5ETVA

S. aureus 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase complexed with ampcpp and inhibitor at 1.72 angstrom resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
158
structure length
157
Chain Sequence
HMIQAYLGLGSNIGDRESQLNDAIKILNEYDGISVSNISPIYETAPVGYTEQPNFLNLCVEIQTTLTVLQLLECCLKTEELHRIRKERWGPRTLDVDILLYGEEMIDLPKLSVPHPRMNERAFVLIPLNDIAANVVEPRSKLKVKDLVFVDDSVKRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
publication title Structural Basis for the Selective Binding of Inhibitors to 6-Hydroxymethyl-7,8-dihydropterin Pyrophosphokinase from Staphylococcus aureus and Escherichia coli.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 44
structure length 157
sequence length 158
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2015-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 5etvA00
5ETLA 5ETKA 3KUGA 1IM6A 4M5GA 3ILIA 2CG8A 5ETVA 4AD6A 2F63A 4M5IA 1KBRA 4CRJA 1F9HA 1EX8A 4M5JA 2F65A 3MCMA 4M5NA 5ETNA 1RU2A 1DY3A 3ILLA 4CWBA 4F7VA 3MCNA 3HT0A 3ILOA 1HKAA 3HD2A 5ETQA 3KUHA 5ETPA 1CBKA 2BMBA 3IP0A 4M5HA 3HSDA 3MCOA 4PZVA 4M5KA 1RTZA 3QBCA 3ILJA 5ETRA 3HSJA 3HSZA 1G4CA 4M5MA 3UDEA 4CYUA 1TMJA 1EQ0A 1EQMA 5ETSA 3HSGA 3UDVA 1HQ2A 5ETOA 1Q0NA 1TMMA 1RB0A 4CYUB 1RU1A 3HCXA 3KUEA 4M5LA 3UD5A 3HD1A 5ETTA 5ETMA 2QX0A 1RAOA
chains in the Genus database with same CATH superfamily
2CAJA 2IJFA 2FZGB 2JDJA 3IRXB 3CCRS 3CD0A 3MEDB 2DHSA 5HVFA 1AB8A 2KM8C 1BY9A 2MY8A 4UTGA 2GA7A 4DL2A 1ZTTA 2M7SA 1REGX 1RA6A 2Z4PA 4OI1A 4M63A 2MQNA 2LLZA 2B5JB 1Q8KA 3NOCA 3SDEB 3G96A 2DKOB 2OSRA 3G6ES 1J5OB 2FC9A 3UW1A 3DHXA 1R0CB 1TVRA 4MK8A 2FY8A 1IJFB 2I8EA 3PJXA 3QT7A 3UN5A 4Q2LA 2O67A 5THWA 1TL5A 1D8YA 1R8BA 2HVDA 2ZITA 4K59A 2F40A 4NMLA 3PCOB 2ZJQQ 4KFBA 3RBDA 3PYDA 3CMES 1YBUA 3CDAA 1U1KA 2YNIA 1HMVB 4OJHA 4RW9B 2J6TA 2IPOB 3HK2A 1ITPA 4TYBA 2R8HA 4F4XA 4OLPA 4NA1A 3GJTB 1REVB 2XS7A 4IH7A 4L3NA 3CCSS 2VPWB 4WCEQ 5DM7Q 3ISND 4A48A 3QJPA 4JI3F 1N88A 2KXHA 2WSEC 1TAQA 4X4OA 1F9EB 4F36A 1WC5A 4JV0A 1KHWA 3PJWA 1FRJA 2OMOA 4I6AA 4LVNP 1FD8A 2G2OA 4EZ9A 3HHEA 3I9V9 3BQ0A 3KMSA 1IKWA 3M6VA 2AEJA 2MKHA 1FK9A 1VRUB 2G9OA 1X4AA 8AT1B 2BRLA 3RBZA 5GAHU 4OZ2A 4E2FB 1B7FA 2QLJB 4KY3A 2MJUA 3D66A 4MAKA 5F8LA 4LFCJ 3KKFA 1K73T 4O3NA 3RRKA 3GWCA 4RL1A 3F44A 1YZ6A 3JSMB 1HNVB 4YY3F 2HWTA 3DLLQ 5C2GA 2VHGA 2PT0A 1LOUA 2XY6A 1Z2ZA 1C0TA 5E5NA 2QA2A 3AOAA 3WHIA 4F3QA 5L1KA 4ED7A 2VC0A 3M8SA 4ED4A 1PJ7A 4LSZB 1T0TV 4ZITA 2RU9A 4O3QA 3D0GE 3IRWP 1RT2A 3QAUA 3T1HJ 1ZBTA 3LTOA 2OO4A 2NS1B 2M2BA 4LF4F 4WK1A 1JJCB 1WC1A 2GJ2A 4AXJA 3RRHA 2MZSA 2QLBB 2LMIA 4EI2A 2RF2B 2RHQB 3CD7A 1HWLA 1NJXA 2VBYA 2RMLA 2FZKB 1TAUA 2N7YA 2F63A 3THPA 3HFVA 4Z37A 4L6V3 3KJQB 5AT1B 4CLLA 4QCLA 2FHJD 4ANCA 4I2QB 5A2QY 1EQ0A 1T3NA 4PG7A 2I38A 2BJ9A 2QL9B 2MZJA 4L73A 3OR2A 4L3KA 5L9XA 2GV1A 2DO0A 5KFSA 3W66A 1WG5A 2KFYA 4X4RA 5IWAF 3W9JA 2IC3A 1GAOA 3PO5A 3HVTB 2V2VA 3D3BJ 2L9WA 2XBPA 4JI8F 1S9EB 2QFJA 4W90B 2K1RA 4WJBA 4JBCA 3QPIA 5GMDA 2HHHJ 3QGHA 3RU0A 1HNXF 1BQMB 3RAQA 4I0WA 3Q8QB 1KTQA 4ZP8A 2LU1A 1S6QA 2R3VA 4GC7A 3KG4A 3MCOA 3PDNA 4IRKA 4ED5A 4BS2A 2DHGA 3EXYA 2IFXA 5A2QU 3F41A 5D78A 4PG4A 1CJTA 2F1FA 2VBZA 3ZZOA 2C3YA 4JI4J 4G65A 3QO9B 2UUTA 4J91A 5D3GA 1NB7A 1X9MA 2XO6A 4LFBF 1U0HB 3NNHA 2OD6A 3D7SB 4U8YA 3UD4P 4JI7J 2QL7B 3N6NA 1C0UB 3TQ1A 4B3RJ 2WCXA 3IGNA 4HTIA 4O23A 2GAGC 3MMBA 5B0AA 1FWLA 2QSWA 1QSLA 1TKTB 2VJUA 4EYIB 1KVIA 3IWLA 5KFZA 4WU2A 2ATCB 5ETNA 4CQ1A 1R43A 2EFOA 3QBCA 1RWNB 3J81U 4DPTA 4ES3A 2BJ7A 2VQFJ 3DM2B 2V68A 4FF3A 3SCKE 2PFFB 4WIIA 5ETLA 2PIIA 3TJ9A 4QR1A 2QSFA 3U1MA 4ZCIA 4CLYA 1IN0A 1Q4RA 3SV3A 5J1NA 4B9UA 1YTYA 2GAHC 3ZC4A 3NKYA 3BGUA 2J6SA 2CNLB 2CIMA 3K57A 1C2PA 2BDPA 1BMQB 4TN2A 2D9PA 3LH2S 3GFHA 3RG6A 2KJWA 4J37A 2C3UA 1Q1KA 1RTDA 3M8QA 2MKYA 2RSQA 4MFBB 2UXDJ 2WOMB 1NDLA 5F0WA 3R7NB 4HVZA 1FJCA 2W4CA 3SSQA 2FJDB 1TL1A 3Q89A 5AE3A 1HNIB 2F9JA 2VPXB 4B3TJ 1ZM4A 3Q2SC 1VQ6S 1IQZA 2C1EB 1X7VA 1NH8A 4ZLNA 4LSNA 4M5NA 2XMAA 4JYAF 4KQZA 2BX6A 3N9UC 4EWTA 4WKRA 1DFDA 2MZRA 2J0XA 2BM0A 4F04B 2B6AA 1LNQA 5HQ8A 4I56A 1RISA 4P71A 1YIJS 1FDDA 5KFPA 2OMLA 3DN9A 2IRUA 1FCAA 4DR7F 5K5MA 2OPSA 1WC3A 1Y9OA 4ZHRB 4UT4A 2QYCA 1S1XB 3EGZA 3LUYA 1UJ5A 3M6UA 1S99A 4UW2A 4HYKA 4C8OA 2VA2A 4X65F 5MAOA 2V0NA 3I82A 1RT4A 2KDOA 2ADCA 4ZLLA 2DIUA 4ZCLA 5E3QA 2I2YA 3GYNA 4I4BA 3BGRA 2GMHA 3JSRA 4GRSA 3M8ZA 3DGPA 4I67A 1SIWB 3KK1B 4LIWA 2AZ3A 1U1QA 4AE5A 1FERA 2DHAA 2NREA 2RDJA 2CQHA 4K4ZA 4FF4A 2Y9HA 1P6TA 3CJ8A 4J90A 4JV5J 1TUWA 2CG8A 4QYZJ 3BSCA 4ECZA 1RAJA 1CJUA 4LFAJ 4NLXA 4TQRA 1F2HA 4V19J 3M4XA 2W2QP 5F8JA 4NA2A 4ZIVA 3T6BA 4LF8J 5A6PA 3JTNA 1N0VC 2D3UA 1NAQA 3W61A 2WVBA 4DMZA 3QAEA 3G6XA 4IFYB 4Y6IA 3T6JA 4TY8B 1AYEA 3M1VB 1I5OB 1NDPA 3BB5A 1PAEX 2R42A 4JUZA 4FYDA 4PXCA 3DRYA 4WE1A 4LF5F 3JYTA 5CYMA 2F4VJ 4MT1A 2VFUA 4KV8B 4ZN1A 1DTQA 3MEKA 2AJ2A 1RT6A 5CXTA 3D28A 2ROPA 3KLEA 1OYDA 1HWUA 4RUBA 2IAJA 2X1FA 3CCES 4NLVA 1GTHA 2AJQA 2NLWA 2QFIA 1Q5VA 2W9CA 4CM0A 4KO0A 3Q8PB 4ZVSB 1JLEB 5DZ7A 3KYLA 3Q0AA 5KOXA 2R8IA 4HL9A 1I3OB 2DHXA 2V63A 4DL5A 5IQ6A 3OVBA 1WSVA 3I55S 4DWIA 1NPPA 3C19A 3KLFA 4M5LA 2V69A 2YWEA 3CJKB 1S4FA 4NZ0A 5AJ3F 3MPWA 4CWBA 2IIHA 1CLFA 4NXMF 4YOEA 4DZDA 3K58A 2RQ4A 3BH7B 2F8MA 4MYTA 5I3UA 4J9KA 4LF9J 2GHWA 3LWLA 2HHVA 4WKYA 2FPHX 3TX8A 4J9PA 3T1YF 4N56A 3OLBA 2D3O1 1TFYA 2OPPB 1X4EA 4X66F 2VG5A 1FKPB 3W2WB 4NLQA 2QGFB 3I0SB 2JEIA 1XNQF 4DR4J 1U4BA 4TKTA 3M2UB 2MPUA 5T14A 1K9MT 3Q24A 4OYBA 2ERRA 1R0AB 3G4SS 4Q43A 2EWHA 4ZJOA 1UVNA 1B0TA 2ZWPA 2BQUA 2XZWA 3VGSA 4JB8B 4FS2A 3MR5A 2K3KA 4LR7A 1HLWA 4ZVOB 4DR5J 1M5HA 4I69A 4EEYA 2R2UA 3KDOA 3FRYA 2HQCA 1PBAA 5CH7B 3VCDA 2RU3A 3R2CJ 4CO3A 1VJQA 4CI0B 5A8RB 2LXFA 3X3UA 5H9EK 1ZA2B 2VV5A 2ASLA 2CWKA 1B70B 2E44A 4X4NA 2ASJA 2OPQA 3DLGA 4O44A 1S1WB 2VKZG 2UXBF 4A46A 1RTZA 1FWKA 3VGVA 2ZD1A 5HATA 2D3OR 4U8VA 2WTFA 2PEBA 4PYAA 2VFTA 4KT0C 2NPIA 1LW2A 1VIXA 1SB6A 3M7VA 2ZZNA 3W62A 4LIRA 2V67A 5F8GA 5CCMA 2L41A 1TKXB 4ILRA 5U47A 1O6XA 3HM9A 3V6HA 3H5SA 3JSBA 3C46A 2P2CB 3WX4A 2HAFA 1R8CA 1MN7A 4F7VA 3UFCX 1L3TA 4M5HA 4I68A 2DNHA 4RKUC 1UJ4A 2WSFC 2B8QA 4RNHA 1WELA 4RNFA 2QX0A 1FRXA 2MZTA 1KHVA 4PPDA 4NRTA 3AXMA 1S0VA 3HZGA 4KGZB 2VF3A 1GNKA 3M30A 1CQNA 2R8JA 3MECB 3FMWA 2ADBA 4HH1A 3CCQS 5LSLA 2J5AA 2ALYB 3G6YA 1YJ7A 2W2PP 4I2PA 1DY3A 2VFSA 2J0QD 2HBQB 4U6PA 2BKPA 3CJ3A 1TL7B 3K8VA 5EDWA 3VAGA 2Y8YA 2CQBA 9ATCB 2A1BA 3BGOP 2VQEF 3FSXA 1KKHA 4JP8A 5BYRA 2KN4A 1DLOA 3GZ7A 2GQCA 2W24A 3HFKA 4P2FA 4IOAQ 2E5IA 5KT7A 3KHHA 2QMXA 4P2XA 3U1NA 4RO0A 3W63A 1FDAA 5JJBA 4K2JA 4BDPA 3V6JA 2KVIA 2CPFA 4F4ZA 1JB0C 2HK3A 3LP2A 1X4CA 4OZ3A 4YDXA 1X0FA 1VQNS 4W4MA 4ELVA 1X4GA 1B3TA 4OIXA 1U2FA 1QVGR 2XMTA 1SJ4P 3GSDA 5DZ6A 2BJ8A 4LT6A 2W7PA 4YR2A 2P8IA 2Z2LA 1VQ8S 3OFFA 1NK7A 4Y65A 1X0PA 1RCOB 2JFKA 2IBOA 1NM2A 4OYOA 1KN6A 2AJ0A 2BE7D 1R8PA 3FSIA 5LMUF 2CQDA 2Y0BB 3GSIA 1NPKA 1IKWB 4EZ6A 1H98A 4ECYA 3G71S 1FK9B 2BE2B 3BBFA 2KHDA 3JS9A 3NRBA 2XNQA 1GMWA 4XDDA 4X4SA 3GR0A 2R2TA 2M4MA 4K5RA 4DDFA 5H1SV 4FDFA 1YBAA 4IO9Q 2EBEA 3EYZA 1MNEA 4CLKA 3NMAA 1NXIA 2RUGA 2XYHB 4PABA 1NJIT 2CZ9A 4YN3B 4DSKA 3HSDA 3DI6A 1NCLA 4QPTA 2YQ3A 2JEFA 4LF6F 1ZPVA 2EFGA 3R5DA 5BR8J 4DV4J 3W3SA 4C9DA 2G1HA 1RUSA 1LFWA 3H4DA 1NZAA 1FNXH 4LSLA 1ZZNA 1RB0A 5DLFA 5C5JA 1RT2B 4M95A 3WIUA 4DSFA 3PG9A 1N36J 1S57A 3M8YA 2XYPB 2CJ9A 3OTEA 3NGSA 1YI2S 5ETMA 2H9ZA 3QGIA 5H9FJ 4YHHF 3UCGA 4ED0A 3MDFA 1T8EA 1F0XA 2VFVA 2O1PA 4DR1F 3ILJA 1C1BB 2OHDA 2UVWA 2MMYA 3OL9A 2FLNA 2U1AA 4IQMA 1EHWA 3MUMP 3H0PA 3WDOA 2LEAA 4HEA9 2IBKA 5I3QA 4NA3A 3OR2B 2KFZA 3VHQA 1UVMA 3OVSA 4DPXA 3TVYA 1CULA 1I1GA 3PNIA 4C3KA 2IVYA 4DX8H 1HNWF 4ED1A 3MF5A 3IS9A 3CEDA 3KHRA 3MURP 4HI1A 2C2OB 1S1UA 3HHNB 2LA6A 3GONA 4W92B 1N34J 2C28A 2DNLA 2XCPA 1WOPA 4WF9Q 2RJZA 4Y34A 3QZ8A 3UPFA 1LV5A 2W2NP 3R8YA 3NWRA 4ZOSA 3WIVA 3HZEA 1SL0A 3L3CA 2I9SA 2R2RA 3N6LA 5KFBA 2OSQA 1RE1B 1BUXA 2G1DA 3MR6A 1R6VA 4R8UA 4IKAA 1MU2B 3CB4A 1CJTB 1JKHB 1VLYA 5C25B 4K0KF 1IM6A 3EM1A 1HI1A 3CTRA 3R2DJ 2HFZA 2BQ3A 1TL3A 2NYHA 1S97A 3DRSB 4OI6A 3MMBB 3NS6A 3CJQA 2V4JB 5FD1A 3M2RB 2VBWA 3Q23A 3QRPA 2FB0A 4USKA 3V81A 1RSCA 3W65A 2J9CA 4M5IA 1SQGA 3OTDA 2JNJA 1AW0A 1M5PC 4UQTA 5T7LB 1IBCB 1GMWD 1UWBA 1CJKA 4ZJLA 3KK2A 4C97A 4J9NA 4WFYA 2MJNA 4J9SA 1U02A 2OLWA 1QM9A 3UNYA 4Y2AA 2GJIA 3EDQB 5KG7A 5CAAA 2FIUA 3R1LA 1Q7YT 4FBUA 1N5YA 5ETTA 1RT1B 1APSA 4MH8A 4ZA1A 1IQTA 4A8MP 5DGAA 1RAGB 5KG1A 2DXDA 1QLNA 2A10A 1S0NA 1VBZA 3BR9A 2H5EA 1LWCB 3OVAA 3EPGA 3NS7B 3A3OB 5DDQC 3BEGB 3D68A 1I51B 2F3JA 4C11B 1P27B 2KT5A 4DZ6A 4ED6A 3EGWB 2XZTB 4HT7A 5E33A 3BZQA 1MW7A 3DOMA 1M0SA 2OH2A 2B6AB 5IWAJ 4X2BA 1WTBA 1Y4ZB 2G0IA 2MQ8A 3R5BA 4RW6A 4QYZK 4N8NA 2A0FB 3A12A 4BWMA 3J81j 4LFCF 1U1PA 2ZBPA 2CVEA 2E29A 4WPAA 1N4LA 3G8SA 2IMOA 1D09B 1HNXJ 4RNNA 2HBZB 5IS2A 4LF7J 3N4WA 3GJQB 4BCAA 2ZKUA 3LWMA 1GTEA 1H0HB 4NE9C 1NSKL 2EVZA 4C0HA 3QRQA 2HS3A 3TR5A 3VF0B 1WI6A 4OHZA 3EICA 2YNHB 4ECQA 1T9TA 1TK0A 2L08A 3T1HF 3R5CA 3NS5A 3DGPB 1GK8A 3MM6A 1TU0B 2ZBRA 5ITHA 1XWLA 4K4WA 3TOQA 4X4VA 2A3JA 2JC1A 2VC1A 4URGA 4LQ9A 4RPFA 2DR8A 1YKWA 1SXLA 3CD5A 3CJRA 3Q8YA 2DHHA 3BBCA 3IRXA 3FDSA 1NO8A 2R7OA 2LDIA 4AXIA 1RYSA 1BLUA 5GADI 3SFUA 4JI2F 4QPXA 1B99A 3OXLA 3UN3A 1PC5A 4RJVA 4ATNA 2UZAA 3SDEA 4OZNA 2NXEA 1DURA 2V8VA 2HVZA 4H4KC 4DUZJ 1UJ6A 3ONQA 3CJ2A 1OQ6A 1VFJA 3D1HA 1U26A 1KQSR 1HHSA 3GG1A 1RT5B 4FPRA 5KT4A 2UVRA 4MMOA 3K89A 4WE1B 2X1AA 2ZOMA 3T3FA 2R4FA 2AWZA 3OR1B 5E0OA 1RT6B 2LQ9A 1K0TA 1HMVA 4C6AA 1R31A 1QSYA 2R7RA 1XN9A 3AB2B 4B17A 2HHHF 1F5AA 1BWEA 2DGTA 5IOLA 2BACA 2NUHA 1Q16B 3FEXB 1REVA 1Q8LA 7AT1B 4KO0B 3PW2A 4AYBD 2IYIA 4KE5A 2RT3A 4KHRA 3P3DA 1FEHA 2LXIA 4DS4A 2RRAA 2EG2A 4FYXB 1ZTWA 3FK4A 3KLGB 2PMWA 3UE2A 4IOBA 4OYMA 5CYQB 4FPIA 1SKWA 4JI4F 1BGXT 2HQDA 4JI0F 3FCWA 1KEKA 1VRUA 3IP0A 1S77D 2CG4A 1R7IA 3ZTSA 2IRXA 3PYGA 2OJ3A 3SV4A 1FKOB 1YGYA 2HGLA 1RAAB 4PWUA 4USIA 1BQNB 1W2BR 1Z4UA 4B9NA 3VTIA 4OI3A 3MWBA 4LUBA 3SSRA 4DN9A 1ZM2A 3JSMA 1HNVA 1H2TZ 4Q5VA 2MQPA 3BH6B 1D0EA 2GO8A 1YQHA 2VQFF 2HHXA 2XNRA 4X65J 1PKUA 4QOTA 2VG5B 5KFUA 4USWA 1WHVA 4GKJJ 4OHYA 1RI7A 1JXVA 4ZPWR 1TFWA 1S79A 1HA1A 3PO4A 3H20A 4J9QA 3ISNC 3BDEA 5A8KB 2ZE2B 2OIHA 4USTA 5LL6d 1KOOA 4DR2J 3R97A 1B64A 1MN9A 3KOAA 1YJNS 3M8RA 3QNWB 3W60A 3KLHB 1NK0A 3ADAC 4DSJA 3ETOA 1WG1A 3CCWA 3EVMA 2V8HA 1PO6A 2UXDF 1H73A 4IR9A 3DLJA 4I6YA 5DQHA 2FVSA 3C14B 1OO0B 4B3TF 4ZP9A 3TW0A 3IWNC 1GXUA 4QWAA 2O3DA 2G2ZA 1VGYA 3HVWA 2L3MA 3TP2A 1ELOA 2E5GA 3UR0A 5IT0A 2XLJA 2NQPA 2RAQA 1RWPB 3HO1A 2ALZA 3L7UA 4LF5J 1H3DA 2JHEA 1XIQA 3HVTA 1Q86T 3NAIA 3UVJB 1RT3A 3AXKA 1NEEA 4WU3A 4F4KA 3HHDA 2Z2MA 1U7LA 2HQ3A 3VR1A 1QJHA 1SQEA 2R7XA 2XG8A 5F8NA 1Y5NB 4F2SA 3T41A 3R1HA 3M8PA 1VS3A 3QMQA 4P7VA 4DFKA 2XEXA 5BJRA 1SCJB 2CPJA 3LP0B 2JEGA 3O5TB 3RAMA 2YWWA 5HMXA 3UO0A 4GVBB 4LREA 1SJRA 1WC6A 4Y2MA 3GJRB 1WUUA 4DX5A 2PI5A 3IR7B 1C4AA 2OTJS 3W2VA 3GPAA 3T5KA 3QO9A 1ZAWA 2LA4A 2RRBA 2OFGX 1RHQB 3CPWR 2B7CB 1YHQS 2FHKA 3C6TA 4A8YA 3FRZA 5I4MA 3MM5B 3OXGA 5AJ3J 3VZHA 1VRTA 3BKFA 2UV8A 4NXMJ 3TI0A 4QR2A 1C0UA 4JV5F 3T1AA 3T9ZA 3IG1B 2WK4A 1RABB 3G82B 3CC7S 3UCUP 4CM2A 1TKTA 4LFAF 3MD3A 2JOQA 1F9FA 3FMBA 3IBWA 4O3PA 3BQ2A 5AXMA 2D69A 1XTZA 4NCGB 2ZJRQ 1VOMA 1N6QB 3DFEA 4I2PB 3MMAA 4X66J 1VHFA 2GFFA 1EKSA 3GIRA 2QO3A 1KSPA 1EIYB 5DDRC 4PUOA 2HHWA 4OYPA 2KI2A 2Q66A 3OL6A 2FZCB 4I6WA 1JX4A 2F4VF 1WHWA 2OFHX 4ID5A 4N47A 1A6LA 3ZTOA 1O5JA 1J2VA 4K4VA 2VDHA 4O3OA 2W2MP 3GV8B 3GCWP 4DPWA 4MJKA 4EO6A 2YKOA 3LAKA 3PY8A 4ICLA 1TMJA 3N6MA 4MFBA 1DHMA 3FBEA 4IG0A 2KTQA 2WOMA 4I1TA 5LXRA 2PD1A 3TEGA 3HULA 1WEYA 7FDRA 1CS4B 2JRSA 1M5KC 4K5SA 1OS5A 2B8PA 5EHHA 1HNIA 5CZXA 5BYQA 3LP2B 2D7SA 2A2DA 4P10A 1ZPWX 2G0JA 3C6UB 3AQPA 3ZTPA 3O8WA 4YB5A 1QUVA 2KL8A 3D54A 3PW0A 4LMZA 1U1RA 3IM8A 3QGPA 2KG1A 4DV6J 1H38A 4IOCQ 3GIJA 2FLOA 3IMQJ 3UR3C 2PA3A 2LYVA 3CMQA 4MTPA 4Q2MA 5KG4A 2UU9J 3JAMY 1X5SA 2ZH6A 3SCJE 4W98A 3LANA 1RLCL 2CPDA 1OY9A 3S7RA 4LF9F 2HFNA 5J2PB 1KP6A 4RR5A 2DNMA 1S1XA 2N82B 1ICEB 4ZPBA 2CPXA 4CO2A 4F02A 5EUHA 4CDIA 2DH9A 4OLOA 4A8WA 3J7ZT 2MZ1A 1N52B 3OTCA 5H9FK 5LM7E 4ZVEA 4TU7A 2V9WA 4I64A 4CLZA 1HIYA 2L48A 2VFRA 2KVQE 4ZCKA 1K8AT 4RNMA 4OMFG 1HWIA 2BW7A 4DLGA 3KK1A 3LAMA 2VJVA 3ILIA 3J7YI 4QW8A 3ZZYA 3NGTA 5E3PA 4ECXA 3JAMU 1NPRA 2QRRA 2H48B 4E98A 1ACMB 4DR5F 2DNZA 2YWHA 1UVJA 3D3CJ 3N5BA 1VCTA 4P73A 4EGLA 1N56A 2KB2A 2E5LJ 1Y00A 1NH7A 1WF2A 5CABA 2ZBCA 3BPDA 1S0OA 4IFYA 2HHSA 3R7SB 2WVFA 3M1VA 3MUTP 2ZHAA 1WSRA 4ZVPB 2DRDA 1RBLA 3MEEA 4ZKAA 3HSJA 4G1IA 4PQAA 4CLSA 1YJTA 4LRCA 1QSSA 3FBFA 2MQQA 3LP1A 4HHJA 1N5SA 2J0WA 4JI6J 3EDRB 2QA4G 1TTHB 2OGUA 3DNCA 3M9NB 2VOPA 1XK8A 4UOCA 2XMUA 4QWEA 2LCWA 4ZIWA 2EG1A 2XS5A 1T03B 1JLGA 1NHKL 1Z1ZA 1JLEA 4HLBA 1FRLA 4HACB 3US5A 4BLGA 2AGQA 2HHUA 3D6TB 1S1UB 3VGUA 3IM9A 1K0VA 2YQ0A 3C15B 3EMTA 4CRJA 1HL6A 2NZCA 3BN4A 2W9AA 3FVYA 3DU5A 1RAIB 1JMTA 3CJKA 2L9DA 3H2VE 4KJIA 2ILYA 3NLCA 2CNKB 3QATA 5K8MA 2HAIA 3BO3A 1RTHB 1V5VA 3AJ2A 1N54B 2VKRA 2HMIA 3MUVP 3SQOP 3RGIA 1JLAB 1LWEB 2VPZB 4L76A 2ACMA 4U96A 2MKCA 3ILLA 5IC4B 2DNOA 1NJYA 3MM7A 2Y1LB 4U95A 1FKPA 4DPYA 3HKZD 3ZZRA 1IR2A 1V3ZA 3I0SA 2GC8A 1H7WA 1HPZB 4XDCA 4PG8A 2A18A 3BKUA 2E1RA 2XMWA 1S1VA 1TELA 3N0VA 4ZP6A 3V81B 3I96A 4H4OB 1FJGJ 3R3TA 1P1LA 2D74B 2EPIA 1RGVA 1HR0J 7FD1A 2B56A 4D3GA 1QTMA 2MLYA 2H51B 5DJBA 4DN0A 3NL0A 3AH6A 1RKIA 3RAXA 3GB0A 1UWBB 1SKUB 5CD4H 2G4BA 4OFZA 3N79A 2B4VA 2DNQA 2V2QA 2Z8QA 3THTA 4IFVA 4DQRA 3Q86A 2DR9A 1PBUA 2IA6A 1F5CA 2ZUGA 3MAAB 3SMZA 4Z7CA 2ZEJA 2KYZA 1HKAA 1DAXA 3QIDA 2CJBA 2MKKA 1S59A 4AL7A 4IH6A 2FJAB 1VC6A 2ZOFA 1S6UA 1NUEA 4B3SJ 3V6DA 2N4CA 2ZH9A 3QLHB 3DXBA 4ZDNA 1S1WA 4DR1J 4PQUA 3RR8A 4RU9A 2HVIA 3KFWX 3GFXA 1IBLJ 4GKKJ 3IXQA 3AD9C 3H8YA 3OSNA 4DBQA 1FX4A 1G4CA 4FVCA 2HBRB 2DIVA 4UOFA 3NEKA 4DL4A 5MLCV 4XK8C 2KXNB 4OJGA 4PYDA 1TKZB 5IM0B 1PYOB 4QIEA 1HNWJ 1YITS 3JB9k 1UAWA 3DLKB 1TKXA 3VV2B 2ZC3A 1KLMA 1AROP 3H5XA 1ZAVA 4RW6B 1T95A 4DFMA 1HD0A 4F0KA 5KFEA 1JXEA 1Y0HA 1UKUA 5LJ3Y 4P74A 2FVQA 5RUBA 2D1CA 1P1TA 1ZH5A 2BBEA 1R8AA 1GH8A 1HARA 3OL7A 4CO5A 5KFRA 1SJFA 4NRUA 1SI9A 4ZK7M 4XTTA 1SBRA 3WC0A 2LEBA 1SH3A 5BR8F 4OJ3A 4G1QA 1CC8A 4HHHA 4DV4F 3HX9A 3VGTA 1IWAA 3LF0A 3O2IA 1AFIA 4O4GB 1JXLA 3SI8A 1S7HA 4F2RA 2H3EB 3PIOQ 3L09A 4WIQA 3HVRA 3G2XA 2DGQA 3CF5Q 4QJVA 3E3XA 2C2ZB 2CQ1A 4CP5A 5D0HA 3CT9A 3I4HX 2EC2A 2Q3PA 3VAMA 4YUDA 2H5JB 4NXNJ 2WB1D 3GR1A 3I32A 4NCAA 3KMQA 1TL7A 1X5TA 2D9OA 4CH1A 4USHA 4NOHA 3ENAA 3MR3A 1Q5YA 2YNFB 4RUAA 5IFMA 2PSZA 1UPPA 3AQOA 1RA7A 2IM3A 1M5VC 3G6VA 4DL7A 3TARA 1U49A 2YH1A 1SJQA 2RHSB 2JZ5A 3PZPA 1KRPA 4DCPB 1R3NA 2CUYA 1NNDA 3D4JA 1FESA 1N34F 2QA4S 5IZHA 2F65A 1NU4A 3TVZA 2XB2D 2ZDOA 1WORA 2ACYA 2HGMA 3RB0A 1OIAA 1K44A 2ZKTA 3PKYA 5M2RA 2RDIA 5DM6Q 3CE8A 4Y2CA 1RU2A 5D0GA 4B9TA 1HQUA 2ABYA 3N01A 5DRKA 4N7TA 1UW4A 1R8HA 3TUPA 1RZMA 4HR2A 4DFJA 1DQ8A 1RAFB 4X64J 1ZM3A 2BE2A 4DSLA 2C2MB 1VC0A 3RUBL 5GVQA 1MMLA 5ADZA 2JLFA 5F41A 4U7UK 1PILA 4ZJQA 2Q79A 3TA2A 2ZH8A 4GMKA 1VQPS 3UDEA 4UOGA 5KG5A 4ILLA 2IHR1 5AXLA 2J9DA 1MLAA 2JH3A 1A7GE 4YDDB 2EC0A 3RZAA 1RAOA 2OPRB 5IC6B 3PX6A 2BANB 4FKXA 3MCNA 3NGDA 1CJVB 2V4RA 1H6KX 1SC1B 4YR0A 5J1EB 4CYUA 1TQLA 2LECA 4FKYA 1SH0A 5DG8A 4OI2A 2V8DA 3F73A 1ZYQA 4OV1A 2I6WA 3IR6B 3GFYA 2YX4A 3A8IA 3NGRA 4DFPA 5ETOA 2LDYA 2HEKA 2AF6A 4ECVA 3FEYB 4D3HA 2NSCA 3EVOA 4OV6A 4JI2J 2BJ3A 4F25A 1C1BA 2N3LA 2C2DA 5CD4A 3ZFVA 2VIHA 3E51A 1N0UA 1F60B 3A8JA 2K8GA 2AEFA 3L9ZA 2QIFA 5J2MB 1UETA 1DQ9A 2LVWA 2WW8A 2HURA 3L95X 4BC7A 3ITHB 3DMJB 1C4CA 2F5GA 3C16A 4NLYA 2DTJA 2RS2A 5HROA 1KQKA 1RT3B 3EUNA 4DCOB 1WKLA 1NK4A 4RBUA 2AJFE 4UOHA 3GLJA 5K8NA 1HQ2A 3FCVA 4DSEA 2VICA 5B0CA 3M8PB 1U45A 4LF7F 1D9AA 3I5AA 4ZVUB 1QTNB 1RWKB 2W9BB 2YX1A 2DJWA 2B0GA 2Y0SD 4PXBA 3ET6B 3M6WA 1HBNB 4RLEA 1R89A 2JWNA 5DDOC 4MIBA 1CVJA 3M2VB 3W2VB 1MU2A 1A0OB 1FTRA 4ER8A 1JKHA 2HZCA 1RTIB 2FDNA 3P96A 4HDHA 2LFVA 5C25A 4JI0J 3AFGA 1CPZA 3C6TB 4NI2B 4F4WA 3M8WA 1YJVA 1TR0A 4C3LA 3A3PB 1VQMS 1VRTB 1XMBA 1A9NB 4RBTA 1MWQA 3DRSA 2OUGA 1U0SA 2GW8A 1L3VA 2YWFA 2NR0A 3MAHA 3QRRA 1QAXA 2V4JA 3AOCA 2XGQA 3M2RA 2DGOA 4F26A 2YNGB 4M8LA 3I9ZA 2CJAA 3LOUA 3CDBA 2W25A 4L74A 3ULHA 3ZZZA 1EQMA 2ZC4A 2YPZA 4PKDB 3MMAB 4DUZF 1P9QC 5C42A 3CO0P 1LW0B 1FD2A 3HD1A 3SBMA 2DNNA 4PUOB 4MKBA 5T7LA 2HNDB 2Z0GA 3IO1A 4FXVA 2NSBA 4M5DB 1IKVB 2VPYB 4ID5B 3QWPA 2ZHOA 3PVXA 2Z57B 5HI7A 2XTJP 1OSCA 5KFLA 3VZIA 3MXHP 2MQLA 5AXNA 4PWWA 1F1BB 2I0XA 3ILOA 1TP7A 2BXJA 5FIIA 1RKJA 3SQGA 4TXSA 1VMBA 1QAJA 4NL5A 2HQFA 1C1CA 3TAQA 4WFXA 3OD2A 3OTOJ 1WDDA 1RT1A 4ICLB 2RQKA 4QWCA 3GV5B 2VB6A 1FA0A 2A6MA 3L7PA 2DPIA 1JJ4A 3EZUA 4IG0B 5L8RC 4CT8A 3BQ1A 4AFFA 2HLTA 2VBXA 2C2KB 1SV5B 2RIJA 4DV3J 1LWCA 3RBXA 1FXRA 4TLQA 2BEFA 1FDBA 3E2EA 4Q45A 1FVSA 4M5GA 2OP5A 4C11A 1RK8A 2BJDA 3ZZ0A 2MEWA 2AX0A 4KB7A 2XLKA 2OI2A 2CPZA 4OX8A 2P6SA 4OYIA 5ETRA 2Y8WA 4L75A 2AX1A 1Q95G 3K5PA 1YJWS 4KHMA 1WHXA 4PXEA 2IMWP 3DRPA 1KBRA 3ZZTA 3M32A 5FLXY 1U6BA 2CA9A 2KG0A 2EEYA 2H4YB 2QLFB 3UNGC 1NSPA 5KFGA 4B08A 2FGOA 5HMYA 1M5SA 4DR6F 1K1SA 2Z56B 2XMVA 2ZJPQ 2RUSA 1S7IA 2W1BA 4GKJF 1HYSB 2ASDA 5C24A 3NNAA 5ETKA 4Z7YA 2FJVA 4ITSA 4CLUA 3GIKA 3FZ2A 2W7AA 3QJLA 2P5VA 5DG9A 2YNHA 2M3DA 2GQQA 4JOUA 4Q0BB 3T9NA 3KHGA 2X7IA 4DR2F 3HHKA 1JWWA 3AODA 2DGWA 5C2CA 4FYWB 1YG0A 2DISA 1M90T 1VC5A 4CT9A 3CDEA 5D4LA 2B9YA 4GO7X 3IFEA 5G4DA 3TAPA 4IH5A 2YY3A 5GAHI 3D5MA 3BYRA 4BBYA 3PTWA 3DU6A 2P9EA 1XBWA 2CQCA 2VH7A 2MSTA 1MWYA 1E6VA 1FNOA 2RQCA 4P2MA 1EETB 1HBUB 4FVMA 4DG1A 3V4MA 4YMEA 5KFTA 3H59A 3FEZA 3HT3A 1M1HA 1NK6A 1T94A 1RT5A 3PW5A 2RKIB 1PGZA 3MEEB 1KQGB 2NCKL 2ROEA 2QMWA 4OZLA 3E8OA 3LP1B 3OR1A 2YPYA 5K8OA 2VODA 2YQ1A 1NDKA 2PA8D 3W5ZA 5D6GA 3PEHA 3GQCA 2PI4A 2PO4A 3TAMA 3BN7A 3CJ0A 2HVEA 4KBIA 3I4PA 2F8HA 4WFZA 4PR6A 1JLGB 4QIVA 1AZSA 3S01A 2R7UA 3DHWC 3BKTA 1Y3KA 5LSRA 2HFOA 3UD5A 2DCLA 4BHQA 5B08A 4PXDA 1TUVA 3KLGA 2IYGA 2M8HA 2PGCA 3Q8UA 1ROFA 1WACA 1IBMJ 5CYQA 2AKWB 2QL5B 2FLPA 4ANDA 2HGNA 4DV5F 2HS0A 4B3MF 1T9WA 4KHPF 2QYGA 3GIIA 4FNIA 1HD1A 2YX7A 1NK8A 2OD4A 1WI8A 2ZOGA 2W4DA 2HMIB 4DJBA 4QQBA 1FKOA 5KFVA 1CQMA 1BQNA 2ZVSA 2GMJA 3JSYA 3GILA 1L3KA 2M52A 4ANEA 2FVPA 2W4PA 1VK8A 1P8GA 3MM7B 3CCLS 5LXYA 4Y3CA 2QLWA 4ES2A 2EFPA 4JV2A 5A8WB 5D4PA 2KH9A 3K17A 5E7OB 2PMZD 5A8KA 1U8WA 2ZE2A 5FDLA 1O51A 2E7VA 4DLEA 1S1VB 3LALA 3NGUA 5IQQA 4EBDA 3JQKA 4MKVA 5IT9Y 3KHLA 1RACB 3TUZC 3KLHA 4AUKA 3BS9A 3K0JA 4QR0A 1MMDA 3G87A 2UUAJ 3CSKA 1RTJA 2BE9B 5EWGA 5J1PA 3ISZA 4OZ1A 2FYXA 3HD2A 4DQQA 5D0EA 4IFVB 3C14A 3BR8A 3ENWA 2GIRA 3DRRA 3LGMA 5F9NA 1R27B 2FJEB 4Y0FA 4DUYJ 4OYXA 1DRZA 4QU6A 4IG3B 4DV6F 3EX7B 1T05B 5L38A 4BWJA 3UCZP 3V6DB 4C48A 2QZ8A 5K9FA 3NGKA 2UU9F 4PQUB 1TKDA 3O3LA 3UVJA 4IDKA 2B4PA 2IY5B 2MKSA 1U8SA 5DQIA 3WC2A 2CDRB 4YB1P 4FYVB 2EW9A 3GCXP 3HT0A 2YKMA 2B9XA 2ATLA 2FJWA 3OT9A 3LP0A 2GQ2A 2OEKA 2C2NA 1KLMB 5KAKA 2XO7A 3TZZA 2QA1A 4GVBA 4YEAA 3CCTA 1YDLA 2HRUA 3MGJA 1U1LA 1LEOA 1SIZA 5LSOA 2VG7B 1OYEA 2AJ1A 3KG1A 4X4QA 3A3NB 2CQ2A 3NY0A 2XLIA 2MLZA 1YBTA 1H74A 2XS2A 2LKZA 3MM5A 3VVUA 2HKEA 3QT8A 3TUJC 4IRDA 3DDIA 4KGXB 4G1QB 3PXGa 4J9OA 3FGVA 3V5RA 3MPDA 3IG1A 5GMKa 2AGPA 3G82A 1I94J 4KGKA 3MHYA 3AD7C 4NPOA 3J7A1 3P49B 2J7WA 2WW4A 4ID8A 2U2FA 1WG4A 1IR0A 2B4UA 2MHEA 1JK9B 3HMJG 2GZOA 1KDNA 2ZUAA 2E5LF 3N28A 4NCGA 3TA1A 1SC3B 3MM9B 4F67A 3K2YA 3IWXA 1N6QA 4J9RA 2HNYB 1YX2A 4RZRA 2R2SA 4DXLA 4Y2IA 1FNMA 2HWHA 5HQLA 3CNQP 1HBOB 4KKOB 3QFHA 2ZZMA 2AZ1A 3Q83A 5KG6A 2E1CA 1W26A 1Y5LB 2A2CA 1T7PA 5DQGA 2HQGA 4JI6F 5I3PA 3T5LA 2YKQA 3IN5A 1SUQA 5KOWA 3C2PA 1N8RT 5HBMB 1ZA1B 5CA5A 1Q8IA 1WKJA 4H4MA 2O66A 1HBMB 1XMQF 1FWPA 2HS4A 1X9WA 2IDEA 2XCAA 3FQLA 1CS4A 5I42B 4QIGA 3OPKA 1VK3A 2BJ1A 4PG6A 3ZTRA 4B9LA 1UVKA 2FVRA 1YJ9S 4ZVFA 3C6UA 2HSEB 2V9KA 4TLRA 4RW8B 2FUG9 1B0VA 5F8MA 5A0YB 3CW2C 3H90A 5CZVA 2R7VA 1HQUB 1RWWB 2J8SA 5J2PA 1QE1B 2E5HA 2SXLA 4DV2J 2GHPA 2YKPA 2W01A 4PWDB 2MSSA 2AV5A 3FJ2A 1T9VA 1U6FA 4C2MA 4M5KA 1PYTA 2FD2A 1XEZA 4U9RA 4HT5A 4EBCA 1RWUA 3AA9A 4OYZA 2J7KA 2V4QA 1TZ0A 2Y3YA 1U48A 3PRDA 2EFQA 1KTVA 1FJGF 1U24A 4EMDA 1HR0F 3OFHA 1S48A 5HP1B 1KNZA 3OUYB 1EP4B 5A76A 2HG4A 3DLEB 1PCAA 3CJ5A 3P5BP 1JLFB 4ILMA 2KKHA 4NZ6A 4J9UE 1JLQB 4CYUB 1J5EJ 3P8BB 2WBMA 1SL2A 4XO0A 4R5PB 4KAIA 2L9NA 1RQ0A 3TANA 3EXCX 4ZVRB 2LP4A 1FRMA 4P52A 5ETVA 2UXCJ 2H65B 4J9MA 4B3SF 4UY8T 5HVHA 1SPBP 2WONA 4DV0F 3NXZA 2FTRA 2M70A 2YBVA 4DQSA 3D9BA 1IBLF 4GKKF 3EGVA 2DBBA 1RBAA 3SCIE 1V9OA 3G86A 3NCRA 2F4FA 4RU2A 2EK1A 1RAHB 2ZH4A 1IKYA 4O3SA 4A8FA 4UQGA 1AFJA 4DV1J 2KXFA 2EI5A 3VQTA 1UL3A 2PMHA 4LJMA 3CMAS 1IXKA 2ZDPA 4MYUA 1T03A 3C16B 2YH0A 3ETMA 3B4DA 5HROB 2UUCJ 2CFXA 4HACA 2RS8A 2W2OP 2GVZA 1QAIA 3C15A 4C7QA 1S6PB 2PN6A 4X84A 1GX6A 3CIMA 3BO4A 3HKWA 2D3ZA 1CG2A 2GGPB 2Z30B 1UFLA 2B9WA 4DX6A 4V19X 4KPYA 2RNEA 1QAYA 5HMWA 2K7JA 1RTHA 1NSAA 3J81Y 1WC4A 1OPZA 2XSJA 1UZDA 2CRLA 2KRBA 2JLEA 1JLAA 1LWEA 1LXJA 1HW9A 3DOLA 1UP1A 2R8KA 2HFUA 4KIAA 3X1LB 2JJ4D 3KK3A 4C8ZA 2J9DE 2HNZA 3PV8A 4TVAB 4NZ7A 2HK2A 1FX2A 8ATCB 1HPZA 1B7YB 4NXNF 4C0BA 2VDIA 3PX4A 2EK6A 2ZBQA 2EXUA 2KZZA 5F3TA 3CUNA 1FVQA 3BV8A 4H4OA 3SXLA 2BR0A 3NBPB 3KUEA 4ED8A 3GIMA 3RB3A 5C42B 4CLTA 4UZBA 5BYSA 4ZVHA 4RW7B 1NBEB 2M5YA 4DSIA 1AUSL 3NCPA 4ECWA 2YKNA 2MGZB 1P9YA 5DS7A 3ZZPA 2OAUA 2UV8G 5KT3A 3MAAA 1RDRA 3SQGB 5KFWA 1MROA 2YKAA 1C1CB 1OY8A 3OQ2A 2IJRA 4DL3A 5CQGA 4C0OC 2DPJA 1FXDA 3IBFB 3KNAA 4KR0B 1NSQA 1BE4A 4XPEA 3M6XA 3FUYA 1FRIA 4NX9A 1HI8A 1S1TB 5HLFA 3QLHA 4UY85 4G1PA 1RADB 5AE2A 1EARA 1Y3JA 2FHOB 5HANA 2B43A 2BKNA 3ENVA 1JLCB 2XC9A 4JI5J 2PFDA 3HSZA 2P9CA 3DLHA 4USUA 1KOHA 2AYMA 4YP3A 2Y1RI 1WKKA 4X64F 2Q6CA 1TKZA 3DYAB 5IM0A 1QUPA 3HHLB 3DLKA 3DRPB 1NZ8A 3HDSA 2QC3A 1KWMA 3T5HA 3M32B 1XR7A 2Q43A 5IT4A 1URNA 5B0EA 2JEJA 2JC0A 3WZ0A 2XY7A 4YS2A 2VD3A 1UVIA 1VQSA 4NYOA 2FQQB 2FC8A 1X4FA 6FDRA 1NDCA 4A8OA 3P45B 3EJMA 2UUBF 1MG7A 2HIQA 4CLPA 1VHIA 5J2QB 3QIPB 2AW0A 4ED2A 4IRCA 3BJYA 3RR7A 1FI4A 5C24B 4IUFA 4J7CA 2V34A 4QWDA 4RW4B 4NLDA 3MMCA 2AQ4A 1K47A 1IBKJ 1TV6B 4O4GA 4B9MA 2ZNZA 2HFVA 3MM8B 1LWFB 6FD1A 5D15A 4RWXA 4QIFA 4OHXA 1BD6A 4C8NA 3R6LB 3RTVA 2XM3A 3KLIB 1PG5B 1AXQA 1X8DA 3GFZA 3BBBA 5DO2A 1U1MA 2I5JB 1JQGA 4N8OA 4ZP7A 2OEJA 1CBKA 5DLGA 4NASA 3U02A 4DCJB 3UDCA 1U1NA 4CH0S 5EWFA 1S72S 4E0DA 3U27A 4LF2A 1E6VB 2V6AA 1RHRB 2YNFA 2UVVA 3MR7A 3BO2A 4DG1B 4QWBA 4CLFA 3GTYX 4DX7A 4WP8A 3MPYA 5LT5A 3O44A 1HNZJ 5KT5A 2UP1A 2F9DA 3M9OB 3TZXA 1KFSA 5B0FA 4BC9A 3QT6A 3ICLA 1MWZA 3JTPA 1EAYC 2AHOB 3G8TA 3R7BB 3MTJA 2ZM6F 1WOSA 4OYWA 2UUWA 3EVWA 4AT1B 1HQEB 3POTA 4WFNQ 1S49A 2LXUA 3K7RA 1VBXA 3QFWA 2WRMA 1WD6A 2HBYB 3TAMB 4EO8A 5HSPA 2BJEA 3D6MB 1SKSA 1XC9A 3TX0A 2R7TA 5HMZA 1AT1B 4CH7A 4K2XA 3CO9A 2MQMA 2IM0A 2CNOB 1AZSB 4LF1A 3VAKA 3F0NA 3W5YA 2CZ4A 2GVDB 3RJMB 1D3WA 4U67Q 1J27A 1UPMB 1CEZA 1N33J 1RJJA 4JI1J 3OHBA 1M1GA 3KG0A 2PC6A 3VQSA 3K5NA 2WAQD 2IDLA 2ZHBA 4RUCA 3VAIA 1LQ9A 1FXLA 2DVIA 1EB0A 3SCLE 1M5OC 3DC2A 4ZLJA 1VR6A 4NLOA 2BRKA 5J2NB 2ROGA 4KGMA 4ENOA 2DXEA 2LEPA 5HVGA 2HYIB 4Q8FA 2AP6A 4B3OA 4ZVTB 5SZTA 2JSXA 4ZPAA 3QSIA 5KFXA 3A4TA 2OELA 2E9TA 4DR6J 1DQAA 4K4TA 1ZS6A 3KXDA 3PIPQ 3C3LA 4DQIA 3KJVB 3SSSA 3H2UB 3OFEA 1HW8A 1LK5A 4K4UA 1WDTA 3ZZUA 1FRKA 2OPRA 4USVA 5FDLB 2RVJA 4X62J 2BANA 1YJUA 3DGVA 1CJVA 4DL0C 5J1EA 3CDWA 4WXOA 2DR7A 3UN2A 4TU9A 3PM9A 4P75A 2WHOA 4FXWA 3OTOF 3ELHA 1SC4B 1RTJB 5B0GA 4USJC 4WYWA 3Q8SB 1FKAF 1YSJA 3BF4A 1RT7B 2BV3A 4DV3F 3PJ9A 3QT5A 4AQYJ 3QGGA 1NHUA 4I7FB 4NEZA 4ZPCA 3W7BA 1IKXB 2B51A 3DRRB 3BPSP 3W9HA 3BSOA 5GAGI 2VA3A 5G0RA 3P6YC 5J2MA 4ZPVR 2XYGB 2F8EX 4WZMA 4DEZA 3OW2R 2AYGA 1UFKA 1E6YA 3NAHA 2PEHA 4C4WA 3LPEA 3ITHA 3MCMA 5HK4A 3DMJA 4P9SA 2LQ5A 2CNNB 1NKEA 1S4EA 4DU8A 4X4TA 1YRUA 5KG3A 4IDKB 1VQOS 1XNRF 2J9EA 2JFDA 3K8WA 3RB6A 1XJWB 2G13A 3ZNJ1 3FFIB 4NYPA 2CWXA 2AYBA 5ETPA 4RBVA 2XMJA 2JVRA 2YKMB 2HHTA 5AXKA 1DZ5A 3TUIC 2CADA 1IUJA 4DPOA 4C8LA 3M05A 3EWGA 2W9BA 5JUMA 3ET6A 1HBNA 3K5MA 2A6OA 3LGHA 3G9CA 3MFHA 3M2VA 3WX8A 1WC0A 3Q8VA 1T3OA 1RHUB 1RTIA 2LQBA 3MEGA 6AT1B 4DV5J 3GYXB 4O0NA 4A4JA 4B3MJ 3W9IA 1W2IA 4KHPJ 2XY5A 1AUDA 4OX9J 2DYAA 4NI2A 4CNYA 1S12A 2QJ3A 3OBIA 1YK9A 1R6YA 4HDGA 1DARA 2KU7A 1QY7A 4CTAB 3BSNA 3K59A 3J7AN 2BVZA 5JXSA 2CQ4A 2GCFA 4TQSA 2CQIA 1OJ4A 4E8UA 3TA0A 1RU1A 5B7WA 2YNGA 1UEVA 3D67A 3NNCA 2R7SA 2DNYA 3MFIA 3KNGA 3OJSA 2MDAA 1S76D 2NXCA 3MI7X 3ZO7A 1RCXB 4OZ0A 5K14B 2M8DB 4ZVQB 1LW0A 3OXFA 3PKMA 4CCHA 4CO4A 3TEHB 2HNDA 3ZNUA 3IGVA 2VG6A 4M5JA 4M5DA 1IKVA 1UVLA 5KFHA 3QYYA 2OEMA 2M88A 2FGCA 5AE1A 3ZXWA 4Q44A 4QBUA 2AT1B 2E5JA 1KD1T 1SUQB 3M9MB 5E3RA 4PCQA 1F6TA 4OJ1A 1Q78A 4H4MB 1V6HA 2C2EA 1FDNA 3HJFA 5E3CA 4DHVA 1UTAA 1SV5A 3PRBA 1TVRB 4K4YA 3UWTA 1XMOJ 3PHEA 2B9EA 1VQYA 3MMJA 2Q1LA 2W7OA 3CJSA 1X4DA 2CJQA 1QVFR 1VQKS 2KHCA 4UF4A 2NUUG 2J76E 3KJNB 1IBMF 1G6BA 5CHCB 4CNZA 4K8RA 4KFBB 4DV7J 5KFMA 2EBGA 1HHTP 5K8PA 2YNIB 1KONA 4NMXA 4B9VA 1O0PA 1URRA 1VJWA 3HJVA 1L3UA 1LWXA 4O4RA 4OZJA 4WTOB 2BA9A 2MZQA 1RBOB 5KFQA 1T9UA 4HI2A 4LBPA 5KG2A 1Q82T 4NLTA 3DCAA 4ZS6A 1F5BA 4F3OA 4PRFA 4RNOA 4N77A 1Q7LB 3HP6A 2EFVA 3AB4B 1Y5IB 4URSA 1HYSA 2WSCC 4WYLA 1N48A 4Z2XA 2VU5A 1VQLS 4ED3A 2H5IB 4FYYB 2CPIA 4DR3J 2EKYA 1H2UX 5B0DA 3Q22A 4B02A 1ULRA 5D8HB 4Q0BA 4WTYA 1JLBA 2V50A 3UQSA 2IVMA 4K7QA 3PHTA 5GADU 1D9FA 3HI9A 3GV7B 4JV1A 1RAEB 2AYEA 1S9FA 4FNHA 3RW7A 1N32J 3E01A 2W8KA 4P2SA 2UUAF 5LMNJ 1OSDA 2XMKA 2HPUA 3OSPA 3H5UA 2BMBA 4G6VB 2XI3A 1KR4A 2RRNA 1FFSB 1S10A 1TMMA 2HIYA 1HWJA 2KJVA 1C0TB 2YTCA 1SL1A 3S6EA 3A8KA 3VALA 4NLSA 2QLXA 4EFAC 5EX0A 2E1AA 1N5VA 1OWXA 5F3ZA 3I5BA 1EETA 2MHNA 4R25A 1HBUA 4AL5A 3KWMA 4DUYF 4QIWD 1V3RA 3D1QA 1S9GA 4F0MA 5DGBA 2FY1A 2RKIA 2HVHA 2E7XA 2HRTA 2KZMA 3DRXA 4P72A 2WONB 2KFNA 2Z2YB 4ETZA 1PJ6A 3LO3A 5GAEI 5KFIA 3H42A 1T9YA 3QSYB 3LQVA 3TYTA 3H2LA 2NYIA 1WEZA 2PE8A 1IKYB 2R9LA 4IQXA 1LFPA 3K5LA 3EPIA 2IRYA 2H54B 2ZFHA 3AAWB 1FE4A 2MKJA 5KFYA 3CIZA 2CVIA 4FBTA 1XMQJ 1GX5A 2CYYA 5KTQA 8RUCA 2DITA 2MB0B 5EGYA 1R0BG 2C22A 2IM1A 3PACA 2ZH5A 2ZBIA 3GJSB 1JJ2R 5EWEA 2QMUB 1LXNA 2N3OA 2GVZB 1RHMB 4KTQA 2IC3B 2DNPA 3U7JA 1WTFA 3HPOA 2FLLA 1NB2A 1B0PA 2J7UA 3T19A 4OYAA 2WB4A 2DEIA 5M2PA 2K1RB 1H7XA 2H1YA 4XPCA 3FQKA 4J9LA 2X3GA 1NRKA 1I94F 2XSJB 3HF5A 2JLGA 3I31A 1S6QB 5HN0A 2BYCA 4JI3J 1WOOA 3DOLB 4MKYA 1U6ZA 4HTJA 3GU0A 2NXUA 1NHVA 1CC7A 1GT8A 3KK3B 2G0CA 3GMGA 1U2RA 2GNKA 4A8SA 3JQJA 3QZ7A 2HNZB 3MD1A 5D3GB 4ZPDA 4ALZA 2VASA 3J7Z5 5A8WA 5F8HA 3NWGA 3H40A 4J5OA 5L9NA 4ES1A 5KG0A 4F4AA 3AJDA 3IAS9 4WWSA 1ZAXA 5HJYA 2K2PA 3NP5A 3D2WA 5GMEA 5GAGU 4YY3J 4ZCMA 1KC8T 1SVDA 3O1LA 2DCUB 3DOKA 1EJ7L 1QDUB 2KRRA 2HHQA 2N7CA 5F9LA 4NLRA 2AEMA 2E1PA 4QW9A 2IA0A 2YKNB 1G1XA 2Q6BA 1YRTA 1RWXB 1X5OA 1RWMB 3KTQA 3S1TA 2K7KA 1U25A 1UZHA 5M2UA 2KO1A 1MROB 1YLXA 2ASYA 4OI4A 3MAQA 3UI3A 3RRGA 4IG3A 1KFDA 1T05A 4KGVB 2KT2A 2JX2A 4LF4J 2ILZA 3BDPA 5HLFB 2HQIA 4DV0J 2VUGA 3AHPA 1T02A 1RTDB 3M8QB 3HHLC 1U1OA 5K20B 1D8ZA 1VQ5S 2DEJA 3GP9A 4RX6A 3CGIA 2DR5A 2N4DA 1TL1B 3CCMS 5JVHQ 4LBHA 2QE5A 4DV2F 4C98A 1RYRA 1D9DA 2GX8A 3SYZA 3CXCR 4LSNB 3EGNA 3VAJA 3AOBA 5KFKA 4M94A 4X4PA 1DTTA 4WK3A 4CO0A 5HO4A 3FBBA 4KH0B 3C8YA 3WBZA 1NKBA 2RQMA 2IJNA 2BABA 2GMLA 1FJEB 4YB7A 2VG7A 3IR5B 5L1JA 2XHCA 3CJTA 1WF0A 4AL6A 2Z58B 3Q8RB 1UEUA 2GS8A 2OPSB 2KYXA 1PJ5A 3DDKA 4JI8J 4MKAA 2FJBB 1L3SA 1Y7PA 3IAM9 3MMCB 1IR1A 1RWVB 1X4HA 4LVOP 1UW9A 1L5UA 4V1Ak 3AY0A 1F3FA 1FT8A 4ZMMA 1TL4A 2BZ2A 1J5EF 1RT4B 2CJKA 5KFFA 5E41A 4RUHA 5T41A 3BGFA 3MM9A 3FNNA 1CSJA 2CDQA 2HNYA 1UEKA 3BGRB 2IM2A 2XWXA 1FRHA 2M0GB 2AD9A 1FTCA 3V4IA 5D0RA 3I0RA 2CZVC 3IA0A 2UXCF 1HBOA 4LFBJ 4KKOA 1SH2A 1RWOB 4M5MA 1PAUB 2DY1A 1NK9A 1DBDA 4LQ3A 2VL1A 5KFNA 2XQCA 2V5HG 3OFGA 4KSEB 4FXDA 3W8PA 2R8GA 4DL6A 1V5IB 3NCQA 3MEDA 4P6QA 5B0BA 3KLVA 2C42A 3LPYA 3R5GA 3MOZA 1CJUB 3RB4A 3CVKA 2QG9B 2ZH3A 1EKRA 4DV1F 5HBMA 3SZ2A 1S0MA 1RXOB 2B5JA 4C8YA 1Y11A 1HBMA 4QYRA 3TVKA 3BREA 1J5OA 3F56A 5I42A 4ECRA 2KM8B 2UUCF 4K4SA 1GQEA 2NPFA 2DNRA 2DGVA 2ZH7A 4ELUA 2P9GA 1XR6A 3POTB 5E2QA 4NLUA 3H4BA 3W5XA 3JTOA 3TWZA 3JYTB 2ZH1A 5CYMB 1X31C 5D77A 1FFGB 4PZVA 4Q8EA 1DTQB 2YWGA 4TNOA 4RW8A 3TJAA 5DDPC 3B4MA 3KLEB 1TK5A 4F50A 2IAJB 1U47A 4RW9A 5A0YA 2BW2A 3RBEA 3UDLA 1KVJA 1X60A 2W9CB 2RD5C 1JNZB 3PRVA 4USMA 2MQOA 1Q53A 2DH8A 3UDVA 1VQ9S 2B4OA 3K5OA 3D6FB 3J80Y 5SUHA 2DT9A 4IYQA 1QE1A 3I6PA 2O5DA 4ECTA 2QTWA 1NLKL 1NKCA 4PWDA 3WQPA 3HSGA 3BSAA 1T9XA 3D6HB 4JYAJ 1WF1A 1U09A 3J7YU 1IWGA 1BHNA 1EX8A 3KLFB 4EBEA 5DETA 2RB7A 3TZWA 4B3OB 3FZBA 5F8IA 4JI7F 2GJFA 2HZAA 2UVUA 2DNKA 4B3RF 2UUBJ 3D1OA 2K06A 5KFOA 2J8AA 5I3UB 4DR7J 2BM1A 4LRBA 5ETQA 4CZCA 3KUHA 1YJRA 2COLA 5HP1A 2J0SD 3OJUA 3OUYA 1EP4A 2DR6A 2CPHA 1PYSB 3DLEA 1JLFA 4A8QA 3PX0A 2EFNA 2GO9A 1M1KT 2ZNYA 2XSFA 3J80U 3PW4A 1KLNA 2CQ0A 1H72C 1JLQA 4MIAA 4R5PA 1FF2A 5L1IA 5GAEU 2VONA 2BOAA 2DO4A 2CQPA 1HI0P 3B6BA 4CO1A 3KJFB 4OL8A 2CJXB 3KDNA 4C3MA 2PDAA 4OX6A 2RH3A 3W64A 2O01C 3HCXA 4OZ5A 2DRBA 4FS1A 2XWYA 3MPUB 2RF2A 2HRYA 1S5ZA 3CULA 5G0RB 4FF1A 4DPUA 5ETSA 4JI5F 3CC2S 3L4BC 4RWWA 3KUGA 3L7OA 1GXTA 1E6YB 1T11A 2YWKA 4ECUA 3R5JB 5HQMA 4I2QA 5B09A 2VOOA 2H4WB 3LA0A 3I5CA 2NZ4A 1X5PA 1NMEB 4TY9A 1UA0A 1YVFA 4N76A 3AD8C 2HLUA 2ZM6J 2E1MC 3V2UC 3FSYA 2I1RA 2IVFB 4X4UA 3OL8A 3VVTA 4EUVA 4WXWA 4WP9A 2OPQB 4LRAA 3DLGB 4WP3A 1K1QA 3BYPA 4O44B 3JQMA 3CCJS 1S6PA 1N5QA 2EKNA 2P6TA 3PEJA 3RW6A 4CLWA 3R5AA 5FJ4A 1VIOA 2GGPA 4IO1A 1S9EA 1UWAA 2AMCB 2ZD1B 1WHYA 1VDHA 2RDDA 2X51A 1SJ1A 1LW2B 2KT3A 1BQMA 1IBKF 5EN1A 4KPCA 3AA8A 3CDUA 3HXMA 3OLAA 2XI2A 3MEGB 3PR4A 3VWSA 4L72B 3QJJA 3TNVA 2X1GA 3P5TL 4EK2A 4DOZA 1BWVA 4NWBA 3NOGA 1H2VZ 3A1YG 2K3IA 3TQEA 4U7CA 3H7HB 2ZH2A 1JJHA 1D1UA 1VQ4S 1U0HA 5CYJA 4TYAA 3SFGA 4HKQA 2QEXS 3A8EA 3LGNA 4P7TA 4NLWA 4PEOA 4R0JA 5KFDA 3JXOA 4PG5A 3NBPA 1Q79A 3BGLA 4URQU 4ERDA 4XAKA 5KFJA 4WFAQ 2DGUA 3W1YC 4EYHB 4KRWA 1X9SA 1GMVA 3M30B 4GVLA 4A8KA 3T1YJ 4RW7A 4LF8F 1HNZF 5CCLA 3V6KA 5HJXA 4ECSA 2VG6B 2V8PA 3DM2A 3I87A 1XQIA 4LR9A 3EE3A 4DQPA 4DF4A 2MGZA 3P4UB 1XNQJ 1I6JA 4OHVA 4UUXA 4M1KA 4K4XA 2CPEA 1RLDA 3FCHA 5D4OA 4DF8A 1HWKA 4IR1A 2XGPA 2E9RX 3B54A 2HWIA 4QZVB 5A6WA 3AJ1A 1DLOB 2GIFA 4F0HA 3VAFA 1S1TA 2WZ1A 1HFEL 2DXFA 4EU0A 2GHVC 2XHWA 4PAAA 2W8LA 1N33F 2YVSA 3GG0A 1JLCA 4JI1F 4H54A 1SJ3P 4DI6A 5KFAA 1BXNA 1OPIA 4C8MA 4MK9A 1NK5A 1RHKB 1UFWA 1ZOTA 5L1LA 1TK8A 2WVDA 1Q0NA 1ZZFA 3DYAA 4WZQA 4LBIA 1BC6A 4N41A 3HHLA 4Y2KA 4WBFA 4ZVGA 4Y00A 1F2GA 4F3MA 1OMSA 1ZM9A 3D0IE 3TRGA 2CQ3A 3OV7A 1XNRJ 5E3AA 1N5TA 2WVCA 4C8KA 4O0IA 1KQFB 4N5SA 5EX3A 2UXBJ 5C7PA 1VYAA 5KT6A 2R7WA 3B82A 3B8HA 5J2QA 4DUTA 2ZVIA 4B9SA 3EZ5A 4ZHRA 3QIPA 3DKDA 2BQRA 2MLXA 2B3TB 1U2CA 2ZZTA 2LQ8A 4RW4A 2XZDB 2DGXA 2G2YA 1TV6A 4U7UD 4X62F 1FEEA 3MM8A 1JLBB 1LWFA 2C2RA 1Y10A 3C66A 3U1LA 3FBCA 4DR4F 1JNRB 1UA1A 2LU2A 3KLIA 3E01B 3H5YA 3R6GB 4OHWA 4UZCA 5KFCA 1KS2A 2I5JA 3PFOA 1MSWD 5FLXU 2QT7A 3DI6B 2R7QA 2FJXA 1DJ0A 4NEYA 5KT2A 1FJ7A 3A13A 4AQYF 1FE0A 2V8GA 5JMNA 4G3IA 4LRFA 4YB6A 5F0UA 2V94A 4ZN3A 4LSLB 2Z2ZA 2BKOA 3H98A 5DG7A 2VZ9A 3NMRA 2XMMA 3I56S 5L39A 4GC6A 2XULA 2MYFA 5HAOA 1QD1A 3PW7A 1S9GB 2RE1A 3OHAA 5IXUA 2FHMA 1VBKA 3MCSA 1VISA 4TY8A 4R0EA 1AA1B 1GFWB 1Q8BA 4CIOA 2HHPA 1HQEA 1VBYA 1HHQA 3SEOA 4S0MA 1V3SA 3TJ8A 1XERA 4ZPTR 4KV8A 3DLBA 4H4KA 2VQEJ 1S6OA 2CPYA 5IV3A 4HHUA 2MXYA 2HFSA 2YXLA 3B78A 1O8BA 4OQJA 2GVDA 4OI0A 2Y1JA 2FVCA 1CULB 2E7WA 2DB1A 1OY6A 2APOA 4Q7AA 1KVKA 4YR3A 2CKWA 3MOJB 3IS9B 4LR8A 1FHTA 3AT1B 1VRQC 1SQFA 4OX9F 4F8RA 4UUWA 3QQCD 4ETXA 1SKRA 1W25A 3IC1A 1GXLA 2DK2A 4NCBA 3CCVS 2NXNA 3HFZB 2DH7A 5J2NA 2QN6B 2DRAA 2X3DA 3CCUS 2WBRA 2AGOA 1NJZA 3SIPB 3CD6S 2JL9A 3PR5B 2DD8S 2BOPA 1WNEA 3R9LA 4WFBQ 2Y1IA 3N5FA 3DDNA 1YZ7A 2MKIA 4PPZA 3KJVA 4R8UB 3HVAA 5LMUJ 2OTLS 3H25A 2DGSA 2V2ZA 3O6QA 1FO1A 3VAHA 3MPVA 2CQGA 3HHLD 2LQJA 3PYEA 4KH1B 1G2EA 2OPPA 2POKA 2HW3A 1TL3B 9RUBA 3W2WA 3W8GA 2CXEA 3S8SA 1YRXA 4FF2A 4ELTA 1FFWB 4OX7A 2MTLA 3DXSX 2J6UA 2GIQA 4HH0A 4GO5X 4YFUA 2M9KA 1VI7A 3FC9A 3M2UA 2X1BA 2WVEA 3QWUA 5JVGQ 1Z2LA 1R0AA 2AU0A 3EZOA 3GYGA 3IBCB 3R27A 3DOKB 4QU7A 4J9VA 1WEXA 2MY7A 4DU7A 1RHJB 5BXIA 1RT7A 4LF6J 1XMOF 1GMUA 1PC4A 3THVA 4I7FA 2CJYB 1VQ7S 4O3RA 1RP5A 1IKXA 2OKQA 1VLOA 1LKZA 4LRDA 1ZETA 3PYFA 1CJKB 3KK2B 5D4NA 3LW5C 5LJ5Y 1YWXA 4DV7F 4K50A 1BQXA 1EZZB 3GE9A 3MTKA 2E9ZA 4DS5A 2NXJA 1WJ9A 1N5YB 2DY9A 4A8XA 4NYZA 4NLGA 1SC6A 3CJ4A 5A8RA 3MR2A 5IV4A 5IT9U 1JIHA 4YHHJ 3UD3P 3CWJA 1G7CB 3FFIA 1XR5A 2QV6A 1X4BA 2AJ4A 1NJWA 4MIWA 3NG8A 2V2KA 3CC4S 4A47A 1GEHA 1B4SA 1DTTB 1W7WA 2C3OA 3BM7A 4YQWA 2D41A 4Y28C 3DOMB 4DR3F 1F9HA 1LK7A 5HL7Q 2HZVA 1PSDA 3Q2TC 1PIEA 4FP9A 1G3OA 1TUGB 2RILA 4F4YA 4KYZA 1F3VA 4KC5A 3TO8A 4TU8A 3FKBA 4NLPA 1IJEB 1N32F 3T5JA 5LMNF 4CTAA 2F7VA 1IM4A 1Q81T 4FN5A 3OTBA 5H9EJ 3HLUA 2B7BB 1MMNA 2AIRB 3CCZA 3PFEA 3MZIA 3TZYA 4FZVA 4ZLPA 1WWHA 2ZWOA 3D0HE 4XIUA 1UCNA 5LOQA 2FHJA 5L46A 4AD6A 2BUNA 5K14A 2E66A 3G8QA 1OQ3A 1IVZA 4K0KJ 3MM6B 4MK7A 3V4IB 3RYLA 3I0RB 3MECA 1UMJA 2C3MA 2C3PA 1N36F 3ENQA 2JVOA 2DNGA 3ZTQA
chains in the Genus database with same CATH topology
5ETLA 5ETKA 3KUGA 1IM6A 4M5GA 3ILIA 2CG8A 5ETVA 4AD6A 2F63A 4M5IA 1KBRA 4CRJA 1F9HA 1EX8A 4M5JA 2F65A 3MCMA 4M5NA 5ETNA 1RU2A 1DY3A 3ILLA 4CWBA 4F7VA 3MCNA 3HT0A 3ILOA 1HKAA 3HD2A 5ETQA 3KUHA 5ETPA 1CBKA 2BMBA 3IP0A 4M5HA 3HSDA 3MCOA 4PZVA 4M5KA 1RTZA 3QBCA 3ILJA 5ETRA 3HSJA 3HSZA 1G4CA 4M5MA 3UDEA 4CYUA 1TMJA 1EQ0A 1EQMA 5ETSA 3HSGA 3UDVA 1HQ2A 5ETOA 1Q0NA 1TMMA 1RB0A 4CYUB 1RU1A 3HCXA 3KUEA 4M5LA 3UD5A 3HD1A 5ETTA 5ETMA 2QX0A 1RAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ETL A;  5ETK A;  3KUG A;  1IM6 A;  4M5G A;  3ILI A;  2CG8 A;  5ETV A;  4AD6 A;  2F63 A;  4M5I A;  1KBR A;  4CRJ A;  1F9H A;  1EX8 A;  4M5J A;  2F65 A;  3MCM A;  4M5N A;  5ETN A;  1RU2 A;  1DY3 A;  3ILL A;  4CWB A;  4F7V A;  3MCN A;  3HT0 A;  3ILO A;  1HKA A;  3HD2 A;  5ETQ A;  3KUH A;  5ETP A;  1CBK A;  2BMB A;  3IP0 A;  4M5H A;  3HSD A;  3MCO A;  4PZV A;  4M5K A;  1RTZ A;  3QBC A;  3ILJ A;  5ETR A;  3HSJ A;  3HSZ A;  1G4C A;  4M5M A;  3UDE A;  4CYU A;  1TMJ A;  1EQ0 A;  1EQM A;  5ETS A;  3HSG A;  3UDV A;  1HQ2 A;  5ETO A;  1Q0N A;  1TMM A;  1RB0 A;  4CYU B;  1RU1 A;  3HCX A;  3KUE A;  4M5L A;  3UD5 A;  3HD1 A;  5ETT A;  5ETM A;  2QX0 A;  1RAO A; 
#chains in the Genus database with same CATH topology
 2CAJ A;  2IJF A;  2FZG B;  2JDJ A;  3IRX B;  3CCR S;  3CD0 A;  3MED B;  2DHS A;  5HVF A;  1AB8 A;  2KM8 C;  1BY9 A;  2MY8 A;  4UTG A;  2GA7 A;  4DL2 A;  1ZTT A;  2M7S A;  1REG X;  1RA6 A;  2Z4P A;  4OI1 A;  4M63 A;  2MQN A;  2LLZ A;  2B5J B;  1Q8K A;  3NOC A;  3SDE B;  3G96 A;  2DKO B;  2OSR A;  3G6E S;  1J5O B;  2FC9 A;  3UW1 A;  3DHX A;  1R0C B;  1TVR A;  4MK8 A;  2FY8 A;  1IJF B;  2I8E A;  3PJX A;  3QT7 A;  3UN5 A;  4Q2L A;  2O67 A;  5THW A;  1TL5 A;  1D8Y A;  1R8B A;  2HVD A;  2ZIT A;  4K59 A;  2F40 A;  4NML A;  3PCO B;  2ZJQ Q;  4KFB A;  3RBD A;  3PYD A;  3CME S;  1YBU A;  3CDA A;  1U1K A;  2YNI A;  1HMV B;  4OJH A;  4RW9 B;  2J6T A;  2IPO B;  3HK2 A;  1ITP A;  4TYB A;  2R8H A;  4F4X A;  4OLP A;  4NA1 A;  3GJT B;  1REV B;  2XS7 A;  4IH7 A;  4L3N A;  3CCS S;  2VPW B;  4WCE Q;  5DM7 Q;  3ISN D;  4A48 A;  3QJP A;  4JI3 F;  1N88 A;  2KXH A;  2WSE C;  1TAQ A;  4X4O A;  1F9E B;  4F36 A;  1WC5 A;  4JV0 A;  1KHW A;  3PJW A;  1FRJ A;  2OMO A;  4I6A A;  4LVN P;  1FD8 A;  2G2O A;  4EZ9 A;  3HHE A;  3I9V 9;  3BQ0 A;  3KMS A;  1IKW A;  3M6V A;  2AEJ A;  2MKH A;  1FK9 A;  1VRU B;  2G9O A;  1X4A A;  8AT1 B;  2BRL A;  3RBZ A;  5GAH U;  4OZ2 A;  4E2F B;  1B7F A;  2QLJ B;  4KY3 A;  2MJU A;  3D66 A;  4MAK A;  5F8L A;  4LFC J;  3KKF A;  1K73 T;  4O3N A;  3RRK A;  3GWC A;  4RL1 A;  3F44 A;  1YZ6 A;  3JSM B;  1HNV B;  4YY3 F;  2HWT A;  3DLL Q;  5C2G A;  2VHG A;  2PT0 A;  1LOU A;  2XY6 A;  1Z2Z A;  1C0T A;  5E5N A;  2QA2 A;  3AOA A;  3WHI A;  4F3Q A;  5L1K A;  4ED7 A;  2VC0 A;  3M8S A;  4ED4 A;  1PJ7 A;  4LSZ B;  1T0T V;  4ZIT A;  2RU9 A;  4O3Q A;  3D0G E;  3IRW P;  1RT2 A;  3QAU A;  3T1H J;  1ZBT A;  3LTO A;  2OO4 A;  2NS1 B;  2M2B A;  4LF4 F;  4WK1 A;  1JJC B;  1WC1 A;  2GJ2 A;  4AXJ A;  3RRH A;  2MZS A;  2QLB B;  2LMI A;  4EI2 A;  2RF2 B;  2RHQ B;  3CD7 A;  1HWL A;  1NJX A;  2VBY A;  2RML A;  2FZK B;  1TAU A;  2N7Y A;  2F63 A;  3THP A;  3HFV A;  4Z37 A;  4L6V 3;  3KJQ B;  5AT1 B;  4CLL A;  4QCL A;  2FHJ D;  4ANC A;  4I2Q B;  5A2Q Y;  1EQ0 A;  1T3N A;  4PG7 A;  2I38 A;  2BJ9 A;  2QL9 B;  2MZJ A;  4L73 A;  3OR2 A;  4L3K A;  5L9X A;  2GV1 A;  2DO0 A;  5KFS A;  3W66 A;  1WG5 A;  2KFY A;  4X4R A;  5IWA F;  3W9J A;  2IC3 A;  1GAO A;  3PO5 A;  3HVT B;  2V2V A;  3D3B J;  2L9W A;  2XBP A;  4JI8 F;  1S9E B;  2QFJ A;  4W90 B;  2K1R A;  4WJB A;  4JBC A;  3QPI A;  5GMD A;  2HHH J;  3QGH A;  3RU0 A;  1HNX F;  1BQM B;  3RAQ A;  4I0W A;  3Q8Q B;  1KTQ A;  4ZP8 A;  2LU1 A;  1S6Q A;  2R3V A;  4GC7 A;  3KG4 A;  3MCO A;  3PDN A;  4IRK A;  4ED5 A;  4BS2 A;  2DHG A;  3EXY A;  2IFX A;  5A2Q U;  3F41 A;  5D78 A;  4PG4 A;  1CJT A;  2F1F A;  2VBZ A;  3ZZO A;  2C3Y A;  4JI4 J;  4G65 A;  3QO9 B;  2UUT A;  4J91 A;  5D3G A;  1NB7 A;  1X9M A;  2XO6 A;  4LFB F;  1U0H B;  3NNH A;  2OD6 A;  3D7S B;  4U8Y A;  3UD4 P;  4JI7 J;  2QL7 B;  3N6N A;  1C0U B;  3TQ1 A;  4B3R J;  2WCX A;  3IGN A;  4HTI A;  4O23 A;  2GAG C;  3MMB A;  5B0A A;  1FWL A;  2QSW A;  1QSL A;  1TKT B;  2VJU A;  4EYI B;  1KVI A;  3IWL A;  5KFZ A;  4WU2 A;  2ATC B;  5ETN A;  4CQ1 A;  1R43 A;  2EFO A;  3QBC A;  1RWN B;  3J81 U;  4DPT A;  4ES3 A;  2BJ7 A;  2VQF J;  3DM2 B;  2V68 A;  4FF3 A;  3SCK E;  2PFF B;  4WII A;  5ETL A;  2PII A;  3TJ9 A;  4QR1 A;  2QSF A;  3U1M A;  4ZCI A;  4CLY A;  1IN0 A;  1Q4R A;  3SV3 A;  5J1N A;  4B9U A;  1YTY A;  2GAH C;  3ZC4 A;  3NKY A;  3BGU A;  2J6S A;  2CNL B;  2CIM A;  3K57 A;  1C2P A;  2BDP A;  1BMQ B;  4TN2 A;  2D9P A;  3LH2 S;  3GFH A;  3RG6 A;  2KJW A;  4J37 A;  2C3U A;  1Q1K A;  1RTD A;  3M8Q A;  2MKY A;  2RSQ A;  4MFB B;  2UXD J;  2WOM B;  1NDL A;  5F0W A;  3R7N B;  4HVZ A;  1FJC A;  2W4C A;  3SSQ A;  2FJD B;  1TL1 A;  3Q89 A;  5AE3 A;  1HNI B;  2F9J A;  2VPX B;  4B3T J;  1ZM4 A;  3Q2S C;  1VQ6 S;  1IQZ A;  2C1E B;  1X7V A;  1NH8 A;  4ZLN A;  4LSN A;  4M5N A;  2XMA A;  4JYA F;  4KQZ A;  2BX6 A;  3N9U C;  4EWT A;  4WKR A;  1DFD A;  2MZR A;  2J0X A;  2BM0 A;  4F04 B;  2B6A A;  1LNQ A;  5HQ8 A;  4I56 A;  1RIS A;  4P71 A;  1YIJ S;  1FDD A;  5KFP A;  2OML A;  3DN9 A;  2IRU A;  1FCA A;  4DR7 F;  5K5M A;  2OPS A;  1WC3 A;  1Y9O A;  4ZHR B;  4UT4 A;  2QYC A;  1S1X B;  3EGZ A;  3LUY A;  1UJ5 A;  3M6U A;  1S99 A;  4UW2 A;  4HYK A;  4C8O A;  2VA2 A;  4X65 F;  5MAO A;  2V0N A;  3I82 A;  1RT4 A;  2KDO A;  2ADC A;  4ZLL A;  2DIU A;  4ZCL A;  5E3Q A;  2I2Y A;  3GYN A;  4I4B A;  3BGR A;  2GMH A;  3JSR A;  4GRS A;  3M8Z A;  3DGP A;  4I67 A;  1SIW B;  3KK1 B;  4LIW A;  2AZ3 A;  1U1Q A;  4AE5 A;  1FER A;  2DHA A;  2NRE A;  2RDJ A;  2CQH A;  4K4Z A;  4FF4 A;  2Y9H A;  1P6T A;  3CJ8 A;  4J90 A;  4JV5 J;  1TUW A;  2CG8 A;  4QYZ J;  3BSC A;  4ECZ A;  1RAJ A;  1CJU A;  4LFA J;  4NLX A;  4TQR A;  1F2H A;  4V19 J;  3M4X A;  2W2Q P;  5F8J A;  4NA2 A;  4ZIV A;  3T6B A;  4LF8 J;  5A6P A;  3JTN A;  1N0V C;  2D3U A;  1NAQ A;  3W61 A;  2WVB A;  4DMZ A;  3QAE A;  3G6X A;  4IFY B;  4Y6I A;  3T6J A;  4TY8 B;  1AYE A;  3M1V B;  1I5O B;  1NDP A;  3BB5 A;  1PAE X;  2R42 A;  4JUZ A;  4FYD A;  4PXC A;  3DRY A;  4WE1 A;  4LF5 F;  3JYT A;  5CYM A;  2F4V J;  4MT1 A;  2VFU A;  4KV8 B;  4ZN1 A;  1DTQ A;  3MEK A;  2AJ2 A;  1RT6 A;  5CXT A;  3D28 A;  2ROP A;  3KLE A;  1OYD A;  1HWU A;  4RUB A;  2IAJ A;  2X1F A;  3CCE S;  4NLV A;  1GTH A;  2AJQ A;  2NLW A;  2QFI A;  1Q5V A;  2W9C A;  4CM0 A;  4KO0 A;  3Q8P B;  4ZVS B;  1JLE B;  5DZ7 A;  3KYL A;  3Q0A A;  5KOX A;  2R8I A;  4HL9 A;  1I3O B;  2DHX A;  2V63 A;  4DL5 A;  5IQ6 A;  3OVB A;  1WSV A;  3I55 S;  4DWI A;  1NPP A;  3C19 A;  3KLF A;  4M5L A;  2V69 A;  2YWE A;  3CJK B;  1S4F A;  4NZ0 A;  5AJ3 F;  3MPW A;  4CWB A;  2IIH A;  1CLF A;  4NXM F;  4YOE A;  4DZD A;  3K58 A;  2RQ4 A;  3BH7 B;  2F8M A;  4MYT A;  5I3U A;  4J9K A;  4LF9 J;  2GHW A;  3LWL A;  2HHV A;  4WKY A;  2FPH X;  3TX8 A;  4J9P A;  3T1Y F;  4N56 A;  3OLB A;  2D3O 1;  1TFY A;  2OPP B;  1X4E A;  4X66 F;  2VG5 A;  1FKP B;  3W2W B;  4NLQ A;  2QGF B;  3I0S B;  2JEI A;  1XNQ F;  4DR4 J;  1U4B A;  4TKT A;  3M2U B;  2MPU A;  5T14 A;  1K9M T;  3Q24 A;  4OYB A;  2ERR A;  1R0A B;  3G4S S;  4Q43 A;  2EWH A;  4ZJO A;  1UVN A;  1B0T A;  2ZWP A;  2BQU A;  2XZW A;  3VGS A;  4JB8 B;  4FS2 A;  3MR5 A;  2K3K A;  4LR7 A;  1HLW A;  4ZVO B;  4DR5 J;  1M5H A;  4I69 A;  4EEY A;  2R2U A;  3KDO A;  3FRY A;  2HQC A;  1PBA A;  5CH7 B;  3VCD A;  2RU3 A;  3R2C J;  4CO3 A;  1VJQ A;  4CI0 B;  5A8R B;  2LXF A;  3X3U A;  5H9E K;  1ZA2 B;  2VV5 A;  2ASL A;  2CWK A;  1B70 B;  2E44 A;  4X4N A;  2ASJ A;  2OPQ A;  3DLG A;  4O44 A;  1S1W B;  2VKZ G;  2UXB F;  4A46 A;  1RTZ A;  1FWK A;  3VGV A;  2ZD1 A;  5HAT A;  2D3O R;  4U8V A;  2WTF A;  2PEB A;  4PYA A;  2VFT A;  4KT0 C;  2NPI A;  1LW2 A;  1VIX A;  1SB6 A;  3M7V A;  2ZZN A;  3W62 A;  4LIR A;  2V67 A;  5F8G A;  5CCM A;  2L41 A;  1TKX B;  4ILR A;  5U47 A;  1O6X A;  3HM9 A;  3V6H A;  3H5S A;  3JSB A;  3C46 A;  2P2C B;  3WX4 A;  2HAF A;  1R8C A;  1MN7 A;  4F7V A;  3UFC X;  1L3T A;  4M5H A;  4I68 A;  2DNH A;  4RKU C;  1UJ4 A;  2WSF C;  2B8Q A;  4RNH A;  1WEL A;  4RNF A;  2QX0 A;  1FRX A;  2MZT A;  1KHV A;  4PPD A;  4NRT A;  3AXM A;  1S0V A;  3HZG A;  4KGZ B;  2VF3 A;  1GNK A;  3M30 A;  1CQN A;  2R8J A;  3MEC B;  3FMW A;  2ADB A;  4HH1 A;  3CCQ S;  5LSL A;  2J5A A;  2ALY B;  3G6Y A;  1YJ7 A;  2W2P P;  4I2P A;  1DY3 A;  2VFS A;  2J0Q D;  2HBQ B;  4U6P A;  2BKP A;  3CJ3 A;  1TL7 B;  3K8V A;  5EDW A;  3VAG A;  2Y8Y A;  2CQB A;  9ATC B;  2A1B A;  3BGO P;  2VQE F;  3FSX A;  1KKH A;  4JP8 A;  5BYR A;  2KN4 A;  1DLO A;  3GZ7 A;  2GQC A;  2W24 A;  3HFK A;  4P2F A;  4IOA Q;  2E5I A;  5KT7 A;  3KHH A;  2QMX A;  4P2X A;  3U1N A;  4RO0 A;  3W63 A;  1FDA A;  5JJB A;  4K2J A;  4BDP A;  3V6J A;  2KVI A;  2CPF A;  4F4Z A;  1JB0 C;  2HK3 A;  3LP2 A;  1X4C A;  4OZ3 A;  4YDX A;  1X0F A;  1VQN S;  4W4M A;  4ELV A;  1X4G A;  1B3T A;  4OIX A;  1U2F A;  1QVG R;  2XMT A;  1SJ4 P;  3GSD A;  5DZ6 A;  2BJ8 A;  4LT6 A;  2W7P A;  4YR2 A;  2P8I A;  2Z2L A;  1VQ8 S;  3OFF A;  1NK7 A;  4Y65 A;  1X0P A;  1RCO B;  2JFK A;  2IBO A;  1NM2 A;  4OYO A;  1KN6 A;  2AJ0 A;  2BE7 D;  1R8P A;  3FSI A;  5LMU F;  2CQD A;  2Y0B B;  3GSI A;  1NPK A;  1IKW B;  4EZ6 A;  1H98 A;  4ECY A;  3G71 S;  1FK9 B;  2BE2 B;  3BBF A;  2KHD A;  3JS9 A;  3NRB A;  2XNQ A;  1GMW A;  4XDD A;  4X4S A;  3GR0 A;  2R2T A;  2M4M A;  4K5R A;  4DDF A;  5H1S V;  4FDF A;  1YBA A;  4IO9 Q;  2EBE A;  3EYZ A;  1MNE A;  4CLK A;  3NMA A;  1NXI A;  2RUG A;  2XYH B;  4PAB A;  1NJI T;  2CZ9 A;  4YN3 B;  4DSK A;  3HSD A;  3DI6 A;  1NCL A;  4QPT A;  2YQ3 A;  2JEF A;  4LF6 F;  1ZPV A;  2EFG A;  3R5D A;  5BR8 J;  4DV4 J;  3W3S A;  4C9D A;  2G1H A;  1RUS A;  1LFW A;  3H4D A;  1NZA A;  1FNX H;  4LSL A;  1ZZN A;  1RB0 A;  5DLF A;  5C5J A;  1RT2 B;  4M95 A;  3WIU A;  4DSF A;  3PG9 A;  1N36 J;  1S57 A;  3M8Y A;  2XYP B;  2CJ9 A;  3OTE A;  3NGS A;  1YI2 S;  5ETM A;  2H9Z A;  3QGI A;  5H9F J;  4YHH F;  3UCG A;  4ED0 A;  3MDF A;  1T8E A;  1F0X A;  2VFV A;  2O1P A;  4DR1 F;  3ILJ A;  1C1B B;  2OHD A;  2UVW A;  2MMY A;  3OL9 A;  2FLN A;  2U1A A;  4IQM A;  1EHW A;  3MUM P;  3H0P A;  3WDO A;  2LEA A;  4HEA 9;  2IBK A;  5I3Q A;  4NA3 A;  3OR2 B;  2KFZ A;  3VHQ A;  1UVM A;  3OVS A;  4DPX A;  3TVY A;  1CUL A;  1I1G A;  3PNI A;  4C3K A;  2IVY A;  4DX8 H;  1HNW F;  4ED1 A;  3MF5 A;  3IS9 A;  3CED A;  3KHR A;  3MUR P;  4HI1 A;  2C2O B;  1S1U A;  3HHN B;  2LA6 A;  3GON A;  4W92 B;  1N34 J;  2C28 A;  2DNL A;  2XCP A;  1WOP A;  4WF9 Q;  2RJZ A;  4Y34 A;  3QZ8 A;  3UPF A;  1LV5 A;  2W2N P;  3R8Y A;  3NWR A;  4ZOS A;  3WIV A;  3HZE A;  1SL0 A;  3L3C A;  2I9S A;  2R2R A;  3N6L A;  5KFB A;  2OSQ A;  1RE1 B;  1BUX A;  2G1D A;  3MR6 A;  1R6V A;  4R8U A;  4IKA A;  1MU2 B;  3CB4 A;  1CJT B;  1JKH B;  1VLY A;  5C25 B;  4K0K F;  1IM6 A;  3EM1 A;  1HI1 A;  3CTR A;  3R2D J;  2HFZ A;  2BQ3 A;  1TL3 A;  2NYH A;  1S97 A;  3DRS B;  4OI6 A;  3MMB B;  3NS6 A;  3CJQ A;  2V4J B;  5FD1 A;  3M2R B;  2VBW A;  3Q23 A;  3QRP A;  2FB0 A;  4USK A;  3V81 A;  1RSC A;  3W65 A;  2J9C A;  4M5I A;  1SQG A;  3OTD A;  2JNJ A;  1AW0 A;  1M5P C;  4UQT A;  5T7L B;  1IBC B;  1GMW D;  1UWB A;  1CJK A;  4ZJL A;  3KK2 A;  4C97 A;  4J9N A;  4WFY A;  2MJN A;  4J9S A;  1U02 A;  2OLW A;  1QM9 A;  3UNY A;  4Y2A A;  2GJI A;  3EDQ B;  5KG7 A;  5CAA A;  2FIU A;  3R1L A;  1Q7Y T;  4FBU A;  1N5Y A;  5ETT A;  1RT1 B;  1APS A;  4MH8 A;  4ZA1 A;  1IQT A;  4A8M P;  5DGA A;  1RAG B;  5KG1 A;  2DXD A;  1QLN A;  2A10 A;  1S0N A;  1VBZ A;  3BR9 A;  2H5E A;  1LWC B;  3OVA A;  3EPG A;  3NS7 B;  3A3O B;  5DDQ C;  3BEG B;  3D68 A;  1I51 B;  2F3J A;  4C11 B;  1P27 B;  2KT5 A;  4DZ6 A;  4ED6 A;  3EGW B;  2XZT B;  4HT7 A;  5E33 A;  3BZQ A;  1MW7 A;  3DOM A;  1M0S A;  2OH2 A;  2B6A B;  5IWA J;  4X2B A;  1WTB A;  1Y4Z B;  2G0I A;  2MQ8 A;  3R5B A;  4RW6 A;  4QYZ K;  4N8N A;  2A0F B;  3A12 A;  4BWM A;  3J81 j;  4LFC F;  1U1P A;  2ZBP A;  2CVE A;  2E29 A;  4WPA A;  1N4L A;  3G8S A;  2IMO A;  1D09 B;  1HNX J;  4RNN A;  2HBZ B;  5IS2 A;  4LF7 J;  3N4W A;  3GJQ B;  4BCA A;  2ZKU A;  3LWM A;  1GTE A;  1H0H B;  4NE9 C;  1NSK L;  2EVZ A;  4C0H A;  3QRQ A;  2HS3 A;  3TR5 A;  3VF0 B;  1WI6 A;  4OHZ A;  3EIC A;  2YNH B;  4ECQ A;  1T9T A;  1TK0 A;  2L08 A;  3T1H F;  3R5C A;  3NS5 A;  3DGP B;  1GK8 A;  3MM6 A;  1TU0 B;  2ZBR A;  5ITH A;  1XWL A;  4K4W A;  3TOQ A;  4X4V A;  2A3J A;  2JC1 A;  2VC1 A;  4URG A;  4LQ9 A;  4RPF A;  2DR8 A;  1YKW A;  1SXL A;  3CD5 A;  3CJR A;  3Q8Y A;  2DHH A;  3BBC A;  3IRX A;  3FDS A;  1NO8 A;  2R7O A;  2LDI A;  4AXI A;  1RYS A;  1BLU A;  5GAD I;  3SFU A;  4JI2 F;  4QPX A;  1B99 A;  3OXL A;  3UN3 A;  1PC5 A;  4RJV A;  4ATN A;  2UZA A;  3SDE A;  4OZN A;  2NXE A;  1DUR A;  2V8V A;  2HVZ A;  4H4K C;  4DUZ J;  1UJ6 A;  3ONQ A;  3CJ2 A;  1OQ6 A;  1VFJ A;  3D1H A;  1U26 A;  1KQS R;  1HHS A;  3GG1 A;  1RT5 B;  4FPR A;  5KT4 A;  2UVR A;  4MMO A;  3K89 A;  4WE1 B;  2X1A A;  2ZOM A;  3T3F A;  2R4F A;  2AWZ A;  3OR1 B;  5E0O A;  1RT6 B;  2LQ9 A;  1K0T A;  1HMV A;  4C6A A;  1R31 A;  1QSY A;  2R7R A;  1XN9 A;  3AB2 B;  4B17 A;  2HHH F;  1F5A A;  1BWE A;  2DGT A;  5IOL A;  2BAC A;  2NUH A;  1Q16 B;  3FEX B;  1REV A;  1Q8L A;  7AT1 B;  4KO0 B;  3PW2 A;  4AYB D;  2IYI A;  4KE5 A;  2RT3 A;  4KHR A;  3P3D A;  1FEH A;  2LXI A;  4DS4 A;  2RRA A;  2EG2 A;  4FYX B;  1ZTW A;  3FK4 A;  3KLG B;  2PMW A;  3UE2 A;  4IOB A;  4OYM A;  5CYQ B;  4FPI A;  1SKW A;  4JI4 F;  1BGX T;  2HQD A;  4JI0 F;  3FCW A;  1KEK A;  1VRU A;  3IP0 A;  1S77 D;  2CG4 A;  1R7I A;  3ZTS A;  2IRX A;  3PYG A;  2OJ3 A;  3SV4 A;  1FKO B;  1YGY A;  2HGL A;  1RAA B;  4PWU A;  4USI A;  1BQN B;  1W2B R;  1Z4U A;  4B9N A;  3VTI A;  4OI3 A;  3MWB A;  4LUB A;  3SSR A;  4DN9 A;  1ZM2 A;  3JSM A;  1HNV A;  1H2T Z;  4Q5V A;  2MQP A;  3BH6 B;  1D0E A;  2GO8 A;  1YQH A;  2VQF F;  2HHX A;  2XNR A;  4X65 J;  1PKU A;  4QOT A;  2VG5 B;  5KFU A;  4USW A;  1WHV A;  4GKJ J;  4OHY A;  1RI7 A;  1JXV A;  4ZPW R;  1TFW A;  1S79 A;  1HA1 A;  3PO4 A;  3H20 A;  4J9Q A;  3ISN C;  3BDE A;  5A8K B;  2ZE2 B;  2OIH A;  4UST A;  5LL6 d;  1KOO A;  4DR2 J;  3R97 A;  1B64 A;  1MN9 A;  3KOA A;  1YJN S;  3M8R A;  3QNW B;  3W60 A;  3KLH B;  1NK0 A;  3ADA C;  4DSJ A;  3ETO A;  1WG1 A;  3CCW A;  3EVM A;  2V8H A;  1PO6 A;  2UXD F;  1H73 A;  4IR9 A;  3DLJ A;  4I6Y A;  5DQH A;  2FVS A;  3C14 B;  1OO0 B;  4B3T F;  4ZP9 A;  3TW0 A;  3IWN C;  1GXU A;  4QWA A;  2O3D A;  2G2Z A;  1VGY A;  3HVW A;  2L3M A;  3TP2 A;  1ELO A;  2E5G A;  3UR0 A;  5IT0 A;  2XLJ A;  2NQP A;  2RAQ A;  1RWP B;  3HO1 A;  2ALZ A;  3L7U A;  4LF5 J;  1H3D A;  2JHE A;  1XIQ A;  3HVT A;  1Q86 T;  3NAI A;  3UVJ B;  1RT3 A;  3AXK A;  1NEE A;  4WU3 A;  4F4K A;  3HHD A;  2Z2M A;  1U7L A;  2HQ3 A;  3VR1 A;  1QJH A;  1SQE A;  2R7X A;  2XG8 A;  5F8N A;  1Y5N B;  4F2S A;  3T41 A;  3R1H A;  3M8P A;  1VS3 A;  3QMQ A;  4P7V A;  4DFK A;  2XEX A;  5BJR A;  1SCJ B;  2CPJ A;  3LP0 B;  2JEG A;  3O5T B;  3RAM A;  2YWW A;  5HMX A;  3UO0 A;  4GVB B;  4LRE A;  1SJR A;  1WC6 A;  4Y2M A;  3GJR B;  1WUU A;  4DX5 A;  2PI5 A;  3IR7 B;  1C4A A;  2OTJ S;  3W2V A;  3GPA A;  3T5K A;  3QO9 A;  1ZAW A;  2LA4 A;  2RRB A;  2OFG X;  1RHQ B;  3CPW R;  2B7C B;  1YHQ S;  2FHK A;  3C6T A;  4A8Y A;  3FRZ A;  5I4M A;  3MM5 B;  3OXG A;  5AJ3 J;  3VZH A;  1VRT A;  3BKF A;  2UV8 A;  4NXM J;  3TI0 A;  4QR2 A;  1C0U A;  4JV5 F;  3T1A A;  3T9Z A;  3IG1 B;  2WK4 A;  1RAB B;  3G82 B;  3CC7 S;  3UCU P;  4CM2 A;  1TKT A;  4LFA F;  3MD3 A;  2JOQ A;  1F9F A;  3FMB A;  3IBW A;  4O3P A;  3BQ2 A;  5AXM A;  2D69 A;  1XTZ A;  4NCG B;  2ZJR Q;  1VOM A;  1N6Q B;  3DFE A;  4I2P B;  3MMA A;  4X66 J;  1VHF A;  2GFF A;  1EKS A;  3GIR A;  2QO3 A;  1KSP A;  1EIY B;  5DDR C;  4PUO A;  2HHW A;  4OYP A;  2KI2 A;  2Q66 A;  3OL6 A;  2FZC B;  4I6W A;  1JX4 A;  2F4V F;  1WHW A;  2OFH X;  4ID5 A;  4N47 A;  1A6L A;  3ZTO A;  1O5J A;  1J2V A;  4K4V A;  2VDH A;  4O3O A;  2W2M P;  3GV8 B;  3GCW P;  4DPW A;  4MJK A;  4EO6 A;  2YKO A;  3LAK A;  3PY8 A;  4ICL A;  1TMJ A;  3N6M A;  4MFB A;  1DHM A;  3FBE A;  4IG0 A;  2KTQ A;  2WOM A;  4I1T A;  5LXR A;  2PD1 A;  3TEG A;  3HUL A;  1WEY A;  7FDR A;  1CS4 B;  2JRS A;  1M5K C;  4K5S A;  1OS5 A;  2B8P A;  5EHH A;  1HNI A;  5CZX A;  5BYQ A;  3LP2 B;  2D7S A;  2A2D A;  4P10 A;  1ZPW X;  2G0J A;  3C6U B;  3AQP A;  3ZTP A;  3O8W A;  4YB5 A;  1QUV A;  2KL8 A;  3D54 A;  3PW0 A;  4LMZ A;  1U1R A;  3IM8 A;  3QGP A;  2KG1 A;  4DV6 J;  1H38 A;  4IOC Q;  3GIJ A;  2FLO A;  3IMQ J;  3UR3 C;  2PA3 A;  2LYV A;  3CMQ A;  4MTP A;  4Q2M A;  5KG4 A;  2UU9 J;  3JAM Y;  1X5S A;  2ZH6 A;  3SCJ E;  4W98 A;  3LAN A;  1RLC L;  2CPD A;  1OY9 A;  3S7R A;  4LF9 F;  2HFN A;  5J2P B;  1KP6 A;  4RR5 A;  2DNM A;  1S1X A;  2N82 B;  1ICE B;  4ZPB A;  2CPX A;  4CO2 A;  4F02 A;  5EUH A;  4CDI A;  2DH9 A;  4OLO A;  4A8W A;  3J7Z T;  2MZ1 A;  1N52 B;  3OTC A;  5H9F K;  5LM7 E;  4ZVE A;  4TU7 A;  2V9W A;  4I64 A;  4CLZ A;  1HIY A;  2L48 A;  2VFR A;  2KVQ E;  4ZCK A;  1K8A T;  4RNM A;  4OMF G;  1HWI A;  2BW7 A;  4DLG A;  3KK1 A;  3LAM A;  2VJV A;  3ILI A;  3J7Y I;  4QW8 A;  3ZZY A;  3NGT A;  5E3P A;  4ECX A;  3JAM U;  1NPR A;  2QRR A;  2H48 B;  4E98 A;  1ACM B;  4DR5 F;  2DNZ A;  2YWH A;  1UVJ A;  3D3C J;  3N5B A;  1VCT A;  4P73 A;  4EGL A;  1N56 A;  2KB2 A;  2E5L J;  1Y00 A;  1NH7 A;  1WF2 A;  5CAB A;  2ZBC A;  3BPD A;  1S0O A;  4IFY A;  2HHS A;  3R7S B;  2WVF A;  3M1V A;  3MUT P;  2ZHA A;  1WSR A;  4ZVP B;  2DRD A;  1RBL A;  3MEE A;  4ZKA A;  3HSJ A;  4G1I A;  4PQA A;  4CLS A;  1YJT A;  4LRC A;  1QSS A;  3FBF A;  2MQQ A;  3LP1 A;  4HHJ A;  1N5S A;  2J0W A;  4JI6 J;  3EDR B;  2QA4 G;  1TTH B;  2OGU A;  3DNC A;  3M9N B;  2VOP A;  1XK8 A;  4UOC A;  2XMU A;  4QWE A;  2LCW A;  4ZIW A;  2EG1 A;  2XS5 A;  1T03 B;  1JLG A;  1NHK L;  1Z1Z A;  1JLE A;  4HLB A;  1FRL A;  4HAC B;  3US5 A;  4BLG A;  2AGQ A;  2HHU A;  3D6T B;  1S1U B;  3VGU A;  3IM9 A;  1K0V A;  2YQ0 A;  3C15 B;  3EMT A;  4CRJ A;  1HL6 A;  2NZC A;  3BN4 A;  2W9A A;  3FVY A;  3DU5 A;  1RAI B;  1JMT A;  3CJK A;  2L9D A;  3H2V E;  4KJI A;  2ILY A;  3NLC A;  2CNK B;  3QAT A;  5K8M A;  2HAI A;  3BO3 A;  1RTH B;  1V5V A;  3AJ2 A;  1N54 B;  2VKR A;  2HMI A;  3MUV P;  3SQO P;  3RGI A;  1JLA B;  1LWE B;  2VPZ B;  4L76 A;  2ACM A;  4U96 A;  2MKC A;  3ILL A;  5IC4 B;  2DNO A;  1NJY A;  3MM7 A;  2Y1L B;  4U95 A;  1FKP A;  4DPY A;  3HKZ D;  3ZZR A;  1IR2 A;  1V3Z A;  3I0S A;  2GC8 A;  1H7W A;  1HPZ B;  4XDC A;  4PG8 A;  2A18 A;  3BKU A;  2E1R A;  2XMW A;  1S1V A;  1TEL A;  3N0V A;  4ZP6 A;  3V81 B;  3I96 A;  4H4O B;  1FJG J;  3R3T A;  1P1L A;  2D74 B;  2EPI A;  1RGV A;  1HR0 J;  7FD1 A;  2B56 A;  4D3G A;  1QTM A;  2MLY A;  2H51 B;  5DJB A;  4DN0 A;  3NL0 A;  3AH6 A;  1RKI A;  3RAX A;  3GB0 A;  1UWB B;  1SKU B;  5CD4 H;  2G4B A;  4OFZ A;  3N79 A;  2B4V A;  2DNQ A;  2V2Q A;  2Z8Q A;  3THT A;  4IFV A;  4DQR A;  3Q86 A;  2DR9 A;  1PBU A;  2IA6 A;  1F5C A;  2ZUG A;  3MAA B;  3SMZ A;  4Z7C A;  2ZEJ A;  2KYZ A;  1HKA A;  1DAX A;  3QID A;  2CJB A;  2MKK A;  1S59 A;  4AL7 A;  4IH6 A;  2FJA B;  1VC6 A;  2ZOF A;  1S6U A;  1NUE A;  4B3S J;  3V6D A;  2N4C A;  2ZH9 A;  3QLH B;  3DXB A;  4ZDN A;  1S1W A;  4DR1 J;  4PQU A;  3RR8 A;  4RU9 A;  2HVI A;  3KFW X;  3GFX A;  1IBL J;  4GKK J;  3IXQ A;  3AD9 C;  3H8Y A;  3OSN A;  4DBQ A;  1FX4 A;  1G4C A;  4FVC A;  2HBR B;  2DIV A;  4UOF A;  3NEK A;  4DL4 A;  5MLC V;  4XK8 C;  2KXN B;  4OJG A;  4PYD A;  1TKZ B;  5IM0 B;  1PYO B;  4QIE A;  1HNW J;  1YIT S;  3JB9 k;  1UAW A;  3DLK B;  1TKX A;  3VV2 B;  2ZC3 A;  1KLM A;  1ARO P;  3H5X A;  1ZAV A;  4RW6 B;  1T95 A;  4DFM A;  1HD0 A;  4F0K A;  5KFE A;  1JXE A;  1Y0H A;  1UKU A;  5LJ3 Y;  4P74 A;  2FVQ A;  5RUB A;  2D1C A;  1P1T A;  1ZH5 A;  2BBE A;  1R8A A;  1GH8 A;  1HAR A;  3OL7 A;  4CO5 A;  5KFR A;  1SJF A;  4NRU A;  1SI9 A;  4ZK7 M;  4XTT A;  1SBR A;  3WC0 A;  2LEB A;  1SH3 A;  5BR8 F;  4OJ3 A;  4G1Q A;  1CC8 A;  4HHH A;  4DV4 F;  3HX9 A;  3VGT A;  1IWA A;  3LF0 A;  3O2I A;  1AFI A;  4O4G B;  1JXL A;  3SI8 A;  1S7H A;  4F2R A;  2H3E B;  3PIO Q;  3L09 A;  4WIQ A;  3HVR A;  3G2X A;  2DGQ A;  3CF5 Q;  4QJV A;  3E3X A;  2C2Z B;  2CQ1 A;  4CP5 A;  5D0H A;  3CT9 A;  3I4H X;  2EC2 A;  2Q3P A;  3VAM A;  4YUD A;  2H5J B;  4NXN J;  2WB1 D;  3GR1 A;  3I32 A;  4NCA A;  3KMQ A;  1TL7 A;  1X5T A;  2D9O A;  4CH1 A;  4USH A;  4NOH A;  3ENA A;  3MR3 A;  1Q5Y A;  2YNF B;  4RUA A;  5IFM A;  2PSZ A;  1UPP A;  3AQO A;  1RA7 A;  2IM3 A;  1M5V C;  3G6V A;  4DL7 A;  3TAR A;  1U49 A;  2YH1 A;  1SJQ A;  2RHS B;  2JZ5 A;  3PZP A;  1KRP A;  4DCP B;  1R3N A;  2CUY A;  1NND A;  3D4J A;  1FES A;  1N34 F;  2QA4 S;  5IZH A;  2F65 A;  1NU4 A;  3TVZ A;  2XB2 D;  2ZDO A;  1WOR A;  2ACY A;  2HGM A;  3RB0 A;  1OIA A;  1K44 A;  2ZKT A;  3PKY A;  5M2R A;  2RDI A;  5DM6 Q;  3CE8 A;  4Y2C A;  1RU2 A;  5D0G A;  4B9T A;  1HQU A;  2ABY A;  3N01 A;  5DRK A;  4N7T A;  1UW4 A;  1R8H A;  3TUP A;  1RZM A;  4HR2 A;  4DFJ A;  1DQ8 A;  1RAF B;  4X64 J;  1ZM3 A;  2BE2 A;  4DSL A;  2C2M B;  1VC0 A;  3RUB L;  5GVQ A;  1MML A;  5ADZ A;  2JLF A;  5F41 A;  4U7U K;  1PIL A;  4ZJQ A;  2Q79 A;  3TA2 A;  2ZH8 A;  4GMK A;  1VQP S;  3UDE A;  4UOG A;  5KG5 A;  4ILL A;  2IHR 1;  5AXL A;  2J9D A;  1MLA A;  2JH3 A;  1A7G E;  4YDD B;  2EC0 A;  3RZA A;  1RAO A;  2OPR B;  5IC6 B;  3PX6 A;  2BAN B;  4FKX A;  3MCN A;  3NGD A;  1CJV B;  2V4R A;  1H6K X;  1SC1 B;  4YR0 A;  5J1E B;  4CYU A;  1TQL A;  2LEC A;  4FKY A;  1SH0 A;  5DG8 A;  4OI2 A;  2V8D A;  3F73 A;  1ZYQ A;  4OV1 A;  2I6W A;  3IR6 B;  3GFY A;  2YX4 A;  3A8I A;  3NGR A;  4DFP A;  5ETO A;  2LDY A;  2HEK A;  2AF6 A;  4ECV A;  3FEY B;  4D3H A;  2NSC A;  3EVO A;  4OV6 A;  4JI2 J;  2BJ3 A;  4F25 A;  1C1B A;  2N3L A;  2C2D A;  5CD4 A;  3ZFV A;  2VIH A;  3E51 A;  1N0U A;  1F60 B;  3A8J A;  2K8G A;  2AEF A;  3L9Z A;  2QIF A;  5J2M B;  1UET A;  1DQ9 A;  2LVW A;  2WW8 A;  2HUR A;  3L95 X;  4BC7 A;  3ITH B;  3DMJ B;  1C4C A;  2F5G A;  3C16 A;  4NLY A;  2DTJ A;  2RS2 A;  5HRO A;  1KQK A;  1RT3 B;  3EUN A;  4DCO B;  1WKL A;  1NK4 A;  4RBU A;  2AJF E;  4UOH A;  3GLJ A;  5K8N A;  1HQ2 A;  3FCV A;  4DSE A;  2VIC A;  5B0C A;  3M8P B;  1U45 A;  4LF7 F;  1D9A A;  3I5A A;  4ZVU B;  1QTN B;  1RWK B;  2W9B B;  2YX1 A;  2DJW A;  2B0G A;  2Y0S D;  4PXB A;  3ET6 B;  3M6W A;  1HBN B;  4RLE A;  1R89 A;  2JWN A;  5DDO C;  4MIB A;  1CVJ A;  3M2V B;  3W2V B;  1MU2 A;  1A0O B;  1FTR A;  4ER8 A;  1JKH A;  2HZC A;  1RTI B;  2FDN A;  3P96 A;  4HDH A;  2LFV A;  5C25 A;  4JI0 J;  3AFG A;  1CPZ A;  3C6T B;  4NI2 B;  4F4W A;  3M8W A;  1YJV A;  1TR0 A;  4C3L A;  3A3P B;  1VQM S;  1VRT B;  1XMB A;  1A9N B;  4RBT A;  1MWQ A;  3DRS A;  2OUG A;  1U0S A;  2GW8 A;  1L3V A;  2YWF A;  2NR0 A;  3MAH A;  3QRR A;  1QAX A;  2V4J A;  3AOC A;  2XGQ A;  3M2R A;  2DGO A;  4F26 A;  2YNG B;  4M8L A;  3I9Z A;  2CJA A;  3LOU A;  3CDB A;  2W25 A;  4L74 A;  3ULH A;  3ZZZ A;  1EQM A;  2ZC4 A;  2YPZ A;  4PKD B;  3MMA B;  4DUZ F;  1P9Q C;  5C42 A;  3CO0 P;  1LW0 B;  1FD2 A;  3HD1 A;  3SBM A;  2DNN A;  4PUO B;  4MKB A;  5T7L A;  2HND B;  2Z0G A;  3IO1 A;  4FXV A;  2NSB A;  4M5D B;  1IKV B;  2VPY B;  4ID5 B;  3QWP A;  2ZHO A;  3PVX A;  2Z57 B;  5HI7 A;  2XTJ P;  1OSC A;  5KFL A;  3VZI A;  3MXH P;  2MQL A;  5AXN A;  4PWW A;  1F1B B;  2I0X A;  3ILO A;  1TP7 A;  2BXJ A;  5FII A;  1RKJ A;  3SQG A;  4TXS A;  1VMB A;  1QAJ A;  4NL5 A;  2HQF A;  1C1C A;  3TAQ A;  4WFX A;  3OD2 A;  3OTO J;  1WDD A;  1RT1 A;  4ICL B;  2RQK A;  4QWC A;  3GV5 B;  2VB6 A;  1FA0 A;  2A6M A;  3L7P A;  2DPI A;  1JJ4 A;  3EZU A;  4IG0 B;  5L8R C;  4CT8 A;  3BQ1 A;  4AFF A;  2HLT A;  2VBX A;  2C2K B;  1SV5 B;  2RIJ A;  4DV3 J;  1LWC A;  3RBX A;  1FXR A;  4TLQ A;  2BEF A;  1FDB A;  3E2E A;  4Q45 A;  1FVS A;  4M5G A;  2OP5 A;  4C11 A;  1RK8 A;  2BJD A;  3ZZ0 A;  2MEW A;  2AX0 A;  4KB7 A;  2XLK A;  2OI2 A;  2CPZ A;  4OX8 A;  2P6S A;  4OYI A;  5ETR A;  2Y8W A;  4L75 A;  2AX1 A;  1Q95 G;  3K5P A;  1YJW S;  4KHM A;  1WHX A;  4PXE A;  2IMW P;  3DRP A;  1KBR A;  3ZZT A;  3M32 A;  5FLX Y;  1U6B A;  2CA9 A;  2KG0 A;  2EEY A;  2H4Y B;  2QLF B;  3UNG C;  1NSP A;  5KFG A;  4B08 A;  2FGO A;  5HMY A;  1M5S A;  4DR6 F;  1K1S A;  2Z56 B;  2XMV A;  2ZJP Q;  2RUS A;  1S7I A;  2W1B A;  4GKJ F;  1HYS B;  2ASD A;  5C24 A;  3NNA A;  5ETK A;  4Z7Y A;  2FJV A;  4ITS A;  4CLU A;  3GIK A;  3FZ2 A;  2W7A A;  3QJL A;  2P5V A;  5DG9 A;  2YNH A;  2M3D A;  2GQQ A;  4JOU A;  4Q0B B;  3T9N A;  3KHG A;  2X7I A;  4DR2 F;  3HHK A;  1JWW A;  3AOD A;  2DGW A;  5C2C A;  4FYW B;  1YG0 A;  2DIS A;  1M90 T;  1VC5 A;  4CT9 A;  3CDE A;  5D4L A;  2B9Y A;  4GO7 X;  3IFE A;  5G4D A;  3TAP A;  4IH5 A;  2YY3 A;  5GAH I;  3D5M A;  3BYR A;  4BBY A;  3PTW A;  3DU6 A;  2P9E A;  1XBW A;  2CQC A;  2VH7 A;  2MST A;  1MWY A;  1E6V A;  1FNO A;  2RQC A;  4P2M A;  1EET B;  1HBU B;  4FVM A;  4DG1 A;  3V4M A;  4YME A;  5KFT A;  3H59 A;  3FEZ A;  3HT3 A;  1M1H A;  1NK6 A;  1T94 A;  1RT5 A;  3PW5 A;  2RKI B;  1PGZ A;  3MEE B;  1KQG B;  2NCK L;  2ROE A;  2QMW A;  4OZL A;  3E8O A;  3LP1 B;  3OR1 A;  2YPY A;  5K8O A;  2VOD A;  2YQ1 A;  1NDK A;  2PA8 D;  3W5Z A;  5D6G A;  3PEH A;  3GQC A;  2PI4 A;  2PO4 A;  3TAM A;  3BN7 A;  3CJ0 A;  2HVE A;  4KBI A;  3I4P A;  2F8H A;  4WFZ A;  4PR6 A;  1JLG B;  4QIV A;  1AZS A;  3S01 A;  2R7U A;  3DHW C;  3BKT A;  1Y3K A;  5LSR A;  2HFO A;  3UD5 A;  2DCL A;  4BHQ A;  5B08 A;  4PXD A;  1TUV A;  3KLG A;  2IYG A;  2M8H A;  2PGC A;  3Q8U A;  1ROF A;  1WAC A;  1IBM J;  5CYQ A;  2AKW B;  2QL5 B;  2FLP A;  4AND A;  2HGN A;  4DV5 F;  2HS0 A;  4B3M F;  1T9W A;  4KHP F;  2QYG A;  3GII A;  4FNI A;  1HD1 A;  2YX7 A;  1NK8 A;  2OD4 A;  1WI8 A;  2ZOG A;  2W4D A;  2HMI B;  4DJB A;  4QQB A;  1FKO A;  5KFV A;  1CQM A;  1BQN A;  2ZVS A;  2GMJ A;  3JSY A;  3GIL A;  1L3K A;  2M52 A;  4ANE A;  2FVP A;  2W4P A;  1VK8 A;  1P8G A;  3MM7 B;  3CCL S;  5LXY A;  4Y3C A;  2QLW A;  4ES2 A;  2EFP A;  4JV2 A;  5A8W B;  5D4P A;  2KH9 A;  3K17 A;  5E7O B;  2PMZ D;  5A8K A;  1U8W A;  2ZE2 A;  5FDL A;  1O51 A;  2E7V A;  4DLE A;  1S1V B;  3LAL A;  3NGU A;  5IQQ A;  4EBD A;  3JQK A;  4MKV A;  5IT9 Y;  3KHL A;  1RAC B;  3TUZ C;  3KLH A;  4AUK A;  3BS9 A;  3K0J A;  4QR0 A;  1MMD A;  3G87 A;  2UUA J;  3CSK A;  1RTJ A;  2BE9 B;  5EWG A;  5J1P A;  3ISZ A;  4OZ1 A;  2FYX A;  3HD2 A;  4DQQ A;  5D0E A;  4IFV B;  3C14 A;  3BR8 A;  3ENW A;  2GIR A;  3DRR A;  3LGM A;  5F9N A;  1R27 B;  2FJE B;  4Y0F A;  4DUY J;  4OYX A;  1DRZ A;  4QU6 A;  4IG3 B;  4DV6 F;  3EX7 B;  1T05 B;  5L38 A;  4BWJ A;  3UCZ P;  3V6D B;  4C48 A;  2QZ8 A;  5K9F A;  3NGK A;  2UU9 F;  4PQU B;  1TKD A;  3O3L A;  3UVJ A;  4IDK A;  2B4P A;  2IY5 B;  2MKS A;  1U8S A;  5DQI A;  3WC2 A;  2CDR B;  4YB1 P;  4FYV B;  2EW9 A;  3GCX P;  3HT0 A;  2YKM A;  2B9X A;  2ATL A;  2FJW A;  3OT9 A;  3LP0 A;  2GQ2 A;  2OEK A;  2C2N A;  1KLM B;  5KAK A;  2XO7 A;  3TZZ A;  2QA1 A;  4GVB A;  4YEA A;  3CCT A;  1YDL A;  2HRU A;  3MGJ A;  1U1L A;  1LEO A;  1SIZ A;  5LSO A;  2VG7 B;  1OYE A;  2AJ1 A;  3KG1 A;  4X4Q A;  3A3N B;  2CQ2 A;  3NY0 A;  2XLI A;  2MLZ A;  1YBT A;  1H74 A;  2XS2 A;  2LKZ A;  3MM5 A;  3VVU A;  2HKE A;  3QT8 A;  3TUJ C;  4IRD A;  3DDI A;  4KGX B;  4G1Q B;  3PXG a;  4J9O A;  3FGV A;  3V5R A;  3MPD A;  3IG1 A;  5GMK a;  2AGP A;  3G82 A;  1I94 J;  4KGK A;  3MHY A;  3AD7 C;  4NPO A;  3J7A 1;  3P49 B;  2J7W A;  2WW4 A;  4ID8 A;  2U2F A;  1WG4 A;  1IR0 A;  2B4U A;  2MHE A;  1JK9 B;  3HMJ G;  2GZO A;  1KDN A;  2ZUA A;  2E5L F;  3N28 A;  4NCG A;  3TA1 A;  1SC3 B;  3MM9 B;  4F67 A;  3K2Y A;  3IWX A;  1N6Q A;  4J9R A;  2HNY B;  1YX2 A;  4RZR A;  2R2S A;  4DXL A;  4Y2I A;  1FNM A;  2HWH A;  5HQL A;  3CNQ P;  1HBO B;  4KKO B;  3QFH A;  2ZZM A;  2AZ1 A;  3Q83 A;  5KG6 A;  2E1C A;  1W26 A;  1Y5L B;  2A2C A;  1T7P A;  5DQG A;  2HQG A;  4JI6 F;  5I3P A;  3T5L A;  2YKQ A;  3IN5 A;  1SUQ A;  5KOW A;  3C2P A;  1N8R T;  5HBM B;  1ZA1 B;  5CA5 A;  1Q8I A;  1WKJ A;  4H4M A;  2O66 A;  1HBM B;  1XMQ F;  1FWP A;  2HS4 A;  1X9W A;  2IDE A;  2XCA A;  3FQL A;  1CS4 A;  5I42 B;  4QIG A;  3OPK A;  1VK3 A;  2BJ1 A;  4PG6 A;  3ZTR A;  4B9L A;  1UVK A;  2FVR A;  1YJ9 S;  4ZVF A;  3C6U A;  2HSE B;  2V9K A;  4TLR A;  4RW8 B;  2FUG 9;  1B0V A;  5F8M A;  5A0Y B;  3CW2 C;  3H90 A;  5CZV A;  2R7V A;  1HQU B;  1RWW B;  2J8S A;  5J2P A;  1QE1 B;  2E5H A;  2SXL A;  4DV2 J;  2GHP A;  2YKP A;  2W01 A;  4PWD B;  2MSS A;  2AV5 A;  3FJ2 A;  1T9V A;  1U6F A;  4C2M A;  4M5K A;  1PYT A;  2FD2 A;  1XEZ A;  4U9R A;  4HT5 A;  4EBC A;  1RWU A;  3AA9 A;  4OYZ A;  2J7K A;  2V4Q A;  1TZ0 A;  2Y3Y A;  1U48 A;  3PRD A;  2EFQ A;  1KTV A;  1FJG F;  1U24 A;  4EMD A;  1HR0 F;  3OFH A;  1S48 A;  5HP1 B;  1KNZ A;  3OUY B;  1EP4 B;  5A76 A;  2HG4 A;  3DLE B;  1PCA A;  3CJ5 A;  3P5B P;  1JLF B;  4ILM A;  2KKH A;  4NZ6 A;  4J9U E;  1JLQ B;  4CYU B;  1J5E J;  3P8B B;  2WBM A;  1SL2 A;  4XO0 A;  4R5P B;  4KAI A;  2L9N A;  1RQ0 A;  3TAN A;  3EXC X;  4ZVR B;  2LP4 A;  1FRM A;  4P52 A;  5ETV A;  2UXC J;  2H65 B;  4J9M A;  4B3S F;  4UY8 T;  5HVH A;  1SPB P;  2WON A;  4DV0 F;  3NXZ A;  2FTR A;  2M70 A;  2YBV A;  4DQS A;  3D9B A;  1IBL F;  4GKK F;  3EGV A;  2DBB A;  1RBA A;  3SCI E;  1V9O A;  3G86 A;  3NCR A;  2F4F A;  4RU2 A;  2EK1 A;  1RAH B;  2ZH4 A;  1IKY A;  4O3S A;  4A8F A;  4UQG A;  1AFJ A;  4DV1 J;  2KXF A;  2EI5 A;  3VQT A;  1UL3 A;  2PMH A;  4LJM A;  3CMA S;  1IXK A;  2ZDP A;  4MYU A;  1T03 A;  3C16 B;  2YH0 A;  3ETM A;  3B4D A;  5HRO B;  2UUC J;  2CFX A;  4HAC A;  2RS8 A;  2W2O P;  2GVZ A;  1QAI A;  3C15 A;  4C7Q A;  1S6P B;  2PN6 A;  4X84 A;  1GX6 A;  3CIM A;  3BO4 A;  3HKW A;  2D3Z A;  1CG2 A;  2GGP B;  2Z30 B;  1UFL A;  2B9W A;  4DX6 A;  4V19 X;  4KPY A;  2RNE A;  1QAY A;  5HMW A;  2K7J A;  1RTH A;  1NSA A;  3J81 Y;  1WC4 A;  1OPZ A;  2XSJ A;  1UZD A;  2CRL A;  2KRB A;  2JLE A;  1JLA A;  1LWE A;  1LXJ A;  1HW9 A;  3DOL A;  1UP1 A;  2R8K A;  2HFU A;  4KIA A;  3X1L B;  2JJ4 D;  3KK3 A;  4C8Z A;  2J9D E;  2HNZ A;  3PV8 A;  4TVA B;  4NZ7 A;  2HK2 A;  1FX2 A;  8ATC B;  1HPZ A;  1B7Y B;  4NXN F;  4C0B A;  2VDI A;  3PX4 A;  2EK6 A;  2ZBQ A;  2EXU A;  2KZZ A;  5F3T A;  3CUN A;  1FVQ A;  3BV8 A;  4H4O A;  3SXL A;  2BR0 A;  3NBP B;  3KUE A;  4ED8 A;  3GIM A;  3RB3 A;  5C42 B;  4CLT A;  4UZB A;  5BYS A;  4ZVH A;  4RW7 B;  1NBE B;  2M5Y A;  4DSI A;  1AUS L;  3NCP A;  4ECW A;  2YKN A;  2MGZ B;  1P9Y A;  5DS7 A;  3ZZP A;  2OAU A;  2UV8 G;  5KT3 A;  3MAA A;  1RDR A;  3SQG B;  5KFW A;  1MRO A;  2YKA A;  1C1C B;  1OY8 A;  3OQ2 A;  2IJR A;  4DL3 A;  5CQG A;  4C0O C;  2DPJ A;  1FXD A;  3IBF B;  3KNA A;  4KR0 B;  1NSQ A;  1BE4 A;  4XPE A;  3M6X A;  3FUY A;  1FRI A;  4NX9 A;  1HI8 A;  1S1T B;  5HLF A;  3QLH A;  4UY8 5;  4G1P A;  1RAD B;  5AE2 A;  1EAR A;  1Y3J A;  2FHO B;  5HAN A;  2B43 A;  2BKN A;  3ENV A;  1JLC B;  2XC9 A;  4JI5 J;  2PFD A;  3HSZ A;  2P9C A;  3DLH A;  4USU A;  1KOH A;  2AYM A;  4YP3 A;  2Y1R I;  1WKK A;  4X64 F;  2Q6C A;  1TKZ A;  3DYA B;  5IM0 A;  1QUP A;  3HHL B;  3DLK A;  3DRP B;  1NZ8 A;  3HDS A;  2QC3 A;  1KWM A;  3T5H A;  3M32 B;  1XR7 A;  2Q43 A;  5IT4 A;  1URN A;  5B0E A;  2JEJ A;  2JC0 A;  3WZ0 A;  2XY7 A;  4YS2 A;  2VD3 A;  1UVI A;  1VQS A;  4NYO A;  2FQQ B;  2FC8 A;  1X4F A;  6FDR A;  1NDC A;  4A8O A;  3P45 B;  3EJM A;  2UUB F;  1MG7 A;  2HIQ A;  4CLP A;  1VHI A;  5J2Q B;  3QIP B;  2AW0 A;  4ED2 A;  4IRC A;  3BJY A;  3RR7 A;  1FI4 A;  5C24 B;  4IUF A;  4J7C A;  2V34 A;  4QWD A;  4RW4 B;  4NLD A;  3MMC A;  2AQ4 A;  1K47 A;  1IBK J;  1TV6 B;  4O4G A;  4B9M A;  2ZNZ A;  2HFV A;  3MM8 B;  1LWF B;  6FD1 A;  5D15 A;  4RWX A;  4QIF A;  4OHX A;  1BD6 A;  4C8N A;  3R6L B;  3RTV A;  2XM3 A;  3KLI B;  1PG5 B;  1AXQ A;  1X8D A;  3GFZ A;  3BBB A;  5DO2 A;  1U1M A;  2I5J B;  1JQG A;  4N8O A;  4ZP7 A;  2OEJ A;  1CBK A;  5DLG A;  4NAS A;  3U02 A;  4DCJ B;  3UDC A;  1U1N A;  4CH0 S;  5EWF A;  1S72 S;  4E0D A;  3U27 A;  4LF2 A;  1E6V B;  2V6A A;  1RHR B;  2YNF A;  2UVV A;  3MR7 A;  3BO2 A;  4DG1 B;  4QWB A;  4CLF A;  3GTY X;  4DX7 A;  4WP8 A;  3MPY A;  5LT5 A;  3O44 A;  1HNZ J;  5KT5 A;  2UP1 A;  2F9D A;  3M9O B;  3TZX A;  1KFS A;  5B0F A;  4BC9 A;  3QT6 A;  3ICL A;  1MWZ A;  3JTP A;  1EAY C;  2AHO B;  3G8T A;  3R7B B;  3MTJ A;  2ZM6 F;  1WOS A;  4OYW A;  2UUW A;  3EVW A;  4AT1 B;  1HQE B;  3POT A;  4WFN Q;  1S49 A;  2LXU A;  3K7R A;  1VBX A;  3QFW A;  2WRM A;  1WD6 A;  2HBY B;  3TAM B;  4EO8 A;  5HSP A;  2BJE A;  3D6M B;  1SKS A;  1XC9 A;  3TX0 A;  2R7T A;  5HMZ A;  1AT1 B;  4CH7 A;  4K2X A;  3CO9 A;  2MQM A;  2IM0 A;  2CNO B;  1AZS B;  4LF1 A;  3VAK A;  3F0N A;  3W5Y A;  2CZ4 A;  2GVD B;  3RJM B;  1D3W A;  4U67 Q;  1J27 A;  1UPM B;  1CEZ A;  1N33 J;  1RJJ A;  4JI1 J;  3OHB A;  1M1G A;  3KG0 A;  2PC6 A;  3VQS A;  3K5N A;  2WAQ D;  2IDL A;  2ZHB A;  4RUC A;  3VAI A;  1LQ9 A;  1FXL A;  2DVI A;  1EB0 A;  3SCL E;  1M5O C;  3DC2 A;  4ZLJ A;  1VR6 A;  4NLO A;  2BRK A;  5J2N B;  2ROG A;  4KGM A;  4ENO A;  2DXE A;  2LEP A;  5HVG A;  2HYI B;  4Q8F A;  2AP6 A;  4B3O A;  4ZVT B;  5SZT A;  2JSX A;  4ZPA A;  3QSI A;  5KFX A;  3A4T A;  2OEL A;  2E9T A;  4DR6 J;  1DQA A;  4K4T A;  1ZS6 A;  3KXD A;  3PIP Q;  3C3L A;  4DQI A;  3KJV B;  3SSS A;  3H2U B;  3OFE A;  1HW8 A;  1LK5 A;  4K4U A;  1WDT A;  3ZZU A;  1FRK A;  2OPR A;  4USV A;  5FDL B;  2RVJ A;  4X62 J;  2BAN A;  1YJU A;  3DGV A;  1CJV A;  4DL0 C;  5J1E A;  3CDW A;  4WXO A;  2DR7 A;  3UN2 A;  4TU9 A;  3PM9 A;  4P75 A;  2WHO A;  4FXW A;  3OTO F;  3ELH A;  1SC4 B;  1RTJ B;  5B0G A;  4USJ C;  4WYW A;  3Q8S B;  1FKA F;  1YSJ A;  3BF4 A;  1RT7 B;  2BV3 A;  4DV3 F;  3PJ9 A;  3QT5 A;  4AQY J;  3QGG A;  1NHU A;  4I7F B;  4NEZ A;  4ZPC A;  3W7B A;  1IKX B;  2B51 A;  3DRR B;  3BPS P;  3W9H A;  3BSO A;  5GAG I;  2VA3 A;  5G0R A;  3P6Y C;  5J2M A;  4ZPV R;  2XYG B;  2F8E X;  4WZM A;  4DEZ A;  3OW2 R;  2AYG A;  1UFK A;  1E6Y A;  3NAH A;  2PEH A;  4C4W A;  3LPE A;  3ITH A;  3MCM A;  5HK4 A;  3DMJ A;  4P9S A;  2LQ5 A;  2CNN B;  1NKE A;  1S4E A;  4DU8 A;  4X4T A;  1YRU A;  5KG3 A;  4IDK B;  1VQO S;  1XNR F;  2J9E A;  2JFD A;  3K8W A;  3RB6 A;  1XJW B;  2G13 A;  3ZNJ 1;  3FFI B;  4NYP A;  2CWX A;  2AYB A;  5ETP A;  4RBV A;  2XMJ A;  2JVR A;  2YKM B;  2HHT A;  5AXK A;  1DZ5 A;  3TUI C;  2CAD A;  1IUJ A;  4DPO A;  4C8L A;  3M05 A;  3EWG A;  2W9B A;  5JUM A;  3ET6 A;  1HBN A;  3K5M A;  2A6O A;  3LGH A;  3G9C A;  3MFH A;  3M2V A;  3WX8 A;  1WC0 A;  3Q8V A;  1T3O A;  1RHU B;  1RTI A;  2LQB A;  3MEG A;  6AT1 B;  4DV5 J;  3GYX B;  4O0N A;  4A4J A;  4B3M J;  3W9I A;  1W2I A;  4KHP J;  2XY5 A;  1AUD A;  4OX9 J;  2DYA A;  4NI2 A;  4CNY A;  1S12 A;  2QJ3 A;  3OBI A;  1YK9 A;  1R6Y A;  4HDG A;  1DAR A;  2KU7 A;  1QY7 A;  4CTA B;  3BSN A;  3K59 A;  3J7A N;  2BVZ A;  5JXS A;  2CQ4 A;  2GCF A;  4TQS A;  2CQI A;  1OJ4 A;  4E8U A;  3TA0 A;  1RU1 A;  5B7W A;  2YNG A;  1UEV A;  3D67 A;  3NNC A;  2R7S A;  2DNY A;  3MFI A;  3KNG A;  3OJS A;  2MDA A;  1S76 D;  2NXC A;  3MI7 X;  3ZO7 A;  1RCX B;  4OZ0 A;  5K14 B;  2M8D B;  4ZVQ B;  1LW0 A;  3OXF A;  3PKM A;  4CCH A;  4CO4 A;  3TEH B;  2HND A;  3ZNU A;  3IGV A;  2VG6 A;  4M5J A;  4M5D A;  1IKV A;  1UVL A;  5KFH A;  3QYY A;  2OEM A;  2M88 A;  2FGC A;  5AE1 A;  3ZXW A;  4Q44 A;  4QBU A;  2AT1 B;  2E5J A;  1KD1 T;  1SUQ B;  3M9M B;  5E3R A;  4PCQ A;  1F6T A;  4OJ1 A;  1Q78 A;  4H4M B;  1V6H A;  2C2E A;  1FDN A;  3HJF A;  5E3C A;  4DHV A;  1UTA A;  1SV5 A;  3PRB A;  1TVR B;  4K4Y A;  3UWT A;  1XMO J;  3PHE A;  2B9E A;  1VQY A;  3MMJ A;  2Q1L A;  2W7O A;  3CJS A;  1X4D A;  2CJQ A;  1QVF R;  1VQK S;  2KHC A;  4UF4 A;  2NUU G;  2J76 E;  3KJN B;  1IBM F;  1G6B A;  5CHC B;  4CNZ A;  4K8R A;  4KFB B;  4DV7 J;  5KFM A;  2EBG A;  1HHT P;  5K8P A;  2YNI B;  1KON A;  4NMX A;  4B9V A;  1O0P A;  1URR A;  1VJW A;  3HJV A;  1L3U A;  1LWX A;  4O4R A;  4OZJ A;  4WTO B;  2BA9 A;  2MZQ A;  1RBO B;  5KFQ A;  1T9U A;  4HI2 A;  4LBP A;  5KG2 A;  1Q82 T;  4NLT A;  3DCA A;  4ZS6 A;  1F5B A;  4F3O A;  4PRF A;  4RNO A;  4N77 A;  1Q7L B;  3HP6 A;  2EFV A;  3AB4 B;  1Y5I B;  4URS A;  1HYS A;  2WSC C;  4WYL A;  1N48 A;  4Z2X A;  2VU5 A;  1VQL S;  4ED3 A;  2H5I B;  4FYY B;  2CPI A;  4DR3 J;  2EKY A;  1H2U X;  5B0D A;  3Q22 A;  4B02 A;  1ULR A;  5D8H B;  4Q0B A;  4WTY A;  1JLB A;  2V50 A;  3UQS A;  2IVM A;  4K7Q A;  3PHT A;  5GAD U;  1D9F A;  3HI9 A;  3GV7 B;  4JV1 A;  1RAE B;  2AYE A;  1S9F A;  4FNH A;  3RW7 A;  1N32 J;  3E01 A;  2W8K A;  4P2S A;  2UUA F;  5LMN J;  1OSD A;  2XMK A;  2HPU A;  3OSP A;  3H5U A;  2BMB A;  4G6V B;  2XI3 A;  1KR4 A;  2RRN A;  1FFS B;  1S10 A;  1TMM A;  2HIY A;  1HWJ A;  2KJV A;  1C0T B;  2YTC A;  1SL1 A;  3S6E A;  3A8K A;  3VAL A;  4NLS A;  2QLX A;  4EFA C;  5EX0 A;  2E1A A;  1N5V A;  1OWX A;  5F3Z A;  3I5B A;  1EET A;  2MHN A;  4R25 A;  1HBU A;  4AL5 A;  3KWM A;  4DUY F;  4QIW D;  1V3R A;  3D1Q A;  1S9G A;  4F0M A;  5DGB A;  2FY1 A;  2RKI A;  2HVH A;  2E7X A;  2HRT A;  2KZM A;  3DRX A;  4P72 A;  2WON B;  2KFN A;  2Z2Y B;  4ETZ A;  1PJ6 A;  3LO3 A;  5GAE I;  5KFI A;  3H42 A;  1T9Y A;  3QSY B;  3LQV A;  3TYT A;  3H2L A;  2NYI A;  1WEZ A;  2PE8 A;  1IKY B;  2R9L A;  4IQX A;  1LFP A;  3K5L A;  3EPI A;  2IRY A;  2H54 B;  2ZFH A;  3AAW B;  1FE4 A;  2MKJ A;  5KFY A;  3CIZ A;  2CVI A;  4FBT A;  1XMQ J;  1GX5 A;  2CYY A;  5KTQ A;  8RUC A;  2DIT A;  2MB0 B;  5EGY A;  1R0B G;  2C22 A;  2IM1 A;  3PAC A;  2ZH5 A;  2ZBI A;  3GJS B;  1JJ2 R;  5EWE A;  2QMU B;  1LXN A;  2N3O A;  2GVZ B;  1RHM B;  4KTQ A;  2IC3 B;  2DNP A;  3U7J A;  1WTF A;  3HPO A;  2FLL A;  1NB2 A;  1B0P A;  2J7U A;  3T19 A;  4OYA A;  2WB4 A;  2DEI A;  5M2P A;  2K1R B;  1H7X A;  2H1Y A;  4XPC A;  3FQK A;  4J9L A;  2X3G A;  1NRK A;  1I94 F;  2XSJ B;  3HF5 A;  2JLG A;  3I31 A;  1S6Q B;  5HN0 A;  2BYC A;  4JI3 J;  1WOO A;  3DOL B;  4MKY A;  1U6Z A;  4HTJ A;  3GU0 A;  2NXU A;  1NHV A;  1CC7 A;  1GT8 A;  3KK3 B;  2G0C A;  3GMG A;  1U2R A;  2GNK A;  4A8S A;  3JQJ A;  3QZ7 A;  2HNZ B;  3MD1 A;  5D3G B;  4ZPD A;  4ALZ A;  2VAS A;  3J7Z 5;  5A8W A;  5F8H A;  3NWG A;  3H40 A;  4J5O A;  5L9N A;  4ES1 A;  5KG0 A;  4F4A A;  3AJD A;  3IAS 9;  4WWS A;  1ZAX A;  5HJY A;  2K2P A;  3NP5 A;  3D2W A;  5GME A;  5GAG U;  4YY3 J;  4ZCM A;  1KC8 T;  1SVD A;  3O1L A;  2DCU B;  3DOK A;  1EJ7 L;  1QDU B;  2KRR A;  2HHQ A;  2N7C A;  5F9L A;  4NLR A;  2AEM A;  2E1P A;  4QW9 A;  2IA0 A;  2YKN B;  1G1X A;  2Q6B A;  1YRT A;  1RWX B;  1X5O A;  1RWM B;  3KTQ A;  3S1T A;  2K7K A;  1U25 A;  1UZH A;  5M2U A;  2KO1 A;  1MRO B;  1YLX A;  2ASY A;  4OI4 A;  3MAQ A;  3UI3 A;  3RRG A;  4IG3 A;  1KFD A;  1T05 A;  4KGV B;  2KT2 A;  2JX2 A;  4LF4 J;  2ILZ A;  3BDP A;  5HLF B;  2HQI A;  4DV0 J;  2VUG A;  3AHP A;  1T02 A;  1RTD B;  3M8Q B;  3HHL C;  1U1O A;  5K20 B;  1D8Z A;  1VQ5 S;  2DEJ A;  3GP9 A;  4RX6 A;  3CGI A;  2DR5 A;  2N4D A;  1TL1 B;  3CCM S;  5JVH Q;  4LBH A;  2QE5 A;  4DV2 F;  4C98 A;  1RYR A;  1D9D A;  2GX8 A;  3SYZ A;  3CXC R;  4LSN B;  3EGN A;  3VAJ A;  3AOB A;  5KFK A;  4M94 A;  4X4P A;  1DTT A;  4WK3 A;  4CO0 A;  5HO4 A;  3FBB A;  4KH0 B;  3C8Y A;  3WBZ A;  1NKB A;  2RQM A;  2IJN A;  2BAB A;  2GML A;  1FJE B;  4YB7 A;  2VG7 A;  3IR5 B;  5L1J A;  2XHC A;  3CJT A;  1WF0 A;  4AL6 A;  2Z58 B;  3Q8R B;  1UEU A;  2GS8 A;  2OPS B;  2KYX A;  1PJ5 A;  3DDK A;  4JI8 J;  4MKA A;  2FJB B;  1L3S A;  1Y7P A;  3IAM 9;  3MMC B;  1IR1 A;  1RWV B;  1X4H A;  4LVO P;  1UW9 A;  1L5U A;  4V1A k;  3AY0 A;  1F3F A;  1FT8 A;  4ZMM A;  1TL4 A;  2BZ2 A;  1J5E F;  1RT4 B;  2CJK A;  5KFF A;  5E41 A;  4RUH A;  5T41 A;  3BGF A;  3MM9 A;  3FNN A;  1CSJ A;  2CDQ A;  2HNY A;  1UEK A;  3BGR B;  2IM2 A;  2XWX A;  1FRH A;  2M0G B;  2AD9 A;  1FTC A;  3V4I A;  5D0R A;  3I0R A;  2CZV C;  3IA0 A;  2UXC F;  1HBO A;  4LFB J;  4KKO A;  1SH2 A;  1RWO B;  4M5M A;  1PAU B;  2DY1 A;  1NK9 A;  1DBD A;  4LQ3 A;  2VL1 A;  5KFN A;  2XQC A;  2V5H G;  3OFG A;  4KSE B;  4FXD A;  3W8P A;  2R8G A;  4DL6 A;  1V5I B;  3NCQ A;  3MED A;  4P6Q A;  5B0B A;  3KLV A;  2C42 A;  3LPY A;  3R5G A;  3MOZ A;  1CJU B;  3RB4 A;  3CVK A;  2QG9 B;  2ZH3 A;  1EKR A;  4DV1 F;  5HBM A;  3SZ2 A;  1S0M A;  1RXO B;  2B5J A;  4C8Y A;  1Y11 A;  1HBM A;  4QYR A;  3TVK A;  3BRE A;  1J5O A;  3F56 A;  5I42 A;  4ECR A;  2KM8 B;  2UUC F;  4K4S A;  1GQE A;  2NPF A;  2DNR A;  2DGV A;  2ZH7 A;  4ELU A;  2P9G A;  1XR6 A;  3POT B;  5E2Q A;  4NLU A;  3H4B A;  3W5X A;  3JTO A;  3TWZ A;  3JYT B;  2ZH1 A;  5CYM B;  1X31 C;  5D77 A;  1FFG B;  4PZV A;  4Q8E A;  1DTQ B;  2YWG A;  4TNO A;  4RW8 A;  3TJA A;  5DDP C;  3B4M A;  3KLE B;  1TK5 A;  4F50 A;  2IAJ B;  1U47 A;  4RW9 A;  5A0Y A;  2BW2 A;  3RBE A;  3UDL A;  1KVJ A;  1X60 A;  2W9C B;  2RD5 C;  1JNZ B;  3PRV A;  4USM A;  2MQO A;  1Q53 A;  2DH8 A;  3UDV A;  1VQ9 S;  2B4O A;  3K5O A;  3D6F B;  3J80 Y;  5SUH A;  2DT9 A;  4IYQ A;  1QE1 A;  3I6P A;  2O5D A;  4ECT A;  2QTW A;  1NLK L;  1NKC A;  4PWD A;  3WQP A;  3HSG A;  3BSA A;  1T9X A;  3D6H B;  4JYA J;  1WF1 A;  1U09 A;  3J7Y U;  1IWG A;  1BHN A;  1EX8 A;  3KLF B;  4EBE A;  5DET A;  2RB7 A;  3TZW A;  4B3O B;  3FZB A;  5F8I A;  4JI7 F;  2GJF A;  2HZA A;  2UVU A;  2DNK A;  4B3R F;  2UUB J;  3D1O A;  2K06 A;  5KFO A;  2J8A A;  5I3U B;  4DR7 J;  2BM1 A;  4LRB A;  5ETQ A;  4CZC A;  3KUH A;  1YJR A;  2COL A;  5HP1 A;  2J0S D;  3OJU A;  3OUY A;  1EP4 A;  2DR6 A;  2CPH A;  1PYS B;  3DLE A;  1JLF A;  4A8Q A;  3PX0 A;  2EFN A;  2GO9 A;  1M1K T;  2ZNY A;  2XSF A;  3J80 U;  3PW4 A;  1KLN A;  2CQ0 A;  1H72 C;  1JLQ A;  4MIA A;  4R5P A;  1FF2 A;  5L1I A;  5GAE U;  2VON A;  2BOA A;  2DO4 A;  2CQP A;  1HI0 P;  3B6B A;  4CO1 A;  3KJF B;  4OL8 A;  2CJX B;  3KDN A;  4C3M A;  2PDA A;  4OX6 A;  2RH3 A;  3W64 A;  2O01 C;  3HCX A;  4OZ5 A;  2DRB A;  4FS1 A;  2XWY A;  3MPU B;  2RF2 A;  2HRY A;  1S5Z A;  3CUL A;  5G0R B;  4FF1 A;  4DPU A;  5ETS A;  4JI5 F;  3CC2 S;  3L4B C;  4RWW A;  3KUG A;  3L7O A;  1GXT A;  1E6Y B;  1T11 A;  2YWK A;  4ECU A;  3R5J B;  5HQM A;  4I2Q A;  5B09 A;  2VOO A;  2H4W B;  3LA0 A;  3I5C A;  2NZ4 A;  1X5P A;  1NME B;  4TY9 A;  1UA0 A;  1YVF A;  4N76 A;  3AD8 C;  2HLU A;  2ZM6 J;  2E1M C;  3V2U C;  3FSY A;  2I1R A;  2IVF B;  4X4U A;  3OL8 A;  3VVT A;  4EUV A;  4WXW A;  4WP9 A;  2OPQ B;  4LRA A;  3DLG B;  4WP3 A;  1K1Q A;  3BYP A;  4O44 B;  3JQM A;  3CCJ S;  1S6P A;  1N5Q A;  2EKN A;  2P6T A;  3PEJ A;  3RW6 A;  4CLW A;  3R5A A;  5FJ4 A;  1VIO A;  2GGP A;  4IO1 A;  1S9E A;  1UWA A;  2AMC B;  2ZD1 B;  1WHY A;  1VDH A;  2RDD A;  2X51 A;  1SJ1 A;  1LW2 B;  2KT3 A;  1BQM A;  1IBK F;  5EN1 A;  4KPC A;  3AA8 A;  3CDU A;  3HXM A;  3OLA A;  2XI2 A;  3MEG B;  3PR4 A;  3VWS A;  4L72 B;  3QJJ A;  3TNV A;  2X1G A;  3P5T L;  4EK2 A;  4DOZ A;  1BWV A;  4NWB A;  3NOG A;  1H2V Z;  3A1Y G;  2K3I A;  3TQE A;  4U7C A;  3H7H B;  2ZH2 A;  1JJH A;  1D1U A;  1VQ4 S;  1U0H A;  5CYJ A;  4TYA A;  3SFG A;  4HKQ A;  2QEX S;  3A8E A;  3LGN A;  4P7T A;  4NLW A;  4PEO A;  4R0J A;  5KFD A;  3JXO A;  4PG5 A;  3NBP A;  1Q79 A;  3BGL A;  4URQ U;  4ERD A;  4XAK A;  5KFJ A;  4WFA Q;  2DGU A;  3W1Y C;  4EYH B;  4KRW A;  1X9S A;  1GMV A;  3M30 B;  4GVL A;  4A8K A;  3T1Y J;  4RW7 A;  4LF8 F;  1HNZ F;  5CCL A;  3V6K A;  5HJX A;  4ECS A;  2VG6 B;  2V8P A;  3DM2 A;  3I87 A;  1XQI A;  4LR9 A;  3EE3 A;  4DQP A;  4DF4 A;  2MGZ A;  3P4U B;  1XNQ J;  1I6J A;  4OHV A;  4UUX A;  4M1K A;  4K4X A;  2CPE A;  1RLD A;  3FCH A;  5D4O A;  4DF8 A;  1HWK A;  4IR1 A;  2XGP A;  2E9R X;  3B54 A;  2HWI A;  4QZV B;  5A6W A;  3AJ1 A;  1DLO B;  2GIF A;  4F0H A;  3VAF A;  1S1T A;  2WZ1 A;  1HFE L;  2DXF A;  4EU0 A;  2GHV C;  2XHW A;  4PAA A;  2W8L A;  1N33 F;  2YVS A;  3GG0 A;  1JLC A;  4JI1 F;  4H54 A;  1SJ3 P;  4DI6 A;  5KFA A;  1BXN A;  1OPI A;  4C8M A;  4MK9 A;  1NK5 A;  1RHK B;  1UFW A;  1ZOT A;  5L1L A;  1TK8 A;  2WVD A;  1Q0N A;  1ZZF A;  3DYA A;  4WZQ A;  4LBI A;  1BC6 A;  4N41 A;  3HHL A;  4Y2K A;  4WBF A;  4ZVG A;  4Y00 A;  1F2G A;  4F3M A;  1OMS A;  1ZM9 A;  3D0I E;  3TRG A;  2CQ3 A;  3OV7 A;  1XNR J;  5E3A A;  1N5T A;  2WVC A;  4C8K A;  4O0I A;  1KQF B;  4N5S A;  5EX3 A;  2UXB J;  5C7P A;  1VYA A;  5KT6 A;  2R7W A;  3B82 A;  3B8H A;  5J2Q A;  4DUT A;  2ZVI A;  4B9S A;  3EZ5 A;  4ZHR A;  3QIP A;  3DKD A;  2BQR A;  2MLX A;  2B3T B;  1U2C A;  2ZZT A;  2LQ8 A;  4RW4 A;  2XZD B;  2DGX A;  2G2Y A;  1TV6 A;  4U7U D;  4X62 F;  1FEE A;  3MM8 A;  1JLB B;  1LWF A;  2C2R A;  1Y10 A;  3C66 A;  3U1L A;  3FBC A;  4DR4 F;  1JNR B;  1UA1 A;  2LU2 A;  3KLI A;  3E01 B;  3H5Y A;  3R6G B;  4OHW A;  4UZC A;  5KFC A;  1KS2 A;  2I5J A;  3PFO A;  1MSW D;  5FLX U;  2QT7 A;  3DI6 B;  2R7Q A;  2FJX A;  1DJ0 A;  4NEY A;  5KT2 A;  1FJ7 A;  3A13 A;  4AQY F;  1FE0 A;  2V8G A;  5JMN A;  4G3I A;  4LRF A;  4YB6 A;  5F0U A;  2V94 A;  4ZN3 A;  4LSL B;  2Z2Z A;  2BKO A;  3H98 A;  5DG7 A;  2VZ9 A;  3NMR A;  2XMM A;  3I56 S;  5L39 A;  4GC6 A;  2XUL A;  2MYF A;  5HAO A;  1QD1 A;  3PW7 A;  1S9G B;  2RE1 A;  3OHA A;  5IXU A;  2FHM A;  1VBK A;  3MCS A;  1VIS A;  4TY8 A;  4R0E A;  1AA1 B;  1GFW B;  1Q8B A;  4CIO A;  2HHP A;  1HQE A;  1VBY A;  1HHQ A;  3SEO A;  4S0M A;  1V3S A;  3TJ8 A;  1XER A;  4ZPT R;  4KV8 A;  3DLB A;  4H4K A;  2VQE J;  1S6O A;  2CPY A;  5IV3 A;  4HHU A;  2MXY A;  2HFS A;  2YXL A;  3B78 A;  1O8B A;  4OQJ A;  2GVD A;  4OI0 A;  2Y1J A;  2FVC A;  1CUL B;  2E7W A;  2DB1 A;  1OY6 A;  2APO A;  4Q7A A;  1KVK A;  4YR3 A;  2CKW A;  3MOJ B;  3IS9 B;  4LR8 A;  1FHT A;  3AT1 B;  1VRQ C;  1SQF A;  4OX9 F;  4F8R A;  4UUW A;  3QQC D;  4ETX A;  1SKR A;  1W25 A;  3IC1 A;  1GXL A;  2DK2 A;  4NCB A;  3CCV S;  2NXN A;  3HFZ B;  2DH7 A;  5J2N A;  2QN6 B;  2DRA A;  2X3D A;  3CCU S;  2WBR A;  2AGO A;  1NJZ A;  3SIP B;  3CD6 S;  2JL9 A;  3PR5 B;  2DD8 S;  2BOP A;  1WNE A;  3R9L A;  4WFB Q;  2Y1I A;  3N5F A;  3DDN A;  1YZ7 A;  2MKI A;  4PPZ A;  3KJV A;  4R8U B;  3HVA A;  5LMU J;  2OTL S;  3H25 A;  2DGS A;  2V2Z A;  3O6Q A;  1FO1 A;  3VAH A;  3MPV A;  2CQG A;  3HHL D;  2LQJ A;  3PYE A;  4KH1 B;  1G2E A;  2OPP A;  2POK A;  2HW3 A;  1TL3 B;  9RUB A;  3W2W A;  3W8G A;  2CXE A;  3S8S A;  1YRX A;  4FF2 A;  4ELT A;  1FFW B;  4OX7 A;  2MTL A;  3DXS X;  2J6U A;  2GIQ A;  4HH0 A;  4GO5 X;  4YFU A;  2M9K A;  1VI7 A;  3FC9 A;  3M2U A;  2X1B A;  2WVE A;  3QWU A;  5JVG Q;  1Z2L A;  1R0A A;  2AU0 A;  3EZO A;  3GYG A;  3IBC B;  3R27 A;  3DOK B;  4QU7 A;  4J9V A;  1WEX A;  2MY7 A;  4DU7 A;  1RHJ B;  5BXI A;  1RT7 A;  4LF6 J;  1XMO F;  1GMU A;  1PC4 A;  3THV A;  4I7F A;  2CJY B;  1VQ7 S;  4O3R A;  1RP5 A;  1IKX A;  2OKQ A;  1VLO A;  1LKZ A;  4LRD A;  1ZET A;  3PYF A;  1CJK B;  3KK2 B;  5D4N A;  3LW5 C;  5LJ5 Y;  1YWX A;  4DV7 F;  4K50 A;  1BQX A;  1EZZ B;  3GE9 A;  3MTK A;  2E9Z A;  4DS5 A;  2NXJ A;  1WJ9 A;  1N5Y B;  2DY9 A;  4A8X A;  4NYZ A;  4NLG A;  1SC6 A;  3CJ4 A;  5A8R A;  3MR2 A;  5IV4 A;  5IT9 U;  1JIH A;  4YHH J;  3UD3 P;  3CWJ A;  1G7C B;  3FFI A;  1XR5 A;  2QV6 A;  1X4B A;  2AJ4 A;  1NJW A;  4MIW A;  3NG8 A;  2V2K A;  3CC4 S;  4A47 A;  1GEH A;  1B4S A;  1DTT B;  1W7W A;  2C3O A;  3BM7 A;  4YQW A;  2D41 A;  4Y28 C;  3DOM B;  4DR3 F;  1F9H A;  1LK7 A;  5HL7 Q;  2HZV A;  1PSD A;  3Q2T C;  1PIE A;  4FP9 A;  1G3O A;  1TUG B;  2RIL A;  4F4Y A;  4KYZ A;  1F3V A;  4KC5 A;  3TO8 A;  4TU8 A;  3FKB A;  4NLP A;  1IJE B;  1N32 F;  3T5J A;  5LMN F;  4CTA A;  2F7V A;  1IM4 A;  1Q81 T;  4FN5 A;  3OTB A;  5H9E J;  3HLU A;  2B7B B;  1MMN A;  2AIR B;  3CCZ A;  3PFE A;  3MZI A;  3TZY A;  4FZV A;  4ZLP A;  1WWH A;  2ZWO A;  3D0H E;  4XIU A;  1UCN A;  5LOQ A;  2FHJ A;  5L46 A;  4AD6 A;  2BUN A;  5K14 A;  2E66 A;  3G8Q A;  1OQ3 A;  1IVZ A;  4K0K J;  3MM6 B;  4MK7 A;  3V4I B;  3RYL A;  3I0R B;  3MEC A;  1UMJ A;  2C3M A;  2C3P A;  1N36 F;  3ENQ A;  2JVO A;  2DNG A;  3ZTQ A; 
#chains in the Genus database with same CATH homology
 5ETL A;  5ETK A;  3KUG A;  1IM6 A;  4M5G A;  3ILI A;  2CG8 A;  5ETV A;  4AD6 A;  2F63 A;  4M5I A;  1KBR A;  4CRJ A;  1F9H A;  1EX8 A;  4M5J A;  2F65 A;  3MCM A;  4M5N A;  5ETN A;  1RU2 A;  1DY3 A;  3ILL A;  4CWB A;  4F7V A;  3MCN A;  3HT0 A;  3ILO A;  1HKA A;  3HD2 A;  5ETQ A;  3KUH A;  5ETP A;  1CBK A;  2BMB A;  3IP0 A;  4M5H A;  3HSD A;  3MCO A;  4PZV A;  4M5K A;  1RTZ A;  3QBC A;  3ILJ A;  5ETR A;  3HSJ A;  3HSZ A;  1G4C A;  4M5M A;  3UDE A;  4CYU A;  1TMJ A;  1EQ0 A;  1EQM A;  5ETS A;  3HSG A;  3UDV A;  1HQ2 A;  5ETO A;  1Q0N A;  1TMM A;  1RB0 A;  4CYU B;  1RU1 A;  3HCX A;  3KUE A;  4M5L A;  3UD5 A;  3HD1 A;  5ETT A;  5ETM A;  2QX0 A;  1RAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...