2U2FA

Solution structure of the second rna-binding domain of hu2af65
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
85
structure length
85
Chain Sequence
AHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structures of the first and second RNA-binding domains of human U2 small nuclear ribonucleoprotein particle auxiliary factor (U2AF(65)).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords PROTEIN (SPLICING FACTOR U2AF 65 KD SUBUNIT)
total genus 9
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 1999-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2u2fA00
2FC8A 2MY8A 3MXHP 1U1MA 1WF1A 1JMTA 1NO8A 1NJIT 2MZQA 3N9UC 1CVJA 5CXTA 3BS9A 2CPFA 2M8HA 3MI7X 2UP1A 2MXYA 3G6ES 1VQKS 1WHYA 2J8AA 2I38A 2HYIB 2YH1A 4CQ1A 1H2VZ 2DHXA 2O3DA 2YH0A 3U1MA 2LYVA 1X5PA 4U67Q 2M8DB 2MQLA 4IO9Q 3PIPQ 3HI9A 3ULHA 2DNNA 3UCZP 1VC5A 2YTCA 4A8XA 1W2BR 4IOAQ 3G4SS 2YKAA 3FEYB 2PE8A 3SMZA 1ZH5A 5LJ5Y 2XS5A 3G8TA 4ERDA 4C0OC 2OJ3A 3BO3A 1VQMS 5GMKa 2KFYA 2MMYA 2D3OR 1WHXA 2DNLA 4TU8A 2D9OA 2NZ4A 2DGSA 2CQBA 4FXWA 3TP2A 3UD3P 2J76E 3CMES 5H1SV 1SXLA 3CCVS 1U6BA 2ZJRQ 2DGOA 3L3CA 1OIAA 2DGXA 1OWXA 2BZ2A 2KI2A 2KXNB 4ED5A 3S01A 3LPYA 4TU7A 3R1HA 1FJ7A 4F26A 4Y00A 2MYFA 2GHPA 4CIOA 2F3JA 3UCUP 2MZRA 3NNCA 2E5IA 3D2WA 2AYEA 2JX2A 3TYTA 3NNAA 3Q2TC 4C4WA 3NNHA 2E5GA 1U1QA 1K73T 2RQ4A 4FXVA 2NLWA 5DDPC 3CCLS 2LCWA 2K8GA 1KQSR 3EGNA 5CA5A 5GAHU 1SJFA 2XS7A 2MKCA 2RQCA 4QU7A 1D9AA 2MZTA 2HGNA 3MDFA 4F25A 4IOCQ 1YJ9S 4YUDA 1HA1A 3ZZZA 2D9PA 2MY7A 2PEHA 3J7YU 2CQ3A 1SJ3P 4Z2XA 2KM8C 2DNZA 1DHMA 1FNXH 1N8RT 3CCSS 1FJCA 2DNGA 1S72S 1VC0A 1ZZNA 2M70A 2XB2D 1QVFR 1AUDA 4UQTA 3MURP 1Q81T 2Q79A 2ADCA 1VQ5S 2MSSA 3U1LA 2KRRA 2CQGA 1R8PA 2RU3A 2MJUA 4EGLA 3CCES 1PGZA 1M5OC 2J0SD 4P6QA 3BEGB 2LKZA 3H2UB 1JJ4A 1M90T 2OTLS 2DNMA 2LQ5A 1OO0B 3VAIA 1YTYA 2CQIA 3IWNC 2F9JA 1RK8A 2DITA 2XS2A 2ERRA 2KYXA 3CD6S 2XNQA 2DNKA 3VF0B 2M88A 3K0JA 5IQQA 2JRSA 2EK1A 4CH1A 1HD0A 1H2TZ 2EK6A 2LEBA 4WFNQ 2RVJA 1M5KC 3S8SA 1QVGR 1X4CA 2MGZA 3VAHA 3P5TL 1YI2S 2MKKA 5DDRC 1UAWA 2MQNA 4F02A 1JJHA 5FJ4A 2LEAA 4LJMA 1U1RA 2KU7A 2E5HA 2KVIA 2RS2A 2KG1A 3LQVA 2DGWA 2DIUA 2G0CA 2GO9A 5GAEU 4W90B 2LMIA 5LSLA 2FY1A 3VAJA 2I2YA 1N54B 3J7ZT 2X1BA 3G96A 2DH8A 4W92B 2RRBA 3CCQS 2CQ2A 3THPA 5HO4A 1U1LA 2CPIA 1WELA 3JB9k 1FHTA 2CPJA 3RW6A 1YITS 1WTBA 2MPUA 3S7RA 1VC6A 3PIOQ 1WEYA 3CCRS 2HZCA 4V19X 1Q86T 3CMAS 1N52B 1WG1A 1IQTA 2M7SA 2CPZA 1Q7YT 1SJRA 3IRWP 4ZKAA 2ZJPQ 3TO8A 2DNYA 3DLLQ 1WEZA 1VQ7S 5JVHQ 1KOOA 3BO4A 2F9DA 2M2BA 3CCJS 2DO0A 2X1GA 4CH0S 2AYGA 4WF9Q 1VQ4S 5EN1A 1URNA 1DZ5A 1YWXA 1VQ9S 2MKSA 3UCGA 1YIJS 2CJKA 3MUVP 1N88A 1VBZA 5BJRA 2QEXS 2WBRA 1WF2A 3CCUS 3EX7B 2RRAA 3B4DA 3VAFA 2MQQA 2LA4A 1O0PA 5HL7Q 2MGZB 5LXYA 1WHWA 4OZ1A 1H2UX 1VBXA 2DGTA 3P49B 3UD4P 5MLCV 2KH9A 1X4EA 1WF0A 4WFBQ 3R27A 2DGQA 3P3DA 3MUMP 3DXBA 5CYJA 2X1FA 3CULA 2KXFA 5DDOC 1WI6A 1A9NB 1X4BA 2DNRA 2AD9A 2RNEA 3UE2A 2N7CA 1KD1T 2DH9A 3MD1A 2U1AA 2ADBA 2KM8B 4Y0FA 1SJQA 3MUTP 1XN9A 1FT8A 1P27B 1M5VC 2MZ1A 1L3KA 4WFAQ 1DBDA 3G71S 2KN4A 1YJWS 5DM6Q 1SJ4P 2M9KA 5ITHA 3CF5Q 3R1LA 3S6EA 1UW4A 1OPIA 3V4MA 2KHCA 2G1DA 3THTA 2DO4A 2XSFA 1PO6A 1HD1A 2CQ0A 3SDEA 2DHSA 2VONA 1F9FA 5DM7Q 3CC7S 2RT3A 2VODA 2OSRA 1WEXA 4WCEQ 1UP1A 2QA4S 1K8AT 3NS5A 3UWTA 5IM0B 2EVZA 2CPYA 2N3OA 4PRFA 1X5OA 2DHGA 2DIVA 3CUNA 5D77A 2YWKA 2LXUA 1X4AA 1FO1A 3CC4S 1P1TA 2MB0B 3OW2R 2K3KA 2L41A 1FXLA 2DNOA 2DK2A 4YB1P 5LXRA 2DNPA 3H2VE 2DGUA 3G8SA 3VALA 2CQ4A 2X1AA 1U1PA 4UY8T 1G2EA 1D8ZA 2CPHA 1H6KX 3VAGA 1VBYA 1NU4A 2CPDA 2FC9A 3US5A 4RU2A 2HGLA 4QU6A 2M52A 2DNQA 3RW7A 2FHOB 1YJNS 5DETA 2A3JA 2VOPA 4M5DB 1KOHA 5GVQA 1WG5A 4TLQA 1A7GE 1S79A 4TU9A 4IUFA 2CQ1A 3B4MA 1U1NA 2RUGA 5LJ3Y 3P6YC 2CQDA 3NMRA 1FJEB 1U2FA 2N3LA 4OZ0A 2SXLA 3ZZYA 1X5TA 2CQCA 1RKJA 4WIIA 1VQOS 3G9CA 1X4GA 1KC8T 4PKDB 2JVOA 3Q2SC 2VOOA 2HGMA 1DRZA 3HHNB 1X4HA 3CPWR 3FEXB 4YOEA 1UFWA 2E44A 2CQHA 2LXIA 2JVRA 2MZSA 1X0FA 4PR6A 2DNHA 1BY9A 2CQPA 2RS8A 3I55S 1HL6A 1QM9A 2HVZA 2MKJA 2LA6A 1B7FA 2DGVA 1M1KT 1X5SA 2KRBA 1WG4A 1VQ8S 3NS6A 1M5PC 2MSTA 2M0GB 1JJ2R 1K9MT 1X4FA 4QPTA 2KG0A 2QFJA 2DH7A 2CPEA 2AYBA 2N82B 2XNRA 1WI8A 2MQPA 1X4DA 3BO2A 2OTJS 4BS2A 5GAGU 1Q82T 2ZJQQ 4LMZA 5D78A 1U6FA 1U1KA 2E5JA 4C7QA 2DISA 5IM0A 3CXCR 1VQPS 2L9WA 3MOJB 1WHVA 2BOPA 3I56S 5JVGQ 2CPXA 5DDQC 1VQ6S 2JWNA 5LSOA 1YHQS 1U1OA 3VAMA 2FPHX 2AYMA 2KXHA 2MHNA 2MKHA 3SXLA 5IFMA 4WKRA 4LIRA 4QQBA 1VQLS 2U2FA 2DHAA 2MJNA 1VQNS 2L08A 2OSQA 3SDEB 5GADU 2G4BA 2DB1A 3EGZA 2MKIA 3CC2S 4J5OA 2MZJA 2MQOA 2OIHA 2MQMA 2KT5A 2J0QD 3CCMS 1WWHA 2V94A 3MD3A 1ZZFA 2LECA 1R8HA 2B0GA 3VAKA 3CTRA 2M4MA
chains in the Genus database with same CATH superfamily
4ZLLA 3TA0A 2ZWOA 4PXCA 1Y3KA 2MY8A 3CJ2A 5CYMB 2YKNA 3A3PB 4QJVA 2V4JA 4ZIVA 1SUQB 3KJFB 4B3OA 1NJIT 2AMCB 2JSXA 4EI2A 2HMIA 4WP3A 2BQUA 3DM2B 3DHWC 3MM6B 1KEKA 1GH8A 2YKOA 5KFTA 2IDLA 2FHKA 2BM0A 3BS9A 4V1Ak 4DDFA 1UETA 4F4YA 1RTDB 1HI0P 1IM6A 1S12A 5F41A 4NZ6A 2HQ3A 2Y1RI 1KQKA 1KDNA 2DJWA 2FIUA 4I69A 4MMOA 3W7BA 2MXYA 1WHYA 1WORA 1VQKS 4HI1A 1TVRA 5HROA 3I4PA 3Q22A 3U1NA 1RACB 2AKWB 2O3DA 2YH0A 3K5PA 3IN5A 1RTJA 2BACA 4TN2A 4MT1A 4ECWA 1LW0B 1RWWB 2MQLA 3W8GA 2R8GA 4PPZA 5KFCA 4X4VA 4IO9Q 1SH2A 3DRYA 1FEHA 4D3HA 3PIPQ 1NKEA 1RA6A 1WC5A 2HFOA 3DLGB 4TVAB 1SUQA 1CC7A 1S97A 1FVQA 1RAIB 1TKZB 2YX1A 2BYCA 4ZVHA 3SIPB 3GCWP 5D0HA 4AXJA 2BW2A 2QLXA 1RDRA 4J9VA 3OHBA 2HHHF 2AP6A 3PJWA 5LJ5Y 4FBUA 2Q6CA 3M2VA 4YQWA 4PEOA 3UR0A 3BO3A 2D1CA 4B3MJ 5C5JA 5GMKa 2DY1A 1U24A 3VV2B 1JLQA 4DOZA 3QNWB 1URRA 4U96A 1WHXA 2DNLA 2XI3A 3D0IE 3KHRA 2DPJA 4B9TA 2DR7A 2QMXA 1VLYA 2CQBA 2LEPA 2ZOFA 3HK2A 3M30A 4LF7J 1R8BA 2J76E 4M5HA 1BGXT 4DPOA 2F1FA 5JUMA 3CMES 4YEAA 2UXBJ 1RWOB 1VOMA 3DDKA 4RKUC 2FTRA 1SXLA 4OHVA 3NGSA 3NP5A 4ZCLA 5H1SV 2XMAA 5HJYA 2ZJRQ 4OV1A 1TFYA 1NPRA 1S4EA 1VBKA 3LALA 1IQZA 2NS1B 1KP6A 1OIAA 2DGXA 2G2OA 4O44B 5DQGA 4DV1J 2ZH3A 1OWXA 4KJIA 3GSIA 5C25B 2IBKA 2L3MA 3ELHA 3FKBA 3OTDA 2FZGB 3TVZA 4CO1A 4CLLA 3LPYA 5F8HA 1Y9OA 2HS3A 4DX5A 5EWEA 3M8RA 3M6XA 5EGYA 4AL7A 1PO6A 1FJ7A 3GIJA 1WTFA 2R2UA 2HIQA 4OI4A 1REVA 3CD0A 2MZRA 4J9RA 4ED1A 3HJFA 2EI5A 1C0UB 3GB0A 2HIYA 2CJAA 1RAAB 2EXUA 5D0GA 5HQLA 3KLHB 1IWGA 3Q2TC 4DR6F 2C3YA 1N34F 3GU0A 2FY8A 4IDKA 4X65J 3KLEA 2CNKB 4F4AA 3NNHA 2KJWA 2GS8A 4USHA 1NK8A 3PFEA 5GAHU 1GX6A 3PJXA 2FHMA 2RQCA 2XS7A 5AE1A 5T14A 1DLOB 1HMVA 2IVMA 2MZTA 3AXMA 4H4KC 4NLOA 3JSBA 2HGNA 1Y11A 4F25A 1RQ0A 1TV6B 3DOLA 3KKFA 3PYDA 3JTPA 4J9KA 3W8PA 2VASA 1T0TV 1HA1A 3UNYA 4C8LA 3DLEA 3FFIA 2V2QA 4FNIA 3GYNA 1NPPA 4PG7A 3KLHA 3J7YU 3HHEA 1YZ7A 4KV8B 1TAQA 5D8HB 1SJ3P 5B08A 1DHMA 4HDHA 2OPPB 4RWXA 2WVFA 2QV6A 4DJBA 5DG8A 2ZH4A 3LWLA 3QWPA 4WP9A 4PQAA 2WSCC 2O01C 2WVEA 4IUFA 1AUDA 4CYUB 4ECRA 2ZUAA 3MURP 3KJVA 3MM5B 4DMZA 1Q81T 1RT2B 4FYWB 2HFZA 2ADCA 3PFOA 5LOQA 5IWAJ 3PO5A 1RHJB 5FDLB 1YQHA 3UN3A 3AOBA 3RAQA 3U1LA 1I3OB 2KRRA 3TOQA 3CCES 2ZHAA 3BREA 4FS1A 4NZ7A 3A8JA 4Q44A 3NGDA 1JJ4A 1E6VA 1M90T 4S0MA 4JI5F 2VV5A 4C8MA 2E9RX 2QE5A 4ECVA 4K4ZA 3J7Z5 3PYGA 1S48A 1S57A 2BKNA 4ZPAA 4IRKA 5J1EB 1P9YA 2XMJA 4OL8A 2J9CA 3MTKA 4K5SA 4PABA 3UD5A 3Q23A 3T5LA 2C22A 1VRQC 3IWNC 1VHFA 1FWPA 1LV5A 5GAGI 2ASJA 1ROFA 2E9ZA 4CLFA 4QYRA 4GMKA 1FNMA 2BVZA 2M88A 3MMAB 1ITPA 4I6WA 5ETKA 1Z2LA 3A13A 1MWZA 2EK1A 1HD0A 4DV6F 2EK6A 3FCWA 1CEZA 1MW7A 3FCHA 1CPZA 2WRMA 2GMJA 3GJRB 3MM6A 4NWBA 3WHIA 3GYGA 1X4CA 1SH0A 2A1BA 3ZTPA 1NJXA 1K1SA 2FHJA 2HVHA 1ZM2A 2AJQA 5DDRC 2VFSA 2YPZA 1PIEA 2MQNA 1JJHA 3MEDA 4F02A 5FJ4A 1T9UA 3VVUA 2G13A 1Z2ZA 2KU7A 1HBMB 1KTVA 2E5HA 2VUGA 3ZFVA 4URGA 4AL6A 5AE3A 2RAQA 5J1NA 2AX0A 1WDTA 1QJHA 3LANA 2G0IA 3DMJA 1H72C 5GAEU 4XIUA 1U47A 2HQIA 4J7CA 2LMIA 4N8OA 4M5KA 4W90B 1F3FA 1RT6B 3AJ2A 1FD8A 3GLJA 3TWZA 1NXIA 4LQ9A 5LSLA 3VAJA 1W2IA 2EBGA 1GTEA 3QIPA 2FLNA 4FKYA 4LF6F 1R0BG 2IFXA 1BE4A 2DH8A 4YDDB 4J9UE 1HR0F 4W92B 4QYZJ 2AGOA 1IBCB 4EO6A 4RUHA 1ZPVA 2HS4A 2FGCA 3JS9A 2GA7A 5BYRA 3THPA 4WU2A 4DSEA 4FXDA 1U1LA 3PX0A 2QYGA 2FB0A 4TY8B 2MLZA 4F50A 4ED0A 3CVKA 2AHOB 5HK4A 1WTBA 3RW6A 3LWMA 4CWBA 4J9SA 2BANB 1IBLF 2QX0A 5L1IA 2HZCA 3LW5C 1Q8LA 2PFFB 4X66J 2MKYA 4DQRA 1R0CB 3CMAS 5U47A 2Q1LA 3NBPA 2Z56B 2M7SA 4NXMJ 1VRUB 3I0SB 1Q7YT 1FJGJ 1SJRA 3HZEA 1R0AA 1V3SA 4DCOB 5LT5A 1F5AA 2W25A 1XEZA 2ZJPQ 4B9MA 4JI7J 1EQ0A 4DUZF 3DLLQ 1FCAA 5DQHA 5F8MA 5KFJA 2OELA 5JVHQ 1UEVA 4K4XA 3F41A 2KJVA 1JWWA 3T9ZA 3PXGa 3AY0A 3M4XA 2ZM6J 2XMVA 3BH7B 4OLPA 5L1LA 2N3OA 1RT5A 1ZOTA 2BJ1A 3IO1A 1V3ZA 2VKZG 3O6QA 4LR8A 1YWXA 4BWMA 1VQ9S 1CLFA 1RAOA 4AUKA 3W2VB 4Z7YA 3NCPA 5H9EK 3MECB 1N88A 5A8WB 2HVDA 4LIWA 2WB4A 3CJQA 2FGOA 1D9DA 2VG6B 4EUVA 3ET6B 5KFNA 1F9EB 3NGUA 3HXMA 4K8RA 1FJGF 2RDDA 4XAKA 3Q8PB 9RUBA 3CCUS 2IMWP 1Y00A 2RQKA 4P2MA 4Q0BB 2MTLA 3UQSA 1IXKA 2I9SA 4CLYA 2O1PA 4ZPWR 2Z58B 1T05B 1HNWF 4DL6A 1T3OA 2B4UA 1EETA 1HQEA 4IH7A 3CB4A 4USTA 5HL7Q 1SBRA 1HMVB 2ASYA 2CVIA 2AX1A 2MGZB 1N5YA 4XPEA 1OS5A 3FQLA 4YDXA 4DXLA 2DGTA 1VBXA 4DL2A 2M5YA 4HYKA 4O0IA 1G4CA 1HNZF 2HNDB 2H9ZA 3FMWA 3GP9A 3E01B 4R8UB 4QWEA 4KHPF 1BWEA 1SKUB 2W1BA 4CTAB 3IBCB 4JUZA 4WFBQ 5LMNJ 3PDNA 3LAMA 1VK3A 3HX9A 4M5NA 4U95A 1SL2A 4DUTA 3V6JA 3WC2A 4IQXA 4MYUA 2XGQA 3MZIA 3IR7B 3NRBA 4LF6J 5CYJA 1C1CA 3NAHA 5A0YA 2KXFA 2OPRA 3ZTRA 4HLBA 2AF6A 4R5PA 2AD9A 3UE2A 1FFSB 1S6PB 4B3RJ 2CNOB 1EETB 3HSGA 5HVHA 5E3PA 1YDLA 2MHEA 3GIKA 3MD1A 1NHVA 4I6YA 2KM8B 2HRTA 2YQ1A 1BQMB 2A0FB 2GX8A 5E3CA 5FDLA 4C97A 4K0KJ 3DNCA 2DTJA 4JV5F 1R89A 2HBRB 1QAXA 2MZ1A 1J27A 2HNDA 3DN9A 1IKXB 2LDIA 3GJSB 3H25A 2F63A 2A18A 3K7RA 1DBDA 1E6VB 4X64F 2IM2A 1WC4A 2KN4A 2CG4A 3DCAA 3JQMA 4A8YA 2NXCA 3PO4A 1XK8A 2XZWA 3EDRB 1UCNA 3FSXA 1I6JA 2J6UA 1MU2A 5ITHA 3I82A 1KN6A 1IN0A 5KFXA 1FKPB 4M5DA 3KK1B 4U7UK 1MMNA 3AHPA 5KG6A 1C1CB 4OYMA 3RBDA 1P1LA 4HACA 3S6EA 4LF9J 5A0YB 4ZDNA 2BV3A 2KVQE 4U7UD 1X0PA 2AJ2A 3AA9A 3THTA 3G8QA 4DL5A 5KG7A 5K9FA 2HQDA 1GNKA 1VQYA 1HD1A 2CQ0A 1LWEB 3DI6A 4ANEA 1WJ9A 3NOCA 1FFWB 4JB8B 4F4XA 1FKOB 2CWKA 1BQMA 3BSAA 4PWWA 3RB4A 3CC7S 2VODA 1HWIA 2OSRA 3I31A 5E33A 3GCXP 5DJBA 1S4FA 1UP1A 4RR5A 2IM1A 2GVDB 3UWTA 2OPSB 4B08A 2ATCB 3OLAA 2EVZA 3MEGB 2CPYA 3KXDA 4QW9A 2P2CB 1TUGB 4U6PA 2XHWA 3QMQA 2BQRA 2C3OA 4RL1A 4ZVOB 3KK1A 4DV3J 2QJ3A 1Q5VA 2GMLA 2YNFB 1P1TA 1VIOA 3EVOA 3IFEA 1CULB 4ZHRA 2W9BA 4DLGA 1N56A 2QSFA 2L41A 2H4WB 1FDAA 4L76A 4RO0A 1GMWD 2CA9A 1RT6A 4IFYA 4ZP7A 1ACMB 3L9ZA 1TMJA 4CLTA 3KJVB 4YB1P 4JV5J 5B0GA 4UW2A 1LWXA 2DNPA 2HQGA 2YNGA 3O5TB 3CJ3A 4USVA 3EMTA 3AXKA 5KFUA 5K20B 2GV1A 5L39A 5L1JA 4FYXB 4J37A 1KHVA 4WXOA 1FK9A 4XDCA 2UV8A 5D4PA 1FVSA 1RWNB 5IOLA 3OTEA 1VBYA 1ZM3A 2D69A 5HP1A 1M1GA 4ED8A 5A8KB 3PNIA 1YBTA 3UFCX 3OXGA 4DV0J 2IY5B 1SH3A 3RW7A 3QJPA 5DETA 1GT8A 3B8HA 5B0CA 1S0NA 2LQ9A 3HO1A 2K7KA 3C16B 4ZJLA 2XM3A 3IS9A 2CWXA 4TLQA 1QLNA 1A7GE 1S79A 5A6PA 1RCXB 3MMAA 2CQ1A 1WKLA 3DOMA 5E7OB 4IG0A 1UVLA 5F0UA 1T3NA 1QTNB 5IZHA 5LJ3Y 3P4UB 3DYAA 1NK0A 3PCOB 4B3TJ 3P6YC 3MGJA 4JI0J 3KJQB 2V69A 2XHCA 4DG1B 3B78A 1U2FA 4WE1B 3QWUA 3K5LA 1N32J 1X5TA 1Z4UA 2CQCA 2QT7A 3H7HB 1F5BA 2HEKA 3ZZPA 2NXEA 4DV2J 1RKJA 4Q8FA 3TANA 1LK5A 3CDWA 2QC3A 2CIMA 3TJ9A 2IRUA 3THVA 4KY3A 1M5SA 1D9FA 1U25A 3FC9A 1VQOS 3MPVA 4ZVFA 2HNYA 3D68A 4UTGA 3GZ7A 2W4PA 3MCOA 2YXLA 4PKDB 5K14B 2JVOA 3Q2SC 4ILLA 2XWYA 1N33F 2ZH5A 4LF5F 2PN6A 2HGMA 4U8VA 1X4HA 1PKUA 5AXLA 3PG9A 4KPCA 4DS4A 4YOEA 4IG0B 5B0EA 2VFVA 3W9IA 2XWXA 2V50A 4YB7A 1QAIA 3ZZRA 1F2GA 1LXJA 2PSZA 3GR1A 1TL7A 2LU1A 3AT1B 5ETSA 4YMEA 4RU9A 2Y8WA 1YK9A 2Y1JA 2MZSA 5KG1A 4HI2A 1GFWB 4K4TA 4NX9A 1N5QA 5CH7B 3NGTA 4PR6A 1F2HA 2NUUG 2WW8A 4JI7F 1BY9A 2CQPA 4ED4A 1N5YB 4UUWA 2UXDJ 5IV3A 2RS8A 3LP1B 3KMQA 2HVZA 1QM9A 9ATCB 2LA6A 5AE2A 4CO4A 3GIMA 3MM9B 1TQLA 2CFXA 3C2PA 2DGVA 1CJVB 1F3VA 4CLSA 1H0HB 1M5PC 2ZBPA 3C6UA 1O6XA 1R7IA 1NSKL 3M9MB 1KLNA 3DRRA 3HSJA 3DLGA 3MEEA 5IC6B 5C2CA 3H4BA 2E29A 4C3LA 4USJC 4I68A 3I0SA 3IGVA 4DLEA 4OJ3A 4Y2KA 5ETQA 4DL4A 3R6GB 3OJSA 5I42A 4U7CA 1WD6A 5L8RC 5SZTA 3GFXA 4RNOA 1OPZA 2MQPA 5HSPA 4FDFA 4P7TA 3W63A 1KQFB 3KYLA 4FF4A 2VF3A 2OLWA 2YQ3A 3L09A 2OMLA 3QT6A 2IJFA 1FE4A 1HNIA 2PDAA 4FNHA 4RBVA 2VFTA 5H9FJ 3KWMA 1Q82T 5D78A 1U6FA 3BV8A 1EAYC 4PXDA 3I0RB 1U1KA 3ZZTA 2DISA 1TL3B 3ILIA 6FDRA 1E6YB 2L9WA 3F56A 3CJ0A 4C3KA 1BC6A 2W4DA 3A1YG 1JLQB 2BOPA 3IG1B 1EQMA 2CPXA 3K8VA 4MAKA 2XCAA 5I3PA 1N0VC 2XMKA 5JVGQ 2IYIA 3QAUA 3DRRB 3R5CA 5H9EJ 2FVRA 4IOBA 2AYMA 4QCLA 1GAOA 2JHEA 1RCOB 2MHNA 3EVMA 3FZBA 2JEGA 4YHHJ 2QLWA 2U2FA 1Z1ZA 1BWVA 2RMLA 4J9PA 4LRCA 1KR4A 2RHSB 3F0NA 8RUCA 1T05A 3OUYB 1KRPA 4O44A 4YR0A 3M8SA 1VQNS 1LWEA 3DI6B 3IR6B 1W25A 4OJGA 3G82B 5J2QB 3NCQA 1X9SA 1S0VA 4MFBA 3I9V9 1QAJA 2HFSA 3TQ1A 4J5OA 2MZJA 1ZA1B 4MJKA 3HF5A 5KG2A 5HLFB 3TRGA 1E6YA 4Z7CA 5KT7A 3ILOA 1H74A 4C48A 1PYSB 4ZJQA 5I3QA 5IV4A 1VMBA 2V94A 4QW8A 3GG1A 3M8PB 4CTAA 3V81B 3D1QA 2NYIA 2F65A 1B0VA 3N4WA 2BJ9A 1PAEX 3M8QA 4OYWA 1Q8BA 4CNYA 5L1KA 2V6AA 3CTRA 5JMNA 1FX4A 5KFZA 5KFEA 4XO0A 1UWBB 4OZLA 2FC8A 4TKTA 2CG8A 5KFLA 1U1MA 1WF1A 3I96A 3MF5A 3LP2B 1XBWA 1RT7B 1NJZA 2MZQA 1JLFA 4RUCA 2OFGX 3OUYA 2C2OB 2LFVA 3DGPA 4RW7B 4Y28C 3WIVA 2B5JB 3SQGA 1UFLA 2C2KB 5KFRA 3I32A 4QIFA 4Q45A 5CXTA 3R9LA 4YN3B 1HNWJ 2M8HA 3CJKA 2UUBJ 2IPOB 3KUHA 3U27A 2IAJA 1EHWA 2R8KA 2RE1A 2J0XA 2I38A 4ETXA 4ZP8A 1IKWB 1KVKA 3FSIA 2H5EA 4M1KA 4ER8A 3V81A 2I0XA 2W7AA 4H54A 1MWYA 4CQ1A 1CJUB 3C15B 5L46A 1X5PA 2RU9A 2KL8A 4NCGB 5IT0A 1T03A 4UY85 1DJ0A 3BKFA 1HBNB 2Y9HA 3HI9A 3C16A 3UCZP 4OI3A 2Y0SD 3OV7A 1IUJA 4MIBA 2RD5C 1RT7A 4ZVGA 2XYHB 1WDDA 4O0NA 4PPDA 5KG4A 3H5YA 2BABA 2HHXA 3FZ2A 3CSKA 3OR1B 3MAHA 4MIWA 3W60A 2HVEA 2L9DA 4A8XA 5HMXA 4EK2A 5KFGA 1HWJA 2LP4A 3GV8B 5A6WA 3PW5A 2XS5A 3G8TA 4EO8A 1T7PA 2ZNYA 4ZPVR 4ERDA 2GVDA 2GAGC 4U9RA 3CJTA 3D3BJ 4ZCMA 4QBUA 5T41A 2HWTA 3CO9A 4X65F 5D0EA 5GAHI 1F1BB 4P2FA 2KFYA 4EEYA 4B9SA 2AZ3A 5HP1B 2HNYB 5C25A 3SZ2A 1I94F 4DWIA 2NZ4A 1T9WA 1JNRB 3TP2A 3MR3A 3UD3P 1RWXB 2EKYA 2GIQA 4P71A 4ZVPB 4DR4J 3OTBA 3UR3C 1K44A 1N5VA 2E1RA 1FWLA 4LVNP 2BE7D 3CCVS 1TFWA 3NAIA 5KFOA 2GO8A 3CW2C 1M1HA 2LXFA 4GO7X 1IJFB 2ILZA 2Y0BB 3L3CA 2P5VA 1XNQF 3KMSA 4C8KA 4RWWA 3QGIA 2BZ2A 3R5AA 4DV1F 4RNHA 1N36J 5KFVA 2FDNA 3S01A 4TU7A 5FIIA 1SCJB 4F26A 1IKYB 5F0WA 4Y00A 2LDYA 2MYFA 3BPSP 3KHGA 1HPZB 2B6AA 4CIOA 4LVOP 1AZSB 3HVWA 2GCFA 3N5BA 2BBEA 4WWSA 1XMBA 3NNCA 3ENWA 4AXIA 2E5IA 2IM3A 1KFDA 1CJKA 4E0DA 4LRAA 3BGOP 5KT2A 2JEJA 3PACA 3NNAA 2K1RB 3MPDA 3H42A 3RB3A 4X62J 1S9GB 4DR3J 3C46A 4DR2F 1LXNA 2NLWA 1UZHA 2DCUB 2LCWA 4FP9A 1VQSA 1S6OA 3C19A 4QR1A 2K8GA 3DYAB 4PXBA 1BLUA 2GMHA 5KAKA 2BKPA 1JLGB 4KSEB 2VH7A 2UZAA 2MKCA 2VBXA 1TU0B 3KG4A 5DS7A 3DKDA 3GYXB 2GZOA 4QU7A 3N01A 1JKHB 1RHQB 4LFCF 5GAEI 4O3NA 2L9NA 2V34A 1HQUA 4F4ZA 4WTOB 4YUDA 3QBCA 2QO3A 4DFMA 3OTOJ 3LH2S 3CJRA 1QTMA 1EIYB 5HATA 2D9PA 1HBOA 4O3SA 3PHEA 3O44A 2MY7A 4L6V3 3F73A 3SCLE 2C2ZB 1FNXH 2CJ9A 2KM8C 1MSWD 2QZ8A 2ZD1A 4CLKA 3KJNB 3HHLB 3HKWA 5AXKA 2VU5A 3IRXB 5HBMA 1OSDA 4LSLA 3VALA 3NBPB 1FJCA 1S72S 2ZZNA 2IA0A 2M70A 5LMUJ 1U26A 2BXJA 2R7XA 1K47A 3OL6A 1XR7A 3HT3A 3W5ZA 2E66A 1DTTB 3W5YA 5IWAF 5D0RA 4ANDA 1XC9A 5J2MB 4BDPA 1S10A 3T5JA 2W8KA 3V6DB 2D74B 1N48A 3CD5A 3LGNA 3OL8A 1R8PA 2RU3A 1Q8IA 4NA2A 3WDOA 1U8WA 2V67A 4JV1A 2VPWB 4P6QA 4BCAA 1RBAA 2LKZA 3H2UB 2AQ4A 4KTQA 2HHSA 2W4CA 5L9NA 2ZBIA 2OTLS 1QD1A 2LQ5A 2XCPA 4ECXA 3VAIA 4RW6A 1N36F 1D0EA 3KLIB 1DQAA 2XBPA 1F9HA 3NY0A 4DEZA 3D6FB 2UUCF 5BR8F 2F9JA 2DPIA 3B6BA 1JLCB 4USWA 5B09A 2R2SA 3QZ8A 2UU9F 3K0JA 2Y3YA 2BJ7A 5IQQA 3M6VA 1HHQA 2BA9A 2JRSA 3OVSA 1RTHB 1H2TZ 4WFYA 1LFPA 2W2PP 3QATA 4WFNQ 1APSA 3S8SA 1BQNA 2WSEC 3C6TB 4F0KA 1D8YA 1HNIB 1OYEA 2GHVC 1S1XA 2ZHOA 3FBCA 2MGZA 1YJRA 3P5TL 1BQXA 4B3SF 4CLWA 2KFNA 2FJEB 2MKKA 4O3PA 3WBZA 2E5LF 3ZZ0A 3M32A 4R8UA 1TKDA 5KFYA 1OY8A 3BYPA 1S6UA 2LVWA 3W2WA 2WOMB 4N56A 5A2QY 3MAAA 2KVIA 3DLHA 2UUTA 1UPPA 2DGWA 3LQVA 1CC8A 2PT0A 1NUEA 1RHKB 2W8LA 2PO4A 1RBLA 3CDUA 4JBCA 1LW2B 1HBUB 4ID5B 3ZXWA 2G0CA 1RT4B 4DR1F 2DR8A 4GRSA 1MN9A 4WTYA 1KLMB 3JYTB 2FY1A 1DAXA 3TAPA 5CAAA 3DFEA 6AT1B 4R5PB 4ANCA 1N54B 1RTHA 3CIZA 3GFYA 4OIXA 4LRBA 2POKA 1RLDA 3OR1A 5C42B 2B51A 3PYFA 3ISND 7FDRA 4WFZA 1WACA 3TZXA 2RRBA 4OHZA 4YS2A 2VQFJ 2A2DA 3DRSA 3HVTA 2YKMA 5HMYA 4DF8A 4DQIA 4CO2A 2RHQB 1V9OA 3I5BA 4WBFA 4EBCA 1WELA 1JLEA 5GADI 3KTQA 1UVMA 1FHTA 3MM8A 4KO0B 4LF7F 1S9EA 1NHKL 4CM0A 1YITS 4JYAJ 4LBIA 3S7RA 1VC6A 3TZYA 1UJ6A 2J5AA 2W2QP 2ZVIA 4K5RA 3CCRS 1Q53A 2J7WA 1LW0A 3CDBA 3G87A 2AIRB 4PZVA 4JI6F 4YY3F 4V19X 3CDEA 1CG2A 2W2OP 4ZPCA 4G1IA 3CGIA 3C8YA 2RDJA 3CWJA 4PG5A 1IQTA 3BSNA 4B9UA 3TAMA 1FEEA 5B7WA 1QE1A 4I7FA 2B9EA 2PFDA 4OX9F 2IVFB 3IRWP 5J2NA 1TKZA 4BBYA 2ZH9A 1L3TA 2R7VA 1EKSA 1KWMA 2RUSA 1WEZA 4OYPA 2XO7A 4JI6J 3ITHB 3MMBB 3EWGA 1S0MA 1UKUA 1R6VA 4OLOA 3N6LA 3CJKB 4HKQA 2E1CA 4DQSA 4RUAA 2M3DA 2ZNZA 1S49A 3BO4A 3CCJS 2M2BA 4WF9Q 2DO0A 5EN1A 4CH0S 2AYGA 4LFAF 3BDEA 4EZ6A 3M2VB 2EFPA 4X4OA 2JJ4D 1DZ5A 2EC2A 2R4FA 3LPEA 5G0RB 1HPZA 3TA2A 1SKSA 2V63A 1RT1B 2E7XA 1HKAA 3ENQA 4KYZA 2GW8A 3RJMB 1S6QA 5BJRA 2NREA 2YVSA 2QEXS 1GEHA 2WBRA 2V0NA 2W9BB 2XEXA 2PEBA 1AFJA 2JZ5A 1FRIA 4ZPBA 3Q8RB 1IBMJ 3W1YC 3P45B 3D6TB 2X51A 4WFXA 3Q8SB 3EX7B 3PZPA 5GMEA 1NB2A 4DR1J 3NKYA 3UNGC 5HI7A 3NXZA 3LF0A 3AODA 3VWSA 2CJYB 2BMBA 3GIIA 4B9VA 5EUHA 1B0TA 1SC3B 2AT1B 2J9DA 5KG5A 1WKKA 4A4JA 3OJUA 1UVNA 4FYYB 4QR0A 2B7CB 4DQPA 1O5JA 1IM4A 3T3FA 3P49B 4QWBA 4DCPB 1HNXJ 4JI1F 1SI9A 3QZ7A 1UMJA 1TK0A 5MLCV 1OQ3A 1X4EA 2KH9A 1W7WA 3M6WA 1LQ9A 3TX8A 3AB4B 1KQGB 5SUHA 2XQCA 4DL3A 2QSWA 4CT9A 2NPIA 3MUMP 2XTJP 3DXBA 4DFPA 1XMQF 2V68A 3BKUA 2EFGA 4RBTA 5DDOC 4NCBA 4L3KA 2DKOB 2VFUA 2RQMA 1KD1T 2BRLA 2AYBA 3TUIC 3UO0A 4EBEA 1DTTA 2RB7A 4ETZA 2JH3A 3PR5B 4QYZK 1FDBA 1RSCA 3BF4A 1XN9A 4RNMA 3TUPA 3R6LB 2KKHA 3KUGA 3PEHA 1RYSA 3K5NA 4N76A 4A8QA 4WFAQ 3EYZA 2O67A 2XLKA 2H65B 2B43A 2JEFA 4KGZB 2RRNA 3FUYA 2M9KA 4NLYA 3CF5Q 2AZ1A 1PYOB 3R1LA 3ZTQA 1FFGB 1V5IB 1JLBA 1S9GA 4C3MA 4ZITA 4F0HA 1JLCA 2C2EA 2PI5A 2MEWA 5LMUF 4O4GA 2KHCA 2BE9B 3OFGA 4IG3A 3MR6A 1NB7A 1TL7B 1Y5NB 4UUXA 1ICEB 2F7VA 3WIUA 1RP5A 1CJTA 1U0HA 4IH5A 2DHSA 4OYAA 3SYZA 1XMOF 2VONA 2LU2A 2OHDA 1RTZA 2FQQB 2Y1IA 2RF2B 3MPUB 1GQEA 3OTOF 3LP1A 4LQ3A 2OMOA 1N5SA 3NS5A 3JSYA 1UVIA 1YLXA 4TQRA 3M2UA 4JI3F 4EYIB 4NZ0A 1LWFB 2WOMA 3G6VA 1Y7PA 1C1BB 4MK9A 4NPOA 1NSAA 3CO0P 5HQ8A 3HM9A 1JLBB 3CUNA 1FO1A 2XSJA 3CMQA 3GMGA 2F5GA 4IDKB 2VHGA 2D3O1 3OT9A 2ZDPA 3Q8VA 3GJTB 3HDSA 4I4BA 1XWLA 2K3KA 1TL1A 3RUBL 5AXNA 3OW2R 4M94A 4IG3B 4Y3CA 1KLMA 3JYTA 3SCIE 3RZAA 4DU7A 3T6JA 2GIFA 2HHPA 1V5VA 2YX7A 3H2VE 3MFHA 1DLOA 2YKPA 2X1AA 3G8SA 3V6DA 2DRAA 1D8ZA 4HTIA 2CPDA 5DZ7A 5MAOA 3QPIA 1R6YA 3US5A 2R3VA 4F36A 3E3XA 2VPZB 3PRDA 1TL3A 1JLAB 2DYAA 2HGLA 1RWKB 2RKIA 3FK4A 2FVCA 3M2UB 3JTNA 3MEDB 3OD2A 4LSNA 1UTAA 2W2NP 3SSSA 3R2DJ 2HHWA 1YZ6A 4CCHA 1RISA 2FHOB 3BBFA 4ICLB 5ETNA 2A3JA 3V4IA 1RU1A 4OZ2A 1X9WA 1XNQJ 1ZA2B 2VOPA 1KOHA 4DHVA 1TL1B 1WG5A 2UUWA 3CIMA 2ASLA 4P73A 1UVKA 5IXUA 4TU9A 2RUGA 2WW4A 1Y4ZB 1T94A 3DLKA 4WZMA 2F40A 3QIPB 4I7FB 4IR1A 2OAUA 4JI4J 2HAIA 3K57A 1AB8A 3J81Y 2P9GA 4NLQA 2QFIA 3G82A 1VRTB 3QT5A 4D3GA 5J2QA 4DU8A 1FRKA 1M0SA 1X31C 3MEKA 3MMBA 4FF2A 5KFKA 3LP0A 4K59A 4NLGA 4K50A 2AJ0A 3DC2A 4ZPTR 4MTPA 5HLFA 4WIIA 5IC4B 1TL4A 3EUNA 2CDRB 3N0VA 4M5MA 5F8IA 1IR2A 5LM7E 4UQGA 3FDSA 4X4RA 4AQYJ 3OL7A 1SIWB 5CHCB 2B4OA 1X4GA 1RTJB 4Q2LA 2YNHB 4X4NA 4ZIWA 4A8MP 4DSFA 1NJWA 3IBWA 1DY3A 4C0HA 1S99A 1R3NA 3T1HJ 1H3DA 3L7PA 4PXEA 3CPWR 5ADZA 4KC5A 3FEXB 4O3OA 3U7JA 1HR0J 3QJJA 4IRCA 3KLVA 3RAMA 3BDPA 1UFWA 2AV5A 1UL3A 2CZ9A 3LP2A 4GKJF 2APOA 1NZ8A 3L4BC 3JAMY 3OPKA 1R27B 1WOSA 1X0FA 2MLYA 2MQ8A 1ZAWA 4MKBA 5I4MA 4GC6A 1R8AA 2YWHA 1IJEB 1J5EF 2P6TA 3TEHB 1JLEB 2MKJA 1RT5B 4YR3A 1HBMA 1M1KT 1NDLA 1S1WA 2Z0GA 1X5SA 3M9NB 3AD7C 3W2VA 3ZNJ1 1RTIA 5JJBA 2HHUA 1WG4A 3DU6A 3FVYA 2MSTA 2WBMA 4ZMMA 4B3RF 1ZM4A 4H4KA 1WOPA 3H2LA 4DUYJ 2NQPA 3ZZOA 5K8MA 2KG0A 4M5LA 2WVCA 4B3OB 2DH7A 2CPEA 2N7YA 3D3CJ 2N82B 1Q78A 1G2EA 2QG9B 1T9TA 2CJQA 3UN2A 4ZK7M 3KNAA 4UOGA 3MWBA 2XY5A 1HQEB 2CKWA 3GG0A 4ES1A 1BUXA 4CT8A 2OTJS 5HVFA 4NLWA 1SV5B 5GAGU 3VCDA 4ZLPA 4KHPJ 3CD6S 3ENAA 2WZ1A 1JJCB 3MR7A 3B82A 4ZP6A 3HFZB 5G0RA 1FERA 1PC4A 1RB0A 2NUHA 2WONA 2ZUGA 5IM0A 4ED7A 4JV2A 2OGUA 4C8ZA 4DV7F 1B7YB 2J6SA 4DSLA 1X60A 2RSQA 1QSYA 1VQ6S 1PBUA 2JWNA 2DRDA 2HK2A 3ICLA 4HT7A 2DR9A 3R5DA 2HS0A 2FPHX 2VQEJ 1S1VA 4PWUA 2KXHA 2ZH8A 2HNZB 3SXLA 1C0TB 3VZIA 1YJVA 3H20A 4LIRA 4XPCA 2HHVA 4WKRA 2GQCA 4OI1A 2MJNA 4K7QA 2H1YA 2PC6A 2XGPA 3LO3A 3FGVA 1CJTB 3HHLD 2DY9A 3N6NA 1GXUA 4KAIA 2I1RA 2MKIA 4ES3A 1O8BA 3TR5A 4ZP9A 3O2IA 4LF4F 1PG5B 3K5OA 1TV6A 3DOLB 1JNZB 3IC1A 3PKMA 4GKJJ 3ZO7A 1AZSA 5KFFA 1L5UA 3TAQA 4CDIA 1K0TA 3R7SB 4KH1B 3UN5A 1WWHA 3CCMS 2J0QD 1ZZFA 5RUBA 4PQUA 1RA7A 1NK9A 4DUZJ 2LECA 1R8HA 2B0GA 3M30B 4QR2A 2QLFB 4AQYF 4DFJA 5E0OA 1L3UA 1NK5A 4X4UA 4F7VA 1RAGB 1CSJA 1JMTA 4O4RA 3R3TA 4LF1A 2H54B 1JLGA 2W01A 3NWGA 4QIGA 4EZ9A 4X4SA 3N9UC 3RYLA 1IBLJ 4DL0C 2VA3A 1T02A 2CRLA 3OFHA 3W3SA 3RGIA 3JAMU 2UP1A 3J7YI 2NSBA 2Z8QA 4HHJA 4UZBA 1IVZA 2YH1A 4Y65A 1REVB 3DOKB 1H2VZ 1XQIA 2DHXA 2FHJD 4OMFG 1HWLA 5B0FA 3U1MA 2ZFHA 2LYVA 2KFZA 4NXNF 5EX3A 2VL1A 3RRKA 3PX6A 2RJZA 3IBFB 2E7VA 1MWQA 2BM1A 2ZEJA 3MTJA 3ULHA 4DR7F 1KBRA 1CULA 3FMBA 3VGUA 4FS2A 1TZ0A 1YX2A 1GXTA 1HWUA 2Y1LB 2YX4A 3NWRA 2ZH6A 7AT1B 4LF4J 2BKOA 1W2BR 3G4SS 1NH8A 1QSSA 1LEOA 5J2MA 2YKAA 3FEYB 4QIWD 5B0BA 2B7BB 3T9NA 5KFBA 4ILRA 1IBKJ 1F6TA 1N33J 2VG7A 3BH6B 1ZH5A 3CCTA 4BC9A 5CZXA 3MOZA 4DV4J 3ZTOA 2CNNB 2H5IB 4C0OC 3GV7B 3S1TA 3POTB 2WK4A 3BQ0A 1T9YA 2ZBRA 4ITSA 5CCLA 4PG6A 3KLIA 3GPAA 2D3OR 3RG6A 5HAOA 1U6ZA 3OSNA 4TU8A 5D15A 2D9OA 3PX4A 2AWZA 2DGSA 2F8HA 4FXWA 3EVWA 4I67A 3RB0A 1RWPB 3EJMA 2R8IA 5K8OA 4N7TA 2HLUA 3HPOA 3HVRA 1VCTA 2C2RA 4CYUA 3VQTA 2V4JB 1U6BA 4CLUA 3HFVA 4IQMA 1GK8A 3RTVA 3FRZA 1WC6A 3HSZA 3EGVA 1B99A 1V6HA 4J91A 3KFWX 4NOHA 4QZVB 4JI2F 2KI2A 2EFQA 4HR2A 4DI6A 2FLPA 2VD3A 4ED5A 3C14A 4OX7A 4Y2AA 1RTDA 2GGPB 3POTA 5IQ6A 4PG4A 3O1LA 3J81U 3DHXA 2ZOGA 2VDIA 4MIAA 1Q1KA 2GHPA 2IDEA 4TY8A 4JI8J 4LRFA 1RADB 1FA0A 1VIXA 2F3JA 3UCUP 3D2WA 2BANA 4DF4A 4ZCKA 2HLTA 2JX2A 1N0UA 3TYTA 1FKAF 4ZHRB 3PJ9A 2E5GA 1U1QA 1V3RA 3CCLS 5DDPC 3M8YA 2HWHA 3N6MA 3TNVA 3J80Y 4GVBA 4NMLA 1U45A 1JXEA 3VTIA 3T1YJ 3EGNA 5CA5A 1REGX 4FPRA 1SJFA 3AQPA 4KGVB 4J9LA 3ILLA 3ZC4A 4IFVB 3NGKA 1J2VA 4JOUA 4UZCA 5KFIA 4OYIA 1RT3A 4FF3A 5FLXU 2LQBA 2YKMB 3MDFA 3EXYA 2K3IA 1K0VA 3T6BA 2G1HA 2VBYA 3NEKA 4KBIA 4DN9A 1FX2A 1S9EB 2P6SA 1UJ5A 3JQKA 3SFUA 3G6YA 3SV3A 3ZZZA 4DV5F 2GJIA 1VR6A 1XMQJ 3T1HF 5KOXA 2FJDB 2ZDOA 3ETMA 4X84A 1RZMA 2CQ3A 4ID8A 3WQPA 4OI0A 5A8WA 4AL5A 3TW0A 3J7AN 1H7XA 2CJBA 4EMDA 2B8PA 3X3UA 1VC0A 3I9ZA 1ZZNA 1RWUA 1J5OB 2UVWA 2XB2D 2C3UA 4UQTA 4KRWA 2XMTA 4ELVA 2HSEB 4DG1A 4DR6J 5KFQA 1WC3A 4LR9A 1W26A 3M7VA 1OY6A 2DD8S 2NCKL 2YKQA 3AH6A 3HHLC 5HANA 2FJVA 2R7UA 1HW8A 1SC4B 2CQGA 4P2SA 4EGLA 2VIHA 3QFWA 3SEOA 1M5OC 1P9QC 4P72A 1SJ1A 2D3UA 3BEGB 2J8SA 2E1MC 2BDPA 2VG5B 4RZRA 1OO0B 2PMWA 3VQSA 4OYBA 1YTYA 4G1QB 3LUYA 4GKKF 1VHIA 2IC3A 2JLEA 4XTTA 1JXVA 2GHWA 5JXSA 1U8SA 2ERRA 1S77D 2BR0A 2KYXA 4IO1A 2E1PA 3UDVA 6FD1A 5CD4A 1ZBTA 1JK9B 1MN7A 2VFRA 2XNQA 1XTZA 3LGHA 2B9XA 3VF0B 2R2RA 2OPRB 2YPYA 1FTRA 2KHDA 3M8ZA 3Q83A 4CH1A 2GC8A 3M2RA 2ZKTA 2LEBA 2PIIA 2RVJA 2E9TA 1RKIA 3C66A 3BGUA 5ETLA 1QVGR 4DZ6A 4IR9A 4OJHA 3VAHA 4DX7A 1EKRA 1YI2S 2MLXA 4MFBB 2Y8YA 5FD1A 1KSPA 5M2PA 2CXEA 5CYQA 7FD1A 1RAFB 1S1UA 2LEAA 1PSDA 4LJMA 2HHHJ 1ZTTA 2C42A 5E3QA 4FZVA 4LFBJ 1YJTA 4NA3A 1FD2A 2RS2A 1FRJA 3FBFA 4OYXA 3W5XA 3JQJA 3D1OA 1XR5A 3ET6A 4W98A 5AT1B 2HG4A 4CNZA 5IT4A 3ISNC 3OHAA 2GO9A 2ZZMA 1B64A 1C4AA 1FXRA 3UW1A 4HH0A 3IM8A 5D4LA 1NAQA 3OR2B 3SI8A 1U1PA 1WNEA 2X1BA 3DRPA 4URQU 2F4FA 1U2CA 2ZOMA 4HTJA 4LT6A 3UDLA 2BEFA 1GMVA 4MKYA 3AA8A 4WK3A 2CQ2A 1KTQA 1TL5A 1ULRA 2CUYA 1DTQA 2J9EA 3D7SB 3R5JB 4UOHA 3H98A 5CYQB 2W7PA 2HZVA 3IAM9 2IAJB 4OHWA 1S1UB 3W62A 2V8PA 1ZM9A 2CPIA 5IT9Y 3M8WA 1QAYA 2NSCA 3M9OB 5CCMA 1NH7A 2MPUA 4MK8A 3W9JA 1RXOB 1FXLA 4FYDA 3PIOQ 1WEYA 2OEKA 4RW8A 3JTOA 3KLEB 2VQFF 1RBOB 2YNFA 1N52B 1TKTA 1WG1A 3BYRA 3CJSA 2FJWA 4DSKA 4NXMF 2QL9B 1YGYA 2CPZA 2EKNA 4NLTA 4YB5A 5M2RA 5KT6A 3K58A 3PVXA 1S6PA 4HHUA 1NM2A 4B17A 4ZKAA 1PAUB 2DBBA 1KONA 5C7PA 1X8DA 1FWKA 3UVJA 1VQ7S 3KDNA 1CQMA 3G86A 2XI2A 3KK2A 2J7UA 2DR6A 1DTQB 4KGXB 2ZITA 1NMEB 4NI2A 3RAXA 3VVTA 3G2XA 2WSFC 2YWEA 3IP0A 1IKXA 1AUSL 2PGCA 1HNVB 4OJ1A 2BE2B 3NL0A 1URNA 3CEDA 2ROEA 2GAHC 4A8KA 2MDAA 4F2RA 3M8PA 3CJ8A 3UCGA 4ZVQB 2EWHA 4RW8B 2B4PA 2OPPA 1U09A 3KLFA 4KGKA 3T5HA 3MCMA 2CVEA 2KO1A 2VPXB 2IJRA 1HARA 2OO4A 4DX8H 5G4DA 4I6AA 4I2PB 2IMOA 5CYMA 2ZBQA 4ZCIA 1PBAA 3JSRA 1Q8KA 3DGPB 2EFNA 4RW7A 2ALZA 2B5JA 4OZNA 1FRXA 3SQGB 3B4DA 2RRAA 3DM2A 3T1AA 3VAFA 4G6VB 3KK2B 2HKEA 1JX4A 5E2QA 2MQQA 2LA4A 4QWDA 1O0PA 4PUOA 4WYWA 1TR0A 5J2PB 4CO3A 2B9YA 2ZZTA 2XC9A 1JXLA 2OI2A 2XYGB 1JLAA 2RKIB 1OQ6A 2J7KA 3AJ1A 3G6ES 4TLRA 3KK3A 1CS4A 3CCWA 3BR9A 1R8CA 5J1EA 4G65A 4ZVEA 1WF0A 4LRDA 4I2QA 1TELA 3R27A 2LQJA 4DZDA 2DXFA 3UDEA 4MYTA 2R7TA 3GE9A 1VISA 2XMUA 1Y5LB 2ILYA 3BPDA 1B3TA 2UVUA 2X1FA 5D4NA 3FEZA 1WI6A 1SKRA 2DNRA 4P10A 1JB0C 3A3NB 1SKWA 1FTCA 3PRVA 2N7CA 1KFSA 4NEYA 3NCRA 1VRTA 2AJFE 2DH9A 3V6KA 1WC0A 3D4JA 2HURA 1FK9B 2U1AA 3IAS9 2ADBA 3LP0B 4P52A 1SJQA 4Y0FA 3MUTP 4LFBF 1FT8A 4OX9J 2GGPA 4MH8A 4FPIA 4GO5X 1O51A 4Q43A 4DR5J 1M5VC 3KK3B 3L95X 5ETRA 4DR2J 2N4CA 3SQOP 3G71S 3R5GA 3BSOA 1YJWS 2V9WA 3MM7A 4KFBA 1U4BA 1FE0A 1SJ4P 2KB2A 1HBOB 2FJBB 1TUVA 3AFGA 2BRKA 4ZS6A 4P9SA 3BGFA 2DEJA 4JI4F 4ED6A 2VG6A 1UW4A 2ATLA 1OPIA 2H4YB 2KZZA 1P6TA 3V4MA 2H5JB 2C2MB 3DLJA 2HMIB 1KKHA 2XSFA 4Q0BA 1TKXA 4GVLA 4KKOB 2XMMA 4MKAA 2AEJA 2JFKA 4PYDA 3SDEA 4L3NA 2WTFA 3N5FA 3QRQA 4WE1A 1F9FA 1YJUA 4NLUA 1NDCA 3X1LB 4OQJA 1Q4RA 4G1PA 1OMSA 4PWDB 4LF8F 2WHOA 4DX6A 1K8AT 2ROGA 4OZ3A 1HYSA 2UVVA 1NK4A 4Z37A 2KDOA 4AE5A 5DZ6A 2FLLA 3D5MA 3IM9A 3E01A 3HKZD 2CDQA 4DL7A 1X5OA 1U0SA 1RLCL 1CJKB 2DIVA 4OYZA 1QSLA 2Z2YB 2YWKA 1F0XA 1X4AA 2LXUA 5CQGA 4ED3A 1ZYQA 4AD6A 1HI1A 2DCLA 2G0JA 3HZGA 3JXOA 2B9WA 5AJ3J 1J5OA 4Q7AA 1EB0A 5KG3A 2PMZD 1RU2A 3MMJA 2DNOA 4F3QA 5HVGA 3V6HA 3CNQP 2DK2A 2L48A 3KHHA 1R0AB 1HIYA 5BYQA 2J6TA 1HFEL 1I5OB 1NEEA 3FRYA 4RW9B 2LQ8A 5D4OA 3DRPB 4CH7A 5LXRA 3BQ2A 1N34J 2DGUA 2G2YA 5HMWA 1JKHA 2CQ4A 3DDNA 4I56A 5HQMA 3PTWA 3GR0A 4KH0B 4R0EA 3QT7A 3H8YA 4HEA9 3IR5B 5C24A 3TJAA 3WC0A 3VAGA 1Q95G 4ECTA 3TI0A 2JLFA 3KHLA 4PWDA 2FC9A 3QFHA 4RU2A 2B4VA 2JC0A 2WONB 1NCLA 4PRFA 3WX4A 1AFIA 5L38A 3I5AA 1N6QB 3CCZA 4IKAA 1CJVA 1IR1A 2M52A 4G1QA 4K4WA 2JOQA 3HP6A 4M8LA 1YJNS 4K4SA 1IKVB 4M95A 2IRXA 2ZD1B 1UVJA 2W24A 1NLKL 4LR7A 2OPQB 3MEEB 3M8QB 1FKPA 2D7SA 3A4TA 4M5DB 5EDWA 4YP3A 3T1YF 3HLUA 1FRLA 1C0TA 1OY9A 3TVKA 4ELUA 4URSA 1TKTB 1Q0NA 2Z4PA 4CZCA 3EICA 4USIA 3EGWB 3HVAA 3QSIA 5ETOA 2CQDA 4IRDA 4KIAA 2V8HA 3MM5A 3CE8A 1HI8A 3OL9A 1PC5A 1FJEB 2HK3A 1X7VA 1MMLA 1NSQA 1EJ7L 4O3QA 3ZZYA 4JI8F 1QUVA 4A46A 2IRYA 1GMWA 3I0RA 4F0MA 3K8WA 1DFDA 1VGYA 2QA1A 3RBZA 3TARA 1SQGA 2OPSA 3D28A 4DSIA 4F4WA 2K7JA 3G9CA 2XULA 3JSMB 1MG7A 4RW4B 2W9CA 4P74A 1DQ9A 3EPIA 2VOOA 4GC7A 1IR0A 3BGLA 3QIDA 4TNOA 1G7CB 4BLGA 2EG1A 1DURA 2V2ZA 4QIEA 2E44A 3H5XA 4I2PA 1T95A 2LXIA 2ZC4A 5IS2A 1SL1A 4Q8EA 4ECQA 2Z2ZA 3QSYB 3J7A1 2R7QA 4PYAA 4ALZA 1VJWA 4ZVUB 1EZZB 3OFEA 3HJVA 4FKXA 2DNHA 2W9AA 4NYOA 2C2DA 1P8GA 3V2UC 4TYAA 1HNXF 3I55S 1HL6A 4YHHF 4X4PA 1B0PA 2AGQA 1B7FA 1T9VA 4Y2IA 1NBEB 4X62F 3W2WB 4KGMA 4ZLJA 1K1QA 3E51A 4CO5A 4USMA 4DR3F 4KV8A 3BN4A 2JNJA 3HD2A 3M6UA 3MMCB 3R7BB 1UA1A 2C28A 1VQ8S 3NS6A 3BKTA 2M0GB 1LW2A 4ID5A 3EZ5A 4C6AA 2WAQD 1K9MT 5KT3A 1S6QB 1UWBA 1X4FA 1XJWB 4Y34A 2VA2A 4DQQA 2XG8A 4M5GA 4QPTA 3R8YA 3KG0A 1U2RA 2G2ZA 4HVZA 2QFJA 3DOMB 4LF8J 4KHRA 1GXLA 2I6WA 1NKCA 3UVJB 3KUEA 5J1PA 2IVYA 2NXNA 2O5DA 3H59A 5CZVA 4MK7A 3BO2A 2VG7B 3DRSB 3HVTB 2A10A 2OUGA 4BS2A 3RR8A 3P5BP 2PMHA 2ZJQQ 1Y3JA 4UOCA 4OYOA 4LMZA 2E5JA 1FESA 2I8EA 3D0GE 2VDHA 2EBEA 4C7QA 4DR4F 3OSPA 2HPUA 3MOJB 1CJUA 3C15A 4NYZA 1L3SA 2Z57B 2V8DA 4NLVA 2KYZA 4CO0A 2EFVA 4WYLA 3OXLA 1MLAA 1HBNA 1YG0A 5LSOA 5K14A 1YHQS 1U1OA 1AA1B 2QRRA 2X7IA 4HHHA 1YBUA 5ETTA 1H38A 2K1RA 4HL9A 2DRBA 1PJ5A 3TQEA 4F04B 5IFMA 1S76D 2VB6A 1LK7A 2OP5A 3N79A 1F60B 2VBWA 3QYYA 2VJVA 1QE1B 2HFUA 1VRUA 2HBQB 3VHQA 3EE3A 4DPXA 2QA4G 3R97A 2DHAA 3SV4A 2AGPA 5DLFA 2FVQA 1TKXB 3ITHA 4TXSA 4F67A 2N4DA 2OSQA 3SDEB 4O23A 2RDIA 2DB1A 2EPIA 4USKA 3GTYX 2G9OA 4KQZA 4PUOB 5D3GA 3EGZA 3OVBA 1D3WA 3TJ8A 3CC2S 1Y0HA 3M05A 2P8IA 1HLWA 1PJ6A 1HQUB 2F8EX 2IHR1 3FQKA 1KVIA 2R7WA 2OIHA 3KDOA 2MQMA 3K5MA 4NRTA 4LREA 3Q8QB 1RT1A 1ZAXA 4W4MA 2QA2A 2RIJA 3MD3A 5EWGA 1FDNA 3FBEA 1SVDA 4WU3A 1NPKA 4C0BA 3MECA 4QPXA 3H0PA 4WK1A 3DMJB 3W66A 2CAJA 3W9HA 5IT9U 3P96A 3C6UB 1H6KX 1FI4A 2M4MA 1FRMA 4G3IA 2B3TB 2E1AA 4KE5A 5L9XA 3MXHP 1SQEA 2QYCA 1NO8A 4O4GB 1D09B 4WPAA 4C8YA 2H3EB 4DV2F 5F8NA 2UUBF 2HAFA 1XERA 2UXCF 1N32F 1CVJA 2Z2LA 2V2VA 3FJ2A 1RT3B 3L7OA 2HRUA 2F4VJ 2CPFA 4DV7J 3MI7X 1ZPWX 4B3TF 3VZHA 1BD6A 3A8EA 3BM7A 2RF2A 4F8RA 3PRBA 2J8AA 2ZE2A 2FYXA 1KHWA 2QL5B 3BB5A 2HYIB 2IA6A 1S7HA 2V5HG 3Q86A 4IH6A 2JL9A 3QRPA 4DN0A 4U67Q 2M8DB 4DPTA 5KTQA 2QMUB 1VYAA 2WVBA 4C9DA 2XSJB 3W64A 2OPQA 4OZJA 1AXQA 2BJ3A 2DNNA 3HHDA 5AXMA 8AT1B 4KT0C 4N5SA 2W7OA 1VC5A 5F3ZA 1WSVA 1ELOA 3QO9A 3D0HE 1M5HA 4KKOA 2YTCA 5THWA 2BUNA 2ASDA 3IWLA 2AU0A 4IOAQ 1C4CA 2UUCJ 2PE8A 4LBHA 3SMZA 3I87A 4J9NA 1HYSB 1QY7A 2WCXA 2VPYB 4NLDA 2OJ3A 3ZNUA 3QGHA 4A8FA 3A3OB 1VQMS 4X4QA 2MMYA 3DRXA 1TK8A 2IC3B 2K06A 4ICLA 2V4QA 1NKBA 2PI4A 4RW4A 3HHLA 4PG8A 2HFVA 4LSLB 3GV5B 5BYSA 2XZTB 2ZH1A 2BJDA 3ENVA 5DGAA 2PA8D 2GVZA 4ZN3A 2NXJA 2CZVC 2YWGA 3M2RB 2XMWA 3NG8A 3ZTSA 2HW3A 1OSCA 1S1TA 2DGOA 1BHNA 2QLBB 3NGRA 2XLJA 4L74A 4JI2J 2QTWA 5KFAA 3OXFA 4DFKA 3TUJC 4QIVA 1FKOA 2KXNB 1SIZA 4XDDA 5F3TA 5DG9A 3R1HA 3UI3A 3PEJA 1MMDA 2EFOA 5DRKA 1N6QA 4LF9F 4RW6B 3CDAA 5BXIA 4LFCJ 3TUZC 1IKVA 1SPBP 3UPFA 2UUAJ 1G1XA 3EXCX 2YNHA 3F44A 4M63A 3ILJA 2AYEA 1G6BA 1XR6A 2VC1A 3W61A 2XY6A 4C4WA 1K73T 2YWWA 2RQ4A 3OTCA 4FXVA 4X64J 3PV8A 4P75A 2UXDF 3OR2A 3TAMB 1KQSR 4DV4F 3MR5A 2DEIA 4ECZA 3CJ4A 2KT2A 3LA0A 1EARA 3Q24A 2YNGB 3J80U 1N5TA 5EHHA 1D9AA 3VGSA 3BGRA 2ZH7A 1XIQA 1RUSA 2VC0A 4RNNA 4IOCQ 4ECYA 3M32B 2OEMA 1YJ9S 3PW7A 4Y2CA 3BBBA 3PW0A 1ZAVA 1AYEA 4FYVB 2AJ4A 4EYHB 2DXDA 1ZTWA 4NMXA 3R7NB 2QGFB 2ROPA 3JSMA 2PEHA 2FVSA 2XZDB 3ONQA 4NL5A 1N8RT 1YRTA 3EDQB 3EM1A 2DNZA 3PHTA 2AEFA 2JFDA 4Z2XA 4GKKJ 1RT4A 4ENOA 3QQCD 3CCSS 1VDHA 4WXWA 2DNGA 3QGPA 2HHTA 1AW0A 1DARA 1Q79A 1PILA 3IGNA 3OBIA 3HULA 1QVFR 3DU5A 4KPYA 5FLXY 4HT5A 2Q79A 1U48A 2JC1A 2QL7B 1UEUA 4B9LA 1RE1B 1S7IA 4JP8A 4NI2B 4JI0F 4ED2A 3RB6A 2QMWA 1VQ5S 4NASA 2MSSA 3GONA 3Q8UA 1PGZA 1SV5A 2MJUA 2Z2MA 3A8IA 5LSRA 2BE2A 3HT0A 3H90A 4ES2A 1IKWA 3SSQA 5CD4H 2J0SD 3MEGA 3Q8YA 3SBMA 4WZQA 2DNMA 3WX8A 3QGGA 2R2TA 3CT9A 3BN7A 4NCGA 1T03B 1U02A 2JEIA 3IMQJ 2CQIA 3V5RA 4FVCA 4Q5VA 4OX6A 2VICA 4Q2MA 2CJXB 4DV5J 1RK8A 1EX8A 2DITA 2XS2A 4OI6A 3BR8A 1H7WA 1SB6A 1T11A 1HWKA 2C3MA 1S1VB 3GIRA 4USUA 3NMAA 2XYPB 2DNKA 2HNZA 3BSCA 3PKYA 2BW7A 2ZM6F 1LNQA 3LGMA 3GQCA 3QRRA 4CLPA 3HCXA 3LAKA 4A8WA 3SCKE 1M5KC 1XNRJ 2NR0A 2R9LA 2GQQA 1QUPA 1TMMA 3FBBA 4H4OA 4QWCA 5J2PA 4EBDA 2R8HA 4YR2A 5HN0A 1SL0A 1S59A 1Y10A 5F9NA 1UAWA 4DPWA 1S1WB 2I5JB 1NRKA 2OFHX 3QLHB 4ZLNA 3MM9A 1U1RA 4UF4A 3IXQA 3K2YA 4E98A 1NK7A 4WJBA 4HH1A 5KFWA 4TQSA 1Q7LB 2ZC3A 2KG1A 2DIUA 1BXNA 2FJAB 3DXSX 1DQ8A 4NLSA 4IYQA 3RRGA 2UV8G 5E3RA 4HDGA 2GJFA 4X4TA 2A6OA 5B0AA 3QAEA 3PW4A 4N41A 4A48A 2I2YA 3OLBA 3TA1A 2ACMA 3QO9B 3J7ZT 3G96A 4V19J 2FVPA 2BX6A 2FUG9 1FRHA 3RRHA 5D3GB 5K5MA 4H4OB 2K2PA 3D6HB 1C2PA 5KT5A 3CCQS 2DHHA 3EPGA 3GFZA 5HO4A 2D41A 2DT9A 4C98A 1RGVA 1FF2A 4C11B 3JB9k 2B6AB 2CPJA 3EZUA 4OV6A 5DQIA 2HBZB 5EX0A 4A8SA 5CABA 2YY3A 3TX0A 2F4VF 2HRYA 4Y6IA 1LWFA 2EW9A 3IG1A 1Q86T 4OHXA 3WZ0A 1GMUA 2IM0A 2DR5A 3HFKA 4LSZB 3RBXA 3HMJG 1ZETA 4DCJB 2GIRA 2NXUA 4FN5A 4YFUA 3KLGB 1IBMF 4OHYA 2V8GA 1H73A 2DVIA 2GVZB 4MKVA 4ZVSB 3ADAC 8ATCB 2COLA 3Q0AA 1NZAA 4DS5A 3TO8A 2DNYA 4NE9C 4NLRA 4PAAA 4ZVTB 3VR1A 4WP8A 1IBKF 5DGBA 2Q43A 1LWCB 3CJ5A 1UWAA 3AB2B 3DDIA 4QOTA 4YB6A 4K2XA 4KHMA 1KOOA 2CYYA 5ETVA 2F9DA 3DLBA 4ILMA 2X1GA 2ZE2B 1VQ4S 4C8OA 4LFAJ 5DO2A 3TVYA 2ZHBA 4DR7J 5HMZA 1GTHA 3H5SA 4ECUA 1FNOA 3AD9C 2MKSA 4DPYA 4LSNB 1MNEA 4P2XA 4DPUA 4EFAC 3I5CA 1YIJS 3H5UA 1VLOA 2CADA 3MPYA 5ETMA 2CJKA 2YNIA 3MUVP 4NXNJ 3MAAB 3N28A 4NCAA 1VBZA 1NDPA 3V4IB 1X9MA 1B70B 1D1UA 2NYHA 2YQ0A 3MCNA 2BOAA 5KFDA 1GX5A 1WF2A 1HNZJ 4UOFA 2BJEA 3K89A 1YSJA 2YWFA 5I42B 4RW9A 1EP4A 4YY3J 4N47A 2NPFA 3NOGA 1TK5A 1NK6A 5C24B 2C2NA 5A8RB 4RPFA 2QN6B 1AT1B 5LXYA 1WHWA 3C14B 1H2UX 2GQ2A 2GNKA 4OZ1A 2X3GA 1RJJA 2ZWPA 4BWJA 4BHQA 4ELTA 1RHUB 3R2CJ 3UDCA 4R25A 2ZH2A 3MM8B 3UD4P 2G4BA 3OQ2A 4K4VA 2Z30B 1LOUA 2HFNA 1JQGA 2PD1A 4OI2A 4XK8C 4F4KA 1KNZA 1NDKA 1HQ2A 1VFJA 2WVDA 1XNRF 4A8OA 2FLOA 2DGQA 2P9CA 5M2UA 2HBYB 3P3DA 5F8LA 5KG0A 2E7WA 3GFHA 4L72B 1OJ4A 4O3RA 3CULA 2UVRA 3R5BA 1UZDA 2YKNB 1A9NB 1X4BA 2AEMA 3M1VA 3E2EA 3BJYA 1A0OB 2Q3PA 5E5NA 2RNEA 1HW9A 2Q66A 5KOWA 4ZPDA 5ETPA 4K4YA 1BQNB 3C6TA 3RBEA 4LF5J 4A47A 4ZOSA 3MPWA 2V4RA 2VZ9A 4Y2MA 4TYBA 3FCVA 4U8YA 2D3ZA 4KB7A 1P27B 1TAUA 1LKZA 2CZ4A 2O66A 1L3KA 2J9DE 5LL6d 2ZBCA 5HROB 2VQEF 1NJYA 4WIQA 1SC1B 4C8NA 3W65A 5DM6Q 3TZWA 2W9CB 4ECSA 2DXEA 1IWAA 3PM9A 2OD4A 3MR2A 5KFMA 3U02A 4RJVA 4JI3J 4M5IA 3C3LA 1H98A 2G1DA 3DLKB 4H4MB 2DO4A 1JLFB 2IBOA 2NZCA 3AD8C 4RUBA 4ATNA 4DBQA 1CBKA 4PCQA 5BR8J 2ZKUA 5C42A 3OVAA 4EWTA 3ZZUA 3D9BA 2HZAA 2R42A 4N77A 4R0JA 3SSRA 4LF2A 4AT1B 2RH3A 3MHYA 3BGRB 3NS7B 3RU0A 2RT3A 5DM7Q 4DV0F 5I3UA 1VS3A 5A76A 1WEXA 4WCEQ 4B9NA 2HQCA 3HHKA 1CQNA 2QA4S 1YRUA 4DUYF 4KO0A 2UXBF 5IM0B 2OD6A 2QIFA 3ISZA 1JIHA 2I5JA 3B54A 3DGVA 2VG5A 3MMCA 3QLHA 4F3MA 3I4HX 2FZCB 2DHGA 2H51B 3D1HA 1MROA 5D77A 3E8OA 2EEYA 3GILA 3BQ1A 3PW2A 3KOAA 3AOAA 3H4DA 4UT4A 1RAEB 2C3PA 4NA1A 3CC4S 1Q5YA 2MB0B 4K4UA 2B56A 1YBAA 2OKQA 4H4MA 4I0WA 4BC7A 5HJXA 1J5EJ 2F8MA 5J2NB 2IIHA 3KNGA 5K8PA 2QLJB 2VJUA 4IFVA 4DV3F 4F3OA 3L7UA 1VK8A 1L3VA 4UY8T 2UUAF 5E3AA 1VJQA 2CPHA 3D67A 4NYPA 5I3UB 4DV6J 1NU4A 2XO6A 1NNDA 3J81j 1YKWA 4LBPA 1RAHB 4I1TA 3T41A 1TVRB 5A2QU 2KTQA 3AJDA 4NLXA 4QU6A 3K17A 4C11A 4RX6A 4WKYA 1SQFA 2DNQA 1RTIB 1MROB 1QDUB 1WC1A 2B8QA 4K2JA 3MFIA 1TUWA 4ZJOA 1C0UA 3AQOA 4RNFA 4JI5J 1I1GA 5GVQA 4C2MA 3IWXA 3A12A 3MCSA 3GWCA 2KT3A 3OFFA 4RLEA 3B4MA 4ZA1A 5KFPA 3KLGA 1U1NA 4JI1J 1N4LA 1HHTP 2ABYA 5AJ3F 3AOCA 1HHSA 3D66A 4E2FB 1PYTA 4KR0B 3KG1A 3NMRA 1U0HB 2FZKB 3G6XA 5F8JA 2JDJA 2GJ2A 5GMDA 2N3LA 4OZ0A 3TZZA 2SXLA 1RWMB 1F5CA 3Q89A 1LWCA 2W2MP 4N8NA 1TP7A 4J9OA 2OH2A 1IKYA 2V2KA 3LOUA 2YBVA 2EG2A 3PY8A 2FJXA 2HHQA 2AJ1A 3QJLA 4B02A 4K0KF 1T8EA 3DLEB 1YRXA 3FFIB 2HVIA 4AYBD 1WOOA 1KC8T 2OEJA 1ZS6A 1RHMB 2A6MA 1MU2B 4OZ5A 1PCAA 4CP5A 3HD1A 1DRZA 2LLZA 3HHNB 4JV0A 1KS2A 4HACB 4FBTA 1KVJA 2PA3A 1OYDA 1RYRA 1NSPA 5F9LA 2CQHA 3TEGA 1AROP 3PYEA 4E8UA 2R7SA 2JVRA 1LFWA 3BZQA 1TTHB 1RT2A 1I94J 3FSYA 5LMNF 4X2BA 1BMQB 4CI0B 5KFSA 3H40A 3GJQB 2IYGA 1YVFA 3O8WA 4L75A 1U7LA 4LUBA 2ACYA 4QWAA 1VI7A 1U49A 1UPMB 4DR5F 1HNVA 1FDDA 4OFZA 2BQ3A 3RR7A 4RBUA 1S9FA 2J0WA 1RI7A 1WKJA 5DLGA 4PQUB 1SC6A 2KRBA 3T19A 1JJ2R 1A6LA 2HQFA 2UXCJ 3IRXA 5HBMB 3KLFB 4JYAF 1T9XA 4ZVRB 2VBZA 2P9EA 5K8NA 3AAWB 3VGVA 3SFGA 3D54A 5D6GA 4FVMA 2H48B 4CM2A 1YJ7A 4NLPA 4IFYB 2A2CA 3HSDA 3M1VB 4OX8A 1WI8A 2R7OA 2XNRA 2KZMA 3D6MB 2CNLB 1RHRB 5H9FK 1X4DA 2WB1D 4J90A 1XMOJ 4DSJA 1B4SA 1RAJA 2GFFA 2R8JA 1R43A 1R31A 3LTOA 2ZVSA 3GSDA 3T5KA 3I6PA 3CXCR 5DG7A 4ZN1A 3DOKA 3EZOA 1VQPS 5A8KA 1CS4B 1WSRA 1WHVA 1UFKA 1FXDA 1WUUA 1Y5IB 5F8GA 1C1BA 2YNIB 5KT4A 3ETOA 2XLIA 3I56S 2C1EB 3BBCA 3QT8A 2IJNA 5T7LB 4I2QB 4M5JA 5DDQC 2V9KA 3FNNA 3VAMA 2XY7A 1I51B 3PR4A 1NHUA 2FD2A 4B3MF 3IA0A 3IS9B 2MKHA 5B0DA 4QQBA 1VQLS 2E5LJ 1EP4B 3K59A 1G3OA 2VKRA 3NLCA 1S5ZA 1S1TB 4GVBB 2R7RA 4X66F 1S0OA 3VGTA 2X3DA 4B3SJ 1RWVB 1UA0A 2L08A 3P8BB 5A8RA 5GADU 4I64A 2JLGA 3A8KA 1UEKA 4NRUA 1S1XB 3SCJE 5C2GA 4AFFA 3MAQA 1PJ7A 4P7VA 4J9MA 2ALYB 4L73A 4EU0A 4J9QA 2HWIA 5KFHA 2MQOA 2UU9J 4FF1A 2RILA 2AW0A 2KT5A 2EC0A 4CLZA 4CRJA 1RABB 1UJ4A 5EWFA 3MM7B 4KFBB 5T7LA 4TY9A 2V8VA 4NEZA 3O3LA 1Q16B 3CD7A 1HBUA 3VAKA 4F2SA 5E41A 1UW9A 2Q6BA 2BJ8A
chains in the Genus database with same CATH topology
3TA0A 4PXCA 1Y3KA 2MY8A 3CJ2A 5CYMB 2YKNA 4QJVA 2V4JA 1SUQB 4B3OA 1NJIT 2JSXA 2HMIA 2BQUA 3DM2B 3DHWC 3MM6B 1KEKA 2YKOA 5KFTA 2FHKA 2BM0A 3BS9A 4DDFA 1UETA 4F4YA 1RTDB 1HI0P 5F41A 4NZ6A 2HQ3A 2Y1RI 1KQKA 4I69A 2DJWA 2FIUA 4MMOA 3W7BA 2MXYA 3G6ES 1WHYA 1VQKS 4HI1A 1TVRA 5HROA 3I4PA 3Q22A 3U1NA 2O3DA 2YH0A 3K5PA 3IN5A 1RTJA 2BACA 4TN2A 4ECWA 1LW0B 2R8GA 2MQLA 4X4VA 4PPZA 4IO9Q 1SH2A 3DRYA 1FEHA 4D3HA 3PIPQ 1NKEA 1RA6A 2HFOA 3DLGB 1SUQA 1CC7A 1S97A 1FVQA 1TKZB 2YX1A 2BYCA 4ZVHA 4AXJA 2BW2A 2QLXA 1RDRA 3OHBA 2HHHF 2AP6A 3PJWA 5LJ5Y 4FBUA 2Q6CA 3M2VA 4YQWA 3UR0A 3BO3A 2D1CA 5C5JA 5GMKa 1U24A 1JLQA 4DOZA 1URRA 1WHXA 2DNLA 2XI3A 3D0IE 3KHRA 2DPJA 4B9TA 2DR7A 2QMXA 1VLYA 2CQBA 2LEPA 2ZOFA 3HK2A 3M30A 1R8BA 2J76E 4DPOA 1BGXT 5JUMA 2F1FA 3CMES 4YEAA 1VOMA 4RKUC 3DDKA 5H1SV 2FTRA 1SXLA 4OHVA 4ZCLA 3NP5A 2ZJRQ 4KTQA 1TFYA 4OV1A 3LALA 1IQZA 2NS1B 1OIAA 2DGXA 4O44B 5DQGA 4KJIA 2ZH3A 1OWXA 2IBKA 2L3MA 3OTDA 3TVZA 4CO1A 4EBCA 3LPYA 5F8HA 1Y9OA 2HS3A 5EWEA 3M8RA 4AL7A 3M6XA 5EGYA 1FJ7A 3GIJA 1WTFA 2R2UA 2HIQA 4OI4A 1REVA 3CD0A 2MZRA 4J9RA 4ED1A 3HJFA 2EI5A 1C0UB 3GB0A 3KLHB 2CJAA 4DR6F 3Q2TC 2C3YA 1N34F 4IDKA 3KLEA 3NNHA 2KJWA 4USHA 1NK8A 3PFEA 5GAHU 1GX6A 3PJXA 2FHMA 2RQCA 2XS7A 5AE1A 5T14A 1DLOB 1HMVA 2IVMA 2MZTA 4H4KC 4NLOA 3JSBA 2HGNA 4F25A 1RQ0A 1TV6B 3DOLA 3KKFA 3JTPA 4J9KA 2VASA 1HA1A 4C8LA 3DLEA 3FFIA 4FNIA 3GYNA 4PG7A 3KLHA 3J7YU 3HHEA 4KV8B 5D8HB 1TAQA 1SJ3P 5B08A 1DHMA 4HDHA 2OPPB 4RWXA 2QV6A 4DJBA 5DG8A 2ZH4A 3LWLA 3QWPA 4PQAA 2WSCC 2O01C 4IUFA 1AUDA 4ECRA 3MURP 3KJVA 3MM5B 4DMZA 1Q81T 1RT2B 2HFZA 2ADCA 3PFOA 3PO5A 5FDLB 1YQHA 3RAQA 3U1LA 2KRRA 3TOQA 3CCES 2ZHAA 3BREA 4FS1A 4NZ7A 4Q44A 3NGDA 1JJ4A 1E6VA 1M90T 4JI5F 2VV5A 4C8MA 2E9RX 2QE5A 4ECVA 4K4ZA 3J7Z5 1S48A 4IRKA 4ZPAA 5J1EB 4OL8A 2XMJA 2J9CA 3MTKA 4K5SA 3Q23A 3T5LA 2C22A 3IWNC 1VHFA 1LV5A 5GAGI 2ASJA 1ROFA 2E9ZA 4QYRA 4GMKA 1FNMA 2BVZA 2M88A 3MMAB 4I6WA 1Z2LA 4DV6F 1MWZA 2EK1A 1HD0A 1GH8A 2EK6A 1CPZA 1CEZA 1MW7A 3FCHA 2WRMA 2GMJA 3MM6A 4NWBA 1X4CA 1SH0A 2A1BA 1NJXA 1K1SA 2FHJA 2HVHA 1ZM2A 2AJQA 5DDRC 2VFSA 2MQNA 4F02A 1JJHA 3MEDA 5FJ4A 2G13A 1Z2ZA 2KU7A 1HBMB 1KTVA 2E5HA 2VUGA 3ZFVA 4URGA 4AL6A 5AE3A 5J1NA 2AX0A 1QJHA 3LANA 3DMJA 5GAEU 4XIUA 1U47A 2HQIA 4N8OA 2LMIA 4W90B 1RT6B 3AJ2A 1FD8A 5LSLA 4LQ9A 3VAJA 1W2IA 2EBGA 1GTEA 3QIPA 2FLNA 4LF6F 2IFXA 2DH8A 4YDDB 4W92B 4QYZJ 2AGOA 4EO6A 4RUHA 1ZPVA 2HS4A 2FGCA 2GA7A 5BYRA 3THPA 4WU2A 4DSEA 4FXDA 1U1LA 3PX0A 2FB0A 4TY8B 4F50A 3RW6A 3CVKA 1WTBA 3LWMA 4J9SA 2BANB 1IBLF 5L1IA 2HZCA 3LW5C 1Q8LA 2PFFB 4DQRA 3CMAS 5U47A 2Q1LA 3NBPA 2M7SA 1VRUB 3I0SB 1Q7YT 1SJRA 3HZEA 1R0AA 1V3SA 2ZJPQ 5LT5A 1F5AA 2W25A 1XEZA 4B9MA 4DUZF 3DLLQ 1FCAA 5DQHA 5F8MA 5KFJA 5JVHQ 1UEVA 4K4XA 3F41A 2KJVA 1JWWA 3T9ZA 3PXGa 3AY0A 3M4XA 2XMVA 4OLPA 5L1LA 1RT5A 1ZOTA 3IO1A 3O6QA 1V3ZA 2VKZG 4BWMA 1CLFA 1YWXA 1VQ9S 4AUKA 3W2VB 3NCPA 3MECB 1N88A 5A8WB 4LIWA 2WB4A 2FGOA 1D9DA 2VG6B 4EUVA 5KFNA 3HXMA 1FJGF 4XAKA 3Q8PB 3CCUS 2IMWP 1Y00A 2RQKA 4Q0BB 3UQSA 1IXKA 2I9SA 2O1PA 4ZPWR 1T05B 1HNWF 1T3OA 2B4UA 1EETA 1HQEA 4IH7A 3CB4A 5HL7Q 1SBRA 1HMVB 2ASYA 2CVIA 2AX1A 2MGZB 1N5YA 4XPEA 1OS5A 3FQLA 4YDXA 1VBXA 2DGTA 4DL2A 2M5YA 4HYKA 4O0IA 1HNZF 2HNDB 2H9ZA 3FMWA 4R8UB 3E01B 4KHPF 4QWEA 1BWEA 4CTAB 4WFBQ 4JUZA 3PDNA 3LAMA 1VK3A 3HX9A 1SL2A 3WC2A 4IQXA 4C9DA 3V6JA 4MYUA 2XGQA 3MZIA 3IR7B 3NRBA 5CYJA 1C1CA 3NAHA 5A0YA 2KXFA 2OPRA 4HLBA 2AF6A 4R5PA 2AD9A 3UE2A 1S6PB 1EETB 5E3PA 3GIKA 2MHEA 3MD1A 1NHVA 4I6YA 2KM8B 1BQMB 5FDLA 2GX8A 5E3CA 4C97A 3DNCA 2DTJA 4JV5F 1R89A 1QAXA 2MZ1A 3DN9A 2HNDA 3H25A 1IKXB 2LDIA 2A18A 3K7RA 1DBDA 1E6VB 4X64F 2IM2A 2KN4A 3DCAA 2CG4A 4A8YA 3PO4A 1XK8A 2XZWA 3FSXA 1I6JA 2J6UA 1MU2A 5ITHA 3I82A 1KN6A 1IN0A 5KFXA 1FKPB 4M5DA 3KK1B 4U7UK 1MMNA 3AHPA 5KG6A 1C1CB 3RBDA 1P1LA 3S6EA 5A0YB 4ZDNA 2BV3A 1X0PA 3AA9A 3THTA 4DL5A 3G8QA 5KG7A 5K9FA 1HD1A 1GNKA 1VQYA 2CQ0A 1LWEB 3DI6A 4F4XA 1FKOB 3BSAA 1BQMA 3RB4A 3CC7S 2VODA 1HWIA 2OSRA 3I31A 5E33A 5DJBA 1S4FA 1UP1A 2IM1A 3UWTA 2OPSB 4B08A 3OLAA 2EVZA 3MEGB 2CPYA 4QW9A 4U6PA 2XHWA 3QMQA 2BQRA 2C3OA 3KK1A 2GMLA 2YNFB 1P1TA 1VIOA 3IFEA 4ZHRA 2W9BA 4DLGA 1N56A 2QSFA 2L41A 4ZP7A 1FDAA 1RT6A 4IFYA 3KJVB 4YB1P 5B0GA 4UW2A 2DNPA 2YNGA 3O5TB 3CJ3A 5KFUA 2GV1A 5L39A 5L1JA 4J37A 4WXOA 1KHVA 5D4PA 1FK9A 4XDCA 2UV8A 1VBYA 1FVSA 3OTEA 1ZM3A 5HP1A 4ED8A 5A8KB 3PNIA 3UFCX 3OXGA 1SH3A 3RW7A 3QJPA 5DETA 1GT8A 3B8HA 5B0CA 1S0NA 2LQ9A 3HO1A 2K7KA 3IS9A 4TLQA 1QLNA 1A7GE 1S79A 5A6PA 3MMAA 2CQ1A 3DOMA 5E7OB 4IG0A 5F0UA 1T3NA 5IZHA 5LJ3Y 3DYAA 1NK0A 3P6YC 3MGJA 4DG1B 3B78A 1U2FA 4WE1B 3QWUA 3K5LA 1X5TA 1Z4UA 2CQCA 2QT7A 4Q8FA 1F5BA 3ZZPA 1RKJA 3TANA 1LK5A 3CDWA 2CIMA 2IRUA 3THVA 1M5SA