3DGPA

Crystal structure of the complex between tfb5 and the c-terminal domain of tfb2
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
62
structure length
62
Chain Sequence
ELDRVITYEGSLYSDFETSQEYNLLSKYAQDIGVLLWKDDKKKKFFISKEGNSQVLDFAKRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA polymerase II transcription factor B subunit 2
publication title Structural basis for group A trichothiodystrophy
pubmed rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 18
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2008-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18307 Tfb2_C Transcription factor Tfb2 (p52) C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2610 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dgpA00
3DOMA 3DGPA
chains in the Genus database with same CATH superfamily
2W8LA 3FFIA 4CO3A 1FT8A 4GVBA 2BJ3A 4RX6A 2C28A 2VG5A 3U7JA 2FIUA 2XS5A 4CIOA 2B9XA 4A8KA 1Q0NA 1JX4A 3GZ7A 3M8PA 1RT7A 2A0FB 2HURA 2GCFA 2DEJA 2HVEA 3F41A 2AF6A 5A8WB 2GS8A 4DR3J 3QFWA 4QIGA 2MXYA 2HBQB 4DR2J 4LFCF 3ZZTA 1YBAA 1JQGA 3EVWA 1S6QA 3H4DA 4CQ1A 2DRBA 1ZYQA 2HQGA 2W25A 4ZCMA 1U2CA 3AB2B 1M90T 4RLEA 4P71A 2AJ1A 4FF4A 2IIHA 1CBKA 5KFBA 5IT4A 1SBRA 3NOGA 1X0FA 4XDCA 4K50A 1M5KC 4DFPA 1SIWB 2QMWA 3P3DA 2LECA 2RIJA 4ZP7A 4J91A 3G2XA 1DTTB 1K0TA 2F9JA 4WFAQ 4RW8B 3DU5A 2IDLA 4BHQA 2DNLA 2B9EA 1VRUA 2OIHA 2IAJA 5KFTA 1FTCA 4HDHA 5B0AA 1VJWA 1UTAA 4GKKF 1K1QA 3HHEA 4J9UE 3LP1A 3CO0P 3UR3C 2DJWA 3FKBA 3CDUA 4LQ3A 2HLTA 4J9SA 3VZHA 4YDXA 3RAXA 1PCAA 5IOLA 2R2SA 1JWWA 3KG1A 5IWAJ 2ZZTA 3PEJA 4WE1B 3HF5A 1VFJA 1Q7LB 1Q8KA 3PM9A 3W9IA 2YQ0A 2WOMB 2E5LF 1CPZA 4NZ7A 5KFCA 4KH0B 3I9V9 5ADZA 4UQGA 5E41A 3NWGA 4CO4A 1JLFB 2UU9J 2B6AA 3KKFA 3OTEA 2W7OA 2VOPA 2B7CB 1FO1A 3N6LA 5D4PA 1X9SA 1T0TV 4DSKA 4ECRA 2QV6A 1S5ZA 2WTFA 5E3QA 1KVKA 3NAHA 3CF5Q 4LF9F 2XI2A 1YJNS 4USUA 2RU9A 4PKDB 3SCIE 1FX4A 1FRLA 3M8YA 1R3NA 3X3UA 4YFUA 3NNHA 3VGUA 2YWWA 5CA5A 1PSDA 1ELOA 1VS3A 3OW2R 5IQ6A 4NMXA 3Q8PB 2DB1A 2P6SA 2MEWA 4RBTA 4GRSA 1YJUA 3WDOA 5LJ5Y 1FX2A 2CFXA 5EX0A 3L7OA 2E5IA 2HZCA 3EVMA 4USWA 1YI2S 2AZ1A 5HATA 3BO2A 2R8KA 3PJWA 2FLNA 3HKWA 1JB0C 5KFVA 2H1YA 3I31A 1SQEA 3D68A 4DDFA 2EFOA 4USKA 1TAUA 2XMWA 1UKUA 3CCQS 2M0GB 1FXDA 2N82B 3GTYX 5EWEA 2DRDA 3W64A 2HVZA 3TNVA 1RKJA 1F9FA 3TARA 2MJUA 2W2MP 1DFDA 3VR1A 1P9YA 1KVIA 4P72A 2LVWA 4KKOB 2WB4A 2CADA 2H4WB 2VOOA 3GR1A 4JI2F 5I3UB 3KG0A 1P9QC 3IRWP 2F7VA 4ZPBA 1WELA 2MZQA 2OPQA 4AQYF 4B3SF 1YZ6A 1VC6A 1WHWA 1HBNB 2VF3A 3D0IE 4GO7X 2R8HA 4YR0A 1HQEA 3BYRA 4CH1A 2DPIA 2FHOB 4RW6B 4B9NA 4Y2IA 4DR1F 1ZM4A 2IM1A 5K8NA 4JUZA 1IBMJ 2O66A 2A6MA 3VWSA 4YOEA 3IRXA 2ZD1B 4WTYA 1UL3A 3KHHA 4M5DB 3ICLA 1Q53A 1I1GA 1LQ9A 2EW9A 4A8MP 3TQEA 1YQHA 1XNRJ 4J9VA 1WC5A 3KXDA 5DDQC 3SDEB 4OX9J 3GV5B 1N34J 3CW2C 4ZJOA 1XMBA 1CC7A 1UJ6A 3SZ2A 3A3NB 1WJ9A 1XR7A 3HHLC 2AYBA 3PYDA 4U7UD 4HL9A 2ZJRQ 2ZJPQ 4OZ0A 2KFNA 4DU7A 4BWJA 4MFBB 2B3TB 4YR3A 3K58A 4DLGA 3KLFA 1T3OA 1LXNA 4RW4B 2V4JB 1TL1B 2ZHBA 2HW3A 4OZNA 1IBKJ 5A76A 4NLWA 3HP6A 4HHHA 2QL9B 4MK9A 1RK8A 4ZKAA 2DXEA 4ZDNA 4RNMA 1D1UA 3IAS9 1F0XA 3DGVA 3MDFA 3NMRA 4QWCA 4F4YA 4B9UA 3D6FB 1VBXA 4EO6A 2HHUA 2W8KA 2R8GA 1OIAA 3TJ9A 4MYUA 3MEKA 2XHWA 2HQCA 3QJJA 2E44A 3EDRB 1IVZA 1T8EA 1VQ7S 1F3FA 2CVIA 1UP1A 4W4MA 5ETPA 4DL4A 5IV4A 2Q1LA 2A18A 2V8GA 4FKYA 4LSZB 4NX9A 3THVA 3HX9A 4ANCA 1P1TA 4OQJA 1YGYA 2Z4PA 2ZUGA 5F8NA 4IOCQ 1BQNA 2CJXB 5E3PA 5DM7Q 4J37A 3P49B 2QSFA 3EGNA 3I0RB 4F04B 5KFGA 1S9GB 3ENAA 3ISND 3LP2A 2HVHA 2XZDB 3HVWA 1TKXA 1YG0A 3ZZZA 4KAIA 3W2VA 4RL1A 2JC0A 4MK7A 1U1QA 3ELHA 5CZXA 4JI5J 3CD5A 2BYCA 1U8WA 2P9GA 2DEIA 1ZZNA 3POTA 3I9ZA 4N8OA 5C42A 1VISA 1LW2A 1RP5A 2NXEA 4XPEA 3IFEA 3L7PA 3BSCA 2CIMA 3HVTA 5SUHA 3PIOQ 5DG7A 3OTOJ 3BEGB 2L48A 2VBWA 2KZMA 4RR5A 2VG7A 1RAGB 1YJTA 2WBRA 2MLZA 2ZKUA 4RBVA 4KH1B 4DV2J 2U1AA 2XLIA 1VJQA 1HBUB 4F3MA 3QO9B 3PR5B 2DHXA 3M2UA 3NGRA 1DTQA 3LW5C 3KLHB 4DV7J 3B6BA 4M5NA 3GSDA 5B0BA 3V6DB 1BWEA 2OEMA 3HZGA 3DLBA 2HLUA 2C1EB 1G4CA 3DHWC 5KG4A 1DQ8A 4DV5J 5F9NA 3ZTQA 3T6BA 3KJQB 3B82A 1WWHA 2DO0A 1HKAA 5SZTA 2P2CB 1VQ5S 1SKSA 2CJBA 5A0YB 4NLUA 4DR7J 2CAJA 3UCUP 1UETA 4Y2KA 3IGNA 1VYAA 4H54A 4C0BA 4WWSA 3HMJG 4C8OA 4LF5F 4K4YA 2KL8A 3KUGA 2VG6B 5DJBA 5HBMB 5B0CA 1HI8A 3PYGA 1VLYA 2P9CA 1RT5A 1O8BA 3CIMA 2DNGA 3CD7A 2E9ZA 2EXUA 1MW7A 2XYGB 1B64A 5I42B 3V6HA 4LRDA 2PN6A 1SIZA 3V81B 2CJQA 3PRDA 4LRBA 4DSLA 4ILRA 2DR6A 2YNFB 3PHEA 4NZ6A 2YPYA 2BJ8A 1ZAVA 3OR2B 2HGMA 4F3QA 4NXNJ 4ZLJA 4B9TA 1KLMA 3NCQA 7FDRA 1JLGA 2JRSA 3DXSX 3CWJA 3AJDA 1L3TA 3CJ5A 3V2UC 3P45B 3KJVB 5KFLA 1GQEA 3KK2A 3T1YJ 5HLFA 3J7AN 3ZTRA 3RZAA 1S10A 1QVGR 3MM8A 1FNMA 4JI0J 1R0AA 4NEZA 4DV4F 3A12A 3N5BA 1KVJA 4YY3F 2WW4A 5KT3A 3ZFVA 1WG1A 2F4VJ 1RT3B 4CO0A 2FD2A 3QSYB 1FF2A 3HKZD 2QLWA 3TP2A 3BSAA 3ZNJ1 2HMIA 1L3UA 3W5YA 4ZLLA 2F3JA 4H4OB 3Q8UA 4ECTA 1WDTA 5I4MA 4OZJA 1S1XB 2OPRA 1Y5IB 4USMA 2FZKB 2Q66A 4NA1A 3PO4A 2RJZA 2VONA 2IA0A 3FCWA 1P27B 2CPXA 2BDPA 3THPA 4RKUC 1WTFA 1U1KA 2XGQA 3NMAA 1SV5A 5LMUJ 2GO9A 4LIRA 3EX7B 4ECWA 2J7WA 2ZOGA 1EKRA 3OR1B 3M9NB 2LQJA 1HBOA 3PZPA 5J2NB 3V4IB 2MSTA 4YUDA 2HFOA 3CJQA 3SSSA 4FBTA 3U1MA 2B4UA 4X4QA 2LLZA 1KD1T 3UD5A 1C0TB 1ZTTA 3BGOP 4NCAA 4YB7A 2AYGA 4ZVSB 3MEEB 3VAKA 2VQEF 1KC8T 3DMJB 4LR7A 2MZRA 1REVA 1U45A 4U95A 3M7VA 4KC5A 1PG5B 5AE2A 5KFAA 2NREA 3A8KA 1NDCA 2ZVSA 1WG4A 3AY0A 1U4BA 5J1EB 1CVJA 3R6LB 2FJBB 2IJRA 1QY7A 4IH6A 4DG1A 2ASYA 4MK8A 3PKYA 1H7XA 2HQIA 1KFSA 2VFUA 2ZBIA 3QAUA 4CI0B 1OY8A 4Y3CA 4Q0BA 3IS9B 5E7OB 2V2VA 1T9VA 3O3LA 2GMHA 2YH1A 1HWKA 1ZA1B 4B3OB 2DH9A 1XEZA 3EGVA 4X4VA 2QT7A 2MKYA 1SI9A 4I68A 3PJ9A 5HMZA 1VDHA 2XWXA 5J2MA 2FB0A 1RT6A 1J5OA 1RKIA 2W4CA 2CJAA 2VICA 4FN5A 2L9NA 3G96A 2C2MB 4ZCIA 4GC7A 1DLOB 4X64F 1XWLA 3LALA 2ZOFA 3DRPB 4K4SA 3EDQB 4IG0A 5IM0A 2W9CB 3NS5A 5A8RB 4ED4A 4RU9A 2ZH5A 3FFIB 2QJ3A 1QTNB 2EFNA 3TA2A 4ZVPB 4GVBB 3R1HA 2N7YA 4HT5A 2VG5B 2AQ4A 4TY8A 3HT3A 4B3RF 9RUBA 1XN9A 2IPOB 1H7WA 1CQNA 4IDKA 4ED3A 2UUBF 3W7BA 3RW6A 3OJUA 3M8PB 1Y7PA 3RRHA 1RT7B 1NKEA 4X66F 1W2IA 2V9KA 1YJWS 3SFGA 2ACYA 2BOAA 1S1VA 3FEYB 4B3TJ 3GILA 3RAMA 3MAQA 2ZH8A 1VQKS 2DCUB 2YKAA 3EWGA 4PXCA 3M6UA 1S6QB 3UD3P 3KUHA 1RLDA 4NL5A 4OJHA 3SV4A 3I5CA 1A9NB 3UDLA 2R2RA 1XIQA 3N79A 3AQPA 2CQPA 2HAFA 2HK3A 2QA4G 5B0GA 4K0KJ 3FBCA 2DGSA 4WCEQ 2VPXB 1I5OB 3CCSS 2F8HA 1VRUB 2IAJB 3W5XA 5L1JA 3DHXA 2PC6A 4U7UK 4XK8C 3CXCR 1EKSA 5B09A 3LP1B 1Q8IA 3ZZ0A 1WDDA 3HVRA 2PI4A 4KSEB 1VQLS 2FY8A 3PX6A 1AB8A 3SFUA 3EZOA 2P8IA 1D9FA 2V5HG 1EETA 3MMJA 4PEOA 3CCZA 4LF8J 4CT8A 2RHQB 2B6AB 1BY9A 3MPUB 1D8ZA 4QBUA 1T9XA 1S1UA 3V6JA 1R8PA 1Y3JA 3OXLA 1PBUA 1KLNA 2QC3A 4TXSA 1VRQC 5ETRA 4F4ZA 1NHVA 4PQAA 1NJYA 4RBUA 2XSFA 4OYIA 3JQJA 2CZVC 4IFYA 2HAIA 4ED1A 3PRVA 3WX4A 1S6PA 4IFVA 1S49A 2BACA 1OY6A 1WI8A 2W4DA 1H2VZ 5KT6A 1D9AA 2ZBCA 4NLGA 3E8OA 4ED0A 3GR0A 1MNEA 3HHDA 2NXJA 1KTVA 1T9YA 2XQCA 1N54B 2YTCA 4HTIA 3ZTSA 1PKUA 2CQGA 3K5PA 4I2QA 1Y3KA 2XM3A 4JI6J 3QMQA 1LWFA 1UVMA 6AT1B 3BS9A 5E2QA 5LT5A 3HLUA 4ETZA 5CXTA 2CJ9A 4EBDA 2FLOA 3RBEA 1NU4A 3MEGA 1FXRA 4FVMA 3SXLA 1FESA 2OPQB 3HHKA 4I4BA 2UVWA 1RT2A 4NRUA 3S7RA 1HQEB 1RWNB 2ZWPA 3N01A 4ED5A 1P1LA 1Y5NB 2XZTB 3BM7A 4KTQA 3D1HA 2OMLA 4OMFG 1MMDA 2J8SA 1UAWA 3LTOA 3MD3A 2RUSA 4KPCA 4JI1J 4DV6F 3SYZA 5ETMA 5KFQA 2NXCA 4YB5A 4YS2A 4MT1A 3DRSA 3M05A 4CNZA 4WP8A 4NA2A 2FLPA 2J9DA 2HFVA 2BZ2A 4RNFA 4FDFA 3J7A1 3IRXB 2LQ5A 4GKJF 2ZBQA 3BGRA 2QLFB 3UN2A 2W7PA 2D3O1 3QGIA 4ECUA 3K8VA 3TVYA 4FYYB 3D28A 3CCTA 3R9LA 2GVDA 1IQTA 2W24A 3OXFA 1TTHB 5F0UA 4RUAA 1WC4A 5KFHA 2C2KB 1K44A 5HQ8A 1UEKA 1RISA 4DX7A 5IFMA 1B0PA 3KNGA 3UPFA 1UJ5A 4CLPA 3KLFB 2DBBA 3Q89A 2QLBB 5F8GA 2OJ3A 2HG4A 4OYPA 3MR5A 3MUTP 4HEA9 2JNJA 4IG3A 1URNA 1M1HA 4AUKA 2FHMA 2R7TA 4D3GA 3RUBL 3FC9A 4HHJA 3OPKA 2FJAB 3W1YC 2RU3A 4NA3A 2ZBPA 1WC1A 2V67A 4OYAA 5D0GA 1X5PA 3PW5A 4RWWA 4ZPVR 2NZCA 4QR1A 5F3TA 1FFWB 3L7UA 4BBYA 3DM2A 4LFBJ 1PYTA 4OYWA 3TZXA 1WHXA 3ULHA 4O0IA 1H2UX 3IBFB 4ED7A 1C1CA 2MKKA 4DPTA 1EZZB 3DLLQ 1BQNB 5K8OA 2D3UA 3C66A 2XNRA 4AD6A 1WC6A 1UW9A 3GIJA 2KM8C 4K4TA 1HHTP 4URSA 3LP2B 2FHJD 2PGCA 2H5JB 1VI7A 2PSZA 1TKXB 4NLVA 1FJCA 4UZBA 1CSJA 3HHNB 4A46A 3W2VB 5LOQA 2JEFA 1HFEL 2WONA 4QWEA 2KH9A 4LF6J 4HH0A 3ADAC 1TK0A 1U1RA 2YY3A 2DR8A 3B8HA 2WRMA 2D3ZA 4ZVTB 2YKQA 4TQRA 2KXFA 3C8YA 5B7WA 2KB2A 1FJGJ 2AZ3A 3KDNA 4F02A 2M70A 1F60B 3QIPA 4FS1A 3POTB 4QIEA 3DYAB 3DFEA 5C42B 5KG5A 1GXUA 3O1LA 5KAKA 3PW7A 1LW2B 3THTA 1NHKL 1N4LA 3RJMB 1UEVA 2XO6A 3HVTB 2BE2A 3IAM9 4NXMF 3FQKA 3R7NB 2VG7B 2DXDA 4YB6A 1UJ4A 2C2ZB 4IR9A 1GTEA 2GV1A 1S97A 3CCRS 1KBRA 2BJ9A 2IJNA 2VUGA 3JQMA 2ZHOA 2MZJA 1KWMA 2GFFA 3M2UB 2V6AA 3VVTA 2H3EB 1DTQB 5MAOA 1IR2A 3BPDA 2KG0A 1WKLA 1R0CB 4XPCA 2J6UA 3GONA 2Z2MA 4HACA 3UE2A 2MHNA 4Y2CA 1YVFA 2CPHA 3H0PA 4YY3J 3CC4S 1H3DA 3ISZA 3DU6A 2WCXA 4RZRA 2QYCA 3BYPA 4JYAJ 3EZUA 3GJRB 3R5AA 4MIWA 3OTCA 3UD4P 1CLFA 2YKPA 4JB8B 2QRRA 3PXGa 4QYRA 4KIAA 5DQGA 2AJ0A 3UVJA 2RNEA 1L3SA 2I0XA 1RT5B 3TR5A 3QWUA 1MN7A 1F6TA 4KHPF 2DGUA 3H7HB 1VQNS 3W61A 4TQSA 3D66A 3BKTA 2OPSA 4P6QA 4UZCA 4C7QA 2HNYA 4I7FA 2BX6A 2L41A 3OUYA 4UQTA 2MQ8A 2OSRA 1WEZA 5D8HB 3CD0A 4Q45A 4LBHA 1P6TA 2A3JA 3UW1A 4FYDA 2I6WA 3HSZA 8RUCA 4B3MJ 2WW8A 5D78A 1KLMB 3MM6A 1JLGB 1IWAA 4B9VA 4ZVRB 4Q8EA 5IZHA 2KXHA 4NLTA 5CH7B 3VAGA 3I5AA 2DR5A 3KK2B 2EFPA 2R8IA 5HLFB 2CA9A 4DV0F 3MM8B 2UUWA 5K14A 5FJ4A 4FPRA 4H4MA 1R0AB 2V34A 5DRKA 2IMOA 2LQ8A 3DI6A 1NMEB 4WKYA 4C8MA 4LREA 2VQEJ 3D3CJ 3SBMA 1UFLA 2LXUA 3NWRA 3P5TL 2WB1D 2HMIB 4DR5J 2Y1RI 5KTQA 4DF4A 3C19A 2QA2A 1IJFB 3TZWA 2DY9A 4Y65A 2CDQA 1RTHA 2ZE2A 3SI8A 1SH3A 2OPRB 1GK8A 3CJ2A 5K8PA 1X8DA 5JXSA 3ENWA 3FSXA 4DX5A 2DXFA 1RAOA 2KFZA 1N33J 4J9OA 1TL5A 3BH7B 2FHKA 2XBPA 2R7UA 1OS5A 2GJFA 4O3PA 2OTJS 2D9PA 1SV5B 3VAHA 4OYBA 1LK5A 3U1NA 2XLJA 3PX0A 2E7VA 1S9EA 4KE5A 3WHIA 1SH2A 4YDDB 3OL8A 1HBOB 3QBCA 1AFJA 2YPZA 2BRKA 1NO8A 2MMYA 4PPDA 2RRNA 4CT9A 2F9DA 1HW9A 1B7FA 3TAQA 4WPAA 1NXIA 4DF8A 2LMIA 4GVLA 4I6WA 1G6BA 2FZGB 5KFOA 4B9MA 2FVRA 1REVB 1X4CA 2L9WA 3RGIA 2K7JA 2G2YA 3E51A 1JLAA 3BQ0A 4DCOB 3TQ1A 2R7OA 1LWCA 3MWBA 5AXLA 2R7XA 2C3UA 2VV5A 2ZOMA 1FE0A 4DG1B 1PAUB 3OD2A 1N32J 2YKMA 4LF7F 2BJEA 4WP9A 2H4YB 5CD4A 5BXIA 2WVEA 3AB4B 7FD1A 4Q0BB 4MMOA 5KFNA 1KQKA 3UN3A 2MPUA 1S77D 2OO4A 2HFUA 3M30A 1MU2A 2Z2LA 1T9WA 1CQMA 5DZ6A 4OZLA 2ZBRA 5AE3A 2HHQA 3O8WA 1JLEA 3T5JA 3CD6S 2WSCC 2W2PP 4KGVB 5J2MB 1HIYA 1J5OB 2G0JA 2E1MC 2R42A 1SJ3P 3TX8A 4X62F 2C2NA 2Q79A 2ZFHA 2XMVA 2CZ4A 2BBEA 1JLBA 1NJZA 2E9RX 3R5DA 4ECZA 3GFHA 4BLGA 2EC2A 1HHQA 2W4PA 4IG0B 2D7SA 2VA3A 3FZBA 1NB7A 2JX2A 1BHNA 2MB0B 5IM0B 3BGUA 3CJ0A 2A6OA 1LV5A 1RYSA 5AXMA 2XCPA 1YJRA 4YEAA 2COLA 1XMOF 1KONA 1N8RT 3DRYA 4TYAA 2VU5A 4ENOA 4TY8B 4ZPDA 3QZ8A 1VR6A 3D4JA 4IDKB 3K17A 4DL3A 3JAMY 4C0HA 4DQIA 2HNDA 1R31A 4ZS6A 2PT0A 4HKQA 1S1VB 1SVDA 2CWXA 3BN4A 5F0WA 4UUWA 3DDKA 3CT9A 2UV8G 1QSYA 4IOBA 4ZJQA 4A8YA 1PAEX 5HVHA 5H9FK 4JI7F 2QG9B 4K5SA 3S6EA 1CJKA 1FEEA 5T41A 2ILYA 4LFAF 3K0JA 2EG1A 4DSIA 4EK2A 1FDAA 3ZZUA 2K3KA 2CPFA 4A4JA 1FDNA 1JLCA 1RAFB 1C0UA 3GIMA 3AAWB 1AFIA 4F3OA 3Q2TC 2QFIA 4HH1A 4Q5VA 1LEOA 3VTIA 2GAHC 2UV8A 4O3SA 3EGZA 4G1QA 4O3QA 1TMJA 4CH7A 3WC0A 1RCXB 1WI6A 2HFNA 2KRBA 2BABA 1RU2A 3NKYA 2ATLA 1TK8A 1FHTA 4EMDA 2A2CA 3PEHA 4DV3F 3LPYA 5KG1A 1HR0J 4KPYA 2CQCA 2AJQA 1X7VA 2FPHX 3LP0A 5E3CA 2YQ1A 3CMQA 1EETB 2HWHA 4ES1A 2DHSA 2KT2A 1LWEA 1U49A 3T5LA 3FSYA 4DOZA 3Q23A 4OV6A 2CNKB 3PIPQ 4ZVFA 3ET6A 2GHVC 1S1UB 1H38A 5LMNJ 4K4UA 3OHAA 1Y00A 3LWMA 3Q8SB 1P8GA 2M8HA 3EZ5A 1KQGB 1VBYA 1OYEA 1T3NA 3M8QA 2KYZA 1N36F 1HYSA 3SMZA 4IFYB 4OJ3A 4IOAQ 1S6PB 5AJ3J 1D8YA 5DGBA 3RB3A 4IFVB 5THWA 4IYQA 2AJ4A 2FY1A 4MH8A 1TUWA 5L9NA 4K2XA 3AD9C 4GKJJ 3JTPA 2IBOA 2AKWB 4OZ1A 3W65A 1FDBA 3RBZA 2ADBA 2ZH6A 3QYYA 2DO4A 2KJVA 2XLKA 3RYLA 3AD7C 2JZ5A 4QQBA 5LSRA 3G6VA 3KJFB 2VH7A 2CQ0A 3AA9A 5G4DA 3HSDA 1M5SA 1NM2A 3DDNA 3Q8QB 4J9PA 4I2QB 3OHBA 4P9SA 5LXYA 2H48B 1GT8A 4WFZA 5F3ZA 4LVOP 2EWHA 1LWFB 1AW0A 2V2QA 1UCNA 4PWDA 3DOMA 3KFWX 2RS8A 2JEJA 5J1PA 2G0CA 4Y00A 2ZH3A 2YWKA 3MEGB 3CCVS 3C16A 1IWGA 3CEDA 3GG1A 5DQIA 3PW0A 5GADI 3R27A 3JSMA 1RT2B 1VK3A 2M88A 5ETKA 4USVA 2FVQA 3SIPB 2N4DA 3ZZPA 2MY8A 1NDPA 3W2WA 2Z2ZA 1JJCB 2EBEA 4ZLNA 2AX1A 4RUHA 1VQ9S 4DQPA 3DRSB 3SSRA 4CO1A 4O3OA 1HNXJ 3BH6B 3KK1A 2CG4A 2PDAA 5A6PA 4QYZJ 2B43A 3BGRB 2AX0A 2QA4S 3RR8A 2D69A 2LA6A 2V8DA 3KMQA 3D9BA 2V2KA 1KP6A 1HNVA 3GMGA 3J81Y 4CLYA 3KHRA 4ZMMA 2B9YA 2JVRA 4UOFA 2V94A 1FDDA 5C2GA 2AT1B 3NAIA 2GVDB 2F1FA 3QJLA 1UFWA 2XULA 2F4FA 4Q44A 5DDRC 3AQOA 4PYAA 3MR6A 4RU2A 2ZH1A 1UFKA 2FLLA 1ZS6A 2CKWA 1NAQA 3FBFA 1VLOA 3HT0A 4C8ZA 5KFDA 2XHCA 3PCOB 1EHWA 3RG6A 1DQ9A 1U25A 3BDEA 4YP3A 1SJFA 2RRBA 2F8MA 5G0RA 1YIJS 2W9BA 2OHDA 1FFGB 4ZIVA 3IN5A 5I42A 2YKNA 1Q8LA 4JI4J 3IWXA 1FRMA 4IG3B 4W92B 4B08A 4IRCA 5ETSA 4K4VA 2ZC4A 5JJBA 1UMJA 2ZH9A 1REGX 3IXQA 4F8RA 5GAGU 3QRRA 1VQMS 1NH7A 2Z0GA 2KVQE 1NKCA 4N8NA 3RBDA 1TP7A 3DM2B 4C48A 4YR2A 2R2UA 1GNKA 2BKOA 2LFVA 1WEXA 1HWJA 4P2FA 3LAMA 1C1CB 1JKHA 3D1QA 4YMEA 2F63A 4DX6A 1UZHA 4JI3J 3TUZC 3DKDA 4E98A 1WC0A 2LEPA 3C14A 2OLWA 2LU1A 1X4HA 2LXFA 3O6QA 4NLPA 2WONB 3GU0A 4FF1A 3U02A 3BSOA 3N6NA 4A8QA 3PJXA 2HS4A 1PJ5A 1JXLA 1QE1A 3I4HX 3MCSA 3C6TA 1I6JA 3QIPB 3M1VA 1U02A 2GA7A 3HJVA 4YHHF 3JS9A 1YKWA 2MKCA 2J8AA 1FD2A 3D5MA 5L1IA 2BE2B 2A10A 2PIIA 4RW9A 3NCRA 4ITSA 3LANA 2YWHA 2JFDA 2OPPB 5LL6d 4QPTA 3TOQA 2QMXA 1RDRA 1TFYA 1TU0B 2ZITA 2F40A 3BZQA 3RB0A 3OTDA 4IKAA 2APOA 4DL2A 3QZ7A 4JV5J 1HW8A 2CDRB 3JSRA 2FZCB 2BW2A 1FK9A 4DN9A 2G1DA 1SC4B 1YHQS 1HNWF 4HACB 4G65A 1O51A 2HSEB 3FK4A 4IO1A 3FSIA 2GO8A 1NZ8A 4AYBD 3AOCA 2E1AA 1Q5VA 1PILA 3TRGA 2K2PA 3QIDA 4DR4F 2C3MA 4CLUA 2L3MA 1UA0A 1VC5A 5KFKA 3MFHA 1XTZA 4MAKA 3JYTA 2C3PA 5KFYA 3ITHA 2UZAA 4I2PA 2DNHA 3PO5A 2BVZA 3UVJB 1EB0A 1T03A 4AL7A 3RB4A 1WORA 3I87A 1S0OA 3MHYA 1X31C 4EUVA 3EXCX 2AV5A 1FNOA 2OPSB 2HNYB 4USHA 3BN7A 4I7FB 1B4SA 3OUYB 5C24A 1I94F 2UUAF 3O44A 3IM8A 3VAIA 2IC3A 3OV7A 3VGTA 3PYEA 2JLEA 3C15A 3NP5A 3JB9k 1EARA 4WZMA 3MM6B 2UXDF 1LK7A 4CYUA 1S4EA 3HO1A 2OSQA 4ZCLA 2QN6B 1NNDA 2DITA 4UTGA 3FEXB 3NBPB 2M9KA 2EBGA 4CRJA 1TV6A 1WC3A 5K14B 4H4MB 1N5TA 3BDPA 3H40A 1BD6A 4CM2A 3DI6B 1MSWD 1RSCA 3BGLA 2HQ3A 3A3OB 1MMLA 1HNZJ 1FVQA 3H2UB 4JP8A 2HHXA 3MPYA 3K8WA 3V6KA 4HR2A 4DLEA 4WFNQ 4P10A 1N5SA 1HPZA 2RH3A 1JMTA 1RTHB 2ROGA 2ZE2B 3T1AA 4LF7J 3BF4A 4WYLA 1F9EB 4NEYA 2M52A 2ZJQQ 1ICEB 1H73A 2V63A 1TQLA 1FNXH 2WBMA 5KG3A 2DVIA 3T3FA 3CE8A 1IKVA 1H6KX 1N52B 2M4MA 1PIEA 4W98A 2X3GA 5HROA 4ZIWA 2MLYA 1OJ4A 3CJKA 4M8LA 1VBZA 3R7SB 2XO7A 1S9EB 1X5OA 1NK9A 3CULA 4X62J 1OO0B 4NMLA 2E9TA 4QR0A 4CLSA 4AFFA 1MN9A 1ZPWX 5KFRA 4I67A 2VQFF 4CLTA 2HZAA 2CQIA 1T9TA 2HFZA 2ZVIA 1R6VA 2XMUA 4S0MA 3KMSA 4CWBA 4JBCA 1ACMB 1RBAA 4C4WA 1LFPA 2UUCJ 1RA7A 4NLOA 2BV3A 1S7HA 3R5BA 3RR7A 4K59A 3MURP 2AD9A 3UQSA 2CPZA 1O6XA 1JLAB 1UA1A 5KG2A 1QM9A 4L3NA 3MM9A 1LWCB 3EVOA 2KN4A 3PX4A 3TI0A 4NLSA 2YKMB 4O4GA 4OI3A 1X5TA 3BKFA 4Z7YA 3WZ0A 3DGPA 1H2TZ 4R8UA 3HCXA 4ZPTR 4QCLA 5D6GA 1FA0A 3QRQA 1WOSA 3HHLA 1YBUA 4I6AA 1CJUA 1FKPA 1A6LA 3W60A 3EPGA 3M30B 1MU2B 4F2RA 4Y0FA 1A7GE 5D4NA 3KYLA 1JLEB 4FXVA 4R25A 3K5MA 4DR3F 4DR2F 1R0BG 2MQQA 1WF0A 5JVGQ 1M5VC 3MR2A 1K73T 1HARA 1SUQA 3J81j 3N9UC 3VAJA 1CJVA 1JLBB 3RRGA 5U47A 3FRYA 2JJ4D 1Z4UA 3T1HJ 1SL1A 1RB0A 2VKRA 4ZITA 1XERA 4LMZA 4KB7A 5I3QA 1O5JA 2FJVA 2HPUA 4C11A 4U8VA 2L9DA 5CZVA 3EXYA 3BV8A 4PPZA 2HNDB 3AJ1A 3LPEA 2DH7A 2FJXA 3RRKA 1RLCL 5IWAF 3GIKA 5CQGA 1IXKA 3QWPA 1NB2A 3D6HB 4FBUA 1IM4A 1CJKB 3QT7A 3B4DA 2BRLA 4OI6A 1B0VA 1Q1KA 3AH6A 1GEHA 5L38A 2R7QA 5K5MA 2NCKL 1SJ1A 4CZCA 1KRPA 4KT0C 2EFGA 1WHVA 2X1GA 2GMJA 4LBPA 1RYRA 2OP5A 2BEFA 1JLCB 2UU9F 4F36A 1C0UB 4NCGA 5HJYA 2H65B 4LRCA 4QOTA 4OHXA 4AL5A 2RE1A 1F3VA 2LXIA 3NGUA 3EYZA 2DGWA 4ZVHA 4JI8J 1V9OA 4F67A 4G1QB 4TNOA 2AP6A 3HVAA 4IRKA 1JNRB 4RUCA 2OFGX 2CQ4A 4CO2A 1RWXB 2B5JA 2DNOA 3JTOA 2KJWA 2D3OR 1IBLJ 3TW0A 1YX2A 1XNQJ 1HWUA 2HBRB 4DV1J 3IR7B 3LP0B 3DCAA 5HSPA 1IBCB 1J5EJ 2VA2A 5GAEU 2YXLA 3FUYA 1LWEB 2A1BA 5K9FA 3LGHA 4ZHRA 3W5ZA 2WVBA 3CIZA 3NNCA 3ET6B 4V1Ak 3VZIA 4RWXA 4DPXA 3UN5A 3A8EA 1FCAA 3GYGA 4TY9A 3BJYA 1Q86T 4ED2A 3HDSA 3M8QB 4ECSA 1L3VA 2VHGA 5KFEA 1M1GA 2O5DA 1HYSB 4M1KA 4DR6J 1T11A 5ITHA 4BDPA 5DLGA 4NLXA 4WK1A 2V0NA 1RHQB 1ZAXA 4KFBA 4DQQA 2MQNA 2HWIA 3MI7X 2J6SA 1FWLA 5D0EA 2YNHB 4V19X 2Z56B 1VMBA 3D54A 2FQQB 3NGDA 3MTJA 2XYHB 1IBMF 2FVPA 1RWVB 3N6MA 4CLLA 4U6PA 3H5XA 3GP9A 5EHHA 3PKMA 3GYNA 4TYBA 1FERA 3DDIA 3TUPA 4X4SA 1WD6A 1MWQA 2YWGA 3CMES 2JFKA 2VZ9A 4OJ1A 2HHHJ 4AL6A 3GB0A 1YLXA 4PWDB 2GAGC 3DOMB 3DOLA 3DYAA 2HK2A 3MCMA 4OX9F 1OMSA 4C97A 4Q43A 3B54A 1N34F 2RVJA 3C16B 1WSVA 3OVAA 3CUNA 3PFEA 3OSNA 1Q79A 5HMWA 5DDPC 2X1BA 2QX0A 1K8AT 3JSMB 3G6XA 1U09A 2BE9B 2LQBA 1VC0A 1DQAA 4EWTA 1RTZA 2QMUB 3W2WB 4FYVB 1N48A 2HHTA 1K9MT 2WVFA 4DUZJ 2G2ZA 2ZH4A 5ETOA 3KK1B 5FLXU 5HI7A 1IBKF 3T41A 4NLRA 1S6OA 5M2UA 2W01A 3QQCD 4KGKA 1IKYA 1FTRA 5E0OA 1PBAA 5CCLA 3IGVA 5FDLA 2J0XA 1HNVB 2B8QA 1SJ4P 1UW4A 6FDRA 2AYMA 1NJIT 4BWMA 5F8JA 2E1PA 1LFWA 2MZ1A 1M5PC 1X9MA 2OUGA 3G82A 2RILA 2FGCA 2M8DB 3F0NA 2CJYB 4XIUA 1DAXA 2BXJA 1R8AA 5F8MA 5GAEI 2ZH2A 1GTHA 2MQMA 3MAHA 3BO3A 4PXEA 3GWCA 2GIFA 2HGNA 5G0RB 2VL1A 2W9BB 4O23A 3K5LA 3FCVA 1UPPA 2MQLA 3PV8A 4MKBA 2XY5A 1JK9B 3OVBA 2YKNB 5RUBA 1PJ6A 5L1LA 4ER8A 5BR8J 2E1CA 2BUNA 1RUSA 1HQUA 3I4PA 4DL7A 3QT5A 4FNHA 4JI5F 1LNQA 2PMWA 3LOUA 3MCOA 2ZUAA 4LVNP 2Z30B 2DGOA 2HGLA 4JV0A 4ZP9A 2DIUA 1HQ2A 2P9EA 1KKHA 1G3OA 4J9LA 2PEHA 3TZZA 2NPIA 4EZ9A 1EQ0A 1JKHB 3KOAA 1X9WA 3WC2A 1GXTA 1RWWB 2CRLA 4HT7A 2X51A 4WXOA 4X65J 4E8UA 3OTOF 3M2VA 3GJQB 1PJ7A 2DRAA 1AT1B 1X4EA 2K7KA 1RZMA 1G7CB 1W25A 5F41A 2JWNA 1U1PA 4LIWA 2PD1A 3C14B 1R27B 4XAKA 4DV2F 3M2RA 1HNWJ 1F2HA 3AXKA 2RDDA 4ZVUB 3KDOA 1SQGA 4M63A 3B78A 4DEZA 3MFIA 1Q7YT 4PXBA 2N3LA 4DV7F 3R7BB 1QE1B 3WIUA 4LT6A 5D0HA 2OMOA 2NUUG 3DLHA 2Q43A 1E6VA 2YNIA 3C6TB 2VPYB 4BS2A 1YSJA 1NSAA 3M1VB 4DV5F 4FYXB 4ZPCA 3DLJA 2CQHA 3Q86A 5F8LA 3GFXA 4FKXA 4NLDA 1Q5YA 1UWAA 3MZIA 1VQ6S 4ZVEA 3BO4A 3F73A 4ED6A 1MG7A 1OQ3A 2RRAA 4TU7A 5D3GA 1TFWA 4RW9B 4DR7F 1TL7A 2AEMA 3KG4A 4L6V3 1D0EA 1FWPA 3GQCA 3R5JB 3HJFA 2KTQA 3HHLD 2UXDJ 1FFSB 2E66A 5HQLA 1ZM9A 3SCJE 4KRWA 1FK9B 1TKZA 1X5SA 3G8QA 5HMXA 3MUVP 2PO4A 4F26A 2QTWA 2EPIA 4MJKA 2AYEA 2QLJB 4NXNF 4DSEA 1FE4A 2VFTA 1JJ2R 2LEBA 1YITS 4LFCJ 1W26A 2ROPA 3CO9A 4DS5A 1DJ0A 5KFSA 1T05A 4ELVA 2VKZG 1RA6A 5K8MA 2NSCA 3FBBA 4ZP6A 1EAYC 3MOZA 3AODA 1VHIA 3JYTB 3ITHB 3UWTA 5IC6B 4I2PB 4JI0F 3IG1A 4A8OA 4ZVOB 5J1NA 1RTJA 1B99A 2BE7D 1T03B 5D4LA 4WFBQ 4QW9A 2F4VF 5AE1A 4P74A 4DMZA 3SQGA 5KOWA 4DPOA 2W7AA 2IMWP 5C24B 1VQOS 2FDNA 2CNOB 5JVHQ 1ZA2B 5GMEA 2IC3B 4GKKJ 2C2OB 4A48A 4NOHA 3CDBA 3N4WA 3C15B 1AA1B 2KT5A 4Q2LA 4O3NA 2DH8A 3NGTA 4M5HA 2CXEA 4CYUB 4HVZA 4B02A 4ECYA 1W2BR 3ZZYA 1KHWA 3TO8A 3E3XA 4OHYA 4AXIA 4PAAA 1U8SA 1PO6A 1RU1A 4A8WA 2J5AA 2V9WA 5H9EJ 4KHRA 2E5LJ 1TV6B 5LMUF 1AXQA 4KV8A 4TN2A 4DUYF 2MKHA 5ETTA 1Q82T 5BJRA 4UOCA 4J9KA 3G6ES 2ROEA 2HHSA 4NE9C 2R3VA 3M9OB 2DNKA 1AZSA 2Y1JA 1RWOB 2QZ8A 4Y34A 1CC8A 2ATCB 2M3DA 3CDEA 4USJC 2HS3A 3QLHA 3Q83A 1X4GA 2MQPA 2OD4A 4LF9J 1HMVA 1HPZB 1APSA 4C3KA 3R2CJ 2QSWA 1WUUA 4O0NA 3F44A 1HBMA 2CPIA 1UVKA 2K3IA 4PUOA 3ISNC 2QE5A 1KN6A 4CDIA 2MGZA 1IKVB 1JXVA 2OTLS 2CZ9A 3V4MA 3TAMA 5HROB 3CJKB 4M5GA 1TK5A 1V5VA 5EN1A 1SB6A 3H59A 3AD8C 2HHWA 3MAAA 4YN3B 1Q78A 5IV3A 2HRTA 3MMAA 3PTWA 4I0WA 2CNNB 3ZTOA 4OHVA 2LA4A 4FPIA 2H9ZA 4HI2A 3NY0A 1NPRA 3MUMP 5LSLA 2BQRA 1JLQA 4I64A 3H5SA 4P7VA 3T9ZA 5CABA 2X3DA 3TVZA 2HFSA 4JI2J 5HJXA 1RAEB 2RD5C 3VQTA 2WK4A 4ZN1A 4CCHA 4AQYJ 4B3SJ 1U0HA 4JV1A 3MM9B 3FGVA 3T6JA 1VQ4S 1Y11A 3NS7B 2Q6CA 2OH2A 1RCOB 1TKTA 2UXCF 4O4GB 2QO3A 1XJWB 4DR1J 3DGPB 4R8UB 1JNZB 4Q7AA 4IQMA 3MMBA 5F9LA 3CCES 2E5HA 1RJJA 2RSQA 2YH0A 2EI5A 3HHLB 1XR5A 1CJUB 2IJFA 4M5JA 1S1TA 3GSIA 1FKPB 4F2SA 2W9AA 2YX1A 4CLWA 3E01A 3KHGA 5GAHU 2SXLA 3OBIA 4OL8A 3VHQA 4B3TF 4OFZA 2RB7A 2AGOA 5BYSA 3QGHA 1SXLA 4NYOA 2RS2A 2X1FA 2J9CA 2JVOA 3M32A 3WQPA 2JH3A 4O4RA 1SUQB 2FVSA 2R7WA 1X4DA 1HLWA 1CJVB 2G2OA 3J7YU 1G2EA 3W63A 3VF0B 2L08A 2RQ4A 3HFKA 2I5JA 3W62A 4K0KF 4LJMA 2EFQA 4TVAB 2VDIA 3ZO7A 4O3RA 3D0GE 4DU8A 4UT4A 5FLXY 4OZ5A 3LAKA 1VHFA 2JDJA 3TUJC 3W8PA 1YJ9S 1JJHA 2HS0A 1N0UA 1VRTA 4QU6A 1FKOA 2IM2A 1Y4ZB 2KDOA 2XSJA 4C11B 3ILIA 4Q2MA 3R6GB 3GJSB 2HVDA 2J7KA 4WK3A 4U67Q 5EX3A 5I3PA 1CULA 3GV7B 2J0QD 1OWXA 3GJTB 2BOPA 2RHSB 2AEFA 4TKTA 3L9ZA 4N76A 3QSIA 2EC0A 4TU8A 1FRJA 4WU3A 2ZZNA 4L3KA 2PEBA 1RT4A 1FRHA 1RWMB 4MIBA 4QU7A 3ZNUA 1CS4B 4WBFA 1RABB 4WZQA 3TZYA 4IRDA 4AXJA 3QGGA 1RHMB 1DHMA 4X4PA 1RGVA 2DGQA 4URGA 5HO4A 4KR0B 4LF8F 4PG6A 4G6VB 3JAMU 4NCGB 4UOHA 5HVGA 1MROA 3SCKE 3NG8A 5K20B 1VGYA 3TEHB 1NJWA 5KT4A 4RO0A 2RF2A 4QIVA 2BQ3A 2Z57B 2ADCA 2GVZA 1T02A 3AOBA 4F0HA 5D0RA 2B4OA 3D67A 3RB6A 2B5JB 1WG5A 4ERDA 1QAJA 5EGYA 2DT9A 4LQ9A 2IFXA 5F8IA 2GC8A 4IH5A 3M6XA 1T95A 2UUTA 3M4XA 1D3WA 4DS4A 2C2EA 4CH0S 4ZN3A 3FVYA 3R3TA 4DFKA 1VIOA 3A13A 3M6VA 1TL4A 4EZ6A 4ECVA 4ZPAA 2NZ4A 5DDOC 2WHOA 4ZHRB 2GNKA 4ZPWR 2FC9A 2FJEB 2JHEA 4J9MA 5BYQA 2GZOA 3N0VA 4C3LA 1R7IA 3MPWA 2Q3PA 2HNZA 1N6QA 2VPZB 4F7VA 4JI6F 2ZDOA 1DY3A 5GAHI 2RQCA 3PVXA 4HTJA 1KQFB 4EBEA 2LDIA 1Q95G 2GQ2A 1KS2A 1EX8A 3G6YA 1QAIA 3KLIA 1F5AA 2ZKTA 3K5NA 1YTYA 3UNYA 3BR9A 3P5BP 3J7YI 2G13A 2IHR1 4DZDA 4ILLA 2AEJA 4KFBB 3UI3A 2CQDA 3GYXB 1L3KA 4JV2A 4RNNA 3OQ2A 3MPDA 4JI1F 2XGPA 1M0SA 4PG4A 2XEXA 3IA0A 3MM7A 1R6YA 6FD1A 1JJ4A 2CPYA 2OD6A 2MJNA 1YDLA 1D9DA 4OI4A 1ZBTA 3IWNC 1SJQA 2Y8WA 5J2PA 1ZM2A 2YNGA 4LF5J 2EK6A 2DNZA 4R5PB 4KGMA 4HLBA 4K4ZA 2ERRA 3DOLB 1Q8BA 1NZAA 1RTIA 1TVRA 1FJEB 4MKVA 1RT1A 2BA9A 4IO9Q 1IN0A 2B7BB 4DHVA 2QLXA 3QAEA 4GMKA 2OI2A 2OPPA 3I0SA 3GLJA 2Y1LB 1XC9A 3MR3A 4F4WA 4XO0A 2GX8A 1QVFR 1WSRA 4QJVA 3IO1A 1X0PA 4LSNA 1WHYA 3DLKA 3KK3A 3NNAA 1HI0P 5DO2A 1RTDA 1Q4RA 2BW7A 3MM5A 3CVKA 2OEJA 2H5EA 4Z37A 1HNIA 2H54B 1IKYB 4DFJA 1KDNA 1NSKL 4MYTA 1Z1ZA 5FDLB 2E5GA 1YRXA 3S01A 4AE5A 2M5YA 4DSJA 3DC2A 4DV4J 3C46A 4J9NA 4JOUA 3HM9A 5HANA 1J27A 3FJ2A 2V4RA 2MKIA 2VC1A 4NLQA 4W90B 5KG7A 3G82B 4LFBF 3FMWA 3OFGA 1SQFA 4O44A 2FC8A 2ZC3A 1V3SA 1WACA 3CJ4A 4L72B 4UY85 4Y2AA 2BANA 2MQOA 1H72C 4ZVGA 2IM0A 3H8YA 3PNIA 4I6YA 2OKQA 5HMYA 1HWIA 3J81U 3BQ2A 1B0TA 1GXLA 5E3AA 4ETXA 2DK2A 4IH7A 5CYMA 2J0SD 5H1SV 3A8IA 3TANA 1HQUB 1NEEA 3BGFA 2JLGA 5BYRA 4QYZK 1FI4A 2A2DA 4LF6F 1R8HA 4F0MA 1NK0A 4K4XA 4KGXB 3A3PB 1ZTWA 1C4CA 3A4TA 5JUMA 1TMMA 2BJ1A 2DPJA 1FJGF 4HHUA 4OJGA 1NLKL 3NBPA 5A2QU 2HQDA 2EVZA 5DQHA 3IBCB 1LW0A 1VBKA 4ZLPA 4I69A 2R7SA 2LQ9A 4WFYA 3IWLA 5DLFA 2W2NP 4CLKA 4X2BA 2GHPA 3PRBA 1URRA 1FRXA 2XNQA 4N47A 3M2VB 1U6FA 1V6HA 1Q81T 3VAFA 4UUXA 3G9CA 5D4OA 2CQ2A 3ILJA 4ICLA 5IXUA 3DLGA 3FNNA 1SKWA 3M2RB 3LGMA 4CM0A 1S1WA 4R0JA 2ALYB 3WBZA 3W3SA 2AGPA 3LH2S 3EICA 4B17A 3H5UA 2UVVA 1R8BA 2QFJA 3OTBA 4ID5A 1A0OB 2DISA 2G4BA 2KG1A 4C8LA 3K5OA 2QYGA 2DGVA 1YRUA 1E6VB 1KFDA 2YNIB 3LGNA 2F5GA 2XYPB 4F4XA 1S9FA 3TVKA 2DCLA 4F25A 1TL3A 2V8VA 4JYAF 4U96A 2ZNYA 5D3GB 4FP9A 2MTLA 2KZZA 1TL7B 5B08A 4PG7A 5AXKA 5EWFA 4X64J 3CTRA 1G1XA 4USIA 2FUG9 2IM3A 1PC4A 1GX6A 2HIYA 4DN0A 4NYPA 1VQPS 4CLFA 2CVEA 3OL6A 2DYAA 2O1PA 2C42A 1T9UA 4OLOA 4B3RJ 1TKZB 1ROFA 4DL0C 2UUBJ 4OYZA 2HHVA 3R2DJ 3MXHP 2U2FA 4X66J 4DUYJ 4V19J 4B3MF 3QT8A 2FHJA 4Z2XA 4PQUA 1DZ5A 5IC4B 4CO5A 4DQSA 2Y3YA 2K1RA 2MDAA 4YQWA 4ECQA 2VBZA 4NI2A 2LEAA 2UVRA 4OI1A 5LM7E 4ALZA 2YKOA 1T05B 3VAMA 2ILZA 3RW7A 2IA6A 3M6WA 4TLRA 4LSLA 1QAXA 5AXNA 3IG1B 3NL0A 1Z2LA 1RTJB 5FIIA 4DBQA 4KGZB 4EGLA 2IRUA 2FJDB 2J9DE 2BJDA 1TZ0A 3T5KA 3SQGB 3QNWB 1UVJA 3N5FA 4DR5F 1NDLA 2IRXA 3L4BC 1IR1A 4PABA 4OLPA 4OX6A 1EQMA 1TR0A 4KY3A 4ZVQB 3QPIA 1N33F 4MKAA 1SC6A 3SCLE 3TA0A 3CCMS 2C3OA 2ABYA 4KJIA 3GIIA 2V2ZA 1F9HA 3J7Z5 2KHCA 3LQVA 1Y5LB 1LOUA 1E6YA 4KV8B 2R8JA 2R9LA 1LWXA 3W66A 4C3MA 3HFZB 3D6TB 1GFWB 1U2FA 2XMTA 2KT3A 2YX7A 3L09A 4AT1B 1AZSB 1BE4A 1S7IA 3GCXP 4NLYA 4FVCA 1U1MA 2AIRB 1IR0A 3RAQA 3R5GA 1SKRA 3QLHB 1UPMB 1HMVB 1U26A 2UXCJ 1ULRA 3TUIC 2DNMA 2VC0A 1HD0A 1HBMB 2CQ3A 1B7YB 3DRRA 4PUOB 1FJ7A 1XBWA 2D1CA 3MMCA 1V3RA 2MGZB 2J7UA 4MTPA 5DETA 1ZH5A 2HHPA 3ZZOA 3TAMB 4HDGA 3NLCA 1N32F 1IUJA 3W9JA 4WTOB 3GFYA 2DHAA 4H4KA 3R5CA 2AJ2A 2WVDA 1XMQF 3MAAB 4J9QA 2E1RA 3DOKA 4DSFA 5ETLA 3MMAB 1FD8A 2POKA 5DG8A 4XTTA 2MY7A 3CPWR 2JEIA 3PYFA 4USTA 3VQSA 3D2WA 4EFAC 2LKZA 4F50A 4G3IA 1JLQB 1BUXA 3UO0A 3ETMA 4YB1P 2Y1IA 2OEKA 1F5CA 5CYQA 4ATNA 4OHWA 5B0FA 2AHOB 3RBXA 2XB2D 3G86A 1U0HB 2QIFA 4DZ6A 4DWIA 1RHRB 2XTJP 5IQQA 2I1RA 1FKAF 3VV2B 2AGQA 1C1BA 4NRTA 2GQQA 2P5VA 3CJ3A 2EKYA 4KYZA 1TKTB 1U1NA 2YWFA 4DV6J 4L74A 4WKRA 2C2DA 1O0PA 3GG0A 3MMBB 5KFWA 4OYXA 2GW8A 1EIYB 1GMVA 3HD2A 1S1TB 2CQ1A 4ZOSA 3ENQA 3NGKA 2DKOB 4K5RA 4KO0A 1S4FA 1WTBA 3QJPA 2D74B 3E01B 1VCTA 3L95X 1Z2ZA 3JXOA 3LWLA 1NBEB 4N41A 2Y8YA 1X4AA 5KOXA 4CTAA 2YNHA 3D6MB 5L39A 3HFVA 2FYXA 4QPXA 1BQMA 3M32B 5KG0A 3PR4A 1FXLA 1NK4A 5HQMA 3JQKA 1N88A 4I1TA 5AT1B 3K7RA 3PFOA 3T9NA 4EU0A 1MLAA 3KLEA 1RACB 1LXJA 4OX7A 5C25A 3ILLA 2I5JB 2ZH7A 2DGTA 4UF4A 3BBFA 1KOOA 3VGVA 4LF1A 2IDEA 4CLZA 3H90A 3CJRA 2B9WA 5CAAA 1H74A 1RWUA 1GAOA 3RTVA 1VRTB 1FKOB 4F4KA 4H4KC 2XSJB 4OYMA 3MD1A 3BKUA 2K06A 2W2OP 3HZEA 1N5QA 1CULB 2Y0SD 5ETNA 1S99A 2PMZD 3IMQJ 2KM8B 2DGXA 4K7QA 1HR0F 5T7LA 1AROP 1JIHA 1RT4B 4NZ0A 4OX8A 3TJ8A 1DARA 4NPOA 2IVYA 1S6UA 2O3DA 2XMJA 3SSQA 8ATCB 3HD1A 5FD1A 2VBXA 2MYFA 3PW2A 2DNQA 1MWYA 3EGWB 3UNGC 5IT9U 4QWBA 2BKNA 3U1LA 1S0VA 4L73A 1MROB 3NRBA 2JL9A 5LMNF 2QL5B 4IQXA 1QAYA 2BKPA 1GMUA 2HKEA 2RF2B 4OHZA 5CD4H 3ILOA 4DQRA 1U24A 1IKXA 2GVZB 4C8NA 2NYHA 3BQ1A 3PHTA 1M5HA 5T14A 2HYIB 1JXEA 2R2TA 4EI2A 3BSNA 5AJ3F 1BQXA 4BC7A 4GC6A 4UY8T 3FEZA 4PXDA 2Y0BB 2GJ2A 1YK9A 5A2QY 3MEDA 2N7CA 4E2FB 3C2PA 1ZM3A 1RXOB 2RKIA 3AXMA 3VGSA 1IKWA 3MF5A 2DNYA 4OI2A 1NCLA 4FF3A 1XR6A 3S1TA 3OJSA 3RU0A 3DNCA 4X4UA 3VVUA 4DCPB 2MZTA 5DS7A 4FXWA 5IS2A 3GFZA 2XC9A 1OYDA 3CCWA 2UXBF 3Q2SC 8AT1B 1I3OB 1AYEA 2P6TA 4NXMJ 2HNZB 1K1SA 1HL6A 1N6QB 1WOPA 3JTNA 3EMTA 2M2BA 4OI0A 3US5A 5A8KA 1RAIB 4P52A 2ASJA 2O01C 4C6AA 3KLIB 2IVFB 1NK5A 1HWLA 2YBVA 3GPAA 4P2MA 5LSOA 2ALZA 4LR8A 1M5OC 2G9OA 2HRYA 4J5OA 4C0OC 4LUBA 3G4SS 3T5HA 1UWBA 2YWEA 3VCDA 2OELA 2I38A 2V4QA 2PFDA 2NLWA 4P73A 2E29A 4DFMA 3OL7A 4TLQA 1NRKA 2CQBA 2LYVA 3OT9A 2VDHA 3M8WA 2YVSA 3MM7B 3U27A 5J2QA 2R7RA 1PGZA 1HNXF 3NGSA 3ONQA 1WF2A 2BM1A 4K8RA 4B9LA 4ID8A 2RQMA 3OFFA 5J2PB 3IC1A 3I82A 4M94A 2YNGB 3FQLA 3DRXA 2PE8A 2BMBA 4PR6A 5LXRA 5LJ3Y 1NPPA 4WU2A 1RTIB 2WVCA 2ZNZA 1TVRB 4KHPJ 4DJBA 1U2RA 2I8EA 2QA1A 3B4MA 1U47A 2IYGA 2RMLA 2UVUA 4FXDA 1RT1B 2VJUA 5JMNA 1ZPVA 4PZVA 3C6UA 4RNHA 1OSCA 3FRZA 1NKBA 3I0SB 1BGXT 3J80U 3EPIA 3DXBA 1N5YA 1HA1A 3EE3A 1S0NA 3ETOA 1V5IB 1S76D 4P7TA 2ZEJA 1GMWA 4LSNB 1XK8A 9ATCB 2IBKA 1FEHA 1CJTA 3DLKB 3KK3B 3VALA 3CCUS 1RTDB 4JI4F 3MM5B 5EDWA 2V8HA 1HNIB 4DV0J 1RAHB 3MECA 4OV1A 5KT2A 4FZVA 5CHCB 3P6YC 4N77A 3GIRA 2XS7A 4X4OA 1EP4A 1FRIA 3WX8A 3G8TA 2FGOA 2KKHA 4M5KA 1HHSA 1R43A 1NUEA 3AOAA 2CJKA 4O44B 4DI6A 1PC5A 2DIVA 3PDNA 1QUVA 4FS2A 2DR7A 3O5TB 2BANB 3BREA 5DM6Q 1J2VA 3BBCA 4QZVB 3LUYA 5GAGI 2CPJA 4JI3F 3TEGA 1SH0A 2Y9HA 2RDJA 3CB4A 2GMLA 5KG6A 2E5JA 3FZ2A 1NJXA 3KTQA 4RW7A 4A47A 5CYMB 3K59A 4MIAA 1EJ7L 1CG2A 5B0DA 1RHJB 3MR7A 2O67A 2DTJA 2WZ1A 3CJSA 5MLCV 1OQ6A 4E0DA 2VASA 2XG8A 2V50A 5HP1A 4ELTA 1LW0B 3CJ8A 2E7XA 3KLGA 2VODA 3CSKA 1AUSL 3D0HE 3GE9A 3TYTA 4L76A 3J7ZT 1QSLA 2EFVA 4EYHB 1X4BA 5GVQA 4N56A 4DL5A 2GJIA 2W1BA 5C7PA 1U0SA 5L8RC 4C2MA 4IUFA 1OPIA 2ASLA 3DLEA 2PI5A 3H42A 4ICLB 3DLGB 4LR9A 1VQYA 2GGPA 2DNPA 5L1KA 2JEGA 1S1WB 4DPYA 1WF1A 1WNEA 1SKUB 1DURA 4CP5A 1VK8A 4ID5B 1FRKA 4JV5F 5KT7A 1KTQA 2V69A 5KFXA 1WEYA 4DUTA 2OAUA 1R89A 4D3HA 4ANEA 4LF4F 4QWAA 5KT5A 1RQ0A 4RJVA 4QIWD 2FVCA 4PCQA 2PA8D 5A8WA 1OPZA 3PACA 2KVIA 2BM0A 3QGPA 2IYIA 1TL3B 1OY9A 5DG9A 2RQKA 2ZM6F 2C2RA 2J9EA 2VJVA 3Q8RB 1UVLA 3W9HA 2MKSA 4N7TA 1ZZFA 1YBTA 2JC1A 1BMQB 2G1HA 3UDVA 2ZWOA 3H2VE 2R7VA 1ZOTA 4U9RA 2IY5B 4K2JA 4ED8A 1C2PA 1DTTA 4C9DA 4J9RA 4RW8A 1XMOJ 1RI7A 1KOHA 4RUBA 3BPSP 2NS1B 5C2CA 1CEZA 1W7WA 4UOGA 3OFHA 5CYJA 2AW0A 2Q6BA 2J6TA 2QL7B 5ETVA 1VIXA 2WSEC 3UCZP 3GV8B 1KHVA 5KFIA 3KHLA 4PQUB 3ZTPA 1U6ZA 1HI1A 2KU7A 2K1RB 2G0IA 2HEKA 4NI2B 3K57A 2AMCB 1S0MA 3QRPA 1NSQA 4WE1A 4ZCKA 4JI7J 2VFVA 4WXWA 1IJEB 3JSBA 4KBIA 1X4FA 1XQIA 2WOMA 4LSLB 4ZP8A 4LFAJ 2D41A 3OL9A 3NXZA 2IVMA 2DNRA 3MPVA 1JLFA 3UCGA 2XMKA 3ZZRA 2VB6A 3UR0A 2NQPA 3QT6A 2B8PA 1HNZF 2NSBA 1GH8A 5A6WA 3G87A 2H51B 3CCLS 2D9OA 2EEYA 2F8EX 1S57A 2KRRA 3NCPA 3MTKA 2ZZMA 2V68A 4J90A 4CNYA 1XMQJ 4DV3J 1M1KT 1QSSA 3FMBA 1SL2A 1QJHA 2NXNA 3K2YA 4EEYA 1E6YB 1YWXA 1H98A 5IT9Y 2NPFA 3CJTA 1RT6B 1TUGB 3AA8A 4FYWB 3G71S 4DL6A 3I55S 3SV3A 2X7IA 4X84A 3I5BA 2CG8A 2KO1A 1ZETA 2XCAA 1CS4A 2MHEA 4ANDA 2CPEA 3CGIA 4FF2A 5EWGA 1QDUB 3D7SB 2AWZA 4ZK7M 1T7PA 3MGJA 2FTRA 3IBWA 4KKOA 1S12A 3CDAA 1N36J 2UUCF 5HL7Q 1YRTA 3AHPA 5I3UA 2XI3A 2VD3A 3DRRB 4WP3A 3L3CA 1HBNA 3MMCB 1VQ8S 4C8YA 2CYYA 4GO5X 2HZVA 4LRAA 4RW6A 2AU0A 3FCHA 2NXUA 1D09B 1Y0HA 1TAQA 4NASA 2KFYA 5H9EK 1RADB 3DOKB 1KNZA 5GADU 2BR0A 5GMKa 2ZD1A 2HBYB 2FJWA 3ZC4A 5HN0A 4M5DA 3TJAA 2B56A 3P96A 2HVIA 2ZDPA 1RHKB 1PYOB 2MZSA 3TX0A 3SDEA 3BBBA 5CYQB 5DZ7A 1DRZA 2HBZB 2DNNA 3CDWA 1RWPB 2GIRA 1UVIA 4X4TA 4NYZA 3LF0A 3IR5B 4DXLA 4G1IA 1C1BB 3TWZA 2HIQA 2XMMA 4WYWA 3T1HF 2GQCA 1V3ZA 1Q16B 3PG9A 2CUYA 2IRYA 4MFBA 3NS6A 5E33A 2CNLB 2I2YA 4L75A 1NK8A 1LKZA 1RAAB 2QGFB 4RW4A 2V4JA 1TL1A 3R97A 1YZ7A 3TAPA 3FBEA 3Q22A 2CWKA 1Y10A 4KO0B 3QFHA 4ELUA 2R4FA 4OZ3A 1NDKA 3CCJS 3KUEA 4P75A 4LBIA 4Z7CA 1RWKB 3H20A 3D3BJ 3A1YG 4CTAB 3M8SA 1KQSR 3N28A 4PWWA 3NEKA 1BQMB 3EUNA 5CCMA 4WFXA 5L46A 2C3YA 3J80Y 1MWZA 4G1PA 1S48A 2EG2A 3KLEB 1GMWD 7AT1B 3ZXWA 5C25B 3KJNB 4Y28C 2ACMA 3OFEA 4R5PA 1SJRA 3MCNA 1XNRF 5HAOA 4A8SA 2OGUA 2NUHA 2H5IB 3I0RA 1S9GA 4JI8F 2RUGA 1RBOB 4EBCA 1KEKA 4HI1A 4ZJLA 2VFSA 4IR1A 5L9XA 4BC9A 2UP1A 2J0WA 1K47A 2M7SA 1IBLF 3OLAA 4PYDA 5D77A 1SC3B 5T7LB 2HWTA 4PRFA 2LDYA 1XNQF 1NH8A 4DV1F 1S59A 3HK2A 3S8SA 2UXBJ 1QTMA 1DBDA 3UDEA 3AJ2A 1J5EF 2B4PA 4MKYA 1TUVA 1SCJB 5KFMA 4TU9A 3I6PA 1I51B 2PMHA 3TA1A 3OLBA 4J7CA 3IM9A 3EM1A 4P2XA 3SEOA 5C5JA 4ECXA 4EYIB 4Y6IA 2WAQD 4X4RA 2C22A 1OSDA 3H4BA 3I56S 2LCWA 1IKXB 3M9MB 3Q8YA 2I9SA 4UW2A 1WOOA 4C8KA 4B9SA 1KR4A 3HI9A 3EJMA 5M2RA 3UFCX 3HULA 4PG8A 3UDCA 2J76E 3H98A 4M95A 4LF2A 4DR6F 1SPBP 1HBUA 1VOMA 2XS2A 3QO9A 3HXMA 4QWDA 3M8ZA 3MEDB 3T19A 1B3TA 1S72S 2B0GA 2BJ7A 3KLHA 2RKIB 1SL0A 1FVSA 5E3RA 3V6DA 1IKWB 1IM6A 3OXGA 1B70B 3HPOA 1C4AA 2PFFB 1N56A 2ASDA 2GHWA 1WKJA 4QIFA 4YHHJ 3C3LA 2PA3A 3MOJB 2CPDA 2WSFC 3Q0AA 4FNIA 4DPWA 4Q8FA 2N3OA 5A0YA 3LO3A 2KXNB 2OFHX 3BR8A 3R1LA 2HHHF 1RE1B 4OZ2A 1UZDA 2VG6A 5HBMA 2DHHA 2MLXA 5A8KB 4ES2A 2LU2A 2VPWB 3H5YA 2B4VA 1TKDA 1GX5A 2XY7A 5F8HA 2EK1A 3V81A 4WIQA 2LP4A 3CC7S 1YJ7A 4OIXA 2YNFA 3H25A 2RT3A 3H2LA 3WIVA 1U6BA 1UWBB 3OR2A 3OVSA 1HD1A 3HSJA 1H0HB 3O2IA 1R8CA 3V5RA 4DUZF 1L5UA 5J2QB 3HSGA 3KJVA 4PG5A 1AUDA 2JLFA 4NWBA 3IP0A 4M5LA 1X60A 2EKNA 4DR4J 4U7CA 2MSSA 4DPUA 1NHUA 4Y2MA 1U1OA 4F0KA 4QR2A 2XMAA 5D15A 2K8GA 1K0VA 3R8YA 3A8JA 1VQSA 2NYIA 1BXNA 5DGAA 4P2SA 4WF9Q 4R0EA 1ITPA 1RT3A 3DN9A 5ETQA 4DX8H 1TELA 4M5IA 4A8FA 3C6UB 5B0EA 3BB5A 5HVFA 2Z58B 1I94J 2UUAJ 5KFZA 4U8YA 1KSPA 4H4OA 4KQZA 2KHDA 4WIIA 1FWKA 2VFRA 3I32A 5M2PA 1N5YB 1S1XA 1QD1A 4DCJB 4URQU 1BLUA 1NPKA 1CJTB 3AT1B 2YQ3A 1QLNA 3CNQP 1U1LA 3KWMA 5BR8F 1NK7A 2E7WA 2N4CA 1PYSB 1SC1B 1N5VA 3MECB 2DR9A 4OYOA 2KI2A 3P8BB 1RHUB 3X1LB 4QW8A 5GMDA 3OR1A 3IR6B 1N0VC 1U7LA 1EP4B 1U48A 2Z2YB 5J2NA 1QUPA 3V4IA 1S79A 4A8XA 4PWUA 3SQOP 2BQUA 3KNAA 2XWYA 1RAJA 3T1YF 3LA0A 3FDSA 3G8SA 2KYXA 2DD8S 1C0TA 2YX4A 2ZHAA 2RDIA 3CMAS 3W8GA 1T94A 3PY8A 1F2GA 2JSXA 3MEEA 4K4WA 4X65F 1BC6A 3PW4A 3DMJA 3Q8VA 1NSPA 4ES3A 4EO8A 4NCBA 5KFJA 3OSPA 1WKKA 3I96A 2F65A 4LF4J 4LRFA 1NK6A 2XY6A 5J1EA 4X4NA 3K89A 4RW7B 1IQZA 2MKJA 4KHMA 1UEUA 2X1AA 4I56A 3CC2S 2HQFA 4F4AA 2HRUA 4RNOA 1ZAWA 4RPFA 3F56A 2DY1A 3IS9A 2QEXS 1F1BB 2B51A 5E5NA 4BCAA 3JSYA 2ZM6J 2RAQA 3Q24A 5KFPA 5KFFA 4C98A 5HP1B 2V8PA 1BWVA 4B3OA 4M5MA 4HYKA 4N5SA 2VQFJ 1F5BA 2JOQA 3KLGB 2Z8QA 3E2EA 4ILMA 2NR0A 4WJBA 5H9FJ 4XDDA 4ZA1A 3ENVA 1RBLA 2XZWA 3D1OA 5KFUA 3QATA 3KLVA 1UVNA 2AJFE 1DLOA 3NOCA 1MMNA 1Y9OA 3AFGA 5HK4A 3DLEB 3M8RA 2VIHA 3DRPA 2VBYA 2W2QP 3P4UB 5IT0A 2GIQA 3GCWP 2GGPB 5EUHA 1YJVA 2W9CA 5A8RA 2DHGA
chains in the Genus database with same CATH topology
2J6UA 2W8LA 1WD6A 2Z2MA 3FFIA 2YWGA 4CO3A 3CMES 1FT8A 4OHWA 2JFKA 2VZ9A 5B0FA 4ATNA 2XB2D 3UE2A 2MHNA 4OJ1A 3G86A 2QIFA 4AL6A 3GB0A 4DWIA 4RX6A 2C28A 2VG5A 3U7JA 4Y2CA 1YVFA 2CPHA 2FIUA 2XS5A 5IQQA 2I1RA 4CIOA 3CC4S 1H3DA 3ISZA 1FKAF 4PWDB 2AGQA 3DOLA 3DYAA 1C1BA 2B9XA 3DU6A 4NRTA 2GQQA 4A8KA 2WCXA 1JX4A 2P5VA 4RZRA 4OX9F 2QYCA 3GZ7A 4C97A 3M8PA 3CJ3A 2EKYA 1RT7A 3EZUA 1TKTB 4Q43A 1U1NA 2YWFA 3R5AA 4MIWA 1N34F 2GCFA 3OTCA 2RVJA 3OVAA 3F41A 3CUNA 3PFEA 2AF6A 3UD4P 3OSNA 1Q79A 5HMWA 1CLFA 5DDPC 2YKPA 5A8WB 2C2DA 4WKRA 1O0PA 2X1BA 3GG0A 2QRRA 1K8AT 3PXGa 3JSMB 3G6XA 3MMBB 4QYRA 4KIAA 4QIGA 2MXYA 5DQGA 2AJ0A 2RNEA 4LFCF 5KFWA 1U09A 3ZZTA 1YBAA 2GW8A 2LQBA 1S6QA 3H4DA 4CQ1A 1L3SA 2DRBA 1ZYQA 1S1TB 2CQ1A 2I0XA 1VC0A 1DQAA 1RT5B 2W25A 3TR5A 4ZOSA 3ENQA 4EWTA 4ZCMA 3NGKA 3QWUA 4K5RA 4KO0A 1S4FA 3AB2B 1WTBA 3QJPA 3W2WB 4KHPF 2DGUA 2D74B 3E01B 1M90T 1VQNS 4TQSA 3L95X 4RLEA 1N48A 2AJ1A 4FF4A 1Z2ZA 2HHTA 3LWLA 1K9MT 2OPSA 4P6QA 4C7QA 2HNYA 4N41A 5KFBA 4I7FA 1SBRA 5IT4A 1X4AA 5KOXA 4CTAA 1X0FA 2YNHA 4XDCA 2L41A 3OUYA 4UQTA 2OSRA 1WEZA 4K50A 5D8HB 3CD0A 2ZH4A 4Q45A 1M5KC 4DFPA 1P6TA 5L39A 2A3JA 1SIWB 3KK1B 5HI7A 2QMWA 1IBKF 3UW1A 3P3DA 2LECA 4NLRA 4QPXA 2RIJA 1BQMA 1S6OA 4ZP7A 3M32B 5M2UA 4FYDA 5KG0A 3PR4A 1DTTB 1FXLA 1K0TA 2F9JA 4KGKA 1IKYA 2WW8A 1FTRA 4WFAQ 1NK4A 5D78A 1KLMB 5E0OA 4RW8B 3MM6A 5CCLA 1N88A 1JLGB 4I1TA 3IGVA 3DU5A 5FDLA 4BHQA 2DNLA 3K7RA 1VRUA 3PFOA 2J0XA 1HNVB 3T9NA 2OIHA 2IAJA 1SJ4P 4EU0A 4B9VA 3KLEA 4Q8EA 5IZHA 2KXHA 5KFTA 1LXJA 1FTCA 4OX7A 4HDHA 5C25A 4NLTA 5B0AA 2I5JB 1UW4A 6FDRA 2ZH7A 2DGTA 5CH7B 1VJWA 3VAGA 2AYMA 4GKKF 1K1QA 1KOOA 1NJIT 3I5AA 4BWMA 2DR5A 3HHEA 3KK2B 3LP1A 5F8JA 2EFPA 2R8IA 1LFWA 3UR3C 5HLFB 2DJWA 3CDUA 2MZ1A 4LQ3A 2HLTA 1M5PC 4DV0F 4J9SA 3VZHA 3MM8B 1X9MA 4YDXA 3RAXA 2UUWA 5K14A 5FJ4A 4FPRA 4H4MA 2B9WA 2RILA 1RWUA 2FGCA 1GAOA 2M8DB 1R0AB 3RTVA 1VRTB 4XIUA 5DRKA 2R2SA 2IMOA 1FKOB 3KG1A 1JWWA 1DAXA 2BXJA 1R8AA 4F4KA 3DI6A 4H4KC 4WKYA 5F8MA 4C8MA 3PEJA 5GAEI 2ZH2A 2XSJB 1GTHA 2MQMA 3MAHA 3MD1A 4WE1B 3BO3A 3HZEA 4PXEA 1N5QA 3HF5A 1VFJA 1Q7LB 3PM9A 3GWCA 2HGNA 5G0RB 2VL1A 2W9BB 4O23A 2Y0SD 1S99A 2WOMB 2PMZD 2E5LF 1CPZA 1UFLA 4NZ7A 5KFCA 3K5LA 2LXUA 3I9V9 3P5TL 5ADZA 2WB1D 4UQGA 2KM8B 2DGXA 2MQLA 2HMIB 3PV8A 4MKBA 2XY5A 1HR0F 1JK9B 5E41A 2Y1RI 3OVBA 3NWGA 5KTQA 5T7LA 1AROP 2YKNB 1JIHA 4CO4A 4DF4A 1JLFB 5L1LA 2QA2A 1RT4B 1IJFB 2E1CA 4NZ0A 4Y65A 2CDQA 1RTHA 2B6AA 4OX8A 2BUNA 2ZE2A 1DARA 3KKFA 3SI8A 1SH3A 3OTEA 4NPOA 2OPRB 2W7OA 2IVYA 1HQUA 2VOPA 3CJ2A 2B7CB 1FO1A 3N6LA 5K8PA 1X8DA 1S6UA 2O3DA 3ENWA 3FSXA 3I4PA 5D4PA 5JXSA 1X9SA 2XMJA 4DL7A 3SSQA 4DSKA 2KFZA 4J9OA 5FD1A 4ECRA 2QV6A 2VBXA 2MYFA 2WTFA 5E3QA 3PW2A 2DNQA 4FNHA 1TL5A 4JI5F 1MWYA 3NAHA 3EGWB 3LOUA 3CF5Q 2FHKA 3UNGC 4LF9F 2XBPA 2XI2A 4QWBA 1YJNS 3U1LA 1S0VA 1OS5A 2R7UA 1MROB 4LVNP 2RU9A 4PKDB 3SCIE 3NRBA 2JL9A 2DGOA 4O3PA 2OTJS 2D9PA 1FRLA 1SV5B 3VAHA 1R3NA 2HGLA 4JV0A 5LMNF 1LK5A 4ZP9A 4IQXA 2DIUA 2P9EA 3X3UA 1QAYA 3U1NA 1G3OA 2XLJA 4J9LA 4YFUA 2RF2B 4OHZA 5CD4H 3NNHA 3PX0A 4DQRA 1U24A 5CA5A 1IKXA 1S9EA 2PEHA 1PSDA 4C8NA 1ELOA 1VS3A 2NPIA 3OW2R 4KE5A 4EZ9A 1SH2A 5IQ6A 4YDDB 3Q8PB 3OL8A 1HBOB 2DB1A 3BQ1A 1JKHB 1AFJA 2P6SA 3KOAA 4RBTA 1X9WA 1M5HA 2BRKA 1NO8A 1YJUA 5T14A 3WC2A 3WDOA 2MMYA 2HYIB 1GXTA 4PPDA 1JXEA 2CRLA 4HT7A 5LJ5Y 2R2TA 2X51A 4WXOA 2CFXA 2RRNA 4CT9A 4E8UA 3BSNA 5EX0A 5AJ3F 3OTOF 3M2VA 1BQXA 3L7OA 2E5IA 4BC7A 2HZCA 2F9DA 1HW9A 4GC6A 2DRAA 1YI2S 4UY8T 3FEZA 4PXDA 1B7FA 3TAQA 3BO2A 2R8KA 1X4EA 3PJWA 2FLNA 3HKWA 1JB0C 5KFVA 2GJ2A 2K7KA 1W25A 1G7CB 3I31A 5A2QY 3MEDA 2JWNA 5F41A 2N7CA 2LMIA 4DF8A 1U1PA 4LIWA 3C2PA 4I6WA 1SQEA 1ZM3A 2PD1A 2RKIA 1G6BA 4DDFA 2EFOA 1R27B 4XAKA 4DV2F 1TAUA 3M2RA 2XMWA 5KFOA 1IKWA 3MF5A 1UKUA 2DNYA 4OI2A 4B9MA 3CCQS 2M0GB 1FXDA 2N82B 5EWEA 2FVRA 1REVB 4FF3A 1XR6A 4M63A 2HVZA 1X4CA 3TNVA 3S1TA 2L9WA 3OJSA 3B78A 2K7JA 4DEZA 3MFIA 1Q7YT 1RKJA 1F9FA 3TARA 3RU0A 3DNCA 4X4UA 2MJUA 3E51A 1DFDA 1JLAA 4PXBA 2MZTA 2N3LA 5DS7A 4FXWA 3VR1A 3BQ0A 3TQ1A 2R7OA 1KVIA 4DV7F 2LVWA 4KKOB 1LWCA 2WB4A 1QE1B 4LT6A 2VOOA 3MWBA 5IS2A 2OMOA 3GFZA 2VV5A 2C3UA 5AXLA 2XC9A 2R7XA 2NUUG 2ZOMA 3GR1A 3DLHA 1FE0A 2Q43A 4JI2F 4DG1B 1E6VA 2YNIA 3CCWA 3C6TB 5I3UB 2UXBF 3Q2SC 3KG0A 1P9QC 3IRWP 2VPYB 2YKMA 4LF7F 2BJEA 2F7VA 4BS2A 4ZPBA 1YSJA 1WELA 2P6TA 2HNZB 1K1SA 1HL6A 2MZQA 1N6QB 2OPQA 3M1VB 4DV5F 4AQYF 4B3SF 4ZPCA 3DLJA 1VC6A 3AB4B 1WHWA 7FD1A 1HBNB 3D0IE 3JTNA 4Q0BB 4MMOA 4GO7X 2CQHA 5F8LA 5KFNA 1HQEA 4YR0A 2R8HA 3GFXA 2M2BA 4NLDA 1KQKA 4OI0A 3US5A 5A8KA 2MPUA 3MZIA 1S77D 4CH1A 2ASJA 2O01C 1VQ6S 4ZVEA 3BO4A 2OO4A 2DPIA 2FHOB 3KLIB 3F73A 4ED6A 3M30A 2IVFB 1OQ3A 2RRAA 1MU2A 2Z2LA 1NK5A 4TU7A 5D3GA 1CQMA 1TFWA 4RW9B 4RW6B 4DR7F 4OZLA 1HWLA 4B9NA 4Y2IA 4DR1F 5AE3A 3KG4A 3O8WA 5LSOA 1JLEA 1ZM4A 2IM1A 5K8NA 2HHQA 2ALZA 4L6V3 4JUZA 3T5JA 3CD6S 2O66A 2WSCC 1D0EA 5J2MB 2J0QD 1M5OC 3GQCA 2G9OA 1J5OB 2HRYA 4J5OA 4C0OC 2E1MC 3HJFA 1SJ3P 3TX8A 4LUBA 4X62F 3G4SS 3T5HA 3VWSA 2KTQA 1UWBA 2YWEA 4YOEA 3HHLD 2Q79A 2ZFHA 3IRXA 3VCDA 2ZD1B 2I38A 2V4QA 2XMVA 2E66A 2CZ4A 2NLWA 2BBEA 4WTYA 1UL3A 2E29A 3KHHA 3OL7A 4DFMA 4M5DB 3ICLA 4TLQA 1NRKA 1Q53A 1I1GA 1JLBA 1NJZA 2E9RX 3R5DA 1LQ9A 2EW9A 4A8MP 2CQBA 2LYVA 4ECZA 1ZM9A 3GFHA 2YVSA 3MM7B 3U27A 5J2QA 3SCJE 2R7RA 1YQHA 1PGZA 4KRWA 2W4PA 1HNXF 1FK9B 1TKZA 1X5SA 4IG0B 2D7SA 3G8QA 3FZBA 1NB7A 2VA3A 3ONQA 5HMXA 3MUVP 2JX2A 2PO4A 1WF2A 4F26A 2MB0B 5DDQC 5IM0B 2BM1A 3SDEB 2EPIA 3BGUA 4MJKA 4B9LA 3CJ0A 3GV5B 2AYEA 4ID8A 1LV5A 4NXNF 2RQMA 1RYSA 5AXMA 2XCPA 1XMBA 1YJRA 4YEAA 3OFFA 4DSEA 1CC7A 2COLA 5J2PB 1XMOF 3IC1A 1KONA 3I82A 1FE4A 1N8RT 4M94A 2VFTA 2YNGB 3DRYA 4TYAA 1UJ6A 3SZ2A 1JJ2R 3FQLA 3DRXA 4TY8B 2PE8A 4ZPDA 3QZ8A 2LEBA 4PR6A 5LXRA 1YITS 2ROPA 3CO9A 4DS5A 1DJ0A 5LJ3Y 1XR7A 3HHLC 2AYBA 4IDKB 4WU2A 1RTIB 5KFSA 1T05A 4DL3A 4ELVA 4HL9A 2ZJRQ 2ZJPQ 2ZNZA 2VKZG 1RA6A 1TVRB 3JAMY 4OZ0A 5K8MA 4C0HA 2NSCA 1U2RA 4DJBA 4DQIA 2KFNA 2I8EA 2QA1A 4BWJA 3B4MA 1U47A 4ZP6A 3MOZA 2IYGA 2RMLA 2UVUA 3JYTB 2HNDA 4MFBB 1RT1B 1R31A 2B3TB 4FXDA 4YR3A 4ZS6A 2PT0A 4HKQA 3ITHB 1S1VB 3UWTA 3K58A 4I2PB 1ZPVA 4DLGA 3KLFA 3C6UA 3BN4A 5F0WA 4UUWA 3IG1A 4JI0F 1T3OA 4RNHA 4A8OA 1LXNA 3CT9A 3DDKA 4RW4B 2UV8G 1OSCA 2V4JB 5J1NA 1QSYA 1RTJA 4IOBA 1TL1B 3FRZA 1NKBA 2ZHBA 1T03B 3I0SB 1BGXT 2HW3A 4OZNA 5D4LA 4WFBQ 4A8YA 4QW9A 3DXBA 4NLWA 3EPIA 3HP6A 2F4VF 4JI7F 5AE1A 4MK9A 1N5YA 1HA1A 1RK8A 4K5SA 3S6EA 4DMZA 4ZKAA 4ZDNA 3SQGA 1S0NA 4RNMA 1FEEA 3ETOA 1D1UA 3IAS9 5T41A 2ILYA 1S76D 1F0XA 4LFAF 3K0JA 3MDFA 2EG1A 5KOWA 4P7TA 4DPOA 3NMRA 2W7AA 4DSIA 4LSNB 1XK8A 2IBKA 4QWCA 4F4YA 1FEHA 2IMWP 3DLKB 1FDAA 3ZZUA 5C24B 1VQOS 3KK3B 4B9UA 2FDNA 3VALA 2K3KA 1VBXA 4EO6A 2CPFA 3CCUS 2W8KA 5JVHQ 4A4JA 2HHUA 1RTDB 2R8GA 4JI4F 1FDNA 1OIAA 3KHLA 1JLCA 2IC3B 4MYUA 3MEKA 2XHWA 3MM5B 1C0UA 5EDWA 3GIMA 4A48A 3QJJA 2E44A 2V8HA 3AAWB 1AFIA 4F3OA 4NOHA 3Q2TC 3CDBA 1T8EA 3N4WA 1HNIB 1VQ7S 2KT5A 2CVIA 1UP1A 4HH1A 4Q2LA 4O3NA 4Q5VA 2DH8A 3VTIA 3MECA 4OV1A 4DL4A 2Q1LA 2A18A 5KT2A 2UV8A 4FZVA 4O3SA 5CHCB 4HVZA 2V8GA 4B02A 4ECYA 1W2BR 4NX9A 3THVA 3ZZYA 3HX9A 3P6YC 3EGZA 4N77A 1P1TA 4OQJA 4G1QA 2XS7A 1YGYA 1EP4A 4X4OA 1FRIA 1KHWA 2J0SD 2Z4PA 2ZUGA 3TO8A 4O3QA 3E3XA 3G8TA 4AXIA 4CH7A 4OHYA 5F8NA 1U8SA 2FGOA 2KKHA 3WC0A 4IOCQ 1PO6A 1BQNA 1WI6A 2HFNA 2KRBA 1HHSA 2BABA 5E3PA 5DM7Q 4J37A 4A8WA 3P49B 2J5AA 2QSFA 5H9EJ 4KHRA 2V9WA 1R43A 1TV6B 3EGNA 1AXQA 3NKYA 4KV8A 4TN2A 5LMUF 2ATLA 4DUYF 2MKHA 1TK8A 1FHTA 1Q82T 3I0RB 5KFGA 1S9GB 2A2CA 3PEHA 5BJRA 4DV3F 3LPYA 5KG1A 2CJKA 4KPYA 2CQCA 4UOCA 4O44B 2AJQA 1PC5A 2DIVA 3PDNA 4J9KA 1QUVA 4FS2A 2DR7A 3G6ES 3ISND 3LP2A 2HVHA 1X7VA 3O5TB 2ROEA 2HHSA 2FPHX 2BANB 3LP0A 3M9OB 5E3CA 3HVWA 3BREA 5DM6Q 1TKXA 1YG0A 2DNKA 1J2VA 3ZZZA 4KAIA 3W2VA 4QZVB 3LUYA 1EETB 2Y1JA 5GAGI 2CPJA 2JC0A 4JI3F 2QZ8A 4Y34A 4MK7A 2HWHA 4ES1A 2DHSA 1SH0A 1CC8A 2RDJA 3CB4A 2GMLA 2KT2A 2M3DA 3CDEA 1LWEA 5KG6A 1U1QA 1U49A 2E5JA 4USJC 5CZXA 3FZ2A 2HS3A 3T5LA 3CD5A 3QLHA 1NJXA 3FSYA 1X4GA 3KTQA 4DOZA 3Q23A 2MQPA 2OD4A 2BYCA 1HMVA 1HPZB 1APSA 4RW7A 4A47A 4C3KA 5CYMB 3K59A 3PIPQ 2P9GA 4MIAA 4ZVFA 2QSWA 2GHVC 1S1UB 3F44A 1H38A 4K4UA 3OHAA 1CG2A 1Y00A 3LWMA 1HBMA 5B0DA 1ZZNA 2CPIA 3Q8SB 3POTA 1UVKA 2K3IA 3I9ZA 4PUOA 3ISNC 2QE5A 4N8OA 1P8GA 2O67A 2M8HA 5C42A 3EZ5A 1KN6A 1KQGB 2DTJA 1VBYA 1T3NA 2MGZA 1LW2A 1IKVB 1RP5A 2OTLS 3M8QA 5MLCV 4XPEA 1OQ6A 2KYZA 3IFEA 4E0DA 3L7PA 3V4MA 5HROB 3TAMA 3BSCA 2VASA 1N36F 2CIMA 3HVTA 5SUHA 2XG8A 3SMZA 1HYSA 4IFYB 3CJKB 3PIOQ 5DG7A 1TK5A 5EN1A 1SB6A 5HP1A 4OJ3A 4ELTA 4IOAQ 1S6PB 1LW0B 3BEGB 1D8YA 2L48A 2VBWA 2KZMA 2E7XA 5DGBA 3RB3A 3KLGA 2VG7A 4IFVB 2VODA 3CSKA 3H59A 2HHWA 1YJTA 5THWA 3D0HE 2WBRA 4IYQA 3GE9A 2AJ4A 3TYTA 2FY1A 4MH8A 2ZKUA 3J7ZT 1QSLA 5L9NA 4K2XA 4RBVA 1Q78A 3JTPA 2IBOA 3MMAA 2EFVA 4EYHB 1X4BA 2U1AA 4I0WA