1S9GB

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r120394.
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
425
structure length
425
Chain Sequence
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL polyprotein [Contains: Reverse transcriptase]
publication title Roles of Conformational and Positional Adaptability in Structure-Based Design of TMC125-R165335 (Etravirine) and Related Non-nucleoside Reverse Transcriptase Inhibitors That Are Highly Potent and Effective against Wild-Type and Drug-Resistant HIV-1 Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 105
structure length 425
sequence length 425
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s9gB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s9gB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s9gB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s9gB03
4KV8B 1JLAA 3LANA 4FS1A 1BQNA 4F4YA 4PQUB 4J9KA 1IKXB 3MEEB 2ILYA 1TKTB 2V4QA 1S0OA 3CVKA 4NLWA 2BANA 3QO9A 5KFCA 5KFJA 2XCPA 3OHBA 4I2PA 2VG6B 3KK2A 1LWFA 3IRXB 4ZVGA 2AGQA 4R8UA 3EPGA 4IRKA 1JLCB 1TKZB 4MK8A 3LP2B 3KJVB 1HNIA 4WZMA 4MKBA 3LP0B 4LSNB 4JV1A 3IG1A 3KK3B 1J5OB 3MFHA 3GILA 2IM2A 1JLFA 1DTQB 3DLEA 2W8LA 2E9RX 3MR5A 1T03A 3I0SB 2ILZA 4Y2CA 5KFDA 3RB3A 3MECA 5C42B 3DLGA 1QAIA 5KFVA 1JLEB 4O44B 4IG3B 4K4WA 3UR0A 3V6JA 1IKWA 4WE1A 2IBKA 2W7PA 4K4YA 4RNOA 4EO6A 2OPRA 3DRRB 5F8JA 1RT6A 2IAJB 4ED2A 3RB4A 2JEIA 2YNHB 1LWCA 5HLFA 1KHWA 1W25A 3CIZA 3RB0A 4O3NA 4RW8B 4R5PB 1RA7A 3NAIA 3GIJA 1QAJA 3OHAA 4Y34A 3NL0A 3BSOA 4ED1A 3CJ2A 2YKNB 1RTIA 4KO0B 4WYLA 1S97A 1TL1B 5KT7A 5FDLA 5DLGA 1C1BB 5J2PA 4TQSA 4ED8A 4ED0A 4MK7A 2ALZA 1SUQA 2WB4A 5KFNA 3LP1A 4DL5A 3KLGA 4RW4A 3NGDA 3TAMB 4DG1B 1JLBA 1K1SA 4JV0A 3FFIA 1S49A 4TYBA 1MU2B 1N6QA 1S1TB 4IH5A 4J9OA 3QLHB 5KFTA 5EUHA 4MIAA 3G6VA 1JIHA 4IOBA 2B5JB 2JEJA 3C6TA 2OPPB 1S6PB 2FJXA 4KFBB 3PJXA 4O4RA 2I1RA 2ASDA 1VRUA 1RYRA 1JKHB 3NAHA 4K4VA 1RT4A 2XI2A 5KFZA 4EBCA 2I5JA 3N6NA 3DDKA 2YNGA 4RW6A 1N5YB 3KMSA 4Q8FA 4IFVB 3H5XA 3MR6A 4O3SA 5C25B 1TKXA 2IM1A 4NLRA 2JC1A 1BQMA 3QIPB 5DGAA 3RAQA 3DI6B 3M9NB 2HMIA 1LW0B 4RW9A 1S9EA 5KT6A 3ITHB 3I5AA 4URQU 5J2QB 2VG5B 4PWDB 1S1XA 3HVWA 4LQ9A 5F8GA 2W9CA 3CJ5A 1D0EA 1FK9B 1VRTA 1RTDA 1EETB 4M94A 4G3IA 1R0AA 3M9MB 1FKPA 3I5CA 2OPQA 1IKYA 4H4MB 3V81A 4IFYA 1C0TB 4KKOB 1RT1A 4WFYA 3OL8A 2C22A 4I2QB 3UDLA 1S1WB 2C2EA 3NKYA 2ZE2B 3KNAA 4ZP6A 2HNYA 4NRTA 2RF2A 3PJWA 5F8NA 3H5UA 1Z4UA 4LSLB 3QIDA 3CDWA 2IM3A 2FJWA 2IC3A 5K14A 1NHVA 4QWBA 1HPZA 5CYQA 5F8MA 1RT2A 1TP7A 4ICLA 2VG6A 2WHOA 2WCXA 1U09A 3QGGA 5EWFA 4RNMA 2OPSB 4RW7A 2R2RA 4OL8A 3DMJB 2R8IA 1RTJB 4M95A 2AX1A 3ICLA 1RA6A 5KFUA 1HNVB 4YMEA 3Q8QB 5J2MB 4O3RA 4NLGA 4FS2A 3KLFA 4ID5A 2DPIA 3KK3A 3KHHA 5KFHA 2VG7B 3H5YA 1LWEA 2B6AA 3BGRB 3HHKA 3MR3A 5L9XA 1HMVA 3V6KA 4O44A 3T19A 4YQWA 1S0NA 3KLVA 4ECXA 4EBDA 3GV7B 5KFXA 4NCGB 5J2NA 3M8QB 1SV5B 1C1CB 5I3UB 3IN5A 2YNHA 4ZPDA 3GYNA 3N6LA 3JSMA 3M8PB 1EP4B 3V4IA 5D3GB 1RT3A 1GX5A 3QZ7A 4RW8A 2V9WA 2O5DA 5KFEA 5KFGA 1JX4A 4X2BA 3LAKA 2WOMB 5DGBA 3Q8RB 3EPIA 1RT7A 1C0UB 2ZKUA 1HQUB 3KLIA 1N4LA 3KHRA 2WONB 3SI8A 4HYKA 2W9BB 1HQEB 2BQ3A 4J9RA 4Q44A 4I7FA 3CDEA 5DG9A 2BRKA 2YNFA 4G1QA 5DQIA 2BQRA 4XPCA 4MH8A 1S9GB 3QZ8A 1TV6B 4NYZA 5KFKA 4ZHRA 2XC9A 3DRPA 2D41A 4ECYA 3C6UB 4NLTA 4ED6A 2AQ4A 2JC0A 3IS9B 4H54A 2HWHA 2E9TA 1S1TA 2R2TA 4RZRA 4H4OA 3KOAA 4ZVHA 3GIMA 4ECSA 4IDKB 3PW4A 4IG0B 4Q8EA 3DOKB 2UVWA 1DTTA 1S6QA 3KHGA 3BR9A 1HYSB 3H98A 1JKHA 3GV8B 1KLMB 4K50A 4KSEB 3MEDA 3I5BA 2RDIA 1RAJA 4QWCA 4K4TA 4ZPAA 4NLPA 1S48A 1JLQA 4ECQA 2ZD1A 5DLFA 4ECUA 3KK1A 1LW2B 1DLOA 3ISNC 1XR7A 3KLHA 1JLGB 1NNDA 5KFIA 3GIKA 5J2QA 1IKVB 3D5MA 3D28A 2HNZA 4IH7A 5KT5A 4ZVFA 4MFBB 1EETA 1RTHB 4J9PA 1RDRA 4GC6A 2D3ZA 2QE5A 3DLKA 2ATLA 4QPXA 5L1JA 4WXOA 5HBMB 3E01B 2C2DA 3G6YA 4O4GA 5HROA 4IR1A 4IH6A 4TN2A 2IMWP 1S1VB 4TY8A 1JLAB 4NLSA 4RNHA 1BQNB 4MK9A 3V6DA 4K4UA 1TL3A 1REVA 5KG4A 4QWEA 3DM2B 4NLYA 1ZETA 5HP1B 1QE1A 2YNIA 4I2PB 5JUMA 4WFZA 1S1UA 1LWFB 1YVFA 2WTFA 2HNDB 3DMJA 4R8UB 4ECTA 3PVXA 3OLBA 2XI3A 2BR0A 3DOLB 3KLEA 4Q0BA 1FKOA 1S0MA 3T1AA 2AU0A 3KMQA 1HNIB 3FDSA 3UPFA 3IG1B 2XWYA 4PUOA 4QW8A 5JXSA 2JEGA 3DLEB 5KFLA 4F4WA 4F4ZA 3BQ0A 5C24A 3JYTA 1T03B 4EYHB 4NLVA 2BRLA 3PR5B 3MEGA 2UUWA 4WFXA 4IQXA 3N6MA 2BE2A 3V6HA 1IKWB 4WE1B 2WK4A 3HVTA 3CJ4A 3QYYA 1RT6B 4Y2AA 4KE5A 3G86A 3OL6A 3I0RA 1TVRA 4WXWA 5J1EB 1LWCB 2W7OA 3BQ2A 4NZ0A 2FVPA 2C28A 4DL3A 5F9LA 2UUTA 4ZVEA 4RUCA 4KV8A 1XR6A 5KFWA 1T05B 3BSAA 1KHVA 4QWDA 4EEYA 1RT5B 4PQUA 1C0UA 2HAIA 1IKXA 3MEEA 5F8IA 1TKTA 2V4RA 1UWBB 2FVSA 5T14A 2B43A 4YR2A 4RU9A 4DL6A 3MTKA 5FDLB 3MR2A 3PZPA 3H2LA 4QWAA 3IRXA 3HKWA 1JLCA 2UVVA 1TKZA 2D7SA 3OSPA 3TVKA 3LP2A 3KLGB 4RW4B 5CYMB 2GIRA 4XO0A 3KJVA 4KHMA 1JLBB 3H4DA 3FFIB 5KG6A 3LP0A 4LSNA 5KFPA 4NLXA 4F4XA 1SH0A 2F8EX 4URSA 1J5OA 1N6QB 1NHUA 1DTQA 4ED3A 2OH2A 3I0SA 3CO9A 1S10A 2AX0A 4KHRA 5C42A 4IR9A 3Q8SB 2R8KA 1JLEA 4IG3A 2UVRA 4Y3CA 4URGA 3DRRA 2XGPA 2IAJA 3QGHA 1VRUB 3E51A 3BREA 1RT4B 3PW0A 2GC8A 2WRMA 2I5JB 3FQKA 4MKAA 4J9QA 3PW5A 2YNGB 4RW6B 4IRCA 5KG7A 4DL4A 4R5PA 4ECWA 5DQGA 2D3UA 3PR4A 4B3OB 4JV2A 3H5SA 1TKXB 4EBEA 3T5HA 3GIIA 4DL7A 3BSCA 3SFUA 1LW2A 1C2PA 2HMIB 2YKNA 4KO0A 1S9EB 3DRSB 4RW9B 4FBTA 1TL1A 2E9ZA 3FSIA 1S1XB 1C1BA 2R8HA 4WYWA 1VRTB 1RTDB 1OS5A 1T94A 4KB7A 1R0AB 5EWGA 4ECVA 2OPQB 1IKYB 3RBEA 3V81B 4IFYB 3TAMA 4DG1A 5HBMA 3CJ0A 3EZUA 1RT1B 3RB6A 3OL9A 1MU2A 4MIBA 3KHLA 1S4FA 3QLHA 2HNYB 2QV6A 3PW7A 2RF2B 4O3QA 2B5JA 2AGPA 5KFFA 2IC3B 1S6PA 2OPPA 3DYAB 5K14B 4KFBA 3MF5A 1HPZB 3DM2A 5CYQB 3FQLA 3QGIA 1N56A 5HP1A 1RT2B 2RKIB 4ICLB 2IA6A 4NLDA 4J9SA 2GIQA 5KG0A 2HNDA 4RW7B 2XCAA 4IRDA 1N5YA 3IGNA 3M9OB 5EDWA 4IFVA 3DOLA 2FLPA 2CKWA 5I42B 5KFAA 3OLAA 4HKQA 5C25A 3BQ1A 3QIPA 3KLFB 4ID5B 4O3OA 3DI6A 4QW9A 4JUZA 1CSJA 4TXSA 3GQCA 3IGVA 4J9LA 1LW0A 3RBDA 1LWEB 2B6AB 3CJ3A 3ITHA 2ASJA 2VG5A 4PWDA 1HMVB 4EO8A 2CJQA 1FK9A 5KG5A 5J2NB 4LQ3A 5KG1A 2V0NA 3NBPB 4H4MA 4F50A 3TQ1A 1C0TA 4Q45A 4KKOA 3UQSA 5J1EA 2IM0A 2BQUA 4U6PA 4I2QA 3JSMB 5EWEA 1S1WA 3V4IB 2EC0A 4U7CA 1RT3B 2ZE2A 3H4BA 2VA3A 2YKMB 2VA2A 3ISND 1T05A 4ECRA 4LSLA 1RT5A 1RT7B 5KFBA 3KLIB 1QUVA 1UWBA 4GC7A 5KG2A 3CWJA 2BANB 3QO9B 3MFIA 2R2SA 3KK2B 3SFGA 4I7FB 2OPSA 5L1LA 5KT3A 5KG3A 2YNFB 4G1QB 4ECZA 1RTJA 4TY9A 4DL2A 3OSNA 1HNVA 1GX6A 4ZHRB 5CYMA 3DRPB 3BSNA 1ZTTA 5J2MA 4J9NA 5KFMA 2FLLA 4ZP7A 5C5JA 3HVAA 3CDUA 1JLFB 2VG7A 3LALA 2HWIA 4ZMMA 3BGRA 4H4OB 5F8LA 4J9MA 1WNEA 5L1IA 3MECB 3DLGB 3LAMA 3G6XA 1I6JA 5L1KA 1RYSA 4RNNA 1DTTB 1S6QB 2OPRB 3GV5B 4NCGA 4TYAA 3M8QA 3OL7A 2R8GA 1SV5A 1C1CA 5I3UA 2C2RA 2W8KA 4NLOA 3MEDB 2FVCA 5HLFB 5D3GA 3M8PA 1EP4A 4R0EA 4ZPCA 5KFOA 2J6SA 2IJNA 4B3OA 2R2UA 3PW2A 1JLQB 2WOMA 2AWZA 3FRZA 3BJYA 4K4ZA 4IKAA 5KFSA 2ZD1B 1TQLA 1HQUA 3KK1B 4NLUA 2RDJA 3Q8PB 2WONA 4KAIA 1MMLA 1RTIB 3DRSA 1D1UA 1DLOB 5F9NA 2W9BA 1HQEA 4XPEA 3KLHB 1K1QA 1SH2A 4TLRA 4ZP8A 2J6UA 2XGQA 2HNZB 1XR5A 5J2PB 5KFYA 2R8JA 1IM4A 1S9GA 1SUQB 1TV6A 2JLEA 3LP1B 3T5JA 3DLKB 1S9FA 4RNFA 4WZQA 3C6UA 2FVRA 4O4GB 5HROB 2FLNA 3IS9A 1T3NA 4ZPBA 4K4SA 4YR3A 4TY8B 5DQHA 5F8HA 4YP3A 3C6TB 3T5KA 2ASLA 4IDKA 4IG0A 3V6DB 2J6TA 3DOKA 1SH3A 1TL3B 1REVB 3DYAA 1ZTWA 1N48A 3RAXA 3NMAA 4KBIA 3H59A 4Q43A 1HYSA 1QE1B 2RKIA 2YNIB 1KLMA 1S1UB 4NRUA 5KFQA 4K4XA 2DPJA 3PHEA 4Q0BB 3KLEB 5I42A 1FKOB 4O3PA 1HARA 1BQMB 4DEZA 4ZP9A 2FVQA 4PUOB 4FBUA 2IJFA 5C24B 3JYTB 3VQSA 3H40A 1JLGA 3MEGB 5KT4A 1IKVA 2W9CB 4YR0A 2BE2B 5DG7A 4EYIB 1JXLA 4MFBA 2FJVA 5KT2A 1RTHA 3HVTB 4RUAA 5KFRA 4NLQA 2AGOA 2W9AA 1FKPB 3NBPA 3I0RB 2JEFA 1TVRB 3E01A 3T5LA 4TQRA 2UVUA 5DG8A 2YKMA 1S1VA 4ED7A
chains in the Genus database with same CATH superfamily
3BDPA 1I51B 4NCAA 1DJ0A 2RILA 4R8UA 4AD6A 1TKZB 2RIJA 3NGRA 1WD6A 3D66A 1Z2LA 1TUWA 5K8OA 4LIRA 2PI5A 3UVJA 2CG4A 3DRRB 2ALYB 3MM9A 4BDPA 4ED1A 3SSRA 2X7IA 1U1OA 4F0KA 2ALZA 3LP1A 5AXMA 5KFTA 1SXLA 3OVBA 1UFLA 1Q8KA 4GVLA 1KRPA 2B4OA 2AEJA 1S79A 5KFZA 2YNGA 1ZS6A 4Y2MA 3H5XA 3OJUA 5C25B 5F0WA 3MURP 2BE7D 1VBZA 1QAYA 4B9UA 1D0EA 4OQJA 1NUEA 2C2EA 1T9XA 2UP1A 4RX6A 1YJUA 3JQKA 2IC3A 1NHVA 1WC1A 1WF1A 4PYAA 2VG6A 1SQFA 2OPSB 2R2RA 5AE2A 2AX1A 3MWBA 1K0TA 3ILOA 3V6KA 4YQWA 3TX8A 2AZ1A 4RPFA 4KGMA 1YSJA 1H2UX 2CRLA 2XZTB 1JQGA 2W9BB 2AT1B 3MXHP 1R0CB 2G0JA 3ETOA 1IBLJ 4H54A 1S1TA 4DS4A 3K5LA 3KOAA 2ZHAA 4L76A 1P1LA 3PW4A 2UVWA 4AL6A 4WFNQ 4CLSA 3IBFB 1OQ3A 2JL9A 3R7BB 3W7BA 4NLPA 5THWA 4ECQA 3TZYA 3P5BP 2B4PA 4ZVFA 2ZBPA 1TTHB 2DR6A 3K7RA 5IM0B 3D54A 1HKAA 3HP6A 3NGTA 1GAOA 3CCUS 2YXLA 2HKEA 2R7WA 2V8DA 1YVFA 4ETZA 4R8UB 1SPBP 3DKDA 1S0MA 1QVFR 4F8RA 4X64J 2VJUA 3G71S 3UVJB 1C4AA 2BJ8A 3GMGA 1TVRA 5BJRA 3MM9B 4KGKA 4DPOA 4RUCA 1XR6A 4QWDA 1TKTA 1FXRA 4CQ1A 3IRXA 3Q0AA 1F6TA 2Z2YB 3H4DA 3LP0A 4NEZA 4NLXA 4B3RJ 3R5BA 1S10A 3Q8SB 2V6AA 3O44A 2IAJA 1N32F 4USWA 7AT1B 2YNGB 1S72S 4IRCA 2D3UA 1MNEA 1PIEA 3D1OA 2AW0A 1FKAF 3DRSB 4U67Q 2C2OB 1UZHA 2R8HA 4OJ3A 1RLCL 3UN5A 3CCRS 1MU2A 3AFGA 4HT7A 2M0GB 3RW7A 5CH7B 2GGPA 2BOPA 2IC3B 4C8YA 3OXFA 3LUYA 2MQOA 1A9NB 4NYPA 2IA6A 4C11A 1HWUA 1N5YA 2VV5A 3M9OB 2CKWA 3G4SS 3MMBA 2XHCA 4CO1A 4I67A 3LQVA 3G2XA 4CO5A 3LGNA 3MM8B 4NL5A 4DQPA 3TQ1A 2KI2A 1RXOB 3VAHA 4LSLA 2JWNA 1RI7A 4PXBA 5KG3A 1NU4A 3MAAA 4GMKA 2Y3YA 5F8LA 3HZGA 2XYPB 1LWXA 1SBRA 4GRSA 3N9UC 3MCMA 5HLFB 1QSSA 4KTQA 4B3OA 2GAHC 2NZ4A 3FRZA 5KFSA 3ZFVA 1G6BA 5D0RA 1HLWA 4JV5J 5J2PB 2V8HA 1IM4A 2Q66A 2XYGB 4LF4J 2Q1LA 1VGYA 1MROA 2FGCA 3VAKA 1VYAA 4B9SA 3C46A 2LA6A 2ZITA 1QD1A 2YX7A 1NJIT 4FBUA 3I56S 2HBRB 2OFGX 5C2GA 5JMNA 2FHJD 5KT2A 2MZRA 3PEJA 2XWXA 2HZVA 1TVRB 2YKMA 2HQCA 1TKTB 2H54B 1VQ7S 1U1MA 5LM7E 1OPZA 3IRXB 4HHUA 1N34J 3TI0A 1JJHA 1DHMA 4J91A 5B0DA 3LP0B 1X31C 4OI4A 3GILA 1NDPA 3IR6B 2IAJB 5AJ3J 1LWCA 1FJEB 4C3LA 2OELA 4F2SA 3PO5A 4F36A 3NL0A 2AEFA 2ZOGA 4I69A 3ZNJ1 4ZCLA 2HRYA 2MQLA 1PC4A 4CO0A 3AQPA 3GYXB 1MU2B 3A8KA 1RGVA 1N8RT 3CMQA 4W4MA 4WTYA 2GGPB 1L3UA 3T41A 4O23A 3U27A 3ULHA 4CNZA 1N5YB 3ADAC 3GFYA 2Z0GA 1TKXA 1FX2A 3L95X 2MHEA 3M1VA 4ZDNA 4X62F 4URQU 1S1XA 4ZK7M 3CJ5A 4NA3A 4PZVA 1OWXA 3BN7A 4IFYA 1MWYA 2LDIA 2MJUA 1X5PA 1BMQB 3NKYA 3OJSA 4DR6J 5HMWA 4NRTA 1R27B 4LSLB 3IO1A 1HPZA 4BWMA 2BM1A 2MLYA 1U09A 3GU0A 2R8IA 4O3RA 2YWEA 3MAAB 2VQEJ 2MQPA 3H5YA 1FRXA 2HWTA 2R3VA 4DL0C 1RT3A 4RW8A 4EMDA 4P71A 4LR9A 2EFGA 1RHKB 1NKCA 3KXDA 3KTQA 3GE9A 3ZZRA 4FXWA 5L46A 1Z2ZA 5D0HA 5DQIA 3DRPA 2EG1A 3TNVA 2J0WA 2JC0A 2J0XA 3PFOA 1MROB 2RD5C 4JI8F 3BR9A 4RUBA 2VC1A 4K50A 1FRHA 3I5BA 5G0RA 4ITSA 1RAJA 4WIIA 1NB2A 2VBWA 3HKZD 3UI3A 1R8CA 2HHQA 1E6YA 2LYVA 3R5AA 1S7HA 1FJCA 1KQGB 2A10A 1Q7YT 5LSRA 2BR0A 1SI9A 2EI5A 1RJJA 2KM8B 1IVZA 1DQ8A 7FD1A 1TMJA 4GKKF 4RUHA 1SJ3P 3G86A 3K59A 1RKIA 1LWCB 4ZVEA 4A8WA 1G2EA 4KV8A 1C0UA 2RQCA 3BF4A 3DHWC 1IR0A 5ETPA 1FFGB 1NKEA 3U1NA 2GIRA 2LDYA 1JLEA 5GAHU 2DHGA 4X4PA 1HI8A 1I3OB 3E51A 1ELOA 3O3LA 5DQGA 3PR4A 1LK7A 1TKXB 4ZCKA 1UP1A 1PJ7A 3M1VB 5GMEA 4DFMA 1S1XB 4CYUA 1IJFB 3G8SA 3RBEA 4IFYB 4DG1A 2C3OA 4FKXA 4DSJA 2YVSA 3KHLA 3FRYA 4PG7A 2OPPA 1S6PA 3WZ0A 1JJ4A 1HPZB 1V3RA 4IRDA 4WPAA 4IUFA 2HLUA 2H5JB 3M7VA 1FT8A 4P2FA 1F3VA 1Y11A 2K3KA 3C19A 1EB0A 1TUGB 2GJ2A 5J1EA 1SQEA 1U0SA 1RT3B 1TR0A 3ISND 1H72C 3UNYA 1RT5A 4NA1A 2MKKA 2ASYA 5IWAJ 2GNKA 3UWTA 1GX6A 2ZUAA 3DRPB 1RWWB 1HD0A 4J9NA 2IYIA 1VQ9S 3B4DA 1JLFB 3MUTP 1WNEA 1QTMA 4PWUA 1I6JA 2OMOA 2WVEA 2FHMA 3NLCA 3QATA 4DR1J 5G0RB 3M8PA 4AFFA 4DFKA 4DV0J 2C2ZB 5IT0A 2QJ3A 2F1FA 5F41A 1E6YB 3IM8A 3RRKA 3OW2R 4KT0C 3M30A 1Y3JA 3NCRA 3THTA 3CPWR 2IPOB 4WP8A 2ZH7A 3J7A1 1AFIA 4YHHF 3PIOQ 2RQKA 1U6BA 2UXCJ 2BJ7A 4ELVA 2ZNZA 2J9DA 4KV8B 4J9KA 1U2FA 2IA0A 3RRHA 1RCOB 1LWFA 3GR1A 4IRKA 4F3QA 4ZVOB 5LJ5Y 2JOQA 2IIHA 1T03A 2A0FB 2ILZA 3QSIA 1JLEB 3UR0A 2OTJS 4P2SA 2G9OA 3IBCB 2PGCA 3QJJA 4QU6A 1RA7A 3NAIA 3OHAA 1P6TA 4HDHA 3KG0A 4EWTA 1X0FA 2QL9B 4U96A 1N36J 4DG1B 1QLNA 4DS5A 2P9EA 2XLIA 4U8YA 4B9TA 4QIGA 4DV4F 2OPPB 1S6PB 1FXDA 1R6YA 3K89A 3D6FB 1YLXA 4A8YA 4OYWA 4UOCA 2YPZA 2UXBJ 3UCUP 2BOAA 1U49A 3M4XA 2OPQA 2AJ0A 4MYTA 2C22A 4LFCJ 1F5CA 5K20B 4ZP6A 2RRAA 3K8VA 3PJWA 5E3AA 3RU0A 2KRBA 1NPPA 1RAFB 1XEZA 3DMJB 5LXYA 4AT1B 3TZXA 4FF2A 3EVMA 1LWEA 2ZZTA 4J9UE 2W2QP 1NK8A 1VR6A 2OMLA 2ZBRA 3M8PB 1GX5A 2O5DA 1FD2A 1CJKB 1JB0C 3U7JA 2Y1IA 4DF8A 3KHRA 1RWPB 4G1QA 4JV5F 2BKNA 5B0EA 2XC9A 3FEZA 1CC7A 3DLJA 5LMUF 2HWHA 1WG4A 4UUXA 1DTTA 3ZZZA 2RU3A 1IXKA 3G82A 4ED5A 1XMQJ 1JLQA 4ZVSB 3OFHA 3BGLA 4BCAA 3ISNC 1KSPA 3KFWX 3BBBA 3T1YF 4DFPA 3MI7X 4QCLA 5KG4A 5HP1B 2YNIA 2QX0A 3L7UA 1LWFB 5FLXU 2XI3A 2BJ3A 1J5EJ 1S7IA 5C24A 1T03B 4I56A 4NLVA 2VZ9A 2BE2A 3V6HA 1S4EA 4EZ6A 4C8NA 2HBYB 1DURA 3PCOB 5AJ3F 3TRGA 3BSAA 1KHVA 3FBCA 3RBZA 1VCTA 4P2XA 4HH0A 4RU9A 1JK9B 2AZ3A 2FHOB 2ZC3A 1SH0A 5BYSA 3D6TB 2A2CA 2MXYA 4DV6J 4KHRA 4AQYJ 2UVRA 4URGA 4DSKA 2AF6A 4F4AA 3MMJA 1B3TA 2RRBA 2BVZA 3SFUA 2UZAA 4FBTA 3SV4A 1TL1A 2E9ZA 1V5VA 2MKJA 2OPQB 5HBMA 2L9WA 2MZSA 2HS3A 3QLHA 4C8ZA 2MSTA 3MDFA 2NPIA 3A8JA 4NPOA 3FQLA 3UD3P 2F3JA 2E1PA 2MLZA 4YFUA 1LWEB 2DH8A 2VQEF 2OTLS 2RH3A 3CD5A 3HI9A 1QUPA 5HN0A 3HD1A 1HNWJ 1YBAA 2Y0SD 4TNOA 3ILIA 1FHTA 1T05A 5KFBA 2AMCB 2F8MA 2R7SA 2F5GA 3I82A 1ZH5A 4G1QB 1XWLA 1HNVA 1PAEX 2V94A 4ZVRB 5C5JA 3OFGA 2ATCB 3OFEA 2CADA 4OZ5A 3MECB 3DLGB 1DTTB 1RBLA 3G82B 2W8KA 2W24A 1X4GA 2J6SA 1RWUA 1JLQB 1F3FA 1K1QA 5ETMA 2VH7A 3NOGA 3T3FA 3MM6A 2WW8A 3CNQP 3QJLA 2E66A 1WF2A 2YNIB 5DDRC 4AXJA 4LF2A 2DPJA 1UFKA 2ZDPA 1LK5A 2V68A 2FVQA 3DFEA 5LL6d 5C24B 4KPCA 1SC6A 1U02A 1IKVA 2W9CB 2BE2B 4L3KA 1KN6A 2W9AA 2W2MP 1Q8BA 1UW9A 2DHAA 2NYHA 3ONQA 1HBUA 4CLPA 2LFVA 4I2PA 5C7PA 2A6MA 4NOHA 1FEEA 2XB2D 1PCAA 3AB2B 3P96A 3HJVA 2RSQA 3GJSB 1B64A 2DIUA 4CO4A 4Y34A 2QT7A 4WU2A 1TL1B 1OJ4A 2W25A 1HFEL 4V19X 3HULA 4G65A 4DL5A 3KLGA 1CVJA 4DSEA 2E7WA 4LF5J 3QLHB 1XNQJ 2Y1LB 3AHPA 3GJQB 3LF0A 1QSYA 4F3MA 3PJXA 1RYRA 5HMXA 4K4VA 2KJWA 1WACA 3MR6A 4NLRA 4PRFA 1H0HB 1ROFA 2V5HG 3CC2S 2ZKTA 5J2QB 1IJEB 1KP6A 4M94A 1N5SA 1AUSL 2DIVA 3DNCA 2H65B 2HNYA 2IM3A 1HWJA 5DM6Q 4RNMA 2HK2A 1T9WA 4RW7A 5DDPC 2B7BB 5IZHA 3DCAA 3HJFA 1HNVB 2D69A 3SSSA 4NLGA 2F4VJ 3BZQA 1NSAA 4O44A 1N5TA 1B99A 4UZBA 4DR1F 3QZ7A 2RUGA 1UW4A 4DV0F 2HHVA 1RWXB 4J9RA 4LBHA 2OP5A 3GONA 2BYCA 3NY0A 4USHA 2HQ3A 3OUYA 4B08A 3SCJE 5H9EJ 4KQZA 1PYOB 2ZZMA 3ELHA 3M2VA 5IFMA 3ENWA 4C0BA 4K4TA 4Q7AA 4ZPAA 5E5NA 3M8WA 3SSQA 1IKVB 4IOAQ 1XMBA 1LFWA 2YQ1A 2J7KA 1RDRA 2UXCF 3DLKA 2C2DA 2V2QA 4DX5A 1HBUB 2PD1A 4CRJA 4I2PB 3R5GA 3KKFA 1S6OA 3D1QA 3MMCA 4RL1A 4DPYA 2DNHA 4KHPJ 1GMWA 1O6XA 1KWMA 2VFRA 1W26A 4MYUA 4IQXA 3X3UA 3N4WA 1MN7A 4FYWB 5KFWA 1O51A 1K73T 1NRKA 5LT5A 4ZS6A 2P8IA 1U1NA 3R5DA 4QWAA 1JLCA 1N36F 5CD4A 3KLGB 4ZIWA 3QNWB 1KVJA 3TANA 5KOWA 3QJPA 1NK6A 3FQKA 4MKAA 4Q2LA 2NQPA 2RE1A 4R5PA 3T5HA 1TU0B 2YKNA 4KO0A 1LKZA 3BO4A 4NZ7A 2BX6A 3A8EA 5HI7A 2DNOA 5EWGA 2AYGA 4ECVA 4FNHA 3EZOA 2GHPA 1D8YA 5A2QY 2N3OA 2HS4A 3EUNA 1PO6A 2HNYB 3HHLD 2EKYA 2H3EB 1TFYA 1WG1A 3DM2A 1UKUA 4RW7B 3R7SB 2JLFA 4IFVA 3DOLA 3B54A 3DRYA 1DZ5A 3C16A 1LW0A 1S0VA 1IQTA 2DH7A 2BW7A 3SEOA 1Y10A 4H4MA 2HGMA 4NMLA 1M5KC 1SJ4P 1OSCA 1YG0A 3AJ2A 5LSLA 2HAFA 3VVUA 2DCUB 1X9MA 4K59A 5A76A 2B8QA 4DL2A 3K5PA 1GTEA 1X9WA 1WTBA 2KO1A 1ZPVA 3OUYB 3BGRA 3WQPA 3BBFA 4FZVA 3M2VB 1C1CA 2EW9A 2BXJA 2FTRA 3BJYA 4IKAA 2ZVSA 2DK2A 3T9NA 4DR5J 4XPEA 4LJMA 4ES3A 2MQ8A 2R8JA 5U47A 3DLKB 3MAQA 3BN4A 4RNFA 5DRKA 3GTYX 3Q83A 4LRDA 3FZBA 5F8HA 4ED4A 1FRMA 3QMQA 2J6TA 1SH3A 1WEXA 4QYZK 1WHYA 2XMTA 3UFCX 2X3DA 2YKOA 1AT1B 4QIWD 3ZXWA 5IT9Y 2F65A 2NXEA 1J5EF 3VQSA 3QT8A 1JXLA 2QTWA 4RUAA 2Z8QA 2B7CB 2DXEA 1Q81T 2HHHJ 1S1VA 3N01A 1F9EB 1JLCB 4BC7A 1A0OB 1N5QA 2VHGA 4ZA1A 2CPDA 3MFHA 4JP8A 4Q5VA 2C3YA 4Z37A 4DV6F 2IBKA 1HI1A 2H1YA 4PABA 1RT6A 2XMVA 3GJRB 2DNKA 2HHXA 2GMHA 4G1PA 9ATCB 4I6AA 4R5PB 1QAXA 3A8IA 2HHWA 2VIHA 3GZ7A 3D1HA 2YKNB 1RTIA 4KO0B 4AE5A 2IRUA 3KWMA 4TQSA 2CQ2A 4RBVA 2YH1A 5ETNA 4JV0A 5MAOA 3VAIA 1UVNA 2E5HA 2VFSA 2FHKA 4C8MA 5HMYA 2RQMA 4O4RA 1GK8A 3H25A 2I1RA 3HCXA 2NZCA 3B82A 4IFVB 1XERA 5DO2A 3A3PB 2G2ZA 5ETRA 1LW0B 3MUVP 4F0HA 4TU9A 4G3IA 3M9MB 4H4MB 2W2NP 1Q82T 3BO2A 3UDLA 2XS5A 2ZH2A 3IWXA 3JS9A 3Q86A 4OZLA 4JI7J 3W63A 3O8WA 4QWBA 4H4KC 2PMWA 1Y0HA 2JLGA 1O0PA 2Z57B 3CGIA 3G6ES 5FD1A 5KFHA 3BGRB 3PYEA 2I0XA 2ZM6F 2DH9A 3W5ZA 1C1CB 3FSXA 3IP0A 3VQTA 3HK2A 2KVQE 3J81Y 3FC9A 1T9VA 2NSCA 2WVFA 2V50A 1ZOTA 1K0VA 1UVJA 2D41A 4DMZA 1CULB 5HVFA 3OFFA 3KHGA 1V5IB 3NG8A 2RRNA 4M5LA 5ETOA 4RBUA 2HQFA 1L3SA 4JYAJ 1LFPA 2NCKL 2DEJA 3RJMB 1TL7A 2ZH6A 2HNZA 5KT5A 4RKUC 3P49B 2D3ZA 3M2UA 2MGZA 2IMWP 1S1VB 1EQMA 4PYDA 4KJIA 3EDRB 1FDNA 1T3OA 1NHKL 1B0TA 5JXSA 4F4ZA 3BQ0A 1OSDA 3MEGA 2VPWB 4CT8A 3POTA 2XYHB 4CO2A 3W2VA 1YJWS 2WK4A 4USKA 1RT6B 1DBDA 3W1YC 3PXGa 3W62A 3MEEA 4YR2A 3BH7B 3HKWA 5KFPA 2MEWA 5DM7Q 3CO9A 4LF5F 3HZEA 5B08A 1XNQF 2R8KA 2RUSA 2KDOA 2AYBA 3NWGA 2M8HA 5AXNA 4CH7A 5CZXA 4DR4J 1G4CA 2MHNA 2SXLA 4N77A 2RAQA 1NZAA 2CNOB 3BSCA 4YY3J 1LW2A 4MAKA 3TUZC 4DWIA 2YWGA 3MPYA 2C1EB 1O5JA 3ZZYA 3TWZA 3A4TA 1NSKL 3MPUB 3TAMA 3TZWA 2MZTA 4DQSA 3C2PA 5IQ6A 2DR8A 3MCNA 2B5JA 2RMLA 2ROEA 3QRQA 2RKIB 2GIQA 5GAGI 5EDWA 5G4DA 4KGXB 4OMFG 3BQ1A 4QW9A 2VODA 2F4VF 1S12A 3CJ3A 3TO8A 3RAMA 3EX7B 4GO7X 3AY0A 1D09B 2RJZA 3RR8A 2P6SA 1L3KA 5B0GA 1UWBA 4DPXA 5KT3A 1HQ2A 5CYMA 5KFMA 4ZP7A 5FIIA 4J9MA 1RHUB 2V34A 3OR1B 4I0WA 3EGWB 2C2RA 2L9NA 2LXIA 2BBEA 1T9TA 4U8VA 3HLUA 3R5CA 3EVOA 3G8QA 2K3IA 4ALZA 2CPZA 2WONA 1TL7B 4ZP8A 2HFZA 2HNZB 1RBOB 3CMES 3W3SA 4KPYA 3M2UB 4JBCA 3P5TL 2HLTA 1T3NA 4HACA 2MGZB 2DXDA 5ETLA 4IDKA 4IG0A 4ELUA 4F3OA 1OIAA 2KN4A 3RAXA 2POKA 1U1QA 4KHPF 3QRPA 3MEGB 2IYGA 5A8WA 3HMJG 5AE1A 4NWBA 3W61A 5DG8A 1VBXA 4FF3A 1BQNA 4F4YA 2ADCA 2DGXA 3MEEB 2NREA 2V4QA 2GW8A 2IRYA 2KXFA 3WC0A 2ZJPQ 1FDBA 2WAQD 3FMBA 2YWWA 1NK4A 3MR5A 3M6WA 3RB3A 5KFVA 4BHQA 2BA9A 2HHUA 3RB4A 4EU0A 2RDDA 1W25A 3RB0A 4LRBA 1XNRJ 3CCVS 4E8UA 3DN9A 3GCWP 4B9NA 3LWLA 1CQMA 3EM1A 1VQLS 4A8XA 3TAMB 3FFIA 2K06A 4P72A 3G6VA 1JIHA 2UUBJ 3EE3A 4IOBA 2B5JB 4CNYA 1U8WA 4IO1A 2FJXA 1JKHB 2QMUB 2KTQA 1HW8A 4PXCA 2DKOB 2WB1D 1S9EA 2CFXA 2NXCA 2BJDA 2XTJP 3HVWA 5F8GA 3CC4S 1X4BA 1EETB 1AB8A 2XBPA 3F56A 4AYBD 2RS2A 2VL1A 1Z4UA 4DFJA 5DS7A 1Y9OA 1HIYA 1RA6A 4Z7CA 2Z58B 1RHQB 2OD4A 1LV5A 1N0UA 3VVTA 1TL5A 3PYFA 1HMVA 4KY3A 1CG2A 4WP3A 2QEXS 2FUG9 1RU1A 2A18A 3H8YA 1WUUA 3PTWA 2WONB 3SI8A 3ENAA 4X4SA 2GQ2A 4Q44A 3CDEA 4DR5F 2EFVA 1NAQA 5A6PA 5B0CA 3MEKA 3QWUA 4FYDA 2LVWA 4H4OA 3IA0A 4IDKB 2DRBA 4IG0B 3DLHA 2Y1RI 2CXEA 2GA7A 3S6EA 3RW6A 4H4KA 2GHWA 2I6WA 4IH7A 4GC6A 5A8WB 4OFZA 4ZJLA 2CZ4A 2V2VA 5A8KA 1BQNB 2Z30B 2HHHF 2DTJA 1TL3A 4QWEA 1AW0A 1QE1A 3R6LB 2Q6BA 3G9CA 4ZPTR 1FKOA 2AYEA 4F02A 1RTZA 1VMBA 1WDTA 4YB6A 4DX7A 3HDSA 2MY7A 3TVZA 2B4VA 2KH9A 2HFVA 3IMQJ 5T14A 2B43A 4K2XA 1PSDA 1WTFA 4OIXA 4KHMA 2FJBB 3FFIB 1RAEB 3PG9A 1EQ0A 3OQ2A 2XZWA 3J7YU 4ED3A 4ZIVA 4WFBQ 4IR9A 4Y3CA 3CDBA 4QIEA 3L09A 3E8OA 5KG7A 4ECWA 5D8HB 2UUCF 1G1XA 4NI2B 1UL3A 1S9EB 4A47A 2RB7A 2F8HA 1OS5A 4P75A 4X4QA 1S4FA 4MIWA 3W9JA 5KFFA 3DYAB 4ANEA 4JI7F 4KFBA 3QGIA 1ZAVA 2I38A 2PO4A 3QSYB 2BDPA 2CQ3A 4N56A 3IWNC 1H2VZ 1HMVB 5JJBA 1TELA 4Y0FA 4N5SA 4ZVTB 1FA0A 1S57A 4RJVA 2IJRA 3J7AN 3UN2A 3M05A 2ZOMA 2CYYA 1NH7A 3HVAA 4QR2A 4H4OB 3GG0A 1N32J 2O67A 7FDRA 1N5VA 1UCNA 2GQCA 1WKKA 2NUUG 3BPDA 4PXDA 3Q8PB 1EJ7L 5GMDA 2KU7A 3D0IE 1X5TA 4HR2A 2NR0A 1SUQB 3T5JA 3FGVA 2R7XA 2X1GA 1VQOS 2FVRA 4HH1A 4XDDA 4CDIA 2VASA 4JI2J 2BM0A 4YP3A 3DGPB 3PDNA 2KZMA 3I87A 1E6VB 1TL3B 1N48A 2W4PA 1QE1B 2DGWA 1GMUA 5M2PA 3K0JA 5HO4A 3O5TB 2CZ9A 1FKOB 1WOPA 2ABYA 1NPKA 4UOFA 3BKFA 1YIJS 2CAJA 2BACA 4OX9J 2PC6A 1WEYA 1ZZFA 4C8KA 3E01A 2P6TA 3T5LA 2D9OA 1RACB 1SKWA 2XY5A 1HHTP 4UUWA 4OYXA 3QO9A 2J5AA 8AT1B 2E7XA 3S8SA 4DR7F 1U8SA 4RBTA 3WIVA 1XN9A 3KK3B 2W8LA 2IM2A 3DLEA 4Y2CA 2QFJA 2NS1B 2OPRA 5F8JA 4K8RA 1JJ2R 4E2FB 1Q79A 2F4FA 3ZTSA 5F0UA 2CPIA 1S97A 3CUNA 2PFFB 5D78A 4NZ6A 1JLBA 1K1SA 2DISA 4O0IA 3C6TA 1B4SA 1KOOA 4KFBB 1U1PA 3DDKA 5H9FJ 3NP5A 2H51B 2M52A 5I3PA 1NK0A 1F9HA 3W65A 2E1RA 2OI2A 3D6MB 4OYMA 2DHXA 1RADB 4V19J 4K2JA 5L9NA 1H38A 1VRTA 4USIA 1OYDA 3I5CA 5E33A 3AT1B 5EN1A 4U7UD 3GFHA 4OZ2A 3H5UA 5K14A 2FC9A 5F8MA 1RT2A 4ICLA 2YH0A 4ZPWR 3T6BA 4F26A 1PJ5A 3HSGA 2AV5A 4P9SA 3MR3A 3GV7B 4L3NA 3N6LA 3V4IA 2COLA 2V9WA 1N88A 3EPIA 5HANA 2HHSA 4W98A 5F3TA 1H73A 4OLPA 3UE2A 4MH8A 2RT3A 5GAHI 3PRDA 4ECYA 3NNHA 3ZTRA 4PAAA 2LXUA 1FNXH 2AIRB 2HEKA 4NYOA 3QT7A 1R31A 2Z4PA 5CXTA 1S48A 1F60B 3A12A 1BXNA 3Q8UA 3EYZA 3BR8A 2I2YA 4QPXA 3E01B 3R27A 3T9ZA 1ITPA 3CCTA 4K4UA 1X4CA 4OV6A 2B8PA 3WC2A 4M5IA 4LMZA 3MPWA 4QW8A 2JEGA 3DLEB 3U1LA 4EYHB 3R7NB 2FJDB 4DN9A 4W90B 3CJ4A 2E44A 2A6OA 4HLBA 4IYQA 4LRAA 5F8IA 1UA0A 2FVSA 3LGMA 3JTPA 4UW2A 3H2LA 2GAGC 1B7FA 1JLBB 2ZHBA 3JSRA 2OH2A 3I0SA 4JI8J 1RKJA 2UUBF 1XTZA 1B7YB 3O2IA 4B9VA 3PW0A 5L38A 6AT1B 3HF5A 2K2PA 2JHEA 5GAGU 1ZA1B 1VRTB 3RG6A 4LF7F 3OBIA 2LU1A 5IM0A 4ZOSA 4MIBA 2WVDA 4PPZA 3F0NA 2HFSA 4PR6A 1UFWA 3JAMY 2GVDA 5K14B 1RT2B 4ICLB 4AL5A 2BV3A 4GKKJ 4AXIA 2PMZD 2GO9A 4KGZB 3TA1A 2MLXA 2G1DA 2N4CA 2MZQA 3WX8A 4EO8A 2N82B 4KH0B 1RQ0A 2V0NA 3NBPB 3VTIA 1F9FA 2BKOA 4I2QA 3V4IB 1QUVA 2BANB 2R2SA 4M5HA 4X84A 2JVRA 3SV3A 4ECZA 1RTJA 1P9QC 1FWKA 1HR0J 2LCWA 4E0DA 3ZZOA 3M8QA 1S6UA 3JQMA 1EP4A 1YJ9S 2IJNA 2VKZG 5ETVA 2KXNB 4DHVA 2CA9A 3DRSA 2BABA 3VWSA 1RU2A 3N79A 2JLEA 2EFPA 2J76E 2CNLB 2YBVA 2F63A 3K8WA 4YR3A 1IR2A 1X60A 3MPDA 3T5KA 4L73A 3FSYA 4KBIA 1KLMA 1M0SA 2OGUA 2OD6A 3J7Z5 2AJQA 4DR3J 1BQMB 4U95A 1XMOJ 3P8BB 2IJFA 2VDIA 1NEEA 3MM8A 1Z1ZA 3CVKA 2YKPA 3PY8A 2EFNA 3PYGA 1RK8A 3GR0A 4WTOB 4MKBA 1RAIB 3C14A 3I0SB 4OHXA 2HURA 2YNHB 5HLFA 2C3PA 1V9OA 1RP5A 2MJNA 4LRCA 1U26A 5J2PA 2LQBA 4ED8A 5KFNA 2GVZA 4YN3B 2CVEA 1N6QA 4OYIA 4DPUA 2GVDB 3AODA 1VBYA 3C8YA 4MJKA 3KMSA 3M8ZA 1U1RA 2XHWA 1Y3KA 2BJEA 2CNKB 4PG5A 5K8PA 2HFNA 4RW9A 4YHHJ 4OX7A 4FF1A 1Y5IB 2AJ1A 3G87A 4NX9A 1FE0A 3IAM9 4I2QB 2ZBQA 1RWKB 4WKRA 4FVCA 3I9V9 1X4FA 4N7TA 3BYPA 3IFEA 4DU8A 4DLEA 1TP7A 2WHOA 5BXIA 1RTJB 3N5FA 4A8KA 1XQIA 3B8HA 1YBUA 2G2YA 3HFKA 4J9VA 4C3MA 2Z2MA 3M8QB 1EP4B 3QPIA 1RT7A 2ZKUA 4P2MA 3TR5A 4I7FA 1WG5A 3FNNA 2N3LA 4ZHRA 2VFUA 2Y9HA 2CPHA 3IRWP 1KR4A 1FXLA 3ZTQA 1WC6A 4DU7A 1H7WA 2DNMA 3O1LA 1K8AT 3EXYA 4JI2F 4DV4J 5ETTA 3FJ2A 2DNPA 2CQGA 2J0SD 2KFZA 2JSXA 1WC0A 1M5SA 5A6WA 1KLMB 4KSEB 3B78A 3DRXA 2IDEA 1RAAB 4ZN3A 3TYTA 2J8AA 5IOLA 3K58A 5K5MA 3T6JA 1RBAA 5ADZA 4OX9F 2H4YB 2KG1A 3OR2A 3HT3A 1JXVA 4PKDB 5L1JA 3PKYA 2XMKA 1IQZA 3FUYA 2FZGB 1FI4A 1FWLA 4WFZA 2WTFA 2HNDB 2VOPA 1YJRA 3UDEA 3C14B 2XWYA 2BRLA 4Y65A 3L3CA 1KQSR 3D9BA 3L7PA 1G3OA 4Y2AA 3GIRA 5GMKa 3AXKA 2FVPA 1QDUB 4HVZA 3TAPA 1G7CB 5LJ3Y 3LH2S 2LP4A 2N7CA 3W66A 2CDQA 5LMUJ 2GVZB 4K5RA 1J5OA 1N6QB 4FYVB 1DAXA 3OTEA 4YB1P 2M88A 3L9ZA 2WRMA 3MD3A 3AJ1A 3AOCA 2OLWA 4RW9B 2XMUA 3T1YJ 1ZYQA 2IBOA 2KT5A 2LQ8A 2PT0A 2FIUA 3IXQA 4M5DA 3CULA 4UTGA 3I6PA 3MF5A 2CPEA 3FBEA 1NJXA 4PG4A 5KFAA 5I42B 2ZVIA 4P73A 3GQCA 1HNZF 3IGVA 1SKRA 1LQ9A 3HFVA 3DU5A 4PWDA 2C3MA 4BLGA 4NXNF 4DXLA 2ZNYA 2BQUA 2B9YA 4XK8C 1RT7B 3DLBA 3IM9A 4I7FB 4TY9A 2VUGA 4ZHRB 4B9MA 1ZTTA 4X66J 1YJ7A 2M4MA 4P7VA 4DV2F 2JRSA 1FJGJ 4LFAJ 3G6XA 4FNIA 4J90A 1DQAA 4NLOA 1VQKS 4R0EA 5KFOA 1ZBTA 5T7LA 4QIFA 1HQUA 2VB6A 2X1BA 1HQEA 3CJRA 4MT1A 3OR2B 4HI2A 3TAQA 1HBMA 5HQMA 4IO9Q 2IY5B 4WZQA 2R4FA 2BW2A 4DR2F 2XM3A 2ZH9A 2K1RA 1S59A 5BYRA 4MTPA 5ETQA 2QMXA 4K0KJ 4ZP9A 3D68A 2W01A 2HQGA 5DG7A 2FJVA 2YKQA 2DNRA 1Y4ZB 5KFRA 1FKPB 4D3HA 5IV3A 4P7TA 2A2DA 4ED7A 2ILYA 1XIQA 2XCPA 1ZM2A 3DDNA 2AGQA 5KTQA 1IWGA 3MCOA 2XMAA 1J5OB 1JLFA 3NGSA 2HQDA 3V6JA 4DSLA 1PC5A 4MKYA 4EO6A 2VPYB 1WDDA 1YZ6A 1SC1B 2P2CB 1Q5YA 2X51A 1EHWA 2BZ2A 1Y7PA 4R25A 1H3DA 2JZ5A 4DLGA 2WB4A 4RW4A 1VQ6S 2U1AA 4M5DB 4MIAA 2JEJA 2DY9A 2ASDA 1VRUA 2WVCA 4MMOA 2XI2A 1WJ9A 2FY8A 2HW3A 2WSFC 3I55S 1FDDA 3U02A 4CH1A 4PWDB 2G4BA 1RTDA 1U0HA 2V4JA 2CJKA 1RT1A 2HZCA 4WF9Q 3HHEA 4FS2A 2DPIA 2ZEJA 5E2QA 1HR0F 2NXUA 1H98A 2EPIA 3DXBA 1IBCB 4ZKAA 1MMDA 1FRKA 3IN5A 4ZPDA 4KC5A 1JX4A 4X2BA 5T7LB 3NS6A 2L3MA 3GB0A 3W8PA 1HQUB 2M2BA 2R7RA 1HQEB 5GAEI 2EBEA 2BRKA 2YNFA 4O0NA 1HBMB 1RAGB 2DNNA 2OSRA 3J81U 4RZRA 2K1RB 1RWOB 4F2RA 4N8OA 1ZM9A 5CA5A 4WWSA 3KUHA 1T0TV 2KZZA 4CT9A 1HI0P 2RDIA 2DR9A 2VQFF 1WF0A 4FPRA 4WU3A 4LF1A 4DR3F 2HQIA 2D3OR 2RHSB 1XMOF 4JI3J 4J9PA 5DZ6A 3CCES 4CIOA 3M8YA 3DOMA 3RTVA 3V6DA 1SIZA 2QLWA 2Z2ZA 3DMJA 3HD2A 4XIUA 5L8RC 3KMQA 1I94J 5EX3A 4F4WA 3GFXA 4OJGA 1UJ6A 4WFXA 4UQTA 3N6MA 3KG4A 1T7PA 4OZ3A 3TEGA 3QYYA 3Q89A 1RHJB 4NZ0A 2YWKA 1LXJA 5F9LA 1SL1A 2F40A 1CJKA 4EEYA 2XY6A 1YI2S 2RU9A 3PZPA 2G2OA 4N41A 4RW4B 2Q3PA 2E7VA 3ZZPA 1VRUB 4WFAQ 4CLLA 3PW5A 4DI6A 2K8GA 2MKYA 2FB0A 3BGUA 1R89A 5LXRA 3HXMA 2IVMA 1RTDB 3BDEA 3MM7B 2CJBA 1U0HB 2MMYA 3EZUA 3MHYA 2V4JB 1SL2A 1RT1B 3PIPQ 2E5JA 2XNQA 4O3QA 2G13A 2DNLA 4KR0B 8RUCA 1EX8A 2VA3A 2EC0A 5HP1A 3GP9A 4NLDA 4J9SA 2NXNA 1Q7LB 1D8ZA 2C3UA 1R3NA 4JOUA 2ZC4A 1WHWA 3LGHA 2OSQA 4AL7A 2Z56B 4M5GA 5JVGQ 2VA2A 1UETA 4HHHA 4A8MP 1TK5A 1IWAA 3TOQA 4B3SF 2KJVA 1GQEA 4OHVA 3KK2B 4LIWA 5L1LA 2YNFB 3WHIA 2KRRA 2VG7A 3W9IA 2ZH3A 4ZLJA 3LAMA 5L1KA 2CQ1A 4M63A 4DCPB 2PDAA 2XLKA 4PWWA 2RDJA 2H48B 2J6UA 2VPXB 2WBRA 1OY8A 3DOMB 2PMHA 2QLBB 5DQHA 3THVA 4ELTA 4PXEA 2M70A 3EICA 3V6DB 3DOKA 5H9EK 4Q43A 3L7OA 4UY85 3LOUA 4X4NA 3RR7A 1M1GA 1WWHA 1X9SA 2UV8G 3ISZA 2XMMA 3R5JB 2OEMA 2KYXA 2CJAA 4HTJA 2QA4G 2D3O1 1UJ5A 1JLAA 3LANA 1S0OA 1OPIA 5EHHA 1FNOA 1BHNA 3R8YA 4ZVUB 3A3OB 4RWXA 5E0OA 2XEXA 1TK0A 2XMJA 4WP9A 2DCLA 4JV1A 3IG1A 2M9KA 1RISA 2VFTA 4X65J 4NXMJ 2E9RX 2K7JA 3MECA 3DLGA 4FP9A 4KYZA 2ADBA 2DYAA 1Q5VA 1R6VA 4RNOA 4USTA 2JEIA 4DSIA 2M5YA 2AEMA 1SC4B 3M32B 2A1BA 2L08A 3UO0A 1SC3B 3NEKA 2MTLA 1U1KA 2CQ0A 5J1PA 4Q2MA 1S49A 1GMVA 3PFEA 4IH5A 2DHHA 5E3PA 2RQ4A 3R9LA 4EBCA 3N0VA 4Q8FA 3ENQA 3E2EA 3RYLA 2KM8C 4A8QA 4OYOA 5KT6A 2B9WA 2W9CA 1HWKA 3PRBA 1FE4A 1UJ4A 1WI6A 3PRVA 5CQGA 2HZAA 5CYQA 4QJVA 5EWFA 3R1HA 2GHVC 3KLFA 2IHR1 4X66F 3KHHA 2VG7B 2D74B 2B6AA 1NK9A 1FJGF 3AJDA 4LFAF 1NK5A 4BS2A 4A4JA 3JSMA 2XMWA 2XULA 4J7CA 3OTCA 1U24A 4X4UA 4XPCA 3AAWB 1NK7A 2ZH5A 4DV5J 2E5GA 3GIMA 5LMNJ 1FERA 1R8HA 3DOKB 2CG8A 4I6YA 1HNXJ 1TKDA 1SJQA 4QWCA 3K17A 3H2VE 4K0KF 4USMA 5CD4H 1VLYA 1DLOA 1XR7A 3KLHA 1RUSA 5KFIA 5J2QA 4ES2A 4XDCA 2J0QD 2ATLA 3M2RA 4IH6A 1NDCA 4B3TJ 4TY8A 1JLAB 4NLSA 2DB1A 4QYRA 1P1TA 5HSPA 5D0GA 3KNGA 3Q2SC 3H20A 1ZAWA 2FHJA 3PVXA 2Y1JA 3IG1B 2HBZB 2ZM6J 1Q86T 3SCIE 2YWHA 3OL6A 3BQ2A 4DL3A 4BBYA 1L3VA 5D4OA 2OUGA 2XZDB 1J2VA 4P74A 2WW4A 1IKXA 5B0BA 2ACYA 3MTKA 3JB9k 1YDLA 1X4DA 5B0AA 3LTOA 4LSNA 4Y28C 3AQOA 4QQBA 1VRQC 5C42A 4EFAC 5LOQA 1W2BR 2M3DA 3BREA 3CJ8A 2J9EA 1FVSA 3R2DJ 3PYDA 1MMNA 4CCHA 1FDAA 3GCXP 2J7WA 2E1MC 3CJQA 1ZZNA 3I4PA 2LKZA 3VCDA 1K9MT 2QV6A 3PW7A 3W5YA 2UUAF 2KB2A 5CYQB 2DJWA 5KG0A 2UXDJ 2LMIA 3KLFB 3M8SA 4J9LA 1PAUB 2B6AB 5HJXA 1X5OA 4YB5A 3L4BC 3HSDA 3JSMB 4U7CA 4C0HA 2ZFHA 1N33J 4QIVA 5IC6B 4OI2A 3A3NB 3SFGA 4USVA 4NASA 2M7SA 2QLXA 2F9DA 3FVYA 1YRTA 2HFOA 3CDUA 4ZVQB 3SQOP 2AD9A 1U4BA 4RNNA 4QBUA 1RAOA 4TYAA 3E3XA 1YJNS 3CCJS 4ZPCA 1YQHA 3ZNUA 1CEZA 2LQ9A 2ZBCA 3AA9A 3IR5B 5CCMA 3BO3A 1M1HA 4KAIA 1MMLA 1DLOB 3KLHB 4U9RA 1L5UA 1A6LA 1S9GA 2PFDA 3LP1B 4JI3F 1WEZA 3CT9A 3M2RB 1KVIA 3SBMA 4TY8B 1W2IA 2CJXB 3US5A 1TZ0A 3HVRA 4LF9F 1BY9A 3VGTA 2N7YA 4O3PA 4JI4F 4ZITA 1I94F 1CS4A 2IMOA 3GSDA 1JLGA 1T9UA 1UTAA 4CLWA 3PV8A 4CO3A 1F1BB 1IKXB 1UEVA 2PSZA 3GPAA 2VG6B 4UT4A 4ZVGA 2QN6B 1KTVA 3H42A 3QFWA 1YGYA 4LSNB 1M1KT 1VC6A 5HMZA 4V1Ak 1WHXA 4BWJA 2VONA 5C42B 3VALA 1ZA2B 1HD1A 3MMAA 4OX6A 1SJ1A 2YWFA 2WSEC 3CJ2A 2N4DA 2EWHA 3NS5A 4WYLA 4EZ9A 2WSCC 3BGFA 2JFDA 3VGSA 1UVLA 3J80Y 2CQHA 1X4AA 2QIFA 1RABB 5RUBA 2DGSA 1S1TB 4J9OA 5EUHA 4UZCA 1RHRB 3OPKA 4UOHA 4DZDA 3NMRA 1YJTA 4DUZJ 4DOZA 2J7UA 1QTNB 1B70B 2MQMA 3C66A 3JSBA 2ACMA 3EDQB 3ZZ0A 4RLEA 4CM0A 1S5ZA 5BR8J 3J81j 1MLAA 2XO7A 1GXTA 2ZZNA 4LF8J 3I96A 4M95A 3ICLA 5KFUA 4QR0A 3BS9A 2XS2A 1ZM3A 4ID5A 5GAEU 5IC4B 1BLUA 2MDAA 1V6HA 1S0NA 5KFXA 4CZCA 2CJYB 3UN3A 2HSEB 3SIPB 2BQ3A 5DG9A 1NPRA 3J7YI 4U7UK 1X4HA 1S9GB 4NYZA 5KFKA 2X1AA 4B3MJ 2NXJA 4NLTA 2DGTA 2E9TA 4OYPA 1QM9A 1WSVA 2L48A 2ROPA 2HGNA 2APOA 3QT6A 6FD1A 2RNEA 4QZVB 2CPFA 2UU9J 4LRFA 3EMTA 3KK1A 1CS4B 4B9LA 1NZ8A 4WK1A 1JLGB 1NNDA 4RU2A 3D28A 3TJ9A 2G1HA 4ZLLA 3VV2B 3G6YA 4TN2A 5AXLA 5D4LA 4RNHA 1FD8A 4PG6A 1KD1T 4C11B 2HRTA 3VZIA 4ECTA 2OO4A 4EK2A 2LEAA 1YITS 3FDSA 3MMBB 4P6QA 4A8SA 2BQRA 5KFLA 3BH6B 4X65F 4NXMF 1KDNA 2A3JA 5IS2A 3MMAB 4OZ1A 9RUBA 2CPXA 2ERRA 2AP6A 2PEHA 1PILA 4DL6A 2V63A 1CJTA 3TVKA 3W8GA 4F4XA 1CULA 3LPEA 2HYIB 1DTQA 3B6BA 2AX0A 3QGPA 4F04B 1FCAA 4F25A 4P52A 5M2RA 1H6KX 2KFYA 3IR7B 2ZWOA 1NDKA 2OAUA 4B3OB 3H5SA 3LWMA 2BJ9A 2HHTA 1BWEA 1T94A 3Q2TC 4DZ6A 4N8NA 5IXUA 3FZ2A 2PN6A 4GKJF 1WKJA 4FYYB 3HX9A 4ETXA 4ID5B 3IWLA 4D3GA 4JUZA 4TXSA 3JAMU 2IVFB 3VAMA 5KG5A 2QFIA 2UV8A 5KG1A 3UQSA 1MWZA 3TVYA 1LXNA 2YKMB 2EFOA 4LBPA 4ER8A 2R9LA 5KG2A 2EXUA 1Q95G 3MR7A 4OYBA 2L41A 3R97A 2VD3A 3OSNA 3ZZUA 4C6AA 2QC3A 3PHTA 5B0FA 2E5IA 1JNZB 4DV5F 5SZTA 4LBIA 5LMNF 4NCGA 2B9XA 1EKSA 1HNXF 2ZOFA 1U2CA 4DUTA 3CD6S 2UUCJ 2AWZA 3KK1B 4WJBA 5F9NA 4TLRA 1T95A 4OYAA 2LECA 1XR5A 3VR1A 1WSRA 2CQ4A 1KFSA 2DR7A 2CDRB 1WC3A 4B3TF 2P5VA 3Q23A 2V8VA 2RKIA 1YHQS 3NRBA 3PHEA 2LEPA 2CPJA 4MFBA 3O6QA 3HSZA 4CH0S 2E29A 2LQJA 4I1TA 1GMWD 3PEHA 2MKCA 4HT5A 4LFBJ 5KFCA 3HHLC 2ZDOA 2ZH1A 1VHFA 3R1LA 2NYIA 3HM9A 1CJTB 2G0IA 4MK8A 2KYZA 3P6YC 1KONA 3DDIA 1VOMA 8ATCB 2XQCA 1DTQB 3QRRA 4C97A 3OR1A 4K4YA 2ZH4A 3AD7C 4RW8B 1FFSB 3GIJA 4ZJOA 2R42A 3Q8YA 4ED0A 4X4TA 2GMLA 4I4BA 1RE1B 3ZC4A 1IBLF 3D0GE 5LSOA 3AOBA 4CLUA 5CAAA 1KVKA 4RW6A 2UXDF 2X1FA 5DGAA 4CLFA 3AD8C 3M9NB 4FDFA 1D9AA 3M6XA 5GADU 2MZ1A 3ZZTA 2DO0A 3OL8A 2C2NA 1U47A 4ZPVR 3KNAA 4UY8T 3CMAS 2RF2A 1NDLA 3QIDA 1N33F 1JNRB 3PX6A 3QGGA 4DR7J 4KIAA 1Q0NA 1SQGA 4MKVA 3NCQA 1UWAA 4X64F 3D4JA 2Q43A 2AJ4A 2V8GA 1QY7A 2V69A 1T11A 2L9DA 3KJQB 1U45A 4EBDA 1TUVA 4NCGB 4ZLNA 1KBRA 5KFEA 3LAKA 5A8RA 3CCMS 2WZ1A 1K47A 1C0UB 4OI3A 3KLIA 2HVEA 1UEKA 1P8GA 2HGLA 2KHDA 2M8DB 4OJHA 3FEYB 3A13A 3HHNB 4CM2A 3SQGA 4B3RF 1P9YA 5AE3A 1S6QA 3GV8B 1JKHA 2DNGA 2HG4A 4ZCMA 1JWWA 5C2CA 1BE4A 1UEUA 2R7UA 2H5IB 1NXIA 4CYUB 1HW9A 4MFBB 1EETA 3DGVA 2QE5A 1VHIA 2HIQA 1APSA 3V2UC 1TAUA 3CJSA 4MK9A 1MN9A 4DV3J 4DJBA 2O1PA 1S1UA 4Q0BA 3RBXA 1IBKJ 3UPFA 1VK8A 4Q8EA 2FLOA 2QL5B 1Q16B 3PR5B 1ICEB 3EGVA 4KE5A 5K8NA 5D77A 3I0RA 4ZCIA 4WXWA 5J1EB 2XLJA 4HTIA 1NJYA 3CD0A 4FVMA 1NB7A 1RT5B 2VBYA 3TP2A 4DBQA 1OMSA 3D2WA 2EBGA 2LLZA 2D7SA 4XO0A 2CZVC 1NHUA 2QGFB 4IG3A 1UMJA 3ZTOA 5A0YA 4RW6B 2JFKA 4C2MA 4FXVA 1VJQA 3UDCA 4DUZF 1C2PA 1O8BA 3DLLQ 1U6ZA 1YZ7A 1OQ6A 2J9CA 3RZAA 3CJ0A 2YQ3A 3VHQA 2RF2B 4LF4F 1F5BA 3M30B 1UA1A 5BR8F 1UPMB 1VJWA 3CIMA 2ZJQQ 3MZIA 2FLPA 4LF8F 5CYJA 5H9FK 4O3OA 3RBDA 1UVMA 3ITHA 2ASJA 2JJ4D 2VG5A 1FK9A 2IFXA 4F50A 1WC5A 5I4MA 4X4VA 2LA4A 1UVIA 5EWEA 2EEYA 3ETMA 3BYRA 5A8RB 3LW5C 2KKHA 3KLIB 3JXOA 5CCLA 1IUJA 3MFIA 2W7AA 4ID8A 1S77D 4LF6J 3SCKE 3JQJA 1N34F 4K7QA 3BSNA 1DY3A 4B3MF 4ZMMA 4DQQA 3SQGB 4USJC 4NCBA 1RYSA 1S6QB 1VC5A 1JXEA 1EIYB 2R8GA 1H2TZ 4P10A 3ENVA 3SDEA 3OTBA 1QJHA 2R2UA 2WOMA 4K4ZA 2OEKA 4NI2A 2UU9F 4B02A 4CLZA 4LF7J 3T1HJ 4WKYA 3GSIA 1S9FA 5D6GA 3TJ8A 3IS9A 3QAEA 5HQ8A 4KH1B 3DYAA 3NMAA 3Q22A 1S1UB 3V4MA 1FTRA 5KFQA 1M90T 4Q0BB 4WBFA 4Y2IA 2PI4A 2KT3A 1FNMA 3DXSX 1WORA 3EWGA 3H40A 2DGUA 5SUHA 4CP5A 3BPSP 4EYIB 5JVHQ 1RWMB 2O01C 3I0RB 4TQRA 4NEYA 5B09A 4DR6F 2O3DA 3V5RA 4NLWA 1MSWD 3TARA 3KDNA 1XK8A 2F9JA 1HNIA 4WZMA 1QVGR 1D3WA 1NBEB 4IG3B 3HT0A 4HDGA 2DR5A 1RB0A 1YKWA 5A0YB 1U25A 2GS8A 2AJ2A 4O3NA 3MUMP 3AB4B 1SJFA 4JB8B 4C0OC 2J8SA 2RHQB 2NLWA 1SUQA 3DGPA 1E6VA 2R7OA 2VU5A 5DZ7A 3P4UB 4OI1A 1WHVA 1TMMA 5GVQA 1GT8A 1GNKA 1SVDA 4O3SA 2JC1A 3DC2A 1QSLA 3GG1A 3ITHB 1FRLA 4LQ9A 2VG5B 3HHLA 4YOEA 1FK9B 2V2KA 2VOOA 4ZJQA 1RZMA 4WCEQ 3V81A 4GO5X 4NE9C 1NKBA 3NNCA 1P27B 2QLJB 4LR8A 3K5NA 1NCLA 5F8NA 2FJWA 3EGZA 4M1KA 1DARA 3PNIA 5BYQA 2O66A 1SKSA 4NA2A 2VC0A 3KK3A 2YQ0A 1M5OC 3HHKA 4YDXA 4WIQA 2DNYA 3GYNA 3SDEB 4EI2A 4HHJA 2V9KA 2WOMB 5DGBA 4RR5A 3PM9A 1GH8A 3CXCR 1KC8T 1FEHA 1U1LA 4DPWA 1ZPWX 3IS9B 2WBMA 1R8BA 4CI0B 1N0VC 3H98A 2FZKB 2IDLA 3MEDA 1T9YA 2QMWA 2LXFA 2MPUA 4DCJB 5DLFA 2MYFA 2QL7B 3PO4A 3D5MA 1YJVA 1VLOA 5HBMB 2Z2LA 2FQQB 4O4GA 3ZTPA 3ILLA 2KFNA 1WELA 1UAWA 5ETSA 1REVA 3CJTA 1B0PA 3R6GB 3CD7A 4LFBF 2CWXA 3KLEA 1HNIB 1CPZA 2W2PP 5HQLA 2UUWA 3HVTA 1CC8A 1FVQA 3G96A 3W9HA 2W7OA 1AFJA 1T05B 1RCXB 4PQUA 2HAIA 3ILJA 4AUKA 2V4RA 5CHCB 1SIWB 1KLNA 2FY1A 5IWAF 3KJVA 2RS8A 1OY9A 4J37A 1PG5B 1SJRA 3BKUA 2GFFA 1B0VA 1GTHA 4A46A 4OZNA 4J9QA 1H7XA 2ZBIA 4JV2A 1MWQA 3HHLB 4XTTA 3C15A 3V81B 2I8EA 4Y00A 1EZZB 3MM6B 2RVJA 1FRJA 3OTOJ 2PA3A 1N56A 1LNQA 2LQ5A 2FC8A 3HPOA 5HVHA 4ILMA 4PG8A 1Y5LB 4G6VB 3OVSA 1SCJB 1FX4A 3UD4P 1C0TA 4KKOA 2LEBA 1MG7A 4GC7A 2NPFA 1CQNA 2QA1A 4DX6A 1W7WA 1TAQA 1PKUA 2BEFA 5HK4A 3G8TA 5L1IA 2B9EA 4DPTA 2GV1A 3GV5B 3VAFA 1CLFA 5I3UA 3MEDB 3X1LB 1KTQA 1Q8IA 4FXDA 3CF5Q 4NLUA 4TLQA 3Q8VA 3SCLE 2EK1A 5DDQC 5AT1B 2EG2A 1I5OB 3C3LA 5ETKA 4O4GB 4ZPBA 2MY8A 3JTNA 2QZ8A 1WOSA 1VQPS 2E5LJ 1REVB 3KDOA 4B17A 1HYSA 1NLKL 4DV3F 4K4XA 1LOUA 3KLEB 3D6HB 2KT2A 1HARA 1HNZJ 2W1BA 1FTCA 3H7HB 2DVIA 1IBKF 1IBMJ 4N47A 2Y0BB 4NXNJ 2UXBF 5KT4A 1HBNA 3HVTB 4NLQA 2AGOA 1KNZA 3NBPA 1WI8A 1YTYA 4LFCF 4FS1A 4PQUB 2BE9B 2BANA 5KFJA 3R2CJ 5ITHA 3W60A 1MW7A 2D1CA 3EPGA 2XY7A 1UVKA 3D3BJ 3KJVB 4DV2J 1LEOA 5HJYA 3D3CJ 3AH6A 1NM2A 1F2HA 2QA4S 4O44B 2ZUGA 4M8LA 4J5OA 3THPA 1RHMB 4ED2A 2GO8A 3ET6A 3W5XA 1X4EA 1VC0A 2ROGA 3CIZA 3M6UA 1YBTA 4C8OA 1PYSB 3BSOA 4F67A 1X5SA 3EGNA 3IC1A 5FDLA 3CE8A 2XS7A 3CCLS 4MK7A 3C15B 4BC9A 4DR2J 3R3TA 1JMTA 2DITA 2GX8A 4DUYJ 2CQCA 2GQQA 1VQYA 3NAHA 5E3RA 3LA0A 3GFZA 2DT9A 4ILLA 1XMQF 2IM1A 4G1IA 1BQMA 5D0EA 2GJFA 4LREA 1PBAA 1L3TA 1C0TB 4KKOB 4YB7A 4QU7A 5AXKA 3CDWA 1VIOA 2Y8WA 4JI6J 4OL8A 3MMCB 1AYEA 4LF6F 2J9DE 5L9XA 3T19A 1FFWB 4ECXA 1Q78A 5I3UB 2YNHA 2CQPA 2YY3A 3FCWA 4PEOA 2FGOA 3AXMA 4CTAA 2ZJRQ 1YX2A 3HFZB 3PJ9A 2VFVA 3BKTA 5IQQA 1ULRA 4JI1J 3T1HF 4ED6A 4RWWA 1VQ5S 2B4UA 1J27A 3CSKA 1YK9A 4ECSA 3MOJB 2H4WB 1AXQA 4AQYF 1NSPA 1HYSB 3OD2A 2ZHOA 4X4RA 2AJFE 3EZ5A 2MQQA 4OHYA 4L6V3 4LVOP 3GIKA 3F73A 2BUNA 1HBNB 2OKQA 3VGUA 1Q4RA 1YWXA 2NSBA 6FDRA 4KRWA 2R7QA 3WDOA 3DM2B 1ZETA 5JUMA 2HK3A 3BV8A 3OLBA 1KKHA 3DOLB 2PEBA 3MPVA 2QSWA 1RAHB 2VKRA 4HEA9 5B7WA 3C16B 1R8PA 1GXUA 2R7VA 3ET6B 3D0HE 2C28A 2UUTA 1HNWF 3P3DA 2XG8A 3CCSS 2HVHA 5J1NA 4ES1A 3A1YG 5FDLB 4HI1A 3MR2A 1HWLA 2U2FA 4X4OA 3LP2A 4M5NA 5KG6A 1V3SA 2F8EX 3FK4A 1WKLA 5CABA 4QOTA 2FJAB 4DN0A 1TK8A 4EUVA 2EVZA 2B0GA 2XGPA 4ZVPB 2VJVA 5IV4A 1UPPA 2VQFJ 3ZO7A 4JI5J 3LPYA 2H5EA 3GIIA 3NCPA 3FSIA 1C1BA 3MOZA 1RLDA 4KB7A 2BKPA 1DRZA 3RB6A 2BJ1A 4FYXB 5CZVA 5EX0A 5KOXA 3CCWA 3MD1A 2AGPA 4DDFA 1FESA 2XCAA 2HNDA 2DO4A 1IR1A 3OLAA 4HKQA 3QIPA 3DI6A 1YRUA 1CSJA 1WC4A 3VF0B 3LO3A 3NGUA 2AHOB 5K8MA 2IM0A 4M5KA 1GXLA 4U6PA 1S1WA 2HPUA 1ACMB 3QWPA 3W2WA 4CTAB 3IAS9 1DFDA 1BD6A 1URRA 4TKTA 3NWRA 4R0JA 1XJWB 3B4MA 4HL9A 5J2MA 4ERDA 3Q24A 2HWIA 2FZCB 4I64A 1Y00A 3OL7A 1SV5A 3FKBA 5H1SV 1RSCA 1HBOA 4WK3A 4YDDB 1NO8A 3FCVA 4DV1J 3PX4A 4ZLPA 2WVBA 1RTIB 1D1UA 4EGLA 2XGQA 3I31A 3QQCD 1TV6A 2HRUA 3C6UA 1RWNB 3OT9A 4CWBA 2MZJA 4C9DA 4RO0A 2HVZA 4S0MA 2EK6A 3S7RA 1M5PC 4NRUA 4ANDA 1NH8A 5I42A 5HVGA 2DY1A 3TUJC 1KQKA 1FRIA 4C8LA 2KXHA 1ZAXA 4YR0A 4OJ1A 3KYLA 2MKSA 4PCQA 4B3SJ 3TZZA 1H74A 1SKUB 1DQ9A 3OHBA 2HIYA 3LP2B 2YPYA 2V8PA 4DQIA 4I68A 3SXLA 3AA8A 3UDVA 2IVYA 2E1AA 5KFDA 1QAIA 2DXFA 3OV7A 2W7PA 3OXLA 1KQFB 4YEAA 4W92B 2JVOA 1KHWA 1VDHA 1QAJA 4IOCQ 5DJBA 2X3GA 5DLGA 1C1BB 5D4NA 3RUBL 2QRRA 3NGDA 2P9CA 4TYBA 1FF2A 3CCQS 2JDJA 4DSFA 1CJVA 3J80U 3OTOF 3NXZA 1RT4A 3N6NA 2DGOA 3HHDA 2PE8A 1VQ8S 3QIPB 3DI6B 2HMIA 3I5AA 4I6WA 1FJ7A 4OZJA 1R0AA 1FKPA 1IKYA 2GMJA 3SYZA 2LU2A 3U1MA 1S1WB 1BWVA 3W2WB 2VDHA 3UNGC 4OI6A 4JI0J 2CQBA 3UR3C 3RAQA 2WCXA 4OV1A 1PYTA 4YMEA 3Q8QB 5J2MB 2EFQA 5T41A 2XSFA 4DV7J 3MAHA 4OHZA 4FF4A 3POTB 1KS2A 3KLVA 4FPIA 3W2VB 2KL8A 5D4PA 2NUHA 1SV5B 2Q79A 4LUBA 1FO1A 1HBOB 2PA8D 3KUEA 3Q8RB 2GIFA 3BGOP 3FMWA 4HYKA 2VBXA 1U48A 1TV6B 2OEJA 2FD2A 1VQ4S 3C6UB 2R2TA 1HL6A 2QLFB 1M5VC 4QYZJ 3GYGA 2VBZA 2E5LF 3S1TA 5A2QU 1EKRA 5E41A 2DNZA 2MB0B 4L75A 3TQEA 4LR7A 2ZD1A 1LW2B 3NS7B 3K2YA 2MQNA 1D9FA 1IBMF 3QBCA 2DRDA 4DQRA 1XBWA 1HWIA 3I4HX 5FLXY 4IR1A 2CNNB 3UCZP 1HA1A 2HBQB 2FPHX 4Z2XA 3HO1A 1BC6A 4NLYA 4OYZA 3AOAA 4L74A 1X7VA 3H90A 4DCOB 1R43A 2C2MB 3T1AA 2AU0A 1URNA 3FEXB 5I3QA 4PUOA 4OHWA 2DNQA 4USUA 2W4CA 4CLYA 4UF4A 3RRGA 3PX0A 4DF4A 3UCGA 1EARA 1F0XA 2OIHA 4TVAB 1R8AA 1UWBB 4PQAA 1Q1KA 5CYMB 1OY6A 2CUYA 1IM6A 2QG9B 4FKYA 3FBBA 4LVNP 1S76D 4DUYF 3K5OA 3I32A 1CJVB 3QGHA 1RT4B 2GC8A 4ATNA 4DL4A 2B56A 4EBEA 3NOCA 1AZSA 3VAGA 2HMIB 3WBZA 3BBCA 1NSQA 2ZH8A 4WYWA 1R0AB 1IKYB 3OL9A 3MTJA 4LT6A 5IT9U 4HACB 2XO6A 1KEKA 2DBBA 3OTDA 2VICA 4FN5A 4C7QA 3KG1A 1BQXA 4JI6F 2DHSA 3BM7A 3DHXA 1X8DA 4C3KA 1IN0A 2CJQA 1CJUA 1AA1B 3EVWA 2Y8YA 2ZE2A 1VS3A 3H4BA 2QA2A 3K57A 2YX1A 3PKMA 3CWJA 3QT5A 4ZN1A 4C98A 2FLLA 3SZ2A 4JI1F 2R7TA 5L39A 2HVDA 1HHQA 1XC9A 4A48A 2H9ZA 5E7OB 1A7GE 4XAKA 5D3GA 4OZ0A 3PW2A 2ZD1B 3CTRA 1NJWA 1ZM4A 1SH2A 3GWCA 1Q8LA 3MM7A 1Q53A 5IT4A 4ILRA 2FLNA 3KJNB 2V67A 2EC2A 4K4SA 2UUAJ 2IRXA 1ZTWA 3JTOA 4YUDA 3I9ZA 2DRAA 3CB4A 3MGJA 1F2GA 2MSSA 2P9GA 3VZHA 4DEZA 4PUOB 1VQMS 2YTCA 1RTHA 1N54B 2EKNA 4OI0A 2JEFA 3MM5A 2CJ9A 3UD5A 2KVIA 4UOGA 1CBKA 4Y6IA 3KK2A 3OXGA 2E1CA 1VK3A 2XNRA 4IQMA 1VI7A 2VPZB 2CVIA 3CEDA 3CCZA 4Z7YA 3NNAA 3CO0P 4K4WA 4LQ3A 1IKWA 4WE1A 2MKHA 1RWVB 1SL0A 4Y2KA 4ENOA 3D67A 5DETA 4JI5F 1AZSB 3NGKA 4K5SA 5KT7A 2FDNA 2C2KB 2F7VA 2CQIA 1S99A 4LF9J 2I5JA 3CW2C 4JI4J 4JYAF 1CJUB 1KFDA 1FWPA 2B51A 1VQSA 3M8RA 2HFUA 4WFYA 3JSYA 4A8OA 2ZE2B 4N76A 1SB6A 5A8KB 1U7LA 3EXCX 2OFHX 1VIXA 2GZOA 3BB5A 2QO3A 2K7KA 2HHPA 3FBFA 1C4CA 1NJZA 5HL7Q 5J2NA 3CJKA 2CQDA 4LSZB 2KHCA 5D3GB 2C42A 5KFGA 2FYXA 3M32A 4DV1F 4ANCA 1N4LA 5EGYA 2PIIA 3QZ8A 3F44A 4F0MA 2JH3A 2AQ4A 3TUIC 2V2ZA 4ZVHA 3F41A 1VFJA 2W2OP 2I9SA 4GVBA 2BMBA 4OX8A 4DR4F 3CDAA 5DDOC 1UZDA 3PACA 4ECUA 4YY3F 3IBWA 4F4KA 5KAKA 1WOOA 4YS2A 1RTHB 1K44A 3WIUA 4WXOA 3MM5B 2CPYA 5M2UA 5HROA 2KG0A 1VQNS 5FJ4A 3TA2A 2XSJA 2AYMA 2MKIA 3W64A 2AKWB 4E98A 1PJ6A 1GEHA 1T02A 3KUGA 3SMZA 3TEHB 1I1GA 1KOHA 1BUXA 1V3ZA 2W4DA 1R0BG 3JYTA 1NMEB 2GCFA 2HVIA 4PPDA 1IKWB 4WE1B 1EAYC 5K9FA 2YKAA 4OLOA 1N52B 2CIMA 5E3CA 5F3ZA 1F5AA 3HSJA 4QPTA 5HATA 3K5MA 3DU6A 4UQGA 2QYGA 2UVVA 1TKZA 3TA0A 3OSPA 3P45B 2ZWPA 4URSA 4M5JA 3BEGB 4QR1A 2OJ3A 3N28A 1VBKA 1GFWB 3DRRA 5HAOA 2OHDA 3TW0A 2I5JB 3TJAA 1R7IA 2FJEB 3QFHA 3S01A 1PGZA 2DGVA 4DL7A 1Y5NB 1TL4A 2DD8S 1X0PA 1TFWA 2DGQA 2VF3A 2GJIA 3GJTB 2B3TB 3FCHA 2JX2A 3CC7S 2CWKA 5D15A 3N5BA 5E3QA 4TU7A 4CLTA 1M5HA 4JI0F 3IGNA 2YX4A 4KGVB 5C25A 4X62J 1U2RA 3VAJA 1D9DA 4M5MA 4DV7F 1HHSA 1VISA 5J2NB 1PBUA 3CJKB 4DX8H 4Q45A 2QSFA 3H0PA 1BGXT 3M6VA 4ECRA 1OO0B 4F7VA 3OVAA 4C4WA 3QO9B 2OPSA 4C48A 3TUPA 1AUDA 1OYEA 3WX4A 3LALA 3GLJA 1JJCB 4GVBB 1REGX 2OPRB 3AD9C 4CLKA 2D9PA 2DEIA 2FVCA 3D7SB 2HS0A 1TQLA 4A8FA 1XNRF 3KJFB 2W9BA 3UW1A 3MCSA 5MLCV 5KFYA 3RGIA 3H2UB 5HROB 2XSJB 3C6TB 2ASLA 3J7ZT 4GKJJ 3H59A 3EJMA 4L72B 1U6FA 4NMXA 5GADI 3JYTB 3TX0A 2QYCA 3QAUA 1YRXA 2JNJA 2Q6CA 4TU8A 3VGVA 1T8EA 1AROP 2UVUA 2G0CA
chains in the Genus database with same CATH topology
3BDPA 4DR6F 2O3DA 3V5RA 2ILYA 3N01A 4NCAA 4NLWA 1DJ0A 2XCPA 1ZM2A 2RILA 1MSWD 3DDNA 3TARA 2AGQA 4R8UA 1JLCB 5KTQA 1TKZB 1XK8A 2RIJA 4BC7A 1N5QA 4ZA1A 1WD6A 2F9JA 1HNIA 4WZMA 2CPDA 1Z2LA 3MFHA 1J5OB 1JLFA 4Q5VA 1QVGR 2C3YA 5K8OA 1D3WA 4Z37A 4DV6F 4LIRA 4IG3B 3V6JA 4DSLA 2PI5A 1PC5A 1HI1A 2IBKA 4MKYA 2CG4A 4EO6A 2VPYB 3DRRB 1RT6A 2XMVA 2DNKA 2HHXA 2GMHA 4HDGA 2DR5A 5A0YB 4G1PA 3MM9A 1U25A 4O3NA 4BDPA 4I6AA 3MUMP 4R5PB 3AB4B 1QAXA 1SJFA 4ED1A 2HHWA 2X51A 3SSRA 3GZ7A 3D1HA 2YKNB 1RTIA 4KO0B 1Y7PA 2BZ2A 2IRUA 4AE5A 4R25A 1H3DA 2JZ5A 3KWMA 4C0OC 4TQSA 4DLGA 1U1OA 2ALZA 2CQ2A 2NLWA 4RBVA 1SUQA 2WB4A 3LP1A 2YH1A 4RW4A 4JV0A 5MAOA 3VAIA 1UVNA 5AXMA 1VQ6S 2U1AA 4M5DB 5KFTA 2E5HA 2VFSA 1SXLA 4MIAA 2FHKA 3OVBA 4C8MA 1UFLA 3DGPA 5HMYA 2JEJA 1E6VA 1KRPA 2RQMA 4O4RA 2B4OA 3H25A 2I1RA 2ASDA 1VRUA 4MMOA 1S79A 2XI2A 2R7OA 5KFZA 2YNGA 4OI1A 1WHVA 3B82A 4IFVB 1XERA 2HW3A 5DO2A 5GVQA 1GT8A 4Y2MA 1GNKA 3H5XA 3OJUA 4O3SA 5C25B 2WSFC 5F0WA 3I55S 3MURP 2JC1A 1VBZA 3DC2A 1FDDA 1QSLA 1LW0B 1QAYA 3GG1A 3ITHB 1FRLA 3U02A 4CH1A 3MUVP 4B9UA 4LQ9A 2VG5B 4PWDB 3HHLA 4YOEA 2G4BA 1D0EA 1FK9B 1RTDA 4OQJA 2V2KA 4TU9A 4G3IA 3M9MB 2VOOA 4WCEQ 4H4MB 3V81A 4GO5X 1Q82T 2V4JA 3BO2A 2CJKA 1RT1A 1NKBA 3UDLA 2XS5A 2C2EA 3NNCA 1P27B 2ZH2A 2HZCA 3IWXA 3K5NA 2UP1A 4OZLA 5F8NA 4RX6A 1YJUA 2FJWA 2IC3A 4WF9Q 1NHVA 3O8WA 4QWBA 3EGZA 4H4KC 4M1KA 1WF1A 1DARA 3PNIA 2VG6A 1Y0HA 5BYQA 2OPSB 2R2RA 2JLGA 1O0PA 5AE2A 2AX1A 2O66A 3MWBA 3CGIA 1SKSA 3HHEA 3G6ES 4NA2A 2VC0A 4FS2A 2DPIA 3KK3A 5FD1A 5KFHA 5E2QA 1K0TA 1M5OC 1HR0F 3HHKA 3BGRB 2I0XA 4YDXA 3V6KA 2NXUA 4YQWA 1H98A 2EPIA 3DXBA 3TX8A 2ZM6F 2DH9A 4ZKAA 1MMDA 1FRKA 1C1CB 3FSXA 3IN5A 4ZPDA 3VQTA 2DNYA 3GYNA 3SDEB 4KGMA 4HHJA 2V9KA 3HK2A 4KC5A 1YSJA 1JX4A 4X2BA 2WOMB 5T7LB 5DGBA 3J81Y 3NS6A 1H2UX 2L3MA 3GB0A 1HQUB 2M2BA 2CRLA 2W9BB 2R7RA 1HQEB 2NSCA