2WSEC

Improved model of plant photosystem i
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
81
structure length
81
Chain Sequence
MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWGGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AT3G54890
publication title Structure determination and improved model of plant photosystem I
pubmed doi rcsb
molecule tags Photosynthesis
total genus 4
structure length 81
sequence length 81
ec nomenclature ec 1.97.1.12: Photosystem I.
pdb deposition date 2009-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF14697 Fer4_21 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2wseC00
2UZAA 3IR5B 1CLFA 1DURA 2C3UA 3C8YA 2C3OA 2IVFB 1D3WA 7FDRA 2PDAA 1XERA 1Y5NB 1FRJA 1IR0A 1FRMA 1ROFA 3MMBB 2ZVSA 1GTEA 5E7OB 3MM5B 1SIWB 1FTCA 3MM8B 2WSFC 1G3OA 2FJBB 1HFEL 1BWEA 2C3PA 1FRHA 3MM9A 1KEKA 5CH7B 2FJDB 1GAOA 1DFDA 1C4AA 2VKRA 2VPYB 2WAQD 3OR1B 2VPZB 1FRIA 3EUNA 1FXDA 1SJ1A 2XSJA 3MMAA 1K0TA 1BD6A 2O01C 4RKUC 5BYSA 1H98A 2FD2A 3EXYA 1Y5LB 2GMHA 3OR2B 1FERA 4AYBD 1Y4ZB 1GT8A 2V4JA 2PMZD 1KQFB 1AXQA 1FRKA 2Y0SD 5FD1A 1C4CA 1BQXA 1BC6A 3EGWB 3IR7B 2WSCC 1F2GA 4OMFG 1FRLA 7FD1A 2VPXB 3MMCA 1FEHA 1A6LA 4KT0C 1FDDA 1F5BA 1H0HB 5BYRA 2GMJA 2C42A 3HKZD 1F5CA 1Q16B 6FDRA 4ID8A 4L6V3 1KQGB 2FGOA 1DAXA 2FJAB 1FRXA 3PNIA 2FJEB 1JNRB 1RGVA 1FXRA 1R27B 4Y28C 1FD2A 2C3YA 3MM9B 1GTHA 2PA8D 3MMBA 1IQZA 1FDBA 1PC5A 3LW5C 6FD1A 1WTFA 3GYXB 2FDNA 3MM5A 3MM8A 1SIZA 3MM7A 2XSJB 3MMAB 4XDDA 3MM6A 1FCAA 2WB1D 1B0TA 2VPWB 1VJWA 1JB0C 3IR6B 4OV1A 1H7WA 2V2KA 2V4JB 3OR1A 1Y5IB 1PC4A 1B0PA 1BLUA 4YDDB 4CI0B 1H7XA 3OR2A 1FDNA 1FF2A 1JNZB 1FDAA 2WSEC 5L8RC 1G6BA 3MM7B 4DHVA 2C3MA 3MMCB 4XDCA 1B0VA 5CHCB 3MM6B 5BYQA 2Z8QA 4XK8C
chains in the Genus database with same CATH superfamily
4FP9A 3EVOA 1U1PA 4K4TA 3HPOA 4OHZA 4RUHA 1XERA 1VK3A 1FJCA 3OVAA 2V67A 9RUBA 1X4FA 1GNKA 3AXMA 1RADB 4NA2A 3X1LB 2EKNA 2VPZB 1TK5A 2V2ZA 2KVQE 5F3TA 4GO5X 2OGUA 5B08A 4K0KJ 1RBLA 5HP1A 1CC7A 1BC6A 4OMFG 1FRLA 3OLBA 5J1EB 3W61A 4YEAA 4ZVUB 2H48B 1TKDA 3FK4A 1H0HB 2VIHA 2GMJA 5DO2A 4WFAQ 4NMXA 4UTGA 3K7RA 5ETOA 3DLLQ 2J7UA 2CVIA 2AEMA 1UVLA 5DGAA 4IRCA 4DUYF 2XCPA 1YDLA 4DEZA 2KM8C 1IKYB 3FEXB 3MAQA 3TA0A 1Y3JA 4RW8B 3NS7B 1NK5A 2VPWB 1WI6A 3DHWC 2J0QD 4M5NA 1CJTB 5E0OA 3NGKA 1LWFA 1FDAA 3QRRA 2FHKA 1VQNS 5DJBA 4DWIA 1HNXJ 2J9EA 2UXBJ 1VLOA 2QLBB 1NEEA 1UW9A 4C3KA 2F8HA 3I9ZA 4ED1A 2FHJA 4B08A 3OVSA 2QL7B 5RUBA 1KHVA 4UOGA 3JAMY 1D09B 2NXNA 3FQKA 3GLJA 5A0YB 2BW7A 4C11B 2FYXA 2R2TA 2VFSA 4MIBA 1UETA 3DRRA 2ZM6F 4OHXA 2CPHA 3MCMA 3WQPA 4NLQA 4F4ZA 1VQ7S 5ETPA 5AXKA 4HHUA 3KDNA 4N8NA 2XMTA 4ECRA 4YB6A 1DY3A 3IMQJ 4WYLA 4OLOA 3M8WA 4DR7J 2HGLA 3OFFA 4B3SF 1ELOA 2ROEA 1X9WA 1UL3A 5K8MA 1TMMA 1F60B 3NBPB 4ILMA 1TL7A 2BEFA 2RB7A 3JSYA 1FK9B 4JI2J 1R0BG 3KG0A 4KKOB 2OTLS 4NLOA 3DRSA 3D68A 2XYHB 3V6HA 1VCTA 2F4FA 1J27A 4ZJOA 1RWUA 1NH8A 3QRQA 4DR6F 3MEEB 3PV8A 3IAM9 1ACMB 3AB2B 4I2PB 4LFAF 2ZHAA 4OZLA 4P7VA 3KG4A 5CH7B 2QSWA 4DSEA 1FJGJ 1VIXA 3H98A 3MUMP 2FB0A 4IKAA 2JLGA 2OD6A 4DPUA 5DDPC 2MGZB 2GA7A 4JB8B 3UR3C 7FD1A 4PAAA 1VQKS 2DNZA 2BE2A 2K7JA 1L3VA 1QE1B 5L9NA 2W9BB 2YX1A 3OHBA 2F4VJ 3QIPA 2X1FA 1Q53A 4JI7J 1FO1A 1URNA 2FDNA 2LECA 1QLNA 3QPIA 4OV1A 3PEJA 4CYUB 1U8SA 4CH7A 3MECA 2NR0A 1JQGA 2F8MA 1B0PA 3IAS9 1I94J 4CI0B 1IBLF 4DU7A 4TQSA 4C2MA 2ROGA 3OUYA 4FS2A 1Z2ZA 3M8PB 4I56A 3R7BB 4ZPWR 2ASYA 3IFEA 4B9SA 3LGNA 2XBPA 1X5OA 2YKAA 6AT1B 3U7JA 1AFIA 3UNGC 3UNYA 1SJRA 4JV5J 5LXRA 4R8UA 2ZNZA 2F40A 3DGPB 4M5DA 4AL7A 4A8XA 1FKAF 3EZUA 5FDLA 1SJ4P 2JLFA 4IFVA 3CCVS 4HT5A 4WCEQ 3NWGA 1D8ZA 1OY8A 3EGWB 4USHA 3FRYA 3W63A 3KUEA 3QT6A 2M70A 2MZ1A 2JSXA 1U8WA 3H5XA 2WCXA 3Q83A 1YG0A 3VVUA 1RT6B 4OYXA 4YY3J 4G1QB 1HBUB 4ZK7M 4LUBA 2CXEA 3UD4P 5GAHU 4NLDA 4ECTA 1SV5A 4MFBB 3WIVA 1SH2A 2MKCA 4HYKA 1CQNA 3D9BA 4HH1A 2QIFA 3SIPB 3P8BB 4OL8A 2EFNA 1N34F 4YFUA 4DV6F 3I32A 1FX2A 3T1YJ 2YX4A 2OSRA 2O67A 3LA0A 4ZN3A 4ECWA 1LWCA 4E2FB 2FZCB 2L9DA 1U7LA 3KK1B 1Y0HA 4QOTA 4USTA 3MMAA 1XK8A 4ID5B 2CJXB 3EZ5A 2MQPA 4IDKB 1Q5VA 2ZH4A 3BR9A 2RU3A 3L7PA 4I6YA 1RCXB 1Y11A 4PG5A 1FDDA 4HHJA 5JVHQ 2MKHA 2Y1LB 5THWA 4KGVB 1T3NA 2FVPA 1HWKA 4YDXA 2DB1A 2PT0A 1K47A 4LF5J 3M32B 2XSJB 1VQMS 3H90A 1KHWA 2C2OB 2F5GA 5KFBA 2IVMA 2Y0BB 4JV2A 3M05A 4USMA 2HHTA 4OYPA 4YDDB 1RT1A 2DJWA 2W01A 1KVKA 5GMEA 4HKQA 2V0NA 3ZNUA 2LMIA 1P9YA 2I5JA 3I87A 3O6QA 3VWSA 3IO1A 4DQRA 3HHNB 2HFOA 3V6DB 1SQEA 2EK1A 4KFBA 5HQLA 3VAJA 4MJKA 1UFWA 2JDJA 4TLRA 2Q3PA 1IUJA 2KXHA 3GONA 1VRQC 4LSLA 1VGYA 2YWEA 1HFEL 2XCAA 3T41A 4OYWA 1HWJA 1S6PB 4OZ3A 3PYGA 3DC2A 2V9KA 3ILOA 3CCSS 3PX0A 4O4GA 2J8SA 2HGNA 1RCOB 4TN2A 4ZMMA 4JI1J 1U1OA 3PW5A 2W8LA 5CYMA 2VUGA 3BGRA 3N6LA 3K8VA 1FD8A 2X51A 2E44A 4M5MA 1RKJA 4Y28C 1IM4A 3BO3A 1TTHB 3MCSA 3OSNA 4WIIA 2VG7B 4X4QA 1RTIB 1WOPA 4J37A 3M30B 1QJHA 4FPIA 4KGMA 3RBZA 4YP3A 1RHRB 3S8SA 3HXMA 1G1XA 1YJRA 3TJAA 3MM7B 1F1BB 5HANA 3JS9A 1LXJA 1T05A 3TOQA 4RUCA 3BYPA 5EUHA 3H4BA 4JI3J 4IG3B 1S9EB 4RW4A 2E9TA 2D7SA 3SQGA 5FJ4A 3U02A 1EHWA 2HRYA 5I42B 1SQGA 1WSVA 1YJUA 1U0SA 2B5JB 2EW9A 1C4CA 4MIWA 3B78A 4MIAA 4OYIA 2DNLA 3ENQA 1S0NA 2X1AA 2A10A 1UWAA 4OI0A 2RSQA 1T9YA 2FGOA 1KFSA 3FFIB 1FA0A 2XG8A 1JNRB 3D7SB 1U2CA 3WBZA 1PC5A 5HATA 2BKPA 2IAJB 3IRXA 4EZ9A 1VLYA 2AQ4A 3KLFB 3FCVA 4ANCA 4A8FA 2OAUA 3RGIA 4X4UA 2ZFHA 2R2RA 2D1CA 1BQMA 3BF4A 4N5SA 2ACMA 4WF9Q 4Y6IA 4OIXA 1GMWD 2GX8A 1X4BA 1JLQB 3SQOP 3OTOJ 2FIUA 3CJ8A 3QSYB 2XNRA 1KRPA 1GMUA 1IJEB 2U2FA 1YITS 3K59A 1PCAA 3MR3A 4I0WA 2XS7A 1LNQA 4Y2IA 4K59A 4CO0A 5K8NA 3TZZA 5EN1A 4ZCMA 3C2PA 1C0TA 3FQLA 1NDLA 3W2VA 2UXBF 3ZFVA 1S9GA 2GS8A 4PG6A 1OIAA 5E3AA 1S1UA 4I1TA 4XPCA 3VTIA 4AL5A 3G71S 2XGQA 4MKAA 3KLIA 4Q0BB 3MPYA 2OMOA 4JI8J 2HHWA 2D69A 5EGYA 5D4OA 4HACB 1KNZA 2HQFA 2HZCA 3Q2TC 2VKZG 3KUGA 2HWTA 2HWHA 2AX0A 3TP2A 3RB6A 1K1QA 3JQKA 4KGZB 2OELA 4CTAB 4M5IA 4PG7A 2ZH2A 1HNZJ 4DR7F 3D0IE 3MAAB 2B43A 1EP4B 5B0BA 3PJ9A 2AF6A 4KH0B 3W3SA 3MMBB 1EZZB 1U1LA 2LP4A 4NXMJ 3J80Y 2KO1A 1SXLA 2FJXA 2ALYB 4N56A 2AYMA 1RE1B 2WAQD 2B4OA 2ILYA 1VRUA 3CJRA 4N47A 1BD6A 4RU9A 1SKSA 1NK0A 4L76A 4C8LA 3HHLB 3HD1A 4ER8A 4ICLA 5A8KA 3BQ0A 1N6QA 3KJVA 1K0VA 5J1PA 3MMCA 2GIFA 2L48A 3A4TA 4L72B 4PRFA 3M7VA 3PYFA 4DLEA 4YR0A 3C6TB 4WZMA 2E1PA 2B0GA 5DQGA 3DDIA 4C0HA 4EO8A 5HLFA 4OI2A 1KN6A 1BXNA 3IR6B 2QFJA 3Q86A 1B3TA 4Y2MA 3CTRA 4PYAA 3M8QB 1VBZA 4P2FA 4GKJF 1HA1A 1WHYA 5K5MA 1Q7YT 3HVWA 4M63A 3NAIA 1S59A 2HZVA 3IP0A 4A8YA 1CC8A 3C6UA 1WC5A 3PIOQ 4OHWA 3QJPA 2EEYA 2YNIA 5J2PB 2JWNA 4CO4A 2W7OA 4CP5A 1YK9A 4CM0A 2D9OA 4GMKA 3AODA 1FFGB 3QSIA 2LQJA 4KTQA 2MY7A 2CWXA 1QAYA 1VOMA 1MN7A 5DM7Q 1TUVA 3GFYA 1JLFA 4I6WA 1WHXA 2UVVA 1RISA 2NXEA 4DV5F 2P6SA 3HKZD 3RW6A 2MZQA 2WVDA 4ZVPB 5GVQA 4JV5F 1GMVA 1T11A 2MB0B 1UA0A 2V2QA 3MR7A 3KLVA 5CAAA 5I3PA 1M5SA 4F26A 1VQ6S 4ZLJA 1JJHA 4PWDB 3ZZTA 3FUYA 3UE2A 1S0VA 3TEGA 3PXGa 3CEDA 4QU6A 4B9VA 2DGTA 5HBMA 5HVGA 2XO7A 1X5TA 1TL3A 1VC6A 3P6YC 3MF5A 2B6AB 1SC1B 2B51A 4B3TJ 4ZOSA 1LFWA 4QBUA 3T9ZA 4X4VA 3LO3A 2V2VA 1WELA 3J81U 2M2BA 3I0SB 2L08A 5DZ6A 3G6XA 2KZZA 4LQ9A 1RAOA 2QYCA 1T9TA 3JTOA 4NZ0A 2JH3A 5CD4A 5BYSA 5IWAF 1S10A 4ELTA 3BGFA 2DNHA 3AJ1A 4QYRA 1S4FA 2EFPA 2HHPA 3IBWA 5KFNA 1F5BA 4CT9A 4O3QA 4DL7A 2OPQA 2COLA 2K3KA 2GJFA 4ZCLA 5D4PA 2G4BA 1ICEB 5EX0A 4F3MA 4Y3CA 4AL6A 2JLEA 1W7WA 3D54A 2BJEA 2BE9B 3W2WA 4ECZA 1WJ9A 4DL4A 3BSOA 2E66A 1TFYA 2AJ1A 4UW2A 5D0EA 3ELHA 4A8MP 1FTCA 4CLLA 3SI8A 2I38A 2ZHOA 2XS5A 3OJSA 4K4SA 3HLUA 2RMLA 3AAWB 3K58A 1LWFB 5I3UA 4J9NA 2C2ZB 1YJWS 4KB7A 1VQ4S 2HK3A 4F25A 4KIAA 2RRBA 1U0HB 3QO9A 2X1BA 2QLJB 3T1HF 3LAKA 1TUWA 4KHRA 2GJIA 2XHCA 1RGVA 1X4GA 1CS4A 4QIEA 3GZ7A 1PGZA 3I0RA 1HW8A 4NE9C 3DM2A 3R1LA 4AQYJ 3B82A 3V4IA 2CJQA 5GAEI 5CCMA 1VQSA 5B7WA 3W65A 2I0XA 3W64A 4KE5A 4JI1F 3M2UA 3QZ7A 3BBBA 4RJVA 2IM3A 1DQAA 1JXVA 2DHSA 3UCGA 2OFHX 3VVTA 2UVWA 2HHVA 2VL1A 2LXFA 2HHXA 3BQ1A 5E3RA 3RZAA 2PI4A 4LJMA 4PWWA 1CJUA 4UUWA 3KFWX 4J9QA 1NK6A 1UVNA 3OBIA 4FNIA 3DRSB 5C24A 3BGUA 2DTJA 4ES1A 4LR8A 3QWUA 3S1TA 5B09A 1RT7A 3TVYA 2BV3A 4JI3F 2UUCJ 1DARA 4PG4A 4B3MF 1N8RT 3WZ0A 4GC6A 4TU9A 2P9EA 3W1YC 3J7Z5 4KRWA 1SL2A 3CE8A 1WC6A 2X3GA 5IV3A 1VBKA 1S12A 3KKFA 1U1KA 4GVBB 4W92B 3N01A 2BE2B 3K0JA 1ZAVA 3QIPB 1RAAB 3HHKA 3ZC4A 3DFEA 4CQ1A 1J5OA 5KFRA 3VZIA 3V6JA 5K8PA 4FXDA 1BWEA 5DQHA 2MPUA 3IS9A 5DDQC 3WHIA 4UOHA 2VOOA 3MECB 2K2PA 2CQCA 4QWBA 1NPKA 5EWEA 4C8YA 3OUYB 3W5YA 4RWXA 4WP8A 1Q82T 2HNZA 2ZDPA 3D3BJ 1RT3A 3Q0AA 3OTOF 3GTYX 1IKWB 4DFKA 2CADA 1OQ3A 4R8UB 4M5DB 2UUBJ 1FXRA 4IO1A 4FVCA 3E01A 4KQZA 1T94A 3TW0A 5FDLB 4LBPA 3IM8A 4P10A 3NG8A 4IFVB 3VGVA 1NCLA 1L5UA 4DCOB 3B4MA 1PJ7A 3W9HA 2JFKA 5EWGA 4HHHA 1YBTA 2J9DA 2RDJA 4Y2KA 1X9MA 4OV6A 2B8QA 1XNRJ 2DEJA 5C2CA 2DXEA 3P5BP 3CCJS 4DV0J 1YJNS 3D1QA 1X4HA 3QGHA 4OLPA 2EBEA 1DQ9A 2B4UA 3S7RA 1VQ9S 4DPYA 4U7CA 1SV5B 3KLHA 4DR3F 4X4TA 2E5HA 4IR9A 2JNJA 4CWBA 1Y4ZB 2PMZD 2BKOA 5GMKa 1S77D 3H7HB 3ISZA 1HNZF 5L9XA 4F0MA 2IMWP 3NGUA 4JI0F 2Y8WA 2BJ7A 4QPXA 2XMJA 2M4MA 1LWCB 1NMEB 1YJ7A 2CQ4A 2YH0A 4Y00A 3GE9A 1X4DA 1XMOJ 1S1WA 1HBNA 3MMAB 1K8AT 3BM7A 2CDRB 1HNVA 4C8NA 4WFXA 3A13A 1NUEA 2O3DA 1HI1A 1NK7A 2D3ZA 4K5SA 3RUBL 1Q7LB 4PR6A 2BMBA 3G6VA 3OFHA 4IOAQ 3MM6B 5HL7Q 2UUWA 3W5ZA 1HNWF 3VAMA 1BQNA 3CCZA 3W60A 2HBYB 4RLEA 2F1FA 1U6ZA 5D8HB 1AUSL 2ACYA 5KG0A 1KS2A 1X5SA 2XWYA 1B4SA 4ECQA 2N3OA 2CPXA 2FY1A 2R7UA 2UUTA 4CO2A 3Q22A 2DITA 1F9FA 4EO6A 5GAEU 1NDCA 2I5JB 1HWIA 3CDUA 2BANA 1N56A 3N9UC 4WPAA 1OYDA 3M2RA 2VU5A 1TAUA 1XBWA 3OLAA 2YKPA 3US5A 3FMBA 4OJ1A 4IQXA 2FJWA 5GADI 4FYDA 4EEYA 3BZQA 4F02A 5C5JA 4ZPAA 2J0SD 3NGTA 3DMJB 4K4VA 5A2QU 4U8VA 1FXLA 1GH8A 1MLAA 3Q2SC 4KHPJ 1C2PA 4IR1A 2VG6B 3RBEA 4O4GB 1N5TA 1H7XA 2DNYA 4FZVA 4LF8J 4GKKF 1ZS6A 2D3O1 2MQQA 2HBQB 2ZEJA 4HH0A 2HLTA 5IT9U 2FVSA 3KJQB 1LWEA 3BEGB 3ZTOA 4F04B 4X4PA 3I96A 2XZWA 2HIYA 4ECVA 2GGPA 4RW6A 5KFZA 3M8RA 1FRIA 4Z37A 4CO5A 4JV0A 2R7TA 2VBWA 4I7FB 4LRDA 2V9WA 4USJC 2R8GA 2XSFA 1T05B 1YJTA 3FZBA 1NDPA 2XEXA 4RW4B 2GVDA 4LR7A 5DZ7A 2VONA 3A8JA 3MFIA 2DIVA 4FBTA 4BHQA 2EI5A 2ZH9A 3JYTB 1CBKA 2X3DA 1Y5IB 4ZP7A 1HBMA 4CDIA 1D0EA 4ERDA 1YLXA 4NRTA 1PAEX 5BYQA 1VBXA 2K3IA 1FKOA 2P9GA 1NM2A 4L73A 2PDAA 3HKWA 3EICA 4H4MA 2BKNA 2AD9A 3OTEA 4WJBA 4LBIA 4J9RA 3DRXA 1TL1A 1L3TA 1DFDA 3ZTRA 3SCIE 1YQHA 4K50A 2RF2A 4WFYA 2G1HA 5HMZA 1BQMB 2UXDJ 5FD1A 2CNKB 3R5DA 3V6KA 2CJKA 4J9SA 4IUFA 4QJVA 1N33J 1RWMB 1SJQA 3IWXA 1NSAA 2Q6BA 4UY85 2IY5B 2XYGB 3AFGA 2RE1A 1FEEA 3BDPA 3UN5A 4ES2A 3M9MB 3R5CA 2ZH6A 4FN5A 2DK2A 4PQAA 5KG4A 4ILLA 1DQ8A 5CABA 1QTMA 1C0TB 4J91A 1SPBP 1R7IA 2BBEA 3HF5A 5LOQA 3W2VB 1ZAXA 1SKUB 5KFEA 1Q8IA 1S9GB 3CD0A 1CQMA 1S1UB 3EYZA 1LEOA 2NUHA 5HQMA 4JUZA 2N7YA 4DF4A 2BR0A 4O0NA 3WX4A 2PO4A 3CCLS 5DM6Q 4JI5F 4AFFA 4YB7A 3FKBA 4N76A 1NSPA 3T3FA 5DLGA 5EX3A 2V8HA 2V4QA 3NMRA 1VRTB 3TQEA 1KQFB 2YQ0A 5DS7A 4LSNB 3A8EA 2R8JA 2CNOB 2ZKUA 3UQSA 2OPPB 4KGKA 4ZA1A 4EMDA 3KG1A 2KTQA 2QL9B 2FUG9 3ZXWA 2WTFA 3RAQA 2VG5A 1V5IB 3GV8B 4B3OA 4P74A 4DPWA 3PM9A 1R3NA 3DYAA 2PA8D 3LP2A 3WIUA 3G87A 3MM5A 3G9CA 1VRUB 2GQQA 3CJ4A 3RRHA 1S7HA 2C2KB 2QYGA 3AD7C 4ICLB 5A8KB 1RKIA 4YS2A 1N6QB 1UPMB 1JLAA 3KJVB 3MMCB 2WOMB 5HI7A 2A18A 2H5JB 1UEUA 2VC0A 4NLSA 5CYQA 3UWTA 3C8YA 3OT9A 1S6OA 3TUIC 5LMUJ 2OSQA 3QT7A 1RAGB 5HLFB 4K4XA 2V8DA 1SI9A 2ZHBA 3CMQA 2DCLA 2C1EB 1PYOB 1KFDA 1Q0NA 2YVSA 2PFFB 2LQBA 2DH8A 3UFCX 2W9CA 1KOOA 4FYWB 3HHDA 4M5KA 4ZJQA 3NOCA 2ILZA 1AW0A 2P9CA 3CCTA 2AWZA 2ADCA 3C6UB 2ZBCA 3VGSA 1X4AA 1FVQA 3E51A 3GFZA 2YWKA 4TNOA 1SKRA 2YNIB 3S6EA 3CDBA 2HFUA 2R8KA 5SZTA 1ZETA 4G1IA 4PXDA 3HI9A 1E6YA 3GSDA 1B0TA 1HNIA 1NNDA 2J8AA 3GYNA 4R5PB 2OFGX 4JOUA 5D78A 2HVEA 1JLFB 2CQ0A 2MKYA 2VD3A 2RAQA 2F8EX 2C3OA 3C16B 2LU2A 1WOOA 2HURA 4KY3A 2ZJRQ 2L9WA 2Q1LA 3O8WA 2IC3A 4CLWA 5F8JA 2BRLA 5BR8F 5KFGA 3N6MA 1EETA 3GFHA 5U47A 2VBXA 2V5HG 5HBMB 1S76D 2BW2A 1NHKL 4EFAC 3TJ8A 3A12A 3R27A 2VFTA 5J2QB 4J9KA 1XNRF 4B9MA 1XEZA 3TARA 2XULA 2OH2A 1RABB 2A1BA 4DV0F 2O1PA 3EM1A 4NA1A 1VQOS 1OY6A 4ZP6A 4LF2A 4TQRA 3BKFA 2Y1IA 4NYZA 3VR1A 2EC0A 2MKKA 3EGVA 5G0RA 4F50A 3FBCA 3AJ2A 5KFHA 2NUUG 3OTBA 4Z7CA 2DRBA 1IR1A 4DR1J 2G2YA 1TKZA 4LT6A 1TV6A 4C48A 3GIRA 4KSEB 1S48A 2R7WA 3QGIA 3W66A 2OPQB 1GEHA 3JQJA 2VJVA 5HSPA 2OEKA 4N77A 3CCMS 2W2QP 2DCUB 1G3OA 1S4EA 3OFEA 4ZP9A 1GAOA 3D66A 3CJ5A 5DQIA 4Q43A 4BC7A 3R7SB 4ZVSB 5E33A 4A46A 1FERA 3A3PB 1OWXA 2G2ZA 5DRKA 3AOAA 4LF7J 1ZA2B 2HQIA 3W2WB 1IWGA 4O3RA 3OPKA 2JEJA 4KT0C 4IFYB 2HZAA 3G96A 2OPRA 3G8TA 4NI2A 2L9NA 5D0HA 3L09A 2FC9A 4JI4F 3HSJA 1R27B 4NLPA 1GX6A 2HVHA 2E5JA 3KHHA 1MG7A 1AA1B 1Q5YA 2E5GA 4K5RA 4KYZA 4DV2J 5JMNA 2ZOFA 4P75A 1UAWA 4DN0A 3THTA 2QSFA 1J5EJ 2KG0A 3R6GB 5G4DA 3MTJA 4Q2MA 4WYWA 3DDNA 3G82A 4H4OA 3QO9B 1ZTWA 3FVYA 2ZNYA 2CQHA 2QA4S 1KDNA 2Z2YB 1U49A 4LF9J 3PCOB 1T8EA 1CS4B 1JJ4A 1Q78A 2AMCB 2HIQA 3K17A 3I0RB 2AJQA 1P27B 3DM2B 4AE5A 3NY0A 1NDKA 3DOMA 4ZVTB 3C14A 2G0CA 1C4AA 1LKZA 3V4IB 3CF5Q 1IQTA 1KP6A 1RACB 3EDRB 4OI3A 1XMQJ 1N54B 2XMKA 2AHOB 1KONA 3DRPA 4HVZA 2KXNB 2RJZA 4JYAF 4DQIA 4USWA 3EVMA 2VPXB 3N6NA 1IBKJ 4I4BA 4LRBA 2WRMA 3NP5A 3PACA 6FDRA 1FNMA 3HHLC 1TKXA 3KYLA 1AFJA 1R31A 3JB9k 2RRAA 2UXCJ 4ANEA 3I4PA 4O44A 2LKZA 3TO8A 1R8BA 3ILIA 4DUTA 1J2VA 1R0AA 1FCAA 4P72A 1IBCB 5C24B 3MXHP 1YBAA 2KDOA 1OPZA 5T41A 2FVCA 2V34A 2YWFA 1RT7B 2Z8QA 5J1NA 4ZS6A 1HPZA 5HN0A 2LA6A 1U1QA 3TRGA 3VAFA 2GNKA 1XN9A 1RU1A 2KYZA 1NJYA 1KLNA 5DLFA 3LF0A 5CCLA 3BO4A 4LMZA 2CPFA 3AD8C 4R0EA 1BUXA 1SH3A 1N32J 2CQIA 4X62J 3GIMA 4X4SA 3LQVA 1RT5B 4X66J 3EWGA 4WU3A 3TUJC 3KMQA 2BM0A 3CMAS 4Q44A 1ZTTA 2CPJA 3H0PA 1U45A 1YJ9S 4KAIA 3IS9B 1SBRA 5C42B 3RG6A 4DL3A 3H8YA 1Y9OA 1Q8LA 1UWBA 1B99A 1QAXA 4QWCA 3CJTA 2UXDF 4ZLLA 3MEGA 4LBHA 1YRTA 2E9ZA 4ZIWA 4QQBA 1RT3B 5KFYA 2B9EA 5IS2A 1IBMJ 2YBVA 2CPDA 4M5GA 4PABA 5KFDA 5D6GA 4DI6A 1WACA 4C8OA 1JJ2R 1W2BR 2AEFA 5T7LA 1FKPA 4OX9J 1RDRA 2GMLA 4ZPBA 4B9NA 1PG5B 1HMVB 1ULRA 3R9LA 1IN0A 3KUHA 3BPDA 4O3PA 2DNRA 4WBFA 3BN7A 3KLEB 3M1VA 1TUGB 2WBRA 2JVRA 5KFPA 3ITHA 5E3PA 3I82A 3LTOA 1T03B 1S1XB 2YPYA 3GU0A 4P2XA 2M3DA 2MQMA 3L95X 3NGRA 3G86A 3MEDA 3K89A 1RHQB 3CCRS 3LH2S 3J7AN 3CC2S 3BREA 4EWTA 3RB4A 4NMLA 3R1HA 1DRZA 4G65A 5KFCA 1REVA 1N0VC 2O66A 3DLJA 4DZ6A 1HBOA 3TI0A 3CJQA 2DO4A 3UCUP 3DOLA 4XDCA 2NREA 4J5OA 1ZYQA 4IH5A 4E8UA 4ZVFA 1E6VA 3SSSA 3MZIA 2ZH8A 2R2UA 1S1VA 2R2SA 2AYGA 1IR0A 4ZLNA 1HBNB 1WOSA 2LLZA 4OHYA 2WHOA 3D5MA 1FRHA 2VFVA 2FHOB 4NOHA 4NEYA 1HNVB 4X4OA 2LVWA 4M1KA 4PXBA 4MH8A 2FLNA 1TR0A 1A0OB 1ZH5A 3TUPA 1CJVA 2GO9A 2GVZA 5ETVA 1EAYC 1S6QA 1WORA 3A3OB 1MWYA 4J9OA 1CJKA 2ZWOA 2UU9J 4C4WA 1KQSR 5LMUF 3H5YA 2D3OR 4CLYA 2ALZA 1UMJA 4LF6J 4OJ3A 4W98A 1JKHB 3QT8A 1TK8A 2CZ9A 3GP9A 4IQMA 4F4XA 2RS2A 2YNHB 3LP0B 1M1KT 4UZBA 2E7XA 3I6PA 2HHHJ 5D3GA 1RT4A 1ZM9A 4J9PA 2ASDA 1IKVB 4USKA 5AJ3J 2BANB 1L3KA 3R5AA 2FVRA 4RW9A 2OUGA 1XMBA 3M2RB 2RD5C 3K2YA 5A8RA 3CT9A 3BH6B 4QR0A 4A47A 2PSZA 2ZUGA 3IXQA 4EUVA 1U2FA 3HM9A 3AT1B 4FXWA 1YBUA 2HEKA 5B0AA 3QWPA 4WIQA 1WC4A 3NGSA 2IA0A 4ZJLA 2PMHA 3TWZA 2BJ1A 3CCQS 2M8HA 1UVIA 3HZGA 1U1MA 3NS5A 2ZUAA 3VAHA 4DU8A 4DPXA 2BDPA 4PWUA 2C2EA 2RRNA 2W7AA 5ETKA 2GIQA 2GGPB 5IQQA 2J6TA 2Q66A 2RUGA 3A8IA 1WKKA 1ZM3A 3OR1A 4OX6A 2RDIA 1SJFA 3JTNA 5GAHI 3PO5A 4HTIA 3QATA 4QW9A 4AUKA 2XY6A 2GVDB 5CA5A 3FMWA 1WKJA 2LFVA 5E5NA 2PN6A 1Q8KA 2ASJA 2EPIA 2M7SA 3MM9A 1HLWA 1XR5A 1MU2B 3W8GA 2MHEA 1SUQA 5H9FJ 1UP1A 1H98A 3LWLA 2Y0SD 2ABYA 1KQKA 2LEAA 3D28A 3KJNB 1TVRB 1BMQB 4P71A 4PEOA 4RW8A 4DV7J 3ZNJ1 1T3OA 2DYAA 4K8RA 2B4PA 4RBVA 1Q4RA 3CCWA 2IHR1 1WI8A 2MSTA 1VK8A 1TL1B 3DI6A 1D8YA 1HKAA 2AKWB 5C7PA 4DV4F 4RBUA 2RF2B 1NAQA 4K4ZA 1UJ4A 2ZBPA 1OPIA 3CIZA 1K9MT 4DR2J 3RBDA 4FF4A 4WP3A 3ONQA 2P8IA 4YB1P 2I8EA 4GRSA 3PFOA 4UT4A 2KRRA 2HLUA 1F9EB 5A0YA 4DG1B 2E7WA 4DV3J 5HJYA 4XPEA 4C0BA 2K1RA 1N48A 3SCJE 1HIYA 4PZVA 1KVJA 1KR4A 2H9ZA 3R5BA 3N4WA 1WTBA 3OD2A 4M5LA 2JC0A 1VMBA 2WBMA 2ZOMA 5D0GA 4H4KA 3KXDA 2B3TB 2POKA 5J2MA 1RAFB 4U6PA 3JQMA 4F3OA 4LF9F 5BYRA 3OTDA 4NLRA 5EDWA 1XR7A 1W2IA 1FK9A 3HT0A 1TK0A 4EU0A 5KFXA 4KKOA 1P6TA 2J0XA 3CD7A 2W2PP 1WTFA 2QLXA 3CNQP 3G8SA 4LF4J 1WDDA 5DDRC 3UCZP 4RWWA 3EPIA 2IM0A 1P8GA 1BHNA 3NNCA 3OL8A 2J0WA 4OX8A 2OKQA 2CWKA 3MEEA 3DLGA 4QWEA 2DISA 2QC3A 3J81j 1GX5A 3M6VA 1UVJA 4CH0S 5FIIA 1UEKA 4USVA 5LMNF 4DN9A 1B7FA 4DPTA 2VG5B 4B3OB 1RTZA 2DHXA 2G0JA 2E5LF 3AD9C 5KFJA 2UV8A 3MM5B 4IRKA 3GJRB 4KHMA 5AT1B 4C9DA 2QA4G 2CG8A 1LW0B 2BYCA 3Q8RB 1JLAB 1T9WA 3L9ZA 3HMJG 1QE1A 4FVMA 5CYQB 2VBYA 3CJ3A 2DNQA 1A6LA 2YQ3A 2CNLB 1SB6A 3MGJA 2X7IA 5KFWA 4EZ6A 4NRUA 1U26A 2H65B 5LSRA 3QBCA 2ZDOA 2BQRA 1N36J 1XQIA 2W9CB 2KI2A 1KBRA 1O8BA 4X66F 2UUAF 2WSEC 4QWDA 2IPOB 4RNNA 3TA2A 2CPIA 2M5YA 5KG7A 2VJUA 5I3QA 3IR5B 5F8IA 5H9EK 1SJ3P 3T5HA 5LM7E 5CZXA 4RNOA 2R7XA 2KFYA 4A8KA 4QU7A 3E3XA 3NEKA 4ZVQB 2UP1A 4DDFA 3NOGA 2C28A 1E6YB 2IDEA 1HNIB 4PXCA 2WONA 1IWAA 5K14A 3GQCA 2AIRB 2QMUB 3O5TB 4WFZA 3L7OA 4O0IA 3D6HB 2VBZA 3PFEA 2AYEA 1IBMF 2KXFA 2BVZA 2N4DA 1B64A 4NZ6A 2BJDA 3D1HA 4G1PA 3HCXA 2IBOA 4X64J 2XM3A 1XR6A 2YKOA 2BOAA 3QGPA 1EQ0A 2VQFJ 4Y34A 2DXFA 3TZWA 3OL7A 2XO6A 1EETB 2ZH1A 1HYSB 5SUHA 2FZKB 4XIUA 5M2UA 1IM6A 4RNMA 3ET6A 4X2BA 3BDEA 2MJUA 4NPOA 3CJSA 3E8OA 1M5HA 1Z4UA 3KK1A 3K8WA 1FRJA 4NEZA 2ZJPQ 5G0RB 5LJ3Y 3J81Y 4Y2CA 4IDKA 3B8HA 1IXKA 4F3QA 4OJGA 3MTKA 1TV6B 1YSJA 1S9FA 1TELA 2HKEA 1D9FA 1XNQF 1HQ2A 2OPSA 5D4NA 4DUYJ 3T5KA 3SXLA 1F9HA 3H2UB 5F8HA 4RZRA 3G8QA 4J7CA 2W8KA 3DOKA 3M32A 3VQTA 3PW2A 2GW8A 1RAEB 1RWVB 3MI7X 3SFGA 1DTQA 3TVZA 1NSQA 1UJ5A 1QSYA 2HG4A 2QGFB 5AE1A 5KFMA 2IIHA 2FC8A 3KK2A 4TXSA 2EBGA 3ZZ0A 1MROA 5DG7A 2OIHA 2YKMB 2XGPA 2VZ9A 1F3VA 5A76A 4F2RA 3IG1B 3V6DA 2APOA 4F4AA 2UU9F 2E1MC 3LOUA 4M94A 5KT7A 4ATNA 4NI2B 4LF6F 3L4BC 1S6PA 2FZGB 2E5IA 2P6TA 3NKYA 4WKYA 2VFUA 1WG1A 2KHCA 2DT9A 2YKNA 1YJVA 2ZM6J 2R7QA 5ETLA 2KHDA 2E7VA 5FLXY 4XTTA 1WSRA 2QX0A 4ELUA 3HVRA 3NCPA 1NHUA 2HHHF 1HQUA 2I2YA 1WEZA 4B3RJ 2FD2A 4YMEA 4WKRA 1U1RA 1NBEB 3G82B 4H4OB 1GMWA 4P7TA 2EFVA 3OXGA 2VQEF 3BH7B 1VR6A 3NCQA 1APSA 4J9UE 1RTIA 1NO8A 4QPTA 3GMGA 2RS8A 2G13A 2ZBQA 5ADZA 3DOMB 3KDOA 1MWZA 3C14B 1VC5A 2CUYA 3MM7A 1S57A 4U67Q 4X65F 2QMXA 4IG0A 3DRPB 1YTYA 4YN3B 4DR6J 2NQPA 5HK4A 5HMYA 2CVEA 1G6BA 2IRUA 3H40A 5E41A 4OZ5A 4IG3A 2XMMA 1OJ4A 2DIUA 4LFAJ 4DSFA 3ILJA 1PYSB 1S1TA 2EWHA 4IO9Q 3NRBA 3EE3A 4UF4A 5I42A 2QLWA 3ISNC 7AT1B 5JVGQ 1FRMA 3T9NA 4ED6A 4O44B 1QVFR 2KFNA 1SIWB 1WHVA 1C1BA 3FSYA 3TAPA 4P2MA 3HDSA 2FJDB 2HK2A 1VC0A 4QYZK 1Y5LB 2W7PA 4FKXA 5KFFA 1R8AA 1R8PA 2DD8S 1HPZB 3I56S 5M2PA 3NL0A 2PA3A 3ADAC 4X84A 4EBDA 5L39A 2FGCA 2IAJA 4USUA 1L3SA 3T6BA 4K0KF 5LSOA 3QLHA 2XY5A 2E1RA 1BGXT 1C0UB 3FRZA 5B0CA 2HFZA 3NMAA 1IBLJ 1SIZA 2NZCA 9ATCB 1M1GA 1WF2A 3DGVA 2KJWA 5BJRA 2ROPA 1FFWB 2Z57B 2LXUA 1FDNA 1TP7A 2SXLA 1U48A 4M95A 4DV7F 2NCKL 3EJMA 3KHGA 2M88A 2NPFA 4BWJA 3KNAA 3C66A 3PW4A 1X60A 1HNXF 2QZ8A 1XWLA 2FVQA 1UWBB 1Y10A 1VDHA 5F41A 3LUYA 3F0NA 2D9PA 5KFKA 4IOCQ 2FPHX 1HD0A 3MEGB 1SL0A 3D2WA 1OSCA 2J9CA 1U6BA 2J9DE 4OYAA 4FDFA 2HMIA 1EIYB 4O3SA 3N79A 4ZPCA 3F44A 2CQ3A 2G9OA 3KTQA 4HACA 2MZTA 2IRYA 3R5GA 4DV3F 3F56A 4DFMA 1HR0J 3RR8A 5HO4A 1VQLS 3WDOA 1K73T 3I31A 3PW7A 2PGCA 4NCGB 4A8WA 1RTDA 1N34J 4WU2A 1VFJA 4I2QB 1V3SA 4DV6J 4C8MA 2KB2A 2RH3A 1RT2A 3C15A 4URGA 4JI2F 2YPZA 1WC0A 2MQ8A 1C1CA 3AQOA 3NWRA 2CG4A 1FI4A 2OEJA 5CYJA 4LF4F 2PE8A 3VGTA 2H1YA 1H6KX 4TLQA 3TYTA 2Y9HA 2YNFA 3MHYA 2GHWA 2VKRA 1HBOB 1W26A 1JIHA 1IVZA 3DOLB 3DLHA 3PJWA 3Q8SB 1RU2A 4ED8A 3MMJA 1FJGF 1M1HA 2KKHA 3WC2A 4ES3A 1AZSA 1WEXA 1FEHA 1E6VB 2AGPA 2AU0A 2HHQA 1S1VB 2EG1A 3FSXA 3CB4A 1UJ6A 1FTRA 4U96A 2VASA 1LQ9A 2DNGA 2HW3A 3PO4A 4ECUA 3TUZC 2VICA 4K7QA 2AV5A 4K2XA 2HYIB 2GVZB 3ULHA 3DLKA 1S6QB 1QAJA 2F4VF 4DCPB 3D0HE 4JI7F 2C2NA 3OR2A 3QZ8A 3BBFA 1B0VA 3L3CA 1WNEA 4TY9A 1LV5A 1T95A 3P45B 4YHHJ 4PQUA 5KOWA 1FFSB 2IJNA 3QFHA 5F3ZA 3M6WA 1KLMA 3AY0A 1I94F 5MLCV 4I68A 2EXUA 4FYVB 4CLZA 1NZ8A 2JOQA 5KFLA 2OMLA 4BLGA 4NLWA 4RUAA 5KT6A 5D3GB 1RT4B 1R89A 2BUNA 3Q8VA 3EXYA 3FJ2A 3F73A 1YVFA 3AA9A 4RW9B 2HSEB 2V94A 1S72S 3BYRA 3CDEA 3HHLD 5DG8A 5A8RB 2MSSA 3SSRA 2DY1A 4ZN1A 2JEFA 4Y65A 5K9FA 3EMTA 5IT4A 2RUSA 2NXCA 3ENAA 2RKIA 4RNFA 8RUCA 2CAJA 4N7TA 1N0UA 2HGMA 2D3UA 2HAIA 2I9SA 5A2QY 2HHSA 4M5JA 1SL1A 1BE4A 3CCUS 3RAMA 4LREA 5H9FK 4YY3F 3I0SA 1NKEA 2HAFA 3CJ2A 2JFDA 1QSSA 3B6BA 2MEWA 4YB5A 2C3UA 4F0HA 4ZHRA 4OZJA 4J9VA 1DLOA 5KG6A 3M8SA 4KGXB 5IT9Y 2C3PA 3C19A 5F0UA 1QUVA 3OR1B 1WG5A 4OYOA 3T1YF 3VAIA 4I69A 1BY9A 2FY8A 2V4RA 1QSLA 1R43A 1TAQA 3AHPA 4HEA9 2BABA 3ZO7A 3VALA 2DXDA 2VODA 2PMWA 4U95A 4RX6A 4DL0C 3KK3A 3HVTA 2BQUA 3D6MB 1RTHA 5HP1B 5KFVA 3PHTA 5KG5A 2HNYA 3MM9B 3G2XA 2EK6A 2M9KA 4PUOA 1SUQB 2ERRA 4ED3A 3DHXA 4MK8A 3PG9A 3CULA 2K7KA 5IM0A 5FLXU 1SC3B 2MMYA 2QV6A 3RYLA 3O1LA 3PRVA 4LF5F 1LOUA 3OSPA 3BBCA 3R6LB 1ZAWA 3KJFB 1U25A 1OS5A 2UZAA 1RLDA 4CRJA 4DS4A 1SC6A 4AXJA 1CULA 1X7VA 1PBAA 4BC9A 2CQBA 1UFKA 2DGXA 3DI6B 1R6YA 2JEGA 3HVAA 5HVHA 2NXJA 4U8YA 3D4JA 2XMAA 3UVJA 3GG0A 1U0HA 2ZBIA 3HT3A 1GT8A 4OI6A 1IJFB 4DLGA 5B0DA 1NKCA 2XI2A 3J7YU 2QN6B 2XB2D 2XMVA 4DV1J 4TYAA 3DRRB 1RAIB 2C42A 3KNGA 4FBUA 1RYSA 2K1RB 3PRBA 1D1UA 4P52A 3SFUA 1DJ0A 1XJWB 3OL9A 1PJ5A 1DBDA 4B3RF 1UVMA 3MCOA 3LALA 2N82B 1PC4A 5AE3A 3LANA 3J7A1 5J2MB 3H5UA 2RHQB 2QT7A 2Z56B 4CNYA 1TL7B 1IKXA 5CXTA 3BSAA 3AB4B 5A8WA 3QFWA 3T1AA 1XTZA 2VH7A 2A3JA 3CO9A 3JXOA 5E7OB 3SDEA 3P3DA 1RI7A 3BPSP 3I5AA 2KRBA 2HQDA 1NXIA 2LQ9A 3CPWR 3CC7S 2N4CA 1FXDA 1RTJA 2YKQA 4IH6A 4TVAB 1YIJS 2LA4A 3DLGB 3TQ1A 5CQGA 2B7CB 2B9YA 2BRKA 4ZP8A 3HX9A 2CJAA 3D6FB 2M8DB 4WFBQ 4WXWA 4DSIA 3FCWA 3H2VE 1VS3A 1R6VA 4CLFA 4WP9A 1LFPA 2L3MA 2MKSA 4EBCA 1TKTA 5JJBA 1GTHA 1RB0A 2A2DA 2FHJD 3HZEA 3PHEA 3QQCD 4V19X 4C0OC 2B7BB 4GVBA 2WB1D 3W7BA 4GKJJ 2NYHA 1H7WA 4L74A 1X0PA 4ENOA 1QVGR 2P2CB 4PXEA 3HD2A 2IMOA 3BB5A 1RQ0A 1HI0P 5ITHA 4DJBA 2R3VA 3H20A 4FXVA 4DL6A 1U4BA 4N8OA 1RHUB 2QA2A 3CWJA 2Z2ZA 1MMDA 2QEXS 3RAXA 2IJRA 4TU8A 3OTCA 2VDHA 1NHVA 1GQEA 3DXBA 4HDGA 3DLBA 2YX7A 4QIGA 3SEOA 1RBOB 2GQCA 2Z2MA 4DX5A 4DV5J 2RQMA 1IKWA 3TX8A 4NA3A 4ELVA 5GAGU 1WWHA 4KC5A 2MLXA 4ZDNA 5HMXA 2NPIA 2WVEA 5I4MA 1RXOB 3BV8A 4OYMA 2CPEA 2W24A 2QA1A 3GFXA 2V8PA 1N88A 2BE7D 3R97A 2KT5A 3R3TA 2WONB 2IYGA 3K5PA 5K14B 2CQGA 4B02A 1SKWA 2W4PA 4JI8F 3UDCA 5HVFA 1OMSA 2GJ2A 2CQ1A 2A0FB 5ETMA 2R7SA 4NASA 4XK8C 2UVRA 4O23A 4FS1A 3H2LA 1DURA 4LVOP 2HS4A 1EX8A 2ZWPA 3FBBA 4ECYA 2PD1A 3TA1A 5DGBA 3RRGA 1HD1A 2ATLA 3GJTB 4CM2A 1HR0F 4HT7A 5IWAJ 4A8OA 3FNNA 4DQSA 4DF8A 4DSJA 2MLZA 2J6UA 3HULA 5HROA 3EPGA 4NXMF 3AOCA 5D77A 3ET6B 2N3LA 2XZTB 2CQDA 1VQYA 1YX2A 4MT1A 3CXCR 2XI3A 2BQ3A 2Z30B 2J6SA 6FD1A 4DBQA 1PIEA 4DQPA 3MPWA 4DR5J 3BSNA 3MM6A 1VIOA 3T6JA 3VF0B 1VQ8S 2OPSB 4NYPA 1HQEA 4DFPA 5LT5A 4LSZB 1WEYA 1RUSA 3DOKB 2V8VA 3Q8UA 4QW8A 2MQOA 3HSGA 2DH9A 1DTQB 1RT1B 2NZ4A 3ILLA 4PPDA 4FF3A 3KK2B 1S7IA 3ZTPA 4TU7A 2NSBA 2ZD1A 1MROB 4KFBB 2CYYA 4TY8A 4JP8A 1FNOA 1Q95G 2GFFA 3OQ2A 4LSLB 3T1HJ 4QIVA 3HJFA 3U1LA 5IXUA 3OV7A 4YHHF 4KV8A 1VQ5S 3Q24A 1U2RA 3DMJA 4URQU 2YKNB 4CNZA 2CJ9A 1ZM2A 5HMWA 2VG6A 2VHGA 1KD1T 4HI2A 1WC1A 1FD2A 1OQ6A 3ZZZA 2VB6A 5CYMB 4NLTA 5T14A 3BGRB 2C22A 1HQUB 2EFQA 2CKWA 2DGSA 3SCKE 1A9NB 2F3JA 2XHWA 1QTNB 4DX7A 5IZHA 2EVZA 3GIJA 4FKYA 2J76E 4URSA 5KFQA 3MUTP 2HBZB 1ROFA 4B3TF 3WC0A 4F4WA 3UI3A 1VHIA 4RBTA 1RWKB 3THVA 1PO6A 3IBFB 4CO1A 4I7FA 5KAKA 4IG0B 5D4LA 1JJCB 2DNMA 3SZ2A 2ZH3A 3SQGB 4NXNJ 3LP1A 4HLBA 3POTA 4CT8A 2LDIA 4B3MJ 4FF1A 5JUMA 2C2RA 3P5TL 2DHAA 1FHTA 1S1TB 1P1LA 1QY7A 3JYTA 4J90A 1LXNA 2HNDA 3L7UA 4ID8A 1Q79A 4QCLA 3AJDA 1GXLA 1C1BB 2C2MB 1ZA1B 4EYHB 4OZ2A 1NH7A 1NK8A 4BBYA 2IM2A 3CJ0A 2HQ3A 1JMTA 3CMES 3SBMA 1H38A 3DRYA 1T9VA 5AXMA 2ATCB 4ED4A 1X31C 5KOXA 2H4WB 5F8MA 2DKOB 3IRXB 5CHCB 4ETZA 2YWGA 4C97A 2M52A 1JLCA 1RHMB 3FEYB 3QLHB 4ZCKA 2DHGA 1YKWA 4FF2A 3RB0A 3PKYA 3JAMU 5B0GA 5IFMA 2W25A 3M8ZA 2OJ3A 3I9V9 3Q23A 2JC1A 3KWMA 4UOFA 1HARA 1O0PA 5ETSA 2F9DA 2H51B 3T5LA 1JXLA 3GSIA 2Q6CA 3TJ9A 3IRWP 3W9JA 1F2GA 3DLEA 4ZPTR 5MAOA 4OZ1A 4QR1A 4AXIA 1S49A 3GV7B 1F5CA 1S99A 1QDUB 3B4DA 4DCJB 4Y0FA 2DO0A 4LFBJ 1S97A 2KU7A 3LW5C 4CLUA 2KL8A 3RTVA 3DXSX 5KFIA 1Z2LA 4XDDA 3KLIB 1QD1A 2AX1A 3V4MA 3OXFA 2B4VA 4L3NA 3IM9A 1RA6A 1UTAA 2HMIB 2F7VA 3MCNA 1SQFA 3N5BA 3X3UA 3D0GE 4AQYF 1QUPA 3J7ZT 3Q8QB 4DV1F 4DL5A 2CFXA 1VISA 2OI2A 2IVFB 4DR3J 1V6HA 2BA9A 4ZVEA 5KT5A 2Z4PA 2BJ3A 3SYZA 1RYRA 1VRTA 3O44A 4KBIA 4LSNA 4F0KA 1RTDB 3R7NB 2ZVIA 3RJMB 4JI0J 3LWMA 4F4KA 2R7OA 2OPPA 3PKMA 1K1SA 1NLKL 2PEHA 1RT2B 3C15B 4IRDA 3IR7B 4O3NA 4HI1A 4CLTA 3LPEA 2R8IA 3D1OA 1WF0A 3PZPA 1C1CB 1RBAA 3CDAA 3MFHA 1YRXA 5L1LA 1VYAA 3OJUA 1XIQA 5J2NA 4ECXA 2Y1JA 2YNFB 3P4UB 2R7VA 4U7UD 2OEMA 4ANDA 2UUCF 3LPYA 4B17A 2WOMA 4F7VA 2RDDA 1HNWJ 1JLBA 3GV5B 2JRSA 2MZRA 3R2DJ 2MXYA 1NSKL 5KT3A 1AZSB 3CD5A 3MOJB 3BKUA 4CH1A 2J5AA 3VAKA 3V81A 1X4CA 1D9DA 1FWLA 3H5SA 2YXLA 4TKTA 2A6OA 1R0CB 4OYZA 2DR5A 3VCDA 2RILA 3QGGA 2VA2A 4OZNA 3U1NA 1KEKA 2QE5A 3HO1A 3DLKB 3OHAA 4C8ZA 3OR2B 5H1SV 2KN4A 2B8PA 2AJFE 3GIIA 1I6JA 3DDKA 4PQUB 4MAKA 3P49B 1M5PC 1KLMB 2MTLA 2V68A 2IRXA 1RK8A 5EWFA 1FRXA 2FJEB 2CA9A 3Q89A 1K44A 3S01A 4R5PA 3H25A 4GKKJ 5GMDA 3VAGA 4YR2A 2GQ2A 4K4UA 2UUBF 2KJVA 3C16A 5IQ6A 4CIOA 1I3OB 5DETA 2YH1A 4P73A 5M2RA 3GPAA 3K5NA 2ZOGA 3ISND 4A8QA 5E3QA 2XLJA 3QAEA 1U47A 2CDQA 1TL3B 4OJHA 4C6AA 1N5YA 2EKYA 2RKIB 4Q5VA 5H9EJ 4R0JA 2OP5A 2FLOA 5J2QA 2AJ2A 5KT4A 1IR2A 3WX8A 1KTVA 3PDNA 1WDTA 4H54A 3EZOA 1OSDA 2DGVA 3ENVA 2K8GA 4B9LA 5L1IA 1VJQA 1JLGA 2DEIA 4DXLA 4ZHRB 2CPZA 1DLOB 4ED7A 1UKUA 4Y2AA 1I1GA 1Q16B 3LAMA 1M5VC 4F4YA 1EKSA 1RJJA 3A8KA 1F5AA 2YY3A 1TZ0A 2DVIA 2DGWA 4ALZA 1U02A 3BN4A 1XMOF 1AYEA 2QG9B 2FTRA 2HWIA 2BJ8A 2GAGC 3KK3B 3HVTB 1RTHB 4MKVA 4B9TA 2EC2A 2FLLA 1DHMA 2HNYB 3THPA 4PUOB 4EYIB 1NJXA 4DR5F 1I5OB 2FJBB 1WC3A 4IOBA 3EUNA 5IM0B 1M5KC 2XMWA 3CJKA 4IFYA 2DR6A 2V4JA 4KO0A 4YOEA 1Y00A 1N5SA 4DOZA 3JSBA 4I64A 1CULB 3VHQA 3GILA 5I3UB 2W4CA 3DNCA 3K57A 2XS2A 3OL6A 1QAIA 2AT1B 4QIWD 3NLCA 2BXJA 4RW7A 4Q7AA 2LEPA 3AXKA 3UVJB 4QZVB 2WVFA 2ZH5A 4DZDA 1Q1KA 3I5BA 3MPUB 4KHPF 4JI5J 4KPCA 4WE1A 1F3FA 3QT5A 1REGX 7FDRA 1KWMA 2BACA 2FQQB 1S6UA 1O5JA 3NGDA 3GIKA 4J9MA 3M2UB 4LF8F 1UPPA 3KLGA 3O2IA 4JI6J 1MMNA 1OY9A 1Y7PA 2AP6A 2RNEA 2OD4A 2LXIA 4DPOA 4K4WA 2HFNA 1CJUB 1IKXB 2E1CA 2A6MA 5A8WB 3HP6A 2MYFA 3AOBA 2W2MP 3K5MA 2NYIA 2OTJS 3TX0A 5LL6d 4C8KA 2B9WA 3HK2A 3SDEB 2MZSA 3TNVA 1HHTP 2VFRA 2XQCA 3NNHA 4DFJA 2IVYA 1T7PA 3UO0A 1RTJB 2WVBA 4ZLPA 2KYXA 4C7QA 1YZ7A 3ZZRA 3NNAA 4NXNF 4UY8T 4HL9A 2W2OP 4QR2A 4A4JA 5DDOC 3VGUA 2HRUA 3GR0A 1GXUA 3IBCB 1TL5A 1X5PA 4WK3A 4OHVA 5IOLA 4UQTA 3QJJA 1LW2A 1RWOB 1U1NA 1FE4A 4FPRA 2ZZTA 3N5FA 2ZE2A 2MQLA 3PTWA 2LQ5A 3GJQB 1TKTB 1DZ5A 1WKLA 1LWXA 1O51A 4DSKA 1KOHA 2WSFC 2JHEA 1RT5A 2H3EB 2F65A 3Q8YA 2VC1A 1J5OB 1T0TV 3BO2A 1JLEA 4DR4J 3O3LA 2KM8B 2KZMA 1SC4B 4EGLA 4C3LA 2DNPA 1UZHA 2IA6A 2KFZA 4QYZJ 5C42A 3UDEA 1I51B 5E3CA 5D0RA 3G6ES 2HNZB 1N33F 3QMQA 2DRDA 3T19A 2Z58B 1UEVA 2JJ4D 3HSZA 5KT2A 3EX7B 2X1GA 2EG2A 3E01B 4NCBA 2CJBA 4NL5A 4JBCA 3MR6A 3TZXA 2C3MA 2AEJA 3DU6A 4K2JA 3N0VA 2GAHC 2Y3YA 1TQLA 4CLKA 1HMVA 1VI7A 4RR5A 3FZ2A 3J80U 1ZM4A 2MQNA 4LFBF 3W5XA 5BR8J 2W1BA 3V2UC 1R8HA 3KLEA 4DX6A 5L46A 2ASLA 1HHQA 2NXUA 2DBBA 3M4XA 4MK9A 2VF3A 1G2EA 1T03A 3HFZB 1S1XA 2RQCA 2IYIA 3K5OA 2CZVC 4WZQA 4AYBD 2E1AA 4J9LA 3FDSA 3MEKA 2BX6A 2QL5B 1MSWD 3KLHB 3PX4A 4B9UA 4P6QA 5C2GA 1KQGB 4ZITA 3MOZA 3HSDA 3MM8A 2JZ5A 4BWMA 2K06A 5HROB 1JB0C 2V2KA 2D74B 1JNZB 1S1WB 4WXOA 3ETMA 4RNHA 4KJIA 1TMJA 4O4RA 4X4NA 4MTPA 2BM1A 4UUXA 1V3ZA 2CQPA 2DGQA 1PAUB 1GTEA 1NU4A 2KT3A 2AJ4A 3TAMA 3UDVA 4BDPA 2DNKA 1BQNB 2BJ9A 3JTPA 1CPZA 2NS1B 4ITSA 2Q79A 4UOCA 2GCFA 3ICLA 1HQEB 1D9AA 2CNNB 3AH6A 2XLIA 1YWXA 2OLWA 2XNQA 2ZJQQ 3A3NB 1JKHA 1RHKB 3M9NB 1CG2A 4JI4J 2WSCC 3RBXA 5ETRA 4C98A 5K20B 2PEBA 3D3CJ 2YNHA 3LP0A 2YWHA 5C25A 3P96A 3FEZA 1RA7A 3H42A 1F2HA 4FYXB 2PIIA 3FBEA 4LR9A 2ZD1B 3GR1A 4NX9A 1IKVA 4TY8B 5KG3A 3JSMA 5IT0A 1ZPVA 1B7YB 2B56A 1CEZA 3I55S 4KV8B 5L8RC 2DNNA 2GO8A 2YNGA 3ZTQA 3RU0A 2MY8A 1VBYA 2BZ2A 3MPVA 3M2VA 2GV1A 1Y5NB 4H4KC 2F63A 2W4DA 1SVDA 3PVXA 4LQ3A 1FX4A 2MJNA 2UVUA 1MW7A 3GG1A 1H2VZ 3FCHA 3PJXA 1LK5A 2RQKA 4JYAJ 3PEHA 4W90B 3ZZYA 5IC6B 2IDLA 1LWEB 1BWVA 1UA1A 4DSLA 1DTTA 3UDLA 3R8YA 3RW7A 3KOAA 1Z1ZA 4RW6B 3PR5B 4FYYB 4DX8H 4BS2A 5HQ8A 4ILRA 2R7RA 2QJ3A 3PNIA 1NPRA 4MKBA 2DR8A 4P2SA 1RZMA 2XTJP 1U09A 4P9SA 4G3IA 1FT8A 2CIMA 3LP1B 2XWXA 1UZDA 3POTB 3EVWA 4ED2A 1JX4A 2MLYA 2MKIA 3MR5A 5F9NA 2HNDB 2HRTA 4DR1F 1CSJA 1HBMB 5J1EA 1MU2A 4DUZJ 2AZ1A 3CCES 3T5JA 3MD3A 4ETXA 2DPJA 4A48A 1IKYA 1FKOB 1S0OA 2KG1A 4OQJA 4H4MB 3FGVA 1TVRA 3PW0A 5LSLA 2XMUA 2O01C 3JSRA 3OW2R 3QJLA 1CJTA 2IBKA 4CO3A 1JLCB 3C46A 3CO0P 2M0GB 3F41A 4JV1A 2GHPA 1T02A 1FVSA 2LDYA 2QFIA 2RU9A 4ED0A 3IWNC 5AXLA 4MKYA 1M0SA 4WK1A 1F0XA 4LFCJ 2LQ8A 4LF7F 3UD5A 2DPIA 5E2QA 2IJFA 2VA3A 1HW9A 4CZCA 3DU5A 2ZH7A 3M6XA 2QO3A 3GCXP 4NLYA 2RHSB 4C11A 3DLEB 4DG1A 2I1RA 3TR5A 4DV2F 3QYYA 2MKJA 2Q43A 2W2NP 1J5EF 1LK7A 2ZVSA 3CDWA 2ZZNA 3E2EA 1RLCL 2GC8A 2NSCA 1TL4A 2GIRA 3NBPA 1K0TA 3I5CA 2R8HA 2HFVA 1WUUA 3GB0A 1N52B 5KFTA 2F9JA 1W25A 4YQWA 2DNOA 2U1AA 4QIFA 2PI5A 1EQMA 2ZC4A 3IA0A 1XMQF 1S79A 2G1DA 1JXEA 3MR2A 4L6V3 2GHVC 3PYEA 4TYBA 4RUBA 4WFNQ 2L41A 2QMWA 4JI6F 1IBKF 5IV4A 4I2PA 5CD4H 1B70B 2RVJA 4ED5A 4L3KA 2QRRA 4WTYA 1H74A 3DYAB 1PKUA 1BLUA 2HS3A 3LP2B 2UXCF 3ZZUA 4YR3A 1OYEA 3PYDA 5HAOA 2AGQA 2WW8A 3ZZOA 2MGZA 3BGOP 3VQSA 4LRAA 2CRLA 3H59A 4NLGA 3NXZA 3IWLA 2AJ0A 2N7CA 3G4SS 3ENWA 1LW0A 3CD6S 3NCRA 5J2NB 2PC6A 5F8NA 1HWLA 4ZVGA 4Z7YA 2W9BA 1RHJB 3MDFA 2H5IB 5F0WA 1U6FA 1JLBB 4RO0A 1AUDA 1T9UA 2H5EA 4NLUA 4CYUA 3U1MA 1HI8A 5L1JA 4I67A 4E0DA 5GADU 3V81B 1N32F 1RP5A 1NB7A 2J7WA 3U27A 3SV3A 3M8PA 4X62F 1GXTA 2E9RX 1X8DA 1H2UX 3N28A 1URRA 1YHQS 3PR4A 1FWPA 5F8GA 1OO0B 3EGNA 3DGPA 3TZYA 3QRPA 2VDIA 5KFUA 3UW1A 2ZBRA 1O6XA 2CPYA 4DR4F 1FF2A 1PILA 2AYBA 2Z2LA 4PG8A 2CZ4A 1YRUA 5LJ5Y 2DY9A 4DS5A 1VHFA 2BOPA 1FJEB 4L75A 2ADBA 2JX2A 4XAKA 5B0EA 2J7KA 4IYQA 1PBUA 3PX6A 1MWQA 5K8OA 4HTJA 1RT6A 4M5HA 2DGUA 8AT1B 2VPYB 1NZAA 3EXCX 4G1QA 2AZ3A 1HBUA 4F2SA 4HR2A 4OX9F 3EDQB 5F8LA 4RPFA 4MFBA 1AXQA 1FRKA 2Y1RI 3R5JB 4EBEA 2ZKTA 2D41A 2IC3B 2DGOA 3MWBA 3IGNA 3HFKA 3QNWB 4ZCIA 5JXSA 1N5YB 8ATCB 3MPDA 3Q8PB 5HJXA 1ZPWX 1HYSA 1DAXA 3GYGA 2FJAB 1QM9A 4FNHA 4KH1B 3KMSA 4DQQA 4USIA 3VV2B 3CSKA 5LXYA 2OO4A 3SSQA 1L3UA 1VQPS 3EGZA 1JLGB 4ZVOB 4ID5A 3OFGA 3MURP 2R42A 3CUNA 1NKBA 5KFSA 1TKZB 4PPZA 3IC1A 2EFGA 1NRKA 1Q86T 5IC4B 2XYPB 5KG2A 5F9LA 4A8SA 1FJ7A 2DR9A 3FBFA 3LGMA 2XSJA 5KG1A 2ZZMA 2RIJA 2GMHA 1X0FA 4MYTA 3BR8A 2V8GA 4F36A 1Y3KA 4DL2A 4WTOB 1P1TA 4K4YA 3RB3A 4DV4J 4CLPA 4MK7A 2UV8G 2XLKA 4RL1A 3ZZPA 2V63A 2YKMA 1NPPA 3UD3P 1X9SA 2JVOA 1S5ZA 3IG1A 4BCAA 2OPRB 4V19J 1M5OC 1MMLA 1H3DA 1FWKA 2HVDA 2LU1A 3CGIA 3CJKB 4OZ0A 2V4JB 4KO0B 1N4LA 2XZDB 1ZBTA 1WG4A 2HBRB 1N5VA 2P5VA 4NLXA 3OVBA 2HQCA 3MAHA 1AT1B 1WHWA 5AJ3F 1RSCA 4B3SJ 3I4HX 4RW7B 4C3MA 5CZVA 2FJVA 5ETQA 3D67A 3BGLA 2VG7A 1S0MA 2GZOA 2H54B 3BQ2A 1V3RA 3SCLE 4ZIVA 3M6UA 3M30A 1EKRA 4WE1B 1KKHA 1V9OA 4G6VB 4EI2A 4PCQA 4NYOA 4E98A 4LIWA 2YTCA 3FC9A 4IH7A 3G6YA 2C3YA 3KLGB 5L1KA 1S9EA 2DR7A 5KFAA 2LCWA 2H4YB 4XO0A 1SCJB 3QAUA 1RAHB 3PY8A 4YUDA 4LIRA 4I6AA 2AGOA 1TKXB 5LMNJ 3AA8A 4CLSA 3K5LA 2KVIA 4ZKAA 2B5JA 4V1Ak 2E5LJ 1R0AB 2QLFB 4EK2A 1YZ6A 4KR0B 1HHSA 4DMZA 2YWWA 1D3WA 3LGHA 1KTQA 1A7GE 3FFIA 2Z0GA 4QWAA 1NJZA 2MDAA 2O5DA 3R2CJ 4U7UK 2HS0A 5A6PA 4NLVA 1SJ1A 3C3LA 4RKUC 2EFOA 3KLFA 1PJ6A 1C0UA 2C2DA 1LW2B 1Q8BA 2WW4A 3B54A 2ZE2B 1KSPA 3BJYA 1H2TZ 2DH7A 4DUZF 4F8RA 2OHDA 4UZCA 1GK8A 1ZOTA 1JLQA 1RWWB 2HHUA 2UUAJ 4KPYA 4ECSA 3IGVA 4GC7A 3NS6A 2JL9A 2A2CA 3UN3A 4PYDA 2VV5A 3UN2A 1JLEB 5AXNA 2XC9A 1ZZNA 5DG9A 3W9IA 4S0MA 3DKDA 4LVNP 3W62A 3RRKA 2LEBA 4NZ7A 1EARA 1CLFA 4X4RA 4RU2A 1UW4A 2B9XA 1JK9B 5AE2A 4DR2F 4LFCF 1H72C 3VZHA 1MN9A 4Q0BA 1NJWA 3D6TB 1ZZFA 2G2OA 3MD1A 5T7LB 2ZC3A 2JEIA 1FKPB 1PYTA 4N41A 1NJIT 3FSIA 1R8CA 1KVIA 1NK4A 1FNXH 2WB4A 4Q45A 4CTAA 5A6WA 3QIDA 3IN5A 1PSDA 2HFSA 2IM1A 3M1VB 1HL6A 3MAAA 2HVIA 2RT3A 3ITHB 4NCGA 1EP4A 5ETNA 4ZPDA 3TANA 3J7YI 1WF1A 5B0FA 1X4EA 4I2QA 3MMBA 3H4DA 4OFZA 1JWWA 3MEDB 2KH9A 4Z2XA 4OX7A 3BSCA 1U24A 3AQPA 4ZPVR 3KHRA 3BS9A 4M8LA 4O3OA 1FESA 3GWCA 2VOPA 1CVJA 3UPFA 1P9QC 1REVB 3HHLA 2PFDA 2Y8YA 2HPUA 2MHNA 2AW0A 4R25A 1TU0B 2DHHA 4CCHA 3TAQA 3KHLA 1KC8T 4ZVRB 4HDHA 2KT2A 4OI4A 2QTWA 3MM8B 1XNQJ 3C6TA 2WK4A 1FE0A 3BKTA 4Q8FA 1HWUA 2R9LA 1RWXB 1H73A 1RWNB 3ZTSA 2WVCA 3DN9A 4AT1B 3M9OB 3M8YA 4U9RA 1RAJA 1BQXA 1YGYA 4UQGA 1UCNA 3NAHA 4ZVHA 4LRFA 1MNEA 1F6TA 3PIPQ 2R4FA 1M90T 5KFOA 3M8QA 4Q2LA 4OI1A 5L38A 1CJVB 2V50A 1CJKB 2FLPA 2RQ4A 3TAMB 3CW2C 2NLWA 4GVLA 3GYXB 3TVKA 1G7CB 1T9XA 5J2PA 2LYVA 1UVKA 1EB0A 1RWPB 2FHMA 3CVKA 5EHHA 1V5VA 4DHVA 1G4CA 3CC4S 2V6AA 2CJYB 1EJ7L 4AD6A 3SMZA 1N36F 5C25B 2CQ2A 5KTQA 3GJSB 2IFXA 2YQ1A 4NWBA 1SH0A 3PRDA 3OXLA 2HVZA 1GFWB 1WD6A 3JSMB 2G0IA 1UFLA 1Q81T 2DRAA 1AB8A 5D15A 1N5QA 3V5RA 2VQEJ 1NK9A 4GO7X 3CIMA 4PWDA 2YNGB 1NB2A 3SV4A 4WWSA 3DCAA 3ETOA 4W4MA 2B6AA 4LF1A 2XY7A 3M2VB 3HFVA 3MUVP 3UR0A 2W9AA 3GCWP 1ITPA 5BXIA 2WZ1A 5GAGI 4X65J 4MMOA 3RR7A 3W8PA 1XC9A 4Q8EA 1TFWA 2ZITA 1IQZA 1FDBA 3TEHB 1YI2S 4NCAA 4D3HA 4X64F 3HJVA 1VJWA 2HQGA 1DTTB 4F67A 4MYUA 3HHEA 4PKDB 3A1YG 2VQFF 4OYBA 4D3GA 1AROP 4LRCA 2V69A 2MZJA 2I6WA 5ETTA 2E29A
chains in the Genus database with same CATH topology
4FP9A 4GKKF 3KK3B 3HVTB 4K4TA 1U1PA 5KT7A 4ATNA 3HPOA 1RTHB 4B9TA 4LF6F 4OHZA 2MQQA 4RUHA 4HH0A 1XERA 2HLTA 1VK3A 1FJCA 1S6PA 2FLLA 2FVSA 1DHMA 1LWEA 2E5IA 2HNYB 2P6TA 3NKYA 4WKYA 3OVAA 2VFUA 3THPA 1WG1A 2KHCA 2DT9A 2YKNA 4PUOB 3BEGB 4EYIB 1YJVA 2R7QA 2KHDA 1NJXA 4DR5F 2FJBB 5FLXY 1X4FA 4X4PA 3I96A 2XZWA 1GNKA 4NA2A 4ECVA 4ELUA 4IOBA 3HVRA 3X1LB 2GGPA 4RW6A 3NCPA 1NHUA 2VPZB 1FRIA 5KFZA 3M8RA 3EUNA 2HHHF 1HQUA 5IM0B 2I2YA 1M5KC 1WEZA 1TK5A 2XMWA 4Z37A 3CJKA 4CO5A 4IFYA 5BR8F 5F3TA 2FD2A 4YMEA 4GO5X 4WKRA 2V4JA 4KO0A 4JV0A 5B08A 4YOEA 1U1RA 1Y00A 5HP1A 1N5SA 2R7TA 2VBWA 4I7FB 4H4OB 1CC7A 4P7TA 1BC6A 2V9WA 2EFVA 4USJC 2R8GA 2XSFA 3OXGA 4OMFG 1FRLA 2VQEF 4DOZA 3JSBA 4I64A 3OLBA 3NCQA 1T05B 5J1EB 4YEAA 3GILA 1TKDA 1APSA 1H0HB 2GMJA 5DO2A 2W4CA 5I3UB 3DNCA 1YJTA 3FZBA 4WFAQ 3K57A 2XEXA 3K7RA 1RTIA 3OL6A 2XS2A 1QAIA 4RW4B 3DLLQ 2J7UA 2CVIA 1NO8A 4QPTA 3GMGA 2VONA 3MFIA 2RS8A 1UVLA 2DIVA 2G13A 5DGAA 4IRCA 4BHQA 5ADZA 2XCPA 4DUYF 4FBTA 4DEZA 2KM8C 1IKYB 1MWZA 3FEXB 4QIWD 2EI5A 3MAQA 2ZH9A 1VC5A 3NLCA 2BXJA 3JYTB 3TA0A 1Y3JA 4RW8B 3MM7A 4RW7A 4Q7AA 1NK5A 4U67Q 2LEPA 2VPWB 4QZVB 4X65F 1WI6A 2QMXA 4IG0A 3DHWC 3DRPB 1YTYA 2J0QD 1Y5IB 4ZP7A 1HBMA 5E0OA 2ZH5A 1D0EA 4ERDA 3NGKA 2NQPA 1Q1KA 5HMYA 2CVEA 1LWFA 1FDAA 2FHKA 1G6BA 4NRTA 2IRUA 1VQNS 3I5BA 3H40A 5E41A 4OZ5A 5BYQA 4IG3A 5DJBA 2XMMA 1VBXA 4KHPF 2DIUA 4DWIA 2K3IA 2J9EA 4DSFA 4WE1A 1FKOA 2P9GA 1NEEA 4C3KA 1S1TA 2EWHA 2F8HA 7FDRA 2BACA 3NRBA 3I9ZA 2PDAA 3HKWA 4IO9Q 4ED1A 5I42A 2QLWA 4H4MA 1S6UA 3ISNC 2FHJA 1O5JA 3NGDA 4B08A 5JVGQ 3GIKA 1FRMA 4J9MA 3M2UB 3T9NA 3OVSA 4ED6A 4LF8F 4O44B 2AD9A 1QVFR 2KFNA 3OTEA 1SIWB 1WHVA 4WJBA 1KHVA 1C1BA 3FSYA 4J9RA 3DRXA 3JAMY 3O2IA 3KLGA 1TL1A 3TAPA 1MMNA 1L3TA 3HDSA 2FJDB 1Y7PA 1DFDA 3FQKA 2AP6A 3SCIE 1YQHA 5A0YB 1VC0A 4K50A 2RNEA 4C11B 2R2TA 2OD4A 2VFSA 4MIBA 1UETA 2RF2A 4WFYA 1Y5LB 5HMZA 2LXIA 3DRRA 4DPOA 2W7PA 4OHXA 2CPHA 5KFFA 1BQMB 1R8AA 2ZM6F 4K4WA 2HFNA 1R8PA 1IKXB 2E1CA 5FD1A 2DD8S 1HPZB 3R5DA 4NLQA 5M2PA 3I56S 4F4ZA 3V6KA 1VQ7S 5A8WB 2PA3A 5AXKA 3HP6A 4J9SA 2CJKA 3NL0A 4IUFA 4X84A 4EBDA 2MYFA 5L39A 4QJVA 4N8NA 2XMTA 1SJQA 4ECRA 4YB6A 2FGCA 3IWXA 4WYLA 4OLOA 2IAJA 3K5MA 2NYIA 1L3SA 3T6BA 2HGLA 4K0KF 5LSOA 2Q6BA 2OTJS 4UY85 3OFFA 3QLHA 2XY5A 2E1RA 4B3SF 1ELOA 2ROEA 1BGXT 1C0UB 2B9WA 5LL6d 4C8KA 2RE1A 1X9WA 3HK2A 1FEEA 3SDEB 3FRZA 1UL3A 2MZSA 3TNVA 5K8MA 1HHTP 2VFRA 5B0CA 3BDPA 2HFZA 3NMAA 3NNHA 4DFJA 2IVYA 4ES2A 3M9MB 1T7PA 3R5CA 1F60B 2ZH6A 1SIZA 4FN5A 2DK2A 3NBPB 4PQAA 4ILMA 1RTJB 5KG4A 4ILLA 2RB7A 1DQ8A 4ZLPA 3JSYA 2KYXA 4C7QA 1WF2A 1FK9B 3ZZRA 2KJWA 1C0TB 1QTMA 5BJRA 3KG0A 2ROPA 4NXNF 4KKOB 3NNAA 4UY8T 1R7IA 2BBEA 3HF5A 3W2VB 4HL9A 4QR2A 1ZAXA 4A4JA 2LXUA 5DDOC 2OTLS 4NLOA 1FDNA 5KFEA 1TP7A 2HRUA 3DRSA 3GR0A 1GXUA 1Q8IA 1S9GB 1TL5A 3CD0A 1X5PA 3V6HA 4WK3A 4OHVA 2SXLA 1CQMA 4UQTA 1U48A 1S1UB 4M95A 3EYZA 3QJJA 1RWUA 4DV7F 1LW2A 1NH8A 2NUHA 1U1NA 1FE4A 4DR6F 4FPRA 4JUZA 3KHGA 2N7YA 3MEEB 3N5FA 3PV8A 2ZE2A 4DF4A 3IAM9 2M88A 2MQLA 2BR0A 2LQ5A 2NPFA 3WX4A 4BWJA 1TKTB 2PO4A 3AB2B 3KNAA 3CCLS 5DM6Q 1DZ5A 4JI5F 4I2PB 4LFAF 3C66A 3PW4A 1HNXF 1O51A 2QZ8A 4DSKA 1XWLA 2FVQA 4AFFA 1KOHA 1UWBB 2WSFC 5F41A 2ZHAA 2JHEA 4OZLA 3LUYA 4YB7A 4P7VA 2D9PA 3KG4A 5KFKA 4IOCQ 5CH7B 1RT5A 2QSWA 4N76A 4DSEA 1VIXA 3T3FA 2FPHX 3H98A 3MUMP 1HD0A 2FB0A 5DLGA 3MEGB 5EX3A 1SL0A 4IKAA 3D2WA 2JLGA 2VC1A 1J5OB 2V8HA 1OSCA 2J9CA 2OD6A 2V4QA 3NMRA 1VRTB 3BO2A 1JLEA 1KQFB 1U6BA 5DDPC 2MGZB 2J9DE 5DS7A 3O3LA 2KM8B 2KZMA 4LSNB 2HMIA 3A8EA 2GA7A 4EGLA 2R8JA 3UR3C 4C3LA 2DNPA 2IA6A 4O3SA 3N79A 7FD1A 2KFZA 4ZPCA 3F44A 2CQ3A 2G9OA 1VQKS 4QYZJ 2DNZA 5C42A 3KTQA 2ZKUA 3UQSA 2OPPB 4KGKA 4ZA1A 3KG1A 2BE2A 2K7JA 2KTQA 1L3VA 2MZTA 2IRYA 5E3CA 2FUG9 2WTFA 1QE1B 4DV3F 3RAQA 2VG5A 5L9NA 2W9BB 3GV8B 4B3OA 3F56A 3G6ES 2HNZB 2YX1A 3PM9A 3OHBA 4DFMA 1R3NA 1N33F 3DYAA 3QIPA 2X1FA 1Q53A 2PA8D 3QMQA 3LP2A 1FO1A 3RR8A 3T19A 5HO4A 1URNA 2FDNA 3MM5A 2LECA 3WDOA 1VQLS 1VRUB 3G9CA 1UEVA 2GQQA 2JJ4D 3CJ4A 1K73T 3QPIA 1QLNA 3RRHA 3I31A 3PW7A 2PGCA 4NCGB 4A8WA 5KT2A 1S7HA 4OV1A 3PEJA 1U8SA 4CH7A 3MECA 3EX7B 5D3GB 1RTDA 2NR0A 4WU2A 1VFJA 4I2QB 1V3SA 2X1GA 2F8MA 1B0PA 3IAS9 4ICLB 5A8KB 1RKIA 2EG2A 3E01B 4C8MA 4NCBA 1N6QB 2KB2A 4CI0B 2CJBA 1JLAA 3KJVB 4NL5A 1IBLF 4JBCA 3MR6A 4TQSA 2C3MA 4C2MA 3MMCB 2RH3A 2ROGA 2WOMB 3DU6A 3OUYA 4FS2A 1RT2A 1Z2ZA 3N0VA 5HI7A 2A18A 1UEUA 2VC0A 4URGA 4NLSA 4JI2F 3M8PB 5CYQA 4I56A 3UWTA 3C8YA 1TQLA 4ZPWR 1C1CA 1HMVA 1S6OA 2ASYA 3IFEA 1VI7A 3AQOA 4B9SA 3LGNA 2XBPA 2CG4A 3FZ2A 3TUIC 1ZM4A 1X5OA 2MQNA 4LFBF 2YKAA 2OSQA 5CYJA 3U7JA 1AFIA 3UNGC 3V2UC 1SJRA 1R8HA 5LXRA 4LF4F 4R8UA 3KLEA 2PE8A 2ZNZA 2F40A 4K4XA 4M5DA 5HLFB 1H6KX 2ASLA 4TLQA 2V8DA 1SI9A 3TYTA 2ZHBA 2YNFA 2NXUA 4A8XA 4AL7A 3MHYA 2DBBA 3M4XA 1FKAF 3EZUA 4MK9A 2GHWA 2VKRA 1G2EA 2DCLA 1HBOB 1T03A 1JIHA 5FDLA 1S1XA 2RQCA 1SJ4P 2IYIA 3K5OA 2JLFA 1KFDA 2YVSA 4IFVA 2CZVC 3CCVS 2PFFB 4WZQA 2LQBA 2DH8A 3DOLB 3DLHA 3UFCX 4HT5A 4AYBD 2E1AA 3PJWA 4WCEQ 2W9CA 3Q8SB 1KOOA 4J9LA 3FDSA 4ED8A 3NWGA 3HHDA 3MMJA 1D8ZA 3MEKA 3EGWB 1FJGF 2ILZA 4USHA 1MSWD 3KLHB 3WC2A 2KKHA 4ES3A 1WEXA 3PX4A 1FEHA 3FRYA 1E6VB 1AW0A 2AGPA 2P9CA 3CCTA 2AWZA 2ADCA 4B9UA 2M70A 2AU0A 4P6QA 2HHQA 2MZ1A 3C6UB 1S1VB 2EG1A 2JSXA 2ZBCA 3FSXA 3H5XA 1X4AA 1KQGB 1FVQA 3CB4A 1UJ6A 3E51A 3GFZA 2WCXA 1FTRA 2YWKA 4TNOA 1SKRA 2YNIB 2VASA 3S6EA 3CDBA 3MOZA 1LQ9A 1YG0A 2DNGA 2HW3A 1RT6B 2R8KA 5SZTA 1ZETA 3PO4A 4ECUA 3TUZC 3MM8A 4G1IA 4G1QB 1HBUB 2JZ5A 3HI9A 4PXDA 4ZK7M 1E6YA 4BWMA 4LUBA 3GSDA 3UD4P 2AV5A 4K2XA 5HROB 1B0TA 5GAHU 1HNIA 1JB0C 4NLDA 2HYIB 4ECTA 2V2KA 1SV5A 1NNDA 4MFBB 1SH2A 3ULHA 3DLKA 2MKCA 1S6QB 4HYKA 1QAJA 2F4VF 1CQNA 2J8AA 3D0HE 4HH1A 4JI7F 2D74B 2QIFA 3GYNA 1JNZB 1S1WB 3OR2A 4R5PB 4WXOA 2OFGX 4JOUA 5D78A 3QZ8A 1B0VA 3L3CA 1WNEA 1JLFB 2CQ0A 4TY9A 1LV5A 4RNHA 4OL8A 1T95A 2EFNA 4KJIA 2VD3A 4PQUA 5KOWA 2IJNA 4O4RA 4X4NA 1N34F 2F8EX 2C3OA 5F3ZA 4YFUA 2LU2A 3M6WA 1KLMA 3I32A 2BM1A 3AY0A 4MTPA 4UUXA 1V3ZA 5MLCV 4DV6F 1I94F 4I68A 2CQPA 2YX4A 2DGQA 2OSRA 2O67A 2ZJRQ 4ECWA 1GTEA 1NU4A 2KT3A 2L9WA 1LWCA 2Q1LA 2AJ4A 3TAMA 2JOQA 2L9DA 5KFLA 4BDPA 3O8WA 1U7LA 2DNKA 3KK1B 2OMLA 2IC3A 1BQNB 1Y0HA 3JTPA 1CPZA 4QOTA 2NS1B 4ITSA 4NLWA 4RUAA 5F8JA 2Q79A 5KT6A 2BRLA 3MMAA 4UOCA 2GCFA 5KFGA 1XK8A 3N6MA 3ICLA 1RT4B 1EETA 1R89A 3GFHA 2VBXA 2V5HG 2BUNA 5U47A 1HQEB 5HBMB 1S76D 1D9AA 3EXYA 4ID5B 2BW2A 3AH6A 4EFAC 3FJ2A 2XLIA 1YWXA 3F73A 1YVFA 3AA9A 3EZ5A 2MQPA 4IDKB 2OLWA 2XNQA 2ZJQQ 3R27A 2VFTA 4RW9B 5J2QB 4J9KA 1JKHA 1XNRF 2ZH4A 4B9MA 3M9NB 1CG2A 3BR9A 2RU3A 2V94A 1XEZA 2WSCC 3L7PA 4I6YA 3TARA 2XULA 1S72S 2OH2A 4C98A 3CDEA 3HHLD 2A1BA 4PG5A 5DG8A 1FDDA 5A8RB 4DV0F 2YNHA 3LP0A 2MSSA 4HHJA 2O1PA 2YWHA 3SSRA 5C25A 5JVHQ 3P96A 3FEZA 4NA1A 1VQOS 1RA7A 2JEFA 2MKHA 4ZP6A 4Y65A 5THWA 4TQRA 5K9FA 5IT4A 2PIIA 2FVPA 1T3NA 1HWKA 4YDXA 2Y1IA 2DB1A 2ZD1B 3GR1A 4NX9A 4NYZA 3VR1A 2RKIA 4RNFA 2EC0A 2PT0A 1IKVA 2MKKA 4F50A 5G0RA 4TY8B 3M32B 5KG3A 2XSJB 1VQMS 3AJ2A 5KFHA 1N0UA 1KHWA 2NUUG 5KFBA 3OTBA 2IVMA 3JSMA 5IT0A 2DRBA 1ZPVA 2HGMA 2D3UA 1TKZA 2HAIA 2I9SA 4LT6A 5A2QY 1TV6A 2HHSA 4JV2A 1SL1A 3M05A 2B56A 3CCUS 1CEZA 3RAMA 2HHTA 3I55S 4YDDB 4KV8B 1RT1A 2DJWA 5L8RC 4YY3F 2DNNA 2GO8A 4KSEB 1S48A 3I0SA 2R7WA 2YNGA 1NKEA 3CJ2A 4HKQA 2V0NA 2JFDA 1QSSA 2LMIA 3RU0A 3QGIA 2MY8A 1VBYA 2I5JA 3I87A 4YB5A 3O6QA 3VWSA 2C3UA 2BZ2A 3IO1A 3MPVA 4DQRA 3HHNB 2HFOA 4ZHRA 4OZJA 2OPQB 3M2VA 2GV1A 1DLOA 1Y5NB 1SQEA 2EK1A 4H4KC 3V6DB 3PVXA 2W4DA 4KFBA 5KG6A 4LQ3A 2MJNA 4MJKA 3VAJA 2UVUA 1UFWA 3M8SA 1MW7A 2JDJA 3GG1A 4TLRA 2Q3PA 1IUJA 4N77A 3CCMS 2KXHA 5IT9Y 1H2VZ 2DCUB 3FCHA 1VGYA 1G3OA 2YWEA 1HFEL 4LSLA 3PJXA