1H2UX

Structure of the human nuclear cap-binding-complex (cbc) in complex with a cap analogue m7gpppg
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
149
structure length
149
Chain Sequence
GLLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 80 KDA NUCLEAR CAP BINDING PROTEIN
publication title Large-Scale Induced Fit Recognition of an M(7)Gpppg CAP Analogue by the Human Nuclear CAP-Binding Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
total genus 41
structure length 149
sequence length 149
chains with identical sequence Y
ec nomenclature
pdb deposition date 2002-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1h2uX00
2DH9A 2MPUA 2AYEA 1UFWA 2JVRA 2D9OA 2PEHA 2MGZA 2MQLA 5HL7Q 2KXFA 1OPIA 2MKHA 1VQMS 1OO0B 1N54B 1OWXA 1PO6A 2BOPA 2DIVA 4LMZA 1W2BR 2E5JA 5IFMA 1D8ZA 1DRZA 1SJQA 1N8RT 3DLLQ 2X1FA 5DDOC 4IOAQ 2MKJA 4WF9Q 2J76E 4PKDB 3P5TL 5DM6Q 1SXLA 2OTJS 3P6YC 2RNEA 2DH7A 2KG0A 2RU3A 3U1LA 4CH1A 1B7FA 1VQ4S 5D78A 2FC8A 1QM9A 2MYFA 2RT3A 4CIOA 2MZQA 1U1QA 1SJRA 3SXLA 2CQ1A 3UCGA 5LJ5Y 3BEGB 5BJRA 2KH9A 1U1RA 1X4EA 2DHAA 3H2UB 3U1MA 2MKCA 2E5GA 1S79A 5JVHQ 4CH0S 2QA4S 2FPHX 1Q7YT 4P6QA 1YWXA 1M5KC 4C0OC 2U1AA 3FEXB 1HA1A 1HL6A 2CPJA 3CF5Q 1VC0A 5DM7Q 2FY1A 1FJEB 3THPA 1K9MT 1FO1A 1XN9A 2DNQA 1KD1T 1U1NA 2M70A 1WF1A 1U1MA 1QVGR 3K0JA 3OW2R 1AUDA 4U67Q 2UP1A 2ERRA 4ED5A 3CCSS 1DBDA 2BZ2A 2KHCA 2EK1A 1DHMA 2MSTA 2CPFA 2DGSA 2L41A 4A8XA 2MHNA 1YI2S 1YJWS 4F26A 2M8DB 4RU2A 1X4AA 3P3DA 5IM0B 1D9AA 2QEXS 3FEYB 2OSQA 2RQCA 1PGZA 2G1DA 2LXIA 2VOOA 4IUFA 3BO4A 1WEYA 1X4GA 4C4WA 2HGNA 1JJHA 2VOPA 2FC9A 2RQ4A 4M5DB 4QU6A 1HD1A 2YH1A 2DNNA 2ZJPQ 2AD9A 4J5OA 5IM0A 3S8SA 2M9KA 3MUTP 2AYBA 1X5SA 2DHSA 2MGZB 2N3OA 3PIOQ 5GAGU 3G4SS 2VONA 3S01A 1O0PA 3CCES 3LQVA 1ZZNA 1X5PA 3NS5A 2DNYA 2RUGA 1JJ2R 2DGUA 2HGLA 5EN1A 2LXUA 1VQNS 2N3LA 1U1KA 1CVJA 2L08A 2CQPA 2CQIA 2LEAA 3UWTA 2KI2A 1VQOS 2FHOB 1U6FA 3VAMA 4F25A 2CQ4A 1P1TA 2RRAA 1N88A 2MQMA 3P49B 2MQNA 1FJCA 4PRFA 1KC8T 1WG1A 2L9WA 3MXHP 1FXLA 2F3JA 2XNQA 2CPIA 2DHXA 3J7ZT 2RVJA 3ZZZA 3G71S 3CMAS 4W90B 1JJ4A 5DDRC 5IQQA 1YHQS 2DHGA 1WF0A 3HI9A 2JVOA 3EGZA 3ULHA 2CQ0A 2AYGA 2KM8C 3NNAA 3NS6A 3CCJS 3NNCA 2E5IA 5LXYA 2MXYA 1KOHA 3RW7A 1X4HA 4WCEQ 3CUNA 2CQ3A 2OTLS 3VAGA 1RK8A 3TYTA 2CQBA 1K73T 2KG1A 5DETA 2DNHA 1YTYA 2MMYA 2KXNB 2LA4A 2B0GA 2KM8B 1FJ7A 3V4MA 2EVZA 3VAHA 1H6KX 3MD1A 1M5PC 1X5OA 3LPYA 1R8HA 2O3DA 2SXLA 2DISA 1X4BA 3IRWP 2CPZA 2XS7A 1URNA 1SJ4P 2GHPA 2KXHA 2DO0A 5CA5A 2CPDA 4C7QA 3N9UC 2CPHA 1VQ6S 3D2WA 2RS2A 1Q86T 2CJKA 2XS2A 3TP2A 3CMES 3NNHA 5D77A 2ZJQQ 2K3KA 3CTRA 2RS8A 1X4FA 1YJNS 3H2VE 2DGOA 4W92B 1U2FA 3MD3A 2OJ3A 1NU4A 1G2EA 2MZSA 2X1AA 2LCWA 1ZH5A 3CC2S 3VALA 2XS5A 3TO8A 3G8SA 2LECA 4CQ1A 1WHWA 2MQPA 2DNLA 4Y0FA 4QU7A 1WEZA 1M90T 2CQCA 2LKZA 1DZ5A 2DNPA 3CCLS 2N7CA 2ZJRQ 1NJIT 2LEBA 2DNZA 1UAWA 2KYXA 2M0GB 3UCUP 3UD4P 2MZTA 2QFJA 1VBYA 1WHXA 3CCUS 2KVIA 5LXRA 2WBRA 1A9NB 1VQPS 1VQ5S 4LIRA 1R8PA 1UW4A 3Q2TC 2X1BA 3NMRA 4TLQA 2DGTA 5FJ4A 4YOEA 1P27B 1NO8A 2DGVA 3B4MA 2KFYA 1YITS 1WI6A 3Q2SC 5CXTA 3CPWR 1WEXA 1WHVA 1U6BA 5H1SV 3BO3A 1F9FA 2CQDA 5DDPC 2DNRA 3DXBA 4UQTA 3G6ES 2K8GA 2DGQA 2J8AA 2XSFA 5GVQA 3B4DA 2U2FA 2N82B 5MLCV 3MUMP 1SJ3P 1H2VZ 2AYMA 4IO9Q 1WF2A 3UCZP 1IQTA 2CPEA 2MJUA 2G4BA 3G8TA 4UY8T 2LYVA 3CC4S 2HGMA 2GO9A 3S7RA 3US5A 4WFBQ 1U1PA 5LSOA 3PIPQ 3VAJA 5GADU 2RRBA 3L3CA 1M5OC 2JX2A 3UE2A 3CCQS 1VQ7S 2OSRA 3I56S 1YIJS 1U1LA 4Y00A 5DDQC 2DNOA 4PR6A 2E44A 3IWNC 2MZJA 4FXVA 2M52A 2DO4A 2YWKA 3VAKA 1VBXA 4OZ0A 3MDFA 4TU8A 4IOCQ 3BO2A 2NLWA 1X4CA 3HHNB 2X1GA 2DNGA 2YTCA 4EGLA 2V94A 1JMTA 2E5HA 4V19X 2A3JA 2KRRA 3UD3P 2CQ2A 2MKKA 2F9JA 2XNRA 2I2YA 2M7SA 2EK6A 2DK2A 2DGXA 3THTA 2MJNA 2J0QD 1YJ9S 2NZ4A 4Z2XA 2HZCA 5JVGQ 2KT5A 2YKAA 4FXWA 3VF0B 3SDEB 1U1OA 2MSSA 1A7GE 2D9PA 2LA6A 1BY9A 3MUVP 2HYIB 2MQQA 3CXCR 2HVZA 3I55S 2OIHA 3VAIA 5GAEU 1FT8A 1WI8A 1S72S 1VC5A 3MOJB 4ERDA 4WIIA 3R1LA 2KU7A 2M2BA 5LSLA 3R27A 2J0SD 3ZZYA 1WG5A 2DGWA 3SDEA 3BS9A 1VQ9S 4LJMA 1VC6A 1FHTA 1QVFR 2JWNA 2PE8A 3EX7B 3CCRS 4WFNQ 2G0CA 2MY8A 1VBZA 2ADCA 3S6EA 2D3OR 1WTBA 1X0FA 2MB0B 2LQ5A 3MURP 2VODA 1M5VC 3SMZA 2DITA 1VQLS 3R1HA 1X5TA 1KOOA 2DNKA 1SJFA 2M8HA 2DIUA 4YB1P 1UP1A 2LMIA 1L3KA 2I38A 3MI7X 3JB9k 2MKSA 4TU9A 2DB1A 3CD6S 3G9CA 5HO4A 2MY7A 1N52B 2YH0A 1VQKS 4F02A 1WG4A 3EGNA 3CCVS 1RKJA 2DNMA 2M88A 1FNXH 2CPXA 4ZKAA 2XB2D 1WELA 3CCMS 5LJ3Y 2KN4A 3G96A 2MQOA 2DH8A 1WWHA 1ZZFA 4WFAQ 5CYJA 2MZRA 1HD0A 2MZ1A 2CPYA 4OZ1A 1H2TZ 2CQGA 3J7YU 1Q81T 1KQSR 4BS2A 1VQ8S 1K8AT 2F9DA 3RW6A 5GMKa 1OIAA 4TU7A 4QPTA 5ITHA 1H2UX 2M4MA 1Q82T 3CULA 2Q79A 1WHYA 1M1KT 3VAFA 2ADBA 2CQHA 3CC7S 4YUDA 2KRBA 1X4DA 4QQBA 4WKRA 5GAHU 2JRSA 2MKIA
chains in the Genus database with same CATH superfamily
4PWDA 2XZTB 3EM1A 2V34A 4DR1J 3PW0A 3QRPA 3NOCA 3R7BB 4IRDA 3BBCA 4CCHA 2QG9B 5D0EA 3CDUA 3BDEA 2OP5A 1IKYA 5E2QA 2UUWA 4C98A 4UZCA 3CGIA 3IWXA 4OYBA 5E3PA 2HNZA 4DF8A 2YWGA 1AB8A 3JSRA 4KBIA 2F8HA 3GFXA 3K8VA 2VV5A 4QOTA 4O3RA 3DOKB 2B3TB 2XCPA 5JVHQ 1IKXA 1YVFA 4Y65A 5ETVA 4OV1A 5B0FA 3OL8A 4P7TA 1PBAA 4X62J 3M2RB 2QLBB 1S4FA 1U25A 1U1MA 4DUYJ 2GJFA 4ED5A 3V81A 5IT9U 3M9MB 3C2PA 1U7LA 2VB6A 2YKOA 2YWHA 2BR0A 3JSMA 4KO0B 2F8MA 1K0VA 4LSNA 2YX7A 3QZ7A 2MEWA 3A1YG 1D8YA 2V2QA 2AD9A 1XMOF 4JI8F 3NY0A 3W61A 1QJHA 5KFWA 3PO5A 3PIOQ 1K47A 1KBRA 2DNYA 5T7LA 5GAHI 1U1KA 2JEIA 2W4DA 2VC0A 1ZAXA 2CQIA 4ZVFA 3L95X 2BOAA 2X3DA 3MXHP 4TY8B 1XEZA 4CO2A 3J7ZT 2ZKUA 2HIQA 1F9HA 3TUPA 5DZ7A 3ZTSA 2WHOA 2MXYA 5EWFA 2CQ3A 1RWNB 3QJLA 4FDFA 4NCGB 4LF6J 3AD7C 5C25B 3UVJB 4LF4J 1R8HA 3TR5A 1IJFB 1ZS6A 3SZ2A 1Q86T 5IT4A 4Y6IA 4F8RA 3C66A 3VHQA 4J9NA 2OEJA 4ZPAA 1IR2A 2XS5A 4ZIWA 4CQ1A 2F63A 3I96A 3HSJA 1QE1B 4JV5F 1MSWD 4CLWA 3FCVA 1YKWA 3KNAA 4YB5A 1UW9A 1VQ5S 2FHKA 4WK3A 2W9BB 3TOQA 3DRPB 1P9QC 4EYIB 4CLUA 1TL7B 2NYHA 1LWFA 3B4MA 3PW7A 4UY85 3Q2SC 3B54A 1U49A 8ATCB 2QTWA 2HW3A 2W9AA 4HT5A 1HBOB 2IVFB 2MJUA 2YX1A 3SQGA 2OPPA 1ELOA 4MMOA 1NK0A 4F4ZA 3DRSB 4QPXA 3BSCA 3L7PA 3PKMA 1QTMA 4DX5A 2ZOMA 3TI0A 3O8WA 2ZVIA 1TKTA 3MDFA 2A6MA 1VIXA 4J9OA 1EHWA 1RT6A 2ZC4A 4I4BA 2VJVA 1HWUA 2POKA 2JLGA 1REVB 4ZP6A 1I1GA 2EKNA 1E6VB 2PSZA 2ZH9A 1YQHA 5K9FA 3KK1B 2R8HA 2OFHX 4OZ2A 1V5IB 4QWCA 2ILZA 2WONB 1K44A 3N0VA 4N7TA 4FYWB 4CT9A 4LJMA 1AFJA 4U96A 2GVZB 2JEGA 2G0CA 2DD8S 2H54B 3T1HF 3PX4A 4BC9A 2FJEB 1EKSA 4DQQA 1SPBP 2LMIA 2W9CB 1NDKA 3FBEA 5J1EB 2FIUA 1Q5YA 4G1QB 4NL5A 3QFHA 4MK7A 1YBTA 4CLZA 1S7HA 2XLJA 4NRUA 2HFZA 1R8CA 2VQFF 1MMDA 1XMQJ 2XM3A 4XDDA 1N36F 5ITHA 3D3CJ 4C8MA 2YWFA 2IYGA 3DGPA 3GSIA 3CT9A 5KFOA 4MKVA 2DH9A 1Y7PA 1FWPA 4EZ9A 2HBZB 3JAMY 3TZWA 3OL6A 4H4OA 4F0HA 1HBUA 1C0TA 4ZS6A 3H59A 4JOUA 3DLEA 1R0AB 3K17A 2OELA 3TAPA 5I42A 1SXLA 5B0GA 2RH3A 3ELHA 4U7CA 4QZVB 1XK8A 4OHWA 4PG7A 4FKXA 1RCOB 4CIOA 4TLRA 1B0TA 1SJRA 3PJ9A 2CQ1A 5LJ5Y 2H5EA 2HBYB 3CJRA 4BDPA 5IQ6A 2QA4S 5E7OB 1RAOA 1Q1KA 4K4SA 1T0TV 3BGRA 3FBBA 3DI6B 4LRBA 2H5IB 3AQOA 2GIQA 5DG8A 2L3MA 2C1EB 4ZVSB 3LAKA 5HQLA 2W2NP 3OTDA 2E1AA 4CZCA 3K57A 3MTJA 4RNFA 3DOMB 1G4CA 2CPFA 3RG6A 3P3DA 1BC6A 1F1BB 1IJEB 4FF1A 3BO4A 3GYNA 5SUHA 3KG0A 1LNQA 4ZOSA 3IGNA 4HTIA 1IBKJ 1UVIA 2HSEB 1KQFB 2LFVA 1GMUA 4DQRA 2XMWA 4J7CA 4OQJA 3VAMA 1P1TA 5A2QY 1KTQA 3RBZA 5D15A 2L9WA 1RT7B 1U48A 5JUMA 4ZCIA 3I0SB 1YHQS 3KG1A 5B0EA 4PG5A 4ES2A 2KM8C 2IJRA 3G87A 4RNHA 5CABA 1RK8A 2ZDPA 3DOLB 2PT0A 1R43A 3NGKA 3MCOA 3ZZUA 5B0DA 3E3XA 2B0GA 1ZTTA 3D9BA 4Y28C 4K4WA 4J9SA 4B9NA 2IFXA 2CPZA 4ICLA 4KY3A 4ILLA 1TMMA 4YHHF 4IR1A 1HI8A 4ES3A 3W2VB 2DGOA 2PC6A 2PFDA 2EFNA 2LCWA 5HSPA 1NDCA 1JLFB 3UI3A 1OY8A 3BGOP 3AJ2A 1S1UA 2HPUA 2VPXB 3R5JB 3UCUP 2FVCA 3CJ4A 4JB8B 1VQPS 4ZLPA 4LIRA 2I1RA 3HKZD 2QO3A 4RW8A 4MYUA 3FQKA 4Q2LA 2CQDA 5A0YA 3C6TA 3KK2A 2FLNA 2DGQA 2BUNA 4AQYF 2AYMA 4IO9Q 4NXMJ 4YY3J 5K14B 1IQTA 3DDIA 2YKNB 5C2CA 5B08A 3G8TA 7FD1A 1PSDA 5F9NA 2W8KA 2JX2A 1RUSA 2JEJA 1EX8A 1AXQA 2YY3A 2YVSA 3OT9A 2FY8A 4NLRA 3GONA 1LFPA 4FBTA 3PCOB 3SCJE 2GJIA 2FJBB 4JI5J 4J9UE 4ZPBA 1FD8A 1HNWJ 2MKKA 3N5FA 4LFAJ 3TVYA 1S49A 1U24A 2ZUGA 2GFFA 4JI1J 1KFDA 5KFDA 3D66A 4NCAA 2NUHA 3TX0A 1HR0F 4DCJB 1WI8A 2Z0GA 4OJGA 4P2SA 3ETMA 3MZIA 3TNVA 3EZOA 1OJ4A 4AXIA 1HHSA 3RZAA 2B4PA 5CYQB 1WTBA 1MU2A 2VA2A 1RT3B 2VODA 2P9GA 2DITA 2Z58B 1GT8A 3KHHA 2X7IA 5D3GB 3H98A 2HHUA 2UV8A 3LUYA 1B4SA 1VQKS 5C42B 4C11B 3R6LB 2XB2D 3QWUA 2UXBJ 4DBQA 1RBAA 2FGOA 3A3PB 2JDJA 2MQ8A 2CQGA 1Q81T 1NJWA 2RDDA 3KK3A 4Y3CA 3M9NB 3GYGA 1BWEA 3CC7S 1W26A 2QRRA 3WDOA 2ASJA 3FSYA 4O3SA 5E33A 1JLQB 2MQLA 4EBEA 2O67A 5I3PA 2HWTA 2GVDB 4DSFA 1W2BR 4R5PB 5M2UA 2Y1LB 3K5PA 1AW0A 4JI6J 4NRTA 4DV4F 3T5JA 2UVWA 4WE1B 2WSFC 3C14A 1W7WA 2VL1A 2R8IA 4FP9A 3N79A 4DLEA 2WVCA 1RCXB 1Q78A 2DVIA 1TL4A 4LF8F 4JI7J 1L3VA 1XNQF 1PYTA 5DO2A 1YRXA 3CE8A 2G1HA 2CYYA 1VHIA 3MCNA 1S0MA 3GTYX 2RRNA 4DN0A 2QYCA 5KFBA 1AZSB 1IBLJ 3K7RA 4PPZA 2DPIA 2M70A 3ILJA 2BJEA 1AUDA 2UP1A 4I1TA 1RA7A 4I2QB 7FDRA 2L41A 4A8XA 4QIGA 1LWEB 2M8DB 4MTPA 1BQMA 3D6MB 3DCAA 2V68A 5DS7A 4XIUA 3AOCA 1WNEA 2B43A 4A4JA 2YH1A 4USIA 3RB6A 2NS1B 4P7VA 2JLFA 2B51A 2UVVA 5KFRA 3DRRA 4M5DA 1EZZB 3TA0A 4OHYA 2I5JA 2FHOB 5F8GA 1UWAA 4DX7A 2B6AA 4IFVB 1TL3B 1FJCA 1HHTP 4WYLA 5KFHA 2XNQA 2HHXA 4W90B 2B8QA 4DV5J 4F0MA 3EGZA 1RP5A 2UUCJ 1M1GA 3D7SB 2E5IA 4WCEQ 1D0EA 3CUNA 3EVMA 3SSRA 2CQBA 4RWXA 1NJXA 1F9EB 4JI2F 1GX6A 1M5HA 2KM8B 1C1CB 3M8SA 3MEGA 1WORA 1X4BA 3IRWP 5HANA 2ASYA 1ZA1B 2K7KA 4QW8A 2QL5B 4B3OA 3QGHA 2COLA 2UZAA 1RU1A 1PJ5A 3KTQA 3AXKA 4IH7A 3VALA 3G8SA 5IV4A 3RBDA 1GX5A 2JC0A 1M1HA 2AWZA 1KLMB 4ZK7M 2DNZA 1N32J 1UAWA 4YDDB 4B9MA 1D9FA 1ZM4A 3PX0A 3KMQA 1GXLA 1OYDA 1T9XA 4QR2A 4UUXA 3HVWA 3HHLC 5GAGI 1EKRA 1UJ4A 3ZZRA 4X4QA 2OPRA 5CXTA 1V5VA 2P5VA 4DQPA 2WOMB 2WW4A 3B4DA 4GKKJ 1IN0A 4QYZK 2XMAA 4FXDA 2DKOB 2RHSB 2H3EB 4LRAA 4NOHA 4YB6A 3ZO7A 5IOLA 3NGTA 4X62F 3ET6A 1SB6A 3MEEA 2PEBA 3MMBA 1X60A 5CCMA 4QCLA 1F5BA 1GNKA 3KJQB 1NHKL 1UVLA 4DUYF 4PG6A 2HHWA 2IDEA 2K2PA 3BQ2A 2YTCA 4PWUA 4A8OA 1YRTA 2NZ4A 2RKIB 1HIYA 3VF0B 2VFVA 1HQEB 3MTKA 1RAGB 1TU0B 2P6SA 4ZVOB 1NZ8A 3C6UB 2Z2LA 1MW7A 2NYIA 2LQBA 3MOJB 4YB7A 1BQNB 2KU7A 5LSLA 2J0SD 2DGWA 4M5MA 3SDEA 2ALYB 2J9CA 5DQIA 4UOCA 1JLBB 2DRAA 3Q8YA 3CMQA 5A8WA 2PI4A 4IDKA 4DV7J 4PZVA 5CD4A 3PTWA 5IWAJ 1X9SA 2JH3A 1N5YB 3KKFA 3T9ZA 1JLAB 3TVZA 2CNOB 1TL1A 2R7OA 2ACMA 5DRKA 2C2OB 1R27B 4M95A 1VISA 3M1VB 4LF6F 1C4AA 2AEFA 2QX0A 1UFLA 1S99A 4Z37A 4ECXA 3T9NA 1NPPA 4PWWA 2OPQB 4DS4A 2J6UA 2XYPB 3UDLA 2QMUB 3FKBA 3A3NB 2WK4A 1MN9A 1H2UX 2R8KA 2IA0A 4LSZB 4YUDA 2J9EA 4LFCJ 5E3AA 4XPEA 4DSIA 1UFWA 2MGZA 4J9MA 4LMZA 3MR3A 1Q8BA 4ECQA 2V2KA 4YQWA 1Y9OA 3MAAB 1U0SA 5MAOA 4USHA 4QWEA 3R3TA 2V63A 4WP8A 3PR4A 4O3OA 3ONQA 3FMWA 2F4FA 3PXGa 5ETLA 1FRMA 5KFNA 2EEYA 4YR3A 3Q24A 4NI2B 3F0NA 2XYHB 1V9OA 2FVQA 2D1CA 3DOKA 3MPYA 4DV3F 3HVAA 1EQMA 1ROFA 2XI2A 2GGPB 2WW8A 2HS0A 1CJVB 2LDIA 4EU0A 1DBDA 3QRQA 1FEHA 2DGSA 2FHJA 4NCBA 4LBPA 3M2RA 4NLYA 1D9AA 2BJ7A 2ZOFA 1Y0HA 2VOOA 3VGSA 5KG5A 1FFGB 1IUJA 3MR2A 2LDYA 1VQYA 2ASLA 1URRA 4KO0A 4DCOB 3MUTP 3OHAA 3NGUA 4KGZB 2KFZA 3JAMU 4ZPWR 2HQCA 3IXQA 3OXFA 5U47A 2GC8A 4DX8H 4L3KA 3HHLD 2MQMA 2BANB 3P49B 4YP3A 1XR5A 2Y8YA 5AXMA 2FJXA 4A8FA 4A8WA 3IFEA 2HIYA 2QSWA 4ZPVR 3N6LA 1WDDA 2XWXA 3RGIA 3NS6A 3UN2A 4TY8A 4YDXA 3OR2B 3TYTA 4ANCA 4WZMA 3GR0A 2DNHA 4ED8A 3PJXA 3MD1A 1RT2B 1HNXJ 2PO4A 4KT0C 3ZNUA 2DISA 2YNFB 4DI6A 5L1LA 3BN4A 2FLLA 5C25A 1DLOB 1IWAA 3CTRA 4CTAB 3UVJA 3X3UA 3NEKA 4LF7F 3BSNA 2DR6A 1ZAVA 1Y10A 1S0NA 4ZIVA 1NJIT 3QNWB 2A18A 2MZTA 3CDEA 2RQKA 3X1LB 5G0RB 1A9NB 1EP4B 1P1LA 2C3OA 3TA1A 4LR9A 4WWSA 2QSFA 1SH2A 2VKRA 2J0WA 5A2QU 3VTIA 1WHVA 4F50A 2UUBF 1JLGA 2W9BA 1Y3JA 3HHLB 2XO7A 3DRPA 1H2VZ 1TL7A 2CAJA 4ECSA 3WZ0A 4G1IA 1YDLA 3NS7B 1HBOA 4DL2A 1BD6A 1Q5VA 5EWGA 3CCQS 2PN6A 1U1LA 5KT5A 4TY9A 1SI9A 1B70B 4OZ0A 1X4CA 3K5MA 1UZDA 2QA2A 2EK6A 3HSGA 2O66A 3CCZA 1A7GE 3DFEA 1BY9A 1TAQA 1IBKF 1MMLA 3SCKE 1XNRJ 1REVA 3NGDA 5KFXA 3NXZA 3H5SA 3R27A 3HX9A 3AD8C 3CDAA 1E6VA 3DHWC 4ED4A 3OTOJ 2HQFA 1QVFR 1MWYA 1VK3A 3KK1A 2NQPA 1RKIA 2RILA 2FGCA 4K8RA 4XK8C 2NR0A 1U0HB 2KJVA 2WONA 1F0XA 1UWBB 2ZFHA 3LA0A 2QA1A 5H9FJ 1JXLA 2VFSA 2GVZA 1S59A 4OX9J 1S76D 1KWMA 5HO4A 2OMOA 1NJYA 2EFGA 1NKBA 4JV2A 1N52B 2DNMA 4WU3A 2VQEJ 2M88A 3ENWA 2W9CA 5J1EA 4KE5A 2GHWA 3FRZA 4HACB 5F8HA 2ZH8A 3A12A 4ZVGA 5HVHA 1KQSR 2W7OA 1S1XB 4HHHA 2BQ3A 1TP7A 4QPTA 4WFYA 2E1RA 2LQJA 1HBNB 1PJ7A 1NB7A 2HK3A 4YFUA 1LW0A 2H4YB 4PABA 1F2HA 3BB5A 5KFAA 5H9EK 5LOQA 1OQ6A 3CCTA 5CHCB 5FD1A 3FGVA 3FUYA 5DM6Q 2VFTA 5KFGA 2V69A 2UU9J 3IG1A 1C4CA 4HDHA 1RWPB 2AJ2A 2XI3A 3PFOA 2RU3A 4XTTA 4L72B 3TZXA 4KTQA 2NUUG 3TARA 4DFPA 2MZQA 1N6QB 1Y5NB 1R0AA 3DU6A 3DLGB 4OMFG 4FN5A 1QSSA 4CWBA 1PYSB 1U1RA 1HNVB 3H2UB 4E8UA 2B4OA 3CJTA 3BKUA 2YQ0A 3ISZA 4X64F 4Q5VA 1HA1A 2FTRA 4QWDA 1OS5A 2VHGA 4NXMF 4ZLJA 3I4PA 2ATCB 2OMLA 3FCWA 1KR4A 3UQSA 5IS2A 3RRGA 1EB0A 2BZ2A 5F3ZA 3ZZOA 1YJWS 2MHNA 1VGYA 2IYIA 1UPMB 5IM0B 3KLIA 4ILRA 2HBQB 1SH3A 3EZ5A 4G1PA 2G1DA 4IUFA 4ED2A 3FSXA 1X4GA 5C24A 5A8KB 2XZDB 4L75A 3DOMA 4CO3A 3FDSA 4LFAF 2M9KA 4KQZA 1IBMF 5B0BA 4EBDA 3UWTA 2LEAA 4TN2A 1U6FA 3HVTA 4O3QA 1N88A 4IH5A 2DR9A 3GIMA 1NRKA 2K1RB 3BN7A 3NBPB 3DXSX 1S9EB 2XTJP 4OJHA 5IQQA 1N34J 1MG7A 2V5HG 2LVWA 2P9CA 5HLFA 1RT7A 4DZ6A 4GVBA 1LQ9A 3QT6A 3I0SA 3W65A 3VGVA 4DPOA 1X5OA 5DQGA 2O3DA 1XMOJ 1RLDA 1S6OA 2XS2A 3EJMA 1HYSA 2HFVA 2WVDA 2ZJQQ 3H2VE 2AKWB 4OX6A 3QT5A 3JSBA 1HKAA 1D09B 3LH2S 1EETA 4MK8A 3WHIA 3CD7A 3NGSA 1CQMA 2LECA 3IM9A 3R6GB 4EZ6A 3W2VA 3EDQB 1RT4A 2WVFA 1JLFA 3BYRA 3HKWA 4Y2MA 2V8VA 4JI6F 1RTJA 3J7A1 2E1MC 1ZAWA 1I94J 2KO1A 1HNZJ 1LKZA 5IT9Y 4IG0B 2O5DA 2K8GA 1XIQA 3FFIB 2XSFA 3CO0P 2N82B 4DMZA 1FRJA 3KOAA 4JI7F 5F8NA 3MM9A 3US5A 1LOUA 4RO0A 2IC3B 2Z2MA 2GIRA 3AY0A 5HQMA 5DZ6A 1IBLF 1TKDA 5K14A 4JV5J 2YKNA 4J9RA 4N76A 1RGVA 2CWKA 1UEKA 3TQEA 5F41A 3I31A 1LXJA 1FDBA 2NXJA 4OHZA 3PY8A 3UR3C 3CJ8A 5EX0A 1YG0A 2KRRA 2I2YA 2HZCA 4GVLA 4MIWA 4FZVA 1U1OA 2OAUA 3CXCR 2ROEA 2OH2A 3BGLA 2CJQA 1S72S 1YX2A 3E51A 5CD4H 5CYMB 2BJ3A 1WG5A 4YEAA 5HAOA 4J91A 4MKBA 1VC6A 3W60A 4ID5B 5IT0A 2VH7A 4I68A 1KOOA 2DIUA 5HJXA 4J37A 1EAYC 1FERA 3MI7X 2UUCF 2QGFB 4KSEB 4IG3B 4XO0A 2DB1A 1Y5IB 2J5AA 3H0PA 5DGAA 1RT3A 4NLUA 2EKYA 2HAFA 3LP2A 3UN3A 2XMKA 4AL6A 1XR6A 6FD1A 4QR1A 4WFAQ 4M5NA 5HROA 4OZ1A 3J7YU 4C11A 2F9DA 4ZDNA 5ETPA 4TU7A 3KDOA 1R6YA 2PDAA 3VAFA 2ADBA 1ITPA 4U6PA 1SUQB 1R89A 2BABA 1UEVA 1M0SA 4KGVB 2CZ4A 4M5JA 5KFCA 2WRMA 1SQGA 2XLKA 3QT7A 3HULA 1S1TA 2X1FA 1HQUB 2MKJA 2E5LF 3EGVA 2DEJA 1N32F 1JLQA 3R97A 4JV0A 2DH7A 2WBMA 2GVDA 4PXDA 2BJ9A 4R5PA 3OXLA 1RB0A 1NJZA 3KHLA 5GAEI 2QE5A 1TUGB 2VQFJ 2XSJB 4WE1A 2JLEA 2BV3A 2V4QA 1FESA 1N36J 3Q83A 5DM7Q 3GWCA 1UA1A 4A8KA 3GG0A 3M6XA 3CDBA 3MGJA 3T41A 2B7BB 2GQCA 3W7BA 4RU9A 3RB4A 3IS9A 1FNMA 5KG2A 2RJZA 1T94A 1T03B 1ZOTA 1CJKB 1PCAA 4I69A 3D1HA 3Q8SB 1AZSA 3CVKA 1PGZA 3POTB 2KKHA 3KJVB 2HGNA 5EHHA 4I2QA 2HNDB 2XY6A 3W9JA 4NA3A 5KT4A 2OLWA 2LEPA 3T1AA 1VFJA 3S01A 4JP8A 4F0KA 1S0VA 3NS5A 4CI0B 3D0IE 2EC0A 3R2CJ 1FCAA 1QAYA 2KFNA 4K5RA 2ROGA 1DY3A 1WG1A 3BR8A 1FXLA 4GKJJ 4A46A 2BBEA 2ZBQA 2AU0A 1TKXB 2MTLA 1MN7A 1BWVA 1TAUA 1RT1B 3HZGA 2JEFA 1NSKL 4IFVA 1YZ6A 4C0BA 2CJYB 3R5DA 3UDCA 3KHGA 3DHXA 3M6VA 2HHTA 3CIZA 4DN9A 5J2NB 5DETA 4RNOA 3QFWA 5E5NA 1Q8LA 4KPCA 4O4GB 1RTHA 1H3DA 3GG1A 2CPHA 2DR8A 2I6WA 3UD5A 3A3OB 2BE7D 2I9SA 1C1CA 3VQSA 4O23A 1NSAA 2ZD1B 2OJ3A 2FJVA 4USMA 4P10A 4ZVQB 2X1AA 3M32B 3RRHA 3BPDA 2HNYB 4ZJLA 4LFCF 1TK8A 1UETA 3LW5C 4DQSA 3TJ9A 3GCWP 4B9UA 5L46A 2Q1LA 1WC0A 1Q53A 2KYXA 1BUXA 1Q79A 3OL9A 2GZOA 4ZPTR 3TANA 1W25A 1HMVB 4ZP8A 2XHWA 1KLMA 2NPFA 1NO8A 3GU0A 2GS8A 3OVAA 1DTQA 3BR9A 1I6JA 3MPWA 3QJPA 2RUSA 1TK0A 2JSXA 3PW2A 3PEHA 3MEDA 3W5YA 4DUZF 4RPFA 1VCTA 3H7HB 4DU7A 2B7CB 3A13A 3DYAB 1SL2A 1Z1ZA 1CQNA 2WOMA 2BXJA 2H5JB 3MECA 1WC5A 1SQFA 4NLWA 1M5OC 4DU8A 3UE2A 3Q89A 1OSCA 2GHVC 1IBCB 1V3ZA 2MLYA 2DO4A 2VC1A 4WFXA 3UPFA 4DR4F 2V94A 4V19X 2YBVA 1RHKB 1ZYQA 3R7SB 3VAIA 5A8RA 2AGQA 2WSEC 1NEEA 2RKIA 4LF5J 4ZMMA 1HQEA 4DFKA 3W1YC 4ZLNA 3CJQA 4B3MJ 3H5YA 3C6UA 3CCRS 3A8JA 3KMSA 6AT1B 3RB0A 1BQNA 1M5VC 3AB4B 4FF4A 2FJDB 2IVMA 1JLBA 1GTEA 2KDOA 3N6NA 3EPGA 3M9OB 3EGNA 1N5YA 4ENOA 2NZCA 4P73A 3P4UB 3ZZPA 2NCKL 1HNXF 2CDRB 5DGBA 1REGX 1IKVB 5GMKa 3M1VA 4X4VA 5D0RA 1X4DA 2QJ3A 4NEZA 5GADI 3LALA 4I7FA 2YX4A 2OPQA 4CO1A 3T3FA 1SVDA 1CULA 3FZBA 2MKHA 1N54B 3QO9B 1FEEA 2AEJA 6FDRA 3BM7A 3TUJC 3SSQA 2EFQA 5DDOC 4ZPDA 4NLQA 1ZM9A 5M2PA 4NYZA 2ABYA 4CYUA 1TMJA 1S97A 2JJ4D 1GEHA 2IHR1 3P8BB 3MAAA 5J2MB 4CNZA 4IR9A 5BJRA 2E66A 1HW9A 1E6YB 3KUGA 4DSLA 4BWJA 4BHQA 5L1IA 5L8RC 3THPA 3CJSA 4HKQA 1S1WB 3M2VB 1IWGA 3HJFA 2C28A 3K0JA 3PYGA 4OYZA 5KFZA 2VG7B 4P72A 1RWKB 2GGPA 4K4YA 2VASA 1CJVA 3EICA 2XWYA 1F6TA 4QU6A 2VG6B 2OGUA 1AT1B 2P2CB 3H2LA 3GJSB 3GV8B 1GXTA 3CCES 1OY6A 1N0VC 3I5BA 3J7Z5 1JJ2R 4I0WA 1UVJA 4KH1B 3I9V9 1SQEA 1XNQJ 4PAAA 1VQOS 2KI2A 1XNRF 2ZZTA 2C3YA 4OZ3A 2MQNA 3PM9A 2RMLA 4ID8A 5IC6B 3AA9A 3OTOF 3PYDA 3NAHA 2RVJA 3EVWA 4ECWA 4PG8A 2CQ0A 2CZVC 2RDJA 4PYDA 3CCJS 2BANA 3WQPA 3LGNA 2AJ4A 2BYCA 3RW7A 2BDPA 2YWEA 3LOUA 2W7AA 1KHWA 1YTYA 4F7VA 3H5XA 1JX4A 1AUSL 4P75A 5ETNA 4ZHRA 2IJFA 2VQEF 3OR2A 4L76A 2GX8A 2VA3A 1HARA 2ZC3A 2AJ1A 2VBWA 1Y11A 1VQ6S 2E9RX 1FKOB 4OZLA 3SI8A 3TAMB 3V81B 1RT2A 4OIXA 4F4YA 4N8OA 2YNFA 3HK2A 1ZH5A 4LSNB 3D1QA 1DLOA 4CTAA 3CJKA 2FUG9 3V6DB 2V0NA 3RR8A 2N4CA 1WDTA 3W66A 4OV6A 1S77D 2QFJA 1WHXA 4KV8B 3W2WB 3D6TB 1U8SA 4HHJA 2G2OA 3NWRA 4JI2J 2J6SA 3L7OA 2R7WA 2BM1A 1P27B 1NNDA 3BQ1A 1SBRA 2ZE2B 5G0RA 3MEKA 3CPWR 2AQ4A 4URQU 2GQQA 1EP4A 1JLCB 1LWCB 3BO3A 1JJCB 2DNRA 3EE3A 3V6HA 2J8AA 5D4PA 4NEYA 3O6QA 1SJ3P 3FJ2A 1NK6A 3IR5B 3PACA 2FLOA 3R5BA 2IMWP 1SH0A 3DM2B 2GA7A 3OJUA 3GIRA 3ENAA 1VQ7S 1D3WA 3LPEA 2HKEA 1ZBTA 3GSDA 3A8KA 1KEKA 2YWKA 3P96A 1S6PB 3QYYA 2A3JA 5AE2A 5HMWA 4UF4A 1QSLA 2F9JA 1YZ7A 2DGXA 3AB2B 4NZ0A 3OD2A 3PNIA 3NG8A 1FJGJ 3TA2A 2MSSA 3DDNA 3MUVP 2BACA 4EO6A 3BREA 3ADAC 2B8PA 1Y4ZB 1G7CB 3SV4A 3DDKA 2M2BA 3PRVA 4RW6B 2HLTA 4ITSA 3Q8QB 5D4OA 3W9IA 1VDHA 2HQ3A 1RWOB 5D0HA 2ZVSA 4IFYB 4ZPCA 2IRYA 4OYOA 2FJWA 4P2XA 5F8LA 4YB1P 1KS2A 1UP1A 1N34F 4DWIA 1QAIA 4ZVTB 5LMNJ 5BXIA 3BDPA 2B9YA 3G6VA 3RYLA 1N33J 3SQGB 4ZP7A 4ZKAA 4DV6J 3PRBA 4KKOB 1HHQA 4Y34A 2AW0A 4HH0A 2HK2A 3AJDA 5B09A 2CPYA 3OVSA 1H2TZ 3TZZA 1VQ8S 4A48A 4TQRA 3RW6A 1T9WA 3I9ZA 2PA8D 2E7VA 1WHYA 1YBUA 4AE5A 2CQHA 2KRBA 3FCHA 4HACA 1RZMA 4ECTA 1KQKA 2D9OA 4OYAA 4WFZA 5J1PA 3RRKA 1S1XA 4TXSA 3GPAA 1KRPA 4LF9F 4RW9B 1HBNA 1DRZA 3HFVA 1T9YA 3ENVA 4J9KA 4C3LA 1TTHB 4WF9Q 4ELVA 5HATA 1NBEB 3V6JA 2BVZA 4B02A 4C2MA 1RHJB 1QSYA 5D78A 2BKNA 3EVOA 1EIYB 4CLLA 4USKA 2HMIB 1I94F 1I5OB 1HNZF 4WJBA 3DU5A 4P6QA 3FEXB 4ZA1A 5AE3A 3GMGA 3RB3A 4DF4A 1HNVA 3K89A 3ZZ0A 4WZQA 5ETRA 4A8MP 1EARA 2GW8A 2YNHB 1RSCA 2JZ5A 1Q95G 4U67Q 2QZ8A 1NK9A 3PV8A 2VDIA 3DRXA 1BE4A 3LGMA 2QEXS 2OSQA 1HNIA 5KG6A 4M8LA 4C4WA 4PQAA 2FC9A 3DGPB 2DNNA 1Q7LB 1ICEB 5IM0A 2DJWA 4FNHA 4C97A 4M5GA 4WK1A 4RLEA 5A8KA 3KXDA 2CZ9A 1HBMA 3BKTA 2L08A 1U6ZA 3LP0B 1HI0P 4CM0A 5I42B 1WTFA 3M2UB 5LT5A 5C2GA 4DV3J 1K0TA 3LANA 2CPIA 3B82A 1FKPB 3OSPA 2X3GA 3ZZZA 1JKHB 2ZITA 2KHDA 3M8YA 5LXYA 2K1RA 4JV1A 3NBPA 4FKYA 2KG1A 1S9EA 3J81U 5JMNA 2V2VA 1M5PC 4G3IA 3E01B 1LEOA 1HWJA 4K2JA 3I82A 2KXHA 2DO0A 5CA5A 2L9NA 1O6XA 3VZIA 2CJKA 3O5TB 4EBCA 2K3KA 1NK7A 1JXEA 4W92B 5KFKA 1CBKA 1UCNA 2CNKB 3TO8A 2R7SA 2Z2YB 3HXMA 2IPOB 2NXUA 1Q8IA 2ZJRQ 1N4LA 4WTOB 2M0GB 2W24A 1K1QA 3JQMA 4I6AA 3MFIA 4G65A 2YNIB 3K5NA 2JHEA 1R8PA 3KLGB 4CRJA 1VRQC 3T5KA 4FS1A 2DGVA 3IN5A 1YITS 2BKOA 4A47A 2ZZMA 1GFWB 1VJQA 1R3NA 2B4UA 4CLFA 4S0MA 2JFDA 5GVQA 2U2FA 3R5GA 2W01A 1WF2A 2CPEA 4LF7J 1AROP 3ETOA 1IKWB 4IG0A 3W8GA 4WFBQ 1CJUB 1RT5B 3FFIA 4NPOA 3L3CA 3SSSA 4PUOB 2AT1B 2E44A 3IWNC 3MF5A 2IC3A 2W7PA 4FYDA 4R8UA 2A10A 1WACA 1YK9A 5E0OA 5KG7A 1S6QA 2Z2ZA 1IR1A 2XNRA 2ILYA 3IP0A 4FS2A 1PG5B 2HHSA 4FXWA 4PYAA 4RZRA 3I55S 1GAOA 2UUBJ 5BYSA 1DQ8A 5F0UA 3M8PA 1TR0A 1DTTB 1X9WA 3QSIA 2E7XA 3H5UA 3BKFA 1N5TA 3PW5A 1T7PA 1U4BA 2LXFA 3V2UC 4J9VA 1VBZA 1NSQA 2D3OR 1F3VA 4GKJF 3MURP 1D1UA 3D4JA 4F04B 5CYMA 2DNKA 1KKHA 3KLEA 2OO4A 1T02A 2V2ZA 3C6TB 2EG1A 2FHMA 5F0WA 5HMZA 1CEZA 4ID5A 2VUGA 1RKJA 2Z8QA 4U8YA 3K5OA 4EFAC 4IG3A 4JYAJ 1KQGB 1HD0A 3SYZA 1XTZA 2A2CA 4E2FB 1T9VA 2GCFA 1KSPA 3QAUA 4BS2A 4DFMA 3D0HE 3H42A 2Z56B 1M1KT 5HBMA 5M2RA 2E1PA 5GAHU 1LXNA 2ZNYA 2A6OA 3GIJA 3OV7A 2KXFA 1KN6A 3Q0AA 2UXDJ 1N5SA 1SJQA 1SUQA 5KFMA 5KT3A 1N8RT 4OZNA 3DLLQ 2NXCA 4E0DA 2KG0A 1WC3A 4ZJOA 1B7FA 2HHPA 2F40A 3MR7A 1GMWD 4RBVA 1MU2B 5KFPA 1EJ7L 1VLYA 3BF4A 2EFPA 2U1AA 1HPZB 3D28A 2IAJB 1RAHB 1VC0A 4F3QA 1RU2A 3ISNC 1FDNA 1APSA 4EEYA 1FJEB 1K9MT 4O44B 4Q43A 1H72C 1NUEA 3LWLA 2HLUA 3CW2C 1FRHA 5EUHA 3OW2R 5FDLA 3HDSA 1DHMA 1YI2S 3H20A 4D3HA 4BCAA 4B08A 1T03A 2RQCA 2YNGA 2B9XA 3ZTQA 2XYGB 1UTAA 3PW4A 1CJKA 4EI2A 2V6AA 2VPYB 5GMEA 3OTBA 3KJFB 4CO4A 2ZJPQ 2VU5A 2R2SA 1FE0A 1X5SA 2IM3A 3VCDA 3POTA 1X0PA 4OJ3A 3KJVA 4ED7A 1X5PA 1ZZNA 2CG8A 2RUGA 4X64J 2GMJA 2HNDA 2LXUA 3GV5B 3Q8PB 1NPKA 4NYOA 4LF5F 2F4VF 3EXYA 4B3MF 2BW2A 3UDVA 4ALZA 1VLOA 2DPJA 5KT2A 4DV1F 5HVGA 2B4VA 3ULHA 1RHQB 4UTGA 5BR8J 1TELA 4DV0F 1RADB 4JI4F 1YJRA 4K59A 2OTLS 2MHEA 4B9VA 1TKXA 2MMYA 3T6JA 2LA4A 2AMCB 1RT1A 2PD1A 2EVZA 4LR7A 2ACYA 3LPYA 3WX4A 4OX7A 3VGUA 1RWMB 1T05B 5J2NA 1IBMJ 2OPSB 5L9NA 5L1JA 1YJNS 1IVZA 4O4GA 1ZTWA 2XY5A 3PKYA 5K8NA 2UVUA 2HZVA 2ZBCA 5T41A 4QU7A 2ZD1A 4ED0A 3CCLS 4QYRA 4OL8A 4H4KC 4H4MB 1T8EA 2HNYA 4X2BA 2CA9A 4C8KA 3C16B 4MK9A 3QGIA 1VR6A 1PAEX 1CSJA 3H90A 3NMRA 2JC1A 4A8YA 2B6AB 1U02A 1YSJA 4MIAA 1NKCA 4U8VA 4OX8A 3NCQA 3HO1A 3IGVA 1HMVA 3EPIA 3UNYA 3GQCA 3R8YA 2GAGC 5HMYA 3GYXB 2AX0A 3BYPA 3CC4S 2HGMA 1S6UA 1S12A 4B9SA 1SL0A 4C48A 4ZVPB 2RRBA 4DX6A 3VGTA 3I56S 1YIJS 3DYAA 4PR6A 3C15B 1KHVA 4USVA 2X1GA 4HDGA 4DPTA 4I64A 1H7WA 4Z2XA 4BC7A 3G8QA 1RJJA 5CZVA 3HCXA 4LRDA 1DARA 2J7UA 2D7SA 3IBFB 3PHEA 2R2RA 2HG4A 2ZDOA 1RDRA 4TYBA 2KZMA 2PE8A 3EX7B 2MY8A 2HS3A 7AT1B 4ANDA 4LBIA 3CNQP 4N5SA 1RI7A 5THWA 3NKYA 4ZN3A 3GFHA 1B0VA 3GV7B 1RWXB 1BLUA 3PZPA 3Q86A 2HURA 3ISND 3CD6S 2F65A 3TX8A 2HFSA 3U02A 1RWVB 4AT1B 2RE1A 5FLXY 4IKAA 2ZKTA 4A8SA 5CQGA 1PILA 2I0XA 1WSRA 3LF0A 1WWHA 5ETTA 4CM2A 2PMHA 3F56A 4DUTA 1RHUB 2BEFA 3CULA 4ZCMA 2NXEA 3MAHA 2E7WA 3MM6B 4QQBA 1XJWB 5L39A 5KFLA 3OFHA 2HZAA 1IKVA 3OJSA 3RU0A 5C5JA 5K8PA 3KLFB 1DQAA 2N7YA 2VDHA 1AA1B 1S57A 3QO9A 4CLTA 3ITHB 3HHEA 5DG7A 2FC8A 1FDAA 1YGYA 4WXWA 3BEGB 5AXLA 1X4EA 4DJBA 2RF2B 4IH6A 3AFGA 3CJ5A 2CJXB 4OI3A 1F5CA 2GAHC 5J2MA 3NCPA 4ECRA 2FHJD 1E6YA 3UN5A 3KUEA 4M5LA 4M63A 4AYBD 4PQUA 3FK4A 4DQIA 3BH6B 2OD4A 2ERRA 3G6YA 4D3GA 4JI3F 4LUBA 1RAJA 2E5LJ 3M2VA 1Y5LB 1YBAA 4KHPF 2KJWA 1PAUB 4QWBA 1A0OB 3OUYB 4AFFA 4Q0BA 4CO0A 2RD5C 2VG7A 2DHSA 1FJGF 3NLCA 2MGZB 4PXBA 4B17A 1R6VA 3RBEA 4C9DA 1VQNS 2CQPA 4KHRA 1UA0A 4DS5A 1U09A 4OFZA 3EUNA 4PRFA 1DFDA 4MH8A 2DRDA 2WAQD 1CC8A 3RTVA 5JXSA 3G71S 4B3TF 4K5SA 1H74A 4M1KA 3H4DA 4DLGA 3FBFA 4I56A 2FD2A 5IZHA 1X4HA 3GIIA 2BRKA 3HVRA 4DPXA 1J5OA 5LMNF 4FYXB 4LREA 3V4MA 3K8WA 1H6KX 3MHYA 4LQ9A 1N33F 4DV6F 3BSOA 3MM8B 2XCAA 3IR7B 4WP3A 1U2FA 2DY9A 2V4JB 5CCLA 2VFRA 4J9QA 1CLFA 4RW4B 2OEMA 2HRYA 2H9ZA 3CD5A 1FKOA 3TAMA 2HVDA 1M90T 2E9TA 1HQ2A 2UUTA 2DNPA 2Y0BB 3QATA 4TNOA 2CIMA 2YQ1A 3NGRA 1WC4A 4WU2A 4ZCLA 1QY7A 2WBRA 1CG2A 2C3UA 3JSYA 1QAJA 1FA0A 3V6DA 3Q2TC 1FWKA 5KOWA 3AOBA 1WI6A 4N41A 4KV8A 3K2YA 3W2WA 3KHRA 4YS2A 1HWIA 1F9FA 1NAQA 1MLAA 4X65F 2C3PA 4NZ7A 2ZE2A 1OYEA 3M7VA 2G4BA 1S4EA 5HVFA 4NLTA 1JLCA 2GO9A 1LWCA 1TKZB 1AYEA 3V4IB 3O1LA 2IY5B 3JYTB 2A2DA 4EO8A 5HP1B 3M30B 2BQUA 3T6BA 3VAKA 4PPDA 3I0RB 3DM2A 3R9LA 4BLGA 4EGLA 3HFKA 2Y8WA 2M7SA 3HM9A 2DXEA 1X31C 4C8NA 4Y2AA 1R0BG 3UDEA 3VWSA 3ZC4A 3QWPA 2DCUB 2MQQA 5D6GA 1S6PA 2WCXA 3FEZA 2FZCB 3KYLA 2C3MA 5CAAA 4NX9A 4WIIA 3R1LA 2AJ0A 4DUZJ 3N4WA 1FE4A 5KFUA 5HI7A 2ADCA 5AJ3F 3AQPA 1X5TA 3KLHB 2P6TA 8RUCA 3G82B 4NXNF 1PC5A 4PG4A 4I2PB 4RW6A 1T11A 4X4SA 3LTOA 1JLEB 1UKUA 4DR5J 1JLGB 5KG3A 4QIVA 1RQ0A 4DR6J 4IFYA 4DR4J 1BXNA 4OYXA 3OLAA 4ED3A 2DH8A 1TL5A 3FVYA 5E3RA 5AXKA 1M5SA 1OIAA 4DFJA 3RBXA 1H38A 4O0NA 2DTJA 4KKOA 4HHUA 2AZ3A 4NA1A 3SBMA 2JRSA 3UR0A 2AYEA 2NXNA 3IAS9 4RJVA 3BPSP 1N48A 5KFEA 3NCRA 1WKKA 4F4XA 1XQIA 3HFZB 3EXCX 3NRBA 2V4RA 3CSKA 2HQGA 4Q7AA 4UUWA 3P5TL 4I67A 2RNEA 2JL9A 1NM2A 1T95A 2CNNB 1SC4B 4CH1A 3GE9A 5J2PB 4RW9A 2RT3A 4PXEA 1SC3B 1KONA 2G0JA 3LP1B 2ZH4A 4TYAA 2DHAA 2G13A 4ZJQA 2ZHBA 4ATNA 4C0OC 1F3FA 4NCGA 4RNMA 2ZH6A 3A8IA 5KFYA 2QMXA 4MIBA 2HMIA 1FO1A 4LBHA 2RB7A 4ECUA 1XBWA 2R4FA 5E41A 3BV8A 1WF1A 4L3NA 2O01C 2DR5A 2HHQA 1SKWA 1H98A 3GJQB 2VICA 4IYQA 1FK9B 2H48B 1SV5B 1X4AA 2PA3A 4PCQA 2DEIA 2HVEA 2YNHA 3HJVA 2YPZA 2FQQB 2XQCA 2FJAB 1QE1A 2PGCA 3OXGA 2BJDA 4F3OA 4QIEA 1LW0B 2AYBA 1PKUA 3VV2B 4WKYA 5GAGU 5D8HB 2KTQA 2O1PA 2VG5B 2IRUA 1ACMB 5HQ8A 2Q6BA 2BE2B 1NLKL 4USUA 4KAIA 3IG1B 4DR2F 2DHXA 2IDLA 4V1Ak 1X7VA 3LP0A 5DDRC 3D67A 3NNAA 4DR3J 2XG8A 3M05A 2AHOB 3M2UA 2QMWA 4NZ6A 1BGXT 1FKPA 4NE9C 2E29A 2LU1A 4USWA 3SV3A 1JKHA 3MM7B 2KL8A 1S48A 4CP5A 2ASDA 1X9MA 1VRTB 3DRSA 4GO5X 4CT8A 3R5CA 3N9UC 4HTJA 4ZVUB 4JYAF 3TP2A 1N0UA 1RAEB 1WJ9A 1NB2A 2RS8A 4F67A 3D6FB 3E01A 3Q8VA 4ELUA 3KLIB 3H4BA 1G2EA 1QLNA 1CS4B 1RYRA 3G6XA 1WHWA 3VQTA 2DNLA 5C24B 2C42A 3NOGA 4K4VA 2W1BA 4KJIA 2RIJA 9ATCB 3KUHA 1C1BB 2UXDF 4W98A 5HN0A 2IBKA 4DPWA 3PR5B 4KB7A 2FVSA 3CCUS 4N56A 1PIEA 1U2CA 3P45B 2IMOA 5B7WA 3HVTB 4O3NA 2BMBA 4YOEA 3EWGA 2VD3A 4ZVHA 3FSIA 4DHVA 2YNIA 3FNNA 2CADA 4K4XA 4K0KF 4WTYA 3NAIA 4UOFA 1ULRA 3KLGA 4ZITA 4C8YA 4G1QA 4DPYA 3OBIA 4ILMA 2XGQA 3GZ7A 2VFUA 1VRUB 5HLFB 4UY8T 5IC4B 3RUBL 4ECZA 1JIHA 3I32A 4FBUA 1U1PA 4GVBB 3NWGA 2AP6A 1H0HB 1BMQB 4QIFA 3UFCX 3QMQA 4UT4A 5D4LA 4OI1A 1IKWA 1CJUA 2MZJA 1RT5A 4ZLLA 1HYSB 4IOCQ 2NLWA 3HHNB 2DNGA 2QLJB 4PUOA 5H9FK 4P9SA 1EETB 5JVGQ 4L6V3 2CJBA 3TQ1A 5J2QB 4LFBF 2HVZA 3QQCD 1IXKA 3AXMA 1RT4B 2V67A 1O51A 3OPKA 1TV6B 3F41A 2H65B 1G3OA 5E3QA 4GC6A 3W64A 2LQ5A 4AXJA 4Q8FA 1DTTA 1RWWB 5F8IA 1NH8A 1RTJB 3MM5B 5CZXA 5EX3A 3DI6A 2MKSA 5BR8F 4TU9A 4I6YA 1RTDB 5BYRA 2MY7A 3HT0A 4OZ5A 3ICLA 4IQMA 3D1OA 1C2PA 2Y1RI 3KLVA 2XZWA 1KTVA 3MM9B 2VBYA 1WELA 1ZETA 5IV3A 1U45A 1RABB 3UW1A 3RAXA 2ZH1A 2QN6B 3QLHB 3EMTA 2MLZA 3V6KA 1C0UB 3MMJA 2YXLA 4EWTA 3R7NB 3MMAB 3HMJG 2BA9A 2JVRA 1OSDA 4IRCA 2H1YA 1PO6A 2DIVA 3GILA 1D8ZA 4NLVA 3KFWX 1S9GB 1MWZA 2MDAA 4KGXB 2J76E 2UVRA 4C8OA 4PKDB 3VVTA 3MWBA 3FRYA 2DR7A 1RHRB 1HI1A 2R2TA 3QIDA 2Y0SD 4TQSA 1LWXA 4MT1A 4NA2A 4YN3B 4X4TA 4K50A 2C2DA 2ZWOA 3IO1A 3DOLA 2R8JA 3L7UA 2PI5A 3TAQA 2C22A 2B56A 1Q0NA 1QD1A 3W8PA 5I3UB 1RA6A 2APOA 3PG9A 1Y3KA 3LP2B 3MR5A 2OD6A 1HPZA 3CDWA 2IAJA 4NWBA 5FLXU 4LF9J 2KT2A 3VZHA 4O44A 5HROB 3M8ZA 3TRGA 1RTIB 3THVA 1MROB 2QLWA 4DG1B 4Q8EA 1TQLA 1FD2A 4KHMA 2HVHA 2HAIA 3M8QB 1DAXA 1RE1B 2UUAJ 5L9XA 2VONA 4FYYB 4U95A 2CWXA 2R7UA 1UEUA 1KNZA 2HGLA 2R7RA 5EN1A 5KG1A 1S1TB 3L4BC 4ED6A 3NL0A 1KC8T 2LP4A 2D3ZA 2BE9B 4NLSA 2XO6A 2ZEJA 3HSZA 3QZ8A 3W5ZA 4L73A 2V9KA 1IM6A 4IOBA 1SJ1A 3E2EA 4Y2KA 5DG9A 2NSCA 3CWJA 8AT1B 3QAEA 1RBOB 2WVBA 3QIPB 3M6UA 2WB1D 4AD6A 3AODA 3V5RA 3HF5A 2SXLA 3IS9B 3ENQA 3QGPA 3OVBA 4C7QA 1PC4A 4FF3A 3F44A 1GMWA 1X4FA 4QWAA 2AV5A 1Z4UA 1NU4A 3GJRB 2V8HA 3GCXP 3ILIA 4DR7F 1N5VA 2HWIA 2B9EA 3I5CA 1GTHA 1OQ3A 1T05A 3M8WA 4O0IA 2L9DA 2OPSA 4Q44A 1HFEL 2ZBIA 3M6WA 4OJ1A 2CQCA 2LKZA 3AH6A 3ZTOA 3HPOA 5F9LA 2EW9A 2BW7A 2D3O1 1PBUA 2DYAA 3D68A 3HSDA 2W4PA 1VHFA 2V8PA 4LVNP 5CYQA 4TLQA 1HLWA 1B3TA 1B64A 4H4MA 3DGVA 3MPUB 4Z7CA 2J0XA 4MFBB 3C16A 4Z7YA 5D3GA 2WSCC 5DDPC 2ZWPA 3G6ES 2RQMA 3MUMP 2CKWA 5C42A 4DSJA 3UCZP 4M5KA 1TZ0A 3NMAA 3A8EA 4ECYA 2QA4G 3S7RA 4DPUA 2ZM6J 4U9RA 2B5JB 2E1CA 1FFWB 1RHMB 3OR1B 1RTHB 2V50A 4WYWA 4B3SJ 2MKYA 2HFNA 5ETSA 5LL6d 1FVQA 2HHHJ 1VBXA 2DBBA 3T5LA 2OUGA 3UD3P 1IM4A 2CQ2A 2F1FA 3UO0A 2FVPA 3FMBA 3THTA 2J0QD 3DNCA 3C15A 1KVIA 2H51B 2MLXA 2CDQA 2LA6A 2HYIB 4QYZJ 2P8IA 3DLKB 3U7JA 3MMCB 4LIWA 3J81Y 5JJBA 3HLUA 3TW0A 1WOPA 4MKAA 1OY9A 9RUBA 1V3SA 2V9WA 4DR1F 2OEKA 3OSNA 1IQZA 2W2QP 3Q8UA 3LWMA 3SMZA 4OLOA 3R1HA 1FKAF 2XMVA 3TZYA 1U8WA 1DTQB 3P5BP 2M8HA 1JQGA 4WBFA 3SFGA 3MEDB 1HW8A 1FI4A 4F02A 5ADZA 2LLZA 1FVSA 3EDRB 1FNXH 3WBZA 3AT1B 3CCMS 1S10A 4NYPA 1ZZFA 2MZRA 1LWEA 3MECB 2R7VA 3I4HX 2YKMB 1LW2B 1KVJA 2D3UA 2HWHA 4OI0A 2KZZA 4LSLB 3D6HB 2XMJA 4HI1A 4BWMA 1N5QA 3H40A 5GMDA 2IBOA 3U27A 2PEHA 5K8MA 1OPIA 4FPIA 5LM7E 3CJ3A 4J9PA 3MM6A 4V19J 3QJJA 4KFBB 1FF2A 4DDFA 4ZP9A 1TL3A 5C7PA 3P6YC 3TEGA 5A8RB 1VJWA 4UZBA 3KLFA 2A1BA 2XULA 1VQ4S 1U47A 4KR0B 3M8RA 4CLYA 1R8BA 2PMWA 3JQKA 3SXLA 1TUVA 2GNKA 2MKCA 2E5GA 1S79A 1YLXA 1WD6A 3ITHA 3OHBA 2C2NA 1B7YB 2EBEA 1T3NA 1FX4A 2GMLA 2CPJA 5BYQA 2FY1A 2FVRA 5F8JA 1XWLA 2KYZA 4XDCA 3QRRA 2RF2A 3Q8RB 1S1VB 1L3TA 3HZEA 2W2PP 3KWMA 2CVIA 3ILLA 4MKYA 4A8QA 1S5ZA 1NPRA 1WKLA 4IO1A 4F26A 2G9OA 4YMEA 5A6PA 1NHVA 4B9TA 3MCMA 4LF4F 2ZBRA 5ETQA 1XERA 4I7FB 1CULB 4KRWA 2N3OA 3G4SS 1TVRB 4LF2A 1RBLA 4DL6A 4LQ3A 1Z2LA 3VR1A 5E3CA 3OUYA 4ECVA 2DY1A 2EFVA 3ZXWA 5KFFA 1XC9A 4CYUB 2EI5A 4AL5A 2ZZNA 4C6AA 1FRXA 4MYTA 1NKEA 1SIWB 5L38A 3ZFVA 3GP9A 2DHHA 1GQEA 1FXRA 1K73T 4DR5F 3MCSA 2R7XA 2KXNB 1WOSA 4Y2CA 4DR6F 2LQ9A 3AA8A 4RX6A 1MMNA 2E9ZA 4G6VB 4Q2MA 1VMBA 4KYZA 1AFIA 3MD3A 2YKQA 2QLXA 4N77A 3PO4A 2HQIA 1L5UA 2Q6CA 4TVAB 2QFIA 3MM8A 3HP6A 2F4VJ 2AEMA 1WEZA 4RL1A 2V4JA 1DZ5A 5LMUJ 4DV1J 4RW7B 1DQ9A 4RW4A 2LEBA 1ZM2A 1GK8A 3WIUA 4DV0J 4JI4J 4C8LA 1CJTB 4FPRA 4H54A 1T9TA 4F3MA 2OKQA 1SKRA 3B6BA 1S9FA 1BHNA 1NK8A 2ZH7A 2ZNZA 4M5HA 3D5MA 1JLAA 1XR7A 3DXBA 3OQ2A 4UQTA 5CH7B 4HVZA 1FRKA 4H4KA 3CD0A 3C3LA 2LYVA 3IC1A 4UW2A 4F4AA 5LSOA 4X4NA 4DL0C 4Q45A 2NREA 4OYIA 3KNGA 4ZHRB 1L3SA 4JI0J 1V3RA 1TKZA 5DDQC 3V4IA 3SIPB 3DKDA 4FXVA 4OI2A 1O8BA 1Q16B 4ANEA 4FVCA 1SIZA 3T1YJ 4B9LA 3IRXB 3BO2A 4I6WA 3JYTA 3C19A 4W4MA 4P74A 5HP1A 2DK2A 3M30A 2J7WA 4HLBA 3C46A 1SC6A 3N6MA 3I0RA 1FTCA 4J90A 3CJKB 1XMQF 4HR2A 1JNZB 5GAEU 1VC5A 1LFWA 2CVEA 3QGGA 4WIQA 2AJFE 2Z4PA 5A76A 1FHTA 3ZZTA 2HVIA 3IR6B 1SKSA 4CLSA 1VQLS 4FF2A 4F4WA 4NI2A 4BBYA 2R2UA 4K7QA 4DSKA 1L3KA 3D54A 3G86A 4DR3F 3DMJB 4OI4A 3ZNJ1 2R9LA 4FYVB 2GIFA 5SZTA 1WG4A 4PXCA 4C0HA 3KLHA 1OPZA 1O5JA 3G82A 4I2PA 4K4ZA 3SCLE 1JLEA 3PFEA 3G96A 3O2IA 4HL9A 3HT3A 4PWDB 2MZ1A 3BQ0A 1HWKA 1J5EJ 1K8AT 5I4MA 4HH1A 2Q79A 2NPIA 3E8OA 1IKYB 1SL1A 2YKPA 3LAMA 2OHDA 2HHVA 5B0CA 4WPAA 1OO0B 1OWXA 2HNZB 2FZGB 3Q23A 1P9YA 4DL3A 2JNJA 3CCWA 4R0EA 2ZHAA 4JBCA 2WTFA 2OTJS 4DL4A 4ER8A 1IKXB 3U1LA 5FIIA 1QM9A 1U1QA 3F73A 1KDNA 2AJQA 5K8OA 3JQJA 2KH9A 3U1MA 1PYOB 1Q7YT 1LV5A 1YWXA 1VYAA 2M5YA 3CIMA 5J2PA 3JTNA 4DV2J 1HL6A 5KFQA 1WC1A 3T5HA 3LP1A 5H9EJ 2UXCJ 2QT7A 3GJTB 4QBUA 1F60B 1XN9A 3JSMB 3DLHA 4LRFA 4B3RJ 3CCSS 2HQDA 1F5AA 2W4CA 2KHCA 2MSTA 2YPYA 1Q4RA 4X66J 1JK9B 4AUKA 1FXDA 2VKZG 5KFTA 2ZHOA 5KG0A 1EQ0A 3BGFA 5T7LB 1JJHA 2VOPA 2QL9B 4Y2IA 1XMBA 5HK4A 1FK9A 1SV5A 3J7YI 4CDIA 4RBTA 5DLGA 2C2KB 4GRSA 1VIOA 1RWUA 1NZAA 4OZJA 2CXEA 1UZHA 3QBCA 3I87A 1RISA 1DJ0A 4F25A 4RUCA 1P8GA 1JXVA 4YR0A 2HEKA 2VG5A 5IXUA 4M5IA 4KC5A 3J80Y 3AJ1A 2BE2A 2DHGA 3HI9A 3HHLA 4P52A 4X4RA 3RR7A 3NNCA 1ZPVA 4JI3J 4OHVA 4ZVRB 1G6BA 3GFZA 2RDIA 3LGHA 4KHPJ 3DC2A 4U7UD 1CC7A 2R7TA 3VAHA 4XPCA 3TEHB 4C3KA 4PEOA 3W9HA 3PX6A 2XS7A 1SJ4P 2FZKB 3MM7A 2QIFA 2RS2A 4OI6A 3NNHA 5AXNA 1FRIA 4YY3F 1VRTA 3FC9A 1V6HA 2ZBPA 2PMZD 2Q43A 2MZSA 2EXUA 4AL7A 3TWZA 1HNIB 3CC2S 1KFSA 2RSQA 3ILOA 4B3TJ 4QR0A 1CS4A 2XGPA 5ETMA 2EWHA 1LWFB 1VBYA 4X4PA 1VOMA 1HBMB 4JI5F 1C1BA 1HNWF 1UW4A 5KG4A 3VVUA 5G4DA 1FRLA 5FJ4A 3CB4A 1U0HA 2KB2A 2GJ2A 1UWBA 4JI1F 2OPPB 4N8NA 1WEXA 4FNIA 4HEA9 5H1SV 1RYSA 4EK2A 1UFKA 4RBUA 1UVMA 4F2SA 4KGMA 3CJ0A 3L09A 1YRUA 4O4RA 3PIPQ 2ZH3A 2QC3A 4NLOA 2HFOA 3VAJA 1TKTB 5GADU 3K58A 3A4TA 1RT6B 1VRUA 2OSRA 2CFXA 4RNNA 4R25A 2Q66A 2G0IA 4DSEA 4TU8A 2GMHA 2E5HA 3Q22A 1WKJA 4RUBA 4JI8J 2UXBF 4USTA 2VPZB 2XHCA 3KDNA 2XMUA 2UUAF 3BBBA 1D9DA 2RHQB 1H73A 2OIHA 3M4XA 1FT8A 4X65J 2FDNA 4RUAA 1ZM3A 3ZZYA 4GC7A 3MAQA 3SCIE 3BS9A 1VQ9S 2XMTA 1N6QA 3HHDA 2JWNA 2I8EA 3DLGA 4WFNQ 5KOXA 5J2QA 3OFEA 3MFHA 2VBZA 3OFFA 4ETXA 4LF1A 1LK5A 3MOZA 1ZPWX 1SJFA 1TV6A 3BH7B 3BGUA 4EYHB 2UV8G 3K59A 2F5GA 3PVXA 2ATLA 1UMJA 2YH0A 4OHXA 4WP9A 3CCVS 3MM5A 2XY7A 2BX6A 2MQOA 4ED1A 2HRUA 1FDDA 1RTDA 1SCJB 4KH0B 1RAIB 2AGPA 4TKTA 4H4OB 2OFGX 3DRYA 1HBUB 1Q82T 1C0TB 2W2MP 5AT1B 1Y00A 3GIKA 3DLEB 2K06A 4R8UB 2MPUA 4KGKA 2BQRA 5ETKA 1S6QB 3QLHA 3SEOA 1C0UA 5AJ3J 3MPDA 2C2ZB 2BOPA 2BJ8A 2E5JA 5IFMA 3MMAA 5AE1A 4NXNJ 4DL7A 2ROPA 2F7VA 4HYKA 2EFOA 2BM0A 1NK5A 1NHUA 3D0GE 5A6WA 2R42A 2IRXA 5EWEA 3M8PB 1VQSA 1JWWA 4X84A 3JS9A 3TVKA 2PIIA 2MYFA 1L3UA 1S9GA 1UVNA 3BGRB 1G1XA 3HD2A 1UPPA 2AZ1A 2PFFB 2F8EX 4CH0S 1M5KC 1WC6A 1UJ6A 2IM1A 3KLEB 4C8ZA 1LK7A 1R8AA 3WC0A 4DZDA 2QV6A 3TJ8A 1RAFB 4XAKA 3QSYB 1TUWA 1KD1T 4M94A 1U1NA 2ZH2A 2ZM6F 2QLFB 4DV5F 2EK1A 2C2EA 5HJYA 5I3UA 2CRLA 4B3SF 2IM2A 3CEDA 1VS3A 2HHHF 2HBRB 1TK5A 1QUPA 1VBKA 3PHTA 3W5XA 2RQ4A 1HD1A 5HBMB 4J5OA 3EZUA 1RTIA 3IA0A 1MROA 4DG1A 3WIVA 1YJUA 2W2OP 3OFGA 4K4UA 1UVKA 4OYMA 3FQLA 3M8QA 1FTRA 2CQ4A 4P71A 4CO5A 3B8HA 5L1KA 3T1HJ 2F3JA 3AAWB 5DQHA 4UOGA 2JOQA 4HI2A 3CMAS 1JJ4A 2HRTA 5HMXA 1WF0A 2JVOA 5EDWA 2A0FB 1KOHA 2CG4A 2XEXA 4ICLB 4MAKA 3VAGA 1NH7A 2BJ1A 2R3VA 4NMLA 3PYEA 5D4NA 2G2YA 2W8LA 1FJ7A 3U1NA 4IQXA 2C2MB 3AD9C 1YJVA 2BRLA 1URNA 3N28A 2CPDA 1FFSB 1QUVA 4DEZA 2B9WA 3QIPA 1JNRB 4GKKF 5FDLB 4NASA 1S1UB 2QL7B 3OTEA 2YNGB 3W63A 3DLJA 4JUZA 5T14A 4Y0FA 2H4WB 4DR2J 1NXIA 1TFWA 3WC2A 5DLFA 4NLXA 1RXOB 4RW8B 2KVIA 3TUIC 2LQ8A 5LXRA 1PJ6A 1RLCL 5A0YB 4CLKA 3KK2B 4IRKA 2AGOA 2KFYA 2FYXA 2K7JA 3AHPA 3PEJA 5DJBA 1UL3A 5MLCV 4DOZA 2CJAA 2Z57B 2EG2A 4MFBA 5KFJA 3O3LA 3I5AA 2ZOGA 1KLNA 2GQ2A 2KT3A 1VK8A 2Y1IA 4DV7F 2OI2A 5IWAF 4Y00A 3JTOA 3R2DJ 2DNOA 2VBXA 1MNEA 2B5JA 2J9DA 1YJTA 3HD1A 3OR1A 1JMTA 2WVEA 4GMKA 3IMQJ 2ZUAA 2RU9A 3QPIA 2MJNA 5KFSA 4NLGA 1YJ9S 4ZVEA 1U2RA 2KT5A 2VPWB 4X4UA 2D9PA 1HQUA 3KG4A 1FNOA 4F2RA 1NDLA 2J6TA 4K0KJ 1S7IA 1WOOA 3CJ2A 2VZ9A 1R7IA 1P6TA 3IM8A 2DCLA 3DLKA 1QDUB 3S6EA 1X0FA 2QYGA 2XSJA 3MMCA 2XC9A 4UQGA 4X4OA 3D3BJ 2M3DA 3IAM9 2EBGA 5KFIA 5K20B 3JB9k 4EMDA 4OYWA 3FZ2A 2N4DA 2Y3YA 4F36A 2HS4A 1R0CB 2RAQA 4RUHA 3GFYA 5KAKA 5KFVA 3LO3A 5F3TA 2CPXA 2IVYA 4KPYA 2IA6A 3KK3B 4USJC 1KVKA 5B0AA 5CYJA 2BKPA 4YHHJ 4RWWA 2CJ9A 4LFBJ 3NP5A 3PDNA 2R8GA 2AX1A 3SFUA 2WB4A 2M4MA 3CO9A 4DCPB 3EGWB 2Y9HA 1KP6A 1FX2A 5K5MA 2J7KA 2MKIA 2IIHA 2YKMA 1LW2A 5HL7Q 4LT6A 1VQMS 4LSLA 2FB0A 3C14B 3UNGC 3OL7A 5LMUF 4IOAQ 4ZCKA 1GH8A 3EYZA 3MPVA 2D41A 4EUVA 3DLBA 3RAQA 1S0OA 2R7QA 4KFBA 4U7UK 3UCGA 2Y1JA 4HT7A 2WZ1A 4ZN1A 2DXFA 3J7AN 3J81j 2FPHX 4AQYJ 1A6LA 3IBWA 1YJ7A 4KIAA 3CF5Q 1WSVA 2GV1A 4OLPA 4ELTA 2D69A 2HFUA 2ALZA 3H8YA 3K5LA 4CNYA 3GR1A 2DNQA 4K4TA 1BQMB 2GO8A 2L48A 5KT7A 1W2IA 1F2GA 2XMMA 1QVGR 1TFYA 1I51B 4N47A 4JI0F 5KTQA 4RU2A 2VF3A 1RAAB 2G2ZA 1S1VA 3FEYB 3M32A 4O3PA 2LXIA 4YR2A 4GO7X 5LSRA 1WEYA 3T1YF 3DRRB 3KJNB 4M5DB 3OLBA 2I5JB 3S8SA 4F4KA 2V8GA 5D0GA 1HR0J 1O0PA 3LQVA 1OMSA 2YWWA 4NLDA 2Q3PA 2DGUA 1Q8KA 3PJWA 3G2XA 1H7XA 2N3LA 1CVJA 1J2VA 2EC2A 5EGYA 4MJKA 2RRAA 1J27A 2LU2A 2DXDA 1TVRA 4NMXA 4C3MA 2AYGA 2CUYA 3IWLA 3MEGB 2KVQE 4B3OB 3QT8A 3ZTRA 2C2RA 1RTZA 4LVOP 4R0JA 2Z30B 4QW9A 2GHPA 2ZH5A 4QIWD 3N5BA 3D2WA 4PQUB 3CMES 5D77A 1J5EF 2IJNA 4P2MA 1NCLA 4E98A 2XBPA 2MQPA 1DURA 4UOHA 5I3QA 3HHKA 2D74B 2AIRB 4Q0BB 2N7CA 2CNLB 2VJUA 3I6PA 4CLPA 4K2XA 3UD4P 3O44A 4DV4J 2OPRB 4LR8A 3R5AA 2IM0A 4LRCA 1U26A 1QTNB 3T19A 2X1BA 2AF6A 2DGTA 1CPZA 4QJVA 4RW7A 2NSBA 2J9DE 1R31A 4URGA 2V8DA 1U6BA 2K3IA 4LF8J 3IBCB 3TJAA 1NSPA 1CJTA 2FLPA 3GB0A 1WUUA 3ET6B 4URSA 3MEEB 3J80U 1GMVA 1BQXA 3MMBB 3MR6A 1B99A 1I3OB 2VIHA 3H25A 4DXLA 4DV2F 5KT6A 4DR7J 3BSAA 3OTCA 2UXCF 2DT9A 3C8YA 1J5OB 4P2FA 3SQOP 5J1NA 1NMEB 1IR0A 2DRBA 3B78A 1SKUB 1HWLA 1ZA2B 1NDPA 1QAXA 4B3RF 3BZQA 4OX9F 2M52A 1T9UA 3JTPA 4FVMA 2W25A 1RACB 3ZTPA 4ES1A 3RJMB 4X66F 3WX8A 1JB0C 5F8MA 3RAMA 3AOAA 2J8SA 4L74A 1FWLA 1X8DA 4ETZA 2YKAA 3SDEB 5RUBA 3L9ZA 3IRXA 4RR5A 3N01A 1Z2ZA 3W3SA 2X51A 4ERDA 4OYPA 1MWQA 5A8WB 4IDKB 3W62A 1GXUA 3PYFA 4WXOA 3FBCA 5ETOA 2EPIA 1TL1B 2MB0B 2JFKA 1B0PA 3PRDA 1K1SA 2P9EA 2I38A 1UJ5A 4J9LA 3TUZC 2UU9F 3G9CA 3DN9A 1S1WA 4DL5A 2YQ3A 3JXOA 3GLJA 4RKUC 1SC1B 4NLPA 1T3OA 5LJ3Y 2KN4A 1NK4A 3DMJA 2XLIA 1N56A 3BJYA 4CH7A 3BBFA 3S1TA 1VI7A 4WKRA 2VG6A
chains in the Genus database with same CATH topology
4PWDA 2ZNYA 4YFUA 2IBOA 1LW0A 3U27A 2PEHA 3GIJA 5K8MA 3OV7A 3BB5A 3PW0A 2KXFA 5KFAA 1OPIA 1KN6A 3Q0AA 4IRDA 1N5SA 3CJ3A 1OQ6A 4J9PA 3CCTA 4CCHA 3MM6A 4V19J 3CDUA 5CHCB 3BDEA 1SJQA 1IKYA 1SUQA 2OP5A 5KFMA 4OZNA 5KT3A 1N8RT 3DLLQ 5FD1A 3QJJA 5E2QA 2UUWA 3FGVA 4C98A 4KFBB 4E0DA 1FF2A 3CGIA 4DDFA 4ZP9A 5DM6Q 1TL3A 2VFTA 5KFGA 3IG1A 3IWXA 1C4CA 4HDHA 3P6YC 5A8RB 2KG0A 2RU3A 2XI3A 3PFOA 1VJWA 4L72B 5E3PA 2HNZA 3KLFA 2A1BA 2XULA 4DF8A 1B7FA 1VQ4S 4KTQA 2YWGA 2NUUG 3TARA 4KR0B 1U47A 4DFPA 3JSRA 3M8RA 2MZQA 2F8HA 1Y5NB 1R8BA 3GFXA 4KBIA 1R0AA 3K8VA 2HHPA 2VV5A 3DU6A 4QOTA 2F40A 3DLGB 4OMFG 3SXLA 4FN5A 1QSSA 1TUVA 1U1RA 4O3RA 1HNVB 2GNKA 3H2UB 3DOKB 4RBVA 4E8UA 1MU2B 2B3TB 2B4OA 2E5GA 2MKCA 2XCPA 1S79A 1IKXA 5JVHQ 5KFPA 1VLYA 1WD6A 1YVFA 3ITHA 4Y65A 3ISZA 3OHBA 4X64F 4Q5VA 3BF4A 2EBEA 2EFPA 2U1AA 1HPZB 4OV1A 3D28A 5B0FA 2GMLA 2IAJB 1T3NA 3OL8A 1HA1A 2CPJA 4P7TA 1VC0A 4F3QA 5BYQA 2FY1A 2FTRA 2FVRA 5F8JA 1XWLA 4QWDA 3ISNC 1OS5A 1FDNA 4NXMF 1APSA 4EEYA 2KYZA 1FJEB 1K9MT 3I4PA 4XDCA 2OMLA 4O44B 3M2RB 2RF2A 3Q8RB 1KR4A 3UQSA 1S1VB 5IS2A 4Q43A 1L3TA 3LWLA 3RRGA 3HZEA 1S4FA 2HLUA 1FRHA 1U25A 3KWMA 1U1MA 5EUHA 3OW2R 2CVIA 4ED5A 5FDLA 4MKYA 2BZ2A 3HDSA 5F3ZA 4A8QA 3V81A 1DHMA 3ZZOA 3M9MB 1YI2S 2MHNA 3H20A 4IO1A 1YJWS 4F26A 1VGYA 2IYIA 3C2PA 2G9OA 1U7LA 2VB6A 3KLIA 4YMEA 2YKOA 5IM0B 2YWHA 4ILRA 4D3HA 4BCAA 4KO0B 5A6PA 3JSMA 2BR0A 1SH3A 2F8MA 4B08A 3EZ5A 4G1PA 1T03A 1K0VA 2RQCA 2YNGA 2G1DA 1NHVA 2B9XA 4LSNA 4IUFA 4ED2A 2YX7A 3FSXA 3PW4A 1X4GA 5C24A 3QZ7A 5A8KB 4B9TA 4LF4F 2VPYB 3A1YG 3OTBA 1D8YA 3DOMA 2ZJPQ 4CO4A 2AD9A 4CO3A 1XERA 4I7FB 3FDSA 4LFAF 2R2SA 1FE0A 1XMOF 2M9KA 4KRWA 4JI8F 1X5SA 2IM3A 1QJHA 5KFWA 3VCDA 3PO5A 2N3OA 3PIOQ 4KQZA 3G4SS 1TVRB 3POTA 1X0PA 1IBMF 4OJ3A 5B0BA 3KJVA 4ED7A 1X5PA 1ZZNA 4DL6A 4LQ3A 2DNYA 5T7LA 1Z2LA 2RUGA 2GMJA 4EBDA 3VR1A 5E3CA 2HNDA 2LXUA 5GAHI 3OUYA 1U1KA 2JEIA 2W4DA 2VC0A 1ZAXA 2CQIA 2LEAA 3UWTA 4ZVFA 4ECVA 4TN2A 1U6FA 3HVTA 3L95X 3GV5B 2EFVA 4O3QA 3Q8PB 4NYOA 1N88A 4IH5A 2DR9A 4LF5F 3GIMA 1NRKA 2K1RB 5KFFA 1XC9A 3MXHP 4TY8B 2F4VF 1XEZA 3EXYA 3BN7A 3NBPB 4B3MF 3DXSX 4CO2A 2EI5A 3J7ZT 2BW2A 2ZKUA 2HIQA 4ALZA 4AL5A 2DPJA 5KT2A 1S9EB 2ZZNA 4OJHA 5IQQA 4DV1F 1FRXA 2B4VA 3ULHA 4MYTA 2WHOA 2MXYA 1NKEA 1SIWB 4DV0F 2V5HG 2LVWA 2P9CA 5EWFA 5HLFA 4JI4F 1YJRA 1RT7A 4K59A 2CQ3A 5L38A 2OTLS 3ZFVA 3QJLA 1GQEA 1FXRA 2MHEA 1K73T 4B9VA 4DR5F 1TKXA 3MCSA 1LQ9A 4NCGB 2R7XA 2MMYA 3T6JA 2KXNB 2LA4A 3I0SA 1RT1A 4Y2CA 5C25B 4DR6F 2LQ9A 2PD1A 4DPOA 2EVZA 3AA8A 4RX6A 1X5OA 5DQGA 2ACYA 3LPYA 1R8HA 3WX4A 1MMNA 4OX7A 2O3DA 3TR5A 2E9ZA 4G6VB 4Q2MA 1IJFB 1T05B 5J2NA 1VMBA 1S6OA 3SZ2A 1Q86T 2XS2A 5IT4A 1HYSA 2OPSB 4Y6IA 4F8RA 3C66A 5L9NA 2ZJQQ 5L1JA 1YJNS 1AFIA 4J9NA 4O4GA 3H2VE 4OX6A 1ZTWA 3MD3A 3JSBA 2YKQA 2QLXA 4N77A 2XY5A 3LH2S 3PO4A 1EETA 4MK8A 4ZPAA 5K8NA 2HQIA 3PKYA 2UVUA 1L5UA 2Q6CA 3CD7A 2ZBCA 5T41A 1CQMA 2XS5A 2LECA 4CQ1A 3MM8A 3HP6A 3I96A 4QU7A 1WEZA 4EZ6A 3W2VA 2ZD1A 1QE1B 4JV5F 4ED0A 2V4JA 1DZ5A 3CCLS 1MSWD 4QYRA 4RW7B 1DQ9A 4RW4A 4OL8A 2LEBA 4H4KC 1ZM2A 4H4MB 1T8EA 1RT4A 1JLFA 2HNYA 4X2BA 3HKWA 4C8KA 3KNAA 4Y2MA 4MK9A 2V8VA 3QGIA 4JI6F 4C8LA 4YB5A 1CSJA 1VQ5S 2FHKA 4WK3A 4FPRA 4H54A 2W9BB 3NMRA 4F3MA 2JC1A 2OKQA 1SKRA 3TOQA 3DRPB 4A8YA 1P9QC 2B6AB 4EYIB 1S9FA 1RTJA 1YSJA 3J7A1 1LWFA 3B4MA 1NK8A 2E1MC 1ZAWA 3PW7A 2ZH7A 3Q2SC 4UY85 2KO1A 2ZNZA 4MIAA 1NKCA 1LKZA 1U49A 5IT9Y 4IG0B 3D5MA 1JLAA 1XR7A 2HW3A 3DXBA 3OQ2A 4OX8A 4UQTA 5CH7B 3NCQA 2W9AA 3HO1A 3IGVA 4HT5A 1HBOB 1HMVA 2K8GA 2O5DA 3FFIB 4HVZA 2XSFA 3EPIA 1FRKA 4H4KA 2IVFB 2N82B 3GQCA 4DMZA 2MJUA 2YX1A 1FRJA 3SQGA 3KOAA 5HMYA 4JI7F 3CD0A 3C3LA 2OPPA 3GYXB 2AX0A 5F8NA 2LYVA 3IC1A 4UW2A 3CC4S 2HGMA 3MM9A 3US5A 1S6UA 1ELOA 1LOUA 5LSOA 2IC3B 4B9SA 2Z2MA 1SL0A 4MMOA 2GIRA 3AY0A 4X4NA 4DL0C 2RRBA 4Q45A 2NREA 1IBLF 3KNGA 4ZHRB 1TKDA 1NK0A 4F4ZA 5K14A 1L3SA 3DRSB 1V3RA 2YKNA 3I56S 4J9RA 1YIJS 4QPXA 4N76A 1RGVA 3DYAA 3BSCA 3L7PA 3PKMA 1TKZA 5F41A 5DDQC 3V4IA 3I31A 4PR6A 4FXVA 1QTMA 4OI2A 1KHVA 2ZOMA 1O8BA 1LXJA 3TI0A 1Q16B 1FDBA 1SIZA 3O8WA 4FVCA 4OHZA 3PY8A 1TKTA 3MDFA 3UR3C 4B9LA 3IRXB 1VIXA 3BO2A 4I6WA 3JYTA 2X1GA 5EX0A 4J9OA 4HDGA 1RT6A 2ZC4A 1YG0A 2KRRA 4I64A 4I4BA 2I2YA 5HP1A 2DK2A 3M30A 1HWUA 2J7WA 2POKA 2JLGA 1REVB 1H7WA 4Z2XA 2HZCA 4ZP6A 4HLBA 3C46A 4MIWA 1I1GA 1SC6A 4FZVA 1E6VB 2PSZA 3I0RA 3N6MA 2ZH9A 1U1OA 2OAUA 1FTCA 4BC7A 3CXCR 3G8QA 1RJJA 2ROEA 1YQHA 5CZVA 5K9FA 3CJKB 3KK1B 2OH2A 1XMQF 3BGLA 1DARA 1JNZB 2R8HA 2J7UA 2CJQA 2D7SA 2OFHX 5GAEU 1S72S 1LFWA 4QWCA 2CVEA 1VC5A 3E51A 2ILZA 3PHEA 3QGGA 2R2RA 2WONB 5CD4H 2HG4A 5CYMB 2ZDOA 3N0VA 2AJFE 1WG5A 4YEAA 2Z4PA 4CT9A 1RDRA 4LJMA 4MKBA 1VC6A 4TYBA 2KZMA