2U2FA

Solution structure of the second rna-binding domain of hu2af65
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
85
structure length
85
Chain Sequence
b'AHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SPLICING FACTOR U2AF 65 KD SUBUNIT)
publication title Solution structures of the first and second RNA-binding domains of human U2 small nuclear ribonucleoprotein particle auxiliary factor (U2AF(65)).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 9
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 1999-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2u2fA00
2DNMA 2AYMA 4CH0S 1RKJA 4YOEA 2QA4S 5BJRA 3CCQS 3S6EA 5GVQA 3J7ZT 2DGXA 3CC4S 3IRWP 2DGSA 2M0GB 1VQPS 4F26A 1U1OA 3VAMA 2QFJA 1WELA 2CQ4A 4TU7A 2LKZA 4QQBA 2HGNA 2KRBA 2MSTA 2N3LA 3SXLA 3CCMS 2CQPA 1X5TA 2DNKA 2KH9A 3CMES 1NJIT 2JVRA 2OIHA 3DXBA 3MD1A 1QVGR 2DHGA 5EN1A 2SXLA 4C7QA 1D8ZA 3NNCA 4A8XA 1U1MA 2YWKA 5LSLA 1WF0A 2MHNA 1U2FA 1OIAA 1OWXA 4PKDB 3OW2R 4ED5A 4TU8A 1FXLA 1WF1A 1F9FA 2FC9A 2DGUA 2DNPA 2X1FA 3UCUP 2FPHX 5DDOC 2XNRA 3CUNA 4BS2A 2U2FA 3G4SS 2KHCA 1VQNS 2LA6A 3U1MA 1WF2A 4FXVA 2HVZA 3G9CA 2N82B 1A7GE 1FJCA 3CCES 3LQVA 4Z2XA 1K9MT 1PGZA 2RT3A 3H2UB 4QPTA 1WEXA 5GAHU 2RRAA 4WIIA 1YJNS 1DRZA 3MDFA 2NZ4A 4J5OA 4LIRA 3P49B 3FEYB 3G71S 2AYEA 3NNAA 4ERDA 1SJFA 2LEAA 1X4GA 1KOOA 2RNEA 2XS5A 2DGTA 1SJRA 2M7SA 3MI7X 2HGLA 3G8TA 3P3DA 2KU7A 4LJMA 1YITS 5LSOA 1VQKS 2MZJA 2DNHA 1K73T 1X5PA 2MGZB 3VAJA 2J76E 4OZ0A 2XB2D 2CPYA 2U1AA 2KM8C 1P27B 2CQGA 4UY8T 5GADU 1X5SA 2DNRA 1M5KC 4YUDA 2D9OA 2DISA 2LQ5A 1VQMS 4Y0FA 1U6BA 3N9UC 2MZTA 3R1LA 3MURP 3PIOQ 4IO9Q 5IFMA 2B0GA 3MD3A 1M5OC 2VOOA 1HD1A 1ZZFA 2OTJS 1H2VZ 1YIJS 2HYIB 2DHSA 2KI2A 1K8AT 3VAIA 1YWXA 3V4MA 2DH9A 2MZ1A 1JJ4A 4PRFA 1U1LA 3SDEB 2JX2A 4CQ1A 4RU2A 3D2WA 1P1TA 3BEGB 2ZJPQ 2OSQA 2CQIA 2MB0B 2MZSA 2DB1A 1YI2S 1H6KX 3JB9k 1VQLS 2E5IA 1R8PA 5D78A 3EGZA 2GO9A 2MJNA 2JWNA 5LJ5Y 2UP1A 3NNHA 3ZZYA 2E5HA 1DHMA 2J0SD 3UCGA 2I2YA 4CIOA 4IUFA 2DNLA 2LEBA 1JJ2R 2OTLS 2MY8A 1VBZA 2XS2A 4EGLA 3G8SA 2L9WA 2QEXS 2MY7A 2G1DA 3UD3P 1U6FA 2RS2A 3TO8A 2CJKA 2DO4A 3BO2A 1H2TZ 2AYGA 2MKHA 1VC5A 5CXTA 4PR6A 2EK1A 3CULA 2CPDA 5DM7Q 3CD6S 1DBDA 2X1BA 3VF0B 4C0OC 2AD9A 2WBRA 3G96A 1VC6A 1X4CA 1KC8T 2CPHA 5ITHA 3EX7B 1OPIA 1N88A 1W2BR 2KVIA 2DNGA 1XN9A 3CCUS 1OO0B 4WF9Q 2PE8A 1WEYA 3CXCR 1WHYA 4WKRA 5CA5A 2CPJA 1PO6A 1HA1A 1CVJA 2DHXA 1WI8A 3CCLS 3UE2A 1WG4A 3ZZZA 1KOHA 1Q82T 2CPXA 2LCWA 1H2UX 4WFBQ 3THPA 2MGZA 2DGQA 3TYTA 1S79A 3CC7S 3P5TL 2J0QD 1FJ7A 4LMZA 5LJ3Y 1SJQA 2YKAA 2DGWA 4M5DB 2A3JA 3CCVS 5D77A 1YTYA 1O0PA 4QU7A 1U1NA 3VAKA 1FNXH 2EVZA 2KM8B 1B7FA 2OJ3A 2M70A 5LXYA 2YH1A 4TU9A 2MKIA 3US5A 3RW6A 3S8SA 1AUDA 2XS7A 2YH0A 2MYFA 2ZJQQ 1YJ9S 2DHAA 1VQ4S 4IOAQ 1Q81T 3MUVP 3BS9A 3HI9A 3SDEA 2CQ3A 2XSFA 2E5GA 1UW4A 1U1QA 4QU6A 3PIPQ 4WFNQ 1UFWA 4F02A 3B4MA 1N52B 2MQOA 2CPZA 5DDQC 1FO1A 1NO8A 2MKSA 2ADCA 2CQCA 3U1LA 2KG0A 3NS6A 2DH7A 2LXIA 1X4AA 2RRBA 2L41A 2MJUA 5GAEU 2F3JA 2MZQA 1UP1A 2RUGA 2KRRA 2CPFA 5DM6Q 3CCJS 2X1GA 1VQOS 2I38A 4P6QA 5HL7Q 5GAGU 2VOPA 2FY1A 2MQNA 1WG5A 2VONA 1X4EA 1VQ6S 1NU4A 1N8RT 2MXYA 3VAGA 2MKKA 2LYVA 2YTCA 4ZKAA 3THTA 5DDRC 2M4MA 1U1RA 1HL6A 2M8HA 2D9PA 1ZZNA 1WHVA 5IM0B 3NMRA 1L3KA 1JJHA 3B4DA 3P6YC 3S01A 1UAWA 3R1HA 1JMTA 2CQBA 2M2BA 3CTRA 2ZJRQ 2FC8A 2EK6A 2M9KA 2Q79A 2RVJA 2DNQA 2KXHA 1X0FA 4Y00A 4U67Q 2VODA 2DNNA 3UWTA 2NLWA 1WI6A 2V94A 1HD0A 2MKJA 3S7RA 3I56S 1S72S 2G4BA 4V19X 2CQDA 2OSRA 2BOPA 2K8GA 1FHTA 3CPWR 1VC0A 2DNYA 3VALA 4W92B 3G6ES 2DNOA 5H1SV 3UCZP 3VAFA 2KXFA 1SJ4P 3CCSS 4WFAQ 2BZ2A 4TLQA 4WCEQ 3MUTP 3MXHP 2ADBA 2RU3A 4C4WA 2DNZA 3LPYA 5CYJA 3NS5A 3TP2A 3BO3A 1U1PA 2MSSA 2D3OR 2MMYA 1M5PC 2DITA 1X4HA 2MQLA 2K3KA 1X4FA 2LXUA 2X1AA 1QVFR 2CQ2A 2DH8A 1SJ3P 3CF5Q 1U1KA 1URNA 2ERRA 5DDPC 1VQ8S 2MQMA 2MPUA 1M90T 2RQ4A 2MZRA 2HZCA 3UD4P 3CMAS 2N7CA 3DLLQ 1X5OA 2N3OA 2KG1A 2JRSA 2XNQA 2CQHA 2MKCA 4F25A 3EGNA 2DGVA 4YB1P 2KT5A 3ULHA 2M8DB 1VQ9S 3H2VE 5IQQA 1VBYA 4W90B 3R27A 3RW7A 2M52A 1KQSR 3Q2SC 5JVGQ 1YJWS 2CQ1A 3IWNC 2F9JA 3CCRS 5LXRA 2LECA 2KFYA 5HO4A 2MQPA 2J8AA 1A9NB 1WHXA 1KD1T 5FJ4A 2G0CA 2DIVA 1YHQS 4UQTA 2JVOA 5JVHQ 2DO0A 3MOJB 1BY9A 2L08A 3HHNB 1RK8A 3J7YU 5DETA 1X4DA 1G2EA 1VBXA 2RQCA 4FXWA 3CC2S 1Q7YT 2RS8A 3BO4A 1R8HA 1VQ7S 1DZ5A 2CPIA 1SXLA 1X4BA 2PEHA 2CQ0A 2E44A 2GHPA 2KN4A 1QM9A 2DGOA 2MQQA 3VAHA 3L3CA 1WTBA 1ZH5A 3Q2TC 2F9DA 2FHOB 5IM0A 1D9AA 3I55S 1IQTA 2E5JA 1WG1A 1WHWA 2HGMA 2O3DA 3MUMP 2LMIA 2CPEA 1M1KT 2DK2A 5GMKa 2AYBA 1FJEB 4IOCQ 4OZ1A 2DIUA 4CH1A 1Q86T 1FT8A 3K0JA 1N54B 5MLCV 1WEZA 2LA4A 3FEXB 1M5VC 3SMZA 2KYXA 1VQ5S 1WWHA 2M88A 2KXNB
chains in the Genus database with same CATH superfamily
4NLXA 5KFOA 2E1MC 3TEGA 3S6EA 4UOHA 4ID8A 1VQPS 3DM2A 4B08A 3PW4A 1MG7A 1GXUA 4DX6A 3DXBA 4I1TA 3ZTPA 1K1QA 2R7QA 4DL7A 2BM0A 1S77D 4OHVA 2Q66A 3QGIA 2CJYB 3D0HE 1WC5A 4K5RA 2FGOA 2QG9B 2GIRA 3BBFA 2JDJA 4JV0A 5I3UB 1S0NA 2IMWP 2FZGB 4I7FA 4C8MA 4OZLA 1O51A 4Z2XA 2RRAA 3MDFA 4J5OA 1TUWA 3NNAA 4B3SJ 3H7HB 1U8WA 2IRXA 2R2SA 4CLZA 1IUJA 3VAJA 5JXSA 2J76E 2XB2D 1EQ0A 1S5ZA 1UCNA 3A13A 4ZP6A 1T7PA 2CVEA 4GC6A 4EWTA 4Q0BA 2W4CA 2J0XA 4OYWA 4WZMA 1VRQC 3MD3A 4K4TA 1TTHB 1I6JA 4NCAA 2IIHA 3R5AA 1NJXA 3D2WA 4DMZA 1RWKB 1OSCA 4EYHB 2W1BA 3DLJA 3NNHA 3GSIA 2DTJA 4ECSA 4DQPA 4DCPB 4Y34A 4JYAF 2A6OA 1BUXA 4USUA 3V4IB 3A1YG 3GONA 1YRTA 2VL1A 2RS2A 2PT0A 3KXDA 4H4KA 5CYQB 1IWAA 2AD9A 2LVWA 4KV8B 3K5LA 2CWKA 5EGYA 4KAIA 2UV8A 3Q8YA 4IOBA 1MN7A 3HT0A 2P9CA 3GQCA 3C6TB 2EBEA 5CCLA 1IKWA 5JMNA 1RTDA 2XMTA 4P2MA 3GIKA 4DX7A 3QWUA 1RU2A 4DR1F 1S79A 1C1CB 4LSNA 1GNKA 3MAHA 4TKTA 1RT2B 3IBFB 1FNXH 5K8PA 1TU0B 4K0KJ 2YH1A 3RAQA 2YNGB 2KZZA 2MKIA 4ED3A 1PYTA 4RWWA 3FBBA 4FVMA 3CIMA 5KT7A 2IVYA 4C11B 1UVNA 2VF3A 4F3QA 3OTBA 1UW4A 1SQFA 4QYRA 1UFWA 2JEGA 2JFKA 1KRPA 4OI1A 3PZPA 3GG1A 4DQQA 2XSJB 2MKSA 2CQCA 4Y3CA 3QT8A 4B3RJ 4O3PA 2KJVA 4NLVA 2ZOMA 1ZM2A 4QOTA 2LP4A 4ZIWA 1XMOF 2YKMA 2VKZG 1XC9A 1IKXB 5DDRC 1PJ6A 2M8HA 3NMRA 5T14A 3NG8A 1Y5IB 4QBUA 3VVUA 4G1IA 5KFYA 4W92B 2IVMA 2VJVA 2HNZB 3MCSA 1DTQB 1SJ4P 3WX4A 2W01A 4WCEQ 4DR6J 2K7KA 3CB4A 4I2PA 3PNIA 5KG7A 2MSSA 3DOMB 2HLUA 3MPWA 1X4HA 1EHWA 4YR0A 3D1QA 2ZHBA 4IQXA 4H4OA 1F60B 1TL7B 2QFIA 1NK5A 5H9EJ 1M90T 4Q45A 2N7CA 1PYOB 4TXSA 4LF6J 1HWIA 1V3SA 3DRPB 2Q3PA 4IYQA 1YJWS 2CQ1A 1F5AA 4LSZB 2QTWA 4ECQA 1UTAA 2XO6A 2AEMA 4ZPCA 5CYMB 2WOMA 6FDRA 4C8NA 1Y0HA 1YRUA 2WW4A 2E44A 5ETTA 2JLEA 1B0TA 4LVNP 4M5HA 2DGOA 2XYPB 5F8HA 2GJIA 5G0RB 2OEJA 3GE9A 5IM0A 2J9CA 2FVCA 1WG1A 2EG1A 2GGPB 1RHQB 4IOCQ 1AXQA 5HSPA 3VGTA 4MYUA 3V81A 2FZCB 3MEGB 1JXLA 4HDGA 2AYMA 2V8PA 2GVDA 4NEZA 1GTEA 3CSKA 3PTWA 3TJ8A 1RYRA 2UUTA 4NLOA 3C2PA 1KLMA 4P2FA 1MU2A 2BACA 1TVRB 4M94A 3CD0A 1QY7A 4G1QA 2GMLA 1CJUA 3W60A 4DSKA 5KFAA 2WCXA 4BWJA 1Y10A 2DRDA 1F9FA 2FC9A 4ZPVR 1CSJA 4ICLB 4FYVB 1VHFA 3BSOA 2MQ8A 2XNRA 5L46A 2WAQD 2G2ZA 2WONA 4QPTA 2E7WA 1YJNS 1RT1A 4I69A 1CC7A 7FD1A 3MM7B 4DSIA 2KL8A 2R8IA 3OLBA 2X3GA 4PXCA 4AQYJ 4ALZA 4YHHJ 2QX0A 3KMSA 3LGNA 1ZBTA 3BGRA 2KM8C 3DLEA 4KHMA 1U24A 4ZCLA 3Q86A 4M5MA 3MPUB 1U6BA 1BQXA 2VBXA 2K2PA 3MURP 2P5VA 2LXFA 4A46A 3NEKA 5JJBA 1K8AT 1JLFB 2AGPA 2HQ3A 3PRBA 2EFQA 5A76A 4AT1B 3FZ2A 4OHWA 4DR4J 1JXEA 4X4SA 3MPVA 4CM0A 3MWBA 3JB9k 3T1HF 3D7SB 4U8YA 4PQAA 3IG1A 2VH7A 1VRTB 4RUAA 1JJ2R 3ISND 1SC4B 2BANB 2WBMA 1I5OB 4TY8A 4N41A 2VIHA 3CT9A 2B4VA 4EGLA 1KVJA 3ZTOA 1MN9A 2EK1A 2MDAA 1RTIA 3SQGB 4QWEA 4I2QB 1MW7A 4NCGA 1SUQB 3DDNA 3G96A 4DQIA 3B82A 3DGPB 1JKHB 1QUPA 3Q83A 4L76A 3KLEA 1FVQA 3HD2A 2J0WA 1R0BG 3M8QA 3GFXA 1M0SA 4OZ2A 4BHQA 1PBAA 1OSDA 5A8WB 4X66F 3JQMA 3GFYA 1XQIA 2A3JA 1G3OA 4DR3F 2EFVA 4DUZF 2HMIA 2OJ3A 4LF9F 2OFHX 2N4DA 4M5LA 2D1CA 5BR8F 3M2VB 3G86A 3CJKB 2UUCJ 4OX9J 2DHAA 2F65A 1NM2A 4DQRA 2ZVSA 4CH7A 3WIUA 5DG9A 1UJ4A 3B4MA 4X2BA 1N52B 1L3TA 3M4XA 4USKA 3AY0A 3A4TA 3UPFA 1R31A 2W7AA 2I38A 3AXMA 1T02A 1R3NA 1Q5VA 4R25A 1Q4RA 2NUHA 2NYHA 2DR5A 2W2MP 2RHQB 3QGGA 1U1RA 4ED8A 1ZZNA 2IM2A 2H5JB 1LK5A 2VG7A 4OV6A 4HTIA 2EC2A 1DTTB 3I9ZA 2DNQA 2KXHA 2B5JA 1S57A 4DR5F 2V94A 3PKYA 4ECYA 1WUUA 2B6AB 2CIMA 1FKPB 3GZ7A 4N76A 2QYGA 3KLFB 3JSRA 5K8MA 4KGZB 3B78A 1PILA 1WDDA 5K20B 3IR5B 4WFYA 5CD4A 3RJMB 2BRLA 1BHNA 5M2UA 3C15A 5CYJA 2HVIA 3HVTA 2DITA 3W1YC 2UUAF 5DZ7A 1RZMA 2CQ2A 2DH8A 5DDPC 1XNRJ 3D0IE 3V6DB 4AE5A 5M2PA 5HP1A 2Z0GA 3ZTSA 3ENAA 4A8SA 4RW8B 3R97A 3RR8A 1KQSR 4H4MB 3Q2SC 3IWNC 2F9JA 5F8NA 3AD7C 3O5TB 2J8AA 1C4AA 2AV5A 3W66A 2ACYA 4D3HA 2RS8A 5HBMB 8AT1B 2LEPA 2HQGA 3NAHA 4DR7F 3OQ2A 3UDCA 5J2PB 2CNNB 4GO7X 1BQMB 4K2JA 4AXJA 1RWUA 1WTBA 3Q2TC 1K44A 2R7XA 2QLWA 4DSEA 4MKAA 2ASLA 4LRAA 3HVAA 1FDAA 3I5AA 3M6VA 1CJVB 2KZMA 1LXNA 4OZ1A 1GX5A 4ZDNA 1EZZB 1SH2A 2X7IA 1M5HA 2M3DA 2YKNB 3FEXB 2XQCA 1FKAF 3ISNC 3HO1A 4L3NA 2VBWA 3DXSX 4U7CA 2E66A 1WACA 4X64F 1X5TA 2VFSA 3L7OA 2AIRB 4GKKJ 2W7PA 1I94J 4PXEA 1N36F 1SQEA 3NNCA 1R8AA 1ZS6A 1WF0A 4R5PB 3GFZA 3RBDA 5EWGA 1VDHA 4KIAA 3MAAA 2DXEA 4IG0A 4JI6F 3CO9A 2LA6A 2HVZA 4QYZJ 4WU3A 3L09A 4F4KA 2RHSB 4WE1A 1YK9A 2BEFA 3W8PA 1U8SA 2B8QA 3F73A 1RWPB 3WC0A 3FEYB 2AW0A 3LW5C 2NXCA 4G3IA 3BB5A 1FJGJ 1KOOA 4DL5A 3R7SB 3J81U 1SJRA 1S1WB 2HK2A 4LJMA 4ED1A 1X5PA 3QMQA 4N47A 3DNCA 3PYGA 2F40A 2EKNA 4JI3J 4A4JA 4OJHA 4B9SA 3E01B 3K5OA 3AA8A 3FJ2A 2YWFA 3ETMA 4EI2A 3AB2B 6AT1B 1CC8A 4X4RA 1ZZFA 3UQSA 3KLGA 1W26A 1BXNA 4NXMJ 2YKPA 3SDEB 4CQ1A 3BEGB 2L48A 2DB1A 4N56A 1SKRA 1TL1A 3IRXA 1BD6A 4I6AA 1S1XA 5ETMA 1FXDA 4ZOSA 3NGDA 3KKFA 1U7LA 4P75A 5E3RA 2OTLS 1S49A 4F0KA 3EGVA 3BYRA 2L9WA 4IR1A 2XI3A 2AYGA 2PC6A 1EETB 3PO4A 1Q16B 3CD6S 3NWRA 5ITHA 1T03B 3BPDA 1XN9A 5HMXA 3MF5A 3RTVA 1GMWD 1WKJA 1CS4A 2OPRA 3KJNB 3NOCA 2ZH1A 2PFDA 1RTZA 1S6PB 4A48A 1TKZA 4HACA 4ZA1A 4LF4J 2FDNA 1U0HB 5K5MA 4TU9A 1RXOB 4C97A 2H4WB 2OP5A 3GYXB 3M6WA 1N6QB 5I3PA 3MGJA 2KKHA 4QR0A 3AXKA 2E5GA 5HLFB 2WSFC 5E3CA 2ATLA 3BH7B 4QJVA 1VQSA 3NS6A 4CLPA 2DPIA 2RRBA 4RUBA 4ELVA 3CCJS 4M5NA 1PC5A 1L3UA 3PYDA 3QWPA 1AW0A 4LQ3A 4R0EA 4WFZA 4XAKA 3D6FB 3AFGA 2NPIA 3LP1B 1J5OA 3T1AA 3CDBA 3PYFA 1CJKA 2GW8A 2HHHF 4WP8A 2I5JA 2BE9B 4FF3A 2VQFJ 2IY5B 4DV3J 4I68A 4LRFA 1RT4A 4IFYA 4LF7J 5KFSA 1E6YB 2LQBA 2QZ8A 3G82B 2BZ2A 4F50A 3MUTP 2WRMA 4JB8B 2RU3A 3BR9A 1FK9B 1VRUA 5A0YB 3HSGA 4OJ3A 4X65F 1KS2A 3KYLA 1R27B 5LMUJ 4AL5A 1Y11A 4NLRA 4JI4J 4DV1J 2MZRA 5FLXU 1ZETA 3IM9A 4X84A 3L7PA 2V63A 3EDQB 4UOFA 1EJ7L 2B56A 4PQUB 4X4VA 1JLCB 1D1UA 1MMNA 4ANEA 2HQFA 1LWFA 2R3VA 1T9UA 3H5UA 5DG8A 3J7YU 3QT5A 5ADZA 3DRSA 2W9AA 1GX6A 1J27A 2CQ0A 1HBNA 3R5DA 4ZPTR 1CG2A 2XM3A 3HJVA 4LR9A 4WP3A 3VAHA 3I0RB 3CJRA 3L3CA 2VHGA 3PO5A 2E5LJ 3R5BA 1HW8A 2UXBJ 2HAIA 1WJ9A 1HNXF 5F3TA 5A8KA 1HWUA 3SSQA 4ZN1A 4B3OB 4JV1A 1HI0P 4NEYA 2GVZB 3VHQA 3UNYA 5JUMA 4EU0A 3QZ8A 1HWJA 4A8XA 4RW4A 1RT5A 1HLWA 2G13A 1RWVB 3KWMA 3RGIA 3SXLA 3OBIA 3NLCA 1EKSA 1NJZA 3PX6A 4HHUA 3DOLB 3UDEA 2V68A 2NS1B 1SKUB 2NSCA 3AOCA 5DQIA 4CTAB 3G4SS 2GAHC 3H0PA 2NXJA 4LFAJ 4DSJA 2XC9A 3DYAB 1RAHB 2D41A 1WSRA 1DRZA 4N8OA 3N6MA 4ZS6A 3EM1A 4FYWB 1T8EA 3BDPA 2DVIA 2FJXA 4KPCA 3ISZA 4O0NA 1GTHA 1YLXA 2DR9A 1LW0A 1F9EB 1FE4A 3GIIA 1MWQA 2U1AA 5ETLA 2CQGA 3ICLA 1VI7A 1X9MA 1NMEB 4RPFA 1S1UB 3K57A 4Y0FA 2VZ9A 1XTZA 4A8WA 3PIOQ 2BW2A 5SZTA 1M5OC 4B9MA 2QN6B 1TELA 4WTYA 2HYIB 2HQCA 1S59A 2YKOA 1YWXA 2MZ1A 2F4FA 5B0DA 3CJQA 4DFKA 2Y0SD 2GQQA 4E0DA 3H4DA 2EFOA 4E8UA 1KQGB 1P6TA 1NH8A 2JWNA 2E5HA 2L9NA 4QWAA 1D3WA 1HARA 1FX4A 4IUFA 3I96A 4HYKA 1Y7PA 3QQCD 1OYDA 1ZPVA 5C42A 4USHA 4ZVUB 3MTJA 4W4MA 4M5IA 2WZ1A 2J9DA 2MKHA 4PABA 3C6UA 3OFGA 4MFBB 1VC5A 2VG5A 1WC3A 3TJAA 2W8KA 2QO3A 3PKMA 5IZHA 3BPSP 3WC2A 2H3EB 2KVIA 3NS7B 2DJWA 4OI6A 5EWEA 3QAUA 4IRKA 2XHCA 1AB8A 2GIFA 3G6YA 4EK2A 2XULA 3QRQA 1SL2A 3W7BA 1WG4A 2ZWOA 3ITHA 2R7TA 3TAMB 4C2MA 3I0SB 3POTA 2B43A 2Y8YA 4M5DB 5A2QY 1QJHA 2M70A 1FWPA 3HVRA 1T9XA 1R6YA 2EBGA 2VUGA 4FXDA 3J80U 3S8SA 5AJ3J 3ZZOA 3HI9A 4XO0A 2CQ3A 3D5MA 5C5JA 2FJDB 2EWHA 2AU0A 2FVQA 1N32F 1HBMB 3UVJA 1IVZA 2ADCA 1AZSA 1Y9OA 4RNOA 3OVSA 1TL3A 5GAGU 4DV7F 1NU4A 1LEOA 1UMJA 3TX8A 4M95A 1N34J 2IC3B 1JLQB 2A6MA 4LR7A 3RYLA 3O44A 2HNYB 5B0CA 2WVEA 3OTCA 5K14B 4L75A 2RSQA 3EPGA 4ZHRA 4F7VA 2ZH3A 5KFBA 1Q5YA 2DNNA 2CAJA 4OYMA 1V5VA 4GKJJ 5DLGA 4PUOA 4DBQA 4P7TA 2LU2A 4Q7AA 4ZIVA 4C8ZA 2HWIA 2RDDA 1G6BA 1BQNB 1T0TV 2RJZA 4CT9A 1PJ5A 1CJTA 1HNZJ 3GP9A 3KUHA 2BR0A 3M8PB 4KY3A 2DNZA 4ITSA 1HBOA 3AAWB 4PWDB 3MM6B 2WB1D 2FQQB 1U1KA 2VC0A 2Z2ZA 2ZE2A 3OHAA 2CQHA 4YFUA 3IS9B 1FRKA 3NCRA 3DGVA 3I9V9 3T5KA 1C0TB 2AJ0A 1VQ9S 2XZDB 3KFWX 4M5JA 1JLBA 1VMBA 2WVFA 4USIA 5F8GA 2KTQA 4KPYA 2OH2A 2NREA 1YHQS 2JVOA 3QPIA 3MOJB 3NGKA 5KFDA 1K1SA 1FFSB 3OR1B 1X4DA 4JI5F 3TVYA 1VBXA 5IOLA 4FS2A 1J5EF 1CULA 2AEFA 1NUEA 2VC1A 2VASA 2FHOB 1D9AA 3I55S 2HHQA 2IPOB 3CJ2A 1Y4ZB 2DK2A 4U95A 3U02A 2CXEA 5D15A 5M2RA 3QO9A 1Q86T 4P10A 2AJFE 1HKAA 4RUCA 4DV4F 2C2DA 3MM9B 4J9UE 3JTOA 2HHSA 3CCQS 3HD1A 1SQGA 3QJJA 2CWXA 2CQ4A 1FXRA 3DMJB 1HYSB 1KQKA 3CGIA 2KH9A 3PX4A 5J2MA 1NJIT 4IG3B 1S6QA 3H5XA 4IFVA 2DHGA 1RU1A 1RJJA 4F2SA 4Y65A 1S1TB 1OIAA 4PKDB 1WF1A 4JP8A 2E1RA 3GU0A 2N4CA 3KUEA 1GH8A 5J2QB 5DDOC 2KHCA 1VBKA 3P5BP 3H5SA 3HVWA 2I8EA 3LANA 5HVFA 2F8EX 3UO0A 2HS0A 4RW9A 2N82B 2OFGX 2MLXA 2FVRA 2EKYA 2H1YA 3W65A 3QSIA 5D3GA 3LQVA 5FD1A 1UVJA 2G0IA 1S0VA 2ZBRA 1HNIA 2K1RA 3IAM9 2R7OA 4KGMA 3C66A 2J7KA 4L3KA 1OYEA 2CPYA 3OTDA 3HHLB 4M63A 2ZHOA 2UU9J 1HNVB 4B02A 1RI7A 4DR2J 5IFMA 2VOOA 3NOGA 3CJ8A 2VQEJ 4J37A 4WWSA 5J1NA 4TNOA 3P96A 5D0EA 1FERA 3W2VB 2E5IA 3MFIA 1MLAA 2UP1A 3JAMU 1KFDA 4K4SA 2DNLA 5T7LA 5IXUA 2DYAA 2CJKA 2DO4A 1H2TZ 1TL7A 2UXDF 3LWMA 2PFFB 2HQIA 4A8YA 2JEFA 1KC8T 3EX7B 1N88A 3AT1B 3WDOA 1XMQF 3THVA 2XI2A 4QWDA 4JI0J 4J9VA 4K4XA 1SV5A 1CPZA 3MPYA 2O67A 3UE2A 2A0FB 1UVKA 1REGX 1RHJB 2PN6A 1JLEB 4FYXB 3FUYA 2MGZA 2HVDA 3TA0A 1SJQA 1WC4A 3CCVS 1OY9A 3HXMA 2DCLA 4ZVHA 1YBTA 1KDNA 1ZYQA 1FNOA 3GWCA 1ZA2B 3OL6A 2QMUB 2W2QP 4N5SA 4JI8F 4P7VA 4O3QA 3KTQA 2Q43A 4KO0A 4PG5A 3LF0A 2YNFB 3L95X 1YVFA 1NRKA 4KFBB 1NO8A 3DRYA 4M5GA 2KG0A 1RWMB 1Q8IA 2HAFA 4CLUA 1FVSA 3BKFA 3D67A 1ULRA 4CO1A 4ANCA 2BJ9A 2VONA 1HFEL 4X62J 1SL0A 3KNGA 4IRCA 2D9PA 4P2SA 4LQ9A 1IBMJ 2ZJRQ 3K2YA 3E3XA 3OTOF 4TLRA 4OYXA 3W5YA 2VJUA 1X0FA 3OUYB 3I56S 4ZPWR 1Z2ZA 4K0KF 2RE1A 4PEOA 1VC0A 5FDLB 3C16A 1HR0F 1Q8LA 1C2PA 4B3MJ 3R7NB 3R2DJ 2QIFA 1OY6A 4LVOP 4B3RF 5IWAJ 1QVFR 5MAOA 2KDOA 2KJWA 5AE2A 2N3OA 1EKRA 1AFIA 1IBKJ 5H9EK 1REVA 1RWXB 1I1GA 4YB1P 4CLYA 1TUVA 2GIQA 3MM8A 1FDNA 3D0GE 3I82A 3CCRS 4WFXA 3DRRA 5I3QA 1VLYA 4RLEA 3LPEA 3HHNB 4WXWA 2YWHA 3PV8A 3W62A 2BJDA 1HQUB 2ZITA 1DZ5A 2DRAA 4MTPA 4JI2J 2JJ4D 1S7HA 2DXDA 4ZCKA 3KJVB 2MQQA 3PFEA 1N0UA 3DCAA 3V2UC 1DQ8A 2BDPA 2W4PA 1S1VB 2LMIA 3UR3C 2R8GA 4DV2J 5C2CA 2GHVC 3GJTB 3WHIA 1F0XA 3C14B 4Q2LA 1VISA 2V2KA 1WOSA 3VR1A 4F4XA 4NWBA 1YZ6A 1RKJA 3V5RA 2VG6A 1AUSL 2DGXA 1HPZA 2BQRA 5E33A 3EJMA 2RKIA 4EBDA 3D66A 2QLXA 4ZVFA 1IKYB 1D8ZA 2IDEA 3K89A 2MHNA 3M9OB 2O1PA 3LWLA 2DGUA 2V4JA 2GO8A 5THWA 4WIQA 2U2FA 3T1YJ 2UVUA 1S12A 2YPZA 1WEXA 2YX1A 2NZ4A 4C9DA 1NKEA 3GG0A 4Q44A 2Z30B 3LGHA 2HS3A 3K8VA 1TQLA 3OFFA 2AJ4A 5DG7A 3QIDA 3Q89A 4YUDA 1B99A 1RHMB 1JX4A 1VQMS 3QRPA 4IO9Q 1HD1A 2HURA 4UUWA 2V4RA 3QAEA 3AH6A 4LFCJ 1FKPA 2ZJPQ 2NXUA 3MECB 2CDQA 4J9KA 1QDUB 3M05A 1RHUB 1R8PA 1SB6A 5KFWA 2IAJB 2MLZA 2XZWA 3GJRB 2CVIA 1QAXA 1RAFB 1Q1KA 2MY8A 2WB4A 1DFDA 2ZDPA 2MY7A 4YHHF 4DHVA 2QL5B 4DPOA 1URRA 4C0BA 3RAMA 4YS2A 4TYBA 2EXUA 3CJ4A 4NYOA 3H40A 2RUSA 3MR6A 1VC6A 4NXNJ 1W2BR 2O5DA 4RW8A 5LMNJ 1YG0A 2OLWA 3IBCB 2W2PP 1EP4B 1JNZB 3PHTA 3W2WB 1TKXB 1PO6A 3BQ1A 5E3AA 3OL9A 1TMMA 1KP6A 2KFNA 3LALA 3NCQA 4EUVA 4DR4F 4WFBQ 1JWWA 3F41A 5D0GA 3P5TL 4LMZA 2Y8WA 3IP0A 3MPDA 3OJSA 2AMCB 1GMUA 3VGSA 3F44A 3AJ1A 2B8PA 2ZH7A 3CNQP 4PXBA 1R0CB 4O44B 2EPIA 3BR8A 3CVKA 2WK4A 1G4CA 2C2RA 2B7CB 3PIPQ 2D3O1 4DG1A 5KFTA 5C24A 1NDCA 1QSLA 2RF2A 4NCBA 2HBQB 2WW8A 3HT3A 2CPFA 5DM6Q 2HFZA 3DLGA 5HL7Q 3HMJG 2VBYA 1VQ6S 1MROA 5L1JA 3U7JA 4HT5A 3H98A 3W9HA 1X9SA 3NBPA 4HH1A 2KO1A 3CD7A 2XY6A 1L3KA 3B4DA 4ES2A 2VPYB 2M2BA 1YKWA 2FC8A 2EK6A 4Y2AA 2GX8A 4Y00A 2EEYA 5CAAA 1KFSA 2AZ1A 4NI2A 2QA4G 5F9LA 3AHPA 5D6GA 3EPIA 1XMBA 1FDBA 1XNQF 4OX9F 3FK4A 1RSCA 5D0HA 4DWIA 4J9RA 2HHPA 3DM2B 1SVDA 2WSEC 3W3SA 1GT8A 4DU8A 1M5PC 3A3PB 2C28A 1XMOJ 2Z4PA 2K3KA 1MSWD 2GQ2A 2IJRA 3J7A1 3MMAA 4DPWA 3EGWB 4M1KA 3CMAS 1OS5A 3QATA 1SKWA 2DGVA 2VD3A 1XJWB 4O4RA 3M8SA 1J2VA 5KT3A 1Q79A 5LXRA 5E2QA 2Y3YA 2F8HA 3KLIA 5A6PA 4I7FB 2FJVA 3KDOA 5D4OA 5B7WA 3NMAA 1XIQA 1EIYB 3KK3A 3KDNA 5KFCA 2GFFA 1LWCA 4DEZA 1RACB 2GHPA 3DC2A 1DJ0A 1PC4A 4BC7A 1RLCL 4NPOA 1CBKA 3K5MA 1ZH5A 4FDFA 1B7YB 5SUHA 1PIEA 2ROGA 4YY3J 3AODA 3QBCA 1YJRA 2FJAB 4Q0BB 2FHMA 3KMQA 3EVWA 4CH1A 2DIUA 2R7VA 1HQEA 1WEZA 1GFWB 2F7VA 2QC3A 3DOKA 4A8QA 2NXNA 5KT4A 5GVQA 3AB4B 2DGSA 2M0GB 3CIZA 5H9FJ 2OEMA 2WVDA 2HVEA 4WYLA 3EE3A 3UN5A 3W63A 2V6AA 3T19A 5E41A 2J8SA 3HHKA 3UI3A 4X4QA 4EO8A 1SIZA 2YWKA 5LSLA 2HFUA 4FPIA 1FKOA 1OWXA 2QSWA 4TU8A 4J9NA 2P2CB 4CO0A 2BMBA 4HR2A 1R6VA 2V8VA 4L6V3 1F3VA 1LW2A 2PI5A 3L7UA 2D74B 3U1MA 3G9CA 4IDKA 2UZAA 1S6UA 1K9MT 4J9MA 1PGZA 3W64A 4QYZK 1H7WA 3QRRA 3PXGa 4X4PA 4ERDA 1SJFA 1X4GA 3M6UA 1RTDB 5KG4A 4AL7A 1U48A 3RB3A 3QGPA 1T9TA 1DQ9A 4CZCA 3PJWA 4LSNB 1H72C 5GAHI 5LT5A 2J9EA 4Q8FA 3MCMA 3VQTA 1XR6A 3D68A 1NSAA 3KHRA 2ZM6J 2B0GA 4TN2A 1H2VZ 2KI2A 2DY9A 3TOQA 1JJ4A 1VHIA 1RBLA 2UVVA 4NLSA 4DCJB 1NK9A 2HKEA 4C0HA 1IJEB 2QLFB 2MJNA 3BV8A 5KFQA 1VQYA 4LRBA 3KG4A 3SCJE 1VK8A 4D3GA 4F8RA 3JQJA 1U6ZA 2A2DA 3MM5A 2BQUA 4C98A 4YEAA 4QWBA 1RISA 5E7OB 2XMKA 2VPZB 2M5YA 2YKMB 1RA7A 4G1PA 3CULA 1VLOA 4C0OC 3NGUA 4PPZA 3PW5A 4J9OA 2C2MB 4DUYF 4O0IA 3FMBA 2L9DA 4JUZA 4C8OA 1FTCA 3WZ0A 1F9HA 3W5XA 1H7XA 4OX6A 3T1HJ 4IH7A 1KOHA 2LCWA 3W5ZA 1I3OB 1H2UX 4I2PB 2C2KB 2HVHA 3P8BB 3GV7B 2DGWA 4O3OA 3ILOA 3MEDA 3SSRA 4H4OB 2Q6CA 2ASDA 1T3NA 1VQ4S 3ILIA 5ETNA 3GB0A 3EXYA 3VZHA 3OXGA 4QIWD 4BBYA 4FKXA 2OKQA 4YR3A 2WOMB 1X4AA 5GAEU 4WU2A 1CEZA 1S0OA 4X66J 3HPOA 2DPJA 1PKUA 5KFZA 2MQNA 1RADB 3UR0A 3PYEA 4DR3J 4DUZJ 4Y2CA 2AQ4A 2LDYA 3KK1A 5IM0B 4LF4F 3ZFVA 1TKDA 3OFHA 4MIBA 1DURA 2Q79A 1N5YA 4URSA 4ZVSB 1T9YA 2CQDA 3V81B 1FRIA 4ZPDA 4OI4A 3G6ES 4MKVA 3VAFA 4DS5A 3M8ZA 1S7IA 2ADBA 1HMVA 1UA0A 3HK2A 2G9OA 2BABA 4UOGA 1NLKL 1KLMB 4KGXB 5L38A 2ZFHA 1MU2B 1SJ3P 3FSYA 4BC9A 5C2GA 2OPPA 3KHLA 2NZCA 1VQ8S 1FRLA 4ZP9A 4G1QB 3H2LA 1CJUB 2XNQA 5HJYA 4KSEB 2NXEA 2G0JA 3M6XA 2CJ9A 4DPUA 2LECA 3SCKE 4WK1A 1P1LA 2WONB 2FY8A 1O6XA 2DO0A 1ROFA 4C3KA 4LF7F 4MAKA 2RQCA 1RT1B 1Y3KA 3F56A 2BOAA 2CUYA 1IKVA 3E2EA 5AE1A 3BSCA 3SFUA 1NDKA 4DI6A 3MUMP 3BGRB 3SSSA 4QIFA 3DLEB 2PA3A 2AYBA 4I64A 3LGMA 1Y5LB 3O6QA 4DV1F 4F2RA 2G2OA 4LBHA 5ETRA 2B9XA 3KK2A 2QA4S 2V34A 6FD1A 3CC4S 3IRWP 1U1OA 3TNVA 3I4HX 3AA9A 4LSLA 1LOUA 2CQPA 2DR6A 3MD1A 4WBFA 3CDEA 3HKWA 3IG1B 3QLHA 2YX4A 2HNDA 1A0OB 4TY8B 1U2FA 2FYXA 4GMKA 2FD2A 3M9NB 3FBCA 2E5LF 1RTIB 3DDKA 1RTHA 4YB5A 4NE9C 4NCGB 2VA2A 1VQNS 2ZZMA 3A3OB 1WF2A 2HG4A 2QA2A 3M9MB 4EZ9A 3JSMA 3FSXA 4OIXA 2ZWPA 3IO1A 1H73A 4OHXA 1ZTWA 4NLTA 1QE1A 4XTTA 1NK8A 3KLEB 4ECUA 4TY9A 4FBUA 3BQ0A 1RE1B 3M8QB 1N4LA 2GV1A 4EO6A 2CFXA 4FS1A 3SI8A 9ATCB 5EUHA 2WVBA 3R5GA 1IJFB 4I67A 1JNRB 3BM7A 1QSYA 2HMIB 2MZTA 5KFFA 2PDAA 1YIJS 1ACMB 3N4WA 3SZ2A 2YWEA 2V9WA 2DH9A 4HT7A 3HHLD 1B4SA 1P1TA 3BKUA 2OSQA 3ZC4A 1YI2S 4LFAF 1N48A 1XR7A 4F4WA 1V5IB 3AD9C 2CYYA 2YNHA 1WOOA 3OR2A 2E7XA 2V9KA 2QEXS 5DGBA 3TO8A 3PEJA 4XPCA 5CXTA 4HTJA 3DU5A 2VG7B 3LO3A 3ENVA 3VF0B 3QIPA 2B5JB 4KE5A 1X4CA 5KFPA 4DFPA 3BREA 1LK7A 3CDAA 3SQOP 1PJ7A 3U27A 3C15B 1NPRA 3TYTA 2B9WA 3HVTB 2OMLA 2J0QD 1LXJA 2B4PA 4NRTA 1KQFB 5KT5A 2R42A 1F2HA 5HQMA 4U9RA 3DU6A 2IYIA 2FZKB 8ATCB 5HP1B 3WQPA 4KKOA 2MYFA 1L3SA 2YQ0A 4DS4A 1UWAA 4FNHA 2VFVA 2ZH6A 1FO1A 2ZH9A 4DN9A 3U1LA 2DH7A 1N5TA 3H90A 1DQAA 3CD5A 1FRMA 4DL4A 2FY1A 4NLGA 1X4EA 3FFIA 2BJEA 4PYDA 3THTA 1FWKA 5IV3A 1HL6A 3FRYA 3S01A 3R1HA 1JMTA 2YX7A 4NRUA 2YNIA 5GMDA 4U67Q 4O4GA 3UWTA 5A8RA 2OPSA 1UVLA 3PY8A 2MLYA 1Q8BA 4MYTA 3UCZP 5AJ3F 4USTA 3O8WA 2N7YA 3EZOA 2V50A 4OZ3A 3PDNA 4Z7CA 3ILJA 2D3OR 4C48A 5HATA 4FP9A 4EYIB 2IM1A 3H20A 4P73A 1URNA 3GV5B 3PJXA 2MPUA 5L9XA 1SJ1A 2HZCA 1SH3A 4QR1A 3DLLQ 2HHHJ 1VFJA 3EGNA 2M8DB 1C0UA 3H2VE 3MAAB 4IG0B 2M52A 4MKBA 4JV2A 4DF4A 4ZVQB 4FNIA 3TVKA 4GKJF 4WE1B 3ENQA 1BY9A 2L08A 1U45A 5E5NA 3Q8UA 2F4VF 3CC2S 2IVFB 1HNZF 2P6SA 4ID5A 1KHVA 3HP6A 4URQU 4X65J 2HK3A 3CW2C 8RUCA 5HQ8A 1Z1ZA 2E5JA 5DRKA 5DS7A 2HGMA 1UFLA 3HHLC 2CPEA 4ELUA 2PMHA 1KONA 4Y28C 2BRKA 3M8YA 2HW3A 1N54B 1WC0A 2LA4A 3FZBA 1HQ2A 3RB0A 1VQ5S 4XK8C 3M32A 3DLHA 4P72A 3KLGB 4GVBA 2R9LA 3TZWA 1AA1B 3VAMA 1W7WA 1WELA 2W2NP 4LFBJ 1RAGB 2BJ3A 3H42A 4TU7A 2EW9A 2IMOA 4P52A 1TL1B 1NK0A 1M1GA 2H65B 3IRXB 3UDVA 1QVGR 4YB6A 1S1XB 3TUJC 4OYPA 2BJ1A 4CT8A 5HROA 2ALZA 1D8YA 4ECRA 3CE8A 2XEXA 2BM1A 1YJVA 4BS2A 3HZEA 3TJ9A 3HJFA 4CO2A 4J9PA 3ZZPA 3IWXA 1EQMA 1HI8A 4WIIA 1CS4B 3G6XA 2OPRB 4LIRA 1LQ9A 3M2UA 2LEAA 4CDIA 1TMJA 3N5FA 2FLPA 3ETOA 2XBPA 2JEIA 4LR8A 1TKZB 4HDHA 4HACB 4FBTA 2MZJA 1RTJA 2RB7A 3TEHB 4NASA 1S97A 1VGYA 4IQMA 3TQ1A 4USVA 2XYHB 4P2XA 5GADU 1RBAA 2HS4A 1IBCB 2DISA 1K0VA 4ED0A 2V67A 5AE3A 3M7VA 2XZTB 4USWA 3OUYA 2DHSA 2ROPA 1HIYA 1U1LA 4RU2A 2BKPA 1U47A 1ZAVA 2MB0B 3T5HA 1UEKA 1UWBA 1KR4A 3NGSA 2GO9A 3ZZYA 4RUHA 4CO4A 1SH0A 5EHHA 1YBAA 4CIOA 5KFGA 1GQEA 1NNDA 2H9ZA 4X4NA 4QPXA 3LUYA 3GLJA 1EARA 4AL6A 4TVAB 2BW7A 2ZVIA 2HIQA 2IA0A 1J5OB 4DZ6A 4K50A 1CJKB 3OXFA 3CEDA 4RNNA 2I5JB 5K8NA 2DNGA 2UU9F 1HBUA 1IBLJ 1RT4B 4IFYB 1WEYA 5I42B 1T05A 2RD5C 4MK8A 1WC1A 5F8IA 3AOAA 4DQSA 3QJPA 2A1BA 4URGA 2L3MA 3GCWP 1B64A 2GS8A 3AD8C 2DGQA 3BSAA 1VRUB 3HKZD 2XMJA 1RAJA 1MWZA 5K9FA 4NA2A 5D77A 3RBZA 1O0PA 3VAKA 1B7FA 1FWLA 1WKLA 1ZOTA 2I1RA 3MTKA 2ZOFA 3US5A 5KFNA 3CJTA 2XS7A 2RILA 2ZJQQ 4F04B 2H48B 4QU6A 3T41A 4IH6A 2I0XA 2W9BA 4HLBA 4F02A 4N8NA 4DV6F 1LWFB 2JSXA 2QMWA 1S9GA 3PW7A 1TKTA 3ONQA 1WDTA 2YQ1A 2AT1B 4Q2MA 3DRSB 5IT0A 2ALYB 1HBNB 3FCWA 2VB6A 4O3NA 3I5CA 2W4DA 1UJ6A 4ENOA 1HW9A 2M9KA 3CO0P 5A8KB 2A18A 5L9NA 2JLGA 2CZVC 2K3IA 1SPBP 2MKJA 2LQ9A 1Q53A 3JYTA 3EZ5A 5IS2A 1LFPA 1RT3A 1UZHA 4ZVEA 3D3CJ 1YJ7A 1TR0A 4DU7A 4RW4B 1L3VA 2C22A 5BYSA 5IC6B 4TLQA 1RT5B 4ETZA 3CDWA 3FCVA 3Q8PB 5B0GA 4NA3A 2C2ZB 3N28A 1UKUA 2ZKUA 1R7IA 1C1BA 3NP5A 4RW6A 2D69A 2VDHA 1DLOA 4DSFA 5B0BA 4X62F 1BWEA 1ZM9A 1B70B 1FCAA 2FIUA 3DN9A 3TW0A 1IBMF 2KFYA 1HNWF 2Q6BA 3N0VA 1QAYA 4OMFG 3NRBA 3C3LA 1RK8A 2HBRB 5KG3A 3PM9A 3CJ0A 3DHWC 1QM9A 2P9GA 4I0WA 4V19J 1O5JA 4KBIA 4K4ZA 1LW0B 4C8LA 4R0JA 4L72B 2O3DA 1WHWA 3O2IA 4R8UB 4YDDB 3MZIA 5GMKa 1DAXA 5IWAF 2J7WA 4NYZA 4DPTA 3D4JA 2CNOB 3RRKA 2M88A 1IBKF 4YOEA 1N33F 1OJ4A 5HVGA 1OPZA 5KG2A 2BQ3A 4ILRA 1AROP 1X8DA 4M8LA 1NPPA 2N3LA 4UW2A 2DNKA 4KC5A 2W24A 4NYPA 3IAS9 1R43A 2P6TA 5U47A 1YRXA 3NY0A 3C6UB 2OD6A 3SBMA 3A12A 2VG5B 2DBBA 4DV4J 2V5HG 3GYNA 5IV4A 2ZNZA 1SIWB 1W25A 3WIVA 1PAEX 4CLLA 4CYUA 3H2UB 2GZOA 3KHGA 4K7QA 4ZMMA 3G71S 4XDDA 2F8MA 1S9EA 1S4FA 3ITHB 4Y2MA 3S1TA 1R0AA 5KFEA 1PAUB 5CH7B 2G1HA 1TFWA 2GJFA 3POTB 1P27B 4UY8T 2MHEA 4GRSA 4C3LA 5C25A 3IGNA 3JXOA 3OT9A 2HFNA 3V4MA 3RAXA 2UVWA 3M2RA 3OLAA 2RAQA 3PR5B 3T1YF 1HHQA 2AHOB 3UVJB 2J6SA 4UF4A 1AZSB 3SEOA 2GNKA 3PG9A 5DLFA 5D4LA 2EFPA 3IC1A 1TL3B 2W9CA 3MMCA 3GV8B 2RQKA 4CLSA 2OD4A 1TP7A 4OHYA 5KFRA 2APOA 1E6VA 2BV3A 2D3ZA 3FKBA 1DBDA 1FTRA 2HFVA 2BE2A 4ZHRB 2C2NA 2CPHA 3X3UA 5L8RC 3MR2A 2AEJA 5F9NA 3VWSA 3LOUA 1OO0B 4PUOB 2XLJA 4JI7F 2ZBIA 2CPJA 2C3PA 1CJTB 1TFYA 2BKOA 4LFCF 3TVZA 4OYOA 5AXMA 4RW7A 4FF2A 4WZQA 1HBOB 1FJ7A 3QYYA 2XWYA 1U26A 2CNLB 3EUNA 3HSJA 2UXDJ 3HHDA 3R5CA 2ZE2B 4J91A 1HHTP 4F4AA 3OL7A 2P9EA 3FQLA 1TV6A 2CJQA 1AUDA 5GMEA 4DZDA 2JC1A 3IM8A 1JLBB 1XMQJ 3T5LA 3SFGA 5DDQC 4NXNF 3E8OA 3KOAA 5ETPA 1NKBA 4ZVGA 5LMNF 2X1GA 1EAYC 2NSBA 1N8RT 1CULB 1JQGA 5L1KA 1GMWA 2LYVA 2QLBB 2AX1A 3NL0A 3M8RA 1UAWA 1YJUA 2CG4A 4A8FA 3RBXA 2RVJA 4MK7A 2PGCA 1OMSA 4JI8J 3QO9B 2K8GA 1YZ7A 1GK8A 3I87A 4OJ1A 2BA9A 1LWXA 2HFSA 2VDIA 3D54A 4HEA9 5J2NA 4WPAA 4O3RA 2UUWA 3LPYA 2XTJP 2UV8G 1RAAB 3ZZTA 1FRJA 2MMYA 3GJSB 3CJ5A 1LWEA 5J2MB 1S6QB 2VFTA 2LXUA 3Q8RB 5ETQA 4IFVB 3PR4A 1N0VC 2ERRA 3J7Z5 3OTOJ 2JRSA 4BWMA 3O1LA 3ADAC 4H4KC 5A6WA 3ULHA 3I32A 2OPQA 4BDPA 3T3FA 5DGAA 2ZD1A 3KLHA 4DOZA 1FNMA 1HR0J 4DX5A 1A9NB 3ET6A 1SC3B 1WOPA 4RW9B 3CJ3A 5D3GB 3DHXA 5DETA 1JLAA 4ZJLA 4ILLA 1Q0NA 1Q7YT 1NCLA 4U8VA 1VQ7S 4HHJA 2GMHA 4ZJQA 2KN4A 3DLKA 1HNIB 2K1RB 3DI6A 4P74A 4MMOA 1WC6A 2JLFA 3J7YI 4K4YA 1RUSA 1UL3A 3QT7A 3GR1A 3D1HA 2XHWA 4QR2A 3R9LA 1VK3A 3LP2A 4ECWA 4C8YA 1KNZA 2KYXA 2C3UA 2MEWA 4B3TJ 1Q7LB 4QW8A 4CH0S 5J1EA 2HWHA 5BYQA 1S9FA 2V8HA 3JSBA 4F26A 1FA0A 1OY8A 1WKKA 1EX8A 5KAKA 1VJQA 4IRDA 2K7JA 1X31C 2KRBA 3CCMS 4OHZA 5DQGA 4MIAA 5H9FK 1BLUA 4PG6A 2HHTA 3M1VA 5T7LB 4J7CA 1U1MA 1JLGA 3MMBA 4X4UA 2ILYA 1NAQA 1BMQB 4ED5A 5IC4B 4PCQA 4ZN3A 3M30A 3LP0A 2X1FA 2F5GA 4YY3F 1N5VA 4U6PA 2HHUA 4ED6A 3BBCA 2GMJA 3AJDA 3KLVA 1ZAWA 1A7GE 4W98A 1NKCA 1IWGA 3P49B 1SV5B 3IWLA 4K5SA 2Y1JA 2XS5A 5EX0A 5KOWA 3J81Y 1YITS 4C3MA 2ZBPA 5HQLA 3H5YA 2MGZB 4CO3A 5EX3A 4TYAA 1RAIB 2X51A 2R8KA 2HPUA 4F67A 4CLTA 1RT7A 3R1LA 1RT6A 2W7OA 3EICA 1HI1A 4K59A 4KO0B 1SCJB 4LF8J 3MAQA 2YQ3A 1RKIA 1F1BB 2Y1RI 2KT2A 5LJ5Y 4ZVOB 2HBZB 4DLEA 4LF1A 2I2YA 4MIWA 2BX6A 4Q43A 4AXIA 4FVCA 2QJ3A 1P9YA 2W25A 3TR5A 2EG2A 4PR6A 2ZUAA 4EEYA 2CPDA 3R7BB 5DM7Q 5I3UA 4KHRA 4F4ZA 4Y2IA 3BJYA 4DL6A 2UUBJ 1RWNB 4WF9Q 2PE8A 4S0MA 3TQEA 2ZM6F 4DV0J 3C16B 4P9SA 5CA5A 2XLIA 4OLOA 3JQKA 2OGUA 1Q82T 2HFOA 1IR2A 1YJTA 3AJ2A 1U1NA 4YMEA 4DLGA 3HLUA 2B51A 5LXYA 2PEBA 2J7UA 2QT7A 1UJ5A 3RR7A 3R6LB 1REVB 2VICA 3Q22A 4K4UA 3BS9A 3MM8B 5KFJA 4YP3A 2ZBCA 1M1HA 3DRRB 2A2CA 2WVCA 2MJUA 2F3JA 4LF5J 2RUGA 4JV5J 1FX2A 3AOBA 1Y3JA 1WG5A 3K5PA 2MXYA 3V4IA 3BYPA 1HHSA 5IT9U 1S0MA 4MH8A 2CG8A 3OD2A 2FVSA 1JJHA 5CYQA 3P6YC 4UTGA 3CTRA 2HHXA 2OI2A 4GO5X 3I4PA 4KV8A 5GAGI 3H4BA 5KG1A 2BBEA 3QT6A 2QGFB 1FHTA 4ZPBA 4JBCA 2HEKA 3C6TA 3B54A 4BLGA 3ZZUA 1IN0A 5F8JA 3EYZA 3GIJA 4OYAA 4AFFA 1APSA 2VG6B 1HPZB 5HN0A 1UVMA 3J7AN 3NXZA 1C1CA 5ETOA 5LL6d 2RKIB 1RT2A 2IFXA 3C8YA 1XBWA 3CF5Q 2YNGA 1KTQA 1RAEB 1NHUA 3K7RA 4B9NA 5FLXY 1S76D 4C11A 4F25A 3G6VA 3UW1A 5F3ZA 1VBYA 2V4JB 3VZIA 2XSJA 1XNQJ 1P8GA 5HO4A 2NR0A 4ED7A 2COLA 5JVHQ 4IKAA 4OI0A 2Z2LA 4OX8A 4FYYB 1XR5A 2CPIA 1SXLA 1QLNA 4Y6IA 2UXCJ 1IKXA 4OI3A 1NBEB 1MWYA 3D1OA 2W8LA 1Q78A 1TAQA 1M1KT 2HHVA 4FN5A 1FJEB 3NCPA 1TZ0A 3OTEA 4G65A 1KLNA 3K0JA 3A3NB 1N5SA 2HNZA 1WWHA 4EMDA 2DNMA 1DTQA 7FDRA 3H8YA 4LIWA 3MHYA 4KH1B 1T95A 1QUVA 1RLDA 2JZ5A 2C42A 2YVSA 2HQDA 3DOMA 2VFUA 4B3SF 3N01A 1RYSA 1V6HA 4DL2A 2XGQA 1KHWA 2ZEJA 4J90A 4HI1A 3BN7A 3C46A 2SXLA 2J6UA 2XG8A 3SIPB 3H59A 3QZ7A 1NSQA 4CRJA 1NPKA 1MMLA 1T9VA 1UEVA 3DRPA 2R2RA 3FEZA 4LF2A 4OYIA 1GXLA 2DT9A 1BC6A 5I4MA 4Q8EA 5CYMA 2FHJA 4I6WA 2PSZA 2OAUA 2CA9A 1LV5A 5J1PA 2DGTA 3MI7X 5LSOA 3IBWA 1VQKS 5G0RA 1S99A 3Q8QB 1SBRA 2CJAA 2GGPA 1X5SA 2OEKA 2DNRA 1WSVA 2D9OA 3B6BA 2CDRB 3GILA 3MEGA 3TUPA 1BWVA 3GTYX 2V69A 4ZLNA 2XCAA 3AQPA 3VV2B 4F36A 2MZSA 4DG1B 4HKQA 1H6KX 4DFJA 5D78A 5C24B 2LLZA 4JI1J 3GCXP 1TVRA 4MT1A 2CJXB 2RF2B 4ZLJA 2V2ZA 1UETA 2QSFA 3DLGB 2DXFA 2F63A 1MROB 4OYBA 2AZ3A 4KQZA 4ICLA 3NBPB 2QMXA 1A6LA 3I6PA 2X1BA 3SCIE 1H0HB 2WBRA 2ZH4A 2OMOA 3CCUS 4PPDA 3N6LA 4G6VB 1HWLA 4NI2B 2I9SA 3CXCR 1VS3A 2DHXA 3IFEA 3CCLS 5E3PA 3MM7A 3V6KA 5K8OA 3THPA 2XMAA 3CC7S 2YKAA 5A2QU 3ELHA 2Z2YB 4USJC 1YTYA 3BGOP 2IM3A 2DRBA 4QU7A 2X3DA 3V6JA 3MMAB 3K58A 4BCAA 2YH0A 3J80Y 4DPXA 4DJBA 5EWFA 1JLFA 2LQJA 1U1QA 4DUYJ 4WFNQ 3Q24A 3MEEB 3SCLE 3KLIB 2Z58B 4DR6F 1KTVA 2LXIA 2XGPA 3NGTA 3FDSA 3KK3B 2YBVA 1VRTA 1UP1A 1TUGB 2MKYA 4LUBA 4CCHA 2H5EA 1LWCB 4ECXA 4DCOB 2BANA 4DL0C 2AKWB 2MKKA 2YTCA 3TA2A 4ZKAA 4DXLA 1UPMB 3SQGA 4TQSA 4I2QA 1SUQA 4LF6F 1XWLA 3IN5A 5D4PA 4DV5J 1HD0A 3LAMA 3BBBA 3DGPA 1JKHA 4ATNA 4KHPJ 4WKYA 1HQEB 1LFWA 3CPWR 1ZPWX 3HFVA 2DNYA 1UZDA 3DOKB 1FEEA 1FRXA 4OZ5A 5HANA 3X1LB 1NDPA 1RABB 4OZNA 4LBPA 3OJUA 5A8WA 2MQLA 5L39A 2X1AA 3PHEA 4WYWA 3BKTA 2RQ4A 3M2VA 3CJKA 2DR8A 2KG1A 1FKOB 3HHEA 4ECVA 3Q23A 3Q8VA 2O66A 3FGVA 3IGVA 1UPPA 4RO0A 2KT5A 4ZVTB 3R27A 3K5NA 1SL1A 3TZXA 1LW2B 3N6NA 4DPYA 3MCNA 4IDKB 2C3YA 4YQWA 3GR0A 2JHEA 3W9IA 3DRXA 3SV3A 3BO4A 2IDLA 4I56A 3BGLA 3PEHA 3R3TA 1XEZA 3PW0A 2CKWA 1SKSA 3FMWA 4DL3A 2H5IB 1IQTA 2FVPA 2YKQA 1DTTA 4F4YA 4ECTA 2ABYA 2E9TA 2B6AA 2DR7A 5IT9Y 1M5SA 2IBKA 3KLFA 3SMZA 4PYAA 1V3ZA 4EZ6A 2KXNB 3BQ2A 2RDJA 3KHHA 3RRGA 3ZXWA 5F0WA 3HF5A 1KEKA 3EVOA 3OPKA 3NAIA 2QFJA 4O3SA 5I42A 2POKA 1IXKA 4ETXA 2MSTA 2JVRA 4AQYF 3QFHA 1OQ3A 4NA1A 4ZP7A 1YGYA 2F1FA 5E3QA 3V6DA 3MM5B 3T5JA 4N77A 2K06A 2EI5A 2J5AA 2DNPA 3A8EA 2H54B 4H4MA 1H38A 1CLFA 1U09A 2A10A 5KT6A 9RUBA 2Z57B 1FFGB 4JOUA 3ILLA 3MCOA 4QIGA 4MK9A 5HBMA 4ZLPA 4JYAJ 2IRYA 4UQGA 2DHHA 4TQRA 5J2PA 2M7SA 4GVLA 4LRDA 1BQMA 4Z37A 4WK3A 4LFBF 2NQPA 4OZ0A 1B0VA 3ZZRA 4M5KA 1S6OA 1CJVA 1V9OA 2E7VA 2AP6A 3MEDB 4CI0B 2LQ8A 3ENWA 2LQ5A 1KBRA 1YX2A 2YKNA 2B7BB 2XWXA 2OTJS 5HMYA 4B9LA 3BH6B 1UEUA 4K8RA 3BGFA 3LAKA 2GA7A 4FKYA 1NEEA 2CQIA 4DUTA 4DR1J 2B9EA 2KYZA 1P9QC 4IH5A 3JAMY 1QTNB 1PCAA 2VV5A 1V3RA 3DKDA 4GC7A 4DN0A 3BSNA 4R5PA 1UA1A 3K59A 3G8SA 4CP5A 3KK1B 1VYAA 4L73A 5KFVA 1NSPA 2UUCF 1N5YB 4EFAC 1EB0A 1OPIA 3ZNJ1 4OI2A 2OHDA 1ELOA 2V8DA 1CVJA 4QIVA 1WI8A 2Z56B 1Q8KA 1S1WA 3DFEA 1HMVB 3JSYA 5LSRA 3LA0A 3Q8SB 3PFOA 3CCZA 5KFLA 2ROEA 2C2OB 4FF1A 3E01A 1FD2A 2XCPA 4NZ0A 2Y1IA 2OPPB 3FNNA 2AX0A 4R8UA 2FJWA 2FHKA 1RWWB 3RW6A 1NJWA 1D09B 2XY7A 3MEKA 1UFKA 3D6TB 1U25A 3EMTA 3SDEA 3CMQA 4NOHA 5BXIA 1S10A 1IBLF 2B3TB 2NYIA 5CABA 2MZQA 2V2VA 3TX0A 4RWXA 2VOPA 1VR6A 3T6BA 5HAOA 5HK4A 1IKVB 2WHOA 4FF4A 2ASYA 2HSEB 4HL9A 1D9FA 1VIOA 5KG0A 1K47A 1XNRF 5AXNA 1EETA 3N79A 1N5QA 2VPXB 3I5BA 1T03A 1B0PA 4UY85 4ZP8A 3BF4A 3VALA 4EBCA 1U0SA 3T9ZA 4KR0B 2R8HA 1IM4A 2DD8S 3KK2B 1U4BA 3T6JA 1S6PA 4NLDA 3NS5A 3TP2A 4LSLB 1T3OA 1U0HA 1X4FA 1WNEA 1SI9A 2ZDOA 1WTFA 4PG7A 3QLHB 1VJWA 2HNDB 4KRWA 4LBIA 1X5OA 1N6QA 2MKCA 1G7CB 3PRDA 4W90B 5HLFA 1RTHB 2VPWB 4Q5VA 1TK0A 1IKWB 3N5BA 2MQPA 4OL8A 1NK7A 2E29A 1D0EA 1JJCB 3JSMB 2R4FA 2RMLA 1QE1B 4XPEA 1R8HA 4NMLA 1F5BA 4KGVB 2AJ1A 4GKKF 3OV7A 1IQZA 1I94F 3PRVA 4ED2A 3LP1A 4ES3A 2F9DA 2V4QA 2KT3A 2BKNA 3A8IA 2XMMA 1QAIA 1R8CA 3BDEA 5C7PA 1UVIA 3OL8A 1FT8A 2Z8QA 2BUNA 4B9TA 2IJNA 1M5VC 1E6YA 3G82A 1NSKL 3FBEA 2ZUGA 5IQ6A 3J7ZT 2RH3A 1FK9A 1G1XA 2F4VJ 2LKZA 5A0YA 3PACA 1FJGF 3CMES 4LREA 4U7UK 2DCUB 4CLKA 5EN1A 2FJBB 3I31A 2YNHB 5D4NA 4PWUA 4UOCA 4QZVB 4JI3F 3OR2B 2QL9B 3OW2R 3HM9A 4FYDA 4ED4A 4PQUA 1RA6A 1FESA 4CLFA 1TL5A 1JLCA 3UCUP 3RBEA 3RB6A 2V2QA 3CUNA 3QIPB 4ELTA 3TAPA 4NXMF 2VBZA 3LH2S 1FJCA 2BJ8A 3HDSA 2PD1A 3E51A 2PMZD 5KOXA 2AYEA 1QTMA 2E9RX 5KFMA 5D8HB 2HGLA 2EFNA 3G8TA 3P3DA 4K4WA 4X4TA 3I0RA 4HH0A 2DNHA 2C3MA 1ZM3A 2ILZA 1KVKA 5HJXA 4UT4A 2QV6A 4KGKA 4NX9A 2RIJA 4X4OA 3TWZA 1NK6A 3O3LA 4B3OA 4L74A 4WXOA 2GVZA 3N9UC 2FHJD 5DJBA 2ZH2A 4KKOB 1W2IA 4OLPA 4ER8A 2ZH5A 2JX2A 4NMXA 2NPFA 4AUKA 3EGZA 2J0SD 1NZ8A 2AJ2A 3DOLA 4RKUC 4LF9J 3BZQA 5KT2A 5BR8J 5CD4H 1MNEA 3C19A 3QNWB 3FFIB 1TAUA 3UD3P 1U6FA 4CTAA 3ZNUA 4KYZA 2YNIB 2GAGC 2J9DE 1H98A 2GVDB 4O4GB 4PZVA 3HCXA 5A8RB 1RWOB 3VGVA 1F5CA 2OPSB 4OQJA 3VGUA 2JNJA 3DYAA 1T9WA 1LNQA 1RHKB 1NHKL 1HA1A 4HI2A 3RB4A 2CPXA 4B9UA 2C2EA 3NKYA 4LT6A 3V6HA 3EXCX 3BN4A 4DR5J 3UNGC 3PJ9A 5AT1B 5ETSA 2KM8B 1QSSA 2GQCA 2OUGA 1S1UA 3HSDA 2ZC4A 2KFZA 2ACMA 4ZK7M 1AFJA 3GIRA 3RG6A 5B0EA 2VQFF 2XMWA 4IOAQ 1FD8A 1Q81T 4DV3F 3F0NA 1C0UB 2R8JA 1ICEB 1R89A 1GEHA 2CPZA 4NLQA 1RCXB 5F0UA 2PO4A 1WORA 2UUAJ 5CHCB 1ITPA 2HBYB 1QAJA 4EBEA 3SV4A 4ZJOA 4P6QA 3UFCX 3MOZA 4Z7YA 4ID5B 1PBUA 4MFBA 2OO4A 5LMUF 2IJFA 5GAEI 4JI4F 2LU1A 3NGRA 3KG0A 4KB7A 3WX8A 2VODA 1Q95G 1WI6A 3S7RA 1S72S 1NB2A 2B4OA 2CNKB 4A8MP 1X60A 1SC1B 2OSRA 2Z2MA 3JTPA 1FI4A 4RBUA 2ZHAA 1RCOB 5H1SV 3FQKA 3M32B 2HRTA 2KXFA 4DV6J 2XMVA 1TL4A 4GVBB 4YB7A 3GMGA 4DR7J 2VFRA 3MXHP 3TAMA 3I0SA 1FE0A 2R2TA 3K17A 2KB2A 4FPRA 4IO1A 4M5DA 4K2XA 1R8BA 1OQ6A 3IMQJ 4MJKA 2IBOA 4ZLLA 2UXBF 1KVIA 1T11A 5HROB 3EWGA 2PMWA 3W8GA 3G87A 4RZRA 4RBVA 5DO2A 2FB0A 4HHHA 5B08A 4OJGA 1HBMA 4X64J 2FUG9 3FBFA 5LOQA 1WHXA 1NJYA 2G0CA 5LM7E 5KG6A 3G2XA 3CJSA 3FCHA 3CCTA 3TI0A 1G2EA 4FXWA 3OSPA 1NH7A 1N36J 2R7SA 3M2UB 3RZAA 7AT1B 1JXVA 1IM6A 4FZVA 2IC3A 1JLQA 3A8KA 5BYRA 3G8QA 2HNYA 2JH3A 1YBUA 1RTJB 1RBOB 5CCMA 2ZKTA 4JI6J 5K14A 1F2GA 4CO5A 4F3MA 1BE4A 3PW2A 4ZCIA 5MLCV 2XLKA 2BE7D 1U49A 3D6MB 3GSDA 3OSNA 2VA3A 4CLWA 1BQNA 1NZAA 3IXQA 5B0FA 1HNWJ 3VVTA 1NB7A 1H3DA 4ECZA 3M8PA 2VU5A 2FGCA 1LKZA 4QQBA 2HGNA 4PXDA 1UWBB 1JK9B 4PWDA 3MM6A 4NLYA 2IM0A 5KFUA 2XY5A 1ZA1B 1U2RA 5HI7A 2D7SA 1VOMA 1H74A 3ZTRA 3OFEA 3GFHA 3IS9A 1FXLA 1JB0C 1C0TA 1Y5NB 2HWTA 3L9ZA 4USMA 2FPHX 2QE5A 1RP5A 4J9SA 2D3UA 1O8BA 1ZTTA 1XERA 1N33J 4ES1A 3CCES 1HBUB 4OX7A 3OR1A 2RT3A 2Y9HA 5F8MA 2ZZTA 1T05B 3J81j 4B3TF 2RNEA 4RBTA 4RNMA 2ZZNA 2QLJB 2NUUG 2EC0A 5DQHA 1K73T 1B3TA 3MR7A 4CM2A 1M5KC 2ASJA 4U7UD 3D3BJ 2XMUA 3JTNA 3R5JB 2ATCB 3MM9A 3RRHA 2QRRA 4PRFA 4N7TA 3UN2A 1HWKA 3FRZA 4RU9A 2W9BB 3DMJA 1HYSA 1FDDA 2JFDA 3ZO7A 2BVZA 5KFKA 3FSIA 4IG3A 1S9GB 1TKTB 2E1CA 4V1Ak 3UCGA 2R7UA 2LEBA 3DDIA 2CADA 4RX6A 2C3OA 1S1TA 4OV1A 1VBZA 2XS2A 5RUBA 3MR3A 2G1DA 5E0OA 1N56A 3CDUA 1SC6A 3D6HB 1U02A 5EDWA 4XIUA 3D28A 5J2QA 4C6AA 3UN3A 2QA1A 1GMVA 2HIYA 3HULA 2PA8D 3JYTB 4CNZA 3RU0A 1MMDA 1RT3B 1WHYA 3GJQB 4WKRA 1FF2A 2P8IA 3ZZZA 2ZC3A 3OVBA 2AJQA 2GCFA 1AT1B 4LF8F 4RR5A 3VQSA 4UZBA 4A8KA 2EFGA 2YWWA 3HHLA 1KWMA 1N34F 5KG5A 1RB0A 4OZJA 2PI4A 4IR9A 1C1BB 3QJLA 1U2CA 4RW6B 1HNVA 3A8JA 1DLOB 4WP9A 4UZCA 1I51B 2R7RA 3EDRB 4P71A 5ETVA 4OFZA 3R8YA 3AQOA 5CZXA 2XSFA 1PSDA 4C8KA 4JI7J 2MQOA 2Y1LB 3W2VA 4AD6A 5L1LA 4QWCA 2UUBF 4DSLA 2IA6A 2GHWA 2W2OP 1CQNA 1Z4UA 4UUXA 2IRUA 4J9QA 3R2CJ 2L41A 2HZAA 4DV0F 2DEIA 2KRRA 4PAAA 5DZ6A 2IHR1 2O01C 1YSJA 2H51B 4ZCMA 4E2FB 4LRCA 3HFKA 2MTLA 3GPAA 1WHVA 1RHRB 1AYEA 4RNFA 2QYCA 4PG4A 1KN6A 2CRLA 2NLWA 3U1NA 2R2UA 2G4BA 4H54A 5D0RA 4CNYA 2LFVA 1F6TA 3MMJA 2NCKL 3MFHA 3CCSS 4WFAQ 4NZ6A 3TAQA 1JLEA 1K0TA 4DX8H 2ZNYA 3VCDA 1HNXJ 4LF5F 4JV5F 3H25A 2MQMA 5KFXA 3NWGA 2UVRA 1PYSB 2OELA 1CQMA 4KTQA 1D9DA 2DY1A 2YNFA 5IQQA 3RW7A 5JVGQ 2G2YA 4QIEA 3GIMA 3EZUA 4KFBA 3TANA 3QFWA 5FJ4A 2C1EB 3CWJA 4DF8A 1RDRA 3KUGA 4CYUB 2JC0A 2WTFA 5KTQA 2JEJA 1S9EB 4WTOB 1R0AB 3M8WA 4F0HA 2V8GA 3QSYB 2ZOGA 4U96A 3OXLA 4NLUA 2YWGA 3K8WA 3B8HA 2JL9A 1F3FA 3KNAA 5FDLA 5C25B 3P45B 3P4UB 1VCTA 4CWBA 5BJRA 1TK8A 3EVMA 2FLOA 1QD1A 1TK5A 4I6YA 3M2RB 3TZZA 3KG1A 5B09A 1GXTA 4J9LA 4Y2KA 3OHBA 4ZITA 2OIHA 5T41A 3SYZA 1X0PA 2DEJA 2CZ9A 1RAOA 3BGUA 3TARA 4C7QA 4ANDA 2W9CB 3MMCB 3W61A 2XYGB 5F41A 3KJQB 4AYBD 1WD6A 2UXCF 2V0NA 4PG8A 4O23A 3TZYA 4RL1A 1E6VB 4K4VA 4YR2A 4DR2F 2HHWA 2BE2B 5F8LA 3FC9A 4FXVA 1X7VA 5KFHA 3VTIA 2VQEF 3HSZA 1ZAXA 2H4YB 4HVZA 4KH0B 5GAHU 3MEEA 5FIIA 1HQUA 2CZ4A 4OYZA 3KJVA 2KVQE 4E98A 1S4EA 2KU7A 2GC8A 4RW7B 3LTOA 1S1VA 2CJBA 1KSPA 3JS9A 1DARA 3C14A 2I6WA 3DLBA 2E1PA 1FRHA 3GYGA 2Y0BB 2AGOA 1TV6B 3OVAA 4PWWA 3VAIA 1XK8A 5GADI 2YXLA 3MR5A 4JI0F 1IR0A 1NK4A 1VQLS 2RU9A 4F3OA 2BYCA 2PIIA 1DHMA 3ZTQA 4ZPAA 1IKYA 4NLWA 4YDXA 3IA0A 3HZGA 1Y00A 2BJ7A 3PX0A 4B17A 3BO2A 1NXIA 2KHDA 1RGVA 1N32J 1BGXT 1FFWB 1UW9A 2E1AA 4DFMA 4DDFA 2YPYA 1NHVA 2DKOB 2FLNA 4NLPA 3KJFB 2GJ2A 4DV7J 5J2NB 2YY3A 5LJ3Y 1IR1A 4ZVPB 1LWEB 4JI1F 3ZZ0A 2EVZA 5ETKA 3W9JA 1C4CA 3PCOB 1DY3A 4NZ7A 3Q0AA 4ZVRB 5CQGA 2IYGA 2E9ZA 1JIHA 1YJ9S 1L5UA 1Z2LA 3T9NA 3TA1A 2ZH8A 4RJVA 2AWZA 3MUVP 2HLTA 3TRGA 2OPQB 2ZD1B 3MECA 2VKRA 3KLHB 4I4BA 2ZBQA 5B0AA 5IT4A 3HX9A 2FJEB 1PG5B 2FTRA 2IAJA 2HRYA 3ET6B 4B9VA 4B3MF 3IR7B 5G4DA 1JLAB 5HVHA 3WBZA 1VQOS 3UDLA 2FLLA 4RNHA 2B4UA 3VAGA 1VIXA 4A47A 3DLKB 3DI6B 2M4MA 2RRNA 1KKHA 2CQBA 2R7WA 2QL7B 1ZM4A 1RQ0A 5AXLA 1YQHA 5L1IA 3TUIC 4V19X 2BOPA 3LP2B 2HRUA 2XO7A 1EP4A 4JI5J 2DNOA 3W2WA 1TKXA 5J1EB 1J5EJ 2B9YA 4C4WA 4XDCA 4MKYA 3BO3A 1U1PA 3L4BC 4KJIA 4JI2F 3PVXA 5C42B 2AGQA 2LDIA 2HZVA 3M1VB 1S48A 3QGHA 1JLGB 3UD4P 5HMWA 3MMBB 4O44A 2JOQA 4DV2F 4F0MA 2AF6A 5KFIA 3M30B 2BXJA 3LP0B 4WJBA 5HMZA 3FVYA 2Q1LA 4YN3B 2RQMA 4KT0C 4DV5F 4QCLA 1KD1T 2DIVA 4UQTA 4KHPF 3RUBL 4QW9A 2RDIA 4A8OA 3TUZC 1X4BA 2PEHA 3IR6B 1NDLA 2WSCC 3R6GB 3D9BA 1YDLA 3UD5A 4NL5A 5CZVA 1FEHA 3CCWA 1RT7B 1T94A 4ILMA 1GAOA 1X9WA 5AXKA 2J6TA 3HFZB 1RT6B
chains in the Genus database with same CATH topology
4NLXA 3DLHA 3BQ2A 2RDJA 3JTOA 3KLGB 3KHHA 2R9LA 5KFOA 3RRGA 2E1MC 3CCQS 2HHSA 5F0WA 3HF5A 3S6EA 1KEKA 4ID8A 1VQPS 3OPKA 3NAIA 2QFJA 3DM2A 3VAMA 1WELA 3QJJA 4O3SA 2CQ4A 4B08A 5I42A 2POKA 4TU7A 1IXKA 1FXRA 2EW9A 3DMJB 1HYSB 3PW4A 4ETXA 2MSTA 1KQKA 2IMOA 3CGIA 1GXUA 2KH9A 3PX4A 1TL1B 1NK0A 5J2MA 2JVRA 1NJIT 4IG3B 3DXBA 1S6QA 4I1TA 3H5XA 3IRXB 4AQYF 1OQ3A 1K1QA 1QVGR 4IFVA 2DHGA 4YB6A 1S1XB 4NA1A 4ZP7A 1YGYA 3TUJC 2F1FA 5E3QA 2R7QA 4DL7A 2BM0A 3V6DA 1S77D 4OHVA 1RJJA 2Q66A 3MM5B 4F2SA 3QGIA 3D0HE 4Y65A 1S1TB 1OIAA 3T5JA 4PKDB 4CT8A 1WF1A 4N77A 5HROA 2ALZA 2E1RA 4K5RA 1D8YA 2N4CA 4ECRA 2EI5A 3CE8A 2FGOA 2J5AA 1GH8A 2DNPA 2GIRA 2XEXA 3A8EA 5J2QB 2BM1A 4H4MA 5DDOC 1H38A 1YJVA 1CLFA 2JDJA 4JV0A 4BS2A 5I3UB 1S0NA 3HZEA 2IMWP 2KHCA 3HJFA 3H5SA 4CO2A 4J9PA 1U09A 2A10A 3HVWA 3IWXA 2I8EA 4I7FA 3LANA 4C8MA 3ZZPA 2F8EX 5KT6A 2HS0A 4RW9A 4OZLA 2OFGX 2N82B 2FVRA 2EKYA 1O51A 5D3GA 4JOUA 3LQVA 4Z2XA 2RRAA 1HI8A 4WIIA 5FD1A 3MDFA 2OPRB 3G6XA 4J5OA 4QIGA 4LIRA 4MK9A 5HBMA 4ZLPA 1LQ9A 1UVJA 3NNAA 3M2UA 2LEAA 1S0VA 2IRYA 3N5FA 4UQGA 2FLPA 4TQRA 3ETOA 5J2PA 2IRXA 2M7SA 2XBPA 1HNIA 2R2SA 2JEIA 1BQMA 2K1RA 3IAM9 1TKZB 2R7OA 4HDHA 4Z37A 4WK3A 4FBTA 2MZJA 1IUJA 4KGMA 4LFBF 2NQPA 1RTJA 2RB7A 3C66A 3VAJA 5JXSA 2J76E 4OZ0A 1S97A 2XB2D 1B0VA 1VGYA 2J7KA 4IQMA 3ZZRA 3TQ1A 1S6OA 2CPYA 4ZP6A 1T7PA 2CVEA 4GC6A 3OTDA 1V9OA 5GADU 3HHLB 4M63A 4EWTA 2ZHOA 4Q0BA 2AP6A 2HS4A 3MEDB 2W4CA 4CI0B 2DISA 1K0VA 2J0XA 3ENWA 2LQ5A 4ED0A 5AE3A 4WZMA 1HNVB 4B02A 1RI7A 2YKNA 2B7BB 2XWXA 5IFMA 3MD3A 4K4TA 2VOOA 1I6JA 2OTJS 4NCAA 3OUYA 5HMYA 4B9LA 2DHSA 2ROPA 1UEUA 3R5AA 3BGFA 1U1LA 3LAKA 4J37A 4RU2A 1U47A 2GA7A 3D2WA 1NJXA 1NEEA 5J1NA 1ZAVA 2CQIA 4TNOA 3P96A 2MB0B 3T5HA 4DMZA 2KYZA 1FERA 3W2VB 2E5IA 1UWBA 3MFIA 1OSCA 1KR4A 1P9QC 4EYHB 2GO9A 2UP1A 4IH5A 3DLJA 3NNHA 3ZZYA 4RUHA 4CO4A 1KFDA 4K4SA 1SH0A 3JAMY 5EHHA 1YBAA 2DTJA 2VV5A 4CIOA 5KFGA 4ECSA 1V3RA 4DQPA 2DNLA 1GQEA 5T7LA 1NNDA 4Y34A 2H9ZA 4GC7A 4DN0A 4JYAF 4X4NA 3BSNA 4QPXA 5IXUA 4R5PA 1UA1A 3LUYA 3K59A 3G8SA 3V4IB 3A1YG 1YRTA 2VL1A 2RS2A 4AL6A 2CJKA 2DO4A 1H2TZ 2PT0A 2HIQA 2IA0A 2UXDF 1J5OB 3KK1B 4H4KA 4K50A 5CYQB 5KFVA 3LWMA 2AD9A 2PFFB 2HQIA 3OXFA 2LVWA 4KV8B 1N5YB 3CEDA 4EFAC 4A8YA 1KC8T 4RNNA 5EGYA 3K5LA 2I5JB 1OPIA 4KAIA 3EX7B 1N88A 2UV8A 5K8NA 4IOBA 2DNGA 2UU9F 4OI2A 3WDOA 1HBUA 1XMQF 3THVA 1RT4B 2XI2A 4IFYB 4QWDA 1WEYA 2P9CA 3GQCA 3C6TB 1ELOA 5I42B 1T05A 2UUCF 2EBEA 2RD5C 4MK8A 4K4XA 1SV5A 5CCLA 5F8IA 1IKWA 2V8DA 1CVJA 1CPZA 3MPYA 4QIVA 1WI8A 4DQSA 3QJPA 2A1BA 2O67A 4URGA 1RTDA 2L3MA 3UE2A 2XMTA 1UVKA 1S1WA 3GIKA 3DFEA 2PN6A 1JLEB 1HMVB 3QWUA 3JSYA 1B64A 5LSRA 2MGZA 4DR1F 3Q8SB 2DGQA 1S79A 3CCZA 3BSAA 1C1CB 2ROEA 3PFOA 1VRUB 3HKZD 4LSNA 5KFLA 3TA0A 1SJQA 1GNKA 3MAHA 2XMJA 4FF1A 1RAJA 1MWZA 4TKTA 3CCVS 3HXMA 5K9FA 4NA2A 3E01A 2DCLA 5D77A 1O0PA 1RT2B 1FD2A 2XCPA 4ZVHA 3VAKA 1FNXH 4NZ0A 5K8PA 2Y1IA 1B7FA 2OPPB 1ZOTA 2YH1A 3RAQA 2YNGB 1ZYQA 1FNOA 3GWCA 2I1RA 2KZZA 2MKIA 3FNNA 3MTKA 4ED3A 3OL6A 2AX0A 2ZOFA 4RWWA 4R8UA 2FJWA 4FVMA 3US5A 5KFNA 2FHKA 3CIMA 3RW6A 1NJWA 4N5SA 5KT7A 2XS7A 2XY7A 2IVYA 2RILA 4C11B 3MEKA 2ZJQQ 1UVNA 4JI8F 4P7VA 1U25A 4O3QA 3KTQA 4F3QA 2Q43A 4KO0A 4PG5A 3SDEA 3LF0A 2YNFB 3OTBA 1UW4A 3L95X 4QYRA 4QU6A 1UFWA 2JEGA 2JFKA 1KRPA 4OI1A 3PZPA 3GG1A 4IH6A 1YVFA 2I0XA 2W9BA 4DQQA 4HLBA 4NOHA 4F02A 1NRKA 4N8NA 2XSJB 4DV6F 4KFBB 1NO8A 2MKSA 3DRYA 1LWFB 2JSXA 2CQCA 1S10A 2QMWA 4Y3CA 2KG0A 1S9GA 3PW7A 1Q8IA 1TKTA 1IBLF 3ONQA 2B3TB 2NYIA 1FVSA 4O3PA 2MZQA 1ULRA 4CO1A 2KJVA 4NLVA 4RWXA 2ZOMA 4Q2MA 3DRSB 2VOPA 1ZM2A 4QOTA 3T6BA 2VONA 5IT0A 1HFEL 1XMOF 1HBNB 1IKVB 2WHOA 2VB6A 2YKMA 3I5CA 2VKZG 2ASYA 4O3NA 4FF4A 1SL0A 3KNGA 1XC9A 4HL9A 1IKXB 5DDRC 4IRCA 1D9FA 1VIOA 5KG0A 2M8HA 2D9PA 2W4DA 5AXNA 1XNRF 3NMRA 1EETA 4P2SA 3N79A 5T14A 4LQ9A 1UJ6A 3NG8A 2ZJRQ 3K2YA 3E3XA 3OTOF 1HW9A 2M9KA 1N5QA 4TLRA 5A8KB 2A18A 1Y5IB 5L9NA 1X0FA 2JLGA 2CZVC 2VPXB 3I5BA 2K3IA 3OUYB 2MKJA 3I56S 1T03A 2LQ9A 4QBUA 1Q53A 1B0PA 4ZPWR 1Z2ZA 3JYTA 3EZ5A 5IS2A 4UY85 4K0KF 4G1IA 2RE1A 1LFPA 4ZP8A 5KFYA 3BF4A 1VC0A 1RT3A 3VALA 4EBCA 4W92B 2IVMA 5FDLB 4ZVEA 3T9ZA 4KR0B 2HNZB 3MCSA 1HR0F 1TR0A 4RW4B 1Q8LA 2R8HA 1IM4A 2DD8S 1DTQB 3KK2B 1U4BA 2C22A 3WX4A 5BYSA 3T6JA 1SJ4P 1L3VA 4TLQA 1RT5B 1C2PA 4WCEQ 1S6PA 2K7KA 4ETZA 3CB4A 4I2PA 3CDWA 3Q8PB 5B0GA 4NLDA 3NS5A 3PNIA 3TP2A 5KG7A 2MSSA 2QIFA 4LSLB 4NA3A 1T3OA 2HLUA 3MPWA 1X4HA 3N28A 4YR0A 3D1QA 1UKUA 4LVOP 4B3RF 1X4FA 1WNEA 1SI9A 1QVFR 2ZKUA 2ZDOA 5MAOA 2ZHBA 1R7IA 1WTFA 1C1BA 2KDOA 3NP5A 4H4OA 1F60B 4PG7A 1NK5A 3QLHB 5H9EJ 4IQXA 4RW6A 1HNZF 1VJWA 2KJWA 1M90T 2HNDB 4Q45A 1DLOA 4KRWA 5AE2A 4DSFA 2N7CA 5B0BA 4X62F 1X5OA 2N3OA 4TXSA 1N6QA 2MKCA 1BWEA