2WSEC

Improved model of plant photosystem i
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
81
structure length
81
Chain Sequence
b'MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWGGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLAY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AT3G54890
publication title Structure determination and improved model of plant photosystem I
pubmed doi rcsb
molecule tags Photosynthesis
total genus 4
structure length 81
sequence length 81
ec nomenclature ec 1.97.1.12: Photosystem I.
pdb deposition date 2009-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF14697 Fer4_21 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2wseC00
1FRKA 1AXQA 7FD1A 2O01C 2PMZD 3GYXB 1VJWA 2Y0SD 2FJBB 1DFDA 1F5BA 5L8RC 1FRHA 3MMCA 3MM8B 3MMAB 1D3WA 3MM7A 4ID8A 1HFEL 4OMFG 1Y5NB 6FD1A 4DHVA 2FDNA 1PC5A 2VPYB 3EUNA 2Z8QA 4L6V3 3EXYA 1FDDA 1BLUA 1G6BA 1WTFA 3LW5C 1B0TA 2GMJA 1ROFA 2UZAA 5E7OB 2VPWB 1GT8A 2WAQD 1FERA 1GTHA 1H7WA 1FRXA 2PA8D 2VPXB 3OR1A 2V4JA 3OR2A 1FEHA 3IR7B 1G3OA 2XSJB 2WSEC 5BYSA 1SJ1A 1Y5LB 2WB1D 3C8YA 4XDDA 1BWEA 1FF2A 1R27B 1C4CA 1IQZA 1SIZA 5FD1A 2WSCC 3MM5B 1A6LA 3MM9B 1Q16B 3MM6A 2C3PA 4CI0B 1FRLA 1C4AA 1FCAA 1H98A 3MMCB 1BQXA 1GTEA 3MM7B 3MMAA 2C3OA 3MM8A 5BYRA 1FRJA 4KT0C 1SIWB 2C3UA 2C42A 2WSFC 1KEKA 3MMBB 2IVFB 1BC6A 1DAXA 5CH7B 2FGOA 1FRIA 3EGWB 1H7XA 2C3YA 1BD6A 1FTCA 1IR0A 1FRMA 1FXRA 2VPZB 1B0PA 2FJEB 2V4JB 4RKUC 1Y4ZB 2FD2A 5BYQA 1Y5IB 2XSJA 4YDDB 1JNRB 1FD2A 1XERA 1B0VA 2FJAB 1KQGB 1FXDA 4OV1A 2V2KA 3MM5A 1GAOA 3PNIA 4XDCA 4AYBD 4XK8C 3MM6B 1RGVA 3MM9A 1CLFA 1FDBA 3IR5B 1F2GA 2FJDB 2C3MA 7FDRA 1PC4A 2GMHA 1FDAA 1JB0C 4Y28C 1JNZB 1DURA 2VKRA 3IR6B 3HKZD 3OR1B 1H0HB 3OR2B 1K0TA 3MMBA 5CHCB 1F5CA 2ZVSA 6FDRA 1KQFB 1FDNA 2PDAA
chains in the Genus database with same CATH superfamily
1I94J 4CIOA 1RHRB 3QLHB 2B0GA 2V94A 3EE3A 2B43A 2ZOMA 2ASLA 2MLZA 4ZJLA 3JS9A 3DLKB 4TQSA 4QYRA 2LXFA 4PWWA 5KT3A 4DQRA 2GQCA 4CO0A 1SH0A 1VQ8S 3TJ8A 5F8GA 2AJFE 3CJ3A 2LQBA 2HS3A 3ULHA 4ECWA 4ES1A 3TQEA 4LREA 4RW8B 1HR0F 2XI2A 3LH2S 2QMWA 3GV5B 4JI5F 4M8LA 1S79A 2C2DA 3DLGA 4F3OA 3J81j 2VFVA 1B0PA 4IRCA 1QM9A 1GQEA 1YJNS 2XZDB 3ENWA 3WBZA 1VS3A 4G1QA 3MM9A 4QPTA 2ALZA 4FDFA 3M8WA 2AGPA 2HFSA 3OL8A 1Y3JA 3HKWA 1LK7A 3WZ0A 2DIUA 3J80Y 3BO2A 4O23A 1XNRJ 2CYYA 4A8QA 1KKHA 3DLGB 5AXKA 2GIQA 4LMZA 1MWQA 3H40A 5K8MA 4B9UA 2KRBA 4JI8J 1RT6A 1WC4A 4CNYA 4H4OA 3AT1B 3LW5C 4C8ZA 4DV4F 5IQQA 1U8WA 3ZTOA 2YNFA 3R5CA 6AT1B 1R27B 3H59A 1L3SA 3EGZA 2LMIA 2RHSB 3QIPB 1RISA 2RVJA 3GIRA 4B3RJ 1S9EA 1CC8A 1D8YA 1WI8A 3MHYA 4DR1F 1D9DA 2BX6A 2VOPA 4PQUA 2JFDA 4AQYF 2AYBA 4CLZA 1IBCB 2HFOA 2AZ3A 2YNGA 3MI7X 3NNCA 3HSGA 3M6UA 5DQIA 2ILZA 4UF4A 3QZ8A 2CAJA 4PQUB 4WP8A 4F2RA 1JLGB 3D67A 3T9NA 1FO1A 5B0AA 5HVFA 2F63A 2DIVA 2HGMA 1NU4A 2RH3A 4M5IA 1HHTP 1S59A 3QT7A 5JVGQ 3TX8A 3THTA 1B0TA 5A8KB 3CD0A 3HMJG 3DXBA 2W2NP 2DXFA 3MAQA 3PO5A 2PMWA 1NJIT 2C3PA 4QBUA 3DYAA 3K58A 2EC2A 4TU7A 1RT1B 3IN5A 3DM2A 1HNVB 3G87A 5T14A 4RW6A 4B9TA 1H7XA 1AZSA 5DLFA 1TK5A 3QFHA 3D1OA 4K4WA 4IUFA 2GIFA 5ETVA 4ZPVR 2O67A 2GMHA 2QLJB 4HDGA 1N6QB 3UDCA 1XMBA 5H9EJ 4DUTA 1KS2A 2HURA 5EX0A 1TL5A 1R8AA 2ZJPQ 4DV3J 4FBUA 1QTNB 3PW7A 4RUHA 1NH8A 2QYCA 2CQGA 4FF1A 2L9DA 4LRFA 2XMMA 4RWXA 3PRBA 1TKTA 1RWVB 4NZ0A 1GT8A 2IPOB 4OYIA 4K4SA 5F8IA 4WU2A 2BW2A 1GXTA 2GJIA 3IRWP 4M94A 1QSLA 1UEUA 4C11B 5F3TA 4ZHRA 3JTPA 3KNAA 4ECQA 2UXBF 1DZ5A 5DG8A 4WKRA 1S97A 3PRDA 2JC0A 2QA4G 2HMIB 1F6TA 4ELUA 2QJ3A 3KK3B 4KKOB 1RAFB 1TKTB 2FC8A 4BC7A 1SKWA 2OEKA 2VPZB 3DOLA 4ED4A 1CJTA 3RU0A 2I0XA 1NK6A 3KXDA 4KV8B 3CD5A 3QRRA 1Q7LB 1RYSA 5IZHA 2W4PA 2ZE2A 1YG0A 2EG1A 4R8UB 2FB0A 1RAEB 1OPIA 3H42A 3MCNA 4J9NA 4IOBA 4OI1A 1HIYA 1NHVA 1L5UA 3HVTB 1CEZA 2UVRA 2MKCA 1TAQA 2CJKA 1NO8A 2E1MC 1FI4A 3PR5B 2EPIA 1S1VB 1PILA 3U1MA 2F4VJ 2Y1LB 1FEEA 5KT5A 1CVJA 2JX2A 1IQZA 1ZOTA 2PN6A 3EPIA 3RR7A 1T9TA 3FBBA 3GIIA 1BE4A 2C3OA 4OYOA 1YQHA 4MYUA 2IDLA 3B54A 1FNXH 1OYEA 3VHQA 2Y1RI 4BHQA 3PX0A 4K5SA 4O44B 2F4FA 2X3DA 3CDEA 4WPAA 2G1HA 4O3OA 3BYPA 4LRBA 2XSJA 3D66A 3TEGA 3PJWA 1LEOA 1YJVA 1FESA 1ZPWX 2AYMA 4U7CA 3M32A 1UKUA 4ZVRB 2W1BA 2COLA 1K1SA 5F8MA 2UV8A 4F67A 3JSMA 1PSDA 2AW0A 2RRAA 4CH7A 4WWSA 3DC2A 4K59A 2VFUA 4ZLPA 3QPIA 2HS0A 5I3PA 2LA6A 3BSCA 4KTQA 3X3UA 1LWEA 4DL6A 3SSRA 1WTFA 2GZOA 5L1LA 2F8MA 1ROFA 2FY1A 4C6AA 1CJVB 1LNQA 3AJDA 4H4MB 1MSWD 1ZETA 1G3OA 1S1WA 4TQRA 2V69A 4JI0J 4ENOA 4FVCA 3OTOJ 2RKIA 1WEZA 3H2UB 4LF8J 2V50A 2XNQA 1UVIA 4JI3F 2LU1A 1FHTA 5DRKA 4GO5X 5C25A 4A8YA 3HVWA 4CM0A 2FJVA 2JL9A 2FZGB 4LSZB 3CF5Q 1IKYB 2IY5B 1TKXB 3OV7A 4CZCA 2RKIB 1ZBTA 3D28A 1GX5A 5LSOA 1JNZB 3TZWA 1ITPA 4WIQA 1YJUA 4FYYB 1JLCA 2VC0A 3LF0A 2IVYA 3R27A 4WU3A 1MWZA 3KNGA 4D3GA 4QU7A 4ES2A 4DPXA 4JB8B 2MYFA 3R7SB 2GVDA 4DR4J 2V9KA 1ZH5A 3JYTA 2NUUG 3G86A 4BCAA 2KT2A 3GSDA 3MCOA 2FHMA 4K0KF 3OXFA 2B6AA 2PA8D 3S01A 2IM3A 1TTHB 4KQZA 4OX7A 1RAOA 2FYXA 3J7YU 2YKNA 4DR3J 1FWLA 2EKNA 5DG9A 4AL7A 5T7LB 2YH1A 4OHWA 4FXVA 2F65A 3MEEA 3VAIA 2CWXA 2B6AB 3T5JA 3POTA 4E2FB 4HVZA 1X7VA 2Z58B 5KT7A 1GX6A 4RNOA 2B51A 3S7RA 3KLEB 1L3TA 5SUHA 5L39A 3K8WA 3C16A 2Y1JA 2CIMA 1RTZA 4ZPAA 2R4FA 1QAXA 5ITHA 2I6WA 3D54A 4TLRA 2ROGA 3POTB 4X65J 2RDIA 4KGZB 1W26A 1UJ5A 1GMVA 4FZVA 1NSPA 1NAQA 2ZC4A 1FTRA 4X4RA 2OLWA 4MYTA 1WDDA 4KGVB 3IWXA 2YPYA 3AXMA 3W60A 5KFCA 5HVHA 4XIUA 3C16B 4J9LA 5BR8F 2H4WB 4K4ZA 1NBEB 3OTEA 4EGLA 2VONA 1S0NA 4ZDNA 3MF5A 1GTEA 2V8DA 3MEGB 1WKJA 4RWWA 3BPDA 2KI2A 2LA4A 3DGPA 1NDCA 5D77A 1FRIA 1BD6A 3TZZA 3E01B 4IQXA 3IRXA 5CYQA 4ZLNA 1RWUA 4OV1A 2FTRA 4QIFA 2A0FB 2V2QA 4N47A 1APSA 5EDWA 4NYZA 4K4XA 1U0SA 2VKRA 3OR2B 2ZH9A 3HHKA 1Q4RA 2YQ1A 3FCVA 4C3KA 1HARA 4A8OA 5CYQB 4F4KA 4CLWA 3P4UB 2WHOA 1T9VA 3DDKA 1WHYA 2D3OR 1WOOA 4BDPA 5D8HB 4X4OA 5L9NA 1VRUA 3KK1B 3L9ZA 2VFRA 5JVHQ 1W2BR 4RUAA 1UWBA 5LJ5Y 2VASA 2WK4A 2M9KA 3HM9A 1S0OA 1HNZF 2VG6A 3K5LA 1RHMB 5J2MB 5KOWA 1K47A 2XMVA 3FNNA 2DNHA 2CJYB 3R7BB 3A3OB 3NCPA 3VGTA 1JLQB 2WVDA 1CLFA 1JJCB 5J2NA 4FF3A 4Y65A 2DRAA 1F3FA 2EVZA 1S7HA 3ET6A 2DR5A 3BZQA 5KFJA 2VG6B 2RD5C 5LJ3Y 3KLIB 3KJVA 3R5BA 1U0HA 2WBRA 2GGPB 4DL4A 4NLDA 2B9YA 5J2NB 3EXYA 1PJ7A 2W2QP 3IWNC 4CM2A 3QBCA 3QSIA 4DS5A 2WAQD 2R2UA 2KG0A 2VQFJ 3DU6A 3GONA 2KDOA 2PGCA 2HHTA 3KDOA 1HPZA 3PW0A 2XMTA 3M9MB 3OW2R 2HLTA 3R6GB 3CXCR 3L95X 2VB6A 1U0HB 4X64J 3O1LA 1NK4A 5KFUA 4R5PB 2DH8A 2CPHA 2DT9A 2JLFA 3UCUP 2B56A 3NKYA 3OTDA 1IJEB 4PEOA 5CYMB 2N7YA 5A6PA 1HPZB 3EJMA 4ZVEA 3ZZOA 3SFUA 3NS6A 3FQKA 5FDLA 3FBCA 2AJ0A 1RWPB 5KFMA 2LEPA 3MMBA 5KFRA 1M5VC 3UNGC 2X1GA 1S6PB 2DYAA 2IMOA 4UTGA 2GQQA 3I0RA 3A3PB 2AZ1A 1RHUB 2DRBA 1MMLA 2MQNA 3OVSA 1VQPS 2M88A 4WP3A 3FJ2A 1PYSB 1H2UX 4TLQA 2RQKA 4RJVA 4TYBA 5B0EA 2YXLA 2HS4A 3P6YC 3H8YA 2ZUGA 2DGTA 5FD1A 3MM5B 4Y2MA 3I0RB 5U47A 1WHVA 1NSQA 4W98A 3TA0A 1IJFB 1YBUA 2KVIA 1XMQF 1A9NB 4KB7A 2BA9A 4DV0J 3D1QA 1URRA 2EFGA 4B3SJ 3GJQB 5HATA 3JSRA 1IM6A 1JLAA 3F56A 2BE9B 2QYGA 5IWAJ 1S7IA 1N32J 1SXLA 2ZWOA 2RNEA 2ZNZA 2JSXA 1RT2A 1HWJA 4DR5J 4EZ9A 5HLFA 3UI3A 4K7QA 1DARA 1ZPVA 2HQCA 5KT2A 2R7OA 1CJUB 2KKHA 2MY8A 2HIYA 1PC5A 3NBPA 1I94F 3OL6A 4JI1J 1PBAA 3G6ES 4L3KA 1M90T 3UVJB 4DWIA 3CCUS 4NXNJ 3CC7S 2BV3A 2W4DA 1A6LA 3BBCA 1UWAA 2CQ4A 2WOMA 1S10A 1X5TA 5KFNA 1B7FA 4YHHF 1PYTA 2JLGA 2VC1A 1M5SA 4GO7X 2DHHA 1KLMB 2XWXA 2C42A 1R89A 1HYSB 4DQPA 2ZKUA 4KGKA 4N7TA 1M0SA 3MTJA 3W7BA 3FFIB 1TV6B 3HFKA 4ILMA 2AQ4A 2JEFA 2BDPA 5KAKA 4IH5A 4JI2F 4NLPA 4C8NA 5HP1A 4NZ7A 1YZ6A 2P6SA 2QIFA 2Z30B 1DLOB 2XG8A 3PJ9A 4PYAA 1YVFA 3AQOA 4LBHA 2NPFA 3MPYA 1NJZA 2BJEA 2UV8G 3BM7A 2FVCA 3W2VA 2G9OA 5E3AA 5A8WB 1R8PA 1T9XA 3C3LA 4IKAA 3TAPA 3VR1A 2XQCA 3MM7A 1REVA 3OJSA 3V6JA 3FRYA 3CJ0A 2BABA 2PI5A 2AX0A 2H48B 1FEHA 5B7WA 1RA6A 5L46A 1VQ4S 3BGLA 4YFUA 2EFPA 4OYBA 3MM7B 5IV4A 1DY3A 1R6VA 4I69A 4OI0A 3AY0A 1UAWA 2W7PA 2MMYA 2VUGA 1PJ5A 3DLBA 1HQ2A 3UWTA 3TX0A 1SJFA 3PW4A 3EWGA 3CDWA 2XZTB 3UN3A 3TOQA 3EICA 2E1CA 2R7UA 5LXRA 2W9CB 4CCHA 5HL7Q 4F8RA 1KVIA 1Q8BA 2XWYA 3E2EA 2A6MA 3UN5A 2N82B 2D69A 2QA4S 1VI7A 2LKZA 2HFUA 3Q8QB 1RTDA 4QYZK 2DNNA 3P49B 3TUIC 5F8HA 2CZVC 3RB3A 2OMOA 3D2WA 3BREA 3S6EA 1E6VA 1OQ3A 5K14B 1YDLA 4KIAA 1MU2B 3TAQA 3GILA 1UETA 1X4HA 2BZ2A 4LVNP 4FF2A 4RU9A 4IG0A 3QGHA 2MB0B 3MCMA 1KEKA 2IC3A 1RAIB 3DLHA 4DSLA 1N56A 1E6VB 1P9QC 4Y6IA 1SH2A 5ETMA 2CQ0A 1LXJA 5D15A 3RBXA 1S1TB 2XSFA 3AD8C 2EI5A 1OY6A 4NWBA 1HBNA 4F4ZA 3SCLE 4FPRA 2I38A 1F3VA 2RQMA 4F04B 1HNWJ 2XCPA 3SSQA 3TZYA 2NYHA 3K5PA 3GIMA 1ZA2B 3OHAA 2VQEJ 3V2UC 3HO1A 1Q82T 4QW9A 4MIWA 1HBNB 3DDIA 3ZZTA 1Q8KA 4PG8A 3EZOA 2W7OA 2FIUA 4Z7YA 2A3JA 1WG4A 5KG0A 4L72B 1OQ6A 5HSPA 2R8JA 2RMLA 3IFEA 1F9HA 2ZH1A 4CLFA 1IKWA 3H90A 3KYLA 3GFZA 3NWRA 2LDYA 3DLEA 1U6FA 5E0OA 1AYEA 5RUBA 2RJZA 4ZK7M 3WC2A 1U1RA 2HQIA 4QWAA 2YBVA 4I0WA 3Q83A 1WSVA 1SC3B 1XN9A 1JXVA 1U1NA 2E5GA 4LF6J 2DGQA 1V5VA 4FBTA 3O5TB 2JEJA 3UFCX 2B4VA 4ID5A 2KB2A 3DLEB 2JHEA 1UMJA 2DB1A 2MLXA 3H2VE 1BMQB 5KFFA 2JFKA 3M2RA 4O3PA 1AUDA 4UOFA 4Q8FA 3DOMB 2ZBIA 3IA0A 1H7WA 2F3JA 3EVMA 1WC1A 4ID5B 2F4VF 5IQ6A 1UVMA 2ZKTA 5D0RA 3G9CA 1EJ7L 1P27B 5L1JA 3CIMA 1YWXA 3RTVA 4JI6F 1C1CA 3MPDA 4PXEA 4C48A 2HNDB 2DNPA 3ETOA 5KFXA 2E5JA 2HQGA 1T03A 1N5TA 4OZJA 3W65A 1T7PA 4NMXA 3G82B 4QWDA 2BMBA 1F2GA 1KFSA 2E66A 4U8VA 3NG8A 2I1RA 3HCXA 3WC0A 4ETZA 4OX6A 4LF5F 2GVZA 3VAMA 4LR9A 2HEKA 1NB7A 5IT0A 2QSWA 2HYIB 2ZH2A 2RF2A 4DOZA 2D1CA 1HWLA 3MAHA 4JBCA 4NYOA 4WFNQ 4IYQA 3QGGA 2GX8A 3PEHA 1OIAA 1I5OB 1UZDA 2IRXA 3W9HA 2IM1A 2OAUA 3CPWR 4JYAJ 3R97A 4DX5A 4Y2CA 3J81Y 3VV2B 5KG2A 4WK3A 4DLGA 2AX1A 4JI0F 5A0YB 4QIWD 5KG5A 3LP0A 1LXNA 4KH1B 1FJEB 5FLXY 3OTOF 3NGRA 4EUVA 5I3UB 3E8OA 4GC6A 1SJ3P 1JK9B 4TKTA 1QDUB 5AXMA 4NCBA 1S9FA 3KG4A 2V2KA 3PYEA 3M2VA 2R8KA 4WE1B 4M5NA 3K59A 3A8JA 2MQ8A 1GNKA 2XYGB 1U47A 1DURA 1KONA 3EM1A 1S0VA 1CQNA 5EWEA 2YNHA 1HBOA 4RNFA 5ETQA 2VH7A 3C6UB 3M2UB 1FKAF 4IRDA 3M2VB 2BOAA 5D78A 2NSCA 3QO9B 4ANCA 1NNDA 3NGKA 1RLDA 2V8PA 3WHIA 3OTCA 5KFBA 4ZVSB 4DR4F 1FX2A 2ZVIA 4JP8A 4NMLA 3M05A 2K7JA 3BGRA 1HBOB 3IWLA 4OI6A 3UCGA 1FA0A 3W62A 2XGQA 1LW2B 4L76A 4FYWB 2BRLA 3LP2A 1DAXA 1VQOS 4ZVTB 3FMWA 1V3ZA 3ZNJ1 2C3YA 2HPUA 1RABB 1R0CB 3H20A 3PW2A 5G0RA 4RU2A 2CZ4A 4DPYA 2DGOA 2OPPA 2D7SA 3CWJA 3PNIA 3RBDA 1YZ7A 1FKOA 3GG0A 2W9BA 2Z2YB 2D3ZA 3CMAS 2HHPA 2H5JB 5A2QY 3CIZA 3NL0A 1VFJA 3KLHA 2YPZA 3ZO7A 3LP2B 4KJIA 2J7KA 2IBOA 1ZYQA 1FRKA 5K8NA 2O01C 4C4WA 2D9OA 2I5JB 2MGZA 2QL7B 2WVFA 4PG7A 3OSPA 2GAHC 3BN7A 3AJ1A 4X65F 4X62J 2VICA 2Q6BA 3A8IA 4RW4A 2M2BA 4K4TA 2R3VA 2FC9A 2WB1D 4PWDB 1WOSA 1FF2A 3G96A 3P5BP 1N5YB 2ADBA 3A3NB 1FNMA 2MGZB 2M4MA 3W9JA 2H1YA 4N56A 3V6DA 3W1YC 2HGLA 3PRVA 3DLJA 1C0TA 3CD7A 1L3UA 3GCWP 2VZ9A 2C22A 1VBYA 1MWYA 5IM0A 1VHIA 4PR6A 4DG1A 3TA1A 2R7QA 1VC6A 5BYQA 4DJBA 1RCXB 4ZMMA 5C5JA 3J7AN 1C0UA 2BVZA 2CDQA 2LVWA 3R5DA 4FYXB 4C8YA 3VAFA 2IAJA 5H9FJ 2IHR1 1C1BA 2CA9A 2G0JA 2X1FA 3KG1A 2DCLA 3SFGA 1V6HA 5B0FA 3D1HA 1C0UB 3MDFA 3GLJA 4JOUA 1FRHA 1LFPA 4Y34A 4K8RA 2QO3A 3PYFA 2VG5A 4KRWA 3HFZB 2IAJB 3T19A 5KG1A 2N4CA 1AFIA 1C1BB 1WEXA 1KVKA 3MMJA 2MHNA 4NXMJ 2IIHA 2IJNA 1H2TZ 3THVA 2DR8A 5KG7A 2Z4PA 3IMQJ 1YJRA 2QRRA 4FKXA 1G2EA 3MM6A 4USKA 4DFJA 3MMAA 3L7OA 4I56A 4GMKA 2NPIA 2KJWA 3NRBA 1HMVA 3C14A 3PIPQ 1HW8A 3MECA 2OPQB 1SUQB 4DFPA 1RAJA 3MM6B 1TZ0A 1SC1B 2B4OA 2H5EA 1M5OC 3CD6S 1WOPA 2YWGA 5HROB 3M1VA 1WG1A 3M8YA 4A46A 4UOGA 3UDEA 3PHEA 1M5KC 2XTJP 2F8EX 1ZTWA 1WORA 1UEVA 2CQ2A 3LO3A 4USUA 4WFZA 2FPHX 1NCLA 2WVEA 4F4WA 5KFGA 4X4UA 1D3WA 2DHSA 2OTLS 2MZQA 3NOCA 2MQLA 3M30A 3GJRB 2LU2A 4LQ3A 4E0DA 1U02A 4TU8A 3QGPA 1NK9A 3MURP 2OMLA 5E2QA 2AMCB 4X66J 2V2ZA 3CJ2A 1SJQA 2WONA 3M9NB 3MR3A 3FMBA 1I3OB 2QTWA 3ILOA 2AKWB 2MSTA 2HG4A 3D68A 3M30B 3ZZPA 5KT6A 4KGMA 2OEMA 4TXSA 4AL6A 4F2SA 4RR5A 3N5BA 1XERA 4LBPA 1OY8A 1FJCA 2ZOGA 3R6LB 1I6JA 4O3RA 1FWKA 1PC4A 2DH9A 1WC3A 2ZH5A 1OSCA 2WONB 1HA1A 2X1AA 3NAIA 2HVEA 4Q2LA 1XMOJ 3THPA 3CMQA 5CXTA 1JKHB 4X84A 1W2IA 1VMBA 5J2PB 4ZVFA 5EX3A 5A76A 1MROB 3HHLD 3UDVA 1OWXA 4ANEA 5HAOA 5HBMB 1VQYA 2WSEC 3Q2SC 1NPPA 2QSFA 2ZD1B 4J5OA 4DR6J 3CDUA 1JLBB 3ONQA 1X5SA 4GVBA 3DXSX 5I3QA 1D8ZA 5L1KA 3GIKA 5LMNJ 3PJXA 3B4DA 5HANA 3UR0A 4AXJA 2YKMA 1IKVA 3C15B 3BO3A 4JV5J 1U49A 3SBMA 2QFJA 4B3SF 3VAGA 1FXDA 1GAOA 4Q0BA 4IFVA 3AD9C 1X9WA 2C2EA 4RNHA 2E9ZA 5IWAF 4GVBB 2HRTA 3HJVA 5F0UA 4DL7A 3I4HX 1N32F 2OTJS 2B8QA 2DNZA 3HP6A 1XQIA 4YQWA 4DR5F 3LQVA 1NZ8A 3ZTQA 3D0GE 3D6FB 2OH2A 4Q0BB 4M5DA 1X0PA 4CLUA 3NCQA 4ZKAA 1X0FA 3MOJB 2CPFA 4ZP8A 1XWLA 4JI1F 1RE1B 4LR7A 1S6OA 4USMA 4CO5A 3PEJA 2RUGA 2MLYA 3V4MA 4NXNF 1HLWA 4M5LA 2E7XA 3NGUA 5EWGA 5DQGA 3V4IA 1Q53A 3QJPA 3FBEA 1BHNA 1Z4UA 1UPMB 2LQ9A 1RBAA 1RLCL 2CRLA 3EGNA 4E98A 3I4PA 4J9KA 2VV5A 4RL1A 4DV5J 1IBMJ 2KYXA 4MK8A 3OXGA 4QU6A 1T3OA 3BR8A 2B7BB 4ECRA 1S57A 3F41A 4I7FA 1YBAA 4GKJJ 1YSJA 1ZZFA 1S4EA 3R5GA 2ZHBA 4TY9A 4Q43A 3E3XA 3MM8B 4OYWA 3KDNA 5KFTA 3ETMA 1YTYA 3RW6A 1TVRA 2XS2A 3FEXB 4V19X 1U24A 5ETTA 2MZJA 3FSYA 4K4YA 2BKPA 1RT3A 1S1XB 1RWKB 1QAJA 2CXEA 1RBOB 3CCWA 4P7VA 4ICLB 4F0MA 3DHXA 1Z2LA 1NHUA 5L38A 1BGXT 4QIVA 4ATNA 1SV5A 2KT3A 1UFLA 5EUHA 3AA9A 3MOZA 4TY8B 3LAMA 3K5NA 3PFEA 1T11A 2HVZA 4LRAA 4RW7B 1B0VA 1TP7A 4DX6A 3U1NA 3HXMA 3LANA 4ZJQA 1U45A 2EG2A 3B82A 2MKHA 3IS9A 4X4QA 3PY8A 3QT8A 3GV7B 3FC9A 2A2CA 1GH8A 3ZZZA 3OXLA 1HBMB 2WRMA 5F9LA 3DLLQ 1R6YA 3EYZA 4N5SA 1HD0A 3IR7B 3FEZA 1JQGA 1UEKA 8ATCB 1SH3A 3IS9B 2XO6A 1FRJA 4PG6A 1T05A 3BR9A 1SIWB 2AT1B 1X9SA 4RPFA 3IGVA 2KL8A 1AT1B 3FGVA 5C2GA 2LEBA 2LCWA 1MW7A 3M8SA 3KWMA 3V6HA 2G2ZA 4KFBB 1RGVA 1TL7A 4ZCLA 2MKIA 1JLEA 4F4XA 2JEGA 7FDRA 1A7GE 4KHRA 1T05B 1N48A 1U48A 3OBIA 2C2KB 1TQLA 1P1LA 1F2HA 4I6AA 1DQAA 2CNKB 3KKFA 1LV5A 4PXBA 1VK8A 3R1HA 3BQ0A 3C6TA 4KO0B 1ULRA 3PFOA 1TL7B 4G1PA 5JMNA 1IQTA 1TR0A 2BM0A 2ZJQQ 1U1KA 2CUYA 2OD4A 1GTHA 4LSLB 1EKSA 5F8JA 1JLFA 1R31A 5EWFA 3KMSA 1B99A 4WFXA 3ZXWA 3OUYA 4HI1A 2UVVA 3N28A 1X5OA 4X4VA 3UPFA 3AOBA 1TMJA 1M5HA 4LRDA 2AWZA 3UW1A 3ILJA 3IP0A 3CW2C 3PDNA 1J5EJ 4FPIA 3BN4A 4CQ1A 1RJJA 3HHEA 1FX4A 1CJKA 5CAAA 2L41A 2UU9J 9RUBA 4BLGA 3CCMS 1HI0P 3HF5A 4UUWA 3FK4A 1RB0A 3NWGA 4YB1P 3OUYB 4F36A 2GMLA 2ASJA 4G3IA 4M5JA 1T0TV 1VCTA 1KLNA 5CZVA 5JXSA 1B7YB 4B9LA 1S12A 3BSAA 4U9RA 2B5JA 2J9CA 3WQPA 3SIPB 4DV1J 1HNIA 5M2PA 1Z2ZA 1FT8A 5LXYA 1CJKB 3GFYA 4WZQA 4I2QB 3ADAC 3QT5A 4ID8A 2VHGA 2O3DA 2Y8WA 2RU9A 2W8LA 1EARA 3IC1A 3W2WA 1DTTA 4WFBQ 2UUCF 2G2YA 4OX8A 3VQTA 5I42A 2AHOB 4DCJB 1ELOA 1HNIB 2PIIA 4Y0FA 1S76D 4YB7A 2MTLA 1RT4B 3DRSB 1EQ0A 2APOA 4KGXB 2A10A 4CYUA 1LK5A 4C8MA 1M5PC 3W2WB 4P52A 2DR7A 4YOEA 2HWIA 4ZP6A 3DLKA 2FJEB 2OI2A 3AA8A 4HHUA 3GWCA 2CQHA 4ZPWR 1HR0J 4M63A 4PPZA 1VISA 2R2SA 5DDQC 4DCOB 4FP9A 2QMUB 1ZM9A 1AROP 3KTQA 5A8RA 2HHQA 2YWFA 1Q95G 4RW8A 2G4BA 4WJBA 4CYUB 4Q5VA 2VG7A 1VGYA 1WD6A 4J9SA 4KY3A 7FD1A 5K8PA 5ETRA 4F25A 5AE1A 1PAEX 2B9EA 1Q78A 3OFGA 5IV3A 1PGZA 1DFDA 3D0HE 1K44A 2OPRA 1RA7A 1QVFR 4LSNB 1Y00A 5E33A 1WF0A 4RW9A 5A8RB 2J0QD 4GC7A 2GQ2A 2LXIA 2FHJD 4GVLA 1G7CB 4DV2J 3DNCA 1O0PA 2VG7B 2ZZMA 4HT7A 5KFSA 2AF6A 1XC9A 2OPRB 1TFWA 1SL1A 3BPSP 4RW9B 2LQJA 2PEHA 4OJGA 1E6YA 4I2PA 4Y3CA 1KHVA 2DPJA 1FXLA 5D4LA 2DGVA 2BE2A 1Q81T 2RDDA 3T5HA 3JSYA 3EPGA 3GSIA 4Y2AA 4YR2A 3R5JB 3GR0A 3QIPA 3D7SB 2ZDOA 4KH0B 1ZAWA 1K0TA 2OUGA 2OPSB 1E6YB 4I2PB 1Q0NA 3CCLS 5KFIA 2LXUA 3EVOA 3VZIA 3HVRA 2DK2A 2BE2B 2OSQA 4PUOB 3W8PA 1YKWA 2KFZA 2ILYA 1BLUA 2XZWA 2HK2A 2GAGC 4PZVA 5F9NA 5B0GA 2QLXA 2JVRA 1NPRA 4ZVPB 3TP2A 2XMJA 1JLGA 2Y1IA 2U1AA 1TL3A 4LF9J 2OJ3A 1UA1A 5LSLA 1N54B 2R7VA 2YWEA 3MCSA 1KTQA 2Z57B 2C2MB 4CP5A 2KYZA 3N01A 4OV6A 1DJ0A 3V81A 1CBKA 1Q1KA 4U6PA 1RTJA 2V8GA 5A8KA 2FGOA 3NAHA 1FTCA 1KQSR 4IQMA 3HFVA 1EP4B 3SSSA 3LPEA 3HSJA 1TL3B 2F40A 4P2SA 3US5A 4C98A 1LWFA 1RP5A 3P8BB 4B17A 4B02A 1RT1A 2O5DA 3V81B 1SKUB 3DHWC 3HHDA 4OYXA 2CZ9A 4M95A 5HMYA 3CC2S 1F1BB 2RRBA 1RTJB 1HNVA 4A47A 3JB9k 3M8ZA 1YJ9S 4HTIA 4DN9A 4YEAA 2V9WA 1PKUA 2ASYA 1BWVA 3KMQA 2ZM6J 1T9YA 1U8SA 4YR3A 4BS2A 1DHMA 1XR7A 5CQGA 1LWFB 4NZ6A 2CJ9A 2GNKA 1U1OA 1MN7A 4UW2A 3Q23A 3DRYA 1CC7A 1N6QA 4NL5A 3I9ZA 4ZIVA 2Z2ZA 2KXFA 2IFXA 1NDLA 2PI4A 4DV6F 2QX0A 4OHXA 3WX8A 1VLOA 2OIHA 4UQGA 1SJRA 1T8EA 2C3UA 1NHKL 2EXUA 2FLLA 1QVGR 3PYDA 4NLGA 3QZ7A 2V8HA 2NS1B 3AFGA 2H5IB 4UOCA 1OMSA 2RQCA 3SQGB 2KFYA 4Q2MA 4C11A 2Y9HA 2AU0A 4PAAA 3VF0B 3TAMA 2HMIA 1LW0B 3KUEA 3OR1B 4DL0C 1HI1A 1M1KT 4ZPDA 3KK3A 4KKOA 2E9TA 4DUYJ 1IM4A 1VDHA 1D1UA 1JXEA 3P45B 1TFYA 4KV8A 4J37A 2XYPB 4MFBB 2CNNB 4EBEA 3WIVA 3HT0A 1GMWA 4DL2A 1UW9A 3TAMB 3B4MA 2DXDA 4DR7J 1LOUA 2J7WA 4R8UA 4C97A 2WW8A 1CULB 3Q22A 2VL1A 2LQ8A 1S1UB 3IBFB 3HVTA 2K7KA 1AUSL 3NEKA 4CI0B 4LIRA 3ISZA 3DRPB 2NXEA 3DI6B 1UVLA 2GHVC 1H72C 2NXCA 3VAJA 1CSJA 1S1VA 3MR5A 4W4MA 4N76A 2W4CA 3CJ8A 4OZ3A 4M1KA 2OEJA 1VQLS 4XAKA 4CO3A 4EEYA 1EX8A 2DNMA 2PEBA 3IR5B 3CO0P 2B7CB 4ZLJA 2LYVA 5DO2A 2M7SA 3KLFB 1U7LA 4UUXA 4O44A 1RT5B 4X4SA 4MK9A 4A8WA 4M5GA 1S6UA 4I6WA 2RS2A 3UCZP 4HT5A 3KJNB 2IJFA 3L09A 5ETNA 3LGMA 1U1PA 3W9IA 4DPWA 1MMNA 3W66A 4M5HA 1URNA 4JI4J 3FUYA 4J7CA 2W2MP 4ILRA 1C4CA 5D6GA 2CPIA 2JRSA 4P2FA 5D0EA 1GMUA 1RXOB 1FCAA 1CG2A 1SJ4P 3NGDA 4X66F 4F50A 3QT6A 5F8NA 4C0HA 1VQMS 3EGWB 4K5RA 4ZPTR 4URGA 1CJVA 1BUXA 4ZLLA 2XM3A 4H4MA 2AD9A 3O3LA 1Q79A 1JJ2R 4U67Q 2VIHA 1FE4A 5ETSA 4JI3J 4EBDA 3PO4A 5KFYA 4RNNA 1TU0B 5D3GB 2FVRA 3KLGA 2FVSA 2N7CA 2ZFHA 1KFDA 1BXNA 2VFSA 1F5AA 2BE7D 4WF9Q 3PIOQ 4EMDA 1IKXB 1IWAA 1IKYA 2BEFA 3I32A 3Q24A 1TKXA 9ATCB 4DR2F 1UVJA 2OO4A 4YB5A 2DVIA 2HHWA 3KLGB 2G0IA 3H5UA 2MQMA 2BKNA 4AFFA 3HHNB 1YI2S 1S99A 3H25A 4MMOA 5AJ3F 1T9UA 3K7RA 2V4RA 3O44A 3LWMA 4BC9A 2Q66A 1DTQB 4WYLA 4K0KJ 1S4FA 3RUBL 2DD8S 3Q8VA 4QJVA 4DSJA 4DR6F 1UVNA 1RU2A 2M8HA 5KFVA 2MZRA 4CLPA 2KTQA 2C2ZB 3BSOA 1QUPA 2I9SA 1S72S 3BGUA 4O4GA 5IS2A 5LMNF 3PR4A 5IT4A 2VJUA 4DS4A 1RHKB 3CCRS 2C1EB 3AOAA 4JV5F 1R8BA 1RADB 2XY6A 2IMWP 2AEJA 4EYHB 2MQQA 4NLTA 1TUVA 4NCGA 1J2VA 4IG3A 5T7LA 1MLAA 1VRTA 3SV3A 3PVXA 2DO0A 1TL4A 3ZZRA 4O4GB 4L73A 5HQLA 4CNZA 3TI0A 2NSBA 3OHBA 2VPYB 1RCOB 3IM8A 3J81U 1PJ6A 1PBUA 2ZH6A 4NCGB 3KLEA 2GMJA 4IG3B 1NZAA 1MG7A 2CVIA 2VPWB 1VRTB 1QSSA 2CNLB 4DQIA 1O5JA 1TUWA 3MR7A 4CO1A 5FLXU 5KFLA 3BQ1A 2YQ3A 2LECA 2BJ3A 2OELA 1FVQA 3BQ2A 3FKBA 4ZN1A 1QAYA 2AV5A 2CWKA 2HZAA 5F8LA 2DEIA 4DFKA 4EK2A 1RHJB 3IGNA 4P72A 1IBKJ 1SB6A 4CH1A 3A1YG 4PABA 2OSRA 2DGXA 5IXUA 2HQFA 2EBEA 5HJXA 1GMWD 3SCJE 2CG8A 4P75A 1P8GA 2J9EA 3CEDA 1WHXA 2DY1A 2J6SA 1IBMF 3KOAA 3MEGA 2IM2A 1Q8LA 3V5RA 5D4PA 1D9FA 1C2PA 4J9MA 1VLYA 2R9LA 2CPEA 4YB6A 2D9PA 2UXCF 3E01A 4GKJF 5KFQA 1JWWA 4ZS6A 2P6TA 4LFBJ 2KO1A 4P2MA 4L6V3 2E1RA 1XEZA 2F9DA 2IYIA 3KK2A 3OR2A 2XNRA 1EIYB 1LQ9A 1AFJA 2WSCC 3PM9A 4TU9A 2J9DE 3CCZA 3NS7B 2K1RA 2JJ4D 3PCOB 2RQ4A 4B3MJ 2MHEA 1LWXA 1HBUB 1OS5A 2VBWA 1HD1A 3KK2B 2RAQA 1NK5A 2QA1A 1H3DA 1Y4ZB 4WTYA 5A2QU 1HNZJ 5JUMA 5GAEI 4YDDB 2E7WA 4G65A 3KK1A 2V0NA 4DX8H 2EWHA 2K1RB 3N9UC 2HHXA 3FZBA 5F3ZA 2XEXA 3IR6B 4N77A 1WHWA 5J2MA 5CHCB 2J0XA 4QR2A 3JQKA 4DI6A 1X4DA 3W8GA 2R7SA 4FXDA 1FJGJ 2BJ7A 3I82A 3CUNA 1Y5NB 3RAXA 1JLQA 2VF3A 5THWA 2HVDA 4DEZA 4Y00A 3H5XA 2GJFA 1AA1B 4ZIWA 3KLIA 3EMTA 5LL6d 1R43A 2WB4A 1QE1B 3BBBA 3D4JA 3ZTSA 2UVWA 5D0GA 5H1SV 2RU3A 1RHQB 2HBRB 3BO4A 2GGPA 2D3O1 4ZA1A 1IXKA 2QC3A 4USWA 3A13A 2QN6B 4YS2A 3Q8PB 1N5VA 1RZMA 3HHLC 1N4LA 1TMMA 2DPIA 1N0VC 1SBRA 1NUEA 3MAAB 3EZ5A 4EO6A 5KFAA 4ECTA 2ZWPA 2M52A 4R5PA 2CQPA 5I4MA 1B64A 5KG6A 5CYMA 4UQTA 5L8RC 1XR6A 5EHHA 3QQCD 1BQNB 2YNIB 4N8OA 4NA1A 2ACYA 4CTAA 3P96A 4Z37A 5C42B 1HWIA 2ZNYA 4CRJA 4ZCKA 3GE9A 2MKJA 2ZBRA 2H65B 2XHCA 2CNOB 5C24B 4RBTA 1S6PA 3KUHA 5K8OA 2J9DA 2BBEA 1W25A 1VC5A 4AT1B 4CTAB 3OL9A 4ZVQB 4ECUA 2DJWA 1W7WA 5MLCV 4NYPA 4LF7F 3M4XA 4S0MA 4EYIB 4UT4A 4OJ3A 5BXIA 4ED7A 3QJJA 1J5EF 3MM5A 2ZZNA 3O8WA 2BJ1A 2FJDB 3EDRB 2JOQA 5IT9Y 1RTIB 3LAKA 2KM8C 1Y10A 3DGVA 1YGYA 5CABA 1RTHA 2PDAA 1H2VZ 2AJQA 4ZN3A 3QAUA 3ISND 1VBKA 3FVYA 1Y0HA 1RK8A 3RAMA 2JZ5A 1HFEL 3SDEB 3FZ2A 2E44A 4UZCA 2PFFB 4KSEB 3R8YA 3SQOP 4I67A 2HHHJ 5CA5A 3MUVP 1YK9A 4CLLA 4ECYA 1RTHB 4HTJA 3QRPA 4QYZJ 4KHPF 2ROPA 1HL6A 2VA2A 2HVHA 5KG4A 3PZPA 4O0NA 1CJUA 1CS4A 1RAAB 3FCWA 3TO8A 1HWKA 4YHHJ 1QUVA 4LBIA 3N79A 3UVJA 3HT3A 2XCAA 2UUAJ 2HZCA 2IBKA 1UL3A 1KQGB 2FGCA 1FDBA 4IRKA 2NCKL 2ATLA 1CS4B 4YMEA 1KBRA 1OJ4A 3EDQB 2PD1A 4JI2J 2F9JA 2XY7A 1KLMA 4FNHA 2MQOA 2GW8A 1HYSA 3LWLA 3Q0AA 2HLUA 1G4CA 3FFIA 4DSFA 1TV6A 3NCRA 2HSEB 2XS5A 4PXCA 2RILA 1U2FA 2HHUA 1DLOA 3RGIA 2KU7A 4J9QA 1RU1A 1Y7PA 3RJMB 1KC8T 2NR0A 4J9VA 1X4AA 4HH0A 4EBCA 2ALYB 3JSBA 5A8WA 5HI7A 4IR9A 3L4BC 4DV2F 4G1QB 1N36J 3D6MB 3MM9B 3BV8A 3IO1A 2QA2A 4L3NA 1R0BG 2BACA 2MSSA 2CQIA 4OJ1A 3EGVA 5DZ6A 3KLVA 1IUJA 2DGUA 1N33J 3HX9A 3CSKA 4J91A 2D41A 2E5HA 4E8UA 3OJUA 4ZVUB 3TVKA 2K3IA 2J76E 2CPZA 2DCUB 1RYRA 2I8EA 1RT6B 4MKAA 4FXWA 4P10A 2NLWA 1XNRF 4H4OB 4LT6A 1VIOA 2BRKA 2YNFB 2IRYA 4JI8F 4HR2A 4NLUA 3I5BA 3ZFVA 2KZZA 2YTCA 1Q86T 2AGOA 2DNGA 1DQ9A 2YKPA 2CADA 2QLWA 1SC4B 1P9YA 1S9EB 5LMUJ 2W9CA 3DOKA 1U09A 3CDAA 2JVOA 4AE5A 2BQRA 3W5ZA 2VJVA 4B3RF 2YNGB 4KAIA 3QMQA 1GFWB 3N6MA 1Q16B 4XPCA 2FHOB 3Q8YA 4LF9F 5HO4A 4QOTA 3BGFA 1NDPA 3DOKB 2HW3A 2BQ3A 4DDFA 3TA2A 2RT3A 5CZXA 3FQLA 5K14A 4QWEA 1SKRA 4V19J 2DNOA 4XDCA 1MU2A 2Y0BB 4O3NA 3GYGA 2EEYA 2Z2LA 4QR0A 4NPOA 2ZZTA 5B0BA 4J9RA 3DYAB 2RIJA 1RKJA 5IFMA 3HSDA 1VR6A 2BQUA 4OMFG 2ZM6F 1O8BA 3DM2B 1S1TA 1X60A 2E29A 5GMDA 4ED1A 2K2PA 1OSDA 3MEDA 4RW6B 3GV8B 2UZAA 4X4PA 1AZSB 1N5SA 1LWCA 4M5KA 2YX7A 2HFVA 1ZA1B 1SIZA 4P9SA 1B4SA 1JMTA 4P6QA 2V2VA 2YKQA 3NY0A 1WNEA 2ZUAA 4B9NA 4IFYA 3EZUA 2H54B 2HFNA 2NZ4A 4OFZA 1NJXA 2DNYA 2MY7A 2V68A 5GAGI 3MEDB 3H4BA 2VD3A 1HWUA 1Y11A 4CLKA 3M6VA 1FXRA 1LWCB 4P7TA 1SL2A 2N3OA 3OLBA 1T95A 3LA0A 3PACA 4X2BA 2J8AA 2AGQA 1F0XA 2ZC3A 3CULA 3I6PA 4ECVA 2RUSA 3I0SA 1UVKA 4IFYB 3RB4A 4YUDA 4Y28C 4DV3F 4DCPB 3H5SA 5DGBA 4OZ5A 4ETXA 4DUZJ 2IRUA 1N34J 2CKWA 3OT9A 1KQFB 2MKKA 3NGSA 5SZTA 4ZHRB 4EO8A 4DUYF 4F0KA 1V3SA 4ER8A 1U4BA 1UCNA 4FF4A 5AE2A 1GK8A 2QLFB 2D3UA 2XBPA 4LRCA 5J1EA 3SXLA 3PKMA 3I0SB 4P71A 3I56S 3HI9A 2EBGA 1TKZA 2DBBA 2MXYA 3JTOA 3DOLB 4KYZA 4MKVA 4DR7F 1CJTB 4HI2A 2J6TA 2DGWA 2FJWA 2ZE2B 3PHTA 1RKIA 4OL8A 1SQGA 2H3EB 4WKYA 3U02A 3E51A 3BKUA 1U1LA 1XK8A 5J1EB 3KHLA 1J5OA 1NSAA 2R8HA 5DGAA 4U95A 1TKZB 2X1BA 3DOMA 1H73A 2IM0A 1IWGA 4HEA9 4EI2A 1KOOA 3JAMY 4JI6J 2J7UA 4HHJA 3EX7B 2W7AA 2B9XA 4ZCIA 4IO1A 2W8KA 3SZ2A 1SL0A 3QAEA 1JB0C 4QZVB 3N0VA 2Q79A 1J5OB 3UQSA 2A1BA 2K3KA 3RYLA 2HNDA 3BDEA 3BEGB 2LP4A 2QL5B 4OZ0A 3L3CA 4LF5J 1KN6A 4PXDA 3G82A 3GPAA 2HRYA 4QIEA 5D4OA 3JQMA 2ASDA 3CJ4A 3W63A 3AOCA 3W3SA 2JDJA 2XSJB 4LFAJ 2KRRA 4JI4F 1RACB 3T1YJ 3ELHA 1WJ9A 3G2XA 1C4AA 3M32B 2BW7A 1S9GA 2FLNA 2FZCB 1RAHB 3H0PA 1UP1A 4Z2XA 2Q1LA 4DZ6A 4L75A 3JSMB 4CO2A 5KFOA 1KNZA 4C9DA 1XJWB 4JI7J 2IA6A 2GHPA 2F7VA 1IN0A 1OY9A 1JNRB 3MPWA 3K5MA 2FVQA 5H9EK 1LWEB 1HKAA 1U25A 5DM6Q 5A0YA 2BYCA 2VU5A 1S9GB 2KHCA 1KD1T 1D09B 1PG5B 2XMWA 4J90A 4H4KC 3TNVA 2XULA 5I3UA 4JUZA 1S1WB 3NXZA 3M8QA 4OLOA 2FHKA 5GAHI 1T3NA 2WW4A 4NRUA 3MWBA 3A12A 1SI9A 2CPYA 1ZZNA 2W25A 4DSKA 1PAUB 4WE1A 2JWNA 5KFWA 5C25B 4MT1A 3W61A 2QT7A 4F0HA 1G1XA 4XDDA 4P73A 3M8QB 4LF8F 4IH7A 3C6UA 3M2UA 1YLXA 2PE8A 5LSRA 2N3LA 1R8CA 2KN4A 3ZTPA 1F9FA 3TUJC 2QLBB 4FNIA 3QO9A 3LOUA 2W2PP 3KFWX 5LT5A 1JLCB 1R7IA 3TUZC 3RR8A 4USTA 4B9MA 5HMXA 1IBLJ 1NMEB 2GVDB 4AYBD 5AXNA 3JYTB 2WVCA 4WCEQ 2V4QA 1FJ7A 2XLJA 2RDJA 1LW2A 5KOXA 5DETA 2JLEA 3OSNA 4IOAQ 2OHDA 2V6AA 1F9EB 2P9CA 4B3TJ 2XI3A 5HK4A 2YKNB 1NKBA 3QWUA 3F73A 4NLWA 2E9RX 3IBWA 3I5AA 3MEEB 4OLPA 3OVAA 3W64A 2YKOA 1LFWA 3SCIE 4ED5A 2B4UA 4DR3F 2HHVA 5AT1B 2K06A 4C3LA 2LQ5A 1U6ZA 4RZRA 2HNYA 2I5JA 1ICEB 3TJ9A 3UDLA 4OZ1A 3QSYB 1PYOB 3NLCA 1BQXA 2GHWA 4OYAA 4R0EA 1SCJB 2XLIA 4EZ6A 1B70B 4DU7A 2X3GA 3C2PA 1VQ7S 2GO9A 5LOQA 5HQMA 3T5KA 4PWDA 2L48A 1SC6A 1N5YA 1IBKF 2HNYB 3N4WA 3KUGA 4NLYA 3BB5A 2JC1A 1QAIA 1KTVA 4C3MA 4K4UA 3C46A 2HBQB 2WCXA 3SI8A 3CCES 1P6TA 4FVMA 3H4DA 3PTWA 5ETOA 4M5MA 2BJ9A 2ZBCA 3ZZUA 2GV1A 3DGPB 5KFEA 3EUNA 1WDTA 4WXWA 4DZDA 2R2TA 4LFBF 5GAEU 4KE5A 2H9ZA 3IM9A 5KFPA 2VBZA 2G1DA 3NNHA 3IRXB 3G8SA 3ICLA 4Q44A 2GO8A 4PQAA 2P9EA 4LF1A 1R8HA 3CCQS 3NMAA 2X51A 1XNQJ 3BJYA 4ZP9A 4AXIA 3TEHB 4MKYA 4B3MF 2RHQB 2UUBJ 3VCDA 4MK7A 3UE2A 3RW7A 4TYAA 1L3KA 1RI7A 1KDNA 2QFIA 4IDKA 4C8LA 3QRQA 1GXLA 1QTMA 3GG1A 3SCKE 3TWZA 5ADZA 1FDAA 4A4JA 4LF4J 3GR1A 1T02A 3QATA 1VRUB 2NZCA 3G8QA 1ZM3A 3HLUA 1UWBB 2OPQA 1SUQA 3OL7A 1K8AT 1NH7A 3PG9A 4IDKB 1SQEA 4NE9C 2EKYA 5IOLA 1FJGF 2DTJA 2BJ8A 3KJQB 5HROA 2ZHAA 3TW0A 3WDOA 1VJQA 2CG4A 2KH9A 2E1AA 4NLQA 3R7NB 1QY7A 3KHRA 3HK2A 1M1HA 5DZ7A 3RRHA 5J2QA 3QIDA 4J9PA 5J1NA 5E3PA 3ET6B 1S5ZA 4N8NA 3IBCB 3DMJA 4F3QA 2AYEA 2MZTA 1VYAA 4Q45A 3CJSA 3KJVB 3ZTRA 1TAUA 3GIJA 5B08A 2ZOFA 3I5CA 5CD4A 2FJAB 3A4TA 2Z56B 1UFWA 4WFAQ 4LJMA 4N41A 2H4YB 4O3SA 4OZNA 5B09A 3K89A 5J2QB 2MDAA 5F41A 2VDIA 5ETPA 3DMJB 2HBZB 2FJXA 4HH1A 4MAKA 2PMZD 1U2CA 2MPUA 4G6VB 3ZC4A 1F5BA 1VC0A 2VQFF 3CVKA 2LDIA 4MTPA 1UJ4A 3KG0A 4K2XA 5DLGA 4PG4A 4ZVGA 4BBYA 5M2RA 4KPCA 4TNOA 3ZNUA 3GFXA 4X64F 2DHXA 1M1GA 1NK0A 4Q7AA 1JKHA 3R5AA 3VWSA 5HN0A 1H98A 1HHQA 5J2PA 5FDLB 3M8PA 1MROA 3DN9A 4HLBA 3BF4A 3MMBB 2QE5A 2QGFB 1DRZA 1KSPA 5HBMA 1FRMA 3GYNA 3P3DA 4I64A 2YWHA 4F7VA 4KR0B 5HVGA 3H5YA 2CPJA 5DS7A 3K17A 3GU0A 2ZD1A 3QNWB 4USJC 1R0AA 1JLBA 4USIA 1U1QA 1L3VA 3NMRA 1RWXB 4HL9A 5E5NA 2KT5A 2CPXA 2KJVA 3M8PB 2YY3A 5EGYA 1V5IB 3H98A 3RBEA 1TK0A 6FDRA 2PT0A 1WC0A 3AQPA 4O0IA 2DISA 2UXDJ 1VQSA 2OFGX 3C15A 3GTYX 4USVA 4RLEA 4DF4A 2ZHOA 3CJ5A 1R0AB 2A2DA 3QGIA 2V63A 2NXUA 2D74B 5E7OB 3LGNA 3S1TA 2LFVA 2CQ3A 2DNQA 4DX7A 3CE8A 4UOHA 5FIIA 2HRUA 1JLAB 5BYSA 2HHHF 3K5OA 1QJHA 2GFFA 4DV0F 1N52B 2XMAA 2YVSA 2GA7A 1MN9A 3GB0A 3RRKA 3ZZYA 2DRDA 2L08A 4YY3J 1RT2B 4QCLA 4NLVA 3LUYA 1VQ6S 2KFNA 5HLFB 3TVYA 3QWPA 4PPDA 1OO0B 4URSA 1RDRA 5CCLA 3R9LA 4LFCJ 2KZMA 3VVUA 1Y5IB 2YKAA 2R7TA 3FSIA 2UUAF 2GS8A 3OPKA 4OHYA 3NBPB 3T1AA 2HAIA 2CDRB 2XY5A 2DR6A 4F26A 3HZEA 2XMUA 1YX2A 2QZ8A 1NJWA 4KPYA 2YX1A 1AXQA 3SEOA 2ADCA 2WOMB 4QIGA 3R2CJ 2Y0SD 3DDNA 4FS1A 1YJTA 1Q8IA 4LUBA 3PX4A 1WC5A 2BJDA 3SYZA 1REGX 2GJ2A 2UP1A 2RB7A 5HP1B 2MJUA 2V5HG 2XC9A 5J1PA 3TZXA 1Q5YA 1N36F 2K8GA 3MM8A 2FUG9 1H38A 2QMXA 3W2VB 3LALA 3MZIA 1ZM4A 3MPUB 2VODA 1S1XA 1N33F 1IR0A 2F8HA 4W90B 2AEFA 5E3RA 1FD2A 3K0JA 4ICLA 1REVB 5L1IA 1O51A 2JH3A 3JXOA 4X4TA 2CJAA 3B6BA 1QD1A 2Q43A 4LQ9A 4TY8A 4P74A 4WIIA 2MJNA 4KC5A 3T6JA 3CGIA 2C2NA 3UNYA 2GCFA 2A6OA 4RW7A 2CQDA 1NLKL 2Y3YA 2AP6A 1RWMB 3PYGA 5E3QA 3DFEA 4DV7J 5G4DA 4C8OA 1R3NA 2HZVA 5LMUF 2V4JA 3W5YA 1OPZA 4F02A 3CJQA 2FLOA 1D0EA 4IOCQ 2BUNA 2XHWA 1ZAVA 1S77D 3G6XA 3PXGa 3L7PA 1HI8A 1WF1A 4OX9J 3OFHA 1HBMA 2E5LJ 3GCXP 4ANDA 3VZHA 2V4JB 1PCAA 3M7VA 5IC4B 3W5XA 2FLPA 5C2CA 4XTTA 2HNZA 1S0MA 3CNQP 1NRKA 3UR3C 4WXOA 3RB0A 1RTDB 5B0DA 2B8PA 5DQHA 3HDSA 3CCSS 3TR5A 3RB6A 2HQDA 3TQ1A 1KVJA 2ZVSA 2ZH4A 3U1LA 5BJRA 4FN5A 3P5TL 2CQ1A 1X5PA 3J7ZT 4IG0B 5T41A 2HNZB 2DY9A 5GAGU 4KFBA 1FD8A 2POKA 1KR4A 2IC3B 3AB4B 4WK1A 1FFWB 3AAWB 1V9OA 3I87A 3M8RA 2MKSA 1FNOA 3N5FA 4ELTA 2IA0A 3CMES 5D0HA 1YHQS 4KO0A 1TK8A 3ISNC 3MGJA 2DNKA 2OFHX 1EETA 2B9WA 4B9SA 4ILLA 5CCMA 3K57A 3I96A 2PFDA 3CO9A 1NSKL 2M5YA 3MR6A 5GADI 5EN1A 4LSLA 3D3BJ 4ED3A 3ILLA 4XO0A 4OQJA 4WBFA 3GZ7A 4EWTA 1HNWF 3KJFB 4ED6A 3FDSA 4O4RA 1HNXJ 3M9OB 3DU5A 2OD6A 1ACMB 3MUMP 2PMHA 1EETB 1SPBP 2XGPA 3BGOP 4NEZA 1UTAA 1X4EA 4C0OC 1FFSB 2VQEF 3PV8A 1J27A 1XIQA 2NQPA 4DUZF 1N34F 3T1HJ 4OHVA 3RBZA 2R8GA 3RRGA 1KOHA 1NM2A 3NOGA 2Z8QA 1IKWB 3BS9A 4LR8A 4RNMA 4JV0A 4L74A 4ED8A 5M2UA 1EHWA 4NLXA 1VHFA 3OFEA 5HMZA 4KHMA 4HYKA 1BWEA 3T3FA 2Y8YA 1HW9A 1SKSA 3BBFA 1KWMA 2O1PA 2UUCJ 1RWOB 4I2QA 4DL5A 4DSEA 1X4BA 4GKKJ 1YRXA 5B0CA 2BOPA 2CJXB 3D9BA 1N5QA 1YJ7A 1EZZB 4LF6F 2AIRB 4YDXA 4ED0A 1T94A 3NS5A 4NLSA 2HKEA 4C8KA 1I51B 1WC6A 2WVBA 3M2RB 5K5MA 1RT4A 3DRSA 2BR0A 3HKZD 4O3QA 3KHGA 1KHWA 2YWWA 1IR1A 4NEYA 3L7UA 1HQEA 1EQMA 1P1TA 2BXJA 1RWNB 2OKQA 2J0WA 2NYIA 3BYRA 2VDHA 1A0OB 1C1CB 2KHDA 4ZOSA 1X4FA 2G2OA 4NX9A 3Q86A 4OI4A 3MEKA 4RX6A 2M0GB 2AEMA 3VTIA 1T03B 3G8TA 2V8VA 3T41A 4QQBA 2FY8A 4PYDA 1HQEB 2W9AA 1CQMA 3O6QA 1RT7A 4LFAF 3TUPA 4JI5J 3T1YF 4LSNA 2DHGA 2ZDPA 4XPEA 3NP5A 2H51B 5GAHU 2GVZB 2HBYB 3D6HB 4MJKA 2KG1A 4UY8T 3FEYB 5IT9U 2RF2B 3H2LA 3HD1A 1YIJS 4JI7F 3ENQA 3NGTA 2XLKA 1RT7B 4A8FA 5GVQA 1TL1A 4C2MA 3MD3A 4TVAB 5L9XA 5A6WA 2ABYA 2J5AA 2MZSA 3HVAA 2F1FA 3Q2TC 1AB8A 4F3MA 3LP0B 5DM7Q 4JYAF 4DV4J 1TL1B 4U7UK 3DRRA 3JQJA 1FDDA 3UD3P 2HIQA 3UD4P 4CO4A 2B3TB 2XB2D 2C2RA 3H7HB 3C8YA 2OPSA 3UD5A 4JV2A 5C7PA 1FE0A 4MIAA 4DQQA 4DR1J 4Q8EA 3I31A 4PUOA 2HAFA 4ZVHA 5HQ8A 3DRRB 4F4YA 4AQYJ 2L9NA 3DRXA 1S48A 1BC6A 1JJHA 3T6BA 4PWUA 2BANA 2YNHB 4U96A 3CT9A 3HJFA 4NA3A 3CJTA 1NJYA 4XK8C 3VVTA 4WFYA 2DXEA 1IBLF 5HMWA 3IXQA 1ZS6A 4PKDB 2HWHA 1KQKA 3HHLA 4ZP7A 2JEIA 3NNAA 1H6KX 1D9AA 4Y2IA 1F5CA 2BANB 3D5MA 4TN2A 2M70A 3BGRB 8AT1B 3B8HA 3WIUA 2U2FA 3AODA 2C28A 3SV4A 1EP4A 3J80U 1HHSA 3G6YA 4JV1A 2JNJA 3HZGA 4B3TF 3OLAA 4B3OA 1S6QA 2DH7A 2FDNA 3LGHA 4CT8A 4AUKA 3GFHA 3M6XA 3U7JA 2MKYA 1OYDA 3LP1A 4HHHA 3HHLB 1YITS 2UVUA 1FRXA 4DXLA 5G0RB 4U8YA 2ZEJA 2CQCA 2OPPB 1SQFA 4QWBA 1I1GA 3EVWA 1FKOB 3QYYA 2W9BB 2LEAA 1FRLA 1YBTA 3R1LA 4NRTA 2R2RA 1K9MT 1Z1ZA 4B3OB 4YR0A 1S6QB 4KT0C 4NI2A 2OP5A 4UZBA 3R3TA 3KLHB 1NEEA 4CDIA 3LP1B 4DV6J 3VGVA 3V6KA 1TKDA 4ED2A 1X4GA 1U2RA 4YN3B 2MZ1A 4DPOA 4A8MP 2IDEA 5KFZA 3Q89A 3D3CJ 5IC6B 2QL9B 4A8XA 4DPUA 2ZITA 3JTNA 5DDRC 1N0UA 4OYZA 4NI2B 4RW4B 2W2OP 2J0SD 3ENVA 3J7A1 4PCQA 2PSZA 1VBXA 4X62F 3GYXB 3SQGA 1F60B 1TELA 4ZVOB 4FYVB 3V6DB 4ECSA 2RS8A 3AB2B 3HSZA 4OJHA 2BKOA 1C0TB 2RRNA 2R7WA 3A8EA 1X31C 3RG6A 5IM0B 1GEHA 3A8KA 3Q8SB 1UW4A 4EU0A 4DG1B 3HD2A 4ZPCA 1XBWA 1LW0A 1FERA 3OR1A 1FVSA 2VBYA 3GQCA 1Y5LB 2UXBJ 2M8DB 2R7XA 3D6TB 4ZCMA 4ES3A 2UUWA 3VGUA 2KM8B 2HFZA 3OFFA 5BYRA 4MFBA 2AJ1A 5DG7A 2E1PA 1JX4A 3MD1A 2IVFB 1XNQF 3Q8RB 5CH7B 1RBLA 1HQUA 1CULA 1WELA 4H54A 3IAS9 2UUBF 2VOOA 1S1UA 2XO7A 2HQ3A 3FCHA 5FJ4A 3PW5A 3BKTA 3ILIA 4DFMA 2VG5B 5MAOA 4ELVA 5LM7E 4ZITA 3DRPA 4F4AA 3DI6A 2ROEA 4WP9A 2DEJA 1Y3KA 4EFAC 5CYJA 4LF4F 2M3DA 3FSXA 1HQUB 4OYPA 1CPZA 4NASA 3UO0A 3CTRA 1UFKA 3OTBA 3VAKA 4NLOA 2GC8A 2E7VA 2G13A 3MMAB 2Z0GA 4NXMF 2Q6CA 3QFWA 2YH0A 1H74A 1QLNA 1HMVB 3C14B 1WKKA 4QWCA 4DPTA 3MECB 3KLFA 2P8IA 4W92B 1RT5A 5AE3A 5K9FA 1EKRA 5HJYA 5KFHA 2A18A 1RAGB 3GMGA 4PRFA 4ITSA 3MFHA 1AW0A 3M1VB 4DF8A 3J7Z5 3R2DJ 4U7UD 4LIWA 2I2YA 4ALZA 2DO4A 3DKDA 4DU8A 4J9OA 2AJ2A 3T5LA 3LTOA 2R7RA 3F44A 2C3MA 3AD7C 2B4PA 5KG3A 1X9MA 4MKBA 3VGSA 3T9ZA 4CLSA 2ATCB 1K1QA 2VA3A 5D4NA 1FKPA 1UPPA 3IAM9 4QR1A 2QV6A 5KFDA 1VQ5S 3CB4A 4NCAA 5D3GA 1VQ9S 1MMDA 4DR2J 1NB2A 3F0NA 3TVZA 1NPKA 1FKPB 1YJWS 1FK9A 2RSQA 4HDHA 1UZHA 5GMEA 2N4DA 2P2CB 1IKXA 1T9WA 3TARA 5DDPC 2IJRA 5AJ3J 3JAMU 4IO9Q 2NXJA 4DSIA 1VIXA 1BY9A 5E3CA 5H9FK 3MXHP 2VKZG 2HVIA 2XS7A 4HKQA 4DL3A 3BH7B 1FK9B 4CWBA 1XMOF 4LVOP 1DTQA 3RAQA 3UN2A 4OIXA 3AH6A 3ZZ0A 2GIRA 1O6XA 4C0BA 2YWKA 4GRSA 4K4VA 2Q3PA 3TANA 1WEYA 3MFIA 4MIBA 1VJWA 4NLRA 3BSNA 1K73T 2UXDF 2CJQA 2EW9A 2DKOB 1EB0A 2FVPA 2EC0A 1NDKA 4YP3A 2FQQB 1G6BA 3BDPA 4DLEA 4RUCA 4PG5A 2YKMB 1IKVB 2W01A 3G71S 3CCTA 1EAYC 1SJ1A 4URQU 4K50A 1FFGB 3D0IE 3RZAA 3BH6B 2NUHA 4IFVB 4RUBA 2RE1A 5ETLA 4LF2A 2G0CA 2ZJRQ 2LLZA 4G1IA 2X7IA 4YY3F 2V67A 4FKYA 2ZH7A 3C66A 1JJ4A 2PO4A 3CDBA 4LFCF 4M5DB 5ETKA 4CLTA 1IVZA 5KT4A 4I68A 3J7YI 3MTKA 3VAHA 3PKYA 4AL5A 4RO0A 3S8SA 1FDNA 1WSRA 3LPYA 2P5VA 1FWPA 2FJBB 4OZ2A 2L3MA 4V1Ak 4UY85 4DN0A 3I55S 4DHVA 5AXLA 2Z2MA 1KRPA 3V4IB 2PA3A 3MR2A 2UXCJ 5BR8J 2KXHA 1QSYA 2VPXB 2EK6A 2R42A 4MH8A 4OZLA 1K0VA 5KFKA 3PX6A 1Q7YT 2WZ1A 1V3RA 3G6VA 2P9GA 1NK8A 4Y2KA 3OD2A 3FRZA 3KHHA 5E41A 3CC4S 3VQSA 3Q8UA 2EK1A 2ERRA 2MEWA 2ZH8A 4I7FB 4FS2A 4DV5F 4HACA 3HULA 4KBIA 3AHPA 2CQBA 3U27A 4X4NA 3CJKA 2IVMA 1NKCA 1X4CA 2WBMA 1TVRB 4DBQA 4CLYA 3OVBA 2EFVA 4IR1A 1WACA 4WYWA 2AJ4A 1RT3B 3TYTA 1LKZA 3X1LB 1H0HB 1RWWB 1HBUA 3OQ2A 1U26A 2ZH3A 2FHJA 3IG1A 4HACB 4I6YA 3I9V9 3CJKB 2V34A 2VFTA 2DHAA 3TRGA 1VBZA 1SV5B 4J9UE 4WTOB 1KP6A 3QJLA 5DDOC 4DV7F 3IG1B 3FBFA 4DMZA 1WG5A 1U6BA 4OI2A 4DQSA 2EFNA 8RUCA 1B3TA 2ZBQA 1ZTTA 3HPOA 1BQMA 3G4SS 2YX4A 3VALA 2WSFC 1PO6A 3MPVA 2CPDA 4OX9F 4RBVA 2E5LF 3K8VA 1VOMA 2DR9A 2W24A 2EFQA 2EFOA 1QE1A 1YRTA 4OYMA 2PC6A 1ZAXA 2DNRA 4NA2A 1RSCA 1N8RT 4QW8A 1BQMB 2O66A 1U1MA 2CJBA 4B08A 1PIEA 4NOHA 1GXUA 3C19A 2F5GA 2L9WA 3MMCA 3CCJS 3MAAA 6FD1A 4H4KA 4AD6A 4P2XA 4ECZA 1WTBA 1NXIA 5GADU 1YRUA 2XMKA 4Z7CA 3AXKA 4I1TA 2MQPA 5DJBA 7AT1B 3EXCX 1NK7A 2ACMA 3B78A 2FZKB 1SVDA 3MUTP 1DQ8A 1IR2A 2SXLA 5JJBA 1JLEB 2CVEA 2CFXA 3MMCB 3O2IA 2C2OB 1DBDA 1BQNA 2YNIA 3M6WA 2HGNA 5C42A 2OGUA 3BKFA 4BWMA 1ZM2A 1VRQC 1WWHA 4B9VA 2E5IA 4RKUC 2UUTA 4USHA 1RQ0A 5C24A 1VK3A 3C6TB 1WI6A 1TUGB 4A8KA 3WX4A 5KTQA 4LF7J 1WKLA 2R8IA 3CJRA 1X8DA 3N6LA 4K2JA 4R25A 1HNXF 1UJ6A 2QEXS 1VQNS 1JLFB 4ZJOA 1JXLA 3N6NA 3ITHA 4D3HA 1Q5VA 2DNLA 1XR5A 2DGSA 4I4BA 3GJTB 2QG9B 5CD4H 4QPXA 4A8SA 3T1HF 1WUUA 3GJSB 1NKEA 4BWJA 1RTIA 2KVQE 4WZMA 3CCVS 1UA0A 4C7QA 1RUSA 2ZBPA 2VBXA 4IH6A 4CT9A 4CH0S 1VQKS 3ITHB 1XMQJ 2HHSA 4FYDA 1JIHA 1MNEA 3TJAA 2DITA 3SDEA 1N88A 4KHPJ 2UU9F 2J6UA 5F0WA 3SMZA 2B5JB 4RBUA 4GKKF 4ECXA 4R0JA 4ERDA 3GP9A 2FD2A 4OHZA 4A48A 5K20B 1WF2A 2NXNA 5GMKa 2IYGA 1XTZA 2AYGA 2YQ0A 1Y9OA 3AJ2A 3QLHA 4DV1F 4OI3A 2WTFA 1DTTB 3K2YA 2KXNB 2XYHB 2BM1A 5I42B 4ZPBA 2HWTA 2HK3A 3ENAA 1S49A 2J8SA 2NREA 3DCAA
chains in the Genus database with same CATH topology
5IT0A 2DISA 1KFDA 2QSWA 1VQSA 2OFGX 2VFSA 1F5AA 4WF9Q 3PIOQ 4RLEA 4DF4A 2ZH2A 2HYIB 2RF2A 1IKXB 2D1CA 4DOZA 1HWLA 3MAHA 4JBCA 4NYOA 4WFNQ 4IYQA 1IKYA 3I32A 3QGGA 4CIOA 3Q24A 2ZHOA 1TKXA 3CJ5A 1R0AB 4DR2F 3QLHB 2B0GA 2V94A 2A2DA 2GX8A 1UVJA 3PEHA 2B43A 2OO4A 2ZOMA 4YB5A 1OIAA 2ASLA 3QGIA 2DVIA 2HHWA 3KLGB 2NXUA 2IRXA 2D74B 5E7OB 3H5UA 3LGNA 3S1TA 2MQMA 3DLKB 4TQSA 2IM1A 4QYRA 2LXFA 5KT3A 2OAUA 2CQ3A 2DNQA 4AFFA 3CPWR 4DQRA 3HHNB 3CE8A 5FIIA 2GQCA 2HRUA 1YI2S 4CO0A 1JLAB 4Y2CA 1S99A 5BYSA 3J81Y 4MMOA 3H25A 2HHHF 3K5OA 1SH0A 1QJHA 5AJ3F 2GFFA 5KG2A 1N52B 4DV0F 1VQ8S 2YVSA 3K7RA 2V4RA 5F8GA 4WK3A 2AJFE 4DLGA 3O44A 2GA7A 3CJ3A 2AX1A 2LQBA 4JI0F 2HS3A 4QIWD 3ULHA 1DTQB 4BC9A 4WYLA 5A0YB 5KG5A 1S4FA 3GB0A 3RRKA 3ZZYA 4ECWA 2DD8S 4ES1A 3LP0A 2L08A 1RT2B 4RW8B 4NLVA 4QCLA 4QJVA 1LXNA 4DSJA 4DR6F 1HR0F 1FJEB 2XI2A 3LH2S 3LUYA 5FLXY 2QMWA 1VQ6S 1UVNA 2KFNA 3OTOF 2M8HA 5KFVA 2MZRA 4EUVA 5I3UB 5HLFB 3GV5B 3E8OA 4JI5F 3TVYA 3QWPA 4PPDA 4M8LA 4GC6A 1S79A 2C2DA 3BSOA 1SJ3P 2KTQA 1OO0B 1JK9B 4TKTA 4URSA 1QUPA 3DLGA 5AXMA 2I9SA 4F3OA 1S72S 2VFVA 1RDRA 3BGUA 5CCLA 4O4GA 4NCBA 1S9FA 1B0PA 2KZMA 5IS2A 5LMNF 4IRCA 1Y5IB 1QM9A 5IT4A 3KG4A 2YKAA 3PR4A 1GQEA 4DS4A 1YJNS 3CCRS 2R7TA 3ENWA 2V2KA 3FSIA 3WBZA 1VS3A 4JV5F 4G1QA 3M2VA 1R8BA 2UUAF 2R8KA 2XY6A 3MM9A 2IMWP 4QPTA 3OPKA 2ALZA 4OHYA 3NBPB 4EYHB 2MQQA 4NLTA 4WE1B 3T1AA 2HAIA 1TUVA 2XY5A 2AGPA 4NCGA 3K59A 4F26A 1J2VA 1GNKA 1Y3JA 3OL8A 3HZEA 4IG3A 2XMUA 5T7LA 3HKWA 1U47A 1DURA 1LK7A 1VRTA 1KONA 2QZ8A 3WZ0A 2DIUA 3J80Y 1S0VA 1CQNA 3BO2A 4O23A 5EWEA 3SV3A 2CYYA 4A8QA 2DO0A 3DLGB 3PVXA 1NJWA 4KPYA 1TL4A 2YNHA 3ZZRA 2YX1A 5AXKA 2GIQA 1HBOA 4O4GB 4LMZA 4RNFA 1AXQA 3SEOA 3H40A 2ADCA 5K8MA 2VH7A 3C6UB 3M2UB 2WOMB 4B9UA 2KRBA 4QIGA 1FKAF 2Y0SD 3DDNA 1RT6A 4IRDA 4CNZA 3M2VB 4FS1A 5D78A 1YJTA 4CNYA 2NSBA 3TI0A 2NSCA 3QO9B 3OHBA 2VPYB 4H4OA 1NNDA 3NGKA 1Q8IA 2ZH6A 3LW5C 4LUBA 4NCGB 3PX4A 3OTCA 4C8ZA 5KFBA 3KLEA 2GMJA 4DV4F 4DR4F 4IG3B 2BJDA 1NZAA 2CVIA 3SYZA 2VPWB 5IQQA 1VRTB 2YNFA 1QSSA 3R5CA 4DQIA 4NMLA 2GJ2A 3M05A 1O5JA 2UP1A 2K7JA 2RB7A 3BGRA 1R27B 5HP1B 1HBOB 3IWLA 2MJUA 4OI6A 4CO1A 3H59A 1L3SA 5KFLA 2V5HG 3BQ1A 2XC9A 3UCGA 5J1PA 3EGZA 2LMIA 2YQ3A 2LECA 1FA0A 1FVQA 3BQ2A 2XGQA 3QIPB 1N36F 2K8GA 3MM8A 1RISA 2FUG9 1LW2B 2RVJA 1S9EA 2BRLA 1CC8A 1H38A 1D8YA 1WI8A 2QMXA 3LALA 3W2VB 3MHYA 1QAYA 3LP2A 4DR1F 1D9DA 2VOPA 4PQUA 3MZIA 1DAXA 1VQOS 2JFDA 2AV5A 1ZM4A 3FMWA 1V3ZA 4AQYF 2C3YA 2AYBA 5F8LA 2VODA 1S1XA 1N33F 2HPUA 1IR0A 2F8HA 4DFKA 3IGNA 3H20A 3PW2A 4W90B 1SB6A 5G0RA 4CH1A 4RU2A 3A1YG 2CZ4A 5E3RA 2OSRA 2HFOA 2DGXA 2DGOA 5IXUA 2OPPA 1FD2A 2EBEA 4ICLA 3K0JA 2D7SA 2YNGA 3SCJE 1REVB 3CWJA 3PNIA 3RBDA 5L1IA 1O51A 3MI7X 1FKOA 3GG0A 2W9BA 2JH3A 1P8GA 2J9EA 3CEDA 1WHXA 2D3ZA 3NNCA 3CMAS 2HHPA 5A2QY 2J6SA 3CIZA 3M6UA 5DQIA 1IBMF 2ILZA 3KOAA 3MEGA 2IM2A 4X4TA 1Q8LA 3NL0A 1VFJA 3V5RA 5D4PA 3KLHA 2CJAA 1D9FA 1C2PA 4J9MA 3QZ8A 3LP2B 4PQUB 2Q43A 4LQ9A 1VLYA 4TY8A 2R9LA 4KJIA 4WIIA 2J7KA 2CPEA 2MJNA 2IBOA 1JLGB 4KC5A 4F2RA 1ZYQA 3T9NA 1FRKA 1FO1A 4YB6A 5K8NA 5B0AA 3T6JA 2O01C 3CGIA 4C4WA 2D9OA 2D9PA 2I5JB 2DIVA 2UXCF 2MGZA 3E01A 4K4UA 4PG7A 4GKJF 2HGMA 5KFQA 1JWWA 1NU4A 2GCFA 3OSPA 4RW7A 2RH3A 4ZS6A 2CQDA 1HHTP 2P6TA 3BN7A 2AP6A 2KO1A 3AJ1A 4X65F 5JVGQ 3TX8A 3THTA 5E3QA 3DFEA 4L6V3 5G4DA 2E1RA 1B0TA 4C8OA 1XEZA 2F9DA 5A8KB 1R3NA 2Q6BA 3CD0A 2IYIA 3HMJG 4RW4A 3DXBA 3KK2A 2M2BA 5LMUF 4K4TA 2V4JA 3OR2A 3MAQA 2FC9A 3PO5A 2XNRA 1OPZA 4F02A 1LQ9A 2WB1D 1AFJA 4PWDB 2FLOA 1FF2A 1NJIT 3G96A 1N5YB 2WSCC 3PM9A 2ADBA 4TU9A 1FNMA 2MGZB 2M4MA 1D0EA 2J9DE 2C3PA 4IOCQ 2BUNA 4QBUA 3DYAA 2XHWA 3CCZA 3K58A 1ZAVA 2K1RA 4N56A 3V6DA 1S77D 4TU7A 3G6XA 3PXGa 3L7PA 1RT1B 2JJ4D 2HGLA 2RQ4A 3DLJA 1HI8A 1WF1A 2MHEA 3IN5A 1C0TA 3CD7A 3OFHA 1L3UA 1HBUB 1HBMA 1OS5A 3DM2A 2VZ9A 2C22A 1VBYA 1HNVB 1MWYA 2VBWA 5IM0A 5T14A 4RW6A 4PR6A 1HD1A 4DG1A 3KK2B 1NK5A 3TA1A 1H7XA 4B9TA 3VZHA 2R7QA 2V4JB 2QA1A 5DLFA 1H3DA 1Y4ZB 4WTYA 5BYQA 1VC6A 1TK5A 4DJBA 4ZMMA 5C5JA 5JUMA 5GAEI 4YDDB 1C0UA 2E7WA 2BVZA 3KK1A 2FLPA 2V0NA 2CDQA 4DX8H 2LVWA 2EWHA 3R5DA 2HNZA 3D1OA 1S0MA 3UR3C 1NRKA 4K4WA 4IUFA 4WXOA 4ZPVR 3RB0A 4C8YA 2O67A 2K1RB 1RTDB 5B0DA 3N9UC 2GMHA 5DQHA 3HDSA 4HDGA 2IAJA 3VAFA 2HHXA 5H9FJ 2IHR1 1N6QB 3FZBA 5F3ZA 3CCSS 3UDCA 2XEXA 1XMBA 1C1BA 3TR5A 5H9EJ 3IR6B 3RB6A 1KS2A 3TQ1A 4N77A 1WHWA 5J2MA 5CHCB 3KG1A 2DCLA 2X1FA 2ZVSA 1KVJA 2ZH4A 3SFGA 1V6HA 2J0XA 5EX0A 3U1LA 4QR2A 5BJRA 1TL5A 1R8AA 1X4DA 2ZJPQ 2R7SA 4FN5A 5B0FA 3P5TL 2CQ1A 4FBUA 3D1HA 1X5PA 3PW7A 1C0UB 3J7ZT 3MDFA 4IG0B 4FXDA 4RUHA 4JOUA 3I82A 1FRHA 1LFPA 4Y34A 5T41A 2HNZB 3CUNA 1Y5NB 4KFBA 5GAGU 1FD8A 2QO3A 1NH8A 2QYCA 2CQGA 3RAXA 4FF1A 1JLQA 2L9DA 2POKA 2VG5A 1KR4A 2IC3B 4KRWA 5THWA 2IAJB 2XMMA 4RWXA 3T19A 3PRBA 4DEZA 1TKTA 3AB4B 5KG1A 2N4CA 4NZ0A 1AFIA 4WK1A 1C1BB 1GT8A 4Y00A 1WEXA 3H5XA 3AAWB 1V9OA 4K4SA 3MMJA 3I87A 3M8RA 2MHNA 2MKSA 1FNOA 5F8IA 3N5FA 4ELTA 4WU2A 2BW2A 2IJNA 2IA0A 1GXTA 1H2TZ 2GJIA 5KG7A 3IRWP 3KLIA 2Z4PA 3THVA 2DR8A 4M94A 1QSLA 5LL6d 1R43A 2WB4A 1YJRA 1UEUA 4C11B 2QRRA 3CMES 5F3TA 4ZHRA 1QE1B 3JTPA 3KNAA 1G2EA 4ECQA 3MM6A 2UXBF 1DZ5A 1YHQS 5DG8A 4WKRA 2UVWA 1S97A 3PRDA 5H1SV 2RU3A 4KO0A 3MMAA 4DFJA 1TK8A 3L7OA 2JC0A 3ISNC 3MGJA 2QA4G 2HMIB 4I56A 3BO4A 2DNKA 2GGPA 4M95A 4GMKA 2OFHX 1EETA 4ELUA 3KK3B 2B9WA 2NPIA 4KKOB 4ZA1A 4B9SA 4ILLA 5CCMA 2KJWA 1IXKA 1TKTB 3NRBA 1HMVA 3K57A 2FC8A 3I96A 4BC7A 3CO9A 3PIPQ 2M5YA 3Q8PB 3MR6A 1SKWA 1HW8A 3MECA 1N5VA 2VPZB 5GADI 5EN1A 3DOLA 4LSLA 3HHLC 1N4LA 2OPQB 1SUQB 3RU0A 2I0XA 4ED3A 4DFPA 1NK6A 4KV8B 3CD5A 2DPIA 1N0VC 1Q7LB 4XO0A 1SBRA 4OQJA 1RAJA 1RYSA 3EZ5A 3MM6B 1TZ0A 5IZHA 2W4PA 3GZ7A 2ZE2A 2B4OA 4EO6A 4EWTA 1HNWF 4ED6A 2H5EA 3FDSA 4O4RA 5KFAA 1M5OC 3CD6S 1YG0A 2EG1A 3M9OB 4R8UB 3DU5A 2FB0A 4ECTA 2YWGA 2OD6A 3M1VA 5HROB 1WG1A 3MUMP 2PMHA 1EETB 4A46A 2XGPA 1OPIA 2M52A 4R5PA 2CQPA 4C0OC 1X4EA 4J9NA 5I4MA 3PHEA 2VQEF 1M5KC 4IOBA 4OI1A 3PV8A 1NHVA 1L5UA 2F8EX 1ZTWA 3HVTB 1UEVA 2CQ2A 1B64A 1CEZA 3LO3A 2NQPA 4DUZF 4WFZA 2FPHX 5KG6A 1N34F 5CYMA 4F4WA 4OHVA 4UQTA 5KFGA 4X4UA 2UVRA 2R8GA 5L8RC 1XR6A 5EHHA 1D3WA 2MKCA 3RRGA 1BQNB 2YNIB 1TAQA 4N8OA 4NA1A 2CJKA 1KOHA 2ACYA 2DHSA 3P96A 4CTAA 4Z37A 2OTLS 1NO8A 2MZQA 5C42B 2E1MC 1HWIA 2Z8QA 1IKWB 3PR5B 2ZNYA 3BS9A 2EPIA 1S1VB 4ZCKA 1PILA 3GE9A 4RNMA 4JV0A 2MKJA 2MQLA 3U1MA 4ED8A 3M30A 4NLXA 5M2UA 1VHFA 1FEEA 2LU2A 3OFEA 4LQ3A 5HMZA 4KHMA 4HYKA 4E0DA 5KT5A 1BWEA 5C24B 3T3FA 1CVJA 4RBTA 2JX2A 4TU8A 1IQZA 1HW9A 1ZOTA 3QGPA 1SKSA 1S6PA 1NK9A 3MURP 2PN6A 2OMLA 3EPIA 5E2QA 2O1PA 5K8OA 2J9DA 3RR7A 2BBEA 3GIIA 1W25A 4I2QA 3CJ2A 4DL5A 1VC5A 1SJQA 2C3OA 4DSEA 1X4BA 1YQHA 2WONA 4MYUA 3M9NB 3MR3A 3FMBA 1YRXA 5B0CA 4CTAB 2BOPA 3OL9A 1FNXH 4ECUA 2DJWA 2Y1RI 4BHQA 2MSTA 1N5QA 3PX0A 4K5SA 4O44B 2HG4A 5MLCV 3M30B 3ZZPA 4NYPA 5KT6A 4LF7F 3M4XA 3CDEA 4KGMA 4O3OA 4EYIB 4LF6F 4TXSA 4OJ3A 4AL6A 2XSJA 4ED7A 4F2SA 4YDXA 3QJJA 3N5BA 1XERA 3PJWA 4ED0A 1T94A 1J5EF 3NS5A 1FJCA 2ZOGA 1YJVA 3MM5A 4NLSA 2ZZNA 3O8WA 1I6JA 1FESA 4C8KA 3M2RB 4O3RA 2FJDB 1ZPWX 2JOQA 2AYMA 1PC4A 5IT9Y 1RTIB 2DH9A 5K5MA 4U7CA 3M32A 1RT4A 1UKUA 3DRSA 2ZH5A 1OSCA 2WONB 3LAKA 2COLA 2BR0A 1K1SA 5F8MA 1HA1A 2UV8A 2KM8C 3HKZD 4O3QA 2X1AA 4F67A 3NAIA 3KHGA 1YGYA 4Q2LA 1KHWA 3THPA 1RTHA 3JSMA 1PSDA 5CXTA 1JKHB 2AW0A 2RRAA 4CH7A 4X84A 2PDAA 1H2VZ 2AJQA 1HQEA 3QAUA 3DC2A 4K59A 1W2IA 3ISND 1P1TA 2VFUA 3FVYA 1VMBA 1Y0HA 4ZLPA 2BXJA 1RK8A 2OKQA 3QPIA 2HS0A 3RAMA 5I3PA 2J0WA 2JZ5A 5J2PB 2LA6A 3BSCA 2NYIA 4KTQA 1HFEL 3SDEB 3FZ2A 3X3UA 2E44A 1LWEA 4ZVFA 1C1CB 5EX3A 2PFFB 2KHDA 1MROB 4KSEB 4ZOSA 3SSRA 4DL6A 1X4FA 3HHLD 4NX9A 4I67A 1WTFA 5L1LA 2F8MA 4OI4A 1ROFA