3DGPA

Crystal structure of the complex between tfb5 and the c-terminal domain of tfb2
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
62
structure length
62
Chain Sequence
ELDRVITYEGSLYSDFETSQEYNLLSKYAQDIGVLLWKDDKKKKFFISKEGNSQVLDFAKRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for group A trichothiodystrophy
pubmed rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords RNA polymerase II transcription factor B subunit 2
total genus 18
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2008-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18307 Tfb2_C Transcription factor Tfb2 (p52) C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2610 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dgpA00
3DOMA 3DGPA
chains in the Genus database with same CATH superfamily
2ZNYA 2D41A 3MGJA 4USKA 4OZ0A 4YB7A 4FP9A 1V5IB 1UEKA 2NSCA 5J1EA 1SH3A 4B3SF 1HNXF 1LW2A 1WKKA 2LU1A 1GMWD 4C8OA 4DL5A 2OIHA 3CC7S 1KVJA 4LUBA 3M1VB 1URNA 2MZQA 2G13A 1VBXA 3T3FA 5KT3A 1C1CB 1RLCL 3GPAA 1RXOB 4ED4A 5JMNA 2GQQA 3M9MB 2IM2A 1PYSB 2D69A 4OHWA 4N5SA 1VQOS 2Z30B 3J7YI 2BRKA 3P4UB 3CCMS 3HXMA 4F2RA 4DF4A 3KJQB 3OSNA 5D3GA 2ZM6J 1RAIB 4HDHA 3EXCX 1I5OB 1FEHA 3CCTA 4CO0A 4F4WA 1G3OA 1JLFA 1HNVB 2E1MC 1UEUA 5M2RA 3TQEA 3W5YA 1FFGB 5GAEI 1LW2B 4O3NA 7AT1B 4Y2MA 3RB0A 2RIJA 2DGQA 2E1CA 2XNQA 4NYPA 5HAOA 3GMGA 3SSRA 4DPWA 7FDRA 1P27B 5KFCA 4X65J 1EIYB 2HNZB 3MR6A 1S99A 3EDQB 1N5YA 1RB0A 4RUBA 1TVRA 1F2HA 3UVJA 4Z2XA 1UL3A 1EAYC 2AMCB 1N0VC 2IRXA 1IUJA 1X4CA 3NS6A 3W9JA 3KJVB 1T3OA 3KHHA 4DR2J 2GGPB 5IQ6A 3M2UA 3WX4A 1OQ3A 4ZHRB 5KFJA 2F8MA 1ZA2B 5KFGA 3G96A 3BN4A 3OPKA 2J8SA 3TR5A 2AYGA 1TL4A 3PG9A 3TZYA 3NAHA 2RILA 4DCJB 5ETVA 3ISND 4KQZA 2IYIA 1HQEB 1HQUA 2BKPA 2LVWA 4FKYA 4EMDA 2XNRA 3IWNC 1LNQA 1OQ6A 3ILLA 2KJVA 4RKUC 5FLXU 3N5BA 1UP1A 2HQCA 1RT2A 1YJ7A 2F63A 2GFFA 2RH3A 3MI7X 1DQ8A 1MROA 3RRKA 2OELA 4QPTA 2Y1IA 4FYDA 2RRAA 2GA7A 2IRUA 2WVFA 2XULA 5A8RB 4OYOA 3TAMB 3PNIA 2WB4A 2E7WA 4KHPJ 2DISA 3OTOJ 2FJWA 4UZBA 4ED2A 1TL7A 2QG9B 3M2VA 4HI2A 2ZUAA 4RBUA 4DV3F 2QTWA 2AD9A 2MY8A 1WTBA 1N5TA 1L5UA 1NZAA 4IFYB 1RTDB 4C48A 1KDNA 3MR2A 5CXTA 2E7XA 2E1RA 1WOPA 4LF6F 5KFFA 4DPXA 3NNCA 2GMHA 4KFBB 3MPYA 2VQFJ 2XB2D 3PYGA 2YNIB 4RO0A 2JLGA 1TMMA 1LWFA 1RHQB 1JLBA 3AA9A 4I69A 4LFAJ 4X64J 3MUVP 4C8LA 1F3FA 1XJWB 5BYQA 5KG1A 3P3DA 4HEA9 2MGZA 4ECQA 3FRYA 4DR6J 2FLOA 5A0YA 3K5PA 2CJYB 2V0NA 1R7IA 2L9WA 5BR8J 5EWFA 1O6XA 4LR7A 2IM0A 2D3UA 2A6MA 1VJWA 2XWYA 2R2SA 5HLFA 4GC6A 5MAOA 4K0KF 4G3IA 2ZH5A 5DQGA 1CJKB 3PDNA 2G4BA 3PFOA 1Q95G 5KFWA 2XQCA 1UFWA 1JLCA 1N52B 4IH7A 3RZAA 3R5CA 3RJMB 3CJ5A 4U95A 3TX0A 3ZNJ1 3LPYA 3M9NB 1F9HA 3CJ0A 5DDRC 4FF2A 1DHMA 3GFXA 1ZM9A 4HACB 3MM8A 4O0IA 2MHEA 4WKRA 1YRTA 5LSRA 3DMJB 3L4BC 3SV4A 4E2FB 2MKCA 3CCQS 1QAIA 4LF8F 3M8SA 2B9YA 1HPZB 1XMBA 2C2OB 3F0NA 5A6PA 3G4SS 3NMAA 4QW9A 5L39A 2XYHB 1ZETA 4LFCF 2A2CA 3BGLA 3PFEA 2YPZA 4MK9A 3UDVA 3I5AA 2QE5A 1T95A 1L3UA 1XBWA 2GMLA 2B8PA 1NPRA 3HCXA 1N54B 4A47A 4YR0A 2HBQB 5GAGU 1YDLA 8RUCA 1F5CA 3E8OA 4ZVHA 4K4TA 1M5KC 5KFUA 2CQ0A 1WF2A 1SVDA 4HI1A 5FLXY 1MN7A 2WOMA 2OD4A 3OXFA 4UZCA 4ZJOA 4F4AA 2LKZA 3T1HF 2GJ2A 4YB1P 4U67Q 3QQCD 2KFZA 2H54B 2WTFA 4UOFA 5CYMB 4CLLA 2CJBA 5A8WA 4LVNP 1S0NA 4IRCA 4F8RA 1P6TA 1RT6A 3GFZA 3JSBA 5FDLA 4EEYA 4KPYA 4J5OA 2KM8C 1I3OB 1T11A 3FBEA 4CLUA 3V81A 4LFAF 1UVIA 3KG4A 2W2QP 1RWWB 2HQDA 2J0XA 5GMDA 1VK8A 2JEIA 5LMNJ 3LP2B 1YG0A 4NCGB 1HI8A 3K2YA 4J9KA 4DFMA 2Y8WA 1ZM2A 4ERDA 2WW8A 1H38A 2ZFHA 2X7IA 2N82B 4W90B 3PCOB 1FI4A 1KBRA 2JHEA 2KVQE 3CCSS 2LU2A 4LF1A 2DNLA 1IXKA 4YFUA 3UCGA 3Q8RB 2XHCA 5ETMA 5KFHA 3D66A 2UU9F 2WVBA 1IJEB 5F8LA 2VPYB 1IBMJ 1SKUB 4ECSA 2RF2B 1QUVA 3AODA 3FEYB 3MEGB 4LF4F 5KFKA 1TAQA 1K44A 3BGRA 1XMQJ 4DV0J 2GHWA 1Q7LB 1HNIB 2UP1A 4X66F 1AZSA 3WIUA 2CJKA 3DLKB 3L9ZA 5K8PA 5GAHI 2RS2A 1VBKA 1U09A 2VOPA 2IJFA 2DHHA 3Q2TC 2C2NA 2B51A 2KXHA 2R4FA 3MM5A 4QBUA 4KKOA 4Q0BA 2LP4A 3GJQB 2KHCA 3U1NA 4QWAA 4NXMJ 2B0GA 3MM8B 2OPPB 4AYBD 1M5HA 5IV4A 4J9NA 2J76E 2FVQA 4LF7J 3TO8A 2E5JA 2KO1A 4KSEB 1JJ2R 1D9DA 2HQGA 3M6WA 2FZCB 4B3MF 4HVZA 4PXDA 4JI6F 1DARA 2ILYA 3VGSA 4OX9J 1FDDA 1AB8A 3BGRB 1S1VB 3NEKA 4NEZA 3BYRA 2FLPA 4KHMA 3LWLA 2W9BB 4M95A 4KE5A 1H3DA 4QIGA 4C0HA 2JJ4D 4DMZA 5DDPC 4DWIA 4DR7J 5E5NA 3ET6A 5KFVA 2HQIA 3OFGA 2O1PA 3CE8A 3NCQA 3AXMA 2CQHA 3IM9A 5M2UA 2VPWB 1YJRA 4ZDNA 3MFIA 1WF1A 2EKNA 2LA4A 3MPWA 4OI1A 4YY3F 1YJVA 1U1MA 3FEXB 4ED7A 1RHUB 4PG6A 1EKSA 4RU2A 2FHJD 1CS4B 2YX7A 2DGXA 4EBDA 4ZLLA 5LMNF 2Y1LB 1HNZJ 2KFNA 1FDBA 1FJCA 2QLWA 2V6AA 2G1DA 3IRXA 4J9QA 4R0JA 4CRJA 2MKIA 3E2EA 4DSKA 4WJBA 5B0CA 3RG6A 4AFFA 1HBMA 1Q5VA 1RAOA 2A3JA 2DNNA 2WSEC 4QJVA 4Y65A 5HATA 3P5BP 3UVJB 4ID8A 1NPKA 4KH1B 3KG1A 5KG5A 1AFJA 2OPRB 2CPEA 2AYBA 2AJ2A 5RUBA 2AEFA 4CO1A 4IRKA 3KNGA 2WONB 5KFZA 4FYVB 5LT5A 3C6UA 2OGUA 1KTQA 4CYUB 2CVIA 4NLPA 1QVFR 5DM7Q 3A3NB 1X5SA 2QMWA 1JLEA 2R2UA 1Y5IB 1GX5A 3M4XA 3QGPA 1RP5A 1FRLA 4OHXA 1R8CA 2HEKA 4L75A 1HQEA 1Y5LB 2BQRA 1FDNA 3SDEA 4WFBQ 2M3DA 2B5JB 2V8GA 3WZ0A 1Q4RA 2G2ZA 5DQIA 1S6QB 3TANA 5DO2A 3QJLA 1XWLA 4NEYA 1HBUB 2HNYA 1LKZA 3HPOA 2OAUA 1YJ9S 1KLNA 2MZJA 4CZCA 3QZ7A 2GQCA 3MAAA 4ECUA 1RWUA 3PO4A 1QE1B 2BE2A 3W64A 4YUDA 1WELA 4Y28C 3LF0A 4JI6J 2XZTB 2Z58B 3DC2A 1LFWA 5AXNA 3CXCR 4Y3CA 5AXKA 2WHOA 3THTA 4CLPA 3K5NA 1CULB 5GAEU 3HFKA 4NLYA 3JTOA 3KJFB 2UUBF 5HJXA 4CH1A 2N4DA 3G6VA 2V8VA 3DOMA 1HHTP 1K1SA 2FDNA 3EDRB 4OV6A 2ZH9A 1JLFB 3BGOP 3GYXB 4NLDA 1TKZB 2DNYA 3G8SA 1G4CA 1VQMS 3J7YU 3X1LB 2CA9A 3D68A 2QV6A 1V3RA 3GIJA 1FRKA 3A8JA 5CCMA 5ETKA 2FGCA 3VF0B 2O01C 3D2WA 2R7TA 3OL9A 3TUIC 2ZZTA 3M7VA 4NPOA 3OHAA 3L3CA 2KRRA 1X4HA 4UOGA 1GX6A 3CMAS 1ZAWA 1U24A 2DY9A 5ETTA 4C11B 1LK5A 2E9TA 2VQFF 1WG4A 2H4WB 4EI2A 2IVYA 3EZOA 3JSMB 4RR5A 4L76A 5K9FA 3N5FA 5DRKA 1Y9OA 4DEZA 1OPZA 2A18A 2IRYA 2K7KA 1M5SA 1CC8A 2XI2A 3N6LA 1OIAA 4QR2A 1CQMA 1LWEB 2BJ1A 3G87A 3HSJA 4KBIA 1OYEA 1D9AA 3D54A 1T03A 4CCHA 1VI7A 3MECB 2CJAA 4H4MA 4QZVB 2VONA 1FCAA 2V4JA 4ZP6A 2ZJPQ 4B3RF 3W3SA 2CWKA 3KK2B 1G1XA 3CCWA 3FKBA 4L73A 2QA4G 2I1RA 2VC0A 2L3MA 3DDIA 3IR7B 4MIWA 3NG8A 4P7TA 2XGPA 4LF6J 1U6BA 4F25A 5LXRA 3KHLA 3H5XA 3S01A 2KTQA 1VRUA 2MKYA 5L38A 2K7JA 2N7YA 4P6QA 4DSJA 1BHNA 2XHWA 3DM2B 2WZ1A 3H0PA 3KLIA 4DZDA 2R3VA 1TELA 2P2CB 5D0GA 2ACYA 4CM0A 1R8AA 3EXYA 1RI7A 5F0WA 2EKYA 4NOHA 2MZTA 1BUXA 4ZCKA 1X5TA 5T7LB 1SJ3P 5I42A 1NK9A 4I4BA 4QIEA 4DSLA 4PYDA 4BCAA 2WW4A 2DK2A 4PXCA 1VS3A 2MXYA 1H2VZ 2GVDB 2YPYA 3DI6A 1KNZA 4RW9B 2FJDB 3CULA 2VB6A 2PN6A 3KDOA 3GYGA 1LXJA 2EFPA 4G1IA 3AJDA 2MEWA 4OYMA 3H4BA 1Q8LA 1J5EF 3R97A 4GKJF 1GXUA 1WORA 2CUYA 1S9EA 3GLJA 1RBAA 1IKYB 3JQMA 4LMZA 2YKOA 2A6OA 2IC3A 2OI2A 4U7UK 1DRZA 1PSDA 2G2OA 1F9FA 4I56A 2HFZA 4LREA 1S77D 3OBIA 1S1UA 4OJ1A 7FD1A 5DZ7A 4G1QB 3KLEB 4ECRA 2YQ0A 2VH7A 1T3NA 3BPDA 4LR9A 2WCXA 5F9LA 5AJ3J 3LP0A 4HHJA 4ZN1A 1C0TB 1R8BA 1RWMB 4FNIA 4K8RA 4LBIA 4O3PA 1REGX 2ZBPA 3DGPA 2KDOA 1GFWB 3GU0A 3R7SB 4TYBA 1VLOA 1FRXA 4DXLA 2R7OA 3N6MA 3NAIA 4RW8A 1UZHA 4WFAQ 4FXWA 1RU1A 1WOSA 4J9VA 1XEZA 3RB6A 4M94A 2VHGA 4WFZA 4WU2A 1TL1A 3DXSX 3H20A 2WVEA 4CP5A 3SQGB 2HGMA 3E3XA 2CQ3A 3M32A 5B0GA 3UDLA 4M5HA 4OZJA 2ZDPA 4B3SJ 2OEJA 3SZ2A 5KT5A 2N7CA 4MT1A 4URSA 3HVAA 1NJZA 4RW6A 2CXEA 4BBYA 3QZ8A 1D1UA 2PFDA 4B9LA 3R5GA 3A8EA 1IM4A 1U1QA 1C1BA 4BC9A 2R9LA 5F3ZA 2XTJP 5K8MA 1ZTWA 3UN3A 1IBKF 2ATCB 2DGWA 3SI8A 1DAXA 2B9XA 3DU5A 2L9NA 1JJHA 4DV2J 5DDOC 4D3HA 2HWTA 3C6TA 3D3CJ 1MLAA 1HQUB 5D4PA 2KH9A 3HO1A 4Y2IA 1S1VA 1VQLS 5ETNA 3GIKA 2DHAA 3M32B 1K73T 1P9YA 1M1GA 1HR0F 4OI4A 2Q6CA 1T05B 1FKOA 1BD6A 2QA2A 2X1AA 2DPIA 3D1QA 1RHRB 2VF3A 4DCPB 1NM2A 2BJ3A 2BUNA 3M2VB 5DG8A 1RT7A 3OUYB 3V4IB 5KFXA 5HQLA 2LQBA 3LUYA 1RWKB 4WK3A 4C8MA 1RT4B 2CAJA 3HF5A 4JI3J 1SJ1A 2AJQA 3ILOA 3GG0A 3A1YG 4ED5A 3VQTA 1FRMA 1RYRA 1BQNB 3GCWP 4A4JA 2JZ5A 2RF2A 4X4SA 1WG5A 3CWJA 2AJ0A 3MEKA 5CD4H 1X9MA 1X5OA 1RTHA 2KKHA 4GVBA 4QYZJ 5IT9U 1FNOA 2LXFA 1NRKA 2ATLA 2UUTA 3P96A 3SSSA 3HMJG 2IDEA 4CT9A 2CKWA 3UWTA 4CO5A 3MMAA 3POTA 2DJWA 3HHNB 4DFKA 1WDTA 3ILJA 4RW4B 2MLXA 1ACMB 3PKYA 4OHZA 5AXLA 2MMYA 2HHHF 3B4DA 2JVOA 2IHR1 1U1RA 1KQKA 3NGUA 2GIFA 3HVTB 2BJ7A 1BQNA 4QWBA 3SDEB 1TU0B 4C3KA 3ITHB 4UY8T 2DNGA 1ZAXA 2GJIA 4HHUA 3T9ZA 1S5ZA 1UCNA 2J9EA 1U2RA 2NSBA 5GAGI 3J7AN 1F3VA 1UETA 2AYMA 3VGVA 4F3QA 3NRBA 4R8UA 3RAXA 2B4OA 2K1RA 2IIHA 2PA8D 4I1TA 3U27A 4ED3A 5B09A 4DZ6A 2PGCA 1ZYQA 3UN2A 1RKJA 2QYCA 1K47A 1XK8A 4LIWA 1OMSA 4OX8A 1KKHA 1RGVA 3A13A 5KFSA 3N0VA 1FWLA 3CJ8A 4IH6A 5MLCV 3JSMA 1N6QB 2AGOA 2W8LA 2FHKA 1MSWD 3RBZA 3ZTSA 5LMUJ 2CDRB 1WC4A 4D3GA 1HR0J 2G0IA 2FLNA 4BDPA 1N33F 1JJ4A 4K0KJ 3RR7A 3AXKA 3T1AA 1QVGR 2F40A 2RS8A 4EU0A 2ZJRQ 3GE9A 4KFBA 3LW5C 1T9YA 1N34F 3FZ2A 1TKXA 3OQ2A 4PQUB 3I5CA 1FXLA 2DNKA 1HWIA 2HVDA 1JKHB 3IS9A 3LAMA 1QTNB 4XDCA 4IOCQ 4ED6A 2AGPA 4YHHF 1SUQA 3PEJA 2BVZA 3VVTA 4CDIA 2IAJA 4CIOA 3CPWR 2YY3A 3IFEA 3R7NB 1CSJA 2DB1A 4C7QA 4Y0FA 5A8WB 4DR3F 2E5LJ 4F3MA 3MM6A 2HFVA 2XGQA 3OSPA 1S9FA 2JEJA 4B3OA 1JWWA 1VRUB 4ZPDA 3C16B 3T9NA 4K4XA 2OP5A 2DH8A 2CJXB 2AHOB 3BKUA 3WC0A 1HYSB 4KC5A 2F8HA 2WONA 2BJ8A 4QQBA 3AJ1A 4YB6A 1WC0A 4QW8A 3U02A 4ES1A 4F26A 4AUKA 4UTGA 2QLXA 4ZP7A 3SFUA 1XR7A 3C14A 2QL7B 4U7CA 1OYDA 4R25A 2BOPA 2LDIA 2HVHA 3OTCA 1FWKA 2RU3A 2GVDA 3FJ2A 3IA0A 3V6JA 1MROB 2FYXA 3GONA 4NZ7A 5IT9Y 4A46A 2WBMA 3M8RA 1OJ4A 2DNZA 4ZJQA 5KFQA 2CZ9A 3K8VA 4WP8A 1NB2A 1S6QA 1RU2A 3MPVA 1JNRB 2HFNA 2OH2A 3HFZB 1JXEA 3CJ4A 4IG0A 4LT6A 2DXDA 5A8KA 6FD1A 3NP5A 1KFSA 3PRVA 2XY6A 4IFYA 1RTDA 4LRAA 3LP1B 4OIXA 3IO1A 2KL8A 5I3UB 2QEXS 4KGVB 3O44A 1WUUA 4KAIA 1TQLA 2K3IA 3Q8QB 4E8UA 2AU0A 2KZMA 6FDRA 1NJIT 1SH2A 1X7VA 1OY8A 3G8TA 1RWPB 1H7XA 1ZA1B 3VAJA 2L9DA 4KPCA 3MDFA 1U47A 2XZWA 3AHPA 4QU7A 4Q8EA 3QT6A 4TNOA 4F7VA 5L9NA 1AXQA 2XMMA 2K8GA 2P9EA 2RDIA 5IT0A 4MK8A 4WXOA 2NREA 2M2BA 3E01B 3R6LB 3DN9A 1RQ0A 2HZAA 3LGHA 3TZXA 1XC9A 4ZHRA 4IYQA 4USVA 3TJ9A 4ED0A 2KU7A 3FFIA 4KR0B 3MURP 1WJ9A 2ZHBA 1RLDA 2KXFA 2M4MA 2MJNA 2IM3A 3PJXA 2PE8A 3V2UC 1SQEA 1CQNA 3NLCA 4DV3J 4DL3A 1IBLJ 1JLQA 3PRDA 4LRCA 2EW9A 4ZP9A 3BSAA 3ICLA 4CWBA 4RNHA 4IR1A 1RHMB 4BHQA 1V9OA 2HQFA 1JLGB 1R31A 3K7RA 3Q89A 3FSXA 3NBPB 2RVJA 2NUHA 2H5JB 4YDXA 3P6YC 2R7SA 1TMJA 4PEOA 4XK8C 3DOKA 3T5HA 2X51A 4I7FB 5HMXA 4PWDA 4GKKF 2VBWA 2HFSA 4CLTA 4CNYA 1XMOJ 4ECYA 4O44A 1Z1ZA 2W9CA 4LSNA 3CSKA 2VASA 2LLZA 2E7VA 3MM6B 5K8NA 4HDGA 3KLHA 4NLVA 4RWXA 2POKA 3M8PA 2YTCA 4BWMA 3UI3A 1RA6A 1EQMA 3BO3A 4UY85 1SL2A 4NLTA 5FIIA 3R9LA 4A8MP 3M8WA 1FFWB 1Y7PA 1Z2ZA 3H5YA 2DR5A 2VD3A 1U8WA 2KZZA 2NCKL 3QFWA 4ZLPA 3JB9k 1F5BA 1NK7A 3C2PA 5HANA 2YNIA 4RLEA 5EWEA 4TU7A 1D8ZA 3PYEA 1LWFB 3V6DA 2ZOMA 5LSOA 1BLUA 1S1XA 2RJZA 2R7QA 3MWBA 3Q23A 4DR5J 3MUMP 2AZ3A 2CJQA 2IM1A 2MKHA 3T6JA 4W98A 5D4NA 4ECZA 4Q0BB 3DLEB 5AT1B 3TZWA 3ULHA 4YY3J 3FCWA 2JX2A 4JI8F 2V50A 4B9SA 3GB0A 2DY1A 4ECXA 4V19J 1HLWA 4MYUA 5D15A 5KFRA 1NKBA 1NSAA 2FY8A 2M9KA 2DNQA 3ISNC 4OYWA 1BWVA 4QR0A 5J1NA 1NSQA 1VQ4S 3CNQP 1HWJA 3VGTA 2E1AA 4X4VA 3IMQJ 3G6XA 1B99A 2C22A 3W66A 2PEBA 1X4FA 3O8WA 3KK3B 3HHLD 1M5VC 1RSCA 4JV0A 2QYGA 2V63A 2IDLA 4GKKJ 1X31C 3GQCA 1LWXA 1WHXA 4O23A 1Y3JA 4I64A 2DHSA 5BJRA 2VJVA 1VQKS 2OMLA 1U45A 1C0UA 1QD1A 3LAKA 4TY8A 5HVHA 1X0FA 4MFBA 2OEMA 4DBQA 2I38A 2HG4A 1U6FA 2COLA 2RQ4A 3HK2A 1OPIA 4NRUA 4ZJLA 3M9OB 1KONA 1YK9A 2EPIA 2V2ZA 3S7RA 3FFIB 5E3AA 2GZOA 4NWBA 3W2VA 2ZH4A 3K57A 3CCJS 3CCVS 1MMLA 2ZEJA 2M8DB 5CYQA 3BZQA 3UR3C 5KFBA 3RYLA 2IFXA 2GGPA 4P2MA 1UVNA 4OV1A 5KFNA 2Q3PA 1NHVA 4ZPVR 5EUHA 2D3ZA 1YJTA 4A8OA 2Z2MA 3I31A 4I2QA 2J9DA 2JNJA 1OS5A 3QIPA 2XYGB 4UF4A 4XDDA 4DI6A 2R8IA 4DS5A 1VHIA 1VC5A 2B9EA 3IBWA 3FMWA 3C6UB 4CO2A 5IXUA 3R1LA 4CO4A 4EZ6A 2BJ9A 5LJ5Y 2VU5A 1WEYA 4EO6A 2XCPA 1U1OA 5AXMA 1VJQA 4O4GB 5KFAA 1S12A 3U1LA 5J2PB 4ZVFA 4JUZA 1TK5A 2RHQB 3B54A 4EZ9A 1UPPA 3C46A 5CYQB 4H4MB 5F8IA 1SJQA 2GVZB 4ED1A 1KQSR 1RZMA 3FRZA 4N77A 2JOQA 2I9SA 2YWFA 3PJWA 2ZUGA 4YQWA 1XNQJ 3W7BA 1ZTTA 5KFLA 4ZLJA 4X4QA 1KHVA 3K0JA 2HNYB 5L1LA 2AEMA 2FJXA 3D9BA 3IGNA 3OR1B 4QWDA 2MSSA 3D6TB 3CCRS 2VDHA 1VRQC 3OXLA 2HAFA 4IOBA 4ZIWA 3MEDA 3I5BA 3ZZOA 5KTQA 4DV1J 1N36J 3QRQA 4ANEA 4JI1F 1S0VA 3RU0A 1DY3A 1R6VA 2HZVA 4MTPA 4WYWA 2MQOA 5C42A 2GO9A 1X9SA 1CJKA 4OHYA 2FLLA 1NU4A 4CNZA 3OFEA 1KS2A 3I55S 2LXUA 5B0BA 1VR6A 4LF5F 2UVVA 4LF9F 4OHVA 1M5OC 3IS9B 4C4WA 2O67A 3THVA 4IOAQ 3AT1B 2MQPA 1UKUA 3W61A 5DQHA 1MMNA 1WG1A 4KRWA 1Q16B 2R8HA 2W2MP 1CVJA 4FF3A 1AUSL 2DGSA 4YHHJ 3LALA 3MEDB 4WF9Q 1AA1B 2YWKA 3ZZZA 1SV5A 3Q24A 2H1YA 1F2GA 4AXJA 1YITS 5F8HA 1FXDA 2NPFA 1KFDA 1S4FA 2ZKTA 3QNWB 4TY8B 4N8OA 3ENQA 4EGLA 2CNKB 1WNEA 4OZ1A 4X4TA 4K2JA 4USTA 4B9TA 4P71A 2UXDF 3CMES 3I6PA 3I4HX 1VBYA 1REVB 4FF1A 2EG2A 3B8HA 3O5TB 2QFIA 2AJ4A 5SZTA 3VR1A 2MHNA 3BYPA 4GO5X 1KQFB 2DIVA 4RW7A 5HI7A 2WOMB 1IJFB 4TYAA 2FVSA 2LXIA 4RNOA 3K5LA 3G82B 3R27A 2DRBA 1X4DA 2GIQA 2ZC4A 2YQ3A 3MR3A 3D6FB 4JI2F 2UVRA 1NDLA 2HFOA 3VAMA 1TK8A 1FF2A 3N9UC 2MLZA 3UFCX 3MUTP 4ES2A 3MM9A 2X1FA 4PRFA 4LVOP 4ETXA 2ZOFA 4K4SA 4OL8A 4OX7A 1GAOA 3CB4A 2L48A 3MMJA 5JXSA 5F8JA 3KUHA 1VRTA 3W62A 1X5PA 2W25A 2FB0A 4TQRA 3D0HE 1S7HA 2A0FB 3AOBA 2J7UA 3LP2A 1FO1A 1AYEA 1Q78A 4BWJA 3VAKA 1EP4B 4ZVGA 4R5PA 4USHA 3R8YA 4B9MA 5ETLA 5H9FK 1KD1T 1NKCA 4IRDA 5C2GA 1A7GE 3M8PB 3GTYX 2GAGC 4QYRA 5DGAA 2BQ3A 1T8EA 1N0UA 2F4VF 2RUSA 5L1KA 1TL7B 3IGVA 4RNMA 3QGIA 1HKAA 1T9XA 2C42A 3AD9C 1NSKL 1RAAB 2AYEA 4NLWA 4C97A 2X1GA 2R7VA 5E3QA 1U26A 5IC4B 5T14A 4OYAA 2DD8S 2VJUA 3PYDA 1RWOB 1VBZA 3FMBA 4WE1A 2MQLA 1EP4A 3ZZYA 1W26A 2G1HA 2XMTA 2AJ1A 4ZKAA 4R5PB 3J81U 4XIUA 4DR4J 4C8ZA 4WZMA 2I8EA 2ZOGA 3TA2A 4IO9Q 1YTYA 2E5IA 4ZCIA 2J6TA 1B4SA 4J9RA 1ZZFA 1SJRA 4JI7F 3R6GB 1GTEA 3OR2B 5A0YB 5AE2A 3SBMA 1TFWA 1WC6A 3DLGA 4FYXB 2V2VA 5HN0A 5FJ4A 2VPXB 3R5DA 1EQ0A 2NQPA 2ZNZA 1SKSA 1RCOB 3BBCA 3IBFB 3IAS9 2OMOA 1HI0P 2PEHA 2VG5A 3M2RB 4YDDB 1O51A 3CDWA 3TRGA 4OYXA 3D0GE 3TA0A 2XLIA 2DR8A 1VIOA 8ATCB 2M8HA 3P5TL 3QWPA 4KT0C 4DN0A 3W9IA 1REVA 3MXHP 3KOAA 4DU7A 1FDAA 1FVSA 1Q53A 1VIXA 5KT6A 4C8NA 1R0AA 1E6VA 3RGIA 4DUZJ 2DYAA 1FD8A 2BE7D 1JIHA 2ILZA 4UT4A 5KT2A 3NGDA 2E5GA 2YVSA 3Q2SC 3QGGA 4WFXA 1IKYA 4LSLA 4RUAA 1N56A 2HHQA 3BB5A 3HD1A 4NCAA 2HRYA 3C15B 3I87A 2LMIA 4KY3A 4OLPA 1FRJA 4U8VA 3CC4S 2O3DA 3G71S 3H40A 4K4WA 3UD4P 1P1TA 1DURA 1Q8KA 3CTRA 5KG4A 1SKRA 2JEFA 3F56A 4I67A 1O0PA 1Q0NA 3KJVA 4C8YA 1UAWA 1SQGA 1VRTB 2D3OR 1WSRA 3VALA 3H2LA 3BBBA 3VZHA 2DITA 2OTJS 1B7YB 1FA0A 1DBDA 3JAMY 1SIWB 2ZH8A 2J8AA 3HX9A 2KB2A 1R0AB 4P2FA 2F7VA 1CS4A 2NYHA 1SH0A 1C0UB 1B0VA 2ZDOA 4H4KC 2EFVA 2V4QA 1VQSA 1M0SA 3HI9A 3FNNA 3KK2A 4GC7A 1RA7A 1MU2A 3KLFA 2H3EB 2R2RA 4M5MA 3R5BA 2VODA 2DKOB 2OHDA 1UVJA 3VAGA 4DUYJ 3JS9A 2QA1A 4I2PB 2B7CB 3CJKB 3AD7C 2YNGB 2HWIA 1YRXA 4HH0A 2Z2LA 3GFHA 3TVKA 2E29A 2E1PA 2D9OA 3AB4B 3N79A 5I42B 1YJNS 3QMQA 4DR5F 3OR1A 2C2RA 4KHPF 3DRPA 1MG7A 2D3O1 2VQEF 2NZCA 1DTTA 1TL5A 4OYIA 4C2MA 2BM0A 2UXBF 1FJ7A 4J7CA 3MAAB 1J5OA 3T5LA 2JRSA 2XMVA 2BYCA 2HHPA 5D0EA 1VCTA 5F41A 2IY5B 2JH3A 2RAQA 4CI0B 1ULRA 4R0EA 5L1JA 3PX6A 1PC5A 2YKQA 3MPDA 3Q8SB 2V8DA 1B3TA 1VOMA 1WEXA 2CQBA 2YWWA 3GIIA 3L95X 4DJBA 3MHYA 3KHGA 5IV3A 1U4BA 3H42A 2O5DA 3MM7B 3HKZD 3R2CJ 4PPZA 2HNZA 3KDNA 1KWMA 2H5EA 2LEBA 1IQZA 1SC6A 1SI9A 3M8QB 3MCSA 3T41A 3QSIA 4K7QA 2QLFB 2ZC3A 4WP9A 5IQQA 1RBLA 2DT9A 2AT1B 2WB1D 2HHXA 4ZVQB 5D0HA 4DV7F 5BYRA 1AROP 2HNDA 4KO0A 1LFPA 1QAXA 3M8ZA 2H4YB 2XCAA 5LXYA 3JYTB 1ROFA 2AP6A 1BE4A 2FJAB 1FXRA 5F9NA 3G6ES 1FJEB 2XSJA 4PAAA 1VMBA 5EN1A 4KGKA 5D4LA 1WF0A 2CPFA 1NLKL 5HVFA 4Q2LA 5EDWA 3J7Z5 3Q8PB 2DXEA 1OSCA 2AW0A 2X1BA 4N76A 4G65A 2BV3A 3VWSA 4NMXA 3CD5A 4RJVA 3W5ZA 3IN5A 1BQXA 3GV5B 3RBEA 2C3UA 4UUWA 1TKTB 1OWXA 3DRRB 3W8GA 4ENOA 2K06A 4X4RA 1URRA 2HWHA 4KYZA 2EFGA 2FHMA 2KG0A 5H9EK 3GP9A 4H54A 4P72A 4OI0A 1F1BB 2BANB 1YBTA 2XYPB 1YRUA 4K5RA 2XC9A 3F41A 2OTLS 4K50A 1KHWA 2LYVA 2Z8QA 4ECWA 3H8YA 3ZZ0A 3JAMU 4PUOA 3LA0A 2ZITA 4K4VA 1RE1B 3UN5A 2ASLA 2MQ8A 2DRDA 4UOHA 1XNRF 2NS1B 2WK4A 2ZD1B 3HDSA 2DVIA 1CULA 1S1TA 3QIPB 3HHLB 3TUJC 3NOGA 5KOWA 1W2BR 5ETOA 3D3BJ 3DRSA 3HSZA 3HVTA 4HH1A 1A9NB 3J7A1 1T94A 3FUYA 1T03B 1KN6A 3PIOQ 4DV5F 1S0OA 1HNZF 1TKTA 1FESA 2Y0SD 1JLGA 3MR5A 2DH7A 1X4EA 5ETSA 4CH7A 2LEPA 3D28A 1MWYA 5DJBA 2MGZB 1IVZA 4WIQA 3V6KA 1HMVA 2BW7A 2KT2A 3D6HB 3U1MA 3DI6B 4ILRA 1U1PA 2CQPA 2GO8A 3FBCA 2B9WA 3IC1A 4ZVPB 1NK8A 4IG0B 1UZDA 2DNMA 4NL5A 1FRIA 2HGNA 2NXNA 1H2UX 2KI2A 2VICA 9RUBA 4PPDA 1A6LA 1MN9A 3FQLA 3KLIB 3KLGA 1UJ6A 4B02A 1JB0C 1UW9A 3CC2S 4U7UD 1LWCA 1TUWA 2CADA 2GNKA 4EUVA 1TUGB 4Y2CA 1U6ZA 1AFIA 2GQ2A 3NGKA 2P6TA 1S0MA 1QJHA 4FBTA 3O3LA 3BKFA 4C0BA 8AT1B 1YI2S 5LM7E 2XO6A 3CUNA 2P5VA 3AOCA 1LOUA 2IAJB 2CNOB 2XMWA 2V4JB 2ZVSA 3ENVA 4J9OA 1SL0A 3QATA 3RRGA 1T7PA 2EEYA 1EETB 2W8KA 4F4KA 3K5MA 1C2PA 1HPZA 2PMZD 5B0DA 1XR5A 2W4DA 1YVFA 4PABA 3Q8YA 4RW8B 1X4BA 4OZ3A 1JX4A 1XMQF 2DCLA 2BJEA 1N48A 2L08A 2GX8A 4USMA 3H4DA 3HKWA 3BDPA 3K8WA 3QSYB 3LO3A 3GIRA 4GRSA 2QIFA 1N32F 4EK2A 3DRYA 3D1OA 2OLWA 1EZZB 4HYKA 1HBOB 4IG3A 2I0XA 3L09A 3I56S 2EC2A 1S4EA 2BKNA 1JLAA 3CO0P 2V8PA 2F3JA 3EVOA 4MKVA 4BLGA 4X4PA 1Q8IA 2QGFB 5CYJA 1RADB 2E9RX 2K1RB 3IG1B 2MQQA 3M6XA 5G0RB 5A2QU 3DOKB 2ZVIA 3SCIE 3SMZA 1SJFA 3ZFVA 1T9UA 2H51B 2HS4A 5K14A 1NBEB 1WEZA 3OL7A 4K4ZA 4O44B 4NLOA 3FVYA 2W9CB 1GMWA 4RL1A 5K8OA 3SQGA 4HR2A 4ZVUB 1FWPA 4MYTA 4F04B 2KVIA 3OJSA 5I3UA 2HHSA 2RE1A 3G8QA 4J9UE 3EVMA 4WP3A 2F9JA 1KVKA 3L7PA 1ICEB 4IUFA 2YWGA 1QSSA 3PJ9A 4O3RA 4ZVOB 3MM9B 1L3TA 2YKAA 2DO0A 2IBOA 1HI1A 4OI3A 3W2WB 5ADZA 1KEKA 3N01A 2YKNB 1IN0A 1AT1B 4IDKB 4J9PA 1BMQB 3MFHA 3DGPB 2ALZA 1F60B 1SB6A 2Q79A 3C6TB 1XTZA 3BGFA 3DLLQ 2VV5A 4O4GA 4F4YA 4N47A 2BBEA 5EWGA 3C3LA 2BEFA 3VHQA 2PDAA 5BXIA 2QSFA 5J2QB 4TU8A 3UD3P 1I94J 1QDUB 4ETZA 4A8SA 1MW7A 4OYPA 3RAQA 3ZC4A 3KLGB 3MEGA 2NPIA 3ENAA 1SC3B 2DXFA 3NCRA 1Q79A 2JEGA 4RZRA 3HM9A 2CQ2A 3N4WA 3MPUB 3LPEA 1NAQA 2QL5B 1KOOA 1G6BA 2JLEA 3ENWA 3JSYA 4HKQA 2UXCJ 1FJGF 1R3NA 2YKNA 2B4PA 4X4UA 2UUCF 3J7ZT 2QX0A 2HSEB 2K2PA 2L41A 2HYIB 2MB0B 1LQ9A 2MQNA 3MMBA 4IO1A 4C8KA 3B4MA 2QLJB 3UE2A 4XPCA 5A8KB 5KG6A 5L1IA 2G2YA 3DHWC 3DLJA 1IWGA 1H74A 3O2IA 4J37A 1NJXA 2R8JA 4YS2A 2YBVA 1S79A 3QBCA 5K20B 1Y11A 4FF4A 4K2XA 2HLUA 3CJ3A 4DPTA 4C98A 4GMKA 4GVLA 3T1YJ 1CJTA 3P49B 1TUVA 2IMOA 2ACMA 3H98A 3OTBA 1X4AA 3N28A 1IKWA 1SC1B 3O1LA 3UW1A 5KG7A 1RYSA 4JI4F 4Q44A 3CD6S 1S1UB 1HD1A 3BR9A 1N5YB 2CQ1A 4R8UB 2HNDB 5DG9A 2BQUA 5KFDA 3NNAA 1S10A 4X2BA 2G0JA 2CG4A 4USJC 1WC1A 5FD1A 4DL7A 4IFVA 4E0DA 3DLEA 4DPUA 3EPIA 5E2QA 4ID5A 5B08A 2VZ9A 5D77A 1C4CA 5G0RA 5KT7A 2ZH7A 2LQJA 1N5QA 3JXOA 4LF2A 1NHKL 2MKSA 3PXGa 3TQ1A 2SXLA 2Z4PA 3NS7B 2WVCA 1RTIB 4FN5A 5GADU 4CLWA 3OV7A 4DV1F 4W92B 5IT4A 5E3PA 2LDYA 5KG3A 3UCZP 2ZWOA 2J6UA 3KMQA 2LFVA 4DSEA 2VBYA 3DLKA 2VKZG 4DFPA 2NXJA 3TW0A 3QRRA 2JC1A 1U1KA 2FGOA 3IXQA 3F73A 3WIVA 3S8SA 3MM5B 4ZLNA 2IYGA 3W60A 3CJ2A 4IFVB 1RAHB 5AE1A 2ZH1A 1UA1A 3TNVA 4JV5J 4OJ3A 4Z7YA 1Q86T 2QMXA 1BGXT 2EWHA 1RBOB 1YLXA 2N4CA 3OTDA 4HHHA 4WBFA 2DNHA 3EE3A 2H9ZA 4MMOA 1X9WA 2J0WA 5H1SV 3KLHB 2VC1A 1Q8BA 3HD2A 5GAHU 3W8PA 4B9NA 3THPA 5J2QA 3EGWB 4LBHA 3KLFB 4C9DA 2ROEA 2NZ4A 3VCDA 4X4NA 1NCLA 5F3TA 4Z37A 1H6KX 2VG7A 2BKOA 1HA1A 3PO5A 4YR2A 1HW9A 4RUHA 2QMUB 1GQEA 4IKAA 1FT8A 1TR0A 2J7WA 4PQAA 1T05A 5D4OA 5F8NA 3CO9A 1HBNB 2OD6A 2YKMB 4ES3A 2KT3A 2G9OA 2WBRA 3CJSA 3QWUA 2CPHA 1IR0A 4ZOSA 1DFDA 2YNHA 5E33A 4KIAA 3ILIA 4DUTA 3T1YF 4YR3A 3DRSB 1W25A 2RT3A 2J0SD 4U8YA 2VKRA 4ZPCA 1NSPA 2CPZA 1RJJA 5CCLA 2PSZA 2W2NP 2C2ZB 3HZGA 3Q83A 1NH8A 5JJBA 2HFUA 3BPSP 4MAKA 5F8GA 3MEEA 4ICLB 1UW4A 5LL6d 1R8PA 1CJUB 1OSDA 1JLCB 3SCKE 3TX8A 3T1HJ 4B9UA 3NWRA 4B3RJ 2A1BA 2B7BB 4FYWB 4OLOA 2HS3A 4A8YA 1FRHA 3HULA 4L72B 2DGVA 4FYYB 5A8RA 4M5GA 3V5RA 3D4JA 3K17A 2CNNB 4CYUA 3DKDA 3T5KA 3C16A 4IQXA 4DX5A 4ANCA 2V8HA 1XR6A 4PG4A 1ZS6A 4H4OA 2CVEA 5CA5A 2Q43A 5A6WA 3CF5Q 2UUAF 1AUDA 1QAJA 1RTJB 2VG5B 3GFYA 3M2RA 4DV0F 2RRBA 2F5GA 4DPYA 2XSJB 3EZ5A 1UVLA 2CPXA 3TARA 4QCLA 4JYAJ 3H2UB 3EZUA 4O3OA 1IQTA 4OX9F 1CEZA 4ZVRB 3PHTA 3SCLE 4CLYA 3CCES 2JLFA 4Y2AA 1FTCA 3MAHA 4M8LA 2Z2YB 3BSOA 2XO7A 1VQ6S 1SCJB 5KAKA 3R5JB 2JL9A 4P73A 2YX4A 4FXVA 4NYZA 1TVRB 5LMUF 2XBPA 1NB7A 2QL9B 1VC0A 1L3KA 1X60A 4F36A 3TVYA 4LFBF 3EUNA 3QIDA 3IR6B 4FNHA 2MZ1A 3QO9A 2RU9A 4CT8A 3NKYA 4BC7A 1S7IA 4AT1B 2HBZB 1U2FA 1HW8A 2GMJA 1BXNA 1S1WA 1UWAA 2V9KA 4B3TJ 5IWAJ 1HNWF 1UJ5A 3CCUS 1SBRA 3HHLC 4WCEQ 1LEOA 4WYLA 2OEKA 2LCWA 1N34J 2HAIA 3UQSA 3DYAA 2PMWA 5HMZA 2DNPA 5CZVA 1WWHA 3AD8C 2BXJA 1P8GA 4K59A 2DR7A 2KT5A 1S1XB 3OVSA 2DEJA 4OZLA 4RW9A 4A48A 3WDOA 2ALYB 3E01A 3NMRA 1CJVB 1WKLA 5B0FA 3BH7B 1IR2A 3PR5B 3OVAA 2XY5A 1TTHB 2PFFB 3KG0A 3H5UA 2CPDA 3T19A 1CC7A 2KJWA 1GNKA 2FTRA 1XQIA 4ZP8A 5HBMA 1D3WA 2E66A 1K0VA 4KHRA 2C28A 1KC8T 2QC3A 1YWXA 1HHSA 4Q7AA 4WFNQ 3MEEB 1T9VA 2E5HA 4ICLA 3K58A 4WU3A 1DZ5A 2DHGA 2F4FA 3UR0A 4V19X 3EX7B 1UFKA 3K59A 5L46A 4IDKA 4OJHA 1SKWA 2FHJA 2R8KA 1WI6A 2GCFA 3ZZPA 5J2NA 4PWDB 3Q0AA 1S57A 3K5OA 1YJWS 4ZVTB 1RT4A 1CJVA 2OFGX 1V6HA 4TY9A 3WHIA 4U9RA 5C5JA 3ZZUA 5BR8F 2XM3A 1S6OA 1SV5B 3A3PB 3RBDA 2Z57B 1UVKA 2BA9A 3M30A 3R7BB 3TOQA 4AD6A 1HD0A 4ANDA 4WWSA 3H5SA 3LP1A 4U6PA 1JXVA 4G6VB 4ATNA 1RTJA 5HP1B 2ASJA 1XERA 4DHVA 3FK4A 3ETMA 5HROA 3W1YC 1CPZA 1PGZA 1F6TA 2CQ4A 4EO8A 3IBCB 3CCLS 1IBLF 1RHKB 1NDPA 4DU8A 3DOLA 4O3QA 2ZE2B 2AV5A 2B4UA 1C1BB 1SC4B 2LQ9A 3JSRA 2ZM6F 1UA0A 3GV8B 1ZH5A 1ZOTA 3PV8A 4I2QB 1BY9A 3QT8A 3MAQA 3D5MA 2RRNA 5F8MA 2XS7A 2IC3B 2CJ9A 3PRBA 5K14B 1Q81T 2E44A 3OFFA 3ZTOA 3J81Y 2Z2ZA 2J9DE 5KOXA 2FVCA 1NXIA 1GEHA 3C19A 3GYNA 4JP8A 4N7TA 4EBEA 1PJ7A 3MTJA 1EX8A 2VFSA 3CD7A 1DTQA 4ECVA 1FK9A 2OSQA 4FS1A 4FPRA 4X62J 2XS2A 1U0SA 5IM0A 1JLQB 1U48A 4MIAA 1RCXB 5I3PA 2ZWPA 5EHHA 1UVMA 1EARA 2D7SA 1R0BG 5KG0A 4DR1J 1OO0B 1S49A 4NRTA 4P74A 3GILA 1N6QA 1J5OB 4DV6F 1S6PA 4NLGA 1S72S 4LSLB 2WVDA 2ZH3A 2ASDA 1B0PA 1RT3B 5CYMA 3BV8A 2CNLB 3GZ7A 1GMUA 2CDQA 2AEJA 2M70A 2RQMA 4HLBA 2Y1JA 3BEGB 5DLGA 5DM6Q 3H2VE 2HVZA 4LSZB 2HHWA 1KOHA 2AF6A 4ELTA 2EK1A 1GH8A 4NZ0A 5HSPA 3MM7A 3ET6B 3H7HB 5T41A 5J2MB 1YX2A 4ZCLA 5DGBA 3PIPQ 4JI7J 4Y2KA 4MH8A 1GTHA 2XMJA 3FBFA 3GSIA 2DIUA 1PJ5A 4M5IA 1LK7A 3BM7A 2ZBQA 3M05A 4KJIA 2M5YA 5L8RC 1J2VA 1KTVA 1PBAA 2FIUA 2HK2A 3BSCA 4EYIB 4NLQA 3POTB 5E41A 1UEVA 3GV7B 5C2CA 2W2OP 5AJ3F 3GR1A 2RDJA 1BWEA 4WTYA 1Z4UA 3CT9A 3OR2A 4JI0J 1NJYA 4ILLA 3TVZA 3I0SA 1MWZA 2V67A 4HTIA 2MPUA 2YNGA 3LH2S 3EGNA 1JLBB 1QY7A 1UPMB 1YHQS 3A3OB 1S97A 2RUGA 1N5SA 4JI5F 3HVRA 4RX6A 1CBKA 3DRPB 5E7OB 3OTOF 2I6WA 4DN9A 1NDKA 1PILA 2GHPA 3UD5A 2BX6A 3I9V9 3TZZA 1RT5A 2BANA 3B82A 3MF5A 2BABA 2HS0A 3LQVA 2KG1A 3RR8A 3FSIA 2HVEA 4LBPA 2Y8YA 1QM9A 1VLYA 2Y1RI 1FHTA 2WSFC 1KRPA 2ZD1A 2M0GB 4FVMA 2GV1A 4CM2A 5C24B 3I0SB 4MKBA 4OMFG 5HJYA 4QOTA 1PG5B 1VYAA 2YKPA 5D3GB 2CZVC 2C2MB 1CG2A 1TKDA 2FVPA 5HVGA 1S9GA 2XG8A 3EMTA 1ELOA 3OT9A 3PVXA 4DR6F 1F5AA 1C1CA 3L7UA 2XLKA 1IKVA 1DLOA 2V94A 2EXUA 3OD2A 4HACA 4KV8B 4WFYA 1FK9B 2GAHC 3US5A 4JV5F 4DV4J 1IM6A 3NS5A 4CLKA 2YH1A 2GHVC 4FXDA 4Y6IA 4A8WA 4MK7A 1D9FA 3NNHA 1IR1A 1Y0HA 5M2PA 3HLUA 3UO0A 4YOEA 2GS8A 2C3MA 4WIIA 5LSLA 1EHWA 1S1WB 1S59A 4LIRA 4OZ2A 1H7WA 1KSPA 3OL6A 3OLAA 2DBBA 4PKDB 3VTIA 4JI5J 4ZCMA 3M6VA 3IP0A 1LWCB 3PX4A 2CRLA 2IA0A 3HJFA 1QAYA 4LFCJ 1KLMB 4PWWA 1FNXH 1Q82T 4Z7CA 4PR6A 1V5VA 3S1TA 4JYAF 4I7FA 3SFGA 4M5JA 2Z56B 1XNQF 2XY7A 2MYFA 1IBKJ 4NLRA 1PCAA 1SPBP 5B0EA 4J9MA 2CYYA 2OPSB 1DJ0A 1SQFA 4Y00A 3FGVA 2RKIB 3PW7A 2YKMA 2EI5A 4P75A 1ZPWX 3V81B 2RD5C 4L6V3 4LF5J 1E6YA 2W7AA 4WXWA 5JUMA 2DHXA 2HQ3A 3G86A 2IVMA 3ZTQA 1SL1A 3CDEA 2DR6A 4F50A 3X3UA 4FBUA 2HIQA 4E98A 2BE9B 4WE1B 1U7LA 3TJ8A 1U1NA 2HHHJ 1B0TA 1Y4ZB 2V69A 4DV4F 3CGIA 3TEGA 2MSTA 2UUBJ 4JI2J 3UDEA 3QJJA 2OFHX 1CJUA 2BJDA 3CW2C 2C2KB 3HT3A 1I6JA 2QLBB 2RNEA 3VVUA 1MNEA 2CPYA 2DGTA 2VUGA 2BACA 2MQMA 3ISZA 4JB8B 5HMWA 3TUZC 4V1Ak 4X4OA 4DL6A 1N4LA 1M5PC 3GSDA 1RKIA 1FKPB 3O6QA 1PBUA 3DHXA 3K89A 3LTOA 4L3NA 4PG7A 4A8KA 3V6HA 4JI3F 2PMHA 4EWTA 1T9TA 3TAPA 5JVGQ 1YBUA 1ZM3A 1VFJA 4F0MA 2GJFA 5SUHA 1BQMB 1HWKA 2AZ1A 2FC9A 2QA4S 5E0OA 4B17A 1I94F 1B70B 4CTAA 2VA2A 3Q86A 3W5XA 2BW2A 4TVAB 4P2XA 5AE3A 1D8YA 4N8NA 2KYXA 2MJUA 3EWGA 2XMAA 4FS2A 1SXLA 4X84A 3KXDA 4PXBA 1G7CB 3GJRB 1Z2LA 2ZBCA 3B78A 1NEEA 3MOZA 2VG6B 3BO4A 5B0AA 4DV5J 3W2WA 4A8XA 3VAIA 4ZPAA 1WHVA 1TAUA 4NI2A 3FBBA 4ZPBA 2RQCA 3KNAA 3BDEA 2PT0A 2ROGA 1WHYA 1HFEL 2FC8A 1BC6A 4LF4J 2VBXA 3J80U 1H98A 4FKXA 3FSYA 3G82A 1QUPA 4NASA 2VFVA 1HQ2A 4PG5A 3OW2R 4DQSA 4F2SA 3HHLA 2HBYB 3BQ2A 3JQJA 3FEZA 2W9AA 4OYZA 4QWEA 3ADAC 2V5HG 3M6UA 2C3YA 2F4VJ 1DQAA 1RAFB 1U02A 3PR4A 1IWAA 5HROB 2QFJA 1JLAB 3MCNA 1YBAA 2X3GA 1WKJA 2ZBIA 3SSQA 2QZ8A 3BR8A 4MKAA 5GADI 2QRRA 4ER8A 3MECA 4CH0S 1DTTB 2GIRA 3GIMA 3W63A 1NJWA 1KVIA 4K4YA 3SQOP 5F0UA 3DLBA 2Q1LA 5CAAA 5HMYA 2E5LF 3CIZA 4TXSA 1RK8A 4ZN3A 4QPXA 5J2PA 3BH6B 1VK3A 2RKIA 3CD0A 3C15A 3F44A 4JBCA 4TU9A 3CJQA 1U25A 4FVCA 1Q5YA 1RT6B 5FDLB 3WQPA 2C1EB 3NXZA 3GCXP 5GVQA 2MZSA 5IOLA 3RBXA 2QN6B 3BO2A 4J91A 4KGZB 2AKWB 3VV2B 1ZZNA 2M7SA 1HNIA 5A76A 3CIMA 3I4PA 4J9SA 4RPFA 1RAJA 1O8BA 4ZK7M 2KM8B 1L3VA 4YB5A 2Y9HA 1NK6A 3TEHB 1NPPA 4I6YA 3AQPA 3ZZTA 4AE5A 3CJRA 1PYTA 3HSGA 2RQKA 2OPPA 3OXGA 3PY8A 2ZH6A 4RU9A 4M5DB 1RWXB 3CDUA 2BZ2A 5J1PA 4Q45A 3H25A 1HHQA 2EFNA 4ELVA 1M1HA 2PC6A 2B5JA 2BM1A 3PYFA 2B6AB 3NGTA 3W2VB 3PW2A 2ABYA 2W1BA 1FE0A 3DDKA 4DFJA 2HHUA 2FZGB 4DLEA 1D09B 3CDBA 5D8HB 2EFOA 2J5AA 3I0RA 4DUZF 2C2EA 3KLEA 1HWUA 4H4KA 1JXLA 4ALZA 1HNWJ 1SIZA 1A0OB 4F67A 3QLHA 2UVUA 5C7PA 1UWBA 5L9XA 3Q8VA 1NHUA 5C24A 4PUOB 3IG1A 1IKXB 2DO4A 2DH9A 4I6AA 4ILMA 4OFZA 1E6VB 4K4UA 4NE9C 1F0XA 1PC4A 1S1TB 4BS2A 3WX8A 4USIA 2F1FA 3FQKA 3DRRA 4QIFA 3G9CA 2O66A 4LJMA 4DV2F 1H0HB 2QSWA 2HK3A 3RB3A 2RSQA 1NZ8A 4HT5A 5CABA 2XI3A 4OYBA 1TKXB 3CMQA 3I0RB 2HGLA 4Y34A 4PQUA 4DV6J 3LANA 2XS5A 3KK1B 4KKOB 2XMKA 3MMCA 1SUQB 3MZIA 2EBEA 2WAQD 3DU6A 3WC2A 1HMVB 1VHFA 3DRXA 4KO0B 5H9FJ 5GMKa 1F9EB 4M5NA 4DQPA 4DDFA 5LOQA 4MFBB 4C3MA 2ZH2A 4PZVA 3UPFA 4NXNF 1FKAF 2WSCC 1XMOF 3CJTA 1FEEA 2R42A 4C6AA 1KLMA 1TP7A 2KYZA 2W9BA 5HO4A 2Q6BA 3EGVA 2CPIA 2V2KA 4DX7A 1MWQA 3FC9A 4M5LA 2DGUA 1GK8A 3RUBL 3HT0A 3LGMA 3RAMA 1K9MT 3OLBA 3R2DJ 2W4PA 1JK9B 3ZZRA 1N5VA 3EICA 4KB7A 3VQSA 3TJAA 1LW0A 2VFUA 1RT7B 3AOAA 2UXBJ 3E51A 4N56A 3ZO7A 3MR7A 2V34A 4RNNA 5DZ6A 3RW7A 4N41A 4LFBJ 2DGOA 2OPQA 4OQJA 3T5JA 4I68A 4Q2MA 3EYZA 5A2QY 3AAWB 2W01A 3FCVA 3NL0A 3W65A 5D6GA 3PW5A 4ZITA 2V4RA 1YGYA 4J9LA 4DL2A 4CO3A 2ZZMA 4TLQA 4PXEA 3M1VA 4HTJA 4ZA1A 1EETA 1T02A 4L3KA 1Y00A 3DNCA 3PACA 4F02A 4JV2A 4LQ3A 1FD2A 1H73A 4USWA 3SEOA 3DXBA 3RRHA 4JI8J 1VQNS 1S9EB 4TN2A 2D74B 5DDQC 1IBMF 2HPUA 1UWBB 4WKYA 5J2NB 5HQMA 5KT4A 4ZPWR 4P2SA 1VQ8S 2YQ1A 3D7SB 2ZHOA 2OKQA 3CCZA 4HL9A 4RBVA 5C42B 3PW0A 2AX0A 2EC0A 1EKRA 1YZ6A 3EPGA 3KMSA 2CQIA 3MOJB 4QYZK 2W7PA 2RMLA 2JFKA 3AH6A 3SV3A 4Q5VA 2V9WA 2D9PA 1PKUA 1W7WA 1YJUA 4EFAC 1RDRA 2MDAA 4NI2B 2CG8A 4RBTA 2FJEB 1QTMA 4NXNJ 1LV5A 2PD1A 4USUA 2G0CA 3GR0A 4LR8A 2EBGA 2HIYA 3DYAB 2BE2B 3Q22A 4KV8A 3IAM9 4QR1A 2JFDA 4PG8A 1RWVB 2YNFB 2NUUG 1FKPA 1T0TV 1XN9A 3QPIA 1DQ9A 5CZXA 3A8IA 4YMEA 3KK1A 4EBCA 1M1KT 4B9VA 4RNFA 4OI2A 4KH0B 4ZVEA 5KG2A 5CHCB 4DS4A 3M2UB 2BDPA 2NXEA 2VFRA 4X66J 3NGSA 4URQU 2PIIA 2AGQA 2ZKUA 4DR7F 1RAEB 1TKZA 3PW4A 4RW6B 3IR5B 2ZZNA 2XLJA 4O3SA 1HBOA 2JVRA 4IG3B 4RWWA 3QYYA 4A8QA 4A8FA 1RACB 1WDDA 2DNRA 1YQHA 2H65B 1Y3KA 2M52A 1R43A 2UZAA 4IH5A 4RW7B 4ZMMA 1LWEA 4O4RA 4UOCA 2CIMA 2QO3A 3M8YA 4DF8A 1XIQA 1RT2B 4LF9J 1G2EA 1JKHA 2UV8G 4OZNA 3AY0A 4XO0A 2MKKA 2Q66A 3QRPA 4QWCA 1R8HA 2VIHA 2LEAA 3SIPB 2JSXA 4NYOA 1GXTA 3MD1A 4U96A 4C11A 3DLHA 2B4VA 4MKYA 3BSNA 1WHWA 4TLRA 1RWNB 1VISA 3DLGB 1LW0B 3IRXB 3TP2A 3VAHA 1K8AT 3U7JA 3HP6A 3J81j 3KFWX 2ZJQQ 4UW2A 5LJ3Y 3NGRA 4OJGA 3EJMA 5KFMA 3BGUA 2OPQB 1TV6A 5KFOA 3G6YA 5CQGA 3PHEA 4CLSA 2UUAJ 3DCAA 2LECA 4MIBA 3DM2A 4G1QA 2HMIB 1OY6A 3C14B 2YWHA 4B08A 4DCOB 4LF8J 1VQPS 1U0HB 1ITPA 2CQDA 2Z0GA 2AJFE 3LP0B 4AXIA 5HL7Q 1FNMA 4C0OC 2NXCA 4NLUA 3PX0A 3QGHA 2BR0A 1R27B 3HZEA 4LSNB 2Y3YA 4DR1F 2H48B 2UVWA 4QIVA 4M63A 4K5SA 5CH7B 1RHJB 2PI4A 1FTRA 4TQSA 3TUPA 1FERA 3BJYA 3G2XA 1JMTA 4FZVA 1IKWB 1TV6B 4DLGA 4DQQA 1OY9A 1HBUA 1YKWA 2CQGA 3IM8A 4UQTA 5T7LA 2C2DA 4CTAB 1N8RT 4NX9A 1RUSA 4DOZA 4KGXB 1HL6A 1QE1A 3GJTB 4P7VA 1IBCB 5K5MA 5U47A 3LWMA 5H9EJ 2FPHX 1L3SA 4ELUA 4RW4A 1RT1A 2H5IB 4FDFA 2R7UA 3JYTA 5HK4A 1U2CA 3QAEA 2AQ4A 4AL5A 3MMBB 2J6SA 2ZBRA 1C0TA 1T9WA 2VBZA 2YWEA 2NXUA 3B6BA 3NY0A 3VZIA 3W9HA 1VQYA 5KFIA 1YIJS 2BMBA 4B3TF 3FCHA 2MTLA 5DETA 4F4ZA 1ZBTA 2J7KA 3BN7A 2XWXA 2VOOA 3JTPA 4WPAA 4AL7A 5E3CA 1JJCB 4I6WA 1TK0A 5KFEA 3HSDA 2RB7A 4ZVSB 3HJVA 1VQ7S 3H59A 5JVHQ 2ADCA 1PJ6A 1M90T 2UXDJ 5EX3A 2HLTA 4NZ6A 3I9ZA 2X3DA 2MKJA 3QT5A 2FZKB 2PO4A 3KUEA 3QLHB 2OJ3A 2UU9J 2AWZA 2EFQA 1HBNA 2R7RA 2R7WA 1QSLA 4EYHB 3CDAA 3J80Y 2FQQB 3RB4A 3KTQA 1K0TA 2YNHB 4G1PA 3I96A 1RTIA 2CZ4A 2V68A 3A4TA 1U49A 2B56A 2I5JA 2JDJA 2R8GA 1UMJA 2VG7B 4DX6A 4QU6A 4L74A 4HT7A 2UXCF 5J1EB 1VGYA 4J90A 3QFHA 4DL4A 2D1CA 2UUCJ 4M1KA 5IM0B 1CLFA 5ITHA 1GT8A 3HFVA 3ONQA 5HBMB 2R2TA 4F3OA 2NYIA 4GVBB 2ASYA 4M5KA 1QLNA 2E9ZA 3OHBA 1FVQA 2KRBA 1XNRJ 3VAFA 2Y0BB 3PKMA 4B3OB 3PTWA 5D78A 2RHSB 5CD4A 2PA3A 4IR9A 1RT5B 1GXLA 1U8SA 1S6PB 3DGVA 5IS2A 1FJGJ 3RW6A 2VFTA 4ZPTR 1E6YB 2LQ8A 1NK5A 3OJUA 1RTZA 2IPOB 3OUYA 4NMLA 2I5JB 2DTJA 3V4IA 3QAUA 2CPJA 1TL3A 5E3RA 3KYLA 5ETPA 2GC8A 3AA8A 3A8KA 2ADBA 3UNGC 1YZ7A 1K1QA 5D0RA 4CQ1A 4RUCA 3M30B 4NA3A 2GVZA 3N6NA 2F65A 4DG1B 1S9GB 1UFLA 2P9GA 1FE4A 2B8QA 1FKOB 2W7OA 1RAGB 4DR3J 4MJKA 2BRLA 3I82A 4C3LA 4B3MJ 1WSVA 1AZSB 4OZ5A 5KFPA 1I51B 1TZ0A 2HRUA 1RTHB 4NA2A 4X62F 1D0EA 3D0IE 4H4OB 4X64F 3VGUA 4LRBA 2KN4A 3JQKA 2ERRA 4O0NA 3A12A 3BREA 2P9CA 1NH7A 4AQYJ 1S6UA 1V3SA 1H2TZ 3ELHA 4ID5B 4P9SA 3HHKA 3UDCA 1IKXA 1I1GA 4UQGA 3BQ0A 3EM1A 2J9CA 3QO9B 3IWXA 3ZXWA 3AQOA 2HHTA 4XTTA 4FPIA 1N88A 3QT7A 5DS7A 2XZDB 2GW8A 2K3KA 1HNVA 1RISA 1VDHA 2M88A 2VPZB 3OTEA 2VG6A 4URGA 1NO8A 1PAEX 2AX1A 4CLZA 4WTOB 5IFMA 5DG7A 3ITHA 3C66A 2HHVA 3H90A 1Y5NB 1J5EJ 1B7FA 1WI8A 1P9QC 4YP3A 2FVRA 4JV1A 3S6EA 4PWUA 2BOAA 4P10A 1X8DA 5THWA 1WACA 2OPSA 3AB2B 3MMCB 1VQ9S 1FX2A 1N32J 2FUG9 2DCUB 4XAKA 2LA6A 4LRDA 2HURA 2UV8A 3PEHA 5I4MA 1S76D 2W4CA 2ROPA 2QJ3A 4WK1A 1Q1KA 2FJVA 2IVFB 3KHRA 2P6SA 4DSIA 1VQ5S 3TI0A 2CWXA 2VDIA 1O5JA 1PYOB 1HARA 3NCPA 2P8IA 2FHOB 1WOOA 3FZBA 3AFGA 5KFYA 1KR4A 4JOUA 5J2MA 3GJSB 4LRFA 4DX8H 3OL8A 1HBMB 1WC3A 2YNFA 3NOCA 5C25A 4DPOA 1HIYA 4AQYF 3KLVA 3BS9A 2QT7A 3ETOA 1C4AA 1KQGB 2OPRA 2UUWA 4YN3B 4XPEA 3OVBA 3DDNA 4S0MA 3LGNA 3P8BB 4OX6A 2ZHAA 4DV7J 2YH0A 4Q8FA 1YSJA 4JI1J 3BQ1A 2HRTA 2KXNB 4NCGA 3TWZA 1NNDA 1TL3B 3BKTA 4QIWD 4JI0F 5KFTA 2DNOA 2FD2A 4NA1A 3Q8UA 2IMWP 3V6DB 4ITSA 3DFEA 4I0WA 2C3PA 5HP1A 4PYAA 4DG1A 2DRAA 2RDDA 3OFHA 3NWGA 1FX4A 2OSRA 3KUGA 3TAQA 1WD6A 3JTNA 2PI5A 1TFYA 1P1LA 5C25B 3KWMA 3ZTRA 2CQCA 3MCMA 3P45B 4DL0C 2F9DA 1ZAVA 4DUYF 1VC6A 3HHDA 2B43A 1Q7YT 1Y10A 2KHDA 1X4GA 1MMDA 3D1HA 5HLFB 5HQ8A 2U2FA 1ZPVA 1CJTB 4ZS6A 5IC6B 4LF7F 1TL1B 1UJ4A 1JQGA 4W4MA 2N3LA 4OI6A 2FJBB 3MCOA 1R89A 1LXNA 2VQEJ 2EVZA 2R7XA 1EB0A 3DOMB 3WBZA 2VL1A 1WC5A 3DOLB 3I32A 4DSFA 2XEXA 5ETRA 4ECTA 2HMIA 1RT1B 1QSYA 3FDSA 4NLSA 2I2YA 2MY7A 1IKVB 1DLOB 2W2PP 1H72C 3MMAB 4F0KA 4AL6A 5GMEA 1RABB 2XMUA 3PZPA 2DPJA 1FFSB 3QJPA 5IZHA 2IA6A 2C3OA 4CLFA 2EG1A 3C8YA 3HVWA 4F4XA 5EGYA 2DR9A 2VA3A 3DMJA 4NLXA 4UUXA 4YEAA 5EX0A 1PO6A 2A10A 5IWAF 1EJ7L 1NMEB 2MLYA 3R1HA 3GG1A 4GO7X 1APSA 1MU2B 3MD3A 1BQMA 4P52A 2U1AA 3R3TA 6AT1B 1X0PA 4JI4J 2HW3A 2OUGA 4ZIVA 3KJNB 1PIEA 3T6BA 4I2PA 3CJKA 2N3OA 1R0CB 4IQMA 2IJRA 4LQ9A 3V4MA 4KTQA 1B64A 1S48A 2JC0A 2A2DA 3MTKA 4Q43A 3IRWP 1HNXJ 3CVKA 4DQIA 2MZRA 2EK6A 3BF4A 1R6YA 4KGMA 2DEIA 5B7WA 1WTFA 2YXLA 1PAUB 2ZE2A 5BYSA 1NK4A 2J0QD 2HZCA 2NR0A 1AW0A 1GMVA 4WZQA 2W24A 3D67A 4GKJJ 2JWNA 3LOUA 3NBPA 1W2IA 3R5AA 3ZNUA 1UTAA 4NCBA 4DR4F 3SCJE 2CFXA 3D6MB 2IBKA 4NXMF 2F8EX 2AIRB 2LQ5A 4M5DA 3L7OA 2KFYA 4ED8A 1HWLA 3AJ2A 2YX1A 9ATCB 1NK0A 4PCQA 2B3TB 5G4DA 3SYZA 2IJNA 1DTQB 1KP6A 2B6AA 3PM9A 2HVIA 2XSFA 1NDCA 3TYTA 5ETQA 3EGZA 1NKEA 2HBRB 1JNZB 3IWLA 3BBFA 5DLFA 5I3QA 3KK3A 3TAMA 4X65F 3CEDA 4DQRA 3HHEA 4TKTA 3GWCA 3EVWA 3SXLA 3ZTPA 3M8QA 4F0HA 1N36F 1J27A 3UNYA 3RTVA 3TA1A 1SJ4P 2NLWA 1U1LA 1JLEB 2V2QA 3KKFA 1V3ZA 1N33J 1U0HA 1HYSA 1ZM4A 2WRMA 4DR2F 3UCUP 2HKEA 1RT3A 2APOA 2FY1A 2OO4A 1NUEA
chains in the Genus database with same CATH topology
2ZNYA 2D41A 3MGJA 4YB7A 4OZ0A 4FP9A 5J1EA 2NSCA 1SH3A 4B3SF 1HNXF 1LW2A 2LU1A 4C8OA 4DL5A 2OIHA 3CC7S 1KVJA 4LUBA 3M1VB 1URNA 2MZQA 2G13A 1VBXA 3T3FA 5KT3A 1C1CB 2GQQA 3M9MB 2IM2A 4OHWA 4N5SA 1VQOS 3J7YI 2BRKA 3CCMS 3HXMA 4F2RA 4DF4A 3OSNA 5D3GA 4HDHA 3EXCX 1FEHA 3CCTA 4CO0A 4F4WA 1G3OA 1JLFA 1HNVB 2E1MC 1UEUA 5M2RA 5GAEI 1LW2B 4O3NA 4Y2MA 3RB0A 2RIJA 2DGQA 2E1CA 2XNQA 4NYPA 3SSRA 3GMGA 7FDRA 5KFCA 1P27B 2HNZB 3MR6A 1S99A 1N5YA 1TVRA 4Z2XA 1UL3A 1N0VC 2IRXA 1IUJA 1X4CA 3NS6A 3KJVB 3KHHA 1T3OA 2GGPB 5IQ6A 3M2UA 3WX4A 1OQ3A 4ZHRB 5KFJA 2F8MA 5KFGA 3G96A 3BN4A 3OPKA 3TR5A 2AYGA 1TL4A 3NAHA 2RILA 3ISND 4KQZA 2IYIA 1HQEB 1HQUA 2LVWA 2XNRA 3IWNC 1OQ6A 2KJVA 4RKUC 3N5BA 1UP1A 1RT2A 2GFFA 2RH3A 3MI7X 3V4MA 3RRKA 1DQ8A 1MROA 2Y1IA 4QPTA 4FYDA 2RRAA 2GA7A 2IRUA 5HP1B 2XULA 5A8RB 3TAMB 3PNIA 2WB4A 2E7WA 2DISA 2FJWA 4RBUA 3M2VA 4HI2A 4DV3F 2AD9A 2MY8A 1WTBA 1N5TA 1L5UA 1NZAA 4IFYB 1RTDB 3MR2A 5CXTA 2E7XA 2E1RA 4LF6F 5KFFA 3NNCA 2GMHA 4KFBB 3MPYA 2XB2D 2YNIB 2JLGA 1LWFA 1JLBA 3AA9A 4I69A 3MUVP 4C8LA 5KG1A 5BYQA 2MGZA 4ECQA 3P3DA 4HEA9 3FRYA 2FLOA 5A0YA 3K5PA 2V0NA 1R7IA 2L9WA 5EWFA 2IM0A 2D3UA 2R2SA 1VJWA 2XWYA 5HLFA 4GC6A 5MAOA 4K0KF 4G3IA 2ZH5A 5DQGA 2G4BA 3PDNA 3PFOA 5KFWA 1UFWA 1JLCA 1N52B 4IH7A 3RZAA 3R5CA 3CJ5A 3LPYA 3M9NB 3CJ0A 5DDRC 1DHMA 3GFXA 1ZM9A 4WKRA 3MM8A 4O0IA 2MHEA 1YRTA 5LSRA 3DMJB 3SV4A 2MKCA 3CCQS 1QAIA 4LF8F 3M8SA 2B9YA 1HPZB 1XMBA 5A6PA 3NMAA 3G4SS 4QW9A 5L39A 1ZETA 4LFCF 2A2CA 3BGLA 3PFEA 4MK9A 3I5AA 2QE5A 1T95A 1L3UA 1XBWA 2GMLA 4YR0A 1N54B 4A47A 5GAGU 1M5KC 1F5CA 3E8OA 4ZVHA 4K4TA 5KFUA 2CQ0A 1WF2A 4HI1A 5FLXY 2WOMA 2OD4A 3OXFA 2LKZA 3T1HF 2GJ2A 4YB1P 4U67Q 2KFZA 2WTFA 5CYMB 2CJBA 5A8WA 4LVNP 1S0NA 4IRCA 4F8RA 1P6TA 1RT6A 3GFZA 3JSBA 5FDLA 4EEYA 4KPYA 4J5OA 2KM8C 3V81A 4LFAF 1UVIA 3KG4A 2J0XA 1VK8A 2JEIA 3LP2B 1YG0A 4NCGB 1HI8A 3K2YA 4J9KA 4DFMA 1ZM2A 4ERDA 2WW8A 1H38A 2ZFHA 2N82B 4W90B 2JHEA 3CCSS 2LU2A 4YFUA 2DNLA 1IXKA 3Q8RB 3UCGA 5KFHA 2UU9F 1IJEB 5F8LA 2VPYB 4ECSA 2RF2B 1QUVA 3FEYB 3MEGB 4LF4F 5KFKA 1TAQA 3BGRA 2GHWA 1Q7LB 1HNIB 2UP1A 4X66F 2CJKA 3DLKB 5K8PA 5GAHI 2RS2A 1U09A 2VOPA 2IJFA 3Q2TC 2B51A 2KXHA 2R4FA 3MM5A 4QBUA 4KKOA 4Q0BA 4QWAA 2KHCA 3U1NA 2B0GA 3MM8B 2OPPB 4AYBD 1M5HA 4J9NA 2FVQA 2J76E 3TO8A 2E5JA 2KO1A 4KSEB 1JJ2R 1D9DA 3M6WA 4HVZA 4PXDA 4JI6F 1DARA 2ILYA 1FDDA 3BGRB 1S1VB 2FLPA 4KHMA 3LWLA 2W9BB 4M95A 4KE5A 1H3DA 4QIGA 4C0HA 2JJ4D 4DMZA 5DDPC 4DWIA 5E5NA 5KFVA 2HQIA 3OFGA 2O1PA 3CE8A 3NCQA 2CQHA 5M2UA 2VPWB 1YJRA 4ZDNA 3MFIA 1WF1A 2LA4A 3MPWA 4OI1A 4YY3F 1U1MA 1YJVA 3FEXB 4ED7A 4PG6A 2FHJD 2YX7A 4EBDA 2DGXA 2KFNA 5LMNF 1FDBA 1FJCA 2QLWA 3IRXA 2G1DA 4J9QA 4R0JA 2MKIA 3E2EA 4DSKA 4WJBA 5B0CA 4AFFA 1HBMA 2A3JA 2DNNA 4Y65A 2WSEC 4QJVA 3BO2A 4OL8A 5KG5A 4ID8A 3KG1A 1AFJA 2OPRB 2CPEA 2AYBA 4CO1A 4IRKA 3KNGA 2WONB 5KFZA 5LT5A 3C6UA 1KTQA 2CVIA 4NLPA 1QVFR 5DM7Q 1X5SA 2QMWA 1JLEA 2R2UA 1Y5IB 1GX5A 3M4XA 3QGPA 1RP5A 1FRLA 4OHXA 1R8CA 1HQEA 1Y5LB 2BQRA 1FDNA 3SDEA 4WFBQ 2M3DA 2B5JB 2V8GA 3WZ0A 1Q4RA 5DQIA 3TANA 1S6QB 3QJLA 5DO2A 1XWLA 1HBUB 2HNYA 1LKZA 3HPOA 2OAUA 1YJ9S 1KLNA 2MZJA 4CZCA 3QZ7A 2GQCA 4ECUA 1RWUA 3PO4A 1QE1B 2BE2A 4YUDA 1WELA 4Y28C 3LF0A 3DC2A 1LFWA 5AXNA 3CXCR 4Y3CA 5AXKA 2WHOA 3THTA 3K5NA 5GAEU 3HFKA 4NLYA 3JTOA 2UUBF 4CH1A 3G6VA 2N4DA 2V8VA 3DOMA 1HHTP 1K1SA 2FDNA 2ZH9A 1JLFB 3GYXB 4NLDA 1TKZB 2DNYA 3G8SA 3J7YU 3X1LB 2QV6A 1V3RA 3GIJA 1FRKA 5CCMA 2FGCA 3VF0B 2O01C 3D2WA 2R7TA 3OL9A 3TUIC 4NPOA 3OHAA 3L3CA 2KRRA 1X4HA 3CMAS 1GX6A 1ZAWA 1U24A 4C11B 1LK5A 2E9TA 2VQFF 1WG4A 3JSMB 2IVYA 5K9FA 3N5FA 5DRKA 1Y9OA 4DEZA 1OPZA 2A18A 2IRYA 2K7KA 1M5SA 1CC8A 2XI2A 3N6LA 1OIAA 4QR2A 1CQMA 1LWEB 4JI2F 2XLIA 1T03A 4KBIA 1D9AA 3D54A 4CCHA 1VI7A 3MECB 2CJAA 4H4MA 4QZVB 2VONA 1FCAA 2V4JA 4ZP6A 2ZJPQ 4B3RF 3W3SA 3KK2B 1G1XA 3CCWA 4B3MF 2QA4G 5HP1A 2I1RA 2VC0A 2L3MA 3IR7B 4MIWA 4P7TA 3NG8A 2XGPA 1U6BA 4F25A 5LXRA 3KHLA 3H5XA 3S01A 2KTQA 1VRUA 5L38A 2K7JA 2N7YA 4P6QA 4DSJA 2XHWA 3DM2B 3KLIA 2ACYA 1R8AA 3EXYA 1RI7A 5F0WA 2EKYA 4NOHA 2MZTA 4ZCKA 1SJ3P 1X5TA 5T7LB 1NK9A 4I4BA 4QIEA 4DSLA 4BCAA 2DK2A 4PXCA 1VS3A 2MXYA 1H2VZ 3DI6A 1KNZA 4RW9B 2FJDB 3CULA 2VB6A 2PN6A 1LXJA 2EFPA 4G1IA 3H4BA 1Q8LA 1J5EF 4GKJF 1GXUA 1S9EA 1IKYB 4LMZA 2YKOA 2IC3A 4U7UK 1DRZA 1PSDA 1S77D 1F9FA 4I56A 2HFZA 3OBIA 1S1UA 4OJ1A 7FD1A 3KLEB 4G1QB 4ECRA 2VH7A 1T3NA 2WCXA 5F9LA 3LP0A 4HHJA 1C0TB 1R8BA 4O3PA 4FNIA 3DGPA 2KDOA 4TYBA 1FRXA 2R7OA 3N6MA 3NAIA 4RW8A 4WFAQ 4FXWA 4M94A 3RB6A 1XEZA 4WFZA 4WU2A 1TL1A 3DXSX 3H20A 3SQGB 2HGMA 3E3XA 2CQ3A 3M32A 5B0GA 3UDLA 4OZJA 2ZDPA 3SZ2A 5KT5A 2N7CA 4URSA 3HVAA 1NJZA 4RW6A 4BBYA 1D1UA 3QZ8A 4B9LA 3A8EA 1IM4A 1U1QA 1C1BA 4BC9A 2R9LA 5F3ZA 5K8MA 1ZTWA 1IBKF 2DGWA 3SI8A 1DAXA 2B9XA 3DU5A 2L9NA 1JJHA 5DDOC 4D3HA 2HWTA 3C6TA 5D4PA 1HQUB 2KH9A 3HO1A 4Y2IA 1S1VA 1VQLS 3GIKA 2DHAA 3M32B 1K73T 1HR0F 4OI4A 2Q6CA 1T05B 1FKOA 1BD6A 2QA2A 2X1AA 2DPIA 3D1QA 2BUNA 5DG8A 3M2VB 1RT7A 3OUYB 3V4IB 5KFXA 2LQBA 3LUYA 4WK3A 4C8MA 1RT4B 3HF5A 1SJ1A 2AJQA 3GG0A 3A1YG 4ED5A 3VQTA 1FRMA 1RYRA 1BQNB 4A4JA 2JZ5A 2RF2A 4X4SA 1WG5A 3CWJA 2AJ0A 3MEKA 5CD4H 1X9MA 1X5OA 1RTHA 2KKHA 4QYZJ 1FNOA 2LXFA 1NRKA 2ATLA 2UUTA 3P96A 3SSSA 3HMJG 4CT9A 2CKWA 3UWTA 4CO5A 3MMAA 3POTA 2DJWA 3HHNB 4DFKA 4RW4B 3PKYA 4OHZA 5AXLA 2MMYA 2HHHF 3B4DA 2IHR1 2JVOA 1U1RA 1KQKA 3HVTB 1BQNA 4QWBA 3SDEB 4C3KA 3ITHB 4UY8T 2DNGA 1ZAXA 2GJIA 3T9ZA 5GAGI 1U2RA 2J9EA 2NSBA 1UETA 2AYMA 3RAXA 4F3QA 3NRBA 4R8UA 2B4OA 2K1RA 2PA8D 4I1TA 3U27A 4ED3A 5B09A 2PGCA 1ZYQA 1RKJA 2QYCA 1XK8A 4LIWA 4OX8A 1RGVA 5KFSA 3N0VA 5MLCV 4IH6A 3JSMA 1N6QB 2AGOA 2W8LA 2FHKA 1MSWD 4D3GA 2FLNA 4BDPA 1N33F 1JJ4A 3RR7A 3T1AA 1QVGR 2F40A 2RS8A 4EU0A 2ZJRQ 3GE9A 4KFBA 3LW5C 1N34F 3FZ2A 1TKXA 3OQ2A 4PQUB 3I5CA 1FXLA 2DNKA 1HWIA 3IS9A 1JKHB 3LAMA 4XDCA 4IOCQ 4ED6A 2AGPA 4YHHF 1SUQA 3PEJA 2BVZA 4CIOA 3CPWR 2IAJA 2R7UA 2YY3A 3IFEA 1CSJA 2DB1A 4C7QA 4Y0FA 5A8WB 4DR3F 2JEJA 4F3MA 3MM6A 3OSPA 2XGQA 1S9FA 1JWWA 4B3OA 1VRUB 4ZPDA 3T9NA 4K4XA 2OP5A 2DH8A 3WC0A 1HYSB 4KC5A 2F8HA 2WONA 4QQBA 3AJ1A 4YB6A 4QW8A 4ES1A 3U02A 4F26A 4AUKA 4ZP7A 2QLXA 3SFUA 1XR7A 4U7CA 4R25A 2BOPA 2HVHA 2LDIA 3OTCA 2RU3A 3FJ2A 3V6JA 3IA0A 1MROB 4NZ7A 5IT9Y 4A46A 2WBMA 3M8RA 2DNZA 5KFQA 3K8VA 2OH2A 1S6QA 3MPVA 1JNRB 2HFNA 1JXEA 3CJ4A 4IG0A 4LT6A 5A8KA 6FD1A 3NP5A 1KFSA 2XY6A 4IFYA 1RTDA 3LP1B 4OIXA 3IO1A 5I3UB 2QEXS 3O44A 4KAIA 1TQLA 2K3IA 3Q8QB 4E8UA 2AU0A 2KZMA 6FDRA 1NJIT 1SH2A 1X7VA 3G8TA 1H7XA 3VAJA 1U47A 2L9DA 3MDFA 2XZWA 3AHPA 4Q8EA 4TNOA 5L9NA 1AXQA 2XMMA 2K8GA 2P9EA 2RDIA 5IT0A 4MK8A 4WXOA 2NREA 2M2BA 3E01B 3DN9A 1RQ0A 1XC9A 4ZHRA 4IYQA 4ED0A 1AUDA 2KU7A 3FFIA 4KR0B 3MURP 2ZHBA 2M4MA 2KXFA 3PJXA 2MJNA 2IM3A 2PE8A 3V2UC 1SQEA 1CQNA 3NLCA 4DL3A 1JLQA 3PRDA 2EW9A 4ZP9A 3BSAA 3ICLA 4RNHA 4IR1A 4BHQA 1V9OA 3K7RA 1JLGB 1R31A 3FSXA 3NBPB 2RVJA 2NUHA 4YDXA 3P6YC 2R7SA 4XK8C 3DOKA 3T5HA 2X51A 4I7FB 5HMXA 4PWDA 4GKKF 2VBWA 4CNYA 4ECYA 4O44A 1Z1ZA 2W9CA 4LSNA 3CSKA 2VASA 2LLZA 3MM6B 5K8NA 3KLHA 4HDGA 4NLVA 4RWXA 2POKA 3M8PA 2YTCA 4BWMA 3UI3A 1RA6A 3BO3A 4UY85 1SL2A 4NLTA 5FIIA 4A8MP 1Y7PA 1Z2ZA 3H5YA 2DR5A 2VD3A 2KZZA 4ZLPA 3JB9k 1F5BA 1NK7A 3C2PA 2YNIA 4RLEA 5EWEA 4TU7A 1D8ZA 1LWFB 3V6DA 2ZOMA 5LSOA 1BLUA 1S1XA 2RJZA 2R7QA 3MWBA 3Q23A 3MUMP 2CJQA 2MKHA 2IM1A 3T6JA 5D4NA 4ECZA 4Q0BB 3DLEB 3ULHA 4JI8F 2JX2A 4B9SA 3GB0A 4V19J 4ECXA 4MYUA 1NKBA 5KFRA 3ISNC 2M9KA 2DNQA 5J1NA 4QR0A 1VQ4S 1HWJA 2E1AA 4X4VA 3G6XA 2C22A 1X4FA 3O8WA 3KK3B 3HHLD 1M5VC 4JV0A 3GQCA 1WHXA 4O23A 5BJRA 1Y3JA 4I64A 2DHSA 1VQKS 2OMLA 1U45A 1C0UA 3LAKA 4TY8A 1X0FA 4MFBA 4DBQA 2I38A 2HG4A 1U6FA 2COLA 2RQ4A 3HK2A 1OPIA 4NRUA 3M9OB 1KONA 2EPIA 3S7RA 3CCJS 3FFIB 5E3AA 3W2VA 4NWBA 2ZH4A 3K57A 3CCVS 1MMLA 2M8DB 5CYQA 3BZQA 3UR3C 5KFBA 3RYLA 2IFXA 2GGPA 1UVNA 4OV1A 5KFNA 2Q3PA 1NHVA 4ZPVR 5EUHA 2D3ZA 1YJTA 4A8OA 2Z2MA 3I31A 4I2QA 2J9DA 4XDDA 1OS5A 3QIPA 2R8IA 4DS5A 1VC5A 3IBWA 3FMWA 3C6UB 4CO2A 5IXUA 3R1LA 4CO4A 4EZ6A 5LJ5Y 1WEYA 4EO6A 2XCPA 1U1OA 5AXMA 5KFAA 4O4GB 4FF2A 3U1LA 5J2PB 4ZVFA 4JUZA 1TK5A 4EZ9A 3C46A 5CYQB 4H4MB 5F8IA 1SJQA 4ED1A 1KQSR 3FRZA 4N77A 2JOQA 2I9SA 2YWFA 3PJWA 2ZUGA 4YQWA 3W7BA 1ZTTA 5KFLA 4X4QA 1KHVA 3K0JA 2HNYB 5L1LA 2FJXA 3OR1B 3IGNA 4QWDA 2MSSA 3CCRS 3OXLA 4IOBA 3MEDA 3I5BA 3ZZOA 5KTQA 4JI1F 1S0VA 3RU0A 4MTPA 4WYWA 2MQOA 5C42A 2GO9A 1X9SA 4OHYA 2FLLA 1NU4A 4CNZA 3OFEA 1KS2A 3I55S 2LXUA 5B0BA 4LF5F 2UVVA 4LF9F 4OHVA 1M5OC 3IS9B 4C4WA 2O67A 3THVA 4IOAQ 2MQPA 1UKUA 5DQHA 1MMNA 1WG1A 4KRWA 1Q16B 2R8HA 1CVJA 4FF3A 2DGSA 3LALA 3MEDB 4WF9Q 3ZZZA 2YWKA 3Q24A 1SV5A 1F2GA 4AXJA 1YITS 5F8HA 1FXDA 2NPFA 1KFDA 1S4FA 2ZKTA 4TY8B 4N8OA 3ENQA 4EGLA 1WNEA 4OZ1A 4X4TA 4B9TA 2UXDF 3CMES 3I6PA 3I4HX 1VBYA 1REVB 4FF1A 2EG2A 3B8HA 3O5TB 2AJ4A 5SZTA 3VR1A 2MHNA 4GO5X 1KQFB 2DIVA 4RW7A 5HI7A 2WOMB 1IJFB 4TYAA 2FVSA 2LXIA 4RNO