2WSEC

Improved model of plant photosystem i
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
81
structure length
81
Chain Sequence
MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWGGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure determination and improved model of plant photosystem I
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords AT3G54890
total genus 4
structure length 81
sequence length 81
ec nomenclature ec 1.97.1.12: Photosystem I.
pdb deposition date 2009-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF14697 Fer4_21 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2wseC00
2Z8QA 4OMFG 3MMCA 1IR0A 3IR7B 1K0TA 1Y5NB 1FERA 1C4AA 1B0VA 1GTHA 2C3UA 2XSJB 4CI0B 3EUNA 3PNIA 3HKZD 1WTFA 2ZVSA 1FRLA 1FTCA 1FDBA 2V4JA 4OV1A 4L6V3 1D3WA 3LW5C 1FRXA 2FGOA 5CH7B 1FXDA 3MM9B 5BYRA 2FJDB 1FF2A 1BC6A 2IVFB 1F5CA 4DHVA 3OR2B 3C8YA 1KQGB 1FEHA 2WAQD 5FD1A 4YDDB 5L8RC 3MM8B 1G3OA 1B0PA 1FRIA 2VKRA 2VPYB 1IQZA 2VPXB 3MM8A 1SJ1A 1JNRB 1BQXA 1BLUA 1JNZB 1AXQA 1PC4A 1B0TA 3IR6B 2O01C 1FDAA 7FD1A 1SIZA 1FRHA 2PA8D 3MM9A 2C3YA 5E7OB 6FD1A 1DURA 7FDRA 1R27B 1G6BA 3MM7A 4Y28C 1GTEA 1BWEA 1Y4ZB 2FDNA 4AYBD 1FRMA 2WSCC 2UZAA 1H7XA 1A6LA 2GMHA 1H7WA 3OR2A 2PMZD 1XERA 1HFEL 2WSEC 2C42A 1H98A 4XDDA 2WB1D 1FCAA 2Y0SD 3EXYA 3OR1A 5BYSA 2WSFC 3MMCB 3MM7B 1JB0C 2V2KA 1GAOA 3OR1B 1FXRA 1FDDA 1BD6A 1FRKA 3GYXB 1RGVA 2C3OA 1FRJA 3MM5A 3MM6A 1Q16B 1DAXA 3EGWB 1KEKA 2C3PA 6FDRA 1FDNA 1Y5IB 2C3MA 1H0HB 1Y5LB 2XSJA 3MM5B 3MM6B 1F2GA 1FD2A 2VPZB 1GT8A 5CHCB 2FJEB 4RKUC 1KQFB 2FJAB 3IR5B 4XK8C 1PC5A 2FJBB 1CLFA 3MMAA 1VJWA 2FD2A 4ID8A 1DFDA 3MMBA 1SIWB 1F5BA 2GMJA 4XDCA 5BYQA 4KT0C 2VPWB 1C4CA 1ROFA 3MMAB 2PDAA 3MMBB 2V4JB
chains in the Genus database with same CATH superfamily
2E1MC 5JMNA 5LMNF 5DO2A 5DDRC 4LF7F 2Y1LB 2RU3A 4KJIA 2VFTA 4KV8B 2CNKB 3RYLA 4YB7A 1TL3B 5K14A 5AXMA 3SCLE 4CLLA 4DU8A 4ZIWA 2MQ8A 1EQMA 4TU7A 2BUNA 2DY9A 2R7OA 2YKOA 3FGVA 1S72S 4R0JA 1WKJA 4JI3F 1T94A 2IDEA 2CQ3A 5EWFA 4FXVA 2MKJA 3MPUB 1N56A 2DVIA 5GAEU 1N52B 2QLBB 3OXFA 2OFHX 4URQU 4R25A 4YR0A 4QWCA 2P2CB 3DFEA 4XTTA 4DV6J 2CJKA 1WNEA 4HLBA 5ETRA 3HSDA 4B3SJ 2EFNA 2CAJA 4MKYA 5HMZA 2ZH6A 4FYWB 1WORA 2YKMA 3C14A 1QVFR 1VQNS 3G9CA 4Q43A 1Z2LA 1U6FA 3BO4A 2H1YA 2Q6CA 2W7AA 2E9ZA 1UEVA 3W7BA 5KFEA 2IC3B 4RL1A 4IH7A 4RW6B 4F4YA 3VQSA 4CCHA 2LECA 1G4CA 5L8RC 2XZWA 5AT1B 1S6QB 3IG1A 3TWZA 2FQQB 4F8RA 1TL7A 4O0IA 2IM3A 2KM8B 3L95X 3EDQB 5C7PA 1FE4A 2QFJA 3HD2A 2W1BA 2LYVA 5K5MA 1U2FA 3K57A 4PXDA 2QN6B 3PZPA 3WBZA 2KU7A 3I0SA 1RWPB 2ZDOA 4DOZA 2V8PA 4KKOB 4ZVQB 1IBKF 4FXDA 1TKTB 1HMVA 2KVQE 1R8BA 3DI6B 2RRBA 3R3TA 3JAMY 2A6MA 4X62J 1GX5A 4EGLA 1PAEX 3J81U 3GCWP 4ZHRA 5A76A 3X3UA 1JLEA 4DX8H 3J80Y 4ZVTB 3MAQA 1KLNA 4JI6J 2NR0A 4DV7J 2DIUA 1Y4ZB 3QWUA 3SZ2A 1NJIT 2GS8A 2HEKA 3HFKA 3D6FB 4DBQA 1Q5VA 1RJJA 2CNLB 4B3TJ 2D69A 1H7XA 3T6BA 4I2PA 4KYZA 7AT1B 5C2CA 1N5TA 2C2RA 3BH6B 3MECA 4JI5F 3R1LA 2W2MP 4MYTA 1YBAA 3EYZA 4Q2LA 1T7PA 1JLAA 4HACA 2R8JA 4I6AA 3C66A 3QFHA 3QSYB 4CH1A 1N0UA 1UA0A 2XYPB 4WWSA 2ZBQA 4C11B 1CS4A 2P9GA 1UFLA 3MMCB 1JB0C 4RU9A 1JJ4A 4F3OA 2AYBA 1EKRA 4A48A 4LF4F 2B7CB 3NCPA 2HNDB 4CT8A 3VGVA 4LUBA 1BD6A 2ATCB 2EG2A 5L9XA 4DL4A 3VAKA 1Y00A 2Y8WA 2D3UA 2H4WB 3DRPA 4ILLA 4CP5A 4P2XA 1PBAA 3UCUP 5I4MA 3SIPB 1LQ9A 4HHUA 4KV8A 4R5PB 1LWCB 1Q1KA 1VBZA 1FD2A 4NZ0A 1O5JA 5JJBA 3J7AN 4RKUC 2BJEA 2QLJB 3BGUA 1SXLA 2GV1A 2QYGA 4P2SA 1C0TA 2IAJA 5IS2A 1UTAA 4IH5A 2OELA 2UUAF 3OXLA 1ZM3A 2K7JA 1RT7A 4ZKAA 2D9PA 2VPWB 4DL0C 1ROFA 2CQGA 1SQGA 2U2FA 2BE7D 4LJMA 4NLVA 5HVHA 1WJ9A 5DGBA 2OJ3A 3CT9A 4Q8EA 1FE0A 2BW2A 1REVB 2VBYA 2WBMA 4I6WA 1OWXA 2PE8A 5JXSA 2Z58B 3QT6A 2SXLA 1RISA 2J9CA 3DOLA 4E2FB 5C2GA 3AY0A 3TAQA 2GZOA 3NGSA 4MT1A 2R8KA 1R8PA 4V19J 4ZP7A 1KFSA 2RMLA 1B0VA 2OPSB 2OMOA 4IG0A 4O3PA 2RKIB 2Q66A 5E3QA 2UXDF 4RW6A 3QLHB 2D1CA 2ROEA 1MWYA 5A8WB 5D3GB 1FT8A 2XHWA 4JI3J 5GAHI 2DKOB 3RZAA 5KFUA 4YHHF 1SL0A 1X9MA 4X66J 4CDIA 4UUXA 2RSQA 4B9UA 1IBCB 4JI2F 2PFDA 3LA0A 4GO7X 3DOKB 2FC9A 5F8LA 1ZPWX 4F50A 3CCSS 4C4WA 2I5JB 4YY3F 2X1FA 3ELHA 1A0OB 1UPPA 3MCMA 1CJVA 4EBCA 5HROA 3J7A1 2A1BA 1DLOB 1M0SA 1YZ7A 2FGOA 2ZOGA 4ANEA 3KLGA 2C2ZB 1S1UA 3CD0A 3MFIA 5H9FK 1N5YA 1FKPB 1EARA 4YUDA 3P5TL 3M30A 2IBOA 1O8BA 1VK3A 2HIYA 3VGTA 3TZXA 2LQJA 1HNIB 2OEJA 2WOMB 5B0EA 2AIRB 1YRXA 3EDRB 2BKOA 1S57A 1F0XA 5KG3A 2IYGA 1CJUB 1KOHA 1G3OA 3QMQA 3VZHA 3VAMA 1RBAA 3U02A 4KO0A 2O1PA 3P8BB 4X4PA 3RB6A 2CZ4A 1QY7A 1FWKA 1YK9A 2G9OA 3T5LA 2DH9A 1U1LA 3A8JA 3THTA 1VYAA 3NOGA 1R6YA 3AOAA 5H9FJ 1CJTA 3Q24A 4M5IA 2MZTA 3LO3A 2N82B 3IR6B 4WFNQ 1CS4B 2ZJQQ 3CC2S 2UU9F 1R0BG 2N4CA 5EX0A 4P74A 4IFVB 4OYXA 4F4AA 5MAOA 1HPZB 2PA8D 3T5JA 2CJXB 1TL1B 3VV2B 5CZVA 1S10A 3S6EA 5LSRA 1XMOF 4ZCIA 1P27B 4Q0BB 3I0SB 1YBUA 2AV5A 1S9GB 2HKEA 3OTEA 1N32J 4UT4A 2DNKA 2HWTA 3P6YC 4DV3F 2HAFA 2AEMA 2CYYA 2YVSA 2FLPA 2W7OA 2WSCC 3GV8B 3MUVP 3KHRA 3KLVA 1JLEB 1U45A 3DRSB 2VIHA 4ALZA 5KFLA 1HWKA 2F3JA 2Z57B 4ERDA 3OSPA 2XMUA 2WCXA 1C0UA 3LAKA 4K59A 2KHCA 2P6TA 3BBBA 2GAHC 4CLYA 1SJFA 3D6MB 1MLAA 1DARA 3HSZA 1RWWB 4P7TA 4ENOA 1CC8A 1WEXA 5ETOA 4K0KJ 2FUG9 3HVAA 2FZKB 4DR6F 4K50A 2ERRA 1KN6A 4HHHA 3EZOA 3N5BA 4F3QA 1V5IB 2DHAA 3BGRA 1RA6A 2XLJA 2XB2D 4JV5F 3C3LA 3O5TB 4KHMA 2CQCA 2RHSB 2QTWA 1KQKA 5T14A 4RNHA 1HD1A 5HVGA 3CC7S 3K8WA 1VIXA 1X5PA 4MKAA 4ETXA 4TKTA 4YN3B 3FRYA 1NSKL 1SPBP 2NCKL 2XC9A 2DRAA 5DDQC 2VPZB 2ILYA 2KYXA 5J2NB 1SC1B 4USJC 3R5JB 3PW2A 3H8YA 3OFFA 4ZP8A 5CYQB 4PG7A 2DPJA 3J81Y 2FJBB 3KTQA 1U47A 2Y0BB 4NI2A 4ECZA 1VQLS 1H38A 3DOKA 2HWIA 2MLXA 1JLBB 2ASYA 4OZJA 1G2EA 2DHGA 3WX8A 3KUHA 5DJBA 5HQ8A 3THVA 1FX2A 1I6JA 3V4MA 4G6VB 2E7WA 4TXSA 4O3QA 3UN3A 5D4PA 4XPCA 1S1UB 2J6SA 2DD8S 2WW4A 4LFBJ 4QIWD 1KFDA 4KSEB 3QZ8A 1WG1A 2ZKUA 2PEBA 4HI1A 3M2UB 4CTAB 4TU9A 4IOAQ 3LP2B 1PIEA 1NBEB 2KVIA 1U4BA 1RWVB 4DQQA 3TJ9A 2NPIA 3ADAC 2QL9B 5C25B 1S6OA 3CO9A 3GFYA 4TY9A 4LF2A 3KG1A 4NLDA 1WI6A 2CQDA 4FN5A 4Y65A 3BPSP 4QIEA 2Q3PA 4DLGA 1XNQF 1R8CA 2YWKA 4DFPA 4JI2J 3AB2B 1HBUA 2H9ZA 4LSLA 1VRTA 2XS5A 1NHVA 4RZRA 1VLOA 3G8QA 3UDLA 2N7CA 1D09B 4PQUA 1WI8A 2EW9A 5E41A 1S1XA 3EICA 4DSKA 3GILA 2JFKA 1T03B 2A10A 2BVZA 2POKA 3GR1A 4K7QA 5B09A 4DHVA 3TEGA 3IS9A 1VIOA 3M4XA 2CPDA 4MIAA 4Q0BA 3T41A 5IZHA 1RQ0A 1VCTA 3IO1A 1S79A 3IWLA 1RHQB 4KGZB 3JB9k 3BYRA 4P2FA 1S1WA 5IT4A 5E5NA 2KN4A 3THPA 4K4SA 3ZTSA 4PXBA 1NKBA 3DRSA 2EXUA 1DRZA 2L08A 4HTJA 3IGVA 5A6PA 3HD1A 5F3ZA 4A8FA 4JV1A 4L74A 1TL3A 1FWLA 4Z7CA 3TVZA 1BQXA 4N41A 1RBLA 2ZH1A 4OYZA 1VI7A 4ZVFA 3R2DJ 1U02A 2RQMA 2R4FA 2JJ4D 2B9YA 4F04B 1N88A 1YVFA 5DQGA 4Q44A 4BDPA 2ZE2A 5FIIA 3KJVB 3HO1A 3CE8A 2HS4A 2C3YA 3D54A 2WVFA 3SQOP 5L1JA 4LBPA 3FC9A 3HMJG 4ZCMA 2BZ2A 2FB0A 3H0PA 4R8UB 5KG7A 1YQHA 1V3RA 3QO9A 4JV0A 4RW7A 3QRRA 1FESA 4PWDB 1V5VA 1DTTB 2KI2A 3VF0B 3IM8A 1TL5A 2GQQA 4NLSA 1HQUB 1UVKA 2G0CA 2YNFB 3AD7C 1IKWA 2ZOMA 5K9FA 5F8NA 5HMXA 1KBRA 4NCGA 2E1AA 4FZVA 4RR5A 1T0TV 2V4QA 5IM0A 1HYSA 2WSEC 1S12A 3AODA 3BGOP 2VASA 2M7SA 1QSLA 3VAFA 1UVIA 5A0YA 3S8SA 3Q8SB 1V3ZA 4ZOSA 2RB7A 3AXMA 1R3NA 4X4NA 4Y0FA 4TQRA 3QJPA 2QA1A 3R7NB 5KFPA 1G7CB 1D9AA 2GA7A 4RW4A 2AJ2A 2MXYA 1HI8A 2BRKA 3CDWA 2FVPA 4M63A 1SL2A 4FF4A 4PZVA 2BBEA 4AQYF 2I0XA 3L7UA 5IT0A 2DR6A 4ZVOB 2KL8A 3PW5A 3N79A 4LF5F 2IMWP 1NH8A 1N34F 2PI4A 4ILMA 1RCXB 1LOUA 1HA1A 4JOUA 4OZNA 3DI6A 1WTBA 2DGSA 9RUBA 1K44A 1K47A 5DG7A 4KY3A 2W4DA 3J7Z5 4MYUA 3RRKA 1W25A 2B4PA 2E5JA 2F8HA 3FKBA 3CTRA 3K2YA 2V6AA 3W5XA 3OLBA 2CDRB 4DL2A 3L3CA 1IWGA 2CG8A 4QBUA 2N3LA 1FVQA 3BKUA 4ID8A 1BQMB 2VD3A 1X7VA 2VKZG 4FNHA 3D0HE 2Q6BA 5M2PA 3FBEA 1EP4A 3R5CA 2YQ0A 1KQSR 1C4CA 4PR6A 1RTDB 2HQGA 4ID5B 1XIQA 3M32A 4GC7A 3NS5A 2E7XA 2ZM6J 1NCLA 3ILJA 3MMCA 2H48B 2XY7A 1F6TA 2JEFA 2OPQB 2VA3A 3K8VA 1Y5NB 4DPTA 1HHTP 1C4AA 2VQFF 4BC9A 5IWAJ 4I67A 2MKCA 3RBZA 1GMWD 3LP2A 3SQGA 1S4FA 1TFYA 2CWKA 3HKZD 5SUHA 1IKYB 1LWEA 4K4YA 2CPYA 1NDLA 3WDOA 2KT3A 1FDBA 1OMSA 1LWXA 1PAUB 1X0PA 2FGCA 2V4JA 2VV5A 3CCZA 3DXSX 2XM3A 1YGYA 4LF8F 4CO2A 5SZTA 1T9WA 4G1QB 2F4VJ 1O6XA 4RWXA 1UVMA 1GH8A 1MG7A 2H5EA 1RU1A 2DGUA 2W2QP 3KHHA 4A8SA 4OJHA 4B9NA 4L3KA 5DRKA 4Y3CA 1Y11A 1XWLA 4CM2A 3CEDA 4A8YA 1HI0P 4WP3A 2OEMA 4CO4A 3RAMA 3BN4A 1XNRF 1N32F 1JXEA 3HKWA 4OX7A 2AD9A 3L7PA 4OI0A 1REVA 2HVDA 1NO8A 3M1VB 4RLEA 4KFBB 4URSA 2YQ3A 3AH6A 2JWNA 3GR0A 3PYDA 5DG9A 1VGYA 3M8RA 4W92B 1L3KA 5C24A 2RDJA 1Q86T 4RU2A 2UU9J 3DLLQ 4IOBA 1SJ1A 2RKIA 2EFQA 1WF2A 2ASDA 1AA1B 1SKWA 4C8KA 4OIXA 1XQIA 3HHLD 1UEKA 2W25A 1TR0A 2W7PA 2VUGA 2GQCA 1TV6B 4ECXA 3BYPA 1RWNB 4RW8A 3O8WA 5T41A 3GFZA 3EMTA 4N56A 1Q8LA 1FKOB 4LBHA 3SV4A 1S0MA 1XJWB 2ZE2B 4KB7A 4NYZA 4FKXA 4LR8A 3RRGA 2M2BA 4IUFA 1CJVB 2FVSA 1M5SA 1G6BA 2DBBA 1XR6A 4PWWA 4OX9J 2ZWPA 3A8IA 2VONA 4UZCA 5CD4H 2LU1A 2IMOA 4J91A 2V34A 3KYLA 3WIUA 1TKXB 3B4MA 3TEHB 3R5BA 4RUHA 1W26A 3DRYA 2QYCA 3DLEB 4JI1J 1KVKA 1NNDA 3E3XA 2E5IA 3BEGB 3QRQA 1FCAA 2AJQA 4LFCJ 2FVCA 2KRBA 1Q79A 4DCPB 1IWAA 4CQ1A 4EFAC 4ECVA 1UFWA 2VOPA 4X66F 4A8KA 4A4JA 1UVLA 4Q45A 2AZ3A 2J8SA 1GAOA 2YNIB 4JP8A 4LSNB 4KC5A 4OZ1A 3CIZA 3M8SA 5KT2A 3KLEB 4Y2MA 4NLUA 1VQKS 2KZMA 3OL6A 2K7KA 3MDFA 4C0HA 4ELTA 4DX7A 3GCXP 3H90A 1PYTA 4JI4F 5T7LB 4LF6J 1KNZA 1KEKA 5I3UB 2MHEA 4NYOA 1WC1A 4ECWA 3ZZOA 3KK3A 1HW8A 4RW9A 2C3MA 1HPZA 2YH1A 1APSA 1YJVA 2WZ1A 2V69A 2ZD1A 1OPIA 3MM5B 5CABA 2HFNA 2J9EA 4IR1A 2ZH7A 4NLPA 3U1MA 4QW9A 5K20B 2MQQA 4CO1A 2WBRA 4O3SA 4ES3A 3M9OB 2GJ2A 3ZO7A 4O44A 5HI7A 4CIOA 5D0EA 1GK8A 2B43A 3FBBA 3LPEA 4ICLB 3TR5A 5KFHA 3V5RA 1ZETA 4F4KA 4C9DA 1VOMA 2UXBJ 2LEAA 1F5BA 4CLKA 3OVBA 4X65F 3J81j 2YWFA 1HLWA 4O4RA 3CMQA 4MAKA 4M5DB 5JUMA 5I42A 4X4UA 2VICA 2AEJA 4UW2A 2RIJA 1L3UA 1EKSA 4PAAA 2VA2A 5EWEA 1FVSA 1UVNA 3AOCA 5B0DA 1U1KA 2UUCJ 3UD3P 4GKJJ 1I5OB 1OYDA 2ZNYA 2L48A 3FRZA 4ANCA 4ID5A 1HBOB 1RCOB 3OJUA 2CJ9A 4IH6A 1DHMA 1QTNB 2R3VA 1R43A 2HZCA 2XSJB 3WQPA 3IWXA 1NKEA 1IBMF 2ZZTA 2OH2A 4DS4A 1VMBA 5KFNA 1DQ8A 2LFVA 2YKMB 4ZLPA 2IVYA 2W9CA 4UOGA 3WIVA 5E0OA 2CZVC 3S1TA 1IKXB 2XZTB 3HJFA 1WUUA 4EYHB 2ZBCA 2W4PA 3CXCR 4N47A 3ZXWA 1RAAB 5CQGA 4WFYA 1GNKA 2KJVA 3NBPB 4DUTA 2G2OA 4EMDA 5ETKA 3LW5C 5AE2A 2A0FB 4AL6A 4IRDA 3W5YA 1S6QA 3IG1B 3BO2A 2IVMA 4H4KA 4M5JA 4FYDA 5LJ5Y 2MQOA 2HVIA 3CMES 3PIPQ 1VQSA 3RAXA 2FJDB 3AQOA 4AE5A 3CCJS 2QJ3A 3OSNA 3G2XA 3MHYA 4ZLJA 1NDCA 1VQ7S 3OLAA 1S6PB 4N7TA 1R7IA 3IRXB 2M8HA 1K1QA 4KIAA 1RWUA 1UWBA 4ECTA 3TQ1A 3OUYB 4MFBA 5IC6B 4LT6A 1U6BA 1TKTA 1YRTA 2PGCA 4GRSA 5B0FA 3UFCX 4K2XA 5HMYA 4AQYJ 3C14B 1FK9A 4PG4A 1T9XA 1WF1A 3H59A 3BB5A 4UF4A 3E8OA 3GLJA 4ZVHA 5C25A 2VG5A 4JI5J 2VBXA 1ZH5A 2IRXA 3KXDA 3I82A 3C15B 4YB5A 3KG0A 1CQNA 1D9FA 4C3KA 1WHWA 2Y1RI 6FD1A 4WFAQ 3BZQA 1T05B 4OHVA 1UFKA 3FZBA 3MWBA 4X62F 2OPPB 1GTEA 3KK3B 3I96A 4CLFA 4Z2XA 1VFJA 4GVBA 1NK9A 3KOAA 2RRNA 2MGZB 3AD8C 3HSGA 3PO4A 2DNZA 5H9EJ 4B3MJ 3H5SA 4DPOA 4XPEA 4QYRA 5LJ3Y 1TKDA 1OQ3A 1FO1A 1RT3B 2RT3A 2W2OP 2XG8A 3PKMA 2IBKA 5A8KB 3OQ2A 1SQEA 3BM7A 1OY6A 1IBLJ 3OR1A 3TW0A 1H2VZ 1S1WB 4ICLA 3H98A 2KTQA 3DRRB 3LANA 2BJ3A 3OW2R 1IM6A 1F3VA 4YS2A 4ZPWR 3Q89A 4CRJA 4FDFA 3MAAB 1YI2S 2HW3A 3G82B 1FRKA 2KKHA 3IRWP 2IRUA 3BBFA 3GE9A 1X4HA 1K8AT 1E6VB 2CPJA 2ZM6F 5KFIA 1HHSA 3HULA 3BGFA 3MGJA 5B0BA 1RT7B 2D41A 3Q22A 2OMLA 1TK0A 3PACA 2L3MA 2B9WA 1NSQA 5T7LA 4C11A 3CCMS 1DY3A 2FJEB 4JI8J 4MJKA 3DRXA 3QGGA 4RW7B 4ZPCA 1PC5A 3TJ8A 2CNNB 3TNVA 3H40A 3GMGA 3IBWA 5A2QY 5KAKA 2X1BA 3R6GB 1RWMB 4AUKA 3CVKA 4CH7A 4U7CA 4DUZJ 2FVRA 1Q78A 2CPZA 3N4WA 3OTOJ 1DTQB 2FY8A 4WF9Q 4ZCKA 5HP1A 1R89A 1LFWA 1EB0A 3M8PA 1I1GA 2E7VA 2GCFA 2NXNA 5I42B 2NREA 2OFGX 1C0TB 2IAJB 1RT1B 3C6TA 3IP0A 1TKZB 3R5AA 5ETQA 2P5VA 1S99A 2LA6A 1K0TA 1WHYA 4M5KA 4QU6A 3GYGA 1HNWJ 4HHJA 2PO4A 4I2QB 1TTHB 4H4OB 4JI8F 2LLZA 4NEZA 1BUXA 3RAQA 3HPOA 3PHTA 4OL8A 1URNA 1NJXA 1WHVA 1N33J 2I2YA 1IQTA 3DYAA 5HVFA 5AJ3F 1VLYA 1X4AA 1YG0A 2P8IA 1HNIA 3A8KA 3AB4B 2RU9A 4Q5VA 1U1MA 3MF5A 3B54A 4IOCQ 1JLQB 3W1YC 2VG5B 3TQEA 3GFXA 4NOHA 3HT3A 4WTYA 3BBCA 4ECUA 1URRA 3TI0A 3DLHA 3N9UC 4NMXA 2MB0B 1X4GA 3PM9A 2DEIA 2NXJA 4U96A 3SFUA 4I4BA 1Q5YA 5KFWA 5KFXA 1FF2A 1HQEB 3H2LA 4F4ZA 1LXJA 1CJTB 1NEEA 3PYGA 2EFPA 1S1TA 2MMYA 2CQHA 2GNKA 3FMWA 1QUVA 2BJDA 4X4OA 4X4QA 3PO5A 3AXKA 1ZAWA 5FDLB 4QJVA 2VG7B 4QWDA 2M8DB 4OZLA 1PJ5A 4Y2CA 2RRAA 2DHSA 5G4DA 1S6PA 1XR7A 5HROB 4WKRA 2FHJA 2HHUA 2LDIA 2JOQA 2A3JA 3CD5A 3IA0A 4Y6IA 1Q7LB 5D4NA 3MR2A 1R8HA 4IR9A 3T1AA 3J7YI 3OUYA 2EFVA 3OXGA 4ED4A 2BOAA 2DNQA 2HQFA 1QAIA 3HVTB 4YEAA 2HGLA 2IPOB 3GZ7A 3D1HA 4E8UA 3I32A 3TJAA 4YB1P 1ZZFA 1JNZB 3CJKA 5LMNJ 3WC2A 1WELA 5E3AA 2R2UA 4IQXA 1WWHA 1VK8A 4FYVB 4NEYA 4DR6J 3LALA 3IN5A 2AF6A 2ZOFA 1KD1T 2JEIA 3MAAA 3TUZC 4OX9F 2K06A 1JJ2R 8AT1B 5KFJA 4NLTA 2MKSA 2ROPA 4LVOP 2YKAA 1IN0A 2YWEA 4U95A 3CNQP 1BWEA 3AHPA 2ZUAA 2AMCB 3D7SB 3TOQA 3BQ2A 1FWPA 2MZSA 2OPPA 3P5BP 3OR2A 4OYPA 1X4FA 1IM4A 4ZVUB 4AXJA 5KFBA 2QIFA 3JAMU 1VQ4S 2J6TA 4KGXB 2HYIB 4LF5J 2BMBA 5KFKA 3KLHA 4K8RA 5F41A 3JSMA 3LQVA 3TO8A 2W8KA 4JI1F 4DL6A 1ZTWA 2QA2A 1QSSA 1L5UA 1RK8A 4LQ9A 4K4UA 4F26A 3HXMA 4U8YA 2XGQA 1NU4A 5HK4A 5DM6Q 1FXRA 1GXUA 1XBWA 2LVWA 3DLKB 2JC1A 5HP1B 1VHIA 3A3OB 1Q8BA 3QIPB 3GYXB 4P72A 1IR2A 1T9UA 2BQUA 4I7FB 1Q16B 1NJZA 1LK5A 4A8MP 1KOOA 1IR1A 2E44A 2C3PA 1JLBA 2VU5A 3AA8A 4JI0J 3CW2C 1J5EF 1TFWA 3BO3A 1QVGR 4BC7A 1RUSA 5KFYA 1TUVA 2LKZA 3M6XA 1X0FA 4YR2A 2NSBA 1NB7A 3D2WA 2NSCA 2FIUA 4ER8A 2D9OA 1XMQJ 2E5HA 1U1NA 2BA9A 2LQBA 3QRPA 2YQ1A 3FNNA 4QZVB 1MN9A 2AKWB 4A8XA 4NE9C 3MCSA 5HJXA 4I1TA 3PY8A 4NA2A 3SXLA 2HNYB 3U1NA 3W61A 3DN9A 1BQNB 1VQOS 5LT5A 1E6YB 1EHWA 2HZVA 4FYYB 2HRYA 4ZITA 4HH1A 3FJ2A 2E9RX 3GSDA 2YX7A 3T5KA 4RX6A 1VRTB 3DU5A 3IR7B 4ZPBA 2R8IA 5J1PA 3D67A 3CDAA 2Z2MA 4LSNA 3F44A 4U9RA 3VCDA 3H2UB 4EI2A 2J0XA 2ZH5A 2ZUGA 2DITA 3PNIA 1REGX 1VRUB 4XO0A 1HQ2A 2EBGA 2VFRA 3R1HA 3BSNA 2PT0A 1J5OA 3DLGB 3A1YG 3QGHA 1T8EA 2WTFA 2FVQA 2X7IA 1TAQA 2KYZA 4KAIA 4MH8A 2UVWA 5D0HA 4ZVSB 2J76E 5U47A 4KGVB 3M2UA 3ZZYA 2ROGA 2MLZA 3HP6A 1OIAA 2ZBPA 4P2MA 3MM9B 1GXLA 3UCZP 4B9TA 2HHHF 2NPFA 1N34J 3W63A 4MK7A 4QQBA 2AJ4A 1SKUB 1WOSA 2YWHA 4LRBA 2RF2B 3UR0A 3RTVA 1RT5A 4J37A 2M9KA 2Z56B 5KG6A 2ZZMA 1ITPA 1VQPS 3PG9A 3MEGA 1HQEA 3VGUA 2LEBA 4DV5F 2VZ9A 5E3CA 1U6ZA 2MQPA 1H6KX 4TLQA 1HWJA 3H5UA 2MYFA 5DLGA 4QCLA 2IRYA 2R42A 2ZHOA 3B6BA 5B0GA 3CIMA 1S1XB 1VBXA 2HGNA 2XNRA 3ETMA 3MCNA 2NUUG 3EX7B 1YJ7A 1LXNA 3Q8QB 3I0RA 3P4UB 2JX2A 3TZYA 2A18A 4DR1F 2MQMA 2I8EA 1PC4A 1PJ7A 4QWAA 2GO8A 2ZH9A 2NZCA 3ZNUA 3OVAA 3FQLA 7FD1A 5IM0B 2XY5A 4LF4J 3ENVA 2HK3A 4DR1J 1N36F 3TX8A 3H4BA 1S97A 2MKHA 4OI3A 1VS3A 2DCLA 3DU6A 4QR1A 3W5ZA 5I3QA 1RDRA 1X5OA 4ZK7M 2B5JA 3LTOA 4R0EA 1OYEA 3A8EA 1NK0A 1YBTA 3LH2S 3N6NA 4Q2MA 3SEOA 4RUBA 3DM2B 5K8MA 4YP3A 3KK2B 3MR6A 1NHKL 4XIUA 4GKJF 2HHSA 1HBNA 4JYAJ 2QX0A 2KXHA 2HQIA 3UVJA 4DZDA 1FJGJ 1RKJA 2HRUA 3RW6A 4DV7F 4FS2A 3KJVA 4FKYA 1JJHA 5J2MB 5BJRA 3G6XA 5KFDA 2BX6A 2DRDA 2YPYA 4OI1A 3ETOA 3CDEA 4KQZA 2E29A 4DV1F 4F4XA 2UUBF 2Y8YA 2LP4A 5J1EA 4OFZA 2VOOA 3UDEA 1T3NA 4C8ZA 1JLCA 1HQUA 3CB4A 3GP9A 3I87A 4OHZA 1RBOB 1R0CB 1N48A 1Q82T 3MURP 2UVUA 1K9MT 3KLFA 5BXIA 1FRJA 5KT6A 3V4IB 2G1HA 4KBIA 3HM9A 4M94A 1RLDA 2LXFA 3NWRA 2KDOA 2EK6A 2MDAA 4LF8J 6FDRA 3GV7B 1FDNA 3M05A 4P7VA 2C2MB 4K5SA 5GMDA 3WC0A 3JYTA 1H0HB 1KTQA 1U25A 3KFWX 4DPWA 1B3TA 1RTDA 2KFZA 5DETA 3S01A 3M8QB 1S59A 2I5JA 1T05A 2F1FA 3ZFVA 2KFNA 3DNCA 2FJAB 3IR5B 3GJTB 1VQ9S 4RW4B 2ACMA 4FVCA 2CFXA 2GJFA 4WP9A 1U1OA 4B3RF 2RS8A 2XMWA 3W64A 1NK8A 1OJ4A 1SIWB 5L1LA 1Q81T 4UY85 1ZPVA 2DH8A 1XMOJ 1AFIA 4ZA1A 1N6QB 1LWEB 3UWTA 2WOMA 1IJEB 2CPXA 2CUYA 4DL3A 3G8TA 3RBEA 1NK6A 4JYAF 1FJGF 4B9SA 1TAUA 3ENWA 3T9ZA 4HVZA 5D77A 1RT6A 4J5OA 3CULA 1RAEB 4USUA 2N3OA 2DT9A 1AROP 1NHUA 2WK4A 4NMLA 4X64F 3EZ5A 2MQLA 2PA3A 2YPZA 2XMKA 1RAFB 1IUJA 2F8MA 2HNZB 3UD5A 4DV0J 3RB3A 4D3HA 2ZH8A 1JXLA 3NG8A 2VL1A 5ETLA 3DDNA 2DNYA 1H74A 1MU2B 1UZDA 3GIRA 1SUQB 1XEZA 2HHWA 4CM0A 2L9NA 3W2WB 1KTVA 3CCWA 3FCVA 3HLUA 2VG6A 3TA2A 5KG1A 3QBCA 4IDKB 3FEXB 4B9VA 2M5YA 2MZRA 2F8EX 3OJSA 2AX0A 4WIIA 4CLTA 1AW0A 5KT3A 3K58A 1UJ4A 3ILIA 5IT9Y 3NS6A 1FFSB 1HKAA 3H2VE 4I56A 1TU0B 1U1RA 3K89A 4ZVRB 1U0HB 2XMJA 1F5CA 1MSWD 2YNGB 1P9YA 4KGKA 3QJJA 3US5A 3QZ7A 4U6PA 4B3RJ 5D4LA 2W2NP 4RBVA 3QT7A 1TV6A 5FD1A 4YDDB 4IQMA 5MLCV 1NAQA 2V2VA 1A7GE 1SJ3P 2AJFE 3NAIA 2HLUA 1J2VA 4WE1B 3T1HJ 3L09A 2ZWOA 5LXRA 2VDHA 3C6TB 2RQCA 1F5AA 3QYYA 3JSBA 2D3OR 2F4VF 2CADA 3DDKA 1EZZB 2H65B 3MPVA 1RWKB 3DMJA 4WYWA 4CNYA 4G65A 4QWEA 1ULRA 2GQ2A 2OLWA 4FYXB 4P73A 4ANDA 4F0HA 3GTYX 1BLUA 3AD9C 5GMEA 2DB1A 3CJ8A 3CD6S 1U8SA 1S77D 1SI9A 2B56A 2PIIA 5L1KA 2CQ0A 4OHYA 2K3IA 3KWMA 3NRBA 1N8RT 2QE5A 4KHPF 3ZZZA 2DR7A 3QAUA 5CD4A 2RAQA 2UXCJ 3GSIA 1TUGB 2GO9A 3F0NA 2CJAA 3TZWA 4HACB 2GIFA 4L76A 3I5AA 4DSIA 3D9BA 1PSDA 2DISA 3QAEA 4ED2A 3BGLA 3IGNA 2DNRA 1TL7B 1RWOB 3PHEA 1H2UX 5KT7A 2OD4A 1WHXA 5ETPA 2IA6A 1IVZA 2QC3A 3G6YA 3CJTA 3LGMA 2HPUA 1SC4B 2QL5B 1V9OA 4KRWA 1P6TA 4Y00A 4CWBA 2AGOA 1KS2A 3LAMA 2OHDA 1FDDA 3TVYA 3NOCA 5GAGU 1SBRA 1TKXA 4TYBA 4ZHRB 1PG5B 4DUZF 4NA1A 3M6WA 2R8GA 2XMTA 3WZ0A 1YJTA 2DHXA 2VC0A 5H9EK 3Q8PB 1HARA 2YWGA 4OI4A 3UE2A 4M5GA 3W2VA 4C3MA 4URGA 1CEZA 3MUMP 2Q43A 1C1BB 4O4GA 4P71A 1EETA 1QE1B 4PCQA 4QOTA 5KFCA 4TYAA 3TAPA 2HVEA 2VJVA 3AT1B 2JEJA 4WK1A 2MZQA 2GAGC 3O1LA 4EU0A 5EHHA 4PQUB 2CKWA 3M8QA 3PFEA 4X4RA 3M9MB 2E1CA 3V6DA 2LU2A 2OIHA 1JX4A 4WFBQ 4N76A 2MKYA 1BXNA 2M88A 3MMAA 2E1PA 5CCLA 2FPHX 5KFOA 1RTIB 1N36J 3HFVA 3EVOA 4PUOA 3SDEB 5HSPA 1SQFA 3MZIA 1SL1A 4LF7J 2DJWA 2ZDPA 3FSXA 4LR7A 4IFYA 3QT5A 3BH7B 2X3DA 3E51A 2BRLA 4WPAA 3NAHA 3F73A 2BDPA 3C2PA 2B3TB 2ZH4A 2LQ8A 2KH9A 1UWAA 1M1HA 1JLFA 1F3FA 2C2OB 3OL7A 3VGSA 5IV3A 3NBPA 3G4SS 1EAYC 2PN6A 2X1GA 2Z2LA 4HDHA 2J7UA 2OD6A 1FERA 4ZVEA 5F8HA 2JLGA 2UUCF 1LEOA 1TL4A 2HVZA 3OT9A 3ZZPA 3N6LA 2DNLA 3QT8A 5G0RB 4M5DA 3FZ2A 1PYSB 1WKKA 1NJYA 3HT0A 4DU7A 2I1RA 1KHWA 4OV1A 3Q2TC 3QFWA 2LXIA 2DK2A 4ZPAA 3U1LA 4FBUA 1KHVA 2A2DA 2AX1A 3K17A 4KR0B 3UR3C 1HBOA 4DI6A 4PG8A 4LFAF 1Y7PA 2ILZA 3IWNC 2M3DA 1P1LA 4RBTA 5D4OA 3SBMA 2VG6B 3JTOA 1FRXA 4RNFA 4PPZA 3T5HA 4ED8A 3OPKA 3KMQA 1ICEB 4OYAA 4NRUA 1RZMA 2N4DA 3BSCA 4CZCA 4DQPA 4WP8A 1NZAA 3W9IA 3ZTQA 2C22A 4RJVA 3PTWA 2FC8A 5EX3A 2VQEF 3NMRA 2RE1A 3JQKA 1MNEA 2B6AA 3MPYA 3TAMA 1UJ5A 2YNGA 3DOMA 2LQ9A 5A0YB 2YTCA 4QYZJ 3K5OA 4J9UE 3NCRA 5KFZA 4NXNJ 3TUPA 1S1VA 3PW7A 1I51B 4RNNA 2VPXB 4DFJA 1V3SA 3GONA 4TQSA 2YKPA 3JS9A 3BV8A 4ECQA 5HQMA 2AYMA 2IHR1 1XN9A 1VQ8S 2O01C 1PBUA 1B70B 1UWBB 3A3NB 1MROA 2EWHA 2BM0A 3HVRA 2L9WA 8ATCB 3IXQA 1FFWB 4WTOB 2D7SA 2MPUA 2YX4A 3D1QA 3M30B 4WYLA 5CYJA 2DPIA 1RLCL 4UQGA 4LF9J 4FF2A 2IDLA 1JLGA 4A46A 5B7WA 2XI3A 3UDVA 2WONA 9ATCB 1GEHA 2OKQA 3H42A 5F9NA 4DEZA 1PJ6A 4ZLNA 3OFHA 1X8DA 4DR4F 4KO0B 2RF2A 3G96A 4KPYA 3TP2A 4AFFA 3DXBA 4YB6A 1ZOTA 1I3OB 3M2VB 4GVLA 4ECSA 2UV8G 4C97A 4HKQA 4OZ5A 2RHQB 4AL7A 1HNZJ 3FEZA 3ZC4A 4IO9Q 5IT9U 2V2KA 2OPQA 1M1GA 4ELVA 2E5GA 2BKPA 2RD5C 1BHNA 2VODA 3C6UB 5KFVA 3GJQB 2XYGB 5LL6d 1RT3A 4ES2A 1PGZA 1T9TA 1Z2ZA 3MD3A 4DSLA 1FEEA 2VBWA 5KG0A 3LF0A 1Y5IB 4Q8FA 3B78A 5J2MA 2DXEA 1FI4A 2XULA 3LP0B 4WXWA 2GIQA 4ZCLA 3CSKA 4DPXA 3CJ0A 2HK2A 3CJSA 4DV0F 4DR3F 1UPMB 2J7WA 2BJ8A 3I5CA 4NLXA 5D8HB 4K0KF 2QGFB 4DQIA 2HBYB 2MQNA 5B08A 2YKNA 3G82A 1B7FA 1C1BA 2CRLA 1X31C 3DM2A 4JI7F 2HVHA 1PILA 4CLWA 4C7QA 1KC8T 3MMBA 3PJ9A 4G1PA 4WU2A 2X1AA 2QMUB 5BR8F 2YBVA 2FZCB 4DF4A 3V6DB 3N01A 3RBDA 1H2TZ 3MMAB 4H4KC 3KNGA 5E2QA 4X65J 3T1HF 1I94J 1HBMB 4LSZB 4FPIA 5CH7B 4KHPJ 5A8RB 1NPRA 3LPYA 2VQFJ 5ETVA 3MOJB 4QIVA 1JLCB 4DZ6A 2DR5A 3HHEA 3ZZUA 5AE1A 3TANA 4NZ7A 4CI0B 2GGPB 1JLFB 2FLNA 3KLFB 3BDEA 3TRGA 2LQ5A 1X9WA 1RAIB 1IKVA 5F3TA 3FSIA 1S1VB 4NI2B 2R7VA 4JI7J 4ZPVR 3IM9A 3DLJA 5KFTA 3D0IE 4PEOA 2AGQA 2HIQA 8RUCA 1S9FA 1U7LA 4WK3A 4UOCA 5LSOA 2IYIA 3KJNB 4DR7J 1T9YA 3KMSA 1M5HA 4F3MA 4NCBA 1HNXJ 4OJGA 1YTYA 4PG5A 1RHUB 1ZM2A 3R2CJ 2QT7A 4F0MA 4G3IA 1CC7A 2O67A 4DX6A 2JSXA 1GFWB 2CPIA 3JTNA 2B9EA 2RNEA 3P49B 2R7QA 3Q2SC 2R7UA 4KHRA 3VAGA 3OL8A 4O0NA 1JLQA 5K8NA 1S7IA 5F0UA 4IO1A 2VFVA 4PXCA 5HMWA 1B0PA 5F8JA 2XSFA 3CDBA 2CVIA 3BN7A 4C8MA 5DZ6A 1NK4A 2YNIA 3Q8UA 1CBKA 2HBRB 2NXCA 2WVDA 2EKYA 2HNZA 1HBUB 3SV3A 2HZAA 2XWYA 2XQCA 3PR5B 1KLMB 4IG3B 1RTZA 4F67A 3CUNA 3QQCD 1D8ZA 1WOOA 2FJXA 4R8UA 4NASA 1IBKJ 3QJLA 1SIZA 1FRHA 4FXWA 4QU7A 2Q1LA 3ICLA 5D3GA 1S6UA 1B4SA 4QPTA 1NSAA 4OLPA 1IBMJ 2YNFA 3R5DA 1GXTA 2IFXA 5HN0A 2V94A 4U7UK 3DKDA 4NCGB 4BHQA 2V67A 3D3CJ 3MEDB 4OHXA 5DZ7A 1IJFB 3EZUA 4DL7A 3O3LA 3TA0A 2CZ9A 4AYBD 4GC6A 1LWCA 4MMOA 1S9EA 3CJKB 4N5SA 3CPWR 1YLXA 2Z2YB 2AU0A 1F9HA 4OV6A 2H51B 4I7FA 2PMZD 1VJQA 4LREA 1WSVA 2K8GA 3LP1A 4USIA 4K4ZA 4M5MA 1TZ0A 2IIHA 4DV1J 4NLOA 1OY8A 1UZHA 1FNMA 4WE1A 4X4SA 3MPWA 3CCLS 1P8GA 2IM1A 3M8WA 3ISNC 2NYIA 1PYOB 2MTLA 2OSRA 2G1DA 3M2VA 1VC5A 3ILOA 1K1SA 4AXIA 4ZVGA 2HGMA 3O2IA 4FVMA 2AEFA 3KDNA 2QA4S 4TLRA 2CJYB 2BW7A 1RGVA 2GJIA 5A8RA 5ITHA 4DUYF 3W8PA 2BQRA 4ZJOA 4K4WA 3FEYB 2DNMA 1VQYA 1V6HA 2G0IA 1SC3B 2HS3A 2V8HA 3M8ZA 3TUIC 3UO0A 3GIMA 2J0QD 1FJCA 5KG5A 1WG4A 3EWGA 1MW7A 1EIYB 2NUHA 1Y5LB 3LWLA 4HTIA 3NNAA 2ZH3A 2OTJS 1F2GA 2LCWA 3FK4A 4C8YA 4W4MA 3UDCA 2DTJA 1N5QA 1SH3A 4OQJA 4XK8C 3VQTA 4NXMF 3AJ1A 4FPRA 1N5SA 3DCAA 2YKQA 2KFYA 3OTBA 3W9JA 1CLFA 4EBEA 3CO0P 4DJBA 3CJ5A 1Q8KA 1FD8A 1SVDA 2K3KA 5J2QB 1XNQJ 1UAWA 2YNHA 3QATA 1LK7A 2W4CA 3CCQS 2M0GB 4F25A 2R2TA 3NKYA 1S49A 3FFIB 4LQ3A 3MMBB 4DX5A 1VDHA 2WVEA 4U8VA 4L75A 3CD7A 1RABB 2MEWA 2RDIA 4WXOA 4ZDNA 3RB4A 3NL0A 2RQ4A 5KFMA 4F7VA 2DNOA 2HFVA 3DLBA 2X51A 1A9NB 2DEJA 2R2SA 1WC6A 1UEUA 5D0GA 4ELUA 3W62A 1MMNA 1MMDA 2B7BB 1KDNA 2J0SD 2B0GA 4DQRA 2MSTA 1ZAVA 2ZKTA 3E01B 3SFGA 3CMAS 2C1EB 2ZVSA 1BQNA 3KUEA 1FRLA 2CA9A 1FTCA 4Y2KA 4OYIA 5KT4A 4WCEQ 3VALA 3FVYA 4X84A 4IRKA 2APOA 3BKTA 3OBIA 2R7SA 1BQMA 3UD4P 2I9SA 5KOXA 3NWGA 4EO8A 4KGMA 2DGQA 1R31A 1HNVB 1VRQC 3TARA 2ASLA 3PDNA 3PW0A 1WC5A 2FHKA 2H3EB 4CNZA 4M1KA 3MPDA 4FP9A 2F7VA 3Q23A 5RUBA 1J5OB 3KLGB 3I0RB 4PYAA 3VAHA 2VC1A 1YJWS 3HZEA 2HHHJ 1CULB 3T1YF 1VQ6S 2WAQD 3MD1A 2AZ1A 2FTRA 2Q79A 3U27A 1RAGB 1W2IA 4UOHA 5KFRA 5ADZA 5KT5A 4YR3A 4NCAA 2B8QA 4BWJA 2XY6A 2HHTA 4F02A 2E66A 2P9CA 2VPYB 5KFFA 1X9SA 3HHDA 6AT1B 3RRHA 3LP1B 4B3SF 3KK2A 4B3OB 1JNRB 2NXEA 3EGVA 3P45B 4UQTA 1U1QA 4DN9A 1IXKA 1NPPA 1RT5B 3KG4A 4DQSA 4HR2A 4WFXA 4C98A 2ACYA 1XMQF 1S7HA 1JKHB 2CVEA 4F36A 4MKVA 2BXJA 5GVQA 2MZJA 4TN2A 1BMQB 2UXBF 2QG9B 3X1LB 3IMQJ 3GG0A 3ITHB 3PYEA 2RS2A 4CO3A 4DR5J 3NGTA 4L73A 2ATLA 4DPUA 3CJ2A 4ZVPB 2B51A 3TA1A 3MM7A 2G2YA 1YJNS 3IBCB 4JV5J 5B0AA 1YHQS 4ZP6A 4NPOA 4ED5A 1Y3JA 1SC6A 1TQLA 2MHNA 4DL5A 2GMHA 3OHBA 2KG0A 1KONA 2AQ4A 2LXUA 4ED0A 2BANA 2R7RA 2Z2ZA 2NYHA 1RACB 3N0VA 1SV5B 2O66A 2MY7A 3TAMB 2GVDA 3KNAA 1KWMA 3DOMB 3T9NA 2V8DA 1RHJB 4I6YA 3BSOA 4DSEA 2G2ZA 4AL5A 3JTPA 1LNQA 4C3LA 2UP1A 1WD6A 4AT1B 5L39A 2VJUA 3AFGA 4PPDA 2HWHA 2CPFA 3PRDA 3UVJB 4LRDA 4OI2A 5HQLA 3T3FA 1HWUA 1DZ5A 2PI5A 2BYCA 4WZMA 1H73A 3MM5A 3MTKA 5ETSA 5AJ3J 3ZTOA 2ZHAA 4USHA 4ETZA 5CAAA 1X4DA 3LUYA 2B4OA 1QSYA 3D66A 5ETMA 1WC0A 1XC9A 3IBFB 3V81B 3AOBA 2J9DE 4NLRA 1DQ9A 1DJ0A 3W66A 4O44B 4HT5A 4KPCA 1GT8A 4RPFA 4GMKA 5HANA 3RR8A 2XBPA 1KQFB 4K4TA 2NQPA 2V9KA 2XTJP 3ENQA 1U0SA 3POTA 3R6LB 4WJBA 1RAJA 3GG1A 3BPDA 3SSRA 1YDLA 1DFDA 3ZZ0A 3HZGA 4ED1A 5EN1A 4LSLB 3PIOQ 1RTJB 3CJQA 1CSJA 5BYQA 2OP5A 3FMBA 3MR5A 2QO3A 1J27A 1ACMB 4A8OA 1NXIA 2HQ3A 3DGPA 3KJQB 4A8WA 3I31A 2PDAA 2HQCA 4RWWA 2B4VA 2JHEA 5K8PA 4X64J 2QEXS 4X4VA 2EEYA 2VFUA 5CXTA 4LRFA 2DO0A 1IBLF 1HW9A 1VR6A 3ZTRA 4X2BA 2C3UA 1GTHA 2ZC4A 2P6SA 4P75A 3GIIA 3M6UA 4F2SA 1IKXA 1ZBTA 3QNWB 1NK5A 1YWXA 2HHXA 3AA9A 4NLWA 5D0RA 4RBUA 3EGNA 1U0HA 4DXLA 1RT2A 2AYGA 1LW2B 2EVZA 2EFOA 4EWTA 4GKKJ 2W8LA 5CZXA 1ZZNA 1RSCA 3AAWB 2G13A 2NS1B 3SCIE 2UUAJ 2F63A 2KHDA 4YHHJ 4FBTA 2HAIA 2H54B 4WKYA 4ED3A 5DGAA 2QRRA 1QAXA 3CCTA 4JBCA 4PABA 4CLPA 2YKNB 4UOFA 3PR4A 1FXDA 3I6PA 3A13A 1UCNA 1MWZA 4OJ1A 3GIKA 2BOPA 4I64A 5JVHQ 5F8IA 1SUQA 2BM1A 2VF3A 2OPRB 3OR2B 4M5HA 4MFBB 3ZTPA 1HR0J 2D3ZA 4ZPTR 3V2UC 4ILRA 1NUEA 1Q8IA 1AZSA 3NGUA 4F0KA 4NLGA 4HEA9 2W9BB 4C0OC 2VDIA 4ES1A 1ZTTA 4HDGA 3A4TA 2BABA 3MM8B 3PJWA 4PG6A 3G8SA 3KHGA 5L1IA 1CULA 1FRIA 1NDPA 2ZZNA 2VKRA 2OUGA 3C16A 3FBFA 3OTOF 2J0WA 4YMEA 2RVJA 2BANB 2IA0A 3CJ4A 3HHLA 2FLOA 3C15A 2X3GA 4DSJA 4MIWA 3JSMB 2ZJPQ 5LSLA 4B9MA 2C2NA 4Y2AA 1RA7A 1D8YA 5A8WA 2RUSA 3S7RA 3OFEA 3M2RA 4C48A 5DDPC 2VHGA 4J9OA 1X4CA 2XEXA 2GHVC 1HNWF 2O5DA 3UN5A 5E3RA 2QSFA 2BE9B 2RJZA 4TU8A 2E1RA 2HFZA 5CYMA 2PSZA 4O3OA 4DV5J 1S5ZA 4DFMA 1WKLA 2C2DA 2KZZA 2Y1JA 4GVBB 1YJRA 1RHMB 1VC0A 1U2RA 4JI6F 3K5MA 2DNHA 3KUGA 4Y28C 2V0NA 4ZJLA 3RU0A 4HH0A 4DS5A 2ALYB 2DXFA 2JZ5A 5M2UA 5F8GA 5EDWA 4OYMA 1KSPA 3R97A 5AXKA 1YSJA 2F4FA 3HHKA 3LGHA 2HLTA 1A6LA 4LRAA 4X4TA 1HL6A 2JDJA 3I55S 1BY9A 2GX8A 5D6GA 3G6VA 2PEHA 3FSYA 2OSQA 1HWLA 1MWQA 3EJMA 1U26A 5EGYA 2V63A 1EX8A 3MI7X 3R8YA 1RT4B 1SJRA 4J9PA 1AYEA 1T03A 3K5LA 1NKCA 2V9WA 2CPEA 4PYDA 3W2VB 2CQ1A 2BQ3A 4WZQA 1LW0A 1AFJA 3DDIA 5ETTA 5HLFA 3TVKA 4O4GB 1SV5A 4C2MA 4DUYJ 3HHNB 1EP4B 5HBMA 5M2RA 4WU3A 5KFGA 2XO7A 3K5NA 1D9DA 1HI1A 1KVJA 2HFOA 3C46A 5IV4A 2UV8A 3M32B 4M95A 1FNOA 1DAXA 1SJ4P 1NZ8A 2AYEA 4IFVA 2DO4A 4IFYB 1CG2A 3H25A 4EZ6A 4V19X 2DGTA 1CJKA 1JK9B 3HVWA 5KFQA 2V2QA 1NDKA 2DNPA 1S9GA 1RAOA 2AT1B 2K1RA 1RT2B 5KG4A 1LV5A 2FHOB 3KKFA 4OZ2A 2QLXA 3D6TB 3QGIA 4DV6F 5K14B 1S9EB 2ADCA 2CWXA 4USKA 2VH7A 3NEKA 1M5VC 1HWIA 3PFOA 4HYKA 2Y9HA 3GJRB 3UCGA 2BEFA 1RT1A 1UJ6A 1FXLA 1TMMA 1NMEB 1FA0A 1HD0A 4ZN3A 4EUVA 2O3DA 5LMUF 1GQEA 3R27A 3PYFA 4P52A 4JI0F 4N8NA 2CPHA 3ONQA 4I68A 4OYOA 4DDFA 2M4MA 4LFCF 1U48A 1M5KC 2WVBA 3BF4A 3UN2A 3HCXA 2GW8A 1QUPA 1RTIA 2KT5A 4DN0A 2JH3A 1NJWA 2V4RA 3SDEA 4PUOB 2MLYA 2EC0A 1Y3KA 2DGWA 5J1NA 4M5NA 4J9LA 2W01A 3L4BC 4P9SA 3W8GA 1R0AB 3SQGB 4LF6F 4WFZA 5GADU 4L6V3 3PX6A 4JI4J 1IKYA 3D5MA 4DR2J 2AJ0A 3JQJA 5DDOC 1TP7A 1VQ5S 3I56S 4OX6A 4YFUA 1ELOA 2GHPA 1B64A 3NXZA 4DR4J 2ZC3A 1T95A 2KO1A 4RW8B 5BYRA 4CT9A 3VAIA 1HBNB 3W9HA 4K4XA 2MKKA 4LF9F 3DC2A 3I4PA 1WOPA 1KQGB 1VC6A 5J2PA 1YJ9S 4BS2A 1T02A 3HK2A 3FQKA 2OEKA 3VWSA 3MUTP 2PFFB 5DS7A 1AZSB 2FYXA 4YOEA 4ED6A 2EFGA 2GHWA 3G87A 4TVAB 1S0NA 2XS7A 1R8AA 2VFSA 2ZEJA 1ZS6A 3VAJA 4RNOA 3MM8A 4F2RA 4QPXA 3GV5B 3EPIA 1MMLA 1Z4UA 3LWMA 3K0JA 4LFBF 3CF5Q 3B4DA 3Q83A 5LMUJ 1C2PA 1N0VC 1RU2A 2B9XA 2RDDA 3SSSA 2QL7B 5HLFB 1B0TA 2UVRA 2XI2A 2GFFA 2MKIA 3ILLA 5JVGQ 3OHAA 1FDAA 3GJSB 4H4MA 4QR2A 1FNXH 3MECB 3BR9A 3RUBL 3R7BB 3GIJA 4QIGA 4E0DA 3H20A 1JLAB 1KVIA 1DURA 1WACA 2GVZB 3P96A 3CDUA 4LRCA 2XCPA 4DV4J 3PX0A 1S1TB 4OZ0A 2LMIA 4ZN1A 2V50A 5L38A 3OFGA 1LWFA 4XAKA 4AD6A 5FDLA 1TMJA 1AT1B 1K73T 5L9NA 1UA1A 2UVVA 4EK2A 3R5GA 3C6UA 2HBZB 5CA5A 1ZM9A 5GADI 4D3GA 1CQMA 1XERA 1D1UA 2F5GA 4DPYA 3KHLA 4IYQA 2ASJA 2CQBA 1S48A 1ZA1B 3EXYA 2AJ1A 2WSFC 4R5PA 1KKHA 2J7KA 3LP0A 1OO0B 1X5TA 1RT4A 1U09A 4Z7YA 2WONB 3JQMA 4BLGA 3BSAA 3ENAA 2ZH2A 3N5FA 3V6KA 3BJYA 4B3OA 1QDUB 1HNZF 1SCJB 3MM6A 4DV4F 2EI5A 2EK1A 1WDDA 1XR5A 5C42A 2JFDA 4CO5A 2QA4G 4JV2A 4K4VA 4GO5X 4J90A 1WSRA 3O6QA 2G4BA 2XSJA 1OY9A 3ITHA 2JLFA 4USTA 4V1Ak 5IWAF 5CHCB 2OAUA 2WRMA 4FF1A 3MEEB 3T1YJ 1Q95G 2DNNA 3AJ2A 3VZIA 4C8LA 3MEKA 2HS0A 3EVWA 4DV2F 2BE2A 3I4HX 4LMZA 4OI6A 1Q0NA 3J7YU 1UETA 1VBYA 3HF5A 3RW7A 1N33F 3DRPB 2GGPA 4EEYA 4EYIB 3EGZA 1RADB 3NCQA 1NH7A 1M5OC 2DGOA 3FUYA 4PXEA 3RG6A 1IKVB 3RJMB 5FLXU 3NMAA 2FJVA 1Y0HA 1WEZA 2GVDB 1WF0A 1YIJS 2Z8QA 2BJ9A 1RTHB 1T11A 3EXCX 4OMFG 2R8HA 2IJRA 2RQKA 1IR0A 2WVCA 3CWJA 2ZFHA 4A8QA 5E33A 1AUDA 1SB6A 4KE5A 5HO4A 2AHOB 4RO0A 2NZ4A 1FX4A 1OSDA 2CXEA 5AE3A 3OD2A 3L9ZA 3HFZB 3V6JA 1JIHA 5J2PB 3EUNA 3T19A 4C8NA 1QAJA 3CC4S 1PKUA 2QFIA 2JVRA 3Q86A 2ZVIA 1ZM4A 3QPIA 4I0WA 1N5YB 4LIRA 1JJCB 4O3NA 4ZP9A 4Z37A 1GX6A 1OSCA 2MY8A 3I9V9 3P3DA 2W9CB 1SJQA 4J9NA 3V81A 3BQ1A 1W7WA 2YY3A 1D3WA 1OQ6A 5THWA 4ZLLA 1EQ0A 2GC8A 3QWPA 2F9JA 2HRTA 2IM2A 1RP5A 2OPSA 4IG0B 3PEHA 5DQHA 2XWXA 3OVSA 2CIMA 4H4MB 4YY3J 2A6OA 3D1OA 3Q8VA 5HJYA 4HL9A 1Y9OA 4JB8B 1BC6A 3CCVS 1H72C 1RTJA 2GVZA 1EJ7L 3ET6B 4PWUA 1KLMA 4IG3A 5D15A 4PRFA 4JUZA 1YITS 2FHJD 4UTGA 2XCAA 1RYRA 2BACA 1QD1A 4O23A 1N54B 3JSYA 3ZZTA 2NLWA 1C1CB 1VRUA 3BS9A 1O0PA 3IRXA 4L3NA 3W65A 1YKWA 4BCAA 1DLOA 1RI7A 2XLIA 5KTQA 2HG4A 2ZBRA 5ETNA 3KK1B 3Q0AA 1NM2A 1IQZA 1XMBA 4QR0A 3ZNJ1 2R7XA 5A8KA 1FKPA 2D74B 5KG2A 4Y34A 4CLUA 3HSJA 2P9EA 4TY8A 2DR8A 3GYNA 4DWIA 1AXQA 1FK9B 3DRRA 3I9ZA 4J9MA 3RB0A 2CJQA 3F56A 4ATNA 3MM9A 4ECRA 2ZHBA 2Y3YA 2MSSA 1CJUA 3R9LA 2UUBJ 2KXNB 5FJ4A 3QSIA 1EETB 1QE1A 2JNJA 2K2PA 4NZ6A 1FHTA 1QAYA 5B0CA 5D78A 3GU0A 5IFMA 1R27B 2HMIB 2LDYA 3MEGB 4A47A 1VHFA 4EO6A 2PMWA 1FRMA 1UW4A 2PC6A 2UZAA 1CVJA 2G0JA 1LWFB 1H7WA 3H5XA 2EBEA 3HI9A 4FS1A 2HFUA 3GWCA 4CLZA 2MGZA 3MR3A 3IC1A 3BQ0A 2AGPA 1RB0A 2Y0SD 2DY1A 1SH0A 3M1VA 1W2BR 2HSEB 1XK8A 3PX4A 2HHVA 4G1IA 2VBZA 3WHIA 3MEDA 3R7SB 1Q4RA 2KM8C 4NLQA 1M1KT 3L7OA 3OR1B 4B08A 5C24B 2AW0A 4N77A 3V4IA 1R6VA 3FCWA 2BR0A 4C8OA 2CQIA 4J9VA 1RWXB 3D68A 3TYTA 4YQWA 3CCRS 1M5PC 3RR7A 1RTHA 3MOZA 2OGUA 3EGWB 5GAGI 3SYZA 3I5BA 2MZ1A 1TK5A 4NYPA 4W98A 1TELA 3C19A 3MFHA 1XTZA 3MM6B 4NA3A 3SMZA 2FJWA 1U24A 2JEGA 4WIQA 3CGIA 1X4EA 4MTPA 3WX4A 2J6UA 3PCOB 2Z0GA 3BGRB 1UL3A 5EUHA 2J9DA 2LEPA 2H5JB 3TUJC 1JXVA 3EPGA 2N7YA 1X60A 1N6QA 3MEEA 4J9QA 4LIWA 4NXMJ 3GB0A 2R7WA 4RUCA 4XDCA 1UMJA 2XYHB 1WG5A 2I6WA 4KT0C 4C0BA 1UVJA 4UUWA 5GAHU 3DLEA 2EKNA 2E5LF 1NRKA 4USMA 1I94F 3W3SA 2KRRA 4OX8A 3T6JA 2C28A 4DFKA 1QM9A 5DLFA 5J2NA 3HHLC 3G86A 1DTQA 5CYQA 4J9KA 1ZYQA 3NNCA 4KH0B 1HIYA 1MN7A 1TVRA 1HNVA 1YRUA 2AP6A 2RH3A 3EM1A 1T3OA 1H3DA 2KB2A 3NGKA 2YNHB 5KFAA 2XO6A 4F4WA 3NY0A 1QLNA 2Z4PA 2OTLS 2PMHA 2DYAA 1WTFA 5LOQA 5I3UA 2M70A 2ZBIA 3K5PA 1MROB 2QV6A 4HI2A 4H4OA 4Q7AA 4DR5F 1U1PA 1OS5A 4GKKF 2XLKA 1HMVB 4KH1B 1F9FA 2W24A 3NNHA 3H4DA 3D4JA 4ZJQA 3M8YA 1DQAA 1NSPA 2FHMA 3GQCA 1YJUA 4MK9A 2CNOB 3G6ES 1JMTA 3DYAB 4P6QA 4LF1A 2R7TA 4Y2IA 4TNOA 1JLGB 4DCOB 1T9VA 3BREA 3H7HB 2GIRA 5L46A 2ALZA 4EBDA 5DQIA 2OO4A 3VVTA 2VB6A 3B82A 4WBFA 2HQDA 4I2PB 3NS7B 3A12A 3C8YA 1G1XA 3ZZRA 1JKHA 3BR8A 1FEHA 3UNGC 4DR7F 4CLSA 4C6AA 2EG1A 3ET6A 3FCHA 3VHQA 3ISZA 1MU2A 3DMJB 5IOLA 2W9AA 1KR4A 1J5EJ 5EWGA 4DV3J 3W2WA 2JVOA 2XZDB 2NXUA 2QLFB 3RGIA 1LKZA 1C1CA 2KT2A 4N8OA 4ITSA 1ZA2B 1DTTA 4DR2F 2B4UA 2DR9A 3PKYA 2DRBA 1UKUA 1N4LA 3A3PB 1IKWB 3KLIA 3AJDA 4L72B 4CYUB 3UNYA 1L3SA 2D3O1 4J9RA 2HURA 3IAM9 2LA4A 2V68A 3HVTA 1SKRA 1ZAXA 4TY8B 1HYSB 2F40A 3PJXA 4MK8A 3EE3A 3QIPA 2C2EA 7FDRA 4DV2J 2CG4A 1DBDA 4O3RA 4NX9A 4P10A 4UY8T 2J8AA 4DSFA 5A2QU 2FDNA 1RHKB 3MTJA 4OYWA 5I3PA 1SH2A 4NXNF 2HMIA 1FKAF 4J7CA 1JWWA 2EC2A 2CDQA 5A6WA 2C42A 1H98A 2WW8A 4XDDA 4ZMMA 4UZBA 2GMLA 2MJNA 2DIVA 1HBMA 2WB1D 3PRBA 4OZ3A 5HL7Q 1M90T 3QO9B 2W2PP 4PWDA 3NGDA 3MM7B 2IY5B 2OI2A 3FBCA 2RUGA 2DCUB 2DNGA 3FDSA 3KLHB 2HNYA 3KJFB 2KG1A 3IAS9 2V2ZA 1Q7YT 3DHXA 1RAHB 1XNRJ 3POTB 2F65A 3HJVA 2CQ2A 3LGNA 3QLHA 2L9DA 3SCJE 2J5AA 3E2EA 3N6MA 3TX0A 5DM7Q 2C2KB 3V6HA 3DLKA 3NP5A 2COLA 3SSQA 3UI3A 4B9LA 5GAEI 1SKSA 1TUWA 3CJ3A 1TVRB 4DCJB 1S76D 4E98A 2HHPA 4NLYA 3O44A 3MR7A 2R9LA 4BBYA 3HDSA 3G71S 3Q8YA 4ECYA 3PV8A 3IFEA 1Z1ZA 2JLEA 1TK8A 1PCAA 2M52A 3CJRA 4BWMA 3DLGA 1L3VA 2XMAA 4W90B 5IC4B 2FD2A 1FTRA 4LBIA 2KXFA 4MIBA 3RBXA 2L41A 5HAOA 4QYZK 2E5LJ 1BE4A 1HHQA 2V8GA 3OTDA 3PRVA 1UW9A 3J7ZT 1WC3A 5KFSA 2Y1IA 4IRCA 1RKIA 2DH7A 4B02A 3OTCA 3QIDA 2V4JB 3SI8A 3TZZA 2UUWA 4RUAA 1YZ6A 3N28A 4B17A 1F60B 2H5IB 4MKBA 1RE1B 5F9LA 5F8MA 1BGXT 2DGXA 1OPZA 1UP1A 1E6YA 4OLOA 5IQQA 5G0RA 2HHQA 1NPKA 2ABYA 1QJHA 1Y10A 2DHHA 3NLCA 4CH0S 4DG1A 5K8OA 2JRSA 4OJ3A 4EZ9A 1E6VA 2WHOA 3DGPB 3VVUA 5C42B 1K0VA 2OPRA 1X4BA 3ISND 3JXOA 4IKAA 1TL1A 3UPFA 1YX2A 4NWBA 2BV3A 3JSRA 5H1SV 4QW8A 2PD1A 1BWVA 2WB4A 5DG8A 3KLIB 4CYUA 4RNMA 3CCES 2H4YB 5AXNA 1P9QC 3C16B 1RHRB 2F9DA 3DHWC 2BJ7A 1S0OA 2BE2B 5FLXY 2IC3A 3HHLB 1RYSA 2BKNA 2CJBA 1NK7A 2FLLA 4DMZA 3MXHP 2B6AB 3QGPA 4S0MA 5LM7E 2IVFB 1LW2A 1X5SA 4H54A 1VISA 4NRTA 1RXOB 5E3PA 1B7YB 3M2RB 3OV7A 1U2CA 2CQPA 1L3TA 5IXUA 4NL5A 2XGPA 2I38A 2V5HG 1C0UB 5F0WA 1FJEB 1AB8A 3PVXA 4G1QA 2U1AA 2JL9A 3M8PB 5CCMA 1NB2A 1FKOA 2ZITA 3B8HA 5C5JA 3DGVA 1D0EA 2UXCF 1TKZA 3UQSA 2MJUA 3J80U 1Q53A 5LXYA 1B99A 3M7VA 4I2QA 3D0GE 4KKOA 4FNIA 3EVMA 2Z30B 1HNXF 2HFSA 4K5RA 3VTIA 4YDXA 1F1BB 2IM0A 4USWA 4HT7A 5J1EB 3GFHA 2W9BA 2ZNZA 3BKFA 2UXDJ 3UW1A 1FFGB 4ZS6A 2VQEJ 5E7OB 4KFBA 4CO0A 5BR8J 2RILA 3K7RA 2XMVA 1KRPA 1HR0F 3SCKE 1VBKA 4FF3A 4J9SA 1S4EA 2FY1A 4PKDB 3F41A 3M9NB 2DGVA 5HBMB 3JYTB 4DF8A 1GMVA 4B3MF 2YX1A 2QSWA 1VQMS 2B5JB 3Q8RB 3KLEA 5J2QA 1QTMA 3CCUS 2QMXA 1CPZA 1LFPA 2KJWA 2CQ4A 3NGRA 4LFAJ 1HFEL 1JQGA 1KP6A 3FFIA 5CYMB 3M6VA 3MCOA 4I69A 3D28A 3VR1A 1WDTA 2AWZA 2VG7A 4RW9B 3W60A 2HNDA 1AUSL 2ZD1B 3LOUA 3MAHA 5BYSA 2IJNA 2QZ8A 3H5YA 2XS2A 3PW4A 2B8PA 2UUTA 2JC0A 4QIFA 5IQ6A 4CTAA 1PO6A 2YWWA 1S0VA 3KK1A 2R2RA 4LVNP 3D6HB 2HBQB 1U49A 1FJ7A 1F9EB 4ZPDA 2K1RB 1WC4A 1N5VA 1O51A 5AXLA 3ULHA 4B3TF 2V8VA 3PEJA 2C3OA 3BDPA 2FZGB 3E01A 1RT6B 2ZJRQ 2IJFA 2A2CA 4U67Q 4ED7A 3MMJA 4U7UD 4LR9A 2YH0A 1LW0B 1GMUA 5KOWA 4DG1B 4DR3J 4OYBA 2E9TA 2XNQA 4M5LA 2QMWA 5HATA 1WEYA 3KDOA 3GPAA 4QWBA 3AQPA 2BJ1A 4DLEA 3D3BJ 3U7JA 4USVA 5GMKa 4KTQA 4OHWA 2ADBA 3K59A 4K2JA 1NLKL 1VJWA 4M8LA 4PQAA 1U8WA 4ZIVA 4IDKA 2EPIA 2GMJA 1GMWA 3IS9B 2DXDA 2XMMA 3HX9A 2QLWA 3PXGa 1F2HA 3DOLB 3OL9A 2YXLA 1CJKB 1R0AA 1P1TA 2XHCA
chains in the Genus database with same CATH topology
2E1MC 5LMNF 5DO2A 5DDRC 2RU3A 4KJIA 2VFTA 4KV8B 3RYLA 4YB7A 1TL3B 5K14A 5AXMA 3SCLE 4TU7A 2BUNA 2R7OA 3FGVA 2YKOA 1S72S 4JI3F 4R0JA 1T94A 2CQ3A 5EWFA 4FXVA 2MKJA 1N56A 2DVIA 5GAEU 1N52B 4URQU 3OXFA 2OFHX 4R25A 4YR0A 4QWCA 3DFEA 2CJKA 1WNEA 4HLBA 2EFNA 4MKYA 5HMZA 2ZH6A 2YKMA 1QVFR 1VQNS 3G9CA 4Q43A 1Z2LA 1U6FA 3BO4A 2Q6CA 2W7AA 2E9ZA 1UEVA 3W7BA 5KFEA 2IC3B 4IH7A 4RW6B 4F4YA 3VQSA 4CCHA 2LECA 5L8RC 2XZWA 1S6QB 3IG1A 4F8RA 4O0IA 2IM3A 2KM8B 3L95X 1FE4A 2QFJA 2LYVA 5K5MA 1U2FA 3K57A 4PXDA 3PZPA 3WBZA 2KU7A 3I0SA 2ZDOA 4DOZA 4KKOB 1IBKF 4FXDA 1TKTB 1HMVA 1R8BA 3DI6B 2RRBA 3R3TA 3JAMY 2NREA 4LF7F 1GX5A 4EGLA 4ZHRA 3J80Y 3X3UA 1JLEA 4DX8H 3MAQA 1KLNA 2NR0A 2DIUA 1Y4ZB 3QWUA 3SZ2A 1NJIT 2J0QD 3HFKA 4DBQA 4JV2A 1RJJA 1H7XA 3T6BA 4I2PA 2C2RA 1N5TA 3MECA 4JI5F 3R1LA 4MYTA 1YBAA 3EYZA 4Q2LA 1T7PA 1JLAA 2R8JA 4I6AA 3C66A 1UA0A 4CH1A 1N0UA 5A2QY 4C11B 2P9GA 3MMCB 1UFLA 4RU9A 1JB0C 1JJ4A 4F3OA 4LF4F 2AYBA 4A48A 2B7CB 3NCPA 2HNDB 4CT8A 4LUBA 1BD6A 2EG2A 5L9XA 4DL4A 3VAKA 1Y00A 2D3UA 3DRPA 4ILLA 3UCUP 5I4MA 1LQ9A 4KV8A 4R5PB 1Q1KA 1LWCB 1VBZA 1FD2A 4NZ0A 1O5JA 5JJBA 4RKUC 2BJEA 3BGUA 1SXLA 2GV1A 4P2SA 1C0TA 2IAJA 5IS2A 4IH5A 2UUAF 3OXLA 1ZM3A 2K7JA 1RT7A 4ZKAA 2D9PA 2VPWB 4DL0C 1ROFA 2CQGA 4LJMA 2U2FA 4NLVA 5DGBA 5J2MA 2OJ3A 4Q8EA 3CT9A 1FE0A 2BW2A 1REVB 2VBYA 2WBMA 4I6WA 1OWXA 2PE8A 5JXSA 2SXLA 1RISA 2J9CA 3DOLA 3AY0A 3TAQA 2R8KA 1R8PA 4V19J 4ZP7A 2OTJS 2RMLA 1B0VA 2OPSB 2OMOA 4IG0A 4O3PA 2RKIB 2Q66A 5E3QA 2UXDF 4RW6A 3QLHB 2D1CA 2ROEA 1MWYA 5A8WB 5D3GB 1FT8A 2XHWA 5GAHI 3RZAA 5KFUA 4YHHF 1SL0A 1X9MA 4UUXA 2RSQA 4B9UA 1HI0P 4JI2F 5F8LA 4F50A 4GO7X 3DOKB 2FC9A 4C4WA 1ZPWX 3CCSS 2I5JB 4YY3F 2X1FA 5HROA 4EBCA 3J7A1 2A1BA 1DLOB 1M0SA 2ZOGA 2FGOA 3KLGA 1S1UA 3CD0A 3MFIA 1N5YA 1FKPB 4YUDA 3P5TL 3M30A 1O8BA 2IBOA 1VK3A 2LQJA 1HNIB 2WOMB 5B0EA 1YRXA 1F0XA 5KG3A 2IYGA 1KOHA 3VZHA 1G3OA 3QMQA 3VAMA 3RB6A 3U02A 4X4PA 4KO0A 2O1PA 2CZ4A 1QY7A 2G9OA 3T5LA 2DH9A 1U1LA 3THTA 1R6YA 5H9FJ 3Q24A 2N82B 2MZTA 3LO3A 4WFNQ 3IR6B 2UU9F 2ZJQQ 3CC2S 1UVMA 2N4CA 5EX0A 4IFVB 5MAOA 1HPZB 2PA8D 3T5JA 1TL1B 5CZVA 1S10A 3S6EA 5LSRA 1XMOF 4ZCIA 1P27B 4Q0BB 3I0SB 3OTEA 2AV5A 1S9GB 2DNKA 2HWTA 3P6YC 4DV3F 2CYYA 2YVSA 2FLPA 2W7OA 2WSCC 3GV8B 3MUVP 3KHRA 3KLVA 1JLEB 1U45A 3DRSB 4ALZA 5KFLA 1HWKA 2F3JA 4ERDA 3OSPA 2XMUA 2WCXA 1C0UA 3LAKA 4K59A 2KHCA 2P6TA 1SJFA 1TFWA 4P7TA 1DARA 1CC8A 1WEXA 2FUG9 3HVAA 4DR6F 4K50A 1KN6A 2ERRA 3N5BA 4F3QA 2DHAA 3BGRA 2XB2D 1RA6A 2XLJA 4JV5F 3C3LA 3O5TB 4KHMA 2CQCA 5T14A 1HD1A 1KQKA 4RNHA 3CC7S 3K8WA 1VIXA 1X5PA 4MKAA 4ETXA 4TKTA 3FRYA 2XC9A 2DRAA 5DDQC 2VPZB 2ILYA 2KYXA 5J2NB 4USJC 3PW2A 3H8YA 3OFFA 4ZP8A 5CYQB 4PG7A 2DPJA 3J81Y 2FJBB 3KTQA 1U47A 4ECZA 1VQLS 1H38A 3DOKA 2HWIA 1JLBB 2ASYA 4OZJA 1G2EA 2DHGA 5HQ8A 5DJBA 3THVA 1I6JA 3V4MA 4G6VB 2E7WA 4TXSA 4O3QA 4XPCA 5D4PA 1S1UB 2J6SA 2DD8S 4QIWD 1KFDA 4KSEB 3QZ8A 1WG1A 2ZKUA 4HI1A 3M2UB 4CTAB 4TU9A 4IOAQ 3LP2B 2KVIA 1U4BA 4DQQA 2NPIA 5C25B 1S6OA 3CO9A 3GFYA 4TY9A 3KG1A 4NLDA 1WI6A 2CQDA 4FN5A 4Y65A 4QIEA 2Q3PA 4DLGA 1XNQF 1R8CA 2YWKA 4DFPA 3AB2B 1HBUA 2H9ZA 4LSLA 1VRTA 2XS5A 1NHVA 4RZRA 3UDLA 3G8QA 4PQUA 1WI8A 2EW9A 5E41A 1S1XA 4DSKA 3GILA 2JFKA 2A10A 2BVZA 2POKA 3GR1A 5B09A 4DHVA 4Q0BA 3IS9A 1VIOA 3M4XA 2CPDA 4MIAA 5IZHA 1RQ0A 3IO1A 1S79A 3IWLA 3JB9k 5IT4A 1S1WA 5E5NA 2KN4A 3THPA 1NKBA 4PXBA 3DRSA 1DRZA 2L08A 4HTJA 3IGVA 5A6PA 5F3ZA 4A8FA 4JV1A 1TL3A 3TVZA 1BQXA 4N41A 2ZH1A 1VI7A 4ZVFA 4Q44A 2RQMA 2R4FA 2JJ4D 2B9YA 1N88A 1YVFA 5DQGA 4BDPA 2ZE2A 5FIIA 3KJVB 3HO1A 3CE8A 2HS4A 2C3YA 3D54A 5L1JA 3HMJG 4ZCMA 2BZ2A 2FB0A 4R8UB 5KG7A 1YQHA 1V3RA 3QO9A 4JV0A 4RW7A 4PWDB 1FESA 2KI2A 1DTTB 3VF0B 4K4SA 1TL5A 2GQQA 4NLSA 1HQUB 1UVKA 2G0CA 2YNFB 5K9FA 1IKWA 2ZOMA 5F8NA 5HMXA 4NCGA 2E1AA 4FZVA 2V4QA 5IM0A 1HYSA 2WSEC 2VASA 2M7SA 1QSLA 3VAFA 1UVIA 5A0YA 3S8SA 3Q8SB 1V3ZA 4ZOSA 2RB7A 1R3NA 4X4NA 4Y0FA 4TQRA 3QJPA 2QA1A 5KFPA 1G7CB 1D9AA 2GA7A 4RW4A 2MXYA 1HI8A 2BRKA 3CDWA 2FVPA 4M63A 1SL2A 4FF4A 4AQYF 2BBEA 2I0XA 5IT0A 4ILMA 3PW5A 3N79A 4LF5F 2IMWP 1NH8A 1N34F 2PI4A 1LOUA 1HA1A 4JOUA 4OZNA 3DI6A 1WTBA 2DGSA 5DG7A 2W4DA 3J7Z5 4MYUA 3RRKA 1W25A 2B4PA 2E5JA 2F8HA 3CTRA 3K2YA 3OLBA 4DL2A 3L3CA 4QBUA 2N3LA 1FVQA 4ID8A 1BQMB 2VD3A 1X7VA 2VKZG 4FNHA 3D0HE 2Q6BA 5M2PA 3R5CA 1EP4A 1KQSR 1C4CA 4PR6A 1RTDB 4ID5B 3M32A 4GC7A 3NS5A 2E7XA 3MMCA 2XY7A 2JEFA 2OPQB 2VA3A 3K8VA 1Y5NB 1HHTP 1C4AA 2VQFF 4BC9A 4I67A 2MKCA 3SQGA 3LP2A 1S4FA 1TFYA 3HKZD 5SUHA 1IKYB 1LWEA 4K4YA 2CPYA 3WDOA 2N7CA 2KT3A 1FDBA 2VV5A 1X0PA 2FGCA 2V4JA 3CCZA 3DXSX 1YGYA 4LF8F 4CO2A 5SZTA 4G1QB 4RWXA 1GH8A 2H5EA 2DGUA 3KHHA 4B9NA 4A8SA 4OJHA 5DRKA 4Y3CA 1XWLA 3CEDA 4A8YA 4CO4A 3RAMA 3BN4A 1XNRF 1N32F 1JXEA 3HKWA 4OX7A 2AD9A 3L7PA 4OI0A 1REVA 3M1VB 1NO8A 4RLEA 4URSA 4KFBB 2YQ3A 3AH6A 2JWNA 3GR0A 5DG9A 1VGYA 3M8RA 4W92B 1L3KA 5C24A 2RDJA 1Q86T 4RU2A 3DLLQ 4IOBA 1SJ1A 2RKIA 2EFQA 1WF2A 2ASDA 1SKWA 4C8KA 4OIXA 3HHLD 2W7PA 2W25A 1TR0A 4ECXA 2VUGA 2GQCA 1TV6B 4RW8A 3O8WA 5T41A 3GFZA 4N56A 1Q8LA 1FKOB 3SV4A 1S0MA 4KB7A 2ZE2B 4NYZA 4IUFA 3RRGA 2M2BA 2FVSA 1M5SA 1G6BA 2DBBA 1XR6A 2VONA 5CD4H 2LU1A 2IMOA 3KYLA 1TKXB 3B4MA 3R5BA 4RUHA 3DRYA 2QYCA 3DLEB 1NNDA 3E3XA 2E5IA 3BEGB 1FCAA 2FVCA 2KRBA 1Q79A 4CQ1A 4EFAC 4ECVA 1UFWA 2VOPA 4X66F 4A8KA 4A4JA 1UVLA 4Q45A 1GAOA 2YNIB 4LSNB 4KC5A 4OZ1A 3CIZA 3M8SA 5KT2A 3KLEB 4Y2MA 4NLUA 1VQKS 2KZMA 3OL6A 2K7KA 3MDFA 4C0HA 4ELTA 4JI4F 5T7LB 1KNZA 1KEKA 5I3UB 2MHEA 4NYOA 4ECWA 1KFSA 3ZZOA 3KK3A 1HW8A 4RW9A 2C3MA 1HPZA 2YH1A 1APSA 1YJVA 2ZD1A 3MM5B 1OPIA 2HFNA 2J9EA 4IR1A 2ZH7A 4NLPA 3U1MA 4QW9A 2MQQA 4CO1A 2WBRA 4O3SA 4ES3A 3M9OB 2GJ2A 4O44A 5HI7A 4CIOA 2B43A 3TR5A 4ICLB 1ZETA 5KFHA 4F4KA 3V5RA 4C9DA 1VOMA 2LEAA 1F5BA 3OVBA 4X65F 2YWFA 4O4RA 4X4UA 4MAKA 5JUMA 4M5DB 5I42A 4UW2A 2RIJA 1L3UA 1UVNA 2VA2A 5EWEA 1FVSA 5B0DA 1U1KA 3UD3P 3FRZA 2ZNYA 2L48A 3OJUA 4ID5A 1HBOB 2CJ9A 4IH6A 1DHMA 1R43A 2HZCA 2XSJB 3IWXA 1NKEA 1IBMF 2OH2A 4DS4A 1VMBA 5KFNA 1DQ8A 2YKMB 4ZLPA 2IVYA 2W9CA 5E0OA 2CZVC 3S1TA 1IKXB 3HJFA 4EYHB 2ZBCA 2W4PA 3CXCR 4N47A 5CQGA 4WFYA 1GNKA 2KJVA 3NBPB 5AE2A 4AL6A 4IRDA 3LW5C 1S6QA 3IG1B 3BO2A 2IVMA 4H4KA 4FYDA 5LJ5Y 2MQOA 2HVIA 3CMES 3PIPQ 1VQSA 3RAXA 2FJDB 3AQOA 4AE5A 3CCJS 3OSNA 3MHYA 1VQ7S 3OLAA 1S6PB 1R7IA 3IRXB 2M8HA 1K1QA 4KIAA 1RWUA 1UWBA 4ECTA 3TQ1A 3OUYB 4MFBA 4LT6A 1U6BA 1TKTA 1YRTA 2PGCA 5B0FA 3UFCX 4K2XA 5HMYA 1FK9A 4PG4A 1WF1A 3H59A 4ZVHA 3BB5A 5C25A 3E8OA 3PX6A 2VG5A 2VBXA 1ZH5A 2IRXA 3I82A 4YB5A 3KG0A 1CQNA 1D9FA 4C3KA 1WHWA 2Y1RI 6FD1A 4WFAQ 3BZQA 1T05B 4OHVA 3FZBA 3MWBA 4X62F 2OPPB 1GTEA 3KK3B 3I96A 4Z2XA 1NK9A 1VFJA 3KOAA 2RRNA 2MGZB 3PO4A 2DNZA 5H9EJ 3H5SA 4DPOA 4XPEA 4QYRA 5LJ3Y 1TKDA 1OQ3A 1FO1A 1RT3B 2RT3A 2XG8A 3PKMA 2IBKA 5A8KB 3OQ2A 1SQEA 3BM7A 3OR1A 3TW0A 1H2VZ 1S1WB 4ICLA 3H98A 2KTQA 3DRRB 3LANA 3OW2R 4ZPWR 1YI2S 2HW3A 1FRKA 2KKHA 3IRWP 2IRUA 3GE9A 1X4HA 1K8AT 1E6VB 2CPJA 2ZM6F 5KFIA 1HHSA 3BGFA 3MGJA 5B0BA 1RT7B 2D41A 3Q22A 2OMLA 1TK0A 3PACA 2L3MA 2B9WA 4C11A 5T7LA 3CCMS 2FJEB 4MJKA 3DRXA 3QGGA 4RW7B 4ZPCA 1PC5A 3TNVA 3H40A 3GMGA 3IBWA 5KAKA 2X1BA 4AUKA 4CH7A 3CVKA 4U7CA 2FVRA 1Q78A 2CPZA 3N4WA 1DTQB 4WF9Q 4ZCKA 5HP1A 1R89A 1LFWA 3M8PA 1I1GA 2GCFA 5I42B 3E2EA 2OFGX 1C0TB 2IAJB 1RT1B 3C6TA 3R5AA 1TKZB 1K0TA 2P5VA 1S99A 2LA6A 1WHYA 4QU6A 4HHJA 2PO4A 4I2QB 4H4OB 4JI8F 2LLZA 3RAQA 3HPOA 4OL8A 1NJXA 1WHVA 1IQTA 2I2YA 3DYAA 5AJ3F 4Q5VA 1VLYA 1X4AA 1YG0A 4ECYA 1HNIA 1U1MA 3AB4B 2RU9A 3MF5A 4IOCQ 2E9RX 1JLQB 2VG5B 3HT3A 3GFXA 4NOHA 4WTYA 3DLHA 3TI0A 1URRA 3N9UC 2MB0B 1X4GA 3PM9A 3SFUA 5KFWA 4I4BA 5KFXA 1FF2A 1HQEB 3H2LA 4F4ZA 1LXJA 1NEEA 2MMYA 2EFPA 1S1TA 2CQHA 2GNKA 3FMWA 1QUVA 2BJDA