2U2FA

Solution structure of the second rna-binding domain of hu2af65
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
85
structure length
85
Chain Sequence
AHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SPLICING FACTOR U2AF 65 KD SUBUNIT)
publication title Solution structures of the first and second RNA-binding domains of human U2 small nuclear ribonucleoprotein particle auxiliary factor (U2AF(65)).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 9
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 1999-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2u2fA00
2X1FA 3CMES 2KN4A 2YWKA 4TU7A 1WI6A 1U6FA 1R8PA 2DGTA 4LMZA 1VQ7S 5DDQC 3FEXB 2MKIA 5DDPC 2MHNA 2LXUA 2DNKA 2CPDA 2X1BA 4Y00A 1SJ4P 3NNCA 2MKHA 4QQBA 3S7RA 3H2VE 2CQ3A 4YUDA 1N88A 2BZ2A 1M5OC 2XS2A 2MKJA 1HD1A 1X5PA 1X5SA 2AYEA 2MZTA 3G8TA 3TYTA 5IM0A 5MLCV 3UCZP 2I2YA 2WBRA 2LXIA 1X4GA 2DNHA 1FO1A 2V94A 2JRSA 5LSOA 2SXLA 1U2FA 2DNRA 1H2TZ 1A9NB 2MZSA 4CH0S 4J5OA 1DZ5A 1D8ZA 1JJ4A 1UFWA 1KOHA 5GVQA 4FXVA 3IWNC 4WIIA 3G71S 3BO4A 1BY9A 4QU6A 4WCEQ 3MD3A 2LEBA 1U1QA 1WI8A 2MJUA 2CJKA 2CPHA 4PR6A 2CQGA 2LECA 2MSTA 3PIPQ 2KRRA 1WWHA 2LCWA 3VAGA 5DM7Q 4Y0FA 5DDOC 3MD1A 1XN9A 2DH8A 3VALA 1U1MA 2VONA 3CTRA 1M90T 1X4CA 4WFNQ 1PGZA 2AYBA 3CCSS 2J76E 1X4HA 2AYGA 2YKAA 1N52B 3UE2A 3DLLQ 1VQKS 1HL6A 1K73T 3U1LA 1WTBA 2CQPA 3CXCR 5D77A 5LXRA 2I38A 1YITS 1JMTA 3CMAS 1S72S 2KT5A 2OSRA 1AUDA 2DHXA 2DNNA 2M70A 2OJ3A 1SXLA 1D9AA 2MKCA 4YB1P 4F26A 3EGNA 1P1TA 2N7CA 2CQ4A 1VQMS 5JVGQ 4WFAQ 2E5JA 2MKSA 4IO9Q 1WEZA 2X1GA 3SXLA 2UP1A 4IUFA 1KC8T 1N54B 1X5OA 2MSSA 2MQNA 4ERDA 2MKKA 2DH7A 3CD6S 1FT8A 1YIJS 2F3JA 2CQ0A 3SDEA 2DNOA 4ED5A 2QFJA 1NU4A 5EN1A 1VQOS 1VQPS 3VAFA 2NZ4A 1ZH5A 2DNZA 5LJ5Y 2MQOA 1WHWA 2MY8A 3I56S 2CQDA 2CPEA 2OIHA 1JJ2R 2YH1A 1YTYA 2DGVA 5IM0B 2E5IA 1B7FA 2CQ1A 5DETA 2FC8A 2N3OA 3R1LA 2CPFA 3UCUP 1K9MT 1OIAA 2DNYA 1VQ8S 2RNEA 1N8RT 2DGXA 1DHMA 2EK1A 2DO0A 1P27B 1IQTA 5LXYA 1YJNS 3P3DA 2K8GA 4M5DB 2F9JA 4LJMA 2RQ4A 1URNA 1H2VZ 1M5KC 2JVRA 2HGMA 4C7QA 2M8HA 2CQHA 5JVHQ 2XB2D 2MXYA 4F02A 3MDFA 1X4BA 2HZCA 3TO8A 2RQCA 1NO8A 2QA4S 2MB0B 5GMKa 1U1RA 2VOPA 4FXWA 2DITA 1X0FA 1X4EA 3S6EA 2DH9A 1JJHA 2K3KA 4UQTA 2D3OR 1ZZFA 5D78A 2GHPA 1WELA 2U2FA 4PKDB 2JX2A 5LSLA 2XS7A 2DHGA 2DK2A 2M7SA 2QEXS 1SJ3P 3UWTA 2KXFA 1SJFA 3CCES 3US5A 2KRBA 2MQQA 3MUMP 3NS5A 1KOOA 2HVZA 4CH1A 3G4SS 1U1PA 2CQIA 1WF1A 3FEYB 2LYVA 1Q86T 3NS6A 3VAKA 3B4DA 2LQ5A 2OSQA 5GAHU 3SDEB 5FJ4A 1QM9A 2E5HA 2M0GB 1WHVA 4LIRA 2GO9A 3CC2S 1FJ7A 3LPYA 1F9FA 2E44A 2DNQA 2RVJA 3NMRA 5DDRC 1PO6A 1QVFR 2KXNB 3BS9A 2CQCA 4OZ0A 1KD1T 3UCGA 4C0OC 3CCRS 2XNRA 2B0GA 1Q81T 3P6YC 3I55S 1YHQS 1X4DA 2FPHX 2RT3A 1OWXA 2CPJA 3VAJA 4PRFA 1DRZA 4V19X 1UAWA 2KU7A 3ZZYA 3OW2R 4W92B 2FHOB 1NJIT 2MGZA 2MY7A 3CC4S 1WHYA 2DHSA 2KYXA 2KH9A 3THPA 2M88A 2DO4A 2EK6A 3G8SA 2KFYA 3J7ZT 2KM8C 2OTJS 3P49B 3ZZZA 3MI7X 2KHCA 2MYFA 2CPZA 2RS2A 1VQ5S 3L3CA 2M2BA 2OTLS 3VAIA 2J0SD 3K0JA 3S01A 4BS2A 4WF9Q 1OO0B 2CQBA 2FC9A 2DGQA 5GADU 2Q79A 3TP2A 4UY8T 4W90B 5ITHA 1WG1A 2M8DB 1VBZA 2DGSA 2MQLA 2KG1A 2LMIA 3ULHA 2G0CA 1VBXA 3RW6A 2J0QD 2A3JA 1S79A 2DNGA 3G6ES 3CCLS 2DGOA 2DB1A 3DXBA 4U67Q 2DHAA 1ZZNA 2LKZA 3U1MA 1VC6A 2N3LA 2LA6A 4CIOA 5HL7Q 1W2BR 1VQ9S 2ADCA 1U1LA 2U1AA 2CPYA 1UW4A 3NNAA 1QVGR 2VODA 1M5VC 2CQ2A 1O0PA 2MZQA 5CYJA 2DGWA 3BO2A 4CQ1A 3MXHP 2M9KA 1YWXA 3PIOQ 3V4MA 4P6QA 3UD3P 1YJ9S 4TU8A 2G1DA 3MOJB 5H1SV 2XSFA 1X4AA 3G96A 1CVJA 5HO4A 2RS8A 1U1NA 1M5PC 2DNMA 1VQLS 3MURP 2FY1A 2CPIA 3EGZA 2XNQA 1WEXA 1X5TA 5GAEU 3MUVP 2JVOA 1HA1A 3CCQS 3R27A 2J8AA 1KQSR 3EX7B 2G4BA 2NLWA 3SMZA 3CULA 1VQ4S 1WG4A 3HHNB 1Q7YT 2E5GA 2KG0A 1FXLA 2DIVA 2KI2A 2RRBA 2MGZB 1H2UX 4WKRA 1FHTA 2YH0A 2DNLA 1G2EA 3CCJS 2MZ1A 4Z2XA 2PE8A 2DNPA 3CCUS 4OZ1A 3Q2TC 1L3KA 1RK8A 4F25A 2HGLA 1SJRA 2LA4A 2L9WA 1VC0A 3VAHA 2MQMA 5IQQA 3HI9A 2ERRA 1U1OA 2XS5A 3H2UB 1RKJA 5LJ3Y 2KVIA 2BOPA 3VAMA 2MZRA 1X4FA 2M52A 1A7GE 5CA5A 1WF2A 2VOOA 4YOEA 2DISA 3P5TL 4TU9A 1R8HA 4IOAQ 3UD4P 2L41A 1Q82T 2F9DA 1DBDA 2AYMA 3BO3A 1FJCA 3MUTP 4C4WA 2ZJPQ 1VC5A 2RRAA 2MJNA 2HGNA 4EGLA 1YJWS 1U1KA 5GAGU 4QU7A 2LEAA 3Q2SC 1FNXH 2EVZA 2ZJRQ 1VBYA 4ZKAA 1WEYA 3B4MA 3D2WA 3CCVS 2MZJA 2D9PA 5DM6Q 3N9UC 3THTA 3CC7S 2M4MA 1H6KX 1VQ6S 2O3DA 3J7YU 3CUNA 2ADBA 4RU2A 2RUGA 2MMYA 4A8XA 2CPXA 2X1AA 1FJEB 2AD9A 3CPWR 1M1KT 2L08A 3G9CA 5CXTA 4IOCQ 3R1HA 3CCMS 1VQNS 3JB9k 3IRWP 4WFBQ 2ZJQQ 4TLQA 1HD0A 1WF0A 1U6BA 1SJQA 2N82B 3RW7A 1WHXA 5IFMA 2KXHA 2MQPA 3S8SA 3CF5Q 1YI2S 2YTCA 2KM8B 3BEGB 1K8AT 3LQVA 4QPTA 1UP1A 3VF0B 5BJRA 2MPUA 3NNHA 2PEHA 2RU3A 2D9OA 2DGUA 1OPIA 1WG5A 2HYIB 2DIUA 2JWNA
chains in the Genus database with same CATH superfamily
3JTNA 2AJ4A 3PW7A 8AT1B 1RT7A 1R8PA 1VQ7S 1M1GA 3PG9A 1NHUA 2B6AA 2HRYA 1FRLA 2C22A 2QSWA 1SJ4P 1UVMA 3T5LA 3A12A 4K8RA 4H4KC 3UVJA 1X5PA 2GO8A 2AJ2A 1UW9A 5KG4A 2LXIA 1JJCB 2ZH4A 2JRSA 2NR0A 2OD4A 3MMBB 2DNRA 2BVZA 1NXIA 1HNIA 4J5OA 3ZZOA 4RW9B 4ILRA 4WIIA 3C66A 4JI6F 5CHCB 1Q5YA 4DWIA 1RHKB 3NS7B 4X4OA 4OHYA 4Y0FA 1WD6A 1R6VA 3I9ZA 2BKPA 2J9DE 3H90A 3ISZA 1HPZB 4B9SA 2ZC4A 1LK7A 1KRPA 3WHIA 4IO1A 4AT1B 1S72S 1TKZA 3GSDA 3Q23A 5C2CA 3A8IA 2YKNA 3QIPB 2DRAA 2R2UA 1S99A 2VPXB 1JLCA 4DQPA 1EP4A 1FF2A 1N54B 5F41A 1HWUA 5KG6A 2CQ0A 4KSEB 4LT6A 2WOMA 2PGCA 2XGQA 1LEOA 2DRBA 2BRLA 3A3NB 1CJUA 1HQUA 3QWUA 4TVAB 2J8SA 5KT6A 5M2UA 1G3OA 1FRKA 1DURA 4C9DA 1WKLA 4R25A 4TXSA 4W98A 1XMQF 4LRAA 5F3ZA 1QAXA 1IKVA 1REVA 3RRHA 1GXLA 2RQ4A 2PFFB 2F65A 1JXLA 2M8HA 3KXDA 4CM0A 2XB2D 4JI6J 2BJ3A 1X4BA 1JLFB 9ATCB 2V8HA 4P75A 2RB7A 2EPIA 3GYXB 2ROEA 1CULB 2UUCF 2D7SA 3CDBA 2KVQE 3JTOA 4FF2A 2P2CB 3HD1A 3I96A 1UA0A 3UWTA 1YZ7A 3POTB 2M5YA 1RLCL 3US5A 1JLBA 2OKQA 2XI2A 4CDIA 1TAUA 2OSQA 5CZXA 1K47A 3W7BA 3QMQA 1WC6A 1IKWA 4KKOB 3MEDB 1U0HB 4OZ0A 3WIVA 2FB0A 2ZDPA 3WX4A 2VB6A 2CPJA 3OL7A 5I42B 3VWSA 1FWLA 1E6VB 1TL3B 1D0EA 1F3FA 1X60A 3GP9A 1XMQJ 2Z0GA 4PG5A 1KHVA 2KFNA 2EKYA 2VA2A 3PRVA 3L3CA 1P6TA 4J9PA 1IKYB 3IS9A 2MQLA 2EKNA 3DYAB 2OI2A 2UUCJ 4ICLB 1IBMF 4AE5A 4C8OA 3DRYA 1OYDA 3FMWA 2JZ5A 3W61A 3BSAA 3TRGA 4ED3A 2DT9A 5BXIA 2FUG9 2CJQA 1LW2A 3AD7C 5HQLA 2PIIA 1Q79A 4OMFG 4KB7A 4GVBB 3V4MA 1YJ9S 4NRUA 2G1DA 1L3UA 4C3KA 3J80Y 3HPOA 1S9GA 1S0NA 2DNMA 2VBXA 4UOCA 5C24A 4RUBA 3KG4A 2B51A 3KWMA 3CCQS 2KHDA 1FX4A 4IG3B 2C3UA 1Q7YT 2E5GA 2KG0A 2DIVA 2KI2A 3EZOA 1V5VA 2YH0A 3QO9B 4NLYA 4NYOA 3TR5A 4YY3F 5KT4A 2LDYA 3HM9A 1Z2LA 1SJRA 2GIFA 3W5ZA 2BQ3A 4FBTA 3JSYA 3FFIB 1A7GE 4N41A 2C2KB 2WVCA 3OLAA 3UD4P 2OELA 1AT1B 1SKRA 4OLPA 4OL8A 2XQCA 2W1BA 1WEYA 3B4MA 1VBYA 4LSLB 4ZVOB 2D9PA 1IBMJ 3MM6A 2VQFF 3G9CA 1VQNS 4P2FA 3JB9k 2HSEB 1NSPA 2GIRA 1HD0A 5K8PA 2VF3A 1S1VB 1IKXB 1K8AT 3FBEA 2W4CA 3W2VB 3OVSA 1RBOB 2VG6A 1UEKA 3HJVA 1IM6A 1S7HA 2ZNZA 1FEEA 4F3QA 1RHMB 3N79A 1ZM9A 2YXLA 5FDLB 3M8WA 3E01A 3KK3A 2MHNA 1RAGB 4WFYA 1YJVA 5HJXA 4ID5A 4QQBA 2CQ3A 2KZMA 4YUDA 2VA3A 4O4RA 3IXQA 4YY3J 1WJ9A 2KT3A 1QJHA 3AY0A 4ZLNA 1HNVB 2W2QP 1RXOB 1VYAA 1R8BA 5GVQA 5D0GA 3BKFA 4Q2MA 4QU6A 2OPSA 4C8MA 5K8MA 3PIPQ 2A6OA 4WE1B 3BV8A 1S57A 1NZAA 1HI0P 5J2NB 3KK1B 4YEAA 2VQFJ 3DU5A 2HVIA 1X4HA 1N52B 1BMQB 1S6QA 1VQKS 2B4VA 3L95X 3IMQJ 4ED1A 2HFOA 2A2DA 1I51B 1K0TA 1LWEA 2E5JA 2BRKA 3AD9C 2V9KA 1ZTWA 2PFDA 4M5HA 1ZBTA 2HWHA 2P6SA 3V6KA 2KB2A 2J0WA 5G0RB 3BN7A 4KC5A 5K20B 4GC7A 3GIKA 3ZZTA 3T3FA 2FC8A 2OEMA 1MW7A 4DS5A 4FVCA 4K7QA 3BBBA 3QLHB 3IWXA 2W9AA 3M2VA 2QT7A 1A0OB 2ZITA 3GR0A 4Q0BA 2MQ8A 3CJTA 1M5SA 2B43A 3DDIA 1F2GA 3HVTA 4O4GB 5CYMB 4I69A 1HYSB 4GO5X 1KQFB 2IDEA 5DQGA 3I0RA 1SJ3P 2VICA 2CWKA 4L74A 3W62A 4PWDA 1KOOA 3IO1A 4MT1A 4PABA 4YS2A 3W2WA 3B4DA 1NDCA 1S6UA 3NGRA 2BKOA 4RUHA 2WHOA 2J0XA 3EDRB 2E5HA 1P9YA 2GO9A 4JBCA 2RVJA 2KXNB 3IR5B 4KE5A 4CLTA 2B9YA 4C0OC 4PG4A 1O8BA 2A18A 2YKMB 2V8PA 3D28A 1X4DA 5K9FA 5DQIA 3CEDA 4BWMA 3EE3A 4KJIA 2DHSA 1QTNB 4P73A 2F7VA 2E1MC 1UETA 3W1YC 2FD2A 1SQGA 3CJ5A 3NP5A 2R2TA 3VAIA 2QN6B 1F9EB 1RT3A 1NNDA 2KJWA 4K4YA 5J1EB 1S9EB 2M8DB 2F5GA 1RT4B 2LMIA 2GNKA 3ENAA 3DXBA 3LALA 2Z2MA 4ZDNA 5D4OA 1NHVA 1XK8A 2CPYA 2BJEA 3CT9A 1KONA 3ZO7A 2A6MA 3EVOA 3FDSA 4BC7A 4LF4J 2R2RA 3PX6A 3VVTA 4U7CA 1FCAA 3I9V9 3FBFA 1F6TA 4TKTA 3L9ZA 3EZ5A 1LWFB 1YBAA 5H9EJ 2H3EB 2MLYA 1X8DA 3DI6A 2J8AA 2G4BA 2WONA 2BBEA 2OPQB 3G6YA 1VQ4S 1V3RA 4DN0A 4PPZA 5IOLA 4M63A 4WKRA 5KFVA 4A4JA 5C25B 3P8BB 2IC3A 3W3SA 4F25A 1VC0A 1CJKA 1ZAXA 3ET6B 1OSDA 3BSCA 3LOUA 4ZA1A 1RQ0A 1BQNB 4RUAA 2HGNA 1WKJA 4RLEA 2E9RX 2PEBA 2DCLA 1XJWB 1SCJB 1NK4A 1H6KX 1IWAA 2EFGA 2YNFB 4WFBQ 4ZHRA 1CQNA 3K5MA 1RT1B 1WF0A 1S1XA 1K0VA 2QL7B 2AQ4A 1IR0A 2QL5B 1TKTB 4EI2A 3GV7B 2W9CA 2YNGB 2KYZA 1AA1B 3UDVA 3HP6A 3R5BA 1LOUA 5HMZA 5A2QY 1VS3A 1LW0A 3GYNA 4CLKA 1SKSA 4MFBA 3MEEA 3IG1A 2W9BB 1FNMA 4I56A 4YR2A 4DSLA 2BOAA 1CPZA 4ZVUB 4ALZA 1KR4A 1CQMA 1HNWF 3Q86A 2B4PA 1M5OC 2XS2A 2ZEJA 5HVGA 4KHRA 1GX5A 3GPAA 2RHQB 3F0NA 1YJTA 1FERA 4CO0A 1UFWA 1KOHA 4PPDA 2LU2A 3MD3A 5D3GA 4Z7YA 2L3MA 4OHXA 4ZVSB 4WTOB 4ECWA 4WFNQ 5A8WA 1SL2A 2QA4G 1XBWA 4F4WA 4IH7A 2OO4A 3SFGA 3KK2B 3TZYA 3K5PA 3EVWA 4OI4A 2EFPA 4JOUA 3CJRA 2GA7A 5IZHA 1RT7B 4NLDA 5ETQA 1WKKA 1U49A 4F4AA 3MTJA 1YIJS 2B6AB 2POKA 3TVZA 5ADZA 4DR4F 2G0JA 2XEXA 4NYZA 3EPIA 3DXSX 3SCIE 1YRTA 2CPEA 2ZUAA 3BR9A 4DR3F 2YH1A 1HNWJ 4L3NA 1RWXB 4OZNA 2FVCA 2CQ1A 2Y1LB 1TL1A 1VQ8S 3M9MB 3O5TB 1HNIB 1SH3A 4J9MA 4RW4A 2ZE2B 1R0BG 2ZH7A 1M5KC 2ZZNA 4WZMA 3AT1B 4F50A 4FP9A 4RBVA 5IT0A 4DHVA 3SV3A 3T41A 1WACA 4NCGA 2ILYA 4ZPDA 1JJHA 4UQTA 2Y0BB 2JC1A 2E7XA 3Q8UA 2DYAA 4OYIA 1VRUA 2DHGA 1UZDA 4KYZA 4Y2KA 3OTCA 3W5XA 3PW5A 2R9LA 4M5KA 4DR6F 3M8QA 1JLAB 1JLCB 1EP4B 1HW9A 4WK3A 1U02A 3QATA 2HFUA 1N34F 2AEJA 5DGAA 1S49A 2WOMB 2M0GB 2R8GA 2G2OA 1I6JA 1F9FA 4DR4J 4M94A 1ZPWX 5DDRC 1GMUA 3KUHA 1CJUB 1HQUB 2HNZA 5KFTA 4F3OA 4LF6F 3OXLA 3BJYA 3DDKA 2D3UA 4DR3J 1OWXA 2GQCA 4DL5A 3OHBA 1C1CA 1R89A 2DPJA 1NB2A 4YB6A 2KDOA 4LUBA 4O0IA 1IR2A 1NDLA 1REVB 3A8EA 1BLUA 3HHLA 3J7ZT 4XDCA 4MH8A 3R2CJ 4TY8A 1T9XA 3LAKA 2ZZMA 2JLEA 1OO0B 4QWAA 4RW6A 4CI0B 3N6LA 2AX1A 1VK3A 4I1TA 1LXJA 3TI0A 2V5HG 3KHLA 2HHVA 2BM0A 4LF9F 1OQ3A 3RAQA 4CIOA 5HL7Q 3IP0A 2U1AA 1Y9OA 1G1XA 3UFCX 5CABA 4DL7A 2VODA 3HSZA 4DR6J 2ZBPA 1XC9A 1X7VA 3NLCA 3Q83A 1KBRA 2XYHB 4P6QA 4JI4F 1N34J 2V4JB 1IKWB 1B7YB 3HSDA 1CG2A 1EETA 1Q8LA 5GAEU 2XCPA 3N5FA 4M5GA 1IXKA 4DL2A 4J91A 4LF6J 3JTPA 3QSIA 4QIFA 2MDAA 3GV8B 3BN4A 2C2ZB 1F2HA 1S97A 4K4WA 1LQ9A 3DOLA 4P9SA 2VFTA 4EBCA 2FVQA 2MQMA 1U1OA 3NOGA 4RR5A 3FC9A 4NZ0A 5HN0A 1DBDA 3PX4A 1S0MA 4ZMMA 2VUGA 1H7XA 1JQGA 1T9VA 1IBKF 4O3PA 3CCMS 3SBMA 3RBXA 1LW2B 1SJQA 2JEGA 2YTCA 3EXCX 3QGGA 1S9GB 3RZAA 1N5SA 3I0SA 4JI4J 3K8VA 4RX6A 4E0DA 3JSMB 3W65A 1BWVA 5IT9Y 1U7LA 4K4TA 1FKOB 4LMZA 4IDKA 4EEYA 2N7YA 1RTHB 3OVBA 4DCPB 2CPDA 3B82A 3UDCA 1HWLA 4DQIA 4FBUA 3NNCA 3S7RA 2V69A 2W4DA 1RGVA 2MKJA 3TEHB 2R7SA 3CJ2A 2FY8A 2RJZA 4FPIA 4ECUA 4U8VA 1NJWA 4CH0S 4HHJA 1D8ZA 1RT2A 4G6VB 4WCEQ 3MM6B 2CQGA 3L4BC 5DDOC 4DL4A 2H5IB 1S59A 2HQGA 1XN9A 3Q8YA 3PO5A 3N0VA 5I3PA 4LBPA 4M95A 4JI2F 3CCSS 1IBKJ 4LF5F 2WVFA 2AYGA 1VIOA 4K0KF 4RNNA 1KHWA 3BBCA 1OSCA 3BF4A 3H59A 3D5MA 5FLXU 2VG6B 3JXOA 2N7CA 4C97A 2CFXA 3D6FB 2Z2LA 3BGRB 2N4DA 3E01B 2DH7A 1FT8A 4GKJF 1UWAA 3VVUA 2Y1JA 1KS2A 1GFWB 2OIHA 4ZLLA 4LREA 3JS9A 5DETA 3M2UB 1S48A 2FGCA 2DNYA 1JWWA 1FD2A 4N56A 2JLGA 5LXYA 3H5SA 4LVOP 2FDNA 2WVDA 3AOAA 1H2VZ 2XYGB 2HGMA 4GVLA 5JVHQ 5E7OB 4F02A 2RQCA 3NGUA 1VQSA 4B17A 1Y7PA 4UOGA 2C28A 4JI2J 2ZOFA 2CJBA 4LF5J 2XSJB 2HKEA 5LMNF 4P52A 2M7SA 4NA2A 4K0KJ 2YWWA 3QAEA 1WOPA 1ZPVA 1HBUB 1U2CA 2NSBA 1B70B 1LWEB 2YKPA 3BR8A 1W26A 2OPPB 5ETVA 1Q86T 5K14A 3I5BA 2OPRA 5FJ4A 2IM1A 4O3OA 5B0GA 2J6UA 4GKJJ 3AA9A 2NYHA 2GVDB 2BJ9A 2LQBA 4QW9A 3FQLA 4ZVFA 3UCGA 1RWNB 3EMTA 1KFSA 4NRTA 1HBMA 4O0NA 5H9FK 2VBYA 1R3NA 2UUAF 2YX4A 4V19X 2OMLA 2Y1RI 1YQHA 1MSWD 4UQGA 1H7WA 3NWGA 3M2VB 2KZZA 2J0SD 2CQBA 3MM9A 1RT5B 4Q0BB 5CZVA 3NMAA 2R8JA 3AQPA 2W25A 4K2JA 1WG1A 4HYKA 1T8EA 2Z2YB 4IFYA 2V50A 4FDFA 3VR1A 1FNOA 3HVTB 2DGOA 1V5IB 3I0RB 5LMNJ 2LKZA 1RP5A 4ED8A 3FBCA 4PXDA 1KLNA 3TW0A 4PWDB 1ICEB 3ZTPA 4B08A 3T1YF 2R7QA 3GONA 2DGWA 5F8HA 3W2WB 1T03A 2IHR1 1KKHA 2HNDB 4KY3A 3RRGA 2QYCA 4AXIA 4QJVA 4OYOA 1FXRA 2GIQA 2J7KA 2NS1B 4FS2A 1UVJA 2YWEA 3PRBA 4I2QA 1ELOA 1B0VA 4TLRA 3LWLA 4DV3F 5KOWA 2UUAJ 4H4MA 4Z2XA 4ZVHA 3I31A 3CSKA 4EUVA 3NGDA 2HVEA 3D6MB 3PXGa 2QZ8A 2M52A 3W66A 2VOOA 3MUTP 3VGVA 3AAWB 2DTJA 1U1KA 1S10A 2ZH9A 4ZKAA 3O1LA 4HL9A 2IJNA 2Q43A 4KTQA 5CAAA 1DTQA 3TA2A 3L09A 1Z4UA 3BSOA 1JNZB 3IRWP 4GO7X 1VISA 4C11A 1NK9A 3T1YJ 4JP8A 3LP2A 2XO7A 4EZ9A 4OJGA 4DI6A 3V2UC 2R7WA 2C3PA 5A76A 3HDSA 1FK9B 2CDQA 4HEA9 2XLIA 3ITHB 2HQIA 4ZCMA 4MIWA 2DHHA 2DIUA 4TU7A 4C3MA 4JUZA 1HLWA 3DRPB 4Y6IA 1P8GA 2BKNA 2XWYA 2RILA 4GC6A 2UXDF 4XTTA 4DV3J 3AH6A 4KRWA 1CJKB 2BZ2A 2H5JB 2BV3A 5IM0A 3W9JA 3TNVA 2XZDB 4URQU 1SH0A 2XZWA 3GJRB 5J2MA 2IA0A 2UUTA 3OLBA 3FNNA 4OHWA 3MMAA 3IWNC 3HULA 4D3HA 2HMIA 3CIZA 1C0UA 1B4SA 3D0HE 2DH8A 4ZPVR 4M5JA 1M90T 4C8YA 2J76E 1VHFA 1HMVA 3IM8A 4YQWA 3A4TA 3CXCR 5LXRA 3X3UA 1JMTA 1RADB 1HQEA 3GSIA 4MMOA 2MKCA 1LW0B 2J7UA 3KMQA 3Q22A 1I5OB 3J7Z5 4ZLPA 5HBMA 3MEEB 3F73A 3IG1B 2GQQA 1OPZA 4USWA 2AMCB 4LF8F 1GMWD 1VQOS 2NZ4A 3MR2A 2MQOA 2GFFA 2UXDJ 1RYRA 1PAEX 1NSKL 2CQDA 2IPOB 2VH7A 1QAYA 2X3GA 2JEIA 1TKXA 2HS3A 4NWBA 3H2LA 5D4LA 3V6DA 5KTQA 3NRBA 1IQTA 3KDOA 5D3GB 2VD3A 4C48A 2AWZA 2CUYA 3KJQB 2XMKA 1I1GA 1C0TA 1S1WA 4IRDA 3RBZA 4DUTA 2JEFA 4HVZA 1MLAA 5I3QA 3R7BB 4IRKA 1VI7A 3NY0A 4F0HA 2J9DA 2KRBA 4DV4F 2DCUB 4I0WA 1WF1A 2IM3A 2RF2B 1JKHA 3O44A 4B3OB 4ELUA 2LQ5A 3MECA 4A8OA 1QSSA 4CLLA 1R0AB 2B9WA 1ZM2A 1FVQA 3ZFVA 3D1HA 4LF8J 1TL7A 5M2PA 3LH2S 4XDDA 5HMWA 2V6AA 2J7WA 4AD6A 3ZXWA 3H5YA 1LV5A 4B9VA 1EQMA 2HRTA 1TL1B 2Z8QA 4ES2A 4W92B 1GQEA 4RW9A 1YG0A 2RRNA 4O3NA 2Z2ZA 2RQKA 3S01A 4NCGB 5T41A 4L72B 1N0UA 1FDAA 1J2VA 4BCAA 4DU7A 4YHHF 3RR7A 2H48B 5A8RB 3ULHA 2XMTA 1VRUB 2A3JA 2QLFB 2UVVA 3T5HA 2R7RA 4RW7A 2DHAA 1F5AA 3PJ9A 3M8QB 2XY6A 1OMSA 5CYJA 3HO1A 4DV4J 1RLDA 3GILA 2UUBF 5B09A 1T3NA 3EPGA 4ES1A 4WXWA 5DLFA 3EGVA 3D3BJ 2CPIA 4B9MA 2DEJA 2F40A 2H65B 3NAHA 4F4YA 4FVMA 3ZZRA 4ZVGA 1C1CB 2ABYA 1YDLA 3IC1A 4KPCA 1N5QA 4LSNA 3CW2C 2DNPA 1ZM3A 2I6WA 3J7YI 3HHLB 1IUJA 2P6TA 2DPIA 1JXVA 4TY8B 1JLFA 1LXNA 2ZUGA 2FHKA 4Q7AA 5LJ3Y 4RW6B 3QGPA 3R5CA 3W9HA 2L41A 4YHHJ 2ZNYA 5IV4A 1XR5A 2AZ1A 3MR6A 1W7WA 2LEAA 5C42A 3NCPA 1RSCA 1RTZA 1YLXA 5DM6Q 3CD0A 3QJPA 4ED2A 2OH2A 1H98A 1WC3A 2P8IA 2JEJA 4OLOA 2X51A 1R31A 4F2SA 1FTRA 2HBYB 4M5LA 3S8SA 3CF5Q 2FJAB 4L76A 3EZUA 4ITSA 2O5DA 4KKOA 2F4FA 3MM8B 4DCOB 2UUBJ 2PEHA 2RU3A 2I8EA 2CZ4A 3RU0A 4L6V3 4WXOA 2HYIB 4F0KA 2WB4A 3UDEA 5I42A 3B8HA 2YWKA 1RHRB 3FVYA 2HWIA 5E3PA 3DOLB 4DX7A 4B9NA 2ZVIA 4KH0B 2YVSA 3OL9A 2UVUA 4P2SA 2IIHA 3HZGA 1AFIA 1FO1A 4QW8A 3DYAA 2IM0A 1NK7A 2NXUA 4ZJLA 4ICLA 3M8RA 3E3XA 2HLUA 4FXVA 4USUA 1U1QA 3THVA 2RAQA 4X66F 2YPZA 1U45A 1UCNA 2VONA 2YQ1A 2EFNA 3OR1A 4DV5F 4AL5A 3Q89A 2QLXA 4GVBA 3TJAA 1J27A 4CLUA 1YITS 2FJDB 2FJXA 1LWXA 1VRQC 2M70A 2WAQD 4H4KA 2GVZA 2YY3A 3TZWA 7FD1A 4ZCIA 4F26A 5KG0A 5A8KB 4JV1A 4P72A 4IG3A 3CJKA 3SXLA 1XMOF 3IBCB 4CO4A 1WUUA 4RW8B 2R8IA 3IR6B 3K57A 2F3JA 2CIMA 4HTIA 3KDNA 1E6YB 4LRCA 4G1QB 4NOHA 3SIPB 4XPCA 2K1RB 3BZQA 2CJ9A 4NLXA 4ZIVA 3R5JB 4EYIB 3BREA 2N3OA 1RZMA 2HNYA 4L3KA 5J1NA 3M8PA 1RT2B 3CWJA 3FSXA 2LU1A 4QBUA 4C8LA 1NK5A 2ACYA 3I87A 3IRXA 2J6SA 3M2RB 3D6TB 2HZCA 4X66J 1DQ9A 1HWIA 4KR0B 5KFPA 1FEHA 1ZYQA 4X4NA 5GAHI 4DV7F 4KHPF 3X1LB 2D3OR 1T9UA 1NH8A 4LQ9A 4EFAC 3MFHA 3N4WA 5K8NA 4DV5J 1Q8KA 4WWSA 1BUXA 4KIAA 1HARA 4WBFA 4OZ5A 1A6LA 3IGNA 4DX5A 5CCLA 4CH1A 4YFUA 3G4SS 4HH1A 2IA6A 1GAOA 2KFZA 3GB0A 3KJVB 1XMOJ 4ED0A 3TWZA 3D54A 4EMDA 2W24A 5KFRA 3MCOA 1V9OA 1Q81T 3TUZC 4HTJA 3ZC4A 2BMBA 2ZH3A 5ETLA 1HNVA 5IC4B 3FSIA 3OW2R 4K5RA 1T3OA 5MAOA 2IVYA 4C6AA 2DO4A 4W4MA 1YRXA 3NGSA 4RBUA 3OTOF 1SKUB 4WE1A 3ZZZA 2KHCA 2CPZA 1SJ1A 1CS4A 3G87A 5J2NA 4PEOA 2HBRB 6FD1A 1FKPB 1NRKA 1D8YA 1RISA 2XMUA 4DV7J 1HHTP 5B0DA 1ZZNA 4Q8EA 3ZNJ1 4I7FB 3J7A1 1W2BR 4K4VA 3SSQA 2G0IA 3G6VA 3H8YA 2CQ2A 2CNKB 1MG7A 1JLQA 2OPRB 2CZ9A 1N56A 3VTIA 3UD3P 1NJZA 5JJBA 1B0TA 2V4QA 2FLPA 4J9RA 3OFGA 2IY5B 1WEXA 2CAJA 1HA1A 1HBMB 2WW4A 3BQ0A 5E0OA 1KQSR 3EX7B 3CULA 1MN7A 1DJ0A 3HHNB 1S7IA 1VK8A 3PR5B 3CCJS 2NUHA 2HBZB 3ISND 4I6YA 2X3DA 4MIBA 4O3SA 3OTOJ 4NLTA 3MM9B 4J9QA 3MGJA 5ETSA 3PR4A 4YOEA 2DISA 2HFVA 4IFYB 2H4WB 1Q82T 3GZ7A 2CG8A 4O4GA 4QU7A 1HYSA 1P1LA 1RT6A 3AXMA 2B9EA 3EXYA 2GZOA 3NCQA 3KLIB 2DJWA 1CSJA 3J7YU 5A6WA 1FJEB 4J9VA 3BBFA 2A10A 4AYBD 4TLQA 1T03B 2C1EB 2I5JA 3D0GE 3G82A 2O1PA 1TFWA 2Z4PA 4XAKA 3NEKA 1S76D 1GT8A 4ZPTR 4DSEA 3OBIA 4I2QB 2YKMA 2D1CA 1KQGB 3HKWA 8ATCB 3SV4A 4YMEA 5HMXA 2RD5C 1RABB 2AIRB 2UZAA 4H4MB 1HQ2A 2XY7A 3C15B 1DTTB 3H98A 2X1BA 5AT1B 2MKHA 2ZH2A 1TMMA 3G8TA 3CJQA 4RNHA 2DY1A 5B0BA 3EJMA 2PI4A 2DNHA 3TARA 5LSOA 3M1VB 1RT4A 2NSCA 3UR3C 3I82A 4U95A 4O44A 2ZZTA 4PXEA 3MR7A 1DZ5A 1F1BB 3G71S 4AQYF 3E2EA 4DX8H 4ZN3A 3OFHA 4X4PA 2LECA 2KRRA 1WWHA 4WYLA 1T9TA 3DLGA 4B9TA 1DTQB 4MKVA 7FDRA 4J9UE 2Q3PA 3MMJA 1XERA 2YKQA 4C11B 2E1PA 1HL6A 3LWMA 3R8YA 3LP2B 2VG7B 2XCAA 2FLNA 3CMAS 1TQLA 2CJAA 3EDQB 2DNNA 4USMA 4H4OB 3D9BA 2D3O1 2OPQA 1D9FA 3T1HF 3I5AA 3M6WA 2GC8A 1SH2A 2MTLA 2MQNA 1GK8A 2MKKA 4MYUA 1LNQA 5C25A 3VV2B 2QFJA 2DEIA 3HXMA 1SC6A 3ET6A 3KTQA 1NKEA 5IM0B 2FZCB 5KFQA 4URGA 1N4LA 2B9XA 4Z7CA 4AL6A 5D0RA 2DGXA 2P9CA 4WU3A 4PQUA 3MMAB 3HFVA 2K8GA 4LJMA 3IA0A 2HMIB 3KUEA 2CQHA 1PCAA 4AQYJ 3LAMA 4XIUA 1FE4A 2BUNA 5HSPA 1BXNA 2FLOA 5L39A 3PVXA 4FXWA 1HMVB 1RT1A 1X0FA 3GFHA 4WJBA 2BM1A 5F8NA 5K5MA 1TKTA 1EHWA 4NX9A 1L3VA 3LF0A 2CXEA 4FF1A 2J9EA 4LSZB 5B08A 3PYFA 3QAUA 4O23A 5DRKA 3LGHA 2DXEA 3O2IA 1KP6A 4RPFA 1HNXF 3CO9A 4EO6A 4CYUA 3HLUA 5HBMB 2RH3A 2W9BA 3T1HJ 1Y0HA 2FTRA 5GAHU 3T9NA 3MR3A 4LIRA 5D0HA 3LPYA 2ALYB 1KDNA 3TQEA 1PO6A 3UN5A 4FXDA 4JI5F 1TKXB 9RUBA 3BDEA 4PCQA 3QT8A 2HIQA 5LM7E 5F9NA 3V6DB 1VBKA 5LL6d 4FYYB 1UPMB 3KFWX 2XMWA 3P45B 2KM8C 4CRJA 5HLFA 2QV6A 1YJRA 1Y10A 3WC0A 1Y00A 3SFUA 1QDUB 2DGSA 1N5VA 1WSRA 1C0TB 1S1WB 3KK2A 3MCMA 4BBYA 2Z58B 2NZCA 2W8LA 2NPIA 1MNEA 4NLRA 2LA6A 2GJIA 1FDNA 4X84A 3HZEA 1JKHB 1FFGB 1EJ7L 2XYPB 1EX8A 1HNXJ 3MECB 2CWXA 4P10A 3MXHP 1YBTA 4ID8A 2BR0A 3N6MA 3J81Y 4UUXA 5HK4A 5H1SV 2XSFA 1X4AA 4KO0A 1S1UB 3GIIA 1TL7B 1VQLS 4DDFA 4B3SF 2I0XA 2BQUA 1ZA1B 2JVOA 3HHLC 3SMZA 5CD4A 4JI5J 3L7PA 3VZHA 1PJ6A 2Q66A 2ZE2A 3HFKA 3CCUS 1HR0F 3BH6B 4DS4A 2EG2A 1Y3JA 2ERRA 3H2UB 3QZ7A 4DSJA 1YJUA 4DFJA 3R3TA 4U6PA 4IOAQ 3GQCA 3NBPB 1FJCA 4P71A 4F3MA 4FS1A 2ZJRQ 2R2SA 1K44A 4RW7B 2HBQB 3CC7S 3ZZ0A 3JAMY 4OI3A 3PW4A 1GMVA 5KFJA 1KWMA 2CVIA 1JLAA 3ENVA 2R7OA 3TANA 3QZ8A 3H0PA 1H3DA 4J7CA 3AA8A 3GG0A 3H5XA 2WSCC 2AHOB 2AX0A 4DL3A 4X4SA 4I67A 2HS4A 4F36A 2W7AA 3FCVA 1XIQA 4OX6A 4B3SJ 2E7WA 4DUZF 4IFVA 2DBBA 4K4ZA 2E66A 2XHCA 4J9KA 2IFXA 5DDQC 3K58A 3I4HX 4LSNB 2CG4A 4WZQA 4ANCA 2WVEA 2XMVA 3LW5C 4M1KA 1HR0J 4YR3A 3R97A 3OXFA 1XWLA 1JX4A 3K5LA 1N36F 3BB5A 1EZZB 3HVRA 1A9NB 3U1NA 5GAGI 2H54B 1JJ4A 5C42B 3Q8RB 4ZP8A 3GYGA 3HKZD 5E5NA 2MJUA 2CPHA 2ZVSA 3PTWA 3MD1A 3VALA 2FQQB 2HLTA 2BQRA 3DLLQ 3UE2A 3K8WA 2WW8A 2C2RA 2I38A 5KFYA 2V4JA 1UEUA 4PG8A 2IAJB 2OJ3A 3Q8VA 4DV6F 2FHJD 2L9NA 2AKWB 3C46A 1F60B 1ZETA 4DUZJ 2WSFC 3UD5A 5THWA 5F9LA 1M0SA 2ZDOA 5EN1A 3M6VA 1EB0A 4KV8A 5RUBA 1FFWB 3FCWA 1VJQA 4N8NA 1MWZA 2JJ4D 2Z30B 4LFCF 1JJ2R 3FKBA 1YTYA 5AE2A 4JI8F 2XMJA 5ETOA 1FRJA 1N36J 1C2PA 1S5ZA 1JXEA 4DG1B 1T05A 3DOKA 3MDFA 1NM2A 3MOZA 2N4CA 5L9XA 1R0CB 2YQ3A 5GMKa 2VPZB 3OR1B 3BPSP 1NPRA 4KGVB 1HWKA 5KG3A 5DG9A 1CJVA 2FIUA 2GVZB 4CM2A 2WCXA 1FD8A 4C8KA 3JSMA 3GIMA 4ZLJA 1Y4ZB 1U1PA 1MROA 4DV6J 3ILJA 3DGPB 2V0NA 3M6XA 3CJKB 1YSJA 1FKOA 4O3QA 2PT0A 1RTHA 2JHEA 3EM1A 2HVHA 4M8LA 1WC4A 2NXEA 2QTWA 3SCKE 3RGIA 1KD1T 2HK2A 3FQKA 3GFYA 4LFCJ 1GXUA 2RT3A 3ONQA 3LANA 2HNYB 4JI8J 1DRZA 1JLEB 3M8PB 3EGWB 3G2XA 1NJIT 1OJ4A 1RU2A 2F8EX 4LFAF 1N5TA 2OTJS 4NYPA 3IRXB 5KFKA 1VQ5S 3K0JA 1RA7A 5M2RA 3DOMB 2VC1A 3T6JA 1VBZA 1YVFA 3A3PB 3PYEA 3TUJC 1HWJA 2KJVA 5D6GA 1AXQA 2PO4A 5SUHA 1S1TA 3U1MA 3MFIA 1BQXA 4NA3A 3DHWC 2ASJA 1DQAA 3CCTA 1UW4A 5ETKA 1RTJB 1WC1A 1SUQA 3BGRA 4GMKA 4L73A 4DN9A 4K4UA 1KQKA 2BW7A 2LEPA 4K5SA 5HO4A 4USIA 5I3UB 1M5PC 1SKWA 1KVKA 4J9SA 2XTJP 3M2UA 4BWJA 2AT1B 1Q4RA 2AJ1A 2AU0A 1NPPA 3VHQA 1G2EA 1T0TV 2PE8A 2YWFA 4IH5A 1RK8A 4LFAJ 1CS4B 3VAHA 3PJWA 2BOPA 3MPWA 3VAMA 4ZJOA 2R7XA 1R8HA 5KFIA 3TZXA 4C8NA 2XSJA 2ZJPQ 4QOTA 1X0PA 4QIVA 3VQTA 5FD1A 1VJWA 1U25A 1HBUA 1VQ6S 2ADBA 4A8XA 2CPXA 2KKHA 1BGXT 4F04B 1XNRF 3DGVA 3PHTA 2VFVA 3M8SA 2OPPA 3FEZA 1JLQB 5JUMA 2V2VA 1VLOA 3LQVA 4ZPWR 3VGUA 2GVDA 3ZTRA 1RAOA 2MPUA 3L7UA 4QYZJ 4X4VA 2QLWA 3IWLA 4HKQA 4MYTA 1NDKA 2HG4A 1LFWA 4FZVA 4CLYA 1SQEA 2XY5A 2X1FA 1U6FA 1NPKA 1VMBA 1OY9A 2JDJA 2G2YA 4DQQA 2AEFA 3JSRA 3J80U 5IXUA 1RE1B 1T95A 1RT5A 5D4PA 1AW0A 4IRCA 2XMAA 3TYTA 3UCZP 2I2YA 2WBRA 1UVNA 4KT0C 4AUKA 4LF2A 2Y8WA 4RBTA 3RRKA 3GJTB 2G9OA 4BDPA 5KFZA 2R8KA 1RDRA 4A46A 4DPYA 1S4EA 1RT6B 2FJWA 1SPBP 2OFGX 2FGOA 4OX7A 2MSTA 2BE9B 6FDRA 5DM7Q 3ZTSA 3TZZA 1BHNA 1XQIA 2JFKA 3MPUB 1NSQA 4IR1A 4C0BA 1XNRJ 4Y2IA 4DF8A 2HNDA 2I5JB 4ANDA 1RWMB 3G82B 2OD6A 3ILOA 1D9AA 3C14A 3PHEA 3QGHA 3M7VA 1TL5A 2FVRA 3NGKA 5L1KA 4ERDA 4L75A 3DCAA 3QNWB 2BE2A 1JLGA 2B56A 5JXSA 2VDHA 2CRLA 3NXZA 2QYGA 2JLFA 4G1PA 2E1RA 2B5JB 3R5AA 2B7CB 5K8OA 3U7JA 1OIAA 4O44B 4LQ3A 1T9WA 4JI1F 1DHMA 2F1FA 2XLKA 2RHSB 3P4UB 2DVIA 1P27B 4NPOA 3T5KA 2G2ZA 3DLHA 1Q16B 2YNHB 5EHHA 4AL7A 3GMGA 3DLGB 1RAIB 2IMOA 2VBZA 2R42A 3G8QA 3A13A 1NO8A 1UZHA 3KG0A 4HACA 2DITA 4RNOA 1HHQA 3H42A 1WC0A 3CD5A 4MKYA 3BGOP 1U8SA 2GHPA 3JQJA 3CIMA 3R2DJ 3W63A 1NKCA 1FK9A 2R4FA 3ITHA 2B4UA 3NKYA 2CQIA 5F8MA 4RJVA 3AJ1A 3DRPA 5E3AA 4DV2F 1MWYA 1WHVA 1UVIA 4JI3F 4AXJA 2PSZA 5T7LA 3BS9A 1QY7A 3OD2A 3MM5B 4XPEA 2FPHX 4OFZA 5I4MA 1UAWA 2B8QA 5L46A 4TQSA 3TVKA 2FHOB 5BYQA 1WHYA 3GJSB 4PQUB 2KH9A 2K3IA 2M88A 2HFZA 4JI0F 2XBPA 2IRYA 4JI1J 4Z37A 5E33A 1T02A 2EC0A 3QSYB 2FC9A 1PC5A 2AJFE 5B0EA 3MMCA 1C1BA 4F0MA 1MMDA 2DXDA 3OR2A 1Q8IA 4J90A 3UNYA 2HHHF 3ZNUA 4CYUB 2GS8A 4NMXA 3ZZUA 1YWXA 1F0XA 3BYRA 5DG7A 4MJKA 3KLFA 4DV2J 3G96A 1W25A 8RUCA 2M3DA 1U1NA 4QIGA 3PYDA 3IFEA 7AT1B 4JI3J 5DS7A 3JYTB 2Q6BA 3R27A 1FESA 2ZWPA 4ZS6A 4A8WA 5AE3A 3SYZA 3MWBA 2YKOA 5AXLA 1H2UX 1Z1ZA 1FHTA 2K2PA 2DNLA 4TNOA 1Y5IB 1QLNA 4CTAB 2QL9B 5HLFB 4JI0J 2ZBCA 2KT2A 3D66A 4QCLA 3RB3A 1KFDA 2MZRA 2ALZA 3BO3A 5J1PA 4DZ6A 1IWGA 3DLKA 3TQ1A 1YJWS 3W64A 3LO3A 2MZJA 1NJXA 3PYGA 3VCDA 2BEFA 4IOCQ 2RF2A 1RYSA 4B3OA 4UTGA 3ETMA 3H7HB 1XTZA 2HHHJ 1R0AA 1S4FA 3MCNA 2PDAA 2KXHA 2MQPA 1YI2S 4X4TA 1KEKA 4KO0B 3VF0B 4ZP7A 1RWOB 1AYEA 4CO2A 1RTIA 4DQSA 3ADAC 3GG1A 4DJBA 1MMNA 1KN6A 2UVWA 2YX1A 1G6BA 5EWFA 2MHEA 4DR1F 2JWNA 2LLZA 4HH0A 1ITPA 1Q0NA 1BQMA 4J9LA 3IR7B 2NXNA 3PM9A 1FTCA 1SC3B 1N88A 1FI4A 5MLCV 4K2XA 4LRFA 2W8KA 4C98A 1SVDA 5A8RA 5HMYA 4Y2AA 4M5DA 2F63A 1TK5A 2LCWA 4U7UD 1KLMA 4UOHA 2XG8A 3TAMA 1PJ5A 2VPYB 1YRUA 1LKZA 3NG8A 5HJYA 3CGIA 3KLGB 1KSPA 2APOA 1NDPA 2NPFA 3K7RA 4XO0A 3I5CA 2V34A 2W7PA 1PKUA 4LVNP 2F8MA 4WU2A 3HCXA 3PCOB 4C2MA 1QSLA 3KLEA 3P96A 3EGNA 5HI7A 3WDOA 4ILLA 1FE0A 1VHIA 4CWBA 4Y28C 4IFVB 3ZTQA 2X1GA 1N0VC 3QWPA 4DR1J 3K89A 4K4XA 3CD6S 2K06A 2ZOGA 3C16A 1ZTTA 4MIAA 3M32A 4HI2A 4USVA 2W2PP 4OYWA 2Y3YA 3QT6A 5A2QU 2E5IA 1JB0C 3CCWA 1FRHA 1AZSA 2BX6A 2GGPB 4ETXA 1N8RT 3W8PA 3FZ2A 4NLWA 5T14A 4NLQA 2CNNB 4ANEA 3OTBA 2J5AA 6AT1B 4ZK7M 4USHA 3BGUA 3DKDA 4I68A 4CLZA 4BLGA 2MLZA 4WP3A 4DUYF 4DFKA 3M8ZA 4JI7F 5KT5A 4ZPCA 4UW2A 1WELA 2ACMA 1RACB 3MM8A 4P7VA 2C42A 4FYDA 4DFMA 3QPIA 2JFDA 3PFEA 1PIEA 3NS5A 1WC5A 3QFWA 1NMEB 1HIYA 3FEYB 1RHUB 3UN2A 2Y9HA 4NI2A 3M30A 2K7KA 4PXCA 4ZCLA 1B64A 4KV8B 4PG6A 3CC2S 1FJ7A 4R8UA 3NMRA 1X9SA 1U47A 3DRXA 2B0GA 3MCSA 1SI9A 1NSAA 4TY9A 1D1UA 3KUGA 4I64A 4CLSA 4F2RA 2FJEB 3ZZYA 1PC4A 2BDPA 1SIZA 1Z2ZA 1T05B 3UO0A 1NK8A 4LF9J 3DOKB 1WOOA 2M2BA 2E7VA 3VGSA 2UV8G 3KNGA 5E3QA 2EI5A 3TP2A 4QR2A 4ZPBA 4DUYJ 2RIJA 4B3TF 4JI7J 3RW6A 3ZZPA 1SC1B 1CJVB 1TELA 2B4OA 2QJ3A 1VC6A 2C3MA 1HKAA 4JV2A 5CYQA 5A8KA 2ZD1B 1MROB 5AXNA 2PC6A 1K1SA 1SIWB 4RW8A 1YX2A 1FWKA 1JIHA 2VFRA 2UXCF 1E6YA 4G1QA 2QLJB 3M05A 4MAKA 1ROFA 1B99A 2K1RA 4LRDA 1UKUA 2PN6A 4ZVQB 5JMNA 3F44A 3WZ0A 1I3OB 4LF7F 2EEYA 3FUYA 3Q2TC 3M2RA 3WX8A 2CADA 1RKJA 3OT9A 2C3YA 1NZ8A 1IJEB 1IN0A 2BXJA 3LTOA 4LR7A 4CO5A 5F0WA 1FRIA 4ELTA 3OSPA 1FRXA 1FNXH 4DSKA 2EVZA 1U4BA 3DLEA 4N5SA 2VV5A 4B3TJ 4F8RA 3CCVS 1S1TB 3BM7A 5KFSA 3D3CJ 2HHUA 4OI0A 3CVKA 2ZJQQ 1SUQB 1U6BA 3N6NA 3KJVA 1WHXA 1HBOB 2EFVA 1QUPA 3WBZA 4DZDA 3SQGA 1U6ZA 1VRTB 2VJVA 2UXCJ 2GMLA 1U48A 5HANA 5KFEA 4NA1A 3RB6A 2HZAA 2H4YB 2X7IA 1UJ6A 5EWGA 2MKIA 5J2QA 4B3MF 4FF4A 1URRA 1RA6A 4Y00A 4LBHA 4WYWA 5D8HB 2BA9A 4LF7J 3A1YG 4RL1A 1EARA 1RBAA 1X4GA 1C4CA 3IM9A 4PAAA 2NCKL 2YBVA 4USJC 1FKPA 2IYIA 4EYHB 3R5GA 4PUOB 3FRYA 4YR0A 3BGLA 1CBKA 1DARA 1PILA 4I7FA 4ZVTB 2DR7A 5LT5A 3QRRA 2AYBA 3HJFA 5ETNA 4CNZA 2OHDA 4NLSA 5DZ7A 1K73T 4E8UA 2OLWA 2JSXA 4DU8A 2BANA 4TN2A 4OHZA 1WOSA 4ZOSA 3T6BA 1UA1A 2QMXA 2AJ0A 4LR8A 1X9WA 3PEHA 4LF1A 1KNZA 3PV8A 2MSSA 3LP1B 3SDEA 2DNOA 4OJ1A 3JQMA 4B3MJ 5HQMA 2NXJA 3MM7B 1VCTA 3GR1A 5L9NA 2V2ZA 4Y3CA 1L3TA 3V6HA 1B7FA 2VC0A 3R1LA 1WORA 1S0VA 3HMJG 2PMWA 2QSFA 2RNEA 3V4IA 5IT9U 1KVJA 3FMBA 3KJNB 1URNA 1LFPA 3ILIA 3KLIA 4C7QA 3D4JA 1N6QA 2V2QA 2QA4S 2MB0B 1S9FA 2HIYA 3GE9A 3TA1A 3GLJA 1DY3A 5DGBA 4N77A 4YP3A 2DXFA 1ZZFA 5LSLA 1HFEL 4DOZA 4EU0A 1OY8A 5HROB 3LGMA 4NLGA 4HT7A 1FJGF 1NAQA 3GFXA 3C14B 2GMJA 4X4QA 3MEGB 3Q24A 3UR0A 1IVZA 1JNRB 2LYVA 5EX0A 4J9OA 2A2CA 4WTYA 4CP5A 3AODA 2BE2B 1UTAA 3A3OB 3C15A 1DTTA 1JLGB 4Q45A 2OAUA 3V81B 5HVHA 2RSQA 1QVFR 1VLYA 3QGIA 3AB4B 2CKWA 3PEJA 4Y34A 2ATCB 3M1VA 3CMQA 2V8VA 2V63A 3J81j 2MGZA 3NL0A 3H20A 2ZBQA 3G8SA 3CDEA 4DPUA 2QFIA 2QA1A 2OEJA 2JL9A 3HSJA 3PKMA 4K4SA 4NCBA 4HACB 4WP8A 4OQJA 1RAEB 3KJFB 4LBIA 4QR1A 2G0CA 2VG7A 4P7TA 4HDHA 4DF4A 5EWEA 2QC3A 2V8GA 1U09A 3Q0AA 3C3LA 1TV6A 1O6XA 2ZH1A 4H4OA 1ULRA 1FJGJ 3WQPA 4F4ZA 2ZKTA 2BYCA 3PDNA 4CQ1A 3C6UB 4DL6A 3ENWA 1VDHA 3L7OA 2RS8A 1S77D 1RCOB 3KHHA 1T11A 1VR6A 1TR0A 3MPDA 5T7LB 2VU5A 1TKDA 5IC6B 2B8PA 3W60A 3WIUA 4M5MA 4F67A 4LF4F 4DLEA 1WNEA 3CJ4A 3DHXA 2HZVA 4OZ1A 1L3KA 2L9WA 4V19J 1H0HB 2FZGB 3OUYA 3OFFA 3R6LB 2VBWA 3MMCB 5CA5A 1WF2A 3M9NB 1C1BB 5F0UA 1O51A 2B7BB 4C4WA 1VC5A 2MJNA 4CCHA 3GWCA 4ETZA 2W4PA 3D2WA 2NUUG 3OR2B 1N5YA 3OPKA 2RUGA 2CZVC 3FK4A 1Q78A 3SQOP 5EX3A 2N82B 4HT5A 4FKYA 2IBKA 5IFMA 5E41A 1LWCA 2HK3A 2HQ3A 4QPTA 3KLFB 3CDUA 4M5IA 2AEMA 5DJBA 4ECVA 5GAEI 2O66A 2HHTA 4X4RA 4OZJA 1XR7A 3KLHA 1WG5A 2UXBF 1N33F 5BYSA 1DAXA 4DFPA 3HHEA 3SI8A 1RJJA 5HATA 4AFFA 4KGMA 3OTEA 3CCZA 4CT8A 1AB8A 4C0HA 1RI7A 2AYEA 1HD1A 4P2XA 1T7PA 4FYWB 2AGQA 3DFEA 3Q8QB 3IN5A 3DM2A 1U2FA 4UZCA 1H2TZ 2MZSA 3DLKB 5B0FA 2LFVA 4RU9A 3BO4A 2OFHX 2HEKA 2GW8A 2ZC3A 1U1MA 2RUSA 2CNOB 5L1LA 3HX9A 2R7TA 4QIEA 2E5LF 2YKAA 5HQ8A 3AD8C 3U1LA 4OJHA 2GV1A 1GXTA 1S1UA 2OSRA 4Q43A 1RCXB 1Y11A 4QWCA 1RTIB 5LSRA 4H54A 2QO3A 3MAAA 5GMDA 3MAQA 2RKIB 5ETPA 4ECSA 5JVGQ 5SZTA 2CJXB 5D0EA 4CO3A 1YBUA 2UXBJ 2OUGA 1N33J 2WZ1A 2VASA 4ED5A 4E2FB 3AXKA 1BQMB 3VAFA 5LJ5Y 1QAJA 2MY8A 5DG8A 2D3ZA 3OJSA 1EKSA 5LOQA 4B9LA 3SCJE 2AP6A 3MF5A 1IBLF 5L8RC 5IT4A 2LQ9A 3UDLA 3OV7A 1RHJB 3NBPA 4U9RA 1TVRB 2BJ7A 1UWBA 2XZTB 2EK1A 4A8FA 2R7VA 4M5DB 3Q8PB 2ZH6A 1S6PB 4ED4A 1IQZA 1KLMB 2ROPA 3TAMB 4IQMA 5BR8F 2AW0A 3QJLA 4QIWD 3M6UA 3HVWA 2FZKB 1H72C 3RJMB 3J7AN 2H9ZA 2U2FA 2E5LJ 3I6PA 1NCLA 3PW2A 4ZVPB 4KGXB 3KLEB 3GIJA 5AE1A 2HVZA 1GTHA 3P5BP 1FFSB 2ZH8A 3RTVA 3QFHA 3TOQA 3CJSA 3C16B 4QWBA 1PG5B 3M32B 1SV5B 3LP0A 3MZIA 3KHRA 1I94F 3HF5A 1ZS6A 1RUSA 5BYRA 1IBLJ 4N8OA 1AZSB 1RWUA 3VAJA 3NOCA 1QE1A 3R9LA 1UMJA 2KU7A 3CC4S 4QPXA 3THPA 1Q8BA 4F4KA 4F4XA 3EVMA 3MI7X 2MYFA 4OHVA 4WF9Q 2HHQA 3V5RA 3UVJB 5C7PA 5ITHA 5BR8J 1H73A 1TP7A 2KG1A 3O6QA 2GQ2A 4FPRA 1AFJA 1AROP 1R8AA 2IVMA 4KAIA 3G6ES 3CCLS 1GNKA 4NLVA 3U02A 3R7SB 1WSVA 5J2PA 2IAJA 3EUNA 4OYXA 5KFOA 3NNAA 3TAQA 1TL4A 2MZQA 5A0YA 1HNZF 2GCFA 4ECZA 1RTDA 3BO2A 4NI2B 3M30B 2M9KA 1BC6A 5F8LA 2HW3A 3UPFA 4ECRA 1TKZB 4R8UB 4BC9A 4Q8FA 1OQ6A 1PYOB 2YKNB 1X5TA 1RB0A 1SC4B 3MUVP 1OS5A 2NLWA 2WK4A 1I94J 3KOAA 1WG4A 2FHJA 1WTFA 2BW2A 4OI6A 2C2OB 4DG1A 4IG0A 1UFLA 3PRDA 2HGLA 2W7OA 5C5JA 5IQQA 3HI9A 1EIYB 2KVIA 3EWGA 1BE4A 4IOBA 5KFLA 3OL8A 1S12A 3DRRA 4Q2LA 3QQCD 5FLXY 1IKVB 4B9UA 2O67A 3TA0A 5HP1A 1REGX 4JV5F 4HR2A 4RU2A 2EFQA 3N5BA 5CYQB 2H5EA 3SEOA 2KL8A 5KFBA 2L08A 2Z56B 3DGPA 4ATNA 1WDDA 2E1AA 1VOMA 1DFDA 2W01A 3ETOA 4CLWA 2XI3A 1T9YA 4QWDA 2WBMA 1HNZJ 1FDDA 4CO1A 2O01C 1UP1A 3VQSA 3RB0A 4NE9C 2C2EA 5KG1A 1GX6A 1UFKA 1B3TA 5HAOA 2LVWA 2K7JA 4Q44A 1OPIA 1JLBB 2PA8D 4NASA 1JLEA 1U24A 4NLUA 2IVFB 2PMZD 1N32F 2AV5A 4ZPAA 2DNKA 1FVSA 4DR2F 3CD7A 2GHVC 2FJVA 3OSNA 2W2MP 2MZTA 3N01A 3DOMA 1CJTA 3GTYX 4GRSA 3QRPA 2FVSA 2XO6A 3RR8A 3DLEB 3H40A 4RZRA 2JNJA 3M9OB 3B78A 2C2NA 3S1TA 2GJFA 4JV5J 3OVAA 3RBEA 1PGZA 1RBLA 1QTMA 1RTJA 2VG5A 2L9DA 1TUWA 3IS9B 3D0IE 3IBFB 4FN5A 1WTBA 2CQPA 3SQGB 1AUDA 5I3UA 2DHXA 4DR5F 4FNIA 3WC2A 1IR1A 3BQ1A 4WFAQ 3H5UA 3HFZB 5L1JA 2IM2A 2J6TA 3RG6A 5J2QB 3MTKA 3D7SB 1VQPS 3O3LA 2MEWA 1N32J 3CDWA 3I56S 1EAYC 2ROGA 4DR2J 3CDAA 5C24B 1RAAB 1U0SA 2QE5A 3UCUP 1K9MT 3H4DA 1MU2A 2VKRA 1UVLA 5KFCA 4KHPJ 4P2MA 4OJ3A 2BABA 1YJNS 2Y0SD 1HI8A 4DV1F 1YZ6A 4DLGA 2QRRA 5B0AA 1U2RA 4I6AA 3TO8A 3H4BA 4LRBA 4DXLA 4DL0C 1XR6A 2LXFA 2VOPA 1X4EA 2DH9A 1TZ0A 2EC2A 3RUBL 2AZ3A 4PKDB 2JX2A 2LQJA 1D9DA 2IDLA 2BANB 3K59A 4RKUC 2Q1LA 1RWKB 4RWWA 2KXFA 2WVBA 4DR5J 2AGOA 4IYQA 3N28A 4ED7A 2CNLB 4QYRA 4JYAF 1ZM4A 3GV5B 2VZ9A 3SDEB 4I2PA 4J9NA 2AF6A 4FYXB 1SQFA 2I9SA 3R5DA 4FF3A 5H9FJ 1TK0A 2VQEF 2CQCA 2XNRA 4IKAA 3NCRA 1RWWB 1CEZA 3V4IB 3R7NB 3C6TA 2G13A 3KK3B 3KLVA 4R5PA 3U27A 2EK6A 2KFYA 3P49B 4BHQA 2QMWA 2RS2A 4ID5B 4DV1J 5F3TA 1R6YA 1N6QB 3QYYA 4UY8T 2COLA 2HAFA 3KNAA 3FGVA 5DLGA 1VGYA 2YPYA 2DNGA 3PKYA 1HBNA 2RQMA 2DB1A 3CO0P 1RAJA 4U67Q 2OPSB 1KTVA 2YNIA 3TX0A 4USKA 1M5VC 1FWPA 3MHYA 2ZHBA 1S6QB 3W9IA 1R43A 4JYAJ 2VDIA 3PX0A 3EYZA 3D67A 2CVEA 2Q6CA 3JSBA 2H51B 1UJ4A 1IM4A 2B5JA 2ASLA 3UW1A 2VQEJ 1FXLA 2RRBA 2MGZB 4TQRA 1F9HA 1GTEA 1FX2A 2BE7D 2DR6A 2ASDA 3AQOA 4ES3A 2YNHA 2B3TB 2LA4A 4OIXA 4OYMA 3D1QA 1GEHA 4KGZB 1Q5VA 2XS5A 2FLLA 4Y2MA 1X4FA 4TU9A 4RNMA 2AYMA 3TEGA 4X65F 4EGLA 4K50A 4CH7A 5LMUF 1YGYA 2O3DA 3CUNA 1TV6B 3PY8A 2MMYA 3T1AA 2HRUA 4GKKF 1Q1KA 4ZCKA 3R1HA 4KFBA 5C2GA 3MAHA 3QJJA 1CC7A 5G4DA 3BEGB 3HHKA 3QRQA 4OZLA 5D4NA 2JH3A 1B0PA 3SSRA 2DY9A 2F8HA 4EZ6A 2HFSA 2WRMA 3MM5A 4XK8C 4A8KA 4OZ2A 2KN4A 2VFSA 2HURA 2LXUA 1PAUB 2D69A 4RO0A 5EUHA 1X9MA 4NZ6A 2WTFA 1UPPA 4R0EA 2FJBB 4DQRA 4OV1A 1X5SA 3OFEA 3OUYB 2J9CA 3DN9A 2V94A 3GFZA 5DQHA 1TUVA 5F8GA 2HQCA 4DPOA 1PSDA 1ZAWA 4X65J 1BY9A 1WI8A 1N5YB 2W2NP 5KG5A 4PR6A 2V4RA 5LMUJ 3VAGA 1V6HA 1J5OA 1H74A 3AJ2A 3ICLA 2EXUA 2UUWA 1RT3B 5AJ3F 3QIDA 3K5OA 4GKKJ 1UL3A 5KFWA 3MEKA 1LWCB 4B02A 4P74A 4EBDA 2MLXA 4DPWA 1DLOA 2HHWA 3JYTA 2ZHOA 3KLHB 1PBAA 2E9ZA 2CQ4A 5KFHA 3VGTA 4HHUA 1KC8T 3E8OA 3RB4A 4N47A 4CTAA 2HHXA 4PZVA 3QBCA 2HS0A 1ZA2B 3DI6B 3DM2B 4UF4A 2WONB 5AXKA 4LR9A 2HHSA 1BD6A 2PD1A 3E51A 2UVRA 1SL0A 2DKOB 2RDDA 3TX8A 3V6JA 2IC3B 2BJDA 5CCMA 3DMJA 5KFDA 2ZBRA 3MR5A 2CDRB 1RKIA 2PI5A 2OMOA 3NWRA 2K3KA 2F4VF 5AJ3J 2ZFHA 2UU9F 4NLOA 1P9QC 3MAAB 1SJFA 3CCES 3FSYA 1YJ7A 3AB2B 3NAIA 4NLPA 4ZHRB 1XNQF 1S1XB 2XGPA 1V3SA 3T5JA 2IMWP 1RAHB 1QM9A 2W9CB 2DRDA 2R3VA 4A8YA 3HHDA 4ZJQA 2GMHA 4KHMA 4NXMF 1YHQS 2CJYB 3PACA 4MFBB 4FNHA 5CD4H 4PRFA 1PYTA 1UWBB 3H25A 3DRSA 1FKAF 2FYXA 5DZ6A 3LGNA 2C2MB 5IS2A 2DGQA 3PJXA 1ZOTA 1SB6A 5B0CA 3KLGA 1O5JA 1NH7A 1QUVA 3AOBA 4PWUA 5E2QA 2J0QD 4J37A 4YDDB 1S79A 2F4VJ 1R8CA 2UU9J 3MPVA 2N3LA 2HAIA 3SSSA 2NYIA 1M5HA 1BWEA 2RDJA 2BACA 1C4AA 1G4CA 2XHWA 5A8WB 4WKYA 2GHWA 1QD1A 3BDPA 4EBEA 1SL1A 1XNQJ 4A48A 2HHPA 1VQYA 1Y5LB 3HD2A 4URSA 5L38A 4LFBF 3LP0B 3MURP 4LIWA 4PQAA 2FY1A 2BJ1A 1YKWA 3ZTOA 1APSA 4ZP9A 2A0FB 4NL5A 3DU6A 2GGPA 4OZ3A 1QE1B 2RU9A 4NXMJ 3OHAA 4ECYA 4RWXA 2DR5A 3SZ2A 2HVDA 5HVFA 4IR9A 1CC8A 2P5VA 4DSFA 4USTA 1D3WA 3MMBA 4TYAA 2RRAA 4CNYA 2C3OA 1TTHB 5KFNA 4RW4B 2PMHA 1PYSB 5J2PB 2AGPA 3T9ZA 2XULA 4ZVEA 3CPWR 1M1KT 4NXNF 1RAFB 5KOXA 5A0YB 1RTDB 3TUPA 1HPZA 3RW7A 2KM8B 4EO8A 3ELHA 1XEZA 4ZIWA 5BJRA 3FJ2A 3NNHA 3QIPA 2Z57B 3HVAA 2D9OA 4LFBJ 1S0OA 2DGUA 4NEYA 2ZOMA 5FIIA 3HHLD 2ILZA 3FEXB 5DDPC 4G1IA 3J81U 3SCLE 3HSGA 2XLJA 3TAPA 4ZP6A 4IG0B 4A47A 2ATLA 4ZVRB 2HNZB 3O8WA 4CLFA 3RBDA 1UEVA 3DRRB 5EGYA 5HP1B 2E29A 4DPTA 2CA9A 2ZD1A 1SBRA 3CTRA 1X4CA 1W2IA 2IBOA 3DC2A 1CULA 3R6GB 4NXNJ 4N76A 5KFGA 5D77A 1YK9A 3LUYA 4ILMA 2OEKA 3T19A 2QG9B 3JAMU 3POTA 4MKBA 3F56A 1P1TA 5KFFA 1RWPB 1VQMS 4OYAA 2MKSA 4IO9Q 1WEZA 2UP1A 4IUFA 4EK2A 4CT9A 3HK2A 2QLBB 4UZBA 1TU0B 3PNIA 4NEZA 1H38A 3HT3A 4UY85 5DO2A 2DNZA 3A8JA 1D09B 1LK5A 3MEDA 2IJRA 4KGKA 2HWTA 1UJ5A 1HW8A 3BGFA 1EETB 1U0HA 3AOCA 1NKBA 1CJTB 4WIQA 1T94A 4OX9F 2EG1A 4I4BA 4UT4A 1E6VA 1TL3A 3DLJA 3UQSA 2DO0A 1NEEA 3OJUA 3P3DA 5EDWA 2F9JA 3LA0A 4WFZA 3F41A 3KG1A 3AJDA 1IKYA 4EWTA 1U1RA 2VG5B 4X64F 5KT7A 4KPYA 1HBOA 1EKRA 5D78A 1IJFB 4HLBA 2XS7A 1VRTA 2DK2A 2LP4A 1PBUA 4U96A 1DQ8A 1WDTA 1U26A 2V8DA 4JB8B 2LQ8A 4TYBA 4HDGA 3MUMP 1K1QA 2VL1A 5A6PA 2AJQA 1NHKL 4PWWA 4FKXA 2QA2A 4DBQA 3W8GA 4HHHA 1RWVB 3BH7B 2RDIA 2E44A 2DNQA 4YB5A 3I0SB 5GADI 4DEZA 3TJ9A 4A8QA 3CCRS 2NREA 3P6YC 3I55S 2VIHA 4R0JA 4WK1A 1NLKL 1MU2B 1F5BA 3PZPA 2VPWB 3K5NA 4PUOA 3ISNC 4IDKB 4OX9J 5KG7A 1S6OA 3FBBA 2KYXA 1G7CB 3QO9A 1FRMA 4Y65A 1TFYA 5IQ6A 1XMBA 2ZH5A 4RNFA 2OTLS 3AHPA 4QWEA 3FFIA 4ZITA 1CLFA 4OI2A 4NMLA 5KAKA 4X64J 4LSLA 3DLBA 1X31C 3FCHA 5KFUA 3EICA 5B7WA 2EFOA 2ADCA 3ILLA 1FA0A 3M8YA 2XC9A 1HHSA 3C8YA 4YN3B 1TUGB 2P9GA 3GU0A 3Q8SB 2E1CA 3LP1A 1S1VA 2JC0A 4I2PB 1IKXA 4WP9A 4TU8A 3MOJB 3CE8A 1GH8A 3CJ3A 1CVJA 3W2VA 4OX8A 3MM7A 2PA3A 3FRZA 2H1YA 1F3VA 3EGZA 2XNQA 1TK8A 5ETMA 1KTQA 4WPAA 2V67A 3QT7A 3OL6A 1V3ZA 5FDLA 3C6TB 2VKZG 3CNQP 4R5PB 3GJQB 5ETTA 4DV0F 5KFXA 3QT5A 2YWHA 4KQZA 3P5TL 2VHGA 2F9DA 3M4XA 5GAGU 1TAQA 4PYDA 4M5NA 1HBNB 5HROA 2ASYA 3N9UC 2M4MA 2X1AA 3KKFA 2AD9A 4B3RF 3MEGA 4MK8A 2YNIB 5CXTA 3KK1A 3TUIC 5F8IA 2XM3A 3V81A 2IJFA 2ZKUA 2D74B 1L5UA 2LDIA 4QYZK 2HQDA 3UNGC 2XMMA 1MMLA 4F7VA 5IWAF 3CMES 1WI6A 2RMLA 2DGTA 1NUEA 5K14B 1NJYA 3B54A 3D1OA 4DPXA 5G0RA 3BSNA 3OXGA 3GCWP 3H2VE 4G3IA 3OQ2A 1ZAVA 3MPYA 2HPUA 4DV0J 5KT3A 3IAS9 3I32A 2SXLA 1U8WA 2IYGA 1R7IA 2KTQA 3VZIA 2EBEA 3QLHA 1Y5NB 2LEBA 3JQKA 4MKAA 2CJKA 1TMJA 3KYLA 2XWXA 2OGUA 3DDNA 4WFXA 3HT0A 2A1BA 3NGTA 5KG2A 4KFBB 3C19A 4B3RJ 2D41A 3D68A 2IRUA 3C6UA 1PJ7A 4RUCA 4NCAA 5CYMA 2KT5A 2FHMA 2DR9A 3BQ2A 3BPDA 1Q53A 1SXLA 4YB1P 4ENOA 2QIFA 2RE1A 3G86A 1F5CA 3PFOA 1MWQA 4O3RA 1VIXA 2EBGA 3DNCA 4MTPA 1N48A 1X5OA 4JV0A 5L1IA 1ACMB 5IWAJ 3G6XA 1NU4A 4UUWA 1RHQB 4IH6A 1ZH5A 1WHWA 4D3GA 4C3LA 4YDXA 1J5EF 2GX8A 2DGVA 5AXMA 1KVIA 2GAGC 2CPFA 3IGVA 2MKYA 1NBEB 2WB1D 2JVRA 2VJUA 4N7TA 4DMZA 2MXYA 4CZCA 1JK9B 4G65A 1EQ0A 1J5OB 1FDBA 4DCJB 3AFGA 3PO4A 4ELVA 5E3CA 5J1EA 5KT2A 3S6EA 1S9EA 4PYAA 4YB7A 1QSYA 5F8JA 4MK7A 3CB4A 4ECXA 5IV3A 2QEXS 1DLOB 3PW0A 2EW9A 4KBIA 2MQQA 2UV8A 4K59A 5H9EK 3IBWA 2E9TA 2V2KA 3NS6A 3IAM9 3VAKA 4PXBA 2Y8YA 2C2DA 3KHGA 3CJ0A 5CQGA 2ZM6F 1GMWA 2EWHA 2DR8A 3BKTA 1FXDA 1LWFA 2I1RA 2HQFA 1J5EJ 1NB7A 5CH7B 2IRXA 2MY7A 1NK0A 4V1Ak 5KFAA 3B6BA 3RAXA 4MK9A 3GIRA 3K2YA 4X62F 4OI1A 2QX0A 4Y2CA 3DMJB 4BS2A 4QZVB 5GADU 4PG7A 2V9WA 4DR7F 2Q79A 3UN3A 4W90B 3I4PA 2FVPA 3UI3A 1VBXA 4A8MP 1BQNA 5J2MB 1Q7LB 4A8SA 2ZWOA 4OYPA 3W5YA 2YX7A 4QR0A 2QMUB 3RYLA 2NXCA 1Q95G 4CLPA 3TVYA 3FZBA 1C0UB 2RKIA 1VQ9S 1VFJA 4ED6A 1U1LA 2YNFA 1QVGR 1R27B 4UOFA 1O0PA 3GCXP 1IBCB 1NK6A 1AUSL 1MN9A 4I6WA 3BYPA 1RU1A 2DD8S 5KFMA 3PIOQ 4X4UA 2G1HA 2YNGA 1M1HA 2P9EA 2WSEC 2ZM6J 1HQEB 5ETRA 4ECTA 2ZHAA 5U47A 3CJ8A 4S0MA 5D15A 1TVRA 1OYEA 2CYYA 2HFNA 2KO1A 2Y1IA 1L3SA 2W2OP 3DRSB 2OP5A 3A8KA 2R8HA 2MZ1A 4DX6A 1S6PA 2YWGA 5E3RA 3ENQA 2BJ8A 2GAHC 3LPEA 1Y3KA 1OY6A 2QGFB 4X62J 4NZ7A 4C8ZA 2GJ2A 4E98A 4DR7J 2YQ0A 4HI1A 3Q2SC 4ZN1A 2NQPA 3BKUA 3TJ8A 3THTA 3OTDA 2R7UA 4OV6A 1QAIA 2V68A 2ZBIA 4ECQA 3KMSA 3K17A 4ER8A 4X2BA 2VFUA 4U7UK 4OYBA 2JOQA 1SV5A 4IQXA 4Q5VA 4OYZA 1HI1A 3C2PA 5GMEA 3RAMA 3D6HB 4U8YA 4KH1B 4FYVB 2L48A 4DSIA 1UVKA
chains in the Genus database with same CATH topology
2PA8D 3JTNA 2AJ4A 2XY5A 2X1FA 1JLEA 1U24A 4TU7A 4C3MA 4NLUA 3PW7A 1U6FA 1RT7A 1R8PA 2IVFB 4JUZA 3DRPB 1VQ7S 4Y6IA 2PMZD 1P8GA 1NHUA 1VMBA 2B6AA 2RILA 2HRYA 2XWYA 4GC6A 1N32F 2UXDF 2AV5A 1FRLA 4ZPAA 2DNKA 2JDJA 1FVSA 3AH6A 2C22A 4DR2F 3CD7A 2GHVC 4DQQA 2QSWA 4KRWA 1SJ4P 2FJVA 1UVMA 3JSRA 3OSNA 3T5LA 5IXUA 1T95A 2BZ2A 1RT5A 5D4PA 1AW0A 4H4KC 1X5PA 2MZTA 4IRCA 2BV3A 2GO8A 3TYTA 5IM0A 3N01A 3UCZP 5KG4A 2I2YA 3DOMA 2WBRA 1UVNA 2LXIA 4KT0C 3TNVA 4AUKA 4URQU 2ZH4A 4RBTA 2JRSA 3RRKA 2NR0A 1SH0A 2OD4A 3MMBB 2XZWA 2DNRA 2BVZA 2G9OA 4BDPA 5J2MA 5KFZA 2R8KA 2FVSA 1HNIA 4J5OA 1RDRA 2IA0A 2UUTA 4A46A 3ZZOA 3RR8A 3DLEB 3H40A 4RW9B 3FNNA 3OLBA 4OHWA 4ILRA 3MMAA 3IWNC 4WIIA 4RZRA 1RT6B 3C66A 5CHCB 4JI6F 3M9OB 2FJWA 4DWIA 4D3HA 2HMIA 3CIZA 2OFGX 4X4OA 2FGOA 4OX7A 2MSTA 3B78A 1C0UA 4OHYA 6FDRA 5DM7Q 4Y0FA 1WD6A 3D0HE 3S1TA 2DH8A 4ZPVR 1M90T 3OVAA 2JFKA 3RBEA 1PGZA 3I9ZA 4IR1A 1QTMA 2J9DE 4C8YA 1RTJA 4C0BA 2J76E 1VHFA 1HMVA 2L9DA 2VG5A 3IS9B 3ISZA 3D0IE 1HPZB 4Y2IA 4DF8A 4YQWA 2HNDA 2I5JB 4B9SA 4FN5A 2ZC4A 1LK7A 1WTBA 2CQPA 3CXCR 1KRPA 5LXRA 3X3UA 1JMTA 4IO1A 1S72S 3SQGB 1TKZA 3GSDA 3Q23A 1AUDA 5I3UA 2DHXA 4DR5F 2OD6A 4FNIA 2YKNA 3QIPB 1HQEA 3WC2A 4MMOA 1D9AA 2MKCA 2DRAA 1LW0B 2R2UA 2J7UA 1S99A 3KMQA 3Q22A 3BQ1A 2VPXB 3J7Z5 3PHEA 1JLCA 4WFAQ 3QGHA 4DQPA 4ZLPA 3H5UA 1EP4A 1FF2A 2IM2A 5L1JA 2J6TA 5HBMA 3MEEB 3F73A 1N54B 1TL5A 2FVRA 3IG1B 3NGKA 2GQQA 5F41A 1HWUA 5KG6A 1OPZA 5L1KA 4ERDA 5J2QB 3DCAA 3MTKA 2CQ0A 4KSEB 4LF8F 2BE2A 4LT6A 2WOMA 1JLGA 1VQOS 2B56A 1VQPS 2NZ4A 3O3LA 3MR2A 5JXSA 2PGCA 2MQOA 2XGQA 2GFFA 3CDWA 2CRLA 2DRBA 1RYRA 3I56S 2CQDA 2VH7A 2ROGA 2JLFA 2BRLA 1QAYA 2X3GA 3CDAA 2JEIA 5C24B 1HQUA 3QWUA 1TKXA 4G1PA 2E1RA 2B5JB 5KT6A 2HS3A 3R5AA 2B7CB 5K8OA 2QE5A 5M2UA 3U7JA 4NWBA 1G3OA 3UCUP 1K9MT 1FRKA 1OIAA 4O44B 3H4DA 1DURA 3H2LA 4C9DA 5D4LA 4LQ3A 1MU2A 4R25A 4TXSA 2VKRA 3V6DA 1XMQF 1UVLA 5KFCA 5KTQA 1DHMA 2F1FA 3NRBA 4JI1F 2XLKA 2DVIA 1P27B 4NPOA 4OJ3A 1IQTA 3T5KA 2BABA 5F3ZA 1YJNS 1QAXA 1IKVA 1REVA 3RRHA 2Y0SD 1GXLA 2RQ4A 1HI8A 4DV1F 2PFFB 1JXLA 5D3GB 2M8HA 3DLHA 4DLGA 1Q16B 2QRRA 2YNHB 5EHHA 2XB2D 4AL7A 3GMGA 3DLGB 1X4BA 2IMOA 2VBZA 5B0AA 2VD3A 1JLFB 3G8QA 2AWZA 1U2RA 4I6AA 3TO8A 3H4BA 2V8HA 1NO8A 2RB7A 3KG0A 2EPIA 4DL0C 3GYXB 2ROEA 1XR6A 2LXFA 2VOPA 2DITA 4RNOA 2UUCF 1X4EA 2DH9A 2D7SA 3CD5A 4MKYA 1TZ0A 3CDBA 1U8SA 2XMKA 1I1GA 1C0TA 2GHPA 3CIMA 4PKDB 1S1WA 2JX2A 2LQJA 4IRDA 1D9DA 3JTOA 4FF2A 2JEFA 4HVZA 1NKCA 2BANB 3K59A 3I96A 4RKUC 5I3QA 2Q1LA 4IRKA 1UA0A 1VI7A 4RWWA 3UWTA 2KXFA 1FK9A 2J9DA 3POTB 2R4FA 2AGOA 2M5YA 3ITHA 3US5A 2B4UA 2KRBA 4DV4F 2DCUB 3NKYA 4IYQA 2CQIA 1JLBA 3N28A 4I0WA 4ED7A 1WF1A 2IM3A 2OKQA 1JKHA 2RF2B 5F8MA 3O44A 4B3OB 4QYRA 2XI2A 4ELUA 4JYAF 1ZM4A 3AJ1A 3DRPA 5E3AA 2LQ5A 1TAUA 2OSQA 3MECA 3GV5B 4A8OA 1QSSA 4DV2F 1R0AB 5CZXA 2VZ9A 3SDEB 4I2PA 3W7BA 1MWYA 2B9WA 4J9NA 2AF6A 1ZM2A 3QMQA 1WHVA 1FVQA 1UVIA 1IKWA 2I9SA 3ZFVA 4JI3F 4KKOB 3D1HA 3R5DA 4AXJA 4FF3A 3MEDB 5M2PA 5H9FJ 2PSZA 5T7LA 1TK0A 3LH2S 4XDDA 3BS9A 2VQEF 2CQCA 4OZ0A 5HMWA 4IKAA 2XNRA 3NCRA 2FB0A 1QY7A 2J7WA 2ZDPA 3WX4A 3MM5B 4XPEA 2VB6A 2FPHX 3H5YA 2CPJA 4OFZA 1LV5A 5I4MA 4B9VA 1CEZA 1TL1B 3OL7A 5I42B 2Z8QA 3VWSA 3V4IB 1UAWA 4ES2A 1E6VB 1TL3B 1D0EA 4TQSA 3TVKA 1GQEA 2FHOB 4W92B 5BYQA 4RW9A 1WHYA 1YG0A 4PQUB 2RRNA 3C6TA 2KH9A 2G13A 3KK3B 3KLVA 2K3IA 2M88A 2HFZA 4JI0F 4R5PA 2XBPA 2Z0GA 4PG5A 2IRYA 3U27A 2EK6A 1KHVA 2KFNA 4Z37A 2KFYA 5E33A 4O3NA 4BHQA 3P49B 2QMWA 2EKYA 1T02A 2RS2A 2VA2A 2EC0A 2RQKA 4ID5B 3L3CA 1P6TA 5F3TA 1R6YA 1N6QB 3QYYA 3S01A 4NCGB 5T41A 4L72B 1N0UA 2FC9A 1IKYB 1FDAA 1PC5A 2AJFE 5B0EA 4J9PA 1J2VA 4BCAA 4YHHF 3IS9A 3RR7A 3MMCA 4UY8T 2COLA 1C1BA 2MQLA 3DYAB 5A8RB 3ULHA 2XMTA 3KNAA 3FGVA 5DLGA 1VGYA 4ICLB 1VRUB 2A3JA 1IBMF 2DNGA 4AE5A 3PKYA 1HBNA 1MMDA 2RQMA 2UVVA 2DB1A 4C8OA 1RAJA 3DRYA 3FMWA 3T5HA 2R7RA 4RW7A 2JZ5A 4U67Q 2DHAA 3OR2A 2OPSB 1F5AA 1Q8IA 3BSAA 3TRGA 1KTVA 4ED3A 3M8QB 2DT9A 2XY6A 2YNIA 2HHHF 2FUG9 2CJQA 1M5VC 5CYJA 3HO1A 1LW2A 2PIIA 3MHYA 1Q79A 2ZHBA 4OMFG 1S6QB 1R43A 4KB7A 3ZZUA 3GILA 1YWXA 2UUBF 5B09A 1F0XA 3V4MA 3PX0A 3EYZA 5DG7A 1YJ9S 4NRUA 1T3NA 2G1DA 4MJKA 4ES1A 3KLFA 3EPGA 1L3UA 2CVEA 4C3KA 3G96A 1W25A 2Q6CA 3J80Y 2M3DA 3HPOA 1S9GA 1U1NA 1S0NA 4WXWA 2DNMA 4QIGA 5DLFA 3IFEA 2VBXA 3JSBA 4UOCA 2CPIA 1UJ4A 5C24A 5DS7A 4B9MA 3JYTB 1IM4A 2Q6BA 2F40A 3KG4A 2B51A 2B5JA 1FESA 3KWMA 3R27A 4ZS6A 3CCQS 5AE3A 4A8WA 2ASLA 3NAHA 4F4YA 3UW1A 2KHDA 4FVMA 3ZZRA 3SYZA 3MWBA 4IG3B 1C1CB 2C3UA 2YKOA 4ZVGA 1Q7YT 2E5GA 2KG0A 1FXLA 2DIVA 2KI2A 2RRBA 5AXLA 2ABYA 2MGZB 3IC1A 1H2UX 1Z1ZA 1FHTA 2K2PA 2YH0A 2DNLA 3QO9B 1N5QA 4TNOA 4TQRA 1GTEA 1Y5IB 4NLYA 1QLNA 4LSNA 2DNPA 4NYOA 2ASDA 1ZM3A 4CTAB