2UXCJ

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 9
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 2uxcJ00
4JI3J 4DV1J 4KYZA 5AJ3J 4LF5J 1HR0J 3OTOJ 2VQFJ 4DR3J 3D3CJ 3J80U 4DR4J 1HNXJ 4DR1J 4DV0J 2UUBJ 2ZM6J 4YY3J 4JI1J 4X65J 4JI2J 1N33J 4DV2J 2MQ8A 4NEZA 3D3BJ 2E5LJ 4X64J 1XNQJ 4YHHJ 4AQYJ 1HNZJ 3IMQJ 2UUCJ 3JAMU 4DV4J 4DUZJ 4DV5J 4LFBJ 4LF7J 5FLXU 4DR6J 3J7AN 1N32J 5BR8J 4KHPJ 4JV5J 5LM7E 4B3SJ 4LFAJ 4DR2J 2MEWA 3R2CJ 1FJGJ 4LF9J 5A2QU 4DV6J 5LMUJ 4PWWA 4NEYA 2UXCJ 3R2DJ 2VQEJ 4X66J 4LF8J 1IBKJ 5IWAJ 4K0KJ 1IBLJ 4LF6J 4KY3A 4JI5J 4X62J 2KVQE 1N34J 5LMNJ 4OX9J 2MTLA 4HHUA 4JI8J 3J81U 3W1YC 1XMOJ 4DUYJ 4B3TJ 4JI0J 2UUAJ 4DV3J 4B3RJ 2KL8A 4JYAJ 4JI7J 4NXMJ 2UXDJ 5IT9U 1HNWJ 1J5EJ 1XNRJ 4DR5J 4DV7J 1I94J 4V1Ak 3T1HJ 2UU9J 4NXNJ 2UXBJ 4GKJJ 4DR7J 4GKKJ 1N36J 4LFCJ 4LF4J 4JI6J 1XMQJ 3T1YJ 2F4VJ 2HHHJ 1IBMJ 4B3MJ 4RJVA 4JI4J
chains in the Genus database with same CATH superfamily
1LW2B 4KR0B 4LVNP 1NH7A 1NU4A 3CO0P 4RBTA 3T41A 5KFNA 4WF9Q 3W9HA 2AYMA 3AB4B 3KLFB 1IXKA 2WCXA 5IQQA 4OI0A 3IWNC 1U25A 2E1MC 1ULRA 2MKCA 3I0RB 3PO5A 4ZPBA 1DQ9A 2CDRB 1H2UX 1NMEB 2F9DA 3WQPA 3IRWP 3ENVA 1NK6A 2XB2D 1WI6A 2IYIA 4DR1J 4LIRA 3AQPA 2P6TA 3K5PA 4C3MA 1RISA 2CJ9A 1SJFA 1XNRF 4LBIA 5A6WA 5LJ5Y 4TU7A 2QA4S 4F02A 1UZHA 1ZM2A 2ZKTA 3TZYA 3CCQS 4LF9F 2OFGX 2YKMA 2VZ9A 4TQRA 4QYRA 1X0PA 4OZLA 1H7WA 3PEJA 3W66A 5CAAA 2NLWA 1Y10A 3I9ZA 4PG8A 3LH2S 2I8EA 1RHKB 5KFMA 1J2VA 4FBUA 4K7QA 2XGQA 3GG0A 3LGMA 1JLAA 3SBMA 2RIJA 4DV4J 2KYZA 3AD9C 4B02A 3M6UA 4ZVPB 3RG6A 1MROA 3HVWA 3SCKE 4AFFA 3OTOF 2JLGA 1ZM9A 4ZVTB 3KNGA 3IG1A 3DOLB 3WC0A 4IYQA 4CM0A 2OO4A 4F4YA 2BQRA 2R7SA 1NDCA 2QGFB 4OV1A 4NX9A 3EPIA 3BGUA 2C2NA 2GQCA 4NCGB 1AZSB 1NB7A 3OTCA 4B9SA 3EXCX 1V3RA 1YTYA 1FXDA 1N88A 2FTRA 2O3DA 5HJYA 4CNYA 2J6SA 5EX3A 5H1SV 4Z37A 2F63A 5KFWA 3TANA 1PJ5A 2C2EA 2PEBA 4B3OA 1HPZA 3AD8C 1IR0A 4KT0C 2E7WA 5B0EA 5IM0B 5KG2A 4ED7A 1NK4A 1C2PA 2V4QA 4ZDNA 1Y5LB 1IR2A 2FVRA 2QSWA 2ZE2A 2H5JB 2E5JA 2POKA 5ETTA 4ECRA 2XY5A 4TQSA 1SB6A 2ATCB 4J9KA 2D3ZA 3MDFA 2IJFA 5JVGQ 2CNOB 1S6UA 3QSYB 4DV7F 4DSIA 4DFJA 3ZC4A 1CJKA 2XGPA 3CJ5A 4J5OA 4JV0A 5D77A 5L1IA 2ZEJA 4LF7F 3GV8B 2HIQA 3AT1B 3PZPA 2XY6A 4XAKA 4WTOB 1DLOB 1GXTA 1Z2ZA 2WVCA 4ZIVA 3ISND 4WFYA 1RAGB 4C98A 2ALZA 1TL5A 4ZKAA 2YWWA 1AUSL 5ETQA 4ZMMA 1RT6A 1RTZA 2CPEA 2MPUA 1U49A 4Q8FA 1U0HB 3ELHA 1H7XA 4HACB 1J5OA 3EMTA 3FEZA 5J2MB 1N48A 4FZVA 2PE8A 5DLFA 1OIAA 5D15A 3OHAA 3HLUA 1H6KX 2VQEF 2DB1A 2HPUA 2BEFA 3EDQB 2F8HA 1H2TZ 1KEKA 2JWNA 2F65A 3SCJE 2I1RA 4NE9C 4UQTA 2DHXA 1ACMB 3CJTA 4WE1B 2OEMA 5JMNA 2LXUA 2AEJA 2H65B 3C6UB 4F0MA 3VZHA 2VV5A 1EX8A 2ZFHA 4FN5A 1SQFA 4IH6A 3ZTRA 2QO3A 3OL6A 1LW2A 2YWHA 1FWKA 5E2QA 3M8QA 4NXNJ 1HBOB 5KFBA 2C2KB 4LF4J 3TNVA 4PWUA 1U0SA 4P71A 4F0HA 1X4AA 2EFOA 2NXJA 3G6YA 1QAIA 4R0EA 2R7RA 3DHXA 2DRBA 2V0NA 2MZSA 1Q8LA 4TLRA 5G4DA 1JLBA 1TAQA 1BE4A 2W2OP 2CJAA 5ETOA 5I3UA 4C8OA 4OX7A 2XYPB 4B3TF 4CLFA 1MMDA 1SI9A 1IM6A 1YZ7A 3AOAA 3BSAA 3N0VA 3TZZA 3KYLA 1R31A 3PW7A 1U1NA 2B9EA 3GONA 2PIIA 2MKYA 2PSZA 2ZNZA 2W2QP 2J0SD 4MK8A 2DO0A 1CLFA 1N5TA 4QU6A 1JLQA 2MY7A 4NLWA 3W2WB 4DUZF 1RWMB 4ED4A 5J2PB 3I5BA 1PYTA 3MCMA 4E0DA 2FLOA 2C3UA 3DOKA 1XTZA 1TAUA 3KLIA 1N32F 4GKJF 2PO4A 2XLJA 4ED3A 2CPDA 1RT3A 3QJPA 4YY3J 4KAIA 3CJKB 3DLJA 4WP3A 2CQ1A 1FKAF 3D4JA 2FC9A 3CNQP 2KU7A 3CWJA 3NAIA 4OJHA 1LK5A 3TYTA 4NEZA 3ZTSA 4FS2A 2HWHA 1MG7A 3DNCA 4CO5A 3GILA 1NSQA 3X1LB 3OVSA 2XMWA 1VQMS 2K1RA 2RRBA 2N3LA 4GVBB 5DG7A 2Q79A 2CQ2A 2KDOA 3DLGA 4RUHA 1NB2A 2OPPA 1S79A 3M8PA 3DGPB 5F8HA 5KT4A 2KXFA 2CKWA 2ZBQA 4RW7A 3VQTA 2AJ4A 4DUTA 4OZ5A 3V81A 1VQPS 1W2BR 1JXVA 2VJUA 5AXKA 5HJXA 4UZBA 5E3AA 2QA4G 2G4BA 4X84A 2HGLA 2V8VA 1F9EB 5EWEA 1PJ6A 1PYOB 1RGVA 2WONA 2QLXA 4X62F 4X4TA 4GVBA 3VAKA 3QRRA 4HDHA 5KFDA 2JEGA 2YNIA 3AD7C 2B9XA 3LO3A 2E44A 4KC5A 4EZ9A 2CPJA 4K4UA 4JV5J 2Y8YA 1YQHA 4XK8C 2DNLA 3OLBA 3C46A 3R2CJ 3R5BA 2VODA 2CJYB 5KFKA 4ZVEA 4AYBD 1YI2S 1UVMA 4DV6J 3SQOP 1RBOB 1TR0A 2DHAA 3R6LB 4M5JA 4DFKA 1VLYA 3O6QA 2E9TA 4ZCMA 3NBPB 1RWKB 4LSLB 2H4WB 4QWEA 4FKYA 4KHRA 3UCZP 2YNHA 1VQ7S 1VFJA 2IVMA 5K5MA 3QSIA 4QR0A 1Y5NB 2OKQA 1OPIA 2PMZD 2DGWA 2QRRA 4H54A 3MZIA 2OEJA 1NK9A 4IQXA 1FRMA 2XMVA 3I32A 3QPIA 4IFYB 4K0KJ 1SJ4P 1FE0A 4W4MA 3V81B 2ZH3A 2I6WA 3T1HF 4CLTA 2KJVA 2XG8A 2CQHA 1UJ6A 2KVQE 3FMWA 2FLLA 4JI6F 1RT7A 5CYQB 4N41A 4DR2F 3I5CA 3MM8B 4F7VA 3CXCR 3W2VB 3TA0A 5K8MA 2R4FA 2DEJA 2RDIA 3N5FA 3IN5A 2HS4A 2HQCA 2P5VA 4P7TA 4AL7A 1TL7B 1HBOA 3AH6A 3E51A 1GFWB 4IQMA 2E5IA 2E1PA 4CTAA 3CCRS 5H9EJ 3KHRA 2UUAJ 4EO6A 2B9YA 4MYUA 1HR0F 5HANA 1DAXA 3IS9B 4NI2B 1B3TA 2CQDA 2B4PA 4NZ0A 4A8YA 1HNVB 3PFOA 2MQPA 4NOHA 2MQMA 1IBKF 1W2IA 4IOAQ 4WWSA 2ZHAA 3EICA 2G13A 4RBVA 1NH8A 3U1NA 2I38A 3ZTOA 2QL9B 3CJSA 5KFXA 2L08A 4J9MA 1RT2B 1NHUA 4OQJA 3BGRB 4QIEA 3VQSA 5ADZA 1YJ9S 2QT7A 3WHIA 2RQCA 3X3UA 4ZLNA 5KFTA 4X4QA 5EWFA 3HO1A 1U6ZA 1QJHA 1GEHA 1HQEB 2KT5A 4D3GA 2ZZNA 2RJZA 1Z2LA 2Y0SD 5E7OB 1ELOA 3M8SA 1VBXA 4PUOA 2ILYA 2WSEC 2KRBA 2M3DA 3M8PB 1BUXA 2J8AA 3SV4A 2EFPA 2HHHJ 3H2UB 1HD0A 2FJDB 1C4CA 2J9EA 3H7HB 1WEXA 1FRKA 4ECVA 1XNQF 2W2NP 2RKIB 4L6V3 4JI3J 2J6TA 3MEGA 4F3QA 2CQ4A 3MCNA 4OMFG 3LUYA 3ZFVA 2ILZA 2HW3A 4M95A 1H72C 2MHEA 2W7AA 4MIWA 4DV5F 3OTBA 4WP9A 4Z7CA 2R9LA 1GX6A 3SDEB 1TMMA 4JBCA 2YNGA 5D0HA 5B09A 2C2MB 4EBEA 3HVTB 2XMJA 3BEGB 4NZ7A 4OLPA 5BYQA 4YDDB 2ZM6J 1YSJA 2XHWA 1ZM3A 2FIUA 1UMJA 1U0HA 3H25A 1UEKA 3EGNA 1VR6A 2DHHA 3G8QA 4ZLLA 4MJKA 3JSMA 2ZH8A 2I9SA 1AB8A 3IC1A 5HAOA 3ET6B 2DXDA 2J9DE 2RB7A 2FHMA 2V2ZA 3MR6A 4P2FA 1H38A 5EHHA 2BM1A 1UJ5A 5GMKa 5CD4H 3MTKA 4LF5F 2XCAA 1RU1A 3DMJB 2XY7A 2VDHA 4TY9A 2DGQA 2B56A 1WG5A 3QYYA 2HHUA 4BLGA 3D67A 3TUJC 1RB0A 3CJ8A 3CULA 4Y0FA 1FDNA 1EETB 2WOMB 3TUIC 1R8HA 4DV0F 3W5YA 4OX6A 4EFAC 4ECSA 2N3OA 5DG9A 2OI2A 1KNZA 4TN2A 2FZGB 1VOMA 2LA6A 1CSJA 2GVDA 1N0VC 3LP0B 5ETLA 1WTBA 3BGOP 2R8GA 3FRYA 1N33F 2PGCA 1T05A 4MMOA 2EVZA 4QIGA 4U9RA 1TUGB 4U95A 2H54B 1PGZA 2GO9A 2GQ2A 4HYKA 2W01A 2V50A 4HT7A 1QTMA 3CCUS 4ICLB 3UD3P 4ILLA 2KTQA 2MYFA 2J0QD 3RR7A 3CC7S 3C6UA 4MK7A 2BW7A 3HSZA 4ZVSB 1JIHA 4O3NA 3TUZC 1UJ4A 4IOCQ 2LXFA 2CA9A 2XMMA 3LWMA 4I2PB 3OQ2A 4HLBA 4EUVA 4USMA 2AJFE 1LWXA 1WF2A 2IRXA 5AE3A 2KZMA 1T9VA 4WZQA 1T8EA 1RTJB 2HG4A 2KFZA 4DL7A 4KV8A 2AV5A 4M5DA 1PJ7A 4YR0A 1NK8A 3H5YA 1HQUA 4YB5A 3K59A 2A6OA 1V3ZA 1LW0A 5KG7A 4DS4A 1HNVA 2PI4A 5A8WB 2ZOMA 4OHZA 3UVJB 4FXDA 3IM8A 5KFLA 2DNQA 3LP2B 3GIRA 3HZGA 4B3TJ 4M94A 4DL4A 3ETOA 4FXWA 4I0WA 1J27A 5LOQA 3JS9A 4M5DB 1YRXA 4B3RJ 1VHFA 2E1AA 3SDEA 1T05B 3AJ1A 3BKTA 5I42B 2J5AA 3LALA 3TO8A 3IBFB 4WFZA 4USWA 3KJVA 5IT9U 4HT5A 4OI6A 4WIIA 1JLCA 4P2SA 4RW9A 4NZ6A 1U8SA 3PIOQ 4IRCA 4C9DA 3OLAA 1KLNA 3K5LA 2MGZB 2JLFA 3TVKA 3N6NA 1IJFB 4JUZA 1LFWA 4H4KC 4GKJJ 1B70B 4DR7J 5C2CA 3VV2B 3PACA 2LU1A 1JLFB 2LP4A 1CJUA 2VASA 1EKRA 3KG0A 3M32B 1WHYA 1UFKA 4RL1A 3HXMA 1PC4A 1WC3A 2KO1A 3AHPA 4XDCA 5BYRA 3U1MA 3W63A 3M05A 4TLQA 3KK1B 1RBAA 2HWTA 3BS9A 1FRXA 3ILIA 3KHGA 3P49B 1QE1A 2XMTA 4C8KA 3UCGA 2R2SA 1S1XB 3WX4A 5GAHI 1VC0A 3I4PA 2BZ2A 2KVIA 4M5HA 2U2FA 4KYZA 4ZLPA 3FCVA 2HYIB 3E8OA 3MD3A 4ZJOA 1TK0A 4V19X 4W98A 4C11A 3P5BP 2FGCA 3D28A 2BMBA 3GFHA 2FGOA 3O2IA 5D4LA 5C25B 2ZUGA 3GG1A 4MTPA 4KSEB 3MMJA 3OJSA 4DX6A 5BJRA 3PR4A 3GIKA 1U1PA 3N5BA 2MQNA 2GHWA 3UNGC 4KIAA 1E6VB 5K20B 4BWMA 1IUJA 4RNOA 4DSEA 2FYXA 1FRLA 2JEJA 5B0BA 1SL2A 3W9IA 3PW4A 2D69A 4C8NA 2RILA 5HATA 2LQ9A 5KOWA 4ATNA 1HIYA 4OZNA 2W8KA 2E1CA 2FHOB 4KFBB 4OYBA 1IQZA 4DDFA 5F8MA 2UV8A 2DIVA 4Y2MA 5L9NA 3FZBA 4OZ0A 2OMOA 3MM5B 3Q8QB 4A48A 2UV8G 4FYWB 3PRBA 1F2GA 2M5YA 2YKAA 2ACYA 4OJGA 4DL3A 4CO3A 4XPCA 3VVTA 2DJWA 2XO6A 2I5JA 2W1BA 2XCPA 1F0XA 1VISA 2JC0A 4WJBA 4GC6A 2BR0A 4I64A 3M30B 2KFNA 3V4IA 2L48A 3ENQA 4A8XA 3T19A 3M6VA 4I7FA 3HSJA 4J7CA 4F0KA 2ZJPQ 4PQUA 1C1BA 1SV5B 2CNLB 2HS3A 4ANDA 5J1PA 3EGVA 2KYXA 1PSDA 2LKZA 2H5IB 2O1PA 2BQUA 1HQ2A 4D3HA 3NNHA 4C8YA 1RTJA 2ADBA 3DDIA 1YBAA 2K7KA 1PILA 4O44B 2CQCA 2RNEA 5J2PA 3R8YA 2D74B 2CPFA 4C0OC 4QCLA 4Y00A 3QAUA 2PMWA 1Y11A 4KBIA 1Q7LB 1Y3JA 3UVJA 5EWGA 1GX5A 5LMUJ 2QLFB 2MZJA 1JNRB 4U7CA 4OI3A 3T9NA 3NAHA 3ZNUA 4YHHF 4DFPA 4WXWA 2KI2A 3TZWA 5KFEA 2UUAF 1TKZA 3LAMA 3M6XA 2FY8A 4OHYA 3DLHA 4FYYB 4WPAA 1YBUA 4HI2A 2RT3A 2UUCF 3RRHA 3LW5C 3OD2A 2IHR1 4M63A 3DI6A 3UDCA 3RR8A 4NCAA 2MSSA 3T5JA 3T9ZA 1IBKJ 4LF6J 1IWAA 2OPPB 2YNGB 1T9TA 3M1VB 3I82A 9RUBA 3SCIE 4UT4A 2MGZA 3FQKA 3PW2A 1UTAA 3OL9A 3AAWB 2CQBA 7AT1B 1DTQB 4I1TA 1UEUA 3W8PA 2HVHA 2OEKA 1QE1B 1RDRA 3AFGA 3SSSA 1MU2A 5D78A 4ANCA 2AGOA 1AW0A 2F5GA 5IT4A 2ZOFA 1JXEA 1Q86T 2VG7B 1MWZA 4KJIA 1AZSA 1U1MA 1UW9A 3B78A 1S1XA 1YK9A 2Q43A 4IG0A 3SMZA 3K8WA 3D1HA 1Q1KA 2KL8A 1FNOA 4JYAJ 3SCLE 2PT0A 2JL9A 3BN7A 2Q1LA 5HROA 3ZZTA 1S10A 4ID8A 1RA7A 4F3OA 2ZDOA 4CP5A 2B5JB 1TFYA 2L3MA 4DPOA 3PX4A 1SCJB 2EWHA 4YP3A 1HI1A 4FYVB 5K8NA 1RACB 3NWGA 2ZBPA 2B43A 2DHGA 2CJQA 4USVA 4LUBA 4ZN3A 1CJKB 2R3VA 5E0OA 2XO7A 2W9CA 1N5VA 1VGYA 4LQ9A 4CIOA 1RJJA 1BQXA 4K4ZA 2QG9B 1XMBA 3TUPA 3CIMA 4RJVA 2M7SA 2HNDB 5ETPA 4DV1J 3ILLA 4NLRA 1Q0NA 2XULA 4DPYA 1PBAA 4A8QA 1URNA 3V5RA 2LDIA 2UXDF 1VMBA 4DHVA 4DOZA 2JOQA 2B3TB 3MURP 3V4IB 2PN6A 1UP1A 3PTWA 3O5TB 2HBRB 2VC1A 4EMDA 5J2QA 5KOXA 6FDRA 2A1BA 2OELA 1WC4A 3V6KA 4NLTA 1HNXJ 2IMOA 2LLZA 3AOBA 2HNDA 3DRRB 5HO4A 3DRSB 4QR2A 2R7WA 2ERRA 4J9LA 4NXNF 2RKIA 3KK1A 2B7BB 2NUHA 3WBZA 1DURA 4UOCA 4Q2MA 1NHVA 3GR1A 5IXUA 4RW8A 4CLWA 4PG6A 1T3OA 1N33J 2AF6A 2FQQB 1T9WA 1E6YA 2HIYA 2HVEA 2MQ8A 2QLWA 4TYBA 3QO9B 5HQLA 1YJWS 4C8LA 2ZBCA 4YR3A 4JI4F 2NXCA 3H2LA 3GCWP 4A8WA 1DZ5A 3C2PA 3VTIA 1T7PA 4IRDA 2VC0A 2FHJD 3L7OA 4BC9A 2IY5B 2HFZA 2W25A 2IFXA 4P73A 2F9JA 3PRDA 4YS2A 3Q8RB 3KDNA 3L7UA 3M7VA 1WF0A 3RJMB 4FS1A 3ZTQA 1UWBB 3EM1A 2VQFF 1RK8A 3CMQA 1X31C 3CJRA 4U8VA 3IGVA 3HI9A 5GMEA 4YFUA 2EPIA 2MSTA 2ZE2B 3H90A 4Y34A 2F8MA 4EO8A 1GQEA 5KT3A 4Z7YA 2ZBIA 2FJAB 3VAIA 4RPFA 5J2QB 4YY3F 1JWWA 1MMLA 1O5JA 4NLVA 4LFAJ 3W60A 1Y0HA 3QRPA 5BYSA 2AYGA 3OR1A 2AEFA 2XI3A 1AYEA 1FFGB 1RUSA 4DU7A 5KFHA 1WC6A 1WKJA 2RD5C 5AXMA 3M8RA 1UVIA 4QU7A 1F9HA 1HLWA 1JJ2R 2B4UA 4NEYA 2UXCJ 2AGQA 2L9DA 1NSKL 2OMLA 3FCWA 1Y5IB 3UWTA 5CD4A 1X5PA 3U7JA 5JUMA 3G8SA 4IFVA 5HLFA 1SKWA 5EX0A 3AODA 1HMVB 1KHVA 1FTRA 4NLXA 4OI2A 3GJRB 4Q5VA 1VC6A 1G4CA 4U96A 4G3IA 1CQMA 3A3NB 1RWPB 1P1LA 1QAXA 4KY3A 1I51B 3W61A 1U1RA 4JI5J 3NMRA 3MCOA 1FFSB 1UFLA 3DOMA 1C1BB 1SV5A 2C3PA 2VBWA 4DI6A 2NPFA 1RT4B 1RWOB 1UPMB 5HROB 1FJGF 1HMVA 3BH6B 2V94A 2I0XA 2Z58B 1M1KT 2K8GA 4FPIA 4KRWA 1UW4A 2RSQA 1UVNA 4DV6F 2AYBA 3DN9A 5T7LB 3KWMA 4RU9A 2EK6A 3QZ7A 3EPGA 3CO9A 1IR1A 2DXEA 2EFQA 3QT5A 1HPZB 2X51A 4MKAA 3V2UC 4BDPA 4R25A 3HKZD 1WHWA 1RABB 2JLEA 5EUHA 4XTTA 5I3PA 1SUQB 4CH1A 3ENWA 3NS5A 4HHJA 3UCUP 4PUOB 3BKUA 1XNRJ 1RAAB 5DDRC 2ZZMA 4QW9A 3C16A 5CA5A 1YHQS 4V1Ak 4DQSA 2BV3A 4CTAB 4NLDA 4W92B 5J2NA 2UXBJ 4IR1A 4QYZJ 4FNHA 1S5ZA 2BJ3A 1SUQA 1YWXA 1JLQB 2GJ2A 3G86A 3W2WA 2RU3A 2FD2A 2MY8A 3ZZOA 1S6OA 1S7HA 2IYGA 1F5AA 2C3OA 2QIFA 3DC2A 2Z0GA 3MFHA 3KJFB 3M9MB 1YVFA 3JYTA 3D9BA 4F50A 2NQPA 4B9TA 3A3OB 4RKUC 3VAMA 1LV5A 3TAQA 1BD6A 2VKZG 1FDBA 1YLXA 2ZOGA 3DU5A 4USKA 3H40A 3LAKA 3LQVA 4HTIA 3RAQA 3CD6S 1CJUB 1GMUA 1I1GA 3M32A 3VF0B 4C6AA 1Y7PA 4NLUA 3UDVA 1FWPA 1DQAA 2CG4A 2G0JA 3KLHA 1S57A 2ZH6A 3MOJB 4ED0A 4FKXA 1IKWA 2E29A 4OJ1A 1LQ9A 1Q8IA 2MMYA 4DR4J 2DYAA 4XIUA 2IM3A 2CNKB 2L9NA 2AT1B 5ETVA 4LF2A 5SUHA 4DN9A 1REVA 3OJUA 4CH7A 1S1TB 3SZ2A 2FVPA 4X4PA 2R7VA 3GR0A 1HYSA 4DX5A 4B9UA 1S1UB 4J9QA 4A8MP 4V19J 3S8SA 2DNRA 3PIPQ 4ED2A 1QAJA 3R6GB 2BJ9A 3MM6A 1EIYB 2JZ5A 4B3MF 2R7TA 3O1LA 5D4PA 2CG8A 1XNQJ 3QGPA 4U8YA 2EXUA 1HNZJ 4AL5A 3CC4S 4MFBA 2GCFA 4QW8A 1UVJA 3ADAC 1RAHB 2AIRB 2W9BB 3JTPA 2VG6B 1U26A 3K8VA 4EK2A 4WE1A 5L46A 1KDNA 1RXOB 1G1XA 4LBPA 5DQHA 4C0HA 4L72B 3DGVA 4HTJA 1VYAA 4LF7J 1RTIB 4F25A 1KOOA 4DR6J 3NGSA 3LOUA 1FEEA 4CLPA 3KLHB 2R2UA 1P1TA 2XI2A 2V9KA 2CUYA 4RO0A 3TR5A 2MQQA 2AYEA 1IKXB 5DLGA 3NCRA 1S9FA 4RW6B 4MIBA 1C4AA 4ZP6A 4ZPDA 4CT8A 4ED6A 4WK1A 2V9WA 2G1DA 5GADI 8AT1B 4DQQA 2HHVA 2K06A 4K50A 3T6BA 2RAQA 1U7LA 5M2UA 3L95X 4LR8A 4KH1B 4KO0B 2HQ3A 1X4HA 2JDJA 2CQIA 4QWDA 2KM8B 2JVRA 3BBCA 4NA1A 1F5BA 4ED1A 2VONA 4NCBA 2I5JB 1XR6A 2UUTA 2VG6A 4EGLA 4DF4A 3KLIB 3K5OA 3LA0A 5FDLB 4WYLA 3ZZ0A 3MPVA 2FUG9 2RUSA 5D4NA 1Y9OA 4N5SA 1B0VA 4LF4F 1FHTA 3IXQA 1WEYA 3ITHA 5I3UB 1R0AA 3OT9A 1NSAA 4LSNA 5E33A 2GC8A 3PNIA 2E66A 2MB0B 1S97A 1KFSA 4G1PA 1RP5A 3CSKA 3NGRA 2E1RA 2RRAA 4ZVHA 1FKPA 3KDOA 2GNKA 2J8SA 1HBUA 4QBUA 2D1CA 3ULHA 3PJXA 4K59A 2KZZA 3QFHA 1NKCA 2HHQA 3LP2A 3MAHA 3FBBA 1S4EA 2A10A 4ID5A 3FVYA 1ZTTA 3E01B 4UQGA 1NLKL 1WC5A 3NP5A 2ZBRA 3W64A 4YQWA 1U1LA 5KFGA 1IBLF 1VC5A 3QMQA 1R0CB 3VAFA 2X7IA 1HFEL 2UU9J 2WW8A 2ZJQQ 1WOPA 4N8OA 1PAEX 3CD7A 4DPTA 2YPYA 4X65F 3TARA 3JB9k 2IIHA 1MLAA 3DXBA 2Y1JA 1ZOTA 2V5HG 2O66A 3BR9A 1FDAA 3IP0A 4CM2A 4OLOA 3PY8A 1UEVA 4F2RA 3NNAA 3HHEA 1L3SA 4DUYF 2BQ3A 1QLNA 1HI8A 4OV6A 5CZVA 2HQIA 3MUMP 2JH3A 2WHOA 4FNIA 3BSOA 2WSCC 5F8NA 4AQYF 1HBMB 2B51A 1ZS6A 4I6YA 4N47A 3VGUA 1NKBA 1KC8T 3SSQA 2PFDA 4MK9A 5DETA 1M0SA 3JXOA 5HVHA 3HM9A 2D9PA 3D66A 2VQFJ 1NJWA 3H5XA 4CCHA 2KHDA 4OHWA 1YZ6A 4WBFA 5H9FJ 5THWA 1KSPA 2HQDA 2A18A 3T3FA 3PDNA 4DF8A 1U1QA 3CIZA 2HFVA 5MLCV 3V6DA 3BSCA 5GAGU 3IWXA 3D7SB 4URQU 5HSPA 3CE8A 2GHVC 3KLEB 1CJVA 2A2DA 2GAHC 3DRYA 3LGNA 1RT6B 4C97A 3J7Z5 1ZH5A 1MNEA 1VQ5S 1GMWA 1FT8A 1TL7A 4HH1A 4NWBA 3RAMA 3RU0A 2VBYA 1YJNS 1TL1A 1S99A 2YKMB 4CLKA 3J7ZT 4AT1B 1FA0A 3RTVA 3UD4P 2IBKA 1M5KC 3UI3A 1RCOB 4N76A 1T02A 4ZPTR 3KUGA 1LNQA 1IVZA 4F2SA 2G2YA 1S77D 3NY0A 3SQGA 4JV2A 2R7UA 3R5DA 1F60B 3QGIA 3VR1A 3PFEA 3HP6A 5D3GA 5T14A 2CFXA 5CXTA 3TJAA 2QMUB 4PQUB 4EI2A 1P8GA 3R7BB 4PWDA 1I6JA 2MEWA 3OXFA 1VHIA 1WJ9A 1KVKA 3LPYA 4J90A 4RBUA 4LF9J 5D0RA 1SBRA 1XMOF 1HHTP 1H98A 2JHEA 2QA2A 5IFMA 1F5CA 5GAEU 2G2ZA 3C3LA 4DMZA 5GAGI 3P8BB 3B4MA 1H0HB 1G2EA 2PFFB 2HAFA 1KWMA 3DRPB 3GB0A 2Z57B 1DTQA 1TU0B 4ZPCA 4F4WA 3R2DJ 3EGZA 1K47A 3KJNB 2ZH9A 1S0VA 1TV6B 2LQBA 1RU2A 1UPPA 1Q16B 2CWKA 4Z2XA 4NYOA 2AEMA 2JRSA 4DV4F 1XERA 2W7PA 1C1CB 1LXJA 3L7PA 4HH0A 5D4OA 3KLVA 3F41A 4PXDA 4WFNQ 4LF1A 3TVZA 4ER8A 1FF2A 2QFIA 5KT7A 1Y3KA 2P8IA 2H51B 3JSYA 1H73A 2V69A 3ZZZA 4JOUA 2EI5A 4IFVB 4AE5A 3FDSA 4CWBA 4HHUA 3KUEA 2LEBA 2YKPA 1KQSR 5KFQA 5LMUF 1G7CB 1TKXB 3MMBA 3N28A 3TJ8A 3V4MA 3MR5A 3BQ1A 5DM7Q 1KD1T 4H4OA 2J7WA 1BQMA 1N4LA 4MKYA 2YKOA 1ZAVA 4ZP9A 2KT3A 3OR1B 1ZBTA 3VZIA 2J6UA 2K7JA 3GLJA 4ZVFA 5KFZA 4YB6A 2ZDPA 1J5EJ 1KTQA 2PEHA 4F3MA 2FJBB 3I0RA 4DPXA 1V6HA 3VHQA 3DYAB 5DJBA 4URSA 5E3CA 5DGAA 2OPRA 4YB7A 4QWCA 3UFCX 1HBMA 1UFWA 3G6ES 2CQGA 4ZITA 4U67Q 1HNIA 3EVMA 1CEZA 3M2VA 1U1OA 4K4SA 3D6FB 2GMLA 4JI2F 5C25A 2LXIA 2NZCA 3G2XA 4LRFA 2J7UA 3A8IA 2HRYA 4AXIA 3EYZA 1UVLA 2V34A 4L73A 4K4TA 4Q7AA 3BQ0A 3E2EA 1D9AA 4U7UD 5C42B 3MTJA 4FF1A 3KTQA 4DL2A 1RT4A 3MUTP 3P3DA 2IM2A 2YWGA 1N5QA 1ZA2B 2MKSA 1JLBB 1W7WA 4LF5J 3SYZA 1SL1A 5CQGA 1FCAA 3OFEA 3I0SB 2BJDA 1NZ8A 1RSCA 3NGTA 3MAQA 3OSPA 3GMGA 2BDPA 3BO2A 3NG8A 4F8RA 2YKQA 3KG4A 4FP9A 1FVQA 1S4FA 1QSSA 2CAJA 2WBMA 3R5CA 5KG6A 1X4CA 3MM7A 3QBCA 3QGGA 2JFKA 3J80U 1YRTA 3P4UB 1DHMA 4PYDA 4DWIA 3QIPA 1WD6A 3MCSA 4B9LA 1G3OA 4YB1P 1T9XA 3K57A 4LRDA 3DYAA 1N8RT 5IM0A 2HS0A 1AFJA 4G1QA 3MUVP 4GO7X 1HWIA 1OS5A 2DGOA 1FXLA 2E5LJ 1BGXT 3DLLQ 3RB4A 2OGUA 4ETZA 2W4PA 4ES2A 3BDPA 3DRRA 2GW8A 4DV1F 1TFWA 1ZTWA 2A0FB 3DRXA 3QLHA 2E9RX 2N82B 1FK9A 1YX2A 4P52A 4TKTA 3C6TB 1NUEA 4ZS6A 2N4DA 2QMXA 2IC3A 4K5SA 4R0JA 5HQ8A 3SFGA 2HHTA 1YGYA 4ZCIA 1BWVA 3EX7B 4RNHA 4H4MA 1N56A 2A2CA 3NBPA 2MHNA 4LSLA 4CH0S 4CNZA 2DRDA 2OSQA 4KHPJ 3ENAA 1S0NA 4HACA 3HK2A 1U2RA 4B3SJ 1WF1A 3GTYX 5F9NA 3H4BA 4CO4A 2NZ4A 2X1BA 2V8GA 4TY8B 2HNYB 2XBPA 1K1QA 3TOQA 5KT2A 3G6VA 1U24A 2F4VF 2Y3YA 4NMLA 5BXIA 2MLYA 1FE4A 2KM8C 2N4CA 1FJ7A 3HVRA 1VQOS 2BW2A 2OHDA 3FBEA 1REGX 2HWIA 3W2VA 1GAOA 4Q44A 5JVHQ 1M5OC 2BJEA 5RUBA 4CO1A 2AHOB 2BACA 1IBLJ 1T3NA 3DGPA 1B0TA 4I56A 4ENOA 2W9BA 1WOOA 3FC9A 2BANA 2OPRB 2EK1A 3FUYA 4KHMA 4OI4A 4OYIA 5C5JA 1XC9A 4OYMA 3OSNA 1T03B 1Q5VA 1N34J 1MWYA 3AQOA 3BBFA 4WCEQ 4OX9J 1RAFB 3GP9A 3CDUA 5E3PA 2V4JA 1HWUA 2W9AA 3HFVA 4A8SA 1BQNB 1RTDA 2DT9A 1VQSA 1FKOA 3ZZYA 1R8AA 4A8OA 3DLKA 2RDJA 3IBWA 3WC2A 2VIHA 4JI0J 4NYPA 2BKOA 3TEHB 4LRAA 1IWGA 1CS4A 2DNGA 4TY8A 4DV3J 2Y1LB 1VQYA 4IG3A 4CO2A 1H2VZ 4F4XA 2CRLA 5E3QA 2M0GB 2FJXA 5KFUA 1QUVA 8ATCB 1D09B 1KP6A 1JLEA 2K3IA 3KJQB 1RT1B 2PA8D 5HMWA 1JLGB 1I94J 3ZZRA 3FBCA 1FX2A 3T5LA 3T1HJ 1NAQA 2YXLA 2HVDA 2CNNB 4L3NA 3SFUA 3VGVA 3NOGA 1C1CA 5LSLA 3PW5A 4GKKJ 3I31A 3HCXA 4IKAA 2GX8A 2HQGA 4CLLA 5KFJA 1VQLS 2EG2A 1SJ1A 1X4DA 4P2XA 2VBZA 2AP6A 5DDPC 3FMBA 3TA2A 3A4TA 5KFOA 2XC9A 2CWXA 4QWBA 3DRSA 1DJ0A 4HVZA 5KG5A 2YH0A 4K2XA 4ES1A 2ZUAA 5AJ3J 2LU2A 4ZN1A 1HR0J 3AJ2A 4NRTA 4CO0A 4G1QB 1Q5YA 5K14B 1K8AT 1HYSB 1GK8A 3OR2B 2OD6A 3C6TA 2BVZA 3F0NA 3Q23A 2FZKB 1M1GA 1RT3B 4LRBA 3H5SA 2HFSA 3CB4A 4WFAQ 3DHWC 2VOPA 1S9EB 3AY0A 3GFXA 3QIDA 3ZZUA 1FI4A 2IA6A 5C2GA 4MFBB 4J37A 1F3VA 3AXKA 1GH8A 4ZOSA 4F36A 4WU3A 2PDAA 2QA1A 1EHWA 5DDQC 2GIFA 4E2FB 2BKNA 3QATA 2QZ8A 4LIWA 2BUNA 1XR7A 2Z2LA 3H5UA 4QIFA 1ZPVA 2W9CB 3C8YA 2YY3A 4UOFA 5G0RB 1TVRB 5A8KB 1S1TA 3K5MA 5M2RA 3B82A 2J76E 1PG5B 2BXJA 1X9WA 3UW1A 4C8ZA 2GAGC 3E3XA 4KGZB 4MH8A 4CQ1A 4YHHJ 1L3TA 2OH2A 4G6VB 4KQZA 2VFRA 1N6QA 3BDEA 3BR8A 2V2KA 1SC4B 2AKWB 3KK2B 5L1KA 3LP0A 3ICLA 2UUCJ 2C2RA 3GU0A 3JTNA 4WYWA 3NLCA 2HK2A 2YNIB 4A46A 5B08A 2IBOA 3I0SA 5CCMA 5IWAF 2EFNA 2MQOA 4LF6F 1Q95G 3BZQA 3GIMA 4DR4F 1FJCA 2BANB 2R7XA 3M8QB 1EB0A 2RDDA 3MEKA 5CH7B 5F0WA 4WTYA 5ETSA 4R5PB 5FLXU 1SIWB 2ZHBA 1SJ3P 2HFOA 1FKOB 4FXVA 4P72A 5LM7E 2ADCA 1R3NA 4ZPAA 1D3WA 2X1FA 1FTCA 5DRKA 3F73A 3SEOA 2RMLA 1EP4A 1YRUA 1FDDA 2BE2B 3IRXA 3HT3A 1UA0A 4JV1A 1RTHB 3MMCA 2WSFC 2KJWA 3CDWA 1T03A 1HD1A 2W8LA 4IO9Q 1IJEB 1T9YA 1VIXA 3QNWB 3PO4A 3HFZB 3NNCA 2Z4PA 4X66J 1O0PA 1YBTA 3GV5B 2IAJA 3L3CA 4ECUA 4ILMA 3BYRA 4ZIWA 1IKXA 2J9CA 2VPZB 3FCHA 3MECB 4DPWA 3OV7A 2UVRA 2SXLA 4LF8J 1NK7A 1VI7A 2XM3A 5C7PA 2X3DA 3K89A 4EYHB 2CPXA 3DOKB 4KO0A 3GIJA 3OUYA 1WC0A 2BJ7A 4Y28C 1F2HA 1FD2A 1A6LA 4UOHA 4ANEA 2Z2YB 5F8IA 1Q7YT 3W3SA 2VG5A 2XHCA 2BYCA 3M6WA 2P6SA 3OTEA 4Y65A 3AXMA 4RW8B 1N5YB 3LP1A 2ZJRQ 1HBNA 3MHYA 4NYZA 3JYTB 1YITS 3PG9A 3DLBA 2VPWB 1FNXH 4L75A 1VK3A 2N7CA 4JI7J 1WHVA 4NXMJ 4ZJLA 3MEEA 4KTQA 2UXDJ 2OPQB 1R89A 1NKEA 3ZTPA 1FWLA 2ALYB 4DR5J 4I2QA 2BABA 2ZC4A 5B0DA 1ZETA 3HJFA 3GYGA 4PXBA 4PXCA 1X9SA 4FF4A 2KRRA 2IAJB 2C3MA 2E5GA 3TP2A 5HL7Q 4U7UK 4PG7A 1HBUB 2XEXA 3MEGB 1MMNA 2DNHA 4N7TA 3TX8A 3UQSA 4EBDA 1SC3B 3Q89A 3C15A 1DBDA 2I2YA 2ASYA 1EQ0A 2IRYA 2B0GA 1SPBP 1IKVB 2GVZA 1K0VA 1IKYB 3DCAA 4UF4A 5A6PA 3OPKA 5IV4A 5GVQA 2XTJP 1HARA 3NGUA 4RWXA 1LW0B 2EEYA 2ZVIA 3ET6A 3GIIA 4K4XA 1RWNB 1XK8A 4OZJA 1E6VA 2ZC3A 2DGUA 2LVWA 3GYXB 2APOA 3UN3A 2NYHA 2LMIA 1N5YA 4KKOB 3PRVA 3AOCA 4WFBQ 2XSJB 4J9SA 5E3RA 1IKWB 5KFFA 3V6DB 2QL7B 3O8WA 2GVZB 3B4DA 2LECA 1P9QC 3HHKA 3MPDA 3HVTA 3MOZA 3PX6A 3FFIA 1M1HA 4RUAA 2WZ1A 3GYNA 1RTIA 2ROGA 1M5VC 2DCLA 2OPSA 3HHLB 4C48A 2E9ZA 3BN4A 1H74A 3C16B 4ETXA 3D1OA 1K0TA 1HWLA 1VQ9S 4B3SF 1RAOA 5L38A 3DXSX 4RUCA 3D2WA 4ALZA 3OL8A 3TA1A 3Q24A 1X4FA 2QJ3A 2Z56B 2WTFA 3KLGA 3FQLA 3BSNA 2GFFA 1HNIB 3MXHP 1JK9B 1RTHA 3MMCB 5HVFA 3RZAA 2R2RA 2DR9A 4O3RA 2XS7A 2QL5B 5J2MA 4N8NA 4A47A 3MM5A 3D0GE 5ETKA 1HA1A 1IBCB 2QLJB 1DARA 4IO1A 4TVAB 3FK4A 1RAIB 4DZ6A 2DPJA 5B0AA 2NYIA 4DZDA 4GVLA 1KFDA 1SH0A 2VF3A 2MZRA 3Q83A 2OIHA 2M9KA 3MFIA 3H59A 1YG0A 3AA9A 1RT2A 2LFVA 3LGHA 3PKYA 3KLFA 3OUYB 3J7AN 2NUUG 4LSZB 3NS7B 1MROB 3A8EA 2BRKA 5L9XA 3T5HA 1N34F 5B0FA 2QV6A 2DR5A 4JI1F 2W24A 2VA3A 1PC5A 2HRUA 2M88A 3A3PB 1Q8BA 2XZDB 1REVB 3TQEA 3ISNC 1NPKA 4KB7A 3TWZA 2ZZTA 5GAEI 5L1JA 4ZVRB 1U2CA 1JJCB 5A76A 4ITSA 4KV8B 1R27B 2JX2A 3THPA 4O4RA 4TYAA 2FZCB 4ECTA 3CDAA 4DCPB 1L3KA 3KLGB 3NEKA 2LYVA 4HI1A 4LSNB 2LEPA 3W7BA 2CADA 1FXRA 2F3JA 2RU9A 3BGFA 3UR0A 3CT9A 3E01A 1FX4A 3F44A 3I9V9 1XQIA 1RWWB 2OLWA 3PYEA 4L76A 1TKTB 2V8PA 5J2NB 5C24B 5I3QA 3M9OB 3A8KA 3I87A 3QLHB 4RW4B 1VJQA 1I94F 3OFHA 1R8PA 4PZVA 4RW7B 1NO8A 2COLA 2MKKA 2C2ZB 2DR6A 4Y2IA 2H48B 1KQFB 4TU8A 5KFCA 1HWKA 1NDPA 3HSDA 1N36F 3RRGA 4LFCF 3SIPB 2EBGA 4DSKA 3KOAA 3C14B 5CHCB 1DQ8A 1P9YA 3S01A 4EYIB 1IKYA 4O23A 2D3O1 1BLUA 1HHSA 4P10A 4B3OB 4B9NA 2XSJA 1B7FA 4OYPA 2AJ0A 2M2BA 1LWEB 2VFUA 2W4DA 4USJC 1XMOJ 3FRZA 2DRAA 4ZPVR 4AD6A 3G8TA 5DGBA 2ZHOA 3ZNJ1 2PD1A 3QWUA 1KQKA 1UWAA 3JSRA 2C3YA 3T6JA 5AJ3F 2FJEB 3CCVS 3U1LA 3CDBA 1TKXA 4L74A 3DM2B 2HNYA 7FDRA 2VD3A 1WG4A 2MZTA 2RE1A 1SVDA 2BM0A 2LQ8A 3H20A 5E41A 2GJIA 2HFNA 2KKHA 3R5AA 4GMKA 4M5IA 1CBKA 1YKWA 1RQ0A 2E7XA 4P75A 2M8DB 1FVSA 2AU0A 2IM1A 2NSBA 5K8OA 4AL6A 4DJBA 4FYXB 3CCTA 4J9UE 1TUVA 2RUGA 5IV3A 3OL7A 2JEFA 3MPWA 3CUNA 4RR5A 5G0RA 4ZVUB 5IQ6A 4OHVA 1UA1A 5CZXA 2DO4A 5KFVA 2RQMA 2VG5B 3QQCD 4YR2A 1U4BA 3JQMA 3R5GA 3A13A 1QVGR 4B3MJ 4B9VA 2Z30B 2DGTA 2J0WA 4NLSA 3D68A 4JP8A 2D9OA 3EE3A 3A1YG 1S6QB 3OBIA 3RRKA 3S1TA 4ZK7M 1SXLA 4J9RA 2MKJA 3LTOA 2VG7A 3PM9A 1HBNB 2PC6A 4ZJQA 3IWLA 1FRIA 3I4HX 5AXNA 3EVOA 1SKUB 5CYMB 2MKHA 3BH7B 4ERDA 3M8ZA 4CT9A 3OTOJ 4I7FB 4ECQA 3KKFA 2XMUA 1WEZA 1B64A 3DLEB 2OPQA 2V63A 1PBUA 5A8RB 2CJKA 2A6MA 2Z8QA 3N01A 3G9CA 1S6QA 1MSWD 1APSA 2R8IA 2DPIA 2UUBJ 1OMSA 1RHQB 5B7WA 2BA9A 2B5JA 2HBYB 3D6TB 1JLEB 1N0UA 3MM7B 1DTTA 3BYPA 2DNZA 3US5A 2UP1A 4LVOP 2QTWA 4LR9A 4OJ3A 3LP1B 5LXRA 1L5UA 1VQ6S 1TKZB 5KG3A 5FIIA 1R6VA 1IBMF 3PV8A 1NPRA 4GRSA 1FKPB 2HNZA 3L9ZA 2IA0A 2UVVA 3NKYA 1WG1A 3Q8VA 4I67A 2IM0A 2WBRA 3PXGa 3JAMU 2C28A 5GAHU 2Q6BA 3ISZA 3TZXA 1SKRA 2B6AA 4PYAA 3VVUA 1RHRB 1YJ7A 1WHXA 1KKHA 5FLXY 4NA3A 1NM2A 1S9EA 3I96A 4RU2A 3CGIA 3LPEA 1XEZA 1WELA 2IC3B 3HMJG 2JNJA 3RBEA 2DH8A 4OYXA 3IR7B 1QSLA 1D8YA 1TL3B 2DTJA 2Q66A 3AA8A 1X5TA 3CJ0A 5I4MA 2F8EX 3KK2A 1S0MA 4KE5A 1W25A 1RAJA 2KXNB 4WKRA 4F04B 3RW7A 4M5LA 1MWQA 2WAQD 4P7VA 3R7NB 2HHSA 4CLYA 1EZZB 2ROEA 4H4OB 1RA6A 1WKLA 4PPDA 1L3VA 1PYSB 2EG1A 3GSDA 3JSBA 1ZZFA 1F9FA 1E6YB 2VQEJ 2UUBF 4JI7F 4NXMF 2R7OA 3M1VA 1ZA1B 2HGMA 2RS2A 1S12A 3MM9B 2DR7A 1DLOA 3R27A 5H9FK 5AXLA 4LT6A 3DU6A 1OYEA 1VRQC 1WDDA 3FSIA 1LXNA 4IDKA 3OFFA 1MN9A 2HZVA 3AB2B 3Q8YA 5LMNJ 1Q53A 5DDOC 4LFAF 2FLPA 1GXLA 1NJIT 2G1HA 3RB6A 3MM9A 2G2OA 2AW0A 4EEYA 3TEGA 3MD1A 4B08A 5A0YA 3A12A 3G4SS 4I69A 5AT1B 4DUYJ 2B9WA 2DGSA 2YNFB 3T1AA 5HMXA 3PJWA 2LCWA 2U1AA 2WVBA 3CCZA 3PR5B 4E98A 4IDKB 2V4JB 2VPXB 4BCAA 2GJFA 1PCAA 2E7VA 4MIAA 4DU8A 2DISA 1RHJB 1PIEA 2XZWA 3BPDA 2ASLA 4HR2A 3MM8A 2MXYA 3ZZPA 2NPIA 2PA3A 3D0IE 3HVAA 2ZWOA 3N6MA 2B4VA 2XWXA 4OZ2A 4EU0A 4DR3F 1TV6A 2BKPA 1Q79A 2XMAA 5HLFB 1FRHA 2UVWA 2V67A 2DVIA 2KHCA 4OYAA 4RW4A 3TJ9A 1YJVA 4IFYA 4QJVA 2X3GA 1DFDA 1SH2A 1WI8A 4J91A 2MDAA 3C19A 4PCQA 4ZPWR 3T1YJ 1O6XA 1RLCL 1RT5A 2OSRA 1ZZNA 2CDQA 4DSJA 1U2FA 1V5VA 4OFZA 2A3JA 4ZA1A 2HMIA 4JI0F 5EN1A 4YEAA 1GXUA 1NDLA 1V9OA 2C42A 4XDDA 4NLOA 5A0YB 2V68A 1FERA 1BQNA 3MMAB 1RTDB 3NL0A 2EC0A 3SQGB 3DI6B 1BXNA 2DXFA 3BBBA 3O3LA 4L3KA 4O44A 4Y6IA 4TU9A 3Q22A 1QD1A 3J81j 4LFBF 4X4VA 1K44A 1X4GA 5L1LA 3D3CJ 4KGVB 1Q81T 2GHPA 3PW0A 3R7SB 2EKNA 4NA2A 2D7SA 2HVZA 4M5NA 5F8GA 1JJHA 2KH9A 4GKKF 4J9NA 1CJTB 1WACA 3FJ2A 3TAMA 2CPHA 1AFIA 2D41A 2LA4A 5K14A 2HEKA 1WUUA 1Z1ZA 3H0PA 3R3TA 5ETMA 2FHKA 3GFZA 4DCOB 3HHNB 4X2BA 2ZNYA 3M2UA 4DLGA 3G87A 3O44A 2LEAA 1OSCA 3WIUA 1IM4A 1JLFA 2YWFA 2IVFB 4DXLA 3J80Y 4X64J 1RLDA 5KFRA 2HSEB 2QYGA 4X4OA 2WVEA 2B8PA 2DY1A 3CF5Q 1TK8A 4H4KA 4A8FA 1JMTA 4WKYA 3FZ2A 2Q6CA 3CCES 4DX8H 1TL4A 4OYWA 3KHHA 2BRLA 5KT5A 2VPYB 3CD0A 5CYMA 1VRTA 3BPSP 4DBQA 1GMVA 1GTEA 3HHLA 3PHEA 2QMWA 3VGTA 2QYCA 4F4AA 2EKYA 2YKNA 4QPXA 1ZYQA 1NJYA 5U47A 1J5OB 2BBEA 1OSDA 3EXYA 3QWPA 3POTB 5GMDA 2BJ1A 3CMAS 2CZ4A 1SC1B 1VRUB 2MJUA 2VICA 1Q78A 3DFEA 4DS5A 3T5KA 1ZAXA 3FGVA 3M2RA 1TELA 1CQNA 3FEXB 4C0BA 3G96A 1CJTA 1Z4UA 1QY7A 4WFXA 3TAMB 3DLKB 1NZAA 2GQQA 2P9EA 3DOMB 4PEOA 2HZCA 3HFKA 5ETNA 1HNZF 2NSCA 4PRFA 2HLTA 2WB4A 3BM7A 1CJVB 2AD9A 3J7YU 3CJ3A 2ZITA 3B8HA 3KMSA 1VBZA 2M4MA 2QN6B 2RS8A 3N4WA 4AUKA 5DQGA 1HNWF 2XS5A 1KVIA 4OZ3A 1V5IB 5IWAJ 3QFWA 4LR7A 2Y1RI 4M5GA 4ZVGA 1FK9B 3WDOA 3V6HA 3G6XA 1BHNA 2CJBA 4BBYA 5HBMB 2ZH4A 1FD8A 2E5HA 5BR8F 3CMES 4ICLA 2RHSB 5KFSA 1QUPA 2GV1A 3KUHA 2DNYA 3W8GA 1VIOA 4S0MA 5CCLA 3GV7B 1M90T 3PVXA 4QIVA 2ZH2A 1RHMB 3K0JA 2DGXA 2CQ3A 3CTRA 1F3FA 1TL3A 3A8JA 5DZ7A 4PKDB 3NS6A 2VA2A 3NMAA 1WORA 5KFAA 2CPIA 2WVFA 5HBMA 4HDGA 5KT6A 3CEDA 2HQFA 4EZ6A 4X66F 1ZPWX 1RYSA 2FJVA 1S9GB 3IGNA 1UWBA 1NRKA 3BB5A 2XYHB 1A9NB 4HHHA 2B6AB 1QTNB 2J7KA 1JLAB 1OPZA 1UVKA 2AX0A 2OFHX 2JJ4D 3MPYA 2W2MP 2ZKUA 1D1UA 1KRPA 2GZOA 1VQ8S 4H4MB 2UZAA 2DY9A 2XLKA 4ECYA 2RH3A 1S6PA 1AA1B 1JKHB 2R7QA 5AE1A 3SI8A 1B7YB 2WRMA 2AWZA 3QO9A 3RUBL 3S7RA 2GGPA 4ZCLA 2F7VA 3QJJA 5F9LA 4NI2A 1RWXB 2B8QA 4ELVA 3J81Y 4R8UB 4DV2F 1IBMJ 1NSPA 3C15B 1LWFB 5IC4B 4USUA 1KTVA 3CCWA 1MU2B 1FESA 2KN4A 2GS8A 3J7A1 1VK8A 1U8WA 4DL0C 3QRQA 1U45A 3P6YC 1SJQA 1A0OB 1A7GE 1VRTB 1VJWA 4MKBA 2WONB 4ZVQB 5F3TA 2ZH1A 1S1UA 1KONA 1JJ4A 2M8HA 4GO5X 1JLCB 2C2OB 2FC8A 5L8RC 4K4YA 2EW9A 5I42A 3R5JB 2OD4A 4UTGA 1NJZA 5EDWA 4DV0J 2JSXA 1X4BA 2V6AA 3CJ2A 4ES3A 2ATLA 4KHPF 2UVUA 4ECXA 4URGA 1XWLA 2LQ5A 4PAAA 3FKBA 4X65J 4XO0A 2XLIA 4BHQA 1XMQF 3M8WA 2BX6A 4K5RA 1CULA 3D1QA 5DG8A 5KAKA 3M2RB 3IR6B 2IPOB 4OL8A 2Y8WA 2HHWA 5KTQA 2GGPB 3PX0A 1T9UA 3FBFA 4TXSA 1RHUB 2CQPA 3K58A 1U47A 4M5MA 2R8JA 2UUWA 4AQYJ 1X5SA 2YWKA 4QR1A 5F3ZA 1PAUB 4W90B 4RUBA 3CCSS 3NCQA 3W5XA 3D5MA 2G0CA 3EVWA 2R42A 2AMCB 3BQ2A 1TK5A 1LK7A 3CDEA 1CULB 4LQ3A 3MECA 1LEOA 5HQMA 4DSFA 2VL1A 2IDEA 3MR7A 3KK3A 1JQGA 5CYQA 5ETRA 4Q45A 5D0EA 1KN6A 2L9WA 4DG1B 1KVJA 1O8BA 2EFVA 4Y2CA 4X4RA 3VALA 2HLUA 1S0OA 3MR3A 2B4OA 5FDLA 3MPUB 4RZRA 1N32J 2HNZB 2Z2MA 3PKMA 2FVCA 5MAOA 1R0BG 3WZ0A 4K2JA 2XNRA 1X8DA 2VB6A 2B7CB 2J0XA 4EWTA 4QWAA 5A2QU 2RF2A 3MWBA 4Q0BA 3MEDB 1RCXB 3KG1A 2P2CB 1ZAWA 2VDIA 3HD2A 1B0PA 4DQIA 4O3PA 3B6BA 1UKUA 4C4WA 3UO0A 1YDLA 1QM9A 3HPOA 1FNMA 5E5NA 1ICEB 3J7YI 4X4UA 1CC8A 1GT8A 4NL5A 1C0TA 1Q4RA 1RKIA 5J1NA 1KLMA 5DZ6A 3FSYA 4I6WA 2DGVA 4WU2A 1VS3A 4KPCA 3HF5A 1RI7A 3H2VE 4C8MA 3UN2A 4DX7A 4FF3A 3H4DA 1U48A 1BQMB 2CQ0A 2NS1B 4OIXA 5J1EB 2C2DA 4JV5F 2W7OA 2RRNA 3HT0A 3EZ5A 1VDHA 2DKOB 1D8ZA 2BE9B 2LDYA 3PHTA 2HMIB 2CJXB 2MTLA 3DKDA 1LOUA 1UZDA 4JI8J 1VBKA 1W26A 1RE1B 3POTA 1X5OA 3H98A 4RWWA 1PKUA 1U09A 1AUDA 4Y3CA 3KNAA 4RNFA 2GMJA 3OXGA 5J1EA 1M5HA 2Y0BB 3HHLC 1EKSA 3QT8A 1MW7A 2HHPA 3H8YA 4USIA 4PPZA 3C14A 2HHHF 1LKZA 4JI5F 5LJ3Y 5HP1A 4MAKA 3Q8PB 4FBTA 3AJDA 5KFYA 3DM2A 1EETA 1GMWD 2AJ1A 2H1YA 4ZLJA 4R5PA 2OPSB 5D0GA 4C3KA 5C24A 5KFIA 2KG0A 1S49A 1N36J 4LFCJ 4Q43A 3ILOA 2X1GA 2YQ1A 3GFYA 1FFWB 4CLSA 3GSIA 4CZCA 4P2MA 4KKOA 2YTCA 1OYDA 2GO8A 4Y2AA 4X64F 3QIPB 5EGYA 2YPZA 1QVFR 3RYLA 1EARA 2VKRA 3TRGA 1XIQA 3HJVA 2DD8S 1XJWB 3KLEA 1RWUA 1R8BA 3ILJA 4I6AA 2X1AA 2QSFA 5AE2A 3HDSA 3VCDA 1U6FA 3GJTB 2H3EB 3NXZA 4I2PA 1J5EF 1U6BA 3MAAB 3RBXA 4G65A 3OFGA 4J9PA 3M9NB 1KR4A 2FY1A 1JXLA 2MJNA 3CW2C 3WIVA 2CPYA 1ITPA 3RW6A 3CD5A 2P9GA 1TL1B 1TZ0A 1X4EA 2FB0A 4LREA 3SSRA 3W5ZA 1RYRA 1SQGA 3G71S 4JI2J 1ROFA 1P27B 4RX6A 1RT5B 2FDNA 4LRCA 3P96A 4AXJA 2KG1A 3RBDA 3NOCA 4CDIA 6AT1B 3PCOB 3M2VB 5FD1A 3D3BJ 1T94A 2GA7A 4QZVB 4LMZA 1UL3A 2VFVA 3D0HE 1HWJA 1LWFA 3Q0AA 5HN0A 2CYYA 3CCLS 3I6PA 3IO1A 4B17A 3OVAA 2DEIA 5H9EK 3N6LA 1K9MT 4LF8F 4DV5J 4NLPA 1X0FA 2YX7A 2RHQB 1IN0A 4U6PA 4O3QA 4MYTA 1JKHA 3PYDA 4CRJA 3IAM9 2QE5A 1VCTA 5BR8J 3MAAA 3OVBA 4ELUA 3MMBB 4QYZK 4DQPA 4IUFA 5IT9Y 2VFSA 2Y9HA 1KLMB 5L39A 1RADB 3EZUA 4R8UA 2NREA 1YJRA 2ZD1B 1S72S 2FVSA 4OYZA 4X4NA 1NPPA 4P6QA 1DTTB 2C1EB 2KT2A 1SIZA 3GJSB 4YUDA 2E5LF 2K1RB 1CVJA 1OWXA 1FO1A 4ZVOB 2J9DA 5F8LA 1WSRA 4DCJB 3VAHA 1JB0C 3VWSA 4Q8EA 2QLBB 4DR5F 4MT1A 4WXOA 3PEHA 4Q2LA 2JC1A 3GE9A 1YJTA 2D3UA 2QFJA 3W9JA 1Y00A 5LSRA 1TUWA 4J9VA 3D6HB 2IVYA 2DHSA 4N56A 4C2MA 2ZH7A 3BO4A 4A8KA 1TTHB 2FJWA 4DG1A 2F1FA 1LWEA 1YJUA 1F1BB 2IJRA 1UETA 3D6MB 4QQBA 2YX4A 4IOBA 2HBQB 2YNHB 3THTA 3VAJA 2BOPA 2YQ0A 2XS2A 3KMQA 3EDRB 3P45B 2AZ1A 4M5KA 4N77A 2CVEA 2EBEA 3BF4A 1RT7B 1HW9A 4PG4A 2WVDA 3G82B 3CC2S 2JEIA 4QOTA 1Q82T 4UUXA 2OTJS 4NRUA 4PQAA 1QSYA 1G6BA 4E8UA 3VAGA 3BJYA 2MLZA 3B54A 3MF5A 5F0UA 2YWEA 4NLGA 2EFGA 4PG5A 3TVYA 3SV3A 2FVQA 4OYOA 2HK3A 4FVMA 4WIQA 4RNNA 4HKQA 2OUGA 3BGLA 3FSXA 1NCLA 4MKVA 2DH7A 1FRJA 2DNNA 4FPRA 3RB0A 4GC7A 1JX4A 1KHWA 1WKKA 1VQ4S 2AZ3A 3IS9A 3R9LA 3IA0A 5A8RA 2D3OR 4UZCA 4O0IA 1S1VB 3TQ1A 1HNXF 1MN7A 2AX1A 2G9OA 2DNMA 3Q86A 1LFPA 4YMEA 1AXQA 1C0UA 1T11A 5C42A 3JSMB 3W62A 3L09A 5IC6B 4OX9F 1XMQJ 1S9GA 1RKJA 3OR2A 4RLEA 4B9MA 3M8YA 3DLGB 3EJMA 3K17A 4K8RA 4NLQA 3HD1A 2JFDA 4LJMA 5F8JA 5DQIA 4ZHRA 4BWJA 5KG0A 1R6YA 4UY8T 1JNZB 3DRPA 3ETMA 1VLOA 3IAS9 3ITHB 4NPOA 5KG4A 2VJVA 4JI4J 1DY3A 5ITHA 2H9ZA 2V4RA 4DV3F 4CLUA 3N9UC 5LT5A 3EUNA 4B3RF 4TNOA 2RVJA 1HQEA 5K9FA 3UE2A 1T95A 4DPUA 4O3OA 4PWDB 4DR3J 3IBCB 7FD1A 3IG1B 1S6PB 4WP8A 5DM6Q 3QZ8A 2MQLA 1GTHA 3EWGA 1RT1A 2NCKL 2F4FA 5IS2A 1NHKL 4JI1J 2BJ8A 1TKDA 1WNEA 1Q8KA 3F56A 1XBWA 2DIUA 3ONQA 4USTA 2HAIA 4OI1A 1OQ3A 4C3LA 3TI0A 3GJQB 1N5SA 5A8WA 1NBEB 2ZD1A 2PI5A 4O4GB 1N54B 1C0UB 1T0TV 1OY9A 4K4VA 3PJ9A 3S6EA 4NLYA 2UXCF 4NASA 4WZMA 3HKWA 2DNKA 1TQLA 3I55S 2C22A 1FJEB 1M5SA 2VOOA 4RNMA 4PABA 2MZQA 1S59A 2NR0A 4PXEA 1EP4B 2BE2A 2HRTA 3IRXB 3LANA 4ID5B 5K8PA 4LFBJ 1WTFA 2DK2A 4K0KF 4OZ1A 5B0GA 4X4SA 1GNKA 1LWCA 1TP7A 3U27A 3OW2R 4DFMA 2OJ3A 2XWYA 4DR1F 3UR3C 1NNDA 2JVOA 3DLEA 3G82A 3KHLA 1XR5A 3OTDA 3BKFA 4I4BA 3EZOA 1URRA 1KS2A 2IJNA 2Z2ZA 1D0EA 4DR2J 1RZMA 4OX8A 1S7IA 1X60A 1FJGJ 4JB8B 1IKVA 1D9FA 1N52B 3THVA 1NDKA 3QAEA 4PWWA 1S76D 4G1IA 1L3UA 3HHLD 4IH7A 3OXLA 4M8LA 2OTLS 2WOMA 2KFYA 2YH1A 1IQTA 2HBZB 4J9OA 2NXEA 1EAYC 3VGSA 1WOSA 2HURA 1B99A 1KQGB 1R7IA 2R8HA 4HEA9 2VU5A 1V3SA 5HVGA 4QPTA 3ZO7A 1VRUA 2YBVA 2P9CA 3BO3A 3KK3B 3K5NA 1BWEA 2VFTA 3GZ7A 2EC2A 2W2PP 2M52A 4M1KA 4CI0B 3D54A 3Q2SC 1OY6A 1S1VA 4ZCKA 2XNQA 2ASDA 2UXBF 1X7VA 4FVCA 4LBHA 1P6TA 4O3SA 2AGPA 3MGJA 3QT6A 2YNFA 1C0TB 1I5OB 2V8HA 5HI7A 1YIJS 2YX1A 3CJ4A 3W1YC 1CS4B 4CYUA 3J81U 3BV8A 3K2YA 4NMXA 4F4ZA 3RGIA 1HW8A 4FDFA 2K3KA 1UAWA 2VHGA 4JI3F 1KBRA 3NCPA 3H42A 3Q8UA 2RF2B 4Q0BB 3GWCA 3DDKA 4HL9A 1KOHA 2FLNA 3NGDA 1HNWJ 3HHDA 4FF2A 1K1SA 1XN9A 3QT7A 1R0AB 4DV7J 3JTOA 4QIWD 3U02A 2WB1D 1U1KA 3MEEB 2ABYA 5D3GB 3IFEA 4RW9B 3HSGA 1QAYA 3UD5A 5A2QY 4EBCA 3TW0A 3MM6B 2ZM6F 1TKTA 4C7QA 4O0NA 1M5PC 5HK4A 1WDTA 1WWHA 2ZVSA 1O51A 2DCUB 3IR5B 3JQKA 1N6QB 3C66A 5HMYA 3MMAA 1SL0A 3TX0A 4YOEA 1NXIA 5LL6d 3BGRA 2XQCA 4ED5A 1QDUB 1S1WA 3QJLA 4KH0B 1NK5A 3HULA 5IT0A 5D6GA 4JYAF 1VQNS 4UW2A 2PMHA 2H5EA 3PYFA 5SZTA 3CCJS 1CC7A 2DBBA 1DRZA 1OJ4A 1OY8A 2GIQA 3KFWX 2CVIA 2GMHA 1RWVB 3JQJA 2R2TA 1AROP 4C11B 4UUWA 3I56S 2V8DA 3I5AA 1F6TA 2XZTB 4P9SA 5IOLA 2L41A 5HMZA 2R8KA 4DR6F 2LQJA 1S1WB 3L4BC 4I2QB 4K4WA 3R1HA 3QGHA 5HP1B 3SXLA 1BC6A 2CXEA 3LWLA 2ROPA 4ED8A 2ASJA 2RQ4A 3HZEA 3UDEA 4DV2J 1RBLA 2O5DA 2HVIA 1EJ7L 3JAMY 5F41A 3R1LA 2OP5A 3GCXP 5CYJA 2YKNB 9ATCB 1UCNA 2HFUA 3RAXA 3IMQJ 4ZHRB 2BOAA 2HHXA 4XPEA 1WSVA 4WK3A 1R43A 2VBXA 2XYGB 3WX8A 3NWRA 4DUZJ 2G0IA 2XMKA 4KGKA 4IRKA 3CVKA 2YVSA 1HQUB 4DEZA 1B4SA 4KGMA 1FEHA 4ZP8A 2YQ3A 2MZ1A 1BMQB 4F67A 3UN5A 1K73T 1EQMA 3GQCA 1CG2A 2DITA 5T7LA 2FHJA 3CJQA 2O67A 3FFIB 2NXUA 5LMNF 2QC3A 2F40A 3DMJA 1HHQA 3EGWB 2MKIA 3CPWR 5FJ4A 5CABA 4KFBA 3M30A 3KXDA 4IG3B 4CYUB 2QX0A 2CZ9A 4IG0B 5IZHA 4IH5A 1WC1A 5KG1A 1HKAA 1RAEB 3P5TL 1TMJA 1OO0B 1Y4ZB 5LSOA 2AQ4A 2BE7D 2RQKA 2MLXA 4O4GA 5KFPA 3MEDA 2FPHX 2QEXS 3M2UB 1JLGA 4F4KA 1NEEA 4KPYA 4ELTA 3LF0A 2ZH5A 2W4CA 2GVDB 5DS7A 1VBYA 3N79A 2ACMA 4PR6A 1BY9A 2M70A 4DL5A 2KXHA 4UY85 2AJQA 3IM9A 3DOLA 3BREA 4X62J 5DO2A 2NXNA 3PYGA 4ZP7A 2DNOA 2AJ2A 2CZVC 3RBZA 4DN0A 2UU9F 4KGXB 1I3OB 3TAPA 1U02A 3UPFA 1LWCB 3UNYA 4IR9A 4DR7F 8RUCA 3K7RA 5LXYA 3KJVB 2WK4A 3T1YF 2Y1IA 4USHA 4OHXA 1HL6A 5JJBA 1X9MA 3CJKA 2DNPA 2N7YA 4DLEA 2V2VA 4ECZA 1OQ6A 4NCGA 3FNNA 3Q2TC 5D8HB 4YN3B 1R8CA 2HKEA 3FEYB 3MI7X 2XSFA 3V6JA 1SJRA 3GPAA 4P74A 2HGNA 2V2QA 2CPZA 2CIMA 4YDXA 4UOGA 1AT1B 1D9DA 3NRBA 3DDNA 4A4JA 4BC7A 2VUGA 2KB2A 1PO6A 1HI0P 2IMWP 2IRUA 1S48A 2WW4A 5T41A 3OHBA 2ZWPA 1SH3A 4Y2KA 5JXSA 4DQRA 2O01C 1SQEA 2HZAA 3NGKA 3CCMS 4BS2A 3HX9A 1SKSA 4FYDA 1CPZA 2DH9A 2VH7A 1TVRA 3M4XA 5A8KA 2DR8A 4I68A 3MR2A 4JI6J 5GADU 2K2PA 3W65A 2OAUA 3R97A 2IDLA 1NJXA 2F4VJ 4F26A 4JI8F 4RW6A 4DSLA 1H3DA 3UDLA 3ZXWA 5M2PA 1NK0A 1VQKS 2H4YB 2GIRA 2Q3PA 6FD1A 1ZM4A 4ILRA 5B0CA 4ECWA 3RB3A 4DL6A 1SC6A 3Q8SB 4CLZA
chains in the Genus database with same CATH topology
4JI3J 4DV1J 4KYZA 5AJ3J 4LF5J 1HR0J 3OTOJ 2VQFJ 4DR3J 3D3CJ 3J80U 4DR4J 1HNXJ 4DR1J 4DV0J 2UUBJ 2ZM6J 4YY3J 4JI1J 4X65J 4JI2J 1N33J 4DV2J 2MQ8A 4NEZA 3D3BJ 2E5LJ 4X64J 1XNQJ 4YHHJ 4AQYJ 1HNZJ 3IMQJ 2UUCJ 3JAMU 4DV4J 4DUZJ 4DV5J 4LFBJ 4LF7J 5FLXU 4DR6J 3J7AN 1N32J 5BR8J 4KHPJ 4JV5J 5LM7E 4B3SJ 4LFAJ 4DR2J 2MEWA 3R2CJ 1FJGJ 4LF9J 5A2QU 4DV6J 5LMUJ 4PWWA 4NEYA 2UXCJ 3R2DJ 2VQEJ 4X66J 4LF8J 1IBKJ 5IWAJ 4K0KJ 1IBLJ 4LF6J 4KY3A 4JI5J 4X62J 2KVQE 1N34J 5LMNJ 4OX9J 2MTLA 4HHUA 4JI8J 3J81U 3W1YC 1XMOJ 4DUYJ 4B3TJ 4JI0J 2UUAJ 4DV3J 4B3RJ 2KL8A 4JYAJ 4JI7J 4NXMJ 2UXDJ 5IT9U 1HNWJ 1J5EJ 1XNRJ 4DR5J 4DV7J 1I94J 4V1Ak 3T1HJ 2UU9J 4NXNJ 2UXBJ 4GKJJ 4DR7J 4GKKJ 1N36J 4LFCJ 4LF4J 4JI6J 1XMQJ 3T1YJ 2F4VJ 2HHHJ 1IBMJ 4B3MJ 4RJVA 4JI4J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI3 J;  4DV1 J;  4KYZ A;  5AJ3 J;  4LF5 J;  1HR0 J;  3OTO J;  2VQF J;  4DR3 J;  3D3C J;  3J80 U;  4DR4 J;  1HNX J;  4DR1 J;  4DV0 J;  2UUB J;  2ZM6 J;  4YY3 J;  4JI1 J;  4X65 J;  4JI2 J;  1N33 J;  4DV2 J;  2MQ8 A;  4NEZ A;  3D3B J;  2E5L J;  4X64 J;  1XNQ J;  4YHH J;  4AQY J;  1HNZ J;  3IMQ J;  2UUC J;  3JAM U;  4DV4 J;  4DUZ J;  4DV5 J;  4LFB J;  4LF7 J;  5FLX U;  4DR6 J;  3J7A N;  1N32 J;  5BR8 J;  4KHP J;  4JV5 J;  5LM7 E;  4B3S J;  4LFA J;  4DR2 J;  2MEW A;  3R2C J;  1FJG J;  4LF9 J;  5A2Q U;  4DV6 J;  5LMU J;  4PWW A;  4NEY A;  2UXC J;  3R2D J;  2VQE J;  4X66 J;  4LF8 J;  1IBK J;  5IWA J;  4K0K J;  1IBL J;  4LF6 J;  4KY3 A;  4JI5 J;  4X62 J;  2KVQ E;  1N34 J;  5LMN J;  4OX9 J;  2MTL A;  4HHU A;  4JI8 J;  3J81 U;  3W1Y C;  1XMO J;  4DUY J;  4B3T J;  4JI0 J;  2UUA J;  4DV3 J;  4B3R J;  2KL8 A;  4JYA J;  4JI7 J;  4NXM J;  2UXD J;  5IT9 U;  1HNW J;  1J5E J;  1XNR J;  4DR5 J;  4DV7 J;  1I94 J;  4V1A k;  3T1H J;  2UU9 J;  4NXN J;  2UXB J;  4GKJ J;  4DR7 J;  4GKK J;  1N36 J;  4LFC J;  4LF4 J;  4JI6 J;  1XMQ J;  3T1Y J;  2F4V J;  2HHH J;  1IBM J;  4B3M J;  4RJV A;  4JI4 J; 
#chains in the Genus database with same CATH topology
 1LW2 B;  4KR0 B;  4LVN P;  1NH7 A;  1NU4 A;  3CO0 P;  4RBT A;  3T41 A;  5KFN A;  4WF9 Q;  3W9H A;  2AYM A;  3AB4 B;  3KLF B;  1IXK A;  2WCX A;  5IQQ A;  4OI0 A;  3IWN C;  1U25 A;  2E1M C;  1ULR A;  2MKC A;  3I0R B;  3PO5 A;  4ZPB A;  1DQ9 A;  2CDR B;  1H2U X;  1NME B;  2F9D A;  3WQP A;  3IRW P;  3ENV A;  1NK6 A;  2XB2 D;  1WI6 A;  2IYI A;  4DR1 J;  4LIR A;  3AQP A;  2P6T A;  3K5P A;  4C3M A;  1RIS A;  2CJ9 A;  1SJF A;  1XNR F;  4LBI A;  5A6W A;  5LJ5 Y;  4TU7 A;  2QA4 S;  4F02 A;  1UZH A;  1ZM2 A;  2ZKT A;  3TZY A;  3CCQ S;  4LF9 F;  2OFG X;  2YKM A;  2VZ9 A;  4TQR A;  4QYR A;  1X0P A;  4OZL A;  1H7W A;  3PEJ A;  3W66 A;  5CAA A;  2NLW A;  1Y10 A;  3I9Z A;  4PG8 A;  3LH2 S;  2I8E A;  1RHK B;  5KFM A;  1J2V A;  4FBU A;  4K7Q A;  2XGQ A;  3GG0 A;  3LGM A;  1JLA A;  3SBM A;  2RIJ A;  4DV4 J;  2KYZ A;  3AD9 C;  4B02 A;  3M6U A;  4ZVP B;  3RG6 A;  1MRO A;  3HVW A;  3SCK E;  4AFF A;  3OTO F;  2JLG A;  1ZM9 A;  4ZVT B;  3KNG A;  3IG1 A;  3DOL B;  3WC0 A;  4IYQ A;  4CM0 A;  2OO4 A;  4F4Y A;  2BQR A;  2R7S A;  1NDC A;  2QGF B;  4OV1 A;  4NX9 A;  3EPI A;  3BGU A;  2C2N A;  2GQC A;  4NCG B;  1AZS B;  1NB7 A;  3OTC A;  4B9S A;  3EXC X;  1V3R A;  1YTY A;  1FXD A;  1N88 A;  2FTR A;  2O3D A;  5HJY A;  4CNY A;  2J6S A;  5EX3 A;  5H1S V;  4Z37 A;  2F63 A;  5KFW A;  3TAN A;  1PJ5 A;  2C2E A;  2PEB A;  4B3O A;  1HPZ A;  3AD8 C;  1IR0 A;  4KT0 C;  2E7W A;  5B0E A;  5IM0 B;  5KG2 A;  4ED7 A;  1NK4 A;  1C2P A;  2V4Q A;  4ZDN A;  1Y5L B;  1IR2 A;  2FVR A;  2QSW A;  2ZE2 A;  2H5J B;  2E5J A;  2POK A;  5ETT A;  4ECR A;  2XY5 A;  4TQS A;  1SB6 A;  2ATC B;  4J9K A;  2D3Z A;  3MDF A;  2IJF A;  5JVG Q;  2CNO B;  1S6U A;  3QSY B;  4DV7 F;  4DSI A;  4DFJ A;  3ZC4 A;  1CJK A;  2XGP A;  3CJ5 A;  4J5O A;  4JV0 A;  5D77 A;  5L1I A;  2ZEJ A;  4LF7 F;  3GV8 B;  2HIQ A;  3AT1 B;  3PZP A;  2XY6 A;  4XAK A;  4WTO B;  1DLO B;  1GXT A;  1Z2Z A;  2WVC A;  4ZIV A;  3ISN D;  4WFY A;  1RAG B;  4C98 A;  2ALZ A;  1TL5 A;  4ZKA A;  2YWW A;  1AUS L;  5ETQ A;  4ZMM A;  1RT6 A;  1RTZ A;  2CPE A;  2MPU A;  1U49 A;  4Q8F A;  1U0H B;  3ELH A;  1H7X A;  4HAC B;  1J5O A;  3EMT A;  3FEZ A;  5J2M B;  1N48 A;  4FZV A;  2PE8 A;  5DLF A;  1OIA A;  5D15 A;  3OHA A;  3HLU A;  1H6K X;  2VQE F;  2DB1 A;  2HPU A;  2BEF A;  3EDQ B;  2F8H A;  1H2T Z;  1KEK A;  2JWN A;  2F65 A;  3SCJ E;  2I1R A;  4NE9 C;  4UQT A;  2DHX A;  1ACM B;  3CJT A;  4WE1 B;  2OEM A;  5JMN A;  2LXU A;  2AEJ A;  2H65 B;  3C6U B;  4F0M A;  3VZH A;  2VV5 A;  1EX8 A;  2ZFH A;  4FN5 A;  1SQF A;  4IH6 A;  3ZTR A;  2QO3 A;  3OL6 A;  1LW2 A;  2YWH A;  1FWK A;  5E2Q A;  3M8Q A;  4NXN J;  1HBO B;  5KFB A;  2C2K B;  4LF4 J;  3TNV A;  4PWU A;  1U0S A;  4P71 A;  4F0H A;  1X4A A;  2EFO A;  2NXJ A;  3G6Y A;  1QAI A;  4R0E A;  2R7R A;  3DHX A;  2DRB A;  2V0N A;  2MZS A;  1Q8L A;  4TLR A;  5G4D A;  1JLB A;  1TAQ A;  1BE4 A;  2W2O P;  2CJA A;  5ETO A;  5I3U A;  4C8O A;  4OX7 A;  2XYP B;  4B3T F;  4CLF A;  1MMD A;  1SI9 A;  1IM6 A;  1YZ7 A;  3AOA A;  3BSA A;  3N0V A;  3TZZ A;  3KYL A;  1R31 A;  3PW7 A;  1U1N A;  2B9E A;  3GON A;  2PII A;  2MKY A;  2PSZ A;  2ZNZ A;  2W2Q P;  2J0S D;  4MK8 A;  2DO0 A;  1CLF A;  1N5T A;  4QU6 A;  1JLQ A;  2MY7 A;  4NLW A;  3W2W B;  4DUZ F;  1RWM B;  4ED4 A;  5J2P B;  3I5B A;  1PYT A;  3MCM A;  4E0D A;  2FLO A;  2C3U A;  3DOK A;  1XTZ A;  1TAU A;  3KLI A;  1N32 F;  4GKJ F;  2PO4 A;  2XLJ A;  4ED3 A;  2CPD A;  1RT3 A;  3QJP A;  4YY3 J;  4KAI A;  3CJK B;  3DLJ A;  4WP3 A;  2CQ1 A;  1FKA F;  3D4J A;  2FC9 A;  3CNQ P;  2KU7 A;  3CWJ A;  3NAI A;  4OJH A;  1LK5 A;  3TYT A;  4NEZ A;  3ZTS A;  4FS2 A;  2HWH A;  1MG7 A;  3DNC A;  4CO5 A;  3GIL A;  1NSQ A;  3X1L B;  3OVS A;  2XMW A;  1VQM S;  2K1R A;  2RRB A;  2N3L A;  4GVB B;  5DG7 A;  2Q79 A;  2CQ2 A;  2KDO A;  3DLG A;  4RUH A;  1NB2 A;  2OPP A;  1S79 A;  3M8P A;  3DGP B;  5F8H A;  5KT4 A;  2KXF A;  2CKW A;  2ZBQ A;  4RW7 A;  3VQT A;  2AJ4 A;  4DUT A;  4OZ5 A;  3V81 A;  1VQP S;  1W2B R;  1JXV A;  2VJU A;  5AXK A;  5HJX A;  4UZB A;  5E3A A;  2QA4 G;  2G4B A;  4X84 A;  2HGL A;  2V8V A;  1F9E B;  5EWE A;  1PJ6 A;  1PYO B;  1RGV A;  2WON A;  2QLX A;  4X62 F;  4X4T A;  4GVB A;  3VAK A;  3QRR A;  4HDH A;  5KFD A;  2JEG A;  2YNI A;  3AD7 C;  2B9X A;  3LO3 A;  2E44 A;  4KC5 A;  4EZ9 A;  2CPJ A;  4K4U A;  4JV5 J;  2Y8Y A;  1YQH A;  4XK8 C;  2DNL A;  3OLB A;  3C46 A;  3R2C J;  3R5B A;  2VOD A;  2CJY B;  5KFK A;  4ZVE A;  4AYB D;  1YI2 S;  1UVM A;  4DV6 J;  3SQO P;  1RBO B;  1TR0 A;  2DHA A;  3R6L B;  4M5J A;  4DFK A;  1VLY A;  3O6Q A;  2E9T A;  4ZCM A;  3NBP B;  1RWK B;  4LSL B;  2H4W B;  4QWE A;  4FKY A;  4KHR A;  3UCZ P;  2YNH A;  1VQ7 S;  1VFJ A;  2IVM A;  5K5M A;  3QSI A;  4QR0 A;  1Y5N B;  2OKQ A;  1OPI A;  2PMZ D;  2DGW A;  2QRR A;  4H54 A;  3MZI A;  2OEJ A;  1NK9 A;  4IQX A;  1FRM A;  2XMV A;  3I32 A;  3QPI A;  4IFY B;  4K0K J;  1SJ4 P;  1FE0 A;  4W4M A;  3V81 B;  2ZH3 A;  2I6W A;  3T1H F;  4CLT A;  2KJV A;  2XG8 A;  2CQH A;  1UJ6 A;  2KVQ E;  3FMW A;  2FLL A;  4JI6 F;  1RT7 A;  5CYQ B;  4N41 A;  4DR2 F;  3I5C A;  3MM8 B;  4F7V A;  3CXC R;  3W2V B;  3TA0 A;  5K8M A;  2R4F A;  2DEJ A;  2RDI A;  3N5F A;  3IN5 A;  2HS4 A;  2HQC A;  2P5V A;  4P7T A;  4AL7 A;  1TL7 B;  1HBO A;  3AH6 A;  3E51 A;  1GFW B;  4IQM A;  2E5I A;  2E1P A;  4CTA A;  3CCR S;  5H9E J;  3KHR A;  2UUA J;  4EO6 A;  2B9Y A;  4MYU A;  1HR0 F;  5HAN A;  1DAX A;  3IS9 B;  4NI2 B;  1B3T A;  2CQD A;  2B4P A;  4NZ0 A;  4A8Y A;  1HNV B;  3PFO A;  2MQP A;  4NOH A;  2MQM A;  1IBK F;  1W2I A;  4IOA Q;  4WWS A;  2ZHA A;  3EIC A;  2G13 A;  4RBV A;  1NH8 A;  3U1N A;  2I38 A;  3ZTO A;  2QL9 B;  3CJS A;  5KFX A;  2L08 A;  4J9M A;  1RT2 B;  1NHU A;  4OQJ A;  3BGR B;  4QIE A;  3VQS A;  5ADZ A;  1YJ9 S;  2QT7 A;  3WHI A;  2RQC A;  3X3U A;  4ZLN A;  5KFT A;  4X4Q A;  5EWF A;  3HO1 A;  1U6Z A;  1QJH A;  1GEH A;  1HQE B;  2KT5 A;  4D3G A;  2ZZN A;  2RJZ A;  1Z2L A;  2Y0S D;  5E7O B;  1ELO A;  3M8S A;  1VBX A;  4PUO A;  2ILY A;  2WSE C;  2KRB A;  2M3D A;  3M8P B;  1BUX A;  2J8A A;  3SV4 A;  2EFP A;  2HHH J;  3H2U B;  1HD0 A;  2FJD B;  1C4C A;  2J9E A;  3H7H B;  1WEX A;  1FRK A;  4ECV A;  1XNQ F;  2W2N P;  2RKI B;  4L6V 3;  4JI3 J;  2J6T A;  3MEG A;  4F3Q A;  2CQ4 A;  3MCN A;  4OMF G;  3LUY A;  3ZFV A;  2ILZ A;  2HW3 A;  4M95 A;  1H72 C;  2MHE A;  2W7A A;  4MIW A;  4DV5 F;  3OTB A;  4WP9 A;  4Z7C A;  2R9L A;  1GX6 A;  3SDE B;  1TMM A;  4JBC A;  2YNG A;  5D0H A;  5B09 A;  2C2M B;  4EBE A;  3HVT B;  2XMJ A;  3BEG B;  4NZ7 A;  4OLP A;  5BYQ A;  4YDD B;  2ZM6 J;  1YSJ A;  2XHW A;  1ZM3 A;  2FIU A;  1UMJ A;  1U0H A;  3H25 A;  1UEK A;  3EGN A;  1VR6 A;  2DHH A;  3G8Q A;  4ZLL A;  4MJK A;  3JSM A;  2ZH8 A;  2I9S A;  1AB8 A;  3IC1 A;  5HAO A;  3ET6 B;  2DXD A;  2J9D E;  2RB7 A;  2FHM A;  2V2Z A;  3MR6 A;  4P2F A;  1H38 A;  5EHH A;  2BM1 A;  1UJ5 A;  5GMK a;  5CD4 H;  3MTK A;  4LF5 F;  2XCA A;  1RU1 A;  3DMJ B;  2XY7 A;  2VDH A;  4TY9 A;  2DGQ A;  2B56 A;  1WG5 A;  3QYY A;  2HHU A;  4BLG A;  3D67 A;  3TUJ C;  1RB0 A;  3CJ8 A;  3CUL A;  4Y0F A;  1FDN A;  1EET B;  2WOM B;  3TUI C;  1R8H A;  4DV0 F;  3W5Y A;  4OX6 A;  4EFA C;  4ECS A;  2N3O A;  5DG9 A;  2OI2 A;  1KNZ A;  4TN2 A;  2FZG B;  1VOM A;  2LA6 A;  1CSJ A;  2GVD A;  1N0V C;  3LP0 B;  5ETL A;  1WTB A;  3BGO P;  2R8G A;  3FRY A;  1N33 F;  2PGC A;  1T05 A;  4MMO A;  2EVZ A;  4QIG A;  4U9R A;  1TUG B;  4U95 A;  2H54 B;  1PGZ A;  2GO9 A;  2GQ2 A;  4HYK A;  2W01 A;  2V50 A;  4HT7 A;  1QTM A;  3CCU S;  4ICL B;  3UD3 P;  4ILL A;  2KTQ A;  2MYF A;  2J0Q D;  3RR7 A;  3CC7 S;  3C6U A;  4MK7 A;  2BW7 A;  3HSZ A;  4ZVS B;  1JIH A;  4O3N A;  3TUZ C;  1UJ4 A;  4IOC Q;  2LXF A;  2CA9 A;  2XMM A;  3LWM A;  4I2P B;  3OQ2 A;  4HLB A;  4EUV A;  4USM A;  2AJF E;  1LWX A;  1WF2 A;  2IRX A;  5AE3 A;  2KZM A;  1T9V A;  4WZQ A;  1T8E A;  1RTJ B;  2HG4 A;  2KFZ A;  4DL7 A;  4KV8 A;  2AV5 A;  4M5D A;  1PJ7 A;  4YR0 A;  1NK8 A;  3H5Y A;  1HQU A;  4YB5 A;  3K59 A;  2A6O A;  1V3Z A;  1LW0 A;  5KG7 A;  4DS4 A;  1HNV A;  2PI4 A;  5A8W B;  2ZOM A;  4OHZ A;  3UVJ B;  4FXD A;  3IM8 A;  5KFL A;  2DNQ A;  3LP2 B;  3GIR A;  3HZG A;  4B3T J;  4M94 A;  4DL4 A;  3ETO A;  4FXW A;  4I0W A;  1J27 A;  5LOQ A;  3JS9 A;  4M5D B;  1YRX A;  4B3R J;  1VHF A;  2E1A A;  3SDE A;  1T05 B;  3AJ1 A;  3BKT A;  5I42 B;  2J5A A;  3LAL A;  3TO8 A;  3IBF B;  4WFZ A;  4USW A;  3KJV A;  5IT9 U;  4HT5 A;  4OI6 A;  4WII A;  1JLC A;  4P2S A;  4RW9 A;  4NZ6 A;  1U8S A;  3PIO Q;  4IRC A;  4C9D A;  3OLA A;  1KLN A;  3K5L A;  2MGZ B;  2JLF A;  3TVK A;  3N6N A;  1IJF B;  4JUZ A;  1LFW A;  4H4K C;  4GKJ J;  1B70 B;  4DR7 J;  5C2C A;  3VV2 B;  3PAC A;  2LU1 A;  1JLF B;  2LP4 A;  1CJU A;  2VAS A;  1EKR A;  3KG0 A;  3M32 B;  1WHY A;  1UFK A;  4RL1 A;  3HXM A;  1PC4 A;  1WC3 A;  2KO1 A;  3AHP A;  4XDC A;  5BYR A;  3U1M A;  3W63 A;  3M05 A;  4TLQ A;  3KK1 B;  1RBA A;  2HWT A;  3BS9 A;  1FRX A;  3ILI A;  3KHG A;  3P49 B;  1QE1 A;  2XMT A;  4C8K A;  3UCG A;  2R2S A;  1S1X B;  3WX4 A;  5GAH I;  1VC0 A;  3I4P A;  2BZ2 A;  2KVI A;  4M5H A;  2U2F A;  4KYZ A;  4ZLP A;  3FCV A;  2HYI B;  3E8O A;  3MD3 A;  4ZJO A;  1TK0 A;  4V19 X;  4W98 A;  4C11 A;  3P5B P;  2FGC A;  3D28 A;  2BMB A;  3GFH A;  2FGO A;  3O2I A;  5D4L A;  5C25 B;  2ZUG A;  3GG1 A;  4MTP A;  4KSE B;  3MMJ A;  3OJS A;  4DX6 A;  5BJR A;  3PR4 A;  3GIK A;  1U1P A;  3N5B A;  2MQN A;  2GHW A;  3UNG C;  4KIA A;  1E6V B;  5K20 B;  4BWM A;  1IUJ A;  4RNO A;  4DSE A;  2FYX A;  1FRL A;  2JEJ A;  5B0B A;  1SL2 A;  3W9I A;  3PW4 A;  2D69 A;  4C8N A;  2RIL A;  5HAT A;  2LQ9 A;  5KOW A;  4ATN A;  1HIY A;  4OZN A;  2W8K A;  2E1C A;  2FHO B;  4KFB B;  4OYB A;  1IQZ A;  4DDF A;  5F8M A;  2UV8 A;  2DIV A;  4Y2M A;  5L9N A;  3FZB A;  4OZ0 A;  2OMO A;  3MM5 B;  3Q8Q B;  4A48 A;  2UV8 G;  4FYW B;  3PRB A;  1F2G A;  2M5Y A;  2YKA A;  2ACY A;  4OJG A;  4DL3 A;  4CO3 A;  4XPC A;  3VVT A;  2DJW A;  2XO6 A;  2I5J A;  2W1B A;  2XCP A;  1F0X A;  1VIS A;  2JC0 A;  4WJB A;  4GC6 A;  2BR0 A;  4I64 A;  3M30 B;  2KFN A;  3V4I A;  2L48 A;  3ENQ A;  4A8X A;  3T19 A;  3M6V A;  4I7F A;  3HSJ A;  4J7C A;  4F0K A;  2ZJP Q;  4PQU A;  1C1B A;  1SV5 B;  2CNL B;  2HS3 A;  4AND A;  5J1P A;  3EGV A;  2KYX A;  1PSD A;  2LKZ A;  2H5I B;  2O1P A;  2BQU A;  1HQ2 A;  4D3H A;  3NNH A;  4C8Y A;  1RTJ A;  2ADB A;  3DDI A;  1YBA A;  2K7K A;  1PIL A;  4O44 B;  2CQC A;  2RNE A;  5J2P A;  3R8Y A;  2D74 B;  2CPF A;  4C0O C;  4QCL A;  4Y00 A;  3QAU A;  2PMW A;  1Y11 A;  4KBI A;  1Q7L B;  1Y3J A;  3UVJ A;  5EWG A;  1GX5 A;  5LMU J;  2QLF B;  2MZJ A;  1JNR B;  4U7C A;  4OI3 A;  3T9N A;  3NAH A;  3ZNU A;  4YHH F;  4DFP A;  4WXW A;  2KI2 A;  3TZW A;  5KFE A;  2UUA F;  1TKZ A;  3LAM A;  3M6X A;  2FY8 A;  4OHY A;  3DLH A;  4FYY B;  4WPA A;  1YBU A;  4HI2 A;  2RT3 A;  2UUC F;  3RRH A;  3LW5 C;  3OD2 A;  2IHR 1;  4M63 A;  3DI6 A;  3UDC A;  3RR8 A;  4NCA A;  2MSS A;  3T5J A;  3T9Z A;  1IBK J;  4LF6 J;  1IWA A;  2OPP B;  2YNG B;  1T9T A;  3M1V B;  3I82 A;  9RUB A;  3SCI E;  4UT4 A;  2MGZ A;  3FQK A;  3PW2 A;  1UTA A;  3OL9 A;  3AAW B;  2CQB A;  7AT1 B;  1DTQ B;  4I1T A;  1UEU A;  3W8P A;  2HVH A;  2OEK A;  1QE1 B;  1RDR A;  3AFG A;  3SSS A;  1MU2 A;  5D78 A;  4ANC A;  2AGO A;  1AW0 A;  2F5G A;  5IT4 A;  2ZOF A;  1JXE A;  1Q86 T;  2VG7 B;  1MWZ A;  4KJI A;  1AZS A;  1U1M A;  1UW9 A;  3B78 A;  1S1X A;  1YK9 A;  2Q43 A;  4IG0 A;  3SMZ A;  3K8W A;  3D1H A;  1Q1K A;  2KL8 A;  1FNO A;  4JYA J;  3SCL E;  2PT0 A;  2JL9 A;  3BN7 A;  2Q1L A;  5HRO A;  3ZZT A;  1S10 A;  4ID8 A;  1RA7 A;  4F3O A;  2ZDO A;  4CP5 A;  2B5J B;  1TFY A;  2L3M A;  4DPO A;  3PX4 A;  1SCJ B;  2EWH A;  4YP3 A;  1HI1 A;  4FYV B;  5K8N A;  1RAC B;  3NWG A;  2ZBP A;  2B43 A;  2DHG A;  2CJQ A;  4USV A;  4LUB A;  4ZN3 A;  1CJK B;  2R3V A;  5E0O A;  2XO7 A;  2W9C A;  1N5V A;  1VGY A;  4LQ9 A;  4CIO A;  1RJJ A;  1BQX A;  4K4Z A;  2QG9 B;  1XMB A;  3TUP A;  3CIM A;  4RJV A;  2M7S A;  2HND B;  5ETP A;  4DV1 J;  3ILL A;  4NLR A;  1Q0N A;  2XUL A;  4DPY A;  1PBA A;  4A8Q A;  1URN A;  3V5R A;  2LDI A;  2UXD F;  1VMB A;  4DHV A;  4DOZ A;  2JOQ A;  2B3T B;  3MUR P;  3V4I B;  2PN6 A;  1UP1 A;  3PTW A;  3O5T B;  2HBR B;  2VC1 A;  4EMD A;  5J2Q A;  5KOX A;  6FDR A;  2A1B A;  2OEL A;  1WC4 A;  3V6K A;  4NLT A;  1HNX J;  2IMO A;  2LLZ A;  3AOB A;  2HND A;  3DRR B;  5HO4 A;  3DRS B;  4QR2 A;  2R7W A;  2ERR A;  4J9L A;  4NXN F;  2RKI A;  3KK1 A;  2B7B B;  2NUH A;  3WBZ A;  1DUR A;  4UOC A;  4Q2M A;  1NHV A;  3GR1 A;  5IXU A;  4RW8 A;  4CLW A;  4PG6 A;  1T3O A;  1N33 J;  2AF6 A;  2FQQ B;  1T9W A;  1E6Y A;  2HIY A;  2HVE A;  2MQ8 A;  2QLW A;  4TYB A;  3QO9 B;  5HQL A;  1YJW S;  4C8L A;  2ZBC A;  4YR3 A;  4JI4 F;  2NXC A;  3H2L A;  3GCW P;  4A8W A;  1DZ5 A;  3C2P A;  3VTI A;  1T7P A;  4IRD A;  2VC0 A;  2FHJ D;  3L7O A;  4BC9 A;  2IY5 B;  2HFZ A;  2W25 A;  2IFX A;  4P73 A;  2F9J A;  3PRD A;  4YS2 A;  3Q8R B;  3KDN A;  3L7U A;  3M7V A;  1WF0 A;  3RJM B;  4FS1 A;  3ZTQ A;  1UWB B;  3EM1 A;  2VQF F;  1RK8 A;  3CMQ A;  1X31 C;  3CJR A;  4U8V A;  3IGV A;  3HI9 A;  5GME A;  4YFU A;  2EPI A;  2MST A;  2ZE2 B;  3H90 A;  4Y34 A;  2F8M A;  4EO8 A;  1GQE A;  5KT3 A;  4Z7Y A;  2ZBI A;  2FJA B;  3VAI A;  4RPF A;  5J2Q B;  4YY3 F;  1JWW A;  1MML A;  1O5J A;  4NLV A;  4LFA J;  3W60 A;  1Y0H A;  3QRP A;  5BYS A;  2AYG A;  3OR1 A;  2AEF A;  2XI3 A;  1AYE A;  1FFG B;  1RUS A;  4DU7 A;  5KFH A;  1WC6 A;  1WKJ A;  2RD5 C;  5AXM A;  3M8R A;  1UVI A;  4QU7 A;  1F9H A;  1HLW A;  1JJ2 R;  2B4U A;  4NEY A;  2UXC J;  2AGQ A;  2L9D A;  1NSK L;  2OML A;  3FCW A;  1Y5I B;  3UWT A;  5CD4 A;  1X5P A;  3U7J A;  5JUM A;  3G8S A;  4IFV A;  5HLF A;  1SKW A;  5EX0 A;  3AOD A;  1HMV B;  1KHV A;  1FTR A;  4NLX A;  4OI2 A;  3GJR B;  4Q5V A;  1VC6 A;  1G4C A;  4U96 A;  4G3I A;  1CQM A;  3A3N B;  1RWP B;  1P1L A;  1QAX A;  4KY3 A;  1I51 B;  3W61 A;  1U1R A;  4JI5 J;  3NMR A;  3MCO A;  1FFS B;  1UFL A;  3DOM A;  1C1B B;  1SV5 A;  2C3P A;  2VBW A;  4DI6 A;  2NPF A;  1RT4 B;  1RWO B;  1UPM B;  5HRO B;  1FJG F;  1HMV A;  3BH6 B;  2V94 A;  2I0X A;  2Z58 B;  1M1K T;  2K8G A;  4FPI A;  4KRW A;  1UW4 A;  2RSQ A;  1UVN A;  4DV6 F;  2AYB A;  3DN9 A;  5T7L B;  3KWM A;  4RU9 A;  2EK6 A;  3QZ7 A;  3EPG A;  3CO9 A;  1IR1 A;  2DXE A;  2EFQ A;  3QT5 A;  1HPZ B;  2X51 A;  4MKA A;  3V2U C;  4BDP A;  4R25 A;  3HKZ D;  1WHW A;  1RAB B;  2JLE A;  5EUH A;  4XTT A;  5I3P A;  1SUQ B;  4CH1 A;  3ENW A;  3NS5 A;  4HHJ A;  3UCU P;  4PUO B;  3BKU A;  1XNR J;  1RAA B;  5DDR C;  2ZZM A;  4QW9 A;  3C16 A;  5CA5 A;  1YHQ S;  4V1A k;  4DQS A;  2BV3 A;  4CTA B;  4NLD A;  4W92 B;  5J2N A;  2UXB J;  4IR1 A;  4QYZ J;  4FNH A;  1S5Z A;  2BJ3 A;  1SUQ A;  1YWX A;  1JLQ B;  2GJ2 A;  3G86 A;  3W2W A;  2RU3 A;  2FD2 A;  2MY8 A;  3ZZO A;  1S6O A;  1S7H A;  2IYG A;  1F5A A;  2C3O A;  2QIF A;  3DC2 A;  2Z0G A;  3MFH A;  3KJF B;  3M9M B;  1YVF A;  3JYT A;  3D9B A;  4F50 A;  2NQP A;  4B9T A;  3A3O B;  4RKU C;  3VAM A;  1LV5 A;  3TAQ A;  1BD6 A;  2VKZ G;  1FDB A;  1YLX A;  2ZOG A;  3DU5 A;  4USK A;  3H40 A;  3LAK A;  3LQV A;  4HTI A;  3RAQ A;  3CD6 S;  1CJU B;  1GMU A;  1I1G A;  3M32 A;  3VF0 B;  4C6A A;  1Y7P A;  4NLU A;  3UDV A;  1FWP A;  1DQA A;  2CG4 A;  2G0J A;  3KLH A;  1S57 A;  2ZH6 A;  3MOJ B;  4ED0 A;  4FKX A;  1IKW A;  2E29 A;  4OJ1 A;  1LQ9 A;  1Q8I A;  2MMY A;  4DR4 J;  2DYA A;  4XIU A;  2IM3 A;  2CNK B;  2L9N A;  2AT1 B;  5ETV A;  4LF2 A;  5SUH A;  4DN9 A;  1REV A;  3OJU A;  4CH7 A;  1S1T B;  3SZ2 A;  2FVP A;  4X4P A;  2R7V A;  3GR0 A;  1HYS A;  4DX5 A;  4B9U A;  1S1U B;  4J9Q A;  4A8M P;  4V19 J;  3S8S A;  2DNR A;  3PIP Q;  4ED2 A;  1QAJ A;  3R6G B;  2BJ9 A;  3MM6 A;  1EIY B;  2JZ5 A;  4B3M F;  2R7T A;  3O1L A;  5D4P A;  2CG8 A;  1XNQ J;  3QGP A;  4U8Y A;  2EXU A;  1HNZ J;  4AL5 A;  3CC4 S;  4MFB A;  2GCF A;  4QW8 A;  1UVJ A;  3ADA C;  1RAH B;  2AIR B;  2W9B B;  3JTP A;  2VG6 B;  1U26 A;  3K8V A;  4EK2 A;  4WE1 A;  5L46 A;  1KDN A;  1RXO B;  1G1X A;  4LBP A;  5DQH A;  4C0H A;  4L72 B;  3DGV A;  4HTJ A;  1VYA A;  4LF7 J;  1RTI B;  4F25 A;  1KOO A;  4DR6 J;  3NGS A;  3LOU A;  1FEE A;  4CLP A;  3KLH B;  2R2U A;  1P1T A;  2XI2 A;  2V9K A;  2CUY A;  4RO0 A;  3TR5 A;  2MQQ A;  2AYE A;  1IKX B;  5DLG A;  3NCR A;  1S9F A;  4RW6 B;  4MIB A;  1C4A A;  4ZP6 A;  4ZPD A;  4CT8 A;  4ED6 A;  4WK1 A;  2V9W A;  2G1D A;  5GAD I;  8AT1 B;  4DQQ A;  2HHV A;  2K06 A;  4K50 A;  3T6B A;  2RAQ A;  1U7L A;  5M2U A;  3L95 X;  4LR8 A;  4KH1 B;  4KO0 B;  2HQ3 A;  1X4H A;  2JDJ A;  2CQI A;  4QWD A;  2KM8 B;  2JVR A;  3BBC A;  4NA1 A;  1F5B A;  4ED1 A;  2VON A;  4NCB A;  2I5J B;  1XR6 A;  2UUT A;  2VG6 A;  4EGL A;  4DF4 A;  3KLI B;  3K5O A;  3LA0 A;  5FDL B;  4WYL A;  3ZZ0 A;  3MPV A;  2FUG 9;  2RUS A;  5D4N A;  1Y9O A;  4N5S A;  1B0V A;  4LF4 F;  1FHT A;  3IXQ A;  1WEY A;  3ITH A;  5I3U B;  1R0A A;  3OT9 A;  1NSA A;  4LSN A;  5E33 A;  2GC8 A;  3PNI A;  2E66 A;  2MB0 B;  1S97 A;  1KFS A;  4G1P A;  1RP5 A;  3CSK A;  3NGR A;  2E1R A;  2RRA A;  4ZVH A;  1FKP A;  3KDO A;  2GNK A;  2J8S A;  1HBU A;  4QBU A;  2D1C A;  3ULH A;  3PJX A;  4K59 A;  2KZZ A;  3QFH A;  1NKC A;  2HHQ A;  3LP2 A;  3MAH A;  3FBB A;  1S4E A;  2A10 A;  4ID5 A;  3FVY A;  1ZTT A;  3E01 B;  4UQG A;  1NLK L;  1WC5 A;  3NP5 A;  2ZBR A;  3W64 A;  4YQW A;  1U1L A;  5KFG A;  1IBL F;  1VC5 A;  3QMQ A;  1R0C B;  3VAF A;  2X7I A;  1HFE L;  2UU9 J;  2WW8 A;  2ZJQ Q;  1WOP A;  4N8O A;  1PAE X;  3CD7 A;  4DPT A;  2YPY A;  4X65 F;  3TAR A;  3JB9 k;  2IIH A;  1MLA A;  3DXB A;  2Y1J A;  1ZOT A;  2V5H G;  2O66 A;  3BR9 A;  1FDA A;  3IP0 A;  4CM2 A;  4OLO A;  3PY8 A;  1UEV A;  4F2R A;  3NNA A;  3HHE A;  1L3S A;  4DUY F;  2BQ3 A;  1QLN A;  1HI8 A;  4OV6 A;  5CZV A;  2HQI A;  3MUM P;  2JH3 A;  2WHO A;  4FNI A;  3BSO A;  2WSC C;  5F8N A;  4AQY F;  1HBM B;  2B51 A;  1ZS6 A;  4I6Y A;  4N47 A;  3VGU A;  1NKB A;  1KC8 T;  3SSQ A;  2PFD A;  4MK9 A;  5DET A;  1M0S A;  3JXO A;  5HVH A;  3HM9 A;  2D9P A;  3D66 A;  2VQF J;  1NJW A;  3H5X A;  4CCH A;  2KHD A;  4OHW A;  1YZ6 A;  4WBF A;  5H9F J;  5THW A;  1KSP A;  2HQD A;  2A18 A;  3T3F A;  3PDN A;  4DF8 A;  1U1Q A;  3CIZ A;  2HFV A;  5MLC V;  3V6D A;  3BSC A;  5GAG U;  3IWX A;  3D7S B;  4URQ U;  5HSP A;  3CE8 A;  2GHV C;  3KLE B;  1CJV A;  2A2D A;  2GAH C;  3DRY A;  3LGN A;  1RT6 B;  4C97 A;  3J7Z 5;  1ZH5 A;  1MNE A;  1VQ5 S;  1GMW A;  1FT8 A;  1TL7 A;  4HH1 A;  4NWB A;  3RAM A;  3RU0 A;  2VBY A;  1YJN S;  1TL1 A;  1S99 A;  2YKM B;  4CLK A;  3J7Z T;  4AT1 B;  1FA0 A;  3RTV A;  3UD4 P;  2IBK A;  1M5K C;  3UI3 A;  1RCO B;  4N76 A;  1T02 A;  4ZPT R;  3KUG A;  1LNQ A;  1IVZ A;  4F2S A;  2G2Y A;  1S77 D;  3NY0 A;  3SQG A;  4JV2 A;  2R7U A;  3R5D A;  1F60 B;  3QGI A;  3VR1 A;  3PFE A;  3HP6 A;  5D3G A;  5T14 A;  2CFX A;  5CXT A;  3TJA A;  2QMU B;  4PQU B;  4EI2 A;  1P8G A;  3R7B B;  4PWD A;  1I6J A;  2MEW A;  3OXF A;  1VHI A;  1WJ9 A;  1KVK A;  3LPY A;  4J90 A;  4RBU A;  4LF9 J;  5D0R A;  1SBR A;  1XMO F;  1HHT P;  1H98 A;  2JHE A;  2QA2 A;  5IFM A;  1F5C A;  5GAE U;  2G2Z A;  3C3L A;  4DMZ A;  5GAG I;  3P8B B;  3B4M A;  1H0H B;  1G2E A;  2PFF B;  2HAF A;  1KWM A;  3DRP B;  3GB0 A;  2Z57 B;  1DTQ A;  1TU0 B;  4ZPC A;  4F4W A;  3R2D J;  3EGZ A;  1K47 A;  3KJN B;  2ZH9 A;  1S0V A;  1TV6 B;  2LQB A;  1RU2 A;  1UPP A;  1Q16 B;  2CWK A;  4Z2X A;  4NYO A;  2AEM A;  2JRS A;  4DV4 F;  1XER A;  2W7P A;  1C1C B;  1LXJ A;  3L7P A;  4HH0 A;  5D4O A;  3KLV A;  3F41 A;  4PXD A;  4WFN Q;  4LF1 A;  3TVZ A;  4ER8 A;  1FF2 A;  2QFI A;  5KT7 A;  1Y3K A;  2P8I A;  2H51 B;  3JSY A;  1H73 A;  2V69 A;  3ZZZ A;  4JOU A;  2EI5 A;  4IFV B;  4AE5 A;  3FDS A;  4CWB A;  4HHU A;  3KUE A;  2LEB A;  2YKP A;  1KQS R;  5KFQ A;  5LMU F;  1G7C B;  1TKX B;  3MMB A;  3N28 A;  3TJ8 A;  3V4M A;  3MR5 A;  3BQ1 A;  5DM7 Q;  1KD1 T;  4H4O A;  2J7W A;  1BQM A;  1N4L A;  4MKY A;  2YKO A;  1ZAV A;  4ZP9 A;  2KT3 A;  3OR1 B;  1ZBT A;  3VZI A;  2J6U A;  2K7J A;  3GLJ A;  4ZVF A;  5KFZ A;  4YB6 A;  2ZDP A;  1J5E J;  1KTQ A;  2PEH A;  4F3M A;  2FJB B;  3I0R A;  4DPX A;  1V6H A;  3VHQ A;  3DYA B;  5DJB A;  4URS A;  5E3C A;  5DGA A;  2OPR A;  4YB7 A;  4QWC A;  3UFC X;  1HBM A;  1UFW A;  3G6E S;  2CQG A;  4ZIT A;  4U67 Q;  1HNI A;  3EVM A;  1CEZ A;  3M2V A;  1U1O A;  4K4S A;  3D6F B;  2GML A;  4JI2 F;  5C25 A;  2LXI A;  2NZC A;  3G2X A;  4LRF A;  2J7U A;  3A8I A;  2HRY A;  4AXI A;  3EYZ A;  1UVL A;  2V34 A;  4L73 A;  4K4T A;  4Q7A A;  3BQ0 A;  3E2E A;  1D9A A;  4U7U D;  5C42 B;  3MTJ A;  4FF1 A;  3KTQ A;  4DL2 A;  1RT4 A;  3MUT P;  3P3D A;  2IM2 A;  2YWG A;  1N5Q A;  1ZA2 B;  2MKS A;  1JLB B;  1W7W A;  4LF5 J;  3SYZ A;  1SL1 A;  5CQG A;  1FCA A;  3OFE A;  3I0S B;  2BJD A;  1NZ8 A;  1RSC A;  3NGT A;  3MAQ A;  3OSP A;  3GMG A;  2BDP A;  3BO2 A;  3NG8 A;  4F8R A;  2YKQ A;  3KG4 A;  4FP9 A;  1FVQ A;  1S4F A;  1QSS A;  2CAJ A;  2WBM A;  3R5C A;  5KG6 A;  1X4C A;  3MM7 A;  3QBC A;  3QGG A;  2JFK A;  3J80 U;  1YRT A;  3P4U B;  1DHM A;  4PYD A;  4DWI A;  3QIP A;  1WD6 A;  3MCS A;  4B9L A;  1G3O A;  4YB1 P;  1T9X A;  3K57 A;  4LRD A;  3DYA A;  1N8R T;  5IM0 A;  2HS0 A;  1AFJ A;  4G1Q A;  3MUV P;  4GO7 X;  1HWI A;  1OS5 A;  2DGO A;  1FXL A;  2E5L J;  1BGX T;  3DLL Q;  3RB4 A;  2OGU A;  4ETZ A;  2W4P A;  4ES2 A;  3BDP A;  3DRR A;  2GW8 A;  4DV1 F;  1TFW A;  1ZTW A;  2A0F B;  3DRX A;  3QLH A;  2E9R X;  2N82 B;  1FK9 A;  1YX2 A;  4P52 A;  4TKT A;  3C6T B;  1NUE A;  4ZS6 A;  2N4D A;  2QMX A;  2IC3 A;  4K5S A;  4R0J A;  5HQ8 A;  3SFG A;  2HHT A;  1YGY A;  4ZCI A;  1BWV A;  3EX7 B;  4RNH A;  4H4M A;  1N56 A;  2A2C A;  3NBP A;  2MHN A;  4LSL A;  4CH0 S;  4CNZ A;  2DRD A;  2OSQ A;  4KHP J;  3ENA A;  1S0N A;  4HAC A;  3HK2 A;  1U2R A;  4B3S J;  1WF1 A;  3GTY X;  5F9N A;  3H4B A;  4CO4 A;  2NZ4 A;  2X1B A;  2V8G A;  4TY8 B;  2HNY B;  2XBP A;  1K1Q A;  3TOQ A;  5KT2 A;  3G6V A;  1U24 A;  2F4V F;  2Y3Y A;  4NML A;  5BXI A;  2MLY A;  1FE4 A;  2KM8 C;  2N4C A;  1FJ7 A;  3HVR A;  1VQO S;  2BW2 A;  2OHD A;  3FBE A;  1REG X;  2HWI A;  3W2V A;  1GAO A;  4Q44 A;  5JVH Q;  1M5O C;  2BJE A;  5RUB A;  4CO1 A;  2AHO B;  2BAC A;  1IBL J;  1T3N A;  3DGP A;  1B0T A;  4I56 A;  4ENO A;  2W9B A;  1WOO A;  3FC9 A;  2BAN A;  2OPR B;  2EK1 A;  3FUY A;  4KHM A;  4OI4 A;  4OYI A;  5C5J A;  1XC9 A;  4OYM A;  3OSN A;  1T03 B;  1Q5V A;  1N34 J;  1MWY A;  3AQO A;  3BBF A;  4WCE Q;  4OX9 J;  1RAF B;  3GP9 A;  3CDU A;  5E3P A;  2V4J A;  1HWU A;  2W9A A;  3HFV A;  4A8S A;  1BQN B;  1RTD A;  2DT9 A;  1VQS A;  1FKO A;  3ZZY A;  1R8A A;  4A8O A;  3DLK A;  2RDJ A;  3IBW A;  3WC2 A;  2VIH A;  4JI0 J;  4NYP A;  2BKO A;  3TEH B;  4LRA A;  1IWG A;  1CS4 A;  2DNG A;  4TY8 A;  4DV3 J;  2Y1L B;  1VQY A;  4IG3 A;  4CO2 A;  1H2V Z;  4F4X A;  2CRL A;  5E3Q A;  2M0G B;  2FJX A;  5KFU A;  1QUV A;  8ATC B;  1D09 B;  1KP6 A;  1JLE A;  2K3I A;  3KJQ B;  1RT1 B;  2PA8 D;  5HMW A;  1JLG B;  1I94 J;  3ZZR A;  3FBC A;  1FX2 A;  3T5L A;  3T1H J;  1NAQ A;  2YXL A;  2HVD A;  2CNN B;  4L3N A;  3SFU A;  3VGV A;  3NOG A;  1C1C A;  5LSL A;  3PW5 A;  4GKK J;  3I31 A;  3HCX A;  4IKA A;  2GX8 A;  2HQG A;  4CLL A;  5KFJ A;  1VQL S;  2EG2 A;  1SJ1 A;  1X4D A;  4P2X A;  2VBZ A;  2AP6 A;  5DDP C;  3FMB A;  3TA2 A;  3A4T A;  5KFO A;  2XC9 A;  2CWX A;  4QWB A;  3DRS A;  1DJ0 A;  4HVZ A;  5KG5 A;  2YH0 A;  4K2X A;  4ES1 A;  2ZUA A;  5AJ3 J;  2LU2 A;  4ZN1 A;  1HR0 J;  3AJ2 A;  4NRT A;  4CO0 A;  4G1Q B;  1Q5Y A;  5K14 B;  1K8A T;  1HYS B;  1GK8 A;  3OR2 B;  2OD6 A;  3C6T A;  2BVZ A;  3F0N A;  3Q23 A;  2FZK B;  1M1G A;  1RT3 B;  4LRB A;  3H5S A;  2HFS A;  3CB4 A;  4WFA Q;  3DHW C;  2VOP A;  1S9E B;  3AY0 A;  3GFX A;  3QID A;  3ZZU A;  1FI4 A;  2IA6 A;  5C2G A;  4MFB B;  4J37 A;  1F3V A;  3AXK A;  1GH8 A;  4ZOS A;  4F36 A;  4WU3 A;  2PDA A;  2QA1 A;  1EHW A;  5DDQ C;  2GIF A;  4E2F B;  2BKN A;  3QAT A;  2QZ8 A;  4LIW A;  2BUN A;  1XR7 A;  2Z2L A;  3H5U A;  4QIF A;  1ZPV A;  2W9C B;  3C8Y A;  2YY3 A;  4UOF A;  5G0R B;  1TVR B;  5A8K B;  1S1T A;  3K5M A;  5M2R A;  3B82 A;  2J76 E;  1PG5 B;  2BXJ A;  1X9W A;  3UW1 A;  4C8Z A;  2GAG C;  3E3X A;  4KGZ B;  4MH8 A;  4CQ1 A;  4YHH J;  1L3T A;  2OH2 A;  4G6V B;  4KQZ A;  2VFR A;  1N6Q A;  3BDE A;  3BR8 A;  2V2K A;  1SC4 B;  2AKW B;  3KK2 B;  5L1K A;  3LP0 A;  3ICL A;  2UUC J;  2C2R A;  3GU0 A;  3JTN A;  4WYW A;  3NLC A;  2HK2 A;  2YNI B;  4A46 A;  5B08 A;  2IBO A;  3I0S A;  5CCM A;  5IWA F;  2EFN A;  2MQO A;  4LF6 F;  1Q95 G;  3BZQ A;  3GIM A;  4DR4 F;  1FJC A;  2BAN B;  2R7X A;  3M8Q B;  1EB0 A;  2RDD A;  3MEK A;  5CH7 B;  5F0W A;  4WTY A;  5ETS A;  4R5P B;  5FLX U;  1SIW B;  2ZHB A;  1SJ3 P;  2HFO A;  1FKO B;  4FXV A;  4P72 A;  5LM7 E;  2ADC A;  1R3N A;  4ZPA A;  1D3W A;  2X1F A;  1FTC A;  5DRK A;  3F73 A;  3SEO A;  2RML A;  1EP4 A;  1YRU A;  1FDD A;  2BE2 B;  3IRX A;  3HT3 A;  1UA0 A;  4JV1 A;  1RTH B;  3MMC A;  2WSF C;  2KJW A;  3CDW A;  1T03 A;  1HD1 A;  2W8L A;  4IO9 Q;  1IJE B;  1T9Y A;  1VIX A;  3QNW B;  3PO4 A;  3HFZ B;  3NNC A;  2Z4P A;  4X66 J;  1O0P A;  1YBT A;  3GV5 B;  2IAJ A;  3L3C A;  4ECU A;  4ILM A;  3BYR A;  4ZIW A;  1IKX A;  2J9C A;  2VPZ B;  3FCH A;  3MEC B;  4DPW A;  3OV7 A;  2UVR A;  2SXL A;  4LF8 J;  1NK7 A;  1VI7 A;  2XM3 A;  5C7P A;  2X3D A;  3K89 A;  4EYH B;  2CPX A;  3DOK B;  4KO0 A;  3GIJ A;  3OUY A;  1WC0 A;  2BJ7 A;  4Y28 C;  1F2H A;  1FD2 A;  1A6L A;  4UOH A;  4ANE A;  2Z2Y B;  5F8I A;  1Q7Y T;  3W3S A;  2VG5 A;  2XHC A;  2BYC A;  3M6W A;  2P6S A;  3OTE A;  4Y65 A;  3AXM A;  4RW8 B;  1N5Y B;  3LP1 A;  2ZJR Q;  1HBN A;  3MHY A;  4NYZ A;  3JYT B;  1YIT S;  3PG9 A;  3DLB A;  2VPW B;  1FNX H;  4L75 A;  1VK3 A;  2N7C A;  4JI7 J;  1WHV A;  4NXM J;  4ZJL A;  3MEE A;  4KTQ A;  2UXD J;  2OPQ B;  1R89 A;  1NKE A;  3ZTP A;  1FWL A;  2ALY B;  4DR5 J;  4I2Q A;  2BAB A;  2ZC4 A;  5B0D A;  1ZET A;  3HJF A;  3GYG A;  4PXB A;  4PXC A;  1X9S A;  4FF4 A;  2KRR A;  2IAJ B;  2C3M A;  2E5G A;  3TP2 A;  5HL7 Q;  4U7U K;  4PG7 A;  1HBU B;  2XEX A;  3MEG B;  1MMN A;  2DNH A;  4N7T A;  3TX8 A;  3UQS A;  4EBD A;  1SC3 B;  3Q89 A;  3C15 A;  1DBD A;  2I2Y A;  2ASY A;  1EQ0 A;  2IRY A;  2B0G A;  1SPB P;  1IKV B;  2GVZ A;  1K0V A;  1IKY B;  3DCA A;  4UF4 A;  5A6P A;  3OPK A;  5IV4 A;  5GVQ A;  2XTJ P;  1HAR A;  3NGU A;  4RWX A;  1LW0 B;  2EEY A;  2ZVI A;  3ET6 A;  3GII A;  4K4X A;  1RWN B;  1XK8 A;  4OZJ A;  1E6V A;  2ZC3 A;  2DGU A;  2LVW A;  3GYX B;  2APO A;  3UN3 A;  2NYH A;  2LMI A;  1N5Y A;  4KKO B;  3PRV A;  3AOC A;  4WFB Q;  2XSJ B;  4J9S A;  5E3R A;  1IKW B;  5KFF A;  3V6D B;  2QL7 B;  3O8W A;  2GVZ B;  3B4D A;  2LEC A;  1P9Q C;  3HHK A;  3MPD A;  3HVT A;  3MOZ A;  3PX6 A;  3FFI A;  1M1H A;  4RUA A;  2WZ1 A;  3GYN A;  1RTI A;  2ROG A;  1M5V C;  2DCL A;  2OPS A;  3HHL B;  4C48 A;  2E9Z A;  3BN4 A;  1H74 A;  3C16 B;  4ETX A;  3D1O A;  1K0T A;  1HWL A;  1VQ9 S;  4B3S F;  1RAO A;  5L38 A;  3DXS X;  4RUC A;  3D2W A;  4ALZ A;  3OL8 A;  3TA1 A;  3Q24 A;  1X4F A;  2QJ3 A;  2Z56 B;  2WTF A;  3KLG A;  3FQL A;  3BSN A;  2GFF A;  1HNI B;  3MXH P;  1JK9 B;  1RTH A;  3MMC B;  5HVF A;  3RZA A;  2R2R A;  2DR9 A;  4O3R A;  2XS7 A;  2QL5 B;  5J2M A;  4N8N A;  4A47 A;  3MM5 A;  3D0G E;  5ETK A;  1HA1 A;  1IBC B;  2QLJ B;  1DAR A;  4IO1 A;  4TVA B;  3FK4 A;  1RAI B;  4DZ6 A;  2DPJ A;  5B0A A;  2NYI A;  4DZD A;  4GVL A;  1KFD A;  1SH0 A;  2VF3 A;  2MZR A;  3Q83 A;  2OIH A;  2M9K A;  3MFI A;  3H59 A;  1YG0 A;  3AA9 A;  1RT2 A;  2LFV A;  3LGH A;  3PKY A;  3KLF A;  3OUY B;  3J7A N;  2NUU G;  4LSZ B;  3NS7 B;  1MRO B;  3A8E A;  2BRK A;  5L9X A;  3T5H A;  1N34 F;  5B0F A;  2QV6 A;  2DR5 A;  4JI1 F;  2W24 A;  2VA3 A;  1PC5 A;  2HRU A;  2M88 A;  3A3P B;  1Q8B A;  2XZD B;  1REV B;  3TQE A;  3ISN C;  1NPK A;  4KB7 A;  3TWZ A;  2ZZT A;  5GAE I;  5L1J A;  4ZVR B;  1U2C A;  1JJC B;  5A76 A;  4ITS A;  4KV8 B;  1R27 B;  2JX2 A;  3THP A;  4O4R A;  4TYA A;  2FZC B;  4ECT A;  3CDA A;  4DCP B;  1L3K A;  3KLG B;  3NEK A;  2LYV A;  4HI1 A;  4LSN B;  2LEP A;  3W7B A;  2CAD A;  1FXR A;  2F3J A;  2RU9 A;  3BGF A;  3UR0 A;  3CT9 A;  3E01 A;  1FX4 A;  3F44 A;  3I9V 9;  1XQI A;  1RWW B;  2OLW A;  3PYE A;  4L76 A;  1TKT B;  2V8P A;  5J2N B;  5C24 B;  5I3Q A;  3M9O B;  3A8K A;  3I87 A;  3QLH B;  4RW4 B;  1VJQ A;  1I94 F;  3OFH A;  1R8P A;  4PZV A;  4RW7 B;  1NO8 A;  2COL A;  2MKK A;  2C2Z B;  2DR6 A;  4Y2I A;  2H48 B;  1KQF B;  4TU8 A;  5KFC A;  1HWK A;  1NDP A;  3HSD A;  1N36 F;  3RRG A;  4LFC F;  3SIP B;  2EBG A;  4DSK A;  3KOA A;  3C14 B;  5CHC B;  1DQ8 A;  1P9Y A;  3S01 A;  4EYI B;  1IKY A;  4O23 A;  2D3O 1;  1BLU A;  1HHS A;  4P10 A;  4B3O B;  4B9N A;  2XSJ A;  1B7F A;  4OYP A;  2AJ0 A;  2M2B A;  1LWE B;  2VFU A;  2W4D A;  4USJ C;  1XMO J;  3FRZ A;  2DRA A;  4ZPV R;  4AD6 A;  3G8T A;  5DGB A;  2ZHO A;  3ZNJ 1;  2PD1 A;  3QWU A;  1KQK A;  1UWA A;  3JSR A;  2C3Y A;  3T6J A;  5AJ3 F;  2FJE B;  3CCV S;  3U1L A;  3CDB A;  1TKX A;  4L74 A;  3DM2 B;  2HNY A;  7FDR A;  2VD3 A;  1WG4 A;  2MZT A;  2RE1 A;  1SVD A;  2BM0 A;  2LQ8 A;  3H20 A;  5E41 A;  2GJI A;  2HFN A;  2KKH A;  3R5A A;  4GMK A;  4M5I A;  1CBK A;  1YKW A;  1RQ0 A;  2E7X A;  4P75 A;  2M8D B;  1FVS A;  2AU0 A;  2IM1 A;  2NSB A;  5K8O A;  4AL6 A;  4DJB A;  4FYX B;  3CCT A;  4J9U E;  1TUV A;  2RUG A;  5IV3 A;  3OL7 A;  2JEF A;  3MPW A;  3CUN A;  4RR5 A;  5G0R A;  4ZVU B;  5IQ6 A;  4OHV A;  1UA1 A;  5CZX A;  2DO4 A;  5KFV A;  2RQM A;  2VG5 B;  3QQC D;  4YR2 A;  1U4B A;  3JQM A;  3R5G A;  3A13 A;  1QVG R;  4B3M J;  4B9V A;  2Z30 B;  2DGT A;  2J0W A;  4NLS A;  3D68 A;  4JP8 A;  2D9O A;  3EE3 A;  3A1Y G;  1S6Q B;  3OBI A;  3RRK A;  3S1T A;  4ZK7 M;  1SXL A;  4J9R A;  2MKJ A;  3LTO A;  2VG7 A;  3PM9 A;  1HBN B;  2PC6 A;  4ZJQ A;  3IWL A;  1FRI A;  3I4H X;  5AXN A;  3EVO A;  1SKU B;  5CYM B;  2MKH A;  3BH7 B;  4ERD A;  3M8Z A;  4CT9 A;  3OTO J;  4I7F B;  4ECQ A;  3KKF A;  2XMU A;  1WEZ A;  1B64 A;  3DLE B;  2OPQ A;  2V63 A;  1PBU A;  5A8R B;  2CJK A;  2A6M A;  2Z8Q A;  3N01 A;  3G9C A;  1S6Q A;  1MSW D;  1APS A;  2R8I A;  2DPI A;  2UUB J;  1OMS A;  1RHQ B;  5B7W A;  2BA9 A;  2B5J A;  2HBY B;  3D6T B;  1JLE B;  1N0U A;  3MM7 B;  1DTT A;  3BYP A;  2DNZ A;  3US5 A;  2UP1 A;  4LVO P;  2QTW A;  4LR9 A;  4OJ3 A;  3LP1 B;  5LXR A;  1L5U A;  1VQ6 S;  1TKZ B;  5KG3 A;  5FII A;  1R6V A;  1IBM F;  3PV8 A;  1NPR A;  4GRS A;  1FKP B;  2HNZ A;  3L9Z A;  2IA0 A;  2UVV A;  3NKY A;  1WG1 A;  3Q8V A;  4I67 A;  2IM0 A;  2WBR A;  3PXG a;  3JAM U;  2C28 A;  5GAH U;  2Q6B A;  3ISZ A;  3TZX A;  1SKR A;  2B6A A;  4PYA A;  3VVU A;  1RHR B;  1YJ7 A;  1WHX A;  1KKH A;  5FLX Y;  4NA3 A;  1NM2 A;  1S9E A;  3I96 A;  4RU2 A;  3CGI A;  3LPE A;  1XEZ A;  1WEL A;  2IC3 B;  3HMJ G;  2JNJ A;  3RBE A;  2DH8 A;  4OYX A;  3IR7 B;  1QSL A;  1D8Y A;  1TL3 B;  2DTJ A;  2Q66 A;  3AA8 A;  1X5T A;  3CJ0 A;  5I4M A;  2F8E X;  3KK2 A;  1S0M A;  4KE5 A;  1W25 A;  1RAJ A;  2KXN B;  4WKR A;  4F04 B;  3RW7 A;  4M5L A;  1MWQ A;  2WAQ D;  4P7V A;  3R7N B;  2HHS A;  4CLY A;  1EZZ B;  2ROE A;  4H4O B;  1RA6 A;  1WKL A;  4PPD A;  1L3V A;  1PYS B;  2EG1 A;  3GSD A;  3JSB A;  1ZZF A;  1F9F A;  1E6Y B;  2VQE J;  2UUB F;  4JI7 F;  4NXM F;  2R7O A;  3M1V A;  1ZA1 B;  2HGM A;  2RS2 A;  1S12 A;  3MM9 B;  2DR7 A;  1DLO A;  3R27 A;  5H9F K;  5AXL A;  4LT6 A;  3DU6 A;  1OYE A;  1VRQ C;  1WDD A;  3FSI A;  1LXN A;  4IDK A;  3OFF A;  1MN9 A;  2HZV A;  3AB2 B;  3Q8Y A;  5LMN J;  1Q53 A;  5DDO C;  4LFA F;  2FLP A;  1GXL A;  1NJI T;  2G1H A;  3RB6 A;  3MM9 A;  2G2O A;  2AW0 A;  4EEY A;  3TEG A;  3MD1 A;  4B08 A;  5A0Y A;  3A12 A;  3G4S S;  4I69 A;  5AT1 B;  4DUY J;  2B9W A;  2DGS A;  2YNF B;  3T1A A;  5HMX A;  3PJW A;  2LCW A;  2U1A A;  2WVB A;  3CCZ A;  3PR5 B;  4E98 A;  4IDK B;  2V4J B;  2VPX B;  4BCA A;  2GJF A;  1PCA A;  2E7V A;  4MIA A;  4DU8 A;  2DIS A;  1RHJ B;  1PIE A;  2XZW A;  3BPD A;  2ASL A;  4HR2 A;  3MM8 A;  2MXY A;  3ZZP A;  2NPI A;  2PA3 A;  3D0I E;  3HVA A;  2ZWO A;  3N6M A;  2B4V A;  2XWX A;  4OZ2 A;  4EU0 A;  4DR3 F;  1TV6 A;  2BKP A;  1Q79 A;  2XMA A;  5HLF B;  1FRH A;  2UVW A;  2V67 A;  2DVI A;  2KHC A;  4OYA A;  4RW4 A;  3TJ9 A;  1YJV A;  4IFY A;  4QJV A;  2X3G A;  1DFD A;  1SH2 A;  1WI8 A;  4J91 A;  2MDA A;  3C19 A;  4PCQ A;  4ZPW R;  3T1Y J;  1O6X A;  1RLC L;  1RT5 A;  2OSR A;  1ZZN A;  2CDQ A;  4DSJ A;  1U2F A;  1V5V A;  4OFZ A;  2A3J A;  4ZA1 A;  2HMI A;  4JI0 F;  5EN1 A;  4YEA A;  1GXU A;  1NDL A;  1V9O A;  2C42 A;  4XDD A;  4NLO A;  5A0Y B;  2V68 A;  1FER A;  1BQN A;  3MMA B;  1RTD B;  3NL0 A;  2EC0 A;  3SQG B;  3DI6 B;  1BXN A;  2DXF A;  3BBB A;  3O3L A;  4L3K A;  4O44 A;  4Y6I A;  4TU9 A;  3Q22 A;  1QD1 A;  3J81 j;  4LFB F;  4X4V A;  1K44 A;  1X4G A;  5L1L A;  3D3C J;  4KGV B;  1Q81 T;  2GHP A;  3PW0 A;  3R7S B;  2EKN A;  4NA2 A;  2D7S A;  2HVZ A;  4M5N A;  5F8G A;  1JJH A;  2KH9 A;  4GKK F;  4J9N A;  1CJT B;  1WAC A;  3FJ2 A;  3TAM A;  2CPH A;  1AFI A;  2D41 A;  2LA4 A;  5K14 A;  2HEK A;  1WUU A;  1Z1Z A;  3H0P A;  3R3T A;  5ETM A;  2FHK A;  3GFZ A;  4DCO B;  3HHN B;  4X2B A;  2ZNY A;  3M2U A;  4DLG A;  3G87 A;  3O44 A;  2LEA A;  1OSC A;  3WIU A;  1IM4 A;  1JLF A;  2YWF A;  2IVF B;  4DXL A;  3J80 Y;  4X64 J;  1RLD A;  5KFR A;  2HSE B;  2QYG A;  4X4O A;  2WVE A;  2B8P A;  2DY1 A;  3CF5 Q;  1TK8 A;  4H4K A;  4A8F A;  1JMT A;  4WKY A;  3FZ2 A;  2Q6C A;  3CCE S;  4DX8 H;  1TL4 A;  4OYW A;  3KHH A;  2BRL A;  5KT5 A;  2VPY B;  3CD0 A;  5CYM A;  1VRT A;  3BPS P;  4DBQ A;  1GMV A;  1GTE A;  3HHL A;  3PHE A;  2QMW A;  3VGT A;  2QYC A;  4F4A A;  2EKY A;  2YKN A;  4QPX A;  1ZYQ A;  1NJY A;  5U47 A;  1J5O B;  2BBE A;  1OSD A;  3EXY A;  3QWP A;  3POT B;  5GMD A;  2BJ1 A;  3CMA S;  2CZ4 A;  1SC1 B;  1VRU B;  2MJU A;  2VIC A;  1Q78 A;  3DFE A;  4DS5 A;  3T5K A;  1ZAX A;  3FGV A;  3M2R A;  1TEL A;  1CQN A;  3FEX B;  4C0B A;  3G96 A;  1CJT A;  1Z4U A;  1QY7 A;  4WFX A;  3TAM B;  3DLK B;  1NZA A;  2GQQ A;  2P9E A;  3DOM B;  4PEO A;  2HZC A;  3HFK A;  5ETN A;  1HNZ F;  2NSC A;  4PRF A;  2HLT A;  2WB4 A;  3BM7 A;  1CJV B;  2AD9 A;  3J7Y U;  3CJ3 A;  2ZIT A;  3B8H A;  3KMS A;  1VBZ A;  2M4M A;  2QN6 B;  2RS8 A;  3N4W A;  4AUK A;  5DQG A;  1HNW F;  2XS5 A;  1KVI A;  4OZ3 A;  1V5I B;  5IWA J;  3QFW A;  4LR7 A;  2Y1R I;  4M5G A;  4ZVG A;  1FK9 B;  3WDO A;  3V6H A;  3G6X A;  1BHN A;  2CJB A;  4BBY A;  5HBM B;  2ZH4 A;  1FD8 A;  2E5H A;  5BR8 F;  3CME S;  4ICL A;  2RHS B;  5KFS A;  1QUP A;  2GV1 A;  3KUH A;  2DNY A;  3W8G A;  1VIO A;  4S0M A;  5CCL A;  3GV7 B;  1M90 T;  3PVX A;  4QIV A;  2ZH2 A;  1RHM B;  3K0J A;  2DGX A;  2CQ3 A;  3CTR A;  1F3F A;  1TL3 A;  3A8J A;  5DZ7 A;  4PKD B;  3NS6 A;  2VA2 A;  3NMA A;  1WOR A;  5KFA A;  2CPI A;  2WVF A;  5HBM A;  4HDG A;  5KT6 A;  3CED A;  2HQF A;  4EZ6 A;  4X66 F;  1ZPW X;  1RYS A;  2FJV A;  1S9G B;  3IGN A;  1UWB A;  1NRK A;  3BB5 A;  2XYH B;  1A9N B;  4HHH A;  2B6A B;  1QTN B;  2J7K A;  1JLA B;  1OPZ A;  1UVK A;  2AX0 A;  2OFH X;  2JJ4 D;  3MPY A;  2W2M P;  2ZKU A;  1D1U A;  1KRP A;  2GZO A;  1VQ8 S;  4H4M B;  2UZA A;  2DY9 A;  2XLK A;  4ECY A;  2RH3 A;  1S6P A;  1AA1 B;  1JKH B;  2R7Q A;  5AE1 A;  3SI8 A;  1B7Y B;  2WRM A;  2AWZ A;  3QO9 A;  3RUB L;  3S7R A;  2GGP A;  4ZCL A;  2F7V A;  3QJJ A;  5F9L A;  4NI2 A;  1RWX B;  2B8Q A;  4ELV A;  3J81 Y;  4R8U B;  4DV2 F;  1IBM J;  1NSP A;  3C15 B;  1LWF B;  5IC4 B;  4USU A;  1KTV A;  3CCW A;  1MU2 B;  1FES A;  2KN4 A;  2GS8 A;  3J7A 1;  1VK8 A;  1U8W A;  4DL0 C;  3QRQ A;  1U45 A;  3P6Y C;  1SJQ A;  1A0O B;  1A7G E;  1VRT B;  1VJW A;  4MKB A;  2WON B;  4ZVQ B;  5F3T A;  2ZH1 A;  1S1U A;  1KON A;  1JJ4 A;  2M8H A;  4GO5 X;  1JLC B;  2C2O B;  2FC8 A;  5L8R C;  4K4Y A;  2EW9 A;  5I42 A;  3R5J B;  2OD4 A;  4UTG A;  1NJZ A;  5EDW A;  4DV0 J;  2JSX A;  1X4B A;  2V6A A;  3CJ2 A;  4ES3 A;  2ATL A;  4KHP F;  2UVU A;  4ECX A;  4URG A;  1XWL A;  2LQ5 A;  4PAA A;  3FKB A;  4X65 J;  4XO0 A;  2XLI A;  4BHQ A;  1XMQ F;  3M8W A;  2BX6 A;  4K5R A;  1CUL A;  3D1Q A;  5DG8 A;  5KAK A;  3M2R B;  3IR6 B;  2IPO B;  4OL8 A;  2Y8W A;  2HHW A;  5KTQ A;  2GGP B;  3PX0 A;  1T9U A;  3FBF A;  4TXS A;  1RHU B;  2CQP A;  3K58 A;  1U47 A;  4M5M A;  2R8J A;  2UUW A;  4AQY J;  1X5S A;  2YWK A;  4QR1 A;  5F3Z A;  1PAU B;  4W90 B;  4RUB A;  3CCS S;  3NCQ A;  3W5X A;  3D5M A;  2G0C A;  3EVW A;  2R42 A;  2AMC B;  3BQ2 A;  1TK5 A;  1LK7 A;  3CDE A;  1CUL B;  4LQ3 A;  3MEC A;  1LEO A;  5HQM A;  4DSF A;  2VL1 A;  2IDE A;  3MR7 A;  3KK3 A;  1JQG A;  5CYQ A;  5ETR A;  4Q45 A;  5D0E A;  1KN6 A;  2L9W A;  4DG1 B;  1KVJ A;  1O8B A;  2EFV A;  4Y2C A;  4X4R A;  3VAL A;  2HLU A;  1S0O A;  3MR3 A;  2B4O A;  5FDL A;  3MPU B;  4RZR A;  1N32 J;  2HNZ B;  2Z2M A;  3PKM A;  2FVC A;  5MAO A;  1R0B G;  3WZ0 A;  4K2J A;  2XNR A;  1X8D A;  2VB6 A;  2B7C B;  2J0X A;  4EWT A;  4QWA A;  5A2Q U;  2RF2 A;  3MWB A;  4Q0B A;  3MED B;  1RCX B;  3KG1 A;  2P2C B;  1ZAW A;  2VDI A;  3HD2 A;  1B0P A;  4DQI A;  4O3P A;  3B6B A;  1UKU A;  4C4W A;  3UO0 A;  1YDL A;  1QM9 A;  3HPO A;  1FNM A;  5E5N A;  1ICE B;  3J7Y I;  4X4U A;  1CC8 A;  1GT8 A;  4NL5 A;  1C0T A;  1Q4R A;  1RKI A;  5J1N A;  1KLM A;  5DZ6 A;  3FSY A;  4I6W A;  2DGV A;  4WU2 A;  1VS3 A;  4KPC A;  3HF5 A;  1RI7 A;  3H2V E;  4C8M A;  3UN2 A;  4DX7 A;  4FF3 A;  3H4D A;  1U48 A;  1BQM B;  2CQ0 A;  2NS1 B;  4OIX A;  5J1E B;  2C2D A;  4JV5 F;  2W7O A;  2RRN A;  3HT0 A;  3EZ5 A;  1VDH A;  2DKO B;  1D8Z A;  2BE9 B;  2LDY A;  3PHT A;  2HMI B;  2CJX B;  2MTL A;  3DKD A;  1LOU A;  1UZD A;  4JI8 J;  1VBK A;  1W26 A;  1RE1 B;  3POT A;  1X5O A;  3H98 A;  4RWW A;  1PKU A;  1U09 A;  1AUD A;  4Y3C A;  3KNA A;  4RNF A;  2GMJ A;  3OXG A;  5J1E A;  1M5H A;  2Y0B B;  3HHL C;  1EKS A;  3QT8 A;  1MW7 A;  2HHP A;  3H8Y A;  4USI A;  4PPZ A;  3C14 A;  2HHH F;  1LKZ A;  4JI5 F;  5LJ3 Y;  5HP1 A;  4MAK A;  3Q8P B;  4FBT A;  3AJD A;  5KFY A;  3DM2 A;  1EET A;  1GMW D;  2AJ1 A;  2H1Y A;  4ZLJ A;  4R5P A;  2OPS B;  5D0G A;  4C3K A;  5C24 A;  5KFI A;  2KG0 A;  1S49 A;  1N36 J;  4LFC J;  4Q43 A;  3ILO A;  2X1G A;  2YQ1 A;  3GFY A;  1FFW B;  4CLS A;  3GSI A;  4CZC A;  4P2M A;  4KKO A;  2YTC A;  1OYD A;  2GO8 A;  4Y2A A;  4X64 F;  3QIP B;  5EGY A;  2YPZ A;  1QVF R;  3RYL A;  1EAR A;  2VKR A;  3TRG A;  1XIQ A;  3HJV A;  2DD8 S;  1XJW B;  3KLE A;  1RWU A;  1R8B A;  3ILJ A;  4I6A A;  2X1A A;  2QSF A;  5AE2 A;  3HDS A;  3VCD A;  1U6F A;  3GJT B;  2H3E B;  3NXZ A;  4I2P A;  1J5E F;  1U6B A;  3MAA B;  3RBX A;  4G65 A;  3OFG A;  4J9P A;  3M9N B;  1KR4 A;  2FY1 A;  1JXL A;  2MJN A;  3CW2 C;  3WIV A;  2CPY A;  1ITP A;  3RW6 A;  3CD5 A;  2P9G A;  1TL1 B;  1TZ0 A;  1X4E A;  2FB0 A;  4LRE A;  3SSR A;  3W5Z A;  1RYR A;  1SQG A;  3G71 S;  4JI2 J;  1ROF A;  1P27 B;  4RX6 A;  1RT5 B;  2FDN A;  4LRC A;  3P96 A;  4AXJ A;  2KG1 A;  3RBD A;  3NOC A;  4CDI A;  6AT1 B;  3PCO B;  3M2V B;  5FD1 A;  3D3B J;  1T94 A;  2GA7 A;  4QZV B;  4LMZ A;  1UL3 A;  2VFV A;  3D0H E;  1HWJ A;  1LWF A;  3Q0A A;  5HN0 A;  2CYY A;  3CCL S;  3I6P A;  3IO1 A;  4B17 A;  3OVA A;  2DEI A;  5H9E K;  3N6L A;  1K9M T;  4LF8 F;  4DV5 J;  4NLP A;  1X0F A;  2YX7 A;  2RHQ B;  1IN0 A;  4U6P A;  4O3Q A;  4MYT A;  1JKH A;  3PYD A;  4CRJ A;  3IAM 9;  2QE5 A;  1VCT A;  5BR8 J;  3MAA A;  3OVB A;  4ELU A;  3MMB B;  4QYZ K;  4DQP A;  4IUF A;  5IT9 Y;  2VFS A;  2Y9H A;  1KLM B;  5L39 A;  1RAD B;  3EZU A;  4R8U A;  2NRE A;  1YJR A;  2ZD1 B;  1S72 S;  2FVS A;  4OYZ A;  4X4N A;  1NPP A;  4P6Q A;  1DTT B;  2C1E B;  2KT2 A;  1SIZ A;  3GJS B;  4YUD A;  2E5L F;  2K1R B;  1CVJ A;  1OWX A;  1FO1 A;  4ZVO B;  2J9D A;  5F8L A;  1WSR A;  4DCJ B;  3VAH A;  1JB0 C;  3VWS A;  4Q8E A;  2QLB B;  4DR5 F;  4MT1 A;  4WXO A;  3PEH A;  4Q2L A;  2JC1 A;  3GE9 A;  1YJT A;  2D3U A;  2QFJ A;  3W9J A;  1Y00 A;  5LSR A;  1TUW A;  4J9V A;  3D6H B;  2IVY A;  2DHS A;  4N56 A;  4C2M A;  2ZH7 A;  3BO4 A;  4A8K A;  1TTH B;  2FJW A;  4DG1 A;  2F1F A;  1LWE A;  1YJU A;  1F1B B;  2IJR A;  1UET A;  3D6M B;  4QQB A;  2YX4 A;  4IOB A;  2HBQ B;  2YNH B;  3THT A;  3VAJ A;  2BOP A;  2YQ0 A;  2XS2 A;  3KMQ A;  3EDR B;  3P45 B;  2AZ1 A;  4M5K A;  4N77 A;  2CVE A;  2EBE A;  3BF4 A;  1RT7 B;  1HW9 A;  4PG4 A;  2WVD A;  3G82 B;  3CC2 S;  2JEI A;  4QOT A;  1Q82 T;  4UUX A;  2OTJ S;  4NRU A;  4PQA A;  1QSY A;  1G6B A;  4E8U A;  3VAG A;  3BJY A;  2MLZ A;  3B54 A;  3MF5 A;  5F0U A;  2YWE A;  4NLG A;  2EFG A;  4PG5 A;  3TVY A;  3SV3 A;  2FVQ A;  4OYO A;  2HK3 A;  4FVM A;  4WIQ A;  4RNN A;  4HKQ A;  2OUG A;  3BGL A;  3FSX A;  1NCL A;  4MKV A;  2DH7 A;  1FRJ A;  2DNN A;  4FPR A;  3RB0 A;  4GC7 A;  1JX4 A;  1KHW A;  1WKK A;  1VQ4 S;  2AZ3 A;  3IS9 A;  3R9L A;  3IA0 A;  5A8R A;  2D3O R;  4UZC A;  4O0I A;  1S1V B;  3TQ1 A;  1HNX F;  1MN7 A;  2AX1 A;  2G9O A;  2DNM A;  3Q86 A;  1LFP A;  4YME A;  1AXQ A;  1C0U A;  1T11 A;  5C42 A;  3JSM B;  3W62 A;  3L09 A;  5IC6 B;  4OX9 F;  1XMQ J;  1S9G A;  1RKJ A;  3OR2 A;  4RLE A;  4B9M A;  3M8Y A;  3DLG B;  3EJM A;  3K17 A;  4K8R A;  4NLQ A;  3HD1 A;  2JFD A;  4LJM A;  5F8J A;  5DQI A;  4ZHR A;  4BWJ A;  5KG0 A;  1R6Y A;  4UY8 T;  1JNZ B;  3DRP A;  3ETM A;  1VLO A;  3IAS 9;  3ITH B;  4NPO A;  5KG4 A;  2VJV A;  4JI4 J;  1DY3 A;  5ITH A;  2H9Z A;  2V4R A;  4DV3 F;  4CLU A;  3N9U C;  5LT5 A;  3EUN A;  4B3R F;  4TNO A;  2RVJ A;  1HQE A;  5K9F A;  3UE2 A;  1T95 A;  4DPU A;  4O3O A;  4PWD B;  4DR3 J;  3IBC B;  7FD1 A;  3IG1 B;  1S6P B;  4WP8 A;  5DM6 Q;  3QZ8 A;  2MQL A;  1GTH A;  3EWG A;  1RT1 A;  2NCK L;  2F4F A;  5IS2 A;  1NHK L;  4JI1 J;  2BJ8 A;  1TKD A;  1WNE A;  1Q8K A;  3F56 A;  1XBW A;  2DIU A;  3ONQ A;  4UST A;  2HAI A;  4OI1 A;  1OQ3 A;  4C3L A;  3TI0 A;  3GJQ B;  1N5S A;  5A8W A;  1NBE B;  2ZD1 A;  2PI5 A;  4O4G B;  1N54 B;  1C0U B;  1T0T V;  1OY9 A;  4K4V A;  3PJ9 A;  3S6E A;  4NLY A;  2UXC F;  4NAS A;  4WZM A;  3HKW A;  2DNK A;  1TQL A;  3I55 S;  2C22 A;  1FJE B;  1M5S A;  2VOO A;  4RNM A;  4PAB A;  2MZQ A;  1S59 A;  2NR0 A;  4PXE A;  1EP4 B;  2BE2 A;  2HRT A;  3IRX B;  3LAN A;  4ID5 B;  5K8P A;  4LFB J;  1WTF A;  2DK2 A;  4K0K F;  4OZ1 A;  5B0G A;  4X4S A;  1GNK A;  1LWC A;  1TP7 A;  3U27 A;  3OW2 R;  4DFM A;  2OJ3 A;  2XWY A;  4DR1 F;  3UR3 C;  1NND A;  2JVO A;  3DLE A;  3G82 A;  3KHL A;  1XR5 A;  3OTD A;  3BKF A;  4I4B A;  3EZO A;  1URR A;  1KS2 A;  2IJN A;  2Z2Z A;  1D0E A;  4DR2 J;  1RZM A;  4OX8 A;  1S7I A;  1X60 A;  1FJG J;  4JB8 B;  1IKV A;  1D9F A;  1N52 B;  3THV A;  1NDK A;  3QAE A;  4PWW A;  1S76 D;  4G1I A;  1L3U A;  3HHL D;  4IH7 A;  3OXL A;  4M8L A;  2OTL S;  2WOM A;  2KFY A;  2YH1 A;  1IQT A;  2HBZ B;  4J9O A;  2NXE A;  1EAY C;  3VGS A;  1WOS A;  2HUR A;  1B99 A;  1KQG B;  1R7I A;  2R8H A;  4HEA 9;  2VU5 A;  1V3S A;  5HVG A;  4QPT A;  3ZO7 A;  1VRU A;  2YBV A;  2P9C A;  3BO3 A;  3KK3 B;  3K5N A;  1BWE A;  2VFT A;  3GZ7 A;  2EC2 A;  2W2P P;  2M52 A;  4M1K A;  4CI0 B;  3D54 A;  3Q2S C;  1OY6 A;  1S1V A;  4ZCK A;  2XNQ A;  2ASD A;  2UXB F;  1X7V A;  4FVC A;  4LBH A;  1P6T A;  4O3S A;  2AGP A;  3MGJ A;  3QT6 A;  2YNF A;  1C0T B;  1I5O B;  2V8H A;  5HI7 A;  1YIJ S;  2YX1 A;  3CJ4 A;  3W1Y C;  1CS4 B;  4CYU A;  3J81 U;  3BV8 A;  3K2Y A;  4NMX A;  4F4Z A;  3RGI A;  1HW8 A;  4FDF A;  2K3K A;  1UAW A;  2VHG A;  4JI3 F;  1KBR A;  3NCP A;  3H42 A;  3Q8U A;  2RF2 B;  4Q0B B;  3GWC A;  3DDK A;  4HL9 A;  1KOH A;  2FLN A;  3NGD A;  1HNW J;  3HHD A;  4FF2 A;  1K1S A;  1XN9 A;  3QT7 A;  1R0A B;  4DV7 J;  3JTO A;  4QIW D;  3U02 A;  2WB1 D;  1U1K A;  3MEE B;  2ABY A;  5D3G B;  3IFE A;  4RW9 B;  3HSG A;  1QAY A;  3UD5 A;  5A2Q Y;  4EBC A;  3TW0 A;  3MM6 B;  2ZM6 F;  1TKT A;  4C7Q A;  4O0N A;  1M5P C;  5HK4 A;  1WDT A;  1WWH A;  2ZVS A;  1O51 A;  2DCU B;  3IR5 B;  3JQK A;  1N6Q B;  3C66 A;  5HMY A;  3MMA A;  1SL0 A;  3TX0 A;  4YOE A;  1NXI A;  5LL6 d;  3BGR A;  2XQC A;  4ED5 A;  1QDU B;  1S1W A;  3QJL A;  4KH0 B;  1NK5 A;  3HUL A;  5IT0 A;  5D6G A;  4JYA F;  1VQN S;  4UW2 A;  2PMH A;  2H5E A;  3PYF A;  5SZT A;  3CCJ S;  1CC7 A;  2DBB A;  1DRZ A;  1OJ4 A;  1OY8 A;  2GIQ A;  3KFW X;  2CVI A;  2GMH A;  1RWV B;  3JQJ A;  2R2T A;  1ARO P;  4C11 B;  4UUW A;  3I56 S;  2V8D A;  3I5A A;  1F6T A;  2XZT B;  4P9S A;  5IOL A;  2L41 A;  5HMZ A;  2R8K A;  4DR6 F;  2LQJ A;  1S1W B;  3L4B C;  4I2Q B;  4K4W A;  3R1H A;  3QGH A;  5HP1 B;  3SXL A;  1BC6 A;  2CXE A;  3LWL A;  2ROP A;  4ED8 A;  2ASJ A;  2RQ4 A;  3HZE A;  3UDE A;  4DV2 J;  1RBL A;  2O5D A;  2HVI A;  1EJ7 L;  3JAM Y;  5F41 A;  3R1L A;  2OP5 A;  3GCX P;  5CYJ A;  2YKN B;  9ATC B;  1UCN A;  2HFU A;  3RAX A;  3IMQ J;  4ZHR B;  2BOA A;  2HHX A;  4XPE A;  1WSV A;  4WK3 A;  1R43 A;  2VBX A;  2XYG B;  3WX8 A;  3NWR A;  4DUZ J;  2G0I A;  2XMK A;  4KGK A;  4IRK A;  3CVK A;  2YVS A;  1HQU B;  4DEZ A;  1B4S A;  4KGM A;  1FEH A;  4ZP8 A;  2YQ3 A;  2MZ1 A;  1BMQ B;  4F67 A;  3UN5 A;  1K73 T;  1EQM A;  3GQC A;  1CG2 A;  2DIT A;  5T7L A;  2FHJ A;  3CJQ A;  2O67 A;  3FFI B;  2NXU A;  5LMN F;  2QC3 A;  2F40 A;  3DMJ A;  1HHQ A;  3EGW B;  2MKI A;  3CPW R;  5FJ4 A;  5CAB A;  4KFB A;  3M30 A;  3KXD A;  4IG3 B;  4CYU B;  2QX0 A;  2CZ9 A;  4IG0 B;  5IZH A;  4IH5 A;  1WC1 A;  5KG1 A;  1HKA A;  1RAE B;  3P5T L;  1TMJ A;  1OO0 B;  1Y4Z B;  5LSO A;  2AQ4 A;  2BE7 D;  2RQK A;  2MLX A;  4O4G A;  5KFP A;  3MED A;  2FPH X;  2QEX S;  3M2U B;  1JLG A;  4F4K A;  1NEE A;  4KPY A;  4ELT A;  3LF0 A;  2ZH5 A;  2W4C A;  2GVD B;  5DS7 A;  1VBY A;  3N79 A;  2ACM A;  4PR6 A;  1BY9 A;  2M70 A;  4DL5 A;  2KXH A;  4UY8 5;  2AJQ A;  3IM9 A;  3DOL A;  3BRE A;  4X62 J;  5DO2 A;  2NXN A;  3PYG A;  4ZP7 A;  2DNO A;  2AJ2 A;  2CZV C;  3RBZ A;  4DN0 A;  2UU9 F;  4KGX B;  1I3O B;  3TAP A;  1U02 A;  3UPF A;  1LWC B;  3UNY A;  4IR9 A;  4DR7 F;  8RUC A;  3K7R A;  5LXY A;  3KJV B;  2WK4 A;  3T1Y F;  2Y1I A;  4USH A;  4OHX A;  1HL6 A;  5JJB A;  1X9M A;  3CJK A;  2DNP A;  2N7Y A;  4DLE A;  2V2V A;  4ECZ A;  1OQ6 A;  4NCG A;  3FNN A;  3Q2T C;  5D8H B;  4YN3 B;  1R8C A;  2HKE A;  3FEY B;  3MI7 X;  2XSF A;  3V6J A;  1SJR A;  3GPA A;  4P74 A;  2HGN A;  2V2Q A;  2CPZ A;  2CIM A;  4YDX A;  4UOG A;  1AT1 B;  1D9D A;  3NRB A;  3DDN A;  4A4J A;  4BC7 A;  2VUG A;  2KB2 A;  1PO6 A;  1HI0 P;  2IMW P;  2IRU A;  1S48 A;  2WW4 A;  5T41 A;  3OHB A;  2ZWP A;  1SH3 A;  4Y2K A;  5JXS A;  4DQR A;  2O01 C;  1SQE A;  2HZA A;  3NGK A;  3CCM S;  4BS2 A;  3HX9 A;  1SKS A;  4FYD A;  1CPZ A;  2DH9 A;  2VH7 A;  1TVR A;  3M4X A;  5A8K A;  2DR8 A;  4I68 A;  3MR2 A;  4JI6 J;  5GAD U;  2K2P A;  3W65 A;  2OAU A;  3R97 A;  2IDL A;  1NJX A;  2F4V J;  4F26 A;  4JI8 F;  4RW6 A;  4DSL A;  1H3D A;  3UDL A;  3ZXW A;  5M2P A;  1NK0 A;  1VQK S;  2H4Y B;  2GIR A;  2Q3P A;  6FD1 A;  1ZM4 A;  4ILR A;  5B0C A;  4ECW A;  3RB3 A;  4DL6 A;  1SC6 A;  3Q8S B;  4CLZ A; 
#chains in the Genus database with same CATH homology
 4JI3 J;  4DV1 J;  4KYZ A;  5AJ3 J;  4LF5 J;  1HR0 J;  3OTO J;  2VQF J;  4DR3 J;  3D3C J;  3J80 U;  4DR4 J;  1HNX J;  4DR1 J;  4DV0 J;  2UUB J;  2ZM6 J;  4YY3 J;  4JI1 J;  4X65 J;  4JI2 J;  1N33 J;  4DV2 J;  2MQ8 A;  4NEZ A;  3D3B J;  2E5L J;  4X64 J;  1XNQ J;  4YHH J;  4AQY J;  1HNZ J;  3IMQ J;  2UUC J;  3JAM U;  4DV4 J;  4DUZ J;  4DV5 J;  4LFB J;  4LF7 J;  5FLX U;  4DR6 J;  3J7A N;  1N32 J;  5BR8 J;  4KHP J;  4JV5 J;  5LM7 E;  4B3S J;  4LFA J;  4DR2 J;  2MEW A;  3R2C J;  1FJG J;  4LF9 J;  5A2Q U;  4DV6 J;  5LMU J;  4PWW A;  4NEY A;  2UXC J;  3R2D J;  2VQE J;  4X66 J;  4LF8 J;  1IBK J;  5IWA J;  4K0K J;  1IBL J;  4LF6 J;  4KY3 A;  4JI5 J;  4X62 J;  2KVQ E;  1N34 J;  5LMN J;  4OX9 J;  2MTL A;  4HHU A;  4JI8 J;  3J81 U;  3W1Y C;  1XMO J;  4DUY J;  4B3T J;  4JI0 J;  2UUA J;  4DV3 J;  4B3R J;  2KL8 A;  4JYA J;  4JI7 J;  4NXM J;  2UXD J;  5IT9 U;  1HNW J;  1J5E J;  1XNR J;  4DR5 J;  4DV7 J;  1I94 J;  4V1A k;  3T1H J;  2UU9 J;  4NXN J;  2UXB J;  4GKJ J;  4DR7 J;  4GKK J;  1N36 J;  4LFC J;  4LF4 J;  4JI6 J;  1XMQ J;  3T1Y J;  2F4V J;  2HHH J;  1IBM J;  4B3M J;  4RJV A;  4JI4 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...