2WSEC

Improved model of plant photosystem i
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
81
structure length
81
Chain Sequence
MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWGGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords AT3G54890
publication title Structure determination and improved model of plant photosystem I
pubmed doi rcsb
total genus 4
structure length 81
sequence length 81
ec nomenclature ec 1.97.1.12: Photosystem I.
pdb deposition date 2009-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF14697 Fer4_21 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2wseC00
3MM6B 2Y0SD 1SJ1A 1SIWB 2VKRA 1PC5A 1VJWA 2V2KA 2PMZD 1FD2A 1BWEA 2C42A 2ZVSA 1CLFA 3IR7B 1B0VA 1G6BA 2FJAB 2FD2A 6FD1A 1F2GA 4XDDA 1KQGB 3MM5A 5BYQA 2WAQD 3OR2A 3MMBA 3IR5B 1WTFA 2XSJA 1B0TA 4ID8A 3MM7A 4XK8C 4RKUC 1HFEL 1FRHA 1FEHA 1FDBA 3MMAB 2WSCC 1Y4ZB 1AXQA 1BD6A 1H7XA 4L6V3 1FRXA 1FRKA 1H98A 4AYBD 1PC4A 1FF2A 3MMCB 1FDDA 4CI0B 2VPZB 2VPWB 1FDAA 1IQZA 1A6LA 2GMHA 1KEKA 1GAOA 5FD1A 2WSEC 1K0TA 1Q16B 3EUNA 1FERA 1H0HB 1D3WA 1F5BA 1BC6A 2IVFB 1ROFA 3MM8A 3OR2B 3EXYA 3MMBB 4KT0C 1FRJA 2VPYB 2V4JB 2UZAA 3GYXB 3HKZD 2FGOA 3MM7B 2C3UA 3OR1B 1DAXA 1JB0C 2WSFC 1C4AA 1FXRA 1BLUA 4Y28C 4OMFG 1FDNA 4DHVA 1FTCA 3MM9A 1GTEA 1R27B 1DFDA 1Y5LB 1H7WA 1B0PA 1C4CA 3LW5C 5BYSA 1GT8A 3MM6A 1RGVA 4YDDB 6FDRA 2FDNA 1F5CA 3MM5B 7FDRA 1KQFB 1DURA 1FCAA 2O01C 3MMCA 4OV1A 5E7OB 1XERA 1Y5IB 5L8RC 2PA8D 3EGWB 2XSJB 1JNZB 2FJDB 2C3MA 1JNRB 3MM8B 1FRIA 2FJEB 4XDCA 1FXDA 7FD1A 1IR0A 1GTHA 2GMJA 2C3OA 2WB1D 1SIZA 3IR6B 2VPXB 3C8YA 1BQXA 1Y5NB 3MM9B 1FRLA 2V4JA 2PDAA 3MMAA 2C3PA 1G3OA 1FRMA 2Z8QA 5BYRA 3OR1A 3PNIA 5CH7B 2FJBB 2C3YA 5CHCB
chains in the Genus database with same CATH superfamily
4I68A 3WBZA 2HZVA 2UUAJ 2FPHX 3KHLA 2Y9HA 1NO8A 4ZLLA 1YZ6A 2EFQA 3NNHA 3HT3A 4V19J 2QLXA 1PAUB 3UW1A 4ZITA 2YVSA 4HYKA 1RAFB 1CJUA 2GJ2A 4DFKA 3DDKA 4QWBA 3GTYX 2Z0GA 1NHKL 1VQ7S 5AJ3J 3F56A 3VQSA 1T3NA 3PW7A 1HIYA 2Z2LA 3MWBA 2MQMA 4D3GA 4RUHA 3PYFA 1C4AA 2V2QA 4MYTA 1XNQF 1H7WA 4A8OA 4FXWA 5KTQA 3OTOF 5KG1A 2V50A 3W62A 5AXKA 4I6YA 3Q8UA 2VODA 1AFIA 3ZZ0A 1RAGB 3HP6A 4HHUA 4NEYA 2Z30B 4ED2A 2YX7A 1TAUA 1LW2B 2CJQA 4FYXB 1TUVA 4S0MA 5K14B 1R89A 4OI0A 3PW0A 2UXDF 3O1LA 4I64A 1KDNA 1ZH5A 2VL1A 4ZVRB 4O44B 3D68A 1V3ZA 1LXJA 2DYAA 2OI2A 5E3QA 3MOJB 2A0FB 4CLZA 2ALYB 4RWWA 3I0RB 5LJ5Y 3HLUA 3W64A 1RHMB 2V4RA 1WKJA 2QLBB 2DR7A 2LXFA 1SB6A 1YSJA 3IG1A 1T05A 2AYBA 1TV6A 2BMBA 2BOPA 2UV8G 1IKXB 1S72S 2XLIA 3GSDA 1BLUA 4AE5A 3SFUA 1NZAA 3T41A 4V1Ak 2PO4A 2XNRA 2KFNA 1RU1A 4B3MF 1DURA 5L8RC 1HW8A 4A8KA 1YRUA 4OJGA 3T9NA 1QUVA 1Q4RA 2VPXB 4I6WA 3MPYA 2HFVA 2E9TA 1HWUA 2DH7A 2ASDA 3CDAA 3M8YA 4CCHA 1X5OA 1PC5A 3PX4A 3KG1A 5IFMA 1S1XA 4MAKA 2IVMA 3BBCA 5HVGA 1RWNB 3TX0A 2IJNA 1PBAA 3HHDA 5T7LB 3BZQA 3CMES 5B0CA 4RKUC 3BDEA 1SJRA 3HXMA 2OSRA 2G4BA 3NOCA 3BDPA 2YWWA 1TMMA 1FESA 2GQ2A 2QRRA 3ZFVA 4Y2CA 2DT9A 4PG7A 2ZNYA 1NK0A 2G1DA 4JI5F 3OW2R 2X7IA 2IC3A 3IO1A 1RKJA 2YNGB 2BJ1A 5JVHQ 4LFBF 4DUZF 2HHXA 4L76A 3FGVA 3BO2A 4YB6A 2LDIA 4HACB 3ZXWA 1KTQA 2EVZA 2F8EX 2B4VA 2DRBA 1SL0A 3DLGB 5HANA 2WVDA 1XK8A 1N5SA 2DHSA 1GNKA 2RDJA 4NLOA 4AQYJ 1AYEA 1SC3B 4MMOA 4IKAA 1K9MT 1YDLA 3HFVA 1UJ4A 4WP3A 1UJ5A 3H20A 2YKNB 1HL6A 4JI8F 3ZTOA 1RWXB 1WOOA 4NOHA 2N7YA 1OY9A 1WC5A 1YHQS 1HMVA 4A47A 3PY8A 5HBMA 1NXIA 2F8HA 4QU6A 3HVAA 3R9LA 3PIPQ 2W2PP 4WP8A 3TI0A 2H65B 5FD1A 3EUNA 3FFIB 3QWUA 1VCTA 3IAS9 3JQMA 3VZHA 5FDLB 4CO5A 5I3UB 3CB4A 1KOHA 1HNIB 2LEAA 1JXVA 1XTZA 1EZZB 4KPYA 1HI1A 4DV3F 1UVNA 3QSYB 4YUDA 2HZCA 4X4UA 1S6QA 1J5EJ 1YKWA 2EBGA 3DRSB 1N36J 3IP0A 1CPZA 3I87A 1CEZA 4ZJLA 4K4TA 4Y6IA 2OPPA 3W3SA 3OTCA 4C48A 1Q8BA 3D66A 3PFOA 5IOLA 3HVRA 1PYTA 4LF6J 3D9BA 2RVJA 4CO0A 2IDLA 4OZ5A 2V69A 3MTKA 1RT6B 2FHKA 3M2UA 4OJ1A 3MMBA 3HX9A 3UE2A 2A6MA 3F44A 1DTQB 1ICEB 1FDBA 3JSYA 2I1RA 1PCAA 5DZ7A 4DPYA 3LP0A 4WFYA 1I5OB 3TAMA 2I2YA 3MPDA 3CWJA 4C8KA 3W2WA 4K2XA 1YQHA 3JQKA 3M4XA 2NXJA 1IBKF 1NNDA 4FP9A 3CCVS 3UVJB 1HYSA 3QIPB 4DL5A 2YWEA 3RU0A 4YY3F 1FI4A 3J7A1 1IBMF 4I2QA 2GIRA 5B08A 2M52A 1Q5VA 2HFOA 1IKVB 1K1QA 3HHKA 3J81Y 4DQIA 1YIJS 2VJVA 1HNWF 4CO3A 3IM8A 3C6UA 5GAHU 2HSEB 5G0RA 5DDOC 4HKQA 3MXHP 2R7XA 3QJLA 2V2ZA 2AGOA 3ADAC 5K20B 3V5RA 3PIOQ 3P6YC 2NZ4A 4DR1J 4RZRA 1IBLJ 1D09B 4UZCA 5E2QA 2JRSA 3ISND 1SV5B 3MR2A 4PWDA 2CJBA 4KRWA 1IR2A 3DGPB 2PMHA 3UWTA 2O3DA 3GSIA 2HQCA 3TZYA 3MAAA 5F8LA 1S1UA 1BQMB 4ELTA 2F65A 5IV4A 1F9FA 5EHHA 1A6LA 5KFXA 1YGYA 4RWXA 1U2FA 1X9WA 2ZHAA 2WW4A 2RU3A 2C3UA 1N6QA 2CPYA 2YXLA 5A2QU 3FBBA 4Y3CA 3BBFA 5F0UA 2HVZA 4U96A 1OPIA 2HYIB 3LH2S 1F5CA 2V8PA 5DO2A 3FZ2A 2PN6A 2ZD1B 2R8HA 2DR8A 3EDQB 1UL3A 4IRCA 2IY5B 2MZ1A 1RHKB 3GR0A 3U02A 4LBPA 3BS9A 1D0EA 2FHJD 5BYRA 4ER8A 5EWFA 2V6AA 1MNEA 2WOMA 1SJ1A 4O3PA 1SKWA 1UFKA 4DSFA 3N79A 3LP2B 1UJ6A 4QYZK 4MKYA 1QLNA 5U47A 3FC9A 3L7PA 5LSOA 5IQ6A 1NSKL 2AD9A 2ROPA 4YOEA 1RT3A 3CD6S 1PJ7A 3RAXA 5HMXA 3N6LA 3NWGA 4KKOB 4CTAA 3VWSA 3Q0AA 2JEFA 3VGSA 4KE5A 5B7WA 4DR6F 1IKWB 1NLKL 4F0KA 3OXGA 1HQUB 2ZH6A 4ZK7M 2AF6A 3B78A 3PFEA 4F4WA 2XY6A 3BKTA 4P10A 5ETVA 1JJCB 3V2UC 4LF7J 3QGIA 5A0YB 5L1JA 3CSKA 4RNFA 4PXBA 2HVHA 4FKYA 5HO4A 2Z2MA 4YEAA 2DGWA 4U95A 4RL1A 1VRTA 1WC1A 1OQ3A 3MUMP 3SCKE 4NE9C 4MKVA 3DU5A 2GV1A 5C24A 3RRGA 3KK3A 5KFAA 1LNQA 4TY9A 2RILA 4M5LA 3NRBA 3V6HA 1X0PA 2Q43A 2M2BA 1NDLA 3M1VA 2M7SA 1MN7A 3AFGA 3D0HE 3R2CJ 5KT7A 2RQMA 2IMWP 2QX0A 1SH0A 3A3NB 4Y2AA 4ZP9A 2R8GA 3CIZA 4NX9A 3CCTA 1GX6A 1AUDA 1U49A 4C11A 4GKKF 3EGZA 3MR7A 2YPZA 4LF9J 4C7QA 5J1PA 2WSFC 3M8QA 4ZVPB 5ADZA 4WFXA 4C97A 2FHJA 4X84A 2HPUA 3I0SB 2D3O1 3I31A 3WDOA 4X62F 1KQSR 1G7CB 4F3OA 2VQEF 1RB0A 1M5SA 3D4JA 2QIFA 2B9XA 3UN3A 4A48A 2R8IA 2AJQA 2R2TA 4DFMA 4OX9J 2LQ9A 2WW8A 4J9OA 2HHVA 2HZAA 3LO3A 3M2RB 4PXEA 1HBNA 2O1PA 4X4QA 1QAYA 2XG8A 5D78A 3FSYA 2YKMB 1OJ4A 3AQOA 2ALZA 4F0MA 3QLHB 2W4DA 3R5JB 3O5TB 1U25A 1XMBA 3GIMA 5B0EA 4WWSA 2XULA 1PJ5A 4CO4A 5LJ3Y 5DGBA 2NPIA 2M5YA 5IWAF 1FO1A 2B51A 3SQGB 1QTMA 3DLBA 5GMDA 3ZZPA 1DQ9A 4MH8A 3G2XA 2MTLA 4ANCA 2Z56B 3LTOA 4K4WA 2AYEA 1J27A 4J9LA 4JI7F 2EG2A 1IXKA 1FJEB 4OL8A 4LMZA 3MM8B 2HFUA 2FZGB 4EMDA 3AA9A 3QGGA 2YTCA 4EU0A 4A4JA 3CCSS 1CS4B 2UXBF 4HI1A 3DOKB 4ZCIA 3H7HB 2CQIA 1TKXB 1VBKA 1U02A 4DF4A 1RYRA 3ZZZA 1FJ7A 3DLLQ 3O6QA 3IR7B 3SSSA 3O8WA 3MTJA 2DXFA 2P8IA 2EBEA 2QA2A 1Q5YA 3RUBL 3MMAB 4YP3A 4HT7A 4DLEA 2CDQA 3IRXB 5B0BA 4NLWA 4LRFA 2NSBA 4TU7A 3BGLA 1JLBB 2CDRB 3CJ3A 2V4JB 4YB5A 1IM4A 4DUTA 4I7FB 3PW4A 1JLCA 4EBCA 1WKKA 3QQCD 2GS8A 4IQMA 4WE1A 2ZWOA 2AEFA 3P3DA 4CYUB 1RT5A 8RUCA 1X4AA 3W2VB 2GVZB 2LQ8A 3G4SS 3FRYA 4DV1F 2BR0A 2O01C 1LFPA 1Y5IB 1R31A 3MCOA 1HA1A 4IYQA 1PO6A 5KG0A 2F8MA 5CYQB 2OPSB 2MJNA 1B70B 2HURA 2YNIA 1I3OB 4RW6A 4ECQA 3EX7B 2KJVA 3R6GB 1S57A 2UXCJ 4ANDA 1R6YA 3AB2B 5GAGI 4PG8A 3ETOA 5A8WB 2QC3A 3P8BB 2HMIA 3MECB 5D4NA 3C3LA 3M8WA 3UDVA 4R8UB 4OFZA 1CJKA 1JMTA 4JV5F 1WF1A 2H9ZA 1VBYA 5HQMA 1X4DA 1PC4A 4EGLA 3IN5A 3HKWA 2DR6A 3GIKA 4RNNA 3WQPA 1E6VA 1WHVA 4AT1B 1XMQF 1SJFA 4ECTA 2RF2A 1PILA 2HS0A 3QSIA 5E3PA 1HQEA 4LREA 3MMJA 4WKYA 2PD1A 3OSPA 4DL2A 4B9TA 2MKCA 2OPQB 3RB3A 4ID5B 4PYAA 4RO0A 2QMWA 1EP4B 4NA2A 1HNXF 1TL3B 3CCZA 3CDBA 4ICLB 2KI2A 2B9WA 4XIUA 2JLFA 3RR8A 5B0FA 5ETKA 2BJ7A 4F36A 1S1TB 5CA5A 1SJQA 2GHVC 5CHCB 4L73A 3VAHA 1S9GB 2B9YA 4MIBA 2DK2A 3FEZA 3ET6B 3PXGa 3J7AN 4HT5A 5HL7Q 5CXTA 5IC4B 1U45A 1RT2A 4OJHA 4HR2A 2AGPA 2R7SA 4NLTA 1HWIA 2R8KA 3W9IA 2DY9A 1GXUA 2C2EA 1JWWA 4EO6A 1QY7A 1URRA 2NQPA 3FBCA 3GV7B 3CDUA 1RWUA 2RE1A 1KFSA 4NCGB 5JMNA 3BN4A 2MQ8A 1QAXA 3FVYA 3LALA 4IFVB 4W4MA 1UETA 3C14B 5KT6A 4UOGA 5L9NA 5CYMA 4C2MA 3F73A 4R25A 3H5YA 2QT7A 4L3KA 3TQEA 4C9DA 4LF8F 3HO1A 5GMKa 1ZA1B 4K4UA 3H90A 2RT3A 4Y2MA 2KVQE 4RW9A 4J5OA 1M5OC 2AT1B 3QT5A 2VBZA 1S10A 1WJ9A 4Q8EA 3L3CA 2QLJB 1UVJA 3L7OA 2NSCA 1T8EA 1HNZJ 2JEIA 4PAAA 2C3YA 2BJDA 5GMEA 2VKZG 5KOXA 4ZVFA 5F9NA 2ACYA 3OQ2A 5B09A 1NDKA 1D9FA 3UDEA 4IH6A 4M1KA 5ITHA 3EPIA 4WU2A 1FK9B 3VCDA 4OLPA 2LXIA 1KBRA 1RK8A 4ZVOB 1VMBA 3EXCX 3VAKA 1J5OA 1L3UA 3V6JA 5H9EJ 3V4IA 3OTBA 3PYGA 1X4BA 4DV0J 3KLHB 4K8RA 3MR5A 2OSQA 1X4HA 4DQQA 1VRUA 4K4VA 3EZOA 2ZJPQ 3KLFB 1HI8A 4OYBA 2JC1A 2MGZB 1VC0A 3TZXA 2RJZA 5KFRA 1WC6A 2AYMA 3QO9A 2XI3A 1W2IA 1GMUA 1N33F 3IR6B 5KFQA 3TP2A 2J9DA 3SBMA 1CQNA 3WC2A 1S48A 2M8DB 1ZPWX 2P5VA 2CAJA 3M6WA 5IQQA 2D3ZA 1NSQA 3BGUA 5C2CA 3CGIA 3M8RA 2R7QA 1ITPA 3SCJE 2P9CA 4DR2F 1WNEA 1ZM2A 4OYMA 4BWMA 2UVRA 4OZ2A 2KN4A 3QFHA 3KK2A 4B3TF 4AL6A 2HHWA 4NZ7A 1FERA 1FX4A 2HHQA 1HD1A 4NXNF 2PFFB 5AXLA 2E7XA 1FFSB 1VQMS 5KFHA 3BGRA 1KN6A 3DOLB 2AJ1A 5FIIA 4C4WA 1CC8A 1LWFA 4Y65A 2XSJB 2RU9A 4FBUA 2BXJA 1PYSB 5J2MB 2W9AA 1X4EA 3PHTA 4W90B 1IR1A 3C8YA 4H4MB 1Y5NB 3OXFA 3LA0A 3RR7A 3TAPA 2XZDB 4MTPA 2ZH3A 5A76A 2XM3A 3PACA 3HSGA 3T5LA 2Y8WA 2KO1A 1QSSA 2RB7A 3TJ9A 1X0FA 2IRXA 3IR5B 4ED3A 2CKWA 1FNMA 4DJBA 3O3LA 2BABA 3ZZYA 2CXEA 4XPEA 3OFEA 1U0SA 1E6YA 2A2CA 5MAOA 1FE4A 3K0JA 4QWCA 1MWQA 3EPGA 1CJVB 2ZHOA 2C2DA 5GADI 2KRRA 4ELUA 2IJRA 2OPRB 2W24A 4TYBA 3BB5A 4OHVA 3VTIA 2IM0A 4TQSA 1S1VA 3EGVA 2LQBA 5CCLA 4K0KF 3CO9A 1MLAA 2E5IA 4F67A 3ILLA 3RBZA 5I42B 1BY9A 5DDQC 2ZZMA 3H4DA 2VG5B 2C2RA 3C6TB 4WCEQ 2BM1A 1BQNA 4JI1F 4E0DA 2XGPA 2FQQB 3J81U 1B99A 2HHSA 4I2PA 3H42A 3DLEA 2FLOA 4OQJA 5HVFA 1FD2A 5T14A 1XNRJ 1IWGA 3H0PA 1RT4A 4OI1A 2RSQA 3OR2A 3IC1A 4URGA 3BPSP 3PO4A 1Q79A 4JI3F 1QAIA 4K2JA 1K47A 3BJYA 4NLGA 4LQ9A 3DKDA 2K8GA 2HVEA 3H8YA 4A8WA 3UD4P 1FD8A 5C42A 3V81B 1F5BA 5D6GA 4UUWA 4IOBA 4FN5A 2VQFJ 1N56A 3JSBA 2H3EB 3A13A 4MT1A 2N7CA 3R5DA 2FLLA 4Z7CA 2HNDA 3K17A 2UUBF 3DOMA 1FXLA 1REVA 1MWZA 3K8VA 3W8GA 2U2FA 2BZ2A 3SDEB 2CJAA 2E44A 2F5GA 3RAMA 5L1LA 3GG0A 3GFYA 1CQMA 3NCQA 1RT1A 2EWHA 1C1BA 3ZTQA 8AT1B 5KFSA 1TL1B 4WK1A 3LGMA 3J80Y 4ZP7A 6FD1A 3RB0A 1JK9B 2E1RA 1BUXA 1R0BG 2XMAA 2DNMA 2D41A 2RS8A 1R3NA 1JLQA 4QPTA 1BD6A 2GIFA 2CPZA 3HK2A 3DFEA 2HNZA 2FUG9 3KKFA 4MIWA 1A7GE 3MUVP 2VJUA 5BR8F 4UY85 4LSLA 1UZHA 3R5BA 3RRKA 1FFGB 2BOAA 3DRYA 4USJC 3ZTPA 2K1RB 5A6WA 4ZLPA 3MF5A 4Q5VA 2LMIA 1Q82T 2R7RA 3LAMA 3D6FB 3TWZA 1V6HA 1WF2A 2QE5A 4ZP6A 3HZGA 1RLCL 2UV8A 4RW4A 4CLPA 4P7TA 3DGVA 2ZE2B 1NPPA 4WIQA 1U0HB 3TRGA 2MLXA 3MEEA 3HHNB 2V8GA 5AE2A 4UW2A 1T11A 4ATNA 2E5JA 1P27B 1UPMB 3VALA 4DV4F 1EB0A 1S9EB 2DGOA 4HH1A 4FNIA 2JEJA 3P45B 2I5JA 4QWDA 3X3UA 2GC8A 4QWAA 2FJWA 1HWJA 1S0MA 5KFDA 4PPDA 1H73A 3VAGA 4F04B 1KVIA 5J2PA 3MFIA 1LWEB 3LP1B 3M6UA 2C2ZB 4HVZA 4OYZA 2KRBA 4QU7A 1EQMA 1XC9A 2OHDA 1TVRB 3AHPA 4X4SA 2XS2A 4CLTA 2DNQA 2OELA 2XEXA 2OAUA 4KTQA 3DLHA 1RADB 3E3XA 5D0EA 1P1LA 4B9VA 1FA0A 4NLRA 1OSCA 2DGSA 4LF4F 3DDIA 2DEJA 3OVBA 2GO8A 1UEUA 3RBEA 4ED5A 3GIJA 2MXYA 2Z58B 2F4VF 4R5PB 2NR0A 4LBIA 1FRLA 5JJBA 5DRKA 1YLXA 3ZNJ1 2ZH8A 1LXNA 1JLEA 2J8AA 1LKZA 3MEDA 1N5QA 4NXMJ 1F2GA 4W98A 2GHWA 1RTIB 1TP7A 4WP9A 3M9MB 3GMGA 4ED4A 2AJ4A 4X65F 4DR7J 5HN0A 3KNGA 2IBOA 1C2PA 2HFSA 2QL5B 1YWXA 3SIPB 1CULB 3KK1A 2NLWA 1HWKA 2QN6B 4YR0A 2OP5A 2CNOB 1RTHA 3PVXA 4O4GA 4DEZA 1RWWB 1UWBA 2YQ0A 4KR0B 4OIXA 4TLQA 1T3OA 1B64A 1RT7A 2Y3YA 1B0PA 2KFYA 1VK8A 1OSDA 4NCBA 5ETRA 3QJJA 5DETA 5C7PA 4LFCJ 1JQGA 2VONA 3J81j 1WKLA 2DNPA 3OJUA 2HGLA 4J91A 2YNFA 3I9V9 2GGPA 3NCPA 4ILRA 3M9NB 1C0TA 4WXOA 3TA2A 1P6TA 2CQ3A 4WXWA 2YKPA 3PYDA 1ZZFA 3U1LA 3G82B 1AUSL 4DCOB 2OEKA 3FNNA 3AODA 2XMMA 5HVHA 2BJ9A 2AQ4A 3A3OB 3H5XA 2UUAF 2WSCC 4EBEA 3N5BA 1H98A 1AT1B 4F50A 1RI7A 1VI7A 1EQ0A 1LWCA 4B3SJ 1LW0A 1RZMA 1MSWD 1M1HA 1RTDA 1RWKB 4E8UA 1NKEA 2GCFA 5AJ3F 1GXLA 3MGJA 1S1XB 3PJ9A 2VG6A 3G71S 3DRPB 3ENQA 3JAMU 3QFWA 4L74A 2BE7D 3SV4A 4M5HA 2DH8A 1HHTP 2XO7A 1S4FA 5HP1B 1W7WA 5KT5A 2IRUA 2JJ4D 4FS2A 1Y0HA 3PR4A 4UQGA 2VZ9A 4LF1A 2MZJA 3JTPA 1UP1A 4CLWA 4B3RJ 2R3VA 4DPUA 4DX7A 1R0AB 2J9DE 1GMWD 4USWA 2ILYA 2CWXA 4DSJA 2R2UA 3N01A 4Q8FA 1XR5A 3HULA 2BQ3A 4U8YA 4F0HA 2HQDA 1KVKA 4RW7B 3ISNC 3OL9A 4X66J 1F9EB 4JI5J 2K3IA 2PT0A 4PG5A 4LFBJ 5DDRC 1S6PB 2I38A 1XMOJ 2HLUA 1LW2A 3M2VB 4DR3J 3C46A 1XBWA 4KHRA 5K14A 4P74A 4JI6J 2B4OA 2XS5A 1LK5A 3AJ1A 4ECUA 2KM8B 1YBAA 3OVAA 4AXIA 4ECZA 4FNHA 5J2QB 1Q7LB 3IGNA 2XMVA 4O44A 3ZTRA 2WVEA 3LWMA 2DNYA 3UN2A 3FK4A 1VHFA 4MK9A 5KFCA 1NH7A 2FC9A 3UR3C 2DGUA 3Q8VA 1JKHA 1M1GA 3FCHA 4EFAC 1S0VA 1XQIA 5THWA 4Y2IA 3GFXA 3UR0A 3W1YC 2V9WA 4CNYA 5KAKA 4BDPA 4KGKA 2OJ3A 3UCZP 1IKXA 2JLEA 3AH6A 3BQ1A 3SCLE 2VOOA 4NYPA 4ZS6A 3KLGB 4G1IA 3D2WA 2HHHJ 2OPPB 4RR5A 2YQ3A 4ES2A 1YRTA 2W9BB 4FXDA 1FHTA 3M8ZA 2VH7A 4LRCA 1GT8A 2PI4A 4MJKA 3Q23A 4DV3J 1GMWA 3TAQA 1F9HA 5CABA 4LR9A 1UKUA 3GYGA 4WZMA 3T6BA 1NK4A 5T7LA 2IBKA 4TU9A 2DO0A 4B9UA 1RYSA 1W26A 2C3PA 4AQYF 3VAIA 3TAMB 4OHWA 2AJ2A 4TN2A 3ZZRA 2YNGA 3MCMA 1S49A 2R2RA 3TANA 1G4CA 1FKPB 2AMCB 4HACA 5KFFA 4O0IA 1KQKA 3RW7A 2W01A 4DCPB 1U6ZA 3PRBA 1IQZA 1IKYB 3E8OA 4OI4A 2VFSA 2V2VA 3BKUA 2IM1A 3MCNA 2E9RX 4KT0C 2CYYA 3D67A 2BQRA 3EMTA 2FC8A 4ZA1A 4RBUA 4DHVA 2P9EA 2GNKA 3LW5C 2B5JB 2DPIA 4RUCA 2YKNA 3KLEB 4YHHJ 2KT5A 2JVRA 1HQ2A 4DXLA 4RX6A 3GZ7A 3S1TA 3KDOA 4OX7A 2E5LJ 2D74B 4XTTA 2DKOB 4QIFA 3RG6A 2CPIA 2YY3A 1FJCA 1EX8A 2JSXA 4KV8B 2E9ZA 5CD4A 4ITSA 1JLAB 4USTA 1T9YA 2HNYB 1N36F 2MLZA 3FFIA 1WHYA 2ZFHA 2E5HA 3EZ5A 5FDLA 5E3CA 3T6JA 1YJWS 2LU1A 4F7VA 4LF6F 2KTQA 1HNIA 3I4PA 1Q8IA 3VV2B 3WC0A 2ZBQA 4KY3A 1BMQB 2OD6A 1NK9A 2H5IB 4QR1A 3GP9A 1I94J 1T9XA 4HDGA 1K0TA 1KWMA 4DL7A 2YH0A 5I4MA 1NB7A 1YG0A 4JV2A 3GYXB 2FVCA 1LOUA 2ZJRQ 3DRSA 2H5EA 3PX0A 4RPFA 4Z37A 2HWHA 3ITHB 1U1KA 4RU2A 3BR8A 3BEGB 3ILJA 2W9CB 4X4OA 2YNHB 1O51A 4I0WA 2JFDA 4PQUB 1RAIB 5KFTA 4CNZA 3JYTB 2GA7A 4ELVA 2Q3PA 1DTQA 2CG4A 3MD3A 4AUKA 2CNLB 3CUNA 1KP6A 1TKTB 2VUGA 4U7CA 3KHGA 1UEVA 4IO1A 1ZAVA 1DY3A 3KLIB 1SPBP 4DR1F 1IBLF 3AJDA 1H7XA 1QUPA 3UVJA 3QIPA 4PR6A 1U48A 4QIVA 2RD5C 1IKVA 3BQ2A 1VRTB 4BBYA 3Q24A 4DG1B 4H4OB 4P9SA 2B7CB 4UT4A 2L41A 1ZPVA 5F8HA 4PUOB 4QR0A 3IAM9 4P72A 3ILIA 4LRDA 1B4SA 3IS9B 2AX0A 2R4FA 4UF4A 3M1VB 3HZEA 4ECVA 2G2OA 2RKIB 3DGPA 2QSFA 3NXZA 2VDHA 3T1YJ 4NLQA 1HKAA 4DN0A 4F2RA 1EIYB 2BEFA 4A8FA 2PDAA 2R7VA 2PI5A 3RRHA 2EKYA 3AOBA 5IS2A 1BQMA 5GAGU 3UD5A 2DVIA 3BSNA 2RDIA 2IYIA 2NXEA 1G6BA 4C98A 2MJUA 2Q79A 2HRYA 2DGVA 1WDDA 2JL9A 2KYXA 3KOAA 3NBPB 3ENAA 2EW9A 1JLFB 2BW2A 2LQJA 2BQUA 2BM0A 3OV7A 2X1GA 4TY8B 4DN9A 4MFBB 3CMQA 4LIWA 3OHBA 1MG7A 3DDNA 4Q43A 1LQ9A 2Y1IA 2ZD1A 3MHYA 1N0UA 4C0BA 2FVQA 3NS5A 4YN3B 1EARA 4LR8A 1YBUA 4C0HA 3QIDA 1FTRA 4ED8A 2ZH1A 4ECSA 2MKSA 2RUGA 2A6OA 3CTRA 2XHCA 4FPIA 1SQGA 5K9FA 4QIGA 2W2OP 4X62J 4F8RA 2FY8A 1H38A 2C3OA 4XPCA 3LPYA 3BR9A 4LF7F 2CPFA 1H2UX 5IXUA 1S76D 4LR7A 3THPA 3ISZA 3PNIA 1VLYA 4K5RA 4KKOA 2PE8A 3ZO7A 4DV5J 5D4LA 4IG3B 1IKWA 1TKZB 1UMJA 5DS7A 1XJWB 1HQUA 1NHUA 3J80U 3N0VA 2KT2A 2F9DA 1S59A 3HCXA 5A0YA 3R2DJ 2CQBA 3R6LB 2EG1A 2L3MA 3K2YA 2V4QA 2BACA 3K7RA 3DHWC 3OXLA 2HG4A 2XLJA 3VAMA 1VQ8S 2FVPA 4CP5A 3OFFA 5L38A 2DNKA 1RTJA 2F63A 4ZPTR 3D0IE 1JNRB 3DI6B 1WC4A 4CH7A 3EJMA 4IR1A 2XCPA 1TELA 5D4PA 3OLAA 1C1CB 3TQ1A 3W60A 3OL7A 1T9VA 2FJXA 4HHJA 1CLFA 3HVTA 2BANA 2XQCA 3BYRA 3K5LA 3A8EA 4D3HA 3B54A 2DB1A 5GAHI 1VHIA 3NP5A 2ZUAA 5C5JA 2ZOMA 2NXNA 1SQEA 3R27A 1NDCA 3H5UA 1GQEA 4O3OA 2UUTA 3HT0A 2KM8C 5AE1A 3TUIC 4ZPDA 5HI7A 3I0SA 2GX8A 2QLFB 4HH0A 2YNIB 2M4MA 4USHA 4WKRA 6AT1B 3MPUB 3PKMA 1DFDA 5DQIA 2MPUA 1VJQA 3IFEA 3M2RA 2MEWA 1KQFB 1LV5A 4LVOP 3CDWA 1UCNA 4LF5F 1XERA 3T9ZA 4DV1J 3AQPA 1CJKB 1KS2A 3UNGC 5A8RB 3DN9A 2BBEA 3PCOB 4J37A 1U6FA 2HS3A 1SKRA 2YKMA 5ETNA 5D4OA 1E6VB 4KFBB 4URQU 2R7WA 2DGQA 5K8PA 4NLUA 4DL4A 2OFHX 1NMEB 3AOCA 3SCIE 2GMLA 5D3GB 1JIHA 1SVDA 4WTYA 1WTFA 2VV5A 1T0TV 4ZPCA 2HFZA 2X1BA 2UUCJ 5F8JA 5IV3A 4K59A 1S0OA 3C66A 2RNEA 3D3BJ 1GAOA 4B17A 3A8IA 3Q8RB 4B9SA 3RGIA 1YITS 1UPPA 3MM8A 2H48B 1CS4A 5K8MA 2Y1RI 3GJRB 2GJFA 4DLGA 2CFXA 3DOKA 1RA7A 4ZHRB 4UTGA 1TKXA 2DPJA 1M5PC 4AD6A 2KZMA 4C0OC 1OPZA 3FMWA 2Z4PA 2ZZTA 1TL4A 4GO5X 2CNKB 2JOQA 4LSZB 1YVFA 3MMAA 2DTJA 2WBMA 4OYXA 1TFWA 3UDCA 1NHVA 7AT1B 2DNZA 4FXVA 3RTVA 3SMZA 5FLXU 3MEGB 2HVDA 1VQKS 2LA4A 5AXNA 1JLBA 2JZ5A 2OKQA 2GQQA 4DR4F 3MM5A 1JJHA 4F4ZA 5CYMB 4HHHA 2ATLA 1JJ2R 2UXCF 5HQLA 1FT8A 1F3FA 2BRLA 3T1HJ 2EC0A 3G6ES 4QR2A 4AYBD 3D1OA 4RW9B 5HMWA 3WX4A 3I5AA 4CYUA 5IM0B 4TYAA 2A1BA 2XYHB 4KIAA 3W2VA 2GVZA 1H0HB 2XCAA 2NREA 1YJ9S 3MZIA 2C22A 3K59A 2J8SA 5CYQA 2OPSA 3SQOP 5KT4A 4G3IA 3MDFA 4L75A 2XC9A 1RWMB 1ZZNA 4OV1A 3M32B 4QCLA 2COLA 4ZPBA 2E7VA 2DHXA 1C0UB 2IM3A 1ACMB 3MECA 1R8BA 4NZ0A 3A4TA 4O3SA 1RWPB 4C3LA 3LGNA 4R8UA 3TOQA 4CLFA 4V19X 3OD2A 5AT1B 4DV2F 2FLPA 1QVGR 2DRAA 2EFOA 2X3DA 2G2ZA 4NWBA 4RBVA 2OTLS 3QRRA 5HROB 2JNJA 2AX1A 3CD0A 4QPXA 4J9SA 4Q44A 1NPRA 5HJXA 2OEJA 3JSRA 1RHQB 2OPQA 4CIOA 3NOGA 2OTJS 1EP4A 2MZQA 4CM0A 2KKHA 4LBHA 5G4DA 1KSPA 2Y1JA 1BWVA 2V63A 4EEYA 4F25A 1RAJA 1C4CA 2HRUA 4YDDB 1YRXA 5IZHA 2QFJA 1S9GA 3GV5B 4BWJA 2DCUB 3VHQA 5LM7E 3ET6A 2MQLA 1TQLA 3AXKA 3M8PB 1TK0A 3KJNB 4OI3A 4I4BA 5HLFA 2FLNA 4U67Q 2AZ3A 4NCGA 3HMJG 1VRQC 3CMAS 1SCJB 2DIUA 2UP1A 2HWTA 1UVKA 1HNZF 4IFVA 1PBUA 2ZOGA 3E2EA 3I32A 3C14A 4FKXA 3BGRB 1CJTB 3V4MA 1P1TA 1TK5A 2MKHA 1MWYA 1S1WA 3T3FA 3CW2C 1YK9A 2VOPA 3MR6A 1UAWA 5LSLA 2HVIA 2RQ4A 2LECA 1WSVA 3EWGA 1KKHA 4K4YA 2C2NA 1RAAB 4O3QA 1TL5A 2KT3A 4DZ6A 3C15B 2VICA 1RAHB 2RUSA 1OIAA 4P6QA 1X5SA 4DV0F 3VVUA 4WFZA 2CZ4A 1SH2A 3SXLA 1KR4A 1N52B 4NEZA 3QNWB 4NPOA 3H40A 1SC4B 4X64J 2MHEA 3QWPA 1LK7A 1U1MA 2ADCA 2P6SA 3CCMS 4NI2B 4NLPA 1FK9A 1N34F 3PJXA 3DLKB 5KFVA 1U8WA 1ZETA 3NGUA 4PZVA 3VAJA 2N4DA 2V2KA 4O3NA 2C42A 4RW8B 4AXJA 2W2NP 2D9OA 2E66A 3W8PA 1NKBA 3CO0P 4P2SA 4J9QA 3CCQS 3KLHA 2Q1LA 2XWXA 3Q2SC 1TAQA 8ATCB 3MR3A 1R6VA 1X4FA 1SL2A 2ZKTA 3KLFA 2L9DA 1Q78A 2BRKA 4RUAA 2MGZA 5DDPC 2FHOB 2E29A 4WK3A 5A8KB 2BYCA 5J2NB 3K5MA 3NWRA 3VVTA 5JVGQ 4P2XA 1BE4A 2V94A 3R7BB 2AJ0A 3B82A 1KFDA 4Y28C 3CC4S 3CJ8A 5A2QY 4K0KJ 3QYYA 1M1KT 2NUUG 4UUXA 3PX6A 4BHQA 3L95X 3CCWA 1NM2A 3M7VA 3HF5A 4UY8T 3H5SA 1SXLA 3HHLB 4DU7A 2RH3A 2GAGC 1FKAF 2O67A 3F41A 2GZOA 4A8QA 5DLFA 3UQSA 4FF4A 2NPFA 4ES1A 1BXNA 3OR1A 5LMNF 1U1RA 2MKKA 1N5TA 5C42B 2LCWA 4M94A 4WJBA 4ZLNA 1QVFR 2HBQB 2HWIA 3H2VE 1HARA 2AWZA 2W4CA 4DQRA 5DM6Q 1T9UA 4ERDA 3FCVA 4EYIB 2QJ3A 3HFZB 2VPZB 2ZHBA 3KUEA 4F4YA 2CG8A 4URSA 2XMJA 4FYVB 1IVZA 2KH9A 2K3KA 1NH8A 2IVFB 5J2MA 2BVZA 1CC7A 2BKOA 4RBTA 3MM7B 3EDRB 3ZTSA 4DX6A 4AL5A 4H4MA 3GWCA 5LSRA 3D1HA 3HJVA 4TU8A 1RACB 4LRBA 4B08A 3VAFA 2AJFE 1L5UA 1VLOA 3OUYA 4KHMA 5LMUJ 2JWNA 3LANA 2M3DA 2HNZB 2FJVA 4NZ6A 4DF8A 2HIYA 4ZN1A 2N4CA 4C8ZA 4JV1A 4IG0B 4LF2A 4ED6A 3L7UA 2OIHA 4DL3A 2D7SA 4FBTA 4WYWA 3POTB 4RNMA 3KHHA 1CJVA 3HDSA 3IMQJ 1DRZA 5DQGA 2OPRA 1WF0A 4JI0J 3FBFA 5EX0A 3LWLA 1XNRF 4X4VA 2CVEA 2VASA 4NMLA 3H25A 5GAEU 4RW4B 3CVKA 5I42A 2YH1A 1Y10A 1DTTB 2H4WB 2EC2A 3ZZUA 2I6WA 4K50A 3UFCX 2YWGA 4I6AA 4R0EA 1IJEB 5HMYA 4USUA 4DSLA 2VQFF 4PABA 1Q7YT 1WHXA 3EGWB 3HPOA 2FJEB 5DJBA 2B56A 1HLWA 3TARA 3FKBA 4JOUA 4CO1A 2HQFA 3EVOA 4DL6A 2HEKA 2FJBB 1YJUA 3BBBA 3D28A 3TEGA 1REGX 3KJFB 2B6AB 1HNVB 2PFDA 3CT9A 1VGYA 2R8JA 2YKAA 1NU4A 3V81A 1Y00A 3CJ0A 1KLMB 4PKDB 1RWOB 2AW0A 1DHMA 2DITA 2ROEA 3KMQA 3O2IA 1NSPA 5KFLA 5D0GA 1FWLA 3THVA 1HI0P 2CQHA 4LFAJ 2BJEA 1WUUA 4DPOA 1RISA 1MU2B 5MLCV 4F4AA 1F2HA 1MMDA 1FRJA 4EO8A 2LFVA 3N4WA 1Z4UA 4FVCA 4ZKAA 4P75A 4XO0A 1FDNA 2GAHC 2B4PA 2RRNA 4OI2A 2MY8A 4X4TA 2O66A 2A2DA 1PJ6A 3V6KA 1TL1A 3OLBA 4ZJQA 5I3PA 2ILZA 4ECXA 2F4VJ 1G3OA 1UVMA 1Z1ZA 4GC7A 5KFIA 3MI7X 4USVA 5HK4A 1N54B 2VKRA 4F4KA 3TVYA 1D1UA 3KUGA 1KONA 4O4GB 2ASYA 2XYPB 3GG1A 3SSRA 4DR5F 1WDTA 4L72B 2K1RA 3ZZOA 3DMJB 1Q0NA 5F41A 3ETMA 1YJNS 3UCUP 4YR3A 2F9JA 5J1EB 2EPIA 1Q8LA 1NJYA 4CM2A 3CE8A 4NLYA 4TVAB 1RJJA 2L08A 5F8NA 4C8YA 2J6SA 2EK6A 3QZ7A 3EICA 4NASA 2QL7B 4EK2A 3R7NB 2YNFB 2IAJB 5E0OA 1WC0A 1U0HA 3C16B 2KG0A 4GVBB 3BH7B 3SV3A 1FJGJ 3TJ8A 4OLOA 4WU3A 1QE1B 1WELA 4CQ1A 1S9EA 1T03B 3NMRA 2JHEA 2YWHA 2WZ1A 2F40A 2JH3A 2L9WA 4Z2XA 5DZ6A 4DQPA 4KPCA 1WI6A 5L39A 1FRMA 2XSFA 2QYGA 1O8BA 4PEOA 4RU9A 1I51B 2DD8S 1T7PA 3CULA 2GHPA 3DRRB 2M8HA 1NK8A 1LWEA 3LP1A 3WX8A 5CZVA 3KJVB 2WAQD 1FEEA 1FE0A 4HTJA 1JLGA 4ZVGA 1ZTTA 3D6HB 1TVRA 2KHCA 2MQOA 1NJIT 4H4KC 4NXMF 3GONA 1SBRA 3HM9A 3G86A 3PYEA 4ZPWR 3TYTA 3QZ8A 2RS2A 4DR7F 1HBOB 3AOAA 2X51A 4ZP8A 3VZIA 4UOCA 1MROB 4R5PA 4IDKB 1JJ4A 4HL9A 3GJSB 2ZM6J 2D1CA 3R8YA 3ENVA 4ZVUB 1N32J 3QT7A 3TUZC 1Z2ZA 1K8AT 5ETOA 1VOMA 1RHJB 1UW4A 1RTIA 2Y8YA 2X1AA 4CH0S 2RRBA 4RNHA 4JP8A 2ZZNA 1SUQB 4LFCF 4OYPA 3R7SB 2QA1A 4IUFA 1CULA 3RYLA 5DG8A 3M9OB 2LVWA 4DV6J 3PRDA 1HPZB 3GILA 4PXDA 1NCLA 1R8AA 5L1KA 4I69A 1AA1B 2UVUA 3D7SB 4DX5A 1NDPA 3K57A 1OWXA 4I56A 1GX5A 1MMLA 3R1HA 1TKDA 2ACMA 1RA6A 3CJKB 3N28A 3FRZA 1JKHB 2J9CA 4QJVA 4FF1A 2GVDB 3ICLA 2EFGA 5AXMA 2YX1A 4EZ6A 4B3SF 3I6PA 2ASJA 2BE2B 1QJHA 1NBEB 7FDRA 1UEKA 4Q0BB 3G82A 3M8SA 3SSQA 5D77A 2QA4S 2VC0A 2AEJA 3JTNA 4Q7AA 3GJTB 3HJFA 2EKNA 1ZBTA 2WTFA 3T5HA 3MM6B 3CCLS 3EZUA 3RZAA 3V6DA 1NPKA 1M90T 2E1PA 4OJ3A 5I3QA 1T94A 2CPJA 2NYIA 4B3RF 2HRTA 1X9SA 1HWLA 2MDAA 2VDIA 4ID8A 3HFKA 1S7HA 1H72C 1R7IA 3DRPA 4A8YA 2NUHA 3HHLC 3KFWX 4UOHA 1SJ4P 5HP1A 4EUVA 1HBUB 3MPVA 4MK7A 2D3UA 3KUHA 3I96A 4X66F 1RCXB 3CC2S 2CIMA 4WTOB 2CPHA 2B43A 1WG5A 1R0AA 4B3OB 1TFYA 3MMCA 4PWWA 4HEA9 1XMOF 4DR3F 4IRDA 2WVFA 4TKTA 3TVKA 2ZOFA 4JI6F 1Q81T 4J9VA 3OL8A 1P9YA 1VC6A 4ECWA 2ERRA 2R7TA 4RW7A 4JI2F 3JSMB 3OT9A 4M5DA 4A8XA 2HHUA 2WVBA 2VFVA 2DNRA 3UI3A 2OEMA 4YMEA 4OZ3A 3GIRA 3AD7C 1S6PA 1RU2A 1ULRA 3BO4A 1HFEL 2LP4A 3NKYA 1SL1A 4Q45A 4ZN3A 4EYHB 3M2VA 3RB4A 1VBZA 3FMBA 2J6UA 1FVQA 2PIIA 4RNOA 4DUYJ 3G8TA 3MD1A 3BSCA 5J2QA 1ROFA 2ZBIA 4C8MA 2XMKA 3J7YI 4N56A 3G6YA 2OLWA 4DCJB 2DNNA 2C2KB 2J0QD 4UZBA 4K5SA 2OFGX 1U7LA 4N8NA 2P6TA 2ASLA 5C25B 5BYSA 3QBCA 5IT4A 2HHHF 1FCAA 2MZSA 1X9MA 2CJKA 3DYAA 1YJVA 2LKZA 3BYPA 1TL7B 3K8WA 4KGVB 1RWVB 4RUBA 1V3SA 3NGSA 3ENWA 3MM9B 1RCOB 2CQDA 4LUBA 3BPDA 3CJTA 1EHWA 2HLTA 3M6XA 2CJ9A 2FZCB 3KLGA 3OVSA 3IWNC 2ZBPA 1HR0J 4G1QB 4EWTA 1N0VC 3I56S 5B0GA 1O0PA 2MKIA 4DFJA 2PMWA 1OYDA 1NK7A 1OS5A 1WORA 1KTVA 2W9BA 3BV8A 3EVWA 3UDLA 3PKYA 4CI0B 2CVIA 1FDAA 3J7ZT 1EETB 3SYZA 4ZIVA 2V67A 3KJQB 5DG9A 2K06A 2J7UA 4JYAF 3EXYA 3CF5Q 1T9TA 4HI2A 2OH2A 1G1XA 2FGOA 3UCGA 2NXCA 3TA1A 3JS9A 2V5HG 2XMUA 4DV7J 2DY1A 1FNOA 1ZA2B 2G1HA 2YWKA 1DLOB 1GTEA 4GC6A 3CJ2A 4J9NA 1M0SA 3W66A 3G87A 4X4RA 3U7JA 3CJSA 3NL0A 2ZBRA 2LEBA 5ETLA 4K4XA 1FKPA 5JUMA 4YHHF 2BA9A 3DM2B 4OHYA 1RHUB 3CPWR 2AU0A 4IFYB 3W63A 5KFYA 1HHQA 2E5LF 1IKYA 3ZC4A 5CD4H 1QAJA 4WIIA 3PM9A 3QRQA 2HK3A 5KFGA 1IBCB 2IFXA 1FKOB 4LJMA 2HQGA 4FF2A 1RUSA 1X4GA 3M30B 3R3TA 2B5JA 4KHPF 3G9CA 3Q8YA 1TZ0A 2HQIA 1FWKA 4WFBQ 3KLEA 1YJTA 3EYZA 4ZOSA 2FGCA 1AZSB 3H59A 4NMXA 2GQCA 3FSIA 3BM7A 4GKJF 2F3JA 1I94F 4G6VB 5ETMA 1TUWA 1HBMB 2Z2ZA 3LF0A 3L9ZA 2L48A 2VB6A 4KV8A 1OMSA 2W1BA 1QTNB 1JLAA 1IUJA 2KXFA 2EFNA 2HNYA 3NG8A 3GV8B 3BH6B 4ZVSB 1N5YA 4KBIA 4CLKA 3A12A 3KWMA 1H74A 3AD8C 2FVRA 4CLUA 4K4SA 3P96A 4DBQA 1R8CA 1L3SA 5KG2A 2IDEA 1XR6A 5F3TA 3RAQA 1U1NA 4MIAA 1UA1A 5RUBA 5H9FK 2UU9F 2FTRA 2XO6A 1Q1KA 1DZ5A 3PR5B 3TVZA 2KXNB 3PZPA 1KNZA 3ITHA 1B3TA 3MAHA 4IOAQ 1ZM4A 2W9CA 2YNHA 4HLBA 4IRKA 4PQUA 2V68A 3JYTA 5CQGA 3D54A 3G8QA 4Z7YA 2RQKA 1TK8A 4KO0B 1Y5LB 2R7UA 2B7BB 3OFGA 1S79A 4JI4J 2HS4A 4O4RA 1TKTA 1EJ7L 5D15A 2JC0A 5ETSA 3KLIA 1WOPA 5T41A 2IM2A 2G13A 1X5TA 1N5VA 4ED1A 5D0HA 2QA4G 1GXTA 2FB0A 3QGHA 3T1YF 4ZPAA 4ZVHA 1JX4A 3WZ0A 1YI2S 1DQAA 2DNGA 4DG1A 4H4OA 2HFNA 5EN1A 2NCKL 1RTJB 4LSNB 1WWHA 1R43A 2FZKB 4PUOA 3O44A 1NB2A 2JDJA 2WSEC 3IS9A 1F60B 2I8EA 4MK8A 3E01A 4ETZA 1KRPA 2D69A 2ZH4A 2UZAA 2RKIA 2HGNA 2DHGA 1CJUB 1TTHB 1VC5A 4PQAA 3HVTB 2DRDA 2BANB 1S0NA 1F0XA 2FDNA 5D8HB 5ETPA 2AYGA 4WFAQ 2GFFA 2WB1D 3TUPA 1YTYA 3NCRA 1BQXA 3UNYA 3PJWA 5ETQA 2B0GA 3NBPA 3KNAA 2N3LA 1OO0B 2Y0SD 1JLFA 2QLWA 2ZBCA 4TY8A 2V8HA 4MFBA 2MSTA 2J7WA 2WONA 5DG7A 4B02A 2G9OA 3R97A 2Q66A 4XK8C 4DPXA 5BXIA 4E2FB 2POKA 4DV5F 2QGFB 5E33A 5KG7A 3NY0A 4OZ1A 3G6VA 3JB9k 2DHAA 2JX2A 1ZOTA 1WHWA 2ZUGA 1XNQJ 3DRXA 3IM9A 4NL5A 3OTOJ 3PEJA 5E3AA 2J76E 2ZH7A 3DXSX 1DAXA 1U1QA 4KJIA 1S12A 3BN7A 3TJAA 2QZ8A 3SEOA 4KC5A 6FDRA 5LXRA 2Y0BB 2AGQA 1VQPS 3KG0A 1S77D 2FJDB 2UXDJ 1K0VA 4LF5J 4IG3A 3IG1B 1T05B 1TV6B 7FD1A 1YBTA 3H2LA 3TZWA 1VQ6S 4WF9Q 3WHIA 1TKZA 2A10A 4F26A 1KVJA 3FUYA 2CUYA 2Z57B 2ZKUA 5DQHA 3N6MA 4DFPA 2WB4A 3MURP 2VG7A 1G2EA 1DARA 2W8KA 4ZDNA 3CD7A 4XDDA 1U2CA 4LIRA 4ECYA 2RQCA 3K5OA 1CSJA 4Q2MA 3S01A 3MUTP 4EZ9A 4QW9A 3KG4A 1U1PA 2H5JB 4NLVA 1H6KX 2YQ1A 5DGAA 4FS1A 2E1CA 1S4EA 3QMQA 2C1EB 2ZH9A 4M95A 3L09A 4IH7A 2V9KA 4YB7A 2MSSA 4B3MJ 3DI6A 2W7OA 5HMZA 3PDNA 2YWFA 3VF0B 5SZTA 4A8SA 3UO0A 2ZH5A 1C1CA 4DU8A 4OYIA 1RGVA 2IC3B 3MM5B 3Q8SB 1WC3A 1L3VA 1F5AA 3JAMY 5IT0A 1VQ4S 1U6BA 2XTJP 2WHOA 3VGUA 3B4DA 5C2GA 2MKYA 1NUEA 4OZ0A 2MZRA 3HI9A 1IWAA 4M5NA 4J9PA 2XI2A 4CLYA 2VFRA 2AEMA 3G6XA 3CJQA 4O3RA 1P8GA 1LEOA 2ZC3A 4DR4J 3T1AA 4J9MA 4DUZJ 3HHEA 3W5XA 1HD0A 5K8NA 3G96A 4W92B 1NJXA 1IQTA 2IHR1 1Z2LA 2APOA 2DEIA 1Q16B 2FIUA 2UUCF 2HQ3A 3N5FA 1N4LA 2XWYA 1HMVB 5HBMB 2BDPA 2VPYB 1S9FA 5A8RA 3CC7S 4B9LA 3TZZA 1RBOB 4YDXA 3FCWA 1OQ6A 4FYWB 2CQ0A 4KFBA 4MKAA 1DBDA 3PO5A 3BGOP 3I0RA 3THTA 4AFFA 4USMA 2GW8A 4N5SA 2DJWA 1S6UA 1RXOB 1VQOS 2NYHA 4JI8J 5D3GA 2OUGA 1SIZA 2VA2A 2DBBA 2W4PA 1T02A 5M2RA 3OFHA 1WD6A 3AB4B 3TW0A 9RUBA 3OHAA 4G65A 1WOSA 1WEYA 4R0JA 4DV2J 4CZCA 4QIWD 2W8LA 2WRMA 2BJ3A 1SQFA 2C2OB 3TEHB 1S6QB 5FJ4A 4U6PA 3CDEA 1NRKA 1RBLA 1F1BB 1FRXA 4J90A 3NNCA 1IN0A 4WBFA 3JQJA 4ZHRA 5KFKA 4DX8H 3PG9A 2B8QA 3T1HF 1D8YA 4TLRA 3M2UB 1RDRA 3MMBB 1PG5B 2BV3A 2HHPA 1ZYQA 5HLFB 1BHNA 1SJ3P 4USKA 1FX2A 1LFWA 1R27B 3I82A 2CPDA 3LP0B 1Y3JA 3MEGA 2FVSA 1R0CB 3Q89A 2G2YA 3W2WB 5E3RA 1S1WB 3NGDA 4H54A 2VU5A 4NYOA 4OHZA 2YKQA 1CBKA 3EM1A 2LYVA 2W2MP 1HYSB 3S6EA 2B3TB 1U26A 3L4BC 4I2QB 2H4YB 2LDYA 5IM0A 1MW7A 2AP6A 3DLGA 4YB1P 2B4UA 2CNNB 4DQSA 5EX3A 5HQ8A 4O0NA 3AJ2A 2XLKA 1YJ7A 3C6UB 1U1LA 3DNCA 5G0RB 1U24A 4PWDB 3D6TB 1RAEB 1IBKJ 2YPYA 4QYRA 3M32A 3U1MA 2D9PA 1C0UA 4YY3J 1IBMJ 2MZTA 2MQNA 1SH3A 3IRWP 2HKEA 3MAAB 1Y11A 3DLJA 3SI8A 2HAFA 4KGZB 1S1UB 1HNWJ 4ZIWA 2QFIA 2ATCB 4NLXA 2DH9A 4ZVEA 2PA8D 1J5EF 5F8MA 4PCQA 5HROA 3K58A 1N6QB 2NXUA 2IPOB 1TUGB 3TA0A 2XHWA 5KG6A 2DIVA 5KFZA 1RHRB 3NS7B 1FWPA 5I3UA 1N34J 2RAQA 3NAHA 4QW8A 5KFPA 1R8HA 4DI6A 4M5KA 1V9OA 2FJAB 2KJWA 2K7JA 4F4XA 1XEZA 3T5KA 1WTBA 2GJIA 2FHMA 3NS6A 4F3QA 4ZVTB 4ILLA 1FRKA 3B8HA 2W7AA 2WOMB 1Y3KA 3FEYB 3QT8A 4DPTA 2BKPA 4H4KA 1VIXA 1VR6A 1PYOB 2H54B 3HKZD 3GR1A 2VBWA 1RT3B 3OR1B 4ZPVR 1RT6A 4CLLA 3M8PA 2XS7A 1T9WA 1O5JA 4WYLA 1SI9A 2WBRA 4CTAB 4NRUA 5KOWA 4KSEB 1YX2A 2ZVIA 4M63A 4C6AA 3EVMA 2ADBA 2IIHA 1KHVA 2C3MA 1FRIA 1VQ9S 3HHLD 2E1MC 1ZAXA 4WFNQ 1CJTA 4CT8A 3D3CJ 2DXEA 4C3KA 2V34A 3H2UB 4X64F 5LMNJ 3IXQA 3AY0A 3CJ5A 2HW3A 4J9UE 1OYEA 4N41A 4U7UD 3W9JA 2IA6A 2MY7A 1GEHA 4F2SA 5HAOA 2AV5A 4ENOA 4L3NA 4DR6J 1Y4ZB 3C15A 2Q6BA 2KDOA 1FFWB 3HSDA 5L46A 1NAQA 5C24B 3KK3B 2MKJA 2MMYA 4ECRA 5IT9Y 3OTEA 1EAYC 3OUYB 1EKSA 2K2PA 4M5JA 3S7RA 3ZZTA 1SV5A 3RBXA 4DSEA 1XR7A 1U4BA 3SFGA 4NI2A 3TO8A 3PTWA 3I5BA 1P9QC 5AE3A 3DLKA 3CJ4A 2PSZA 3J7Z5 1ZM3A 4BS2A 3QJPA 2Q6CA 1WEZA 4OZJA 2J5AA 4X4PA 4FYYB 2LU2A 4C11B 4YS2A 4RW8A 3CD5A 3NNAA 3SZ2A 3M8QB 1KC8T 1NK6A 1VQYA 2AKWB 2CQPA 5JXSA 1V5VA 5F9LA 2R9LA 3CEDA 3Q22A 2OGUA 2RRAA 2VD3A 3TX8A 4UOFA 3BGFA 1B0VA 1UWAA 5A8KA 5J2NA 3NEKA 5BYQA 1S99A 1A0OB 1XIQA 3LOUA 2KU7A 4Y00A 4PRFA 1I1GA 4TXSA 2QO3A 4GKKJ 4M5GA 1B7FA 1MN9A 5DLGA 4DS5A 3I4HX 1S5ZA 3N6NA 4ALZA 3PRVA 1W2BR 3P4UB 4PG4A 1FDDA 3GB0A 1HBNB 2DR5A 5GVQA 2RDDA 5KFEA 2AHOB 3I55S 3HHLA 5F3ZA 1QSLA 3LP2A 4ZCKA 5KFOA 2M0GB 2R42A 3Q8QB 1FXRA 2VQEJ 2R7OA 2CQ2A 4NLDA 2B8PA 3KHRA 3S8SA 1RTZA 1KHWA 1QSYA 1KLNA 1I6JA 1D9DA 1VFJA 3BKFA 2EK1A 3R5CA 4B9NA 3WIVA 1H2TZ 1PAEX 1X7VA 2CADA 5LMUF 3LUYA 2FYXA 2ZITA 4JUZA 1MMNA 2IRYA 4EBDA 2HAIA 2W2QP 4PPZA 2FD2A 1APSA 5HJYA 5KFNA 1PSDA 4OHXA 4P71A 3QT6A 3MM7A 4QQBA 4L6V3 2ZC4A 2NZCA 3OTDA 5IWAJ 4KH1B 2O5DA 4FPRA 4JI0F 2JLGA 4NLSA 2EFVA 4RLEA 3KLVA 4I67A 3DU6A 2PGCA 1FVSA 3K5PA 4LF9F 2LEPA 3CJRA 1B7YB 4QIEA 3PW2A 3ULHA 4JI7J 2CA9A 1UVIA 2WVCA 4KB7A 4DZDA 5BJRA 3MPWA 3LQVA 4IG0A 1D9AA 3DXBA 3W7BA 2RHSB 2UXBJ 2GO9A 4KH0B 3POTA 1VBXA 4BC9A 3R1LA 3JTOA 2C28A 2I9SA 1JLCB 2YBVA 4OX9F 1GH8A 2E1AA 2QMUB 4WE1B 4JV0A 4A8MP 2X1FA 1RT5B 2QV6A 2J7KA 2YX4A 3M05A 4C8NA 3UD3P 2ZVSA 1T95A 2QYCA 1DTTA 3K5NA 1VYAA 1NZ8A 2RMLA 2MYFA 4WZQA 4DR5J 4CDIA 1QDUB 4DSKA 1B0TA 4RW6B 5CYJA 3B4MA 1Q95G 5E41A 2OMOA 2CWKA 1N8RT 2VPWB 3MEKA 4N77A 2HMIB 3BREA 3D1QA 2XGQA 2PA3A 2DR9A 2BE9B 2XMWA 3US5A 3BQ0A 4Y0FA 1K1SA 4LFAF 4C8OA 5L9XA 5E5NA 4P52A 1NJZA 2CPEA 4YFUA 1ELOA 3HD1A 2ZWPA 3LGHA 4K7QA 2KL8A 3GQCA 3PHEA 3QLHA 2RF2B 2XNQA 4U7UK 1JLGB 2B6AA 2QG9B 4Y2KA 1HNVA 4OX8A 2B9EA 3C2PA 1KLMA 1HQEB 5KG3A 5LXYA 1HHSA 1SKUB 2V8VA 3QRPA 2Z8QA 1QM9A 3SQGA 4N8OA 1LWXA 4JV5J 3P49B 4FDFA 4IR9A 5F8GA 3QATA 2OO4A 4N7TA 1GFWB 2K7KA 1MU2A 5EWEA 1KOOA 3KYLA 2VA3A 5HATA 1XMQJ 4KGXB 1VISA 4GVLA 4DPWA 3CCUS 2H51B 4NYZA 2DXDA 3PW5A 1AW0A 3GIIA 4FYDA 2QL9B 2F4FA 4ZLJA 2PC6A 2XMTA 3J7YU 1URNA 1HNXJ 2KZZA 1RT2B 4TNOA 3GYNA 3IWLA 5KFMA 1JB0C 3G8SA 1DQ8A 3W5YA 1S97A 5DM7Q 2HGMA 1SC1B 3KTQA 4DDFA 2CJXB 4IO9Q 3GU0A 4B9MA 3Q86A 2C2MB 5EDWA 4LT6A 3IRXA 1ZAWA 1UA0A 4BCAA 2EI5A 5ETTA 3UPFA 1FJGF 2MLYA 3DMJA 1IJFB 2DISA 2V4JA 4I7FA 2AIRB 2J9EA 1SIWB 5J1EA 2A3JA 3IWXA 2DNLA 5FLXY 4IH5A 3WIUA 5GADU 3A3PB 3CXCR 2IAJA 3C16A 4QBUA 2W25A 4N76A 4PWUA 4GVBA 2OMLA 3I9ZA 3M6VA 1FF2A 2VBYA 1QE1A 4PG6A 3FSXA 4EI2A 2HHTA 1T03A 1H3DA 4A46A 3ILOA 4LF8J 5A8WA 3NMAA 1RAOA 3ELHA 3NGTA 2HBRB 1CG2A 4LRAA 2JFKA 5GAEI 3V6DB 2N3OA 1J5OB 3FZBA 4TQRA 1AFJA 3IGVA 3V4IB 2CZ9A 2YKOA 3HD2A 1R8PA 2AZ1A 2M88A 2M9KA 3DRRA 4X2BA 3K89A 1VRUB 3U1NA 3F0NA 3KJVA 2ZM6F 2R2SA 4KGMA 3VQTA 4C3MA 2ZJQQ 5M2UA 2E5GA 3IBWA 1N32F 3VGTA 2G0IA 5EUHA 3EGNA 3FJ2A 2UVWA 2PEHA 3ONQA 4CO2A 4ID5A 3QO9B 1H2VZ 3R5AA 1J2VA 4J9KA 1HBOA 1TL3A 1RABB 3W61A 2XB2D 2CQ1A 4X4NA 3DC2A 1U09A 4ICLA 4PXCA 3B6BA 3Q83A 2IJFA 3DHXA 3GCXP 1MROA 1X31C 1AXQA 2IA0A 3FBEA 4IDKA 2A18A 4ES3A 3MMCB 1S1TA 3Q8PB 3AT1B 1V5IB 2ZDPA 2IYGA 5CAAA 4DV6F 2CRLA 1D3WA 2QMXA 4M8LA 4ZCMA 3NGKA 1L3KA 4ILMA 3GFHA 2CQ4A 4ETXA 2J0WA 4OI6A 3P5TL 1JXEA 3KMSA 4OMFG 4M5DB 2G0JA 3DCAA 1SUQA 5M2PA 1N33J 3KK2B 2G0CA 4F3MA 5E7OB 1JNZB 1PKUA 1N88A 4XDCA 3BF4A 3D0GE 2VBXA 5F0WA 1HPZA 4GRSA 4O23A 3MOZA 5F8IA 4ZVQB 2DCLA 5CH7B 1UVLA 2UUWA 4DR2J 3RW6A 1LWFB 3OBIA 4MYUA 2V0NA 4JI2J 4MKBA 2XYGB 5J1NA 2IMOA 1N48A 4B3TJ 1TR0A 3VGVA 2KG1A 3CJKA 1XWLA 1K44A 1GK8A 5KFJA 4XAKA 2U1AA 2GVDA 4DSIA 4LQ3A 1HW9A 1WI8A 3H98A 1GMVA 4NXNJ 2E7WA 5SUHA 3DYAB 2BE2A 1KEKA 3ZNUA 4Q0BA 2BJ8A 3W9HA 1RE1B 2HBZB 3D5MA 2MQQA 4I1TA 2DO4A 3BSAA 5B0AA 2VFTA 1E6YB 3MM6A 3IA0A 2P2CB 3U27A 4RJVA 3R5GA 2VHGA 4KYZA 2V8DA 5A6PA 3W65A 4Y34A 1RSCA 4DL0C 4HDHA 1FXDA 4C8LA 3OL6A 1S1VB 2I0XA 1VIOA 1YJRA 1ZM9A 3RB6A 1X5PA 2BUNA 1CVJA 2CQGA 5CZXA 3N9UC 2N82B 2XY7A 1BQNB 1KQGB 3LAKA 3X1LB 5D0RA 3PV8A 3FDSA 3CIMA 1HBUA 1A9NB 1U8SA 4I2PB 2ZH2A 1VS3A 1PIEA 3OSNA 3DLEB 5H9EK 3GPAA 2F7VA 4YQWA 4ZMMA 2EFPA 3IBCB 4OYWA 4U9RA 4B3OA 1BGXT 3TNVA 1RT4B 1YZ7A 1NSAA 2JEGA 3OR2B 1AB8A 5EGYA 1TMJA 4ED0A 4JYAJ 1UZDA 4OZNA 1VK3A 1M5HA 1UTAA 5HSPA 2HBYB 1UFLA 4M5IA 4DUYF 4JI1J 5KG4A 1EKRA 3T5JA 4BLGA 2F1FA 4F02A 3JSMA 1RKIA 3C19A 1X60A 1VQNS 3A8JA 2DGXA 2HK2A 4J7CA 1F6TA 2VIHA 4OV6A 3GCWP 4J9RA 2BW7A 2VC1A 2ABYA 2RHQB 4CH1A 4DWIA 3A1YG 4DOZA 2HNDB 4M5MA 4JI3J 3DOMB 1OY6A 1BWEA 1REVB 3DOLA 3CNQP 1IM6A 2XY5A 1NKCA 4ZCLA 2XSJA 1O6XA 1RT1B 2CJYB 1FEHA 1VQSA 5H9FJ 3NGRA 1FNXH 1C1BB 2QTWA 4JBCA 1HR0F 2J0SD 3CCES 5C25A 2GMHA 4CLSA 3GLJA 1PGZA 4KHPJ 4P7VA 1N5YB 4KQZA 1Y9OA 5K8OA 4QYZJ 3PEHA 2UUBJ 1JLQB 1TL7A 3AAWB 2RIJA 4AL7A 4GKJJ 1NK5A 2M70A 3OJSA 1WG4A 3TUJC 3MCSA 3MM9A 4LSLB 2ZNZA 2MHNA 5K5MA 4IQXA 4DV7F 2UVVA 4G1QA 1IR0A 1GTHA 2KXHA 3AXMA 4LVNP 2P9GA 5B0DA 1QD1A 2SXLA 1TU0B 3IBFB 4USIA 1UW9A 4NA1A 2XBPA 1EETA 3NLCA 3QGPA 1VQLS 3I5CA 2XZWA 3HVWA 3FEXB 2KVIA 5BR8J 5LT5A 2MQPA 3MEEB 2VG5A 5KFWA 3C6TA 1FRHA 4ED7A 4DS4A 2IVYA 2NS1B 3CCRS 2Y1LB 2UU9J 1DLOA 2LQ5A 1VDHA 2I5JB 1RBAA 3EE3A 4CWBA 2ZDOA 1JXLA 4UQTA 1WSRA 3H4BA 2DNOA 5IT9U 5KT2A 1F3VA 1WEXA 4JB8B 1FTCA 3BO3A 3DM2A 1K73T 2OD4A 4IFYA 2MB0B 3CCJS 3MFHA 5J2PB 4E98A 3GJQB 1KD1T 2DHHA 2FY1A 3HSJA 2L9NA 4GMKA 2EXUA 4DV4J 1U2RA 5KFBA 4P2MA 2XZTB 3KXDA 2W7PA 3AD9C 2QSWA 3JXOA 4ANEA 5KT3A 1FKOA 4FF3A 4NA3A 3MAQA 3E01B 2CQCA 1VJWA 9ATCB 3OPKA 2ROGA 3NAIA 3M30A 3A8KA 4DMZA 3BSOA 1SC6A 1AZSA 1UFWA 5KFUA 5LOQA 4OYAA 3SDEA 4OZLA 1U1OA 3QAEA 1HBMA 1D8ZA 4BC7A 4OYOA 2VFUA 1ZTWA 1JLEB 4OX6A 3MEDB 2D3OR 3T19A 3FQLA 4IOCQ 2H1YA 3VR1A 2X3GA 1BC6A 1NEEA 1V3RA 2EEYA 1RLDA 3AA8A 4Q2LA 3W5ZA 2VF3A 4LF4J 1RP5A 4KAIA 2CPXA 5L1IA 4P73A 2WONB 3QPIA 1Q53A 2PEBA 3UN5A 1X4CA 4P2FA 5EWGA 3KK1B 4NCAA 5CCMA 1M5VC 3KDNA 2QEXS 1RTHB 2J0XA 1RQ0A 1UWBB 2GMJA 2KYZA 2KFZA 2GIQA 3FQKA 2Z2YB 1RT7B 4GO7X 2HIQA 1W25A 5LL6d 4JI4F 4X65J 1Q8KA 5KG5A 1U47A 3GFZA 2PMZD 4FVMA 4PYDA 1NJWA 1VQ5S 2LXUA 1ZS6A 1DJ0A 2LLZA 4YR2A 3LPEA 1L3TA 4CT9A 3RBDA 2BX6A 4QWEA 1XN9A 2ZE2A 2JVOA 2WK4A 4QOTA 1WG1A 4CRJA 2GGPB 4WPAA 4QZVB 1C0TB 4G1PA 4KO0A 1S6OA 1M5KC 4HTIA 1SKSA 4N47A 1WACA 2DNHA 2J6TA 4FZVA 3HSZA 2KHDA 1Y7PA 2VG7B 2LA6A 2CZVC 4NRTA 2WCXA 1S7IA 1LWCB 3D6MB 2DGTA 3E51A 3RJMB 1OY8A 2KB2A 1LW0B 3TR5A 4K4ZA 3GE9A 4ZJOA 2ZEJA 1RTDB 5H1SV 1Q86T 3P5BP 2BKNA 1X8DA 1AROP 5IC6B 3QAUA 4U8VA 3Q2TC 4LSNA 2VG6B
chains in the Genus database with same CATH topology
3OHAA 4I68A 3WBZA 1C1BA 3VAJA 1WEYA 2FPHX 3KHLA 4R0JA 2N4DA 4CZCA 4QIWD 2W8LA 1NO8A 2V2KA 4O3NA 2C42A 5KFSA 2WRMA 4RW8B 4AXJA 1TL1B 2D9OA 4WK1A 3LGMA 3J80Y 2E66A 4ZP7A 6FD1A 1NKBA 2EFQA 4P2SA 1S6QB 4J9QA 3CCQS 3RB0A 3NNHA 3KLHA 2Q1LA 3HT3A 1JK9B 2E1RA 2XWXA 3Q2SC 1TAQA 5FJ4A 4U6PA 4V19J 2DNMA 2D41A 2RS8A 1NRKA 2QLXA 3CDEA 1R3NA 1JLQA 3MR3A 3UW1A 4HYKA 2YVSA 1X4FA 1SL2A 2GJ2A 4QPTA 1BD6A 2ZKTA 3KLFA 4DFKA 2L9DA 1Q78A 1FRXA 2CPZA 3DDKA 2BRKA 3DFEA 4QWBA 4RUAA 2MGZA 3HK2A 3NNCA 2HNZA 2FUG9 3KKFA 4MIWA 2Z0GA 5DDPC 1A7GE 3MUVP 1IN0A 1VQ7S 4ZHRA 2FHOB 2E29A 5BR8F 4UY85 5KFKA 3F56A 4LSLA 3VQSA 3RRKA 3R5BA 4DX8H 4WK3A 1T3NA 5A8KB 2BYCA 3PW7A 3DRYA 5J2NB 4USJC 2Z2LA 3T1HF 1D8YA 4TLRA 3K5MA 2K1RB 5JVGQ 5A6WA 4ZLPA 3M2UB 1RDRA 3MWBA 3MF5A 3MMBB 2V94A 2MQMA 4D3GA 4RUHA 2AJ0A 2BV3A 2HHPA 4Q5VA 2LMIA 1C4AA 3B82A 1ZYQA 5HLFB 1KFDA 4Y28C 1Q82T 1SJ3P 3CC4S 2R7RA 3LAMA 1LFWA 1R27B 4MYTA 1XNQF 3I82A 5A2QY 3QYYA 1H7WA 1V6HA 1WF2A 4A8OA 1M1KT 2CPDA 4FXWA 3LP0B 2QE5A 4ZP6A 2NUUG 4UUXA 5KTQA 4BHQA 5KG1A 3HZGA 3OTOF 3L95X 3PX6A 2UV8A 5AXKA 1Y3JA 4I6YA 3MEGA 3CCWA 2FVSA 2VODA 4RW4A 1AFIA 3ZZ0A 4P7TA 3HF5A 3HP6A 3H5SA 1SXLA 4UY8T 2ZE2B 3W2WB 3HHLB 2RH3A 5E3RA 1S1WB 1FKAF 3NGDA 4ED2A 4H54A 2O67A 2YX7A 3TRGA 3F41A 4NYOA 1TAUA 3MEEA 3HHNB 4OHZA 4A8QA 2YKQA 5DLFA 1LW2B 2CJQA 2V8GA 5AE2A 1TUVA 2LYVA 3UQSA 4UW2A 4FF4A 2NPFA 4ATNA 4ES1A 1HYSB 3S6EA 5K14B 3OR1A 1R89A 2B3TB 2E5JA 4OI0A 3PW0A 1U26A 5LMNF 1U1RA 2MKKA 2UXDF 1P27B 1N5TA 4I2QB 3O1LA 4I64A 3VALA 5C42B 4DV4F 1ZH5A 2LCWA 2LDYA 4WJBA 1S9EB 2DGOA 4M94A 4HH1A 2VL1A 4FNIA 5IM0A 2JEJA 2I5JA 4QWDA 1MW7A 2AP6A 3DLGA 4YB1P 2B4UA 1QVFR 4O44B 4DQSA 3X3UA 2GC8A 2HWIA 3H2VE 1V3ZA 1HARA 2AWZA 5EX3A 5HQ8A 4QWAA 1LXJA 3AJ2A 2XLKA 2W4CA 3C6UB 2FJWA 1U1LA 1HWJA 3DNCA 5G0RB 4DQRA 5DM6Q 5E3QA 1U24A 1S0MA 5KFDA 3MOJB 4ERDA 4PPDA 4EYIB 4RWWA 3I0RB 5LJ5Y 3HLUA 2VPZB 2ZHBA 3VAGA 4PWDB 1KVIA 4F4YA 4URSA 2XMJA 5J2PA 2V4RA 3MFIA 4QYRA 1LWEB 3LP1B 3M32A 3M6UA 2KH9A 2K3KA 1NH8A 4HVZA 3U1MA 2D9PA 2LXFA 2IVFB 1C0UA 2DR7A 2KRBA 5J2MA 1SB6A 1CC7A 1YSJA 2BVZA 4QU7A 2MZTA 3IG1A 4RBTA 1T05A 3MM7B 1TV6A 2AYBA 2MQNA 2BOPA 2UV8G 1XC9A 1IKXB 1SH3A 1TVRB 3IRWP 1S72S 3AHPA 3DLJA 3SI8A 4AL5A 4H4MA 2XLIA 1S1UB 3GSDA 1BLUA 4AE5A 4X4SA 3GWCA 3SFUA 5LSRA 3D1HA 1NZAA 2XS2A 2DNQA 2XEXA 2PO4A 2OAUA 4TU8A 2XNRA 4KTQA 3DLHA 2KFNA 4NLXA 2DH9A 3E3XA 4B3MF 1P1LA 4B08A 1DURA 3VAFA 4B9VA 4ZVEA 1FA0A 5L8RC 2PA8D 1HW8A 2AJFE 4NLRA 4A8KA 1YRUA 1OSCA 2DGSA 4OJGA 1L5UA 1J5EF 4LF4F 3T9NA 3OVBA 2GO8A 3OUYA 4KHMA 5F8MA 4PCQA 2JWNA 1UEUA 5HROA 3K58A 3RBEA 1N6QB 4ED5A 3LANA 2NXUA 2M3DA 2HNZB 1QUVA 2MXYA 3GIJA 2F4VF 4R5PB 1Q4RA 2FJVA 4NZ6A 2VPXB 3TA0A 4DF8A 2NR0A 2XHWA 4I6WA 2DIVA 5KG6A 5KFZA 2N4CA 1FRLA 4C8ZA 4JV1A 3MPYA 5I3UA 4IG0B 2E9TA 1HWUA 5JJBA 4ED6A 5DRKA 3NAHA 2DH7A 4QW8A 2ASDA 3CDAA 5KFPA 2OIHA 4CCHA 4DL3A 1X5OA 1PC5A 2ZH8A 1R8HA 1LXNA 2D7SA 3KG1A 3PX4A 4FBTA 5IFMA 1JLEA 4WYWA 2J8AA 3POTB 1LKZA 1S1XA 4MAKA 3MEDA 1N5QA 2IVMA 4RNMA 1V9OA 2FJAB 2KJWA 3KHHA 1F2GA 2K7JA 3HDSA 4F4XA 2GHWA 1RTIB 1TP7A 1DRZA 3M9MB 5DQGA 2OPRA 2IJNA 3GMGA 1XEZA 1WF0A 3T5KA 1WTBA 2AJ4A 3HHDA 5T7LB 4X65F 2GJIA 3BZQA 3CMES 5HN0A 2FHMA 3NS6A 5B0CA 5EX0A 4RKUC 3BDEA 4F3QA 1SJRA 3LWLA 3HXMA 2OSRA 3KNGA 2G4BA 3BDPA 2IBOA 1FRKA 1FESA 4ILLA 1XNRF 2GQ2A 3B8HA 4X4VA 2CVEA 2QRRA 2VASA 4NMLA 3ZFVA 2W7AA 2WOMB 3H25A 1Y3KA 3FEYB 4Y2CA 5GAEU 4RW4B 1C2PA 2DT9A 4PG7A 2ZNYA 1NK0A 3CVKA 5I42A 2YH1A 2G1DA 1YWXA 4JI5F 3OW2R 2IC3A 3IO1A 3KK1A 1RKJA 1DTTB 2YNGB 4H4KA 5JVHQ 2NLWA 1HWKA 1VIXA 4DUZF 4LFBF 2HHXA 3ZZUA 4YR0A 2OP5A 3FGVA 1RTHA 3BO2A 4YB6A 2LDIA 3PVXA 3HKZD 4O4GA 3GR1A 2VBWA 3UFCX 2YWGA 4DEZA 4K50A 1RT3B 3OR1B 1KTQA 1UWBA 4I6AA 4R0EA 2EVZA 4ZPVR 1RT6A 4KR0B 3M8PA 4OIXA 4TLQA 1T3OA 2XS7A 1O5JA 1B64A 2F8EX 2B4VA 2DRBA 1SL0A 1RT7A 4WYLA 1SI9A 3DLGB 2WBRA 4CTAB 4NRUA 1B0PA 5KOWA 1IJEB 4KSEB 1XK8A 1VK8A 2KFYA 1N5SA 5HMYA 1OSDA 4M63A 4NCBA 4DSLA 2VQFF 3QJJA 2DHSA 1GNKA 1Q7YT 2RDJA 4NLOA 1WHXA 2ADBA 3EGWB 5DETA 3HPOA 1KHVA 2C3MA 1FRIA 2FJEB 1VQ9S 2VONA 5DJBA 3HHLD 2B56A 2E1MC 3TARA 2DNPA 3OJUA 4MMOA 4IKAA 1ZAXA 2HGLA 4JOUA 1K9MT 4CO1A 4WFNQ 1ZETA 2YNFA 4DL6A 4CT8A 3I9V9 1UJ4A 2GGPA 2FJBB 3NCPA 1UJ5A 3H20A 4C3KA 3H2UB 4ILRA 3M9NB 1YJUA 1C0TA 2YKNB 4WXOA 3TA2A 4X64F 3D28A 1HL6A 1P6TA 2CQ3A 3AY0A 3IXQA 2YKPA 4WXWA 4JI8F 2B6AB 1ZZFA 1HNVB 3CJ5A 2HW3A 3CT9A 1VGYA 4N41A 3U1LA 2R8JA 2IA6A 4NOHA 2YKAA 1NU4A 3V81A 1Y00A 3CJ0A 2N7YA 1KLMB 2MY7A 4PKDB 4F2SA 3FNNA 1YHQS 1HMVA 2AW0A 2AV5A 4A47A 1DHMA 3PY8A 5HBMA 4L3NA 2XMMA 2DITA 2ROEA 2AQ4A 3H5XA 2UUAF 3KMQA 3O2IA 2WSCC 1Y4ZB 5KFLA 4EBEA 2Q6BA 3N5BA 2KDOA 1H98A 2F8HA 3THVA 1NAQA 5C24B 4QU6A 1HI0P 3KK3B 2CQHA 4F50A 3HVAA 2MKJA 1RI7A 2MMYA 3PIPQ 4ECRA 5IT9Y 3OTEA 1VI7A 3OUYB 3TI0A 5FD1A 2BJEA 1LWCA 4DPOA 3EUNA 3FFIB 1RISA 2K2PA 3QWUA 1MU2B 5MLCV 3IAS9 1LW0A 3VZHA 3S7RA 5FDLB 1SV5A 3ZZTA 1MSWD 4CO5A 1MMDA 4DSEA 1FRJA 1XR7A 4EO8A 1RTDA 5I3UB 3CB4A 1U4BA 3N4WA 1KOHA 1Z4UA 4FVCA 3SFGA 4ZKAA 4E8UA 1NKEA 1HNIB 2GCFA 5AJ3F 2LEAA 4XO0A 3TO8A 1XTZA 1FDNA 3I5BA 1P9QC 5AE3A 1GXLA 3DLKA 3MGJA 1S1XB 3CJ4A 2PSZA 2B4PA 3J7Z5 1ZM3A 1HI1A 4KPYA 4DV3F 3G71S 2VG6A 2RRNA 4BS2A 3DRPB 3ENQA 4OI2A 2Q6CA 1UVNA 3QJPA 1WEZA 4OZJA 2J5AA 4X4PA 2MY8A 3SV4A 2LU2A 1HHTP 2DH8A 4C11B 4X4TA 2XO7A 2O66A 4YUDA 4RW8A 2A2DA 3CD5A 3V6KA 1TL1A 2HZCA 1S4FA 5HP1B 5KT5A 3OLBA 2IRUA 3NNAA 2JJ4D 4X4UA 1S6QA 3SZ2A 4FS2A 2EBGA 3DRSB 5I3PA 3M8QB 2ILZA 1CPZA 3I87A 1CEZA 4ECXA 4K4TA 1Y0HA 3PR4A 4UQGA 1NK6A 1KC8T 2VZ9A 4Y6IA 1VQYA 2OPPA 3W3SA 1G3OA 2MZJA 3JTPA 1UP1A 1Z1ZA 2CQPA 1UVMA 4GC7A 3OTCA 1Q8BA 5KFIA 3MI7X 3PFOA 5JXSA 1R0AB 2J9DE 5F9LA 1N54B 2R9LA 2VKRA 3CEDA 3HVRA 3Q22A 2RRAA 3TVYA 4F4KA 1D1UA 2VD3A 2RVJA 3TX8A 3BGFA 1KONA 4CO0A 1B0VA 2ILYA 4O4GB 2ASYA 3GG1A 3SSRA 5A8KA 4OZ5A 4DR5F 5J2NA 3MTKA 4L72B 1RT6B 4DSJA 2FHKA 2K1RA 5BYQA 3ZZOA 1S99A 3M2UA 4OJ1A 2R2UA 3MMBA 3HX9A 2KU7A 3LOUA 4Y00A 3UE2A 4PRFA 1I1GA 3F44A 4TXSA 2QO3A 3N01A 4Q8FA 3DMJB 1XR5A 1DTQB 1FDBA 3JSYA 1B7FA 5DLGA 5F41A 4DS5A 2BQ3A 3I4HX 3N6NA 1YJNS 4ALZA 1W2BR 2I1RA 3UCUP 4PG4A 4YR3A 1FDDA 4RW7B 2F9JA 5J1EB 3GB0A 1HBNB 2DR5A 2EPIA 1Q8LA 3ISNC 5GVQA 1NJYA 3CE8A 4NLYA 3OL9A 3LP0A 1RJJA 2L08A 4WFYA 5F8NA 3TAMA 2I2YA 4C8YA 2J6SA 5KFEA 2EK6A 3CWJA 3QZ7A 2K3IA 3I55S 2PT0A 4PG5A 4C8KA 5DDRC 1S6PB 4K2XA 3W2WA 2YNFB 3HHLA 5F3ZA 2IAJB 5E0OA 1QSLA 1YQHA 3LP2A 2I38A 4ZCKA 5KFOA 2M0GB 2KG0A 3Q8QB 1FXRA 3M4XA 2HLUA 1IBKF 1LW2A 2R7OA 3M2VB 3C46A 1NNDA 2CQ2A 4FP9A 3CCVS 3SV3A 1XBWA 1HYSA 3QIPB 4KHRA 4OLOA 4WU3A 4DL5A 2YWEA 5K14A 1QE1B 3RU0A 4NLDA 2B4OA 2XS5A 4YY3F 3KHRA 3S8SA 1IBMF 1WELA 4I2QA 2GIRA 5B08A 1LK5A 3J7A1 2M52A 4CQ1A 3AJ1A 1S9EA 4ECUA 2HFOA 2KM8B 1IKVB 1YBAA 3OVAA 1T03B 1KHWA 1K1QA 3NMRA 3HHKA 4AXIA 3J81Y 4DQIA 4ECZA 4FNHA 2JHEA 5J2QB 1Q7LB 2YWHA 2XMVA 3IGNA 1QSYA 1KLNA 1YIJS 4O44A 2F40A 3LWMA 1HNWF 1I6JA 2DNYA 1D9DA 2JH3A 4CO3A 2L9WA 1VHFA 1VFJA 3C6UA 5GAHU 4Z2XA 4MK9A 5KFCA 2EK1A 5G0RA 1NH7A 3R5CA 5DDOC 4DQPA 4HKQA 2FC9A 3UR3C 3MXHP 2DGUA 4B9NA 2R7XA 1WI6A 3QJLA 2AGOA 5L39A 1FRMA 1JKHA 2XSFA 1H2TZ 3V5RA 3PIOQ 1X7VA 3P6YC 3FCHA 2NZ4A 1O8BA 4RZRA 4RU9A 5LMUF 3LUYA 4EFAC 5E2QA 1S0VA 2JRSA 2ZITA 3ISND 4JUZA 1MMNA 2IRYA 1SV5B 3MR2A 4EBDA 4PWDA 2DD8S 2HAIA 1T7PA 3CULA 4PPZA 5THWA 2GHPA 4Y2IA 3DRRB 2M8HA 2FD2A 1APSA 2CJBA 1NK8A 1LWEA 3LP1A 4KRWA 3GFXA 3UR0A 2PMHA 5CZVA 2V9WA 5KFNA 1PSDA 3KJVB 2WAQD 1FEEA 1FE0A 4OHXA 3UWTA 2O3DA 4HTJA 4CNYA 5KAKA 1JLGA 4ZVGA 4BDPA 4KGKA 3MM7A 2OJ3A 3UCZP 1ZTTA 1IKXA 1TVRA 4QQBA 5F8LA 2JLEA 2KHCA 4L6V3 2ZC4A 3AH6A 3OTDA 1S1UA 2MQOA 1NJIT 4H4KC 3BQ1A 1BQMB 4NXMF 1SBRA 3SCLE 3HM9A 4ELTA 2VOOA 3G86A 4NYPA <