3DGPA

Crystal structure of the complex between tfb5 and the c-terminal domain of tfb2
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
62
structure length
62
Chain Sequence
ELDRVITYEGSLYSDFETSQEYNLLSKYAQDIGVLLWKDDKKKKFFISKEGNSQVLDFAKRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords RNA polymerase II transcription factor B subunit 2
publication title Structural basis for group A trichothiodystrophy
pubmed rcsb
source organism Saccharomyces cerevisiae
total genus 18
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2008-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18307 Tfb2_C Transcription factor Tfb2 (p52) C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2610 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dgpA00
3DGPA 3DOMA
chains in the Genus database with same CATH superfamily
4C3MA 2CPZA 3GJRB 4K4VA 3DKDA 2UXBF 5I42B 2DNQA 2ZVIA 2L9DA 4P7VA 4C8NA 5D0GA 2ZHBA 2VFVA 5KG7A 4P2MA 4CO1A 4ED0A 1CJUA 3O2IA 1MMNA 2KRRA 1F6TA 1XMOF 4KAIA 2GIRA 3IR5B 1PYTA 4OHXA 4DF8A 5D4LA 4L76A 4ELVA 1HNVB 3D0IE 1X5TA 2M3DA 3PJWA 3GV7B 4ERDA 3JSRA 1VQKS 1IKVB 2GIQA 4OZ2A 2B0GA 4O3QA 4EO6A 3D6FB 1RTIB 1S6PA 5SZTA 2HFSA 3EDQB 2CZ4A 4JI4F 2DT9A 1FX2A 2XMVA 1BQNA 3D9BA 2NXCA 1JLCB 4C8YA 3I0SB 5A8WA 3ENWA 5GAHI 3JSYA 2MKCA 4XDDA 2B5JB 4Q0BA 2DY1A 4CH1A 2GVDA 1WKJA 4MFBA 5KFZA 5KFBA 5HP1B 1EAYC 4Y2MA 5ETMA 1N5VA 2B8PA 1RHKB 2KTQA 1V9OA 2A10A 2B4VA 1K0VA 3KK3A 2B4PA 3TRGA 3KJQB 1KBRA 1X7VA 3QT6A 3SBMA 2H4YB 2MKKA 1RHJB 3BKUA 2JDJA 3D54A 4R8UA 3C6TA 1XQIA 4ETXA 2IAJB 3VAFA 2C2OB 5THWA 3VAHA 3ZNJ1 4OLOA 3C15A 4USMA 4IFVA 4URGA 3MM5B 2VOOA 2P8IA 4UW2A 4I2PB 3PHEA 1B64A 2RHQB 2BV3A 4JI6F 1IUJA 1GTEA 4HVZA 1U1PA 5U47A 4OI2A 3Q83A 4XK8C 1M5PC 5CHCB 1P1TA 2DIUA 5GMKa 4FKYA 3JQJA 3NKYA 4F8RA 2OELA 1B70B 4ZVFA 2U1AA 3DN9A 9ATCB 1HA1A 5EWFA 3H25A 3AJ1A 4PXCA 3POTA 2VG7B 3HSZA 1N5QA 2YTCA 3RAMA 1R31A 1CJVB 4AE5A 1RU2A 2FLPA 3FMBA 3OT9A 4KO0B 4WK1A 5E33A 2AJQA 2DYAA 1M1HA 4X4QA 1LK5A 5JJBA 4K50A 1CQMA 1B3TA 2IRYA 2B7CB 5KFGA 4QWAA 1VK8A 3TEHB 3DLEB 2NXEA 3JXOA 2NPFA 3EVOA 1NK0A 3AD8C 4F7VA 1E6VB 5G4DA 2MJUA 4U67Q 4ED8A 1J5EF 1UVNA 3KG0A 3CD5A 3M1VA 2YKAA 1YJ7A 4KHPJ 3BO2A 3FGVA 2ZH7A 2ZJQQ 2XULA 2IY5B 2K7JA 2HLTA 4LR7A 1N5YA 2E1CA 4JI1J 3QJPA 1EARA 1UETA 1Q53A 4RX6A 2IJNA 2VG5B 2FGOA 4DL6A 1FF2A 1QD1A 3C16B 2I5JB 2MZRA 3OR2A 1CG2A 4MYTA 3CJKB 2XG8A 1IBLJ 3BJYA 4DLEA 3RB0A 2B9XA 1H98A 2UXCJ 3I82A 1JB0C 5KFEA 1Y4ZB 4IOAQ 2VKRA 3I5BA 2N82B 1WC6A 2YPZA 3PV8A 3VQTA 3JSMB 1NHVA 3IGNA 3FCWA 5AE2A 1HFEL 2E1PA 2V63A 1QDUB 3EXCX 3VGVA 2BE2B 1DLOB 5L39A 1UCNA 3EGZA 1JIHA 4O44B 2ZC3A 3NP5A 2HHVA 2QSWA 3CCVS 2HQFA 1R27B 3CCTA 2MQ8A 1DTTB 3PRDA 5DLGA 2J7UA 2DJWA 3UFCX 3JQMA 2OO4A 1DFDA 4CYUB 1HWJA 4U95A 2MKYA 1Y0HA 2HZCA 4I7FA 3MM8A 3D28A 7FDRA 3A1YG 2APOA 2ZE2A 2RNEA 4HL9A 2RRNA 4F25A 4ED1A 3DRPA 3VHQA 2ZH8A 3HKWA 3LP0A 2M88A 1EP4B 4A4JA 3H2VE 4ZVSB 1S0OA 3W9HA 1I5OB 2QC3A 5ETPA 8AT1B 4AL7A 8RUCA 2J6TA 4IQMA 1SVDA 2CQBA 2R2SA 1SXLA 1FRIA 1UWBB 2CFXA 5KT7A 1FE0A 5JVHQ 2VJVA 3TUJC 1KOHA 2AKWB 2C3PA 5KFXA 3RGIA 1RT3A 2HKEA 2NZCA 4FYYB 2MGZA 2N3OA 4DPXA 2ZH6A 2EEYA 2VDIA 3M6UA 2HBRB 1VC6A 4KH0B 4CM0A 1EX8A 1YK9A 2HVIA 4WP3A 3MEDB 3BZQA 1HI1A 3B82A 1D09B 2Y0BB 2WBRA 5HN0A 4YB1P 2VQFF 2QO3A 4I4BA 3M8YA 3LTOA 4J37A 4AL5A 3MHYA 1Y7PA 1FEEA 1DURA 1MLAA 2NREA 4EU0A 3UR3C 2OEJA 2DHHA 4TU9A 3ZZUA 4PAAA 1ZOTA 2DCLA 2OTJS 3EUNA 1UP1A 3Q86A 4ZCIA 4OQJA 4RJVA 3UW1A 2LQ8A 2DGSA 5CYMB 4FYXB 3MD3A 3BDEA 2RAQA 5KFVA 1R6VA 1F3VA 2FHJA 4FYVB 3FNNA 5DDOC 1F5CA 1FTCA 4NX9A 2HHQA 1LW2B 1BQMB 4V19J 1ZETA 2XSJA 3KLEB 4DPWA 2DRAA 3GLJA 4USWA 3JTNA 1EKSA 4YHHF 5AXNA 4JOUA 1FNXH 1U6FA 3BR8A 3PR4A 4KB7A 1YBAA 2FPHX 4ILRA 2G9OA 2LCWA 2RF2A 3RU0A 3BBFA 1CLFA 1NZ8A 1U02A 4J9NA 4EGLA 4I6WA 4PG6A 1S1XB 3D6TB 3P5TL 3QFWA 1SJFA 3PKMA 2R2RA 1S1TB 3ITHB 2GHVC 3NMAA 4K4WA 1FKAF 3SFGA 1OS5A 2OAUA 4OMFG 4P75A 2C3UA 1OSDA 5JMNA 2BM1A 2FTRA 3JAMY 2WRMA 1IKWB 2ASYA 4LF1A 4KV8B 2BE7D 2GMHA 5I4MA 1U45A 2W25A 5A8KA 5C5JA 2MLZA 1RWVB 1TFYA 1XK8A 5LJ3Y 4X4TA 3HD2A 3R5AA 4QYRA 1PCAA 2GW8A 2AYEA 3NCRA 3LANA 3A3NB 4ZA1A 4RUAA 1FTRA 2VG6A 4ECUA 3K5MA 3TW0A 2L9NA 1N33F 4YB7A 2H5EA 2R7TA 2DKOB 2Y8WA 1N5TA 2XNQA 4JI2F 2QLBB 5DM6Q 4DJBA 3LGNA 2HRUA 1EKRA 3HVAA 3CDUA 2BOPA 4OYAA 5H1SV 2F4VJ 1ICEB 4ZLJA 2JSXA 4B17A 4ECZA 2E44A 4CT9A 3P3DA 4YY3J 3PZPA 2BRKA 1D9DA 3G4SS 2M8DB 2CRLA 4F2RA 3ETMA 3CCES 2CZ9A 2B6AA 3OPKA 1K44A 3M2VB 5K8MA 1GAOA 4PWDA 1Z4UA 4LSNA 1BGXT 4CNYA 5BJRA 1K47A 3CD0A 1R0AA 1FHTA 1SKWA 2NPIA 4JI5J 2RQCA 2ACMA 3GWCA 3PXGa 2IM2A 4KFBA 4PCQA 2P5VA 3MMAB 2PN6A 1UW4A 5KTQA 2CWXA 3HJFA 3PW5A 4A8MP 1VLOA 1NZAA 3R5GA 3C14B 5F8GA 4DR2F 2UUAF 1SH3A 2FLNA 4ED6A 2JVRA 1HWLA 4H4MA 4B3MJ 2RHSB 4LRCA 1DRZA 1S0MA 2PO4A 1TFWA 1HHSA 1N0VC 1U26A 4EFAC 4ZPBA 1C1CA 3LA0A 5CZXA 3CT9A 1FT8A 1SV5B 2RDJA 2GGPB 4WFBQ 3NGTA 3A4TA 3T1HJ 1F9EB 2V68A 1B7YB 2ZH5A 3BO4A 2WONA 2R7RA 1N8RT 2RKIB 1FKOA 1KS2A 1WHXA 2FHOB 4CIOA 3G71S 5J2NB 1OQ3A 5BXIA 3ILJA 4X62J 2KXFA 4ANCA 1VBKA 1TK8A 2JOQA 1TMMA 1T05B 1IM6A 3TUIC 2KZZA 1EETB 3R6LB 3J7YI 2VJUA 2HHHF 1RT1A 4OLPA 5G0RA 4HDGA 4UTGA 1TL7A 3KTQA 2XHCA 3U1MA 4NXMF 2HGNA 3MAAA 1CC7A 2BZ2A 1RGVA 2LXUA 2CXEA 2KYXA 5HVHA 3DCAA 1IQZA 2M2BA 3DRXA 4FXVA 3TEGA 2A2DA 4NYPA 2XMJA 4F26A 4GMKA 5E3RA 2YWHA 2KT2A 3V6HA 4DV4J 2MTLA 1F2GA 5HQLA 1UAWA 3G8SA 1P9YA 2N3LA 4IO9Q 4RW7A 4OZNA 2CIMA 4NLRA 1RUSA 4KKOA 3CCZA 4Q7AA 3KXDA 3T9ZA 5C25B 2ZD1B 3KOAA 4CLUA 1IBCB 1WOOA 5BR8J 4NLPA 3SIPB 1NSKL 3CC2S 2AJ2A 1NJWA 2J9CA 4OI1A 2FZGB 2UUCJ 4DQSA 1OPIA 4P7TA 2G1HA 1T9VA 2Z8QA 3L95X 2NXUA 4OV6A 4X4VA 1OJ4A 5J1PA 5DO2A 5HL7Q 2CJQA 2LP4A 2WW8A 3GCXP 1S5ZA 3M2UB 3HHNB 4MJKA 2R8KA 3M9OB 2FY1A 3HHEA 3MPDA 3IG1A 4DSIA 3US5A 3GFYA 2AJ4A 4RNFA 1OSCA 3FEYB 2R8IA 3JAMU 1J5OB 1TU0B 2YNIB 4KGZB 3I96A 4RO0A 5AJ3F 2Z30B 1MROB 2DNGA 1LQ9A 2AYGA 1HR0J 2DH7A 1REGX 1NDCA 4LFAJ 2I6WA 4KH1B 4RUCA 1HMVB 2PFFB 3FDSA 2QLXA 1YJVA 4PG4A 3VV2B 1IR1A 1LW0B 1YIJS 1IQTA 2XY6A 4RW4B 4OZ0A 3D0HE 2B9WA 3N5FA 5D0EA 4G3IA 1IR0A 4LFBJ 1TP7A 1M5SA 4YP3A 3R1LA 4AD6A 3I5AA 4RUBA 3E3XA 1V6HA 2DEIA 3IAS9 1H2VZ 2J9EA 2OSQA 2W8KA 5F8JA 4MKVA 3BYPA 1R3NA 2DBBA 4GVBB 2MXYA 2EXUA 2QL5B 1VYAA 3DXBA 4KYZA 4QPTA 3HZEA 2HZVA 4J5OA 3MECB 1WF0A 2F9DA 2G13A 4NI2B 1XJWB 1HBOB 4Z7CA 1JLFB 1KQKA 2HFUA 1WG1A 5CH7B 1CJTB 2VZ9A 1RKIA 1S9GB 3KG1A 1KP6A 3VCDA 3NOGA 1FDDA 3BKTA 4F3OA 3ADAC 1HPZB 4C48A 1GXLA 3AHPA 3G8TA 1RKJA 1WSRA 3CIZA 1LK7A 4DI6A 2LMIA 1T7PA 3DRRB 1F5BA 1YRUA 4OX9J 1JLGB 2AT1B 2RU9A 3BB5A 4WPAA 2ZUAA 2YNHB 2RUSA 2E5HA 5KG3A 4I64A 4FNHA 4IFYA 4ZN1A 4OJHA 4C11B 1IBLF 2J0QD 2H9ZA 2R3VA 4ZCLA 4NL5A 2DNRA 2FYXA 3OSNA 2VA3A 2I9SA 4DR3F 5E0OA 1MMLA 3IA0A 2XZWA 1AUDA 4USKA 3IWNC 4ZPCA 1RLDA 3V5RA 1Q95G 3MM7A 2O3DA 4DV5J 3UVJA 1SL2A 1KSPA 1ZBTA 3AXMA 3PYDA 1WC0A 2DXDA 2BJ7A 4R5PB 5E3CA 2FLOA 3I4HX 3JS9A 5B0AA 2WZ1A 3TQ1A 1SUQB 4LJMA 2CQHA 3MGJA 1QY7A 5F3TA 4M5GA 1Q86T 4M8LA 3PEHA 2GVZB 1IKXA 2YKOA 3EGNA 3H90A 3G8QA 3RB4A 3HHLB 2CPJA 1OYDA 3DFEA 3O1LA 1UVJA 4ED7A 2FJAB 4I2QA 1BUXA 4RW6B 2R8GA 3H5YA 1RWPB 2IC3B 1ULRA 2WW4A 2RRAA 3KKFA 1RZMA 2R8JA 1C0TA 3IO1A 2R7QA 4DL7A 1KVIA 2HBYB 2ZVSA 3OVBA 1HL6A 2XLKA 1MWZA 4QQBA 2HHSA 1HYSA 4DOZA 3CCRS 1VMBA 5B0EA 5EN1A 2QZ8A 3MEEB 4TQRA 2IMOA 3GB0A 1HBMA 5GADU 2IYIA 1KEKA 1WEZA 4A8XA 2AWZA 3W5ZA 2YPYA 1CSJA 4ICLA 4YS2A 1D8ZA 1IVZA 5DGAA 2V4QA 2R7UA 2KDOA 3LPEA 3MR6A 4CLPA 3H8YA 2COLA 4DUTA 2WBMA 1QAJA 3TR5A 4M5JA 1S7IA 3CVKA 1GK8A 2K1RA 2Q79A 3K8VA 3GV8B 1VRQC 5AXLA 1JX4A 5EUHA 2I38A 5A0YB 1KTQA 5KFHA 1YKWA 3RBEA 2ROGA 4URSA 4F36A 2C42A 1WTFA 3PEJA 4I68A 1MW7A 3GCWP 2XB2D 3KLVA 3SQGB 2HEKA 2CDQA 2VH7A 1NXIA 2UZAA 2Y8YA 1UZDA 3TVKA 1CJKB 5DG7A 2WVBA 2HBQB 3L4BC 3UDVA 3D0GE 3HK2A 2F65A 2BRLA 2Y9HA 4JB8B 2DRDA 5GAHU 1FRHA 2B56A 3IR7B 1F60B 5I3QA 5DS7A 2WOMA 1NU4A 4FF4A 3QZ7A 4FNIA 1RDRA 4C3LA 4IR1A 4NCGA 3M8PB 2D69A 5K9FA 3WX8A 2F8EX 3KLFA 2J5AA 3SCKE 5LMUJ 3DM2A 2WVCA 3QATA 2OI2A 1HBNB 3QLHA 4F3MA 2HRYA 5DZ6A 3MEGB 1UFLA 4USHA 3RRKA 4M5LA 3BBCA 2WB4A 1GXUA 1R43A 2LLZA 2XYPB 2YKMB 3MM9B 1AW0A 2GO8A 2ASJA 2L9WA 2BANA 3W3SA 3M9NB 3THTA 4JI7F 3WBZA 3L3CA 5HROA 3TA1A 4HI2A 2GA7A 3T41A 4Q2MA 1KNZA 2FVCA 3GIMA 2BR0A 4DX5A 1UL3A 4ITSA 2ZH4A 2VD3A 3MR7A 4CTAB 1WKLA 3D2WA 4N5SA 4PQUB 2ZZMA 2MSSA 2F9JA 1Y5IB 5MAOA 2HQDA 4FPRA 3PRBA 3LO3A 1RT6A 1RK8A 4LIWA 1E6YA 3CJ4A 5HQMA 2DGOA 1N52B 3BQ0A 4B3SJ 3G87A 3OJSA 4U96A 1N4LA 1FK9A 4JI3F 3PFOA 1ZAVA 3M8WA 4TNOA 2ZEJA 5A8RA 5IQ6A 2XMTA 4G1QB 5HMXA 3NEKA 3GIIA 3IXQA 3WC2A 4DV7J 4DSKA 3A8IA 2FHJD 1I1GA 2HNZB 3AD7C 3M30A 2QA4G 1RHUB 3ISZA 2EKYA 3LH2S 4MT1A 4G1IA 2A3JA 1VQYA 4DV0F 2LXFA 4PKDB 4ZJOA 2F8HA 2QJ3A 3KK2A 3DU5A 5EGYA 4ED3A 2A2CA 4UUXA 3WX4A 1N32F 1T03B 4X64J 4J9PA 3MCSA 4ID5A 4WCEQ 2DCUB 3A8EA 2Q1LA 1PBUA 4MKAA 4IR9A 4DSFA 2CJAA 4IH6A 3FBFA 5K14A 3FRZA 3M6XA 5LT5A 5AE1A 3MOJB 5KAKA 2HS3A 2QX0A 2KYZA 1LFWA 3FFIB 1VFJA 5GAGI 3G86A 2QYCA 2L3MA 5DDRC 3MMCA 2FZCB 4DR5J 4WYWA 4UZBA 1SI9A 5IT9Y 1KLNA 4HH0A 5EX0A 1RABB 1GNKA 4USIA 3V6DA 1ACMB 1S1VB 5F8LA 4B3MF 1LWEA 4C6AA 1FRKA 4KGMA 2BKPA 4RBVA 4OI0A 5LM7E 2POKA 2H51B 2QFIA 3IS9B 3AY0A 2ZH1A 4O4GA 4KHRA 1FCAA 3IC1A 1UJ5A 1NK8A 3CO0P 1CC8A 2HMIB 2NS1B 1JNRB 4WE1B 4CRJA 1SC3B 4DU7A 1MNEA 4YQWA 1IJEB 3MTKA 4LSLA 1U0HA 4JP8A 1X0PA 4FS1A 3SI8A 4OL8A 1KONA 4K2XA 1X4GA 3CDBA 4DUZJ 1MN9A 5F8HA 1KHVA 4K2JA 5H9FK 5KFWA 4I6AA 5KG5A 4X62F 2Z2ZA 1SIWB 1FI4A 3B4DA 4QWBA 4DBQA 2VUGA 1A9NB 4GRSA 3HLUA 3IRXA 3UPFA 4UQTA 1NDPA 3Q8RB 2J0XA 2VQEF 2LQ5A 2GAHC 1HARA 1TK5A 4P2FA 3NBPA 1DQ8A 3ETOA 5IFMA 5HBMA 3R7SB 3M32A 1IKYB 1TQLA 1W25A 4DV4F 1HI0P 1JLAB 4DG1A 2MZQA 4QWDA 4TLQA 3I31A 2YX7A 2R7OA 3HVWA 1N36F 4JI0F 3DGPB 5LXYA 3T9NA 2R7VA 2LQBA 1WF1A 1S6UA 2WTFA 3VQSA 2U2FA 2J8SA 2DR8A 3W63A 4WTOB 4QR1A 1FXDA 5DDQC 4DL4A 3EE3A 1V5VA 2C3YA 3AQOA 4UY8T 4MIBA 5D0RA 2RQ4A 3I56S 2IBKA 3TZXA 4PUOB 1QAXA 3CD7A 3AA8A 4HR2A 3H59A 4OYZA 1KVKA 2OPRB 2XQCA 3OTCA 2JEIA 2MY7A 2DR5A 1JLBA 2K3IA 5LOQA 2XMKA 1REVB 5JXSA 2MQPA 1R7IA 4N47A 3PRVA 4FF3A 4RUHA 1T3OA 3LP2A 4A8WA 3UD3P 3KUGA 2IFXA 4O3RA 5GVQA 5T14A 3BBBA 4NA1A 4TY8B 3PW7A 5FJ4A 4B3TF 1RT7B 1S9EA 4A8QA 2ZZTA 3X3UA 3HVRA 1HR0F 4NCBA 3T1YF 1SH0A 1AZSB 3IRWP 4LFAF 2J8AA 4PG5A 2FUG9 3HFVA 3CDEA 4EBDA 5D4PA 1HNZJ 4R25A 1XIQA 3I6PA 3MDFA 4DR4F 1VBXA 4CLTA 4KQZA 3MM6A 5C42B 1R6YA 2OTLS 1XR6A 1AT1B 2ZH3A 3UD4P 1T11A 3GG0A 2UUTA 2HQIA 3K7RA 4L75A 3T5KA 4K5RA 3R3TA 3FUYA 2ZBPA 4YR3A 4X4RA 2VBWA 3LW5C 1H7XA 5D8HB 2AJFE 4E0DA 1U6ZA 2CPYA 4B02A 4CLKA 1S48A 4YR0A 1YI2S 5J2QB 4NCAA 4WIIA 3OR1B 3H2LA 1IN0A 2VPWB 1Q81T 5BYSA 1PBAA 4H4OB 1QVFR 1TV6A 3BN7A 4OHZA 1NJZA 1JLQA 1OY8A 1A6LA 5D3GA 3IM8A 5LMNJ 3H0PA 3HHKA 2X7IA 7FD1A 3DLGB 2EKNA 4CO0A 1FJ7A 1YBTA 3JTPA 1YG0A 3NGDA 1TR0A 4Y0FA 2YKQA 3SMZA 2A18A 3QRRA 5IT9U 3PIOQ 2HNYA 4CM2A 1RAAB 2WSFC 3MCNA 3EPGA 1R0CB 4YR2A 2VFTA 3BKFA 1EHWA 2XI2A 5C24A 2H3EB 3CJ0A 2HAFA 4P2XA 2ZBIA 2XI3A 2HK2A 3SSQA 4PQAA 4ZVPB 2CUYA 3BYRA 1IJFB 1CS4B 4B9NA 1UVMA 3EJMA 4PABA 1RT5B 2XS5A 1S6OA 4YMEA 3QBCA 1SQEA 1RI7A 4NLOA 3N4WA 1N5SA 4DV1F 2IRXA 5IZHA 1EQMA 1FDAA 3U27A 5H9EK 2BMBA 4QYZJ 2MKSA 2JEFA 3OBIA 3GFXA 3CJQA 4WK3A 2YNFA 1M90T 2C2NA 2EBGA 3CXCR 3LAKA 4ZK7M 3M8QA 1K73T 1TKXB 5A2QY 3KHGA 6AT1B 4BC9A 5IT4A 5KT2A 4P74A 1GFWB 3PKYA 2YX1A 2ZWOA 1FJGF 5EDWA 2EK1A 2OPPB 3E01B 4C0OC 1TKZA 3VGSA 3L9ZA 1VRUB 1QUVA 2VV5A 1QE1B 4P10A 1FD2A 1VHFA 4ZOSA 2QN6B 1QSSA 1HKAA 4TU8A 4F3QA 2AZ1A 2CNNB 4WFAQ 4ED5A 1SL1A 3NAHA 2UU9F 3J7YU 1WHVA 5KFJA 4A8KA 3K59A 4LRBA 3TYTA 3C19A 4IG0A 4ES3A 1YTYA 3FCHA 4IG3B 1RACB 3LPYA 1UFWA 4A8OA 3GONA 3W62A 1G7CB 2W9CB 4HHHA 4OYWA 2W9BA 2VPYB 1U7LA 3PJ9A 4DL0C 4WFYA 3MMJA 3OXGA 2OPSB 3V4MA 1U24A 2W7OA 4PPDA 4YDXA 2RDDA 4ECYA 1F0XA 3OQ2A 3SEOA 5F0UA 3THVA 3EM1A 3B54A 4M5MA 5L8RC 2WSCC 1BWEA 1I3OB 1OO0B 3I55S 4KRWA 2C2EA 3KLIB 3OTOF 1RT4A 3CTRA 3W66A 3M8RA 1Q8LA 2JX2A 4R0EA 2BX6A 2WHOA 4DF4A 4XIUA 4X65J 3OSPA 2LA4A 5E7OB 1S79A 2H5JB 2GJIA 4DL5A 2BJEA 2W2PP 2IM3A 4G1PA 3FSYA 2OKQA 3JB9k 4YB5A 2VA2A 3A3PB 2E5GA 3E2EA 2GNKA 4NMLA 1LWFB 2DK2A 3BM7A 3OVAA 2YNGB 1VQNS 5F3ZA 5J2MB 4ZHRA 5CZVA 4A8YA 4K0KF 3BGOP 1DTQA 3FCVA 1NH7A 3ONQA 2CG4A 2Y0SD 3OFEA 4AT1B 2VASA 2E9TA 1RAIB 3V4IB 1FRLA 1WHYA 4O3NA 4DX8H 1N34F 4ECQA 1ZM2A 1RTHA 4JV1A 1FRMA 4KJIA 1GH8A 1QM9A 1YJUA 1S6QB 4GKKF 2C2DA 4ZVEA 4B9UA 2AF6A 2KT3A 2XCPA 3ILOA 4J9VA 2IM0A 4AL6A 4LF6F 1FKPB 4FVMA 2D9OA 3AFGA 1X8DA 4K7QA 1HQEB 2UP1A 1I6JA 2OGUA 1Q79A 4CI0B 4A8FA 3PYFA 2J9DA 4N7TA 5E2QA 1WELA 3H5UA 1KWMA 2GQCA 2GMLA 4M95A 1NMEB 5KT6A 5FDLA 4U9RA 1S9FA 1B0VA 4KR0B 3ZTOA 3W65A 2R2TA 3PX0A 3X1LB 5AXMA 4PYAA 2OPQA 2EFPA 3EMTA 1MWQA 2DHAA 4WJBA 2D3O1 2I0XA 1PAUB 3CCSS 3QO9A 5K8OA 3CMQA 2V4JA 4WF9Q 1T95A 2CQ4A 1KFSA 4NYZA 4TKTA 2ALYB 1IBMJ 1VC5A 2YVSA 1RWOB 4X66J 4LRDA 1UVIA 2WB1D 4CLYA 2EC2A 2OEMA 1ZM9A 2ZOMA 3CJ2A 1H72C 1UJ6A 3VTIA 4LFCJ 3D68A 1X9WA 2KVQE 2OLWA 4ECVA 3QIDA 3TVZA 3S7RA 1T3NA 1IBKJ 4LF4F 1N6QA 1CULA 1JLEB 4FKXA 1D9AA 2XY7A 2VPZB 4YDDB 4QWCA 2ZOGA 1GMVA 3B4MA 3KG4A 1HI8A 2W4CA 2R7XA 2XY5A 2NSCA 5B0GA 1BD6A 1NB2A 1HQUA 2Q43A 3L7PA 2DRBA 1G4CA 1YZ7A 4ZIWA 2OEKA 3OXLA 4MK8A 2DNLA 1OWXA 5A2QU 1JXLA 4CO4A 4LQ3A 1KFDA 5E3AA 2JJ4D 3IBFB 2CJ9A 4CLLA 4OZ3A 3ZC4A 1B0PA 5A76A 2QL7B 2CVEA 5ADZA 4ETZA 2YKNA 2VODA 4CDIA 1IWGA 1WC3A 4B3RF 1NBEB 5DLFA 3GR0A 3DOLB 1U1OA 4QU6A 3QRPA 4O4RA 4LF9J 3CSKA 2MKIA 3BGUA 4DSLA 3CPWR 5RUBA 2ZHAA 1X31C 1BY9A 4OYIA 4FBTA 2CPXA 5CYQA 5B0FA 4YN3B 5M2UA 4U7UK 4DUZF 2AJ0A 4Z2XA 3M8SA 3TJAA 4ZIVA 4B9TA 1S4EA 2HLUA 2YWKA 4NMXA 3C66A 4IDKA 1HNWJ 3VF0B 1GMWA 5IV4A 2KM8B 4UY85 2IIHA 2FVPA 2YWEA 1PJ6A 4OI4A 3KJVA 2DHSA 2AP6A 1F1BB 2Q6CA 4LF5J 2D7SA 1UWAA 2EC0A 1TKTB 4CWBA 5IM0B 4NRTA 3VAJA 4H54A 5E3PA 2MHEA 1XNQF 5T7LB 1PGZA 5KT4A 4DQQA 5J1NA 3K8WA 5J1EA 1RT2A 1TK0A 2ASLA 2V6AA 3R97A 3J80Y 3GU0A 1TVRA 1NSAA 2AZ3A 1WI6A 3FZ2A 3N6LA 1MU2B 3N9UC 4LRAA 3HSGA 3I4PA 4Y3CA 1Z2ZA 4J91A 4DFMA 2HWIA 3RBXA 3MD1A 3FEZA 2Y1LB 1S1WA 3VGTA 1RWXB 2JRSA 2F5GA 2V2ZA 3W2VA 5L1JA 4CO5A 1NPKA 4P6QA 1KTVA 4TVAB 3O3LA 1L3VA 3TAPA 4CZCA 2ZM6J 2PMWA 2LQJA 3U7JA 4FS2A 5E41A 4ZVUB 2FJWA 4GVLA 3TA0A 3T19A 1PC5A 1WTBA 1C4AA 4B3OA 2DNNA 2MZTA 3VAMA 3T6JA 1PIEA 3TZYA 5I3UB 4RLEA 1BWVA 4LREA 4RR5A 2AJ1A 5CABA 4QIEA 3K5OA 2MY8A 2CQ0A 5HQ8A 2ZBRA 1X5PA 3DLKB 1WC1A 3G82A 2KI2A 1HNIA 4X4NA 1EB0A 4NLUA 2XZTB 3MMBB 2HPUA 2B51A 5KFYA 3FK4A 2VDHA 2B4OA 2IVYA 1C0UB 4W98A 1EIYB 1S1UB 1BQXA 2ZKUA 4ZVQB 4RW9A 3OUYA 1I51B 1YVFA 3IWXA 2PFDA 3NCQA 4WZQA 4C8MA 3BV8A 1RTJB 2UXBJ 3EWGA 3OL7A 3RBDA 4DL2A 4NEZA 3W2WA 3NNCA 2DGWA 5K8PA 2W1BA 1KQGB 5GAEI 4DV3F 5HMZA 3DYAB 1YZ6A 2YXLA 4QIGA 2XTJP 3V81B 4RNNA 1XMOJ 4BS2A 4WWSA 2GAGC 5DRKA 3ZTPA 3KLGB 5I42A 3DOMB 1U25A 1SC4B 1PO6A 1NAQA 2ZITA 3HZGA 1FVQA 2QG9B 1Y5LB 3A8JA 1TL1B 2FJXA 3PM9A 4ZITA 3JYTB 4JI4J 3J7Z5 1WUUA 4ZLNA 1DY3A 5DGBA 1HNVA 3K5PA 2ZNYA 3NS7B 3AD9C 1X9SA 2PA3A 1IKVA 4OJ3A 2FVSA 3H4DA 3K5LA 3HPOA 2QA2A 1RTIA 2M0GB 1X9MA 1SKUB 2Z2YB 6FDRA 5DQHA 3M2RB 2OD6A 4HT5A 4ILLA 2LKZA 1MMDA 2X1BA 3HFKA 1JLCA 5HO4A 3I0SA 3MUVP 2B5JA 4KPYA 3FMWA 2KXNB 1LWCB 1RBOB 2H54B 5HP1A 2V9KA 4J9LA 4M5DB 1XNRJ 3TANA 2V5HG 3PX6A 4DXLA 4OJ1A 5KFOA 3QIPB 5F0WA 2FJBB 4K8RA 3ET6B 1DAXA 2UVRA 1HWIA 2VL1A 1J2VA 1TAUA 3ZZTA 2I2YA 2D1CA 5GAGU 1YLXA 2V8GA 4YFUA 1S77D 3HO1A 3HVTB 2E5LJ 5JVGQ 2RUGA 2G4BA 3DRSB 1B4SA 4M5IA 2KXHA 2Z2MA 4HACB 3GPAA 1YITS 2IAJA 2AX0A 3NL0A 5DJBA 3BPSP 3EICA 5DETA 5KOXA 3L09A 3MM5A 4QIFA 4ENOA 4I2PA 2RB7A 4ZPWR 1DARA 1OMSA 4P71A 4MH8A 1A0OB 3DI6B 2ROEA 5D0HA 3RZAA 5J2PB 2JEGA 4Q43A 4L6V3 4EEYA 2CA9A 4ECWA 4ZMMA 1NSQA 1ZA1B 2B4UA 3CUNA 4U8YA 1QTNB 3THPA 1CEZA 2EFOA 3DXSX 2QMWA 4PG8A 1ZPVA 3T1AA 2VG7A 1PJ5A 4TLRA 4C8ZA 3ISNC 1CJVA 3V81A 1LNQA 5F9NA 4KSEB 4KO0A 2M7SA 2BXJA 2VC0A 1JWWA 3J80U 4P9SA 1VI7A 5IS2A 3NAIA 3TJ9A 1NJXA 2CPEA 2E5IA 1J5EJ 4UOCA 3TA2A 3SDEB 4Q8EA 1UJ4A 1KR4A 1U8SA 2V8HA 3DLEA 2GJ2A 1Q16B 4WKRA 3KK1B 4KHMA 1VCTA 4XAKA 4OYXA 1E6VA 3KHHA 2XMMA 3DOKB 3QSIA 2RSQA 3IAM9 4IO1A 4JV2A 2ILZA 2C3MA 4YB6A 1U49A 1YQHA 3DDIA 1SB6A 1VK3A 4K4YA 2EI5A 2VG5A 2XYGB 2L41A 4A47A 2MZJA 4J9QA 1V3RA 4DN0A 2QLJB 2ADBA 3QIPA 4ANDA 3G6ES 3C16A 2I5JA 2P9CA 2V2VA 1HD1A 3CJKA 1V5IB 2VONA 2PDAA 1TAQA 4Y00A 1FE4A 3OV7A 2LU2A 1X5SA 3KNGA 3CC4S 1RTDB 1X60A 2CYYA 3Q22A 1LXNA 1UEVA 3JSMA 1SL0A 2GMJA 1RHRB 1Y9OA 4F02A 4LSZB 4NLYA 4DCJB 3ILLA 4DR7J 1YSJA 4NPOA 1RWNB 2BE2A 2YBVA 3DMJB 1DLOA 2KM8C 3LP1B 4O44A 3BGRB 4RNHA 4WP9A 3TX0A 3N6NA 3R27A 2R9LA 1RYSA 1DTTA 3PW4A 2CJKA 1PSDA 2G2YA 3UCUP 3P5BP 3KDOA 1X4DA 3DRYA 2X3DA 1WKKA 4AFFA 3NNAA 1SJ1A 4CYUA 4RKUC 1VLYA 4WIQA 2BVZA 1R0BG 4DV6F 2RRBA 1D9FA 2E9RX 5KG1A 5KFSA 3NWGA 2KHDA 2DISA 4GC7A 4ZLPA 3NGSA 1C1BB 2WVEA 1EP4A 3NXZA 1QSLA 3QWUA 4WU3A 3DLLQ 2WVDA 1HHQA 3SXLA 2Z2LA 3L7OA 1SQGA 2Y1RI 1X4CA 2DGUA 2E29A 1UWBA 1YRTA 4QIWD 4NA2A 2HNDB 2AGPA 3J7AN 4DU8A 4F0HA 1UEKA 3MR2A 5B7WA 2VQFJ 1RWMB 3FKBA 2G0IA 4WYLA 2V67A 4AQYJ 1TL3B 3TZZA 4K4XA 2H4WB 3PO5A 1KLMB 3BR9A 2DH9A 3DDKA 4GO7X 3SCJE 3UCGA 3MEDA 5M2RA 5AXKA 3UD5A 3Q8SB 4K4ZA 1NK6A 1YJTA 1P8GA 4J9UE 2HIQA 4AXJA 2P6TA 4KC5A 4C8KA 1W26A 4G65A 4LFCF 2PT0A 1X4FA 5HVFA 4WBFA 3AXKA 2CPIA 5HAOA 1FFSB 4O3PA 2XO7A 4Q45A 2BEFA 3CE8A 5HMWA 4N8NA 2AHOB 2RILA 2DPJA 5HLFB 2A6MA 1H3DA 2KRBA 4EI2A 3TAMB 3C6UB 4TXSA 4FXWA 4DN9A 5AT1B 4L3NA 1RP5A 3GIKA 1XTZA 2QFJA 3NMRA 4P72A 2BJ9A 5CYMA 4RW8B 1FJCA 3CCLS 2EK6A 2OFHX 4LBHA 1M1GA 2BW7A 1S10A 2MDAA 4DSEA 1Q5YA 2HK3A 4JV5J 2XLJA 1WDDA 4PWWA 1ZZNA 2VB6A 1VQ8S 2KJVA 4ZPVR 1LW2A 2IM1A 2X3GA 1BQMA 2FLLA 3KLEA 2YWGA 2J9DE 5CCLA 1ZS6A 5ITHA 2WAQD 1X4BA 3HSDA 3Q2TC 2V69A 1QLNA 4DMZA 2AMCB 1I94F 1HW8A 3FQLA 1L3SA 2W01A 2EWHA 4MIWA 3RR8A 1QAIA 4LF8J 4RBUA 3CWJA 1S1XA 2KH9A 3U02A 4J9RA 4IOCQ 1N88A 5F41A 3DC2A 2DIVA 2J6SA 2IBOA 4DZ6A 4M5KA 1S1TA 3D6MB 3QMQA 4BWJA 2OIHA 2E1MC 3ITHA 3MZIA 2GO9A 2LEAA 4OIXA 4LF9F 2AV5A 4U6PA 1IKWA 1N33J 5LXRA 4UZCA 4NASA 4LF7J 2ADCA 3I0RB 2XHWA 2ZBCA 1D8YA 3BGFA 4KV8A 4KE5A 4BDPA 2JNJA 2L48A 1VJQA 4ZP6A 2MLXA 4RBTA 4O3SA 1HNWF 1JKHB 1T9UA 4ZVTB 2X1AA 1HBUB 4I6YA 3K89A 1T9YA 3QNWB 1W2BR 4WP8A 2HQGA 1FO1A 3QT8A 2AGOA 3T6BA 2G0CA 4LF5F 4HDHA 3ZZRA 8ATCB 1W7WA 3LGMA 4OYPA 1F3FA 3IGVA 1OPZA 4HHJA 1CJUB 3VR1A 1WEYA 4CO3A 2HWTA 1DQAA 3HDSA 1VRTB 4ZJQA 1FRJA 3CCQS 3CJTA 3GQCA 1WF2A 2RT3A 3UR0A 3AB2B 1M5HA 4DR1J 3PW2A 2DPIA 4OZ1A 1S6PB 1NKEA 3VGUA 1Q8IA 2Y3YA 5ETRA 1UEUA 3M2VA 1U4BA 1BQNB 1KHWA 5A8WB 5DZ7A 2P2CB 4IH5A 2RJZA 2DNKA 2LVWA 1FA0A 3MURP 1LFPA 4Q0BB 2GVDB 4MFBB 2O1PA 1L3KA 1A7GE 3DLJA 1AROP 1VIXA 1BC6A 4DR2J 4X84A 1YJWS 3PDNA 3R9LA 3MCMA 2KZMA 4ILMA 3IWLA 3MMAA 3KDNA 2FDNA 2VICA 3KK3B 1RWKB 3Q23A 3WIVA 3BSCA 3JQKA 4DFKA 1K9MT 3C14A 2JC0A 1VQ9S 3HULA 3ZFVA 2BOAA 1Y3JA 4R8UB 3H98A 1UZHA 2AU0A 3C6TB 3RW6A 4PYDA 3QAEA 1N48A 1GMWD 3N28A 3K17A 1NJYA 3PIPQ 3KFWX 3C15B 2J6UA 3W5XA 4IFVB 5ETNA 3SV3A 2JVOA 1WOPA 1AB8A 4ZPTR 2AW0A 1SV5A 2GGPA 2LECA 2UV8G 3UI3A 1FFWB 5DG8A 3HX9A 1Q0NA 4NZ6A 4KTQA 3PYGA 2HHHJ 1APSA 1FD8A 1U1RA 2RKIA 4I67A 3LOUA 4NXMJ 1HQ2A 1C4CA 3AA9A 2KL8A 2WCXA 5J2NA 3UQSA 2IA0A 2HHPA 1F5AA 4C8LA 1ZAWA 3ZZOA 1H0HB 3POTB 1T05A 4RWXA 2XGQA 2DR6A 2D9PA 4I1TA 1EETA 2NLWA 3HSJA 3OHBA 4QJVA 2IMWP 1MSWD 5IOLA 2OH2A 3BDPA 1RCXB 1CQNA 5A6WA 4J9KA 2HHUA 2LEBA 2DGVA 3BF4A 3PYEA 2NUHA 4C98A 1K1QA 2UUWA 4CT8A 1Q8BA 5KT3A 3W8PA 3MPUB 1WDTA 1ZM4A 1VRTA 4MAKA 4RWWA 3CJ5A 1RA7A 3ENQA 4USTA 1BE4A 4N8OA 5KFKA 1FXRA 4W90B 3M1VB 1URNA 3IFEA 3QFHA 3G6YA 3EZOA 1UPPA 2YH0A 1V3SA 4EUVA 4UOFA 3CJ8A 4B9MA 4W92B 5B0CA 5C25A 5BYRA 1N5YB 5HVGA 2QMUB 1Q1KA 2ZD1A 4UOGA 3QYYA 1RHMB 4U7CA 2HYIB 4KHPF 5I3PA 5EWGA 2KJWA 5B0DA 2DXFA 1IR2A 1RHQB 3OR2B 2YWWA 2QMXA 2F63A 1G3OA 3M4XA 4UT4A 1PG5B 2R4FA 3VVTA 3W5YA 2N4CA 4JI1F 4QWEA 3AH6A 1HHTP 4K59A 2EG1A 1XNRF 3I5CA 3P49B 4CLSA 2VKZG 1UA1A 5AJ3J 2KHCA 3M2UA 3DLHA 5KFCA 3GV5B 3EZUA 6FD1A 2UXCF 1WC5A 1P6TA 2RS8A 2AEMA 1J5OA 2E5LF 3TAQA 3I9ZA 2YNIA 1MROA 1NHKL 4BHQA 2Z4PA 2HG4A 2VBYA 1VQPS 2PI5A 2GQ2A 2RD5C 3UN3A 4I7FB 1R8CA 3MM8B 4WXOA 1HMVA 2ZE2B 4L3KA 3JSBA 3GILA 2B8QA 3RUBL 3DRPB 1VQ4S 2GZOA 1LW0A 3LP0B 4NZ0A 2FB0A 4RW4A 3AB4B 3KHRA 2OUGA 2W4PA 1T8EA 4NWBA 2JH3A 3RTVA 1NDKA 4ES1A 5EX3A 4HYKA 1ZTWA 3RRHA 2ZH9A 1KKHA 1RAFB 1OIAA 4NLTA 1RT3B 2FHKA 3D4JA 2HQCA 4GVBA 1RAOA 2F1FA 1XWLA 2MGZB 1SH2A 3MECA 4NI2A 2XWXA 1IM4A 2BQUA 1VJWA 4LR8A 1HBOA 1JLFA 1CJTA 1XERA 3HHDA 4HLBA 5FD1A 1Z1ZA 2XM3A 4IYQA 3PCOB 4ZP8A 1S9GA 2ZDPA 2IRUA 2PEBA 5MLCV 3D1QA 1HPZA 4LRFA 1ZYQA 2VIHA 2ABYA 1RBAA 5ETOA 3DRRA 1H7WA 2J76E 4O0IA 2BJ8A 1JLGA 2AIRB 4G6VB 3HI9A 2HWHA 3FC9A 2DGQA 2XSFA 5KFPA 2YNHA 4Y2IA 4DR3J 4C3KA 2BACA 4V1Ak 2IJFA 1N54B 5KFTA 2H65B 5ETVA 3FBEA 3W64A 1T94A 5IC6B 1NEEA 2MQMA 3C8YA 3CJ3A 4C11A 5EWEA 2XGPA 3HP6A 3J7A1 2E1AA 4C0BA 2ALZA 2YQ0A 3CIMA 3BPDA 5L46A 4OYOA 1K1SA 4TU7A 2V34A 3NGRA 5F8NA 2CQ3A 3OHAA 4NLQA 2CPFA 1VQOS 1Y5NB 2LEPA 3A12A 1RAHB 1TUVA 3IM9A 3LWMA 5CAAA 2JZ5A 1SJ4P 4DR7F 2XSJB 3IP0A 1TUGB 1ELOA 4PXBA 4H4KC 5D4OA 1ZA2B 3FBBA 4R5PA 3BH7B 1XC9A 2DH8A 4FXDA 3TVYA 1SUQA 1RLCL 1RXOB 3OL8A 3S6EA 4MMOA 2GVZA 2PMHA 2RF2B 3MTJA 5BYQA 1SC1B 3GG1A 2JHEA 4RU9A 3HHLA 1D3WA 5B09A 3K58A 1WD6A 2D3OR 4DCPB 2IPOB 4RW6A 5KFIA 2DR9A 3V6KA 1FRXA 4NEYA 1NM2A 3SZ2A 2IC3A 3PR5B 2XWYA 3BSAA 3B8HA 2O01C 2W2QP 5K5MA 4DFPA 2RDIA 2N7CA 4QIVA 1JJHA 2DITA 4O23A 1YWXA 2PGCA 5A8KB 4ECXA 2EG2A 3M7VA 4W4MA 1OY9A 2FJDB 1RAGB 3MEEA 3TP2A 2VG6B 1VBZA 3QZ8A 3H5SA 4TY9A 2QYGA 5GAEU 5KFRA 2LDIA 4FZVA 3OFFA 3KHLA 4EMDA 3R5DA 4AQYF 4YUDA 2FHMA 3I32A 4FBUA 2HURA 5CYJA 4Y6IA 1AYEA 3CCWA 5GMDA 5E5NA 2XBPA 1ZPWX 2Q3PA 3OL9A 1RWWB 1VDHA 3PACA 5KFAA 5K8NA 4B08A 1T02A 3ZZPA 5A0YA 2J7WA 3SSRA 4N77A 2FJEB 3BH6B 3C46A 1NSPA 3SQGA 4URQU 2OSRA 4DX6A 4DEZA 1CJKA 2F4VF 2CJBA 2B6AB 3BN4A 3HM9A 4FYWB 3AT1B 1UVKA 4PWDB 4LSNB 3LWLA 5AE3A 4DX7A 4YY3F 1R0AB 3GP9A 3JTOA 4CH0S 1GXTA 2DO4A 2V50A 4KFBB 2W7AA 2VHGA 4X4PA 3PVXA 2HSEB 3PHTA 3Q8QB 4OX7A 3GYXB 3M8PA 5LL6d 1NPPA 3FQKA 2X1GA 3UN5A 3NS6A 4ECRA 4JV5F 3MFIA 3BGLA 1Q7YT 3OFGA 1S0VA 3D7SB 2AQ4A 3CULA 2DNMA 2W2NP 1HBNA 2VBZA 4JI5F 3GMGA 3NOCA 4MKYA 1YX2A 4H4MB 4JI7J 3MEGA 4WU2A 2KVIA 3A3OB 1EZZB 3HFZB 4J9SA 4KBIA 2RMLA 2YKMA 4ZVGA 3MM9A 2DNHA 4PRFA 5M2PA 3KWMA 2PI4A 1C1CB 1WOSA 4X4SA 4DCOB 4N56A 3ZNUA 3PFEA 2OJ3A 4DQIA 4DPUA 4LF8F 1VR6A 1CBKA 3HD1A 1VQ5S 1FXLA 2DO0A 4CP5A 5DM7Q 2WONB 1FKOB 2MJNA 4C2MA 3K2YA 1OY6A 3OJUA 4QW8A 1M5VC 4F50A 4LF7F 4CTAA 1X0FA 3M9MB 3T1HF 2DGXA 4PQUA 3D67A 4JI3J 2JLGA 1CPZA 1RT1B 5G0RB 5C2GA 4NYOA 1GQEA 1ZAXA 3ZTQA 1TL7B 2F4FA 1S57A 3MAAB 3SCIE 2AX1A 3MPWA 3KMSA 1MN7A 1T9WA 4Z7YA 1YJNS 2K06A 4QCLA 2VFUA 3KLHB 2YKPA 2PE8A 4ZP7A 5L1KA 4DV0J 2UUBJ 3LAMA 3UCZP 4DPOA 4OYBA 3GJTB 3UDCA 4G1QA 1TUWA 4R0JA 3LALA 4J9OA 4NE9C 4IRCA 1F9HA 1N32J 2MKHA 5C2CA 2VPXB 4UOHA 2HNZA 2ATLA 4RW7B 2YY3A 3J81Y 1HIYA 4C4WA 1X4AA 3CDAA 1VBYA 2XMAA 4ECSA 5D78A 2Y1JA 2KO1A 3RR7A 4OHYA 2V8VA 4KKOB 3CCUS 3NS5A 5KFFA 1DHMA 3EYZA 4S0MA 1XMQJ 2KFYA 4KPCA 2GHPA 4FN5A 4DR1F 2IVFB 1FDNA 2MQOA 3KJFB 1R89A 2HHXA 2QE5A 1T03A 4PWUA 4U7UD 1ZTTA 4CLWA 4QR0A 2VOPA 1X5OA 2PC6A 3HHLC 4V19X 1H2TZ 1RYRA 2DGTA 3RYLA 3CC7S 3F56A 3K5NA 3FFIA 5BR8F 4USVA 3TNVA 1WG4A 4LT6A 3SV4A 4IOBA 5IV3A 3NCPA 2UUCF 5L9XA 1W2IA 3IG1B 3NWRA 3CO9A 3MPVA 1FJEB 2CAJA 1S1VA 3GFHA 4CNZA 4OZJA 4JYAJ 3J81j 3VWSA 3ZTSA 5JUMA 1JJCB 5D15A 5FIIA 5LSRA 2BQ3A 3AOBA 5DQIA 4LUBA 3P6YC 1WORA 3M6VA 2R2UA 1H74A 3IS9A 4QOTA 3P4UB 4E8UA 2QL9B 4M5NA 4RPFA 4Q8FA 2EFGA 1NB7A 2HMIA 2UVUA 3OW2R 2B43A 4RL1A 4WE1A 2V9WA 4LQ9A 2CDRB 2DY9A 3O5TB 3UN2A 3QRQA 5CD4H 2NXJA 1Q78A 2DNOA 1XBWA 2VQEJ 4ZVRB 1U47A 4ZLLA 5CA5A 3NNHA 3KLHA 4M63A 5HJYA 3SYZA 4QZVB 4MK7A 4DWIA 4P73A 2RU3A 4UUWA 2MLYA 2ERRA 4LFBF 4KGVB 2C2RA 3SSSA 1BHNA 5FLXY 4AXIA 1N36J 1BMQB 4JI0J 4D3GA 2VFRA 2BBEA 1JXVA 4QW9A 1BLUA 3Q8YA 4OZLA 1IKYA 2EVZA 1YGYA 2ZHOA 5HI7A 1JLAA 2KG0A 4LF2A 3RW7A 2Y1IA 4NA3A 4A46A 2FJVA 4M94A 1NUEA 2HRTA 3DGPA 1DZ5A 2HS0A 1HNXJ 3Q8PB 2M4MA 3C3LA 2ATCB 1Q8KA 4K4UA 3M6WA 1S99A 2E1RA 2GX8A 1NKBA 3FJ2A 4DQRA 3MCOA 4ZP9A 1RTZA 1JJ2R 3DHWC 2HHTA 3IN5A 1GX6A 4JBCA 1LKZA 3CNQP 1M0SA 3W8GA 4F67A 4HT7A 5KOWA 4PUOA 2PIIA 1IXKA 2HQ3A 3KUHA 1G2EA 4IFYB 3D5MA 2CNLB 1U2RA 2VC1A 3CEDA 4OX9F 2OPRA 1MWYA 4NLVA 5LSOA 3CCMS 3H42A 3G6VA 2E7VA 4WZMA 4DV2J 2GCFA 3WC0A 4DUYJ 4NXNJ 1EJ7L 1REVA 1K0TA 4EK2A 3Q0AA 2UXDJ 4B3TJ 4P2SA 2RQMA 3MM7B 1NLKL 1RJJA 3UVJB 4F4YA 4ATNA 3T1YJ 2ASDA 3H20A 2XLIA 3C2PA 2G0JA 3OFHA 3MUTP 4TY8A 1QVGR 2FIUA 3J7ZT 1LXJA 1RT7A 4DR4J 1IKXB 2YQ1A 4AYBD 4DV5F 3E51A 2GV1A 4LBIA 3GIRA 4OX8A 3N01A 2DB1A 4LVOP 1AZSA 4MK9A 1H73A 3V6JA 2LU1A 2O5DA 1U8WA 5IWAJ 4I2QB 2QA1A 3MFHA 3DHXA 1NKCA 2CQCA 1RWUA 2QGFB 1Q82T 1U1MA 3ZO7A 5L1IA 3MR3A 5C42A 1GT8A 1C0TB 3CB4A 3U1LA 3GE9A 1RAEB 3NRBA 1HYSB 1GEHA 3D1HA 4FP9A 3J81U 3BSOA 3H7HB 3T5LA 4NLSA 1NDLA 2RE1A 4EO8A 5H9FJ 2N7YA 2QLWA 4HHUA 1HBMB 3B78A 1WHWA 4USJC 2GC8A 3CJSA 4ICLB 5J2QA 1QAYA 3OR1A 2O66A 2V2KA 3GZ7A 2GHWA 4F4XA 4H4OA 4DDFA 1U1QA 2QLFB 1H2UX 1NK7A 2K1RB 1SC6A 3WQPA 4NRUA 1S76D 1LEOA 3M05A 2XMUA 3MF5A 3K0JA 5ETTA 2KG1A 2DVIA 3SQOP 2QA4S 4RNMA 1NH8A 2QEXS 3ZZYA 1F9FA 1XR7A 3EZ5A 2IVMA 3DLGA 1OQ6A 1NCLA 4Y2CA 1VIOA 1NHUA 4EZ6A 5HATA 3CD6S 3HT0A 2WSEC 2P9GA 4PEOA 5HK4A 3EX7B 2CVIA 4Q44A 3IBCB 1S4FA 1U2FA 4TYAA 1ZH5A 4DV1J 3DDNA 5KT5A 2EFVA 2BKOA 3TARA 4E98A 2QT7A 2MHNA 2WOMB 5HANA 5KFMA 3AOCA 3P96A 1CS4A 1YBUA 5F8MA 4NCGB 2K2PA 2C2ZB 2O67A 1LV5A 1RT5A 1M1KT 3KLFB 1UFKA 4PXDA 2M52A 4DSJA 3DM2B 1SIZA 2V8DA 3QLHB 3FBCA 1P1LA 3CMES 2PEHA 2CQ2A 1S97A 1FJGJ 2Z0GA 3D6HB 3GJQB 3SCLE 3R7NB 2B9YA 4PR6A 3EGVA 5LMUF 4ZVHA 3ZTRA 2BANB 1TKXA 2BE9B 2DHXA 4BC7A 1U48A 3E8OA 1N0UA 5HROB 2UU9J 1RE1B 2OPPA 4ZCMA 5FLXU 4K4TA 3E01A 2I8EA 3AQPA 5T41A 4O3OA 1VRUA 1QE1A 1RAJA 4RU2A 2JFKA 3AOAA 1NK4A 2GJFA 4ELUA 3QWPA 1SCJB 3D3CJ 1QJHA 3UNGC 4DZDA 1ITPA 4ES2A 5ETSA 1J27A 1RT6B 4LIRA 1SKRA 4DR6J 1E6YB 1FNMA 2P6SA 4YEAA 2UVVA 3MI7X 2YWFA 3O44A 3G96A 4N76A 1K8AT 4IG3A 2CNOB 2FVRA 1JK9B 3GSDA 3AAWB 4C9DA 1FK9B 4C7QA 4OFZA 5F9LA 1SBRA 2ZH2A 2W9CA 1P27B 1VS3A 5A8RB 2AYMA 2GS8A 2XYHB 3R6GB 2C22A 1LWXA 4QR2A 4CQ1A 2OPSA 3RG6A 5ETLA 1L5UA 1Y00A 3M30B 1SPBP 4DHVA 3PX4A 4B3SF 1UW9A 4HKQA 3ZXWA 5K20B 2X51A 2J7KA 3O8WA 3OTOJ 2VFSA 3OL6A 7AT1B 3VZHA 2J0WA 3KK2B 1U09A 2RQKA 4Y34A 4DV7F 2MB0B 1TMJA 4A48A 2HFNA 3TI0A 1KQFB 3KLIA 1JQGA 3ILIA 3GJSB 4ID5B 4GKJJ 3HMJG 3HHLD 2NYIA 4LBPA 1NK5A 3F41A 4NLDA 1VHIA 2PA8D 5K14B 4K0KJ 1HD0A 3QGGA 2ZNZA 1M5KC 3R5CA 1G6BA 4X64F 3M8ZA 2E7WA 2H5IB 2UV8A 4ELTA 1LWFA 3MMCB 1RCOB 3Q8VA 2YNGA 3VAKA 3P45B 1N34J 5J2MA 2N4DA 3HT3A 3CDWA 2GQQA 5CD4A 1TL5A 2AYBA 3MWBA 1QUPA 1DBDA 4U8VA 3V6DB 3OD2A 4GKKJ 2HW3A 1FDBA 2BA9A 1D0EA 1SJQA 1LWEB 2WK4A 2DHGA 3V4IA 1U1NA 4LF6J 4DR5F 4DPTA 1FWLA 3V2UC 1WJ9A 4NLWA 3UO0A 2CADA 1YRXA 3DGVA 5H9EJ 1YJRA 2FC9A 2VF3A 3OTBA 1S6QA 4O4GB 2MSTA 2LFVA 2KT5A 4AUKA 9RUBA 1S49A 3R5JB 2R7SA 4EZ9A 1FKPA 3F0NA 4LSLB 1XN9A 4M1KA 1U0HB 2SXLA 1HQEA 5ETKA 1RU1A 2G1DA 3KNAA 4ZS6A 1S12A 4M5HA 4C0HA 3HKZD 3Q8UA 5KG0A 1WI8A 1UVLA 1PAEX 4JI8J 2H48B 4ZN3A 2CNKB 2CQDA 3IRXB 2BDPA 4Q5VA 2IJRA 2BKNA 2RIJA 4PG7A 3RJMB 1T9TA 1CVJA 3NBPB 4NZ7A 1YJ9S 2HAIA 2MEWA 1YDLA 5HBMB 4ED4A 2W9AA 3IMQJ 4NOHA 2BJ1A 2UUBF 1RB0A 3M32B 4LF4J 4DG1B 2BABA 4K4SA 4C8OA 2CQPA 3U1NA 2JLFA 1AA1B 4HI1A 1KD1T 3W7BA 2JL9A 1MG7A 4I69A 3RRGA 4E2FB 1HWUA 4GO5X 4WFXA 3F44A 2V8PA 3IR6B 2IHR1 2E66A 1N56A 1QSYA 1XMQF 1JLEA 2DNPA 4PPZA 4TQSA 1SKSA 3EPIA 5EHHA 1URRA 2C2KB 1YHQS 2V4RA 2YQ3A 5LJ5Y 2WVFA 5IXUA 2M9KA 5KG4A 2DXEA 1S59A 2NSBA 2JLEA 1JLBB 1DQ9A 4B3RJ 3G9CA 4QYZK 2GFFA 1GTHA 2K8GA 4XDCA 3H4BA 4D3HA 3W60A 3LP2B 2OHDA 4KIAA 3DU6A 3AODA 2M8HA 2EFNA 5KFLA 3WZ0A 2D74B 3FZBA 3ENAA 1PYOB 1L3UA 4JYAF 5HSPA 4ALZA 2G2OA 3DOLA 3F73A 1PKUA 2IA6A 1R8PA 1S9EB 1GMUA 2W7PA 2HGMA 3D3BJ 2B7BB 1B7FA 4MYUA 1U1KA 3ZZZA 2W2OP 3ENVA 2LQ9A 4J7CA 3KUEA 2XEXA 2HVEA 2OMOA 4RNOA 2Z56B 1R8AA 2HFZA 1FX4A 3Q24A 1SJ3P 3MM6B 5DDPC 1JMTA 1XEZA 4JUZA 4ED2A 2JEJA 4FPIA 4OI3A 2AEFA 2A1BA 2VBXA 3DLBA 1TL4A 1HNZF 5L9NA 2ILYA 1FNOA 4LVNP 4BBYA 2RS2A 1XNQJ 4Y65A 3VALA 1WG5A 4FF2A 3SFUA 4BCAA 3T5JA 4OX6A 3HF5A 4ECTA 2HFOA 1TKTA 2E5JA 4B9LA 1VGYA 1KDNA 5IM0A 4OHWA 3BQ2A 2ZJRQ 4EBEA 1PJ7A 5T7LA 2EW9A 1TV6B 4LR9A 2QSFA 1VQSA 2H1YA 2HBZB 3QSYB 1JLQB 4DS4A 5B0BA 4FDFA 5D3GB 4ZPDA 5L38A 2D3UA 5GMEA 1HNXF 1IWAA 3FVYA 3AJDA 3UDEA 2GIFA 4IH7A 1MU2A 2I1RA 4OYMA 2JC1A 4XO0A 1NO8A 1P9QC 2B9EA 2Z58B 3FSXA 1WNEA 4LMZA 2FY8A 2BYCA 3OLBA 1M5OC 2HNYB 5E3QA 5D4NA 5LMNF 2L08A 4Y28C 3QGPA 1R8HA 2C3OA 2HIYA 2ZDOA 3T3FA 5C24B 2IDLA 2QV6A 2KFNA 1HLWA 2RH3A 4KGXB 2ROPA 2YX4A 1B99A 2XS7A 1RA6A 2ZKTA 4NLGA 1VOMA 4DV2F 1G1XA 4DL3A 3FEXB 3I87A 4FYDA 1UA0A 4DUYF 2BQRA 4NXNF 2FQQB 3BQ1A 4IRDA 4K5SA 2PMZD 3FRYA 2UXDF 2C1EB 2A0FB 5DQGA 2JWNA 4CH7A 2CPDA 5I3UA 4KGKA 3HCXA 3W61A 1BXNA 3BEGB 2Z57B 4X4UA 4XTTA 2CKWA 1HW9A 2D41A 3OTEA 3DLKA 4L73A 3GYGA 1O5JA 4JI6J 2YNFB 4RZRA 4F4KA 4CCHA 3A13A 1UTAA 3MMBA 3M8QB 2J0SD 4IKAA 4EYHB 2KFZA 1U2CA 3MPYA 3EXYA 1C0UA 4MKBA 2E9ZA 4FF1A 1S1UA 5IWAF 1S72S 4DV3J 2AEJA 1TKZB 3CJRA 4MTPA 3MUMP 4XPCA 4B9VA 3NGKA 3S8SA 2CJXB 1C2PA 1RTJA 3OLAA 3ZZ0A 1SQFA 1R8BA 3W1YC 4IRKA 3UNYA 3MEKA 2YH1A 3GTYX 5LSLA 5HJXA 3DYAA 3QJLA 4F04B 5D6GA 3VVUA 5KG6A 4OZ5A 4IG0B 5IC4B 2MZSA 3R2CJ 2IDEA 4TN2A 4F0MA 3KLGA 3DOMA 4QPXA 3QT5A 1QTMA 2F8MA 3LUYA 1FERA 3ICLA 3BREA 2W9BB 4WXWA 1JXEA 3R8YA 5KFDA 1TL1A 5KFQA 4XPEA 5DG9A 3JYTA 2UVWA 2P9EA 3B6BA 4WFZA 4KY3A 1VQLS 4JV0A 1FVSA 4IUFA 3S1TA 4DS5A 2BJ3A 3CGIA 3RB3A 1VISA 1Y11A 4C97A 4DQPA 1Q7LB 3OTDA 2R8HA 3M2RA 3RAXA 4WKYA 2NZ4A 2HVZA 3H2UB 1RT4B 2CJYB 1ZZFA 3QAUA 3KYLA 1UPMB 3LGHA 1LWCA 2OD4A 4M5DA 4QBUA 5CQGA 1F2HA 3TWZA 2ACYA 3ET6A 1O8BA 3H40A 2BJDA 1OYEA 4L74A 2ZUGA 2CZVC 4HTJA 5D77A 2NR0A 3TQEA 4X65F 1FWKA 4ZHRB 4TYBA 3HVTA 3N0VA 2E7XA 5CCMA 3DRSA 1DTQB 4L72B 4HACA 2BW2A 3GSIA 3L7UA 1UMJA 5KG2A 3QGHA 2RVJA 1WEXA 3H5XA 3PTWA 5L1LA 1EQ0A 2PD1A 1LOUA 3KMQA 3RB6A 4WTYA 3QPIA 4F2SA 1GX5A 3DI6A 1RTHB 3BSNA 1T9XA 2DTJA 5J2PA 2VU5A 3VZIA 1JJ4A 3GR1A 2ZBQA 4Z37A 3OXFA 4ZCKA 4B9SA 3WDOA 2NYHA 4ZKAA 4BLGA 3CW2C 3NG8A 2HZAA 1RSCA 4FVCA 1WWHA 2FVQA 5FDLB 2A6OA 3DNCA 1TTHB 1KN6A 3WHIA 3HXMA 2OPQB 2QIFA 4I0WA 4O0NA 3UWTA 2DR7A 1H38A 1DJ0A 1NRKA 2LDYA 3SDEA 4DR6F 3LQVA 3QO9B 3TUZC 2BUNA 1Z2LA 1VQMS 1TKDA 2V4JB 4EYIB 1AFJA 2FZKB 2FD2A 4DPYA 4A8SA 3HJVA 3W9IA 2AD9A 5KFUA 3KK1A 2FGCA 4CLZA 4DFJA 2ZJPQ 3QGIA 1O51A 2C28A 1KRPA 4QU7A 3DOKA 4X2BA 4HEA9 3KJNB 3W9JA 2ZOFA 2V94A 3OVSA 3FSIA 4ZPAA 4I56A 3Q89A 2V0NA 2HVDA 3R7BB 1IBMF 1U1LA 3TX8A 1WSVA 3WIUA 2XS2A 1UKUA 1JNZB 2XNRA 1FESA 4X66F 1CULB 1N6QB 2C2MB 2OP5A 2W4DA 3O6QA 1KC8T 2X1FA 2M5YA 3PJXA 3MAHA 1SJRA 5CXTA 1VQ6S 1HWKA 3GIJA 4EBCA 1PYSB 2KU7A 2D3ZA 4GC6A 4OV1A 1ROFA 4GKJF 1HQUB 1IBKF 4F4AA 1X4HA 3G6XA 2MYFA 2NCKL 3EVMA 4ZDNA 2MQQA 1RTDA 1S0NA 4OI6A 4YOEA 1FFGB 1FWPA 4N41A 2BM0A 2EBEA 3TO8A 2NQPA 1TELA 3TOQA 2F3JA 3DMJA 1VQ7S 2MZ1A 1Q5VA 3LP1A 4DV6J 3BGRA 4YHHJ 3I9V9 4NLXA 2DEJA 1O0PA 3RBZA 5A6PA 1D1UA 2NUUG 2YKNB 2QRRA 2K7KA 4ID8A 4OJGA 4F4ZA 1KOOA 4P52A 1TZ0A 2HHWA 4USUA 3CMAS 2CPHA 1T0TV 2KN4A 3G2XA 1NJIT 3TUPA 3A8KA 3VAGA 1ZM3A 1C1BA 1AXQA 3MAQA 2LYVA 2M70A 3D66A 2ZZNA 2CG8A 4ZVOB 3EVWA 2Q66A 2CWKA 5CYQB 2K3KA 2DD8S 2MPUA 4ER8A 4PXEA 2LXIA 1VC0A 4F0KA 1V3ZA 3TZWA 4IDKB 5ETQA 4OHVA 2ZWPA 2HNDA 1U0SA 3D1OA 4ANEA 4BWMA 1B0TA 3VAIA 4J9MA 3AJ2A 3R5BA 2MQNA 3P8BB 2QTWA 4JI8F 4JI2J 2G2ZA 1TL3A 3KJVB 4HTIA 5C7PA 4Y2KA 1KLMA 3RAQA 3UDLA 2XC9A 1XR5A 1RISA 1RADB 2W24A 2V2QA 5HMYA 3GFZA 4PZVA 4F4WA 3QT7A 5J1EB 3MOZA 1RT2B 2DNYA 2XZDB 4Q2LA 1L3TA 1H6KX 2CQGA 2XCAA 2DNZA 2KKHA 1TVRB 1O6XA 2EFQA 5IQQA 3S01A 3TJ8A 3NY0A 2HVHA 1X4EA 1AUSL 2CQ1A 3PNIA 2OFGX 2W2MP 2B3TB 5HLFA 4CLFA 3NLCA 1S1WB 3TAMA 3C6UA 2MMYA 3PY8A 1NNDA 2HGLA 2MQLA 5F8IA 3CF5Q 3W2VB 2CQIA 3PO4A 4J90A 2W8LA 3BS9A 4RW8A 2OMLA 3N6MA 3Q2SC 2R42A 1U6BA 4KT0C 2IYGA 1XMBA 2F40A 2EPIA 4EWTA 3CCJS 1FEHA 3QJJA 3MR5A 1I94J 3R2DJ 4UF4A 3EGWB 2UUAJ 4UQGA 1AFIA 1RQ0A 4B3OB 5SUHA 2XMWA 3N79A 3R1HA 2ZM6F 2PSZA 1NK9A 4MIAA 1Y3KA 1RBLA 4HH1A 3GYNA 2ZC4A 4CO2A 3ELHA 3IBWA 2R7WA 5B08A 3G82B 1PILA 1WC4A 1HNIB 4DLGA 2AGQA 1Q4RA 4Y2AA 1S7HA 2NXNA 3N5BA 3PG9A 2HS4A 3T5HA 3PW0A 3LF0A 3ULHA 2Q6BA 1Y10A 2MKJA 1KQSR 4WFNQ 2FC8A 3BO3A 4ZJLA 3I0RA 4RW9B 3OUYB 2JFDA 1PC4A 2ZFHA 1KVJA 3EDRB 4IQXA 2KB2A 3QQCD 4X4OA 3NGUA 5GADI 3UE2A 2XO6A 1WACA 5IT0A 5KFNA 3W2WB 1NPRA 3MXHP 3K57A 1JKHA 3ISND 2LA6A 2HFVA 1HBUA 2F7VA 4H4KA
chains in the Genus database with same CATH topology
2F8HA 3KK2A 4C3MA 3V6JA 2LU1A 2CPZA 4NLYA 2O5DA 3DU5A 5EGYA 4ED3A 4K4VA 4I2QB 2QA1A 3MFHA 2A2CA 4UUXA 1YSJA 4NPOA 3WX4A 2BE2A 1N32F 3DHXA 2UXBF 3DMJB 1DLOA 1NKCA 2CQCA 1RWUA 2KM8C 5I42B 2DNQA 1Q82T 3LP1B 4O44A 1U1MA 3BGRB 1T03B 5L1IA 4RNHA 2L9DA 4J9PA 3MR3A 4P7VA 5C42A 1GT8A 3N6NA 3R27A 1C0TB 4C8NA 3MCSA 3CB4A 2R9LA 4ID5A 4WCEQ 2DCUB 3A8EA 3U1LA 2ZHBA 1RYSA 3GE9A 1DTTA 3PW4A 2CJKA 2Q1LA 1PSDA 2VFVA 5KG7A 4MKAA 4IR9A 3UCUP 4CO1A 3NRBA 4DSFA 4ED0A 3O2IA 2CJAA 4IH6A 1X4DA 3DRYA 1MMNA 2KRRA 5K14A 1HYSB 3FRZA 4AFFA 3M6XA 5LT5A 1XMOF 3NNAA 5AE1A 3D1HA 3MOJB 1SJ1A 5KAKA 4RKUC 2HS3A 4KAIA 1VLYA 2GIRA 4FP9A 2BVZA 2KYZA 3BSOA 3IR5B 3T5LA 4OHXA 4DF8A 4NLSA 5D4LA 1LFWA 3FFIB 4ELVA 2RE1A 4EO8A 4DV6F 1HNVB 5H9FJ 2N7YA 2QLWA 2RRBA 1HBMB 1D9FA 3D0IE 2E9RX 1VFJA 5GAGI 3B78A 1X5TA 3G86A 2M3DA 1WHWA 2QYCA 3PJWA 2L3MA 5DDRC 3GV7B 5KG1A 4ERDA 3JSRA 4USJC 1VQKS 5KFSA 3NWGA 3MMCA 1IKVB 2GC8A 2GIQA 4WYWA 2B0GA 2KHDA 4O3QA 2DISA 4GC7A 4EO6A 4ICLB 4ZLPA 1RTIB 5J2QA 1S6PA 5SZTA 1C1BB 1QAYA 1SI9A 3OR1A 5IT9Y 1KLNA 1EP4A 2CZ4A 4HH0A 1QSLA 2O66A 5EX0A 2V2KA 1GNKA 4JI4F 2DT9A 3GZ7A 3QWUA 4USIA 3V6DA 1S1VB 2XMVA 2GHWA 4WU3A 1BQNA 3DLLQ 1JLCB 4C8YA 4F4XA 4H4OA 3I0SB 4DDFA 3ENWA 5A8WA 5F8LA 5GAHI 1U1QA 3SXLA 1H2UX 3JSYA 2Z2LA 2MKCA 3L7OA 1NK7A 4XDDA 4B3MF 1LWEA 2B5JB 1FRKA 4Q0BA 4KGMA 4CH1A 2Y1RI 2K1RB 1SC6A 1X4CA 2DGUA 4MFBA 4NRUA 1S76D 5KFZA 5KFBA 2E29A 1UWBA 4RBVA 5HP1B 1YRTA 3M05A 4OI0A 4QIWD 4Y2MA 2XMUA 3MF5A 3K0JA 4NA2A 2KG1A 2HNDB 2AGPA 2DVIA 1N5VA 2POKA 2QA4S 2QEXS 4RNMA 1NH8A 3ZZYA 3IS9B 2KTQA 1F9FA 1V9OA 1XR7A 3AY0A 3EZ5A 2IVMA 3MR2A 3DLGA 4O4GA 2ZH1A 2A10A 2B4VA 1OQ6A 5B7WA 1K0VA 4Y2CA 3KK3A 4KHRA 1FCAA 1VIOA 3IC1A 2B4PA 1NHUA 1UJ5A 1NK8A 4WYLA 4EZ6A 3TRGA 1CC8A 1TL3B 2HMIB 4K4XA 2NS1B 1X7VA 1JNRB 4WE1B 2MKKA 3CD6S 1MNEA 3PO5A 1KLMB 3BR9A 1IJEB 4YQWA 3MTKA 2DH9A 3DDKA 2WSEC 2JDJA 4GO7X 3D54A 2P9GA 4LSLA 3SCJE 3EX7B 1X0PA 4R8UA 2CVIA 3C6TA 3UCGA 4FS1A 3SI8A 4OL8A 4ETXA 4Q44A 1KONA 4K2XA 1X4GA 1S4FA 3CDBA 3MEDA 1U2FA 2IAJB 5F8HA 1KHVA 5M2RA 3VAFA 5KFWA 4I6AA 5AXKA 4TYAA 5KG5A 4X62F 5THWA 3VAHA 1ZH5A 4OLOA 4IFVA 4URGA 4PWDA 1SIWB 3MM5B 3Q8SB 4K4ZA 1NK6A 3DDNA 2VOOA 1YJTA 4UW2A 5KT5A 4I2PB 1P8GA 3B4DA 4QWBA 2EFVA 3TARA 3PHEA 4E98A 1B64A 2HIQA 2QT7A 4AXJA 2BV3A 4JI6F 2MHNA 2WOMB 1IUJA 2P6TA 1GTEA 4HVZA 5KFMA 4DBQA 1U1PA 3P96A 4KC5A 4C8KA 2VUGA 5F8MA 1A9NB 5U47A 4NCGB 4LFCF 2K2PA 3HLUA 2PT0A 4OI2A 2O67A 3IRXA 1LV5A 4XK8C 1RT5A 1M5PC 3UPFA 1X4FA 4UQTA 3Q8RB 2J0XA 2VQEF 5CHCB 1P1TA 2DIUA 2LQ5A 2CPIA 5GMKa 1M1KT 3KLFB 1HARA 4O3PA 2XO7A 1TK5A 4PXDA 4Q45A 3CE8A 2M52A 5HMWA 4N8NA 3NBPA 2RILA 4DSJA 3DM2B 3NKYA 1DQ8A 3ETOA 4F8RA 2DPJA 1SIZA 2V8DA 4ZVFA 2U1AA 3DN9A 5IFMA 5HLFB 5HBMA 3QLHB 1H3DA 1HA1A 2KRBA 5EWFA 1P1LA 3H25A 3CMES 3AJ1A 3TAMB 3C6UB 4TXSA 4FXWA 4DN9A 4PXCA 3POTA 2PEHA 4L3NA 2CQ2A 2VG7B 3M32A 1IKYB 1RP5A 1TQLA 1W25A 4DV4F 1S97A 1N5QA 2YTCA 3GIKA 1HI0P 1JLAB 1XTZA 2MZQA 3RAMA 4DG1A 1R31A 4QWDA 2Z0GA 3SCLE 4TLQA 4AE5A 2QFJA 3NMRA 2FLPA 3I31A 3FMBA 2YX7A 2R7OA 4KO0B 4RW8B 5CYMA 3HVWA 4WK1A 1FJCA 3CCLS 2EK6A 2OFHX 2B9YA 4PR6A 5E33A 1N36F 4JI0F 5LMUF 2AJQA 5LXYA 4ZVHA 3T9NA 2LQBA 2R7VA 1S10A 2BANB 2MDAA 1WF1A 4X4QA 1S6UA 2WTFA 4DSEA 1TKXA 3VQSA 1LK5A 2DHXA 5JJBA 4BC7A 2U2FA 2XLJA 1ZZNA 2DR8A 1U48A 4K50A 1CQMA 2VB6A 4QR1A 3E8OA 2IRYA 2B7CB 1N0UA 5HROB 5KFGA 1VQ8S 2KJVA 1FXDA 4ZPVR 1LW2A 2IM1A 2X3GA 4QWAA 1BQMA 2OPPA 4ZCMA 5DDQC 1VK8A 2FLLA 4K4TA 3KLEA 3E01A 4DL4A 2I8EA 2YWGA 3AQPA 3DLEB 2C3YA 5T41A 4O3OA 1VRUA 2J9DE 3AQOA 2NPFA 5CCLA 1QE1A 4UY8T 5ITHA 4MIBA 3I56S 1RAJA 2RQ4A 2WAQD 1NK0A 2JFKA 4RU2A 1NK4A 2IBKA 4PUOB 1QAXA 1X4BA 3CD7A 1E6VB 3AA8A 5G4DA 3Q2TC 2MJUA 4U67Q 1QLNA 3H59A 4ELUA 4ED8A 4DMZA 1J5EF 1UVNA 3QWPA 3KG0A 2OPRB 3CD5A 3M1VA 3OTCA 2YKAA 1QJHA 2JEIA 2MY7A 3UNGC 1I94F 1HW8A 3FQLA 3BO2A 1L3SA 4ES2A 3FGVA 2EWHA 2DR5A 4MIWA 1JLBA 3RR8A 2ZH7A 2ZJQQ 2XULA 2K3IA 1QAIA 4RBUA 3CWJA 1RT6B 1S1XA 2K7JA 4LIRA 3U02A 2KH9A 4J9RA 1N88A 2XMKA 4IOCQ 2HLTA 5F41A 3DC2A 1SKRA 2DIVA 2J6SA 1REVB 1E6YB 1FNMA 2IBOA 5JXSA 2P6SA 4YEAA 2UVVA 3MI7X 2YWFA 2MQPA 3O44A 1N5YA 3G96A 2E1CA 3QJPA 1R7IA 1S1TA 3QMQA 4BWJA 4N76A 1K8AT 4N47A 2OIHA 2E1MC 3ITHA 4IG3A 3MZIA 2FVRA 2GO9A 4FF3A 1JK9B 2LEAA 3GSDA 1T3OA 4OIXA 1UETA 4RUHA 3AAWB 1Q53A 4RX6A 4LF9F 2IJNA 2VG5B 2AV5A 2FGOA 4C9DA 3LP2A 4U6PA 1FK9B 4DL6A 4C7QA 4A8WA 3UD3P 1IKWA 5LXRA 1FF2A 4OFZA 2ADCA 3I0RB 5F9LA 2IFXA 1SBRA 2I5JB 2MZRA 3OR2A 2W9CA 2ZH2A 1P27B 1CG2A 1VS3A 2XHWA 2ZBCA 3BGFA 4KV8A 4KE5A 5A8RB 1D8YA 4O3RA 2AYMA 4MYTA 3CJKB 2XG8A 2C22A 4BDPA 3BJYA 5GVQA 4DLEA 5T14A 3RB0A 2L48A 4NA1A 2B9XA 4QR2A 1H98A 4TY8B 4CQ1A 2OPSA 3I82A 3PW7A 5FJ4A 1JB0C 5KFEA 1Y4ZB 1L5UA 4IOAQ 2VKRA 3I5BA 1RT7B 1Y00A 3M30B 4ZP6A 2N82B 4B3TF 4DHVA 3PX4A 4B3SF 1S9EA 4HKQA 4RBTA 4A8QA 3X3UA 3HVRA 3PV8A 4O3SA 1HNWF 1JKHB 2X51A 2J7KA 3O8WA 3VQTA 1HR0F 4NCBA 2VFSA 3OL6A 3T1YF 3JSMB 1NHVA 1SH0A 3IGNA 2X1AA 3VZHA 1HBUB 4I6YA 2J0WA 5AE2A 1HFEL 3IRWP 4LFAF 2J8AA 3KK2B 4PG5A 1U09A 2FUG9 2RQKA 1W2BR 3CDEA 3EXCX 4Y34A 1FO1A 4EBDA 4DV7F 5D4PA 2MB0B 4R25A 2BE2B 2AGOA 1DLOB 3T6BA 5L39A 3I6PA 2G0CA 3EGZA 4LF5F 3MDFA 1JIHA 4HDHA 4DR4F 4O44B 3ZZRA 1VBXA 2ZC3A 3NP5A 2HHVA 2QSWA 4A48A 4KQZA 2HFNA 3CCVS 1R27B 3TI0A 3MM6A 5C42B 3LGMA 1KQFB 3CCTA 3KLIA 1R6YA 2OTLS 4ID5B 1XR6A 3IGVA 3HMJG 1DTTB 1OPZA 2ZH3A 3HHLD 3UD4P 2NYIA 3PRDA 1NK5A 3F41A 4HHJA 4NLDA 3GG0A 5DLGA 2UUTA 2PA8D 2HQIA 3K7RA 5K14B 2J7UA 3T5KA 2DJWA 3UFCX 3VR1A 4K5RA 1WEYA 4CO3A 1HD0A 2HWTA 2OO4A 3QGGA 3R3TA 1DFDA 4YR3A 2ZNZA 1M5KC 1DQAA 3HDSA 1HWJA 3R5CA 4X4RA 1VRTB 1FRJA 3CCQS 1Y0HA 2HZCA 4I7FA 2VBWA 1G6BA 3MM8A 3D28A 7FDRA 3LW5C 3GQCA 1WF2A 4X64F 2RT3A 3UR0A 1H7XA 3AB2B 3A1YG 5D8HB 2APOA 2E7WA 2ZE2A 1M5HA 2UV8A 2RNEA 4HL9A 2AJFE 3PW2A 2DPIA 2RRNA 4ELTA 4E0DA 1U6ZA 1LWFA 3MMCB 4OZ1A 4F25A 4ED1A 2CPYA 4B02A 3DRPA 1S48A 2YNGA 4YR0A 3VAKA 5J2MA 2ZH8A 1YI2S 5J2QB 1S6PB 4NCAA 3HKWA 4WIIA 3LP0A 2M88A 3OR1B 2N4DA 3H2LA 3CDWA 1IN0A 3HT3A 1EP4B 2GQQA 1NKEA 1TL5A 1Q8IA 2VPWB 3H2VE 3MWBA 4A4JA 2AYBA 1S0OA 1QUPA 1Q81T 1DBDA 1UEUA 3V6DB 5BYSA 3M2VA 1U4BA 2HW3A 1BQNB 1FDBA 2BA9A 4H4OB 1QVFR 1KHWA 4AL7A 1TV6A 5A8WB 1D0EA 2J6TA 3BN7A 4IQMA 4IH5A 2CQBA 2RJZA 2DNKA 4OHZA 2R2SA 1SJQA 2LVWA 1FA0A 1LWEB 1LFPA 1SXLA 2WK4A 3MURP 1NJZA 4Q0BB 2DHGA 4MFBB 3V4IA 2O1PA 1U1NA 1L3KA 1A7GE 1FRIA 3DLJA 1AROP 4DR5F 1JLQA 1UWBB 1VIXA 2CFXA 5KT7A 1A6LA 1BC6A 4X84A 1YJWS 3PDNA 1FE0A 3V2UC 5JVHQ 5D3GA 4NLWA 2KZMA 1YRXA 3TUJC 5H9EJ 4ILMA 1KOHA 1YJRA 2C3PA 3IWLA 2FC9A 5KFXA 3MMAA 3OTBA 3HHKA 1S6QA 7FD1A 2FDNA 3DLGB 4O4GB 2MSTA 4CO0A 1RT3A 1FJ7A 3KK3B 2KT5A 3JTPA 4AUKA 1YG0A 3Q23A 3NGDA 1TR0A 4Y0FA 1S49A 2R7SA 2YKQA 3SMZA 2A18A 3BSCA 2MGZA 2N3OA 4EZ9A 4DFKA 1FKPA 1K9MT 2ZH6A 4LSLB 2JC0A 1XN9A 3M6UA 1VQ9S 4M1KA 1VC6A 3PIOQ 3ZFVA 2SXLA 1Y3JA 1HQEA 3H98A 4R8UB 2HNYA 3C6TB 2AU0A 2WSFC 3RW6A 2HVIA 3QAEA 3EPGA 2G1DA 3KNAA 3MEDB 3BZQA 4ZS6A 1HI1A 4YR2A 2VFTA 3B82A 1N48A 3N28A 2XI2A 1NJYA 3PIPQ 2WBRA 3KFWX 5C24A 5HN0A 4YB1P 2VQFF 3CJ0A 2J6UA 2QO3A 4IFVB 3SV3A 4C0HA 3HKZD 2JVOA 2ZBIA 2XI3A 3SSQA 4PQAA 4I4BA 4ZPTR 2AW0A 5KG0A 1WI8A 1SV5A 1UVLA 4J37A 2GGPA 2LECA 4AL5A 2UV8G 3MHYA 3UI3A 1Y7PA 1IJFB 5DG8A 4B9NA 1FEEA 3HX9A 1UVMA 2CQDA 1DURA 3IRXB 1RT5B 2XS5A 1S6OA 2BDPA 4NZ6A 4YMEA 4KTQA 2NREA 4Q5VA 1APSA 1SQEA 2RIJA 1FD8A 1RI7A 4PG7A 1U1RA 4NLOA 3N4WA 4EU0A 2RKIA 3UR3C 4I67A 3LOUA 1N5SA 4TU9A 4DV1F 2IRXA 3ZZUA 5IZHA 1CVJA 1C4CA 3NBPB 1ZOTA 4NZ7A 2DCLA 1YJ9S 2HAIA 3AA9A 2WCXA 5J2NA 3UQSA 5HBMB 2IA0A 2OTJS 3EUNA 2HHPA 1UP1A 2W9AA 1F5AA 4C8LA 1FDAA 1ZAWA 3U27A 4NOHA 3ZZOA 1H0HB 3POTB 4QYZJ 4ZCIA 2UUBF 2MKSA 4OQJA 1T05A 4RWXA 3M32B 3UW1A 2XGQA 2D9PA 4I1TA 1EETA 2NLWA 2DGSA 4DG1B 2JEFA 2BABA 3OBIA 3OHBA 3GFXA 4K4SA 4C8OA 2CQPA 3U1NA 2JLFA 5CYMB 4QJVA 4WK3A 2YNFA 1M90T 4HI1A 1KD1T 2IMWP 2EBGA 3CXCR 3W7BA 1MSWD 3MD3A 3LAKA 2JL9A 2OH2A 3BDPA 3BDEA 1CQNA 4ZK7M 5A6WA 4J9KA 4I69A 3RRGA 3M8QA 2HHUA 2LEBA 1K73T 5KFVA 1HWUA 1TKXB 2DGVA 2FHJA 4GO5X 5A2QY 4WFXA 3F44A 3KHGA 3FNNA 3IR6B 2IHR1 2E66A 5DDOC 4BC9A 1F5CA 1N56A 3BF4A 1FTCA 4NX9A 2HHQA 5IT4A 5KT2A 1QSYA 2NUHA 4C98A 1XMQF 1K1QA 1JLEA 2UUWA 3PKYA 1FJGF 2YX1A 4CT8A 5EDWA 1Q8BA 1LW2B 2DNPA 2EK1A 4PPZA 5KT3A 1BQMB 2OPPB 4V19J 1ZETA 4TQSA 1SKSA 2XSJA 3E01B 5EHHA 3KLEB 4C0OC 3EPIA 1TKZA 2DRAA 1URRA 1YHQS 1ZM4A 2V4RA 1VRTA 1VRUB 1QUVA 2VV5A 2YQ3A 4MAKA 4RWWA 5LJ5Y 3CJ5A 1QE1B 3JTNA 1FD2A 4YHHF 1RA7A 1VHFA 4ZOSA 5AXNA 5IXUA 4JOUA 1FNXH 1U6FA 3BR8A 1QSSA 2M9KA 5KG4A 3PR4A 3ENQA 4TU8A 4F3QA 4N8OA 5KFKA 1FXRA 4W90B 4KB7A 1YBAA 2FPHX 3M1VB 4WFAQ 4ED5A 4ILRA 1URNA 2G9OA 3IFEA 2LCWA 2NSBA 2RF2A 3RU0A 1SL1A 3G6YA 3NAHA 1CLFA 2JLEA 2UU9F 3J7YU 4J9NA 1JLBB 1WHVA 4EGLA 2YH0A 5KFJA 1V3SA 1DQ9A 4I6WA 4EUVA 4A8KA 4PG6A 3K59A 1S1XB 3P5TL 4B9MA 3TYTA 4W92B 1SJFA 3PKMA 5B0CA 2R2RA 5C25A