2UXCJ

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
98
structure length
98
Chain Sequence
b'KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 2uxcJ00
2UXBJ 1FJGJ 1HNWJ 4KHPJ 3J80U 4OX9J 4YY3J 4DV7J 2MEWA 1IBKJ 4B3TJ 4JYAJ 5IT9U 4X66J 3D3BJ 4K0KJ 2UUBJ 4JI5J 4LF9J 2MTLA 4JI0J 1HR0J 4AQYJ 2E5LJ 4DR5J 4HHUA 4NXMJ 2VQFJ 3R2CJ 4B3MJ 2MQ8A 5LMNJ 1XMQJ 4DR1J 1IBLJ 5LMUJ 4GKKJ 5BR8J 4JI2J 4LF4J 2UUCJ 4DUZJ 2UUAJ 4JI6J 5IWAJ 4DR6J 3JAMU 4DV2J 3W1YC 4JI8J 4NXNJ 1HNXJ 4YHHJ 3J81U 2UXDJ 4DV0J 4DR2J 4LFAJ 4DV5J 4JI3J 3J7AN 4V1Ak 1IBMJ 4B3RJ 1N36J 2HHHJ 4JI7J 2ZM6J 4RJVA 4X62J 3IMQJ 4LF7J 4LF5J 4KYZA 3OTOJ 4DR4J 4LF6J 4LFCJ 1HNZJ 1N33J 2KVQE 2KL8A 5A2QU 4X64J 4DV3J 4JI4J 4DV1J 4DUYJ 1N32J 2VQEJ 4B3SJ 3D3CJ 1XMOJ 2UXCJ 1XNQJ 4KY3A 3T1HJ 5FLXU 4GKJJ 2UU9J 4JV5J 4X65J 3T1YJ 4NEYA 4JI1J 5AJ3J 4DV6J 1J5EJ 1XNRJ 2F4VJ 5LM7E 1N34J 4NEZA 4DR3J 4DR7J 4LFBJ 4PWWA 1I94J 3R2DJ 4DV4J 4LF8J
chains in the Genus database with same CATH superfamily
2VF3A 2IFXA 4EZ6A 3LOUA 4USJC 3H25A 2NUHA 2WSFC 2OI2A 4KFBA 9ATCB 2CPEA 4OYIA 1SL2A 3UDLA 4KGZB 4ECVA 2XMUA 3FKBA 3HJVA 5A8RA 1VJQA 4ES1A 1NHKL 3KLGB 4DUZJ 1QTNB 1DAXA 2VONA 1TL1A 2BXJA 1U6FA 2CQDA 5IT4A 3CSKA 2OJ3A 3IFEA 2W2MP 4DR6F 3V5RA 4CZCA 1HQEB 2AGPA 1IKWA 2DNNA 1IKVB 3ULHA 3VV2B 1IBLF 3G8SA 4J9QA 4U7CA 2PA3A 2BUNA 5EUHA 1KBRA 1MROB 5ADZA 4OL8A 1TZ0A 1MMNA 1T9WA 3QT7A 1LW2B 2X1GA 1U4BA 4G65A 4EWTA 4QWAA 2E9ZA 3R7NB 2X51A 2R8GA 5KAKA 4I7FA 4LMZA 2DNOA 3AY0A 4YFUA 1MW7A 4ZIWA 3I56S 3TAQA 2F7VA 3FC9A 4FS1A 4FNIA 2AYBA 2G13A 4OJHA 2DBBA 2XLJA 2VH7A 5KG6A 4C48A 3GV5B 2XO7A 1S4FA 1TFYA 2V63A 3OVAA 1BLUA 2W8KA 3M8ZA 1HBMA 5K8NA 3FSYA 4OV6A 4CYUA 1FEEA 1CPZA 4DV1J 1IM6A 2BANB 5A8KA 2OSRA 4CO4A 3G86A 5D4OA 5EDWA 4W98A 1NBEB 4BC9A 2Y8YA 2MSSA 3BQ2A 3LA0A 1UEKA 2VASA 5HLFB 2QYGA 1IBMF 3KK1A 3K5NA 3D28A 2KTQA 3OSNA 3BKFA 2AMCB 3KJFB 2VD3A 3PKYA 3TQEA 2KT5A 1S6QA 2RAQA 3FK4A 3SSRA 3D1QA 1BXNA 5T14A 3GSDA 3KFWX 3N5BA 1TKDA 5KFTA 4DR6J 2WBRA 1CULA 4QIEA 3AHPA 2MJUA 2B6AA 4UOGA 2ILZA 3PW2A 4Q2LA 3I32A 2ZHAA 5C25A 1Q86T 2QV6A 4ZJOA 3CF5Q 2R7VA 3GCXP 5F8LA 1TL3A 2Y0SD 2HVDA 2KVQE 3MEDB 5DLFA 4K8RA 2O1PA 2X7IA 2RSQA 3CD0A 1HD1A 4NX9A 4ZIVA 1SJFA 4RW4A 3W2VA 4R0EA 2HQIA 2HLUA 2J9EA 1NJZA 2JC1A 2RF2A 3MM8B 1G1XA 1YZ7A 1RZMA 3EUNA 2MYFA 2ZOFA 1YK9A 2OFGX 2DJWA 1NXIA 2B56A 3KWMA 3GFYA 3VGTA 5D15A 2IC3A 2R2TA 4RNHA 3DLEB 3B78A 4WWSA 3FCWA 3OLBA 2NXEA 5KFSA 3LP0B 1J5OB 4DCJB 1KFDA 1FFGB 2ASDA 2G1DA 5DM6Q 1EQMA 2FPHX 4BCAA 2UXDJ 3Q8RB 2YKPA 3SCJE 3HK2A 2XHCA 2J9DE 2KG1A 1Y11A 3MMAA 2IVFB 2XSJB 5G0RB 4ZVHA 4C6AA 2Z2LA 3CJSA 3ZFVA 3LH2S 4DL3A 1W2BR 4PYDA 2R8IA 2KL8A 2MGZB 4NMXA 5DQIA 2R3VA 2LYVA 1E6VA 2A2CA 1IR2A 3TW0A 2XB2D 4AXJA 3I82A 4L74A 3GTYX 5AJ3J 1U2RA 1EP4A 2XI3A 4EO8A 3M8QB 1HBUA 2YPYA 3PHTA 2XZDB 3EZ5A 4RUAA 4PG6A 2ZEJA 3G6YA 1N34F 4JYAJ 1IKYA 1BUXA 3BZQA 1FJGF 3R2CJ 1T3OA 4UY85 4JV5F 5DJBA 3H2VE 3FEZA 3CXCR 3KNGA 1NK7A 5KTQA 3M7VA 2YH0A 1FKAF 4Y28C 1E6YA 1HHSA 2LVWA 2DGWA 3TYTA 4ILMA 4F67A 1S9GA 2A18A 3CJ8A 4V1Ak 4C3MA 3K59A 2VG5A 3BYRA 4LSNB 1J2VA 2W1BA 2L41A 1VQPS 3H42A 4OI3A 2W9CA 1SL1A 3T5KA 4O4RA 5C42B 1WC3A 1RT5A 1NJWA 1S79A 2CPIA 2BJEA 1RAAB 2H5EA 4XDDA 5K8PA 1BE4A 1HNZF 1Z2ZA 1RKIA 4KKOB 3UD5A 4ICLA 3ZXWA 2F65A 3CJKA 1KVKA 2XEXA 4C8KA 2ADCA 2L9DA 4RBVA 1FT8A 2ZNYA 3D5MA 1RXOB 2VC0A 4LFBF 1TVRB 4ZS6A 2EG2A 2V69A 1CJTA 1VK8A 3P3DA 4RR5A 2V2QA 5J1PA 3KK2B 2DEIA 1O8BA 3LO3A 4KH1B 4KPCA 3MDFA 3TEGA 1SBRA 3NCRA 3WIVA 5IV4A 4Q43A 1HLWA 4P74A 1HI0P 5CYMB 1CQMA 1RT6A 2Z2ZA 2B3TB 4L3KA 3KDNA 3MEKA 1FNXH 2VOOA 3MFIA 1GXLA 1RCOB 3NXZA 2HBZB 1KVJA 3QGPA 4DFMA 1S1XA 3UR0A 3UPFA 1PSDA 1QAXA 3SIPB 3OFFA 3H2LA 3FSXA 1KHWA 1IKXA 2EC2A 2DIUA 5GAEU 8ATCB 4LQ9A 3O5TB 1JLBB 7AT1B 3KKFA 2HK3A 4I2PA 2DXDA 1S0NA 1N34J 5F9NA 4QWEA 1PYTA 3DNCA 2VA3A 3FRYA 1FJGJ 4PG7A 3NGDA 4PG5A 2ERRA 2FC8A 2Z57B 5KFVA 2CFXA 5IC6B 3N9UC 5J2NB 1UVMA 2JWNA 4DFPA 1ZH5A 2H4YB 3QO9B 5MLCV 3I9V9 2DHGA 4DBQA 3ZZRA 2YWKA 2CQ0A 5JXSA 1RKJA 4NWBA 4C0OC 2NYIA 9RUBA 4Q2MA 4CLWA 1QDUB 2PSZA 3F41A 3C6TA 3PW0A 1U0HA 1CS4A 4PWDB 2GMHA 2K8GA 1YITS 2J9CA 5KOWA 2I38A 2MQNA 3G8QA 4KC5A 2ZE2B 5ETOA 4TU8A 2E5JA 4E0DA 2OSQA 2P9EA 3EDRB 2VKZG 2KU7A 1S1WA 3R5BA 2ZJRQ 3HX9A 5FLXY 3MEEA 1UJ4A 1HNZJ 1VQLS 2VICA 3D0HE 2V8PA 4WK1A 1HNXF 2G9OA 1EX8A 2OPRA 4F26A 3R7SB 3I96A 4NI2A 3JYTA 2HZCA 3HKZD 3MR6A 4LFBJ 4NCAA 1V5VA 2Q79A 2I1RA 2RT3A 2CJBA 2BJ1A 3LALA 1RBAA 4N56A 1VRUB 3H0PA 4FPRA 5F8GA 1UFLA 2PN6A 3LWLA 1SUQB 3OXFA 2E5IA 2R7OA 2M0GB 2V2ZA 4PZVA 3RAXA 3D6MB 4O23A 3PHEA 4LF8F 3OV7A 1RT7B 5KFLA 3GFHA 5J2MB 2ADBA 1FVQA 5H9EK 2KDOA 3JTPA 3LP2B 5LJ3Y 1ZM2A 1TL4A 4B9NA 2MKIA 3GG1A 1SL0A 4Y2IA 3AQPA 2ZC4A 3EICA 2RU3A 3V6HA 1L3SA 2B7CB 1FK9A 1ZZNA 1YWXA 1OMSA 1KONA 1N33F 5KFYA 3A3OB 1QAYA 2LQ5A 4OHWA 2BKOA 2HMIA 1RHKB 4NLVA 2IVMA 4LVNP 2MKJA 2FVQA 1S4EA 4YDXA 3RBEA 3TZZA 2CZ4A 4OZLA 1RTDB 5M2UA 2JVRA 1S6UA 3I4HX 2GNKA 2CQ1A 2A3JA 2FHKA 4DS5A 2GQ2A 2KG0A 2YH1A 4TU7A 3NOGA 5F0WA 1LKZA 1WWHA 2C2OB 3TZYA 5LJ5Y 5I42B 3DKDA 2V68A 5KT7A 2XY5A 5BR8F 3V6DA 3OTBA 1RBOB 3IGVA 5KFFA 5KOXA 2X1AA 1X31C 1HFEL 1IWGA 3GILA 3HVAA 5BXIA 3L3CA 2JSXA 5SZTA 3IS9B 3OLAA 3HHLB 1FDAA 3DOKA 4IG3B 5CQGA 3RU0A 1U47A 3DOLA 5LSLA 2IAJA 1B7YB 4MMOA 4RW7A 4IFYB 4NXNF 1HWKA 3LF0A 4I56A 4C3LA 3R3TA 3RBZA 4AT1B 3LP1B 2ZHBA 2YNIA 3JAMY 1RU2A 4L76A 1LWFA 2UV8A 2ZJPQ 3SMZA 2IJNA 1FERA 2YKMB 3MMBB 3LUYA 4FDFA 1JXLA 5DETA 2OEKA 2PIIA 5HJXA 2G4BA 2A1BA 2YWGA 3MMJA 2JVOA 2XYGB 5L1KA 2AX0A 4OX9F 4CTAB 1RLCL 2LP4A 1NO8A 3G71S 3O44A 1RT2B 4X2BA 1JLAA 1N5VA 1KQKA 3OJUA 3NGRA 1FF2A 3QT6A 2VL1A 3W64A 4DWIA 4LSZB 3MM9A 2NYHA 1WKLA 3CCZA 1PIEA 4ID5A 1RT1A 1QUVA 1KWMA 4NCGA 5H1SV 1IVZA 2UUWA 1AFIA 2GX8A 3BPSP 4UY8T 3KHGA 3K5MA 4OYXA 4DR1F 5HQ8A 3K5PA 4WYWA 2JLGA 2XLIA 3BH7B 3L09A 1N33J 4RNMA 4OI0A 2IJRA 3EMTA 3D66A 5D0GA 2GMJA 4DL6A 2DNRA 3UE2A 1F60B 1HPZA 3M6WA 1SIWB 1V3SA 2MB0B 1KSPA 5ETSA 1Q7YT 3HFVA 4MIWA 4ZHRB 1UJ6A 2YNGB 5GAGU 4CT9A 2L08A 1SQGA 2Z56B 5ITHA 3I31A 4WIIA 3V81A 4JV1A 1QAIA 5I3PA 4Y2CA 5K14A 4JB8B 4XTTA 2AJ4A 2VV5A 4JI0F 5BR8J 3Q8UA 2VUGA 1UW4A 3BQ1A 4BWJA 5A0YB 1N0UA 1UEUA 4RPFA 4DL5A 2QA4S 4ZJLA 3P96A 1LWEB 3DI6A 5CABA 2POKA 4KO0A 5HVHA 3D68A 4IYQA 3W65A 1R7IA 3W5XA 2GHVC 3C6UB 3N0VA 2HVEA 3BDPA 3M05A 2F40A 4PQUB 2GJFA 4YB7A 4IFVA 4M63A 1C1CA 3MR7A 3VF0B 4CLTA 3M8PA 4MYTA 1DHMA 2HBYB 3MM5B 2HHUA 4CT8A 3MMCB 4ZPAA 4MT1A 4E2FB 5GADI 1JJHA 3U1MA 2YPZA 4C8YA 1NRKA 1CJUA 3CDEA 1SV5B 4ER8A 2XY6A 3IRXB 4B9MA 4OX9J 2EG1A 1WD6A 3K5LA 2J6SA 4UF4A 3Q0AA 1X4AA 3BBCA 3NS5A 3OD2A 4PXCA 4EBDA 3J7YU 4IDKA 4IQXA 3ADAC 2V8GA 3RZAA 1X4FA 1VQKS 4ZP8A 2W24A 2VIHA 1Q82T 2D74B 3LAMA 4ALZA 2GVZB 2FJDB 2HURA 1HYSB 1YSJA 3QIPA 3PJWA 2KHCA 1A9NB 1QSSA 1T05A 3C15B 3QGGA 4AQYF 2CNLB 1GXUA 3M8RA 4DN9A 3DM2B 2OO4A 1TP7A 2JZ5A 3QZ7A 4TYBA 5HATA 3QGHA 1RB0A 3SZ2A 1T9UA 5M2RA 4ZCIA 4RW6A 1SJQA 1Q8LA 1Y5LB 1ZTTA 2ZVSA 3LGMA 2BQUA 1KNZA 1N6QA 3PJXA 4K50A 2AJ0A 3G6ES 3V2UC 4DR4F 4OYMA 4H4OB 4JI0J 4WKRA 3VQTA 1R6YA 3CIMA 3RR8A 4J9VA 1PYOB 1UA1A 1M90T 4PXBA 3VAGA 2NCKL 2BOPA 4CO0A 1TK8A 1FWKA 3W2WA 4X4VA 2APOA 2YTCA 3GZ7A 1B0TA 3NNCA 2L9NA 2DHAA 4LRFA 3BBFA 1DY3A 3OJSA 3D1OA 5HO4A 2D7SA 2VA2A 3QBCA 3SFGA 2L9WA 2VC1A 1SPBP 2D3OR 3EGVA 2QLJB 2F9DA 1RK8A 2B4OA 1XR7A 4HHHA 2W2NP 2HHHF 4M5HA 3A8IA 3RRGA 3DRPA 3HT0A 4JI8F 6AT1B 2DR5A 1SJ1A 1P1LA 4NMLA 2ZH5A 2W2OP 1IQZA 1EZZB 3HHEA 2VQEF 3F0NA 1PG5B 4TQSA 4Q0BA 2XMWA 1ZM3A 1RCXB 1S6OA 2OPPA 1UTAA 2ZITA 4A46A 5H9FK 4LFCF 1Y00A 3J7ZT 3M8WA 3D3BJ 5K20B 4USMA 2M7SA 4P72A 5L1LA 1RE1B 3IXQA 1HNIB 1TKTB 5LMNJ 4DSJA 3AH6A 2QZ8A 4ZVUB 4QPTA 3TUZC 1VIXA 4M1KA 5HROB 2Z58B 1U8SA 3EJMA 3GJQB 3AQOA 1WF1A 2CPFA 2E7XA 1S7IA 3T5HA 3NL0A 1N5SA 2HIQA 3WDOA 1Q8KA 5DDOC 2JL9A 5KFUA 2IIHA 4FF1A 3A3NB 4FBTA 2K3IA 2BQ3A 1QM9A 5E7OB 2AD9A 1Q5YA 2KI2A 2Z30B 4HACA 1WHXA 4AFFA 4MK7A 2W9AA 3FCVA 4JP8A 3A8EA 1ZA1B 2I5JB 3R97A 1F5BA 1JLFA 1OY6A 2CJ9A 3RB0A 5D3GA 3G82B 5A2QU 1X5SA 4DX5A 3ZTOA 4PG8A 1R0AA 3D6HB 3HSZA 3GIRA 4B3OA 2AJQA 1TK0A 1PC5A 3HJFA 5GAHI 1DBDA 1U7LA 3QYYA 2EKYA 3N6LA 1PGZA 3DLJA 3Q8PB 3E01A 2ZH2A 1HI1A 2CPDA 2YKAA 2OMOA 1CC8A 4F0HA 2BX6A 1B70B 2DK2A 2U1AA 3UD4P 4M95A 4M5DA 4CLSA 2J6UA 2EKNA 1NK6A 2MQLA 2DGUA 3L7PA 4QIGA 4B17A 3UCGA 3IG1B 4Y34A 4QWBA 3PNIA 1UWBB 4KGMA 3W1YC 2EK6A 3US5A 1PKUA 3VGUA 4QIWD 2ZUAA 1F3FA 2ZBQA 3OR2B 3RUBL 1L3KA 3MECB 3RYLA 1RP5A 2CNOB 3NNAA 2HHHJ 1JQGA 4WKYA 3PCOB 4BWMA 1N5TA 2XMJA 3K58A 1M1HA 4GRSA 2BRLA 1NZ8A 2JEFA 1HWLA 2VQEJ 4ZDNA 2ZD1A 3M32B 3VALA 2FZCB 1IR1A 2ZUGA 3GQCA 1VLYA 4PPZA 4EFAC 1KR4A 2KZMA 4WTOB 1UVIA 1EQ0A 4OMFG 3CGIA 5AXLA 4BHQA 2ALYB 1JLQA 2P6SA 1ZBTA 1XNRF 3D6FB 2FDNA 2AHOB 1T7PA 2HFZA 1S97A 2VFSA 2RVJA 4WIQA 2AGQA 1VQMS 2PE8A 1C4CA 2RNEA 1RT3A 1C1BB 1JLCA 4YB5A 1S9FA 2GVDA 3HHLC 5DLGA 2XYPB 2HWTA 1T94A 1UETA 2VG6A 2M2BA 4Y3CA 1FKOA 2C2MB 2VBWA 4DQQA 2JFDA 1IBKF 2QO3A 2ASLA 3SV3A 3OUYA 4CLPA 2K06A 2V4RA 2C3PA 3POTB 4O3RA 3HCXA 4PPDA 2GMLA 1NPKA 2ALZA 2F8EX 2PD1A 1Q7LB 4KV8B 3W9HA 1RTIA 1B99A 5A6PA 3FSIA 3TO8A 1N32F 4WU3A 3MAAA 2JHEA 1KTQA 1PO6A 3HLUA 4J9OA 4MJKA 5KFGA 4P10A 2O5DA 1Q81T 4KFBB 4U8VA 3W3SA 1M0SA 5HMWA 3CEDA 4NLDA 1LFWA 2VBZA 2GIFA 1I1GA 2OHDA 5B0CA 3MM6A 5A8RB 1D8YA 1RWWB 2MKHA 4DOZA 2R2SA 1HHTP 4X65F 4HVZA 3MUMP 3SBMA 1TL1B 4KTQA 4FXWA 3CNQP 4OJGA 3DLGA 3G4SS 2FLNA 2FJBB 1KOHA 2R7UA 2B4VA 3ZZ0A 1R8PA 1IKWB 1DJ0A 2ZWOA 3CCTA 1X8DA 4X4UA 3MTKA 2QFIA 2ZJQQ 3H8YA 1RDRA 1HHQA 3HZEA 4HDGA 1GMWA 1S0MA 3MD1A 1Q4RA 3AJDA 4DV3F 3T1YJ 3DGVA 3TAPA 4FF2A 3RW6A 2E1AA 1P1TA 1XNRJ 4B3RF 4RW9A 5HP1A 4I7FB 5L1IA 4Y2KA 1FX2A 2UXBJ 4ZPTR 2CZVC 4WCEQ 1U1PA 3KDOA 1M5SA 4Q45A 2ABYA 3PO5A 4KRWA 5HQMA 5DG9A 3H20A 1SXLA 4URQU 3W8GA 3ET6A 1F1BB 4XO0A 3MEGA 1HKAA 3IWLA 2DO4A 1CC7A 2GO9A 2QA1A 1C0UB 3RAMA 4EBEA 4GO7X 2CPHA 2QGFB 3WX4A 4Z7YA 4WP8A 2UVRA 1HBMB 1UW9A 1ZPWX 3T5LA 4DR2F 2HNDA 3R8YA 3OPKA 4CYUB 2XGQA 3CCQS 2CJKA 4HTIA 1RHMB 2K1RA 5B0AA 5A8KB 4NZ0A 3PY8A 1JB0C 1N32J 5ETQA 1OY9A 2RQ4A 1RWPB 4NRTA 1RWMB 1LOUA 3EX7B 1YVFA 5ETRA 3IR7B 1UWAA 2F4FA 4X84A 2F8HA 2P6TA 3KK1B 2XS2A 4JI1J 4AL6A 1N8RT 3FBEA 2WOMA 3WIUA 5LOQA 2CDQA 4GVLA 1C0TB 4I68A 1NHUA 2CRLA 2HVIA 2AIRB 4L72B 1HIYA 1S6QB 2M4MA 3Q8VA 2FY1A 4NLPA 2FJWA 1TTHB 2MQ8A 4B9LA 1BWEA 3DGPA 2NREA 1HQ2A 4OI6A 5U47A 2AEMA 1OSCA 1CULB 2CXEA 1BGXT 2B6AB 5E3RA 2NXJA 1DLOB 3MGJA 3ISNC 4X4OA 3KMQA 1KHVA 2WB4A 5C25B 1B64A 3W61A 1UAWA 1TL3B 2RJZA 3CJ0A 1DARA 2ZH1A 3H98A 2W9BA 4UOFA 2W7AA 1TR0A 1RTHA 1FA0A 3PIPQ 2W7OA 2MZTA 4RW4B 2KKHA 3W2VB 2H4WB 4DV3J 2X3DA 2HFNA 3KXDA 1QY7A 1QD1A 4R5PB 1LNQA 1UL3A 3PXGa 2FLPA 4OLPA 3KJVA 1EETA 4OYWA 1U6BA 2EEYA 2H5IB 1I94J 3R2DJ 1M5KC 3CDUA 1KN6A 3DLHA 1J5EF 3ZNJ1 1WI6A 3C66A 3BSAA 3UN2A 5GVQA 1JXVA 2GGPA 1AW0A 1XERA 4IG0A 3DLLQ 1NK0A 3Q83A 5CZXA 1D9FA 3SSQA 4OYAA 4PUOA 4JI2F 4IUFA 3MMAB 1V3ZA 4DR2J 2BW2A 4B3TF 4NRUA 2UUCF 3I0RA 3SCLE 3V4MA 2R8JA 3CMAS 3GR1A 3S6EA 2OTLS 3ENWA 1DTTB 4DR5F 1GK8A 2W2PP 3C14A 1D9AA 2LQBA 4YEAA 4GC7A 1VCTA 5CZVA 2ACYA 1E6VB 2Y1IA 2QJ3A 5KFCA 2NSBA 4FYDA 2EK1A 1HBUB 3CJ2A 3Q22A 1ZZFA 1O51A 3KUGA 4G6VB 4ZLJA 4TY8B 1RTZA 1IKYB 5HBMA 3EZUA 3FQLA 4F25A 1GNKA 4QPXA 1RLDA 4OHZA 2GJIA 2VFRA 5FD1A 4HHUA 4KPYA 3MPDA 1VBKA 2R7TA 3SQGA 4PWUA 3BO2A 1UCNA 1YG0A 1M5PC 2QLWA 1E6YB 3GP9A 3BKTA 4KB7A 1S9GB 3C19A 2VG5B 1SKSA 4KHMA 2OP5A 4ZVSB 1HBOA 5BYQA 2W9CB 4WFBQ 3MR2A 4RJVA 3Q2SC 1RT5B 1FDDA 3TZXA 4RBUA 5L9NA 3SI8A 3R5CA 3H90A 3D7SB 1HL6A 5K8MA 1WHWA 4ETZA 4DQSA 4ICLB 1F9HA 4KIAA 3CJKB 3TQ1A 5CHCB 4WZMA 1V3RA 2UXCF 3PIOQ 1J5EJ 1NPRA 4NLUA 5LM7E 1TUVA 2DKOB 3OQ2A 3O6QA 2MKKA 4USHA 3B8HA 5DZ6A 1CJTB 5GAEI 5I4MA 2YKOA 2PFDA 1R8AA 3N28A 2F1FA 4ANCA 4C4WA 1NDCA 2WHOA 1RWVB 2Z2YB 3J81Y 3T1HF 4ELTA 2N4CA 1PILA 2Z4PA 4JI2J 4A4JA 2COLA 5LXYA 2UUCJ 1REVA 2BJ8A 2IHR1 2A0FB 1SIZA 3I55S 1S0VA 3R6LB 1F0XA 3IBCB 2ZH8A 4WFYA 3DOMA 2F63A 2IM3A 4H4MA 3IN5A 4IRCA 2IVYA 2CPXA 1S1XB 1GQEA 2C2ZB 4WFAQ 2RU9A 2JX2A 1VI7A 3OR1A 1IKXB 2Y1RI 2QFJA 2ZVIA 4NASA 3T41A 2AZ1A 1S59A 1FVSA 1RABB 2AKWB 5IZHA 3KG1A 4NYPA 3EVOA 1WELA 3RW7A 4NE9C 1FRIA 1NU4A 2M3DA 2XSFA 1WF0A 4AYBD 1FEHA 3R5AA 3EZOA 3CCUS 3CJRA 4I64A 4IRDA 3ICLA 2NXCA 2B0GA 3WQPA 3C6TB 5IT0A 1LW2A 4J9KA 1HI8A 2YWEA 1CS4B 3UW1A 4UUWA 4NL5A 4LR8A 2RE1A 2BM0A 2BW7A 1F3VA 4C8NA 3BGLA 2CPZA 1S1WB 1UPMB 4JI5F 4LJMA 3IAM9 3KJQB 3MEEB 5DM7Q 2HS3A 1K9MT 1R89A 4DPWA 2WSCC 1Y9OA 4DUYJ 1K1SA 3Q2TC 2OPRB 2UXCJ 4LF6F 3M2VA 2DHHA 4NI2B 3JYTB 3C8YA 2ZWPA 4HEA9 2HKEA 2WONA 1I3OB 3UCUP 5B0EA 5D77A 2PA8D 2BKNA 1YI2S 2C2RA 3CCRS 3UN3A 4YMEA 2J7KA 2CQBA 4MIAA 2KRRA 2M88A 4P2XA 2OKQA 2YQ0A 4TY9A 2HK2A 4P9SA 2J8SA 1EARA 1U02A 5T7LB 3HKWA 3PYEA 1P6TA 2R8KA 2V8DA 4DG1A 2KN4A 2R4FA 4DSEA 3Q24A 2KT3A 4UTGA 1U24A 4G1QA 2JOQA 4OZ5A 2XMMA 3ZTSA 1H2TZ 2E5HA 3I0SA 2HVZA 1FK9B 1GEHA 4CLFA 2LA6A 6FDRA 3B4DA 1REGX 3BH6B 1VHFA 5A8WA 4HI1A 1S6PB 4KHRA 5FLXU 4YS2A 3PEJA 2IBOA 5J2QA 1BQXA 3MWBA 4BS2A 4ED4A 4G1IA 3VAFA 2XY7A 3PKMA 3FRZA 1VLOA 1T9XA 4FXVA 3PM9A 3HZGA 3UI3A 3SQOP 3QJPA 3TEHB 1JLEA 1FXDA 3FDSA 3IM8A 1WC5A 1DQ8A 1H72C 5IV3A 4DSLA 3MM8A 3FBCA 4QU7A 4HL9A 2DISA 3SCKE 1TAUA 3GJRB 1FJEB 4DR7F 4FZVA 3EPIA 5E3AA 3MCNA 2HFOA 4USIA 2AX1A 3HD1A 4XPEA 4MKBA 3DOKB 2HNYA 4U95A 4YHHF 1Q53A 3W60A 1VC0A 3DOLB 4HDHA 2IAJB 3LP0A 4RW7B 3KUHA 2AW0A 4LF6J 1RA7A 4X64J 1LWCA 3HM9A 1H7XA 1NMEB 2UUAF 4JI6F 2CQPA 1NDKA 2V9KA 2QG9B 1UFWA 2H65B 2QLBB 1T95A 4V19J 1LWFB 2Y8WA 2DXFA 2IM2A 3GG0A 2XMAA 1WC4A 4L3NA 4ANDA 2QE5A 4DV4J 3HFKA 3TVZA 4B9SA 1SCJB 1W2IA 2V50A 3NCQA 2NSCA 1H7WA 5A6WA 4K4ZA 3W9IA 4P73A 3UO0A 3GSIA 4X4QA 4FP9A 3TUIC 2AQ4A 3UN5A 2AV5A 5GAGI 3CO9A 3H40A 2IMWP 3MM9B 5CCLA 3MAQA 3HHNB 4ID5B 1RT1B 1RHUB 1VHIA 3NNHA 3M1VA 2MY7A 4NCGB 1JKHA 1DQ9A 1T11A 3D4JA 3P5TL 3PW5A 5D6GA 4DV0F 1S49A 1VQ7S 2JDJA 1VR6A 2GCFA 3IR6B 5T41A 5LMUF 5DQHA 1Z1ZA 4QYZJ 1YLXA 2KYZA 4RUHA 4C9DA 2M9KA 2V34A 4M5MA 1N88A 2KJWA 4IRKA 1RAHB 2BJ9A 3ZZTA 2VPXB 4NEYA 1URNA 3CO0P 5DDPC 2ZBPA 2RKIA 2DNMA 2VPZB 1JJ4A 4MKYA 4DL4A 4KGKA 4P7TA 5C42A 2NXUA 3AXKA 3M9MB 3V81B 1OSDA 4ELVA 1SQFA 4WBFA 5K14B 4LIRA 5KFBA 4A8OA 3ISZA 4KKOA 1FDBA 5DS7A 4QWDA 2GIQA 1F9EB 4IOAQ 4CM2A 4OZ0A 4FYXB 1KQSR 4QR0A 1PJ7A 4DR3F 2OPSB 3MXHP 5D78A 4OI1A 4YHHJ 2V2KA 3DI6B 3E51A 4P52A 1KLNA 1N48A 3J7YI 4KO0B 3DHWC 2BYCA 3MOJB 2HHQA 3KLHA 2B51A 4QWCA 3PV8A 1PJ5A 3KK2A 3L4BC 4IFVB 4OZ2A 4FS2A 1RTJA 1U09A 1Y5IB 2DGSA 1C1CB 3M8PB 4ECQA 1N5QA 4LT6A 5L9XA 3G6VA 2J8AA 4F7VA 3BJYA 1CJUB 2LXUA 3PO4A 1PAEX 3MZIA 5J1EB 2YWHA 2BA9A 3ILLA 3T9ZA 4WP3A 4I69A 4IDKB 4P2FA 1O6XA 2HWIA 3UDEA 4UZBA 4DPXA 1FNMA 2FIUA 1VK3A 2C1EB 1FFWB 4ELUA 2FVSA 4WFZA 3FZBA 4USUA 4LR9A 4EZ9A 1YBUA 1FESA 3QIPB 4FKXA 2CJAA 4CLLA 1XMQF 2FY8A 2KT2A 1KVIA 4QR2A 3TZWA 3GJSB 4DV0J 1M1GA 2HNZA 3FZ2A 3QNWB 1T05B 4K4SA 4A8XA 2HFVA 2Q3PA 3DFEA 1YTYA 1Q5VA 4I4BA 3CIZA 3BEGB 2MY8A 3C3LA 3KNAA 5M2PA 1KFSA 2DR7A 2W01A 2GA7A 2EI5A 1AB8A 3VZHA 1S7HA 3HULA 5HMYA 2CZ9A 4LVOP 2KFZA 1VMBA 1FDNA 3NMAA 4U67Q 3Q8SB 4RBTA 1CBKA 4USKA 3HSDA 3V4IB 4ETXA 2CAJA 3KG0A 1N6QB 5IT9Y 2GO8A 5ETLA 3D54A 4CO1A 3VVUA 1YJTA 3MF5A 1TAQA 2DGXA 4DDFA 1JMTA 2ROEA 1Y10A 5F8NA 4YR2A 2C22A 3MCOA 4ZP6A 1M5OC 3A1YG 3QFHA 4UT4A 4OYZA 4DV7F 4DX7A 3H5SA 1NH7A 2V8VA 4B02A 3PYFA 1IXKA 4EYHB 3H7HB 3OBIA 2A6OA 1NCLA 2B4PA 1O5JA 3W2WB 2M52A 3BV8A 1RI7A 1FJCA 2D3ZA 4O3QA 5IFMA 1WEZA 2J0XA 3RTVA 4C8MA 4EO6A 3B82A 3IWNC 1LFPA 4WPAA 2RHSB 1U1NA 4QOTA 3TNVA 1W25A 3AT1B 3EGWB 2ZDOA 1QE1A 3KMSA 3U1LA 5CCMA 3K8VA 3CJ5A 3DRPB 5FIIA 3CPWR 1MNEA 2ZM6F 3LQVA 1VFJA 1X4EA 1NK5A 4R25A 3GR0A 3OTOF 2E7VA 2GJ2A 2YY3A 2BM1A 1KDNA 2OPPB 2YQ1A 1DFDA 3W5YA 4ZVTB 1NM2A 1AZSA 4NA1A 1WHYA 3R1LA 3H59A 1YDLA 2I8EA 4O3OA 2YBVA 2B5JA 2LDIA 3LTOA 3NMRA 3PR4A 3QFWA 1WOOA 1P8GA 3KK3B 3GE9A 1Q16B 2PO4A 3IGNA 4ZKAA 1XMQJ 3R5JB 1IBLJ 3L9ZA 2VFVA 2MZQA 4B08A 4DV6F 5HMZA 3BF4A 2XZTB 4B9TA 5LL6d 4ZITA 1VBYA 1XWLA 2QA2A 1KD1T 4LBIA 2DNLA 1RTDA 4HACB 2BDPA 3Q23A 2UV8G 4LF9F 5B0FA 3E3XA 5SUHA 1JLFB 1FD2A 4C3KA 5D3GB 4AD6A 2HRYA 5KG2A 2M8DB 1R0AB 4A8KA 1FRKA 2RS8A 2MKYA 2XS5A 3BYPA 1Q1KA 4B3OB 5EHHA 1XC9A 1WHVA 1WG4A 3MPYA 2KM8B 3NCPA 3TI0A 4DJBA 1FE0A 4RLEA 4H54A 3R7BB 3E01B 4S0MA 5AXMA 1HNVA 4WYLA 1N36F 3IS9A 2UU9F 4BC7A 4J37A 1T03A 2V4QA 4ECTA 4DV7J 5KFIA 3VHQA 1R3NA 2DR6A 1FRMA 1ZM9A 3DN9A 4LUBA 3OW2R 4B3SF 1GXTA 2VBYA 3RJMB 5B08A 4ZPCA 4M5KA 4TU9A 4I67A 3ILJA 3BSOA 1HW9A 2X3GA 5L38A 1LV5A 2JC0A 1BQNA 2BZ2A 1CJVA 1WC6A 2LXFA 3D2WA 2RUGA 3L7UA 1WI8A 2ASYA 1F2GA 1WJ9A 2XCAA 1IBMJ 4NLYA 2ZM6J 2A10A 5KFJA 2FHJD 3BO4A 2MHEA 3OTOJ 3EVWA 2ZD1B 3EWGA 4W4MA 4GC6A 4TYAA 2XO6A 4CIOA 4XIUA 1SI9A 1S77D 1XJWB 1GTHA 4JI4F 1KEKA 2SXLA 4CLYA 4USTA 3VAJA 1HWUA 1JLQB 4Y65A 2KYXA 1UVNA 5H9EJ 4DPYA 5C7PA 2MEWA 2E9RX 1X4BA 3BGOP 4LQ3A 2CNNB 1IJEB 1RT3B 1JLCB 3CD7A 5B0BA 1X9WA 2ZKTA 4FN5A 1N4LA 1UPPA 2B9XA 5B0GA 2VG6B 5CYQA 1VQ6S 2HEKA 1FKOB 2YNGA 4N8OA 4J9MA 5CD4H 2FB0A 3OUYB 3DYAA 2EFQA 4K4WA 1S0OA 2Y3YA 3TJ8A 3DRXA 1RT4A 1L3VA 4JBCA 3BREA 2R7QA 1VQ8S 1XMBA 2NZ4A 3MTJA 1NK9A 2AYEA 1RTIB 3GB0A 1YJWS 3JSMA 5A0YA 2N3OA 4ANEA 1NK4A 4CP5A 4DV2F 5KT6A 4Y6IA 3VCDA 3G6XA 2LEPA 3K8WA 4DXLA 2V5HG 1UA0A 3KHHA 2UU9J 1GAOA 4OHXA 5KFXA 3ZZPA 2HHXA 1NK8A 5D4LA 2QC3A 3PRDA 4XAKA 3CB4A 4OV1A 1DQAA 2DPJA 3IC1A 1UKUA 2KXHA 1R6VA 4TQRA 4L75A 3MM6B 3CCVS 1OWXA 1HNWF 5DRKA 4J9PA 1WDDA 4PG4A 1SKWA 2GV1A 3MM5A 2O67A 2WAQD 5JVGQ 1NB2A 1VIOA 5RUBA 4B3MF 3DLGB 3KLEA 1N5YA 2CJQA 2GQQA 2AP6A 2GS8A 1NSPA 4OX6A 4EBCA 4DSKA 5F3TA 5IWAF 3EVMA 3JXOA 2VBXA 3X1LB 2E5LF 1F9FA 4NLRA 1TMMA 5E41A 2GVZA 1S5ZA 4JI4J 4Q8EA 1HYSA 4WTYA 2IM0A 4CH0S 3FBFA 2R8HA 3C2PA 2EFNA 1VRTA 3PDNA 1VS3A 2XCPA 4JV5J 2DH8A 4O4GA 4V19X 3C15A 5KG5A 3M2RA 4RNFA 3B54A 2E44A 1WC0A 3B4MA 2XMTA 4KHPF 4ZPWR 4QW8A 3V6JA 3ET6B 3ZO7A 3MEGB 2RDJA 4F3QA 3AA9A 3RRKA 2OD4A 1LWXA 2ZNZA 1NEEA 1OO0B 1PBUA 2L3MA 4DU7A 1ZAWA 3CC2S 2F8MA 3UWTA 2CJYB 3A8KA 2VFTA 4LBHA 1YJ7A 2HNDB 3HFZB 1VQ9S 2B9EA 2YKQA 4JUZA 5KFRA 2K1RB 4DV5F 2IDEA 2YX1A 4K4YA 2DNKA 2FVPA 4HTJA 1MG7A 5CA5A 3UCZP 3PW4A 1IR0A 3G9CA 3DU6A 1DTQB 1PC4A 1D0EA 2DY1A 3SSSA 4X4PA 3UNYA 1LXJA 2GW8A 1SC1B 2WOMB 4WFNQ 4OJ3A 1RWXB 2QIFA 4ECUA 2B8PA 3DRRA 3OL8A 3LAKA 4DU8A 1HMVA 2W8LA 3U02A 3N79A 1HNWJ 1S1UA 1FO1A 3HI9A 3DGPB 6FD1A 1XMOF 4B3MJ 3DMJA 2Z2MA 4HH0A 3OXGA 3HVTA 1QSYA 2K3KA 5FDLA 4OZ1A 5IWAJ 2V94A 1X7VA 5CD4A 3W5ZA 3IR5B 4C11A 3NP5A 5AXNA 2W9BB 3PRBA 4ECYA 2PI4A 3X3UA 2VB6A 1XK8A 3MPUB 3BB5A 4Z2XA 2D3UA 3DRYA 2C2DA 1WF2A 4ED6A 2H3EB 2MDAA 2BV3A 4OQJA 1TL7A 3ZZZA 4ED2A 1S10A 1EETB 1X5PA 2LQ9A 2U2FA 2DY9A 4KHPJ 4E98A 3HP6A 4X62F 3CMES 2XYHB 5DQGA 1OY8A 2QYCA 2GGPB 3KOAA 1HBNA 5F0UA 1ACMB 2KFYA 1WOPA 4RWWA 4DX8H 4IG0B 1IUJA 1A7GE 4J90A 4NLOA 2O3DA 2CG4A 1SH0A 5CYJA 2MPUA 4TNOA 5KFPA 3LW5C 3TOQA 4EI2A 3KLIA 4PUOB 4FYYB 5DDQC 2DR9A 2GIRA 5HVFA 1HNXJ 3I0RB 4F8RA 1YJ9S 4DV5J 2MMYA 3UD3P 2W25A 4NOHA 4TN2A 3T1AA 1Q95G 1P9QC 2V4JA 1U6ZA 1H3DA 4C8ZA 3CJ3A 1XTZA 3N01A 1VQOS 2FZKB 3CC7S 3H5YA 4WF9Q 1GMWD 2X1FA 2BRKA 3QSIA 4PAAA 4RUBA 1T02A 2PEBA 4MTPA 1LK5A 3M6UA 3GIMA 3GPAA 2FVRA 4JV2A 4DCPB 2PFFB 5HBMB 1WC1A 4LF8J 3GFXA 2D69A 1K8AT 1TU0B 4Y0FA 2AYMA 4WK3A 1B0PA 3SQGB 3MPWA 4ZOSA 2HRUA 4R0JA 2ROGA 2AWZA 5IC4B 5GMEA 4HKQA 4OHVA 4FPIA 4ECZA 4X4NA 5KG7A 4HH1A 3AAWB 1HBOB 4F04B 2KM8C 1OYEA 2J7WA 3A8JA 2FD2A 5DG8A 1T0TV 2V0NA 3U27A 4DEZA 1OS5A 2JJ4D 2DYAA 5KG0A 4H4KA 4ED3A 4YUDA 3MR5A 4EU0A 4LF5F 2RILA 5K5MA 1G6BA 1F5CA 4IO1A 3T5JA 3CC4S 1Y3JA 1PJ6A 1X9SA 3BGRA 1AFJA 2BACA 4NLTA 4FBUA 4C98A 1XQIA 3CCLS 1RGVA 2R42A 1H6KX 5KFNA 3H4BA 2G1HA 3DLKA 2CNKB 4KV8A 4KGVB 5HSPA 1XR6A 1K0VA 4QJVA 2VFUA 2XULA 2R7RA 5B0DA 1ZETA 4B9UA 4X4TA 1TV6A 4YY3F 4ED5A 3PG9A 2XZWA 4HT7A 1REVB 3DRSB 2R7XA 2WVCA 3NAIA 3NKYA 3NGTA 3WHIA 3WBZA 3PR5B 2X1BA 1R27B 5D0HA 3DOMB 1EJ7L 4NXNJ 3VAKA 4H4MB 1UJ5A 2IDLA 5EWEA 2E1RA 1NKBA 3FUYA 3G8TA 4M5GA 3SXLA 1H38A 2J0SD 3ZTRA 2M70A 5GMDA 1RYSA 3OR1B 4ZVPB 4N8NA 3VVTA 2PC6A 1J27A 2CIMA 1Z2LA 2DRAA 4LF7F 4GVBA 1C4AA 2VG7A 2LEAA 2D41A 3PACA 4XPCA 2YXLA 3GLJA 2IM1A 3RG6A 2H5JB 1OYDA 4G3IA 1D8ZA 3CJ4A 2DIVA 4UZCA 1U2FA 1B3TA 2CJXB 4ZP7A 2RIJA 5J2PA 1I6JA 2BE2A 1MWZA 1ROFA 4DQPA 2DEJA 3DXSX 3FQKA 2WRMA 4Q44A 3Q8YA 3RBDA 4DR1J 4KQZA 3A12A 4CO2A 4P75A 5ETKA 1VJWA 1P27B 1UVJA 1NH8A 1Y4ZB 3CT9A 1NNDA 5ETVA 3J81U 1YJRA 2Y1JA 1RWNB 2FHJA 5E0OA 3QT8A 2ZH7A 1B7FA 4TKTA 2C28A 3CDBA 4DQIA 4FKYA 5JUMA 3DU5A 1QTMA 3UR3C 3VWSA 5DO2A 4LF5J 5F3ZA 3MCMA 4KH0B 3PYGA 3C16B 3K0JA 3M2VB 5HL7Q 1C0UA 1GTEA 5C24B 2XTJP 1R8HA 4YR0A 2WONB 2DNYA 1X0FA 2UXDF 4CI0B 3CCJS 3BDEA 4J9NA 3KLFB 2RRAA 3OXLA 4J9RA 2IPOB 3R1HA 3BKUA 1ZA2B 3GMGA 2WBMA 4YY3J 4ZVEA 2WVFA 3IBWA 2KVIA 3I9ZA 2DCLA 2XWYA 3QLHA 5ETNA 1OJ4A 3SDEA 4A47A 2VDIA 2WW4A 1S9EA 4CCHA 2XM3A 4DG1B 4K2JA 3BGUA 5AJ3F 3PVXA 2ZZNA 4DPTA 4MKAA 1EB0A 2WVDA 1C0TA 4G1QB 4RU9A 4QYZK 1U1LA 2DT9A 3CDWA 2ACMA 5JMNA 5D8HB 1H98A 1NKCA 3P8BB 3I0SB 4ENOA 4JYAF 4AUKA 1BQMA 4C2MA 1U1MA 3PTWA 1WKJA 2ATCB 1WACA 3EYZA 3CCMS 2KRBA 4LF7J 2FHOB 1JLGA 2HBQB 3TAMA 2W4PA 1YRTA 4W90B 2WSEC 2G0JA 3AD7C 5A8WB 2F9JA 4A8MP 2FLOA 5DG7A 1QJHA 1MWYA 3GYXB 2FJEB 3S01A 2JNJA 1DLOA 5J2QB 4F2SA 3PX6A 3AB2B 3OFEA 2FTRA 4KY3A 3M6XA 2V2VA 4FNHA 4MK8A 2C42A 1RHRB 2UP1A 4F0KA 1ELOA 2CWKA 2M8HA 1JLEB 4WXOA 3AOCA 4R5PA 4AQYJ 3IWXA 4ILLA 2FC9A 1FFSB 3WX8A 4A8SA 3AD8C 1FE4A 2OELA 4I6AA 4K0KF 2EW9A 3CCES 5L1JA 3VZIA 2VQFF 2W4DA 3P6YC 3THVA 5L46A 1YBTA 2YNHA 2HNYB 2DRBA 1SH3A 2OMLA 1DRZA 2B7BB 2DPIA 2XBPA 5EX0A 1NLKL 4J9SA 1XN9A 1VDHA 4A8FA 1LWCB 4TVAB 2DR8A 4DR4J 3HSGA 5KFHA 4UW2A 3S7RA 5IM0A 3QWUA 3JTNA 2MSTA 2NUUG 3AJ2A 1IWAA 1U1OA 4O3SA 2ZH3A 3TUPA 4YOEA 2PMHA 1YJNS 2QT7A 3UVJA 1DTTA 4DFJA 1YKWA 4OJ1A 1BMQB 1FKPA 2V9WA 4IH6A 1Q79A 2OTJS 4RZRA 1R8CA 4CNYA 4OYOA 4UQTA 4QIVA 2YX4A 2HHTA 2W2QP 3L95X 2JLEA 1S12A 3UDCA 4EYIB 2ZOMA 4XK8C 2HHVA 3PW7A 4OHYA 3OVSA 5IQ6A 5KFDA 2HZVA 3NWRA 1S72S 1M5HA 1UFKA 3WC2A 3P5BP 2HBRB 2RD5C 1LW0A 4TY8A 5KT2A 3F56A 3M1VB 2FZGB 3MFHA 4JI8J 1GFWB 1JKHB 4LF4F 5KFEA 1SKUB 2BJDA 4DI6A 1TFWA 4I2QA 3T19A 1T9TA 2EC0A 4LFCJ 4F4WA 3CWJA 2N82B 2RRBA 2YKNA 4ZLLA 3V6KA 1ZAVA 3ETOA 3P49B 2RKIB 2JLFA 3PYDA 4OYBA 1KS2A 1U45A 4J9LA 4NEZA 2HAIA 1ZAXA 5F8JA 2J6TA 3BR9A 4EEYA 4ZCKA 3OTEA 4Z37A 4IOCQ 5THWA 4K0KJ 3ZZUA 2VQFJ 4IH7A 4LRDA 2RMLA 1CJKA 4PQAA 3EXCX 3CCWA 3MUVP 1RYRA 3FVYA 2FJAB 1KQGB 3MM7B 4ECRA 1TMJA 3R27A 3KLHB 2DB1A 3K5OA 1TL5A 4NLXA 2W4CA 2Z0GA 1Q0NA 4RKUC 4OI2A 2A2DA 1M1KT 1RTJB 1WSRA 2CPJA 1N56A 2F3JA 1YBAA 2AF6A 2CQHA 5CAAA 4IR9A 3FFIA 2H48B 4DX6A 2OPQA 2EFPA 2QSFA 4TLRA 1MU2A 3KYLA 3NAHA 2DVIA 1UZDA 4NZ6A 1HD0A 3D67A 2NS1B 1RAFB 4RUCA 3FNNA 2OGUA 2HG4A 4RNNA 4O0NA 3RAQA 4LF4J 4IO9Q 5LXRA 1KLMA 2HNZB 1CSJA 2Y1LB 2IA6A 4NLWA 2E1PA 3BSNA 4P6QA 2LEBA 4NCBA 1S1TA 2QTWA 4K59A 4QR1A 2OLWA 1URRA 2BVZA 4ID8A 1VBZA 1UEVA 1U0SA 3OSPA 2D9PA 5HI7A 5HAOA 2P5VA 5HQLA 1H2UX 3IMQJ 1WG1A 3M30A 4RW8A 4ZPDA 5D4PA 3EDQB 3TA0A 3HO1A 4DPOA 4WE1A 3J81j 2DHXA 2J0WA 3Q86A 3J80Y 3I6PA 2E9TA 2BJ7A 3D0IE 2HGMA 2MLYA 2QX0A 5HANA 2XQCA 3EM1A 2EBEA 5D0RA 2YNFA 3KTQA 2QLFB 2EXUA 2Q66A 5IS2A 5E2QA 5DDRC 3CTRA 1IBKJ 2MXYA 1D9DA 2AZ3A 3BO3A 2OEJA 2Q43A 4YQWA 4D3HA 4A8QA 5D4NA 2IYIA 1DURA 4IR1A 3GIIA 1CLFA 3BGFA 1WSVA 2HHPA 4P2SA 1JXEA 3UDVA 3F44A 1K1QA 2HAFA 3IBFB 5DGBA 1X4HA 2LQ8A 3D1HA 1A0OB 3HD2A 3CVKA 1NPPA 5KFOA 1QE1B 3P45B 3ITHA 3MD3A 5L39A 8AT1B 3GYGA 2YWWA 2GHPA 5T7LA 2YQ3A 2C2NA 1CEZA 3NLCA 3TRGA 3R5DA 1SC6A 2JFKA 3HT3A 2GAGC 4F4AA 1K73T 3PX4A 2DTJA 4USWA 3D3CJ 3IA0A 2Q1LA 3NS7B 4X65J 1AZSB 4Q7AA 1NUEA 3J7Z5 1NB7A 2C3OA 2GQCA 4NLQA 4YB1P 2Y9HA 1UVLA 1YGYA 2RB7A 2B5JB 5B09A 3AB4B 1I5OB 1VOMA 2HHSA 1KTVA 4BDPA 2WTFA 1TUWA 5IT9U 2CG8A 3CW2C 1R0CB 1ULRA 1S6PA 4ERDA 3SV4A 5IOLA 1HQUA 2HW3A 1QLNA 1M5VC 2KJVA 2KB2A 4I6WA 4J9UE 1F6TA 2KFNA 7FD1A 2G0IA 3LWMA 1SJRA 4KAIA 1AYEA 3TWZA 2MKCA 4OZNA 3OL9A 3M2UA 4URSA 4WZQA 2CVEA 1KP6A 3M6VA 2AJ1A 3TA1A 2BJ3A 2H1YA 2RF2B 1YJVA 4B3RJ 4PKDB 2CADA 3NBPA 1TKZA 3DDNA 1JJCB 2H54B 4YDDB 3TX8A 4KGXB 1UP1A 5MAOA 2LCWA 2AJFE 3GCWP 4DLEA 4O44A 3ZC4A 2IC3B 1HNVB 4LSLA 2QEXS 4MFBA 4OZ3A 5KFQA 4GMKA 3PZPA 2R7WA 3JSBA 4F02A 2B43A 1T03B 4HI2A 1TKXA 4I1TA 1S1VA 4F50A 3VQSA 4OIXA 4K4VA 4KE5A 4R8UA 5EWFA 1ZPVA 4DHVA 1MLAA 1Y7PA 4E8UA 1R31A 1APSA 3CUNA 1BQNB 1DZ5A 3BS9A 4DL0C 1CJVB 3HSJA 2DCUB 4PCQA 2IYGA 3OVBA 3VAHA 1ZTWA 2E5GA 4ZVOB 2IY5B 3HMJG 4Q8FA 4OYPA 1YHQS 1CG2A 1EP4B 4PEOA 2OFHX 1FX4A 2HQGA 4ZA1A 5E33A 2ZBRA 1LK7A 3DXBA 4JV0A 4LRAA 2HVHA 5B7WA 2DRDA 2B9YA 3O1LA 3OL7A 2DD8S 4U7UK 5EGYA 3OTDA 1K47A 3PEHA 2XNQA 2BBEA 2H51B 2FVCA 2HGNA 1FWPA 3AFGA 3K2YA 4WP9A 2MZSA 1PCAA 4QU6A 2Q6BA 4CO5A 1RAOA 3RB4A 3QAEA 4AL7A 1AUDA 2MTLA 1G4CA 2QL5B 5CYQB 3SYZA 1K0TA 2HQ3A 1WORA 2HGLA 2OAUA 2VU5A 4L73A 3DYAB 1KC8T 4LRCA 4U9RA 3N6NA 1QSLA 2IA0A 3HXMA 1RT4B 4KR0B 3TJ9A 3QT5A 2P9GA 2EWHA 1FXRA 3QWPA 4CLKA 5HMXA 2C3MA 2QL9B 3JSMB 3KG4A 3HVRA 1BHNA 4K4TA 8RUCA 4LF2A 3UNGC 3OT9A 3TP2A 4RWXA 3FCHA 5I3UA 2OPSA 4A48A 3QAUA 5E3PA 1SC4B 4YB6A 1RU1A 4F0MA 1NSQA 3B6BA 4CRJA 4LRBA 4M8LA 2KZZA 2YWFA 3AOBA 3CD6S 2XWXA 2OH2A 4G1PA 2MZRA 5DZ7A 1MMDA 2DH9A 1KRPA 2NQPA 4FYVB 4ES2A 3HDSA 4J91A 3E8OA 1AT1B 4B3TJ 2HSEB 2J76E 4ZN1A 1RT6B 3DLBA 2OEMA 4DR5J 2WVEA 1SJ3P 3JQMA 3Q8QB 2B4UA 3KLEB 1MSWD 2ZH4A 1N5YB 5F9LA 5J1EA 1JNZB 7FDRA 1L5UA 2D9OA 2BMBA 3QJLA 3KLGA 1U8WA 2KXNB 3JS9A 3N4WA 3QRQA 4ZMMA 1XIQA 5F8MA 4I2PB 5JVHQ 5LMNF 3VR1A 1HQEA 3N5FA 1IKVA 1VRTB 3CJTA 4O4GB 3TUJC 4NLSA 3HHLD 3M2RB 4P7VA 1MROA 4L6V3 3BR8A 1SVDA 3BPDA 3OHAA 1VISA 2C3UA 2AU0A 1U0HB 1VQYA 2UUTA 3O8WA 4HLBA 1T3NA 2DO0A 3GJTB 4YN3B 4ZPVR 3V4IA 1U49A 1X0PA 4HT5A 4N5SA 2DGOA 4MIBA 3MUTP 1RHQB 2NR0A 3D9BA 1MWQA 5HVGA 3GV7B 3Q89A 2P9CA 1WTBA 3FJ2A 3R9LA 2QMUB 3TVKA 1PBAA 2E66A 2HFUA 2HWHA 1YRXA 2LLZA 1VYAA 1ZS6A 2FLLA 4X4RA 3DC2A 4KYZA 1H74A 5GMKa 2BEFA 4O3PA 4QYRA 4DZDA 3O2IA 2O66A 2DNHA 1S57A 3GIKA 5CH7B 4M5IA 3GIJA 3ILIA 3NGKA 3T1HJ 2BANA 3K57A 3DRRB 1HMVB 3G87A 1X4DA 4QIFA 4N7TA 1F2HA 1PYSB 2ZC3A 3DCAA 1S1UB 1R43A 1EKSA 2K7JA 2MZJA 1QUPA 3QSYB 5HLFA 4MAKA 1N54B 3LPEA 2WW8A 1OIAA 3DMJB 4N47A 5AE3A 1JIHA 3HVTB 1VQNS 1U26A 3JB9k 1LEOA 3S1TA 1SQEA 5FDLB 1C2PA 2P2CB 2NZCA 5AXKA 2CQCA 2BR0A 3TANA 4ZVGA 4C11B 3VGVA 3FMWA 4I0WA 2OUGA 2HMIB 3KK3A 3ENVA 2LMIA 1L3UA 3ZNUA 4NYZA 4QW9A 5AE1A 5EN1A 3DDKA 1X4GA 1TL7B 4TLQA 2E29A 3QIDA 4MH8A 2J9DA 4O3NA 5L8RC 2HLTA 3MEDA 4F4KA 4CH1A 2KH9A 4RU2A 3AA8A 3M8YA 3W7BA 3U7JA 2CKWA 3W8PA 1AROP 4J7CA 2PMWA 3GV8B 1HBNB 2KHDA 4O0IA 3V6DB 2I9SA 3T6BA 2DNQA 4JI5J 4NLGA 2QLXA 1RWKB 3WC0A 3ENQA 1T9YA 5ETTA 3KLIB 2A6MA 3DLEA 5E3QA 1NDLA 4QCLA 3U1NA 2ZDPA 5D0EA 2VOPA 3UFCX 2IRUA 5E3CA 1S99A 1J5OA 2RRNA 4F4YA 3MR3A 4DS4A 2VDHA 3VTIA 1HWIA 4GKKF 4LF1A 1LQ9A 1D09B 1NHVA 2V4JB 1RA6A 2YNIB 5LSRA 2DNGA 4F36A 4P2MA 1WOSA 2QMXA 2DNPA 4LR7A 2CQGA 1IBCB 2XSJA 5G0RA 5KT5A 4M5JA 2G2ZA 4Y2MA 2MGZA 3AOAA 1GX5A 4AXIA 1HARA 1Z4UA 1ITPA 3GYNA 3D0GE 1JLAB 1WUUA 4K2XA 1RQ0A 3ISND 3M8QA 1NZAA 5K8OA 4IH5A 2QN6B 4F2RA 2WCXA 5EX3A 3M8SA 4DL7A 1Y3KA 3CD5A 2BE7D 2RDDA 3T1YF 2K2PA 2LA4A 3AJ1A 1X4CA 3AXMA 2CWXA 3QMQA 5BJRA 4ZLNA 2Q6CA 2UXBF 3G2XA 3ZTPA 2EPIA 2MHNA 1HPZB 5F8HA 5K9FA 1Y0HA 1TUGB 4ITSA 4LBPA 4DQRA 1OQ6A 3D6TB 3GWCA 4LSNA 1UMJA 4ZVQB 2MJNA 2I2YA 3QQCD 3SFUA 4K7QA 4M5LA 3G96A 3BGRB 3FBBA 2FJXA 1RAJA 5CXTA 3O3LA 2DHSA 4DR7J 3ETMA 1FRXA 3DLKB 2ZZTA 3GFZA 2I0XA 3EXYA 4EMDA 3EGZA 1WEXA 4KJIA 1TV6B 1WG5A 4FXDA 1FD8A 3OTCA 2PEHA 2PGCA 1TVRA 3OL6A 1U1KA 1WTFA 2VZ9A 4X66F 1UVKA 5KG1A 3L7OA 3NY0A 4JI1F 4GKKJ 3PRVA 4GO5X 3KHRA 1VQ4S 2M5YA 2UUAJ 4JI6J 3JTOA 1XR5A 3HF5A 3F73A 2GC8A 3EPGA 4RNOA 2CVIA 5CYMA 4ED7A 1VC5A 3MHYA 3I5AA 3MCSA 4U96A 2EVZA 4GVBB 3CE8A 2JH3A 1GMVA 4CDIA 2VG7B 1I51B 5LSOA 4F3OA 2Z8QA 2QSWA 2RHQB 2IMOA 2RQKA 1GT8A 2BOAA 2ROPA 1JLBA 5J2PB 2RDIA 2LECA 2BE2B 1RACB 3NGSA 1RAGB 2VJUA 2FYXA 1X60A 3QATA 1A6LA 4AE5A 1WKKA 2MQQA 4K5RA 1YX2A 3NS6A 1MN7A 5I3QA 2B9WA 4IQMA 1Q8BA 5LMUJ 2IRYA 5J2NA 4ES3A 4ED8A 1D3WA 3QO9A 1JWWA 3VAIA 1I94F 1K44A 4X4SA 4IOBA 3R5GA 1OPZA 4OZJA 4PWDA 3UQSA 1ZYQA 2VJVA 2ZHOA 1YIJS 3OFGA 4M5NA 4RW6B 2MQOA 3LPYA 4DL2A 2R2RA 2ZE2A 2CQIA 3M9OB 4OLOA 4EUVA 2HQFA 1NSKL 2ASJA 3THPA 2DGVA 4DSFA 2F5GA 4PYAA 3W63A 4FF3A 4DCOB 3PJ9A 3A3PB 2XNRA 4FVCA 2ZBIA 4DR3J 1X5OA 2J5AA 2N3LA 1VQSA 1FTRA 4F4ZA 3K17A 1AA1B 1FWLA 3IRWP 3QLHB 4UOCA 1WEYA 2XLKA 3SDEB 1EKRA 4X66J 2DGTA 1FHTA 4ILRA 2RQMA 1R8BA 1S9EB 1DTQA 2LU1A 3FEXB 1VRUA 1HA1A 4HR2A 2VPWB 2UUBF 4NYOA 1SUQA 2IRXA 2HS4A 3N6MA 4NZ7A 2ZOGA 2LFVA 5IQQA 1QVFR 4ZP9A 3TR5A 3ZZYA 3M4XA 1N0VC 1BQMB 2PMZD 1RT7A 3I5BA 5C2GA 1RBLA 5J2MA 2C2EA 1RUSA 2N4DA 1JLGB 2HRTA 3LP2A 2VHGA 3TAMB 4LFAF 1JNRB 4Q0BB 2BE9B 2UVUA 4C8OA 1MMLA 4LREA 4EK2A 1T8EA 4Y2AA 4J5OA 2AGOA 2BKPA 3HPOA 3K89A 1G2EA 2WVBA 3HVWA 4Y00A 2G2OA 1FJ7A 3VGSA 4CNZA 2F4VF 2NPIA 3TARA 3T6JA 2RQCA 4RX6A 2XHWA 1N52B 2E7WA 2FHMA 3IM9A 4ECSA 3MOZA 2ZZMA 3I4PA 2YNHB 1KQFB 1GX6A 2D3O1 1FTCA 3R6GB 5I42A 3CCSS 3LANA 5KT3A 2CQ2A 1RWOB 2C2KB 3ELHA 4C0BA 5IM0B 4KSEB 3T3FA 3JQKA 3ILOA 1V5IB 3IP0A 3KJNB 2V8HA 3ENAA 3HHLA 1RAEB 4IG3A 2H9ZA 3FEYB 4CM0A 2UVWA 4C97A 5BYRA 3SEOA 3S8SA 3UVJB 3PX0A 2BQRA 4IFYA 4M5DB 1FKPB 2CUYA 1Q78A 4C8LA 4ZCLA 3PFEA 3LP1A 5KT4A 1Y5NB 1H2VZ 5HN0A 2G2YA 1EHWA 2L48A 2LU2A 3J7A1 2YKMA 3MMBA 2UUBJ 1NKEA 3OFHA 3ONQA 1H0HB 3M9NB 4F3MA 5KFWA 2OD6A 4NA2A 1LW0B 5E5NA 4CTAA 3KUEA 1IM4A 2OIHA 5AE2A 1S48A 1OQ3A 1L3TA 1ICEB 1RT2A 2K7KA 4IKAA 3NG8A 2XS7A 4I6YA 4LFAJ 1IQTA 2IBKA 3J7AN 4I2QB 3TVYA 1QAJA 4MYUA 2ZH9A 1F5AA 1OPIA 1XEZA 4KT0C 1SJ4P 4K4UA 3THTA 4BBYA 1G3OA 4ZVRB 3CMQA 3BN4A 5KG4A 2V6AA 1RADB 2QRRA 2YKNB 4PABA 3NEKA 5KG3A 2BABA 1H73A 3MPVA 2JEIA 4U8YA 1BC6A 4ECXA 2C3YA 4CH7A 2AT1B 2LXIA 1U1RA 4DUTA 2LDYA 3MAHA 2YVSA 3I5CA 2GVDB 1CVJA 4DV6J 3KLVA 3AD9C 1XNQF 2F4VJ 2UZAA 2LKZA 1FRHA 2EFOA 4OX7A 3RBXA 4DFKA 4ZHRA 4DMZA 3CDAA 2QL7B 2I6WA 4ZVFA 3BN7A 4DUYF 4LF9J 2CQ4A 1AUSL 1CJKB 1W26A 3E2EA 1RHJB 3EE3A 2AYGA 4ZJQA 1KOOA 2AEFA 5F41A 3H5XA 1ZM4A 1KKHA 3RB6A 1TQLA 4U6PA 4LIWA 2YX7A 3LGHA 1CQNA 5A76A 3RRHA 2HYIB 4RO0A 1V6HA 3MAAB 2WZ1A 5IXUA 1N36J 1LWEA 3DRSA 1FRLA 4OFZA 1U48A 1BY9A 2J0QD 2B8QA 5KFMA 4YR3A 2JRSA 3IO1A 4B3SJ 3C6UA 3I87A 4USVA 3FFIB 1NJIT 2HHWA 4PQUA 3K7RA 2OPQB 3CJQA 5C5JA 3W66A 1MU2B 5C2CA 4UOHA 4N41A 4BLGA 2FGCA 2GFFA 2AJ2A 3BM7A 2ZFHA 3MMCA 2MLXA 1GMUA 1SV5A 2AEJA 2NPFA 2Y0BB 5G4DA 5HK4A 3IRXA 1JJ2R 2NLWA 1VQ5S 3FMBA 3ZZOA 4Q5VA 4H4KC 2WK4A 2XMKA 1KLMB 1HR0F 4NPOA 3MURP 2MQPA 2XMVA 4DF8A 4FVMA 1S1TB 1FXLA 4QQBA 1FNOA 3LGNA 2RH3A 4WFXA 4TXSA 1XBWA 4UUXA 2CA9A 1U1QA 1B0VA 2MKSA 3M30B 4DSIA 4RW8B 4RW9B 5GADU 5HP1B 2R9LA 1X9MA 4WE1B 1BWVA 3MI7X 4ECWA 2DXEA 4KBIA 2XG8A 3DM2A 3EGNA 3GONA 4AL5A 4DZ6A 2HS0A 2LQJA 1XNQJ 3P4UB 1RJJA 2YNFB 5BYSA 4CWBA 2CDRB 2HZAA 5AT1B 4MK9A 4P71A 1PAUB 4GKJF 4ZK7M 1S76D 2QMWA 1ZOTA 3C16A 5C24A 1VGYA 4X64F 3A4TA 5HJYA 2VKRA 2G0CA 2R2UA 2R7SA 4H4OA 1VC6A 3ZTQA 3KLFA 2V67A 4NXMF 4CQ1A 4DV2J 4ZPBA 4DV4F 5J1NA 4PR6A 1U2CA 1NSAA 4YP3A 4N76A 3ITHB 2O01C 4C0HA 1IJFB 1FRJA 1RAIB 1VRQC 1EAYC 2CQ3A 1HW8A 5A2QY 4ZN3A 4UQGA 1RSCA 4MKVA 4WU2A 5LT5A 1RWUA 5EWGA 3RR7A 3A13A 2XGPA 4JI3F 4RL1A 1TELA 5F8IA 4JI7F 3WZ0A 4K4XA 3QGIA 3DDIA 3JSRA 2MZ1A 2GHWA 5JJBA 4ED1A 1WDTA 1LXNA 2P8IA 2FQQB 2JEGA 3J80U 1V9OA 3JSYA 2HFSA 3NOCA 1HQUB 3QZ8A 3HHDA 2EFGA 1HR0J 4D3GA 2E5LJ 2DITA 1GH8A 3HHKA 1JX4A 2PT0A 3OHBA 1HNIA 3M2UB 1TKTA 1SKRA 1VBXA 1RTHB 1Q8IA 2RS2A 2N7YA 4ZLPA 4JOUA 5HROA 1U25A 2VPYB 4A8YA 4FYWB 3QPIA 1O0PA 3TJAA 4F4XA 2CPYA 2VODA 1NAQA 3NBPB 1UZHA 4DN0A 1TKZB 3KJVB 4DLGA 3T9NA 1YJUA 4CO3A 4Z7CA 2MQMA 2DGQA 1QVGR 4O44B 1MN9A 2I5JA 2HQCA 4LSLB 4MFBB 2XI2A 3G82A 2NXNA 4QZVB 4GKJJ 3BBBA 3TA2A 1R0BG 1X5TA 3BQ0A 1TKXB 1SC3B 3RB3A 4OI4A 1S1VB 3IAS9 2W7PA 4A8WA 1D1UA 3QRRA 3PFOA 4PXEA 4OX8A 4R8UB 4NA3A 1WNEA 1HWJA 1EIYB 1NJXA 2D1CA 4DPUA 2HIYA 1BD6A 2ILYA 4PRFA 4NXMJ 4K5SA 3W9JA 1NDPA 3NWGA 2UVVA 3C14B 2CYYA 1IN0A 3RGIA 2KXFA 3IG1A 2IJFA 3TX0A 1JK9B 3W62A 1UWBA 1AXQA 3AODA 4DUZF 5DGAA 2ZBCA 4JI3J 2N7CA 4CLZA 4HHJA 4M94A 5ETMA 4JI7J 5GAHU 3OR2A 2KO1A 3MECA 2DNZA 2FUG9 4B9VA 1YZ6A 4U7UD 1FI4A 2HPUA 4C7QA 3QRPA 1T9VA 4QBUA 1XMOJ 1B4SA 2PI5A 4FF4A 3M32A 4CLUA 3GU0A 3H4DA 5ETPA 4W92B 5FJ4A 2E1MC 3H2UB 4PWWA 2XC9A 1SB6A 2PDAA 2QA4G 5KFAA 1FCAA 2FJVA 2ATLA 1G7CB 2EBGA 5KFKA 3H5UA 1C1BA 2EFVA 3QJJA 4URGA 2FGOA 5H9FJ 4ATNA 3JAMU 4PXDA 2GZOA 3DHXA 4N77A 1YQHA 2GAHC 2E1CA 3NRBA 3NGUA 3KHLA 1YRUA 1W7WA 2J7UA 2MLZA 3BSCA 3FGVA 3CULA 4X62J 5KFZA 5I3UB 2HQDA 2JEJA 1P9YA 4ZCMA 3MM7A 3POTA 3C46A 1NJYA 1SH2A 2ZH6A 4ED0A 2WB1D 3VAMA 4HYKA 4DF4A 2ZKUA 4WXWA 1RISA 4EGLA 4WJBA 2DH7A 4XDCA 4DV1F 1TK5A 2RUSA 3JQJA 3SCIE
chains in the Genus database with same CATH topology
2UXBJ 1FJGJ 1HNWJ 4KHPJ 3J80U 4OX9J 4YY3J 4DV7J 2MEWA 1IBKJ 4B3TJ 4JYAJ 5IT9U 4X66J 3D3BJ 4K0KJ 2UUBJ 4JI5J 4LF9J 2MTLA 4JI0J 1HR0J 4AQYJ 2E5LJ 4DR5J 4HHUA 4NXMJ 2VQFJ 3R2CJ 4B3MJ 2MQ8A 5LMNJ 1XMQJ 4DR1J 1IBLJ 5LMUJ 4GKKJ 5BR8J 4JI2J 4LF4J 2UUCJ 4DUZJ 2UUAJ 4JI6J 5IWAJ 4DR6J 3JAMU 4DV2J 3W1YC 4JI8J 4NXNJ 1HNXJ 4YHHJ 3J81U 2UXDJ 4DV0J 4DR2J 4LFAJ 4DV5J 4JI3J 3J7AN 4V1Ak 1IBMJ 4B3RJ 1N36J 2HHHJ 4JI7J 2ZM6J 4RJVA 4X62J 3IMQJ 4LF7J 4LF5J 4KYZA 3OTOJ 4DR4J 4LF6J 4LFCJ 1HNZJ 1N33J 2KVQE 2KL8A 5A2QU 4X64J 4DV3J 4JI4J 4DV1J 4DUYJ 1N32J 2VQEJ 4B3SJ 3D3CJ 1XMOJ 2UXCJ 1XNQJ 4KY3A 3T1HJ 5FLXU 4GKJJ 2UU9J 4JV5J 4X65J 3T1YJ 4NEYA 4JI1J 5AJ3J 4DV6J 1J5EJ 1XNRJ 2F4VJ 5LM7E 1N34J 4NEZA 4DR3J 4DR7J 4LFBJ 4PWWA 1I94J 3R2DJ 4DV4J 4LF8J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXB J;  1FJG J;  1HNW J;  4KHP J;  3J80 U;  4OX9 J;  4YY3 J;  4DV7 J;  2MEW A;  1IBK J;  4B3T J;  4JYA J;  5IT9 U;  4X66 J;  3D3B J;  4K0K J;  2UUB J;  4JI5 J;  4LF9 J;  2MTL A;  4JI0 J;  1HR0 J;  4AQY J;  2E5L J;  4DR5 J;  4HHU A;  4NXM J;  2VQF J;  3R2C J;  4B3M J;  2MQ8 A;  5LMN J;  1XMQ J;  4DR1 J;  1IBL J;  5LMU J;  4GKK J;  5BR8 J;  4JI2 J;  4LF4 J;  2UUC J;  4DUZ J;  2UUA J;  4JI6 J;  5IWA J;  4DR6 J;  3JAM U;  4DV2 J;  3W1Y C;  4JI8 J;  4NXN J;  1HNX J;  4YHH J;  3J81 U;  2UXD J;  4DV0 J;  4DR2 J;  4LFA J;  4DV5 J;  4JI3 J;  3J7A N;  4V1A k;  1IBM J;  4B3R J;  1N36 J;  2HHH J;  4JI7 J;  2ZM6 J;  4RJV A;  4X62 J;  3IMQ J;  4LF7 J;  4LF5 J;  4KYZ A;  3OTO J;  4DR4 J;  4LF6 J;  4LFC J;  1HNZ J;  1N33 J;  2KVQ E;  2KL8 A;  5A2Q U;  4X64 J;  4DV3 J;  4JI4 J;  4DV1 J;  4DUY J;  1N32 J;  2VQE J;  4B3S J;  3D3C J;  1XMO J;  2UXC J;  1XNQ J;  4KY3 A;  3T1H J;  5FLX U;  4GKJ J;  2UU9 J;  4JV5 J;  4X65 J;  3T1Y J;  4NEY A;  4JI1 J;  5AJ3 J;  4DV6 J;  1J5E J;  1XNR J;  2F4V J;  5LM7 E;  1N34 J;  4NEZ A;  4DR3 J;  4DR7 J;  4LFB J;  4PWW A;  1I94 J;  3R2D J;  4DV4 J;  4LF8 J; 
#chains in the Genus database with same CATH topology
 2VF3 A;  2IFX A;  4EZ6 A;  3LOU A;  4USJ C;  3H25 A;  2NUH A;  2WSF C;  2OI2 A;  4KFB A;  9ATC B;  2CPE A;  4OYI A;  1SL2 A;  3UDL A;  4KGZ B;  4ECV A;  2XMU A;  3FKB A;  3HJV A;  5A8R A;  1VJQ A;  4ES1 A;  1NHK L;  3KLG B;  4DUZ J;  1QTN B;  1DAX A;  2VON A;  1TL1 A;  2BXJ A;  1U6F A;  2CQD A;  5IT4 A;  3CSK A;  2OJ3 A;  3IFE A;  2W2M P;  4DR6 F;  3V5R A;  4CZC A;  1HQE B;  2AGP A;  1IKW A;  2DNN A;  1IKV B;  3ULH A;  3VV2 B;  1IBL F;  3G8S A;  4J9Q A;  4U7C A;  2PA3 A;  2BUN A;  5EUH A;  1KBR A;  1MRO B;  5ADZ A;  4OL8 A;  1TZ0 A;  1MMN A;  1T9W A;  3QT7 A;  1LW2 B;  2X1G A;  1U4B A;  4G65 A;  4EWT A;  4QWA A;  2E9Z A;  3R7N B;  2X51 A;  2R8G A;  5KAK A;  4I7F A;  4LMZ A;  2DNO A;  3AY0 A;  4YFU A;  1MW7 A;  4ZIW A;  3I56 S;  3TAQ A;  2F7V A;  3FC9 A;  4FS1 A;  4FNI A;  2AYB A;  2G13 A;  4OJH A;  2DBB A;  2XLJ A;  2VH7 A;  5KG6 A;  4C48 A;  3GV5 B;  2XO7 A;  1S4F A;  1TFY A;  2V63 A;  3OVA A;  1BLU A;  2W8K A;  3M8Z A;  1HBM A;  5K8N A;  3FSY A;  4OV6 A;  4CYU A;  1FEE A;  1CPZ A;  4DV1 J;  1IM6 A;  2BAN B;  5A8K A;  2OSR A;  4CO4 A;  3G86 A;  5D4O A;  5EDW A;  4W98 A;  1NBE B;  4BC9 A;  2Y8Y A;  2MSS A;  3BQ2 A;  3LA0 A;  1UEK A;  2VAS A;  5HLF B;  2QYG A;  1IBM F;  3KK1 A;  3K5N A;  3D28 A;  2KTQ A;  3OSN A;  3BKF A;  2AMC B;  3KJF B;  2VD3 A;  3PKY A;  3TQE A;  2KT5 A;  1S6Q A;  2RAQ A;  3FK4 A;  3SSR A;  3D1Q A;  1BXN A;  5T14 A;  3GSD A;  3KFW X;  3N5B A;  1TKD A;  5KFT A;  4DR6 J;  2WBR A;  1CUL A;  4QIE A;  3AHP A;  2MJU A;  2B6A A;  4UOG A;  2ILZ A;  3PW2 A;  4Q2L A;  3I32 A;  2ZHA A;  5C25 A;  1Q86 T;  2QV6 A;  4ZJO A;  3CF5 Q;  2R7V A;  3GCX P;  5F8L A;  1TL3 A;  2Y0S D;  2HVD A;  2KVQ E;  3MED B;  5DLF A;  4K8R A;  2O1P A;  2X7I A;  2RSQ A;  3CD0 A;  1HD1 A;  4NX9 A;  4ZIV A;  1SJF A;  4RW4 A;  3W2V A;  4R0E A;  2HQI A;  2HLU A;  2J9E A;  1NJZ A;  2JC1 A;  2RF2 A;  3MM8 B;  1G1X A;  1YZ7 A;  1RZM A;  3EUN A;  2MYF A;  2ZOF A;  1YK9 A;  2OFG X;  2DJW A;  1NXI A;  2B56 A;  3KWM A;  3GFY A;  3VGT A;  5D15 A;  2IC3 A;  2R2T A;  4RNH A;  3DLE B;  3B78 A;  4WWS A;  3FCW A;  3OLB A;  2NXE A;  5KFS A;  3LP0 B;  1J5O B;  4DCJ B;  1KFD A;  1FFG B;  2ASD A;  2G1D A;  5DM6 Q;  1EQM A;  2FPH X;  4BCA A;  2UXD J;  3Q8R B;  2YKP A;  3SCJ E;  3HK2 A;  2XHC A;  2J9D E;  2KG1 A;  1Y11 A;  3MMA A;  2IVF B;  2XSJ B;  5G0R B;  4ZVH A;  4C6A A;  2Z2L A;  3CJS A;  3ZFV A;  3LH2 S;  4DL3 A;  1W2B R;  4PYD A;  2R8I A;  2KL8 A;  2MGZ B;  4NMX A;  5DQI A;  2R3V A;  2LYV A;  1E6V A;  2A2C A;  1IR2 A;  3TW0 A;  2XB2 D;  4AXJ A;  3I82 A;  4L74 A;  3GTY X;  5AJ3 J;  1U2R A;  1EP4 A;  2XI3 A;  4EO8 A;  3M8Q B;  1HBU A;  2YPY A;  3PHT A;  2XZD B;  3EZ5 A;  4RUA A;  4PG6 A;  2ZEJ A;  3G6Y A;  1N34 F;  4JYA J;  1IKY A;  1BUX A;  3BZQ A;  1FJG F;  3R2C J;  1T3O A;  4UY8 5;  4JV5 F;  5DJB A;  3H2V E;  3FEZ A;  3CXC R;  3KNG A;  1NK7 A;  5KTQ A;  3M7V A;  2YH0 A;  1FKA F;  4Y28 C;  1E6Y A;  1HHS A;  2LVW A;  2DGW A;  3TYT A;  4ILM A;  4F67 A;  1S9G A;  2A18 A;  3CJ8 A;  4V1A k;  4C3M A;  3K59 A;  2VG5 A;  3BYR A;  4LSN B;  1J2V A;  2W1B A;  2L41 A;  1VQP S;  3H42 A;  4OI3 A;  2W9C A;  1SL1 A;  3T5K A;  4O4R A;  5C42 B;  1WC3 A;  1RT5 A;  1NJW A;  1S79 A;  2CPI A;  2BJE A;  1RAA B;  2H5E A;  4XDD A;  5K8P A;  1BE4 A;  1HNZ F;  1Z2Z A;  1RKI A;  4KKO B;  3UD5 A;  4ICL A;  3ZXW A;  2F65 A;  3CJK A;  1KVK A;  2XEX A;  4C8K A;  2ADC A;  2L9D A;  4RBV A;  1FT8 A;  2ZNY A;  3D5M A;  1RXO B;  2VC0 A;  4LFB F;  1TVR B;  4ZS6 A;  2EG2 A;  2V69 A;  1CJT A;  1VK8 A;  3P3D A;  4RR5 A;  2V2Q A;  5J1P A;  3KK2 B;  2DEI A;  1O8B A;  3LO3 A;  4KH1 B;  4KPC A;  3MDF A;  3TEG A;  1SBR A;  3NCR A;  3WIV A;  5IV4 A;  4Q43 A;  1HLW A;  4P74 A;  1HI0 P;  5CYM B;  1CQM A;  1RT6 A;  2Z2Z A;  2B3T B;  4L3K A;  3KDN A;  3MEK A;  1FNX H;  2VOO A;  3MFI A;  1GXL A;  1RCO B;  3NXZ A;  2HBZ B;  1KVJ A;  3QGP A;  4DFM A;  1S1X A;  3UR0 A;  3UPF A;  1PSD A;  1QAX A;  3SIP B;  3OFF A;  3H2L A;  3FSX A;  1KHW A;  1IKX A;  2EC2 A;  2DIU A;  5GAE U;  8ATC B;  4LQ9 A;  3O5T B;  1JLB B;  7AT1 B;  3KKF A;  2HK3 A;  4I2P A;  2DXD A;  1S0N A;  1N34 J;  5F9N A;  4QWE A;  1PYT A;  3DNC A;  2VA3 A;  3FRY A;  1FJG J;  4PG7 A;  3NGD A;  4PG5 A;  2ERR A;  2FC8 A;  2Z57 B;  5KFV A;  2CFX A;  5IC6 B;  3N9U C;  5J2N B;  1UVM A;  2JWN A;  4DFP A;  1ZH5 A;  2H4Y B;  3QO9 B;  5MLC V;  3I9V 9;  2DHG A;  4DBQ A;  3ZZR A;  2YWK A;  2CQ0 A;  5JXS A;  1RKJ A;  4NWB A;  4C0O C;  2NYI A;  9RUB A;  4Q2M A;  4CLW A;  1QDU B;  2PSZ A;  3F41 A;  3C6T A;  3PW0 A;  1U0H A;  1CS4 A;  4PWD B;  2GMH A;  2K8G A;  1YIT S;  2J9C A;  5KOW A;  2I38 A;  2MQN A;  3G8Q A;  4KC5 A;  2ZE2 B;  5ETO A;  4TU8 A;  2E5J A;  4E0D A;  2OSQ A;  2P9E A;  3EDR B;  2VKZ G;  2KU7 A;  1S1W A;  3R5B A;  2ZJR Q;  3HX9 A;  5FLX Y;  3MEE A;  1UJ4 A;  1HNZ J;  1VQL S;  2VIC A;  3D0H E;  2V8P A;  4WK1 A;  1HNX F;  2G9O A;  1EX8 A;  2OPR A;  4F26 A;  3R7S B;  3I96 A;  4NI2 A;  3JYT A;  2HZC A;  3HKZ D;  3MR6 A;  4LFB J;  4NCA A;  1V5V A;  2Q79 A;  2I1R A;  2RT3 A;  2CJB A;  2BJ1 A;  3LAL A;  1RBA A;  4N56 A;  1VRU B;  3H0P A;  4FPR A;  5F8G A;  1UFL A;  2PN6 A;  3LWL A;  1SUQ B;  3OXF A;  2E5I A;  2R7O A;  2M0G B;  2V2Z A;  4PZV A;  3RAX A;  3D6M B;  4O23 A;  3PHE A;  4LF8 F;  3OV7 A;  1RT7 B;  5KFL A;  3GFH A;  5J2M B;  2ADB A;  1FVQ A;  5H9E K;  2KDO A;  3JTP A;  3LP2 B;  5LJ3 Y;  1ZM2 A;  1TL4 A;  4B9N A;  2MKI A;  3GG1 A;  1SL0 A;  4Y2I A;  3AQP A;  2ZC4 A;  3EIC A;  2RU3 A;  3V6H A;  1L3S A;  2B7C B;  1FK9 A;  1ZZN A;  1YWX A;  1OMS A;  1KON A;  1N33 F;  5KFY A;  3A3O B;  1QAY A;  2LQ5 A;  4OHW A;  2BKO A;  2HMI A;  1RHK B;  4NLV A;  2IVM A;  4LVN P;  2MKJ A;  2FVQ A;  1S4E A;  4YDX A;  3RBE A;  3TZZ A;  2CZ4 A;  4OZL A;  1RTD B;  5M2U A;  2JVR A;  1S6U A;  3I4H X;  2GNK A;  2CQ1 A;  2A3J A;  2FHK A;  4DS5 A;  2GQ2 A;  2KG0 A;  2YH1 A;  4TU7 A;  3NOG A;  5F0W A;  1LKZ A;  1WWH A;  2C2O B;  3TZY A;  5LJ5 Y;  5I42 B;  3DKD A;  2V68 A;  5KT7 A;  2XY5 A;  5BR8 F;  3V6D A;  3OTB A;  1RBO B;  3IGV A;  5KFF A;  5KOX A;  2X1A A;  1X31 C;  1HFE L;  1IWG A;  3GIL A;  3HVA A;  5BXI A;  3L3C A;  2JSX A;  5SZT A;  3IS9 B;  3OLA A;  3HHL B;  1FDA A;  3DOK A;  4IG3 B;  5CQG A;  3RU0 A;  1U47 A;  3DOL A;  5LSL A;  2IAJ A;  1B7Y B;  4MMO A;  4RW7 A;  4IFY B;  4NXN F;  1HWK A;  3LF0 A;  4I56 A;  4C3L A;  3R3T A;  3RBZ A;  4AT1 B;  3LP1 B;  2ZHB A;  2YNI A;  3JAM Y;  1RU2 A;  4L76 A;  1LWF A;  2UV8 A;  2ZJP Q;  3SMZ A;  2IJN A;  1FER A;  2YKM B;  3MMB B;  3LUY A;  4FDF A;  1JXL A;  5DET A;  2OEK A;  2PII A;  5HJX A;  2G4B A;  2A1B A;  2YWG A;  3MMJ A;  2JVO A;  2XYG B;  5L1K A;  2AX0 A;  4OX9 F;  4CTA B;  1RLC L;  2LP4 A;  1NO8 A;  3G71 S;  3O44 A;  1RT2 B;  4X2B A;  1JLA A;  1N5V A;  1KQK A;  3OJU A;  3NGR A;  1FF2 A;  3QT6 A;  2VL1 A;  3W64 A;  4DWI A;  4LSZ B;  3MM9 A;  2NYH A;  1WKL A;  3CCZ A;  1PIE A;  4ID5 A;  1RT1 A;  1QUV A;  1KWM A;  4NCG A;  5H1S V;  1IVZ A;  2UUW A;  1AFI A;  2GX8 A;  3BPS P;  4UY8 T;  3KHG A;  3K5M A;  4OYX A;  4DR1 F;  5HQ8 A;  3K5P A;  4WYW A;  2JLG A;  2XLI A;  3BH7 B;  3L09 A;  1N33 J;  4RNM A;  4OI0 A;  2IJR A;  3EMT A;  3D66 A;  5D0G A;  2GMJ A;  4DL6 A;  2DNR A;  3UE2 A;  1F60 B;  1HPZ A;  3M6W A;  1SIW B;  1V3S A;  2MB0 B;  1KSP A;  5ETS A;  1Q7Y T;  3HFV A;  4MIW A;  4ZHR B;  1UJ6 A;  2YNG B;  5GAG U;  4CT9 A;  2L08 A;  1SQG A;  2Z56 B;  5ITH A;  3I31 A;  4WII A;  3V81 A;  4JV1 A;  1QAI A;  5I3P A;  4Y2C A;  5K14 A;  4JB8 B;  4XTT A;  2AJ4 A;  2VV5 A;  4JI0 F;  5BR8 J;  3Q8U A;  2VUG A;  1UW4 A;  3BQ1 A;  4BWJ A;  5A0Y B;  1N0U A;  1UEU A;  4RPF A;  4DL5 A;  2QA4 S;  4ZJL A;  3P96 A;  1LWE B;  3DI6 A;  5CAB A;  2POK A;  4KO0 A;  5HVH A;  3D68 A;  4IYQ A;  3W65 A;  1R7I A;  3W5X A;  2GHV C;  3C6U B;  3N0V A;  2HVE A;  3BDP A;  3M05 A;  2F40 A;  4PQU B;  2GJF A;  4YB7 A;  4IFV A;  4M63 A;  1C1C A;  3MR7 A;  3VF0 B;  4CLT A;  3M8P A;  4MYT A;  1DHM A;  2HBY B;  3MM5 B;  2HHU A;  4CT8 A;  3MMC B;  4ZPA A;  4MT1 A;  4E2F B;  5GAD I;  1JJH A;  3U1M A;  2YPZ A;  4C8Y A;  1NRK A;  1CJU A;  3CDE A;  1SV5 B;  4ER8 A;  2XY6 A;  3IRX B;  4B9M A;  4OX9 J;  2EG1 A;  1WD6 A;  3K5L A;  2J6S A;  4UF4 A;  3Q0A A;  1X4A A;  3BBC A;  3NS5 A;  3OD2 A;  4PXC A;  4EBD A;  3J7Y U;  4IDK A;  4IQX A;  3ADA C;  2V8G A;  3RZA A;  1X4F A;  1VQK S;  4ZP8 A;  2W24 A;  2VIH A;  1Q82 T;  2D74 B;  3LAM A;  4ALZ A;  2GVZ B;  2FJD B;  2HUR A;  1HYS B;  1YSJ A;  3QIP A;  3PJW A;  2KHC A;  1A9N B;  1QSS A;  1T05 A;  3C15 B;  3QGG A;  4AQY F;  2CNL B;  1GXU A;  3M8R A;  4DN9 A;  3DM2 B;  2OO4 A;  1TP7 A;  2JZ5 A;  3QZ7 A;  4TYB A;  5HAT A;  3QGH A;  1RB0 A;  3SZ2 A;  1T9U A;  5M2R A;  4ZCI A;  4RW6 A;  1SJQ A;  1Q8L A;  1Y5L B;  1ZTT A;  2ZVS A;  3LGM A;  2BQU A;  1KNZ A;  1N6Q A;  3PJX A;  4K50 A;  2AJ0 A;  3G6E S;  3V2U C;  4DR4 F;  4OYM A;  4H4O B;  4JI0 J;  4WKR A;  3VQT A;  1R6Y A;  3CIM A;  3RR8 A;  4J9V A;  1PYO B;  1UA1 A;  1M90 T;  4PXB A;  3VAG A;  2NCK L;  2BOP A;  4CO0 A;  1TK8 A;  1FWK A;  3W2W A;  4X4V A;  2APO A;  2YTC A;  3GZ7 A;  1B0T A;  3NNC A;  2L9N A;  2DHA A;  4LRF A;  3BBF A;  1DY3 A;  3OJS A;  3D1O A;  5HO4 A;  2D7S A;  2VA2 A;  3QBC A;  3SFG A;  2L9W A;  2VC1 A;  1SPB P;  2D3O R;  3EGV A;  2QLJ B;  2F9D A;  1RK8 A;  2B4O A;  1XR7 A;  4HHH A;  2W2N P;  2HHH F;  4M5H A;  3A8I A;  3RRG A;  3DRP A;  3HT0 A;  4JI8 F;  6AT1 B;  2DR5 A;  1SJ1 A;  1P1L A;  4NML A;  2ZH5 A;  2W2O P;  1IQZ A;  1EZZ B;  3HHE A;  2VQE F;  3F0N A;  1PG5 B;  4TQS A;  4Q0B A;  2XMW A;  1ZM3 A;  1RCX B;  1S6O A;  2OPP A;  1UTA A;  2ZIT A;  4A46 A;  5H9F K;  4LFC F;  1Y00 A;  3J7Z T;  3M8W A;  3D3B J;  5K20 B;  4USM A;  2M7S A;  4P72 A;  5L1L A;  1RE1 B;  3IXQ A;  1HNI B;  1TKT B;  5LMN J;  4DSJ A;  3AH6 A;  2QZ8 A;  4ZVU B;  4QPT A;  3TUZ C;  1VIX A;  4M1K A;  5HRO B;  2Z58 B;  1U8S A;  3EJM A;  3GJQ B;  3AQO A;  1WF1 A;  2CPF A;  2E7X A;  1S7I A;  3T5H A;  3NL0 A;  1N5S A;  2HIQ A;  3WDO A;  1Q8K A;  5DDO C;  2JL9 A;  5KFU A;  2IIH A;  4FF1 A;  3A3N B;  4FBT A;  2K3I A;  2BQ3 A;  1QM9 A;  5E7O B;  2AD9 A;  1Q5Y A;  2KI2 A;  2Z30 B;  4HAC A;  1WHX A;  4AFF A;  4MK7 A;  2W9A A;  3FCV A;  4JP8 A;  3A8E A;  1ZA1 B;  2I5J B;  3R97 A;  1F5B A;  1JLF A;  1OY6 A;  2CJ9 A;  3RB0 A;  5D3G A;  3G82 B;  5A2Q U;  1X5S A;  4DX5 A;  3ZTO A;  4PG8 A;  1R0A A;  3D6H B;  3HSZ A;  3GIR A;  4B3O A;  2AJQ A;  1TK0 A;  1PC5 A;  3HJF A;  5GAH I;  1DBD A;  1U7L A;  3QYY A;  2EKY A;  3N6L A;  1PGZ A;  3DLJ A;  3Q8P B;  3E01 A;  2ZH2 A;  1HI1 A;  2CPD A;  2YKA A;  2OMO A;  1CC8 A;  4F0H A;  2BX6 A;  1B70 B;  2DK2 A;  2U1A A;  3UD4 P;  4M95 A;  4M5D A;  4CLS A;  2J6U A;  2EKN A;  1NK6 A;  2MQL A;  2DGU A;  3L7P A;  4QIG A;  4B17 A;  3UCG A;  3IG1 B;  4Y34 A;  4QWB A;  3PNI A;  1UWB B;  4KGM A;  3W1Y C;  2EK6 A;  3US5 A;  1PKU A;  3VGU A;  4QIW D;  2ZUA A;  1F3F A;  2ZBQ A;  3OR2 B;  3RUB L;  1L3K A;  3MEC B;  3RYL A;  1RP5 A;  2CNO B;  3NNA A;  2HHH J;  1JQG A;  4WKY A;  3PCO B;  4BWM A;  1N5T A;  2XMJ A;  3K58 A;  1M1H A;  4GRS A;  2BRL A;  1NZ8 A;  2JEF A;  1HWL A;  2VQE J;  4ZDN A;  2ZD1 A;  3M32 B;  3VAL A;  2FZC B;  1IR1 A;  2ZUG A;  3GQC A;  1VLY A;  4PPZ A;  4EFA C;  1KR4 A;  2KZM A;  4WTO B;  1UVI A;  1EQ0 A;  4OMF G;  3CGI A;  5AXL A;  4BHQ A;  2ALY B;  1JLQ A;  2P6S A;  1ZBT A;  1XNR F;  3D6F B;  2FDN A;  2AHO B;  1T7P A;  2HFZ A;  1S97 A;  2VFS A;  2RVJ A;  4WIQ A;  2AGQ A;  1VQM S;  2PE8 A;  1C4C A;  2RNE A;  1RT3 A;  1C1B B;  1JLC A;  4YB5 A;  1S9F A;  2GVD A;  3HHL C;  5DLG A;  2XYP B;  2HWT A;  1T94 A;  1UET A;  2VG6 A;  2M2B A;  4Y3C A;  1FKO A;  2C2M B;  2VBW A;  4DQQ A;  2JFD A;  1IBK F;  2QO3 A;  2ASL A;  3SV3 A;  3OUY A;  4CLP A;  2K06 A;  2V4R A;  2C3P A;  3POT B;  4O3R A;  3HCX A;  4PPD A;  2GML A;  1NPK A;  2ALZ A;  2F8E X;  2PD1 A;  1Q7L B;  4KV8 B;  3W9H A;  1RTI A;  1B99 A;  5A6P A;  3FSI A;  3TO8 A;  1N32 F;  4WU3 A;  3MAA A;  2JHE A;  1KTQ A;  1PO6 A;  3HLU A;  4J9O A;  4MJK A;  5KFG A;  4P10 A;  2O5D A;  1Q81 T;  4KFB B;  4U8V A;  3W3S A;  1M0S A;  5HMW A;  3CED A;  4NLD A;  1LFW A;  2VBZ A;  2GIF A;  1I1G A;  2OHD A;  5B0C A;  3MM6 A;  5A8R B;  1D8Y A;  1RWW B;  2MKH A;  4DOZ A;  2R2S A;  1HHT P;  4X65 F;  4HVZ A;  3MUM P;  3SBM A;  1TL1 B;  4KTQ A;  4FXW A;  3CNQ P;  4OJG A;  3DLG A;  3G4S S;  2FLN A;  2FJB B;  1KOH A;  2R7U A;  2B4V A;  3ZZ0 A;  1R8P A;  1IKW B;  1DJ0 A;  2ZWO A;  3CCT A;  1X8D A;  4X4U A;  3MTK A;  2QFI A;  2ZJQ Q;  3H8Y A;  1RDR A;  1HHQ A;  3HZE A;  4HDG A;  1GMW A;  1S0M A;  3MD1 A;  1Q4R A;  3AJD A;  4DV3 F;  3T1Y J;  3DGV A;  3TAP A;  4FF2 A;  3RW6 A;  2E1A A;  1P1T A;  1XNR J;  4B3R F;  4RW9 A;  5HP1 A;  4I7F B;  5L1I A;  4Y2K A;  1FX2 A;  2UXB J;  4ZPT R;  2CZV C;  4WCE Q;  1U1P A;  3KDO A;  1M5S A;  4Q45 A;  2ABY A;  3PO5 A;  4KRW A;  5HQM A;  5DG9 A;  3H20 A;  1SXL A;  4URQ U;  3W8G A;  3ET6 A;  1F1B B;  4XO0 A;  3MEG A;  1HKA A;  3IWL A;  2DO4 A;  1CC7 A;  2GO9 A;  2QA1 A;  1C0U B;  3RAM A;  4EBE A;  4GO7 X;  2CPH A;  2QGF B;  3WX4 A;  4Z7Y A;  4WP8 A;  2UVR A;  1HBM B;  1UW9 A;  1ZPW X;  3T5L A;  4DR2 F;  2HND A;  3R8Y A;  3OPK A;  4CYU B;  2XGQ A;  3CCQ S;  2CJK A;  4HTI A;  1RHM B;  2K1R A;  5B0A A;  5A8K B;  4NZ0 A;  3PY8 A;  1JB0 C;  1N32 J;  5ETQ A;  1OY9 A;  2RQ4 A;  1RWP B;  4NRT A;  1RWM B;  1LOU A;  3EX7 B;  1YVF A;  5ETR A;  3IR7 B;  1UWA A;  2F4F A;  4X84 A;  2F8H A;  2P6T A;  3KK1 B;  2XS2 A;  4JI1 J;  4AL6 A;  1N8R T;  3FBE A;  2WOM A;  3WIU A;  5LOQ A;  2CDQ A;  4GVL A;  1C0T B;  4I68 A;  1NHU A;  2CRL A;  2HVI A;  2AIR B;  4L72 B;  1HIY A;  1S6Q B;  2M4M A;  3Q8V A;  2FY1 A;  4NLP A;  2FJW A;  1TTH B;  2MQ8 A;  4B9L A;  1BWE A;  3DGP A;  2NRE A;  1HQ2 A;  4OI6 A;  5U47 A;  2AEM A;  1OSC A;  1CUL B;  2CXE A;  1BGX T;  2B6A B;  5E3R A;  2NXJ A;  1DLO B;  3MGJ A;  3ISN C;  4X4O A;  3KMQ A;  1KHV A;  2WB4 A;  5C25 B;  1B64 A;  3W61 A;  1UAW A;  1TL3 B;  2RJZ A;  3CJ0 A;  1DAR A;  2ZH1 A;  3H98 A;  2W9B A;  4UOF A;  2W7A A;  1TR0 A;  1RTH A;  1FA0 A;  3PIP Q;  2W7O A;  2MZT A;  4RW4 B;  2KKH A;  3W2V B;  2H4W B;  4DV3 J;  2X3D A;  2HFN A;  3KXD A;  1QY7 A;  1QD1 A;  4R5P B;  1LNQ A;  1UL3 A;  3PXG a;  2FLP A;  4OLP A;  3KJV A;  1EET A;  4OYW A;  1U6B A;  2EEY A;  2H5I B;  1I94 J;  3R2D J;  1M5K C;  3CDU A;  1KN6 A;  3DLH A;  1J5E F;  3ZNJ 1;  1WI6 A;  3C66 A;  3BSA A;  3UN2 A;  5GVQ A;  1JXV A;  2GGP A;  1AW0 A;  1XER A;  4IG0 A;  3DLL Q;  1NK0 A;  3Q83 A;  5CZX A;  1D9F A;  3SSQ A;  4OYA A;  4PUO A;  4JI2 F;  4IUF A;  3MMA B;  1V3Z A;  4DR2 J;  2BW2 A;  4B3T F;  4NRU A;  2UUC F;  3I0R A;  3SCL E;  3V4M A;  2R8J A;  3CMA S;  3GR1 A;  3S6E A;  2OTL S;  3ENW A;  1DTT B;  4DR5 F;  1GK8 A;  2W2P P;  3C14 A;  1D9A A;  2LQB A;  4YEA A;  4GC7 A;  1VCT A;  5CZV A;  2ACY A;  1E6V B;  2Y1I A;  2QJ3 A;  5KFC A;  2NSB A;  4FYD A;  2EK1 A;  1HBU B;  3CJ2 A;  3Q22 A;  1ZZF A;  1O51 A;  3KUG A;  4G6V B;  4ZLJ A;  4TY8 B;  1RTZ A;  1IKY B;  5HBM A;  3EZU A;  3FQL A;  4F25 A;  1GNK A;  4QPX A;  1RLD A;  4OHZ A;  2GJI A;  2VFR A;  5FD1 A;  4HHU A;  4KPY A;  3MPD A;  1VBK A;  2R7T A;  3SQG A;  4PWU A;  3BO2 A;  1UCN A;  1YG0 A;  1M5P C;  2QLW A;  1E6Y B;  3GP9 A;  3BKT A;  4KB7 A;  1S9G B;  3C19 A;  2VG5 B;  1SKS A;  4KHM A;  2OP5 A;  4ZVS B;  1HBO A;  5BYQ A;  2W9C B;  4WFB Q;  3MR2 A;  4RJV A;  3Q2S C;  1RT5 B;  1FDD A;  3TZX A;  4RBU A;  5L9N A;  3SI8 A;  3R5C A;  3H90 A;  3D7S B;  1HL6 A;  5K8M A;  1WHW A;  4ETZ A;  4DQS A;  4ICL B;  1F9H A;  4KIA A;  3CJK B;  3TQ1 A;  5CHC B;  4WZM A;  1V3R A;  2UXC F;  3PIO Q;  1J5E J;  1NPR A;  4NLU A;  5LM7 E;  1TUV A;  2DKO B;  3OQ2 A;  3O6Q A;  2MKK A;  4USH A;  3B8H A;  5DZ6 A;  1CJT B;  5GAE I;  5I4M A;  2YKO A;  2PFD A;  1R8A A;  3N28 A;  2F1F A;  4ANC A;  4C4W A;  1NDC A;  2WHO A;  1RWV B;  2Z2Y B;  3J81 Y;  3T1H F;  4ELT A;  2N4C A;  1PIL A;  2Z4P A;  4JI2 J;  4A4J A;  2COL A;  5LXY A;  2UUC J;  1REV A;  2BJ8 A;  2IHR 1;  2A0F B;  1SIZ A;  3I55 S;  1S0V A;  3R6L B;  1F0X A;  3IBC B;  2ZH8 A;  4WFY A;  3DOM A;  2F63 A;  2IM3 A;  4H4M A;  3IN5 A;  4IRC A;  2IVY A;  2CPX A;  1S1X B;  1GQE A;  2C2Z B;  4WFA Q;  2RU9 A;  2JX2 A;  1VI7 A;  3OR1 A;  1IKX B;  2Y1R I;  2QFJ A;  2ZVI A;  4NAS A;  3T41 A;  2AZ1 A;  1S59 A;  1FVS A;  1RAB B;  2AKW B;  5IZH A;  3KG1 A;  4NYP A;  3EVO A;  1WEL A;  3RW7 A;  4NE9 C;  1FRI A;  1NU4 A;  2M3D A;  2XSF A;  1WF0 A;  4AYB D;  1FEH A;  3R5A A;  3EZO A;  3CCU S;  3CJR A;  4I64 A;  4IRD A;  3ICL A;  2NXC A;  2B0G A;  3WQP A;  3C6T B;  5IT0 A;  1LW2 A;  4J9K A;  1HI8 A;  2YWE A;  1CS4 B;  3UW1 A;  4UUW A;  4NL5 A;  4LR8 A;  2RE1 A;  2BM0 A;  2BW7 A;  1F3V A;  4C8N A;  3BGL A;  2CPZ A;  1S1W B;  1UPM B;  4JI5 F;  4LJM A;  3IAM 9;  3KJQ B;  3MEE B;  5DM7 Q;  2HS3 A;  1K9M T;  1R89 A;  4DPW A;  2WSC C;  1Y9O A;  4DUY J;  1K1S A;  3Q2T C;  2OPR B;  2UXC J;  4LF6 F;  3M2V A;  2DHH A;  4NI2 B;  3JYT B;  3C8Y A;  2ZWP A;  4HEA 9;  2HKE A;  2WON A;  1I3O B;  3UCU P;  5B0E A;  5D77 A;  2PA8 D;  2BKN A;  1YI2 S;  2C2R A;  3CCR S;  3UN3 A;  4YME A;  2J7K A;  2CQB A;  4MIA A;  2KRR A;  2M88 A;  4P2X A;  2OKQ A;  2YQ0 A;  4TY9 A;  2HK2 A;  4P9S A;  2J8S A;  1EAR A;  1U02 A;  5T7L B;  3HKW A;  3PYE A;  1P6T A;  2R8K A;  2V8D A;  4DG1 A;  2KN4 A;  2R4F A;  4DSE A;  3Q24 A;  2KT3 A;  4UTG A;  1U24 A;  4G1Q A;  2JOQ A;  4OZ5 A;  2XMM A;  3ZTS A;  1H2T Z;  2E5H A;  3I0S A;  2HVZ A;  1FK9 B;  1GEH A;  4CLF A;  2LA6 A;  6FDR A;  3B4D A;  1REG X;  3BH6 B;  1VHF A;  5A8W A;  4HI1 A;  1S6P B;  4KHR A;  5FLX U;  4YS2 A;  3PEJ A;  2IBO A;  5J2Q A;  1BQX A;  3MWB A;  4BS2 A;  4ED4 A;  4G1I A;  3VAF A;  2XY7 A;  3PKM A;  3FRZ A;  1VLO A;  1T9X A;  4FXV A;  3PM9 A;  3HZG A;  3UI3 A;  3SQO P;  3QJP A;  3TEH B;  1JLE A;  1FXD A;  3FDS A;  3IM8 A;  1WC5 A;  1DQ8 A;  1H72 C;  5IV3 A;  4DSL A;  3MM8 A;  3FBC A;  4QU7 A;  4HL9 A;  2DIS A;  3SCK E;  1TAU A;  3GJR B;  1FJE B;  4DR7 F;  4FZV A;  3EPI A;  5E3A A;  3MCN A;  2HFO A;  4USI A;  2AX1 A;  3HD1 A;  4XPE A;  4MKB A;  3DOK B;  2HNY A;  4U95 A;  4YHH F;  1Q53 A;  3W60 A;  1VC0 A;  3DOL B;  4HDH A;  2IAJ B;  3LP0 A;  4RW7 B;  3KUH A;  2AW0 A;  4LF6 J;  1RA7 A;  4X64 J;  1LWC A;  3HM9 A;  1H7X A;  1NME B;  2UUA F;  4JI6 F;  2CQP A;  1NDK A;  2V9K A;  2QG9 B;  1UFW A;  2H65 B;  2QLB B;  1T95 A;  4V19 J;  1LWF B;  2Y8W A;  2DXF A;  2IM2 A;  3GG0 A;  2XMA A;  1WC4 A;  4L3N A;  4AND A;  2QE5 A;  4DV4 J;  3HFK A;  3TVZ A;  4B9S A;  1SCJ B;  1W2I A;  2V50 A;  3NCQ A;  2NSC A;  1H7W A;  5A6W A;  4K4Z A;  3W9I A;  4P73 A;  3UO0 A;  3GSI A;  4X4Q A;  4FP9 A;  3TUI C;  2AQ4 A;  3UN5 A;  2AV5 A;  5GAG I;  3CO9 A;  3H40 A;  2IMW P;  3MM9 B;  5CCL A;  3MAQ A;  3HHN B;  4ID5 B;  1RT1 B;  1RHU B;  1VHI A;  3NNH A;  3M1V A;  2MY7 A;  4NCG B;  1JKH A;  1DQ9 A;  1T11 A;  3D4J A;  3P5T L;  3PW5 A;  5D6G A;  4DV0 F;  1S49 A;  1VQ7 S;  2JDJ A;  1VR6 A;  2GCF A;  3IR6 B;  5T41 A;  5LMU F;  5DQH A;  1Z1Z A;  4QYZ J;  1YLX A;  2KYZ A;  4RUH A;  4C9D A;  2M9K A;  2V34 A;  4M5M A;  1N88 A;  2KJW A;  4IRK A;  1RAH B;  2BJ9 A;  3ZZT A;  2VPX B;  4NEY A;  1URN A;  3CO0 P;  5DDP C;  2ZBP A;  2RKI A;  2DNM A;  2VPZ B;  1JJ4 A;  4MKY A;  4DL4 A;  4KGK A;  4P7T A;  5C42 A;  2NXU A;  3AXK A;  3M9M B;  3V81 B;  1OSD A;  4ELV A;  1SQF A;  4WBF A;  5K14 B;  4LIR A;  5KFB A;  4A8O A;  3ISZ A;  4KKO A;  1FDB A;  5DS7 A;  4QWD A;  2GIQ A;  1F9E B;  4IOA Q;  4CM2 A;  4OZ0 A;  4FYX B;  1KQS R;  4QR0 A;  1PJ7 A;  4DR3 F;  2OPS B;  3MXH P;  5D78 A;  4OI1 A;  4YHH J;  2V2K A;  3DI6 B;  3E51 A;  4P52 A;  1KLN A;  1N48 A;  3J7Y I;  4KO0 B;  3DHW C;  2BYC A;  3MOJ B;  2HHQ A;  3KLH A;  2B51 A;  4QWC A;  3PV8 A;  1PJ5 A;  3KK2 A;  3L4B C;  4IFV B;  4OZ2 A;  4FS2 A;  1RTJ A;  1U09 A;  1Y5I B;  2DGS A;  1C1C B;  3M8P B;  4ECQ A;  1N5Q A;  4LT6 A;  5L9X A;  3G6V A;  2J8A A;  4F7V A;  3BJY A;  1CJU B;  2LXU A;  3PO4 A;  1PAE X;  3MZI A;  5J1E B;  2YWH A;  2BA9 A;  3ILL A;  3T9Z A;  4WP3 A;  4I69 A;  4IDK B;  4P2F A;  1O6X A;  2HWI A;  3UDE A;  4UZB A;  4DPX A;  1FNM A;  2FIU A;  1VK3 A;  2C1E B;  1FFW B;  4ELU A;  2FVS A;  4WFZ A;  3FZB A;  4USU A;  4LR9 A;  4EZ9 A;  1YBU A;  1FES A;  3QIP B;  4FKX A;  2CJA A;  4CLL A;  1XMQ F;  2FY8 A;  2KT2 A;  1KVI A;  4QR2 A;  3TZW A;  3GJS B;  4DV0 J;  1M1G A;  2HNZ A;  3FZ2 A;  3QNW B;  1T05 B;  4K4S A;  4A8X A;  2HFV A;  2Q3P A;  3DFE A;  1YTY A;  1Q5V A;  4I4B A;  3CIZ A;  3BEG B;  2MY8 A;  3C3L A;  3KNA A;  5M2P A;  1KFS A;  2DR7 A;  2W01 A;  2GA7 A;  2EI5 A;  1AB8 A;  3VZH A;  1S7H A;  3HUL A;  5HMY A;  2CZ9 A;  4LVO P;  2KFZ A;  1VMB A;  1FDN A;  3NMA A;  4U67 Q;  3Q8S B;  4RBT A;  1CBK A;  4USK A;  3HSD A;  3V4I B;  4ETX A;  2CAJ A;  3KG0 A;  1N6Q B;  5IT9 Y;  2GO8 A;  5ETL A;  3D54 A;  4CO1 A;  3VVU A;  1YJT A;  3MF5 A;  1TAQ A;  2DGX A;  4DDF A;  1JMT A;  2ROE A;  1Y10 A;  5F8N A;  4YR2 A;  2C22 A;  3MCO A;  4ZP6 A;  1M5O C;  3A1Y G;  3QFH A;  4UT4 A;  4OYZ A;  4DV7 F;  4DX7 A;  3H5S A;  1NH7 A;  2V8V A;  4B02 A;  3PYF A;  1IXK A;  4EYH B;  3H7H B;  3OBI A;  2A6O A;  1NCL A;  2B4P A;  1O5J A;  3W2W B;  2M52 A;  3BV8 A;  1RI7 A;  1FJC A;  2D3Z A;  4O3Q A;  5IFM A;  1WEZ A;  2J0X A;  3RTV A;  4C8M A;  4EO6 A;  3B82 A;  3IWN C;  1LFP A;  4WPA A;  2RHS B;  1U1N A;  4QOT A;  3TNV A;  1W25 A;  3AT1 B;  3EGW B;  2ZDO A;  1QE1 A;  3KMS A;  3U1L A;  5CCM A;  3K8V A;  3CJ5 A;  3DRP B;  5FII A;  3CPW R;  1MNE A;  2ZM6 F;  3LQV A;  1VFJ A;  1X4E A;  1NK5 A;  4R25 A;  3GR0 A;  3OTO F;  2E7V A;  2GJ2 A;  2YY3 A;  2BM1 A;  1KDN A;  2OPP B;  2YQ1 A;  1DFD A;  3W5Y A;  4ZVT B;  1NM2 A;  1AZS A;  4NA1 A;  1WHY A;  3R1L A;  3H59 A;  1YDL A;  2I8E A;  4O3O A;  2YBV A;  2B5J A;  2LDI A;  3LTO A;  3NMR A;  3PR4 A;  3QFW A;  1WOO A;  1P8G A;  3KK3 B;  3GE9 A;  1Q16 B;  2PO4 A;  3IGN A;  4ZKA A;  1XMQ J;  3R5J B;  1IBL J;  3L9Z A;  2VFV A;  2MZQ A;  4B08 A;  4DV6 F;  5HMZ A;  3BF4 A;  2XZT B;  4B9T A;  5LL6 d;  4ZIT A;  1VBY A;  1XWL A;  2QA2 A;  1KD1 T;  4LBI A;  2DNL A;  1RTD A;  4HAC B;  2BDP A;  3Q23 A;  2UV8 G;  4LF9 F;  5B0F A;  3E3X A;  5SUH A;  1JLF B;  1FD2 A;  4C3K A;  5D3G B;  4AD6 A;  2HRY A;  5KG2 A;  2M8D B;  1R0A B;  4A8K A;  1FRK A;  2RS8 A;  2MKY A;  2XS5 A;  3BYP A;  1Q1K A;  4B3O B;  5EHH A;  1XC9 A;  1WHV A;  1WG4 A;  3MPY A;  2KM8 B;  3NCP A;  3TI0 A;  4DJB A;  1FE0 A;  4RLE A;  4H54 A;  3R7B B;  3E01 B;  4S0M A;  5AXM A;  1HNV A;  4WYL A;  1N36 F;  3IS9 A;  2UU9 F;  4BC7 A;  4J37 A;  1T03 A;  2V4Q A;  4ECT A;  4DV7 J;  5KFI A;  3VHQ A;  1R3N A;  2DR6 A;  1FRM A;  1ZM9 A;  3DN9 A;  4LUB A;  3OW2 R;  4B3S F;  1GXT A;  2VBY A;  3RJM B;  5B08 A;  4ZPC A;  4M5K A;  4TU9 A;  4I67 A;  3ILJ A;  3BSO A;  1HW9 A;  2X3G A;  5L38 A;  1LV5 A;  2JC0 A;  1BQN A;  2BZ2 A;  1CJV A;  1WC6 A;  2LXF A;  3D2W A;  2RUG A;  3L7U A;  1WI8 A;  2ASY A;  1F2G A;  1WJ9 A;  2XCA A;  1IBM J;  4NLY A;  2ZM6 J;  2A10 A;  5KFJ A;  2FHJ D;  3BO4 A;  2MHE A;  3OTO J;  3EVW A;  2ZD1 B;  3EWG A;  4W4M A;  4GC6 A;  4TYA A;  2XO6 A;  4CIO A;  4XIU A;  1SI9 A;  1S77 D;  1XJW B;  1GTH A;  4JI4 F;  1KEK A;  2SXL A;  4CLY A;  4UST A;  3VAJ A;  1HWU A;  1JLQ B;  4Y65 A;  2KYX A;  1UVN A;  5H9E J;  4DPY A;  5C7P A;  2MEW A;  2E9R X;  1X4B A;  3BGO P;  4LQ3 A;  2CNN B;  1IJE B;  1RT3 B;  1JLC B;  3CD7 A;  5B0B A;  1X9W A;  2ZKT A;  4FN5 A;  1N4L A;  1UPP A;  2B9X A;  5B0G A;  2VG6 B;  5CYQ A;  1VQ6 S;  2HEK A;  1FKO B;  2YNG A;  4N8O A;  4J9M A;  5CD4 H;  2FB0 A;  3OUY B;  3DYA A;  2EFQ A;  4K4W A;  1S0O A;  2Y3Y A;  3TJ8 A;  3DRX A;  1RT4 A;  1L3V A;  4JBC A;  3BRE A;  2R7Q A;  1VQ8 S;  1XMB A;  2NZ4 A;  3MTJ A;  1NK9 A;  2AYE A;  1RTI B;  3GB0 A;  1YJW S;  3JSM A;  5A0Y A;  2N3O A;  4ANE A;  1NK4 A;  4CP5 A;  4DV2 F;  5KT6 A;  4Y6I A;  3VCD A;  3G6X A;  2LEP A;  3K8W A;  4DXL A;  2V5H G;  1UA0 A;  3KHH A;  2UU9 J;  1GAO A;  4OHX A;  5KFX A;  3ZZP A;  2HHX A;  1NK8 A;  5D4L A;  2QC3 A;  3PRD A;  4XAK A;  3CB4 A;  4OV1 A;  1DQA A;  2DPJ A;  3IC1 A;  1UKU A;  2KXH A;  1R6V A;  4TQR A;  4L75 A;  3MM6 B;  3CCV S;  1OWX A;  1HNW F;  5DRK A;  4J9P A;  1WDD A;  4PG4 A;  1SKW A;  2GV1 A;  3MM5 A;  2O67 A;  2WAQ D;  5JVG Q;  1NB2 A;  1VIO A;  5RUB A;  4B3M F;  3DLG B;  3KLE A;  1N5Y A;  2CJQ A;  2GQQ A;  2AP6 A;  2GS8 A;  1NSP A;  4OX6 A;  4EBC A;  4DSK A;  5F3T A;  5IWA F;  3EVM A;  3JXO A;  2VBX A;  3X1L B;  2E5L F;  1F9F A;  4NLR A;  1TMM A;  5E41 A;  2GVZ A;  1S5Z A;  4JI4 J;  4Q8E A;  1HYS A;  4WTY A;  2IM0 A;  4CH0 S;  3FBF A;  2R8H A;  3C2P A;  2EFN A;  1VRT A;  3PDN A;  1VS3 A;  2XCP A;  4JV5 J;  2DH8 A;  4O4G A;  4V19 X;  3C15 A;  5KG5 A;  3M2R A;  4RNF A;  3B54 A;  2E44 A;  1WC0 A;  3B4M A;  2XMT A;  4KHP F;  4ZPW R;  4QW8 A;  3V6J A;  3ET6 B;  3ZO7 A;  3MEG B;  2RDJ A;  4F3Q A;  3AA9 A;  3RRK A;  2OD4 A;  1LWX A;  2ZNZ A;  1NEE A;  1OO0 B;  1PBU A;  2L3M A;  4DU7 A;  1ZAW A;  3CC2 S;  2F8M A;  3UWT A;  2CJY B;  3A8K A;  2VFT A;  4LBH A;  1YJ7 A;  2HND B;  3HFZ B;  1VQ9 S;  2B9E A;  2YKQ A;  4JUZ A;  5KFR A;  2K1R B;  4DV5 F;  2IDE A;  2YX1 A;  4K4Y A;  2DNK A;  2FVP A;  4HTJ A;  1MG7 A;  5CA5 A;  3UCZ P;  3PW4 A;  1IR0 A;  3G9C A;  3DU6 A;  1DTQ B;  1PC4 A;  1D0E A;  2DY1 A;  3SSS A;  4X4P A;  3UNY A;  1LXJ A;  2GW8 A;  1SC1 B;  2WOM B;  4WFN Q;  4OJ3 A;  1RWX B;  2QIF A;  4ECU A;  2B8P A;  3DRR A;  3OL8 A;  3LAK A;  4DU8 A;  1HMV A;  2W8L A;  3U02 A;  3N79 A;  1HNW J;  1S1U A;  1FO1 A;  3HI9 A;  3DGP B;  6FD1 A;  1XMO F;  4B3M J;  3DMJ A;  2Z2M A;  4HH0 A;  3OXG A;  3HVT A;  1QSY A;  2K3K A;  5FDL A;  4OZ1 A;  5IWA J;  2V94 A;  1X7V A;  5CD4 A;  3W5Z A;  3IR5 B;  4C11 A;  3NP5 A;  5AXN A;  2W9B B;  3PRB A;  4ECY A;  2PI4 A;  3X3U A;  2VB6 A;  1XK8 A;  3MPU B;  3BB5 A;  4Z2X A;  2D3U A;  3DRY A;  2C2D A;  1WF2 A;  4ED6 A;  2H3E B;  2MDA A;  2BV3 A;  4OQJ A;  1TL7 A;  3ZZZ A;  4ED2 A;  1S10 A;  1EET B;  1X5P A;  2LQ9 A;  2U2F A;  2DY9 A;  4KHP J;  4E98 A;  3HP6 A;  4X62 F;  3CME S;  2XYH B;  5DQG A;  1OY8 A;  2QYC A;  2GGP B;  3KOA A;  1HBN A;  5F0U A;  1ACM B;  2KFY A;  1WOP A;  4RWW A;  4DX8 H;  4IG0 B;  1IUJ A;  1A7G E;  4J90 A;  4NLO A;  2O3D A;  2CG4 A;  1SH0 A;  5CYJ A;  2MPU A;  4TNO A;  5KFP A;  3LW5 C;  3TOQ A;  4EI2 A;  3KLI A;  4PUO B;  4FYY B;  5DDQ C;  2DR9 A;  2GIR A;  5HVF A;  1HNX J;  3I0R B;  4F8R A;  1YJ9 S;  4DV5 J;  2MMY A;  3UD3 P;  2W25 A;  4NOH A;  4TN2 A;  3T1A A;  1Q95 G;  1P9Q C;  2V4J A;  1U6Z A;  1H3D A;  4C8Z A;  3CJ3 A;  1XTZ A;  3N01 A;  1VQO S;  2FZK B;  3CC7 S;  3H5Y A;  4WF9 Q;  1GMW D;  2X1F A;  2BRK A;  3QSI A;  4PAA A;  4RUB A;  1T02 A;  2PEB A;  4MTP A;  1LK5 A;  3M6U A;  3GIM A;  3GPA A;  2FVR A;  4JV2 A;  4DCP B;  2PFF B;  5HBM B;  1WC1 A;  4LF8 J;  3GFX A;  2D69 A;  1K8A T;  1TU0 B;  4Y0F A;  2AYM A;  4WK3 A;  1B0P A;  3SQG B;  3MPW A;  4ZOS A;  2HRU A;  4R0J A;  2ROG A;  2AWZ A;  5IC4 B;  5GME A;  4HKQ A;  4OHV A;  4FPI A;  4ECZ A;  4X4N A;  5KG7 A;  4HH1 A;  3AAW B;  1HBO B;  4F04 B;  2KM8 C;  1OYE A;  2J7W A;  3A8J A;  2FD2 A;  5DG8 A;  1T0T V;  2V0N A;  3U27 A;  4DEZ A;  1OS5 A;  2JJ4 D;  2DYA A;  5KG0 A;  4H4K A;  4ED3 A;  4YUD A;  3MR5 A;  4EU0 A;  4LF5 F;  2RIL A;  5K5M A;  1G6B A;  1F5C A;  4IO1 A;  3T5J A;  3CC4 S;  1Y3J A;  1PJ6 A;  1X9S A;  3BGR A;  1AFJ A;  2BAC A;  4NLT A;  4FBU A;  4C98 A;  1XQI A;  3CCL S;  1RGV A;  2R42 A;  1H6K X;  5KFN A;  3H4B A;  2G1H A;  3DLK A;  2CNK B;  4KV8 A;  4KGV B;  5HSP A;  1XR6 A;  1K0V A;  4QJV A;  2VFU A;  2XUL A;  2R7R A;  5B0D A;  1ZET A;  4B9U A;  4X4T A;  1TV6 A;  4YY3 F;  4ED5 A;  3PG9 A;  2XZW A;  4HT7 A;  1REV B;  3DRS B;  2R7X A;  2WVC A;  3NAI A;  3NKY A;  3NGT A;  3WHI A;  3WBZ A;  3PR5 B;  2X1B A;  1R27 B;  5D0H A;  3DOM B;  1EJ7 L;  4NXN J;  3VAK A;  4H4M B;  1UJ5 A;  2IDL A;  5EWE A;  2E1R A;  1NKB A;  3FUY A;  3G8T A;  4M5G A;  3SXL A;  1H38 A;  2J0S D;  3ZTR A;  2M70 A;  5GMD A;  1RYS A;  3OR1 B;  4ZVP B;  4N8N A;  3VVT A;  2PC6 A;  1J27 A;  2CIM A;  1Z2L A;  2DRA A;  4LF7 F;  4GVB A;  1C4A A;  2VG7 A;  2LEA A;  2D41 A;  3PAC A;  4XPC A;  2YXL A;  3GLJ A;  2IM1 A;  3RG6 A;  2H5J B;  1OYD A;  4G3I A;  1D8Z A;  3CJ4 A;  2DIV A;  4UZC A;  1U2F A;  1B3T A;  2CJX B;  4ZP7 A;  2RIJ A;  5J2P A;  1I6J A;  2BE2 A;  1MWZ A;  1ROF A;  4DQP A;  2DEJ A;  3DXS X;  3FQK A;  2WRM A;  4Q44 A;  3Q8Y A;  3RBD A;  4DR1 J;  4KQZ A;  3A12 A;  4CO2 A;  4P75 A;  5ETK A;  1VJW A;  1P27 B;  1UVJ A;  1NH8 A;  1Y4Z B;  3CT9 A;  1NND A;  5ETV A;  3J81 U;  1YJR A;  2Y1J A;  1RWN B;  2FHJ A;  5E0O A;  3QT8 A;  2ZH7 A;  1B7F A;  4TKT A;  2C28 A;  3CDB A;  4DQI A;  4FKY A;  5JUM A;  3DU5 A;  1QTM A;  3UR3 C;  3VWS A;  5DO2 A;  4LF5 J;  5F3Z A;  3MCM A;  4KH0 B;  3PYG A;  3C16 B;  3K0J A;  3M2V B;  5HL7 Q;  1C0U A;  1GTE A;  5C24 B;  2XTJ P;  1R8H A;  4YR0 A;  2WON B;  2DNY A;  1X0F A;  2UXD F;  4CI0 B;  3CCJ S;  3BDE A;  4J9N A;  3KLF B;  2RRA A;  3OXL A;  4J9R A;  2IPO B;  3R1H A;  3BKU A;  1ZA2 B;  3GMG A;  2WBM A;  4YY3 J;  4ZVE A;  2WVF A;  3IBW A;  2KVI A;  3I9Z A;  2DCL A;  2XWY A;  3QLH A;  5ETN A;  1OJ4 A;  3SDE A;  4A47 A;  2VDI A;  2WW4 A;  1S9E A;  4CCH A;  2XM3 A;  4DG1 B;  4K2J A;  3BGU A;  5AJ3 F;  3PVX A;  2ZZN A;  4DPT A;  4MKA A;  1EB0 A;  2WVD A;  1C0T A;  4G1Q B;  4RU9 A;  4QYZ K;  1U1L A;  2DT9 A;  3CDW A;  2ACM A;  5JMN A;  5D8H B;  1H98 A;  1NKC A;  3P8B B;  3I0S B;  4ENO A;  4JYA F;  4AUK A;  1BQM A;  4C2M A;  1U1M A;  3PTW A;  1WKJ A;  2ATC B;  1WAC A;  3EYZ A;  3CCM S;  2KRB A;  4LF7 J;  2FHO B;  1JLG A;  2HBQ B;  3TAM A;  2W4P A;  1YRT A;  4W90 B;  2WSE C;  2G0J A;  3AD7 C;  5A8W B;  2F9J A;  4A8M P;  2FLO A;  5DG7 A;  1QJH A;  1MWY A;  3GYX B;  2FJE B;  3S01 A;  2JNJ A;  1DLO A;  5J2Q B;  4F2S A;  3PX6 A;  3AB2 B;  3OFE A;  2FTR A;  4KY3 A;  3M6X A;  2V2V A;  4FNH A;  4MK8 A;  2C42 A;  1RHR B;  2UP1 A;  4F0K A;  1ELO A;  2CWK A;  2M8H A;  1JLE B;  4WXO A;  3AOC A;  4R5P A;  4AQY J;  3IWX A;  4ILL A;  2FC9 A;  1FFS B;  3WX8 A;  4A8S A;  3AD8 C;  1FE4 A;  2OEL A;  4I6A A;  4K0K F;  2EW9 A;  3CCE S;  5L1J A;  3VZI A;  2VQF F;  2W4D A;  3P6Y C;  3THV A;  5L46 A;  1YBT A;  2YNH A;  2HNY B;  2DRB A;  1SH3 A;  2OML A;  1DRZ A;  2B7B B;  2DPI A;  2XBP A;  5EX0 A;  1NLK L;  4J9S A;  1XN9 A;  1VDH A;  4A8F A;  1LWC B;  4TVA B;  2DR8 A;  4DR4 J;  3HSG A;  5KFH A;  4UW2 A;  3S7R A;  5IM0 A;  3QWU A;  3JTN A;  2MST A;  2NUU G;  3AJ2 A;  1IWA A;  1U1O A;  4O3S A;  2ZH3 A;  3TUP A;  4YOE A;  2PMH A;  1YJN S;  2QT7 A;  3UVJ A;  1DTT A;  4DFJ A;  1YKW A;  4OJ1 A;  1BMQ B;  1FKP A;  2V9W A;  4IH6 A;  1Q79 A;  2OTJ S;  4RZR A;  1R8C A;  4CNY A;  4OYO A;  4UQT A;  4QIV A;  2YX4 A;  2HHT A;  2W2Q P;  3L95 X;  2JLE A;  1S12 A;  3UDC A;  4EYI B;  2ZOM A;  4XK8 C;  2HHV A;  3PW7 A;  4OHY A;  3OVS A;  5IQ6 A;  5KFD A;  2HZV A;  3NWR A;  1S72 S;  1M5H A;  1UFK A;  3WC2 A;  3P5B P;  2HBR B;  2RD5 C;  1LW0 A;  4TY8 A;  5KT2 A;  3F56 A;  3M1V B;  2FZG B;  3MFH A;  4JI8 J;  1GFW B;  1JKH B;  4LF4 F;  5KFE A;  1SKU B;  2BJD A;  4DI6 A;  1TFW A;  4I2Q A;  3T19 A;  1T9T A;  2EC0 A;  4LFC J;  4F4W A;  3CWJ A;  2N82 B;  2RRB A;  2YKN A;  4ZLL A;  3V6K A;  1ZAV A;  3ETO A;  3P49 B;  2RKI B;  2JLF A;  3PYD A;  4OYB A;  1KS2 A;  1U45 A;  4J9L A;  4NEZ A;  2HAI A;  1ZAX A;  5F8J A;  2J6T A;  3BR9 A;  4EEY A;  4ZCK A;  3OTE A;  4Z37 A;  4IOC Q;  5THW A;  4K0K J;  3ZZU A;  2VQF J;  4IH7 A;  4LRD A;  2RML A;  1CJK A;  4PQA A;  3EXC X;  3CCW A;  3MUV P;  1RYR A;  3FVY A;  2FJA B;  1KQG B;  3MM7 B;  4ECR A;  1TMJ A;  3R27 A;  3KLH B;  2DB1 A;  3K5O A;  1TL5 A;  4NLX A;  2W4C A;  2Z0G A;  1Q0N A;  4RKU C;  4OI2 A;  2A2D A;  1M1K T;  1RTJ B;  1WSR A;  2CPJ A;  1N56 A;  2F3J A;  1YBA A;  2AF6 A;  2CQH A;  5CAA A;  4IR9 A;  3FFI A;  2H48 B;  4DX6 A;  2OPQ A;  2EFP A;  2QSF A;  4TLR A;  1MU2 A;  3KYL A;  3NAH A;  2DVI A;  1UZD A;  4NZ6 A;  1HD0 A;  3D67 A;  2NS1 B;  1RAF B;  4RUC A;  3FNN A;  2OGU A;  2HG4 A;  4RNN A;  4O0N A;  3RAQ A;  4LF4 J;  4IO9 Q;  5LXR A;  1KLM A;  2HNZ B;  1CSJ A;  2Y1L B;  2IA6 A;  4NLW A;  2E1P A;  3BSN A;  4P6Q A;  2LEB A;  4NCB A;  1S1T A;  2QTW A;  4K59 A;  4QR1 A;  2OLW A;  1URR A;  2BVZ A;  4ID8 A;  1VBZ A;  1UEV A;  1U0S A;  3OSP A;  2D9P A;  5HI7 A;  5HAO A;  2P5V A;  5HQL A;  1H2U X;  3IMQ J;  1WG1 A;  3M30 A;  4RW8 A;  4ZPD A;  5D4P A;  3EDQ B;  3TA0 A;  3HO1 A;  4DPO A;  4WE1 A;  3J81 j;  2DHX A;  2J0W A;  3Q86 A;  3J80 Y;  3I6P A;  2E9T A;  2BJ7 A;  3D0I E;  2HGM A;  2MLY A;  2QX0 A;  5HAN A;  2XQC A;  3EM1 A;  2EBE A;  5D0R A;  2YNF A;  3KTQ A;  2QLF B;  2EXU A;  2Q66 A;  5IS2 A;  5E2Q A;  5DDR C;  3CTR A;  1IBK J;  2MXY A;  1D9D A;  2AZ3 A;  3BO3 A;  2OEJ A;  2Q43 A;  4YQW A;  4D3H A;  4A8Q A;  5D4N A;  2IYI A;  1DUR A;  4IR1 A;  3GII A;  1CLF A;  3BGF A;  1WSV A;  2HHP A;  4P2S A;  1JXE A;  3UDV A;  3F44 A;  1K1Q A;  2HAF A;  3IBF B;  5DGB A;  1X4H A;  2LQ8 A;  3D1H A;  1A0O B;  3HD2 A;  3CVK A;  1NPP A;  5KFO A;  1QE1 B;  3P45 B;  3ITH A;  3MD3 A;  5L39 A;  8AT1 B;  3GYG A;  2YWW A;  2GHP A;  5T7L A;  2YQ3 A;  2C2N A;  1CEZ A;  3NLC A;  3TRG A;  3R5D A;  1SC6 A;  2JFK A;  3HT3 A;  2GAG C;  4F4A A;  1K73 T;  3PX4 A;  2DTJ A;  4USW A;  3D3C J;  3IA0 A;  2Q1L A;  3NS7 B;  4X65 J;  1AZS B;  4Q7A A;  1NUE A;  3J7Z 5;  1NB7 A;  2C3O A;  2GQC A;  4NLQ A;  4YB1 P;  2Y9H A;  1UVL A;  1YGY A;  2RB7 A;  2B5J B;  5B09 A;  3AB4 B;  1I5O B;  1VOM A;  2HHS A;  1KTV A;  4BDP A;  2WTF A;  1TUW A;  5IT9 U;  2CG8 A;  3CW2 C;  1R0C B;  1ULR A;  1S6P A;  4ERD A;  3SV4 A;  5IOL A;  1HQU A;  2HW3 A;  1QLN A;  1M5V C;  2KJV A;  2KB2 A;  4I6W A;  4J9U E;  1F6T A;  2KFN A;  7FD1 A;  2G0I A;  3LWM A;  1SJR A;  4KAI A;  1AYE A;  3TWZ A;  2MKC A;  4OZN A;  3OL9 A;  3M2U A;  4URS A;  4WZQ A;  2CVE A;  1KP6 A;  3M6V A;  2AJ1 A;  3TA1 A;  2BJ3 A;  2H1Y A;  2RF2 B;  1YJV A;  4B3R J;  4PKD B;  2CAD A;  3NBP A;  1TKZ A;  3DDN A;  1JJC B;  2H54 B;  4YDD B;  3TX8 A;  4KGX B;  1UP1 A;  5MAO A;  2LCW A;  2AJF E;  3GCW P;  4DLE A;  4O44 A;  3ZC4 A;  2IC3 B;  1HNV B;  4LSL A;  2QEX S;  4MFB A;  4OZ3 A;  5KFQ A;  4GMK A;  3PZP A;  2R7W A;  3JSB A;  4F02 A;  2B43 A;  1T03 B;  4HI2 A;  1TKX A;  4I1T A;  1S1V A;  4F50 A;  3VQS A;  4OIX A;  4K4V A;  4KE5 A;  4R8U A;  5EWF A;  1ZPV A;  4DHV A;  1MLA A;  1Y7P A;  4E8U A;  1R31 A;  1APS A;  3CUN A;  1BQN B;  1DZ5 A;  3BS9 A;  4DL0 C;  1CJV B;  3HSJ A;  2DCU B;  4PCQ A;  2IYG A;  3OVB A;  3VAH A;  1ZTW A;  2E5G A;  4ZVO B;  2IY5 B;  3HMJ G;  4Q8F A;  4OYP A;  1YHQ S;  1CG2 A;  1EP4 B;  4PEO A;  2OFH X;  1FX4 A;  2HQG A;  4ZA1 A;  5E33 A;  2ZBR A;  1LK7 A;  3DXB A;  4JV0 A;  4LRA A;  2HVH A;  5B7W A;  2DRD A;  2B9Y A;  3O1L A;  3OL7 A;  2DD8 S;  4U7U K;  5EGY A;  3OTD A;  1K47 A;  3PEH A;  2XNQ A;  2BBE A;  2H51 B;  2FVC A;  2HGN A;  1FWP A;  3AFG A;  3K2Y A;  4WP9 A;  2MZS A;  1PCA A;  4QU6 A;  2Q6B A;  4CO5 A;  1RAO A;  3RB4 A;  3QAE A;  4AL7 A;  1AUD A;  2MTL A;  1G4C A;  2QL5 B;  5CYQ B;  3SYZ A;  1K0T A;  2HQ3 A;  1WOR A;  2HGL A;  2OAU A;  2VU5 A;  4L73 A;  3DYA B;  1KC8 T;  4LRC A;  4U9R A;  3N6N A;  1QSL A;  2IA0 A;  3HXM A;  1RT4 B;  4KR0 B;  3TJ9 A;  3QT5 A;  2P9G A;  2EWH A;  1FXR A;  3QWP A;  4CLK A;  5HMX A;  2C3M A;  2QL9 B;  3JSM B;  3KG4 A;  3HVR A;  1BHN A;  4K4T A;  8RUC A;  4LF2 A;  3UNG C;  3OT9 A;  3TP2 A;  4RWX A;  3FCH A;  5I3U A;  2OPS A;  4A48 A;  3QAU A;  5E3P A;  1SC4 B;  4YB6 A;  1RU1 A;  4F0M A;  1NSQ A;  3B6B A;  4CRJ A;  4LRB A;  4M8L A;  2KZZ A;  2YWF A;  3AOB A;  3CD6 S;  2XWX A;  2OH2 A;  4G1P A;  2MZR A;  5DZ7 A;  1MMD A;  2DH9 A;  1KRP A;  2NQP A;  4FYV B;  4ES2 A;  3HDS A;  4J91 A;  3E8O A;  1AT1 B;  4B3T J;  2HSE B;  2J76 E;  4ZN1 A;  1RT6 B;  3DLB A;  2OEM A;  4DR5 J;  2WVE A;  1SJ3 P;  3JQM A;  3Q8Q B;  2B4U A;  3KLE B;  1MSW D;  2ZH4 A;  1N5Y B;  5F9L A;  5J1E A;  1JNZ B;  7FDR A;  1L5U A;  2D9O A;  2BMB A;  3QJL A;  3KLG A;  1U8W A;  2KXN B;  3JS9 A;  3N4W A;  3QRQ A;  4ZMM A;  1XIQ A;  5F8M A;  4I2P B;  5JVH Q;  5LMN F;  3VR1 A;  1HQE A;  3N5F A;  1IKV A;  1VRT B;  3CJT A;  4O4G B;  3TUJ C;  4NLS A;  3HHL D;  3M2R B;  4P7V A;  1MRO A;  4L6V 3;  3BR8 A;  1SVD A;  3BPD A;  3OHA A;  1VIS A;  2C3U A;  2AU0 A;  1U0H B;  1VQY A;  2UUT A;  3O8W A;  4HLB A;  1T3N A;  2DO0 A;  3GJT B;  4YN3 B;  4ZPV R;  3V4I A;  1U49 A;  1X0P A;  4HT5 A;  4N5S A;  2DGO A;  4MIB A;  3MUT P;  1RHQ B;  2NR0 A;  3D9B A;  1MWQ A;  5HVG A;  3GV7 B;  3Q89 A;  2P9C A;  1WTB A;  3FJ2 A;  3R9L A;  2QMU B;  3TVK A;  1PBA A;  2E66 A;  2HFU A;  2HWH A;  1YRX A;  2LLZ A;  1VYA A;  1ZS6 A;  2FLL A;  4X4R A;  3DC2 A;  4KYZ A;  1H74 A;  5GMK a;  2BEF A;  4O3P A;  4QYR A;  4DZD A;  3O2I A;  2O66 A;  2DNH A;  1S57 A;  3GIK A;  5CH7 B;  4M5I A;  3GIJ A;  3ILI A;  3NGK A;  3T1H J;  2BAN A;  3K57 A;  3DRR B;  1HMV B;  3G87 A;  1X4D A;  4QIF A;  4N7T A;  1F2H A;  1PYS B;  2ZC3 A;  3DCA A;  1S1U B;  1R43 A;  1EKS A;  2K7J A;  2MZJ A;  1QUP A;  3QSY B;  5HLF A;  4MAK A;  1N54 B;  3LPE A;  2WW8 A;  1OIA A;  3DMJ B;  4N47 A;  5AE3 A;  1JIH A;  3HVT B;  1VQN S;  1U26 A;  3JB9 k;  1LEO A;  3S1T A;  1SQE A;  5FDL B;  1C2P A;  2P2C B;  2NZC A;  5AXK A;  2CQC A;  2BR0 A;  3TAN A;  4ZVG A;  4C11 B;  3VGV A;  3FMW A;  4I0W A;  2OUG A;  2HMI B;  3KK3 A;  3ENV A;  2LMI A;  1L3U A;  3ZNU A;  4NYZ A;  4QW9 A;  5AE1 A;  5EN1 A;  3DDK A;  1X4G A;  1TL7 B;  4TLQ A;  2E29 A;  3QID A;  4MH8 A;  2J9D A;  4O3N A;  5L8R C;  2HLT A;  3MED A;  4F4K A;  4CH1 A;  2KH9 A;  4RU2 A;  3AA8 A;  3M8Y A;  3W7B A;  3U7J A;  2CKW A;  3W8P A;  1ARO P;  4J7C A;  2PMW A;  3GV8 B;  1HBN B;  2KHD A;  4O0I A;  3V6D B;  2I9S A;  3T6B A;  2DNQ A;  4JI5 J;  4NLG A;  2QLX A;  1RWK B;  3WC0 A;  3ENQ A;  1T9Y A;  5ETT A;  3KLI B;  2A6M A;  3DLE A;  5E3Q A;  1NDL A;  4QCL A;  3U1N A;  2ZDP A;  5D0E A;  2VOP A;  3UFC X;  2IRU A;  5E3C A;  1S99 A;  1J5O A;  2RRN A;  4F4Y A;  3MR3 A;  4DS4 A;  2VDH A;  3VTI A;  1HWI A;  4GKK F;  4LF1 A;  1LQ9 A;  1D09 B;  1NHV A;  2V4J B;  1RA6 A;  2YNI B;  5LSR A;  2DNG A;  4F36 A;  4P2M A;  1WOS A;  2QMX A;  2DNP A;  4LR7 A;  2CQG A;  1IBC B;  2XSJ A;  5G0R A;  5KT5 A;  4M5J A;  2G2Z A;  4Y2M A;  2MGZ A;  3AOA A;  1GX5 A;  4AXI A;  1HAR A;  1Z4U A;  1ITP A;  3GYN A;  3D0G E;  1JLA B;  1WUU A;  4K2X A;  1RQ0 A;  3ISN D;  3M8Q A;  1NZA A;  5K8O A;  4IH5 A;  2QN6 B;  4F2R A;  2WCX A;  5EX3 A;  3M8S A;  4DL7 A;  1Y3K A;  3CD5 A;  2BE7 D;  2RDD A;  3T1Y F;  2K2P A;  2LA4 A;  3AJ1 A;  1X4C A;  3AXM A;  2CWX A;  3QMQ A;  5BJR A;  4ZLN A;  2Q6C A;  2UXB F;  3G2X A;  3ZTP A;  2EPI A;  2MHN A;  1HPZ B;  5F8H A;  5K9F A;  1Y0H A;  1TUG B;  4ITS A;  4LBP A;  4DQR A;  1OQ6 A;  3D6T B;  3GWC A;  4LSN A;  1UMJ A;  4ZVQ B;  2MJN A;  2I2Y A;  3QQC D;  3SFU A;  4K7Q A;  4M5L A;  3G96 A;  3BGR B;  3FBB A;  2FJX A;  1RAJ A;  5CXT A;  3O3L A;  2DHS A;  4DR7 J;  3ETM A;  1FRX A;  3DLK B;  2ZZT A;  3GFZ A;  2I0X A;  3EXY A;  4EMD A;  3EGZ A;  1WEX A;  4KJI A;  1TV6 B;  1WG5 A;  4FXD A;  1FD8 A;  3OTC A;  2PEH A;  2PGC A;  1TVR A;  3OL6 A;  1U1K A;  1WTF A;  2VZ9 A;  4X66 F;  1UVK A;  5KG1 A;  3L7O A;  3NY0 A;  4JI1 F;  4GKK J;  3PRV A;  4GO5 X;  3KHR A;  1VQ4 S;  2M5Y A;  2UUA J;  4JI6 J;  3JTO A;  1XR5 A;  3HF5 A;  3F73 A;  2GC8 A;  3EPG A;  4RNO A;  2CVI A;  5CYM A;  4ED7 A;  1VC5 A;  3MHY A;  3I5A A;  3MCS A;  4U96 A;  2EVZ A;  4GVB B;  3CE8 A;  2JH3 A;  1GMV A;  4CDI A;  2VG7 B;  1I51 B;  5LSO A;  4F3O A;  2Z8Q A;  2QSW A;  2RHQ B;  2IMO A;  2RQK A;  1GT8 A;  2BOA A;  2ROP A;  1JLB A;  5J2P B;  2RDI A;  2LEC A;  2BE2 B;  1RAC B;  3NGS A;  1RAG B;  2VJU A;  2FYX A;  1X60 A;  3QAT A;  1A6L A;  4AE5 A;  1WKK A;  2MQQ A;  4K5R A;  1YX2 A;  3NS6 A;  1MN7 A;  5I3Q A;  2B9W A;  4IQM A;  1Q8B A;  5LMU J;  2IRY A;  5J2N A;  4ES3 A;  4ED8 A;  1D3W A;  3QO9 A;  1JWW A;  3VAI A;  1I94 F;  1K44 A;  4X4S A;  4IOB A;  3R5G A;  1OPZ A;  4OZJ A;  4PWD A;  3UQS A;  1ZYQ A;  2VJV A;  2ZHO A;  1YIJ S;  3OFG A;  4M5N A;  4RW6 B;  2MQO A;  3LPY A;  4DL2 A;  2R2R A;  2ZE2 A;  2CQI A;  3M9O B;  4OLO A;  4EUV A;  2HQF A;  1NSK L;  2ASJ A;  3THP A;  2DGV A;  4DSF A;  2F5G A;  4PYA A;  3W63 A;  4FF3 A;  4DCO B;  3PJ9 A;  3A3P B;  2XNR A;  4FVC A;  2ZBI A;  4DR3 J;  1X5O A;  2J5A A;  2N3L A;  1VQS A;  1FTR A;  4F4Z A;  3K17 A;  1AA1 B;  1FWL A;  3IRW P;  3QLH B;  4UOC A;  1WEY A;  2XLK A;  3SDE B;  1EKR A;  4X66 J;  2DGT A;  1FHT A;  4ILR A;  2RQM A;  1R8B A;  1S9E B;  1DTQ A;  2LU1 A;  3FEX B;  1VRU A;  1HA1 A;  4HR2 A;  2VPW B;  2UUB F;  4NYO A;  1SUQ A;  2IRX A;  2HS4 A;  3N6M A;  4NZ7 A;  2ZOG A;  2LFV A;  5IQQ A;  1QVF R;  4ZP9 A;  3TR5 A;  3ZZY A;  3M4X A;  1N0V C;  1BQM B;  2PMZ D;  1RT7 A;  3I5B A;  5C2G A;  1RBL A;  5J2M A;  2C2E A;  1RUS A;  2N4D A;  1JLG B;  2HRT A;  3LP2 A;  2VHG A;  3TAM B;  4LFA F;  1JNR B;  4Q0B B;  2BE9 B;  2UVU A;  4C8O A;  1MML A;  4LRE A;  4EK2 A;  1T8E A;  4Y2A A;  4J5O A;  2AGO A;  2BKP A;  3HPO A;  3K89 A;  1G2E A;  2WVB A;  3HVW A;  4Y00 A;  2G2O A;  1FJ7 A;  3VGS A;  4CNZ A;  2F4V F;  2NPI A;  3TAR A;  3T6J A;  2RQC A;  4RX6 A;  2XHW A;  1N52 B;  2E7W A;  2FHM A;  3IM9 A;  4ECS A;  3MOZ A;  2ZZM A;  3I4P A;  2YNH B;  1KQF B;  1GX6 A;  2D3O 1;  1FTC A;  3R6G B;  5I42 A;  3CCS S;  3LAN A;  5KT3 A;  2CQ2 A;  1RWO B;  2C2K B;  3ELH A;  4C0B A;  5IM0 B;  4KSE B;  3T3F A;  3JQK A;  3ILO A;  1V5I B;  3IP0 A;  3KJN B;  2V8H A;  3ENA A;  3HHL A;  1RAE B;  4IG3 A;  2H9Z A;  3FEY B;  4CM0 A;  2UVW A;  4C97 A;  5BYR A;  3SEO A;  3S8S A;  3UVJ B;  3PX0 A;  2BQR A;  4IFY A;  4M5D B;  1FKP B;  2CUY A;  1Q78 A;  4C8L A;  4ZCL A;  3PFE A;  3LP1 A;  5KT4 A;  1Y5N B;  1H2V Z;  5HN0 A;  2G2Y A;  1EHW A;  2L48 A;  2LU2 A;  3J7A 1;  2YKM A;  3MMB A;  2UUB J;  1NKE A;  3OFH A;  3ONQ A;  1H0H B;  3M9N B;  4F3M A;  5KFW A;  2OD6 A;  4NA2 A;  1LW0 B;  5E5N A;  4CTA A;  3KUE A;  1IM4 A;  2OIH A;  5AE2 A;  1S48 A;  1OQ3 A;  1L3T A;  1ICE B;  1RT2 A;  2K7K A;  4IKA A;  3NG8 A;  2XS7 A;  4I6Y A;  4LFA J;  1IQT A;  2IBK A;  3J7A N;  4I2Q B;  3TVY A;  1QAJ A;  4MYU A;  2ZH9 A;  1F5A A;  1OPI A;  1XEZ A;  4KT0 C;  1SJ4 P;  4K4U A;  3THT A;  4BBY A;  1G3O A;  4ZVR B;  3CMQ A;  3BN4 A;  5KG4 A;  2V6A A;  1RAD B;  2QRR A;  2YKN B;  4PAB A;  3NEK A;  5KG3 A;  2BAB A;  1H73 A;  3MPV A;  2JEI A;  4U8Y A;  1BC6 A;  4ECX A;  2C3Y A;  4CH7 A;  2AT1 B;  2LXI A;  1U1R A;  4DUT A;  2LDY A;  3MAH A;  2YVS A;  3I5C A;  2GVD B;  1CVJ A;  4DV6 J;  3KLV A;  3AD9 C;  1XNQ F;  2F4V J;  2UZA A;  2LKZ A;  1FRH A;  2EFO A;  4OX7 A;  3RBX A;  4DFK A;  4ZHR A;  4DMZ A;  3CDA A;  2QL7 B;  2I6W A;  4ZVF A;  3BN7 A;  4DUY F;  4LF9 J;  2CQ4 A;  1AUS L;  1CJK B;  1W26 A;  3E2E A;  1RHJ B;  3EE3 A;  2AYG A;  4ZJQ A;  1KOO A;  2AEF A;  5F41 A;  3H5X A;  1ZM4 A;  1KKH A;  3RB6 A;  1TQL A;  4U6P A;  4LIW A;  2YX7 A;  3LGH A;  1CQN A;  5A76 A;  3RRH A;  2HYI B;  4RO0 A;  1V6H A;  3MAA B;  2WZ1 A;  5IXU A;  1N36 J;  1LWE A;  3DRS A;  1FRL A;  4OFZ A;  1U48 A;  1BY9 A;  2J0Q D;  2B8Q A;  5KFM A;  4YR3 A;  2JRS A;  3IO1 A;  4B3S J;  3C6U A;  3I87 A;  4USV A;  3FFI B;  1NJI T;  2HHW A;  4PQU A;  3K7R A;  2OPQ B;  3CJQ A;  5C5J A;  3W66 A;  1MU2 B;  5C2C A;  4UOH A;  4N41 A;  4BLG A;  2FGC A;  2GFF A;  2AJ2 A;  3BM7 A;  2ZFH A;  3MMC A;  2MLX A;  1GMU A;  1SV5 A;  2AEJ A;  2NPF A;  2Y0B B;  5G4D A;  5HK4 A;  3IRX A;  1JJ2 R;  2NLW A;  1VQ5 S;  3FMB A;  3ZZO A;  4Q5V A;  4H4K C;  2WK4 A;  2XMK A;  1KLM B;  1HR0 F;  4NPO A;  3MUR P;  2MQP A;  2XMV A;  4DF8 A;  4FVM A;  1S1T B;  1FXL A;  4QQB A;  1FNO A;  3LGN A;  2RH3 A;  4WFX A;  4TXS A;  1XBW A;  4UUX A;  2CA9 A;  1U1Q A;  1B0V A;  2MKS A;  3M30 B;  4DSI A;  4RW8 B;  4RW9 B;  5GAD U;  5HP1 B;  2R9L A;  1X9M A;  4WE1 B;  1BWV A;  3MI7 X;  4ECW A;  2DXE A;  4KBI A;  2XG8 A;  3DM2 A;  3EGN A;  3GON A;  4AL5 A;  4DZ6 A;  2HS0 A;  2LQJ A;  1XNQ J;  3P4U B;  1RJJ A;  2YNF B;  5BYS A;  4CWB A;  2CDR B;  2HZA A;  5AT1 B;  4MK9 A;  4P71 A;  1PAU B;  4GKJ F;  4ZK7 M;  1S76 D;  2QMW A;  1ZOT A;  3C16 A;  5C24 A;  1VGY A;  4X64 F;  3A4T A;  5HJY A;  2VKR A;  2G0C A;  2R2U A;  2R7S A;  4H4O A;  1VC6 A;  3ZTQ A;  3KLF A;  2V67 A;  4NXM F;  4CQ1 A;  4DV2 J;  4ZPB A;  4DV4 F;  5J1N A;  4PR6 A;  1U2C A;  1NSA A;  4YP3 A;  4N76 A;  3ITH B;  2O01 C;  4C0H A;  1IJF B;  1FRJ A;  1RAI B;  1VRQ C;  1EAY C;  2CQ3 A;  1HW8 A;  5A2Q Y;  4ZN3 A;  4UQG A;  1RSC A;  4MKV A;  4WU2 A;  5LT5 A;  1RWU A;  5EWG A;  3RR7 A;  3A13 A;  2XGP A;  4JI3 F;  4RL1 A;  1TEL A;  5F8I A;  4JI7 F;  3WZ0 A;  4K4X A;  3QGI A;  3DDI A;  3JSR A;  2MZ1 A;  2GHW A;  5JJB A;  4ED1 A;  1WDT A;  1LXN A;  2P8I A;  2FQQ B;  2JEG A;  3J80 U;  1V9O A;  3JSY A;  2HFS A;  3NOC A;  1HQU B;  3QZ8 A;  3HHD A;  2EFG A;  1HR0 J;  4D3G A;  2E5L J;  2DIT A;  1GH8 A;  3HHK A;  1JX4 A;  2PT0 A;  3OHB A;  1HNI A;  3M2U B;  1TKT A;  1SKR A;  1VBX A;  1RTH B;  1Q8I A;  2RS2 A;  2N7Y A;  4ZLP A;  4JOU A;  5HRO A;  1U25 A;  2VPY B;  4A8Y A;  4FYW B;  3QPI A;  1O0P A;  3TJA A;  4F4X A;  2CPY A;  2VOD A;  1NAQ A;  3NBP B;  1UZH A;  4DN0 A;  1TKZ B;  3KJV B;  4DLG A;  3T9N A;  1YJU A;  4CO3 A;  4Z7C A;  2MQM A;  2DGQ A;  1QVG R;  4O44 B;  1MN9 A;  2I5J A;  2HQC A;  4LSL B;  4MFB B;  2XI2 A;  3G82 A;  2NXN A;  4QZV B;  4GKJ J;  3BBB A;  3TA2 A;  1R0B G;  1X5T A;  3BQ0 A;  1TKX B;  1SC3 B;  3RB3 A;  4OI4 A;  1S1V B;  3IAS 9;  2W7P A;  4A8W A;  1D1U A;  3QRR A;  3PFO A;  4PXE A;  4OX8 A;  4R8U B;  4NA3 A;  1WNE A;  1HWJ A;  1EIY B;  1NJX A;  2D1C A;  4DPU A;  2HIY A;  1BD6 A;  2ILY A;  4PRF A;  4NXM J;  4K5S A;  3W9J A;  1NDP A;  3NWG A;  2UVV A;  3C14 B;  2CYY A;  1IN0 A;  3RGI A;  2KXF A;  3IG1 A;  2IJF A;  3TX0 A;  1JK9 B;  3W62 A;  1UWB A;  1AXQ A;  3AOD A;  4DUZ F;  5DGA A;  2ZBC A;  4JI3 J;  2N7C A;  4CLZ A;  4HHJ A;  4M94 A;  5ETM A;  4JI7 J;  5GAH U;  3OR2 A;  2KO1 A;  3MEC A;  2DNZ A;  2FUG 9;  4B9V A;  1YZ6 A;  4U7U D;  1FI4 A;  2HPU A;  4C7Q A;  3QRP A;  1T9V A;  4QBU A;  1XMO J;  1B4S A;  2PI5 A;  4FF4 A;  3M32 A;  4CLU A;  3GU0 A;  3H4D A;  5ETP A;  4W92 B;  5FJ4 A;  2E1M C;  3H2U B;  4PWW A;  2XC9 A;  1SB6 A;  2PDA A;  2QA4 G;  5KFA A;  1FCA A;  2FJV A;  2ATL A;  1G7C B;  2EBG A;  5KFK A;  3H5U A;  1C1B A;  2EFV A;  3QJJ A;  4URG A;  2FGO A;  5H9F J;  4ATN A;  3JAM U;  4PXD A;  2GZO A;  3DHX A;  4N77 A;  1YQH A;  2GAH C;  2E1C A;  3NRB A;  3NGU A;  3KHL A;  1YRU A;  1W7W A;  2J7U A;  2MLZ A;  3BSC A;  3FGV A;  3CUL A;  4X62 J;  5KFZ A;  5I3U B;  2HQD A;  2JEJ A;  1P9Y A;  4ZCM A;  3MM7 A;  3POT A;  3C46 A;  1NJY A;  1SH2 A;  2ZH6 A;  4ED0 A;  2WB1 D;  3VAM A;  4HYK A;  4DF4 A;  2ZKU A;  4WXW A;  1RIS A;  4EGL A;  4WJB A;  2DH7 A;  4XDC A;  4DV1 F;  1TK5 A;  2RUS A;  3JQJ A;  3SCI E; 
#chains in the Genus database with same CATH homology
 2UXB J;  1FJG J;  1HNW J;  4KHP J;  3J80 U;  4OX9 J;  4YY3 J;  4DV7 J;  2MEW A;  1IBK J;  4B3T J;  4JYA J;  5IT9 U;  4X66 J;  3D3B J;  4K0K J;  2UUB J;  4JI5 J;  4LF9 J;  2MTL A;  4JI0 J;  1HR0 J;  4AQY J;  2E5L J;  4DR5 J;  4HHU A;  4NXM J;  2VQF J;  3R2C J;  4B3M J;  2MQ8 A;  5LMN J;  1XMQ J;  4DR1 J;  1IBL J;  5LMU J;  4GKK J;  5BR8 J;  4JI2 J;  4LF4 J;  2UUC J;  4DUZ J;  2UUA J;  4JI6 J;  5IWA J;  4DR6 J;  3JAM U;  4DV2 J;  3W1Y C;  4JI8 J;  4NXN J;  1HNX J;  4YHH J;  3J81 U;  2UXD J;  4DV0 J;  4DR2 J;  4LFA J;  4DV5 J;  4JI3 J;  3J7A N;  4V1A k;  1IBM J;  4B3R J;  1N36 J;  2HHH J;  4JI7 J;  2ZM6 J;  4RJV A;  4X62 J;  3IMQ J;  4LF7 J;  4LF5 J;  4KYZ A;  3OTO J;  4DR4 J;  4LF6 J;  4LFC J;  1HNZ J;  1N33 J;  2KVQ E;  2KL8 A;  5A2Q U;  4X64 J;  4DV3 J;  4JI4 J;  4DV1 J;  4DUY J;  1N32 J;  2VQE J;  4B3S J;  3D3C J;  1XMO J;  2UXC J;  1XNQ J;  4KY3 A;  3T1H J;  5FLX U;  4GKJ J;  2UU9 J;  4JV5 J;  4X65 J;  3T1Y J;  4NEY A;  4JI1 J;  5AJ3 J;  4DV6 J;  1J5E J;  1XNR J;  2F4V J;  5LM7 E;  1N34 J;  4NEZ A;  4DR3 J;  4DR7 J;  4LFB J;  4PWW A;  1I94 J;  3R2D J;  4DV4 J;  4LF8 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...