUA 3M1VB 4F8RA 2VPXB 3PZPA 3RTVA 1FJGJ 2QMXA 4OHXA 2HZAA 2A0FB 3O8WA 3C14A 3ZZPA 4GO7X 2HHPA 2GAGC 1X4FA 2R7UA 1NJZA 4KHRA 1RTHA 3LANA 3MMCB 3MECA 4CCHA 5KT4A 4WXWA 4RW7B 5KFPA 3W7BA 5LMUF 4O3SA 2LQ5A 1YLXA 1B0PA 4RW8A 1OPZA 1XMQF 3PW4A 1WC1A 2QE5A 4FVMA 1W7WA 2AZ1A 3TNVA 1TL3B 1U7LA 3HD2A 4JI8F 1NJXA 1RLDA 3BKTA 3M8YA 1X9SA 3H40A 3G86A 3QWPA 1U0HB 1NDPA 3HHLC 4BBYA 3PHEA 1WC5A 2DNLA 4ZVRB 3VR1A 5AXMA 4DR7F 3BO2A 2W25A 5L1IA 2FB0A
chains in the Genus database with same CATH topology
1EAYC 1FFWB 1A0OB 1FWPA 1FFSB 2LP4A 1FFGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EAY C;  1FFW B;  1A0O B;  1FWP A;  1FFS B;  2LP4 A;  1FFG B; 
#chains in the Genus database with same CATH topology
 4HL9 A;  3GTY X;  1VQ8 S;  2DD8 S;  1Y5I B;  1TQL A;  1VRT B;  9RUB A;  3MFH A;  3FRY A;  3M6W A;  1IWA A;  2CPX A;  1R3N A;  2VD3 A;  5CYJ A;  5J2P B;  4Y2I A;  2YQ1 A;  3MD1 A;  3KDN A;  4WU2 A;  3VGS A;  1QY7 A;  1FHT A;  1S7I A;  1XNQ J;  2MHN A;  3AJD A;  2EK6 A;  4J91 A;  1U1L A;  1CJV A;  5D4O A;  2W8L A;  2XMU A;  1SI9 A;  2GO9 A;  3PX6 A;  4CH7 A;  1IBL J;  2VKR A;  2MQQ A;  2AJQ A;  5DZ6 A;  1R89 A;  3K0J A;  5J2Q A;  2NQP A;  5C24 A;  1T02 A;  1JLE B;  1YJ9 S;  4ZVQ B;  1F2G A;  3K57 A;  5GVQ A;  1RAC B;  4USK A;  1M90 T;  2L3M A;  2QLF B;  3I4H X;  3BGU A;  3V6K A;  3J7A 1;  4X4V A;  4HAC B;  4YP3 A;  2IDL A;  2KG0 A;  2DT9 A;  3M8Q A;  3DLG B;  1VQK S;  1TVR A;  1R27 B;  1W2I A;  2PD1 A;  1VQS A;  5E41 A;  2HGM A;  4ZS6 A;  2DGV A;  4R0J A;  3CC4 S;  3NY0 A;  2F1F A;  4DV6 F;  2HND A;  4I1T A;  1S6O A;  5HMY A;  3H5S A;  3N5F A;  4DQS A;  1P1T A;  4ZPW R;  1FD8 A;  3DMJ A;  3D7S B;  2IY5 B;  2ZHO A;  1LWE A;  5GAD U;  2BJD A;  1QJH A;  1D9F A;  4B08 A;  4OJH A;  4UOC A;  1IQT A;  4CLU A;  2KRR A;  4ED3 A;  2P6S A;  1S0N A;  4BWM A;  2WON A;  3FEZ A;  3OL7 A;  2FVR A;  3UQS A;  2XLJ A;  2V2Z A;  2W9C A;  1N56 A;  3DOL B;  2G2Y A;  4NEZ A;  4PWU A;  2E7W A;  5ETL A;  1RT7 A;  2LU1 A;  5IXU A;  3VV2 B;  2BAB A;  2YX7 A;  3M8S A;  4K5R A;  2KJW A;  3A13 A;  3C16 A;  2J0Q D;  4C3K A;  1YGY A;  2FJB B;  1TL5 A;  1VR6 A;  4KGK A;  2CIM A;  2U2F A;  3M6U A;  3R5D A;  2J9D E;  3KK2 A;  2PMZ D;  1KON A;  3KHR A;  3D68 A;  3FFI B;  2AYM A;  4N8N A;  1IM4 A;  2IMW P;  2GVZ B;  3CCS S;  2XS5 A;  1OY9 A;  1GMW A;  2DNO A;  4KH1 B;  1OSC A;  5KT6 A;  2FZC B;  8AT1 B;  3WX8 A;  4PRF A;  2AKW B;  2M52 A;  3KUH A;  2V34 A;  3I31 A;  5KFL A;  4LIR A;  1E6V A;  3GPA A;  3DNC A;  3W5X A;  5J2M B;  1NSQ A;  4CO1 A;  3I0R A;  2DJW A;  3W9J A;  3M9M B;  3Q2S C;  1B70 B;  1RTJ B;  1FF2 A;  4LFB J;  3NNC A;  4DN0 A;  2XSF A;  4PYD A;  2ZZM A;  3QSI A;  5F9L A;  1KKH A;  1S5Z A;  2N82 B;  3MTK A;  3PJX A;  5L46 A;  1KHV A;  3TA0 A;  4TVA B;  2V8D A;  1KFS A;  4QWD A;  3BRE A;  4I2P B;  1UTA A;  4ED7 A;  1DTT B;  2V69 A;  4ZN1 A;  2CG4 A;  2LEB A;  4CLF A;  2D3Z A;  4DR6 F;  4O3Q A;  3I55 S;  5C42 A;  3FC9 A;  1KDN A;  4A48 A;  4OI4 A;  2V50 A;  1G1X A;  3D67 A;  2JOQ A;  3IMQ J;  3ZZR A;  4MYU A;  2XZD B;  2LYV A;  4LF8 J;  3U7J A;  5A8W A;  4P7T A;  4ZVS B;  2YXL A;  4RZR A;  4UQG A;  3KLI A;  1C0T B;  2PA8 D;  2NR0 A;  2C2N A;  3GFH A;  3MPV A;  1VC5 A;  2H3E B;  4IFY A;  7FDR A;  2CXE A;  1RAF B;  1UW9 A;  4ECW A;  2FLO A;  4MK7 A;  4F3Q A;  3D6M B;  1J5E F;  4CQ1 A;  3ZZ0 A;  3PM9 A;  4WIQ A;  2FVS A;  1S79 A;  3K8W A;  2UUW A;  2YH0 A;  1HWJ A;  4DS4 A;  1F1B B;  4B9N A;  2ZBP A;  1MN9 A;  3I9Z A;  2VFS A;  1U49 A;  3C15 A;  4PG5 A;  3WHI A;  2L48 A;  3MM5 B;  1XMB A;  2EFO A;  4R25 A;  4F4A A;  1FRX A;  4C8M A;  5HMX A;  3M9O B;  4IRK A;  4YHH J;  4KHP J;  4RPF A;  3JQJ A;  2CDR B;  2P5V A;  2GMH A;  1R0A A;  2ZNZ A;  2YNG A;  4F4X A;  1FKO B;  2OPS A;  4DG1 A;  2IYI A;  5DQI A;  4ZIW A;  4WP3 A;  3THP A;  4PG8 A;  2EFG A;  3HHK A;  5EWE A;  3HSJ A;  2R8G A;  2X1F A;  5KG7 A;  1RHU B;  3LO3 A;  4X64 J;  3WIU A;  1S99 A;  1YWX A;  1SJ3 P;  2ZE2 A;  3GIR A;  3TW0 A;  3SSR A;  4DL3 A;  2VJV A;  3TUZ C;  2PI5 A;  3UVJ A;  3DOM A;  1V5V A;  4O3O A;  1YZ7 A;  2H5I B;  1XWL A;  1IUJ A;  4ZVH A;  3CCE S;  1UZH A;  1RHJ B;  4ZJQ A;  2RT3 A;  3U1M A;  2CZ4 A;  2YPZ A;  3BJY A;  4DV3 F;  3M8P B;  1EB0 A;  3UR3 C;  4DR4 F;  4NLO A;  3JSR A;  3QGI A;  4X2B A;  2KXH A;  2MZS A;  1NPK A;  1BWE A;  3OR2 B;  4BDP A;  1ZZN A;  1TEL A;  1YX2 A;  1XR7 A;  2FDN A;  4J90 A;  3G4S S;  1XR6 A;  4DUZ F;  3Q24 A;  3AH6 A;  4QCL A;  4AYB D;  2MLX A;  1GH8 A;  2Z2Z A;  1U4B A;  1UP1 A;  3MDF A;  4P74 A;  3BGR B;  2I38 A;  2CNN B;  4NI2 A;  3AA8 A;  4ERD A;  2ZFH A;  3OFF A;  1NND A;  4IQM A;  2Y0S D;  4IDK B;  1TKT A;  3R5G A;  2J0S D;  4UUW A;  3GWC A;  3VGU A;  4MMO A;  4DLE A;  1WF2 A;  3MPU B;  4LBP A;  3M2V A;  3FBF A;  3KNG A;  2KTQ A;  3AJ2 A;  4PPZ A;  4B9V A;  3J81 U;  1X4D A;  1S9E B;  5ETR A;  1WC4 A;  1Q4R A;  2HNY A;  5HQL A;  5J2N A;  4RBU A;  3B82 A;  4FBT A;  1N4L A;  3RB0 A;  1GX5 A;  2BM1 A;  4B9S A;  3POT A;  4DU8 A;  1XER A;  3MAH A;  3Q8R B;  5AE3 A;  2A2D A;  1U2R A;  3MR6 A;  2VV5 A;  4J9S A;  5E3C A;  2KHC A;  1FDA A;  3EZU A;  3IG1 B;  2VU5 A;  5JMN A;  4V19 X;  2VPY B;  1TK8 A;  1PYT A;  2AYE A;  3AQP A;  1HW9 A;  3DXB A;  2VFV A;  4P2S A;  1J5O B;  3LP0 A;  1VJW A;  1AZS B;  4ED4 A;  4QR1 A;  1IKV B;  3OXG A;  3R6L B;  1ZA1 B;  2CQ1 A;  4YDD B;  4UUX A;  3CD7 A;  3AD7 C;  3M30 A;  1EET B;  4Q2L A;  3GJQ B;  2BE9 B;  1RGV A;  1FDB A;  1P1L A;  2OPP A;  3IRW P;  2BV3 A;  4JV5 J;  5LJ3 Y;  4KFB A;  3HDS A;  4K8R A;  2KFY A;  4EBD A;  5KFK A;  2HFO A;  2JFK A;  2Q43 A;  1UJ4 A;  5H9F J;  1DAX A;  3H0P A;  2ZNY A;  9ATC B;  4K4V A;  1XNR J;  5F0U A;  2WB1 D;  1VQM S;  2UUT A;  1RXO B;  1PCA A;  2GHP A;  5C5J A;  2XNR A;  1JJH A;  1SQF A;  2C3M A;  2LQJ A;  1OYD A;  1WEX A;  3TQ1 A;  3G8Q A;  3CJS A;  3M2U B;  4CT9 A;  3V5R A;  5THW A;  2DY9 A;  2ZH9 A;  4GRS A;  2XUL A;  4LSL B;  4HYK A;  1K1Q A;  2ZJQ Q;  2HBR B;  2J7K A;  1RSC A;  4MKV A;  2KI2 A;  4L73 A;  4LRA A;  4X4N A;  2HPU A;  1SVD A;  2CAJ A;  4LBI A;  3RW7 A;  1HNX F;  5C25 B;  2LKZ A;  5HLF A;  4NOH A;  2HFS A;  1IM6 A;  3QFH A;  2ZVI A;  4PAB A;  2CWK A;  3WZ0 A;  5L1L A;  2ZWP A;  3I6P A;  2E5G A;  4GKJ J;  5KFQ A;  2IYG A;  1PGZ A;  4DSJ A;  1DLO A;  5K8O A;  2RKI A;  2HHV A;  1NUE A;  4H54 A;  2OH2 A;  3H8Y A;  3W3S A;  3MHY A;  1K1S A;  1RAG B;  4KO0 A;  4N76 A;  4S0M A;  4X65 F;  4WF9 Q;  4HT7 A;  4FXW A;  2ZH2 A;  2ERR A;  3L3C A;  2Q1L A;  4U9R A;  3TEH B;  1S6P A;  3CJ8 A;  4F25 A;  4O3N A;  2B56 A;  3DDN A;  3I5C A;  4MIB A;  2RDJ A;  3R9L A;  3K5P A;  4QR2 A;  1S49 A;  3CJT A;  3A4T A;  1NK8 A;  1LWX A;  1OIA A;  4OYX A;  3PO4 A;  4ZJO A;  1EIY B;  2VAS A;  1N34 J;  3GV8 B;  5KOW A;  3A8I A;  4NXM J;  2M70 A;  3AD9 C;  4U95 A;  5KFC A;  3N6L A;  4DJB A;  1YRT A;  3ENW A;  4LSN B;  3SDE B;  3Q89 A;  3TP2 A;  1H2T Z;  2J0W A;  4AXI A;  3TAM A;  2O66 A;  4DSF A;  4CIO A;  1ZYQ A;  1CS4 B;  2PFF B;  1TFW A;  3QJL A;  2DXF A;  4UT4 A;  4NLD A;  1PAU B;  3QJJ A;  2OPR A;  1RB0 A;  2BAC A;  3PFO A;  1EKS A;  1JLQ A;  4WFX A;  5D0E A;  2HFN A;  2M9K A;  1LV5 A;  5KFI A;  4JYA J;  3Q23 A;  1ZAW A;  4IH5 A;  3NXZ A;  3IR7 B;  2MQM A;  3M7V A;  1L3S A;  2HRU A;  1T9U A;  4ZKA A;  2R7X A;  1A9N B;  1U1Q A;  4R5P B;  3QO9 A;  1U48 A;  4JI2 F;  2AMC B;  1GTH A;  4XAK A;  2WOM A;  4USM A;  1WDT A;  1H6K X;  1VFJ A;  3M8W A;  4X4T A;  5D3G A;  1H73 A;  5F41 A;  2R2S A;  1N48 A;  4YB5 A;  1HHQ A;  3DRR B;  2GX8 A;  3E3X A;  2D1C A;  1U8W A;  4XPE A;  2IM3 A;  2LXU A;  5I3U B;  4HH1 A;  5GAD I;  3N28 A;  3MAA B;  3TX8 A;  1N33 F;  1UET A;  4CM0 A;  2XY5 A;  5IOL A;  3HKW A;  1EAY C;  3OJU A;  4CI0 B;  4W4M A;  4ZPT R;  5AJ3 F;  2X1B A;  1S1U B;  3KOA A;  4Z2X A;  4OQJ A;  4ER8 A;  2CZ9 A;  3GON A;  4JI1 F;  3Q8Q B;  4RNN A;  1FFS B;  4B3S J;  1RLC L;  3BSO A;  3KFW X;  3QGG A;  1D9D A;  4IYQ A;  1Z1Z A;  2NYI A;  1WEZ A;  2ZKT A;  3HJV A;  3W9I A;  2X1A A;  2K7K A;  2B9E A;  2H1Y A;  3CDE A;  4LF5 J;  1Y00 A;  4LIW A;  2AQ4 A;  3VF0 B;  2I0X A;  3SCJ E;  1F5C A;  2IM2 A;  3GR1 A;  2GZO A;  2H5E A;  5F8J A;  3HX9 A;  3FJ2 A;  3GJR B;  1DRZ A;  2BJE A;  4L76 A;  2MZ1 A;  4NA1 A;  1JLC A;  1GTE A;  3VQS A;  5E3Q A;  1RWP B;  3R3T A;  2QSF A;  3RBE A;  1FT8 A;  3OLA A;  2HFV A;  3J80 Y;  3JXO A;  3R5A A;  4ICL A;  1DHM A;  5GME A;  2AW0 A;  1U1P A;  4OHV A;  4OJG A;  2VG7 B;  4ZPC A;  3MMA A;  1WEY A;  2IC3 B;  3JYT A;  1SJ1 A;  1XR5 A;  5K14 B;  3HF5 A;  1KC8 T;  3PX4 A;  2FD2 A;  2PT0 A;  3ILL A;  3P6Y C;  1WG5 A;  3ZTP A;  4LFC F;  3VAM A;  1P27 B;  2WVF A;  3L95 X;  3FZB A;  3KLF A;  5F8G A;  2LEC A;  3R97 A;  5CYQ A;  1MN7 A;  4I2Q A;  2AX1 A;  2KFZ A;  2CPD A;  1RI7 A;  4HT5 A;  3OV7 A;  1FXD A;  1MU2 B;  1HWI A;  3IAS 9;  5HRO B;  4PCQ A;  2KM8 B;  1W25 A;  2IAJ B;  2ZM6 F;  3V6D B;  3X1L B;  2FHO B;  1ZM2 A;  3VZI A;  1GXL A;  4HI1 A;  3CJQ A;  2KXF A;  1C1C B;  1N54 B;  3ILJ A;  1HA1 A;  2VQF F;  4OX9 J;  1UWA A;  4DUT A;  1FFG B;  4TLQ A;  4PZV A;  2CDQ A;  3HI9 A;  2F8E X;  2YKM A;  4C11 A;  1SC3 B;  2FHJ A;  2J9E A;  1JLG B;  1NZA A;  5J1P A;  2FYX A;  1TZ0 A;  4YR0 A;  4CLK A;  4K4X A;  3DRP A;  4B3O B;  2J9C A;  1H2V Z;  3GIK A;  2XMJ A;  2GNK A;  3HZG A;  3C8Y A;  2HYI B;  1TKD A;  3MD3 A;  2QYG A;  4DV5 J;  3ITH A;  4OYO A;  3DDI A;  4DV2 F;  5EGY A;  5KAK A;  2OMO A;  1R6Y A;  4NLR A;  2D74 B;  2FJX A;  4OLO A;  1TTH B;  3IM8 A;  1PO6 A;  3GYN A;  2SXL A;  3JSM A;  1NSK L;  5D15 A;  1S1X A;  2DO0 A;  1CUL B;  3PR5 B;  2FY1 A;  1ZOT A;  2ZH7 A;  1QTN B;  2BOP A;  2JC0 A;  5JVG Q;  3TUI C;  2WSE C;  1FDD A;  3MEG A;  2P8I A;  2VPW B;  2XMM A;  1OS5 A;  4EO6 A;  4RW4 B;  4A8X A;  1K0T A;  1UW4 A;  3K59 A;  1NEE A;  4QWA A;  4NL5 A;  1FX2 A;  3QID A;  3R8Y A;  4AFF A;  1N36 F;  1PYO B;  4ID8 A;  1IBM F;  4N5S A;  3J7Y U;  2D3O 1;  1BHN A;  3NWG A;  2RDD A;  1KHW A;  2C3O A;  5A6W A;  3ZTO A;  3CCZ A;  2OTL S;  5KFN A;  1UFW A;  3C66 A;  3OHB A;  2V2K A;  1FK9 A;  5CYM A;  4C8L A;  3B8H A;  5BYQ A;  4M5D A;  1IKY B;  4IG3 B;  2B4U A;  3OD2 A;  3AB2 B;  4DEZ A;  1NJY A;  3CF5 Q;  5AT1 B;  2FJV A;  4FP9 A;  2P9E A;  3I0S A;  1FKP A;  2OPQ A;  4W92 B;  1DY3 A;  1MG7 A;  4RNO A;  2E29 A;  3Q83 A;  3CCV S;  4IFV A;  3J81 j;  4GVB B;  4ZDN A;  1B4S A;  1L3V A;  5IQ6 A;  3RAM A;  4ILM A;  2F5G A;  2VKZ G;  4F0K A;  1FD2 A;  1ZPV A;  1AA1 B;  3KJV B;  4HI2 A;  4NZ7 A;  3LP2 A;  1KQF B;  3K58 A;  4F2R A;  4RW6 A;  2JVR A;  5IC6 B;  2C2R A;  2MY7 A;  2QL7 B;  4Y28 C;  4OYM A;  3JSY A;  3TJ8 A;  3KDO A;  5KG1 A;  2BRK A;  2VFU A;  4X62 J;  4MK9 A;  2OHD A;  2AT1 B;  1FX4 A;  4LFA F;  4DZ6 A;  1CJU A;  3J7Z T;  2HK3 A;  2AIR B;  2CWX A;  2MZQ A;  3G8T A;  1PJ5 A;  1LNQ A;  1WOO A;  4YY3 F;  1KQK A;  4RU2 A;  2RSQ A;  4QJV A;  2EFV A;  1QM9 A;  3VAF A;  5HBM B;  4HDH A;  3CUL A;  4DLG A;  3BM7 A;  4RW9 A;  2VIC A;  2YPY A;  1HPZ B;  2ZH8 A;  2XZT B;  3M05 A;  3C2P A;  2EG2 A;  2VA2 A;  3LW5 C;  4WZM A;  1FNX H;  4O0I A;  5ETT A;  4DR3 F;  3SV4 A;  4I7F B;  5MLC V;  1NH7 A;  4B02 A;  2G4B A;  1RT2 A;  3MM9 B;  1T94 A;  1XMO F;  3MMB B;  4TY9 A;  3V81 B;  1I6J A;  3OTO J;  2YQ3 A;  1F2H A;  4U6P A;  2IVY A;  3LWM A;  2DNY A;  5ETN A;  2IHR 1;  2JLE A;  2FUG 9;  3H4D A;  2HWT A;  1RWU A;  1YBT A;  2EI5 A;  4Q45 A;  4M5K A;  2CJY B;  1NZ8 A;  5K8M A;  3QQC D;  2YTC A;  3R2C J;  1F3F A;  3OBI A;  1KVK A;  5FD1 A;  3M6V A;  3QJP A;  2V2Q A;  1TL7 B;  3PY8 A;  1LWF A;  4L6V 3;  2J5A A;  1N5S A;  2I8E A;  2ZD1 B;  2COL A;  1QAY A;  1YJV A;  3IRX B;  1Q1K A;  2PII A;  5G0R A;  4DXL A;  2MSS A;  3QT7 A;  3BSN A;  4LRE A;  4JV1 A;  2AF6 A;  1BXN A;  3BN7 A;  3NP5 A;  5HQ8 A;  3DLE A;  5IT0 A;  2AGO A;  1P6T A;  2VQE J;  1GEH A;  4RR5 A;  2J6T A;  5IQQ A;  1VLO A;  2VG6 A;  3FK4 A;  3MM7 B;  2DGS A;  2J9D A;  5DG9 A;  5HSP A;  4O0N A;  1N5Y A;  1LW2 B;  4DQR A;  4Z37 A;  4DWI A;  1QE1 A;  4NCG A;  2N4C A;  2BYC A;  2IA0 A;  3ONQ A;  2C2M B;  4JI5 F;  4J9U E;  1KTQ A;  2MKH A;  4QU6 A;  5HP1 B;  4K4S A;  4YME A;  1OSD A;  2CQD A;  1XTZ A;  3EM1 A;  1RAH B;  4HTI A;  3QAT A;  3EGV A;  1G7C B;  2DEI A;  3ENQ A;  2JNJ A;  1ZM4 A;  1CJK B;  3TEG A;  3CDA A;  2CQG A;  4Q8E A;  3W2W B;  4JI6 J;  3BYP A;  4AQY F;  1T7P A;  2F8H A;  4DCJ B;  2H48 B;  2HK2 A;  2ADB A;  3FRZ A;  2ASD A;  2W1B A;  4KGV B;  3TZW A;  1U1N A;  3MR2 A;  2X3G A;  3RR7 A;  1VI7 A;  5F8N A;  2W2O P;  5A2Q Y;  3EPG A;  1WOS A;  1HBN B;  2DGW A;  1E6Y B;  1VQY A;  3EGZ A;  1RDR A;  2E9T A;  1MSW D;  4LR8 A;  3PYD A;  1HNZ F;  3DCA A;  3HT0 A;  1Q0N A;  4PQU A;  2OKQ A;  4A47 A;  5A76 A;  4KSE B;  1S6Q B;  4FF1 A;  1S97 A;  1CJT B;  4F4Z A;  2HQC A;  4CTA A;  3ZTS A;  2O1P A;  3DRS B;  4QWB A;  3JAM U;  1H7W A;  1NKC A;  3OTE A;  4K4Z A;  2E5H A;  4C6A A;  4CZC A;  3NNA A;  4DCO B;  1C2P A;  3T9Z A;  3MM6 A;  3RBZ A;  3A3O B;  3M1V A;  1UMJ A;  1NDC A;  2GMJ A;  1LWC B;  2KKH A;  4AUK A;  5B0B A;  3Q0A A;  4DUY F;  4Y3C A;  4ED8 A;  3RUB L;  2DR7 A;  4FF3 A;  4R0E A;  4FF2 A;  4BC9 A;  4QQB A;  5GMD A;  4DL7 A;  1RBL A;  3BQ1 A;  3OHA A;  2DY1 A;  3NMR A;  1RTD A;  5RUB A;  5CA5 A;  4A8O A;  2ATL A;  2GW8 A;  1V3R A;  2HVH A;  2CKW A;  1RU2 A;  3PW2 A;  3A3N B;  4A8W A;  4A8M P;  4KV8 B;  1OY8 A;  1VHF A;  1X0F A;  5BR8 J;  2WVE A;  1Q16 B;  3UI3 A;  4NWB A;  3G87 A;  1MLA A;  2C1E B;  1TL3 A;  2KRB A;  3L4B C;  3W2V A;  2UXC F;  5IT9 U;  1T9V A;  2GIQ A;  3HP6 A;  3MM8 B;  3FCH A;  5KFS A;  2AEF A;  4P7V A;  3QPI A;  3CME S;  2ZH3 A;  2QG9 B;  2YKO A;  1ZTW A;  5L9X A;  3F56 A;  4CNY A;  1RBA A;  1QVG R;  2QV6 A;  5KFG A;  4DFM A;  2F4V F;  3T1Y F;  1ZAX A;  1SJQ A;  4ED6 A;  4ECZ A;  4LFC J;  2PO4 A;  2OUG A;  3H4B A;  3HJF A;  3UFC X;  5JVH Q;  1GQE A;  2R8I A;  4DN9 A;  2OI2 A;  3BO4 A;  2WZ1 A;  1XC9 A;  1R6V A;  4AXJ A;  2DIS A;  3M6X A;  4L72 B;  4NCA A;  2YNH A;  2A1B A;  1WTF A;  4NRT A;  4Z7Y A;  3E01 A;  2B6A B;  3KLG B;  4J9N A;  5CCL A;  3R5B A;  1RTI B;  4U67 Q;  2P9G A;  2KVI A;  5KFZ A;  5GAG U;  1WG4 A;  4Q44 A;  4TYA A;  5EWG A;  1Q7Y T;  1I3O B;  2BE7 D;  3C14 B;  3QGP A;  3O6Q A;  1O0P A;  1H3D A;  1HMV A;  3HVR A;  3Q8Y A;  4WPA A;  2HAF A;  4N7T A;  5IM0 A;  3MEC B;  2ZHA A;  2Y1I A;  3OTD A;  3ISZ A;  4BHQ A;  4HAC A;  3G6Y A;  3Q22 A;  4CLP A;  4YDX A;  1K73 T;  4HHJ A;  3NGU A;  2OFH X;  1JWW A;  3DLG A;  2C2K B;  1KVJ A;  4PXD A;  2OIH A;  1RTZ A;  3R7B B;  2B9Y A;  4C8K A;  2M2B A;  2W9B A;  2JEI A;  2CJQ A;  4WII A;  3NGD A;  1QUP A;  3GE9 A;  4QIE A;  1T11 A;  1VMB A;  3NBP A;  3CCJ S;  4WK3 A;  4ECT A;  4K59 A;  2HBQ B;  4YR3 A;  3I32 A;  2NXJ A;  1W2B R;  1K44 A;  2HQF A;  1G6B A;  3DM2 A;  1VYA A;  2M88 A;  1VQ4 S;  2E5J A;  2VH7 A;  2Z8Q A;  1H2U X;  4ED2 A;  2F3J A;  2ZBQ A;  3MPD A;  2V4Q A;  1N6Q A;  1R8P A;  1N32 J;  2LA4 A;  2DNZ A;  2WW8 A;  1L3K A;  1VC6 A;  2NSC A;  3UW1 A;  2KO1 A;  5LJ5 Y;  2UUA J;  2LQ8 A;  5KFF A;  2OLW A;  4DR2 F;  3S1T A;  5LMN F;  2U1A A;  4WKR A;  4ITS A;  2RU9 A;  2LDI A;  3GIM A;  4FYV B;  5J1N A;  2YNF A;  1YSJ A;  3IS9 B;  2O01 C;  4IRC A;  1HNI B;  2LP4 A;  2Z57 B;  1FJC A;  4CLT A;  2I9S A;  2GC8 A;  2C3U A;  5SZT A;  1JX4 A;  1RK8 A;  1SQE A;  2E9R X;  4J9P A;  5ETV A;  1CJV B;  5LOQ A;  4UST A;  2KM8 C;  3PR4 A;  2ZZT A;  5FII A;  3TZZ A;  2WSF C;  3AD8 C;  2B5J A;  4FYX B;  2QZ8 A;  2CJK A;  2AWZ A;  2EXU A;  3ILO A;  2XWX A;  3LUY A;  2YQ0 A;  4EGL A;  5J2Q B;  4RUA A;  5ETP A;  3PRD A;  5C24 B;  3TYT A;  2VC0 A;  3NCR A;  3IN5 A;  3C6U B;  4MH8 A;  4XDC A;  2LA6 A;  2QLX A;  5K8N A;  4JOU A;  2JC1 A;  2JDJ A;  3N9U C;  3P5B P;  1A0O B;  1OMS A;  2UU9 F;  2DHA A;  1RA7 A;  1YJU A;  2EVZ A;  4I4B A;  2GJ2 A;  3D1H A;  3FEX B;  5EX3 A;  3WX4 A;  3BR9 A;  4U7C A;  2YKP A;  1SH3 A;  1TVR B;  1Q86 T;  5FJ4 A;  4ZN3 A;  4JB8 B;  4YB1 P;  4DPU A;  2G2Z A;  3RR8 A;  1D3W A;  3MCM A;  2AHO B;  1U6B A;  2WW4 A;  3LPY A;  1H74 A;  2HND B;  1F9H A;  1K47 A;  3PYE A;  4P2F A;  3MUR P;  1WC6 A;  2GO8 A;  1C4A A;  3TA2 A;  3DMJ B;  1N0U A;  4TU7 A;  1LWE B;  4J37 A;  1TU0 B;  1TK5 A;  4AE5 A;  1WTB A;  2VFT A;  3KUG A;  1BLU A;  1IR0 A;  1C0T A;  3TAN A;  3E2E A;  1XMO J;  2HVE A;  2HVI A;  1AUS L;  2MPU A;  4JI0 J;  4ZP9 A;  3ZZU A;  2HW3 A;  1NSA A;  3PVX A;  4K4Y A;  2I6W A;  4B3T J;  2MKJ A;  1NH8 A;  4YQW A;  4AL7 A;  3C16 B;  4WFB Q;  3NEK A;  2ZH6 A;  1IBK J;  1WHW A;  3K5N A;  3KK2 B;  1RYR A;  4LRF A;  1PIL A;  1FO1 A;  4WU3 A;  3CDU A;  3VVT A;  2N3L A;  4NXN J;  3UNY A;  2EFP A;  4PG6 A;  2O67 A;  1OYE A;  1NKB A;  2E5L J;  3SXL A;  3E51 A;  3R2D J;  4OZL A;  1UVN A;  2X7I A;  2DNK A;  1HBM A;  3FEY B;  2HKE A;  4K2X A;  3BDE A;  2OEK A;  4KIA A;  3G6V A;  1LFP A;  2CQB A;  4NYO A;  2JEJ A;  4OX8 A;  4H4M A;  5CD4 A;  3H42 A;  2GCF A;  3GSI A;  2V8G A;  3DI6 A;  3H5Y A;  5HAO A;  1KFD A;  3HSZ A;  3QYY A;  2PN6 A;  2YKN B;  1MNE A;  1KSP A;  4F3O A;  1KEK A;  3OVS A;  4CO3 A;  4C48 A;  1SKR A;  2OEJ A;  1LOU A;  1TUG B;  4R8U B;  1AW0 A;  3I82 A;  1NRK A;  2FJA B;  2BKO A;  2KXN B;  3T5H A;  4WXO A;  5CD4 H;  3SCI E;  2XSJ A;  1WF1 A;  1X4G A;  2FJW A;  2HQD A;  2ZJP Q;  5B0G A;  2V4J A;  4G1I A;  1HWU A;  4UY8 5;  5KFR A;  3ZTR A;  2ZH4 A;  4JI4 J;  3CC2 S;  4K50 A;  1VRU A;  2GGP A;  4Y65 A;  2J8A A;  3M8P A;  3PFE A;  2HLU A;  3GZ7 A;  5K5M A;  3IBC B;  1FCA A;  4M1K A;  4B3M J;  1R31 A;  5A8W B;  2KDO A;  1S9G A;  4G1Q A;  1YIT S;  3KLI B;  3CJ4 A;  1S7H A;  3IGV A;  3SEO A;  3FSY A;  2MTL A;  4IFY B;  3AHP A;  4FNH A;  4NLT A;  2KZZ A;  1VQN S;  2MST A;  1TUV A;  2XYP B;  3HO1 A;  2YWE A;  1JLB A;  2Z4P A;  4OYW A;  1CQN A;  4CNZ A;  4MFB A;  1RKI A;  4FYD A;  2BA9 A;  3G6E S;  4I67 A;  2H5J B;  1GAO A;  1VC0 A;  3KG0 A;  4WKY A;  2HVZ A;  2ABY A;  2XYG B;  4DL4 A;  1JXE A;  4ZHR A;  3UO0 A;  1WUU A;  2V6A A;  1RWV B;  3C15 B;  1M5V C;  5I42 A;  1Y5N B;  2RDI A;  4CP5 A;  5A8K B;  3M2R A;  1RQ0 A;  4ELV A;  1S4F A;  2B9W A;  3CXC R;  2LVW A;  4C8N A;  2R2U A;  1R0A B;  1QSL A;  2DK2 A;  2YNG B;  3CMA S;  4C8Z A;  4IOB A;  2OPS B;  4LF7 J;  4ILR A;  1F6T A;  3MUM P;  2OSQ A;  4C8Y A;  3SQO P;  3NGR A;  4X4O A;  3G6X A;  3CVK A;  3B4M A;  5A0Y A;  3K5O A;  5LSL A;  2EK1 A;  4MAK A;  2C2O B;  1WHX A;  4LR7 A;  2X51 A;  2DGQ A;  4WCE Q;  1HBU A;  3TUJ C;  2V63 A;  1PAE X;  3KK3 A;  4FYY B;  1VK3 A;  4LF4 J;  1KP6 A;  3IG1 A;  4B3R F;  2DHS A;  4ES1 A;  4G1P A;  1BGX T;  1FI4 A;  2ZE2 B;  1U1M A;  4DV1 J;  4H4O B;  4ED1 A;  4DV0 J;  5BYS A;  3CB4 A;  3OPK A;  2BOA A;  3DOM B;  1P9Q C;  4OI6 A;  2UVU A;  3CE8 A;  2JFD A;  3CCR S;  3KK1 A;  2HQG A;  2FVC A;  3OL8 A;  1PYS B;  4O4G B;  5A8R A;  1IKV A;  3DRY A;  4DPT A;  3K89 A;  1VHI A;  3UWT A;  3OTC A;  1RAI B;  4LF9 J;  4OZJ A;  4C3L A;  2QN6 B;  4L75 A;  2AJF E;  4M5J A;  3LF0 A;  2UXB F;  2XI3 A;  3MAQ A;  1P8G A;  2R3V A;  4NLG A;  3LQV A;  1LFW A;  3MPY A;  1IWG A;  4OFZ A;  2MJU A;  2C42 A;  3A3P B;  4NI2 B;  1VBY A;  2IJF A;  1NDL A;  4LMZ A;  4J7C A;  2XQC A;  1I94 F;  4UOG A;  4RNF A;  2PEH A;  5DQH A;  2P2C B;  1ZAV A;  3K7R A;  4LQ9 A;  5E5N A;  1C0U A;  2DH8 A;  4IG0 A;  3FGV A;  2BQR A;  4USH A;  2HNZ B;  4BCA A;  4B9U A;  4H4K C;  1LEO A;  4RWW A;  2UUB F;  2RIJ A;  2CYY A;  3W66 A;  2UXD J;  4EBC A;  3ET6 A;  3LWL A;  5J1E B;  5IWA F;  3EDQ B;  2PC6 A;  1V9O A;  2JJ4 D;  3W1Y C;  3F44 A;  1YK9 A;  2EWH A;  1UEK A;  1VOM A;  2R7O A;  2Y8Y A;  4BC7 A;  4USI A;  2R8J A;  1HI1 A;  1QVF R;  1PJ6 A;  2QL9 B;  3W9H A;  1HNV A;  4DDF A;  3RAX A;  3RRG A;  2FGO A;  1NO8 A;  4TU8 A;  1DQA A;  3VAH A;  4KKO A;  3POT B;  2G0C A;  1RT3 A;  3F73 A;  3BH7 B;  3GG1 A;  2MZT A;  2W2M P;  1U47 A;  1B7F A;  4OI3 A;  4LF6 J;  1FXR A;  3EXY A;  1NJW A;  1PSD A;  4F50 A;  3ZO7 A;  4EEY A;  3HD1 A;  1U24 A;  4J9Q A;  4FBU A;  4ALZ A;  2WTF A;  2ALY B;  3GJS B;  3MWB A;  5KFU A;  1S1V A;  2IM0 A;  1M1G A;  1VS3 A;  4XK8 C;  4OIX A;  4CYU B;  1GK8 A;  3UD5 A;  4DQI A;  5D4L A;  1ELO A;  2BDP A;  3M30 B;  4Y2C A;  2IBO A;  1U25 A;  1Q78 A;  3BF4 A;  1WJ9 A;  2OPP B;  3MED B;  3JQM A;  3JTP A;  1TV6 A;  1D8Z A;  3Q8S B;  3H5U A;  3QRP A;  3UD4 P;  2E9Z A;  2QYC A;  4KFB B;  2CQC A;  3TZX A;  2Q6C A;  3QZ8 A;  1M5P C;  4KPY A;  1Y3J A;  2EKY A;  3SDE A;  4L3K A;  2POK A;  3CJ5 A;  4Q7A A;  2C28 A;  3PX0 A;  4Q5V A;  1HR0 J;  2P9C A;  1JJC B;  5GAE U;  5GAG I;  4DR1 J;  5ITH A;  3HHN B;  1V3Z A;  3PG9 A;  3SQG B;  2AYB A;  1VK8 A;  3DLL Q;  3EYZ A;  1URR A;  1R0B G;  4IOA Q;  2R4F A;  1BY9 A;  4QU7 A;  4ZIV A;  3Q2T C;  4DFJ A;  2DHG A;  3KG1 A;  4DR5 F;  2J8S A;  4IRD A;  8ATC B;  3T1H J;  1QAI A;  4YN3 B;  3D1Q A;  1FXL A;  4DV7 F;  4HVZ A;  4OYA A;  1J27 A;  4DU7 A;  4IO1 A;  5H9E K;  4R5P A;  1RWM B;  3UPF A;  2UUC F;  1LKZ A;  4K0K F;  1M1H A;  2G0J A;  5HLF B;  2K8G A;  1RAE B;  2VDH A;  2FGC A;  3KKF A;  4DL2 A;  2BQU A;  5I3U A;  4JI3 F;  4ZCI A;  2VUG A;  3MAA A;  3H2L A;  2CQ2 A;  1KD1 T;  1Y3K A;  1JNZ B;  2YNI A;  1DLO B;  3AT1 B;  2RKI B;  3CJK A;  1YTY A;  2DR6 A;  3W65 A;  3C46 A;  4EBE A;  5CXT A;  4DV4 F;  2R7Q A;  4LJM A;  1NPP A;  2MXY A;  4ECY A;  4KO0 B;  1SXL A;  4N47 A;  4ZVE A;  4CLW A;  4NA2 A;  3GP9 A;  4I64 A;  2XM3 A;  1S6P B;  3JB9 k;  1R7I A;  1C1B A;  3PKM A;  4OZ2 A;  4ZIT A;  2XHC A;  3TI0 A;  4NRU A;  2FZK B;  3SZ2 A;  2CG8 A;  3KLH A;  5ETM A;  2JVO A;  1ZM9 A;  3BQ2 A;  3LP1 B;  2NZC A;  2YWK A;  3BSA A;  4C98 A;  5KG2 A;  1OWX A;  1QTM A;  1WOR A;  2HHH F;  1NBE B;  1JIH A;  4X4P A;  1Y10 A;  2OEM A;  3BKU A;  1RT5 A;  3EX7 B;  4U8Y A;  5EDW A;  1RWW B;  4TU9 A;  3TAM B;  4OL8 A;  2GML A;  1IXK A;  3AOD A;  2DPI A;  5BXI A;  2RS8 A;  3B78 A;  2MEW A;  4CRJ A;  2QLW A;  1KOH A;  2MZJ A;  4D3H A;  5C2C A;  2FY8 A;  1PC5 A;  5DLF A;  5EN1 A;  1WKJ A;  2BX6 A;  2BJ3 A;  2C2D A;  2RJZ A;  3TWZ A;  3R1H A;  1N8R T;  5LL6 d;  4O4R A;  2MKC A;  2IC3 A;  2DNN A;  2ZIT A;  1FE4 A;  4OI0 A;  5BJR A;  2CJX B;  3NG8 A;  4I69 A;  4ATN A;  3NOG A;  1X4A A;  4ES3 A;  1WOP A;  4GVL A;  1QD1 A;  3BZQ A;  4X84 A;  4M5N A;  2CPF A;  1YDL A;  5D3G B;  4WJB A;  2OTJ S;  2MKS A;  5CZV A;  4Q43 A;  4C2M A;  2XLK A;  2BRL A;  1RHK B;  2R9L A;  1F0X A;  4A46 A;  4J9O A;  1VQP S;  2JLF A;  1DQ8 A;  1RT4 B;  1VQ9 S;  1TL1 A;  2MGZ A;  2EFN A;  1CQM A;  2RB7 A;  3US5 A;  1RBO B;  2HS3 A;  5LM7 E;  2Z2Y B;  1U6F A;  2J7U A;  4OHY A;  2CNL B;  4UF4 A;  1APS A;  5KG4 A;  4WFA Q;  3BYR A;  2XNQ A;  1FJG F;  4J9M A;  4CLZ A;  4QYR A;  4DPO A;  4ECV A;  1F5A A;  2FLN A;  4ZLJ A;  2HHQ A;  2APO A;  8RUC A;  4P10 A;  1JLG A;  5KG3 A;  2EG1 A;  2NXE A;  1T05 A;  5H1S V;  2R8K A;  4G65 A;  1AT1 B;  5CCM A;  4DCP B;  2DR9 A;  4ELU A;  4B3O A;  4CT8 A;  1DZ5 A;  1G3O A;  4QYZ K;  4M94 A;  3MEE B;  1UFL A;  1RAD B;  5I3P A;  3A8J A;  3TOQ A;  2W2P P;  4IKA A;  1RU1 A;  3R7N B;  3TAR A;  1PKU A;  1ROF A;  4NCB A;  5DG8 A;  1YI2 S;  1JLC B;  4UQT A;  1KLM B;  3SI8 A;  2XZW A;  1CUL A;  2O3D A;  4JI7 J;  4B17 A;  5C2G A;  3CO9 A;  2BW7 A;  4X66 J;  4DPY A;  1X8D A;  3OXF A;  4MKA A;  5HJY A;  4G3I A;  1BC6 A;  1X9W A;  3RW6 A;  3O5T B;  3PIP Q;  3S7R A;  5ETQ A;  3CCL S;  4GKK J;  4PYA A;  4RUH A;  3K2Y A;  2ZUA A;  3JYT B;  1XBW A;  3R5C A;  3HXM A;  2XCA A;  3OL9 A;  2WVD A;  1ZPW X;  3EIC A;  5KT7 A;  4DBQ A;  3KLF B;  1YBA A;  3BPS P;  4WFZ A;  5IS2 A;  3MF5 A;  1XNQ F;  4IG3 A;  4CH0 S;  1U1O A;  4HHH A;  5KG5 A;  5ETS A;  5DDR C;  3HVT B;  2B3T B;  1XQI A;  1WD6 A;  1HBO A;  3BDP A;  4GVB A;  1YZ6 A;  3IM9 A;  3SBM A;  2H65 B;  1N5Q A;  4KTQ A;  2N7Y A;  4URS A;  1IBL F;  5E0O A;  3J7A N;  4EFA C;  2LXF A;  1YJT A;  4ZVU B;  1RP5 A;  4F4K A;  3KTQ A;  3OQ2 A;  1FEE A;  1YJW S;  1NPR A;  3T5J A;  4RBV A;  2JEF A;  1GXU A;  5D0R A;  1U1R A;  2YKM B;  4U96 A;  2ZJR Q;  2VIH A;  4UW2 A;  1EP4 A;  3BBB A;  2A3J A;  4OI2 A;  1WC0 A;  3GIL A;  4A8F A;  4X4R A;  3WC2 A;  1YHQ S;  2QTW A;  2OD6 A;  4FPR A;  1Q5Y A;  1FRI A;  1DTQ B;  2IVF B;  3I56 S;  2OO4 A;  2V5H G;  1FRJ A;  3SFG A;  2VL1 A;  2EC2 A;  1S0M A;  4Y34 A;  3C6T A;  2VG5 A;  2PFD A;  3JSM B;  1A6L A;  7AT1 B;  3AFG A;  5EWF A;  1S1X B;  3HHD A;  1Q82 T;  2IRX A;  3DLH A;  2RE1 A;  3CD5 A;  1SV5 A;  3OFG A;  1D1U A;  3UR0 A;  4USU A;  5L9N A;  3GR0 A;  3I9V 9;  4LVO P;  3B54 A;  4F0H A;  2HIY A;  4I7F A;  4FF4 A;  3HHE A;  3MM9 A;  2KZM A;  4IH7 A;  4RUB A;  1HI8 A;  3NOC A;  2KYZ A;  1GFW B;  1RJJ A;  1TKZ A;  2GIR A;  2J0X A;  2Q3P A;  4FS2 A;  5DG7 A;  2ALZ A;  2X3D A;  3PTW A;  3IWX A;  5LMU J;  2Q6B A;  1UKU A;  5SUH A;  3HFV A;  4N8O A;  3VVU A;  4OYB A;  4DX8 H;  1OO0 B;  1TL7 A;  1XMQ J;  1FK9 B;  5CYM B;  2RQ4 A;  4RWX A;  2IIH A;  4M5D B;  3CC7 S;  2ZD1 A;  3IRX A;  3N4W A;  2BE2 B;  5D0H A;  1Z2L A;  1FKP B;  2OPQ B;  3P3D A;  4PWD A;  1FVQ A;  2GHW A;  4JI8 J;  3VTI A;  4IFV B;  2NYH A;  2GV1 A;  4AL5 A;  1KWM A;  3HUL A;  1REV A;  3MM7 A;  4CLL A;  2FHJ D;  2I5J A;  1U02 A;  2B7C B;  4DPX A;  4F67 A;  2A6M A;  1KQG B;  2IJN A;  1C4C A;  3LP2 B;  4DR7 J;  4LFB F;  5M2R A;  1KVI A;  3MUV P;  4RW6 B;  1Z2Z A;  4PQA A;  1R8A A;  1BQN A;  4M63 A;  2A18 A;  3PEJ A;  1VQ7 S;  3MOJ B;  2QA4 S;  5HP1 A;  1YKW A;  1ZS6 A;  2YVS A;  1MRO B;  4ZPA A;  5AXK A;  2W4D A;  2EBG A;  5EHH A;  2ZBR A;  4WWS A;  1S1T B;  1UCN A;  3NL0 A;  1L5U A;  1CJU B;  2C3P A;  3ISN D;  3F41 A;  5B0E A;  1N52 B;  3KWM A;  4KGM A;  4Y6I A;  5KT3 A;  3PW0 A;  4WTO B;  5U47 A;  4RW9 B;  2R7R A;  2BVZ A;  5KFW A;  1QSS A;  3P5T L;  2E1R A;  3AOC A;  4PWW A;  3MI7 X;  1TAQ A;  2RD5 C;  2DIT A;  4NLU A;  4WYL A;  5DO2 A;  2JWN A;  2WVC A;  5KFB A;  4LF8 F;  2G1D A;  1BMQ B;  3R7S B;  1S48 A;  2MQP A;  1WWH A;  4TNO A;  1S6Q A;  3T6J A;  3T3F A;  1CJT A;  1NM2 A;  3D3C J;  5DDQ C;  1T9W A;  6FD1 A;  3D1O A;  5KT5 A;  2R7W A;  2XTJ P;  2GHV C;  2LXI A;  1KNZ A;  3R27 A;  1LWF B;  1RAB B;  1WEL A;  4HDG A;  1LWC A;  3IBW A;  2DRD A;  3NCP A;  3JTO A;  3ZFV A;  4DV6 J;  2V9K A;  1ZZF A;  4Y0F A;  3UDL A;  5CQG A;  3OJS A;  1RA6 A;  3DLE B;  4LRB A;  2W01 A;  4RO0 A;  3SMZ A;  3ZNJ 1;  1S1W A;  1JLA B;  4HEA 9;  1RIS A;  1VJQ A;  3D66 A;  1SBR A;  4GC6 A;  3ELH A;  1N5Y B;  4YHH F;  1S0O A;  1LK5 A;  2L41 A;  4KHP F;  3TO8 A;  2VJU A;  1RCX B;  1QE1 B;  2ZWO A;  3A12 A;  1UA0 A;  4NCG B;  4ZVF A;  4KV8 A;  2F40 A;  1FWL A;  4IR9 A;  3BBC A;  1TP7 A;  2CQ0 A;  4M5I A;  1URN A;  4RKU C;  4PG4 A;  5GAE I;  2BJ1 A;  5A6P A;  4ANE A;  1SCJ B;  3L09 A;  3D28 A;  4DFK A;  1SH2 A;  3MM8 A;  2VC1 A;  2KL8 A;  4ZPB A;  4X64 F;  5FLX Y;  3DGV A;  2YWW A;  4ZA1 A;  2HUR A;  2VZ9 A;  3U27 A;  2JH3 A;  2HHU A;  1T3O A;  5L8R C;  4KGX B;  4OMF G;  2E1M C;  3ZZT A;  3BQ0 A;  5L1J A;  5G4D A;  3A8E A;  4ZP8 A;  3HCX A;  1U2F A;  5CH7 B;  5GAH U;  6FDR A;  2W2Q P;  1RAA B;  3VZH A;  2QEX S;  3MFI A;  1KBR A;  3CCU S;  3K17 A;  1Q8I A;  4PQU B;  1B7Y B;  2BR0 A;  1GXT A;  4ECS A;  1NHU A;  5KTQ A;  2DBB A;  3HHL A;  2DIV A;  2R8H A;  4O23 A;  2MKY A;  3V4I B;  2YWF A;  2BQ3 A;  4C9D A;  3WDO A;  2L9N A;  1IKW B;  2B6A A;  1UEV A;  4PXE A;  3KLG A;  2VON A;  3PDN A;  3R6G B;  1RAJ A;  1RTI A;  5B0F A;  5HMZ A;  2Y1J A;  4QIV A;  1L3T A;  4RNH A;  2RNE A;  3QIP A;  2DKO B;  2NXU A;  2DPJ A;  3H20 A;  4DR6 J;  1D9A A;  2A10 A;  4JBC A;  3RU0 A;  3QWU A;  1JJ4 A;  4HTJ A;  1OJ4 A;  4PUO B;  3P4U B;  5KFM A;  1RTD B;  2K7J A;  4WTY A;  4TQS A;  1S77 D;  2VB6 A;  1DBD A;  4X4Q A;  1Q79 A;  2ZH5 A;  5I4M A;  1UVL A;  2HQI A;  2KG1 A;  4YB7 A;  1I51 B;  4E2F B;  4P71 A;  2DRA A;  2K3K A;  1H72 C;  2CJ9 A;  2XHW A;  3TVK A;  5E3P A;  2FLL A;  1DUR A;  2D7S A;  3PXG a;  3W2V B;  4ED5 A;  1J5E J;  2LU2 A;  4L3N A;  4PKD B;  2YH1 A;  3HFK A;  3GII A;  3D0I E;  2XLI A;  1G4C A;  1U26 A;  4NLQ A;  4NAS A;  2XMK A;  4KT0 C;  2PGC A;  1NK9 A;  2OML A;  2IMO A;  2HWI A;  3GYG A;  3NWR A;  1JLF B;  1WKL A;  5D6G A;  3MR3 A;  3IS9 A;  4XTT A;  1HNI A;  1J2V A;  2F8M A;  2CNK B;  3IR6 B;  1RT6 B;  2D3U A;  4LQ3 A;  3CED A;  3KLE B;  3TVY A;  3PIO Q;  3AXM A;  2UV8 A;  1FRK A;  4E98 A;  2AJ4 A;  2YNH B;  4NLS A;  4JV5 F;  5F9N A;  2DO4 A;  1MWZ A;  1ICE B;  4DOZ A;  3G9C A;  1QDU B;  1NXI A;  5KT2 A;  1VIX A;  3IBF B;  4O3P A;  3E01 B;  1FDN A;  3A1Y G;  1BQM B;  2PI4 A;  2ZVS A;  3J80 U;  5M2U A;  1IJE B;  1O6X A;  1FKA F;  3OVB A;  3N6N A;  3TJ9 A;  2QT7 A;  1XNR F;  3BKF A;  3C6U A;  1Z4U A;  3NS5 A;  1DFD A;  4LSZ B;  1HMV B;  3CIM A;  3W8P A;  5B0A A;  4OZ1 A;  1SPB P;  1NB2 A;  5IM0 B;  3MXH P;  1UEU A;  1MW7 A;  5HMW A;  5M2P A;  2CPJ A;  4DV3 J;  3H7H B;  4DR4 J;  2DH7 A;  3BGL A;  5E3A A;  3JS9 A;  3VAI A;  4TY8 A;  1T8E A;  4ETX A;  2ROP A;  1U1K A;  4B9L A;  3QLH A;  2W9B B;  4DS5 A;  3HKZ D;  3BB5 A;  2H4Y B;  1NDK A;  4LRD A;  1WI8 A;  5F3T A;  1M5K C;  4DUZ J;  4ZJL A;  2ZDO A;  4NLP A;  3NBP B;  3KLV A;  3Q86 A;  1LW0 A;  3BV8 A;  4J5O A;  2V9W A;  1PBA A;  4UZB A;  1WHY A;  1YJR A;  3M8R A;  4IR1 A;  4WP8 A;  2XGP A;  4P73 A;  3DM2 B;  3FSI A;  3DOK B;  4TKT A;  3MR5 A;  2RQK A;  4HLB A;  2VFR A;  2GVD B;  4DFP A;  2WSC C;  3D6T B;  1UWB A;  3SCL E;  2PEB A;  4FXV A;  4NLV A;  3LPE A;  1N6Q B;  4GKJ F;  1HQ2 A;  4ZVG A;  1JKH A;  1R0C B;  2NLW A;  2NXC A;  3W64 A;  3T5K A;  4Q2M A;  3TAP A;  2QJ3 A;  2CJB A;  2L08 A;  2NXN A;  1NK0 A;  3MCS A;  1FRH A;  4J9R A;  4F04 B;  2YNF B;  1B99 A;  3QSY B;  4QR0 A;  3OW2 R;  2R42 A;  1TMM A;  1ZM3 A;  4XO0 A;  2H54 B;  3LGH A;  2PA3 A;  4U8V A;  2YBV A;  1L3U A;  1T03 A;  4C7Q A;  3N6M A;  2QFI A;  4RLE A;  2CAD A;  5D0G A;  3AY0 A;  1N34 F;  2OGU A;  2IRY A;  2KN4 A;  4NXM F;  1XJW B;  3HT3 A;  2B5J B;  2KT3 A;  1RE1 B;  2ZC4 A;  2QA2 A;  4EI2 A;  2ACY A;  1VBK A;  3U1L A;  2DVI A;  3D2W A;  1Y0H A;  5DM7 Q;  2JRS A;  1NME B;  4NYP A;  4PEO A;  2CPY A;  2BEF A;  3N01 A;  1AFI A;  1B64 A;  2XEX A;  4FYW B;  3DRX A;  3S01 A;  5HVH A;  2JSX A;  2FQQ B;  1KTV A;  2YKN A;  3W5Y A;  3OR1 A;  1U8S A;  2LFV A;  3DGP A;  2HAI A;  3IWL A;  2ZOM A;  3FDS A;  3DYA A;  4JYA F;  3BGF A;  2MLY A;  4R8U A;  4RU9 A;  1UVJ A;  1F5B A;  2V8H A;  3V6J A;  3KHH A;  5HI7 A;  2I1R A;  1EAR A;  1AB8 A;  4OYZ A;  3LA0 A;  4AND A;  2IJR A;  1SQG A;  5KFO A;  3S6E A;  2K2P A;  3EWG A;  5LSO A;  2ZUG A;  3ISN C;  5E3R A;  1SJ4 P;  3BSC A;  5F3Z A;  1FTC A;  2Y3Y A;  2BAN B;  2NUU G;  4XDD A;  3LAL A;  2DR5 A;  4ID5 A;  1QLN A;  2QMW A;  4K7Q A;  4LF1 A;  5AXN A;  1IR1 A;  1TKX A;  5L1K A;  4OJ3 A;  4DX6 A;  2KU7 A;  2VOD A;  1YG0 A;  2E7V A;  3D0H E;  4IQX A;  2LEP A;  1JB0 C;  1FRL A;  3PNI A;  1HIY A;  1H38 A;  3FQL A;  4UOF A;  2GJI A;  4B3S F;  1X5P A;  1ULR A;  3BPD A;  3DKD A;  2RVJ A;  3EVW A;  1I5O B;  2F9D A;  3K5L A;  1M1K T;  1I1G A;  2CA9 A;  3DN9 A;  3D3B J;  2ZZN A;  4LF5 F;  3V2U C;  4PPD A;  4QIW D;  3EZO A;  3EXC X;  3MMJ A;  1HNX J;  3A8K A;  4PG7 A;  3U1N A;  1X4H A;  4Q0B B;  3KG4 A;  4USW A;  2W2N P;  3CMQ A;  5KFX A;  2XS7 A;  5A8K A;  4MIW A;  1GX6 A;  1RUS A;  2CZV C;  3EZ5 A;  2W9A A;  5D4P A;  2AGP A;  1HBM B;  2CQ3 A;  2UVW A;  5K8P A;  2HMI A;  4OZ5 A;  2YY3 A;  4UTG A;  1T9X A;  2DGU A;  4EU0 A;  4M5H A;  2K1R B;  2ZC3 A;  2GQQ A;  4H4M B;  5T7L A;  3DI6 B;  5FDL A;  4X65 J;  3CGI A;  2FJD B;  3DXS X;  2G1H A;  2XS2 A;  1RWO B;  4NYZ A;  3EGN A;  3G82 A;  4ZCL A;  4F2S A;  3QRQ A;  2DRB A;  1T3N A;  3H98 A;  5D8H B;  2EFQ A;  4O44 B;  4YFU A;  4H4O A;  2XSJ B;  2V4J B;  4KJI A;  3D9B A;  1U0S A;  2E1P A;  3JSB A;  3ZZY A;  1RCO B;  4MK8 A;  4W90 B;  5HQM A;  2N4D A;  3W60 A;  4O4G A;  1IKX B;  3PKY A;  4UZC A;  1VRU B;  3OUY A;  2AEM A;  2KFN A;  2GGP B;  2XMA A;  3WIV A;  1SIZ A;  4TYB A;  3NKY A;  4WE1 A;  5DZ7 A;  3HVA A;  2RRA A;  4YS2 A;  3NGT A;  1S9G B;  5H9E J;  1Y9O A;  4G1Q B;  3CTR A;  2ZHB A;  3FSX A;  3PO5 A;  3FBB A;  4LUB A;  3PV8 A;  4K2J A;  2V8V A;  5KFY A;  2GA7 A;  2E1C A;  1U09 A;  3PCO B;  3UD3 P;  4OX9 F;  2UVR A;  4RL1 A;  1HQE A;  3ETM A;  2WVB A;  1JLB B;  1SUQ B;  3DLK A;  3I4P A;  1IR2 A;  4MFB B;  3DDK A;  3NMA A;  3RGI A;  3CD6 S;  4K4W A;  1X5O A;  2Y1L B;  4QBU A;  3QRR A;  2MQN A;  4KY3 A;  2DCL A;  2ILY A;  2HNZ A;  4FKY A;  3J81 Y;  4ECQ A;  3G8S A;  4JI2 J;  1ZH5 A;  4ZHR B;  1FNO A;  2G0I A;  1RAO A;  2GQC A;  4GC7 A;  2EBE A;  1HYS B;  5I42 B;  4KPC A;  4DV5 F;  5J1E A;  1NU4 A;  5A2Q U;  4QW8 A;  5DQG A;  3M2R B;  4TQR A;  1K9M T;  2QRR A;  3MTJ A;  5IZH A;  1F3V A;  1N33 J;  1DJ0 A;  4IOC Q;  1ITP A;  2ZH1 A;  5HJX A;  2MB0 B;  2DTJ A;  3H5X A;  3CIZ A;  1DQ9 A;  1MWY A;  3AJ1 A;  5HVG A;  4TLR A;  5AJ3 J;  3T19 A;  5JJB A;  2VF3 A;  2E66 A;  1FVS A;  5IC4 B;  1WSR A;  5A0Y B;  5KFJ A;  3MPW A;  3UNG C;  3RRK A;  1U6Z A;  1SJF A;  5IT4 A;  1SH0 A;  4JI1 J;  2KVQ E;  1HBU B;  4ZMM A;  2QMU B;  1JJ2 R;  3KK3 B;  3FCV A;  2RUS A;  4QWE A;  3BH6 B;  1HQU B;  3MMC A;  4FN5 A;  2D9P A;  2CQH A;  4CDI A;  2CNO B;  4RW7 A;  2NCK L;  5CAA A;  1CSJ A;  4A4J A;  3HM9 A;  3OSP A;  3RZA A;  2DHX A;  1UVI A;  2KT2 A;  3QT5 A;  5AE2 A;  3RRH A;  1RWN B;  1RZM A;  2DGO A;  2J6S A;  3LTO A;  3KK1 B;  4J9V A;  4OHZ A;  4IO9 Q;  2BKN A;  3TUP A;  4CYU A;  5A8R B;  2AX0 A;  3QAE A;  2FJE B;  5GAH I;  2BJ9 A;  2BUN A;  4ELT A;  1SB6 A;  1VBZ A;  1RT1 B;  1VLY A;  4CO4 A;  2RRN A;  2ZBI A;  3MED A;  4NX9 A;  2AYG A;  1U0H A;  4K4U A;  2UV8 G;  4PXB A;  2ZBC A;  4ECR A;  4FNI A;  1HFE L;  2FZG B;  2B8Q A;  4F4W A;  1PG5 B;  3M32 B;  2QL5 B;  2RF2 B;  1FFW B;  4F7V A;  1IQZ A;  2ATC B;  1LXN A;  3SQG A;  1VRT A;  1C0U B;  4IG0 B;  3DHW C;  3F0N A;  3LH2 S;  4X62 F;  4ZLN A;  1YRU A;  5J2P A;  2OSR A;  3OL6 A;  1HD0 A;  2E1A A;  3DFE A;  3ET6 B;  4OYI A;  4ZPD A;  3TA1 A;  2QIF A;  1YQH A;  3O3L A;  4P6Q A;  3IA0 A;  1SKS A;  1D0E A;  1FNM A;  2Z0G A;  2ZM6 J;  4C97 A;  1FER A;  4KHM A;  2AJ2 A;  3RBX A;  2GFF A;  5D78 A;  4F02 A;  1HNV B;  2CRL A;  3IP0 A;  4QYZ J;  2IDE A;  2C2Z B;  4URG A;  5B09 A;  3O44 A;  3VGV A;  5F8H A;  1NLK L;  2VQF J;  3CW2 C;  4ANC A;  1M5O C;  4KKO B;  3GQC A;  2QSW A;  4U7U K;  2HBZ B;  1RT3 B;  2VOP A;  1JLE A;  2JLG A;  2HIQ A;  4QZV B;  3OTO F;  1QUV A;  4CM2 A;  1F9E B;  1RTH B;  3SIP B;  2EW9 A;  4M95 A;  2YKQ A;  4X4U A;  3GCX P;  2ZEJ A;  1P9Y A;  1QSY A;  2LDY A;  1FWK A;  3UCZ P;  4RW8 B;  1Q7L B;  1S1V B;  1TUW A;  1SJR A;  4DV2 J;  3GMG A;  3BN4 A;  3CUN A;  3FKB A;  2RQC A;  5F8M A;  4OX6 A;  1OQ6 A;  2QA1 A;  3TAQ A;  4ZOS A;  5DDP C;  1T9Y A;  2MLZ A;  2VQE F;  2XYH B;  1TV6 B;  3LP1 A;  3R5J B;  3UCG A;  4NLY A;  2J7W A;  2JHE A;  1SC1 B;  4DL6 A;  3EPI A;  1W26 A;  4OHW A;  2HS0 A;  4DL5 A;  3T5L A;  4JV0 A;  1AFJ A;  3CPW R;  3UCU P;  4NZ0 A;  1TL4 A;  2GS8 A;  3HPO A;  3H2V E;  3NAH A;  2FIU A;  2N7C A;  3DOL A;  1N36 J;  1IBM J;  3CDB A;  3D4J A;  4ED0 A;  1K0V A;  4NEY A;  4ES2 A;  1QAJ A;  3UDC A;  3UDV A;  3I96 A;  4CLY A;  1SIW B;  1SKW A;  2ROG A;  3LOU A;  3FBC A;  2IFX A;  3VCD A;  1NK7 A;  3C3L A;  4EMD A;  2ZOF A;  3FFI A;  4JI6 F;  3FUY A;  3TX0 A;  1CPZ A;  2GVZ A;  3LGN A;  4NMX A;  4YOE A;  1T9T A;  2ZOG A;  3C19 A;  4P52 A;  1Q81 T;  2XI2 A;  5J2M A;  3K5M A;  1Q53 A;  5IFM A;  3TQE A;  4E0D A;  1YBU A;  1RTJ A;  2W7A A;  4JV2 A;  2QX0 A;  2WHO A;  5IV4 A;  5DGA A;  2AV5 A;  3TJA A;  2KYX A;  1Q8L A;  1RT4 A;  3FZ2 A;  3T9N A;  2HHX A;  2YNI B;  3CJK B;  2RUG A;  2PMH A;  5KFD A;  2KHD A;  1WKK A;  3P45 B;  2M3D A;  3M8Q B;  1KLN A;  1XK8 A;  4KE5 A;  4LFA J;  3RB3 A;  2ACM A;  4I2P A;  5KG0 A;  3D0G E;  1DTT A;  4YY3 J;  4LF2 A;  3CJ3 A;  1HKA A;  5KFH A;  3RB4 A;  1C1B B;  1X4E A;  3DU6 A;  2IBK A;  4XIU A;  2HZC A;  4K5S A;  3KLH B;  4C0O C;  2DGT A;  2LMI A;  1CBK A;  2C2E A;  4MT1 A;  1IVZ A;  3P49 B;  3CCT A;  4BS2 A;  4DR3 J;  2CPI A;  2FHM A;  3MEE A;  1RT5 B;  2WON B;  1EQ0 A;  5CHC B;  1VRQ C;  4RBT A;  5BR8 F;  2W9C B;  1EJ7 L;  3KHG A;  1KLM A;  5I3Q A;  1RT7 B;  2UZA A;  3NS7 B;  3AAW B;  1ACM B;  2QLJ B;  1YRX A;  2MDA A;  4Z7C A;  2NSB A;  3TRG A;  2HSE B;  3PW7 A;  4V1A k;  2Q79 A;  3GCW P;  4UY8 T;  1X31 C;  2WB4 A;  2MJN A;  4DF8 A;  4MKY A;  2Y0B B;  4ZVP B;  4KQZ A;  2DNG A;  1HWK A;  1NSP A;  4DI6 A;  2OJ3 A;  4OV6 A;  3MM5 A;  1HWL A;  1E6V B;  1EHW A;  4ECU A;  3I0R B;  2K3I A;  1X0P A;  2R2R A;  5HAN A;  4URQ U;  3UDE A;  1FKO A;  4DL0 C;  2EC0 A;  4JI5 J;  2XY7 A;  2V4R A;  1CG2 A;  4DF4 A;  1JK9 B;  2AEJ A;  4EZ6 A;  3HVT A;  1FEH A;  4OX7 A;  1TL1 B;  2MGZ B;  5KFE A;  2QGF B;  1GMV A;  2DNQ A;  2XO7 A;  2B4O A;  1HD1 A;  4HKQ A;  4ZP7 A;  2PMW A;  2BW2 A;  2HRY A;  4OZ3 A;  3N5B A;  3FVY A;  4F3M A;  2D41 A;  1YIJ S;  3IXQ A;  2HQ3 A;  2J6U A;  1CLF A;  3BEG B;  4AQY J;  1Q8B A;  1VDH A;  3KMQ A;  2M7S A;  2WAQ D;  5C42 B;  4C0H A;  3BS9 A;  4ZP6 A;  1GNK A;  3D54 A;  2OAU A;  4KC5 A;  1T05 B;  3L9Z A;  2L9D A;  3QMQ A;  3IFE A;  4YB6 A;  1HNZ J;  1WSV A;  3GYX B;  1Q5V A;  2JL9 A;  4KBI A;  1DTQ A;  1CC8 A;  4N41 A;  3GG0 A;  1XEZ A;  4F26 A;  2LEA A;  3OR2 A;  3UN2 A;  3CNQ P;  1IN0 A;  5EUH A;  4ECX A;  5GMK a;  4EYI B;  3M4X A;  2P6T A;  3EVM A;  2LQB A;  1D09 B;  1QAX A;  1U45 A;  3BGR A;  2E5I A;  1OQ3 A;  1TK0 A;  3CT9 A;  2W4C A;  1YVF A;  4A8S A;  3RB6 A;  1B0T A;  2N3O A;  1GMW D;  5EX0 A;  2G9O A;  4J9K A;  1BE4 A;  1FA0 A;  3WBZ A;  3PAC A;  1MML A;  4DUY J;  4IDK A;  3O2I A;  1N32 F;  2OP5 A;  1N0V C;  5D4N A;  2FVQ A;  1NHK L;  1VGY A;  2UUA F;  1HHS A;  2J76 E;  4KGZ B;  1UZD A;  2JX2 A;  4I6Y A;  4FXD A;  4ETZ A;  2XMV A;  1S9E A;  1FTR A;  5DS7 A;  1R8B A;  2XY6 A;  2RU3 A;  3GV7 B;  1VBX A;  2BE2 A;  4C4W A;  4DG1 B;  2W7O A;  3DHX A;  3ZC4 A;  2DB1 A;  4WK1 A;  4CO0 A;  1CC7 A;  1G2E A;  1HBO B;  2FPH X;  4I6W A;  2UXC J;  5K9F A;  2B4P A;  1KRP A;  2RS2 A;  4JP8 A;  4I68 A;  3PYG A;  2RAQ A;  4PAA A;  4ENO A;  4USJ C;  2G13 A;  3EMT A;  3LGM A;  3CD0 A;  4FKX A;  1HI0 P;  2CPE A;  2CQP A;  3UVJ B;  4AT1 B;  2F4V J;  2XC9 A;  3T1Y J;  4M5G A;  2HFU A;  4NPO A;  4L74 A;  1X9M A;  4P75 A;  1Y4Z B;  1J5O A;  1TMJ A;  2DR8 A;  3KYL A;  1X5S A;  3RBD A;  1AZS A;  1MRO A;  1EP4 B;  3D6H B;  5E7O B;  1WNE A;  1S1T A;  1EET A;  1TAU A;  1KQS R;  3X3U A;  3T6B A;  1Q8K A;  1SC4 B;  1NAQ A;  4QPX A;  4M5M A;  2NRE A;  3C6T B;  4YEA A;  2VG5 B;  4TN2 A;  4CO5 A;  1UPP A;  3FBE A;  3G71 S;  2FTR A;  1PC4 A;  2CQI A;  1NB7 A;  1SV5 B;  3TR5 A;  2WK4 A;  1VIO A;  2RHQ B;  3NGS A;  4GO5 X;  1UPM B;  4P2M A;  2ASY A;  5KOX A;  2HBY B;  1S4E A;  3Q8P B;  2VBY A;  2V68 A;  4KYZ A;  1Q95 G;  1UL3 A;  3GB0 A;  4GMK A;  2F4F A;  1YJN S;  1TKT B;  3EDR B;  5C7P A;  2VBW A;  3I5B A;  3KJQ B;  4JI0 F;  3OVA A;  3M2U A;  1TKZ B;  1S72 S;  3GU0 A;  4B3T F;  3M2V B;  4QPT A;  3ETO A;  4LSL A;  2ASJ A;  4KB7 A;  3NRB A;  3OLB A;  3E8O A;  3VAJ A;  5KFT A;  2DNM A;  1ZBT A;  1IBK F;  5BYR A;  2MZR A;  2W24 A;  2HNY B;  3J7Z 5;  2QA4 G;  1BQX A;  4OYP A;  2MMY A;  2DNP A;  3MOZ A;  5J2N B;  2VOO A;  2AJ1 A;  2GAH C;  4U7U D;  3HSG A;  4PWD B;  3AXK A;  4NXN F;  5DJB A;  3WC0 A;  2E7X A;  3HVW A;  4DQP A;  2RML A;  5C25 A;  4TXS A;  2HEK A;  3RYL A;  5E33 A;  3ICL A;  2E5L F;  2BBE A;  4NLX A;  1REV B;  2H4W B;  2HZV A;  3GIJ A;  1JLA A;  2I5J B;  2DYA A;  3CDW A;  3QFW A;  5B0D A;  3Q8V A;  1KN6 A;  2EKN A;  3ZXW A;  2CJA A;  3GFY A;  2IRU A;  3N79 A;  2OEL A;  2DGX A;  1VQ6 S;  3SSS A;  1RYS A;  2JEG A;  1WI6 A;  3W62 A;  4KH0 B;  2RH3 A;  4MYT A;  4DX7 A;  1BQN B;  1V6H A;  4DR2 J;  2Z2L A;  3LP0 B;  5LMN J;  3DLB A;  1RHM B;  3ZTQ A;  2RHS B;  2HS4 A;  1UVM A;  3W8G A;  4PR6 A;  2DH9 A;  1S6U A;  4HR2 A;  2GQ2 A;  1Y7P A;  3PRV A;  2AU0 A;  2QLB B;  1XN9 A;  3HMJ G;  3ILI A;  4P2X A;  1V3S A;  3G2X A;  4OZ0 A;  1H7X A;  2MQL A;  2Z58 B;  3CJ2 A;  5ETO A;  4JI4 F;  1WF0 A;  3KJN B;  4LSN A;  3I87 A;  1HW8 A;  4OJ1 A;  1S9F A;  2R7T A;  4V19 J;  4QW9 A;  4USV A;  2R7V A;  3GFZ A;  4OLP A;  3JAM Y;  4B3M F;  1CS4 A;  4N56 A;  4CO2 A;  2AD9 A;  4RJV A;  3V4I A;  2NPI A;  2UU9 J;  3FNN A;  2BJ8 A;  2RRB A;  3H59 A;  2UP1 A;  1NK4 A;  3IC1 A;  4P9S A;  2FC8 A;  1IKW A;  1SKU B;  4LRC A;  4HHU A;  3U02 A;  3D6F B;  1S12 A;  5L39 A;  1M0S A;  1RKJ A;  4F0M A;  3RJM B;  5DM6 Q;  1X60 A;  4FDF A;  2AJ0 A;  2B51 A;  4LR9 A;  3OXL A;  3H2U B;  4WBF A;  3IWN C;  2M0G B;  2VBX A;  4M8L A;  4RUC A;  2V94 A;  3CO0 P;  3L7O A;  1F60 B;  1LQ9 A;  2JZ5 A;  4EO8 A;  4PUO A;  1S59 A;  6AT1 B;  3DRR A;  1OY6 A;  3MGJ A;  1S1W B;  2BKP A;  4I6A A;  1HLW A;  3L7U A;  5ADZ A;  5T41 A;  5T14 A;  4ZVO B;  3BGO P;  2HFZ A;  2Y8W A;  2Y1R I;  3DLJ A;  5IT9 Y;  2R7S A;  2D69 A;  3ZZO A;  2XO6 A;  4LF7 F;  2XWY A;  3HZE A;  1HNW F;  3T41 A;  1S1U A;  2AP6 A;  3Q8U A;  2UVV A;  1CVJ A;  4P72 A;  5F8L A;  2YX4 A;  2YWG A;  3CCQ S;  5KG6 A;  3OFE A;  4JUZ A;  1O51 A;  5E2Q A;  1VCT A;  4LF4 F;  3W5Z A;  5KFA A;  2XBP A;  2QFJ A;  1SL2 A;  4LVN P;  2XB2 D;  4DV1 F;  4DV0 F;  3P96 A;  4Y2M A;  3R1L A;  4I56 A;  1NJI T;  1UAW A;  2O5D A;  3MEK A;  4DSK A;  3VWS A;  1BUX A;  4EK2 A;  1RHQ B;  3AOA A;  3MR7 A;  3IO1 A;  1JLF A;  3SSQ A;  4K4T A;  2A6O A;  1FES A;  1S10 A;  3JTN A;  2W4P A;  1RWK B;  2QO3 A;  3EGW B;  3PEH A;  1RT6 A;  4LF9 F;  1N88 A;  3KLE A;  1REG X;  7FD1 A;  2R2T A;  3I5A A;  3OTB A;  4A8K A;  1JQG A;  1ZTT A;  1B0V A;  1V5I B;  3HHL B;  1A7G E;  4ZLL A;  2OPR B;  1AYE A;  2C22 A;  3FQK A;  4I0W A;  1SC6 A;  2CPH A;  1O8B A;  1VIS A;  1Y5L B;  3NGK A;  5HAT A;  4DX5 A;  1JLQ B;  2BXJ A;  1BQM A;  4BWJ A;  4Y2A A;  4ZK7 M;  2W8K A;  2VG7 A;  5K14 A;  1FWP A;  2HHT A;  4X4S A;  3CCW A;  1R43 A;  1KS2 A;  3QIP B;  4AD6 A;  1WHV A;  3QO9 B;  1S76 D;  2CVI A;  2OD4 A;  3QT8 A;  2WOM B;  1NKE A;  3VAG A;  3B6B A;  3HFZ B;  2UXD F;  2NPF A;  4OV1 A;  1MU2 A;  3CJR A;  3EE3 A;  5HRO A;  5B0C A;  1D8Y A;  2IAJ A;  5DET A;  3V6D A;  3RG6 A;  5H9F K;  4C3M A;  2XMW A;  3KJF B;  1RWX B;  5D77 A;  1LK7 A;  1HL6 A;  2DIU A;  1C1C A;  4B9M A;  1DAR A;  1M5H A;  2VPZ B;  1PBU A;  4F4Y A;  3ULH A;  4M5L A;  1H98 A;  3IR5 B;  2V0N A;  2LQ9 A;  1UJ5 A;  2MQO A;  1EQM A;  3DOK A;  2YX1 A;  2GVD A;  2VA3 A;  4G6V B;  4KAI A;  2FHK A;  3AB4 B;  4PXC A;  5L38 A;  4LF6 F;  2YKA A;  1LXJ A;  1TFY A;  2V2V A;  3NS6 A;  4ZCM A;  1EX8 A;  2H9Z A;  2HHS A;  3AQO A;  4MIA A;  2IVM A;  1O5J A;  3H90 A;  4DPW A;  3D5M A;  1WDD A;  2X1G A;  3CJ0 A;  3HHL D;  4QIG A;  1BD6 A;  4QWC A;  5HN0 A;  5DDO C;  3RAQ A;  3FMW A;  4D3G A;  2LCW A;  5LXY A;  3SFU A;  2GJF A;  4MKB A;  2WRM A;  3CCM S;  3NNH A;  4C0B A;  1VQL S;  2RIL A;  2BZ2 A;  5LT5 A;  4RW4 A;  4CLS A;  2MY8 A;  4DMZ A;  4ICL B;  3K8V A;  3VHQ A;  4EYH B;  3H25 A;  3W61 A;  5K20 B;  2MYF A;  3MMA B;  2QC3 A;  2PE8 A;  1NK5 A;  4B3R J;  2B9X A;  3L7P A;  1HR0 F;  4DR1 F;  4NLW A;  4IH6 A;  4LBH A;  4EUV A;  4KRW A;  2DEJ A;  1X7V A;  3THT A;  2EPI A;  3GJT B;  4YR2 A;  4A8Y A;  2F9J A;  3M8Z A;  2BMB A;  5CYQ B;  2ROE A;  3OSN A;  2HHW A;  4I2Q B;  3M9N B;  2BJ7 A;  3HSD A;  4OZN A;  4A8Q A;  1IKY A;  2IPO B;  2M8H A;  4DSI A;  3GSD A;  2NZ4 A;  2K06 A;  4TY8 B;  3T1H F;  4B9T A;  2NUH A;  3QLH B;  5F8I A;  2UXB J;  4FPI A;  2ASL A;  1ARO P;  3P8B B;  1LW0 B;  5LSR A;  3KJV A;  2HGL A;  1X5T A;  4Q8F A;  4DZD A;  1OPI A;  3DU5 A;  1I94 J;  2DHH A;  3QBC A;  2EEY A;  3LAK A;  3VGT A;  4C11 B;  2M4M A;  3MZI A;  1UWB B;  4WZQ A;  4O3R A;  2ZKU A;  5B08 A;  2WBM A;  2BAN A;  3ZZZ A;  1WG1 A;  3HK2 A;  3DRP B;  1JKH B;  2UUB J;  2G2O A;  2Y9H A;  3AOB A;  2CUY A;  5IV3 A;  3KXD A;  1K8A T;  1B3T A;  3QGH A;  3ITH B;  5IWA J;  3CSK A;  4ZCK A;  2ZDP A;  3PRB A;  3J7Y I;  2C3Y A;  5AXL A;  5HBM A;  2Q66 A;  3ADA C;  2MKK A;  2CPZ A;  2B8P A;  3GFX A;  4CWB A;  3BR8 A;  1HPZ A;  2RQM A;  2D3O R;  3WQP A;  1T03 B;  5JXS A;  1HAR A;  1R8H A;  3OFH A;  2Z56 B;  1T95 A;  3MEG B;  2HG4 A;  3GV5 B;  3W63 A;  2VBZ A;  2FC9 A;  3FMB A;  4Q0B A;  2DXE A;  1WC3 A;  5HL7 Q;  3JQK A;  2DXD A;  3MMB A;  3V81 A;  4XPC A;  1AXQ A;  2B0G A;  5F0W A;  3MCN A;  1UFK A;  2K1R A;  2MHE A;  3VQT A;  1ZA2 B;  1X4C A;  5DLG A;  4FVC A;  4OI1 A;  1BWV A;  2Z30 B;  2DNH A;  3OR1 B;  3DGP B;  2W7P A;  3CWJ A;  3I0S B;  4Y2K A;  3DYA B;  2FVP A;  3KNA A;  4NML A;  2M8D B;  5AE1 A;  3VAK A;  2VDI A;  3OT9 A;  1ZET A;  1VQO S;  2V67 A;  4O44 A;  1X4B A;  4N77 A;  3T1A A;  3G96 A;  2KB2 A;  1M5S A;  4EZ9 A;  1LW2 A;  3VAL A;  2I2Y A;  2CFX A;  2WBR A;  1IKX A;  2OFG X;  4HH0 A;  1TR0 A;  3MUT P;  4IUF A;  1SL1 A;  5DGB A;  2D9O A;  3NLC A;  4Y00 A;  3HLU A;  5DRK A;  4MJK A;  4ID5 B;  2YWH A;  4W98 A;  1N5V A;  1MMN A;  1S57 A;  5HO4 A;  1KR4 A;  3QT6 A;  1CJK A;  4KR0 B;  1GT8 A;  3B4D A;  4RNM A;  1WAC A;  2HVD A;  1TKX B;  4BLG A;  4YUD A;  1N5T A;  3W2W A;  2CVE A;  3V4M A;  3PW5 A;  1SUQ A;  4DR5 J;  3PJW A;  2HLT A;  2XMT A;  3SYZ A;  1XIQ A;  1MMD A;  2Z2M A;  2B4V A;  2ILZ A;  2HRT A;  3ZNU A;  1NHV A;  3UE2 A;  4DV7 J;  2VHG A;  2MKI A;  4AL6 A;  3NAI A;  1HBN A;  2IA6 A;  1NK6 A;  1E6Y A;  2L9W A;  3N0V A;  1CEZ A;  2UUC J;  4DQQ A;  4K0K J;  3IGN A;  4WYW A;  1U2C A;  1HYS A;  2HGN A;  3KMS A;  2XCP A;  3KUE A;  4CH1 A;  2FLP A;  1RT2 B;  3UN5 A;  2IM1 A;  1F9F A;  2NS1 B;  2CQ4 A;  2WCX A;  4JI3 J;  3DRS A;  2HMI B;  3O1L A;  1RHR B;  2B43 A;  2H51 B;  4JI7 F;  1UA1 A;  4DV4 J;  1HNW J;  2E44 A;  1UVK A;  5T7L B;  4X66 F;  3FCW A;  1S0V A;  5FDL B;  1UJ6 A;  4UOH A;  1T0T V;  3PYF A;  5HK4 A;  3SCK E;  4NE9 C;  4QIF A;  2XGQ A;  3G82 B;  2BM0 A;  1Y11 A;  5G0R B;  2F65 A;  4H4K A;  2HWH A;  2GIF A;  4ZPV R;  2B7B B;  2M5Y A;  4GKK F;  3QNW B;  4DHV A;  4WFN Q;  1HQU A;  3V6H A;  1EKR A;  1IJF B;  4F36 A;  3THV A;  2KT5 A;  1JMT A;  3SV3 A;  3BBF A;  2VG6 B;  3TZY A;  2LLZ A;  4WFY A;  1R8C A;  4QOT A;  3KHL A;  3PHT A;  1PJ7 A;  3TVZ A;  3S8S A;  2HHH J;  2PDA A;  3IAM 9;  1JXV A;  1SL0 A;  1JNR B;  4LT6 A;  5CZX A;  3OUY B;  3ENA A;  3PJ9 A;  4WE1 B;  1FJ7 A;  1RT1 A;  1EZZ B;  3MCO A;  1HHT P;  4J9L A;  1FJE B;  1NCL A;  4ILL A;  2DNR A;  5JUM A;  5ETK A;  2DCU B;  4MTP A;  4ZLP A;  4C8O A;  3EJM A;  5KFV A;  3QZ7 A;  3QAU A;  2A2C A;  2MQ8 A;  4RX6 A;  3GLJ A;  2ADC A;  2KJV A;  3DC2 A;  4WP9 A;  2F63 A;  1HQE B;  2XG8 A;  1PIE A;  5B7W A;  2AZ3 A;  3DLK B;  4DSE A;  3NCQ A;  5FLX U;  3M32 A;  4DSL A;  1MWQ A;  2RF2 A;  4ZVT B;  1JXL A;  5HVF A;  1H0H B;  4EWT A;  4NZ6 A;  1IBC B;  1FRM A;  1YJ7 A;  4FS1 A;  1AUD A;  3LAM A;  5MAO A;  2V8P A;  1VQ5 S;  3BO3 A;  4FZV A;  2AGQ A;  1KOO A;  3ENV A;  5CAB A;  4CTA B;  3EUN A;  4NA3 A;  2PSZ A;  2F7V A;  3UN3 A;  5LXR A;  4E8U A;  3EVO A;  1FE0 A;  3AA9 A;  3MM6 B;  2KH9 A;  1GMU A;  3M1V B;  4F8R A;  2VPX B;  3PZP A;  3RTV A;  1FJG J;  2QMX A;  4OHX A;  2HZA A;  2A0F B;  3O8W A;  3C14 A;  3ZZP A;  4GO7 X;  2HHP A;  2GAG C;  1X4F A;  2R7U A;  1NJZ A;  4KHR A;  1RTH A;  3LAN A;  3MMC B;  3MEC A;  4CCH A;  5KT4 A;  4WXW A;  4RW7 B;  5KFP A;  3W7B A;  5LMU F;  4O3S A;  2LQ5 A;  1YLX A;  1B0P A;  4RW8 A;  1OPZ A;  1XMQ F;  3PW4 A;  1WC1 A;  2QE5 A;  4FVM A;  1W7W A;  2AZ1 A;  3TNV A;  1TL3 B;  1U7L A;  3HD2 A;  4JI8 F;  1NJX A;  1RLD A;  3BKT A;  3M8Y A;  1X9S A;  3H40 A;  3G86 A;  3QWP A;  1U0H B;  1NDP A;  3HHL C;  4BBY A;  3PHE A;  1WC5 A;  2DNL A;  4ZVR B;  3VR1 A;  5AXM A;  4DR7 F;  3BO2 A;  2W25 A;  5L1I A;  2FB0 A; 
#chains in the Genus database with same CATH homology
 1EAY C;  1FFW B;  1A0O B;  1FWP A;  1FFS B;  2LP4 A;  1FFG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...