2WSEC

Improved model of plant photosystem i
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
81
structure length
81
Chain Sequence
MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWGGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure determination and improved model of plant photosystem I
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords AT3G54890
total genus 4
structure length 81
sequence length 81
ec nomenclature ec 1.97.1.12: Photosystem I.
pdb deposition date 2009-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF14697 Fer4_21 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2wseC00
1FXRA 4Y28C 4AYBD 2FJDB 7FDRA 1FCAA 3GYXB 2VPYB 1FDDA 3OR1A 2FGOA 3OR2B 1A6LA 1BC6A 5E7OB 3LW5C 2GMHA 3IR5B 4CI0B 1Y5NB 2WAQD 2O01C 1IR0A 3EXYA 6FD1A 2V4JA 1BD6A 4L6V3 1BWEA 1RGVA 3MM7A 5BYSA 1SJ1A 1FRKA 1FTCA 1DURA 2FJAB 1JNRB 1H7WA 2FJBB 2ZVSA 1D3WA 2XSJA 3IR6B 1KEKA 2WB1D 2VPZB 1SIWB 2GMJA 3IR7B 1IQZA 2WSEC 1GTEA 3OR1B 2Z8QA 1FERA 1GTHA 1FRJA 1HFEL 1SIZA 6FDRA 1BQXA 1FXDA 1KQFB 3MM5A 1FRHA 2WSFC 2UZAA 4XDCA 1GT8A 1H0HB 1FRXA 4XK8C 1FD2A 2V2KA 1B0VA 1H7XA 5CH7B 1XERA 3MM7B 3HKZD 2C3UA 1DAXA 1F5CA 3MM6A 1FRIA 3MMCB 3MMBA 2PA8D 2IVFB 1PC5A 3EGWB 4YDDB 1Q16B 1FRMA 4XDDA 7FD1A 3MMBB 1VJWA 3MMCA 1WTFA 3MM8A 2XSJB 2C3OA 3MMAB 5FD1A 1B0TA 4OV1A 1FDAA 2WSCC 3C8YA 3OR2A 3MM8B 1KQGB 1FEHA 1Y5IB 2PDAA 2PMZD 1FDNA 5CHCB 1AXQA 1FF2A 1C4CA 1R27B 3EUNA 2VPXB 3MM6B 1DFDA 5BYRA 1GAOA 2C3PA 5L8RC 1Y4ZB 2VKRA 1JNZB 1ROFA 2VPWB 3MM5B 3PNIA 4OMFG 4KT0C 3MM9A 2Y0SD 4DHVA 1C4AA 1JB0C 1Y5LB 2FD2A 1B0PA 1G3OA 1FDBA 3MM9B 3MMAA 1K0TA 2C3YA 1CLFA 1H98A 2C3MA 1F5BA 1FRLA 4RKUC 1PC4A 2FJEB 1F2GA 5BYQA 1G6BA 2C42A 2V4JB 1BLUA 4ID8A 2FDNA
chains in the Genus database with same CATH superfamily
1RWXB 4AYBD 2KH9A 3EPIA 2FJWA 1NB7A 7FDRA 1LWFA 3GYXB 3LP0B 2VPYB 3MTKA 3OFFA 3V5RA 3Q8SB 3CPWR 2GJIA 4TY8B 1Y10A 2EFNA 3C6TB 2WCXA 4RLEA 4CTAA 4JI0J 2X1AA 4ZPWR 2AHOB 2IM2A 2DH9A 2K3KA 2BACA 3E3XA 3F41A 2OEMA 5MLCV 4JI6F 1CQMA 2NZCA 3MUTP 1R31A 2GVDB 2LA4A 8AT1B 4NXMJ 2BW7A 3CD0A 2O67A 3FGVA 3FNNA 2I5JB 4ECUA 4DDFA 4F67A 2CAJA 4F04B 3QSYB 4ZOSA 3SI8A 1EX8A 2XS5A 2XMAA 2J9DA 2L9NA 2W24A 3W62A 1JMTA 1XJWB 4AQYJ 4YB5A 3CXCR 2CXEA 2ZZTA 5A0YB 2B9EA 2UV8A 3ZZUA 2F4VF 2M8DB 2DHHA 3VCDA 1R3NA 4C2MA 2N3LA 2IMWP 5HBMB 1PGZA 1TKXB 1UVMA 1VRUB 2Z2YB 3OFGA 1VJQA 2XGPA 3V4IA 2F4VJ 3FMBA 4NLPA 2OHDA 1FTRA 4RNMA 4YB1P 4B3OB 3BV8A 5GADI 1WJ9A 3J7AN 4ZP9A 5DM6Q 1CEZA 2V69A 5DG8A 3PFOA 1CULB 3BGFA 4G1QA 4JV5F 1TZ0A 2HMIB 2A18A 1K9MT 1UWBA 4J9VA 2DISA 2I9SA 2ATCB 3OR1B 3VTIA 3HXMA 4DR5F 4I6YA 3BS9A 1VQKS 3W8PA 5ADZA 3CDWA 2E9TA 5A6PA 3GCWP 4IG0A 5D0GA 4EU0A 2E5IA 2E5LJ 4DSLA 4RNFA 2VQEJ 6FDRA 2DXEA 2KXNB 1MWYA 4DJBA 2AQ4A 1WF2A 1T9XA 4ENOA 2D7SA 4FVCA 3G8QA 3J81Y 3L4BC 4EI2A 2ILZA 2DD8S 1GXLA 4AE5A 2CQ1A 1RWVB 3K59A 1N56A 1O6XA 1B99A 1VQOS 1MROA 1WKJA 5GMDA 4XK8C 4PR6A 1VQMS 2KL8A 3GJQB 4B9SA 2CFXA 1D8ZA 2YKMA 3A8IA 2LKZA 2PEBA 3DU5A 4ZHRB 1H7XA 1HR0J 5IOLA 2WVEA 1EAYC 2E66A 3CJ5A 5B0AA 1P1LA 3UQSA 4PKDB 5KFFA 4JI4F 5KFIA 1FRIA 4F4AA 4QWBA 2ZH8A 4ER8A 4DL5A 1R6VA 4Q8EA 2V6AA 1UETA 1V3ZA 4PG8A 2DRBA 1JLQA 2VFUA 2B51A 4RUAA 4X65F 3BEGB 1OYEA 2B5JB 2RUGA 4A4JA 1UA1A 1XMOJ 2YPYA 1GK8A 4DR1F 2BVZA 2J9EA 5CCMA 3OFEA 3TQ1A 1LW0B 3M2RA 3FSXA 3ENQA 3HLUA 3W2WB 3PKYA 1IBCB 2OMOA 2WSCC 2Z57B 2CVIA 1RUSA 3C8YA 1FK9B 1JXLA 4L3NA 1Y5IB 2EK6A 2FTRA 5T41A 1FDNA 4ZP7A 3CDAA 2VBZA 2VFVA 3HFKA 3QGHA 2HFNA 1NK0A 2L48A 1R27B 3A12A 4ZCKA 4JI5J 4CLTA 4NLOA 2AKWB 4TYAA 4DQSA 5JXSA 2RILA 3GR0A 5E2QA 5KT6A 4KKOA 2Y1JA 4RW7B 2ASLA 3KUHA 2IY5B 2C2DA 1C4AA 2XCPA 4CNZA 1WHXA 3AOCA 5LOQA 5J2QA 2BE7D 1NDPA 4HL9A 4PUOB 4X62J 3KOAA 3U7JA 4LBIA 4WYLA 1VHIA 3HHLD 3ZFVA 1CLFA 1FRLA 3M7VA 4E2FB 2EBEA 2ROPA 4JB8B 5KG4A 1AB8A 3D1QA 3UW1A 1CQNA 2W1BA 3O8WA 2E1PA 4KGMA 5K14A 4OI1A 1F2GA 3FVYA 3PIOQ 4KJIA 2RUSA 3G82A 1XMQJ 2BA9A 4OYXA 1F6TA 1H3DA 2QYCA 4TNOA 4ES3A 5GAEI 3TZXA 2ZE2B 3CJKB 2DNPA 4CLZA 2E1MC 4A8WA 1B7YB 3FMWA 1BQMA 3BPSP 4EK2A 2UP1A 4IRCA 2WHOA 1DTTA 3GWCA 3KLFB 3OR2B 1PYTA 1BHNA 1PJ6A 5KFCA 4U95A 3EGZA 3FCHA 4NMXA 1Q86T 1OQ3A 4LF6J 2XWXA 3J7YI 2EVZA 2J6SA 3RR8A 1IVZA 1ZM3A 4X64F 3BSNA 3FUYA 3MR2A 1DARA 1Q79A 2ZNZA 1RLDA 2WTFA 4RBVA 2NREA 4LT6A 4WTYA 5KT4A 4DR6F 3CJ3A 4M8LA 4CDIA 4OZ5A 3OVBA 3BM7A 1SQGA 2ZWOA 3D4JA 4Q0BB 2NZ4A 2H65B 4ECQA 1XBWA 3JTOA 1TK5A 4AD6A 3W5ZA 2YKOA 2VZ9A 1WHVA 1S97A 2W4PA 4TVAB 3MCSA 3VGVA 4WKYA 3H5UA 4FZVA 2FJBB 2SXLA 5KFPA 3QBCA 5L38A 2OPSB 4MKVA 2AEFA 3M05A 5KFJA 5KFHA 2YWWA 3M6XA 2BANB 1NKCA 2R7TA 5D0HA 3HK2A 4DPWA 4NMLA 4YDXA 5CZXA 4FYDA 1SIWB 3IR7B 1UVNA 2AYEA 2H3EB 2WSEC 2C2KB 1QVGR 3L7UA 2ZM6J 4ZVOB 3NGKA 2MSTA 3MAQA 4DV4F 3EVWA 4ZCIA 1XNQF 3I4HX 1S77D 4I2PA 4C9DA 2M3DA 1WC1A 1EKRA 1RQ0A 1UVLA 1P27B 5KFEA 3RB4A 5IQQA 3DU6A 4ID5A 3PIPQ 4JI6J 3SCJE 2B4OA 3HT3A 2UVWA 5LMUF 3MM5A 2PMWA 1T3OA 3NBPB 2Y1LB 2GIQA 4F26A 3OJSA 4EBCA 3ILIA 3J80Y 3TAQA 4ANDA 1SI9A 3FFIB 4ZN3A 5D4PA 5C2CA 4J9UE 2VQEF 3UVJB 2UUAJ 4DN0A 1K44A 3ZC4A 3RRGA 4WP9A 1U09A 3UR3C 3OVSA 3WBZA 1KOOA 3A3PB 3PHEA 4N47A 1B7FA 4K5RA 4DPXA 4J37A 2DGWA 1JLBB 4L75A 4EO8A 4ZCMA 1RTDB 2E9RX 4OX9F 3TNVA 5KT7A 2ZM6F 1O8BA 1BGXT 1FKPA 3PXGa 1E6YB 1TL1B 1WEXA 2VDHA 2YNFA 4DSFA 1RTDA 2R7SA 2GQQA 1RKJA 3CCJS 3C6TA 3KJQB 4Z37A 4GKJF 1KHVA 2O66A 5KFBA 5EUHA 1KC8T 4ECXA 2MLZA 4RBTA 2VDIA 1E6VB 3HVRA 1AXQA 2MEWA 4Y2KA 2QFJA 5D3GB 2X3GA 2CQ0A 3K0JA 3ISZA 2HNYA 5K9FA 4B9MA 3R1LA 1S1VB 1WEYA 2WBMA 3CJ2A 1AYEA 4ZLLA 3K58A 4DPYA 1Y5LB 1X4HA 2N3OA 2UUCF 1N5QA 3PX4A 1VQNS 3JSMB 1IJEB 1VC6A 1YJRA 4DQRA 5A8WB 1PJ5A 2X51A 1HWLA 1TKTA 3C14B 1F5BA 5DGAA 3BO2A 5DLFA 1C1CA 3GTYX 1HBNB 4ED8A 1ACMB 1L3TA 2GNKA 1LW2A 1HMVB 4KFBA 4QR1A 1Q5YA 4USIA 4B9NA 2HSEB 2K3IA 4ZS6A 5THWA 4JV5J 3ZZPA 5KG7A 1FXRA 2EBGA 1IJFB 4DV2F 2B4UA 3GE9A 3GZ7A 4P9SA 1D9DA 2WB4A 3OBIA 4OLPA 1KLNA 2DBBA 5KOXA 2VH7A 5KG2A 3OSPA 3PYGA 3MCMA 3RRHA 2R3VA 3POTA 3HKWA 2KXHA 2Y1RI 5DRKA 2R4FA 3VWSA 5B0DA 3KHHA 1N4LA 4MKYA 1X4DA 2HQ3A 1HIYA 1XTZA 2LXIA 1IBLJ 3KMQA 1R43A 3TOQA 2AP6A 1IWGA 2CKWA 4DFPA 3R7BB 1HD1A 4ZVGA 2XB2D 2KG0A 4HKQA 5H9FK 1RAIB 2G0CA 5KG3A 1NUEA 1RTHB 1ZOTA 2JEGA 1S1XA 1KLMB 2QA1A 2KYZA 3CIZA 4P71A 2K1RA 3MM7A 4F7VA 5M2UA 1SJ1A 4B9LA 4DR4F 1FTCA 1JLAA 3MD3A 1S9FA 1IQTA 4CO0A 4M94A 2B9XA 2CPZA 2H1YA 2IAJA 5L9XA 4B3TJ 3WDOA 4LSNB 1T9UA 4LRFA 4WE1B 4ZVSB 3HHNB 1P9YA 3BH7B 3I5BA 4M5DA 2MGZA 3VQSA 2ZHAA 3L3CA 4X4PA 2NCKL 3SYZA 1TKDA 3P96A 1XIQA 1N48A 5HLFA 4NXNF 2DNHA 5F8NA 1Y00A 2EKNA 3D3BJ 2FUG9 3FSYA 4ZVFA 4TQRA 1QDUB 1RCOB 3KLHB 3H42A 3OTOJ 1U47A 3BKTA 4MFBA 4K4ZA 3AA8A 3AD9C 4UZCA 3JYTB 4AQYF 1SIZA 4PZVA 3T5JA 3Q8QB 3B6BA 2AGPA 4JYAF 2E5JA 4O3PA 3OSNA 1Z1ZA 4GO5X 3MAHA 2FVCA 2XI3A 2CPXA 1RHUB 3RRKA 3B4MA 4W92B 5KG0A 1ZM2A 1X5TA 4P2MA 3O2IA 2MZRA 3FBCA 3TA2A 1HQUA 4WZQA 1YJTA 3M8WA 4MIBA 3RTVA 2ZJPQ 2YQ0A 3AOBA 4K59A 1B0VA 2GVDA 3HCXA 1YQHA 3AOAA 3HD2A 5B0BA 3DLBA 2QSFA 1N5VA 5I3UA 5HQLA 1HWUA 2C3UA 5GAGU 1F5CA 5D4OA 1UCNA 3I0RB 4K2JA 4ED6A 5AT1B 3NP5A 1QE1B 3S7RA 4A8MP 4R0EA 2IPOB 2IVFB 1PC5A 3OTBA 2FLLA 2V50A 1S1WB 4C3MA 2DIUA 1H38A 7FD1A 3OUYB 4K0KJ 3MCOA 2WVFA 1WTFA 4I68A 3K5MA 3JSMA 4U7CA 4ZLPA 2XSJB 3W9JA 4CLLA 2E9ZA 1JXEA 1PCAA 1S4FA 2JZ5A 2ZKUA 4ZP8A 4EGLA 2E5HA 2P2CB 2ZVIA 5RUBA 4YY3J 4X2BA 3OXFA 2PMZD 1FEHA 1TU0B 2YKMB 3GMGA 1VQ9S 4I2PB 1TV6B 2RS8A 5CXTA 1OY8A 3H98A 3AY0A 2QT7A 2VA3A 5L9NA 2ZH2A 5L46A 4DF4A 2VG7A 3NAHA 1R8BA 5A2QU 1WC6A 1S9EA 3D6MB 1NB2A 2R9LA 2HBQB 3DI6B 3LPEA 7AT1B 3LO3A 3TEGA 4CLFA 4QCLA 2ILYA 4KHRA 2OPRA 5C42A 1R89A 3MMAA 3QWUA 2RRAA 1U45A 2BMBA 1EHWA 2VC0A 1EQ0A 2DH8A 1KOHA 2KI2A 2QZ8A 4IG3A 2RDIA 1S76D 3ZZRA 3M9OB 1Q4RA 4QQBA 1LFWA 4OI6A 1RB0A 4DR7J 4EZ9A 3TZZA 4C0BA 2ZEJA 4A8SA 1QJHA 2AYMA 2CQ3A 4LIRA 1HNXF 1W25A 5F41A 1YJWS 2VG6B 4PWDB 2HW3A 4TY8A 5KFVA 4CIOA 4BWMA 4Q2MA 2GC8A 3M8SA 4JI0F 1NM2A 1FCAA 5EGYA 1U1OA 3GIRA 2IRUA 3CMQA 1Y9OA 4K2XA 3CO9A 2P9CA 3QATA 3D9BA 4DL6A 1RTZA 1YVFA 1BC6A 3AD8C 4NRUA 4NZ0A 2L9DA 1PYOB 5ETQA 1U1PA 1IBMJ 4B9TA 1TVRB 1U1RA 1UA0A 3T1YF 2JWNA 4ITSA 1FJ7A 3AHPA 3CJSA 3TA1A 3KLEA 5E7OB 3LW5C 5B08A 2P6TA 3IR5B 4X65J 3E01A 4E8UA 3C15A 1UL3A 2MMYA 2VB6A 3M32A 4ICLB 4CLPA 1JJHA 4N76A 3EXYA 2FHMA 1PYSB 1GFWB 1X5PA 1LWCA 2CPFA 4IO1A 1BD6A 2V63A 2NXNA 3A13A 2OMLA 4JBCA 4NLTA 4P7TA 3OVAA 3PG9A 5E3QA 3GFZA 1M1HA 2I5JA 5F8JA 5HK4A 1J5EF 1CC7A 5ETTA 1IKXA 4N7TA 1DLOA 2QLJB 3R3TA 2HQGA 4DCOB 3CCRS 1KN6A 1GXTA 2UU9J 4M5MA 4C97A 2D69A 4DV0J 1FWPA 3QLHA 4B3OA 4CLUA 3HVWA 3M8PA 1HQEB 4K8RA 2DPIA 3BGOP 1CJTB 3S1TA 5DG7A 3NNAA 3BGRB 2VOPA 2GIFA 1U8SA 1NHUA 1UAWA 2WB1D 4YR3A 1I3OB 2V2ZA 5IT9U 3DRRA 3H90A 4MK8A 3D5MA 5T7LA 2CJXB 2WVCA 3KUEA 4O3QA 4LFCJ 5G4DA 1GTEA 1U0SA 4QWDA 2OKQA 4WWSA 3CTRA 2RU3A 3CCZA 3AJ2A 2HPUA 2F8EX 5DDRC 1BWVA 2DXFA 3UD5A 3J7A1 5F9LA 4URQU 3IS9B 4KHPJ 2C22A 4KPYA 1S99A 4P7VA 3M2UB 1BQXA 4IDKA 3CMAS 1S1WA 4KGXB 5AXKA 2YWEA 3ENAA 3KDNA 3AJDA 5KFYA 3UFCX 1I6JA 1HYSB 1NRKA 2IFXA 3CDUA 2DR6A 2ZH9A 2BJ3A 5F8HA 2OSRA 3H2VE 3M2RB 2CYYA 2UZAA 1SV5A 3OTCA 4ZPDA 2MZSA 4KO0A 2K7KA 4ZVQB 5J2NB 2ASYA 1H0HB 1SC6A 1UW4A 5KFWA 1OPIA 1RTHA 1S10A 3PYDA 4FP9A 3TUJC 3TARA 3M30B 4MYUA 3VVUA 2EFGA 1TFWA 2A1BA 1S6PB 2PD1A 2DNGA 5CYMB 3OXLA 5GAEU 1AROP 2B4VA 2HGLA 2RF2B 2RKIB 3H20A 3MM6A 4H4KA 4OJ3A 4ZJOA 3T6JA 4RU9A 2JHEA 3CF5Q 3VAFA 3A3OB 4LF1A 5BR8F 3AJ1A 4M1KA 5HO4A 3T1YJ 1CVJA 1Q0NA 3KFWX 4YDDB 3LWLA 1LQ9A 3RAQA 2F4FA 2EXUA 3KLVA 1J27A 1V5IB 2EFQA 1JLFA 3KNGA 5CYQA 1DQ8A 1SL2A 4PUOA 1S48A 1AUSL 1ZA2B 2LA6A 3MM8A 4WXWA 3KMSA 2C3OA 3JS9A 2B9YA 1B0TA 1PAEX 5FD1A 3R5JB 2W2OP 5J1PA 4R5PA 3HF5A 2HS0A 1YG0A 3PEHA 1C0UB 4HDGA 2OUGA 4DFJA 3D66A 1Q8IA 3TA0A 1XR5A 4NLSA 3NOGA 4IG0B 5CHCB 1NU4A 3TZWA 3I32A 4IDKB 4EYHB 1DFDA 5B0EA 5BYRA 1K0VA 3ZTQA 1Y4ZB 2VKRA 2MKKA 1RT4B 4P72A 3TJAA 2YQ1A 4H4KC 3FK4A 2V8VA 4R0JA 4TU7A 4KR0B 2I1RA 1X4FA 1NMEB 3VVTA 1IUJA 1HBOA 2K1RB 2B3TB 3IA0A 3VAKA 1VBYA 1U2CA 2APOA 3QIPB 3HI9A 2AJ2A 3MECB 4JOUA 5ETNA 3MUVP 1W26A 3O1LA 2FIUA 2G1HA 5G0RB 3PR4A 4DV7F 1U1NA 2MKSA 4DPTA 2N82B 2UUBJ 1B70B 2ZBQA 3RW6A 2B7CB 2JLFA 3AFGA 4FF3A 3L9ZA 1XR7A 2C42A 2IA6A 3HM9A 4DLEA 2CNLB 1RDRA 2GGPA 1VISA 1OYDA 3EDQB 4NI2B 3R8YA 1ZZNA 1P9QC 4DCPB 1JXVA 3IP0A 1U1MA 4K4XA 4C98A 4Q5VA 2DNMA 3V2UC 4I64A 3W5XA 2CVEA 5KOWA 2BJEA 2FZKB 3BH6B 3ADAC 4X4UA 3DLEA 2J5AA 3HVTB 1HQEA 4P74A 1SV5B 1FESA 3W64A 2Y1IA 2KXFA 4WU2A 1U49A 1UVJA 1C0TB 8ATCB 3LAMA 2VA2A 2RRNA 1VHFA 4QWCA 4PYAA 4USVA 4ETZA 4YS2A 4DV1J 3NCRA 5EDWA 1BUXA 2V4JA 3A8JA 4NOHA 4QPTA 4UY8T 2AGQA 4RJVA 5CABA 2QC3A 3DXBA 4OFZA 1OMSA 1FRKA 1KDNA 4Z2XA 1UVKA 4C4WA 4ID5B 3D2WA 3CCES 1YDLA 2QLBB 1XMOF 3PACA 5IT9Y 2BBEA 1HD0A 3ZXWA 3RR7A 4TLQA 3DOKB 4CP5A 2G0IA 1KFDA 4DX7A 3J7ZT 1ZM9A 2VPZB 1IBKF 1R7IA 1GEHA 3THTA 1R8CA 2QIFA 2CQBA 2WRMA 4ZLNA 1F60B 1Z2ZA 3KLFA 4RW8B 2DY1A 4Q2LA 3GFHA 4F4XA 2QL7B 4LRDA 1U1KA 4DQIA 2QG9B 5KFDA 3N4WA 4ELUA 2J7KA 2NUHA 2NYIA 4OZJA 4USHA 3TX0A 4F4WA 3T5HA 4IR1A 2XNRA 4DPOA 3KLEB 1WSRA 4RU2A 1RTIA 2KT2A 4H4OB 1T11A 3MPUB 4KH1B 2JEIA 2PFDA 4MK7A 3T6BA 2OP5A 4MKAA 1F3VA 1ZTWA 4PPZA 2HHWA 2XO6A 4NEZA 2JL9A 4C11B 4QWAA 4EEYA 1KKHA 5SUHA 1X4GA 2DK2A 2HQDA 1EIYB 1B4SA 1FKOA 4RNNA 1V5VA 2B9WA 2GX8A 4ZJLA 4OYWA 5AXMA 2W9BB 3I9ZA 1S1UA 4P73A 1EARA 4G6VB 5IWAF 4HT5A 2FZGB 5HI7A 2FVSA 1F9EB 1J5OA 2F3JA 4V1Ak 1PKUA 2XLKA 1KP6A 1P1TA 3PDNA 3PW5A 1AW0A 4DWIA 2KTQA 4PXBA 1T9VA 3PJWA 1L3VA 3RU0A 3TYTA 2VQFF 1BXNA 5L1LA 4OV1A 2J0WA 5KFSA 1N5YB 2G13A 3FBBA 2M7SA 2HHHF 2PIIA 3D6HB 1TR0A 3PW4A 2PE8A 3VGSA 2J6TA 1S4EA 4K4VA 1QUPA 2UUAF 4MAKA 2JFKA 1QAYA 1YJUA 2HFUA 3MM5B 5DZ7A 1JLQB 2LECA 3MM9A 2HFOA 4LRBA 1IR1A 2J76E 2QE5A 4EYIB 1S7IA 3HZEA 4L3KA 2AZ1A 3MM9B 5K8NA 2JNJA 4ES2A 1EQMA 1RU1A 5GAHU 1H98A 2DKOB 4CWBA 3IBCB 4ZJQA 2BYCA 4F4YA 1HI0P 4FN5A 2XY7A 3UDEA 3Q8UA 4O0NA 2LMIA 1RT6B 1SXLA 1IKVB 3GV5B 3AB4B 3SFUA 3IFEA 1R8HA 3BGRA 1HPZB 3SQGA 4DEZA 1RAFB 4N56A 2AIRB 3KHGA 4ECZA 2HGNA 4IRKA 3NEKA 3TAPA 3P49B 5K8PA 1X5SA 2FDNA 4OLOA 4Y28C 2V8GA 2NPIA 2WW8A 2MZJA 3GB0A 3IG1B 3LP2A 4RNHA 4TN2A 5FDLB 1RKIA 3BR8A 2XI2A 5F3TA 1VR6A 1GQEA 5DZ6A 4AL7A 3UR0A 3HPOA 3TAMA 3EVMA 4ANEA 4F36A 2XNQA 5DG9A 1SJRA 4DL3A 3K17A 1XNRF 2B7BB 2E1RA 3AA9A 4LSNA 4O4RA 1RHRB 2ZHOA 4M5IA 1DJ0A 1YHQS 4LSZB 5IC6B 3H4DA 2KKHA 2GMHA 3I5CA 3VAMA 1U6BA 3HDSA 5AXLA 2VBYA 1ZZFA 3JSBA 1KD1T 1HNXJ 3KHLA 3BKUA 1K1QA 3F56A 2Z30B 3QGIA 2ZH7A 2ALYB 4L6V3 2RH3A 1HBOB 1HNVB 2HAIA 3DRPA 1X31C 2GQCA 3Q8VA 1U2FA 4PWUA 2XYGB 1YZ7A 5KFNA 1NAQA 4NLUA 2Z56B 1RK8A 4KTQA 5IXUA 2XSJA 4Y3CA 3GP9A 4CO5A 3JAMY 3D0HE 2OPQA 1FEEA 4Q45A 4J9LA 5HATA 1S1TA 1MWQA 2BJ7A 2KO1A 5IQ6A 1Q81T 3NS7B 2NPFA 2IYGA 4KHPF 1BQNA 3QGPA 4NX9A 1NJYA 2W25A 2YNGA 4ICLA 3IG1A 2PFFB 1IQZA 3D67A 2QLFB 1NKBA 4C8ZA 1QUVA 2QGFB 3I0RA 2J7UA 2DR9A 3GFYA 5HVGA 2UXDF 2KFZA 4C8NA 4QW8A 3EGVA 3M4XA 2HHQA 1M1GA 2YNIA 1S72S 1HI1A 2Z2ZA 4N77A 3NY0A 2GQ2A 4JV0A 3UD4P 3IC1A 2I8EA 3H5SA 2ZUGA 2KB2A 4X66F 1FT8A 1S6UA 2BE2B 1N32F 1VQSA 1U0HB 5KFMA 1GT8A 2BW2A 2CQHA 3L09A 3DYAA 4LIWA 2I2YA 1Q8BA 2YWKA 4OI4A 5DDPC 4IUFA 4DR6J 2YNHB 3LGHA 3N6LA 3T3FA 2HHHJ 2V9WA 3HSJA 5F0WA 4FKYA 5H9FJ 1T94A 1HA1A 2A2CA 3BDPA 3I56S 2QV6A 3MOJB 4LQ3A 3ISND 2LEPA 1P8GA 1DHMA 2OFHX 2GHVC 4J7CA 2MQOA 1RT1A 4HDHA 1M5PC 3EGWB 5KG5A 4LF9J 2BOAA 1Q16B 2MKYA 2MYFA 4M5DB 1FVSA 2HK2A 4UZBA 2YWHA 1KVIA 4I6WA 1WG1A 4HR2A 4J9MA 2OPQB 3VZIA 1YBTA 4WK1A 2D9OA 4P2FA 3H2LA 3E01B 1KQGB 3C15B 3IO1A 2LXFA 3M32B 2GAGC 4IFYB 1ZAVA 3DRRB 4AXJA 5E41A 4R5PB 5GADU 4YHHJ 2CJKA 3JYTA 4OZ2A 3GG1A 4DQPA 3HSZA 4P6QA 2CNNB 3DRYA 3EDRB 4QW9A 5IWAJ 3KLGB 4ZPTR 2AJ1A 4WF9Q 4U8YA 2YWFA 2MSSA 3N28A 5A8RB 4NCGB 2B6AB 2HWIA 4LJMA 4UT4A 2LQJA 6AT1B 2L08A 4WK3A 1RE1B 5KFOA 3BZQA 4J9SA 1VQ4S 1VQ8S 4IKAA 1ZA1B 4BLGA 1GMWA 3BDEA 1TUVA 2XQCA 2WVBA 3NWGA 3O6QA 4DR3J 4PCQA 1PC4A 1YJVA 2OPSA 5D4NA 5KFAA 4BDPA 2NXUA 3S6EA 4IQXA 4LFBJ 4QIEA 4KRWA 1RWNB 3GYNA 3Q89A 2BE9B 4OZ0A 4UUXA 4Y2AA 2I6WA 3VGTA 3LWMA 1XNQJ 4K4SA 4ID8A 2B8QA 3DRPB 3JQJA 2DHGA 2J0XA 3G82B 2E1AA 2DJWA 1RT1B 3M2UA 3N01A 4ZVEA 3T41A 5HJXA 2JC1A 2LFVA 5DLGA 2J9DE 4I2QB 4ZVPB 4AXIA 2YPZA 2XEXA 5FJ4A 4P2SA 4CO2A 3HFZB 3LPYA 1LKZA 2MQ8A 5EN1A 4CT8A 3CIMA 1UKUA 1XMQF 2DHSA 4ANCA 3MTJA 4QR0A 5ETLA 2NR0A 2OJ3A 2HRYA 2Z2LA 1S6PA 3PCOB 5KTQA 4Y6IA 4NXNJ 2XZWA 2IVMA 4UOFA 4ZVTB 3DRXA 4DV3F 2VASA 2R8IA 4G65A 1LK7A 3ILLA 1UEVA 4NA2A 5EX0A 3X3UA 1V9OA 1QY7A 2ZE2A 1REVB 4FVMA 3CJKA 2DRDA 2HHVA 2DEIA 1JNRB 4LF7J 4YP3A 1F3FA 3AQOA 2J0QD 2ZVSA 5E3PA 4U6PA 4LF7F 4KBIA 3ITHA 4X66J 3W2WA 2DNRA 4KE5A 2WZ1A 3GJSB 1JLEB 3AXKA 1X4EA 2L3MA 4PEOA 3T1HJ 5M2PA 1NK4A 4USWA 2ZC4A 1FJCA 3MI7X 3PW7A 4U8VA 3PTWA 4Y2CA 2DO4A 2YBVA 3AODA 1U25A 5D8HB 1NSKL 1M5KC 3D0IE 4OL8A 4NCBA 3QJPA 1RAAB 2YH1A 2GO8A 1EETB 2CQPA 3IMQJ 2M9KA 3BR9A 1PILA 2QEXS 3SZ2A 4P2XA 4ZN1A 1JX4A 2YX4A 3RUBL 3OV7A 2RHQB 2HBZB 1HNWF 3OXGA 4Y0FA 2KVQE 2IA0A 2V94A 2XCAA 3B82A 3RB6A 1JLBA 1WUUA 3M8YA 1UPPA 2E44A 2BDPA 3UD3P 4LFCF 1V3SA 1E6YA 1TL1A 2YNFB 2N4CA 2MQNA 3M1VB 4UOCA 1Q7YT 2EKYA 1Q5VA 1UPMB 1FA0A 4F4KA 2XM3A 3LGMA 3UCGA 4DL4A 3SEOA 3FC9A 5FLXY 3NBPA 4B3SJ 2CNOB 4ED1A 1T05A 1F1BB 4C8OA 4YB7A 3GPAA 1VIOA 2HGMA 2RNEA 4RWWA 2KRRA 5C5JA 1HQ2A 5JUMA 1RWOB 3D0GE 4JI8F 2B4PA 2IRXA 1VK3A 1WOPA 1VOMA 2D3ZA 4ETXA 4TQSA 3A4TA 3MR6A 3D3CJ 3D6FB 1N33F 4Q8FA 5EX3A 5HP1A 1SC1B 2EWHA 1I5OB 3BGUA 4RW4A 1CBKA 1NH8A 3CE8A 5IFMA 1CPZA 1RAJA 3A1YG 5DGBA 1R0AB 4KT0C 4JI4J 3FDSA 2MKCA 3NXZA 2BX6A 4HI2A 5F8IA 3OL6A 2ADBA 2JFDA 2CPYA 1JB0C 2KYXA 4Z7CA 1XN9A 3G6YA 3MFHA 4J9OA 2KFNA 1NSQA 1ITPA 3KJVA 1UJ5A 1TKZA 4MH8A 3NGDA 5CCLA 4ZMMA 2DIVA 2LQ8A 1X0FA 3IWXA 2FJEB 3ETOA 3R5AA 1Y7PA 1K1SA 3MAAA 1KQKA 5BYQA 1G6BA 1FWKA 2DGXA 2FQQB 3DDNA 3P5BP 4Y2IA 3Q8YA 1SC3B 1BLUA 1NNDA 2ACYA 5I3QA 4XIUA 5DM7Q 1LOUA 1FFSB 1IXKA 3DDKA 3MURP 2FJDB 3OQ2A 1VBKA 2HMIA 2HLTA 2F65A 4I1TA 3KXDA 4OIXA 4OYOA 2NXJA 1WI8A 2IMOA 2BKPA 3KJNB 3ZNJ1 2XTJP 5B0CA 2POKA 1RT7A 3HO1A 2VFRA 2IJFA 2Q66A 1RU2A 1CJVA 3TRGA 2E29A 1GMVA 1S12A 3C16B 2A6OA 4CO4A 2OI2A 1OSCA 1JKHA 2H4WB 3QSIA 4EWTA 5F8GA 5GAGI 2ZHBA 1R0BG 2GAHC 1GX5A 1NK6A 1Q78A 1T9TA 1RT5B 1Y11A 4QOTA 1I94F 1QSYA 4KGZB 3SCLE 2LVWA 5DDQC 3D7SB 4O3SA 4LSLA 4R8UA 3PKMA 1TAQA 2MLXA 3I4PA 3U1LA 2BOPA 2BEFA 3DKDA 5KFLA 5KFRA 2NXEA 2VFTA 3Q83A 2WBRA 2XMUA 1LWEA 4NZ7A 4YN3B 1T9YA 2CQ4A 5HMYA 5F8LA 4K4UA 2P6SA 1GMUA 4P10A 2F9DA 4NLXA 2KFYA 5JVHQ 1VLYA 1SL1A 3NNHA 3O44A 4RW9B 3O5TB 1TL7B 2CQIA 1VC5A 3H5XA 1KEKA 2Q79A 3FEZA 2GZOA 4O44A 3UVJA 4ED4A 1SH2A 4O0IA 4B08A 2YX1A 4OX8A 2ZOMA 5LXRA 2F1FA 1HWJA 3CULA 4QIVA 4J5OA 1FFWB 2A6MA 3T9ZA 4IO9Q 4ZPAA 2BKOA 1DTQA 2MJUA 5DQGA 4LF5J 1FERA 1UFKA 2CQDA 3NOCA 4NWBA 1M1KT 1KVJA 3CD7A 3QZ7A 1QSSA 3K89A 1RTIB 1MMDA 3C46A 1UFWA 1M0SA 1SQFA 2N7CA 1JQGA 2BJDA 5B09A 3QJJA 2EC2A 4F0MA 2JVRA 2XO7A 3Q8RB 4LQ9A 1X0PA 1KS2A 2OPPA 2MTLA 1H6KX 3FZBA 1OS5A 4MMOA 2MY8A 5HMWA 2OELA 3CB4A 1RT6A 4JI8J 2IJRA 5CH7B 3EM1A 1U7LA 1WG5A 2CJAA 5HP1B 1XC9A 3R5CA 2ALZA 5I42B 2J6UA 4EZ6A 1WELA 3DLGB 1HHSA 3DOMB 3ISNC 1PAUB 2CJ9A 2VBWA 2UXCJ 1Z4UA 5F9NA 3QT7A 4YB6A 4GVBA 3KK1B 5L1JA 2J9CA 4B3RF 2HBYB 4FF1A 2QMXA 2XHCA 3POTB 4WBFA 3UO0A 2HHPA 2MQPA 3RAXA 4ZLJA 4DR4J 4B3TF 3Q2TC 1HBMA 3IAS9 4NASA 3OUYA 2R2TA 2V8HA 2FJVA 3F44A 4XPCA 4OZNA 1IR2A 1SPBP 1RBOB 4O4GA 4CLWA 4LF4F 2ZH1A 4DBQA 3V81A 3PY8A 4DFKA 2HVIA 2HNZB 2KZMA 4FF4A 3OHAA 3CCLS 1K47A 2U1AA 3UN5A 3CO0P 4CNYA 4NEYA 1RTJB 2RQKA 2EEYA 4HHHA 3FCVA 3R1HA 9ATCB 3R2DJ 4WZMA 3W65A 2J7WA 5K8OA 3CCSS 1ELOA 2IHR1 1TL3B 3UN3A 2R7VA 1FDBA 5C25B 2DGQA 4MIAA 3P6YC 2AJFE 1U0HA 2BJ9A 1MMLA 2O1PA 2DGSA 1FKOB 2IRYA 3FZ2A 3TI0A 3WC2A 4PG5A 3TJ8A 4G1QB 5KFZA 1U6ZA 1IKWB 3DGPA 3DXSX 3GIMA 3HZGA 1RT2A 4P75A 1FX4A 4ZHRA 3R2CJ 5CYJA 1RWKB 3G6XA 3G8TA 4WFNQ 3B78A 2C2MB 2Y8YA 3SCIE 2ZD1B 1NH7A 1ZM4A 3PRBA 1VQ6S 3UNYA 5HL7Q 1SKRA 2WOMB 2M70A 4CLSA 2W4DA 3RBZA 4URGA 3HHDA 4MT1A 2V5HG 1UZDA 4I67A 1C2PA 1N6QB 2RE1A 1RJJA 3NS5A 1IKYB 3THVA 3MDFA 3QWPA 2Y3YA 4C3KA 2BZ2A 5B0GA 2KHCA 3GU0A 1NHKL 1WDDA 2F40A 2R8JA 3H25A 5AE2A 4FXVA 3J7Z5 1N88A 4DV0F 4LF2A 4CI0B 1Y5NB 3CGIA 2WAQD 3OJUA 5J2NA 4UOGA 2JVOA 3RGIA 2C2RA 1UWAA 1FI4A 2HK3A 1WC0A 3KK2A 1VIXA 1LXJA 3DMJA 3ET6B 2UVUA 3KG4A 2XYPB 3VF0B 2VQFJ 1RGVA 4B02A 1T02A 4YHHF 1WC3A 3R5GA 3HHLB 2GV1A 4DSKA 2FJAB 2K06A 4A47A 3OW2R 3SV4A 1U1LA 4OX7A 1N0UA 3GSIA 3OLAA 4KHMA 2A0FB 2BE2A 1HI8A 2ADCA 3MMJA 4KH0B 2PC6A 4NLRA 4IH6A 2AX1A 2AD9A 3BSAA 2FHJD 3QLHB 2BQUA 4I7FB 3C6UB 4LREA 1WSVA 4EBEA 2QRRA 3JQMA 2BXJA 4AUKA 4RO0A 4Y00A 4RUBA 4IOCQ 4LFBF 2Z8QA 1EB0A 2HQIA 3CJQA 4KGVB 3UE2A 2VIHA 1V6HA 3BREA 2P9GA 3NAIA 1IKXB 3SQOP 2XHWA 4HT7A 4CH1A 5L1KA 5K5MA 4OHZA 2EFPA 3AQPA 3D1OA 1KQFB 2UV8G 3V4MA 4CO3A 4NLWA 4RW4B 1QAJA 1GX6A 1F9HA 3UCUP 5DQIA 4A48A 3CCQS 3X1LB 2IVYA 3EPGA 1RT5A 1YJ7A 3HT0A 3RAMA 4MIWA 1G4CA 2GA7A 4QR2A 4RWXA 3W2VB 2QA4S 1KQSR 1FD2A 2FYXA 2QTWA 2QO3A 3MEDB 3OL8A 2ATLA 2HHUA 2R7XA 1URNA 1JJCB 2V2QA 1WKLA 3K2YA 3N6MA 3DDIA 4DN9A 4HYKA 1YIJS 1HNVA 4JI7F 1OY9A 4S0MA 3GIJA 2E7VA 4WYWA 1W2IA 2J8AA 4A8XA 1SQEA 4PWDA 2XMJA 1JLFB 1X5OA 5CYQB 4WU3A 2C2NA 1RBLA 2YKPA 4X4SA 2V4QA 3PRVA 4I2QA 2HHXA 3GG0A 5D15A 2HQFA 3U27A 1QLNA 5CQGA 1VJWA 2DTJA 4ZVRB 4EMDA 4FNIA 4LBPA 1G1XA 1BQMB 3MMAB 2R7WA 1VBZA 3SFGA 3TP2A 1EP4A 4F3OA 4PABA 3OR2A 5ITHA 3BJYA 3SCKE 4WFBQ 3BQ0A 2XWYA 3VAJA 2DH7A 1VQPS 3R7SB 3EUNA 1JKHB 1WNEA 4QYZJ 2PA3A 1KNZA 3KTQA 3W1YC 1U1QA 5AE1A 2VPWB 2EK1A 2IBOA 5IM0A 1T3NA 4USTA 1VC0A 3I96A 2D74B 3G9CA 4GKKJ 5A8RA 3PO4A 1U2RA 4NA1A 3CCMS 2KN4A 3QZ8A 4LBHA 1U6FA 4OYPA 3B8HA 5KFXA 2W2PP 3TUPA 2XZDB 3CD5A 1T03B 3DOMA 2YKQA 2EG2A 4L74A 4F2SA 1C1BA 3FRZA 1R8PA 3SSSA 3HJFA 1T9WA 2CDRB 2JDJA 1X9WA 1Q53A 2UUWA 2MY7A 1Q7LB 5JVGQ 1LW0A 1D8YA 1TAUA 1HYSA 3C66A 3FRYA 3FQLA 4PPDA 2OH2A 2AWZA 1N0VC 5KFGA 3D28A 3L7OA 3I5AA 2HKEA 3JAMU 1RHKB 5A8WA 4X4TA 1YJNS 2JEJA 3DLEB 4FBUA 4LR9A 1VBXA 1TFYA 4FYYB 1C0UA 3F73A 5GMKa 2DCLA 2R2RA 2AT1B 2Z0GA 3IGVA 4KB7A 3V6DA 4PG4A 2HWTA 1NSAA 1HPZA 3PW2A 1HHQA 2RDJA 3CCUS 3QRPA 4R25A 4DUZF 4E0DA 2KDOA 3UCZP 3BYRA 3LOUA 2H51B 5KFKA 3K8VA 2MB0B 1GNKA 2MLYA 4KSEB 4AL6A 2RS2A 1G2EA 1LWXA 2RDDA 1G7CB 1D3WA 2HNDA 2GFFA 3DGVA 2MJNA 3QIPA 4OJHA 4DV6J 3ZTPA 4GKJJ 1NXIA 1RHQB 1SH0A 1TKTB 3CVKA 3DOLB 4KIAA 4M5NA 3VHQA 4RPFA 1HBUB 1X4CA 2ROEA 3L95X 2GMJA 2YX7A 2KU7A 1RADB 4C8MA 4EO6A 1X9MA 5SZTA 1TL5A 3W63A 4CZCA 2W9AA 3OFHA 1ZTTA 1JJ4A 2M88A 2XMTA 4O3RA 3Q23A 5IZHA 3HHKA 1FXDA 2IIHA 4USKA 2P8IA 1UJ4A 4QYRA 4YY3F 1Q8LA 4DL2A 3Q24A 4WP8A 5M2RA 2E7WA 3MUMP 3M6WA 5LM7E 3JSRA 2VFSA 1NDCA 2FHJA 3AXMA 4OI0A 2AU0A 2FLPA 2UXBF 1UEUA 3V6DB 5CYMA 4NE9C 2NQPA 4LR8A 2XS2A 1ICEB 4LF6F 3W8GA 1RAOA 4HLBA 1RAGB 1WI6A 2ROGA 3R6GB 1XERA 5E3CA 3TO8A 2W8KA 5F3ZA 1VMBA 3WQPA 5LMNF 2R8KA 1DAXA 2VONA 3G86A 3C19A 4W90B 3IGNA 4JV1A 3M8QB 4OX6A 5HQ8A 2LXUA 4RL1A 5EHHA 1JLGB 2O3DA 3IN5A 1TUGB 4ECTA 1LV5A 3EE3A 5LJ5Y 3NNCA 3UDCA 2O5DA 3IRXA 1XNRJ 1D09B 1FRMA 3TJ9A 2HZCA 1LK5A 1MN9A 2RRBA 1OY6A 3LP2B 4HTJA 4I7FA 4B9VA 1IM4A 2FHOB 4JI3F 2GCFA 2V2VA 3QGGA 3MR3A 3T19A 5AJ3J 4JI3J 2GIRA 4L76A 3V6HA 1HW9A 2X1FA 1JIHA 3MXHP 2COLA 2XY6A 1T03A 1N33J 1CJUB 3LGNA 4TU9A 2XS7A 1HL6A 2AEJA 2LU1A 2U2FA 3DN9A 2GGPB 3EJMA 4NI2A 3EZ5A 3T5KA 1N36J 4NLGA 4FS1A 2HZAA 2CJQA 3DLGA 4OV6A 3P45B 2D41A 5HVFA 3U1NA 1IBMF 4OMFG 2CZ9A 5LMNJ 1CS4B 1VCTA 1KSPA 3CJ0A 1X8DA 5G0RA 1J2VA 1UEKA 4A46A 5K8MA 3LP1A 1K0TA 1AZSA 2E5LF 4CQ1A 1WKKA 3IAM9 3MPVA 1HBUA 3KJVB 1OO0B 3VAHA 3QO9A 1KHWA 2FJXA 2FB0A 2CPDA 4USUA 3DM2A 2IJNA 4O3OA 2V4JB 5DS7A 1C1CB 2MGZB 3CNQP 3TVYA 3PJXA 4EBDA 3H40A 4RNOA 1FKAF 4Q0BA 4DPUA 2CWXA 1S9EB 3TQEA 5D0EA 4LFAJ 3RBDA 1SKSA 1J5OB 2R8GA 5ETVA 3E51A 4WCEQ 1YBAA 3EYZA 2LEBA 3QAEA 4HHUA 3WZ0A 1TK8A 4IR9A 4F2RA 3KDOA 1RABB 4DV6F 2FVPA 2VODA 5KAKA 2FY8A 3TUZC 2XGQA 4U7UD 3TW0A 2ZUAA 5J1EA 2BJ1A 2CNKB 3ONQA 4ZCLA 3DGPB 3R5DA 2LDIA 4WFYA 1KRPA 1XMBA 1RA7A 1X9SA 3LALA 4RW7A 2GS8A 5KFUA 2HEKA 5I42A 4L72B 5I4MA 2G2OA 3A8KA 4ZIWA 2FGCA 2L41A 2MDAA 4XPEA 2AX0A 4UW2A 2ZH3A 1RWMB 3QAUA 4LF4J 2IAJB 2OTLS 2ABYA 2AF6A 3TEHB 1DURA 3HMJG 3CC7S 1FKPB 1RWWB 4GC7A 3OTEA 2HIQA 2NS1B 2VJUA 2Y8WA 4OHXA 1URRA 1N54B 4DR2J 1HBMB 1WOSA 5C42B 2CJYB 1LNQA 2BM0A 1IBKJ 2DRAA 4XAKA 2ZH6A 2QL9B 4ED7A 3HJVA 1NPKA 3HVAA 4ERDA 2GJFA 4WTOB 4G1IA 2JC0A 3FSIA 2UU9F 1RT2B 2CZ4A 3M8ZA 4DV4J 1L3SA 1AFIA 1PBAA 4C0OC 1GTHA 2VG6A 3T1AA 2X7IA 3KK3A 4DR1J 4X4QA 3CWJA 1TV6A 2C28A 3MFIA 4DV7J 1SCJB 4X4NA 3GLJA 3KNAA 3OLBA 4WFXA 3AD7C 4ED5A 4DS5A 1ZS6A 1U02A 3TVKA 3M8PB 4ALZA 2F7VA 2ZFHA 2OIHA 4NCAA 4ECYA 4NLYA 2C2OB 4KGKA 4OZLA 3H59A 4PYDA 5I3UB 1L3UA 2VOOA 2EC0A 2BQRA 3CDBA 3MZIA 2DR8A 3W2VA 3H5YA 3NGTA 3V81B 3MPWA 1HKAA 2VU5A 1FVQA 1VGYA 2XULA 2QJ3A 2ZBRA 2R2SA 3V6KA 3MWBA 3QT5A 3CDEA 5LT5A 4J9PA 2AGOA 1NK8A 4LF8F 3CCWA 3F0NA 4WXOA 3MMBA 1QAXA 2MKIA 4LF8J 3GR1A 3E2EA 5HANA 4ES1A 2DHAA 2BRLA 3K5OA 5E3RA 5HVHA 1RWPB 1R6YA 2G1DA 1WF1A 1TVRA 1Z2LA 5FLXU 2PSZA 4YR2A 1YX2A 3A8EA 3OTDA 4FYWB 4DV5F 5J2PA 1MROB 2ASDA 5ETMA 2D1CA 2C2EA 4JI2F 5B7WA 2DCUB 1IKWA 1KR4A 3EMTA 3CW2C 1UW9A 5J2PB 3W5YA 3V6JA 1JWWA 1FF2A 2HVHA 2RKIA 3MM6B 3N5FA 1FNOA 1EZZB 4IQMA 2BUNA 2DEJA 3KLHA 4V19X 1FE0A 5H9EK 1N5SA 1TL3A 3HHLA 5IV4A 1K73T 4ECWA 3UN2A 1S79A 3Q86A 2Y0SD 3WIUA 2HVZA 3OD2A 3TAMB 2XLIA 2QA4G 3RBEA 3CC4S 3VAGA 3HULA 3N5BA 2DYAA 3RBXA 1VRTB 5GMEA 1VI7A 3C16A 2KJWA 3QYYA 2K7JA 5CZVA 3VGUA 1S0VA 1SJFA 1WHYA 2C3MA 6FD1A 2JRSA 3IXQA 2CRLA 3RZAA 3M8QA 2YNHA 1OIAA 1WHWA 1JLCA 3BBCA 3EZUA 4CLKA 1IM6A 3DOKA 2OSQA 3S01A 2PI5A 1QSLA 2AW0A 2G4BA 1S1XB 4M63A 1SKUB 1NJWA 5JMNA 3BSCA 2DB1A 4UF4A 5T7LB 2DPJA 4ZPVR 2VUGA 2CG8A 3SSRA 4BCAA 1H72C 3DRSB 4ZDNA 3B54A 3I55S 4G1PA 4ECVA 3LA0A 3BN4A 1HNZF 5HSPA 5A76A 3PVXA 1QTNB 4QU7A 1HNWJ 2R7OA 4AL5A 3C3LA 4ZVUB 3DHWC 1H2UX 2M5YA 2ZITA 2HFZA 2L9WA 3B4DA 1CG2A 3I6PA 4MYTA 4W98A 5H1SV 4BS2A 1KTQA 2HVEA 3M30A 4C3LA 2YNGB 3OHBA 2OTJS 2DNKA 2O01C 4N8OA 4TXSA 1IR0A 4J9NA 1KTVA 3WIVA 2XY5A 3CEDA 4BC9A 3RB0A 1XQIA 4I4BA 4DV2J 4G3IA 4F0KA 1S9GB 1RA6A 2MZTA 2FC8A 2KM8B 1XR6A 3BF4A 1VLOA 4W4MA 4FBTA 5DJBA 2B5JA 2LQ5A 4NXMF 4B3SF 3QQCD 5KG1A 4YQWA 1CULA 4BC7A 2ZWPA 3FEXB 1ZPWX 3ZZ0A 3MD1A 2DXDA 4U7UK 4X4VA 5BYSA 2MZQA 3I87A 1TTHB 2HS4A 1RACB 3KLIA 4DUZJ 1SBRA 4UUWA 4FS2A 3R5BA 2H5IB 1UZHA 2DGTA 2XMKA 2EG1A 2YNIB 3MR7A 3GIKA 3IRWP 3EXCX 2R2UA 3DLLQ 1DBDA 1FRJA 1EKSA 4OHWA 5HAOA 2GVZB 1FO1A 2HBRB 1KWMA 3D68A 3NCPA 4GVBB 2WVDA 5HROA 2N7YA 1LWEB 1O5JA 4C8KA 4B3RJ 1L5UA 2BM1A 2MQLA 4JV2A 3RW7A 3KKFA 3ENWA 1R0AA 2ZZMA 1FRHA 2KG1A 3NL0A 2DT9A 4FXWA 2G2ZA 1I94J 5L1IA 4K4WA 1FRXA 2VV5A 4M5HA 1S6QA 4GO7X 1S0MA 2XSFA 1NCLA 3IBWA 2XLJA 2XYHB 4KO0B 5EWEA 1HARA 3MM7B 2WONB 3R27A 5A2QY 1YJ9S 1D0EA 4FPRA 4TY9A 5D78A 1H74A 2GJ2A 5C24B 2NXCA 3G71S 1MNEA 5AE3A 1OJ4A 1W2BR 1SJQA 1YI2S 1RYSA 4NL5A 3TX8A 3RB3A 1SC4B 2UXCF 4K0KF 1TKXA 4HVZA 3VAIA 3BQ1A 1MWZA 3NG8A 2PI4A 2VKZG 5GVQA 2ZBCA 3CJRA 3CJTA 5KFQA 1OQ6A 3HSGA 1O51A 1NPRA 4DOZA 3ITHB 1FNXH 4I6AA 2MKJA 4F02A 3K5PA 4L73A 3ICLA 4PG6A 2IM3A 1M5VC 4F4ZA 4C7QA 3PRDA 4MFBB 5LSRA 2MZ1A 1CC8A 4K7QA 4QIWD 5ETKA 5LL6d 4KPCA 1FK9A 4DG1B 2PT0A 1U24A 4FYXB 1Q1KA 5K20B 1GAOA 4F25A 4PWWA 2CA9A 3HD1A 2PGCA 2VC1A 2LYVA 1VS3A 1YWXA 2CPEA 4PAAA 4DG1A 3CCTA 3I0SA 1Q95G 1TELA 4DHVA 4CTAB 3BN7A 1H2VZ 2EPIA 3UDVA 3ZTRA 4CLYA 4ZPCA 3BGLA 3ZZTA 2FD2A 2DGUA 3DLHA 1B0PA 4OJGA 2G9OA 3AT1B 4A8OA 5C2GA 3NWRA 3OTOF 3OPKA 3NGUA 3FKBA 4TU8A 4IFVB 1JLAB 4XO0A 4MKBA 4RKUC 2XC9A 3BQ2A 1U4BA 3QJLA 2KZZA 1VYAA 1U8WA 2CQCA 2W2MP 1NJXA 3T1HF 4OQJA 2RJZA 4F8RA 2V0NA 1F5AA 3VR1A 3MOZA 1EJ7L 1HR0F 1AFJA 2DNQA 2HHTA 4CM0A 3U02A 1S9GA 3H0PA 3KWMA 1HMVA 2PO4A 4KFBB 2PEHA 2ZDOA 3TR5A 1Y3JA 4A8FA 4QJVA 3LTOA 3M1VA 2DNZA 2ZC3A 2HRTA 2MKHA 3U1MA 1SB6A 2OLWA 2FHKA 2ZDPA 3HFVA 3P4UB 1QVFR 3SMZA 4K50A 2F63A 2AJ0A 1P6TA 4F0HA 2R7QA 2QMUB 1IWAA 1S7HA 4X84A 4DV3J 5BXIA 2FVQA 4FPIA 4NCGA 2GHPA 4DU7A 1HQUB 3O3LA 1LW2B 2CZVC 1TMMA 5J1EB 3UPFA 2W7OA 3CD6S 3Q22A 1FHTA 3DI6A 2KJVA 3I82A 4Y34A 4YFUA 2ASJA 4USMA 1RCXB 3TANA 4RBUA 2JX2A 5H9EJ 4WIIA 5JJBA 1ZBTA 4ED3A 4LFAF 5DO2A 3J80U 4NYZA 2EW9A 4GMKA 2A10A 2W9CA 3DC2A 4PQUB 3UDLA 2A2DA 3G2XA 1H2TZ 4KY3A 4E98A 1VQYA 1B3TA 2FY1A 4ZK7M 2BKNA 5FIIA 4FDFA 1X4AA 1ZAXA 1N6QA 2DGOA 3KJFB 4JI2J 5D3GA 2KM8C 4B17A 2W7AA 2CG4A 3LANA 4LSLB 2ZNYA 3GFXA 4R8UB 2ZJQQ 2ZZNA 4USJC 2RMLA 2M52A 2QLXA 1NLKL 4DR3F 1SJ4P 4JI5F 4LMZA 2C2ZB 3QPIA 4N8NA 4DR7F 2YWGA 4WP3A 5CAAA 5ETOA 1Q8KA 4IOAQ 1DZ5A 1TL4A 2VG7B 1AA1B 1ULRA 1FJGJ 2B6AA 2D3UA 1BE4A 1CJVB 2MPUA 4ZITA 3JTPA 2LQ9A 2DGVA 4RUHA 4IH5A 4OYZA 3K8WA 4BHQA 2HZVA 2H48B 1FX2A 1T7PA 1MW7A 4QPXA 1Q82T 9RUBA 4HHJA 1FE4A 2VICA 1NEEA 2AMCB 3DLJA 2HAFA 2V34A 4HH1A 2QLWA 4M5JA 4MTPA 3GJTB 2IDEA 1RXOB 2LDYA 2RVJA 3EICA 3MMCB 3S8SA 4TLRA 5IM0B 3CJ8A 2LU2A 2E5GA 1YSJA 1F0XA 1WD6A 1O0PA 2RT3A 2AZ3A 2LQBA 1MU2B 2QYGA 2VBXA 2OAUA 1NJIT 3D1HA 3Q8PB 4HI1A 1NDLA 3H8YA 3D6TB 3I9V9 3MPYA 3PEJA 2VF3A 1OWXA 2Z58B 4KYZA 3PYEA 3WHIA 4CCHA 1JJ2R 3GONA 2AYGA 4WFAQ 5CD4A 1SUQA 4WIQA 1NZ8A 4X4RA 3PR5B 3N6NA 3QO9B 1HBNA 4F50A 4JI1J 1R8AA 1FJGF 2F9JA 1OSDA 5E33A 4QYZK 2GVZA 4PG7A 1YKWA 3R7NB 3MEGB 2B0GA 1WEZA 5A8KB 2UXBJ 4ILLA 4U67Q 1JK9B 2C3PA 5KT2A 4K4TA 3TZYA 4D3HA 1ROFA 2IM0A 2RSQA 5ETRA 2DHXA 2IYIA 3FFIA 1HW8A 3GV8B 3WX8A 1S1VA 4KAIA 4C11A 4CM2A 3MGJA 4RW9A 2ZBIA 2Q1LA 3HHLC 4K5SA 4YR0A 1PBUA 2OEJA 5F0UA 2RF2A 5BJRA 5C24A 3EWGA 2W8LA 2CPJA 4ZIVA 2RQ4A 2AEMA 3ZZZA 3PX0A 1N5TA 4Z7YA 5J2MB 1A9NB 4GRSA 2UXDJ 2JJ4D 1JLEA 1UMJA 1RAEB 2V8DA 5FDLA 5MAOA 4PRFA 4N5SA 1QTMA 2FPHX 3BKFA 2V4RA 1F9FA 4RW8A 4RR5A 2G0JA 2HG4A 3OR1A 5ETPA 1FDDA 1L3KA 2H5EA 2I0XA 2XMWA 1RLCL 2YXLA 4IH7A 3G4SS 4M5LA 4OI2A 3CC2S 1UFLA 1N5YA 1TUWA 3IS9A 3QT8A 4X62F 3SSQA 4A8QA 1ZETA 1BMQB 1WACA 1V3RA 3SIPB 4UQGA 2H5JB 1XK8A 3G6ES 5HN0A 4O4GB 3M2VA 1DQ9A 1X7VA 4WPAA 2K8GA 2P9EA 4GC6A 3MHYA 1PJ7A 3DYAB 2Y9HA 2D9PA 1WC4A 3VZHA 3PJ9A 2UVVA 3KYLA 3IWLA 1QM9A 5IT0A 2UUCJ 2CQ2A 3UI3A 1BWEA 2HURA 4AT1B 3VALA 1UTAA 1WG4A 2HS3A 2Q3PA 4NRTA 1K8AT 5LSOA 1TL7A 3P8BB 1J5EJ 2F5GA 4PQAA 2RD5C 3MR5A 1RHMB 1N34F 3IR6B 3OL9A 4BWJA 2W4CA 1AT1B 1VRTA 1B64A 1WDTA 4HTIA 1N36F 2VL1A 3M9NB 4OJ1A 4ILMA 3HSDA 4DU8A 5DETA 3GIIA 4DF8A 4DUYJ 4MJKA 1RWUA 3OT9A 2HLUA 2LEAA 3N0VA 2ZH5A 1LWCB 1N8RT 4J91A 1D9AA 1YGYA 2XMVA 3NRBA 2LP4A 3PV8A 2CADA 4CYUA 1UWBB 2ZJRQ 3EX7B 2DO0A 4KV8B 4DV1F 1KVKA 2FVRA 2NYHA 2WOMA 3TUIC 2R8HA 2UVRA 4GKKF 4FYVB 3CT9A 3ENVA 2JEFA 4I0WA 5EWGA 4RZRA 4LVNP 5J1NA 4Q44A 1R0CB 3P5TL 2K2PA 1OPZA 3ILJA 4XDCA 4ECRA 4M5GA 5HJYA 3V4IB 1CJTA 1RI7A 5D6GA 4C48A 1UJ6A 1MN7A 3MPDA 2DR7A 3M6UA 4F3MA 2C1EB 4JI1F 3BSOA 4JP8A 4IFVA 3ZTSA 3NKYA 4ECSA 3MEDA 4XTTA 4P52A 2B8PA 4DL7A 2YKNB 1FFGB 4O3NA 1HHTP 4ED0A 3ZTOA 3BO4A 3MAAB 3W66A 2MHEA 2ZOGA 3W60A 1ZH5A 1ZAWA 2BV3A 4ED2A 4O23A 3BO3A 4DFMA 4YUDA 5LXYA 2IC3A 2GW8A 2HVDA 3MMBB 4U9RA 1M90T 4DX8H 2OPRB 3CSKA 3MEEA 3N79A 2DNYA 4Q43A 3LP1B 4DLGA 3DNCA 3BPDA 2YH0A 3QIDA 4EUVA 3MM8B 2W2NP 4FNHA 1N52B 3C2PA 3A3NB 1TK0A 4CH0S 1D1UA 3AH6A 1VQLS 2Y0BB 4A8KA 3SDEB 1C4CA 2F8MA 2JLEA 2YQ3A 1APSA 4X4OA 3AAWB 2H9ZA 2XBPA 4ZPBA 1JNZB 3E8OA 1XWLA 2CWKA 5J2QB 3WC0A 3PNIA 3DRSA 5C25A 4ATNA 4N41A 4OHVA 4U96A 2NSBA 3NS6A 3IBFB 2JSXA 5IV3A 4KKOB 1SL0A 5HBMA 3HP6A 2FLNA 1G3OA 3W61A 3I0SB 4X64J 3LAKA 3NGSA 4CO1A 5E5NA 1U48A 4OYAA 1MG7A 1JLCB 2DNLA 3J81U 1N32J 1BY9A 1HWKA 1M5OC 1UP1A 1BQNB 1S6QB 3MCNA 4C0HA 1UVIA 2KHDA 2BANA 5HMXA 4KQZA 2IBKA 1HLWA 1QD1A 2HFSA 4M5KA 4DMZA 1C1BB 1IKYA 5HROB 4NZ6A 2UUTA 1Y3KA 1VQ5S 2FGOA 4IRDA 5HQMA 2AJQA 1A6LA 3CJ4A 5AJ3F 2DVIA 1M5HA 4J9RA 1VRUA 3CUNA 1YTYA 3K5NA 4LR7A 4JYAJ 1KONA 3HHEA 3MECA 1FJEB 3KG0A 1EETA 4PXEA 1T05B 3UWTA 1D9FA 2OFGX 2BR0A 3W9IA 3JB9k 3FQKA 4C8LA 4WKRA 1REGX 2WONA 3FEYB 2HIYA 4DX6A 1DLOB 5C7PA 4WJBA 1GXUA 3BB5A 4LF5F 4BBYA 4H4MB 1FWLA 2V67A 4KV8A 2WW4A 5D4LA 4DX5A 2V9KA 2QFIA 4URSA 5LSLA 2IC3B 1DRZA 2OGUA 4IG3B 3DOLA 1S49A 4UY85 2F8HA 2WK4A 4DL0C 4YMEA 4C8YA 4PXCA 4ZVHA 2OEKA 3EGNA 5A6WA 1TP7A 3SQGB 2HNDB 4Y2MA 1PO6A 5ETSA 2YY3A 1VDHA 1PIEA 3PYFA 2FZCB 2JOQA 1XEZA 1KBRA 2QL5B 3MF5A 3M9MB 2HRUA 3J81j 3R9LA 4QIFA 2Z2MA 1RP5A 2J8SA 1WWHA 2CQGA 2PMHA 2QA2A 3KLIB 3Q2SC 5KT5A 3KLGA 1S0NA 2DITA 1SKWA 1HFEL 2AYBA 3JSYA 1W7WA 1YLXA 3QMQA 2LLZA 2OD6A 3GV7B 1I1GA 2BABA 3W7BA 3KHRA 3T9NA 4DUYF 4DSIA 1LFPA 3I31A 1YRTA 1QAIA 2VJVA 2GMLA 3T5LA 2D3OR 1TMJA 3D54A 1NSPA 2DNOA 2FC9A 3WX4A 2CPIA 4DS4A 3IM9A 1NK7A 3DLKA 1YRXA 3KG1A 4WE1A 3VQTA 4DV5J 5I3PA 2ZBPA 4Y65A 4LF9F 3QT6A 2V2KA 4NA3A 2RAQA 1FXLA 4CH7A 2X3DA 3PHTA 3R97A 1ZPVA 3J7YU 3K5LA 1TKZB 2KT3A 2D3O1 3JXOA 2Q6CA 4QZVB 2RIJA 3PO5A 2V68A 1WC5A 4ELTA 3NLCA 4DCJB 5DQHA 2PA8D 1LEOA 3HX9A 3JTNA 4UQTA 1S1TB 1WF0A 4XDDA 4IOBA 3GQCA 1JLGA 1EP4B 2BQ3A 4NLVA 3C6UA 2X1GA 4NLDA 4OYIA 3IM8A 3FJ2A 3THPA 2MXYA 1FDAA 4V19J 4ZP6A 1NBEB 2Q43A 1A7GE 1NPPA 1MMNA 2PDAA 3ZNUA 5BR8J 2H54B 1YITS 4YOEA 2IDLA 4OI3A 1RYRA 1I51B 2M4MA 2RU9A 2KRBA 3LQVA 4NYOA 2DY9A 2VPXB 3LH2S 2W9BA 3PX6A 1E6VA 3QRQA 1PG5B 1QE1A 3PW0A 3BBBA 3MEGA 4DZ6A 4OZ3A 1HNIB 4HACA 2HQCA 2HWHA 3AB2B 1DTTB 3IRXB 3CCVS 2QSWA 1RT4A 1HWIA 2VG5A 2ZOFA 4TYBA 4OZ1A 4PXDA 5IC4B 1RBAA 4J9QA 1AUDA 2CDQA 4H4OA 4HEA9 1F2HA 1S59A 3RJMB 2CUYA 2C3YA 2IM1A 3DLKB 4DQQA 2V8PA 3M6VA 1H73A 1LXNA 2BRKA 2M8HA 2YKNA 4DR2F 2DR5A 1WORA 2JLGA 4RW6B 3TVZA 2QMWA 4DXLA 3ZZOA 3K7RA 5U47A 2XZTB 4O44B 2XMMA 2HYIB 2R7UA 5EWFA 4FF2A 1IKVA 1RAHB 2HNYB 4B3MF 3ETMA 3NMRA 1RT7B 4DR5J 1S5ZA 2EFVA 5HMZA 1CS4A 3LF0A 3SBMA 1CJKA 8RUCA 4FKXA 2QX0A 4I69A 4IFYA 4DSJA 4LUBA 4CRJA 2QN6B 1DY3A 3QNWB 5B0FA 3W9HA 1Y0HA 3SDEA 1NHVA 2P5VA 5AXNA 5F8MA 3US5A 3L7PA 4RUCA 4QU6A 1IBLF 4DSEA 2OD4A 3ILOA 4LRAA 1C0TA 5CA5A 1HNIA 4HACB 3OL7A 4C6AA 4DI6A 3GCXP 1NK9A 1N34J 2CJBA 1PSDA 2E7XA 2RQMA 5D77A 3Q0AA 3PZPA 1S57A 4OX9J 3BYPA 3EVOA 3PFEA 3LUYA 4ZA1A 3MEKA 2B56A 3LP0A 4J90A 4HH0A 5T14A 1MLAA 1CSJA 1MU2A 1NDKA 1U26A 3NGRA 4QWEA 4UTGA 1H7WA 2A3JA 2JH3A 3BBFA 4LRCA 5KFTA 4B3MJ 2HFVA 2VG5B 4KC5A 3QRRA 5GAHI 1GH8A 3GSDA 3M8RA 2YTCA 2ERRA 4DUTA 3G6VA 3TWZA 2ACMA 1RHJB 2DNNA 2B43A 4GVLA 3ZZYA 5LMUJ 2J0SD 2ZKTA 2XG8A 5LJ3Y 4NYPA 4IYQA 3RG6A 4ZKAA 5E3AA 3KK3B 2G2YA 4TKTA 3DCAA 1M5SA 2Q6BA 2X1BA 3DMJB 3ET6A 3KUGA 2EI5A 1RSCA 1S6OA 1SH3A 5D0RA 5HLFB 4EFAC 3ZO7A 4WFZA 1DQAA 4CT9A 3W3SA 4B9UA 2CIMA 3P3DA 3QFWA 1MSWD 3QFHA 4NPOA 1FNMA 1RISA 2M2BA 2YKAA 1T8EA 1T0TV 1YZ6A 1TQLA 1SJ3P 5KT3A 2MQMA 1YRUA 3H7HB 2NLWA 2WSFC 2NSCA 2MQQA 3DHXA 2OO4A 3H4BA 2R42A 3G87A 3CMES 3GYGA 1X4BA 2AJ4A 4H54A 2W01A 1IN0A 5E0OA 2VHGA 5J2MA 2AV5A 3ELHA 3R6LB 1X60A 2YVSA 3HKZD 4H4MA 4RX6A 1SVDA 1WOOA 2H4YB 3G96A 2RQCA 1S0OA 1KFSA 3KK1A 4JI7J 1WTBA 2R7RA 2BJ8A 5K14B 2HHSA 5IT4A 1LWFB 4ILRA 5KG6A 4F3QA 2CPHA 2Z4PA 4Q7AA 2W9CB 4J9KA 5L39A 1CJKB 4PQUA 4I56A 4K4YA 4MK9A 1HNZJ 1VRQC 2GHWA 3VV2B 5A0YA 3MMCA 3SXLA 1YK9A 1NZAA 4AFFA 2RHSB 3FCWA 2N4DA 2I38A 2VD3A 3JQKA 2KVIA 1CJUA 3GILA 2KT5A 3NCQA 3MEEB 2MHNA 3N9UC 3ULHA 5A8KA 2W7PA 1VQ7S 4UOHA 3DFEA 4RW6A 4D3GA 5IS2A 2RB7A 3DM2B 1VFJA 1VK8A 1NO8A 2EFOA 2LCWA 1SUQB 1RTJA 4YEAA 3KK2B 2E1CA 1KLMA 4OYBA 5L8RC 4M95A 1RZMA 3G8SA 1NKEA 3PM9A 2HNZA 4OHYA 1GMWD 2GO9A 3EZOA 2UUBF 3FBEA 1T95A 1YBUA 3GJRB 4NLQA 2OPPB 4QIGA 4JUZA 3C14A 3RYLA 1AZSB 5CD4H 1FD8A 3SV3A 1REVA 3FBFA 3HVTA 3NMAA 1ZYQA 2FLOA 4QBUA 2ZH4A 4DZDA 2NUUG 4FXDA 1RT3A 3M2VB 4OYMA 1NK5A 1S1UB 4LVOP 3H2UB 2ZD1A 4A8YA 2M0GB 2W2QP 2PN6A 3UNGC 3K57A 1RT3B 4ELVA 1DTQB 5DDOC 3IWNC 4CYUB 1NJZA 1A0OB
chains in the Genus database with same CATH topology
4AYBD 2KH9A 3EPIA 2FJWA 1NB7A 7FDRA 1LWFA 3GYXB 3LP0B 2VPYB 3MTKA 3OFFA 3V5RA 3Q8SB 3CPWR 2GJIA 4TY8B 2EFNA 4CTAA 3C6TB 2WCXA 4RLEA 2X1AA 4ZPWR 2IM2A 2DH9A 2K3KA 2BACA 3E3XA 3F41A 5MLCV 4JI6F 1CQMA 3MUTP 1R31A 2LA4A 3CD0A 2O67A 3FGVA 3FNNA 2I5JB 4ECUA 4DDFA 4F67A 3SI8A 4ZOSA 2XS5A 2J9DA 2L9NA 2W24A 1JMTA 4YB5A 3CXCR 2F4VF 5A0YB 2UV8A 3ZZUA 2M8DB 3VCDA 4C2MA 1R3NA 2N3LA 2IMWP 5HBMB 1PGZA 1TKXB 1UVMA 1VRUB 3OFGA 2XGPA 3V4IA 3FMBA 4NLPA 1FTRA 4RNMA 4YB1P 4B3OB 5GADI 4ZP9A 5DM6Q 1CEZA 5DG8A 3PFOA 4G1QA 3BGFA 4JV5F 1TZ0A 2HMIB 2A18A 1K9MT 1UWBA 3VTIA 2DISA 2I9SA 3OR1B 3HXMA 4DR5F 1VQKS 4I6YA 3BS9A 5ADZA 3CDWA 2E9TA 5A6PA 4DSLA 4IG0A 4EU0A 2E5IA 4RNFA 6FDRA 2KXNB 1MWYA 4DJBA 2AQ4A 1WF2A 2D7SA 4FVCA 3G8QA 3J81Y 2ILZA 2DD8S 1GXLA 4AE5A 2CQ1A 3K59A 1N56A 3HJFA 1VQOS 1MROA 4PR6A 4XK8C 1VQMS 4B9SA 2CFXA 1D8ZA 2YKMA 2LKZA 3DU5A 4ZHRB 1H7XA 3CJ5A 2E66A 3UQSA 5B0AA 5KFFA 1P1LA 4JI4F 4PKDB 1KNZA 5KFIA 1FRIA 4QWBA 2ZH8A 4DL5A 4Q8EA 1UETA 1V3ZA 4PG8A 2DRBA 1JLQA 2VFUA 2B51A 4RUAA 4X65F 3BEGB 2B5JB 2RUGA 4A4JA 1UA1A 4DR1F 2BVZA 2J9EA 5CCMA 3OFEA 3TQ1A 1LW0B 3M2RA 3FSXA 3ENQA 3HLUA 3W2WB 3PKYA 2OMOA 2WSCC 3C8YA 2CVIA 1JXLA 1FK9B 4L3NA 1Y5IB 2EK6A 2FTRA 5T41A 1FDNA 4ZP7A 3CDAA 2VBZA 2VFVA 3HFKA 3QGHA 2HFNA 1NK0A 2L48A 1R27B 4ZCKA 4NLOA 4TYAA 4DQSA 5JXSA 2RILA 3GR0A 5E2QA 5KT6A 4KKOA 2Y1JA 4RW7B 2ASLA 2C2DA 1C4AA 2XCPA 4CNZA 1WHXA 5J2QA 4HL9A 4PUOB 3KOAA 3U7JA 4WYLA 3HHLD 3ZFVA 1CLFA 1FRLA 5IWAF 2EBEA 2ROPA 5KG4A 3UW1A 3D1QA 1CQNA 3O8WA 4OI1A 4KGMA 5K14A 1F2GA 3FVYA 3PIOQ 4KJIA 2BA9A 1H3DA 2QYCA 4TNOA 4ES3A 5GAEI 2ZE2B 3CJKB 2DNPA 2E1MC 4A8WA 3FMWA 1BQMA 2UP1A 4IRCA 2WHOA 1DTTA 3GWCA 3KLFB 3OR2B 5KFCA 3EGZA 3FCHA 1Q86T 1OQ3A 2XWXA 3J7YI 2EVZA 2J6SA 3RR8A 1ZM3A 4X64F 3BSNA 3MR2A 1DARA 1Q79A 2ZNZA 2WTFA 2NREA 4RBVA 4LT6A 4WTYA 5KT4A 4DR6F 3CJ3A 4M8LA 4OZ5A 3OVBA 3BM7A 2NZ4A 4Q0BB 4ECQA 1XBWA 3JTOA 1TK5A 2YKOA 2VZ9A 1WHVA 1S97A 2W4PA 3MCSA 4WKYA 3H5UA 4FZVA 2FJBB 2SXLA 5KFPA 5L38A 2OPSB 3M05A 5KFJA 5KFHA 2R7TA 3M6XA 2BANB 1NKCA 3HK2A 4NMLA 4YDXA 5CZXA 4FYDA 1SIWB 3IR7B 1UVNA 2AYEA 2WSEC 1QVGR 3NGKA 2MSTA 3MAQA 4DV4F 4ZCIA 1XNQF 3I4HX 1S77D 4I2PA 4C9DA 2M3DA 1RQ0A 1UVLA 1P27B 5KFEA 3RB4A 5IQQA 3DU6A 4ID5A 3PIPQ 3SCJE 2B4OA 3HT3A 2UVWA 5LMUF 3MM5A 3NBPB 1T3OA 3TAQA 4F26A 2GIQA 3OJSA 4EBCA 3J80Y 1SI9A 3FFIB 5D4PA 2VQEF 3RRGA 4DN0A 3ZC4A 1U09A 3UR3C 3OVSA 3WBZA 1KOOA 3PHEA 4N47A 1B7FA 4K5RA 4J37A 2DGWA 1JLBB 4ZCMA 4EO8A 1RTDB 2E9RX 4OX9F 3TNVA 5KT7A 2ZM6F 1O8BA 1BGXT 1FKPA 3PXGa 1E6YB 1TL1B 1WEXA 2YNFA 4DSFA 1RTDA 2R7SA 2GQQA 1RKJA 3CCJS 3C6TA 4Z37A 4GKJF 1KHVA 2O66A 5KFBA 5EUHA 1KC8T 4ECXA 4RBTA 1E6VB 3HVRA 1AXQA 4Y2KA 2QFJA 5D3GB 2X3GA 2CQ0A 3K0JA 3ISZA 2HNYA 5K9FA 4B9MA 3R1LA 1S1VB 1WEYA 2WBMA 3CJ2A 3K58A 1Y5LB 1X4HA 2N3OA 2UUCF 1N5QA 3PX4A 1VQNS 3JSMB 1IJEB 1VC6A 1YJRA 4DQRA 5A8WB 2X51A 1HWLA 1TKTA 1F5BA 5DGAA 5DLFA 1C1CA 1HBNB 4ED8A 1L3TA 2GNKA 1LW2A 1HMVB 4KFBA 4QR1A 4USIA 4B9NA 4ZS6A 2K3IA 5THWA 3ZZPA 5KG7A 1FXRA 2EBGA 1IJFB 4DV2F 2B4UA 3GE9A 3GZ7A 1D9DA 2WB4A 3OBIA 4OLPA 1KLNA 2DBBA 5KOXA 2VH7A 5KG2A 3OSPA 3RRHA 5DRKA 3POTA 3HKWA 2KXHA 2Y1RI 3VWSA 2R4FA 3KHHA 5B0DA 1N4LA 4MKYA 1X4DA 2HQ3A 1XTZA 2LXIA 3KMQA 1R43A 3TOQA 2AP6A 2CKWA 4DFPA 1HD1A 4ZVGA 2XB2D 2KG0A 4HKQA 2G0CA 5KG3A 1RTHB 1ZOTA 2JEGA 1S1XA 1KLMB 2QA1A 2KYZA 3CIZA 2K1RA 3MM7A 5M2UA 4B9LA 1SJ1A 4DR4F 1FTCA 1JLAA 3MD3A 1S9FA 1IQTA 4CO0A 4M94A 2B9XA 2CPZA 2IAJA 5L9XA 3WDOA 4LSNB 4WE1B 3HHNB 3I5BA 4M5DA 2MGZA 3VQSA 2ZHAA 3L3CA 4X4PA 3SYZA 1TKDA 3P96A 1N48A 4NXNF 5HLFA 2DNHA 5F8NA 1Y00A 2FUG9 3FSYA 4ZVFA 4TQRA 3KLHB 1U47A 4K4ZA 4MFBA 3AA8A 3JYTB 4AQYF 3T5JA 1SIZA 2AGPA 3Q8QB 4JYAF 2E5JA 4O3PA 3OSNA 1Z1ZA 4GO5X 3MAHA 2FVCA 2XI3A 2CPXA 3RRKA 4W92B 3B4MA 5KG0A 1ZM2A 1X5TA 3TA2A 3O2IA 2MZRA 1HQUA 4WZQA 1YJTA 4MIBA 3RTVA 2ZJPQ 5B0BA 4K59A 1B0VA 1YQHA 3DLBA 2QSFA 1N5VA 5I3UA 1HWUA 2C3UA 5GAGU 1F5CA 5D4OA 3I0RB 4ED6A 3NP5A 1QE1B 3S7RA 4A8MP 4R0EA 2IVFB 1PC5A 3OTBA 2FLLA 1S1WB 4C3MA 2DIUA 1H38A 7FD1A 3OUYB 3K5MA 1WTFA 4I68A 3JSMA 4U7CA 4ZLPA 2XSJB 2E9ZA 1JXEA 1S4FA 2JZ5A 4ZP8A 2ZKUA 4EGLA 1SKSA 2E5HA 1N6QB 4X2BA 3OXFA 2PMZD 1FEHA 2YKMB 3GMGA 1VQ9S 4I2PB 1TV6B 2RS8A 5CXTA 3H98A 3AY0A 2QT7A 2VA3A 5L9NA 2ZH2A 4DF4A 2VG7A 3NAHA 1R8BA 1S9EA 2R9LA 3DI6B 3LO3A 4QCLA 2ILYA 4KHRA 2OPRA 5C42A 1R89A 3MMAA 3QWUA 2RRAA 1U45A 2VC0A 2DH8A 1KOHA 2KI2A 2QZ8A 4IG3A 2RDIA 1S76D 3ZZRA 3M9OB 1Q4RA 4QQBA 1LFWA 4OI6A 4EZ9A 4C0BA 4A8SA 1QJHA 2AYMA 2CQ3A 4LIRA 1HNXF 1W25A 5F41A 1YJWS 2VG6B 4PWDB 2HW3A 4TY8A 5KFVA 4CIOA 4BWMA 4Q2MA 2GC8A 3M8SA 4JI0F 5EGYA 1FCAA 1U1OA 2IRUA 1Y9OA 4K2XA 3CO9A 2P9CA 1YVFA 1BC6A 4NRUA 4NZ0A 2L9DA 4B9TA 1U1PA 1TVRB 1U1RA 1UA0A 3T1YF 2JWNA 4ITSA 1FJ7A 3AHPA 3TA1A 3KLEA 5E7OB 3LW5C 5B08A 2P6TA 3IR5B 3E01A 4E8UA 3M32A 1UL3A 2MMYA 2VB6A 4ICLB 1JJHA 4N76A 3EXYA 2FHMA 1X5PA 6FD1A 2CPFA 1LWCA 4IO1A 2ZH9A 1BD6A 4P7TA 3OVAA 4JBCA 2OMLA 4NLTA 2QEXS 5E3QA 3GFZA 2I5JA 1J5EF 1CC7A 1IKXA 1DLOA 3R3TA 3CCRS 1KN6A 1GXTA 4C97A 3QLHA 4B3OA 3HVWA 3M8PA 1HQEB 2DPIA 3S1TA 5DG7A 3NNAA 3BGRB 1U8SA 1NHUA 1UAWA 2WB1D 4YR3A 3DRRA 4MK8A 3D5MA 5T7LA 4O3QA 5G4DA 1GTEA 4QWDA 2OKQA 3CTRA 2RU3A 3CCZA 3AJ2A 2F8EX 2HPUA 5DDRC 3J7A1 5F9LA 4URQU 3IS9B 2C22A 4KPYA 1S99A 4P7VA 3M2UB 1BQXA 4IDKA 3CMAS 1S1WA 5AXKA 2YWEA 5KFYA 3UFCX 1I6JA 1HYSB 1NRKA 2IFXA 3CDUA 5F8HA 2OSRA 3H2VE 3M2RB 2CYYA 2UZAA 1SV5A 3OTCA 4ZPDA 2MZSA 4KO0A 2K7KA 5J2NB 5KFWA 2ASYA 1H0HB 1SC6A 1UW4A 1OPIA 1RTHA 1S10A 4FP9A 3TUJC 3TARA 3M30B 4MYUA 2EFGA 1TFWA 2A1BA 1S6PB 2PD1A 2DNGA 5CYMB 3OXLA 5GAEU 1AROP 2B4VA 2HGLA 2RF2B 2RKIB 3H20A 3MM6A 4H4KA 4OJ3A 3T6JA 4RU9A 4RNOA 2JHEA 3CF5Q 3VAFA 4DL6A 5BR8F 1CVJA 3AJ1A 4M1KA 5HO4A 3KFWX 4YDDB 3LWLA 1LQ9A 3RAQA 3KLVA 2EFQA 1JLFA 3KNGA 5CYQA 1DQ8A 1SL2A 4PUOA 1S48A 4WXWA 2LA6A 3MM8A 3KMSA 2C3OA 5FD1A 2B9YA 1B0TA 5J1PA 4R5PA 3HF5A 2HS0A 1YG0A 3PEHA 1C0UB 4HDGA 4DFJA 1Q8IA 3TA0A 1XR5A 4NLSA 4IG0B 5CHCB 1NU4A 3I32A 4IDKB 4EYHB 1DFDA 5B0EA 5BYRA 1K0VA 1Y4ZB 2VKRA 2MKKA 1RT4B 4H4KC 2V8VA 4R0JA 4TU7A 4KR0B 1X4FA 2I1RA 1IUJA 1HBOA 2K1RB 2B3TB 3IA0A 3VAKA 1VBYA 2APOA 4JOUA 3QIPB 3HI9A 3MECB 3MUVP 3O1LA 2FIUA 5G0RB 3PR4A 4DV7F 1U1NA 2MKSA 2N82B 3RW6A 2B7CB 2JLFA 4FF3A 1XR7A 2C42A 2IA6A 3HM9A 4DLEA 1RDRA 2GGPA 1ZZNA 1P9QC 1U1MA 4K4XA 4C98A 4Q5VA 2DNMA 3V2UC 4I64A 2CVEA 5KOWA 2BJEA 4X4UA 3DLEA 2J5AA 3HVTB 1HQEA 2Y1IA 1SV5B 1FESA 2KXFA 4WU2A 1U49A 1UVJA 1C0TB 2VA2A 3LAMA 2RRNA 1VHFA 4QWCA 4ETZA 3NCRA 5EDWA 2V4JA 4NOHA 4QPTA 4UY8T 2AGQA 3DXBA 4OFZA 1FRKA 4Z2XA 4C4WA 1UVKA 4ID5B 3D2WA 3CCES 3PACA 5IT9Y 2BBEA 1HD0A 3RR7A 4TLQA 3DOKB 1KFDA 3J7ZT 1ZM9A 2VPZB 1IBKF 1R7IA 3THTA 1R8CA 2QIFA 2CQBA 2WRMA 1F60B 1Z2ZA 3KLFA 4RW8B 4Q2LA 3GFHA 4F4XA 1U1KA 4DQIA 5KFDA 3N4WA 4ELUA 2J7KA 2NUHA 2NYIA 4OZJA 4USHA 4F4WA 3T5HA 4IR1A 2XNRA 4DPOA 3KLEB 4RU2A 1RTIA 2KT2A 4H4OB 2JEIA 4MK7A 3T6BA 1ZTWA 2OP5A 4MKAA 4PPZA 2JL9A 4C11B 4QWAA 4EEYA 5SUHA 1X4GA 2DK2A 1FKOA 4RNNA 2W9BB 2B9WA 2GX8A 5AXMA 3I9ZA 1S1UA 4G6VB 4HT5A 5HI7A 2FVSA 1J5OA 2F3JA 2XLKA 3PDNA 1P1TA 3PW5A 1AW0A 4DWIA 2KTQA 4PXBA 3PJWA 1L3VA 3RU0A 3TYTA 2VQFF 5L1LA 4OV1A 2J0WA 5KFSA 1N5YB 2G13A 2HHHF 2M7SA 2PIIA 1TR0A 3PW4A 2PE8A 2J6TA 4K4VA 1QUPA 2UUAF 4MAKA 2JFKA 1QAYA 1YJUA 3MM5B 2LECA 1JLQB 3MM9A 2HFOA 2J76E 2QE5A 4EYIB 3HZEA 3MM9B 5K8NA 4ES2A 5GAHU 1H98A 1HI0P 2BYCA 4F4YA 4FN5A 2XY7A 2LMIA 1RT6B 1SXLA 1IKVB 3GV5B 3AB4B 3SFUA 3IFEA 1R8HA 3BGRA 1HPZB 3SQGA 4DEZA 4N56A 3KHGA 4IRKA 4ECZA 2HGNA 3TAPA 3P49B 5K8PA 1X5SA 2FDNA 4OLOA 4Y28C 2V8GA 2NPIA 2WW8A 2MZJA 3GB0A 3IG1B 3LP2A 4RNHA 4TN2A 5FDLB 1RKIA 3BR8A 2XI2A 5F3TA 4AL7A 1GQEA 3UR0A 3HPOA 3TAMA 2XNQA 5DG9A 1SJRA 4DL3A 1XNRF 2B7BB