2QLJB

Crystal structure of caspase-7 with inhibitor ac-wehd-cho
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
KIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-7
publication title Plasticity of S2-S4 specificity pockets of executioner caspase-7 revealed by structural and kinetic analysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2007-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2qljB00
3NS7B 2CJXB 3IBCB 1NMEB 3IBFB 1QTNB 1RWKB 1SC4B 1I51B 4DCPB 3GJQB 1RWVB 2CNKB 1RWXB 2CNNB 3SIPB 4ZVUB 2QLFB 3KJQB 2C2ZB 1SC3B 1RHUB 1GFWB 1SC1B 1BMQB 2C2KB 4ZVSB 3KJNB 3R7SB 3GJRB 2DKOB 2C2OB 1F9EB 3GJSB 4JB8B 2QLBB 3RJMB 3EDRB 3R7BB 1RHKB 2H4YB 4ZVRB 2CDRB 2H4WB 2Y1LB 2QLJB 3R7NB 1RHJB 2H51B 2QL9B 1I3OB 2C1EB 2H5JB 1RWNB 5IC4B 3P45B 1RWPB 1PYOB 4ZVQB 2XZDB 2HBZB 2HBRB 3D6HB 2Y0BB 3D6MB 4ZVPB 2HBQB 3P4UB 1RHMB 1PAUB 1RHQB 3GJTB 3R6GB 4ZVOB 3QNWB 2HBYB 4DCOB 1RWOB 2CNLB 3R5JB 5IC6B 2CNOB 2QL5B 2XYGB 2H5IB 3EDQB 1RHRB 2QL7B 1ICEB 2P2CB 2C2MB 1QDUB 1RE1B 2XYHB 5K20B 4LSZB 2FQQB 4DCJB 1RWMB 2CJYB 3R6LB 1RWWB 2XYPB 2H48B 4ZVTB 2XZTB 1IBCB 3KJFB 2H54B 3D6FB 2H65B
chains in the Genus database with same CATH superfamily
4ZIWA 2VKRA 1PG5B 1AROP 3PHTA 1JJHA 2ZZMA 1JLCB 1V5VA 1HMVA 1RT1A 3ONQA 3PJ9A 4RL1A 4F3QA 4RNFA 1UVKA 2QLFB 2DIVA 2WSFC 2UUTA 3MEDA 3MM9A 3ZZRA 1SJ4P 1KVKA 4DL0C 2RUSA 4AE5A 2V2VA 3IO1A 1WI8A 4BC7A 4K0KF 1VDHA 2HFOA 1TKTA 1LFWA 3TRGA 1JXLA 4KH1B 2A2CA 2ZEJA 4P6QA 3PNIA 2OSRA 1VQOS 4MFBB 4NCBA 2GZOA 2QV6A 1RHQB 2DBBA 2M5YA 2BE9B 4FP9A 4I4BA 4DU8A 3V6HA 2YPZA 4KO0B 4P75A 2XS2A 1NK0A 5I42A 2UVVA 4PG6A 3IBWA 3LUYA 5D0RA 2HFNA 4WPAA 2H65B 4IRCA 1VJQA 1BE4A 1RLDA 4WKRA 3LP0B 3ETMA 4IH7A 2UUBF 3OJUA 3W63A 1IBKJ 2DH9A 4W98A 1G4CA 5B0BA 3UW1A 4OLPA 3KLEB 2MLYA 5KFLA 2ZJRQ 1XK8A 2CDRB 5EWGA 2MQQA 3KWMA 2F1FA 3MTJA 4IFVA 3W1YC 2W2PP 4U96A 2QGFB 1YZ6A 1L3KA 1C1BA 1Y3JA 1HBMB 1AZSB 2MZRA 3IRXB 1WORA 1BQXA 3KXDA 1L3UA 3M05A 3KMSA 3QAUA 4YR2A 1Q0NA 2I5JA 2MB0B 3TX8A 4L72B 1DZ5A 1B70B 1HQUA 1NRKA 1VCTA 3S1TA 1RE1B 3PW7A 2KTQA 1PBAA 4O3PA 7FDRA 2CPXA 5HMWA 4BWJA 2XMTA 3I5CA 3W9JA 4YY3F 1SVDA 1CQNA 3MZIA 5EX0A 5KFNA 4Q0BB 3ET6B 4W90B 2YBVA 3M1VA 2A6OA 2P9GA 2LEAA 1DRZA 4X64J 3D4JA 1H72C 1Q1KA 4CYUA 3E51A 3NWGA 4OYPA 4MH8A 5KG1A 4LIRA 4FN5A 2BJ9A 4Y00A 3M8PB 1NB2A 1KLMA 2IRYA 5KFBA 2VD3A 1NZAA 4NZ6A 3ZZZA 2AW0A 2HVIA 1UKUA 2JLEA 4OYXA 1HW9A 5HL7Q 4IR9A 2KDOA 4LFBF 2LKZA 2DEIA 3DDNA 4FVCA 1RT5B 4DV3J 2D3O1 2NXJA 2FC9A 4B08A 2IMWP 3T3FA 3MEGA 2BABA 1SUQA 1AW0A 5KFSA 1U49A 5DRKA 3BR9A 2OD6A 1N6QA 2CQ4A 2HFVA 3MOZA 2AX1A 4GC7A 2HFZA 2YNGB 3THPA 4KV8A 1XTZA 1LW2A 1WC4A 1URRA 4UQTA 3LA0A 5J2PA 4UW2A 4NCGB 4RNHA 4OZ1A 3W9IA 2CPFA 4B3MJ 2R2UA 4DV0J 3E3XA 5GAEI 2OTJS 3DFEA 4L6V3 1ZM9A 4OX7A 2VG6B 1ELOA 1XIQA 3R5GA 2HHXA 3VQTA 3L9ZA 3RR8A 4XTTA 4EZ6A 3AA9A 5IT9U 2JFDA 3BQ2A 3TUIC 1RAEB 2OELA 3ADAC 4K4WA 2CPJA 5A6WA 1D09B 1OO0B 1QDUB 2DXEA 1SKUB 3KG0A 3AHPA 3L09A 3DLLQ 2MGZA 2UV8A 4ILRA 1BC6A 3NMAA 4ES3A 4AQYF 4ELVA 5KFTA 5F9NA 4V19J 2PI5A 3I82A 4JI5J 1D9AA 1ZTTA 4WK3A 2VIHA 1T9XA 2YXLA 2PMZD 1R6VA 4DCPB 2FVPA 5BYQA 4A8OA 3DU6A 1F2GA 3NMRA 2PEBA 2EPIA 2MEWA 3JAMU 3BSOA 1WG5A 1IR2A 4LF7J 3J7YI 3Q83A 2PA3A 4F0MA 2EG1A 3X1LB 1HQ2A 2HQGA 1XMBA 1X4DA 2R7UA 3SV3A 5FIIA 2N3OA 2AWZA 2NR0A 3WX4A 2DNKA 4UF4A 2NXCA 4QIFA 2XC9A 4PG8A 3TZXA 4JI2F 4WIQA 1JK9B 3GYNA 2W7PA 3LP1B 4UOCA 2POKA 3J81U 1RWWB 3H4BA 3VGTA 4X4NA 4NOHA 3HVAA 3MFIA 2QE5A 4DX8H 1WEXA 4NYZA 4QWBA 1WG1A 1WOSA 5L38A 2C42A 3Q8UA 4Q7AA 2OO4A 3VAJA 2XB2D 1YDLA 4F2RA 2YKQA 4NLSA 4RNMA 4U7UD 1NM2A 5E2QA 1CG2A 3HX9A 4KHRA 5IZHA 5KFOA 4E0DA 1LK7A 5L8RC 2EFGA 2GMHA 2PC6A 5AJ3J 2E1PA 1R0BG 1C0UA 1EKSA 4P71A 3BV8A 4ICLB 4ZCLA 4L3KA 2OEJA 3HVTB 3O2IA 2Q1LA 1K0TA 3CDEA 1NJWA 3H5SA 4ZP8A 2Z2LA 3FK4A 4M5DB 1JLGA 2IDEA 3MURP 3QT7A 5B08A 2FQQB 2P6SA 1Q16B 2Z8QA 5ETRA 3ZZTA 1QSYA 3G86A 1VIOA 3ZO7A 3ZTOA 2WOMA 2DR8A 3BGRB 1SBRA 5F8JA 3EICA 5DDPC 3ISND 4C4WA 1HBNB 3H20A 3QGPA 3OL7A 3AD9C 2GO9A 4ALZA 2G0JA 5K9FA 4Q2LA 3BGOP 5EWEA 2AJFE 4WFBQ 1VFJA 4HTIA 2GW8A 5J2NB 2V63A 1RHJB 4CM0A 4ECVA 2F4VF 1FDAA 3UWTA 1NPKA 1ZOTA 3SSRA 3MPUB 4FS2A 2ROPA 3LGMA 2XMJA 4MK8A 1U6FA 4S0MA 2M2BA 3C66A 4C48A 1HI8A 3NNCA 2OPPA 1Q5VA 1UETA 4ZLNA 4OHYA 3TQEA 3JSMB 1DQAA 5AXMA 3VQSA 2E7WA 2X3DA 2JDJA 5LXYA 1LWCB 3DNCA 4L73A 1UFKA 3GZ7A 4G1QB 2IYGA 1VC6A 3PG9A 3OFGA 3KK2B 3C15B 3PDNA 3CJ5A 5L9XA 2UXBJ 2N4CA 3J81j 2E9ZA 4CTAB 1PJ5A 2GC8A 4O0NA 2VODA 1TUVA 1U47A 4LSNB 5HLFB 4ZN1A 2DGXA 4DR4F 2ZVSA 3DLGB 3OBIA 4LF2A 1RAHB 5JVHQ 3VZIA 4RU2A 2ZH2A 2BQUA 2W7AA 1P9QC 2J9DA 3I5AA 4QQBA 2CZ4A 2YNIA 2B9EA 4RW8A 3BH6B 3FFIA 1XNRF 2OPRB 2AGPA 1NB7A 4ETZA 1S1VA 3FBCA 1Z4UA 2E5HA 3F73A 5AT1B 5KFXA 3BKUA 1KFSA 3M6WA 2B8PA 2VQFJ 1V9OA 3J80U 2E5LF 1VJWA 1VRUB 2HK2A 4OMFG 2HQIA 4UY85 4N47A 1U09A 9ATCB 5KFVA 4KH0B 1RUSA 5A6PA 1HNIA 4N8NA 1RT7B 3M2UA 2QLWA 4DR2J 1IKWA 4ZHRA 1LWFA 3HCXA 3Q8PB 1QY7A 4HVZA 3UDVA 4NZ7A 2YNHA 3QGGA 2E7VA 1FKOA 3I55S 1XJWB 1JLCA 5KFHA 4DL3A 4DFJA 1M5HA 1S48A 4GKKF 2L9NA 3MUTP 4JV5F 4NA2A 2LQ9A 1VQNS 3UDCA 3G71S 3KYLA 2QJ3A 2J7WA 2W1BA 3VVUA 6FDRA 5EDWA 1KR4A 4YFUA 2VG7B 1NNDA 3TJAA 2VPZB 3EGWB 2JL9A 3KFWX 4J9MA 1F60B 1XR5A 4Q8EA 1MWYA 2OPSA 2GVDB 1IBKF 5D8HB 1QSLA 2FJDB 4CT9A 3POTA 4WBFA 1KQGB 4OYWA 3NGKA 2KFNA 2CQ3A 2AGOA 2AF6A 1X9SA 3VF0B 1NSKL 4NCAA 5C2CA 3EVWA 1UWBA 3PACA 3MEKA 4ZCMA 1S1TB 4X62J 3ZNJ1 3V6DB 1NHVA 2ASLA 3HHLC 1CJKA 3QT8A 1LOUA 2C2OB 2C22A 2IC3A 1CJUB 2MYFA 5KFPA 2SXLA 3FEZA 1MMDA 3K89A 4JV0A 3W2WB 3NP5A 4UQGA 3NNAA 3E8OA 2M4MA 5JVGQ 3KLEA 2M70A 1IWAA 4BHQA 2ALZA 2W4DA 3GR0A 2GJIA 1RHMB 3T6JA 1GK8A 2B4OA 3DOMB 2F7VA 4CM2A 1YRXA 3O8WA 2D1CA 5KT5A 3HKWA 4CNYA 2HPUA 1T03B 4Y0FA 1HBMA 4JBCA 3OJSA 3PYDA 3PRBA 2ZH8A 3OHAA 1JJCB 3TVZA 3ICLA 5B0AA 3JSBA 1I94J 2CJQA 4P7VA 5DLGA 2CQIA 2NUUG 4B3TJ 4P72A 5ETVA 2B4PA 2KRRA 2F3JA 4O44B 2VQEF 3KKFA 1ZBTA 3L7PA 5KFCA 3M6UA 2CQ1A 2HVEA 3K0JA 3KJQB 2J5AA 2UXCF 1YJ9S 4FYVB 4A8QA 2XS5A 2ROEA 3DLJA 3KLGA 1RISA 3H90A 2BKOA 2GQCA 3KLVA 3I96A 2GAGC 1EIYB 1UFLA 1R8CA 4WP3A 2DH7A 2UXDF 2CWKA 3QZ8A 4MKYA 3TR5A 2R7QA 2HNDA 3C6UB 5KFIA 5A8KB 1JNRB 1VRTA 3OSPA 2UVRA 3TVKA 3K57A 2C3MA 1R8HA 4WTOB 4J9LA 4B3MF 4DV0F 3H2UB 1TP7A 4WE1B 4ZVTB 4DSEA 2RVJA 3EWGA 2CJXB 2KT3A 5H1SV 4A47A 4ZP7A 3Q8YA 4LBHA 5HSPA 1MNEA 3R5BA 3Q2TC 2JNJA 4O4GB 1FT8A 4I6WA 3N5BA 1E6VA 4QIEA 4KR0B 1WF1A 4WU3A 3K58A 2DH8A 1RXOB 4DSLA 4ED4A 2DNGA 1S6PA 2YNGA 4ANCA 2KH9A 1SC6A 2LQ8A 2EXUA 3SBMA 1H7XA 1PJ6A 2IM1A 4PWDB 5FD1A 1RAAB 3MCMA 3UCUP 1T0TV 1WOPA 2HIYA 1Y5IB 3W61A 1U02A 4FXVA 5B0DA 4IG0B 2VF3A 3RRKA 3ISZA 3GPAA 1CJTB 2FHMA 4F67A 4L76A 5D78A 3DRXA 3EDQB 1FTRA 3D67A 4PYDA 1TKZB 4EGLA 5F8HA 4V19X 1UVMA 4MMOA 1SV5A 4AL7A 4LF7F 4CDIA 2DD8S 3S8SA 1RKIA 1LWXA 5KFGA 3MI7X 1VR6A 2FVRA 5AE1A 3D3CJ 1S6UA 4B3RF 4H4OA 2ZZTA 3M8RA 2IAJB 2BJEA 2XY7A 5J1NA 3UNGC 3PEJA 4CLFA 5M2UA 1Q7YT 4BCAA 3GQCA 2GX8A 3TZYA 3D1HA 3F56A 2N82B 5E3QA 2OMLA 1WC1A 2GJ2A 4NXNJ 4K7QA 4LIWA 2VFSA 3R7NB 4OX8A 3M4XA 4I6AA 5RUBA 4LRBA 4WFAQ 4TLRA 2JEFA 4NZ0A 3TZZA 1H2TZ 2HGMA 1SI9A 3DXBA 4DWIA 2GVZA 2ZH3A 1S10A 4LVNP 4LVOP 1PAEX 1KDNA 1RWOB 4DXLA 3H4DA 1LNQA 3V2UC 2VJVA 2W2QP 3PYGA 4TYBA 2LA6A 2OUGA 1K8AT 1C1CA 2DHSA 2M9KA 3KJFB 3MAAB 3R3TA 2XMVA 5IQQA 3U1NA 2B43A 3LP1A 2M8DB 2W2NP 1UWAA 3DYAA 2V2KA 4TQSA 2WONA 2GGPB 3OR2B 1HWKA 1KHWA 2XY6A 3GJSB 3U27A 1TR0A 2OHDA 4J9NA 3FGVA 1R0AA 4OYIA 5HK4A 1WHWA 1U48A 3ITHB 4FXWA 4PEOA 2DHHA 5T14A 3KG4A 2UUCJ 1GXTA 2YPYA 2BBEA 1X31C 5E41A 4X4VA 3CJ8A 1SPBP 3MHYA 2RUGA 4DU7A 5JUMA 1CLFA 2HBQB 4X65J 1OY9A 2HWTA 3MR3A 1M5PC 1RB0A 2XSFA 2OIHA 1GX5A 4IRKA 4ICLA 4USIA 3UI3A 2U1AA 2QL7B 4DR7J 2HGNA 3K59A 2ZWOA 5A2QY 1YRUA 3QMQA 3A1YG 4FPIA 1VK3A 1WTBA 5BR8J 1YRTA 4TU8A 4ED1A 1VQPS 3K5LA 3ILLA 4NASA 4M5DA 4X4PA 1T9TA 1XERA 3QGHA 1FWKA 3OTOJ 2QYGA 2IFXA 3M7VA 5HI7A 1KLNA 1QE1A 3CULA 3FDSA 4RPFA 2ADCA 4NLTA 3IWXA 2AMCB 2DKOB 4YDDB 4YR0A 4CLUA 2KYZA 4TLQA 1HBNA 5A76A 3CWJA 3R7BB 4GO5X 3P5TL 2MKYA 2YKMB 1U2RA 3DI6B 1WEYA 4URSA 2BEFA 2IHR1 3CUNA 2VFVA 3L7OA 1WDTA 4UT4A 3CT9A 3WC0A 3A3OB 4URGA 2UXBF 2C2DA 1HI1A 5J2MB 2HURA 3MWBA 4MYTA 5J2NA 1ZAXA 2PI4A 4G1PA 2JJ4D 2HS0A 3ZZ0A 1YJTA 3RTVA 4CLTA 3HT0A 1TQLA 4Y6IA 3TW0A 2DRDA 1S6QB 2DPJA 4PKDB 4CLLA 3HO1A 2NCKL 5KG7A 3C19A 3EUNA 4HL9A 3KLFB 3CCLS 4LR7A 5KT6A 3IM9A 1VQKS 4MK9A 1LWCA 1NJXA 4TXSA 4G1QA 3KHRA 4Z7YA 4EO6A 3KK2A 3C15A 3MXHP 3OL6A 5F8GA 4JI8F 5DDRC 4M5IA 4CTAA 4DFPA 3VZHA 1IKYA 4OJ3A 2VQFF 2LP4A 1F5BA 2RB7A 2ZUAA 5HLFA 4OZ5A 4LBPA 1UW9A 2L41A 1TL1B 2D69A 1B99A 2LLZA 5K14B 4I1TA 1RT2A 1U45A 4ZVPB 2XSJA 2K8GA 4JI3F 5LSLA 2RU9A 4WXOA 3MUVP 1TKXA 4DR2F 2KJVA 2R8GA 1HNXJ 4CO5A 1S0VA 1S9EA 4I2PB 2DNOA 3NBPB 2J76E 1VISA 1WKKA 8AT1B 2OPRA 1RWUA 3MM8A 2Z58B 5EGYA 1TL5A 1R31A 4JI6J 2DGTA 2ZH6A 1REGX 4JI0J 2JLFA 1PYSB 1H73A 2CWXA 1BQNB 3D6TB 1RWVB 2AYBA 1VRUA 3NLCA 1RU1A 1VQ8S 4ZS6A 2XNRA 1CPZA 1LK5A 2K1RA 4OYBA 1Q95G 3MR2A 2DK2A 2GV1A 1OS5A 1D8ZA 2HLUA 3DOLB 1GQEA 3KTQA 3TX0A 4AXIA 1IJEB 4ECWA 5I4MA 3BJYA 4GO7X 4HHJA 2R7TA 2PSZA 2J0WA 1TU0B 1WJ9A 5F8LA 1N8RT 4RLEA 4OI1A 1EHWA 1RACB 2CIMA 2LQBA 1FA0A 4X62F 2UU9F 1S76D 1MMNA 3DXSX 1GMWD 2VG7A 1UEUA 4QCLA 2QRRA 4I69A 2MZQA 5AE2A 3GCXP 2B9YA 4M5NA 4R0JA 1CJVB 3OXFA 5ETMA 2V2ZA 2FY8A 4KPCA 4DUZF 1HNVB 5DZ7A 3N28A 2HGLA 2VC0A 4LQ9A 4BC9A 1U0HB 5KFWA 3MEEA 3PKMA 3T6BA 1PBUA 1SQFA 3QLHB 2W9AA 3H40A 3D0IE 3A12A 2DCUB 3DDIA 4D3HA 1QD1A 4DL5A 2ZZNA 2ASYA 1FX4A 3VR1A 3WIUA 3FCWA 2CPEA 1S1TA 1UA1A 3VAKA 4GKJF 1P6TA 4DX7A 4LF9J 3KG1A 1I94F 4ERDA 2DGQA 4RJVA 3JSRA 1REVA 3CMAS 3EXCX 4TYAA 1GT8A 1YJUA 2ILZA 5CYMB 2DO4A 2C3OA 3R6GB 3M32B 2DHGA 2WZ1A 1X9WA 1NKCA 1HW8A 3TI0A 2BA9A 4M5KA 1VLOA 1N5VA 2EKNA 2OFGX 4NLQA 4PRFA 5J2QB 1R6YA 1Y9OA 5DG9A 3NS7B 2X7IA 4LSLA 2ZH4A 1NMEB 3F44A 4ZA1A 3TOQA 3AY0A 4MIWA 3I87A 2BANB 1O8BA 2CNNB 1D0EA 4ES1A 1VMBA 3QYYA 3CJKA 4CLSA 2RSQA 4XIUA 2XBPA 2K3IA 4DDFA 1UPPA 3FNNA 4XPCA 4RKUC 1ZETA 2RRBA 1D9DA 4OZJA 1IBMJ 2VA2A 5JMNA 1KHVA 1YX2A 1V3SA 1S1XB 3M9NB 3M30A 3V81B 4IO1A 1WD6A 4BBYA 1J5OB 1IM4A 2D9OA 4PPZA 1U8WA 5ETQA 5T7LB 2AJ0A 4F4XA 4DS4A 2R42A 1H0HB 2HRTA 3NGTA 1FRXA 3C6UA 3LGHA 1U25A 2CJYB 4JV2A 1XNQJ 5A8KA 3HFZB 1CS4A 5KFAA 2HK3A 2V69A 5LMUF 2HAFA 1RBAA 2VBWA 4CT8A 4RW9B 1QVFR 4RUCA 3K8VA 3G8TA 3A8KA 4FS1A 1HPZA 1N33F 2HZVA 1NK8A 3QWUA 1Z1ZA 1D1UA 2HNZB 3LF0A 1RT4B 2H5EA 3MDFA 4EFAC 3PX6A 4C2MA 2RKIB 2XY5A 1YITS 2E29A 2PMWA 3TP2A 3O5TB 2NSCA 1T95A 1YHQS 2YKPA 3OUYB 2BW2A 4QPTA 2HVHA 1RGVA 4WKYA 2BE2B 5KT2A 4O4GA 4ED3A 1RTIA 1BD6A 2ERRA 5AXKA 1HI0P 2MPUA 4EU0A 5DO2A 4ZPTR 3JYTB 2KJWA 1HR0J 1VBZA 4YS2A 3PJXA 2DGSA 4JV1A 4AD6A 2MKHA 3D6HB 3RZAA 2DIUA 4BS2A 3C6TB 1EP4B 5D0HA 1X60A 1DLOA 4OHXA 4A8FA 4HT7A 1NEEA 4K0KJ 3IRWP 1WTFA 2BUNA 1XR6A 3JS9A 2F5GA 3DU5A 2HBYB 1RTZA 5CCLA 3FZ2A 1BUXA 2RH3A 4FYYB 5HN0A 9RUBA 1W26A 3E2EA 1F3FA 2AEFA 3FQLA 3QAEA 2QSFA 4NXNF 1WC5A 4IG0A 4KIAA 3C46A 1S9GB 3W9HA 1QLNA 2F8EX 4Z7CA 5B09A 2CA9A 2GO8A 4HHUA 4R5PB 1B3TA 1TKZA 3PXGa 3M8WA 1JB0C 4QWDA 1M0SA 1RTJA 3PEHA 2AZ3A 4OYZA 1XMQF 2CNKB 5KFUA 1RWXB 2YH0A 1Y0HA 2EC0A 3W65A 3QFHA 4NLDA 4ZVSB 4YP3A 2KU7A 2YX1A 1VGYA 4NLPA 3HSZA 1T11A 3QRPA 2DNNA 4GVBA 4NLGA 4CLKA 2O01C 2MMYA 2ZHOA 1N48A 3RB0A 2UUBJ 4F0HA 2PEHA 1IXKA 1PC5A 2EC2A 2KHCA 1WF0A 2VDIA 4MKBA 3FSIA 3J7ZT 3LO3A 1ACMB 3BPDA 1VHIA 3UE2A 2ACMA 4RBVA 3KJVB 2XS7A 4LFAF 3IS9A 5EN1A 4NYOA 3LALA 4RW7B 2FGOA 4NLWA 2MQLA 3UQSA 4NLUA 3AD7C 2AKWB 3HM9A 5IV4A 3CB4A 2HHVA 3IN5A 3JB9k 4DCJB 4OJGA 3ZTRA 3UN2A 1XR7A 4J9KA 2E9RX 2UUCF 7AT1B 1H98A 1S1WA 4OZLA 3CJ4A 3GV5B 1M5OC 4PG4A 2WAQD 1RA7A 4CLZA 4JOUA 3B78A 4RBTA 1I51B 1RDRA 2BQ3A 5IT9Y 3MR7A 3GV7B 3PTWA 1FX2A 2LXIA 1OYEA 3GE9A 1IJFB 1BMQB 4L75A 4YY3J 4ECTA 5KG4A 4Q43A 5H9EK 1WI6A 3HKZD 1N56A 4KHMA 5IFMA 2QMXA 1ZA1B 1PKUA 4DR7F 4YB1P 3TAMB 5KFYA 1YK9A 3K5PA 3GIRA 2X1BA 2GGPA 3T5KA 2VASA 1UEVA 1RBOB 3M8QB 2WCXA 3MMBB 2R8JA 4DQQA 4YB5A 3P45B 3MFHA 5DJBA 4ZVQB 3OQ2A 4O4RA 1PCAA 2AYMA 4DV1J 1RBLA 2V9WA 4CRJA 5MAOA 3EXYA 1N5QA 1EETA 2RD5C 2J9CA 4NPOA 4B3SJ 2K3KA 3QSYB 4DZDA 5A0YB 2CPHA 2YKOA 4DF8A 3LWMA 4J9PA 2KFYA 1NDCA 2YX7A 3AT1B 1GAOA 1T94A 1TK5A 4LFBJ 4ECYA 2IJFA 3DCAA 3UVJB 3OPKA 1R43A 2RMLA 2ABYA 3KK1B 3FCVA 1U1QA 4ZVEA 1SJQA 3BM7A 5KG5A 4WFXA 5CD4A 1NLKL 3TEHB 3UN5A 3RUBL 4HH0A 1SCJB 1LFPA 1F6TA 4EYIB 2E9TA 3CJQA 3CE8A 4RW6A 1RT3B 2R8IA 3DLEB 2CZVC 1FWLA 4P73A 1GMWA 4KQZA 2AP6A 3LAKA 4OZ0A 3LAMA 1R7IA 2E66A 1N36F 4AFFA 2DT9A 4J5OA 3CDAA 3Q8SB 1MG7A 1FKAF 2XCPA 2W2MP 1WC3A 3DMJB 3OTDA 3GFXA 2VDHA 2HQ3A 3SQOP 1T9VA 5CA5A 2VPWB 1X4HA 1K0VA 1MW7A 1HNWF 2FVQA 3OVSA 2MDAA 2DGWA 4IG3B 1SKRA 3K5MA 2DITA 2VU5A 1SH0A 1SKSA 3BS9A 1OPIA 4R8UB 2BE7D 3DOKB 3RAXA 1PYTA 5KT3A 1DTTB 3T5HA 2HHPA 3FZBA 3ZC4A 2EI5A 1SJRA 3F41A 4A8KA 1UVLA 3TJ8A 2ADBA 1QTNB 1N5YB 2KN4A 4XK8C 3V4IB 3H0PA 4AQYJ 1Q8BA 1KBRA 2RDJA 5LOQA 4H4MB 1FVQA 2DVIA 1X5PA 4DR6J 3VWSA 1FJ7A 3KLFA 3EGZA 2R8HA 2VBXA 3WDOA 1VQ6S 3BBFA 1T05B 2KYXA 4A8SA 1A6LA 1EAYC 2MQPA 3G96A 3DLBA 4FYWB 4USKA 3DC2A 5I3PA 4JI6F 3AOAA 2XHWA 4IRDA 3WIVA 3MECB 4ELUA 4ZLJA 3GYGA 3PZPA 3BPSP 2RRAA 2V0NA 1NHKL 3QIPB 3KMQA 3LPEA 5K14A 4MTPA 1DQ8A 1T8EA 1RHRB 2N3LA 1JX4A 2MZSA 3TEGA 4ZN3A 1NAQA 4I2PA 2LU1A 4O0IA 2XZWA 1VQLS 2KZMA 2ASDA 1JNZB 1RADB 1S99A 3MGJA 5M2PA 4B9TA 3TVYA 4KFBB 1ZAVA 4YOEA 4USTA 2BJ7A 5LJ3Y 4LF6J 3GCWP 5I3UB 3BDPA 5KFFA 3CW2C 1UA0A 1IR1A 1FRIA 1TAUA 3BKFA 5L39A 3KOAA 3BEGB 5E3CA 3RU0A 4ED6A 1RYRA 1YJVA 4U8YA 1FFWB 2D9PA 3NCQA 5D15A 1FEEA 1FESA 3IAS9 4PXBA 4F7VA 4FYDA 2ZFHA 3JQMA 1BHNA 3DOLA 3SEOA 3OVBA 3MM5B 5KT7A 1H7WA 2J0QD 2YWHA 2VZ9A 2DYAA 5CYQB 1N5SA 2APOA 2EVZA 3BREA 5BJRA 3R97A 2XLIA 3BGUA 1U26A 1JLBA 3UDLA 1GTEA 2QMUB 1R3NA 3MD1A 3QO9B 3VV2B 4IKAA 2QA4S 3VALA 2N7CA 4LF9F 3G8SA 4C8KA 3ZTSA 3ZZUA 1OY6A 2J6SA 1M1HA 4LT6A 1WWHA 3CC2S 4C3MA 1U1LA 1HNVA 3GSDA 1MMLA 3QQCD 4EK2A 4HT5A 5HATA 4PWWA 2A0FB 3CCJS 5F8NA 3CXCR 1PGZA 2B0GA 1FK9B 5KT4A 4DV7J 2AJ2A 3CVKA 3QLHA 4MYUA 2HQDA 2V50A 4HR2A 2M3DA 4NLXA 3VAFA 2D7SA 1RWNB 4C0BA 1OJ4A 2QMWA 3N6MA 1IBLJ 2ZUGA 1IKXB 1Q7LB 2F4VJ 4CH7A 1JLEA 1DFDA 3ETOA 3BF4A 3R5JB 4EI2A 1Y3KA 4P2MA 1G2EA 3VVTA 1TUWA 1YBUA 1PJ7A 1N5TA 1IBMF 3DDKA 3QJLA 1U0SA 5G0RB 2HVZA 3ZNUA 5DETA 4U7CA 2FJBB 3H7HB 2CUYA 1NDLA 4ECUA 2W2OP 1RT6B 2RDDA 1TVRB 4CZCA 4DL2A 3GIJA 2RE1A 2M7SA 2W8LA 3IG1A 4ED5A 2VOOA 3MPWA 3GONA 4FKYA 4KT0C 2BKNA 4PQUB 3JQKA 3VAIA 1RHKB 1S7IA 1X0PA 3EVOA 2B4VA 3ZTQA 2BANA 1XNQF 3N79A 2W9BB 4TQRA 3I31A 4DG1B 3SQGB 2R2SA 5E0OA 5CXTA 3KHLA 2Y0BB 3MF5A 3PR5B 1FKPB 3QPIA 4DF4A 1NU4A 2XMKA 3UO0A 4N56A 2IM3A 1KQFB 1UZHA 4DMZA 5C2GA 3NY0A 2LVWA 1M1KT 2DNHA 4YQWA 1JKHA 3V81A 1BGXT 2MSTA 2WVDA 2Z2YB 2DB1A 1J5OA 2C2MB 4OZNA 3NXZA 1FWPA 3I0RB 2MXYA 3M2RB 1XNRJ 3R6LB 1RCOB 1T02A 5SZTA 2AJQA 4HDHA 2VG5A 3BN7A 4QYZK 1YJRA 1HR0F 2O3DA 4DV6J 2FZKB 3E01B 4WJBA 2GIFA 1ZA2B 2E5LJ 2IVYA 3FQKA 2GMJA 3D66A 4IQMA 4RW9A 1YJNS 2BKPA 3OFEA 1WUUA 1VK8A 2OH2A 4J91A 2OSQA 2KI2A 3BGFA 3DRYA 1YLXA 3AB2B 1OWXA 1JIHA 2NUHA 1RT4A 4ZCKA 3GP9A 5B0FA 3DM2A 3EE3A 2R9LA 1F0XA 2GFFA 4M5JA 3CEDA 1RABB 2RKIA 1X5SA 1YKWA 4DPWA 2VL1A 4IO9Q 3GWCA 1QJHA 4M5LA 3CCVS 5CQGA 1TK0A 4GKKJ 3OUYA 3BBBA 4JV5J 4ED2A 3NOCA 2D41A 3PX4A 3RB4A 2J8AA 4C8NA 4KPYA 1RK8A 1L3SA 2L9DA 4PABA 2CNOB 2QL5B 2RJZA 2AJ1A 4ID5B 4ZP6A 4OI2A 1JJ2R 4RX6A 1NSAA 3CCWA 4DR3J 4YR3A 8ATCB 5JXSA 2CAJA 3HD1A 1FRMA 3PR4A 1M90T 1KKHA 2FJWA 4QR2A 1KTQA 1S9GA 3DRRB 4ILMA 2Y1IA 4R5PA 1O0PA 1FXLA 2ZH5A 1YGYA 2HWHA 3AQOA 4UOHA 5IWAF 2GHWA 1Y00A 2M8HA 1Z2LA 2VA3A 2DEJA 2QFIA 3FBBA 3MM7B 2BMBA 2XLKA 2FLOA 3D6MB 5CZXA 2BM1A 4WF9Q 4DN0A 3QBCA 4QOTA 4W92B 1FJCA 3P96A 4DV2F 3CC7S 3C14B 1S77D 2C28A 2ZH7A 2DGVA 1URNA 2J0XA 2MQOA 1AYEA 3KJVA 3CO9A 2XWXA 4USMA 2WSEC 4A8XA 4O3NA 3MMAA 3SSQA 2Z4PA 1G3OA 2FDNA 2FJXA 4HACA 4DV1F 4F02A 1T9UA 1HMVB 2XHCA 4XAKA 5DZ6A 4B3SF 1HNZF 4K4YA 4DQRA 3X3UA 4OI0A 3MEDB 2ZJQQ 3MM9B 2VQEJ 5IT0A 3MR5A 4EWTA 3U1LA 4Y2CA 4TU9A 2PMHA 2Y1LB 4E2FB 2E1CA 1RTHB 2UXCJ 3IP0A 3Q8QB 5K8PA 4QWEA 3TAMA 2FGCA 4ZVFA 1H6KX 2CQ0A 3M8QA 5FLXY 4Z2XA 1RKJA 3TAPA 1S5ZA 2UXDJ 2XQCA 4DV5F 2IJNA 1U7LA 5K20B 4ZMMA 5I42B 5L9NA 4F04B 3FSYA 1UEKA 2IRXA 5A0YA 4E8UA 5J1PA 4AUKA 2RF2B 3NG8A 4DR5J 1QVGR 3LANA 1KD1T 3IBFB 2B51A 3BSAA 1D8YA 1L3VA 2XI3A 3TYTA 3W60A 1NK7A 2ZBQA 1WNEA 3MMCB 1V5IB 3KK1A 2PT0A 4DJBA 3NCPA 1FRKA 5D0EA 3R7SB 4DUYJ 2FIUA 3OTBA 3NAIA 2NS1B 1KQSR 1HWJA 5L1KA 3JQJA 2NPFA 2LCWA 3AH6A 4AL6A 1SIZA 3T5JA 2GQQA 2XNQA 2VHGA 3PVXA 2GIRA 1RTDA 3CCES 4OHVA 3PV8A 1U2FA 2QN6B 4C0OC 2V67A 4EBEA 3HULA 2ZHBA 1W25A 2YWWA 3W7BA 4IR1A 4A8WA 4DR6F 2Z30B 3HVWA 1UFWA 2P5VA 2JEIA 1KC8T 1UPMB 2VBYA 4ZPBA 2I5JB 4CO2A 2FB0A 2KXFA 4EBDA 4FDFA 1TL7B 3CCQS 1TUGB 3F0NA 3AOBA 4IG3A 3JTPA 2QIFA 3C3LA 3V6KA 4ECSA 3PYEA 1DTTA 2O67A 4J9VA 5IXUA 1HWIA 4WXWA 4KB7A 4KJIA 3ISNC 1NZ8A 2FVSA 2E44A 1X8DA 1B64A 2XGQA 2DRAA 2VH7A 1QM9A 4IFYA 3J7YU 2IVFB 3GIMA 1CEZA 3FMBA 4H4MA 4B3RJ 2BW7A 3M9OB 5KFKA 2W7OA 2PFDA 2B9XA 2YX4A 4EBCA 2MHEA 2D3ZA 1FXRA 4DZ6A 1KLMB 1RCXB 1KNZA 2FY1A 3BYPA 3GFHA 4B9SA 2KVQE 2GA7A 4DSIA 2FLLA 2R7WA 4QIVA 4LF6F 3DRPA 1K9MT 4C3LA 2XEXA 1ICEB 1SIWB 4B9VA 3M8YA 5HQ8A 3UPFA 3MEGB 1SUQB 1R8PA 5GMEA 3PYFA 1YG0A 3I0SA 4DUTA 1N6QB 1AA1B 2RHSB 3G2XA 1Y5LB 1CULA 1F5AA 4DOZA 4KV8B 4AT1B 1LW2B 2JC1A 1NSPA 5J2PB 3NGRA 4N8OA 3Q86A 3GMGA 4A48A 1FDDA 4OLOA 4K59A 3KNGA 3QIDA 4K4XA 1B7FA 3UNYA 3FKBA 4LR8A 4M1KA 1SB6A 2CG8A 2YY3A 1GH8A 4FF2A 1T3NA 4XDDA 4USUA 4DSFA 2CQCA 3ENWA 5JJBA 1NK6A 2XULA 3V5RA 1T9WA 4DV7F 4URQU 1U4BA 2ZBCA 4ID8A 2MGZB 5E5NA 2ZKTA 2C2RA 5CYQA 4MJKA 2CG4A 1CVJA 4F50A 4NEZA 1PSDA 3OR1A 4ZK7M 1NO8A 2MHNA 2XMUA 4FF4A 3VTIA 1IBLF 4Y2AA 2I1RA 3D0GE 2R4FA 3NWRA 5LMNJ 5KG6A 3TQ1A 1NH7A 2IMOA 2R7SA 2B8QA 2HHWA 1GNKA 1NKBA 1G6BA 1DY3A 3RJMB 3IGNA 3QATA 3VCDA 4QYRA 3T1YJ 1W2IA 1M1GA 4OV1A 3UFCX 1PILA 2AQ4A 1S79A 3CNQP 1KFDA 4J9OA 5ADZA 4FNIA 4DSJA 2FLPA 1FK9A 4LRDA 4BDPA 3DRSB 3QJJA 3R5DA 4F3OA 2YNFB 4TVAB 2ZDOA 2CPDA 2EG2A 4ZLPA 1AXQA 3PW0A 4OJHA 2BJDA 4BLGA 1HIYA 5CCMA 3MUMP 3Q24A 4YDXA 4KGMA 2K2PA 1RJJA 4Q8FA 1LWEB 2ZKUA 2DO0A 2Q66A 3D68A 1JLAB 4CO1A 1F9HA 1MWZA 4P74A 2AIRB 5DG8A 4QU6A 2BX6A 2QTWA 2X1GA 5F3ZA 1KEKA 3N0VA 5G0RA 1SC1B 2F4FA 2WVEA 3VAGA 2G4BA 2CZ9A 3I4PA 4NMXA 1CC8A 1TVRA 1ZPWX 5EHHA 3I4HX 2OPQA 1JXEA 2M52A 4I0WA 4M94A 4JI8J 2V8VA 2KVIA 1YIJS 4DV6F 3KDNA 2WRMA 2V8DA 5KFRA 1WKJA 4DS5A 2V2QA 2FHJD 4MKVA 2W9BA 4DG1A 3BDEA 2C3PA 3MCNA 1TZ0A 4D3GA 3CD6S 2ALYB 1JLGB 4JI3J 1FKPA 3R1LA 1QUVA 3OFHA 2HHUA 3MTKA 4PYAA 5F0WA 5GADU 4KTQA 2J6TA 1GX6A 2WOMB 3CJRA 4EO8A 4LF4J 3CGIA 3CF5Q 2YTCA 1ULRA 3I0RA 1SQGA 2HFSA 1N4LA 4RUHA 5LXRA 4U67Q 4CLYA 3MOJB 1F9EB 1X5OA 3TUZC 1V6HA 5ETSA 4WFZA 6AT1B 5CD4H 1NDPA 1WF2A 3MM6B 4G1IA 4F2SA 1B0VA 3B4MA 1EJ7L 4J37A 4DR3F 3K7RA 4ECXA 3CDUA 2OEKA 1HQEB 2RAQA 3SDEB 4MFBA 2JWNA 4DX6A 5E3RA 1V3ZA 3RW7A 2FZGB 1W7WA 4GVLA 1AB8A 1BY9A 4ZVOB 2VPXB 1HWUA 3HD2A 2PN6A 4KO0A 3WC2A 3NNHA 4WU2A 3QGIA 3R5CA 5MLCV 3PKYA 1YWXA 5F8MA 4K4SA 2AU0A 2UU9J 4KHPJ 3FEXB 2DNMA 1B7YB 1S1UB 1OIAA 2J0SD 1IBCB 2B9WA 2DNRA 1T3OA 2H9ZA 4Y28C 1ZYQA 3LP0A 2AJ4A 4TN2A 3R2DJ 3CD7A 5HQLA 4WFYA 3IMQJ 1HARA 4DUZJ 5IQ6A 5HVGA 1SL1A 1N34J 4IYQA 3QZ7A 1V3RA 1BQMB 2I0XA 2CQBA 2M88A 3TZWA 5F9LA 4X84A 1KONA 3OW2R 2H4YB 1Y5NB 4WK1A 1Z2ZA 2HWIA 4Y3CA 2G2YA 3WHIA 3KDOA 3M6VA 1DBDA 1FNOA 2O1PA 1AZSA 1DAXA 1FCAA 3IRXA 1WG4A 2PE8A 4GKJJ 1IM6A 2YNIB 4QR0A 5HMYA 3LW5C 3FFIB 2Q6BA 3HHDA 4RNNA 3D5MA 1H38A 3KNAA 3PFOA 2IJRA 4OL8A 2DGUA 4QIGA 3C14A 2V4QA 4LF5J 4C7QA 5H9FK 3HFKA 2BQRA 1QTMA 4Q0BA 3ET6A 2FUG9 3CJ2A 5U47A 4MKAA 3D7SB 4ZDNA 3W8GA 3O1LA 4U6PA 1HNIB 1KOOA 4JI7F 3M2UB 3AQPA 4ZVUB 1IKWB 3T1HJ 2KKHA 1LWFB 1K1SA 3GJRB 1MSWD 3JSYA 5DLFA 2V9KA 2YNHB 1VRQC 4DN9A 3MAQA 1FKOB 2O5DA 3ZZYA 1SQEA 1ZM4A 2DXDA 1FF2A 2H51B 3M8PA 1FFGB 4B02A 4LQ3A 4PXEA 1XEZA 4DR5F 4FF3A 1YBTA 1FO1A 3A3PB 4P10A 1RTHA 4MIBA 3ILOA 2OPSB 2JX2A 1RT5A 4DUYF 2ZE2B 3EPGA 1KN6A 1VC0A 3WZ0A 3TA2A 1C0TB 2N7YA 1HD1A 3POTB 4ENOA 4NA1A 2DHAA 3R1HA 5CZVA 1RP5A 2H48B 4J7CA 5AE3A 3J7AN 3LOUA 3VAHA 1J5EJ 3R5AA 2HHHF 1ZH5A 1KRPA 2E1MC 2GCFA 1N0VC 2F9DA 2EFOA 1UWBB 4A46A 1U1MA 1QAJA 5LMUJ 3SFUA 2HNYB 2G13A 3NOGA 2RF2A 4P2FA 5KFJA 4NCGA 1CJKB 1FXDA 1RLCL 1N33J 4F4KA 2IC3B 2GIQA 4LF8J 1OSCA 3Q8VA 3TAQA 3MMCA 2W8KA 2VG6A 2DXFA 3NGDA 3AXKA 4PXCA 1UAWA 3FEYB 3CC4S 4DR1J 4CNZA 3C8YA 4MIAA 2EEYA 3G82B 3CCTA 1U1NA 2V8PA 3PRDA 2IDLA 1HBOB 4Q45A 3K5NA 1OSDA 4ZVGA 3H8YA 4ZLLA 2H5IB 1SXLA 2E5GA 2AHOB 5HO4A 1N32F 4ILLA 4JI1J 5GAHU 4N41A 1FJGF 2QA1A 2ZJPQ 3QRRA 5FLXU 3H98A 4PZVA 4KGKA 3BQ1A 2QX0A 3D6FB 5E33A 4J9QA 4DQIA 2KRBA 1TL7A 3PX0A 3W66A 4ZJOA 1X4GA 4DHVA 1JLFB 4OI3A 2J9EA 2R7RA 1FJEB 2OD4A 1GMVA 3OLBA 3O44A 1F5CA 2QLBB 1S7HA 4QIWD 4JYAF 3HK2A 1XMQJ 5FDLB 3NL0A 3TA1A 3HMJG 3KLGB 5GMKa 1LKZA 5THWA 4X4RA 2HLTA 2WTFA 4IOAQ 1X4EA 3MD3A 4N77A 2HBRB 1C4CA 2IBKA 1JQGA 4Y2MA 2HNDB 3B54A 2MJUA 3PIPQ 3ZZOA 1VRTB 4XDCA 1H2VZ 5DDQC 2FYXA 3TARA 4RW4B 3HP6A 4LFAJ 3UN3A 2X51A 5DQGA 2W9CB 3K8WA 3P3DA 5HBMB 5KFMA 2E5JA 4WYWA 1MWQA 1ZTWA 2RHQB 5D6GA 3G8QA 3RBZA 1DHMA 1RI7A 4X4SA 3NRBA 1E6VB 2FHJA 2CQHA 1RAOA 4ANDA 4C97A 1RAFB 1S6PB 2C3UA 3GG1A 3OVAA 1B0TA 1L5UA 1E6YB 2BRLA 2F63A 2FJEB 1XMOJ 3CPWR 2IM2A 4NWBA 4I7FB 2ZOMA 2VFUA 1H2UX 5ETLA 3HVTA 4C8YA 2VJUA 1Q8IA 3R27A 1AUDA 3G87A 1P27B 1KVJA 5LMNF 4J9RA 1VBYA 2HHSA 1WC6A 4RO0A 3N01A 1O51A 2R3VA 4C6AA 3DKDA 5K8MA 3TANA 3RR7A 3T1YF 5HROB 1JXVA 4YHHF 3SI8A 1SV5B 3BGRA 1F2HA 5HVHA 4FBTA 4F4YA 1S9FA 2C2NA 2ZOGA 2HRYA 3LGNA 4ED0A 3R2CJ 2QLXA 2YKNB 2FVCA 1RHUB 4H4OB 3RRGA 1EARA 3IM8A 2UUWA 1C2PA 2KT5A 3IA0A 3ZXWA 5E3AA 1ZM3A 2MY8A 3R9LA 3HJVA 3DGPB 4F3MA 4CLWA 3I5BA 1HYSB 1A9NB 2G2OA 4GMKA 3HVRA 2MLXA 2V8HA 2IVMA 2EWHA 4P7TA 4DQPA 2GVZB 1N36J 2NYIA 2ZHAA 2ZH9A 3BO3A 2CQDA 3JSMA 1VHFA 2MY7A 3DRSA 3D0HE 4C0HA 4KGZB 4ZPCA 1HNWJ 3UD5A 2YNFA 4OI6A 1APSA 2WW8A 2CFXA 1YQHA 2HMIB 1C1CB 1U2CA 2MQMA 2K7KA 4HLBA 2G2ZA 1XBWA 1TL4A 1YTYA 2RQMA 4H4KA 3TWZA 3M8SA 1IQZA 2RQ4A 1HL6A 4IQXA 4LSNA 2I8EA 3G9CA 1LWEA 3DYAB 2OI2A 1XN9A 2WONB 4N76A 4A8MP 3CD5A 3DLGA 2YWFA 3SXLA 2JEGA 1JLAA 3FSXA 4LFCF 3LTOA 4USJC 3U1MA 4RNOA 2QLJB 1R0AB 2VPYB 1A7GE 3S7RA 1TV6B 2BOPA 4DV4F 3HPOA 4R0EA 4LF4F 4NLVA 3O6QA 1KTVA 2BXJA 5K8OA 4O3RA 1FI4A 4F26A 1K44A 5GAGU 3QNWB 3EZ5A 2B6AB 2ZWPA 3IGVA 2P6TA 4NXMF 1YSJA 3W2VB 2JC0A 1RSCA 4QU7A 3HDSA 2EKYA 2ZM6J 3AODA 5A8WB 2VBZA 2A1BA 1CBKA 2Y3YA 4HI2A 1RWKB 5M2RA 3GYXB 1RT7A 3G4SS 4JI4J 3D9BA 1LXNA 3THVA 1M5SA 2E1AA 1QE1B 3QWPA 4QW9A 1PC4A 3IC1A 1ZM2A 4JUZA 5F0UA 2IYIA 4JB8B 1UTAA 3OL9A 3D1OA 4RZRA 3AJ2A 1VI7A 3ZZPA 2X1AA 3CDWA 3LP2B 1HBUB 1KOHA 4WYLA 4KHPF 3W5YA 2HEKA 5HVFA 4IH6A 2V4JB 3MM6A 2XWYA 1H3DA 2QO3A 4F4ZA 1KWMA 1XWLA 3I32A 2Z56B 2GVDA 2DTJA 1HKAA 1NH8A 1TTHB 4Q44A 4YB7A 2IIHA 1N34F 3PHEA 3KK3B 5B7WA 4N7TA 3OLAA 3EYZA 1GMUA 1HQEA 1Q81T 1AT1B 1NDKA 3SDEA 4LJMA 4UOFA 3IR5B 1ZZFA 2OEMA 2PA8D 4YMEA 5LT5A 3KUEA 5D4LA 2KG1A 1TL3B 4C8OA 1ZAWA 2DGOA 2EK1A 1MU2B 2AEJA 3IBCB 3QSIA 3MCSA 2ZDPA 2UZAA 2F8MA 1RQ0A 3V6DA 1S1UA 2BZ2A 3MPVA 2KXHA 1CJUA 2HS4A 3H25A 1IKVB 4PG7A 3FUYA 1N54B 3T9ZA 3BR8A 4M5GA 3NAHA 1NPPA 4NLOA 3W2WA 1IKYB 4ZITA 2LDYA 4CCHA 1BQMA 2VONA 3N6NA 4LF5F 3CJ3A 3G6XA 3SV4A 3O3LA 2BOAA 2PD1A 1RT2B 2P9EA 2XSJB 3DOMA 3PIOQ 3D3BJ 2QC3A 1TKXB 2EFPA 3T1HF 2KXNB 3I9ZA 1WDDA 4F4WA 2CRLA 1T03A 1S9EB 2FHKA 1AUSL 3DHXA 4DL6A 4G65A 2QG9B 4K5RA 5T41A 2RIJA 5L1LA 3CCUS 3MM8B 2Q79A 2CPYA 1S97A 4O44A 7FD1A 2AEMA 1C4AA 2LEBA 2GNKA 4FZVA 2E7XA 1EKRA 4WIIA 4WCEQ 4K4ZA 2RS2A 4Y34A 2K1RB 4OFZA 5GADI 2VOPA 3GILA 2DCLA 3TNVA 4XPEA 2MZ1A 3C16B 3HHLB 4H54A 1J5EF 1VQSA 3D1QA 5H9EJ 5K5MA 1HHSA 2A2DA 2WHOA 3EMTA 4E98A 3GR1A 4LRFA 3Q8RB 2JHEA 1FVSA 1HHQA 2Z2MA 3D54A 2B4UA 2ILYA 1M5KC 4M63A 4DPYA 4LF8F 2ZOFA 1FHTA 4WE1A 3QT5A 1FERA 4NI2B 2W4PA 1HLWA 3CJ0A 3FBFA 2Y9HA 2ZE2A 2OKQA 2Z57B 4DR1F 3RBDA 1C0TA 4QBUA 3N4WA 1YJ7A 3LWLA 2BRKA 2PFFB 3J7Z5 4KC5A 4GC6A 5C7PA 4WZMA 3MEEB 1Q8KA 3H2LA 4OIXA 5DS7A 4CO4A 1D3WA 2JOQA 2JEJA 3BGLA 1RYSA 3ILIA 3AFGA 4JI1F 1X7VA 2H4WB 5DQIA 2DISA 4KGVB 4UY8T 4PWDA 1NK9A 2HNYA 2Z2ZA 3C2PA 1S57A 1UP1A 3RYLA 1BWVA 1REVB 2JRSA 2ZBRA 1WSRA 1J2VA 3SZ2A 1SL0A 1U6BA 5C24B 1I6JA 2NSBA 1CJTA 2HFUA 4KKOB 1U1RA 2RDIA 2G0IA 3GLJA 2DNQA 4ED8A 4KBIA 3CO0P 3OTCA 3B82A 3FC9A 3Q22A 1Q53A 2Q43A 3G82A 2YWGA 2RNEA 3T5LA 1OMSA 1KQKA 1UVIA 4C11B 1ROFA 1HBOA 5KOXA 2CYYA 2FPHX 2LYVA 4KYZA 2HZCA 1IR0A 4X64F 3VHQA 1QAYA 1VQ4S 2DNZA 4LSLB 1B4SA 2D3OR 4OX9J 2G1DA 1RA6A 4ZCIA 4PR6A 4DPTA 5C25B 3CMQA 2HZAA 1S59A 2NQPA 2IAJA 4B9UA 4FKXA 3CJKB 2ATLA 4TU7A 5I3QA 4I64A 5IOLA 2XMMA 1MN7A 2WVBA 4TY9A 2XMAA 1JLFA 4OZ2A 4I67A 5D3GB 1P1LA 2P9CA 3RB6A 5J1EB 2C1EB 3HLUA 3B4DA 2V68A 3P49B 4YN3B 4HH1A 4DV3F 3M30B 5FDLA 2EBEA 5IWAJ 2MKKA 4U7UK 4KAIA 1DTQB 2KT2A 1UJ6A 2NLWA 3CD0A 3L7UA 5B0GA 4QZVB 1ZPVA 5IC6B 1K73T 3EPIA 1FD8A 4DL7A 3NGSA 2AD9A 4ZJLA 3TUPA 5HQMA 5GMDA 1M5VC 4DV2J 3DLKB 3MAAA 1CS4B 1RAIB 3VAMA 2J9DE 2GHPA 3W8PA 4ATNA 1XMOF 2B7BB 4RUBA 4RW4A 1Q86T 1HPZB 3HHLD 5IM0B 3W5ZA 4WP8A 2AX0A 2F8HA 5BYSA 4MK7A 2R7XA 1L3TA 4USVA 4K50A 3OR2A 5HP1B 2W9CA 5D4PA 5HBMA 1O6XA 3ITHA 1YI2S 3IR7B 4OHWA 5BYRA 1R27B 4OYMA 1HNZJ 1RTIB 1WC0A 3EX7B 2G9OA 3CCZA 2J7UA 1P1TA 4B9MA 1U1KA 2A18A 4TY8B 3N9UC 2FZCB 2VB6A 3N6LA 2DR6A 5HANA 3SCKE 1DLOB 1E6YA 3KLIB 4RUAA 2YWKA 2HG4A 2LU2A 1SJ3P 4I7FA 4JI5F 1EQMA 2FTRA 4DI6A 5DGBA 1U24A 1XC9A 1KP6A 2ZNZA 2ZBPA 1IVZA 3HT3A 3W5XA 4ECQA 2L08A 4PAAA 1S4FA 2WVCA 2PDAA 4DPOA 4DV5J 3HZEA 2QA2A 3OV7A 4I56A 2GAHC 3WQPA 2CKWA 4P2XA 3GJQB 3RGIA 5HROA 1RTJB 3FBEA 3SIPB 3J7A1 2CQPA 3FRYA 1MN9A 5GAHI 5F8IA 1U1OA 1TFYA 3I9V9 4CI0B 2YKMA 5KAKA 4GVBB 2EBGA 3DI6A 5HJYA 1T9YA 3EVMA 2YKNA 3LPYA 4X4TA 3SCJE 5C42B 4RU9A 1JLQB 1UJ4A 3CCRS 3OXGA 1HD0A 4PCQA 2G1HA 2LA4A 5J2MA 1IWGA 3A4TA 1DARA 2K06A 4PWUA 4RWWA 2Q3PA 2D3UA 3R8YA 1ZZNA 3IS9B 4KRWA 3DGPA 1U8SA 1FFSB 4XO0A 4FYXB 2MKJA 1HYSA 3P8BB 1S6QA 3JTOA 4NX9A 5AXNA 3PW4A 3M8ZA 4U8VA 1S1WB 2XCAA 2NYHA 2DNPA 2L9WA 3CJTA 3QRQA 3KLHB 4X66J 4M5HA 4ECZA 3CJSA 5F41A 2LQJA 2C2EA 2HMIA 1TFWA 4ZPWR 1HFEL 5AJ3F 2PO4A 3CMES 2VICA 5G4DA 5A8RB 3UDEA 4C3KA 5C5JA 2ZM6F 1P9YA 4HYKA 5HMZA 1TL1A 3Q0AA 5LM7E 1Q4RA 3Q89A 4OX6A 3SCLE 2Z0GA 4JI4F 3CIZA 2F9JA 2A10A 1UMJA 1EETB 4IH5A 1TV6A 2KZZA 2UUAJ 2FJVA 3NBPA 4DFMA 3KUHA 2NZCA 5DDOC 2XGPA 2DNYA 3OSNA 2PIIA 1S6OA 1G7CB 2MTLA 4PQAA 2B56A 2H3EB 3A8EA 1R8BA 3H42A 3US5A 2YQ3A 3UD3P 1QAIA 3I56S 4Y2KA 5DQHA 2B6AA 3CCSS 3TUJC 3AJ1A 2DY1A 4F36A 2DR9A 4V1Ak 4OYAA 3VGSA 3W2VA 1BQNA 2Y1JA 2H1YA 2B5JB 2I2YA 2C2KB 1N88A 5KFZA 1SH3A 5A8WA 3RG6A 2RQCA 2M0GB 2VUGA 3PJWA 1F9FA 1NCLA 4QYZJ 4RW6B 3QFWA 2JVOA 1FEHA 1TMJA 5DM7Q 1EX8A 4Q2MA 3BKTA 4UUWA 4TKTA 2ROGA 1DQ9A 2KM8C 2GJFA 1UZDA 3BQ0A 2OMOA 3UD4P 3LP2A 1HBUA 2CVIA 1UW4A 1JJ4A 1S0OA 3IXQA 5ETKA 1WKLA 2R8KA 2V4JA 1FRLA 4LBIA 4G6VB 3FVYA 4NLYA 3N5FA 1T7PA 2QFJA 1CJVA 3V4MA 1WHYA 2OLWA 1VS3A 3MCOA 1SKWA 2BJ3A 1FDBA 2H54B 5D0GA 3KK3A 2I9SA 5FJ4A 3SSSA 1U0HA 2NXUA 2MZTA 2W01A 1VQMS 3QJPA 5HMXA 2XM3A 4TNOA 1TL3A 3RAQA 1JMTA 2W24A 2HHQA 5EX3A 1MU2A 4FXDA 2IA0A 5ETOA 1WSVA 3OTEA 3PW5A 3H2VE 1S72S 3L3CA 4B3OB 1IQTA 3ENVA 2IBOA 4P2SA 4ES2A 3D2WA 2V94A 4LF1A 1SJFA 2LECA 2K7JA 1IKVA 4C9DA 4IDKB 5E7OB 2UVWA 3AOCA 5CYMA 1Q8LA 3BSNA 2A6MA 1NK5A 2JVRA 3M32A 4J90A 4K2JA 2CJKA 5LSOA 4R25A 3T1AA 1I1GA 4P9SA 4ZIVA 3NGUA 2BJ1A 3GIKA 1NKEA 3WX8A 1DJ0A 1MLAA 1RWMB 5J2QA 1TK8A 4X4QA 2ZD1B 2QEXS 3GFZA 4FF1A 2P8IA 1VOMA 3IWLA 1S49A 1AFIA 5GAGI 2UVUA 3M9MB 3IAM9 4ZP9A 1SC3B 4PUOB 2OP5A 3LH2S 2NPIA 4J9UE 2V34A 4WFNQ 4I2QB 2VFRA 2V8GA 2ZVIA 4Y65A 2RQKA 3SFGA 2MJNA 3D28A 3U02A 1S1XA 4BWMA 2V4RA 4NA3A 2CJAA 3L95X 2EK6A 3HFVA 3P4UB 5T7LA 1LW0B 4DPXA 3UR0A 3MMJA 3Q23A 3GJTB 3C16A 4QWCA 1Y4ZB 3HHLA 4LR9A 3UR3C 1YZ7A 2XO6A 3KUGA 4K4TA 2MLZA 3HSDA 1NHUA 1JLBB 5ETTA 2XMWA 1X4AA 4U95A 2W25A 2ASJA 2MQ8A 3NEKA 3HI9A 2B3TB 4L3NA 1OQ3A 2HNZA 1MROB 5HJXA 4G3IA 1VC5A 4NI2A 2NZ4A 4DFKA 4NEYA 1UVJA 4F8RA 2GHVC 4MT1A 3EDRB 3ZFVA 4PXDA 2BE2A 3IFEA 4YUDA 4RR5A 1BLUA 4DPUA 1I3OB 3JYTA 1RU2A 2XZDB 3BO2A 4OYOA 2BACA 3C6TA 1EP4A 2DNLA 2FC8A 3ENAA 4USHA 2BR0A 1AFJA 4OX9F 4A4JA 3EGVA 1NBEB 1X4CA 2AYEA 1JLEB 3P5BP 1KS2A 4Z37A 4B3TF 2J8SA 4OQJA 4EUVA 3GTYX 3ELHA 5C24A 4DLGA 2KO1A 4KKOA 2ZC4A 5KG0A 2ZC3A 2XZTB 2ZH1A 4DBQA 5LL6d 3HSGA 3OFFA 2JSXA 5KFQA 3RAMA 3M2VB 1UCNA 4C11A 4CWBA 5L1JA 1X4FA 3HHKA 3IG1B 3RRHA 2WB4A 1J27A 4UTGA 3H59A 2VV5A 3OD2A 1NJIT 3FRZA 2HYIB 1BXNA 3Q2SC 2YQ0A 5BXIA 2FJAB 3CDBA 5C25A 5LJ5Y 5CH7B 1IN0A 4ZOSA 2B7CB 4I68A 4USWA 1R8AA 3RB3A 3OL8A 4OV6A 3BO4A 3FCHA 4WWSA 5D3GA 1FNMA 4F0KA 2OAUA 5J1EA 2Y8WA 4RW7A 2BVZA 2EW9A 3EJMA 4X4OA 3K5OA 1FD2A 4DCOB 2DRBA 2QZ8A 4W4MA 1JKHB 4CIOA 1DTQA 4NMLA 1RT1B 1R89A 4K5SA 3EGNA 3PM9A 5E3PA 2MKCA 3HSJA 2ZBIA 2WBRA 1S0MA 3RBXA 2VG5B 4K4VA 2LEPA 4DQSA 2X1FA 4DLEA 2HW3A 3KHHA 2PGCA 5KFEA 2MKSA 2RILA 3EZUA 3DLKA 5IT4A 4WZQA 4J9SA 4LRAA 3THTA 2V6AA 1TKTB 2XG8A 2CXEA 3TO8A 4CH0S 3KHGA 1H74A 5IM0A 3W64A 4F25A 3L4BC 4JI7J 2LMIA 2CJBA 3MMBA 5HP1A 2F65A 3HF5A 3DM2B 2QL9B 3HHEA 5EUHA 1RWPB 1PYOB 5ITHA 1S12A 2OTLS 1OYDA 3FJ2A 2AZ1A 3G6ES 4OJ1A 4C98A 3BBCA 2NXNA 2CADA 1XQIA 2AV5A 4LRCA 3H5UA 4M8LA 4ZVHA 4TY8A 2RRNA 5F3TA 1EZZB 3QT6A 1IUJA 2XYHB 5SUHA 3I6PA 3UVJA 3S6EA 4HDGA 3KLIA 2BDPA 2HIQA 3BB5A 2OJ3A 5GAEU 3A8IA 2IPOB 3TJ9A 3T9NA 2YKAA 3OT9A 4U9RA 4IUFA 3CIMA 4UUXA 4FBUA 4QW8A 4IFVB 4WP9A 2ACYA 3ENQA 4B9LA 1U6ZA 2HHHJ 4ELTA 5L1IA 5IV3A 1RT3A 1N0UA 3DLEA 1C1BB 1WHVA 4QWAA 1OQ6A 1HA1A 1VBKA 4HHHA 8RUCA 4FPRA 3DMJA 2HBZB 5HAOA 1S0NA 2LDIA 1HQUB 1DURA 4X66F 1Q82T 2Y0SD 3A13A 1YJWS 3GG0A 4RBUA 3NKYA 5C42A 4R8UA 1JLQA 1S4EA 3DOKA 1VBXA 4A8YA 4EEYA 4EMDA 3AB4B 3BH7B 4DEZA 3M1VB 4Y2IA 2WK4A 3MMAB 4CYUB 5K8NA 1N5YA 1W2BR 1N32J 1P8GA 3W62A 3M6XA 3V4IA 1FJGJ 2CPIA 4HACB 1NUEA 2WW4A 3IR6B 3T41A 1UVNA 1VQ5S 4I6YA 1D9FA 1NSQA 2FD2A 1RAJA 2UUAF 1T05A 3KLHA 1UL3A 5D4OA 4AXJA 3DGVA 5B0CA 1A0OB 1R0CB 4X65F 5CHCB 2BM0A 3SYZA 1WHXA 1QUPA 5KG3A 1NPRA 2YQ1A 4EYHB 4Q5VA 4NL5A 3H5XA 4JYAJ 2YVSA 3T19A 1CSJA 2IY5B 1UJ5A 3MECA 2HS3A 4O3SA 5A8RA 3UCZP 4DX5A 3U7JA 4LUBA 1VIXA 2CPZA 4CQ1A 3QIPA 5BR8F 5B0EA 2BJ8A 3HHNB 1KSPA 2LXUA 3PCOB 3LQVA 4OHZA 1GEHA 1EB0A 3OTOF 2U2FA 4HTJA 2AGQA 5D4NA 3AAWB 2GQ2A 5D77A 2XYPB 2E5IA 1FE0A 3V6JA 2F40A 2HRUA 1SL2A 3JAMY 2HSEB 2UV8G 4ETXA 4OI4A 4KFBA 2Y1RI 1YVFA 2JZ5A 1K47A 2HQFA 5I3UA 1FRHA 1NK4A 2MZJA 4PG5A 1RZMA 2FHOB 3WBZA 4KY3A 2HAIA 2KHDA 4LREA 1K1QA 2B5JA 3B8HA 4F4AA 2O66A 1GTHA 4AYBD 4CP5A 4ED7A 3OXLA 1BWEA 2QA4G 1TELA 1RTDB 2R2RA 1QSSA 2IM0A 1FRJA 4CO0A 2MSSA 2I6WA 1X5TA 3MM5A 3CCMS 3IWNC 1B0PA 3J81Y 3HXMA 4QPXA 2BYCA 5DG7A 2L3MA 1X4BA 3AD8C 2CQ2A 4RWXA 4YEAA 1OY8A 3QO9A 4ZPDA 1U1PA 2R7OA 3K17A 1TAQA 3A3NB 3FMWA 2Y8YA 3AXMA 1NJZA 2XLJA 2I38A 4O23A 1SC4B 1FDNA 3GSIA 2EFVA 3CTRA 4YHHJ 2MQNA 1GFWB 1NJYA 2HVDA 3EZOA 3H5YA 3KJNB 4MAKA 1O5JA 4QR1A 1VYAA 4O3OA 5A2QU 3AA8A 4IFYB 4ANEA 2UP1A 3GIIA 1FNXH 2XI2A 3ULHA 2Q6CA 1HNXF 5IC4B 3NCRA 4DL4A 2VKZG 2N4DA 2JLGA 1KVIA 4B3OA 2G0CA 3S01A 1YBAA 1IKXA 2QYCA 4CH1A 4X4UA 3PO5A 4ZPVR 2YWEA 1JWWA 2IRUA 1SH2A 4GRSA 2AT1B 2LXFA 1WACA 1Y11A 3ZTPA 4KGXB 2R7VA 4ITSA 2VFTA 4IDKA 5KG2A 2X3GA 3GU0A 3DRPB 4JI0F 2GS8A 2NXEA 3PRVA 3MR6A 2ZNYA 1Q79A 1TMMA 3HZGA 2J7KA 4FNHA 2OGUA 2QT7A 5KTQA 1WEZA 1EQ0A 3SCIE 3UCGA 3CSKA 1VQ7S 4UZBA 2KM8B 3I0SB 1RT6A 1HHTP 4ZJQA 4IOBA 4CLPA 2QSWA 4FVMA 4B9NA 1F3VA 5KOWA 1CULB 4UOGA 3MAHA 2YH1A 3MPYA 2C2ZB 2ZD1A 4PQUA 3GV8B 2R2TA 1LV5A 2RT3A 3G6VA 1C0UB 4KE5A 3HJFA 4JI2J 4OZ3A 5H9FJ 5EWFA 5LSRA 2DPIA 3ILJA 4NRTA 2IA6A 4ZVRB 4HI1A 2RU3A 2KL8A 3P6YC 2KG0A 4PUOA 4M5MA 3SQGA 2OFHX 4WTYA 4LFCJ 2BV3A 4I2QA 2JFKA 1NXIA 4ZKAA 4LMZA 4H4KC 2W4CA 4N5SA 4HKQA 4CO3A 1PAUB 1ZS6A 3DN9A 1X0FA 2CJ9A 2DY9A 2A3JA 1VQYA 1N52B 3GFYA 4DV4J 2CNLB 4NLRA 2V5HG 3M2RA 1X9MA 4LSZB 1LW0A 1Q5YA 1CQMA 1CC7A 2VC1A 1PO6A 3PW2A 4NXMJ 1FE4A 3BZQA 4K4UA 4KSEB 3E01A 3OR1B 4YB6A 4ECRA 3K2YA 2J6UA 2CVEA 1WOOA 3BN4A 3MPDA 3TA0A 3DLHA 1Q78A 3NS6A 1I5OB 2NREA 4JP8A 2KB2A 3SMZA 2HQCA 1MROA 4IOCQ 3BYRA 2ATCB 4M95A 2WSCC 1LEOA 1OPZA 3EM1A 2RS8A 2XO7A 2OPPB 2LFVA 5CAAA 3PFEA 3DHWC 2DHXA 1Y7PA 3RW6A 5CYJA 1LXJA 3J80Y 5IS2A 2LQ5A 3G6YA 4EZ9A 4DSKA 4K8RA 3JXOA 2DJWA 4ID5A 1Y10A 3GB0A 1GXLA 2P2CB 4C8ZA 3BSCA 4NYPA 2XTJP 2KFZA 2ZITA 5GVQA 4PPDA 2C3YA 2HKEA 2JH3A 3B6BA 6FD1A 1VQ9S 1QAXA 3OHBA 4C8MA 4L74A 4QJVA 2WBMA 2WVFA 3DRRA 4P52A 5DM6Q 3W3SA 2AYGA 2HHTA 5ETPA 2WB1D 5CABA 5KFDA 4NE9C 3M2VA 4B17A 2D74B 3AJDA 1FTCA 4HEA9 4RW8B 2OPQB 3VGVA 2EFNA 3PY8A 2H5JB 5L46A 3PO4A 4C8LA 3MM7A 4O3QA 1LQ9A 3A8JA 1S1VB 5AXLA 1F1BB 2MKIA 1G1XA 2DR7A 3VGUA 2FLNA 2CDQA 1WELA 4NRUA 4UZCA 2CQGA 5ETNA 5DGAA 2DR5A 2L48A 4ZPAA 3JTNA 4DR4J 2GMLA 1GXUA 2XYGB 1SJ1A 1VLYA 1TKDA 1ITPA 1HWLA 1RAGB 2COLA 3NS5A 4X2BA 4ER8A 4K2XA 4AL5A 4ZHRB 1PIEA 3RBEA 2EFQA 2E1RA
chains in the Genus database with same CATH topology
3NS7B 2CJXB 3IBCB 1NMEB 3IBFB 1QTNB 1RWKB 1SC4B 1I51B 4DCPB 3GJQB 1RWVB 2CNKB 1RWXB 2CNNB 3SIPB 4ZVUB 2QLFB 3KJQB 2C2ZB 1SC3B 1RHUB 1GFWB 1SC1B 1BMQB 2C2KB 4ZVSB 3KJNB 3R7SB 3GJRB 2DKOB 2C2OB 1F9EB 3GJSB 4JB8B 2QLBB 3RJMB 3EDRB 3R7BB 1RHKB 2H4YB 4ZVRB 2CDRB 2H4WB 2Y1LB 2QLJB 3R7NB 1RHJB 2H51B 2QL9B 1I3OB 2C1EB 2H5JB 1RWNB 5IC4B 3P45B 1RWPB 1PYOB 4ZVQB 2XZDB 2HBZB 2HBRB 3D6HB 2Y0BB 3D6MB 4ZVPB 2HBQB 3P4UB 1RHMB 1PAUB 1RHQB 3GJTB 3R6GB 4ZVOB 3QNWB 2HBYB 4DCOB 1RWOB 2CNLB 3R5JB 5IC6B 2CNOB 2QL5B 2XYGB 2H5IB 3EDQB 1RHRB 2QL7B 1ICEB 2P2CB 2C2MB 1QDUB 1RE1B 2XYHB 5K20B 4LSZB 2FQQB 4DCJB 1RWMB 2CJYB 3R6LB 1RWWB 2XYPB 2H48B 4ZVTB 2XZTB 1IBCB 3KJFB 2H54B 3D6FB 2H65B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NS7 B;  2CJX B;  3IBC B;  1NME B;  3IBF B;  1QTN B;  1RWK B;  1SC4 B;  1I51 B;  4DCP B;  3GJQ B;  1RWV B;  2CNK B;  1RWX B;  2CNN B;  3SIP B;  4ZVU B;  2QLF B;  3KJQ B;  2C2Z B;  1SC3 B;  1RHU B;  1GFW B;  1SC1 B;  1BMQ B;  2C2K B;  4ZVS B;  3KJN B;  3R7S B;  3GJR B;  2DKO B;  2C2O B;  1F9E B;  3GJS B;  4JB8 B;  2QLB B;  3RJM B;  3EDR B;  3R7B B;  1RHK B;  2H4Y B;  4ZVR B;  2CDR B;  2H4W B;  2Y1L B;  2QLJ B;  3R7N B;  1RHJ B;  2H51 B;  2QL9 B;  1I3O B;  2C1E B;  2H5J B;  1RWN B;  5IC4 B;  3P45 B;  1RWP B;  1PYO B;  4ZVQ B;  2XZD B;  2HBZ B;  2HBR B;  3D6H B;  2Y0B B;  3D6M B;  4ZVP B;  2HBQ B;  3P4U B;  1RHM B;  1PAU B;  1RHQ B;  3GJT B;  3R6G B;  4ZVO B;  3QNW B;  2HBY B;  4DCO B;  1RWO B;  2CNL B;  3R5J B;  5IC6 B;  2CNO B;  2QL5 B;  2XYG B;  2H5I B;  3EDQ B;  1RHR B;  2QL7 B;  1ICE B;  2P2C B;  2C2M B;  1QDU B;  1RE1 B;  2XYH B;  5K20 B;  4LSZ B;  2FQQ B;  4DCJ B;  1RWM B;  2CJY B;  3R6L B;  1RWW B;  2XYP B;  2H48 B;  4ZVT B;  2XZT B;  1IBC B;  3KJF B;  2H54 B;  3D6F B;  2H65 B; 
#chains in the Genus database with same CATH topology
 4ZIW A;  2VKR A;  1PG5 B;  1ARO P;  3PHT A;  1JJH A;  2ZZM A;  1JLC B;  1V5V A;  1HMV A;  1RT1 A;  3ONQ A;  3PJ9 A;  4RL1 A;  4F3Q A;  4RNF A;  1UVK A;  2QLF B;  2DIV A;  2WSF C;  2UUT A;  3MED A;  3MM9 A;  3ZZR A;  1SJ4 P;  1KVK A;  4DL0 C;  2RUS A;  4AE5 A;  2V2V A;  3IO1 A;  1WI8 A;  4BC7 A;  4K0K F;  1VDH A;  2HFO A;  1TKT A;  1LFW A;  3TRG A;  1JXL A;  4KH1 B;  2A2C A;  2ZEJ A;  4P6Q A;  3PNI A;  2OSR A;  1VQO S;  4MFB B;  4NCB A;  2GZO A;  2QV6 A;  1RHQ B;  2DBB A;  2M5Y A;  2BE9 B;  4FP9 A;  4I4B A;  4DU8 A;  3V6H A;  2YPZ A;  4KO0 B;  4P75 A;  2XS2 A;  1NK0 A;  5I42 A;  2UVV A;  4PG6 A;  3IBW A;  3LUY A;  5D0R A;  2HFN A;  4WPA A;  2H65 B;  4IRC A;  1VJQ A;  1BE4 A;  1RLD A;  4WKR A;  3LP0 B;  3ETM A;  4IH7 A;  2UUB F;  3OJU A;  3W63 A;  1IBK J;  2DH9 A;  4W98 A;  1G4C A;  5B0B A;  3UW1 A;  4OLP A;  3KLE B;  2MLY A;  5KFL A;  2ZJR Q;  1XK8 A;  2CDR B;  5EWG A;  2MQQ A;  3KWM A;  2F1F A;  3MTJ A;  4IFV A;  3W1Y C;  2W2P P;  4U96 A;  2QGF B;  1YZ6 A;  1L3K A;  1C1B A;  1Y3J A;  1HBM B;  1AZS B;  2MZR A;  3IRX B;  1WOR A;  1BQX A;  3KXD A;  1L3U A;  3M05 A;  3KMS A;  3QAU A;  4YR2 A;  1Q0N A;  2I5J A;  2MB0 B;  3TX8 A;  4L72 B;  1DZ5 A;  1B70 B;  1HQU A;  1NRK A;  1VCT A;  3S1T A;  1RE1 B;  3PW7 A;  2KTQ A;  1PBA A;  4O3P A;  7FDR A;  2CPX A;  5HMW A;  4BWJ A;  2XMT A;  3I5C A;  3W9J A;  4YY3 F;  1SVD A;  1CQN A;  3MZI A;  5EX0 A;  5KFN A;  4Q0B B;  3ET6 B;  4W90 B;  2YBV A;  3M1V A;  2A6O A;  2P9G A;  2LEA A;  1DRZ A;  4X64 J;  3D4J A;  1H72 C;  1Q1K A;  4CYU A;  3E51 A;  3NWG A;  4OYP A;  4MH8 A;  5KG1 A;  4LIR A;  4FN5 A;  2BJ9 A;  4Y00 A;  3M8P B;  1NB2 A;  1KLM A;  2IRY A;  5KFB A;  2VD3 A;  1NZA A;  4NZ6 A;  3ZZZ A;  2AW0 A;  2HVI A;  1UKU A;  2JLE A;  4OYX A;  1HW9 A;  5HL7 Q;  4IR9 A;  2KDO A;  4LFB F;  2LKZ A;  2DEI A;  3DDN A;  4FVC A;  1RT5 B;  4DV3 J;  2D3O 1;  2NXJ A;  2FC9 A;  4B08 A;  2IMW P;  3T3F A;  3MEG A;  2BAB A;  1SUQ A;  1AW0 A;  5KFS A;  1U49 A;  5DRK A;  3BR9 A;  2OD6 A;  1N6Q A;  2CQ4 A;  2HFV A;  3MOZ A;  2AX1 A;  4GC7 A;  2HFZ A;  2YNG B;  3THP A;  4KV8 A;  1XTZ A;  1LW2 A;  1WC4 A;  1URR A;  4UQT A;  3LA0 A;  5J2P A;  4UW2 A;  4NCG B;  4RNH A;  4OZ1 A;  3W9I A;  2CPF A;  4B3M J;  2R2U A;  4DV0 J;  3E3X A;  5GAE I;  2OTJ S;  3DFE A;  4L6V 3;  1ZM9 A;  4OX7 A;  2VG6 B;  1ELO A;  1XIQ A;  3R5G A;  2HHX A;  3VQT A;  3L9Z A;  3RR8 A;  4XTT A;  4EZ6 A;  3AA9 A;  5IT9 U;  2JFD A;  3BQ2 A;  3TUI C;  1RAE B;  2OEL A;  3ADA C;  4K4W A;  2CPJ A;  5A6W A;  1D09 B;  1OO0 B;  1QDU B;  2DXE A;  1SKU B;  3KG0 A;  3AHP A;  3L09 A;  3DLL Q;  2MGZ A;  2UV8 A;  4ILR A;  1BC6 A;  3NMA A;  4ES3 A;  4AQY F;  4ELV A;  5KFT A;  5F9N A;  4V19 J;  2PI5 A;  3I82 A;  4JI5 J;  1D9A A;  1ZTT A;  4WK3 A;  2VIH A;  1T9X A;  2YXL A;  2PMZ D;  1R6V A;  4DCP B;  2FVP A;  5BYQ A;  4A8O A;  3DU6 A;  1F2G A;  3NMR A;  2PEB A;  2EPI A;  2MEW A;  3JAM U;  3BSO A;  1WG5 A;  1IR2 A;  4LF7 J;  3J7Y I;  3Q83 A;  2PA3 A;  4F0M A;  2EG1 A;  3X1L B;  1HQ2 A;  2HQG A;  1XMB A;  1X4D A;  2R7U A;  3SV3 A;  5FII A;  2N3O A;  2AWZ A;  2NR0 A;  3WX4 A;  2DNK A;  4UF4 A;  2NXC A;  4QIF A;  2XC9 A;  4PG8 A;  3TZX A;  4JI2 F;  4WIQ A;  1JK9 B;  3GYN A;  2W7P A;  3LP1 B;  4UOC A;  2POK A;  3J81 U;  1RWW B;  3H4B A;  3VGT A;  4X4N A;  4NOH A;  3HVA A;  3MFI A;  2QE5 A;  4DX8 H;  1WEX A;  4NYZ A;  4QWB A;  1WG1 A;  1WOS A;  5L38 A;  2C42 A;  3Q8U A;  4Q7A A;  2OO4 A;  3VAJ A;  2XB2 D;  1YDL A;  4F2R A;  2YKQ A;  4NLS A;  4RNM A;  4U7U D;  1NM2 A;  5E2Q A;  1CG2 A;  3HX9 A;  4KHR A;  5IZH A;  5KFO A;  4E0D A;  1LK7 A;  5L8R C;  2EFG A;  2GMH A;  2PC6 A;  5AJ3 J;  2E1P A;  1R0B G;  1C0U A;  1EKS A;  4P71 A;  3BV8 A;  4ICL B;  4ZCL A;  4L3K A;  2OEJ A;  3HVT B;  3O2I A;  2Q1L A;  1K0T A;  3CDE A;  1NJW A;  3H5S A;  4ZP8 A;  2Z2L A;  3FK4 A;  4M5D B;  1JLG A;  2IDE A;  3MUR P;  3QT7 A;  5B08 A;  2FQQ B;  2P6S A;  1Q16 B;  2Z8Q A;  5ETR A;  3ZZT A;  1QSY A;  3G86 A;  1VIO A;  3ZO7 A;  3ZTO A;  2WOM A;  2DR8 A;  3BGR B;  1SBR A;  5F8J A;  3EIC A;  5DDP C;  3ISN D;  4C4W A;  1HBN B;  3H20 A;  3QGP A;  3OL7 A;  3AD9 C;  2GO9 A;  4ALZ A;  2G0J A;  5K9F A;  4Q2L A;  3BGO P;  5EWE A;  2AJF E;  4WFB Q;  1VFJ A;  4HTI A;  2GW8 A;  5J2N B;  2V63 A;  1RHJ B;  4CM0 A;  4ECV A;  2F4V F;  1FDA A;  3UWT A;  1NPK A;  1ZOT A;  3SSR A;  3MPU B;  4FS2 A;  2ROP A;  3LGM A;  2XMJ A;  4MK8 A;  1U6F A;  4S0M A;  2M2B A;  3C66 A;  4C48 A;  1HI8 A;  3NNC A;  2OPP A;  1Q5V A;  1UET A;  4ZLN A;  4OHY A;  3TQE A;  3JSM B;  1DQA A;  5AXM A;  3VQS A;  2E7W A;  2X3D A;  2JDJ A;  5LXY A;  1LWC B;  3DNC A;  4L73 A;  1UFK A;  3GZ7 A;  4G1Q B;  2IYG A;  1VC6 A;  3PG9 A;  3OFG A;  3KK2 B;  3C15 B;  3PDN A;  3CJ5 A;  5L9X A;  2UXB J;  2N4C A;  3J81 j;  2E9Z A;  4CTA B;  1PJ5 A;  2GC8 A;  4O0N A;  2VOD A;  1TUV A;  1U47 A;  4LSN B;  5HLF B;  4ZN1 A;  2DGX A;  4DR4 F;  2ZVS A;  3DLG B;  3OBI A;  4LF2 A;  1RAH B;  5JVH Q;  3VZI A;  4RU2 A;  2ZH2 A;  2BQU A;  2W7A A;  1P9Q C;  2J9D A;  3I5A A;  4QQB A;  2CZ4 A;  2YNI A;  2B9E A;  4RW8 A;  3BH6 B;  3FFI A;  1XNR F;  2OPR B;  2AGP A;  1NB7 A;  4ETZ A;  1S1V A;  3FBC A;  1Z4U A;  2E5H A;  3F73 A;  5AT1 B;  5KFX A;  3BKU A;  1KFS A;  3M6W A;  2B8P A;  2VQF J;  1V9O A;  3J80 U;  2E5L F;  1VJW A;  1VRU B;  2HK2 A;  4OMF G;  2HQI A;  4UY8 5;  4N47 A;  1U09 A;  9ATC B;  5KFV A;  4KH0 B;  1RUS A;  5A6P A;  1HNI A;  4N8N A;  1RT7 B;  3M2U A;  2QLW A;  4DR2 J;  1IKW A;  4ZHR A;  1LWF A;  3HCX A;  3Q8P B;  1QY7 A;  4HVZ A;  3UDV A;  4NZ7 A;  2YNH A;  3QGG A;  2E7V A;  1FKO A;  3I55 S;  1XJW B;  1JLC A;  5KFH A;  4DL3 A;  4DFJ A;  1M5H A;  1S48 A;  4GKK F;  2L9N A;  3MUT P;  4JV5 F;  4NA2 A;  2LQ9 A;  1VQN S;  3UDC A;  3G71 S;  3KYL A;  2QJ3 A;  2J7W A;  2W1B A;  3VVU A;  6FDR A;  5EDW A;  1KR4 A;  4YFU A;  2VG7 B;  1NND A;  3TJA A;  2VPZ B;  3EGW B;  2JL9 A;  3KFW X;  4J9M A;  1F60 B;  1XR5 A;  4Q8E A;  1MWY A;  2OPS A;  2GVD B;  1IBK F;  5D8H B;  1QSL A;  2FJD B;  4CT9 A;  3POT A;  4WBF A;  1KQG B;  4OYW A;  3NGK A;  2KFN A;  2CQ3 A;  2AGO A;  2AF6 A;  1X9S A;  3VF0 B;  1NSK L;  4NCA A;  5C2C A;  3EVW A;  1UWB A;  3PAC A;  3MEK A;  4ZCM A;  1S1T B;  4X62 J;  3ZNJ 1;  3V6D B;  1NHV A;  2ASL A;  3HHL C;  1CJK A;  3QT8 A;  1LOU A;  2C2O B;  2C22 A;  2IC3 A;  1CJU B;  2MYF A;  5KFP A;  2SXL A;  3FEZ A;  1MMD A;  3K89 A;  4JV0 A;  3W2W B;  3NP5 A;  4UQG A;  3NNA A;  3E8O A;  2M4M A;  5JVG Q;  3KLE A;  2M70 A;  1IWA A;  4BHQ A;  2ALZ A;  2W4D A;  3GR0 A;  2GJI A;  1RHM B;  3T6J A;  1GK8 A;  2B4O A;  3DOM B;  2F7V A;  4CM2 A;  1YRX A;  3O8W A;  2D1C A;  5KT5 A;  3HKW A;  4CNY A;  2HPU A;  1T03 B;  4Y0F A;  1HBM A;  4JBC A;  3OJS A;  3PYD A;  3PRB A;  2ZH8 A;  3OHA A;  1JJC B;  3TVZ A;  3ICL A;  5B0A A;  3JSB A;  1I94 J;  2CJQ A;  4P7V A;  5DLG A;  2CQI A;  2NUU G;  4B3T J;  4P72 A;  5ETV A;  2B4P A;  2KRR A;  2F3J A;  4O44 B;  2VQE F;  3KKF A;  1ZBT A;  3L7P A;  5KFC A;  3M6U A;  2CQ1 A;  2HVE A;  3K0J A;  3KJQ B;  2J5A A;  2UXC F;  1YJ9 S;  4FYV B;  4A8Q A;  2XS5 A;  2ROE A;  3DLJ A;  3KLG A;  1RIS A;  3H90 A;  2BKO A;  2GQC A;  3KLV A;  3I96 A;  2GAG C;  1EIY B;  1UFL A;  1R8C A;  4WP3 A;  2DH7 A;  2UXD F;  2CWK A;  3QZ8 A;  4MKY A;  3TR5 A;  2R7Q A;  2HND A;  3C6U B;  5KFI A;  5A8K B;  1JNR B;  1VRT A;  3OSP A;  2UVR A;  3TVK A;  3K57 A;  2C3M A;  1R8H A;  4WTO B;  4J9L A;  4B3M F;  4DV0 F;  3H2U B;  1TP7 A;  4WE1 B;  4ZVT B;  4DSE A;  2RVJ A;  3EWG A;  2CJX B;  2KT3 A;  5H1S V;  4A47 A;  4ZP7 A;  3Q8Y A;  4LBH A;  5HSP A;  1MNE A;  3R5B A;  3Q2T C;  2JNJ A;  4O4G B;  1FT8 A;  4I6W A;  3N5B A;  1E6V A;  4QIE A;  4KR0 B;  1WF1 A;  4WU3 A;  3K58 A;  2DH8 A;  1RXO B;  4DSL A;  4ED4 A;  2DNG A;  1S6P A;  2YNG A;  4ANC A;  2KH9 A;  1SC6 A;  2LQ8 A;  2EXU A;  3SBM A;  1H7X A;  1PJ6 A;  2IM1 A;  4PWD B;  5FD1 A;  1RAA B;  3MCM A;  3UCU P;  1T0T V;  1WOP A;  2HIY A;  1Y5I B;  3W61 A;  1U02 A;  4FXV A;  5B0D A;  4IG0 B;  2VF3 A;  3RRK A;  3ISZ A;  3GPA A;  1CJT B;  2FHM A;  4F67 A;  4L76 A;  5D78 A;  3DRX A;  3EDQ B;  1FTR A;  3D67 A;  4PYD A;  1TKZ B;  4EGL A;  5F8H A;  4V19 X;  1UVM A;  4MMO A;  1SV5 A;  4AL7 A;  4LF7 F;  4CDI A;  2DD8 S;  3S8S A;  1RKI A;  1LWX A;  5KFG A;  3MI7 X;  1VR6 A;  2FVR A;  5AE1 A;  3D3C J;  1S6U A;  4B3R F;  4H4O A;  2ZZT A;  3M8R A;  2IAJ B;  2BJE A;  2XY7 A;  5J1N A;  3UNG C;  3PEJ A;  4CLF A;  5M2U A;  1Q7Y T;  4BCA A;  3GQC A;  2GX8 A;  3TZY A;  3D1H A;  3F56 A;  2N82 B;  5E3Q A;  2OML A;  1WC1 A;  2GJ2 A;  4NXN J;  4K7Q A;  4LIW A;  2VFS A;  3R7N B;  4OX8 A;  3M4X A;  4I6A A;  5RUB A;  4LRB A;  4WFA Q;  4TLR A;  2JEF A;  4NZ0 A;  3TZZ A;  1H2T Z;  2HGM A;  1SI9 A;  3DXB A;  4DWI A;  2GVZ A;  2ZH3 A;  1S10 A;  4LVN P;  4LVO P;  1PAE X;  1KDN A;  1RWO B;  4DXL A;  3H4D A;  1LNQ A;  3V2U C;  2VJV A;  2W2Q P;  3PYG A;  4TYB A;  2LA6 A;  2OUG A;  1K8A T;  1C1C A;  2DHS A;  2M9K A;  3KJF B;  3MAA B;  3R3T A;  2XMV A;  5IQQ A;  3U1N A;  2B43 A;  3LP1 A;  2M8D B;  2W2N P;  1UWA A;  3DYA A;  2V2K A;  4TQS A;  2WON A;  2GGP B;  3OR2 B;  1HWK A;  1KHW A;  2XY6 A;  3GJS B;  3U27 A;  1TR0 A;  2OHD A;  4J9N A;  3FGV A;  1R0A A;  4OYI A;  5HK4 A;  1WHW A;  1U48 A;  3ITH B;  4FXW A;  4PEO A;  2DHH A;  5T14 A;  3KG4 A;  2UUC J;  1GXT A;  2YPY A;  2BBE A;  1X31 C;  5E41 A;  4X4V A;  3CJ8 A;  1SPB P;  3MHY A;  2RUG A;  4DU7 A;  5JUM A;  1CLF A;  2HBQ B;  4X65 J;  1OY9 A;  2HWT A;  3MR3 A;  1M5P C;  1RB0 A;  2XSF A;  2OIH A;  1GX5 A;  4IRK A;  4ICL A;  4USI A;  3UI3 A;  2U1A A;  2QL7 B;  4DR7 J;  2HGN A;  3K59 A;  2ZWO A;  5A2Q Y;  1YRU A;  3QMQ A;  3A1Y G;  4FPI A;  1VK3 A;  1WTB A;  5BR8 J;  1YRT A;  4TU8 A;  4ED1 A;  1VQP S;  3K5L A;  3ILL A;  4NAS A;  4M5D A;  4X4P A;  1T9T A;  1XER A;  3QGH A;  1FWK A;  3OTO J;  2QYG A;  2IFX A;  3M7V A;  5HI7 A;  1KLN A;  1QE1 A;  3CUL A;  3FDS A;  4RPF A;  2ADC A;  4NLT A;  3IWX A;  2AMC B;  2DKO B;  4YDD B;  4YR0 A;  4CLU A;  2KYZ A;  4TLQ A;  1HBN A;  5A76 A;  3CWJ A;  3R7B B;  4GO5 X;  3P5T L;  2MKY A;  2YKM B;  1U2R A;  3DI6 B;  1WEY A;  4URS A;  2BEF A;  2IHR 1;  3CUN A;  2VFV A;  3L7O A;  1WDT A;  4UT4 A;  3CT9 A;  3WC0 A;  3A3O B;  4URG A;  2UXB F;  2C2D A;  1HI1 A;  5J2M B;  2HUR A;  3MWB A;  4MYT A;  5J2N A;  1ZAX A;  2PI4 A;  4G1P A;  2JJ4 D;  2HS0 A;  3ZZ0 A;  1YJT A;  3RTV A;  4CLT A;  3HT0 A;  1TQL A;  4Y6I A;  3TW0 A;  2DRD A;  1S6Q B;  2DPJ A;  4PKD B;  4CLL A;  3HO1 A;  2NCK L;  5KG7 A;  3C19 A;  3EUN A;  4HL9 A;  3KLF B;  3CCL S;  4LR7 A;  5KT6 A;  3IM9 A;  1VQK S;  4MK9 A;  1LWC A;  1NJX A;  4TXS A;  4G1Q A;  3KHR A;  4Z7Y A;  4EO6 A;  3KK2 A;  3C15 A;  3MXH P;  3OL6 A;  5F8G A;  4JI8 F;  5DDR C;  4M5I A;  4CTA A;  4DFP A;  3VZH A;  1IKY A;  4OJ3 A;  2VQF F;  2LP4 A;  1F5B A;  2RB7 A;  2ZUA A;  5HLF A;  4OZ5 A;  4LBP A;  1UW9 A;  2L41 A;  1TL1 B;  2D69 A;  1B99 A;  2LLZ A;  5K14 B;  4I1T A;  1RT2 A;  1U45 A;  4ZVP B;  2XSJ A;  2K8G A;  4JI3 F;  5LSL A;  2RU9 A;  4WXO A;  3MUV P;  1TKX A;  4DR2 F;  2KJV A;  2R8G A;  1HNX J;  4CO5 A;  1S0V A;  1S9E A;  4I2P B;  2DNO A;  3NBP B;  2J76 E;  1VIS A;  1WKK A;  8AT1 B;  2OPR A;  1RWU A;  3MM8 A;  2Z58 B;  5EGY A;  1TL5 A;  1R31 A;  4JI6 J;  2DGT A;  2ZH6 A;  1REG X;  4JI0 J;  2JLF A;  1PYS B;  1H73 A;  2CWX A;  1BQN B;  3D6T B;  1RWV B;  2AYB A;  1VRU A;  3NLC A;  1RU1 A;  1VQ8 S;  4ZS6 A;  2XNR A;  1CPZ A;  1LK5 A;  2K1R A;  4OYB A;  1Q95 G;  3MR2 A;  2DK2 A;  2GV1 A;  1OS5 A;  1D8Z A;  2HLU A;  3DOL B;  1GQE A;  3KTQ A;  3TX0 A;  4AXI A;  1IJE B;  4ECW A;  5I4M A;  3BJY A;  4GO7 X;  4HHJ A;  2R7T A;  2PSZ A;  2J0W A;  1TU0 B;  1WJ9 A;  5F8L A;  1N8R T;  4RLE A;  4OI1 A;  1EHW A;  1RAC B;  2CIM A;  2LQB A;  1FA0 A;  4X62 F;  2UU9 F;  1S76 D;  1MMN A;  3DXS X;  1GMW D;  2VG7 A;  1UEU A;  4QCL A;  2QRR A;  4I69 A;  2MZQ A;  5AE2 A;  3GCX P;  2B9Y A;  4M5N A;  4R0J A;  1CJV B;  3OXF A;  5ETM A;  2V2Z A;  2FY8 A;  4KPC A;  4DUZ F;  1HNV B;  5DZ7 A;  3N28 A;  2HGL A;  2VC0 A;  4LQ9 A;  4BC9 A;  1U0H B;  5KFW A;  3MEE A;  3PKM A;  3T6B A;  1PBU A;  1SQF A;  3QLH B;  2W9A A;  3H40 A;  3D0I E;  3A12 A;  2DCU B;  3DDI A;  4D3H A;  1QD1 A;  4DL5 A;  2ZZN A;  2ASY A;  1FX4 A;  3VR1 A;  3WIU A;  3FCW A;  2CPE A;  1S1T A;  1UA1 A;  3VAK A;  4GKJ F;  1P6T A;  4DX7 A;  4LF9 J;  3KG1 A;  1I94 F;  4ERD A;  2DGQ A;  4RJV A;  3JSR A;  1REV A;  3CMA S;  3EXC X;  4TYA A;  1GT8 A;  1YJU A;  2ILZ A;  5CYM B;  2DO4 A;  2C3O A;  3R6G B;  3M32 B;  2DHG A;  2WZ1 A;  1X9W A;  1NKC A;  1HW8 A;  3TI0 A;  2BA9 A;  4M5K A;  1VLO A;  1N5V A;  2EKN A;  2OFG X;  4NLQ A;  4PRF A;  5J2Q B;  1R6Y A;  1Y9O A;  5DG9 A;  3NS7 B;  2X7I A;  4LSL A;  2ZH4 A;  1NME B;  3F44 A;  4ZA1 A;  3TOQ A;  3AY0 A;  4MIW A;  3I87 A;  2BAN B;  1O8B A;  2CNN B;  1D0E A;  4ES1 A;  1VMB A;  3QYY A;  3CJK A;  4CLS A;  2RSQ A;  4XIU A;  2XBP A;  2K3I A;  4DDF A;  1UPP A;  3FNN A;  4XPC A;  4RKU C;  1ZET A;  2RRB A;  1D9D A;  4OZJ A;  1IBM J;  2VA2 A;  5JMN A;  1KHV A;  1YX2 A;  1V3S A;  1S1X B;  3M9N B;  3M30 A;  3V81 B;  4IO1 A;  1WD6 A;  4BBY A;  1J5O B;  1IM4 A;  2D9O A;  4PPZ A;  1U8W A;  5ETQ A;  5T7L B;  2AJ0 A;  4F4X A;  4DS4 A;  2R42 A;  1H0H B;  2HRT A;  3NGT A;  1FRX A;  3C6U A;  3LGH A;  1U25 A;  2CJY B;  4JV2 A;  1XNQ J;  5A8K A;  3HFZ B;  1CS4 A;  5KFA A;  2HK3 A;  2V69 A;  5LMU F;  2HAF A;  1RBA A;  2VBW A;  4CT8 A;  4RW9 B;  1QVF R;  4RUC A;  3K8V A;  3G8T A;  3A8K A;  4FS1 A;  1HPZ A;  1N33 F;  2HZV A;  1NK8 A;  3QWU A;  1Z1Z A;  1D1U A;  2HNZ B;  3LF0 A;  1RT4 B;  2H5E A;  3MDF A;  4EFA C;  3PX6 A;  4C2M A;  2RKI B;  2XY5 A;  1YIT S;  2E29 A;  2PMW A;  3TP2 A;  3O5T B;  2NSC A;  1T95 A;  1YHQ S;  2YKP A;  3OUY B;  2BW2 A;  4QPT A;  2HVH A;  1RGV A;  4WKY A;  2BE2 B;  5KT2 A;  4O4G A;  4ED3 A;  1RTI A;  1BD6 A;  2ERR A;  5AXK A;  1HI0 P;  2MPU A;  4EU0 A;  5DO2 A;  4ZPT R;  3JYT B;  2KJW A;  1HR0 J;  1VBZ A;  4YS2 A;  3PJX A;  2DGS A;  4JV1 A;  4AD6 A;  2MKH A;  3D6H B;  3RZA A;  2DIU A;  4BS2 A;  3C6T B;  1EP4 B;  5D0H A;  1X60 A;  1DLO A;  4OHX A;  4A8F A;  4HT7 A;  1NEE A;  4K0K J;  3IRW P;  1WTF A;  2BUN A;  1XR6 A;  3JS9 A;  2F5G A;  3DU5 A;  2HBY B;  1RTZ A;  5CCL A;  3FZ2 A;  1BUX A;  2RH3 A;  4FYY B;  5HN0 A;  9RUB A;  1W26 A;  3E2E A;  1F3F A;  2AEF A;  3FQL A;  3QAE A;  2QSF A;  4NXN F;  1WC5 A;  4IG0 A;  4KIA A;  3C46 A;  1S9G B;  3W9H A;  1QLN A;  2F8E X;  4Z7C A;  5B09 A;  2CA9 A;  2GO8 A;  4HHU A;  4R5P B;  1B3T A;  1TKZ A;  3PXG a;  3M8W A;  1JB0 C;  4QWD A;  1M0S A;  1RTJ A;  3PEH A;  2AZ3 A;  4OYZ A;  1XMQ F;  2CNK B;  5KFU A;  1RWX B;  2YH0 A;  1Y0H A;  2EC0 A;  3W65 A;  3QFH A;  4NLD A;  4ZVS B;  4YP3 A;  2KU7 A;  2YX1 A;  1VGY A;  4NLP A;  3HSZ A;  1T11 A;  3QRP A;  2DNN A;  4GVB A;  4NLG A;  4CLK A;  2O01 C;  2MMY A;  2ZHO A;  1N48 A;  3RB0 A;  2UUB J;  4F0H A;  2PEH A;  1IXK A;  1PC5 A;  2EC2 A;  2KHC A;  1WF0 A;  2VDI A;  4MKB A;  3FSI A;  3J7Z T;  3LO3 A;  1ACM B;  3BPD A;  1VHI A;  3UE2 A;  2ACM A;  4RBV A;  3KJV B;  2XS7 A;  4LFA F;  3IS9 A;  5EN1 A;  4NYO A;  3LAL A;  4RW7 B;  2FGO A;  4NLW A;  2MQL A;  3UQS A;  4NLU A;  3AD7 C;  2AKW B;  3HM9 A;  5IV4 A;  3CB4 A;  2HHV A;  3IN5 A;  3JB9 k;  4DCJ B;  4OJG A;  3ZTR A;  3UN2 A;  1XR7 A;  4J9K A;  2E9R X;  2UUC F;  7AT1 B;  1H98 A;  1S1W A;  4OZL A;  3CJ4 A;  3GV5 B;  1M5O C;  4PG4 A;  2WAQ D;  1RA7 A;  4CLZ A;  4JOU A;  3B78 A;  4RBT A;  1I51 B;  1RDR A;  2BQ3 A;  5IT9 Y;  3MR7 A;  3GV7 B;  3PTW A;  1FX2 A;  2LXI A;  1OYE A;  3GE9 A;  1IJF B;  1BMQ B;  4L75 A;  4YY3 J;  4ECT A;  5KG4 A;  4Q43 A;  5H9E K;  1WI6 A;  3HKZ D;  1N56 A;  4KHM A;  5IFM A;  2QMX A;  1ZA1 B;  1PKU A;  4DR7 F;  4YB1 P;  3TAM B;  5KFY A;  1YK9 A;  3K5P A;  3GIR A;  2X1B A;  2GGP A;  3T5K A;  2VAS A;  1UEV A;  1RBO B;  3M8Q B;  2WCX A;  3MMB B;  2R8J A;  4DQQ A;  4YB5 A;  3P45 B;  3MFH A;  5DJB A;  4ZVQ B;  3OQ2 A;  4O4R A;  1PCA A;  2AYM A;  4DV1 J;  1RBL A;  2V9W A;  4CRJ A;  5MAO A;  3EXY A;  1N5Q A;  1EET A;  2RD5 C;  2J9C A;  4NPO A;  4B3S J;  2K3K A;  3QSY B;  4DZD A;  5A0Y B;  2CPH A;  2YKO A;  4DF8 A;  3LWM A;  4J9P A;  2KFY A;  1NDC A;  2YX7 A;  3AT1 B;  1GAO A;  1T94 A;  1TK5 A;  4LFB J;  4ECY A;  2IJF A;  3DCA A;  3UVJ B;  3OPK A;  1R43 A;  2RML A;  2ABY A;  3KK1 B;  3FCV A;  1U1Q A;  4ZVE A;  1SJQ A;  3BM7 A;  5KG5 A;  4WFX A;  5CD4 A;  1NLK L;  3TEH B;  3UN5 A;  3RUB L;  4HH0 A;  1SCJ B;  1LFP A;  1F6T A;  4EYI B;  2E9T A;  3CJQ A;  3CE8 A;  4RW6 A;  1RT3 B;  2R8I A;  3DLE B;  2CZV C;  1FWL A;  4P73 A;  1GMW A;  4KQZ A;  2AP6 A;  3LAK A;  4OZ0 A;  3LAM A;  1R7I A;  2E66 A;  1N36 F;  4AFF A;  2DT9 A;  4J5O A;  3CDA A;  3Q8S B;  1MG7 A;  1FKA F;  2XCP A;  2W2M P;  1WC3 A;  3DMJ B;  3OTD A;  3GFX A;  2VDH A;  2HQ3 A;  3SQO P;  1T9V A;  5CA5 A;  2VPW B;  1X4H A;  1K0V A;  1MW7 A;  1HNW F;  2FVQ A;  3OVS A;  2MDA A;  2DGW A;  4IG3 B;  1SKR A;  3K5M A;  2DIT A;  2VU5 A;  1SH0 A;  1SKS A;  3BS9 A;  1OPI A;  4R8U B;  2BE7 D;  3DOK B;  3RAX A;  1PYT A;  5KT3 A;  1DTT B;  3T5H A;  2HHP A;  3FZB A;  3ZC4 A;  2EI5 A;  1SJR A;  3F41 A;  4A8K A;  1UVL A;  3TJ8 A;  2ADB A;  1QTN B;  1N5Y B;  2KN4 A;  4XK8 C;  3V4I B;  3H0P A;  4AQY J;  1Q8B A;  1KBR A;  2RDJ A;  5LOQ A;  4H4M B;  1FVQ A;  2DVI A;  1X5P A;  4DR6 J;  3VWS A;  1FJ7 A;  3KLF A;  3EGZ A;  2R8H A;  2VBX A;  3WDO A;  1VQ6 S;  3BBF A;  1T05 B;  2KYX A;  4A8S A;  1A6L A;  1EAY C;  2MQP A;  3G96 A;  3DLB A;  4FYW B;  4USK A;  3DC2 A;  5I3P A;  4JI6 F;  3AOA A;  2XHW A;  4IRD A;  3WIV A;  3MEC B;  4ELU A;  4ZLJ A;  3GYG A;  3PZP A;  3BPS P;  2RRA A;  2V0N A;  1NHK L;  3QIP B;  3KMQ A;  3LPE A;  5K14 A;  4MTP A;  1DQ8 A;  1T8E A;  1RHR B;  2N3L A;  1JX4 A;  2MZS A;  3TEG A;  4ZN3 A;  1NAQ A;  4I2P A;  2LU1 A;  4O0I A;  2XZW A;  1VQL S;  2KZM A;  2ASD A;  1JNZ B;  1RAD B;  1S99 A;  3MGJ A;  5M2P A;  4B9T A;  3TVY A;  4KFB B;  1ZAV A;  4YOE A;  4UST A;  2BJ7 A;  5LJ3 Y;  4LF6 J;  3GCW P;  5I3U B;  3BDP A;  5KFF A;  3CW2 C;  1UA0 A;  1IR1 A;  1FRI A;  1TAU A;  3BKF A;  5L39 A;  3KOA A;  3BEG B;  5E3C A;  3RU0 A;  4ED6 A;  1RYR A;  1YJV A;  4U8Y A;  1FFW B;  2D9P A;  3NCQ A;  5D15 A;  1FEE A;  1FES A;  3IAS 9;  4PXB A;  4F7V A;  4FYD A;  2ZFH A;  3JQM A;  1BHN A;  3DOL A;  3SEO A;  3OVB A;  3MM5 B;  5KT7 A;  1H7W A;  2J0Q D;  2YWH A;  2VZ9 A;  2DYA A;  5CYQ B;  1N5S A;  2APO A;  2EVZ A;  3BRE A;  5BJR A;  3R97 A;  2XLI A;  3BGU A;  1U26 A;  1JLB A;  3UDL A;  1GTE A;  2QMU B;  1R3N A;  3MD1 A;  3QO9 B;  3VV2 B;  4IKA A;  2QA4 S;  3VAL A;  2N7C A;  4LF9 F;  3G8S A;  4C8K A;  3ZTS A;  3ZZU A;  1OY6 A;  2J6S A;  1M1H A;  4LT6 A;  1WWH A;  3CC2 S;  4C3M A;  1U1L A;  1HNV A;  3GSD A;  1MML A;  3QQC D;  4EK2 A;  4HT5 A;  5HAT A;  4PWW A;  2A0F B;  3CCJ S;  5F8N A;  3CXC R;  1PGZ A;  2B0G A;  1FK9 B;  5KT4 A;  4DV7 J;  2AJ2 A;  3CVK A;  3QLH A;  4MYU A;  2HQD A;  2V50 A;  4HR2 A;  2M3D A;  4NLX A;  3VAF A;  2D7S A;  1RWN B;  4C0B A;  1OJ4 A;  2QMW A;  3N6M A;  1IBL J;  2ZUG A;  1IKX B;  1Q7L B;  2F4V J;  4CH7 A;  1JLE A;  1DFD A;  3ETO A;  3BF4 A;  3R5J B;  4EI2 A;  1Y3K A;  4P2M A;  1G2E A;  3VVT A;  1TUW A;  1YBU A;  1PJ7 A;  1N5T A;  1IBM F;  3DDK A;  3QJL A;  1U0S A;  5G0R B;  2HVZ A;  3ZNU A;  5DET A;  4U7C A;  2FJB B;  3H7H B;  2CUY A;  1NDL A;  4ECU A;  2W2O P;  1RT6 B;  2RDD A;  1TVR B;  4CZC A;  4DL2 A;  3GIJ A;  2RE1 A;  2M7S A;  2W8L A;  3IG1 A;  4ED5 A;  2VOO A;  3MPW A;  3GON A;  4FKY A;  4KT0 C;  2BKN A;  4PQU B;  3JQK A;  3VAI A;  1RHK B;  1S7I A;  1X0P A;  3EVO A;  2B4V A;  3ZTQ A;  2BAN A;  1XNQ F;  3N79 A;  2W9B B;  4TQR A;  3I31 A;  4DG1 B;  3SQG B;  2R2S A;  5E0O A;  5CXT A;  3KHL A;  2Y0B B;  3MF5 A;  3PR5 B;  1FKP B;  3QPI A;  4DF4 A;  1NU4 A;  2XMK A;  3UO0 A;  4N56 A;  2IM3 A;  1KQF B;  1UZH A;  4DMZ A;  5C2G A;  3NY0 A;  2LVW A;  1M1K T;  2DNH A;  4YQW A;  1JKH A;  3V81 A;  1BGX T;  2MST A;  2WVD A;  2Z2Y B;  2DB1 A;  1J5O A;  2C2M B;  4OZN A;  3NXZ A;  1FWP A;  3I0R B;  2MXY A;  3M2R B;  1XNR J;  3R6L B;  1RCO B;  1T02 A;  5SZT A;  2AJQ A;  4HDH A;  2VG5 A;  3BN7 A;  4QYZ K;  1YJR A;  1HR0 F;  2O3D A;  4DV6 J;  2FZK B;  3E01 B;  4WJB A;  2GIF A;  1ZA2 B;  2E5L J;  2IVY A;  3FQK A;  2GMJ A;  3D66 A;  4IQM A;  4RW9 A;  1YJN S;  2BKP A;  3OFE A;  1WUU A;  1VK8 A;  2OH2 A;  4J91 A;  2OSQ A;  2KI2 A;  3BGF A;  3DRY A;  1YLX A;  3AB2 B;  1OWX A;  1JIH A;  2NUH A;  1RT4 A;  4ZCK A;  3GP9 A;  5B0F A;  3DM2 A;  3EE3 A;  2R9L A;  1F0X A;  2GFF A;  4M5J A;  3CED A;  1RAB B;  2RKI A;  1X5S A;  1YKW A;  4DPW A;  2VL1 A;  4IO9 Q;  3GWC A;  1QJH A;  4M5L A;  3CCV S;  5CQG A;  1TK0 A;  4GKK J;  3OUY A;  3BBB A;  4JV5 J;  4ED2 A;  3NOC A;  2D41 A;  3PX4 A;  3RB4 A;  2J8A A;  4C8N A;  4KPY A;  1RK8 A;  1L3S A;  2L9D A;  4PAB A;  2CNO B;  2QL5 B;  2RJZ A;  2AJ1 A;  4ID5 B;  4ZP6 A;  4OI2 A;  1JJ2 R;  4RX6 A;  1NSA A;  3CCW A;  4DR3 J;  4YR3 A;  8ATC B;  5JXS A;  2CAJ A;  3HD1 A;  1FRM A;  3PR4 A;  1M90 T;  1KKH A;  2FJW A;  4QR2 A;  1KTQ A;  1S9G A;  3DRR B;  4ILM A;  2Y1I A;  4R5P A;  1O0P A;  1FXL A;  2ZH5 A;  1YGY A;  2HWH A;  3AQO A;  4UOH A;  5IWA F;  2GHW A;  1Y00 A;  2M8H A;  1Z2L A;  2VA3 A;  2DEJ A;  2QFI A;  3FBB A;  3MM7 B;  2BMB A;  2XLK A;  2FLO A;  3D6M B;  5CZX A;  2BM1 A;  4WF9 Q;  4DN0 A;  3QBC A;  4QOT A;  4W92 B;  1FJC A;  3P96 A;  4DV2 F;  3CC7 S;  3C14 B;  1S77 D;  2C28 A;  2ZH7 A;  2DGV A;  1URN A;  2J0X A;  2MQO A;  1AYE A;  3KJV A;  3CO9 A;  2XWX A;  4USM A;  2WSE C;  4A8X A;  4O3N A;  3MMA A;  3SSQ A;  2Z4P A;  1G3O A;  2FDN A;  2FJX A;  4HAC A;  4DV1 F;  4F02 A;  1T9U A;  1HMV B;  2XHC A;  4XAK A;  5DZ6 A;  4B3S F;  1HNZ F;  4K4Y A;  4DQR A;  3X3U A;  4OI0 A;  3MED B;  2ZJQ Q;  3MM9 B;  2VQE J;  5IT0 A;  3MR5 A;  4EWT A;  3U1L A;  4Y2C A;  4TU9 A;  2PMH A;  2Y1L B;  4E2F B;  2E1C A;  1RTH B;  2UXC J;  3IP0 A;  3Q8Q B;  5K8P A;  4QWE A;  3TAM A;  2FGC A;  4ZVF A;  1H6K X;  2CQ0 A;  3M8Q A;  5FLX Y;  4Z2X A;  1RKJ A;  3TAP A;  1S5Z A;  2UXD J;  2XQC A;  4DV5 F;  2IJN A;  1U7L A;  5K20 B;  4ZMM A;  5I42 B;  5L9N A;  4F04 B;  3FSY A;  1UEK A;  2IRX A;  5A0Y A;  4E8U A;  5J1P A;  4AUK A;  2RF2 B;  3NG8 A;  4DR5 J;  1QVG R;  3LAN A;  1KD1 T;  3IBF B;  2B51 A;  3BSA A;  1D8Y A;  1L3V A;  2XI3 A;  3TYT A;  3W60 A;  1NK7 A;  2ZBQ A;  1WNE A;  3MMC B;  1V5I B;  3KK1 A;  2PT0 A;  4DJB A;  3NCP A;  1FRK A;  5D0E A;  3R7S B;  4DUY J;  2FIU A;  3OTB A;  3NAI A;  2NS1 B;  1KQS R;  1HWJ A;  5L1K A;  3JQJ A;  2NPF A;  2LCW A;  3AH6 A;  4AL6 A;  1SIZ A;  3T5J A;  2GQQ A;  2XNQ A;  2VHG A;  3PVX A;  2GIR A;  1RTD A;  3CCE S;  4OHV A;  3PV8 A;  1U2F A;  2QN6 B;  4C0O C;  2V67 A;  4EBE A;  3HUL A;  2ZHB A;  1W25 A;  2YWW A;  3W7B A;  4IR1 A;  4A8W A;  4DR6 F;  2Z30 B;  3HVW A;  1UFW A;  2P5V A;  2JEI A;  1KC8 T;  1UPM B;  2VBY A;  4ZPB A;  2I5J B;  4CO2 A;  2FB0 A;  2KXF A;  4EBD A;  4FDF A;  1TL7 B;  3CCQ S;  1TUG B;  3F0N A;  3AOB A;  4IG3 A;  3JTP A;  2QIF A;  3C3L A;  3V6K A;  4ECS A;  3PYE A;  1DTT A;  2O67 A;  4J9V A;  5IXU A;  1HWI A;  4WXW A;  4KB7 A;  4KJI A;  3ISN C;  1NZ8 A;  2FVS A;  2E44 A;  1X8D A;  1B64 A;  2XGQ A;  2DRA A;  2VH7 A;  1QM9 A;  4IFY A;  3J7Y U;  2IVF B;  3GIM A;  1CEZ A;  3FMB A;  4H4M A;  4B3R J;  2BW7 A;  3M9O B;  5KFK A;  2W7O A;  2PFD A;  2B9X A;  2YX4 A;  4EBC A;  2MHE A;  2D3Z A;  1FXR A;  4DZ6 A;  1KLM B;  1RCX B;  1KNZ A;  2FY1 A;  3BYP A;  3GFH A;  4B9S A;  2KVQ E;  2GA7 A;  4DSI A;  2FLL A;  2R7W A;  4QIV A;  4LF6 F;  3DRP A;  1K9M T;  4C3L A;  2XEX A;  1ICE B;  1SIW B;  4B9V A;  3M8Y A;  5HQ8 A;  3UPF A;  3MEG B;  1SUQ B;  1R8P A;  5GME A;  3PYF A;  1YG0 A;  3I0S A;  4DUT A;  1N6Q B;  1AA1 B;  2RHS B;  3G2X A;  1Y5L B;  1CUL A;  1F5A A;  4DOZ A;  4KV8 B;  4AT1 B;  1LW2 B;  2JC1 A;  1NSP A;  5J2P B;  3NGR A;  4N8O A;  3Q86 A;  3GMG A;  4A48 A;  1FDD A;  4OLO A;  4K59 A;  3KNG A;  3QID A;  4K4X A;  1B7F A;  3UNY A;  3FKB A;  4LR8 A;  4M1K A;  1SB6 A;  2CG8 A;  2YY3 A;  1GH8 A;  4FF2 A;  1T3N A;  4XDD A;  4USU A;  4DSF A;  2CQC A;  3ENW A;  5JJB A;  1NK6 A;  2XUL A;  3V5R A;  1T9W A;  4DV7 F;  4URQ U;  1U4B A;  2ZBC A;  4ID8 A;  2MGZ B;  5E5N A;  2ZKT A;  2C2R A;  5CYQ A;  4MJK A;  2CG4 A;  1CVJ A;  4F50 A;  4NEZ A;  1PSD A;  3OR1 A;  4ZK7 M;  1NO8 A;  2MHN A;  2XMU A;  4FF4 A;  3VTI A;  1IBL F;  4Y2A A;  2I1R A;  3D0G E;  2R4F A;  3NWR A;  5LMN J;  5KG6 A;  3TQ1 A;  1NH7 A;  2IMO A;  2R7S A;  2B8Q A;  2HHW A;  1GNK A;  1NKB A;  1G6B A;  1DY3 A;  3RJM B;  3IGN A;  3QAT A;  3VCD A;  4QYR A;  3T1Y J;  1W2I A;  1M1G A;  4OV1 A;  3UFC X;  1PIL A;  2AQ4 A;  1S79 A;  3CNQ P;  1KFD A;  4J9O A;  5ADZ A;  4FNI A;  4DSJ A;  2FLP A;  1FK9 A;  4LRD A;  4BDP A;  3DRS B;  3QJJ A;  3R5D A;  4F3O A;  2YNF B;  4TVA B;  2ZDO A;  2CPD A;  2EG2 A;  4ZLP A;  1AXQ A;  3PW0 A;  4OJH A;  2BJD A;  4BLG A;  1HIY A;  5CCM A;  3MUM P;  3Q24 A;  4YDX A;  4KGM A;  2K2P A;  1RJJ A;  4Q8F A;  1LWE B;  2ZKU A;  2DO0 A;  2Q66 A;  3D68 A;  1JLA B;  4CO1 A;  1F9H A;  1MWZ A;  4P74 A;  2AIR B;  5DG8 A;  4QU6 A;  2BX6 A;  2QTW A;  2X1G A;  5F3Z A;  1KEK A;  3N0V A;  5G0R A;  1SC1 B;  2F4F A;  2WVE A;  3VAG A;  2G4B A;  2CZ9 A;  3I4P A;  4NMX A;  1CC8 A;  1TVR A;  1ZPW X;  5EHH A;  3I4H X;  2OPQ A;  1JXE A;  2M52 A;  4I0W A;  4M94 A;  4JI8 J;  2V8V A;  2KVI A;  1YIJ S;  4DV6 F;  3KDN A;  2WRM A;  2V8D A;  5KFR A;  1WKJ A;  4DS5 A;  2V2Q A;  2FHJ D;  4MKV A;  2W9B A;  4DG1 A;  3BDE A;  2C3P A;  3MCN A;  1TZ0 A;  4D3G A;  3CD6 S;  2ALY B;  1JLG B;  4JI3 J;  1FKP A;  3R1L A;  1QUV A;  3OFH A;  2HHU A;  3MTK A;  4PYA A;  5F0W A;  5GAD U;  4KTQ A;  2J6T A;  1GX6 A;  2WOM B;  3CJR A;  4EO8 A;  4LF4 J;  3CGI A;  3CF5 Q;  2YTC A;  1ULR A;  3I0R A;  1SQG A;  2HFS A;  1N4L A;  4RUH A;  5LXR A;  4U67 Q;  4CLY A;  3MOJ B;  1F9E B;  1X5O A;  3TUZ C;  1V6H A;  5ETS A;  4WFZ A;  6AT1 B;  5CD4 H;  1NDP A;  1WF2 A;  3MM6 B;  4G1I A;  4F2S A;  1B0V A;  3B4M A;  1EJ7 L;  4J37 A;  4DR3 F;  3K7R A;  4ECX A;  3CDU A;  2OEK A;  1HQE B;  2RAQ A;  3SDE B;  4MFB A;  2JWN A;  4DX6 A;  5E3R A;  1V3Z A;  3RW7 A;  2FZG B;  1W7W A;  4GVL A;  1AB8 A;  1BY9 A;  4ZVO B;  2VPX B;  1HWU A;  3HD2 A;  2PN6 A;  4KO0 A;  3WC2 A;  3NNH A;  4WU2 A;  3QGI A;  3R5C A;  5MLC V;  3PKY A;  1YWX A;  5F8M A;  4K4S A;  2AU0 A;  2UU9 J;  4KHP J;  3FEX B;  2DNM A;  1B7Y B;  1S1U B;  1OIA A;  2J0S D;  1IBC B;  2B9W A;  2DNR A;  1T3O A;  2H9Z A;  4Y28 C;  1ZYQ A;  3LP0 A;  2AJ4 A;  4TN2 A;  3R2D J;  3CD7 A;  5HQL A;  4WFY A;  3IMQ J;  1HAR A;  4DUZ J;  5IQ6 A;  5HVG A;  1SL1 A;  1N34 J;  4IYQ A;  3QZ7 A;  1V3R A;  1BQM B;  2I0X A;  2CQB A;  2M88 A;  3TZW A;  5F9L A;  4X84 A;  1KON A;  3OW2 R;  2H4Y B;  1Y5N B;  4WK1 A;  1Z2Z A;  2HWI A;  4Y3C A;  2G2Y A;  3WHI A;  3KDO A;  3M6V A;  1DBD A;  1FNO A;  2O1P A;  1AZS A;  1DAX A;  1FCA A;  3IRX A;  1WG4 A;  2PE8 A;  4GKJ J;  1IM6 A;  2YNI B;  4QR0 A;  5HMY A;  3LW5 C;  3FFI B;  2Q6B A;  3HHD A;  4RNN A;  3D5M A;  1H38 A;  3KNA A;  3PFO A;  2IJR A;  4OL8 A;  2DGU A;  4QIG A;  3C14 A;  2V4Q A;  4LF5 J;  4C7Q A;  5H9F K;  3HFK A;  2BQR A;  1QTM A;  4Q0B A;  3ET6 A;  2FUG 9;  3CJ2 A;  5U47 A;  4MKA A;  3D7S B;  4ZDN A;  3W8G A;  3O1L A;  4U6P A;  1HNI B;  1KOO A;  4JI7 F;  3M2U B;  3AQP A;  4ZVU B;  1IKW B;  3T1H J;  2KKH A;  1LWF B;  1K1S A;  3GJR B;  1MSW D;  3JSY A;  5DLF A;  2V9K A;  2YNH B;  1VRQ C;  4DN9 A;  3MAQ A;  1FKO B;  2O5D A;  3ZZY A;  1SQE A;  1ZM4 A;  2DXD A;  1FF2 A;  2H51 B;  3M8P A;  1FFG B;  4B02 A;  4LQ3 A;  4PXE A;  1XEZ A;  4DR5 F;  4FF3 A;  1YBT A;  1FO1 A;  3A3P B;  4P10 A;  1RTH A;  4MIB A;  3ILO A;  2OPS B;  2JX2 A;  1RT5 A;  4DUY F;  2ZE2 B;  3EPG A;  1KN6 A;  1VC0 A;  3WZ0 A;  3TA2 A;  1C0T B;  2N7Y A;  1HD1 A;  3POT B;  4ENO A;  4NA1 A;  2DHA A;  3R1H A;  5CZV A;  1RP5 A;  2H48 B;  4J7C A;  5AE3 A;  3J7A N;  3LOU A;  3VAH A;  1J5E J;  3R5A A;  2HHH F;  1ZH5 A;  1KRP A;  2E1M C;  2GCF A;  1N0V C;  2F9D A;  2EFO A;  1UWB B;  4A46 A;  1U1M A;  1QAJ A;  5LMU J;  3SFU A;  2HNY B;  2G13 A;  3NOG A;  2RF2 A;  4P2F A;  5KFJ A;  4NCG A;  1CJK B;  1FXD A;  1RLC L;  1N33 J;  4F4K A;  2IC3 B;  2GIQ A;  4LF8 J;  1OSC A;  3Q8V A;  3TAQ A;  3MMC A;  2W8K A;  2VG6 A;  2DXF A;  3NGD A;  3AXK A;  4PXC A;  1UAW A;  3FEY B;  3CC4 S;  4DR1 J;  4CNZ A;  3C8Y A;  4MIA A;  2EEY A;  3G82 B;  3CCT A;  1U1N A;  2V8P A;  3PRD A;  2IDL A;  1HBO B;  4Q45 A;  3K5N A;  1OSD A;  4ZVG A;  3H8Y A;  4ZLL A;  2H5I B;  1SXL A;  2E5G A;  2AHO B;  5HO4 A;  1N32 F;  4ILL A;  4JI1 J;  5GAH U;  4N41 A;  1FJG F;  2QA1 A;  2ZJP Q;  3QRR A;  5FLX U;  3H98 A;  4PZV A;  4KGK A;  3BQ1 A;  2QX0 A;  3D6F B;  5E33 A;  4J9Q A;  4DQI A;  2KRB A;  1TL7 A;  3PX0 A;  3W66 A;  4ZJO A;  1X4G A;  4DHV A;  1JLF B;  4OI3 A;  2J9E A;  2R7R A;  1FJE B;  2OD4 A;  1GMV A;  3OLB A;  3O44 A;  1F5C A;  2QLB B;  1S7H A;  4QIW D;  4JYA F;  3HK2 A;  1XMQ J;  5FDL B;  3NL0 A;  3TA1 A;  3HMJ G;  3KLG B;  5GMK a;  1LKZ A;  5THW A;  4X4R A;  2HLT A;  2WTF A;  4IOA Q;  1X4E A;  3MD3 A;  4N77 A;  2HBR B;  1C4C A;  2IBK A;  1JQG A;  4Y2M A;  2HND B;  3B54 A;  2MJU A;  3PIP Q;  3ZZO A;  1VRT B;  4XDC A;  1H2V Z;  5DDQ C;  2FYX A;  3TAR A;  4RW4 B;  3HP6 A;  4LFA J;  3UN3 A;  2X51 A;  5DQG A;  2W9C B;  3K8W A;  3P3D A;  5HBM B;  5KFM A;  2E5J A;  4WYW A;  1MWQ A;  1ZTW A;  2RHQ B;  5D6G A;  3G8Q A;  3RBZ A;  1DHM A;  1RI7 A;  4X4S A;  3NRB A;  1E6V B;  2FHJ A;  2CQH A;  1RAO A;  4AND A;  4C97 A;  1RAF B;  1S6P B;  2C3U A;  3GG1 A;  3OVA A;  1B0T A;  1L5U A;  1E6Y B;  2BRL A;  2F63 A;  2FJE B;  1XMO J;  3CPW R;  2IM2 A;  4NWB A;  4I7F B;  2ZOM A;  2VFU A;  1H2U X;  5ETL A;  3HVT A;  4C8Y A;  2VJU A;  1Q8I A;  3R27 A;  1AUD A;  3G87 A;  1P27 B;  1KVJ A;  5LMN F;  4J9R A;  1VBY A;  2HHS A;  1WC6 A;  4RO0 A;  3N01 A;  1O51 A;  2R3V A;  4C6A A;  3DKD A;  5K8M A;  3TAN A;  3RR7 A;  3T1Y F;  5HRO B;  1JXV A;  4YHH F;  3SI8 A;  1SV5 B;  3BGR A;  1F2H A;  5HVH A;  4FBT A;  4F4Y A;  1S9F A;  2C2N A;  2ZOG A;  2HRY A;  3LGN A;  4ED0 A;  3R2C J;  2QLX A;  2YKN B;  2FVC A;  1RHU B;  4H4O B;  3RRG A;  1EAR A;  3IM8 A;  2UUW A;  1C2P A;  2KT5 A;  3IA0 A;  3ZXW A;  5E3A A;  1ZM3 A;  2MY8 A;  3R9L A;  3HJV A;  3DGP B;  4F3M A;  4CLW A;  3I5B A;  1HYS B;  1A9N B;  2G2O A;  4GMK A;  3HVR A;  2MLX A;  2V8H A;  2IVM A;  2EWH A;  4P7T A;  4DQP A;  2GVZ B;  1N36 J;  2NYI A;  2ZHA A;  2ZH9 A;  3BO3 A;  2CQD A;  3JSM A;  1VHF A;  2MY7 A;  3DRS A;  3D0H E;  4C0H A;  4KGZ B;  4ZPC A;  1HNW J;  3UD5 A;  2YNF A;  4OI6 A;  1APS A;  2WW8 A;  2CFX A;  1YQH A;  2HMI B;  1C1C B;  1U2C A;  2MQM A;  2K7K A;  4HLB A;  2G2Z A;  1XBW A;  1TL4 A;  1YTY A;  2RQM A;  4H4K A;  3TWZ A;  3M8S A;  1IQZ A;  2RQ4 A;  1HL6 A;  4IQX A;  4LSN A;  2I8E A;  3G9C A;  1LWE A;  3DYA B;  2OI2 A;  1XN9 A;  2WON B;  4N76 A;  4A8M P;  3CD5 A;  3DLG A;  2YWF A;  3SXL A;  2JEG A;  1JLA A;  3FSX A;  4LFC F;  3LTO A;  4USJ C;  3U1M A;  4RNO A;  2QLJ B;  1R0A B;  2VPY B;  1A7G E;  3S7R A;  1TV6 B;  2BOP A;  4DV4 F;  3HPO A;  4R0E A;  4LF4 F;  4NLV A;  3O6Q A;  1KTV A;  2BXJ A;  5K8O A;  4O3R A;  1FI4 A;  4F26 A;  1K44 A;  5GAG U;  3QNW B;  3EZ5 A;  2B6A B;  2ZWP A;  3IGV A;  2P6T A;  4NXM F;  1YSJ A;  3W2V B;  2JC0 A;  1RSC A;  4QU7 A;  3HDS A;  2EKY A;  2ZM6 J;  3AOD A;  5A8W B;  2VBZ A;  2A1B A;  1CBK A;  2Y3Y A;  4HI2 A;  1RWK B;  5M2R A;  3GYX B;  1RT7 A;  3G4S S;  4JI4 J;  3D9B A;  1LXN A;  3THV A;  1M5S A;  2E1A A;  1QE1 B;  3QWP A;  4QW9 A;  1PC4 A;  3IC1 A;  1ZM2 A;  4JUZ A;  5F0U A;  2IYI A;  4JB8 B;  1UTA A;  3OL9 A;  3D1O A;  4RZR A;  3AJ2 A;  1VI7 A;  3ZZP A;  2X1A A;  3CDW A;  3LP2 B;  1HBU B;  1KOH A;  4WYL A;  4KHP F;  3W5Y A;  2HEK A;  5HVF A;  4IH6 A;  2V4J B;  3MM6 A;  2XWY A;  1H3D A;  2QO3 A;  4F4Z A;  1KWM A;  1XWL A;  3I32 A;  2Z56 B;  2GVD A;  2DTJ A;  1HKA A;  1NH8 A;  1TTH B;  4Q44 A;  4YB7 A;  2IIH A;  1N34 F;  3PHE A;  3KK3 B;  5B7W A;  4N7T A;  3OLA A;  3EYZ A;  1GMU A;  1HQE A;  1Q81 T;  1AT1 B;  1NDK A;  3SDE A;  4LJM A;  4UOF A;  3IR5 B;  1ZZF A;  2OEM A;  2PA8 D;  4YME A;  5LT5 A;  3KUE A;  5D4L A;  2KG1 A;  1TL3 B;  4C8O A;  1ZAW A;  2DGO A;  2EK1 A;  1MU2 B;  2AEJ A;  3IBC B;  3QSI A;  3MCS A;  2ZDP A;  2UZA A;  2F8M A;  1RQ0 A;  3V6D A;  1S1U A;  2BZ2 A;  3MPV A;  2KXH A;  1CJU A;  2HS4 A;  3H25 A;  1IKV B;  4PG7 A;  3FUY A;  1N54 B;  3T9Z A;  3BR8 A;  4M5G A;  3NAH A;  1NPP A;  4NLO A;  3W2W A;  1IKY B;  4ZIT A;  2LDY A;  4CCH A;  1BQM A;  2VON A;  3N6N A;  4LF5 F;  3CJ3 A;  3G6X A;  3SV4 A;  3O3L A;  2BOA A;  2PD1 A;  1RT2 B;  2P9E A;  2XSJ B;  3DOM A;  3PIO Q;  3D3B J;  2QC3 A;  1TKX B;  2EFP A;  3T1H F;  2KXN B;  3I9Z A;  1WDD A;  4F4W A;  2CRL A;  1T03 A;  1S9E B;  2FHK A;  1AUS L;  3DHX A;  4DL6 A;  4G65 A;  2QG9 B;  4K5R A;  5T41 A;  2RIJ A;  5L1L A;  3CCU S;  3MM8 B;  2Q79 A;  2CPY A;  1S97 A;  4O44 A;  7FD1 A;  2AEM A;  1C4A A;  2LEB A;  2GNK A;  4FZV A;  2E7X A;  1EKR A;  4WII A;  4WCE Q;  4K4Z A;  2RS2 A;  4Y34 A;  2K1R B;  4OFZ A;  5GAD I;  2VOP A;  3GIL A;  2DCL A;  3TNV A;  4XPE A;  2MZ1 A;  3C16 B;  3HHL B;  4H54 A;  1J5E F;  1VQS A;  3D1Q A;  5H9E J;  5K5M A;  1HHS A;  2A2D A;  2WHO A;  3EMT A;  4E98 A;  3GR1 A;  4LRF A;  3Q8R B;  2JHE A;  1FVS A;  1HHQ A;  2Z2M A;  3D54 A;  2B4U A;  2ILY A;  1M5K C;  4M63 A;  4DPY A;  4LF8 F;  2ZOF A;  1FHT A;  4WE1 A;  3QT5 A;  1FER A;  4NI2 B;  2W4P A;  1HLW A;  3CJ0 A;  3FBF A;  2Y9H A;  2ZE2 A;  2OKQ A;  2Z57 B;  4DR1 F;  3RBD A;  1C0T A;  4QBU A;  3N4W A;  1YJ7 A;  3LWL A;  2BRK A;  2PFF B;  3J7Z 5;  4KC5 A;  4GC6 A;  5C7P A;  4WZM A;  3MEE B;  1Q8K A;  3H2L A;  4OIX A;  5DS7 A;  4CO4 A;  1D3W A;  2JOQ A;  2JEJ A;  3BGL A;  1RYS A;  3ILI A;  3AFG A;  4JI1 F;  1X7V A;  2H4W B;  5DQI A;  2DIS A;  4KGV B;  4UY8 T;  4PWD A;  1NK9 A;  2HNY A;  2Z2Z A;  3C2P A;  1S57 A;  1UP1 A;  3RYL A;  1BWV A;  1REV B;  2JRS A;  2ZBR A;  1WSR A;  1J2V A;  3SZ2 A;  1SL0 A;  1U6B A;  5C24 B;  1I6J A;  2NSB A;  1CJT A;  2HFU A;  4KKO B;  1U1R A;  2RDI A;  2G0I A;  3GLJ A;  2DNQ A;  4ED8 A;  4KBI A;  3CO0 P;  3OTC A;  3B82 A;  3FC9 A;  3Q22 A;  1Q53 A;  2Q43 A;  3G82 A;  2YWG A;  2RNE A;  3T5L A;  1OMS A;  1KQK A;  1UVI A;  4C11 B;  1ROF A;  1HBO A;  5KOX A;  2CYY A;  2FPH X;  2LYV A;  4KYZ A;  2HZC A;  1IR0 A;  4X64 F;  3VHQ A;  1QAY A;  1VQ4 S;  2DNZ A;  4LSL B;  1B4S A;  2D3O R;  4OX9 J;  2G1D A;  1RA6 A;  4ZCI A;  4PR6 A;  4DPT A;  5C25 B;  3CMQ A;  2HZA A;  1S59 A;  2NQP A;  2IAJ A;  4B9U A;  4FKX A;  3CJK B;  2ATL A;  4TU7 A;  5I3Q A;  4I64 A;  5IOL A;  2XMM A;  1MN7 A;  2WVB A;  4TY9 A;  2XMA A;  1JLF A;  4OZ2 A;  4I67 A;  5D3G B;  1P1L A;  2P9C A;  3RB6 A;  5J1E B;  2C1E B;  3HLU A;  3B4D A;  2V68 A;  3P49 B;  4YN3 B;  4HH1 A;  4DV3 F;  3M30 B;  5FDL A;  2EBE A;  5IWA J;  2MKK A;  4U7U K;  4KAI A;  1DTQ B;  2KT2 A;  1UJ6 A;  2NLW A;  3CD0 A;  3L7U A;  5B0G A;  4QZV B;  1ZPV A;  5IC6 B;  1K73 T;  3EPI A;  1FD8 A;  4DL7 A;  3NGS A;  2AD9 A;  4ZJL A;  3TUP A;  5HQM A;  5GMD A;  1M5V C;  4DV2 J;  3DLK B;  3MAA A;  1CS4 B;  1RAI B;  3VAM A;  2J9D E;  2GHP A;  3W8P A;  4ATN A;  1XMO F;  2B7B B;  4RUB A;  4RW4 A;  1Q86 T;  1HPZ B;  3HHL D;  5IM0 B;  3W5Z A;  4WP8 A;  2AX0 A;  2F8H A;  5BYS A;  4MK7 A;  2R7X A;  1L3T A;  4USV A;  4K50 A;  3OR2 A;  5HP1 B;  2W9C A;  5D4P A;  5HBM A;  1O6X A;  3ITH A;  1YI2 S;  3IR7 B;  4OHW A;  5BYR A;  1R27 B;  4OYM A;  1HNZ J;  1RTI B;  1WC0 A;  3EX7 B;  2G9O A;  3CCZ A;  2J7U A;  1P1T A;  4B9M A;  1U1K A;  2A18 A;  4TY8 B;  3N9U C;  2FZC B;  2VB6 A;  3N6L A;  2DR6 A;  5HAN A;  3SCK E;  1DLO B;  1E6Y A;  3KLI B;  4RUA A;  2YWK A;  2HG4 A;  2LU2 A;  1SJ3 P;  4I7F A;  4JI5 F;  1EQM A;  2FTR A;  4DI6 A;  5DGB A;  1U24 A;  1XC9 A;  1KP6 A;  2ZNZ A;  2ZBP A;  1IVZ A;  3HT3 A;  3W5X A;  4ECQ A;  2L08 A;  4PAA A;  1S4F A;  2WVC A;  2PDA A;  4DPO A;  4DV5 J;  3HZE A;  2QA2 A;  3OV7 A;  4I56 A;  2GAH C;  3WQP A;  2CKW A;  4P2X A;  3GJQ B;  3RGI A;  5HRO A;  1RTJ B;  3FBE A;  3SIP B;  3J7A 1;  2CQP A;  3FRY A;  1MN9 A;  5GAH I;  5F8I A;  1U1O A;  1TFY A;  3I9V 9;  4CI0 B;  2YKM A;  5KAK A;  4GVB B;  2EBG A;  3DI6 A;  5HJY A;  1T9Y A;  3EVM A;  2YKN A;  3LPY A;  4X4T A;  3SCJ E;  5C42 B;  4RU9 A;  1JLQ B;  1UJ4 A;  3CCR S;  3OXG A;  1HD0 A;  4PCQ A;  2G1H A;  2LA4 A;  5J2M A;  1IWG A;  3A4T A;  1DAR A;  2K06 A;  4PWU A;  4RWW A;  2Q3P A;  2D3U A;  3R8Y A;  1ZZN A;  3IS9 B;  4KRW A;  3DGP A;  1U8S A;  1FFS B;  4XO0 A;  4FYX B;  2MKJ A;  1HYS A;  3P8B B;  1S6Q A;  3JTO A;  4NX9 A;  5AXN A;  3PW4 A;  3M8Z A;  4U8V A;  1S1W B;  2XCA A;  2NYH A;  2DNP A;  2L9W A;  3CJT A;  3QRQ A;  3KLH B;  4X66 J;  4M5H A;  4ECZ A;  3CJS A;  5F41 A;  2LQJ A;  2C2E A;  2HMI A;  1TFW A;  4ZPW R;  1HFE L;  5AJ3 F;  2PO4 A;  3CME S;  2VIC A;  5G4D A;  5A8R B;  3UDE A;  4C3K A;  5C5J A;  2ZM6 F;  1P9Y A;  4HYK A;  5HMZ A;  1TL1 A;  3Q0A A;  5LM7 E;  1Q4R A;  3Q89 A;  4OX6 A;  3SCL E;  2Z0G A;  4JI4 F;  3CIZ A;  2F9J A;  2A10 A;  1UMJ A;  1EET B;  4IH5 A;  1TV6 A;  2KZZ A;  2UUA J;  2FJV A;  3NBP A;  4DFM A;  3KUH A;  2NZC A;  5DDO C;  2XGP A;  2DNY A;  3OSN A;  2PII A;  1S6O A;  1G7C B;  2MTL A;  4PQA A;  2B56 A;  2H3E B;  3A8E A;  1R8B A;  3H42 A;  3US5 A;  2YQ3 A;  3UD3 P;  1QAI A;  3I56 S;  4Y2K A;  5DQH A;  2B6A A;  3CCS S;  3TUJ C;  3AJ1 A;  2DY1 A;  4F36 A;  2DR9 A;  4V1A k;  4OYA A;  3VGS A;  3W2V A;  1BQN A;  2Y1J A;  2H1Y A;  2B5J B;  2I2Y A;  2C2K B;  1N88 A;  5KFZ A;  1SH3 A;  5A8W A;  3RG6 A;  2RQC A;  2M0G B;  2VUG A;  3PJW A;  1F9F A;  1NCL A;  4QYZ J;  4RW6 B;  3QFW A;  2JVO A;  1FEH A;  1TMJ A;  5DM7 Q;  1EX8 A;  4Q2M A;  3BKT A;  4UUW A;  4TKT A;  2ROG A;  1DQ9 A;  2KM8 C;  2GJF A;  1UZD A;  3BQ0 A;  2OMO A;  3UD4 P;  3LP2 A;  1HBU A;  2CVI A;  1UW4 A;  1JJ4 A;  1S0O A;  3IXQ A;  5ETK A;  1WKL A;  2R8K A;  2V4J A;  1FRL A;  4LBI A;  4G6V B;  3FVY A;  4NLY A;  3N5F A;  1T7P A;  2QFJ A;  1CJV A;  3V4M A;  1WHY A;  2OLW A;  1VS3 A;  3MCO A;  1SKW A;  2BJ3 A;  1FDB A;  2H54 B;  5D0G A;  3KK3 A;  2I9S A;  5FJ4 A;  3SSS A;  1U0H A;  2NXU A;  2MZT A;  2W01 A;  1VQM S;  3QJP A;  5HMX A;  2XM3 A;  4TNO A;  1TL3 A;  3RAQ A;  1JMT A;  2W24 A;  2HHQ A;  5EX3 A;  1MU2 A;  4FXD A;  2IA0 A;  5ETO A;  1WSV A;  3OTE A;  3PW5 A;  3H2V E;  1S72 S;  3L3C A;  4B3O B;  1IQT A;  3ENV A;  2IBO A;  4P2S A;  4ES2 A;  3D2W A;  2V94 A;  4LF1 A;  1SJF A;  2LEC A;  2K7J A;  1IKV A;  4C9D A;  4IDK B;  5E7O B;  2UVW A;  3AOC A;  5CYM A;  1Q8L A;  3BSN A;  2A6M A;  1NK5 A;  2JVR A;  3M32 A;  4J90 A;  4K2J A;  2CJK A;  5LSO A;  4R25 A;  3T1A A;  1I1G A;  4P9S A;  4ZIV A;  3NGU A;  2BJ1 A;  3GIK A;  1NKE A;  3WX8 A;  1DJ0 A;  1MLA A;  1RWM B;  5J2Q A;  1TK8 A;  4X4Q A;  2ZD1 B;  2QEX S;  3GFZ A;  4FF1 A;  2P8I A;  1VOM A;  3IWL A;  1S49 A;  1AFI A;  5GAG I;  2UVU A;  3M9M B;  3IAM 9;  4ZP9 A;  1SC3 B;  4PUO B;  2OP5 A;  3LH2 S;  2NPI A;  4J9U E;  2V34 A;  4WFN Q;  4I2Q B;  2VFR A;  2V8G A;  2ZVI A;  4Y65 A;  2RQK A;  3SFG A;  2MJN A;  3D28 A;  3U02 A;  1S1X A;  4BWM A;  2V4R A;  4NA3 A;  2CJA A;  3L95 X;  2EK6 A;  3HFV A;  3P4U B;  5T7L A;  1LW0 B;  4DPX A;  3UR0 A;  3MMJ A;  3Q23 A;  3GJT B;  3C16 A;  4QWC A;  1Y4Z B;  3HHL A;  4LR9 A;  3UR3 C;  1YZ7 A;  2XO6 A;  3KUG A;  4K4T A;  2MLZ A;  3HSD A;  1NHU A;  1JLB B;  5ETT A;  2XMW A;  1X4A A;  4U95 A;  2W25 A;  2ASJ A;  2MQ8 A;  3NEK A;  3HI9 A;  2B3T B;  4L3N A;  1OQ3 A;  2HNZ A;  1MRO B;  5HJX A;  4G3I A;  1VC5 A;  4NI2 A;  2NZ4 A;  4DFK A;  4NEY A;  1UVJ A;  4F8R A;  2GHV C;  4MT1 A;  3EDR B;  3ZFV A;  4PXD A;  2BE2 A;  3IFE A;  4YUD A;  4RR5 A;  1BLU A;  4DPU A;  1I3O B;  3JYT A;  1RU2 A;  2XZD B;  3BO2 A;  4OYO A;  2BAC A;  3C6T A;  1EP4 A;  2DNL A;  2FC8 A;  3ENA A;  4USH A;  2BR0 A;  1AFJ A;  4OX9 F;  4A4J A;  3EGV A;  1NBE B;  1X4C A;  2AYE A;  1JLE B;  3P5B P;  1KS2 A;  4Z37 A;  4B3T F;  2J8S A;  4OQJ A;  4EUV A;  3GTY X;  3ELH A;  5C24 A;  4DLG A;  2KO1 A;  4KKO A;  2ZC4 A;  5KG0 A;  2ZC3 A;  2XZT B;  2ZH1 A;  4DBQ A;  5LL6 d;  3HSG A;  3OFF A;  2JSX A;  5KFQ A;  3RAM A;  3M2V B;  1UCN A;  4C11 A;  4CWB A;  5L1J A;  1X4F A;  3HHK A;  3IG1 B;  3RRH A;  2WB4 A;  1J27 A;  4UTG A;  3H59 A;  2VV5 A;  3OD2 A;  1NJI T;  3FRZ A;  2HYI B;  1BXN A;  3Q2S C;  2YQ0 A;  5BXI A;  2FJA B;  3CDB A;  5C25 A;  5LJ5 Y;  5CH7 B;  1IN0 A;  4ZOS A;  2B7C B;  4I68 A;  4USW A;  1R8A A;  3RB3 A;  3OL8 A;  4OV6 A;  3BO4 A;  3FCH A;  4WWS A;  5D3G A;  1FNM A;  4F0K A;  2OAU A;  5J1E A;  2Y8W A;  4RW7 A;  2BVZ A;  2EW9 A;  3EJM A;  4X4O A;  3K5O A;  1FD2 A;  4DCO B;  2DRB A;  2QZ8 A;  4W4M A;  1JKH B;  4CIO A;  1DTQ A;  4NML A;  1RT1 B;  1R89 A;  4K5S A;  3EGN A;  3PM9 A;  5E3P A;  2MKC A;  3HSJ A;  2ZBI A;  2WBR A;  1S0M A;  3RBX A;  2VG5 B;  4K4V A;  2LEP A;  4DQS A;  2X1F A;  4DLE A;  2HW3 A;  3KHH A;  2PGC A;  5KFE A;  2MKS A;  2RIL A;  3EZU A;  3DLK A;  5IT4 A;  4WZQ A;  4J9S A;  4LRA A;  3THT A;  2V6A A;  1TKT B;  2XG8 A;  2CXE A;  3TO8 A;  4CH0 S;  3KHG A;  1H74 A;  5IM0 A;  3W64 A;  4F25 A;  3L4B C;  4JI7 J;  2LMI A;  2CJB A;  3MMB A;  5HP1 A;  2F65 A;  3HF5 A;  3DM2 B;  2QL9 B;  3HHE A;  5EUH A;  1RWP B;  1PYO B;  5ITH A;  1S12 A;  2OTL S;  1OYD A;  3FJ2 A;  2AZ1 A;  3G6E S;  4OJ1 A;  4C98 A;  3BBC A;  2NXN A;  2CAD A;  1XQI A;  2AV5 A;  4LRC A;  3H5U A;  4M8L A;  4ZVH A;  4TY8 A;  2RRN A;  5F3T A;  1EZZ B;  3QT6 A;  1IUJ A;  2XYH B;  5SUH A;  3I6P A;  3UVJ A;  3S6E A;  4HDG A;  3KLI A;  2BDP A;  2HIQ A;  3BB5 A;  2OJ3 A;  5GAE U;  3A8I A;  2IPO B;  3TJ9 A;  3T9N A;  2YKA A;  3OT9 A;  4U9R A;  4IUF A;  3CIM A;  4UUX A;  4FBU A;  4QW8 A;  4IFV B;  4WP9 A;  2ACY A;  3ENQ A;  4B9L A;  1U6Z A;  2HHH J;  4ELT A;  5L1I A;  5IV3 A;  1RT3 A;  1N0U A;  3DLE A;  1C1B B;  1WHV A;  4QWA A;  1OQ6 A;  1HA1 A;  1VBK A;  4HHH A;  8RUC A;  4FPR A;  3DMJ A;  2HBZ B;  5HAO A;  1S0N A;  2LDI A;  1HQU B;  1DUR A;  4X66 F;  1Q82 T;  2Y0S D;  3A13 A;  1YJW S;  3GG0 A;  4RBU A;  3NKY A;  5C42 A;  4R8U A;  1JLQ A;  1S4E A;  3DOK A;  1VBX A;  4A8Y A;  4EEY A;  4EMD A;  3AB4 B;  3BH7 B;  4DEZ A;  3M1V B;  4Y2I A;  2WK4 A;  3MMA B;  4CYU B;  5K8N A;  1N5Y A;  1W2B R;  1N32 J;  1P8G A;  3W62 A;  3M6X A;  3V4I A;  1FJG J;  2CPI A;  4HAC B;  1NUE A;  2WW4 A;  3IR6 B;  3T41 A;  1UVN A;  1VQ5 S;  4I6Y A;  1D9F A;  1NSQ A;  2FD2 A;  1RAJ A;  2UUA F;  1T05 A;  3KLH A;  1UL3 A;  5D4O A;  4AXJ A;  3DGV A;  5B0C A;  1A0O B;  1R0C B;  4X65 F;  5CHC B;  2BM0 A;  3SYZ A;  1WHX A;  1QUP A;  5KG3 A;  1NPR A;  2YQ1 A;  4EYH B;  4Q5V A;  4NL5 A;  3H5X A;  4JYA J;  2YVS A;  3T19 A;  1CSJ A;  2IY5 B;  1UJ5 A;  3MEC A;  2HS3 A;  4O3S A;  5A8R A;  3UCZ P;  4DX5 A;  3U7J A;  4LUB A;  1VIX A;  2CPZ A;  4CQ1 A;  3QIP A;  5BR8 F;  5B0E A;  2BJ8 A;  3HHN B;  1KSP A;  2LXU A;  3PCO B;  3LQV A;  4OHZ A;  1GEH A;  1EB0 A;  3OTO F;  2U2F A;  4HTJ A;  2AGQ A;  5D4N A;  3AAW B;  2GQ2 A;  5D77 A;  2XYP B;  2E5I A;  1FE0 A;  3V6J A;  2F40 A;  2HRU A;  1SL2 A;  3JAM Y;  2HSE B;  2UV8 G;  4ETX A;  4OI4 A;  4KFB A;  2Y1R I;  1YVF A;  2JZ5 A;  1K47 A;  2HQF A;  5I3U A;  1FRH A;  1NK4 A;  2MZJ A;  4PG5 A;  1RZM A;  2FHO B;  3WBZ A;  4KY3 A;  2HAI A;  2KHD A;  4LRE A;  1K1Q A;  2B5J A;  3B8H A;  4F4A A;  2O66 A;  1GTH A;  4AYB D;  4CP5 A;  4ED7 A;  3OXL A;  1BWE A;  2QA4 G;  1TEL A;  1RTD B;  2R2R A;  1QSS A;  2IM0 A;  1FRJ A;  4CO0 A;  2MSS A;  2I6W A;  1X5T A;  3MM5 A;  3CCM S;  3IWN C;  1B0P A;  3J81 Y;  3HXM A;  4QPX A;  2BYC A;  5DG7 A;  2L3M A;  1X4B A;  3AD8 C;  2CQ2 A;  4RWX A;  4YEA A;  1OY8 A;  3QO9 A;  4ZPD A;  1U1P A;  2R7O A;  3K17 A;  1TAQ A;  3A3N B;  3FMW A;  2Y8Y A;  3AXM A;  1NJZ A;  2XLJ A;  2I38 A;  4O23 A;  1SC4 B;  1FDN A;  3GSI A;  2EFV A;  3CTR A;  4YHH J;  2MQN A;  1GFW B;  1NJY A;  2HVD A;  3EZO A;  3H5Y A;  3KJN B;  4MAK A;  1O5J A;  4QR1 A;  1VYA A;  4O3O A;  5A2Q U;  3AA8 A;  4IFY B;  4ANE A;  2UP1 A;  3GII A;  1FNX H;  2XI2 A;  3ULH A;  2Q6C A;  1HNX F;  5IC4 B;  3NCR A;  4DL4 A;  2VKZ G;  2N4D A;  2JLG A;  1KVI A;  4B3O A;  2G0C A;  3S01 A;  1YBA A;  1IKX A;  2QYC A;  4CH1 A;  4X4U A;  3PO5 A;  4ZPV R;  2YWE A;  1JWW A;  2IRU A;  1SH2 A;  4GRS A;  2AT1 B;  2LXF A;  1WAC A;  1Y11 A;  3ZTP A;  4KGX B;  2R7V A;  4ITS A;  2VFT A;  4IDK A;  5KG2 A;  2X3G A;  3GU0 A;  3DRP B;  4JI0 F;  2GS8 A;  2NXE A;  3PRV A;  3MR6 A;  2ZNY A;  1Q79 A;  1TMM A;  3HZG A;  2J7K A;  4FNH A;  2OGU A;  2QT7 A;  5KTQ A;  1WEZ A;  1EQ0 A;  3SCI E;  3UCG A;  3CSK A;  1VQ7 S;  4UZB A;  2KM8 B;  3I0S B;  1RT6 A;  1HHT P;  4ZJQ A;  4IOB A;  4CLP A;  2QSW A;  4FVM A;  4B9N A;  1F3V A;  5KOW A;  1CUL B;  4UOG A;  3MAH A;  2YH1 A;  3MPY A;  2C2Z B;  2ZD1 A;  4PQU A;  3GV8 B;  2R2T A;  1LV5 A;  2RT3 A;  3G6V A;  1C0U B;  4KE5 A;  3HJF A;  4JI2 J;  4OZ3 A;  5H9F J;  5EWF A;  5LSR A;  2DPI A;  3ILJ A;  4NRT A;  2IA6 A;  4ZVR B;  4HI1 A;  2RU3 A;  2KL8 A;  3P6Y C;  2KG0 A;  4PUO A;  4M5M A;  3SQG A;  2OFH X;  4WTY A;  4LFC J;  2BV3 A;  4I2Q A;  2JFK A;  1NXI A;  4ZKA A;  4LMZ A;  4H4K C;  2W4C A;  4N5S A;  4HKQ A;  4CO3 A;  1PAU B;  1ZS6 A;  3DN9 A;  1X0F A;  2CJ9 A;  2DY9 A;  2A3J A;  1VQY A;  1N52 B;  3GFY A;  4DV4 J;  2CNL B;  4NLR A;  2V5H G;  3M2R A;  1X9M A;  4LSZ B;  1LW0 A;  1Q5Y A;  1CQM A;  1CC7 A;  2VC1 A;  1PO6 A;  3PW2 A;  4NXM J;  1FE4 A;  3BZQ A;  4K4U A;  4KSE B;  3E01 A;  3OR1 B;  4YB6 A;  4ECR A;  3K2Y A;  2J6U A;  2CVE A;  1WOO A;  3BN4 A;  3MPD A;  3TA0 A;  3DLH A;  1Q78 A;  3NS6 A;  1I5O B;  2NRE A;  4JP8 A;  2KB2 A;  3SMZ A;  2HQC A;  1MRO A;  4IOC Q;  3BYR A;  2ATC B;  4M95 A;  2WSC C;  1LEO A;  1OPZ A;  3EM1 A;  2RS8 A;  2XO7 A;  2OPP B;  2LFV A;  5CAA A;  3PFE A;  3DHW C;  2DHX A;  1Y7P A;  3RW6 A;  5CYJ A;  1LXJ A;  3J80 Y;  5IS2 A;  2LQ5 A;  3G6Y A;  4EZ9 A;  4DSK A;  4K8R A;  3JXO A;  2DJW A;  4ID5 A;  1Y10 A;  3GB0 A;  1GXL A;  2P2C B;  4C8Z A;  3BSC A;  4NYP A;  2XTJ P;  2KFZ A;  2ZIT A;  5GVQ A;  4PPD A;  2C3Y A;  2HKE A;  2JH3 A;  3B6B A;  6FD1 A;  1VQ9 S;  1QAX A;  3OHB A;  4C8M A;  4L74 A;  4QJV A;  2WBM A;  2WVF A;  3DRR A;  4P52 A;  5DM6 Q;  3W3S A;  2AYG A;  2HHT A;  5ETP A;  2WB1 D;  5CAB A;  5KFD A;  4NE9 C;  3M2V A;  4B17 A;  2D74 B;  3AJD A;  1FTC A;  4HEA 9;  4RW8 B;  2OPQ B;  3VGV A;  2EFN A;  3PY8 A;  2H5J B;  5L46 A;  3PO4 A;  4C8L A;  3MM7 A;  4O3Q A;  1LQ9 A;  3A8J A;  1S1V B;  5AXL A;  1F1B B;  2MKI A;  1G1X A;  2DR7 A;  3VGU A;  2FLN A;  2CDQ A;  1WEL A;  4NRU A;  4UZC A;  2CQG A;  5ETN A;  5DGA A;  2DR5 A;  2L48 A;  4ZPA A;  3JTN A;  4DR4 J;  2GML A;  1GXU A;  2XYG B;  1SJ1 A;  1VLY A;  1TKD A;  1ITP A;  1HWL A;  1RAG B;  2COL A;  3NS5 A;  4X2B A;  4ER8 A;  4K2X A;  4AL5 A;  4ZHR B;  1PIE A;  3RBE A;  2EFQ A;  2E1R A; 
#chains in the Genus database with same CATH homology
 3NS7 B;  2CJX B;  3IBC B;  1NME B;  3IBF B;  1QTN B;  1RWK B;  1SC4 B;  1I51 B;  4DCP B;  3GJQ B;  1RWV B;  2CNK B;  1RWX B;  2CNN B;  3SIP B;  4ZVU B;  2QLF B;  3KJQ B;  2C2Z B;  1SC3 B;  1RHU B;  1GFW B;  1SC1 B;  1BMQ B;  2C2K B;  4ZVS B;  3KJN B;  3R7S B;  3GJR B;  2DKO B;  2C2O B;  1F9E B;  3GJS B;  4JB8 B;  2QLB B;  3RJM B;  3EDR B;  3R7B B;  1RHK B;  2H4Y B;  4ZVR B;  2CDR B;  2H4W B;  2Y1L B;  2QLJ B;  3R7N B;  1RHJ B;  2H51 B;  2QL9 B;  1I3O B;  2C1E B;  2H5J B;  1RWN B;  5IC4 B;  3P45 B;  1RWP B;  1PYO B;  4ZVQ B;  2XZD B;  2HBZ B;  2HBR B;  3D6H B;  2Y0B B;  3D6M B;  4ZVP B;  2HBQ B;  3P4U B;  1RHM B;  1PAU B;  1RHQ B;  3GJT B;  3R6G B;  4ZVO B;  3QNW B;  2HBY B;  4DCO B;  1RWO B;  2CNL B;  3R5J B;  5IC6 B;  2CNO B;  2QL5 B;  2XYG B;  2H5I B;  3EDQ B;  1RHR B;  2QL7 B;  1ICE B;  2P2C B;  2C2M B;  1QDU B;  1RE1 B;  2XYH B;  5K20 B;  4LSZ B;  2FQQ B;  4DCJ B;  1RWM B;  2CJY B;  3R6L B;  1RWW B;  2XYP B;  2H48 B;  4ZVT B;  2XZT B;  1IBC B;  3KJF B;  2H54 B;  3D6F B;  2H65 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...