3DGPA

Crystal structure of the complex between tfb5 and the c-terminal domain of tfb2
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
62
structure length
62
Chain Sequence
ELDRVITYEGSLYSDFETSQEYNLLSKYAQDIGVLLWKDDKKKKFFISKEGNSQVLDFAKRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA polymerase II transcription factor B subunit 2
publication title Structural basis for group A trichothiodystrophy
pubmed rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 18
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2008-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18307 Tfb2_C Transcription factor Tfb2 (p52) C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2610 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dgpA00
3DOMA 3DGPA
chains in the Genus database with same CATH superfamily
3QQCD 1WKLA 3C14A 4ZP6A 1RSCA 2WONB 2LECA 1LEOA 4ETXA 3EZ5A 1RZMA 1CJVB 4DR7J 2YPZA 1F3FA 1RWKB 2CQ3A 3TW0A 3VAHA 2E1AA 2M9KA 4NEYA 4PG4A 1VQMS 2IJFA 3CCLS 1F0XA 2VFUA 1HI0P 4DV1F 4YUDA 4NZ7A 2LEPA 5J2MB 3HP6A 1Z2ZA 2MLYA 4DQPA 1I51B 2ZKUA 1BQXA 4LF5J 1UZHA 3MEGA 4X64F 3DNCA 3A3OB 4FKYA 1NZ8A 3BQ1A 5ETSA 2WVFA 5C42B 3QO9A 1XERA 4RU9A 5EX0A 2WSEC 3DCAA 3N01A 3H4BA 2HWTA 2B0GA 3MTJA 2V67A 3LP0A 4PWWA 5B0AA 2MMYA 5ITHA 1OPIA 4KH1B 3OTOF 3BB5A 2CQCA 2LQBA 4CP5A 4U9RA 4DN9A 2WVBA 1FX4A 1EX8A 2YKAA 2Z2YB 4P73A 3TAMA 4CLLA 4Y2KA 2J6UA 2CWKA 3QZ7A 5DO2A 3A8IA 5DM7Q 3IR7B 1KBRA 3DMJA 4OHWA 4ECRA 2VH7A 5FIIA 4QQBA 3VV2B 2RH3A 4J9UE 4YS2A 3QGHA 2FJAB 3H25A 1QVFR 2MDAA 3Q89A 2HURA 5A8KB 5DQIA 2ZBQA 4L73A 1FRXA 1LXJA 3CXCR 2OP5A 1EARA 2KL8A 3W5ZA 4N77A 3CE8A 4DV4F 3GV8B 3D5MA 1NB2A 4GKJJ 2IAJA 1O6XA 3HFZB 3CCMS 1T02A 2E1MC 3NL0A 1SUQA 1AT1B 1DQAA 3THVA 2YVSA 2ZHBA 1S1WA 1JLQB 5E5NA 4CLUA 1SH0A 5L1LA 4TYBA 2RF2B 3PKMA 2PFFB 3CJ5A 1OJ4A 4B3SF 3R97A 2B9EA 2DO4A 2JFKA 3UVJB 1QSSA 2N7YA 1R8BA 2I9SA 1NH8A 3QZ8A 1IBCB 1YWXA 2I5JB 5CQGA 2GHWA 1F9FA 3CGIA 3E8OA 5HI7A 3TRGA 1RAGB 5E7OB 1RWMB 2G1DA 3MCMA 2XCAA 3DRXA 5BYRA 1HNIB 4ZLPA 3Q0AA 5K14B 4A46A 3I82A 3HMJG 4E98A 3MMBA 1NJIT 2H65B 3RB6A 3GLJA 4QYZK 4JI5J 1BY9A 3ZC4A 3GQCA 4J37A 1DZ5A 3FCHA 1UVJA 1XJWB 5DLGA 1ZAXA 4CTAB 3SV4A 5DETA 3KG4A 3ILJA 2VQFF 3FC9A 2KFYA 1KQFB 2XG8A 1HWIA 4HHJA 1QE1A 2NUHA 4A48A 1FJCA 4I2QA 3VQSA 3MFIA 4ZPVR 3UCUP 2EKNA 4JYAJ 3SDEB 1WTFA 4RW9A 2DGSA 2R8JA 2MQPA 4GKKF 2PFDA 2QL5B 4OV6A 3LTOA 3FFIB 3NGTA 2ZC3A 1IBLJ 1URRA 1KHVA 4EI2A 3EVWA 2AV5A 2VBWA 3C6UB 4FYVB 4ZOSA 2RKIA 2V34A 2F9DA 3DXSX 2MGZB 4O3QA 3K0JA 1DLOA 5KG3A 4UW2A 5LOQA 5J1PA 1KVJA 1RT1A 2L9NA 1VQ9S 1PYSB 3FEZA 3VCDA 3SCIE 2C2DA 5L9XA 1M5HA 1O5JA 2FHKA 2ZC4A 5F0WA 1FCAA 4OYMA 5IM0B 3BN7A 3M6XA 3R1HA 2FDNA 2MZRA 4X62J 2D7SA 4DSEA 4OMFG 4OYZA 3T9NA 2HRYA 2F40A 2B56A 5DJBA 2CQ0A 5JVGQ 2R2RA 1KEKA 1GEHA 1FDAA 3V4IB 5I4MA 5D78A 1FXLA 1RT7A 1U1MA 3FRZA 2OSRA 2RE1A 2KM8C 2FJVA 2YNFB 1NKCA 3UNGC 3QNWB 1DAXA 2BANB 4NXNF 4K59A 4V19J 4WZQA 2CPXA 3LGHA 2CQPA 3OPKA 2P9GA 4Q7AA 2LCWA 1U1QA 3BGRB 4ED7A 4CZCA 3IR5B 4DUYF 1PYOB 1FKOA 3FSIA 1LW0A 2B4VA 2LEAA 1JNZB 2RNEA 3FBEA 3HSDA 2KKHA 2LU2A 4QPTA 4QIGA 1FD2A 4AYBD 5HP1B 4E2FB 2Y9HA 1K0VA 5HLFA 3GWCA 3CCTA 1TFYA 2AT1B 4C9DA 2KVQE 3J7AN 2HBRB 2R3VA 3ISZA 1EP4A 3KK1B 2LEBA 3JYTA 4FYWB 1P9YA 3RW7A 3J80Y 1NK9A 3TZZA 5K8OA 4X4RA 1D8YA 1UPPA 2X1FA 4QWDA 3VZHA 2U1AA 1TL3B 5A76A 4NYZA 3CO9A 1SL1A 3PJ9A 4OX9J 3FEXB 2VC1A 1NK8A 1UL3A 4XTTA 4WXOA 3UWTA 2XMMA 4OIXA 3GP9A 1NO8A 1HHTP 2OH2A 4EZ6A 5LSRA 3MEDA 2NXNA 1BQMA 1Q1KA 4U8YA 1FRIA 2DHAA 3ZTRA 2HK2A 3KJFB 3M9NB 2CPEA 2G0CA 2GVDA 4ECYA 3MMCA 1VBXA 3AXKA 1R3NA 1B0PA 3NCPA 1VDHA 3MD1A 1U0HA 3KLEB 1J5OA 3JQMA 4RNMA 3EGNA 2B3TB 3UE2A 3IS9A 1SVDA 5J1EA 2OIHA 4LRCA 5MAOA 3OV7A 3R8YA 2HGMA 3V2UC 3DRSA 2FHMA 1TL5A 1RBOB 1U1NA 4L6V3 2GO9A 3ZNUA 1LWEB 2J0QD 2DY9A 1MWQA 2VPZB 3IA0A 3EGZA 5D0HA 3Q8YA 4ZA1A 4ELVA 3N9UC 3OTCA 4X84A 7FD1A 4JI6F 3E2EA 2D3ZA 2HPUA 5CA5A 2YNIA 3LGMA 2UVUA 4K7QA 1RP5A 1B3TA 3IM8A 4NYOA 1QSYA 3KNGA 2CPYA 4DEZA 2VU5A 1M90T 1JLAA 2UXDF 2ATCB 2AGOA 1DTQB 1X9WA 1DJ0A 1X4AA 3A12A 1NSAA 2CXEA 4PWUA 3PEJA 3F44A 3AAWB 1VK8A 4FPRA 3TX8A 4LSZB 4J5OA 3J7A1 3PW0A 2EC2A 2LKZA 4PEOA 1OSCA 4NASA 4N41A 1MWYA 3OR2A 1TK0A 1K44A 4QOTA 2DGQA 3KDNA 2QEXS 4ZS6A 4F4KA 2VQEJ 3MEEB 2NCKL 3QT5A 1S9EA 3Q83A 3H2UB 1QTNB 2BJDA 3P45B 1F9HA 4FNIA 3R5GA 4CCHA 4DOZA 2J0WA 3T1HF 3GIMA 4A8MP 5I42A 4WP3A 4WE1B 2DGUA 3SSQA 2YKMA 3GR0A 4QWBA 3TUZC 4LUBA 1VR6A 2AIRB 5GADU 4KC5A 1OY8A 3DKDA 2FJBB 2ZDOA 1HQEA 2ZWPA 1P1LA 2KO1A 3MM6B 4IFYB 4LF9F 1X0PA 5F8JA 3DOKA 2XLIA 1FKPA 4AD6A 3F56A 3G8QA 4I2PB 3OTOJ 3R5AA 2XZWA 2ALZA 2N82B 1X4HA 2CQ1A 4QW8A 3DU6A 1IM6A 4JI3F 1I94J 2HW3A 2V5HG 4M5HA 2AZ1A 1XNQJ 1YVFA 4DU7A 2B4OA 2HHHJ 1V9OA 3NWGA 3UD3P 5HROB 1UCNA 4IH6A 3FEYB 3FDSA 3G2XA 2AKWB 4NCGB 3GFHA 1QSLA 2OTLS 5GAGI 3WC0A 2C3UA 4IOAQ 2VG5A 2CPDA 4YN3B 3W5YA 4ILRA 4OYAA 1LW2B 1VJWA 3WX8A 3AQPA 2XBPA 3VVTA 3H4DA 4MIBA 3I4HX 3CF5Q 2MYFA 2BJ1A 2H48B 4WP9A 4RR5A 5ETVA 4JI7J 1SBRA 3HPOA 1SXLA 2FQQB 1TKTA 4L74A 4I69A 3KLHA 1ZA2B 1L3SA 3J81U 2KM8B 1YX2A 1MN7A 4UQGA 3AD8C 2DT9A 2JLEA 3M9MB 3BJYA 5KFTA 2PSZA 1JXEA 3OTBA 2B51A 3D6TB 1SH3A 5E3RA 4QIEA 1W2BR 5HBMA 4DV2J 3MR6A 4JI0J 2K1RB 2Z2ZA 5ETQA 2F7VA 4NXMF 3QRQA 3GIKA 1Q78A 3OHBA 1SI9A 1URNA 3TUPA 2PMZD 1S6UA 3GE9A 2UVWA 4M5MA 2KJWA 2IM1A 2HS3A 3HSGA 4U6PA 1PJ7A 3EXCX 1BXNA 1ZA1B 1Z2LA 5L1IA 1S4FA 4KY3A 2CRLA 2IIHA 3HVTB 1OYEA 3ILLA 3CCUS 2AJ4A 2W7AA 4M94A 2V8VA 1DBDA 1JQGA 1OMSA 2CQBA 2CG8A 4CO1A 4OJ1A 2B6AA 3MHYA 2M8DB 4F0MA 2MY7A 3GILA 3M7VA 2XSJB 3W5XA 2ADCA 4JOUA 5THWA 3K5LA 2HHPA 2BW2A 3DRPB 3SZ2A 4J90A 4L3KA 3VALA 2XULA 1Y00A 2G0JA 1V5VA 4OZJA 4UY8T 4JV2A 2FLOA 2DNQA 3SSRA 2DVIA 3W2VB 4MYTA 3Q24A 1RWNB 2QYCA 2QLBB 3QBCA 2F4VF 4I6YA 2HLUA 4UF4A 5HMYA 2DIVA 4H4OA 4KFBB 1Y3KA 5LL6d 4C97A 2OAUA 2NUUG 3J7ZT 3G6XA 2UV8A 4QPXA 3HHLB 4X4TA 2A18A 1T9WA 4C6AA 5L46A 2DHGA 4A8OA 3G86A 1EIYB 2J7KA 4H4KA 2IVFB 1U26A 1XIQA 2POKA 2KRBA 1UJ5A 4ZCMA 1WI8A 4S0MA 4WIQA 2WRMA 5F8IA 1RT3B 5U47A 2Q43A 2AX0A 1VHIA 4MYUA 1YZ7A 3SV3A 3T5HA 1RHMB 1RTHB 1AXQA 2VFTA 1LWFA 3T1YF 3HLUA 4HT5A 1F5AA 1S1TA 1HNWF 1S76D 1KQSR 1CJVA 2ZH9A 4ZP8A 2VPYB 3GYXB 3TANA 1HNXJ 4G6VB 3BZQA 2FVCA 5KT3A 4USJC 1PAUB 3VAFA 1T9TA 1JMTA 4DN0A 4IO1A 1WDTA 3CD5A 4F3OA 5AXKA 3JQJA 5KG2A 3QSYB 4LSLA 4NLSA 1FDDA 2UUBJ 3FBCA 4PQUA 5G0RA 2PA8D 3VAKA 5DDRC 3N0VA 1Z1ZA 1RKJA 1TAQA 3OSNA 1H7WA 1KWMA 5KFJA 3UR3C 4ANCA 4C3KA 4O0IA 4IDKB 3N5FA 2V63A 1S77D 3M2VA 5J2QB 3IG1B 1NSQA 1HBMA 3HO1A 2J9CA 4Z7YA 3NBPA 4AL7A 1FEEA 3DLKB 2EG1A 2GIQA 4A8KA 3C46A 4ECZA 4WXWA 5K5MA 1Y5LB 3U1NA 4ZPDA 3H98A 2G9OA 2BW7A 1S9GB 1WEXA 2YNHB 3FK4A 1NDPA 2IM0A 4OZ2A 3DOLB 3I0RB 1HMVA 3J7YI 2H5EA 1F5CA 1K9MT 4I7FB 3H59A 4LF8J 4NPOA 1IWAA 4DR1F 1RLCL 2DEIA 2X1GA 5DRKA 3IXQA 2U2FA 1CJUA 2RQ4A 3RUBL 4N56A 4HDGA 5RUBA 3AJ2A 4WYWA 1WG1A 2VDIA 3RAXA 4Z37A 1WELA 1JLGB 2R2TA 1U1OA 4NI2A 1CC7A 3GSIA 4WPAA 3M1VA 2HRTA 2HS0A 2XZTB 4K4SA 3B78A 2HMIB 3BBFA 3ENVA 2FVSA 4DPYA 2VB6A 1TELA 4P52A 1S48A 2X7IA 3HHKA 3LOUA 1R0AB 2NREA 4KJIA 2E9ZA 4O4RA 4YB1P 3ITHA 5JJBA 1QJHA 2HFZA 2OFHX 2Z4PA 1HKAA 3N6LA 4OJ3A 1PYTA 4LSNA 4ENOA 1RWWB 1OIAA 2BKPA 4PRFA 4M95A 3QLHB 2V9KA 2RDJA 2UU9F 1GFWB 2F63A 2HNDB 4WTOB 2XHCA 1ZM9A 3ZZRA 5C7PA 4RW7B 1HR0F 2C1EB 2FHJA 4JI2F 2EI5A 2Z56B 4MKBA 4DPOA 5J2NA 1H6KX 2K7KA 4RUHA 3I87A 1VYAA 4OHVA 4DSKA 1H38A 1N36J 2EKYA 3MM8A 3RBEA 3LP1B 1N8RT 3R5CA 1S59A 1NNDA 3MI7X 3G82A 5LT5A 1PILA 4CLTA 4MFBA 2CQDA 2R8GA 3IAS9 2JH3A 4Q8FA 2XCPA 1VLYA 4C8KA 2CYYA 1F1BB 1VQSA 1IKVB 1OSDA 3CJ4A 2E5HA 1GMUA 1SJFA 3JSRA 4ZVUB 4O3RA 3ULHA 1X4DA 1RTIB 2DNKA 2VV5A 4X2BA 1QAXA 1NXIA 5D77A 2F8HA 4DG1B 4AL6A 1Q79A 3CWJA 3P5TL 1UEKA 2OGUA 1LV5A 1HW9A 4USWA 1XBWA 3AB4B 1O0PA 4ZPBA 4ES3A 4B3OA 1DQ9A 2I0XA 1UVMA 5F8MA 3BGUA 4EZ9A 1T9VA 1JNRB 3T9ZA 4XPEA 4CYUB 3V6HA 1SKWA 3TA1A 2MKIA 2VOPA 1B70B 4DR3F 4K5SA 5L8RC 3BR8A 1QM9A 3G6VA 1DARA 2UUWA 5HJXA 1N4LA 2J6SA 1ICEB 1JXLA 3ZZTA 1IQTA 2EFOA 1RAAB 4PR6A 3SFUA 1E6YB 4C3MA 3BPDA 2ZH7A 2UXBF 4HACB 3GU0A 4B9UA 4K0KJ 4I4BA 2JVOA 1RACB 3GIRA 2QRRA 4M5KA 3JAMY 4YHHF 1VQPS 2DYAA 2E1PA 3MAAB 1NLKL 2XSFA 1P6TA 2BE2B 3CB4A 2ZH3A 2GHVC 3JXOA 4CM2A 2VG7B 4RPFA 2D69A 1HBNB 4NLGA 3OVSA 1YITS 1H2VZ 4P7VA 2HNYB 3KG1A 1UA1A 1NKEA 3UD4P 3HD2A 4ZN1A 4B02A 3EVMA 2YX1A 4CLWA 2Y8WA 3NRBA 4FN5A 2VZ9A 4DR4J 3D54A 4I56A 2UP1A 3PACA 4LR7A 3KK2B 1RT5B 5AE1A 3HK2A 1S0MA 4NWBA 1REVB 4OJHA 4GMKA 7FDRA 4BWJA 4DV3F 2KVIA 2E1CA 4IQXA 1KLNA 4UT4A 2HNZB 2YWHA 5F9NA 2LP4A 4ZVTB 3TQ1A 2VJUA 1UWBB 2ZZMA 1L5UA 3K5NA 3GYGA 4O3OA 4B9NA 4L75A 2QSFA 4NCAA 3CD0A 4EU0A 4RJVA 4I1TA 2C22A 4DSJA 4OX7A 3KLGA 3D6HB 2BJ3A 3W9IA 2KT2A 1GTEA 3MXHP 5E3AA 4ZDNA 1TL1B 2HHQA 1TUGB 3T1AA 1B7YB 5DG8A 2DPIA 4X65F 4RW6B 3MD3A 2NPFA 4C8NA 2RRBA 3PO4A 1R8PA 3UR0A 1NPPA 4NL5A 1YHQS 1V3SA 2IDEA 2WTFA 3K5MA 5AJ3J 4HR2A 1LQ9A 1WHYA 1ZM2A 1JLEA 2OUGA 2LVWA 2GNKA 3CO0P 3DYAA 3HSZA 1CLFA 5DQHA 1T11A 1IJEB 2GVZA 3PHEA 3M32A 3NCQA 3IGVA 4F7VA 4ZHRA 1LWEA 4FS2A 1BMQB 1T03A 5KG6A 3MUTP 3IFEA 2JOQA 1NH7A 2KG0A 4WK3A 4F02A 5FDLA 4B3TJ 3BSNA 4CM0A 2Z0GA 2Z30B 4KHPJ 3H5SA 3TQEA 4A8FA 2BOPA 3Q86A 1HD1A 1S1UA 4HTJA 2F5GA 4WFXA 3D28A 3G4SS 1M0SA 5IC4B 2IA6A 3NNAA 4QYRA 4F4AA 1NKBA 2ZE2A 2F9JA 4ETZA 3QIPA 2UZAA 1NAQA 3TOQA 4TQRA 4D3HA 1HFEL 1LK7A 1LXNA 4JI1J 3MEGB 4LFBF 1T94A 5LMUJ 4DUZF 1XNRJ 4OYWA 5KTQA 4HHUA 3CDAA 4PUOA 1VQNS 3KMQA 5L9NA 2MQMA 2XMAA 3TVZA 3BDEA 3QO9B 4ALZA 1QY7A 5HMZA 4YR0A 3MEEA 1VOMA 3NWRA 5E3PA 1F2HA 2XYGB 3LP0B 1U47A 2QSWA 5LM7E 2MJUA 7AT1B 2KFZA 2QA2A 4ZP9A 1DQ8A 3FSXA 5HO4A 3RRKA 2PA3A 4UZBA 5K9FA 1IVZA 1NJYA 4LRDA 3PYDA 1RHQB 2G0IA 1WSRA 3PIOQ 3TAMB 1KOHA 2R7WA 2EVZA 3ZNJ1 6FD1A 4OZNA 4ECSA 1S9FA 1DRZA 2CZ9A 4FXVA 1IKYA 2O01C 5EGYA 3CMAS 5H9FK 3RBZA 5ETOA 3MOZA 2DJWA 3DMJB 4J9MA 2CIMA 4OI6A 1VIOA 5KAKA 4Q43A 4OZ3A 3CPWR 4A8XA 3IRXA 3MAHA 4K50A 2IBOA 4QWAA 2FLPA 2R7UA 1GXUA 1TV6A 1RT6A 5KFOA 4NLXA 2CPHA 2VFSA 4TXSA 2AGQA 1JJ2R 2DNZA 4NCGA 3LAMA 2FZCB 3HD1A 1OQ3A 3GYNA 5EWEA 2E29A 1XEZA 1SUQB 5CABA 3DU5A 3FGVA 2MZTA 1S1WB 4DR6J 1X4GA 3F73A 2WAQD 2CVEA 2KT5A 3AA8A 3HZEA 4FF2A 3TZXA 2I38A 5DG7A 3I5CA 4USVA 3PYFA 5A0YA 1FXDA 1PSDA 2Y1LB 3CCZA 3B8HA 1NRKA 1Q86T 2MQNA 2E5LF 4RWWA 5HAOA 1K73T 3H2VE 2M2BA 4G1QA 4ER8A 2K1RA 2WSFC 4C8LA 2XO7A 2GQQA 3MMBB 1PC4A 4O0NA 1CEZA 1AZSA 2HK3A 2LXUA 2YBVA 4DL0C 4OFZA 3TZWA 1YDLA 2JLFA 2FC8A 3QJLA 1R6VA 2DH8A 3EPGA 3DLGA 2RDDA 2J9EA 4MH8A 1MG7A 1XMOJ 3LP2A 2RJZA 5LSLA 4QYZJ 3FMBA 4G3IA 1VIXA 4Y65A 3M2UA 3TP2A 1KC8T 3THTA 4LFCF 1N48A 1GMWA 3CCJS 4DFPA 1QE1B 2YH1A 4I2QB 4C48A 4K4XA 3ILOA 1WC0A 4DZ6A 4YR2A 6FDRA 2RUSA 3M8QA 3IRWP 2ABYA 1FNXH 1GX6A 4RW9B 4KV8A 1LFWA 3R5DA 1IQZA 1RB0A 1WSVA 2CZVC 4MJKA 4YY3F 4LF6J 2ZJPQ 2LMIA 1FDNA 1S1VA 3I31A 1RA6A 4TQSA 1PGZA 3MCNA 4GVLA 2RKIB 4F36A 5BXIA 4DL6A 3SQOP 3NAIA 1DLOB 4MIAA 1QLNA 3D3BJ 2OELA 4M5GA 2Y8YA 2ZVSA 1RT1B 2PMWA 3KUEA 2BJ7A 5HVGA 3CJ2A 3MDFA 2OKQA 4IR9A 4F2SA 2FJXA 3T5LA 5LMNF 3NMAA 1KS2A 4WZMA 1QAIA 5DLFA 3MPYA 4DR7F 3PJWA 1WF1A 1RT7B 1FHTA 3W64A 4F67A 3HHEA 4DQIA 2Y0SD 5LJ5Y 4LIRA 2DB1A 2E7XA 1X8DA 3HHDA 1NCLA 5EDWA 1EB0A 4USMA 3I6PA 1N0VC 5C5JA 1Q8LA 4DV6F 4NE9C 3BREA 1GQEA 3R7BB 4NLYA 3D6MB 1FKOB 1LW0B 3GZ7A 3CMES 2V2ZA 3CIMA 1R8CA 4YP3A 4OZ5A 3HM9A 5DDOC 3KJVA 4LF5F 4O3PA 3IAM9 1YK9A 1RHJB 3E51A 5LSOA 1B7FA 4F26A 5HLFB 5ADZA 3SCJE 2B9YA 2A10A 1Z4UA 1IBMJ 4KSEB 3KYLA 1EP4B 3W66A 3MCOA 4WYLA 3JYTB 5E33A 3IMQJ 3G8TA 4HH1A 4FKXA 1NHVA 3KTQA 3KJQB 1SV5A 2DBBA 1RHUB 3ZFVA 4ZIVA 4DLEA 1VHFA 3AD7C 5BR8J 4FS1A 4WFZA 3I0SA 3K58A 3K59A 3SBMA 1TUWA 3L7PA 5F3ZA 3MEDB 3VGVA 2BUNA 1BQMB 3QAEA 3DLKA 1YTYA 2CNNB 1IJFB 2CQ2A 3MMCB 2VOOA 1WF2A 2VA3A 3TJ8A 1F5BA 4K4VA 4OX8A 2UXCJ 1U0HB 4M5JA 1J5OB 5B7WA 3J80U 4DSIA 3IS9B 1H7XA 4ZLJA 1HBOA 2MSSA 5J1EB 2YWEA 3BM7A 1QTMA 2VIHA 2H5IB 4HYKA 3W60A 3CVKA 4ZPCA 3TA2A 3DRSB 4GKJF 3E01A 4ED0A 2UUAJ 4KGVB 1CVJA 3HKWA 5B0GA 1RWVB 4X65J 3VAMA 1KVKA 2B5JA 4OI4A 4CLSA 3H5YA 2HBYB 2A6MA 2MSTA 1JLGA 2YNIB 1NJWA 2HHXA 2DCUB 3AXMA 3MEKA 2ROPA 2MZ1A 2KXNB 2VBXA 4DI6A 3GIJA 2DHSA 1Q8KA 5D4NA 4XPCA 3BQ2A 2GZOA 4G1IA 3PCOB 1JLAB 1KTQA 1RK8A 3WQPA 3OJSA 4EWTA 1CQMA 3ISND 4O4GB 4MAKA 1ITPA 3GJQB 2EG2A 2NYIA 2L9WA 3CULA 1Q0NA 4KGMA 3CC2S 4ZLNA 4NMXA 3BBBA 3BKTA 3EZUA 2A3JA 3Q8VA 3SSSA 4U7UD 2APOA 3OR2B 3NY0A 3O3LA 2YPYA 2C2MB 2VJVA 3MMAA 5KFZA 1S9EB 5ETLA 1U24A 3G8SA 4Q44A 1VMBA 3R27A 3OL7A 2PE8A 1S0NA 4BS2A 1MN9A 1BHNA 4AXIA 4DR5J 2HNDA 2XZDB 5I42B 2GJFA 2RMLA 4IG3A 3TI0A 3SQGA 4PWDA 3ISNC 1RCOB 2YKMB 1TQLA 4JV5J 3CNQP 3B4MA 2C2EA 1IR2A 2MJNA 1UMJA 1HQEB 3SMZA 1T05A 4C7QA 1RAEB 5CCLA 3OL8A 3BKFA 3NNCA 2H51B 3DOKB 2MEWA 1FKPB 4AUKA 4PXBA 2RD5C 2BOAA 4K4YA 1NBEB 3GFZA 2VHGA 1OWXA 1ZZFA 2IYGA 2CPZA 2DO0A 1WC6A 4JYAF 4JP8A 1O8BA 2AYMA 2BACA 2IC3A 5KFDA 4NA1A 4HI1A 1ZTWA 2ZWOA 4QR0A 4IFVA 1B64A 1IBLF 3D0GE 2EFGA 4M1KA 2DGWA 4OV1A 1RAIB 2HHUA 2YY3A 3Q8SB 2B43A 4DG1A 1VQYA 2VG5B 2OPQA 3OFGA 1EQMA 2EFQA 2RQCA 4ID5A 1X5TA 3DFEA 1QAYA 2OPRA 4U96A 1TK5A 2DGXA 4X62F 1XMBA 2JHEA 1YGYA 3AB2B 1U2CA 1TKTB 2BM1A 2ZHOA 2M8HA 2PC6A 5E2QA 1C4AA 1FVQA 3K8WA 2V4JA 2IBKA 3C15A 3WIVA 3ELHA 1HWLA 3IWNC 1G2EA 3DOMA 2MKSA 2VC0A 2GJIA 3UDCA 1SJ1A 4JI4J 1G3OA 4ITSA 3GSDA 4IUFA 2XY7A 1S6QA 5HBMB 4MKYA 1F3VA 1S0VA 1E6YA 4JV1A 3ONQA 3C2PA 3Q23A 3GG1A 1F2GA 3PRBA 1XMQJ 4ZJLA 1Y3JA 1PBAA 3KHRA 1KQGB 3TVKA 3AY0A 4FF4A 4DL2A 2E5LJ 1U6BA 4WFBQ 5KFPA 1UVNA 4N47A 2KI2A 2BE2A 1X4CA 3M05A 4DL4A 3QJJA 5ETTA 2J0XA 1WOPA 3H2LA 2O1PA 4ZVPB 2DNRA 3W7BA 3UD5A 2ASDA 4DU8A 3PM9A 4JI8J 3CJTA 3KLFA 1VQ8S 1YJVA 1PJ6A 3B54A 4CLPA 1YI2S 4OX9F 2Q66A 3N5BA 3UNYA 1Q95G 2B6AB 3B4DA 4Q2LA 3C16B 4AT1B 2VG6A 4PXDA 1KOOA 2ZDPA 4ZJOA 2Y1IA 2KU7A 1HNZJ 1G1XA 3DRRA 1WF0A 1YJRA 2MLZA 2YTCA 4LFCJ 2BBEA 3AJDA 3K8VA 4WU3A 2WHOA 1SC4B 3N28A 4DX8H 3OQ2A 2J76E 3G6ES 2KJVA 2V94A 2HBQB 4H4OB 1Y7PA 3PX0A 4NLPA 3A1YG 2BABA 1KVIA 1TR0A 4A8QA 4J9QA 2FGOA 4PCQA 4ZPTR 2EXUA 2AW0A 3NS7B 2HZVA 1FFWB 3GFYA 1WKKA 4ZMMA 2NXCA 1WJ9A 2H54B 4FVCA 1Q7LB 3RYLA 3F0NA 3K2YA 1TVRA 1J5EJ 4OHXA 1BWVA 2YX4A 1MU2A 5M2PA 2ZH1A 1VRUA 1R31A 4L72B 1B4SA 1LWFB 1X4EA 2DNPA 3MM7A 1Q82T 4ILLA 2C2ZB 1S1TB 3NP5A 2ZH2A 4K2XA 4ICLA 1RGVA 1UWAA 1LWCA 5KFMA 2QMUB 4CNYA 1L3VA 5CYMA 1TTHB 5KFFA 1TL4A 4KKOA 2YKNA 2DISA 3QT6A 2GGPA 1U45A 4RBTA 3MECA 1S5ZA 4DBQA 3P4UB 2DNNA 2RAQA 4LSLB 4DV6J 2VQEF 4ZPWR 2VL1A 4PQUB 5G0RB 4Y2CA 1P9QC 5A8WA 3EJMA 1NB7A 3ZZ0A 3A3NB 1Y9OA 5L39A 4CDIA 5D8HB 1WG5A 4RU2A 2R7VA 1FA0A 2X1BA 2BE7D 5CYJA 5KFAA 2XS5A 2IPOB 5DGBA 4HHHA 2G13A 4BWMA 3MWBA 1MW7A 5KFEA 3M2VB 2LQ5A 2XY6A 1ZAVA 2V68A 2F4FA 4DV0J 3FBFA 1FWKA 1EAYC 1HBMB 2UUCJ 2DRAA 1OY6A 4UQTA 3NBPB 4UY85 3EVOA 5IV3A 2OPPA 4AL5A 1RTZA 3RR7A 2UV8G 2JJ4D 5SZTA 2ZOFA 1WI6A 5KOWA 1HWJA 1Y4ZB 1I94F 1NPRA 1XNQF 4LF4J 2X3GA 4JB8B 3J7Z5 2HHHF 4Q0BA 4FYXB 2AMCB 3D67A 1CJKB 4CO2A 1HMVB 3T19A 1PAEX 3EICA 4LF2A 1D1UA 3HT0A 3PRVA 4ZPAA 2J9DA 1FD8A 2HG4A 1CJUB 2GW8A 5HVHA 4UUWA 4HI2A 5T41A 2EFNA 4O44A 2QA4G 2E1RA 4JI7F 4NI2B 3M1VB 2NPIA 1RT4A 4R0EA 1FXRA 2CUYA 1U6ZA 4XDCA 2CKWA 3GB0A 2FB0A 2R7QA 3CDUA 3KG0A 3W2WA 2N4CA 1HWUA 2HIYA 4ZIWA 5C2CA 2X1AA 5GAHU 1TKZA 2H3EB 3JSBA 4IRDA 5HQLA 3MM5A 2DNGA 3MPVA 2L48A 1JB0C 4J9RA 2E9TA 3ITHB 4BC7A 4OI0A 2AJFE 4DV2F 4JI0F 2MQQA 2J6TA 4LSNB 1YJ9S 2VPWB 4FXDA 4DX6A 4USKA 4CLZA 1SC3B 3ZXWA 4C98A 3GFXA 3CJRA 2CNKB 4NRTA 2KB2A 5KFLA 4NX9A 1UKUA 2ILYA 5GADI 2ZOGA 5EWGA 1WEZA 3ENQA 3QFWA 1C1BA 2YQ1A 3D1QA 5J2NB 3O2IA 1FT8A 2EPIA 4YR3A 3JQKA 1W2IA 1VBYA 1YRXA 3FZ2A 4DXLA 2YWFA 3FNNA 4ID8A 3MM8B 5KFRA 1FF2A 2DNHA 2MZQA 3G71S 1K1QA 1TU0B 1H72C 3G82B 2AJ0A 5B09A 2W9BA 4MFBB 4QCLA 1U8SA 3WDOA 3L95X 5D3GA 3PX6A 1VQLS 4EEYA 4P9SA 3L7UA 2V0NA 4DPWA 3US5A 1C2PA 2BEFA 1XN9A 3MUMP 2KYZA 2BQRA 3HFVA 4FPIA 1VGYA 2N3LA 2HQ3A 2Z57B 4YB6A 3LPYA 1WC1A 1M5PC 4LJMA 1D3WA 2HQFA 3MOJB 2VUGA 2DNMA 4RNFA 1N5YA 2KRRA 3UFCX 3LA0A 2PT0A 3G87A 4ECVA 4IRKA 3O8WA 2UVRA 4YMEA 5T14A 4GO5X 4B3OB 4ZVHA 2Y3YA 5ETRA 1YQHA 3C6TA 1R0BG 4YDXA 1KONA 3HF5A 4LR9A 2HFVA 2CQ4A 1K0TA 2E5IA 2FTRA 3NGRA 1RCXB 3BDPA 3C19A 1N32J 2AX1A 2SXLA 4P2XA 2RS8A 3TEGA 3KUGA 3U27A 3QIDA 3PYEA 1QUVA 3T41A 2R7XA 1GAOA 3RU0A 2GHPA 2NQPA 2HSEB 4QW9A 3PJXA 1V5IB 1HNXF 1RKIA 2ZM6J 3ZO7A 2R7SA 3ZZUA 3NMRA 2AP6A 3EX7B 5C2GA 4R0JA 1D9FA 2RIJA 1SJ4P 1U09A 2ZBPA 4OJGA 4DR2J 2LFVA 3K17A 2UUBF 3U1MA 3RBXA 3RW6A 3CCQS 1H0HB 3V6JA 4TY9A 3SCLE 1U2FA 2CNLB 4HL9A 1VK3A 2I6WA 1U4BA 3OUYB 1Q8BA 1SL0A 1T95A 3GONA 5LXRA 5KG4A 2ZD1A 3JB9k 2KYXA 2AEFA 3ZZZA 5IWAJ 1S49A 3MTKA 2LLZA 4J7CA 5IT9U 2ERRA 3JAMU 2ZBIA 3NCRA 1YRTA 2JEIA 2AQ4A 4FNHA 2ZZNA 2K3KA 5DGAA 4L3NA 1RXOB 4YEAA 4Y2MA 2AF6A 4C8MA 4DQRA 3WIUA 2CQIA 2CPFA 2MB0B 2R2SA 3HJFA 1FESA 4HKQA 3KLGB 3WHIA 4R5PA 3HHLD 2YWWA 4ELTA 4GVBA 3CDWA 2R2UA 3TUJC 1JJCB 3WC2A 3HXMA 5KFBA 3BYPA 1KLMA 2FGCA 3I96A 5DDPC 2PI4A 3S01A 1EJ7L 2QL7B 3OTEA 4AFFA 4LF8F 1LKZA 2W1BA 4RNHA 1SB6A 3ICLA 1RDRA 2CPIA 2A2CA 4V1Ak 1TL7A 2RQMA 2LQ8A 3ZTPA 3HVRA 4CH7A 1JLEB 4ES1A 2HZAA 4ECQA 2XMTA 2BMBA 3DYAB 3W9HA 4X66J 3W1YC 1ZBTA 3HHLC 2GVZB 3M32B 4DCJB 3C3LA 4WK1A 4ZHRB 2LYVA 1T03B 1JK9B 3QAUA 3VAJA 2H1YA 1FFSB 3NG8A 3DM2A 2D3O1 2XM3A 3SYZA 4BDPA 2YXLA 4M63A 5IZHA 1R89A 5FDLB 4RNNA 5KT6A 3OR1A 4OL8A 1S1UB 2M4MA 2HFOA 2LDIA 5GAEU 5K20B 3S1TA 1OPZA 2M7SA 2ZE2B 3QIPB 3R2DJ 5K8PA 3OFEA 4OHZA 4O4GA 2AGPA 2Z2MA 1HYSA 4ELUA 3OXLA 3KLIB 4EO8A 1C0TA 1UTAA 2QTWA 5ETNA 1LNQA 4PUOB 1WC5A 5IOLA 4IQMA 3N79A 3W63A 3DI6A 4P71A 2QN6B 2OPSB 3EM1A 1S99A 2BVZA 4QJVA 1RE1B 3M9OB 1N36F 4PYAA 2GMHA 2HVEA 2ROEA 3KNAA 3TYTA 4Y00A 4RW4A 3AJ1A 2GJ2A 1JLCA 2UVVA 4EBCA 2XMJA 2OJ3A 5HANA 2ATLA 4I0WA 3HFKA 1HBUA 2IM2A 3HT3A 1IKYB 1N34J 2VPXB 4DV5J 5D4LA 4NLQA 4K4UA 4TLQA 2OSQA 1R7IA 2XQCA 3NS5A 5L1JA 4C0HA 2A2DA 2AYGA 3PY8A 3RR8A 1RYRA 3IRXB 5GMKa 2DY1A 2ZVIA 3EPIA 2MLXA 5H9FJ 1TV6B 1RT6B 5D0GA 1RISA 3R5BA 3EUNA 3UO0A 2XHWA 1NDCA 4TU8A 3CJQA 4KBIA 2D3UA 2FY8A 4IOBA 3BO3A 4RUCA 2AYBA 1UFKA 2ACMA 4CIOA 2C28A 5EN1A 5KFIA 3TX0A 3ENWA 1AW0A 1A9NB 2EFPA 1W25A 2J8AA 1Y5NB 4Y28C 3N6NA 1RYSA 1FJGF 2ZEJA 1T9XA 2ZH8A 5DDQC 5F8NA 2VKRA 4I6AA 1K8AT 2ZH5A 5HMXA 5A0YB 3QWUA 2YKQA 2C2RA 3IWXA 2MHNA 4K0KF 4NYPA 4M8LA 3M4XA 2HGNA 5HQMA 1M5SA 1X5PA 2V8HA 3V6KA 2GA7A 2IY5B 2QL9B 1GH8A 4YDDB 3TR5A 4DQSA 4G1QB 2KHCA 1B99A 3UN3A 1S1XA 3CT9A 2GFFA 1IBKJ 5CXTA 3NXZA 3T5KA 2G1HA 2HWHA 1AZSB 4I64A 1Y0HA 2V4RA 1T3NA 1U2RA 3MR7A 4D3GA 4OLOA 4DR4F 3KOAA 1X31C 4NLUA 5B0EA 2C3PA 3DLGB 1S72S 3R6LB 2Z8QA 1MROA 5DQGA 2EC0A 3QT7A 4LF7J 3LP2B 4QIFA 2XWXA 3LQVA 2RDIA 3M2UB 1JIHA 4KPCA 2HHWA 1Q5VA 1H3DA 2YQ3A 3A8JA 4X4SA 3CTRA 1K1SA 3DGVA 1D8ZA 3P3DA 2W4CA 2YQ0A 4P74A 3C16A 1WWHA 3M8QB 1WEYA 4KV8B 4NLDA 4DMZA 5B08A 5F3TA 1S1VB 4IKAA 5HMWA 2WSCC 2XNQA 4NEZA 1JLBA 2CQGA 2BKOA 3K89A 2C2OB 3KHHA 2DHXA 1MNEA 8AT1B 2FIUA 1P8GA 2C3OA 3HI9A 1GT8A 4C3LA 3PO5A 5AJ3F 1FVSA 3BKUA 5I3PA 2I1RA 2W25A 1N54B 3BQ0A 4DX5A 4CH1A 4B9VA 3ETOA 3I32A 3ZZOA 5AXMA 3MMJA 4CT8A 1XQIA 1JKHA 4Z2XA 4ED3A 1YJUA 3LAKA 2ZOMA 4DHVA 4XAKA 5G4DA 1DTTA 1WG4A 2CPJA 2ZITA 4B3TF 4M5NA 1TKXB 1WC4A 2VODA 2M0GB 2AWZA 4KIAA 2ZUAA 3FBBA 1PKUA 1U1LA 4KHPF 1TMJA 3DDIA 5FLXU 4WU2A 1NDKA 2BRKA 2HS4A 2N3OA 5HN0A 4RBUA 2E5GA 4Q45A 4ZVRB 3ENAA 3U1LA 1M1GA 3EE3A 2JVRA 3MZIA 3VGTA 3KJVB 4JI1F 2GAHC 5A6PA 4IH7A 1LWXA 3P6YC 1UJ4A 5LMUF 2R8IA 1FRKA 1XNRF 4R8UA 4OLPA 2IVYA 2V8DA 1HI8A 1IWGA 4J9SA 2YNGA 1KSPA 1R0CB 2KG1A 1SC6A 3IGNA 1TFWA 3TJAA 5ETMA 2DKOB 3EGVA 4DZDA 2DNOA 3IM9A 2OHDA 5D6GA 3BYRA 1XK8A 1SCJB 1SV5B 4CI0B 3NGUA 3PTWA 3BO2A 2JC0A 5A2QY 1E6VA 3VTIA 4U95A 5I3UA 1KFSA 4W98A 4OHYA 3FRYA 3TVYA 4ECWA 5J2PA 2N7CA 5H9EJ 3I0SB 1JLFA 3MPWA 4WF9Q 3CEDA 3SI8A 5T7LA 4Y2IA 1UW4A 4J9VA 4K2JA 1SKUB 1ZETA 3K5PA 1SQGA 1HARA 4JUZA 2O66A 4B3RJ 3DLBA 1ZPVA 4MKVA 3SCKE 3HULA 2GCFA 1APSA 4EBEA 4DSFA 2HHSA 3RB4A 3HCXA 1HBOB 4O23A 1VBKA 1CJKA 4B9LA 3PYGA 2CJXB 2LA4A 2V2KA 1MMDA 4ZVQB 1R6YA 2XS2A 3E01B 1GK8A 2VKZG 3I55S 3GMGA 5KFCA 3LUYA 2R8HA 3RG6A 5KOXA 4C11A 5HK4A 3MPDA 2B5JB 3UCZP 3TAQA 2J5AA 2HFSA 3FCVA 5KT7A 4DR6F 4PAAA 2W2PP 4GRSA 1CULA 3VVUA 2WBRA 1FEHA 4N5SA 4N7TA 2HVIA 3CD7A 1WOSA 2H9ZA 1HLWA 2IJRA 2P8IA 3U7JA 3RJMB 1HW8A 5K8NA 4KQZA 1FO1A 1EHWA 2IA0A 2IFXA 4M5DA 1RHRB 1UP1A 1S4EA 2CADA 4FP9A 2XEXA 3D7SB 1X4BA 1RAHB 1S97A 1YIJS 4L76A 2QYGA 4QBUA 3QATA 4F0HA 1R8HA 3Q8QB 1M1HA 3C66A 1HD0A 1OQ6A 4FBTA 1RAJA 2BZ2A 4ED5A 1IXKA 3MMAB 2DPJA 4ED1A 4GC6A 3FJ2A 4HLBA 3W9JA 2AU0A 3CJKA 3BSAA 4AQYJ 4KHMA 4IG3B 2BKNA 3SQGB 5HATA 4PWDB 3D0HE 3MF5A 2BJEA 4OYIA 4QIVA 4OZLA 3UDLA 2V4QA 3DDNA 3H42A 1XMOF 4ECUA 1VI7A 1T05B 2BX6A 1UVKA 4MT1A 2V8GA 3AFGA 3GJRB 1Q16B 2QT7A 3SIPB 2W2MP 3L09A 2B4UA 1ZS6A 1N33J 1FNMA 2JRSA 1BC6A 1RWXB 1EETA 3MR2A 2H4WB 2IC3B 3S7RA 1CSJA 4WFNQ 4LF6F 1RT2A 4FXWA 5JVHQ 4IFVB 2HLTA 3KK3A 4LFAJ 2NYHA 2WVEA 2V50A 4DCPB 3I4PA 1IKXA 4ILMA 2QG9B 4DV7J 1KHWA 3M8RA 5F9LA 2DK2A 2OPQB 4F3QA 4ID5B 1ULRA 1WOOA 1M1KT 1FFGB 2DGTA 2OPRB 1ZZNA 3QRRA 3MCSA 2RHSB 2YWGA 1HNVA 1H73A 1RUSA 1H98A 3JSMA 4H4MA 3NAHA 2FPHX 2ZNZA 2WOMA 3V6DA 3G96A 4HDHA 4DLGA 2V4JB 3C15B 1FTCA 2OFGX 3UDEA 2PN6A 4ANDA 3DLLQ 3PRDA 3DOMB 4RUAA 2J0SD 1DURA 2Y0BB 3VGSA 4GO7X 1TP7A 4IYQA 1CG2A 4RW8A 3AQOA 3RRGA 1WTBA 5A8RB 1FJGJ 1S6QB 2W8KA 5CZXA 3B6BA 5KFGA 1X5SA 4CLKA 5CCMA 1FX2A 2BV3A 5ETKA 2CDRB 3PZPA 3KUHA 2AEJA 1RTDA 5IT9Y 4DCOB 1U49A 4M5IA 2EBEA 5JMNA 1YBTA 2K06A 2X3DA 2FVQA 4DUTA 4HTIA 2HVZA 3AH6A 3R5JB 1IBMF 4ZCKA 3KXDA 2GV1A 4ZVSB 3Q22A 4NCBA 4B17A 3R7NB 3TA0A 3G9CA 2HKEA 3I9ZA 1W7WA 2IYIA 4USUA 2B8QA 3PVXA 4EFAC 3KLFB 2DGOA 3P96A 1VQOS 1C1CA 1JWWA 3HVAA 3I56S 1D09B 3ET6B 1NK4A 2FUG9 3X1LB 3AOCA 3PFEA 3OUYA 1M5OC 5BR8F 3SXLA 2VG6B 2XI3A 3BGLA 4X4QA 2ASJA 3CMQA 4KH0B 3CJSA 2WCXA 1NSPA 3GIIA 4QU7A 3V81B 3U02A 4FF3A 2PEBA 3C8YA 3PIPQ 3DRRB 2MQ8A 4B9TA 1UEVA 2I8EA 3KJNB 1GMVA 5KFVA 4PG5A 3OFHA 1NDLA 3QPIA 2UXCF 3BF4A 4USIA 2F3JA 3OL6A 4ECXA 5CH7B 1HHQA 1HQUA 4HVZA 2CFXA 2RS2A 1Y10A 1NUEA 4TN2A 4DWIA 2GQ2A 2WZ1A 3TJ9A 3DDKA 3KFWX 4R25A 1P27B 4UOHA 2RILA 3JTPA 3AD9C 3MM9A 3E3XA 2MZSA 1Q4RA 3D66A 2UUAF 4ES2A 1S7HA 4PG7A 2DXDA 4PYDA 4X4VA 1KN6A 2W8LA 3P49B 1KRPA 2HVHA 4LRAA 3GCXP 3D6FB 3JS9A 2O67A 4OYXA 1PC5A 1S6PA 2XWYA 4Y6IA 1TVRB 4F4YA 4C8ZA 1X7VA 1MU2B 4WKYA 1HI1A 2QX0A 1VRUB 3MM7B 1OO0B 4IRCA 3UPFA 2DHHA 4C8OA 1RTJA 1F60B 3Q2SC 2NS1B 2QLXA 3TARA 3RGIA 2DR8A 1O51A 4TU7A 4ICLB 2KN4A 1LWCB 4I6WA 1VS3A 1AFJA 1RWPB 5CYMB 1IKWA 4BHQA 4KKOB 1G7CB 5IQQA 4K5RA 2YKNB 1M5KC 2QZ8A 2GGPB 3MECB 1SH2A 1TZ0A 3D9BA 2IMOA 2QLFB 4ZVEA 1SC1B 5A8WB 3N4WA 4IG0A 2K8GA 3BEGB 3M8YA 2NSBA 3AOBA 4DR5F 4KPYA 4FVMA 4YB7A 2V9WA 3KLIA 4WP8A 1UETA 1QAJA 2DD8S 4JV5F 2I2YA 2F8EX 1NJXA 2OPSA 2ZUGA 2CJAA 1HPZA 5E3CA 2CQHA 5KT2A 4DV1J 3UCGA 3FQLA 4OX6A 2JFDA 4P72A 4DDFA 4WJBA 2GC8A 2OPPB 3HSJA 2M52A 4KYZA 2HFNA 2KZZA 1NK7A 2W7OA 1VFJA 4U7CA 4X64J 3DLEA 3SFGA 4KT0C 1RWOB 1BD6A 2XMWA 3RRHA 3VGUA 2VICA 1VC0A 2ADBA 4Q0BB 3P5BP 1FK9A 5CYQA 3BS9A 2FJWA 2LU1A 4F4XA 4G65A 4CWBA 4NLRA 1U1RA 1NZAA 2AJQA 4DL5A 1N5VA 2WB4A 3LW5C 5F8HA 2BYCA 4P2MA 2PMHA 4KB7A 3ZTSA 1VRTA 2P9CA 2CDQA 2H5JB 1I6JA 5AXNA 1NEEA 3R9LA 4O44B 1V3RA 3O44A 3O5TB 4NZ6A 4RO0A 4CQ1A 4P2FA 1RT4B 3BSOA 3TWZA 1N6QA 1UJ6A 3VR1A 2FHOB 4OI3A 1IR1A 2BXJA 3D0IE 3W2WB 3OD2A 2W9AA 1U8WA 2XI2A 3GJTB 3QGPA 1BE4A 4EMDA 2B7CB 1TKZB 2MTLA 4DF8A 1QUPA 2QJ3A 2LDYA 3MM5B 5JUMA 5KFKA 2DIUA 4JI4F 4KE5A 1AFIA 3H7HB 3M30A 1B0VA 3OVAA 2EFVA 1XMQF 3CSKA 4CO4A 2KZMA 4DV4J 1OYDA 4N8NA 1PG5B 2E7VA 5EWFA 5F41A 1YKWA 4QWEA 4DSLA 4TVAB 1C1BB 2MPUA 4KO0A 2FVRA 3KHLA 4FF1A 1CBKA 3BR9A 4LQ9A 2ACYA 2XY5A 1MLAA 1YJTA 1GXLA 3L3CA 4W90B 2R9LA 1BLUA 4B3SJ 1RQ0A 4JI8F 4AE5A 2OO4A 3QRPA 3S6EA 2W9BB 1UZDA 1QDUB 3LANA 5D3GB 4EK2A 2LXFA 1Q7YT 2P9EA 1N5QA 2FJDB 3H5UA 3VZIA 2W9CB 2V6AA 1KDNA 4B3MF 3FZBA 4DF4A 5AE2A 3Q8UA 5ETPA 5KG0A 1HNZF 1VC5A 3IBFB 1FTRA 3WBZA 5GVQA 2Q6CA 2QO3A 2IHR1 3AODA 2QV6A 4WBFA 4YB5A 2HQDA 3RBDA 3RAQA 3M8PA 5E0OA 2B4PA 1CS4A 5HL7Q 1LK5A 3NLCA 5AXLA 1YBAA 1TKDA 5B0DA 2OTJS 3UI3A 1FE0A 2HYIB 1N5YB 1X60A 2C3MA 1FRJA 4B08A 3BPSP 4NZ0A 1H74A 4KGKA 3POTA 5FLXY 3TUIC 3NGKA 4OI1A 4KGXB 4AXJA 3A8KA 3T6BA 4X4PA 3H0PA 2VQFJ 3C6TB 1NHKL 5C25A 3M2RA 1HIYA 3CDEA 3IN5A 1RAOA 3R3TA 1UW9A 4TY8A 1QVGR 2CJYB 3LO3A 3QGGA 1J5EF 1PIEA 3EDRB 2PIIA 2Q6BA 2JWNA 4GKKJ 4DJBA 2OEMA 1WNEA 4RLEA 1ACMB 3OW2R 1S10A 1XWLA 4P2SA 4Y3CA 2FJEB 3EMTA 2RB7A 2YKPA 2CAJA 1VCTA 1TKXA 3AOAA 2HIQA 1SKRA 2C2KB 2AEMA 3PW4A 2OD4A 3LPEA 2D74B 3QGIA 2RQKA 3NEKA 1C0UA 5B0CA 3CIZA 1VBZA 4ZP7A 1HA1A 5D4PA 2GMJA 1F9EB 3Q2TC 2CZ4A 3MUVP 2W4PA 2FYXA 2WONA 3KMSA 4ED4A 3DN9A 3KWMA 2BRLA 1KKHA 3FVYA 2F65A 5AE3A 2ZD1B 4Q8EA 2WK4A 4DX7A 4NXNJ 2MZJA 3CD6S 4DV0F 1KQKA 2UUCF 3KKFA 1S6OA 4J9OA 5H9EK 4A8WA 2XGQA 5J2MA 4P6QA 5H1SV 4DUYJ 1U02A 3WX4A 2IRUA 2ZBRA 2OEJA 2GAGC 4RUBA 3A4TA 2PGCA 4MIWA 4LF4F 1P1TA 4R5PB 4PPDA 5IT0A 4GVBB 2KHDA 3W65A 5C42A 1YRUA 3PV8A 1FRHA 1D9DA 1TUVA 5CAAA 1KLMB 1FE4A 3RZAA 1D9AA 3FCWA 2G2ZA 3DGPB 2J9DE 3I5BA 1MMLA 3D1OA 2CG4A 3OXFA 1V6HA 5SUHA 1WHXA 3PW2A 1TL7B 4W4MA 4ECTA 5AT1B 2BQ3A 4EUVA 1F6TA 3W62A 2RU3A 3CCWA 4B9SA 5CD4H 2GMLA 4LMZA 2OEKA 4LVNP 2HAFA 3D1HA 1RWUA 2HHTA 3OVBA 1R27B 5DS7A 3D2WA 4C4WA 5D0RA 1HL6A 4NRUA 3DM2B 3LH2S 1S0OA 4H4KC 2W2QP 1RI7A 2JX2A 2IJNA 4FBUA 3LGNA 5C24B 1VLOA 3DXBA 5A8KA 3OR1B 4PPZA 2P6TA 3OSPA 2JEFA 1FRLA 4Q2MA 2D9PA 2WB1D 4J9KA 3W8GA 1R8AA 1HYSB 2D3OR 3R6GB 2MKJA 3HHNB 5EX3A 4N76A 1C0TB 3VAGA 3K7RA 1JXVA 4FYYB 1JLQA 5GAGU 3DI6B 3CCRS 4JI6J 4NLVA 3QFHA 2NSCA 3HDSA 2RF2A 2E9RX 4DPXA 1V3ZA 1TMMA 2IDLA 4WKRA 4DS5A 3UVJA 4RW4B 2UXDJ 3AHPA 4LRFA 1JLCB 2YWKA 2I5JA 3CJ8A 2WVCA 1ZH5A 4ATNA 1IM4A 3H5XA 4CO3A 4Z7CA 2VD3A 3IBCB 1HBUB 2X51A 1WHWA 4MK9A 4OYBA 4DPTA 1S12A 3TZYA 4J9LA 3BH7B 3DRYA 1HNIA 5HQ8A 2MQOA 5K14A 1EQ0A 1RADB 1HWKA 3KHGA 2D9OA 2L08A 2A1BA 3T1HJ 4K4WA 2JL9A 4EYHB 1AA1B 1H2UX 3JSYA 3H40A 2P5VA 5BYQA 2HBZB 1Q53A 3THPA 4CTAA 1GNKA 4LBHA 1N88A 5GAHI 1UAWA 2WVDA 2B9WA 4LF9J 1J27A 3D68A 4F8RA 2PDAA 5IT4A 3G6YA 1ZTTA 4A8SA 3MR3A 1VQ6S 1N32F 1FJEB 1A7GE 3OBIA 4LBPA 2V8PA 3SDEA 2JLGA 2ZH4A 1VQ4S 4JI3J 4ZCLA 1ZAWA 2DH7A 2DRBA 3EGWB 1ZM3A 3FFIA 1N0UA 3EWGA 4HT7A 2EK1A 3QSIA 1I1GA 1NHUA 2AHOB 2MKKA 3N6MA 3C6UA 3PR4A 2ZM6F 2MGZA 4Y34A 2AD9A 2FHJD 2MQLA 1NPKA 4KTQA 4U67Q 3NS6A 2EEYA 2MKYA 2C3YA 1A0OB 2YH0A 5A8RA 1CPZA 2VONA 4DR2F 2AYEA 2AZ3A 2K2PA 1S1XB 5IM0A 1RBLA 2XLKA 4X4UA 2QLJB 3ILIA 3V4IA 1T3OA 1Y5IB 4ZLLA 2YNFA 2HFUA 2BANA 5IWAF 2KDOA 1MROB 2W24A 3NGDA 4C0BA 4LIWA 3BGRA 2IMWP 5D4OA 1PJ5A 2QIFA 2KXFA 3VWSA 1S7IA 1GX5A 1LOUA 1WD6A 3D4JA 4NXMJ 1HHSA 3OT9A 4QIWD 2R8KA 1REGX 2ZHAA 3ET6A 3EDQB 2KH9A 1IUJA 2DCLA 3OLAA 2BQUA 2CVIA 2QGFB 5E3QA 5HP1A 1T9UA 3BBCA 2H4YB 1XR6A 3GCWP 4A8YA 1GTHA 4B3MJ 3BV8A 3V81A 1I5OB 3IBWA 1MSWD 1QD1A 2ZJQQ 3KK1A 1JLBB 2E44A 3VF0B 4QR2A 4U8VA 4CLYA 3SEOA 3PFOA 2XTJP 4LRBA 1RABB 3GV5B 2ZZTA 5HJYA 2PD1A 1UFLA 4USTA 2RHQB 3W8PA 1TL3A 3CUNA 1AROP 5IQ6A 1VQ7S 1VISA 4YFUA 4OI2A 3M8ZA 1PBUA 2XS7A 4QR1A 5D15A 4X66F 5L38A 1JKHB 4F4ZA 2IM3A 1WHVA 4WWSA 1BQNB 2ZNYA 1DTTB 1CJTB 1L3TA 5L1KA 4I68A 3ZZPA 4XIUA 2R42A 5KG7A 2DITA 3HVWA 1BGXT 3L4BC 3DLHA 1DY3A 1CC8A 1YJWS 4A4JA 5B0BA 4N8OA 4Y0FA 3IO1A 3KLEA 4UOCA 1SQFA 2F4VJ 4ZJQA 1WUUA 2WW8A 1H2TZ 3DC2A 2EBGA 4ANEA 2MXYA 2XGPA 2A6OA 3OL9A 4FYDA 2GIRA 4ZITA 4B9MA 2OMOA 4RX6A 2NZ4A 2XB2D 3C14B 1RLDA 4V19X 1J2VA 2QFIA 1RHKB 4XO0A 1ZPWX 4R8UB 4F2RA 3J7YU 4OYPA 2N4DA 2V2VA 2KTQA 1DHMA 4WTYA 3QWPA 2YNGB 3CDBA 5KFQA 2DR9A 2HVDA 2HQIA 3O6QA 4MTPA 4JV0A 1VJQA 3QYYA 3UQSA 4BCAA 2ZFHA 3S8SA 3GR1A 3X3UA 2F1FA 3IP0A 2JEJA 2Q3PA 1FNOA 2RUGA 4CNZA 1R43A 4PKDB 3T1YJ 5IFMA 2XYPB 2F8MA 2XMKA 3M6VA 5HVFA 1HNWJ 1DTQA 2XO6A 3GV7B 2HAIA 3FQKA 1FJ7A 3Q8PB 1E6VB 6AT1B 5I3UB 4BBYA 1NK5A 5IS2A 1WORA 2A0FB 2HEKA 5J2PB 2R7TA 1JLFB 1SPBP 1FWPA 1UPMB 5T7LB 1KTVA 1U7LA 5E41A 2L3MA 2L9DA 3RB3A 2CJ9A 1N34F 4DV5F 5F0UA 4OQJA 1KD1T 3PNIA 3J81j 1RU2A 5KT4A 2MKHA 1N5TA 3BO4A 5KFXA 4OZ1A 4WE1A 3PX4A 4NLOA 1KFDA 3CC4S 1T7PA 1Y11A 2QA4S 4P75A 1DFDA 3RB0A 4ZKAA 2XC9A 1PCAA 5A2QU 3VHQA 3KDOA 2AJ2A 3MM6A 4E0DA 4IFYA 1EZZB 3A3PB 3H8YA 1U1KA 2OI2A 1UVIA 4RNOA 3PHTA 4C11B 3PW7A 4MKAA 5J1NA 4BLGA 4I2PA 1YJNS 2VFRA 5IC6B 1L3UA 3ZTOA 4A47A 2DXFA 1CULB 2DXEA 1NM2A 4MK8A 5GAEI 4TLRA 2C2NA 2FC9A 3J81Y 2GQCA 2MY8A 1RAFB 4J9NA 3H90A 1WDDA 1WACA 1FERA 3QJPA 4QWCA 1AUSL 1X9SA 3UN5A 5HROA 1U0SA 1ROFA 1XR7A 3ADAC 4M5DB 4H54A 2IAJB 3T5JA 4DR1J 3I9V9 1S79A 2MHEA 1LW2A 4UZCA 5DG9A 1W26A 5GMEA 1SIWB 1T9YA 2D1CA 4CO0A 2GS8A 1IBKF 2JSXA 2YKOA 4O3SA 1GXTA 4ED2A 2W7PA 3CJKB 1FRMA 4CT9A 3NOGA 4NLTA 2EK6A 4BC9A 3PKYA 3PR5B 1VC6A 3LF0A 1AUDA 2GX8A 1MWZA 4J9PA 2XMVA 4LF7F 2K3IA 1CQNA 4F04B 2BDPA 2QMWA 3GTYX 2Z2LA 3PEHA 2W4DA 3WZ0A 2PI5A 4URQU 3BH6B 1KP6A 3L7OA 2BJ9A 2UU9J 1EETB 3GPAA 2RSQA 3NGSA 4P7TA 5DM6Q 2W9CA 2PEHA 2ASLA 1HR0J 5M2RA 2DR7A 3VQTA 1RT2B 4JI2J 5DZ7A 1SJ3P 3IR6B 4ZCIA 4IO9Q 3M8SA 3KK3B 2R7RA 3NOCA 1WKJA 2FZKB 1LFPA 1YBUA 3HVTA 2FVPA 4M5LA 5LXYA 3O1LA 1IKXB 1ZYQA 4NLWA 3EXYA 3DLJA 5KT5A 4PXEA 2BA9A 5CD4A 3R2CJ 5KFUA 4TYAA 2JC1A 2EW9A 4UOFA 2G2YA 1Q8IA 5A6WA 1EKSA 2IRXA 5KG5A 2P2CB 2XSJA 4CRJA 1HNVB 5KFNA 3JSMB 4H4MB 3DRPA 4U7UK 2RVJA 4PQAA 2WOMB 3V6DB 3I5AA 5BJRA 5EHHA 1SQEA 1FDBA 2DR6A 2YX7A 1JX4A 3W2VA 1YLXA 8ATCB 4PG8A 4RW8B 4F3MA 4DQQA 1UVLA 4Q5VA 4KFBA 4HEA9 8RUCA 1D0EA 3UN2A 5D0EA 4HH0A 5F8GA 1AYEA 3HHLA 3PW5A 4TKTA 2E5JA 2ZJRQ 4DFMA 1TK8A 2FZGB 2E7WA 1RTDB 4F0KA 4E8UA 4X4NA 2FY1A 1N56A 1SIZA 1IN0A 2QA1A 3AT1B 2LQ9A 2LA6A 2FD2A 3RAMA 1RT3A 4DR3J 4CLFA 1SL2A 4KGZB 3TAPA 1RTHA 3A13A 4LT6A 3PDNA 4ZVOB 4UOGA 3T6JA 3IC1A 5CHCB 1GMWD 2Z58B 2UXBJ 1C1CB 3BGOP 2MKCA 3OLBA 2D41A 3L9ZA 1BWEA 3V4MA 2VFVA 2FLNA 5KFHA 5KFYA 4EGLA 4YHHJ 2M3DA 9RUBA 3OFFA 1K47A 1RJJA 4PABA 2HQGA 4QU6A 4KHRA 3R1LA 3FMWA 3CJ3A 3M8WA 2RRAA 3BN4A 5IXUA 1VRQC 5I3QA 2ZH6A 2DNLA 4XDDA 3QMQA 4B3RF 4ZN3A 4ZVFA 2B8PA 3DHWC 1FKAF 3GG0A 4YQWA 4LREA 4DFJA 4IDKA 1NK6A 1HQUB 3BSCA 4TNOA 5KG1A 1T8EA 2NLWA 4TU9A 5J2QA 2OMLA 3IG1A 3MM9B 4NMLA 3DGPA 2HHVA 2M88A 1U48A 1YG0A 2LQJA 1X5OA 4CO5A 1YSJA 2LXIA 4RKUC 4DV3J 4IOCQ 3R7SB 1NJZA 2GVDB 4ZK7M 2G2OA 1ZM4A 3HJVA 1JJ4A 3F41A 3TO8A 2ZBCA 2HZCA 1X4FA 4PZVA 2VBZA 1S6PB 3MPUB 4FDFA 4ZVGA 1NK0A 1S9GA 2YNHA 2Q1LA 4ED6A 2ALYB 1RTJB 1AB8A 3DOLA 3I0RA 2GIFA 2JNJA 2QMXA 2DRDA 2NZCA 1VQ5S 4I7FA 2BE9B 3BGFA 4LVOP 5HSPA 4RL1A 4XK8C 4F4WA 2Y1JA 1IKWB 5C24A 5FJ4A 3GJSB 1JJHA 4Y2AA 4URGA 3OHAA 9ATCB 4WIIA 2O5DA 2CJKA 4ED8A 2HRUA 3FSYA 4O3NA 2J7UA 1OS5A 4IG0B 2AJ1A 2JZ5A 4MK7A 2HMIA 1OY9A 4X4OA 1RA7A 4QZVB 1UA0A 3P8BB 2RT3A 4DL7A 2R4FA 4AQYF 3MURP 3QT8A 3EZOA 2B9XA 5M2UA 3HZGA 1R0AA 4URSA 1XTZA 1PO6A 3KLVA 2ROGA 4OZ0A 1NSKL 2JEGA 1HPZB 1ELOA 3JTOA 3DHXA 3TEHB 3OJUA 2XMUA 4LQ3A 2DTJA 4YOEA 1N33F 2DGVA 1IR0A 5BYSA 3QLHA 4K4ZA 3HKZD 3LWMA 3AA9A 4JI5F 2W2OP 1S57A 2CWXA 4LFBJ 3LALA 1RBAA 3DLEB 4RW7A 4DUZJ 1X0FA 4DL3A 1G6BA 3TNVA 1FK9B 5CYQB 1Q5YA 4NA3A 3PG9A 4LFAF 2GO8A 2KFNA 5K8MA 1YZ6A 1WC3A 3LP1A 4DV7F 3H20A 4EYIB 5KFWA 1VRTB 2HGLA 5F8LA 2CJBA 5B0FA 4UTGA 3K5OA 2VASA 2QE5A 3NNHA 1IKVA 3MFHA 1U25A 4W92B 1SKSA 2WBMA 2DH9A 2KT3A 2XLJA 2BM0A 2FLLA 2KXHA 1N6QB 1M5VC 2HWIA 1RTIA 1G4CA 3CCSS 4RZRA 1VQKS 4MMOA 1NU4A 4DS4A 2JDJA 1FI4A 5KFSA 4NOHA 3W3SA 4LR8A 2NXUA 1KNZA 4P10A 1EKRA 3M30B 1U1PA 3HX9A 4G1PA 4LF1A 3PXGa 4IH5A 3T3FA 3M6UA 2G4BA 2CA9A 3KLHB 4GC7A 2J7WA 2RRNA 4CYUA 3ZZYA 2NXEA 3RTVA 2V2QA 2QFJA 2DNYA 4C0OC 4KO0B 1XR5A 4CH0S 2WW4A 3K57A 1RU1A 3VAIA 4F50A 2W01A 3NKYA 2VA2A 5CZVA 3CCVS 3JTNA 4HACA 3CJ0A 2B7BB 1UFWA 3W61A 2K7JA 4DFKA 2Q79A 3CC7S 2XNRA 4RWXA 3MR5A 2C42A 2W2NP 4F25A 5IV4A 1X9MA 4KR0B 4PG6A 3CCES 4KRWA 4JBCA 3MAAA 5FD1A 1KR4A 5MLCV 5EUHA 2V69A 4WFYA 2VG7A 2BR0A 2VF3A 5LJ3Y 2M5YA 3MAQA 1HBNA 3B82A 1UEUA 4FZVA 4PXCA 1ZOTA 2P6SA 2BJ8A 2R7OA 2OD6A 3IWLA 1BUXA 4K8RA 2QC3A 2HNYA 1Q81T 2NXJA 1I3OB 4USHA 5JXSA 1L3KA 3M8PB 1CS4B 4I67A 4UUXA 1MMNA 2EWHA 3FKBA 1SJRA 2CJQA 4WCEQ 4OYOA 4K4TA 4ERDA 3KK2A 2OLWA 3MGJA 2CNOB 1RT5A 2DR5A 2E66A 3POTB 4RBVA 1REVA 3LWLA 2IVMA 3M6WA 2IRYA 4NA2A 2O3DA 1A6LA 2M70A 5C25B 3M2RB 2HNZA 3CW2C 1SJQA 1C4CA 2VDHA 2NR0A 3OXGA 3V5RA 1UWBA 3ZTQA 4EO6A 4WFAQ 4TY8B 2QLWA 5DZ6A 1FWLA 5GMDA 2L41A 4EBDA 1NMEB 2PO4A 2XYHB 2ASYA 3FUYA 2HQCA 1YJ7A 2ZKTA 1N52B 2J8SA 4J91A 4YY3J 1BQNA 1B0TA 4IR1A 1TL1A 1CJTA 3OTDA 4KAIA 2VBYA 4C2MA 1U6FA 4RW6A 1TAUA 4LBIA 1N5SA 3EYZA 4DPUA 3A8EA 2COLA 2UUTA 2Y1RI 2DEJA 3ETMA 3UW1A 4C8YA 1T0TV 3D3CJ 1HQ2A 2ILZA 1XC9A 2RU9A 1C0UB 3UDVA 3Q8RB 5LMNJ
chains in the Genus database with same CATH topology
4X65F 4DV0F 2CPFA 4RW6B 1KQKA 3MD3A 2NPFA 4ZP6A 2UUCF 3KKFA 4C8NA 2R2SA 2RRBA 2MB0B 3PO4A 2WONB 1S6OA 1R8PA 4J9OA 2LECA 4ETXA 3UR0A 1FESA 3HJFA 4A8WA 4NL5A 3KLGB 3EZ5A 1YHQS 4HKQA 1V3SA 4R5PA 3HHLD 2XGQA 4ELTA 2WTFA 3K5MA 5J2MA 3CDWA 1LQ9A 4P6QA 5H1SV 2R2UA 3TUJC 3WX4A 1WHYA 1ZM2A 1JLEA 3WC2A 3HXMA 5KFBA 1KLMA 2CQ3A 2FGCA 2LVWA 3I96A 5DDPC 2IRUA 3TW0A 2GNKA 2PI4A 3S01A 3DYAA 3VAHA 3OTEA 2E1AA 4AFFA 2M9KA 4PG4A 4LF8F 1VQMS 1CLFA 2IJFA 1LKZA 5DQHA 3CCLS 1F0XA 1IJEB 4RNHA 3PHEA 2VFUA 2PGCA 1SB6A 3M32A 3ICLA 1RDRA 1HI0P 4MIWA 4LF4F 4DV1F 2CPIA 3NCQA 1P1TA 4YUDA 2A2CA 4NZ7A 3IGVA 2LEPA 1LWEA 4PPDA 4ZHRA 4R5PB 4FS2A 1T03A 5IT0A 2RQMA 5KG6A 3MUTP 2KHDA 3IFEA 5C42A 5J2MB 1YRUA 2JOQA 3HP6A 1FRHA 3PV8A 3HVRA 1NH7A 1Z2ZA 2KG0A 4WK3A 4DQPA 4CH7A 1D9DA 1JLEB 1TUVA 1KLMB 1FE4A 4F02A 4ES1A 5FDLA 3RZAA 1D9AA 2ZKUA 4ECQA 1BQXA 3BSNA 2J9DE 2XMTA 2Z0GA 3DYAB 3I5BA 1MMLA 3MEGA 3D1OA 2CG4A 4X64F 3H5SA 1V6HA 3DNCA 3OXFA 5SUHA 4A8FA 1ZBTA 3HHLC 1WHXA 2BOPA 1HD1A 3PW2A 3M32B 3C3LA 1S1UA 4HTJA 4WFXA 3D28A 3G4SS 1M0SA 3BQ1A 2IA6A 4WK1A 4ZHRB 4QYRA 3NNAA 2LYVA 1T03B 1JK9B 3QAUA 5C42B 3VAJA 4ECTA 3NG8A 2BQ3A 1NKBA 2ZE2A 2F9JA 3DM2A 4ETZA 3QIPA 2UZAA 1NAQA 4EUVA 3QO9A 3SYZA 3TOQA 4BDPA 4M63A 5IZHA 1R89A 5FDLB 1XERA 4RU9A 4TQRA 5EX0A 4D3HA 2RU3A 2WSEC 4RNNA 3CCWA 4B9SA 1HFEL 1LK7A 1LXNA 3DCAA 5CD4H 3N01A 3MEGB 2HWTA 3H4BA 2GMLA 4LFBF 4LMZA 2B0GA 3MTJA 3LP0A 1T94A 5B0AA 2MMYA 4LVNP 5KT6A 3D1HA 3OR1A 4OL8A 4DUZF 5ITHA 5KTQA 1OPIA 1S1UB 2M4MA 2HFOA 1RWUA 2HHTA 3OVBA 3CDAA 2LDIA 3OTOF 3BB5A 1R27B 5DS7A 3D2WA 4PUOA 1VQNS 5GAEU 2CQCA 2LQBA 4C4WA 3S1TA 5L9NA 1HL6A 4NRUA 2MQMA 4U9RA 4DN9A 1OPZA 2M7SA 2ZE2B 3DM2B 3LH2S 1S0OA 3QIPB 4H4KC 3TVZA 5K8PA 1RI7A 3BDEA 3QO9B 2JX2A 4ALZA 1QY7A 5HMZA 4YR0A 3MEEA 1VOMA 2YKAA 3OFEA 4OHZA 4O4GA 2AGPA 2IJNA 4FBUA 2Z2MA 5E3PA 1HYSA 3LGNA 3TAMA 5C24B 3OXLA 4ELUA 3KLIB 4Y2KA 2J6UA 3LP0B 1U47A 2QSWA 3DXBA 3QZ7A 2MJUA 5DO2A 4EO8A 5A8KA 2KFZA 2QA2A 1C0TA 3OR1B 4ZP9A 4PPZA 2P6TA 3IR7B 5DM7Q 3OSPA 4PUOB 1DQ8A 2JEFA 1FRLA 3DMJA 3FSXA 3N79A 4IQMA 3RRKA 5HO4A 3DI6A 4OHWA 2PA3A 4Q2MA 4ECRA 2VH7A 5FIIA 4QQBA 2D9PA 2OPSB 2WB1D 1S99A 4J9KA 5K9FA 1NJYA 1R8AA 2BVZA 4QJVA 3M9OB 2RH3A 1N36F 2GMHA 1HYSB 2D3OR 3PIOQ 3QGHA 2FJAB 3TAMB 1KOHA 2MKJA 3H25A 2R7WA 2ROEA 1QVFR 3HHNB 2EVZA 6FD1A 4ECSA 4OZNA 1S9FA 1DRZA 3KNAA 3TYTA 2MDAA 5EX3A 4Y00A 4RW4A 4N76A 3AJ1A 4FXVA 5A8KB 1IKYA 1C0TB 5DQIA 2O01C 3VAGA 5EGYA 2GJ2A 1FRXA 3K7RA 1LXJA 3CXCR 2OP5A 3CMAS 1JLCA 2DJWA 3MOZA 2UVVA 1JLQA 3DMJB 5GAGU 4J9MA 2CIMA 3DI6B 3CCRS 4EBCA 4NLVA 2XMJA 2OJ3A 4OI6A 2NSCA 3HDSA 4N77A 1VIOA 2RF2A 3CE8A 4DV4F 2ATLA 2E9RX 4I0WA 3GV8B 5KAKA 3D5MA 1V3ZA 3KMQA 4Q43A 3HFKA 2IAJA 1HBUA 3CPWR 2IM2A 4A8XA 3IRXA 3HT3A 3CCMS 4WKRA 3MAHA 4DS5A 4K50A 1T02A 2IBOA 4QWAA 4RW4B 2E1MC 2FLPA 2R7UA 1GXUA 3NL0A 1SUQA 1IKYB 2VPXB 5D4LA 1TV6A 4NLQA 1DQAA 1RT6A 4K4UA 3THVA 3AHPA 2YVSA 4TLQA 2ZHBA 1S1WA 2OSQA 5KFOA 1R7IA 1JLCB 4NLXA 1JLQB 2YWKA 5E5NA 2I5JA 1SH0A 2CPHA 2VFSA 4TXSA 3NS5A 5L1LA 4TYBA 2AGQA 1ZH5A 2RF2B 4ATNA 5L1JA 1IM4A 3PKMA 4C0HA 2A2DA 3H5XA 1JJ2R 4CO3A 2DNZA 2PFFB 2VD3A 3CJ5A 4NCGA 2AYGA 3PY8A 3RR8A 1HBUB 3LAMA 1RYRA 4B3SF 2X51A 3IRXB 5GMKa 1OQ3A 2DO4A 2JFKA 3GYNA 1WHWA 5EWEA 2E29A 1XEZA 4MK9A 3EPIA 1QSSA 1SUQB 2N7YA 4J9LA 1R8BA 5H9FJ 2I9SA 1TV6B 1HNIA 3DRYA 3DU5A 1RT6B 3FGVA 1NH8A 5HQ8A 2MZTA 3QZ8A 1S1WB 2MQOA 5K14A 1FJ7A 1RISA 1YWXA 2I5JB 3R5BA 1X4GA 3EUNA 3F73A 5CQGA 1HWKA 2GHWA 2XHWA 3KHGA 4TU8A 2WAQD 1F9FA 3CGIA 2CVEA 2D3UA 4KBIA 2KT5A 3AA8A 3HZEA 3E8OA 4IOBA 3BO3A 4FF2A 2D9OA 2L08A 5HI7A 3TRGA 4RUCA 2A1BA 2AYBA 2I38A 5DG7A 3I5CA 4CIOA 2JL9A 5E7OB 4K4WA 2C28A 4EYHB 5EN1A 5KFIA 5A0YA 2G1DA 1FXDA 1PSDA 1H2UX 2XCAA 3ENWA 3DRXA 3JSYA 5BYRA 1A9NB 1AW0A 2EFPA 1HNIB 3H40A 1W25A 2P5VA 4ZLPA 2J8AA 3Q0AA 1Y5NB 3CCZA 5K14B 5BYQA 4Y28C 3N6NA 4A46A 3I82A 3B8HA 4E98A 1Q53A 1NRKA 3MMBA 3THPA 4CTAA 3HMJG 1RYSA 1GNKA 1Q86T 1FJGF 3RB6A 2MQNA 2E5LF 1N88A 5GAHI 2ZH8A 5DDQC 1UAWA 4RWWA 2B9WA 1K73T 5F8NA 2XY7A 2VKRA 3H2VE 2M2BA 1BY9A 4I6AA 3ZC4A 4F8RA 3GQCA 4G1QA 1K8AT 2ZH5A 5HMXA 5A0YB 4J37A 2PDAA 5IT4A 3QWUA 3G6YA 3FCHA 1ZTTA 1DZ5A 4A8SA 3MR3A 2K1RA 2WSFC 2YKQA 3IWXA 2XO7A 2C2RA 2MHNA 2GQQA 4C8LA 1UVJA 4K0KF 1VQ6S 1N32F 1FJEB 1A7GE 5DLGA 1ZAXA 4NYPA 4M8LA 3OBIA 3M4XA 2HGNA 1PC4A 3MMBB 4CTAB 3SV4A 5DETA 1M5SA 1X5PA 1CEZA 3KG4A 2V8HA 3SDEA 2JLGA 3V6KA 2ZH4A 2VQFF 2GA7A 1VQ4S 4ZCLA 2LXUA 1ZAWA 2DH7A 4DL0C 2DRBA 4OFZA 1GH8A 3EGWB 1ZM3A 3FFIA 4YDDB 3TR5A 4JI4F 4DQSA 1N0UA 4HT7A 2KFYA 4G1QB 2EK1A 2XG8A 1KQFB 1HWIA 2JLFA 2FC8A 3QJLA 2KHCA 1I1GA 1NHUA 2DH8A 4HHJA 1QE1A 3EPGA 2NUHA 4A48A 3N6MA 2MKKA 1FJCA 3C6UA 3DLGA 1S1XA 4I2QA 3CT9A 2GFFA 3VQSA 3MFIA 3PR4A 4ZPVR 2ZM6F 2J9EA 5CXTA 3UCUP 2MGZA 4Y34A 3T5KA 4MH8A 3LP2A 2AD9A 2RJZA 2FHJD 2HWHA 2MQLA 1WTFA 4I64A 4RW9A 3SDEB 3FMBA 1Y0HA 2DGSA 5LSLA 4KTQA 4U67Q 2R8JA 3NS6A 2MQPA 4G3IA 1VIXA 4GKKF 2V4RA 4Y65A 1T3NA 1U2RA 2C3YA 3FFIB 2YH0A 5A8RA 1CPZA 2VONA 4DR2F 4D3GA 3M2UA 4OLOA 3TP2A 1KC8T 3THTA 2AYEA 4DR4F 2ZC3A 4LFCF 1N48A 3KOAA 3CCJS 1URRA 1KHVA 4DFPA 4NLUA 1QE1B 2AV5A 2K2PA 2VBWA 5B0EA 2YH1A 3C6UB 2C3PA 3DLGB 1S1XB 5IM0A 4I2QB 1S72S 4ZOSA 2RKIA 4K4XA 2Z8QA 2F9DA 3DXSX 1MROA 5DQGA 2MGZB 4O3QA 3K0JA 4YR2A 2EC0A 2XLKA 1DLOA 4X4UA 6FDRA 3M8QA 3LP2B 3IRWP 2ABYA 1FNXH 1GX6A 5KG3A 4RW9B 4UW2A 4KV8A 1LFWA 5J1PA 3R5DA 4QIFA 1RT1A 1KVJA 1IQZA 2L9NA 2XWXA 1VQ9S 2CZVC 4MJKA 4YY3F 3FEZA 2ZJPQ 3LQVA 3V4IA 3VCDA 2LMIA 2RDIA 1FDNA 1S1VA 1T3OA 1Y5IB 1JIHA 3I31A 3M2UB 3SCIE 2HHWA 2C2DA 5L9XA 1H3DA 2YQ3A 1M5HA 1O5JA 4X4SA 2YNFA 3CTRA 1K1SA 1RA6A 2FHKA 2ZC4A 5F0WA 4TQSA 1FCAA 1PGZA 1D8ZA 5IM0B 3P3DA 2W4CA 3BN7A 3M6XA 2FDNA 2BANA 3R1HA 2RKIB 2MZRA 2D7SA 5IWAF 4DSEA 2KDOA 4OMFG 4DL6A 3T9NA 1MROB 2HRYA 2F40A 2B56A 5DJBA 3NAIA 2CQ0A 1DLOB 4MIAA 1WWHA 1QLNA 3M8QB 2W24A 1WEYA 4KV8B 4NLDA 4DMZA 3NGDA 5B08A 5JVGQ 2ZVSA 4C0BA 4LIWA 2R2RA 1RT1B 3BGRA 1KEKA 2IMWP 5D4OA 1FDAA 5F3TA 3V4IB 5I4MA 2QIFA 5D78A 2KXFA 1FXLA 1S1VB 1RT7A 4IKAA 1U1MA 3FRZA 2OSRA 2RE1A 2KM8C 3VWSA 2FJVA 3CJ2A 1GX5A 1LOUA 1WD6A 3MDFA 2YNFB 1NKCA 1HHSA 2WSCC 2XNQA 3UNGC 5HMWA 1JLBA 2CQGA 2OKQA 4QIWD 4IR9A 2R8KA 4F2SA 3KHHA 2ZHAA 2FJXA 2DHXA 1DAXA 2KH9A 1IUJA 2DCLA 3OLAA 2BANB 3T5LA 1MNEA 2BQUA 4NXNF 2CVIA 5E3QA 4K59A 5LMNF 4V19J 4WZQA 2CPXA 2CQPA 5HP1A 3NMAA 1KS2A 1XR6A 2FIUA 3OPKA 2P9GA 1P8GA 4A8YA 4WZMA 4Q7AA 1GTHA 2C3OA 1QAIA 2LCWA 3HI9A 5DLFA 1U1QA 1GT8A 3BGRB 3MPYA 4C3LA 4ED7A 5AJ3F 3PO5A 1FVSA 4DR7F 4CZCA 3IR5B 3PJWA 5I3PA 3V81A 1WF1A 4DUYF 1FKOA 1RT7B 2I1RA 3IBWA 1LW0A 1N54B 2B4VA 2LEAA 2W25A 3FSIA 2ZJQQ 1JNZB 3BQ0A 1MSWD 1FHTA 4CH1A 4B9VA 3KK1A 4F67A 3ETOA 2RNEA 1JLBB 3HHEA 3I32A 4DQIA 2Y0SD 5LJ5Y 2E44A 5AXMA 3ZZOA 4LIRA 2DB1A 2E7XA 3MMJA 4CT8A 1X8DA 3VF0B 3HHDA 4QR2A 2KKHA 2LU2A 4QPTA 4QIGA 5EDWA 1JKHA 4Z2XA 1FD2A 3SEOA 3I6PA 4AYBD 5HP1B 4ED3A 1YJUA 3PFOA 3LAKA 2ZOMA 1K0VA 1N0VC 4DHVA 5C5JA 4XAKA 3GV5B 2PD1A 5G4DA 1Q8LA 4DV6F 5HLFA 3GWCA 1DTTA 3CCTA 1WG4A 1UFLA 3BREA 1TFYA 1TL3A 1GQEA 3CUNA 4NLYA 4C9DA 1AROP 1FKOB 5IQ6A 1VQ7S 1LW0B 2CPJA 3GZ7A 4YFUA 3CMES 4OI2A 3ISZA 2ZITA 1EP4A 3CIMA 3KK1B 2LEBA 1R8CA 4B3TF 2XS7A 4YP3A 1TKXB 4OZ5A 3JYTA 3HM9A 2VODA 5DDOC 2M0GB 2AWZA 4QR1A 3KJVA 4LF5F 4KIAA 4O3PA 1U1LA 3IAM9 4KHPF 3RW7A 4X66F 5L38A 3J80Y 1NK9A 4WU2A 1JKHB 4F4ZA 2IM3A 3E51A 5LSOA 5K8OA 1WHVA 2BRKA 4X4RA 1D8YA 2HS4A 2N3OA 2X1FA 1B7FA 1BQNB 5HN0A 4F26A 3VZHA 4QWDA 4RBUA 2ZNYA 5HLFB 1DTTB 2E5GA 4Q45A 1L3TA 2U1AA 5ADZA 1TL3B 5L1KA 4I68A 2B9YA 4NYZA 3SCJE 3U1LA 3ZZPA 4XIUA 2A10A 5KG7A 1Z4UA 3CO9A 4KSEB 1SL1A 2DITA 3HVWA 1BGXT 3KYLA 3FEXB 2VC1A 1EP4B 3DLHA 1NK8A 4WYLA 1UL3A 1CC8A 2JVRA 4WXOA 3MZIA 5E33A 3UWTA 3JYTB 4A4JA 1YJWS 2XMMA 5B0BA 3KJVB 4JI1F 4OIXA 5A6PA 3G8TA 1NO8A 4HH1A 4N8OA 4Y0FA 1HHTP 2OH2A 3IO1A 3KLEA 4IH7A 3P6YC 4UOCA 1NHVA 1UJ4A 4EZ6A 5LMUF 3KTQA 2R8IA 1FRKA 1H2TZ 2WW8A 3DC2A 5LSRA 2EBGA 4R8UA 1XNRF 3MEDA 1SV5A 4OLPA 2IVYA 2DBBA 2MXYA 2XGPA 2V8DA 3OL9A 4FYDA 1BQMA 1HI8A 1Q1KA 4J9SA 2YNGA 1FRIA 2DHAA 1KSPA 2GIRA 4B9MA 2OMOA 4RX6A 3ZFVA 3M9NB 2KG1A 2CPEA 2G0CA 1SC6A 4ECYA 3MMCA 2NZ4A 4DLEA 2XB2D 1VHFA 1VBXA 3IGNA 1TFWA 4FS1A 4WFZA 1R3NA 1B0PA 4V19X 1J2VA 3NCPA 3I0SA 3MD1A 3K58A 3KLEB 1J5OA 3K59A 2DNOA 4RNMA 3EGNA 4XO0A 1ZPWX 5D6GA 2B3TB 3L7PA 1XK8A 5F3ZA 4R8UB 3MEDB 4F2RA 3J7YU 1SV5B 2N4DA 3UE2A 4CI0B 2BUNA 3BO2A 3IS9A 1BQMB 3QAEA 2KTQA 3DLKA 1DHMA 4WTYA 3QWPA 2JC0A 5J1EA 1YTYA 2OIHA 2YNGB 5A2QY 3CDBA 5KFQA 1NJIT 1E6VA 3VTIA 2DR9A 1IJFB 2HQIA 5I3UA 5MAOA 3OV7A 2CQ2A 3MMCB 3O6QA 1KFSA 4MTPA 2VOOA 1WF2A 4JV0A 2HGMA 3FRYA 3QYYA 3TVYA 2VA3A 4OHYA 1F5BA 4ECWA 3V2UC 4K4VA 3UQSA 5J2PA 3DRSA 4BCAA 2N7CA 2ZFHA 3S8SA 2FHMA 3GR1A 3X3UA 2F1FA 1TL5A 5H9EJ 4OX8A 3I0SB 1JLFA 3MPWA 1U1NA 4L6V3 2GO9A 2JEJA 3CEDA 4WF9Q 2Q3PA 1J5OB 1FNOA 2RUGA 1LWEB 4CNZA 2J0QD 1R43A 5B7WA