2UXCJ

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 2uxcJ00
2UXDJ 4V1Ak 1FJGJ 4JI7J 1XMQJ 4HHUA 4JYAJ 3J7AN 5LM7E 4DR5J 3OTOJ 4AQYJ 4B3RJ 4X65J 1XMOJ 2MQ8A 4B3SJ 1N32J 4B3MJ 3R2DJ 2ZM6J 2KVQE 4LF9J 4JV5J 4LFBJ 4LF6J 4LF4J 4DV5J 1HNWJ 3R2CJ 2F4VJ 4KY3A 4GKKJ 4DV1J 4GKJJ 4JI8J 2UXCJ 4X64J 4X62J 4KHPJ 1XNRJ 4JI1J 5IT9U 2HHHJ 1IBLJ 4PWWA 2UUAJ 4DR2J 1I94J 4DV7J 4DV3J 1N33J 3T1HJ 4NEYA 1IBKJ 3D3CJ 4DR3J 1J5EJ 4LFCJ 1HNXJ 3D3BJ 4DR1J 4NXNJ 4JI5J 4JI6J 2VQFJ 4RJVA 4LF5J 1HNZJ 5LMUJ 4LFAJ 5LMNJ 5BR8J 4YY3J 4DR4J 4K0KJ 1HR0J 2UUBJ 2MEWA 4DUYJ 3JAMU 2KL8A 1N34J 4DUZJ 3T1YJ 2UU9J 4KYZA 4NXMJ 1XNQJ 4NEZA 1IBMJ 2UXBJ 4DR7J 4JI4J 4DV6J 4LF8J 3IMQJ 4JI2J 2E5LJ 4LF7J 2UUCJ 3J80U 2VQEJ 3W1YC 5A2QU 5IWAJ 4YHHJ 4OX9J 4JI0J 4DR6J 5FLXU 4DV0J 2MTLA 5AJ3J 4DV4J 4JI3J 4DV2J 3J81U 4B3TJ 4X66J 1N36J
chains in the Genus database with same CATH superfamily
2YNIA 2RF2A 2YPYA 5A6PA 3JTNA 4QYZK 1K1SA 4FPRA 2XEXA 3HZEA 3DDKA 3LO3A 4LQ3A 8ATCB 4RW6A 4HACB 4OLPA 5B09A 3PEHA 5A8KB 3KOAA 2P8IA 4USJC 1LFPA 3PNIA 3OJSA 5AJ3F 2QJ3A 1S0NA 2UXCJ 4NLYA 1ZPWX 1Y5NB 4F02A 2IRYA 2MJNA 3DXSX 2YKAA 2R2RA 3GB0A 4LBHA 1Q95G 4X4OA 4IUFA 1ZAWA 4I7FA 4DPTA 1MMNA 3TARA 1S0MA 3JYTA 3OR1B 1HWLA 4DUYJ 4LRBA 2PC6A 3MM5A 2MQLA 3BGRA 1TTHB 4LBPA 1FRKA 2YKNB 4FS2A 4MK8A 2V2QA 1RTJB 5A8WB 1D9FA 4LSLB 2B6AA 3WIVA 4CYUB 3D7SB 3R6LB 2G9OA 5AXKA 3V6JA 3HMJG 2RRBA 4Y3CA 4KR0B 1NSKL 3R5AA 5L8RC 1Q5YA 1UW9A 1SQEA 2KYZA 1N0UA 1SJFA 2J0QD 3SSSA 2EKYA 3CUNA 4Q0BB 1VBKA 3IAM9 5B0AA 1KHWA 2HLUA 1QAIA 1URNA 2BQUA 3IBCB 2AJQA 4K2XA 2CPXA 4DV7J 1WTFA 1XC9A 3H98A 3U27A 1MLAA 2GNKA 5IOLA 1XR7A 3LA0A 2V67A 3RRKA 1SKWA 2H54B 3MEGA 4Y2IA 2OPRB 4OX6A 2BRLA 4CWBA 4DPUA 3I82A 5KFAA 1QTMA 3FKBA 1FX4A 5KG2A 3ADAC 1J5EF 4ELTA 3DKDA 1MG7A 2MZSA 3PFOA 2HFVA 3KMQA 3JSBA 4ILRA 3I4HX 2B9EA 4F04B 5HL7Q 2NCKL 5K5MA 1RT3A 4UUXA 4WKRA 2FUG9 1HW9A 2KFNA 3Q83A 3O3LA 2AF6A 3PFEA 2QSFA 1NSAA 2EPIA 5CZVA 1FK9B 3QT7A 4DLGA 4J9QA 3HP6A 2OPPA 4DV4F 1CC7A 3C16A 4C7QA 3CEDA 5GAEU 1HBNB 1CS4B 3NNAA 2CQ3A 3CJKB 3D4JA 1BWVA 1IBKJ 1X9SA 4TY8A 4YMEA 2P9EA 2MHNA 3M8YA 3SQGB 2FLNA 2HNYA 1Q79A 4P6QA 3W2WB 4OJ3A 3CC2S 2FJEB 3NNCA 1Q7LB 2ZDPA 4O44A 1NH7A 4ZJQA 4GVBB 1NDPA 5A2QU 3E8OA 2E7XA 1FF2A 2OLWA 2G1DA 1YZ6A 4ECQA 2DT9A 4K8RA 1M90T 1XMBA 1J5OA 1UEKA 3KLEB 4F3MA 2QA1A 3MHYA 1K0VA 4Y2MA 4IO9Q 4KE5A 3LOUA 5CZXA 3EZUA 1ZZNA 1SC1B 4OI0A 2WONA 1YBTA 3D28A 1SH0A 4X62J 4ZS6A 1N36F 4IR1A 4J91A 2KB2A 1FRIA 2V8DA 4ERDA 5ETKA 1AUSL 2W4CA 2I6WA 5K8MA 2PA8D 3VZHA 3T5LA 2CPDA 5HMZA 1AFIA 2GC8A 3C2PA 2HHXA 3OD2A 2DNOA 1C1BA 5HQMA 4YB6A 4F7VA 1NHUA 3C66A 4RW9A 3TOQA 2C3YA 2XMTA 3IFEA 1N5YB 4K2JA 1SH3A 2HFOA 3FSYA 1JLBB 5DDPC 4QWBA 1YTYA 3CTRA 5HP1A 1NNDA 2K1RB 1YIJS 2VJVA 5KG0A 2PE8A 2WW8A 2ZH5A 4J9PA 1RBOB 1Y7PA 3GIIA 5FDLB 2R7VA 5HQLA 1UL3A 4DR7F 3OTOJ 2G0JA 2Y8YA 4I56A 1OWXA 2M8HA 2HHTA 4FYYB 1RHUB 1U2FA 2D1CA 4X64J 4EO6A 1NB7A 5CD4H 3BQ1A 1KR4A 4YS2A 4K7QA 2PFDA 4PCQA 3H40A 4DR3J 5DG7A 4BS2A 2DR6A 4UQTA 2V63A 5KFLA 1RHMB 1RHRB 4A8OA 2BDPA 3UNYA 1U1PA 2JOQA 4ZP6A 2UUBJ 3MM6B 2R7OA 5CH7B 4PUOA 4ZVHA 4NCBA 4OX8A 3T1YJ 3NGRA 2VF3A 2CDRB 1VIXA 4DR1F 1KLMB 2YKMB 3CB4A 4URSA 3VV2B 4LJMA 3LUYA 4ED1A 1FJCA 1S6QA 5BXIA 2GHWA 1RWUA 3SYZA 1HNIB 3W8GA 1NJIT 4C98A 4TU7A 2AD9A 1OYDA 1JLAB 3HHLA 5AE2A 1M0SA 4JV5J 1CC8A 1ZAXA 3ULHA 2MKYA 1FWPA 2EKNA 2LLZA 3WX4A 1AZSA 5DDQC 2CVIA 1I94J 2QV6A 3M9OB 4RU9A 1AA1B 2YWHA 2CJ9A 4LUBA 3OQ2A 4RWXA 3OHAA 3IWXA 1WC1A 5C42A 3U1LA 4ZLJA 4Z37A 4EYIB 2APOA 2ZNZA 3EE3A 4DN9A 2G2OA 1WEZA 3IS9B 3HD2A 1WC5A 2RQCA 3OVBA 1TUVA 1ZTWA 2YY3A 3GE9A 4OI6A 1BQXA 1R8AA 2RMLA 3DM2A 4A48A 4H4OA 4RW4A 3G8TA 1C2PA 1DHMA 1GMWD 3ILOA 4RU2A 3TX0A 2DTJA 4BLGA 4B3RJ 4OYIA 1N32J 1TUWA 2PMWA 3MMCB 3A8IA 3DRSA 1FVSA 5DLFA 3SCJE 1ZM9A 3G96A 1YRTA 4G1IA 4FXVA 3SEOA 2JWNA 4KIAA 3B4DA 4CO1A 3DC2A 3VGSA 2CAJA 1UWBA 2PI4A 1VC0A 2AGPA 4K50A 3N9UC 2Y1RI 1CSJA 1RA7A 1G6BA 4LR8A 5K9FA 3TANA 3FSIA 1SKUB 3CC4S 3KLHB 4DS4A 1NB2A 1NO8A 4URQU 5DRKA 4ILMA 1YLXA 1T9WA 5LL6d 1JNZB 3GYNA 2HRUA 5KFYA 3W5ZA 2R7XA 2LXUA 3GJSB 3TJAA 1D09B 2Q1LA 1F9FA 2EK1A 2ZJPQ 1U02A 3DYAA 4WXWA 3QT5A 3UNGC 3UCGA 3CCMS 1GEHA 4KB7A 3PHTA 2BJ9A 1ZAVA 3LWMA 5DZ7A 4Z2XA 2BJ8A 2QG9B 3CCJS 4QCLA 2VQEF 2H3EB 2AIRB 1RE1B 3IWNC 4OYOA 1KSPA 3Q8YA 4DPWA 3W63A 1F6TA 1YJ9S 3NBPB 2CJQA 5HBMB 1EZZB 3M2UB 4CP5A 3MFHA 3W2VA 2NYHA 5KFGA 4BC9A 1FCAA 3T1AA 4C11B 2HBZB 3MZIA 1BD6A 2GS8A 5B08A 3CD0A 4ZIVA 2H4WB 5IXUA 3EZ5A 2XZDB 4IRDA 3CDAA 5CYJA 1QJHA 2C2MB 3FBEA 2ALYB 5IT9Y 4Q8FA 3A13A 2VG7B 5KFQA 2HEKA 2NXUA 2W1BA 2UXBJ 1XEZA 3IGVA 4Y00A 3M7VA 2Y9HA 2OI2A 2AJ0A 1HQEB 2DNLA 1EP4A 2A18A 3JSRA 4IG3B 4NZ0A 3VVUA 2X1AA 1X4EA 2C2OB 4J90A 4EBEA 2X7IA 1FRLA 4LF9J 4DSIA 4ECRA 4OFZA 4CO3A 2XM3A 4IRCA 1P27B 3MM7B 3PVXA 3DU5A 4O3RA 1SQFA 2M2BA 2UUAJ 1X4CA 1RCOB 3F0NA 2MQPA 2PMZD 4TU8A 2X1BA 4C0HA 1IQTA 3MM8B 2E7WA 4XDDA 3SCIE 2GV1A 2CWKA 4I69A 4ED5A 1HNZJ 2B4VA 2F4VF 4L74A 1BQMA 2EEYA 2YTCA 3CF5Q 4YB1P 2IYGA 4ZN1A 2UV8A 1QD1A 3TYTA 2ZJQQ 1YJRA 2XS5A 3VZIA 2CQ1A 4BWMA 4DPXA 3MR7A 1HHQA 2GVDA 1KC8T 2EFNA 3OFGA 3MCOA 1KNZA 3DLGB 1T9YA 3C6TB 1AUDA 2HHUA 1TKXB 2BXJA 2H4YB 5MLCV 5T14A 4F4KA 1GXTA 3NGKA 3QSYB 3FGVA 1Q78A 2OEJA 3SCKE 4CLYA 1IR1A 4ED4A 4LSNB 1JLGB 2OD6A 4LRDA 4RNMA 2ZH3A 1QE1A 5KFVA 4PWUA 2UXCF 3O2IA 5LSRA 1PC4A 1FRMA 2LDIA 4HLBA 2HPUA 3M30A 2KH9A 5LJ5Y 4A8MP 4KYZA 1NK4A 2XSJA 3QSIA 4C9DA 1IBMJ 3P4UB 1NJWA 2C2KB 4AT1B 3FSXA 4LIWA 1F5CA 4H4KA 4LRFA 5CQGA 1TV6B 2ZWPA 2AHOB 2Y1JA 3BDEA 4DUYF 2BKPA 3PV8A 1RAHB 2W24A 3SZ2A 5H9EJ 4MYUA 5LXRA 2GHPA 1TMJA 4A8XA 2JLEA 1U26A 1ZA2B 4K4VA 2ZHAA 4G1PA 4N41A 1UVLA 4O4RA 2GIQA 1T02A 3MCMA 1RGVA 3BGFA 1RT2B 3FBCA 2CPZA 3C15B 3GSIA 1RAOA 1U0SA 3QRPA 2YH1A 4G6VB 4QIEA 3DLKA 4DR6F 3QAUA 4X4TA 3M8QA 1IKVB 2HGNA 4PXDA 2G0IA 4X4NA 3HVAA 1FXRA 1G7CB 5LJ3Y 3E01A 4DV7F 2QFJA 2QRRA 5AE3A 2XYGB 1HA1A 5M2UA 2ZC3A 1K9MT 3PYGA 1N8RT 2ZH6A 4YHHJ 1ZBTA 2XMMA 2MZRA 3HXMA 3C14B 4QJVA 4I2QB 4X66J 2MKIA 2ZH9A 1IJFB 1LWFA 1WF1A 4L72B 4CQ1A 4NRTA 3VCDA 2HQGA 2ZUGA 2CPJA 2ZM6J 1SUQA 1TK5A 4Q2LA 5GADI 1HARA 2MPUA 9ATCB 2QA2A 5DLGA 2GQ2A 5C7PA 1ZH5A 2L9WA 1FNOA 2IVYA 4YQWA 1XNRJ 1S4FA 1H2VZ 2ACMA 3BN7A 3TZXA 4DHVA 1YHQS 2R8GA 5IM0A 3TAPA 1IVZA 2MGZB 3DDNA 2RS8A 4I6AA 3OFFA 4BCAA 5U47A 2B5JA 1QM9A 1MW7A 2VA2A 2XTJP 2OEKA 1NLKL 4ZPWR 3ZTSA 2I5JA 2KKHA 1IBKF 3RB3A 3MECA 5K8PA 3BQ0A 1VRQC 5T7LB 3IMQJ 3PKMA 5CXTA 4Q43A 3ZC4A 4FF1A 3DNCA 3LP1B 2PSZA 1SBRA 1FRHA 3ISNC 1FTCA 1RQ0A 1ELOA 1AT1B 1MU2A 2CVEA 4Y0FA 3US5A 1HBOB 2DNKA 3MPVA 4JYAJ 1VQ5S 3CCLS 1Q8LA 3CD5A 4J7CA 3D67A 1ZYQA 3HJVA 2D9PA 3AQPA 4XPCA 4ZKAA 3A12A 1L3VA 2HZVA 2FJWA 4HEA9 3D1OA 2HW3A 1OSDA 1O51A 5GMEA 1AB8A 1FNMA 3KLFA 3BYPA 2OMLA 4F8RA 1FRXA 2DNPA 3UN2A 4QW8A 2CZ9A 3DMJA 2VKRA 3QATA 4DDFA 5I4MA 2DRAA 1TKDA 3RYLA 3QFHA 1ACMB 2RDDA 3MOZA 2QL5B 2LEAA 2BABA 2DH7A 4X62F 1RSCA 1QUVA 4DR4J 1N4LA 5ETQA 1T9VA 1RAJA 1UFLA 1BY9A 3I6PA 1RT1A 3EPIA 2W9AA 2FZGB 3PRVA 4ZCKA 1WEYA 1U6BA 2UP1A 1V5VA 2BM0A 2LQJA 1BQNA 2ATCB 4KFBA 4NYZA 2HIYA 1KQGB 3KLGB 2ASJA 1S0VA 4PABA 4OZ2A 4ETXA 2IAJB 4O23A 1EIYB 3M32B 4S0MA 4ZVOB 4DL6A 2YX4A 4W92B 2H5EA 3NP5A 4AQYJ 2Q79A 3J80Y 2DIVA 4F4AA 2WSEC 1NJZA 1VBZA 4X4VA 3AOCA 4KY3A 3J81Y 3SXLA 5AXMA 5ETSA 2CJYB 3P5BP 3OTOF 1FEEA 4F4ZA 2HMIB 1M1GA 4NEYA 3J7YU 1MN9A 5EHHA 1HYSA 2RDJA 1MNEA 3CCUS 2M5YA 2MQOA 4DSJA 3W9JA 1U0HB 2FVPA 2MB0B 4X64F 1UA1A 1LV5A 4UW2A 4FYVB 1S9EB 2O66A 1KQKA 2BOPA 1RT7B 3FUYA 2XWYA 3R7SB 4WK1A 5M2PA 4KPYA 1X5OA 4B9SA 2NSBA 4N76A 3GPAA 1BXNA 3DCAA 5EX0A 4X4SA 2UUBF 1WDTA 2R8JA 4B08A 1KVKA 3T1YF 1T9XA 1VQ4S 1Q4RA 4Q5VA 3W62A 3RRGA 2B43A 2MQ8A 1TL1B 2LFVA 3VGUA 2DITA 5KT3A 1JJCB 2M0GB 2O01C 2GQCA 3M1VB 1DTQB 2R3VA 5ETRA 3CJ0A 2BJ1A 2F9DA 4M95A 1JXVA 1HQ2A 4CH0S 3H2LA 2MZJA 1AYEA 2AGOA 1LWEA 2BA9A 1L3TA 3NWRA 1C0UB 4DG1B 1YSJA 1GH8A 3DOKB 3MAHA 3QZ7A 1R7IA 1ZM3A 2V4JA 3K89A 2DGVA 2VUGA 1KP6A 4JV5F 5JMNA 3MOJB 4ZLLA 3LGMA 2DXFA 2QN6B 4ED7A 3N6NA 4YY3J 2CPEA 2V2VA 5F8NA 2Z2YB 3BZQA 1I94F 4TU9A 3IBFB 4CT8A 4KTQA 2YNFA 5A8RB 3JQJA 1Y11A 4NA2A 3PJXA 1LW2B 2FLLA 5GAEI 4WF9Q 2FVRA 2C3UA 3PACA 1SJ4P 5SZTA 2HNDA 3BS9A 2OHDA 5A0YA 3W61A 3P96A 1F2HA 4Q7AA 5AXNA 2YWEA 5J2NB 5KFZA 4NRUA 3AFGA 5E3PA 5J2QB 2XLJA 1VLYA 3M2VA 4HH1A 4QU7A 2GCFA 1VRUA 2RIJA 4D3GA 1S1VA 2DPIA 4UTGA 2HNZB 5HROB 4ZMMA 1YQHA 3PRBA 3OUYB 2N4CA 2HFUA 4OLOA 3GP9A 4EYHB 4B3RF 3H4BA 3GILA 1N32F 3P45B 4NYOA 2ZVIA 3CDEA 2YH0A 2LEPA 1RWVB 1VRTA 4K4SA 1HMVB 2X51A 4ZCMA 2R8KA 1NHKL 2BV3A 4DL4A 1N5VA 2V69A 1N5TA 1VQ9S 5CYQA 1A0OB 1WHYA 3RBDA 3H4DA 3VALA 4OYZA 1CBKA 1KRPA 1S6PA 3UDVA 1CJVA 1U47A 5B0DA 2G2ZA 2AYMA 2RAQA 4TQSA 1TAQA 3FVYA 2Q43A 4ZPAA 2DJWA 5D3GA 4NOHA 1OJ4A 3POTA 2OJ3A 2B9WA 3IG1B 4DSFA 2A0FB 4ED0A 1SIZA 1IM4A 1XMOJ 5C25B 1TKTA 3EVWA 3OFHA 2VG6A 1IJEB 1JLFB 3FEXB 3UVJB 4M5MA 3FC9A 4L6V3 1HWJA 1EB0A 3KDNA 4FVCA 4M8LA 1I51B 2IRUA 4QR2A 4NI2B 3LALA 2E1MC 2FJBB 5IT9U 1OSCA 1OY9A 2X3GA 3IA0A 2DNMA 1RWKB 3RAQA 3PO5A 1WUUA 4NX9A 4M94A 2VQFJ 3IRXA 3N79A 4ZDNA 5B0BA 3M6XA 3IP0A 1HQUA 3FNNA 2EFGA 4M5JA 3VWSA 4Q8EA 1MROA 2ZKTA 2AMCB 2OSRA 2F4FA 3FEZA 3BF4A 2HFZA 1N34J 1VCTA 2R7TA 1VIOA 2OH2A 5A8KA 3CNQP 4UOFA 4GVLA 1WC4A 4F0MA 4M1KA 3PR4A 4LRCA 3PTWA 2B8QA 2UVRA 3QT8A 2DYAA 4DS5A 2AW0A 1IWGA 1TFYA 2EBEA 3OL7A 3M05A 1KONA 2DNQA 4HHJA 1Q53A 2IPOB 1FEHA 1VQPS 2D3O1 3M8WA 2O5DA 1RBAA 1JJHA 3OR1A 1FE0A 2BACA 4GMKA 4NL5A 4X4UA 3KK2B 1S1UB 2XZWA 2A3JA 5E3AA 2GMJA 2W9BB 1JXLA 1GXLA 4LF9F 4F4YA 1A7GE 1F5BA 2YKNA 2RKIB 4B3TF 2RS2A 2VBWA 1RTJA 4DFKA 3RB4A 5A8WA 1XWLA 1EETB 5HLFB 4LSLA 3GU0A 3NAHA 3W64A 3BEGB 4CYUA 2POKA 3D6TB 4KO0A 3IR7B 3EGWB 2WOMB 4KGZB 3M8ZA 3NKYA 2L3MA 3KG1A 1VHIA 1E6YB 2XS7A 1JLEA 2LXFA 4Q0BA 1APSA 4M63A 4MTPA 4P2XA 4DQRA 3DLHA 2KJVA 5DDRC 2AJFE 2BJEA 5E0OA 3CXCR 4ECSA 2LMIA 1BMQB 2J7UA 2VG5B 4ZITA 1C4AA 1YX2A 1W25A 3MR6A 2OPRA 2WBRA 4KRWA 1H74A 3UPFA 4G1QA 4ZLNA 3ZZUA 4ZVEA 2OTJS 2W2NP 2YWWA 4MT1A 4E98A 4USHA 3DRYA 1K1QA 2YNGB 1RU1A 3TA2A 2J6SA 2XMUA 4DWIA 1FVQA 1D8ZA 3QWPA 2KFYA 1WOOA 3NAIA 2QT7A 3HFKA 4PQUB 1VI7A 1M5PC 4RPFA 1WWHA 1P6TA 2XSFA 2QMUB 3NLCA 2IIHA 1FK9A 3KYLA 4OI3A 4ANDA 3RR7A 3GZ7A 4PG6A 2GIFA 3FMWA 3U7JA 3UD3P 2HVHA 2UUWA 1SC4B 3Q8RB 2XCAA 1HBNA 3PW5A 1CS4A 5HQ8A 4L75A 3R7NB 3I0RB 1R0BG 4CO4A 3CJKA 1FXDA 2D3OR 1CJUB 2RU3A 1IBMF 2V9KA 4NA1A 1WHVA 1CG2A 3I55S 3BV8A 2B56A 1PKUA 4HVZA 4CLTA 5B0EA 2ZBCA 1RAAB 2PA3A 2DK2A 3SQGA 4DCOB 4FZVA 3QT6A 2FGOA 2AX1A 2EC0A 3WX8A 1X7VA 2LKZA 4DQQA 1RWXB 4P2FA 3W2WA 3WHIA 2QA4S 4Y28C 2CQBA 2J7WA 1C1CB 1U1QA 2WSCC 1DQAA 2LA4A 4LFCJ 1U1MA 2ZH2A 1HFEL 2BM1A 4IH7A 5L1JA 4TYBA 2IMWP 2CRLA 4OYMA 5LMNJ 2DGTA 3M8PA 4K0KJ 3IR6B 5EN1A 4OYPA 2ZOFA 3W5XA 5K20B 4K4ZA 1GTEA 1IKXB 2J0SD 4K59A 3KLEA 3ENWA 4OHYA 1NAQA 1LXNA 1RXOB 2UUCJ 3RUBL 1IN0A 1DTTB 3I4PA 1FXLA 1S12A 3N4WA 1W7WA 3M8RA 3QO9B 3J7A1 4USVA 3ET6B 5KFRA 3P49B 1XIQA 2ERRA 5HJXA 2VBXA 1D1UA 5G0RB 3F56A 2MKKA 1RK8A 2QC3A 1T7PA 4JOUA 5D4PA 4ELUA 4YHHF 3CVKA 4EGLA 1Z4UA 2MDAA 1BGXT 4X66F 4OYWA 3THVA 2QL9B 3R5CA 4ZPTR 1GX6A 2HAFA 3MPYA 1NBEB 1JLBA 3KUEA 4P75A 2ZM6F 3CJ2A 4WZMA 1RZMA 2AJ2A 3FCHA 1NH8A 2K1RA 5KFNA 5HMYA 1LK5A 3N01A 3P8BB 1XNRF 3AB2B 1SV5B 2VA3A 4H54A 2AKWB 4RUAA 2ADBA 1EJ7L 2F8EX 5FDLA 3Q8QB 1JLCB 1Z1ZA 1UVMA 2KL8A 2J9DA 2JFDA 2YX7A 2H65B 3FEYB 4DSLA 2HYIB 1VQSA 3CDUA 2C2DA 3P5TL 4W98A 7FDRA 3BGLA 3TEGA 3QIPB 5SUHA 3FMBA 4QOTA 2Z4PA 4B9VA 2WVBA 3HJFA 2XGQA 5DZ6A 1IR0A 4EMDA 2KM8B 2DEJA 4C8ZA 1HWKA 2FPHX 4JI7J 5KT2A 3PG9A 4I68A 1REVA 3BSAA 5KT6A 2MY8A 2AEFA 1I1GA 1Q1KA 2IFXA 1B0VA 4NLDA 2FD2A 2OP5A 1VYAA 1D8YA 2LXIA 4W4MA 3VR1A 1H3DA 2AEMA 5E3CA 3TZZA 2QLJB 3DLEA 1LWXA 3VAGA 3I96A 4O3QA 5KT4A 1SJ3P 2KRBA 4JYAF 4ZVPB 4WP3A 1NPPA 3M2RB 3W9IA 1KLMA 1FWLA 2YKMA 4P9SA 2AT1B 1RDRA 5JVHQ 1DQ8A 3WQPA 2A6OA 1VQLS 5KFUA 4TVAB 2OO4A 4PZVA 1HNIA 1HI8A 1A9NB 5D4OA 1JLAA 2ZE2B 2ZUAA 1MWQA 1HBMB 4P72A 3BO3A 2VFVA 1NSQA 1B4SA 3J80U 2WBMA 4K4TA 1O6XA 1HI0P 5IWAJ 4DR4F 3ZNUA 3ZZPA 2HK3A 3J81U 3SDEB 2FY1A 2D9OA 2KT3A 4QWAA 5E3RA 4A8SA 2VV5A 2IJRA 1FX2A 4EFAC 1T8EA 5E5NA 4BWJA 3QNWB 3IC1A 3LQVA 3MEGB 4RUHA 4RBVA 3IS9A 1CJTB 2CQDA 1EQ0A 4NZ7A 1R0CB 5DQHA 2G4BA 1YJ7A 3BSCA 2FQQB 1S1XA 5KFCA 1WELA 1IKWA 4EEYA 2XMWA 3I5BA 2DCUB 4X65F 3T3FA 2PEBA 1HKAA 5D8HB 4CDIA 2Q66A 1GTHA 3MMCA 3R8YA 4CTAB 4CNZA 1FDAA 1UPMB 2CADA 2XB2D 4N8NA 2ALZA 2R9LA 2RD5C 1FI4A 2HK2A 3CJQA 3R7BB 5F8LA 2FVCA 4I2PB 1VQNS 1FDNA 3JAMY 3OV7A 1RTDB 3H0PA 4MKYA 1YK9A 1FFGB 2CPYA 2XYHB 5DETA 2ASDA 1PAEX 2RQ4A 1TVRB 3WC0A 1WI8A 4FVMA 2FVQA 2K8GA 4KHPJ 1KQSR 2JZ5A 1ROFA 4CO2A 1KVJA 2ZOGA 1I3OB 1PILA 1HNXJ 5B0CA 3VHQA 1SQGA 3RBEA 4I6WA 4ID8A 2DGXA 2MKHA 4ZPBA 5J1EB 1U48A 4QYRA 4HDHA 3MF5A 4U9RA 2AQ4A 4ZHRB 1RAEB 4FS1A 1VJQA 3HHLD 2HFNA 4FDFA 4EO8A 4KHRA 3QJJA 1H0HB 3W1YC 3TX8A 2HQDA 2M9KA 3MUTP 3NBPA 4YY3F 1S7HA 4DX6A 2IJNA 3H2UB 2CNOB 4FNHA 3QMQA 3M2UA 1JNRB 2F63A 4IH6A 1FESA 2WHOA 4C11A 2E44A 3CJ5A 4M5NA 4O4GB 1RT6B 3Q24A 3RW6A 2RSQA 2R7RA 3HSGA 1NDLA 4ID5B 4DQSA 2CNLB 1X5TA 2WZ1A 2R8IA 3EICA 3V81B 4TXSA 1S97A 2VC1A 3HLUA 3K8VA 5HVHA 3R1LA 3D0IE 1LOUA 2ILYA 3AAWB 3BB5A 2VG7A 3KLIB 2V4QA 1FA0A 1DLOB 2LU2A 5GAHU 1WC6A 5BYRA 1VQ8S 2G2YA 2JSXA 5I3PA 3J81j 1HQEA 3A3NB 3UR3C 4BC7A 1FWKA 4ZP7A 4BDPA 1SKRA 2A1BA 4UT4A 2X3DA 4RBTA 3AD8C 3MPWA 3S6EA 3H5XA 1XNQJ 1UVIA 4DZDA 1MMDA 1H2UX 4U8YA 3GR1A 3K5PA 3Q8PB 3MM7A 4F50A 3UCUP 3MCNA 4TLQA 1BC6A 5LXYA 1DARA 3SBMA 4L73A 2NR0A 3PIPQ 2BKNA 3R5BA 1K47A 3MM8A 4F36A 4PXEA 3KDOA 1WSVA 1URRA 4LF4J 4ECWA 2JVRA 4JB8B 1VBXA 1T03B 1RACB 3GFYA 3FDSA 3MMBB 4FPIA 4WCEQ 3O44A 3OL8A 2GIRA 5GADU 3BPSP 5HK4A 2RJZA 4NCAA 1XMOF 4P73A 3PEJA 2J0WA 4J5OA 3HFZB 2IJFA 4UY8T 3HVWA 3QJPA 1D0EA 4JI6J 4FKYA 4FP9A 2VDHA 3ENQA 3DOLA 3OLBA 3DLGA 5HATA 4L3NA 3HCXA 2W2QP 4CLUA 5D0RA 4NXMJ 3QPIA 5RUBA 1TKXA 4CZCA 5K8NA 4MKAA 3ZFVA 5GMDA 3HVTB 1UW4A 3AJ1A 2VQFF 2WTFA 1YKWA 2XMVA 2YKPA 3V2UC 3CIZA 3NG8A 3TP2A 3TAQA 5KG1A 1N34F 4LSNA 1JLGA 4AFFA 3Q2SC 2VJUA 1H7WA 2RHSB 2HZCA 3VF0B 2MMYA 3VAIA 3PM9A 2JHEA 2KZMA 1NK5A 5HMWA 4X84A 5L1LA 2W8LA 3C6UB 2HWHA 4BBYA 2ILZA 3KMSA 4LF5J 1TV6A 1WC3A 4KGMA 4KH0B 1FKOB 1P1LA 2K2PA 5J2PB 1MMLA 3VQTA 4J9RA 5KFBA 4DZ6A 2E29A 1NRKA 1U1KA 5JXSA 4LF1A 2NXCA 5HJYA 3VAJA 1QAYA 3SSQA 1Z2LA 4MIAA 3DI6B 5I42B 3WC2A 1D3WA 4RLEA 1RT2A 5KT7A 3C15A 4YB5A 2FTRA 1HL6A 2IHR1 3KJVA 1XQIA 2H5JB 3RJMB 3KWMA 1RWMB 3N28A 2CQGA 3C3LA 2F65A 3QRQA 2DNGA 1VDHA 3TR5A 3JSMB 1IKVA 1FTRA 3GG0A 3JQMA 2KG1A 2Q6CA 3OXFA 2XYPB 3PYDA 4YR2A 4RW8B 2L08A 3KUGA 1TP7A 4A46A 2MKJA 3LGNA 3DRPB 3VAMA 2M3DA 3PW0A 2JFKA 5L46A 4AL5A 1KN6A 4ICLB 3RB6A 4NPOA 3C14A 2ZBPA 3DOMB 2C2RA 3G2XA 2BVZA 1H73A 4U7UD 2Y1IA 1M1KT 1ZPVA 2YNHB 2EWHA 5CD4A 2ATLA 4XIUA 1LW0B 1VISA 4HT5A 5D78A 2RHQB 2E5GA 1SC6A 4RW7B 1QVGR 4DR6J 3VAHA 4ZVGA 4DV0J 3CCTA 3V4IA 3W2VB 1GMUA 2Z56B 2OPQB 3A8JA 2MGZA 3EDQB 1RTHB 4C48A 4YOEA 5AT1B 1N5QA 3U1NA 2M70A 2HG4A 4ZPCA 5KFEA 4JV2A 1FKPB 3A4TA 3BBCA 1YBAA 4PPDA 4ED6A 2CG8A 4URGA 5T7LA 4O0NA 1S0OA 3LP1A 4DLEA 1NZ8A 1NCLA 1YRUA 4PKDB 3K8WA 2ZNYA 4FBUA 1S6OA 2PFFB 2YKOA 2AZ3A 4FXWA 1IKYB 4QR0A 1NKBA 4HR2A 4B17A 1YDLA 4LFCF 2Y3YA 3GCXP 5FD1A 3QJLA 4OMFG 5THWA 3FBBA 2C3OA 4WTOB 1MN7A 5LMNF 1KFSA 1SJRA 1P9QC 3H2VE 2FJXA 4ZJOA 4K0KF 4USUA 4K4WA 1TL3A 3L4BC 4CT9A 2UXDJ 2AWZA 1LXJA 1YJNS 5BYSA 2MXYA 2GA7A 1NKCA 1L5UA 4N8OA 4DR5J 1YVFA 3CW2C 4B3OB 4DF8A 4B3SJ 4P2MA 2UUCF 2QYGA 3WBZA 3QRRA 2DVIA 4ECXA 4EI2A 4WFXA 2LEBA 1QAXA 1OIAA 4IOAQ 3FFIB 2MSTA 2LP4A 2MSSA 3SFUA 4H4KC 3BR9A 3I56S 4A8QA 3ONQA 2C2EA 2KTQA 4ELVA 1VK3A 1RADB 4A8FA 5IC4B 4EZ9A 1NU4A 2H5IB 3KLGA 1KTQA 2W01A 2IAJA 3M32A 1Y10A 1IQZA 2MY7A 1HR0J 2D69A 1HWUA 4J9NA 3FCVA 3GTYX 4LFBF 3ELHA 3G82A 1QTNB 1OYEA 2E5LJ 4KGVB 4ZPVR 2YXLA 4Y6IA 4E8UA 1JKHB 5KG7A 3TRGA 1NK0A 2KHDA 3QIDA 3AJ2A 4QPTA 2BKOA 1FO1A 4CLWA 1ZOTA 3I0SB 3VAKA 2MQQA 2HMIA 3VAFA 4JI5F 3OSNA 3CJSA 2ZH8A 2BEFA 3L9ZA 3B82A 2B51A 3GIKA 1U0HA 3KTQA 2PGCA 4RL1A 1K0TA 1S9EA 5K14B 4CH1A 4RBUA 2OEMA 1RT7A 1S9FA 1E6VB 1CQMA 4JI7F 1PYOB 4PYAA 2KM8C 1X4GA 4FYDA 2DHAA 4OI4A 2N7YA 5H9FJ 2ZITA 2P9GA 4QBUA 1FJ7A 4QYZJ 2KDOA 1SH2A 2JH3A 1B0TA 3TZYA 4J37A 4ZLPA 3HF5A 2PI5A 3H7HB 1X60A 5CCMA 1TL1A 2FIUA 1T3NA 5I3UB 4P74A 4JI4J 2FDNA 1WC0A 3M1VA 1DTQA 1WDDA 1JJ2R 3K5MA 3OLAA 2CQIA 2MTLA 5HI7A 2WB4A 3LAKA 4HTJA 4LR9A 1B0PA 3ZZ0A 1C0UA 1D9DA 4DG1A 4R0JA 3ZZOA 3QGIA 2CJAA 5D15A 3IBWA 3ZZRA 3FRZA 4NLUA 1ZZFA 2B0GA 3KK3B 4DV5J 5IWAF 4C4WA 4Y2AA 3H5YA 3VGTA 2R7SA 5E3QA 2ZFHA 3P3DA 2W7PA 4WTYA 2HHWA 3H20A 3HDSA 5A8RA 2Z2ZA 3CMES 3N6MA 4RWWA 1LW2A 1EX8A 3CCQS 2JJ4D 5KFIA 1NEEA 5ETMA 1RTZA 3NMRA 4KKOB 3PW4A 3JAMU 5J2NA 4DUZJ 4RNNA 2NREA 5KFXA 1UAWA 5J2QA 4TY9A 3UN5A 1Y4ZB 1WOSA 2DGOA 5F3ZA 2HNZA 1Y5LB 5GMKa 4ED3A 3TVZA 3OUYA 5KFJA 1DZ5A 3NWGA 4ECUA 1NK6A 1Y3KA 4M5GA 1H72C 2MLYA 5D4NA 2QIFA 2GAHC 3SFGA 2YVSA 4RKUC 4IRKA 4NWBA 3JB9k 2XHWA 2CQHA 1UFWA 3K57A 2W2OP 4A47A 5F8GA 3OR2A 2XWXA 1S1TB 4P10A 2BE2A 5F8JA 2X1FA 4F26A 3G86A 4ALZA 1SPBP 3DGPA 1YWXA 4AL7A 2FLOA 4KHPF 4HHHA 2Z57B 5KFPA 3GWCA 1CVJA 3IG1A 2O67A 3HSZA 3AD9C 3HKZD 1RHQB 2BANB 5C25A 2Q3PA 4QQBA 1HNXF 4EUVA 3G87A 3H25A 4LF8J 1JLFA 3UVJA 1M5KC 3MMAB 3VQSA 2ZBRA 4J9UE 4B02A 2OAUA 2JLGA 1X4AA 2OGUA 4NI2A 3ZNJ1 4B9NA 2X1GA 4WP9A 5E41A 2BJDA 1SL0A 3UDEA 3GJTB 2B4PA 4XAKA 2W25A 2DNYA 1PO6A 1PSDA 3X3UA 5EWFA 4M5KA 2IMOA 1WOPA 1T0TV 2VONA 3EJMA 2JX2A 3PW7A 2KYXA 4X4RA 4PWDB 3GYXB 1ZA1B 5F41A 3L09A 5D4LA 1RWWB 4CLKA 1PBUA 1X4FA 3NCRA 2HHHJ 1SL1A 4DV6F 4ZK7M 2CJKA 3D6FB 2I1RA 4DV3J 5ETVA 2VZ9A 4KAIA 1DURA 4USMA 4IFYA 2QLBB 3ZZZA 3G6VA 3AY0A 4QWDA 2DHXA 4I4BA 3JSYA 4OIXA 1S48A 1T3OA 5B0GA 1VFJA 4NLWA 4DSKA 2UU9J 1QSSA 1TL7B 1XTZA 2MZQA 4JI2J 3SI8A 3EYZA 1KD1T 1X4DA 2J6TA 4JI3J 3AXKA 3UO0A 1EHWA 4F0KA 3KK2A 5F3TA 1S1UA 3K59A 2KU7A 1XNQF 3CT9A 4KH1B 3RBXA 2W9BA 2H48B 2IRXA 3LH2S 4OJ1A 1I5OB 2RKIA 1TZ0A 4ZJLA 3TVKA 3OVAA 4C2MA 1SKSA 3A3PB 3MD1A 1CULB 1EETA 5GAGU 5HLFA 5FLXY 4PXCA 3QGHA 5K8OA 2LYVA 3G6XA 2WOMA 3AOAA 4N77A 3BH6B 3GJQB 3ETMA 4U8VA 4KQZA 3AOBA 3KLVA 4LF4F 3BJYA 3QBCA 3BBBA 2NLWA 3AA8A 4LQ9A 2PDAA 1G1XA 1U25A 5KG5A 3JTPA 3M4XA 4YB7A 4DPYA 3ZTOA 2XNRA 4KBIA 5BYQA 4IDKB 4C0BA 1WF2A 3HFVA 4OYAA 4JI6F 3K0JA 3MTJA 4CCHA 2VG5A 4NCGB 4NLXA 2DKOB 3K58A 3CCRS 2G0CA 2D74B 2IM0A 4B3TJ 2JVOA 1FJGJ 4IOBA 5BJRA 1S6UA 4PQAA 1B7FA 1XR5A 2ZEJA 4NXMF 1UPPA 3J7AN 4AD6A 3T9ZA 1H38A 1W2BR 2YNGA 4DL3A 1V6HA 2IBOA 3GV7B 3BSNA 1RA6A 4R5PB 1LEOA 4PQUA 3MDFA 1N88A 2DNHA 1B7YB 4UY85 4HI1A 2CUYA 4ZPDA 1NPRA 4HT7A 3F44A 3G4SS 3ENAA 2HFSA 2OTLS 3I0RA 2ASYA 4J9LA 2CPHA 5C24B 3OL6A 4D3HA 1LWCB 5D6GA 1VRUB 4KV8B 4LF5F 3K7RA 3PX4A 1XR6A 1TL5A 3DLLQ 3U02A 2VPXB 4PPZA 4Y2CA 3UI3A 1C1CA 3TWZA 5LM7E 2VPYB 3M6UA 3CO9A 2MQNA 1U8SA 4M5DB 2W7OA 3LTOA 2XZTB 3W9HA 3E51A 1YJVA 3G6ES 4ZP8A 2QX0A 1GX5A 1XN9A 1IKXA 1N5SA 3N5BA 2W4PA 3S01A 3HK2A 1FT8A 2FHOB 3QWUA 3FQLA 1YITS 2GO9A 5E33A 1DTTA 1YG0A 4GO5X 3O8WA 3DLBA 2HHPA 2RQMA 2WCXA 4JV1A 2KZZA 3QO9A 3QQCD 4OZ3A 1ZS6A 3ET6A 4CM0A 2ZHOA 4DFMA 3IGNA 1PBAA 4ANCA 3B4MA 1LFWA 5G0RA 3A1YG 3MM9B 4V19J 2DD8S 1M5SA 1HI1A 2JEFA 1OY8A 4AYBD 4MAKA 5CABA 4DFJA 3R6GB 3UCZP 3PYFA 5GAHI 2MJUA 4IG0B 2GJ2A 2YQ0A 1PAUB 3PXGa 1V9OA 3ILIA 3CD6S 2F9JA 5DG9A 5IV3A 1DJ0A 4CIOA 2YBVA 4DV0F 1EKSA 4MH8A 1SV5A 2KI2A 2FVSA 2QLWA 1JLCA 2ABYA 1RI7A 2ZJRQ 4MKVA 1R0AB 1FFWB 4ATNA 1ITPA 2SXLA 2GW8A 4ZCLA 2XY7A 3TVYA 1UVNA 2R4FA 4CRJA 3MTKA 3QIPA 4L3KA 1M5HA 3IM9A 1UVJA 5LMUJ 3ISZA 3TQEA 3N0VA 2Q6BA 5IT0A 2ZDOA 2DPJA 4JP8A 2J0XA 1WJ9A 4J9KA 1L3KA 3MURP 2BZ2A 1YRXA 1D9AA 3ISND 1WG5A 4R8UB 2H1YA 1S59A 4DV2J 2IC3B 1QAJA 1QSYA 4IH5A 3IO1A 4FNIA 3M2RA 3TUIC 2DISA 4LVOP 4P71A 1RT5B 3ZTQA 2HHQA 3NCQA 2CG4A 2UXDF 4KO0B 4C8MA 2GX8A 1JX4A 2FZKB 2ZE2A 4DR5F 2PN6A 1HPZB 1HBMA 4CI0B 4B3SF 3PX0A 1X5PA 5CYMB 1LQ9A 3K5OA 2J7KA 4WFYA 4P52A 1JLEB 1VS3A 2JC0A 2WW4A 3S1TA 1NDCA 2ZC4A 2WRMA 4QW9A 3SDEA 3EXYA 3FQKA 3K5LA 2OKQA 1WKJA 3M6WA 5ETLA 4N5SA 1RAFB 4IKAA 4TN2A 1FERA 4J9OA 3S8SA 4OV1A 5F9NA 2E5IA 1AFJA 4ZVTB 1V3RA 2FHKA 5DGAA 4YN3B 1TFWA 4P7TA 5C2CA 1SB6A 4ZVQB 1CJTA 1HHSA 4C8LA 1HR0F 4G1QB 1TKZB 2VICA 1RTIB 3U1MA 1JLQB 3PDNA 2GO8A 4H4MB 2F3JA 4UF4A 4A8YA 2QA4G 2E5LF 3W65A 1U45A 1U24A 2FLPA 1NKEA 2HWTA 3E2EA 4PG4A 4WFZA 2KVQE 1OPIA 3GSDA 3CJTA 3CCSS 4RUCA 2VIHA 2COLA 3LF0A 5J2MB 3UDLA 3PJ9A 3SIPB 4ES2A 4I6YA 2UZAA 5KTQA 4YUDA 3L95X 3OJUA 3EGNA 1HD0A 4CTAA 2ZZTA 3D54A 2WSFC 4WP8A 2C1EB 3X1LB 4QIGA 2UUTA 3DGVA 3IN5A 1UZDA 4ZVUB 4I2PA 3T5KA 3NEKA 3J7ZT 1RTDA 1GMVA 3QAEA 4HH0A 4ECVA 4PYDA 4KJIA 2N82B 2HZAA 4WIQA 5KFKA 3NGDA 2F1FA 3C46A 2WVDA 1TVRA 5CA5A 2DR7A 2XO6A 6FDRA 1T05A 3OT9A 2Y8WA 1FD2A 4ILLA 1H98A 7AT1B 2QLFB 1NM2A 1C0TB 2LQ8A 4HDGA 4DL7A 2N7CA 4JI4F 4X65J 4C97A 4FF4A 3IR5B 2GVZB 3GV8B 4UUWA 5J1EA 3M8PB 2B9YA 1R27B 5HO4A 1N6QB 1V3SA 4USKA 2U2FA 3MI7X 2V94A 2QGFB 5KFTA 4ZHRA 1TL4A 2RUSA 4P2SA 2KVIA 4U7UK 1VBYA 1U6ZA 4NASA 4USWA 4DV5F 2DY9A 1WD6A 2HSEB 3HVRA 3NL0A 2KFZA 5F8IA 3TNVA 3BSOA 5KOXA 2CWXA 1QDUB 1WTBA 2DRBA 4ZVFA 4O4GA 1RT6A 4ZA1A 4DJBA 4ID5A 3AD7C 1OY6A 1QUPA 1KQFB 3V81A 3OL9A 2BJ3A 2R7UA 5CAAA 3SCLE 2AGQA 3MUMP 3D66A 4C3MA 3HD1A 3KLIA 4DUZF 3V4MA 1DLOA 5AXLA 2QZ8A 4YEAA 3KJFB 4MFBB 5IQQA 3BQ2A 1HBUB 2D3UA 2IY5B 2XMAA 3VGVA 1IWAA 3L7PA 1CJKA 4DCJB 4R25A 1WORA 2YQ1A 4IFVB 7FD1A 1NHVA 2EC2A 2OPSB 4TLRA 4LR7A 2MKSA 4A4JA 2VBZA 3JTOA 5MAOA 3TUPA 1PIEA 2XG8A 1U09A 4DL0C 3L7UA 1QSLA 1ICEB 1RCXB 3I9V9 2EK6A 4WE1A 1RYRA 1F9HA 1Z2ZA 3ITHB 1REVB 3MEEB 3OTBA 1CQNA 1HNVB 4NEZA 4DU8A 2V8HA 3THTA 5FIIA 3KK1B 4YDXA 2CQ0A 2HIQA 2V5HG 4WIIA 1T03A 3EZOA 3DLEB 1RJJA 1TAUA 3EUNA 3MMBA 2KRRA 5AE1A 1Q5VA 1N54B 2YQ3A 2KHCA 3PO4A 1S1WA 3UE2A 4LF8F 1B64A 3HM9A 5KFMA 3DN9A 3BYRA 3H5UA 2IBKA 4NLTA 4AE5A 3TUZC 3MAAA 3MR2A 3CDWA 1R8PA 2BUNA 4RZRA 1FDDA 2V68A 2HS4A 1N33J 3HVTA 1RAGB 3R5JB 5L39A 4DL5A 3ICLA 3EMTA 2OFGX 3PJWA 2ZZMA 2F7VA 4O3OA 4DQPA 3A3OB 2HQCA 3BDPA 2ZH1A 3SSRA 1RWNB 2HHHF 4USTA 2E1CA 4DMZA 4XO0A 3D2WA 3MPUB 3ZO7A 4DV3F 1O5JA 1WACA 3I5AA 2HVDA 3TEHB 1R6YA 2PIIA 1YJTA 2FHJA 5F8MA 5ETTA 1HHTP 5FLXU 2FJDB 5E7OB 5KFHA 1GFWB 2UU9F 1X4BA 2CYYA 1S1XB 3C6UA 4ED8A 4Z7CA 4JI2F 3AODA 3GIJA 1WNEA 4N47A 4CO0A 1S72S 1FKOA 5HSPA 1IKWB 5J2PA 2FY8A 4JI3F 4JI8J 5L1KA 4Y65A 1SXLA 4QWEA 3NCPA 3LP0B 1UFKA 3V6DB 1F9EB 1RAIB 4LSZB 1T9TA 2ZBIA 1S7IA 2RDIA 2Y0BB 1B70B 4HACA 2CZVC 2MHEA 1CLFA 3DI6A 3TAMB 5I42A 1J2VA 2WB1D 2R42A 4J9SA 3QLHB 8RUCA 2EVZA 5H9EK 3CC7S 3H90A 2YWKA 4RUBA 2RUGA 4O3PA 2B3TB 4WPAA 3VTIA 2HQFA 1VOMA 4Y34A 1FRJA 4AUKA 3ZTRA 3D6MB 2HHVA 4QIFA 4OHXA 3JSMA 4JUZA 3G9CA 3HSDA 2FHMA 5D0GA 4M5IA 2ZD1B 1F0XA 4RW8A 4PEOA 4F67A 2JEGA 4LRAA 4OHWA 2XNQA 2HAIA 2P6TA 2NUHA 3DRPA 4WZQA 1UJ4A 1S76D 3ZZTA 3B6BA 3CDBA 4DPOA 2CZ4A 2VL1A 4FKXA 3GYGA 4WU3A 1NXIA 3MEKA 4ICLA 1QLNA 1NJXA 3T6BA 4DV1J 1DQ9A 3M6VA 2HRYA 3LWLA 1FJGF 3DOMA 3TO8A 3GJRB 4JI1J 4IO1A 1YGYA 4PWWA 2DB1A 1VQ7S 2LCWA 2YNHA 3CCZA 5KG3A 2XI2A 1LW0A 4C8NA 2B7CB 2M8DB 5LSLA 3H8YA 3CO0P 4RW7A 1UETA 2YWGA 2GMHA 3A8KA 1DFDA 1X0PA 2JC1A 1U1OA 2OPQA 4ZP9A 2FGCA 2D41A 2GGPB 1ULRA 3AXMA 3I9ZA 4OL8A 2JEJA 3CCWA 1RTHA 3TI0A 1X31C 3EWGA 2PEHA 2RRAA 3GQCA 1UJ6A 2DR8A 3HSJA 3TW0A 3HO1A 1FKPA 2A2DA 1F60B 5J1PA 4TNOA 4KT0C 4QU6A 1VR6A 2PD1A 2QYCA 1NZAA 1DAXA 2OSQA 3WIUA 2RE1A 4B3MJ 3UDCA 3R2DJ 1F2GA 2XBPA 4WU2A 4LMZA 2DHSA 3CJRA 2BR0A 4O0IA 3O1LA 3D1QA 3L7OA 4ZCIA 1IKYA 3NS7B 3KG4A 2CJBA 4C0OC 4NMLA 3HHDA 1U6FA 2Z8QA 3C8YA 2NS1B 2V34A 1EKRA 1NDKA 3FBFA 2RRNA 4UZBA 1R43A 2AX0A 2F5GA 1U2CA 4DX5A 1JB0C 1RT4B 1T94A 3RTVA 1KOOA 4B3OA 3RRHA 6AT1B 1SCJB 4LF7J 4I67A 2BW2A 2JLFA 3FFIA 3ENVA 3IRWP 3PKYA 4ZVRB 1Y5IB 2CFXA 1XMQJ 2ROPA 3I5CA 1OS5A 3R27A 4M5LA 2DH9A 1WKLA 5A6WA 1JMTA 3EVMA 4GVBA 1VMBA 4GKKJ 2G1HA 3MEDB 4MMOA 4B9MA 3DOLB 4DX7A 3T5HA 2KT5A 4DFPA 3W3SA 2IA0A 1V5IB 2DIUA 1OQ3A 8AT1B 2O1PA 1REGX 3LP2B 1V3ZA 3Q8UA 1JKHA 4MIWA 3RZAA 4P7VA 1F3FA 4F4WA 2EBGA 4GO7X 3I0SA 3TJ8A 3DRRB 1B99A 3DRXA 2HGLA 2VBYA 5KFFA 2E9ZA 4ER8A 5GAGI 3OTDA 2HLTA 1UWAA 5LMUF 1GQEA 1J27A 1S9GB 5K14A 3KG0A 5L9NA 4DEZA 3UD4P 3CJ3A 2I0XA 1E6VA 2W9CB 3MFIA 2XO7A 2ADCA 3ILJA 1Q8KA 3PRDA 3G71S 4ED2A 2BRKA 4O3SA 1N5YA 3LGHA 3PW2A 2QFIA 4QR1A 4LFBJ 5HAOA 1N52B 4AXIA 3SV3A 4DV2F 3SQOP 2J8AA 2QLXA 1P1TA 1IBLJ 2DCLA 4OYXA 1T9UA 2YNIB 4OZJA 2RF2B 2V50A 5I3UA 2XY6A 5DQIA 2QL7B 3T1HJ 9RUBA 2DR9A 2LQ9A 4KPCA 2XS2A 4RW6B 4JI5J 5ETPA 2ZVSA 4CH7A 3C19A 2CKWA 4RNOA 4DX8H 3M8SA 3AHPA 4CLSA 3T19A 3NNHA 4Y2KA 3KJVB 1YI2S 2KN4A 1M5VC 4WFNQ 3IXQA 2KG0A 2K7JA 3KK3A 3SMZA 3OXGA 1HWIA 5ETNA 2KXFA 4I7FB 2HGMA 3R9LA 1R6VA 1BE4A 3IWLA 2VU5A 3MM6A 1VQOS 1L3SA 3JYTB 1U7LA 3HI9A 4KHMA 1BHNA 1FDBA 1N0VC 3MM5B 3BGRB 3ZZYA 3D1HA 1Q8IA 1HNWJ 4ECTA 2AP6A 1H6KX 4HL9A 2RILA 1NSPA 4RNFA 4KKOA 3T6JA 2GAGC 4ZIWA 1DY3A 3QZ8A 4ECZA 2WVCA 2B6AB 2IM2A 1W2IA 3MD3A 3BBFA 4YR0A 4ECYA 4NE9C 1F1BB 4UOGA 4NLPA 2VOOA 4NLOA 4PR6A 2J5AA 3KXDA 1OQ6A 2I9SA 2K06A 2EW9A 3V4IB 3T5JA 1H2TZ 3MR5A 1UEUA 2JRSA 5DDOC 1S77D 3NMAA 2P5VA 1I6JA 4NLRA 4WYWA 3UN3A 2IVFB 4B9UA 3FZBA 3D6HB 1UA0A 2ZHBA 2E5HA 2JEIA 1YZ7A 2XI3A 1S1TA 3BKUA 3EVOA 1JJ4A 1PJ7A 3CE8A 1SJ1A 1FD8A 4LF6J 2VPZB 2Z2LA 1FJEB 4ETZA 4FF3A 1RT3B 3I31A 4UOHA 3RU0A 3UR0A 4ES3A 2BANA 4ES1A 5L38A 1P8GA 4GRSA 1RWOB 3MMAA 2HVZA 2QMWA 1SI9A 4NXNJ 1RHJB 3KHRA 4DBQA 2B4OA 5CHCB 4QWCA 4ITSA 1TL3B 3MUVP 2OPPB 3C16B 3PZPA 1VC6A 3J7Z5 2EFQA 2B4UA 2JL9A 4NA3A 1S5ZA 4N7TA 5KOWA 3LW5C 2FB0A 5D0HA 5EGYA 4TY8B 2E9RX 2E9TA 4PWDA 1WEXA 2MYFA 2BE7D 3V6HA 3JXOA 2EG2A 2NUUG 5I3QA 1ZTTA 2N4DA 5JJBA 1KBRA 4BHQA 1S4EA 2DGUA 3KLHA 1YJUA 3MPDA 5KFDA 4LIRA 4U67Q 2C2ZB 2AEJA 2HNYB 2P9CA 1CEZA 2LQ5A 5EX3A 1C4CA 4XPEA 4JBCA 3UD5A 1KOHA 4MYTA 1TK8A 3MR3A 1IBCB 4O44B 3MWBA 3W66A 1KVIA 1MWYA 1X9WA 2HWIA 4N56A 1O0PA 4CLFA 2PO4A 3G8QA 2F40A 1BUXA 3NOGA 5DG8A 3DFEA 5F0WA 2DR5A 1FNXH 3B8HA 1TL7A 1N48A 5HMXA 3G82B 1EQMA 1J5OB 3W5YA 1SC3B 4TYAA 4WFBQ 1XJWB 4U96A 3D9BA 1VLOA 2UVUA 4A8KA 1VQMS 1HIYA 3PIOQ 2K3KA 2WONB 1NUEA 3KKFA 5BR8J 2GQQA 2A10A 1S79A 2L9NA 4UQGA 4K5SA 2J76E 5HBMA 2IM3A 1VQKS 1QY7A 4G65A 3FK4A 4QPXA 4DV6J 2N3LA 3RGIA 1CULA 2J9DE 4L76A 2CQ4A 5EWEA 1KFDA 2ROEA 5IS2A 1C1BB 2E66A 2VASA 1WG4A 4RW9B 2HS3A 4DR3F 2NPIA 2LU1A 2K7KA 4CLLA 3Q8VA 1Y3JA 5IT4A 1Q0NA 2B7BB 1WHXA 3ZXWA 2H51B 5DQGA 2E7VA 1GMWA 5HP1B 2HHSA 1GNKA 3CGIA 3GIRA 1H7XA 1TELA 1X4HA 2GFFA 1N56A 2IDEA 4IG3A 2V9WA 4IDKA 1T95A 4I1TA 3Q86A 2WK4A 2NXJA 4NCGA 2QEXS 1R8HA 4OX7A 1F5AA 5ITHA 5DJBA 1EARA 1FKAF 3UFCX 1WI6A 6FD1A 3MGJA 2M52A 4YP3A 4DL2A 1N33F 3NGTA 3BGUA 2GZOA 2W8KA 3KNGA 4NZ6A 1U1NA 2VD3A 4FYXB 2DXEA 1UZHA 3KJQB 4OI2A 3KHHA 2BQRA 2FYXA 4GC6A 3SV4A 4C3KA 2V2KA 2LDYA 4R5PA 2AU0A 5HVFA 2XMJA 2C3MA 2R7WA 2J8SA 1PGZA 4LFAJ 1U2RA 4OZLA 4C3LA 4QIVA 1GK8A 2VFSA 2J9CA 4PUOB 5FJ4A 3CMQA 3DLJA 3T41A 3N6LA 3RBZA 3GR0A 4QZVB 1MWZA 4GKJJ 3RAXA 4KGXB 2DRDA 3BPDA 3GG1A 3EGZA 1S6QB 5C24A 4IQMA 5KAKA 1LWCA 1RB0A 3C6TA 4KV8A 2FJAB 1MSWD 3HHLB 3AA9A 2VPWB 4K5RA 2Z0GA 4JI8F 4PXBA 4AL6A 4B9LA 2DNNA 1JK9B 1AZSB 2DGQA 1PJ5A 3R1HA 3CWJA 4M5DA 2QO3A 1PYSB 1NJYA 3HPOA 3TA1A 1WHWA 1OPZA 2ZZNA 1JXEA 5C42B 4IQXA 4JI0J 3H42A 2ZKUA 4ENOA 1K73T 5H1SV 3OR2B 3BKFA 4WXOA 2PMHA 2CPFA 2BE2B 2BQ3A 3GFXA 3CCVS 3DM2B 4K4UA 3DGPB 4H4OB 4RW4B 3BH7B 1UVKA 1U4BA 3UQSA 2DNZA 4DR2J 3CCES 4CLZA 2HQ3A 2F8MA 3B54A 4DSEA 3MM9A 2A6MA 2VH7A 2AYEA 3MMJA 3E3XA 3GV5B 2Z2MA 2EG1A 3HHEA 1SVDA 1A6LA 1XK8A 3DRSB 1YBUA 4DV1F 4KGKA 4JI1F 4DUTA 4EU0A 3Q0AA 3QGPA 2DY1A 2WAQD 5CCLA 4IG0A 3R5GA 3RB0A 4OHVA 2NXEA 5IZHA 4RO0A 1UWBB 5A76A 1IXKA 2FZCB 2GJFA 3BO2A 3ZTPA 2XQCA 3BKTA 1PYTA 2XLIA 4EBDA 4WJBA 3DHWC 4OX9J 3Q2TC 3BO4A 5F0UA 3OVSA 2OIHA 1R0AA 3MAQA 3I32A 5T41A 4RR5A 1FE4A 4F2SA 2Y0SD 2DXDA 5HVGA 4WBFA 2NSCA 3THPA 4IFYB 3HZGA 4DU7A 4IOCQ 2E5JA 3QGGA 2KXHA 2R8HA 3DYAB 3AB4B 2RNEA 1KS2A 3LPEA 3VVTA 4I2QA 1SIWB 2UXBF 2LA6A 2C28A 2BJ7A 3F41A 4B3MF 2E1PA 3AT1B 3M9NB 2KT2A 5GVQA 2AZ1A 4R8UA 2FJVA 1PG5B 2IC3A 5B7WA 2BOAA 4ZVSB 3CIMA 2QTWA 2HKEA 3RW7A 2VB6A 3PYEA 2C22A 2AYBA 3ILLA 4OZ1A 2P2CB 3N5FA 2CA9A 1RT5A 5F8HA 2BYCA 2VHGA 4LT6A 5L1IA 4F2RA 2I8EA 3NRBA 4TKTA 2UUAF 2B9XA 1K44A 5AJ3J 2J9EA 4OZNA 3WZ0A 5C5JA 5LOQA 2O3DA 1HPZA 2QE5A 2QSWA 5CYMA 1HNZF 4LF7F 4MKBA 3V6KA 2CQCA 2NYIA 3NS6A 3NOCA 2V8VA 2ACYA 4V19X 2VC0A 1EP4B 4RX6A 5EDWA 3FRYA 1XMQF 2ZBQA 5DS7A 4TQRA 4OV6A 2CXEA 1HBOA 3EM1A 2P6SA 3OPKA 4QIWD 3BREA 2ASLA 1VGYA 1TUGB 3KHGA 4GKKF 1TKZA 1RTIA 2CJXB 1JLQA 1RKIA 2R2UA 2I38A 4H4MA 4NLQA 1M1HA 3GIMA 3WDOA 4U6PA 3CD7A 2IM1A 4B9TA 4YDDB 4HKQA 3DDIA 3FCWA 4U7CA 1R8CA 5J2MA 4F25A 3TUJC 3Q22A 3HT0A 1BQMB 3HULA 2M7SA 3BM7A 4EWTA 4OYBA 4PG7A 1O8BA 3R5DA 4WKYA 3W8PA 2XHCA 5DGBA 1NMEB 2NZCA 1HW8A 4ANEA 2BX6A 3GMGA 5KG4A 4E2FB 2LVWA 2CNNB 2GVDB 3QFWA 2YPZA 2H9ZA 2ZWOA 1TR0A 3GCWP 5J1NA 4WWSA 2R7QA 2NXNA 3AH6A 3NS5A 3KHLA 4OZ5A 1J5EJ 3K2YA 1TU0B 1WF0A 2L9DA 3JQKA 4F3QA 4EK2A 1CPZA 2XC9A 3Q23A 3K5NA 4M5HA 2OD4A 2MZ1A 3F73A 1PJ6A 3PY8A 3OTEA 2MLXA 2OFHX 1IBLF 3MCSA 1VQYA 2CPIA 1C0TA 2GJIA 2L48A 2IA6A 1NK9A 4DI6A 1Y9OA 3T1HF 4FN5A 4UZCA 4DN0A 2W4DA 1F3VA 3NGSA 4I64A 2GVZA 2AJ4A 4UOCA 3FZ2A 1N6QA 1QE1B 1U49A 2HBYB 1Y0HA 3B78A 4DV4J 3KFWX 2N3OA 4PRFA 4KC5A 1UTAA 2VFUA 4Q44A 4PAAA 2XGPA 3M30B 2WVEA 1P9YA 2XSJB 1KWMA 3LPYA 3JS9A 5M2RA 3KNAA 3RAMA 5HANA 4XK8C 1GXUA 4LREA 4F3OA 4DF4A 4I0WA 1UMJA 1UCNA 1L3UA 4FF2A 4NLVA 3NXZA 4F0HA 5D77A 1BWEA 4X4PA 2VFRA 2U1AA 1RISA 3OBIA 1HNWF 3MXHP 4RJVA 1AROP 3H5SA 4CO5A 1SJQA 2Y1LB 4MFBA 4DCPB 1HBUA 5C2GA 2KJWA 2VKZG 3PHEA 3DOKA 5EWGA 4G3IA 2XY5A 3DLKB 1TQLA 1OO0B 2ZOMA 5ADZA 4CNYA 1RUSA 4IFVA 2HURA 3M8QB 3M9MB 1NK8A 2BBEA 2OPSA 1N36J 3HT3A 3E01B 2DH8A 2LECA 1XBWA 1RWPB 5ETOA 2MQMA 2M88A 5E2QA 5A2QY 2ZH4A 3CPWR 3H59A 3EPGA 2MZTA 1LNQA 3ITHA 4X4QA 2RB7A 3MEEA 2Z30B 2YX1A 3HHKA 2R2SA 4IYQA 1HNVA 2BW7A 1LWFB 4MJKA 1G2EA 3GFHA 2NZ4A 5IFMA 2V6AA 3KK1A 1S49A 1G4CA 3D3CJ 3TQ1A 4K4XA 4LF6F 5IC6B 1RHKB 1GT8A 3DHXA 1RP5A 1SUQB 2C3PA 1Q8BA 2YWFA 1Y00A 1W26A 5HROA 3PCOB 3W7BA 1KLNA 1KKHA 1VC5A 3LAMA 2F8HA 4NLGA 4DR7J 4NXNF 4Q45A 5IM0B 3RR8A 3CJ8A 2DBBA 1NPKA 1HMVA 2B5JB 3D0HE 3QYYA 2D7SA 3L3CA 4V1Ak 2DHGA 1XERA 4YR3A 1R89A 2I5JB 1R3NA 3MECB 1X9MA 4WK3A 4AXJA 4MK9A 3EXCX 2KXNB 2G13A 1TK0A 2OMOA 3RG6A 4HYKA 2B8PA 3FJ2A 3G6YA 3UW1A 4IR9A 1MU2B 5LT5A 1X5SA 2XCPA 2OELA 2WVFA 5IV4A 4DR1J 3Q89A 3PR5B 5F9LA 1WSRA 3R97A 4DOZA 2A2CA 4AQYF 2HBRB 3KLFB 3AJDA 4XTTA 3DMJB 2BE9B 1FHTA 3LANA 4Q2MA 4NLSA 2HVIA 1JWWA 2XMKA 2V0NA 4CLPA 5BR8F 2XLKA 3LP0A 3TA0A 2CIMA 3V6DA 1LKZA 1IM6A 1DRZA 1PC5A 5KFWA 1X0FA 2C2NA 2E1AA 1SL2A 1X8DA 1RT1B 3TAMA 2CQ2A 3OW2R 1BQNB 3QLHA 4KFBB 2D3ZA 2JDJA 3D68A 3D5MA 3G8SA 2AYGA 2M4MA 4JV0A 1VQ6S 2IVMA 4HI2A 2E1RA 4WYLA 3A8EA 3HHNB 5EUHA 4USIA 2L41A 4RNHA 1KDNA 2ZD1A 2PT0A 1T05B 1WKKA 4W90B 1VHFA 1Q82T 2VODA 2QMXA 2GMLA 3BGOP 3TJ9A 3P6YC 3K17A 5KT5A 2V2ZA 2BMBA 1VK8A 2MLZA 2GHVC 5JVGQ 4NYPA 2W7AA 1HYSB 2I2YA 2R2TA 5DM7Q 3S7RA 4HTIA 5L9XA 1RABB 1U8WA 2HS0A 5HN0A 3DXBA 1G3OA 3EDRB 3W60A 4K4YA 3GONA 4DXLA 1Q16B 4LVNP 1FFSB 3EX7B 2W2PP 3GLJA 2RU9A 5KFSA 2EI5A 4XDCA 1E6YA 2JNJA 1RBLA 3CULA 4LFAF 2EFOA 3D0GE 2DGSA 1UJ5A 2GGPA 1Q86T 2VFTA 1KTVA 4F4XA 2RVJA 4YFUA 1QVFR 2KO1A 3CMAS 1YJWS 2YKQA 4Z7YA 1Q81T 3PX6A 3D3BJ 4A8WA 2FHJD 2NQPA 4GKJF 2RT3A 1B3TA 3KUHA 4OHZA 4C8OA 3IAS9 1RLDA 2DGWA 4OI1A 1UP1A 4C6AA 2MEWA 3OHBA 2IDLA 3HX9A 4CM2A 1LWEB 2FC8A 4OQJA 2DO0A 2DNRA 1RKJA 3GFZA 2VQEJ 1EAYC 2V4JB 3HHLC 4ZOSA 1S10A 1CJKB 4LBIA 2EFPA 2HVEA 2LQBA 4WFAQ 4E0DA 3O6QA 3CSKA 1AXQA 3EGVA 4HHUA 5KG6A 5B0FA 3I87A 4R0EA 2VDIA 2YNFB 2C42A 1KEKA 4PG8A 2ROGA 3OSPA 4JI0F 4WE1B 4U95A 4OJGA 2HNDB 4J9MA 5A0YB 1RT4A 4OJHA 2V8PA 4C8YA 1M5OC 3KJNB 1UEVA 2UV8G 1CJUA 2UVVA 4O3NA 5IQ6A 2DO4A 3UWTA 1BLUA 1GAOA 1T11A 2HRTA 3CJ4A 3M2VB 1UKUA 2K3IA 1ZETA 2Z58B 1S1VB 3O5TB 4PG5A 3T9NA 1U1RA 1R8BA 5DO2A 2CDQA 4DR2F 5G4DA 1S1WB 1VJWA 4LF2A 4GC7A 2V8GA 2HQIA 2IYIA 1TMMA 2OUGA 3R3TA 4FYWB 2W2MP 2V4RA 4FXDA 2XULA 2AJ1A 1NK7A 3TZWA 1JQGA 1VRTB 2FC9A 1LK7A 3MEDA 1IUJA 1ZM2A 3MAAB 2DHHA 2EFVA 4ZN3A 2MKCA 5KFOA 3ETOA 5JUMA 2AV5A 1S99A 2VOPA 5CYQB 1IR2A 3LP2A 3DU6A 1S6PB 5LSOA 1HD1A 1CJVB 2RQKA 2J6UA 4OX9F 1WG1A 1U1LA 3R2CJ 2F4VJ 3DRRA 2EXUA 2DEIA 5DM6Q 1OMSA 3NGUA 3J7YI 3OFEA 4EBCA 2UVWA 3IM8A 4X2BA 5D3GB 3POTB 4OZ0A 4FBTA 1R31A 3V5RA 3OTCA 1AW0A 1PCAA 5D0EA 1Q7YT 1TKTB 1S9GA 2VG6B 2W9CA 4NMXA 1K8AT 4MIBA 4EZ6A 3NY0A 1HLWA 3Q8SB 2NPFA 3HKWA 4J9VA 1RYSA 3OXLA 4DQIA 2HBQB 2ZH7A 2RH3A 3AQOA 4MK7A 3BN4A 4C8KA 1RLCL 1RU2A 3IRXB 1JIHA 1DBDA 4KSEB 2CQPA 1ZM4A 2CNKB 1KHVA 1HQUB 1S57A 5H9FK 1MROB 3BR8A
chains in the Genus database with same CATH topology
2UXDJ 4V1Ak 1FJGJ 4JI7J 1XMQJ 4HHUA 4JYAJ 3J7AN 5LM7E 4DR5J 3OTOJ 4AQYJ 4B3RJ 4X65J 1XMOJ 2MQ8A 4B3SJ 1N32J 4B3MJ 3R2DJ 2ZM6J 2KVQE 4LF9J 4JV5J 4LFBJ 4LF6J 4LF4J 4DV5J 1HNWJ 3R2CJ 2F4VJ 4KY3A 4GKKJ 4DV1J 4GKJJ 4JI8J 2UXCJ 4X64J 4X62J 4KHPJ 1XNRJ 4JI1J 5IT9U 2HHHJ 1IBLJ 4PWWA 2UUAJ 4DR2J 1I94J 4DV7J 4DV3J 1N33J 3T1HJ 4NEYA 1IBKJ 3D3CJ 4DR3J 1J5EJ 4LFCJ 1HNXJ 3D3BJ 4DR1J 4NXNJ 4JI5J 4JI6J 2VQFJ 4RJVA 4LF5J 1HNZJ 5LMUJ 4LFAJ 5LMNJ 5BR8J 4YY3J 4DR4J 4K0KJ 1HR0J 2UUBJ 2MEWA 4DUYJ 3JAMU 2KL8A 1N34J 4DUZJ 3T1YJ 2UU9J 4KYZA 4NXMJ 1XNQJ 4NEZA 1IBMJ 2UXBJ 4DR7J 4JI4J 4DV6J 4LF8J 3IMQJ 4JI2J 2E5LJ 4LF7J 2UUCJ 3J80U 2VQEJ 3W1YC 5A2QU 5IWAJ 4YHHJ 4OX9J 4JI0J 4DR6J 5FLXU 4DV0J 2MTLA 5AJ3J 4DV4J 4JI3J 4DV2J 3J81U 4B3TJ 4X66J 1N36J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXD J;  4V1A k;  1FJG J;  4JI7 J;  1XMQ J;  4HHU A;  4JYA J;  3J7A N;  5LM7 E;  4DR5 J;  3OTO J;  4AQY J;  4B3R J;  4X65 J;  1XMO J;  2MQ8 A;  4B3S J;  1N32 J;  4B3M J;  3R2D J;  2ZM6 J;  2KVQ E;  4LF9 J;  4JV5 J;  4LFB J;  4LF6 J;  4LF4 J;  4DV5 J;  1HNW J;  3R2C J;  2F4V J;  4KY3 A;  4GKK J;  4DV1 J;  4GKJ J;  4JI8 J;  2UXC J;  4X64 J;  4X62 J;  4KHP J;  1XNR J;  4JI1 J;  5IT9 U;  2HHH J;  1IBL J;  4PWW A;  2UUA J;  4DR2 J;  1I94 J;  4DV7 J;  4DV3 J;  1N33 J;  3T1H J;  4NEY A;  1IBK J;  3D3C J;  4DR3 J;  1J5E J;  4LFC J;  1HNX J;  3D3B J;  4DR1 J;  4NXN J;  4JI5 J;  4JI6 J;  2VQF J;  4RJV A;  4LF5 J;  1HNZ J;  5LMU J;  4LFA J;  5LMN J;  5BR8 J;  4YY3 J;  4DR4 J;  4K0K J;  1HR0 J;  2UUB J;  2MEW A;  4DUY J;  3JAM U;  2KL8 A;  1N34 J;  4DUZ J;  3T1Y J;  2UU9 J;  4KYZ A;  4NXM J;  1XNQ J;  4NEZ A;  1IBM J;  2UXB J;  4DR7 J;  4JI4 J;  4DV6 J;  4LF8 J;  3IMQ J;  4JI2 J;  2E5L J;  4LF7 J;  2UUC J;  3J80 U;  2VQE J;  3W1Y C;  5A2Q U;  5IWA J;  4YHH J;  4OX9 J;  4JI0 J;  4DR6 J;  5FLX U;  4DV0 J;  2MTL A;  5AJ3 J;  4DV4 J;  4JI3 J;  4DV2 J;  3J81 U;  4B3T J;  4X66 J;  1N36 J; 
#chains in the Genus database with same CATH topology
 2YNI A;  2RF2 A;  2YPY A;  5A6P A;  3JTN A;  4QYZ K;  1K1S A;  4FPR A;  2XEX A;  3HZE A;  3DDK A;  3LO3 A;  4LQ3 A;  8ATC B;  4RW6 A;  4HAC B;  4OLP A;  5B09 A;  3PEH A;  5A8K B;  3KOA A;  2P8I A;  4USJ C;  1LFP A;  3PNI A;  3OJS A;  5AJ3 F;  2QJ3 A;  1S0N A;  2UXC J;  4NLY A;  1ZPW X;  1Y5N B;  4F02 A;  2IRY A;  2MJN A;  3DXS X;  2YKA A;  2R2R A;  3GB0 A;  4LBH A;  1Q95 G;  4X4O A;  4IUF A;  1ZAW A;  4I7F A;  4DPT A;  1MMN A;  3TAR A;  1S0M A;  3JYT A;  3OR1 B;  1HWL A;  4DUY J;  4LRB A;  2PC6 A;  3MM5 A;  2MQL A;  3BGR A;  1TTH B;  4LBP A;  1FRK A;  2YKN B;  4FS2 A;  4MK8 A;  2V2Q A;  1RTJ B;  5A8W B;  1D9F A;  4LSL B;  2B6A A;  3WIV A;  4CYU B;  3D7S B;  3R6L B;  2G9O A;  5AXK A;  3V6J A;  3HMJ G;  2RRB A;  4Y3C A;  4KR0 B;  1NSK L;  3R5A A;  5L8R C;  1Q5Y A;  1UW9 A;  1SQE A;  2KYZ A;  1N0U A;  1SJF A;  2J0Q D;  3SSS A;  2EKY A;  3CUN A;  4Q0B B;  1VBK A;  3IAM 9;  5B0A A;  1KHW A;  2HLU A;  1QAI A;  1URN A;  2BQU A;  3IBC B;  2AJQ A;  4K2X A;  2CPX A;  4DV7 J;  1WTF A;  1XC9 A;  3H98 A;  3U27 A;  1MLA A;  2GNK A;  5IOL A;  1XR7 A;  3LA0 A;  2V67 A;  3RRK A;  1SKW A;  2H54 B;  3MEG A;  4Y2I A;  2OPR B;  4OX6 A;  2BRL A;  4CWB A;  4DPU A;  3I82 A;  5KFA A;  1QTM A;  3FKB A;  1FX4 A;  5KG2 A;  3ADA C;  1J5E F;  4ELT A;  3DKD A;  1MG7 A;  2MZS A;  3PFO A;  2HFV A;  3KMQ A;  3JSB A;  4ILR A;  3I4H X;  2B9E A;  4F04 B;  5HL7 Q;  2NCK L;  5K5M A;  1RT3 A;  4UUX A;  4WKR A;  2FUG 9;  1HW9 A;  2KFN A;  3Q83 A;  3O3L A;  2AF6 A;  3PFE A;  2QSF A;  1NSA A;  2EPI A;  5CZV A;  1FK9 B;  3QT7 A;  4DLG A;  4J9Q A;  3HP6 A;  2OPP A;  4DV4 F;  1CC7 A;  3C16 A;  4C7Q A;  3CED A;  5GAE U;  1HBN B;  1CS4 B;  3NNA A;  2CQ3 A;  3CJK B;  3D4J A;  1BWV A;  1IBK J;  1X9S A;  4TY8 A;  4YME A;  2P9E A;  2MHN A;  3M8Y A;  3SQG B;  2FLN A;  2HNY A;  1Q79 A;  4P6Q A;  3W2W B;  4OJ3 A;  3CC2 S;  2FJE B;  3NNC A;  1Q7L B;  2ZDP A;  4O44 A;  1NH7 A;  4ZJQ A;  4GVB B;  1NDP A;  5A2Q U;  3E8O A;  2E7X A;  1FF2 A;  2OLW A;  2G1D A;  1YZ6 A;  4ECQ A;  2DT9 A;  4K8R A;  1M90 T;  1XMB A;  1J5O A;  1UEK A;  3KLE B;  4F3M A;  2QA1 A;  3MHY A;  1K0V A;  4Y2M A;  4IO9 Q;  4KE5 A;  3LOU A;  5CZX A;  3EZU A;  1ZZN A;  1SC1 B;  4OI0 A;  2WON A;  1YBT A;  3D28 A;  1SH0 A;  4X62 J;  4ZS6 A;  1N36 F;  4IR1 A;  4J91 A;  2KB2 A;  1FRI A;  2V8D A;  4ERD A;  5ETK A;  1AUS L;  2W4C A;  2I6W A;  5K8M A;  2PA8 D;  3VZH A;  3T5L A;  2CPD A;  5HMZ A;  1AFI A;  2GC8 A;  3C2P A;  2HHX A;  3OD2 A;  2DNO A;  1C1B A;  5HQM A;  4YB6 A;  4F7V A;  1NHU A;  3C66 A;  4RW9 A;  3TOQ A;  2C3Y A;  2XMT A;  3IFE A;  1N5Y B;  4K2J A;  1SH3 A;  2HFO A;  3FSY A;  1JLB B;  5DDP C;  4QWB A;  1YTY A;  3CTR A;  5HP1 A;  1NND A;  2K1R B;  1YIJ S;  2VJV A;  5KG0 A;  2PE8 A;  2WW8 A;  2ZH5 A;  4J9P A;  1RBO B;  1Y7P A;  3GII A;  5FDL B;  2R7V A;  5HQL A;  1UL3 A;  4DR7 F;  3OTO J;  2G0J A;  2Y8Y A;  4I56 A;  1OWX A;  2M8H A;  2HHT A;  4FYY B;  1RHU B;  1U2F A;  2D1C A;  4X64 J;  4EO6 A;  1NB7 A;  5CD4 H;  3BQ1 A;  1KR4 A;  4YS2 A;  4K7Q A;  2PFD A;  4PCQ A;  3H40 A;  4DR3 J;  5DG7 A;  4BS2 A;  2DR6 A;  4UQT A;  2V63 A;  5KFL A;  1RHM B;  1RHR B;  4A8O A;  2BDP A;  3UNY A;  1U1P A;  2JOQ A;  4ZP6 A;  2UUB J;  3MM6 B;  2R7O A;  5CH7 B;  4PUO A;  4ZVH A;  4NCB A;  4OX8 A;  3T1Y J;  3NGR A;  2VF3 A;  2CDR B;  1VIX A;  4DR1 F;  1KLM B;  2YKM B;  3CB4 A;  4URS A;  3VV2 B;  4LJM A;  3LUY A;  4ED1 A;  1FJC A;  1S6Q A;  5BXI A;  2GHW A;  1RWU A;  3SYZ A;  1HNI B;  3W8G A;  1NJI T;  4C98 A;  4TU7 A;  2AD9 A;  1OYD A;  1JLA B;  3HHL A;  5AE2 A;  1M0S A;  4JV5 J;  1CC8 A;  1ZAX A;  3ULH A;  2MKY A;  1FWP A;  2EKN A;  2LLZ A;  3WX4 A;  1AZS A;  5DDQ C;  2CVI A;  1I94 J;  2QV6 A;  3M9O B;  4RU9 A;  1AA1 B;  2YWH A;  2CJ9 A;  4LUB A;  3OQ2 A;  4RWX A;  3OHA A;  3IWX A;  1WC1 A;  5C42 A;  3U1L A;  4ZLJ A;  4Z37 A;  4EYI B;  2APO A;  2ZNZ A;  3EE3 A;  4DN9 A;  2G2O A;  1WEZ A;  3IS9 B;  3HD2 A;  1WC5 A;  2RQC A;  3OVB A;  1TUV A;  1ZTW A;  2YY3 A;  3GE9 A;  4OI6 A;  1BQX A;  1R8A A;  2RML A;  3DM2 A;  4A48 A;  4H4O A;  4RW4 A;  3G8T A;  1C2P A;  1DHM A;  1GMW D;  3ILO A;  4RU2 A;  3TX0 A;  2DTJ A;  4BLG A;  4B3R J;  4OYI A;  1N32 J;  1TUW A;  2PMW A;  3MMC B;  3A8I A;  3DRS A;  1FVS A;  5DLF A;  3SCJ E;  1ZM9 A;  3G96 A;  1YRT A;  4G1I A;  4FXV A;  3SEO A;  2JWN A;  4KIA A;  3B4D A;  4CO1 A;  3DC2 A;  3VGS A;  2CAJ A;  1UWB A;  2PI4 A;  1VC0 A;  2AGP A;  4K50 A;  3N9U C;  2Y1R I;  1CSJ A;  1RA7 A;  1G6B A;  4LR8 A;  5K9F A;  3TAN A;  3FSI A;  1SKU B;  3CC4 S;  3KLH B;  4DS4 A;  1NB2 A;  1NO8 A;  4URQ U;  5DRK A;  4ILM A;  1YLX A;  1T9W A;  5LL6 d;  1JNZ B;  3GYN A;  2HRU A;  5KFY A;  3W5Z A;  2R7X A;  2LXU A;  3GJS B;  3TJA A;  1D09 B;  2Q1L A;  1F9F A;  2EK1 A;  2ZJP Q;  1U02 A;  3DYA A;  4WXW A;  3QT5 A;  3UNG C;  3UCG A;  3CCM S;  1GEH A;  4KB7 A;  3PHT A;  2BJ9 A;  1ZAV A;  3LWM A;  5DZ7 A;  4Z2X A;  2BJ8 A;  2QG9 B;  3CCJ S;  4QCL A;  2VQE F;  2H3E B;  2AIR B;  1RE1 B;  3IWN C;  4OYO A;  1KSP A;  3Q8Y A;  4DPW A;  3W63 A;  1F6T A;  1YJ9 S;  3NBP B;  2CJQ A;  5HBM B;  1EZZ B;  3M2U B;  4CP5 A;  3MFH A;  3W2V A;  2NYH A;  5KFG A;  4BC9 A;  1FCA A;  3T1A A;  4C11 B;  2HBZ B;  3MZI A;  1BD6 A;  2GS8 A;  5B08 A;  3CD0 A;  4ZIV A;  2H4W B;  5IXU A;  3EZ5 A;  2XZD B;  4IRD A;  3CDA A;  5CYJ A;  1QJH A;  2C2M B;  3FBE A;  2ALY B;  5IT9 Y;  4Q8F A;  3A13 A;  2VG7 B;  5KFQ A;  2HEK A;  2NXU A;  2W1B A;  2UXB J;  1XEZ A;  3IGV A;  4Y00 A;  3M7V A;  2Y9H A;  2OI2 A;  2AJ0 A;  1HQE B;  2DNL A;  1EP4 A;  2A18 A;  3JSR A;  4IG3 B;  4NZ0 A;  3VVU A;  2X1A A;  1X4E A;  2C2O B;  4J90 A;  4EBE A;  2X7I A;  1FRL A;  4LF9 J;  4DSI A;  4ECR A;  4OFZ A;  4CO3 A;  2XM3 A;  4IRC A;  1P27 B;  3MM7 B;  3PVX A;  3DU5 A;  4O3R A;  1SQF A;  2M2B A;  2UUA J;  1X4C A;  1RCO B;  3F0N A;  2MQP A;  2PMZ D;  4TU8 A;  2X1B A;  4C0H A;  1IQT A;  3MM8 B;  2E7W A;  4XDD A;  3SCI E;  2GV1 A;  2CWK A;  4I69 A;  4ED5 A;  1HNZ J;  2B4V A;  2F4V F;  4L74 A;  1BQM A;  2EEY A;  2YTC A;  3CF5 Q;  4YB1 P;  2IYG A;  4ZN1 A;  2UV8 A;  1QD1 A;  3TYT A;  2ZJQ Q;  1YJR A;  2XS5 A;  3VZI A;  2CQ1 A;  4BWM A;  4DPX A;  3MR7 A;  1HHQ A;  2GVD A;  1KC8 T;  2EFN A;  3OFG A;  3MCO A;  1KNZ A;  3DLG B;  1T9Y A;  3C6T B;  1AUD A;  2HHU A;  1TKX B;  2BXJ A;  2H4Y B;  5MLC V;  5T14 A;  4F4K A;  1GXT A;  3NGK A;  3QSY B;  3FGV A;  1Q78 A;  2OEJ A;  3SCK E;  4CLY A;  1IR1 A;  4ED4 A;  4LSN B;  1JLG B;  2OD6 A;  4LRD A;  4RNM A;  2ZH3 A;  1QE1 A;  5KFV A;  4PWU A;  2UXC F;  3O2I A;  5LSR A;  1PC4 A;  1FRM A;  2LDI A;  4HLB A;  2HPU A;  3M30 A;  2KH9 A;  5LJ5 Y;  4A8M P;  4KYZ A;  1NK4 A;  2XSJ A;  3QSI A;  4C9D A;  1IBM J;  3P4U B;  1NJW A;  2C2K B;  4AT1 B;  3FSX A;  4LIW A;  1F5C A;  4H4K A;  4LRF A;  5CQG A;  1TV6 B;  2ZWP A;  2AHO B;  2Y1J A;  3BDE A;  4DUY F;  2BKP A;  3PV8 A;  1RAH B;  2W24 A;  3SZ2 A;  5H9E J;  4MYU A;  5LXR A;  2GHP A;  1TMJ A;  4A8X A;  2JLE A;  1U26 A;  1ZA2 B;  4K4V A;  2ZHA A;  4G1P A;  4N41 A;  1UVL A;  4O4R A;  2GIQ A;  1T02 A;  3MCM A;  1RGV A;  3BGF A;  1RT2 B;  3FBC A;  2CPZ A;  3C15 B;  3GSI A;  1RAO A;  1U0S A;  3QRP A;  2YH1 A;  4G6V B;  4QIE A;  3DLK A;  4DR6 F;  3QAU A;  4X4T A;  3M8Q A;  1IKV B;  2HGN A;  4PXD A;  2G0I A;  4X4N A;  3HVA A;  1FXR A;  1G7C B;  5LJ3 Y;  3E01 A;  4DV7 F;  2QFJ A;  2QRR A;  5AE3 A;  2XYG B;  1HA1 A;  5M2U A;  2ZC3 A;  1K9M T;  3PYG A;  1N8R T;  2ZH6 A;  4YHH J;  1ZBT A;  2XMM A;  2MZR A;  3HXM A;  3C14 B;  4QJV A;  4I2Q B;  4X66 J;  2MKI A;  2ZH9 A;  1IJF B;  1LWF A;  1WF1 A;  4L72 B;  4CQ1 A;  4NRT A;  3VCD A;  2HQG A;  2ZUG A;  2CPJ A;  2ZM6 J;  1SUQ A;  1TK5 A;  4Q2L A;  5GAD I;  1HAR A;  2MPU A;  9ATC B;  2QA2 A;  5DLG A;  2GQ2 A;  5C7P A;  1ZH5 A;  2L9W A;  1FNO A;  2IVY A;  4YQW A;  1XNR J;  1S4F A;  1H2V Z;  2ACM A;  3BN7 A;  3TZX A;  4DHV A;  1YHQ S;  2R8G A;  5IM0 A;  3TAP A;  1IVZ A;  2MGZ B;  3DDN A;  2RS8 A;  4I6A A;  3OFF A;  4BCA A;  5U47 A;  2B5J A;  1QM9 A;  1MW7 A;  2VA2 A;  2XTJ P;  2OEK A;  1NLK L;  4ZPW R;  3ZTS A;  2I5J A;  2KKH A;  1IBK F;  3RB3 A;  3MEC A;  5K8P A;  3BQ0 A;  1VRQ C;  5T7L B;  3IMQ J;  3PKM A;  5CXT A;  4Q43 A;  3ZC4 A;  4FF1 A;  3DNC A;  3LP1 B;  2PSZ A;  1SBR A;  1FRH A;  3ISN C;  1FTC A;  1RQ0 A;  1ELO A;  1AT1 B;  1MU2 A;  2CVE A;  4Y0F A;  3US5 A;  1HBO B;  2DNK A;  3MPV A;  4JYA J;  1VQ5 S;  3CCL S;  1Q8L A;  3CD5 A;  4J7C A;  3D67 A;  1ZYQ A;  3HJV A;  2D9P A;  3AQP A;  4XPC A;  4ZKA A;  3A12 A;  1L3V A;  2HZV A;  2FJW A;  4HEA 9;  3D1O A;  2HW3 A;  1OSD A;  1O51 A;  5GME A;  1AB8 A;  1FNM A;  3KLF A;  3BYP A;  2OML A;  4F8R A;  1FRX A;  2DNP A;  3UN2 A;  4QW8 A;  2CZ9 A;  3DMJ A;  2VKR A;  3QAT A;  4DDF A;  5I4M A;  2DRA A;  1TKD A;  3RYL A;  3QFH A;  1ACM B;  2RDD A;  3MOZ A;  2QL5 B;  2LEA A;  2BAB A;  2DH7 A;  4X62 F;  1RSC A;  1QUV A;  4DR4 J;  1N4L A;  5ETQ A;  1T9V A;  1RAJ A;  1UFL A;  1BY9 A;  3I6P A;  1RT1 A;  3EPI A;  2W9A A;  2FZG B;  3PRV A;  4ZCK A;  1WEY A;  1U6B A;  2UP1 A;  1V5V A;  2BM0 A;  2LQJ A;  1BQN A;  2ATC B;  4KFB A;  4NYZ A;  2HIY A;  1KQG B;  3KLG B;  2ASJ A;  1S0V A;  4PAB A;  4OZ2 A;  4ETX A;  2IAJ B;  4O23 A;  1EIY B;  3M32 B;  4S0M A;  4ZVO B;  4DL6 A;  2YX4 A;  4W92 B;  2H5E A;  3NP5 A;  4AQY J;  2Q79 A;  3J80 Y;  2DIV A;  4F4A A;  2WSE C;  1NJZ A;  1VBZ A;  4X4V A;  3AOC A;  4KY3 A;  3J81 Y;  3SXL A;  5AXM A;  5ETS A;  2CJY B;  3P5B P;  3OTO F;  1FEE A;  4F4Z A;  2HMI B;  1M1G A;  4NEY A;  3J7Y U;  1MN9 A;  5EHH A;  1HYS A;  2RDJ A;  1MNE A;  3CCU S;  2M5Y A;  2MQO A;  4DSJ A;  3W9J A;  1U0H B;  2FVP A;  2MB0 B;  4X64 F;  1UA1 A;  1LV5 A;  4UW2 A;  4FYV B;  1S9E B;  2O66 A;  1KQK A;  2BOP A;  1RT7 B;  3FUY A;  2XWY A;  3R7S B;  4WK1 A;  5M2P A;  4KPY A;  1X5O A;  4B9S A;  2NSB A;  4N76 A;  3GPA A;  1BXN A;  3DCA A;  5EX0 A;  4X4S A;  2UUB F;  1WDT A;  2R8J A;  4B08 A;  1KVK A;  3T1Y F;  1T9X A;  1VQ4 S;  1Q4R A;  4Q5V A;  3W62 A;  3RRG A;  2B43 A;  2MQ8 A;  1TL1 B;  2LFV A;  3VGU A;  2DIT A;  5KT3 A;  1JJC B;  2M0G B;  2O01 C;  2GQC A;  3M1V B;  1DTQ B;  2R3V A;  5ETR A;  3CJ0 A;  2BJ1 A;  2F9D A;  4M95 A;  1JXV A;  1HQ2 A;  4CH0 S;  3H2L A;  2MZJ A;  1AYE A;  2AGO A;  1LWE A;  2BA9 A;  1L3T A;  3NWR A;  1C0U B;  4DG1 B;  1YSJ A;  1GH8 A;  3DOK B;  3MAH A;  3QZ7 A;  1R7I A;  1ZM3 A;  2V4J A;  3K89 A;  2DGV A;  2VUG A;  1KP6 A;  4JV5 F;  5JMN A;  3MOJ B;  4ZLL A;  3LGM A;  2DXF A;  2QN6 B;  4ED7 A;  3N6N A;  4YY3 J;  2CPE A;  2V2V A;  5F8N A;  2Z2Y B;  3BZQ A;  1I94 F;  4TU9 A;  3IBF B;  4CT8 A;  4KTQ A;  2YNF A;  5A8R B;  3JQJ A;  1Y11 A;  4NA2 A;  3PJX A;  1LW2 B;  2FLL A;  5GAE I;  4WF9 Q;  2FVR A;  2C3U A;  3PAC A;  1SJ4 P;  5SZT A;  2HND A;  3BS9 A;  2OHD A;  5A0Y A;  3W61 A;  3P96 A;  1F2H A;  4Q7A A;  5AXN A;  2YWE A;  5J2N B;  5KFZ A;  4NRU A;  3AFG A;  5E3P A;  5J2Q B;  2XLJ A;  1VLY A;  3M2V A;  4HH1 A;  4QU7 A;  2GCF A;  1VRU A;  2RIJ A;  4D3G A;  1S1V A;  2DPI A;  4UTG A;  2HNZ B;  5HRO B;  4ZMM A;  1YQH A;  3PRB A;  3OUY B;  2N4C A;  2HFU A;  4OLO A;  3GP9 A;  4EYH B;  4B3R F;  3H4B A;  3GIL A;  1N32 F;  3P45 B;  4NYO A;  2ZVI A;  3CDE A;  2YH0 A;  2LEP A;  1RWV B;  1VRT A;  4K4S A;  1HMV B;  2X51 A;  4ZCM A;  2R8K A;  1NHK L;  2BV3 A;  4DL4 A;  1N5V A;  2V69 A;  1N5T A;  1VQ9 S;  5CYQ A;  1A0O B;  1WHY A;  3RBD A;  3H4D A;  3VAL A;  4OYZ A;  1CBK A;  1KRP A;  1S6P A;  3UDV A;  1CJV A;  1U47 A;  5B0D A;  2G2Z A;  2AYM A;  2RAQ A;  4TQS A;  1TAQ A;  3FVY A;  2Q43 A;  4ZPA A;  2DJW A;  5D3G A;  4NOH A;  1OJ4 A;  3POT A;  2OJ3 A;  2B9W A;  3IG1 B;  4DSF A;  2A0F B;  4ED0 A;  1SIZ A;  1IM4 A;  1XMO J;  5C25 B;  1TKT A;  3EVW A;  3OFH A;  2VG6 A;  1IJE B;  1JLF B;  3FEX B;  3UVJ B;  4M5M A;  3FC9 A;  4L6V 3;  1HWJ A;  1EB0 A;  3KDN A;  4FVC A;  4M8L A;  1I51 B;  2IRU A;  4QR2 A;  4NI2 B;  3LAL A;  2E1M C;  2FJB B;  5IT9 U;  1OSC A;  1OY9 A;  2X3G A;  3IA0 A;  2DNM A;  1RWK B;  3RAQ A;  3PO5 A;  1WUU A;  4NX9 A;  4M94 A;  2VQF J;  3IRX A;  3N79 A;  4ZDN A;  5B0B A;  3M6X A;  3IP0 A;  1HQU A;  3FNN A;  2EFG A;  4M5J A;  3VWS A;  4Q8E A;  1MRO A;  2ZKT A;  2AMC B;  2OSR A;  2F4F A;  3FEZ A;  3BF4 A;  2HFZ A;  1N34 J;  1VCT A;  2R7T A;  1VIO A;  2OH2 A;  5A8K A;  3CNQ P;  4UOF A;  4GVL A;  1WC4 A;  4F0M A;  4M1K A;  3PR4 A;  4LRC A;  3PTW A;  2B8Q A;  2UVR A;  3QT8 A;  2DYA A;  4DS5 A;  2AW0 A;  1IWG A;  1TFY A;  2EBE A;  3OL7 A;  3M05 A;  1KON A;  2DNQ A;  4HHJ A;  1Q53 A;  2IPO B;  1FEH A;  1VQP S;  2D3O 1;  3M8W A;  2O5D A;  1RBA A;  1JJH A;  3OR1 A;  1FE0 A;  2BAC A;  4GMK A;  4NL5 A;  4X4U A;  3KK2 B;  1S1U B;  2XZW A;  2A3J A;  5E3A A;  2GMJ A;  2W9B B;  1JXL A;  1GXL A;  4LF9 F;  4F4Y A;  1A7G E;  1F5B A;  2YKN A;  2RKI B;  4B3T F;  2RS2 A;  2VBW A;  1RTJ A;  4DFK A;  3RB4 A;  5A8W A;  1XWL A;  1EET B;  5HLF B;  4LSL A;  3GU0 A;  3NAH A;  3W64 A;  3BEG B;  4CYU A;  2POK A;  3D6T B;  4KO0 A;  3IR7 B;  3EGW B;  2WOM B;  4KGZ B;  3M8Z A;  3NKY A;  2L3M A;  3KG1 A;  1VHI A;  1E6Y B;  2XS7 A;  1JLE A;  2LXF A;  4Q0B A;  1APS A;  4M63 A;  4MTP A;  4P2X A;  4DQR A;  3DLH A;  2KJV A;  5DDR C;  2AJF E;  2BJE A;  5E0O A;  3CXC R;  4ECS A;  2LMI A;  1BMQ B;  2J7U A;  2VG5 B;  4ZIT A;  1C4A A;  1YX2 A;  1W25 A;  3MR6 A;  2OPR A;  2WBR A;  4KRW A;  1H74 A;  3UPF A;  4G1Q A;  4ZLN A;  3ZZU A;  4ZVE A;  2OTJ S;  2W2N P;  2YWW A;  4MT1 A;  4E98 A;  4USH A;  3DRY A;  1K1Q A;  2YNG B;  1RU1 A;  3TA2 A;  2J6S A;  2XMU A;  4DWI A;  1FVQ A;  1D8Z A;  3QWP A;  2KFY A;  1WOO A;  3NAI A;  2QT7 A;  3HFK A;  4PQU B;  1VI7 A;  1M5P C;  4RPF A;  1WWH A;  1P6T A;  2XSF A;  2QMU B;  3NLC A;  2IIH A;  1FK9 A;  3KYL A;  4OI3 A;  4AND A;  3RR7 A;  3GZ7 A;  4PG6 A;  2GIF A;  3FMW A;  3U7J A;  3UD3 P;  2HVH A;  2UUW A;  1SC4 B;  3Q8R B;  2XCA A;  1HBN A;  3PW5 A;  1CS4 A;  5HQ8 A;  4L75 A;  3R7N B;  3I0R B;  1R0B G;  4CO4 A;  3CJK A;  1FXD A;  2D3O R;  1CJU B;  2RU3 A;  1IBM F;  2V9K A;  4NA1 A;  1WHV A;  1CG2 A;  3I55 S;  3BV8 A;  2B56 A;  1PKU A;  4HVZ A;  4CLT A;  5B0E A;  2ZBC A;  1RAA B;  2PA3 A;  2DK2 A;  3SQG A;  4DCO B;  4FZV A;  3QT6 A;  2FGO A;  2AX1 A;  2EC0 A;  3WX8 A;  1X7V A;  2LKZ A;  4DQQ A;  1RWX B;  4P2F A;  3W2W A;  3WHI A;  2QA4 S;  4Y28 C;  2CQB A;  2J7W A;  1C1C B;  1U1Q A;  2WSC C;  1DQA A;  2LA4 A;  4LFC J;  1U1M A;  2ZH2 A;  1HFE L;  2BM1 A;  4IH7 A;  5L1J A;  4TYB A;  2IMW P;  2CRL A;  4OYM A;  5LMN J;  2DGT A;  3M8P A;  4K0K J;  3IR6 B;  5EN1 A;  4OYP A;  2ZOF A;  3W5X A;  5K20 B;  4K4Z A;  1GTE A;  1IKX B;  2J0S D;  4K59 A;  3KLE A;  3ENW A;  4OHY A;  1NAQ A;  1LXN A;  1RXO B;  2UUC J;  3RUB L;  1IN0 A;  1DTT B;  3I4P A;  1FXL A;  1S12 A;  3N4W A;  1W7W A;  3M8R A;  3QO9 B;  3J7A 1;  4USV A;  3ET6 B;  5KFR A;  3P49 B;  1XIQ A;  2ERR A;  5HJX A;  2VBX A;  1D1U A;  5G0R B;  3F56 A;  2MKK A;  1RK8 A;  2QC3 A;  1T7P A;  4JOU A;  5D4P A;  4ELU A;  4YHH F;  3CVK A;  4EGL A;  1Z4U A;  2MDA A;  1BGX T;  4X66 F;  4OYW A;  3THV A;  2QL9 B;  3R5C A;  4ZPT R;  1GX6 A;  2HAF A;  3MPY A;  1NBE B;  1JLB A;  3KUE A;  4P75 A;  2ZM6 F;  3CJ2 A;  4WZM A;  1RZM A;  2AJ2 A;  3FCH A;  1NH8 A;  2K1R A;  5KFN A;  5HMY A;  1LK5 A;  3N01 A;  3P8B B;  1XNR F;  3AB2 B;  1SV5 B;  2VA3 A;  4H54 A;  2AKW B;  4RUA A;  2ADB A;  1EJ7 L;  2F8E X;  5FDL A;  3Q8Q B;  1JLC B;  1Z1Z A;  1UVM A;  2KL8 A;  2J9D A;  2JFD A;  2YX7 A;  2H65 B;  3FEY B;  4DSL A;  2HYI B;  1VQS A;  3CDU A;  2C2D A;  3P5T L;  4W98 A;  7FDR A;  3BGL A;  3TEG A;  3QIP B;  5SUH A;  3FMB A;  4QOT A;  2Z4P A;  4B9V A;  2WVB A;  3HJF A;  2XGQ A;  5DZ6 A;  1IR0 A;  4EMD A;  2KM8 B;  2DEJ A;  4C8Z A;  1HWK A;  2FPH X;  4JI7 J;  5KT2 A;  3PG9 A;  4I68 A;  1REV A;  3BSA A;  5KT6 A;  2MY8 A;  2AEF A;  1I1G A;  1Q1K A;  2IFX A;  1B0V A;  4NLD A;  2FD2 A;  2OP5 A;  1VYA A;  1D8Y A;  2LXI A;  4W4M A;  3VR1 A;  1H3D A;  2AEM A;  5E3C A;  3TZZ A;  2QLJ B;  3DLE A;  1LWX A;  3VAG A;  3I96 A;  4O3Q A;  5KT4 A;  1SJ3 P;  2KRB A;  4JYA F;  4ZVP B;  4WP3 A;  1NPP A;  3M2R B;  3W9I A;  1KLM A;  1FWL A;  2YKM A;  4P9S A;  2AT1 B;  1RDR A;  5JVH Q;  1DQ8 A;  3WQP A;  2A6O A;  1VQL S;  5KFU A;  4TVA B;  2OO4 A;  4PZV A;  1HNI A;  1HI8 A;  1A9N B;  5D4O A;  1JLA A;  2ZE2 B;  2ZUA A;  1MWQ A;  1HBM B;  4P72 A;  3BO3 A;  2VFV A;  1NSQ A;  1B4S A;  3J80 U;  2WBM A;  4K4T A;  1O6X A;  1HI0 P;  5IWA J;  4DR4 F;  3ZNU A;  3ZZP A;  2HK3 A;  3J81 U;  3SDE B;  2FY1 A;  2D9O A;  2KT3 A;  4QWA A;  5E3R A;  4A8S A;  2VV5 A;  2IJR A;  1FX2 A;  4EFA C;  1T8E A;  5E5N A;  4BWJ A;  3QNW B;  3IC1 A;  3LQV A;  3MEG B;  4RUH A;  4RBV A;  3IS9 A;  1CJT B;  2CQD A;  1EQ0 A;  4NZ7 A;  1R0C B;  5DQH A;  2G4B A;  1YJ7 A;  3BSC A;  2FQQ B;  1S1X A;  5KFC A;  1WEL A;  1IKW A;  4EEY A;  2XMW A;  3I5B A;  2DCU B;  4X65 F;  3T3F A;  2PEB A;  1HKA A;  5D8H B;  4CDI A;  2Q66 A;  1GTH A;  3MMC A;  3R8Y A;  4CTA B;  4CNZ A;  1FDA A;  1UPM B;  2CAD A;  2XB2 D;  4N8N A;  2ALZ A;  2R9L A;  2RD5 C;  1FI4 A;  2HK2 A;  3CJQ A;  3R7B B;  5F8L A;  2FVC A;  4I2P B;  1VQN S;  1FDN A;  3JAM Y;  3OV7 A;  1RTD B;  3H0P A;  4MKY A;  1YK9 A;  1FFG B;  2CPY A;  2XYH B;  5DET A;  2ASD A;  1PAE X;  2RQ4 A;  1TVR B;  3WC0 A;  1WI8 A;  4FVM A;  2FVQ A;  2K8G A;  4KHP J;  1KQS R;  2JZ5 A;  1ROF A;  4CO2 A;  1KVJ A;  2ZOG A;  1I3O B;  1PIL A;  1HNX J;  5B0C A;  3VHQ A;  1SQG A;  3RBE A;  4I6W A;  4ID8 A;  2DGX A;  2MKH A;  4ZPB A;  5J1E B;  1U48 A;  4QYR A;  4HDH A;  3MF5 A;  4U9R A;  2AQ4 A;  4ZHR B;  1RAE B;  4FS1 A;  1VJQ A;  3HHL D;  2HFN A;  4FDF A;  4EO8 A;  4KHR A;  3QJJ A;  1H0H B;  3W1Y C;  3TX8 A;  2HQD A;  2M9K A;  3MUT P;  3NBP A;  4YY3 F;  1S7H A;  4DX6 A;  2IJN A;  3H2U B;  2CNO B;  4FNH A;  3QMQ A;  3M2U A;  1JNR B;  2F63 A;  4IH6 A;  1FES A;  2WHO A;  4C11 A;  2E44 A;  3CJ5 A;  4M5N A;  4O4G B;  1RT6 B;  3Q24 A;  3RW6 A;  2RSQ A;  2R7R A;  3HSG A;  1NDL A;  4ID5 B;  4DQS A;  2CNL B;  1X5T A;  2WZ1 A;  2R8I A;  3EIC A;  3V81 B;  4TXS A;  1S97 A;  2VC1 A;  3HLU A;  3K8V A;  5HVH A;  3R1L A;  3D0I E;  1LOU A;  2ILY A;  3AAW B;  3BB5 A;  2VG7 A;  3KLI B;  2V4Q A;  1FA0 A;  1DLO B;  2LU2 A;  5GAH U;  1WC6 A;  5BYR A;  1VQ8 S;  2G2Y A;  2JSX A;  5I3P A;  3J81 j;  1HQE A;  3A3N B;  3UR3 C;  4BC7 A;  1FWK A;  4ZP7 A;  4BDP A;  1SKR A;  2A1B A;  4UT4 A;  2X3D A;  4RBT A;  3AD8 C;  3MPW A;  3S6E A;  3H5X A;  1XNQ J;  1UVI A;  4DZD A;  1MMD A;  1H2U X;  4U8Y A;  3GR1 A;  3K5P A;  3Q8P B;  3MM7 A;  4F50 A;  3UCU P;  3MCN A;  4TLQ A;  1BC6 A;  5LXY A;  1DAR A;  3SBM A;  4L73 A;  2NR0 A;  3PIP Q;  2BKN A;  3R5B A;  1K47 A;  3MM8 A;  4F36 A;  4PXE A;  3KDO A;  1WSV A;  1URR A;  4LF4 J;  4ECW A;  2JVR A;  4JB8 B;  1VBX A;  1T03 B;  1RAC B;  3GFY A;  3FDS A;  3MMB B;  4FPI A;  4WCE Q;  3O44 A;  3OL8 A;  2GIR A;  5GAD U;  3BPS P;  5HK4 A;  2RJZ A;  4NCA A;  1XMO F;  4P73 A;  3PEJ A;  2J0W A;  4J5O A;  3HFZ B;  2IJF A;  4UY8 T;  3HVW A;  3QJP A;  1D0E A;  4JI6 J;  4FKY A;  4FP9 A;  2VDH A;  3ENQ A;  3DOL A;  3OLB A;  3DLG A;  5HAT A;  4L3N A;  3HCX A;  2W2Q P;  4CLU A;  5D0R A;  4NXM J;  3QPI A;  5RUB A;  1TKX A;  4CZC A;  5K8N A;  4MKA A;  3ZFV A;  5GMD A;  3HVT B;  1UW4 A;  3AJ1 A;  2VQF F;  2WTF A;  1YKW A;  2XMV A;  2YKP A;  3V2U C;  3CIZ A;  3NG8 A;  3TP2 A;  3TAQ A;  5KG1 A;  1N34 F;  4LSN A;  1JLG A;  4AFF A;  3Q2S C;  2VJU A;  1H7W A;  2RHS B;  2HZC A;  3VF0 B;  2MMY A;  3VAI A;  3PM9 A;  2JHE A;  2KZM A;  1NK5 A;  5HMW A;  4X84 A;  5L1L A;  2W8L A;  3C6U B;  2HWH A;  4BBY A;  2ILZ A;  3KMS A;  4LF5 J;  1TV6 A;  1WC3 A;  4KGM A;  4KH0 B;  1FKO B;  1P1L A;  2K2P A;  5J2P B;  1MML A;  3VQT A;  4J9R A;  5KFB A;  4DZ6 A;  2E29 A;  1NRK A;  1U1K A;  5JXS A;  4LF1 A;  2NXC A;  5HJY A;  3VAJ A;  1QAY A;  3SSQ A;  1Z2L A;  4MIA A;  3DI6 B;  5I42 B;  3WC2 A;  1D3W A;  4RLE A;  1RT2 A;  5KT7 A;  3C15 A;  4YB5 A;  2FTR A;  1HL6 A;  2IHR 1;  3KJV A;  1XQI A;  2H5J B;  3RJM B;  3KWM A;  1RWM B;  3N28 A;  2CQG A;  3C3L A;  2F65 A;  3QRQ A;  2DNG A;  1VDH A;  3TR5 A;  3JSM B;  1IKV A;  1FTR A;  3GG0 A;  3JQM A;  2KG1 A;  2Q6C A;  3OXF A;  2XYP B;  3PYD A;  4YR2 A;  4RW8 B;  2L08 A;  3KUG A;  1TP7 A;  4A46 A;  2MKJ A;  3LGN A;  3DRP B;  3VAM A;  2M3D A;  3PW0 A;  2JFK A;  5L46 A;  4AL5 A;  1KN6 A;  4ICL B;  3RB6 A;  4NPO A;  3C14 A;  2ZBP A;  3DOM B;  2C2R A;  3G2X A;  2BVZ A;  1H73 A;  4U7U D;  2Y1I A;  1M1K T;  1ZPV A;  2YNH B;  2EWH A;  5CD4 A;  2ATL A;  4XIU A;  1LW0 B;  1VIS A;  4HT5 A;  5D78 A;  2RHQ B;  2E5G A;  1SC6 A;  4RW7 B;  1QVG R;  4DR6 J;  3VAH A;  4ZVG A;  4DV0 J;  3CCT A;  3V4I A;  3W2V B;  1GMU A;  2Z56 B;  2OPQ B;  3A8J A;  2MGZ A;  3EDQ B;  1RTH B;  4C48 A;  4YOE A;  5AT1 B;  1N5Q A;  3U1N A;  2M70 A;  2HG4 A;  4ZPC A;  5KFE A;  4JV2 A;  1FKP B;  3A4T A;  3BBC A;  1YBA A;  4PPD A;  4ED6 A;  2CG8 A;  4URG A;  5T7L A;  4O0N A;  1S0O A;  3LP1 A;  4DLE A;  1NZ8 A;  1NCL A;  1YRU A;  4PKD B;  3K8W A;  2ZNY A;  4FBU A;  1S6O A;  2PFF B;  2YKO A;  2AZ3 A;  4FXW A;  1IKY B;  4QR0 A;  1NKB A;  4HR2 A;  4B17 A;  1YDL A;  4LFC F;  2Y3Y A;  3GCX P;  5FD1 A;  3QJL A;  4OMF G;  5THW A;  3FBB A;  2C3O A;  4WTO B;  1MN7 A;  5LMN F;  1KFS A;  1SJR A;  1P9Q C;  3H2V E;  2FJX A;  4ZJO A;  4K0K F;  4USU A;  4K4W A;  1TL3 A;  3L4B C;  4CT9 A;  2UXD J;  2AWZ A;  1LXJ A;  1YJN S;  5BYS A;  2MXY A;  2GA7 A;  1NKC A;  1L5U A;  4N8O A;  4DR5 J;  1YVF A;  3CW2 C;  4B3O B;  4DF8 A;  4B3S J;  4P2M A;  2UUC F;  2QYG A;  3WBZ A;  3QRR A;  2DVI A;  4ECX A;  4EI2 A;  4WFX A;  2LEB A;  1QAX A;  1OIA A;  4IOA Q;  3FFI B;  2MST A;  2LP4 A;  2MSS A;  3SFU A;  4H4K C;  3BR9 A;  3I56 S;  4A8Q A;  3ONQ A;  2C2E A;  2KTQ A;  4ELV A;  1VK3 A;  1RAD B;  4A8F A;  5IC4 B;  4EZ9 A;  1NU4 A;  2H5I B;  3KLG A;  1KTQ A;  2W01 A;  2IAJ A;  3M32 A;  1Y10 A;  1IQZ A;  2MY7 A;  1HR0 J;  2D69 A;  1HWU A;  4J9N A;  3FCV A;  3GTY X;  4LFB F;  3ELH A;  3G82 A;  1QTN B;  1OYE A;  2E5L J;  4KGV B;  4ZPV R;  2YXL A;  4Y6I A;  4E8U A;  1JKH B;  5KG7 A;  3TRG A;  1NK0 A;  2KHD A;  3QID A;  3AJ2 A;  4QPT A;  2BKO A;  1FO1 A;  4CLW A;  1ZOT A;  3I0S B;  3VAK A;  2MQQ A;  2HMI A;  3VAF A;  4JI5 F;  3OSN A;  3CJS A;  2ZH8 A;  2BEF A;  3L9Z A;  3B82 A;  2B51 A;  3GIK A;  1U0H A;  3KTQ A;  2PGC A;  4RL1 A;  1K0T A;  1S9E A;  5K14 B;  4CH1 A;  4RBU A;  2OEM A;  1RT7 A;  1S9F A;  1E6V B;  1CQM A;  4JI7 F;  1PYO B;  4PYA A;  2KM8 C;  1X4G A;  4FYD A;  2DHA A;  4OI4 A;  2N7Y A;  5H9F J;  2ZIT A;  2P9G A;  4QBU A;  1FJ7 A;  4QYZ J;  2KDO A;  1SH2 A;  2JH3 A;  1B0T A;  3TZY A;  4J37 A;  4ZLP A;  3HF5 A;  2PI5 A;  3H7H B;  1X60 A;  5CCM A;  1TL1 A;  2FIU A;  1T3N A;  5I3U B;  4P74 A;  4JI4 J;  2FDN A;  1WC0 A;  3M1V A;  1DTQ A;  1WDD A;  1JJ2 R;  3K5M A;  3OLA A;  2CQI A;  2MTL A;  5HI7 A;  2WB4 A;  3LAK A;  4HTJ A;  4LR9 A;  1B0P A;  3ZZ0 A;  1C0U A;  1D9D A;  4DG1 A;  4R0J A;  3ZZO A;  3QGI A;  2CJA A;  5D15 A;  3IBW A;  3ZZR A;  3FRZ A;  4NLU A;  1ZZF A;  2B0G A;  3KK3 B;  4DV5 J;  5IWA F;  4C4W A;  4Y2A A;  3H5Y A;  3VGT A;  2R7S A;  5E3Q A;  2ZFH A;  3P3D A;  2W7P A;  4WTY A;  2HHW A;  3H20 A;  3HDS A;  5A8R A;  2Z2Z A;  3CME S;  3N6M A;  4RWW A;  1LW2 A;  1EX8 A;  3CCQ S;  2JJ4 D;  5KFI A;  1NEE A;  5ETM A;  1RTZ A;  3NMR A;  4KKO B;  3PW4 A;  3JAM U;  5J2N A;  4DUZ J;  4RNN A;  2NRE A;  5KFX A;  1UAW A;  5J2Q A;  4TY9 A;  3UN5 A;  1Y4Z B;  1WOS A;  2DGO A;  5F3Z A;  2HNZ A;  1Y5L B;  5GMK a;  4ED3 A;  3TVZ A;  3OUY A;  5KFJ A;  1DZ5 A;  3NWG A;  4ECU A;  1NK6 A;  1Y3K A;  4M5G A;  1H72 C;  2MLY A;  5D4N A;  2QIF A;  2GAH C;  3SFG A;  2YVS A;  4RKU C;  4IRK A;  4NWB A;  3JB9 k;  2XHW A;  2CQH A;  1UFW A;  3K57 A;  2W2O P;  4A47 A;  5F8G A;  3OR2 A;  2XWX A;  1S1T B;  4P10 A;  2BE2 A;  5F8J A;  2X1F A;  4F26 A;  3G86 A;  4ALZ A;  1SPB P;  3DGP A;  1YWX A;  4AL7 A;  2FLO A;  4KHP F;  4HHH A;  2Z57 B;  5KFP A;  3GWC A;  1CVJ A;  3IG1 A;  2O67 A;  3HSZ A;  3AD9 C;  3HKZ D;  1RHQ B;  2BAN B;  5C25 A;  2Q3P A;  4QQB A;  1HNX F;  4EUV A;  3G87 A;  3H25 A;  4LF8 J;  1JLF A;  3UVJ A;  1M5K C;  3MMA B;  3VQS A;  2ZBR A;  4J9U E;  4B02 A;  2OAU A;  2JLG A;  1X4A A;  2OGU A;  4NI2 A;  3ZNJ 1;  4B9N A;  2X1G A;  4WP9 A;  5E41 A;  2BJD A;  1SL0 A;  3UDE A;  3GJT B;  2B4P A;  4XAK A;  2W25 A;  2DNY A;  1PO6 A;  1PSD A;  3X3U A;  5EWF A;  4M5K A;  2IMO A;  1WOP A;  1T0T V;  2VON A;  3EJM A;  2JX2 A;  3PW7 A;  2KYX A;  4X4R A;  4PWD B;  3GYX B;  1ZA1 B;  5F41 A;  3L09 A;  5D4L A;  1RWW B;  4CLK A;  1PBU A;  1X4F A;  3NCR A;  2HHH J;  1SL1 A;  4DV6 F;  4ZK7 M;  2CJK A;  3D6F B;  2I1R A;  4DV3 J;  5ETV A;  2VZ9 A;  4KAI A;  1DUR A;  4USM A;  4IFY A;  2QLB B;  3ZZZ A;  3G6V A;  3AY0 A;  4QWD A;  2DHX A;  4I4B A;  3JSY A;  4OIX A;  1S48 A;  1T3O A;  5B0G A;  1VFJ A;  4NLW A;  4DSK A;  2UU9 J;  1QSS A;  1TL7 B;  1XTZ A;  2MZQ A;  4JI2 J;  3SI8 A;  3EYZ A;  1KD1 T;  1X4D A;  2J6T A;  4JI3 J;  3AXK A;  3UO0 A;  1EHW A;  4F0K A;  3KK2 A;  5F3T A;  1S1U A;  3K59 A;  2KU7 A;  1XNQ F;  3CT9 A;  4KH1 B;  3RBX A;  2W9B A;  2H48 B;  2IRX A;  3LH2 S;  4OJ1 A;  1I5O B;  2RKI A;  1TZ0 A;  4ZJL A;  3TVK A;  3OVA A;  4C2M A;  1SKS A;  3A3P B;  3MD1 A;  1CUL B;  1EET A;  5GAG U;  5HLF A;  5FLX Y;  4PXC A;  3QGH A;  5K8O A;  2LYV A;  3G6X A;  2WOM A;  3AOA A;  4N77 A;  3BH6 B;  3GJQ B;  3ETM A;  4U8V A;  4KQZ A;  3AOB A;  3KLV A;  4LF4 F;  3BJY A;  3QBC A;  3BBB A;  2NLW A;  3AA8 A;  4LQ9 A;  2PDA A;  1G1X A;  1U25 A;  5KG5 A;  3JTP A;  3M4X A;  4YB7 A;  4DPY A;  3ZTO A;  2XNR A;  4KBI A;  5BYQ A;  4IDK B;  4C0B A;  1WF2 A;  3HFV A;  4OYA A;  4JI6 F;  3K0J A;  3MTJ A;  4CCH A;  2VG5 A;  4NCG B;  4NLX A;  2DKO B;  3K58 A;  3CCR S;  2G0C A;  2D74 B;  2IM0 A;  4B3T J;  2JVO A;  1FJG J;  4IOB A;  5BJR A;  1S6U A;  4PQA A;  1B7F A;  1XR5 A;  2ZEJ A;  4NXM F;  1UPP A;  3J7A N;  4AD6 A;  3T9Z A;  1H38 A;  1W2B R;  2YNG A;  4DL3 A;  1V6H A;  2IBO A;  3GV7 B;  3BSN A;  1RA6 A;  4R5P B;  1LEO A;  4PQU A;  3MDF A;  1N88 A;  2DNH A;  1B7Y B;  4UY8 5;  4HI1 A;  2CUY A;  4ZPD A;  1NPR A;  4HT7 A;  3F44 A;  3G4S S;  3ENA A;  2HFS A;  2OTL S;  3I0R A;  2ASY A;  4J9L A;  2CPH A;  5C24 B;  3OL6 A;  4D3H A;  1LWC B;  5D6G A;  1VRU B;  4KV8 B;  4LF5 F;  3K7R A;  3PX4 A;  1XR6 A;  1TL5 A;  3DLL Q;  3U02 A;  2VPX B;  4PPZ A;  4Y2C A;  3UI3 A;  1C1C A;  3TWZ A;  5LM7 E;  2VPY B;  3M6U A;  3CO9 A;  2MQN A;  1U8S A;  4M5D B;  2W7O A;  3LTO A;  2XZT B;  3W9H A;  3E51 A;  1YJV A;  3G6E S;  4ZP8 A;  2QX0 A;  1GX5 A;  1XN9 A;  1IKX A;  1N5S A;  3N5B A;  2W4P A;  3S01 A;  3HK2 A;  1FT8 A;  2FHO B;  3QWU A;  3FQL A;  1YIT S;  2GO9 A;  5E33 A;  1DTT A;  1YG0 A;  4GO5 X;  3O8W A;  3DLB A;  2HHP A;  2RQM A;  2WCX A;  4JV1 A;  2KZZ A;  3QO9 A;  3QQC D;  4OZ3 A;  1ZS6 A;  3ET6 A;  4CM0 A;  2ZHO A;  4DFM A;  3IGN A;  1PBA A;  4ANC A;  3B4M A;  1LFW A;  5G0R A;  3A1Y G;  3MM9 B;  4V19 J;  2DD8 S;  1M5S A;  1HI1 A;  2JEF A;  1OY8 A;  4AYB D;  4MAK A;  5CAB A;  4DFJ A;  3R6G B;  3UCZ P;  3PYF A;  5GAH I;  2MJU A;  4IG0 B;  2GJ2 A;  2YQ0 A;  1PAU B;  3PXG a;  1V9O A;  3ILI A;  3CD6 S;  2F9J A;  5DG9 A;  5IV3 A;  1DJ0 A;  4CIO A;  2YBV A;  4DV0 F;  1EKS A;  4MH8 A;  1SV5 A;  2KI2 A;  2FVS A;  2QLW A;  1JLC A;  2ABY A;  1RI7 A;  2ZJR Q;  4MKV A;  1R0A B;  1FFW B;  4ATN A;  1ITP A;  2SXL A;  2GW8 A;  4ZCL A;  2XY7 A;  3TVY A;  1UVN A;  2R4F A;  4CRJ A;  3MTK A;  3QIP A;  4L3K A;  1M5H A;  3IM9 A;  1UVJ A;  5LMU J;  3ISZ A;  3TQE A;  3N0V A;  2Q6B A;  5IT0 A;  2ZDO A;  2DPJ A;  4JP8 A;  2J0X A;  1WJ9 A;  4J9K A;  1L3K A;  3MUR P;  2BZ2 A;  1YRX A;  1D9A A;  3ISN D;  1WG5 A;  4R8U B;  2H1Y A;  1S59 A;  4DV2 J;  2IC3 B;  1QAJ A;  1QSY A;  4IH5 A;  3IO1 A;  4FNI A;  3M2R A;  3TUI C;  2DIS A;  4LVO P;  4P71 A;  1RT5 B;  3ZTQ A;  2HHQ A;  3NCQ A;  2CG4 A;  2UXD F;  4KO0 B;  4C8M A;  2GX8 A;  1JX4 A;  2FZK B;  2ZE2 A;  4DR5 F;  2PN6 A;  1HPZ B;  1HBM A;  4CI0 B;  4B3S F;  3PX0 A;  1X5P A;  5CYM B;  1LQ9 A;  3K5O A;  2J7K A;  4WFY A;  4P52 A;  1JLE B;  1VS3 A;  2JC0 A;  2WW4 A;  3S1T A;  1NDC A;  2ZC4 A;  2WRM A;  4QW9 A;  3SDE A;  3EXY A;  3FQK A;  3K5L A;  2OKQ A;  1WKJ A;  3M6W A;  5ETL A;  4N5S A;  1RAF B;  4IKA A;  4TN2 A;  1FER A;  4J9O A;  3S8S A;  4OV1 A;  5F9N A;  2E5I A;  1AFJ A;  4ZVT B;  1V3R A;  2FHK A;  5DGA A;  4YN3 B;  1TFW A;  4P7T A;  5C2C A;  1SB6 A;  4ZVQ B;  1CJT A;  1HHS A;  4C8L A;  1HR0 F;  4G1Q B;  1TKZ B;  2VIC A;  1RTI B;  3U1M A;  1JLQ B;  3PDN A;  2GO8 A;  4H4M B;  2F3J A;  4UF4 A;  4A8Y A;  2QA4 G;  2E5L F;  3W65 A;  1U45 A;  1U24 A;  2FLP A;  1NKE A;  2HWT A;  3E2E A;  4PG4 A;  4WFZ A;  2KVQ E;  1OPI A;  3GSD A;  3CJT A;  3CCS S;  4RUC A;  2VIH A;  2COL A;  3LF0 A;  5J2M B;  3UDL A;  3PJ9 A;  3SIP B;  4ES2 A;  4I6Y A;  2UZA A;  5KTQ A;  4YUD A;  3L95 X;  3OJU A;  3EGN A;  1HD0 A;  4CTA A;  2ZZT A;  3D54 A;  2WSF C;  4WP8 A;  2C1E B;  3X1L B;  4QIG A;  2UUT A;  3DGV A;  3IN5 A;  1UZD A;  4ZVU B;  4I2P A;  3T5K A;  3NEK A;  3J7Z T;  1RTD A;  1GMV A;  3QAE A;  4HH0 A;  4ECV A;  4PYD A;  4KJI A;  2N82 B;  2HZA A;  4WIQ A;  5KFK A;  3NGD A;  2F1F A;  3C46 A;  2WVD A;  1TVR A;  5CA5 A;  2DR7 A;  2XO6 A;  6FDR A;  1T05 A;  3OT9 A;  2Y8W A;  1FD2 A;  4ILL A;  1H98 A;  7AT1 B;  2QLF B;  1NM2 A;  1C0T B;  2LQ8 A;  4HDG A;  4DL7 A;  2N7C A;  4JI4 F;  4X65 J;  4C97 A;  4FF4 A;  3IR5 B;  2GVZ B;  3GV8 B;  4UUW A;  5J1E A;  3M8P B;  2B9Y A;  1R27 B;  5HO4 A;  1N6Q B;  1V3S A;  4USK A;  2U2F A;  3MI7 X;  2V94 A;  2QGF B;  5KFT A;  4ZHR A;  1TL4 A;  2RUS A;  4P2S A;  2KVI A;  4U7U K;  1VBY A;  1U6Z A;  4NAS A;  4USW A;  4DV5 F;  2DY9 A;  1WD6 A;  2HSE B;  3HVR A;  3NL0 A;  2KFZ A;  5F8I A;  3TNV A;  3BSO A;  5KOX A;  2CWX A;  1QDU B;  1WTB A;  2DRB A;  4ZVF A;  4O4G A;  1RT6 A;  4ZA1 A;  4DJB A;  4ID5 A;  3AD7 C;  1OY6 A;  1QUP A;  1KQF B;  3V81 A;  3OL9 A;  2BJ3 A;  2R7U A;  5CAA A;  3SCL E;  2AGQ A;  3MUM P;  3D66 A;  4C3M A;  3HD1 A;  3KLI A;  4DUZ F;  3V4M A;  1DLO A;  5AXL A;  2QZ8 A;  4YEA A;  3KJF B;  4MFB B;  5IQQ A;  3BQ2 A;  1HBU B;  2D3U A;  2IY5 B;  2XMA A;  3VGV A;  1IWA A;  3L7P A;  1CJK A;  4DCJ B;  4R25 A;  1WOR A;  2YQ1 A;  4IFV B;  7FD1 A;  1NHV A;  2EC2 A;  2OPS B;  4TLR A;  4LR7 A;  2MKS A;  4A4J A;  2VBZ A;  3JTO A;  5MAO A;  3TUP A;  1PIE A;  2XG8 A;  1U09 A;  4DL0 C;  3L7U A;  1QSL A;  1ICE B;  1RCX B;  3I9V 9;  2EK6 A;  4WE1 A;  1RYR A;  1F9H A;  1Z2Z A;  3ITH B;  1REV B;  3MEE B;  3OTB A;  1CQN A;  1HNV B;  4NEZ A;  4DU8 A;  2V8H A;  3THT A;  5FII A;  3KK1 B;  4YDX A;  2CQ0 A;  2HIQ A;  2V5H G;  4WII A;  1T03 A;  3EZO A;  3DLE B;  1RJJ A;  1TAU A;  3EUN A;  3MMB A;  2KRR A;  5AE1 A;  1Q5V A;  1N54 B;  2YQ3 A;  2KHC A;  3PO4 A;  1S1W A;  3UE2 A;  4LF8 F;  1B64 A;  3HM9 A;  5KFM A;  3DN9 A;  3BYR A;  3H5U A;  2IBK A;  4NLT A;  4AE5 A;  3TUZ C;  3MAA A;  3MR2 A;  3CDW A;  1R8P A;  2BUN A;  4RZR A;  1FDD A;  2V68 A;  2HS4 A;  1N33 J;  3HVT A;  1RAG B;  3R5J B;  5L39 A;  4DL5 A;  3ICL A;  3EMT A;  2OFG X;  3PJW A;  2ZZM A;  2F7V A;  4O3O A;  4DQP A;  3A3O B;  2HQC A;  3BDP A;  2ZH1 A;  3SSR A;  1RWN B;  2HHH F;  4UST A;  2E1C A;  4DMZ A;  4XO0 A;  3D2W A;  3MPU B;  3ZO7 A;  4DV3 F;  1O5J A;  1WAC A;  3I5A A;  2HVD A;  3TEH B;  1R6Y A;  2PII A;  1YJT A;  2FHJ A;  5F8M A;  5ETT A;  1HHT P;  5FLX U;  2FJD B;  5E7O B;  5KFH A;  1GFW B;  2UU9 F;  1X4B A;  2CYY A;  1S1X B;  3C6U A;  4ED8 A;  4Z7C A;  4JI2 F;  3AOD A;  3GIJ A;  1WNE A;  4N47 A;  4CO0 A;  1S72 S;  1FKO A;  5HSP A;  1IKW B;  5J2P A;  2FY8 A;  4JI3 F;  4JI8 J;  5L1K A;  4Y65 A;  1SXL A;  4QWE A;  3NCP A;  3LP0 B;  1UFK A;  3V6D B;  1F9E B;  1RAI B;  4LSZ B;  1T9T A;  2ZBI A;  1S7I A;  2RDI A;  2Y0B B;  1B70 B;  4HAC A;  2CZV C;  2MHE A;  1CLF A;  3DI6 A;  3TAM B;  5I42 A;  1J2V A;  2WB1 D;  2R42 A;  4J9S A;  3QLH B;  8RUC A;  2EVZ A;  5H9E K;  3CC7 S;  3H90 A;  2YWK A;  4RUB A;  2RUG A;  4O3P A;  2B3T B;  4WPA A;  3VTI A;  2HQF A;  1VOM A;  4Y34 A;  1FRJ A;  4AUK A;  3ZTR A;  3D6M B;  2HHV A;  4QIF A;  4OHX A;  3JSM A;  4JUZ A;  3G9C A;  3HSD A;  2FHM A;  5D0G A;  4M5I A;  2ZD1 B;  1F0X A;  4RW8 A;  4PEO A;  4F67 A;  2JEG A;  4LRA A;  4OHW A;  2XNQ A;  2HAI A;  2P6T A;  2NUH A;  3DRP A;  4WZQ A;  1UJ4 A;  1S76 D;  3ZZT A;  3B6B A;  3CDB A;  4DPO A;  2CZ4 A;  2VL1 A;  4FKX A;  3GYG A;  4WU3 A;  1NXI A;  3MEK A;  4ICL A;  1QLN A;  1NJX A;  3T6B A;  4DV1 J;  1DQ9 A;  3M6V A;  2HRY A;  3LWL A;  1FJG F;  3DOM A;  3TO8 A;  3GJR B;  4JI1 J;  4IO1 A;  1YGY A;  4PWW A;  2DB1 A;  1VQ7 S;  2LCW A;  2YNH A;  3CCZ A;  5KG3 A;  2XI2 A;  1LW0 A;  4C8N A;  2B7C B;  2M8D B;  5LSL A;  3H8Y A;  3CO0 P;  4RW7 A;  1UET A;  2YWG A;  2GMH A;  3A8K A;  1DFD A;  1X0P A;  2JC1 A;  1U1O A;  2OPQ A;  4ZP9 A;  2FGC A;  2D41 A;  2GGP B;  1ULR A;  3AXM A;  3I9Z A;  4OL8 A;  2JEJ A;  3CCW A;  1RTH A;  3TI0 A;  1X31 C;  3EWG A;  2PEH A;  2RRA A;  3GQC A;  1UJ6 A;  2DR8 A;  3HSJ A;  3TW0 A;  3HO1 A;  1FKP A;  2A2D A;  1F60 B;  5J1P A;  4TNO A;  4KT0 C;  4QU6 A;  1VR6 A;  2PD1 A;  2QYC A;  1NZA A;  1DAX A;  2OSQ A;  3WIU A;  2RE1 A;  4B3M J;  3UDC A;  3R2D J;  1F2G A;  2XBP A;  4WU2 A;  4LMZ A;  2DHS A;  3CJR A;  2BR0 A;  4O0I A;  3O1L A;  3D1Q A;  3L7O A;  4ZCI A;  1IKY A;  3NS7 B;  3KG4 A;  2CJB A;  4C0O C;  4NML A;  3HHD A;  1U6F A;  2Z8Q A;  3C8Y A;  2NS1 B;  2V34 A;  1EKR A;  1NDK A;  3FBF A;  2RRN A;  4UZB A;  1R43 A;  2AX0 A;  2F5G A;  1U2C A;  4DX5 A;  1JB0 C;  1RT4 B;  1T94 A;  3RTV A;  1KOO A;  4B3O A;  3RRH A;  6AT1 B;  1SCJ B;  4LF7 J;  4I67 A;  2BW2 A;  2JLF A;  3FFI A;  3ENV A;  3IRW P;  3PKY A;  4ZVR B;  1Y5I B;  2CFX A;  1XMQ J;  2ROP A;  3I5C A;  1OS5 A;  3R27 A;  4M5L A;  2DH9 A;  1WKL A;  5A6W A;  1JMT A;  3EVM A;  4GVB A;  1VMB A;  4GKK J;  2G1H A;  3MED B;  4MMO A;  4B9M A;  3DOL B;  4DX7 A;  3T5H A;  2KT5 A;  4DFP A;  3W3S A;  2IA0 A;  1V5I B;  2DIU A;  1OQ3 A;  8AT1 B;  2O1P A;  1REG X;  3LP2 B;  1V3Z A;  3Q8U A;  1JKH A;  4MIW A;  3RZA A;  4P7V A;  1F3F A;  4F4W A;  2EBG A;  4GO7 X;  3I0S A;  3TJ8 A;  3DRR B;  1B99 A;  3DRX A;  2HGL A;  2VBY A;  5KFF A;  2E9Z A;  4ER8 A;  5GAG I;  3OTD A;  2HLT A;  1UWA A;  5LMU F;  1GQE A;  1J27 A;  1S9G B;  5K14 A;  3KG0 A;  5L9N A;  4DEZ A;  3UD4 P;  3CJ3 A;  2I0X A;  1E6V A;  2W9C B;  3MFI A;  2XO7 A;  2ADC A;  3ILJ A;  1Q8K A;  3PRD A;  3G71 S;  4ED2 A;  2BRK A;  4O3S A;  1N5Y A;  3LGH A;  3PW2 A;  2QFI A;  4QR1 A;  4LFB J;  5HAO A;  1N52 B;  4AXI A;  3SV3 A;  4DV2 F;  3SQO P;  2J8A A;  2QLX A;  1P1T A;  1IBL J;  2DCL A;  4OYX A;  1T9U A;  2YNI B;  4OZJ A;  2RF2 B;  2V50 A;  5I3U A;  2XY6 A;  5DQI A;  2QL7 B;  3T1H J;  9RUB A;  2DR9 A;  2LQ9 A;  4KPC A;  2XS2 A;  4RW6 B;  4JI5 J;  5ETP A;  2ZVS A;  4CH7 A;  3C19 A;  2CKW A;  4RNO A;  4DX8 H;  3M8S A;  3AHP A;  4CLS A;  3T19 A;  3NNH A;  4Y2K A;  3KJV B;  1YI2 S;  2KN4 A;  1M5V C;  4WFN Q;  3IXQ A;  2KG0 A;  2K7J A;  3KK3 A;  3SMZ A;  3OXG A;  1HWI A;  5ETN A;  2KXF A;  4I7F B;  2HGM A;  3R9L A;  1R6V A;  1BE4 A;  3IWL A;  2VU5 A;  3MM6 A;  1VQO S;  1L3S A;  3JYT B;  1U7L A;  3HI9 A;  4KHM A;  1BHN A;  1FDB A;  1N0V C;  3MM5 B;  3BGR B;  3ZZY A;  3D1H A;  1Q8I A;  1HNW J;  4ECT A;  2AP6 A;  1H6K X;  4HL9 A;  2RIL A;  1NSP A;  4RNF A;  4KKO A;  3T6J A;  2GAG C;  4ZIW A;  1DY3 A;  3QZ8 A;  4ECZ A;  2WVC A;  2B6A B;  2IM2 A;  1W2I A;  3MD3 A;  3BBF A;  4YR0 A;  4ECY A;  4NE9 C;  1F1B B;  4UOG A;  4NLP A;  2VOO A;  4NLO A;  4PR6 A;  2J5A A;  3KXD A;  1OQ6 A;  2I9S A;  2K06 A;  2EW9 A;  3V4I B;  3T5J A;  1H2T Z;  3MR5 A;  1UEU A;  2JRS A;  5DDO C;  1S77 D;  3NMA A;  2P5V A;  1I6J A;  4NLR A;  4WYW A;  3UN3 A;  2IVF B;  4B9U A;  3FZB A;  3D6H B;  1UA0 A;  2ZHB A;  2E5H A;  2JEI A;  1YZ7 A;  2XI3 A;  1S1T A;  3BKU A;  3EVO A;  1JJ4 A;  1PJ7 A;  3CE8 A;  1SJ1 A;  1FD8 A;  4LF6 J;  2VPZ B;  2Z2L A;  1FJE B;  4ETZ A;  4FF3 A;  1RT3 B;  3I31 A;  4UOH A;  3RU0 A;  3UR0 A;  4ES3 A;  2BAN A;  4ES1 A;  5L38 A;  1P8G A;  4GRS A;  1RWO B;  3MMA A;  2HVZ A;  2QMW A;  1SI9 A;  4NXN J;  1RHJ B;  3KHR A;  4DBQ A;  2B4O A;  5CHC B;  4QWC A;  4ITS A;  1TL3 B;  3MUV P;  2OPP B;  3C16 B;  3PZP A;  1VC6 A;  3J7Z 5;  2EFQ A;  2B4U A;  2JL9 A;  4NA3 A;  1S5Z A;  4N7T A;  5KOW A;  3LW5 C;  2FB0 A;  5D0H A;  5EGY A;  4TY8 B;  2E9R X;  2E9T A;  4PWD A;  1WEX A;  2MYF A;  2BE7 D;  3V6H A;  3JXO A;  2EG2 A;  2NUU G;  5I3Q A;  1ZTT A;  2N4D A;  5JJB A;  1KBR A;  4BHQ A;  1S4E A;  2DGU A;  3KLH A;  1YJU A;  3MPD A;  5KFD A;  4LIR A;  4U67 Q;  2C2Z B;  2AEJ A;  2HNY B;  2P9C A;  1CEZ A;  2LQ5 A;  5EX3 A;  1C4C A;  4XPE A;  4JBC A;  3UD5 A;  1KOH A;  4MYT A;  1TK8 A;  3MR3 A;  1IBC B;  4O44 B;  3MWB A;  3W66 A;  1KVI A;  1MWY A;  1X9W A;  2HWI A;  4N56 A;  1O0P A;  4CLF A;  2PO4 A;  3G8Q A;  2F40 A;  1BUX A;  3NOG A;  5DG8 A;  3DFE A;  5F0W A;  2DR5 A;  1FNX H;  3B8H A;  1TL7 A;  1N48 A;  5HMX A;  3G82 B;  1EQM A;  1J5O B;  3W5Y A;  1SC3 B;  4TYA A;  4WFB Q;  1XJW B;  4U96 A;  3D9B A;  1VLO A;  2UVU A;  4A8K A;  1VQM S;  1HIY A;  3PIO Q;  2K3K A;  2WON B;  1NUE A;  3KKF A;  5BR8 J;  2GQQ A;  2A10 A;  1S79 A;  2L9N A;  4UQG A;  4K5S A;  2J76 E;  5HBM A;  2IM3 A;  1VQK S;  1QY7 A;  4G65 A;  3FK4 A;  4QPX A;  4DV6 J;  2N3L A;  3RGI A;  1CUL A;  2J9D E;  4L76 A;  2CQ4 A;  5EWE A;  1KFD A;  2ROE A;  5IS2 A;  1C1B B;  2E66 A;  2VAS A;  1WG4 A;  4RW9 B;  2HS3 A;  4DR3 F;  2NPI A;  2LU1 A;  2K7K A;  4CLL A;  3Q8V A;  1Y3J A;  5IT4 A;  1Q0N A;  2B7B B;  1WHX A;  3ZXW A;  2H51 B;  5DQG A;  2E7V A;  1GMW A;  5HP1 B;  2HHS A;  1GNK A;  3CGI A;  3GIR A;  1H7X A;  1TEL A;  1X4H A;  2GFF A;  1N56 A;  2IDE A;  4IG3 A;  2V9W A;  4IDK A;  1T95 A;  4I1T A;  3Q86 A;  2WK4 A;  2NXJ A;  4NCG A;  2QEX S;  1R8H A;  4OX7 A;  1F5A A;  5ITH A;  5DJB A;  1EAR A;  1FKA F;  3UFC X;  1WI6 A;  6FD1 A;  3MGJ A;  2M52 A;  4YP3 A;  4DL2 A;  1N33 F;  3NGT A;  3BGU A;  2GZO A;  2W8K A;  3KNG A;  4NZ6 A;  1U1N A;  2VD3 A;  4FYX B;  2DXE A;  1UZH A;  3KJQ B;  4OI2 A;  3KHH A;  2BQR A;  2FYX A;  4GC6 A;  3SV4 A;  4C3K A;  2V2K A;  2LDY A;  4R5P A;  2AU0 A;  5HVF A;  2XMJ A;  2C3M A;  2R7W A;  2J8S A;  1PGZ A;  4LFA J;  1U2R A;  4OZL A;  4C3L A;  4QIV A;  1GK8 A;  2VFS A;  2J9C A;  4PUO B;  5FJ4 A;  3CMQ A;  3DLJ A;  3T41 A;  3N6L A;  3RBZ A;  3GR0 A;  4QZV B;  1MWZ A;  4GKJ J;  3RAX A;  4KGX B;  2DRD A;  3BPD A;  3GG1 A;  3EGZ A;  1S6Q B;  5C24 A;  4IQM A;  5KAK A;  1LWC A;  1RB0 A;  3C6T A;  4KV8 A;  2FJA B;  1MSW D;  3HHL B;  3AA9 A;  2VPW B;  4K5R A;  2Z0G A;  4JI8 F;  4PXB A;  4AL6 A;  4B9L A;  2DNN A;  1JK9 B;  1AZS B;  2DGQ A;  1PJ5 A;  3R1H A;  3CWJ A;  4M5D A;  2QO3 A;  1PYS B;  1NJY A;  3HPO A;  3TA1 A;  1WHW A;  1OPZ A;  2ZZN A;  1JXE A;  5C42 B;  4IQX A;  4JI0 J;  3H42 A;  2ZKU A;  4ENO A;  1K73 T;  5H1S V;  3OR2 B;  3BKF A;  4WXO A;  2PMH A;  2CPF A;  2BE2 B;  2BQ3 A;  3GFX A;  3CCV S;  3DM2 B;  4K4U A;  3DGP B;  4H4O B;  4RW4 B;  3BH7 B;  1UVK A;  1U4B A;  3UQS A;  2DNZ A;  4DR2 J;  3CCE S;  4CLZ A;  2HQ3 A;  2F8M A;  3B54 A;  4DSE A;  3MM9 A;  2A6M A;  2VH7 A;  2AYE A;  3MMJ A;  3E3X A;  3GV5 B;  2Z2M A;  2EG1 A;  3HHE A;  1SVD A;  1A6L A;  1XK8 A;  3DRS B;  1YBU A;  4DV1 F;  4KGK A;  4JI1 F;  4DUT A;  4EU0 A;  3Q0A A;  3QGP A;  2DY1 A;  2WAQ D;  5CCL A;  4IG0 A;  3R5G A;  3RB0 A;  4OHV A;  2NXE A;  5IZH A;  4RO0 A;  1UWB B;  5A76 A;  1IXK A;  2FZC B;  2GJF A;  3BO2 A;  3ZTP A;  2XQC A;  3BKT A;  1PYT A;  2XLI A;  4EBD A;  4WJB A;  3DHW C;  4OX9 J;  3Q2T C;  3BO4 A;  5F0U A;  3OVS A;  2OIH A;  1R0A A;  3MAQ A;  3I32 A;  5T41 A;  4RR5 A;  1FE4 A;  4F2S A;  2Y0S D;  2DXD A;  5HVG A;  4WBF A;  2NSC A;  3THP A;  4IFY B;  3HZG A;  4DU7 A;  4IOC Q;  2E5J A;  3QGG A;  2KXH A;  2R8H A;  3DYA B;  3AB4 B;  2RNE A;  1KS2 A;  3LPE A;  3VVT A;  4I2Q A;  1SIW B;  2UXB F;  2LA6 A;  2C28 A;  2BJ7 A;  3F41 A;  4B3M F;  2E1P A;  3AT1 B;  3M9N B;  2KT2 A;  5GVQ A;  2AZ1 A;  4R8U A;  2FJV A;  1PG5 B;  2IC3 A;  5B7W A;  2BOA A;  4ZVS B;  3CIM A;  2QTW A;  2HKE A;  3RW7 A;  2VB6 A;  3PYE A;  2C22 A;  2AYB A;  3ILL A;  4OZ1 A;  2P2C B;  3N5F A;  2CA9 A;  1RT5 A;  5F8H A;  2BYC A;  2VHG A;  4LT6 A;  5L1I A;  4F2R A;  2I8E A;  3NRB A;  4TKT A;  2UUA F;  2B9X A;  1K44 A;  5AJ3 J;  2J9E A;  4OZN A;  3WZ0 A;  5C5J A;  5LOQ A;  2O3D A;  1HPZ A;  2QE5 A;  2QSW A;  5CYM A;  1HNZ F;  4LF7 F;  4MKB A;  3V6K A;  2CQC A;  2NYI A;  3NS6 A;  3NOC A;  2V8V A;  2ACY A;  4V19 X;  2VC0 A;  1EP4 B;  4RX6 A;  5EDW A;  3FRY A;  1XMQ F;  2ZBQ A;  5DS7 A;  4TQR A;  4OV6 A;  2CXE A;  1HBO A;  3EM1 A;  2P6S A;  3OPK A;  4QIW D;  3BRE A;  2ASL A;  1VGY A;  1TUG B;  3KHG A;  4GKK F;  1TKZ A;  1RTI A;  2CJX B;  1JLQ A;  1RKI A;  2R2U A;  2I38 A;  4H4M A;  4NLQ A;  1M1H A;  3GIM A;  3WDO A;  4U6P A;  3CD7 A;  2IM1 A;  4B9T A;  4YDD B;  4HKQ A;  3DDI A;  3FCW A;  4U7C A;  1R8C A;  5J2M A;  4F25 A;  3TUJ C;  3Q22 A;  3HT0 A;  1BQM B;  3HUL A;  2M7S A;  3BM7 A;  4EWT A;  4OYB A;  4PG7 A;  1O8B A;  3R5D A;  4WKY A;  3W8P A;  2XHC A;  5DGB A;  1NME B;  2NZC A;  1HW8 A;  4ANE A;  2BX6 A;  3GMG A;  5KG4 A;  4E2F B;  2LVW A;  2CNN B;  2GVD B;  3QFW A;  2YPZ A;  2H9Z A;  2ZWO A;  1TR0 A;  3GCW P;  5J1N A;  4WWS A;  2R7Q A;  2NXN A;  3AH6 A;  3NS5 A;  3KHL A;  4OZ5 A;  1J5E J;  3K2Y A;  1TU0 B;  1WF0 A;  2L9D A;  3JQK A;  4F3Q A;  4EK2 A;  1CPZ A;  2XC9 A;  3Q23 A;  3K5N A;  4M5H A;  2OD4 A;  2MZ1 A;  3F73 A;  1PJ6 A;  3PY8 A;  3OTE A;  2MLX A;  2OFH X;  1IBL F;  3MCS A;  1VQY A;  2CPI A;  1C0T A;  2GJI A;  2L48 A;  2IA6 A;  1NK9 A;  4DI6 A;  1Y9O A;  3T1H F;  4FN5 A;  4UZC A;  4DN0 A;  2W4D A;  1F3V A;  3NGS A;  4I64 A;  2GVZ A;  2AJ4 A;  4UOC A;  3FZ2 A;  1N6Q A;  1QE1 B;  1U49 A;  2HBY B;  1Y0H A;  3B78 A;  4DV4 J;  3KFW X;  2N3O A;  4PRF A;  4KC5 A;  1UTA A;  2VFU A;  4Q44 A;  4PAA A;  2XGP A;  3M30 B;  2WVE A;  1P9Y A;  2XSJ B;  1KWM A;  3LPY A;  3JS9 A;  5M2R A;  3KNA A;  3RAM A;  5HAN A;  4XK8 C;  1GXU A;  4LRE A;  4F3O A;  4DF4 A;  4I0W A;  1UMJ A;  1UCN A;  1L3U A;  4FF2 A;  4NLV A;  3NXZ A;  4F0H A;  5D77 A;  1BWE A;  4X4P A;  2VFR A;  2U1A A;  1RIS A;  3OBI A;  1HNW F;  3MXH P;  4RJV A;  1ARO P;  3H5S A;  4CO5 A;  1SJQ A;  2Y1L B;  4MFB A;  4DCP B;  1HBU A;  5C2G A;  2KJW A;  2VKZ G;  3PHE A;  3DOK A;  5EWG A;  4G3I A;  2XY5 A;  3DLK B;  1TQL A;  1OO0 B;  2ZOM A;  5ADZ A;  4CNY A;  1RUS A;  4IFV A;  2HUR A;  3M8Q B;  3M9M B;  1NK8 A;  2BBE A;  2OPS A;  1N36 J;  3HT3 A;  3E01 B;  2DH8 A;  2LEC A;  1XBW A;  1RWP B;  5ETO A;  2MQM A;  2M88 A;  5E2Q A;  5A2Q Y;  2ZH4 A;  3CPW R;  3H59 A;  3EPG A;  2MZT A;  1LNQ A;  3ITH A;  4X4Q A;  2RB7 A;  3MEE A;  2Z30 B;  2YX1 A;  3HHK A;  2R2S A;  4IYQ A;  1HNV A;  2BW7 A;  1LWF B;  4MJK A;  1G2E A;  3GFH A;  2NZ4 A;  5IFM A;  2V6A A;  3KK1 A;  1S49 A;  1G4C A;  3D3C J;  3TQ1 A;  4K4X A;  4LF6 F;  5IC6 B;  1RHK B;  1GT8 A;  3DHX A;  1RP5 A;  1SUQ B;  2C3P A;  1Q8B A;  2YWF A;  1Y00 A;  1W26 A;  5HRO A;  3PCO B;  3W7B A;  1KLN A;  1KKH A;  1VC5 A;  3LAM A;  2F8H A;  4NLG A;  4DR7 J;  4NXN F;  4Q45 A;  5IM0 B;  3RR8 A;  3CJ8 A;  2DBB A;  1NPK A;  1HMV A;  2B5J B;  3D0H E;  3QYY A;  2D7S A;  3L3C A;  4V1A k;  2DHG A;  1XER A;  4YR3 A;  1R89 A;  2I5J B;  1R3N A;  3MEC B;  1X9M A;  4WK3 A;  4AXJ A;  4MK9 A;  3EXC X;  2KXN B;  2G13 A;  1TK0 A;  2OMO A;  3RG6 A;  4HYK A;  2B8P A;  3FJ2 A;  3G6Y A;  3UW1 A;  4IR9 A;  1MU2 B;  5LT5 A;  1X5S A;  2XCP A;  2OEL A;  2WVF A;  5IV4 A;  4DR1 J;  3Q89 A;  3PR5 B;  5F9L A;  1WSR A;  3R97 A;  4DOZ A;  2A2C A;  4AQY F;  2HBR B;  3KLF B;  3AJD A;  4XTT A;  3DMJ B;  2BE9 B;  1FHT A;  3LAN A;  4Q2M A;  4NLS A;  2HVI A;  1JWW A;  2XMK A;  2V0N A;  4CLP A;  5BR8 F;  2XLK A;  3LP0 A;  3TA0 A;  2CIM A;  3V6D A;  1LKZ A;  1IM6 A;  1DRZ A;  1PC5 A;  5KFW A;  1X0F A;  2C2N A;  2E1A A;  1SL2 A;  1X8D A;  1RT1 B;  3TAM A;  2CQ2 A;  3OW2 R;  1BQN B;  3QLH A;  4KFB B;  2D3Z A;  2JDJ A;  3D68 A;  3D5M A;  3G8S A;  2AYG A;  2M4M A;  4JV0 A;  1VQ6 S;  2IVM A;  4HI2 A;  2E1R A;  4WYL A;  3A8E A;  3HHN B;  5EUH A;  4USI A;  2L41 A;  4RNH A;  1KDN A;  2ZD1 A;  2PT0 A;  1T05 B;  1WKK A;  4W90 B;  1VHF A;  1Q82 T;  2VOD A;  2QMX A;  2GML A;  3BGO P;  3TJ9 A;  3P6Y C;  3K17 A;  5KT5 A;  2V2Z A;  2BMB A;  1VK8 A;  2MLZ A;  2GHV C;  5JVG Q;  4NYP A;  2W7A A;  1HYS B;  2I2Y A;  2R2T A;  5DM7 Q;  3S7R A;  4HTI A;  5L9X A;  1RAB B;  1U8W A;  2HS0 A;  5HN0 A;  3DXB A;  1G3O A;  3EDR B;  3W60 A;  4K4Y A;  3GON A;  4DXL A;  1Q16 B;  4LVN P;  1FFS B;  3EX7 B;  2W2P P;  3GLJ A;  2RU9 A;  5KFS A;  2EI5 A;  4XDC A;  1E6Y A;  2JNJ A;  1RBL A;  3CUL A;  4LFA F;  2EFO A;  3D0G E;  2DGS A;  1UJ5 A;  2GGP A;  1Q86 T;  2VFT A;  1KTV A;  4F4X A;  2RVJ A;  4YFU A;  1QVF R;  2KO1 A;  3CMA S;  1YJW S;  2YKQ A;  4Z7Y A;  1Q81 T;  3PX6 A;  3D3B J;  4A8W A;  2FHJ D;  2NQP A;  4GKJ F;  2RT3 A;  1B3T A;  3KUH A;  4OHZ A;  4C8O A;  3IAS 9;  1RLD A;  2DGW A;  4OI1 A;  1UP1 A;  4C6A A;  2MEW A;  3OHB A;  2IDL A;  3HX9 A;  4CM2 A;  1LWE B;  2FC8 A;  4OQJ A;  2DO0 A;  2DNR A;  1RKJ A;  3GFZ A;  2VQE J;  1EAY C;  2V4J B;  3HHL C;  4ZOS A;  1S10 A;  1CJK B;  4LBI A;  2EFP A;  2HVE A;  2LQB A;  4WFA Q;  4E0D A;  3O6Q A;  3CSK A;  1AXQ A;  3EGV A;  4HHU A;  5KG6 A;  5B0F A;  3I87 A;  4R0E A;  2VDI A;  2YNF B;  2C42 A;  1KEK A;  4PG8 A;  2ROG A;  3OSP A;  4JI0 F;  4WE1 B;  4U95 A;  4OJG A;  2HND B;  4J9M A;  5A0Y B;  1RT4 A;  4OJH A;  2V8P A;  4C8Y A;  1M5O C;  3KJN B;  1UEV A;  2UV8 G;  1CJU A;  2UVV A;  4O3N A;  5IQ6 A;  2DO4 A;  3UWT A;  1BLU A;  1GAO A;  1T11 A;  2HRT A;  3CJ4 A;  3M2V B;  1UKU A;  2K3I A;  1ZET A;  2Z58 B;  1S1V B;  3O5T B;  4PG5 A;  3T9N A;  1U1R A;  1R8B A;  5DO2 A;  2CDQ A;  4DR2 F;  5G4D A;  1S1W B;  1VJW A;  4LF2 A;  4GC7 A;  2V8G A;  2HQI A;  2IYI A;  1TMM A;  2OUG A;  3R3T A;  4FYW B;  2W2M P;  2V4R A;  4FXD A;  2XUL A;  2AJ1 A;  1NK7 A;  3TZW A;  1JQG A;  1VRT B;  2FC9 A;  1LK7 A;  3MED A;  1IUJ A;  1ZM2 A;  3MAA B;  2DHH A;  2EFV A;  4ZN3 A;  2MKC A;  5KFO A;  3ETO A;  5JUM A;  2AV5 A;  1S99 A;  2VOP A;  5CYQ B;  1IR2 A;  3LP2 A;  3DU6 A;  1S6P B;  5LSO A;  1HD1 A;  1CJV B;  2RQK A;  2J6U A;  4OX9 F;  1WG1 A;  1U1L A;  3R2C J;  2F4V J;  3DRR A;  2EXU A;  2DEI A;  5DM6 Q;  1OMS A;  3NGU A;  3J7Y I;  3OFE A;  4EBC A;  2UVW A;  3IM8 A;  4X2B A;  5D3G B;  3POT B;  4OZ0 A;  4FBT A;  1R31 A;  3V5R A;  3OTC A;  1AW0 A;  1PCA A;  5D0E A;  1Q7Y T;  1TKT B;  1S9G A;  2VG6 B;  2W9C A;  4NMX A;  1K8A T;  4MIB A;  4EZ6 A;  3NY0 A;  1HLW A;  3Q8S B;  2NPF A;  3HKW A;  4J9V A;  1RYS A;  3OXL A;  4DQI A;  2HBQ B;  2ZH7 A;  2RH3 A;  3AQO A;  4MK7 A;  3BN4 A;  4C8K A;  1RLC L;  1RU2 A;  3IRX B;  1JIH A;  1DBD A;  4KSE B;  2CQP A;  1ZM4 A;  2CNK B;  1KHV A;  1HQU B;  1S57 A;  5H9F K;  1MRO B;  3BR8 A; 
#chains in the Genus database with same CATH homology
 2UXD J;  4V1A k;  1FJG J;  4JI7 J;  1XMQ J;  4HHU A;  4JYA J;  3J7A N;  5LM7 E;  4DR5 J;  3OTO J;  4AQY J;  4B3R J;  4X65 J;  1XMO J;  2MQ8 A;  4B3S J;  1N32 J;  4B3M J;  3R2D J;  2ZM6 J;  2KVQ E;  4LF9 J;  4JV5 J;  4LFB J;  4LF6 J;  4LF4 J;  4DV5 J;  1HNW J;  3R2C J;  2F4V J;  4KY3 A;  4GKK J;  4DV1 J;  4GKJ J;  4JI8 J;  2UXC J;  4X64 J;  4X62 J;  4KHP J;  1XNR J;  4JI1 J;  5IT9 U;  2HHH J;  1IBL J;  4PWW A;  2UUA J;  4DR2 J;  1I94 J;  4DV7 J;  4DV3 J;  1N33 J;  3T1H J;  4NEY A;  1IBK J;  3D3C J;  4DR3 J;  1J5E J;  4LFC J;  1HNX J;  3D3B J;  4DR1 J;  4NXN J;  4JI5 J;  4JI6 J;  2VQF J;  4RJV A;  4LF5 J;  1HNZ J;  5LMU J;  4LFA J;  5LMN J;  5BR8 J;  4YY3 J;  4DR4 J;  4K0K J;  1HR0 J;  2UUB J;  2MEW A;  4DUY J;  3JAM U;  2KL8 A;  1N34 J;  4DUZ J;  3T1Y J;  2UU9 J;  4KYZ A;  4NXM J;  1XNQ J;  4NEZ A;  1IBM J;  2UXB J;  4DR7 J;  4JI4 J;  4DV6 J;  4LF8 J;  3IMQ J;  4JI2 J;  2E5L J;  4LF7 J;  2UUC J;  3J80 U;  2VQE J;  3W1Y C;  5A2Q U;  5IWA J;  4YHH J;  4OX9 J;  4JI0 J;  4DR6 J;  5FLX U;  4DV0 J;  2MTL A;  5AJ3 J;  4DV4 J;  4JI3 J;  4DV2 J;  3J81 U;  4B3T J;  4X66 J;  1N36 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...