2QLJB

Crystal structure of caspase-7 with inhibitor ac-wehd-cho
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
KIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Plasticity of S2-S4 specificity pockets of executioner caspase-7 revealed by structural and kinetic analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-7
total genus 16
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2007-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2qljB00
1RWMB 2H5IB 2H48B 4JB8B 4DCPB 3R7SB 3R6GB 2XZDB 1RHKB 2CDRB 2Y1LB 2CNKB 2C1EB 3EDRB 5IC4B 2HBRB 2QL7B 1ICEB 2C2ZB 3KJFB 2XYGB 1SC3B 3GJRB 2C2MB 2CJXB 1F9EB 3KJQB 2FQQB 5K20B 2QLFB 1RWVB 4ZVPB 1QDUB 1I3OB 2H4WB 3R5JB 3GJSB 4DCOB 2C2OB 2H54B 1I51B 4ZVSB 4DCJB 2QL9B 3SIPB 2HBZB 2QLBB 1RWKB 3R7NB 3GJQB 3P4UB 3D6HB 2CNOB 3IBCB 3NS7B 2QLJB 4ZVQB 2HBYB 3QNWB 1RWOB 2C2KB 1RWXB 1RHMB 1RHQB 5IC6B 1RHUB 1NMEB 4ZVOB 3IBFB 4ZVTB 2H51B 1GFWB 2XZTB 1PAUB 3D6MB 1PYOB 1QTNB 2HBQB 2DKOB 2CNLB 3D6FB 3GJTB 2P2CB 1RHJB 2CJYB 2H65B 1RWNB 4ZVRB 4ZVUB 3EDQB 2QL5B 1BMQB 3R6LB 1SC1B 3KJNB 2CNNB 2XYHB 3P45B 1SC4B 3R7BB 4LSZB 2XYPB 2Y0BB 1RWPB 1IBCB 1RWWB 2H5JB 1RHRB 2H4YB 3RJMB 1RE1B
chains in the Genus database with same CATH superfamily
2BQRA 1PIEA 1U02A 2H48B 1T9TA 1TELA 2W4CA 1Q16B 2W01A 4GVBB 4ZN1A 1HQUB 4CLZA 3C6UB 4ZPCA 3HO1A 1REVB 3PY8A 1UPPA 3PW5A 4P7TA 4BC9A 3IGVA 2DIUA 1AA1B 3V2UC 1NKEA 2I0XA 2MQOA 4B9MA 2V63A 1X0PA 2J6UA 1M1KT 2F4FA 2VD3A 4HHJA 3PX4A 4OHWA 3W5YA 4E0DA 1VRUA 1VJWA 3MMCA 5SUHA 1S7IA 1HHSA 2CJKA 4QIGA 2XY7A 4YB7A 2VQEJ 3BREA 4AL5A 1KP6A 4MYTA 3ZTPA 1EQMA 3OR2B 1TV6B 2HFSA 1HNWF 1HYSB 2HWTA 3QWUA 2CUYA 1S1WB 1V3SA 2YNFA 5KFAA 5K20B 2JNJA 3A8EA 1TVRA 3PYEA 4ZVPB 5BXIA 3H5SA 3TZZA 2VPZB 2WVDA 1FE4A 2Z57B 3N79A 4A8YA 3GCXP 3QSYB 3OW2R 2PC6A 2B0GA 4PXDA 3HVRA 2XNQA 1I51B 3MAAA 4HI1A 1FJGF 2YNGB 2R9LA 3OLBA 3MUMP 4FYYB 4ZHRB 3GWCA 4PG7A 3SCKE 2AYEA 3TAQA 4RW6A 3LA0A 5IOLA 2OMOA 4ZCMA 1O8BA 1YBAA 1LW0A 3FRYA 2DNYA 3V6KA 1Q8IA 2IBKA 3UO0A 2KXFA 5LL6d 2VG5A 1DQ9A 3IM8A 1OQ6A 3OBIA 3D1OA 4WP9A 2K8GA 1FNOA 1SKSA 4OI0A 5A8WB 1X9MA 2QLJB 1K73T 1VCTA 1NEEA 1Y5LB 4NLGA 2VICA 1NJWA 3M8PB 2MY7A 4Q0BB 3H90A 1RWOB 3KG1A 1SUQB 4LIWA 1R27B 1RWXB 2DYAA 3L4BC 1VQYA 4F7VA 4RZRA 1UA1A 2DR9A 5DLFA 4F0KA 3A8IA 1MU2B 1S97A 4NXMF 3DYAB 4HT7A 3BQ0A 4B3MF 4LVNP 1WI8A 2DISA 1E6YB 2XLJA 2IA0A 3NWRA 3WHIA 4X4SA 4AFFA 4DWIA 3MOJB 5CCLA 1ZM4A 4NLRA 4DQRA 4A8MP 1PBAA 1HQUA 5J2PB 3CDUA 4WFZA 5FDLA 2PEBA 1E6VA 1PAUB 3DRPB 2W4PA 2NYHA 3FEZA 1WACA 1EETA 4V19X 1Q0NA 4OYXA 3W7BA 2UXDJ 3ZZOA 4DV1J 4KIAA 2HHUA 5HSPA 2NXNA 3GJTB 4OYIA 4M63A 4PWUA 4RNMA 1X4CA 2BE9B 1VRQC 3MMCB 2BQ3A 1IBLJ 4LSLB 1ZAWA 2DVIA 3HHEA 4OZNA 1MNEA 3MHYA 5HJXA 1DHMA 3OR2A 4KHMA 2EK6A 4YB1P 1SJQA 1S6PB 4PG5A 2JEFA 5HVHA 1L3UA 2XYHB 1M0SA 2AJ2A 3P45B 3C66A 4X66J 4LREA 1K8AT 2OEJA 1ZA2B 4ER8A 2KVQE 2WOMA 4U7CA 4MFBA 3ONQA 3MAAB 5ETOA 4ID5A 5M2UA 1H2VZ 2YNGA 1ZAVA 1VR6A 2A0FB 2OUGA 1IBCB 1IKYB 1RWWB 4RW6B 1KEKA 5HLFB 1V3ZA 1IKWB 2GVZA 1NJXA 1XIQA 3ZTRA 4CH1A 2CVEA 4ANEA 3TARA 2PFDA 4RLEA 5DDRC 1NDKA 5A8KA 2VB6A 2PDAA 1U26A 1VI7A 3DDIA 3MDFA 5KFBA 2D9OA 1QM9A 1G6BA 4J90A 1SJFA 5FJ4A 2HLUA 3PYGA 4I68A 2MZJA 2JL9A 2CDRB 4OX8A 4KH0B 3BGRB 4Q0BA 4ZCIA 3ETOA 5BR8J 1RKJA 1SL2A 4HACA 1GX6A 4ZA1A 4QW8A 3W9HA 4ANCA 3KDNA 4DUYJ 4QYRA 3MZIA 2HQIA 4JI1J 5HJYA 2B5JB 3NGUA 3E3XA 2J76E 3R9LA 1T95A 1UPMB 5CHCB 2DGVA 2XWYA 3IRWP 1XBWA 1YJ9S 4RW4A 3CPWR 4N76A 1IWAA 5HO4A 5KFGA 2C2MB 2BE7D 1SQEA 4QWAA 2E7WA 3QT8A 2A2DA 4KYZA 4LR8A 3T19A 1D09B 2WW8A 2XG8A 3UN5A 3L3CA 5J2PA 5DS7A 3MMBB 5IWAJ 1S59A 2H9ZA 3PIPQ 1FT8A 4NX9A 9RUBA 2UU9J 1AB8A 5F8IA 3M32A 2AEMA 4CLWA 3R5JB 1SKWA 3RZAA 1A0OB 3MPVA 2R7UA 5KFFA 1UZDA 4DCJB 3D0IE 2ZE2B 2QE5A 1TMJA 3KLIB 3MGJA 4F2RA 1L3VA 1OIAA 4J9LA 3T3FA 2ZH1A 3RTVA 2YWKA 2XO7A 2GMJA 2HBZB 3DDKA 1ULRA 4L73A 2G13A 4M5MA 2XGQA 2BJ1A 1S6PA 4DQQA 4CO4A 3GYXB 4BHQA 1NK6A 3PCOB 2C3PA 3ENAA 5KG6A 3IBWA 3I56S 2V2KA 2ZH5A 3CSKA 4CCHA 4GKJF 1RAJA 3MPWA 1FRHA 2L9WA 3EYZA 1S72S 4P7VA 4A8FA 3TA0A 1Q4RA 1G7CB 3PRBA 3OTOJ 1HNZJ 4GMKA 3OTCA 3QNWB 3UI3A 3VGSA 1SKUB 2Z2LA 3G82B 3MTKA 3PJWA 2DNHA 3CCUS 3N5BA 1QLNA 4MKVA 2VV5A 1URRA 2BABA 2XULA 4CZCA 5HN0A 1SQFA 2ZWOA 1UEKA 3AOCA 2LQ5A 1FKPA 2B7BB 2DNQA 3M8QA 1S12A 4IKAA 4KC5A 4EK2A 2W8LA 2ACMA 5A2QU 1JNZB 3MCOA 3OTBA 4OYZA 3VAMA 1YJNS 1S9GB 1S1UB 1WG4A 1FX4A 2EI5A 3KG0A 4J91A 4L6V3 4EWTA 2J7KA 5LJ3Y 1TK5A 4NLXA 2UXCF 1TFYA 5KT6A 4ENOA 2NLWA 3BGRA 4M5NA 2W25A 4HACB 4HH0A 3OSPA 5JUMA 1S4EA 2A6MA 4RNOA 4M95A 2B5JA 2CNLB 4YDXA 1K9MT 1XNQJ 1RAIB 4ERDA 4DPXA 5LSRA 3UE2A 2FJXA 1RT7B 1WG5A 4RW4B 3CCLS 2ZNZA 3BYRA 3EDQB 3SDEB 1RT4B 1RYSA 1RDRA 1RKIA 2M4MA 3V4IA 1C4AA 1SC1B 3QFWA 3KYLA 1UVNA 1FXLA 2C2NA 2BM1A 2RUGA 3I5AA 3OUYA 3Q22A 2MKCA 2FJBB 1R6YA 3MEGB 4UOGA 5HMWA 4PPZA 3J81j 5IT9U 5IT9Y 4JI0F 2HHWA 2VPYB 1SCJB 3IXQA 3SEOA 4X62J 2FLLA 5F9LA 4X65F 4JI2J 3VCDA 5CD4H 2IBOA 3MMJA 2RRBA 2R8JA 4NCBA 4ICLB 1RLDA 2W7PA 2NS1B 4LF5F 2CQ1A 1NRKA 2DNRA 3CCTA 1DTQB 3VAGA 3KLVA 4JV5J 2NYIA 1FF2A 2PEHA 2CPEA 1SBRA 2Z2MA 3FEXB 5KG1A 3V6DA 2NREA 5BYRA 1HNXF 1P1TA 1SIZA 3HFKA 2OD4A 5B0DA 1CQMA 2AGQA 1KVJA 4M5HA 2HNYB 5I42B 1T05B 3NMRA 2XZDB 3HT0A 1HWIA 3ADAC 3MCMA 1ZOTA 2CADA 2CNKB 4O3QA 1IR1A 3G82A 5DQIA 1VQLS 3TP2A 2DJWA 4K59A 5THWA 2R7WA 1Q7LB 2BE2A 4C0OC 1U7LA 3D3BJ 4K2XA 2FPHX 3WIVA 1FKPB 3M8QB 4LF8F 3MM9B 4HTJA 3DGPA 3B8HA 4B08A 3T1YF 2HZAA 1XMOF 4UQGA 3OVBA 2B4PA 3KJQB 3QLHA 4OL8A 1I5OB 4PPDA 4CM2A 3VAHA 2A2CA 3KK1A 1GXLA 1X4DA 5I3PA 2N4CA 1RWVB 3H0PA 4DN9A 3K5OA 5DG8A 3H59A 3AXMA 4NLYA 4CRJA 3MECB 4PEOA 2OO4A 4DV3J 4H4MA 1FKAF 2HIQA 5L9NA 2J8SA 4B3OA 3SSSA 1FWKA 2HHPA 1WNEA 4USTA 4F3QA 2XQCA 1P9YA 2FIUA 3SBMA 4AXJA 1XMOJ 2DNLA 1SXLA 2ZBIA 3DRYA 2AJQA 2BMBA 1JIHA 3FQLA 3PNIA 1RT4A 5C42A 1CSJA 3PG9A 2NZCA 5LSLA 3NP5A 1UWBA 5B0EA 5KG0A 4DLEA 1VYAA 4USUA 5EHHA 3M8RA 3PRVA 2R3VA 9ATCB 3N01A 4WYLA 4YP3A 2HZVA 3MEGA 2DR6A 3GJQB 5ETSA 3BBCA 2AEJA 3D6HB 4ECVA 4WXOA 4ZVFA 5CYQB 3NS7B 4ZJLA 3LQVA 3R5AA 2HYIB 1YZ7A 5D0GA 4F4XA 1RT5A 2W24A 4DV0J 1QJHA 3ILIA 2DRBA 4TXSA 4KFBA 1XNRF 2CQIA 1BWVA 1YBUA 3A13A 4JV5F 1SH0A 4A8XA 4JYAF 3MI7X 3HVWA 1DTQA 1IUJA 1Q1KA 1U6FA 3K2YA 5CZVA 3SMZA 3K5MA 4GO5X 1WC0A 3T5LA 1HWUA 3TW0A 2FUG9 2WTFA 1SI9A 2W2OP 3VZHA 2GO9A 2VBXA 3ZXWA 5A6PA 2POKA 1NNDA 2GHPA 3IBFB 5T7LB 1WEZA 3GFZA 2XMTA 1T05A 4PG6A 3KTQA 4FBTA 4LFCF 2BJ3A 2V94A 5IV3A 1JXLA 4KHPF 2FDNA 4KGMA 2YKMB 1QTNB 3JAMU 1KQFB 2CG4A 1H3DA 4J9OA 4G6VB 1YX2A 2AU0A 3SCLE 1CJUA 3M2VA 1U8SA 3TVYA 4F8RA 4I67A 1IM4A 2JZ5A 3CD0A 1B0TA 3MM9A 3QMQA 4RBVA 5J1PA 4DV2J 1LV5A 3DGVA 3QGHA 1FRKA 3QLHB 2HVEA 2KFYA 1UW9A 2LKZA 3KK2B 2MDAA 4DR1J 2LDIA 3KJNB 1CS4B 2HS3A 4MIAA 2HHHF 4O3SA 3KK1B 5B0BA 4DR6J 1KS2A 2XBPA 4OX9J 1MSWD 3MECA 4LFCJ 1SL0A 3BSNA 2V4QA 4DX5A 2JEIA 2ZDOA 4UOFA 1VC5A 4DG1B 1VC6A 2GQQA 2WVCA 2J8AA 2W4DA 3P3DA 2HHQA 2Q43A 1SVDA 3OR1A 3F73A 4FF2A 3KNGA 4I2QA 5C42B 2X7IA 1BY9A 2XS5A 3LP2B 3PDNA 1UWBB 2B6AA 3F41A 3BM7A 1GAOA 1PC5A 1NB7A 2R8IA 1RT3B 2VBZA 2F4VF 3TNVA 4KKOB 1MROB 2GGPB 5HQ8A 4J7CA 1S76D 4X4UA 1BQMB 1WF1A 3GONA 4IH7A 2D69A 4QIWD 2HAIA 5CYQA 3OL6A 4F0HA 3ILOA 2R4FA 8AT1B 3FSYA 2QIFA 4ELTA 1S0VA 1HHQA 2MZRA 3DRSB 4FXDA 1F3VA 3PO5A 1N33J 2MXYA 3T6JA 1PC4A 2XWXA 2QEXS 5HL7Q 4DR4J 2XSJB 4TYBA 4EU0A 1JK9B 2D41A 2HRYA 2MHNA 3D1QA 2UXDF 4ECUA 2JC1A 1VRUB 2D3ZA 4ED4A 1ZPVA 3CIMA 2VF3A 4F0MA 5KTQA 4XPEA 1WWHA 3K59A 4O3RA 4G3IA 2E9TA 3U1NA 2OHDA 2ALYB 5B0FA 4DV3F 2GX8A 2HQ3A 1JQGA 1Y5NB 3AAWB 3CJSA 5D0HA 4ZVEA 2HKEA 1X8DA 2BJDA 2EBGA 3ZFVA 1KHVA 1RTZA 4RW8B 1S1WA 2YNFB 2HGNA 2H4WB 1SV5B 3VVTA 3LANA 3MUVP 1TVRB 5KFLA 2KM8C 1IBMF 1CJUB 3M2VB 3H4BA 3EXCX 3IAS9 2CDQA 1HWLA 4UOHA 5EUHA 2DR7A 2KFNA 3A3NB 1OQ3A 2KJWA 3U7JA 4ZHRA 3RAQA 2UVWA 1RQ0A 5IM0B 1IQTA 4NLSA 5A0YB 3BDEA 4R25A 3R1HA 4QWBA 3QAUA 1TKTA 3MCNA 4DPUA 4A8WA 4JI4F 2D7SA 1FFWB 2VG5B 4KRWA 4R5PB 4QYZK 4LFAJ 3ZZ0A 4DZDA 3Q8PB 3O2IA 4GKKJ 4OJGA 4O0IA 2RDIA 4J9UE 3C2PA 4DG1A 2MQPA 1VQ4S 2DGQA 2WAQD 4I0WA 2Q6BA 4HH1A 5A8RA 2B4OA 2QX0A 3M8PA 4AL6A 3VTIA 2PA8D 5D0RA 3LP2A 5I4MA 1XMQJ 2YKOA 5B0AA 4UQTA 1JLBB 4LR9A 3U1MA 5KFCA 1JB0C 2DR8A 3W64A 1MROA 4CYUB 1H38A 3W1YC 3MXHP 1EJ7L 3DYAA 2Q66A 1FK9A 4Y34A 5K8OA 2MKSA 2NXUA 4OIXA 4X66F 4CLTA 2IVMA 4QBUA 4PCQA 2IAJB 2XEXA 3JS9A 3UCZP 2AGPA 1RTDA 5DETA 3UQSA 1VQKS 2C22A 5ETVA 3EWGA 3DRSA 1I6JA 1XERA 3BR8A 5HAOA 1BGXT 2DXEA 3VAKA 4EEYA 3RYLA 6FD1A 1YQHA 2XMKA 2E29A 2ZHOA 3TZWA 5HQLA 4OYBA 2JSXA 4YR0A 3R1LA 1YHQS 3RW6A 1IBLF 1BQNB 2MKHA 5KFXA 3ZNJ1 3HHKA 2MQ8A 4IH6A 4X4QA 4FXVA 1AUDA 2QL5B 3DNCA 2FHKA 5F8MA 3MR6A 2XS7A 4LSLA 3R6LB 5BR8F 2V8GA 3J7YU 3HJVA 3TEGA 4DV4F 2JDJA 4OI2A 3MPUB 4I64A 1XK8A 4FZVA 4L74A 4QYZJ 4RW8A 1YJVA 2GS8A 1SC4B 1M5HA 3C8YA 3QJPA 2F40A 2VBYA 4DFJA 1RK8A 3MTJA 3CMQA 3VAJA 2XTJP 2RAQA 2WOMB 3PHTA 2LECA 4JI5F 2QFIA 4MFBB 2UUAJ 2EWHA 2HS0A 2CZVC 4ID5B 3B6BA 5LMUJ 2HHXA 4USKA 1KSPA 2G4BA 5ETMA 2HHSA 4GRSA 1IKWA 2GVZB 1ZM3A 5IM0A 4X4OA 5A0YA 2BW7A 2QC3A 3A12A 5LXYA 2V4JB 2YX4A 1TKTB 3G96A 2DO4A 3R5CA 2DO0A 3ILLA 3R5BA 3KK3B 1VMBA 3HI9A 3R7SB 5A8KB 2CZ9A 2N3LA 2F1FA 5SZTA 3SYZA 3ZC4A 2FB0A 2M3DA 3HKZD 1KTVA 4DX8H 2A3JA 4N8NA 1U1KA 3BEGB 1B0VA 3GMGA 1S0MA 4AUKA 1PSDA 4JUZA 3FSXA 3OXGA 2DGUA 2AW0A 2M8HA 4M5DA 2B9WA 3CD5A 1RB0A 1JLBA 2J9DE 3EPGA 1VQ6S 4WK1A 1U1QA 5KFIA 2G2ZA 1KFSA 4QIEA 4AXIA 4H4KA 3GE9A 1F3FA 1Y5IB 2Z4PA 4KGKA 5GAGU 3H25A 4FPRA 2QLFB 3US5A 4AD6A 3GYGA 3OHAA 3GTYX 3MEKA 3MEEA 1I3OB 1TUVA 3LGNA 4D3GA 3WQPA 4RUAA 3BO2A 2ASLA 4UT4A 1VBYA 1EX8A 3ZTQA 3UR0A 3I82A 2ZKTA 4L72B 4AL7A 3CULA 2UXCJ 2HNZB 2ZZTA 4B3TJ 2P9GA 1BQNA 8ATCB 5DZ7A 1R0CB 4R0EA 1PJ6A 2HWHA 3GU0A 2FVPA 5DDQC 1WG1A 5E3PA 1S9FA 4CLLA 4K0KF 4FS1A 2NUUG 1U47A 3SCJE 2RVJA 2XI2A 3IRXB 4FYVB 2J6TA 4GKKF 3DC2A 3A3PB 3PR4A 5U47A 3TAMA 4IO1A 3TJ9A 4KT0C 4BC7A 5IT0A 2FLNA 1OYDA 3CVKA 1NJYA 1EIYB 2QLXA 3EZOA 3AB4B 3NS6A 3PHEA 1N54B 2DNZA 3ZNUA 3NY0A 3S8SA 3FRZA 1RA7A 4DF8A 3HX9A 2HK2A 1V9OA 4C4WA 3D0HE 2AJ0A 1RABB 3NOCA 3ZO7A 2MMYA 4K2JA 3PZPA 1K1QA 3MOZA 2AYGA 1S0NA 2F63A 3AJ1A 1B4SA 4TU8A 1B99A 3B4MA 1RZMA 2HVHA 1K0TA 3PYFA 4XK8C 4C8ZA 1GMWA 3S1TA 3FC9A 2V4JA 2EFQA 5CXTA 4ZVOB 1PG5B 3D68A 1MG7A 1S5ZA 5F8GA 4PXBA 5FLXU 4ZVTB 4EO6A 3QFHA 3VV2B 2DNOA 4OX7A 4Z7CA 3E8OA 4ID8A 1KN6A 1S9GA 2Z2YB 1U1PA 1D0EA 4ANDA 2NXEA 2B51A 1NJIT 1T94A 1FWPA 4I6YA 2JHEA 3DU6A 4EO8A 4URGA 5CQGA 5GVQA 4PXCA 3TVZA 1UL3A 2ROEA 4M5DB 1VBKA 2DNMA 2HNDB 2OEKA 1WOOA 2YY3A 2WW4A 3BBFA 5GAEU 1RWNB 3J7Z5 1GMVA 5D4PA 3W9JA 3KUHA 3MR3A 4ILMA 1N33F 2QMXA 3DRXA 2EFGA 3QWPA 4ZPBA 5DG9A 1MWQA 1RT7A 3CJQA 5DGAA 3M9MB 1UW4A 4DV1F 1LK7A 2HQCA 4RWXA 3UCUP 4RL1A 1M5OC 4E8UA 1RCXB 4A8QA 3V4IB 3J7A1 1XN9A 1Y00A 3CJ3A 2HQDA 1FEHA 3MEEB 1K47A 3OUYB 5EWFA 2ZKUA 2B9YA 3JQMA 5F0WA 4P9SA 3M4XA 2BOPA 2E9RX 1WKLA 4M5IA 3W3SA 5H9EK 2YNIB 4OLPA 4DMZA 5DQHA 3O1LA 2F7VA 3OTEA 5G4DA 2L9NA 5KFYA 3TUZC 3VAFA 2J0QD 4QU7A 1S10A 1UFWA 2JVOA 2LXUA 2BRLA 4ICLA 1WSRA 2H4YB 2HFOA 3FVYA 1TKXA 3BN4A 2CQCA 3NG8A 3IRXA 4N56A 2W7AA 1J5EJ 1APSA 2BW2A 3I31A 4JB8B 3D66A 1TP7A 1HWJA 4NLPA 3RB6A 2M9KA 1NKBA 4X2BA 4DS5A 2RT3A 4C3KA 2E7VA 1FTCA 1N56A 4IG3B 2GJIA 3HHLC 2DRDA 2UVUA 2HNYA 5I42A 2QZ8A 2V2ZA 2X1GA 3I0RB 3PXGa 3I9V9 4DDFA 2GO8A 3PKMA 2XYGB 3M1VA 4MK7A 2VDIA 3QT6A 2B3TB 2I2YA 4KSEB 2JH3A 2XMVA 1JJ2R 4F4AA 4XAKA 4JV2A 1M90T 2PFFB 1Q8KA 4XO0A 5AXMA 3D3CJ 4YB6A 3M9OB 1DAXA 2QA2A 3DGPB 4GC7A 2NUHA 1N8RT 3GB0A 2XMMA 5D6GA 4QPTA 2E9ZA 1BC6A 4N47A 2VFUA 1KC8T 4B9NA 4OYOA 4EGLA 5J1EA 3FFIA 2G1DA 2FC9A 1F6TA 3O8WA 4TNOA 4PG4A 2VHGA 1LNQA 2LMIA 4ITSA 2OFHX 1P8GA 2E7XA 1WD6A 3N6NA 2CJ9A 5KG3A 3MFHA 4L3KA 2FY8A 4U8VA 4WIQA 3QT7A 2IDEA 1W2IA 4FPIA 4L75A 1Y3JA 1F60B 2FHJD 3P5TL 2AJ1A 2V9KA 3TEHB 2ASJA 2QL9B 1RCOB 2KT3A 4KGZB 3BGOP 4KHRA 1WOPA 2RILA 4L3NA 4NRTA 4TY9A 4ECYA 2UUTA 4C11B 2VOPA 3OFHA 3Q23A 3T1HF 1G4CA 4LF2A 4ES2A 4YMEA 1JLGA 2AJ4A 2L48A 3G6ES 2R7XA 3NXZA 3JTOA 2DHAA 1JXEA 4OZJA 2B9EA 2CAJA 2HG4A 3UD5A 4LFAF 1OPIA 2YX7A 1F5BA 4FYDA 2PI5A 2Y8YA 3SQOP 2QT7A 2BUNA 1AUSL 2ADBA 2YNIA 1VGYA 3LF0A 4H4OB 3KOAA 1Q81T 4Y6IA 2QFJA 2RS2A 1XMBA 3GIJA 2EVZA 1RT5B 3T5KA 5EN1A 1GMWD 3IA0A 3ZZPA 4DV7F 1VOMA 2LQBA 4WZMA 2UUAF 2DY9A 2PI4A 1TKXB 3JTPA 2UXBJ 3R2DJ 4HR2A 2HLTA 1OY6A 3NRBA 1YSJA 4ED6A 2EFVA 1S77D 1GFWB 3B4DA 3CJ0A 2IM2A 4CNZA 5IXUA 3KHHA 4ECSA 5DG7A 5HP1B 3RR8A 2XB2D 2HBQB 1HQEB 1QSLA 1VJQA 1R89A 3FCVA 2YKMA 1TUWA 2IPOB 3M1VB 3PW7A 2M7SA 4B17A 2WHOA 3GIMA 1CG2A 2D74B 1XWLA 2L3MA 3PIOQ 3G4SS 2WSCC 4O4RA 1CPZA 3HFZB 3D2WA 1T9WA 3UDVA 5CAAA 3CCZA 1NJZA 5HANA 3VALA 3ILJA 2X1AA 3MR7A 4FYXB 1CEZA 1N5VA 4ZPTR 5AJ3J 3KK2A 2MKKA 1YBTA 3VF0B 3OV7A 2J6SA 5J1EB 3FFIB 1CS4A 4P74A 5CABA 1YDLA 3D0GE 4DHVA 3R7BB 2FJEB 1HNXJ 3D1HA 2BX6A 1KFDA 1XR6A 2GCFA 2ILYA 2Y0BB 1ZETA 1YJUA 1UEUA 4DR3F 4UY8T 2LXFA 3S7RA 4KPYA 1RBOB 4GVLA 4NLQA 1SH3A 1TMMA 2CZ4A 3PTWA 4DR3J 4JI8F 2CJBA 2ATCB 3FMBA 1JLGB 1LWCB 4I2QB 4PQAA 3OT9A 3CF5Q 2FVQA 2GIFA 2CJQA 3ZZTA 1C4CA 3NGSA 2XGPA 2B6AB 4Q2MA 4DCPB 2AT1B 3LWMA 4EBEA 2M5YA 1IXKA 1BUXA 1FDDA 1T9XA 1RT3A 5GAHU 3Q2SC 4KKOA 3ZZUA 1DJ0A 3E2EA 4JBCA 3TYTA 4ZS6A 1RTHB 4I69A 4CM0A 4DL4A 1C0TB 1QUPA 4H4OA 2U2FA 3EDRB 2HMIB 3CCJS 3KJFB 1FRMA 5GAGI 1DURA 4OZ3A 1TL5A 1UZHA 1D9AA 3CDBA 2CPDA 4DL7A 3M6UA 1A6LA 3A3OB 2E5LF 3IO1A 2H3EB 1MN9A 2ROGA 3QIPB 4DQIA 1LWFA 2OPRB 1BQXA 2AHOB 2B8QA 2EKYA 2BKOA 2XSJA 4X84A 4ATNA 2D3OR 2YH1A 3BZQA 4RU9A 3RW7A 2FQQB 5FIIA 4QIVA 5HP1A 3GIKA 4K7QA 2YQ3A 3VGTA 2Y1JA 2PIIA 1HQEA 1QDUB 4LRCA 1H2TZ 1X4EA 3K58A 3TQ1A 2R7TA 4C0HA 3ZTOA 2O1PA 1GK8A 4LVOP 1WJ9A 3MM5B 4MTPA 5ETNA 4ZVSB 1IJEB 1HI1A 1SV5A 3HSZA 3VGUA 1FNXH 1TL4A 2VFVA 1H98A 1O51A 1REGX 4OYPA 3OTDA 4ECZA 1LOUA 1XNRJ 1Y11A 4O4GA 5D15A 5DQGA 1KVIA 4LFBF 3NBPA 5D77A 5EWGA 3RBDA 1XJWB 4WU2A 4F3MA 3PX0A 2W2NP 2QSWA 2MSTA 4H54A 2IYIA 4U95A 3CTRA 2KJVA 2KG0A 3BQ2A 1U48A 4NCGA 4F4ZA 3HLUA 3ZZRA 3J80Y 4R5PA 4KV8A 1G1XA 1RI7A 2GW8A 3DI6A 2CQGA 5IV4A 1YWXA 3JAMY 1IR2A 1MW7A 1AYEA 3BKFA 4HL9A 3AH6A 3L7PA 2DEIA 4P2XA 1RADB 2QTWA 1WHVA 2WB1D 5L1IA 3BGUA 4OYWA 1VBXA 2FVCA 2OJ3A 1WI6A 2MSSA 3DHWC 2AWZA 5A8RB 1LQ9A 4PWDA 1U6ZA 1LWCA 2B4UA 3NAHA 4RUHA 2ZJRQ 1LK5A 3AB2B 4Z7YA 1PGZA 1ZM2A 1FX2A 4YDDB 3HSGA 2MQMA 4ZN3A 4DL6A 5C7PA 1YITS 5JVGQ 4ZMMA 1FJCA 1LWXA 3A1YG 2NPFA 1U2CA 4CYUA 4X4RA 2KT5A 2VKZG 3THVA 1FK9B 2YX1A 3HJFA 1AFIA 3CCQS 3S01A 2M88A 2DHSA 2YPZA 1T9VA 3KHRA 1SL1A 2HHHJ 3NNAA 2UV8A 2QGFB 3TZXA 2HMIA 3P49B 2IAJA 2BBEA 5F9NA 1TKZA 5F8HA 3T1YJ 1RTDB 2DRAA 4RR5A 2RQKA 5F3TA 4FYWB 4LF8J 3TA2A 2J0WA 2DNNA 4OLOA 3VHQA 3OL8A 2CJYB 1LWFB 2OPRA 3POTB 2ZBCA 4TU7A 4CP5A 5HMYA 3B78A 1Q8BA 5ADZA 1YRUA 4B9LA 2HQFA 2V5HG 3AQPA 4DBQA 2QYGA 4NEZA 5H1SV 1U1RA 1OO0B 3IWXA 2R2TA 4CWBA 3Q8YA 4W98A 3H42A 3PEHA 3VQSA 3OVSA 2EBEA 5F0UA 3HT3A 4EZ9A 5D0EA 2QJ3A 5IFMA 4Y2AA 4DPOA 4JI3J 5LXRA 1CVJA 1F5AA 2V6AA 1OSDA 3QSIA 2BJ7A 2I38A 4YR3A 3PW2A 4R0JA 1IM6A 1CC7A 3RAXA 1DLOA 3VGVA 2VOOA 5K8MA 1I1GA 3MURP 4DV7J 5KT5A 3MM6B 2E5HA 4DSEA 4CO1A 4AT1B 1BXNA 2ZZNA 1KQKA 1NKCA 1JLCA 3OL9A 1ZBTA 3N9UC 2KZZA 2K1RA 2K3KA 5K14A 5KFRA 3AT1B 3KDOA 4DL0C 1RWMB 1HI8A 1SQGA 4X62F 5J2QB 3QRPA 4CNYA 4NCGB 3KK3A 4HI2A 2JLFA 2Q79A 4K4VA 3NS5A 1HKAA 4GKJJ 2R8KA 3VR1A 2MJNA 5F41A 4FVCA 4RX6A 1QAIA 4W92B 2W7OA 1S0OA 5EGYA 1T03A 1O5JA 2C2ZB 2CQHA 2MHEA 3HHLB 3JTNA 4WTOB 4C8OA 4J5OA 4IUFA 4XDDA 2WK4A 4RW9A 1AFJA 2DXFA 2YVSA 4C6AA 3W62A 2IY5B 2X51A 3DLGA 5F8LA 4B3SF 3EM1A 3IFEA 3W63A 4IR1A 4WU3A 5K8NA 5L46A 1TR0A 3FMWA 4J9NA 2HVIA 4URSA 2OLWA 4C3MA 4ZP7A 4RNFA 2H1YA 2MKIA 2C2OB 5LM7E 1TKZB 2AIRB 1UVJA 3KMSA 4P72A 2MLYA 3LP0B 4OHVA 2GZOA 2VJVA 3NNHA 2VG7A 1UA0A 1Z4UA 2R2RA 4DV5F 1JMTA 4K4WA 1FJEB 5GADI 2HNZA 4U8YA 4O0NA 2N82B 5A2QY 5A6WA 1SJ3P 1MMDA 3CEDA 2DITA 5HQMA 3MM8B 4F50A 1Q86T 4LF9J 2KDOA 2LFVA 3KLGA 3MR5A 3H8YA 3CE8A 4QR1A 4WFAQ 4OV6A 1RAOA 4B3OB 2C2RA 2BZ2A 2VPWB 4J9PA 4O3NA 5LSOA 1JX4A 3TAMB 1FTRA 1HW9A 1Q79A 1Y7PA 4F25A 3T1HJ 2NXJA 2ROPA 4I7FA 4TY8A 4OQJA 3HM9A 2UUBJ 1DLOB 1U1MA 1R31A 1WC4A 5EX0A 4QQBA 3TX8A 2AZ3A 2BA9A 4XDCA 1JLCB 2K1RB 2LEAA 3QZ8A 3RGIA 1WDTA 5K14B 4WFYA 3A4TA 4PYAA 1NMEB 3BJYA 2P6TA 4MKAA 2IMWP 2B56A 2MJUA 1SPBP 2DNGA 4PUOA 3HSDA 4ED0A 2MZQA 5HMXA 2GJFA 5LMNF 2XZTB 4D3HA 2B7CB 4NL5A 3KHGA 3EZ5A 2VFSA 3LH2S 4C98A 4FNIA 4LQ3A 1S9EB 3UDCA 1T03B 3H4DA 3C15B 3UR3C 1DQ8A 4YY3F 2VA2A 4YQWA 5D8HB 3HCXA 4ILRA 1W2BR 1FRLA 1QAYA 3FJ2A 3W65A 3FQKA 2P8IA 1TZ0A 4OHYA 2F65A 2IDLA 1IKXB 1X4GA 4LF1A 4NZ0A 4ZVRB 2HNDA 5KG5A 1N34F 1M5VC 1U6BA 1YI2S 2KZMA 4DR2F 3Q24A 3FGVA 1S6OA 2LU1A 4NCAA 1T3NA 1HBUA 2PMWA 4Y2CA 4AQYJ 2Q1LA 4LBHA 2X3DA 2XMAA 4IRKA 2Z58B 4PKDB 2Z8QA 3RB4A 3GG0A 4DL5A 4EBDA 4UZBA 3CC7S 5T14A 4EZ6A 3LP0A 2QV6A 5HROA 3GSDA 3OQ2A 1ZZNA 1XEZA 2VG7B 5IQQA 5LMUF 4Q43A 2H5JB 5HK4A 3RUBL 4RUCA 3QIDA 2OIHA 3VQTA 3CNQP 4CO0A 4UOCA 1JLEB 2CPFA 2W2PP 4KAIA 2KHCA 1JNRB 4WJBA 1RE1B 4AYBD 1MWYA 2YWFA 1WHYA 3PJXA 4UUWA 4CT8A 4Q5VA 3OTOF 1VC0A 1W25A 4DLGA 2CQ3A 1U1NA 1P27B 1B3TA 4NWBA 1X60A 2LQ9A 3LPYA 5B7WA 4NYPA 3F44A 2HK3A 2OH2A 1VQ8S 2AKWB 2N4DA 1NK8A 2Y1LB 3NCQA 1IKVB 4HT5A 1NSKL 1IBKJ 4IG3A 2LQ8A 5J2MA 3I0RA 2IJRA 1R3NA 4WK3A 2R7OA 3LP1A 4ZLPA 1HL6A 1FFSB 3K7RA 4LRDA 4YY3J 2B4VA 4TQSA 2F8HA 3G8TA 4BWJA 3CUNA 4XPCA 1TL3B 3FBCA 5KFHA 1H73A 5DO2A 2DK2A 1U49A 4LF6J 2EW9A 1U2RA 4FXWA 2JOQA 1TFWA 2F8EX 4PAAA 3CW2C 2EC2A 2IVFB 4DFKA 3OJUA 2RKIB 3R5DA 2VFRA 4B3MJ 3EJMA 1FI4A 4RO0A 3X3UA 1DQAA 4CH0S 3TQEA 3HP6A 1RAFB 1XMQF 4K4ZA 2QA4S 2KXHA 1CULA 1H6KX 3D5MA 1IKXA 2KYXA 3BDPA 1SB6A 3MMAA 2MPUA 3GIRA 2W9CB 1N6QA 4KPCA 4E98A 3GPAA 1HBUB 2JJ4D 1PJ5A 5D78A 4C11A 4ED7A 3Q8UA 3R7NB 1FRIA 2CPIA 2V34A 3VWSA 4C0BA 4EFAC 3J7AN 4DR7J 5DZ6A 4P73A 1MLAA 1T02A 3V81A 5JJBA 4DR7F 2XY6A 4PRFA 1O0PA 4Y28C 2ZH3A 4DPWA 2BVZA 3BKTA 5KFKA 2ZHBA 1LKZA 1T9YA 4DX6A 5HROB 1XC9A 2WSFC 4JV1A 1RISA 1P1LA 2HBYB 3F56A 3GLJA 4M5KA 3QZ7A 3M8SA 4HYKA 1TUGB 3CJRA 1PKUA 2B9XA 3Q83A 1JLEA 2RQCA 3MUTP 2XM3A 2J9DA 1NPKA 3T1AA 1NZ8A 4OYAA 4A8OA 2ZH9A 1FJGJ 3HXMA 1H72C 4ZIVA 1Z1ZA 4A8KA 5KFDA 2XMJA 3M05A 3JYTA 3UDEA 1HHTP 2F9DA 3KXDA 1JLFA 1GMUA 4N8OA 4Q45A 1IKVA 4F67A 2I8EA 2YXLA 3NMAA 5J2MB 4DR2J 3D7SB 3PFOA 4KBIA 5KFTA 2BDPA 3LP1B 1FESA 1L5UA 3TO8A 1QAXA 2J7WA 3OSNA 5B09A 1C0UA 1TL3A 2RRNA 1NM2A 2O67A 2MZTA 3CMAS 3NL0A 4QR2A 2XSFA 2LP4A 3BV8A 3HSJA 1QSSA 2R7QA 3Q8RB 2EK1A 3W66A 5K8PA 4G1QA 4Q8FA 1WEYA 5KFVA 2RKIA 4LSZB 1YTYA 1W7WA 2NCKL 3QATA 4IDKA 2IYGA 3H5UA 4HTIA 4MMOA 3BO3A 2BKNA 4Y00A 1CULB 2VONA 1JKHA 3CJ8A 2QRRA 1YVFA 3G2XA 1VDHA 3PR5B 2BR0A 3PVXA 3TA1A 4XIUA 1SC6A 2W9CA 3M6WA 4WCEQ 1N6QB 2UVRA 3H2VE 4JI3F 3RJMB 2YH0A 3M9NB 4XTTA 4WE1A 2APOA 1Y0HA 3G87A 4USMA 5KT7A 4DXLA 5F3ZA 5KAKA 4UUXA 1CC8A 1RAHB 5L38A 5KFQA 2DPJA 1X5OA 1TKDA 2RSQA 3MAQA 4P10A 4C8LA 3ICLA 2O66A 3FSIA 2EG1A 2NR0A 4DR1F 1L3TA 3K5NA 2OTLS 4Z2XA 2L08A 1HWKA 5IC4B 1IJFB 1RTHA 1ICEB 4P2FA 2JLGA 1C0TA 1JJ4A 2HGLA 1T11A 1X31C 1UAWA 4N41A 2PO4A 2EFPA 2PSZA 3BR9A 1URNA 5ETPA 4CO5A 1UEVA 3CB4A 3GP9A 4K4TA 2CJXB 1YG0A 1XTZA 2ZOMA 3HPOA 1BE4A 2UP1A 3QIPA 4FF4A 1FO1A 1B0PA 4Q44A 3N6MA 3SV3A 2XLIA 4KTQA 4ED3A 3W61A 2DGTA 2OPQB 2KYZA 3UPFA 2FZCB 4LF6F 1RWUA 4Y2KA 3R5GA 1RBLA 5K5MA 5GMEA 4USHA 3L09A 3UD3P 2HW3A 1RTIB 4CLKA 2XLKA 3MM5A 1C0UB 4R8UA 3KLFA 3CMES 4USVA 3HK2A 4OHXA 2BKPA 2HVZA 2LYVA 2A18A 5HATA 4EYHB 2UUBF 3G8SA 1IBKF 1QAJA 4O4GB 4Y0FA 2WBMA 3P4UB 1MN7A 2JFKA 3Q89A 3NBPB 4G1QB 1TL7B 4QOTA 3IBCB 4ZP6A 2VA3A 1VIXA 2PMHA 1JLQB 2RMLA 3AOBA 3W2WB 1V6HA 2FTRA 2G2YA 4M8LA 1F2GA 1T3OA 1TQLA 4FKXA 1U45A 2Y8WA 1D8YA 3W5XA 3FBBA 4IYQA 3QO9B 3LTOA 2ZWPA 4KV8B 3RU0A 4IR9A 4LRBA 3DOKB 2DTJA 2BACA 3DI6B 2RIJA 4DV5J 1EB0A 4IO9Q 4DQSA 2YNHA 1OMSA 2FHMA 3QJLA 3KUEA 2FVSA 1YK9A 2KTQA 4QJVA 3KLHA 3BGFA 3FKBA 3H2UB 5IC6B 2AYBA 3PYDA 1WHWA 4LQ9A 2HFUA 2E1PA 2VL1A 1YRTA 4KE5A 4OI4A 2E1AA 4WXWA 5KT4A 2R8HA 4PWDB 2VQFF 2FZKB 4HHHA 5KFUA 3MF5A 2M52A 4EMDA 1A9NB 2JC0A 3FZ2A 4OX9F 2YKAA 1WHXA 1VLYA 2QLWA 4J9SA 2QMWA 2ZEJA 2EKNA 1RTJA 4K4XA 3CXCR 4PQUA 4RKUC 1CBKA 1X5SA 1PYSB 3HHDA 2H5EA 4S0MA 3C6TB 3WX4A 3I6PA 4LMZA 3FK4A 3EPIA 2H65B 2MZ1A 1WF0A 4FP9A 3M30A 4NLDA 2OMLA 2FGOA 3NAIA 3KMQA 4NZ7A 5KG7A 4ZCKA 2C28A 3EGVA 4ZCLA 4DSIA 3ENQA 2OPPA 3CO9A 2AX0A 3POTA 4MK8A 5M2RA 1H74A 1H7XA 3V6HA 5J2NB 3B54A 2YKPA 2DXDA 1U0HA 5IT4A 4LUBA 5GADU 5LMNJ 1YJWS 2OPQA 2HVDA 3FCHA 4DUTA 5I3UA 1RT6A 1UETA 2KN4A 4CLSA 2XHWA 1TU0B 3UD4P 4HEA9 4DFPA 1RTIA 4WF9Q 1DY3A 4WP8A 4MIWA 3KLFB 3J81Y 1S1VB 5C25A 2OTJS 4P71A 3LALA 3DLHA 2OPSA 1YIJS 4X4TA 2VG6A 4B3SJ 2DGOA 3MM6A 1NK4A 3DM2B 2ZJPQ 3K5PA 3SQGA 3PFEA 4GC6A 4YOEA 3L95X 2V4RA 2H5IB 5E41A 3DMJB 3DLBA 1TL7A 3H2LA 3DDNA 1QTMA 3IP0A 1Q5YA 3O5TB 3W2WA 3T5JA 4DR6F 3DXSX 5AE2A 2OGUA 3CWJA 3HZGA 1M1GA 1BLUA 4OZ0A 5ETTA 5ETKA 5BYSA 5J2QA 1N4LA 1HNVB 2RHQB 4WFBQ 1KBRA 3QO9A 4FN5A 3D4JA 3G71S 3TUJC 4DF4A 1EHWA 3I87A 1IBMJ 3ENVA 2WSEC 1OY9A 1N5QA 1SC3B 2YNHB 4KR0B 5B0CA 3QJJA 2G9OA 2FJVA 4V19J 3B82A 5FLXY 3HHLA 4CT9A 3EUNA 2R2SA 4LF7F 3TJ8A 4U7UD 3DN9A 1F9EB 3OPKA 1QUVA 1R8CA 4RW9B 3DLLQ 1X4HA 2UUCJ 1Q95G 2HRUA 3M8ZA 1EP4B 3GFHA 4TQRA 3AQOA 4X4VA 3K8WA 1WTFA 3DLGB 1FDAA 2ZVSA 1S1XA 2N7CA 5AT1B 1X4BA 1U4BA 1LXJA 1KWMA 5KT3A 2QO3A 2J5AA 1JJHA 1M5SA 2GAHC 3GJSB 4DN0A 1DTTA 2C42A 4PQUB 2O5DA 3SSRA 3C6TA 3ELHA 3ISZA 1I94F 4LF7J 4I2PB 2KHDA 2DH9A 2RQ4A 2XCPA 3A8KA 2PGCA 3LPEA 4IFVB 5C24A 2DCLA 3TX0A 4ZPWR 4ALZA 1VQ7S 3I96A 4NXNF 1M5PC 2RU3A 1PYTA 4LSNB 1YZ6A 2B8PA 3GCWP 1DARA 2ZFHA 3AOAA 1RLCL 2OPPB 3FDSA 4LRFA 1MMLA 3QRQA 2ZH7A 2JVRA 3HD1A 2VASA 4ECXA 5J2NA 2XS2A 3CIZA 1PBUA 2Y1IA 3MM8A 3VZIA 5ETQA 2QG9B 3M2UB 4P75A 5LOQA 3J7YI 3N4WA 5L9XA 5G0RA 3W9IA 3KLGB 1NDLA 4M5JA 1M1HA 3L7UA 5I3UB 1WC6A 2D9PA 1RA6A 2G0IA 1WC1A 4DOZA 2JFDA 1KLNA 4X64J 2WVEA 2RE1A 2ZNYA 3I32A 3I0SB 4MKBA 4BLGA 4I7FB 3LGMA 2HSEB 3AD9C 3EGNA 4OI3A 4TY8B 1ZM9A 3CDWA 4HLBA 4WYWA 5HVGA 2VJUA 1DRZA 4LF5J 2CPHA 2AEFA 1UJ5A 1KKHA 3DM2A 3SXLA 4RNHA 3BSOA 3SQGB 4ZOSA 1VFJA 3PW0A 5KFNA 2AQ4A 3AJDA 2DHGA 4ETZA 2I6WA 2RJZA 5DDPC 3GV5B 3JXOA 4K8RA 1UMJA 2DPIA 1YGYA 3MD1A 3GILA 4PUOB 3G6XA 1HNVA 3I4HX 4EI2A 1WOSA 5JVHQ 3UWTA 4I1TA 2E5IA 1NHKL 2I1RA 3D9BA 2P2CB 4DR5J 2XZWA 4QZVB 1FNMA 1R6VA 1S9EA 1RHJB 3IAM9 3C15A 1S79A 4TVAB 4Y2MA 4IOCQ 4DR5F 4ED1A 3FCWA 4F04B 4DUYF 4ETXA 3CC4S 5E3AA 2Y9HA 2ACYA 3PJ9A 4BDPA 3PW4A 2CPJA 2Z30B 4NLTA 2Z0GA 2MKJA 2DGSA 3CCMS 4DX7A 3DKDA 1VS3A 1VQPS 4NRUA 4FNHA 1DTTB 3CCSS 1D9DA 2CQBA 2I5JB 3KHLA 4C2MA 1N88A 2VH7A 2XYPB 2HPUA 4ZP9A 4AE5A 1HIYA 5EWEA 1T7PA 3KJVA 1N48A 3CGIA 2G0JA 1OS5A 5KFOA 2W1BA 4LSNA 3NGDA 2E5GA 3CD7A 3RBXA 4JYAJ 3P6YC 4V1Ak 3SFUA 1X0FA 2WVBA 2X3GA 3PO4A 2RQMA 3CCWA 5MAOA 4IQXA 4DV0F 2WVFA 1FD2A 3CT9A 1B70B 1YJRA 4ECTA 2BXJA 1LW2B 2FC8A 7AT1B 3QRRA 1OJ4A 3NCPA 4QIFA 5KFWA 1UWAA 1D8ZA 1P9QC 4Y65A 5L1LA 1K44A 1WKKA 5AJ3F 1FRJA 1UVKA 1X9SA 2ZJQQ 4OHZA 4U67Q 4G1PA 4ELUA 3RR7A 2C1EB 1WC5A 2NZ4A 2CQ0A 4F4KA 4CQ1A 1RAAB 4EUVA 4TU9A 2BV3A 5AE1A 4UY85 4E2FB 3K5LA 1ZA1B 2QYCA 2YQ0A 3NGKA 3EZUA 2W8KA 1W26A 4UZCA 2KKHA 3RBEA 2WONB 1GTEA 2E1MC 3QGPA 1VQ9S 2ALZA 3EXYA 4NLWA 2RDJA 3TRGA 4MK9A 2ZBQA 1ITPA 2ZD1B 1HR0J 2EPIA 3GQCA 2RRAA 4Y2IA 2D3O1 4HDHA 2RS8A 1JXVA 4P6QA 2RF2B 5J1NA 2ASDA 3IC1A 2MZSA 2ADCA 5ITHA 3TVKA 3OFFA 3RG6A 1Z2ZA 5HMZA 4KGXB 2EFOA 3W8GA 3MFIA 3Q2TC 5L39A 2E66A 2GQ2A 2YPYA 1FVSA 2GFFA 4O23A 5B08A 1NK5A 1K0VA 1DBDA 3GR0A 2WBRA 4CLPA 1IWGA 1R8AA 4ES1A 3E01B 3R2CJ 4I6WA 4K4UA 4NOHA 3K0JA 1UVLA 3D67A 1RSCA 1VBZA 2L9DA 2DGXA 2PT0A 3MMAB 4OJHA 1TL1A 2AJFE 3ZTSA 2FJAB 3MCSA 1UJ4A 5HI7A 7FDRA 4NE9C 1YKWA 3K8VA 2CQ2A 4IG0A 1NHVA 2KU7A 2IIHA 4IQMA 1J2VA 2CG8A 2OEMA 4GO7X 2DIVA 2V68A 4ZLNA 4DU8A 1K1SA 1EQ0A 1YRXA 2FLPA 1FXRA 3ISND 3V81B 2AD9A 1R0BG 4NI2B 2COLA 4PZVA 2HFZA 3KJVB 1RT1B 5JXSA 1Y9OA 1RHMB 2QA4G 4WP3A 3EICA 1VRTB 1HARA 1RHQB 2O3DA 3A8JA 5HLFA 2MY8A 4DSJA 1U25A 2CPXA 5L1JA 3THTA 1LW2A 5KFPA 4F3OA 1TAQA 2I9SA 3H7HB 4Q2LA 3IG1B 3T6BA 5CCMA 5E3RA 1N36J 2UU9F 2ZH6A 1VQNS 3RBZA 2RD5C 2L41A 4OYMA 2LU2A 1RT2A 3JYTB 1KRPA 4DSKA 3DOMB 4ILLA 1PYOB 2BEFA 3BS9A 2QSFA 3NNCA 3SZ2A 2DB1A 1NHUA 4JP8A 1JLFB 3ZZZA 2IRYA 2J9EA 2WRMA 3L9ZA 3P96A 2NSCA 4BCAA 1KR4A 5AE3A 2PMZD 4BWMA 4TYAA 4ZPVR 2CQPA 4FF1A 2VIHA 4NLVA 4WFXA 3DRRA 4PXEA 2FHJA 2WONA 1H2UX 4NEYA 4RBUA 3AA8A 4LJMA 1IR0A 3BH6B 7FD1A 1FE0A 4K5SA 1XNQF 3KUGA 1BMQB 2IM0A 3O3LA 2YWHA 2K7KA 3KLEA 2ZD1A 1S1TA 3OLAA 2V2VA 3RRHA 2W9BA 1ROFA 2RB7A 3NGRA 3HFVA 5D3GB 1FWLA 1R0AA 1T8EA 3W2VB 3PKYA 2EXUA 3IN5A 2C3MA 2HEKA 2Q3PA 1Y3KA 4CTAB 2HFNA 3GFYA 3PEJA 1ZPWX 2NXCA 1RWPB 1AT1B 2R42A 1HPZA 3AD7C 2Y3YA 2BJ9A 3OFEA 4IDKB 2GVDA 3DOLB 5GMDA 5KG4A 3E01A 1HBMB 1S6QA 3HF5A 4TLRA 5K9FA 3UN2A 1N34J 5F8JA 1JKHB 3IGNA 1NPPA 3SV4A 3TZYA 2KG1A 3H5YA 3JB9k 5E0OA 1AZSA 1UFKA 1TL1B 2HGMA 2QN6B 1VK3A 3D28A 2C3YA 3LAKA 4QW9A 4J9KA 1UCNA 2ZM6F 1N5YA 3CD6S 1FD8A 3THPA 1XR5A 4IG0B 1QY7A 1GXTA 4K4YA 4WE1B 1CJVB 2PE8A 3HVAA 1WTBA 1U0SA 4DV4J 4J9RA 4K0KJ 3JSYA 3R27A 5H9EJ 1N5SA 3IM9A 1GTHA 3QT5A 2LA6A 3MEDB 3AHPA 1MMNA 3HHLD 4M5GA 2RUSA 4A4JA 3DXBA 4RNNA 1TAUA 4TKTA 4OJ3A 1ZTTA 5E2QA 2O01C 4F26A 4B3TF 2ZUAA 4K50A 2V50A 3GZ7A 1S57A 1Z2LA 2VU5A 4NA1A 3RB3A 3T5HA 1Y10A 4OMFG 3ENWA 1RT2B 2DGWA 3CJ5A 2VFTA 2K3IA 1UP1A 3M8WA 1TK8A 2R7SA 4WBFA 1EKRA 1F5CA 4ECQA 2LEPA 4CLYA 2J0XA 2BRKA 2LDYA 3TUIC 4KY3A 3CDAA 2HWIA 3DRRB 1NB2A 5E3CA 3UDLA 1HBNA 4F02A 2IHR1 1CJKB 5RUBA 3QGIA 3GFXA 2JEJA 3AD8C 2X1BA 4OZ5A 4LT6A 2AGOA 2HHTA 4ZP8A 2CKWA 4R8UB 3KLEB 1QE1B 4EYIB 1S1TB 3PACA 4ES3A 2XHCA 5DDOC 4TN2A 2M8DB 1NDCA 2W9BB 1JWWA 1IN0A 1EARA 3WBZA 4LRAA 4CLUA 1NSAA 3TUPA 1RACB 1R0AB 4NA3A 2BOAA 2ATLA 3W2VA 2IJNA 1RXOB 1T9UA 3I55S 4ZVQB 3DLJA 1JLQA 2CWKA 3KFWX 1HPZB 3OD2A 2VODA 4DQPA 2GVDB 5GAHI 1HBMA 1S6QB 2P9CA 1LWEB 3IS9A 4KH1B 1KTQA 4J9VA 3HKWA 3IR5B 3WZ0A 2LA4A 2KXNB 3DOKA 1Q53A 2IM1A 1RBAA 4CLFA 2Z56B 4ZJQA 1N5YB 3JQJA 2DH8A 3KLHB 1NO8A 2F3JA 5DJBA 4ZJOA 1NSQA 4CDIA 1CJVA 4ZPAA 2PD1A 4F36A 5KT2A 4U6PA 4ED2A 1NK0A 3C14B 2FY1A 2HAFA 3IWLA 5DRKA 4DJBA 1UJ6A 2F9JA 5KFSA 3AXKA 2YQ1A 5EX3A 5HBMA 2ZH2A 2YKNA 5LJ5Y 3CCES 1F1BB 4K5RA 1ZS6A 2NPIA 3MEDA 4C3LA 2VQEF 4B9TA 1VHIA 3BH7B 3ITHB 1RTJB 1EAYC 4NASA 4DR4F 3S6EA 4ZPDA 2W2MP 3RB0A 2GV1A 4A8SA 5DM6Q 3KWMA 3X1LB 3E51A 1PILA 3EGZA 4NYOA 4YEAA 1FKOA 4NZ6A 4J9MA 2QMUB 2MTLA 3M30B 4FBUA 2JEGA 2V0NA 1GT8A 1QVGR 2R8GA 4DS4A 4OZLA 3QYYA 3P8BB 1F9HA 4U9RA 2BANA 3IR6B 3NGTA 2ZM6J 1KD1T 2KRRA 1U0HB 2DEJA 4TLQA 4UTGA 5CZXA 1V5IB 4JOUA 4OX6A 1C1CA 1HMVB 3N28A 3BSCA 2CRLA 2BQUA 1RT6B 1HBNB 4DSLA 1F9FA 1JJCB 1CJKA 4FDFA 4DL3A 1U1OA 3GSIA 5GMKa 4NXMJ 4B3RJ 2DH7A 2CXEA 3Q8QB 3PX6A 1FDBA 2UZAA 1X4AA 1S1VA 3UCGA 5C25B 2RDDA 2YWEA 3M7VA 2OPSB 1OY8A 1V3RA 1ELOA 4B02A 2VG6B 3G9CA 2CFXA 3Q8VA 1Q5VA 1REVA 2GIRA 3LO3A 1U1LA 4IRCA 1N32J 3CJ4A 3R6GB 4BS2A 1RAEB 5KOXA 4AQYF 4USIA 5E7OB 3DMJA 3PV8A 3NWGA 3G8QA 4WWSA 3I5BA 2OAUA 2AYMA 4LF9F 2FGCA 2HBRB 1WEXA 2YKQA 1F0XA 4O3OA 3HULA 4QPXA 4YHHF 3GJRB 1FA0A 2A6OA 4N77A 1KQGB 4JV0A 3H98A 4RW7B 4IH5A 1V5VA 2KT2A 1TV6A 2R7RA 2XY5A 1ZZFA 3BKUA 4YS2A 1A7GE 1S49A 1KNZA 2MQNA 2FD2A 4IRDA 1M5KC 2ZBRA 5H9FK 4DZ6A 3C14A 3BQ1A 1EP4A 4KB7A 2WZ1A 1HR0F 3CCVS 5KFEA 1CJTB 1N36F 1S1XB 4M94A 1YLXA 2EEYA 3EMTA 1HNWJ 2V2QA 3H20A 4O44A 1C1BA 2V8DA 3I4PA 1WUUA 3FBFA 3ITHA 4PWWA 4B9SA 2AZ1A 5E3QA 1RUSA 2UUWA 5CH7B 2VZ9A 3DCAA 1R8HA 3GYNA 1R7IA 1KOHA 2LLZA 1NSPA 1RU2A 1S6UA 3ULHA 2DCUB 1WKJA 2GA7A 4I2PA 1FJ7A 4USJC 4IFVA 5C24B 4IFYA 1FKOB 4WTYA 1RWKB 4UW2A 2FHOB 2ZOFA 2NSBA 4QU6A 4DL2A 4JI6J 3GG1A 1G3OA 2YWWA 5T41A 2BANB 3H40A 1NU4A 2CNOB 3OXFA 3JSMA 1Q82T 3CO0P 2XMUA 3PM9A 4J9QA 3ET6A 3M2UA 4WIIA 2F4VJ 5G0RB 1HMVA 1SUQA 1QVFR 1NK9A 4HHUA 4DI6A 1RP5A 2PN6A 3BPDA 2CA9A 3BN7A 4LF4F 3OFGA 1RU1A 1OYEA 4NXNJ 1WELA 2C2KB 5D4NA 3FBEA 3I0SA 5B0GA 4EBCA 4JI5J 4LIRA 1HD1A 2V8VA 3UN3A 3N0VA 5FDLB 1KDNA 1VQ5S 2E1CA 1E6VB 3DRPA 1PCAA 1EETB 1X5TA 1L3SA 2GC8A 3W8PA 4YB5A 3FEYB 4YR2A 2VKRA 1FFGB 4ZKAA 4OZ1A 2ZH8A 2FYXA 4NLUA 3HZEA 1J27A 5LT5A 2IA6A 2N3OA 3J81U 4ELVA 4JI7F 1UVIA 1L3KA 2G1HA 2ABYA 3F0NA 1CQNA 3MM7B 4FVMA 4RW7A 4CO2A 4A46A 1FDNA 1ZTWA 2CVIA 1X4FA 2HFVA 3LUYA 4ZVUB 3H5XA 3W5ZA 1WSVA 2DHXA 2V9WA 4QCLA 5KFMA 4ECWA 1AW0A 1EKSA 5DGBA 2XO6A 3MPDA 1HBOB 1WORA 5ETLA 3QQCD 1DZ5A 2GIQA 2OFGX 2VC1A 3BB5A 4RJVA 4DUZJ 2AF6A 1FRXA 1CJTA 4KHPJ 2ZUGA 2OD6A 4C7QA 3HD2A 4WZQA 3TAPA 4OI1A 1IKYA 1KOOA 1WC3A 1C1BB 2PA3A 1NUEA 4O44B 3V6JA 4USWA 1G2EA 3M8YA 2W9AA 1U09A 4G1IA 2RHSB 2EC0A 4FS2A 1DFDA 2I5JA 1R8BA 3NCRA 2CQDA 2BJ8A 4IFYB 1YJ7A 5AXLA 4DU7A 4X64F 4Z37A 3L7OA 4DV6J 5E33A 2MGZB 3OL7A 1HNIA 4BBYA 1U8WA 3JSMB 4P2SA 1X7VA 1HQ2A 3TWZA 1GH8A 2IM3A 3LWLA 4ECRA 5L8RC 4C8NA 3ET6B 1HFEL 4C8MA 1T0TV 2ZVIA 1JLAB 4JI4J 2ZH4A 4K4SA 1SJ1A 3QPIA 4ZDNA 3DLEB 2ZZMA 1LFPA 1SJRA 2DNKA 1NXIA 3CJKA 2MQLA 4C48A 2C3UA 1BD6A 3I9ZA 2N7YA 4WKRA 4DPTA 3C46A 4B9VA 5AXNA 2QA1A 3UNGC 1S99A 4KGVB 4JI7J 2V8HA 2OSRA 4IOAQ 3O6QA 3G6YA 2Y0SD 5M2PA 3MMBA 2DR5A 4P52A 2AV5A 2CYYA 2XNRA 1J5OB 3SSQA 1XQIA 4DV2F 3M32B 4NLOA 1RAGB 3Q86A 4QWDA 2VC0A 3KNAA 3BPSP 1C2PA 3CJTA 3ETMA 3LAMA 1LEOA 1OSCA 2B43A 2IJFA 2KB2A 1VHFA 2AX1A 2ZE2A 3IR7B 3KLIA 3MWBA 4DCOB 5I3QA 1BHNA 3EX7B 1FEEA 2E1RA 2UUCF 2NQPA 3HHNB 4W90B 2RF2A 3TANA 1KLMA 4HVZA 1FERA 2A10A 3MM7A 1PJ7A 3QAEA 1Q78A 4NYZA 2E44A 5D4LA 3MR2A 2P9EA 3DHXA 2DD8S 3KKFA 2IVYA 3NEKA 1NDPA 3EGWB 4I56A 2CIMA 5EDWA 4DSFA 1UVMA 3WDOA 3K57A 2IC3B 1S4FA 2LXIA 2YWGA 1HBOA 4YN3B 5CA5A 2R7VA 3BO4A 1ZAXA 5D4OA 1NZAA 4F2SA 5IQ6A 3M2RB 2CWXA 5KOWA 3AFGA 3R97A 1Q8LA 1VQMS 4QR0A 4UF4A 1PAEX 1UFLA 3CDEA 4JI6F 3V5RA 1FXDA 2XCAA 3J80U 2LEBA 4LFBJ 3C19A 3CCRS 3VAIA 1RJJA 2ZC3A 2BYCA 1GXUA 5IS2A 4KO0B 1ZH5A 1N5TA 2YBVA 2YTCA 4OZ2A 3WIUA 3Q8SB 3AY0A 1VISA 1S7HA 2M2BA 4NI2A 2CQ4A 2IFXA 1RT1A 2XMWA 5HVFA 1X9WA 1NAQA 4PABA 4RU2A 1S1UA 1Q7YT 1HD0A 2KRBA 2MGZA 4JI2F 1VRTA 1HNIB 4X65J 2IRUA 4Q8EA 4WKYA 1XR7A 2DHHA 1S48A 5BYQA 1IQZA 2C2DA 3HVTB 5IWAF 2LQJA 4OJ1A 2SXLA 1JLAA 3IG1A 1NH8A 2F8MA 2JWNA 3D6MB 3DLEA 3EVWA 3UVJB 3EVOA 2RNEA 3NKYA 2BJEA 1H0HB 3DOMA 4ZVHA 3CJKB 4QWCA 3TI0A 2FVRA 4HKQA 2XI3A 4NMXA 3R3TA 1UKUA 3UNYA 2ZBPA 1P6TA 2GNKA 3FUYA 1VIOA 3SDEA 3ZZYA 1X5PA 3MD3A 4A48A 4PG8A 4YHHJ 4CIOA 1FHTA 5CYMA 2IMOA 2D3UA 3BBBA 3D54A 6AT1B 3CC2S 2UVVA 1B7FA 1NPRA 3WC0A 4FKYA 1LXNA 2KL8A 1J5OA 2M0GB 4B9UA 2FZGB 3ISNC 3C16A 3BGLA 2VUGA 2LVWA 4HDGA 2ZOGA 4NA2A 2V69A 5GAEI 4ZIWA 1HW8A 3OXLA 4CO3A 5A76A 4U96A 2GMHA 1MWZA 4C8YA 3GR1A 3RRGA 2VPXB 1SIWB 3U27A 1N52B 5D3GA 2MYFA 1U24A 2FJDB 1KLMB 3BYPA 2P5VA 3EVMA 4N5SA 1D1UA 2GQCA 2ERRA 2DNPA 3V4MA 3AODA 3UFCX 4M5LA 4CTAA 3V6DB 3G6VA 4NMLA 3TOQA 3T41A 4B3RF 4I6AA 2IC3A 3DOLA 4LBPA 5AXKA 4A47A 4KQZA 5JMNA 4ZITA 3Q0AA 1VK8A 4NPOA 1CLFA 2HURA 4L76A 3TJAA 1HNZF 2V67A 2IRXA 1GNKA 2M70A 2LCWA 3M2RA 4OV1A 3R8YA 1AZSB 6FDRA 2J0SD 4C9DA 1TTHB 1OWXA 2KO1A 2MEWA 3MAHA 1KVKA 4G65A 2C3OA 3DLKB 4PYDA 1NLKL 1RHKB 2DBBA 2HQGA 1OPZA 4QWEA 4DFMA 3M6XA 2MB0B 2BE2B 4OFZA 3QBCA 1B7YB 4KO0A 2GHWA 4RUBA 1U2FA 2QL7B 4H4KC 1VQOS 2KFZA 4MT1A 1B64A 1O6XA 2G2OA 4X4NA 5H9FJ 2D1CA 1F2HA 2F5GA 1D9FA 5CD4A 3IMQJ 2GMLA 4MIBA 1I94J 4F4YA 2HIYA 2VBWA 3DU5A 4URQU 5BJRA 4WFNQ 3U02A 3GIIA 3QGGA 1SJ4P 2U1AA 2OKQA 3HVTA 3WX8A 2HS4A 1BWEA 2DY1A 2WB4A 3K17A 1LFWA 4H4MB 1RYRA 2V8PA 3FNNA 3T9ZA 1GQEA 2GJ2A 3MPYA 2RU9A 3UVJA 2VQFJ 4ZK7M 1VLOA 3OVAA 2UV8G 2G0CA 4U7UK 2UXBF 3EE3A 2H54B 2KVIA 2CPYA 5KG2A 4IOBA 3C3LA 3I5CA 4C8KA 4CH7A 3RRKA 2E5LJ 4O3PA 1KONA 4LBIA 5CYMB 1PO6A 1SKRA 4LF4J 2JLEA 2OSQA 2E5JA 3AA9A 2XC9A 5KFZA 2Y1RI 2ZDPA 1D3WA 4M1KA 3SIPB 4MAKA 3P5BP 2QLBB 3VVUA 5ETRA 5DM7Q 4JI1F 2A1BA 2J9CA 1N0UA 3M6VA 4YUDA 3C16B 1QD1A 3NLCA 4CI0B 4ZLJA 3DFEA 2KM8B 1WDDA 2DT9A 2MQQA 1QE1A 3JQKA 4MKYA 8RUCA 2AMCB 1ACMB 2GAGC 3PRDA 4GVBA 4KFBB 2OP5A 3C6UA 1FVQA 2J7UA 3TR5A 2ZC4A 1TK0A 1R43A 2OI2A 2Q6CA 1J5EF 3IWNC 5F8NA 4DV6F 3OHBA 4Y3CA 2X1FA 2GHVC 3N5FA 2HHVA 4MJKA 5L1KA 4JI8J 3SCIE 3KG4A 1RGVA 2ZITA 4RPFA 2MLZA 5E5NA 2ASYA 4ZLLA 3J7ZT 1ZYQA 4RWWA 4ED8A 4OI6A 2MLXA 2Z2ZA 5C2GA 3OJSA 1Y4ZB 1LWEA 2K7JA 3G86A 3IS9B 1RHUB 4J37A 1NCLA 5T7LA 1N0VC 2W2QP 3GV7B 4FF3A 2H51B 2AP6A 3LOUA 1H7WA 4N7TA 4DEZA 1NBEB 2KH9A 1HYSA 3AJ2A 2FLOA 3DLKA 4WPAA 3RAMA 1NK7A 2RH3A 4DUZF 1WF2A 2KI2A 1IVZA 3K89A 5C2CA 1QSYA 4ED5A 3FZBA 2DKOB 4MH8A 1KQSR 5HBMB 1KHWA 3D6FB 2R2UA 2YKNB 3NOGA 1AXQA 2JX2A 2ILZA 3LW5C 4KJIA 3D6TB 1HLWA 2HZCA 3UW1A 3HMJG 3SI8A 1HI0P 5KFJA 1EZZB 2OELA 4LR7A 5C5JA 1LW0B 1YJTA 1SH2A 3JSBA 5FD1A 2FJWA 2JRSA 2K2PA 4X4PA 2BM0A 2EFNA 1HA1A 2CNNB 2HRTA 1GEHA 1VQSA 1N32F 3LGHA 4F4WA 2CPZA 2K06A 2MKYA 3HDSA 5A8WA 2C2EA 4DPYA 4MYUA 1R8PA 4P2MA 4PR6A 4RBTA 4I4BA 2P6SA 5CYJA 4JI0J 3OR1B 4C97A 3O44A 4ZVGA 2CJAA 1GX5A 2WCXA 3SFGA 4W4MA 3U1LA 2VDHA 3N6LA 1AROP 1UTAA 3T9NA 5IZHA 5MLCV 1C1CB 1RHRB 3BSAA 5DLGA 2EG2A 4Q7AA 3JSRA 3BF4A 2ZHAA 1FCAA 1NH7A 3WC2A 1MU2A 2GGPA 3W60A 4YFUA 3GV8B 1BQMA 3CJ2A 1E6YA
chains in the Genus database with same CATH topology
1RWMB 2H5IB 2H48B 4JB8B 4DCPB 3R7SB 3R6GB 2XZDB 1RHKB 2CDRB 2Y1LB 2CNKB 2C1EB 3EDRB 5IC4B 2HBRB 2QL7B 1ICEB 2C2ZB 3KJFB 2XYGB 1SC3B 3GJRB 2C2MB 2CJXB 1F9EB 3KJQB 2FQQB 5K20B 2QLFB 1RWVB 4ZVPB 1QDUB 1I3OB 2H4WB 3R5JB 3GJSB 4DCOB 2C2OB 2H54B 1I51B 4ZVSB 4DCJB 2QL9B 3SIPB 2HBZB 2QLBB 1RWKB 3R7NB 3GJQB 3P4UB 3D6HB 2CNOB 3IBCB 3NS7B 2QLJB 4ZVQB 2HBYB 3QNWB 1RWOB 2C2KB 1RWXB 1RHMB 1RHQB 5IC6B 1RHUB 1NMEB 4ZVOB 3IBFB 4ZVTB 2H51B 1GFWB 2XZTB 1PAUB 3D6MB 1PYOB 1QTNB 2HBQB 2DKOB 2CNLB 3D6FB 3GJTB 2P2CB 1RHJB 2CJYB 2H65B 1RWNB 4ZVRB 4ZVUB 3EDQB 2QL5B 1BMQB 3R6LB 1SC1B 3KJNB 2CNNB 2XYHB 3P45B 1SC4B 3R7BB 4LSZB 2XYPB 2Y0BB 1RWPB 1IBCB 1RWWB 2H5JB 1RHRB 2H4YB 3RJMB 1RE1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RWM B;  2H5I B;  2H48 B;  4JB8 B;  4DCP B;  3R7S B;  3R6G B;  2XZD B;  1RHK B;  2CDR B;  2Y1L B;  2CNK B;  2C1E B;  3EDR B;  5IC4 B;  2HBR B;  2QL7 B;  1ICE B;  2C2Z B;  3KJF B;  2XYG B;  1SC3 B;  3GJR B;  2C2M B;  2CJX B;  1F9E B;  3KJQ B;  2FQQ B;  5K20 B;  2QLF B;  1RWV B;  4ZVP B;  1QDU B;  1I3O B;  2H4W B;  3R5J B;  3GJS B;  4DCO B;  2C2O B;  2H54 B;  1I51 B;  4ZVS B;  4DCJ B;  2QL9 B;  3SIP B;  2HBZ B;  2QLB B;  1RWK B;  3R7N B;  3GJQ B;  3P4U B;  3D6H B;  2CNO B;  3IBC B;  3NS7 B;  2QLJ B;  4ZVQ B;  2HBY B;  3QNW B;  1RWO B;  2C2K B;  1RWX B;  1RHM B;  1RHQ B;  5IC6 B;  1RHU B;  1NME B;  4ZVO B;  3IBF B;  4ZVT B;  2H51 B;  1GFW B;  2XZT B;  1PAU B;  3D6M B;  1PYO B;  1QTN B;  2HBQ B;  2DKO B;  2CNL B;  3D6F B;  3GJT B;  2P2C B;  1RHJ B;  2CJY B;  2H65 B;  1RWN B;  4ZVR B;  4ZVU B;  3EDQ B;  2QL5 B;  1BMQ B;  3R6L B;  1SC1 B;  3KJN B;  2CNN B;  2XYH B;  3P45 B;  1SC4 B;  3R7B B;  4LSZ B;  2XYP B;  2Y0B B;  1RWP B;  1IBC B;  1RWW B;  2H5J B;  1RHR B;  2H4Y B;  3RJM B;  1RE1 B; 
#chains in the Genus database with same CATH topology
 2BQR A;  1PIE A;  1U02 A;  2H48 B;  1T9T A;  1TEL A;  2W4C A;  1Q16 B;  2W01 A;  4GVB B;  4ZN1 A;  1HQU B;  4CLZ A;  3C6U B;  4ZPC A;  3HO1 A;  1REV B;  3PY8 A;  1UPP A;  3PW5 A;  4P7T A;  4BC9 A;  3IGV A;  2DIU A;  1AA1 B;  3V2U C;  1NKE A;  2I0X A;  2MQO A;  4B9M A;  2V63 A;  1X0P A;  2J6U A;  1M1K T;  2F4F A;  2VD3 A;  4HHJ A;  3PX4 A;  4OHW A;  3W5Y A;  4E0D A;  1VRU A;  1VJW A;  3MMC A;  5SUH A;  1S7I A;  1HHS A;  2CJK A;  4QIG A;  2XY7 A;  4YB7 A;  2VQE J;  3BRE A;  4AL5 A;  1KP6 A;  4MYT A;  3ZTP A;  1EQM A;  3OR2 B;  1TV6 B;  2HFS A;  1HNW F;  1HYS B;  2HWT A;  3QWU A;  2CUY A;  1S1W B;  1V3S A;  2YNF A;  5KFA A;  5K20 B;  2JNJ A;  3A8E A;  1TVR A;  3PYE A;  4ZVP B;  5BXI A;  3H5S A;  3TZZ A;  2VPZ B;  2WVD A;  1FE4 A;  2Z57 B;  3N79 A;  4A8Y A;  3GCX P;  3QSY B;  3OW2 R;  2PC6 A;  2B0G A;  4PXD A;  3HVR A;  2XNQ A;  1I51 B;  3MAA A;  4HI1 A;  1FJG F;  2YNG B;  2R9L A;  3OLB A;  3MUM P;  4FYY B;  4ZHR B;  3GWC A;  4PG7 A;  3SCK E;  2AYE A;  3TAQ A;  4RW6 A;  3LA0 A;  5IOL A;  2OMO A;  4ZCM A;  1O8B A;  1YBA A;  1LW0 A;  3FRY A;  2DNY A;  3V6K A;  1Q8I A;  2IBK A;  3UO0 A;  2KXF A;  5LL6 d;  2VG5 A;  1DQ9 A;  3IM8 A;  1OQ6 A;  3OBI A;  3D1O A;  4WP9 A;  2K8G A;  1FNO A;  1SKS A;  4OI0 A;  5A8W B;  1X9M A;  2QLJ B;  1K73 T;  1VCT A;  1NEE A;  1Y5L B;  4NLG A;  2VIC A;  1NJW A;  3M8P B;  2MY7 A;  4Q0B B;  3H90 A;  1RWO B;  3KG1 A;  1SUQ B;  4LIW A;  1R27 B;  1RWX B;  2DYA A;  3L4B C;  1VQY A;  4F7V A;  4RZR A;  1UA1 A;  2DR9 A;  5DLF A;  4F0K A;  3A8I A;  1MU2 B;  1S97 A;  4NXM F;  3DYA B;  4HT7 A;  3BQ0 A;  4B3M F;  4LVN P;  1WI8 A;  2DIS A;  1E6Y B;  2XLJ A;  2IA0 A;  3NWR A;  3WHI A;  4X4S A;  4AFF A;  4DWI A;  3MOJ B;  5CCL A;  1ZM4 A;  4NLR A;  4DQR A;  4A8M P;  1PBA A;  1HQU A;  5J2P B;  3CDU A;  4WFZ A;  5FDL A;  2PEB A;  1E6V A;  1PAU B;  3DRP B;  2W4P A;  2NYH A;  3FEZ A;  1WAC A;  1EET A;  4V19 X;  1Q0N A;  4OYX A;  3W7B A;  2UXD J;  3ZZO A;  4DV1 J;  4KIA A;  2HHU A;  5HSP A;  2NXN A;  3GJT B;  4OYI A;  4M63 A;  4PWU A;  4RNM A;  1X4C A;  2BE9 B;  1VRQ C;  3MMC B;  2BQ3 A;  1IBL J;  4LSL B;  1ZAW A;  2DVI A;  3HHE A;  4OZN A;  1MNE A;  3MHY A;  5HJX A;  1DHM A;  3OR2 A;  4KHM A;  2EK6 A;  4YB1 P;  1SJQ A;  1S6P B;  4PG5 A;  2JEF A;  5HVH A;  1L3U A;  2XYH B;  1M0S A;  2AJ2 A;  3P45 B;  3C66 A;  4X66 J;  4LRE A;  1K8A T;  2OEJ A;  1ZA2 B;  4ER8 A;  2KVQ E;  2WOM A;  4U7C A;  4MFB A;  3ONQ A;  3MAA B;  5ETO A;  4ID5 A;  5M2U A;  1H2V Z;  2YNG A;  1ZAV A;  1VR6 A;  2A0F B;  2OUG A;  1IBC B;  1IKY B;  1RWW B;  4RW6 B;  1KEK A;  5HLF B;  1V3Z A;  1IKW B;  2GVZ A;  1NJX A;  1XIQ A;  3ZTR A;  4CH1 A;  2CVE A;  4ANE A;  3TAR A;  2PFD A;  4RLE A;  5DDR C;  1NDK A;  5A8K A;  2VB6 A;  2PDA A;  1U26 A;  1VI7 A;  3DDI A;  3MDF A;  5KFB A;  2D9O A;  1QM9 A;  1G6B A;  4J90 A;  1SJF A;  5FJ4 A;  2HLU A;  3PYG A;  4I68 A;  2MZJ A;  2JL9 A;  2CDR B;  4OX8 A;  4KH0 B;  3BGR B;  4Q0B A;  4ZCI A;  3ETO A;  5BR8 J;  1RKJ A;  1SL2 A;  4HAC A;  1GX6 A;  4ZA1 A;  4QW8 A;  3W9H A;  4ANC A;  3KDN A;  4DUY J;  4QYR A;  3MZI A;  2HQI A;  4JI1 J;  5HJY A;  2B5J B;  3NGU A;  3E3X A;  2J76 E;  3R9L A;  1T95 A;  1UPM B;  5CHC B;  2DGV A;  2XWY A;  3IRW P;  1XBW A;  1YJ9 S;  4RW4 A;  3CPW R;  4N76 A;  1IWA A;  5HO4 A;  5KFG A;  2C2M B;  2BE7 D;  1SQE A;  4QWA A;  2E7W A;  3QT8 A;  2A2D A;  4KYZ A;  4LR8 A;  3T19 A;  1D09 B;  2WW8 A;  2XG8 A;  3UN5 A;  3L3C A;  5J2P A;  5DS7 A;  3MMB B;  5IWA J;  1S59 A;  2H9Z A;  3PIP Q;  1FT8 A;  4NX9 A;  9RUB A;  2UU9 J;  1AB8 A;  5F8I A;  3M32 A;  2AEM A;  4CLW A;  3R5J B;  1SKW A;  3RZA A;  1A0O B;  3MPV A;  2R7U A;  5KFF A;  1UZD A;  4DCJ B;  3D0I E;  2ZE2 B;  2QE5 A;  1TMJ A;  3KLI B;  3MGJ A;  4F2R A;  1L3V A;  1OIA A;  4J9L A;  3T3F A;  2ZH1 A;  3RTV A;  2YWK A;  2XO7 A;  2GMJ A;  2HBZ B;  3DDK A;  1ULR A;  4L73 A;  2G13 A;  4M5M A;  2XGQ A;  2BJ1 A;  1S6P A;  4DQQ A;  4CO4 A;  3GYX B;  4BHQ A;  1NK6 A;  3PCO B;  2C3P A;  3ENA A;  5KG6 A;  3IBW A;  3I56 S;  2V2K A;  2ZH5 A;  3CSK A;  4CCH A;  4GKJ F;  1RAJ A;  3MPW A;  1FRH A;  2L9W A;  3EYZ A;  1S72 S;  4P7V A;  4A8F A;  3TA0 A;  1Q4R A;  1G7C B;  3PRB A;  3OTO J;  1HNZ J;  4GMK A;  3OTC A;  3QNW B;  3UI3 A;  3VGS A;  1SKU B;  2Z2L A;  3G82 B;  3MTK A;  3PJW A;  2DNH A;  3CCU S;  3N5B A;  1QLN A;  4MKV A;  2VV5 A;  1URR A;  2BAB A;  2XUL A;  4CZC A;  5HN0 A;  1SQF A;  2ZWO A;  1UEK A;  3AOC A;  2LQ5 A;  1FKP A;  2B7B B;  2DNQ A;  3M8Q A;  1S12 A;  4IKA A;  4KC5 A;  4EK2 A;  2W8L A;  2ACM A;  5A2Q U;  1JNZ B;  3MCO A;  3OTB A;  4OYZ A;  3VAM A;  1YJN S;  1S9G B;  1S1U B;  1WG4 A;  1FX4 A;  2EI5 A;  3KG0 A;  4J91 A;  4L6V 3;  4EWT A;  2J7K A;  5LJ3 Y;  1TK5 A;  4NLX A;  2UXC F;  1TFY A;  5KT6 A;  4ENO A;  2NLW A;  3BGR A;  4M5N A;  2W25 A;  4HAC B;  4HH0 A;  3OSP A;  5JUM A;  1S4E A;  2A6M A;  4RNO A;  4M95 A;  2B5J A;  2CNL B;  4YDX A;  1K9M T;  1XNQ J;  1RAI B;  4ERD A;  4DPX A;  5LSR A;  3UE2 A;  2FJX A;  1RT7 B;  1WG5 A;  4RW4 B;  3CCL S;  2ZNZ A;  3BYR A;  3EDQ B;  3SDE B;  1RT4 B;  1RYS A;  1RDR A;  1RKI A;  2M4M A;  3V4I A;  1C4A A;  1SC1 B;  3QFW A;  3KYL A;  1UVN A;  1FXL A;  2C2N A;  2BM1 A;  2RUG A;  3I5A A;  3OUY A;  3Q22 A;  2MKC A;  2FJB B;  1R6Y A;  3MEG B;  4UOG A;  5HMW A;  4PPZ A;  3J81 j;  5IT9 U;  5IT9 Y;  4JI0 F;  2HHW A;  2VPY B;  1SCJ B;  3IXQ A;  3SEO A;  4X62 J;  2FLL A;  5F9L A;  4X65 F;  4JI2 J;  3VCD A;  5CD4 H;  2IBO A;  3MMJ A;  2RRB A;  2R8J A;  4NCB A;  4ICL B;  1RLD A;  2W7P A;  2NS1 B;  4LF5 F;  2CQ1 A;  1NRK A;  2DNR A;  3CCT A;  1DTQ B;  3VAG A;  3KLV A;  4JV5 J;  2NYI A;  1FF2 A;  2PEH A;  2CPE A;  1SBR A;  2Z2M A;  3FEX B;  5KG1 A;  3V6D A;  2NRE A;  5BYR A;  1HNX F;  1P1T A;  1SIZ A;  3HFK A;  2OD4 A;  5B0D A;  1CQM A;  2AGQ A;  1KVJ A;  4M5H A;  2HNY B;  5I42 B;  1T05 B;  3NMR A;  2XZD B;  3HT0 A;  1HWI A;  3ADA C;  3MCM A;  1ZOT A;  2CAD A;  2CNK B;  4O3Q A;  1IR1 A;  3G82 A;  5DQI A;  1VQL S;  3TP2 A;  2DJW A;  4K59 A;  5THW A;  2R7W A;  1Q7L B;  2BE2 A;  4C0O C;  1U7L A;  3D3B J;  4K2X A;  2FPH X;  3WIV A;  1FKP B;  3M8Q B;  4LF8 F;  3MM9 B;  4HTJ A;  3DGP A;  3B8H A;  4B08 A;  3T1Y F;  2HZA A;  1XMO F;  4UQG A;  3OVB A;  2B4P A;  3KJQ B;  3QLH A;  4OL8 A;  1I5O B;  4PPD A;  4CM2 A;  3VAH A;  2A2C A;  3KK1 A;  1GXL A;  1X4D A;  5I3P A;  2N4C A;  1RWV B;  3H0P A;  4DN9 A;  3K5O A;  5DG8 A;  3H59 A;  3AXM A;  4NLY A;  4CRJ A;  3MEC B;  4PEO A;  2OO4 A;  4DV3 J;  4H4M A;  1FKA F;  2HIQ A;  5L9N A;  2J8S A;  4B3O A;  3SSS A;  1FWK A;  2HHP A;  1WNE A;  4UST A;  4F3Q A;  2XQC A;  1P9Y A;  2FIU A;  3SBM A;  4AXJ A;  1XMO J;  2DNL A;  1SXL A;  2ZBI A;  3DRY A;  2AJQ A;  2BMB A;  1JIH A;  3FQL A;  3PNI A;  1RT4 A;  5C42 A;  1CSJ A;  3PG9 A;  2NZC A;  5LSL A;  3NP5 A;  1UWB A;  5B0E A;  5KG0 A;  4DLE A;  1VYA A;  4USU A;  5EHH A;  3M8R A;  3PRV A;  2R3V A;  9ATC B;  3N01 A;  4WYL A;  4YP3 A;  2HZV A;  3MEG A;  2DR6 A;  3GJQ B;  5ETS A;  3BBC A;  2AEJ A;  3D6H B;  4ECV A;  4WXO A;  4ZVF A;  5CYQ B;  3NS7 B;  4ZJL A;  3LQV A;  3R5A A;  2HYI B;  1YZ7 A;  5D0G A;  4F4X A;  1RT5 A;  2W24 A;  4DV0 J;  1QJH A;  3ILI A;  2DRB A;  4TXS A;  4KFB A;  1XNR F;  2CQI A;  1BWV A;  1YBU A;  3A13 A;  4JV5 F;  1SH0 A;  4A8X A;  4JYA F;  3MI7 X;  3HVW A;  1DTQ A;  1IUJ A;  1Q1K A;  1U6F A;  3K2Y A;  5CZV A;  3SMZ A;  3K5M A;  4GO5 X;  1WC0 A;  3T5L A;  1HWU A;  3TW0 A;  2FUG 9;  2WTF A;  1SI9 A;  2W2O P;  3VZH A;  2GO9 A;  2VBX A;  3ZXW A;  5A6P A;  2POK A;  1NND A;  2GHP A;  3IBF B;  5T7L B;  1WEZ A;  3GFZ A;  2XMT A;  1T05 A;  4PG6 A;  3KTQ A;  4FBT A;  4LFC F;  2BJ3 A;  2V94 A;  5IV3 A;  1JXL A;  4KHP F;  2FDN A;  4KGM A;  2YKM B;  1QTN B;  3JAM U;  1KQF B;  2CG4 A;  1H3D A;  4J9O A;  4G6V B;  1YX2 A;  2AU0 A;  3SCL E;  1CJU A;  3M2V A;  1U8S A;  3TVY A;  4F8R A;  4I67 A;  1IM4 A;  2JZ5 A;  3CD0 A;  1B0T A;  3MM9 A;  3QMQ A;  4RBV A;  5J1P A;  4DV2 J;  1LV5 A;  3DGV A;  3QGH A;  1FRK A;  3QLH B;  2HVE A;  2KFY A;  1UW9 A;  2LKZ A;  3KK2 B;  2MDA A;  4DR1 J;  2LDI A;  3KJN B;  1CS4 B;  2HS3 A;  4MIA A;  2HHH F;  4O3S A;  3KK1 B;  5B0B A;  4DR6 J;  1KS2 A;  2XBP A;  4OX9 J;  1MSW D;  3MEC A;  4LFC J;  1SL0 A;  3BSN A;  2V4Q A;  4DX5 A;  2JEI A;  2ZDO A;  4UOF A;  1VC5 A;  4DG1 B;  1VC6 A;  2GQQ A;  2WVC A;  2J8A A;  2W4D A;  3P3D A;  2HHQ A;  2Q43 A;  1SVD A;  3OR1 A;  3F73 A;  4FF2 A;  3KNG A;  4I2Q A;  5C42 B;  2X7I A;  1BY9 A;  2XS5 A;  3LP2 B;  3PDN A;  1UWB B;  2B6A A;  3F41 A;  3BM7 A;  1GAO A;  1PC5 A;  1NB7 A;  2R8I A;  1RT3 B;  2VBZ A;  2F4V F;  3TNV A;  4KKO B;  1MRO B;  2GGP B;  5HQ8 A;  4J7C A;  1S76 D;  4X4U A;  1BQM B;  1WF1 A;  3GON A;  4IH7 A;  2D69 A;  4QIW D;  2HAI A;  5CYQ A;  3OL6 A;  4F0H A;  3ILO A;  2R4F A;  8AT1 B;  3FSY A;  2QIF A;  4ELT A;  1S0V A;  1HHQ A;  2MZR A;  3DRS B;  4FXD A;  1F3V A;  3PO5 A;  1N33 J;  2MXY A;  3T6J A;  1PC4 A;  2XWX A;  2QEX S;  5HL7 Q;  4DR4 J;  2XSJ B;  4TYB A;  4EU0 A;  1JK9 B;  2D41 A;  2HRY A;  2MHN A;  3D1Q A;  2UXD F;  4ECU A;  2JC1 A;  1VRU B;  2D3Z A;  4ED4 A;  1ZPV A;  3CIM A;  2VF3 A;  4F0M A;  5KTQ A;  4XPE A;  1WWH A;  3K59 A;  4O3R A;  4G3I A;  2E9T A;  3U1N A;  2OHD A;  2ALY B;  5B0F A;  4DV3 F;  2GX8 A;  2HQ3 A;  1JQG A;  1Y5N B;  3AAW B;  3CJS A;  5D0H A;  4ZVE A;  2HKE A;  1X8D A;  2BJD A;  2EBG A;  3ZFV A;  1KHV A;  1RTZ A;  4RW8 B;  1S1W A;  2YNF B;  2HGN A;  2H4W B;  1SV5 B;  3VVT A;  3LAN A;  3MUV P;  1TVR B;  5KFL A;  2KM8 C;  1IBM F;  1CJU B;  3M2V B;  3H4B A;  3EXC X;  3IAS 9;  2CDQ A;  1HWL A;  4UOH A;  5EUH A;  2DR7 A;  2KFN A;  3A3N B;  1OQ3 A;  2KJW A;  3U7J A;  4ZHR A;  3RAQ A;  2UVW A;  1RQ0 A;  5IM0 B;  1IQT A;  4NLS A;  5A0Y B;  3BDE A;  4R25 A;  3R1H A;  4QWB A;  3QAU A;  1TKT A;  3MCN A;  4DPU A;  4A8W A;  4JI4 F;  2D7S A;  1FFW B;  2VG5 B;  4KRW A;  4R5P B;  4QYZ K;  4LFA J;  3ZZ0 A;  4DZD A;  3Q8P B;  3O2I A;  4GKK J;  4OJG A;  4O0I A;  2RDI A;  4J9U E;  3C2P A;  4DG1 A;  2MQP A;  1VQ4 S;  2DGQ A;  2WAQ D;  4I0W A;  2Q6B A;  4HH1 A;  5A8R A;  2B4O A;  2QX0 A;  3M8P A;  4AL6 A;  3VTI A;  2PA8 D;  5D0R A;  3LP2 A;  5I4M A;  1XMQ J;  2YKO A;  5B0A A;  4UQT A;  1JLB B;  4LR9 A;  3U1M A;  5KFC A;  1JB0 C;  2DR8 A;  3W64 A;  1MRO A;  4CYU B;  1H38 A;  3W1Y C;  3MXH P;  1EJ7 L;  3DYA A;  2Q66 A;  1FK9 A;  4Y34 A;  5K8O A;  2MKS A;  2NXU A;  4OIX A;  4X66 F;  4CLT A;  2IVM A;  4QBU A;  4PCQ A;  2IAJ B;  2XEX A;  3JS9 A;  3UCZ P;  2AGP A;  1RTD A;  5DET A;  3UQS A;  1VQK S;  2C22 A;  5ETV A;  3EWG A;  3DRS A;  1I6J A;  1XER A;  3BR8 A;  5HAO A;  1BGX T;  2DXE A;  3VAK A;  4EEY A;  3RYL A;  6FD1 A;  1YQH A;  2XMK A;  2E29 A;  2ZHO A;  3TZW A;  5HQL A;  4OYB A;  2JSX A;  4YR0 A;  3R1L A;  1YHQ S;  3RW6 A;  1IBL F;  1BQN B;  2MKH A;  5KFX A;  3ZNJ 1;  3HHK A;  2MQ8 A;  4IH6 A;  4X4Q A;  4FXV A;  1AUD A;  2QL5 B;  3DNC A;  2FHK A;  5F8M A;  3MR6 A;  2XS7 A;  4LSL A;  3R6L B;  5BR8 F;  2V8G A;  3J7Y U;  3HJV A;  3TEG A;  4DV4 F;  2JDJ A;  4OI2 A;  3MPU B;  4I64 A;  1XK8 A;  4FZV A;  4L74 A;  4QYZ J;  4RW8 A;  1YJV A;  2GS8 A;  1SC4 B;  1M5H A;  3C8Y A;  3QJP A;  2F40 A;  2VBY A;  4DFJ A;  1RK8 A;  3MTJ A;  3CMQ A;  3VAJ A;  2XTJ P;  2RAQ A;  2WOM B;  3PHT A;  2LEC A;  4JI5 F;  2QFI A;  4MFB B;  2UUA J;  2EWH A;  2HS0 A;  2CZV C;  4ID5 B;  3B6B A;  5LMU J;  2HHX A;  4USK A;  1KSP A;  2G4B A;  5ETM A;  2HHS A;  4GRS A;  1IKW A;  2GVZ B;  1ZM3 A;  5IM0 A;  4X4O A;  5A0Y A;  2BW7 A;  2QC3 A;  3A12 A;  5LXY A;  2V4J B;  2YX4 A;  1TKT B;  3G96 A;  2DO4 A;  3R5C A;  2DO0 A;  3ILL A;  3R5B A;  3KK3 B;  1VMB A;  3HI9 A;  3R7S B;  5A8K B;  2CZ9 A;  2N3L A;  2F1F A;  5SZT A;  3SYZ A;  3ZC4 A;  2FB0 A;  2M3D A;  3HKZ D;  1KTV A;  4DX8 H;  2A3J A;  4N8N A;  1U1K A;  3BEG B;  1B0V A;  3GMG A;  1S0M A;  4AUK A;  1PSD A;  4JUZ A;  3FSX A;  3OXG A;  2DGU A;  2AW0 A;  2M8H A;  4M5D A;  2B9W A;  3CD5 A;  1RB0 A;  1JLB A;  2J9D E;  3EPG A;  1VQ6 S;  4WK1 A;  1U1Q A;  5KFI A;  2G2Z A;  1KFS A;  4QIE A;  4AXI A;  4H4K A;  3GE9 A;  1F3F A;  1Y5I B;  2Z4P A;  4KGK A;  5GAG U;  3H25 A;  4FPR A;  2QLF B;  3US5 A;  4AD6 A;  3GYG A;  3OHA A;  3GTY X;  3MEK A;  3MEE A;  1I3O B;  1TUV A;  3LGN A;  4D3G A;  3WQP A;  4RUA A;  3BO2 A;  2ASL A;  4UT4 A;  1VBY A;  1EX8 A;  3ZTQ A;  3UR0 A;  3I82 A;  2ZKT A;  4L72 B;  4AL7 A;  3CUL A;  2UXC J;  2HNZ B;  2ZZT A;  4B3T J;  2P9G A;  1BQN A;  8ATC B;  5DZ7 A;  1R0C B;  4R0E A;  1PJ6 A;  2HWH A;  3GU0 A;  2FVP A;  5DDQ C;  1WG1 A;  5E3P A;  1S9F A;  4CLL A;  4K0K F;  4FS1 A;  2NUU G;  1U47 A;  3SCJ E;  2RVJ A;  2XI2 A;  3IRX B;  4FYV B;  2J6T A;  4GKK F;  3DC2 A;  3A3P B;  3PR4 A;  5U47 A;  3TAM A;  4IO1 A;  3TJ9 A;  4KT0 C;  4BC7 A;  5IT0 A;  2FLN A;  1OYD A;  3CVK A;  1NJY A;  1EIY B;  2QLX A;  3EZO A;  3AB4 B;  3NS6 A;  3PHE A;  1N54 B;  2DNZ A;  3ZNU A;  3NY0 A;  3S8S A;  3FRZ A;  1RA7 A;  4DF8 A;  3HX9 A;  2HK2 A;  1V9O A;  4C4W A;  3D0H E;  2AJ0 A;  1RAB B;  3NOC A;  3ZO7 A;  2MMY A;  4K2J A;  3PZP A;  1K1Q A;  3MOZ A;  2AYG A;  1S0N A;  2F63 A;  3AJ1 A;  1B4S A;  4TU8 A;  1B99 A;  3B4M A;  1RZM A;  2HVH A;  1K0T A;  3PYF A;  4XK8 C;  4C8Z A;  1GMW A;  3S1T A;  3FC9 A;  2V4J A;  2EFQ A;  5CXT A;  4ZVO B;  1PG5 B;  3D68 A;  1MG7 A;  1S5Z A;  5F8G A;  4PXB A;  5FLX U;  4ZVT B;  4EO6 A;  3QFH A;  3VV2 B;  2DNO A;  4OX7 A;  4Z7C A;  3E8O A;  4ID8 A;  1KN6 A;  1S9G A;  2Z2Y B;  1U1P A;  1D0E A;  4AND A;  2NXE A;  2B51 A;  1NJI T;  1T94 A;  1FWP A;  4I6Y A;  2JHE A;  3DU6 A;  4EO8 A;  4URG A;  5CQG A;  5GVQ A;  4PXC A;  3TVZ A;  1UL3 A;  2ROE A;  4M5D B;  1VBK A;  2DNM A;  2HND B;  2OEK A;  1WOO A;  2YY3 A;  2WW4 A;  3BBF A;  5GAE U;  1RWN B;  3J7Z 5;  1GMV A;  5D4P A;  3W9J A;  3KUH A;  3MR3 A;  4ILM A;  1N33 F;  2QMX A;  3DRX A;  2EFG A;  3QWP A;  4ZPB A;  5DG9 A;  1MWQ A;  1RT7 A;  3CJQ A;  5DGA A;  3M9M B;  1UW4 A;  4DV1 F;  1LK7 A;  2HQC A;  4RWX A;  3UCU P;  4RL1 A;  1M5O C;  4E8U A;  1RCX B;  4A8Q A;  3V4I B;  3J7A 1;  1XN9 A;  1Y00 A;  3CJ3 A;  2HQD A;  1FEH A;  3MEE B;  1K47 A;  3OUY B;  5EWF A;  2ZKU A;  2B9Y A;  3JQM A;  5F0W A;  4P9S A;  3M4X A;  2BOP A;  2E9R X;  1WKL A;  4M5I A;  3W3S A;  5H9E K;  2YNI B;  4OLP A;  4DMZ A;  5DQH A;  3O1L A;  2F7V A;  3OTE A;  5G4D A;  2L9N A;  5KFY A;  3TUZ C;  3VAF A;  2J0Q D;  4QU7 A;  1S10 A;  1UFW A;  2JVO A;  2LXU A;  2BRL A;  4ICL A;  1WSR A;  2H4Y B;  2HFO A;  3FVY A;  1TKX A;  3BN4 A;  2CQC A;  3NG8 A;  3IRX A;  4N56 A;  2W7A A;  1J5E J;  1APS A;  2BW2 A;  3I31 A;  4JB8 B;  3D66 A;  1TP7 A;  1HWJ A;  4NLP A;  3RB6 A;  2M9K A;  1NKB A;  4X2B A;  4DS5 A;  2RT3 A;  4C3K A;  2E7V A;  1FTC A;  1N56 A;  4IG3 B;  2GJI A;  3HHL C;  2DRD A;  2UVU A;  2HNY A;  5I42 A;  2QZ8 A;  2V2Z A;  2X1G A;  3I0R B;  3PXG a;  3I9V 9;  4DDF A;  2GO8 A;  3PKM A;  2XYG B;  3M1V A;  4MK7 A;  2VDI A;  3QT6 A;  2B3T B;  2I2Y A;  4KSE B;  2JH3 A;  2XMV A;  1JJ2 R;  4F4A A;  4XAK A;  4JV2 A;  1M90 T;  2PFF B;  1Q8K A;  4XO0 A;  5AXM A;  3D3C J;  4YB6 A;  3M9O B;  1DAX A;  2QA2 A;  3DGP B;  4GC7 A;  2NUH A;  1N8R T;  3GB0 A;  2XMM A;  5D6G A;  4QPT A;  2E9Z A;  1BC6 A;  4N47 A;  2VFU A;  1KC8 T;  4B9N A;  4OYO A;  4EGL A;  5J1E A;  3FFI A;  2G1D A;  2FC9 A;  1F6T A;  3O8W A;  4TNO A;  4PG4 A;  2VHG A;  1LNQ A;  2LMI A;  4ITS A;  2OFH X;  1P8G A;  2E7X A;  1WD6 A;  3N6N A;  2CJ9 A;  5KG3 A;  3MFH A;  4L3K A;  2FY8 A;  4U8V A;  4WIQ A;  3QT7 A;  2IDE A;  1W2I A;  4FPI A;  4L75 A;  1Y3J A;  1F60 B;  2FHJ D;  3P5T L;  2AJ1 A;  2V9K A;  3TEH B;  2ASJ A;  2QL9 B;  1RCO B;  2KT3 A;  4KGZ B;  3BGO P;  4KHR A;  1WOP A;  2RIL A;  4L3N A;  4NRT A;  4TY9 A;  4ECY A;  2UUT A;  4C11 B;  2VOP A;  3OFH A;  3Q23 A;  3T1H F;  1G4C A;  4LF2 A;  4ES2 A;  4YME A;  1JLG A;  2AJ4 A;  2L48 A;  3G6E S;  2R7X A;  3NXZ A;  3JTO A;  2DHA A;  1JXE A;  4OZJ A;  2B9E A;  2CAJ A;  2HG4 A;  3UD5 A;  4LFA F;  1OPI A;  2YX7 A;  1F5B A;  4FYD A;  2PI5 A;  2Y8Y A;  3SQO P;  2QT7 A;  2BUN A;  1AUS L;  2ADB A;  2YNI A;  1VGY A;  3LF0 A;  4H4O B;  3KOA A;  1Q81 T;  4Y6I A;  2QFJ A;  2RS2 A;  1XMB A;  3GIJ A;  2EVZ A;  1RT5 B;  3T5K A;  5EN1 A;  1GMW D;  3IA0 A;  3ZZP A;  4DV7 F;  1VOM A;  2LQB A;  4WZM A;  2UUA F;  2DY9 A;  2PI4 A;  1TKX B;  3JTP A;  2UXB J;  3R2D J;  4HR2 A;  2HLT A;  1OY6 A;  3NRB A;  1YSJ A;  4ED6 A;  2EFV A;  1S77 D;  1GFW B;  3B4D A;  3CJ0 A;  2IM2 A;  4CNZ A;  5IXU A;  3KHH A;  4ECS A;  5DG7 A;  5HP1 B;  3RR8 A;  2XB2 D;  2HBQ B;  1HQE B;  1QSL A;  1VJQ A;  1R89 A;  3FCV A;  2YKM A;  1TUW A;  2IPO B;  3M1V B;  3PW7 A;  2M7S A;  4B17 A;  2WHO A;  3GIM A;  1CG2 A;  2D74 B;  1XWL A;  2L3M A;  3PIO Q;  3G4S S;  2WSC C;  4O4R A;  1CPZ A;  3HFZ B;  3D2W A;  1T9W A;  3UDV A;  5CAA A;  3CCZ A;  1NJZ A;  5HAN A;  3VAL A;  3ILJ A;  2X1A A;  3MR7 A;  4FYX B;  1CEZ A;  1N5V A;  4ZPT R;  5AJ3 J;  3KK2 A;  2MKK A;  1YBT A;  3VF0 B;  3OV7 A;  2J6S A;  5J1E B;  3FFI B;  1CS4 A;  4P74 A;  5CAB A;  1YDL A;  3D0G E;  4DHV A;  3R7B B;  2FJE B;  1HNX J;  3D1H A;  2BX6 A;  1KFD A;  1XR6 A;  2GCF A;  2ILY A;  2Y0B B;  1ZET A;  1YJU A;  1UEU A;  4DR3 F;  4UY8 T;  2LXF A;  3S7R A;  4KPY A;  1RBO B;  4GVL A;  4NLQ A;  1SH3 A;  1TMM A;  2CZ4 A;  3PTW A;  4DR3 J;  4JI8 F;  2CJB A;  2ATC B;  3FMB A;  1JLG B;  1LWC B;  4I2Q B;  4PQA A;  3OT9 A;  3CF5 Q;  2FVQ A;  2GIF A;  2CJQ A;  3ZZT A;  1C4C A;  3NGS A;  2XGP A;  2B6A B;  4Q2M A;  4DCP B;  2AT1 B;  3LWM A;  4EBE A;  2M5Y A;  1IXK A;  1BUX A;  1FDD A;  1T9X A;  1RT3 A;  5GAH U;  3Q2S C;  4KKO A;  3ZZU A;  1DJ0 A;  3E2E A;  4JBC A;  3TYT A;  4ZS6 A;  1RTH B;  4I69 A;  4CM0 A;  4DL4 A;  1C0T B;  1QUP A;  4H4O A;  2U2F A;  3EDR B;  2HMI B;  3CCJ S;  3KJF B;  1FRM A;  5GAG I;  1DUR A;  4OZ3 A;  1TL5 A;  1UZH A;  1D9A A;  3CDB A;  2CPD A;  4DL7 A;  3M6U A;  1A6L A;  3A3O B;  2E5L F;  3IO1 A;  2H3E B;  1MN9 A;  2ROG A;  3QIP B;  4DQI A;  1LWF A;  2OPR B;  1BQX A;  2AHO B;  2B8Q A;  2EKY A;  2BKO A;  2XSJ A;  4X84 A;  4ATN A;  2D3O R;  2YH1 A;  3BZQ A;  4RU9 A;  3RW7 A;  2FQQ B;  5FII A;  4QIV A;  5HP1 A;  3GIK A;  4K7Q A;  2YQ3 A;  3VGT A;  2Y1J A;  2PII A;  1HQE A;  1QDU B;  4LRC A;  1H2T Z;  1X4E A;  3K58 A;  3TQ1 A;  2R7T A;  4C0H A;  3ZTO A;  2O1P A;  1GK8 A;  4LVO P;  1WJ9 A;  3MM5 B;  4MTP A;  5ETN A;  4ZVS B;  1IJE B;  1HI1 A;  1SV5 A;  3HSZ A;  3VGU A;  1FNX H;  1TL4 A;  2VFV A;  1H98 A;  1O51 A;  1REG X;  4OYP A;  3OTD A;  4ECZ A;  1LOU A;  1XNR J;  1Y11 A;  4O4G A;  5D15 A;  5DQG A;  1KVI A;  4LFB F;  3NBP A;  5D77 A;  5EWG A;  3RBD A;  1XJW B;  4WU2 A;  4F3M A;  3PX0 A;  2W2N P;  2QSW A;  2MST A;  4H54 A;  2IYI A;  4U95 A;  3CTR A;  2KJV A;  2KG0 A;  3BQ2 A;  1U48 A;  4NCG A;  4F4Z A;  3HLU A;  3ZZR A;  3J80 Y;  4R5P A;  4KV8 A;  1G1X A;  1RI7 A;  2GW8 A;  3DI6 A;  2CQG A;  5IV4 A;  1YWX A;  3JAM Y;  1IR2 A;  1MW7 A;  1AYE A;  3BKF A;  4HL9 A;  3AH6 A;  3L7P A;  2DEI A;  4P2X A;  1RAD B;  2QTW A;  1WHV A;  2WB1 D;  5L1I A;  3BGU A;  4OYW A;  1VBX A;  2FVC A;  2OJ3 A;  1WI6 A;  2MSS A;  3DHW C;  2AWZ A;  5A8R B;  1LQ9 A;  4PWD A;  1U6Z A;  1LWC A;  2B4U A;  3NAH A;  4RUH A;  2ZJR Q;  1LK5 A;  3AB2 B;  4Z7Y A;  1PGZ A;  1ZM2 A;  1FX2 A;  4YDD B;  3HSG A;  2MQM A;  4ZN3 A;  4DL6 A;  5C7P A;  1YIT S;  5JVG Q;  4ZMM A;  1FJC A;  1LWX A;  3A1Y G;  2NPF A;  1U2C A;  4CYU A;  4X4R A;  2KT5 A;  2VKZ G;  3THV A;  1FK9 B;  2YX1 A;  3HJF A;  1AFI A;  3CCQ S;  3S01 A;  2M88 A;  2DHS A;  2YPZ A;  1T9V A;  3KHR A;  1SL1 A;  2HHH J;  3NNA A;  2UV8 A;  2QGF B;  3TZX A;  2HMI A;  3P49 B;  2IAJ A;  2BBE A;  5F9N A;  1TKZ A;  5F8H A;  3T1Y J;  1RTD B;  2DRA A;  4RR5 A;  2RQK A;  5F3T A;  4FYW B;  4LF8 J;  3TA2 A;  2J0W A;  2DNN A;  4OLO A;  3VHQ A;  3OL8 A;  2CJY B;  1LWF B;  2OPR A;  3POT B;  2ZBC A;  4TU7 A;  4CP5 A;  5HMY A;  3B78 A;  1Q8B A;  5ADZ A;  1YRU A;  4B9L A;  2HQF A;  2V5H G;  3AQP A;  4DBQ A;  2QYG A;  4NEZ A;  5H1S V;  1U1R A;  1OO0 B;  3IWX A;  2R2T A;  4CWB A;  3Q8Y A;  4W98 A;  3H42 A;  3PEH A;  3VQS A;  3OVS A;  2EBE A;  5F0U A;  3HT3 A;  4EZ9 A;  5D0E A;  2QJ3 A;  5IFM A;  4Y2A A;  4DPO A;  4JI3 J;  5LXR A;  1CVJ A;  1F5A A;  2V6A A;  1OSD A;  3QSI A;  2BJ7 A;  2I38 A;  4YR3 A;  3PW2 A;  4R0J A;  1IM6 A;  1CC7 A;  3RAX A;  1DLO A;  3VGV A;  2VOO A;  5K8M A;  1I1G A;  3MUR P;  4DV7 J;  5KT5 A;  3MM6 B;  2E5H A;  4DSE A;  4CO1 A;  4AT1 B;  1BXN A;  2ZZN A;  1KQK A;  1NKC A;  1JLC A;  3OL9 A;  1ZBT A;  3N9U C;  2KZZ A;  2K1R A;  2K3K A;  5K14 A;  5KFR A;  3AT1 B;  3KDO A;  4DL0 C;  1RWM B;  1HI8 A;  1SQG A;  4X62 F;  5J2Q B;  3QRP A;  4CNY A;  4NCG B;  3KK3 A;  4HI2 A;  2JLF A;  2Q79 A;  4K4V A;  3NS5 A;  1HKA A;  4GKJ J;  2R8K A;  3VR1 A;  2MJN A;  5F41 A;  4FVC A;  4RX6 A;  1QAI A;  4W92 B;  2W7O A;  1S0O A;  5EGY A;  1T03 A;  1O5J A;  2C2Z B;  2CQH A;  2MHE A;  3HHL B;  3JTN A;  4WTO B;  4C8O A;  4J5O A;  4IUF A;  4XDD A;  2WK4 A;  4RW9 A;  1AFJ A;  2DXF A;  2YVS A;  4C6A A;  3W62 A;  2IY5 B;  2X51 A;  3DLG A;  5F8L A;  4B3S F;  3EM1 A;  3IFE A;  3W63 A;  4IR1 A;  4WU3 A;  5K8N A;  5L46 A;  1TR0 A;  3FMW A;  4J9N A;  2HVI A;  4URS A;  2OLW A;  4C3M A;  4ZP7 A;  4RNF A;  2H1Y A;  2MKI A;  2C2O B;  5LM7 E;  1TKZ B;  2AIR B;  1UVJ A;  3KMS A;  4P72 A;  2MLY A;  3LP0 B;  4OHV A;  2GZO A;  2VJV A;  3NNH A;  2VG7 A;  1UA0 A;  1Z4U A;  2R2R A;  4DV5 F;  1JMT A;  4K4W A;  1FJE B;  5GAD I;  2HNZ A;  4U8Y A;  4O0N A;  2N82 B;  5A2Q Y;  5A6W A;  1SJ3 P;  1MMD A;  3CED A;  2DIT A;  5HQM A;  3MM8 B;  4F50 A;  1Q86 T;  4LF9 J;  2KDO A;  2LFV A;  3KLG A;  3MR5 A;  3H8Y A;  3CE8 A;  4QR1 A;  4WFA Q;  4OV6 A;  1RAO A;  4B3O B;  2C2R A;  2BZ2 A;  2VPW B;  4J9P A;  4O3N A;  5LSO A;  1JX4 A;  3TAM B;  1FTR A;  1HW9 A;  1Q79 A;  1Y7P A;  4F25 A;  3T1H J;  2NXJ A;  2ROP A;  4I7F A;  4TY8 A;  4OQJ A;  3HM9 A;  2UUB J;  1DLO B;  1U1M A;  1R31 A;  1WC4 A;  5EX0 A;  4QQB A;  3TX8 A;  2AZ3 A;  2BA9 A;  4XDC A;  1JLC B;  2K1R B;  2LEA A;  3QZ8 A;  3RGI A;  1WDT A;  5K14 B;  4WFY A;  3A4T A;  4PYA A;  1NME B;  3BJY A;  2P6T A;  4MKA A;  2IMW P;  2B56 A;  2MJU A;  1SPB P;  2DNG A;  4PUO A;  3HSD A;  4ED0 A;  2MZQ A;  5HMX A;  2GJF A;  5LMN F;  2XZT B;  4D3H A;  2B7C B;  4NL5 A;  3KHG A;  3EZ5 A;  2VFS A;  3LH2 S;  4C98 A;  4FNI A;  4LQ3 A;  1S9E B;  3UDC A;  1T03 B;  3H4D A;  3C15 B;  3UR3 C;  1DQ8 A;  4YY3 F;  2VA2 A;  4YQW A;  5D8H B;  3HCX A;  4ILR A;  1W2B R;  1FRL A;  1QAY A;  3FJ2 A;  3W65 A;  3FQK A;  2P8I A;  1TZ0 A;  4OHY A;  2F65 A;  2IDL A;  1IKX B;  1X4G A;  4LF1 A;  4NZ0 A;  4ZVR B;  2HND A;  5KG5 A;  1N34 F;  1M5V C;  1U6B A;  1YI2 S;  2KZM A;  4DR2 F;  3Q24 A;  3FGV A;  1S6O A;  2LU1 A;  4NCA A;  1T3N A;  1HBU A;  2PMW A;  4Y2C A;  4AQY J;  2Q1L A;  4LBH A;  2X3D A;  2XMA A;  4IRK A;  2Z58 B;  4PKD B;  2Z8Q A;  3RB4 A;  3GG0 A;  4DL5 A;  4EBD A;  4UZB A;  3CC7 S;  5T14 A;  4EZ6 A;  3LP0 A;  2QV6 A;  5HRO A;  3GSD A;  3OQ2 A;  1ZZN A;  1XEZ A;  2VG7 B;  5IQQ A;  5LMU F;  4Q43 A;  2H5J B;  5HK4 A;  3RUB L;  4RUC A;  3QID A;  2OIH A;  3VQT A;  3CNQ P;  4CO0 A;  4UOC A;  1JLE B;  2CPF A;  2W2P P;  4KAI A;  2KHC A;  1JNR B;  4WJB A;  1RE1 B;  4AYB D;  1MWY A;  2YWF A;  1WHY A;  3PJX A;  4UUW A;  4CT8 A;  4Q5V A;  3OTO F;  1VC0 A;  1W25 A;  4DLG A;  2CQ3 A;  1U1N A;  1P27 B;  1B3T A;  4NWB A;  1X60 A;  2LQ9 A;  3LPY A;  5B7W A;  4NYP A;  3F44 A;  2HK3 A;  2OH2 A;  1VQ8 S;  2AKW B;  2N4D A;  1NK8 A;  2Y1L B;  3NCQ A;  1IKV B;  4HT5 A;  1NSK L;  1IBK J;  4IG3 A;  2LQ8 A;  5J2M A;  3I0R A;  2IJR A;  1R3N A;  4WK3 A;  2R7O A;  3LP1 A;  4ZLP A;  1HL6 A;  1FFS B;  3K7R A;  4LRD A;  4YY3 J;  2B4V A;  4TQS A;  2F8H A;  3G8T A;  4BWJ A;  3CUN A;  4XPC A;  1TL3 B;  3FBC A;  5KFH A;  1H73 A;  5DO2 A;  2DK2 A;  1U49 A;  4LF6 J;  2EW9 A;  1U2R A;  4FXW A;  2JOQ A;  1TFW A;  2F8E X;  4PAA A;  3CW2 C;  2EC2 A;  2IVF B;  4DFK A;  3OJU A;  2RKI B;  3R5D A;  2VFR A;  4B3M J;  3EJM A;  1FI4 A;  4RO0 A;  3X3U A;  1DQA A;  4CH0 S;  3TQE A;  3HP6 A;  1RAF B;  1XMQ F;  4K4Z A;  2QA4 S;  2KXH A;  1CUL A;  1H6K X;  3D5M A;  1IKX A;  2KYX A;  3BDP A;  1SB6 A;  3MMA A;  2MPU A;  3GIR A;  2W9C B;  1N6Q A;  4KPC A;  4E98 A;  3GPA A;  1HBU B;  2JJ4 D;  1PJ5 A;  5D78 A;  4C11 A;  4ED7 A;  3Q8U A;  3R7N B;  1FRI A;  2CPI A;  2V34 A;  3VWS A;  4C0B A;  4EFA C;  3J7A N;  4DR7 J;  5DZ6 A;  4P73 A;  1MLA A;  1T02 A;  3V81 A;  5JJB A;  4DR7 F;  2XY6 A;  4PRF A;  1O0P A;  4Y28 C;  2ZH3 A;  4DPW A;  2BVZ A;  3BKT A;  5KFK A;  2ZHB A;  1LKZ A;  1T9Y A;  4DX6 A;  5HRO B;  1XC9 A;  2WSF C;  4JV1 A;  1RIS A;  1P1L A;  2HBY B;  3F56 A;  3GLJ A;  4M5K A;  3QZ7 A;  3M8S A;  4HYK A;  1TUG B;  3CJR A;  1PKU A;  2B9X A;  3Q83 A;  1JLE A;  2RQC A;  3MUT P;  2XM3 A;  2J9D A;  1NPK A;  3T1A A;  1NZ8 A;  4OYA A;  4A8O A;  2ZH9 A;  1FJG J;  3HXM A;  1H72 C;  4ZIV A;  1Z1Z A;  4A8K A;  5KFD A;  2XMJ A;  3M05 A;  3JYT A;  3UDE A;  1HHT P;  2F9D A;  3KXD A;  1JLF A;  1GMU A;  4N8O A;  4Q45 A;  1IKV A;  4F67 A;  2I8E A;  2YXL A;  3NMA A;  5J2M B;  4DR2 J;  3D7S B;  3PFO A;  4KBI A;  5KFT A;  2BDP A;  3LP1 B;  1FES A;  1L5U A;  3TO8 A;  1QAX A;  2J7W A;  3OSN A;  5B09 A;  1C0U A;  1TL3 A;  2RRN A;  1NM2 A;  2O67 A;  2MZT A;  3CMA S;  3NL0 A;  4QR2 A;  2XSF A;  2LP4 A;  3BV8 A;  3HSJ A;  1QSS A;  2R7Q A;  3Q8R B;  2EK1 A;  3W66 A;  5K8P A;  4G1Q A;  4Q8F A;  1WEY A;  5KFV A;  2RKI A;  4LSZ B;  1YTY A;  1W7W A;  2NCK L;  3QAT A;  4IDK A;  2IYG A;  3H5U A;  4HTI A;  4MMO A;  3BO3 A;  2BKN A;  4Y00 A;  1CUL B;  2VON A;  1JKH A;  3CJ8 A;  2QRR A;  1YVF A;  3G2X A;  1VDH A;  3PR5 B;  2BR0 A;  3PVX A;  3TA1 A;  4XIU A;  1SC6 A;  2W9C A;  3M6W A;  4WCE Q;  1N6Q B;  2UVR A;  3H2V E;  4JI3 F;  3RJM B;  2YH0 A;  3M9N B;  4XTT A;  4WE1 A;  2APO A;  1Y0H A;  3G87 A;  4USM A;  5KT7 A;  4DXL A;  5F3Z A;  5KAK A;  4UUX A;  1CC8 A;  1RAH B;  5L38 A;  5KFQ A;  2DPJ A;  1X5O A;  1TKD A;  2RSQ A;  3MAQ A;  4P10 A;  4C8L A;  3ICL A;  2O66 A;  3FSI A;  2EG1 A;  2NR0 A;  4DR1 F;  1L3T A;  3K5N A;  2OTL S;  4Z2X A;  2L08 A;  1HWK A;  5IC4 B;  1IJF B;  1RTH A;  1ICE B;  4P2F A;  2JLG A;  1C0T A;  1JJ4 A;  2HGL A;  1T11 A;  1X31 C;  1UAW A;  4N41 A;  2PO4 A;  2EFP A;  2PSZ A;  3BR9 A;  1URN A;  5ETP A;  4CO5 A;  1UEV A;  3CB4 A;  3GP9 A;  4K4T A;  2CJX B;  1YG0 A;  1XTZ A;  2ZOM A;  3HPO A;  1BE4 A;  2UP1 A;  3QIP A;  4FF4 A;  1FO1 A;  1B0P A;  4Q44 A;  3N6M A;  3SV3 A;  2XLI A;  4KTQ A;  4ED3 A;  3W61 A;  2DGT A;  2OPQ B;  2KYZ A;  3UPF A;  2FZC B;  4LF6 F;  1RWU A;  4Y2K A;  3R5G A;  1RBL A;  5K5M A;  5GME A;  4USH A;  3L09 A;  3UD3 P;  2HW3 A;  1RTI B;  4CLK A;  2XLK A;  3MM5 A;  1C0U B;  4R8U A;  3KLF A;  3CME S;  4USV A;  3HK2 A;  4OHX A;  2BKP A;  2HVZ A;  2LYV A;  2A18 A;  5HAT A;  4EYH B;  2UUB F;  3G8S A;  1IBK F;  1QAJ A;  4O4G B;  4Y0F A;  2WBM A;  3P4U B;  1MN7 A;  2JFK A;  3Q89 A;  3NBP B;  4G1Q B;  1TL7 B;  4QOT A;  3IBC B;  4ZP6 A;  2VA3 A;  1VIX A;  2PMH A;  1JLQ B;  2RML A;  3AOB A;  3W2W B;  1V6H A;  2FTR A;  2G2Y A;  4M8L A;  1F2G A;  1T3O A;  1TQL A;  4FKX A;  1U45 A;  2Y8W A;  1D8Y A;  3W5X A;  3FBB A;  4IYQ A;  3QO9 B;  3LTO A;  2ZWP A;  4KV8 B;  3RU0 A;  4IR9 A;  4LRB A;  3DOK B;  2DTJ A;  2BAC A;  3DI6 B;  2RIJ A;  4DV5 J;  1EB0 A;  4IO9 Q;  4DQS A;  2YNH A;  1OMS A;  2FHM A;  3QJL A;  3KUE A;  2FVS A;  1YK9 A;  2KTQ A;  4QJV A;  3KLH A;  3BGF A;  3FKB A;  3H2U B;  5IC6 B;  2AYB A;  3PYD A;  1WHW A;  4LQ9 A;  2HFU A;  2E1P A;  2VL1 A;  1YRT A;  4KE5 A;  4OI4 A;  2E1A A;  4WXW A;  5KT4 A;  2R8H A;  4PWD B;  2VQF F;  2FZK B;  4HHH A;  5KFU A;  3MF5 A;  2M52 A;  4EMD A;  1A9N B;  2JC0 A;  3FZ2 A;  4OX9 F;  2YKA A;  1WHX A;  1VLY A;  2QLW A;  4J9S A;  2QMW A;  2ZEJ A;  2EKN A;  1RTJ A;  4K4X A;  3CXC R;  4PQU A;  4RKU C;  1CBK A;  1X5S A;  1PYS B;  3HHD A;  2H5E A;  4S0M A;  3C6T B;  3WX4 A;  3I6P A;  4LMZ A;  3FK4 A;  3EPI A;  2H65 B;  2MZ1 A;  1WF0 A;  4FP9 A;  3M30 A;  4NLD A;  2OML A;  2FGO A;  3NAI A;  3KMQ A;  4NZ7 A;  5KG7 A;  4ZCK A;  2C28 A;  3EGV A;  4ZCL A;  4DSI A;  3ENQ A;  2OPP A;  3CO9 A;  2AX0 A;  3POT A;  4MK8 A;  5M2R A;  1H74 A;  1H7X A;  3V6H A;  5J2N B;  3B54 A;  2YKP A;  2DXD A;  1U0H A;  5IT4 A;  4LUB A;  5GAD U;  5LMN J;  1YJW S;  2OPQ A;  2HVD A;  3FCH A;  4DUT A;  5I3U A;  1RT6 A;  1UET A;  2KN4 A;  4CLS A;  2XHW A;  1TU0 B;  3UD4 P;  4HEA 9;  4DFP A;  1RTI A;  4WF9 Q;  1DY3 A;  4WP8 A;  4MIW A;  3KLF B;  3J81 Y;  1S1V B;  5C25 A;  2OTJ S;  4P71 A;  3LAL A;  3DLH A;  2OPS A;  1YIJ S;  4X4T A;  2VG6 A;  4B3S J;  2DGO A;  3MM6 A;  1NK4 A;  3DM2 B;  2ZJP Q;  3K5P A;  3SQG A;  3PFE A;  4GC6 A;  4YOE A;  3L95 X;  2V4R A;  2H5I B;  5E41 A;  3DMJ B;  3DLB A;  1TL7 A;  3H2L A;  3DDN A;  1QTM A;  3IP0 A;  1Q5Y A;  3O5T B;  3W2W A;  3T5J A;  4DR6 F;  3DXS X;  5AE2 A;  2OGU A;  3CWJ A;  3HZG A;  1M1G A;  1BLU A;  4OZ0 A;  5ETT A;  5ETK A;  5BYS A;  5J2Q A;  1N4L A;  1HNV B;  2RHQ B;  4WFB Q;  1KBR A;  3QO9 A;  4FN5 A;  3D4J A;  3G71 S;  3TUJ C;  4DF4 A;  1EHW A;  3I87 A;  1IBM J;  3ENV A;  2WSE C;  1OY9 A;  1N5Q A;  1SC3 B;  2YNH B;  4KR0 B;  5B0C A;  3QJJ A;  2G9O A;  2FJV A;  4V19 J;  3B82 A;  5FLX Y;  3HHL A;  4CT9 A;  3EUN A;  2R2S A;  4LF7 F;  3TJ8 A;  4U7U D;  3DN9 A;  1F9E B;  3OPK A;  1QUV A;  1R8C A;  4RW9 B;  3DLL Q;  1X4H A;  2UUC J;  1Q95 G;  2HRU A;  3M8Z A;  1EP4 B;  3GFH A;  4TQR A;  3AQO A;  4X4V A;  3K8W A;  1WTF A;  3DLG B;  1FDA A;  2ZVS A;  1S1X A;  2N7C A;  5AT1 B;  1X4B A;  1U4B A;  1LXJ A;  1KWM A;  5KT3 A;  2QO3 A;  2J5A A;  1JJH A;  1M5S A;  2GAH C;  3GJS B;  4DN0 A;  1DTT A;  2C42 A;  4PQU B;  2O5D A;  3SSR A;  3C6T A;  3ELH A;  3ISZ A;  1I94 F;  4LF7 J;  4I2P B;  2KHD A;  2DH9 A;  2RQ4 A;  2XCP A;  3A8K A;  2PGC A;  3LPE A;  4IFV B;  5C24 A;  2DCL A;  3TX0 A;  4ZPW R;  4ALZ A;  1VQ7 S;  3I96 A;  4NXN F;  1M5P C;  2RU3 A;  1PYT A;  4LSN B;  1YZ6 A;  2B8P A;  3GCW P;  1DAR A;  2ZFH A;  3AOA A;  1RLC L;  2OPP B;  3FDS A;  4LRF A;  1MML A;  3QRQ A;  2ZH7 A;  2JVR A;  3HD1 A;  2VAS A;  4ECX A;  5J2N A;  2XS2 A;  3CIZ A;  1PBU A;  2Y1I A;  3MM8 A;  3VZI A;  5ETQ A;  2QG9 B;  3M2U B;  4P75 A;  5LOQ A;  3J7Y I;  3N4W A;  5L9X A;  5G0R A;  3W9I A;  3KLG B;  1NDL A;  4M5J A;  1M1H A;  3L7U A;  5I3U B;  1WC6 A;  2D9P A;  1RA6 A;  2G0I A;  1WC1 A;  4DOZ A;  2JFD A;  1KLN A;  4X64 J;  2WVE A;  2RE1 A;  2ZNY A;  3I32 A;  3I0S B;  4MKB A;  4BLG A;  4I7F B;  3LGM A;  2HSE B;  3AD9 C;  3EGN A;  4OI3 A;  4TY8 B;  1ZM9 A;  3CDW A;  4HLB A;  4WYW A;  5HVG A;  2VJU A;  1DRZ A;  4LF5 J;  2CPH A;  2AEF A;  1UJ5 A;  1KKH A;  3DM2 A;  3SXL A;  4RNH A;  3BSO A;  3SQG B;  4ZOS A;  1VFJ A;  3PW0 A;  5KFN A;  2AQ4 A;  3AJD A;  2DHG A;  4ETZ A;  2I6W A;  2RJZ A;  5DDP C;  3GV5 B;  3JXO A;  4K8R A;  1UMJ A;  2DPI A;  1YGY A;  3MD1 A;  3GIL A;  4PUO B;  3G6X A;  1HNV A;  3I4H X;  4EI2 A;  1WOS A;  5JVH Q;  3UWT A;  4I1T A;  2E5I A;  1NHK L;  2I1R A;  3D9B A;  2P2C B;  4DR5 J;  2XZW A;  4QZV B;  1FNM A;  1R6V A;  1S9E A;  1RHJ B;  3IAM 9;  3C15 A;  1S79 A;  4TVA B;  4Y2M A;  4IOC Q;  4DR5 F;  4ED1 A;  3FCW A;  4F04 B;  4DUY F;  4ETX A;  3CC4 S;  5E3A A;  2Y9H A;  2ACY A;  3PJ9 A;  4BDP A;  3PW4 A;  2CPJ A;  2Z30 B;  4NLT A;  2Z0G A;  2MKJ A;  2DGS A;  3CCM S;  4DX7 A;  3DKD A;  1VS3 A;  1VQP S;  4NRU A;  4FNH A;  1DTT B;  3CCS S;  1D9D A;  2CQB A;  2I5J B;  3KHL A;  4C2M A;  1N88 A;  2VH7 A;  2XYP B;  2HPU A;  4ZP9 A;  4AE5 A;  1HIY A;  5EWE A;  1T7P A;  3KJV A;  1N48 A;  3CGI A;  2G0J A;  1OS5 A;  5KFO A;  2W1B A;  4LSN A;  3NGD A;  2E5G A;  3CD7 A;  3RBX A;  4JYA J;  3P6Y C;  4V1A k;  3SFU A;  1X0F A;  2WVB A;  2X3G A;  3PO4 A;  2RQM A;  3CCW A;  5MAO A;  4IQX A;  4DV0 F;  2WVF A;  1FD2 A;  3CT9 A;  1B70 B;  1YJR A;  4ECT A;  2BXJ A;  1LW2 B;  2FC8 A;  7AT1 B;  3QRR A;  1OJ4 A;  3NCP A;  4QIF A;  5KFW A;  1UWA A;  1D8Z A;  1P9Q C;  4Y65 A;  5L1L A;  1K44 A;  1WKK A;  5AJ3 F;  1FRJ A;  1UVK A;  1X9S A;  2ZJQ Q;  4OHZ A;  4U67 Q;  4G1P A;  4ELU A;  3RR7 A;  2C1E B;  1WC5 A;  2NZ4 A;  2CQ0 A;  4F4K A;  4CQ1 A;  1RAA B;  4EUV A;  4TU9 A;  2BV3 A;  5AE1 A;  4UY8 5;  4E2F B;  3K5L A;  1ZA1 B;  2QYC A;  2YQ0 A;  3NGK A;  3EZU A;  2W8K A;  1W26 A;  4UZC A;  2KKH A;  3RBE A;  2WON B;  1GTE A;  2E1M C;  3QGP A;  1VQ9 S;  2ALZ A;  3EXY A;  4NLW A;  2RDJ A;  3TRG A;  4MK9 A;  2ZBQ A;  1ITP A;  2ZD1 B;  1HR0 J;  2EPI A;  3GQC A;  2RRA A;  4Y2I A;  2D3O 1;  4HDH A;  2RS8 A;  1JXV A;  4P6Q A;  2RF2 B;  5J1N A;  2ASD A;  3IC1 A;  2MZS A;  2ADC A;  5ITH A;  3TVK A;  3OFF A;  3RG6 A;  1Z2Z A;  5HMZ A;  4KGX B;  2EFO A;  3W8G A;  3MFI A;  3Q2T C;  5L39 A;  2E66 A;  2GQ2 A;  2YPY A;  1FVS A;  2GFF A;  4O23 A;  5B08 A;  1NK5 A;  1K0V A;  1DBD A;  3GR0 A;  2WBR A;  4CLP A;  1IWG A;  1R8A A;  4ES1 A;  3E01 B;  3R2C J;  4I6W A;  4K4U A;  4NOH A;  3K0J A;  1UVL A;  3D67 A;  1RSC A;  1VBZ A;  2L9D A;  2DGX A;  2PT0 A;  3MMA B;  4OJH A;  1TL1 A;  2AJF E;  3ZTS A;  2FJA B;  3MCS A;  1UJ4 A;  5HI7 A;  7FDR A;  4NE9 C;  1YKW A;  3K8V A;  2CQ2 A;  4IG0 A;  1NHV A;  2KU7 A;  2IIH A;  4IQM A;  1J2V A;  2CG8 A;  2OEM A;  4GO7 X;  2DIV A;  2V68 A;  4ZLN A;  4DU8 A;  1K1S A;  1EQ0 A;  1YRX A;  2FLP A;  1FXR A;  3ISN D;  3V81 B;  2AD9 A;  1R0B G;  4NI2 B;  2COL A;  4PZV A;  2HFZ A;  3KJV B;  1RT1 B;  5JXS A;  1Y9O A;  1RHM B;  2QA4 G;  4WP3 A;  3EIC A;  1VRT B;  1HAR A;  1RHQ B;  2O3D A;  3A8J A;  5HLF A;  2MY8 A;  4DSJ A;  1U25 A;  2CPX A;  5L1J A;  3THT A;  1LW2 A;  5KFP A;  4F3O A;  1TAQ A;  2I9S A;  3H7H B;  4Q2L A;  3IG1 B;  3T6B A;  5CCM A;  5E3R A;  1N36 J;  2UU9 F;  2ZH6 A;  1VQN S;  3RBZ A;  2RD5 C;  2L41 A;  4OYM A;  2LU2 A;  1RT2 A;  3JYT B;  1KRP A;  4DSK A;  3DOM B;  4ILL A;  1PYO B;  2BEF A;  3BS9 A;  2QSF A;  3NNC A;  3SZ2 A;  2DB1 A;  1NHU A;  4JP8 A;  1JLF B;  3ZZZ A;  2IRY A;  2J9E A;  2WRM A;  3L9Z A;  3P96 A;  2NSC A;  4BCA A;  1KR4 A;  5AE3 A;  2PMZ D;  4BWM A;  4TYA A;  4ZPV R;  2CQP A;  4FF1 A;  2VIH A;  4NLV A;  4WFX A;  3DRR A;  4PXE A;  2FHJ A;  2WON A;  1H2U X;  4NEY A;  4RBU A;  3AA8 A;  4LJM A;  1IR0 A;  3BH6 B;  7FD1 A;  1FE0 A;  4K5S A;  1XNQ F;  3KUG A;  1BMQ B;  2IM0 A;  3O3L A;  2YWH A;  2K7K A;  3KLE A;  2ZD1 A;  1S1T A;  3OLA A;  2V2V A;  3RRH A;  2W9B A;  1ROF A;  2RB7 A;  3NGR A;  3HFV A;  5D3G B;  1FWL A;  1R0A A;  1T8E A;  3W2V B;  3PKY A;  2EXU A;  3IN5 A;  2C3M A;  2HEK A;  2Q3P A;  1Y3K A;  4CTA B;  2HFN A;  3GFY A;  3PEJ A;  1ZPW X;  2NXC A;  1RWP B;  1AT1 B;  2R42 A;  1HPZ A;  3AD7 C;  2Y3Y A;  2BJ9 A;  3OFE A;  4IDK B;  2GVD A;  3DOL B;  5GMD A;  5KG4 A;  3E01 A;  1HBM B;  1S6Q A;  3HF5 A;  4TLR A;  5K9F A;  3UN2 A;  1N34 J;  5F8J A;  1JKH B;  3IGN A;  1NPP A;  3SV4 A;  3TZY A;  2KG1 A;  3H5Y A;  3JB9 k;  5E0O A;  1AZS A;  1UFK A;  1TL1 B;  2HGM A;  2QN6 B;  1VK3 A;  3D28 A;  2C3Y A;  3LAK A;  4QW9 A;  4J9K A;  1UCN A;  2ZM6 F;  1N5Y A;  3CD6 S;  1FD8 A;  3THP A;  1XR5 A;  4IG0 B;  1QY7 A;  1GXT A;  4K4Y A;  4WE1 B;  1CJV B;  2PE8 A;  3HVA A;  1WTB A;  1U0S A;  4DV4 J;  4J9R A;  4K0K J;  3JSY A;  3R27 A;  5H9E J;  1N5S A;  3IM9 A;  1GTH A;  3QT5 A;  2LA6 A;  3MED B;  3AHP A;  1MMN A;  3HHL D;  4M5G A;  2RUS A;  4A4J A;  3DXB A;  4RNN A;  1TAU A;  4TKT A;  4OJ3 A;  1ZTT A;  5E2Q A;  2O01 C;  4F26 A;  4B3T F;  2ZUA A;  4K50 A;  2V50 A;  3GZ7 A;  1S57 A;  1Z2L A;  2VU5 A;  4NA1 A;  3RB3 A;  3T5H A;  1Y10 A;  4OMF G;  3ENW A;  1RT2 B;  2DGW A;  3CJ5 A;  2VFT A;  2K3I A;  1UP1 A;  3M8W A;  1TK8 A;  2R7S A;  4WBF A;  1EKR A;  1F5C A;  4ECQ A;  2LEP A;  4CLY A;  2J0X A;  2BRK A;  2LDY A;  3TUI C;  4KY3 A;  3CDA A;  2HWI A;  3DRR B;  1NB2 A;  5E3C A;  3UDL A;  1HBN A;  4F02 A;  2IHR 1;  1CJK B;  5RUB A;  3QGI A;  3GFX A;  2JEJ A;  3AD8 C;  2X1B A;  4OZ5 A;  4LT6 A;  2AGO A;  2HHT A;  4ZP8 A;  2CKW A;  4R8U B;  3KLE B;  1QE1 B;  4EYI B;  1S1T B;  3PAC A;  4ES3 A;  2XHC A;  5DDO C;  4TN2 A;  2M8D B;  1NDC A;  2W9B B;  1JWW A;  1IN0 A;  1EAR A;  3WBZ A;  4LRA A;  4CLU A;  1NSA A;  3TUP A;  1RAC B;  1R0A B;  4NA3 A;  2BOA A;  2ATL A;  3W2V A;  2IJN A;  1RXO B;  1T9U A;  3I55 S;  4ZVQ B;  3DLJ A;  1JLQ A;  2CWK A;  3KFW X;  1HPZ B;  3OD2 A;  2VOD A;  4DQP A;  2GVD B;  5GAH I;  1HBM A;  1S6Q B;  2P9C A;  1LWE B;  3IS9 A;  4KH1 B;  1KTQ A;  4J9V A;  3HKW A;  3IR5 B;  3WZ0 A;  2LA4 A;  2KXN B;  3DOK A;  1Q53 A;  2IM1 A;  1RBA A;  4CLF A;  2Z56 B;  4ZJQ A;  1N5Y B;  3JQJ A;  2DH8 A;  3KLH B;  1NO8 A;  2F3J A;  5DJB A;  4ZJO A;  1NSQ A;  4CDI A;  1CJV A;  4ZPA A;  2PD1 A;  4F36 A;  5KT2 A;  4U6P A;  4ED2 A;  1NK0 A;  3C14 B;  2FY1 A;  2HAF A;  3IWL A;  5DRK A;  4DJB A;  1UJ6 A;  2F9J A;  5KFS A;  3AXK A;  2YQ1 A;  5EX3 A;  5HBM A;  2ZH2 A;  2YKN A;  5LJ5 Y;  3CCE S;  1F1B B;  4K5R A;  1ZS6 A;  2NPI A;  3MED A;  4C3L A;  2VQE F;  4B9T A;  1VHI A;  3BH7 B;  3ITH B;  1RTJ B;  1EAY C;  4NAS A;  4DR4 F;  3S6E A;  4ZPD A;  2W2M P;  3RB0 A;  2GV1 A;  4A8S A;  5DM6 Q;  3KWM A;  3X1L B;  3E51 A;  1PIL A;  3EGZ A;  4NYO A;  4YEA A;  1FKO A;  4NZ6 A;  4J9M A;  2QMU B;  2MTL A;  3M30 B;  4FBU A;  2JEG A;  2V0N A;  1GT8 A;  1QVG R;  2R8G A;  4DS4 A;  4OZL A;  3QYY A;  3P8B B;  1F9H A;  4U9R A;  2BAN A;  3IR6 B;  3NGT A;  2ZM6 J;  1KD1 T;  2KRR A;  1U0H B;  2DEJ A;  4TLQ A;  4UTG A;  5CZX A;  1V5I B;  4JOU A;  4OX6 A;  1C1C A;  1HMV B;  3N28 A;  3BSC A;  2CRL A;  2BQU A;  1RT6 B;  1HBN B;  4DSL A;  1F9F A;  1JJC B;  1CJK A;  4FDF A;  4DL3 A;  1U1O A;  3GSI A;  5GMK a;  4NXM J;  4B3R J;  2DH7 A;  2CXE A;  3Q8Q B;  3PX6 A;  1FDB A;  2UZA A;  1X4A A;  1S1V A;  3UCG A;  5C25 B;  2RDD A;  2YWE A;  3M7V A;  2OPS B;  1OY8 A;  1V3R A;  1ELO A;  4B02 A;  2VG6 B;  3G9C A;  2CFX A;  3Q8V A;  1Q5V A;  1REV A;  2GIR A;  3LO3 A;  1U1L A;  4IRC A;  1N32 J;  3CJ4 A;  3R6G B;  4BS2 A;  1RAE B;  5KOX A;  4AQY F;  4USI A;  5E7O B;  3DMJ A;  3PV8 A;  3NWG A;  3G8Q A;  4WWS A;  3I5B A;  2OAU A;  2AYM A;  4LF9 F;  2FGC A;  2HBR B;  1WEX A;  2YKQ A;  1F0X A;  4O3O A;  3HUL A;  4QPX A;  4YHH F;  3GJR B;  1FA0 A;  2A6O A;  4N77 A;  1KQG B;  4JV0 A;  3H98 A;  4RW7 B;  4IH5 A;  1V5V A;  2KT2 A;  1TV6 A;  2R7R A;  2XY5 A;  1ZZF A;  3BKU A;  4YS2 A;  1A7G E;  1S49 A;  1KNZ A;  2MQN A;  2FD2 A;  4IRD A;  1M5K C;  2ZBR A;  5H9F K;  4DZ6 A;  3C14 A;  3BQ1 A;  1EP4 A;  4KB7 A;  2WZ1 A;  1HR0 F;  3CCV S;  5KFE A;  1CJT B;  1N36 F;  1S1X B;  4M94 A;  1YLX A;  2EEY A;  3EMT A;  1HNW J;  2V2Q A;  3H20 A;  4O44 A;  1C1B A;  2V8D A;  3I4P A;  1WUU A;  3FBF A;  3ITH A;  4PWW A;  4B9S A;  2AZ1 A;  5E3Q A;  1RUS A;  2UUW A;  5CH7 B;  2VZ9 A;  3DCA A;  1R8H A;  3GYN A;  1R7I A;  1KOH A;  2LLZ A;  1NSP A;  1RU2 A;  1S6U A;  3ULH A;  2DCU B;  1WKJ A;  2GA7 A;  4I2P A;  1FJ7 A;  4USJ C;  4IFV A;  5C24 B;  4IFY A;  1FKO B;  4WTY A;  1RWK B;  4UW2 A;  2FHO B;  2ZOF A;  2NSB A;  4QU6 A;  4DL2 A;  4JI6 J;  3GG1 A;  1G3O A;  2YWW A;  5T41 A;  2BAN B;  3H40 A;  1NU4 A;  2CNO B;  3OXF A;  3JSM A;  1Q82 T;  3CO0 P;  2XMU A;  3PM9 A;  4J9Q A;  3ET6 A;  3M2U A;  4WII A;  2F4V J;  5G0R B;  1HMV A;  1SUQ A;  1QVF R;  1NK9 A;  4HHU A;  4DI6 A;  1RP5 A;  2PN6 A;  3BPD A;  2CA9 A;  3BN7 A;  4LF4 F;  3OFG A;  1RU1 A;  1OYE A;  4NXN J;  1WEL A;  2C2K B;  5D4N A;  3FBE A;  3I0S A;  5B0G A;  4EBC A;  4JI5 J;  4LIR A;  1HD1 A;  2V8V A;  3UN3 A;  3N0V A;  5FDL B;  1KDN A;  1VQ5 S;  2E1C A;  1E6V B;  3DRP A;  1PCA A;  1EET B;  1X5T A;  1L3S A;  2GC8 A;  3W8P A;  4YB5 A;  3FEY B;  4YR2 A;  2VKR A;  1FFG B;  4ZKA A;  4OZ1 A;  2ZH8 A;  2FYX A;  4NLU A;  3HZE A;  1J27 A;  5LT5 A;  2IA6 A;  2N3O A;  3J81 U;  4ELV A;  4JI7 F;  1UVI A;  1L3K A;  2G1H A;  2ABY A;  3F0N A;  1CQN A;  3MM7 B;  4FVM A;  4RW7 A;  4CO2 A;  4A46 A;  1FDN A;  1ZTW A;  2CVI A;  1X4F A;  2HFV A;  3LUY A;  4ZVU B;  3H5X A;  3W5Z A;  1WSV A;  2DHX A;  2V9W A;  4QCL A;  5KFM A;  4ECW A;  1AW0 A;  1EKS A;  5DGB A;  2XO6 A;  3MPD A;  1HBO B;  1WOR A;  5ETL A;  3QQC D;  1DZ5 A;  2GIQ A;  2OFG X;  2VC1 A;  3BB5 A;  4RJV A;  4DUZ J;  2AF6 A;  1FRX A;  1CJT A;  4KHP J;  2ZUG A;  2OD6 A;  4C7Q A;  3HD2 A;  4WZQ A;  3TAP A;  4OI1 A;  1IKY A;  1KOO A;  1WC3 A;  1C1B B;  2PA3 A;  1NUE A;  4O44 B;  3V6J A;  4USW A;  1G2E A;  3M8Y A;  2W9A A;  1U09 A;  4G1I A;  2RHS B;  2EC0 A;  4FS2 A;  1DFD A;  2I5J A;  1R8B A;  3NCR A;  2CQD A;  2BJ8 A;  4IFY B;  1YJ7 A;  5AXL A;  4DU7 A;  4X64 F;  4Z37 A;  3L7O A;  4DV6 J;  5E33 A;  2MGZ B;  3OL7 A;  1HNI A;  4BBY A;  1U8W A;  3JSM B;  4P2S A;  1X7V A;  1HQ2 A;  3TWZ A;  1GH8 A;  2IM3 A;  3LWL A;  4ECR A;  5L8R C;  4C8N A;  3ET6 B;  1HFE L;  4C8M A;  1T0T V;  2ZVI A;  1JLA B;  4JI4 J;  2ZH4 A;  4K4S A;  1SJ1 A;  3QPI A;  4ZDN A;  3DLE B;  2ZZM A;  1LFP A;  1SJR A;  2DNK A;  1NXI A;  3CJK A;  2MQL A;  4C48 A;  2C3U A;  1BD6 A;  3I9Z A;  2N7Y A;  4WKR A;  4DPT A;  3C46 A;  4B9V A;  5AXN A;  2QA1 A;  3UNG C;  1S99 A;  4KGV B;  4JI7 J;  2V8H A;  2OSR A;  4IOA Q;  3O6Q A;  3G6Y A;  2Y0S D;  5M2P A;  3MMB A;  2DR5 A;  4P52 A;  2AV5 A;  2CYY A;  2XNR A;  1J5O B;  3SSQ A;  1XQI A;  4DV2 F;  3M32 B;  4NLO A;  1RAG B;  3Q86 A;  4QWD A;  2VC0 A;  3KNA A;  3BPS P;  1C2P A;  3CJT A;  3ETM A;  3LAM A;  1LEO A;  1OSC A;  2B43 A;  2IJF A;  2KB2 A;  1VHF A;  2AX1 A;  2ZE2 A;  3IR7 B;  3KLI A;  3MWB A;  4DCO B;  5I3Q A;  1BHN A;  3EX7 B;  1FEE A;  2E1R A;  2UUC F;  2NQP A;  3HHN B;  4W90 B;  2RF2 A;  3TAN A;  1KLM A;  4HVZ A;  1FER A;  2A10 A;  3MM7 A;  1PJ7 A;  3QAE A;  1Q78 A;  4NYZ A;  2E44 A;  5D4L A;  3MR2 A;  2P9E A;  3DHX A;  2DD8 S;  3KKF A;  2IVY A;  3NEK A;  1NDP A;  3EGW B;  4I56 A;  2CIM A;  5EDW A;  4DSF A;  1UVM A;  3WDO A;  3K57 A;  2IC3 B;  1S4F A;  2LXI A;  2YWG A;  1HBO A;  4YN3 B;  5CA5 A;  2R7V A;  3BO4 A;  1ZAX A;  5D4O A;  1NZA A;  4F2S A;  5IQ6 A;  3M2R B;  2CWX A;  5KOW A;  3AFG A;  3R97 A;  1Q8L A;  1VQM S;  4QR0 A;  4UF4 A;  1PAE X;  1UFL A;  3CDE A;  4JI6 F;  3V5R A;  1FXD A;  2XCA A;  3J80 U;  2LEB A;  4LFB J;  3C19 A;  3CCR S;  3VAI A;  1RJJ A;  2ZC3 A;  2BYC A;  1GXU A;  5IS2 A;  4KO0 B;  1ZH5 A;  1N5T A;  2YBV A;  2YTC A;  4OZ2 A;  3WIU A;  3Q8S B;  3AY0 A;  1VIS A;  1S7H A;  2M2B A;  4NI2 A;  2CQ4 A;  2IFX A;  1RT1 A;  2XMW A;  5HVF A;  1X9W A;  1NAQ A;  4PAB A;  4RU2 A;  1S1U A;  1Q7Y T;  1HD0 A;  2KRB A;  2MGZ A;  4JI2 F;  1VRT A;  1HNI B;  4X65 J;  2IRU A;  4Q8E A;  4WKY A;  1XR7 A;  2DHH A;  1S48 A;  5BYQ A;  1IQZ A;  2C2D A;  3HVT B;  5IWA F;  2LQJ A;  4OJ1 A;  2SXL A;  1JLA A;  3IG1 A;  1NH8 A;  2F8M A;  2JWN A;  3D6M B;  3DLE A;  3EVW A;  3UVJ B;  3EVO A;  2RNE A;  3NKY A;  2BJE A;  1H0H B;  3DOM A;  4ZVH A;  3CJK B;  4QWC A;  3TI0 A;  2FVR A;  4HKQ A;  2XI3 A;  4NMX A;  3R3T A;  1UKU A;  3UNY A;  2ZBP A;  1P6T A;  2GNK A;  3FUY A;  1VIO A;  3SDE A;  3ZZY A;  1X5P A;  3MD3 A;  4A48 A;  4PG8 A;  4YHH J;  4CIO A;  1FHT A;  5CYM A;  2IMO A;  2D3U A;  3BBB A;  3D54 A;  6AT1 B;  3CC2 S;  2UVV A;  1B7F A;  1NPR A;  3WC0 A;  4FKY A;  1LXN A;  2KL8 A;  1J5O A;  2M0G B;  4B9U A;  2FZG B;  3ISN C;  3C16 A;  3BGL A;  2VUG A;  2LVW A;  4HDG A;  2ZOG A;  4NA2 A;  2V69 A;  5GAE I;  4ZIW A;  1HW8 A;  3OXL A;  4CO3 A;  5A76 A;  4U96 A;  2GMH A;  1MWZ A;  4C8Y A;  3GR1 A;  3RRG A;  2VPX B;  1SIW B;  3U27 A;  1N52 B;  5D3G A;  2MYF A;  1U24 A;  2FJD B;  1KLM B;  3BYP A;  2P5V A;  3EVM A;  4N5S A;  1D1U A;  2GQC A;  2ERR A;  2DNP A;  3V4M A;  3AOD A;  3UFC X;  4M5L A;  4CTA A;  3V6D B;  3G6V A;  4NML A;  3TOQ A;  3T41 A;  4B3R F;  4I6A A;  2IC3 A;  3DOL A;  4LBP A;  5AXK A;  4A47 A;  4KQZ A;  5JMN A;  4ZIT A;  3Q0A A;  1VK8 A;  4NPO A;  1CLF A;  2HUR A;  4L76 A;  3TJA A;  1HNZ F;  2V67 A;  2IRX A;  1GNK A;  2M70 A;  2LCW A;  3M2R A;  4OV1 A;  3R8Y A;  1AZS B;  6FDR A;  2J0S D;  4C9D A;  1TTH B;  1OWX A;  2KO1 A;  2MEW A;  3MAH A;  1KVK A;  4G65 A;  2C3O A;  3DLK B;  4PYD A;  1NLK L;  1RHK B;  2DBB A;  2HQG A;  1OPZ A;  4QWE A;  4DFM A;  3M6X A;  2MB0 B;  2BE2 B;  4OFZ A;  3QBC A;  1B7Y B;  4KO0 A;  2GHW A;  4RUB A;  1U2F A;  2QL7 B;  4H4K C;  1VQO S;  2KFZ A;  4MT1 A;  1B64 A;  1O6X A;  2G2O A;  4X4N A;  5H9F J;  2D1C A;  1F2H A;  2F5G A;  1D9F A;  5CD4 A;  3IMQ J;  2GML A;  4MIB A;  1I94 J;  4F4Y A;  2HIY A;  2VBW A;  3DU5 A;  4URQ U;  5BJR A;  4WFN Q;  3U02 A;  3GII A;  3QGG A;  1SJ4 P;  2U1A A;  2OKQ A;  3HVT A;  3WX8 A;  2HS4 A;  1BWE A;  2DY1 A;  2WB4 A;  3K17 A;  1LFW A;  4H4M B;  1RYR A;  2V8P A;  3FNN A;  3T9Z A;  1GQE A;  2GJ2 A;  3MPY A;  2RU9 A;  3UVJ A;  2VQF J;  4ZK7 M;  1VLO A;  3OVA A;  2UV8 G;  2G0C A;  4U7U K;  2UXB F;  3EE3 A;  2H54 B;  2KVI A;  2CPY A;  5KG2 A;  4IOB A;  3C3L A;  3I5C A;  4C8K A;  4CH7 A;  3RRK A;  2E5L J;  4O3P A;  1KON A;  4LBI A;  5CYM B;  1PO6 A;  1SKR A;  4LF4 J;  2JLE A;  2OSQ A;  2E5J A;  3AA9 A;  2XC9 A;  5KFZ A;  2Y1R I;  2ZDP A;  1D3W A;  4M1K A;  3SIP B;  4MAK A;  3P5B P;  2QLB B;  3VVU A;  5ETR A;  5DM7 Q;  4JI1 F;  2A1B A;  2J9C A;  1N0U A;  3M6V A;  4YUD A;  3C16 B;  1QD1 A;  3NLC A;  4CI0 B;  4ZLJ A;  3DFE A;  2KM8 B;  1WDD A;  2DT9 A;  2MQQ A;  1QE1 A;  3JQK A;  4MKY A;  8RUC A;  2AMC B;  1ACM B;  2GAG C;  3PRD A;  4GVB A;  4KFB B;  2OP5 A;  3C6U A;  1FVQ A;  2J7U A;  3TR5 A;  2ZC4 A;  1TK0 A;  1R43 A;  2OI2 A;  2Q6C A;  1J5E F;  3IWN C;  5F8N A;  4DV6 F;  3OHB A;  4Y3C A;  2X1F A;  2GHV C;  3N5F A;  2HHV A;  4MJK A;  5L1K A;  4JI8 J;  3SCI E;  3KG4 A;  1RGV A;  2ZIT A;  4RPF A;  2MLZ A;  5E5N A;  2ASY A;  4ZLL A;  3J7Z T;  1ZYQ A;  4RWW A;  4ED8 A;  4OI6 A;  2MLX A;  2Z2Z A;  5C2G A;  3OJS A;  1Y4Z B;  1LWE A;  2K7J A;  3G86 A;  3IS9 B;  1RHU B;  4J37 A;  1NCL A;  5T7L A;  1N0V C;  2W2Q P;  3GV7 B;  4FF3 A;  2H51 B;  2AP6 A;  3LOU A;  1H7W A;  4N7T A;  4DEZ A;  1NBE B;  2KH9 A;  1HYS A;  3AJ2 A;  2FLO A;  3DLK A;  4WPA A;  3RAM A;  1NK7 A;  2RH3 A;  4DUZ F;  1WF2 A;  2KI2 A;  1IVZ A;  3K89 A;  5C2C A;  1QSY A;  4ED5 A;  3FZB A;  2DKO B;  4MH8 A;  1KQS R;  5HBM B;  1KHW A;  3D6F B;  2R2U A;  2YKN B;  3NOG A;  1AXQ A;  2JX2 A;  2ILZ A;  3LW5 C;  4KJI A;  3D6T B;  1HLW A;  2HZC A;  3UW1 A;  3HMJ G;  3SI8 A;  1HI0 P;  5KFJ A;  1EZZ B;  2OEL A;  4LR7 A;  5C5J A;  1LW0 B;  1YJT A;  1SH2 A;  3JSB A;  5FD1 A;  2FJW A;  2JRS A;  2K2P A;  4X4P A;  2BM0 A;  2EFN A;  1HA1 A;  2CNN B;  2HRT A;  1GEH A;  1VQS A;  1N32 F;  3LGH A;  4F4W A;  2CPZ A;  2K06 A;  2MKY A;  3HDS A;  5A8W A;  2C2E A;  4DPY A;  4MYU A;  1R8P A;  4P2M A;  4PR6 A;  4RBT A;  4I4B A;  2P6S A;  5CYJ A;  4JI0 J;  3OR1 B;  4C97 A;  3O44 A;  4ZVG A;  2CJA A;  1GX5 A;  2WCX A;  3SFG A;  4W4M A;  3U1L A;  2VDH A;  3N6L A;  1ARO P;  1UTA A;  3T9N A;  5IZH A;  5MLC V;  1C1C B;  1RHR B;  3BSA A;  5DLG A;  2EG2 A;  4Q7A A;  3JSR A;  3BF4 A;  2ZHA A;  1FCA A;  1NH7 A;  3WC2 A;  1MU2 A;  2GGP A;  3W60 A;  4YFU A;  3GV8 B;  1BQM A;  3CJ2 A;  1E6Y A; 
#chains in the Genus database with same CATH homology
 1RWM B;  2H5I B;  2H48 B;  4JB8 B;  4DCP B;  3R7S B;  3R6G B;  2XZD B;  1RHK B;  2CDR B;  2Y1L B;  2CNK B;  2C1E B;  3EDR B;  5IC4 B;  2HBR B;  2QL7 B;  1ICE B;  2C2Z B;  3KJF B;  2XYG B;  1SC3 B;  3GJR B;  2C2M B;  2CJX B;  1F9E B;  3KJQ B;  2FQQ B;  5K20 B;  2QLF B;  1RWV B;  4ZVP B;  1QDU B;  1I3O B;  2H4W B;  3R5J B;  3GJS B;  4DCO B;  2C2O B;  2H54 B;  1I51 B;  4ZVS B;  4DCJ B;  2QL9 B;  3SIP B;  2HBZ B;  2QLB B;  1RWK B;  3R7N B;  3GJQ B;  3P4U B;  3D6H B;  2CNO B;  3IBC B;  3NS7 B;  2QLJ B;  4ZVQ B;  2HBY B;  3QNW B;  1RWO B;  2C2K B;  1RWX B;  1RHM B;  1RHQ B;  5IC6 B;  1RHU B;  1NME B;  4ZVO B;  3IBF B;  4ZVT B;  2H51 B;  1GFW B;  2XZT B;  1PAU B;  3D6M B;  1PYO B;  1QTN B;  2HBQ B;  2DKO B;  2CNL B;  3D6F B;  3GJT B;  2P2C B;  1RHJ B;  2CJY B;  2H65 B;  1RWN B;  4ZVR B;  4ZVU B;  3EDQ B;  2QL5 B;  1BMQ B;  3R6L B;  1SC1 B;  3KJN B;  2CNN B;  2XYH B;  3P45 B;  1SC4 B;  3R7B B;  4LSZ B;  2XYP B;  2Y0B B;  1RWP B;  1IBC B;  1RWW B;  2H5J B;  1RHR B;  2H4Y B;  3RJM B;  1RE1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...