5ETVA

S. aureus 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase complexed with ampcpp and inhibitor at 1.72 angstrom resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
158
structure length
157
Chain Sequence
HMIQAYLGLGSNIGDRESQLNDAIKILNEYDGISVSNISPIYETAPVGYTEQPNFLNLCVEIQTTLTVLQLLECCLKTEELHRIRKERWGPRTLDVDILLYGEEMIDLPKLSVPHPRMNERAFVLIPLNDIAANVVEPRSKLKVKDLVFVDDSVKRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Selective Binding of Inhibitors to 6-Hydroxymethyl-7,8-dihydropterin Pyrophosphokinase from Staphylococcus aureus and Escherichia coli.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase/transferase inhibitor
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
total genus 44
structure length 157
sequence length 158
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2015-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 5etvA00
4CWBA 2F65A 2BMBA 3HD2A 3UDEA 3HSDA 5ETRA 5ETNA 2CG8A 3ILJA 5ETVA 3UD5A 4PZVA 4M5MA 1TMJA 1RU1A 3KUHA 3KUEA 1HKAA 3MCOA 1HQ2A 3HCXA 4M5LA 4M5HA 5ETTA 5ETPA 1EX8A 1F9HA 3ILIA 3UDVA 1EQ0A 3MCNA 1G4CA 3HSZA 3ILLA 4M5NA 5ETKA 1RU2A 1TMMA 3HT0A 3MCMA 5ETLA 5ETSA 1CBKA 4M5KA 1RAOA 3QBCA 4CYUA 4M5IA 4AD6A 1RTZA 1EQMA 2QX0A 3IP0A 5ETQA 4F7VA 4CYUB 3KUGA 1IM6A 4M5GA 1DY3A 4CRJA 5ETMA 2F63A 1RB0A 1Q0NA 3HD1A 3ILOA 4M5JA 5ETOA 3HSJA 3HSGA 1KBRA
chains in the Genus database with same CATH superfamily
1QVGR 2HG4A 3TZWA 2XTJP 4F3MA 4TY8A 4EFAC 4O44A 1RT2A 4XTTA 3MR2A 3V4IB 4AL5A 3CCJS 4X4NA 3DDIA 1H72C 5CYJA 4F8RA 4MKAA 3M6XA 1EQ0A 1F9HA 3ILIA 1WC0A 2DHGA 1AZSB 2OGUA 3AOBA 1P1TA 4USVA 3W65A 3WC0A 1ZM4A 5B0GA 3JAMY 1FNXH 5AXLA 1PBUA 4J7CA 2LP4A 4DQRA 5KG5A 4RBUA 4JI5F 1LW2B 2YKNB 1UFLA 3J7A1 1AFIA 4NA3A 1EETA 2A6MA 3JSRA 4Y34A 4J9MA 2XY5A 2CAJA 2L08A 3RRGA 1IKYB 1XMQJ 2HRYA 4XPEA 4DV0J 5FJ4A 1YSJA 1WKKA 1M90T 3PIOQ 4IQMA 3W5ZA 1YLXA 3ENAA 1K8AT 4B3RJ 4JB8B 4QWDA 2GVDA 1BC6A 1ZETA 1QE1A 2B9EA 1JMTA 4AL6A 1BWEA 3CCQS 1VYAA 1Y5NB 1IR0A 1CJVB 2H4YB 1IKXA 2E9RX 1HWKA 3ITHB 1HWJA 3GJSB 5KT3A 1BQMA 5K8NA 3QZ8A 1SC1B 2E5JA 1G6BA 1IKYA 4M5LA 6AT1B 2F8MA 4ZVSB 2W9CA 2LQ8A 2YKNA 3A3OB 2JHEA 3BKTA 4DOZA 2L41A 1Q8KA 2K7JA 2V8GA 5IT9Y 4HHUA 4Y0FA 3KWMA 3EICA 4BWMA 3D6HB 4V1Ak 1MMLA 3FRZA 4PG4A 3EDRB 1TUVA 1UA0A 2RH3A 2MKCA 3K2YA 2P6TA 1TAQA 2I9SA 5A6PA 1IBLJ 5JVGQ 3MCSA 5D3GA 1B7FA 2LKZA 2C2ZB 2KI2A 1VJWA 3D3BJ 1U1QA 4ERDA 1TV6B 2CZ9A 2BDPA 2HHTA 2B8PA 3GG0A 1LWXA 2FLOA 5HAOA 4X4PA 3M30B 3CCES 1O6XA 2F65A 2CKWA 1FE4A 4AXJA 4J5OA 3DI6B 1HQEB 4KC5A 1KWMA 3ISZA 2WSCC 3FSXA 4KV8A 4USUA 3ZNUA 5C25A 5L39A 2BR0A 2FUG9 1CJTA 1X9SA 3KUEA 2P9CA 1V5VA 3LGNA 4Q45A 1BMQB 2RDJA 3FVYA 1SV5B 3C6UB 1R8HA 3GIJA 5D0GA 3S6EA 4AL7A 2NREA 1RSCA 5L46A 4X64F 2GAHC 4LF9J 2IBOA 1T9VA 2OEMA 2M3DA 2Q43A 4DN0A 3J7ZT 3HM9A 4DL6A 3FBFA 2YNGA 3LALA 3M6WA 2WRMA 3R5BA 4N7TA 2OO4A 2FHOB 2PO4A 4RUBA 3T6JA 4EGLA 2FJWA 5B0EA 2GHWA 3H59A 3VAMA 4CRJA 1FRJA 4PG8A 3HMJG 4RKUC 3ITHA 3DOMB 2AU0A 1WEXA 3BGFA 1RKIA 3MAAA 1BY9A 3T5HA 3PXGa 1T3NA 3TJAA 4CP5A 4WIQA 1NJZA 1X9WA 2Z2LA 1DLOB 3KLGB 5KFIA 3SI8A 4OZLA 1D1UA 4NLSA 2JLFA 5H9FJ 1TELA 2O66A 1FI4A 2CA9A 3HCXA 3M2UB 2FLPA 3D9BA 2K06A 1K0VA 3DLJA 4NEZA 4RW4A 1RAEB 1UVIA 1S76D 2R42A 4WZMA 4PXEA 4I4BA 5CYMA 2YWHA 2ZWOA 3DYAB 2MJUA 4XDCA 7AT1B 5K8OA 2XYPB 2RKIB 3RR7A 5C42B 5D4NA 1EKRA 1YJ7A 4CM0A 2JL9A 2YY3A 4YS2A 3MEKA 2EBEA 4DL5A 4FS2A 3CJ5A 3R5CA 4LF4J 2C2KB 2XI2A 3MM8A 1NNDA 3K5LA 3OXGA 4Y2IA 1R8AA 1ZAVA 4WJBA 1H0HB 1KEKA 3AJDA 4DX8H 3SQOP 3IWNC 4KKOB 2GS8A 3FEYB 4DR4F 1MROB 3AA8A 1VIXA 1T05B 1RTDB 1XEZA 4FBTA 3C6TA 2L48A 5HI7A 3M2UA 2RS8A 3H2LA 5AT1B 2X1FA 1JJ4A 3JSMB 1U09A 4KTQA 4LBIA 3MECB 2IDLA 3BGUA 1YRUA 3OR2B 4NLVA 4U67Q 1YBAA 3K8WA 3W5XA 2NUUG 2WVDA 4LF2A 4WIIA 3D2WA 3O2IA 1VQ9S 5HATA 2ACMA 1N32J 4MK7A 4W98A 2UXBF 4FVMA 3PX4A 5LMUF 5J1PA 1ZAWA 5LT5A 3L3CA 4M1KA 4ECQA 3GIMA 1QM9A 8ATCB 3RTVA 2HHHF 1CQNA 3R3TA 2UVRA 3OXLA 4NRTA 3T5JA 4LF8J 2YWFA 1NEEA 4L76A 4LUBA 1IBCB 1F2HA 5IT4A 4BHQA 4YQWA 1X5TA 3D6MB 3R7BB 1NH8A 3PX6A 3KMSA 4I0WA 4JOUA 4DPYA 4WKRA 1ROFA 1TL3A 2RE1A 4FKYA 4NLTA 2JEGA 1HBUB 2IA0A 3HHLB 1JLCB 4CLTA 1U8WA 3MR7A 4JI4F 1WOSA 5EX0A 2D74B 2VOOA 4G3IA 3CCSS 4IQXA 1RU2A 4NLRA 2HS3A 2VFTA 3ZTSA 2Y1JA 3AQPA 3PFEA 1HBNB 3THPA 3G87A 2BUNA 3M8WA 3D0HE 5KFDA 2HBZB 1WG1A 1KQSR 2RHSB 1X7VA 3ULHA 2D3OR 4KJIA 1Y4ZB 3UE2A 2KFYA 2MLYA 3UDLA 1KFSA 1Z2ZA 3I4PA 3OVBA 4FVCA 2MKJA 5K14A 2QLXA 4Y28C 3OJUA 4WTYA 1OWXA 1UJ5A 2EFNA 2V0NA 3HVTB 1XR5A 3N5FA 5DO2A 3TOQA 4AT1B 2R8KA 3GSDA 4EK2A 2XI3A 1S1WA 3PO5A 2DNZA 2B4UA 1ZM3A 4NASA 4A8OA 1RU1A 2JC1A 4ZLNA 3OLBA 2XNQA 2JEFA 3NNAA 2IAJA 3RBEA 1RT3B 2QL5B 3SSRA 2MQMA 5HJXA 5AE1A 3VAKA 3PCOB 2CPZA 2GVDB 3E01B 2CJKA 3AB4B 2DK2A 1MWYA 3DOKA 1JJCB 2XLJA 3G8SA 1SQFA 1LEOA 5KG7A 2POKA 3V81B 4ZN1A 2MXYA 4JI3J 4HL9A 1BQXA 1YHQS 5CD4A 4MYTA 4NCBA 3GPAA 4J9KA 3PIPQ 2ZBIA 3HJVA 1S10A 4DHVA 4ZOSA 2LEAA 2LDYA 1HNZJ 5M2PA 1VQSA 2KG0A 2ZH7A 2UV8G 4F25A 1U48A 2YH1A 4B9SA 1JNRB 2R8HA 3E01A 1ZTWA 4Y2KA 3SCJE 3QYYA 3US5A 3W1YC 1HNVA 2UUBJ 4GVBA 1S5ZA 4FF4A 4DUYF 2DXDA 5GMDA 1TKTB 1WEYA 4YDDB 3ZTQA 3B8HA 1VHIA 2GQCA 2KU7A 2AJ1A 2HWHA 2VPZB 1NPKA 4OV1A 2NLWA 1OSCA 1TL5A 2GAGC 2UV8A 3NCRA 5B0DA 4KO0A 1RT2B 4DUZF 3V4IA 3EGVA 2BKPA 3BV8A 2E5LF 5KG0A 2CQBA 3PACA 1NSAA 1MLAA 1YK9A 3GG1A 3HHKA 2Y3YA 3HSZA 4S0MA 2R2SA 2ZVIA 3G9CA 1FJGF 2DBBA 3W2WA 4N76A 4FYDA 4N47A 1U6FA 4JI1F 1KN6A 1EB0A 1HBOB 2LDIA 2PDAA 2GV1A 3TX8A 3J7YI 5L1JA 3T1HF 4C3LA 3DGVA 2Z0GA 1C1CA 2GNKA 3VVUA 4RUCA 5D0EA 4DR3F 3FQKA 2XY7A 4CLPA 2FJVA 2FVPA 1M5SA 3N0VA 5J2NB 2ZDOA 3PJWA 2CPHA 3VVTA 4O4RA 1S1WB 4DV3F 3PJXA 3V6JA 1W7WA 2JFDA 1U6ZA 1XN9A 3FQLA 3VWSA 3RB6A 4IR9A 1C1BA 2F4VF 2BJ7A 1S4EA 4YY3F 1TP7A 5KT7A 4F67A 4GC7A 1VQ4S 4OI2A 5K14B 5KFWA 4J90A 4DU8A 1U0HA 2DNQA 3VGSA 3O44A 1JLQB 1FJ7A 3UDVA 3QIPA 2HFUA 4PYAA 2DNGA 4OX9F 4CLUA 1DZ5A 2AT1B 1RT7A 1HA1A 4FDFA 2QLBB 3LOUA 4NLDA 4DV6F 2YVSA 2ALZA 1OYEA 2BJ9A 2BJ8A 1LWEA 2JX2A 2KT2A 1LK7A 3H0PA 4MK9A 4WKYA 4RNMA 4C7QA 2LECA 3FFIB 3H2VE 3IG1A 2E1PA 1I94J 3SSSA 3DLLQ 2R7VA 4B9NA 2LVWA 1DY3A 2PGCA 4IFYA 3TA2A 3VZHA 1FK9B 1FEHA 1SPBP 1NJWA 1VDHA 2WVBA 3CSKA 5C5JA 4QIFA 2XZWA 4K4TA 1F0XA 5K8MA 3IM8A 1RKJA 3CF5Q 5D0RA 4X4OA 4DR1F 1U1RA 1LWCA 2DNMA 5ETNA 3HXMA 2B9YA 3MF5A 1Q7LB 3LP1A 3NGRA 3HX9A 2VQFJ 5GAEI 1S1UB 4RU2A 4NEYA 2L9WA 1DQAA 1JLAB 2Q1LA 2XMWA 3TP2A 5LXRA 2AJ0A 3PW0A 2BKNA 1TK5A 4LFAF 1X31C 2KZZA 1KQGB 3CD5A 4QW9A 2VFRA 5DM6Q 4K7QA 4KE5A 4KHRA 3MMJA 4RW8B 4I2PB 4R8UB 3DM2A 3ZXWA 3MFIA 1TFYA 2HNYA 2MB0B 3QT5A 1CLFA 1T11A 4TLQA 1DRZA 1HBOA 5HBMA 2ZNYA 1P27B 3QGGA 1FT8A 1WI8A 2R4FA 3P5TL 5ETOA 2DRAA 1GXLA 2CADA 4MFBB 1XNRJ 3FMBA 4GO7X 4Y3CA 4ZP9A 4CNYA 5EHHA 5SZTA 3MM5A 4MFBA 3OUYB 4C8ZA 3UQSA 5ETVA 1CULA 2YQ0A 2J6SA 4NLGA 2OPPA 2AZ3A 2L9DA 3I87A 5IT0A 3MMAA 3MOZA 1U1KA 2PMZD 1NKCA 2HNYB 4O3PA 2WOMB 4ITSA 2QZ8A 2MKSA 2YKAA 4QIEA 1N8RT 1GEHA 3M32A 3DDKA 3I0SB 2U1AA 3M9OB 2ZKTA 2CQIA 1S79A 5AXKA 3M6VA 3PHEA 3CPWR 2BOAA 2HK3A 2KXFA 2LA6A 3BSAA 3U02A 3T5LA 2M88A 2X3GA 3R8YA 3QGPA 5IQQA 1N54B 1OY6A 1HQUA 3GP9A 2Z57B 3UCUP 4NOHA 3EDQB 4LSNB 4P7TA 1HBMB 2YNGB 3MTJA 1GX6A 1SJ4P 4AUKA 3KHHA 3HD1A 3QIDA 4OHWA 1AFJA 1FE0A 3BB5A 2IPOB 2XMTA 3K89A 4EMDA 1OYDA 3U1NA 4A8FA 1CEZA 2EC0A 4IDKB 4N77A 2X51A 4DR5F 1J5EJ 4IFYB 5KFYA 2FY1A 1VQ8S 3CW2C 3QJPA 3KYLA 1KTVA 2VBZA 3EGZA 3KJQB 1V6HA 2MZSA 1FD2A 4URGA 1CG2A 1N33F 1BWVA 5THWA 1FNOA 1WD6A 2WBRA 3SEOA 3NGTA 3V4MA 4JV1A 5F8LA 1YKWA 1Q5VA 1VLOA 4X66F 4B9VA 2QA4G 1JKHB 4K5SA 1RT7B 2PMHA 4ECXA 3UN2A 3OBIA 1XMQF 1RHRB 2COLA 2AMCB 3A3PB 3EZOA 3IS9B 1C1CB 3TJ9A 4P2SA 4GKJF 3ZNJ1 4PQAA 1ITPA 2XSJB 2PA8D 3DHWC 1RA7A 4NZ7A 2UUAF 2DO0A 2R9LA 4X65J 2RQCA 5DRKA 4USHA 3P8BB 1C1BB 2JDJA 2FGOA 1REGX 2WW4A 1FK9A 4QR2A 2XMVA 1RBAA 1RWMB 4EBEA 4CZCA 2RDDA 3SQGA 1YTYA 5CCMA 4Q0BA 4RPFA 2KHDA 4F0HA 1B7YB 4BC9A 5EN1A 4ILLA 2J5AA 3QQCD 3O8WA 2KJVA 1PKUA 1UPPA 2HBYB 4P71A 2GHPA 3QLHB 9ATCB 2OAUA 1RT1B 1XK8A 4YHHJ 1SKSA 4ZVEA 2J0WA 4F02A 1UTAA 2LCWA 3KLFA 3KNAA 2FJBB 4K2JA 1WHYA 3L95X 3DLGB 4X4UA 5B08A 2MQOA 2OEKA 2VKZG 4I7FB 3KG0A 3Q2SC 4KBIA 5GMKa 4TU8A 2D41A 4ZDNA 5LL6d 2W7OA 1MSWD 2YWKA 5F8JA 1R0AA 3CCTA 5KT6A 1T94A 2MY7A 3AB2B 4K0KJ 3CDBA 1KNZA 1I5OB 4KHMA 3HPOA 4F4YA 2AJ2A 3CIZA 3QFHA 4RX6A 3UPFA 4M95A 4K4XA 2ZWPA 4B9MA 1ZBTA 3VAGA 3UR0A 2Y8YA 3RAMA 4CI0B 2DHXA 3RBXA 9RUBA 4L3KA 4PXDA 4TVAB 5KFUA 3WBZA 5IWAJ 4DR6F 5IQ6A 5KFQA 1CC8A 3J81U 4P7VA 3OL7A 1U26A 2I38A 1VGYA 5KG3A 2W1BA 1JJHA 1VRTB 4EU0A 1S6PA 1KR4A 4U8VA 4AD6A 5L38A 1L3TA 2R8GA 3O3LA 4I2PA 2DXFA 1TVRA 1SXLA 3TA0A 1IVZA 4NYPA 2N7YA 3FBCA 5CZXA 1HNIB 1FDDA 3I55S 5G0RB 3P6YC 4ZPVR 2B51A 3D3CJ 2XGPA 2Y1LB 1TKDA 4LF7J 4CWBA 2ZVSA 4OZNA 1U45A 1NDCA 1IBKJ 4I1TA 1W2IA 4R0JA 4ZLLA 2YX1A 5A0YA 4UZBA 2AGPA 3CD6S 2ABYA 4MH8A 3H4DA 4H4KC 1NRKA 1U0SA 3NP5A 1LQ9A 1DQ8A 2VONA 4L73A 5D6GA 4LF1A 4JI5J 4RUAA 2XS2A 2AZ1A 2HQFA 3AA9A 2RQ4A 3Q89A 2VG7B 1X4BA 4B9TA 5D8HB 1FHTA 4ECTA 4F3QA 1FKPA 1HW9A 2XC9A 1S1TB 3DRSA 4DV0F 4ZVUB 5HP1A 4QWEA 1FKPB 4RBTA 2CNNB 1Q8LA 2WK4A 2CNLB 1FX2A 4OI3A 1IKWA 1U6BA 2E5HA 4URQU 4IH5A 5JMNA 2OHDA 2DD8S 2RT3A 1HFEL 5IM0A 3HVTA 4IKAA 1OQ3A 2QN6B 3R5AA 1D9AA 1SV5A 1WSVA 3C6UA 1VRQC 3KFWX 3G96A 1D8YA 1D9DA 1S77D 5KFSA 3KK2A 2P9GA 2EKNA 2DPIA 1UCNA 2BYCA 4PZVA 1OY9A 1TZ0A 4UOHA 1UWBB 4PR6A 3WQPA 4C48A 4A8YA 3D66A 2PIIA 3I0RB 3R1LA 1K9MT 2QA1A 5GAGI 2EI5A 2XSFA 3JYTB 2FGCA 2OIHA 5CXTA 2DHAA 2QL7B 3CJ2A 4YB5A 1RACB 4DFPA 3GJQB 3M9NB 1T95A 1XTZA 2HNZB 4JI7F 2YXLA 4HEA9 3MI7X 2EVZA 3KDOA 2WONA 1KONA 5JVHQ 3PEJA 4LF8F 2O1PA 2HS4A 3IAM9 4NXNJ 4DL2A 3BR9A 3ET6A 2IFXA 5KT2A 3CC2S 4M63A 1L3UA 2AF6A 1VCTA 3P5BP 4WP8A 4ED5A 1FTRA 1OQ6A 3ZTRA 4LMZA 1MROA 5AXMA 5KFNA 3NAIA 4AFFA 2V9WA 1RT6B 2EK6A 1GQEA 4MJKA 2DCLA 1URRA 5DG8A 2XLKA 1IWAA 2E1MC 2JWNA 4NLOA 3OTOJ 1WTBA 5KOWA 1XR7A 2VC0A 4HI1A 4YUDA 1CJUA 2KO1A 3DOMA 1UEKA 5DJBA 5F41A 2BKOA 2VH7A 1X0PA 5CAAA 4TU9A 1O5JA 1Q79A 1XBWA 1N88A 3MAHA 3RAQA 2ASDA 1G1XA 2FVRA 1C2PA 3OLAA 1MN9A 1FFGB 4DPXA 4DSKA 3WC2A 2FVSA 1V3RA 1UKUA 3CCZA 3FSYA 3IR7B 4CLWA 2ZH5A 1PSDA 1D09B 3SCIE 1F9FA 1HYSB 3CCUS 3Q2TC 5BYQA 1X4EA 4MMOA 1TTHB 2VFUA 1RJJA 4N56A 2CJQA 4QWCA 1SQGA 5HROA 3IXQA 3RUBL 1MMNA 4DMZA 2XG8A 1Y5IB 3I6PA 4B3MF 2H51B 3MM8B 2DNPA 4LRDA 1TUWA 3KJNB 5KFLA 3Q8YA 3I5BA 1U1OA 3BBFA 1EP4A 3J81Y 3EYZA 3W9HA 3BO3A 3OR1A 1EAYC 3GWCA 3KHRA 2DISA 2GMJA 3TAQA 3GJRB 1S0MA 4CCHA 4I6YA 1YG0A 2EPIA 4U7CA 2XO6A 3OVAA 2R8IA 2ALYB 1N5YA 3V6DB 3U1LA 4CYUA 1BD6A 1N5QA 2OD6A 2XYGB 4NRUA 3EPGA 2R2UA 3CXCR 3S8SA 2V50A 4DFMA 2HVHA 2C2OB 3FCHA 3Q8QB 2LXFA 1A7GE 2UUBF 2Z8QA 3NWGA 1A0OB 2KYZA 3HI9A 3CC7S 4DUYJ 3HLUA 5T7LB 2DY9A 3EE3A 2HWTA 2J7WA 1ZPWX 1V3SA 3UCZP 1TV6A 4IR1A 1TQLA 1Y5LB 1K44A 2XULA 3KJVA 2K3KA 1FRMA 4UQGA 2RB7A 4FKXA 4D3GA 4DX7A 3NGDA 5EWGA 3JTNA 1S0VA 1C0UB 2DGVA 3V5RA 2XWXA 1U7LA 2BABA 4M5NA 4JP8A 5ETKA 2UVVA 4I6AA 1HYSA 2UXBJ 2XCPA 1S9FA 3CDUA 3MPVA 4YR2A 1U2FA 4GRSA 4X4TA 3J7AN 2V9KA 4J9OA 4P73A 2UP1A 2AYBA 3QIPB 4NCGA 3RJMB 1UP1A 2VG6A 4DPTA 1T9WA 4QW8A 4QPXA 5E41A 2A3JA 2B0GA 1BQMB 5ETMA 3CD0A 2YKMB 3T1YF 1HQEA 1BHNA 3CVKA 4KGXB 4ZA1A 3B78A 4DR2F 2F4VJ 3NL0A 2DH7A 3O6QA 4IRCA 4B3TF 4A46A 4B3RF 1WC5A 3GLJA 3LP0A 4JI4J 3AHPA 5J1NA 2AJQA 5KOXA 2Y8WA 1WNEA 3C6TB 3Q86A 2CPDA 4QR0A 1QAYA 2BQUA 5DM7Q 5G4DA 1F9EB 4C8YA 1FWLA 1RAGB 1F3VA 3MAQA 1JX4A 4DCOB 1B70B 4WFNQ 1AB8A 2LQBA 4P2XA 1OMSA 2AEJA 5B0CA 3Q23A 2XY6A 5KFAA 3CMAS 2KVIA 2WONB 4UOFA 4Z7CA 2BE2B 4O3OA 2J0SD 4EI2A 3W2VA 1Q7YT 1S12A 1IBLF 1EKSA 1DAXA 5LXYA 2M9KA 2A2DA 1IN0A 4F4ZA 2J7KA 1PIEA 2LA4A 1KVIA 4PYDA 1SI9A 3PR4A 3GV8B 3TAPA 3T19A 4CO3A 3ICLA 4OYXA 1K47A 4PKDB 5KTQA 5K5MA 4Q43A 4IG3B 3CC4S 3KUHA 1WC3A 1FDNA 2VBXA 1MWQA 5DLGA 3TARA 3R5GA 2UUTA 1YDLA 2RJZA 4NLYA 2VL1A 2KRBA 4OZ2A 2G2YA 2DR8A 2HHXA 2YQ1A 4UW2A 5L1IA 2JH3A 5ETLA 2IJFA 5KFPA 4B17A 4ED7A 3JTPA 1RWXB 2E44A 2OD4A 3GJTB 4X64J 3A1YG 1RXOB 3N4WA 3Q8UA 3H8YA 3NOCA 4WP3A 1S1XB 3CJQA 4TU7A 3QT8A 3B54A 2CQPA 2W2OP 4BDPA 1DTTA 3WX4A 2HHPA 2ASLA 4B3OA 3KK1A 5KFZA 2MPUA 1UPMB 2HFNA 1OO0B 1RWPB 2JVOA 1R0BG 2LXIA 1UMJA 2OTJS 6FD1A 2J76E 3RBZA 2VU5A 1K0TA 1KC8T 3QT6A 4FZVA 5EX3A 1NK6A 3ET6B 1Y10A 1KRPA 2OSQA 2XEXA 5BXIA 4ZVHA 1FX4A 1NU4A 5F8NA 1Q8IA 2HFSA 3L4BC 1SJ3P 3DRYA 1F6TA 2K1RA 2VBYA 1FRLA 1PILA 1SJQA 2YNFA 3N6LA 2W7AA 2PE8A 4NXMF 4GKKJ 3UN5A 4CM2A 5AE3A 4ELVA 1S6PB 1FXLA 4DN9A 4Y2MA 3D54A 3E2EA 2AW0A 3L7OA 3PVXA 4QCLA 2OPSB 3R9LA 1TL3B 2I8EA 3W2WB 4EO8A 4ECWA 3HHLD 5E5NA 2HHWA 5DZ7A 2HNDA 1HNWJ 2IYGA 2CQ4A 2XMAA 1EZZB 1S48A 4NI2A 3ZC4A 2YKPA 4CO2A 3UDCA 4UUWA 5K8PA 1F2GA 1LW0B 4P72A 1F60B 4Q2LA 3DRPA 4F50A 1VQMS 4G65A 2FC8A 3R6LB 2V67A 2Y0BB 5F9NA 2QG9B 3AODA 1AUSL 2ROEA 2WSFC 1H2UX 4C11B 1SC4B 3PRBA 4DV6J 2B4VA 2LFVA 5CHCB 4C0BA 5KFFA 2C3PA 4ER8A 2WSEC 2MTLA 2VBWA 3A8JA 2F3JA 3G6XA 2OPRA 6FDRA 2IMOA 2VFVA 2ZC4A 3CIMA 4J91A 1OPZA 3W5YA 2JLEA 4X65F 1LW2A 4RW7A 1CULB 1S6UA 1U2RA 5F8GA 3PW7A 3NNHA 1T3OA 3M6UA 3H40A 4DQPA 2YNHA 2RQMA 1S97A 3DLBA 1N0VC 3EVWA 1JLEA 4LVNP 1DHMA 2WB1D 5KFMA 2WAQD 3TANA 2V63A 4DS4A 4DWIA 3NMRA 2EKYA 4DF4A 3CJTA 3V6HA 2XMUA 1IQZA 2V69A 4CT9A 1QAXA 1B4SA 1H2VZ 1YX2A 1H7XA 4CH1A 2RRAA 1NK7A 1TKTA 3I9ZA 2X1BA 5LSLA 4FXWA 1T9XA 1Y0HA 4DV5J 1VI7A 2B7BB 4ANCA 3KG1A 3QAEA 1URNA 4GVLA 3RW6A 1CSJA 2RHQB 1JXLA 4OI0A 4OZJA 4Q7AA 3K8VA 1YQHA 4LF9F 2ZBRA 3LP2B 2ADCA 2CNKB 2JRSA 2ZBQA 3Q83A 1U8SA 2LMIA 3M8YA 4NCGB 4WPAA 5FIIA 3B6BA 4O4GA 1UVJA 2HHVA 3D4JA 3HF5A 3EX7B 2GFFA 3KK2B 4IFVA 1JK9B 3TAMA 3SMZA 1IQTA 1H98A 3MR5A 3MM9B 4C11A 2B9XA 2FY8A 3SZ2A 4H4OA 3QGIA 2ZH1A 2EFVA 1VQNS 4ED3A 2MZRA 2QTWA 1SJFA 2E9ZA 4XAKA 1S7HA 4ZVQB 1UZHA 1UEUA 1RAFB 2W8KA 4QR1A 3T3FA 4NA1A 1HPZB 1YGYA 2CJXB 5J2MB 3TUJC 4RWWA 4NZ0A 2W2NP 3D1QA 4OLPA 3MM7A 2CXEA 3WIUA 2B4OA 3IS9A 3UO0A 2KFZA 3OJSA 3FRYA 4CYUB 2R7UA 1T0TV 4I2QA 4M5GA 1HBNA 4MKYA 2AP6A 5F8MA 1WOOA 2HWIA 2RUGA 4ZP8A 2HQ3A 4H4OB 3MGJA 2G13A 3PZPA 1IBKF 1S0OA 2BANA 3RW7A 1HNZF 5KG2A 2MJNA 3C3LA 1FRXA 3M2VA 3LPEA 4PUOB 2JOQA 3HFZB 3M8PB 1Y11A 5IOLA 2ASJA 2DGWA 1KOOA 1HI0P 3KLVA 1T7PA 2J6TA 5H9FK 1X5OA 2ZNZA 4YP3A 4OHYA 1R6VA 3G8TA 4ZVGA 1FXDA 1GAOA 2VUGA 4U95A 3NBPA 3GIIA 3RB4A 3HK2A 2BACA 2DB1A 1WELA 1FEEA 1FRHA 1H73A 3WX8A 4DL0C 4DS5A 3GZ7A 1FJGJ 2DITA 3HHNB 3ENQA 4RBVA 3W7BA 3FZ2A 3G86A 5LMUJ 3SXLA 3PKYA 2RDIA 4MT1A 4WXOA 4YN3B 4E0DA 4M8LA 3KUGA 3K57A 5KFEA 4BS2A 2EC2A 4DCJB 1RTIB 1S6OA 2WOMA 2IVFB 4NL5A 1K73T 4YY3J 1OS5A 4FN5A 4C2MA 4ECYA 3IRWP 3SCLE 4Q8EA 2WHOA 5FDLA 3J81j 3OUYA 4YHHF 3WDOA 2FDNA 1AT1B 2IC3B 5E7OB 3ZZPA 3ILLA 4JI7J 3MAAB 4KKOA 3C16A 1RAJA 3SFGA 2WBMA 1NDPA 4BWJA 2PEBA 2DNLA 2DT9A 2V4JB 3CMQA 1W2BR 1AZSA 1WJ9A 1ZM9A 1Y00A 1RTZA 4ZVFA 3D0GE 2KH9A 3L9ZA 4E8UA 2DTJA 1C4AA 2IJNA 4OMFG 1HL6A 1DTQB 2RF2B 3TI0A 1MN7A 3ILOA 5KFGA 2KM8B 2DXEA 4A8QA 1BUXA 2RAQA 2XHCA 4WU2A 2MQPA 4TQRA 1S1UA 3R6GB 2Y1RI 2VJVA 2C2RA 2KT3A 4U7UK 2VC1A 2D9OA 2KYXA 1D8ZA 2NZCA 1R7IA 5HMZA 1RWNB 2XMKA 2MQQA 1LFPA 2CZVC 2K3IA 3K17A 2KFNA 3AFGA 3W64A 4B08A 4ZCMA 2R7SA 5KG1A 3JAMU 1DLOA 3M2VB 4PUOA 1CPZA 4LSLA 2VG5B 1QUVA 2GC8A 2M0GB 3U27A 5LMNF 3AH6A 3CTRA 3KXDA 1VMBA 3ZO7A 2EFPA 5HK4A 3QSIA 5HQLA 2OMLA 4F4AA 3SDEA 2HAIA 4OZ5A 3C66A 4DSIA 4FF1A 1EQMA 2L9NA 3QO9B 2HFVA 3HHLA 5EWEA 3FCVA 4ZITA 5HQ8A 4F3OA 5DETA 5A8RB 2J0QD 4NLWA 3RZAA 3RRHA 2ZJPQ 2BVZA 3HHLC 2H5IB 4I6WA 2C3YA 4LRAA 1SCJB 5DDPC 2AHOB 1C0UA 1JXVA 2UUCJ 1KP6A 3L7UA 4OI4A 2YKOA 2CRLA 3D28A 3ZZRA 3KLHB 4B3OB 4HDGA 1PCAA 3DRXA 2KXHA 4LIWA 4P74A 4WFXA 4TKTA 5E2QA 2HW3A 5IV4A 1HKAA 3WZ0A 4WWSA 4LSNA 4DV7J 3MMCB 1EX8A 3MWBA 1SKRA 2VOPA 4YOEA 2A1BA 2IRYA 4CO5A 3FZBA 4YB1P 1HNXF 3GV5B 3Q24A 3GR1A 2KJWA 4QJVA 4YEAA 3W2VB 5KT5A 4O4GB 3CUNA 4HTJA 1X5SA 2GGPA 1Z1ZA 1YVFA 4CLSA 5KFHA 2AYMA 5C2GA 2NXUA 1C4CA 1LOUA 2HFZA 3BGRA 3GB0A 3MEGA 2DRDA 4PG6A 4F7VA 3MMAB 3OFEA 2ZM6J 2XNRA 1RYSA 3EMTA 2DGOA 3N9UC 2QMUB 1H3DA 2D3ZA 2GQQA 3FEZA 3TVYA 4EYHB 3T9NA 1HR0J 3CDAA 4WF9Q 2V4RA 3FGVA 3HZEA 3ELHA 3UDEA 3W62A 4QYZK 4USKA 4USTA 4ECRA 5L1KA 2E29A 1IXKA 2HRUA 1LXNA 2BE2A 3MM6A 3VAJA 1J5EF 4DPWA 4OFZA 4A48A 1L3KA 2F9DA 2BJ1A 2Q6CA 1OIAA 1VRTA 3HHDA 3R97A 1SL1A 1KHWA 1CVJA 3D68A 4YDXA 1PYSB 1LK5A 4ZN3A 2QT7A 1YBTA 4ZPDA 1NJYA 1I6JA 1FRKA 1LNQA 3D0IE 3DGPB 3POTB 3RR8A 1NDKA 3VQTA 3CCVS 2QSFA 2MZ1A 2HQCA 2FPHX 3DLGA 4H4MB 3FDSA 1X4AA 1U49A 2OPRB 1N32F 4YR0A 2GQ2A 2C2NA 2Z2ZA 2CPFA 2G0IA 5BYRA 3DOLB 4RO0A 4ZHRB 2Z2YB 3M8PA 3G4SS 3PX0A 1DQ9A 4M5DB 3W61A 4P10A 3MURP 5RUBA 3MR6A 3MEEB 4O0NA 2AQ4A 1JLCA 4EBDA 1H38A 2IMWP 2GJ2A 2HS0A 2ZOMA 3CO9A 4I2QB 3BQ0A 3OTOF 4OJ3A 2CFXA 1X0FA 2UXCJ 1WACA 3LF0A 2KZMA 2EXUA 2HIYA 4O0IA 3M2RB 1FVSA 2AJ4A 4NYZA 1W26A 1CC7A 1SB6A 1PG5B 1FERA 4F36A 4F26A 4DV2F 4LQ9A 2MHEA 3V81A 2FVCA 1MU2B 1MMDA 2QA4S 4B9LA 4F2SA 1IWGA 1RAOA 4Q5VA 4QYRA 3PO4A 4I69A 4PPDA 2BE7D 4PQUB 2ERRA 2CVEA 5BYSA 2MLXA 4Q2MA 3DXBA 4ZVOB 5L1LA 3LPYA 5HMYA 1NMEB 3VCDA 1RE1B 2DNHA 4FYVB 3KK3B 1O51A 2C1EB 1NJIT 3KHLA 4NLXA 4C8KA 2CQ1A 2OKQA 4ED4A 5GADU 3DU5A 3C15A 3VF0B 3OR1B 3SBMA 4DLEA 3BO2A 4U7UD 4DUTA 1UVKA 1UJ6A 5I3UB 1WF2A 4FS1A 2M4MA 1JLBA 3JSMA 1WDDA 1G3OA 2XBPA 3G6ES 1YRTA 2IA6A 1RTJB 4P2FA 3IO1A 3PRDA 1U1MA 2OSRA 2VQEF 4QU7A 5KFVA 3C8YA 1RAHB 3BKUA 2OP5A 4DR6J 3JSBA 2HQDA 1IKWB 2HGLA 3KMQA 3C46A 1DTQA 4P75A 3L7PA 3H4BA 3IA0A 3GMGA 3GFHA 4OYOA 2F4FA 1IJEB 4Y65A 2N4CA 4DL3A 3TRGA 1HBUA 2QYCA 4J37A 4EWTA 4UQTA 1UW9A 2LQJA 3KJVB 4NCAA 3KLIB 1UVMA 3IC1A 3IGVA 3NRBA 4OI1A 4C3MA 1GXUA 4DG1B 5KAKA 5T14A 4JI2F 2ZOFA 2B4PA 2B7CB 5D15A 3DOLA 2ILYA 2KB2A 3FBBA 1TMJA 3DNCA 4M5MA 2O3DA 1QJHA 2XLIA 3ZTOA 3PYDA 3GV7B 4JYAF 4DBQA 3JXOA 5CYQA 3QGHA 3MM5B 4CO1A 1E6VA 4DSLA 1U1LA 2UVWA 1R8PA 1KLMB 1U24A 3OXFA 1RCOB 4HHJA 4ID8A 4DSFA 3RAXA 5A76A 4NXMJ 1N33J 5LJ3Y 1HD0A 1APSA 3BJYA 3E3XA 3M7VA 4ZPBA 5HMWA 2DR7A 4X66J 4UUXA 4J9UE 2ZH9A 2LU2A 1RBLA 4PXCA 1VBZA 1VBYA 1GNKA 2V6AA 2DCUB 3VQSA 1V5IB 1HWLA 4K8RA 1HNWF 1NM2A 5HROB 4TXSA 1UFWA 3WHIA 3QJLA 4ICLB 1KSPA 4Y2CA 4QOTA 1WI6A 3MOJB 4ICLA 1YJ9S 1PC4A 1RWWB 2H9ZA 2NXCA 4KB7A 2BQ3A 3M8ZA 3Q8VA 4I64A 4HKQA 2G0CA 3CJKB 3BR8A 5KFKA 4DQSA 2AYGA 1QY7A 2RIJA 2ZD1B 1GXTA 4IOBA 1RZMA 3NLCA 4DG1A 4HTIA 3K0JA 1R27B 3S7RA 5HJYA 4TY9A 2RS2A 3FJ2A 4NPOA 1N36F 1Q53A 3I9V9 3D7SB 1RT5A 4C0OC 5HP1B 2KL8A 4DDFA 4GMKA 5AJ3J 5A8KB 1R3NA 4WU3A 3ZZ0A 5MLCV 4WK1A 3UCGA 1HD1A 2WVFA 1EJ7L 4OYZA 3UNGC 5JJBA 2GIQA 4XDDA 3KLHA 1FF2A 1PBAA 2LEPA 3K59A 1PYOB 4KPCA 4IOAQ 2R7OA 7FDRA 2HNDB 2KHCA 3TYTA 1CJTB 1WF1A 2B6AA 2U2FA 2Z4PA 4O3SA 4C97A 1X4GA 4AXIA 1S1XA 5C25B 1FKOA 1R8BA 3PEHA 5A8KA 2QLFB 1VHFA 3VR1A 5DQHA 1VR6A 3SIPB 3Q8PB 3BYPA 2DJWA 1TMMA 4G1IA 2HYIB 2PI4A 4NMLA 2ATCB 1V3ZA 1XQIA 1LWFA 4DQQA 1WDTA 3JYTA 2G4BA 4N8OA 3OTBA 2AGQA 3W9JA 1N56A 4PQUA 5F8IA 1LXJA 4USMA 1BE4A 1TKXA 3PW2A 4C8NA 1S4FA 3LW5C 3N6MA 1TKZA 1RB0A 3DFEA 5D4PA 3IMQJ 1ZAXA 4LF5F 3DC2A 3VALA 1KBRA 1KS2A 2EG1A 3C15B 3MZIA 2BMBA 5DLFA 2HSEB 3TUZC 5L8RC 2ATLA 1M5KC 4V19X 4MTPA 4JBCA 4WE1A 4MKVA 4EZ9A 2VPXB 1QVFR 4USJC 5J1EA 1WC1A 2UVUA 2HURA 5EWFA 1R0AB 5C42A 1SIZA 3HT0A 1BQNA 3GILA 4ID5A 5CZVA 4M5KA 4RW7B 4FP9A 5CYMB 2X3DA 2HIQA 2HLTA 3AXKA 4CH7A 5I4MA 3A3NB 1YI2S 2BJEA 5GVQA 5J2QB 2LU1A 2AV5A 2D3O1 3BSNA 4IO1A 2HMIA 1SL2A 5DQIA 1GT8A 3QLHA 3HDSA 4OX6A 2H54B 2HBQB 1GMWA 5HN0A 3UN3A 2HBRB 2FQQB 4IG0A 2IM0A 1LFWA 2OPQA 1Q16B 4A8XA 1T9YA 5HMXA 5F0WA 1VS3A 2HHHJ 2C3MA 3S01A 8AT1B 1TVRB 4M5HA 4RNNA 1T8EA 4OJ1A 1NKEA 1B0TA 1QSLA 3MEDB 3IWLA 3TUPA 2ZBPA 5U47A 3PW4A 1RAAB 2YPYA 3U1MA 4KFBB 2CPYA 2QMWA 4ECZA 1ELOA 2UU9J 2ZITA 3CD7A 4LRCA 5BJRA 1VK3A 3CDEA 3DLEA 3BBCA 3PR5B 2FHKA 3J80U 3OTCA 4EO6A 3H20A 3LGHA 1WG5A 3ZFVA 3DM2B 1VK8A 3NEKA 2MKHA 3RB0A 1PYTA 1E6YB 3OSNA 1RUSA 1NXIA 3A8IA 2Q79A 3RGIA 3TZZA 1HLWA 4HT5A 2A18A 4DR2J 4LFBF 4LSLB 1NUEA 3MMCA 1SUQA 2Z58B 4CQ1A 4LRFA 3GQCA 1J2VA 2F7VA 3M9MB 1OPIA 3CJ3A 3ILJA 3LP1B 3H98A 3K7RA 4A8SA 3BGRB 2BXJA 2CNOB 2VG6B 4USWA 2HGNA 4OLOA 5F3TA 2GGPB 1HMVB 3EWGA 2C3UA 1SBRA 1F5AA 5SUHA 2AX0A 2VPYB 5A8RA 3LAMA 3ZZYA 1VQ7S 3BDPA 4G1QA 3QSYB 2W9AA 3FBEA 4KPYA 5KFCA 3K5NA 2MSSA 4NYOA 2ASYA 2VG7A 2GJFA 1CJVA 2DVIA 1UZDA 2XGQA 1IKVA 1Z4UA 2DNNA 2DO4A 4DZDA 2OELA 5MAOA 1HHSA 1NK4A 4N8NA 1YIJS 5ETRA 2PT0A 3VHQA 1S1VA 5H1SV 3TZYA 1QDUB 3DCAA 1GMVA 4R0EA 4RJVA 1EARA 3QZ7A 4ZMMA 4B3MJ 4C4WA 2W2QP 3E51A 2A6OA 3BSCA 2NZ4A 2XMMA 1NSPA 2AJFE 3BS9A 5F0UA 3W63A 2ZEJA 4KGKA 4DX5A 1VQLS 4OL8A 4QWAA 1KFDA 3BKFA 4B3SJ 2CG4A 3JTOA 1F3FA 4NLPA 5IT9U 2VG5A 2E1AA 4K2XA 5LOQA 4L3NA 2IVYA 4ZVTB 3CJKA 2D1CA 3MM6B 3OPKA 4CTAA 3DLKA 1TL7A 4ZK7M 2V8DA 2ZH4A 4K4SA 4HH0A 1SIWB 4RW6B 2UUCF 4UT4A 4V19J 3PJ9A 4IRDA 1N6QB 4KGZB 5C7PA 2XQCA 3I32A 1Y7PA 4OYIA 2DH8A 1QAIA 4XIUA 1WG4A 1TFWA 1XERA 2DGSA 1NKBA 3V2UC 1Q81T 2VJUA 2YQ3A 2K8GA 2QC3A 2RUSA 2BANB 3GCWP 2MKKA 1VJQA 1GFWB 2HAFA 4ILRA 1UFKA 2FZCB 1I3OB 5GAEU 1JNZB 4PWWA 4ZPAA 3TA1A 3AOCA 1KLMA 4DX6A 3HO1A 3I4HX 4G1PA 1VQYA 2O67A 2ZM6F 2H3EB 4HH1A 1O8BA 1KKHA 1TR0A 5D77A 3A12A 4BC7A 4PG5A 3PNIA 2R2TA 1HR0F 3W8GA 1S1VB 4E98A 1D9FA 2CVIA 1ZYQA 2FZGB 3BGLA 3T1YJ 2YX7A 1MG7A 4PWDA 2BX6A 2LEBA 3K5MA 2ILZA 2KRRA 5BR8J 3CCMS 4HLBA 4CNZA 3SSQA 4JI0J 5C2CA 3UD5A 5AXNA 2DH9A 5KFJA 3MUMP 4F4WA 3H7HB 1T9UA 3QWPA 1Q5YA 2OH2A 4RNOA 2HEKA 1FXRA 3M1VA 4J9VA 1RBOB 3OFGA 4KHPF 1YJTA 4AQYJ 2YNIB 2HQGA 3A4TA 3H5SA 3NS6A 1VBXA 3R2CJ 3KK3A 1WEZA 1JLAA 3VV2B 3QAUA 5J2NA 3CJ4A 4J9QA 2P8IA 2B5JA 2YWGA 2H65B 3CEDA 3R5DA 2MKIA 2HK2A 1RTJA 3CJSA 4WYLA 1XMBA 2BEFA 2MMYA 5AE2A 5HO4A 2BQRA 4OX8A 1KDNA 2VODA 3GFYA 4P2MA 4LBPA 2V4QA 4N41A 3I31A 3R5JB 1TAUA 1PJ7A 2GO9A 2R7XA 2MLZA 5B0FA 3X3UA 5E3RA 3IBFB 1HWIA 1HNIA 1RWKB 2AYEA 2MQNA 4OHXA 1IBMF 3GE9A 3NGSA 1X4CA 4R25A 2RF2A 2P5VA 4DV1J 1VC5A 4DV2J 3FUYA 2MQLA 4ETZA 2G1DA 5I42B 1Q86T 3O1LA 1JXEA 1JLEB 1LWEB 2W7PA 2PEHA 3CNQP 4IFVB 4ZS6A 3TAMB 3UW1A 1SH2A 2HMIB 2UXDF 4FPRA 2JSXA 2J0XA 2IC3A 4NZ6A 2OTLS 4WXWA 5CA5A 4H4MA 4ZJOA 2W9BA 3DHXA 2GW8A 4IH7A 2CQ2A 3H5YA 4RZRA 4QIVA 1IKXB 1BQNB 3N01A 2X1AA 1KOHA 1B99A 2NXNA 3CT9A 5L9XA 3LTOA 1YJNS 4LFCF 1G2EA 4MIAA 2AX1A 1RWVB 2F40A 1S7IA 3KKFA 4ZLPA 2DHHA 1XMOF 4FXVA 5FD1A 1Q1KA 1PAEX 3IFEA 2PFFB 3EUNA 3ZZZA 1DJ0A 1W25A 1XIQA 3BQ1A 5L9NA 2W9BB 2VQEJ 1ZA1B 2YTCA 2CQHA 2M70A 2XZTB 3RG6A 1EETB 3KLFB 3IR6B 3HVAA 2GMHA 2NXJA 5B0BA 4C9DA 2NS1B 2N7CA 3TR5A 1J5OA 2PA3A 1WHXA 1N34J 1B3TA 1WSRA 5FLXY 2J9DE 1RHUB 4LF6F 3CGIA 4TYBA 3IAS9 4ILMA 4ENOA 4U9RA 2BBEA 2GJIA 4Q0BB 4GKKF 7FD1A 5DDOC 1IM4A 3MUVP 3NGUA 3EXYA 3TQEA 4CIOA 1SKWA 2HFOA 2P9EA 1S59A 5K20B 4YR3A 2CJAA 4KH1B 4CLFA 3P3DA 3G6VA 4J9LA 1VC0A 2GIFA 2WZ1A 4ECUA 3OSPA 1HI8A 1R31A 4B9UA 3VTIA 1VQOS 1UL3A 2FJAB 2IRXA 2QL9B 3SV4A 2MHNA 2W24A 2WVEA 2ZDPA 4I7FA 3NWRA 4OZ1A 5ETTA 3HVRA 4ECVA 3IRXA 3AJ1A 4UZCA 4HHHA 1LWFB 2ROGA 3MCNA 2M2BA 5I3PA 1VFJA 3FSIA 3KK1B 2HPUA 3A8EA 5HLFA 1NJXA 4OHVA 1D0EA 1K1QA 4KQZA 2DR9A 3OTDA 4O3QA 4ZCKA 5HL7Q 2DY1A 1YJVA 2ZE2A 2ADBA 4DF8A 2CYYA 3PYGA 4HACA 2IAJB 2JLGA 3GYNA 3HZGA 3SDEB 5KFOA 3EZ5A 2IRUA 3DRPB 3TQ1A 2B6AB 1NK9A 2EFOA 2X1GA 4IDKA 4OZ0A 4ED1A 5HQMA 3R7NB 2I5JB 1SQEA 2MZJA 4FNIA 1RLDA 2XMJA 1NAQA 1KVKA 2AGOA 2NQPA 4LR8A 2UXCF 2BW7A 2CG8A 2OPSA 3H5UA 5HVHA 1NCLA 1U0HB 1DURA 5FLXU 3BQ2A 4A8MP 2EK1A 1AA1B 2O5DA 2R7TA 2V94A 1AW0A 1P6TA 3JB9k 3C14A 2HHQA 2ZOGA 1JKHA 1N36J 3ETMA 3MD3A 4Z2XA 2Y9HA 4DV5F 1GK8A 1N5YB 3GFZA 1N4LA 2FHJA 3DLKB 4FYYB 2KDOA 5AJ3F 2BOPA 1A6LA 2Q66A 2DGXA 3I0SA 4JI6J 4ZJLA 4C8LA 1YZ6A 2VA2A 2JEIA 4CO0A 1FNMA 3GTYX 5E3PA 5A8WA 3CO0P 3GONA 4H4KA 5KG4A 1FJEB 2F1FA 3ENWA 4ELUA 4KH0B 5J2PA 3NS5A 2IHR1 4X4VA 2C42A 4HT7A 4PWDB 3G8QA 1BXNA 2MYFA 1NHUA 3ZTPA 2DKOB 3F44A 2WCXA 2A2CA 4FYWB 4UOGA 5H9EJ 1V9OA 5LSOA 4WZQA 3Q8RB 3WIVA 8RUCA 3BN7A 1PC5A 3HFKA 3LH2S 2ZHBA 1VBKA 2VHGA 1S0NA 2PMWA 2CQ0A 1FFWB 1G7CB 4JV0A 1ULRA 4QQBA 1RK8A 1GMUA 1X4HA 5F8HA 5LMNJ 2FJXA 3AD7C 1CS4B 1REVB 2GX8A 2E1RA 2NPIA 3DMJA 1A9NB 4PEOA 2A0FB 2Z30B 3UD3P 1SH3A 1R89A 2HGMA 3X1LB 1FDAA 3EJMA 4OYPA 3KLEB 3QJJA 1S6QA 4E2FB 2RNEA 4QU6A 3G2XA 4ID5B 4JI2J 2H5EA 2WVCA 3TEHB 2F8HA 4KR0B 1UA1A 3GSIA 2AEMA 1IKVB 4FYXB 2BZ2A 1RT3A 2P6SA 4H54A 2E66A 4IYQA 3CJ8A 4JYAJ 3LP0B 3UR3C 4BCAA 3J7Z5 2RRBA 5A8WB 2UUAJ 2FC9A 4JV5J 1LKZA 3DRRB 4UF4A 2MKYA 5DZ6A 1NPPA 1TU0B 5E3CA 2MSTA 1RHMB 2W01A 3E8OA 4LR9A 5DDQC 4HYKA 5GAHI 3Q0AA 1DARA 2DHSA 1HNXJ 4IOCQ 3C14B 2RU9A 3MPWA 5A2QY 2NSBA 3R2DJ 1JLGA 5D4OA 5E3AA 5K9FA 2QO3A 2CJBA 1IJFB 2GMLA 1RCXB 2W2MP 4KV8B 4DEZA 1LWCB 2YNIA 3JS9A 3LWMA 3N5BA 4M5JA 3HSGA 3D1OA 4KSEB 4ECSA 3OW2R 2ZZMA 1FVQA 2I0XA 4X84A 3MFHA 3HFVA 2W9CB 2C2EA 1EP4B 2GIRA 3W3SA 2K7KA 1DTTB 5IC6B 3GIKA 4Z7YA 2XM3A 1WKLA 4Y6IA 3OT9A 3T5KA 5D3GB 2QJ3A 4L75A 4NLQA 4WCEQ 3CCLS 3C2PA 3KTQA 2H5JB 2HVEA 2IJRA 2PC6A 3A8KA 1HW8A 4XO0A 1Z2LA 2EEYA 1QE1B 2Z56B 3IR5B 4I56A 3T1AA 3K5OA 5ETSA 1UJ4A 1QAJA 1S6QB 4LQ3A 4IRKA 4QYZJ 3F41A 2CZ4A 3I56S 2OFHX 3EVMA 1AROP 1Q82T 4R5PB 3HKWA 1AUDA 2CWKA 4ZVRB 3CCWA 2BM1A 2AIRB 2HHSA 1XR6A 4DV4J 2HZVA 3OL6A 1BLUA 2V8VA 3OHBA 4W92B 2JJ4D 4OI6A 2V5HG 3UWTA 2CQGA 3FC9A 4C8OA 2PN6A 1PJ6A 4OV6A 5GMEA 4P9SA 3T41A 5D4LA 2RILA 2VB6A 3K5PA 4CLZA 3NMAA 2E7XA 5LJ5Y 2BA9A 2L3MA 1EIYB 2GHVC 3MR3A 1RT6A 4O3NA 3MHYA 2J9EA 3PW5A 4M94A 1VISA 3GCXP 2DGTA 3OD2A 4JI8F 4IO9Q 4O44B 1DBDA 4DPOA 5B09A 3ISND 5J2QA 4QIWD 4ATNA 2HLUA 1KQKA 2NSCA 1H74A 3KDNA 4KGVB 1RTHB 3QNWB 3R7SB 1R0CB 4X62J 2RRNA 1TKZB 4YFUA 1H2TZ 1RTHA 1WC4A 2W2PP 4WBFA 5B7WA 4F2RA 4X4QA 1MNEA 4L6V3 2QFJA 2HHUA 3KOAA 1S9GA 3O5TB 4ETXA 4KO0B 4HR2A 2KN4A 4PXBA 2AKWB 2YKQA 3AAWB 3P4UB 1Y9OA 2PFDA 2XHWA 3DYAA 4OQJA 1WTFA 5I3QA 1VQ5S 1QTMA 2V68A 3P49B 1M5PC 3ETOA 4TLRA 2VDIA 1YWXA 4K4UA 3CJ0A 2J8SA 2YKMA 3PG9A 4EUVA 3BPDA 1L3SA 2E7VA 1TKXB 5GAGU 1VQ6S 2N82B 3BBBA 1WF0A 4URSA 1HQ2A 2A10A 3G82A 4TN2A 3TVZA 4YMEA 3PKMA 4ES1A 2J7UA 1R6YA 1VQPS 1I1GA 4JI3F 4DV7F 4CT8A 1PAUB 3UVJA 1SJ1A 3KLIA 2MEWA 2IM1A 3MXHP 2G9OA 2VV5A 4RW9B 2VPWB 2NR0A 3IBWA 5DGBA 3IBCB 2QIFA 3QRRA 3CE8A 2KVQE 3F0NA 3GU0A 4UTGA 3GFXA 1H7WA 1ZZNA 1RT4B 1N5VA 4DSJA 4DSEA 2HNZA 4P52A 2FZKB 3NS7B 2RVJA 3PHTA 1ZM2A 2GCFA 1RHQB 4KYZA 3CULA 4HI2A 1FJCA 4ED2A 2VASA 5T7LA 4ZPTR 3AJ2A 4Y2AA 2G0JA 4DUZJ 3PM9A 3PYFA 4OJHA 4LVOP 4F4KA 2C28A 1XNQJ 2XSJA 5A0YB 3J80Y 2ZH3A 1GTEA 3QO9A 4X4SA 2FVQA 2KXNB 3BN4A 2BRLA 3PFOA 1ZOTA 1WWHA 1NBEB 4J9SA 2FD2A 2NXEA 4DL4A 4JI1J 2VDHA 4F0KA 3V6DA 4FF3A 4UY85 3B4DA 4YB6A 5KFRA 4LRBA 2VIHA 5HANA 1S99A 3BM7A 1QD1A 1FA0A 1WHVA 5CCLA 4ZCIA 1RDRA 1RT4A 3I82A 3QBCA 3SYZA 2GA7A 1T03B 3UI3A 1B64A 4A8WA 3OR2A 1P9QC 1S1TA 2FB0A 3DRSB 5KFXA 3TX0A 5IV3A 2ZE2B 2EWHA 2MGZA 2WW8A 1RP5A 1ZZFA 2V4JA 4JUZA 4ANDA 4DR7J 4O3RA 1SC3B 3EXCX 5KFTA 1Q0NA 4LFBJ 1D3WA 2QLJB 4AYBD 1JQGA 3ISNC 3M2RA 3H2UB 2Y1IA 3F56A 3IWXA 2ZJQQ 2MZQA 1Y3KA 2OLWA 3LAKA 2ZUAA 1ZTTA 4DFKA 1S57A 4RWXA 1WOPA 2IDEA 3B4MA 2K2PA 4K4ZA 1X4DA 3D5MA 3VAFA 4NWBA 1HQUB 4F04B 4EBCA 5DG9A 2FJDB 1EHWA 2ZH2A 1SJRA 2FHMA 1T9TA 3FCWA 1N5TA 1NK8A 1E6VB 2DEIA 5EGYA 4TNOA 3MPUB 1VC6A 4LJMA 3BYRA 3N28A 4P6QA 3SCKE 4W90B 3ZZTA 3BO4A 3DGPA 3POTA 4OJGA 2EFGA 3DOKB 3I96A 2X7IA 4LBHA 2F5GA 2O01C 2YX4A 4BBYA 1IBMJ 2DRBA 1UEVA 4PG7A 4OX7A 5J2PB 1YJRA 3BGOP 5DDRC 3EGNA 3I5AA 2NYHA 1WHWA 5J1EB 5HBMB 3NXZA 2HKEA 4PCQA 2JFKA 5CQGA 1N48A 3GIRA 1WC6A 2R7RA 1QUPA 4QBUA 5ETPA 2BJDA 2DGQA 4LFAJ 1QLNA 1I51B 4B3SF 2VF3A 2ZC3A 4KRWA 2CPIA 4KT0C 2FTRA 3NBPB 2ZHOA 4RNFA 3AY0A 1NZ8A 2DYAA 4K59A 4KAIA 1KQFB 5LM7E 3MEGB 3G6YA 4FBUA 1RAIB 2PI5A 4OYWA 3IP0A 4ED6A 5ETQA 1U1NA 1NHVA 2C2MB 1NH7A 2R3VA 3OFFA 1JLBB 3PV8A 1S49A 1N52B 3UNYA 4KGMA 2EW9A 3D6TB 2OJ3A 2UUWA 4DPUA 1JLFA 4K4YA 1N0UA 2C22A 2D3UA 1UVLA 2HZAA 1RA6A 3AQOA 4WK3A 1Q78A 2I2YA 3U7JA 2E5LJ 1TL1A 4OZ3A 3I5CA 3KG4A 2NPFA 3SQGB 4CO4A 4X2BA 2R2RA 5ADZA 1YRXA 3QMQA 2CQ3A 1NB2A 2XWYA 2CIMA 3DXSX 1VOMA 3BREA 1NSQA 5LSRA 3EPIA 3M05A 1M1KT 4G1QB 4M5DA 2GVZB 3PRVA 1PGZA 3BF4A 1BGXT 1MU2A 2IIHA 2UZAA 3JQMA 2QFIA 4DR3J 3KLEA 3D6FB 2DGUA 1HMVA 4RLEA 1U25A 3H25A 4M5IA 3H90A 2AD9A 4TYAA 3IRXB 4KIAA 1FD8A 2B5JB 2AWZA 2CPJA 2G2ZA 3QT7A 4MIWA 1TK0A 4UY8T 3EGWB 4XK8C 2WTFA 3AXMA 4IH6A 4CLYA 4QIGA 2E5GA 2F63A 3PTWA 1NK5A 4L74A 4USIA 2AEFA 3M30A 3MPDA 4DR5J 3K58A 3T9ZA 2ZD1A 2DNKA 4FNHA 5G0RA 3T6BA 3HD2A 2W4PA 4DR4J 4ZHRA 2ZH8A 1KLNA 3DKDA 3VGTA 2B43A 2V8PA 2W25A 3BH6B 4KY3A 5IXUA 4OX9J 2MQ8A 3V6KA 4Z37A 1FWKA 3BZQA 3MTKA 4DLGA 4KHPJ 4AQYF 3MD1A 1T05A 4HVZA 1WUUA 2FHJD 1UAWA 1FCAA 4DI6A 1RTDA 2ROPA 5DS7A 3EM1A 1CJKB 4B02A 2QE5A 3OFHA 1FTCA 4FPIA 5EDWA 1OSDA 1IR2A 2IYIA 1RWUA 3QRPA 1FO1A 2ZJRQ 1RQ0A 4I68A 3MEDA 3AD9C 1IR1A 2M5YA 2G1HA 3IGNA 3SFUA 2J8AA 1KVJA 1F1BB 1ICEB 2QGFB 1AXQA 3TZXA 1KD1T 5CABA 3HJFA 2RKIA 2CPEA 2IM3A 4DU7A 2IVMA 2OMOA 1K1SA 3TWZA 4WP9A 2MZTA 1YZ7A 5HSPA 4J9PA 2NYIA 4DR1J 3R1HA 3Q22A 4Q44A 4ED0A 1L5UA 2CQCA 2YNHB 3OQ2A 1MWZA 1RI7A 5D0HA 3ADAC 5FDLB 4CLLA 3FNNA 3QRQA 2M8DB 2M7SA 2OPPB 2XZDB 1OY8A 2SXLA 3C19A 3TEGA 3Q8SB 5F9LA 2CDRB 4G6VB 3W9IA 3DMJB 5KFBA 2LLZA 4MYUA 3GYGA 3NCPA 4PAAA 4OYBA 2UXDJ 3BDEA 4LREA 4JV2A 1VLYA 1Q8BA 1CBKA 4CH0S 1RGVA 3MPYA 1TL7B 4MAKA 2XS5A 5DG7A 2I1RA 2CWXA 3NOGA 5C24A 1X8DA 5E33A 3IN5A 2NUHA 2F8EX 3FFIA 3IG1B 4BLGA 4IUFA 3SV3A 4DFJA 2OFGX 1HWUA 4O23A 3TW0A 3KLGA 1JIHA 1VIOA 4C8MA 4WE1B 3W66A 3CCRS 2C2DA 1DFDA 3W60A 2PD1A 1F5CA 1Q4RA 2OEJA 4MK8A 1U4BA 2XB2D 2QA2A 2OI2A 1QTNB 1VRUB 2V2ZA 4NX9A 5GADI 1N5SA 4LF5J 2RD5C 1UETA 5JXSA 1UWBA 4ZP6A 2W4CA 2DEJA 4RUHA 2MGZB 2DR5A 1H6KX 1U02A 1TUGB 2BE9B 5IWAF 4L72B 1YJWS 2IBKA 4ED8A 1U1PA 3OHAA 2D9PA 3RYLA 3KJFB 2JEJA 3TUIC 1N34F 5IM0B 1M0SA 4ES3A 3IM9A 1HHTP 1HI1A 3PY8A 3CMES 1FRIA 2Q6BA 4WFZA 3LWLA 2JC0A 2NCKL 5CH7B 3DRRA 3VAHA 1FESA 3JSYA 4LSZB 1ZA2B 2LQ5A 3MM7B 3I0RA 1FKOB 3QFWA 5ITHA 1MW7A 3UFCX 4LF4F 1SKUB 3P45B 1X60A 1J5OB 2B9WA 5HLFB 4RU9A 1VRUA 2MY8A 2CJYB 4A47A 2BM0A 3CJRA 1R8CA 3TVKA 1FFSB 3G82B 3M4XA 2ACYA 3BH7B 1RHJB 4IG3A 1TL1B 4Y00A 3MEEA 4HACB 3FKBA 4JV5F 1HNVB 2HVDA 1TK8A 1L3VA 2ZZNA 1GH8A 1HARA 1SL0A 4RL1A 3LA0A 3TNVA 1NDLA 1WKJA 2M52A 3VZIA 3M8SA 2UU9F 5D78A 4GKJJ 3M32B 2E1CA 1S9GB 3OTEA 1M5OC 2HRTA 2XYHB 3THTA 3M8QA 1R43A 3TO8A 4NE9C 2ZUGA 4MKBA 2R7QA 2CPXA 1ZH5A 1RTIA 4EYIB 1SVDA 4QZVB 1CQMA 1HHQA 4DV3J 2YBVA 2N3OA 5I42A 5H9EK 1SH0A 1RHKB 5KG6A 2JZ5A 3FK4A 2E5IA 2EFQA 2J9DA 1F5BA 3DLHA 4TY8B 3RBDA 3NGKA 3PDNA 1B0PA 3VGVA 3LO3A 4R8UA 2QLWA 4C3KA 3D67A 4GC6A 1CJKA 3N6NA 2R7WA 3C16B 1NB7A 4CLKA 1ACMB 2LXUA 2IM2A 3M8QB 4ZVPB 1P1LA 4RW4B 4ZPWR 4OHZA 1Y3JA 5T41A 5HVGA 4DV4F 4AE5A 2VA3A 2F9JA 3QPIA 4FXDA 1T02A 2V8HA 3HVWA 1NZAA 4ZP7A 4K0KF 2BW2A 5M2RA 1OJ4A 1RT1A 4NLUA 2YWWA 2B3TB 2DNRA 4C98A 2OUGA 2ZHAA 3M1VB 4GVBB 3VAIA 4I67A 1RLCL 4K5RA 5KT4A 4A8KA 1JWWA 2APOA 1IUJA 1XWLA 1RABB 2P2CB 3HKZD 4ALZA 1UW4A 4DZ6A 4ES2A 2DPJA 1S9EA 2FLLA 1SC6A 4FF2A 1PO6A 2VICA 3AT1B 4LR7A 3NCQA 3ZZOA 2ZH6A 1X9MA 1QSSA 3RRKA 3JQJA 1GX5A 2I6WA 4QPTA 4UOCA 4X62F 4DV1F 1JLFB 1G4CA 2WB4A 3EZUA 5E3QA 4C6AA 3GYXB 3MMBB 2JNJA 4W4MA 3OVSA 3L09A 4ZIWA 3MMBA 3RB3A 4DQIA 4A4JA 1JJ2R 3PYEA 2QSWA 1J27A 1JLGB 2BRKA 1RADB 3LP2A 2QRRA 4YB7A 3P96A 2E9TA 2Y0SD 2VKRA 3S1TA 1IM6A 1FKAF 2YWEA 2K1RB 1FWPA 4LF7F 1U47A 4DXLA 3CWJA 3HT3A 2VFSA 4HDHA 4PWUA 3NNCA 4WFAQ 4TQSA 1C0TB 5B0AA 1P8GA 2YH0A 4LIRA 2B8QA 2E7WA 2V2KA 4ZLJA 4OIXA 2GO8A 4WTOB 1E6YA 4DL7A 2FJEB 2H48B 5A2QU 1TL4A 2CQDA 2V2QA 4WYWA 4ZJQA 3DDNA 1M5HA 2C3OA 5IZHA 1NK0A 3DLEB 5DGAA 5IS2A 1P9YA 4ZIVA 2RU3A 1HPZA 1ZPVA 3NAHA 2GVZA 2JVRA 1S72S 4WFBQ 2W8LA 2QYGA 1UVNA 3FEXB 5IC4B 2YPZA 2D69A 3T1HJ 3ONQA 2CJ9A 1NPRA 3DN9A 2KG1A 4LT6A 3NKYA 5F3ZA 1NO8A 4RW9A 1S9EB 5DQGA 3H42A 4OYAA 2XO7A 1Q95G 3ZZUA 1RYRA 1XJWB 4IG0B 3W8PA 3MM9A 5E0OA 3MDFA 3QWUA 1XNQF 2GZOA 1RISA 1NHKL 3HSDA 1KHVA 3MECA 4NA2A 2BJ3A 2DIVA 1M1GA 2KKHA 2XCAA 1M1HA 4U6PA 3NY0A 5BR8F 2Z2MA 4U8YA 3BPSP 4K4WA 2RQKA 1LW0A 3AD8C 1HBMA 2H1YA 3BEGB 5HVFA 4JI0F 4PPZA 4U96A 1N6QA 2FIUA 1XC9A 5GAHU 1CS4A 1REVA 4RW6A 2XS7A 2KTQA 3BSOA 2DNYA 1CJUB 2ZBCA 4ZPCA 2J6UA 1WORA 2CUYA 1NLKL 5CD4H 4DR7F 2J9CA 3CB4A 3MUTP 1VQKS 1O0PA 1ZS6A 1YITS 1I94F 2FLNA 3M8RA 1JB0C 4B3TJ 2HVZA 3HHEA 4K50A 3F73A 3HSJA 3TJ8A 2CDQA 3GR0A 2FYXA 2Q3PA 4WFYA 1QSYA 4ZKAA 2KM8C 4MIBA 4CDIA 5CYQB 4PABA 2HZCA 2R8JA 5A6WA 4JI8J 2B56A 3JQKA 2QMXA 4PRFA 3OL9A 3RU0A 4CTAB 3MCOA 1LV5A 1X5PA 2LYVA 4GO5X 1C0TA 2QEXS 1AYEA 4RW8A 4Q8FA 2DIUA 2G2OA 2VQFF 3HULA 4D3HA 3J7YU 2YNFB 4K4VA 3G71S 1FDBA 3VGUA 3N79A 3B82A 2D7SA 3FMWA 1M5VC 1UWAA 2N3LA 2PSZA 3LANA 2V2VA 2RSQA 3LGMA 2QX0A 1HIYA 4RR5A 3A13A 4ZCLA 4R5PA 3DU6A 4NMXA 4X4RA 2VZ9A 3UD4P 4JI6F 4EZ6A 3D1HA 4RNHA 1YJUA 3H5XA 3THVA 5J2MA 1YBUA 3KNGA 3QATA 3UVJB 5M2UA 3OV7A 4NXNF 2IY5B 4KFBA 2MDAA 4NI2B 2I5JA 4XPCA 2RMLA 3AOAA 3OL8A 4EEYA 2BV3A 3CDWA 1XNRF 2LQ9A 1RWOB 3LQVA 4LFCJ 3KHGA 4N5SA 2V34A 1XMOJ 4ELTA 2DR6A 5I3UA 2W4DA 2OPQB 2ZZTA 1SUQB 2M8HA 4OYMA 1T03A 1GTHA 1RT5B 1X4FA 1NSKL 2N4DA 3ENVA 3EVOA 4J9RA 3MCMA 2ZFHA 5EUHA 2H4WB 4DCPB 1U2CA 2QV6A 4ANEA 4C0HA 1PJ5A 1GMWD 2VD3A 2EBGA 3LUYA 3NG8A 4J9NA 1JLQA 5JUMA 4LF6J 5IFMA 2KT5A 2ZKUA 2DNOA 2HVIA 4F4XA 4DJBA 4F0MA 3DI6A 5C24B 3R27A 4QWBA 1KTQA 1B0VA 2HQIA 3HP6A 2EG2A
chains in the Genus database with same CATH topology
4CWBA 2F65A 2BMBA 3HD2A 3UDEA 3HSDA 5ETRA 5ETNA 2CG8A 3ILJA 5ETVA 3UD5A 4PZVA 4M5MA 1TMJA 1RU1A 3KUHA 3KUEA 1HKAA 3MCOA 1HQ2A 3HCXA 4M5LA 4M5HA 5ETTA 5ETPA 1EX8A 1F9HA 3ILIA 3UDVA 1EQ0A 3MCNA 1G4CA 3HSZA 3ILLA 4M5NA 5ETKA 1RU2A 1TMMA 3HT0A 3MCMA 5ETLA 5ETSA 1CBKA 4M5KA 1RAOA 3QBCA 4CYUA 4M5IA 4AD6A 1RTZA 1EQMA 2QX0A 3IP0A 5ETQA 4F7VA 4CYUB 3KUGA 1IM6A 4M5GA 1DY3A 4CRJA 5ETMA 2F63A 1RB0A 1Q0NA 3HD1A 3ILOA 4M5JA 5ETOA 3HSJA 3HSGA 1KBRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CWB A;  2F65 A;  2BMB A;  3HD2 A;  3UDE A;  3HSD A;  5ETR A;  5ETN A;  2CG8 A;  3ILJ A;  5ETV A;  3UD5 A;  4PZV A;  4M5M A;  1TMJ A;  1RU1 A;  3KUH A;  3KUE A;  1HKA A;  3MCO A;  1HQ2 A;  3HCX A;  4M5L A;  4M5H A;  5ETT A;  5ETP A;  1EX8 A;  1F9H A;  3ILI A;  3UDV A;  1EQ0 A;  3MCN A;  1G4C A;  3HSZ A;  3ILL A;  4M5N A;  5ETK A;  1RU2 A;  1TMM A;  3HT0 A;  3MCM A;  5ETL A;  5ETS A;  1CBK A;  4M5K A;  1RAO A;  3QBC A;  4CYU A;  4M5I A;  4AD6 A;  1RTZ A;  1EQM A;  2QX0 A;  3IP0 A;  5ETQ A;  4F7V A;  4CYU B;  3KUG A;  1IM6 A;  4M5G A;  1DY3 A;  4CRJ A;  5ETM A;  2F63 A;  1RB0 A;  1Q0N A;  3HD1 A;  3ILO A;  4M5J A;  5ETO A;  3HSJ A;  3HSG A;  1KBR A; 
#chains in the Genus database with same CATH topology
 1QVG R;  2HG4 A;  3TZW A;  2XTJ P;  4F3M A;  4TY8 A;  4EFA C;  4O44 A;  1RT2 A;  4XTT A;  3MR2 A;  3V4I B;  4AL5 A;  3CCJ S;  4X4N A;  3DDI A;  1H72 C;  5CYJ A;  4F8R A;  4MKA A;  3M6X A;  1EQ0 A;  1F9H A;  3ILI A;  1WC0 A;  2DHG A;  1AZS B;  2OGU A;  3AOB A;  1P1T A;  4USV A;  3W65 A;  3WC0 A;  1ZM4 A;  5B0G A;  3JAM Y;  1FNX H;  5AXL A;  1PBU A;  4J7C A;  2LP4 A;  4DQR A;  5KG5 A;  4RBU A;  4JI5 F;  1LW2 B;  2YKN B;  1UFL A;  3J7A 1;  1AFI A;  4NA3 A;  1EET A;  2A6M A;  3JSR A;  4Y34 A;  4J9M A;  2XY5 A;  2CAJ A;  2L08 A;  3RRG A;  1IKY B;  1XMQ J;  2HRY A;  4XPE A;  4DV0 J;  5FJ4 A;  1YSJ A;  1WKK A;  1M90 T;  3PIO Q;  4IQM A;  3W5Z A;  1YLX A;  3ENA A;  1K8A T;  4B3R J;  4JB8 B;  4QWD A;  2GVD A;  1BC6 A;  1ZET A;  1QE1 A;  2B9E A;  1JMT A;  4AL6 A;  1BWE A;  3CCQ S;  1VYA A;  1Y5N B;  1IR0 A;  1CJV B;  2H4Y B;  1IKX A;  2E9R X;  1HWK A;  3ITH B;  1HWJ A;  3GJS B;  5KT3 A;  1BQM A;  5K8N A;  3QZ8 A;  1SC1 B;  2E5J A;  1G6B A;  1IKY A;  4M5L A;  6AT1 B;  2F8M A;  4ZVS B;  2W9C A;  2LQ8 A;  2YKN A;  3A3O B;  2JHE A;  3BKT A;  4DOZ A;  2L41 A;  1Q8K A;  2K7J A;  2V8G A;  5IT9 Y;  4HHU A;  4Y0F A;  3KWM A;  3EIC A;  4BWM A;  3D6H B;  4V1A k;  1MML A;  3FRZ A;  4PG4 A;  3EDR B;  1TUV A;  1UA0 A;  2RH3 A;  2MKC A;  3K2Y A;  2P6T A;  1TAQ A;  2I9S A;  5A6P A;  1IBL J;  5JVG Q;  3MCS A;  5D3G A;  1B7F A;  2LKZ A;  2C2Z B;  2KI2 A;  1VJW A;  3D3B J;  1U1Q A;  4ERD A;  1TV6 B;  2CZ9 A;  2BDP A;  2HHT A;  2B8P A;  3GG0 A;  1LWX A;  2FLO A;  5HAO A;  4X4P A;  3M30 B;  3CCE S;  1O6X A;  2F65 A;  2CKW A;  1FE4 A;  4AXJ A;  4J5O A;  3DI6 B;  1HQE B;  4KC5 A;  1KWM A;  3ISZ A;  2WSC C;  3FSX A;  4KV8 A;  4USU A;  3ZNU A;  5C25 A;  5L39 A;  2BR0 A;  2FUG 9;  1CJT A;  1X9S A;  3KUE A;  2P9C A;  1V5V A;  3LGN A;  4Q45 A;  1BMQ B;  2RDJ A;  3FVY A;  1SV5 B;  3C6U B;  1R8H A;  3GIJ A;  5D0G A;  3S6E A;  4AL7 A;  2NRE A;  1RSC A;  5L46 A;  4X64 F;  2GAH C;  4LF9 J;  2IBO A;  1T9V A;  2OEM A;  2M3D A;  2Q43 A;  4DN0 A;  3J7Z T;  3HM9 A;  4DL6 A;  3FBF A;  2YNG A;  3LAL A;  3M6W A;  2WRM A;  3R5B A;  4N7T A;  2OO4 A;  2FHO B;  2PO4 A;  4RUB A;  3T6J A;  4EGL A;  2FJW A;  5B0E A;  2GHW A;  3H59 A;  3VAM A;  4CRJ A;  1FRJ A;  4PG8 A;  3HMJ G;  4RKU C;  3ITH A;  3DOM B;  2AU0 A;  1WEX A;  3BGF A;  1RKI A;  3MAA A;  1BY9 A;  3T5H A;  3PXG a;  1T3N A;  3TJA A;  4CP5 A;  4WIQ A;  1NJZ A;  1X9W A;  2Z2L A;  1DLO B;  3KLG B;  5KFI A;  3SI8 A;  4OZL A;  1D1U A;  4NLS A;  2JLF A;  5H9F J;  1TEL A;  2O66 A;  1FI4 A;  2CA9 A;  3HCX A;  3M2U B;  2FLP A;  3D9B A;  2K06 A;  1K0V A;  3DLJ A;  4NEZ A;  4RW4 A;  1RAE B;  1UVI A;  1S76 D;  2R42 A;  4WZM A;  4PXE A;  4I4B A;  5CYM A;  2YWH A;  2ZWO A;  3DYA B;  2MJU A;  4XDC A;  7AT1 B;  5K8O A;  2XYP B;  2RKI B;  3RR7 A;  5C42 B;  5D4N A;  1EKR A;  1YJ7 A;  4CM0 A;  2JL9 A;  2YY3 A;  4YS2 A;  3MEK A;  2EBE A;  4DL5 A;  4FS2 A;  3CJ5 A;  3R5C A;  4LF4 J;  2C2K B;  2XI2 A;  3MM8 A;  1NND A;  3K5L A;  3OXG A;  4Y2I A;  1R8A A;  1ZAV A;  4WJB A;  1H0H B;  1KEK A;  3AJD A;  4DX8 H;  3SQO P;  3IWN C;  4KKO B;  2GS8 A;  3FEY B;  4DR4 F;  1MRO B;  3AA8 A;  1VIX A;  1T05 B;  1RTD B;  1XEZ A;  4FBT A;  3C6T A;  2L48 A;  5HI7 A;  3M2U A;  2RS8 A;  3H2L A;  5AT1 B;  2X1F A;  1JJ4 A;  3JSM B;  1U09 A;  4KTQ A;  4LBI A;  3MEC B;  2IDL A;  3BGU A;  1YRU A;  3OR2 B;  4NLV A;  4U67 Q;  1YBA A;  3K8W A;  3W5X A;  2NUU G;  2WVD A;  4LF2 A;  4WII A;  3D2W A;  3O2I A;  1VQ9 S;  5HAT A;  2ACM A;  1N32 J;  4MK7 A;  4W98 A;  2UXB F;  4FVM A;  3PX4 A;  5LMU F;  5J1P A;  1ZAW A;  5LT5 A;  3L3C A;  4M1K A;  4ECQ A;  3GIM A;  1QM9 A;  8ATC B;  3RTV A;  2HHH F;  1CQN A;  3R3T A;  2UVR A;  3OXL A;  4NRT A;  3T5J A;  4LF8 J;  2YWF A;  1NEE A;  4L76 A;  4LUB A;  1IBC B;  1F2H A;  5IT4 A;  4BHQ A;  4YQW A;  1X5T A;  3D6M B;  3R7B B;  1NH8 A;  3PX6 A;  3KMS A;  4I0W A;  4JOU A;  4DPY A;  4WKR A;  1ROF A;  1TL3 A;  2RE1 A;  4FKY A;  4NLT A;  2JEG A;  1HBU B;  2IA0 A;  3HHL B;  1JLC B;  4CLT A;  1U8W A;  3MR7 A;  4JI4 F;  1WOS A;  5EX0 A;  2D74 B;  2VOO A;  4G3I A;  3CCS S;  4IQX A;  1RU2 A;  4NLR A;  2HS3 A;  2VFT A;  3ZTS A;  2Y1J A;  3AQP A;  3PFE A;  1HBN B;  3THP A;  3G87 A;  2BUN A;  3M8W A;  3D0H E;  5KFD A;  2HBZ B;  1WG1 A;  1KQS R;  2RHS B;  1X7V A;  3ULH A;  2D3O R;  4KJI A;  1Y4Z B;  3UE2 A;  2KFY A;  2MLY A;  3UDL A;  1KFS A;  1Z2Z A;  3I4P A;  3OVB A;  4FVC A;  2MKJ A;  5K14 A;  2QLX A;  4Y28 C;  3OJU A;  4WTY A;  1OWX A;  1UJ5 A;  2EFN A;  2V0N A;  3HVT B;  1XR5 A;  3N5F A;  5DO2 A;  3TOQ A;  4AT1 B;  2R8K A;  3GSD A;  4EK2 A;  2XI3 A;  1S1W A;  3PO5 A;  2DNZ A;  2B4U A;  1ZM3 A;  4NAS A;  4A8O A;  1RU1 A;  2JC1 A;  4ZLN A;  3OLB A;  2XNQ A;  2JEF A;  3NNA A;  2IAJ A;  3RBE A;  1RT3 B;  2QL5 B;  3SSR A;  2MQM A;  5HJX A;  5AE1 A;  3VAK A;  3PCO B;  2CPZ A;  2GVD B;  3E01 B;  2CJK A;  3AB4 B;  2DK2 A;  1MWY A;  3DOK A;  1JJC B;  2XLJ A;  3G8S A;  1SQF A;  1LEO A;  5KG7 A;  2POK A;  3V81 B;  4ZN1 A;  2MXY A;  4JI3 J;  4HL9 A;  1BQX A;  1YHQ S;  5CD4 A;  4MYT A;  4NCB A;  3GPA A;  4J9K A;  3PIP Q;  2ZBI A;  3HJV A;  1S10 A;  4DHV A;  4ZOS A;  2LEA A;  2LDY A;  1HNZ J;  5M2P A;  1VQS A;  2KG0 A;  2ZH7 A;  2UV8 G;  4F25 A;  1U48 A;  2YH1 A;  4B9S A;  1JNR B;  2R8H A;  3E01 A;  1ZTW A;  4Y2K A;  3SCJ E;  3QYY A;  3US5 A;  3W1Y C;  1HNV A;  2UUB J;  4GVB A;  1S5Z A;  4FF4 A;  4DUY F;  2DXD A;  5GMD A;  1TKT B;  1WEY A;  4YDD B;  3ZTQ A;  3B8H A;  1VHI A;  2GQC A;  2KU7 A;  2AJ1 A;  2HWH A;  2VPZ B;  1NPK A;  4OV1 A;  2NLW A;  1OSC A;  1TL5 A;  2GAG C;  2UV8 A;  3NCR A;  5B0D A;  4KO0 A;  1RT2 B;  4DUZ F;  3V4I A;  3EGV A;  2BKP A;  3BV8 A;  2E5L F;  5KG0 A;  2CQB A;  3PAC A;  1NSA A;  1MLA A;  1YK9 A;  3GG1 A;  3HHK A;  2Y3Y A;  3HSZ A;  4S0M A;  2R2S A;  2ZVI A;  3G9C A;  1FJG F;  2DBB A;  3W2W A;  4N76 A;  4FYD A;  4N47 A;  1U6F A;  4JI1 F;  1KN6 A;  1EB0 A;  1HBO B;  2LDI A;  2PDA A;  2GV1 A;  3TX8 A;  3J7Y I;  5L1J A;  3T1H F;  4C3L A;  3DGV A;  2Z0G A;  1C1C A;  2GNK A;  3VVU A;  4RUC A;  5D0E A;  4DR3 F;  3FQK A;  2XY7 A;  4CLP A;  2FJV A;  2FVP A;  1M5S A;  3N0V A;  5J2N B;  2ZDO A;  3PJW A;  2CPH A;  3VVT A;  4O4R A;  1S1W B;  4DV3 F;  3PJX A;  3V6J A;  1W7W A;  2JFD A;  1U6Z A;  1XN9 A;  3FQL A;  3VWS A;  3RB6 A;  4IR9 A;  1C1B A;  2F4V F;  2BJ7 A;  1S4E A;  4YY3 F;  1TP7 A;  5KT7 A;  4F67 A;  4GC7 A;  1VQ4 S;  4OI2 A;  5K14 B;  5KFW A;  4J90 A;  4DU8 A;  1U0H A;  2DNQ A;  3VGS A;  3O44 A;  1JLQ B;  1FJ7 A;  3UDV A;  3QIP A;  2HFU A;  4PYA A;  2DNG A;  4OX9 F;  4CLU A;  1DZ5 A;  2AT1 B;  1RT7 A;  1HA1 A;  4FDF A;  2QLB B;  3LOU A;  4NLD A;  4DV6 F;  2YVS A;  2ALZ A;  1OYE A;  2BJ9 A;  2BJ8 A;  1LWE A;  2JX2 A;  2KT2 A;  1LK7 A;  3H0P A;  4MK9 A;  4WKY A;  4RNM A;  4C7Q A;  2LEC A;  3FFI B;  3H2V E;  3IG1 A;  2E1P A;  1I94 J;  3SSS A;  3DLL Q;  2R7V A;  4B9N A;  2LVW A;  1DY3 A;  2PGC A;  4IFY A;  3TA2 A;  3VZH A;  1FK9 B;  1FEH A;  1SPB P;  1NJW A;  1VDH A;  2WVB A;  3CSK A;  5C5J A;  4QIF A;  2XZW A;  4K4T A;  1F0X A;  5K8M A;  3IM8 A;  1RKJ A;  3CF5 Q;  5D0R A;  4X4O A;  4DR1 F;  1U1R A;  1LWC A;  2DNM A;  5ETN A;  3HXM A;  2B9Y A;  3MF5 A;  1Q7L B;  3LP1 A;  3NGR A;  3HX9 A;  2VQF J;  5GAE I;  1S1U B;  4RU2 A;  4NEY A;  2L9W A;  1DQA A;  1JLA B;  2Q1L A;  2XMW A;  3TP2 A;  5LXR A;  2AJ0 A;  3PW0 A;  2BKN A;  1TK5 A;  4LFA F;  1X31 C;  2KZZ A;  1KQG B;  3CD5 A;  4QW9 A;  2VFR A;  5DM6 Q;  4K7Q A;  4KE5 A;  4KHR A;  3MMJ A;  4RW8 B;  4I2P B;  4R8U B;  3DM2 A;  3ZXW A;  3MFI A;  1TFY A;  2HNY A;  2MB0 B;  3QT5 A;  1CLF A;  1T11 A;  4TLQ A;  1DRZ A;  1HBO A;  5HBM A;  2ZNY A;  1P27 B;  3QGG A;  1FT8 A;  1WI8 A;  2R4F A;  3P5T L;  5ETO A;  2DRA A;  1GXL A;  2CAD A;  4MFB B;  1XNR J;  3FMB A;  4GO7 X;  4Y3C A;  4ZP9 A;  4CNY A;  5EHH A;  5SZT A;  3MM5 A;  4MFB A;  3OUY B;  4C8Z A;  3UQS A;  5ETV A;  1CUL A;  2YQ0 A;  2J6S A;  4NLG A;  2OPP A;  2AZ3 A;  2L9D A;  3I87 A;  5IT0 A;  3MMA A;  3MOZ A;  1U1K A;  2PMZ D;  1NKC A;  2HNY B;  4O3P A;  2WOM B;  4ITS A;  2QZ8 A;  2MKS A;  2YKA A;  4QIE A;  1N8R T;  1GEH A;  3M32 A;  3DDK A;  3I0S B;  2U1A A;  3M9O B;  2ZKT A;  2CQI A;  1S79 A;  5AXK A;  3M6V A;  3PHE A;  3CPW R;  2BOA A;  2HK3 A;  2KXF A;  2LA6 A;  3BSA A;  3U02 A;  3T5L A;  2M88 A;  2X3G A;  3R8Y A;  3QGP A;  5IQQ A;  1N54 B;  1OY6 A;  1HQU A;  3GP9 A;  2Z57 B;  3UCU P;  4NOH A;  3EDQ B;  4LSN B;  4P7T A;  1HBM B;  2YNG B;  3MTJ A;  1GX6 A;  1SJ4 P;  4AUK A;  3KHH A;  3HD1 A;  3QID A;  4OHW A;  1AFJ A;  1FE0 A;  3BB5 A;  2IPO B;  2XMT A;  3K89 A;  4EMD A;  1OYD A;  3U1N A;  4A8F A;  1CEZ A;  2EC0 A;  4IDK B;  4N77 A;  2X51 A;  4DR5 F;  1J5E J;  4IFY B;  5KFY A;  2FY1 A;  1VQ8 S;  3CW2 C;  3QJP A;  3KYL A;  1KTV A;  2VBZ A;  3EGZ A;  3KJQ B;  1V6H A;  2MZS A;  1FD2 A;  4URG A;  1CG2 A;  1N33 F;  1BWV A;  5THW A;  1FNO A;  1WD6 A;  2WBR A;  3SEO A;  3NGT A;  3V4M A;  4JV1 A;  5F8L A;  1YKW A;  1Q5V A;  1VLO A;  4X66 F;  4B9V A;  2QA4 G;  1JKH B;  4K5S A;  1RT7 B;  2PMH A;  4ECX A;  3UN2 A;  3OBI A;  1XMQ F;  1RHR B;  2COL A;  2AMC B;  3A3P B;  3EZO A;  3IS9 B;  1C1C B;  3TJ9 A;  4P2S A;  4GKJ F;  3ZNJ 1;  4PQA A;  1ITP A;  2XSJ B;  2PA8 D;  3DHW C;  1RA7 A;  4NZ7 A;  2UUA F;  2DO0 A;  2R9L A;  4X65 J;  2RQC A;  5DRK A;  4USH A;  3P8B B;  1C1B B;  2JDJ A;  2FGO A;  1REG X;  2WW4 A;  1FK9 A;  4QR2 A;  2XMV A;  1RBA A;  1RWM B;  4EBE A;  4CZC A;  2RDD A;  3SQG A;  1YTY A;  5CCM A;  4Q0B A;  4RPF A;  2KHD A;  4F0H A;  1B7Y B;  4BC9 A;  5EN1 A;  4ILL A;  2J5A A;  3QQC D;  3O8W A;  2KJV A;  1PKU A;  1UPP A;  2HBY B;  4P71 A;  2GHP A;  3QLH B;  9ATC B;  2OAU A;  1RT1 B;  1XK8 A;  4YHH J;  1SKS A;  4ZVE A;  2J0W A;  4F02 A;  1UTA A;  2LCW A;  3KLF A;  3KNA A;  2FJB B;  4K2J A;  1WHY A;  3L95 X;  3DLG B;  4X4U A;  5B08 A;  2MQO A;  2OEK A;  2VKZ G;  4I7F B;  3KG0 A;  3Q2S C;  4KBI A;  5GMK a;  4TU8 A;  2D41 A;  4ZDN A;  5LL6 d;  2W7O A;  1MSW D;  2YWK A;  5F8J A;  1R0A A;  3CCT A;  5KT6 A;  1T94 A;  2MY7 A;  3AB2 B;  4K0K J;  3CDB A;  1KNZ A;  1I5O B;  4KHM A;  3HPO A;  4F4Y A;  2AJ2 A;  3CIZ A;  3QFH A;  4RX6 A;  3UPF A;  4M95 A;  4K4X A;  2ZWP A;  4B9M A;  1ZBT A;  3VAG A;  3UR0 A;  2Y8Y A;  3RAM A;  4CI0 B;  2DHX A;  3RBX A;  9RUB A;  4L3K A;  4PXD A;  4TVA B;  5KFU A;  3WBZ A;  5IWA J;  4DR6 F;  5IQ6 A;  5KFQ A;  1CC8 A;  3J81 U;  4P7V A;  3OL7 A;  1U26 A;  2I38 A;  1VGY A;  5KG3 A;  2W1B A;  1JJH A;  1VRT B;  4EU0 A;  1S6P A;  1KR4 A;  4U8V A;  4AD6 A;  5L38 A;  1L3T A;  2R8G A;  3O3L A;  4I2P A;  2DXF A;  1TVR A;  1SXL A;  3TA0 A;  1IVZ A;  4NYP A;  2N7Y A;  3FBC A;  5CZX A;  1HNI B;  1FDD A;  3I55 S;  5G0R B;  3P6Y C;  4ZPV R;  2B51 A;  3D3C J;  2XGP A;  2Y1L B;  1TKD A;  4LF7 J;  4CWB A;  2ZVS A;  4OZN A;  1U45 A;  1NDC A;  1IBK J;  4I1T A;  1W2I A;  4R0J A;  4ZLL A;  2YX1 A;  5A0Y A;  4UZB A;  2AGP A;  3CD6 S;  2ABY A;  4MH8 A;  3H4D A;  4H4K C;  1NRK A;  1U0S A;  3NP5 A;  1LQ9 A;  1DQ8 A;  2VON A;  4L73 A;  5D6G A;  4LF1 A;  4JI5 J;  4RUA A;  2XS2 A;  2AZ1 A;  2HQF A;  3AA9 A;  2RQ4 A;  3Q89 A;  2VG7 B;  1X4B A;  4B9T A;  5D8H B;  1FHT A;  4ECT A;  4F3Q A;  1FKP A;  1HW9 A;  2XC9 A;  1S1T B;  3DRS A;  4DV0 F;  4ZVU B;  5HP1 A;  4QWE A;  1FKP B;  4RBT A;  2CNN B;  1Q8L A;  2WK4 A;  2CNL B;  1FX2 A;  4OI3 A;  1IKW A;  1U6B A;  2E5H A;  4URQ U;  4IH5 A;  5JMN A;  2OHD A;  2DD8 S;  2RT3 A;  1HFE L;  5IM0 A;  3HVT A;  4IKA A;  1OQ3 A;  2QN6 B;  3R5A A;  1D9A A;  1SV5 A;  1WSV A;  3C6U A;  1VRQ C;  3KFW X;  3G96 A;  1D8Y A;  1D9D A;  1S77 D;  5KFS A;  3KK2 A;  2P9G A;  2EKN A;  2DPI A;  1UCN A;  2BYC A;  4PZV A;  1OY9 A;  1TZ0 A;  4UOH A;  1UWB B;  4PR6 A;  3WQP A;  4C48 A;  4A8Y A;  3D66 A;  2PII A;  3I0R B;  3R1L A;  1K9M T;  2QA1 A;  5GAG I;  2EI5 A;  2XSF A;  3JYT B;  2FGC A;  2OIH A;  5CXT A;  2DHA A;  2QL7 B;  3CJ2 A;  4YB5 A;  1RAC B;  4DFP A;  3GJQ B;  3M9N B;  1T95 A;  1XTZ A;  2HNZ B;  4JI7 F;  2YXL A;  4HEA 9;  3MI7 X;  2EVZ A;  3KDO A;  2WON A;  1KON A;  5JVH Q;  3PEJ A;  4LF8 F;  2O1P A;  2HS4 A;  3IAM 9;  4NXN J;  4DL2 A;  3BR9 A;  3ET6 A;  2IFX A;  5KT2 A;  3CC2 S;  4M63 A;  1L3U A;  2AF6 A;  1VCT A;  3P5B P;  4WP8 A;  4ED5 A;  1FTR A;  1OQ6 A;  3ZTR A;  4LMZ A;  1MRO A;  5AXM A;  5KFN A;  3NAI A;  4AFF A;  2V9W A;  1RT6 B;  2EK6 A;  1GQE A;  4MJK A;  2DCL A;  1URR A;  5DG8 A;  2XLK A;  1IWA A;  2E1M C;  2JWN A;  4NLO A;  3OTO J;  1WTB A;  5KOW A;  1XR7 A;  2VC0 A;  4HI1 A;  4YUD A;  1CJU A;  2KO1 A;  3DOM A;  1UEK A;  5DJB A;  5F41 A;  2BKO A;  2VH7 A;  1X0P A;  5CAA A;  4TU9 A;  1O5J A;  1Q79 A;  1XBW A;  1N88 A;  3MAH A;  3RAQ A;  2ASD A;  1G1X A;  2FVR A;  1C2P A;  3OLA A;  1MN9 A;  1FFG B;  4DPX A;  4DSK A;  3WC2 A;  2FVS A;  1V3R A;  1UKU A;  3CCZ A;  3FSY A;  3IR7 B;  4CLW A;  2ZH5 A;  1PSD A;  1D09 B;  3SCI E;  1F9F A;  1HYS B;  3CCU S;  3Q2T C;  5BYQ A;  1X4E A;  4MMO A;  1TTH B;  2VFU A;  1RJJ A;  4N56 A;  2CJQ A;  4QWC A;  1SQG A;  5HRO A;  3IXQ A;  3RUB L;  1MMN A;  4DMZ A;  2XG8 A;  1Y5I B;  3I6P A;  4B3M F;  2H51 B;  3MM8 B;  2DNP A;  4LRD A;  1TUW A;  3KJN B;  5KFL A;  3Q8Y A;  3I5B A;  1U1O A;  3BBF A;  1EP4 A;  3J81 Y;  3EYZ A;  3W9H A;  3BO3 A;  3OR1 A;  1EAY C;  3GWC A;  3KHR A;  2DIS A;  2GMJ A;  3TAQ A;  3GJR B;  1S0M A;  4CCH A;  4I6Y A;  1YG0 A;  2EPI A;  4U7C A;  2XO6 A;  3OVA A;  2R8I A;  2ALY B;  1N5Y A;  3V6D B;  3U1L A;  4CYU A;  1BD6 A;  1N5Q A;  2OD6 A;  2XYG B;  4NRU A;  3EPG A;  2R2U A;  3CXC R;  3S8S A;  2V50 A;  4DFM A;  2HVH A;  2C2O B;  3FCH A;  3Q8Q B;  2LXF A;  1A7G E;  2UUB F;  2Z8Q A;  3NWG A;  1A0O B;  2KYZ A;  3HI9 A;  3CC7 S;  4DUY J;  3HLU A;  5T7L B;  2DY9 A;  3EE3 A;  2HWT A;  2J7W A;  1ZPW X;  1V3S A;  3UCZ P;  1TV6 A;  4IR1 A;  1TQL A;  1Y5L B;  1K44 A;  2XUL A;  3KJV A;  2K3K A;  1FRM A;  4UQG A;  2RB7 A;  4FKX A;  4D3G A;  4DX7 A;  3NGD A;  5EWG A;  3JTN A;  1S0V A;  1C0U B;  2DGV A;  3V5R A;  2XWX A;  1U7L A;  2BAB A;  4M5N A;  4JP8 A;  5ETK A;  2UVV A;  4I6A A;  1HYS A;  2UXB J;  2XCP A;  1S9F A;  3CDU A;  3MPV A;  4YR2 A;  1U2F A;  4GRS A;  4X4T A;  3J7A N;  2V9K A;  4J9O A;  4P73 A;  2UP1 A;  2AYB A;  3QIP B;  4NCG A;  3RJM B;  1UP1 A;  2VG6 A;  4DPT A;  1T9W A;  4QW8 A;  4QPX A;  5E41 A;  2A3J A;  2B0G A;  1BQM B;  5ETM A;  3CD0 A;  2YKM B;  3T1Y F;  1HQE A;  1BHN A;  3CVK A;  4KGX B;  4ZA1 A;  3B78 A;  4DR2 F;  2F4V J;  3NL0 A;  2DH7 A;  3O6Q A;  4IRC A;  4B3T F;  4A46 A;  4B3R F;  1WC5 A;  3GLJ A;  3LP0 A;  4JI4 J;  3AHP A;  5J1N A;  2AJQ A;  5KOX A;  2Y8W A;  1WNE A;  3C6T B;  3Q86 A;  2CPD A;  4QR0 A;  1QAY A;  2BQU A;  5DM7 Q;  5G4D A;  1F9E B;  4C8Y A;  1FWL A;  1RAG B;  1F3V A;  3MAQ A;  1JX4 A;  4DCO B;  1B70 B;  4WFN Q;  1AB8 A;  2LQB A;  4P2X A;  1OMS A;  2AEJ A;  5B0C A;  3Q23 A;  2XY6 A;  5KFA A;  3CMA S;  2KVI A;  2WON B;  4UOF A;  4Z7C A;  2BE2 B;  4O3O A;  2J0S D;  4EI2 A;  3W2V A;  1Q7Y T;  1S12 A;  1IBL F;  1EKS A;  1DAX A;  5LXY A;  2M9K A;  2A2D A;  1IN0 A;  4F4Z A;  2J7K A;  1PIE A;  2LA4 A;  1KVI A;  4PYD A;  1SI9 A;  3PR4 A;  3GV8 B;  3TAP A;  3T19 A;  4CO3 A;  3ICL A;  4OYX A;  1K47 A;  4PKD B;  5KTQ A;  5K5M A;  4Q43 A;  4IG3 B;  3CC4 S;  3KUH A;  1WC3 A;  1FDN A;  2VBX A;  1MWQ A;  5DLG A;  3TAR A;  3R5G A;  2UUT A;  1YDL A;  2RJZ A;  4NLY A;  2VL1 A;  2KRB A;  4OZ2 A;  2G2Y A;  2DR8 A;  2HHX A;  2YQ1 A;  4UW2 A;  5L1I A;  2JH3 A;  5ETL A;  2IJF A;  5KFP A;  4B17 A;  4ED7 A;  3JTP A;  1RWX B;  2E44 A;  2OD4 A;  3GJT B;  4X64 J;  3A1Y G;  1RXO B;  3N4W A;  3Q8U A;  3H8Y A;  3NOC A;  4WP3 A;  1S1X B;  3CJQ A;  4TU7 A;  3QT8 A;  3B54 A;  2CQP A;  2W2O P;  4BDP A;  1DTT A;  3WX4 A;  2HHP A;  2ASL A;  4B3O A;  3KK1 A;  5KFZ A;  2MPU A;  1UPM B;  2HFN A;  1OO0 B;  1RWP B;  2JVO A;  1R0B G;  2LXI A;  1UMJ A;  2OTJ S;  6FD1 A;  2J76 E;  3RBZ A;  2VU5 A;  1K0T A;  1KC8 T;  3QT6 A;  4FZV A;  5EX3 A;  1NK6 A;  3ET6 B;  1Y10 A;  1KRP A;  2OSQ A;  2XEX A;  5BXI A;  4ZVH A;  1FX4 A;  1NU4 A;  5F8N A;  1Q8I A;  2HFS A;  3L4B C;  1SJ3 P;  3DRY A;  1F6T A;  2K1R A;  2VBY A;  1FRL A;  1PIL A;  1SJQ A;  2YNF A;  3N6L A;  2W7A A;  2PE8 A;  4NXM F;  4GKK J;  3UN5 A;  4CM2 A;  5AE3 A;  4ELV A;  1S6P B;  1FXL A;  4DN9 A;  4Y2M A;  3D54 A;  3E2E A;  2AW0 A;  3L7O A;  3PVX A;  4QCL A;  2OPS B;  3R9L A;  1TL3 B;  2I8E A;  3W2W B;  4EO8 A;  4ECW A;  3HHL D;  5E5N A;  2HHW A;  5DZ7 A;  2HND A;  1HNW J;  2IYG A;  2CQ4 A;  2XMA A;  1EZZ B;  1S48 A;  4NI2 A;  3ZC4 A;  2YKP A;  4CO2 A;  3UDC A;  4UUW A;  5K8P A;  1F2G A;  1LW0 B;  4P72 A;  1F60 B;  4Q2L A;  3DRP A;  4F50 A;  1VQM S;  4G65 A;  2FC8 A;  3R6L B;  2V67 A;  2Y0B B;  5F9N A;  2QG9 B;  3AOD A;  1AUS L;  2ROE A;  2WSF C;  1H2U X;  4C11 B;  1SC4 B;  3PRB A;  4DV6 J;  2B4V A;  2LFV A;  5CHC B;  4C0B A;  5KFF A;  2C3P A;  4ER8 A;  2WSE C;  2MTL A;  2VBW A;  3A8J A;  2F3J A;  3G6X A;  2OPR A;  6FDR A;  2IMO A;  2VFV A;  2ZC4 A;  3CIM A;  4J91 A;  1OPZ A;  3W5Y A;  2JLE A;  4X65 F;  1LW2 A;  4RW7 A;  1CUL B;  1S6U A;  1U2R A;  5F8G A;  3PW7 A;  3NNH A;  1T3O A;  3M6U A;  3H40 A;  4DQP A;  2YNH A;  2RQM A;  1S97 A;  3DLB A;  1N0V C;  3EVW A;  1JLE A;  4LVN P;  1DHM A;  2WB1 D;  5KFM A;  2WAQ D;  3TAN A;  2V63 A;  4DS4 A;  4DWI A;  3NMR A;  2EKY A;  4DF4 A;  3CJT A;  3V6H A;  2XMU A;  1IQZ A;  2V69 A;  4CT9 A;  1QAX A;  1B4S A;  1H2V Z;  1YX2 A;  1H7X A;  4CH1 A;  2RRA A;  1NK7 A;  1TKT A;  3I9Z A;  2X1B A;  5LSL A;  4FXW A;  1T9X A;  1Y0H A;  4DV5 J;  1VI7 A;  2B7B B;  4ANC A;  3KG1 A;  3QAE A;  1URN A;  4GVL A;  3RW6 A;  1CSJ A;  2RHQ B;  1JXL A;  4OI0 A;  4OZJ A;  4Q7A A;  3K8V A;  1YQH A;  4LF9 F;  2ZBR A;  3LP2 B;  2ADC A;  2CNK B;  2JRS A;  2ZBQ A;  3Q83 A;  1U8S A;  2LMI A;  3M8Y A;  4NCG B;  4WPA A;  5FII A;  3B6B A;  4O4G A;  1UVJ A;  2HHV A;  3D4J A;  3HF5 A;  3EX7 B;  2GFF A;  3KK2 B;  4IFV A;  1JK9 B;  3TAM A;  3SMZ A;  1IQT A;  1H98 A;  3MR5 A;  3MM9 B;  4C11 A;  2B9X A;  2FY8 A;  3SZ2 A;  4H4O A;  3QGI A;  2ZH1 A;  2EFV A;  1VQN S;  4ED3 A;  2MZR A;  2QTW A;  1SJF A;  2E9Z A;  4XAK A;  1S7H A;  4ZVQ B;  1UZH A;  1UEU A;  1RAF B;  2W8K A;  4QR1 A;  3T3F A;  4NA1 A;  1HPZ B;  1YGY A;  2CJX B;  5J2M B;  3TUJ C;  4RWW A;  4NZ0 A;  2W2N P;  3D1Q A;  4OLP A;  3MM7 A;  2CXE A;  3WIU A;  2B4O A;  3IS9 A;  3UO0 A;  2KFZ A;  3OJS A;  3FRY A;  4CYU B;  2R7U A;  1T0T V;  4I2Q A;  4M5G A;  1HBN A;  4MKY A;  2AP6 A;  5F8M A;  1WOO A;  2HWI A;  2RUG A;  4ZP8 A;  2HQ3 A;  4H4O B;  3MGJ A;  2G13 A;  3PZP A;  1IBK F;  1S0O A;  2BAN A;  3RW7 A;  1HNZ F;  5KG2 A;  2MJN A;  3C3L A;  1FRX A;  3M2V A;  3LPE A;  4PUO B;  2JOQ A;  3HFZ B;  3M8P B;  1Y11 A;  5IOL A;  2ASJ A;  2DGW A;  1KOO A;  1HI0 P;  3KLV A;  1T7P A;  2J6T A;  5H9F K;  1X5O A;  2ZNZ A;  4YP3 A;  4OHY A;  1R6V A;  3G8T A;  4ZVG A;  1FXD A;  1GAO A;  2VUG A;  4U95 A;  3NBP A;  3GII A;  3RB4 A;  3HK2 A;  2BAC A;  2DB1 A;  1WEL A;  1FEE A;  1FRH A;  1H73 A;  3WX8 A;  4DL0 C;  4DS5 A;  3GZ7 A;  1FJG J;  2DIT A;  3HHN B;  3ENQ A;  4RBV A;  3W7B A;  3FZ2 A;  3G86 A;  5LMU J;  3SXL A;  3PKY A;  2RDI A;  4MT1 A;  4WXO A;  4YN3 B;  4E0D A;  4M8L A;  3KUG A;  3K57 A;  5KFE A;  4BS2 A;  2EC2 A;  4DCJ B;  1RTI B;  1S6O A;  2WOM A;  2IVF B;  4NL5 A;  1K73 T;  4YY3 J;  1OS5 A;  4FN5 A;  4C2M A;  4ECY A;  3IRW P;  3SCL E;  4Q8E A;  2WHO A;  5FDL A;  3J81 j;  3OUY A;  4YHH F;  3WDO A;  2FDN A;  1AT1 B;  2IC3 B;  5E7O B;  3ZZP A;  3ILL A;  4JI7 J;  3MAA B;  4KKO A;  3C16 A;  1RAJ A;  3SFG A;  2WBM A;  1NDP A;  4BWJ A;  2PEB A;  2DNL A;  2DT9 A;  2V4J B;  3CMQ A;  1W2B R;  1AZS A;  1WJ9 A;  1ZM9 A;  1Y00 A;  1RTZ A;  4ZVF A;  3D0G E;  2KH9 A;  3L9Z A;  4E8U A;  2DTJ A;  1C4A A;  2IJN A;  4OMF G;  1HL6 A;  1DTQ B;  2RF2 B;  3TI0 A;  1MN7 A;  3ILO A;  5KFG A;  2KM8 B;  2DXE A;  4A8Q A;  1BUX A;  2RAQ A;  2XHC A;  4WU2 A;  2MQP A;  4TQR A;  1S1U A;  3R6G B;  2Y1R I;  2VJV A;  2C2R A;  2KT3 A;  4U7U K;  2VC1 A;  2D9O A;  2KYX A;  1D8Z A;  2NZC A;  1R7I A;  5HMZ A;  1RWN B;  2XMK A;  2MQQ A;  1LFP A;  2CZV C;  2K3I A;  3K17 A;  2KFN A;  3AFG A;  3W64 A;  4B08 A;  4ZCM A;  2R7S A;  5KG1 A;  3JAM U;  1DLO A;  3M2V B;  4PUO A;  1CPZ A;  4LSL A;  2VG5 B;  1QUV A;  2GC8 A;  2M0G B;  3U27 A;  5LMN F;  3AH6 A;  3CTR A;  3KXD A;  1VMB A;  3ZO7 A;  2EFP A;  5HK4 A;  3QSI A;  5HQL A;  2OML A;  4F4A A;  3SDE A;  2HAI A;  4OZ5 A;  3C66 A;  4DSI A;  4FF1 A;  1EQM A;  2L9N A;  3QO9 B;  2HFV A;  3HHL A;  5EWE A;  3FCV A;  4ZIT A;  5HQ8 A;  4F3O A;  5DET A;  5A8R B;  2J0Q D;  4NLW A;  3RZA A;  3RRH A;  2ZJP Q;  2BVZ A;  3HHL C;  2H5I B;  4I6W A;  2C3Y A;  4LRA A;  1SCJ B;  5DDP C;  2AHO B;  1C0U A;  1JXV A;  2UUC J;  1KP6 A;  3L7U A;  4OI4 A;  2YKO A;  2CRL A;  3D28 A;  3ZZR A;  3KLH B;  4B3O B;  4HDG A;  1PCA A;  3DRX A;  2KXH A;  4LIW A;  4P74 A;  4WFX A;  4TKT A;  5E2Q A;  2HW3 A;  5IV4 A;  1HKA A;  3WZ0 A;  4WWS A;  4LSN A;  4DV7 J;  3MMC B;  1EX8 A;  3MWB A;  1SKR A;  2VOP A;  4YOE A;  2A1B A;  2IRY A;  4CO5 A;  3FZB A;  4YB1 P;  1HNX F;  3GV5 B;  3Q24 A;  3GR1 A;  2KJW A;  4QJV A;  4YEA A;  3W2V B;  5KT5 A;  4O4G B;  3CUN A;  4HTJ A;  1X5S A;  2GGP A;  1Z1Z A;  1YVF A;  4CLS A;  5KFH A;  2AYM A;  5C2G A;  2NXU A;  1C4C A;  1LOU A;  2HFZ A;  3BGR A;  3GB0 A;  3MEG A;  2DRD A;  4PG6 A;  4F7V A;  3MMA B;  3OFE A;  2ZM6 J;  2XNR A;  1RYS A;  3EMT A;  2DGO A;  3N9U C;  2QMU B;  1H3D A;  2D3Z A;  2GQQ A;  3FEZ A;  3TVY A;  4EYH B;  3T9N A;  1HR0 J;  3CDA A;  4WF9 Q;  2V4R A;  3FGV A;  3HZE A;  3ELH A;  3UDE A;  3W62 A;  4QYZ K;  4USK A;  4UST A;  4ECR A;  5L1K A;  2E29 A;  1IXK A;  2HRU A;  1LXN A;  2BE2 A;  3MM6 A;  3VAJ A;  1J5E F;  4DPW A;  4OFZ A;  4A48 A;  1L3K A;  2F9D A;  2BJ1 A;  2Q6C A;  1OIA A;  1VRT A;  3HHD A;  3R97 A;  1SL1 A;  1KHW A;  1CVJ A;  3D68 A;  4YDX A;  1PYS B;  1LK5 A;  4ZN3 A;  2QT7 A;  1YBT A;  4ZPD A;  1NJY A;  1I6J A;  1FRK A;  1LNQ A;  3D0I E;  3DGP B;  3POT B;  3RR8 A;  1NDK A;  3VQT A;  3CCV S;  2QSF A;  2MZ1 A;  2HQC A;  2FPH X;  3DLG A;  4H4M B;  3FDS A;  1X4A A;  1U49 A;  2OPR B;  1N32 F;  4YR0 A;  2GQ2 A;  2C2N A;  2Z2Z A;  2CPF A;  2G0I A;  5BYR A;  3DOL B;  4RO0 A;  4ZHR B;  2Z2Y B;  3M8P A;  3G4S S;  3PX0 A;  1DQ9 A;  4M5D B;  3W61 A;  4P10 A;  3MUR P;  5RUB A;  3MR6 A;  3MEE B;  4O0N A;  2AQ4 A;  1JLC A;  4EBD A;  1H38 A;  2IMW P;  2GJ2 A;  2HS0 A;  2ZOM A;  3CO9 A;  4I2Q B;  3BQ0 A;  3OTO F;  4OJ3 A;  2CFX A;  1X0F A;  2UXC J;  1WAC A;  3LF0 A;  2KZM A;  2EXU A;  2HIY A;  4O0I A;  3M2R B;  1FVS A;  2AJ4 A;  4NYZ A;  1W26 A;  1CC7 A;  1SB6 A;  1PG5 B;  1FER A;  4F36 A;  4F26 A;  4DV2 F;  4LQ9 A;  2MHE A;  3V81 A;  2FVC A;  1MU2 B;  1MMD A;  2QA4 S;  4B9L A;  4F2S A;  1IWG A;  1RAO A;  4Q5V A;  4QYR A;  3PO4 A;  4I69 A;  4PPD A;  2BE7 D;  4PQU B;  2ERR A;  2CVE A;  5BYS A;  2MLX A;  4Q2M A;  3DXB A;  4ZVO B;  5L1L A;  3LPY A;  5HMY A;  1NME B;  3VCD A;  1RE1 B;  2DNH A;  4FYV B;  3KK3 B;  1O51 A;  2C1E B;  1NJI T;  3KHL A;  4NLX A;  4C8K A;  2CQ1 A;  2OKQ A;  4ED4 A;  5GAD U;  3DU5 A;  3C15 A;  3VF0 B;  3OR1 B;  3SBM A;  4DLE A;  3BO2 A;  4U7U D;  4DUT A;  1UVK A;  1UJ6 A;  5I3U B;  1WF2 A;  4FS1 A;  2M4M A;  1JLB A;  3JSM A;  1WDD A;  1G3O A;  2XBP A;  3G6E S;  1YRT A;  2IA6 A;  1RTJ B;  4P2F A;  3IO1 A;  3PRD A;  1U1M A;  2OSR A;  2VQE F;  4QU7 A;  5KFV A;  3C8Y A;  1RAH B;  3BKU A;  2OP5 A;  4DR6 J;  3JSB A;  2HQD A;  1IKW B;  2HGL A;  3KMQ A;  3C46 A;  1DTQ A;  4P75 A;  3L7P A;  3H4B A;  3IA0 A;  3GMG A;  3GFH A;  4OYO A;  2F4F A;  1IJE B;  4Y65 A;  2N4C A;  4DL3 A;  3TRG A;  1HBU A;  2QYC A;  4J37 A;  4EWT A;  4UQT A;  1UW9 A;  2LQJ A;  3KJV B;  4NCA A;  3KLI B;  1UVM A;  3IC1 A;  3IGV A;  3NRB A;  4OI1 A;  4C3M A;  1GXU A;  4DG1 B;  5KAK A;  5T14 A;  4JI2 F;  2ZOF A;  2B4P A;  2B7C B;  5D15 A;  3DOL A;  2ILY A;  2KB2 A;  3FBB A;  1TMJ A;  3DNC A;  4M5M A;  2O3D A;  1QJH A;  2XLI A;  3ZTO A;  3PYD A;  3GV7 B;  4JYA F;  4DBQ A;  3JXO A;  5CYQ A;  3QGH A;  3MM5 B;  4CO1 A;  1E6V A;  4DSL A;  1U1L A;  2UVW A;  1R8P A;  1KLM B;  1U24 A;  3OXF A;  1RCO B;  4HHJ A;  4ID8 A;  4DSF A;  3RAX A;  5A76 A;  4NXM J;  1N33 J;  5LJ3 Y;  1HD0 A;  1APS A;  3BJY A;  3E3X A;  3M7V A;  4ZPB A;  5HMW A;  2DR7 A;  4X66 J;  4UUX A;  4J9U E;  2ZH9 A;  2LU2 A;  1RBL A;  4PXC A;  1VBZ A;  1VBY A;  1GNK A;  2V6A A;  2DCU B;  3VQS A;  1V5I B;  1HWL A;  4K8R A;  1HNW F;  1NM2 A;  5HRO B;  4TXS A;  1UFW A;  3WHI A;  3QJL A;  4ICL B;  1KSP A;  4Y2C A;  4QOT A;  1WI6 A;  3MOJ B;  4ICL A;  1YJ9 S;  1PC4 A;  1RWW B;  2H9Z A;  2NXC A;  4KB7 A;  2BQ3 A;  3M8Z A;  3Q8V A;  4I64 A;  4HKQ A;  2G0C A;  3CJK B;  3BR8 A;  5KFK A;  4DQS A;  2AYG A;  1QY7 A;  2RIJ A;  2ZD1 B;  1GXT A;  4IOB A;  1RZM A;  3NLC A;  4DG1 A;  4HTI A;  3K0J A;  1R27 B;  3S7R A;  5HJY A;  4TY9 A;  2RS2 A;  3FJ2 A;  4NPO A;  1N36 F;  1Q53 A;  3I9V 9;  3D7S B;  1RT5 A;  4C0O C;  5HP1 B;  2KL8 A;  4DDF A;  4GMK A;  5AJ3 J;  5A8K B;  1R3N A;  4WU3 A;  3ZZ0 A;  5MLC V;  4WK1 A;  3UCG A;  1HD1 A;  2WVF A;  1EJ7 L;  4OYZ A;  3UNG C;  5JJB A;  2GIQ A;  4XDD A;  3KLH A;  1FF2 A;  1PBA A;  2LEP A;  3K59 A;  1PYO B;  4KPC A;  4IOA Q;  2R7O A;  7FDR A;  2HND B;  2KHC A;  3TYT A;  1CJT B;  1WF1 A;  2B6A A;  2U2F A;  2Z4P A;  4O3S A;  4C97 A;  1X4G A;  4AXI A;  1S1X A;  5C25 B;  1FKO A;  1R8B A;  3PEH A;  5A8K A;  2QLF B;  1VHF A;  3VR1 A;  5DQH A;  1VR6 A;  3SIP B;  3Q8P B;  3BYP A;  2DJW A;  1TMM A;  4G1I A;  2HYI B;  2PI4 A;  4NML A;  2ATC B;  1V3Z A;  1XQI A;  1LWF A;  4DQQ A;  1WDT A;  3JYT A;  2G4B A;  4N8O A;  3OTB A;  2AGQ A;  3W9J A;  1N56 A;  4PQU A;  5F8I A;  1LXJ A;  4USM A;  1BE4 A;  1TKX A;  3PW2 A;  4C8N A;  1S4F A;  3LW5 C;  3N6M A;  1TKZ A;  1RB0 A;  3DFE A;  5D4P A;  3IMQ J;  1ZAX A;  4LF5 F;  3DC2 A;  3VAL A;  1KBR A;  1KS2 A;  2EG1 A;  3C15 B;  3MZI A;  2BMB A;  5DLF A;  2HSE B;  3TUZ C;  5L8R C;  2ATL A;  1M5K C;  4V19 X;  4MTP A;  4JBC A;  4WE1 A;  4MKV A;  4EZ9 A;  2VPX B;  1QVF R;  4USJ C;  5J1E A;  1WC1 A;  2UVU A;  2HUR A;  5EWF A;  1R0A B;  5C42 A;  1SIZ A;  3HT0 A;  1BQN A;  3GIL A;  4ID5 A;  5CZV A;  4M5K A;  4RW7 B;  4FP9 A;  5CYM B;  2X3D A;  2HIQ A;  2HLT A;  3AXK A;  4CH7 A;  5I4M A;  3A3N B;  1YI2 S;  2BJE A;  5GVQ A;  5J2Q B;  2LU1 A;  2AV5 A;  2D3O 1;  3BSN A;  4IO1 A;  2HMI A;  1SL2 A;  5DQI A;  1GT8 A;  3QLH A;  3HDS A;  4OX6 A;  2H54 B;  2HBQ B;  1GMW A;  5HN0 A;  3UN3 A;  2HBR B;  2FQQ B;  4IG0 A;  2IM0 A;  1LFW A;  2OPQ A;  1Q16 B;  4A8X A;  1T9Y A;  5HMX A;  5F0W A;  1VS3 A;  2HHH J;  2C3M A;  3S01 A;  8AT1 B;  1TVR B;  4M5H A;  4RNN A;  1T8E A;  4OJ1 A;  1NKE A;  1B0T A;  1QSL A;  3MED B;  3IWL A;  3TUP A;  2ZBP A;  5U47 A;  3PW4 A;  1RAA B;  2YPY A;  3U1M A;  4KFB B;  2CPY A;  2QMW A;  4ECZ A;  1ELO A;  2UU9 J;  2ZIT A;  3CD7 A;  4LRC A;  5BJR A;  1VK3 A;  3CDE A;  3DLE A;  3BBC A;  3PR5 B;  2FHK A;  3J80 U;  3OTC A;  4EO6 A;  3H20 A;  3LGH A;  1WG5 A;  3ZFV A;  3DM2 B;  1VK8 A;  3NEK A;  2MKH A;  3RB0 A;  1PYT A;  1E6Y B;  3OSN A;  1RUS A;  1NXI A;  3A8I A;  2Q79 A;  3RGI A;  3TZZ A;  1HLW A;  4HT5 A;  2A18 A;  4DR2 J;  4LFB F;  4LSL B;  1NUE A;  3MMC A;  1SUQ A;  2Z58 B;  4CQ1 A;  4LRF A;  3GQC A;  1J2V A;  2F7V A;  3M9M B;  1OPI A;  3CJ3 A;  3ILJ A;  3LP1 B;  3H98 A;  3K7R A;  4A8S A;  3BGR B;  2BXJ A;  2CNO B;  2VG6 B;  4USW A;  2HGN A;  4OLO A;  5F3T A;  2GGP B;  1HMV B;  3EWG A;  2C3U A;  1SBR A;  1F5A A;  5SUH A;  2AX0 A;  2VPY B;  5A8R A;  3LAM A;  3ZZY A;  1VQ7 S;  3BDP A;  4G1Q A;  3QSY B;  2W9A A;  3FBE A;  4KPY A;  5KFC A;  3K5N A;  2MSS A;  4NYO A;  2ASY A;  2VG7 A;  2GJF A;  1CJV A;  2DVI A;  1UZD A;  2XGQ A;  1IKV A;  1Z4U A;  2DNN A;  2DO4 A;  4DZD A;  2OEL A;  5MAO A;  1HHS A;  1NK4 A;  4N8N A;  1YIJ S;  5ETR A;  2PT0 A;  3VHQ A;  1S1V A;  5H1S V;  3TZY A;  1QDU B;  3DCA A;  1GMV A;  4R0E A;  4RJV A;  1EAR A;  3QZ7 A;  4ZMM A;  4B3M J;  4C4W A;  2W2Q P;  3E51 A;  2A6O A;  3BSC A;  2NZ4 A;  2XMM A;  1NSP A;  2AJF E;  3BS9 A;  5F0U A;  3W63 A;  2ZEJ A;  4KGK A;  4DX5 A;  1VQL S;  4OL8 A;  4QWA A;  1KFD A;  3BKF A;  4B3S J;  2CG4 A;  3JTO A;  1F3F A;  4NLP A;  5IT9 U;  2VG5 A;  2E1A A;  4K2X A;  5LOQ A;  4L3N A;  2IVY A;  4ZVT B;  3CJK A;  2D1C A;  3MM6 B;  3OPK A;  4CTA A;  3DLK A;  1TL7 A;  4ZK7 M;  2V8D A;  2ZH4 A;  4K4S A;  4HH0 A;  1SIW B;  4RW6 B;  2UUC F;  4UT4 A;  4V19 J;  3PJ9 A;  4IRD A;  1N6Q B;  4KGZ B;  5C7P A;  2XQC A;  3I32 A;  1Y7P A;  4OYI A;  2DH8 A;  1QAI A;  4XIU A;  1WG4 A;  1TFW A;  1XER A;  2DGS A;  1NKB A;  3V2U C;  1Q81 T;  2VJU A;  2YQ3 A;  2K8G A;  2QC3 A;  2RUS A;  2BAN B;  3GCW P;  2MKK A;  1VJQ A;  1GFW B;  2HAF A;  4ILR A;  1UFK A;  2FZC B;  1I3O B;  5GAE U;  1JNZ B;  4PWW A;  4ZPA A;  3TA1 A;  3AOC A;  1KLM A;  4DX6 A;  3HO1 A;  3I4H X;  4G1P A;  1VQY A;  2O67 A;  2ZM6 F;  2H3E B;  4HH1 A;  1O8B A;  1KKH A;  1TR0 A;  5D77 A;  3A12 A;  4BC7 A;  4PG5 A;  3PNI A;  2R2T A;  1HR0 F;  3W8G A;  1S1V B;  4E98 A;  1D9F A;  2CVI A;  1ZYQ A;  2FZG B;  3BGL A;  3T1Y J;  2YX7 A;  1MG7 A;  4PWD A;  2BX6 A;  2LEB A;  3K5M A;  2ILZ A;  2KRR A;  5BR8 J;  3CCM S;  4HLB A;  4CNZ A;  3SSQ A;  4JI0 J;  5C2C A;  3UD5 A;  5AXN A;  2DH9 A;  5KFJ A;  3MUM P;  4F4W A;  3H7H B;  1T9U A;  3QWP A;  1Q5Y A;  2OH2 A;  4RNO A;  2HEK A;  1FXR A;  3M1V A;  4J9V A;  1RBO B;  3OFG A;  4KHP F;  1YJT A;  4AQY J;  2YNI B;  2HQG A;  3A4T A;  3H5S A;  3NS6 A;  1VBX A;  3R2C J;  3KK3 A;  1WEZ A;  1JLA A;  3VV2 B;  3QAU A;  5J2N A;  3CJ4 A;  4J9Q A;  2P8I A;  2B5J A;  2YWG A;  2H65 B;  3CED A;  3R5D A;  2MKI A;  2HK2 A;  1RTJ A;  3CJS A;  4WYL A;  1XMB A;  2BEF A;  2MMY A;  5AE2 A;  5HO4 A;  2BQR A;  4OX8 A;  1KDN A;  2VOD A;  3GFY A;  4P2M A;  4LBP A;  2V4Q A;  4N41 A;  3I31 A;  3R5J B;  1TAU A;  1PJ7 A;  2GO9 A;  2R7X A;  2MLZ A;  5B0F A;  3X3U A;  5E3R A;  3IBF B;  1HWI A;  1HNI A;  1RWK B;  2AYE A;  2MQN A;  4OHX A;  1IBM F;  3GE9 A;  3NGS A;  1X4C A;  4R25 A;  2RF2 A;  2P5V A;  4DV1 J;  1VC5 A;  4DV2 J;  3FUY A;  2MQL A;  4ETZ A;  2G1D A;  5I42 B;  1Q86 T;  3O1L A;  1JXE A;  1JLE B;  1LWE B;  2W7P A;  2PEH A;  3CNQ P;  4IFV B;  4ZS6 A;  3TAM B;  3UW1 A;  1SH2 A;  2HMI B;  2UXD F;  4FPR A;  2JSX A;  2J0X A;  2IC3 A;  4NZ6 A;  2OTL S;  4WXW A;  5CA5 A;  4H4M A;  4ZJO A;  2W9B A;  3DHX A;  2GW8 A;  4IH7 A;  2CQ2 A;  3H5Y A;  4RZR A;  4QIV A;  1IKX B;  1BQN B;  3N01 A;  2X1A A;  1KOH A;  1B99 A;  2NXN A;  3CT9 A;  5L9X A;  3LTO A;  1YJN S;  4LFC F;  1G2E A;  4MIA A;  2AX1 A;  1RWV B;  2F40 A;  1S7I A;  3KKF A;  4ZLP A;  2DHH A;  1XMO F;  4FXV A;  5FD1 A;  1Q1K A;  1PAE X;  3IFE A;  2PFF B;  3EUN A;  3ZZZ A;  1DJ0 A;  1W25 A;  1XIQ A;  3BQ1 A;  5L9N A;  2W9B B;  2VQE J;  1ZA1 B;  2YTC A;  2CQH A;  2M70 A;  2XZT B;  3RG6 A;  1EET B;  3KLF B;  3IR6 B;  3HVA A;  2GMH A;  2NXJ A;  5B0B A;  4C9D A;  2NS1 B;  2N7C A;  3TR5 A;  1J5O A;  2PA3 A;  1WHX A;  1N34 J;  1B3T A;  1WSR A;  5FLX Y;  2J9D E;  1RHU B;  4LF6 F;  3CGI A;  4TYB A;  3IAS 9;  4ILM A;  4ENO A;  4U9R A;  2BBE A;  2GJI A;  4Q0B B;  4GKK F;  7FD1 A;  5DDO C;  1IM4 A;  3MUV P;  3NGU A;  3EXY A;  3TQE A;  4CIO A;  1SKW A;  2HFO A;  2P9E A;  1S59 A;  5K20 B;  4YR3 A;  2CJA A;  4KH1 B;  4CLF A;  3P3D A;  3G6V A;  4J9L A;  1VC0 A;  2GIF A;  2WZ1 A;  4ECU A;  3OSP A;  1HI8 A;  1R31 A;  4B9U A;  3VTI A;  1VQO S;  1UL3 A;  2FJA B;  2IRX A;  2QL9 B;  3SV4 A;  2MHN A;  2W24 A;  2WVE A;  2ZDP A;  4I7F A;  3NWR A;  4OZ1 A;  5ETT A;  3HVR A;  4ECV A;  3IRX A;  3AJ1 A;  4UZC A;  4HHH A;  1LWF B;  2ROG A;  3MCN A;  2M2B A;  5I3P A;  1VFJ A;  3FSI A;  3KK1 B;  2HPU A;  3A8E A;  5HLF A;  1NJX A;  4OHV A;  1D0E A;  1K1Q A;  4KQZ A;  2DR9 A;  3OTD A;  4O3Q A;  4ZCK A;  5HL7 Q;  2DY1 A;  1YJV A;  2ZE2 A;  2ADB A;  4DF8 A;  2CYY A;  3PYG A;  4HAC A;  2IAJ B;  2JLG A;  3GYN A;  3HZG A;  3SDE B;  5KFO A;  3EZ5 A;  2IRU A;  3DRP B;  3TQ1 A;  2B6A B;  1NK9 A;  2EFO A;  2X1G A;  4IDK A;  4OZ0 A;  4ED1 A;  5HQM A;  3R7N B;  2I5J B;  1SQE A;  2MZJ A;  4FNI A;  1RLD A;  2XMJ A;  1NAQ A;  1KVK A;  2AGO A;  2NQP A;  4LR8 A;  2UXC F;  2BW7 A;  2CG8 A;  2OPS A;  3H5U A;  5HVH A;  1NCL A;  1U0H B;  1DUR A;  5FLX U;  3BQ2 A;  4A8M P;  2EK1 A;  1AA1 B;  2O5D A;  2R7T A;  2V94 A;  1AW0 A;  1P6T A;  3JB9 k;  3C14 A;  2HHQ A;  2ZOG A;  1JKH A;  1N36 J;  3ETM A;  3MD3 A;  4Z2X A;  2Y9H A;  4DV5 F;  1GK8 A;  1N5Y B;  3GFZ A;  1N4L A;  2FHJ A;  3DLK B;  4FYY B;  2KDO A;  5AJ3 F;  2BOP A;  1A6L A;  2Q66 A;  2DGX A;  3I0S A;  4JI6 J;  4ZJL A;  4C8L A;  1YZ6 A;  2VA2 A;  2JEI A;  4CO0 A;  1FNM A;  3GTY X;  5E3P A;  5A8W A;  3CO0 P;  3GON A;  4H4K A;  5KG4 A;  1FJE B;  2F1F A;  3ENW A;  4ELU A;  4KH0 B;  5J2P A;  3NS5 A;  2IHR 1;  4X4V A;  2C42 A;  4HT7 A;  4PWD B;  3G8Q A;  1BXN A;  2MYF A;  1NHU A;  3ZTP A;  2DKO B;  3F44 A;  2WCX A;  2A2C A;  4FYW B;  4UOG A;  5H9E J;  1V9O A;  5LSO A;  4WZQ A;  3Q8R B;  3WIV A;  8RUC A;  3BN7 A;  1PC5 A;  3HFK A;  3LH2 S;  2ZHB A;  1VBK A;  2VHG A;  1S0N A;  2PMW A;  2CQ0 A;  1FFW B;  1G7C B;  4JV0 A;  1ULR A;  4QQB A;  1RK8 A;  1GMU A;  1X4H A;  5F8H A;  5LMN J;  2FJX A;  3AD7 C;  1CS4 B;  1REV B;  2GX8 A;  2E1R A;  2NPI A;  3DMJ A;  1A9N B;  4PEO A;  2A0F B;  2Z30 B;  3UD3 P;  1SH3 A;  1R89 A;  2HGM A;  3X1L B;  1FDA A;  3EJM A;  4OYP A;  3KLE B;  3QJJ A;  1S6Q A;  4E2F B;  2RNE A;  4QU6 A;  3G2X A;  4ID5 B;  4JI2 J;  2H5E A;  2WVC A;  3TEH B;  2F8H A;  4KR0 B;  1UA1 A;  3GSI A;  2AEM A;  1IKV B;  4FYX B;  2BZ2 A;  1RT3 A;  2P6S A;  4H54 A;  2E66 A;  4IYQ A;  3CJ8 A;  4JYA J;  3LP0 B;  3UR3 C;  4BCA A;  3J7Z 5;  2RRB A;  5A8W B;  2UUA J;  2FC9 A;  4JV5 J;  1LKZ A;  3DRR B;  4UF4 A;  2MKY A;  5DZ6 A;  1NPP A;  1TU0 B;  5E3C A;  2MST A;  1RHM B;  2W01 A;  3E8O A;  4LR9 A;  5DDQ C;  4HYK A;  5GAH I;  3Q0A A;  1DAR A;  2DHS A;  1HNX J;  4IOC Q;  3C14 B;  2RU9 A;  3MPW A;  5A2Q Y;  2NSB A;  3R2D J;  1JLG A;  5D4O A;  5E3A A;  5K9F A;  2QO3 A;  2CJB A;  1IJF B;  2GML A;  1RCX B;  2W2M P;  4KV8 B;  4DEZ A;  1LWC B;  2YNI A;  3JS9 A;  3LWM A;  3N5B A;  4M5J A;  3HSG A;  3D1O A;  4KSE B;  4ECS A;  3OW2 R;  2ZZM A;  1FVQ A;  2I0X A;  4X84 A;  3MFH A;  3HFV A;  2W9C B;  2C2E A;  1EP4 B;  2GIR A;  3W3S A;  2K7K A;  1DTT B;  5IC6 B;  3GIK A;  4Z7Y A;  2XM3 A;  1WKL A;  4Y6I A;  3OT9 A;  3T5K A;  5D3G B;  2QJ3 A;  4L75 A;  4NLQ A;  4WCE Q;  3CCL S;  3C2P A;  3KTQ A;  2H5J B;  2HVE A;  2IJR A;  2PC6 A;  3A8K A;  1HW8 A;  4XO0 A;  1Z2L A;  2EEY A;  1QE1 B;  2Z56 B;  3IR5 B;  4I56 A;  3T1A A;  3K5O A;  5ETS A;  1UJ4 A;  1QAJ A;  1S6Q B;  4LQ3 A;  4IRK A;  4QYZ J;  3F41 A;  2CZ4 A;  3I56 S;  2OFH X;  3EVM A;  1ARO P;  1Q82 T;  4R5P B;  3HKW A;  1AUD A;  2CWK A;  4ZVR B;  3CCW A;  2BM1 A;  2AIR B;  2HHS A;  1XR6 A;  4DV4 J;  2HZV A;  3OL6 A;  1BLU A;  2V8V A;  3OHB A;  4W92 B;  2JJ4 D;  4OI6 A;  2V5H G;  3UWT A;  2CQG A;  3FC9 A;  4C8O A;  2PN6 A;  1PJ6 A;  4OV6 A;  5GME A;  4P9S A;  3T41 A;  5D4L A;  2RIL A;  2VB6 A;  3K5P A;  4CLZ A;  3NMA A;  2E7X A;  5LJ5 Y;  2BA9 A;  2L3M A;  1EIY B;  2GHV C;  3MR3 A;  1RT6 A;  4O3N A;  3MHY A;  2J9E A;  3PW5 A;  4M94 A;  1VIS A;  3GCX P;  2DGT A;  3OD2 A;  4JI8 F;  4IO9 Q;  4O44 B;  1DBD A;  4DPO A;  5B09 A;  3ISN D;  5J2Q A;  4QIW D;  4ATN A;  2HLU A;  1KQK A;  2NSC A;  1H74 A;  3KDN A;  4KGV B;  1RTH B;  3QNW B;  3R7S B;  1R0C B;  4X62 J;  2RRN A;  1TKZ B;  4YFU A;  1H2T Z;  1RTH A;  1WC4 A;  2W2P P;  4WBF A;  5B7W A;  4F2R A;  4X4Q A;  1MNE A;  4L6V 3;  2QFJ A;  2HHU A;  3KOA A;  1S9G A;  3O5T B;  4ETX A;  4KO0 B;  4HR2 A;  2KN4 A;  4PXB A;  2AKW B;  2YKQ A;  3AAW B;  3P4U B;  1Y9O A;  2PFD A;  2XHW A;  3DYA A;  4OQJ A;  1WTF A;  5I3Q A;  1VQ5 S;  1QTM A;  2V68 A;  3P49 B;  1M5P C;  3ETO A;  4TLR A;  2VDI A;  1YWX A;  4K4U A;  3CJ0 A;  2J8S A;  2YKM A;  3PG9 A;  4EUV A;  3BPD A;  1L3S A;  2E7V A;  1TKX B;  5GAG U;  1VQ6 S;  2N82 B;  3BBB A;  1WF0 A;  4URS A;  1HQ2 A;  2A10 A;  3G82 A;  4TN2 A;  3TVZ A;  4YME A;  3PKM A;  4ES1 A;  2J7U A;  1R6Y A;  1VQP S;  1I1G A;  4JI3 F;  4DV7 F;  4CT8 A;  1PAU B;  3UVJ A;  1SJ1 A;  3KLI A;  2MEW A;  2IM1 A;  3MXH P;  2G9O A;  2VV5 A;  4RW9 B;  2VPW B;  2NR0 A;  3IBW A;  5DGB A;  3IBC B;  2QIF A;  3QRR A;  3CE8 A;  2KVQ E;  3F0N A;  3GU0 A;  4UTG A;  3GFX A;  1H7W A;  1ZZN A;  1RT4 B;  1N5V A;  4DSJ A;  4DSE A;  2HNZ A;  4P52 A;  2FZK B;  3NS7 B;  2RVJ A;  3PHT A;  1ZM2 A;  2GCF A;  1RHQ B;  4KYZ A;  3CUL A;  4HI2 A;  1FJC A;  4ED2 A;  2VAS A;  5T7L A;  4ZPT R;  3AJ2 A;  4Y2A A;  2G0J A;  4DUZ J;  3PM9 A;  3PYF A;  4OJH A;  4LVO P;  4F4K A;  2C28 A;  1XNQ J;  2XSJ A;  5A0Y B;  3J80 Y;  2ZH3 A;  1GTE A;  3QO9 A;  4X4S A;  2FVQ A;  2KXN B;  3BN4 A;  2BRL A;  3PFO A;  1ZOT A;  1WWH A;  1NBE B;  4J9S A;  2FD2 A;  2NXE A;  4DL4 A;  4JI1 J;  2VDH A;  4F0K A;  3V6D A;  4FF3 A;  4UY8 5;  3B4D A;  4YB6 A;  5KFR A;  4LRB A;  2VIH A;  5HAN A;  1S99 A;  3BM7 A;  1QD1 A;  1FA0 A;  1WHV A;  5CCL A;  4ZCI A;  1RDR A;  1RT4 A;  3I82 A;  3QBC A;  3SYZ A;  2GA7 A;  1T03 B;  3UI3 A;  1B64 A;  4A8W A;  3OR2 A;  1P9Q C;  1S1T A;  2FB0 A;  3DRS B;  5KFX A;  3TX0 A;  5IV3 A;  2ZE2 B;  2EWH A;  2MGZ A;  2WW8 A;  1RP5 A;  1ZZF A;  2V4J A;  4JUZ A;  4AND A;  4DR7 J;  4O3R A;  1SC3 B;  3EXC X;  5KFT A;  1Q0N A;  4LFB J;  1D3W A;  2QLJ B;  4AYB D;  1JQG A;  3ISN C;  3M2R A;  3H2U B;  2Y1I A;  3F56 A;  3IWX A;  2ZJQ Q;  2MZQ A;  1Y3K A;  2OLW A;  3LAK A;  2ZUA A;  1ZTT A;  4DFK A;  1S57 A;  4RWX A;  1WOP A;  2IDE A;  3B4M A;  2K2P A;  4K4Z A;  1X4D A;  3D5M A;  3VAF A;  4NWB A;  1HQU B;  4F04 B;  4EBC A;  5DG9 A;  2FJD B;  1EHW A;  2ZH2 A;  1SJR A;  2FHM A;  1T9T A;  3FCW A;  1N5T A;  1NK8 A;  1E6V B;  2DEI A;  5EGY A;  4TNO A;  3MPU B;  1VC6 A;  4LJM A;  3BYR A;  3N28 A;  4P6Q A;  3SCK E;  4W90 B;  3ZZT A;  3BO4 A;  3DGP A;  3POT A;  4OJG A;  2EFG A;  3DOK B;  3I96 A;  2X7I A;  4LBH A;  2F5G A;  2O01 C;  2YX4 A;  4BBY A;  1IBM J;  2DRB A;  1UEV A;  4PG7 A;  4OX7 A;  5J2P B;  1YJR A;  3BGO P;  5DDR C;  3EGN A;  3I5A A;  2NYH A;  1WHW A;  5J1E B;  5HBM B;  3NXZ A;  2HKE A;  4PCQ A;  2JFK A;  5CQG A;  1N48 A;  3GIR A;  1WC6 A;  2R7R A;  1QUP A;  4QBU A;  5ETP A;  2BJD A;  2DGQ A;  4LFA J;  1QLN A;  1I51 B;  4B3S F;  2VF3 A;  2ZC3 A;  4KRW A;  2CPI A;  4KT0 C;  2FTR A;  3NBP B;  2ZHO A;  4RNF A;  3AY0 A;  1NZ8 A;  2DYA A;  4K59 A;  4KAI A;  1KQF B;  5LM7 E;  3MEG B;  3G6Y A;  4FBU A;  1RAI B;  2PI5 A;  4OYW A;  3IP0 A;  4ED6 A;  5ETQ A;  1U1N A;  1NHV A;  2C2M B;  1NH7 A;  2R3V A;  3OFF A;  1JLB B;  3PV8 A;  1S49 A;  1N52 B;  3UNY A;  4KGM A;  2EW9 A;  3D6T B;  2OJ3 A;  2UUW A;  4DPU A;  1JLF A;  4K4Y A;  1N0U A;  2C22 A;  2D3U A;  1UVL A;  2HZA A;  1RA6 A;  3AQO A;  4WK3 A;  1Q78 A;  2I2Y A;  3U7J A;  2E5L J;  1TL1 A;  4OZ3 A;  3I5C A;  3KG4 A;  2NPF A;  3SQG B;  4CO4 A;  4X2B A;  2R2R A;  5ADZ A;  1YRX A;  3QMQ A;  2CQ3 A;  1NB2 A;  2XWY A;  2CIM A;  3DXS X;  1VOM A;  3BRE A;  1NSQ A;  5LSR A;  3EPI A;  3M05 A;  1M1K T;  4G1Q B;  4M5D A;  2GVZ B;  3PRV A;  1PGZ A;  3BF4 A;  1BGX T;  1MU2 A;  2IIH A;  2UZA A;  3JQM A;  2QFI A;  4DR3 J;  3KLE A;  3D6F B;  2DGU A;  1HMV A;  4RLE A;  1U25 A;  3H25 A;  4M5I A;  3H90 A;  2AD9 A;  4TYA A;  3IRX B;  4KIA A;  1FD8 A;  2B5J B;  2AWZ A;  2CPJ A;  2G2Z A;  3QT7 A;  4MIW A;  1TK0 A;  4UY8 T;  3EGW B;  4XK8 C;  2WTF A;  3AXM A;  4IH6 A;  4CLY A;  4QIG A;  2E5G A;  2F63 A;  3PTW A;  1NK5 A;  4L74 A;  4USI A;  2AEF A;  3M30 A;  3MPD A;  4DR5 J;  3K58 A;  3T9Z A;  2ZD1 A;  2DNK A;  4FNH A;  5G0R A;  3T6B A;  3HD2 A;  2W4P A;  4DR4 J;  4ZHR A;  2ZH8 A;  1KLN A;  3DKD A;  3VGT A;  2B43 A;  2V8P A;  2W25 A;  3BH6 B;  4KY3 A;  5IXU A;  4OX9 J;  2MQ8 A;  3V6K A;  4Z37 A;  1FWK A;  3BZQ A;  3MTK A;  4DLG A;  4KHP J;  4AQY F;  3MD1 A;  1T05 A;  4HVZ A;  1WUU A;  2FHJ D;  1UAW A;  1FCA A;  4DI6 A;  1RTD A;  2ROP A;  5DS7 A;  3EM1 A;  1CJK B;  4B02 A;  2QE5 A;  3OFH A;  1FTC A;  4FPI A;  5EDW A;  1OSD A;  1IR2 A;  2IYI A;  1RWU A;  3QRP A;  1FO1 A;  2ZJR Q;  1RQ0 A;  4I68 A;  3MED A;  3AD9 C;  1IR1 A;  2M5Y A;  2G1H A;  3IGN A;  3SFU A;  2J8A A;  1KVJ A;  1F1B B;  1ICE B;  2QGF B;  1AXQ A;  3TZX A;  1KD1 T;  5CAB A;  3HJF A;  2RKI A;  2CPE A;  2IM3 A;  4DU7 A;  2IVM A;  2OMO A;  1K1S A;  3TWZ A;  4WP9 A;  2MZT A;  1YZ7 A;  5HSP A;  4J9P A;  2NYI A;  4DR1 J;  3R1H A;  3Q22 A;  4Q44 A;  4ED0 A;  1L5U A;  2CQC A;  2YNH B;  3OQ2 A;  1MWZ A;  1RI7 A;  5D0H A;  3ADA C;  5FDL B;  4CLL A;  3FNN A;  3QRQ A;  2M8D B;  2M7S A;  2OPP B;  2XZD B;  1OY8 A;  2SXL A;  3C19 A;  3TEG A;  3Q8S B;  5F9L A;  2CDR B;  4G6V B;  3W9I A;  3DMJ B;  5KFB A;  2LLZ A;  4MYU A;  3GYG A;  3NCP A;  4PAA A;  4OYB A;  2UXD J;  3BDE A;  4LRE A;  4JV2 A;  1VLY A;  1Q8B A;  1CBK A;  4CH0 S;  1RGV A;  3MPY A;  1TL7 B;  4MAK A;  2XS5 A;  5DG7 A;  2I1R A;  2CWX A;  3NOG A;  5C24 A;  1X8D A;  5E33 A;  3IN5 A;  2NUH A;  2F8E X;  3FFI A;  3IG1 B;  4BLG A;  4IUF A;  3SV3 A;  4DFJ A;  2OFG X;  1HWU A;  4O23 A;  3TW0 A;  3KLG A;  1JIH A;  1VIO A;  4C8M A;  4WE1 B;  3W66 A;  3CCR S;  2C2D A;  1DFD A;  3W60 A;  2PD1 A;  1F5C A;  1Q4R A;  2OEJ A;  4MK8 A;  1U4B A;  2XB2 D;  2QA2 A;  2OI2 A;  1QTN B;  1VRU B;  2V2Z A;  4NX9 A;  5GAD I;  1N5S A;  4LF5 J;  2RD5 C;  1UET A;  5JXS A;  1UWB A;  4ZP6 A;  2W4C A;  2DEJ A;  4RUH A;  2MGZ B;  2DR5 A;  1H6K X;  1U02 A;  1TUG B;  2BE9 B;  5IWA F;  4L72 B;  1YJW S;  2IBK A;  4ED8 A;  1U1P A;  3OHA A;  2D9P A;  3RYL A;  3KJF B;  2JEJ A;  3TUI C;  1N34 F;  5IM0 B;  1M0S A;  4ES3 A;  3IM9 A;  1HHT P;  1HI1 A;  3PY8 A;  3CME S;  1FRI A;  2Q6B A;  4WFZ A;  3LWL A;  2JC0 A;  2NCK L;  5CH7 B;  3DRR A;  3VAH A;  1FES A;  3JSY A;  4LSZ B;  1ZA2 B;  2LQ5 A;  3MM7 B;  3I0R A;  1FKO B;  3QFW A;  5ITH A;  1MW7 A;  3UFC X;  4LF4 F;  1SKU B;  3P45 B;  1X60 A;  1J5O B;  2B9W A;  5HLF B;  4RU9 A;  1VRU A;  2MY8 A;  2CJY B;  4A47 A;  2BM0 A;  3CJR A;  1R8C A;  3TVK A;  1FFS B;  3G82 B;  3M4X A;  2ACY A;  3BH7 B;  1RHJ B;  4IG3 A;  1TL1 B;  4Y00 A;  3MEE A;  4HAC B;  3FKB A;  4JV5 F;  1HNV B;  2HVD A;  1TK8 A;  1L3V A;  2ZZN A;  1GH8 A;  1HAR A;  1SL0 A;  4RL1 A;  3LA0 A;  3TNV A;  1NDL A;  1WKJ A;  2M52 A;  3VZI A;  3M8S A;  2UU9 F;  5D78 A;  4GKJ J;  3M32 B;  2E1C A;  1S9G B;  3OTE A;  1M5O C;  2HRT A;  2XYH B;  3THT A;  3M8Q A;  1R43 A;  3TO8 A;  4NE9 C;  2ZUG A;  4MKB A;  2R7Q A;  2CPX A;  1ZH5 A;  1RTI A;  4EYI B;  1SVD A;  4QZV B;  1CQM A;  1HHQ A;  4DV3 J;  2YBV A;  2N3O A;  5I42 A;  5H9E K;  1SH0 A;  1RHK B;  5KG6 A;  2JZ5 A;  3FK4 A;  2E5I A;  2EFQ A;  2J9D A;  1F5B A;  3DLH A;  4TY8 B;  3RBD A;  3NGK A;  3PDN A;  1B0P A;  3VGV A;  3LO3 A;  4R8U A;  2QLW A;  4C3K A;  3D67 A;  4GC6 A;  1CJK A;  3N6N A;  2R7W A;  3C16 B;  1NB7 A;  4CLK A;  1ACM B;  2LXU A;  2IM2 A;  3M8Q B;  4ZVP B;  1P1L A;  4RW4 B;  4ZPW R;  4OHZ A;  1Y3J A;  5T41 A;  5HVG A;  4DV4 F;  4AE5 A;  2VA3 A;  2F9J A;  3QPI A;  4FXD A;  1T02 A;  2V8H A;  3HVW A;  1NZA A;  4ZP7 A;  4K0K F;  2BW2 A;  5M2R A;  1OJ4 A;  1RT1 A;  4NLU A;  2YWW A;  2B3T B;  2DNR A;  4C98 A;  2OUG A;  2ZHA A;  3M1V B;  4GVB B;  3VAI A;  4I67 A;  1RLC L;  4K5R A;  5KT4 A;  4A8K A;  1JWW A;  2APO A;  1IUJ A;  1XWL A;  1RAB B;  2P2C B;  3HKZ D;  4ALZ A;  1UW4 A;  4DZ6 A;  4ES2 A;  2DPJ A;  1S9E A;  2FLL A;  1SC6 A;  4FF2 A;  1PO6 A;  2VIC A;  3AT1 B;  4LR7 A;  3NCQ A;  3ZZO A;  2ZH6 A;  1X9M A;  1QSS A;  3RRK A;  3JQJ A;  1GX5 A;  2I6W A;  4QPT A;  4UOC A;  4X62 F;  4DV1 F;  1JLF B;  1G4C A;  2WB4 A;  3EZU A;  5E3Q A;  4C6A A;  3GYX B;  3MMB B;  2JNJ A;  4W4M A;  3OVS A;  3L09 A;  4ZIW A;  3MMB A;  3RB3 A;  4DQI A;  4A4J A;  1JJ2 R;  3PYE A;  2QSW A;  1J27 A;  1JLG B;  2BRK A;  1RAD B;  3LP2 A;  2QRR A;  4YB7 A;  3P96 A;  2E9T A;  2Y0S D;  2VKR A;  3S1T A;  1IM6 A;  1FKA F;  2YWE A;  2K1R B;  1FWP A;  4LF7 F;  1U47 A;  4DXL A;  3CWJ A;  3HT3 A;  2VFS A;  4HDH A;  4PWU A;  3NNC A;  4WFA Q;  4TQS A;  1C0T B;  5B0A A;  1P8G A;  2YH0 A;  4LIR A;  2B8Q A;  2E7W A;  2V2K A;  4ZLJ A;  4OIX A;  2GO8 A;  4WTO B;  1E6Y A;  4DL7 A;  2FJE B;  2H48 B;  5A2Q U;  1TL4 A;  2CQD A;  2V2Q A;  4WYW A;  4ZJQ A;  3DDN A;  1M5H A;  2C3O A;  5IZH A;  1NK0 A;  3DLE B;  5DGA A;  5IS2 A;  1P9Y A;  4ZIV A;  2RU3 A;  1HPZ A;  1ZPV A;  3NAH A;  2GVZ A;  2JVR A;  1S72 S;  4WFB Q;  2W8L A;  2QYG A;  1UVN A;  3FEX B;  5IC4 B;  2YPZ A;  2D69 A;  3T1H J;  3ONQ A;  2CJ9 A;  1NPR A;  3DN9 A;  2KG1 A;  4LT6 A;  3NKY A;  5F3Z A;  1NO8 A;  4RW9 A;  1S9E B;  5DQG A;  3H42 A;  4OYA A;  2XO7 A;  1Q95 G;  3ZZU A;  1RYR A;  1XJW B;  4IG0 B;  3W8P A;  3MM9 A;  5E0O A;  3MDF A;  3QWU A;  1XNQ F;  2GZO A;  1RIS A;  1NHK L;  3HSD A;  1KHV A;  3MEC A;  4NA2 A;  2BJ3 A;  2DIV A;  1M1G A;  2KKH A;  2XCA A;  1M1H A;  4U6P A;  3NY0 A;  5BR8 F;  2Z2M A;  4U8Y A;  3BPS P;  4K4W A;  2RQK A;  1LW0 A;  3AD8 C;  1HBM A;  2H1Y A;  3BEG B;  5HVF A;  4JI0 F;  4PPZ A;  4U96 A;  1N6Q A;  2FIU A;  1XC9 A;  5GAH U;  1CS4 A;  1REV A;  4RW6 A;  2XS7 A;  2KTQ A;  3BSO A;  2DNY A;  1CJU B;  2ZBC A;  4ZPC A;  2J6U A;  1WOR A;  2CUY A;  1NLK L;  5CD4 H;  4DR7 F;  2J9C A;  3CB4 A;  3MUT P;  1VQK S;  1O0P A;  1ZS6 A;  1YIT S;  1I94 F;  2FLN A;  3M8R A;  1JB0 C;  4B3T J;  2HVZ A;  3HHE A;  4K50 A;  3F73 A;  3HSJ A;  3TJ8 A;  2CDQ A;  3GR0 A;  2FYX A;  2Q3P A;  4WFY A;  1QSY A;  4ZKA A;  2KM8 C;  4MIB A;  4CDI A;  5CYQ B;  4PAB A;  2HZC A;  2R8J A;  5A6W A;  4JI8 J;  2B56 A;  3JQK A;  2QMX A;  4PRF A;  3OL9 A;  3RU0 A;  4CTA B;  3MCO A;  1LV5 A;  1X5P A;  2LYV A;  4GO5 X;  1C0T A;  2QEX S;  1AYE A;  4RW8 A;  4Q8F A;  2DIU A;  2G2O A;  2VQF F;  3HUL A;  4D3H A;  3J7Y U;  2YNF B;  4K4V A;  3G71 S;  1FDB A;  3VGU A;  3N79 A;  3B82 A;  2D7S A;  3FMW A;  1M5V C;  1UWA A;  2N3L A;  2PSZ A;  3LAN A;  2V2V A;  2RSQ A;  3LGM A;  2QX0 A;  1HIY A;  4RR5 A;  3A13 A;  4ZCL A;  4R5P A;  3DU6 A;  4NMX A;  4X4R A;  2VZ9 A;  3UD4 P;  4JI6 F;  4EZ6 A;  3D1H A;  4RNH A;  1YJU A;  3H5X A;  3THV A;  5J2M A;  1YBU A;  3KNG A;  3QAT A;  3UVJ B;  5M2U A;  3OV7 A;  4NXN F;  2IY5 B;  4KFB A;  2MDA A;  4NI2 B;  2I5J A;  4XPC A;  2RML A;  3AOA A;  3OL8 A;  4EEY A;  2BV3 A;  3CDW A;  1XNR F;  2LQ9 A;  1RWO B;  3LQV A;  4LFC J;  3KHG A;  4N5S A;  2V34 A;  1XMO J;  4ELT A;  2DR6 A;  5I3U A;  2W4D A;  2OPQ B;  2ZZT A;  1SUQ B;  2M8H A;  4OYM A;  1T03 A;  1GTH A;  1RT5 B;  1X4F A;  1NSK L;  2N4D A;  3ENV A;  3EVO A;  4J9R A;  3MCM A;  2ZFH A;  5EUH A;  2H4W B;  4DCP B;  1U2C A;  2QV6 A;  4ANE A;  4C0H A;  1PJ5 A;  1GMW D;  2VD3 A;  2EBG A;  3LUY A;  3NG8 A;  4J9N A;  1JLQ A;  5JUM A;  4LF6 J;  5IFM A;  2KT5 A;  2ZKU A;  2DNO A;  2HVI A;  4F4X A;  4DJB A;  4F0M A;  3DI6 A;  5C24 B;  3R27 A;  4QWB A;  1KTQ A;  1B0V A;  2HQI A;  3HP6 A;  2EG2 A; 
#chains in the Genus database with same CATH homology
 4CWB A;  2F65 A;  2BMB A;  3HD2 A;  3UDE A;  3HSD A;  5ETR A;  5ETN A;  2CG8 A;  3ILJ A;  5ETV A;  3UD5 A;  4PZV A;  4M5M A;  1TMJ A;  1RU1 A;  3KUH A;  3KUE A;  1HKA A;  3MCO A;  1HQ2 A;  3HCX A;  4M5L A;  4M5H A;  5ETT A;  5ETP A;  1EX8 A;  1F9H A;  3ILI A;  3UDV A;  1EQ0 A;  3MCN A;  1G4C A;  3HSZ A;  3ILL A;  4M5N A;  5ETK A;  1RU2 A;  1TMM A;  3HT0 A;  3MCM A;  5ETL A;  5ETS A;  1CBK A;  4M5K A;  1RAO A;  3QBC A;  4CYU A;  4M5I A;  4AD6 A;  1RTZ A;  1EQM A;  2QX0 A;  3IP0 A;  5ETQ A;  4F7V A;  4CYU B;  3KUG A;  1IM6 A;  4M5G A;  1DY3 A;  4CRJ A;  5ETM A;  2F63 A;  1RB0 A;  1Q0N A;  3HD1 A;  3ILO A;  4M5J A;  5ETO A;  3HSJ A;  3HSG A;  1KBR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...