2UXCJ

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 2uxcJ00
2UUBJ 2UU9J 5IT9U 1N32J 2UXBJ 4K0KJ 4JI4J 4RJVA 4YY3J 4JV5J 4B3MJ 3D3BJ 3JAMU 3R2CJ 3D3CJ 5A2QU 4JI5J 1XNQJ 4GKJJ 4DV2J 4JI7J 4B3RJ 4X66J 4GKKJ 3J80U 5FLXU 1XMOJ 4X65J 3T1HJ 2KVQE 1HNZJ 4DV6J 4LF7J 4DUYJ 4DV5J 5LM7E 4NEZA 2F4VJ 4HHUA 5LMNJ 2ZM6J 4LFCJ 4X62J 1IBLJ 3J81U 1N33J 1I94J 2KL8A 4LF6J 1XNRJ 3T1YJ 5AJ3J 4DV3J 2UXCJ 4DR5J 2VQFJ 4LFBJ 5BR8J 3R2DJ 2UXDJ 4DR7J 4DV0J 4NXNJ 5IWAJ 3OTOJ 4LF5J 4NXMJ 3W1YC 4KHPJ 1HNWJ 4YHHJ 4LF4J 4LF9J 4OX9J 1N34J 4B3SJ 2UUCJ 4DUZJ 1HNXJ 4JYAJ 4DR2J 1IBKJ 1XMQJ 4JI2J 5LMUJ 4JI6J 4DV7J 4KYZA 4X64J 3IMQJ 1N36J 1IBMJ 4KY3A 4JI0J 2MTLA 2HHHJ 4B3TJ 2MEWA 4PWWA 1J5EJ 4JI8J 4LF8J 1FJGJ 2E5LJ 4DR1J 4DV4J 1HR0J 4DR4J 2MQ8A 4DV1J 4NEYA 2VQEJ 4DR3J 4JI1J 4V1Ak 4LFAJ 4DR6J 2UUAJ 3J7AN 4JI3J 4AQYJ
chains in the Genus database with same CATH superfamily
3H4BA 4ZIWA 4ID8A 3BQ1A 4HACA 2ZWOA 2OTJS 3KHRA 2GVZA 1AT1B 1HHTP 2E9ZA 2JX2A 2KT3A 2AJ0A 1RTJA 2FVRA 2AD9A 3K8VA 1KR4A 2VBZA 2F40A 2D9PA 2IJFA 3ZNUA 1IQZA 2OD4A 2CNLB 3R7BB 2OPRA 4YR3A 1SJFA 1RYSA 3BV8A 3LWLA 1U0HA 1RTDB 2DXEA 4Q7AA 4P9SA 4P6QA 2EC0A 2MGZB 1FKPB 4DN0A 2QEXS 1EB0A 1FXLA 3GYNA 2V4RA 4R25A 3PM9A 2UUCF 1WWHA 4C7QA 4C6AA 1R0CB 3AD9C 2PIIA 5HK4A 1JNRB 4LSZB 5HANA 1XMQJ 3AAWB 2HURA 2GCFA 2QZ8A 1RQ0A 3MHYA 2HHHJ 3TA1A 1LW0A 3ZTSA 1RWWB 4OX6A 1S99A 3K5OA 1RHUB 4DL2A 1AW0A 5CH7B 2WW8A 5KT5A 4ED5A 2IC3B 2DCLA 2ZJQQ 1BQMB 3PYFA 5L9NA 3FRZA 1D0EA 2K7KA 3PJXA 1YZ6A 4IH7A 5CXTA 2HMIA 3GIKA 3U1LA 2VICA 4X4QA 4TY9A 9RUBA 2KG0A 2RDIA 3LP1A 2XMMA 4O0NA 1OO0B 2ILYA 5F8MA 1OPZA 4NLTA 4U96A 2XMKA 2IM3A 1FRXA 4DX7A 4DG1B 4A47A 3QO9A 2JVRA 3BGRA 3T1AA 3A12A 5AT1B 1SBRA 1HNWF 4DR7J 2E44A 2R7SA 2J7WA 4Y2AA 5BYQA 1R89A 4B9TA 3CJ8A 2RUGA 4H54A 5L39A 2MZ1A 1KDNA 3WC2A 2KJVA 2BA9A 4P2MA 4B3TF 2PSZA 2M88A 3FFIA 3D1OA 3SQGA 3DLEB 1P1TA 4NI2A 1X31C 1EKRA 2CNNB 4I6WA 2DTJA 5T41A 4EO8A 4PG8A 4R0JA 2CVEA 4H4MB 2O3DA 2HHTA 1VQLS 2Y8YA 2FHJD 4IRKA 4JI3J 2ZITA 4Y2KA 1Q8LA 3C6UA 2OMOA 1S0OA 1JLFA 2K7JA 5KT6A 1TK8A 1XMOJ 2J6SA 1FKPA 1R31A 2LQJA 2CAJA 4IG3A 4PYAA 2R9LA 3KK2A 1FERA 1VYAA 2AZ1A 2ZHOA 2DH8A 4DUTA 2CQ0A 2VB6A 5CAAA 1IUJA 2OPQA 2HNDA 3ZC4A 5F0WA 4R5PB 1U1QA 1Q82T 4FN5A 3WIVA 4I4BA 4LF4J 2LEPA 2V4QA 3RW7A 3PIOQ 1UJ4A 4I2PB 3VAFA 3HHLD 2QO3A 2CJYB 1R6YA 3KNGA 4IOAQ 2FLPA 1Q81T 4DR1F 1Y5LB 3OQ2A 2CRLA 2C28A 4F0HA 2AJFE 1RLDA 1G1XA 5F8JA 1TL3A 1SIWB 2C3YA 2WSCC 2AP6A 3FQKA 4DFJA 2R7RA 2B9EA 1IQTA 1VIXA 5C42B 1WC3A 2XNQA 1FNMA 3QRRA 2O01C 4I0WA 2AU0A 2L9WA 2FZGB 4WE1B 4YR2A 4ZVSB 2ASDA 1NKCA 4A8FA 1S1WA 2AW0A 2ZWPA 4ZS6A 5T7LB 1QE1A 2VA2A 3DM2B 4IQMA 2Y9HA 2C2KB 3QSIA 2FD2A 3QGPA 1PYSB 2XNRA 1EIYB 3BKTA 2BM0A 5LSRA 4MKVA 4UUWA 4CLPA 4GVBA 4PZVA 5F3ZA 1L3KA 1SC1B 5L46A 4JI6F 4TN2A 2H54B 5KG1A 1REVB 4KGXB 3SIPB 3HSGA 3CJKB 1KOOA 2E7WA 2MKSA 3KLGB 3NMAA 1FI4A 3JAMY 5F9LA 1KVKA 2UV8G 4G1PA 2KM8B 5FLXY 1VC0A 3CCJS 3PACA 1Z2LA 3RG6A 5L1IA 3K57A 4KGMA 2DGWA 4ER8A 5AXNA 5B0DA 1KQFB 2ZFHA 2CQGA 4A8QA 3TNVA 1IBCB 1IR2A 1JJCB 1WI6A 3EICA 2D9OA 4E98A 1RCOB 2E5IA 1VI7A 4P2FA 4LFCJ 2KYZA 3GCWP 3VAJA 4ECQA 1RTIB 2HS0A 3ZZOA 3QT6A 3RAXA 4QWDA 1AROP 1FFGB 5FIIA 2MHNA 3FBEA 2JWNA 3AY0A 4OHWA 4DUZF 4NCGB 2CJQA 2FZCB 4DHVA 2OELA 3D7SB 2YKPA 1JXVA 4OLOA 2QA4G 2LDYA 4RO0A 4Y6IA 2GQQA 3U7JA 1X9SA 2G1HA 3G6XA 1RA6A 3DRYA 2V0NA 3MAHA 3RB3A 3RAQA 5CQGA 5I3UB 5JVGQ 1WC4A 1ZAWA 1HMVB 2N82B 2GFFA 5D0RA 4W92B 2ZH1A 3PW5A 3EXYA 1DQAA 4U6PA 5CD4H 1L3VA 4DL7A 3DRXA 3TUJC 5HJXA 2VPWB 3TX8A 4ED7A 1X5SA 1SB6A 4ED1A 3CCMS 3CGIA 2W9BB 1NJIT 4KR0B 4MYTA 2QC3A 1M5KC 4C8YA 4IO9Q 2MKKA 2C2RA 4K8RA 2FB0A 2EKYA 2UXCF 1H2TZ 3SFGA 1R6VA 4NMXA 1XNRJ 5AJ3J 1X4BA 4KC5A 1WNEA 3ET6B 1ZA1B 3T9NA 1QAJA 1VS3A 3UCUP 4B3SF 4EUVA 2DD8S 2VH7A 2F1FA 3B78A 2B3TB 3DOMA 4XAKA 1EZZB 5J2PA 1EETB 2AKWB 2P9EA 4QCLA 4DLEA 3HX9A 4KY3A 4TYBA 1FK9B 5CYMA 3IR7B 2XSFA 5K8PA 5KFRA 3J80Y 3TA0A 4ZP6A 4C11A 3AD8C 2YNFB 1OS5A 4F3QA 2ZM6F 5GMEA 2EFVA 2VUGA 2PD1A 4C0OC 4B3MJ 3D3BJ 2HNZA 3CJQA 5ETPA 4DL4A 5E5NA 3D67A 1G7CB 4UUXA 2YKNB 2XGPA 3GWCA 2QLWA 3K5LA 1DTQA 3R5GA 3LPEA 2LP4A 1VBYA 4RW7A 2XCPA 1NKBA 2EBEA 2BJEA 2M7SA 4OZNA 2IDEA 5FDLB 5DDRC 2QYCA 4NZ0A 4NMLA 3W5YA 3IWLA 3KHHA 1Y7PA 3HHLB 2DNRA 1Q53A 2WOMB 3DCAA 4IDKA 2L41A 3W1YC 4BHQA 3BBCA 1U48A 4JI2F 3M8RA 4P7TA 1UVKA 1WF0A 4J9OA 4DV7J 4M5MA 1WTFA 5I3QA 4NRUA 1HR0F 3EPIA 4USWA 3NGTA 1KVIA 3NS6A 4OYPA 3NCPA 1S72S 1NRKA 5H9EJ 4W4MA 3J7A1 3JSYA 4LSNB 3N79A 4DBQA 2OIHA 4GRSA 4DL3A 2YX7A 1AZSB 3CCVS 3V81A 5BYRA 3LO3A 2DRDA 3G82A 2IYGA 4CTAB 2KM8C 2DXFA 1FJEB 1QJHA 4RX6A 2AJ1A 3FSIA 4X62J 4G1IA 3FC9A 4N8NA 1FESA 1HARA 2FGCA 2NSBA 2ZH4A 3KLFB 3F56A 4K7QA 4K5RA 2N3OA 2LQBA 4OI4A 2MDAA 4EEYA 4ES3A 3OLBA 4O3QA 4KPCA 1JQGA 3MM5A 2PDAA 3TA2A 3DOLB 4M5DA 1HI8A 1A0OB 1RABB 2YNFA 4TLRA 4BS2A 3CCES 4X64J 2Q66A 1M0SA 1FD2A 1RT2A 5H9FK 1R43A 2W7OA 4BWMA 4FXVA 3V6DA 3K2YA 4AL6A 2I38A 4I6AA 1RAEB 1SJRA 2ZE2A 5J2NB 4TXSA 4X4RA 5KFCA 3D6TB 4Y0FA 2X3GA 2GA7A 3ENVA 5FD1A 4RNHA 3LP0B 1TKTA 2DCUB 2W2NP 5C24B 4IH6A 1G6BA 2ZVSA 3TVKA 5FDLA 2F4VF 4AXJA 3RRKA 1FF2A 5KT7A 1NHVA 1RHKB 1C0UB 2IM0A 2OGUA 1L3TA 1QUPA 4UY85 1C1BA 5MAOA 1WEXA 1RT3A 1TL7A 4FYDA 5M2RA 4F4WA 3QBCA 4NLUA 1SH2A 2BRKA 3QPIA 3ZZUA 1FDAA 3GLJA 2XC9A 4QIFA 1VC6A 1NK7A 1HNXJ 1UMJA 4FS1A 5G4DA 2RHQB 3AH6A 1SC3B 5IC6B 3GILA 2ADCA 2YWHA 4OX7A 4BC9A 3MAQA 2G9OA 1W7WA 4F2SA 4OX8A 3I32A 2B4OA 3I5CA 2A10A 3UD5A 4DZ6A 3MEKA 3I0SA 3I4PA 2V68A 4M63A 1RWXB 2OFGX 4RR5A 2B4PA 4AD6A 4NYOA 4K0KJ 3D66A 3HO1A 1SXLA 1TTHB 4B9VA 3BPDA 2GHVC 1C1CB 2FQQB 2I0XA 1CC7A 2BR0A 2DNNA 2F8EX 5H1SV 3O3LA 1VMBA 4NPOA 1RYRA 2HQGA 4L6V3 5DDPC 1XTZA 1QSSA 3DOLA 4NOHA 2KU7A 5IM0B 3BQ0A 5C5JA 4N41A 3MM9B 1P8GA 2XEXA 4LRAA 2LYVA 4TNOA 4OQJA 2P9CA 4USHA 1I1GA 4HYKA 1UWBB 2ATCB 1OY9A 2B7BB 2BW2A 3BO3A 3FCVA 2B0GA 2IVYA 1NDCA 3HHLC 2W2QP 4ALZA 2D3UA 3N0VA 4DJBA 2UUBF 5KG0A 1H2VZ 1FO1A 3M8QB 5IS2A 2GGPB 1Q8IA 1FT8A 1NXIA 1C0UA 5D3GB 5GAEI 4J9KA 2FJAB 3PO5A 3RAMA 1X7VA 1GX5A 2L9DA 1D9FA 3CW2C 4EBCA 3AQPA 1VBXA 2BV3A 3EDRB 2EFGA 3K8WA 3TQEA 1U2FA 2IMOA 3BO4A 3KTQA 1VRTA 3TUIC 3RR7A 2V2QA 2KZMA 3DXBA 2WONA 2FDNA 2EC2A 4EWTA 4WFYA 1JMTA 3PV8A 1JLAB 1N54B 3IRXA 3P5BP 3MOJB 3R5DA 4M94A 3WHIA 5T14A 1TUGB 1B4SA 3FK4A 2MY7A 3CO0P 1HBOB 4ITSA 5KOWA 4K2XA 4YY3F 3HZEA 2B5JA 4OZJA 2IFXA 2UXBJ 2XG8A 3Q22A 1Q4RA 3JQJA 3KXDA 3ULHA 2YQ3A 2XLKA 3PKMA 4NXNF 2M52A 3LP2B 4QIGA 4HR2A 4B9LA 2QIFA 1YBUA 3DLKA 3MM9A 5G0RB 3A1YG 2BE2B 1PO6A 2ROGA 1LV5A 2JJ4D 2IRUA 4UT4A 1RBOB 4QYRA 1LFWA 2P9GA 3SV4A 1MMLA 2DHGA 4O3SA 3O2IA 3ENWA 3M2UA 4WFAQ 1JLCB 2NPIA 1TL1B 3NOGA 2VG7A 3MPYA 2KT5A 4HH0A 1CBKA 2XULA 3EUNA 4CLFA 3TZWA 1LKZA 3EGNA 1TKZB 4ZIVA 2P2CB 4LVNP 4FF3A 4HEA9 3I5BA 2AEFA 5AXLA 2ZUGA 2VBXA 3AXMA 3PX4A 2V67A 4J9NA 2G2ZA 1BMQB 4DX6A 5DG7A 5F9NA 1FRIA 1GH8A 1PGZA 4PCQA 2DISA 4ECYA 3CNQP 5A8WA 3CPWR 2WRMA 2CA9A 4H4KA 1CLFA 4YB5A 4BC7A 2RQ4A 4NLYA 4ZVHA 4URSA 4KH1B 2Z56B 3KLEB 3K0JA 5IC4B 2RDJA 1GMWA 3PFOA 4RPFA 4XTTA 5KFJA 1VQMS 5KFZA 2W9CB 3I0RB 5KFPA 4RW9B 3FMWA 4LR9A 4E2FB 5HVGA 4TQRA 1HNIB 4HHJA 3L4BC 1NHKL 3AA8A 3TZYA 2IYIA 3G86A 4QU6A 3WZ0A 4IRCA 5ETKA 2OTLS 1IBMJ 3FRYA 1X9WA 2VC0A 5F8IA 3Q24A 3D2WA 2ZZMA 5L1JA 4UQTA 3PW7A 1KWMA 2AGQA 3LUYA 2KTQA 4OYZA 3PRVA 1N5TA 4PG4A 5SZTA 2J8SA 3BYRA 1FRLA 2CG4A 3GFYA 4A8WA 1VK8A 1ZYQA 3D1HA 1CQMA 2AYBA 3CJTA 2J9CA 3UVJA 1TV6B 3LALA 1WG5A 3KYLA 5A8KA 1S1TA 1W2IA 1N5YA 3QZ8A 3MGJA 4DL6A 1SV5B 3NG8A 3HDSA 3M32B 4LF7J 3OR1A 3M6XA 4HTIA 3HHNB 3X1LB 2G1DA 2E7XA 3S8SA 2DPIA 4X4TA 1VK3A 1UFKA 2KXFA 3DDKA 3W60A 4Q5VA 3NRBA 1CJVA 2NXEA 1PILA 1AB8A 3HKZD 3H2UB 3QJLA 2O1PA 2QG9B 5EWGA 2IA0A 1OSCA 2DNGA 2QT7A 1FRKA 2VBYA 1FVQA 4I68A 1XK8A 5JVHQ 4CO1A 1OQ6A 3MTJA 4FYWB 4LF8F 2ZJRQ 1N36J 5C2CA 2GMLA 5DETA 4KO0B 3MPDA 2YNIA 5D77A 3OFGA 1HNVA 2DH9A 1MROA 4Q43A 3PZPA 3DOKB 2WCXA 4OL8A 1WTBA 2HQ3A 1NSAA 3OUYB 2CPJA 4CLUA 3O6QA 2VC1A 2W25A 3JYTA 3UR0A 5LMNF 4KHPF 2C2DA 1PBUA 3IO1A 5KT4A 2GC8A 4FKXA 4NA1A 4N56A 2ZOFA 2LCWA 4NASA 3IM8A 3GONA 3DLLQ 1S6QA 4KV8A 4ZN1A 3MXHP 1BC6A 2G2OA 5EGYA 3VAIA 2DKOB 5AE2A 2DNKA 4CIOA 5A76A 4MJKA 5KFSA 1X0PA 1FFWB 2M8HA 2MZRA 4LRBA 1DQ9A 2CPYA 3KFWX 2XM3A 2DJWA 4DR4F 3W62A 1R8HA 1WDTA 4C3MA 1Y3JA 4NZ6A 1Q79A 3CJ0A 5CCMA 5GAHI 1ZETA 1F9FA 3JQKA 2XMWA 1UCNA 3OTEA 3ISND 1SV5A 3M8PA 1PJ7A 3TARA 2ZHAA 1QD1A 3BN4A 1CULB 4PYDA 1SKUB 3DRRB 3W8PA 4M5LA 3UPFA 3S1TA 1TZ0A 2RS8A 4CO5A 3DRSA 2I2YA 2V8PA 2YWEA 2D7SA 3I56S 5E3QA 2P8IA 1TKDA 1UJ6A 3Q8QB 3MTKA 3MD3A 3DMJA 3H59A 1K73T 2EG1A 3NGRA 3FNNA 3Q83A 2DY9A 2LKZA 4RW8A 2JH3A 3SI8A 2WVFA 2CNOB 2MHEA 3MF5A 3DKDA 2NUHA 4QR1A 4UZBA 1D9AA 1U02A 3KUHA 3KK1A 3H5SA 4FNHA 2Q1LA 2Z57B 2IAJB 5DGAA 1RAAB 3WC0A 2U1AA 4ICLB 3VAGA 1HQUB 4DV4F 2A2CA 3MD1A 3O5TB 2OSQA 1UPPA 3IR6B 2BOPA 4LBPA 4Y28C 1SVDA 1S1VB 4MFBA 2LFVA 2W9AA 1URRA 2IRYA 4JV5J 2AWZA 3M30A 5D4LA 5ETTA 2XY6A 3AJ2A 2UP1A 4PQUB 2HZAA 1VQPS 1RADB 1RHQB 2CPXA 4ECRA 4RNMA 2R8JA 2B4UA 2VDHA 3H90A 1TU0B 2ZM6J 1RT1B 3BSNA 1KNZA 3CF5Q 3BM7A 2LVWA 2HS4A 2ZC3A 5B0BA 2BUNA 4J5OA 1T3NA 4ID5A 5KFAA 4NLRA 3J7YI 2VQFJ 3FJ2A 4PPDA 4ZJQA 1VLOA 2CZVC 2CXEA 4F25A 1JWWA 5A2QY 1BWVA 1FRHA 1R8AA 1U26A 3M2RB 2Z4PA 2LECA 4TVAB 3MM7A 4AUKA 3S01A 2D69A 5LMUJ 4J9SA 3PW4A 3NBPA 1F3VA 2W8KA 1FJGJ 1T05A 4QYZJ 4DR6F 2I5JA 3LAMA 2F9DA 4C8LA 3H5YA 4JUZA 1S76D 4ZLJA 3PR4A 1U6ZA 4ZP9A 2DO0A 3DHWC 4Q2MA 4LF6F 3IN5A 1U1PA 1X5PA 1RHRB 4MIAA 3CSKA 3MCOA 1NH7A 4RNOA 4HVZA 4MIWA 3NKYA 1V5VA 3BGOP 4CP5A 1Z4UA 2ZBCA 4NLSA 1BGXT 2FLOA 1KRPA 4HKQA 3BH6B 3HSDA 4OIXA 1O5JA 3JTPA 2Y1IA 1JLEA 3PX0A 5BJRA 4ICLA 5K14B 4OX9F 3UN3A 1UL3A 3GSIA 4LMZA 4YP3A 2WHOA 1ZM3A 2VL1A 3GV7B 4DS5A 4FF4A 3A4TA 3CIMA 1LWFA 2FC9A 1N5QA 4IYQA 4ZLNA 3MR5A 4ILMA 2FY1A 4PG7A 2KKHA 4OHVA 3VGVA 1S1UB 1GT8A 3FCWA 2YQ1A 4M5KA 3KUEA 4WFZA 4C3KA 4IFVA 5J2QB 3VVTA 1RU2A 4RUBA 2PE8A 1GTEA 3GFHA 3KLHB 5HQLA 3TQ1A 2RE1A 4DUYF 2V4JA 2FJXA 2R7VA 2QTWA 3WDOA 3T9ZA 1IBLF 5KAKA 3TUZC 4ECWA 3GMGA 1UVJA 4K4WA 3M1VB 2QSFA 1X4AA 2BQ3A 3FBCA 1AXQA 3HI9A 2DNHA 5LSOA 4KT0C 3E01A 2HWIA 4DQRA 2K8GA 2QGFB 4Z37A 3MUVP 2FVCA 3NWRA 2YPZA 2KO1A 2HBYB 2XYPB 1CVJA 1B0TA 6AT1B 1KQGB 5L1LA 3QRQA 2NUUG 3NAHA 2H5JB 3PEHA 3KOAA 2E5JA 5AXMA 3VALA 4DMZA 4LRFA 4Q8EA 5HVFA 4YB1P 3THTA 5ETNA 4OYBA 5DZ7A 2FY8A 4JV0A 2OPSA 3DGPA 4JI5F 4KBIA 1RAOA 4U8VA 4KFBB 1KLMA 1LXJA 4R8UB 3VZHA 2EFQA 1DHMA 2UVUA 3FBBA 3DLHA 1IKVA 5D6GA 3FDSA 1QSYA 4WU2A 2YWGA 4WIIA 4CYUA 1NMEB 3PIPQ 2HYIB 4LF5J 4NXMJ 4D3HA 3R1LA 1RWUA 2EW9A 3M8YA 1HQEA 2KXNB 2DXDA 2BE9B 3TVYA 4O44A 2WSFC 1Y00A 3BR8A 4BLGA 2QL5B 1EP4B 4OJ3A 2B51A 4A48A 1FWPA 1RT6A 2ASJA 3SSQA 1RT4A 2DIVA 1WSRA 4L73A 4RBTA 3ITHB 1TFYA 2DR7A 2OLWA 3D0IE 2D3O1 1K0VA 2UU9J 1F9EB 4GKKF 3J81Y 4F3MA 3ONQA 1SKRA 1K8AT 2ZUAA 2HHUA 1CJTA 1RK8A 1FJCA 2JZ5A 4M95A 4FBTA 1N33J 2QMXA 3F41A 4RLEA 2B43A 2WAQD 1NSKL 2RS2A 4FPIA 5IWAF 3KJVA 4RNNA 4DR5J 1G2EA 1VBZA 1T03B 5IV3A 4UY8T 4LSLB 3IR5B 4EU0A 3IG1B 3RJMB 1N34J 2EG2A 2RUSA 5CYQB 4P2SA 1AA1B 3DI6B 2PI4A 4Q0BA 2HQCA 3CDAA 3WBZA 2E9TA 3GG1A 2HQFA 2J9DA 1S1XA 1RTHA 1LNQA 4RW4A 2J0SD 3DYAA 4B3OA 1HL6A 3KMQA 1DTTB 3FGVA 2LQ8A 4IG0A 2Z2MA 3THVA 1N32J 5A2QU 4DV2J 1X0FA 1V6HA 5KFMA 1UW9A 1FXDA 3CDEA 3VV2B 1MMNA 3KWMA 2RF2B 1OY6A 1KQSR 5IZHA 4KGKA 3PW0A 5A0YA 1JK9B 3DFEA 2V6AA 4USVA 4H4OA 1VC5A 4DPOA 2GNKA 2WB1D 3POTA 5BR8F 1SUQA 3MEEA 3HP6A 2B7CB 4I64A 2ASYA 2ZDPA 5L9XA 4DPUA 2FPHX 3AD7C 4NXNJ 1SIZA 1F9HA 3MEDB 3MZIA 1EP4A 5D0EA 1FEEA 1FEHA 2HIQA 3C6TB 2KRBA 4CM0A 1LWXA 2DO4A 1U1NA 1RHJB 3BGLA 1M5SA 2YNHB 3U27A 1H7XA 4OLPA 4WZMA 4GO5X 3W2VB 4X4PA 3ITHA 2U2FA 7AT1B 3UNYA 2C2MB 3HXMA 5IT9Y 3TX0A 3T41A 4J9LA 2MQ8A 3KK3B 3BSCA 3CUNA 5KFFA 4ANEA 2WK4A 1JLBB 3SXLA 2V9WA 3MMBB 2XQCA 1E6YB 4MH8A 1Y4ZB 2IVFB 2MKJA 1RLCL 1UP1A 3ISNC 2V8DA 3A3NB 3PHTA 1RKJA 1UFWA 3SZ2A 1OQ3A 3ELHA 1Y9OA 2DEJA 3DI6A 4DZDA 1B64A 4F36A 1X4CA 2FHOB 2YH1A 1D3WA 3TAMA 3FVYA 4O0IA 1HBUA 4WP9A 1B7YB 1IJEB 2Q79A 1AUDA 1X5OA 4CO2A 4DI6A 4EBEA 1RWNB 2UUAF 2ZBRA 3KLIB 3LGHA 3WQPA 2PI5A 1IKXA 2VFRA 5LT5A 2W2MP 1DBDA 2GZOA 1VIOA 2C22A 4A4JA 1Q78A 2DNQA 1TKXA 2B9YA 1WHYA 3HSZA 2B6AB 5DQGA 2AT1B 5IT4A 3OL6A 1C0TA 4DSLA 4FBUA 2VG5A 2AYEA 3CO9A 1WORA 1U8WA 2QL7B 3ZZYA 1WDDA 4JI7F 1FTRA 4DWIA 1R0AA 2ZH7A 3QGHA 5E3PA 4X65F 3PW2A 1QTMA 3TJ9A 2F4FA 4G65A 2QA1A 3R9LA 3UQSA 1SJ4P 3OTBA 1AFJA 1VQ7S 3EVOA 4DV5J 3UN5A 2NYIA 2ZD1B 2MQOA 2ERRA 2E1CA 4Y2IA 4JOUA 3HFKA 3CMAS 2HVHA 5IT0A 3T1YF 3MM6B 3L09A 3RUBL 1S5ZA 5J1PA 3JSBA 3C8YA 5KFKA 2K2PA 3PYDA 1NJZA 1W25A 1NK8A 5D0GA 3DLBA 1IKWA 3GZ7A 4C0HA 4UQGA 1HBMB 2VFVA 1XMBA 4ENOA 4TY8A 2KB2A 1LQ9A 4QJVA 3M05A 2BKOA 4PG6A 2C3MA 1F60B 3RB0A 5I42A 2H4WB 3HVTB 3MEGB 5BXIA 2QJ3A 3CCTA 1NPPA 4OV6A 2VFSA 1RISA 4B3RF 1S9EB 1XJWB 4QWCA 1XNQJ 4JP8A 2NREA 2N3LA 4W90B 2BZ2A 1MNEA 3OHBA 2CFXA 3E51A 4A8MP 1RT5B 1O8BA 3OVSA 3NL0A 1N88A 3C14B 1YJVA 5E0OA 3GU0A 3DDNA 4ZPAA 2R8KA 2VOOA 1B70B 3KLIA 1HQ2A 3PYEA 1C2PA 3TAQA 5KFXA 4PG5A 2M0GB 2L9NA 3I6PA 3NEKA 1WSVA 3X3UA 1VRUB 3Q2TC 1VDHA 4ES2A 2V34A 4KHPJ 3F44A 1YI2S 2B6AA 2YKMA 2MQPA 1UKUA 3CE8A 2BJ9A 2K06A 4P52A 2HWTA 2VPZB 4ELTA 3HVAA 2HFNA 3MMJA 3MMAA 3OL8A 4I2QB 5F8NA 3CJRA 2V2VA 1RCXB 1Q7LB 2Q3PA 3AOCA 4PR6A 2HK2A 1GXTA 2GHPA 2F8HA 3IA0A 3N6NA 4KGVB 5F8LA 1HWIA 4JI4F 3MUTP 2QX0A 3CCZA 4IQXA 3M9MB 3MECA 1F1BB 1GXUA 4HACB 4U8YA 5KFGA 2GVZB 4WCEQ 1T9VA 4DCPB 3K17A 4U7UK 2VD3A 3HK2A 1U2CA 1RTJB 1DAXA 1WD6A 1SKSA 3IBCB 2BANA 5LOQA 3GIRA 2NLWA 4U95A 3LOUA 1FDDA 2JFKA 4IOCQ 4QWEA 2OPRB 2Z2LA 4EI2A 1E6VB 2WVCA 2KL8A 1U0HB 1YSJA 5ETOA 4WP3A 5CZVA 2J9DE 2DHAA 3ILIA 2GO8A 2HAIA 3NMRA 2J6TA 2J76E 4B08A 1SKWA 4I7FB 5L8RC 4DFMA 1X4DA 2CADA 4RU9A 3E3XA 3GQCA 4DR2J 5RUBA 3E2EA 4JI0J 3BN7A 1YITS 2HGLA 3SV3A 1LW0B 2CQBA 3W63A 1S9EA 4PXCA 1OSDA 1UETA 2IJRA 1V3ZA 2B9XA 3EWGA 4A8OA 2VQEJ 1H73A 5GAEU 3TZZA 3G6VA 2MYFA 2BQRA 1WC1A 1FDNA 2BBEA 1NU4A 4MKYA 2HMIB 3M2VA 1X4EA 3T1HF 4N76A 4JB8B 1YIJS 5HLFA 2APOA 4NE9C 2HFSA 4QIEA 3LP1B 5ITHA 4LF2A 2AEJA 4FF1A 3TEHB 1PKUA 4PWDA 3MR6A 2QA4S 1RHMB 5J2MA 4F4AA 1HYSA 3QO9B 2E29A 2UXDF 1EQ0A 3BGRB 1YJUA 2K1RA 2KFNA 2N4DA 2ZH6A 2GQ2A 3MMCA 2VF3A 4F67A 1WKJA 3I96A 3QIPA 2F7VA 3FFIB 4ZLPA 3CJ4A 2BQUA 3SQGB 2E5LF 3CDBA 1UAWA 4NI2B 4DQPA 3QGIA 4IR9A 4USJC 4NCAA 3OW2R 4Y34A 3EZ5A 2HRYA 1NEEA 3GIMA 2NS1B 3CD5A 2DR9A 3C6UB 4ZITA 1TUWA 2OSRA 1S4FA 1JLFB 1E6VA 4U9RA 3PR5B 1M5OC 1UA1A 3N9UC 5A8RA 2DR6A 3Q2SC 4ED0A 4P73A 4UOGA 5HBMA 1ZZFA 4NRTA 4XK8C 5KFVA 4IG3B 3VF0B 3SCJE 2Y0SD 3UI3A 4OYAA 1I6JA 3MCNA 3KK2B 2MZQA 4U67Q 1VR6A 5DRKA 3IFEA 3OXGA 4I7FA 3VGTA 2XZTB 5M2PA 2MKCA 1YLXA 1U6FA 2OPQB 2HNDB 1T3OA 4CCHA 4LF6J 1NSQA 1WOPA 1OPIA 2HHPA 1S0MA 3JSMA 5HMZA 2HHWA 2RU9A 2CDRB 4OZ5A 4O4GA 1WUUA 1XMQF 2OMLA 2RKIA 5DO2A 1RWVB 4YQWA 2HHHF 1NDLA 4IH5A 3ZZ0A 2LA4A 2XMVA 2DRAA 1IM4A 4ZN3A 2DT9A 1TL3B 1QAYA 3MR7A 1KVJA 1PYTA 3ILLA 3VHQA 1NSPA 2Z58B 2NXCA 3UCZP 1GNKA 3L9ZA 3W5ZA 4NLDA 4Q8FA 4DPXA 2NXJA 2EFNA 4X66J 1S1WB 4AL5A 2MLYA 2WVEA 4ZVEA 3BREA 1HA1A 3PXGa 1QE1B 1Y3KA 3HKWA 3KJNB 4DPTA 4P75A 2DNLA 1S6UA 4DR7F 3MPWA 3MCMA 4GVBB 1YJ9S 2OFHX 4WXWA 2LXIA 4WK1A 2CJAA 1NNDA 3T3FA 3D0HE 2FTRA 3W61A 4JYAJ 4U7CA 1BXNA 3CT9A 2XSJA 4KQZA 1RWOB 4ANDA 1SQFA 4FXDA 4ZA1A 4RUCA 4WPAA 3TYTA 4LR7A 3ZZZA 2DPJA 1HW8A 1XIQA 4OJHA 1D09B 2JSXA 4USMA 4JI1J 4LFAJ 2J0XA 2PGCA 5JUMA 3SSSA 4B9NA 2A2DA 2IIHA 3VTIA 1PSDA 4FVCA 1WHVA 3BJYA 4U7UD 2VV5A 5K8OA 2FHKA 1XMOF 3N5FA 2XMAA 2D3ZA 1N8RT 4HI2A 4G1QA 2VU5A 3GCXP 4DDFA 1LEOA 3PTWA 4M5HA 2OAUA 1H74A 2GW8A 1AYEA 1NBEB 2E1RA 2RRBA 1LW2A 1RP5A 1VBKA 5CZXA 1JXEA 1NUEA 3IC1A 4GC7A 4LF4F 1N6QA 4XO0A 3T5LA 2LLZA 2V8VA 1ZAVA 1RAJA 4I67A 3QGGA 1N48A 5AE3A 3KHGA 3PHEA 4CH0S 1ZZNA 1IKYA 2OI2A 2Y1RI 2CQHA 1VCTA 1X5TA 1YVFA 4DV1J 5IFMA 2F3JA 4QIVA 3UO0A 1Q8KA 3R2CJ 1WC0A 4Y2CA 4D3GA 4C4WA 4XPCA 1UVNA 2A3JA 3L7OA 1Y10A 2XMTA 3CCQS 5E7OB 1DY3A 5DS7A 2CPHA 1A9NB 3US5A 1HD0A 3K5MA 1CJUA 1FE4A 2IBKA 3UDCA 2BJ1A 3B54A 5FJ4A 5C2GA 1IM6A 3PRBA 3DOMB 5J2PB 2J0QD 3LQVA 3GFZA 1S77D 5CYMB 1J5EJ 5EUHA 3F73A 3H4DA 3LGNA 3AB2B 4C11B 1NCLA 4IFYA 4EZ6A 2IHR1 4M5JA 4ZCLA 2F9JA 1WJ9A 1XEZA 4WWSA 2HNZB 4F8RA 3OR2B 4TU8A 1YJ7A 1SQEA 4OZ1A 4WF9Q 1EHWA 4LFCF 3MDFA 4DV6J 3D6MB 3NS7B 1DTQB 1EJ7L 1ZPWX 2Q6CA 2OD6A 3EGVA 2QLFB 4RW7B 1F5CA 2PA8D 1RT7A 2R7XA 4M8LA 4M5IA 1FKOA 4ZCIA 1H2UX 2P6SA 1VOMA 5HJYA 1QSLA 2AMCB 4GO7X 3EYZA 4IDKB 5KFEA 2MB0B 3MM8A 2FUG9 2JC0A 1UWAA 3R7NB 3JSRA 2AJQA 4OZLA 3QSYB 1O0PA 1OJ4A 2DGOA 1U6BA 1KOHA 2N4CA 3DLJA 3KKFA 1U24A 2M2BA 2BJDA 4RW6A 4F2RA 3BSAA 4K4XA 4PKDB 2ZVIA 2YKAA 1SJ1A 4OHXA 3GIIA 3DLGA 2GIQA 4HT5A 4CNZA 2DR5A 5H9FJ 3GSDA 1K1QA 1S12A 1YKWA 1SJQA 1X4GA 3Q8SB 3DRPA 3RRHA 3GPAA 5KFHA 3V81B 5J1EA 3RBXA 3G82B 3QMQA 3UWTA 2AHOB 3BR9A 2QV6A 3AB4B 1MN9A 4WFBQ 3QZ7A 1JB0C 3SCLE 5E3AA 5HAOA 1XNRF 2B56A 3J7YU 4O4RA 1QVGR 1U1MA 3U1MA 1YZ7A 3NGSA 1FX4A 1H0HB 1S4EA 4PUOB 2MQNA 1HI1A 4ZVTB 3R3TA 3EVWA 2EFOA 2RQKA 5LJ5Y 3MM5B 3G9CA 4EGLA 4ED4A 4ZP7A 4JV2A 3FEYB 3EJMA 5HMYA 2M5YA 4M5DB 2MKHA 1ACMB 2EXUA 2GX8A 3OT9A 3VGUA 1RT2B 1XN9A 2RB7A 5EWFA 8ATCB 3TAPA 1F3FA 4QBUA 4F0MA 1SC6A 4ZK7M 3IM9A 3OR2A 4DQQA 1VLYA 1OWXA 3V6DB 2UUAJ 4NYPA 5DQIA 4B3MF 2PMZD 1UEKA 3G2XA 4HHHA 4AQYJ 2ZE2B 2MSTA 2ZOGA 4C0BA 1TKTB 3FKBA 5DDQC 2QMWA 3PCOB 2UUTA 4DL5A 1IN0A 2J9EA 2I6WA 3UW1A 2GHWA 2AIRB 4DSEA 3HJFA 3M9NB 3GB0A 1TVRA 1N5SA 2GS8A 3H2VE 2WVDA 4X4SA 1FWLA 3KG1A 1C1BB 4KHMA 3D5MA 1NJXA 1LK5A 1RT3B 3F0NA 1GMWD 1F2GA 3FZBA 1TL7B 3BEGB 4DV3J 3C3LA 4ILLA 4M5NA 4DQSA 2LEAA 4ZVUB 3VAHA 3HT3A 1J2VA 2RAQA 4OYWA 5F8HA 4DV7F 2PO4A 3UE2A 4ECSA 4ZOSA 1IBKJ 4DQIA 2A1BA 4M5GA 2LXUA 2V2KA 2YTCA 1UEUA 5GADI 1CS4B 3R5AA 1MU2A 2CG8A 1NB2A 1RXOB 4Q44A 2AYGA 2OKQA 2ZBIA 1FRMA 3I0SB 2C2OB 1FFSB 5E3RA 3QRPA 2ZKTA 3O44A 1T8EA 1WACA 3OHAA 3IAS9 1J5OA 1EARA 5IQQA 5KFTA 4EBDA 1EAYC 3ZTRA 1QLNA 4OI2A 3H2LA 4X62F 4PUOA 2FVPA 5E3CA 3OLAA 2ZH2A 3OXFA 4NWBA 2GQCA 4J90A 5HROA 5DJBA 2HG4A 2I9SA 3ETOA 4C8OA 1I94J 2YH0A 5JMNA 3PRDA 3ENQA 5HVHA 2MJNA 1BD6A 2DYAA 5HL7Q 4LFBJ 2W24A 5LJ3Y 2H3EB 3P96A 3HF5A 3H98A 4X84A 4LF9J 1NAQA 4X64F 1MWYA 3DC2A 1PG5B 3JTNA 2F65A 4ETXA 1LWCB 1DJ0A 2MTLA 4CH1A 4PWWA 4ES1A 1P9QC 2DITA 3JB9k 3V5RA 4HL9A 3QQCD 4NLXA 4IOBA 1BQNA 2A0FB 2Q43A 2XI3A 3I9ZA 3IWNC 2XY5A 2JRSA 2QSWA 4I69A 2V2ZA 3P45B 2KHCA 1KTQA 4FNIA 3I87A 3JAMU 3CXCR 3DU5A 5FLXU 3GP9A 2FVSA 3W9IA 1HNZJ 2KFYA 2IA6A 4KPYA 3NY0A 2CJBA 2MZTA 2A6OA 2EBGA 2CUYA 3ZO7A 2E1MC 4EZ9A 1DLOA 4USKA 2CZ4A 3IP0A 2WZ1A 1VRTB 1KP6A 1CS4A 2A6MA 3MI7X 2WONB 2GV1A 4KJIA 1HNXF 2SXLA 2HGNA 2GVDA 4GMKA 5CCLA 3IRXB 4EMDA 1HPZA 3OPKA 4UOHA 2HNYA 4ZDNA 4HI1A 4MMOA 3QT7A 1WG1A 5B0CA 1JKHA 1OIAA 3WX8A 4NX9A 2WVBA 3OFHA 4K0KF 2QA2A 1FCAA 3C16B 4TLQA 1B0PA 2B5JB 1CJKA 3V4IA 3TZXA 2CQPA 4K4VA 2QLXA 5AE1A 2IDLA 4DU7A 4WTOB 1BY9A 2KZZA 3OSNA 4IRDA 4MT1A 1H98A 2IJNA 2I1RA 3DLKB 3VAMA 4ZKAA 3NCRA 2ALZA 2RRAA 5ETMA 5LSLA 2BXJA 2DHSA 1SC4B 2LXFA 2JC1A 3W2WA 2AGPA 3I82A 3M2UB 3MAAA 2VG7B 2FJBB 2QFIA 1LWCA 1WELA 1RI7A 3IBWA 2IVMA 2Z2ZA 4ZCMA 4YHHJ 3RR8A 1Y5IB 2RD5C 1GMVA 3P5TL 5HI7A 2YKOA 5HMWA 4DX8H 1ZM2A 4ZHRA 1JIHA 3LGMA 2R7QA 4JI8J 2KVIA 3M4XA 4CLYA 1X4HA 1Q1KA 3GJRB 4O23A 1CEZA 3C19A 3R6LB 1LK7A 3R5BA 1B7FA 1TP7A 3IS9A 2M70A 4V1Ak 1N4LA 1S9GA 4Y2MA 4LUBA 1IWAA 2M3DA 2YNGB 4NLWA 3HM9A 5A8WB 2JEIA 2Y8WA 5F41A 1VQNS 2XTJP 3J80U 3T5HA 2RNEA 2XS2A 2VOPA 3P49B 3NNAA 3C15A 1Y11A 2J8AA 2G2YA 5IQ6A 2D41A 1SL2A 4A8KA 2L08A 5KG5A 2EEYA 5ETSA 2HVIA 1KBRA 1BHNA 3J7Z5 1WC5A 4GC6A 3R1HA 5EDWA 2O67A 2BOAA 2HFZA 1FNOA 3T5JA 1HFEL 4HDHA 4QWBA 4DLGA 2P6TA 4WKYA 2C2EA 2UUCJ 5I3PA 4AFFA 2DNYA 3C16A 4P2XA 3QJPA 5LXRA 3HSJA 1WI8A 5HMXA 1DARA 3PEJA 4YS2A 3SCKE 4G6VB 4ZPWR 5ETRA 3NNCA 3PX6A 3KG0A 5ETLA 2XWXA 1NK9A 2UXBF 2XS7A 2YKQA 3R8YA 1IXKA 4HTJA 1H7WA 4N5SA 1UZDA 1JLGA 2UVRA 2Z30B 3UVJB 3NP5A 2HKEA 1H72C 5A8KB 1UVLA 1S1TB 2OPPA 1K44A 1N5YB 4DV0F 3VGSA 2PFFB 5K8NA 3ZTQA 5GMDA 3C46A 3HT0A 4MIBA 1U1LA 3OR1B 3ILOA 3ZZTA 1N56A 1UFLA 2VJUA 2GJ2A 2VONA 4ZJOA 3UDLA 4WP8A 1H3DA 4WJBA 1U1RA 5HP1A 3RW6A 5KG7A 5DG8A 2JFDA 1CJVB 2HPUA 2AJ2A 3PYGA 3D68A 2OHDA 1KFSA 1T7PA 4CLZA 1IWGA 1HNWJ 1PIEA 2GAGC 5DGBA 4B9UA 1S7HA 1OYDA 5C25A 1NH8A 3HJVA 1RBLA 2ACYA 2X1BA 3CVKA 1TK0A 4B3TJ 2YNGA 4CRJA 2VIHA 3TOQA 3QLHA 1I3OB 4F50A 2RMLA 2YNIB 2J7KA 4RWXA 1HNVB 3CCWA 4PXEA 1Q95G 2D1CA 5KFIA 4WFNQ 1MROB 3DDIA 2ZNYA 1K1SA 4DL0C 2VASA 5D4PA 3N6LA 2Y1JA 1QY7A 4F02A 1BWEA 1N5VA 5CHCB 1WEYA 3JYTB 1MLAA 1R8BA 3IAM9 2IM2A 3G8QA 2DBBA 4EYHB 3QJJA 4O3NA 3TW0A 5DZ6A 1S6QB 3M6UA 3EX7B 4KV8B 3JTOA 1TFWA 3LTOA 2EKNA 3LH2S 4LBHA 1RTDA 3B4DA 1XR7A 2OEJA 3N28A 4OZ2A 2H51B 2LMIA 2MGZA 4FZVA 2LQ5A 4S0MA 4ED3A 3D9BA 3G96A 2CWKA 2W2PP 2W7AA 4OI1A 1B0VA 1VQKS 2Y1LB 1IBMF 1TELA 2OH2A 2YQ0A 1DURA 2R7UA 1ZTTA 1WF1A 1EX8A 1JX4A 4DR1J 4QIWD 4KSEB 5HATA 4C8KA 4F4YA 4K4YA 4FF2A 3TJ8A 2IC3A 1NB7A 3M8PB 3S6EA 1BQMA 1IJFB 1ZAXA 2R7TA 4UZCA 3PO4A 4DSKA 4X4OA 2GJIA 2AF6A 2NQPA 2XYGB 2YWWA 3JS9A 2HSEB 3M8WA 3DRSB 5KT3A 2H9ZA 1VJQA 1PAEX 2DGQA 4LF7F 1RBAA 3EMTA 2UVWA 1R8PA 2VBWA 4F4KA 3K59A 3SBMA 3DMJB 1HHSA 1RKIA 4USUA 2FLNA 3I31A 2AEMA 2DH7A 1FNXH 4DG1A 5ETQA 4RW8B 3SEOA 2XO7A 1N0UA 2WBMA 1O51A 1KFDA 5D4OA 4H4KC 1FXRA 2XCAA 4BBYA 4ELUA 3KK1B 4DR3F 3L7PA 1RGVA 2B8PA 4YOEA 1N36F 4JI6J 3IWXA 2W4DA 2ABYA 2NR0A 1L3SA 3DLEA 2YPYA 5KFLA 4ECUA 1MWQA 5KFYA 1XC9A 5KFDA 1ZOTA 4J37A 4H4MA 1AFIA 4L76A 4MFBB 1EKSA 2ZH9A 1GX6A 5I4MA 4CO4A 3VZIA 3RB4A 4ED8A 5EN1A 1U1OA 4L3NA 1FJ7A 3BS9A 3M30B 4O3OA 1Q7YT 1YGYA 2DGUA 3OTOF 2VDIA 1NDPA 2WSEC 1PAUB 4YB7A 4F26A 4HH1A 4CLWA 3CEDA 1P1LA 3CB4A 1KSPA 2NZ4A 3Q8PB 4NA2A 1CC8A 2V8HA 4ID5B 2NXUA 4OZ0A 4ECTA 1HW9A 4KAIA 4R5PA 1VISA 4HT7A 1TR0A 2EFPA 2R8HA 5F8GA 3IGNA 1S10A 1F5BA 3MM7B 4ZMMA 4DUZJ 4ECZA 2CPEA 1YQHA 2HQDA 3DGVA 4DEZA 4I2PA 1T95A 5KOXA 4AYBD 5A6PA 3NBPB 3T6BA 2F5GA 1T05B 2W8LA 4NLOA 2I5JB 3OVAA 1U45A 2AYMA 5U47A 5CABA 1W26A 3RZAA 3MPUB 4LQ3A 4ATNA 3ISZA 2H65B 2HBZB 5C42A 2GIRA 1QUVA 1HHQA 1SPBP 1A7GE 3CJ5A 5JXSA 1LOUA 1T9WA 1Z1ZA 4WE1A 2C2NA 1NJWA 8RUCA 2HBQB 2DGSA 4XPEA 1KC8T 5T7LA 4TU9A 1QTNB 4OJ1A 3DM2A 5GAGI 3SYZA 2WW4A 2VHGA 3FEXB 4N8OA 2MLXA 2UXCJ 1JLEB 4J9VA 2L3MA 4LR8A 3HHDA 3OD2A 3N4WA 4OI6A 2MZJA 3RRGA 2CYYA 2CZ9A 3OSPA 4B3SJ 5LL6d 4ED2A 3R6GB 4YN3B 1REVA 5ADZA 2B4VA 3BDPA 1LWFB 3CJKA 2FC8A 1ZS6A 2RT3A 1GQEA 1Q5VA 3KLGA 1Q8BA 4QR2A 1UJ5A 3UDEA 4O3PA 2QL9B 4P7VA 2X7IA 1FX2A 1U49A 1N0VC 4QW8A 4JV5F 4IFVB 3O1LA 2HK3A 2NCKL 9ATCB 2C2ZB 1FVSA 2HLTA 4OI3A 2O66A 2MKIA 4OJGA 5KFBA 4AL7A 4C48A 2ZC4A 1NZAA 3BPSP 3G4SS 3Q89A 2V4JB 2JLFA 3O8WA 4MK9A 1R7IA 1ZPVA 1BE4A 2LU1A 2VA3A 2VQFF 4CO3A 3KDNA 1RU1A 3PJWA 5HO4A 1RTIA 1VGYA 4RL1A 3E01B 3M6WA 1RUSA 4K59A 1NK6A 5HSPA 3OV7A 1ROFA 3N5BA 3UNGC 5LMUF 4NCGA 4OYMA 4KTQA 4JI2J 3UD4P 2ZH3A 3RTVA 4DCOB 1IR1A 1FJGF 1KS2A 3GFXA 1JJ2R 4GKJF 2QRRA 4OYXA 3ZZRA 3HHEA 3VVUA 5I3UA 1K0TA 1HR0J 1HMVA 4JBCA 2BDPA 1OMSA 3RGIA 2OPSB 3DGPB 3K58A 2UZAA 3CD6S 1KLMB 3UDVA 4K2JA 1NO8A 2YWFA 2M9KA 4Z7CA 1D1UA 4YB6A 2W9BA 1MW7A 2X1FA 1I5OB 5DLFA 3Q86A 4DN9A 1GEHA 3BGUA 1KEKA 1IKVB 2KHDA 5GVQA 2LDIA 3M9OB 4B17A 1DZ5A 3AT1B 2ZBQA 4CYUB 3W3SA 3ET6A 3R2DJ 1WOOA 1J27A 1X9MA 3VR1A 5THWA 1RTZA 4CLSA 3PJ9A 2AV5A 3OL7A 4JV1A 4LIRA 1HQEB 1EETA 2JEFA 4O44B 4L75A 2DIUA 4C98A 2HWHA 1FK9A 2GMJA 1FWKA 2FHJA 3NAIA 1TQLA 1RT6B 3DU6A 1SJ3P 4TKTA 1RT4B 1G4CA 2ROPA 4LRDA 1CG2A 3U02A 1U25A 2ZJPQ 3CCSS 4NZ7A 1M1GA 4XDCA 5KT2A 3P6YC 4DFKA 1ICEB 3OJSA 3ETMA 2P5VA 3R97A 1NZ8A 1RWKB 2IM1A 4CT8A 2GIFA 2YKNA 1CJTB 3JQMA 2F4VJ 4HHUA 4DSIA 2BABA 1CQNA 2XS5A 2XLIA 2ATLA 1UA0A 2XI2A 4LVOP 1VQOS 3KJVB 2YVSA 3ENAA 5B08A 3HHLA 3MR2A 2WOMA 3UCGA 3I9V9 4WK3A 3THPA 3OVBA 1GMUA 1WKKA 4OHYA 2BKPA 2XHWA 3CC4S 4Q0BB 4OZ3A 3FUYA 1XBWA 1S1XB 1RTHB 3PNIA 3V4MA 4RW4B 3FCHA 2BACA 3DYAB 2VODA 4B3OB 2VPYB 3NNHA 1JJ4A 4CNYA 4OI0A 4J91A 5GMKa 4IG0B 3B6BA 3Q8YA 4CLLA 3IXQA 2R8IA 3A3OB 3WX4A 5IOLA 2CQCA 4LSNA 2KRRA 2RILA 2Z8QA 1P27B 2I8EA 1AZSA 3HD2A 1WHWA 4WXOA 2MMYA 2C42A 3AOBA 5A0YB 4CTAA 3K5NA 5CD4A 2H48B 4WFXA 4J9QA 4H4OB 1C4AA 1WKLA 3E8OA 2J0WA 3POTB 2YBVA 1YTYA 1SUQB 3CD7A 3MEEB 4ELVA 2RIJA 1HI0P 1U09A 3KLFA 4LF5F 3EPGA 4NXMF 2W4PA 4TU7A 1KD1T 1R8CA 4URQU 2CJXB 2PC6A 2ZHBA 2CJKA 2PMHA 1YDLA 1KKHA 2YY3A 2CQ4A 2FVQA 5H9EK 1KHWA 1SL1A 2RRNA 3V2UC 2RQMA 4NL5A 5DDOC 3BQ2A 2XWYA 2FLLA 2GJFA 2UU9F 3FZ2A 1FRJA 3ADAC 4P72A 2UUBJ 2ZH5A 4ED6A 3R7SB 3NCQA 1NPRA 5J2NA 4MKBA 2DY1A 3LP0A 5C24A 4DF4A 2IPOB 3PDNA 1JJHA 2UV8A 1N33F 3QYYA 2KN4A 4ETZA 2H5IB 4USIA 3CDWA 1IR0A 4DR5F 5L1KA 1M5HA 3W7BA 1U1KA 3H40A 1YK9A 1VQSA 4MYUA 1HWLA 3TAMB 2V50A 4N7TA 2ZZTA 1HBUB 1N34F 2N7YA 5MLCV 2BVZA 1MG7A 2G4BA 2KDOA 4ANCA 1UVMA 1IKXB 4ZPDA 1Q16B 1ZH5A 3D0GE 4LRCA 4ZPVR 3GV5B 5IXUA 3FQLA 1LFPA 3GE9A 2G0CA 3R27A 2MPUA 1TKXB 4J9UE 4PXBA 3UN2A 4B9SA 1C0TB 2ZEJA 3SFUA 5B0GA 1UZHA 2VG5B 2Y0BB 4QOTA 1R3NA 1UPMB 1N32F 1F0XA 1X60A 4AT1B 1URNA 1TMJA 2W7PA 3CC2S 4DV2F 3FSYA 1R0AB 4YY3J 1HKAA 4PWUA 1V3SA 2HVDA 3P3DA 2X51A 1C1CA 5IV4A 1NK0A 2RDDA 1TAQA 1S57A 3OL9A 1S6PB 7FD1A 2HHSA 3Q8UA 5IM0A 1KONA 4FYYB 4DV0J 3BYPA 5B0AA 3MPVA 2H1YA 1UWBA 2XB2D 2C3OA 3BBBA 1IKWB 2FJEB 2E5HA 2W1BA 4PAAA 2GO9A 4C3LA 2V63A 4PXDA 2KH9A 4TY8B 4F04B 3FBFA 4IR1A 2H5EA 2D74B 3NGUA 5I42B 1S9FA 3VCDA 3LF0A 2EK1A 2YX4A 2FYXA 3HHKA 4G3IA 5KFNA 3M8QA 2GGPA 2V5HG 2HRUA 5D3GA 4DCJB 2XMJA 3GR1A 2DGXA 2HFUA 1UW4A 3EZOA 3OXLA 3LAKA 3CD0A 2DGTA 4HDGA 4X4NA 1T9UA 1APSA 3NOCA 4ZVGA 1ZM9A 3B8HA 2G0IA 2CQ2A 4K4SA 1FTCA 3T6JA 2MQMA 4OYOA 4F3OA 2N7CA 3HULA 3CMES 1ZM4A 3B82A 2YKMB 4I1TA 3J7ZT 1T02A 2KXHA 3DXSX 4CZCA 4YFUA 5GADU 2V69A 1JLAA 3BO2A 3M7VA 4A46A 2CNKB 2Z2YB 3W66A 1GK8A 5C7PA 3H7HB 3I5AA 3MMAB 3W64A 2B8QA 2DVIA 2DR8A 2ASLA 4YDXA 1S79A 3H8YA 1HBOA 1BQXA 2LU2A 3J7AN 3MECB 3A3PB 1B3TA 2CPFA 2WTFA 2DHHA 2NYHA 3CMQA 1S6PA 2HRTA 1YBAA 3RBDA 3TUPA 1V3RA 3CC7S 2CQ1A 4DV5F 3LP2A 2BANB 2ZBPA 1LXNA 1X8DA 3T19A 5G0RA 2BE2A 4Z2XA 4N77A 1M90T 2VFTA 4LJMA 4UOCA 3VQSA 1JLCA 2QMUB 1TL1A 4A8YA 3GJQB 2HIYA 4HLBA 4A8SA 3ZTPA 1NK4A 2AZ3A 3W65A 3L7UA 4A8XA 1T9XA 1TKZA 2MQLA 1F2HA 1VRQC 2J5AA 2BYCA 1IVZA 3EDQB 5KG4A 2ROEA 3EGZA 4KYZA 2BE7D 4K4ZA 4P71A 1R27B 1K47A 4LF8J 3AXKA 2R2SA 2CPIA 3MURP 3EXCX 5DM6Q 4DR3J 1CSJA 2MY8A 3TO8A 1XNQF 1YRUA 3N6MA 3M2VB 1GXLA 3IGVA 3BDEA 5DG9A 7FDRA 1I51B 2OO4A 2NSCA 3HZGA 4F0KA 5HLFB 1MWZA 3QIDA 1F5AA 3KLEA 4LF1A 3CIZA 3G6ES 3A13A 1W2BR 5LMNJ 3RB6A 4PWDB 4FDFA 1S0VA 5B0FA 5J2MB 3VWSA 4FYVB 3J81U 2QLJB 3KNAA 1HYSB 2OUGA 5DQHA 2W9CA 3UD3P 3I0RA 4R0EA 5M2UA 4RW9A 5D0HA 2K1RB 5EHHA 2M4MA 3W5XA 3BKUA 1VHFA 1HNIA 3MMCB 1JLQB 2HHXA 3OTOJ 3LA0A 1U8SA 4X4UA 3QIPB 1YG0A 4J9MA 1ZA2B 1WEZA 1TL5A 3EGWB 4RKUC 2CWXA 1UVIA 2MEWA 4WYLA 1HWKA 3S7RA 2EI5A 1H6KX 3VAKA 4DR4J 4RNFA 3GIJA 2JOQA 2LEBA 1ULRA 5L38A 3GYGA 2HZCA 1YBTA 5F3TA 3QAEA 3GR0A 3DHXA 3RBEA 2C1EB 1YRXA 4XIUA 3D3CJ 3QT5A 5ETVA 2HW3A 4NLGA 2MXYA 1TV6A 5A8RB 4ZVOB 2R2UA 4CWBA 2VG6B 3ZNJ1 2XGQA 1TK5A 2IMWP 5HBMB 3W8GA 4IKAA 3D4JA 4OHZA 3M32A 5LM7E 1JXLA 3HMJG 3RU0A 2XZWA 3CJ2A 4FYXB 5D4NA 1HWUA 2VKRA 3JSMB 1PC4A 2FHMA 4PABA 3ICLA 4O4GB 4DR2F 2RKIB 1HLWA 1RA7A 1WHXA 4JI0F 1VQYA 2E1PA 5K5MA 4BWJA 1R0BG 2FJWA 3A8KA 1BUXA 4KRWA 1FA0A 2VQEF 4DV4J 4KO0A 1SQGA 3H42A 4E0DA 1Y0HA 3GG0A 4QZVB 2BRLA 3DOKA 4Y3CA 2QYGA 5IT9U 2KG1A 3OUYA 3HFZB 3BB5A 4FPRA 3FEZA 3IRWP 4LBIA 3EZUA 3M8ZA 2GMHA 1HD1A 1JLQA 2NZCA 2R8GA 1OYEA 2JHEA 4NLQA 1RACB 2BKNA 5KFOA 4DS4A 1D9DA 2CVIA 1X4FA 4Q2LA 5EWEA 1KLNA 2AQ4A 3TI0A 3HD1A 1D8ZA 3NXZA 3CCLS 3PVXA 4CT9A 2JLGA 2FIUA 2XSJB 1LWEB 3KUGA 4CQ1A 2HQIA 3GYXB 3IMQJ 2J7UA 2IBOA 4LQ9A 1RB0A 4O3RA 2CIMA 2CPZA 2JEJA 3TR5A 3AHPA 2WB4A 2DNPA 2VG6A 5E33A 2RJZA 1VJWA 5SUHA 2RU3A 1YHQS 4X4VA 4DR6J 4EK2A 1QAXA 2BMBA 1CULA 5HQ8A 3DRRA 4TYAA 2X1AA 4FP9A 4GKJJ 1EQMA 4G1QB 3HLUA 3L3CA 3NS5A 4C97A 1RWPB 4C8NA 3C66A 4LT6A 3MWBA 1DFDA 4CDIA 3ZTOA 4CLTA 4E8UA 3J81j 3CCRS 5AXKA 5CYJA 2VJVA 2BJ3A 2PFDA 4YMEA 4FVMA 2XYHB 4CLKA 3D6FB 3V6JA 1LW2B 4LIWA 1Q0NA 2K3KA 1N6QB 3MR3A 3D54A 4YR0A 4ZVPB 2LA6A 4ZJLA 1NDKA 2HVEA 5D15A 3HCXA 3AJDA 4CH7A 4J7CA 4OX9J 4RBUA 2GAHC 3CJSA 1S59A 4QR0A 2YWKA 3OJUA 3A8IA 1DQ8A 3AOAA 5KG2A 2KJWA 2V8GA 3BZQA 2IAJA 2EK6A 4B9MA 1KQKA 3MCSA 1HQUA 1WOSA 4RZRA 1IKYB 1UTAA 4UTGA 1Q86T 1U0SA 1PYOB 1GFWB 3VQTA 2JDJA 1PJ6A 1S1VA 2VZ9A 3A8EA 4X66F 3EVMA 2ZKUA 3Q8RB 1SL0A 2XLJA 2PEHA 1SH3A 5EX0A 3KG4A 2ZH8A 3RYLA 4PQUA 4C2MA 3MFIA 4DUYJ 1N52B 4QWAA 1RT1A 4PEOA 1IBLJ 1CJUB 3BH7B 1YX2A 2R7OA 1LWEA 1NKEA 2DHXA 4P10A 2MJUA 4ZCKA 3UFCX 4EO6A 4OYIA 4JYAF 1RJJA 3CULA 2BM1A 3M2RA 1U7LA 2RQCA 5E2QA 4JI3F 1HIYA 4IUFA 1KN6A 3D6HB 1HWJA 1CPZA 4WBFA 1XR5A 2F8MA 1L3UA 3PY8A 2OP5A 2V94A 2BX6A 1YWXA 3MOZA 2R4FA 1VQ5S 3AJ1A 3FMBA 4JI1F 1OY8A 5B7WA 4LFAF 3BGFA 4WU3A 5K8MA 4USTA 3M6VA 2J6UA 4IFYB 3KLVA 3K5PA 1RAHB 2JNJA 2OJ3A 3SDEB 1YRTA 4FS2A 1NM2A 3H5XA 3KMSA 4J9RA 2MKYA 4JI5J 2DEIA 3G6YA 1TAUA 2CPDA 1YJNS 5KG3A 1S49A 2FGOA 4ERDA 3GTYX 1O6XA 1S6OA 2W4CA 1XWLA 2R42A 2B9WA 4NEZA 4ECXA 2HS3A 3H0PA 4KB7A 1WC6A 1SH0A 4QQBA 4DPYA 1RT7B 1ZBTA 4ZVFA 3G71S 2V9KA 1FKOB 4K4TA 3QFWA 1FKAF 4NYZA 5K14A 4ILRA 2DK2A 3MM8B 3ZFVA 3QFHA 1ZTWA 2ALYB 1RSCA 4AXIA 2HHQA 1NK5A 2VFUA 4QYZK 1Q5YA 3KJFB 6FDRA 2KI2A 1RDRA 4RW6B 2XHCA 2IRXA 3ILJA 4DV1F 1S1UA 3DLGB 5KTQA 5KG6A 2RSQA 4IO1A 3LW5C 4RBVA 5J2QA 3Q23A 3GJSB 2E66A 3DRPB 2E1AA 1RZMA 4V19X 3KLHA 4F4ZA 4KKOB 2MLZA 4GKKJ 1KTVA 2WBRA 6FD1A 3U1NA 5J1EB 3NWGA 4TQSA 2Z0GA 2VKZG 5F0UA 3V6HA 4UOFA 3SSRA 3HVRA 2JVOA 2F63A 3M1VA 2YX1A 4MTPA 4CO0A 3LWMA 5GAHU 1M1KT 4RUHA 5IWAJ 5BYSA 1G3OA 1NJYA 3KHLA 3H5UA 4KGZB 2X3DA 3I55S 2L48A 1J5EF 4PRFA 2R2TA 3SDEA 2DB1A 2QFJA 4L3KA 3QATA 4NA3A 4OV1A 4QPTA 3IBFB 2ZNZA 4C9DA 5KFWA 3FSXA 3EM1A 2JL9A 2IY5B 1KHVA 2DGVA 4YEAA 4KFBA 1FD8A 3W9HA 4MKAA 4ECVA 2PMWA 4DV6F 4K50A 4R8UA 5GAGU 3T5KA 1TVRB 1F6TA 4K4UA 1M1HA 2YXLA 4X2BA 4MK7A 4ZVQB 4FKYA 2O5DA 1YJWS 4C8MA 3UR3C 2PN6A 2MQQA 2H4YB 3Q0AA 1JNZB 5BR8J 1MSWD 4DX5A 3CJ3A 2C3PA 4DFPA 1FDBA 3QNWB 2PA3A 2E9RX 2D3OR 3R5CA 1RAIB 3QAUA 4YDDB 2M8DB 1MU2B 3OTDA 1D8YA 2A18A 3Q8VA 1S97A 1VFJA 3NGKA 4KKOA 3CCUS 2UUWA 4K5SA 5A6WA 4CM2A 2Q6BA 2BEFA 4CI0B 1VQ9S 1RAFB 1J5OB 4RJVA 1PBAA 5AJ3F 4F7VA 5E41A 2DNMA 4QU7A 1GAOA 3A8JA 3KDOA 3GJTB 3TRGA 2W01A 1T9TA 3JXOA 5HROB 2COLA 2XMUA 4OMFG 3DN9A 2CKWA 3CWJA 4DU8A 3TP2A 4ZPBA 1T03A 2KT2A 4LSLA 3SMZA 2KFZA 4QPXA 5LXYA 3CTRA 3IG1A 4I56A 2HLUA 1MN7A 4ZPCA 5CYQA 3G87A 4RU2A 3WIUA 3L95X 1RWMB 2E5GA 3QT8A 4NLPA 2PEBA 2RH3A 1PCAA 3SCIE 4URGA 1BQNB 2EWHA 1P6TA 1DTTA 1T94A 4UW2A 4AQYF 3MUMP 4N47A 3ZXWA 2CDQA 2G13A 1L5UA 1DRZA 4ZLLA 3OFEA 3HVWA 2ACMA 5K9FA 4JI7J 4AE5A 1QAIA 5B0EA 5HN0A 3LPYA 1P9YA 4X65J 3NGDA 1FHTA 2RF2A 3TEGA 3D28A 1U2RA 4KE5A 5D8HB 3OBIA 2ZDOA 4DV3F 1QVFR 4EYIB 2UVVA 3AA9A 1DLOB 3T1YJ 1XR6A 1HBNB 2QE5A 1QDUB 3B4MA 2JEGA 2PT0A 2K3IA 2FJVA 3MEDA 4KH0B 1C4CA 1PJ5A 3C6TA 1IBKF 3QWPA 2GVDB 2OEMA 2E7VA 2YNHA 1TL4A 1VQ8S 2ZZNA 5D78A 3LANA 3QWUA 4PPZA 8AT1B 3W2VA 1HPZB 1T9YA 2HNYB 5DLGA 1M5PC 2HZVA 1JKHB 1S0NA 4NCBA 3BBFA 4NEYA 4W98A 5EX3A 3KK3A 3D1QA 3TVZA 4RUAA 3H20A 3BKFA 1CJKB 3V4IB 1JLBA 3PG9A 2POKA 4M1KA 3MMBA 3OTCA 1SI9A 1E6YA 4J9PA 2R7WA 4B3RJ 1T0TV 4WTYA 2EVZA 1VQ4S 1QM9A 3EE3A 1I94F 4WZQA 2ADBA 4NLVA 1WF2A 3W2WB 2R3VA 5K20B 3W9JA 2XY7A 4KHRA 1VQ6S 4LFBF 3MAAB 3R5JB 1BLUA 1AUSL 2FJDB 3SQOP 1FE0A 4LF9F 2DNZA 1YJRA 4BDPA 5HQMA 2NXNA 2HHVA 2LQ9A 1PC5A 2KYXA 3NLCA 4EFAC 1YJTA 2Y3YA 5KFUA 4ZHRB 2QLBB 2OEKA 4PQAA 1RAGB 4Q45A 1B99A 4XDDA 2BJ7A 4MAKA 4C8ZA 3OFFA 1SCJB 5DM7Q 1T11A 4Y00A 3AQOA 2C3UA 4I6YA 3IS9B 1S9GB 2DRBA 4ZP8A 3P8BB 4JI4J 1M5VC 3ZZPA 1RE1B 1HNZF 1H38A 3AFGA 3C15B 4QW9A 1V5IB 1HBNA 2KVQE 4LREA 4B02A 3K7RA 5J1NA 4OFZA 2CQIA 3PFEA 4BCAA 2ZD1A 2JLEA 2R2RA 1TMMA 4KIAA 2BW7A 3G8TA 1VHIA 3MM6A 3PKYA 3HPOA 2QN6B 2RHSB 4MK8A 1ELOA 4ZVRB 1Y5NB 1TUVA 1V9OA 1NPKA 1GTHA 2CQDA 1REGX 2CQ3A 2AJ4A 1HBMA 1NHUA 4L74A 2ZOMA 3BF4A 2HFVA 5CA5A 4P74A 4WIQA 3AODA 2ILZA 3BSOA 1A6LA 4FXWA 2X1GA 2RVJA 3HVTA 4DSJA 2DNOA 2EPIA 2HGMA 3MEGA 2MZSA 2XO6A 1JLGB 3M8SA 5KFQA 4DSFA 3KJQB 5B09A 4RWWA 2OPPB 1XERA 4WYWA 3T1HJ 3C2PA 2HVZA 1S7IA 3CDUA 1RT5A 2FZKB 2AX1A 2W2OP 3DNCA 1S48A 1XQIA 3C14A 1NLKL 2G0JA 4Y65A 4DF8A 2VPXB 3I4HX 2NPFA 5HP1B 3TANA 3G8SA 3V6KA 1K9MT 3N01A 4YHHF 3TWZA 5JJBA 2UXDJ 4UF4A 1VRUA 3TJAA 1MMDA 2HBRB 3H25A 1U4BA 3GV8B 4WKRA 2HAFA 4F4XA 4L72B 5C25B 2AX0A 1U47A 3K89A 3MFHA 4JI8F 1Z2ZA 2HEKA 2CJ9A 1WG4A 4ZPTR 3QLHB 4I2QA 2HFOA 2MSSA 2E5LJ 4DXLA 2XBPA 2BJ8A 1UEVA 4DOZA 3RBZA 1ITPA 3P4UB 2AGOA 4V19J 4YUDA 3HFVA 4GVLA 2XZDB 4Z7YA 4DPWA
chains in the Genus database with same CATH topology
2UUBJ 2UU9J 5IT9U 1N32J 2UXBJ 4K0KJ 4JI4J 4RJVA 4YY3J 4JV5J 4B3MJ 3D3BJ 3JAMU 3R2CJ 3D3CJ 5A2QU 4JI5J 1XNQJ 4GKJJ 4DV2J 4JI7J 4B3RJ 4X66J 4GKKJ 3J80U 5FLXU 1XMOJ 4X65J 3T1HJ 2KVQE 1HNZJ 4DV6J 4LF7J 4DUYJ 4DV5J 5LM7E 4NEZA 2F4VJ 4HHUA 5LMNJ 2ZM6J 4LFCJ 4X62J 1IBLJ 3J81U 1N33J 1I94J 2KL8A 4LF6J 1XNRJ 3T1YJ 5AJ3J 4DV3J 2UXCJ 4DR5J 2VQFJ 4LFBJ 5BR8J 3R2DJ 2UXDJ 4DR7J 4DV0J 4NXNJ 5IWAJ 3OTOJ 4LF5J 4NXMJ 3W1YC 4KHPJ 1HNWJ 4YHHJ 4LF4J 4LF9J 4OX9J 1N34J 4B3SJ 2UUCJ 4DUZJ 1HNXJ 4JYAJ 4DR2J 1IBKJ 1XMQJ 4JI2J 5LMUJ 4JI6J 4DV7J 4KYZA 4X64J 3IMQJ 1N36J 1IBMJ 4KY3A 4JI0J 2MTLA 2HHHJ 4B3TJ 2MEWA 4PWWA 1J5EJ 4JI8J 4LF8J 1FJGJ 2E5LJ 4DR1J 4DV4J 1HR0J 4DR4J 2MQ8A 4DV1J 4NEYA 2VQEJ 4DR3J 4JI1J 4V1Ak 4LFAJ 4DR6J 2UUAJ 3J7AN 4JI3J 4AQYJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUB J;  2UU9 J;  5IT9 U;  1N32 J;  2UXB J;  4K0K J;  4JI4 J;  4RJV A;  4YY3 J;  4JV5 J;  4B3M J;  3D3B J;  3JAM U;  3R2C J;  3D3C J;  5A2Q U;  4JI5 J;  1XNQ J;  4GKJ J;  4DV2 J;  4JI7 J;  4B3R J;  4X66 J;  4GKK J;  3J80 U;  5FLX U;  1XMO J;  4X65 J;  3T1H J;  2KVQ E;  1HNZ J;  4DV6 J;  4LF7 J;  4DUY J;  4DV5 J;  5LM7 E;  4NEZ A;  2F4V J;  4HHU A;  5LMN J;  2ZM6 J;  4LFC J;  4X62 J;  1IBL J;  3J81 U;  1N33 J;  1I94 J;  2KL8 A;  4LF6 J;  1XNR J;  3T1Y J;  5AJ3 J;  4DV3 J;  2UXC J;  4DR5 J;  2VQF J;  4LFB J;  5BR8 J;  3R2D J;  2UXD J;  4DR7 J;  4DV0 J;  4NXN J;  5IWA J;  3OTO J;  4LF5 J;  4NXM J;  3W1Y C;  4KHP J;  1HNW J;  4YHH J;  4LF4 J;  4LF9 J;  4OX9 J;  1N34 J;  4B3S J;  2UUC J;  4DUZ J;  1HNX J;  4JYA J;  4DR2 J;  1IBK J;  1XMQ J;  4JI2 J;  5LMU J;  4JI6 J;  4DV7 J;  4KYZ A;  4X64 J;  3IMQ J;  1N36 J;  1IBM J;  4KY3 A;  4JI0 J;  2MTL A;  2HHH J;  4B3T J;  2MEW A;  4PWW A;  1J5E J;  4JI8 J;  4LF8 J;  1FJG J;  2E5L J;  4DR1 J;  4DV4 J;  1HR0 J;  4DR4 J;  2MQ8 A;  4DV1 J;  4NEY A;  2VQE J;  4DR3 J;  4JI1 J;  4V1A k;  4LFA J;  4DR6 J;  2UUA J;  3J7A N;  4JI3 J;  4AQY J; 
#chains in the Genus database with same CATH topology
 3H4B A;  4ZIW A;  4ID8 A;  3BQ1 A;  4HAC A;  2ZWO A;  2OTJ S;  3KHR A;  2GVZ A;  1AT1 B;  1HHT P;  2E9Z A;  2JX2 A;  2KT3 A;  2AJ0 A;  1RTJ A;  2FVR A;  2AD9 A;  3K8V A;  1KR4 A;  2VBZ A;  2F40 A;  2D9P A;  2IJF A;  3ZNU A;  1IQZ A;  2OD4 A;  2CNL B;  3R7B B;  2OPR A;  4YR3 A;  1SJF A;  1RYS A;  3BV8 A;  3LWL A;  1U0H A;  1RTD B;  2DXE A;  4Q7A A;  4P9S A;  4P6Q A;  2EC0 A;  2MGZ B;  1FKP B;  4DN0 A;  2QEX S;  1EB0 A;  1FXL A;  3GYN A;  2V4R A;  4R25 A;  3PM9 A;  2UUC F;  1WWH A;  4C7Q A;  4C6A A;  1R0C B;  3AD9 C;  2PII A;  5HK4 A;  1JNR B;  4LSZ B;  5HAN A;  1XMQ J;  3AAW B;  2HUR A;  2GCF A;  2QZ8 A;  1RQ0 A;  3MHY A;  2HHH J;  3TA1 A;  1LW0 A;  3ZTS A;  1RWW B;  4OX6 A;  1S99 A;  3K5O A;  1RHU B;  4DL2 A;  1AW0 A;  5CH7 B;  2WW8 A;  5KT5 A;  4ED5 A;  2IC3 B;  2DCL A;  2ZJQ Q;  1BQM B;  3PYF A;  5L9N A;  3FRZ A;  1D0E A;  2K7K A;  3PJX A;  1YZ6 A;  4IH7 A;  5CXT A;  2HMI A;  3GIK A;  3U1L A;  2VIC A;  4X4Q A;  4TY9 A;  9RUB A;  2KG0 A;  2RDI A;  3LP1 A;  2XMM A;  4O0N A;  1OO0 B;  2ILY A;  5F8M A;  1OPZ A;  4NLT A;  4U96 A;  2XMK A;  2IM3 A;  1FRX A;  4DX7 A;  4DG1 B;  4A47 A;  3QO9 A;  2JVR A;  3BGR A;  3T1A A;  3A12 A;  5AT1 B;  1SBR A;  1HNW F;  4DR7 J;  2E44 A;  2R7S A;  2J7W A;  4Y2A A;  5BYQ A;  1R89 A;  4B9T A;  3CJ8 A;  2RUG A;  4H54 A;  5L39 A;  2MZ1 A;  1KDN A;  3WC2 A;  2KJV A;  2BA9 A;  4P2M A;  4B3T F;  2PSZ A;  2M88 A;  3FFI A;  3D1O A;  3SQG A;  3DLE B;  1P1T A;  4NI2 A;  1X31 C;  1EKR A;  2CNN B;  4I6W A;  2DTJ A;  5T41 A;  4EO8 A;  4PG8 A;  4R0J A;  2CVE A;  4H4M B;  2O3D A;  2HHT A;  1VQL S;  2Y8Y A;  2FHJ D;  4IRK A;  4JI3 J;  2ZIT A;  4Y2K A;  1Q8L A;  3C6U A;  2OMO A;  1S0O A;  1JLF A;  2K7J A;  5KT6 A;  1TK8 A;  1XMO J;  2J6S A;  1FKP A;  1R31 A;  2LQJ A;  2CAJ A;  4IG3 A;  4PYA A;  2R9L A;  3KK2 A;  1FER A;  1VYA A;  2AZ1 A;  2ZHO A;  2DH8 A;  4DUT A;  2CQ0 A;  2VB6 A;  5CAA A;  1IUJ A;  2OPQ A;  2HND A;  3ZC4 A;  5F0W A;  4R5P B;  1U1Q A;  1Q82 T;  4FN5 A;  3WIV A;  4I4B A;  4LF4 J;  2LEP A;  2V4Q A;  3RW7 A;  3PIO Q;  1UJ4 A;  4I2P B;  3VAF A;  3HHL D;  2QO3 A;  2CJY B;  1R6Y A;  3KNG A;  4IOA Q;  2FLP A;  1Q81 T;  4DR1 F;  1Y5L B;  3OQ2 A;  2CRL A;  2C28 A;  4F0H A;  2AJF E;  1RLD A;  1G1X A;  5F8J A;  1TL3 A;  1SIW B;  2C3Y A;  2WSC C;  2AP6 A;  3FQK A;  4DFJ A;  2R7R A;  2B9E A;  1IQT A;  1VIX A;  5C42 B;  1WC3 A;  2XNQ A;  1FNM A;  3QRR A;  2O01 C;  4I0W A;  2AU0 A;  2L9W A;  2FZG B;  4WE1 B;  4YR2 A;  4ZVS B;  2ASD A;  1NKC A;  4A8F A;  1S1W A;  2AW0 A;  2ZWP A;  4ZS6 A;  5T7L B;  1QE1 A;  2VA2 A;  3DM2 B;  4IQM A;  2Y9H A;  2C2K B;  3QSI A;  2FD2 A;  3QGP A;  1PYS B;  2XNR A;  1EIY B;  3BKT A;  2BM0 A;  5LSR A;  4MKV A;  4UUW A;  4CLP A;  4GVB A;  4PZV A;  5F3Z A;  1L3K A;  1SC1 B;  5L46 A;  4JI6 F;  4TN2 A;  2H54 B;  5KG1 A;  1REV B;  4KGX B;  3SIP B;  3HSG A;  3CJK B;  1KOO A;  2E7W A;  2MKS A;  3KLG B;  3NMA A;  1FI4 A;  3JAM Y;  5F9L A;  1KVK A;  2UV8 G;  4G1P A;  2KM8 B;  5FLX Y;  1VC0 A;  3CCJ S;  3PAC A;  1Z2L A;  3RG6 A;  5L1I A;  3K57 A;  4KGM A;  2DGW A;  4ER8 A;  5AXN A;  5B0D A;  1KQF B;  2ZFH A;  2CQG A;  4A8Q A;  3TNV A;  1IBC B;  1IR2 A;  1JJC B;  1WI6 A;  3EIC A;  2D9O A;  4E98 A;  1RCO B;  2E5I A;  1VI7 A;  4P2F A;  4LFC J;  2KYZ A;  3GCW P;  3VAJ A;  4ECQ A;  1RTI B;  2HS0 A;  3ZZO A;  3QT6 A;  3RAX A;  4QWD A;  1ARO P;  1FFG B;  5FII A;  2MHN A;  3FBE A;  2JWN A;  3AY0 A;  4OHW A;  4DUZ F;  4NCG B;  2CJQ A;  2FZC B;  4DHV A;  2OEL A;  3D7S B;  2YKP A;  1JXV A;  4OLO A;  2QA4 G;  2LDY A;  4RO0 A;  4Y6I A;  2GQQ A;  3U7J A;  1X9S A;  2G1H A;  3G6X A;  1RA6 A;  3DRY A;  2V0N A;  3MAH A;  3RB3 A;  3RAQ A;  5CQG A;  5I3U B;  5JVG Q;  1WC4 A;  1ZAW A;  1HMV B;  2N82 B;  2GFF A;  5D0R A;  4W92 B;  2ZH1 A;  3PW5 A;  3EXY A;  1DQA A;  4U6P A;  5CD4 H;  1L3V A;  4DL7 A;  3DRX A;  3TUJ C;  5HJX A;  2VPW B;  3TX8 A;  4ED7 A;  1X5S A;  1SB6 A;  4ED1 A;  3CCM S;  3CGI A;  2W9B B;  1NJI T;  4KR0 B;  4MYT A;  2QC3 A;  1M5K C;  4C8Y A;  4IO9 Q;  2MKK A;  2C2R A;  4K8R A;  2FB0 A;  2EKY A;  2UXC F;  1H2T Z;  3SFG A;  1R6V A;  4NMX A;  1XNR J;  5AJ3 J;  1X4B A;  4KC5 A;  1WNE A;  3ET6 B;  1ZA1 B;  3T9N A;  1QAJ A;  1VS3 A;  3UCU P;  4B3S F;  4EUV A;  2DD8 S;  2VH7 A;  2F1F A;  3B78 A;  2B3T B;  3DOM A;  4XAK A;  1EZZ B;  5J2P A;  1EET B;  2AKW B;  2P9E A;  4QCL A;  4DLE A;  3HX9 A;  4KY3 A;  4TYB A;  1FK9 B;  5CYM A;  3IR7 B;  2XSF A;  5K8P A;  5KFR A;  3J80 Y;  3TA0 A;  4ZP6 A;  4C11 A;  3AD8 C;  2YNF B;  1OS5 A;  4F3Q A;  2ZM6 F;  5GME A;  2EFV A;  2VUG A;  2PD1 A;  4C0O C;  4B3M J;  3D3B J;  2HNZ A;  3CJQ A;  5ETP A;  4DL4 A;  5E5N A;  3D67 A;  1G7C B;  4UUX A;  2YKN B;  2XGP A;  3GWC A;  2QLW A;  3K5L A;  1DTQ A;  3R5G A;  3LPE A;  2LP4 A;  1VBY A;  4RW7 A;  2XCP A;  1NKB A;  2EBE A;  2BJE A;  2M7S A;  4OZN A;  2IDE A;  5FDL B;  5DDR C;  2QYC A;  4NZ0 A;  4NML A;  3W5Y A;  3IWL A;  3KHH A;  1Y7P A;  3HHL B;  2DNR A;  1Q53 A;  2WOM B;  3DCA A;  4IDK A;  2L41 A;  3W1Y C;  4BHQ A;  3BBC A;  1U48 A;  4JI2 F;  3M8R A;  4P7T A;  1UVK A;  1WF0 A;  4J9O A;  4DV7 J;  4M5M A;  1WTF A;  5I3Q A;  4NRU A;  1HR0 F;  3EPI A;  4USW A;  3NGT A;  1KVI A;  3NS6 A;  4OYP A;  3NCP A;  1S72 S;  1NRK A;  5H9E J;  4W4M A;  3J7A 1;  3JSY A;  4LSN B;  3N79 A;  4DBQ A;  2OIH A;  4GRS A;  4DL3 A;  2YX7 A;  1AZS B;  3CCV S;  3V81 A;  5BYR A;  3LO3 A;  2DRD A;  3G82 A;  2IYG A;  4CTA B;  2KM8 C;  2DXF A;  1FJE B;  1QJH A;  4RX6 A;  2AJ1 A;  3FSI A;  4X62 J;  4G1I A;  3FC9 A;  4N8N A;  1FES A;  1HAR A;  2FGC A;  2NSB A;  2ZH4 A;  3KLF B;  3F56 A;  4K7Q A;  4K5R A;  2N3O A;  2LQB A;  4OI4 A;  2MDA A;  4EEY A;  4ES3 A;  3OLB A;  4O3Q A;  4KPC A;  1JQG A;  3MM5 A;  2PDA A;  3TA2 A;  3DOL B;  4M5D A;  1HI8 A;  1A0O B;  1RAB B;  2YNF A;  4TLR A;  4BS2 A;  3CCE S;  4X64 J;  2Q66 A;  1M0S A;  1FD2 A;  1RT2 A;  5H9F K;  1R43 A;  2W7O A;  4BWM A;  4FXV A;  3V6D A;  3K2Y A;  4AL6 A;  2I38 A;  4I6A A;  1RAE B;  1SJR A;  2ZE2 A;  5J2N B;  4TXS A;  4X4R A;  5KFC A;  3D6T B;  4Y0F A;  2X3G A;  2GA7 A;  3ENV A;  5FD1 A;  4RNH A;  3LP0 B;  1TKT A;  2DCU B;  2W2N P;  5C24 B;  4IH6 A;  1G6B A;  2ZVS A;  3TVK A;  5FDL A;  2F4V F;  4AXJ A;  3RRK A;  1FF2 A;  5KT7 A;  1NHV A;  1RHK B;  1C0U B;  2IM0 A;  2OGU A;  1L3T A;  1QUP A;  4UY8 5;  1C1B A;  5MAO A;  1WEX A;  1RT3 A;  1TL7 A;  4FYD A;  5M2R A;  4F4W A;  3QBC A;  4NLU A;  1SH2 A;  2BRK A;  3QPI A;  3ZZU A;  1FDA A;  3GLJ A;  2XC9 A;  4QIF A;  1VC6 A;  1NK7 A;  1HNX J;  1UMJ A;  4FS1 A;  5G4D A;  2RHQ B;  3AH6 A;  1SC3 B;  5IC6 B;  3GIL A;  2ADC A;  2YWH A;  4OX7 A;  4BC9 A;  3MAQ A;  2G9O A;  1W7W A;  4F2S A;  4OX8 A;  3I32 A;  2B4O A;  3I5C A;  2A10 A;  3UD5 A;  4DZ6 A;  3MEK A;  3I0S A;  3I4P A;  2V68 A;  4M63 A;  1RWX B;  2OFG X;  4RR5 A;  2B4P A;  4AD6 A;  4NYO A;  4K0K J;  3D66 A;  3HO1 A;  1SXL A;  1TTH B;  4B9V A;  3BPD A;  2GHV C;  1C1C B;  2FQQ B;  2I0X A;  1CC7 A;  2BR0 A;  2DNN A;  2F8E X;  5H1S V;  3O3L A;  1VMB A;  4NPO A;  1RYR A;  2HQG A;  4L6V 3;  5DDP C;  1XTZ A;  1QSS A;  3DOL A;  4NOH A;  2KU7 A;  5IM0 B;  3BQ0 A;  5C5J A;  4N41 A;  3MM9 B;  1P8G A;  2XEX A;  4LRA A;  2LYV A;  4TNO A;  4OQJ A;  2P9C A;  4USH A;  1I1G A;  4HYK A;  1UWB B;  2ATC B;  1OY9 A;  2B7B B;  2BW2 A;  3BO3 A;  3FCV A;  2B0G A;  2IVY A;  1NDC A;  3HHL C;  2W2Q P;  4ALZ A;  2D3U A;  3N0V A;  4DJB A;  2UUB F;  5KG0 A;  1H2V Z;  1FO1 A;  3M8Q B;  5IS2 A;  2GGP B;  1Q8I A;  1FT8 A;  1NXI A;  1C0U A;  5D3G B;  5GAE I;  4J9K A;  2FJA B;  3PO5 A;  3RAM A;  1X7V A;  1GX5 A;  2L9D A;  1D9F A;  3CW2 C;  4EBC A;  3AQP A;  1VBX A;  2BV3 A;  3EDR B;  2EFG A;  3K8W A;  3TQE A;  1U2F A;  2IMO A;  3BO4 A;  3KTQ A;  1VRT A;  3TUI C;  3RR7 A;  2V2Q A;  2KZM A;  3DXB A;  2WON A;  2FDN A;  2EC2 A;  4EWT A;  4WFY A;  1JMT A;  3PV8 A;  1JLA B;  1N54 B;  3IRX A;  3P5B P;  3MOJ B;  3R5D A;  4M94 A;  3WHI A;  5T14 A;  1TUG B;  1B4S A;  3FK4 A;  2MY7 A;  3CO0 P;  1HBO B;  4ITS A;  5KOW A;  4K2X A;  4YY3 F;  3HZE A;  2B5J A;  4OZJ A;  2IFX A;  2UXB J;  2XG8 A;  3Q22 A;  1Q4R A;  3JQJ A;  3KXD A;  3ULH A;  2YQ3 A;  2XLK A;  3PKM A;  4NXN F;  2M52 A;  3LP2 B;  4QIG A;  4HR2 A;  4B9L A;  2QIF A;  1YBU A;  3DLK A;  3MM9 A;  5G0R B;  3A1Y G;  2BE2 B;  1PO6 A;  2ROG A;  1LV5 A;  2JJ4 D;  2IRU A;  4UT4 A;  1RBO B;  4QYR A;  1LFW A;  2P9G A;  3SV4 A;  1MML A;  2DHG A;  4O3S A;  3O2I A;  3ENW A;  3M2U A;  4WFA Q;  1JLC B;  2NPI A;  1TL1 B;  3NOG A;  2VG7 A;  3MPY A;  2KT5 A;  4HH0 A;  1CBK A;  2XUL A;  3EUN A;  4CLF A;  3TZW A;  1LKZ A;  3EGN A;  1TKZ B;  4ZIV A;  2P2C B;  4LVN P;  4FF3 A;  4HEA 9;  3I5B A;  2AEF A;  5AXL A;  2ZUG A;  2VBX A;  3AXM A;  3PX4 A;  2V67 A;  4J9N A;  2G2Z A;  1BMQ B;  4DX6 A;  5DG7 A;  5F9N A;  1FRI A;  1GH8 A;  1PGZ A;  4PCQ A;  2DIS A;  4ECY A;  3CNQ P;  5A8W A;  3CPW R;  2WRM A;  2CA9 A;  4H4K A;  1CLF A;  4YB5 A;  4BC7 A;  2RQ4 A;  4NLY A;  4ZVH A;  4URS A;  4KH1 B;  2Z56 B;  3KLE B;  3K0J A;  5IC4 B;  2RDJ A;  1GMW A;  3PFO A;  4RPF A;  4XTT A;  5KFJ A;  1VQM S;  5KFZ A;  2W9C B;  3I0R B;  5KFP A;  4RW9 B;  3FMW A;  4LR9 A;  4E2F B;  5HVG A;  4TQR A;  1HNI B;  4HHJ A;  3L4B C;  1NHK L;  3AA8 A;  3TZY A;  2IYI A;  3G86 A;  4QU6 A;  3WZ0 A;  4IRC A;  5ETK A;  2OTL S;  1IBM J;  3FRY A;  1X9W A;  2VC0 A;  5F8I A;  3Q24 A;  3D2W A;  2ZZM A;  5L1J A;  4UQT A;  3PW7 A;  1KWM A;  2AGQ A;  3LUY A;  2KTQ A;  4OYZ A;  3PRV A;  1N5T A;  4PG4 A;  5SZT A;  2J8S A;  3BYR A;  1FRL A;  2CG4 A;  3GFY A;  4A8W A;  1VK8 A;  1ZYQ A;  3D1H A;  1CQM A;  2AYB A;  3CJT A;  2J9C A;  3UVJ A;  1TV6 B;  3LAL A;  1WG5 A;  3KYL A;  5A8K A;  1S1T A;  1W2I A;  1N5Y A;  3QZ8 A;  3MGJ A;  4DL6 A;  1SV5 B;  3NG8 A;  3HDS A;  3M32 B;  4LF7 J;  3OR1 A;  3M6X A;  4HTI A;  3HHN B;  3X1L B;  2G1D A;  2E7X A;  3S8S A;  2DPI A;  4X4T A;  1VK3 A;  1UFK A;  2KXF A;  3DDK A;  3W60 A;  4Q5V A;  3NRB A;  1CJV A;  2NXE A;  1PIL A;  1AB8 A;  3HKZ D;  3H2U B;  3QJL A;  2O1P A;  2QG9 B;  5EWG A;  2IA0 A;  1OSC A;  2DNG A;  2QT7 A;  1FRK A;  2VBY A;  1FVQ A;  4I68 A;  1XK8 A;  5JVH Q;  4CO1 A;  1OQ6 A;  3MTJ A;  4FYW B;  4LF8 F;  2ZJR Q;  1N36 J;  5C2C A;  2GML A;  5DET A;  4KO0 B;  3MPD A;  2YNI A;  5D77 A;  3OFG A;  1HNV A;  2DH9 A;  1MRO A;  4Q43 A;  3PZP A;  3DOK B;  2WCX A;  4OL8 A;  1WTB A;  2HQ3 A;  1NSA A;  3OUY B;  2CPJ A;  4CLU A;  3O6Q A;  2VC1 A;  2W25 A;  3JYT A;  3UR0 A;  5LMN F;  4KHP F;  2C2D A;  1PBU A;  3IO1 A;  5KT4 A;  2GC8 A;  4FKX A;  4NA1 A;  4N56 A;  2ZOF A;  2LCW A;  4NAS A;  3IM8 A;  3GON A;  3DLL Q;  1S6Q A;  4KV8 A;  4ZN1 A;  3MXH P;  1BC6 A;  2G2O A;  5EGY A;  3VAI A;  2DKO B;  5AE2 A;  2DNK A;  4CIO A;  5A76 A;  4MJK A;  5KFS A;  1X0P A;  1FFW B;  2M8H A;  2MZR A;  4LRB A;  1DQ9 A;  2CPY A;  3KFW X;  2XM3 A;  2DJW A;  4DR4 F;  3W62 A;  1R8H A;  1WDT A;  4C3M A;  1Y3J A;  4NZ6 A;  1Q79 A;  3CJ0 A;  5CCM A;  5GAH I;  1ZET A;  1F9F A;  3JQK A;  2XMW A;  1UCN A;  3OTE A;  3ISN D;  1SV5 A;  3M8P A;  1PJ7 A;  3TAR A;  2ZHA A;  1QD1 A;  3BN4 A;  1CUL B;  4PYD A;  1SKU B;  3DRR B;  3W8P A;  4M5L A;  3UPF A;  3S1T A;  1TZ0 A;  2RS8 A;  4CO5 A;  3DRS A;  2I2Y A;  2V8P A;  2YWE A;  2D7S A;  3I56 S;  5E3Q A;  2P8I A;  1TKD A;  1UJ6 A;  3Q8Q B;  3MTK A;  3MD3 A;  3DMJ A;  3H59 A;  1K73 T;  2EG1 A;  3NGR A;  3FNN A;  3Q83 A;  2DY9 A;  2LKZ A;  4RW8 A;  2JH3 A;  3SI8 A;  2WVF A;  2CNO B;  2MHE A;  3MF5 A;  3DKD A;  2NUH A;  4QR1 A;  4UZB A;  1D9A A;  1U02 A;  3KUH A;  3KK1 A;  3H5S A;  4FNH A;  2Q1L A;  2Z57 B;  2IAJ B;  5DGA A;  1RAA B;  3WC0 A;  2U1A A;  4ICL B;  3VAG A;  1HQU B;  4DV4 F;  2A2C A;  3MD1 A;  3O5T B;  2OSQ A;  1UPP A;  3IR6 B;  2BOP A;  4LBP A;  4Y28 C;  1SVD A;  1S1V B;  4MFB A;  2LFV A;  2W9A A;  1URR A;  2IRY A;  4JV5 J;  2AWZ A;  3M30 A;  5D4L A;  5ETT A;  2XY6 A;  3AJ2 A;  2UP1 A;  4PQU B;  2HZA A;  1VQP S;  1RAD B;  1RHQ B;  2CPX A;  4ECR A;  4RNM A;  2R8J A;  2B4U A;  2VDH A;  3H90 A;  1TU0 B;  2ZM6 J;  1RT1 B;  3BSN A;  1KNZ A;  3CF5 Q;  3BM7 A;  2LVW A;  2HS4 A;  2ZC3 A;  5B0B A;  2BUN A;  4J5O A;  1T3N A;  4ID5 A;  5KFA A;  4NLR A;  3J7Y I;  2VQF J;  3FJ2 A;  4PPD A;  4ZJQ A;  1VLO A;  2CZV C;  2CXE A;  4F25 A;  1JWW A;  5A2Q Y;  1BWV A;  1FRH A;  1R8A A;  1U26 A;  3M2R B;  2Z4P A;  2LEC A;  4TVA B;  3MM7 A;  4AUK A;  3S01 A;  2D69 A;  5LMU J;  4J9S A;  3PW4 A;  3NBP A;  1F3V A;  2W8K A;  1FJG J;  1T05 A;  4QYZ J;  4DR6 F;  2I5J A;  3LAM A;  2F9D A;  4C8L A;  3H5Y A;  4JUZ A;  1S76 D;  4ZLJ A;  3PR4 A;  1U6Z A;  4ZP9 A;  2DO0 A;  3DHW C;  4Q2M A;  4LF6 F;  3IN5 A;  1U1P A;  1X5P A;  1RHR B;  4MIA A;  3CSK A;  3MCO A;  1NH7 A;  4RNO A;  4HVZ A;  4MIW A;  3NKY A;  1V5V A;  3BGO P;  4CP5 A;  1Z4U A;  2ZBC A;  4NLS A;  1BGX T;  2FLO A;  1KRP A;  4HKQ A;  3BH6 B;  3HSD A;  4OIX A;  1O5J A;  3JTP A;  2Y1I A;  1JLE A;  3PX0 A;  5BJR A;  4ICL A;  5K14 B;  4OX9 F;  3UN3 A;  1UL3 A;  3GSI A;  4LMZ A;  4YP3 A;  2WHO A;  1ZM3 A;  2VL1 A;  3GV7 B;  4DS5 A;  4FF4 A;  3A4T A;  3CIM A;  1LWF A;  2FC9 A;  1N5Q A;  4IYQ A;  4ZLN A;  3MR5 A;  4ILM A;  2FY1 A;  4PG7 A;  2KKH A;  4OHV A;  3VGV A;  1S1U B;  1GT8 A;  3FCW A;  2YQ1 A;  4M5K A;  3KUE A;  4WFZ A;  4C3K A;  4IFV A;  5J2Q B;  3VVT A;  1RU2 A;  4RUB A;  2PE8 A;  1GTE A;  3GFH A;  3KLH B;  5HQL A;  3TQ1 A;  2RE1 A;  4DUY F;  2V4J A;  2FJX A;  2R7V A;  2QTW A;  3WDO A;  3T9Z A;  1IBL F;  5KAK A;  3TUZ C;  4ECW A;  3GMG A;  1UVJ A;  4K4W A;  3M1V B;  2QSF A;  1X4A A;  2BQ3 A;  3FBC A;  1AXQ A;  3HI9 A;  2DNH A;  5LSO A;  4KT0 C;  3E01 A;  2HWI A;  4DQR A;  2K8G A;  2QGF B;  4Z37 A;  3MUV P;  2FVC A;  3NWR A;  2YPZ A;  2KO1 A;  2HBY B;  2XYP B;  1CVJ A;  1B0T A;  6AT1 B;  1KQG B;  5L1L A;  3QRQ A;  2NUU G;  3NAH A;  2H5J B;  3PEH A;  3KOA A;  2E5J A;  5AXM A;  3VAL A;  4DMZ A;  4LRF A;  4Q8E A;  5HVF A;  4YB1 P;  3THT A;  5ETN A;  4OYB A;  5DZ7 A;  2FY8 A;  4JV0 A;  2OPS A;  3DGP A;  4JI5 F;  4KBI A;  1RAO A;  4U8V A;  4KFB B;  1KLM A;  1LXJ A;  4R8U B;  3VZH A;  2EFQ A;  1DHM A;  2UVU A;  3FBB A;  3DLH A;  1IKV A;  5D6G A;  3FDS A;  1QSY A;  4WU2 A;  2YWG A;  4WII A;  4CYU A;  1NME B;  3PIP Q;  2HYI B;  4LF5 J;  4NXM J;  4D3H A;  3R1L A;  1RWU A;  2EW9 A;  3M8Y A;  1HQE A;  2KXN B;  2DXD A;  2BE9 B;  3TVY A;  4O44 A;  2WSF C;  1Y00 A;  3BR8 A;  4BLG A;  2QL5 B;  1EP4 B;  4OJ3 A;  2B51 A;  4A48 A;  1FWP A;  1RT6 A;  2ASJ A;  3SSQ A;  1RT4 A;  2DIV A;  1WSR A;  4L73 A;  4RBT A;  3ITH B;  1TFY A;  2DR7 A;  2OLW A;  3D0I E;  2D3O 1;  1K0V A;  2UU9 J;  1F9E B;  4GKK F;  3J81 Y;  4F3M A;  3ONQ A;  1SKR A;  1K8A T;  2ZUA A;  2HHU A;  1CJT A;  1RK8 A;  1FJC A;  2JZ5 A;  4M95 A;  4FBT A;  1N33 J;  2QMX A;  3F41 A;  4RLE A;  2B43 A;  2WAQ D;  1NSK L;  2RS2 A;  4FPI A;  5IWA F;  3KJV A;  4RNN A;  4DR5 J;  1G2E A;  1VBZ A;  1T03 B;  5IV3 A;  4UY8 T;  4LSL B;  3IR5 B;  4EU0 A;  3IG1 B;  3RJM B;  1N34 J;  2EG2 A;  2RUS A;  5CYQ B;  4P2S A;  1AA1 B;  3DI6 B;  2PI4 A;  4Q0B A;  2HQC A;  3CDA A;  3WBZ A;  2E9T A;  3GG1 A;  2HQF A;  2J9D A;  1S1X A;  1RTH A;  1LNQ A;  4RW4 A;  2J0S D;  3DYA A;  4B3O A;  1HL6 A;  3KMQ A;  1DTT B;  3FGV A;  2LQ8 A;  4IG0 A;  2Z2M A;  3THV A;  1N32 J;  5A2Q U;  4DV2 J;  1X0F A;  1V6H A;  5KFM A;  1UW9 A;  1FXD A;  3CDE A;  3VV2 B;  1MMN A;  3KWM A;  2RF2 B;  1OY6 A;  1KQS R;  5IZH A;  4KGK A;  3PW0 A;  5A0Y A;  1JK9 B;  3DFE A;  2V6A A;  4USV A;  4H4O A;  1VC5 A;  4DPO A;  2GNK A;  2WB1 D;  3POT A;  5BR8 F;  1SUQ A;  3MEE A;  3HP6 A;  2B7C B;  4I64 A;  2ASY A;  2ZDP A;  5L9X A;  4DPU A;  2FPH X;  3AD7 C;  4NXN J;  1SIZ A;  1F9H A;  3MED B;  3MZI A;  1EP4 A;  5D0E A;  1FEE A;  1FEH A;  2HIQ A;  3C6T B;  2KRB A;  4CM0 A;  1LWX A;  2DO4 A;  1U1N A;  1RHJ B;  3BGL A;  1M5S A;  2YNH B;  3U27 A;  1H7X A;  4OLP A;  4WZM A;  4GO5 X;  3W2V B;  4X4P A;  3ITH A;  2U2F A;  7AT1 B;  3UNY A;  2C2M B;  3HXM A;  5IT9 Y;  3TX0 A;  3T41 A;  4J9L A;  2MQ8 A;  3KK3 B;  3BSC A;  3CUN A;  5KFF A;  4ANE A;  2WK4 A;  1JLB B;  3SXL A;  2V9W A;  3MMB B;  2XQC A;  1E6Y B;  4MH8 A;  1Y4Z B;  2IVF B;  2MKJ A;  1RLC L;  1UP1 A;  3ISN C;  2V8D A;  3A3N B;  3PHT A;  1RKJ A;  1UFW A;  3SZ2 A;  1OQ3 A;  3ELH A;  1Y9O A;  2DEJ A;  3DI6 A;  4DZD A;  1B64 A;  4F36 A;  1X4C A;  2FHO B;  2YH1 A;  1D3W A;  3TAM A;  3FVY A;  4O0I A;  1HBU A;  4WP9 A;  1B7Y B;  1IJE B;  2Q79 A;  1AUD A;  1X5O A;  4CO2 A;  4DI6 A;  4EBE A;  1RWN B;  2UUA F;  2ZBR A;  3KLI B;  3LGH A;  3WQP A;  2PI5 A;  1IKX A;  2VFR A;  5LT5 A;  2W2M P;  1DBD A;  2GZO A;  1VIO A;  2C22 A;  4A4J A;  1Q78 A;  2DNQ A;  1TKX A;  2B9Y A;  1WHY A;  3HSZ A;  2B6A B;  5DQG A;  2AT1 B;  5IT4 A;  3OL6 A;  1C0T A;  4DSL A;  4FBU A;  2VG5 A;  2AYE A;  3CO9 A;  1WOR A;  1U8W A;  2QL7 B;  3ZZY A;  1WDD A;  4JI7 F;  1FTR A;  4DWI A;  1R0A A;  2ZH7 A;  3QGH A;  5E3P A;  4X65 F;  3PW2 A;  1QTM A;  3TJ9 A;  2F4F A;  4G65 A;  2QA1 A;  3R9L A;  3UQS A;  1SJ4 P;  3OTB A;  1AFJ A;  1VQ7 S;  3EVO A;  4DV5 J;  3UN5 A;  2NYI A;  2ZD1 B;  2MQO A;  2ERR A;  2E1C A;  4Y2I A;  4JOU A;  3HFK A;  3CMA S;  2HVH A;  5IT0 A;  3T1Y F;  3MM6 B;  3L09 A;  3RUB L;  1S5Z A;  5J1P A;  3JSB A;  3C8Y A;  5KFK A;  2K2P A;  3PYD A;  1NJZ A;  1W25 A;  1NK8 A;  5D0G A;  3DLB A;  1IKW A;  3GZ7 A;  4C0H A;  4UQG A;  1HBM B;  2VFV A;  1XMB A;  4ENO A;  4TY8 A;  2KB2 A;  1LQ9 A;  4QJV A;  3M05 A;  2BKO A;  4PG6 A;  2C3M A;  1F60 B;  3RB0 A;  5I42 A;  2H4W B;  3HVT B;  3MEG B;  5BXI A;  2QJ3 A;  3CCT A;  1NPP A;  4OV6 A;  2VFS A;  1RIS A;  4B3R F;  1S9E B;  1XJW B;  4QWC A;  1XNQ J;  4JP8 A;  2NRE A;  2N3L A;  4W90 B;  2BZ2 A;  1MNE A;  3OHB A;  2CFX A;  3E51 A;  4A8M P;  1RT5 B;  1O8B A;  3OVS A;  3NL0 A;  1N88 A;  3C14 B;  1YJV A;  5E0O A;  3GU0 A;  3DDN A;  4ZPA A;  2R8K A;  2VOO A;  1B70 B;  3KLI A;  1HQ2 A;  3PYE A;  1C2P A;  3TAQ A;  5KFX A;  4PG5 A;  2M0G B;  2L9N A;  3I6P A;  3NEK A;  1WSV A;  3X3U A;  1VRU B;  3Q2T C;  1VDH A;  4ES2 A;  2V34 A;  4KHP J;  3F44 A;  1YI2 S;  2B6A A;  2YKM A;  2MQP A;  1UKU A;  3CE8 A;  2BJ9 A;  2K06 A;  4P52 A;  2HWT A;  2VPZ B;  4ELT A;  3HVA A;  2HFN A;  3MMJ A;  3MMA A;  3OL8 A;  4I2Q B;  5F8N A;  3CJR A;  2V2V A;  1RCX B;  1Q7L B;  2Q3P A;  3AOC A;  4PR6 A;  2HK2 A;  1GXT A;  2GHP A;  2F8H A;  3IA0 A;  3N6N A;  4KGV B;  5F8L A;  1HWI A;  4JI4 F;  3MUT P;  2QX0 A;  3CCZ A;  4IQX A;  3M9M B;  3MEC A;  1F1B B;  1GXU A;  4HAC B;  4U8Y A;  5KFG A;  2GVZ B;  4WCE Q;  1T9V A;  4DCP B;  3K17 A;  4U7U K;  2VD3 A;  3HK2 A;  1U2C A;  1RTJ B;  1DAX A;  1WD6 A;  1SKS A;  3IBC B;  2BAN A;  5LOQ A;  3GIR A;  2NLW A;  4U95 A;  3LOU A;  1FDD A;  2JFK A;  4IOC Q;  4QWE A;  2OPR B;  2Z2L A;  4EI2 A;  1E6V B;  2WVC A;  2KL8 A;  1U0H B;  1YSJ A;  5ETO A;  4WP3 A;  5CZV A;  2J9D E;  2DHA A;  3ILI A;  2GO8 A;  2HAI A;  3NMR A;  2J6T A;  2J76 E;  4B08 A;  1SKW A;  4I7F B;  5L8R C;  4DFM A;  1X4D A;  2CAD A;  4RU9 A;  3E3X A;  3GQC A;  4DR2 J;  5RUB A;  3E2E A;  4JI0 J;  3BN7 A;  1YIT S;  2HGL A;  3SV3 A;  1LW0 B;  2CQB A;  3W63 A;  1S9E A;  4PXC A;  1OSD A;  1UET A;  2IJR A;  1V3Z A;  2B9X A;  3EWG A;  4A8O A;  2VQE J;  1H73 A;  5GAE U;  3TZZ A;  3G6V A;  2MYF A;  2BQR A;  1WC1 A;  1FDN A;  2BBE A;  1NU4 A;  4MKY A;  2HMI B;  3M2V A;  1X4E A;  3T1H F;  4N76 A;  4JB8 B;  1YIJ S;  5HLF A;  2APO A;  4NE9 C;  2HFS A;  4QIE A;  3LP1 B;  5ITH A;  4LF2 A;  2AEJ A;  4FF1 A;  3TEH B;  1PKU A;  4PWD A;  3MR6 A;  2QA4 S;  1RHM B;  5J2M A;  4F4A A;  1HYS A;  3QO9 B;  2E29 A;  2UXD F;  1EQ0 A;  3BGR B;  1YJU A;  2K1R A;  2KFN A;  2N4D A;  2ZH6 A;  2GQ2 A;  3MMC A;  2VF3 A;  4F67 A;  1WKJ A;  3I96 A;  3QIP A;  2F7V A;  3FFI B;  4ZLP A;  3CJ4 A;  2BQU A;  3SQG B;  2E5L F;  3CDB A;  1UAW A;  4NI2 B;  4DQP A;  3QGI A;  4IR9 A;  4USJ C;  4NCA A;  3OW2 R;  4Y34 A;  3EZ5 A;  2HRY A;  1NEE A;  3GIM A;  2NS1 B;  3CD5 A;  2DR9 A;  3C6U B;  4ZIT A;  1TUW A;  2OSR A;  1S4F A;  1JLF B;  1E6V A;  4U9R A;  3PR5 B;  1M5O C;  1UA1 A;  3N9U C;  5A8R A;  2DR6 A;  3Q2S C;  4ED0 A;  4P73 A;  4UOG A;  5HBM A;  1ZZF A;  4NRT A;  4XK8 C;  5KFV A;  4IG3 B;  3VF0 B;  3SCJ E;  2Y0S D;  3UI3 A;  4OYA A;  1I6J A;  3MCN A;  3KK2 B;  2MZQ A;  4U67 Q;  1VR6 A;  5DRK A;  3IFE A;  3OXG A;  4I7F A;  3VGT A;  2XZT B;  5M2P A;  2MKC A;  1YLX A;  1U6F A;  2OPQ B;  2HND B;  1T3O A;  4CCH A;  4LF6 J;  1NSQ A;  1WOP A;  1OPI A;  2HHP A;  1S0M A;  3JSM A;  5HMZ A;  2HHW A;  2RU9 A;  2CDR B;  4OZ5 A;  4O4G A;  1WUU A;  1XMQ F;  2OML A;  2RKI A;  5DO2 A;  1RWV B;  4YQW A;  2HHH F;  1NDL A;  4IH5 A;  3ZZ0 A;  2LA4 A;  2XMV A;  2DRA A;  1IM4 A;  4ZN3 A;  2DT9 A;  1TL3 B;  1QAY A;  3MR7 A;  1KVJ A;  1PYT A;  3ILL A;  3VHQ A;  1NSP A;  2Z58 B;  2NXC A;  3UCZ P;  1GNK A;  3L9Z A;  3W5Z A;  4NLD A;  4Q8F A;  4DPX A;  2NXJ A;  2EFN A;  4X66 J;  1S1W B;  4AL5 A;  2MLY A;  2WVE A;  4ZVE A;  3BRE A;  1HA1 A;  3PXG a;  1QE1 B;  1Y3K A;  3HKW A;  3KJN B;  4DPT A;  4P75 A;  2DNL A;  1S6U A;  4DR7 F;  3MPW A;  3MCM A;  4GVB B;  1YJ9 S;  2OFH X;  4WXW A;  2LXI A;  4WK1 A;  2CJA A;  1NND A;  3T3F A;  3D0H E;  2FTR A;  3W61 A;  4JYA J;  4U7C A;  1BXN A;  3CT9 A;  2XSJ A;  4KQZ A;  1RWO B;  4AND A;  1SQF A;  4FXD A;  4ZA1 A;  4RUC A;  4WPA A;  3TYT A;  4LR7 A;  3ZZZ A;  2DPJ A;  1HW8 A;  1XIQ A;  4OJH A;  1D09 B;  2JSX A;  4USM A;  4JI1 J;  4LFA J;  2J0X A;  2PGC A;  5JUM A;  3SSS A;  4B9N A;  2A2D A;  2IIH A;  3VTI A;  1PSD A;  4FVC A;  1WHV A;  3BJY A;  4U7U D;  2VV5 A;  5K8O A;  2FHK A;  1XMO F;  3N5F A;  2XMA A;  2D3Z A;  1N8R T;  4HI2 A;  4G1Q A;  2VU5 A;  3GCX P;  4DDF A;  1LEO A;  3PTW A;  4M5H A;  2OAU A;  1H74 A;  2GW8 A;  1AYE A;  1NBE B;  2E1R A;  2RRB A;  1LW2 A;  1RP5 A;  1VBK A;  5CZX A;  1JXE A;  1NUE A;  3IC1 A;  4GC7 A;  4LF4 F;  1N6Q A;  4XO0 A;  3T5L A;  2LLZ A;  2V8V A;  1ZAV A;  1RAJ A;  4I67 A;  3QGG A;  1N48 A;  5AE3 A;  3KHG A;  3PHE A;  4CH0 S;  1ZZN A;  1IKY A;  2OI2 A;  2Y1R I;  2CQH A;  1VCT A;  1X5T A;  1YVF A;  4DV1 J;  5IFM A;  2F3J A;  4QIV A;  3UO0 A;  1Q8K A;  3R2C J;  1WC0 A;  4Y2C A;  4D3G A;  4C4W A;  4XPC A;  1UVN A;  2A3J A;  3L7O A;  1Y10 A;  2XMT A;  3CCQ S;  5E7O B;  1DY3 A;  5DS7 A;  2CPH A;  1A9N B;  3US5 A;  1HD0 A;  3K5M A;  1CJU A;  1FE4 A;  2IBK A;  3UDC A;  2BJ1 A;  3B54 A;  5FJ4 A;  5C2G A;  1IM6 A;  3PRB A;  3DOM B;  5J2P B;  2J0Q D;  3LQV A;  3GFZ A;  1S77 D;  5CYM B;  1J5E J;  5EUH A;  3F73 A;  3H4D A;  3LGN A;  3AB2 B;  4C11 B;  1NCL A;  4IFY A;  4EZ6 A;  2IHR 1;  4M5J A;  4ZCL A;  2F9J A;  1WJ9 A;  1XEZ A;  4WWS A;  2HNZ B;  4F8R A;  3OR2 B;  4TU8 A;  1YJ7 A;  1SQE A;  4OZ1 A;  4WF9 Q;  1EHW A;  4LFC F;  3MDF A;  4DV6 J;  3D6M B;  3NS7 B;  1DTQ B;  1EJ7 L;  1ZPW X;  2Q6C A;  2OD6 A;  3EGV A;  2QLF B;  4RW7 B;  1F5C A;  2PA8 D;  1RT7 A;  2R7X A;  4M8L A;  4M5I A;  1FKO A;  4ZCI A;  1H2U X;  2P6S A;  1VOM A;  5HJY A;  1QSL A;  2AMC B;  4GO7 X;  3EYZ A;  4IDK B;  5KFE A;  2MB0 B;  3MM8 A;  2FUG 9;  2JC0 A;  1UWA A;  3R7N B;  3JSR A;  2AJQ A;  4OZL A;  3QSY B;  1O0P A;  1OJ4 A;  2DGO A;  1U6B A;  1KOH A;  2N4C A;  3DLJ A;  3KKF A;  1U24 A;  2M2B A;  2BJD A;  4RW6 A;  4F2R A;  3BSA A;  4K4X A;  4PKD B;  2ZVI A;  2YKA A;  1SJ1 A;  4OHX A;  3GII A;  3DLG A;  2GIQ A;  4HT5 A;  4CNZ A;  2DR5 A;  5H9F J;  3GSD A;  1K1Q A;  1S12 A;  1YKW A;  1SJQ A;  1X4G A;  3Q8S B;  3DRP A;  3RRH A;  3GPA A;  5KFH A;  3V81 B;  5J1E A;  3RBX A;  3G82 B;  3QMQ A;  3UWT A;  2AHO B;  3BR9 A;  2QV6 A;  3AB4 B;  1MN9 A;  4WFB Q;  3QZ7 A;  1JB0 C;  3SCL E;  5E3A A;  5HAO A;  1XNR F;  2B56 A;  3J7Y U;  4O4R A;  1QVG R;  1U1M A;  3U1M A;  1YZ7 A;  3NGS A;  1FX4 A;  1H0H B;  1S4E A;  4PUO B;  2MQN A;  1HI1 A;  4ZVT B;  3R3T A;  3EVW A;  2EFO A;  2RQK A;  5LJ5 Y;  3MM5 B;  3G9C A;  4EGL A;  4ED4 A;  4ZP7 A;  4JV2 A;  3FEY B;  3EJM A;  5HMY A;  2M5Y A;  4M5D B;  2MKH A;  1ACM B;  2EXU A;  2GX8 A;  3OT9 A;  3VGU A;  1RT2 B;  1XN9 A;  2RB7 A;  5EWF A;  8ATC B;  3TAP A;  1F3F A;  4QBU A;  4F0M A;  1SC6 A;  4ZK7 M;  3IM9 A;  3OR2 A;  4DQQ A;  1VLY A;  1OWX A;  3V6D B;  2UUA J;  4NYP A;  5DQI A;  4B3M F;  2PMZ D;  1UEK A;  3G2X A;  4HHH A;  4AQY J;  2ZE2 B;  2MST A;  2ZOG A;  4C0B A;  1TKT B;  3FKB A;  5DDQ C;  2QMW A;  3PCO B;  2UUT A;  4DL5 A;  1IN0 A;  2J9E A;  2I6W A;  3UW1 A;  2GHW A;  2AIR B;  4DSE A;  3HJF A;  3M9N B;  3GB0 A;  1TVR A;  1N5S A;  2GS8 A;  3H2V E;  2WVD A;  4X4S A;  1FWL A;  3KG1 A;  1C1B B;  4KHM A;  3D5M A;  1NJX A;  1LK5 A;  1RT3 B;  3F0N A;  1GMW D;  1F2G A;  3FZB A;  1TL7 B;  3BEG B;  4DV3 J;  3C3L A;  4ILL A;  4M5N A;  4DQS A;  2LEA A;  4ZVU B;  3VAH A;  3HT3 A;  1J2V A;  2RAQ A;  4OYW A;  5F8H A;  4DV7 F;  2PO4 A;  3UE2 A;  4ECS A;  4ZOS A;  1IBK J;  4DQI A;  2A1B A;  4M5G A;  2LXU A;  2V2K A;  2YTC A;  1UEU A;  5GAD I;  1CS4 B;  3R5A A;  1MU2 A;  2CG8 A;  1NB2 A;  1RXO B;  4Q44 A;  2AYG A;  2OKQ A;  2ZBI A;  1FRM A;  3I0S B;  2C2O B;  1FFS B;  5E3R A;  3QRP A;  2ZKT A;  3O44 A;  1T8E A;  1WAC A;  3OHA A;  3IAS 9;  1J5O A;  1EAR A;  5IQQ A;  5KFT A;  4EBD A;  1EAY C;  3ZTR A;  1QLN A;  4OI2 A;  3H2L A;  4X62 F;  4PUO A;  2FVP A;  5E3C A;  3OLA A;  2ZH2 A;  3OXF A;  4NWB A;  2GQC A;  4J90 A;  5HRO A;  5DJB A;  2HG4 A;  2I9S A;  3ETO A;  4C8O A;  1I94 J;  2YH0 A;  5JMN A;  3PRD A;  3ENQ A;  5HVH A;  2MJN A;  1BD6 A;  2DYA A;  5HL7 Q;  4LFB J;  2W24 A;  5LJ3 Y;  2H3E B;  3P96 A;  3HF5 A;  3H98 A;  4X84 A;  4LF9 J;  1NAQ A;  4X64 F;  1MWY A;  3DC2 A;  1PG5 B;  3JTN A;  2F65 A;  4ETX A;  1LWC B;  1DJ0 A;  2MTL A;  4CH1 A;  4PWW A;  4ES1 A;  1P9Q C;  2DIT A;  3JB9 k;  3V5R A;  4HL9 A;  3QQC D;  4NLX A;  4IOB A;  1BQN A;  2A0F B;  2Q43 A;  2XI3 A;  3I9Z A;  3IWN C;  2XY5 A;  2JRS A;  2QSW A;  4I69 A;  2V2Z A;  3P45 B;  2KHC A;  1KTQ A;  4FNI A;  3I87 A;  3JAM U;  3CXC R;  3DU5 A;  5FLX U;  3GP9 A;  2FVS A;  3W9I A;  1HNZ J;  2KFY A;  2IA6 A;  4KPY A;  3NY0 A;  2CJB A;  2MZT A;  2A6O A;  2EBG A;  2CUY A;  3ZO7 A;  2E1M C;  4EZ9 A;  1DLO A;  4USK A;  2CZ4 A;  3IP0 A;  2WZ1 A;  1VRT B;  1KP6 A;  1CS4 A;  2A6M A;  3MI7 X;  2WON B;  2GV1 A;  4KJI A;  1HNX F;  2SXL A;  2HGN A;  2GVD A;  4GMK A;  5CCL A;  3IRX B;  4EMD A;  1HPZ A;  3OPK A;  4UOH A;  2HNY A;  4ZDN A;  4HI1 A;  4MMO A;  3QT7 A;  1WG1 A;  5B0C A;  1JKH A;  1OIA A;  3WX8 A;  4NX9 A;  2WVB A;  3OFH A;  4K0K F;  2QA2 A;  1FCA A;  3C16 B;  4TLQ A;  1B0P A;  2B5J B;  1CJK A;  3V4I A;  3TZX A;  2CQP A;  4K4V A;  2QLX A;  5AE1 A;  2IDL A;  4DU7 A;  4WTO B;  1BY9 A;  2KZZ A;  3OSN A;  4IRD A;  4MT1 A;  1H98 A;  2IJN A;  2I1R A;  3DLK B;  3VAM A;  4ZKA A;  3NCR A;  2ALZ A;  2RRA A;  5ETM A;  5LSL A;  2BXJ A;  2DHS A;  1SC4 B;  2LXF A;  2JC1 A;  3W2W A;  2AGP A;  3I82 A;  3M2U B;  3MAA A;  2VG7 B;  2FJB B;  2QFI A;  1LWC A;  1WEL A;  1RI7 A;  3IBW A;  2IVM A;  2Z2Z A;  4ZCM A;  4YHH J;  3RR8 A;  1Y5I B;  2RD5 C;  1GMV A;  3P5T L;  5HI7 A;  2YKO A;  5HMW A;  4DX8 H;  1ZM2 A;  4ZHR A;  1JIH A;  3LGM A;  2R7Q A;  4JI8 J;  2KVI A;  3M4X A;  4CLY A;  1X4H A;  1Q1K A;  3GJR B;  4O23 A;  1CEZ A;  3C19 A;  3R6L B;  1LK7 A;  3R5B A;  1B7F A;  1TP7 A;  3IS9 A;  2M70 A;  4V1A k;  1N4L A;  1S9G A;  4Y2M A;  4LUB A;  1IWA A;  2M3D A;  2YNG B;  4NLW A;  3HM9 A;  5A8W B;  2JEI A;  2Y8W A;  5F41 A;  1VQN S;  2XTJ P;  3J80 U;  3T5H A;  2RNE A;  2XS2 A;  2VOP A;  3P49 B;  3NNA A;  3C15 A;  1Y11 A;  2J8A A;  2G2Y A;  5IQ6 A;  2D41 A;  1SL2 A;  4A8K A;  2L08 A;  5KG5 A;  2EEY A;  5ETS A;  2HVI A;  1KBR A;  1BHN A;  3J7Z 5;  1WC5 A;  4GC6 A;  3R1H A;  5EDW A;  2O67 A;  2BOA A;  2HFZ A;  1FNO A;  3T5J A;  1HFE L;  4HDH A;  4QWB A;  4DLG A;  2P6T A;  4WKY A;  2C2E A;  2UUC J;  5I3P A;  4AFF A;  2DNY A;  3C16 A;  4P2X A;  3QJP A;  5LXR A;  3HSJ A;  1WI8 A;  5HMX A;  1DAR A;  3PEJ A;  4YS2 A;  3SCK E;  4G6V B;  4ZPW R;  5ETR A;  3NNC A;  3PX6 A;  3KG0 A;  5ETL A;  2XWX A;  1NK9 A;  2UXB F;  2XS7 A;  2YKQ A;  3R8Y A;  1IXK A;  4HTJ A;  1H7W A;  4N5S A;  1UZD A;  1JLG A;  2UVR A;  2Z30 B;  3UVJ B;  3NP5 A;  2HKE A;  1H72 C;  5A8K B;  1UVL A;  1S1T B;  2OPP A;  1K44 A;  1N5Y B;  4DV0 F;  3VGS A;  2PFF B;  5K8N A;  3ZTQ A;  5GMD A;  3C46 A;  3HT0 A;  4MIB A;  1U1L A;  3OR1 B;  3ILO A;  3ZZT A;  1N56 A;  1UFL A;  2VJU A;  2GJ2 A;  2VON A;  4ZJO A;  3UDL A;  4WP8 A;  1H3D A;  4WJB A;  1U1R A;  5HP1 A;  3RW6 A;  5KG7 A;  5DG8 A;  2JFD A;  1CJV B;  2HPU A;  2AJ2 A;  3PYG A;  3D68 A;  2OHD A;  1KFS A;  1T7P A;  4CLZ A;  1IWG A;  1HNW J;  1PIE A;  2GAG C;  5DGB A;  4B9U A;  1S7H A;  1OYD A;  5C25 A;  1NH8 A;  3HJV A;  1RBL A;  2ACY A;  2X1B A;  3CVK A;  1TK0 A;  4B3T J;  2YNG A;  4CRJ A;  2VIH A;  3TOQ A;  3QLH A;  1I3O B;  4F50 A;  2RML A;  2YNI B;  2J7K A;  4RWX A;  1HNV B;  3CCW A;  4PXE A;  1Q95 G;  2D1C A;  5KFI A;  4WFN Q;  1MRO B;  3DDI A;  2ZNY A;  1K1S A;  4DL0 C;  2VAS A;  5D4P A;  3N6L A;  2Y1J A;  1QY7 A;  4F02 A;  1BWE A;  1N5V A;  5CHC B;  1WEY A;  3JYT B;  1MLA A;  1R8B A;  3IAM 9;  2IM2 A;  3G8Q A;  2DBB A;  4EYH B;  3QJJ A;  4O3N A;  3TW0 A;  5DZ6 A;  1S6Q B;  3M6U A;  3EX7 B;  4KV8 B;  3JTO A;  1TFW A;  3LTO A;  2EKN A;  3LH2 S;  4LBH A;  1RTD A;  3B4D A;  1XR7 A;  2OEJ A;  3N28 A;  4OZ2 A;  2H51 B;  2LMI A;  2MGZ A;  4FZV A;  2LQ5 A;  4S0M A;  4ED3 A;  3D9B A;  3G96 A;  2CWK A;  2W2P P;  2W7A A;  4OI1 A;  1B0V A;  1VQK S;  2Y1L B;  1IBM F;  1TEL A;  2OH2 A;  2YQ0 A;  1DUR A;  2R7U A;  1ZTT A;  1WF1 A;  1EX8 A;  1JX4 A;  4DR1 J;  4QIW D;  4KSE B;  5HAT A;  4C8K A;  4F4Y A;  4K4Y A;  4FF2 A;  3TJ8 A;  2IC3 A;  1NB7 A;  3M8P B;  3S6E A;  1BQM A;  1IJF B;  1ZAX A;  2R7T A;  4UZC A;  3PO4 A;  4DSK A;  4X4O A;  2GJI A;  2AF6 A;  2NQP A;  2XYG B;  2YWW A;  3JS9 A;  2HSE B;  3M8W A;  3DRS B;  5KT3 A;  2H9Z A;  1VJQ A;  1PAE X;  2DGQ A;  4LF7 F;  1RBA A;  3EMT A;  2UVW A;  1R8P A;  2VBW A;  4F4K A;  3K59 A;  3SBM A;  3DMJ B;  1HHS A;  1RKI A;  4USU A;  2FLN A;  3I31 A;  2AEM A;  2DH7 A;  1FNX H;  4DG1 A;  5ETQ A;  4RW8 B;  3SEO A;  2XO7 A;  1N0U A;  2WBM A;  1O51 A;  1KFD A;  5D4O A;  4H4K C;  1FXR A;  2XCA A;  4BBY A;  4ELU A;  3KK1 B;  4DR3 F;  3L7P A;  1RGV A;  2B8P A;  4YOE A;  1N36 F;  4JI6 J;  3IWX A;  2W4D A;  2ABY A;  2NR0 A;  1L3S A;  3DLE A;  2YPY A;  5KFL A;  4ECU A;  1MWQ A;  5KFY A;  1XC9 A;  5KFD A;  1ZOT A;  4J37 A;  4H4M A;  1AFI A;  4L76 A;  4MFB B;  1EKS A;  2ZH9 A;  1GX6 A;  5I4M A;  4CO4 A;  3VZI A;  3RB4 A;  4ED8 A;  5EN1 A;  1U1O A;  4L3N A;  1FJ7 A;  3BS9 A;  3M30 B;  4O3O A;  1Q7Y T;  1YGY A;  2DGU A;  3OTO F;  2VDI A;  1NDP A;  2WSE C;  1PAU B;  4YB7 A;  4F26 A;  4HH1 A;  4CLW A;  3CED A;  1P1L A;  3CB4 A;  1KSP A;  2NZ4 A;  3Q8P B;  4NA2 A;  1CC8 A;  2V8H A;  4ID5 B;  2NXU A;  4OZ0 A;  4ECT A;  1HW9 A;  4KAI A;  4R5P A;  1VIS A;  4HT7 A;  1TR0 A;  2EFP A;  2R8H A;  5F8G A;  3IGN A;  1S10 A;  1F5B A;  3MM7 B;  4ZMM A;  4DUZ J;  4ECZ A;  2CPE A;  1YQH A;  2HQD A;  3DGV A;  4DEZ A;  4I2P A;  1T95 A;  5KOX A;  4AYB D;  5A6P A;  3NBP B;  3T6B A;  2F5G A;  1T05 B;  2W8L A;  4NLO A;  2I5J B;  3OVA A;  1U45 A;  2AYM A;  5U47 A;  5CAB A;  1W26 A;  3RZA A;  3MPU B;  4LQ3 A;  4ATN A;  3ISZ A;  2H65 B;  2HBZ B;  5C42 A;  2GIR A;  1QUV A;  1HHQ A;  1SPB P;  1A7G E;  3CJ5 A;  5JXS A;  1LOU A;  1T9W A;  1Z1Z A;  4WE1 A;  2C2N A;  1NJW A;  8RUC A;  2HBQ B;  2DGS A;  4XPE A;  1KC8 T;  5T7L A;  4TU9 A;  1QTN B;  4OJ1 A;  3DM2 A;  5GAG I;  3SYZ A;  2WW4 A;  2VHG A;  3FEX B;  4N8O A;  2MLX A;  2UXC J;  1JLE B;  4J9V A;  2L3M A;  4LR8 A;  3HHD A;  3OD2 A;  3N4W A;  4OI6 A;  2MZJ A;  3RRG A;  2CYY A;  2CZ9 A;  3OSP A;  4B3S J;  5LL6 d;  4ED2 A;  3R6G B;  4YN3 B;  1REV A;  5ADZ A;  2B4V A;  3BDP A;  1LWF B;  3CJK A;  2FC8 A;  1ZS6 A;  2RT3 A;  1GQE A;  1Q5V A;  3KLG A;  1Q8B A;  4QR2 A;  1UJ5 A;  3UDE A;  4O3P A;  2QL9 B;  4P7V A;  2X7I A;  1FX2 A;  1U49 A;  1N0V C;  4QW8 A;  4JV5 F;  4IFV B;  3O1L A;  2HK3 A;  2NCK L;  9ATC B;  2C2Z B;  1FVS A;  2HLT A;  4OI3 A;  2O66 A;  2MKI A;  4OJG A;  5KFB A;  4AL7 A;  4C48 A;  2ZC4 A;  1NZA A;  3BPS P;  3G4S S;  3Q89 A;  2V4J B;  2JLF A;  3O8W A;  4MK9 A;  1R7I A;  1ZPV A;  1BE4 A;  2LU1 A;  2VA3 A;  2VQF F;  4CO3 A;  3KDN A;  1RU1 A;  3PJW A;  5HO4 A;  1RTI A;  1VGY A;  4RL1 A;  3E01 B;  3M6W A;  1RUS A;  4K59 A;  1NK6 A;  5HSP A;  3OV7 A;  1ROF A;  3N5B A;  3UNG C;  5LMU F;  4NCG A;  4OYM A;  4KTQ A;  4JI2 J;  3UD4 P;  2ZH3 A;  3RTV A;  4DCO B;  1IR1 A;  1FJG F;  1KS2 A;  3GFX A;  1JJ2 R;  4GKJ F;  2QRR A;  4OYX A;  3ZZR A;  3HHE A;  3VVU A;  5I3U A;  1K0T A;  1HR0 J;  1HMV A;  4JBC A;  2BDP A;  1OMS A;  3RGI A;  2OPS B;  3DGP B;  3K58 A;  2UZA A;  3CD6 S;  1KLM B;  3UDV A;  4K2J A;  1NO8 A;  2YWF A;  2M9K A;  4Z7C A;  1D1U A;  4YB6 A;  2W9B A;  1MW7 A;  2X1F A;  1I5O B;  5DLF A;  3Q86 A;  4DN9 A;  1GEH A;  3BGU A;  1KEK A;  1IKV B;  2KHD A;  5GVQ A;  2LDI A;  3M9O B;  4B17 A;  1DZ5 A;  3AT1 B;  2ZBQ A;  4CYU B;  3W3S A;  3ET6 A;  3R2D J;  1WOO A;  1J27 A;  1X9M A;  3VR1 A;  5THW A;  1RTZ A;  4CLS A;  3PJ9 A;  2AV5 A;  3OL7 A;  4JV1 A;  4LIR A;  1HQE B;  1EET A;  2JEF A;  4O44 B;  4L75 A;  2DIU A;  4C98 A;  2HWH A;  1FK9 A;  2GMJ A;  1FWK A;  2FHJ A;  3NAI A;  1TQL A;  1RT6 B;  3DU6 A;  1SJ3 P;  4TKT A;  1RT4 B;  1G4C A;  2ROP A;  4LRD A;  1CG2 A;  3U02 A;  1U25 A;  2ZJP Q;  3CCS S;  4NZ7 A;  1M1G A;  4XDC A;  5KT2 A;  3P6Y C;  4DFK A;  1ICE B;  3OJS A;  3ETM A;  2P5V A;  3R97 A;  1NZ8 A;  1RWK B;  2IM1 A;  4CT8 A;  2GIF A;  2YKN A;  1CJT B;  3JQM A;  2F4V J;  4HHU A;  4DSI A;  2BAB A;  1CQN A;  2XS5 A;  2XLI A;  2ATL A;  1UA0 A;  2XI2 A;  4LVO P;  1VQO S;  3KJV B;  2YVS A;  3ENA A;  5B08 A;  3HHL A;  3MR2 A;  2WOM A;  3UCG A;  3I9V 9;  4WK3 A;  3THP A;  3OVB A;  1GMU A;  1WKK A;  4OHY A;  2BKP A;  2XHW A;  3CC4 S;  4Q0B B;  4OZ3 A;  3FUY A;  1XBW A;  1S1X B;  1RTH B;  3PNI A;  3V4M A;  4RW4 B;  3FCH A;  2BAC A;  3DYA B;  2VOD A;  4B3O B;  2VPY B;  3NNH A;  1JJ4 A;  4CNY A;  4OI0 A;  4J91 A;  5GMK a;  4IG0 B;  3B6B A;  3Q8Y A;  4CLL A;  3IXQ A;  2R8I A;  3A3O B;  3WX4 A;  5IOL A;  2CQC A;  4LSN A;  2KRR A;  2RIL A;  2Z8Q A;  1P27 B;  2I8E A;  1AZS A;  3HD2 A;  1WHW A;  4WXO A;  2MMY A;  2C42 A;  3AOB A;  5A0Y B;  4CTA A;  3K5N A;  5CD4 A;  2H48 B;  4WFX A;  4J9Q A;  4H4O B;  1C4A A;  1WKL A;  3E8O A;  2J0W A;  3POT B;  2YBV A;  1YTY A;  1SUQ B;  3CD7 A;  3MEE B;  4ELV A;  2RIJ A;  1HI0 P;  1U09 A;  3KLF A;  4LF5 F;  3EPG A;  4NXM F;  2W4P A;  4TU7 A;  1KD1 T;  1R8C A;  4URQ U;  2CJX B;  2PC6 A;  2ZHB A;  2CJK A;  2PMH A;  1YDL A;  1KKH A;  2YY3 A;  2CQ4 A;  2FVQ A;  5H9E K;  1KHW A;  1SL1 A;  2RRN A;  3V2U C;  2RQM A;  4NL5 A;  5DDO C;  3BQ2 A;  2XWY A;  2FLL A;  2GJF A;  2UU9 F;  3FZ2 A;  1FRJ A;  3ADA C;  4P72 A;  2UUB J;  2ZH5 A;  4ED6 A;  3R7S B;  3NCQ A;  1NPR A;  5J2N A;  4MKB A;  2DY1 A;  3LP0 A;  5C24 A;  4DF4 A;  2IPO B;  3PDN A;  1JJH A;  2UV8 A;  1N33 F;  3QYY A;  2KN4 A;  4ETZ A;  2H5I B;  4USI A;  3CDW A;  1IR0 A;  4DR5 F;  5L1K A;  1M5H A;  3W7B A;  1U1K A;  3H40 A;  1YK9 A;  1VQS A;  4MYU A;  1HWL A;  3TAM B;  2V50 A;  4N7T A;  2ZZT A;  1HBU B;  1N34 F;  2N7Y A;  5MLC V;  2BVZ A;  1MG7 A;  2G4B A;  2KDO A;  4ANC A;  1UVM A;  1IKX B;  4ZPD A;  1Q16 B;  1ZH5 A;  3D0G E;  4LRC A;  4ZPV R;  3GV5 B;  5IXU A;  3FQL A;  1LFP A;  3GE9 A;  2G0C A;  3R27 A;  2MPU A;  1TKX B;  4J9U E;  4PXB A;  3UN2 A;  4B9S A;  1C0T B;  2ZEJ A;  3SFU A;  5B0G A;  1UZH A;  2VG5 B;  2Y0B B;  4QOT A;  1R3N A;  1UPM B;  1N32 F;  1F0X A;  1X60 A;  4AT1 B;  1URN A;  1TMJ A;  2W7P A;  3CC2 S;  4DV2 F;  3FSY A;  1R0A B;  4YY3 J;  1HKA A;  4PWU A;  1V3S A;  2HVD A;  3P3D A;  2X51 A;  1C1C A;  5IV4 A;  1NK0 A;  2RDD A;  1TAQ A;  1S57 A;  3OL9 A;  1S6P B;  7FD1 A;  2HHS A;  3Q8U A;  5IM0 A;  1KON A;  4FYY B;  4DV0 J;  3BYP A;  5B0A A;  3MPV A;  2H1Y A;  1UWB A;  2XB2 D;  2C3O A;  3BBB A;  1IKW B;  2FJE B;  2E5H A;  2W1B A;  4PAA A;  2GO9 A;  4C3L A;  2V63 A;  4PXD A;  2KH9 A;  4TY8 B;  4F04 B;  3FBF A;  4IR1 A;  2H5E A;  2D74 B;  3NGU A;  5I42 B;  1S9F A;  3VCD A;  3LF0 A;  2EK1 A;  2YX4 A;  2FYX A;  3HHK A;  4G3I A;  5KFN A;  3M8Q A;  2GGP A;  2V5H G;  2HRU A;  5D3G A;  4DCJ B;  2XMJ A;  3GR1 A;  2DGX A;  2HFU A;  1UW4 A;  3EZO A;  3OXL A;  3LAK A;  3CD0 A;  2DGT A;  4HDG A;  4X4N A;  1T9U A;  1APS A;  3NOC A;  4ZVG A;  1ZM9 A;  3B8H A;  2G0I A;  2CQ2 A;  4K4S A;  1FTC A;  3T6J A;  2MQM A;  4OYO A;  4F3O A;  2N7C A;  3HUL A;  3CME S;  1ZM4 A;  3B82 A;  2YKM B;  4I1T A;  3J7Z T;  1T02 A;  2KXH A;  3DXS X;  4CZC A;  4YFU A;  5GAD U;  2V69 A;  1JLA A;  3BO2 A;  3M7V A;  4A46 A;  2CNK B;  2Z2Y B;  3W66 A;  1GK8 A;  5C7P A;  3H7H B;  3I5A A;  3MMA B;  3W64 A;  2B8Q A;  2DVI A;  2DR8 A;  2ASL A;  4YDX A;  1S79 A;  3H8Y A;  1HBO A;  1BQX A;  2LU2 A;  3J7A N;  3MEC B;  3A3P B;  1B3T A;  2CPF A;  2WTF A;  2DHH A;  2NYH A;  3CMQ A;  1S6P A;  2HRT A;  1YBA A;  3RBD A;  3TUP A;  1V3R A;  3CC7 S;  2CQ1 A;  4DV5 F;  3LP2 A;  2BAN B;  2ZBP A;  1LXN A;  1X8D A;  3T19 A;  5G0R A;  2BE2 A;  4Z2X A;  4N77 A;  1M90 T;  2VFT A;  4LJM A;  4UOC A;  3VQS A;  1JLC A;  2QMU B;  1TL1 A;  4A8Y A;  3GJQ B;  2HIY A;  4HLB A;  4A8S A;  3ZTP A;  1NK4 A;  2AZ3 A;  3W65 A;  3L7U A;  4A8X A;  1T9X A;  1TKZ A;  2MQL A;  1F2H A;  1VRQ C;  2J5A A;  2BYC A;  1IVZ A;  3EDQ B;  5KG4 A;  2ROE A;  3EGZ A;  4KYZ A;  2BE7 D;  4K4Z A;  4P71 A;  1R27 B;  1K47 A;  4LF8 J;  3AXK A;  2R2S A;  2CPI A;  3MUR P;  3EXC X;  5DM6 Q;  4DR3 J;  1CSJ A;  2MY8 A;  3TO8 A;  1XNQ F;  1YRU A;  3N6M A;  3M2V B;  1GXL A;  3IGV A;  3BDE A;  5DG9 A;  7FDR A;  1I51 B;  2OO4 A;  2NSC A;  3HZG A;  4F0K A;  5HLF B;  1MWZ A;  3QID A;  1F5A A;  3KLE A;  4LF1 A;  3CIZ A;  3G6E S;  3A13 A;  1W2B R;  5LMN J;  3RB6 A;  4PWD B;  4FDF A;  1S0V A;  5B0F A;  5J2M B;  3VWS A;  4FYV B;  3J81 U;  2QLJ B;  3KNA A;  1HYS B;  2OUG A;  5DQH A;  2W9C A;  3UD3 P;  3I0R A;  4R0E A;  5M2U A;  4RW9 A;  5D0H A;  2K1R B;  5EHH A;  2M4M A;  3W5X A;  3BKU A;  1VHF A;  1HNI A;  3MMC B;  1JLQ B;  2HHX A;  3OTO J;  3LA0 A;  1U8S A;  4X4U A;  3QIP B;  1YG0 A;  4J9M A;  1ZA2 B;  1WEZ A;  1TL5 A;  3EGW B;  4RKU C;  2CWX A;  1UVI A;  2MEW A;  4WYL A;  1HWK A;  3S7R A;  2EI5 A;  1H6K X;  3VAK A;  4DR4 J;  4RNF A;  3GIJ A;  2JOQ A;  2LEB A;  1ULR A;  5L38 A;  3GYG A;  2HZC A;  1YBT A;  5F3T A;  3QAE A;  3GR0 A;  3DHX A;  3RBE A;  2C1E B;  1YRX A;  4XIU A;  3D3C J;  3QT5 A;  5ETV A;  2HW3 A;  4NLG A;  2MXY A;  1TV6 A;  5A8R B;  4ZVO B;  2R2U A;  4CWB A;  2VG6 B;  3ZNJ 1;  2XGQ A;  1TK5 A;  2IMW P;  5HBM B;  3W8G A;  4IKA A;  3D4J A;  4OHZ A;  3M32 A;  5LM7 E;  1JXL A;  3HMJ G;  3RU0 A;  2XZW A;  3CJ2 A;  4FYX B;  5D4N A;  1HWU A;  2VKR A;  3JSM B;  1PC4 A;  2FHM A;  4PAB A;  3ICL A;  4O4G B;  4DR2 F;  2RKI B;  1HLW A;  1RA7 A;  1WHX A;  4JI0 F;  1VQY A;  2E1P A;  5K5M A;  4BWJ A;  1R0B G;  2FJW A;  3A8K A;  1BUX A;  4KRW A;  1FA0 A;  2VQE F;  4DV4 J;  4KO0 A;  1SQG A;  3H42 A;  4E0D A;  1Y0H A;  3GG0 A;  4QZV B;  2BRL A;  3DOK A;  4Y3C A;  2QYG A;  5IT9 U;  2KG1 A;  3OUY A;  3HFZ B;  3BB5 A;  4FPR A;  3FEZ A;  3IRW P;  4LBI A;  3EZU A;  3M8Z A;  2GMH A;  1HD1 A;  1JLQ A;  2NZC A;  2R8G A;  1OYE A;  2JHE A;  4NLQ A;  1RAC B;  2BKN A;  5KFO A;  4DS4 A;  1D9D A;  2CVI A;  1X4F A;  4Q2L A;  5EWE A;  1KLN A;  2AQ4 A;  3TI0 A;  3HD1 A;  1D8Z A;  3NXZ A;  3CCL S;  3PVX A;  4CT9 A;  2JLG A;  2FIU A;  2XSJ B;  1LWE B;  3KUG A;  4CQ1 A;  2HQI A;  3GYX B;  3IMQ J;  2J7U A;  2IBO A;  4LQ9 A;  1RB0 A;  4O3R A;  2CIM A;  2CPZ A;  2JEJ A;  3TR5 A;  3AHP A;  2WB4 A;  2DNP A;  2VG6 A;  5E33 A;  2RJZ A;  1VJW A;  5SUH A;  2RU3 A;  1YHQ S;  4X4V A;  4DR6 J;  4EK2 A;  1QAX A;  2BMB A;  1CUL A;  5HQ8 A;  3DRR A;  4TYA A;  2X1A A;  4FP9 A;  4GKJ J;  1EQM A;  4G1Q B;  3HLU A;  3L3C A;  3NS5 A;  4C97 A;  1RWP B;  4C8N A;  3C66 A;  4LT6 A;  3MWB A;  1DFD A;  4CDI A;  3ZTO A;  4CLT A;  4E8U A;  3J81 j;  3CCR S;  5AXK A;  5CYJ A;  2VJV A;  2BJ3 A;  2PFD A;  4YME A;  4FVM A;  2XYH B;  4CLK A;  3D6F B;  3V6J A;  1LW2 B;  4LIW A;  1Q0N A;  2K3K A;  1N6Q B;  3MR3 A;  3D54 A;  4YR0 A;  4ZVP B;  2LA6 A;  4ZJL A;  1NDK A;  2HVE A;  5D15 A;  3HCX A;  3AJD A;  4CH7 A;  4J7C A;  4OX9 J;  4RBU A;  2GAH C;  3CJS A;  1S59 A;  4QR0 A;  2YWK A;  3OJU A;  3A8I A;  1DQ8 A;  3AOA A;  5KG2 A;  2KJW A;  2V8G A;  3BZQ A;  2IAJ A;  2EK6 A;  4B9M A;  1KQK A;  3MCS A;  1HQU A;  1WOS A;  4RZR A;  1IKY B;  1UTA A;  4UTG A;  1Q86 T;  1U0S A;  1PYO B;  1GFW B;  3VQT A;  2JDJ A;  1PJ6 A;  1S1V A;  2VZ9 A;  3A8E A;  4X66 F;  3EVM A;  2ZKU A;  3Q8R B;  1SL0 A;  2XLJ A;  2PEH A;  1SH3 A;  5EX0 A;  3KG4 A;  2ZH8 A;  3RYL A;  4PQU A;  4C2M A;  3MFI A;  4DUY J;  1N52 B;  4QWA A;  1RT1 A;  4PEO A;  1IBL J;  1CJU B;  3BH7 B;  1YX2 A;  2R7O A;  1LWE A;  1NKE A;  2DHX A;  4P10 A;  2MJU A;  4ZCK A;  3UFC X;  4EO6 A;  4OYI A;  4JYA F;  1RJJ A;  3CUL A;  2BM1 A;  3M2R A;  1U7L A;  2RQC A;  5E2Q A;  4JI3 F;  1HIY A;  4IUF A;  1KN6 A;  3D6H B;  1HWJ A;  1CPZ A;  4WBF A;  1XR5 A;  2F8M A;  1L3U A;  3PY8 A;  2OP5 A;  2V94 A;  2BX6 A;  1YWX A;  3MOZ A;  2R4F A;  1VQ5 S;  3AJ1 A;  3FMB A;  4JI1 F;  1OY8 A;  5B7W A;  4LFA F;  3BGF A;  4WU3 A;  5K8M A;  4UST A;  3M6V A;  2J6U A;  4IFY B;  3KLV A;  3K5P A;  1RAH B;  2JNJ A;  2OJ3 A;  3SDE B;  1YRT A;  4FS2 A;  1NM2 A;  3H5X A;  3KMS A;  4J9R A;  2MKY A;  4JI5 J;  2DEI A;  3G6Y A;  1TAU A;  2CPD A;  1YJN S;  5KG3 A;  1S49 A;  2FGO A;  4ERD A;  3GTY X;  1O6X A;  1S6O A;  2W4C A;  1XWL A;  2R42 A;  2B9W A;  4NEZ A;  4ECX A;  2HS3 A;  3H0P A;  4KB7 A;  1WC6 A;  1SH0 A;  4QQB A;  4DPY A;  1RT7 B;  1ZBT A;  4ZVF A;  3G71 S;  2V9K A;  1FKO B;  4K4T A;  3QFW A;  1FKA F;  4NYZ A;  5K14 A;  4ILR A;  2DK2 A;  3MM8 B;  3ZFV A;  3QFH A;  1ZTW A;  2ALY B;  1RSC A;  4AXI A;  2HHQ A;  1NK5 A;  2VFU A;  4QYZ K;  1Q5Y A;  3KJF B;  6FDR A;  2KI2 A;  1RDR A;  4RW6 B;  2XHC A;  2IRX A;  3ILJ A;  4DV1 F;  1S1U A;  3DLG B;  5KTQ A;  5KG6 A;  2RSQ A;  4IO1 A;  3LW5 C;  4RBV A;  5J2Q A;  3Q23 A;  3GJS B;  2E66 A;  3DRP B;  2E1A A;  1RZM A;  4V19 X;  3KLH A;  4F4Z A;  4KKO B;  2MLZ A;  4GKK J;  1KTV A;  2WBR A;  6FD1 A;  3U1N A;  5J1E B;  3NWG A;  4TQS A;  2Z0G A;  2VKZ G;  5F0U A;  3V6H A;  4UOF A;  3SSR A;  3HVR A;  2JVO A;  2F63 A;  3M1V A;  2YX1 A;  4MTP A;  4CO0 A;  3LWM A;  5GAH U;  1M1K T;  4RUH A;  5IWA J;  5BYS A;  1G3O A;  1NJY A;  3KHL A;  3H5U A;  4KGZ B;  2X3D A;  3I55 S;  2L48 A;  1J5E F;  4PRF A;  2R2T A;  3SDE A;  2DB1 A;  2QFJ A;  4L3K A;  3QAT A;  4NA3 A;  4OV1 A;  4QPT A;  3IBF B;  2ZNZ A;  4C9D A;  5KFW A;  3FSX A;  3EM1 A;  2JL9 A;  2IY5 B;  1KHV A;  2DGV A;  4YEA A;  4KFB A;  1FD8 A;  3W9H A;  4MKA A;  4ECV A;  2PMW A;  4DV6 F;  4K50 A;  4R8U A;  5GAG U;  3T5K A;  1TVR B;  1F6T A;  4K4U A;  1M1H A;  2YXL A;  4X2B A;  4MK7 A;  4ZVQ B;  4FKY A;  2O5D A;  1YJW S;  4C8M A;  3UR3 C;  2PN6 A;  2MQQ A;  2H4Y B;  3Q0A A;  1JNZ B;  5BR8 J;  1MSW D;  4DX5 A;  3CJ3 A;  2C3P A;  4DFP A;  1FDB A;  3QNW B;  2PA3 A;  2E9R X;  2D3O R;  3R5C A;  1RAI B;  3QAU A;  4YDD B;  2M8D B;  1MU2 B;  3OTD A;  1D8Y A;  2A18 A;  3Q8V A;  1S97 A;  1VFJ A;  3NGK A;  4KKO A;  3CCU S;  2UUW A;  4K5S A;  5A6W A;  4CM2 A;  2Q6B A;  2BEF A;  4CI0 B;  1VQ9 S;  1RAF B;  1J5O B;  4RJV A;  1PBA A;  5AJ3 F;  4F7V A;  5E41 A;  2DNM A;  4QU7 A;  1GAO A;  3A8J A;  3KDO A;  3GJT B;  3TRG A;  2W01 A;  1T9T A;  3JXO A;  5HRO B;  2COL A;  2XMU A;  4OMF G;  3DN9 A;  2CKW A;  3CWJ A;  4DU8 A;  3TP2 A;  4ZPB A;  1T03 A;  2KT2 A;  4LSL A;  3SMZ A;  2KFZ A;  4QPX A;  5LXY A;  3CTR A;  3IG1 A;  4I56 A;  2HLU A;  1MN7 A;  4ZPC A;  5CYQ A;  3G87 A;  4RU2 A;  3WIU A;  3L95 X;  1RWM B;  2E5G A;  3QT8 A;  4NLP A;  2PEB A;  2RH3 A;  1PCA A;  3SCI E;  4URG A;  1BQN B;  2EWH A;  1P6T A;  1DTT A;  1T94 A;  4UW2 A;  4AQY F;  3MUM P;  4N47 A;  3ZXW A;  2CDQ A;  2G13 A;  1L5U A;  1DRZ A;  4ZLL A;  3OFE A;  3HVW A;  2ACM A;  5K9F A;  4JI7 J;  4AE5 A;  1QAI A;  5B0E A;  5HN0 A;  3LPY A;  1P9Y A;  4X65 J;  3NGD A;  1FHT A;  2RF2 A;  3TEG A;  3D28 A;  1U2R A;  4KE5 A;  5D8H B;  3OBI A;  2ZDO A;  4DV3 F;  1QVF R;  4EYI B;  2UVV A;  3AA9 A;  1DLO B;  3T1Y J;  1XR6 A;  1HBN B;  2QE5 A;  1QDU B;  3B4M A;  2JEG A;  2PT0 A;  2K3I A;  2FJV A;  3MED A;  4KH0 B;  1C4C A;  1PJ5 A;  3C6T A;  1IBK F;  3QWP A;  2GVD B;  2OEM A;  2E7V A;  2YNH A;  1TL4 A;  1VQ8 S;  2ZZN A;  5D78 A;  3LAN A;  3QWU A;  4PPZ A;  8AT1 B;  3W2V A;  1HPZ B;  1T9Y A;  2HNY B;  5DLG A;  1M5P C;  2HZV A;  1JKH B;  1S0N A;  4NCB A;  3BBF A;  4NEY A;  4W98 A;  5EX3 A;  3KK3 A;  3D1Q A;  3TVZ A;  4RUA A;  3H20 A;  3BKF A;  1CJK B;  3V4I B;  1JLB A;  3PG9 A;  2POK A;  4M1K A;  3MMB A;  3OTC A;  1SI9 A;  1E6Y A;  4J9P A;  2R7W A;  4B3R J;  1T0T V;  4WTY A;  2EVZ A;  1VQ4 S;  1QM9 A;  3EE3 A;  1I94 F;  4WZQ A;  2ADB A;  4NLV A;  1WF2 A;  3W2W B;  2R3V A;  5K20 B;  3W9J A;  2XY7 A;  4KHR A;  1VQ6 S;  4LFB F;  3MAA B;  3R5J B;  1BLU A;  1AUS L;  2FJD B;  3SQO P;  1FE0 A;  4LF9 F;  2DNZ A;  1YJR A;  4BDP A;  5HQM A;  2NXN A;  2HHV A;  2LQ9 A;  1PC5 A;  2KYX A;  3NLC A;  4EFA C;  1YJT A;  2Y3Y A;  5KFU A;  4ZHR B;  2QLB B;  2OEK A;  4PQA A;  1RAG B;  4Q45 A;  1B99 A;  4XDD A;  2BJ7 A;  4MAK A;  4C8Z A;  3OFF A;  1SCJ B;  5DM7 Q;  1T11 A;  4Y00 A;  3AQO A;  2C3U A;  4I6Y A;  3IS9 B;  1S9G B;  2DRB A;  4ZP8 A;  3P8B B;  4JI4 J;  1M5V C;  3ZZP A;  1RE1 B;  1HNZ F;  1H38 A;  3AFG A;  3C15 B;  4QW9 A;  1V5I B;  1HBN A;  2KVQ E;  4LRE A;  4B02 A;  3K7R A;  5J1N A;  4OFZ A;  2CQI A;  3PFE A;  4BCA A;  2ZD1 A;  2JLE A;  2R2R A;  1TMM A;  4KIA A;  2BW7 A;  3G8T A;  1VHI A;  3MM6 A;  3PKY A;  3HPO A;  2QN6 B;  2RHS B;  4MK8 A;  1ELO A;  4ZVR B;  1Y5N B;  1TUV A;  1V9O A;  1NPK A;  1GTH A;  2CQD A;  1REG X;  2CQ3 A;  2AJ4 A;  1HBM A;  1NHU A;  4L74 A;  2ZOM A;  3BF4 A;  2HFV A;  5CA5 A;  4P74 A;  4WIQ A;  3AOD A;  2ILZ A;  3BSO A;  1A6L A;  4FXW A;  2X1G A;  2RVJ A;  3HVT A;  4DSJ A;  2DNO A;  2EPI A;  2HGM A;  3MEG A;  2MZS A;  2XO6 A;  1JLG B;  3M8S A;  5KFQ A;  4DSF A;  3KJQ B;  5B09 A;  4RWW A;  2OPP B;  1XER A;  4WYW A;  3T1H J;  3C2P A;  2HVZ A;  1S7I A;  3CDU A;  1RT5 A;  2FZK B;  2AX1 A;  2W2O P;  3DNC A;  1S48 A;  1XQI A;  3C14 A;  1NLK L;  2G0J A;  4Y65 A;  4DF8 A;  2VPX B;  3I4H X;  2NPF A;  5HP1 B;  3TAN A;  3G8S A;  3V6K A;  1K9M T;  3N01 A;  4YHH F;  3TWZ A;  5JJB A;  2UXD J;  4UF4 A;  1VRU A;  3TJA A;  1MMD A;  2HBR B;  3H25 A;  1U4B A;  3GV8 B;  4WKR A;  2HAF A;  4F4X A;  4L72 B;  5C25 B;  2AX0 A;  1U47 A;  3K89 A;  3MFH A;  4JI8 F;  1Z2Z A;  2HEK A;  2CJ9 A;  1WG4 A;  4ZPT R;  3QLH B;  4I2Q A;  2HFO A;  2MSS A;  2E5L J;  4DXL A;  2XBP A;  2BJ8 A;  1UEV A;  4DOZ A;  3RBZ A;  1ITP A;  3P4U B;  2AGO A;  4V19 J;  4YUD A;  3HFV A;  4GVL A;  2XZD B;  4Z7Y A;  4DPW A; 
#chains in the Genus database with same CATH homology
 2UUB J;  2UU9 J;  5IT9 U;  1N32 J;  2UXB J;  4K0K J;  4JI4 J;  4RJV A;  4YY3 J;  4JV5 J;  4B3M J;  3D3B J;  3JAM U;  3R2C J;  3D3C J;  5A2Q U;  4JI5 J;  1XNQ J;  4GKJ J;  4DV2 J;  4JI7 J;  4B3R J;  4X66 J;  4GKK J;  3J80 U;  5FLX U;  1XMO J;  4X65 J;  3T1H J;  2KVQ E;  1HNZ J;  4DV6 J;  4LF7 J;  4DUY J;  4DV5 J;  5LM7 E;  4NEZ A;  2F4V J;  4HHU A;  5LMN J;  2ZM6 J;  4LFC J;  4X62 J;  1IBL J;  3J81 U;  1N33 J;  1I94 J;  2KL8 A;  4LF6 J;  1XNR J;  3T1Y J;  5AJ3 J;  4DV3 J;  2UXC J;  4DR5 J;  2VQF J;  4LFB J;  5BR8 J;  3R2D J;  2UXD J;  4DR7 J;  4DV0 J;  4NXN J;  5IWA J;  3OTO J;  4LF5 J;  4NXM J;  3W1Y C;  4KHP J;  1HNW J;  4YHH J;  4LF4 J;  4LF9 J;  4OX9 J;  1N34 J;  4B3S J;  2UUC J;  4DUZ J;  1HNX J;  4JYA J;  4DR2 J;  1IBK J;  1XMQ J;  4JI2 J;  5LMU J;  4JI6 J;  4DV7 J;  4KYZ A;  4X64 J;  3IMQ J;  1N36 J;  1IBM J;  4KY3 A;  4JI0 J;  2MTL A;  2HHH J;  4B3T J;  2MEW A;  4PWW A;  1J5E J;  4JI8 J;  4LF8 J;  1FJG J;  2E5L J;  4DR1 J;  4DV4 J;  1HR0 J;  4DR4 J;  2MQ8 A;  4DV1 J;  4NEY A;  2VQE J;  4DR3 J;  4JI1 J;  4V1A k;  4LFA J;  4DR6 J;  2UUA J;  3J7A N;  4JI3 J;  4AQY J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...