5ETVA

S. aureus 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase complexed with ampcpp and inhibitor at 1.72 angstrom resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
158
structure length
157
Chain Sequence
HMIQAYLGLGSNIGDRESQLNDAIKILNEYDGISVSNISPIYETAPVGYTEQPNFLNLCVEIQTTLTVLQLLECCLKTEELHRIRKERWGPRTLDVDILLYGEEMIDLPKLSVPHPRMNERAFVLIPLNDIAANVVEPRSKLKVKDLVFVDDSVKRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
publication title Structural Basis for the Selective Binding of Inhibitors to 6-Hydroxymethyl-7,8-dihydropterin Pyrophosphokinase from Staphylococcus aureus and Escherichia coli.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase/transferase inhibitor
total genus 44
structure length 157
sequence length 158
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2015-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 5etvA00
3HD2A 1TMMA 1HKAA 4CYUA 3ILLA 3HSDA 3HSJA 2CG8A 3KUHA 3KUEA 5ETPA 3UD5A 2F63A 4PZVA 5ETSA 4CYUB 1RU2A 3IP0A 3MCNA 2BMBA 2F65A 3HT0A 3UDEA 4M5JA 5ETRA 1RB0A 1RAOA 5ETTA 3ILOA 1DY3A 4M5MA 3UDVA 4CRJA 4M5HA 3HSGA 5ETMA 3HD1A 3ILJA 3MCMA 1EQ0A 5ETQA 4M5IA 1IM6A 1EQMA 4CWBA 5ETLA 1RU1A 1CBKA 2QX0A 3MCOA 4M5LA 5ETKA 5ETVA 1F9HA 1G4CA 3HCXA 3QBCA 3ILIA 1HQ2A 1KBRA 3KUGA 5ETOA 1Q0NA 1RTZA 4M5GA 5ETNA 3HSZA 4AD6A 1EX8A 1TMJA 4M5NA 4M5KA 4F7VA
chains in the Genus database with same CATH superfamily
1V3SA 2BJ7A 3SFGA 1S1TA 5CCMA 5C25B 2RUGA 3MR3A 4TXSA 2XMUA 4PG6A 1EAYC 3CJ5A 5KFJA 3BH7B 5B0DA 5F3ZA 4ECSA 1ZAXA 2XMWA 4Q0BB 1NJZA 1RT4A 4JI5J 3FBEA 3O6QA 4ELUA 2ZITA 3T1YJ 3K0JA 2VPXB 1VCTA 1LFPA 5HN0A 3E8OA 3MCOA 3KHGA 1XR5A 4YUDA 3EZUA 2IJRA 3LPEA 5C25A 2LXIA 1VRUB 4JUZA 1N5YB 2Y1IA 4B3OB 1BLUA 2OKQA 2AIRB 2P9GA 1NPPA 5HMYA 4MMOA 2NCKL 2W01A 1SKWA 2E7XA 5KFPA 4JI6J 2IM3A 7AT1B 4AE5A 4B3MF 2YX1A 4Q0BA 1T9XA 4MK7A 4UTGA 3Q2SC 3CNQP 1IR0A 1KC8T 1L3KA 1M5PC 2ZKTA 3BM7A 2HFOA 1RU2A 4S0MA 2CVEA 2CJAA 1PYTA 2FHOB 3C14B 4IRCA 2V63A 2M7SA 1VRUA 3M1VB 2FJXA 1KQGB 1N5YA 4B3OA 4C0BA 4IR9A 4FYWB 1U25A 3CGIA 1FVSA 3M8RA 5GAHI 1S9EB 2ZHAA 1HWIA 2UUAF 1HWUA 1C4CA 3BBBA 3FC9A 2NQPA 3EWGA 4U7UK 2B3TB 3GJTB 5M2PA 4BC7A 4DV6F 4M8LA 3WC0A 3GYNA 2GAHC 3C14A 3M1VA 1GX6A 3H8YA 2LCWA 4BCAA 1Y9OA 3QZ8A 1S9EA 3UFCX 5IT9U 2BE9B 3CPWR 3T9NA 3SQGB 1VQYA 2CQ3A 1KDNA 5LSLA 1M5SA 4NZ6A 1Q81T 3K17A 2XULA 4WFBQ 2UUCF 3GYXB 1CSJA 4WIQA 3AXMA 3C46A 2MJNA 1Y3JA 4WK3A 3UI3A 2M0GB 4FF3A 3W66A 3FSXA 2H65B 3U1NA 2R7SA 3J7AN 5DM7Q 5KFEA 3TZZA 4MIBA 2W7OA 1HNXJ 4MKAA 4CTAB 2IJFA 1Q1KA 1VK8A 3GMGA 5HBMB 3SQGA 4IUFA 5KFOA 4O3RA 4XDDA 2I6WA 5DDQC 8AT1B 2CJKA 3PYFA 2KFZA 2RH3A 2XM3A 2DXDA 3GFYA 3PXGa 3MCNA 2YKQA 2NR0A 1IBKJ 2MQOA 4CTAA 1R0BG 4QIFA 5HBMA 4N7TA 2XI3A 4C11B 3Q8RB 1IBLF 4JI8F 1SC6A 1EIYB 2KJVA 3HDSA 3DKDA 1X8DA 1UL3A 1VS3A 2JLGA 3J81Y 3NGDA 2OHDA 1DRZA 2HRUA 2XY5A 3THVA 1TQLA 2BKNA 4OYZA 4X4NA 2W25A 4DUZJ 2IVFB 1N5VA 2FLPA 2G2OA 5F41A 2N3OA 4C11A 4WYWA 1RHJB 3A3PB 5KFFA 5GAEU 3HHEA 3TA1A 2XLKA 4ZIWA 2E7WA 2XYHB 4F3QA 1WHYA 4B9MA 1KHWA 3R5AA 1MG7A 1DQ8A 4F26A 3CSKA 5KG2A 2B9YA 2OEJA 2MDAA 4JV1A 5CXTA 4YDXA 1SL1A 3RRGA 3BO4A 2ERRA 1Y5IB 1YK9A 3I87A 5BJRA 1FWPA 4ZJLA 3LWMA 2PSZA 1FFWB 4KT0C 3LH2S 4X62F 2UV8G 4B3MJ 3U7JA 4QWAA 2P5VA 1QD1A 1VQ7S 3I55S 5DGBA 3ZNUA 4B9UA 3PKMA 3GV7B 5KFYA 4RUBA 3HHNB 4BHQA 3ETOA 4QIVA 1RHKB 3EGVA 4FP9A 3DNCA 1FHTA 2GGPB 1XN9A 4DG1B 4NYOA 3W9HA 1KHVA 3HLUA 2UUAJ 4DL2A 1SJFA 2RU9A 2KFYA 1FFSB 3QBCA 2CNKB 2AJ1A 2V8HA 2D3OR 1TK0A 4DV6J 1T3OA 4EFAC 2JEIA 2N82B 3FSIA 4O3OA 5L38A 1E6YA 1RTJB 3K57A 1TU0B 5L8RC 2QX0A 3NWRA 4L3NA 3MGJA 4DG1A 2Y8YA 4LRDA 4DXLA 2ZDPA 5H9FJ 1YJNS 1K0TA 1MWQA 3MOZA 1OY8A 2XSFA 3C19A 1WJ9A 2DITA 2UUCJ 3LOUA 2MZ1A 4LUBA 4KQZA 2VG5B 2D3UA 5KG7A 1RTJA 3PM9A 1RUSA 1FX4A 4QPXA 3RRHA 2BQ3A 1RAEB 4YB7A 3HXMA 3JSMB 2LQJA 4AYBD 4XPEA 2V5HG 2YKPA 4MKYA 1B99A 4URQU 3NGSA 1NK4A 3F56A 1W2BR 2XLIA 2VG5A 4RBVA 2OFGX 1MW7A 1FRHA 2G2YA 3OSPA 3VAGA 2MHNA 2B7BB 4X4RA 4HHUA 5J2MB 2VA2A 4DOZA 3EYZA 3QT7A 4KBIA 3JSMA 2DNMA 4WXWA 4I6YA 4NEYA 2CWXA 1IBLJ 2LMIA 1FEHA 3OUYB 4DR6F 4JI8J 2WVDA 2HAFA 5B0AA 3R3TA 1IUJA 3CCRS 2Y9HA 2VBXA 1FWKA 5J2QB 4U6PA 3OW2R 2HFNA 5F8HA 3M2RB 4DV5F 2K3IA 4HH0A 2RUSA 1B7YB 1AFIA 1FRMA 3MD1A 4CNYA 1EP4B 1LXJA 4GKJF 2RKIB 4RNFA 5L9NA 3HJVA 2GHWA 3OUYA 4RNOA 4CH1A 4ES3A 3CD0A 1PAEX 4M5IA 2RIJA 3BPDA 3JSYA 3V6HA 3M8YA 3N01A 2BABA 2WW8A 5J2QA 5E5NA 4DL4A 1FNMA 3HP6A 4AL7A 5C42A 3M2RA 4OZ2A 2E1MC 3DXSX 2ZJPQ 1Y0HA 4JI7F 3E01B 2XGQA 1N34F 1EP4A 1X4EA 2RKIA 1EX8A 4DQQA 1KD1T 2E9TA 1HQEB 1F3FA 5A76A 3HK2A 9RUBA 1SV5A 2D74B 2E1CA 3IR7B 2ROEA 3BB5A 3EVMA 2UP1A 2CPEA 3NBPB 4X62J 1H3DA 2V2QA 2DGQA 2JNJA 4MYUA 1MMLA 4TYBA 2KVIA 4Z2XA 4ED4A 1M5OC 4IKAA 3E01A 1QM9A 3OV7A 2P9CA 3BR8A 1PKUA 2J0XA 2PMZD 1FRIA 1M1KT 1ZH5A 1HQEA 5E3CA 4X2BA 1SB6A 3EGNA 1TFYA 1LWEB 2XMTA 4WE1B 2R42A 1HNWF 2HWHA 3SV3A 4OZLA 3NBPA 2HAIA 1VMBA 3VGSA 5F8GA 3OFFA 2FGOA 2CG4A 1NXIA 2ABYA 3H2VE 4FVCA 1W7WA 4U96A 2VBYA 1SL0A 4WWSA 4DLEA 1P9QC 4QR1A 1LWEA 4WE1A 3QGPA 2HBQB 1TFWA 1YITS 3NMAA 1UMJA 2HNDB 1YJ7A 5KFCA 1S6OA 1X5SA 4HH1A 2LECA 1GMUA 2CZVC 3IAM9 2G1DA 4ES2A 3KJQB 4U95A 2Q66A 3ZTSA 5BYQA 1BC6A 3S6EA 4QIEA 3UCGA 3IN5A 1RACB 1JLQB 2DXEA 4OZJA 4R5PB 2CQPA 3CJKB 5B0FA 2PD1A 3MM5B 3H4BA 1XMOF 1KLMB 3NWGA 2V8DA 4ZJQA 3TVKA 1U1OA 2HNDA 5LXYA 3D6TB 2BV3A 4A8KA 1GMWD 3VCDA 1K44A 1R8CA 2L9DA 1VBYA 2ZH4A 1FXRA 1KVJA 4NRUA 1ITPA 3QIPB 5HSPA 1JLQA 4XK8C 4R5PA 4C8NA 1NBEB 3CJKA 1K0VA 3HSDA 2CRLA 3MM5A 1M1HA 2Q3PA 3FCWA 1PSDA 2DEJA 1KLMA 3M6UA 4IQMA 2ZHOA 5KT5A 1WDDA 4CDIA 1HBMB 2A2DA 3MM7B 5DDRC 3BO3A 4P73A 2ZH6A 1VQ9S 3LW5C 1U2FA 2VF3A 4UY85 2RS2A 4EGLA 1HFEL 2OPPB 3PRVA 1RAAB 1T0TV 3QIPA 2XYPB 1VQ8S 5HL7Q 3JS9A 2D9PA 1MMNA 1Q0NA 3BS9A 2B9WA 2R8HA 2YBVA 1TK8A 5KTQA 4ES1A 1HBMA 3TEHB 3OL8A 3OFHA 3MM7A 4WKRA 4DV5J 1TL7A 3KOAA 5GMEA 2YNHB 3N9UC 3E51A 2ZEJA 2HLTA 2MQMA 5DJBA 3BGOP 3SSSA 3MCSA 2OPPA 2VH7A 3BDEA 2RVJA 1T3NA 4GKJJ 1RKJA 5DS7A 2VA3A 2HHHF 1RISA 3GG1A 5KFDA 3IR6B 1WC0A 2YWGA 2RB7A 4RPFA 5EHHA 2Q6BA 1TK5A 3CJQA 2YNHA 4AFFA 2H1YA 2LDYA 5EUHA 2KM8C 5K20B 2EFVA 2F4FA 4JI7J 3PNIA 1PCAA 4RUAA 1N34J 2MKYA 2AYGA 3G82B 5KFSA 4JI3F 4OHZA 3WX4A 1UVMA 3V2UC 5KFKA 2MZTA 3GZ7A 3W8PA 3KJNB 3AQPA 2YQ3A 4P9SA 3TEGA 3AA8A 1XWLA 4RR5A 4Q45A 2B56A 1FNOA 1JK9B 2DVIA 2CZ9A 2QYGA 2QLXA 3N5BA 3FBCA 4LJMA 5E3RA 1Q86T 3HD2A 3G82A 2ASJA 2XS2A 1KFDA 1P1TA 3P5TL 4C0HA 1NO8A 4QIWD 2MZQA 2J9CA 4NLSA 5FLXU 4NLQA 3NOGA 1JLAB 3W5ZA 1UVLA 1GEHA 5KFTA 3HSJA 2BR0A 3VZHA 3Q8UA 5IC6B 5D4OA 3AXKA 3IM8A 1QTNB 4L6V3 5E33A 3AD7C 3ELHA 3J7Z5 3KLGB 1B70B 1FESA 4OHYA 1JLAA 3M32B 5J2NB 4KGVB 3G86A 4H4KC 1MN7A 1ZM2A 5IQQA 1YJUA 4DV0J 4N76A 4W90B 1R6VA 2VKRA 5KG3A 2XMJA 4KGZB 4P75A 2BVZA 4KRWA 1AA1B 1HW8A 4KV8B 2Y3YA 1XMOJ 3AB4B 4P2SA 3KXDA 3CJ2A 3KLGA 2AJ0A 3SEOA 5AE2A 2HHUA 3DRRA 5E41A 3M32A 3D3BJ 5J2NA 2DGSA 4DN0A 2J8SA 4UT4A 3D4JA 2HFUA 5C2GA 1Q53A 3PYEA 3QFHA 3ZTOA 3GSIA 2E7VA 2OIHA 4KV8A 5AXLA 2U2FA 1FXDA 2F8HA 4YN3B 1RP5A 3BKTA 3L09A 4A8MP 2CPZA 3HMJG 2BUNA 2HS0A 1U1PA 3KDOA 3HT0A 2WAQD 1CS4B 1NKEA 4KGKA 2W2MP 2EBEA 4PAAA 2XSJB 4Z7CA 4LF8F 2HQ3A 3RG6A 4JOUA 3DYAB 2MSTA 3C6TB 1HKAA 3MR5A 5B0EA 4P71A 2BJ3A 2Z30B 1IQTA 1H98A 4ZPCA 4ZCKA 3C15B 2DXFA 1Q4RA 1X7VA 3TP2A 4J5OA 2FZCB 1Y11A 1OSDA 5GAHU 5I4MA 2BDPA 3HVWA 1HNIB 1CS4A 3CCMS 3ZTRA 1ZM4A 3UDCA 4OZNA 2XSJA 2HHHJ 4GO5X 2HVZA 1XTZA 3DYAA 3S1TA 1AW0A 3AY0A 3C6TA 5AE3A 2IRUA 1KOOA 5KT4A 2M88A 4G1IA 3THTA 3C15A 4ZPTR 4O4GB 3MTJA 4PUOB 4L72B 2VJUA 2G13A 2YX4A 2GVZB 5DQGA 2MKHA 1HNIA 5EX3A 3DOLB 4Y2CA 1X0PA 3PW2A 4YS2A 3MAQA 4JI3J 2JX2A 4ZVRB 5CYMB 2KYZA 1YJRA 2HRYA 4FNHA 1IKXB 2J8AA 3FZBA 3MFIA 4RW8B 3KWMA 4EK2A 2ZWOA 3L95X 5IZHA 4O4GA 4PUOA 2G0IA 2ZH3A 2MJUA 2M70A 3D6MB 3DOLA 3MUVP 1HYSB 4TN2A 3HF5A 4NLYA 2B0GA 4B9LA 4OX9F 4DZDA 5CYMA 4LFCF 1IKXA 3B4MA 4WJBA 1EQ0A 1SI9A 4NA3A 1VBZA 4C3KA 3UPFA 4RW8A 2I2YA 2WVFA 4R25A 3WHIA 2WBRA 4QOTA 2VFRA 3V4MA 3BQ1A 5KG0A 3BSAA 2B43A 4Q43A 3MMJA 3DRSB 5KT7A 1HYSA 3UR0A 4HKQA 3M9NB 2DNQA 4TLQA 4ILLA 3TI0A 4DEZA 2XS7A 1D3WA 2BRKA 2B9EA 2V50A 4NCBA 2X1FA 5EDWA 1VYAA 2H54B 1AYEA 1WWHA 1S1VB 2F63A 4QZVB 3VGUA 3MD3A 2QLFB 3WQPA 4C9DA 3PRBA 4WTYA 3G2XA 5F8NA 3DRSA 4RBTA 1FRLA 4NA1A 4YR3A 2D9OA 4NCGB 2LQ5A 1JX4A 4ZPBA 1UETA 3OTDA 1TELA 2XWXA 4CLYA 3IG1A 2OUGA 3TOQA 4RO0A 3OL9A 2HNYB 4KTQA 1ROFA 3G8SA 4ELVA 1L3TA 2BEFA 5F8IA 1S1VA 3OD2A 5ITHA 3FMWA 2OPSB 1U0HB 4IFYB 2B4OA 3T5LA 4YQWA 4NCGA 4K4XA 2HFVA 1DURA 3I4PA 2ZBRA 4YB5A 4DL5A 1H7WA 3TUIC 4WIIA 2NXEA 2AX1A 1S5ZA 3MEKA 4CNZA 3UD4P 5DRKA 4LF8J 2C3UA 2GIRA 2OPSA 1D9AA 1R8BA 3KKFA 1U0HA 3WIUA 4ECXA 1XEZA 4IFYA 3NGTA 4HDGA 2W24A 1T95A 3VVUA 2DNGA 4ZLNA 2XC9A 5CD4H 2CQDA 2V2ZA 1V3ZA 2H3EB 3T6JA 3A8KA 4CLPA 2APOA 3KG0A 1WC5A 3TRGA 2CWKA 2G9OA 4OZ3A 1DBDA 1Y4ZB 3VF0B 4RNNA 4USUA 1FKOB 2R7OA 1ZAVA 5HQ8A 4K50A 1R3NA 2MQ8A 2I8EA 2UXDF 3DU6A 3TA2A 1WEYA 1EHWA 4X84A 2CADA 3D5MA 1PIEA 5ETNA 3LANA 3CJTA 3I5BA 3PJWA 3PHEA 2JC0A 3M05A 5K14B 3OSNA 1FKOA 2FD2A 4DPUA 3MZIA 3JXOA 3E3XA 2HS3A 3MCMA 4KC5A 2VU5A 3HHLD 4RW4B 5C2CA 3EUNA 4X64F 1NK9A 3ICLA 4FXVA 1LQ9A 3L4BC 1YKWA 1WC6A 4N8OA 1R8HA 1FJEB 4TU9A 4MTPA 5F0WA 1P6TA 1RGVA 1Y00A 3TZXA 3Q8VA 1BUXA 5C5JA 3T41A 4KPCA 4OX9J 1RJJA 4LFCJ 2Y0BB 5J1EB 1G3OA 3IR5B 2ZHBA 7FD1A 1HQ2A 3M4XA 4LR7A 2AGPA 2V67A 2ZOGA 1ZETA 2CPXA 4LQ3A 3PZPA 1VIXA 4P2MA 3BF4A 1OMSA 3W60A 4C8LA 4Q7AA 2O1PA 2HWIA 1NZAA 4DUTA 2WVEA 1OO0B 2C3OA 5IXUA 4CH0S 3Q2TC 1YSJA 2WHOA 4GC6A 3R2DJ 2F3JA 1WG4A 4UUXA 2GA7A 5J1EA 2ALYB 4ED8A 1D1UA 2NXNA 2VIHA 1M90T 3PRDA 4Y28C 4K4ZA 3ZC4A 4WFAQ 3PW7A 1F6TA 4QU6A 2QSWA 1WI6A 1H2UX 1BQXA 4WP9A 4ZJOA 3TO8A 4QCLA 4RW7A 3EXCX 1HQUB 2V9WA 1RT1B 5F0UA 3HSZA 1K47A 3I31A 1JJHA 1RXOB 3BN7A 1N33F 3R7NB 2MPUA 4LFBF 3MMAB 3MURP 2CZ4A 3I9V9 2COLA 3QPIA 2J5AA 2XS5A 4Y00A 3RYLA 5IS2A 2V68A 1RHUB 1S76D 1RHQB 1OYEA 1HQUA 1U24A 5EGYA 2QO3A 1RT1A 3F0NA 4BWMA 1MSWD 2GMLA 4NLTA 2DD8S 1S0MA 4WU2A 3SQOP 3K5NA 3GIJA 4ED0A 5K8MA 5B0CA 4N41A 1WDTA 2DO0A 3NOCA 4Y3CA 3MMAA 1KSPA 2CFXA 3G71S 5DQHA 3ZXWA 1B0PA 4ZPWR 2IIHA 1XR6A 1S99A 1RAFB 3WX8A 2WRMA 4X65F 2BW7A 4A4JA 2CDRB 2HHXA 5CZXA 4E2FB 2GO9A 1RWWB 4BDPA 1S12A 1KKHA 4CQ1A 3H5XA 2DPJA 4NXNF 1WSVA 1OIAA 4KR0B 2EK1A 5D4NA 3T6BA 4A8WA 3ISZA 1NHKL 2P6TA 2DIUA 1DJ0A 1XC9A 2F4VF 1U7LA 4DSIA 2E5LF 1L3UA 3H59A 3VR1A 4CO4A 1SIZA 3TZYA 2HW3A 3KNGA 2C2MB 1BE4A 1HWLA 4ECWA 3TUJC 3MAAB 1YHQS 2UXDJ 1RHRB 2MY7A 2JHEA 3M8SA 1VR6A 4C3LA 1H38A 4A8FA 3ILJA 4XDCA 2YWWA 1VQ6S 1NRKA 4EO6A 3UCUP 2KRRA 2IRYA 2AEMA 3IO1A 2RD5C 4FXWA 1RT3B 2VONA 2FB0A 1WNEA 4IFVB 2DHSA 4FF1A 2QYCA 2Z2ZA 4A8QA 2M3DA 1HPZB 1TUVA 4B9NA 4EYHB 4J9OA 4F67A 3MAAA 1NU4A 1HLWA 5FLXY 2W7AA 1SQEA 4X64J 2W4CA 1FERA 1ZS6A 4FF2A 1KEKA 5LOQA 1VK3A 3GB0A 2F7VA 1YVFA 3PV8A 4P72A 1VGYA 2DK2A 1BMQB 1HPZA 3MUTP 4XTTA 3QRRA 4BS2A 3JB9k 2DHHA 1TKTB 2DR9A 1RTHB 4JV2A 3L7PA 3P4UB 1IXKA 1U1LA 1KVIA 4CLZA 1VHFA 1SC3B 3DXBA 1X4FA 3RW6A 4MAKA 3THPA 2CUYA 1IQZA 4F2SA 4KFBB 2JVRA 3CCUS 4BBYA 5KAKA 2PEBA 3KG1A 1Q5VA 1TKTA 1RTHA 2QL5B 3H25A 3VALA 1U49A 3GR0A 1VQ4S 4PZVA 1NB2A 4LR8A 3PTWA 2SXLA 3UO0A 3WBZA 3BQ0A 1I5OB 2XTJP 3DRPB 4AQYF 2MY8A 2WONB 2NPFA 2J0QD 3BREA 2H51B 1OY9A 4OV6A 1QSYA 4QR2A 2H5IB 4KFBA 1S1XB 3M9MB 2FLNA 1RB0A 2YWFA 1IBCB 1I6JA 2LEBA 1N33J 3N0VA 3GFZA 1AROP 1AUDA 3A3OB 4LFBJ 4YR2A 2J6UA 2ZJRQ 5B09A 3PX0A 2DGUA 3FRZA 4PABA 3DRPA 4USVA 3KHRA 1CBKA 3MECB 2XZWA 5DO2A 2WONA 2RRAA 5DDOC 4LVNP 1S1XA 1KQSR 3LGMA 1JXEA 1JLBB 2J7KA 1LNQA 3POTB 4ZK7M 1RA7A 5LL6d 2AD9A 4GO7X 5D0HA 2BKPA 3SFUA 2PI4A 2HQIA 2O3DA 1F60B 3CULA 1LEOA 1N88A 4NLXA 4LT6A 4X65J 2FPHX 1PGZA 2AYMA 1PYOB 1QVFR 3MPYA 1R31A 3ZZPA 3MECA 2V4RA 4NXNJ 1U8WA 4DX5A 4PQAA 4ZS6A 2VG7B 1Q8IA 5DG7A 1B7FA 1JLBA 1SUQB 2ZZNA 2D3ZA 4PG5A 1YQHA 5HROB 3IP0A 2F4VJ 3HFKA 4ZP8A 2E5LJ 2KVQE 1ZBTA 1HI1A 3OHAA 1SIWB 1NSQA 4ECQA 2VFUA 2VC0A 3RW7A 3PG9A 4Y0FA 2C2DA 3HX9A 2FTRA 2ILYA 2NSBA 1FE0A 3UNYA 2FHJA 2OTJS 2C3YA 3MPUB 3MM6B 2FJWA 2VG7A 3H4DA 5HMXA 8ATCB 2R7XA 4PWWA 1SUQA 3FRYA 2DGOA 3QYYA 5HROA 4OJGA 5IV3A 3D1HA 3VWSA 3H20A 1OQ6A 3ZZYA 2B9XA 5A8RB 1FRXA 2GAGC 3U1LA 2BMBA 3SDEB 2F9DA 3P49B 2L3MA 3RZAA 3ZZRA 6FDRA 5C7PA 5HP1B 1U2RA 1UJ6A 2HZVA 3PFOA 3G6ES 3VAHA 1S0NA 4IO1A 1JJ2R 2MHEA 2X1BA 3MM6A 3BBFA 2GJFA 5BYRA 2RS8A 1LWXA 1UTAA 2KM8B 4JI1F 3AB2B 2LQ9A 2GJ2A 3DC2A 4MFBB 4JB8B 4TQRA 4O44B 3EICA 5A8RA 3SDEA 1J5EF 1WG5A 4DQSA 1FX2A 2F8MA 1KN6A 3N79A 2OSQA 1WACA 1FJ7A 3GR1A 3W62A 4B08A 3EPIA 1RAGB 5HP1A 1YTYA 5E2QA 4CWBA 1APSA 2V6AA 1VC6A 3JYTB 2BJDA 1VHIA 4IH5A 1VLYA 2A2CA 4QU7A 2FVRA 3K8VA 2B5JB 4MFBA 4NYZA 1XIQA 4O44A 3R1HA 3GP9A 4LMZA 1F9HA 1LKZA 2K1RB 2MSSA 2KKHA 2M5YA 2E5GA 1LW0B 4ZVQB 2O67A 3DLGB 2VPZB 5H9EJ 2K3KA 6AT1B 3GFXA 4K4TA 1FA0A 3JYTA 2C22A 4UOGA 3R2CJ 4JYAF 3S01A 3T19A 3LPYA 2P6SA 4XO0A 4F36A 2B5JA 2BANB 1HA1A 2YPZA 5LMUF 2DNPA 1WOPA 2R7UA 3RRKA 4X4UA 2ZH1A 4I0WA 1T11A 4MIAA 3GJRB 2K1RA 5G4DA 4QYZJ 2NYIA 1LW0A 1Q95G 1HARA 1QDUB 4AQYJ 3NXZA 1RT5B 3DLGA 2EG2A 2BYCA 2HKEA 5IT4A 1WD6A 3LP0B 2KJWA 4DLGA 4DPXA 2M4MA 3I96A 3HVTB 4X4SA 2BANA 2NXUA 4ED1A 3VV2B 2XGPA 2ROGA 3LAMA 1Y7PA 4DSLA 3O3LA 4TY9A 1HL6A 4X66F 1RT5A 4CLSA 2YY3A 2W9BB 2Z2YB 3LP0A 3TX8A 4Y2MA 2KFNA 3HVTA 3EDRB 4H4KA 4NX9A 1S1WB 2C1EB 1NDCA 2AMCB 2E44A 1RE1B 1JWWA 1TP7A 1BD6A 3G8TA 4OI4A 3GLJA 2V8PA 2R9LA 4N8NA 2W9BA 3R6GB 1D9FA 4P2XA 2EFQA 5KOWA 4CLTA 4IDKB 3VAJA 5H9FK 1S1WA 4PWDB 1FWLA 1UFKA 1JIHA 3UWTA 4UUWA 4KY3A 1VOMA 4C8MA 1M5VC 4NA2A 2HFZA 2IVMA 2DY1A 4RW9B 5C24B 1SC1B 2WK4A 3OTEA 4IRDA 3X1LB 3EVOA 3VQTA 1EETB 1SQFA 4IDKA 2EKYA 4ECRA 4PWDA 1T05B 1EB0A 1U6ZA 3A8IA 3TJ9A 5DQIA 1H0HB 1QVGR 3CJ4A 3H40A 3OT9A 5BYSA 2MKKA 4RW9A 2R7VA 3P6YC 2JSXA 4LIRA 5C24A 1CC7A 1Q8BA 2ZC4A 1EETA 1B0TA 4UOHA 2YNIB 3GV5B 2LQBA 2KG1A 1J5EJ 2FJDB 4DMZA 2ZUGA 3BGRB 3CJRA 2FJAB 3W61A 1QLNA 3LQVA 1UZHA 2IJNA 4OHXA 5MLCV 2CQBA 1DZ5A 2CJYB 5G0RB 1S4FA 3CCQS 4P2FA 5HO4A 2ACMA 2PC6A 1X0FA 2YNIA 2IRXA 1KWMA 2HK3A 4PG8A 2A3JA 3EJMA 3BGRA 3CXCR 1OPZA 3QAEA 1PJ6A 3W2VB 2BE7D 4TY8B 2F8EX 3K7RA 3Q8QB 5KT2A 4JYAJ 1QE1A 2CQGA 2DRAA 3N6MA 3JSRA 4WTOB 1U2CA 2PI5A 2HBRB 5G0RA 3T1HF 4C3MA 4P74A 5DG8A 5B0BA 5LMUJ 4FF4A 2UVWA 3CDUA 4AXIA 1FF2A 1UVNA 2YKNB 1WSRA 2PDAA 4OI2A 2WBMA 2B8PA 3ZZ0A 2DCUB 3W2VA 2RDIA 4R0EA 4TY8A 3D54A 3CTRA 4K5SA 4WBFA 4LF9F 4ZN3A 2W2PP 2MKCA 2KZMA 1RABB 4WFYA 2GCFA 5LJ3Y 2XO6A 2DNHA 2JL9A 3AFGA 3IAS9 2JVOA 3ISNC 2AW0A 4A8YA 3AOAA 2PE8A 2FY8A 3OL6A 2FVQA 3DLKB 1X4GA 2CIMA 2YKNA 1FTRA 4X66J 1H72C 5DETA 1TUWA 2K7KA 3QT5A 1RAOA 4QPTA 1VBXA 1WC3A 5KFVA 4NL5A 2RAQA 1NJYA 3JSBA 1S49A 3OFEA 2G4BA 4L3KA 4JBCA 2L9WA 2UU9F 1GT8A 3DLKA 4DDFA 4NEZA 2GMHA 1JNZB 2DR7A 2V4JB 2Y0SD 2BOPA 1Q8LA 1S0VA 2NXCA 3T1AA 2GIQA 2ZOMA 2YKAA 2JWNA 4EBCA 3AOCA 5KT6A 2C2EA 3HKZD 1HNZF 4KKOB 4DBQA 2NZCA 1FVQA 4KGMA 2LP4A 1G7CB 2GIFA 4I1TA 3W63A 5BR8F 2E1AA 2XCPA 2V4JA 1DY3A 4OLOA 1OYDA 2UVVA 3Q8YA 1UWAA 2DNZA 2DR5A 1MWZA 4KJIA 1HBUB 1VC0A 2RDDA 1X4CA 4KKOA 1O6XA 3BV8A 1FFGB 5IFMA 2AQ4A 4CLLA 3NNHA 4TU7A 1L5UA 3A8JA 4DF8A 4DU7A 1GH8A 5HQMA 1JXLA 5KFAA 3BZQA 3EPGA 1RLDA 1RTDB 3W3SA 3MMCA 2KYXA 1HBUA 1N56A 5HI7A 2HURA 4NOHA 4KO0B 3RU0A 2WTFA 4OJ3A 3MAHA 5EWGA 4LFAF 1VC5A 3KNAA 1UEVA 4J9VA 4RUCA 1D09B 4E0DA 2QRRA 5KFWA 3RR7A 3K5LA 1R6YA 2CQHA 2CPFA 3QSYB 5ETTA 2DHXA 1CPZA 1YBTA 3BEGB 1RSCA 1Y5LB 1RTDA 2D41A 4KO0A 4GC7A 4FS1A 3IGNA 3R7BB 2IMOA 1ZYQA 2J0SD 4BWJA 3QAUA 3CC4S 4QJVA 4ELTA 1TL1B 1WORA 2MLYA 4V19J 1XNQF 3DGVA 1N6QB 1X60A 3ZZUA 3H5UA 4WP3A 2NPIA 4MT1A 1YBUA 1GQEA 1EKSA 4WZMA 3D68A 3T1HJ 1N5TA 3W5XA 4ANDA 2LXFA 3T5HA 4M5MA 5D4PA 4ITSA 4MIWA 5K5MA 5IWAF 2XNRA 1FNXH 1KFSA 3C66A 4DSFA 3OTCA 1D8ZA 2OD6A 1VQKS 2VOOA 4OLPA 1TL1A 2CPHA 3PCOB 4F0HA 5L1JA 3HD1A 3LF0A 1FK9A 1N6QA 4LF9J 1WF2A 4DV4F 2OI2A 3FDSA 2CPYA 4DI6A 4ZP6A 3SBMA 4RJVA 5KFMA 3BGFA 1OS5A 3NCRA 1F1BB 3TZWA 2XMVA 3JTPA 4NLDA 2DNRA 3SXLA 3AQOA 1TMMA 4PG4A 3QRQA 3HJFA 2XYGB 4RL1A 1WEXA 2C2NA 1UFWA 4OX6A 4WP8A 1ACMB 3FK4A 4KH1B 1J2VA 4EZ9A 4HDHA 4ZVPB 1HHTP 1QSSA 3SI8A 2UU9J 2HSEB 2DB1A 4NMXA 3BKFA 1SXLA 4DSEA 1RDRA 4URSA 2E5IA 1RADB 3NGUA 4CM0A 4PYAA 2MKIA 5D77A 4OYOA 3FBFA 4KE5A 3FCHA 3UD5A 4FPRA 2BQRA 2V9KA 3IGVA 4WF9Q 4LF2A 2R3VA 2J6SA 1HNZJ 1IM6A 2DGXA 2CA9A 2YNFB 3IXQA 2DYAA 3Q23A 1U1NA 3V81B 4QW9A 4D3GA 5BR8J 4RX6A 2AYEA 2DNKA 2Q1LA 4EBDA 1JLGB 1NK7A 3NGRA 3AJ2A 4USIA 1HMVB 3IWNC 4FXDA 2KXNB 3ADAC 2HMIB 2J9EA 2HFSA 3CC2S 1NK0A 1U1MA 3I5CA 2B51A 4IOCQ 1XMQF 4CP5A 2YNFA 3SIPB 1E6YB 2QG9B 2VODA 2KU7A 3V81A 1JKHB 4J9UE 2XEXA 1WHVA 1R43A 2QMUB 1JLGA 3UCZP 3R5DA 4WU3A 2XNQA 1HMVA 3VHQA 4JI4F 2RRNA 2HMIA 5EN1A 2DHGA 4ZKAA 1QY7A 2KDOA 2KTQA 1QAYA 1IKVB 4CT9A 2DNNA 3G6VA 1HIYA 4ZPDA 4I64A 2QN6B 4KIAA 4LFAJ 3L7OA 1JKHA 1X5OA 2R2RA 3DHXA 5HVHA 4FBUA 1QJHA 2HZCA 5HLFB 2JEFA 3ULHA 2XWYA 3FUYA 1N48A 1GXLA 5U47A 1RZMA 1X31C 2XO7A 1IKVA 2WCXA 4ZVSB 3OBIA 5A8WB 1KQFB 4ZVFA 3O2IA 3KLVA 3N4WA 3C3LA 2HHWA 3NNCA 1UVJA 1RWUA 5B7WA 1DQAA 2AJQA 5KG6A 3IS9B 1XNQJ 2J9DA 1W2IA 3AJDA 4NLVA 2ASDA 3P96A 5SUHA 5ADZA 5HLFA 1JJ4A 3PIOQ 1DARA 3PX6A 5IV4A 2UXBF 4N56A 3DLBA 1S1UB 2W2QP 4DL3A 4WYLA 3QATA 2LA6A 3K59A 5A8WA 5IWAJ 2QMXA 4N77A 2K8GA 4ID8A 3IC1A 4UW2A 3WIVA 3EXYA 4K59A 1WF1A 1BWVA 1GTEA 3IS9A 4LVOP 2A6MA 3VGVA 2W8KA 1FDAA 1K8AT 2IMWP 1BXNA 4OMFG 4RLEA 4DV4J 4ZCMA 2ZE2B 2RJZA 4HT5A 2P8IA 4ZVHA 1S1UA 3SV4A 4GKKF 2HNZB 1S4EA 1XK8A 3D1OA 4RWWA 2DRBA 1G2EA 4ATNA 2R7QA 2H4YB 4G1PA 4DPTA 4HI2A 3R1LA 5C42B 4DX8H 3I32A 3VZIA 2PEHA 5KFBA 2CDQA 2QL7B 2RSQA 1JB0C 5A6WA 3W64A 2ZE2A 1SC4B 5ETPA 2PT0A 1R89A 2JFKA 4NLWA 4DR5F 1SV5B 2HNZA 5KFIA 2C2RA 4JI0F 5JXSA 2HQGA 3JQKA 2A1BA 3FQKA 1JLEB 3I5AA 3GONA 3G4SS 4ZVUB 2A0FB 3DOKB 4J9KA 2CKWA 2V8GA 3VAMA 1WELA 3CVKA 3UN3A 2HVIA 3C16B 1WC4A 3QIDA 3IBWA 2MLXA 2QLJB 2CJQA 1IWGA 2RHSB 2E29A 1N32F 3C6UB 4DV3F 1N54B 5KFZA 3J81j 1JLEA 2Z0GA 2G1HA 4HHJA 3RAXA 1YI2S 2RQ4A 1X9MA 4AL5A 3DOKA 2VV5A 3HPOA 2J9DE 4ZPVR 4PEOA 4M94A 3GE9A 2KI2A 4Q44A 4ZN1A 3C16A 1XMQJ 2WB1D 5FJ4A 2XB2D 4ZLJA 2WZ1A 3JAMU 3C6UA 3DFEA 4ZVTB 1NLKL 3ZO7A 4WPAA 1VDHA 5ETMA 4K4SA 1VQPS 4J9LA 4JI4J 3R97A 1CVJA 2XHCA 5LT5A 3W65A 2IA6A 3HFVA 2M9KA 2Z8QA 4OX7A 4DCPB 3I0RB 3GILA 2OJ3A 1YJWS 4ZP7A 1SH3A 3CDAA 3MR6A 1F3VA 4M5NA 4BLGA 3FFIB 2AV5A 2DT9A 4YB1P 5KFUA 1FEEA 1HI0P 3CE8A 5J1PA 4WXOA 1T9UA 1P27B 1RAHB 4NPOA 5F9LA 4ZVOB 4DV0F 2VFVA 3I0RA 3CDBA 3QNWB 2ZH2A 3RB4A 1CG2A 1U4BA 2FZGB 2GW8A 3K8WA 1UA0A 3PO5A 1VQMS 4PR6A 3FFIA 3M8ZA 3B6BA 2H5JB 1O8BA 2CNNB 4HR2A 2UXBJ 1FJCA 2QE5A 2UVRA 2QFIA 2N7YA 2CNLB 1CJUB 4ER8A 3UR3C 2VFSA 4TVAB 3H5SA 4A46A 1HWKA 2VPYB 4P6QA 3JQJA 3OR1B 3OFGA 4KHPF 1TL7B 2I9SA 2EEYA 3TAPA 4I2PB 1WI8A 3FVYA 4B9VA 2MZSA 4C8KA 3CMQA 4M5JA 4ZCIA 3UDLA 3DI6B 4GKKJ 1CJUA 2LEPA 4DFJA 1FD2A 3KJVB 4CO3A 2MZRA 1RBAA 2MQPA 2ZWPA 2AJ2A 2ZH9A 3UVJB 3OR1A 2EPIA 2IYIA 4W98A 2IVYA 2M8DB 1XBWA 4I2PA 1PJ7A 3R8YA 4Q8EA 1WF0A 1LFWA 2N7CA 1FCAA 2E5HA 3ENQA 1GK8A 4UZBA 1CJKB 1OSCA 2CAJA 1GXUA 1DHMA 3DI6A 3D6FB 3GV8B 4DR5J 3MWBA 2IAJB 3KJVA 1SJRA 2HGLA 2BOAA 2FJBB 2A18A 2YWKA 4JI0J 4DR1F 1TKXB 4X4QA 3HKWA 2WOMB 2KO1A 2QL9B 3UVJA 4LF7J 5CYQB 2BM0A 3KYLA 5HVGA 2R2SA 1RCXB 5ETSA 1N0VC 1GX5A 3OVAA 3BJYA 1H7XA 4J91A 1YG0A 1IVZA 4EWTA 3RBXA 3U1MA 4FYDA 1RWPB 3R27A 1CJKA 2F40A 3BDPA 3QT8A 3CCLS 2IAJA 1N32J 3EGWB 2YTCA 4DV3J 1TKXA 2WOMA 2FDNA 2O01C 5CYQA 1WC1A 3PFEA 3CD6S 4WZQA 2FUG9 1D9DA 2RILA 5HVFA 2DRDA 2Z2LA 2ZM6F 3D0HE 3QQCD 2KH9A 4OJ1A 2ZNYA 3DLLQ 2CQ2A 1C0TB 2HGNA 2JC1A 5IT9Y 4KPYA 3Q22A 3BGUA 1VIOA 3FEYB 4FYXB 2WVCA 2VG6B 4A8OA 1KP6A 2MEWA 1REVB 1RWMB 2DISA 2EFPA 3H5YA 1PILA 5L1IA 4Q2MA 2DH7A 3MTKA 1P9YA 2FHJD 3P8BB 3A8EA 3F73A 1C0TA 3W2WB 3ZTPA 4DFPA 1ZPWX 1LWCB 3DRRB 4YHHJ 1GTHA 3QZ7A 2JFDA 2VG6A 3W1YC 3Q83A 3BO2A 1S59A 1A9NB 2R8IA 3TQ1A 4F4KA 1XJWB 4PG7A 1NM2A 1S10A 4DL6A 3NKYA 1S0OA 4K4VA 4NZ0A 1REVA 4DWIA 2DR8A 3OJSA 4IOAQ 2XMAA 4U8VA 2ASYA 1NSPA 4Q8FA 1X4DA 4USKA 3W2WA 2HK2A 5IQ6A 3AD9C 1TV6B 3LGHA 2ACYA 2AEJA 1LWCA 2F9JA 2I0XA 3KTQA 3PYDA 5A2QU 8RUCA 3Q8SB 1JMTA 4Z7YA 3CUNA 1HD1A 1LWFB 3GQCA 5LM7E 1HBNB 4DR4F 1Q79A 2AKWB 3FSYA 3W9JA 2UZAA 1Z4UA 2ZBQA 2ADBA 3K89A 2R4FA 1U47A 5D3GB 1BQNB 2G2ZA 3BN4A 4I7FB 2R2TA 3DDKA 4KHPJ 2R8GA 4DFMA 1TV6A 4Y34A 2HHTA 1X4BA 1ZAWA 3TWZA 3MUMP 3R5CA 5L39A 1GXTA 1UPMB 2V94A 2F65A 2FYXA 3PIPQ 1KLNA 1KR4A 1LWFA 3MDFA 5MAOA 1HBNA 2RQMA 4X4OA 3J7A1 2W1BA 2OPRB 3SSRA 4HYKA 4DX7A 2R7TA 2IBOA 3CC7S 5D3GA 1BQNA 2EKNA 3DM2B 4I7FA 5EWFA 4WFZA 1NK6A 2AF6A 3GJQB 4O0NA 2HVHA 3OTOF 2ALZA 2MMYA 4J7CA 3Q8PB 4EZ6A 2IM2A 2C3MA 4L74A 2KXHA 4ECUA 1Q7YT 3OQ2A 4HTJA 4J90A 3UD3P 3DHWC 3LAKA 4ZITA 5THWA 3V6JA 1ZTWA 3D67A 1B0VA 4OZ1A 2E5JA 2OPRA 4DR1J 5BXIA 3DM2A 3EVWA 1DAXA 1V3RA 4DU8A 3PVXA 2XMMA 1NH7A 3DRXA 2HQFA 3NAIA 2VUGA 4CM2A 4IH6A 1GFWB 3D28A 1ZA1B 2W2NP 5D0GA 4K4WA 2J76E 3GPAA 3B54A 3RB6A 1X9SA 5E3QA 2QA4S 4DPWA 1AXQA 3EX7B 3CCVS 3J80U 2DY9A 2CJ9A 3GIRA 4KHRA 3RTVA 3CCSS 3H42A 3PJ9A 2BM1A 5I3QA 3TUZC 4EUVA 1G6BA 4KSEB 2MXYA 2ZZTA 2ZM6J 5FD1A 4M95A 1RWOB 4FVMA 2ATCB 4G65A 1K1SA 1FKPB 2HVDA 4OYPA 2X51A 4B3SF 2VDIA 5ETRA 5I3UB 5KFNA 3DDNA 2FC8A 3D6HB 1R0CB 1U1QA 4IO9Q 2MTLA 2NUUG 2WVBA 4F0KA 2L08A 2B4VA 4G1QB 1H6KX 4F0MA 4M1KA 1BQMB 4OYXA 5AT1B 1Q8KA 4YP3A 1HI8A 3D7SB 1KONA 1VISA 2DO4A 3V6KA 3TANA 4D3HA 1FKPA 2JLEA 1IM4A 2Y8WA 3DRYA 4ED3A 1YRXA 2E66A 4ED5A 3IG1B 5K8NA 5I3UA 4M63A 1A7GE 3GU0A 3CEDA 1RU1A 3DMJB 5IM0B 1JLFB 3O44A 4RWXA 3K2YA 3Q86A 1WUUA 1QTMA 4G1QA 1BQMA 1LK5A 4NMLA 3MM9B 1KBRA 1ZM9A 1F9FA 4KGXB 3CCZA 1P8GA 4PKDB 3NY0A 4NZ7A 4TKTA 4V19X 3DMJA 5IM0A 1JLFA 3V5RA 3P5BP 4DR4J 3LALA 2WSCC 2XI2A 4PPZA 2GV1A 2YWEA 4C48A 3IMQJ 4K0KF 1CULB 3MM9A 3W9IA 4LSLB 4ED2A 9ATCB 2C28A 1RAIB 3TARA 1IR1A 1AZSB 3KUHA 3SSQA 3IM9A 2KZZA 3M8PB 3PDNA 1HHSA 4CIOA 4UZCA 4G6VB 5CZVA 3I82A 4A8XA 2MGZB 2CQIA 3OLBA 5LSOA 1JQGA 2JOQA 4PRFA 3NG8A 2AJ4A 4OIXA 1X4HA 3LO3A 3BSCA 3N6NA 3FNNA 4C8OA 1CULA 2QEXS 5F8MA 4I6WA 4LSLA 3OTOJ 3KG4A 2A10A 1NMEB 3TW0A 2VOPA 1V5VA 1NDLA 1AZSA 5KG4A 2GGPA 3M30B 3TAQA 4MK9A 3M8PA 2PFDA 4USJC 2GO8A 4LBIA 3ZTQA 1H73A 3OR2B 1TAQA 2MB0B 2MGZA 4LF5F 2DPIA 2ZH8A 5DM6Q 2L9NA 4O3PA 4OQJA 3JTNA 3G8QA 1N52B 2HBYB 4IH7A 2YNGB 5H9EK 3SCJE 1AB8A 3IBFB 2VBWA 2OP5A 3M30A 4QR0A 1DTQB 1MWYA 2KT3A 3D0GE 2P9EA 1NCLA 2CVIA 1FO1A 2B4UA 2OEMA 3HI9A 1YJTA 3OR2A 1X5TA 4LQ9A 2HLUA 3JAMY 3PJXA 3MR7A 4F4ZA 4OI0A 4U67Q 4DZ6A 1C4AA 4QYZK 2D1CA 1KVKA 2ZJQQ 1CJTB 2KG0A 2CG8A 2YNGA 3CIZA 1FDDA 2R7RA 2EWHA 1DTQA 5J1NA 2EW9A 4NYPA 5DDPC 3IWLA 4DS5A 2V2VA 5GVQA 3PW5A 4B3SJ 2LYVA 3VTIA 2E1PA 5KFGA 4CZCA 2UUBF 5B08A 2RQCA 4JI2F 4X4TA 1IWAA 1CJTA 2Q6CA 1Q78A 3MPDA 1R27B 5CHCB 2IA0A 1XQIA 4WK1A 2HS4A 5J2MA 4CO1A 5LJ5Y 4RW7B 3CD7A 2W9CB 3OLAA 4ECYA 1RBLA 3AD8C 2GQ2A 2AYBA 1GAOA 4NCAA 1CEZA 1URNA 2M2BA 3MPWA 2C2ZB 2EFOA 5DZ7A 3ENVA 3M7VA 4J9SA 3SCLE 5GAGU 3MEEB 2FZKB 1QUPA 3KDNA 2BA9A 4YDDB 5E0OA 4OI6A 4PXBA 2QJ3A 2DJWA 5D0RA 2W9CA 4C4WA 4EMDA 3F41A 3GCXP 1PBAA 3FEXB 3CCWA 3CJSA 2DNYA 4QW8A 5DLGA 4I56A 3HM9A 3QT6A 1I3OB 4LBPA 2N4DA 3MEEA 1S6UA 4F50A 5L1KA 5D4LA 2KHDA 2D7SA 4O3QA 3LA0A 1SJ1A 1NHUA 4LRFA 3HVAA 4DUYF 2OTLS 2AJFE 4Q2LA 5HMZA 2B6AB 4WKYA 2E9RX 4K0KJ 2DGTA 4ZCLA 1ZA2B 2ZD1B 1YWXA 1YBAA 3PX4A 4FN5A 2W4DA 3BKUA 3I56S 4DV7F 4PXDA 2W2OP 3EMTA 3D9BA 3AAWB 1HD0A 1RT7B 2BX6A 4I68A 1R8PA 4NLUA 2C3PA 3CCJS 2ZDOA 2B6AA 2K06A 4H4OB 2BJ1A 4HI1A 1YX2A 1TTHB 2DNLA 3CO9A 1N0UA 4O3SA 2IHR1 1H2TZ 3QSIA 2ZD1A 2JEJA 3V4IB 3LWLA 2AU0A 4FZVA 1N5QA 2U1AA 4FYVB 1TL4A 3GIKA 2CPJA 2MLZA 2H5EA 3RBDA 3CIMA 3QFWA 5KFXA 3UDVA 1S77D 2RDJA 1RT7A 1IN0A 4LF5J 2M8HA 2FHKA 4H4OA 3KUEA 1RT2B 4ECZA 1IKYB 3V4IA 4I4BA 4GVLA 2HG4A 1F5CA 2CXEA 4Y6IA 5T7LB 2N3LA 3KLHB 4ZLLA 3DLHA 4I67A 5KFLA 3A3NB 1FRJA 4J9QA 2PA3A 4KAIA 1UVIA 3QGIA 3GWCA 1MMDA 1RT2A 2KT2A 5GADI 3PR5B 4AL6A 4OI1A 1Z1ZA 3OL7A 1IKYA 1AT1B 4U8YA 3DDIA 3TYTA 2Q43A 4CO2A 5T7LA 3KUGA 3KLHA 4AD6A 2WSFC 4K7QA 2HBZB 2F5GA 3B4DA 5EWEA 4WCEQ 3E2EA 3VAFA 2HVEA 4CLUA 1I1GA 1QSLA 5IC4B 4TU8A 1HW9A 4DR6J 2UUBJ 4RW6B 2DR6A 3KHLA 4DHVA 4ETXA 2QIFA 4F25A 4JI2J 1FTCA 2BXJA 2WB4A 1VRQC 2CQ0A 5HJYA 4HEA9 4RU2A 3BSOA 3PEJA 3KHHA 2XBPA 4YEAA 4TLRA 3R5JB 2GC8A 4K4YA 5KG5A 4LF6F 3FGVA 1OJ4A 2B8QA 4X4VA 2E9ZA 2BE2B 1UAWA 1YJ9S 4RW6A 4L76A 3MR2A 3SCKE 2IDEA 5FIIA 4TNOA 1GNKA 4ZHRB 5A2QY 1RWNB 4DX6A 3AHPA 5D8HB 3OVSA 1S9FA 3NLCA 1A6LA 2LQ8A 2MQNA 1MROB 4U7CA 2XHWA 4QWDA 3Q0AA 2QLWA 3H0PA 1PC4A 1V5IB 2BE2A 1SH0A 2AHOB 4DJBA 3N6LA 1S6QB 5CAAA 1T03B 3MOJB 2LEAA 2L48A 4F3OA 3ENAA 2ZUAA 3CJ3A 4FPIA 5LSRA 4LSZB 4ZHRA 2BJ8A 3I9ZA 5ETKA 2AX0A 4GRSA 2WW4A 2KN4A 3QGGA 4ZIVA 1B3TA 1U09A 2B7CB 4DUYJ 2HHSA 2I38A 1MROA 3TR5A 4L75A 2VC1A 4QYRA 2OPQB 1FT8A 5H1SV 3GG0A 2XZTB 4P52A 1S6QA 4B02A 1ICEB 1NKBA 3G6YA 1T03A 4O23A 4NE9C 1NPRA 2FJEB 5CYJA 1KTQA 1V9OA 1JNRB 3EZOA 1HNWJ 4ZMMA 2CPDA 4DV7J 1WKJA 5KFQA 1YRUA 5KT3A 3M9OB 1U45A 5E3AA 5DZ6A 1T9WA 3M8WA 5D6GA 2PIIA 2YXLA 2W9AA 1LOUA 4JP8A 3BBCA 4CH7A 4DS4A 3VVTA 4URGA 4J9PA 1F2GA 3DLEB 3H7HB 4NI2B 2OPQA 2Z56B 3OTBA 3TUPA 5HK4A 3BH6B 4OX8A 3QLHB 1LV5A 3M6WA 4P7VA 3ENWA 1O5JA 3EGZA 3L9ZA 1ZTTA 5AJ3F 1TL5A 1T9VA 1A0OB 2VJVA 3HSGA 1NSAA 2EBGA 2FVPA 2GJIA 2XY7A 3KMSA 1DTTB 2HPUA 3DLEA 4OYIA 4NI2A 3RB0A 3J80Y 3QWPA 3ETMA 3QLHA 4OL8A 3A1YG 1WHXA 3RBEA 1WTFA 3HHDA 3ET6B 2MKSA 1LXNA 1VQNS 4O4RA 4LR9A 4RUHA 5HANA 5DG9A 5JVGQ 2FJVA 2Z4PA 1WG1A 1KS2A 5SZTA 2ZFHA 1TAUA 2V4QA 1DTTA 1CLFA 4JV0A 3GCWP 4J37A 1RA6A 4DQPA 1RWVB 4DV1F 1ZM3A 4C6AA 4UOFA 2OO4A 3H90A 2O66A 2DEIA 3ET6A 3RJMB 2IYGA 4TQSA 3BGLA 1MLAA 5HAOA 4ANCA 2JEGA 4B3TF 1AUSL 4E8UA 1GMVA 3N5FA 4NXMF 2XMKA 4FYYB 4AXJA 3HCXA 3M8QB 2GVDB 3PO4A 2DHAA 3A12A 5KOXA 3I0SB 1VJQA 4H4MB 1L3VA 4ZP9A 3CJ8A 4E98A 2AWZA 4LF4F 1NH8A 2RMLA 1EZZB 2JJ4D 4ICLB 1VI7A 4OZ0A 2L41A 3PY8A 4HACB 4LF6J 4F8RA 3NNAA 4R0JA 1C2PA 3F44A 1FI4A 3M8QA 2GVDA 5D0EA 5FDLB 3I0SA 3M6XA 4H4MA 4LSNB 4M5KA 1C1CB 3OXGA 3AOBA 1SKSA 3CMES 4ICLA 3ITHB 3B8HA 1S48A 3NGKA 3UDEA 4HACA 4YR0A 3D2WA 3G9CA 2HQDA 2GQQA 2PMHA 4P10A 3VAIA 1PJ5A 1ULRA 4ID5B 1EKRA 1TZ0A 3GTYX 3HULA 2BW2A 4UY8T 5FDLA 4LSNA 2ROPA 4B3RF 3BYRA 1C1CA 4DF4A 5K9FA 5KG1A 5LMNF 1FE4A 3ITHA 2PGCA 1NK5A 1UVKA 3BQ2A 4B9TA 1X9WA 2GVZA 2YQ0A 5L46A 4M5GA 2DGVA 1SL2A 2I5JB 4ID5A 4EBEA 4A48A 3RB3A 4OYMA 3FMBA 4HLBA 1XMBA 1NK8A 3FCVA 1G1XA 1Q5YA 3B82A 4B17A 1MNEA 5D78A 1NEEA 2VBZA 5E7OB 3NAHA 2EXUA 4NRTA 1YGYA 3G96A 2AZ3A 3HHKA 3UNGC 2I5JA 3AJ1A 3ONQA 3S7RA 1SJQA 4X4PA 2LFVA 4UQTA 4U7UD 2FVCA 5AJ3J 3HO1A 4ZA1A 3HHLC 3P3DA 4M5HA 5GMKa 1TL3B 1FKAF 2JRSA 2E1RA 4EYIB 1VQOS 3MI7X 4YY3F 4FDFA 4A8SA 1O0PA 4F04B 4QQBA 1Q7LB 4DQRA 1SJ4P 1R0AB 2GS8A 2Y1LB 4CCHA 3N28A 2Z2MA 2J6TA 2VDHA 3QGHA 4C0OC 3FZ2A 1URRA 5F3TA 4CLWA 2PMWA 4UOCA 3KLFB 1ZZFA 1RI7A 4DFKA 1XR7A 3EZ5A 2KRBA 1YJVA 2BRLA 2XG8A 2VPWB 1TL3A 2ZVSA 5T41A 1U6BA 1NDKA 2MQQA 2CPIA 2F1FA 3O8WA 3OXFA 5T14A 3SZ2A 1JXVA 4IG0B 1OY6A 3J7YI 4FS2A 2NREA 2CQ4A 1R0AA 4DV1J 1BHNA 4PPDA 1RT6B 3T5KA 4ALZA 1RWKB 3AH6A 4NLGA 4EO8A 1NKCA 3KLFA 3LP1B 3T3FA 1BWEA 3Q89A 3CCTA 4W92B 3RUBL 3D1QA 5K8OA 4USHA 2HNYA 2YPYA 3GYGA 1D0EA 2Z57B 4IOBA 3VAKA 3ILOA 3DLJA 4OFZA 2CJXB 4B3TJ 4IG0A 2RE1A 3QO9B 4NXMJ 2I1RA 1Q82T 4XPCA 3J7ZT 1QE1B 2HIQA 1RT6A 3CO0P 4Y2AA 3RBZA 2VL1A 3QMQA 3KK1B 4LF4J 1MU2B 3HZEA 4DSJA 2FLLA 3LP1A 2W7PA 1D8YA 1TVRB 4CO5A 1N8RT 3R5BA 1B64A 2HHVA 2POKA 2C2OB 3UN2A 3BR9A 3IRWP 3QO9A 2JZ5A 2QGFB 4K2XA 2PO4A 4Z37A 4XIUA 4F4WA 1C0UB 1FDNA 3RR8A 3L3CA 1CC8A 3KK1A 1MU2A 7FDRA 2VQFF 1AFJA 4YOEA 2ZBCA 2IPOB 1TVRA 2GZOA 3CF5Q 2JH3A 5ETLA 1T9TA 5JUMA 4GVBB 2UUWA 1TMJA 3DGPB 2IDLA 3PW4A 4F2RA 4F4XA 2UUTA 2ZOFA 4F4YA 4LREA 4RKUC 3NCQA 1J5OB 1I51B 2NYHA 3CDWA 4W4MA 2QSFA 1C0UA 1T94A 2AZ1A 3L7UA 4B3RJ 1M1GA 2IY5B 5HMWA 3QJPA 5LMNJ 4ANEA 4ZVGA 1NUEA 4GVBA 2BZ2A 4AT1B 3DGPA 2B4PA 1PBUA 1UEUA 5K14A 1J5OA 1F5AA 3R7SB 2H48B 1NDPA 5JVHQ 2IM0A 2JLFA 4RW4A 3PW0A 5ETVA 2OMOA 2V8VA 3W7BA 2GQCA 4V1Ak 4C98A 1RLCL 3KLIB 4QWCA 3KLEB 1Z2LA 3LUYA 5HQLA 2VD3A 4HTIA 1RQ0A 3NMRA 5KFHA 2BKOA 2JDJA 5F8JA 1DFDA 4MK8A 3K5PA 3S8SA 4DSKA 2QFJA 2OD4A 4NWBA 2ATLA 3TQEA 2NLWA 3MHYA 1RBOB 3GIMA 1IJFB 1FJGF 4YY3J 4PXCA 1NZ8A 4FKYA 3KLIA 3KLEA 2QMWA 4LIWA 3TA0A 4I6AA 3NEKA 5KFRA 4ZDNA 1P1LA 4PCQA 4NLRA 5M2RA 2HIYA 1T8EA 3MMCB 2A6OA 1WKLA 1QAJA 1VBKA 3CW2C 4LRAA 2BQUA 3TX0A 4ILRA 1Y3KA 1PO6A 3UE2A 3P45B 2LA4A 5DLFA 4XAKA 4YFUA 1RTZA 4TYAA 1REGX 2UVUA 2CJBA 1J27A 5AXMA 1VQSA 3DU5A 1VRTB 4NLOA 4DPYA 4M5DB 1KOHA 5K8PA 2AEFA 3PKYA 4DL7A 4DCJB 4MYTA 2GHVC 1N5SA 3W5YA 6FD1A 1S79A 1TR0A 4DN9A 4OHWA 2ZVIA 1Q16B 2YWHA 2PFFB 4DPOA 3DOMB 1MN9A 2QZ8A 4C2MA 2HZAA 5AE1A 2X3DA 1W25A 4PWUA 2IC3B 3RGIA 2V69A 1S57A 2Y1RI 1VRTA 3K5OA 3WZ0A 4M5DA 2ZNZA 3PHTA 3FJ2A 3EE3A 3ISND 3ZZTA 4CI0B 2UV8A 3H2UB 1RCOB 2PA8D 2NZ4A 3DOMA 4CYUB 1VQ5S 3FQLA 1S7HA 5JMNA 1RKIA 2IC3A 1FK9B 3AT1B 3ILIA 3OVBA 2XZDB 4DV2F 3NL0A 3ILLA 2GHPA 3NS6A 3ZNJ1 5CH7B 4IR1A 1RWXB 1K73T 2VFTA 2DKOB 1O51A 2VQFJ 3PR4A 4FNIA 2ZC3A 2GFFA 3O1LA 3QWUA 2D3O1 1XNRF 1M5HA 4CYUA 2FGCA 4ENOA 3KJFB 2NS1B 2GMJA 3RAMA 2OLWA 2BJ9A 1XERA 3JTOA 2RF2B 4ZPAA 4HVZA 1T7PA 4I69A 3UQSA 5CD4A 3WC2A 1FDBA 1QAIA 4UQGA 1FRKA 4RBUA 3SMZA 2H9ZA 5GAEI 3TJ8A 4Y65A 3FKBA 2FQQB 1VQLS 1GMWA 2OMLA 2DNOA 4OHVA 2IBKA 2DCLA 1TKDA 1YDLA 3KK3B 1M0SA 5HJXA 2KB2A 4RZRA 3OPKA 1RT3A 2G0CA 4USMA 5AXNA 3VQSA 1WTBA 4IFVA 4OYAA 1JLCB 1OWXA 1IJEB 2RF2A 2RHQB 1VLOA 2KL8A 3V6DB 1BGXT 1KRPA 1YIJS 3W8GA 4IRKA 1UJ5A 3KMQA 3BSNA 5GADU 2MYFA 3LTOA 3Q24A 3SCIE 1KNZA 4FKXA 4Y2KA 1R7IA 3MEGB 3NRBA 3WDOA 3KK3A 2GX8A 3EM1A 2ZZMA 2K2PA 2EFNA 3HFZB 3IRXB 1UFLA 4F4AA 1U02A 3GFHA 3X3UA 1EARA 3TAMB 1JLCA 5B0GA 2X3GA 4QIGA 2YKMB 2PN6A 3V6DA 2XQCA 1F5BA 4HHHA 3FEZA 3R5GA 3HVRA 3A13A 3DN9A 2YH1A 1C1BB 1UKUA 1SCJB 1FJGJ 5CQGA 2YVSA 4B9SA 3DCAA 4ERDA 2EC2A 2DTJA 3MEGA 4DR2F 3RAQA 1DQ9A 1UPPA 2DBBA 1N4LA 1U8SA 4MH8A 3IRXA 1N36F 1EQMA 1LK7A 2R8KA 2YX7A 3TAMA 3ZZZA 1U0SA 1UW4A 1M5KC 1FXLA 2YKMA 1H2VZ 3IBCB 1W26A 1SPBP 1PYSB 1C1BA 2OH2A 2VASA 3D3CJ 2RT3A 4NLPA 3MXHP 4K8RA 2D69A 1U26A 3A4TA 2VQEF 3ZFVA 1L3SA 4RNHA 2YQ1A 2HQCA 1TKZB 1WKKA 2M52A 3I6PA 2HHQA 3MFHA 4ILMA 1RYRA 3B78A 2VICA 1UEKA 1R8AA 4FBTA 3NS7B 2UXCF 2Q79A 3I4HX 1S72S 2EI5A 2OAUA 4K2JA 1QUVA 2X1AA 1ZPVA 1I94F 3IA0A 2EVZA 2QLBB 1OQ3A 4CLKA 5AXKA 2ILZA 1TKZA 3KK2B 4C97A 1NJIT 3TJAA 2EG1A 3J81U 2C2KB 4C7QA 1SJ3P 3T9ZA 4C8ZA 3TNVA 2X1GA 3PYGA 3G87A 4DL0C 1NB7A 3POTA 1KTVA 2FC9A 2HWTA 2N4CA 4ETZA 3CB4A 3OXLA 2KXFA 4QBUA 1SKUB 3QJJA 1HHQA 3M6VA 4OV1A 1ELOA 4DV2J 3VGTA 2QC3A 2OEKA 2NSCA 3KK2A 4F02A 3D0IE 4BC9A 1IKWB 3C2PA 4J9RA 2DH8A 2K7JA 1VFJA 3CCES 3TVZA 3K5MA 1XNRJ 3NP5A 2V0NA 2Y1JA 4AUKA 1HNVB 2G0JA 5CA5A 3CJ0A 1S9GB 1T02A 1X5PA 1NJXA 1V6HA 4R8UB 2OFHX 3BYPA 4A47A 2RU3A 3LP2B 2VZ9A 5I3PA 3U27A 4I2QB 1IKWA 4IG3B 4QWBA 1NAQA 3OHBA 3TVYA 4K5RA 5GAGI 1PG5B 1HNVA 1WOSA 5JJBA 4ZOSA 2HGMA 5CABA 2R2UA 1S9GA 1S97A 1U1KA 1PC5A 3QRPA 1FD8A 5F9NA 2LDIA 2CNOB 4R8UA 3IWXA 4HT7A 1U1RA 2HEKA 2FVSA 3LP2A 4DR7F 1HWJA 2NXJA 4EEYA 4I2QA 4OYWA 4YB6A 4IG3A 2ASLA 3CD5A 4PYDA 4N5SA 1Z2ZA 4LRCA 1LW2B 4LF7F 2HYIB 4QWEA 4Y2IA 1UW9A 1T9YA 5E3PA 3FBBA 1F9EB 3C8YA 3ZZOA 5IOLA 5EX0A 4OZ5A 5DGAA 2QA1A 1UZDA 4MKBA 3EDQB 4IYQA 4KH0B 3JQMA 1F2HA 5A0YB 2RRBA 1HR0F 3SYZA 1ZOTA 4DR2J 1LW2A 5A6PA 4M5LA 1N36J 4O0IA 3H2LA 4ECVA 2LVWA 4EI2A 3M2UB 4ECTA 1RTIB 1KQKA 1IR2A 4NASA 2LLZA 1BY9A 2OGUA 4ED6A 2W4PA 5A0YA 4UF4A 5ETOA 2J0WA 2XCAA 1X4AA 1SVDA 1IBMF 5I42B 1RAJA 3AODA 4DR3F 2C42A 3MEDB 2VQEJ 4USTA 2BJEA 3H98A 4LRBA 3BPSP 4USWA 2J7UA 1ZZNA 1K9MT 4JV5F 1SH2A 3IFEA 2ZH5A 3M2UA 4MJKA 4CLFA 2HHPA 3LGNA 1RTIA 3UN5A 1H74A 2VB6A 2YH0A 1RHMB 3NCPA 1TUGB 2UXCJ 1SQGA 2LKZA 5CCLA 1HBOB 3PACA 3PEHA 4KYZA 4KHMA 1I94J 5I42A 2P2CB 2R8JA 3MEDA 1NPKA 4YHHF 4ZVEA 3OJUA 1CJVB 1NNDA 2H4WB 2MZJA 4K4UA 4MKVA 1DLOB 2X7IA 4JI5F 4F7VA 1UP1A 2AGQA 3KFWX 1UA1A 4F3MA 3T1YF 4OJHA 1JJCB 3GIIA 2OSRA 3D66A 2ZH7A 4O3NA 1YRTA 5ETQA 1CQNA 1HBOA 2WSEC 1WHWA 2RQKA 5D15A 2FY1A 1S7IA 4OI3A 1YZ6A 3GJSB 4WFNQ 1CJVA 2VKZG 2KT5A 5A8KB 1UCNA 4JI6F 1DLOA 1CQMA 1VJWA 1B4SA 4H54A 1E6VB 2ZKUA 4L73A 2QTWA 2Z58B 3R9LA 4PXEA 3O5TB 2OELA 3CWJA 4DQIA 2V2KA 2ZBIA 2XY6A 4EU0A 2DGWA 3CT9A 3M2VB 1NJWA 5A8KA 1RK8A 2NUHA 1OPIA 3MPVA 2GNKA 3AA9A 1SBRA 4JI1J 4PQUB 1E6VA 1YZ7A 1Y10A 1UJ4A 2LU2A 5LXRA 2BACA 3QJLA 2FIUA 1PAUB 4RNMA 1WEZA 1T05A 2QA4G 1RYSA 2CQ1A 2ADCA 3M2VA 3MMBB 4C8YA 4N47A 3J7YU 2RNEA 4DR7J 3U02A 2QA2A 3T5JA 1U48A 5GMDA 3G6XA 5M2UA 1UWBB 4HL9A 2IFXA 5F8LA 2AP6A 2EFGA 4U9RA 2EC0A 4PQUA 1U6FA 4LF1A 4J9MA 3R6LB 1EJ7L 2FHMA 2J7WA 1G4CA 1WOOA 2IM1A 4CO0A 5IT0A 1S6PB 1NHVA 2O5DA 2CQCA 2QT7A 2ZBPA 3MMBA 1HNXF 2BBEA 5HATA 3US5A 4RU9A 1UWBA 1HR0J 4ZLPA 2LU1A 2DH9A 3NS5A 2W8LA 2LXUA 3HT3A 1YLXA 5J2PB 4ED7A 1SKRA 1S6PA 4KB7A 2V34A 4G3IA 3GSDA 1NSKL 2FLOA 2HRTA 3HHLB 1IBKF 4CRJA 4WFXA 3CMAS 5L9XA 3K58A 1Y5NB 3UW1A 3MM8B 4YMEA 5L1LA 4J9NA 2EK6A 4OYBA 3CDEA 4DCOB 5J2PA 2KHCA 1S1TB 2MKJA 1IBMJ 4CT8A 4DR3J 4Q5VA 4GMKA 2XLJA 2DIVA 1F0XA 2AT1B 1QAXA 3HZGA 4JV5J 1K1QA 3HHLA 5RUBA 1RT4B 2R7WA 4DUZF 4LBHA 2AGOA 2CYYA 4P7TA 3MF5A 2YKOA 3MM8A 2MQLA 2QV6A 4IQXA 2VHGA
chains in the Genus database with same CATH topology
3HD2A 1TMMA 1HKAA 4CYUA 3ILLA 3HSDA 3HSJA 2CG8A 3KUHA 3KUEA 5ETPA 3UD5A 2F63A 4PZVA 5ETSA 4CYUB 1RU2A 3IP0A 3MCNA 2BMBA 2F65A 3HT0A 3UDEA 4M5JA 5ETRA 1RB0A 1RAOA 5ETTA 3ILOA 1DY3A 4M5MA 3UDVA 4CRJA 4M5HA 3HSGA 5ETMA 3HD1A 3ILJA 3MCMA 1EQ0A 5ETQA 4M5IA 1IM6A 1EQMA 4CWBA 5ETLA 1RU1A 1CBKA 2QX0A 3MCOA 4M5LA 5ETKA 5ETVA 1F9HA 1G4CA 3HCXA 3QBCA 3ILIA 1HQ2A 1KBRA 3KUGA 5ETOA 1Q0NA 1RTZA 4M5GA 5ETNA 3HSZA 4AD6A 1EX8A 1TMJA 4M5NA 4M5KA 4F7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HD2 A;  1TMM A;  1HKA A;  4CYU A;  3ILL A;  3HSD A;  3HSJ A;  2CG8 A;  3KUH A;  3KUE A;  5ETP A;  3UD5 A;  2F63 A;  4PZV A;  5ETS A;  4CYU B;  1RU2 A;  3IP0 A;  3MCN A;  2BMB A;  2F65 A;  3HT0 A;  3UDE A;  4M5J A;  5ETR A;  1RB0 A;  1RAO A;  5ETT A;  3ILO A;  1DY3 A;  4M5M A;  3UDV A;  4CRJ A;  4M5H A;  3HSG A;  5ETM A;  3HD1 A;  3ILJ A;  3MCM A;  1EQ0 A;  5ETQ A;  4M5I A;  1IM6 A;  1EQM A;  4CWB A;  5ETL A;  1RU1 A;  1CBK A;  2QX0 A;  3MCO A;  4M5L A;  5ETK A;  5ETV A;  1F9H A;  1G4C A;  3HCX A;  3QBC A;  3ILI A;  1HQ2 A;  1KBR A;  3KUG A;  5ETO A;  1Q0N A;  1RTZ A;  4M5G A;  5ETN A;  3HSZ A;  4AD6 A;  1EX8 A;  1TMJ A;  4M5N A;  4M5K A;  4F7V A; 
#chains in the Genus database with same CATH topology
 1V3S A;  2BJ7 A;  3SFG A;  1S1T A;  5CCM A;  5C25 B;  2RUG A;  3MR3 A;  4TXS A;  2XMU A;  4PG6 A;  1EAY C;  3CJ5 A;  5KFJ A;  3BH7 B;  5B0D A;  5F3Z A;  4ECS A;  1ZAX A;  2XMW A;  4Q0B B;  1NJZ A;  1RT4 A;  4JI5 J;  3FBE A;  3O6Q A;  4ELU A;  2ZIT A;  3T1Y J;  3K0J A;  2VPX B;  1VCT A;  1LFP A;  5HN0 A;  3E8O A;  3MCO A;  3KHG A;  1XR5 A;  4YUD A;  3EZU A;  2IJR A;  3LPE A;  5C25 A;  2LXI A;  1VRU B;  4JUZ A;  1N5Y B;  2Y1I A;  4B3O B;  1BLU A;  2OKQ A;  2AIR B;  2P9G A;  1NPP A;  5HMY A;  4MMO A;  2NCK L;  2W01 A;  1SKW A;  2E7X A;  5KFP A;  4JI6 J;  2IM3 A;  7AT1 B;  4AE5 A;  4B3M F;  2YX1 A;  4Q0B A;  1T9X A;  4MK7 A;  4UTG A;  3Q2S C;  3CNQ P;  1IR0 A;  1KC8 T;  1L3K A;  1M5P C;  2ZKT A;  3BM7 A;  2HFO A;  1RU2 A;  4S0M A;  2CVE A;  2CJA A;  1PYT A;  2FHO B;  3C14 B;  4IRC A;  2V63 A;  2M7S A;  1VRU A;  3M1V B;  2FJX A;  1KQG B;  1N5Y A;  4B3O A;  4C0B A;  4IR9 A;  4FYW B;  1U25 A;  3CGI A;  1FVS A;  3M8R A;  5GAH I;  1S9E B;  2ZHA A;  1HWI A;  2UUA F;  1HWU A;  1C4C A;  3BBB A;  3FC9 A;  2NQP A;  3EWG A;  4U7U K;  2B3T B;  3GJT B;  5M2P A;  4BC7 A;  4DV6 F;  4M8L A;  3WC0 A;  3GYN A;  2GAH C;  3C14 A;  3M1V A;  1GX6 A;  3H8Y A;  2LCW A;  4BCA A;  1Y9O A;  3QZ8 A;  1S9E A;  3UFC X;  5IT9 U;  2BE9 B;  3CPW R;  3T9N A;  3SQG B;  1VQY A;  2CQ3 A;  1KDN A;  5LSL A;  1M5S A;  4NZ6 A;  1Q81 T;  3K17 A;  2XUL A;  4WFB Q;  2UUC F;  3GYX B;  1CSJ A;  4WIQ A;  3AXM A;  3C46 A;  2MJN A;  1Y3J A;  4WK3 A;  3UI3 A;  2M0G B;  4FF3 A;  3W66 A;  3FSX A;  2H65 B;  3U1N A;  2R7S A;  3J7A N;  5DM7 Q;  5KFE A;  3TZZ A;  4MIB A;  2W7O A;  1HNX J;  4MKA A;  4CTA B;  2IJF A;  1Q1K A;  1VK8 A;  3GMG A;  5HBM B;  3SQG A;  4IUF A;  5KFO A;  4O3R A;  4XDD A;  2I6W A;  5DDQ C;  8AT1 B;  2CJK A;  3PYF A;  2KFZ A;  2RH3 A;  2XM3 A;  2DXD A;  3GFY A;  3PXG a;  3MCN A;  2YKQ A;  2NR0 A;  1IBK J;  2MQO A;  4CTA A;  1R0B G;  4QIF A;  5HBM A;  4N7T A;  2XI3 A;  4C11 B;  3Q8R B;  1IBL F;  4JI8 F;  1SC6 A;  1EIY B;  2KJV A;  3HDS A;  3DKD A;  1X8D A;  1UL3 A;  1VS3 A;  2JLG A;  3J81 Y;  3NGD A;  2OHD A;  1DRZ A;  2HRU A;  2XY5 A;  3THV A;  1TQL A;  2BKN A;  4OYZ A;  4X4N A;  2W25 A;  4DUZ J;  2IVF B;  1N5V A;  2FLP A;  2G2O A;  5F41 A;  2N3O A;  4C11 A;  4WYW A;  1RHJ B;  3A3P B;  5KFF A;  5GAE U;  3HHE A;  3TA1 A;  2XLK A;  4ZIW A;  2E7W A;  2XYH B;  4F3Q A;  1WHY A;  4B9M A;  1KHW A;  3R5A A;  1MG7 A;  1DQ8 A;  4F26 A;  3CSK A;  5KG2 A;  2B9Y A;  2OEJ A;  2MDA A;  4JV1 A;  5CXT A;  4YDX A;  1SL1 A;  3RRG A;  3BO4 A;  2ERR A;  1Y5I B;  1YK9 A;  3I87 A;  5BJR A;  1FWP A;  4ZJL A;  3LWM A;  2PSZ A;  1FFW B;  4KT0 C;  3LH2 S;  4X62 F;  2UV8 G;  4B3M J;  3U7J A;  4QWA A;  2P5V A;  1QD1 A;  1VQ7 S;  3I55 S;  5DGB A;  3ZNU A;  4B9U A;  3PKM A;  3GV7 B;  5KFY A;  4RUB A;  3HHN B;  4BHQ A;  3ETO A;  4QIV A;  1RHK B;  3EGV A;  4FP9 A;  3DNC A;  1FHT A;  2GGP B;  1XN9 A;  4DG1 B;  4NYO A;  3W9H A;  1KHV A;  3HLU A;  2UUA J;  4DL2 A;  1SJF A;  2RU9 A;  2KFY A;  1FFS B;  3QBC A;  2CNK B;  2AJ1 A;  2V8H A;  2D3O R;  1TK0 A;  4DV6 J;  1T3O A;  4EFA C;  2JEI A;  2N82 B;  3FSI A;  4O3O A;  5L38 A;  1E6Y A;  1RTJ B;  3K57 A;  1TU0 B;  5L8R C;  2QX0 A;  3NWR A;  4L3N A;  3MGJ A;  4DG1 A;  2Y8Y A;  4LRD A;  4DXL A;  2ZDP A;  5H9F J;  1YJN S;  1K0T A;  1MWQ A;  3MOZ A;  1OY8 A;  2XSF A;  3C19 A;  1WJ9 A;  2DIT A;  2UUC J;  3LOU A;  2MZ1 A;  4LUB A;  4KQZ A;  2VG5 B;  2D3U A;  5KG7 A;  1RTJ A;  3PM9 A;  1RUS A;  1FX4 A;  4QPX A;  3RRH A;  2BQ3 A;  1RAE B;  4YB7 A;  3HXM A;  3JSM B;  2LQJ A;  4AYB D;  4XPE A;  2V5H G;  2YKP A;  4MKY A;  1B99 A;  4URQ U;  3NGS A;  1NK4 A;  3F56 A;  1W2B R;  2XLI A;  2VG5 A;  4RBV A;  2OFG X;  1MW7 A;  1FRH A;  2G2Y A;  3OSP A;  3VAG A;  2MHN A;  2B7B B;  4X4R A;  4HHU A;  5J2M B;  2VA2 A;  4DOZ A;  3EYZ A;  3QT7 A;  4KBI A;  3JSM A;  2DNM A;  4WXW A;  4I6Y A;  4NEY A;  2CWX A;  1IBL J;  2LMI A;  1FEH A;  3OUY B;  4DR6 F;  4JI8 J;  2WVD A;  2HAF A;  5B0A A;  3R3T A;  1IUJ A;  3CCR S;  2Y9H A;  2VBX A;  1FWK A;  5J2Q B;  4U6P A;  3OW2 R;  2HFN A;  5F8H A;  3M2R B;  4DV5 F;  2K3I A;  4HH0 A;  2RUS A;  1B7Y B;  1AFI A;  1FRM A;  3MD1 A;  4CNY A;  1EP4 B;  1LXJ A;  4GKJ F;  2RKI B;  4RNF A;  5L9N A;  3HJV A;  2GHW A;  3OUY A;  4RNO A;  4CH1 A;  4ES3 A;  3CD0 A;  1PAE X;  4M5I A;  2RIJ A;  3BPD A;  3JSY A;  3V6H A;  3M8Y A;  3N01 A;  2BAB A;  2WW8 A;  5J2Q A;  5E5N A;  4DL4 A;  1FNM A;  3HP6 A;  4AL7 A;  5C42 A;  3M2R A;  4OZ2 A;  2E1M C;  3DXS X;  2ZJP Q;  1Y0H A;  4JI7 F;  3E01 B;  2XGQ A;  1N34 F;  1EP4 A;  1X4E A;  2RKI A;  1EX8 A;  4DQQ A;  1KD1 T;  2E9T A;  1HQE B;  1F3F A;  5A76 A;  3HK2 A;  9RUB A;  1SV5 A;  2D74 B;  2E1C A;  3IR7 B;  2ROE A;  3BB5 A;  3EVM A;  2UP1 A;  2CPE A;  3NBP B;  4X62 J;  1H3D A;  2V2Q A;  2DGQ A;  2JNJ A;  4MYU A;  1MML A;  4TYB A;  2KVI A;  4Z2X A;  4ED4 A;  1M5O C;  4IKA A;  3E01 A;  1QM9 A;  3OV7 A;  2P9C A;  3BR8 A;  1PKU A;  2J0X A;  2PMZ D;  1FRI A;  1M1K T;  1ZH5 A;  1HQE A;  5E3C A;  4X2B A;  1SB6 A;  3EGN A;  1TFY A;  1LWE B;  2XMT A;  4WE1 B;  2R42 A;  1HNW F;  2HWH A;  3SV3 A;  4OZL A;  3NBP A;  2HAI A;  1VMB A;  3VGS A;  5F8G A;  3OFF A;  2FGO A;  2CG4 A;  1NXI A;  2ABY A;  3H2V E;  4FVC A;  1W7W A;  4U96 A;  2VBY A;  1SL0 A;  4WWS A;  4DLE A;  1P9Q C;  4QR1 A;  1LWE A;  4WE1 A;  3QGP A;  2HBQ B;  1TFW A;  1YIT S;  3NMA A;  1UMJ A;  2HND B;  1YJ7 A;  5KFC A;  1S6O A;  1X5S A;  4HH1 A;  2LEC A;  1GMU A;  2CZV C;  3IAM 9;  2G1D A;  4ES2 A;  3KJQ B;  4U95 A;  2Q66 A;  3ZTS A;  5BYQ A;  1BC6 A;  3S6E A;  4QIE A;  3UCG A;  3IN5 A;  1RAC B;  1JLQ B;  2DXE A;  4OZJ A;  4R5P B;  2CQP A;  3CJK B;  5B0F A;  2PD1 A;  3MM5 B;  3H4B A;  1XMO F;  1KLM B;  3NWG A;  2V8D A;  4ZJQ A;  3TVK A;  1U1O A;  2HND A;  5LXY A;  3D6T B;  2BV3 A;  4A8K A;  1GMW D;  3VCD A;  1K44 A;  1R8C A;  2L9D A;  1VBY A;  2ZH4 A;  1FXR A;  1KVJ A;  4NRU A;  1ITP A;  3QIP B;  5HSP A;  1JLQ A;  4XK8 C;  4R5P A;  4C8N A;  1NBE B;  3CJK A;  1K0V A;  3HSD A;  2CRL A;  3MM5 A;  1M1H A;  2Q3P A;  3FCW A;  1PSD A;  2DEJ A;  1KLM A;  3M6U A;  4IQM A;  2ZHO A;  5KT5 A;  1WDD A;  4CDI A;  1HBM B;  2A2D A;  3MM7 B;  5DDR C;  3BO3 A;  4P73 A;  2ZH6 A;  1VQ9 S;  3LW5 C;  1U2F A;  2VF3 A;  4UY8 5;  2RS2 A;  4EGL A;  1HFE L;  2OPP B;  3PRV A;  1RAA B;  1T0T V;  3QIP A;  2XYP B;  1VQ8 S;  5HL7 Q;  3JS9 A;  2D9P A;  1MMN A;  1Q0N A;  3BS9 A;  2B9W A;  2R8H A;  2YBV A;  1TK8 A;  5KTQ A;  4ES1 A;  1HBM A;  3TEH B;  3OL8 A;  3OFH A;  3MM7 A;  4WKR A;  4DV5 J;  1TL7 A;  3KOA A;  5GME A;  2YNH B;  3N9U C;  3E51 A;  2ZEJ A;  2HLT A;  2MQM A;  5DJB A;  3BGO P;  3SSS A;  3MCS A;  2OPP A;  2VH7 A;  3BDE A;  2RVJ A;  1T3N A;  4GKJ J;  1RKJ A;  5DS7 A;  2VA3 A;  2HHH F;  1RIS A;  3GG1 A;  5KFD A;  3IR6 B;  1WC0 A;  2YWG A;  2RB7 A;  4RPF A;  5EHH A;  2Q6B A;  1TK5 A;  3CJQ A;  2YNH A;  4AFF A;  2H1Y A;  2LDY A;  5EUH A;  2KM8 C;  5K20 B;  2EFV A;  2F4F A;  4JI7 J;  3PNI A;  1PCA A;  4RUA A;  1N34 J;  2MKY A;  2AYG A;  3G82 B;  5KFS A;  4JI3 F;  4OHZ A;  3WX4 A;  1UVM A;  3V2U C;  5KFK A;  2MZT A;  3GZ7 A;  3W8P A;  3KJN B;  3AQP A;  2YQ3 A;  4P9S A;  3TEG A;  3AA8 A;  1XWL A;  4RR5 A;  4Q45 A;  2B56 A;  1FNO A;  1JK9 B;  2DVI A;  2CZ9 A;  2QYG A;  2QLX A;  3N5B A;  3FBC A;  4LJM A;  5E3R A;  1Q86 T;  3HD2 A;  3G82 A;  2ASJ A;  2XS2 A;  1KFD A;  1P1T A;  3P5T L;  4C0H A;  1NO8 A;  4QIW D;  2MZQ A;  2J9C A;  4NLS A;  5FLX U;  4NLQ A;  3NOG A;  1JLA B;  3W5Z A;  1UVL A;  1GEH A;  5KFT A;  3HSJ A;  2BR0 A;  3VZH A;  3Q8U A;  5IC6 B;  5D4O A;  3AXK A;  3IM8 A;  1QTN B;  4L6V 3;  5E33 A;  3AD7 C;  3ELH A;  3J7Z 5;  3KLG B;  1B70 B;  1FES A;  4OHY A;  1JLA A;  3M32 B;  5J2N B;  4KGV B;  3G86 A;  4H4K C;  1MN7 A;  1ZM2 A;  5IQQ A;  1YJU A;  4DV0 J;  4N76 A;  4W90 B;  1R6V A;  2VKR A;  5KG3 A;  2XMJ A;  4KGZ B;  4P75 A;  2BVZ A;  4KRW A;  1AA1 B;  1HW8 A;  4KV8 B;  2Y3Y A;  1XMO J;  3AB4 B;  4P2S A;  3KXD A;  3CJ2 A;  3KLG A;  2AJ0 A;  3SEO A;  5AE2 A;  2HHU A;  3DRR A;  5E41 A;  3M32 A;  3D3B J;  5J2N A;  2DGS A;  4DN0 A;  2J8S A;  4UT4 A;  3D4J A;  2HFU A;  5C2G A;  1Q53 A;  3PYE A;  3QFH A;  3ZTO A;  3GSI A;  2E7V A;  2OIH A;  4KV8 A;  5AXL A;  2U2F A;  1FXD A;  2F8H A;  4YN3 B;  1RP5 A;  3BKT A;  3L09 A;  4A8M P;  2CPZ A;  3HMJ G;  2BUN A;  2HS0 A;  1U1P A;  3KDO A;  3HT0 A;  2WAQ D;  1CS4 B;  1NKE A;  4KGK A;  2W2M P;  2EBE A;  4PAA A;  2XSJ B;  4Z7C A;  4LF8 F;  2HQ3 A;  3RG6 A;  4JOU A;  3DYA B;  2MST A;  3C6T B;  1HKA A;  3MR5 A;  5B0E A;  4P71 A;  2BJ3 A;  2Z30 B;  1IQT A;  1H98 A;  4ZPC A;  4ZCK A;  3C15 B;  2DXF A;  1Q4R A;  1X7V A;  3TP2 A;  4J5O A;  2FZC B;  1Y11 A;  1OSD A;  5GAH U;  5I4M A;  2BDP A;  3HVW A;  1HNI B;  1CS4 A;  3CCM S;  3ZTR A;  1ZM4 A;  3UDC A;  4OZN A;  2XSJ A;  2HHH J;  4GO5 X;  2HVZ A;  1XTZ A;  3DYA A;  3S1T A;  1AW0 A;  3AY0 A;  3C6T A;  5AE3 A;  2IRU A;  1KOO A;  5KT4 A;  2M88 A;  4G1I A;  3THT A;  3C15 A;  4ZPT R;  4O4G B;  3MTJ A;  4PUO B;  4L72 B;  2VJU A;  2G13 A;  2YX4 A;  2GVZ B;  5DQG A;  2MKH A;  1HNI A;  5EX3 A;  3DOL B;  4Y2C A;  1X0P A;  3PW2 A;  4YS2 A;  3MAQ A;  4JI3 J;  2JX2 A;  4ZVR B;  5CYM B;  2KYZ A;  1YJR A;  2HRY A;  4FNH A;  1IKX B;  2J8A A;  3FZB A;  3MFI A;  4RW8 B;  3KWM A;  4EK2 A;  2ZWO A;  3L95 X;  5IZH A;  4O4G A;  4PUO A;  2G0I A;  2ZH3 A;  2MJU A;  2M70 A;  3D6M B;  3DOL A;  3MUV P;  1HYS B;  4TN2 A;  3HF5 A;  4NLY A;  2B0G A;  4B9L A;  4OX9 F;  4DZD A;  5CYM A;  4LFC F;  1IKX A;  3B4M A;  4WJB A;  1EQ0 A;  1SI9 A;  4NA3 A;  1VBZ A;  4C3K A;  3UPF A;  4RW8 A;  2I2Y A;  2WVF A;  4R25 A;  3WHI A;  2WBR A;  4QOT A;  2VFR A;  3V4M A;  3BQ1 A;  5KG0 A;  3BSA A;  2B43 A;  4Q43 A;  3MMJ A;  3DRS B;  5KT7 A;  1HYS A;  3UR0 A;  4HKQ A;  3M9N B;  2DNQ A;  4TLQ A;  4ILL A;  3TI0 A;  4DEZ A;  2XS7 A;  1D3W A;  2BRK A;  2B9E A;  2V50 A;  4NCB A;  2X1F A;  5EDW A;  1VYA A;  2H54 B;  1AYE A;  1WWH A;  1S1V B;  2F63 A;  4QZV B;  3VGU A;  3MD3 A;  2QLF B;  3WQP A;  4C9D A;  3PRB A;  4WTY A;  3G2X A;  5F8N A;  3DRS A;  4RBT A;  1FRL A;  4NA1 A;  4YR3 A;  2D9O A;  4NCG B;  2LQ5 A;  1JX4 A;  4ZPB A;  1UET A;  3OTD A;  1TEL A;  2XWX A;  4CLY A;  3IG1 A;  2OUG A;  3TOQ A;  4RO0 A;  3OL9 A;  2HNY B;  4KTQ A;  1ROF A;  3G8S A;  4ELV A;  1L3T A;  2BEF A;  5F8I A;  1S1V A;  3OD2 A;  5ITH A;  3FMW A;  2OPS B;  1U0H B;  4IFY B;  2B4O A;  3T5L A;  4YQW A;  4NCG A;  4K4X A;  2HFV A;  1DUR A;  3I4P A;  2ZBR A;  4YB5 A;  4DL5 A;  1H7W A;  3TUI C;  4WII A;  2NXE A;  2AX1 A;  1S5Z A;  3MEK A;  4CNZ A;  3UD4 P;  5DRK A;  4LF8 J;  2C3U A;  2GIR A;  2OPS A;  1D9A A;  1R8B A;  3KKF A;  1U0H A;  3WIU A;  4ECX A;  1XEZ A;  4IFY A;  3NGT A;  4HDG A;  2W24 A;  1T95 A;  3VVU A;  2DNG A;  4ZLN A;  2XC9 A;  5CD4 H;  2CQD A;  2V2Z A;  1V3Z A;  2H3E B;  3T6J A;  3A8K A;  4CLP A;  2APO A;  3KG0 A;  1WC5 A;  3TRG A;  2CWK A;  2G9O A;  4OZ3 A;  1DBD A;  1Y4Z B;  3VF0 B;  4RNN A;  4USU A;  1FKO B;  2R7O A;  1ZAV A;  5HQ8 A;  4K50 A;  1R3N A;  2MQ8 A;  2I8E A;  2UXD F;  3DU6 A;  3TA2 A;  1WEY A;  1EHW A;  4X84 A;  2CAD A;  3D5M A;  1PIE A;  5ETN A;  3LAN A;  3CJT A;  3I5B A;  3PJW A;  3PHE A;  2JC0 A;  3M05 A;  5K14 B;  3OSN A;  1FKO A;  2FD2 A;  4DPU A;  3MZI A;  3JXO A;  3E3X A;  2HS3 A;  3MCM A;  4KC5 A;  2VU5 A;  3HHL D;  4RW4 B;  5C2C A;  3EUN A;  4X64 F;  1NK9 A;  3ICL A;  4FXV A;  1LQ9 A;  3L4B C;  1YKW A;  1WC6 A;  4N8O A;  1R8H A;  1FJE B;  4TU9 A;  4MTP A;  5F0W A;  1P6T A;  1RGV A;  1Y00 A;  3TZX A;  3Q8V A;  1BUX A;  5C5J A;  3T41 A;  4KPC A;  4OX9 J;  1RJJ A;  4LFC J;  2Y0B B;  5J1E B;  1G3O A;  3IR5 B;  2ZHB A;  7FD1 A;  1HQ2 A;  3M4X A;  4LR7 A;  2AGP A;  2V67 A;  2ZOG A;  1ZET A;  2CPX A;  4LQ3 A;  3PZP A;  1VIX A;  4P2M A;  3BF4 A;  1OMS A;  3W60 A;  4C8L A;  4Q7A A;  2O1P A;  2HWI A;  1NZA A;  4DUT A;  2WVE A;  1OO0 B;  2C3O A;  5IXU A;  4CH0 S;  3Q2T C;  1YSJ A;  2WHO A;  4GC6 A;  3R2D J;  2F3J A;  1WG4 A;  4UUX A;  2GA7 A;  5J1E A;  2ALY B;  4ED8 A;  1D1U A;  2NXN A;  2VIH A;  1M90 T;  3PRD A;  4Y28 C;  4K4Z A;  3ZC4 A;  4WFA Q;  3PW7 A;  1F6T A;  4QU6 A;  2QSW A;  1WI6 A;  1H2U X;  1BQX A;  4WP9 A;  4ZJO A;  3TO8 A;  4QCL A;  4RW7 A;  3EXC X;  1HQU B;  2V9W A;  1RT1 B;  5F0U A;  3HSZ A;  1K47 A;  3I31 A;  1JJH A;  1RXO B;  3BN7 A;  1N33 F;  3R7N B;  2MPU A;  4LFB F;  3MMA B;  3MUR P;  2CZ4 A;  3I9V 9;  2COL A;  3QPI A;  2J5A A;  2XS5 A;  4Y00 A;  3RYL A;  5IS2 A;  2V68 A;  1RHU B;  1S76 D;  1RHQ B;  1OYE A;  1HQU A;  1U24 A;  5EGY A;  2QO3 A;  1RT1 A;  3F0N A;  4BWM A;  1MSW D;  2GML A;  4NLT A;  2DD8 S;  1S0M A;  4WU2 A;  3SQO P;  3K5N A;  3GIJ A;  4ED0 A;  5K8M A;  5B0C A;  4N41 A;  1WDT A;  2DO0 A;  3NOC A;  4Y3C A;  3MMA A;  1KSP A;  2CFX A;  3G71 S;  5DQH A;  3ZXW A;  1B0P A;  4ZPW R;  2IIH A;  1XR6 A;  1S99 A;  1RAF B;  3WX8 A;  2WRM A;  4X65 F;  2BW7 A;  4A4J A;  2CDR B;  2HHX A;  5CZX A;  4E2F B;  2GO9 A;  1RWW B;  4BDP A;  1S12 A;  1KKH A;  4CQ1 A;  3H5X A;  2DPJ A;  4NXN F;  1WSV A;  1OIA A;  4KR0 B;  2EK1 A;  5D4N A;  3T6B A;  4A8W A;  3ISZ A;  1NHK L;  2P6T A;  2DIU A;  1DJ0 A;  1XC9 A;  2F4V F;  1U7L A;  4DSI A;  2E5L F;  1L3U A;  3H59 A;  3VR1 A;  4CO4 A;  1SIZ A;  3TZY A;  2HW3 A;  3KNG A;  2C2M B;  1BE4 A;  1HWL A;  4ECW A;  3TUJ C;  3MAA B;  1YHQ S;  2UXD J;  1RHR B;  2MY7 A;  2JHE A;  3M8S A;  1VR6 A;  4C3L A;  1H38 A;  4A8F A;  3ILJ A;  4XDC A;  2YWW A;  1VQ6 S;  1NRK A;  4EO6 A;  3UCU P;  2KRR A;  2IRY A;  2AEM A;  3IO1 A;  2RD5 C;  4FXW A;  1RT3 B;  2VON A;  2FB0 A;  1WNE A;  4IFV B;  2DHS A;  4FF1 A;  2QYC A;  2Z2Z A;  4A8Q A;  2M3D A;  1HPZ B;  1TUV A;  4B9N A;  4EYH B;  4J9O A;  4F67 A;  3MAA A;  1NU4 A;  1HLW A;  5FLX Y;  2W7A A;  1SQE A;  4X64 J;  2W4C A;  1FER A;  1ZS6 A;  4FF2 A;  1KEK A;  5LOQ A;  1VK3 A;  3GB0 A;  2F7V A;  1YVF A;  3PV8 A;  4P72 A;  1VGY A;  2DK2 A;  1BMQ B;  1HPZ A;  3MUT P;  4XTT A;  3QRR A;  4BS2 A;  3JB9 k;  2DHH A;  1TKT B;  2DR9 A;  1RTH B;  4JV2 A;  3L7P A;  3P4U B;  1IXK A;  1U1L A;  1KVI A;  4CLZ A;  1VHF A;  1SC3 B;  3DXB A;  1X4F A;  3RW6 A;  4MAK A;  3THP A;  2CUY A;  1IQZ A;  4F2S A;  4KFB B;  2JVR A;  3CCU S;  4BBY A;  5KAK A;  2PEB A;  3KG1 A;  1Q5V A;  1TKT A;  1RTH A;  2QL5 B;  3H25 A;  3VAL A;  1U49 A;  3GR0 A;  1VQ4 S;  4PZV A;  1NB2 A;  4LR8 A;  3PTW A;  2SXL A;  3UO0 A;  3WBZ A;  3BQ0 A;  1I5O B;  2XTJ P;  3DRP B;  4AQY F;  2MY8 A;  2WON B;  2NPF A;  2J0Q D;  3BRE A;  2H51 B;  1OY9 A;  4OV6 A;  1QSY A;  4QR2 A;  2H5I B;  4KFB A;  1S1X B;  3M9M B;  2FLN A;  1RB0 A;  2YWF A;  1IBC B;  1I6J A;  2LEB A;  1N33 J;  3N0V A;  3GFZ A;  1ARO P;  1AUD A;  3A3O B;  4LFB J;  4YR2 A;  2J6U A;  2ZJR Q;  5B09 A;  3PX0 A;  2DGU A;  3FRZ A;  4PAB A;  3DRP A;  4USV A;  3KHR A;  1CBK A;  3MEC B;  2XZW A;  5DO2 A;  2WON A;  2RRA A;  5DDO C;  4LVN P;  1S1X A;  1KQS R;  3LGM A;  1JXE A;  1JLB B;  2J7K A;  1LNQ A;  3POT B;  4ZK7 M;  1RA7 A;  5LL6 d;  2AD9 A;  4GO7 X;  5D0H A;  2BKP A;  3SFU A;  2PI4 A;  2HQI A;  2O3D A;  1F60 B;  3CUL A;  1LEO A;  1N88 A;  4NLX A;  4LT6 A;  4X65 J;  2FPH X;  1PGZ A;  2AYM A;  1PYO B;  1QVF R;  3MPY A;  1R31 A;  3ZZP A;  3MEC A;  2V4R A;  4NXN J;  1U8W A;  4DX5 A;  4PQA A;  4ZS6 A;  2VG7 B;  1Q8I A;  5DG7 A;  1B7F A;  1JLB A;  1SUQ B;  2ZZN A;  2D3Z A;  4PG5 A;  1YQH A;  5HRO B;  3IP0 A;  2F4V J;  3HFK A;  4ZP8 A;  2E5L J;  2KVQ E;  1ZBT A;  1HI1 A;  3OHA A;  1SIW B;  1NSQ A;  4ECQ A;  2VFU A;  2VC0 A;  3RW7 A;  3PG9 A;  4Y0F A;  2C2D A;  3HX9 A;  2FTR A;  2ILY A;  2NSB A;  1FE0 A;  3UNY A;  2FHJ A;  2OTJ S;  2C3Y A;  3MPU B;  3MM6 B;  2FJW A;  2VG7 A;  3H4D A;  5HMX A;  8ATC B;  2R7X A;  4PWW A;  1SUQ A;  3FRY A;  2DGO A;  3QYY A;  5HRO A;  4OJG A;  5IV3 A;  3D1H A;  3VWS A;  3H20 A;  1OQ6 A;  3ZZY A;  2B9X A;  5A8R B;  1FRX A;  2GAG C;  3U1L A;  2BMB A;  3SDE B;  2F9D A;  3P49 B;  2L3M A;  3RZA A;  3ZZR A;  6FDR A;  5C7P A;  5HP1 B;  1U2R A;  1UJ6 A;  2HZV A;  3PFO A;  3G6E S;  3VAH A;  1S0N A;  4IO1 A;  1JJ2 R;  2MHE A;  2X1B A;  3MM6 A;  3BBF A;  2GJF A;  5BYR A;  2RS8 A;  1LWX A;  1UTA A;  2KM8 B;  4JI1 F;  3AB2 B;  2LQ9 A;  2GJ2 A;  3DC2 A;  4MFB B;  4JB8 B;  4TQR A;  4O44 B;  3EIC A;  5A8R A;  3SDE A;  1J5E F;  1WG5 A;  4DQS A;  1FX2 A;  2F8M A;  1KN6 A;  3N79 A;  2OSQ A;  1WAC A;  1FJ7 A;  3GR1 A;  3W62 A;  4B08 A;  3EPI A;  1RAG B;  5HP1 A;  1YTY A;  5E2Q A;  4CWB A;  1APS A;  2V6A A;  1VC6 A;  3JYT B;  2BJD A;  1VHI A;  4IH5 A;  1VLY A;  2A2C A;  4QU7 A;  2FVR A;  3K8V A;  2B5J B;  4MFB A;  4NYZ A;  1XIQ A;  4O44 A;  3R1H A;  3GP9 A;  4LMZ A;  1F9H A;  1LKZ A;  2K1R B;  2MSS A;  2KKH A;  2M5Y A;  2E5G A;  1LW0 B;  4ZVQ B;  2O67 A;  3DLG B;  2VPZ B;  5H9E J;  2K3K A;  6AT1 B;  3GFX A;  4K4T A;  1FA0 A;  3JYT A;  2C22 A;  4UOG A;  3R2C J;  4JYA F;  3S01 A;  3T19 A;  3LPY A;  2P6S A;  4XO0 A;  4F36 A;  2B5J A;  2BAN B;  1HA1 A;  2YPZ A;  5LMU F;  2DNP A;  1WOP A;  2R7U A;  3RRK A;  4X4U A;  2ZH1 A;  4I0W A;  1T11 A;  4MIA A;  3GJR B;  2K1R A;  5G4D A;  4QYZ J;  2NYI A;  1LW0 A;  1Q95 G;  1HAR A;  1QDU B;  4AQY J;  3NXZ A;  1RT5 B;  3DLG A;  2EG2 A;  2BYC A;  2HKE A;  5IT4 A;  1WD6 A;  3LP0 B;  2KJW A;  4DLG A;  4DPX A;  2M4M A;  3I96 A;  3HVT B;  4X4S A;  2BAN A;  2NXU A;  4ED1 A;  3VV2 B;  2XGP A;  2ROG A;  3LAM A;  1Y7P A;  4DSL A;  3O3L A;  4TY9 A;  1HL6 A;  4X66 F;  1RT5 A;  4CLS A;  2YY3 A;  2W9B B;  2Z2Y B;  3LP0 A;  3TX8 A;  4Y2M A;  2KFN A;  3HVT A;  3EDR B;  4H4K A;  4NX9 A;  1S1W B;  2C1E B;  1NDC A;  2AMC B;  2E44 A;  1RE1 B;  1JWW A;  1TP7 A;  1BD6 A;  3G8T A;  4OI4 A;  3GLJ A;  2V8P A;  2R9L A;  4N8N A;  2W9B A;  3R6G B;  1D9F A;  4P2X A;  2EFQ A;  5KOW A;  4CLT A;  4IDK B;  3VAJ A;  5H9F K;  1S1W A;  4PWD B;  1FWL A;  1UFK A;  1JIH A;  3UWT A;  4UUW A;  4KY3 A;  1VOM A;  4C8M A;  1M5V C;  4NA2 A;  2HFZ A;  2IVM A;  2DY1 A;  4RW9 B;  5C24 B;  1SC1 B;  2WK4 A;  3OTE A;  4IRD A;  3X1L B;  3EVO A;  3VQT A;  1EET B;  1SQF A;  4IDK A;  2EKY A;  4ECR A;  4PWD A;  1T05 B;  1EB0 A;  1U6Z A;  3A8I A;  3TJ9 A;  5DQI A;  1H0H B;  1QVG R;  3CJ4 A;  3H40 A;  3OT9 A;  5BYS A;  2MKK A;  4RW9 A;  2R7V A;  3P6Y C;  2JSX A;  4LIR A;  5C24 A;  1CC7 A;  1Q8B A;  2ZC4 A;  1EET A;  1B0T A;  4UOH A;  2YNI B;  3GV5 B;  2LQB A;  2KG1 A;  1J5E J;  2FJD B;  4DMZ A;  2ZUG A;  3BGR B;  3CJR A;  2FJA B;  3W61 A;  1QLN A;  3LQV A;  1UZH A;  2IJN A;  4OHX A;  5MLC V;  2CQB A;  1DZ5 A;  2CJY B;  5G0R B;  1S4F A;  3CCQ S;  4P2F A;  5HO4 A;  2ACM A;  2PC6 A;  1X0F A;  2YNI A;  2IRX A;  1KWM A;  2HK3 A;  4PG8 A;  2A3J A;  3EJM A;  3BGR A;  3CXC R;  1OPZ A;  3QAE A;  1PJ6 A;  3W2V B;  2BE7 D;  4TY8 B;  2F8E X;  3K7R A;  3Q8Q B;  5KT2 A;  4JYA J;  1QE1 A;  2CQG A;  2DRA A;  3N6M A;  3JSR A;  4WTO B;  1U2C A;  2PI5 A;  2HBR B;  5G0R A;  3T1H F;  4C3M A;  4P74 A;  5DG8 A;  5B0B A;  5LMU J;  4FF4 A;  2UVW A;  3CDU A;  4AXI A;  1FF2 A;  1UVN A;  2YKN B;  1WSR A;  2PDA A;  4OI2 A;  2WBM A;  2B8P A;  3ZZ0 A;  2DCU B;  3W2V A;  2RDI A;  4R0E A;  4TY8 A;  3D54 A;  3CTR A;  4K5S A;  4WBF A;  4LF9 F;  4ZN3 A;  2W2P P;  2MKC A;  2KZM A;  1RAB B;  4WFY A;  2GCF A;  5LJ3 Y;  2XO6 A;  2DNH A;  2JL9 A;  3AFG A;  3IAS 9;  2JVO A;  3ISN C;  2AW0 A;  4A8Y A;  3AOA A;  2PE8 A;  2FY8 A;  3OL6 A;  2FVQ A;  3DLK B;  1X4G A;  2CIM A;  2YKN A;  1FTR A;  4X66 J;  1H72 C;  5DET A;  1TUW A;  2K7K A;  3QT5 A;  1RAO A;  4QPT A;  1VBX A;  1WC3 A;  5KFV A;  4NL5 A;  2RAQ A;  1NJY A;  3JSB A;  1S49 A;  3OFE A;  2G4B A;  4L3K A;  4JBC A;  2L9W A;  2UU9 F;  1GT8 A;  3DLK A;  4DDF A;  4NEZ A;  2GMH A;  1JNZ B;  2DR7 A;  2V4J B;  2Y0S D;  2BOP A;  1Q8L A;  1S0V A;  2NXC A;  3T1A A;  2GIQ A;  2ZOM A;  2YKA A;  2JWN A;  4EBC A;  3AOC A;  5KT6 A;  2C2E A;  3HKZ D;  1HNZ F;  4KKO B;  4DBQ A;  2NZC A;  1FVQ A;  4KGM A;  2LP4 A;  1G7C B;  2GIF A;  4I1T A;  3W63 A;  5BR8 F;  2E1A A;  2XCP A;  2V4J A;  1DY3 A;  4OLO A;  1OYD A;  2UVV A;  3Q8Y A;  1UWA A;  2DNZ A;  2DR5 A;  1MWZ A;  4KJI A;  1HBU B;  1VC0 A;  2RDD A;  1X4C A;  4KKO A;  1O6X A;  3BV8 A;  1FFG B;  5IFM A;  2AQ4 A;  4CLL A;  3NNH A;  4TU7 A;  1L5U A;  3A8J A;  4DF8 A;  4DU7 A;  1GH8 A;  5HQM A;  1JXL A;  5KFA A;  3BZQ A;  3EPG A;  1RLD A;  1RTD B;  3W3S A;  3MMC A;  2KYX A;  1HBU A;  1N56 A;  5HI7 A;  2HUR A;  4NOH A;  4KO0 B;  3RU0 A;  2WTF A;  4OJ3 A;  3MAH A;  5EWG A;  4LFA F;  1VC5 A;  3KNA A;  1UEV A;  4J9V A;  4RUC A;  1D09 B;  4E0D A;  2QRR A;  5KFW A;  3RR7 A;  3K5L A;  1R6Y A;  2CQH A;  2CPF A;  3QSY B;  5ETT A;  2DHX A;  1CPZ A;  1YBT A;  3BEG B;  1RSC A;  1Y5L B;  1RTD A;  2D41 A;  4KO0 A;  4GC7 A;  4FS1 A;  3IGN A;  3R7B B;  2IMO A;  1ZYQ A;  2J0S D;  4BWJ A;  3QAU A;  3CC4 S;  4QJV A;  4ELT A;  1TL1 B;  1WOR A;  2MLY A;  4V19 J;  1XNQ F;  3DGV A;  1N6Q B;  1X60 A;  3ZZU A;  3H5U A;  4WP3 A;  2NPI A;  4MT1 A;  1YBU A;  1GQE A;  1EKS A;  4WZM A;  3D68 A;  3T1H J;  1N5T A;  3W5X A;  4AND A;  2LXF A;  3T5H A;  4M5M A;  5D4P A;  4ITS A;  4MIW A;  5K5M A;  5IWA F;  2XNR A;  1FNX H;  1KFS A;  3C66 A;  4DSF A;  3OTC A;  1D8Z A;  2OD6 A;  1VQK S;  2VOO A;  4OLP A;  1TL1 A;  2CPH A;  3PCO B;  4F0H A;  5L1J A;  3HD1 A;  3LF0 A;  1FK9 A;  1N6Q A;  4LF9 J;  1WF2 A;  4DV4 F;  2OI2 A;  3FDS A;  2CPY A;  4DI6 A;  4ZP6 A;  3SBM A;  4RJV A;  5KFM A;  3BGF A;  1OS5 A;  3NCR A;  1F1B B;  3TZW A;  2XMV A;  3JTP A;  4NLD A;  2DNR A;  3SXL A;  3AQO A;  1TMM A;  4PG4 A;  3QRQ A;  3HJF A;  2XYG B;  4RL1 A;  1WEX A;  2C2N A;  1UFW A;  4OX6 A;  4WP8 A;  1ACM B;  3FK4 A;  4KH1 B;  1J2V A;  4EZ9 A;  4HDH A;  4ZVP B;  1HHT P;  1QSS A;  3SI8 A;  2UU9 J;  2HSE B;  2DB1 A;  4NMX A;  3BKF A;  1SXL A;  4DSE A;  1RDR A;  4URS A;  2E5I A;  1RAD B;  3NGU A;  4CM0 A;  4PYA A;  2MKI A;  5D77 A;  4OYO A;  3FBF A;  4KE5 A;  3FCH A;  3UD5 A;  4FPR A;  2BQR A;  2V9K A;  3IGV A;  4WF9 Q;  4LF2 A;  2R3V A;  2J6S A;  1HNZ J;  1IM6 A;  2DGX A;  2CA9 A;  2YNF B;  3IXQ A;  2DYA A;  3Q23 A;  1U1N A;  3V81 B;  4QW9 A;  4D3G A;  5BR8 J;  4RX6 A;  2AYE A;  2DNK A;  2Q1L A;  4EBD A;  1JLG B;  1NK7 A;  3NGR A;  3AJ2 A;  4USI A;  1HMV B;  3IWN C;  4FXD A;  2KXN B;  3ADA C;  2HMI B;  2J9E A;  2HFS A;  3CC2 S;  1NK0 A;  1U1M A;  3I5C A;  2B51 A;  4IOC Q;  1XMQ F;  4CP5 A;  2YNF A;  3SIP B;  1E6Y B;  2QG9 B;  2VOD A;  2KU7 A;  3V81 A;  1JKH B;  4J9U E;  2XEX A;  1WHV A;  1R43 A;  2QMU B;  1JLG A;  3UCZ P;  3R5D A;  4WU3 A;  2XNQ A;  1HMV A;  3VHQ A;  4JI4 F;  2RRN A;  2HMI A;  5EN1 A;  2DHG A;  4ZKA A;  1QY7 A;  2KDO A;  2KTQ A;  1QAY A;  1IKV B;  4CT9 A;  2DNN A;  3G6V A;  1HIY A;  4ZPD A;  4I64 A;  2QN6 B;  4KIA A;  4LFA J;  3L7O A;  1JKH A;  1X5O A;  2R2R A;  3DHX A;  5HVH A;  4FBU A;  1QJH A;  2HZC A;  5HLF B;  2JEF A;  3ULH A;  2XWY A;  3FUY A;  1N48 A;  1GXL A;  5U47 A;  1RZM A;  1X31 C;  2XO7 A;  1IKV A;  2WCX A;  4ZVS B;  3OBI A;  5A8W B;  1KQF B;  4ZVF A;  3O2I A;  3KLV A;  3N4W A;  3C3L A;  2HHW A;  3NNC A;  1UVJ A;  1RWU A;  5B7W A;  1DQA A;  2AJQ A;  5KG6 A;  3IS9 B;  1XNQ J;  2J9D A;  1W2I A;  3AJD A;  4NLV A;  2ASD A;  3P96 A;  5SUH A;  5ADZ A;  5HLF A;  1JJ4 A;  3PIO Q;  1DAR A;  3PX6 A;  5IV4 A;  2UXB F;  4N56 A;  3DLB A;  1S1U B;  2W2Q P;  4DL3 A;  4WYL A;  3QAT A;  2LA6 A;  3K59 A;  5A8W A;  5IWA J;  2QMX A;  4N77 A;  2K8G A;  4ID8 A;  3IC1 A;  4UW2 A;  3WIV A;  3EXY A;  4K59 A;  1WF1 A;  1BWV A;  1GTE A;  3IS9 A;  4LVO P;  2A6M A;  3VGV A;  2W8K A;  1FDA A;  1K8A T;  2IMW P;  1BXN A;  4OMF G;  4RLE A;  4DV4 J;  4ZCM A;  2ZE2 B;  2RJZ A;  4HT5 A;  2P8I A;  4ZVH A;  1S1U A;  3SV4 A;  4GKK F;  2HNZ B;  1S4E A;  1XK8 A;  3D1O A;  4RWW A;  2DRB A;  1G2E A;  4ATN A;  2R7Q A;  2H4Y B;  4G1P A;  4DPT A;  4HI2 A;  3R1L A;  5C42 B;  4DX8 H;  3I32 A;  3VZI A;  2PEH A;  5KFB A;  2CDQ A;  2QL7 B;  2RSQ A;  1JB0 C;  5A6W A;  3W64 A;  2ZE2 A;  1SC4 B;  5ETP A;  2PT0 A;  1R89 A;  2JFK A;  4NLW A;  4DR5 F;  1SV5 B;  2HNZ A;  5KFI A;  2C2R A;  4JI0 F;  5JXS A;  2HQG A;  3JQK A;  2A1B A;  3FQK A;  1JLE B;  3I5A A;  3GON A;  3G4S S;  4ZVU B;  2A0F B;  3DOK B;  4J9K A;  2CKW A;  2V8G A;  3VAM A;  1WEL A;  3CVK A;  3UN3 A;  2HVI A;  3C16 B;  1WC4 A;  3QID A;  3IBW A;  2MLX A;  2QLJ B;  2CJQ A;  1IWG A;  2RHS B;  2E29 A;  1N32 F;  3C6U B;  4DV3 F;  1N54 B;  5KFZ A;  3J81 j;  1JLE A;  2Z0G A;  2G1H A;  4HHJ A;  3RAX A;  1YI2 S;  2RQ4 A;  1X9M A;  4AL5 A;  3DOK A;  2VV5 A;  3HPO A;  2J9D E;  4ZPV R;  4PEO A;  4M94 A;  3GE9 A;  2KI2 A;  4Q44 A;  4ZN1 A;  3C16 A;  1XMQ J;  2WB1 D;  5FJ4 A;  2XB2 D;  4ZLJ A;  2WZ1 A;  3JAM U;  3C6U A;  3DFE A;  4ZVT B;  1NLK L;  3ZO7 A;  4WPA A;  1VDH A;  5ETM A;  4K4S A;  1VQP S;  4J9L A;  4JI4 J;  3R97 A;  1CVJ A;  2XHC A;  5LT5 A;  3W65 A;  2IA6 A;  3HFV A;  2M9K A;  2Z8Q A;  4OX7 A;  4DCP B;  3I0R B;  3GIL A;  2OJ3 A;  1YJW S;  4ZP7 A;  1SH3 A;  3CDA A;  3MR6 A;  1F3V A;  4M5N A;  4BLG A;  3FFI B;  2AV5 A;  2DT9 A;  4YB1 P;  5KFU A;  1FEE A;  1HI0 P;  3CE8 A;  5J1P A;  4WXO A;  1T9U A;  1P27 B;  1RAH B;  4NPO A;  5F9L A;  4ZVO B;  4DV0 F;  2VFV A;  3I0R A;  3CDB A;  3QNW B;  2ZH2 A;  3RB4 A;  1CG2 A;  1U4B A;  2FZG B;  2GW8 A;  3K8W A;  1UA0 A;  3PO5 A;  1VQM S;  4PR6 A;  3FFI A;  3M8Z A;  3B6B A;  2H5J B;  1O8B A;  2CNN B;  4HR2 A;  2UXB J;  1FJC A;  2QE5 A;  2UVR A;  2QFI A;  2N7Y A;  2CNL B;  1CJU B;  4ER8 A;  3UR3 C;  2VFS A;  4TVA B;  3H5S A;  4A46 A;  1HWK A;  2VPY B;  4P6Q A;  3JQJ A;  3OR1 B;  3OFG A;  4KHP F;  1TL7 B;  2I9S A;  2EEY A;  3TAP A;  4I2P B;  1WI8 A;  3FVY A;  4B9V A;  2MZS A;  4C8K A;  3CMQ A;  4M5J A;  4ZCI A;  3UDL A;  3DI6 B;  4GKK J;  1CJU A;  2LEP A;  4DFJ A;  1FD2 A;  3KJV B;  4CO3 A;  2MZR A;  1RBA A;  2MQP A;  2ZWP A;  2AJ2 A;  2ZH9 A;  3UVJ B;  3OR1 A;  2EPI A;  2IYI A;  4W98 A;  2IVY A;  2M8D B;  1XBW A;  4I2P A;  1PJ7 A;  3R8Y A;  4Q8E A;  1WF0 A;  1LFW A;  2N7C A;  1FCA A;  2E5H A;  3ENQ A;  1GK8 A;  4UZB A;  1CJK B;  1OSC A;  2CAJ A;  1GXU A;  1DHM A;  3DI6 A;  3D6F B;  3GV8 B;  4DR5 J;  3MWB A;  2IAJ B;  3KJV A;  1SJR A;  2HGL A;  2BOA A;  2FJB B;  2A18 A;  2YWK A;  4JI0 J;  4DR1 F;  1TKX B;  4X4Q A;  3HKW A;  2WOM B;  2KO1 A;  2QL9 B;  3UVJ A;  4LF7 J;  5CYQ B;  2BM0 A;  3KYL A;  5HVG A;  2R2S A;  1RCX B;  5ETS A;  1N0V C;  1GX5 A;  3OVA A;  3BJY A;  1H7X A;  4J91 A;  1YG0 A;  1IVZ A;  4EWT A;  3RBX A;  3U1M A;  4FYD A;  1RWP B;  3R27 A;  1CJK A;  2F40 A;  3BDP A;  3QT8 A;  3CCL S;  2IAJ A;  1N32 J;  3EGW B;  2YTC A;  4DV3 J;  1TKX A;  2WOM A;  2FDN A;  2O01 C;  5CYQ A;  1WC1 A;  3PFE A;  3CD6 S;  4WZQ A;  2FUG 9;  1D9D A;  2RIL A;  5HVF A;  2DRD A;  2Z2L A;  2ZM6 F;  3D0H E;  3QQC D;  2KH9 A;  4OJ1 A;  2ZNY A;  3DLL Q;  2CQ2 A;  1C0T B;  2HGN A;  2JC1 A;  5IT9 Y;  4KPY A;  3Q22 A;  3BGU A;  1VIO A;  3FEY B;  4FYX B;  2WVC A;  2VG6 B;  4A8O A;  1KP6 A;  2MEW A;  1REV B;  1RWM B;  2DIS A;  2EFP A;  3H5Y A;  1PIL A;  5L1I A;  4Q2M A;  2DH7 A;  3MTK A;  1P9Y A;  2FHJ D;  3P8B B;  3A8E A;  3F73 A;  1C0T A;  3W2W B;  3ZTP A;  4DFP A;  1ZPW X;  1LWC B;  3DRR B;  4YHH J;  1GTH A;  3QZ7 A;  2JFD A;  2VG6 A;  3W1Y C;  3Q83 A;  3BO2 A;  1S59 A;  1A9N B;  2R8I A;  3TQ1 A;  4F4K A;  1XJW B;  4PG7 A;  1NM2 A;  1S10 A;  4DL6 A;  3NKY A;  1S0O A;  4K4V A;  4NZ0 A;  1REV A;  4DWI A;  2DR8 A;  3OJS A;  4IOA Q;  2XMA A;  4U8V A;  2ASY A;  1NSP A;  4Q8F A;  1X4D A;  4USK A;  3W2W A;  2HK2 A;  5IQ6 A;  3AD9 C;  1TV6 B;  3LGH A;  2ACY A;  2AEJ A;  1LWC A;  2F9J A;  2I0X A;  3KTQ A;  3PYD A;  5A2Q U;  8RUC A;  3Q8S B;  1JMT A;  4Z7Y A;  3CUN A;  1HD1 A;  1LWF B;  3GQC A;  5LM7 E;  1HBN B;  4DR4 F;  1Q79 A;  2AKW B;  3FSY A;  3W9J A;  2UZA A;  1Z4U A;  2ZBQ A;  2ADB A;  3K89 A;  2R4F A;  1U47 A;  5D3G B;  1BQN B;  2G2Z A;  3BN4 A;  4I7F B;  2R2T A;  3DDK A;  4KHP J;  2R8G A;  4DFM A;  1TV6 A;  4Y34 A;  2HHT A;  1X4B A;  1ZAW A;  3TWZ A;  3MUM P;  3R5C A;  5L39 A;  1GXT A;  1UPM B;  2V94 A;  2F65 A;  2FYX A;  3PIP Q;  1KLN A;  1KR4 A;  1LWF A;  3MDF A;  5MAO A;  1HBN A;  2RQM A;  4X4O A;  3J7A 1;  2W1B A;  2OPR B;  3SSR A;  4HYK A;  4DX7 A;  2R7T A;  2IBO A;  3CC7 S;  5D3G A;  1BQN A;  2EKN A;  3DM2 B;  4I7F A;  5EWF A;  4WFZ A;  1NK6 A;  2AF6 A;  3GJQ B;  4O0N A;  2HVH A;  3OTO F;  2ALZ A;  2MMY A;  4J7C A;  3Q8P B;  4EZ6 A;  2IM2 A;  2C3M A;  4L74 A;  2KXH A;  4ECU A;  1Q7Y T;  3OQ2 A;  4HTJ A;  4J90 A;  3UD3 P;  3DHW C;  3LAK A;  4ZIT A;  5THW A;  3V6J A;  1ZTW A;  3D67 A;  1B0V A;  4OZ1 A;  2E5J A;  2OPR A;  4DR1 J;  5BXI A;  3DM2 A;  3EVW A;  1DAX A;  1V3R A;  4DU8 A;  3PVX A;  2XMM A;  1NH7 A;  3DRX A;  2HQF A;  3NAI A;  2VUG A;  4CM2 A;  4IH6 A;  1GFW B;  3D28 A;  1ZA1 B;  2W2N P;  5D0G A;  4K4W A;  2J76 E;  3GPA A;  3B54 A;  3RB6 A;  1X9S A;  5E3Q A;  2QA4 S;  4DPW A;  1AXQ A;  3EX7 B;  3CCV S;  3J80 U;  2DY9 A;  2CJ9 A;  3GIR A;  4KHR A;  3RTV A;  3CCS S;  3H42 A;  3PJ9 A;  2BM1 A;  5I3Q A;  3TUZ C;  4EUV A;  1G6B A;  4KSE B;  2MXY A;  2ZZT A;  2ZM6 J;  5FD1 A;  4M95 A;  1RWO B;  4FVM A;  2ATC B;  4G65 A;  1K1S A;  1FKP B;  2HVD A;  4OYP A;  2X51 A;  4B3S F;  2VDI A;  5ETR A;  5I3U B;  5KFN A;  3DDN A;  2FC8 A;  3D6H B;  1R0C B;  1U1Q A;  4IO9 Q;  2MTL A;  2NUU G;  2WVB A;  4F0K A;  2L08 A;  2B4V A;  4G1Q B;  1H6K X;  4F0M A;  4M1K A;  1BQM B;  4OYX A;  5AT1 B;  1Q8K A;  4YP3 A;  1HI8 A;  3D7S B;  1KON A;  1VIS A;  2DO4 A;  3V6K A;  3TAN A;  4D3H A;  1FKP A;  2JLE A;  1IM4 A;  2Y8W A;  3DRY A;  4ED3 A;  1YRX A;  2E66 A;  4ED5 A;  3IG1 B;  5K8N A;  5I3U A;  4M63 A;  1A7G E;  3GU0 A;  3CED A;  1RU1 A;  3DMJ B;  5IM0 B;  1JLF B;  3O44 A;  4RWX A;  3K2Y A;  3Q86 A;  1WUU A;  1QTM A;  4G1Q A;  1BQM A;  1LK5 A;  4NML A;  3MM9 B;  1KBR A;  1ZM9 A;  1F9F A;  4KGX B;  3CCZ A;  1P8G A;  4PKD B;  3NY0 A;  4NZ7 A;  4TKT A;  4V19 X;  3DMJ A;  5IM0 A;  1JLF A;  3V5R A;  3P5B P;  4DR4 J;  3LAL A;  2WSC C;  2XI2 A;  4PPZ A;  2GV1 A;  2YWE A;  4C48 A;  3IMQ J;  4K0K F;  1CUL B;  3MM9 A;  3W9I A;  4LSL B;  4ED2 A;  9ATC B;  2C28 A;  1RAI B;  3TAR A;  1IR1 A;  1AZS B;  3KUH A;  3SSQ A;  3IM9 A;  2KZZ A;  3M8P B;  3PDN A;  1HHS A;  4CIO A;  4UZC A;  4G6V B;  5CZV A;  3I82 A;  4A8X A;  2MGZ B;  2CQI A;  3OLB A;  5LSO A;  1JQG A;  2JOQ A;  4PRF A;  3NG8 A;  2AJ4 A;  4OIX A;  1X4H A;  3LO3 A;  3BSC A;  3N6N A;  3FNN A;  4C8O A;  1CUL A;  2QEX S;  5F8M A;  4I6W A;  4LSL A;  3OTO J;  3KG4 A;  2A10 A;  1NME B;  3TW0 A;  2VOP A;  1V5V A;  1NDL A;  1AZS A;  5KG4 A;  2GGP A;  3M30 B;  3TAQ A;  4MK9 A;  3M8P A;  2PFD A;  4USJ C;  2GO8 A;  4LBI A;  3ZTQ A;  1H73 A;  3OR2 B;  1TAQ A;  2MB0 B;  2MGZ A;  4LF5 F;  2DPI A;  2ZH8 A;  5DM6 Q;  2L9N A;  4O3P A;  4OQJ A;  3JTN A;  3G8Q A;  1N52 B;  2HBY B;  4IH7 A;  2YNG B;  5H9E K;  3SCJ E;  1AB8 A;  3IBF B;  2VBW A;  2OP5 A;  3M30 A;  4QR0 A;  1DTQ B;  1MWY A;  2KT3 A;  3D0G E;  2P9E A;  1NCL A;  2CVI A;  1FO1 A;  2B4U A;  2OEM A;  3HI9 A;  1YJT A;  3OR2 A;  1X5T A;  4LQ9 A;  2HLU A;  3JAM Y;  3PJX A;  3MR7 A;  4F4Z A;  4OI0 A;  4U67 Q;  4DZ6 A;  1C4A A;  4QYZ K;  2D1C A;  1KVK A;  2ZJQ Q;  1CJT B;  2KG0 A;  2CG8 A;  2YNG A;  3CIZ A;  1FDD A;  2R7R A;  2EWH A;  1DTQ A;  5J1N A;  2EW9 A;  4NYP A;  5DDP C;  3IWL A;  4DS5 A;  2V2V A;  5GVQ A;  3PW5 A;  4B3S J;  2LYV A;  3VTI A;  2E1P A;  5KFG A;  4CZC A;  2UUB F;  5B08 A;  2RQC A;  4JI2 F;  4X4T A;  1IWA A;  1CJT A;  2Q6C A;  1Q78 A;  3MPD A;  1R27 B;  5CHC B;  2IA0 A;  1XQI A;  4WK1 A;  2HS4 A;  5J2M A;  4CO1 A;  5LJ5 Y;  4RW7 B;  3CD7 A;  2W9C B;  3OLA A;  4ECY A;  1RBL A;  3AD8 C;  2GQ2 A;  2AYB A;  1GAO A;  4NCA A;  1CEZ A;  1URN A;  2M2B A;  3MPW A;  2C2Z B;  2EFO A;  5DZ7 A;  3ENV A;  3M7V A;  4J9S A;  3SCL E;  5GAG U;  3MEE B;  2FZK B;  1QUP A;  3KDN A;  2BA9 A;  4YDD B;  5E0O A;  4OI6 A;  4PXB A;  2QJ3 A;  2DJW A;  5D0R A;  2W9C A;  4C4W A;  4EMD A;  3F41 A;  3GCX P;  1PBA A;  3FEX B;  3CCW A;  3CJS A;  2DNY A;  4QW8 A;  5DLG A;  4I56 A;  3HM9 A;  3QT6 A;  1I3O B;  4LBP A;  2N4D A;  3MEE A;  1S6U A;  4F50 A;  5L1K A;  5D4L A;  2KHD A;  2D7S A;  4O3Q A;  3LA0 A;  1SJ1 A;  1NHU A;  4LRF A;  3HVA A;  4DUY F;  2OTL S;  2AJF E;  4Q2L A;  5HMZ A;  2B6A B;  4WKY A;  2E9R X;  4K0K J;  2DGT A;  4ZCL A;  1ZA2 B;  2ZD1 B;  1YWX A;  1YBA A;  3PX4 A;  4FN5 A;  2W4D A;  3BKU A;  3I56 S;  4DV7 F;  4PXD A;  2W2O P;  3EMT A;  3D9B A;  3AAW B;  1HD0 A;  1RT7 B;  2BX6 A;  4I68 A;  1R8P A;  4NLU A;  2C3P A;  3CCJ S;  2ZDO A;  2B6A A;  2K06 A;  4H4O B;  2BJ1 A;  4HI1 A;  1YX2 A;  1TTH B;  2DNL A;  3CO9 A;  1N0U A;  4O3S A;  2IHR 1;  1H2T Z;  3QSI A;  2ZD1 A;  2JEJ A;  3V4I B;  3LWL A;  2AU0 A;  4FZV A;  1N5Q A;  2U1A A;  4FYV B;  1TL4 A;  3GIK A;  2CPJ A;  2MLZ A;  2H5E A;  3RBD A;  3CIM A;  3QFW A;  5KFX A;  3UDV A;  1S77 D;  2RDJ A;  1RT7 A;  1IN0 A;  4LF5 J;  2M8H A;  2FHK A;  4H4O A;  3KUE A;  1RT2 B;  4ECZ A;  1IKY B;  3V4I A;  4I4B A;  4GVL A;  2HG4 A;  1F5C A;  2CXE A;  4Y6I A;  5T7L B;  2N3L A;  3KLH B;  4ZLL A;  3DLH A;  4I67 A;  5KFL A;  3A3N B;  1FRJ A;  4J9Q A;  2PA3 A;  4KAI A;  1UVI A;  3QGI A;  3GWC A;  1MMD A;  1RT2 A;  2KT2 A;  5GAD I;  3PR5 B;  4AL6 A;  4OI1 A;  1Z1Z A;  3OL7 A;  1IKY A;  1AT1 B;  4U8Y A;  3DDI A;  3TYT A;  2Q43 A;  4CO2 A;  5T7L A;  3KUG A;  3KLH A;  4AD6 A;  2WSF C;  4K7Q A;  2HBZ B;  2F5G A;  3B4D A;  5EWE A;  4WCE Q;  3E2E A;  3VAF A;  2HVE A;  4CLU A;  1I1G A;  1QSL A;  5IC4 B;  4TU8 A;  1HW9 A;  4DR6 J;  2UUB J;  4RW6 B;  2DR6 A;  3KHL A;  4DHV A;  4ETX A;  2QIF A;  4F25 A;  4JI2 J;  1FTC A;  2BXJ A;  2WB4 A;  1VRQ C;  2CQ0 A;  5HJY A;  4HEA 9;  4RU2 A;  3BSO A;  3PEJ A;  3KHH A;  2XBP A;  4YEA A;  4TLR A;  3R5J B;  2GC8 A;  4K4Y A;  5KG5 A;  4LF6 F;  3FGV A;  1OJ4 A;  2B8Q A;  4X4V A;  2E9Z A;  2BE2 B;  1UAW A;  1YJ9 S;  4RW6 A;  4L76 A;  3MR2 A;  3SCK E;  2IDE A;  5FII A;  4TNO A;  1GNK A;  4ZHR B;  5A2Q Y;  1RWN B;  4DX6 A;  3AHP A;  5D8H B;  3OVS A;  1S9F A;  3NLC A;  1A6L A;  2LQ8 A;  2MQN A;  1MRO B;  4U7C A;  2XHW A;  4QWD A;  3Q0A A;  2QLW A;  3H0P A;  1PC4 A;  1V5I B;  2BE2 A;  1SH0 A;  2AHO B;  4DJB A;  3N6L A;  1S6Q B;  5CAA A;  1T03 B;  3MOJ B;  2LEA A;  2L48 A;  4F3O A;  3ENA A;  2ZUA A;  3CJ3 A;  4FPI A;  5LSR A;  4LSZ B;  4ZHR A;  2BJ8 A;  3I9Z A;  5ETK A;  2AX0 A;  4GRS A;  2WW4 A;  2KN4 A;  3QGG A;  4ZIV A;  1B3T A;  1U09 A;  2B7C B;  4DUY J;  2HHS A;  2I38 A;  1MRO A;  3TR5 A;  4L75 A;  2VC1 A;  4QYR A;  2OPQ B;  1FT8 A;  5H1S V;  3GG0 A;  2XZT B;  4P52 A;  1S6Q A;  4B02 A;  1ICE B;  1NKB A;  3G6Y A;  1T03 A;  4O23 A;  4NE9 C;  1NPR A;  2FJE B;  5CYJ A;  1KTQ A;  1V9O A;  1JNR B;  3EZO A;  1HNW J;  4ZMM A;  2CPD A;  4DV7 J;  1WKJ A;  5KFQ A;  1YRU A;  5KT3 A;  3M9O B;  1U45 A;  5E3A A;  5DZ6 A;  1T9W A;  3M8W A;  5D6G A;  2PII A;  2YXL A;  2W9A A;  1LOU A;  4JP8 A;  3BBC A;  4CH7 A;  4DS4 A;  3VVT A;  4URG A;  4J9P A;  1F2G A;  3DLE B;  3H7H B;  4NI2 B;  2OPQ A;  2Z56 B;  3OTB A;  3TUP A;  5HK4 A;  3BH6 B;  4OX8 A;  3QLH B;  1LV5 A;  3M6W A;  4P7V A;  3ENW A;  1O5J A;  3EGZ A;  3L9Z A;  1ZTT A;  5AJ3 F;  1TL5 A;  1T9V A;  1A0O B;  2VJV A;  3HSG A;  1NSA A;  2EBG A;  2FVP A;  2GJI A;  2XY7 A;  3KMS A;  1DTT B;  2HPU A;  3DLE A;  4OYI A;  4NI2 A;  3RB0 A;  3J80 Y;  3QWP A;  3ETM A;  3QLH A;  4OL8 A;  3A1Y G;  1WHX A;  3RBE A;  1WTF A;  3HHD A;  3ET6 B;  2MKS A;  1LXN A;  1VQN S;  4O4R A;  4LR9 A;  4RUH A;  5HAN A;  5DG9 A;  5JVG Q;  2FJV A;  2Z4P A;  1WG1 A;  1KS2 A;  5SZT A;  2ZFH A;  1TAU A;  2V4Q A;  1DTT A;  1CLF A;  4JV0 A;  3GCW P;  4J37 A;  1RA6 A;  4DQP A;  1RWV B;  4DV1 F;  1ZM3 A;  4C6A A;  4UOF A;  2OO4 A;  3H90 A;  2O66 A;  2DEI A;  3ET6 A;  3RJM B;  2IYG A;  4TQS A;  3BGL A;  1MLA A;  5HAO A;  4ANC A;  2JEG A;  4B3T F;  1AUS L;  4E8U A;  1GMV A;  3N5F A;  4NXM F;  2XMK A;  4FYY B;  4AXJ A;  3HCX A;  3M8Q B;  2GVD B;  3PO4 A;  2DHA A;  3A12 A;  5KOX A;  3I0S B;  1VJQ A;  4H4M B;  1L3V A;  4ZP9 A;  3CJ8 A;  4E98 A;  2AWZ A;  4LF4 F;  1NH8 A;  2RML A;  1EZZ B;  2JJ4 D;  4ICL B;  1VI7 A;  4OZ0 A;  2L41 A;  3PY8 A;  4HAC B;  4LF6 J;  4F8R A;  3NNA A;  4R0J A;  1C2P A;  3F44 A;  1FI4 A;  3M8Q A;  2GVD A;  5D0E A;  5FDL B;  3I0S A;  3M6X A;  4H4M A;  4LSN B;  4M5K A;  1C1C B;  3OXG A;  3AOB A;  1SKS A;  3CME S;  4ICL A;  3ITH B;  3B8H A;  1S48 A;  3NGK A;  3UDE A;  4HAC A;  4YR0 A;  3D2W A;  3G9C A;  2HQD A;  2GQQ A;  2PMH A;  4P10 A;  3VAI A;  1PJ5 A;  1ULR A;  4ID5 B;  1EKR A;  1TZ0 A;  3GTY X;  3HUL A;  2BW2 A;  4UY8 T;  5FDL A;  4LSN A;  2ROP A;  4B3R F;  3BYR A;  1C1C A;  4DF4 A;  5K9F A;  5KG1 A;  5LMN F;  1FE4 A;  3ITH A;  2PGC A;  1NK5 A;  1UVK A;  3BQ2 A;  4B9T A;  1X9W A;  2GVZ A;  2YQ0 A;  5L46 A;  4M5G A;  2DGV A;  1SL2 A;  2I5J B;  4ID5 A;  4EBE A;  4A48 A;  3RB3 A;  4OYM A;  3FMB A;  4HLB A;  1XMB A;  1NK8 A;  3FCV A;  1G1X A;  1Q5Y A;  3B82 A;  4B17 A;  1MNE A;  5D78 A;  1NEE A;  2VBZ A;  5E7O B;  3NAH A;  2EXU A;  4NRT A;  1YGY A;  3G96 A;  2AZ3 A;  3HHK A;  3UNG C;  2I5J A;  3AJ1 A;  3ONQ A;  3S7R A;  1SJQ A;  4X4P A;  2LFV A;  4UQT A;  4U7U D;  2FVC A;  5AJ3 J;  3HO1 A;  4ZA1 A;  3HHL C;  3P3D A;  4M5H A;  5GMK a;  1TL3 B;  1FKA F;  2JRS A;  2E1R A;  4EYI B;  1VQO S;  3MI7 X;  4YY3 F;  4FDF A;  4A8S A;  1O0P A;  4F04 B;  4QQB A;  1Q7L B;  4DQR A;  1SJ4 P;  1R0A B;  2GS8 A;  2Y1L B;  4CCH A;  3N28 A;  2Z2M A;  2J6T A;  2VDH A;  3QGH A;  4C0O C;  3FZ2 A;  1URR A;  5F3T A;  4CLW A;  2PMW A;  4UOC A;  3KLF B;  1ZZF A;  1RI7 A;  4DFK A;  1XR7 A;  3EZ5 A;  2KRB A;  1YJV A;  2BRL A;  2XG8 A;  2VPW B;  1TL3 A;  2ZVS A;  5T41 A;  1U6B A;  1NDK A;  2MQQ A;  2CPI A;  2F1F A;  3O8W A;  3OXF A;  5T14 A;  3SZ2 A;  1JXV A;  4IG0 B;  1OY6 A;  3J7Y I;  4FS2 A;  2NRE A;  2CQ4 A;  1R0A A;  4DV1 J;  1BHN A;  4PPD A;  1RT6 B;  3T5K A;  4ALZ A;  1RWK B;  3AH6 A;  4NLG A;  4EO8 A;  1NKC A;  3KLF A;  3LP1 B;  3T3F A;  1BWE A;  3Q89 A;  3CCT A;  4W92 B;  3RUB L;  3D1Q A;  5K8O A;  4USH A;  2HNY A;  2YPY A;  3GYG A;  1D0E A;  2Z57 B;  4IOB A;  3VAK A;  3ILO A;  3DLJ A;  4OFZ A;  2CJX B;  4B3T J;  4IG0 A;  2RE1 A;  3QO9 B;  4NXM J;  2I1R A;  1Q82 T;  4XPC A;  3J7Z T;  1QE1 B;  2HIQ A;  1RT6 A;  3CO0 P;  4Y2A A;  3RBZ A;  2VL1 A;  3QMQ A;  3KK1 B;  4LF4 J;  1MU2 B;  3HZE A;  4DSJ A;  2FLL A;  3LP1 A;  2W7P A;  1D8Y A;  1TVR B;  4CO5 A;  1N8R T;  3R5B A;  1B64 A;  2HHV A;  2POK A;  2C2O B;  3UN2 A;  3BR9 A;  3IRW P;  3QO9 A;  2JZ5 A;  2QGF B;  4K2X A;  2PO4 A;  4Z37 A;  4XIU A;  4F4W A;  1C0U B;  1FDN A;  3RR8 A;  3L3C A;  1CC8 A;  3KK1 A;  1MU2 A;  7FDR A;  2VQF F;  1AFJ A;  4YOE A;  2ZBC A;  2IPO B;  1TVR A;  2GZO A;  3CF5 Q;  2JH3 A;  5ETL A;  1T9T A;  5JUM A;  4GVB B;  2UUW A;  1TMJ A;  3DGP B;  2IDL A;  3PW4 A;  4F2R A;  4F4X A;  2UUT A;  2ZOF A;  4F4Y A;  4LRE A;  4RKU C;  3NCQ A;  1J5O B;  1I51 B;  2NYH A;  3CDW A;  4W4M A;  2QSF A;  1C0U A;  1T94 A;  2AZ1 A;  3L7U A;  4B3R J;  1M1G A;  2IY5 B;  5HMW A;  3QJP A;  5LMN J;  4ANE A;  4ZVG A;  1NUE A;  4GVB A;  2BZ2 A;  4AT1 B;  3DGP A;  2B4P A;  1PBU A;  1UEU A;  5K14 A;  1J5O A;  1F5A A;  3R7S B;  2H48 B;  1NDP A;  5JVH Q;  2IM0 A;  2JLF A;  4RW4 A;  3PW0 A;  5ETV A;  2OMO A;  2V8V A;  3W7B A;  2GQC A;  4V1A k;  4C98 A;  1RLC L;  3KLI B;  4QWC A;  3KLE B;  1Z2L A;  3LUY A;  5HQL A;  2VD3 A;  4HTI A;  1RQ0 A;  3NMR A;  5KFH A;  2BKO A;  2JDJ A;  5F8J A;  1DFD A;  4MK8 A;  3K5P A;  3S8S A;  4DSK A;  2QFJ A;  2OD4 A;  4NWB A;  2ATL A;  3TQE A;  2NLW A;  3MHY A;  1RBO B;  3GIM A;  1IJF B;  1FJG F;  4YY3 J;  4PXC A;  1NZ8 A;  4FKY A;  3KLI A;  3KLE A;  2QMW A;  4LIW A;  3TA0 A;  4I6A A;  3NEK A;  5KFR A;  4ZDN A;  1P1L A;  4PCQ A;  4NLR A;  5M2R A;  2HIY A;  1T8E A;  3MMC B;  2A6O A;  1WKL A;  1QAJ A;  1VBK A;  3CW2 C;  4LRA A;  2BQU A;  3TX0 A;  4ILR A;  1Y3K A;  1PO6 A;  3UE2 A;  3P45 B;  2LA4 A;  5DLF A;  4XAK A;  4YFU A;  1RTZ A;  4TYA A;  1REG X;  2UVU A;  2CJB A;  1J27 A;  5AXM A;  1VQS A;  3DU5 A;  1VRT B;  4NLO A;  4DPY A;  4M5D B;  1KOH A;  5K8P A;  2AEF A;  3PKY A;  4DL7 A;  4DCJ B;  4MYT A;  2GHV C;  1N5S A;  3W5Y A;  6FD1 A;  1S79 A;  1TR0 A;  4DN9 A;  4OHW A;  2ZVI A;  1Q16 B;  2YWH A;  2PFF B;  4DPO A;  3DOM B;  1MN9 A;  2QZ8 A;  4C2M A;  2HZA A;  5AE1 A;  2X3D A;  1W25 A;  4PWU A;  2IC3 B;  3RGI A;  2V69 A;  1S57 A;  2Y1R I;  1VRT A;  3K5O A;  3WZ0 A;  4M5D A;  2ZNZ A;  3PHT A;  3FJ2 A;  3EE3 A;  3ISN D;  3ZZT A;  4CI0 B;  2UV8 A;  3H2U B;  1RCO B;  2PA8 D;  2NZ4 A;  3DOM A;  4CYU B;  1VQ5 S;  3FQL A;  1S7H A;  5JMN A;  1RKI A;  2IC3 A;  1FK9 B;  3AT1 B;  3ILI A;  3OVB A;  2XZD B;  4DV2 F;  3NL0 A;  3ILL A;  2GHP A;  3NS6 A;  3ZNJ 1;  5CH7 B;  4IR1 A;  1RWX B;  1K73 T;  2VFT A;  2DKO B;  1O51 A;  2VQF J;  3PR4 A;  4FNI A;  2ZC3 A;  2GFF A;  3O1L A;  3QWU A;  2D3O 1;  1XNR F;  1M5H A;  4CYU A;  2FGC A;  4ENO A;  3KJF B;  2NS1 B;  2GMJ A;  3RAM A;  2OLW A;  2BJ9 A;  1XER A;  3JTO A;  2RF2 B;  4ZPA A;  4HVZ A;  1T7P A;  4I69 A;  3UQS A;  5CD4 A;  3WC2 A;  1FDB A;  1QAI A;  4UQG A;  1FRK A;  4RBU A;  3SMZ A;  2H9Z A;  5GAE I;  3TJ8 A;  4Y65 A;  3FKB A;  2FQQ B;  1VQL S;  1GMW A;  2OML A;  2DNO A;  4OHV A;  2IBK A;  2DCL A;  1TKD A;  1YDL A;  3KK3 B;  1M0S A;  5HJX A;  2KB2 A;  4RZR A;  3OPK A;  1RT3 A;  2G0C A;  4USM A;  5AXN A;  3VQS A;  1WTB A;  4IFV A;  4OYA A;  1JLC B;  1OWX A;  1IJE B;  2RF2 A;  2RHQ B;  1VLO A;  2KL8 A;  3V6D B;  1BGX T;  1KRP A;  1YIJ S;  3W8G A;  4IRK A;  1UJ5 A;  3KMQ A;  3BSN A;  5GAD U;  2MYF A;  3LTO A;  3Q24 A;  3SCI E;  1KNZ A;  4FKX A;  4Y2K A;  1R7I A;  3MEG B;  3NRB A;  3WDO A;  3KK3 A;  2GX8 A;  3EM1 A;  2ZZM A;  2K2P A;  2EFN A;  3HFZ B;  3IRX B;  1UFL A;  4F4A A;  1U02 A;  3GFH A;  3X3U A;  1EAR A;  3TAM B;  1JLC A;  5B0G A;  2X3G A;  4QIG A;  2YKM B;  2PN6 A;  3V6D A;  2XQC A;  1F5B A;  4HHH A;  3FEZ A;  3R5G A;  3HVR A;  3A13 A;  3DN9 A;  2YH1 A;  1C1B B;  1UKU A;  1SCJ B;  1FJG J;  5CQG A;  2YVS A;  4B9S A;  3DCA A;  4ERD A;  2EC2 A;  2DTJ A;  3MEG A;  4DR2 F;  3RAQ A;  1DQ9 A;  1UPP A;  2DBB A;  1N4L A;  1U8S A;  4MH8 A;  3IRX A;  1N36 F;  1EQM A;  1LK7 A;  2R8K A;  2YX7 A;  3TAM A;  3ZZZ A;  1U0S A;  1UW4 A;  1M5K C;  1FXL A;  2YKM A;  1H2V Z;  3IBC B;  1W26 A;  1SPB P;  1PYS B;  1C1B A;  2OH2 A;  2VAS A;  3D3C J;  2RT3 A;  4NLP A;  3MXH P;  4K8R A;  2D69 A;  1U26 A;  3A4T A;  2VQE F;  3ZFV A;  1L3S A;  4RNH A;  2YQ1 A;  2HQC A;  1TKZ B;  1WKK A;  2M52 A;  3I6P A;  2HHQ A;  3MFH A;  4ILM A;  1RYR A;  3B78 A;  2VIC A;  1UEK A;  1R8A A;  4FBT A;  3NS7 B;  2UXC F;  2Q79 A;  3I4H X;  1S72 S;  2EI5 A;  2OAU A;  4K2J A;  1QUV A;  2X1A A;  1ZPV A;  1I94 F;  3IA0 A;  2EVZ A;  2QLB B;  1OQ3 A;  4CLK A;  5AXK A;  2ILZ A;  1TKZ A;  3KK2 B;  4C97 A;  1NJI T;  3TJA A;  2EG1 A;  3J81 U;  2C2K B;  4C7Q A;  1SJ3 P;  3T9Z A;  4C8Z A;  3TNV A;  2X1G A;  3PYG A;  3G87 A;  4DL0 C;  1NB7 A;  3POT A;  1KTV A;  2FC9 A;  2HWT A;  2N4C A;  4ETZ A;  3CB4 A;  3OXL A;  2KXF A;  4QBU A;  1SKU B;  3QJJ A;  1HHQ A;  3M6V A;  4OV1 A;  1ELO A;  4DV2 J;  3VGT A;  2QC3 A;  2OEK A;  2NSC A;  3KK2 A;  4F02 A;  3D0I E;  4BC9 A;  1IKW B;  3C2P A;  4J9R A;  2DH8 A;  2K7J A;  1VFJ A;  3CCE S;  3TVZ A;  3K5M A;  1XNR J;  3NP5 A;  2V0N A;  2Y1J A;  4AUK A;  1HNV B;  2G0J A;  5CA5 A;  3CJ0 A;  1S9G B;  1T02 A;  1X5P A;  1NJX A;  1V6H A;  4R8U B;  2OFH X;  3BYP A;  4A47 A;  2RU3 A;  3LP2 B;  2VZ9 A;  5I3P A;  3U27 A;  4I2Q B;  1IKW A;  4IG3 B;  4QWB A;  1NAQ A;  3OHB A;  3TVY A;  4K5R A;  5GAG I;  1PG5 B;  1HNV A;  1WOS A;  5JJB A;  4ZOS A;  2HGM A;  5CAB A;  2R2U A;  1S9G A;  1S97 A;  1U1K A;  1PC5 A;  3QRP A;  1FD8 A;  5F9N A;  2LDI A;  2CNO B;  4R8U A;  3IWX A;  4HT7 A;  1U1R A;  2HEK A;  2FVS A;  3LP2 A;  4DR7 F;  1HWJ A;  2NXJ A;  4EEY A;  4I2Q A;  4OYW A;  4YB6 A;  4IG3 A;  2ASL A;  3CD5 A;  4PYD A;  4N5S A;  1Z2Z A;  4LRC A;  1LW2 B;  4LF7 F;  2HYI B;  4QWE A;  4Y2I A;  1UW9 A;  1T9Y A;  5E3P A;  3FBB A;  1F9E B;  3C8Y A;  3ZZO A;  5IOL A;  5EX0 A;  4OZ5 A;  5DGA A;  2QA1 A;  1UZD A;  4MKB A;  3EDQ B;  4IYQ A;  4KH0 B;  3JQM A;  1F2H A;  5A0Y B;  2RRB A;  1HR0 F;  3SYZ A;  1ZOT A;  4DR2 J;  1LW2 A;  5A6P A;  4M5L A;  1N36 J;  4O0I A;  3H2L A;  4ECV A;  2LVW A;  4EI2 A;  3M2U B;  4ECT A;  1RTI B;  1KQK A;  1IR2 A;  4NAS A;  2LLZ A;  1BY9 A;  2OGU A;  4ED6 A;  2W4P A;  5A0Y A;  4UF4 A;  5ETO A;  2J0W A;  2XCA A;  1X4A A;  1SVD A;  1IBM F;  5I42 B;  1RAJ A;  3AOD A;  4DR3 F;  2C42 A;  3MED B;  2VQE J;  4UST A;  2BJE A;  3H98 A;  4LRB A;  3BPS P;  4USW A;  2J7U A;  1ZZN A;  1K9M T;  4JV5 F;  1SH2 A;  3IFE A;  2ZH5 A;  3M2U A;  4MJK A;  4CLF A;  2HHP A;  3LGN A;  1RTI A;  3UN5 A;  1H74 A;  2VB6 A;  2YH0 A;  1RHM B;  3NCP A;  1TUG B;  2UXC J;  1SQG A;  2LKZ A;  5CCL A;  1HBO B;  3PAC A;  3PEH A;  4KYZ A;  4KHM A;  1I94 J;  5I42 A;  2P2C B;  2R8J A;  3MED A;  1NPK A;  4YHH F;  4ZVE A;  3OJU A;  1CJV B;  1NND A;  2H4W B;  2MZJ A;  4K4U A;  4MKV A;  1DLO B;  2X7I A;  4JI5 F;  4F7V A;  1UP1 A;  2AGQ A;  3KFW X;  1UA1 A;  4F3M A;  3T1Y F;  4OJH A;  1JJC B;  3GII A;  2OSR A;  3D66 A;  2ZH7 A;  4O3N A;  1YRT A;  5ETQ A;  1CQN A;  1HBO A;  2WSE C;  1WHW A;  2RQK A;  5D15 A;  2FY1 A;  1S7I A;  4OI3 A;  1YZ6 A;  3GJS B;  4WFN Q;  1CJV A;  2VKZ G;  2KT5 A;  5A8K B;  1UCN A;  4JI6 F;  1DLO A;  1CQM A;  1VJW A;  1B4S A;  4H54 A;  1E6V B;  2ZKU A;  4L73 A;  2QTW A;  2Z58 B;  3R9L A;  4PXE A;  3O5T B;  2OEL A;  3CWJ A;  4DQI A;  2V2K A;  2ZBI A;  2XY6 A;  4EU0 A;  2DGW A;  3CT9 A;  3M2V B;  1NJW A;  5A8K A;  1RK8 A;  2NUH A;  1OPI A;  3MPV A;  2GNK A;  3AA9 A;  1SBR A;  4JI1 J;  4PQU B;  1E6V A;  1YZ7 A;  1Y10 A;  1UJ4 A;  2LU2 A;  5LXR A;  2BAC A;  3QJL A;  2FIU A;  1PAU B;  4RNM A;  1WEZ A;  1T05 A;  2QA4 G;  1RYS A;  2CQ1 A;  2ADC A;  3M2V A;  3MMB B;  4C8Y A;  4N47 A;  3J7Y U;  2RNE A;  4DR7 J;  3U02 A;  2QA2 A;  3T5J A;  1U48 A;  5GMD A;  3G6X A;  5M2U A;  1UWB B;  4HL9 A;  2IFX A;  5F8L A;  2AP6 A;  2EFG A;  4U9R A;  2EC0 A;  4PQU A;  1U6F A;  4LF1 A;  4J9M A;  3R6L B;  1EJ7 L;  2FHM A;  2J7W A;  1G4C A;  1WOO A;  2IM1 A;  4CO0 A;  5IT0 A;  1S6P B;  1NHV A;  2O5D A;  2CQC A;  2QT7 A;  2ZBP A;  3MMB A;  1HNX F;  2BBE A;  5HAT A;  3US5 A;  4RU9 A;  1UWB A;  1HR0 J;  4ZLP A;  2LU1 A;  2DH9 A;  3NS5 A;  2W8L A;  2LXU A;  3HT3 A;  1YLX A;  5J2P B;  4ED7 A;  1SKR A;  1S6P A;  4KB7 A;  2V34 A;  4G3I A;  3GSD A;  1NSK L;  2FLO A;  2HRT A;  3HHL B;  1IBK F;  4CRJ A;  4WFX A;  3CMA S;  5L9X A;  3K58 A;  1Y5N B;  3UW1 A;  3MM8 B;  4YME A;  5L1L A;  4J9N A;  2EK6 A;  4OYB A;  3CDE A;  4DCO B;  5J2P A;  2KHC A;  1S1T B;  2MKJ A;  1IBM J;  4CT8 A;  4DR3 J;  4Q5V A;  4GMK A;  2XLJ A;  2DIV A;  1F0X A;  2AT1 B;  1QAX A;  3HZG A;  4JV5 J;  1K1Q A;  3HHL A;  5RUB A;  1RT4 B;  2R7W A;  4DUZ F;  4LBH A;  2AGO A;  2CYY A;  4P7T A;  3MF5 A;  2YKO A;  3MM8 A;  2MQL A;  2QV6 A;  4IQX A;  2VHG A; 
#chains in the Genus database with same CATH homology
 3HD2 A;  1TMM A;  1HKA A;  4CYU A;  3ILL A;  3HSD A;  3HSJ A;  2CG8 A;  3KUH A;  3KUE A;  5ETP A;  3UD5 A;  2F63 A;  4PZV A;  5ETS A;  4CYU B;  1RU2 A;  3IP0 A;  3MCN A;  2BMB A;  2F65 A;  3HT0 A;  3UDE A;  4M5J A;  5ETR A;  1RB0 A;  1RAO A;  5ETT A;  3ILO A;  1DY3 A;  4M5M A;  3UDV A;  4CRJ A;  4M5H A;  3HSG A;  5ETM A;  3HD1 A;  3ILJ A;  3MCM A;  1EQ0 A;  5ETQ A;  4M5I A;  1IM6 A;  1EQM A;  4CWB A;  5ETL A;  1RU1 A;  1CBK A;  2QX0 A;  3MCO A;  4M5L A;  5ETK A;  5ETV A;  1F9H A;  1G4C A;  3HCX A;  3QBC A;  3ILI A;  1HQ2 A;  1KBR A;  3KUG A;  5ETO A;  1Q0N A;  1RTZ A;  4M5G A;  5ETN A;  3HSZ A;  4AD6 A;  1EX8 A;  1TMJ A;  4M5N A;  4M5K A;  4F7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...