3DGPA

Crystal structure of the complex between tfb5 and the c-terminal domain of tfb2
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
62
structure length
62
Chain Sequence
b'ELDRVITYEGSLYSDFETSQEYNLLSKYAQDIGVLLWKDDKKKKFFISKEGNSQVLDFAKRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA polymerase II transcription factor B subunit 2
publication title Structural basis for group A trichothiodystrophy
pubmed rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 18
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2008-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18307 Tfb2_C Transcription factor Tfb2 (p52) C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2610 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dgpA00
3DGPA 3DOMA
chains in the Genus database with same CATH superfamily
4ES1A 2P9GA 3TA0A 3LALA 1X7VA 3BN4A 1AYEA 3OFEA 5D77A 2V67A 1UFWA 2QA4G 3VVUA 2PDAA 4MT1A 1IBLJ 2EFQA 4J91A 2VPZB 4UOCA 4S0MA 4Z2XA 3LAMA 2NR0A 3NL0A 4PG4A 3M4XA 4DFMA 4M5GA 4OX6A 4F67A 2Z56B 2B4UA 4HDHA 5DG9A 5IT9U 1KHVA 1NJZA 3JXOA 1IBKF 1CVJA 2F1FA 2XZDB 2PT0A 2VPWB 2DJWA 3B4DA 4RW8B 3FCVA 3TUJC 4DV4J 3QFHA 1CS4B 5LOQA 4DV0J 4X66F 2X3GA 1V3RA 4X4RA 2ZKTA 3FZ2A 1OY8A 3AJ1A 1FFWB 3W5ZA 4AYBD 3V81B 4ZKAA 3GV8B 1UAWA 2LA6A 3D6MB 2FLPA 3B54A 2KVQE 4B3OB 2HAIA 3GG1A 3HHLD 2UUCF 1TKDA 4KT0C 3KFWX 4FXWA 4KO0A 2NUHA 4WK3A 4I4BA 1IN0A 1D8YA 2ATLA 1PC5A 3HSGA 2YNFA 4DXLA 5CZVA 2MGZB 2DNGA 1UW4A 1TV6B 2OD6A 2AQ4A 2X7IA 4B3TJ 1N32J 1TAUA 4M5NA 2YX1A 1I1GA 1KVKA 3WQPA 2F40A 2WVDA 3M7VA 2DXDA 4MJKA 1UETA 2OSQA 5KFBA 2VG6A 2GIRA 3G82B 3CDBA 2FLOA 3HSDA 1KRPA 3V6DA 3ZZZA 3ZZYA 2P2CB 4W4MA 2YWEA 4DV5F 4ED2A 1FRIA 5IS2A 4LSLA 1NXIA 2A10A 3CCJS 1X9WA 3NCQA 4NCGA 4NXNF 4F8RA 1PC4A 2BVZA 2E29A 3C46A 5JVGQ 1F5CA 1J5EJ 2E44A 2GGPB 4H4KC 3OPKA 3DHWC 1TU0B 4LF6F 4EUVA 3HZGA 4NLGA 1UWAA 2PSZA 4LUBA 3PVXA 3HVTA 1N5TA 3TEHB 2JSXA 3T9NA 1LXJA 1FRKA 3G8QA 4NA1A 3SCKE 4URGA 1F9EB 4KHPJ 1T7PA 3B6BA 5HJXA 3NGUA 3QPIA 2HBQB 3D4JA 2EFGA 3M6XA 3MD1A 1C4AA 1VQMS 2OD4A 5AXNA 3C15B 2XWXA 1MROB 1FF2A 4OX9J 5KFZA 3ILJA 2HYIB 2VOPA 1ZPVA 1X5PA 5AE2A 1JNRB 4UTGA 2W4DA 2H65B 1VQOS 4CO0A 1OY6A 4O3QA 4LMZA 1RT4A 2GQCA 4YS2A 2OGUA 2N82B 2D7SA 1IKXA 4NCAA 1UJ5A 3F73A 4WPAA 2AW0A 1VS3A 2JEJA 3V5RA 3GV5B 2PE8A 3GSIA 3Q8VA 2AYEA 5L1JA 1R8BA 2B4OA 3PW0A 3DLLQ 4MIWA 3D6TB 4ERDA 1C1CA 2NYIA 1HQ2A 3T5JA 5M2UA 3VQTA 3R27A 1SJQA 3RJMB 4XPEA 1HIYA 3PRVA 4X4NA 3MOZA 5DDPC 2NXNA 2WW4A 3D68A 3IM8A 2Y0BB 2B5JB 2EBGA 4C11B 3VALA 3T1HJ 2KZMA 3QAUA 2AZ3A 4OQJA 1N36F 4LF4F 4DX8H 2M8HA 1RGVA 1RHRB 1T05A 4U7CA 3NS6A 1IBMF 2ZE2B 3SCJE 4UUWA 3SFUA 1NK4A 3CF5Q 4RU9A 2R7QA 2W24A 1P9QC 4LBPA 1Q8LA 6AT1B 3OR2B 2HRUA 5CH7B 2I38A 3W61A 1UEVA 4JYAF 1RHKB 1NZ8A 5F0WA 5SUHA 2QLWA 3DC2A 3EZOA 4C7QA 3AA9A 1D9DA 3GIKA 1WSVA 1UJ4A 3NEKA 1FNMA 2UVWA 2MZTA 3KMQA 4C8ZA 1S0OA 4ILMA 3HPOA 4DR5F 2HAFA 2LEBA 3CSKA 1S9GB 2R7RA 2N3OA 3HD2A 4X65J 1BQMA 3T5KA 4PQAA 2QO3A 1NK6A 2DH9A 2OPRB 1HWUA 1GAOA 3D0IE 4OX7A 2OH2A 2KXFA 1CBKA 1U24A 2BR0A 1I3OB 2FJWA 4QU6A 3MUTP 4JV2A 5D0RA 4ECXA 1KOHA 3FCHA 2MKJA 2UV8A 3QLHB 3CJ4A 1FA0A 2DGXA 3QO9A 4FF2A 1OYDA 3C16B 1GEHA 4LR8A 2V6AA 2FHMA 2M0GB 3H2LA 3OTBA 5ITHA 3UD5A 2GS8A 2H5IB 3BQ1A 1Z1ZA 3EUNA 2AJ2A 3OVAA 1PAEX 3QSYB 4KPCA 2RKIB 5HVGA 4WFNQ 4GKJJ 3ILOA 3DU5A 4TU8A 5IWAJ 1TQLA 2B3TB 4JI0J 4H4KA 2GQQA 3TJ8A 1N0UA 2DNLA 3NS7B 4F7VA 1RWUA 5BYSA 3MXHP 3R6LB 4ZPVR 2V2QA 3EDQB 1YKWA 2V2VA 2Z57B 4KAIA 2RS8A 4C2MA 2PC6A 2BA9A 3MOJB 3Q8RB 4KQZA 1QLNA 1SI9A 2HQCA 3CEDA 1HNIA 3PEHA 3OD2A 1S7IA 4C9DA 4QWEA 1J5OA 4QIEA 2MQPA 1E6YA 4CTAB 3QGHA 5KG1A 4RNFA 4PUOA 4FXDA 3QYYA 1VQ9S 4OJHA 2B8QA 1N6QA 2OPSB 2HQDA 4QYRA 1HA1A 1DTQB 5KFFA 2JEFA 1URRA 1KN6A 1HI0P 1RWOB 5D4LA 3HI9A 2R2RA 3FEXB 1JWWA 1OQ6A 1U47A 3UCUP 1DURA 1JLGA 1N0VC 4I2PA 1U1KA 1XMOF 1LW0B 4NA3A 3TP2A 4MKVA 4O3NA 1AUSL 5HBMB 2UXCJ 4OYWA 3A8EA 2C2DA 4RL1A 1R8AA 1TKZA 1RWMB 1UZHA 3G2XA 5T7LA 5J1EA 4KHRA 1U1QA 4I67A 1U8SA 3F0NA 3DDKA 2KN4A 1XTZA 3CTRA 2BYCA 3AXMA 3G86A 1YLXA 9ATCB 3FFIA 2BABA 2YWFA 3MAAA 4K4VA 4ECYA 3T6BA 3ITHB 1R6YA 5T14A 4DR2J 2F65A 2N7CA 1RBOB 1NSKL 4A8YA 5HJYA 4J9KA 2W7AA 4CLWA 2DGUA 1X4DA 1FFSB 1N4LA 5E3AA 1RISA 1VYAA 3PYFA 1S6QB 3BGLA 3LP1B 4UT4A 3HCXA 5FD1A 3KNAA 4CDIA 2HBYB 3FDSA 3MMBA 2O66A 5HSPA 1NSPA 5KFLA 2B7BB 1RT2A 4OYOA 1GMUA 5KG7A 2HS4A 1H6KX 1HNXJ 4M5LA 2XULA 4NCBA 2G13A 3UWTA 1HR0J 3LP2B 2B8PA 4OV1A 4Z7YA 2FD2A 3N5BA 3FGVA 1A0OB 2HVDA 2LXIA 3HX9A 4B3SF 5KT4A 1Q81T 1HARA 1CJVB 3VV2B 2ZZNA 2QG9B 2HHHF 4KTQA 3QNWB 3R5DA 5F8HA 3VGTA 1Z2ZA 1LWCB 1WORA 2KFZA 1L3KA 5DG7A 2ZDOA 1B0VA 1S1WB 2WSCC 4P75A 4H4OA 3BM7A 2U1AA 4YR3A 3TAMA 2BE2B 4K0KJ 1TMMA 1ZOTA 5CCLA 3LW5C 2FC9A 3FEYB 1HMVB 1KNZA 1SKWA 4BDPA 4NLTA 3EJMA 3PG9A 4IYQA 3DMJB 4NLUA 4O44A 5L1IA 3J80Y 3BGRA 1S1XB 3SDEA 3DM2B 3NKYA 2MLXA 1N8RT 4B9UA 4FS1A 3Q89A 2R8KA 4CLFA 5J2QB 4B17A 3CJQA 2DHHA 4Y2CA 1GT8A 4I68A 5KFRA 1UW9A 4U6PA 3ZNJ1 1VQLS 4K5SA 2BJ1A 1S49A 1N34J 3ILIA 2EPIA 2AEJA 3O44A 3NMAA 4N7TA 1RA6A 1UVJA 5IV3A 1JLQB 2BM0A 6FD1A 3ULHA 2OTLS 2KRBA 1Q78A 4YN3B 3I5CA 2GC8A 1IKWB 2J7KA 3CWJA 1DQAA 1FXRA 4DUYF 1R8CA 4PQUB 4HHUA 1PILA 2XMKA 1Y11A 1YDLA 2HW3A 2K06A 3VAFA 4ZMMA 1FERA 1OO0B 2O5DA 2KG1A 2R9LA 3LGMA 1S76D 4DQPA 2CQHA 1WTFA 4JI8J 4DG1A 2CNOB 4PWDA 4Y2MA 5BYQA 4ZLLA 3R5JB 2U2FA 3PW4A 2QEXS 1DLOA 1MMLA 3LWMA 5DLFA 5KFEA 3T1YF 4QQBA 3OFFA 2GQ2A 2KI2A 2NPIA 5GVQA 2CQDA 3DLKB 1NEEA 2VU5A 5LMNF 2GJ2A 3OR1B 3HFZB 2F4VF 1RI7A 4RW6B 2QL5B 1PIEA 2PEHA 1VRTA 4O3RA 5ETTA 1IVZA 1Y4ZB 3POTB 3I82A 2A0FB 2L08A 3M1VB 5HQLA 4CM0A 2ZZTA 3AHPA 3Q0AA 3MM7B 1LW2A 1NBEB 2R3VA 4LRAA 1RHQB 2ZZMA 2B9XA 3M6VA 1G7CB 2BXJA 2XHWA 4V19X 1RWPB 4X2BA 3RAXA 5LMUJ 3DLBA 3K8WA 2LU1A 4ID5B 1T94A 5H9EJ 4GVBA 2WONA 1WELA 1Q82T 3L7UA 4AE5A 1UFLA 1CQMA 1G2EA 3KK3B 5KG2A 1OS5A 1F3VA 4USVA 3GYXB 1L3SA 3ZZRA 2AEMA 1UVMA 2G4BA 1VR6A 4PPZA 5IZHA 1BWVA 1NJWA 2P8IA 4ZLPA 1NB7A 5H1SV 3CMES 3EPIA 4L76A 2OEJA 2PA3A 1T9YA 2ILYA 2KZZA 4ZVSB 1EP4B 1R0AA 4LBHA 1WHVA 4OHVA 2KXHA 5KFIA 3KLFA 1VOMA 1VJQA 3D9BA 2W7OA 4ZP7A 2AP6A 1S1VB 4FF1A 4USKA 2GO8A 3P4UB 4DPUA 2Z8QA 4DQIA 2CQ0A 2AU0A 5C25A 2XI2A 3TARA 3ENVA 5A6WA 4M94A 4IRCA 4ZVFA 4IFVA 4PG6A 1VQNS 1NDKA 3G6XA 3D1OA 2YPYA 4M5JA 4DV0F 1V3ZA 1NHKL 3QGIA 1RT1B 4HL9A 4CH0S 1UZDA 3C6TA 2I6WA 1P8GA 5ETNA 1O51A 1JKHB 4K8RA 2MQQA 1OPZA 1EB0A 4ECQA 1AFJA 2AKWB 4R5PB 5ETPA 1H7WA 2RH3A 1UA1A 1FNXH 2J8AA 4ZP6A 5F8JA 4QR1A 3GFYA 3PFEA 1I5OB 2V8DA 1Y3KA 2R2TA 3TAPA 4IFYA 1LWXA 5CYMB 4KGVB 5G0RB 1X60A 1WF2A 2XHCA 4HTIA 2I2YA 1UWBA 3HHLB 1UA0A 1NNDA 4PYDA 3DRPB 3RZAA 3CDWA 1SKUB 4EMDA 1TELA 4A8FA 3RBXA 1HBUB 5HMYA 5BR8F 2BANA 1WF1A 2QLXA 3L7OA 3OJSA 2BOPA 3THVA 4F4YA 2WVBA 1LFPA 3TUPA 2AV5A 3NCRA 4PXEA 3HJFA 4ALZA 4PG5A 1F0XA 1VK3A 1V9OA 5F8MA 4GC7A 2VC0A 2VH7A 1GNKA 1WUUA 1S9EA 3AQOA 4Y3CA 4TY8A 2CADA 1BLUA 2QYCA 4WP9A 3MEGB 1F9FA 3MMAA 1YJRA 2FVPA 2JDJA 2FQQB 1F2HA 1B99A 2V4JA 5HVFA 2CJAA 1JLCA 4WIQA 1FJCA 1FK9B 1J5EF 2CPIA 3EE3A 4I6YA 1DAXA 1JLAB 4IR1A 2XC9A 3UPFA 4DCJB 1A9NB 4DR7J 1VJWA 5J2MA 2P9EA 4Q44A 4KHPF 1KFDA 2H54B 3IP0A 4CLKA 5C5JA 4FVCA 4WFBQ 1VQSA 4KSEB 1FKPB 3G6YA 4ZLJA 1YZ6A 4M8LA 2ABYA 1RTJB 1KTQA 3ISNC 1OY9A 2DNKA 1S97A 4JI3J 3C19A 2IRYA 4OX9F 1URNA 1X4FA 1JLEA 3BDPA 1HWJA 3SFGA 2DITA 1T9TA 3S7RA 4OI6A 4ZVRB 5KG4A 1REVB 2YKNA 3I87A 3N01A 4OLOA 1K0VA 3HLUA 1LWEB 2HZCA 1T9UA 3WZ0A 1WG4A 2UU9F 2IVMA 3LPYA 2HGMA 1U2RA 2YQ3A 2I1RA 4FS2A 1L3TA 5CXTA 1FWKA 4DX6A 1PYOB 4KGMA 1YHQS 2DH7A 4DL6A 4O3PA 5F8GA 1IKVA 2GVDB 3M30A 4P71A 1WKJA 3UCZP 1FD2A 5J1PA 5KFQA 2DNMA 3GSDA 3A4TA 2R8JA 5E41A 3IBFB 2PMHA 5K5MA 3MURP 1HW9A 3PNIA 2ACYA 1NK0A 3HVWA 3THTA 2APOA 5BXIA 1I51B 3R5BA 4KRWA 2E5LJ 4Y28C 4LFAJ 3VGSA 4ED6A 2FJXA 2FDNA 3N5FA 3JSYA 4Q45A 1U4BA 3KJVB 1H72C 5E3CA 1HQEA 1RABB 4OYAA 3GLJA 3KLEB 1RWXB 2YNIB 4DV1F 2VFSA 1AXQA 2ALYB 3AA8A 2VQEJ 2QMWA 2BE7D 2R7SA 3KMSA 2OPPA 4UOGA 2ZH8A 5C24B 2B4VA 1NM2A 4ELVA 1HBNB 4OMFG 2LDYA 1SKRA 1CLFA 3JTOA 5ETKA 1JMTA 2MQLA 4EK2A 4RWXA 2C2MB 4ICLB 3MEDA 3I96A 1GMWA 1U2CA 3CJKA 1H98A 4MMOA 2MQ8A 1XNQJ 2IM0A 4X65F 2E9ZA 2GNKA 2XM3A 3G82A 4RW4B 2DR6A 2NCKL 4HH1A 4PZVA 2YNGA 3CIZA 1UVKA 4TU9A 2ZH9A 1S79A 2KT3A 4OI3A 1X8DA 3GMGA 3HT3A 3M8PB 2ZUGA 3AOBA 4W98A 3S6EA 4LF8J 4FKXA 2B6AB 1V3SA 5KFOA 4L3KA 3BSOA 2BW7A 4CYUA 3J7Z5 2ZBIA 3OHBA 1RT3B 3BR8A 5F8NA 2DCUB 1IR1A 2HIYA 4PYAA 4AL5A 3MCSA 2XNRA 3EGZA 1VRUB 3NLCA 3PHEA 2Y1JA 5C42A 3Q8UA 3D3BJ 1SJRA 4ECVA 4TYAA 1N88A 3CC7S 2GIFA 4GKJF 2W2QP 5HP1A 2XBPA 4HH0A 1SH3A 2KYXA 2MPUA 5SZTA 4JI0F 4FKYA 2Q1LA 4DMZA 2FUG9 4K4YA 2VFVA 2ROGA 1JXVA 1IBKJ 3W7BA 3V6KA 2ZJRQ 3BQ0A 2RJZA 2MZ1A 4YFUA 2ZOGA 2VKRA 4OJ1A 4Q2LA 4WE1B 1T8EA 2ZNZA 2MMYA 1NDCA 1B0PA 2W1BA 4C6AA 3M32B 5D0HA 5A0YB 3I5AA 3LGHA 3R5GA 5F9NA 2BDPA 1ACMB 3KJQB 5I4MA 1FDDA 3KHRA 5B7WA 3CGIA 3DLEA 2R42A 3HHDA 2BJ7A 2EFVA 1RT6A 5I3UA 4O23A 3OL7A 3LTOA 2K3IA 4KR0B 4ENOA 3IC1A 2GHVC 1FCAA 1X5TA 4DSLA 3OV7A 2AIRB 5GMEA 1BMQB 2RDJA 1NDPA 2AX0A 4A8MP 4CP5A 3GR1A 2NSBA 1KQGB 5HQMA 3JYTB 1S48A 2BJ3A 4A48A 4C3KA 2ZH4A 3GFXA 2EK6A 3DXSX 3H0PA 1JJ2R 2WOMB 3I0SB 5LJ5Y 4LF7J 2NSCA 3MD3A 3MPWA 1T03B 4U7UK 1EHWA 1EQ0A 3BEGB 4G6VB 1A7GE 3K5PA 2ERRA 2R4FA 3QGGA 4CO2A 3B4MA 2J7WA 4XIUA 2UXCF 3CB4A 2ASDA 2Q79A 1RKJA 2V2ZA 1ZS6A 2ZE2A 2BJ9A 4WFZA 4NPOA 5DGAA 1NUEA 4ZK7M 2KU7A 4P52A 2KXNB 5LSRA 2P6SA 1JLFB 3HD1A 4HVZA 1WOSA 3MECB 1VMBA 5GAEI 4LIRA 3JAMU 4CLTA 3DRYA 4USIA 4A8WA 3THPA 2JJ4D 3UW1A 4DR2F 5ETLA 3SV4A 3GG0A 1KONA 2JEIA 1UEKA 4JV0A 2XYGB 3TW0A 4I2QB 1DFDA 1U8WA 3DRSB 3UVJB 4OZ0A 1WOOA 4OZ2A 2BEFA 5L1LA 3EGNA 4ZIWA 1IJFB 4OZ1A 2V50A 4QPTA 3MZIA 1W2IA 1X9MA 4YP3A 2FY1A 4FXVA 2RF2A 4X4PA 3TZZA 2VG7B 2D9OA 3GJSB 3KG4A 5JMNA 4DPTA 2HBZB 1HNXF 4C97A 2OHDA 1KQKA 2MQMA 1HR0F 1TK0A 3KK2B 1U6BA 1X4GA 3DOLA 1UEUA 2CNKB 4TVAB 3JB9k 4ZHRB 3M2VB 3RB0A 4UOFA 3M2RB 2D69A 1S4EA 2VBXA 2ZH7A 4B9MA 4IRKA 1T3NA 4L74A 4UQTA 2RU3A 1YRXA 1EX8A 1SC1B 3K2YA 3M8RA 2JH3A 2CAJA 4NX9A 2R2UA 2V0NA 4ILRA 2DO4A 1G3OA 4LF5F 2M52A 4B3MF 2RIJA 1DRZA 5DM6Q 5L39A 3V4IB 1S12A 4AT1B 3PRDA 1WC1A 1NO8A 3PKMA 4I56A 4QJVA 2XI3A 1FKOB 3TVZA 1FRXA 5ETSA 1CJKA 3P96A 2B7CB 2HWTA 4J5OA 3A3OB 4Y0FA 5BYRA 3QRRA 3K0JA 1ULRA 2H4WB 4UF4A 4K0KF 1HQUB 2KM8B 4G65A 1SJ1A 2M8DB 2CQBA 1TL1B 3MFHA 4AXJA 1HI1A 2HFSA 1RT7B 2Q6CA 1Q7YT 5GAHI 1NJXA 5F8IA 2HHXA 4TLQA 1VIOA 2ASJA 3NS5A 4ZIVA 5FIIA 2CJ9A 3CPWR 4UUXA 5HATA 2DKOB 4ATNA 1DJ0A 4LVOP 3WIUA 4LF4J 4IKAA 3ETMA 2J9DA 2H5JB 1OJ4A 1IBMJ 3OTDA 1H0HB 1AROP 1KFSA 1X0PA 1C2PA 2MZJA 1HBMB 4K7QA 3M9NB 1R27B 1X0FA 4KH1B 4HI1A 3WC2A 2MEWA 4M5HA 3EVMA 4RKUC 2FVSA 1C1BA 4LR7A 4OV6A 4X62J 1U6FA 4ZS6A 2G0IA 4X4QA 1SL0A 4DR3J 2UZAA 3SQGB 5I42A 2HNYB 2XS5A 1IBCB 2JFDA 3M6UA 1M1KT 4IG0A 2IVYA 4KV8B 4RU2A 4DCOB 2RHSB 1PO6A 3SBMA 2CNLB 1SB6A 3TRGA 3SQOP 3M2UA 2L3MA 3D7SB 1HWLA 2HEKA 2JVOA 4J7CA 2HVHA 4FYXB 2E9RX 1XR5A 1RAOA 4I7FB 2RILA 3BB5A 1B7FA 2HMIB 3MM5A 2AMCB 2QIFA 1NZAA 1RBLA 3ONQA 4GKKF 2X1BA 4CO3A 3BKUA 3K57A 2DXFA 3L9ZA 2AWZA 1AZSB 3CCWA 2GIQA 2XLJA 4R8UB 4KGZB 3GJRB 5JXSA 2EXUA 1F5AA 3I31A 2YVSA 2YTCA 3US5A 1JQGA 4IO1A 2N7YA 1HPZB 3QT6A 4MK8A 2BQRA 3AFGA 2E5IA 1FE4A 3MCMA 1VDHA 1JX4A 4JB8B 5B0BA 2ZNYA 2C2EA 1TUGB 4RX6A 2A3JA 1U0HA 4OHZA 1XMBA 4ZITA 2FPHX 5E3QA 3VHQA 2AF6A 2ALZA 5LMUF 3W60A 2UUBJ 2E5HA 1KLMA 2IPOB 3IRXB 1QSSA 3T9ZA 2W9CA 4L72B 4WK1A 4DWIA 3UQSA 5B0AA 2HNZA 3CCLS 3X1LB 5KFMA 2HNDA 4B02A 4X84A 3MR5A 1D0EA 2VG5A 1Q5YA 5GADU 3DLHA 3DI6A 4EBCA 4DSKA 2ZHBA 2PN6A 3DRRA 2WAQD 4KY3A 1V6HA 2KJVA 4NXMJ 1RWKB 1HBOB 4MTPA 2IYIA 2YKMB 2CPYA 3MCOA 1T0TV 1M1HA 1SQEA 2QZ8A 1TKTB 3CD0A 3CCES 5HO4A 1RP5A 1PJ6A 4WP3A 2J9EA 2EC0A 4I1TA 3KUGA 3E01A 4WCEQ 1SV5B 4RUHA 2ZJPQ 4F2SA 2UP1A 3PCOB 3KLGA 1RT5B 2K7KA 2CYYA 2EKNA 2DY9A 1D8ZA 3GYGA 4QWCA 5KFXA 1XMOJ 1TK8A 4Y2AA 2MLZA 1RTIA 4RJVA 3JQKA 2Z0GA 3JSMB 3RAQA 2W9BB 3DMJA 1RLCL 3HHLC 2JX2A 1S1TA 4FBUA 4B9TA 3CMQA 3DGPB 2XLKA 4TYBA 2OMLA 2V34A 4DV2J 2B43A 1SL1A 5B0FA 5B0DA 2EK1A 1QE1A 1FRMA 1RYRA 2HFOA 2XZTB 3CCUS 4HLBA 3VAMA 1S1UB 2MQNA 4J9NA 2WHOA 5HQ8A 1JLQA 3RW7A 5HN0A 3I0RA 5KFCA 3P45B 1ITPA 3TVKA 2AJ4A 5HVHA 4DU8A 2FIUA 3SCLE 1R6VA 4BHQA 3ENAA 4LR9A 3G9CA 2Y1IA 1X5SA 3IGVA 2KVIA 3TAQA 5GMKa 4YMEA 1H3DA 2HG4A 4QWAA 1S0VA 4TKTA 2M88A 2GJIA 2OPQB 1RKIA 2CG8A 1EETB 5DDRC 3EXCX 5EX0A 4DDFA 5KFHA 2L48A 3I56S 2ROEA 4WKRA 5JVHQ 3CD7A 3JTNA 4DL3A 4D3GA 1M0SA 4RUBA 2FB0A 4B3SJ 3ZNUA 1CPZA 3H20A 1IQTA 2XY5A 2HZAA 3W5XA 1KSPA 5C7PA 2A2CA 2VV5A 4KKOA 1OPIA 4ILLA 3TNVA 1WDDA 3EDRB 4MIBA 1TTHB 1HNZF 4URSA 8AT1B 3TR5A 1CC7A 4OL8A 2RS2A 4RW9A 1UL3A 2LFVA 1R0BG 2W8LA 2RAQA 4DEZA 1U48A 1U6ZA 3I6PA 4F4WA 1FNOA 4JI3F 4CLSA 4H4MB 1RHMB 2SXLA 4IG3A 5KG3A 1VK8A 2L9WA 2HFVA 2J9DE 3B82A 4KO0B 1MG7A 1BQXA 3RB6A 2BMBA 3D6HB 4YR2A 4DUZF 2DNYA 5KFWA 2YNFB 3DDNA 1BXNA 3BBBA 2UVVA 4ZN1A 5AJ3J 2QA1A 1JNZB 2XWYA 1V5IB 4P74A 2HK3A 3DHXA 2V4QA 3ZC4A 3CT9A 4LF2A 3GIJA 5F0UA 3ETOA 1VLOA 1CJTA 2VICA 3CJTA 4BS2A 1T9XA 1R8PA 2EBEA 1VC6A 3CDEA 3MUVP 4IRDA 1UMJA 2YH0A 1VBKA 2VG6B 4ZPBA 3ZFVA 2DBBA 2YY3A 3EZUA 2UUWA 3AXKA 1VBXA 1EZZB 1S1VA 5J2NA 3V6DB 1VQ8S 5GAGU 1EKRA 2E7WA 4DUYJ 4ZVGA 1GK8A 2EFPA 4LSLB 2H51B 2E5LF 4C48A 4LFAF 1FXLA 2EFNA 2JC0A 1RZMA 3PW5A 2LDIA 4PCQA 1R31A 3QT5A 3NAIA 1ZETA 1TUVA 4KPYA 1M90T 3VAHA 1YI2S 3W66A 3RW6A 4FF4A 1JKHA 2QC3A 3N79A 1F5BA 2CPDA 2UXDF 1X4AA 2Y1RI 5E33A 3KUHA 4DFPA 1UVIA 3EVWA 4LIWA 2POKA 1PYSB 4ECWA 1CJUA 4A47A 1PJ7A 3T1YJ 2OMOA 3IAM9 2C2ZB 1T95A 2GZOA 2VQEF 4CO1A 3DU6A 5LMNJ 3OUYA 2HBRB 2F4VJ 3BH7B 3KLIA 3PJXA 1QAYA 3D67A 1LK5A 3LAKA 3VTIA 3DRPA 4N47A 4QW8A 4JI7J 5HK4A 4UOHA 3KUEA 3HJVA 4EBEA 1WOPA 5E5NA 1JB0C 3GFHA 3IFEA 4BLGA 3CO9A 1HL6A 2F4FA 2HHVA 5M2PA 5KT3A 3NOGA 2YX4A 4O3OA 4KB7A 1IKXB 1QY7A 1O8BA 2DTJA 3G6VA 2L9DA 2IRXA 3QRPA 1J2VA 4PXDA 2YXLA 4NEZA 1YK9A 3FMWA 4LF8F 1GXTA 1NHUA 1XEZA 1BHNA 4RNOA 1C1CB 3GJQB 2W2OP 1QUPA 1VBZA 4ECSA 5D4PA 1UP1A 4USWA 2MJNA 1G4CA 5HANA 1QUVA 5A2QY 1R0CB 2N4DA 4F4KA 3MUMP 4ZPAA 2Z2LA 4LSNA 2IBKA 1NK7A 2Z4PA 2DRDA 2HFZA 4ANCA 1OSDA 1PBUA 3RB3A 1KP6A 1F3FA 2LA4A 2ROPA 1FFGB 1VQPS 1FKPA 1T11A 5L38A 4JI6J 3DYAA 4EEYA 5HL7Q 1WHXA 3CD6S 2XY6A 4OYBA 4OYXA 4EBDA 3Q24A 2ZD1B 3HP6A 3A3PB 4PG8A 3CCRS 4G1QA 3G96A 1QD1A 2F7VA 2ZVSA 4C4WA 1GMWD 3AD9C 4FNIA 2MY8A 3A1YG 1LWEA 4X4UA 3NG8A 4IOBA 3HHEA 2GV1A 4F3OA 2QGFB 4Z7CA 4LFBJ 3Q86A 2MKCA 4IOCQ 2H48B 4ZP9A 1VBYA 4TN2A 2J6UA 1BD6A 5RUBA 4LQ3A 3BBFA 2W01A 1FJEB 4C3LA 2MHEA 4P7VA 1BQMB 4KFBA 3W8PA 3LOUA 4C8OA 3DN9A 2QTWA 4N41A 3TOQA 4JI4F 1UFKA 5ETMA 3J81Y 2E1CA 1SQFA 1ZYQA 5A8KA 4G1IA 4K2JA 8ATCB 4BCAA 4JI2J 1F1BB 2D41A 3MPDA 2DRBA 4LF7F 2CG4A 1R89A 5BR8J 2BKOA 1N5YA 1KEKA 1OSCA 2CJKA 4MAKA 1MU2A 4XK8C 3R7BB 3L4BC 2IY5B 3KK1A 3P8BB 1TFYA 1S6OA 4DPYA 1S9FA 2DHGA 3QO9B 4Y00A 4N8NA 1VQKS 4YB5A 2FHKA 4R25A 1TKXA 4RZRA 1Y0HA 5A2QU 3CVKA 2MKHA 5L46A 2YNHA 1R8HA 3UCGA 1KBRA 2G0JA 1KS2A 3R7NB 3GFZA 3FBCA 3JSBA 3FQLA 4DBQA 2YNIA 4P2XA 3TVYA 4CH1A 2QSFA 1KVIA 4DV6J 1DHMA 1BE4A 4JV1A 1WEXA 3QZ7A 3NMRA 1KLNA 2KHCA 1GTEA 1Q5VA 4DHVA 1YZ7A 2HQFA 1BY9A 3RRKA 1Q0NA 2COLA 1Q8KA 3HF5A 2GMJA 5A8RA 5H9EK 3IR6B 3Q83A 3TZXA 1SH0A 3BBCA 3RR8A 4RUAA 1GFWB 1EJ7L 3DLGA 4XDDA 2VUGA 2YKAA 2DGVA 4B3RF 4DV7F 4PWWA 1GMVA 1HNIB 2IJRA 2AJ1A 4I0WA 2FJEB 1K44A 1J5OB 3CXCR 1E6YB 3BSAA 3SMZA 4K4XA 3R2CJ 1B4SA 1VHFA 1N56A 4HACA 4AL7A 3R3TA 3NRBA 4PUOB 1TMJA 2MLYA 2B9WA 2CQ1A 1RADB 1W7WA 3C6UA 3ZZUA 1CEZA 4IDKA 4A8XA 2KM8C 1N6QB 2UU9J 2Q3PA 1H2VZ 6FDRA 5MAOA 5EUHA 4P72A 2JWNA 1S0NA 2I5JA 1S4FA 1IQZA 4RO0A 4DS5A 2VF3A 1U49A 5CD4H 1VRUA 2C2KB 4I6AA 5DQIA 1JLGB 4I2PB 3D0HE 2MKKA 3AQPA 1KC8T 3K5OA 3GR0A 1ROFA 1H74A 2NXUA 4XDCA 2CVEA 2B9EA 4IH7A 1U1RA 1FWPA 3QBCA 2LEPA 3CJ5A 3GCXP 2OTJS 2FHOB 1TKZB 4OHXA 3TQ1A 1M1GA 2ZBQA 4YY3J 3Q8YA 5T7LB 2VASA 2D3UA 2XMTA 3IG1A 3AB4B 3WIVA 1ELOA 4WE1A 5AXKA 4ED8A 3FFIB 2LXFA 4BBYA 3MAAB 5BJRA 3W9HA 4P2MA 3BKTA 2GFFA 5KFGA 4NLQA 4A4JA 2UVUA 4DR1F 3MPUB 2W25A 2VBWA 1SJ3P 2IAJA 3H5YA 2HIQA 1YJ9S 4DCPB 2B51A 3FMBA 3E8OA 2RB7A 3OSPA 4X62F 4M5DA 1TZ0A 2H3EB 2XCAA 4YDXA 2AHOB 3IO1A 2FHJA 4DV1J 2EKYA 4DR3F 4OLPA 1HD0A 3H2VE 4J9UE 5LJ3Y 4NA2A 3MMBB 2OFGX 2EWHA 1RT2B 3ZTOA 5LM7E 1SC3B 1GTHA 3NNCA 2HQ3A 1R43A 3OSNA 1U25A 3MPVA 3CCSS 2VBYA 4DL4A 2ZOMA 3WC0A 3ENWA 3HSJA 2Z2YB 4JV5J 1TVRA 2LEAA 2QRRA 3S8SA 2X1GA 3IGNA 3I4HX 5AE1A 5CAAA 1RTDA 3K17A 1RDRA 3TEGA 5HAOA 2V94A 1QTMA 2N3LA 3OFHA 4A8KA 2DPJA 3BS9A 4OYMA 4ES2A 1UVNA 1H7XA 3AAWB 2AGQA 3VAJA 4IH6A 1EQMA 2DNHA 1U09A 2XMWA 1CQNA 2GAGC 3MECA 4C8MA 3R9LA 2O3DA 2J76E 2RU9A 1QJHA 3W5YA 5KFDA 4EO8A 3IS9B 4OZLA 5KOXA 2VPXB 3CDAA 3TAMB 5D8HB 4ED7A 1JXLA 2PMZD 5KFAA 2XSFA 4RPFA 2UUTA 2BKNA 3C66A 1YBAA 2FC8A 4KJIA 4O44B 3BGRB 2JZ5A 4YB7A 3SDEB 3KHGA 3PIOQ 2V68A 2UUAF 2UUBF 3LA0A 3W2WA 3PX6A 3UI3A 1NK8A 3EPGA 2YWGA 2ZITA 3UNGC 1RAFB 4P7TA 3HVRA 2UXBJ 3H5XA 5K8OA 2J0QD 2CUYA 3W9JA 4DPWA 3M2VA 2BJ8A 1LK7A 2F9DA 3P3DA 3HZEA 4NXMF 4ECRA 3O2IA 4UY85 3UN3A 2C3OA 2OUGA 5D0GA 4NLXA 3TJ9A 2W8KA 1T9VA 1XR7A 4Y34A 2BJEA 3OLBA 4L75A 1RWVB 4NASA 1WSRA 1KQSR 5D4NA 1TL3A 4A46A 4DF8A 4ZPCA 4NYZA 4A8OA 4NMXA 3OVSA 3MR3A 1FTRA 3OTEA 2PGCA 4DG1B 4PWDB 3TANA 1U0SA 3R97A 4DS4A 2QSWA 2QLFB 2LCWA 4DR4F 1RT7A 4ZLNA 1DLOB 2E1MC 4F02A 1HHTP 2VC1A 1HI8A 5DLGA 1WI6A 3NP5A 2ZBRA 1NCLA 1NJIT 2YBVA 2JHEA 5FLXY 3WX8A 1Y00A 5E3PA 3Q8SB 1KTVA 3W1YC 3PR4A 1VRTB 2GO9A 4C8LA 4DV2F 1ZM9A 2ZBPA 3M8QA 1FESA 4PAAA 4TQRA 1XJWB 3IWXA 1LW2B 1S6UA 3HVAA 2WB1D 3ET6A 4CT8A 3ADAC 3CCTA 3SQGA 4ZCIA 5DRKA 4FYDA 3I55S 3DKDA 1YQHA 3PX4A 5B09A 3DDIA 2QA2A 4J9MA 1OMSA 4ZPDA 2AX1A 2Z58B 5CYQA 4GVBB 2WONB 3QZ8A 2CRLA 3H98A 7AT1B 5DG8A 3OW2R 4DPOA 1HWIA 2OKQA 3UR0A 1KWMA 1JJCB 1UPMB 1XWLA 3M6WA 4QYZJ 4DSJA 2ZH6A 3MF5A 3CULA 2DR8A 2VDHA 3JSRA 4WP8A 5HMZA 3UN2A 2ILZA 5C2CA 5KTQA 4NE9C 2XGQA 3QT7A 1X5OA 1R0AB 3KLFB 2E1AA 1YBUA 2IYGA 3QIDA 2C3MA 1DARA 4O4RA 3MEEA 2XSJA 5K14B 2ACMA 2Y9HA 1NSQA 3IM9A 1YJWS 1FRJA 4HHHA 2HQGA 3JS9A 4MFBA 3RBDA 2RQMA 1QSLA 1TR0A 2W2PP 4RW7A 5C25B 4LF5J 4B3MJ 5U47A 1TL7A 2LVWA 4IFVB 2FJDB 4FPIA 4NWBA 3AODA 2NXJA 5KFUA 3O8WA 3C6TB 3J7AN 4ZP8A 5IOLA 5FLXU 2WSFC 3HMJG 2QL7B 4DL2A 5HLFA 3UE2A 1VISA 1WG1A 4ZVPB 3FQKA 4NZ0A 2B9YA 1UCNA 4OJGA 4B9LA 5DQHA 1ZZFA 2DGTA 2AZ1A 2MKIA 5J1NA 3GQCA 4Q7AA 3M9MB 3MTKA 3MR7A 2VQFF 4IFYB 4FP9A 1IM4A 3W2VA 4KBIA 1HNVA 2XMAA 5AJ3F 3IR5B 1UWBB 5KG5A 1H73A 1CULA 3CCVS 2VFUA 4M95A 2AJFE 5D3GA 3R1LA 2QN6B 2HRYA 3MWBA 3OTCA 3KWMA 1HYSA 2M70A 2BANB 3MMCB 3PW2A 4EFAC 4X64F 2P6TA 1HKAA 3HT0A 2WZ1A 2C28A 2B4PA 1D9AA 2RVJA 2C3UA 3BPSP 1IKYA 3L7PA 1KR4A 5IT9Y 1U7LA 1IWAA 2J0WA 1S9EB 3NBPA 1FD8A 5I3PA 2LKZA 3V4MA 4TY8B 3UD3P 3G8SA 3EVOA 2HHSA 3PDNA 3G71S 3BPDA 2EVZA 3MMAB 4QIWD 1RA7A 2KHDA 4USHA 1OYEA 3GU0A 2V4JB 3W3SA 4PWUA 1FVQA 4WFYA 1X4BA 1N48A 3QIPA 3C14A 5DETA 4WZMA 4CO4A 4GKKJ 4L3NA 2AGOA 3C2PA 3BSCA 3EM1A 4TY9A 1NPKA 5J2MB 2ZOFA 4NEYA 2RDIA 2ADBA 1WKKA 3ZTRA 2M7SA 1XNRJ 3OQ2A 2D9PA 3DOKA 4O4GB 1RCXB 1S59A 1YWXA 4KC5A 1N52B 4CI0B 1HLWA 3MTJA 3IA0A 1VC0A 3A12A 4UQGA 2PMWA 4MYTA 1U1LA 5LT5A 4JI7F 3A8JA 1BGXT 3PYEA 1JLBA 2I8EA 4E8UA 3UDVA 1JLEB 4M5KA 5IT0A 2IC3A 4WIIA 1F2GA 1Q1KA 2CA9A 1VFJA 2F8HA 2ZH3A 2YKNB 3TJAA 4ZJQA 3J80U 1FDNA 2IM3A 1Y5LB 3WBZA 2NREA 1VRQC 2ZH2A 4ANEA 4YEAA 2HLTA 4F4XA 3T5LA 1ZA2B 1YJ7A 3D54A 4A8QA 2VDIA 4TLRA 2MJUA 2H5EA 2DD8S 3FUYA 2MZSA 2BE9B 2R2SA 4DL7A 5M2RA 3EXYA 1IKVB 3M30B 3BR9A 2BV3A 2BJDA 2MYFA 2G2OA 4AUKA 5HROA 3P5TL 4QWBA 1Y7PA 4C0OC 2XLIA 3D1HA 2IVFB 3R5AA 2F3JA 5EX3A 3GTYX 3GYNA 2KFYA 2WTFA 5DDQC 3G4SS 2XGPA 3C8YA 4JI6F 1E6VA 2CZ4A 2DB1A 2RHQB 2ZHAA 5LSOA 4HT5A 4PPDA 3MM8A 4H4MA 1HQEB 1R3NA 3Q2SC 3BGFA 2GVZA 4Q0BA 3BYRA 2LP4A 2CQ4A 2BW2A 4NLOA 5IFMA 2C1EB 5CYJA 1P1TA 4NLDA 2OPPB 4KE5A 1SUQA 4EO6A 4F0MA 1SJ4P 1MN7A 3NGRA 1RBAA 4QOTA 2KJWA 2PO4A 4Y2KA 4J9OA 2AEFA 1FRLA 1RTHA 4LFBF 1C0UA 2PA8D 3MEDB 5AXMA 3CJKB 3MM6A 1KKHA 4WFXA 4NL5A 5FDLA 2NXCA 4ZPTR 2CJQA 4K4SA 2M3DA 3AH6A 1S72S 3J7YU 2YNGB 1NKBA 3PKYA 1FI4A 3LGNA 4KHMA 1VHIA 2ASYA 3NGKA 1D09B 4JI2F 5F3ZA 3OHAA 3TWZA 5LXRA 1WD6A 1RK8A 1SIWB 5D78A 4XO0A 2E1RA 3ENQA 5KFNA 3ICLA 2CJXB 2IM1A 4NLWA 2MB0B 2FTRA 3RG6A 4HKQA 3KDOA 4WU3A 1A6LA 4ECZA 4QWDA 4CYUB 1SCJB 1VQYA 3O1LA 4WXWA 2ATCB 2ASLA 2EFOA 4N56A 3X3UA 1Q86T 4DL0C 3UDEA 1YITS 3P5BP 2V8PA 4O0IA 3PX0A 2K8GA 5C42B 4B08A 3OXGA 1S6PA 4CLYA 4F04B 4DV6F 3PEJA 5IQ6A 1J27A 5HP1B 4FN5A 3KLVA 3I9V9 2NS1B 2E5GA 4ED0A 3SI8A 2CDRB 3RU0A 1NH7A 1DTTA 4WF9Q 2LLZA 2XEXA 4O0NA 4FDFA 1FT8A 2DR9A 3JQJA 4WTYA 2BBEA 4HT7A 1HNZJ 4KIAA 2CDQA 4LRDA 1YJNS 1ZPWX 3M8WA 4P2FA 1PKUA 3PRBA 4EGLA 1KD1T 4GO5X 4WJBA 2NZ4A 1K1SA 2HHTA 3V2UC 1FKAF 1C0TA 3DLEB 3DOMA 1YG0A 4HEA9 1RT6B 5CZXA 5I3UB 4LBIA 1ZH5A 1T9WA 4BWJA 4DUZJ 1HD1A 4RBUA 1YTYA 3BDEA 2N4CA 3U7JA 1X4HA 4ID8A 3NAHA 1Y10A 2BQUA 2JLEA 4WFAQ 2BRKA 2DHSA 3UR3C 2WB4A 2ZC3A 4NZ6A 1O0PA 4IQMA 2FVQA 5H9FJ 1LXNA 3KG0A 4XPCA 5L1KA 4GRSA 3QGPA 2RD5C 4X4TA 4DN9A 2X3DA 2OAUA 1VI7A 3DXBA 4YY3F 3S1TA 4B9SA 4FBTA 4YDDB 3MM9B 1WACA 5D4OA 1YJTA 3BN7A 1PGZA 3DLJA 4RW8A 2DCLA 4NLSA 1CS4A 2OFHX 2ZD1A 5KFPA 1RUSA 1SL2A 2LQ5A 1XR6A 3HHKA 3DCAA 2HURA 2LQ9A 1MWZA 1NJYA 2Q6BA 2CPEA 4K4TA 5D0EA 1MNEA 1I94J 4LQ9A 2UXDJ 3V81A 1CSJA 4EZ9A 3A13A 2DNPA 1K0TA 3J7ZT 1XK8A 3N6NA 2DK2A 2JC1A 5E2QA 4J9LA 2Y0SD 4B3OA 4HHJA 3PV8A 3Q23A 3T41A 4W92B 3SSQA 4DU7A 1LQ9A 1ICEB 4GMKA 1EARA 4PRFA 4ES3A 2MGZA 2RF2B 1TV6A 3CC4S 3PYDA 4PXBA 1AW0A 4CH7A 2CWXA 4ETZA 1Y5IB 4AD6A 1Q4RA 2WVFA 4FYWB 3KG1A 4C0BA 2LXUA 2KT5A 3PXGa 3DOLB 1BQNB 3R2DJ 4P10A 4P2SA 2MTLA 1BC6A 3OTOJ 4JV5F 5F9LA 4DPXA 1YIJS 1DQ8A 3HDSA 1SIZA 1B7YB 4CNZA 1QAXA 1YGYA 4OIXA 3GCWP 4AQYJ 3CJ2A 4ZOSA 4EWTA 5AE3A 4CLLA 5DZ7A 4LSZB 1QTNB 4WKYA 2NQPA 3PFOA 1QSYA 3QWUA 4N76A 1WC6A 3MDFA 1CJKB 1UTAA 4F36A 2GGPA 4NZ7A 4C8YA 1RE1B 1IR0A 2DGOA 2FGCA 3PIPQ 2RT3A 4ZCMA 2MSTA 2RE1A 3VGVA 2GCFA 2E7VA 1MMDA 1LFWA 1RJJA 2G9OA 1XMQJ 2OELA 2AJQA 1CG2A 4PR6A 2IA0A 4M63A 4F3MA 2XYPB 1S77D 2WK4A 2IBOA 4CNYA 1RAJA 4ZN3A 2FHJD 1PYTA 5J2PB 4PXCA 2DGWA 2DNOA 3C15A 3LPEA 1MROA 2UXBF 4MYUA 2YH1A 1C1BB 2CFXA 4J9QA 3VZIA 1B70B 3BGOP 1ZA1B 4DSIA 2BQ3A 3TYTA 2XTJP 5I42B 2IJNA 1RAHB 4IG0B 2XMUA 4PABA 1NB2A 2H4YB 1H2UX 4AFFA 5MLCV 4DV3F 2A6OA 5G4DA 5IM0B 2JLGA 2NLWA 3M2UB 2ZM6J 3DGVA 4OZNA 2WW8A 4YUDA 2XMMA 2NXEA 2HK2A 4JI4J 3MR2A 1VQ4S 4OI2A 2ZFHA 3MM5B 4CM2A 5CHCB 2LQBA 2ADCA 4DF4A 4A8SA 1NLKL 5THWA 4X4OA 2DPIA 2B5JA 4D3HA 3GWCA 2HWHA 4UW2A 4C11A 1M5KC 2HGNA 4WTOB 3BO3A 5DO2A 2PI4A 2VONA 1HHSA 2VJVA 4C98A 4MK7A 2DT9A 4ANDA 1NKCA 3MPYA 5KFSA 4ZCLA 2V5HG 1N5VA 3EX7B 3C3LA 1Y9OA 2WRMA 5ETQA 1S5ZA 3GIRA 3E51A 3IR7B 3OR2A 2K1RB 4LFCF 1SH2A 4ZVQB 1D1UA 3GE9A 1U0HB 1LWFB 1Z2LA 5D15A 2A1BA 4QR0A 3N6MA 4CLZA 5HMXA 1BUXA 4OHWA 4AL6A 4LF9F 1KLMB 2W9CB 1APSA 1IM6A 2GA7A 2K3KA 3J81j 2HNZB 1S9GA 2HVZA 2HNDB 4V1Ak 3Q8QB 2FLNA 1VIXA 2DGSA 2VG5B 3CCMS 4U9RA 1GXLA 1PJ5A 3DI6B 1U26A 5A76A 2VJUA 1RXOB 3UO0A 2OPRA 4B3RJ 2C3YA 4DV7J 3DRRB 1TFWA 2IM2A 2RQCA 1ZAXA 1RAGB 1D3WA 4DQQA 3TUIC 4OZJA 4TQSA 5LXYA 3K58A 4WWSA 3RYLA 5K8MA 5F8LA 3FKBA 1BWEA 4ITSA 4JI1F 4N5SA 4ECTA 3E2EA 4JOUA 2CJBA 5AT1B 5HI7A 1U02A 2LYVA 4DR6F 4MKBA 1QVGR 5L9XA 3QLHA 3ZZPA 1U1PA 5LL6d 5KFVA 3PHTA 4CWBA 3D0GE 4U7UD 2QMXA 3C16A 3E01B 3IS9A 2D3O1 4J9SA 1W25A 2Y1LB 1RWNB 1M5VC 4FYYB 1NH8A 3OVBA 1MLAA 2ZEJA 3KLGB 4J9RA 2C3PA 4F50A 4ED1A 2F8EX 4QZVB 1M5HA 1RTIB 4QIGA 2QLBB 2W4PA 1TP7A 2YWKA 2RKIA 3F44A 4Q2MA 3N9UC 2UVRA 1NSAA 4USUA 3OXLA 1S1TB 2H9ZA 2UV8G 2RUGA 3UDCA 1SC6A 1NKEA 1RU2A 3A3NB 4LRCA 1SXLA 2OLWA 4XAKA 4ER8A 1ZBTA 3KJFB 3K59A 3CMAS 1QE1B 4NI2B 2HKEA 1VGYA 3AD7C 1WHYA 3OT9A 3GJTB 3OXFA 2HS3A 9RUBA 5EGYA 2J6TA 3I0RB 2V8HA 2OIHA 4DR1J 2D1CA 2LECA 4QIFA 3GIMA 2BKPA 2GMHA 2VD3A 4CTAA 1K47A 4GO7X 1WTBA 5GADI 1P6TA 2DR7A 2KH9A 4YHHJ 1N33J 3KHHA 4NRTA 5KT2A 4NRUA 3F41A 2OPSA 2CQPA 1RU1A 1DTQA 3G8TA 1S0MA 3MHYA 2XNQA 3CC2S 3EGVA 3MCNA 5F3TA 1U1MA 3SXLA 3BSNA 3EYZA 3PM9A 4QIVA 1EAYC 5K9FA 1FHTA 1XN9A 1LW0A 3PO4A 3W64A 3M8ZA 5IV4A 4DZ6A 1AA1B 5HBMA 7FDRA 1YX2A 3RB4A 2PFFB 1WNEA 4UZBA 3ZTQA 5CD4A 3WDOA 2HVIA 2DEIA 2H1YA 3GZ7A 3HULA 4KKOB 4NLRA 2IRUA 1MMNA 1L3UA 4E98A 4RNMA 1T3OA 3LP0B 1LV5A 5ETOA 1OIAA 3SEOA 3R6GB 3V6JA 3NNHA 3ITHA 2HHWA 4RW9B 1XNRF 5C2GA 3PZPA 2VA3A 4URQU 5CCMA 3UN5A 2HPUA 1WEYA 2CWKA 2VZ9A 2G2ZA 5IQQA 2DRAA 4IG3B 4OZ5A 4USJC 3SV3A 3SSRA 2G2YA 3HKZD 3QATA 1S6QA 1K9MT 3DRXA 1FEHA 3HSZA 4M5IA 4LRBA 4E2FB 3LP1A 1SQGA 3OLAA 1FJGF 3FBEA 2F9JA 1TUWA 2UUAJ 1N5QA 4LJMA 5EWEA 5A8WB 2VL1A 2X51A 3FNNA 3KTQA 3EGWB 1NDLA 3CUNA 3JQMA 2KT2A 1S10A 3LP2A 1CJTB 4OYZA 3K5MA 1IBLF 1IUJA 2CQGA 2ZVIA 2JFKA 3FSXA 2XQCA 2FLLA 2K7JA 3H7HB 2IDEA 4CRJA 2J6SA 1CJVA 3H5UA 5K14A 5J2NB 2VB6A 1CC8A 1F9HA 1V5VA 4M5MA 3MAHA 1LWCA 4IUFA 3OFGA 3P6YC 3LQVA 3QWPA 2OI2A 1NK9A 4DV4F 1GQEA 1S1WA 4QBUA 5DJBA 4DLGA 1NRKA 1XC9A 3O5TB 2ZKUA 1AT1B 1WWHA 2CPXA 4QR2A 2J0XA 4FF3A 5D6GA 2ZH5A 1H38A 4O3SA 4Q8FA 2OJ3A 2BE2A 4JBCA 2VA2A 3KLHB 4DR4J 1YRTA 4HI2A 5F41A 1HMVA 1CJUB 2MSSA 3MR6A 2DVIA 3H5SA 4U67Q 2XG8A 2R7TA 1S1XA 2YKOA 5KT6A 3CCZA 3W65A 4ZCKA 1RAAB 3DM2A 3OUYB 1IWGA 4F25A 4ZDNA 3KLIB 2HHUA 1Z4UA 4K4UA 3GB0A 4ED5A 2VODA 2W2NP 2VPYB 5J2QA 1B3TA 2QYGA 4B3TF 1N32F 2QT7A 1SBRA 4U8VA 1DBDA 1RCOB 3TUZC 4KH0B 3QJJA 3MMCA 2OEKA 4WXOA 4USMA 4DQSA 2JL9A 2NUUG 3FSIA 1LOUA 1IKWA 2BUNA 1JK9B 4JI5J 2RRAA 1X31C 2DEJA 4PQUA 5DS7A 2C2RA 1F60B 2EG2A 1HNWJ 3BO2A 3PYGA 3V6HA 2NPFA 3NGSA 2HFNA 3H8YA 4FZVA 5GAGI 5DGBA 1Q8BA 3OJUA 3VQSA 3CDUA 1XIQA 1JIHA 4LSNB 2VIHA 2ZH1A 3CJRA 4GC6A 3O6QA 4BC9A 4J9PA 2CXEA 2K2PA 4H54A 4UZCA 1UVLA 3DLKA 2KRRA 3B78A 3TX0A 3OR1A 2X1FA 4RW6A 4RWWA 3NGDA 4CCHA 4O4GA 1VQ7S 3DYAB 2LQJA 5IXUA 2R7WA 3POTA 4QW9A 2EI5A 3M1VA 4G3IA 2C22A 4L73A 4ETXA 3MM7A 1G1XA 3U1NA 3HKWA 3CJ8A 2RSQA 2DIVA 2V9WA 4G1QB 5KFTA 3IAS9 3W8GA 4J9VA 2HS0A 3CJ0A 2JRSA 4K5RA 1F6TA 3N4WA 4XTTA 1WI8A 5KG0A 4ID5A 1HHQA 1GX6A 2PI5A 3HFVA 3VWSA 3FC9A 4ECUA 3RR7A 4DX5A 4NMLA 3KHLA 1T02A 3HFKA 3D1QA 1YVFA 3KK3A 3FBFA 3TA2A 2VQFJ 4QCLA 2M4MA 4Q8EA 4KFBB 4CLUA 3VAKA 2RMLA 1WC3A 3M8SA 5CQGA 2KYZA 3IMQJ 3EWGA 3LUYA 1I6JA 3P49B 3SZ2A 5CABA 5A8KB 2V4RA 3K5NA 2XO6A 1FX2A 1ZTWA 3RRGA 3AY0A 2Y8WA 1N54B 1N5YB 2RQ4A 2XMVA 2VFRA 1EP4A 3LWLA 5IT4A 4X64J 1H2TZ 2FVRA 2MQOA 1MU2B 2NYHA 3T1HF 4OZ3A 2RNEA 5EWFA 3KK1B 3L3CA 4N77A 2Y3YA 4FVMA 3T1AA 1DZ5A 5A6PA 5CA5A 1P1LA 4J90A 3GIIA 4K4WA 3N28A 1TKXB 2DY1A 2W2MP 3H42A 3IWLA 4RNNA 4LRFA 3FRYA 4P6QA 1ZM3A 2MKSA 4NYOA 1ZZNA 2YNHB 1Y5NB 2BRLA 1AFIA 1RT1A 4NCGB 1K73T 2FGOA 4WU2A 2DNQA 3BZQA 4KGKA 5KG6A 5E7OB 3GONA 3K5LA 2O67A 4IO9Q 1I94F 3QAEA 4HTJA 3BGUA 1MWYA 2WBRA 3HVTB 8RUCA 4DJBA 2R7VA 4R5PA 4I6WA 5DZ6A 2JNJA 2G0CA 2Z2MA 5A8RB 3QSIA 2VBZA 4RBTA 1PBAA 3D28A 3KXDA 5CYMA 1SVDA 5G0RA 3IN5A 3DLGB 2QLJB 1G6BA 4QYZK 3HHLA 3HK2A 4YB1P 2XZWA 2FJVA 2ZWPA 2XYHB 4NLYA 2WCXA 4N8OA 3A8KA 5E3RA 1HBUA 1L3VA 2A2DA 1SC4B 3SSSA 1RACB 2CQCA 1U1NA 3LF0A 1RT4B 2MDAA 3OTOF 4HACB 2CPZA 1RAEB 1RHJB 3C6UB 2HWIA 1NPPA 4IDKB 3NWRA 1SPBP 1MN9A 1KOOA 5FJ4A 3QJPA 1NAQA 2I5JB 2MZRA 4AQYF 2FJAB 4OI4A 2DNZA 1FDBA 3MEGA 3M9OB 4F3QA 1L5UA 2XO7A 2DNNA 3GILA 4WYLA 3OL9A 3M8YA 2J7UA 4HYKA 3JAMY 5K8PA 1FK9A 2PFDA 2JOQA 4U8YA 2FYXA 2HRTA 2HFUA 1JLAA 1KQFB 2P5VA 2V69A 5IWAF 3MGJA 1O5JA 1MSWD 1VC5A 1Q16B 2CQIA 4ZVTB 2W7PA 4I64A 4RR5A 2CJYB 3IG1B 3RUBL 1XMQF 2QA4S 2FZGB 1QVFR 4U96A 3HO1A 4X66J 4OYIA 1ZAWA 2X1AA 4K2XA 4TU7A 2IMOA 1T05B 4CIOA 2KG0A 1RTJA 3H40A 4PG7A 2EEYA 4DUTA 2CQ3A 2IAJB 4C8NA 4IR9A 2XS7A 2HHPA 3WX4A 1ZM2A 2QV6A 4M5DB 3FBBA 3G6ES 1MW7A 3TX8A 2YX7A 2R8HA 2UUCJ 2J9CA 4KYZA 3RTVA 2AT1B 1WC5A 1RLDA 1REVA 3A8IA 3H2UB 2MY7A 3CW2C 1VQ6S 2ZDPA 4CT9A 3MMJA 1WKLA 1S99A 1X4CA 4USTA 3TZYA 1DQ9A 3FCWA 4IQXA 4ZA1A 1NU4A 3QMQA 1U2FA 2HGLA 3KKFA 2ZM6F 4P73A 3BQ2A 2KDOA 2GVDA 1TL5A 2HLUA 1TVRB 3KNGA 3UD4P 5ETVA 1RTDB 1C4CA 2O01C 3VVTA 4ED3A 1RYSA 3MM9A 4G1PA 1VLYA 4U95A 2E5JA 4DSEA 4DV5J 4E0DA 4HDGA 3NXZA 2R7UA 1OQ3A 4C8KA 1Q53A 4RLEA 3PJWA 2DXEA 1YSJA 2GX8A 4NXNJ 1EIYB 3CNQP 4CZCA 2M5YA 4WBFA 4TNOA 4MK9A 2CPHA 3AD8C 1QAIA 3KJVA 4DQRA 4LF6J 2CNNB 3BREA 3S01A 1TAQA 4MKYA 2DISA 1AB8A 5K20B 1MWQA 3KLEA 1GX5A 4PEOA 4WZQA 4F4ZA 2J8SA 1XERA 3LO3A 2V2KA 4JUZA 2J5AA 3IXQA 3GPAA 2J0SD 2IMWP 3FEZA 4W90B 5EDWA 2FVCA 5C24A 3T5HA 3W2WB 1HBNA 3EICA 4QU7A 4Y6IA 1WG5A 4F0KA 5K8NA 3CJSA 3D2WA 2DO0A 4ICLA 3QJLA 1HWKA 2YPZA 3BF4A 4DFKA 3ISND 1BQNA 3AJDA 4Q5VA 3D66A 4RW4A 2IIHA 2CVIA 3U1LA 3MEKA 1WEZA 4MIAA 3OBIA 3UFCX 1P27B 4DN0A 3M8PA 4R0JA 2D3ZA 2VFTA 2DH8A 3PO5A 1RQ0A 1WDTA 2LQ8A 3I9ZA 1NK5A 4M1KA 4ELUA 2B6AA 2CZVC 2ZBCA 2AYMA 3O3LA 1AUDA 4DL5A 4NYPA 1TL3B 4NLVA 3RRHA 5KT7A 1RT3A 1KVJA 1EKSA 4YQWA 2QL9B 2CIMA 2V9KA 3J81U 2DYAA 1Q8IA 3N0VA 3RGIA 2XY7A 3AT1B 2CPFA 3CCQS 5JUMA 1YBTA 2VHGA 1N5SA 3NWGA 4Y2IA 1O6XA 3RBEA 4DZDA 4OI1A 3AJ2A 2OP5A 1TK5A 2Q43A 4EYIB 2W4CA 4ZJLA 2G1HA 5GAEU 3HHNB 3Q2TC 1HFEL 1FJ7A 3CIMA 1FO1A 1N36J 2YKQA 3D3CJ 2KL8A 3CD5A 3D5MA 5J2PA 1IR2A 5KT5A 2HSEB 5J1EB 1XQIA 4K4ZA 2R8GA 4EU0A 4F4AA 1B64A 3QQCD 3VCDA 4DX7A 2P9CA 3NNAA 2E7XA 3M8QB 3BJYA 3CE8A 1N34F 3RBZA 4X4VA 3ET6B 4JYAJ 3M32A 2AYGA 5A0YA 4BC7A 3L95X 1JXEA 1LNQA 4Q43A 1GXUA 3VAGA 1FXDA 2VKZG 2ZHOA 5CYQB 1B0TA 3H59A 5IM0A 2AD9A 1QDUB 4DR5J 5EHHA 1FX4A 4RUCA 1WC4A 2E66A 1FE0A 1NHVA 2I0XA 2YWHA 2LU2A 4YHHF 1D9FA 1N33F 4EZ6A 3WHIA 1UJ6A 4F26A 3VR1A 3PR5B 3VF0B 2XB2D 3T6JA 3VZHA 3JYTA 1WF0A 3ISZA 5L8RC 4JI8F 3QT8A 2NZCA 2KO1A 2WOMA 3I0SA 1FEEA 1RSCA 3MAQA 1U45A 3ZXWA 1T03A 2MKYA 4GVLA 2EC2A 1RWWB 3FZBA 1JJ4A 2E9TA 5KFJA 2GAHC 4NLPA 2KTQA 4C0HA 3B8HA 2WBMA 2XSJB 3MEEB 1P9YA 2V63A 3L09A 2BZ2A 2DHXA 4BWMA 1RHUB 2BM1A 1SJFA 5AXLA 3K89A 3KDNA 2F5GA 4MFBB 2GHPA 3IWNC 4RW7B 5EN1A 3ZZOA 3IRWP 1TL7B 2BACA 2FZKB 2IJFA 5I3QA 2IHR1 4ZVOB 1JLFA 3JTPA 4UY8T 3W62A 5GAHU 2K1RA 1REGX 4EYHB 1PAUB 2F63A 3AOAA 4K59A 2RQKA 3KYLA 1LWFA 4H4OB 3U27A 4I2QA 2ZUAA 1GH8A 3K7RA 3DRSA 2XMJA 2QMUB 3UVJA 4DSFA 4ZVUB 5HLFB 4ZVEA 3AOCA 4F0HA 4B9VA 1M5PC 1Q79A 4PKDB 2XS2A 2RRNA 1ZAVA 2EW9A 3W2VB 1HNVB 2VG7A 5KOWA 3TZWA 3FK4A 2JVRA 3SYZA 2GMLA 1CULB 1Q95G 1FTCA 2XCPA 5D3GB 2OSRA 3T19A 4KGXB 1HYSB 3SCIE 3G87A 3KK2A 2Q66A 2QFJA 1JJHA 1NMEB 3BYPA 4ZHRA 3BH6B 1ZM4A 3M2RA 1VQ5S 1X9SA 3DNCA 5H9FK 1IKYB 2B0GA 4YB6A 2DHAA 2QX0A 3PTWA 2D3OR 2PD1A 3NBPB 2V8GA 4DV3J 2VOOA 5IC4B 3U1MA 3QRQA 1YJUA 3KOAA 3V4IA 5HMWA 3GP9A 3TA1A 1XBWA 5E0OA 2M9KA 3J7A1 3TI0A 1IXKA 1FKOA 5B0EA 2A18A 3R8YA 3FRZA 3LH2S 2C2NA 1K8AT 2D74B 3T3FA 4RBVA 4MKAA 1HQUA 1LEOA 3QIPB 4DLEA 1LKZA 1TL1A 3C14B 1YRUA 3E3XA 4MH8A 4OHYA 2MZQA 1RTZA 4CO5A 5B08A 4FPRA 2Y8YA 4NI2A 3HM9A 1UPPA 4LF1A 1W26A 5DQGA 2QE5A 2BOAA 2OEMA 3W9IA 1DY3A 3M05A 3NGTA 2YWWA 3BV8A 3DOKB 4LT6A 2HVEA 1HBMA 1FDAA 2DNRA 4ELTA 2I9SA 2A6MA 3Q8PB 4P9SA 1JLBB 5B0GA 2DGQA 4EI2A 2RUSA 2IC3B 4LFCJ 2IDLA 4CQ1A 4FNHA 2HNYA 3PW7A 4V19J 2M2BA 3AB2B 5ADZA 4KV8A 4IH5A 4LF9J 3IBWA 3H4BA 4JI5F 1SKSA 1RB0A 3EZ5A 4OJ3A 1WC0A 2JEGA 3TQEA 1HNWF 4ED4A 1S7HA 2KKHA 1UKUA 1WJ9A 3NY0A 2CZ9A 4OYPA 1RAIB 5KFYA 2E1PA 1Y3JA 4I7FA 1VCTA 1FVSA 2ZJQQ 5IC6B 3CO0P 2HMIA 2HHHJ 3QFWA 2WVCA 3KJNB 4TXSA 1Q7LB 5HROB 2YKPA 3BKFA 3FVYA 4JI1J 1AZSA 4DR7F 4R8UA 2B56A 4DR6J 3FJ2A 3LP0A 1WHWA 3VAIA 3R1HA 4R0EA 2QFIA 3CJ3A 4I69A 1M5SA 3I32A 1S57A 1PCAA 3IBCB 2DIUA 1HPZA 5L9NA 2GHWA 3MI7X 2F8MA 4NOHA 1E6VB 2LMIA 1IJEB 2AGPA 2V8VA 3EMTA 3ELHA 4OI0A 4DI6A 1W2BR 3MM8B 2DR5A 1NPRA 2GVZB 4Q0BB 2PIIA 3U02A 2GW8A 3H25A 1HW8A 5KAKA 3D6FB 3H4DA 4HR2A 4OX8A 3GV7B 4F2RA 3LANA 2AYBA 4JP8A 2WSEC 4C3MA 1SUQB 2R8IA 3PACA 3IRXA 3F56A 3R5CA 5A8WA 2RRBA 2YQ0A 4J37A 4X4SA 1FRHA 3ZTSA 2W9AA 1RTHB 3ZTPA 1C0UB 3I4PA 3MM6B 4L6V3 5FDLB 5B0CA 3RAMA 2RDDA 3UDLA 2CQ2A 4LVNP 1U1OA 4WYWA 2R7OA 2GJFA 4IOAQ 2FZCB 1HBOA 3TO8A 2YKMA 1X4EA 4LREA 4AXIA 4Z37A 2MHNA 3MFIA 3NCPA 2HZVA 4ZPWR 3ILLA 1TKTA 4OFZA 2PEBA 1QAJA 3UNYA 4ZVHA 1OWXA 2Z30B 3FSYA 1M5OC 4RNHA 4B9NA 1SV5A 4DOZA 5KFKA 5ETRA 2C2OB 3PY8A 5EWGA 1TL4A 4FYVB 4QPXA 2L41A 1RT5A 2JLFA 1KHWA 3KLHA 1KDNA 2L9NA 4YOEA 2C42A 3OL6A 4DFJA 1ZTTA 1K1QA 3HXMA 1R7IA 3JSMA 2FY8A 2KFNA 1JLCB 2W9BA 1S6PB 2CKWA 2FJBB 1QM9A 5T41A 2R7XA 2HQIA 2QJ3A 3DGPA 2EG1A 3OL8A 4YR0A 4Y65A 1DTTB 3R7SB 2KB2A 3I5BA 4ZJOA 4K50A 1FWLA 2AJ0A 3DFEA 3ZO7A 2MXYA 7FD1A 3ZZTA 3BO4A 3H90A 1S1UA 1XNQF 1PSDA 3SIPB 2OO4A 3K8VA 3VGUA 2G1DA 1YJVA 5JJBA 2ZWOA 3Q22A 2IFXA 2O1PA 1C0TB 5GMDA 3DOMB 1PG5B 2ZC4A 2YQ1A 3N6LA 2IA6A 5DDOC 2BX6A 1FJGJ 3NOCA 5DM7Q 3J7YI 3W63A 5LSLA 3PJ9A 2OPQA 2HHQA 2CPJA 2Z2ZA 3ZZ0A 1EETA 4CLPA 2WVEA
chains in the Genus database with same CATH topology
4ES1A 1VRUB 2P9GA 3TA0A 3NLCA 3PHEA 2FC8A 3LALA 2Y1JA 1X7VA 5C42A 3BN4A 4KJIA 4O44B 1N5QA 3OFEA 5D77A 3BGRB 4LJMA 5EWEA 1SJRA 2JZ5A 5A8WB 1UFWA 2QA4G 2PDAA 4YB7A 3SDEB 3KHGA 4ECVA 3PIOQ 2VL1A 1N88A 4TYAA 2UUAF 2EFQA 2X51A 2VPZB 2UUBF 3FNNA 3CC7S 3W2WA 3PX6A 3KTQA 3EGWB 4UOCA 4Z2XA 3CUNA 3LAMA 3UI3A 1NK8A 2NR0A 3EPGA 2KT2A 4GKJF 2YWGA 2ZITA 3UNGC 3LP2A 1S10A 5HP1A 2XBPA 3K5MA 4HH0A 4P7TA 3HVRA 1IBLF 3NL0A 1SH3A 2KYXA 2MPUA 5SZTA 1IUJA 2CQGA 4PG4A 3H5XA 4JI0F 2JFKA 3M4XA 4DFMA 3FSXA 4OX6A 4F67A 2Q1LA 2FLLA 2K7JA 2B4UA 4DMZA 2FUG9 4K4YA 2VFVA 5K8OA 2ROGA 4HDHA 5DG9A 1KHVA 3W7BA 3V6KA 2J0QD 2J6SA 2ZJRQ 3BQ0A 2RJZA 3H5UA 2MZ1A 2ZOGA 2VKRA 4YFUA 1NJZA 5K14A 4OJ1A 5J2NB 3M2VA 4Q2LA 4WE1B 1T8EA 2VB6A 2ZNZA 2MMYA 1LK7A 1CC8A 1IBKF 1CVJA 2F1FA 2PT0A 2VPWB 2DJWA 2F9DA 1B0PA 3MAHA 3B4DA 4RW8B 1LWCA 3P3DA 3TUJC 3HZEA 4IUFA 4NXMF 3M32B 4ECRA 3OFGA 4X66F 2X3GA 5A0YB 3I5AA 3P6YC 3O2IA 4UY85 3LQVA 5F9NA 2BDPA 1V3RA 2C3OA 3QWPA 4X4RA 4NLXA 2ZKTA 2W8KA 1NK9A 4DV4F 1XR7A 3FZ2A 4Y34A 3AJ1A 2BJEA 5I4MA 3OLBA 1GQEA 1S1WA 4QBUA 5DJBA 1FDDA 4DLGA 1NRKA 3KHRA 5B7WA 3CGIA 4AYBD 1XC9A 3V81B 3DLEA 3O5TB 3HHDA 1KQSR 2EFVA 4ZKAA 5D4NA 3GV8B 1RT6A 2ZKUA 1TL3A 4A46A 1WWHA 2CPXA 4QR2A 2J0XA 4DF8A 5I3UA 1UAWA 2LA6A 4FF3A 4ZPCA 5D6GA 2ZH5A 4NYZA 1H38A 4O3SA 2FLPA 4Q8FA 4O23A 3OL7A 2OJ3A 2BE2A 2K3IA 4KR0B 3IC1A 4B3OB 2GHVC 4A8OA 2HAIA 3GG1A 3HHLD 1FCAA 3OVSA 3MR3A 1TKDA 2UUCF 1X5TA 4DSLA 1FTRA 4KT0C 3OV7A 3OTEA 4JBCA 2VA2A 3KLHB 3KFWX 4FXWA 4KO0A 1YRTA 2NUHA 4HI2A 4WK3A 2RDJA 2AX0A 5F41A 1HMVA 4I4BA 4A8MP 1IN0A 2PGCA 3GR1A 2ATLA 1D8YA 4DG1B 2MSSA 2NSBA 3MR6A 2DVIA 4PWDB 1KQGB 1PC5A 3H5SA 3TANA 2YNFA 4DS4A 4U67Q 2QSWA 2LCWA 5CZVA 2MGZB 3JYTB 4DR4F 2DNGA 1RT7A 1UW4A 1S48A 1DLOB 2XG8A 2R7TA 1S1XA 2YKOA 4A48A 2E1MC 5KT6A 1TV6B 4C3KA 4F02A 3CCZA 2ZH4A 2OD6A 1HHTP 2VC1A 1HI8A 4ZCKA 3GFXA 2AQ4A 3DM2A 5DLGA 1WI6A 3OUYB 2EK6A 3DXSX 1JJ2R 2WOMB 3I0SB 4ZDNA 4F25A 3NP5A 5LJ5Y 3KLIB 2NSCA 2HHUA 1Z4UA 4K4UA 1NJIT 3GB0A 3MD3A 4ED5A 3MPWA 1T03B 4U7UK 2VODA 3BEGB 4G6VB 1A7GE 2VPYB 2JHEA 3K5PA 5FLXY 2ERRA 1TAUA 2YX1A 5J2QA 1Y00A 5E3PA 2R4FA 3Q8SB 4B3TF 3QGGA 4CO2A 1KTVA 3B4MA 2J7WA 4XIUA 2UXCF 1N32F 1I1GA 2QT7A 3CB4A 3PR4A 1SBRA 2F40A 2Q79A 2ASDA 1VRTB 1DBDA 3TUZC 1RKJA 2GO9A 4C8LA 4MJKA 1UETA 2OSQA 4DV2F 5KFBA 2VG6A 3QJJA 2GIRA 1ZM9A 2ZE2A 3MMCA 4WFZA 4WXOA 3CDBA 4DQSA 2FLOA 4NPOA 5DGAA 1KRPA 3M8QA 1FESA 3V6DA 2JL9A 4ZK7M 2KU7A 4TQRA 3ZZZA 2KXNB 5LSRA 2P6SA 2NUUG 3IWXA 3ZZYA 1LW2B 1S6UA 3HVAA 3FSIA 2WB1D 2YWEA 1LOUA 1JLFB 4CT8A 4DV5F 3CCTA 4ED2A 4HVZA 3SQGA 1FRIA 5DRKA 4ZCIA 3MECB 5IS2A 1IKWA 1VMBA 2BUNA 4LSLA 5GAEI 4FYDA 3I55S 4LIRA 1JK9B 1YQHA 3PX4A 5B09A 3DRYA 4USIA 2A10A 3CCJS 3THPA 4A8WA 2JJ4D 2RRAA 2QA2A 4J9MA 3UW1A 4DR2F 4PQUA 1X9WA 5DS7A 3NCQA 4NCGA 3SV4A 4NXNF 3GG0A 2C2RA 4ZPDA 4F8RA 1F60B 1KONA 2AX1A 2JEIA 4JV0A 2EG2A 5CYQA 3TW0A 1PC4A 4I2QB 1DFDA 2WONB 2BVZA 2E29A 3C46A 3QZ8A 5JVGQ 3BO2A 3DRSB 2CRLA 1F5CA 2E44A 2GGPB 3H98A 4H4KC 3OPKA 5DG8A 3V6HA 3OW2R 4OZ0A 4DPOA 3DHWC 1HWIA 4LF6F 2NPFA 4EUVA 3HZGA 4NLGA 2HFNA 2OKQA 3UR0A 3H8YA 2PSZA 1XWLA 4FZVA 4LUBA 5GAGI 3M6WA 3PVXA 4QYZJ 3HVTA 5L1LA 3EGNA 5DGBA 1N5TA 2JSXA 3T9NA 4DSJA 1Q8BA 3OJUA 1IJFB 1LXJA 4OZ1A 2ZH6A 3MF5A 3CULA 1FRKA 3G8QA 4NA1A 3VQSA 2DR8A 3CDUA 4LSNB 1JIHA 3SCKE 2ZH1A 4QPTA 4URGA 3JSRA 5HMZA 3MZIA 1W2IA 1X9MA 4YP3A 1T7PA 2FY1A 4GC6A 4FXVA 2RF2A 3O6QA 2ILZA 4X4PA 2VG7B 4BC9A 5KTQA 2D9OA 3QPIA 4J9PA 3KG4A 2K2PA 1HNXF 4H54A 4C97A 1UVLA 2XGQA 3DLKA 1X5OA 2KRRA 3B78A 1R0AB 1KQKA 2MQMA 2EFGA 3M6XA 3MD1A 3OR1A 1HR0F 3KLFB 2X1FA 2E1AA 1TK0A 1C4AA 4RW6A 1VQMS 2OD4A 5AXNA 4RWWA 2XWXA 3KK2B 3NGDA 2IYGA 1MROB 3QIDA 1U6BA 4CCHA 2C3MA 1DARA 4O4RA 4O4GA 1X4GA 3DOLA 1FF2A 3MEEA 2XSJA 5KFZA 1UEUA 1VQ7S 5K14B 3JB9k 3DYAB 2LQJA 5IXUA 2R7WA 4ZHRB 3M2VB 2HYIB 3POTA 3RB0A 2VOPA 1ZPVA 4QW9A 1X5PA 3M2RB 5AE2A 2VBXA 1JNRB 2EI5A 2W4DA 1FRJA 3M1VA 2ZH7A 1YJWS 4G3IA 2C22A 1VQOS 4MFBA 3RBDA 4B9MA 4CO0A 4ETXA 4IRKA 1T3NA 2RQMA 4O3QA 1QSLA 4LMZA 1RT4A 1TR0A 4RW7A 4UQTA 5C25B 2RU3A 2GQCA 1YRXA 3MM7A 3K2YA 2N82B 3M8RA 1G1XA 2JH3A 3U1NA 5U47A 4NX9A 2R2UA 2D7SA 1IKXA 4NCAA 2V0NA 3HKWA 4ILRA 2LVWA 2RSQA 2DIVA 4IFVB 2V9WA 4G1QB 2DO4A 5KFTA 2FJDB 1UJ5A 3IAS9 3F73A 2AW0A 1VS3A 1G3OA 2JEJA 4LF5F 2M52A 4B3MF 3V5RA 4NWBA 3GV5B 2RIJA 2PE8A 5KFUA 3O8WA 1DRZA 5DM6Q 2HS0A 3C6TB 3CJ0A 5L39A 2JRSA 4K5RA 3V4IB 2AYEA 3N4WA 3PRDA 1WI8A 5KG0A 1NO8A 5L1JA 1R8BA 2B4OA 4ID5A 3PKMA 1GX6A 4I56A 4QJVA 2XI3A 4ZP8A 3PW0A 3DLLQ 2PI5A 1FKOB 3TVZA 1FRXA 3P96A 3VWSA 2B7CB 2WSFC 2HWTA 4MIWA 3HMJG 4ERDA 4DL2A 4J5OA 4ECUA 3RR7A 1C1CA 4NMLA 5HLFA 3UE2A 4Y0FA 2NYIA 1WG1A 5BYRA 3KHLA 3K0JA 1ULRA 1T02A 3HFKA 3FQKA 3D1QA 1YVFA 4K0KF 3KK3A 3TA2A 1HQUB 4NZ0A 2KM8B 2B9YA 3T5JA 1SJ1A 5M2UA 2M8DB 4OJGA 4QCLA 2CQBA 2M4MA 1TL1B 3MFHA 3VQTA 4Q8EA 4KFBB 4B9LA 3R27A 5DQHA 1SJQA 1ZZFA 3VAKA 2DGTA 4AXJA 1HI1A 2RMLA 2MKIA 1RT7B 2Q6CA 5CQGA 5J1NA 3M8SA 3GQCA 4XPEA 4Q7AA 5GAHI 3M9MB 1Q7YT 3MTKA 1NJXA 2KYZA 2VQFF 5F8IA 2HHXA 4IFYB 4FP9A 1VIOA 3LUYA 4TLQA 1I6JA 3P49B 2ASJA 3NS5A 4X4NA 1IM4A 3MOZA 5DDPC 3W2VA 3SZ2A 4KBIA 5FIIA 1HNVA 5AJ3F 2CJ9A 3CPWR 4UUXA 2B5JB 5A8KB 2V4RA 3K5NA 2EBGA 3IR5B 4ATNA 1DJ0A 1UWBB 4C11B 1ZTWA 5KG5A 4LVOP 3RRGA 3AY0A 2VFUA 4IKAA 3CCVS 2J9DA 4M95A 2AJFE 5D3GA 3VALA 1N54B 1N5YB 2RQ4A 2XMVA 3OTDA 2VFRA 1EP4A 3LWLA 1H0HB 5IT4A 2KZMA 1AROP 1KFSA 3QAUA 3R1LA 1H2TZ 1X0PA 4OQJA 2FVRA 1C2PA 2HRYA 2MZJA 1HBMB 3MWBA 3OTCA 3KWMA 2MQOA 1N36F 1HYSA 1MU2B 4LF4F 4DX8H 2M8HA 1RGVA 3M9NB 2M70A 1T05A 4U7CA 3NS6A 1R27B 3T1HF 1IBMF 2RNEA 2BANB 2ZE2B 3MMCB 4HI1A 3SCJE 1X0FA 5EWFA 3PW2A 4UUWA 3KK1B 3WC2A 3L3CA 4EFAC 4X64F 4N77A 3SFUA 2P6TA 4RKUC 2FVSA 1C1BA 4FVMA 3T1AA 1NK4A 3CF5Q 1DZ5A 5A6PA 5CA5A 1U6FA 2C28A 1P1LA 4ZS6A 2B4PA 3GIIA 4RU9A 2R7QA 4K4WA 2W24A 4X4QA 1P9QC 3N28A 1SL0A 1TKXB 1D9AA 2RVJA 1Q8LA 2UZAA 2C3UA 1IKYA 3L7PA 3OR2B 2HRUA 1KR4A 5IT9Y 1U7LA 5CH7B 3SQGB 3IWLA 2I38A 4RNNA 2HNYB 5I42A 2XS5A 3FRYA 4P6QA 2JFDA 1ZM3A 2MKSA 2J0WA 3M6UA 4NYOA 1UEVA 1S9EB 2YNHB 1ZZNA 1Y5NB 3NBPA 4JYAF 1M1KT 4IG0A 1FD8A 2BRLA 2IVYA 2LKZA 5I3PA 4KV8B 4RU2A 3V4MA 1AFIA 1PO6A 1RT1A 4NCGB 4TY8B 5F0WA 5SUHA 2QLWA 3UD3P 3G8SA 1K73T 2FGOA 2HHSA 3PDNA 4WU2A 3DC2A 3G71S 2DNQA 3BZQA 1SB6A 2EVZA 3TRGA 4KGKA 3MMAB 5KG6A 4C7QA 4QIWD 3AA9A 1RA7A 1D9DA 3GIKA 2KHDA 5E7OB 1UJ4A 4USHA 1FNMA 3M2UA 2UVWA 2V4JB 3K5LA 2O67A 2MZTA 4IO9Q 1I94F 3KMQA 4C8ZA 3W3SA 1S0OA 4ILMA 4PWUA 3HPOA 1FVQA 3QAEA 4HTJA 3BGUA 4WFYA 1MWYA 2L3MA 1X4BA 1HWLA 4DR5F 2JVOA 2WBRA 2HVHA 3HVTB 4DJBA 2E9RX 2R7VA 2LEBA 3CSKA 4R5PA 4I6WA 1XR5A 1S9GB 2R7RA 2N3OA 1N48A 2G0CA 3QIPA 4I7FB 2Z2MA 5A8RB 2RILA 3BB5A 1B7FA 1BQMA 3T5KA 5DETA 4WZMA 4PQAA 4CO4A 2HMIB 4L3NA 2VBZA 2QO3A 2AGOA 4RBTA 1NK6A 3C2PA 3BSCA 2DH9A 2OPRB 3MM5A 2QIFA 3D28A 1NZAA 1HWUA 4TY9A 1GAOA 3ONQA 5CYMA 5J2MB 2ZOFA 3D0IE 4OX7A 2OH2A 5G0RA 2KXFA 1U24A 2BR0A 4GKKF 3IN5A 3DLGB 2X1BA 4CO3A 3K57A 2AWZA 1G6BA 2RDIA 3CCWA 2GIQA 2ADBA 2FJWA 4QU6A 2XLJA 3HHLA 4R8UB 3HK2A 4YB1P 3MUTP 2XZWA 4JV2A 5JXSA 4ECXA 1KOHA 2M7SA 3OQ2A 2FJVA 2D9PA 3FCHA 3DOKA 1F5AA 4O4GB 3I31A 2YVSA 2YTCA 1YWXA 4KC5A 1N52B 2WCXA 4N8OA 4NLYA 4CI0B 3MTJA 3IA0A 1VC0A 2MKJA 1HBUA 5E3RA 3US5A 4IO1A 2UV8A 4UQGA 2N7YA 1L3VA 2A2DA 3SSSA 3QLHB 4MYTA 1HPZB 1U1LA 3CJ4A 5LT5A 4JI7F 2CQCA 1FA0A 1U1NA 1BGXT 2DGXA 1JLBA 2I8EA 3LF0A 3QO9A 4E8UA 4FF2A 1RT4B 2MDAA 4MK8A 1JLEB 3OTOF 2BQRA 5IT0A 2IC3A 2E5IA 2CPZA 4WIIA 1FE4A 1F2GA 3C6UB 1JX4A 2HWIA 1Q1KA 2FHMA 1VFJA 2M0GB 2F8HA 3H2LA 3OTBA 5B0BA 2ZNYA 2ZH3A 2C2EA 4IDKB 5ITHA 2YKNB 4RX6A 1FDNA 2IM3A 1Y5LB 3WBZA 2A3JA 1KOOA 5FJ4A 3BQ1A 4OHZA 1XMBA 1NAQA 1Z1ZA 2I5JB 2MZRA 3EUNA 4AQYF 2NREA 3QJPA 2FPHX 2FJAB 4OI4A 5E3QA 3OVAA 2DNZA 1FDBA 3MEGA 3M9OB 4F3QA 2AF6A 2ALZA 1L5UA 2XO7A 2DNNA 3GILA 2ZH2A 5LMUF 2RKIB 2E5HA 4WYLA 4YEAA 2HLTA 3OL9A 4F4XA 1KLMA 3IRXB 3T5LA 2J7UA 1QSSA 3T9ZA 2W9CA 4HYKA 3D54A 4WFNQ 4L72B 4A8QA 3JAMY 4WK1A 5K8PA 4TLRA 2MJUA 3DU5A 4TU8A 1FK9A 2H5EA 2DD8S 2JOQA 1TQLA 2MZSA 2B3TB 4H4KA 4DWIA 2GQQA 3UQSA 2R2SA 4DL7A 5M2RA 5B0AA 3EXYA 1JLAA 2HNZA 1IKVB 1N0UA 3M30B 3BR9A 1KQFB 3CCLS 5KFMA 2P5VA 2HNDA 3X1LB 5IWAF 2DNLA 4B02A 4X84A 3MR5A 3MGJA 1D0EA 2VG5A 2BV3A 1O5JA 1RWUA 1MSWD 5GADU 3DLHA 1VC5A 1Q16B 2CQIA 3DI6A 5BYSA 2W7PA 4EBCA 3MXHP 4I64A 2BJDA 4DSKA 2ZHBA 2MYFA 2PN6A 4ZPVR 3IG1B 3DRRA 2WAQD 4AUKA 2QA4S 1XMQF 1QVFR 5HROA 3P5TL 1V6HA 2KJVA 4KAIA 2RS8A 4C2MA 4QWBA 1HBOB 2PC6A 3HO1A 2BA9A 1Y7PA 3MOJB 3Q8RB 4KQZA 4C0OC 2XLIA 4MTPA 2IYIA 3D1HA 2YKMB 1QLNA 1SI9A 2CPYA 1ZAWA 2IVFB 2X1AA 4K2XA 4TU7A 2IMOA 3R5AA 1T05B 2F3JA 5EX3A 4CIOA 3CEDA 1HNIA 1RTJA 2KG0A 3H40A 4PG7A 1SQEA 3PEHA 3GYNA 4C9DA 4QWEA 2QZ8A 1TKTB 2KFYA 3CD0A 2CQ3A 4QIEA 1E6YA 2MQPA 2IAJB 5HO4A 2WTFA 4C8NA 4CTAB 5DDQC 3CCES 3G4SS 3QGHA 5KG1A 1RP5A 2XGPA 4IR9A 3C8YA 2XS7A 2HHPA