2QLJB

Crystal structure of caspase-7 with inhibitor ac-wehd-cho
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
KIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-7
publication title Plasticity of S2-S4 specificity pockets of executioner caspase-7 revealed by structural and kinetic analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 16
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2007-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2qljB00
1F9EB 2H5IB 1RWNB 3IBFB 2QL7B 2Y0BB 3D6FB 3QNWB 2H51B 5K20B 1QTNB 3P45B 3IBCB 4DCJB 2H65B 3R6LB 3GJSB 2XZTB 2Y1LB 2C2ZB 3NS7B 3KJFB 2C2OB 2FQQB 1I51B 1GFWB 1PYOB 3KJNB 1RHUB 1RHKB 4ZVRB 1RHRB 4ZVTB 2QLJB 1BMQB 3R6GB 2CNLB 3P4UB 2HBRB 1PAUB 4LSZB 1SC4B 2C2KB 3RJMB 2H4YB 1IBCB 2QL5B 3D6HB 2XYGB 3EDQB 2CJXB 2CNOB 4DCOB 4JB8B 2XZDB 3GJQB 2C2MB 1RWPB 2C1EB 2XYHB 1RWKB 3EDRB 3GJTB 4ZVUB 2DKOB 2H48B 2HBYB 4ZVOB 2HBQB 1RWMB 2CNKB 2CNNB 2QL9B 5IC4B 4ZVPB 1NMEB 1RHQB 2H54B 2CJYB 4ZVSB 1RWOB 1RWWB 4DCPB 3R5JB 3R7NB 2H5JB 1SC1B 1SC3B 3KJQB 2H4WB 1RE1B 2HBZB 2QLFB 1RWVB 1QDUB 3R7BB 3SIPB 5IC6B 1RHJB 2CDRB 4ZVQB 1RHMB 2QLBB 1RWXB 2XYPB 3R7SB 3GJRB 2P2CB 1ICEB 3D6MB 1I3OB
chains in the Genus database with same CATH superfamily
3SXLA 4B17A 3W9IA 1VQNS 3NS7B 1SVDA 1T8EA 1FRJA 4P72A 1B7FA 3POTA 5AXKA 2PI4A 4YDDB 4PWDB 1WTFA 4HACB 3B82A 4NLYA 2AYMA 1ZM2A 2YKMA 5DGBA 2XMKA 1R0BG 4GO5X 1UA1A 3HKZD 4O0NA 1DTTA 4J7CA 2J0XA 3MTJA 2GJIA 4N7TA 2JSXA 2M5YA 3FSXA 4YY3F 2C2RA 4WP8A 1UEVA 2B0GA 1QTMA 1HBUB 3L7UA 4ED4A 4DOZA 3M8QA 1VLOA 4NLGA 4ZCMA 3O3LA 5BR8J 2D3UA 3BO3A 4H4MA 2NXNA 4CI0B 1S4FA 4DQPA 2DH8A 4QWCA 4EBDA 4DV3F 2EC2A 4MKBA 4FYXB 2HMIA 3TYTA 3M2VB 2B9YA 3OL7A 1KHWA 3GFYA 3LP0B 4L74A 2EBEA 1VQ4S 3X1LB 3I55S 2IM3A 2Q79A 2ZBIA 2YNIA 2CQ1A 3PW5A 2J6TA 4PXDA 3MZIA 2I0XA 2CPHA 1V3SA 5DLGA 5IWAJ 1JMTA 1FTCA 2JDJA 5KFWA 3ZZYA 2MSSA 1IBMF 4QQBA 3VAJA 2CQCA 4ZVUB 3CJKA 2LDIA 3TRGA 3T41A 4DL0C 4P6QA 5AXNA 5J1NA 4RNFA 2W4PA 4J9UE 2DO0A 2LLZA 4NLOA 4DR3J 5KFQA 3T1HJ 2YX1A 4Z2XA 1X5OA 4EEYA 3P96A 2MLZA 1VQ8S 1R27B 5KFHA 1RWVB 1IKVA 2QV6A 1N33J 2RT3A 5CABA 2QMUB 2CQ0A 2NYIA 2QLXA 3I96A 1TUGB 3MM7B 1K73T 3MMCB 4KGKA 4TQSA 2QL7B 2WSFC 3P45B 1KEKA 3VALA 3W2WB 3J81Y 2RILA 2FJEB 2KFZA 2YKAA 1NJIT 2XLKA 3FEYB 1R8AA 5KTQA 1N48A 2D9OA 4PWWA 1H2VZ 1YRXA 2D3ZA 5C5JA 5H9FK 1NHVA 2QA2A 4XDDA 2ZKTA 4F4WA 1PSDA 3KHGA 5LOQA 4FKYA 3ITHB 2XYGB 3BZQA 1WEXA 4TVAB 1N5TA 3ETMA 2OLWA 2DR8A 2HEKA 3OFHA 1NB7A 3A8KA 1Q0NA 3SV4A 3TUPA 3AODA 4CTAB 3KLFA 2IAJB 3DLJA 5E2QA 2IC3A 3QJPA 4GKJF 5KFMA 4KJIA 2CADA 2RU3A 2FLNA 3Q22A 1H3DA 2ZNYA 4EGLA 4NLQA 4DV7J 2ZC4A 1WG4A 2FJDB 3KNGA 1F6TA 4CLUA 3HSJA 3DLEB 3OSPA 1FKOB 4YN3B 4GVLA 5KFUA 1YTYA 4E2FB 4DUZJ 6FD1A 1ZTWA 3HSGA 2VPXB 4URSA 4F3OA 1S4EA 3MCOA 1LW2B 2Y1LB 3VGSA 1CJUB 4HHUA 3ENQA 1U47A 4WF9Q 3N79A 2DYAA 3QGPA 1YZ7A 4ECSA 3HZEA 4A46A 3UWTA 1U2FA 4RW7B 2IMOA 1MSWD 3CE8A 4ZP8A 2A1BA 5D0EA 2KI2A 5KOXA 2W9AA 4WIIA 1HNIB 4JV5J 2P9CA 3BEGB 3CMES 4R5PA 4X4VA 3K57A 3FQKA 1NJXA 5IQ6A 1ITPA 2CJQA 5E3CA 2I8EA 4KHRA 4ETXA 4FYDA 4UQGA 2XS2A 1S79A 4QOTA 4P2MA 5D4OA 5FLXU 1WOPA 2ZHAA 4DEZA 3MUMP 4KAIA 2CAJA 4DDFA 4UUXA 3R7NB 3RGIA 1X0PA 2FHJD 4JI4J 1Q5VA 4IOCQ 5KFAA 2YX7A 4I69A 2F8HA 3NOGA 3TWZA 4CLLA 3I0SA 4DSEA 1JXLA 2P2CB 1OY9A 2E29A 1OQ3A 1N6QB 4UOGA 3FBBA 1S1WB 1IR1A 2QYGA 4HHJA 4HACA 1TQLA 1VISA 2CZ4A 3MEEB 1M5OC 5M2UA 4C0OC 1RCXB 4ICLA 4A8SA 2B5JA 3KMSA 3M8YA 2XBPA 1HBUA 3EDQB 1YI2S 4B9NA 2D41A 4MKYA 2M4MA 4KBIA 3LTOA 2MY8A 2QJ3A 4DV3J 1FWPA 2BM0A 1RWMB 5AE1A 2CNKB 1AUSL 3T6JA 4JI0F 1UJ4A 3P49B 1JLGB 4AXJA 3K5NA 2IM2A 4WBFA 5LL6d 3M2VA 3LF0A 1NB2A 4OI3A 3KG1A 3HLUA 3I9V9 2CPIA 4OYOA 1RYSA 4L76A 3H5YA 3UQSA 1L3KA 2JVOA 4BWJA 1AYEA 2RDDA 1R43A 1T03A 3O8WA 1LK5A 4ES1A 1SKWA 3UNGC 1IBMJ 1IVZA 4K4VA 4ANCA 3Q8QB 3ZZZA 1LWFA 4DU8A 5A0YB 4OZJA 2V0NA 2EG1A 1SC4B 5D0RA 3LAMA 5B08A 1KD1T 4USTA 1IBCB 2QMXA 3P5TL 1C4AA 1VK3A 1P6TA 4F67A 1CULB 4GC6A 1RWKB 2DBBA 1KQKA 2R7RA 1T94A 4LVOP 4ZS6A 4F4ZA 3SSQA 3OD2A 1XNQF 4WK1A 2YNHB 3MEDA 2R8JA 3CW2C 5I42A 3NGKA 4QIEA 2D69A 3O6QA 3BF4A 3AJ2A 3ISND 1PKUA 2BYCA 3GSDA 2VF3A 4DPXA 1S48A 1LKZA 2W4DA 4NWBA 4GVBB 3G8QA 1S6UA 3NCRA 4C7QA 2GO8A 2UP1A 1BC6A 1VQSA 3D1OA 2LFVA 1X60A 2Q6BA 1Q8IA 3ZO7A 2DIVA 1QAYA 3CCTA 2IBOA 4GKJJ 1OMSA 4DN0A 3VAKA 4W90B 4CTAA 1Z2LA 1NUEA 2AYGA 2HHHF 2OFHX 4RW6A 3FEXB 2HHSA 1GMWD 3IWLA 4UOHA 2DHAA 2MQ8A 1GMVA 1I1GA 3DLEA 2ZVSA 3TAQA 4RKUC 3RW6A 1FKOA 1HW9A 4ED0A 3V5RA 3E01B 2J76E 3KUHA 4NXNF 4WE1B 2DCUB 3T9ZA 2WBMA 3EZ5A 1RT7B 4X4TA 3HF5A 1CSJA 3HDSA 1SC1B 3N0VA 1H73A 1V9OA 1CJUA 2OHDA 2V63A 4P2FA 3IS9A 2A2CA 1K9MT 1S7IA 2AYBA 1SQFA 5KFGA 3ENVA 5DQIA 2Q6CA 3CXCR 5B0CA 1NPKA 1S9EB 3IM9A 1HBNA 1HNIA 1UCNA 1HR0F 3DOMB 4ZVGA 4ZPVR 3G8TA 4MKAA 3QT5A 2BABA 3AXKA 1S6QA 3QSIA 1HQEB 1PC5A 5F41A 4AT1B 3MAAB 1KONA 2XB2D 1NSQA 2V4QA 2COLA 2FD2A 4FXWA 5JMNA 2XI3A 3KHHA 2FJAB 3KK1B 4J9OA 1JJ2R 5KFYA 1KFSA 4ZN1A 2ZNZA 1KBRA 2AJ2A 5C2CA 4ED2A 4A8YA 1C0UA 5KFNA 3MOZA 3HVWA 3MEEA 2CDRB 1TL7B 4LJMA 4K4UA 3MD1A 2XM3A 2RNEA 2D3OR 2NSBA 4F4KA 1C2PA 4DQQA 3CIMA 1WC1A 3M6UA 4KGZB 2C2OB 2OUGA 2IRUA 4J9RA 2CVEA 3BR9A 3IRWP 2D9PA 4URQU 2KM8B 2DPJA 1S97A 4RLEA 4JI0J 5A8WA 4DG1B 3HT3A 1RKIA 3JTOA 4DV2F 1EIYB 1JLQB 1D9DA 1CG2A 1BWEA 1JLGA 4DQIA 2IJRA 4IUFA 1RWPB 3F73A 3EGVA 2W7OA 2BE2B 4GMKA 4ZVOB 3V81A 2N7YA 2OKQA 3KDNA 4CO2A 5KG1A 4AL6A 4PXBA 4K0KF 1B70B 4QR0A 2OPQA 1S77D 2FVCA 2I38A 2KJVA 3FZBA 3GIJA 1RABB 3B4MA 4K4YA 4U7CA 5ETPA 5KFCA 2ZKUA 2RUSA 3DOLB 3L9ZA 1XC9A 1IBLF 5KFXA 3HXMA 2IHR1 3VQSA 1PO6A 2E1CA 2QN6B 3A1YG 1H2UX 3R2DJ 1ZM3A 4Z7CA 1CULA 1HI1A 2N3OA 4OZ0A 4FF3A 1LQ9A 3GG1A 2MSTA 1KC8T 2E5IA 3KXDA 3DRSB 2JH3A 3D9BA 3G96A 2R4FA 2K8GA 1TU0B 3N4WA 3Q83A 5HBMA 2B43A 2VG6B 1GNKA 1U1QA 1FF2A 4YEAA 4JI6F 2MQLA 3JSMA 5LJ3Y 2PA3A 4IRDA 3C46A 3HHLB 2IRYA 2FPHX 4N77A 4PWUA 2QA4G 2RB7A 3LWMA 1N32F 3SZ2A 5LMUF 3HVTB 1UWBA 1RWOB 3GFHA 1FX4A 3R1LA 3IWXA 2HG4A 2VPWB 2X1GA 2V8GA 3M8PB 1NDLA 2GC8A 1VDHA 3KWMA 5LT5A 4DFKA 2DHGA 5LSRA 1WSVA 4DF8A 3M2RB 2HWHA 2D7SA 3NGSA 3UCGA 5ETVA 3CMAS 2A18A 3NMAA 5HATA 1D8ZA 2DR6A 1K47A 2XQCA 2ZM6F 2EFPA 1ZA1B 2AWZA 1GXUA 2HWIA 3G4SS 3A8EA 3A3PB 4TQRA 3DHWC 3CT9A 2BJ8A 2KVIA 3BBBA 4LRBA 1KKHA 4NXNJ 3C66A 1TL3B 1QSYA 1R0AA 1EB0A 1WKLA 4USHA 2B8PA 1AA1B 5HAOA 1U1NA 3O1LA 3GONA 4RW4A 1S0NA 4ZP9A 3K17A 2DNZA 3AA9A 4I6WA 1RTHB 3TZWA 3ZFVA 1SIWB 4CO3A 4CYUA 1S72S 4G1QA 1RT6B 4ZITA 3BSNA 4P52A 1JXEA 3C8YA 4Q2MA 2W4CA 3DYAB 5BYRA 2XMAA 1HR0J 3SIPB 2B7BB 1WC3A 3P8BB 3DDKA 1YJRA 1N5YA 4DXLA 2QG9B 1MU2B 5DGAA 3DOMA 4HI2A 3PHEA 3G9CA 3IBCB 1TAUA 4L72B 2FY1A 1S9FA 4MIBA 2JEJA 4RUHA 3SCKE 5FIIA 3KUEA 3MAAA 1CJTB 4HH0A 4N41A 2Y1IA 4EO6A 4OYAA 4PAAA 4O44B 3NOCA 4ALZA 2XHCA 2HFZA 5A8KB 2LECA 2V4JA 4ZLPA 3BO4A 3QMQA 1RSCA 2FHKA 3K5OA 2WOMB 5CYMB 1T9YA 3BV8A 2R2RA 5A2QU 3V6HA 2NCKL 3ILOA 5EWGA 2HNDB 5KFIA 3FFIB 1TL7A 4LRAA 1HNVB 2OEMA 5HMZA 4ZPDA 4C8MA 3OPKA 4MFBB 3KOAA 3AOAA 3FMBA 5DZ7A 5KT4A 1WSRA 3D6MB 1BXNA 1LXJA 1WG5A 1T05A 2H1YA 3UW1A 1I3OB 2J9DE 4DV2J 2B6AA 3QT6A 1FJCA 2LQBA 4HLBA 1UVKA 4FYYB 2KL8A 3C19A 3MM8B 3VAHA 2P6TA 1WC6A 1RHUB 3PM9A 1IJEB 1RAJA 3QIDA 3D2WA 1TV6B 4K0KJ 2BE2A 4QR1A 2KZMA 3MPDA 5GAHU 3GV5B 1Q4RA 5MLCV 4UOCA 1NZAA 3D6HB 4YHHF 2NPFA 1SJRA 1RA7A 3KLHB 1FRIA 4DSJA 3BM7A 9ATCB 2AMCB 4DV4F 3PKMA 1MG7A 2AU0A 1IBLJ 4Y65A 1HBMB 1RHQB 4HDGA 3DOLA 4WXOA 1FXRA 4FF4A 2GA7A 2GS8A 1AW0A 3MAQA 1SH0A 1KRPA 5DJBA 4P74A 2BR0A 5DG9A 2VQFF 1QDUB 2IVFB 1MROA 3QRRA 2I2YA 1M5PC 2KRRA 1WOOA 1Q79A 2HQDA 3GSIA 4TXSA 3N5BA 4P7TA 3IA0A 5HLFA 2W8KA 4HDHA 3I5AA 3CJ4A 4C8OA 1UWAA 1Q7LB 3JAMY 2VG6A 5J2NB 3CJ8A 4OI2A 4Z7YA 4L75A 3CUNA 2ZOFA 2W2PP 4NMXA 1NCLA 3O5TB 1N0UA 4ILRA 1OO0B 4RBUA 1N32J 1WNEA 1NSPA 1S7HA 5LMUJ 4E0DA 2F4FA 3HHLA 1QAIA 3DDIA 1H98A 3OUYB 4JI3F 4Y2MA 5CCMA 4WFYA 3H90A 1W2IA 4F8RA 5CD4A 1BQMA 3HULA 4F0MA 2BE9B 1I94F 3EYZA 3RAXA 3D0IE 3NAIA 4LRDA 3CB4A 3M8PA 2NZ4A 2ZUGA 1I5OB 5IZHA 2QRRA 2ERRA 3M2RA 1REVB 2JL9A 1FKAF 2ZM6J 3PJXA 2R7OA 2X1BA 1Y4ZB 3DOKB 2BE7D 1XMQF 2V5HG 2MKKA 2NXEA 3ENAA 2BJDA 1D09B 4KFBB 3A3OB 5CYQB 4Q45A 3M8ZA 1OWXA 1SPBP 4DSKA 5G4DA 1B99A 2UU9F 2DT9A 3UD5A 1TL3A 3WX4A 4ZLNA 3R27A 4A8WA 4W92B 3AJDA 4B9TA 1RT1B 2M88A 3ZTOA 2QGFB 2R42A 5LJ5Y 3VGTA 3MFHA 4UUWA 2R2TA 2VA2A 1SXLA 1MN7A 3CF5Q 3CD0A 2Z2LA 4KGMA 2KHCA 2DCLA 2AW0A 2DIUA 1NSKL 1X31C 4OYBA 1HMVB 2VDHA 3G6XA 1OIAA 4IRKA 4C98A 1QSLA 3MF5A 4D3HA 3OTCA 4XTTA 3IG1A 4I1TA 5F3TA 1T11A 5KG3A 5CZXA 3RB0A 1MU2A 3TVKA 1QM9A 4GKKF 4OYPA 4DCPB 1HWKA 2HHWA 2DXFA 4ZVFA 4OYIA 3KLGA 5J2QB 2IYIA 1URRA 4DQRA 2EW9A 4LF2A 1S1XA 3EMTA 2VQEF 3TJAA 3GQCA 1GMWA 3E3XA 1CEZA 4O3RA 3RBXA 2Z57B 1NK6A 2K3KA 2GVDB 1RWNB 2OEJA 1KSPA 3W2VB 1F2HA 2VU5A 3H5UA 1UJ6A 3W61A 1QTNB 2WW4A 2DNMA 2G2ZA 2LYVA 5A8KA 3MURP 3GR1A 1JX4A 1JQGA 3WBZA 3SMZA 3AQOA 4RZRA 1OYDA 5J2MB 2OFGX 3PR5B 2G4BA 4L3NA 3VHQA 2VG5A 1T3OA 5F8IA 4X64F 3PO4A 5KFPA 1EETB 5JVHQ 1HA1A 4PR6A 3R1HA 4P10A 3R5DA 3OSNA 4ZHRB 1KWMA 2BOAA 3TO8A 1IKWA 4DHVA 2IA6A 2JC1A 4XK8C 2YH0A 2P9GA 5K5MA 1A6LA 2L48A 1XMOF 2M52A 1Y3JA 4C8KA 1D1UA 4I4BA 3MM8A 4ZVQB 3QT7A 1FHTA 1YSJA 5KG5A 4C4WA 2XYPB 3W66A 2HAFA 2ZFHA 4HH1A 3MXHP 4RX6A 2XS5A 2PE8A 2DNRA 1NO8A 4L6V3 2DEIA 3H40A 4DV4J 3IR5B 3KLHA 3AQPA 3T1AA 4ZIWA 4ZLLA 2HVHA 2DY1A 2QIFA 2E9RX 2HVZA 3B8HA 4X4UA 2ZH7A 4YMEA 3P4UB 1EAYC 2DD8S 2C2KB 1JJHA 4S0MA 3I9ZA 4AFFA 2YQ3A 2HFVA 4NLRA 4OV6A 2W01A 2HK3A 4NYPA 3NCQA 2VQFJ 3JYTB 3C6UB 2XY6A 2XZDB 3M9MB 4ZKAA 3R5CA 4J9LA 1V3RA 3K2YA 4EMDA 1AT1B 2Z8QA 3MPUB 5I3PA 3H8YA 3V4MA 2KXHA 4EI2A 2YWGA 3IM8A 3GCWP 2ATLA 5BJRA 4ECYA 3SQOP 1YJNS 5J2NA 2G0JA 3GR0A 1UPPA 1HL6A 1ROFA 3GJRB 2ZH5A 2VFTA 2PEHA 4CO4A 1M5HA 2YTCA 2R7QA 4B9UA 2AX1A 3KJVB 1JIHA 3OUYA 1HNXF 3HCXA 2BEFA 4QIWD 1I94J 3OVAA 4YOEA 4DL5A 1SCJB 3PY8A 3DRXA 1SL0A 3H0PA 3ZZOA 3HK2A 1ACMB 4RW8B 4JV1A 3CTRA 3LA0A 2G2OA 1C1CB 5FLXY 2VC1A 4ZVEA 1R8PA 4GO7X 4X4PA 1SQEA 4LFAF 3CD5A 2W2MP 4IDKB 3FSYA 1XMQJ 4LBPA 4JI7F 3CCVS 4PQUA 3BKFA 5LMNF 3DOKA 2DKOB 2C3YA 4OZ2A 2O66A 1B3TA 3GYXB 3TUIC 3NLCA 2UU9J 4Q0BB 5CYQA 5A6WA 1WTBA 3Q24A 1U1OA 2MHEA 4WIQA 1YK9A 1KNZA 4GC7A 2VC0A 5GMDA 4CH7A 2OIHA 4LSNB 1KLNA 5H1SV 4J91A 2G2YA 3OXGA 1S76D 1NDCA 3IRXB 4IFVB 1RT1A 5GAEU 1UFWA 2DNHA 2CJKA 3M1VB 1XTZA 3J7A1 1B7YB 1FXDA 4Q8EA 3KJFB 4LIRA 1LW0A 5KT2A 1JNRB 1HMVA 3HHLC 4F50A 1TKDA 2HPUA 2P9EA 2PDAA 2XSJB 4DV0F 4GKKJ 1XWLA 3S1TA 2HGMA 3IC1A 5EGYA 4UF4A 3NWRA 1WWHA 2NS1B 2MTLA 4RNHA 1JLBB 2W9CA 1FE0A 5L1IA 1T9UA 5J1PA 4Q8FA 1W7WA 2UUTA 3Q8RB 2RQMA 2VQEJ 2BQ3A 4LQ9A 3MCSA 2HNYB 4QWBA 4RPFA 2XTJP 4ZVPB 4J9SA 2VASA 3PX6A 4Y3CA 4PG8A 2KN4A 4IO1A 1X4EA 5AXLA 3W2VA 4LVNP 2XCAA 3KG0A 2E66A 2M2BA 3IWNC 3ET6B 3KLEB 4JYAF 3G8SA 3W9JA 2BJ3A 4OX6A 5J2MA 4X64J 4DL6A 2AGPA 3DGPB 1LXNA 2G0CA 5EUHA 1TKZB 3TI0A 2O5DA 1TUWA 5KFFA 2DRBA 4WXWA 5DQHA 3OL6A 4KTQA 1T02A 3GIRA 3F56A 4Y2CA 4PQAA 1S0MA 1XMOJ 4A8QA 2YVSA 1ZZFA 4KPYA 4LFCF 1AZSA 2R8KA 2EEYA 3K89A 5GAEI 3BGLA 1KLMA 3VVUA 2KYXA 2NUHA 3N6MA 4LUBA 3BYPA 2AP6A 1R6VA 1U48A 3C6TB 1RACB 5IS2A 2AHOB 4WP9A 1XIQA 2AIRB 4A8FA 4ZVSB 2XNRA 2FLOA 4DUYJ 2OAUA 1S5ZA 2YX4A 3LP2A 3NKYA 5EX0A 3QO9A 4C97A 4KKOB 1LNQA 4DX5A 1KDNA 2VFVA 2XI2A 2RHSB 4O3OA 1FERA 3T5HA 2CQIA 3RAMA 4QYRA 3TOQA 1RT2B 4FS1A 2ALZA 3MM6B 4I7FA 1XR5A 4K59A 1SIZA 1Q81T 4IO9Q 3QT8A 3JYTA 2LDYA 1WDDA 4Q7AA 5GAGI 2RIJA 2GO9A 3CCMS 1RLCL 4V1Ak 2CNLB 2ZD1B 3KK3B 4N8NA 4X4OA 1SUQB 2JWNA 3AA8A 4CLPA 3ILJA 1QY7A 3OVSA 4DPOA 5DS7A 3UNYA 2LXFA 2XULA 2BA9A 4X66F 1LWCB 1IUJA 5ADZA 2AKWB 4JI8J 2HRTA 1N5QA 3AD7C 1DBDA 2W9BA 1FFWB 1HNXJ 2CFXA 3R9LA 3HSZA 2UUAF 4DFMA 4YQWA 3DKDA 3KJVA 2U2FA 5GADU 2GGPA 4USUA 1FKPB 2GJ2A 1VCTA 1VIOA 1EX8A 5D0HA 1G3OA 3I32A 3FVYA 2CXEA 2NR0A 2QFIA 1WF0A 4NXMF 3OR2B 4RW8A 4FZVA 1RTZA 5F9LA 5E41A 3ZTQA 3QNWB 5A8RA 3PR4A 2G0IA 3A3NB 2XMTA 1QUVA 3PV8A 3JB9k 3Q8PB 4JI7J 1ZAVA 5LMNJ 2VPYB 3GZ7A 3CCJS 5C25B 4C9DA 2V4RA 4DR2J 3LO3A 5KG4A 3K5MA 2XEXA 1NHKL 4CO1A 1KOOA 2DNQA 5LSOA 3DGVA 5KFRA 5HVHA 2ASYA 4ZIVA 2OJ3A 1VRQC 3KUGA 4I2QB 3MM5B 3VV2B 2HNZB 2HVDA 2QL9B 4WP3A 3L7OA 3CJRA 3UVJA 2MKHA 4CO5A 3BBFA 2GMLA 1JB0C 5IM0A 1U02A 2D3O1 2B4PA 2NPIA 4B9LA 1K0VA 3TZXA 2V34A 3J7ZT 4ECVA 3B78A 3VAFA 4FDFA 2GNKA 1IKYB 3CPWR 4OJ1A 4DR1F 5FDLA 1FWKA 2UXDF 5K8NA 3CD7A 3W5ZA 4USKA 4C2MA 2M0GB 4ZVRB 2JEFA 2C2DA 3OR1B 5K8OA 2HNYA 5LXYA 5B0BA 3IMQJ 3SCIE 3I4PA 4RW9B 2DNKA 1HI0P 4MIAA 2LEBA 3EXCX 8ATCB 1NK0A 1FD8A 4WFNQ 3NG8A 4HTJA 3CJ2A 3M9OB 3GMGA 3M2UA 4FVCA 3DU5A 3GTYX 1ZETA 1S1TB 4YR0A 2XMWA 5M2PA 1DQAA 2OPPB 5K9FA 1AUDA 3DGPA 3RR7A 4U8VA 2XS7A 1Y7PA 4M5NA 4DPYA 4ILLA 5F8NA 4KIAA 4RU2A 1YKWA 1TKZA 4G1IA 4NX9A 3SDEB 8AT1B 4DX8H 2ZOGA 3WX8A 2R9LA 5KFEA 2NYHA 2CWKA 4C11A 3CVKA 4MJKA 2NXUA 3TUZC 2LXIA 4NPOA 3HJFA 3RW7A 1WHWA 1FFGB 2ALYB 2JFKA 2RVJA 3HVRA 5GVQA 2AJ0A 1JLEA 2PSZA 2R3VA 4FN5A 1S9GA 1XJWB 1HNWF 2J6SA 5CXTA 4DJBA 2SXLA 2ACMA 3AAWB 3MEKA 3U1NA 1HNZJ 2YWFA 1NBEB 3THTA 4LMZA 3MDFA 5FJ4A 3FEZA 1T0TV 2YNGA 3OBIA 3K7RA 1K8AT 4LREA 2MPUA 4F25A 2L9NA 2V69A 1IM6A 2V2QA 2ZBCA 3E2EA 4NLWA 4P2SA 3TQ1A 2ZOMA 1NU4A 3PYGA 3SSSA 3KJQB 4K2JA 3H2VE 5K14B 4LBIA 4DLEA 3QGHA 2MHNA 1K44A 2VUGA 4P73A 2E5LF 4PZVA 1TMMA 3KK3A 1VRTA 4FNHA 1SUQA 5KFBA 2F4VF 2PGCA 3F41A 2HLUA 1ZTTA 1S1VA 1CJVA 1ZM9A 4EFAC 1HYSB 2KXFA 4FVMA 3OTBA 4X66J 4DR4F 2MYFA 5J2PB 2K2PA 1FNOA 4RBVA 4USIA 2C3PA 5DM7Q 1PAUB 1LWCA 2UUAJ 4KYZA 1PYSB 4IG0A 1VC6A 4M5KA 1OS5A 3MCNA 1Q82T 4FPIA 3BBCA 2FYXA 3IO1A 4CM2A 1C1BA 2UVWA 2FLPA 2MKSA 3K8WA 1Z4UA 5ETMA 5D4LA 3AT1B 4BC7A 1N52B 3PG9A 2DHXA 2LQ8A 4NLXA 2DR5A 2DB1A 1G6BA 5KG6A 2YWKA 1NPRA 3CC2S 3AY0A 3OLBA 1NMEB 2PN6A 1FXLA 3OR2A 4BCAA 4BWMA 4N5SA 1OQ6A 3OL8A 3BDEA 2FC8A 1IQZA 3K5LA 2MEWA 5IXUA 5B0EA 2KKHA 4EZ6A 3ILLA 2WW8A 4WCEQ 1FJGF 1X4BA 5C25A 2VB6A 2DVIA 4Y6IA 4Z37A 4JUZA 2CG4A 4BS2A 4Y0FA 4ECQA 1VBKA 3U27A 4M5DA 1REGX 4FPRA 1C0TB 2CPEA 2RQKA 5A2QY 2MKYA 5DZ6A 2JLEA 1NH7A 4H4OA 3D3CJ 4L3KA 3MM9A 2DK2A 4I2QA 4LR7A 1N4LA 1U26A 5KFZA 1Q86T 4O3SA 2BVZA 2HNZA 3BGRA 3V2UC 3BQ0A 1GAOA 4OX9F 1PAEX 3PTWA 1R89A 2L41A 2DNYA 4U9RA 3L95X 2YWEA 2W2QP 4LF4F 3UCUP 2FVQA 4JI5J 4DR1J 1CBKA 4F3MA 2UXDJ 2L3MA 1IKYA 1GK8A 4XAKA 3DM2B 2LXUA 3LALA 1BUXA 4I64A 1VQ5S 3HHKA 1UMJA 4JI2F 1HHSA 3GILA 2PT0A 1RE1B 2OSRA 3KYLA 1VQMS 4ED3A 1F5AA 3G6ES 3LPEA 4EO8A 3OR1A 1UW4A 2QA4S 3VZHA 5EX3A 1X5PA 3QIPB 3VVTA 3BKTA 4HKQA 2LEPA 3LOUA 5L1LA 4QCLA 1CS4A 4ECUA 4JBCA 4TN2A 2XZWA 4X62J 2CIMA 2M70A 3NNAA 4MTPA 2YNFB 4KO0B 1S1TA 2MLYA 2OTJS 2NSCA 1Q95G 2OPPA 2AGOA 4MYUA 5KG7A 2RF2B 1CQMA 5D15A 3AB2B 1WI8A 4G65A 4DL2A 3ZC4A 3SDEA 5B0DA 5DETA 3MGJA 3J7YU 2YPZA 4Y2IA 2PO4A 2Z2YB 4YP3A 4OX8A 3Q86A 2DNNA 1U6BA 3DXBA 1MWYA 3OVBA 2WONB 4B02A 1HNWJ 2X3DA 1QVGR 3MFIA 3OFGA 2Q3PA 1WD6A 2FLLA 4B3RF 3AOBA 3RBZA 5HANA 2K3IA 2BJ1A 3JSRA 3BREA 5L38A 3WC2A 3M8WA 5IV3A 1WC5A 4U67Q 3L7PA 1GX5A 4K50A 2MKIA 2Z58B 2HQ3A 2WVBA 3PJWA 1TP7A 4NASA 4NLSA 2C2EA 1V3ZA 2CQHA 3KK2A 3TP2A 2RD5C 5HN0A 2MLXA 2E5LJ 1WC0A 2ZHOA 5F8JA 4WPAA 2FHMA 2LU1A 4JV0A 3LH2S 4G1PA 2F4VJ 1NK8A 1YVFA 3HHEA 4CWBA 5C24B 1GQEA 1WORA 4DR4J 4R8UB 5J1EB 4QWEA 2FVRA 2K1RB 1G7CB 4RNNA 1WUUA 4ANDA 5J2PA 3NBPB 3TZZA 4B3OA 1HQUA 2FZKB 2WBRA 3AJ1A 4J5OA 2Y0BB 4UY85 3ZXWA 3N6LA 3MR3A 3QJJA 1HLWA 3E8OA 1HWLA 3J7YI 5JVGQ 3J7AN 5BYSA 4IOBA 5IOLA 3WQPA 4M94A 4KB7A 3WC0A 5KFOA 4OV1A 1VR6A 2ZH9A 3CC4S 2D1CA 2CQDA 4CLWA 1E6VA 2I9SA 2RQCA 1F9HA 3QAEA 5AT1B 4YFUA 4NCGB 2M9KA 1L5UA 4G6VB 1FESA 3M32A 1IJFB 2CA9A 4UW2A 2EWHA 2XY7A 1B0TA 2N4CA 1HW8A 3DLGB 1NJZA 1RJJA 1EQMA 4WFBQ 1QE1B 4KPCA 4P7VA 1JLAB 1BWVA 1R8CA 5SZTA 3PRDA 3C2PA 2UVRA 1IKXA 1UZDA 1F5CA 1KTVA 4F2RA 1U4BA 3C3LA 1NSAA 3CO0P 4QYZJ 4DS5A 4OJ3A 3PRBA 1RTIB 4M5HA 1TTHB 3MAHA 5JXSA 2HW3A 2RQ4A 2AD9A 3RRGA 1OSDA 1VRUA 2WVEA 1RAGB 3W62A 5I3UB 4QIVA 4OQJA 1YJWS 2IM0A 4OX9J 3S8SA 2XNQA 1WOSA 2HHQA 4OHXA 4FBUA 3MPVA 3HO1A 1VQLS 1Q5YA 3OLAA 2YKQA 4AXIA 1LOUA 2VH7A 3W1YC 3IFEA 3A8JA 2GIQA 3RAQA 3UE2A 5KT5A 3CNQP 4LSZB 4I6AA 3H5XA 4V19J 2JX2A 2HGNA 4OHYA 3R5GA 4B9SA 4JI2J 3DM2A 1L3TA 1MNEA 3EUNA 1WDTA 2YWWA 4ES3A 2FUG9 3BS9A 5CHCB 2EKNA 2E1AA 4WTOB 3RB6A 1GTEA 4LF9F 1RAOA 3FBCA 1J2VA 4LF6F 3PW0A 3KHLA 4KSEB 1Q8LA 3QIPA 4DS4A 2HHUA 2XO6A 5ETRA 3DMJB 2H4WB 3CCZA 3M8SA 3HP6A 3R97A 3OL9A 3P6YC 2QLBB 5DDQC 3BGFA 2V68A 1DLOB 1FRXA 1M1KT 5F3ZA 4KO0A 4B3SF 4RJVA 1N34F 3TEGA 3GJSB 1YWXA 5E0OA 4E8UA 2KZZA 1WI6A 1F0XA 2Y0SD 3LW5C 4DI6A 2QYCA 3UR0A 2N4DA 2CG8A 3HT0A 4LBHA 4Q2LA 2E9TA 4DX7A 1RCOB 2DEJA 3I6PA 5D8HB 4ES2A 2VA3A 3BSAA 4KT0C 4A8MP 3GCXP 3D3BJ 3SI8A 1T95A 2F7VA 2RKIB 2XY5A 2WONA 4PUOB 1U6ZA 2MJUA 4PG6A 3AD8C 4K4SA 1ZM4A 1S59A 2MXYA 4DR7F 4ERDA 2B51A 2BKOA 4PWDA 1LWXA 3NGTA 1CC7A 4XIUA 1WACA 4QPTA 1X5TA 1JXVA 1YX2A 1RWXB 4KGVB 4HT5A 3P3DA 1WF2A 4M5GA 1D9AA 1FNMA 2V67A 3CWJA 1EP4B 4YY3J 1Y10A 1HWJA 1MW7A 1UAWA 4O4RA 2AEJA 2P6SA 1OJ4A 1DZ5A 3CULA 4YS2A 3W5XA 2EKYA 2WVCA 1CJKB 2DH7A 2RMLA 2ZBPA 1VQYA 3WZ0A 1CPZA 2XG8A 5D4PA 2NXJA 3KLIB 1X9MA 2CPXA 5HK4A 3LQVA 3TX8A 3WDOA 4E98A 2VKZG 2JLFA 3NL0A 1N36F 4ZPAA 2F9JA 5C24A 3FGVA 2V8DA 4LRCA 4R8UA 5J1EA 3CCLS 3HZGA 4IFYB 2K1RA 3W65A 2CPYA 4OMFG 4TLRA 3THPA 5ETSA 3LP0A 4H4KA 3NBPA 3OFFA 2IA0A 3HHDA 1R6YA 1P1LA 2DGUA 4AUKA 3BR8A 4WU2A 1PYTA 2QTWA 1RT3B 1XN9A 5HVFA 2W7AA 4HYKA 2ZH2A 5ETLA 1QVFR 1X4AA 5I3QA 4WJBA 2ZBQA 1PBUA 3CIZA 3W60A 3UD3P 4K4ZA 2RUGA 2Y9HA 4I2PB 3H42A 2J0SD 4AD6A 3NNHA 2GIRA 1KQSR 3MMBB 4ZK7M 1JK9B 2VBYA 3H25A 4OZ3A 4ID5B 2DJWA 2UUCF 3MM7A 5E3AA 1DTQB 3MMCA 3IR6B 5K8PA 3TVYA 3W2WA 4X4RA 1RTIA 2BOPA 3ICLA 1VK8A 1RAHB 2CQ2A 2EVZA 3MUTP 5L39A 5E3RA 2OO4A 4WFXA 4F0HA 5I3UA 3RBEA 2ILYA 2VODA 2WRMA 3DXSX 2PMZD 2F8EX 3ZNJ1 2JHEA 3EPIA 4QJVA 3TNVA 3ITHA 1NNDA 3FQLA 3R7SB 5HP1B 3DRPB 1HHQA 1MMLA 3MD3A 3SEOA 2IAJA 5M2RA 2JEIA 3HSDA 2ZH4A 3ELHA 3QZ8A 2MZSA 4ZOSA 4G3IA 1RHRB 2W7PA 4KRWA 4WFAQ 2VD3A 4JP8A 2RH3A 4LF9J 4LF6J 2Z2ZA 3MUVP 4HHHA 2IDEA 4J9NA 3I0RB 1DHMA 3DMJA 2AYEA 3TAMB 1S6OA 3GJTB 1LW2A 2H48B 4I56A 4R0JA 3AD9C 3IGNA 3QWPA 2MY7A 3PIOQ 2GVZB 2ROEA 3AH6A 1M5VC 4B3SJ 4F26A 2KG1A 2HFNA 1N34J 3NRBA 4RW7A 1HBOB 1RAFB 3POTB 4K8RA 2RSQA 2WTFA 3RR8A 1RP5A 3EICA 1HFEL 2LQJA 5L9XA 4DR5F 2FGOA 2YKMB 1YJTA 3CCSS 5RUBA 3N28A 4W4MA 4WTYA 4PEOA 5AXMA 2A2DA 2BM1A 1S99A 2V8PA 2PFFB 1PC4A 1TELA 2JVRA 2JEGA 1WKKA 5GMEA 2FDNA 3M8QB 3D0HE 4EBCA 2QT7A 3VAMA 2BKPA 2YWHA 2AJQA 3Q8YA 2O1PA 2PI5A 3T9NA 4FBTA 1N6QA 1AFIA 1S1WA 2F65A 2DPIA 5CZVA 5E3QA 1MWQA 2YKNB 3MOJB 4KQZA 1W2BR 4IKAA 4DU7A 1BD6A 4USWA 3HVAA 1TL5A 1YJ7A 5L9NA 1LWEB 4KH0B 3C15B 1NPPA 1V5IB 2WZ1A 3EXYA 2R7XA 4YB5A 2RS8A 1R8BA 2YNIB 2FZGB 1RAAB 4WYWA 4NLDA 2O3DA 1S57A 1YQHA 3UPFA 1Z2ZA 1EZZB 2DO4A 4PCQA 2VV5A 2LMIA 2H51B 1L3UA 3EZOA 5F0UA 4PKDB 1NKBA 2DGXA 1O8BA 2H9ZA 2F9DA 3TVZA 2EC0A 2Y1JA 4M5MA 1YJVA 4DN9A 2ZH6A 2UV8G 1DY3A 1F2GA 2GQQA 3W8GA 3J80Y 2J0WA 2B4VA 2HLTA 1OY8A 4CNZA 1U2RA 2BW7A 4BDPA 1SV5B 3ADAC 3W63A 1N33F 1NH8A 2GCFA 4JV2A 1TMJA 5E7OB 2BUNA 2DRDA 1RB0A 1RA6A 2P8IA 2K06A 1RT3A 4RU9A 1JLCB 4F7VA 1R31A 2F1FA 1QJHA 4A48A 5A0YA 2AZ3A 3PX4A 3B6BA 1IXKA 2R7WA 1UA0A 2M8DB 2XMJA 3OTOF 3HM9A 1SC3B 2RRBA 2R7SA 1CVJA 1JJCB 5KFDA 3PW7A 3TR5A 3M6VA 2KXNB 2B4UA 1TR0A 4I2PA 1X4DA 3MECB 4J9VA 2O67A 1LFWA 4IYQA 2UUCJ 2E5JA 1XNQJ 4QW8A 1TK0A 1FDAA 1KVKA 1F9FA 4ID5A 2MZRA 3CCES 2YNHA 2J7KA 3FBEA 1VOMA 1K1SA 3KJNB 4X4QA 4ZVTB 5CAAA 1YBUA 2BANB 4UZBA 2GIFA 2LA6A 5KT3A 2DNOA 4NLPA 1L3SA 4QWAA 4DV7F 9RUBA 2F5GA 4M5IA 4RWWA 1UFKA 1RAEB 4GVBA 1M5KC 1NDPA 4PYDA 2RDJA 2LQ5A 1H74A 3LUYA 5G0RB 2RJZA 4H4KC 4J90A 1SJQA 4WU3A 2HSEB 4P71A 4DUZF 5B0GA 1U1MA 5HP1A 4ZP7A 2VBWA 4A47A 3CCRS 3QWUA 1SKSA 1CC8A 1VC5A 1Z1ZA 2HHHJ 2EG2A 3PJ9A 4LR8A 1NHUA 4IH5A 3NP5A 1HD1A 2WSEC 3W5YA 2FZCB 4LQ3A 4YB7A 4NYZA 2MZJA 3LPYA 4KV8B 4R5PB 2OP5A 1DAXA 3TA1A 4OJHA 3E01A 3ZTRA 1VQ7S 4WE1A 1X0FA 3HJVA 6FDRA 2VOOA 4IR1A 1RT7A 2KVQE 1D0EA 4PXCA 3ULHA 1OPZA 3TAMA 4QYZK 3CSKA 1JLFB 4YB1P 2JZ5A 4RL1A 3RTVA 2ZBRA 2GVZA 3R3TA 3KG4A 2PFDA 4XPEA 2K7KA 1HBOA 3K8VA 2AF6A 4JI4F 3I0SB 1OY6A 2C3MA 2ZH3A 3U1MA 4DR5J 1FVSA 2VFSA 1S9EA 3CDWA 4OZNA 2WCXA 1EHWA 2ZDOA 1M90T 5F8LA 2LCWA 4ICLB 4MAKA 1KVIA 2QSWA 1G4CA 4Q44A 4NRTA 2DY9A 4TYBA 1H2TZ 2B5JB 1HQEA 1UPMB 4AQYF 3DU6A 3R5AA 1HKAA 4ZCLA 2QMWA 1BHNA 2C28A 5FD1A 3KDOA 1XBWA 3RYLA 3KK1A 3T6BA 3NMRA 5IV4A 2J8AA 1M0SA 2DGTA 1LK7A 4WYLA 3WIUA 1MLAA 1MMNA 4CNYA 4IH7A 2YKNA 1BY9A 3CJTA 1RKJA 2DGOA 3NXZA 3VTIA 2HRUA 2KT3A 3DLHA 2W24A 5DLFA 2IVYA 1LWEA 4DCOB 4NLUA 4KHPF 3C15A 4QWDA 1F1BB 3PRVA 1GXTA 1NEEA 4EWTA 2MGZB 2FC9A 1T03B 1Y3KA 3BKUA 2ZEJA 5KFJA 1NLKL 1ZPVA 4X84A 3FMWA 2PC6A 4C8NA 3FZ2A 1WG1A 2X51A 3BO2A 1LWFB 1T9WA 4CRJA 5L8RC 4DG1A 1A0OB 4OI1A 4PG5A 4IRCA 1JLQA 4I0WA 3Q23A 2D74B 2UVUA 3MR6A 4CIOA 1RAIB 3SCLE 4DSLA 2FHJA 2IPOB 5LXRA 5K20B 3UN3A 4B9MA 1VLYA 1XNRF 2FJBB 3K59A 4WZQA 4MK8A 1TKXB 5H9EJ 4ITSA 1SV5A 1BQNB 3GB0A 4O3QA 2VIHA 1KQGB 1RHKB 3MCMA 2VJUA 3MEDB 5I42B 2B7CB 2EFNA 1RT5B 1JLCA 2OMLA 3OTOJ 2VJVA 2J8SA 2B3TB 2E7XA 3I87A 2AJ1A 1ZS6A 1YBTA 1Q8BA 3DC2A 3BH7B 1UVNA 1KR4A 1NK5A 2XO7A 2QLWA 1QLNA 1IR0A 3J81j 1HHTP 4C8LA 3M8RA 3MECA 1H6KX 1VMBA 2C3UA 1YGYA 2E7VA 3NEKA 3DRSA 3JQJA 1XQIA 5A76A 3PXGa 1DRZA 4JI6J 1DQ8A 2E44A 1FNXH 5ETKA 4NZ6A 2WB1D 4ZN3A 4MT1A 5CD4H 2CQ4A 4KY3A 4OJGA 5L1JA 1U24A 2BANA 2HWTA 3CCUS 4RW6B 2W8LA 4FP9A 3GIIA 2KT2A 3MI7X 1U0SA 3I56S 4C0HA 5F8HA 4ZCIA 3CDAA 3HVTA 1VJWA 2DHHA 2N82B 2WK4A 1Y5LB 5G0RA 4X65F 4M1KA 4C3LA 5C2GA 3DHXA 4CLTA 2UUBF 3T19A 4PRFA 5D3GB 3Q2TC 5IQQA 5BXIA 3RB4A 4ZMMA 1MN9A 2KB2A 3IS9B 3FUYA 3HMJG 4EYIB 5ETOA 4O0IA 2IJNA 4N47A 1VIXA 1APSA 1FI4A 2RAQA 2Y8YA 2MZTA 2BW2A 3X3UA 2XHWA 4I6YA 2JNJA 3KTQA 4WZMA 2BRLA 1HBNB 4LT6A 5HMYA 4KV8A 4ED1A 3BQ1A 2VPZB 3EGZA 2BJ7A 1S6QB 1UVMA 4PYAA 1KFDA 3CC7S 5LSLA 2L9WA 1JLFA 2R8HA 3CGIA 5F8MA 2MDAA 1RTHA 4QU7A 2OGUA 3S01A 4DZ6A 1RT6A 1PBAA 1HPZB 3FCHA 2N7CA 3DYAA 2IMWP 1NDKA 4NLTA 1UP1A 1C0UB 4OLOA 4NL5A 5DRKA 4ELUA 4CH0S 2HS4A 4DLGA 1FTRA 1RTJB 2RE1A 4JB8B 4AQYJ 4ED5A 3BYRA 2HURA 1VHFA 3N9UC 2QA1A 4Y2AA 3D1QA 2BBEA 1CJTA 2QFJA 1KQFB 2IY5B 2E7WA 3I31A 4O44A 3VWSA 2GMJA 4YR3A 1RK8A 4C6AA 7FDRA 4USJC 2UXCF 3OHAA 2RS2A 2RHQB 3T5LA 3V6DB 5A8WB 2WOMA 2E9ZA 5CYMA 5IT9U 4JI1F 5B0AA 4NCBA 2DTJA 2HNDA 3LANA 3FFIA 4DFJA 4KHPJ 5CH7B 3H4DA 3E51A 1YG0A 3HHLD 1HNVA 1UKUA 3CDEA 3V81B 2VL1A 4MFBA 3US5A 4HI1A 2CZ9A 2MGZA 5AE3A 2OPQB 2WSCC 1KOHA 1RADB 1DFDA 3OJUA 4DL7A 1TL1B 2IYGA 2QL5B 5D0GA 3JTPA 5EWFA 3G87A 1ELOA 3B54A 1SH3A 2Z2MA 4TU9A 3BPDA 1XNRJ 3CD6S 1IR2A 4AL7A 5EHHA 3G71S 1TV6A 4YHHJ 1RBLA 5D6GA 4PXEA 3NCPA 2GJFA 7FD1A 2HIYA 2HBZB 1TKXA 3A12A 4NLVA 3BB5A 1BQNA 4NZ0A 5D78A 1Y00A 5HBMB 3EM1A 4Y28C 5HMXA 4C0BA 3FRZA 5KFTA 4MYTA 4BC9A 2EFVA 1RT5A 3THVA 3Q89A 2YQ1A 3GPAA 3JSMB 3ZZ0A 1HBMA 4UQTA 5T14A 1X9WA 1FA0A 2V9KA 1UWBB 3DLKB 1ZAXA 2J5AA 3PYEA 1FT8A 1XEZA 3PACA 4MH8A 3FDSA 4QZVB 5CQGA 4ZPCA 1ZBTA 4D3GA 2EBGA 1AROP 1YRTA 4ECZA 1O5JA 4ECRA 5DQGA 2OMOA 3FSIA 2HVEA 1GEHA 2HBQB 1NJWA 3T1YF 2MQQA 2KM8C 4X2BA 1S1UB 5F9NA 1YITS 1P1TA 2FIUA 2CWXA 4JI3J 1WEYA 4FNIA 3OHBA 3F44A 3ZTPA 1QSSA 4F02A 2OH2A 1R0CB 4X65J 2FJWA 2UUBJ 1R0AB 1EARA 1N88A 2YBVA 1BE4A 3Q8UA 2DNLA 2DH9A 5D3GA 3M4XA 1EJ7L 4F4AA 4IR9A 1REVA 2YPYA 1FWLA 4RW4B 4Q43A 1UVJA 3I5CA 5L46A 8RUCA 1GFWB 1U7LA 4CYUB 4G1QB 3LGNA 5ETQA 3IR7B 4ILMA 4L73A 2BV3A 3PNIA 4CLZA 1YJ9S 2IBKA 1U1PA 2GQ2A 5HQ8A 4C8ZA 1FRKA 4KFBA 1U1RA 2HQFA 3TANA 4W98A 3PW2A 1N5YB 3DCAA 2IVMA 4DSFA 4BLGA 2LVWA 3EDRB 2XSFA 1U1LA 2BACA 2CDQA 3EPGA 2FTRA 4YB6A 5E33A 1FRLA 2ZVIA 2NZCA 2MQOA 2HHPA 4P75A 2V6AA 2VZ9A 2KFYA 2OTLS 2XCPA 3TX0A 5DDOC 1P9QC 3MHYA 1RHMB 4DV5F 1HPZA 3SFUA 4TU7A 5HJYA 3SFGA 2V4JB 2CVIA 2UZAA 2XWYA 3VAIA 3SSRA 2DHSA 4X4SA 2CYYA 1M5SA 5KAKA 2VICA 1F9EB 1HD0A 2H65B 3RB3A 3MR2A 3SV3A 1RDRA 1RTJA 2Y1RI 4OI4A 2DITA 1NKEA 4ENOA 2ZWOA 5J2QA 3RRKA 1SKUB 4B3MF 2Q43A 2V94A 5DDPC 1M1GA 2KO1A 1WELA 2ROGA 5GAGU 3PYFA 4FYVB 2GVDA 2UXCJ 2CJ9A 1T05B 1OPIA 2HZAA 3TW0A 1JWWA 2B6AB 4JI1J 3V6DA 2CNNB 2Z56B 4O3NA 1Y11A 2H54B 5DG7A 1RQ0A 3DRRB 3H4BA 2MMYA 3NNCA 3QFHA 1WKJA 4UT4A 1EETA 1TKTB 4USVA 3GV7B 3MR7A 1P8GA 3ISNC 3D4JA 4B08A 1ZAWA 3T5KA 4NA2A 4ZHRA 3VGUA 2GFFA 2B9WA 2H5IB 2VG7B 4LSLB 5HQLA 4O23A 2C42A 1UL3A 1I6JA 1TL1A 2FQQB 4ZJLA 4J9PA 2X7IA 3QLHB 1S12A 1U49A 4LF7F 4NMLA 4K4WA 1HI8A 3TQEA 1MROB 3UDEA 2IRXA 5IFMA 4ZCKA 2PA8D 3MWBA 2IDLA 2XYHB 3TJ9A 4M8LA 5HLFB 1YHQS 2I5JB 4LR9A 2QE5A 3QZ7A 3CO9A 1U25A 3OTEA 3D1HA 3ZZTA 2POKA 1RISA 1Y0HA 3JS9A 4I68A 2DR7A 2ZJRQ 3IAM9 5KT6A 1JKHB 4OLPA 1RHJB 4C48A 3PO5A 2IM1A 2PD1A 3QFWA 3C6UA 3DLKA 1BQMB 1FVQA 5EDWA 1N56A 1NK9A 3RBDA 2ZHBA 1AXQA 1UEKA 1UVLA 1I51B 4DV1F 1TVRB 3JSYA 2VONA 2G1DA 3AOCA 3ONQA 1SL2A 3T1YJ 1UVIA 4AL5A 2IJFA 2QX0A 2CJAA 4A4JA 2HBRB 4FS2A 1IQTA 3AFGA 1S1UA 3G6VA 5KT7A 2YQ0A 3QATA 1KHVA 1N8RT 1N54B 4CQ1A 2LU2A 4DZDA 3UD4P 2ZUAA 1ULRA 2HBYB 3CDUA 4FF2A 5IC4B 5H9EK 4B3TF 4USMA 3OT9A 3ZZUA 3FJ2A 1NJYA 3H59A 2HHVA 4RUCA 1C1CA 4LFAJ 2QZ8A 2DGQA 1VI7A 3NS6A 1NAQA 1H0HB 5BYQA 2E5HA 1NM2A 3FKBA 1BQXA 4IDKA 1T9XA 2WVDA 1DARA 2DISA 3M05A 1NZ8A 5KG0A 4R25A 2OI2A 2R2UA 2VHGA 2EFQA 4Q0BA 2I6WA 2B9XA 3BDPA 2V8HA 3GFXA 2IFXA 3IG1B 1PYOB 1Q78A 3HFVA 4LSNA 2CKWA 2VBXA 2XMUA 4KH1B 4Y00A 4LIWA 5HL7Q 3IRXA 4F36A 4IFVA 3KLGB 4ZVHA 4DUTA 4ECTA 3M1VA 4QIGA 3PVXA 4F4YA 2CJXB 1S1XB 3J80U 1SJ4P 2HS0A 1YJUA 4ZLJA 4ZJOA 4DV5J 1Y5NB 3ZNUA 3W8PA 3FCWA 4OYMA 2L9DA 2F40A 2BZ2A 2OPSB 1WHVA 4DV0J 5IT0A 2OD6A 1V5VA 4OZ1A 2HFUA 2CPFA 1D8YA 3AHPA 2XSJA 4EYHB 4F2SA 2V2KA 1BLUA 1VFJA 1MWZA 5CCLA 1VGYA 3BN7A 3D54A 2VG5B 1JLBA 3SBMA 5HO4A 2YY3A 1SQGA 2CPJA 4B3MJ 4Y34A 4NA1A 4U96A 5F8GA 2BJEA 2J6UA 3PDNA 1U8WA 1G1XA 3PFOA 3CMQA 3K5PA 2AJ4A 1X8DA 1IKWB 1KTQA 3DI6B 4ZA1A 4TY9A 2GMHA 2X3GA 3BSOA 4ZPBA 1PJ7A 1J27A 3H5SA 4JYAJ 2F8MA 2DGSA 2CJBA 2ZZNA 1U2CA 1T9TA 1LEOA 3ET6A 3C14B 3KLEA 4ZJQA 4OZ5A 3BSCA 2KH9A 1Q53A 2KTQA 6AT1B 3DRRA 3EVOA 3SYZA 2ROPA 2FVPA 4UOFA 5E5NA 1HARA 4O3PA 3JQKA 3TAPA 1TKTA 4RUBA 3D0GE 3WHIA 3BGOP 2GQCA 1EQ0A 2J0QD 2MQPA 3BH6B 4M63A 2VG7A 4LSLA 4LFCJ 2V2ZA 5DDRC 1F5BA 3ZZRA 4TYAA 3A8IA 3IP0A 4LF7J 1PJ6A 3M9NB 1S0VA 2WB4A 3QLHA 2LQ9A 1U0HB 2JOQA 1FFSB 3C6TA 2CPDA 3AXMA 3EE3A 4YDXA 2HGLA 2KFNA 2C2ZB 2OELA 2KRBA 5D4NA 2WVFA 1RTDB 3JTNA 2GW8A 1UTAA 5KOWA 4JOUA 1H7XA 4KKOA 4IG3B 2G1HA 3S6EA 2I5JA 3GG0A 1SI9A 4DFPA 3A13A 1RI7A 1RT2A 2KG0A 3NGDA 1RXOB 2M3DA 1AFJA 2C2MB 3MM6A 7AT1B 3UDLA 2ABYA 1JKHA 2EFGA 3EGWB 3D6TB 2AX0A 4QBUA 4CP5A 2KDOA 1IWGA 5T7LB 1RU2A 1UFLA 2JRSA 3M30B 5ETNA 1S6PB 2ZD1A 4DV1J 2XLJA 4U7UK 2UV8A 2ZJPQ 3KFWX 2UXBF 1TVRA 3CJ3A 4MK9A 3K0JA 2CRLA 5E3PA 5I4MA 3VGVA 3PKYA 2AGQA 5ITHA 1PCAA 1RWUA 4PQUB 1K0TA 3DLLQ 3D7SB 2B9EA 2PIIA 5GAHI 2NXCA 4LF1A 1FKPA 3PZPA 4B3TJ 1WHYA 3W7BA 1TK8A 4NXMJ 1PGZA 2A6MA 1UETA 4K5RA 1NK7A 3I82A 4ZPWR 2LKZA 3JXOA 4K2XA 3R8YA 1GTHA 2BQRA 1FJ7A 1VBZA 4C3KA 2J9DA 2GZOA 4DWIA 3J7Z5 2N3LA 3HFZB 3VR1A 3A4TA 3MTKA 4EU0A 1P27B 2XGPA 1LW0B 2XMMA 4EZ9A 3OXLA 1PG5B 3G86A 1CLFA 3IGVA 4J37A 2CQPA 1X7VA 3WIVA 2VDIA 2BKNA 2NREA 2W9CB 3GYGA 3GFZA 4NE9C 1G2EA 4N8OA 3MM5A 4NEYA 3N6NA 3OQ2A 2HZVA 4A8OA 3NS5A 2R8IA 5DO2A 1S49A 4TLQA 3RUBL 4TNOA 3UO0A 4C8YA 1E6YB 1QAXA 2VFRA 2OPSA 3JQMA 1A7GE 2C2NA 3IBWA 3RJMB 2A3JA 4HVZA 3MEGB 2ATCB 1VBYA 3J81U 2W2OP 2ZH8A 4WKRA 3G2XA 1QUPA 2CPZA 2E1RA 3UDCA 3Q8SB 2Q66A 4OIXA 2XLIA 1N0VC 2YH1A 4F4XA 4WK3A 4DBQA 2VBZA 3BJYA 1PILA 4KGXB 4CT8A 3H2LA 3OXFA 5HMWA 2PEBA 1VQ9S 4RW9A 1RUSA 5D77A 4RO0A 2Z4PA 3DI6A 2BXJA 4NYOA 2MB0B 5DG8A 2Y8WA 2GAGC 2LEAA 1AZSB 1RLDA 3M7VA 1SBRA 2PMHA 2VOPA 5DM6Q 3L4BC 1KLMB 1S10A 3C14A 2W1BA 1FK9B 4DPWA 2EXUA 2HK2A 3FK4A 4ECXA 1RYRA 1VQOS 4BBYA 3MMJA 4OI0A 2HVIA 4J9KA 3MR5A 4NA3A 4FF1A 2BRKA 3F0NA 3LP2B 3QO9B 2HHTA 3MMAB 3EWGA 5KFKA 4DUYF 4LFBF 2GX8A 4P2XA 3LGMA 4F04B 3TJ8A 4V19X 1ZYQA 1ZOTA 1FX2A 2Z30B 1U45A 4M5LA 4KR0B 4PABA 3QQCD 4I7FB 2MKCA 4CH1A 1U0HA 1UJ5A 3CDBA 3PIPQ 2KJWA 3QJLA 1XMBA 5AJ3F 1RTDA 3ISZA 3EVMA 1ICEB 4FKXA 4IG3A 4TU8A 4CT9A 4IQMA 3R6LB 4O4GB 3D5MA 1J5EF 4TY8B 1D3WA 1EKSA 2W9BB 3R5BA 3QAUA 3OV7A 1XR7A 3ENWA 4JI8F 4MK7A 5K14A 1FDDA 2M8HA 2GGPB 1TFYA 5T7LA 2JJ4D 2AT1B 3ETOA 3M30A 3HD2A 2ILZA 1OYEA 1S6PA 5B0FA 2OEKA 2UXBJ 1X9SA 3QBCA 5A8RB 2MQNA 2XGQA 3C16B 3D67A 3RZAA 4RR5A 3MPYA 1HYSA 2OSQA 4R0EA 2EFOA 4DL4A 3DN9A 4C3MA 3RU0A 3IAS9 1FCAA 1N5SA 4YUDA 1CQNA 1DURA 2H5EA 2B8QA 1T7PA 3S7RA 1WHXA 1H38A 4P9SA 5IC6B 5C7PA 3EZUA 2CZVC 1QAJA 4DR2F 4EK2A 3VAGA 3H7HB 1Q7YT 2APOA 2EI5A 4ELTA 4QPXA 3VZIA 3UCZP 3IBFB 2AEMA 4UZCA 1SJ3P 3T3FA 4ZP6A 4DCJB 2ZE2B 3KNAA 3M6WA 3TA2A 1QD1A 2YKPA 5JUMA 3OW2R 1D9FA 2WHOA 1FRMA 3UVJB 4Q5VA 4K4XA 1FJGJ 4DR6F 1SB6A 5IM0B 4OYXA 2YKOA 1L3VA 3H98A 4WKYA 2MZ1A 2CNOB 3HHNB 2GHPA 2ZWPA 4FYWB 1IM4A 3FCVA 1FO1A 4ER8A 2CQBA 4DX6A 1X4HA 1B0VA 3GU0A 3LP1B 1C0TA 2J7UA 5IT9Y 5FDLB 1WF1A 3R2CJ 1KS2A 2DXEA 3EJMA 2MZQA 3RG6A 2YXLA 4NOHA 2FB0A 2AJFE 3BPSP 2W2NP 4LF4J 1IBKF 3NGRA 1GX6A 3TZYA 1HQ2A 1E6YA 2ZITA 3V6KA 2FHOB 3M2UB 1UW9A 4DF4A 3VF0B 5KFVA 3QGIA 4WFZA 4Y2KA 2E1PA 2ASJA 2RRAA 1FE4A 3MEGA 1VS3A 3G82B 2NLWA 1SJ1A 2AEFA 1RGVA 2H4YB 5HI7A 2FJXA 4QR2A 4UTGA 3O2IA 4C11B 4DPTA 5KG2A 4F3QA 2C1EB 1U6FA 1GH8A 1BGXT 1YDLA 3MPWA 1ZH5A 3AB4B 2HQGA 1V6HA 1YRUA 1YIJS 5GMKa 4ED8A 4ANEA 4ECWA 2RU9A 2R7VA 2QC3A 5LM7E 2YNFA 1FK9A 1JLEB 3M6XA 4MIWA 1S9GB 3FBFA 4ED6A 1DJ0A 4GRSA 4OX7A 2RF2A 4RWXA 1RZMA 5C42B 4LFBJ 5HVGA 1HNZF 2NQPA 2HRYA 3MMAA 1TFWA 2YNGB 2Q1LA 2ZDPA 1U8SA 1P9YA 1Q16B 3Q0AA 1ZA2B 3HPOA 2KHDA 2V50A 4IH6A 4OYWA 4HTIA 3PW4A 1LFPA 4OZLA 3N01A 2I1RA 3CJ5A 4LRFA 4LF8F 4B3RJ 4OHWA 1VYAA 3GIMA 4A8KA 1PIEA 4ATNA 5IT4A 1Q1KA 3TARA 5AJ3J 3GJQB 2DRAA 1SJFA 4ETZA 1VRTB 4PPZA 2R8GA 3FC9A 3VCDA 1WEZA 4M95A 2QSFA 2J9CA 3V4IB 2LP4A 2ZZMA 3UI3A 4EBEA 1S1VB 3U7JA 1CJVB 2P5VA 3IN5A 1J5EJ 1LV5A 3GE9A 1Q8KA 5H9FJ 3HKWA 1B0PA 4O4GA 2X1FA 2BMBA 2V8VA 2LA4A 2J7WA 4TY8A 1TZ0A 3HFKA 5HROB 4IG0B 1X5SA 3PYDA 4U7UD 4NZ7A 1C1BB 3D6FB 2AV5A 2M7SA 4NEZA 4H54A 4QW9A 3BN4A 3TA0A 3W3SA 1EKRA 4PG7A 5EWEA 3O44A 3Q2SC 2DR9A 1H7WA 4U95A 5KFSA 5B7WA 1A9NB 2VFUA 3C16A 3I4HX 3I5BA 1FD2A 2KU7A 4CLFA 4CM0A 3KMQA 3HI9A 1VHIA 3QRPA 2U1AA 3FRYA 2OPRB 1XR6A 2WAQD 5F0WA 5ETTA 4HR2A 4PPDA 5JJBA 3DFEA 3D66A 4CZCA 1F60B 1W26A 2Z0GA 5U47A 4M5DB 2FVSA 3JSBA 1RT4B 2DGWA 4H4OB 3W64A 2HYIB 3R5JB 4DSIA 4MMOA 1R3NA 2DNGA 4PG4A 3MM9B 2A6OA 1HWUA 1DQ9A 2HZCA 2ZE2A 4NCGA 3QRQA 4DR6J 4AYBD 2GAHC 2HFOA 1SC6A 2EK1A 2DGVA 4OHZA 3BGRB 3DLGA 1U1KA 1QE1A 2FY8A 3N5FA 5HQMA 2UUWA 1SL1A 1RBAA 2ASLA 4HT7A 1ZZNA 1JLAA 3CCQS 1B64A 1NRKA 3GYNA 2HAIA 4ELVA 4AE5A 4LF5F 4X4NA 1NK4A 3PCOB 4M5JA 2B4OA 4DV6F 4JI5F 3D28A 2RRNA 4CLKA 2JLGA 3PHTA 3LP1A 4OI6A 1HIYA 4ED7A 2ZJQQ 4OYZA 1X4CA 3GLJA 1W25A 5CYJA 2BX6A 3VQTA 4NI2B 2AZ1A 1KVJA 1F3VA 2HKEA 4XDCA 3PX0A 1IBKJ 2XMVA 5MAOA 3DLBA 5GADI 2E5GA 1MMDA 4NRUA 2A0FB 4DMZA 2JFDA 3G6YA 3PFEA 1RWWB 2ZZTA 2V9WA 1CS4B 2FGCA 3LAKA 2H5JB 3NGUA 4KC5A 2JC0A 5T41A 4N76A 3CJSA 4X62F 3G82A 1VQKS 1SH2A 3SQGB 3BGUA 2R7TA 1GT8A 2KYZA 1IWAA 1N5VA 2MQMA 3QPIA 3GWCA 1VJQA 1NKCA 1JNZB 4ZDNA 3LWLA 1JJ4A 4CCHA 1TL4A 4CO0A 4DL3A 2O01C 2XZTB 3BQ2A 3PEJA 2MKJA 1U09A 5HSPA 1BMQB 4ID8A 1J5OB 3R6GB 3TEHB 2W25A 2KT5A 1O0PA 2K7JA 1DLOA 4YR2A 4KHMA 2RDIA 4CLYA 3NY0A 2CQGA 1H72C 4RNMA 4K5SA 3UN5A 5C42A 1O6XA 2R7UA 1UZHA 4IQXA 1DTTB 4TKTA 2B56A 2XC9A 3PEHA 1T3NA 4OFZA 4N56A 1YZ6A 2IIHA 3NAHA 3KK2B 4LF8J 2X1AA 1Y5IB 2RKIA 2HFSA 4DR7J 4PUOA 3GP9A 1YLXA 3DRYA 4H4MB 5KFLA 3K58A 4J9MA 4RBTA 4QU6A 5BR8F 2HQIA 1KN6A 3OJSA 4J9QA 2EPIA 1T9VA 4HL9A 1B4SA 4QIFA 3V4IA 2HMIB 2Y3YA 1FJEB 1K1QA 1FRHA 1VC0A 1EP4A 3OFEA 2A10A 1AB8A 3FNNA 4K7QA 5THWA 3IXQA 3GV8B 1XERA 4B3OB 1HQUB 3EGNA 1FDNA 2F63A 2MJNA 4B9VA 5HROA 3QYYA 2BDPA 1CJKA 3CJQA 1F3FA 2H3EB 4KE5A 2HQCA 1VQ6S 3KLVA 1KP6A 2ASDA 1Y9OA 5CA5A 3KLIA 1C4CA 3UR3C 3L3CA 2QLFB 5IWAF 1N36J 3CJKB 1E6VB 3B4DA 1O51A 2VKRA 1FEHA 3M32B 3UDVA 3ZTSA 2ZC3A 3KHRA 3P5BP 1ZPWX 4IFYA 2UVVA 4CDIA 4DR3F 1IKVB 1YBAA 3T1HF 2E1MC 2OPRA 4RNOA 1X4GA 4DQSA 1IKXB 2GV1A 5AE2A 4URGA 1HWIA 2L08A 2HS3A 4K4TA 2CQ3A 4I67A 1GXLA 5A6PA 1PJ5A 1FDBA 2XWXA 4UY8T 4RUAA 1SKRA 1RT4A 4NCAA 3DNCA 4OL8A 4DPUA 2GHWA 1VRUB 4FXDA 2ADCA 3KKFA 3HX9A 3SCJE 4XPCA 3NWGA 1IN0A 2QEXS 4XO0A 4OHVA 4WWSA 1UEUA 3D68A 1S0OA 1TK5A 2CJYB 4U8YA 3RRHA 1NXIA 3MMBA 3CJ0A 2G9OA 2C22A 4LF5J 4DV6J 4FXVA 3KLFB 3U02A 1URNA 2IC3B 1DTQA 1RBOB 4MKVA 3EVWA 2R2SA 1RU1A 2OD4A 1M1HA 3GIKA 2PMWA 4BHQA 1X4FA 3ZZPA 3LGHA 4NI2A 2J9EA 4EUVA 2CUYA 2AQ4A 1XK8A 1R7IA 3L09A 2QLJB 2C3OA 2NUUG 2ADBA 2HHXA 3V6JA 2EK6A 3QGGA 3DDNA 2GHVC 3DRPA 2HIQA 4IOAQ 1VBXA 2ZH1A 1GMUA 1TUVA 3U1LA 2FJVA 4U6PA 3OTDA 3JAMU 2G13A 3UN2A 5SUHA 2BQUA 3HD1A 4HEA9 5EN1A 5K8MA 4A8XA 3CCWA 3SQGA 3UFCX 1WJ9A 2BJ9A 1OSCA 1WC4A 2DNPA 4CLSA 3T5JA 4ZPTR 1VQPS 2ACYA 3EX7B 2DXDA 1R8HA 3Q8VA 3W9HA 3QSYB 2QO3A 1FEEA 3H2UB 2V2VA 3R7BB 3TUJC 4JV5F 3CEDA 5B09A 4F0KA 3ILIA 2F3JA 3H20A 3I0RA 5HJXA 1TAQA 5L1KA 1J5OA
chains in the Genus database with same CATH topology
1F9EB 2H5IB 1RWNB 3IBFB 2QL7B 2Y0BB 3D6FB 3QNWB 2H51B 5K20B 1QTNB 3P45B 3IBCB 4DCJB 2H65B 3R6LB 3GJSB 2XZTB 2Y1LB 2C2ZB 3NS7B 3KJFB 2C2OB 2FQQB 1I51B 1GFWB 1PYOB 3KJNB 1RHUB 1RHKB 4ZVRB 1RHRB 4ZVTB 2QLJB 1BMQB 3R6GB 2CNLB 3P4UB 2HBRB 1PAUB 4LSZB 1SC4B 2C2KB 3RJMB 2H4YB 1IBCB 2QL5B 3D6HB 2XYGB 3EDQB 2CJXB 2CNOB 4DCOB 4JB8B 2XZDB 3GJQB 2C2MB 1RWPB 2C1EB 2XYHB 1RWKB 3EDRB 3GJTB 4ZVUB 2DKOB 2H48B 2HBYB 4ZVOB 2HBQB 1RWMB 2CNKB 2CNNB 2QL9B 5IC4B 4ZVPB 1NMEB 1RHQB 2H54B 2CJYB 4ZVSB 1RWOB 1RWWB 4DCPB 3R5JB 3R7NB 2H5JB 1SC1B 1SC3B 3KJQB 2H4WB 1RE1B 2HBZB 2QLFB 1RWVB 1QDUB 3R7BB 3SIPB 5IC6B 1RHJB 2CDRB 4ZVQB 1RHMB 2QLBB 1RWXB 2XYPB 3R7SB 3GJRB 2P2CB 1ICEB 3D6MB 1I3OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F9E B;  2H5I B;  1RWN B;  3IBF B;  2QL7 B;  2Y0B B;  3D6F B;  3QNW B;  2H51 B;  5K20 B;  1QTN B;  3P45 B;  3IBC B;  4DCJ B;  2H65 B;  3R6L B;  3GJS B;  2XZT B;  2Y1L B;  2C2Z B;  3NS7 B;  3KJF B;  2C2O B;  2FQQ B;  1I51 B;  1GFW B;  1PYO B;  3KJN B;  1RHU B;  1RHK B;  4ZVR B;  1RHR B;  4ZVT B;  2QLJ B;  1BMQ B;  3R6G B;  2CNL B;  3P4U B;  2HBR B;  1PAU B;  4LSZ B;  1SC4 B;  2C2K B;  3RJM B;  2H4Y B;  1IBC B;  2QL5 B;  3D6H B;  2XYG B;  3EDQ B;  2CJX B;  2CNO B;  4DCO B;  4JB8 B;  2XZD B;  3GJQ B;  2C2M B;  1RWP B;  2C1E B;  2XYH B;  1RWK B;  3EDR B;  3GJT B;  4ZVU B;  2DKO B;  2H48 B;  2HBY B;  4ZVO B;  2HBQ B;  1RWM B;  2CNK B;  2CNN B;  2QL9 B;  5IC4 B;  4ZVP B;  1NME B;  1RHQ B;  2H54 B;  2CJY B;  4ZVS B;  1RWO B;  1RWW B;  4DCP B;  3R5J B;  3R7N B;  2H5J B;  1SC1 B;  1SC3 B;  3KJQ B;  2H4W B;  1RE1 B;  2HBZ B;  2QLF B;  1RWV B;  1QDU B;  3R7B B;  3SIP B;  5IC6 B;  1RHJ B;  2CDR B;  4ZVQ B;  1RHM B;  2QLB B;  1RWX B;  2XYP B;  3R7S B;  3GJR B;  2P2C B;  1ICE B;  3D6M B;  1I3O B; 
#chains in the Genus database with same CATH topology
 3SXL A;  4B17 A;  3W9I A;  1VQN S;  3NS7 B;  1SVD A;  1T8E A;  1FRJ A;  4P72 A;  1B7F A;  3POT A;  5AXK A;  2PI4 A;  4YDD B;  4PWD B;  1WTF A;  4HAC B;  3B82 A;  4NLY A;  2AYM A;  1ZM2 A;  2YKM A;  5DGB A;  2XMK A;  1R0B G;  4GO5 X;  1UA1 A;  3HKZ D;  4O0N A;  1DTT A;  4J7C A;  2J0X A;  3MTJ A;  2GJI A;  4N7T A;  2JSX A;  2M5Y A;  3FSX A;  4YY3 F;  2C2R A;  4WP8 A;  1UEV A;  2B0G A;  1QTM A;  1HBU B;  3L7U A;  4ED4 A;  4DOZ A;  3M8Q A;  1VLO A;  4NLG A;  4ZCM A;  3O3L A;  5BR8 J;  2D3U A;  3BO3 A;  4H4M A;  2NXN A;  4CI0 B;  1S4F A;  4DQP A;  2DH8 A;  4QWC A;  4EBD A;  4DV3 F;  2EC2 A;  4MKB A;  4FYX B;  2HMI A;  3TYT A;  3M2V B;  2B9Y A;  3OL7 A;  1KHW A;  3GFY A;  3LP0 B;  4L74 A;  2EBE A;  1VQ4 S;  3X1L B;  3I55 S;  2IM3 A;  2Q79 A;  2ZBI A;  2YNI A;  2CQ1 A;  3PW5 A;  2J6T A;  4PXD A;  3MZI A;  2I0X A;  2CPH A;  1V3S A;  5DLG A;  5IWA J;  1JMT A;  1FTC A;  2JDJ A;  5KFW A;  3ZZY A;  2MSS A;  1IBM F;  4QQB A;  3VAJ A;  2CQC A;  4ZVU B;  3CJK A;  2LDI A;  3TRG A;  3T41 A;  4DL0 C;  4P6Q A;  5AXN A;  5J1N A;  4RNF A;  2W4P A;  4J9U E;  2DO0 A;  2LLZ A;  4NLO A;  4DR3 J;  5KFQ A;  3T1H J;  2YX1 A;  4Z2X A;  1X5O A;  4EEY A;  3P96 A;  2MLZ A;  1VQ8 S;  1R27 B;  5KFH A;  1RWV B;  1IKV A;  2QV6 A;  1N33 J;  2RT3 A;  5CAB A;  2QMU B;  2CQ0 A;  2NYI A;  2QLX A;  3I96 A;  1TUG B;  3MM7 B;  1K73 T;  3MMC B;  4KGK A;  4TQS A;  2QL7 B;  2WSF C;  3P45 B;  1KEK A;  3VAL A;  3W2W B;  3J81 Y;  2RIL A;  2FJE B;  2KFZ A;  2YKA A;  1NJI T;  2XLK A;  3FEY B;  1R8A A;  5KTQ A;  1N48 A;  2D9O A;  4PWW A;  1H2V Z;  1YRX A;  2D3Z A;  5C5J A;  5H9F K;  1NHV A;  2QA2 A;  4XDD A;  2ZKT A;  4F4W A;  1PSD A;  3KHG A;  5LOQ A;  4FKY A;  3ITH B;  2XYG B;  3BZQ A;  1WEX A;  4TVA B;  1N5T A;  3ETM A;  2OLW A;  2DR8 A;  2HEK A;  3OFH A;  1NB7 A;  3A8K A;  1Q0N A;  3SV4 A;  3TUP A;  3AOD A;  4CTA B;  3KLF A;  2IAJ B;  3DLJ A;  5E2Q A;  2IC3 A;  3QJP A;  4GKJ F;  5KFM A;  4KJI A;  2CAD A;  2RU3 A;  2FLN A;  3Q22 A;  1H3D A;  2ZNY A;  4EGL A;  4NLQ A;  4DV7 J;  2ZC4 A;  1WG4 A;  2FJD B;  3KNG A;  1F6T A;  4CLU A;  3HSJ A;  3DLE B;  3OSP A;  1FKO B;  4YN3 B;  4GVL A;  5KFU A;  1YTY A;  4E2F B;  4DUZ J;  6FD1 A;  1ZTW A;  3HSG A;  2VPX B;  4URS A;  4F3O A;  1S4E A;  3MCO A;  1LW2 B;  2Y1L B;  3VGS A;  1CJU B;  4HHU A;  3ENQ A;  1U47 A;  4WF9 Q;  3N79 A;  2DYA A;  3QGP A;  1YZ7 A;  4ECS A;  3HZE A;  4A46 A;  3UWT A;  1U2F A;  4RW7 B;  2IMO A;  1MSW D;  3CE8 A;  4ZP8 A;  2A1B A;  5D0E A;  2KI2 A;  5KOX A;  2W9A A;  4WII A;  1HNI B;  4JV5 J;  2P9C A;  3BEG B;  3CME S;  4R5P A;  4X4V A;  3K57 A;  3FQK A;  1NJX A;  5IQ6 A;  1ITP A;  2CJQ A;  5E3C A;  2I8E A;  4KHR A;  4ETX A;  4FYD A;  4UQG A;  2XS2 A;  1S79 A;  4QOT A;  4P2M A;  5D4O A;  5FLX U;  1WOP A;  2ZHA A;  4DEZ A;  3MUM P;  4KAI A;  2CAJ A;  4DDF A;  4UUX A;  3R7N B;  3RGI A;  1X0P A;  2FHJ D;  4JI4 J;  1Q5V A;  4IOC Q;  5KFA A;  2YX7 A;  4I69 A;  2F8H A;  3NOG A;  3TWZ A;  4CLL A;  3I0S A;  4DSE A;  1JXL A;  2P2C B;  1OY9 A;  2E29 A;  1OQ3 A;  1N6Q B;  4UOG A;  3FBB A;  1S1W B;  1IR1 A;  2QYG A;  4HHJ A;  4HAC A;  1TQL A;  1VIS A;  2CZ4 A;  3MEE B;  1M5O C;  5M2U A;  4C0O C;  1RCX B;  4ICL A;  4A8S A;  2B5J A;  3KMS A;  3M8Y A;  2XBP A;  1HBU A;  3EDQ B;  1YI2 S;  4B9N A;  2D41 A;  4MKY A;  2M4M A;  4KBI A;  3LTO A;  2MY8 A;  2QJ3 A;  4DV3 J;  1FWP A;  2BM0 A;  1RWM B;  5AE1 A;  2CNK B;  1AUS L;  3T6J A;  4JI0 F;  1UJ4 A;  3P49 B;  1JLG B;  4AXJ A;  3K5N A;  2IM2 A;  4WBF A;  5LL6 d;  3M2V A;  3LF0 A;  1NB2 A;  4OI3 A;  3KG1 A;  3HLU A;  3I9V 9;  2CPI A;  4OYO A;  1RYS A;  4L76 A;  3H5Y A;  3UQS A;  1L3K A;  2JVO A;  4BWJ A;  1AYE A;  2RDD A;  1R43 A;  1T03 A;  3O8W A;  1LK5 A;  4ES1 A;  1SKW A;  3UNG C;  1IBM J;  1IVZ A;  4K4V A;  4ANC A;  3Q8Q B;  3ZZZ A;  1LWF A;  4DU8 A;  5A0Y B;  4OZJ A;  2V0N A;  2EG1 A;  1SC4 B;  5D0R A;  3LAM A;  5B08 A;  1KD1 T;  4UST A;  1IBC B;  2QMX A;  3P5T L;  1C4A A;  1VK3 A;  1P6T A;  4F67 A;  1CUL B;  4GC6 A;  1RWK B;  2DBB A;  1KQK A;  2R7R A;  1T94 A;  4LVO P;  4ZS6 A;  4F4Z A;  3SSQ A;  3OD2 A;  1XNQ F;  4WK1 A;  2YNH B;  3MED A;  2R8J A;  3CW2 C;  5I42 A;  3NGK A;  4QIE A;  2D69 A;  3O6Q A;  3BF4 A;  3AJ2 A;  3ISN D;  1PKU A;  2BYC A;  3GSD A;  2VF3 A;  4DPX A;  1S48 A;  1LKZ A;  2W4D A;  4NWB A;  4GVB B;  3G8Q A;  1S6U A;  3NCR A;  4C7Q A;  2GO8 A;  2UP1 A;  1BC6 A;  1VQS A;  3D1O A;  2LFV A;  1X60 A;  2Q6B A;  1Q8I A;  3ZO7 A;  2DIV A;  1QAY A;  3CCT A;  2IBO A;  4GKJ J;  1OMS A;  4DN0 A;  3VAK A;  4W90 B;  4CTA A;  1Z2L A;  1NUE A;  2AYG A;  2HHH F;  2OFH X;  4RW6 A;  3FEX B;  2HHS A;  1GMW D;  3IWL A;  4UOH A;  2DHA A;  2MQ8 A;  1GMV A;  1I1G A;  3DLE A;  2ZVS A;  3TAQ A;  4RKU C;  3RW6 A;  1FKO A;  1HW9 A;  4ED0 A;  3V5R A;  3E01 B;  2J76 E;  3KUH A;  4NXN F;  4WE1 B;  2DCU B;  3T9Z A;  2WBM A;  3EZ5 A;  1RT7 B;  4X4T A;  3HF5 A;  1CSJ A;  3HDS A;  1SC1 B;  3N0V A;  1H73 A;  1V9O A;  1CJU A;  2OHD A;  2V63 A;  4P2F A;  3IS9 A;  2A2C A;  1K9M T;  1S7I A;  2AYB A;  1SQF A;  5KFG A;  3ENV A;  5DQI A;  2Q6C A;  3CXC R;  5B0C A;  1NPK A;  1S9E B;  3IM9 A;  1HBN A;  1HNI A;  1UCN A;  1HR0 F;  3DOM B;  4ZVG A;  4ZPV R;  3G8T A;  4MKA A;  3QT5 A;  2BAB A;  3AXK A;  1S6Q A;  3QSI A;  1HQE B;  1PC5 A;  5F41 A;  4AT1 B;  3MAA B;  1KON A;  2XB2 D;  1NSQ A;  2V4Q A;  2COL A;  2FD2 A;  4FXW A;  5JMN A;  2XI3 A;  3KHH A;  2FJA B;  3KK1 B;  4J9O A;  1JJ2 R;  5KFY A;  1KFS A;  4ZN1 A;  2ZNZ A;  1KBR A;  2AJ2 A;  5C2C A;  4ED2 A;  4A8Y A;  1C0U A;  5KFN A;  3MOZ A;  3HVW A;  3MEE A;  2CDR B;  1TL7 B;  4LJM A;  4K4U A;  3MD1 A;  2XM3 A;  2RNE A;  2D3O R;  2NSB A;  4F4K A;  1C2P A;  4DQQ A;  3CIM A;  1WC1 A;  3M6U A;  4KGZ B;  2C2O B;  2OUG A;  2IRU A;  4J9R A;  2CVE A;  3BR9 A;  3IRW P;  2D9P A;  4URQ U;  2KM8 B;  2DPJ A;  1S97 A;  4RLE A;  4JI0 J;  5A8W A;  4DG1 B;  3HT3 A;  1RKI A;  3JTO A;  4DV2 F;  1EIY B;  1JLQ B;  1D9D A;  1CG2 A;  1BWE A;  1JLG A;  4DQI A;  2IJR A;  4IUF A;  1RWP B;  3F73 A;  3EGV A;  2W7O A;  2BE2 B;  4GMK A;  4ZVO B;  3V81 A;  2N7Y A;  2OKQ A;  3KDN A;  4CO2 A;  5KG1 A;  4AL6 A;  4PXB A;  4K0K F;  1B70 B;  4QR0 A;  2OPQ A;  1S77 D;  2FVC A;  2I38 A;  2KJV A;  3FZB A;  3GIJ A;  1RAB B;  3B4M A;  4K4Y A;  4U7C A;  5ETP A;  5KFC A;  2ZKU A;  2RUS A;  3DOL B;  3L9Z A;  1XC9 A;  1IBL F;  5KFX A;  3HXM A;  2IHR 1;  3VQS A;  1PO6 A;  2E1C A;  2QN6 B;  3A1Y G;  1H2U X;  3R2D J;  1ZM3 A;  4Z7C A;  1CUL A;  1HI1 A;  2N3O A;  4OZ0 A;  4FF3 A;  1LQ9 A;  3GG1 A;  2MST A;  1KC8 T;  2E5I A;  3KXD A;  3DRS B;  2JH3 A;  3D9B A;  3G96 A;  2R4F A;  2K8G A;  1TU0 B;  3N4W A;  3Q83 A;  5HBM A;  2B43 A;  2VG6 B;  1GNK A;  1U1Q A;  1FF2 A;  4YEA A;  4JI6 F;  2MQL A;  3JSM A;  5LJ3 Y;  2PA3 A;  4IRD A;  3C46 A;  3HHL B;  2IRY A;  2FPH X;  4N77 A;  4PWU A;  2QA4 G;  2RB7 A;  3LWM A;  1N32 F;  3SZ2 A;  5LMU F;  3HVT B;  1UWB A;  1RWO B;  3GFH A;  1FX4 A;  3R1L A;  3IWX A;  2HG4 A;  2VPW B;  2X1G A;  2V8G A;  3M8P B;  1NDL A;  2GC8 A;  1VDH A;  3KWM A;  5LT5 A;  4DFK A;  2DHG A;  5LSR A;  1WSV A;  4DF8 A;  3M2R B;  2HWH A;  2D7S A;  3NGS A;  3UCG A;  5ETV A;  3CMA S;  2A18 A;  3NMA A;  5HAT A;  1D8Z A;  2DR6 A;  1K47 A;  2XQC A;  2ZM6 F;  2EFP A;  1ZA1 B;  2AWZ A;  1GXU A;  2HWI A;  3G4S S;  3A8E A;  3A3P B;  4TQR A;  3DHW C;  3CT9 A;  2BJ8 A;  2KVI A;  3BBB A;  4LRB A;  1KKH A;  4NXN J;  3C66 A;  1TL3 B;  1QSY A;  1R0A A;  1EB0 A;  1WKL A;  4USH A;  2B8P A;  1AA1 B;  5HAO A;  1U1N A;  3O1L A;  3GON A;  4RW4 A;  1S0N A;  4ZP9 A;  3K17 A;  2DNZ A;  3AA9 A;  4I6W A;  1RTH B;  3TZW A;  3ZFV A;  1SIW B;  4CO3 A;  4CYU A;  1S72 S;  4G1Q A;  1RT6 B;  4ZIT A;  3BSN A;  4P52 A;  1JXE A;  3C8Y A;  4Q2M A;  2W4C A;  3DYA B;  5BYR A;  2XMA A;  1HR0 J;  3SIP B;  2B7B B;  1WC3 A;  3P8B B;  3DDK A;  1YJR A;  1N5Y A;  4DXL A;  2QG9 B;  1MU2 B;  5DGA A;  3DOM A;  4HI2 A;  3PHE A;  3G9C A;  3IBC B;  1TAU A;  4L72 B;  2FY1 A;  1S9F A;  4MIB A;  2JEJ A;  4RUH A;  3SCK E;  5FII A;  3KUE A;  3MAA A;  1CJT B;  4HH0 A;  4N41 A;  2Y1I A;  4EO6 A;  4OYA A;  4PAA A;  4O44 B;  3NOC A;  4ALZ A;  2XHC A;  2HFZ A;  5A8K B;  2LEC A;  2V4J A;  4ZLP A;  3BO4 A;  3QMQ A;  1RSC A;  2FHK A;  3K5O A;  2WOM B;  5CYM B;  1T9Y A;  3BV8 A;  2R2R A;  5A2Q U;  3V6H A;  2NCK L;  3ILO A;  5EWG A;  2HND B;  5KFI A;  3FFI B;  1TL7 A;  4LRA A;  1HNV B;  2OEM A;  5HMZ A;  4ZPD A;  4C8M A;  3OPK A;  4MFB B;  3KOA A;  3AOA A;  3FMB A;  5DZ7 A;  5KT4 A;  1WSR A;  3D6M B;  1BXN A;  1LXJ A;  1WG5 A;  1T05 A;  2H1Y A;  3UW1 A;  1I3O B;  2J9D E;  4DV2 J;  2B6A A;  3QT6 A;  1FJC A;  2LQB A;  4HLB A;  1UVK A;  4FYY B;  2KL8 A;  3C19 A;  3MM8 B;  3VAH A;  2P6T A;  1WC6 A;  1RHU B;  3PM9 A;  1IJE B;  1RAJ A;  3QID A;  3D2W A;  1TV6 B;  4K0K J;  2BE2 A;  4QR1 A;  2KZM A;  3MPD A;  5GAH U;  3GV5 B;  1Q4R A;  5MLC V;  4UOC A;  1NZA A;  3D6H B;  4YHH F;  2NPF A;  1SJR A;  1RA7 A;  3KLH B;  1FRI A;  4DSJ A;  3BM7 A;  9ATC B;  2AMC B;  4DV4 F;  3PKM A;  1MG7 A;  2AU0 A;  1IBL J;  4Y65 A;  1HBM B;  1RHQ B;  4HDG A;  3DOL A;  4WXO A;  1FXR A;  4FF4 A;  2GA7 A;  2GS8 A;  1AW0 A;  3MAQ A;  1SH0 A;  1KRP A;  5DJB A;  4P74 A;  2BR0 A;  5DG9 A;  2VQF F;  1QDU B;  2IVF B;  1MRO A;  3QRR A;  2I2Y A;  1M5P C;  2KRR A;  1WOO A;  1Q79 A;  2HQD A;  3GSI A;  4TXS A;  3N5B A;  4P7T A;  3IA0 A;  5HLF A;  2W8K A;  4HDH A;  3I5A A;  3CJ4 A;  4C8O A;  1UWA A;  1Q7L B;  3JAM Y;  2VG6 A;  5J2N B;  3CJ8 A;  4OI2 A;  4Z7Y A;  4L75 A;  3CUN A;  2ZOF A;  2W2P P;  4NMX A;  1NCL A;  3O5T B;  1N0U A;  4ILR A;  1OO0 B;  4RBU A;  1N32 J;  1WNE A;  1NSP A;  1S7H A;  5LMU J;  4E0D A;  2F4F A;  3HHL A;  1QAI A;  3DDI A;  1H98 A;  3OUY B;  4JI3 F;  4Y2M A;  5CCM A;  4WFY A;  3H90 A;  1W2I A;  4F8R A;  5CD4 A;  1BQM A;  3HUL A;  4F0M A;  2BE9 B;  1I94 F;  3EYZ A;  3RAX A;  3D0I E;  3NAI A;  4LRD A;  3CB4 A;  3M8P A;  2NZ4 A;  2ZUG A;  1I5O B;  5IZH A;  2QRR A;  2ERR A;  3M2R A;  1REV B;  2JL9 A;  1FKA F;  2ZM6 J;  3PJX A;  2R7O A;  2X1B A;  1Y4Z B;  3DOK B;  2BE7 D;  1XMQ F;  2V5H G;  2MKK A;  2NXE A;  3ENA A;  2BJD A;  1D09 B;  4KFB B;  3A3O B;  5CYQ B;  4Q45 A;  3M8Z A;  1OWX A;  1SPB P;  4DSK A;  5G4D A;  1B99 A;  2UU9 F;  2DT9 A;  3UD5 A;  1TL3 A;  3WX4 A;  4ZLN A;  3R27 A;  4A8W A;  4W92 B;  3AJD A;  4B9T A;  1RT1 B;  2M88 A;  3ZTO A;  2QGF B;  2R42 A;  5LJ5 Y;  3VGT A;  3MFH A;  4UUW A;  2R2T A;  2VA2 A;  1SXL A;  1MN7 A;  3CF5 Q;  3CD0 A;  2Z2L A;  4KGM A;  2KHC A;  2DCL A;  2AW0 A;  2DIU A;  1NSK L;  1X31 C;  4OYB A;  1HMV B;  2VDH A;  3G6X A;  1OIA A;  4IRK A;  4C98 A;  1QSL A;  3MF5 A;  4D3H A;  3OTC A;  4XTT A;  3IG1 A;  4I1T A;  5F3T A;  1T11 A;  5KG3 A;  5CZX A;  3RB0 A;  1MU2 A;  3TVK A;  1QM9 A;  4GKK F;  4OYP A;  4DCP B;  1HWK A;  2HHW A;  2DXF A;  4ZVF A;  4OYI A;  3KLG A;  5J2Q B;  2IYI A;  1URR A;  4DQR A;  2EW9 A;  4LF2 A;  1S1X A;  3EMT A;  2VQE F;  3TJA A;  3GQC A;  1GMW A;  3E3X A;  1CEZ A;  4O3R A;  3RBX A;  2Z57 B;  1NK6 A;  2K3K A;  2GVD B;  1RWN B;  2OEJ A;  1KSP A;  3W2V B;  1F2H A;  2VU5 A;  3H5U A;  1UJ6 A;  3W61 A;  1QTN B;  2WW4 A;  2DNM A;  2G2Z A;  2LYV A;  5A8K A;  3MUR P;  3GR1 A;  1JX4 A;  1JQG A;  3WBZ A;  3SMZ A;  3AQO A;  4RZR A;  1OYD A;  5J2M B;  2OFG X;  3PR5 B;  2G4B A;  4L3N A;  3VHQ A;  2VG5 A;  1T3O A;  5F8I A;  4X64 F;  3PO4 A;  5KFP A;  1EET B;  5JVH Q;  1HA1 A;  4PR6 A;  3R1H A;  4P10 A;  3R5D A;  3OSN A;  4ZHR B;  1KWM A;  2BOA A;  3TO8 A;  1IKW A;  4DHV A;  2IA6 A;  2JC1 A;  4XK8 C;  2YH0 A;  2P9G A;  5K5M A;  1A6L A;  2L48 A;  1XMO F;  2M52 A;  1Y3J A;  4C8K A;  1D1U A;  4I4B A;  3MM8 A;  4ZVQ B;  3QT7 A;  1FHT A;  1YSJ A;  5KG5 A;  4C4W A;  2XYP B;  3W66 A;  2HAF A;  2ZFH A;  4HH1 A;  3MXH P;  4RX6 A;  2XS5 A;  2PE8 A;  2DNR A;  1NO8 A;  4L6V 3;  2DEI A;  3H40 A;  4DV4 J;  3IR5 B;  3KLH A;  3AQP A;  3T1A A;  4ZIW A;  4ZLL A;  2HVH A;  2DY1 A;  2QIF A;  2E9R X;  2HVZ A;  3B8H A;  4X4U A;  2ZH7 A;  4YME A;  3P4U B;  1EAY C;  2DD8 S;  2C2K B;  1JJH A;  4S0M A;  3I9Z A;  4AFF A;  2YQ3 A;  2HFV A;  4NLR A;  4OV6 A;  2W01 A;  2HK3 A;  4NYP A;  3NCQ A;  2VQF J;  3JYT B;  3C6U B;  2XY6 A;  2XZD B;  3M9M B;  4ZKA A;  3R5C A;  4J9L A;  1V3R A;  3K2Y A;  4EMD A;  1AT1 B;  2Z8Q A;  3MPU B;  5I3P A;  3H8Y A;  3V4M A;  2KXH A;  4EI2 A;  2YWG A;  3IM8 A;  3GCW P;  2ATL A;  5BJR A;  4ECY A;  3SQO P;  1YJN S;  5J2N A;  2G0J A;  3GR0 A;  1UPP A;  1HL6 A;  1ROF A;  3GJR B;  2ZH5 A;  2VFT A;  2PEH A;  4CO4 A;  1M5H A;  2YTC A;  2R7Q A;  4B9U A;  2AX1 A;  3KJV B;  1JIH A;  3OUY A;  1HNX F;  3HCX A;  2BEF A;  4QIW D;  1I94 J;  3OVA A;  4YOE A;  4DL5 A;  1SCJ B;  3PY8 A;  3DRX A;  1SL0 A;  3H0P A;  3ZZO A;  3HK2 A;  1ACM B;  4RW8 B;  4JV1 A;  3CTR A;  3LA0 A;  2G2O A;  1C1C B;  5FLX Y;  2VC1 A;  4ZVE A;  1R8P A;  4GO7 X;  4X4P A;  1SQE A;  4LFA F;  3CD5 A;  2W2M P;  4IDK B;  3FSY A;  1XMQ J;  4LBP A;  4JI7 F;  3CCV S;  4PQU A;  3BKF A;  5LMN F;  3DOK A;  2DKO B;  2C3Y A;  4OZ2 A;  2O66 A;  1B3T A;  3GYX B;  3TUI C;  3NLC A;  2UU9 J;  4Q0B B;  5CYQ A;  5A6W A;  1WTB A;  3Q24 A;  1U1O A;  2MHE A;  4WIQ A;  1YK9 A;  1KNZ A;  4GC7 A;  2VC0 A;  5GMD A;  4CH7 A;  2OIH A;  4LSN B;  1KLN A;  5H1S V;  4J91 A;  2G2Y A;  3OXG A;  1S76 D;  1NDC A;  3IRX B;  4IFV B;  1RT1 A;  5GAE U;  1UFW A;  2DNH A;  2CJK A;  3M1V B;  1XTZ A;  3J7A 1;  1B7Y B;  1FXD A;  4Q8E A;  3KJF B;  4LIR A;  1LW0 A;  5KT2 A;  1JNR B;  1HMV A;  3HHL C;  4F50 A;  1TKD A;  2HPU A;  2P9E A;  2PDA A;  2XSJ B;  4DV0 F;  4GKK J;  1XWL A;  3S1T A;  2HGM A;  3IC1 A;  5EGY A;  4UF4 A;  3NWR A;  1WWH A;  2NS1 B;  2MTL A;  4RNH A;  1JLB B;  2W9C A;  1FE0 A;  5L1I A;  1T9U A;  5J1P A;  4Q8F A;  1W7W A;  2UUT A;  3Q8R B;  2RQM A;  2VQE J;  2BQ3 A;  4LQ9 A;  3MCS A;  2HNY B;  4QWB A;  4RPF A;  2XTJ P;  4ZVP B;  4J9S A;  2VAS A;  3PX6 A;  4Y3C A;  4PG8 A;  2KN4 A;  4IO1 A;  1X4E A;  5AXL A;  3W2V A;  4LVN P;  2XCA A;  3KG0 A;  2E66 A;  2M2B A;  3IWN C;  3ET6 B;  3KLE B;  4JYA F;  3G8S A;  3W9J A;  2BJ3 A;  4OX6 A;  5J2M A;  4X64 J;  4DL6 A;  2AGP A;  3DGP B;  1LXN A;  2G0C A;  5EUH A;  1TKZ B;  3TI0 A;  2O5D A;  1TUW A;  5KFF A;  2DRB A;  4WXW A;  5DQH A;  3OL6 A;  4KTQ A;  1T02 A;  3GIR A;  3F56 A;  4Y2C A;  4PQA A;  1S0M A;  1XMO J;  4A8Q A;  2YVS A;  1ZZF A;  4KPY A;  4LFC F;  1AZS A;  2R8K A;  2EEY A;  3K89 A;  5GAE I;  3BGL A;  1KLM A;  3VVU A;  2KYX A;  2NUH A;  3N6M A;  4LUB A;  3BYP A;  2AP6 A;  1R6V A;  1U48 A;  3C6T B;  1RAC B;  5IS2 A;  2AHO B;  4WP9 A;  1XIQ A;  2AIR B;  4A8F A;  4ZVS B;  2XNR A;  2FLO A;  4DUY J;  2OAU A;  1S5Z A;  2YX4 A;  3LP2 A;  3NKY A;  5EX0 A;  3QO9 A;  4C97 A;  4KKO B;  1LNQ A;  4DX5 A;  1KDN A;  2VFV A;  2XI2 A;  2RHS B;  4O3O A;  1FER A;  3T5H A;  2CQI A;  3RAM A;  4QYR A;  3TOQ A;  1RT2 B;  4FS1 A;  2ALZ A;  3MM6 B;  4I7F A;  1XR5 A;  4K59 A;  1SIZ A;  1Q81 T;  4IO9 Q;  3QT8 A;  3JYT A;  2LDY A;  1WDD A;  4Q7A A;  5GAG I;  2RIJ A;  2GO9 A;  3CCM S;  1RLC L;  4V1A k;  2CNL B;  2ZD1 B;  3KK3 B;  4N8N A;  4X4O A;  1SUQ B;  2JWN A;  3AA8 A;  4CLP A;  3ILJ A;  1QY7 A;  3OVS A;  4DPO A;  5DS7 A;  3UNY A;  2LXF A;  2XUL A;  2BA9 A;  4X66 F;  1LWC B;  1IUJ A;  5ADZ A;  2AKW B;  4JI8 J;  2HRT A;  1N5Q A;  3AD7 C;  1DBD A;  2W9B A;  1FFW B;  1HNX J;  2CFX A;  3R9L A;  3HSZ A;  2UUA F;  4DFM A;  4YQW A;  3DKD A;  3KJV A;  2U2F A;  5GAD U;  2GGP A;  4USU A;  1FKP B;  2GJ2 A;  1VCT A;  1VIO A;  1EX8 A;  5D0H A;  1G3O A;  3I32 A;  3FVY A;  2CXE A;  2NR0 A;  2QFI A;  1WF0 A;  4NXM F;  3OR2 B;  4RW8 A;  4FZV A;  1RTZ A;  5F9L A;  5E41 A;  3ZTQ A;  3QNW B;  5A8R A;  3PR4 A;  2G0I A;  3A3N B;  2XMT A;  1QUV A;  3PV8 A;  3JB9 k;  3Q8P B;  4JI7 J;  1ZAV A;  5LMN J;  2VPY B;  3GZ7 A;  3CCJ S;  5C25 B;  4C9D A;  2V4R A;  4DR2 J;  3LO3 A;  5KG4 A;  3K5M A;  2XEX A;  1NHK L;  4CO1 A;  1KOO A;  2DNQ A;  5LSO A;  3DGV A;  5KFR A;  5HVH A;  2ASY A;  4ZIV A;  2OJ3 A;  1VRQ C;  3KUG A;  4I2Q B;  3MM5 B;  3VV2 B;  2HNZ B;  2HVD A;  2QL9 B;  4WP3 A;  3L7O A;  3CJR A;  3UVJ A;  2MKH A;  4CO5 A;  3BBF A;  2GML A;  1JB0 C;  5IM0 A;  1U02 A;  2D3O 1;  2B4P A;  2NPI A;  4B9L A;  1K0V A;  3TZX A;  2V34 A;  3J7Z T;  4ECV A;  3B78 A;  3VAF A;  4FDF A;  2GNK A;  1IKY B;  3CPW R;  4OJ1 A;  4DR1 F;  5FDL A;  1FWK A;  2UXD F;  5K8N A;  3CD7 A;  3W5Z A;  4USK A;  4C2M A;  2M0G B;  4ZVR B;  2JEF A;  2C2D A;  3OR1 B;  5K8O A;  2HNY A;  5LXY A;  5B0B A;  3IMQ J;  3SCI E;  3I4P A;  4RW9 B;  2DNK A;  1HI0 P;  4MIA A;  2LEB A;  3EXC X;  8ATC B;  1NK0 A;  1FD8 A;  4WFN Q;  3NG8 A;  4HTJ A;  3CJ2 A;  3M9O B;  3GMG A;  3M2U A;  4FVC A;  3DU5 A;  3GTY X;  1ZET A;  1S1T B;  4YR0 A;  2XMW A;  5M2P A;  1DQA A;  2OPP B;  5K9F A;  1AUD A;  3DGP A;  3RR7 A;  4U8V A;  2XS7 A;  1Y7P A;  4M5N A;  4DPY A;  4ILL A;  5F8N A;  4KIA A;  4RU2 A;  1YKW A;  1TKZ A;  4G1I A;  4NX9 A;  3SDE B;  8AT1 B;  4DX8 H;  2ZOG A;  3WX8 A;  2R9L A;  5KFE A;  2NYH A;  2CWK A;  4C11 A;  3CVK A;  4MJK A;  2NXU A;  3TUZ C;  2LXI A;  4NPO A;  3HJF A;  3RW7 A;  1WHW A;  1FFG B;  2ALY B;  2JFK A;  2RVJ A;  3HVR A;  5GVQ A;  2AJ0 A;  1JLE A;  2PSZ A;  2R3V A;  4FN5 A;  1S9G A;  1XJW B;  1HNW F;  2J6S A;  5CXT A;  4DJB A;  2SXL A;  2ACM A;  3AAW B;  3MEK A;  3U1N A;  1HNZ J;  2YWF A;  1NBE B;  3THT A;  4LMZ A;  3MDF A;  5FJ4 A;  3FEZ A;  1T0T V;  2YNG A;  3OBI A;  3K7R A;  1K8A T;  4LRE A;  2MPU A;  4F25 A;  2L9N A;  2V69 A;  1IM6 A;  2V2Q A;  2ZBC A;  3E2E A;  4NLW A;  4P2S A;  3TQ1 A;  2ZOM A;  1NU4 A;  3PYG A;  3SSS A;  3KJQ B;  4K2J A;  3H2V E;  5K14 B;  4LBI A;  4DLE A;  3QGH A;  2MHN A;  1K44 A;  2VUG A;  4P73 A;  2E5L F;  4PZV A;  1TMM A;  3KK3 A;  1VRT A;  4FNH A;  1SUQ A;  5KFB A;  2F4V F;  2PGC A;  3F41 A;  2HLU A;  1ZTT A;  1S1V A;  1CJV A;  1ZM9 A;  4EFA C;  1HYS B;  2KXF A;  4FVM A;  3OTB A;  4X66 J;  4DR4 F;  2MYF A;  5J2P B;  2K2P A;  1FNO A;  4RBV A;  4USI A;  2C3P A;  5DM7 Q;  1PAU B;  1LWC A;  2UUA J;  4KYZ A;  1PYS B;  4IG0 A;  1VC6 A;  4M5K A;  1OS5 A;  3MCN A;  1Q82 T;  4FPI A;  3BBC A;  2FYX A;  3IO1 A;  4CM2 A;  1C1B A;  2UVW A;  2FLP A;  2MKS A;  3K8W A;  1Z4U A;  5ETM A;  5D4L A;  3AT1 B;  4BC7 A;  1N52 B;  3PG9 A;  2DHX A;  2LQ8 A;  4NLX A;  2DR5 A;  2DB1 A;  1G6B A;  5KG6 A;  2YWK A;  1NPR A;  3CC2 S;  3AY0 A;  3OLB A;  1NME B;  2PN6 A;  1FXL A;  3OR2 A;  4BCA A;  4BWM A;  4N5S A;  1OQ6 A;  3OL8 A;  3BDE A;  2FC8 A;  1IQZ A;  3K5L A;  2MEW A;  5IXU A;  5B0E A;  2KKH A;  4EZ6 A;  3ILL A;  2WW8 A;  4WCE Q;  1FJG F;  1X4B A;  5C25 A;  2VB6 A;  2DVI A;  4Y6I A;  4Z37 A;  4JUZ A;  2CG4 A;  4BS2 A;  4Y0F A;  4ECQ A;  1VBK A;  3U27 A;  4M5D A;  1REG X;  4FPR A;  1C0T B;  2CPE A;  2RQK A;  5A2Q Y;  2MKY A;  5DZ6 A;  2JLE A;  1NH7 A;  4H4O A;  3D3C J;  4L3K A;  3MM9 A;  2DK2 A;  4I2Q A;  4LR7 A;  1N4L A;  1U26 A;  5KFZ A;  1Q86 T;  4O3S A;  2BVZ A;  2HNZ A;  3BGR A;  3V2U C;  3BQ0 A;  1GAO A;  4OX9 F;  1PAE X;  3PTW A;  1R89 A;  2L41 A;  2DNY A;  4U9R A;  3L95 X;  2YWE A;  2W2Q P;  4LF4 F;  3UCU P;  2FVQ A;  4JI5 J;  4DR1 J;  1CBK A;  4F3M A;  2UXD J;  2L3M A;  1IKY A;  1GK8 A;  4XAK A;  3DM2 B;  2LXU A;  3LAL A;  1BUX A;  4I64 A;  1VQ5 S;  3HHK A;  1UMJ A;  4JI2 F;  1HHS A;  3GIL A;  2PT0 A;  1RE1 B;  2OSR A;  3KYL A;  1VQM S;  4ED3 A;  1F5A A;  3G6E S;  3LPE A;  4EO8 A;  3OR1 A;  1UW4 A;  2QA4 S;  3VZH A;  5EX3 A;  1X5P A;  3QIP B;  3VVT A;  3BKT A;  4HKQ A;  2LEP A;  3LOU A;  5L1L A;  4QCL A;  1CS4 A;  4ECU A;  4JBC A;  4TN2 A;  2XZW A;  4X62 J;  2CIM A;  2M70 A;  3NNA A;  4MTP A;  2YNF B;  4KO0 B;  1S1T A;  2MLY A;  2OTJ S;  2NSC A;  1Q95 G;  2OPP A;  2AGO A;  4MYU A;  5KG7 A;  2RF2 B;  1CQM A;  5D15 A;  3AB2 B;  1WI8 A;  4G65 A;  4DL2 A;  3ZC4 A;  3SDE A;  5B0D A;  5DET A;  3MGJ A;  3J7Y U;  2YPZ A;  4Y2I A;  2PO4 A;  2Z2Y B;  4YP3 A;  4OX8 A;  3Q86 A;  2DNN A;  1U6B A;  3DXB A;  1MWY A;  3OVB A;  2WON B;  4B02 A;  1HNW J;  2X3D A;  1QVG R;  3MFI A;  3OFG A;  2Q3P A;  1WD6 A;  2FLL A;  4B3R F;  3AOB A;  3RBZ A;  5HAN A;  2K3I A;  2BJ1 A;  3JSR A;  3BRE A;  5L38 A;  3WC2 A;  3M8W A;  5IV3 A;  1WC5 A;  4U67 Q;  3L7P A;  1GX5 A;  4K50 A;  2MKI A;  2Z58 B;  2HQ3 A;  2WVB A;  3PJW A;  1TP7 A;  4NAS A;  4NLS A;  2C2E A;  1V3Z A;  2CQH A;  3KK2 A;  3TP2 A;  2RD5 C;  5HN0 A;  2MLX A;  2E5L J;  1WC0 A;  2ZHO A;  5F8J A;  4WPA A;  2FHM A;  2LU1 A;  4JV0 A;  3LH2 S;  4G1P A;  2F4V J;  1NK8 A;  1YVF A;  3HHE A;  4CWB A;  5C24 B;  1GQE A;  1WOR A;  4DR4 J;  4R8U B;  5J1E B;  4QWE A;  2FVR A;  2K1R B;  1G7C B;  4RNN A;  1WUU A;  4AND A;  5J2P A;  3NBP B;  3TZZ A;  4B3O A;  1HQU A;  2FZK B;  2WBR A;  3AJ1 A;  4J5O A;  2Y0B B;  4UY8 5;  3ZXW A;  3N6L A;  3MR3 A;  3QJJ A;  1HLW A;  3E8O A;  1HWL A;  3J7Y I;  5JVG Q;  3J7A N;  5BYS A;  4IOB A;  5IOL A;  3WQP A;  4M94 A;  4KB7 A;  3WC0 A;  5KFO A;  4OV1 A;  1VR6 A;  2ZH9 A;  3CC4 S;  2D1C A;  2CQD A;  4CLW A;  1E6V A;  2I9S A;  2RQC A;  1F9H A;  3QAE A;  5AT1 B;  4YFU A;  4NCG B;  2M9K A;  1L5U A;  4G6V B;  1FES A;  3M32 A;  1IJF B;  2CA9 A;  4UW2 A;  2EWH A;  2XY7 A;  1B0T A;  2N4C A;  1HW8 A;  3DLG B;  1NJZ A;  1RJJ A;  1EQM A;  4WFB Q;  1QE1 B;  4KPC A;  4P7V A;  1JLA B;  1BWV A;  1R8C A;  5SZT A;  3PRD A;  3C2P A;  2UVR A;  1IKX A;  1UZD A;  1F5C A;  1KTV A;  4F2R A;  1U4B A;  3C3L A;  1NSA A;  3CO0 P;  4QYZ J;  4DS5 A;  4OJ3 A;  3PRB A;  1RTI B;  4M5H A;  1TTH B;  3MAH A;  5JXS A;  2HW3 A;  2RQ4 A;  2AD9 A;  3RRG A;  1OSD A;  1VRU A;  2WVE A;  1RAG B;  3W62 A;  5I3U B;  4QIV A;  4OQJ A;  1YJW S;  2IM0 A;  4OX9 J;  3S8S A;  2XNQ A;  1WOS A;  2HHQ A;  4OHX A;  4FBU A;  3MPV A;  3HO1 A;  1VQL S;  1Q5Y A;  3OLA A;  2YKQ A;  4AXI A;  1LOU A;  2VH7 A;  3W1Y C;  3IFE A;  3A8J A;  2GIQ A;  3RAQ A;  3UE2 A;  5KT5 A;  3CNQ P;  4LSZ B;  4I6A A;  3H5X A;  4V19 J;  2JX2 A;  2HGN A;  4OHY A;  3R5G A;  4B9S A;  4JI2 J;  3DM2 A;  1L3T A;  1MNE A;  3EUN A;  1WDT A;  2YWW A;  4ES3 A;  2FUG 9;  3BS9 A;  5CHC B;  2EKN A;  2E1A A;  4WTO B;  3RB6 A;  1GTE A;  4LF9 F;  1RAO A;  3FBC A;  1J2V A;  4LF6 F;  3PW0 A;  3KHL A;  4KSE B;  1Q8L A;  3QIP A;  4DS4 A;  2HHU A;  2XO6 A;  5ETR A;  3DMJ B;  2H4W B;  3CCZ A;  3M8S A;  3HP6 A;  3R97 A;  3OL9 A;  3P6Y C;  2QLB B;  5DDQ C;  3BGF A;  2V68 A;  1DLO B;  1FRX A;  1M1K T;  5F3Z A;  4KO0 A;  4B3S F;  4RJV A;  1N34 F;  3TEG A;  3GJS B;  1YWX A;  5E0O A;  4E8U A;  2KZZ A;  1WI6 A;  1F0X A;  2Y0S D;  3LW5 C;  4DI6 A;  2QYC A;  3UR0 A;  2N4D A;  2CG8 A;  3HT0 A;  4LBH A;  4Q2L A;  2E9T A;  4DX7 A;  1RCO B;  2DEJ A;  3I6P A;  5D8H B;  4ES2 A;  2VA3 A;  3BSA A;  4KT0 C;  4A8M P;  3GCX P;  3D3B J;  3SI8 A;  1T95 A;  2F7V A;  2RKI B;  2XY5 A;  2WON A;  4PUO B;  1U6Z A;  2MJU A;  4PG6 A;  3AD8 C;  4K4S A;  1ZM4 A;  1S59 A;  2MXY A;  4DR7 F;  4ERD A;  2B51 A;  2BKO A;  4PWD A;  1LWX A;  3NGT A;  1CC7 A;  4XIU A;  1WAC A;  4QPT A;  1X5T A;  1JXV A;  1YX2 A;  1RWX B;  4KGV B;  4HT5 A;  3P3D A;  1WF2 A;  4M5G A;  1D9A A;  1FNM A;  2V67 A;  3CWJ A;  1EP4 B;  4YY3 J;  1Y10 A;  1HWJ A;  1MW7 A;  1UAW A;  4O4R A;  2AEJ A;  2P6S A;  1OJ4 A;  1DZ5 A;  3CUL A;  4YS2 A;  3W5X A;  2EKY A;  2WVC A;  1CJK B;  2DH7 A;  2RML A;  2ZBP A;  1VQY A;  3WZ0 A;  1CPZ A;  2XG8 A;  5D4P A;  2NXJ A;  3KLI B;  1X9M A;  2CPX A;  5HK4 A;  3LQV A;  3TX8 A;  3WDO A;  4E98 A;  2VKZ G;  2JLF A;  3NL0 A;  1N36 F;  4ZPA A;  2F9J A;  5C24 A;  3FGV A;  2V8D A;  4LRC A;  4R8U A;  5J1E A;  3CCL S;  3HZG A;  4IFY B;  2K1R A;  3W65 A;  2CPY A;  4OMF G;  4TLR A;  3THP A;  5ETS A;  3LP0 A;  4H4K A;  3NBP A;  3OFF A;  2IA0 A;  3HHD A;  1R6Y A;  1P1L A;  2DGU A;  4AUK A;  3BR8 A;  4WU2 A;  1PYT A;  2QTW A;  1RT3 B;  1XN9 A;  5HVF A;  2W7A A;  4HYK A;  2ZH2 A;  5ETL A;  1QVF R;  1X4A A;  5I3Q A;  4WJB A;  2ZBQ A;  1PBU A;  3CIZ A;  3W60 A;  3UD3 P;  4K4Z A;  2RUG A;  2Y9H A;  4I2P B;  3H42 A;  2J0S D;  4AD6 A;  3NNH A;  2GIR A;  1KQS R;  3MMB B;  4ZK7 M;  1JK9 B;  2VBY A;  3H25 A;  4OZ3 A;  4ID5 B;  2DJW A;  2UUC F;  3MM7 A;  5E3A A;  1DTQ B;  3MMC A;  3IR6 B;  5K8P A;  3TVY A;  3W2W A;  4X4R A;  1RTI A;  2BOP A;  3ICL A;  1VK8 A;  1RAH B;  2CQ2 A;  2EVZ A;  3MUT P;  5L39 A;  5E3R A;  2OO4 A;  4WFX A;  4F0H A;  5I3U A;  3RBE A;  2ILY A;  2VOD A;  2WRM A;  3DXS X;  2PMZ D;  2F8E X;  3ZNJ 1;  2JHE A;  3EPI A;  4QJV A;  3TNV A;  3ITH A;  1NND A;  3FQL A;  3R7S B;  5HP1 B;  3DRP B;  1HHQ A;  1MML A;  3MD3 A;  3SEO A;  2IAJ A;  5M2R A;  2JEI A;  3HSD A;  2ZH4 A;  3ELH A;  3QZ8 A;  2MZS A;  4ZOS A;  4G3I A;  1RHR B;  2W7P A;  4KRW A;  4WFA Q;  2VD3 A;  4JP8 A;  2RH3 A;  4LF9 J;  4LF6 J;  2Z2Z A;  3MUV P;  4HHH A;  2IDE A;  4J9N A;  3I0R B;  1DHM A;  3DMJ A;  2AYE A;  3TAM B;  1S6O A;  3GJT B;  1LW2 A;  2H48 B;  4I56 A;  4R0J A;  3AD9 C;  3IGN A;  3QWP A;  2MY7 A;  3PIO Q;  2GVZ B;  2ROE A;  3AH6 A;  1M5V C;  4B3S J;  4F26 A;  2KG1 A;  2HFN A;  1N34 J;  3NRB A;  4RW7 A;  1HBO B;  1RAF B;  3POT B;  4K8R A;  2RSQ A;  2WTF A;  3RR8 A;  1RP5 A;  3EIC A;  1HFE L;  2LQJ A;  5L9X A;  4DR5 F;  2FGO A;  2YKM B;  1YJT A;  3CCS S;  5RUB A;  3N28 A;  4W4M A;  4WTY A;  4PEO A;  5AXM A;  2A2D A;  2BM1 A;  1S99 A;  2V8P A;  2PFF B;  1PC4 A;  1TEL A;  2JVR A;  2JEG A;  1WKK A;  5GME A;  2FDN A;  3M8Q B;  3D0H E;  4EBC A;  2QT7 A;  3VAM A;  2BKP A;  2YWH A;  2AJQ A;  3Q8Y A;  2O1P A;  2PI5 A;  3T9N A;  4FBT A;  1N6Q A;  1AFI A;  1S1W A;  2F65 A;  2DPI A;  5CZV A;  5E3Q A;  1MWQ A;  2YKN B;  3MOJ B;  4KQZ A;  1W2B R;  4IKA A;  4DU7 A;  1BD6 A;  4USW A;  3HVA A;  1TL5 A;  1YJ7 A;  5L9N A;  1LWE B;  4KH0 B;  3C15 B;  1NPP A;  1V5I B;  2WZ1 A;  3EXY A;  2R7X A;  4YB5 A;  2RS8 A;  1R8B A;  2YNI B;  2FZG B;  1RAA B;  4WYW A;  4NLD A;  2O3D A;  1S57 A;  1YQH A;  3UPF A;  1Z2Z A;  1EZZ B;  2DO4 A;  4PCQ A;  2VV5 A;  2LMI A;  2H51 B;  1L3U A;  3EZO A;  5F0U A;  4PKD B;  1NKB A;  2DGX A;  1O8B A;  2H9Z A;  2F9D A;  3TVZ A;  2EC0 A;  2Y1J A;  4M5M A;  1YJV A;  4DN9 A;  2ZH6 A;  2UV8 G;  1DY3 A;  1F2G A;  2GQQ A;  3W8G A;  3J80 Y;  2J0W A;  2B4V A;  2HLT A;  1OY8 A;  4CNZ A;  1U2R A;  2BW7 A;  4BDP A;  1SV5 B;  3ADA C;  3W63 A;  1N33 F;  1NH8 A;  2GCF A;  4JV2 A;  1TMJ A;  5E7O B;  2BUN A;  2DRD A;  1RB0 A;  1RA6 A;  2P8I A;  2K06 A;  1RT3 A;  4RU9 A;  1JLC B;  4F7V A;  1R31 A;  2F1F A;  1QJH A;  4A48 A;  5A0Y A;  2AZ3 A;  3PX4 A;  3B6B A;  1IXK A;  2R7W A;  1UA0 A;  2M8D B;  2XMJ A;  3OTO F;  3HM9 A;  1SC3 B;  2RRB A;  2R7S A;  1CVJ A;  1JJC B;  5KFD A;  3PW7 A;  3TR5 A;  3M6V A;  2KXN B;  2B4U A;  1TR0 A;  4I2P A;  1X4D A;  3MEC B;  4J9V A;  2O67 A;  1LFW A;  4IYQ A;  2UUC J;  2E5J A;  1XNQ J;  4QW8 A;  1TK0 A;  1FDA A;  1KVK A;  1F9F A;  4ID5 A;  2MZR A;  3CCE S;  2YNH A;  2J7K A;  3FBE A;  1VOM A;  1K1S A;  3KJN B;  4X4Q A;  4ZVT B;  5CAA A;  1YBU A;  2BAN B;  4UZB A;  2GIF A;  2LA6 A;  5KT3 A;  2DNO A;  4NLP A;  1L3S A;  4QWA A;  4DV7 F;  9RUB A;  2F5G A;  4M5I A;  4RWW A;  1UFK A;  1RAE B;  4GVB A;  1M5K C;  1NDP A;  4PYD A;  2RDJ A;  2LQ5 A;  1H74 A;  3LUY A;  5G0R B;  2RJZ A;  4H4K C;  4J90 A;  1SJQ A;  4WU3 A;  2HSE B;  4P71 A;  4DUZ F;  5B0G A;  1U1M A;  5HP1 A;  4ZP7 A;  2VBW A;  4A47 A;  3CCR S;  3QWU A;  1SKS A;  1CC8 A;  1VC5 A;  1Z1Z A;  2HHH J;  2EG2 A;  3PJ9 A;  4LR8 A;  1NHU A;  4IH5 A;  3NP5 A;  1HD1 A;  2WSE C;  3W5Y A;  2FZC B;  4LQ3 A;  4YB7 A;  4NYZ A;  2MZJ A;  3LPY A;  4KV8 B;  4R5P B;  2OP5 A;  1DAX A;  3TA1 A;  4OJH A;  3E01 A;  3ZTR A;  1VQ7 S;  4WE1 A;  1X0F A;  3HJV A;  6FDR A;  2VOO A;  4IR1 A;  1RT7 A;  2KVQ E;  1D0E A;  4PXC A;  3ULH A;  1OPZ A;  3TAM A;  4QYZ K;  3CSK A;  1JLF B;  4YB1 P;  2JZ5 A;  4RL1 A;  3RTV A;  2ZBR A;  2GVZ A;  3R3T A;  3KG4 A;  2PFD A;  4XPE A;  2K7K A;  1HBO A;  3K8V A;  2AF6 A;  4JI4 F;  3I0S B;  1OY6 A;  2C3M A;  2ZH3 A;  3U1M A;  4DR5 J;  1FVS A;  2VFS A;  1S9E A;  3CDW A;  4OZN A;  2WCX A;  1EHW A;  2ZDO A;  1M90 T;  5F8L A;  2LCW A;  4ICL B;  4MAK A;  1KVI A;  2QSW A;  1G4C A;  4Q44 A;  4NRT A;  2DY9 A;  4TYB A;  1H2T Z;  2B5J B;  1HQE A;  1UPM B;  4AQY F;  3DU6 A;  3R5A A;  1HKA A;  4ZCL A;  2QMW A;  1BHN A;  2C28 A;  5FD1 A;  3KDO A;  1XBW A;  3RYL A;  3KK1 A;  3T6B A;  3NMR A;  5IV4 A;  2J8A A;  1M0S A;  2DGT A;  1LK7 A;  4WYL A;  3WIU A;  1MLA A;  1MMN A;  4CNY A;  4IH7 A;  2YKN A;  1BY9 A;  3CJT A;  1RKJ A;  2DGO A;  3NXZ A;  3VTI A;  2HRU A;  2KT3 A;  3DLH A;  2W24 A;  5DLF A;  2IVY A;  1LWE A;  4DCO B;  4NLU A;  4KHP F;  3C15 A;  4QWD A;  1F1B B;  3PRV A;  1GXT A;  1NEE A;  4EWT A;  2MGZ B;  2FC9 A;  1T03 B;  1Y3K A;  3BKU A;  2ZEJ A;  5KFJ A;  1NLK L;  1ZPV A;  4X84 A;  3FMW A;  2PC6 A;  4C8N A;  3FZ2 A;  1WG1 A;  2X51 A;  3BO2 A;  1LWF B;  1T9W A;  4CRJ A;  5L8R C;  4DG1 A;  1A0O B;  4OI1 A;  4PG5 A;  4IRC A;  1JLQ A;  4I0W A;  3Q23 A;  2D74 B;  2UVU A;  3MR6 A;  4CIO A;  1RAI B;  3SCL E;  4DSL A;  2FHJ A;  2IPO B;  5LXR A;  5K20 B;  3UN3 A;  4B9M A;  1VLY A;  1XNR F;  2FJB B;  3K59 A;  4WZQ A;  4MK8 A;  1TKX B;  5H9E J;  4ITS A;  1SV5 A;  1BQN B;  3GB0 A;  4O3Q A;  2VIH A;  1KQG B;  1RHK B;  3MCM A;  2VJU A;  3MED B;  5I42 B;  2B7C B;  2EFN A;  1RT5 B;  1JLC A;  2OML A;  3OTO J;  2VJV A;  2J8S A;  2B3T B;  2E7X A;  3I87 A;  2AJ1 A;  1ZS6 A;  1YBT A;  1Q8B A;  3DC2 A;  3BH7 B;  1UVN A;  1KR4 A;  1NK5 A;  2XO7 A;  2QLW A;  1QLN A;  1IR0 A;  3J81 j;  1HHT P;  4C8L A;  3M8R A;  3MEC A;  1H6K X;  1VMB A;  2C3U A;  1YGY A;  2E7V A;  3NEK A;  3DRS A;  3JQJ A;  1XQI A;  5A76 A;  3PXG a;  1DRZ A;  4JI6 J;  1DQ8 A;  2E44 A;  1FNX H;  5ETK A;  4NZ6 A;  2WB1 D;  4ZN3 A;  4MT1 A;  5CD4 H;  2CQ4 A;  4KY3 A;  4OJG A;  5L1J A;  1U24 A;  2BAN A;  2HWT A;  3CCU S;  4RW6 B;  2W8L A;  4FP9 A;  3GII A;  2KT2 A;  3MI7 X;  1U0S A;  3I56 S;  4C0H A;  5F8H A;  4ZCI A;  3CDA A;  3HVT A;  1VJW A;  2DHH A;  2N82 B;  2WK4 A;  1Y5L B;  5G0R A;  4X65 F;  4M1K A;  4C3L A;  5C2G A;  3DHX A;  4CLT A;  2UUB F;  3T19 A;  4PRF A;  5D3G B;  3Q2T C;  5IQQ A;  5BXI A;  3RB4 A;  4ZMM A;  1MN9 A;  2KB2 A;  3IS9 B;  3FUY A;  3HMJ G;  4EYI B;  5ETO A;  4O0I A;  2IJN A;  4N47 A;  1VIX A;  1APS A;  1FI4 A;  2RAQ A;  2Y8Y A;  2MZT A;  2BW2 A;  3X3U A;  2XHW A;  4I6Y A;  2JNJ A;  3KTQ A;  4WZM A;  2BRL A;  1HBN B;  4LT6 A;  5HMY A;  4KV8 A;  4ED1 A;  3BQ1 A;  2VPZ B;  3EGZ A;  2BJ7 A;  1S6Q B;  1UVM A;  4PYA A;  1KFD A;  3CC7 S;  5LSL A;  2L9W A;  1JLF A;  2R8H A;  3CGI A;  5F8M A;  2MDA A;  1RTH A;  4QU7 A;  2OGU A;  3S01 A;  4DZ6 A;  1RT6 A;  1PBA A;  1HPZ B;  3FCH A;  2N7C A;  3DYA A;  2IMW P;  1NDK A;  4NLT A;  1UP1 A;  1C0U B;  4OLO A;  4NL5 A;  5DRK A;  4ELU A;  4CH0 S;  2HS4 A;  4DLG A;  1FTR A;  1RTJ B;  2RE1 A;  4JB8 B;  4AQY J;  4ED5 A;  3BYR A;  2HUR A;  1VHF A;  3N9U C;  2QA1 A;  4Y2A A;  3D1Q A;  2BBE A;  1CJT A;  2QFJ A;  1KQF B;  2IY5 B;  2E7W A;  3I31 A;  4O44 A;  3VWS A;  2GMJ A;  4YR3 A;  1RK8 A;  4C6A A;  7FDR A;  4USJ C;  2UXC F;  3OHA A;  2RS2 A;  2RHQ B;  3T5L A;  3V6D B;  5A8W B;  2WOM A;  2E9Z A;  5CYM A;  5IT9 U;  4JI1 F;  5B0A A;  4NCB A;  2DTJ A;  2HND A;  3LAN A;  3FFI A;  4DFJ A;  4KHP J;  5CH7 B;  3H4D A;  3E51 A;  1YG0 A;  3HHL D;  1HNV A;  1UKU A;  3CDE A;  3V81 B;  2VL1 A;  4MFB A;  3US5 A;  4HI1 A;  2CZ9 A;  2MGZ A;  5AE3 A;  2OPQ B;  2WSC C;  1KOH A;  1RAD B;  1DFD A;  3OJU A;  4DL7 A;  1TL1 B;  2IYG A;  2QL5 B;  5D0G A;  3JTP A;  5EWF A;  3G87 A;  1ELO A;  3B54 A;  1SH3 A;  2Z2M A;  4TU9 A;  3BPD A;  1XNR J;  3CD6 S;  1IR2 A;  4AL7 A;  5EHH A;  3G71 S;  1TV6 A;  4YHH J;  1RBL A;  5D6G A;  4PXE A;  3NCP A;  2GJF A;  7FD1 A;  2HIY A;  2HBZ B;  1TKX A;  3A12 A;  4NLV A;  3BB5 A;  1BQN A;  4NZ0 A;  5D78 A;  1Y00 A;  5HBM B;  3EM1 A;  4Y28 C;  5HMX A;  4C0B A;  3FRZ A;  5KFT A;  4MYT A;  4BC9 A;  2EFV A;  1RT5 A;  3THV A;  3Q89 A;  2YQ1 A;  3GPA A;  3JSM B;  3ZZ0 A;  1HBM A;  4UQT A;  5T14 A;  1X9W A;  1FA0 A;  2V9K A;  1UWB B;  3DLK B;  1ZAX A;  2J5A A;  3PYE A;  1FT8 A;  1XEZ A;  3PAC A;  4MH8 A;  3FDS A;  4QZV B;  5CQG A;  4ZPC A;  1ZBT A;  4D3G A;  2EBG A;  1ARO P;  1YRT A;  4ECZ A;  1O5J A;  4ECR A;  5DQG A;  2OMO A;  3FSI A;  2HVE A;  1GEH A;  2HBQ B;  1NJW A;  3T1Y F;  2MQQ A;  2KM8 C;  4X2B A;  1S1U B;  5F9N A;  1YIT S;  1P1T A;  2FIU A;  2CWX A;  4JI3 J;  1WEY A;  4FNI A;  3OHB A;  3F44 A;  3ZTP A;  1QSS A;  4F02 A;  2OH2 A;  1R0C B;  4X65 J;  2FJW A;  2UUB J;  1R0A B;  1EAR A;  1N88 A;  2YBV A;  1BE4 A;  3Q8U A;  2DNL A;  2DH9 A;  5D3G A;  3M4X A;  1EJ7 L;  4F4A A;  4IR9 A;  1REV A;  2YPY A;  1FWL A;  4RW4 B;  4Q43 A;  1UVJ A;  3I5C A;  5L46 A;  8RUC A;  1GFW B;  1U7L A;  4CYU B;  4G1Q B;  3LGN A;  5ETQ A;  3IR7 B;  4ILM A;  4L73 A;  2BV3 A;  3PNI A;  4CLZ A;  1YJ9 S;  2IBK A;  1U1P A;  2GQ2 A;  5HQ8 A;  4C8Z A;  1FRK A;  4KFB A;  1U1R A;  2HQF A;  3TAN A;  4W98 A;  3PW2 A;  1N5Y B;  3DCA A;  2IVM A;  4DSF A;  4BLG A;  2LVW A;  3EDR B;  2XSF A;  1U1L A;  2BAC A;  2CDQ A;  3EPG A;  2FTR A;  4YB6 A;  5E33 A;  1FRL A;  2ZVI A;  2NZC A;  2MQO A;  2HHP A;  4P75 A;  2V6A A;  2VZ9 A;  2KFY A;  2OTL S;  2XCP A;  3TX0 A;  5DDO C;  1P9Q C;  3MHY A;  1RHM B;  4DV5 F;  1HPZ A;  3SFU A;  4TU7 A;  5HJY A;  3SFG A;  2V4J B;  2CVI A;  2UZA A;  2XWY A;  3VAI A;  3SSR A;  2DHS A;  4X4S A;  2CYY A;  1M5S A;  5KAK A;  2VIC A;  1F9E B;  1HD0 A;  2H65 B;  3RB3 A;  3MR2 A;  3SV3 A;  1RDR A;  1RTJ A;  2Y1R I;  4OI4 A;  2DIT A;  1NKE A;  4ENO A;  2ZWO A;  5J2Q A;  3RRK A;  1SKU B;  4B3M F;  2Q43 A;  2V94 A;  5DDP C;  1M1G A;  2KO1 A;  1WEL A;  2ROG A;  5GAG U;  3PYF A;  4FYV B;  2GVD A;  2UXC J;  2CJ9 A;  1T05 B;  1OPI A;  2HZA A;  3TW0 A;  1JWW A;  2B6A B;  4JI1 J;  3V6D A;  2CNN B;  2Z56 B;  4O3N A;  1Y11 A;  2H54 B;  5DG7 A;  1RQ0 A;  3DRR B;  3H4B A;  2MMY A;  3NNC A;  3QFH A;  1WKJ A;  4UT4 A;  1EET A;  1TKT B;  4USV A;  3GV7 B;  3MR7 A;  1P8G A;  3ISN C;  3D4J A;  4B08 A;  1ZAW A;  3T5K A;  4NA2 A;  4ZHR A;  3VGU A;  2GFF A;  2B9W A;  2H5I B;  2VG7 B;  4LSL B;  5HQL A;  4O23 A;  2C42 A;  1UL3 A;  1I6J A;  1TL1 A;  2FQQ B;  4ZJL A;  4J9P A;  2X7I A;  3QLH B;  1S12 A;  1U49 A;  4LF7 F;  4NML A;  4K4W A;  1HI8 A;  3TQE A;  1MRO B;  3UDE A;  2IRX A;  5IFM A;  4ZCK A;  2PA8 D;  3MWB A;  2IDL A;  2XYH B;  3TJ9 A;  4M8L A;  5HLF B;  1YHQ S;  2I5J B;  4LR9 A;  2QE5 A;  3QZ7 A;  3CO9 A;  1U25 A;  3OTE A;  3D1H A;  3ZZT A;  2POK A;  1RIS A;  1Y0H A;  3JS9 A;  4I68 A;  2DR7 A;  2ZJR Q;  3IAM 9;  5KT6 A;  1JKH B;  4OLP A;  1RHJ B;  4C48 A;  3PO5 A;  2IM1 A;  2PD1 A;  3QFW A;  3C6U A;  3DLK A;  1BQM B;  1FVQ A;  5EDW A;  1N56 A;  1NK9 A;  3RBD A;  2ZHB A;  1AXQ A;  1UEK A;  1UVL A;  1I51 B;  4DV1 F;  1TVR B;  3JSY A;  2VON A;  2G1D A;  3AOC A;  3ONQ A;  1SL2 A;  3T1Y J;  1UVI A;  4AL5 A;  2IJF A;  2QX0 A;  2CJA A;  4A4J A;  2HBR B;  4FS2 A;  1IQT A;  3AFG A;  1S1U A;  3G6V A;  5KT7 A;  2YQ0 A;  3QAT A;  1KHV A;  1N8R T;  1N54 B;  4CQ1 A;  2LU2 A;  4DZD A;  3UD4 P;  2ZUA A;  1ULR A;  2HBY B;  3CDU A;  4FF2 A;  5IC4 B;  5H9E K;  4B3T F;  4USM A;  3OT9 A;  3ZZU A;  3FJ2 A;  1NJY A;  3H59 A;  2HHV A;  4RUC A;  1C1C A;  4LFA J;  2QZ8 A;  2DGQ A;  1VI7 A;  3NS6 A;  1NAQ A;  1H0H B;  5BYQ A;  2E5H A;  1NM2 A;  3FKB A;  1BQX A;  4IDK A;  1T9X A;  2WVD A;  1DAR A;  2DIS A;  3M05 A;  1NZ8 A;  5KG0 A;  4R25 A;  2OI2 A;  2R2U A;  2VHG A;  2EFQ A;  4Q0B A;  2I6W A;  2B9X A;  3BDP A;  2V8H A;  3GFX A;  2IFX A;  3IG1 B;  1PYO B;  1Q78 A;  3HFV A;  4LSN A;  2CKW A;  2VBX A;  2XMU A;  4KH1 B;  4Y00 A;  4LIW A;  5HL7 Q;  3IRX A;  4F36 A;  4IFV A;  3KLG B;  4ZVH A;  4DUT A;  4ECT A;  3M1V A;  4QIG A;  3PVX A;  4F4Y A;  2CJX B;  1S1X B;  3J80 U;  1SJ4 P;  2HS0 A;  1YJU A;  4ZLJ A;  4ZJO A;  4DV5 J;  1Y5N B;  3ZNU A;  3W8P A;  3FCW A;  4OYM A;  2L9D A;  2F40 A;  2BZ2 A;  2OPS B;  1WHV A;  4DV0 J;  5IT0 A;  2OD6 A;  1V5V A;  4OZ1 A;  2HFU A;  2CPF A;  1D8Y A;  3AHP A;  2XSJ A;  4EYH B;  4F2S A;  2V2K A;  1BLU A;  1VFJ A;  1MWZ A;  5CCL A;  1VGY A;  3BN7 A;  3D54 A;  2VG5 B;  1JLB A;  3SBM A;  5HO4 A;  2YY3 A;  1SQG A;  2CPJ A;  4B3M J;  4Y34 A;  4NA1 A;  4U96 A;  5F8G A;  2BJE A;  2J6U A;  3PDN A;  1U8W A;  1G1X A;  3PFO A;  3CMQ A;  3K5P A;  2AJ4 A;  1X8D A;  1IKW B;  1KTQ A;  3DI6 B;  4ZA1 A;  4TY9 A;  2GMH A;  2X3G A;  3BSO A;  4ZPB A;  1PJ7 A;  1J27 A;  3H5S A;  4JYA J;  2F8M A;  2DGS A;  2CJB A;  2ZZN A;  1U2C A;  1T9T A;  1LEO A;  3ET6 A;  3C14 B;  3KLE A;  4ZJQ A;  4OZ5 A;  3BSC A;  2KH9 A;  1Q53 A;  2KTQ A;  6AT1 B;  3DRR A;  3EVO A;  3SYZ A;  2ROP A;  2FVP A;  4UOF A;  5E5N A;  1HAR A;  4O3P A;  3JQK A;  3TAP A;  1TKT A;  4RUB A;  3D0G E;  3WHI A;  3BGO P;  2GQC A;  1EQ0 A;  2J0Q D;  2MQP A;  3BH6 B;  4M63 A;  2VG7 A;  4LSL A;  4LFC J;  2V2Z A;  5DDR C;  1F5B A;  3ZZR A;  4TYA A;  3A8I A;  3IP0 A;  4LF7 J;  1PJ6 A;  3M9N B;  1S0V A;  2WB4 A;  3QLH A;  2LQ9 A;  1U0H B;  2JOQ A;  1FFS B;  3C6T A;  2CPD A;  3AXM A;  3EE3 A;  4YDX A;  2HGL A;  2KFN A;  2C2Z B;  2OEL A;  2KRB A;  5D4N A;  2WVF A;  1RTD B;  3JTN A;  2GW8 A;  1UTA A;  5KOW A;  4JOU A;  1H7X A;  4KKO A;  4IG3 B;  2G1H A;  3S6E A;  2I5J A;  3GG0 A;  1SI9 A;  4DFP A;  3A13 A;  1RI7 A;  1RT2 A;  2KG0 A;  3NGD A;  1RXO B;  2M3D A;  1AFJ A;  2C2M B;  3MM6 A;  7AT1 B;  3UDL A;  2ABY A;  1JKH A;  2EFG A;  3EGW B;  3D6T B;  2AX0 A;  4QBU A;  4CP5 A;  2KDO A;  1IWG A;  5T7L B;  1RU2 A;  1UFL A;  2JRS A;  3M30 B;  5ETN A;  1S6P B;  2ZD1 A;  4DV1 J;  2XLJ A;  4U7U K;  2UV8 A;  2ZJP Q;  3KFW X;  2UXB F;  1TVR A;  3CJ3 A;  4MK9 A;  3K0J A;  2CRL A;  5E3P A;  5I4M A;  3VGV A;  3PKY A;  2AGQ A;  5ITH A;  1PCA A;  1RWU A;  4PQU B;  1K0T A;  3DLL Q;  3D7S B;  2B9E A;  2PII A;  5GAH I;  2NXC A;  4LF1 A;  1FKP A;  3PZP A;  4B3T J;  1WHY A;  3W7B A;  1TK8 A;  4NXM J;  1PGZ A;  2A6M A;  1UET A;  4K5R A;  1NK7 A;  3I82 A;  4ZPW R;  2LKZ A;  3JXO A;  4K2X A;  3R8Y A;  1GTH A;  2BQR A;  1FJ7 A;  1VBZ A;  4C3K A;  2J9D A;  2GZO A;  4DWI A;  3J7Z 5;  2N3L A;  3HFZ B;  3VR1 A;  3A4T A;  3MTK A;  4EU0 A;  1P27 B;  2XGP A;  1LW0 B;  2XMM A;  4EZ9 A;  3OXL A;  1PG5 B;  3G86 A;  1CLF A;  3IGV A;  4J37 A;  2CQP A;  1X7V A;  3WIV A;  2VDI A;  2BKN A;  2NRE A;  2W9C B;  3GYG A;  3GFZ A;  4NE9 C;  1G2E A;  4N8O A;  3MM5 A;  4NEY A;  3N6N A;  3OQ2 A;  2HZV A;  4A8O A;  3NS5 A;  2R8I A;  5DO2 A;  1S49 A;  4TLQ A;  3RUB L;  4TNO A;  3UO0 A;  4C8Y A;  1E6Y B;  1QAX A;  2VFR A;  2OPS A;  3JQM A;  1A7G E;  2C2N A;  3IBW A;  3RJM B;  2A3J A;  4HVZ A;  3MEG B;  2ATC B;  1VBY A;  3J81 U;  2W2O P;  2ZH8 A;  4WKR A;  3G2X A;  1QUP A;  2CPZ A;  2E1R A;  3UDC A;  3Q8S B;  2Q66 A;  4OIX A;  2XLI A;  1N0V C;  2YH1 A;  4F4X A;  4WK3 A;  4DBQ A;  2VBZ A;  3BJY A;  1PIL A;  4KGX B;  4CT8 A;  3H2L A;  3OXF A;  5HMW A;  2PEB A;  1VQ9 S;  4RW9 A;  1RUS A;  5D77 A;  4RO0 A;  2Z4P A;  3DI6 A;  2BXJ A;  4NYO A;  2MB0 B;  5DG8 A;  2Y8W A;  2GAG C;  2LEA A;  1AZS B;  1RLD A;  3M7V A;  1SBR A;  2PMH A;  2VOP A;  5DM6 Q;  3L4B C;  1KLM B;  1S10 A;  3C14 A;  2W1B A;  1FK9 B;  4DPW A;  2EXU A;  2HK2 A;  3FK4 A;  4ECX A;  1RYR A;  1VQO S;  4BBY A;  3MMJ A;  4OI0 A;  2HVI A;  4J9K A;  3MR5 A;  4NA3 A;  4FF1 A;  2BRK A;  3F0N A;  3LP2 B;  3QO9 B;  2HHT A;  3MMA B;  3EWG A;  5KFK A;  4DUY F;  4LFB F;  2GX8 A;  4P2X A;  3LGM A;  4F04 B;  3TJ8 A;  4V19 X;  1ZYQ A;  1ZOT A;  1FX2 A;  2Z30 B;  1U45 A;  4M5L A;  4KR0 B;  4PAB A;  3QQC D;  4I7F B;  2MKC A;  4CH1 A;  1U0H A;  1UJ5 A;  3CDB A;  3PIP Q;  2KJW A;  3QJL A;  1XMB A;  5AJ3 F;  1RTD A;  3ISZ A;  3EVM A;  1ICE B;  4FKX A;  4IG3 A;  4TU8 A;  4CT9 A;  4IQM A;  3R6L B;  4O4G B;  3D5M A;  1J5E F;  4TY8 B;  1D3W A;  1EKS A;  2W9B B;  3R5B A;  3QAU A;  3OV7 A;  1XR7 A;  3ENW A;  4JI8 F;  4MK7 A;  5K14 A;  1FDD A;  2M8H A;  2GGP B;  1TFY A;  5T7L A;  2JJ4 D;  2AT1 B;  3ETO A;  3M30 A;  3HD2 A;  2ILZ A;  1OYE A;  1S6P A;  5B0F A;  2OEK A;  2UXB J;  1X9S A;  3QBC A;  5A8R B;  2MQN A;  2XGQ A;  3C16 B;  3D67 A;  3RZA A;  4RR5 A;  3MPY A;  1HYS A;  2OSQ A;  4R0E A;  2EFO A;  4DL4 A;  3DN9 A;  4C3M A;  3RU0 A;  3IAS 9;  1FCA A;  1N5S A;  4YUD A;  1CQN A;  1DUR A;  2H5E A;  2B8Q A;  1T7P A;  3S7R A;  1WHX A;  1H38 A;  4P9S A;  5IC6 B;  5C7P A;  3EZU A;  2CZV C;  1QAJ A;  4DR2 F;  4EK2 A;  3VAG A;  3H7H B;  1Q7Y T;  2APO A;  2EI5 A;  4ELT A;  4QPX A;  3VZI A;  3UCZ P;  3IBF B;  2AEM A;  4UZC A;  1SJ3 P;  3T3F A;  4ZP6 A;  4DCJ B;  2ZE2 B;  3KNA A;  3M6W A;  3TA2 A;  1QD1 A;  2YKP A;  5JUM A;  3OW2 R;  1D9F A;  2WHO A;  1FRM A;  3UVJ B;  4Q5V A;  4K4X A;  1FJG J;  4DR6 F;  1SB6 A;  5IM0 B;  4OYX A;  2YKO A;  1L3V A;  3H98 A;  4WKY A;  2MZ1 A;  2CNO B;  3HHN B;  2GHP A;  2ZWP A;  4FYW B;  1IM4 A;  3FCV A;  1FO1 A;  4ER8 A;  2CQB A;  4DX6 A;  1X4H A;  1B0V A;  3GU0 A;  3LP1 B;  1C0T A;  2J7U A;  5IT9 Y;  5FDL B;  1WF1 A;  3R2C J;  1KS2 A;  2DXE A;  3EJM A;  2MZQ A;  3RG6 A;  2YXL A;  4NOH A;  2FB0 A;  2AJF E;  3BPS P;  2W2N P;  4LF4 J;  1IBK F;  3NGR A;  1GX6 A;  3TZY A;  1HQ2 A;  1E6Y A;  2ZIT A;  3V6K A;  2FHO B;  3M2U B;  1UW9 A;  4DF4 A;  3VF0 B;  5KFV A;  3QGI A;  4WFZ A;  4Y2K A;  2E1P A;  2ASJ A;  2RRA A;  1FE4 A;  3MEG A;  1VS3 A;  3G82 B;  2NLW A;  1SJ1 A;  2AEF A;  1RGV A;  2H4Y B;  5HI7 A;  2FJX A;  4QR2 A;  4UTG A;  3O2I A;  4C11 B;  4DPT A;  5KG2 A;  4F3Q A;  2C1E B;  1U6F A;  1GH8 A;  1BGX T;  1YDL A;  3MPW A;  1ZH5 A;  3AB4 B;  2HQG A;  1V6H A;  1YRU A;  1YIJ S;  5GMK a;  4ED8 A;  4ANE A;  4ECW A;  2RU9 A;  2R7V A;  2QC3 A;  5LM7 E;  2YNF A;  1FK9 A;  1JLE B;  3M6X A;  4MIW A;  1S9G B;  3FBF A;  4ED6 A;  1DJ0 A;  4GRS A;  4OX7 A;  2RF2 A;  4RWX A;  1RZM A;  5C42 B;  4LFB J;  5HVG A;  1HNZ F;  2NQP A;  2HRY A;  3MMA A;  1TFW A;  2YNG B;  2Q1L A;  2ZDP A;  1U8S A;  1P9Y A;  1Q16 B;  3Q0A A;  1ZA2 B;  3HPO A;  2KHD A;  2V50 A;  4IH6 A;  4OYW A;  4HTI A;  3PW4 A;  1LFP A;  4OZL A;  3N01 A;  2I1R A;  3CJ5 A;  4LRF A;  4LF8 F;  4B3R J;  4OHW A;  1VYA A;  3GIM A;  4A8K A;  1PIE A;  4ATN A;  5IT4 A;  1Q1K A;  3TAR A;  5AJ3 J;  3GJQ B;  2DRA A;  1SJF A;  4ETZ A;  1VRT B;  4PPZ A;  2R8G A;  3FC9 A;  3VCD A;  1WEZ A;  4M95 A;  2QSF A;  2J9C A;  3V4I B;  2LP4 A;  2ZZM A;  3UI3 A;  4EBE A;  1S1V B;  3U7J A;  1CJV B;  2P5V A;  3IN5 A;  1J5E J;  1LV5 A;  3GE9 A;  1Q8K A;  5H9F J;  3HKW A;  1B0P A;  4O4G A;  2X1F A;  2BMB A;  2V8V A;  2LA4 A;  2J7W A;  4TY8 A;  1TZ0 A;  3HFK A;  5HRO B;  4IG0 B;  1X5S A;  3PYD A;  4U7U D;  4NZ7 A;  1C1B B;  3D6F B;  2AV5 A;  2M7S A;  4NEZ A;  4H54 A;  4QW9 A;  3BN4 A;  3TA0 A;  3W3S A;  1EKR A;  4PG7 A;  5EWE A;  3O44 A;  3Q2S C;  2DR9 A;  1H7W A;  4U95 A;  5KFS A;  5B7W A;  1A9N B;  2VFU A;  3C16 A;  3I4H X;  3I5B A;  1FD2 A;  2KU7 A;  4CLF A;  4CM0 A;  3KMQ A;  3HI9 A;  1VHI A;  3QRP A;  2U1A A;  3FRY A;  2OPR B;  1XR6 A;  2WAQ D;  5F0W A;  5ETT A;  4HR2 A;  4PPD A;  5JJB A;  3DFE A;  3D66 A;  4CZC A;  1F60 B;  1W26 A;  2Z0G A;  5U47 A;  4M5D B;  2FVS A;  3JSB A;  1RT4 B;  2DGW A;  4H4O B;  3W64 A;  2HYI B;  3R5J B;  4DSI A;  4MMO A;  1R3N A;  2DNG A;  4PG4 A;  3MM9 B;  2A6O A;  1HWU A;  1DQ9 A;  2HZC A;  2ZE2 A;  4NCG A;  3QRQ A;  4DR6 J;  4AYB D;  2GAH C;  2HFO A;  1SC6 A;  2EK1 A;  2DGV A;  4OHZ A;  3BGR B;  3DLG A;  1U1K A;  1QE1 A;  2FY8 A;  3N5F A;  5HQM A;  2UUW A;  1SL1 A;  1RBA A;  2ASL A;  4HT7 A;  1ZZN A;  1JLA A;  3CCQ S;  1B64 A;  1NRK A;  3GYN A;  2HAI A;  4ELV A;  4AE5 A;  4LF5 F;  4X4N A;  1NK4 A;  3PCO B;  4M5J A;  2B4O A;  4DV6 F;  4JI5 F;  3D28 A;  2RRN A;  4CLK A;  2JLG A;  3PHT A;  3LP1 A;  4OI6 A;  1HIY A;  4ED7 A;  2ZJQ Q;  4OYZ A;  1X4C A;  3GLJ A;  1W25 A;  5CYJ A;  2BX6 A;  3VQT A;  4NI2 B;  2AZ1 A;  1KVJ A;  1F3V A;  2HKE A;  4XDC A;  3PX0 A;  1IBK J;  2XMV A;  5MAO A;  3DLB A;  5GAD I;  2E5G A;  1MMD A;  4NRU A;  2A0F B;  4DMZ A;  2JFD A;  3G6Y A;  3PFE A;  1RWW B;  2ZZT A;  2V9W A;  1CS4 B;  2FGC A;  3LAK A;  2H5J B;  3NGU A;  4KC5 A;  2JC0 A;  5T41 A;  4N76 A;  3CJS A;  4X62 F;  3G82 A;  1VQK S;  1SH2 A;  3SQG B;  3BGU A;  2R7T A;  1GT8 A;  2KYZ A;  1IWA A;  1N5V A;  2MQM A;  3QPI A;  3GWC A;  1VJQ A;  1NKC A;  1JNZ B;  4ZDN A;  3LWL A;  1JJ4 A;  4CCH A;  1TL4 A;  4CO0 A;  4DL3 A;  2O01 C;  2XZT B;  3BQ2 A;  3PEJ A;  2MKJ A;  1U09 A;  5HSP A;  1BMQ B;  4ID8 A;  1J5O B;  3R6G B;  3TEH B;  2W25 A;  2KT5 A;  1O0P A;  2K7J A;  1DLO A;  4YR2 A;  4KHM A;  2RDI A;  4CLY A;  3NY0 A;  2CQG A;  1H72 C;  4RNM A;  4K5S A;  3UN5 A;  5C42 A;  1O6X A;  2R7U A;  1UZH A;  4IQX A;  1DTT B;  4TKT A;  2B56 A;  2XC9 A;  3PEH A;  1T3N A;  4OFZ A;  4N56 A;  1YZ6 A;  2IIH A;  3NAH A;  3KK2 B;  4LF8 J;  2X1A A;  1Y5I B;  2RKI A;  2HFS A;  4DR7 J;  4PUO A;  3GP9 A;  1YLX A;  3DRY A;  4H4M B;  5KFL A;  3K58 A;  4J9M A;  4RBT A;  4QU6 A;  5BR8 F;  2HQI A;  1KN6 A;  3OJS A;  4J9Q A;  2EPI A;  1T9V A;  4HL9 A;  1B4S A;  4QIF A;  3V4I A;  2HMI B;  2Y3Y A;  1FJE B;  1K1Q A;  1FRH A;  1VC0 A;  1EP4 A;  3OFE A;  2A10 A;  1AB8 A;  3FNN A;  4K7Q A;  5THW A;  3IXQ A;  3GV8 B;  1XER A;  4B3O B;  1HQU B;  3EGN A;  1FDN A;  2F63 A;  2MJN A;  4B9V A;  5HRO A;  3QYY A;  2BDP A;  1CJK A;  3CJQ A;  1F3F A;  2H3E B;  4KE5 A;  2HQC A;  1VQ6 S;  3KLV A;  1KP6 A;  2ASD A;  1Y9O A;  5CA5 A;  3KLI A;  1C4C A;  3UR3 C;  3L3C A;  2QLF B;  5IWA F;  1N36 J;  3CJK B;  1E6V B;  3B4D A;  1O51 A;  2VKR A;  1FEH A;  3M32 B;  3UDV A;  3ZTS A;  2ZC3 A;  3KHR A;  3P5B P;  1ZPW X;  4IFY A;  2UVV A;  4CDI A;  4DR3 F;  1IKV B;  1YBA A;  3T1H F;  2E1M C;  2OPR A;  4RNO A;  1X4G A;  4DQS A;  1IKX B;  2GV1 A;  5AE2 A;  4URG A;  1HWI A;  2L08 A;  2HS3 A;  4K4T A;  2CQ3 A;  4I67 A;  1GXL A;  5A6P A;  1PJ5 A;  1FDB A;  2XWX A;  4UY8 T;  4RUA A;  1SKR A;  1RT4 A;  4NCA A;  3DNC A;  4OL8 A;  4DPU A;  2GHW A;  1VRU B;  4FXD A;  2ADC A;  3KKF A;  3HX9 A;  3SCJ E;  4XPC A;  3NWG A;  1IN0 A;  2QEX S;  4XO0 A;  4OHV A;  4WWS A;  1UEU A;  3D68 A;  1S0O A;  1TK5 A;  2CJY B;  4U8Y A;  3RRH A;  1NXI A;  3MMB A;  3CJ0 A;  2G9O A;  2C22 A;  4LF5 J;  4DV6 J;  4FXV A;  3KLF B;  3U02 A;  1URN A;  2IC3 B;  1DTQ A;  1RBO B;  4MKV A;  3EVW A;  2R2S A;  1RU1 A;  2OD4 A;  1M1H A;  3GIK A;  2PMW A;  4BHQ A;  1X4F A;  3ZZP A;  3LGH A;  4NI2 A;  2J9E A;  4EUV A;  2CUY A;  2AQ4 A;  1XK8 A;  1R7I A;  3L09 A;  2QLJ B;  2C3O A;  2NUU G;  2ADB A;  2HHX A;  3V6J A;  2EK6 A;  3QGG A;  3DDN A;  2GHV C;  3DRP A;  2HIQ A;  4IOA Q;  1VBX A;  2ZH1 A;  1GMU A;  1TUV A;  3U1L A;  2FJV A;  4U6P A;  3OTD A;  3JAM U;  2G13 A;  3UN2 A;  5SUH A;  2BQU A;  3HD1 A;  4HEA 9;  5EN1 A;  5K8M A;  4A8X A;  3CCW A;  3SQG A;  3UFC X;  1WJ9 A;  2BJ9 A;  1OSC A;  1WC4 A;  2DNP A;  4CLS A;  3T5J A;  4ZPT R;  1VQP S;  2ACY A;  3EX7 B;  2DXD A;  1R8H A;  3Q8V A;  3W9H A;  3QSY B;  2QO3 A;  1FEE A;  3H2U B;  2V2V A;  3R7B B;  3TUJ C;  4JV5 F;  3CED A;  5B09 A;  4F0K A;  3ILI A;  2F3J A;  3H20 A;  3I0R A;  5HJX A;  1TAQ A;  5L1K A;  1J5O A; 
#chains in the Genus database with same CATH homology
 1F9E B;  2H5I B;  1RWN B;  3IBF B;  2QL7 B;  2Y0B B;  3D6F B;  3QNW B;  2H51 B;  5K20 B;  1QTN B;  3P45 B;  3IBC B;  4DCJ B;  2H65 B;  3R6L B;  3GJS B;  2XZT B;  2Y1L B;  2C2Z B;  3NS7 B;  3KJF B;  2C2O B;  2FQQ B;  1I51 B;  1GFW B;  1PYO B;  3KJN B;  1RHU B;  1RHK B;  4ZVR B;  1RHR B;  4ZVT B;  2QLJ B;  1BMQ B;  3R6G B;  2CNL B;  3P4U B;  2HBR B;  1PAU B;  4LSZ B;  1SC4 B;  2C2K B;  3RJM B;  2H4Y B;  1IBC B;  2QL5 B;  3D6H B;  2XYG B;  3EDQ B;  2CJX B;  2CNO B;  4DCO B;  4JB8 B;  2XZD B;  3GJQ B;  2C2M B;  1RWP B;  2C1E B;  2XYH B;  1RWK B;  3EDR B;  3GJT B;  4ZVU B;  2DKO B;  2H48 B;  2HBY B;  4ZVO B;  2HBQ B;  1RWM B;  2CNK B;  2CNN B;  2QL9 B;  5IC4 B;  4ZVP B;  1NME B;  1RHQ B;  2H54 B;  2CJY B;  4ZVS B;  1RWO B;  1RWW B;  4DCP B;  3R5J B;  3R7N B;  2H5J B;  1SC1 B;  1SC3 B;  3KJQ B;  2H4W B;  1RE1 B;  2HBZ B;  2QLF B;  1RWV B;  1QDU B;  3R7B B;  3SIP B;  5IC6 B;  1RHJ B;  2CDR B;  4ZVQ B;  1RHM B;  2QLB B;  1RWX B;  2XYP B;  3R7S B;  3GJR B;  2P2C B;  1ICE B;  3D6M B;  1I3O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...