5ETVA

S. aureus 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase complexed with ampcpp and inhibitor at 1.72 angstrom resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
158
structure length
157
Chain Sequence
HMIQAYLGLGSNIGDRESQLNDAIKILNEYDGISVSNISPIYETAPVGYTEQPNFLNLCVEIQTTLTVLQLLECCLKTEELHRIRKERWGPRTLDVDILLYGEEMIDLPKLSVPHPRMNERAFVLIPLNDIAANVVEPRSKLKVKDLVFVDDSVKRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Selective Binding of Inhibitors to 6-Hydroxymethyl-7,8-dihydropterin Pyrophosphokinase from Staphylococcus aureus and Escherichia coli.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase/transferase inhibitor
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
total genus 44
structure length 157
sequence length 158
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2015-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 5etvA00
5ETTA 5ETSA 1DY3A 2QX0A 3HCXA 1KBRA 5ETKA 4M5JA 2BMBA 3HSDA 5ETVA 3QBCA 4CRJA 2F65A 3MCNA 3KUEA 4M5KA 3KUGA 4M5HA 4M5MA 5ETNA 1TMMA 5ETLA 3HSJA 3ILJA 1HKAA 1RU2A 3MCOA 3MCMA 4M5LA 4M5IA 1CBKA 3HSZA 2F63A 5ETPA 3ILIA 3UDEA 3UDVA 1HQ2A 1Q0NA 4M5GA 4CYUB 3IP0A 1EQ0A 1RTZA 3ILOA 3HSGA 1G4CA 5ETMA 3HT0A 1RAOA 4M5NA 3UD5A 3HD1A 1F9HA 1EQMA 3HD2A 4PZVA 4AD6A 5ETOA 4F7VA 3ILLA 3KUHA 4CWBA 1IM6A 5ETRA 5ETQA 2CG8A 4CYUA 1RB0A 1TMJA 1EX8A 1RU1A
chains in the Genus database with same CATH superfamily
2HZCA 2OPQA 5L9XA 2CJQA 4DBQA 1JXVA 4RW7A 4DF8A 3RAMA 3I56S 2C2OB 4KPYA 4C8YA 1S0MA 4GKKF 2MSTA 3VHQA 3K8WA 2ZJRQ 3FJ2A 5KFSA 3OUYB 2IVYA 3F73A 2F8MA 2Q6BA 4D3GA 2QFJA 4PG5A 1MSWD 4FPRA 1EETA 3KKFA 4IRKA 2FHOB 2IPOB 3BREA 4MH8A 3OD2A 2W4PA 4PQUA 3IS9A 2CZ4A 2CKWA 4H4MA 4L3KA 2F3JA 3PW2A 2HZVA 2XGQA 2CJYB 1FRXA 3BGRA 5LJ3Y 2ZWPA 2XQCA 1KFDA 1N54B 4F7VA 2OGUA 2IRXA 1IM6A 2FLOA 4J91A 5ETQA 4EI2A 3AA9A 2L41A 3Q2TC 4JV0A 2CQGA 2QYCA 2BACA 4JI1F 1XN9A 1REVA 4TNOA 4E0DA 2C3UA 4FYXB 1ZETA 4NEZA 2AYBA 3PO4A 3UN5A 4QWAA 1GFWB 3MEEB 2AZ1A 1HBOA 2QV6A 4USWA 4XDDA 3H2UB 4CLPA 2CFXA 3BBFA 2AT1B 2MQPA 2GQQA 3FFIB 4UOFA 2IBKA 4CYUB 4OZ5A 2CPDA 2I1RA 5B08A 4ZPAA 1S1VA 4HDGA 4PUOA 2KI2A 2IDEA 1RCXB 3A3OB 4DV5F 1VC0A 2R7SA 5EX3A 1R43A 1SVDA 3GU0A 4ECUA 1HBUA 2RUSA 4XK8C 2G2ZA 3P3DA 3JQKA 2ZH9A 4ELUA 3IWNC 1UA0A 4O3OA 3CIZA 3P45B 4B3TJ 4A8FA 4P6QA 2HSEB 4TLRA 3CC4S 4NRUA 2AHOB 1F1BB 3GJTB 4GRSA 5A2QY 2CJBA 4N77A 5HQMA 2OKQA 4PXEA 4C0OC 1B3TA 2DITA 4DV3J 2JNJA 2HBZB 3OR2B 3T1HJ 1Q79A 4DSJA 2G13A 3I4PA 2CXEA 4W4MA 4ALZA 2LXIA 3OLBA 5CYMB 1YTYA 5CYMA 1BC6A 4R25A 2B5JB 4DL6A 2HFSA 3M32B 3A8JA 4DEZA 2KB2A 2BOPA 2UXCF 4B02A 3KG1A 4BC9A 2B8QA 1JK9B 1JLBA 1G4CA 4C7QA 4DS5A 4F4YA 1SV5A 3CD6S 5D4LA 1FD2A 1VBXA 5DDOC 2K3IA 1X5OA 3W3SA 1F0XA 2U2FA 2R7OA 3LQVA 4Q2MA 4LFCF 2XCAA 3W5XA 1S9EB 1UA1A 2NCKL 1TAUA 3VGVA 4U6PA 1B4SA 3IAM9 4YDXA 5KFAA 3GIMA 5CD4A 3CXCR 1DAXA 1WELA 5F3ZA 2VICA 1U4BA 5D0RA 5E3QA 1RT7A 4J9RA 5B0BA 4LF4J 4YDDB 1VK8A 1TVRA 1FNXH 2IMWP 2NUHA 3QWUA 4KHPF 2FVSA 4CZCA 2ATCB 1FWLA 2VFUA 3CCWA 1R89A 4AT1B 3LAMA 3U1MA 4UQGA 4LF6J 1F2GA 2P6TA 1QLNA 4LRAA 3DCAA 1FWPA 2OMLA 2D3ZA 4LR8A 4J9NA 2QL9B 2UXBJ 1KP6A 4HHHA 4WP8A 2OSQA 3JTPA 4NLSA 4M1KA 1PKUA 1RTHA 2BKPA 3QFHA 2OD4A 3IGVA 2QA4S 2FJXA 3ZZRA 4ECXA 1WC1A 4IO9Q 2KXFA 3LA0A 4B3SJ 4F3OA 3TJ8A 3JAMU 2XB2D 3BR8A 3M6VA 4F4AA 2IAJA 1Q7LB 2EK6A 4F0MA 1U1NA 1XNRJ 3FC9A 1N34F 3OFFA 1N5YA 1VLOA 1W2BR 2HHTA 1BQMA 1NM2A 1RT2A 2ZE2B 2EK1A 4NZ0A 4WE1B 3FEYB 3TZYA 4EEYA 1RKJA 2V5HG 4DV0F 1IKWB 1B7YB 3PO5A 4PG4A 3G8QA 2ZZTA 3VQTA 1YZ6A 4CT9A 4DR2F 2DNZA 1JLCB 3WIVA 1S1UA 5D4OA 3AQPA 5F8GA 1LKZA 2W24A 2QLFB 1R27B 4A8XA 1HBMA 4UUXA 1Z2ZA 4OZ0A 3T5JA 5B0AA 1HNXJ 3WZ0A 3CD7A 3DDNA 5ETOA 1S1TA 4UZBA 2E9RX 1TL5A 2I0XA 2IDLA 3MEEA 5B0GA 3CUNA 1HD0A 2CNOB 4X84A 1FJCA 1CJKB 4OJ3A 1WC4A 1PJ5A 3SZ2A 3MMAB 2VQEJ 2X1BA 2R7WA 3ZC4A 5FLXY 4DFKA 1VQLS 2Y9HA 4KRWA 2HBYB 4CH7A 1JMTA 2WBMA 2NS1B 4B3OB 4J90A 5L46A 4CDIA 2L48A 2QEXS 4AFFA 3KK2A 4K0KF 3RRKA 1AXQA 1ZS6A 3CJ2A 4LF9F 3H2LA 1IR0A 1JLFA 3RR8A 3MMBA 4RWXA 2FHJA 2KG0A 1LW0B 4ZKAA 1T0TV 4K4TA 3B4DA 4ZPBA 3EZUA 2WOMB 2SXLA 5MLCV 4AL6A 1RHMB 4RUHA 2HAFA 4NPOA 2BJ8A 5BYSA 1RTDA 3JAMY 5AJ3F 2DNRA 2O67A 3C8YA 3O6QA 5LSLA 3R7BB 2ILYA 1TL7B 5SZTA 2GV1A 2KVIA 2YQ1A 4NXMF 2CZ9A 3JQJA 1RWPB 3DM2B 2DEJA 3PYEA 2FB0A 3RGIA 1OPZA 4DUYF 2PSZA 3D1HA 4RW7B 1UFLA 5I4MA 4GMKA 5L1KA 4F4ZA 2HHVA 2YKOA 4CM0A 2GAHC 4PG7A 4YMEA 3PNIA 3PEJA 2CPIA 4HH0A 2E44A 2BX6A 4RBVA 4BS2A 5KFCA 4OYZA 2FVPA 1JJCB 4HI1A 1EP4A 1S1TB 1WEZA 4EU0A 1ZM3A 2VA3A 2Y0BB 3DLBA 3D6HB 3D67A 3MM6B 4Y3CA 1EETB 2O66A 4DI6A 5EWEA 2F63A 1SH2A 3WX8A 4DPWA 2FDNA 4FF2A 1R3NA 4URQU 4HEA9 4U7UD 3SV3A 2BYCA 3AJDA 4PR6A 4RW6A 4LMZA 5J2NB 3R7SB 1BWVA 1OSCA 3CJ0A 4QWBA 5E2QA 4IKAA 1KVIA 5HP1B 3HD2A 2YPYA 1DTTA 2M9KA 1FRKA 2QZ8A 2CNLB 3G82B 5FLXU 3MFHA 1KN6A 3DRRA 3R2CJ 3J7YI 2HW3A 1IBLF 2UVUA 4BDPA 1GMWA 1K1SA 4FYYB 5K20B 3CO0P 3KLIB 4ES1A 3WC0A 3PW0A 1RQ0A 2BRKA 4RW9A 3AAWB 1ULRA 1UTAA 2IYGA 5M2UA 1QE1B 2DKOB 1X5PA 5DM6Q 3GV5B 3W65A 4RW4B 3PDNA 1VLYA 2C3YA 4MFBA 1FJGJ 3ZZYA 1GXTA 4WXOA 3UCZP 1SC1B 2IYIA 2K1RA 1RJJA 4NI2B 1FEHA 3NBPA 1Q86T 3LALA 5L38A 1Q82T 1HMVA 2VA2A 1TK0A 1X4GA 1HBOB 4FDFA 3V6HA 3D68A 3R1HA 3C46A 5IWAJ 1NH7A 2GMHA 4FYVB 3BH7B 5A8WA 5AE3A 1KOOA 1PBUA 4X64F 1RBOB 5F8HA 2LLZA 3HULA 1K1QA 4KTQA 3M9MB 4DL4A 2XNQA 1SH3A 1RU1A 3F56A 3UPFA 3M4XA 2OAUA 2XZTB 1MMLA 2JHEA 5CYJA 3H5XA 1XWLA 4LSNA 3GJSB 1FKPA 5AE1A 3MMCB 3HHDA 5DDPC 2MDAA 1G6BA 1TKXA 3J80U 4OJ1A 4DPXA 4IH7A 3W9IA 1HWJA 3FBBA 4KYZA 4C8NA 4CO5A 4B9UA 2KFNA 1FHTA 3BDEA 1S6UA 1YDLA 2XY7A 5I42A 2UUBF 1HNWF 3NS7B 2M4MA 3HVWA 3ZXWA 1T9YA 3THVA 4UOCA 3FCHA 2LU1A 2VC1A 1H2TZ 2G2OA 3M2UB 3GYNA 3KLHB 2ZJQQ 2LQBA 3NOCA 4UY85 1FRLA 2P8IA 3RBZA 4ANEA 1M5HA 4CP5A 4UT4A 2FC8A 4MIAA 4QZVB 2L3MA 2DNPA 4O3PA 3CMQA 4HHJA 5DQHA 1JLFB 2ILZA 3T9ZA 2I2YA 4LF8F 3BO3A 2RF2A 4K4UA 4DQRA 3RB4A 1RWWB 4ZPDA 2F4VJ 2RU3A 4IOAQ 2CPZA 2L08A 5RUBA 2V68A 4J9SA 2WVEA 2PDAA 1KLMA 1HBUB 3KUGA 1KTVA 2B8PA 2HS3A 3OXGA 3P5BP 1BXNA 4IQMA 3UNYA 3H5YA 4NZ7A 4N41A 2DGVA 3SIPB 5KFIA 4DUZJ 5A8RB 3W2VA 1Q0NA 1HFEL 1YK9A 3CW2C 2H54B 4IG0B 3DGPA 2VBYA 2E1AA 5MAOA 4KJIA 3M7VA 4QR1A 4OMFG 5A8KA 2D7SA 3MTKA 1XC9A 4RPFA 1JJ2R 3TAMA 2PI5A 2OPRA 3U02A 1NK7A 3QRPA 4NE9C 4CLFA 4RUCA 1NAQA 1C0UA 4HI2A 4DFJA 1FVQA 2V2KA 3PYDA 4FN5A 4GO7X 1VRQC 3VTIA 5HBMB 2VQFJ 1NK6A 2PI4A 1M5KC 1E6YA 4ZVQB 1WOPA 2GVZB 4TLQA 1P9YA 1B0TA 1F60B 3MAAA 4PWDB 1P9QC 4ETZA 2ZH2A 1Y5LB 3M2RB 1U0SA 1F5BA 4MYUA 2JEFA 2Q3PA 3MEGB 2FGCA 2HHSA 2JOQA 1RA7A 1S6QA 3W9JA 1WOSA 1N32J 2KHDA 3T1HF 2DXDA 1NK0A 4UZCA 4ED8A 1IN0A 2UV8G 4FPIA 2P9CA 1NU4A 1WHXA 3W62A 2B4UA 2PMHA 1Y00A 2YY3A 3LWLA 1U02A 5E3CA 1ZBTA 5FDLB 2CNKB 2FJEB 3W66A 3J81U 1O51A 2UXCJ 1Y11A 8ATCB 2ZHAA 2VDIA 3BEGB 1HQEA 5BYQA 3KUHA 1HBNA 4K7QA 4RO0A 1HI1A 4RU2A 2KXHA 2BR0A 1G1XA 1KEKA 4J9QA 1FXDA 1SQFA 2RNEA 2V4JA 2ZD1A 4O0NA 2DY1A 5DGAA 2JFKA 3QFWA 2WTFA 3FEXB 2Q43A 1MU2A 3DLEA 4P2FA 3KK1B 3GV7B 5F8IA 2KL8A 3H2VE 4L72B 4WP9A 3MAQA 5HMZA 1L3TA 4MKYA 4DSIA 1RAGB 3KK2B 5E3RA 5A0YA 3KLFA 1GX6A 5ETNA 4USMA 5JMNA 1RT3A 2Y1RI 4H4KC 4DV7J 2E29A 2PFDA 3G87A 2BJEA 2C2MB 3RBEA 2X1FA 2QE5A 1UMJA 4JOUA 2VV5A 1LWEB 3MI7X 4LVNP 3D7SB 2R2UA 4DL7A 3RBXA 1TL3A 1TKZB 4CO4A 1UW9A 2HRTA 4D3HA 2P9EA 4AUKA 1VQPS 3MUVP 3ILLA 4LJMA 1R8HA 3D3BJ 3KLIA 2CPFA 2CQPA 1CQNA 1YJ7A 4LBPA 2I6WA 3MMJA 5J2MB 4YQWA 4KPCA 4YR3A 1XNQJ 2QSWA 3CJTA 2FHMA 3SEOA 3D0HE 3M32A 1MNEA 3IG1A 1NEEA 4FVMA 3K5OA 2I9SA 3EE3A 4F04B 1XMQJ 4X4QA 2DH9A 4U9RA 2E1MC 3GZ7A 2H65B 4FZVA 1RAIB 1FDDA 4X65F 2Z30B 4YOEA 1EAYC 4OZLA 2X7IA 1HD1A 3RB6A 1ZZFA 4DV1F 1X4DA 5HQ8A 3Q8SB 1X9MA 3H90A 1U2RA 2DIVA 3W7BA 1JLBB 2ZWOA 4I4BA 2IM0A 1FERA 1YJUA 1YBAA 3GYGA 2YQ0A 4PG6A 1MROA 1U7LA 1MROB 1S59A 1HNIA 3GJRB 1H72C 3WDOA 1RGVA 3DOMA 4I7FA 3F0NA 4ZPVR 2VC0A 4FNHA 2DYAA 5CD4H 3HHKA 4FXDA 2DTJA 4JI0F 4JYAJ 3D6FB 3DLKA 4KIAA 3MWBA 1NRKA 2QT7A 2WVBA 2RQMA 3K0JA 5JVGQ 1R7IA 1N36F 1TV6A 2YNFB 4J9PA 2ZHOA 4EYIB 1TL1A 4F25A 1IKXA 1U25A 1IKXB 4JI2J 4X4NA 4LR7A 1B70B 4C8KA 3C14A 5G0RA 2CPHA 2DEIA 1FA0A 2MKYA 2J76E 5KFRA 2XWXA 5KFTA 1REVB 2YKMB 4QQBA 2MQNA 4NI2A 1HQ2A 2PMZD 1FDAA 3K58A 3ILOA 3HKWA 3OBIA 4TU8A 3THPA 3NGSA 2BOAA 2HQCA 4LRFA 4QBUA 1U1PA 1GEHA 5HLFB 2JLEA 3H7HB 1CPZA 5J2PB 2EPIA 2FJBB 3I5BA 4PXBA 2RDJA 1FCAA 4OI2A 3CF5Q 5ETSA 1JX4A 3QZ7A 3IXQA 2WBRA 3QT5A 2RS2A 4DPYA 4ICLA 4ZCKA 4QU7A 5A6WA 3KHLA 4YR2A 5KFGA 5C5JA 4DLGA 4GKKJ 5D8HB 3H4DA 4O4RA 2CA9A 2JDJA 2CQDA 4IDKB 2P6SA 1A7GE 3GIIA 1UJ4A 3PJ9A 2ZH3A 3W2VB 3M2VA 1OS5A 2HIYA 5DDRC 4DSLA 2HBQB 4F67A 4IFVB 1E6VA 4UOGA 3PX4A 4C4WA 1IQZA 4IG3B 2PGCA 3HO1A 3I31A 5BR8F 2D69A 2OELA 4KAIA 5KFNA 2V4RA 1S0NA 5HMYA 2LDYA 2VBXA 2R9LA 3MECA 1AW0A 1WC5A 2DNOA 3R5DA 1DLOA 3O5TB 3FBCA 4Q2LA 2AQ4A 2OPPB 2RRNA 4QWDA 1U47A 4NCGA 1R6VA 1YG0A 2HQDA 4NCAA 4JV5F 5F8JA 4OJHA 3EVWA 2LP4A 3TA2A 2Q6CA 4CLUA 4B3MJ 4PCQA 1VK3A 4I69A 4BWMA 2CQCA 3KG4A 2M52A 3MM5B 1XR7A 3NG8A 4ZCMA 2K8GA 2FY8A 3GSDA 2QMXA 3KDOA 3SCIE 1XIQA 4Z7CA 4LIRA 3BYPA 1RTJA 2NSCA 2XZDB 4DV4F 1VC5A 3HPOA 2GHWA 4M5IA 4HACB 2BZ2A 3EVOA 5HATA 2R8HA 4ECVA 1NXIA 4GVBA 1BHNA 5EWFA 4B9NA 3KJQB 4Y34A 4V19J 5HAOA 4A8SA 3K5PA 1JB0C 2YNGA 1K44A 2DBBA 4ZJQA 1LXNA 3HK2A 3KJVB 1LWCB 1OJ4A 2V9KA 1X8DA 4NLYA 2OPSA 4DF4A 1JKHA 2JC0A 5FJ4A 1ROFA 3VGTA 3T1YF 2J9CA 4B9SA 1MWZA 5DM7Q 2GHPA 3GMGA 2KZMA 2MZQA 2RMLA 2HGLA 1KSPA 4M94A 3ZZPA 2AU0A 4KH1B 4ZVPB 1PYSB 1H0HB 2YXLA 1UPPA 4UUWA 3QJPA 2PA3A 1UFWA 1T11A 2QLXA 1NDPA 2XMWA 3RB0A 1UVMA 4GKJJ 1WC3A 3GFHA 1R8CA 1TU0B 2OFHX 4YEAA 2A6OA 1EQ0A 1C0TA 4OQJA 2HNYB 2K7JA 4HH1A 4YHHJ 4R0JA 3QWPA 4C8OA 3E01A 1CJVA 2ZBPA 4DPUA 4DV6F 3RJMB 2CRLA 5EHHA 1X7VA 2RJZA 2B3TB 5HANA 3WIUA 1LW0A 3B4MA 1IWAA 3CCVS 1HYSB 3KNAA 2XNRA 3CJ8A 1T8EA 3AXKA 1YVFA 2RILA 5I3UA 3EPGA 1T3NA 3G6YA 2VG7A 1LWFB 4NLQA 1S6OA 4NX9A 4PKDB 4ECTA 4U67Q 2BJ9A 4ZVGA 5I42B 1SKSA 1TFWA 1J5OB 1J5OA 9RUBA 4OYAA 3VAHA 4LF8J 2PE8A 3BN7A 3E8OA 2YWKA 1X4AA 2HRUA 2JFDA 4Q44A 1JLQA 5LMUF 2F4VF 4GC6A 4NXNF 3L7OA 3QO9A 3IFEA 5H9EK 3H5SA 5LM7E 2AWZA 5A0YB 3BM7A 3E3XA 3HSJA 1IKVA 2C28A 2PFFB 3GIJA 3GYXB 5HVGA 1NK5A 5F3TA 4DCJB 1S77D 2W7PA 4KT0C 1EHWA 1VQKS 4KE5A 2AJFE 1T3OA 1FJEB 4ERDA 4P71A 2C2NA 1I94F 2H4WB 5C25A 1YLXA 2ZVSA 4DQPA 3OL7A 2V8HA 1VQSA 2VASA 4O44A 4Y2MA 4DFPA 2N4DA 1UJ6A 3CCJS 3N79A 3OSNA 2DISA 2GNKA 4Y2AA 2RSQA 4JB8B 3VWSA 3TZZA 1PBAA 3DYAA 4PAAA 1W7WA 4A8WA 4B3RJ 2HFOA 2NPIA 3T6JA 1N48A 3HCXA 3ONQA 1IKYB 2KM8B 2UUCJ 4X4UA 1AYEA 2DGWA 2FPHX 2FYXA 3QBCA 2XS7A 4YB6A 2ACMA 2BJ1A 2MJUA 3QIPA 3MR6A 1VC6A 3MPWA 4DR3J 3D3CJ 2HFVA 2JJ4D 2X1AA 3TAPA 2ZD1B 2OO4A 4I2PB 3J7Z5 2MLYA 3UDLA 3RRHA 2CJKA 3IBFB 2VHGA 2WSEC 1B0VA 2BXJA 2C42A 2MQMA 5T7LB 3WX4A 4F36A 3NGKA 4X4PA 5J1EB 4DR2J 2UP1A 4I67A 3G86A 4H4OA 1PIEA 3M8ZA 2ROEA 3D66A 4CNYA 2M2BA 1KNZA 1OQ3A 1HNXF 1RAHB 4ZDNA 2HHHF 2FZKB 1QDUB 4RNMA 1S9GA 2G2YA 2Z2MA 2YX4A 1OSDA 2HMIA 4IR1A 1UAWA 1BE4A 1TKTA 2KM8C 1FKPB 2B4OA 4K59A 4WTYA 1Q4RA 4PYAA 1NZ8A 4IG0A 5E33A 2OD6A 3W2WA 2VQEF 2VKRA 2KN4A 1DQAA 1HQUA 2E5JA 2AP6A 5C42A 1NJZA 2JWNA 4WZQA 4A8OA 1WG4A 2PD1A 4CCHA 4ILLA 2CQ0A 2DNKA 1P8GA 2PC6A 3HKZD 4WFAQ 3CCMS 1RT6A 1TUVA 2N3LA 3J81Y 3NCQA 4HDHA 1QSSA 2HRYA 3H98A 3NXZA 4X62F 4ZP6A 3NS5A 5HQLA 2HVZA 2MGZB 3VAMA 3GV8B 2A3JA 2ASYA 5E5NA 3PG9A 2HPUA 3D28A 4JI6J 3ICLA 2UVVA 4Y28C 3MOZA 2JVOA 2LQ9A 3LP1B 3ZNJ1 4C11B 1UVNA 1KBRA 3ADAC 2HVDA 3TO8A 3DRSA 3OTDA 3A3NB 2GCFA 2XLJA 5DETA 2H5JB 1CG2A 3D2WA 5HLFA 3CD0A 4CTAB 3V2UC 1XMQF 2X1GA 4BCAA 5DG9A 4JV5J 1Y5NB 3CCZA 1RP5A 2L9DA 4ZHRA 5F9LA 2MZ1A 5AXNA 2PIIA 4K2XA 4R8UA 1GMUA 4LSNB 2N7CA 3KMQA 4DV1J 2IMOA 5HI7A 3BPDA 4OIXA 4Y2IA 3C16A 5E3AA 4O3RA 3NAIA 2W4DA 3NAHA 3QT8A 4NLUA 1U0HB 4UF4A 2HQ3A 2WB1D 2PT0A 3BS9A 2GVZA 5DRKA 1NPKA 4NA3A 3X1LB 4LBHA 2UU9F 1N0UA 1S57A 4J9KA 3QT7A 2QA1A 3T5HA 2IRUA 3NGTA 2NQPA 1NHKL 4ZMMA 1X4CA 2BMBA 5C24B 1CJTB 2M70A 3HVTB 4LF7F 3QJJA 3IM9A 2XMVA 1NSKL 2FC9A 3IR6B 3AD8C 2EI5A 3DMJA 3DOMB 3IC1A 4I7FB 3ZTSA 1Q7YT 2BANA 1TMMA 1FRIA 2VG6A 3S7RA 2IFXA 2XSJB 5DGBA 3I0SA 1FXRA 3NS6A 1Q8KA 2M5YA 2JH3A 2AX0A 1FDNA 1U6FA 1RWKB 2L9NA 3MCSA 4DJBA 3JSMA 2HHPA 5AXKA 2WOMA 2OH2A 4PQUB 2E66A 2RQCA 2FY1A 4B9TA 3AXMA 3VVUA 3C6TB 1PGZA 4HHUA 3UO0A 3SI8A 3C14B 5G0RB 1TL7A 1UZDA 1GTHA 2UUTA 4TYAA 4ZLNA 5KFEA 3KFWX 5GMKa 2CG8A 3GPAA 3BKUA 4OYXA 2NPFA 2I8EA 1YKWA 3MHYA 3EPIA 1UVIA 3UE2A 3LTOA 2ASLA 1SJFA 2HHXA 3OR1B 4P7VA 3EZOA 3GFZA 4KY3A 2ZM6J 3SFUA 1XNRF 1R0CB 4YFUA 4ZK7M 1EKRA 3HSDA 1WEYA 5A2QU 3A8KA 3KK3B 4F4WA 3JB9k 2BM1A 2W9BA 4DV0J 3NGDA 4J7CA 3FFIA 2NYIA 3H4BA 3K7RA 4PQAA 3CDEA 3V6DB 3E51A 3V6DA 2HVHA 1A0OB 3AHPA 1YX2A 1U8WA 2OEJA 1HNZF 4TQRA 2XI2A 1L5UA 1S6QB 4DX7A 5D77A 4YY3F 1U1LA 3HVTA 4URSA 1YI2S 1FFWB 2DRBA 1NK4A 4OLPA 3RRGA 1C0TB 5L1JA 2VG7B 1NDLA 2JLFA 3BYRA 3L9ZA 1AROP 3AH6A 3JSBA 5DJBA 2R42A 2HWTA 1NUEA 4I6WA 4EWTA 1WHWA 3PACA 4P75A 4CLSA 3MR3A 2ALYB 2W8LA 2WHOA 3JTOA 3IWXA 2IHR1 4X66F 4U96A 3HHLC 4NA1A 3RZAA 4K0KJ 3KHGA 4LF9J 1KD1T 4J9MA 3FDSA 4I2QB 2OPSB 2CJ9A 1FFGB 1Q8LA 5KT3A 5L1LA 1RABB 4ECWA 1AB8A 1VFJA 2HWIA 4WU3A 2YNHB 4DU8A 4R5PB 3OVSA 1WWHA 3OR1A 4N56A 3IM8A 3IBWA 3U1LA 2B9XA 2CYYA 4C2MA 5T14A 4J9LA 5BXIA 2C2DA 5CZXA 4JI8J 3SDEA 1NK8A 3KLFB 2AJ1A 2WZ1A 2ZC4A 3CJRA 3DU5A 2W9BB 2IJRA 3L3CA 3IMQJ 2Z2LA 1HLWA 1KVKA 4RUAA 1QTNB 1KOHA 1CS4B 3FRYA 1TAQA 4XDCA 2W9AA 2JEGA 1ZH5A 3E2EA 4PRFA 2LKZA 1RT1A 4KHRA 2LDIA 1AFJA 3PRBA 1TKZA 1VOMA 1NHVA 5GVQA 5KFYA 3UD4P 3BGOP 2WSCC 1XERA 2AIRB 3M30A 3M8RA 2BBEA 3OR2A 4RUBA 3M9OB 2IC3A 3C16B 3CDWA 1YHQS 1KDNA 5IT9Y 4NL5A 3UD5A 1GT8A 2B43A 1YJWS 1RT6B 3K59A 4ZP9A 1N32F 4CH0S 1QUVA 3OVAA 1FTRA 1ZM2A 4OHZA 4EGLA 1V9OA 4O4GB 2OTLS 2Y0SD 2G1HA 3HZGA 3I4HX 1FK9A 1PC5A 2E5GA 3MZIA 4G6VB 4JI5F 4LUBA 4C6AA 2JRSA 3ZNUA 4RNFA 3RUBL 1RYRA 4PZVA 3VAJA 1FRJA 2UVWA 4DR4J 1S7IA 1RUSA 2B9EA 2ADBA 4KGVB 2R8GA 1URNA 1B0PA 3BO2A 1K47A 4J37A 4KGMA 3IN5A 3QLHB 4LFBJ 1N88A 2HNYA 3TEGA 3R5JB 3DLLQ 4WJBA 1HW8A 3FQLA 1S1WB 4DCOB 3VVTA 2RKIA 2IA0A 1JLAB 1N36J 5CYQB 2CUYA 3LWMA 2IM2A 1WC0A 2YBVA 2ZOGA 4QR0A 2MZJA 1SUQB 2GFFA 2HGNA 4E2FB 5LMUJ 3M2VB 3QAUA 1YQHA 3N5BA 3FRZA 4KSEB 7FD1A 2GJIA 1RYSA 1KHVA 1O5JA 3QMQA 2DPIA 4PXCA 4K50A 2V8GA 3LGNA 9ATCB 2H51B 2Z8QA 3Q8UA 4EBCA 4M95A 3MM8B 2Z4PA 3KJNB 4L75A 4USVA 2KTQA 3TQ1A 3DGPB 4DV7F 3A3PB 3K2YA 4OHVA 4TU7A 4X4SA 2NXNA 2NXCA 1UVLA 2MZSA 2YNGB 1ZA2B 3A8IA 1HPZB 1JLGB 2A18A 2HQGA 3PXGa 3RAQA 1JWWA 1ZAWA 2MGZA 3TA1A 3Q86A 1CJKA 1PO6A 3OVBA 2NXUA 4AE5A 4CO2A 4LRCA 5ETTA 1Q8BA 2C3OA 1WG1A 3HVAA 2C3MA 2Y3YA 1N33J 1YRXA 3TX8A 3MTJA 4I64A 1CC8A 4C3LA 4OJGA 3ET6B 3H5UA 4LR9A 1X31C 3MM5A 5BYRA 4U7UK 2ZDOA 3HX9A 1GK8A 1RWUA 3FK4A 1LEOA 1WD6A 4ZN3A 1B99A 5D6GA 2E7WA 3GILA 2W9CA 5ETRA 4G65A 1TZ0A 2X3GA 2MQOA 4X65J 1PCAA 2RT3A 2DNQA 2VFRA 3FUYA 3M1VA 5LOQA 1RZMA 4ICLB 2ZDPA 4ZA1A 4Y2CA 4N8OA 1TQLA 3JSYA 3FMWA 3N01A 4DG1B 4YUDA 3PR5B 2YX1A 1M5PC 2K2PA 4L73A 2E5LJ 4PPZA 3R97A 5K8MA 4QOTA 2XO7A 3M6WA 1YBUA 4LF1A 1U24A 3HFVA 1NLKL 2VPWB 3I0RB 4LRDA 1H2UX 4IG3A 3MM8A 2B7BB 3DHWC 2HHHJ 4JI0J 3R27A 1VYAA 4V1Ak 4ZLLA 4G3IA 2O3DA 3HXMA 3BJYA 3WQPA 4OZ2A 2NUUG 2NYHA 3LGMA 3VGSA 4CH1A 1NNDA 4UQTA 2QMUB 1O6XA 4MK9A 4ZLPA 2ZBRA 1GX5A 2EW9A 2WONA 4QYZK 4JI2F 4N5SA 4KHPJ 4C48A 1WSRA 1EP4B 4AXIA 2QTWA 2FZGB 4DOZA 3J7ZT 4DU7A 4U7CA 3OHBA 4RW6B 2F9DA 1J5EJ 1DZ5A 1AA1B 5KFZA 1KWMA 2F8HA 2Y1LB 4C3MA 3HJFA 4B3OA 5DS7A 1SJ1A 2VG5A 1MMDA 3RYLA 4W90B 1LWFA 2OHDA 1RDRA 5H9FK 4X62J 3ZTQA 2X51A 5ITHA 5I3UB 4ZJLA 2IVFB 4CLWA 4ED3A 1MN9A 4B3SF 3BH6B 2VOPA 3M1VB 4MYTA 3TUPA 4RW9B 1FT8A 1GXUA 1FX2A 1BMQB 1LWXA 1WDTA 3QRRA 2BQUA 2B7CB 2EBEA 1VRTA 3QATA 1WKKA 1VQ5S 5T41A 2OIHA 1S4FA 1KQKA 1D1UA 2HS4A 3NBPB 1S0VA 3QQCD 5F8NA 3PIOQ 1X5TA 3C15B 3DLHA 2JEIA 2VJUA 2LXFA 2XLKA 1MU2B 4DUTA 2C3PA 3OTBA 1GQEA 2YX7A 2D9PA 5CCMA 5BR8J 5D78A 1S12A 4K4SA 1XMBA 2F4FA 3R6LB 3DHXA 4QWCA 5K14B 3UVJA 2G9OA 3UVJB 1RWVB 3WHIA 1ZM4A 1HHQA 4W98A 1FXLA 1TMJA 2I5JA 2YWHA 3HHNB 3UCGA 4F02A 3NNHA 3OTCA 1H73A 2KVQE 3KJFB 3JYTB 4ED0A 1UWBA 1U49A 2QX0A 3DKDA 3SCKE 1VQ4S 3CJKB 1T9VA 3K17A 4X4TA 3G8SA 4B3MF 4WIIA 1RCOB 3LP2B 5CZVA 1FTCA 4KFBB 4KKOB 3KUEA 3MMCA 4H54A 5I3PA 3S1TA 3U7JA 4LF7J 3O2IA 4M5HA 1Q16B 1PC4A 3IO1A 1NDKA 3FCWA 1X4HA 1UCNA 3NLCA 4O23A 1YIJS 1H38A 4IQXA 3J7A1 2DNNA 4AL5A 2IIHA 5JJBA 1EJ7L 1GMVA 2BE2A 2XMMA 2BA9A 4JP8A 5F0WA 3FKBA 1QAYA 4QCLA 5KFWA 2GZOA 2QRRA 3FEZA 5IV3A 2VPXB 2D3OR 3CULA 2FQQB 2VZ9A 2J7WA 2BANB 3CJ5A 5H9EJ 1N5YB 2KO1A 1IR2A 4NCBA 3MXHP 2J0XA 1VJQA 4DX8H 1S9EA 2M7SA 1ICEB 1MWQA 2YKNB 3FQKA 4NYOA 4NLDA 5GAEI 1HHTP 2GW8A 2RHSB 5B0FA 5C25B 4L74A 5D15A 4M5JA 3CCSS 3BO4A 4QIFA 2XLIA 4EBEA 1S48A 4M5KA 3QYYA 2BE9B 4IFYA 1N5QA 3NY0A 5E41A 1G7CB 3FBFA 2KDOA 1NBEB 4GKJF 1L3KA 4KQZA 3N6LA 5IFMA 4IFVA 2J6SA 1FNOA 3SSSA 3SQGB 2Y1JA 3KLEB 4I56A 3I96A 3CNQP 3LP2A 4J9UE 4F0KA 3R1LA 1OY8A 1HARA 1Y4ZB 2ZUAA 4YY3J 4CM2A 2ZUGA 1H98A 4NASA 4CNZA 1KC8T 1MN7A 1JLGA 1C0UB 1KQGB 1FE4A 1WHYA 5K5MA 1N4LA 3PTWA 1SJRA 2DNYA 3GP9A 2VG6B 3MEDA 1IWGA 1K9MT 3ITHB 1PILA 2MKCA 1IR1A 1YJ9S 3BDPA 3HMJG 1BUXA 2R7TA 1RBLA 3SFGA 1HYSA 1VQ6S 4RNHA 2ZNZA 1NMEB 2DR6A 1O0PA 3W63A 3O3LA 2W9CB 1CULA 1S9GB 2BVZA 1I51B 2EFOA 6FDRA 4LQ9A 4RW8A 4ELVA 4CTAA 4I6YA 3ISZA 2WSFC 3DRPA 4OI3A 1P6TA 5CYQA 1C4AA 3DM2A 1VI7A 3ZZ0A 3FSYA 4TXSA 8RUCA 1SC4B 3V81B 4KGZB 1Q5VA 1SJQA 2H5EA 4WF9Q 3PYGA 2JZ5A 2DGUA 2GA7A 1P1LA 3UCUP 1EB0A 1AFIA 4WZMA 1IXKA 1TP7A 2RDIA 2HNZA 4OZ1A 4ES2A 2RDDA 3GLJA 1NJWA 3POTA 3THTA 5K8PA 1SJ4P 4UY8T 4WP3A 3KLGA 1F5AA 3KWMA 3P4UB 2MKIA 3UR3C 1Q8IA 5D3GA 1SIZA 3MUMP 4O4GA 4QIEA 1HMVB 1P1TA 4B3RF 3LPEA 3LP0A 2ZFHA 4DPTA 2WAQD 3N28A 4OYWA 2K7KA 2EFQA 3ZTRA 4C0BA 5KOXA 5IS2A 1PG5B 2ROPA 3BQ0A 2B4PA 5J2QA 4FBTA 2KJWA 3CC7S 4HT7A 4EZ9A 2R7VA 1WSVA 3NCRA 4DR3F 1KQSR 3CO9A 2F8EX 1SB6A 3M8PB 4DL3A 4DSKA 2AEFA 5H1SV 1JLAA 2EFVA 3RW7A 4KV8B 2ERRA 3ET6A 4JI3F 2C2RA 3TZXA 2VB6A 4LT6A 1B7FA 1WEXA 4FYWB 2QA2A 3CE8A 3TARA 4OX6A 3KTQA 5DZ6A 3X3UA 5KFLA 5KOWA 3DXBA 1N56A 2QC3A 1K8AT 4ITSA 1G3OA 2G0IA 1M0SA 2OMOA 3G82A 1D0EA 4MAKA 1HW9A 2FJVA 3QRQA 4KGKA 2IM1A 5CHCB 1JLCA 1WDDA 3I87A 4NMXA 4CWBA 5GADI 4K4VA 2E7XA 4LFBF 3MUTP 4WTOB 2H4YB 4FS1A 2FVQA 3HHEA 3PEHA 5EX0A 4DV2F 1WF2A 3MR2A 2KU7A 1SV5B 3LANA 4WFNQ 3BGLA 2HK2A 3C19A 4K8RA 2J6TA 2HNDB 3DOLA 3EVMA 3LOUA 4MTPA 3BSNA 3BGFA 3O8WA 3RB3A 4DUZF 4MFBB 1NJXA 2DT9A 2MY7A 2ZBIA 3MCMA 1IBMJ 4FYDA 1G2EA 1N52B 4ZVTB 3M8QB 4OZ3A 2VOOA 4XTTA 1RE1B 2ZOMA 5KG7A 4JI4F 4Y0FA 2V2VA 3W5ZA 3HT0A 1RT1B 3K8VA 2Z57B 3NOGA 3IBCB 2KH9A 2Z56B 2VG5B 3HZEA 2QMWA 1TKDA 5LSOA 1LV5A 7FDRA 4DR5F 4O44B 2PN6A 3T1YJ 4P73A 1DTTB 5HROA 1CJUA 4ED1A 4QYZJ 1REGX 1RWXB 4PABA 2VJVA 1FF2A 3N5FA 1XR6A 4JV2A 1LWEA 2CWKA 1NDCA 1RACB 4JI6F 1KONA 2WCXA 4Q0BB 3VR1A 1VGYA 3ZO7A 3C6TA 3AOCA 1Q81T 1HA1A 4C8MA 2OPRB 1JXLA 4DFMA 3V6KA 4HTJA 1XBWA 2YQ3A 1VQNS 5ETLA 5H9FJ 1HKAA 2XG8A 5D0EA 4ZCIA 1RBAA 1ZZNA 1HHSA 2CPJA 4ANCA 2DGTA 1T9TA 3P8BB 3I9V9 3S01A 4DWIA 1TR0A 2XZWA 4NMLA 2XO6A 1LW2B 2EKYA 1N8RT 3DDKA 4DCPB 3EYZA 2Q66A 3EWGA 4DR6F 5CAAA 1HIYA 4ED2A 4IRDA 3AD9C 1VJWA 1VRUB 1X60A 3A8EA 4F26A 3K5LA 2HLUA 1RLDA 4WE1A 3JSRA 2AGOA 3R5AA 1YRTA 3MURP 2WVFA 2ZEJA 3QLHA 4NLXA 3TRGA 1FKAF 4NOHA 4DXLA 1LFWA 1OWXA 3CIMA 2UU9J 3NWRA 3CEDA 2JX2A 4FXWA 4NXNJ 5LSRA 1S6PB 2CADA 3V4MA 4KFBA 2ZH6A 1NJIT 2C2KB 1CVJA 1S79A 3KNGA 2E7VA 4DZDA 2H5IB 2ZVIA 5KFUA 3OL8A 4HL9A 3IR5B 3I0RA 4WIQA 2HGMA 5KT2A 1SL0A 4F2RA 5A8RA 1C4CA 2C1EB 2OTJS 1IQTA 3D9BA 2GGPB 4Q0BA 3ETMA 3MMAA 4NLRA 4BLGA 3M05A 4Q43A 5DQIA 1ZPVA 3A4TA 3KOAA 3Q22A 5G4DA 2QFIA 5KT5A 2Z2YB 2XYGB 3EM1A 4IH5A 4P74A 3CCTA 2WONB 1RHQB 2H9ZA 5L39A 2FLLA 1IUJA 4OV1A 3OTOJ 1S1XB 1U1MA 2AYGA 3EXYA 4CQ1A 1DURA 2CQ1A 2YH0A 3PHTA 3AB4B 2MSSA 2E5HA 4CIOA 5HJXA 4NLPA 2HZAA 2PEHA 3M8PA 3SDEB 2JVRA 1RK8A 1SPBP 2XMJA 1U1QA 4MT1A 1I5OB 1UWAA 4ZIWA 3CJQA 3UN3A 4Y00A 2LXUA 2ZE2A 4G1IA 5CA5A 2D9OA 1RWNB 2AGPA 5J1NA 2O5DA 4DQQA 2YNIB 2YKNA 2AD9A 5CXTA 1PAUB 4JI7J 1F9FA 3VAKA 1J2VA 2CPYA 4KO0B 3AQOA 3SYZA 5SUHA 4IH6A 1HNZJ 1AUSL 1HQUB 3DOKB 3IAS9 4ECRA 5HK4A 4A46A 2V0NA 5F8LA 3EXCX 3FNNA 2OPPA 1NPRA 3EMTA 5KG3A 4PG8A 2R7UA 1R6YA 2BV3A 3S6EA 2DXEA 3G6VA 4JBCA 1D9DA 1RXOB 4S0MA 1T9WA 3G2XA 4ZN1A 2DK2A 3AY0A 4ECZA 4I68A 3SCLE 4QU6A 1CLFA 3LW5C 2RB7A 3LH2S 4F4KA 3FZBA 4X4OA 2JLGA 5CH7B 2E1CA 4Y6IA 2MYFA 4DPOA 3OHAA 1NB2A 1AT1B 1T03B 4RW8B 2AEJA 1FI4A 2NREA 4ZVRB 5HL7Q 4K4YA 2XSJA 2IJNA 3EUNA 1WG5A 2FGOA 4A8MP 1XMOF 4LF2A 3UWTA 1RT5B 3GFXA 2MHEA 1F3FA 4Q45A 2Q79A 2DPJA 5HSPA 2N3OA 2F9JA 2RQKA 3ULHA 4EZ6A 4HYKA 3TI0A 1TL3B 3DNCA 4AD6A 4DG1A 2LEBA 1AZSA 2ATLA 1L3SA 3EGZA 2P5VA 2ZNYA 3MM7B 4QWEA 1VBZA 5B7WA 1E6VB 2XM3A 4ED6A 2DJWA 1M5VC 3OFHA 4RJVA 4ILMA 4EO6A 1Y7PA 2J9DA 4AL7A 4U8YA 2DH8A 4OLOA 3IG1B 3GE9A 5EDWA 1T9UA 3TVKA 3GQCA 1MG7A 1DBDA 2HNZB 3VAGA 1FVSA 1RA6A 5B09A 1WHVA 3KMSA 3AFGA 4K5SA 2OSRA 3BR9A 4ES3A 1M90T 4J9VA 3QJLA 1HR0J 4Q7AA 1WC6A 1HWUA 3ZZUA 1KS2A 4ATNA 1U45A 1F9HA 1HL6A 2VPZB 4OHWA 1ZM9A 5AE2A 5L9NA 3S8SA 4B9MA 3UN2A 3AODA 2BUNA 4NA2A 2Y8YA 2VD3A 1KHWA 2I5JB 2MLZA 1CJUB 2MB0B 2RAQA 3Q89A 3HT3A 1OY6A 3KLEA 1TK8A 1SJ3P 2OI2A 2DNLA 3ENQA 2OP5A 1GTEA 2JSXA 3BBBA 1UPMB 1S0OA 5IC4B 3AOBA 4DV4J 2GVDB 4OYMA 3OJSA 3QSYB 2HIQA 3PFEA 3Q8RB 4AYBD 2VIHA 1X9SA 3H42A 2ZZMA 1H3DA 3CDUA 5DLGA 3C15A 2NLWA 2QIFA 3I82A 5AT1B 3OV7A 3DDIA 5T7LA 2ASJA 2XULA 2MEWA 4USKA 2N82B 3SMZA 1YITS 1RAEB 2VBWA 1KLNA 4BC7A 4HT5A 1GNKA 1HNIB 2P2CB 2RUGA 3DOLB 2LFVA 2V4QA 2J0SD 5E7OB 3G9CA 4USHA 4WFXA 2DR8A 1Q78A 3KLVA 4F4XA 3H25A 3ENAA 1IJFB 4CYUA 3DU6A 3CJ3A 2NZCA 1RTIA 4DX5A 1RTIB 1Q95G 2M8HA 3GR1A 4RNOA 2ZH7A 4FXVA 4Q8FA 1LXJA 2W2OP 3AJ2A 2R2TA 2XC9A 3M30B 3OXLA 4TKTA 3C66A 3MEKA 3CCRS 4YHHF 4I6AA 1BGXT 5HN0A 5F9NA 1DTQA 1ZAXA 4Y65A 3BV8A 1VRTB 5LXYA 2GIRA 3HSGA 2XY5A 1FKOB 2QN6B 3ZTOA 4LFAJ 1VQOS 2PMWA 2V6AA 4WXWA 5D4NA 3PVXA 3TAQA 4MMOA 2DHGA 1RTHB 2AF6A 2F40A 4DHVA 2W2QP 3DMJB 1V3RA 2V8DA 4M5DB 2DRDA 4DR7F 4ID5B 1H2VZ 3W5YA 1PSDA 4RU9A 4X66J 2D3UA 2YPZA 4BWJA 4J9OA 3T6BA 3I6PA 2H3EB 3BN4A 4JUZA 2C2ZB 4DV2J 1SUQA 2ZH8A 2BRLA 1ZTTA 3ZFVA 2VONA 3V4IA 4M5MA 5JUMA 1PYOB 1SQEA 4P52A 5IT4A 3DRPB 1I94J 5A8KB 5D0GA 1U1OA 3UI3A 3B8HA 4I0WA 1TL4A 2JL9A 1WUUA 2A6MA 3C6UA 2J0QD 4CLZA 4QJVA 2YKQA 3J7YU 1K73T 4YP3A 4O0IA 1LK5A 5LXRA 1LWCA 4CI0B 2HLTA 4HKQA 4DR5J 3MEDB 3M8YA 5IM0A 2IJFA 2M0GB 2MKSA 1F9EB 2OFGX 2PA8D 2UZAA 1VCTA 4OI6A 4ZJOA 4ZVFA 3GG0A 5KG4A 3ZZZA 2HEKA 2W7AA 5F41A 2W1BA 1IM4A 3MEGA 3EDRB 5CABA 1XJWB 3CSKA 5DDQC 3BSCA 3OT9A 4DV3F 5KFHA 3CMES 3MMBB 1HWKA 4U95A 3FCVA 1BY9A 1RT5A 3TUJC 2CDRB 3UD3P 1R8AA 1QAIA 2N4CA 3BF4A 1RHKB 5K9FA 2HQIA 4C0HA 4B9VA 4OX9J 2DR5A 4CLTA 4QR2A 1HNVB 3SXLA 4GVBB 4DR4F 2LA6A 3MR7A 2CQ4A 1GAOA 3VALA 4DN9A 2DHSA 2HWHA 3MM7A 2RS8A 5HMXA 4MIWA 1PAEX 1X0PA 1AZSB 3ETOA 4XIUA 1A9NB 3MD3A 2W25A 4I2PA 1JJ4A 2KXNB 2V34A 3MD1A 3BZQA 2ZJPQ 3NWGA 1XK8A 3VV2B 4XPEA 1U2CA 4NEYA 4O3QA 3PW5A 1RAFB 4MKVA 2GS8A 2K06A 2XHCA 2CJXB 3C6UB 3W60A 5B0DA 1NKBA 2IA6A 4FF4A 3R2DJ 2R7XA 4DSEA 4YR0A 2LCWA 4IYQA 3JTNA 3T9NA 2O1PA 3J81j 1YJNS 1M5SA 1NCLA 1N5SA 3DC2A 3ILIA 2RD5C 4DZ6A 4N76A 3CC2S 3NGRA 4MK8A 2AX1A 2EFGA 2AJ2A 4OZNA 3G96A 5KTQA 2VODA 2VL1A 1LNQA 4M5NA 5IXUA 4OYBA 1QAXA 2KZZA 2C2EA 1JJHA 2LMIA 3CPWR 3TX0A 1SKWA 3PKMA 2X3DA 4E8UA 3QIPB 1DFDA 3OL9A 3P96A 4ZP8A 3GJQB 3W8GA 2R7QA 4R8UB 3KDNA 1CQMA 5D4PA 2ABYA 2Z2ZA 3EGNA 2GGPA 3T5LA 2KG1A 3HI9A 2EVZA 5B0EA 3QGIA 2CIMA 4ECQA 2B51A 3PZPA 3PM9A 2R2RA 1KKHA 3P6YC 3MF5A 2PEBA 5HMWA 1NHUA 2CQ2A 1UEUA 3BSOA 3NP5A 4RW4A 2CQHA 2YNHA 3TA0A 4CLLA 3DLGA 2HYIB 2NXEA 3B6BA 3GIRA 1EARA 4EYHB 1S1VB 4PUOB 1F3VA 2B6AB 2G0JA 3FSXA 1T02A 4H4KA 4JI7F 2WVCA 2J9DE 2E5LF 2WW8A 2M3DA 1S1WA 3FZ2A 3N6MA 3Q8YA 3W9HA 1UETA 2CNNB 4ZIVA 2D1CA 2ZHBA 2AJ0A 2GIQA 2N7YA 2XI3A 4W92B 1I6JA 4PWUA 5JXSA 3TUZC 1NSPA 1WOOA 2FJAB 1MW7A 2HHQA 2CQIA 4OX8A 5KG5A 1H6KX 4ZP7A 5J2NA 2KYZA 3U27A 3CJKA 1VQMS 2DRAA 1YBTA 2IC3B 1VHIA 3VZIA 1TUWA 5KFMA 1IJEB 1FESA 5LMNJ 2BJ7A 1D8YA 2J8AA 3FBEA 2YKMA 1FDBA 3AT1B 4OV6A 4L3NA 4A4JA 1J5EF 2HVEA 5K8OA 1SC3B 2D74B 1UFKA 4L76A 5GAHI 1X4BA 2BDPA 1WKLA 1FJ7A 2GVDA 1IBCB 3PRVA 4B9LA 3UQSA 1NSAA 4DX6A 1LQ9A 3M2RA 4WK3A 3MFIA 3RAXA 4MJKA 3EICA 5AJ3J 4GO5X 3DI6A 4MKBA 1C1BB 2XWYA 4C8ZA 1VRUA 1I1GA 5LT5A 4R5PA 1A6LA 1RHJB 2GHVC 3I32A 1ZPWX 1D3WA 5AXMA 4QIGA 4G1QB 5C2GA 1DY3A 2W2MP 1WACA 4Z2XA 2DH7A 4DUYJ 3Q8VA 4WWSA 2R8JA 3DRYA 2UXDJ 4Q5VA 1BWEA 1EKSA 2YWWA 4AQYJ 1GH8A 1VQ8S 2BKOA 2FZCB 4KO0A 4CRJA 3C3LA 1TTHB 5K14A 3C2PA 3HHLB 4Q8EA 1ITPA 3CD5A 2YNIA 3PYFA 3NNAA 3TR5A 3UDEA 2YVSA 3TVZA 4C97A 4XO0A 3PIPQ 2XGPA 3KLGB 3VAIA 2UUWA 2DR9A 5GMDA 5IV4A 2LECA 1NB7A 3O1LA 3QGPA 4X4VA 2GMJA 2UXBF 1NKCA 1TL1B 2GJFA 1PJ6A 3D4JA 1DLOB 1EQMA 4JI3J 1W26A 2BW7A 3FGVA 4I2QA 3R9LA 2Z0GA 3DN9A 1S7HA 4IOBA 4FBUA 2FHJD 4M5DA 5IQQA 4WBFA 1S1XA 2KT3A 2DO0A 2EFPA 1U8SA 2OEKA 1JLEA 1RT4B 2DNGA 2XMUA 3UFCX 2VUGA 4JI1J 3NMAA 2KHCA 3G71S 3JQMA 2V8VA 3M2UA 1V3ZA 4PWWA 1TELA 3KLHA 5IOLA 4PEOA 2RRAA 4O3SA 2XMAA 2VBZA 2LQJA 1M1HA 2WVDA 5IT9U 2AV5A 1Q53A 2DNHA 2HG4A 3R5GA 1FO1A 2QJ3A 2FTRA 3MPUB 3DRXA 4YB5A 1GXLA 5FDLA 4DQSA 2GQCA 4N47A 1DARA 3O44A 5HVFA 1Y5IB 4A8KA 2LYVA 4JI8F 3DXSX 1RISA 2FUG9 4EMDA 2AJQA 4ENOA 2IY5B 3EJMA 2J9EA 2XYHB 3TUIC 3VQSA 5KFKA 1SBRA 1KFSA 4M63A 2ZBQA 2V4JB 1F5CA 1CSJA 2HFNA 3B54A 4USTA 3SQOP 3AA8A 6AT1B 1ZOTA 5GAGI 4WCEQ 5D3GB 3T3FA 4GC7A 1WTBA 4DQIA 2ZZNA 2GJ2A 2YWEA 1FE0A 3MPVA 3SV4A 2W01A 2BJDA 3CCQS 5L1IA 4FKXA 4G1PA 4B3TF 2AW0A 4X64J 4IO1A 4WFBQ 4OYIA 2MKKA 4F0HA 4YB1P 3CVKA 4FVCA 3K5MA 4DN0A 4TY8B 2LQ5A 5J2QB 5HVHA 2EC0A 1WF1A 2J5AA 4RR5A 4A48A 3AJ1A 4ED4A 3Q0AA 1PJ7A 1YRUA 3JXOA 4JI5J 3R7NB 1S4EA 1RAJA 2DY9A 2RF2B 2GC8A 3ITHA 4EFAC 4FNIA 2HS0A 2AJ4A 1S5ZA 1IBKF 3BGRB 3Q83A 3PR4A 4LFAF 2O01C 1XEZA 4X4RA 1W2IA 3R6GB 4FS2A 4A8QA 2YKPA 1VHFA 4RX6A 3T5KA 1RTDB 3D1QA 4LF5F 1EZZB 4AXJA 4LFCJ 4HTIA 2W8KA 1R31A 2ZITA 4A47A 4OI1A 4FKYA 1YZ7A 4ILRA 3QPIA 4NLOA 4P10A 5DZ7A 3V81A 5KFFA 1RWOB 1DHMA 1RHRB 3MM9B 3TAMB 3PV8A 5C7PA 4KB7A 1JLQB 3EGVA 1WJ9A 5HO4A 2EXUA 4R0EA 2DHAA 2BKNA 1SXLA 1WF0A 2QG9B 1VQ7S 5EN1A 4ID8A 3QIDA 4DR1J 1TUGB 2NR0A 2OPQB 2XEXA 1C1CA 4KBIA 2LEPA 3L09A 1NZAA 3D6MB 1J27A 2ZKTA 3G4SS 1O8BA 2MZTA 3R5CA 2XMTA 1R8BA 5EUHA 4ZVUB 5DLFA 3CTRA 3GWCA 2ROGA 3ISND 4LF6F 2MJNA 1V6HA 3ZZTA 1OIAA 4EBDA 2AGQA 2DR7A 2UVRA 4FF3A 3H8YA 4TY8A 1JNZB 4BBYA 1JNRB 3OTOF 3OFGA 4P2XA 3UNGC 2VQFF 3BPSP 4LQ3A 1KR4A 3QGHA 2GIFA 1U6ZA 2VH7A 1HNVA 4PXDA 3CT9A 3QGGA 4F50A 2VDHA 2JEJA 2VKZG 1UWBB 1WI6A 4CT8A 2G0CA 3R8YA 4KC5A 3QZ8A 2K3KA 3EGWB 1QTMA 4KKOA 3R3TA 2CJAA 2HVIA 3DLGB 2APOA 2CWXA 1WI8A 3NKYA 3US5A 2F7VA 4ID5A 1ACMB 4DDFA 3CCLS 2RH3A 3DRSB 3PHEA 3TEHB 3F44A 3IRXB 3N6NA 2JC1A 3ENWA 1WORA 3PJXA 3G8TA 1D9AA 4WFYA 4DSFA 2V2ZA 3HFZB 5KG1A 2MQ8A 3H59A 2AMCB 4G1QA 4C9DA 2KT2A 1QUPA 4USUA 3W1YC 1EX8A 2LA4A 2R8IA 3W61A 2XHWA 2A10A 1OYDA 2J8SA 2RE1A 3MPDA 3N4WA 4P2MA 3TWZA 1FRHA 4F3QA 4I1TA 1Y9OA 2EEYA 2V9WA 1FEEA 2FIUA 2QGFB 3DRRB 5LJ5Y 2DHXA 4RBUA 3V4IB 3AD7C 1IBMF 1HBNB 3NCPA 1URRA 2OUGA 5KT7A 3RR7A 2FVRA 3HHLD 1QAJA 4FP9A 4WFZA 4JI4J 2QL5B 1S10A 3NRBA 1VBYA 3GIKA 2W2PP 5U47A 4OI4A 3RU0A 4DV5J 1FX4A 1CJTA 3D0IE 1FK9B 2MZRA 2A1BA 3D54A 4UW2A 3CDBA 3Q23A 2VFVA 3BKFA 1X4FA 2BEFA 3DI6B 4NWBA 1X0FA 3K57A 4WYLA 2ZH4A 1N6QA 3FSIA 2HK3A 4TYBA 4NXMJ 1MMNA 2KRBA 1C2PA 2V8PA 2OJ3A 1CEZA 2MMYA 2R3VA 3GONA 5A8WB 3E01B 1CJVB 1VQYA 4OI0A 4H4OB 1KLMB 4MIBA 5KFQA 5ETVA 4QPXA 2B9WA 1C1BA 3NMRA 1OYEA 4Y2KA 1RT2B 1UJ5A 1Y0HA 3QSIA 4UTGA 2BJ3A 4B17A 4MK7A 3HVRA 3DLJA 3VF0B 2COLA 4EO8A 1VR6A 5J2MA 2HKEA 3V5RA 5CCLA 2G1DA 4HACA 2HQFA 1YJVA 2DGOA 2RRBA 2GX8A 4YB7A 1JXEA 1NO8A 1WTFA 2CVIA 2IRYA 3Q2SC 3PX6A 1T05A 1VISA 2QLJB 3PW4A 2OEMA 4ETXA 1U6BA 3IRWP 1JKHB 2QLWA 2CQ3A 5KG0A 3N9UC 3ZTPA 5KFJA 4DLEA 4ER8A 1HI8A 2MPUA 1QVFR 3NGUA 3CMAS 1Q5YA 2KJVA 1HWIA 3CGIA 1IBLJ 4ZPCA 4WKRA 3OSPA 2E1PA 2H1YA 2XBPA 2MXYA 3TVYA 1NJYA 2DD8S 2B0GA 4MKAA 3PCOB 2BQRA 1QVGR 1UVJA 4P2SA 1V5IB 2EG2A 2ZBCA 5L8RC 2QYGA 1RTJB 3AOAA 3GSIA 3QNWB 1TK5A 3D5MA 4IOCQ 3H0PA 5KFVA 4ZPWR 5A76A 3Q8PB 2CPEA 3OJUA 1S97A 5F0UA 3JSMB 1UW4A 1DRZA 1N0VC 1NH8A 4ANDA 1ZTWA 1RAOA 1Z2LA 2BE7D 2V2QA 2PO4A 3LAKA 1SCJB 1Z4UA 3M8SA 2W2NP 3LF0A 2ZC3A 2FLPA 4H4MB 1BQMB 4K4XA 2V67A 3GB0A 4HLBA 4OYOA 2DNMA 3D6TB 4Z37A 2MHNA 2V94A 2MQLA 3HFKA 4QW8A 1JQGA 2R7RA 1BLUA 4ELTA 3GTYX 1Z1ZA 4OHXA 1N34J 1HPZA 1HBMB 1VBKA 4WPAA 5GADU 2UXDF 2AZ3A 5J1EA 3HM9A 4AQYF 4RL1A 1X4EA 4NLTA 2KYXA 2J7UA 3GCWP 1SL1A 3PY8A 3UDVA 4QIWD 2E9TA 3NL0A 3IP0A 2KT5A 4P72A 1XQIA 3MR5A 2DB1A 1KVJA 1MLAA 3MPYA 3OPKA 1HNWJ 4NYPA 2RVJA 4M8LA 5DO2A 4WKYA 4QIVA 5BJRA 2RQ4A 6FD1A 4XPCA 3TANA 5HP1A 2IVMA 2QLBB 3GCXP 2YNFA 4EUVA 3KYLA 1U1KA 1OO0B 2DCLA 2QSFA 2Y1IA 4NRTA 1LK7A 2AYMA 4KH0B 4LRBA 1T95A 3I0SB 3DLKB 1KQFB 1VS3A 3MOJB 5KFOA 3CWJA 2OLWA 5DG8A 5M2PA 1VDHA 3T1AA 5GAHU 4CLYA 4F3MA 2W7OA 2EG1A 3M6UA 5EWGA 4TVAB 2B5JA 4X2BA 3I9ZA 4ED7A 1U48A 4C3KA 1XMOJ 3A1YG 2ZH5A 2NZ4A 2GAGC 2FVCA 2CG4A 2E1RA 2NSBA 2VU5A 5J2PA 3B78A 4OFZA 3MM9A 4QW9A 2QL7B 1U1RA 2RKIB 5F8MA 4P7TA 2XS2A 2DHHA 3QO9B 3PJWA 4F8RA 5KT4A 3OUYA 5K8NA 3HD1A 3VGUA 4JV1A 3J7AN 3DGVA 4HR2A 2BW2A 3VCDA 1CULB 2AYEA 2HURA 4ZVHA 2UUAJ 2XS5A 1C1CB 3JYTA 1OPIA 2VFTA 1CS4A 4ZHRB 1NKEA 2F5GA 4TQSA 1RSCA 3IS9B 5J1PA 3RTVA 2EFNA 1Y10A 5KAKA 2CVEA 4QYRA 3SSRA 3WBZA 1H7WA 1F6TA 3PKYA 5DQGA 3MECB 3W8PA 2GO9A 1T05B 1MWYA 3KHRA 2WB4A 2EBGA 4LVOP 4B08A 1S99A 3I5CA 4K5RA 1DTQB 2XYPB 2ZOFA 5A6PA 3MGJA 1ELOA 3TNVA 3G6ES 3W64A 3OLAA 1LOUA 1RKIA 4DV6J 2Q1LA 2WK4A 4A8YA 2MKHA 1W25A 2I38A 1IBKJ 4UOHA 4FF1A 1YJRA 1QY7A 4DMZA 4PWDA 4YS2A 2B6AA 4M5GA 2FLNA 4WK1A 3M8QA 1QSLA 1ZYQA 1Q1KA 2FHKA 2HFZA 2V50A 5C2CA 1N5VA 1UVKA 4KHMA 2M8DB 3M9NB 2BM0A 4YN3B 4NZ6A 2YKAA 1T7PA 2WW4A 2R8KA 3VZHA 1YJTA 5ETPA 1FRMA 2GMLA 5AXLA 3KHHA 4DR1F 4DL2A 2A2CA 3POTB 3IWLA 4TY9A 3H40A 1SL2A 1S49A 2W4CA 3DLEB 3TYTA 3KK1A 2ALZA 1UEKA 3BBCA 3LUYA 4Z7YA 2YTCA 1S1UB 5KG2A 1U0HA 1N6QB 4CLKA 3IGNA 3IA0A 2KFYA 2A2DA 3I5AA 1BQNB 1F2HA 1PYTA 1QD1A 4ZOSA 3ISNC 3T41A 5IM0B 4QPTA 1RT3B 1E6YB 5EGYA 3M8WA 3MM6A 4EK2A 1YSJA 1XNQF 5C24A 4URGA 3P49B 2IAJB 2FJWA 3K89A 2ASDA 3HF5A 1AUDA 1R8PA 2DO4A 2P9GA 3IRXA 4OZJA 2UUCF 2F65A 2VPYB 5FD1A 3TP2A 5I3QA 1X9WA 4U8VA 1M5OC 5ADZA 2YWFA 2KFZA 8AT1B 3JS9A 3ILJA 3V6JA 1S9FA 2UUBJ 3CDAA 7AT1B 2L9WA 1N5TA 1BQXA 2J7KA 2EKNA 4NLWA 4LSLA 4WYWA 2POKA 2G4BA 4DR6J 4KV8A 5ETMA 2R4FA 3OL6A 1RAAB 3FVYA 3RW6A 4LSZB 4USJC 2EWHA 1HQEB 1TVRB 2HFUA 4DL5A 4DR7J 2CAJA 3SQGA 3FMBA 1P27B 1XTZA 1D8ZA 1R0AA 4JYAF 1SKUB 2ACYA 4USIA 2K1RB 4ZS6A 4L6V3 4ECSA 4RZRA 1DJ0A 1H74A 1SIWB 3KK3A 4IR9A 1QM9A 1V3SA 2IM3A 5IT0A 1IVZA 4LF4F 3UDCA 4ZLJA 2J0WA 2HHUA 4NCGB 4OX7A 5CQGA 5KFPA 1NK9A 1DQ9A 1RI7A 2MY8A 1Y3JA 3TJ9A 3ZZOA 5LMNF 1N33F 3VAFA 1APSA 2DCUB 2HMIB 5D0HA 2UV8A 5HROB 2KRRA 4C11A 3MAAB 3TZWA 3A13A 3GFYA 3MAHA 4ZVEA 1VIOA 1NSQA 1S6PA 2A0FB 3SBMA 2MKJA 1YGYA 4CO3A 1KTQA 1V5VA 3CJ4A 3LPYA 4ZPTR 4WU2A 1RT7B 2F1FA 3U1NA 3ENVA 1SH0A 3G6XA 3BSAA 1RB0A 1FFSB 4ZITA 2IBOA 1K0VA 1HI0P 2Y8WA 4OL8A 4NYZA 1OY9A 5KT6A 4ED5A 1K0TA 2DVIA 2Z58B 1S72S 3BGUA 2HNDA 3L4BC 5ETKA 4C98A 5IZHA 3DOKA 1OQ6A 3K5NA 1RADB 1UP1A 1OMSA 1VMBA 1RLCL 2C22A 3J80Y 1ZA1B 2MLXA 2XSFA 4RLEA 4OX9F 3BQ1A 5DG7A 2J6UA 2B4VA 1B64A 4GVLA 2XMKA 2XCPA 1ZAVA 1X5SA 1M1KT 3LP1A 3HJVA 1TKTB 3TQEA 2LU2A 1SKRA 3CJSA 1SC6A 2DGQA 1VIXA 2M88A 2CPXA 3BB5A 3W2WB 1VQ9S 4BHQA 4IDKA 3SSQA 5E3PA 5KFBA 2DGXA 2CQBA 4N8NA 4OYPA 3TJAA 2XTJP 2E5IA 4LBIA 5KFXA 3WC2A 3OTEA 4OHYA 4RKUC 1T94A 1TV6B 1QJHA 1SQGA 5FIIA 3QAEA 3DYAB 2GO8A 4N7TA 2VFSA 1YWXA 1U26A 2BQ3A 5GMEA 4CO0A 4RNNA 2QA4G 1QSYA 3PFOA 1I3OB 2CDQA 2MQQA 3MCOA 1TKXB 4M5LA 4LIWA 2LQ8A 4CO1A 1UL3A 4ECYA 1RHUB 2XY6A 3QT6A 1L3VA 4DL0C 1RTZA 1WKJA 1U2FA 4ZVSB 4TN2A 3HP6A 3F41A 1GMWD 1H7XA 2KKHA 3GR0A 1UEVA 3LGHA 3OXFA 4IRCA 2H48B 2LVWA 2ZKUA 2B56A 4RBTA 5THWA 1D9FA 4IUFA 3NEKA 3OQ2A 2DIUA 2FD2A 1IKVB 3KXDA 3L7PA 1T03A 1FNMA 3SCJE 5IQ6A 4K2JA 3GG1A 2QO3A 5M2RA 3I55S 5E0OA 2AEMA 4DS4A 3PRDA 3D1OA 3NNCA 3P5TL 2D3O1 4RWWA 1IKWA 5IC6B 1L3UA 4NLGA 2E9ZA 2NXJA 3UR0A 1D09B 1R0BG 1RWMB 4F2SA 4LSLB 5C42B 3KG0A 1T9XA 3ELHA 1LFPA 2ZM6F 1CC7A 1HWLA 1UZHA 3MCNA 3CCUS 3OW2R 2ADCA 1KRPA 4IFYB 1NPPA 2GQ2A 2HAIA 2LEAA 1XR5A 2HBRB 1RU2A 3EDQB 4HVZA 3EX7B 1EIYB 1CBKA 1S76D 1UKUA 1JIHA 1U09A 2RIJA 1IKYA 3M6XA 4PYDA 5KG6A 4TU9A 1HR0F 4ZCLA 4C8LA 5GAEU 4ZVOB 3TW0A 3D0GE 2YH1A 2DXFA 5JVHQ 3RG6A 3N0VA 3LP0B 4V19X 4LREA 2WRMA 3MDFA 1BQNA 4O3NA 3Q8QB 2V69A 3UW1A 1Y3KA 3L95X 4LF5J 4NLVA 2HHWA 3BQ2A 1DQ8A 2RHQB 2B9YA 1FKOA 1LW2A 1JLEB 1RT4A 2V63A 3L7UA 2BE2B 5HBMA 5LL6d 4P9SA 2VF3A 3PX0A 1TFYA 3PW7A 3RBDA 3Q24A 3H20A 5GAGU 3R5BA 3HLUA 4KGXB 3CCES 1FJGF 2ZH1A 1WNEA 4XAKA 1M1GA 3B82A 2YWGA 5KFDA 4J5OA 3HSZA 3LO3A 2EC2A 4E98A 3BKTA 1BD6A 3HDSA 2DGSA 2R2SA 1FWKA 1FD8A 2D41A 5IWAF 3TOQA 2BABA 3OFEA 4KR0B 1QE1A 2CZVC 1SI9A 3DFEA 4K4ZA 3IR7B 3AB2B 3HHLA 3T19A 5B0CA 5HJYA 2AKWB 2FJDB 3KJVA 3EZ5A 4K4WA 3A12A 1R0AB 2UUAF 2MTLA 2U1AA 4PPDA 2RU9A 3CB4A
chains in the Genus database with same CATH topology
5ETTA 5ETSA 1DY3A 2QX0A 3HCXA 1KBRA 5ETKA 4M5JA 2BMBA 3HSDA 5ETVA 3QBCA 4CRJA 2F65A 3MCNA 3KUEA 4M5KA 3KUGA 4M5HA 4M5MA 5ETNA 1TMMA 5ETLA 3HSJA 3ILJA 1HKAA 1RU2A 3MCOA 3MCMA 4M5LA 4M5IA 1CBKA 3HSZA 2F63A 5ETPA 3ILIA 3UDEA 3UDVA 1HQ2A 1Q0NA 4M5GA 4CYUB 3IP0A 1EQ0A 1RTZA 3ILOA 3HSGA 1G4CA 5ETMA 3HT0A 1RAOA 4M5NA 3UD5A 3HD1A 1F9HA 1EQMA 3HD2A 4PZVA 4AD6A 5ETOA 4F7VA 3ILLA 3KUHA 4CWBA 1IM6A 5ETRA 5ETQA 2CG8A 4CYUA 1RB0A 1TMJA 1EX8A 1RU1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ETT A;  5ETS A;  1DY3 A;  2QX0 A;  3HCX A;  1KBR A;  5ETK A;  4M5J A;  2BMB A;  3HSD A;  5ETV A;  3QBC A;  4CRJ A;  2F65 A;  3MCN A;  3KUE A;  4M5K A;  3KUG A;  4M5H A;  4M5M A;  5ETN A;  1TMM A;  5ETL A;  3HSJ A;  3ILJ A;  1HKA A;  1RU2 A;  3MCO A;  3MCM A;  4M5L A;  4M5I A;  1CBK A;  3HSZ A;  2F63 A;  5ETP A;  3ILI A;  3UDE A;  3UDV A;  1HQ2 A;  1Q0N A;  4M5G A;  4CYU B;  3IP0 A;  1EQ0 A;  1RTZ A;  3ILO A;  3HSG A;  1G4C A;  5ETM A;  3HT0 A;  1RAO A;  4M5N A;  3UD5 A;  3HD1 A;  1F9H A;  1EQM A;  3HD2 A;  4PZV A;  4AD6 A;  5ETO A;  4F7V A;  3ILL A;  3KUH A;  4CWB A;  1IM6 A;  5ETR A;  5ETQ A;  2CG8 A;  4CYU A;  1RB0 A;  1TMJ A;  1EX8 A;  1RU1 A; 
#chains in the Genus database with same CATH topology
 2HZC A;  2OPQ A;  5L9X A;  2CJQ A;  4DBQ A;  1JXV A;  4RW7 A;  4DF8 A;  3RAM A;  3I56 S;  2C2O B;  4KPY A;  4C8Y A;  1S0M A;  4GKK F;  2MST A;  3VHQ A;  3K8W A;  2ZJR Q;  3FJ2 A;  5KFS A;  3OUY B;  2IVY A;  3F73 A;  2F8M A;  2Q6B A;  4D3G A;  2QFJ A;  4PG5 A;  1MSW D;  4FPR A;  1EET A;  3KKF A;  4IRK A;  2FHO B;  2IPO B;  3BRE A;  4MH8 A;  3OD2 A;  2W4P A;  4PQU A;  3IS9 A;  2CZ4 A;  2CKW A;  4H4M A;  4L3K A;  2F3J A;  3PW2 A;  2HZV A;  2XGQ A;  2CJY B;  1FRX A;  3BGR A;  5LJ3 Y;  2ZWP A;  2XQC A;  1KFD A;  1N54 B;  4F7V A;  2OGU A;  2IRX A;  1IM6 A;  2FLO A;  4J91 A;  5ETQ A;  4EI2 A;  3AA9 A;  2L41 A;  3Q2T C;  4JV0 A;  2CQG A;  2QYC A;  2BAC A;  4JI1 F;  1XN9 A;  1REV A;  4TNO A;  4E0D A;  2C3U A;  4FYX B;  1ZET A;  4NEZ A;  2AYB A;  3PO4 A;  3UN5 A;  4QWA A;  1GFW B;  3MEE B;  2AZ1 A;  1HBO A;  2QV6 A;  4USW A;  4XDD A;  3H2U B;  4CLP A;  2CFX A;  3BBF A;  2AT1 B;  2MQP A;  2GQQ A;  3FFI B;  4UOF A;  2IBK A;  4CYU B;  4OZ5 A;  2CPD A;  2I1R A;  5B08 A;  4ZPA A;  1S1V A;  4HDG A;  4PUO A;  2KI2 A;  2IDE A;  1RCX B;  3A3O B;  4DV5 F;  1VC0 A;  2R7S A;  5EX3 A;  1R43 A;  1SVD A;  3GU0 A;  4ECU A;  1HBU A;  2RUS A;  4XK8 C;  2G2Z A;  3P3D A;  3JQK A;  2ZH9 A;  4ELU A;  3IWN C;  1UA0 A;  4O3O A;  3CIZ A;  3P45 B;  4B3T J;  4A8F A;  4P6Q A;  2HSE B;  4TLR A;  3CC4 S;  4NRU A;  2AHO B;  1F1B B;  3GJT B;  4GRS A;  5A2Q Y;  2CJB A;  4N77 A;  5HQM A;  2OKQ A;  4PXE A;  4C0O C;  1B3T A;  2DIT A;  4DV3 J;  2JNJ A;  2HBZ B;  3OR2 B;  3T1H J;  1Q79 A;  4DSJ A;  2G13 A;  3I4P A;  2CXE A;  4W4M A;  4ALZ A;  2LXI A;  3OLB A;  5CYM B;  1YTY A;  5CYM A;  1BC6 A;  4R25 A;  2B5J B;  4DL6 A;  2HFS A;  3M32 B;  3A8J A;  4DEZ A;  2KB2 A;  2BOP A;  2UXC F;  4B02 A;  3KG1 A;  4BC9 A;  2B8Q A;  1JK9 B;  1JLB A;  1G4C A;  4C7Q A;  4DS5 A;  4F4Y A;  1SV5 A;  3CD6 S;  5D4L A;  1FD2 A;  1VBX A;  5DDO C;  2K3I A;  1X5O A;  3W3S A;  1F0X A;  2U2F A;  2R7O A;  3LQV A;  4Q2M A;  4LFC F;  2XCA A;  3W5X A;  1S9E B;  1UA1 A;  2NCK L;  1TAU A;  3VGV A;  4U6P A;  1B4S A;  3IAM 9;  4YDX A;  5KFA A;  3GIM A;  5CD4 A;  3CXC R;  1DAX A;  1WEL A;  5F3Z A;  2VIC A;  1U4B A;  5D0R A;  5E3Q A;  1RT7 A;  4J9R A;  5B0B A;  4LF4 J;  4YDD B;  1VK8 A;  1TVR A;  1FNX H;  2IMW P;  2NUH A;  3QWU A;  4KHP F;  2FVS A;  4CZC A;  2ATC B;  1FWL A;  2VFU A;  3CCW A;  1R89 A;  4AT1 B;  3LAM A;  3U1M A;  4UQG A;  4LF6 J;  1F2G A;  2P6T A;  1QLN A;  4LRA A;  3DCA A;  1FWP A;  2OML A;  2D3Z A;  4LR8 A;  4J9N A;  2QL9 B;  2UXB J;  1KP6 A;  4HHH A;  4WP8 A;  2OSQ A;  3JTP A;  4NLS A;  4M1K A;  1PKU A;  1RTH A;  2BKP A;  3QFH A;  2OD4 A;  3IGV A;  2QA4 S;  2FJX A;  3ZZR A;  4ECX A;  1WC1 A;  4IO9 Q;  2KXF A;  3LA0 A;  4B3S J;  4F3O A;  3TJ8 A;  3JAM U;  2XB2 D;  3BR8 A;  3M6V A;  4F4A A;  2IAJ A;  1Q7L B;  2EK6 A;  4F0M A;  1U1N A;  1XNR J;  3FC9 A;  1N34 F;  3OFF A;  1N5Y A;  1VLO A;  1W2B R;  2HHT A;  1BQM A;  1NM2 A;  1RT2 A;  2ZE2 B;  2EK1 A;  4NZ0 A;  4WE1 B;  3FEY B;  3TZY A;  4EEY A;  1RKJ A;  2V5H G;  4DV0 F;  1IKW B;  1B7Y B;  3PO5 A;  4PG4 A;  3G8Q A;  2ZZT A;  3VQT A;  1YZ6 A;  4CT9 A;  4DR2 F;  2DNZ A;  1JLC B;  3WIV A;  1S1U A;  5D4O A;  3AQP A;  5F8G A;  1LKZ A;  2W24 A;  2QLF B;  1R27 B;  4A8X A;  1HBM A;  4UUX A;  1Z2Z A;  4OZ0 A;  3T5J A;  5B0A A;  1HNX J;  3WZ0 A;  3CD7 A;  3DDN A;  5ETO A;  1S1T A;  4UZB A;  2E9R X;  1TL5 A;  2I0X A;  2IDL A;  3MEE A;  5B0G A;  3CUN A;  1HD0 A;  2CNO B;  4X84 A;  1FJC A;  1CJK B;  4OJ3 A;  1WC4 A;  1PJ5 A;  3SZ2 A;  3MMA B;  2VQE J;  2X1B A;  2R7W A;  3ZC4 A;  5FLX Y;  4DFK A;  1VQL S;  2Y9H A;  4KRW A;  2HBY B;  4CH7 A;  1JMT A;  2WBM A;  2NS1 B;  4B3O B;  4J90 A;  5L46 A;  4CDI A;  2L48 A;  2QEX S;  4AFF A;  3KK2 A;  4K0K F;  3RRK A;  1AXQ A;  1ZS6 A;  3CJ2 A;  4LF9 F;  3H2L A;  1IR0 A;  1JLF A;  3RR8 A;  3MMB A;  4RWX A;  2FHJ A;  2KG0 A;  1LW0 B;  4ZKA A;  1T0T V;  4K4T A;  3B4D A;  4ZPB A;  3EZU A;  2WOM B;  2SXL A;  5MLC V;  4AL6 A;  1RHM B;  4RUH A;  2HAF A;  4NPO A;  2BJ8 A;  5BYS A;  1RTD A;  3JAM Y;  5AJ3 F;  2DNR A;  2O67 A;  3C8Y A;  3O6Q A;  5LSL A;  3R7B B;  2ILY A;  1TL7 B;  5SZT A;  2GV1 A;  2KVI A;  2YQ1 A;  4NXM F;  2CZ9 A;  3JQJ A;  1RWP B;  3DM2 B;  2DEJ A;  3PYE A;  2FB0 A;  3RGI A;  1OPZ A;  4DUY F;  2PSZ A;  3D1H A;  4RW7 B;  1UFL A;  5I4M A;  4GMK A;  5L1K A;  4F4Z A;  2HHV A;  2YKO A;  4CM0 A;  2GAH C;  4PG7 A;  4YME A;  3PNI A;  3PEJ A;  2CPI A;  4HH0 A;  2E44 A;  2BX6 A;  4RBV A;  4BS2 A;  5KFC A;  4OYZ A;  2FVP A;  1JJC B;  4HI1 A;  1EP4 A;  1S1T B;  1WEZ A;  4EU0 A;  1ZM3 A;  2VA3 A;  2Y0B B;  3DLB A;  3D6H B;  3D67 A;  3MM6 B;  4Y3C A;  1EET B;  2O66 A;  4DI6 A;  5EWE A;  2F63 A;  1SH2 A;  3WX8 A;  4DPW A;  2FDN A;  4FF2 A;  1R3N A;  4URQ U;  4HEA 9;  4U7U D;  3SV3 A;  2BYC A;  3AJD A;  4PR6 A;  4RW6 A;  4LMZ A;  5J2N B;  3R7S B;  1BWV A;  1OSC A;  3CJ0 A;  4QWB A;  5E2Q A;  4IKA A;  1KVI A;  5HP1 B;  3HD2 A;  2YPY A;  1DTT A;  2M9K A;  1FRK A;  2QZ8 A;  2CNL B;  3G82 B;  5FLX U;  3MFH A;  1KN6 A;  3DRR A;  3R2C J;  3J7Y I;  2HW3 A;  1IBL F;  2UVU A;  4BDP A;  1GMW A;  1K1S A;  4FYY B;  5K20 B;  3CO0 P;  3KLI B;  4ES1 A;  3WC0 A;  3PW0 A;  1RQ0 A;  2BRK A;  4RW9 A;  3AAW B;  1ULR A;  1UTA A;  2IYG A;  5M2U A;  1QE1 B;  2DKO B;  1X5P A;  5DM6 Q;  3GV5 B;  3W65 A;  4RW4 B;  3PDN A;  1VLY A;  2C3Y A;  4MFB A;  1FJG J;  3ZZY A;  1GXT A;  4WXO A;  3UCZ P;  1SC1 B;  2IYI A;  2K1R A;  1RJJ A;  4NI2 B;  1FEH A;  3NBP A;  1Q86 T;  3LAL A;  5L38 A;  1Q82 T;  1HMV A;  2VA2 A;  1TK0 A;  1X4G A;  1HBO B;  4FDF A;  3V6H A;  3D68 A;  3R1H A;  3C46 A;  5IWA J;  1NH7 A;  2GMH A;  4FYV B;  3BH7 B;  5A8W A;  5AE3 A;  1KOO A;  1PBU A;  4X64 F;  1RBO B;  5F8H A;  2LLZ A;  3HUL A;  1K1Q A;  4KTQ A;  3M9M B;  4DL4 A;  2XNQ A;  1SH3 A;  1RU1 A;  3F56 A;  3UPF A;  3M4X A;  2OAU A;  2XZT B;  1MML A;  2JHE A;  5CYJ A;  3H5X A;  1XWL A;  4LSN A;  3GJS B;  1FKP A;  5AE1 A;  3MMC B;  3HHD A;  5DDP C;  2MDA A;  1G6B A;  1TKX A;  3J80 U;  4OJ1 A;  4DPX A;  4IH7 A;  3W9I A;  1HWJ A;  3FBB A;  4KYZ A;  4C8N A;  4CO5 A;  4B9U A;  2KFN A;  1FHT A;  3BDE A;  1S6U A;  1YDL A;  2XY7 A;  5I42 A;  2UUB F;  1HNW F;  3NS7 B;  2M4M A;  3HVW A;  3ZXW A;  1T9Y A;  3THV A;  4UOC A;  3FCH A;  2LU1 A;  2VC1 A;  1H2T Z;  2G2O A;  3M2U B;  3GYN A;  3KLH B;  2ZJQ Q;  2LQB A;  3NOC A;  4UY8 5;  1FRL A;  2P8I A;  3RBZ A;  4ANE A;  1M5H A;  4CP5 A;  4UT4 A;  2FC8 A;  4MIA A;  4QZV B;  2L3M A;  2DNP A;  4O3P A;  3CMQ A;  4HHJ A;  5DQH A;  1JLF B;  2ILZ A;  3T9Z A;  2I2Y A;  4LF8 F;  3BO3 A;  2RF2 A;  4K4U A;  4DQR A;  3RB4 A;  1RWW B;  4ZPD A;  2F4V J;  2RU3 A;  4IOA Q;  2CPZ A;  2L08 A;  5RUB A;  2V68 A;  4J9S A;  2WVE A;  2PDA A;  1KLM A;  1HBU B;  3KUG A;  1KTV A;  2B8P A;  2HS3 A;  3OXG A;  3P5B P;  1BXN A;  4IQM A;  3UNY A;  3H5Y A;  4NZ7 A;  4N41 A;  2DGV A;  3SIP B;  5KFI A;  4DUZ J;  5A8R B;  3W2V A;  1Q0N A;  1HFE L;  1YK9 A;  3CW2 C;  2H54 B;  4IG0 B;  3DGP A;  2VBY A;  2E1A A;  5MAO A;  4KJI A;  3M7V A;  4QR1 A;  4OMF G;  5A8K A;  2D7S A;  3MTK A;  1XC9 A;  4RPF A;  1JJ2 R;  3TAM A;  2PI5 A;  2OPR A;  3U02 A;  1NK7 A;  3QRP A;  4NE9 C;  4CLF A;  4RUC A;  1NAQ A;  1C0U A;  4HI2 A;  4DFJ A;  1FVQ A;  2V2K A;  3PYD A;  4FN5 A;  4GO7 X;  1VRQ C;  3VTI A;  5HBM B;  2VQF J;  1NK6 A;  2PI4 A;  1M5K C;  1E6Y A;  4ZVQ B;  1WOP A;  2GVZ B;  4TLQ A;  1P9Y A;  1B0T A;  1F60 B;  3MAA A;  4PWD B;  1P9Q C;  4ETZ A;  2ZH2 A;  1Y5L B;  3M2R B;  1U0S A;  1F5B A;  4MYU A;  2JEF A;  2Q3P A;  3MEG B;  2FGC A;  2HHS A;  2JOQ A;  1RA7 A;  1S6Q A;  3W9J A;  1WOS A;  1N32 J;  2KHD A;  3T1H F;  2DXD A;  1NK0 A;  4UZC A;  4ED8 A;  1IN0 A;  2UV8 G;  4FPI A;  2P9C A;  1NU4 A;  1WHX A;  3W62 A;  2B4U A;  2PMH A;  1Y00 A;  2YY3 A;  3LWL A;  1U02 A;  5E3C A;  1ZBT A;  5FDL B;  2CNK B;  2FJE B;  3W66 A;  3J81 U;  1O51 A;  2UXC J;  1Y11 A;  8ATC B;  2ZHA A;  2VDI A;  3BEG B;  1HQE A;  5BYQ A;  3KUH A;  1HBN A;  4K7Q A;  4RO0 A;  1HI1 A;  4RU2 A;  2KXH A;  2BR0 A;  1G1X A;  1KEK A;  4J9Q A;  1FXD A;  1SQF A;  2RNE A;  2V4J A;  2ZD1 A;  4O0N A;  2DY1 A;  5DGA A;  2JFK A;  3QFW A;  2WTF A;  3FEX B;  2Q43 A;  1MU2 A;  3DLE A;  4P2F A;  3KK1 B;  3GV7 B;  5F8I A;  2KL8 A;  3H2V E;  4L72 B;  4WP9 A;  3MAQ A;  5HMZ A;  1L3T A;  4MKY A;  4DSI A;  1RAG B;  3KK2 B;  5E3R A;  5A0Y A;  3KLF A;  1GX6 A;  5ETN A;  4USM A;  5JMN A;  1RT3 A;  2Y1R I;  4H4K C;  4DV7 J;  2E29 A;  2PFD A;  3G87 A;  2BJE A;  2C2M B;  3RBE A;  2X1F A;  2QE5 A;  1UMJ A;  4JOU A;  2VV5 A;  1LWE B;  3MI7 X;  4LVN P;  3D7S B;  2R2U A;  4DL7 A;  3RBX A;  1TL3 A;  1TKZ B;  4CO4 A;  1UW9 A;  2HRT A;  4D3H A;  2P9E A;  4AUK A;  1VQP S;  3MUV P;  3ILL A;  4LJM A;  1R8H A;  3D3B J;  3KLI A;  2CPF A;  2CQP A;  1CQN A;  1YJ7 A;  4LBP A;  2I6W A;  3MMJ A;  5J2M B;  4YQW A;  4KPC A;  4YR3 A;  1XNQ J;  2QSW A;  3CJT A;  2FHM A;  3SEO A;  3D0H E;  3M32 A;  1MNE A;  3IG1 A;  1NEE A;  4FVM A;  3K5O A;  2I9S A;  3EE3 A;  4F04 B;  1XMQ J;  4X4Q A;  2DH9 A;  4U9R A;  2E1M C;  3GZ7 A;  2H65 B;  4FZV A;  1RAI B;  1FDD A;  4X65 F;  2Z30 B;  4YOE A;  1EAY C;  4OZL A;  2X7I A;  1HD1 A;  3RB6 A;  1ZZF A;  4DV1 F;  1X4D A;  5HQ8 A;  3Q8S B;  1X9M A;  3H90 A;  1U2R A;  2DIV A;  3W7B A;  1JLB B;  2ZWO A;  4I4B A;  2IM0 A;  1FER A;  1YJU A;  1YBA A;  3GYG A;  2YQ0 A;  4PG6 A;  1MRO A;  1U7L A;  1MRO B;  1S59 A;  1HNI A;  3GJR B;  1H72 C;  3WDO A;  1RGV A;  3DOM A;  4I7F A;  3F0N A;  4ZPV R;  2VC0 A;  4FNH A;  2DYA A;  5CD4 H;  3HHK A;  4FXD A;  2DTJ A;  4JI0 F;  4JYA J;  3D6F B;  3DLK A;  4KIA A;  3MWB A;  1NRK A;  2QT7 A;  2WVB A;  2RQM A;  3K0J A;  5JVG Q;  1R7I A;  1N36 F;  1TV6 A;  2YNF B;  4J9P A;  2ZHO A;  4EYI B;  1TL1 A;  4F25 A;  1IKX A;  1U25 A;  1IKX B;  4JI2 J;  4X4N A;  4LR7 A;  1B70 B;  4C8K A;  3C14 A;  5G0R A;  2CPH A;  2DEI A;  1FA0 A;  2MKY A;  2J76 E;  5KFR A;  2XWX A;  5KFT A;  1REV B;  2YKM B;  4QQB A;  2MQN A;  4NI2 A;  1HQ2 A;  2PMZ D;  1FDA A;  3K58 A;  3ILO A;  3HKW A;  3OBI A;  4TU8 A;  3THP A;  3NGS A;  2BOA A;  2HQC A;  4LRF A;  4QBU A;  1U1P A;  1GEH A;  5HLF B;  2JLE A;  3H7H B;  1CPZ A;  5J2P B;  2EPI A;  2FJB B;  3I5B A;  4PXB A;  2RDJ A;  1FCA A;  4OI2 A;  3CF5 Q;  5ETS A;  1JX4 A;  3QZ7 A;  3IXQ A;  2WBR A;  3QT5 A;  2RS2 A;  4DPY A;  4ICL A;  4ZCK A;  4QU7 A;  5A6W A;  3KHL A;  4YR2 A;  5KFG A;  5C5J A;  4DLG A;  4GKK J;  5D8H B;  3H4D A;  4O4R A;  2CA9 A;  2JDJ A;  2CQD A;  4IDK B;  2P6S A;  1A7G E;  3GII A;  1UJ4 A;  3PJ9 A;  2ZH3 A;  3W2V B;  3M2V A;  1OS5 A;  2HIY A;  5DDR C;  4DSL A;  2HBQ B;  4F67 A;  4IFV B;  1E6V A;  4UOG A;  3PX4 A;  4C4W A;  1IQZ A;  4IG3 B;  2PGC A;  3HO1 A;  3I31 A;  5BR8 F;  2D69 A;  2OEL A;  4KAI A;  5KFN A;  2V4R A;  1S0N A;  5HMY A;  2LDY A;  2VBX A;  2R9L A;  3MEC A;  1AW0 A;  1WC5 A;  2DNO A;  3R5D A;  1DLO A;  3O5T B;  3FBC A;  4Q2L A;  2AQ4 A;  2OPP B;  2RRN A;  4QWD A;  1U47 A;  4NCG A;  1R6V A;  1YG0 A;  2HQD A;  4NCA A;  4JV5 F;  5F8J A;  4OJH A;  3EVW A;  2LP4 A;  3TA2 A;  2Q6C A;  4CLU A;  4B3M J;  4PCQ A;  1VK3 A;  4I69 A;  4BWM A;  2CQC A;  3KG4 A;  2M52 A;  3MM5 B;  1XR7 A;  3NG8 A;  4ZCM A;  2K8G A;  2FY8 A;  3GSD A;  2QMX A;  3KDO A;  3SCI E;  1XIQ A;  4Z7C A;  4LIR A;  3BYP A;  1RTJ A;  2NSC A;  2XZD B;  4DV4 F;  1VC5 A;  3HPO A;  2GHW A;  4M5I A;  4HAC B;  2BZ2 A;  3EVO A;  5HAT A;  2R8H A;  4ECV A;  1NXI A;  4GVB A;  1BHN A;  5EWF A;  4B9N A;  3KJQ B;  4Y34 A;  4V19 J;  5HAO A;  4A8S A;  3K5P A;  1JB0 C;  2YNG A;  1K44 A;  2DBB A;  4ZJQ A;  1LXN A;  3HK2 A;  3KJV B;  1LWC B;  1OJ4 A;  2V9K A;  1X8D A;  4NLY A;  2OPS A;  4DF4 A;  1JKH A;  2JC0 A;  5FJ4 A;  1ROF A;  3VGT A;  3T1Y F;  2J9C A;  4B9S A;  1MWZ A;  5DM7 Q;  2GHP A;  3GMG A;  2KZM A;  2MZQ A;  2RML A;  2HGL A;  1KSP A;  4M94 A;  3ZZP A;  2AU0 A;  4KH1 B;  4ZVP B;  1PYS B;  1H0H B;  2YXL A;  1UPP A;  4UUW A;  3QJP A;  2PA3 A;  1UFW A;  1T11 A;  2QLX A;  1NDP A;  2XMW A;  3RB0 A;  1UVM A;  4GKJ J;  1WC3 A;  3GFH A;  1R8C A;  1TU0 B;  2OFH X;  4YEA A;  2A6O A;  1EQ0 A;  1C0T A;  4OQJ A;  2HNY B;  2K7J A;  4HH1 A;  4YHH J;  4R0J A;  3QWP A;  4C8O A;  3E01 A;  1CJV A;  2ZBP A;  4DPU A;  4DV6 F;  3RJM B;  2CRL A;  5EHH A;  1X7V A;  2RJZ A;  2B3T B;  5HAN A;  3WIU A;  1LW0 A;  3B4M A;  1IWA A;  3CCV S;  1HYS B;  3KNA A;  2XNR A;  3CJ8 A;  1T8E A;  3AXK A;  1YVF A;  2RIL A;  5I3U A;  3EPG A;  1T3N A;  3G6Y A;  2VG7 A;  1LWF B;  4NLQ A;  1S6O A;  4NX9 A;  4PKD B;  4ECT A;  4U67 Q;  2BJ9 A;  4ZVG A;  5I42 B;  1SKS A;  1TFW A;  1J5O B;  1J5O A;  9RUB A;  4OYA A;  3VAH A;  4LF8 J;  2PE8 A;  3BN7 A;  3E8O A;  2YWK A;  1X4A A;  2HRU A;  2JFD A;  4Q44 A;  1JLQ A;  5LMU F;  2F4V F;  4GC6 A;  4NXN F;  3L7O A;  3QO9 A;  3IFE A;  5H9E K;  3H5S A;  5LM7 E;  2AWZ A;  5A0Y B;  3BM7 A;  3E3X A;  3HSJ A;  1IKV A;  2C28 A;  2PFF B;  3GIJ A;  3GYX B;  5HVG A;  1NK5 A;  5F3T A;  4DCJ B;  1S77 D;  2W7P A;  4KT0 C;  1EHW A;  1VQK S;  4KE5 A;  2AJF E;  1T3O A;  1FJE B;  4ERD A;  4P71 A;  2C2N A;  1I94 F;  2H4W B;  5C25 A;  1YLX A;  2ZVS A;  4DQP A;  3OL7 A;  2V8H A;  1VQS A;  2VAS A;  4O44 A;  4Y2M A;  4DFP A;  2N4D A;  1UJ6 A;  3CCJ S;  3N79 A;  3OSN A;  2DIS A;  2GNK A;  4Y2A A;  2RSQ A;  4JB8 B;  3VWS A;  3TZZ A;  1PBA A;  3DYA A;  4PAA A;  1W7W A;  4A8W A;  4B3R J;  2HFO A;  2NPI A;  3T6J A;  1N48 A;  3HCX A;  3ONQ A;  1IKY B;  2KM8 B;  2UUC J;  4X4U A;  1AYE A;  2DGW A;  2FPH X;  2FYX A;  3QBC A;  2XS7 A;  4YB6 A;  2ACM A;  2BJ1 A;  2MJU A;  3QIP A;  3MR6 A;  1VC6 A;  3MPW A;  4DR3 J;  3D3C J;  2HFV A;  2JJ4 D;  2X1A A;  3TAP A;  2ZD1 B;  2OO4 A;  4I2P B;  3J7Z 5;  2MLY A;  3UDL A;  3RRH A;  2CJK A;  3IBF B;  2VHG A;  2WSE C;  1B0V A;  2BXJ A;  2C42 A;  2MQM A;  5T7L B;  3WX4 A;  4F36 A;  3NGK A;  4X4P A;  5J1E B;  4DR2 J;  2UP1 A;  4I67 A;  3G86 A;  4H4O A;  1PIE A;  3M8Z A;  2ROE A;  3D66 A;  4CNY A;  2M2B A;  1KNZ A;  1OQ3 A;  1HNX F;  1RAH B;  4ZDN A;  2HHH F;  2FZK B;  1QDU B;  4RNM A;  1S9G A;  2G2Y A;  2Z2M A;  2YX4 A;  1OSD A;  2HMI A;  4IR1 A;  1UAW A;  1BE4 A;  1TKT A;  2KM8 C;  1FKP B;  2B4O A;  4K59 A;  4WTY A;  1Q4R A;  4PYA A;  1NZ8 A;  4IG0 A;  5E33 A;  2OD6 A;  3W2W A;  2VQE F;  2VKR A;  2KN4 A;  1DQA A;  1HQU A;  2E5J A;  2AP6 A;  5C42 A;  1NJZ A;  2JWN A;  4WZQ A;  4A8O A;  1WG4 A;  2PD1 A;  4CCH A;  4ILL A;  2CQ0 A;  2DNK A;  1P8G A;  2PC6 A;  3HKZ D;  4WFA Q;  3CCM S;  1RT6 A;  1TUV A;  2N3L A;  3J81 Y;  3NCQ A;  4HDH A;  1QSS A;  2HRY A;  3H98 A;  3NXZ A;  4X62 F;  4ZP6 A;  3NS5 A;  5HQL A;  2HVZ A;  2MGZ B;  3VAM A;  3GV8 B;  2A3J A;  2ASY A;  5E5N A;  3PG9 A;  2HPU A;  3D28 A;  4JI6 J;  3ICL A;  2UVV A;  4Y28 C;  3MOZ A;  2JVO A;  2LQ9 A;  3LP1 B;  3ZNJ 1;  4C11 B;  1UVN A;  1KBR A;  3ADA C;  2HVD A;  3TO8 A;  3DRS A;  3OTD A;  3A3N B;  2GCF A;  2XLJ A;  5DET A;  2H5J B;  1CG2 A;  3D2W A;  5HLF A;  3CD0 A;  4CTA B;  3V2U C;  1XMQ F;  2X1G A;  4BCA A;  5DG9 A;  4JV5 J;  1Y5N B;  3CCZ A;  1RP5 A;  2L9D A;  4ZHR A;  5F9L A;  2MZ1 A;  5AXN A;  2PII A;  4K2X A;  4R8U A;  1GMU A;  4LSN B;  2N7C A;  3KMQ A;  4DV1 J;  2IMO A;  5HI7 A;  3BPD A;  4OIX A;  4Y2I A;  3C16 A;  5E3A A;  4O3R A;  3NAI A;  2W4D A;  3NAH A;  3QT8 A;  4NLU A;  1U0H B;  4UF4 A;  2HQ3 A;  2WB1 D;  2PT0 A;  3BS9 A;  2GVZ A;  5DRK A;  1NPK A;  4NA3 A;  3X1L B;  4LBH A;  2UU9 F;  1N0U A;  1S57 A;  4J9K A;  3QT7 A;  2QA1 A;  3T5H A;  2IRU A;  3NGT A;  2NQP A;  1NHK L;  4ZMM A;  1X4C A;  2BMB A;  5C24 B;  1CJT B;  2M70 A;  3HVT B;  4LF7 F;  3QJJ A;  3IM9 A;  2XMV A;  1NSK L;  2FC9 A;  3IR6 B;  3AD8 C;  2EI5 A;  3DMJ A;  3DOM B;  3IC1 A;  4I7F B;  3ZTS A;  1Q7Y T;  2BAN A;  1TMM A;  1FRI A;  2VG6 A;  3S7R A;  2IFX A;  2XSJ B;  5DGB A;  3I0S A;  1FXR A;  3NS6 A;  1Q8K A;  2M5Y A;  2JH3 A;  2AX0 A;  1FDN A;  1U6F A;  1RWK B;  2L9N A;  3MCS A;  4DJB A;  3JSM A;  2HHP A;  5AXK A;  2WOM A;  2OH2 A;  4PQU B;  2E66 A;  2RQC A;  2FY1 A;  4B9T A;  3AXM A;  3VVU A;  3C6T B;  1PGZ A;  4HHU A;  3UO0 A;  3SI8 A;  3C14 B;  5G0R B;  1TL7 A;  1UZD A;  1GTH A;  2UUT A;  4TYA A;  4ZLN A;  5KFE A;  3KFW X;  5GMK a;  2CG8 A;  3GPA A;  3BKU A;  4OYX A;  2NPF A;  2I8E A;  1YKW A;  3MHY A;  3EPI A;  1UVI A;  3UE2 A;  3LTO A;  2ASL A;  1SJF A;  2HHX A;  3OR1 B;  4P7V A;  3EZO A;  3GFZ A;  4KY3 A;  2ZM6 J;  3SFU A;  1XNR F;  1R0C B;  4YFU A;  4ZK7 M;  1EKR A;  3HSD A;  1WEY A;  5A2Q U;  3A8K A;  3KK3 B;  4F4W A;  3JB9 k;  2BM1 A;  2W9B A;  4DV0 J;  3NGD A;  4J7C A;  3FFI A;  2NYI A;  3H4B A;  3K7R A;  4PQA A;  3CDE A;  3V6D B;  3E51 A;  3V6D A;  2HVH A;  1A0O B;  3AHP A;  1YX2 A;  1U8W A;  2OEJ A;  1HNZ F;  4TQR A;  2XI2 A;  1L5U A;  1S6Q B;  4DX7 A;  5D77 A;  4YY3 F;  1U1L A;  3HVT A;  4URS A;  1YI2 S;  1FFW B;  2DRB A;  1NK4 A;  4OLP A;  3RRG A;  1C0T B;  5L1J A;  2VG7 B;  1NDL A;  2JLF A;  3BYR A;  3L9Z A;  1ARO P;  3AH6 A;  3JSB A;  5DJB A;  2R42 A;  2HWT A;  1NUE A;  4I6W A;  4EWT A;  1WHW A;  3PAC A;  4P75 A;  4CLS A;  3MR3 A;  2ALY B;  2W8L A;  2WHO A;  3JTO A;  3IWX A;  2IHR 1;  4X66 F;  4U96 A;  3HHL C;  4NA1 A;  3RZA A;  4K0K J;  3KHG A;  4LF9 J;  1KD1 T;  4J9M A;  3FDS A;  4I2Q B;  2OPS B;  2CJ9 A;  1FFG B;  1Q8L A;  5KT3 A;  5L1L A;  1RAB B;  4ECW A;  1AB8 A;  1VFJ A;  2HWI A;  4WU3 A;  2YNH B;  4DU8 A;  4R5P B;  3OVS A;  1WWH A;  3OR1 A;  4N56 A;  3IM8 A;  3IBW A;  3U1L A;  2B9X A;  2CYY A;  4C2M A;  5T14 A;  4J9L A;  5BXI A;  2C2D A;  5CZX A;  4JI8 J;  3SDE A;  1NK8 A;  3KLF B;  2AJ1 A;  2WZ1 A;  2ZC4 A;  3CJR A;  3DU5 A;  2W9B B;  2IJR A;  3L3C A;  3IMQ J;  2Z2L A;  1HLW A;  1KVK A;  4RUA A;  1QTN B;  1KOH A;  1CS4 B;  3FRY A;  1TAQ A;  4XDC A;  2W9A A;  2JEG A;  1ZH5 A;  3E2E A;  4PRF A;  2LKZ A;  1RT1 A;  4KHR A;  2LDI A;  1AFJ A;  3PRB A;  1TKZ A;  1VOM A;  1NHV A;  5GVQ A;  5KFY A;  3UD4 P;  3BGO P;  2WSC C;  1XER A;  2AIR B;  3M30 A;  3M8R A;  2BBE A;  3OR2 A;  4RUB A;  3M9O B;  2IC3 A;  3C16 B;  3CDW A;  1YHQ S;  1KDN A;  5IT9 Y;  4NL5 A;  3UD5 A;  1GT8 A;  2B43 A;  1YJW S;  1RT6 B;  3K59 A;  4ZP9 A;  1N32 F;  4CH0 S;  1QUV A;  3OVA A;  1FTR A;  1ZM2 A;  4OHZ A;  4EGL A;  1V9O A;  4O4G B;  2OTL S;  2Y0S D;  2G1H A;  3HZG A;  3I4H X;  1FK9 A;  1PC5 A;  2E5G A;  3MZI A;  4G6V B;  4JI5 F;  4LUB A;  4C6A A;  2JRS A;  3ZNU A;  4RNF A;  3RUB L;  1RYR A;  4PZV A;  3VAJ A;  1FRJ A;  2UVW A;  4DR4 J;  1S7I A;  1RUS A;  2B9E A;  2ADB A;  4KGV B;  2R8G A;  1URN A;  1B0P A;  3BO2 A;  1K47 A;  4J37 A;  4KGM A;  3IN5 A;  3QLH B;  4LFB J;  1N88 A;  2HNY A;  3TEG A;  3R5J B;  3DLL Q;  4WJB A;  1HW8 A;  3FQL A;  1S1W B;  4DCO B;  3VVT A;  2RKI A;  2IA0 A;  1JLA B;  1N36 J;  5CYQ B;  2CUY A;  3LWM A;  2IM2 A;  1WC0 A;  2YBV A;  2ZOG A;  4QR0 A;  2MZJ A;  1SUQ B;  2GFF A;  2HGN A;  4E2F B;  5LMU J;  3M2V B;  3QAU A;  1YQH A;  3N5B A;  3FRZ A;  4KSE B;  7FD1 A;  2GJI A;  1RYS A;  1KHV A;  1O5J A;  3QMQ A;  2DPI A;  4PXC A;  4K50 A;  2V8G A;  3LGN A;  9ATC B;  2H51 B;  2Z8Q A;  3Q8U A;  4EBC A;  4M95 A;  3MM8 B;  2Z4P A;  3KJN B;  4L75 A;  4USV A;  2KTQ A;  3TQ1 A;  3DGP B;  4DV7 F;  3A3P B;  3K2Y A;  4OHV A;  4TU7 A;  4X4S A;  2NXN A;  2NXC A;  1UVL A;  2MZS A;  2YNG B;  1ZA2 B;  3A8I A;  1HPZ B;  1JLG B;  2A18 A;  2HQG A;  3PXG a;  3RAQ A;  1JWW A;  1ZAW A;  2MGZ A;  3TA1 A;  3Q86 A;  1CJK A;  1PO6 A;  3OVB A;  2NXU A;  4AE5 A;  4CO2 A;  4LRC A;  5ETT A;  1Q8B A;  2C3O A;  1WG1 A;  3HVA A;  2C3M A;  2Y3Y A;  1N33 J;  1YRX A;  3TX8 A;  3MTJ A;  4I64 A;  1CC8 A;  4C3L A;  4OJG A;  3ET6 B;  3H5U A;  4LR9 A;  1X31 C;  3MM5 A;  5BYR A;  4U7U K;  2ZDO A;  3HX9 A;  1GK8 A;  1RWU A;  3FK4 A;  1LEO A;  1WD6 A;  4ZN3 A;  1B99 A;  5D6G A;  2E7W A;  3GIL A;  2W9C A;  5ETR A;  4G65 A;  1TZ0 A;  2X3G A;  2MQO A;  4X65 J;  1PCA A;  2RT3 A;  2DNQ A;  2VFR A;  3FUY A;  3M1V A;  5LOQ A;  1RZM A;  4ICL B;  2ZDP A;  4ZA1 A;  4Y2C A;  4N8O A;  1TQL A;  3JSY A;  3FMW A;  3N01 A;  4DG1 B;  4YUD A;  3PR5 B;  2YX1 A;  1M5P C;  2K2P A;  4L73 A;  2E5L J;  4PPZ A;  3R97 A;  5K8M A;  4QOT A;  2XO7 A;  3M6W A;  1YBU A;  4LF1 A;  1U24 A;  3HFV A;  1NLK L;  2VPW B;  3I0R B;  4LRD A;  1H2U X;  4IG3 A;  3MM8 A;  2B7B B;  3DHW C;  2HHH J;  4JI0 J;  3R27 A;  1VYA A;  4V1A k;  4ZLL A;  4G3I A;  2O3D A;  3HXM A;  3BJY A;  3WQP A;  4OZ2 A;  2NUU G;  2NYH A;  3LGM A;  3VGS A;  4CH1 A;  1NND A;  4UQT A;  2QMU B;  1O6X A;  4MK9 A;  4ZLP A;  2ZBR A;  1GX5 A;  2EW9 A;  2WON A;  4QYZ K;  4JI2 F;  4N5S A;  4KHP J;  4C48 A;  1WSR A;  1EP4 B;  4AXI A;  2QTW A;  2FZG B;  4DOZ A;  3J7Z T;  4DU7 A;  4U7C A;  3OHB A;  4RW6 B;  2F9D A;  1J5E J;  1DZ5 A;  1AA1 B;  5KFZ A;  1KWM A;  2F8H A;  2Y1L B;  4C3M A;  3HJF A;  4B3O A;  5DS7 A;  1SJ1 A;  2VG5 A;  1MMD A;  3RYL A;  4W90 B;  1LWF A;  2OHD A;  1RDR A;  5H9F K;  4X62 J;  3ZTQ A;  2X51 A;  5ITH A;  5I3U B;  4ZJL A;  2IVF B;  4CLW A;  4ED3 A;  1MN9 A;  4B3S F;  3BH6 B;  2VOP A;  3M1V B;  4MYT A;  3TUP A;  4RW9 B;  1FT8 A;  1GXU A;  1FX2 A;  1BMQ B;  1LWX A;  1WDT A;  3QRR A;  2BQU A;  2B7C B;  2EBE A;  1VRT A;  3QAT A;  1WKK A;  1VQ5 S;  5T41 A;  2OIH A;  1S4F A;  1KQK A;  1D1U A;  2HS4 A;  3NBP B;  1S0V A;  3QQC D;  5F8N A;  3PIO Q;  1X5T A;  3C15 B;  3DLH A;  2JEI A;  2VJU A;  2LXF A;  2XLK A;  1MU2 B;  4DUT A;  2C3P A;  3OTB A;  1GQE A;  2YX7 A;  2D9P A;  5CCM A;  5BR8 J;  5D78 A;  1S12 A;  4K4S A;  1XMB A;  2F4F A;  3R6L B;  3DHX A;  4QWC A;  5K14 B;  3UVJ A;  2G9O A;  3UVJ B;  1RWV B;  3WHI A;  1ZM4 A;  1HHQ A;  4W98 A;  1FXL A;  1TMJ A;  2I5J A;  2YWH A;  3HHN B;  3UCG A;  4F02 A;  3NNH A;  3OTC A;  1H73 A;  2KVQ E;  3KJF B;  3JYT B;  4ED0 A;  1UWB A;  1U49 A;  2QX0 A;  3DKD A;  3SCK E;  1VQ4 S;  3CJK B;  1T9V A;  3K17 A;  4X4T A;  3G8S A;  4B3M F;  4WII A;  1RCO B;  3LP2 B;  5CZV A;  1FTC A;  4KFB B;  4KKO B;  3KUE A;  3MMC A;  4H54 A;  5I3P A;  3S1T A;  3U7J A;  4LF7 J;  3O2I A;  4M5H A;  1Q16 B;  1PC4 A;  3IO1 A;  1NDK A;  3FCW A;  1X4H A;  1UCN A;  3NLC A;  4O23 A;  1YIJ S;  1H38 A;  4IQX A;  3J7A 1;  2DNN A;  4AL5 A;  2IIH A;  5JJB A;  1EJ7 L;  1GMV A;  2BE2 A;  2XMM A;  2BA9 A;  4JP8 A;  5F0W A;  3FKB A;  1QAY A;  4QCL A;  5KFW A;  2GZO A;  2QRR A;  3FEZ A;  5IV3 A;  2VPX B;  2D3O R;  3CUL A;  2FQQ B;  2VZ9 A;  2J7W A;  2BAN B;  3CJ5 A;  5H9E J;  1N5Y B;  2KO1 A;  1IR2 A;  4NCB A;  3MXH P;  2J0X A;  1VJQ A;  4DX8 H;  1S9E A;  2M7S A;  1ICE B;  1MWQ A;  2YKN B;  3FQK A;  4NYO A;  4NLD A;  5GAE I;  1HHT P;  2GW8 A;  2RHS B;  5B0F A;  5C25 B;  4L74 A;  5D15 A;  4M5J A;  3CCS S;  3BO4 A;  4QIF A;  2XLI A;  4EBE A;  1S48 A;  4M5K A;  3QYY A;  2BE9 B;  4IFY A;  1N5Q A;  3NY0 A;  5E41 A;  1G7C B;  3FBF A;  2KDO A;  1NBE B;  4GKJ F;  1L3K A;  4KQZ A;  3N6L A;  5IFM A;  4IFV A;  2J6S A;  1FNO A;  3SSS A;  3SQG B;  2Y1J A;  3KLE B;  4I56 A;  3I96 A;  3CNQ P;  3LP2 A;  4J9U E;  4F0K A;  3R1L A;  1OY8 A;  1HAR A;  1Y4Z B;  2ZUA A;  4YY3 J;  4CM2 A;  2ZUG A;  1H98 A;  4NAS A;  4CNZ A;  1KC8 T;  1MN7 A;  1JLG A;  1C0U B;  1KQG B;  1FE4 A;  1WHY A;  5K5M A;  1N4L A;  3PTW A;  1SJR A;  2DNY A;  3GP9 A;  2VG6 B;  3MED A;  1IWG A;  1K9M T;  3ITH B;  1PIL A;  2MKC A;  1IR1 A;  1YJ9 S;  3BDP A;  3HMJ G;  1BUX A;  2R7T A;  1RBL A;  3SFG A;  1HYS A;  1VQ6 S;  4RNH A;  2ZNZ A;  1NME B;  2DR6 A;  1O0P A;  3W63 A;  3O3L A;  2W9C B;  1CUL A;  1S9G B;  2BVZ A;  1I51 B;  2EFO A;  6FDR A;  4LQ9 A;  4RW8 A;  4ELV A;  4CTA A;  4I6Y A;  3ISZ A;  2WSF C;  3DRP A;  4OI3 A;  1P6T A;  5CYQ A;  1C4A A;  3DM2 A;  1VI7 A;  3ZZ0 A;  3FSY A;  4TXS A;  8RUC A;  1SC4 B;  3V81 B;  4KGZ B;  1Q5V A;  1SJQ A;  2H5E A;  4WF9 Q;  3PYG A;  2JZ5 A;  2DGU A;  2GA7 A;  1P1L A;  3UCU P;  1EB0 A;  1AFI A;  4WZM A;  1IXK A;  1TP7 A;  2RDI A;  2HNZ A;  4OZ1 A;  4ES2 A;  2RDD A;  3GLJ A;  1NJW A;  3POT A;  3THT A;  5K8P A;  1SJ4 P;  4UY8 T;  4WP3 A;  3KLG A;  1F5A A;  3KWM A;  3P4U B;  2MKI A;  3UR3 C;  1Q8I A;  5D3G A;  1SIZ A;  3MUM P;  4O4G A;  4QIE A;  1HMV B;  1P1T A;  4B3R F;  3LPE A;  3LP0 A;  2ZFH A;  4DPT A;  2WAQ D;  3N28 A;  4OYW A;  2K7K A;  2EFQ A;  3ZTR A;  4C0B A;  5KOX A;  5IS2 A;  1PG5 B;  2ROP A;  3BQ0 A;  2B4P A;  5J2Q A;  4FBT A;  2KJW A;  3CC7 S;  4HT7 A;  4EZ9 A;  2R7V A;  1WSV A;  3NCR A;  4DR3 F;  1KQS R;  3CO9 A;  2F8E X;  1SB6 A;  3M8P B;  4DL3 A;  4DSK A;  2AEF A;  5H1S V;  1JLA A;  2EFV A;  3RW7 A;  4KV8 B;  2ERR A;  3ET6 A;  4JI3 F;  2C2R A;  3TZX A;  2VB6 A;  4LT6 A;  1B7F A;  1WEX A;  4FYW B;  2QA2 A;  3CE8 A;  3TAR A;  4OX6 A;  3KTQ A;  5DZ6 A;  3X3U A;  5KFL A;  5KOW A;  3DXB A;  1N56 A;  2QC3 A;  1K8A T;  4ITS A;  1G3O A;  2G0I A;  1M0S A;  2OMO A;  3G82 A;  1D0E A;  4MAK A;  1HW9 A;  2FJV A;  3QRQ A;  4KGK A;  2IM1 A;  5CHC B;  1JLC A;  1WDD A;  3I87 A;  4NMX A;  4CWB A;  5GAD I;  4K4V A;  2E7X A;  4LFB F;  3MUT P;  4WTO B;  2H4Y B;  4FS1 A;  2FVQ A;  3HHE A;  3PEH A;  5EX0 A;  4DV2 F;  1WF2 A;  3MR2 A;  2KU7 A;  1SV5 B;  3LAN A;  4WFN Q;  3BGL A;  2HK2 A;  3C19 A;  4K8R A;  2J6T A;  2HND B;  3DOL A;  3EVM A;  3LOU A;  4MTP A;  3BSN A;  3BGF A;  3O8W A;  3RB3 A;  4DUZ F;  4MFB B;  1NJX A;  2DT9 A;  2MY7 A;  2ZBI A;  3MCM A;  1IBM J;  4FYD A;  1G2E A;  1N52 B;  4ZVT B;  3M8Q B;  4OZ3 A;  2VOO A;  4XTT A;  1RE1 B;  2ZOM A;  5KG7 A;  4JI4 F;  4Y0F A;  2V2V A;  3W5Z A;  3HT0 A;  1RT1 B;  3K8V A;  2Z57 B;  3NOG A;  3IBC B;  2KH9 A;  2Z56 B;  2VG5 B;  3HZE A;  2QMW A;  1TKD A;  5LSO A;  1LV5 A;  7FDR A;  4DR5 F;  4O44 B;  2PN6 A;  3T1Y J;  4P73 A;  1DTT B;  5HRO A;  1CJU A;  4ED1 A;  4QYZ J;  1REG X;  1RWX B;  4PAB A;  2VJV A;  1FF2 A;  3N5F A;  1XR6 A;  4JV2 A;  1LWE A;  2CWK A;  1NDC A;  1RAC B;  4JI6 F;  1KON A;  2WCX A;  4Q0B B;  3VR1 A;  1VGY A;  3ZO7 A;  3C6T A;  3AOC A;  1Q81 T;  1HA1 A;  4C8M A;  2OPR B;  1JXL A;  4DFM A;  3V6K A;  4HTJ A;  1XBW A;  2YQ3 A;  1VQN S;  5ETL A;  5H9F J;  1HKA A;  2XG8 A;  5D0E A;  4ZCI A;  1RBA A;  1ZZN A;  1HHS A;  2CPJ A;  4ANC A;  2DGT A;  1T9T A;  3P8B B;  3I9V 9;  3S01 A;  4DWI A;  1TR0 A;  2XZW A;  4NML A;  2XO6 A;  1LW2 B;  2EKY A;  1N8R T;  3DDK A;  4DCP B;  3EYZ A;  2Q66 A;  3EWG A;  4DR6 F;  5CAA A;  1HIY A;  4ED2 A;  4IRD A;  3AD9 C;  1VJW A;  1VRU B;  1X60 A;  3A8E A;  4F26 A;  3K5L A;  2HLU A;  1RLD A;  4WE1 A;  3JSR A;  2AGO A;  3R5A A;  1YRT A;  3MUR P;  2WVF A;  2ZEJ A;  3QLH A;  4NLX A;  3TRG A;  1FKA F;  4NOH A;  4DXL A;  1LFW A;  1OWX A;  3CIM A;  2UU9 J;  3NWR A;  3CED A;  2JX2 A;  4FXW A;  4NXN J;  5LSR A;  1S6P B;  2CAD A;  3V4M A;  4KFB A;  2ZH6 A;  1NJI T;  2C2K B;  1CVJ A;  1S79 A;  3KNG A;  2E7V A;  4DZD A;  2H5I B;  2ZVI A;  5KFU A;  3OL8 A;  4HL9 A;  3IR5 B;  3I0R A;  4WIQ A;  2HGM A;  5KT2 A;  1SL0 A;  4F2R A;  5A8R A;  1C4C A;  2C1E B;  2OTJ S;  1IQT A;  3D9B A;  2GGP B;  4Q0B A;  3ETM A;  3MMA A;  4NLR A;  4BLG A;  3M05 A;  4Q43 A;  5DQI A;  1ZPV A;  3A4T A;  3KOA A;  3Q22 A;  5G4D A;  2QFI A;  5KT5 A;  2Z2Y B;  2XYG B;  3EM1 A;  4IH5 A;  4P74 A;  3CCT A;  2WON B;  1RHQ B;  2H9Z A;  5L39 A;  2FLL A;  1IUJ A;  4OV1 A;  3OTO J;  1S1X B;  1U1M A;  2AYG A;  3EXY A;  4CQ1 A;  1DUR A;  2CQ1 A;  2YH0 A;  3PHT A;  3AB4 B;  2MSS A;  2E5H A;  4CIO A;  5HJX A;  4NLP A;  2HZA A;  2PEH A;  3M8P A;  3SDE B;  2JVR A;  1RK8 A;  1SPB P;  2XMJ A;  1U1Q A;  4MT1 A;  1I5O B;  1UWA A;  4ZIW A;  3CJQ A;  3UN3 A;  4Y00 A;  2LXU A;  2ZE2 A;  4G1I A;  5CA5 A;  2D9O A;  1RWN B;  2AGP A;  5J1N A;  2O5D A;  4DQQ A;  2YNI B;  2YKN A;  2AD9 A;  5CXT A;  1PAU B;  4JI7 J;  1F9F A;  3VAK A;  1J2V A;  2CPY A;  4KO0 B;  3AQO A;  3SYZ A;  5SUH A;  4IH6 A;  1HNZ J;  1AUS L;  1HQU B;  3DOK B;  3IAS 9;  4ECR A;  5HK4 A;  4A46 A;  2V0N A;  5F8L A;  3EXC X;  3FNN A;  2OPP A;  1NPR A;  3EMT A;  5KG3 A;  4PG8 A;  2R7U A;  1R6Y A;  2BV3 A;  3S6E A;  2DXE A;  3G6V A;  4JBC A;  1D9D A;  1RXO B;  4S0M A;  1T9W A;  3G2X A;  4ZN1 A;  2DK2 A;  3AY0 A;  4ECZ A;  4I68 A;  3SCL E;  4QU6 A;  1CLF A;  3LW5 C;  2RB7 A;  3LH2 S;  4F4K A;  3FZB A;  4X4O A;  2JLG A;  5CH7 B;  2E1C A;  4Y6I A;  2MYF A;  4DPO A;  3OHA A;  1NB2 A;  1AT1 B;  1T03 B;  4RW8 B;  2AEJ A;  1FI4 A;  2NRE A;  4ZVR B;  5HL7 Q;  4K4Y A;  2XSJ A;  2IJN A;  3EUN A;  1WG5 A;  2FGO A;  4A8M P;  1XMO F;  4LF2 A;  3UWT A;  1RT5 B;  3GFX A;  2MHE A;  1F3F A;  4Q45 A;  2Q79 A;  2DPJ A;  5HSP A;  2N3O A;  2F9J A;  2RQK A;  3ULH A;  4EZ6 A;  4HYK A;  3TI0 A;  1TL3 B;  3DNC A;  4AD6 A;  4DG1 A;  2LEB A;  1AZS A;  2ATL A;  1L3S A;  3EGZ A;  2P5V A;  2ZNY A;  3MM7 B;  4QWE A;  1VBZ A;  5B7W A;  1E6V B;  2XM3 A;  4ED6 A;  2DJW A;  1M5V C;  3OFH A;  4RJV A;  4ILM A;  4EO6 A;  1Y7P A;  2J9D A;  4AL7 A;  4U8Y A;  2DH8 A;  4OLO A;  3IG1 B;  3GE9 A;  5EDW A;  1T9U A;  3TVK A;  3GQC A;  1MG7 A;  1DBD A;  2HNZ B;  3VAG A;  1FVS A;  1RA6 A;  5B09 A;  1WHV A;  3KMS A;  3AFG A;  4K5S A;  2OSR A;  3BR9 A;  4ES3 A;  1M90 T;  4J9V A;  3QJL A;  1HR0 J;  4Q7A A;  1WC6 A;  1HWU A;  3ZZU A;  1KS2 A;  4ATN A;  1U45 A;  1F9H A;  1HL6 A;  2VPZ B;  4OHW A;  1ZM9 A;  5AE2 A;  5L9N A;  3S8S A;  4B9M A;  3UN2 A;  3AOD A;  2BUN A;  4NA2 A;  2Y8Y A;  2VD3 A;  1KHW A;  2I5J B;  2MLZ A;  1CJU B;  2MB0 B;  2RAQ A;  3Q89 A;  3HT3 A;  1OY6 A;  3KLE A;  1TK8 A;  1SJ3 P;  2OI2 A;  2DNL A;  3ENQ A;  2OP5 A;  1GTE A;  2JSX A;  3BBB A;  1UPM B;  1S0O A;  5IC4 B;  3AOB A;  4DV4 J;  2GVD B;  4OYM A;  3OJS A;  3QSY B;  2HIQ A;  3PFE A;  3Q8R B;  4AYB D;  2VIH A;  1X9S A;  3H42 A;  2ZZM A;  1H3D A;  3CDU A;  5DLG A;  3C15 A;  2NLW A;  2QIF A;  3I82 A;  5AT1 B;  3OV7 A;  3DDI A;  5T7L A;  2ASJ A;  2XUL A;  2MEW A;  4USK A;  2N82 B;  3SMZ A;  1YIT S;  1RAE B;  2VBW A;  1KLN A;  4BC7 A;  4HT5 A;  1GNK A;  1HNI B;  2P2C B;  2RUG A;  3DOL B;  2LFV A;  2V4Q A;  2J0S D;  5E7O B;  3G9C A;  4USH A;  4WFX A;  2DR8 A;  1Q78 A;  3KLV A;  4F4X A;  3H25 A;  3ENA A;  1IJF B;  4CYU A;  3DU6 A;  3CJ3 A;  2NZC A;  1RTI A;  4DX5 A;  1RTI B;  1Q95 G;  2M8H A;  3GR1 A;  4RNO A;  2ZH7 A;  4FXV A;  4Q8F A;  1LXJ A;  2W2O P;  3AJ2 A;  2R2T A;  2XC9 A;  3M30 B;  3OXL A;  4TKT A;  3C66 A;  3MEK A;  3CCR S;  4YHH F;  4I6A A;  1BGX T;  5HN0 A;  5F9N A;  1DTQ A;  1ZAX A;  4Y65 A;  3BV8 A;  1VRT B;  5LXY A;  2GIR A;  3HSG A;  2XY5 A;  1FKO B;  2QN6 B;  3ZTO A;  4LFA J;  1VQO S;  2PMW A;  2V6A A;  4WXW A;  5D4N A;  3PVX A;  3TAQ A;  4MMO A;  2DHG A;  1RTH B;  2AF6 A;  2F40 A;  4DHV A;  2W2Q P;  3DMJ B;  1V3R A;  2V8D A;  4M5D B;  2DRD A;  4DR7 F;  4ID5 B;  1H2V Z;  3W5Y A;  1PSD A;  4RU9 A;  4X66 J;  2D3U A;  2YPZ A;  4BWJ A;  4J9O A;  3T6B A;  3I6P A;  2H3E B;  3BN4 A;  4JUZ A;  2C2Z B;  4DV2 J;  1SUQ A;  2ZH8 A;  2BRL A;  1ZTT A;  3ZFV A;  2VON A;  3V4I A;  4M5M A;  5JUM A;  1PYO B;  1SQE A;  4P52 A;  5IT4 A;  3DRP B;  1I94 J;  5A8K B;  5D0G A;  1U1O A;  3UI3 A;  3B8H A;  4I0W A;  1TL4 A;  2JL9 A;  1WUU A;  2A6M A;  3C6U A;  2J0Q D;  4CLZ A;  4QJV A;  2YKQ A;  3J7Y U;  1K73 T;  4YP3 A;  4O0I A;  1LK5 A;  5LXR A;  1LWC A;  4CI0 B;  2HLT A;  4HKQ A;  4DR5 J;  3MED B;  3M8Y A;  5IM0 A;  2IJF A;  2M0G B;  2MKS A;  1F9E B;  2OFG X;  2PA8 D;  2UZA A;  1VCT A;  4OI6 A;  4ZJO A;  4ZVF A;  3GG0 A;  5KG4 A;  3ZZZ A;  2HEK A;  2W7A A;  5F41 A;  2W1B A;  1IM4 A;  3MEG A;  3EDR B;  5CAB A;  1XJW B;  3CSK A;  5DDQ C;  3BSC A;  3OT9 A;  4DV3 F;  5KFH A;  3CME S;  3MMB B;  1HWK A;  4U95 A;  3FCV A;  1BY9 A;  1RT5 A;  3TUJ C;  2CDR B;  3UD3 P;  1R8A A;  1QAI A;  2N4C A;  3BF4 A;  1RHK B;  5K9F A;  2HQI A;  4C0H A;  4B9V A;  4OX9 J;  2DR5 A;  4CLT A;  4QR2 A;  1HNV B;  3SXL A;  4GVB B;  4DR4 F;  2LA6 A;  3MR7 A;  2CQ4 A;  1GAO A;  3VAL A;  4DN9 A;  2DHS A;  2HWH A;  3MM7 A;  2RS8 A;  5HMX A;  4MIW A;  1PAE X;  1X0P A;  1AZS B;  3ETO A;  4XIU A;  1A9N B;  3MD3 A;  2W25 A;  4I2P A;  1JJ4 A;  2KXN B;  2V34 A;  3MD1 A;  3BZQ A;  2ZJP Q;  3NWG A;  1XK8 A;  3VV2 B;  4XPE A;  1U2C A;  4NEY A;  4O3Q A;  3PW5 A;  1RAF B;  4MKV A;  2GS8 A;  2K06 A;  2XHC A;  2CJX B;  3C6U B;  3W60 A;  5B0D A;  1NKB A;  2IA6 A;  4FF4 A;  3R2D J;  2R7X A;  4DSE A;  4YR0 A;  2LCW A;  4IYQ A;  3JTN A;  3T9N A;  2O1P A;  3J81 j;  1YJN S;  1M5S A;  1NCL A;  1N5S A;  3DC2 A;  3ILI A;  2RD5 C;  4DZ6 A;  4N76 A;  3CC2 S;  3NGR A;  4MK8 A;  2AX1 A;  2EFG A;  2AJ2 A;  4OZN A;  3G96 A;  5KTQ A;  2VOD A;  2VL1 A;  1LNQ A;  4M5N A;  5IXU A;  4OYB A;  1QAX A;  2KZZ A;  2C2E A;  1JJH A;  2LMI A;  3CPW R;  3TX0 A;  1SKW A;  3PKM A;  2X3D A;  4E8U A;  3QIP B;  1DFD A;  3OL9 A;  3P96 A;  4ZP8 A;  3GJQ B;  3W8G A;  2R7Q A;  4R8U B;  3KDN A;  1CQM A;  5D4P A;  2ABY A;  2Z2Z A;  3EGN A;  2GGP A;  3T5L A;  2KG1 A;  3HI9 A;  2EVZ A;  5B0E A;  3QGI A;  2CIM A;  4ECQ A;  2B51 A;  3PZP A;  3PM9 A;  2R2R A;  1KKH A;  3P6Y C;  3MF5 A;  2PEB A;  5HMW A;  1NHU A;  2CQ2 A;  1UEU A;  3BSO A;  3NP5 A;  4RW4 A;  2CQH A;  2YNH A;  3TA0 A;  4CLL A;  3DLG A;  2HYI B;  2NXE A;  3B6B A;  3GIR A;  1EAR A;  4EYH B;  1S1V B;  4PUO B;  1F3V A;  2B6A B;  2G0J A;  3FSX A;  1T02 A;  4H4K A;  4JI7 F;  2WVC A;  2J9D E;  2E5L F;  2WW8 A;  2M3D A;  1S1W A;  3FZ2 A;  3N6M A;  3Q8Y A;  3W9H A;  1UET A;  2CNN B;  4ZIV A;  2D1C A;  2ZHB A;  2AJ0 A;  2GIQ A;  2N7Y A;  2XI3 A;  4W92 B;  1I6J A;  4PWU A;  5JXS A;  3TUZ C;  1NSP A;  1WOO A;  2FJA B;  1MW7 A;  2HHQ A;  2CQI A;  4OX8 A;  5KG5 A;  1H6K X;  4ZP7 A;  5J2N A;  2KYZ A;  3U27 A;  3CJK A;  1VQM S;  2DRA A;  1YBT A;  2IC3 B;  1VHI A;  3VZI A;  1TUW A;  5KFM A;  1IJE B;  1FES A;  5LMN J;  2BJ7 A;  1D8Y A;  2J8A A;  3FBE A;  2YKM A;  1FDB A;  3AT1 B;  4OV6 A;  4L3N A;  4A4J A;  1J5E F;  2HVE A;  5K8O A;  1SC3 B;  2D74 B;  1UFK A;  4L76 A;  5GAH I;  1X4B A;  2BDP A;  1WKL A;  1FJ7 A;  2GVD A;  1IBC B;  3PRV A;  4B9L A;  3UQS A;  1NSA A;  4DX6 A;  1LQ9 A;  3M2R A;  4WK3 A;  3MFI A;  3RAX A;  4MJK A;  3EIC A;  5AJ3 J;  4GO5 X;  3DI6 A;  4MKB A;  1C1B B;  2XWY A;  4C8Z A;  1VRU A;  1I1G A;  5LT5 A;  4R5P A;  1A6L A;  1RHJ B;  2GHV C;  3I32 A;  1ZPW X;  1D3W A;  5AXM A;  4QIG A;  4G1Q B;  5C2G A;  1DY3 A;  2W2M P;  1WAC A;  4Z2X A;  2DH7 A;  4DUY J;  3Q8V A;  4WWS A;  2R8J A;  3DRY A;  2UXD J;  4Q5V A;  1BWE A;  1EKS A;  2YWW A;  4AQY J;  1GH8 A;  1VQ8 S;  2BKO A;  2FZC B;  4KO0 A;  4CRJ A;  3C3L A;  1TTH B;  5K14 A;  3C2P A;  3HHL B;  4Q8E A;  1ITP A;  3CD5 A;  2YNI A;  3PYF A;  3NNA A;  3TR5 A;  3UDE A;  2YVS A;  3TVZ A;  4C97 A;  4XO0 A;  3PIP Q;  2XGP A;  3KLG B;  3VAI A;  2UUW A;  2DR9 A;  5GMD A;  5IV4 A;  2LEC A;  1NB7 A;  3O1L A;  3QGP A;  4X4V A;  2GMJ A;  2UXB F;  1NKC A;  1TL1 B;  2GJF A;  1PJ6 A;  3D4J A;  1DLO B;  1EQM A;  4JI3 J;  1W26 A;  2BW7 A;  3FGV A;  4I2Q A;  3R9L A;  2Z0G A;  3DN9 A;  1S7H A;  4IOB A;  4FBU A;  2FHJ D;  4M5D A;  5IQQ A;  4WBF A;  1S1X A;  2KT3 A;  2DO0 A;  2EFP A;  1U8S A;  2OEK A;  1JLE A;  1RT4 B;  2DNG A;  2XMU A;  3UFC X;  2VUG A;  4JI1 J;  3NMA A;  2KHC A;  3G71 S;  3JQM A;  2V8V A;  3M2U A;  1V3Z A;  4PWW A;  1TEL A;  3KLH A;  5IOL A;  4PEO A;  2RRA A;  4O3S A;  2XMA A;  2VBZ A;  2LQJ A;  1M1H A;  2WVD A;  5IT9 U;  2AV5 A;  1Q53 A;  2DNH A;  2HG4 A;  3R5G A;  1FO1 A;  2QJ3 A;  2FTR A;  3MPU B;  3DRX A;  4YB5 A;  1GXL A;  5FDL A;  4DQS A;  2GQC A;  4N47 A;  1DAR A;  3O44 A;  5HVF A;  1Y5I B;  4A8K A;  2LYV A;  4JI8 F;  3DXS X;  1RIS A;  2FUG 9;  4EMD A;  2AJQ A;  4ENO A;  2IY5 B;  3EJM A;  2J9E A;  2XYH B;  3TUI C;  3VQS A;  5KFK A;  1SBR A;  1KFS A;  4M63 A;  2ZBQ A;  2V4J B;  1F5C A;  1CSJ A;  2HFN A;  3B54 A;  4UST A;  3SQO P;  3AA8 A;  6AT1 B;  1ZOT A;  5GAG I;  4WCE Q;  5D3G B;  3T3F A;  4GC7 A;  1WTB A;  4DQI A;  2ZZN A;  2GJ2 A;  2YWE A;  1FE0 A;  3MPV A;  3SV4 A;  2W01 A;  2BJD A;  3CCQ S;  5L1I A;  4FKX A;  4G1P A;  4B3T F;  2AW0 A;  4X64 J;  4IO1 A;  4WFB Q;  4OYI A;  2MKK A;  4F0H A;  4YB1 P;  3CVK A;  4FVC A;  3K5M A;  4DN0 A;  4TY8 B;  2LQ5 A;  5J2Q B;  5HVH A;  2EC0 A;  1WF1 A;  2J5A A;  4RR5 A;  4A48 A;  3AJ1 A;  4ED4 A;  3Q0A A;  1PJ7 A;  1YRU A;  3JXO A;  4JI5 J;  3R7N B;  1S4E A;  1RAJ A;  2DY9 A;  2RF2 B;  2GC8 A;  3ITH A;  4EFA C;  4FNI A;  2HS0 A;  2AJ4 A;  1S5Z A;  1IBK F;  3BGR B;  3Q83 A;  3PR4 A;  4LFA F;  2O01 C;  1XEZ A;  4X4R A;  1W2I A;  3R6G B;  4FS2 A;  4A8Q A;  2YKP A;  1VHF A;  4RX6 A;  3T5K A;  1RTD B;  3D1Q A;  4LF5 F;  1EZZ B;  4AXJ A;  4LFC J;  4HTI A;  2W8K A;  1R31 A;  2ZIT A;  4A47 A;  4OI1 A;  4FKY A;  1YZ7 A;  4ILR A;  3QPI A;  4NLO A;  4P10 A;  5DZ7 A;  3V81 A;  5KFF A;  1RWO B;  1DHM A;  1RHR B;  3MM9 B;  3TAM B;  3PV8 A;  5C7P A;  4KB7 A;  1JLQ B;  3EGV A;  1WJ9 A;  5HO4 A;  2EXU A;  4R0E A;  2DHA A;  2BKN A;  1SXL A;  1WF0 A;  2QG9 B;  1VQ7 S;  5EN1 A;  4ID8 A;  3QID A;  4DR1 J;  1TUG B;  2NR0 A;  2OPQ B;  2XEX A;  1C1C A;  4KBI A;  2LEP A;  3L09 A;  1NZA A;  3D6M B;  1J27 A;  2ZKT A;  3G4S S;  1O8B A;  2MZT A;  3R5C A;  2XMT A;  1R8B A;  5EUH A;  4ZVU B;  5DLF A;  3CTR A;  3GWC A;  2ROG A;  3ISN D;  4LF6 F;  2MJN A;  1V6H A;  3ZZT A;  1OIA A;  4EBD A;  2AGQ A;  2DR7 A;  2UVR A;  4FF3 A;  3H8Y A;  4TY8 A;  1JNZ B;  4BBY A;  1JNR B;  3OTO F;  3OFG A;  4P2X A;  3UNG C;  2VQF F;  3BPS P;  4LQ3 A;  1KR4 A;  3QGH A;  2GIF A;  1U6Z A;  2VH7 A;  1HNV A;  4PXD A;  3CT9 A;  3QGG A;  4F50 A;  2VDH A;  2JEJ A;  2VKZ G;  1UWB B;  1WI6 A;  4CT8 A;  2G0C A;  3R8Y A;  4KC5 A;  3QZ8 A;  2K3K A;  3EGW B;  1QTM A;  4KKO A;  3R3T A;  2CJA A;  2HVI A;  3DLG B;  2APO A;  2CWX A;  1WI8 A;  3NKY A;  3US5 A;  2F7V A;  4ID5 A;  1ACM B;  4DDF A;  3CCL S;  2RH3 A;  3DRS B;  3PHE A;  3TEH B;  3F44 A;  3IRX B;  3N6N A;  2JC1 A;  3ENW A;  1WOR A;  3PJX A;  3G8T A;  1D9A A;  4WFY A;  4DSF A;  2V2Z A;  3HFZ B;  5KG1 A;  2MQ8 A;  3H59 A;  2AMC B;  4G1Q A;  4C9D A;  2KT2 A;  1QUP A;  4USU A;  3W1Y C;  1EX8 A;  2LA4 A;  2R8I A;  3W61 A;  2XHW A;  2A10 A;  1OYD A;  2J8S A;  2RE1 A;  3MPD A;  3N4W A;  4P2M A;  3TWZ A;  1FRH A;  4F3Q A;  4I1T A;  1Y9O A;  2EEY A;  2V9W A;  1FEE A;  2FIU A;  2QGF B;  3DRR B;  5LJ5 Y;  2DHX A;  4RBU A;  3V4I B;  3AD7 C;  1IBM F;  1HBN B;  3NCP A;  1URR A;  2OUG A;  5KT7 A;  3RR7 A;  2FVR A;  3HHL D;  1QAJ A;  4FP9 A;  4WFZ A;  4JI4 J;  2QL5 B;  1S10 A;  3NRB A;  1VBY A;  3GIK A;  2W2P P;  5U47 A;  4OI4 A;  3RU0 A;  4DV5 J;  1FX4 A;  1CJT A;  3D0I E;  1FK9 B;  2MZR A;  2A1B A;  3D54 A;  4UW2 A;  3CDB A;  3Q23 A;  2VFV A;  3BKF A;  1X4F A;  2BEF A;  3DI6 B;  4NWB A;  1X0F A;  3K57 A;  4WYL A;  2ZH4 A;  1N6Q A;  3FSI A;  2HK3 A;  4TYB A;  4NXM J;  1MMN A;  2KRB A;  1C2P A;  2V8P A;  2OJ3 A;  1CEZ A;  2MMY A;  2R3V A;  3GON A;  5A8W B;  3E01 B;  1CJV B;  1VQY A;  4OI0 A;  4H4O B;  1KLM B;  4MIB A;  5KFQ A;  5ETV A;  4QPX A;  2B9W A;  1C1B A;  3NMR A;  1OYE A;  4Y2K A;  1RT2 B;  1UJ5 A;  1Y0H A;  3QSI A;  4UTG A;  2BJ3 A;  4B17 A;  4MK7 A;  3HVR A;  3DLJ A;  3VF0 B;  2COL A;  4EO8 A;  1VR6 A;  5J2M A;  2HKE A;  3V5R A;  5CCL A;  2G1D A;  4HAC A;  2HQF A;  1YJV A;  2DGO A;  2RRB A;  2GX8 A;  4YB7 A;  1JXE A;  1NO8 A;  1WTF A;  2CVI A;  2IRY A;  3Q2S C;  3PX6 A;  1T05 A;  1VIS A;  2QLJ B;  3PW4 A;  2OEM A;  4ETX A;  1U6B A;  3IRW P;  1JKH B;  2QLW A;  2CQ3 A;  5KG0 A;  3N9U C;  3ZTP A;  5KFJ A;  4DLE A;  4ER8 A;  1HI8 A;  2MPU A;  1QVF R;  3NGU A;  3CMA S;  1Q5Y A;  2KJV A;  1HWI A;  3CGI A;  1IBL J;  4ZPC A;  4WKR A;  3OSP A;  2E1P A;  2H1Y A;  2XBP A;  2MXY A;  3TVY A;  1NJY A;  2DD8 S;  2B0G A;  4MKA A;  3PCO B;  2BQR A;  1QVG R;  1UVJ A;  4P2S A;  1V5I B;  2EG2 A;  2ZBC A;  5L8R C;  2QYG A;  1RTJ B;  3AOA A;  3GSI A;  3QNW B;  1TK5 A;  3D5M A;  4IOC Q;  3H0P A;  5KFV A;  4ZPW R;  5A76 A;  3Q8P B;  2CPE A;  3OJU A;  1S97 A;  5F0U A;  3JSM B;  1UW4 A;  1DRZ A;  1N0V C;  1NH8 A;  4AND A;  1ZTW A;  1RAO A;  1Z2L A;  2BE7 D;  2V2Q A;  2PO4 A;  3LAK A;  1SCJ B;  1Z4U A;  3M8S A;  2W2N P;  3LF0 A;  2ZC3 A;  2FLP A;  4H4M B;  1BQM B;  4K4X A;  2V67 A;  3GB0 A;  4HLB A;  4OYO A;  2DNM A;  3D6T B;  4Z37 A;  2MHN A;  2V94 A;  2MQL A;  3HFK A;  4QW8 A;  1JQG A;  2R7R A;  1BLU A;  4ELT A;  3GTY X;  1Z1Z A;  4OHX A;  1N34 J;  1HPZ A;  1HBM B;  1VBK A;  4WPA A;  5GAD U;  2UXD F;  2AZ3 A;  5J1E A;  3HM9 A;  4AQY F;  4RL1 A;  1X4E A;  4NLT A;  2KYX A;  2J7U A;  3GCW P;  1SL1 A;  3PY8 A;  3UDV A;  4QIW D;  2E9T A;  3NL0 A;  3IP0 A;  2KT5 A;  4P72 A;  1XQI A;  3MR5 A;  2DB1 A;  1KVJ A;  1MLA A;  3MPY A;  3OPK A;  1HNW J;  4NYP A;  2RVJ A;  4M8L A;  5DO2 A;  4WKY A;  4QIV A;  5BJR A;  2RQ4 A;  6FD1 A;  4XPC A;  3TAN A;  5HP1 A;  2IVM A;  2QLB B;  3GCX P;  2YNF A;  4EUV A;  3KYL A;  1U1K A;  1OO0 B;  2DCL A;  2QSF A;  2Y1I A;  4NRT A;  1LK7 A;  2AYM A;  4KH0 B;  4LRB A;  1T95 A;  3I0S B;  3DLK B;  1KQF B;  1VS3 A;  3MOJ B;  5KFO A;  3CWJ A;  2OLW A;  5DG8 A;  5M2P A;  1VDH A;  3T1A A;  5GAH U;  4CLY A;  4F3M A;  2W7O A;  2EG1 A;  3M6U A;  5EWG A;  4TVA B;  2B5J A;  4X2B A;  3I9Z A;  4ED7 A;  1U48 A;  4C3K A;  1XMO J;  3A1Y G;  2ZH5 A;  2NZ4 A;  2GAG C;  2FVC A;  2CG4 A;  2E1R A;  2NSB A;  2VU5 A;  5J2P A;  3B78 A;  4OFZ A;  3MM9 A;  4QW9 A;  2QL7 B;  1U1R A;  2RKI B;  5F8M A;  4P7T A;  2XS2 A;  2DHH A;  3QO9 B;  3PJW A;  4F8R A;  5KT4 A;  3OUY A;  5K8N A;  3HD1 A;  3VGU A;  4JV1 A;  3J7A N;  3DGV A;  4HR2 A;  2BW2 A;  3VCD A;  1CUL B;  2AYE A;  2HUR A;  4ZVH A;  2UUA J;  2XS5 A;  1C1C B;  3JYT A;  1OPI A;  2VFT A;  1CS4 A;  4ZHR B;  1NKE A;  2F5G A;  4TQS A;  1RSC A;  3IS9 B;  5J1P A;  3RTV A;  2EFN A;  1Y10 A;  5KAK A;  2CVE A;  4QYR A;  3SSR A;  3WBZ A;  1H7W A;  1F6T A;  3PKY A;  5DQG A;  3MEC B;  3W8P A;  2GO9 A;  1T05 B;  1MWY A;  3KHR A;  2WB4 A;  2EBG A;  4LVO P;  4B08 A;  1S99 A;  3I5C A;  4K5R A;  1DTQ B;  2XYP B;  2ZOF A;  5A6P A;  3MGJ A;  1ELO A;  3TNV A;  3G6E S;  3W64 A;  3OLA A;  1LOU A;  1RKI A;  4DV6 J;  2Q1L A;  2WK4 A;  4A8Y A;  2MKH A;  1W25 A;  2I38 A;  1IBK J;  4UOH A;  4FF1 A;  1YJR A;  1QY7 A;  4DMZ A;  4PWD A;  4YS2 A;  2B6A A;  4M5G A;  2FLN A;  4WK1 A;  3M8Q A;  1QSL A;  1ZYQ A;  1Q1K A;  2FHK A;  2HFZ A;  2V50 A;  5C2C A;  1N5V A;  1UVK A;  4KHM A;  2M8D B;  3M9N B;  2BM0 A;  4YN3 B;  4NZ6 A;  2YKA A;  1T7P A;  2WW4 A;  2R8K A;  3VZH A;  1YJT A;  5ETP A;  1FRM A;  2GML A;  5AXL A;  3KHH A;  4DR1 F;  4DL2 A;  2A2C A;  3POT B;  3IWL A;  4TY9 A;  3H40 A;  1SL2 A;  1S49 A;  2W4C A;  3DLE B;  3TYT A;  3KK1 A;  2ALZ A;  1UEK A;  3BBC A;  3LUY A;  4Z7Y A;  2YTC A;  1S1U B;  5KG2 A;  1U0H A;  1N6Q B;  4CLK A;  3IGN A;  3IA0 A;  2KFY A;  2A2D A;  3I5A A;  1BQN B;  1F2H A;  1PYT A;  1QD1 A;  4ZOS A;  3ISN C;  3T41 A;  5IM0 B;  4QPT A;  1RT3 B;  1E6Y B;  5EGY A;  3M8W A;  3MM6 A;  4EK2 A;  1YSJ A;  1XNQ F;  5C24 A;  4URG A;  3P49 B;  2IAJ B;  2FJW A;  3K89 A;  2ASD A;  3HF5 A;  1AUD A;  1R8P A;  2DO4 A;  2P9G A;  3IRX A;  4OZJ A;  2UUC F;  2F65 A;  2VPY B;  5FD1 A;  3TP2 A;  5I3Q A;  1X9W A;  4U8V A;  1M5O C;  5ADZ A;  2YWF A;  2KFZ A;  8AT1 B;  3JS9 A;  3ILJ A;  3V6J A;  1S9F A;  2UUB J;  3CDA A;  7AT1 B;  2L9W A;  1N5T A;  1BQX A;  2J7K A;  2EKN A;  4NLW A;  4LSL A;  4WYW A;  2POK A;  2G4B A;  4DR6 J;  4KV8 A;  5ETM A;  2R4F A;  3OL6 A;  1RAA B;  3FVY A;  3RW6 A;  4LSZ B;  4USJ C;  2EWH A;  1HQE B;  1TVR B;  2HFU A;  4DL5 A;  4DR7 J;  2CAJ A;  3SQG A;  3FMB A;  1P27 B;  1XTZ A;  1D8Z A;  1R0A A;  4JYA F;  1SKU B;  2ACY A;  4USI A;  2K1R B;  4ZS6 A;  4L6V 3;  4ECS A;  4RZR A;  1DJ0 A;  1H74 A;  1SIW B;  3KK3 A;  4IR9 A;  1QM9 A;  1V3S A;  2IM3 A;  5IT0 A;  1IVZ A;  4LF4 F;  3UDC A;  4ZLJ A;  2J0W A;  2HHU A;  4NCG B;  4OX7 A;  5CQG A;  5KFP A;  1NK9 A;  1DQ9 A;  1RI7 A;  2MY8 A;  1Y3J A;  3TJ9 A;  3ZZO A;  5LMN F;  1N33 F;  3VAF A;  1APS A;  2DCU B;  2HMI B;  5D0H A;  2UV8 A;  5HRO B;  2KRR A;  4C11 A;  3MAA B;  3TZW A;  3A13 A;  3GFY A;  3MAH A;  4ZVE A;  1VIO A;  1NSQ A;  1S6P A;  2A0F B;  3SBM A;  2MKJ A;  1YGY A;  4CO3 A;  1KTQ A;  1V5V A;  3CJ4 A;  3LPY A;  4ZPT R;  4WU2 A;  1RT7 B;  2F1F A;  3U1N A;  3ENV A;  1SH0 A;  3G6X A;  3BSA A;  1RB0 A;  1FFS B;  4ZIT A;  2IBO A;  1K0V A;  1HI0 P;  2Y8W A;  4OL8 A;  4NYZ A;  1OY9 A;  5KT6 A;  4ED5 A;  1K0T A;  2DVI A;  2Z58 B;  1S72 S;  3BGU A;  2HND A;  3L4B C;  5ETK A;  4C98 A;  5IZH A;  3DOK A;  1OQ6 A;  3K5N A;  1RAD B;  1UP1 A;  1OMS A;  1VMB A;  1RLC L;  2C22 A;  3J80 Y;  1ZA1 B;  2MLX A;  2XSF A;  4RLE A;  4OX9 F;  3BQ1 A;  5DG7 A;  2J6U A;  2B4V A;  1B64 A;  4GVL A;  2XMK A;  2XCP A;  1ZAV A;  1X5S A;  1M1K T;  3LP1 A;  3HJV A;  1TKT B;  3TQE A;  2LU2 A;  1SKR A;  3CJS A;  1SC6 A;  2DGQ A;  1VIX A;  2M88 A;  2CPX A;  3BB5 A;  3W2W B;  1VQ9 S;  4BHQ A;  4IDK A;  3SSQ A;  5E3P A;  5KFB A;  2DGX A;  2CQB A;  4N8N A;  4OYP A;  3TJA A;  2XTJ P;  2E5I A;  4LBI A;  5KFX A;  3WC2 A;  3OTE A;  4OHY A;  4RKU C;  1T94 A;  1TV6 B;  1QJH A;  1SQG A;  5FII A;  3QAE A;  3DYA B;  2GO8 A;  4N7T A;  2VFS A;  1YWX A;  1U26 A;  2BQ3 A;  5GME A;  4CO0 A;  4RNN A;  2QA4 G;  1QSY A;  3PFO A;  1I3O B;  2CDQ A;  2MQQ A;  3MCO A;  1TKX B;  4M5L A;  4LIW A;  2LQ8 A;  4CO1 A;  1UL3 A;  4ECY A;  1RHU B;  2XY6 A;  3QT6 A;  1L3V A;  4DL0 C;  1RTZ A;  1WKJ A;  1U2F A;  4ZVS B;  4TN2 A;  3HP6 A;  3F41 A;  1GMW D;  1H7X A;  2KKH A;  3GR0 A;  1UEV A;  3LGH A;  3OXF A;  4IRC A;  2H48 B;  2LVW A;  2ZKU A;  2B56 A;  4RBT A;  5THW A;  1D9F A;  4IUF A;  3NEK A;  3OQ2 A;  2DIU A;  2FD2 A;  1IKV B;  3KXD A;  3L7P A;  1T03 A;  1FNM A;  3SCJ E;  5IQ6 A;  4K2J A;  3GG1 A;  2QO3 A;  5M2R A;  3I55 S;  5E0O A;  2AEM A;  4DS4 A;  3PRD A;  3D1O A;  3NNC A;  3P5T L;  2D3O 1;  4RWW A;  1IKW A;  5IC6 B;  1L3U A;  4NLG A;  2E9Z A;  2NXJ A;  3UR0 A;  1D09 B;  1R0B G;  1RWM B;  4F2S A;  4LSL B;  5C42 B;  3KG0 A;  1T9X A;  3ELH A;  1LFP A;  2ZM6 F;  1CC7 A;  1HWL A;  1UZH A;  3MCN A;  3CCU S;  3OW2 R;  2ADC A;  1KRP A;  4IFY B;  1NPP A;  2GQ2 A;  2HAI A;  2LEA A;  1XR5 A;  2HBR B;  1RU2 A;  3EDQ B;  4HVZ A;  3EX7 B;  1EIY B;  1CBK A;  1S76 D;  1UKU A;  1JIH A;  1U09 A;  2RIJ A;  1IKY A;  3M6X A;  4PYD A;  5KG6 A;  4TU9 A;  1HR0 F;  4ZCL A;  4C8L A;  5GAE U;  4ZVO B;  3TW0 A;  3D0G E;  2YH1 A;  2DXF A;  5JVH Q;  3RG6 A;  3N0V A;  3LP0 B;  4V19 X;  4LRE A;  2WRM A;  3MDF A;  1BQN A;  4O3N A;  3Q8Q B;  2V69 A;  3UW1 A;  1Y3K A;  3L95 X;  4LF5 J;  4NLV A;  2HHW A;  3BQ2 A;  1DQ8 A;  2RHQ B;  2B9Y A;  1FKO A;  1LW2 A;  1JLE B;  1RT4 A;  2V63 A;  3L7U A;  2BE2 B;  5HBM A;  5LL6 d;  4P9S A;  2VF3 A;  3PX0 A;  1TFY A;  3PW7 A;  3RBD A;  3Q24 A;  3H20 A;  5GAG U;  3R5B A;  3HLU A;  4KGX B;  3CCE S;  1FJG F;  2ZH1 A;  1WNE A;  4XAK A;  1M1G A;  3B82 A;  2YWG A;  5KFD A;  4J5O A;  3HSZ A;  3LO3 A;  2EC2 A;  4E98 A;  3BKT A;  1BD6 A;  3HDS A;  2DGS A;  2R2S A;  1FWK A;  1FD8 A;  2D41 A;  5IWA F;  3TOQ A;  2BAB A;  3OFE A;  4KR0 B;  1QE1 A;  2CZV C;  1SI9 A;  3DFE A;  4K4Z A;  3IR7 B;  3AB2 B;  3HHL A;  3T19 A;  5B0C A;  5HJY A;  2AKW B;  2FJD B;  3KJV A;  3EZ5 A;  4K4W A;  3A12 A;  1R0A B;  2UUA F;  2MTL A;  2U1A A;  4PPD A;  2RU9 A;  3CB4 A; 
#chains in the Genus database with same CATH homology
 5ETT A;  5ETS A;  1DY3 A;  2QX0 A;  3HCX A;  1KBR A;  5ETK A;  4M5J A;  2BMB A;  3HSD A;  5ETV A;  3QBC A;  4CRJ A;  2F65 A;  3MCN A;  3KUE A;  4M5K A;  3KUG A;  4M5H A;  4M5M A;  5ETN A;  1TMM A;  5ETL A;  3HSJ A;  3ILJ A;  1HKA A;  1RU2 A;  3MCO A;  3MCM A;  4M5L A;  4M5I A;  1CBK A;  3HSZ A;  2F63 A;  5ETP A;  3ILI A;  3UDE A;  3UDV A;  1HQ2 A;  1Q0N A;  4M5G A;  4CYU B;  3IP0 A;  1EQ0 A;  1RTZ A;  3ILO A;  3HSG A;  1G4C A;  5ETM A;  3HT0 A;  1RAO A;  4M5N A;  3UD5 A;  3HD1 A;  1F9H A;  1EQM A;  3HD2 A;  4PZV A;  4AD6 A;  5ETO A;  4F7V A;  3ILL A;  3KUH A;  4CWB A;  1IM6 A;  5ETR A;  5ETQ A;  2CG8 A;  4CYU A;  1RB0 A;  1TMJ A;  1EX8 A;  1RU1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...