1S9GB

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r120394.
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
425
structure length
425
Chain Sequence
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords POL polyprotein [Contains: Reverse transcriptase]
publication title Roles of Conformational and Positional Adaptability in Structure-Based Design of TMC125-R165335 (Etravirine) and Related Non-nucleoside Reverse Transcriptase Inhibitors That Are Highly Potent and Effective against Wild-Type and Drug-Resistant HIV-1 Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 105
structure length 425
sequence length 425
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s9gB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s9gB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s9gB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s9gB03
1LWCB 1HNVB 4ZMMA 2UVWA 4WE1B 1XR7A 1C1CB 1S9EB 1EETA 1RT7B 5KFXA 1JLQA 1KLMB 5DLGA 4RU9A 2W9AA 5C24A 2R8GA 4IOBA 1J5OB 5KT7A 5F8NA 2C22A 5KT3A 4KHMA 3V6DA 4MIAA 2B43A 4ZPAA 3MFHA 5K14B 2HNZA 2YNGA 1S49A 3NBPB 3FQKA 5JXSA 1S0MA 3OLBA 4JV1A 5I3UA 3KLFA 1S6PA 3JYTA 3D28A 3IS9A 3MR3A 1RT2A 4ECTA 3MEEA 1S1VB 4NCGA 4PQUA 1HPZA 2AWZA 4F50A 1RT4A 5KFDA 3V81A 5KFMA 2UUTA 4LQ9A 4ED0A 4ZVHA 2O5DA 4NLDA 5DGBA 2IA6A 4MFBB 1VRTB 2J6TA 4O4GB 3PHEA 2UVUA 3GIMA 5J2PB 2V4RA 4WZMA 5EDWA 3GILA 1S1UA 1GX5A 4ZHRA 4ED1A 1REVB 3MEGA 3QYYA 5KFVA 5F8HA 2B5JB 3ICLA 2FLNA 4G1QA 2IC3A 4KO0A 4KHRA 3OHBA 3DOKB 4ED7A 1LWFB 4RW6B 2OPSA 3KK3A 4J9RA 4YR2A 4ECZA 3HVWA 1JX4A 4IH6A 2I1RA 2YNHB 4PUOB 2W9BB 4WYWA 2W8LA 4IFYA 2ALZA 2VG6A 4K4YA 3IGNA 4RUAA 3T1AA 5FDLB 1N5YA 2FVSA 4EBEA 4IG3B 1DTQA 1FK9A 1S1WB 2WRMA 2R2UA 3T5JA 2UVRA 3PVXA 3BGRA 1QE1B 4MFBA 4LSNA 4O4GA 4Y2CA 3Q8RB 1FKOA 4IG0B 3ISNC 4H4OB 5KFAA 1DTTA 5L1KA 2VA2A 3RB3A 3LP1B 1OS5A 1RT3A 1EP4B 2OPPB 3QGGA 4DG1B 2CJQA 4TXSA 3EZUA 4WXOA 1TL3B 3CDEA 4QWDA 4RW4A 3M9OB 4O3SA 4O44A 3T5LA 3LP0A 5CYQA 4RUCA 4J9QA 4K4WA 3H4DA 2HWHA 3PR5B 1WNEA 3BR9A 1SUQB 1ZETA 3LAKA 2W9BA 4TY8B 5J2NA 4FS1A 1I6JA 3G86A 3KHLA 3H4BA 4TQRA 4NRTA 3KNAA 4DL6A 3I0RA 4PWDB 1TV6A 2B6AB 2RKIB 3T19A 3RB6A 2BANB 4URQU 2C28A 1JLEB 1S4FA 5C25B 2R2SA 3IGVA 3N6NA 5KT2A 5T14A 2UUWA 3MECB 1JLAA 2BRLA 2D3UA 4NRUA 4URGA 1HMVA 1UWBA 3LAMA 1T03B 4F4XA 4FBTA 3G6VA 3MTKA 2D41A 2ZKUA 2AGOA 5J2QA 3CWJA 5KFIA 4TLRA 4TYAA 1BQMA 2ZE2A 5D3GB 4TY9A 1T05A 3H2LA 3DYAA 1RTHB 3I5CA 1S1TA 3PW0A 3LP2B 2GIRA 1C1BA 4ECRA 2RF2A 1RTDA 5EUHA 4I2QA 5DGAA 3IRXB 3CDWA 1SV5A 4ECVA 4TY8A 4B3OA 2HNYA 2V9WA 3M8PA 4IKAA 1NHVA 4K4XA 1IKXA 4ZVFA 2OPRB 4ZVEA 2ASDA 4R8UA 5J1EB 2AX0A 5KFBA 2HAIA 2BANA 4EO8A 3KOAA 1TVRB 3KJVA 3QLHA 1RTIB 3G6YA 3KK1A 2JC0A 5KFGA 1K1QA 4M95A 1R0AB 2ZD1A 3PW2A 3M8QB 1SH2A 2OPQA 5KT5A 5KFJA 2WOMA 3NMAA 3KLIB 4RNHA 1S97A 1S0OA 3G6XA 3KHRA 4EBCA 1RTHA 4YQWA 1HYSA 5KG1A 4RZRA 3T5KA 3GV8B 4RNNA 2JLEA 3V4IB 3RBEA 2IJFA 2VA3A 3M9NB 4Q0BB 2GIQA 2XWYA 5KFLA 4ZPDA 3KHGA 5I42A 1DLOA 4K4SA 5DQGA 2YNIA 4NLXA 2BQRA 2OPRA 4IFVB 2DPIA 3NL0A 5F8JA 2C2RA 4DL7A 2XCPA 4H4MB 1C0UB 3QGHA 4NLUA 3CO9A 2WTFA 3CJ0A 4LSLB 4IH7A 1JLFB 3HVTA 5EWEA 4R5PB 4YR0A 4I2PA 2BE2A 3DLKA 2IBKA 3IN5A 1MU2B 4RNOA 4IDKB 3FQLA 2W8KA 1RT1B 2YNFB 3QO9A 3OSNA 2DPJA 2YKMB 3D5MA 4XPEA 1BQNA 2HMIA 1RDRA 1S10A 3CVKA 4WXWA 2AX1A 4DL4A 2R2RA 3DOLB 3V4IA 4O3OA 2RDJA 3TQ1A 3OL7A 1JLCB 4Y34A 1TL1B 3FFIB 1LWCA 1HNVA 2R8HA 3SI8A 4WE1A 4IFVA 1S1XB 1C1CA 1S9EA 3ITHB 1GX6A 1RT7A 1KLMA 3NAIA 4JV0A 4QW9A 1FKPB 1J5OA 3CDUA 1C0UA 3HKWA 5KFNA 3UPFA 3BSAA 1TKZB 3I5BA 4R0EA 3H98A 5L1JA 3DRSB 5CYMB 1JLFA 5K14A 4DL2A 5HROB 1KHVA 3NBPA 5KG3A 4YMEA 3FSIA 2FJVA 1W25A 2JEIA 3EPIA 1QAIA 2XCAA 1S1VA 3VQSA 3V6HA 5KFOA 3JSMB 3H5YA 5KFEA 2IM0A 2EC0A 1D1UA 4NLSA 5KFRA 5F8GA 4FS2A 4LQ3A 2WONB 1QAJA 2FJXA 1YVFA 1VRTA 2ILYA 5J2PA 2FJWA 1RTJB 5DQHA 2W7OA 3C6TB 2W7PA 5KFFA 3DM2B 1RT6B 1TL1A 1REVA 3GV7B 4JV2A 4EYIB 1TQLA 4I7FB 1RA6A 1CSJA 2C2DA 4Y2AA 5DG9A 4O3PA 2B5JA 2JEJA 1IKWB 3DOKA 3MR2A 1LWFA 3DLGB 4KFBB 4RW6A 5DQIA 2R8KA 2I5JB 5CYMA 3DRPB 1C0TB 3C6UB 3DI6B 2WCXA 3GYNA 4JUZA 5F8LA 2HNDB 2YNHA 4KSEB 1N6QB 4PUOA 3KMSA 2F8EX 4F4ZA 1S0NA 2XGPA 4ZVGA 3GIKA 3NKYA 1LW0B 1JLBB 3V6JA 5HLFB 5FDLA 4IG3A 1S1WA 3DRRB 5EWFA 3PW4A 4KV8B 4Y3CA 5KFPA 2BQUA 4K4UA 1QE1A 3MR5A 4J9LA 3V6KA 3LANA 3DLEB 5J2MB 4H4OA 3MEDB 4IG0A 5JUMA 1ZTTA 5KG0A 3UQSA 4DEZA 3LP1A 4FBUA 4IR1A 4ID5B 4G3IA 1TKTB 1EP4A 1S9GB 2OPPA 4DG1A 3EPGA 4I7FA 5C5JA 3LALA 4ED6A 2C2EA 1TL3A 5F8IA 1N4LA 1S6QB 3DLGA 5KT6A 4ICLB 2I5JA 3OL9A 5HBMB 1D0EA 1XR6A 1LW2B 2WB4A 4NLPA 1SUQA 3UR0A 5KFKA 4ZP8A 1JKHB 4HYKA 2HNDA 3E01B 2VG5B 4RW8B 4KAIA 3RB4A 3NGDA 4DL3A 2W9CB 2HWIA 3QGIA 1JLGB 5KFTA 5DLFA 2CKWA 4EBDA 4PWDA 2B6AA 2RKIA 3DRRA 1RA7A 4RNMA 4QWCA 4X2BA 1JLEA 1HQUB 4ECQA 5HP1B 5EWGA 5C25A 4MKBA 1NHUA 4EYHB 1HQEB 4EO6A 2YKNB 3MECA 4RW9B 3CJ3A 1T03A 3BSCA 3TAMB 2FVRA 5F9NA 2IM2A 4ZP7A 2AGPA 1LWEB 2QE5A 3HHKA 2IAJB 5KG5A 4J9OA 1SH0A 5D3GA 3MR6A 1IKVB 4K4VA 4TYBA 1IKYB 3KLGB 3KLEB 2XC9A 4O3NA 3LP2A 4DL5A 2VG7B 2R2TA 3SFGA 1LW2A 1VRUB 1JKHA 5C24B 3IRXA 4NZ0A 4U6PA 4IR9A 3V6DB 4MK8A 2HNZB 2YNGB 3ISND 2R8JA 4IH5A 5J1EA 4KKOB 1NNDA 5I3UB 1S6PB 3IS9B 4IRDA 1RT2B 5KFYA 1TVRA 4J9MA 3MEEB 1RTIA 4NCGB 4PQUB 4F4WA 1HPZB 3DMJB 1RT4B 4NLQA 5KFCA 2E9ZA 4TQSA 1R0AA 4GC7A 3M8QA 3KLVA 1XR5A 2E9TA 3KMQA 4MK9A 1S1UB 5KG4A 4ZHRB 3KLIA 2BQ3A 1IKYA 3KLGA 3MEGB 2ASJA 1TP7A 4KB7A 2VG7A 3BQ1A 2R8IA 1VRUA 3RAQA 1N56A 4XO0A 4Q0BA 3DDKA 4G1QB 2IC3B 4KO0B 4IRKA 2ATLA 4Q43A 3QZ7A 3KK3B 2OPSB 3HVAA 2JEFA 2AQ4A 2D3ZA 3BSNA 3KK2B 4IRCA 3IG1B 1RYRA 3CJ4A 4KKOA 3H5XA 4URSA 4H4MA 4K4ZA 4IFYB 3MF5A 4NLYA 2VG6B 4RW7B 2FVCA 2IJNA 3BQ2A 4LSLA 3TVKA 3Q8SB 1N5YB 1HARA 3DMJA 1DTQB 1FK9B 4R5PA 4K50A 1N48A 4O3QA 5F8MA 5L1IA 1MU2A 1S48A 3BGRB 5L9XA 4IDKA 3QIDA 4Q44A 3GIIA 1RT1A 4LSNB 2YNFA 2RDIA 5L1LA 2FVQA 1FKOB 4MIBA 1DTTB 3I0SB 4J9SA 4J9NA 1RYSA 2YKMA 4NLTA 1RT3B 4MKAA 4ZP9A 2QV6A 4O4RA 4ECXA 2JC1A 4QWBA 3DOLA 1Z4UA 3CIZA 4RW4B 1JLCA 3E51A 1MMLA 4O44B 3H5SA 4Q8EA 3FFIA 3LP0B 5CYQB 4WYLA 4MK7A 4KE5A 1S1XA 3KK2A 3ITHA 3IG1A 3PJXA 3BJYA 2JEGA 4QWAA 1FKPA 4ED3A 5J2NB 4H54A 2FVPA 1T94A 1TKZA 4ZP6A 4RW7A 4QPXA 3N6MA 2FLPA 3DRSA 3PZPA 5HROA 4ED8A 3I0RB 4NLWA 3I5AA 1TV6B 4O3RA 4TN2A 4QW8A 5DG7A 5KG7A 3GV5B 3BQ0A 1T3NA 3GQCA 4J9KA 3QIPB 5C42B 4WFZA 3JSMA 4WFYA 3I0SA 4J9PA 1JLAB 3KLHB 1IM4A 1HMVB 1UWBB 1RT5B 2WONA 3CJ5A 2XI3A 5KFWA 1KHWA 4ZPCA 3PW5A 5J2QB 1RTJA 4Q45A 1BQMB 2ZE2B 3C6TA 5KFQA 2XGQA 3MFIA 3DM2A 1RT6A 1T05B 2BRKA 3DYAB 4RNFA 3BSOA 2V4QA 1SH3A 1S1TB 1HNIB 4NLRA 3UDLA 1C1BB 2RF2B 1RTDB 1U09A 1IKWA 4I2QB 2ASLA 1SV5B 3SFUA 4B3OB 2HNYB 3M8PB 4GC6A 3N6LA 4KFBA 4NLGA 1IKXB 3DRPA 1C0TA 3FRZA 4R8UB 3PR4A 3OSPA 3C6UA 1TKXB 3DI6A 3OLAA 2AU0A 5DG8A 1N6QA 5KFSA 4ED2A 3KJVB 1LW0A 3QLHB 3QIPA 2ILZA 1JLBA 1ZTWA 1JIHA 5C42A 5HLFA 3KK1B 3CJ2A 5F9LA 5KG2A 3RBDA 3KLHA 2ZD1B 4KV8A 1RT5A 1K1SA 4WFXA 4IQXA 1S9FA 2OPQB 3PJWA 4NYZA 5J2MA 3DLEA 2IM1A 3MEDA 2WOMB 3QZ8A 1RAJA 4ID5A 5KFUA 1TKTA 1JXLA 1S9GA 3OL8A 1HNIA 1HYSB 3H40A 4ECUA 4OL8A 4WZQA 3OHAA 4ECWA 2BR0A 3PW7A 1C2PA 2E9RX 2WHOA 1S6QA 5I42B 1DLOB 4ICLA 3Q8PB 2AGQA 2YNIB 4F4YA 4NLOA 3RAXA 2OH2A 4YP3A 5HBMA 1EETB 3GIJA 2J6SA 2UVVA 1JLQB 1TKXA 2J6UA 4RW8A 3E01A 2VG5A 5KFZA 3Q8QB 4ECSA 4NLVA 4KBIA 2IMWP 3H5UA 2D7SA 4M94A 3FDSA 2WK4A 2XI2A 1JLGA 2W9CA 3HVTB 2GC8A 3NAHA 4K4TA 3T5HA 3OL6A 4I2PB 2BE2B 3DLKB 3KLFB 4QWEA 3JYTB 3RB0A 3H59A 1HQUA 4Q8FA 5HP1A 1QUVA 4ZPBA 4YR3A 3QO9B 3KHHA 1HQEA 2YKNA 4RW9A 3V81B 1BQNB 2HMIB 5KG6A 3TAMA 4HKQA 5KFHA 4ECYA 3M9MB 2IM3A 3BREA 5KT4A 4EEYA 1LWEA 2V0NA 4U7CA 2IAJA 2FLLA 1IKVA 4MH8A 3KLEA 4XPCA
chains in the Genus database with same CATH superfamily
1G4CA 4IOBA 1M1KT 2DYAA 2HVZA 3OLBA 1X4FA 3EZOA 1WDTA 2O5DA 4PG6A 2RUGA 3ILJA 4JB8B 2V69A 2V94A 1VBXA 3HI9A 3G8QA 5F8HA 3GJRB 3IAS9 4X4UA 1Q8BA 2QL7B 1YBUA 5E3QA 2VG6A 3OQ2A 3IGNA 4RUAA 3N01A 2IRXA 2WVEA 3BGRA 5D6GA 3GJQB 3J7YI 2ZM6F 2DJWA 1S59A 1UEVA 2R7WA 1VLOA 3H4DA 2ACYA 4DCOB 3J7Z5 2BANB 3MM9A 1KNZA 3ENVA 5CA5A 2Z56B 4DUTA 3VQTA 3QRRA 4JI2F 1A6LA 3CF5Q 1BLUA 3FZ2A 2RF2A 3MUMP 3IRXB 8ATCB 1FA0A 2ZNZA 2R7TA 1U02A 4ZVEA 1L3SA 3CGIA 3MZIA 3OTOJ 2RRNA 3KLIB 4YQWA 5KG1A 4RZRA 2CNNB 3NCPA 4WPAA 3HP6A 3O5TB 2GIQA 1LEOA 5K8OA 1DQ8A 1HD0A 4DL7A 1B4SA 4UF4A 4DV5J 2HHPA 1YZ6A 3ETOA 1X4GA 4BWMA 5H9EK 1RT1B 1BMQB 2JJ4D 3VVTA 3OFHA 5E3PA 3G96A 2MKKA 4DV6J 2RDJA 1ZBTA 3PKMA 3GCWP 1ZPVA 3W7BA 2YQ0A 4K0KJ 3ITHB 2KVIA 5M2RA 3K8VA 3R6LB 1WACA 2DISA 3AODA 1W25A 2JEIA 3AOBA 3I96A 4LIRA 4DSKA 2UUBJ 2W7OA 2C3PA 3I82A 1WSVA 2AZ1A 4DSIA 4XDCA 1V9OA 3DRPB 3ILLA 2XGPA 3M6WA 4YS2A 5HLFB 3D67A 4DPXA 3SBMA 1UEUA 3M05A 3RTVA 1TK0A 4TU9A 2KFYA 3EGVA 5M2UA 4YB6A 4ICLB 3ONQA 1N8RT 3NS5A 1D0EA 4Y2IA 3E01B 3CT9A 1IR1A 2MQNA 1UJ4A 1CC8A 1PJ6A 2JNJA 3FUYA 4JI1J 1KKHA 1S72S 3HHKA 2FJAB 4KH0B 3OVSA 2DB1A 3KLEB 1SC4B 4NZ7A 4IUFA 3IRXA 2E5LF 2BJEA 4ENOA 4PZVA 4UOHA 4DR6F 3GE9A 4DS5A 2VFTA 4HH0A 1RT2B 3Q22A 4IO9Q 2XULA 1XR5A 1U25A 2NQPA 4ZVRB 3KLIA 2YX4A 3MEGB 1KVKA 1U47A 2XMMA 3KUEA 3BQ1A 2WSCC 3OXGA 2PI4A 3KFWX 3LGMA 3BSNA 5GAGU 4A8XA 5AE2A 1TTHB 1W7WA 4B3RJ 4FP9A 1SKSA 1FK9B 4J7CA 2AV5A 1RT1A 3I9V9 1Q7YT 1URRA 2NUHA 1Y5IB 4LF4J 4RL1A 1HBNB 3J7A1 3ITHA 2V8VA 1EKSA 5L46A 2A6OA 3GCXP 1JB0C 3PZPA 2ZOGA 1WOOA 4M5IA 2BJ7A 1UZHA 6FD1A 2BE9B 3K5NA 4WFZA 5THWA 4JV5J 3KLHB 1TL5A 5HVFA 1HMVB 2D9PA 3VWSA 1NK6A 5KFQA 4M5DA 3DYAB 4P2XA 4A8WA 2AEMA 4HDGA 2UXBJ 2FJDB 3DRPA 4R8UB 2XEXA 3DLBA 3I55S 3OFEA 4KTQA 1H2TZ 5HLFA 1VHIA 2DEJA 1APSA 1RT5A 2OPQB 1Y7PA 3HHLC 4QYRA 5HMXA 1NH8A 1XBWA 2QX0A 2VODA 1LFWA 1H3DA 3V5RA 3TUJC 1C2PA 3Q8PB 4ICLA 3D7SB 4MIWA 2HGLA 3OR1B 3E01A 4UUXA 1NCLA 2N7CA 4QWEA 3BBFA 4YR3A 4FVCA 1BQNB 5GMEA 5HL7Q 4ECYA 5KFHA 1ZM3A 3M9MB 2DNZA 3KLEA 2JHEA 4WE1B 2GX8A 3HX9A 2W9AA 4I68A 2C22A 2F1FA 1M5SA 3KLFA 3D28A 1RT2A 3UDVA 5HMYA 1M5KC 2XB2D 2IA6A 1WEXA 3PHEA 5AJ3J 3MEGA 1KVJA 2FY1A 5I3QA 1LWFB 3S6EA 2DR6A 4DPUA 1YJNS 3R5JB 1WUUA 2PE8A 2FVSA 5DO2A 5A8WA 1FK9A 2UVRA 3HHEA 3TW0A 2VB6A 4DQRA 2KO1A 3F41A 4TXSA 1SQFA 3NCQA 3TARA 4A46A 3WIUA 4LFBJ 3D1HA 3ULHA 1F3FA 2HHXA 4IO1A 3H90A 1TELA 4DR7J 3P96A 2R2SA 4Q7AA 1HMVA 4UZBA 2K8GA 2QN6B 2AGOA 3T6BA 3DYAA 4PYDA 4WKYA 1SL2A 4YHHF 4ZDNA 4OYXA 2KXFA 4R8UA 3TI0A 2HAIA 2DHHA 2A18A 2OPQA 1PO6A 1K44A 3OJSA 4JI5J 2ZWOA 2RHSB 2RH3A 2AJ1A 4AE5A 4Q0BB 2VPYB 1HHSA 3UCGA 4IFVB 3OR1A 1R8CA 4MT1A 3HVRA 1YRXA 2V68A 4CM2A 1RCXB 3NOGA 1K0VA 3IN5A 2CQ4A 2GS8A 1GMVA 3BGLA 1K9MT 4M5KA 1LXNA 1BQNA 3EGZA 4A4JA 2AYBA 3QJJA 2M70A 2DY9A 4RWWA 4WE1A 1C4AA 2BM0A 4HVZA 2BVZA 4JI3F 2Z2LA 2C2MB 2MLYA 3BSAA 4R0EA 2H51B 2YH0A 3NS7B 3ZXWA 4AQYJ 2YX1A 5KG3A 3EGWB 3RU0A 1OYEA 3PRBA 4ES3A 2ZH1A 1IJFB 4FS2A 1FWKA 5DQHA 2ZOFA 3CCES 2DO0A 4J5OA 1LWFA 4FVMA 4DZ6A 2KI2A 2HFVA 3MEDB 3UQSA 4ZJQA 3M2UB 8AT1B 2YQ1A 5L39A 2R7QA 3QWUA 1RAOA 3ILIA 2I5JA 3BF4A 2UXDF 1XR6A 3UR0A 2H4WB 2M2BA 4RLEA 2MQ8A 1RWPB 4X62J 3MDFA 3SXLA 2FVRA 1Q79A 3O44A 4BC9A 2OGUA 2ZBRA 2Y1JA 3QRQA 4GC7A 1X0FA 3VVUA 5IT4A 2GMJA 3W65A 5IM0B 4LSZB 4Q0BA 2ZUAA 2L9DA 2XSJB 2D3ZA 4WKRA 3AQPA 2M3DA 4JOUA 3RRKA 1B0VA 4O3QA 1MROB 4Q44A 2VBZA 4LSNB 4C8OA 2MJUA 4PCQA 5F41A 3AHPA 4Q2MA 2H1YA 4XK8C 5CYQB 4OZ2A 4KE5A 2YKAA 2XYGB 4ED3A 3M8RA 4ED8A 3JQJA 1KQFB 4HH1A 3TANA 3TX8A 3AD9C 2HG4A 4EGLA 4C0OC 2V4QA 3NEKA 1RTDB 1U09A 4Y2MA 5CYJA 4OHVA 3TRGA 1U1KA 1TKXB 2QYCA 2EVZA 4LBHA 5F9LA 3ZTRA 4IQXA 1G6BA 4NX9A 2WW8A 3MEDA 5KFUA 3MAQA 3M2UA 2HHTA 1KVIA 2HSEB 4OIXA 1Q8LA 4NLOA 2DCUB 2MMYA 3HVTB 2DY1A 4JI4J 4BLGA 2AEFA 1XERA 1FNOA 3R7SB 3C3LA 2BW7A 1AA1B 4OHZA 2JRSA 2PFDA 2KZZA 2K7JA 4KHMA 2VUGA 1QAXA 1SQGA 4OX9F 1X8DA 2VPWB 4F4KA 1WKJA 3CJ8A 4ZVHA 4O4GB 4DUZJ 2Z4PA 4ED1A 3VCDA 4JBCA 5IM0A 3QYYA 3ZNUA 1D09B 2XSJA 4FNIA 3UN5A 4J9RA 4YR2A 3MXHP 4UW2A 4IH6A 2H65B 3W9HA 2G9OA 2RU3A 1BXNA 4K4YA 5CHCB 3LO3A 4DL0C 4FF2A 4DQSA 3K8WA 1MROA 4LSNA 1SVDA 2VH7A 2HS4A 3AA9A 3T5LA 5CYQA 3QT5A 5AXNA 2DGTA 4ZLLA 1FJGF 3H4BA 4TQRA 5DDOC 1JLEB 2OSQA 1UCNA 1ZM4A 1RHRB 1AT1B 3CWJA 3OW2R 1CLFA 1A7GE 4LFCF 4LF7F 5K9FA 1RTDA 2HGNA 3VAHA 2H5JB 1QD1A 2PEBA 1GTEA 4HHJA 1OSCA 3VGUA 4FKXA 1R31A 1VQSA 3PEHA 3DFEA 2XS7A 1HNZJ 4CLWA 4DR1J 1AUSL 3TA2A 3D6FB 3SSQA 2D9OA 1IWAA 1FVQA 2V2QA 1N34J 3HVTA 4R5PB 1ZAXA 2N4DA 5LMUF 1VK3A 3UR3C 2C2ZB 1WELA 2Z0GA 1RLCL 3DRYA 3BKUA 3RRGA 1JLFA 2HVHA 5IT9Y 2MYFA 4PQAA 1IM6A 5K20B 3V6HA 5ETQA 2GVDB 2ILYA 4M5GA 4C0BA 3QJPA 4CLPA 3OTBA 4KGKA 5DG9A 1Q95G 4U9RA 3J81Y 3Q89A 5DQIA 1T9UA 1IUJA 2ZH5A 1VQYA 2QA4G 1S0NA 4KHPF 1R43A 1X4EA 2F8HA 4DXLA 2F63A 4NCBA 4DV7F 4MAKA 4F8RA 2CNLB 1FD2A 1VQNS 4OQJA 2J76E 2VG5B 1T9XA 2D69A 2IYIA 5DLFA 3ZZZA 1RA7A 2DGWA 1XQIA 1JLEA 5GAEU 1EHWA 4C8NA 4X66F 6AT1B 1LWEB 2QE5A 3R1LA 2ROPA 4TYBA 1D9FA 2VG7B 4B9VA 1O6XA 1JKHA 4NZ0A 1TK8A 4DR3J 2ZHOA 2W7AA 3WDOA 3ISND 2MDAA 2R8JA 4UY85 4EFAC 1FFGB 4J9MA 1SKUB 2HFZA 2KT5A 1X4DA 5E7OB 1S1UB 2BQ3A 4NL5A 3AD8C 2R8IA 4ZCKA 3D1OA 5HQ8A 2FHMA 1T9WA 4JI8J 2XMKA 3PEJA 4R5PA 1PYOB 1P8GA 4KPCA 1S6UA 4MKAA 3OTCA 2NUUG 4Y00A 1CG2A 1YJTA 4O44B 3H5SA 5EX3A 3TOQA 4C6AA 2ASYA 1U4BA 4QWAA 1LK5A 3QT8A 3EXCX 1VC0A 3CCMS 3QIPB 4X4PA 4KGVB 1M5OC 1KSPA 4C3MA 1NB7A 1MLAA 1WC1A 4RR5A 2RQ4A 4I2QB 2BKPA 1DQAA 2F9JA 2J0SD 5G0RB 1ZTWA 5C42A 4E8UA 1YRTA 3THVA 2JVRA 3HPOA 3QSYB 3C66A 3ZZUA 3CCZA 1DY3A 3PFEA 5IQ6A 1UVJA 3I32A 2UVVA 2UU9J 2VG5A 1NKCA 3DHXA 4NLVA 4KBIA 2JL9A 4U8YA 3JYTB 2XSFA 4UUWA 1K0TA 2CYYA 3EVMA 5KG6A 3FCWA 4QYZJ 1LNQA 1LWEA 5FLXU 4X4VA 3HDSA 4U8VA 2R4FA 3CNQP 1UL3A 2RDDA 4QJVA 4QIEA 2QLXA 2ZVSA 2DK2A 2NCKL 1T02A 2HHHJ 3QAUA 3V81A 1B70B 1MWZA 1X5TA 3W61A 1S1UA 5ADZA 5KFVA 3MD3A 2J0XA 1N33J 1TL7B 1HR0J 1J27A 1ZM9A 5KFAA 3LP1B 3EX7B 4WXOA 2BX6A 1KQSR 4O44A 1ZZFA 5HJYA 5BR8J 1YJRA 4TY8B 1UETA 1AXQA 3KNAA 3FSXA 3I9ZA 2DNOA 4URGA 2BRLA 5LJ3Y 3LAMA 1UPMB 4FN5A 3I5CA 2DNGA 4I2QA 2IA0A 1NUEA 2DGUA 1QDUB 2XLIA 1FRIA 3BYRA 2FIUA 5G0RA 3OT9A 1YBAA 2AJ0A 4CLKA 2AYMA 3EZ5A 4WK3A 3ENAA 1D3WA 1S57A 3PX0A 2CQ1A 5B09A 3MM6B 4OI2A 4DX5A 2BQRA 3JAMU 1R3NA 1FTRA 4NLUA 3LF0A 2DD8S 4ZPVR 1YWXA 5IS2A 4DLGA 2RRBA 3TJ9A 3RJMB 4KY3A 3S8SA 4QOTA 1S1XB 3R8YA 3SQGB 2ZEJA 4CO5A 4DL2A 4JI6J 3TZXA 1DARA 2W2OP 2FDNA 3BYPA 1QAJA 4QZVB 1FWPA 2ZFHA 2MQLA 1S4EA 3VV2B 1CSJA 1W26A 2VJVA 3ZZPA 3JTOA 5LMNF 5HO4A 1N6QB 1TL7A 4IOAQ 4LF8F 2Z58B 5E3CA 2FYXA 2QEXS 1LFPA 2UUAJ 2E66A 3LP1A 2GHPA 3EPGA 3AJDA 2C2EA 3RBXA 2VQEF 3DU5A 3CJKB 2LVWA 2PN6A 4YY3F 3J7ZT 3DLHA 4AL5A 3ZTOA 4GC6A 2HNDA 2EBGA 3SDEA 1VIOA 3RB4A 5GMDA 2LQ5A 2CKWA 1ITPA 2NXCA 1UVLA 4RWXA 5HP1B 4I6YA 2CG8A 2CVIA 2HFOA 2MY8A 4ZLNA 3BV8A 2QFJA 2E1CA 2AGPA 3M6XA 5KG5A 2ZJRQ 5L9NA 3MI7X 3GJSB 1OJ4A 2HURA 3UVJB 4PWUA 1OSDA 2A1BA 5B0CA 4DUYF 2E9ZA 4E2FB 3R6GB 3S1TA 3CB4A 3R2CJ 3SCKE 3N9UC 1VQ7S 3GFZA 4TLQA 3D1QA 3MM6A 1EIYB 2HEKA 4AT1B 1NSAA 3D66A 2JWNA 3FBCA 3PYFA 5EHHA 1GFWB 2GVZB 2VDIA 3NGKA 1FRKA 5DM6Q 4I67A 5E0OA 1X31C 2ZZTA 1S1XA 1XMOJ 1NB2A 2D1CA 3IG1A 4ILLA 2JEGA 1YG0A 3SQGA 4H54A 1Z1ZA 1SKWA 2Y1RI 2QLWA 2FZCB 2BJ8A 3GQCA 1XWLA 3QSIA 1PIEA 4DCPB 1UWBB 3CJ5A 3WC2A 4BCAA 2E5GA 2CJYB 3PG9A 5B0EA 1UVNA 4OZ3A 1VBKA 1N6QA 2ZKTA 2L3MA 3F0NA 1FFSB 1BC6A 3TJAA 2CJKA 5M2PA 3JB9k 2XNRA 1OWXA 1HYSB 2VKZG 4CLYA 2B56A 1ZS6A 3CJKA 1Q8IA 4OHYA 1DLOB 3VAKA 1SJ1A 5AE3A 2AYGA 2BEFA 3O6QA 2WK4A 5L8RC 4NA1A 2FTRA 3E3XA 4CTAB 1FNXH 1RWVB 3H59A 5HP1A 3DGPB 5B0AA 1EKRA 1QSSA 4LF6J 3NOCA 3HD1A 2EI5A 4ZJLA 1G7CB 4ZMMA 3VTIA 4EZ6A 5B0FA 2YWWA 3AJ2A 5KT7A 3PIOQ 4ZPAA 2J0QD 5HI7A 3UVJA 3DXBA 2GQCA 3U1NA 4C8LA 4ZVPB 3N5FA 5KFDA 4NMLA 2ZITA 4L6V3 2KVQE 2W2NP 1VRTB 5EDWA 2HFUA 2GGPB 2HQGA 2Z2MA 3R7BB 4LRCA 2C3OA 1Z2ZA 2W2QP 4RO0A 1VLYA 4PUOB 1Q78A 3W1YC 1TMJA 3NNAA 2V6AA 3GLJA 2GVZA 3EZUA 2MHNA 2ZC4A 1TMMA 2IDLA 2HWHA 3D0HE 2FZKB 3IR7B 2LDYA 3SSSA 5KAKA 1S4FA 1X9WA 3N6NA 1WI8A 1UWBA 1QTNB 3G6VA 2QG9B 5CZXA 5KFIA 2B51A 5I3PA 1Q53A 4CH7A 3NWGA 4ECVA 4ZVFA 1Q4RA 1JWWA 2CJBA 4EO8A 3R5BA 1KQKA 2JC0A 1R0AB 1U2CA 3ZZOA 1S97A 3DHWC 1RTHA 1AUDA 1NHKL 2FY8A 1HYSA 3T5KA 2MTLA 4ZPDA 4B3TJ 2G13A 1DLOA 2OPRA 1IQTA 1RSCA 4OZ0A 2YKQA 1J5EJ 4YR0A 2OIHA 3K0JA 4CTAA 2LXIA 3IRWP 2MPUA 3CTRA 2XTJP 3FC9A 3CVKA 3HSDA 2RQMA 4O3OA 1RAAB 2R8HA 2M52A 1U1NA 4P75A 1CQNA 5E2QA 4PPZA 1T0TV 3M4XA 1SI9A 2K3IA 1VRTA 2UXCJ 5ITHA 1RU2A 5ETKA 1FXDA 4JV2A 3GIRA 4WTYA 1TQLA 2X3DA 4Y2AA 2W24A 3VGTA 1IKWB 1BWVA 3AAWB 1TUWA 3DI6B 4JUZA 4TU8A 4PUOA 3QQCD 2JLFA 1SC6A 4QBUA 3PW4A 3QGPA 2GHWA 1ZAWA 4LBIA 1V5IB 1XNQJ 3Q86A 5EGYA 3M1VB 2YBVA 3DLGA 2FD2A 2J9EA 2CA9A 4NYOA 2RQCA 4YDDB 4ELUA 1LQ9A 4QWCA 1N32J 2DNPA 1HQEB 3SZ2A 4WTOB 4U67Q 1H72C 3PYDA 1GXLA 1HBOB 2JX2A 5MLCV 2I9SA 2L9WA 4V1Ak 2QL9B 2P8IA 3FBFA 2RILA 4CO4A 4KGZB 3POTA 4PRFA 2NR0A 3K2YA 1T11A 3B4DA 5D0RA 5KFYA 4N8NA 2KB2A 4NCGB 1YX2A 1DFDA 1I94J 3QPIA 1R0AA 4TQSA 3WIVA 2HQDA 2CWXA 5D4LA 4HACB 7AT1B 4K5RA 4MKYA 1SJ3P 2CAJA 3MCMA 4XO0A 1WC0A 2C3MA 4P7VA 1U24A 1N36J 4IFYB 3MF5A 3Q8SB 2YXLA 1W2BR 1IBLF 5F8MA 3QIDA 1QJHA 1LWXA 2EXUA 1ZA1B 2QSWA 4J9NA 1RYSA 2QJ3A 2CPFA 1WORA 4LVOP 3CIZA 2QC3A 4ZCMA 4MK7A 3IM8A 3KK2A 2VPXB 2FVPA 4ZP6A 2O01C 2VQFJ 5JMNA 4NLWA 3X3UA 1S99A 1SKRA 4J9KA 1B64A 5ETVA 4DV3F 1QUPA 4Q45A 1NDLA 3Q2TC 2E7WA 1WTFA 1IKWA 3M8PB 3MR7A 1Q5VA 4ES1A 4XAKA 5D15A 2NZ4A 3DI6A 5ETOA 1FT8A 4QU7A 3KK1B 1X4BA 4DMZA 1F5CA 3KUHA 2DXEA 1UFWA 4B9LA 3WQPA 2ROGA 1HNXF 3M1VA 2QRRA 1TU0B 1F6TA 5I42B 4F02A 4Y0FA 1NK7A 1FJ7A 4ECSA 2RAQA 4BHQA 1HQEA 3W5XA 4I6AA 2FJEB 1HQ2A 1WKKA 2PSZA 1YLXA 2HW3A 4B9SA 1UPPA 3NMRA 1VMBA 2V8PA 3NXZA 5DLGA 3OUYB 2IMOA 1GT8A 3LWLA 2E7VA 4ZLJA 2XBPA 4JV1A 4DQIA 3PTWA 1G1XA 2IVYA 1SC3B 3W9JA 4NCGA 2XO6A 2E1RA 2CPJA 2W4PA 3D68A 2VZ9A 3L9ZA 1M5HA 4HACA 3HFZB 2CQ0A 4WIQA 3KG1A 3EYZA 1VGYA 3O8WA 3B4MA 3CSKA 3W9IA 4ERDA 2Y8WA 2W8LA 4IFYA 2ALZA 4F67A 4ZITA 5FDLB 3PVXA 2QT7A 2KM8B 1CC7A 2OPPB 3QGGA 4DG1B 4C0HA 2XO7A 2VHGA 4C7QA 5HATA 1V3SA 3M9OB 5DDRC 5LL6d 4K4WA 4RBUA 1VQ8S 3EGNA 4PABA 1VOMA 3BDEA 4EMDA 2HK2A 2C28A 1H7XA 5D0EA 5FD1A 2UP1A 3I6PA 1PSDA 4USTA 3KUGA 3OVAA 2M7SA 2OELA 3M8PA 2FHJD 2Z2ZA 1TVRB 3EXYA 3KK1A 4GO5X 5B08A 2QLJB 3RAMA 2GMHA 4RNHA 3CULA 2XZWA 4X4OA 3KHRA 1T7PA 4KH1B 5I42A 4B02A 1FRHA 4GKKJ 4H4MB 1SL0A 4EK2A 4P52A 2QTWA 3BGOP 4DL4A 3DOLB 1FFWB 1FXLA 1WEYA 2HS0A 2HAFA 2DHSA 4A8FA 3OUYA 3HK2A 2ZHAA 3P5BP 1B0PA 3HHLD 2I0XA 2W25A 5A2QU 3D0IE 5IZHA 4A47A 4NLSA 2WONB 3CCWA 2LQBA 2FJWA 2AP6A 3GV7B 1NJZA 4H4KA 1PGZA 1O5JA 2M8HA 5CYMA 3K17A 3GYNA 5LSOA 1JNZB 4M5JA 3KKFA 1LW0B 5FDLA 4KJIA 1KN6A 1Y5LB 3OTOF 4KV8B 3J80U 3CUNA 3V6KA 5J2MB 4DEZA 2OPPA 4DG1A 1K8AT 3BDPA 2EFPA 3G87A 1P27B 1NJIT 4AXIA 3OL9A 1YZ7A 2E9RX 4DV5F 3NGDA 3PXGa 1JJCB 1YK9A 5HJXA 4DV6F 2J7KA 2IIHA 3CW2C 4LVNP 4QYZK 2MEWA 2K1RB 4OHWA 4KQZA 1VRUB 2OSRA 2OI2A 4Y28C 2I8EA 1NNDA 5CZVA 4ILMA 3NG8A 3CEDA 3MAAB 2UXDJ 4IRDA 1TVRA 5U47A 2APOA 3DMJB 4DZDA 5E5NA 4F4AA 2UUBF 4M1KA 1WOPA 4ILRA 2E9TA 2FHOB 3K5LA 1E6YB 4NXMJ 3QNWB 2OPSB 2CDQA 1O51A 2Y0SD 4H4MA 3C46A 3TVKA 1XJWB 2AJQA 4L3NA 3GIIA 5L9XA 5CD4A 3DNCA 4J9SA 1SPBP 3DOLA 2GV1A 2ADBA 3KYLA 2FB0A 1CJUB 3PJXA 4X4TA 4A8SA 1KS2A 2MLZA 1WC6A 1H73A 3IAM9 5DG7A 3GV5B 5CQGA 1NZAA 4JI1F 2WONA 2XI3A 3MM8A 1X4AA 3GTYX 1NSQA 3T41A 1VC6A 3B6BA 3S01A 1PC5A 3HD2A 1B7FA 2CPDA 3JSYA 5A6WA 1SCJB 1LW0A 1WG5A 5GMKa 4KV8A 2ACMA 3U1MA 3GFYA 4LBPA 5J2MA 2BV3A 2DR8A 3D0GE 3OL8A 1HNIA 2A10A 3RAXA 2QSFA 3HJVA 4DX6A 4CH1A 3F73A 2NLWA 4LF4F 3SSRA 3QMQA 3A8KA 4DV1J 3BR9A 5J1NA 4UY8T 1HNVB 2K1RA 3LOUA 1C1CB 1UA0A 4O23A 5F8NA 2IDEA 3PNIA 4NI2A 3FQKA 2HIQA 3MAAA 4JV5F 2R7UA 3CC2S 3GZ7A 3DKDA 4DSJA 4CM0A 2V34A 2KTQA 1E6YA 2UXBF 2YPZA 3CMAS 2OPSA 1SJQA 4X4SA 1Q1KA 2NPFA 2W9BB 2PIIA 4HI2A 2YWGA 1Q81T 1Q16B 4BWJA 3IR6B 1CVJA 1FI4A 2HVDA 4Z2XA 3UI3A 5CCLA 2MGZB 1TL3B 3CMQA 2DR7A 4JI0J 4DFJA 3DCAA 1CJUA 3VAJA 1NPKA 1I6JA 2DTJA 2DH8A 3T19A 1B7YB 4MTPA 2KFZA 1LV5A 3E8OA 3FRYA 3G6ES 4DPWA 2NSCA 4WCEQ 2UUWA 2D3UA 2DNYA 2D41A 2WVDA 3PHTA 4QCLA 5T7LB 3AD7C 1TZ0A 2IVFB 2ASDA 1FE4A 5J1EB 1FRLA 1RAIB 3NS6A 4YUDA 1HL6A 3G6YA 3PYGA 5AJ3F 1YJ7A 3VR1A 1R8AA 1P9YA 2A2CA 4WIIA 4ANEA 2JLEA 3RBEA 3MMAB 5KFLA 1L3TA 1KBRA 4OI4A 5AXKA 2WTFA 4I69A 4IH7A 9RUBA 2XMJA 2IBKA 3NCRA 3CD0A 4XIUA 2QZ8A 2H9ZA 5FJ4A 3D3CJ 3OSNA 2DPJA 2PI5A 3R5CA 4WXWA 1FE0A 2H48B 2RRAA 1UMJA 4AL6A 1HNVA 2GAGC 2Q1LA 1IQZA 1C1CA 4QW9A 2J7UA 1C0UA 1P1TA 3UPFA 5L1JA 1NK0A 3T1HJ 4LR9A 4DR7F 4YMEA 1F2GA 5D4NA 1WG4A 2OKQA 7FDRA 1HI1A 5F8GA 3JSRA 4G1IA 2DNRA 2XM3A 4OYZA 2XHCA 1K73T 5KFFA 1ZPWX 2ZBIA 1MN9A 2CPHA 3D3BJ 1VDHA 2IRUA 1V3ZA 2CNOB 1EAYC 4CO0A 2DEIA 4X64J 1URNA 4JI5F 3KJQB 1U48A 2PA8D 1UW9A 4N7TA 1HFEL 1WC4A 4I7FA 5C5JA 1U0HA 2MGZA 1TL3A 3FEXB 4Z7CA 4PWWA 4USIA 5KFTA 3Q0AA 4F25A 1T8EA 1VBZA 2ZH9A 5GAHU 4KHPJ 4QU6A 2QGFB 4JI7J 1IKYB 3KLGB 1PAUB 5T7LA 1LW2A 5C24B 4AQYF 4OZ1A 5E3RA 5J1EA 2BJDA 4N8OA 4KKOB 2B4OA 3PX6A 2AIRB 3WHIA 2QMXA 4OFZA 1CJVB 3PY8A 4DPYA 2K7KA 3BPDA 5D78A 3LH2S 4X66J 1IBMJ 2IC3B 4OJ3A 3MMAA 2M9KA 5K8MA 4DOZA 2FLOA 3UDCA 4CLLA 1N5YB 5DETA 1FERA 4K2XA 1UJ5A 4DSFA 5CXTA 3HHLB 4CLSA 4NLTA 4I1TA 2QV6A 1Z4UA 1TFWA 2CQBA 2CDRB 2V67A 2ZHBA 3JSBA 3G82B 4X62F 1PBAA 3O2IA 4MKVA 1U1MA 1WEZA 1S7HA 1T05B 1SH3A 4NLRA 1JNRB 1Q86T 4B3OB 2DT9A 1F0XA 4RUHA 1U1QA 1NEEA 3FRZA 3NWRA 4P6QA 5DG8A 1CBKA 1AROP 4JYAJ 3J81U 1RBOB 4Y65A 5B0DA 2ZDOA 4OYMA 3LUYA 4WFBQ 2DH9A 5DDQC 4ECUA 5A8KB 1ZH5A 3RZAA 2JFKA 3JXOA 3UN3A 1EETB 1S7IA 1FX4A 2LMIA 3OL6A 4I2PB 3S7RA 1Y00A 4Q8FA 5LXYA 4A8MP 4WU2A 1HNWJ 1FDBA 2FHJA 4ZVQB 4K7QA 2W2MP 2KXNB 1AW0A 4OI3A 2CPZA 5C24A 1RCOB 2MKJA 4FYWB 4HLBA 2B43A 3G2XA 3IO1A 4OI0A 2B4PA 2ERRA 4LQ9A 4MFBB 1CJVA 5IQQA 4CP5A 1RAHB 1REVB 3I4PA 2IC3A 2C2OB 3LTOA 4PG8A 3B54A 2MLXA 3OV7A 1N5YA 1JMTA 2L48A 2WRMA 4B9UA 1U0SA 1FDNA 2VA2A 4IYQA 1KQGB 4A8KA 2LA4A 3MPVA 2GJIA 3QWPA 1N0VC 2ZWPA 4WP8A 2PEHA 4DL6A 3G82A 1WHXA 1BE4A 4QQBA 3ZC4A 1CJTB 3C15B 3IGVA 4P2FA 3IBCB 1T05A 3CCJS 3A13A 4B3OA 2R9LA 4IKAA 3KXDA 1O0PA 5D8HB 2BANA 4DV2J 4DFKA 2FJBB 4DUZF 1K1QA 4M95A 2G0CA 3FSYA 4LREA 5A8KA 4HR2A 3V4IB 3QGHA 3DN9A 3CO9A 4LSLB 1Y3JA 5HVGA 2BJ3A 2OEJA 4I2PA 2CVEA 3DOMB 1L3KA 2QYGA 2MY7A 2YKMB 3GG1A 3BR8A 5KOWA 3CJRA 3TQ1A 5JVHQ 1JLCB 2GJ2A 3FFIB 3X1LB 2B8QA 1TKZB 4OJ1A 1YHQS 2OTJS 3AB4B 1BHNA 1QAIA 2XCAA 3P5TL 3H5YA 5KFEA 2IM0A 1D1UA 2V8HA 1EQMA 1REVA 1OIAA 2R7XA 5F0WA 4OYPA 2RMLA 2YWFA 4UT4A 4J90A 3GMGA 4KT0C 4P7TA 4NA2A 3WZ0A 3DRRB 5EWFA 2GMLA 2COLA 2AJFE 2JFDA 1HW8A 4UQTA 5A76A 3P6YC 1HNZF 1ICEB 4RX6A 4DR1F 2CJXB 4MMOA 1ULRA 3C8YA 4FPRA 4CLFA 1N34F 2AZ3A 2HWIA 1HW9A 4CO1A 1YSJA 3FEZA 4ECQA 1CJTA 3C15A 2F4FA 2DRAA 2Q6BA 1VQLS 2IM2A 2FUG9 1M1GA 1IKVB 3PDNA 1F2HA 2XC9A 2B7BB 1OMSA 1FDDA 4B3SJ 1NPPA 2MKCA 1IR0A 2MZRA 4ANDA 2GAHC 2P2CB 2EG2A 5LSLA 1X4HA 4K8RA 4MK9A 4ZHRB 4USJC 1TP7A 1N56A 1KONA 2CRLA 4Q43A 3IWXA 3CJ4A 4LSLA 1RK8A 4ETZA 2RDIA 1FKOB 1IBKJ 4MIBA 2CWKA 2YKMA 4ZP9A 4O4RA 4N41A 4DSLA 1JLCA 2IJRA 3IC1A 2VASA 4Q8EA 3FFIA 3LP0B 4ZCLA 3LPEA 4NXNJ 2P9EA 5DZ6A 3C19A 5B0BA 2W4DA 5J2NB 1TKZA 2CQGA 2P6TA 3TYTA 1NJXA 5B0GA 2CQPA 3J81j 4WFYA 5HVHA 5KFWA 3NGUA 1HBNA 1R0CB 5D4OA 4U96A 4DR3F 4P71A 2IBOA 1QSYA 3TZYA 4RPFA 2EBEA 3HO1A 5H1SV 4OX8A 4PXCA 3EM1A 4WBFA 3KLHA 5FLXY 4QR1A 3THPA 3R3TA 2XYPB 3ISZA 2IM1A 2WOMB 2C2NA 1S6OA 4TVAB 4F0KA 3K7RA 2P9GA 3PW7A 4JI8F 1Y10A 4M63A 2OH2A 1JLQB 1Y11A 2QA1A 3GFXA 3FDSA 3QATA 1FNMA 1NK9A 1TAQA 2HMIB 1XNRJ 2PT0A 1IKVA 2V4JB 4DV0J 3D2WA 1WKLA 4LR7A 5KT3A 2BKOA 4MIAA 4P2MA 4CH0S 4KGXB 3L09A 1KTQA 4FPIA 3MCNA 1S1VB 2Y3YA 4F50A 4MYTA 2XHWA 3SMZA 5DGBA 1OY9A 1CJKB 3CCRS 4ZHRA 3N28A 4CZCA 1M0SA 1XMQJ 2NXEA 3HVWA 3C2PA 2DHXA 4DX8H 2HHQA 2I1RA 1BY9A 3NP5A 3SV4A 2RIJA 2BYCA 1UJ6A 2EK6A 3Q8RB 1FKOA 2E5JA 5K8PA 4QIGA 3RB3A 1EP4B 4QWDA 1KP6A 2UU9F 2POKA 3LP0A 2AW0A 1VI7A 5J2NA 1JXEA 2B3TB 2BXJA 1Q5YA 3HFKA 4NEYA 2ZBQA 5T14A 4NRUA 3MMBB 2CJAA 3MM5B 3FCVA 1SB6A 4DR2J 2AJ2A 2GO8A 3JAMY 1MSWD 2E1AA 2QMWA 2EKNA 2MXYA 2HRYA 3H42A 2A2DA 4YB7A 2U1AA 2HHHF 3QT6A 2B9YA 3MM7B 3MGJA 1SJ4P 3UCZP 3US5A 4N56A 2WOMA 2X7IA 4DQQA 3AFGA 2BBEA 2AEJA 4RNNA 2LKZA 2XWYA 4DDFA 1VHFA 4PR6A 2R7VA 1N33F 1HR0F 3N4WA 5L38A 3BM7A 3CJ0A 2FC9A 5EWEA 3UDEA 3R1HA 2IVMA 1MU2B 4F3MA 2W8KA 1FEEA 2HMIA 4UOGA 1RLDA 1YBTA 5BR8F 1WSRA 3BO2A 3OL7A 1TL1B 1Q8KA 2V4JA 3BKTA 1R27B 2QA4S 4IFVA 3IM9A 3THTA 3UFCX 4AXJA 2LEBA 2V8DA 1H2UX 4LFAJ 2DBBA 3GFHA 4RJVA 1S1VA 1JJ2R 5KFOA 4ZN1A 4B17A 3IWLA 1RWUA 4M5MA 4CI0B 3K89A 4OYAA 2UZAA 3NRBA 5DM7Q 2Z8QA 3MR2A 2R8KA 2K2PA 3KMSA 1U45A 3NKYA 1ZA2B 3MPDA 4B08A 5KFPA 2QO3A 1GAOA 2LU1A 3GONA 3JTNA 4W92B 3LANA 3DLEB 1NM2A 1QVGR 2ADCA 1EP4A 1VYAA 5B7WA 3G9CA 1VC5A 2EW9A 4FKYA 4H4KC 1I5OB 1JLGB 2F40A 4EBDA 1RWNB 3GG0A 3MD1A 3MMBA 4PXEA 5F9NA 5HMZA 3EWGA 5ETPA 2O67A 1HWKA 2MKSA 1U6FA 1KWMA 2R2TA 3NLCA 1KFDA 4JI6F 1UKUA 2EKYA 4MK8A 2V2KA 2OO4A 3PX4A 2FHKA 3RGIA 2A6MA 5DRKA 2G1DA 5KFCA 3GB0A 3KLVA 1EJ7L 2CG4A 3MOZA 4ED4A 2LCWA 3KK3B 6FDRA 3W3SA 4IRCA 4URSA 2Y1LB 5HK4A 3AH6A 3TEGA 2I2YA 1J2VA 4RW7B 4X65J 1HARA 4LT6A 2UUAF 1FXRA 1MU2A 5CCMA 3I0SB 4FYXB 2VL1A 1NK5A 3E51A 4YB1P 4C9DA 3CD7A 5K8NA 1HBMB 2K06A 5ETSA 4P9SA 5KG7A 1RBLA 5MAOA 1LK7A 2NXJA 2C3UA 4WU3A 3UDLA 2XMWA 2WBRA 1UAWA 1C1BB 1GMUA 3FBBA 1VQPS 1HI8A 1MG7A 4NLGA 3T1YJ 5GADU 1UFKA 3VAMA 1JIHA 1WHVA 3CJ2A 4A8OA 3RBDA 3O3LA 1NXIA 2QFIA 4LIWA 4NYZA 3DLEA 2OFGX 2ZH3A 1DZ5A 2VFVA 2VC1A 1B0TA 4X4QA 4USMA 4CWBA 1TKXA 5IWAJ 2J6UA 1JLGA 4KR0B 2DVIA 4IQMA 4W90B 2A3JA 4ZS6A 5HN0A 2H5IB 1D8YA 4FXDA 2VBXA 3U27A 5C7PA 3DXSX 3BREA 4Z7YA 2KJWA 4U7CA 2FLLA 4LF9J 1XMOF 2J7WA 2B8PA 1FHTA 3AY0A 5BYQA 3MFHA 1KDNA 2DHAA 3MR3A 4PYAA 2MKIA 4GKJJ 3C14B 5IXUA 1KOHA 4C2MA 4OMFG 1RWWB 3HLUA 4KHRA 1EX8A 3KK3A 1SJFA 3TP2A 4HEA9 4XDDA 2ABYA 4CO2A 3T1AA 4EBEA 2EPIA 4N5SA 3T5JA 4O4GA 4Y2CA 5HSPA 4Q5VA 1U1OA 4J9VA 2CJQA 3RW6A 1TKDA 2NSBA 2DGXA 2VF3A 1WNEA 2X1FA 2L9NA 3KHLA 1R6VA 1R8HA 4URQU 3M8SA 3BH7B 4LJMA 4OJHA 1NJYA 4WWSA 4LF6F 1DHMA 3RRHA 3QT7A 4TLRA 3PW0A 1DJ0A 1C1BA 2KRBA 2Q43A 2CQDA 3L7UA 5BXIA 2W4CA 4LUBA 2VBWA 2KZMA 3NGSA 3KOAA 2MKHA 3HCXA 3M8QB 1SH2A 1EQ0A 3D6HB 3P45B 5LM7E 3ZNJ1 1C4CA 3D9BA 3HXMA 3KHGA 3KG0A 4NLXA 4F36A 2QA2A 2HQIA 5DZ7A 3VAFA 4FZVA 2LECA 2HIYA 1TK5A 4RNOA 1JJ4A 1Q7LB 2YNFB 2FPHX 1UA1A 4ATNA 1LXJA 3W66A 2CJ9A 3D5MA 1RDRA 3VAGA 2O3DA 4Y34A 1MW7A 1PYSB 3D6TB 3CDUA 2XMTA 2W01A 2KT2A 3CO0P 3EPIA 4CYUB 4L72B 1M5PC 1F5BA 3TVZA 3IBFB 3A1YG 3BBCA 4LMZA 2C1EB 3MWBA 3HSJA 3C14A 4DJBA 2M8DB 4EYIB 4LRDA 1NKEA 3W62A 1PJ5A 1GNKA 1HWIA 4PG5A 1JLBB 1YQHA 1ELOA 2GVDA 3DGVA 4LRFA 1ZTTA 4IR1A 4FBUA 4G3IA 1S9GB 2DR5A 1VQMS 4B3TF 1UVMA 3TUZC 1JK9B 5KT6A 1KD1T 4NA3A 1NU4A 3VALA 5HBMB 1SJRA 4Q2LA 3BGUA 5KFKA 1U6BA 4ZP8A 3AXKA 4KAIA 2DNMA 1J5EF 1CULB 3LA0A 5DDPC 1HQUB 3K5PA 4EYHB 4RW9B 2HBQB 2CZ4A 3ADAC 3EJMA 2XS2A 2KN4A 3LPYA 2EFGA 4OJGA 2IFXA 2X1GA 2JLGA 2M4MA 2BOPA 3IS9B 3MEEB 4PQUB 4ZN3A 2UXCF 4NWBA 3M8QA 1MMDA 4DV4J 3OVBA 2K3KA 1KLNA 1S79A 2VG7A 4AFFA 2QMUB 4KO0B 4IRKA 5D4PA 4X4RA 2JEFA 2OEKA 2HQ3A 4FF4A 3WBZA 3BGFA 4PXDA 3AXMA 1Y5NB 2IHR1 1GEHA 3PRVA 2UUCJ 1XNQF 4CNZA 2YNFA 3M8ZA 4AYBD 4ZA1A 3NGTA 2ZBCA 3CJTA 2JC1A 3BEGB 4M5DB 4WYLA 3FNNA 1DQ9A 4M5HA 4OX6A 2J9CA 1T9VA 4Y6IA 3JS9A 4GMKA 1N32F 1OPZA 2PFFB 4CYUA 4DR5J 1U26A 1RT5B 3W8PA 1NRKA 3MOJB 2B0GA 3ZO7A 2CQ3A 4KC5A 1SIZA 3OJUA 3GYGA 2FGOA 3N6LA 5JJBA 3PR4A 3IA0A 3W63A 1I94F 3QIPA 1JLBA 5KG2A 3PJWA 2NZCA 1FESA 1S9GA 5KOXA 4OL8A 4WZQA 4EWTA 1K47A 9ATCB 1HIYA 5FIIA 1N36F 5GAHI 2YNIB 3FMWA 3A8IA 4YP3A 5HBMA 4DBQA 3CDBA 2D74B 2GC8A 3NAHA 4YFUA 1CULA 2VOPA 3OFFA 4ZCIA 3DLKB 3KLFB 2ZDPA 4WFAQ 1HQUA 3QO9B 2KRRA 4FF3A 4RW9A 4F2SA 3CCVS 4HDHA 4I6WA 1FKAF 4MH8A 2HLTA 1X60A 2UVWA 2VQFF 3J7AN 1J5OB 5HANA 3RBZA 2FZGB 4QR0A 3TAQA 3JYTA 3IS9A 1D9AA 1X9SA 3MEEA 4PQUA 5A8WB 5KFMA 2J6TA 3GIMA 1XEZA 2EG1A 3W5YA 1NSKL 1IVZA 1QAYA 2B5JB 4KO0A 4RW6B 3NNHA 4F0HA 2GA7A 1N52B 4C8KA 4B3MJ 1M5VC 3ILOA 3UWTA 1OS5A 4NE9C 4RUBA 3PM9A 3CDEA 2GNKA 1UZDA 2DCLA 4NCAA 2NS1B 1UFLA 3G86A 4PWDB 2B6AB 3GWCA 2C2RA 3W8GA 3CDAA 2XQCA 1U1PA 4D3HA 1T03B 4F4XA 1IXKA 4FBTA 4DI6A 1N5VA 4NPOA 3A3OB 5D3GB 3TUPA 4G6VB 1EB0A 4A8YA 2DKOB 2LDIA 3CC7S 4TY8A 2V9WA 1TUVA 1PAEX 4OZ5A 2BZ2A 3TQEA 3GR0A 2PMZD 1A0OB 1RTIB 1NDPA 2V5HG 4LF5J 5KFGA 2Y9HA 4OYWA 2AYEA 1NLKL 2HHUA 2BABA 3SCJE 3VAIA 4GRSA 1WF2A 2XMVA 2VA3A 3M9NB 4LRAA 1VQ6S 2YNIA 2XG8A 5F8JA 5A2QY 1TAUA 2BACA 3K5OA 2CPXA 2F5GA 3DLKA 3QO9A 1G2EA 1WC3A 3SCIE 2OUGA 3T9ZA 3G8TA 4P10A 3AA8A 2AD9A 1FRMA 3R2DJ 1J5OA 3CCQS 3L95X 1HWJA 3I5BA 1FTCA 4PAAA 1RHKB 2N82B 3J80Y 3VGVA 4G65A 4DHVA 3FK4A 2AMCB 2EC0A 2YTCA 2H5EA 1YVFA 5DJBA 1U2FA 1X9MA 3C6TB 1RT6B 3OTEA 4O0NA 1WTBA 5LXRA 1L5UA 1RA6A 2F7VA 2B5JA 2KHDA 3M2VB 1FVSA 4ZVUB 4KFBB 4RW6A 1AZSB 2I5JB 2BUNA 1MN7A 4USWA 3PACA 3B8HA 4OHXA 4PXBA 1XC9A 2F4VJ 2NYIA 4E0DA 2HBYB 2PO4A 1VJWA 1HWLA 3BO3A 4J9LA 2HHSA 5E3AA 2VBYA 4OX7A 3JQKA 1X5OA 1NSPA 3TUIC 1YDLA 4A48A 4GKKF 1S0VA 1F9FA 2XWXA 5AT1B 4YDXA 4PWDA 2B6AA 4BDPA 4X2BA 4KIAA 1WF0A 2ZUGA 4ETXA 1T03A 3TAMB 2C42A 1T9YA 5D3GA 4O3NA 2HZAA 5ETTA 2YNGB 1RWXB 4IH5A 3TVYA 1S6PB 2YKPA 3UE2A 1RTIA 3I4HX 3NGRA 1S76D 2KT3A 3RAQA 1Y3KA 3DDKA 5T41A 2R3VA 1IBCB 1U49A 2XY6A 3D54A 3M32B 1PILA 3KDNA 1RXOB 1S48A 2OD6A 4ECXA 4FDFA 2W2PP 1OQ3A 2MSSA 2FC8A 3PJ9A 5EN1A 3IFEA 4F3OA 3MEKA 4F04B 1A9NB 4L3KA 2J5AA 5IC6B 4QPXA 2EFVA 4HI1A 2RHQB 1VQ9S 1TV6B 4TN2A 2EC2A 3CCSS 5EX0A 1CPZA 4J9PA 1IM4A 4C98A 1U8SA 1YTYA 3DDIA 3FGVA 3PW5A 2ZC3A 3C6TA 2XY7A 1RT6A 3BSOA 1H2VZ 4Y2KA 1S1TB 5LT5A 2ASLA 3M2VA 2HNYB 2J8SA 4GVLA 4KFBA 1AZSA 4ZPTR 2B7CB 4DR4F 3OSPA 3HKZD 2ILZA 3FJ2A 2N3OA 3CJSA 1K1SA 4CDIA 3MHYA 3SCLE 4NXMF 2ZM6J 2R7OA 2HBRB 5C2CA 4W4MA 2IMWP 3P8BB 1QTMA 4ZIWA 2XI2A 3T5HA 3FMBA 3GSIA 1NMEB 2DRDA 3HHDA 4B9NA 3KG4A 4ZJOA 3TAMA 4AL7A 2IM3A 2QL5B 4JI2J 3HJFA 1FRXA 1S9EB 2YNGA 4I56A 1QVFR 2Y1IA 1S6PA 1GQEA 3GU0A 4DPOA 1X0PA 1VQOS 4ECTA 3DLJA 2JOQA 3Q83A 3DGPA 2OEMA 4ED0A 1TUGB 1YIJS 2RS8A 3GILA 3T6JA 2VDHA 3LW5C 3QFWA 4FYVB 2YH1A 3OHBA 3DOKB 3MPYA 1NK8A 4F26A 1RWKB 2HK3A 1JX4A 3VZIA 4WJBA 3IBWA 1IWGA 4WYWA 3M32A 2OP5A 3Q24A 1S1WB 2CIMA 2R2UA 4LR8A 4DS4A 2ATCB 2ALYB 2GGPA 2DGVA 3HM9A 2ZNYA 2PGCA 2LQ8A 4JP8A 2IYGA 4CT9A 2CXEA 4FS1A 4C8MA 3QRPA 2Z57B 3LGHA 4I64A 1TV6A 5F3ZA 2OFHX 1E6VB 4ZIVA 5C25B 3I56S 3JTPA 4ZK7M 4DV1F 1WD6A 1S1TA 3TJ8A 3CDWA 1RBAA 2HNYA 5IFMA 2HKEA 3H2UB 3CE8A 1FJCA 4OZNA 1Y4ZB 2XZDB 3IR5B 2GW8A 5KFJA 1TL4A 1RAGB 2DO4A 4EBCA 2X1BA 5I4MA 5D0GA 1N54B 2YQ3A 4OI1A 1NDKA 4F2RA 1TR0A 3NL0A 2LQ9A 4CLZA 2CQHA 2NYHA 1JLFB 3HT3A 4IDKB 1IJEB 3L4BC 2BA9A 2AX1A 2R2RA 4JI0F 5KTQA 1S12A 1I3OB 3FVYA 1S9EA 3NAIA 3CCTA 5KFNA 1RP5A 2VD3A 4CT8A 2DNLA 2E5LJ 2FJVA 4DR6J 1KR4A 3JSMB 5AE1A 2X51A 2HPUA 5KFRA 1X5SA 1RTJB 3ZZRA 4DCJB 3DM2B 2C2DA 2OAUA 1L3UA 3DOKA 3F44A 4BC7A 2LFVA 2E44A 1HA1A 4ZVGA 4OYOA 1S1WA 3ZTQA 3MR5A 3R5AA 5KG0A 4AUKA 1AFIA 5F8IA 3Q2SC 3UN2A 5SUHA 4HYKA 1JKHB 4ZVTB 2LP4A 3EDRB 2KH9A 2W9CB 4USKA 5J1PA 1UW4A 1E6VA 5C25A 4ALZA 4C3KA 3BPSP 4ANCA 3IWNC 4HL9A 1WWHA 2IAJB 3MR6A 2XMUA 5D77A 5IV4A 3KJNB 4IR9A 3T1HF 2DIUA 3VHQA 1HWUA 4KGMA 1HPZB 4NLQA 1HBOA 3D4JA 4OYBA 1B99A 1FRJA 5F3TA 3SIPB 3HVAA 4FXWA 1JJHA 3NY0A 4W98A 2M88A 3SYZA 2IJNA 4X64F 3CCLS 1DTQB 1BD6A 5L1IA 4IDKA 1VIXA 5L1LA 3M7VA 3BKFA 2HLUA 4BS2A 1QSLA 2BMBA 4RW4B 2RVJA 2WW4A 4YEAA 4J37A 3ENWA 3SV3A 1NAQA 3Q23A 3CD6S 4AD6A 3TNVA 5C42B 3JSMA 4JI7F 1GMWD 1WDDA 3IMQJ 3CD5A 1HBUB 3HULA 1I1GA 1RTJA 2XGQA 3DM2A 1I51B 4UTGA 3HSGA 1SV5B 3QBCA 5H9FJ 1U8WA 2VV5A 1ZAVA 4CCHA 5KFSA 3KJFB 4LF2A 1JXVA 3AOAA 2GIFA 3W60A 1MWYA 4USVA 3T3FA 1IBMF 1MWQA 1CEZA 3ZZ0A 2GQ2A 1YJWS 2PMWA 3UCUP 3H5UA 1F5AA 4M94A 1N5SA 2W9CA 3EUNA 4C48A 3V81B 4OLPA 2ZH2A 4EEYA 3A3PB 2IAJA 1ZZNA 2VFUA 1U1LA 1FDAA 4ED2A 1LWCB 5G4DA 1RT7B 1KLMB 2YWEA 1ZYQA 3DDNA 4YHHJ 1S49A 5JXSA 3M2RB 1U1RA 2OHDA 1HPZA 2UUTA 2LQJA 4DFPA 2V4RA 4WZMA 1N88A 3ICLA 2BJ1A 2DHGA 4JYAF 4OV1A 1IR2A 4WK1A 4OI6A 4ZOSA 2RQKA 5ETMA 1WJ9A 1YJUA 1DTQA 5CH7B 1RJJA 2VONA 4C97A 5E33A 4TU7A 1MMNA 4RW4A 3CPWR 3CJQA 2E5HA 3PR5B 2G2ZA 1YJ9S 2UV8A 3IP0A 3TZZA 4JI3J 2RKIB 1HNWF 1FF2A 4M8LA 1OYDA 1VISA 3KWMA 1HBUA 5GADI 1YJVA 1VBYA 4TY9A 4OV6A 4ECRA 2MZTA 2JVOA 2BDPA 1SV5A 1NHVA 1RABB 1M90T 4DSEA 2Q79A 4UOFA 2AJ4A 3V2UC 2B9XA 3PW2A 3VF0B 3OXFA 4NMXA 4K0KF 4DN9A 3M30B 1RISA 4J9UE 1TFYA 5DQGA 2CPIA 1V5VA 1OO0B 2X1AA 5AXLA 2C2KB 1GH8A 3T9NA 2O66A 4TNOA 4XPEA 5LJ5Y 1P1LA 4J91A 1LWCA 4N77A 1GX6A 1RT7A 1KLMA 3MPWA 2CQIA 3OD2A 3HKWA 2DR9A 3H98A 3DRSB 3CCUS 1KHVA 3FSIA 2XLJA 3M2RA 4FYDA 3HF5A 1OY6A 1GXUA 5A0YB 3BO4A 2Q6CA 3N5BA 4DFMA 4OYIA 1QM9A 3UO0A 3MURP 4O3PA 2CQ2A 3HZGA 1VR6A 1AB8A 1C0TB 4DV2F 2VC0A 1RU1A 2HNDB 4KSEB 1H98A 3SDEB 2WVBA 2NREA 1DURA 1R8PA 1R8BA 2EWHA 3U02A 4B9TA 5IT0A 3EMTA 3EVWA 3PYEA 2HVEA 4BBYA 1N4LA 1S6QB 3OPKA 4NLPA 2WB4A 1SIWB 4RW8B 4NZ6A 4N47A 1X4CA 5BYSA 1Y0HA 3QGIA 3V4MA 1BUXA 2RKIA 4RNMA 5EWGA 1NHUA 2ZH4A 4HTJA 3N0VA 1N5TA 4J9OA 3L7OA 4B3RF 4UOCA 2VJUA 4ZVSB 2P6SA 4MJKA 4DF8A 5I3UB 2XY5A 1GK8A 3H2VE 3CIMA 3ZZTA 1KOOA 3M30A 4ZVOB 2YVSA 1VRUA 4PEOA 4G1QB 2N4CA 2ATLA 1RGVA 3IG1B 2KL8A 2MQOA 2NXUA 2KKHA 2R7SA 3ET6B 2MHEA 4PG7A 1VQ4S 2JZ5A 3DMJA 1RQ0A 1N48A 2PD1A 3ETMA 3TA1A 1BWEA 1DTTB 3O1LA 1RT3B 5D0HA 3TEHB 4ES2A 2R7RA 2Q3PA 4XTTA 1HD1A 1YGYA 3J7YU 3DRSA 2P5VA 2HWTA 2KJVA 3I5AA 3M8YA 3GPAA 4OX9J 1CS4B 3E2EA 3UW1A 5A0YA 2QLBB 2HHVA 2H4YB 5E41A 2ZE2B 1D9DA 5GVQA 3UD3P 4B3SF 1NBEB 1V3RA 4EU0A 3SFUA 3B82A 4HT7A 1C0TA 2I38A 2CZ9A 2RS2A 1RADB 2XLKA 4C11B 1UVKA 3QLHB 3BQ0A 4ZPWR 4L75A 2ZD1B 3ENQA 7FD1A 1S9FA 2C3YA 1RAJA 3WC0A 1JXLA 3H40A 3OHAA 4ECWA 3BBBA 4R0JA 1S6QA 1R89A 1G3OA 4X4NA 2AKWB 2J6SA 1XN9A 4RW8A 2CNKB 4CNYA 2RSQA 2D7SA 4K4TA 2MZSA 2RD5C 1FJGJ 1HLWA 1IBKF 8RUCA 3RB0A 1SQEA 2HRUA 4PKDB 4V19J 1R0BG 2ROEA 2V0NA 4R25A 4NXNF 2G2YA 3QZ8A 3UD4P 4LFCJ 3DLLQ 2R8GA 4LF7J 2XYHB 3OR2B 2BW2A 2R42A 3RYLA 3DC2A 4RKUC 3PV8A 3NBPB 3OTDA 5I3UA 1S77D 1RI7A 4GVBB 1SXLA 2AWZA 1VQKS 3TWZA 2GCFA 4NLDA 1LOUA 1RWMB 4LFBF 4FF1A 3W5ZA 3PO5A 3UD5A 3R7NB 4G1QA 5DS7A 4ED7A 4ITSA 3OBIA 4FYYB 1WF1A 4ZKAA 1NZ8A 3ET6A 5C2GA 3HSZA 4IG3B 1YRUA 2XMAA 2HZVA 1QE1B 4E98A 1DTTA 5L1KA 5LMUJ 3A8JA 2G2OA 2GJFA 1RT3A 1XTZA 2HQCA 3PCOB 4L76A 4RUCA 1ZETA 4A8QA 2W9BA 3ZFVA 2HFSA 1AYEA 1OQ6A 2AHOB 2HVIA 1CS4A 4FNHA 5KT2A 1FJEB 1XNRF 3MECB 3P49B 2DXDA 4DV0F 2ZE2A 3H2LA 2NXNA 1RTHB 3LP2B 2V8GA 3DRXA 1RHQB 4IOCQ 3W2WB 4LRBA 1VS3A 2J9DA 4TKTA 2OPRB 2AX0A 4C11A 3QLHA 3MMCB 2DIVA 2ZD1A 3A12A 5KT5A 1HHTP 3G6XA 2E29A 2MZJA 1XMQF 4DV7J 2WBMA 3A8EA 2XCPA 2MQPA 2MB0B 1T9TA 2ZJPQ 4ID8A 3RR7A 1OPIA 1RUSA 2CZVC 2BM1A 1S5ZA 2CQCA 1PJ7A 1V6HA 5GAGI 3L7PA 3M6VA 2H54B 3HT0A 4WFNQ 2LU2A 1FEHA 3OR2A 1OY8A 5HROB 3NBPA 1WOSA 4QR2A 4GVBA 4I4BA 2XNQA 3HHNB 3VQSA 4P72A 1PYTA 2WB1D 1N5QA 2IY5B 1WG1A 2FJXA 3QAEA 4DR2F 3N79A 2LEAA 2YWHA 2E1PA 2JEJA 2G1HA 4HT5A 3DLGB 2VIHA 3AOCA 2EK1A 1H74A 3V6JA 4IG3A 4K59A 5IT9U 1QE1A 3BN4A 3BB5A 2D3O1 2RU9A 3DU6A 4ID5B 3R27A 2LXFA 4WP3A 3LALA 4ED6A 2MJNA 2GHVC 1RACB 1GMWA 2YY3A 3IXQA 1SC1B 3D6MB 3POTB 4DL3A 2IRYA 4NEZA 4RU2A 4P74A 4MKBA 5HAOA 2YKNB 3MECA 1ROFA 2VFSA 3ZTPA 3L3CA 3TAPA 4DN0A 3LP2A 4M5NA 3W2WA 3I31A 3V6DB 2HNZB 2HZCA 4LFAF 3MMJA 2WSEC 4F4WA 3MMCA 1RT4B 2DGSA 1NPRA 1RAFB 5KG4A 4LF1A 1IKYA 3KLGA 2FGCA 2JH3A 3H0PA 4KB7A 3KK2B 1RYRA 2DH7A 4KKOA 3H5XA 4K4ZA 2KFNA 5H9EJ 2RUSA 1HKAA 3HZEA 1U2RA 2KHCA 2I6WA 1P6TA 4YOEA 4NOHA 3BJYA 3OXLA 3RR8A 1T94A 2FLPA 3OFGA 3SQOP 5HROA 3I0RB 1RTZA 4HHHA 3HHLA 1JLAB 4KYZA 1REGX 2W1BA 3ZZYA 5SZTA 2BRKA 4RNFA 1VCTA 5ETRA 1D8ZA 1O8BA 2H3EB 3R5GA 4L74A 2AU0A 4JI4F 1RKJA 3KJVB 2ZVIA 1UVIA 1BGXT 4ID5A 4YN3B 3Q8VA 1HI0P 4RBTA 2BR0A 2B9WA 2WHOA 1H7WA 3A3NB 4X65F 5KFZA 2VOOA 1NH7A 2BE2B 4ZLPA 2KU7A 3EE3A 1QUVA 4ZPBA 1PBUA 2YKNA 2F9DA 1ACMB 3C16B 4DF4A 1XR7A 1EETA 5KFXA 4RU9A 3V6DA 5K14B 2HNZA 1KEKA 1S0MA 3K57A 2LXUA 2P9CA 1RT4A 3R9LA 1L3VA 1RE1B 3TR5A 5J2PB 1UEKA 4P73A 3T1YF 2B4UA 2E5IA 4FXVA 2JDJA 2RNEA 4MFBA 4O0IA 3ISNC 4H4OB 4KRWA 1XMBA 2MQMA 2E1MC 3TX0A 4DPTA 4K2JA 1BQXA 3U1LA 4J9QA 5IWAF 3GJTB 4CQ1A 3F56A 2CUYA 1RHMB 4NRTA 3I0RA 3PKYA 3RB6A 4DQPA 2KYZA 2J9DE 1JLAA 3RUBL 2WVFA 4LF9F 2ZKUA 4EZ9A 1SL1A 4X84A 1EARA 4CLUA 2GIRA 2EFQA 5DGAA 3EICA 4K4XA 4C4WA 3WX4A 2L08A 5KFBA 3KJVA 5LMNJ 1QY7A 2PA3A 1N0UA 4C8YA 4LF8J 4GKJF 4ELVA 2LEPA 4C3LA 3NMAA 1S0OA 3TA0A 2DXFA 2B4VA 2LYVA 1H38A 3GV8B 2MSTA 2OMOA 2VQEJ 4K4SA 2DPIA 4YY3J 1PCAA 3EDQB 1PG5B 1NK4A 4DLEA 2WVCA 3H20A 2KG1A 3CC4S 2G0JA 2BE2A 2RB7A 3MUVP 2DNQA 2QIFA 5HQLA 2ZH7A 4QPTA 1VQ5S 3V4IA 3FEYB 4S0MA 3C16A 4V19X 3BS9A 1RHUB 5HQMA 1FKPB 2ZH6A 5CYMB 5K14A 3W2VB 2D3OR 3DOMA 1T3OA 4DX7A 4DUYJ 2NPIA 2G0IA 5J2PA 2GQQA 3AJ1A 2KYXA 4DU8A 2OLWA 4G1PA 5IV3A 3C6UB 5H9FK 2F8EX 4F4ZA 3GIKA 5F0UA 3MAHA 3UNGC 2BQUA 4K4UA 5HMWA 4H4OA 5JUMA 1TKTB 3P4UB 2BJ9A 2HFNA 4WF9Q 3GSDA 1WI6A 3FKBA 3K59A 1RAEB 3MTJA 1H6KX 1VJQA 3DRRA 2EFOA 3BZQA 1R7IA 4ELTA 2Y0BB 1FCAA 3BSCA 4ZP7A 5K5MA 4K4VA 2SXLA 1NJWA 2V9KA 1FO1A 4DL5A 1DBDA 3SFGA 2XZTB 2EFNA 4QIVA 1F9EB 2BE7D 3JQMA 4USHA 2Y8YA 5RUBA 1JQGA 2N3LA 5ETNA 4Z37A 2DNHA 1GTHA 3QZ7A 2LA6A 2YX7A 3FBEA 2AQ4A 2IPOB 5A8RB 1WC5A 2OD4A 4NLYA 3BQ2A 3K58A 1AFJA 3HFVA 3MM8B 3MCOA 4QWBA 1WHYA 2RJZA 1FKPA 3N6MA 1RKIA 3K5MA 3W2VA 4O3RA 1T3NA 1M1HA 2U2FA 4ZPCA 5J2QB 2OMLA 1BQMB 3MFIA 4GO7X 4EI2A 5LSRA 1HNIB 2B9EA 3CXCR 3M6UA 1B3TA 1IKXB 4YB5A 4ED5A 1Z2LA 3C6UA 2YPYA 4PPDA 2WSFC 2MKYA 3W64A 3OLAA 2KG0A 2Z2YB 4MYUA 4DV4F 3KDOA 3RW7A 5A6PA 3MPUB 2DRBA 2KDOA 1PC4A 1TKTA 1F9HA 1NO8A 1GXTA 3Q8QB 1DRZA 2PC6A 4NI2B 2UUCF 4F3QA 4DR4J 2GFFA 2E7XA 3AB2B 1U7LA 1KFSA 4USUA 4HKQA 4OZJA 3SEOA 3H25A 4XPCA 1WHWA 5LOQA 1ZOTA 4D3GA 1RWOB 4CRJA 1JLQA 3VGSA 4DR5F 1Q0NA 1R6YA 1RZMA 2DNKA 2YKOA 2UVUA 1GX5A 2CFXA 3PFOA 2DITA 2V2ZA 2HQFA 3EVOA 3CMES 2FLNA 2CPYA 1UP1A 5A8RA 4ECZA 2YNHB 4P2SA 4KPYA 4HHUA 2EEYA 3WX8A 4IG0B 3AQOA 1CJKA 2HBZB 4O3SA 2KXHA 2X3GA 4K5SA 2RT3A 2VICA 3R97A 1SUQB 2VU5A 1FD8A 3LAKA 4RBVA 3MCSA 5CD4H 4QIWD 2HRTA 3P3DA 2F3JA 3G8SA 1KTVA 3TZWA 3MTKA 1LKZA 2V50A 5J2QA 3AT1B 1YI2S 4TYAA 1BQMA 2AF6A 2WZ1A 1FWLA 1YKWA 5EUHA 3PRDA 1KC8T 4CIOA 2V2VA 5GAEI 1IKXA 2UV8G 2QLFB 2VFRA 4N76A 1ZM2A 2BOAA 3MM5A 1T95A 5CABA 2KM8C 3PIPQ 4HTIA 2VKRA 2IJFA 4CLTA 1XIQA 3U7JA 4B3MF 1F3VA 1C0UB 2L41A 5IOLA 2OTLS 3MM7A 3TO8A 3FQLA 2HGMA 1F60B 1S10A 3RG6A 3I87A 1P9QC 2AT1B 3LWMA 3FCHA 4PG4A 3SI8A 5AXMA 3LQVA 4JV0A 3H8YA 1NKBA 3FZBA 4LQ3A 4DU7A 3ZTSA 2W7PA 2HS3A 2XS5A 1TL1A 3BN7A 2ZH8A 4I7FB 1U0HB 2HHWA 3LGNA 1HHQA 1U6ZA 3A4TA 2WAQD 4NASA 5F8LA 2WCXA 2J8AA 2YNHA 4LF5F 2ZBPA 2G4BA 1MNEA 2GZOA 4Y3CA 1QLNA 1IBLJ 4IG0A 1CQMA 2GO9A 2DGQA 4M5LA 3MUTP 2V63A 3QFHA 1LW2B 1SUQA 5BJRA 3NNCA 2PMHA 1PKUA 2F8MA 1RB0A 3GYXB 1VRQC 2CADA 4EO6A 3H7HB 3CJ3A 1Y9OA 4OZLA 3G4SS 1SH0A 3Q8UA 4DV3J 2F65A 2HYIB 3QJLA 2ZZMA 4U6PA 5IC4B 4WP9A 1EZZB 3GP9A 1VFJA 1XK8A 3KMQA 4U7UK 4U7UD 2Q66A 2ZZNA 4NYPA 3R5DA 1W2IA 2ASJA 1HNXJ 1KRPA 1NDCA 5JVGQ 4DWIA 2F4VF 2MZ1A 2ZJQQ 2VG6B 3G71S 2FVCA 1UWAA 2FQQB 3HMJG 4K50A 3B78A 3BGRB 2BKNA 2FVQA 2PDAA 2O1PA 3GR1A 4F0MA 1DAXA 2ZOMA 1MMLA 2Z30B 1IN0A 2YWKA 1X7VA 1VK8A 5ETLA 4RW7A 2DGOA 4QW8A 3MM9B 2MQQA 3I0SA 5CAAA 1KHWA 3UNYA 1Q82T 1FX2A 2M0GB 4QIFA 3BH6B 4L73A 1X5PA 1UTAA 3PO4A 2RF2B 4B9MA 4EUVA 2VPZB 3KTQA 1HBMA 2J0WA 4U95A 1YITS 4UZCA 4WFXA 3VZHA 3KNGA 1SBRA 2MZQA 3ELHA 2CPEA 4ER8A 4C8ZA 5BYRA 3Q8YA 2AGQA 1H0HB 4CO3A 4F4YA 4UQGA 4F7VA 3GIJA 2N7YA 4OLOA 2JSXA 2OJ3A 2A0FB 2RE1A 2LLZA 2DNNA 2M5YA 3M8WA 4I0WA 3KHHA 1F1BB 1RHJB 5KT4A
chains in the Genus database with same CATH topology
1LWCB 5G4DA 1G7CB 4ZMMA 3VTIA 4EZ6A 5B0FA 3D2WA 1RT7B 1KLMB 2YWEA 3AJ2A 4IOBA 5KT7A 1ZYQA 3PIOQ 1M1KT 3DDNA 5KT3A 4MIAA 4ZPAA 2J0QD 5HI7A 1S49A 3DXBA 2GQCA 4CH0S 5JXSA 2HVZA 3U1NA 3OLBA 1X4FA 3M2RB 3L09A 4C8LA 1U1RA 1KTQA 3N5FA 1S1VB 1HPZA 4F50A 4MYTA 5KFDA 2XHWA 3SMZA 4NMLA 2UUTA 2LQJA 2ZITA 4L6V3 2O5DA 5DGBA 4DFPA 4PG6A 1VRTB 2V4RA 4WZMA 5EDWA 3CCRS 4ZHRA 2RUGA 2GGPB 2Z2MA 2V94A 1VBXA 1N88A 3G8QA 3HI9A 5F8HA 3N28A 3ICLA 4CZCA 2C3OA 1M0SA 2DHGA 1Z2ZA 3IAS9 1VLYA 4JYAF 3HVWA 4OV1A 3C2PA 2DHXA 4DX8H 2HHQA 4X4UA 1Q8BA 1BY9A 4PUOB 2I1RA 5E3QA 3NP5A 2VG6A 3OQ2A 4WK1A 3IGNA 4OI6A 4ZOSA 4RUAA 3SV4A 2RQKA 3N01A 1Q78A 1YJUA 2RIJA 1DTQA 2BYCA 2IRXA 1UJ6A 2EK6A 3BGRA 3NNAA 5CH7B 5D6GA 1RJJA 3Q8RB 1FKOA 2E5JA 5K8PA 4QIGA 3J7YI 2ZM6F 3RB3A 2DJWA 2VONA 4C97A 1EP4B 1UEVA 5E33A 3EZUA 4TU7A 1MMNA 2R7WA 2MHNA 4QWDA 4RW4A 2ZC4A 3CPWR 2UU9F 2POKA 3LP0A 2AW0A 2E5HA 3H4DA 2HWHA 3D0HE 2ACYA 3PR5B 3IR7B 1YJ9S 2LDYA 1VI7A 5J2NA 2UV8A 3J7Z5 1JXEA 2B3TB 2BXJA 2RKIB 3SSSA 2BANB 1HNWF 3MM9A 1KNZA 5KAKA 1FF2A 3ENVA 3HFKA 1S4FA 4M8LA 1X9WA 5CA5A 5T14A 3N6NA 1WI8A 3VQTA 4NRUA 1UWBA 3KWMA 3MMBB 2CJAA 1HBUA 5GADI 3G6VA 3MM5B 1YJVA 5CZXA 4JI2F 5KFIA 1A6LA 1VBYA 2B51A 1SB6A 4TY9A 5I3PA 3CF5Q 3JAMY 2GO8A 1MSWD 1BLUA 1Q53A 3FZ2A 2E1AA 2QMWA 4ECRA 2RF2A 2JVOA 2MZTA 2MXYA 3MUMP 2BDPA 2HRYA 4CH7A 3IRXB 1SV5A 2A2DA 3NWGA 1FA0A 4YB7A 4ECVA 2ZNZA 1NHVA 2R7TA 4ZVFA 1Q4RA 4ZVEA 1JWWA 2CJBA 2U1AA 1M90T 2HHHF 4EO8A 1L3SA 4DSEA 2Q79A 3R5BA 1KQKA 2B9YA 3CGIA 3MM7B 2AJ4A 3MGJA 2JC0A 3V2UC 1SJ4P 1R0AB 2B9XA 3UCZP 3US5A 3PW2A 3VF0B 3MZIA 3ZZOA 3OXFA 4N56A 4K0KF 2WOMA 2RRNA 3KLIB 1S97A 4DQQA 4DN9A 3DHWC 1RTHA 1AUDA 2BBEA 3M30B 4YQWA 1HYSA 5KG1A 4RZRA 1RISA 3T5KA 3NCPA 4RNNA 2LKZA 3HP6A 3O5TB 2GIQA 2XWYA 1TFYA 4ZPDA 2G13A 1DLOA 1VHFA 4DDFA 5DQGA 4PR6A 2R7VA 1N33F 2OPRA 5K8OA 1IQTA 1DQ8A 1HR0F