1H2UX

Structure of the human nuclear cap-binding-complex (cbc) in complex with a cap analogue m7gpppg
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
149
structure length
149
Chain Sequence
GLLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclear protein
molecule keywords 80 KDA NUCLEAR CAP BINDING PROTEIN
publication title Large-Scale Induced Fit Recognition of an M(7)Gpppg CAP Analogue by the Human Nuclear CAP-Binding Complex
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 149
sequence length 149
chains with identical sequence Y
ec nomenclature
pdb deposition date 2002-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1h2uX00
5DETA 2AYEA 4TU8A 4J5OA 5CA5A 3SMZA 2MGZB 3US5A 3P6YC 2VODA 4UQTA 4PR6A 2X1AA 2LA6A 2E5JA 3FEXB 2MY7A 5DDOC 5GADU 4TLQA 2KG0A 2LEBA 2YWKA 3CF5Q 2DNHA 5DM7Q 3UD3P 1WG5A 1X0FA 3MUMP 3CULA 2KM8C 3VAMA 2AYGA 2MSSA 1Q7YT 3CCVS 2ADBA 1M5OC 3J7YU 1PO6A 1VQPS 2N82B 1NJIT 1NO8A 2HVZA 2DHXA 1YHQS 1NU4A 5GVQA 2MZJA 3HI9A 1P1TA 2D9OA 4BS2A 3JB9k 1U1NA 4RU2A 2WBRA 2XNQA 3G9CA 1X4GA 3NMRA 2KXHA 2MKSA 3S01A 5HL7Q 3I55S 1WF2A 2HGNA 3P49B 1VQ5S 5LSOA 5IQQA 2D3OR 1AUDA 2DGTA 1X4AA 1FT8A 2MZSA 1YIJS 2DIVA 3VAHA 1X4CA 1VQNS 2CQBA 2E5GA 3DLLQ 1CVJA 1U6FA 2CQGA 4FXWA 1SJ4P 3BEGB 1M5KC 3TYTA 1L3KA 4W92B 2FC9A 1YI2S 3NS6A 4CIOA 2J0QD 1FHTA 1K8AT 2M70A 2CPIA 2DGXA 1FNXH 2I2YA 2E44A 5LSLA 4C7QA 2NLWA 2N3OA 1X5OA 1SJFA 1KOOA 3UCZP 2CQIA 2QEXS 1DHMA 3BO3A 1KOHA 2E5IA 2KH9A 3VF0B 2EK1A 2CPDA 3CPWR 1YJNS 3SXLA 3SDEB 1H6KX 3SDEA 3CCLS 3PIOQ 1UAWA 2K3KA 2MHNA 1O0PA 1WTBA 2CPFA 1U1KA 2DH8A 1DBDA 3PIPQ 2LA4A 2DNYA 1A7GE 1S72S 1WG4A 2KM8B 2U2FA 3S8SA 3CC2S 2DNMA 2BZ2A 4PKDB 1X4FA 2DNLA 1N52B 2MQOA 1M5VC 3TP2A 2VONA 1KC8T 1ZZFA 1SJRA 3CMAS 3THTA 1R8HA 1HD1A 2CQHA 1WHYA 2U1AA 4ZKAA 3CC7S 3UWTA 2N7CA 1VBXA 3VAKA 2DGUA 2BOPA 2M52A 2DB1A 2KT5A 4WCEQ 2CQCA 5IFMA 4P6QA 2CPYA 4V19X 2NZ4A 1JJ2R 2XNRA 1OO0B 2DGVA 1P27B 4U67Q 2G0CA 2MGZA 1FXLA 2MJNA 2M2BA 2XS7A 2DGOA 3U1MA 2ADCA 2M0GB 2XSFA 3K0JA 3CUNA 3G8SA 1WG1A 2KFYA 3G96A 1VBZA 2X1GA 2G4BA 2CPHA 1Q82T 2DHSA 3V4MA 2LEAA 1R8PA 2D9PA 3TO8A 3MUVP 1X4BA 3EGNA 2KG1A 2YTCA 2MMYA 3CCQS 1X4EA 3MD1A 2EK6A 5D77A 2RU3A 5JVGQ 2ZJRQ 2RQCA 2CQ2A 2DH7A 2UP1A 3FEYB 4WFAQ 2ERRA 2F3JA 2MPUA 2DNRA 2RS8A 4QU6A 3G71S 2DGQA 1N54B 4FXVA 3UCUP 1YJ9S 4OZ0A 2MZTA 1VQMS 4QQBA 2L9WA 3CCUS 3R1HA 1VC6A 2KN4A 3MUTP 1SJQA 3CTRA 2LCWA 2G1DA 1U6BA 5BJRA 2DO0A 2FPHX 2RS2A 2M88A 3H2VE 1VQLS 1WEYA 2HZCA 3MOJB 4TU9A 2DNGA 2KI2A 1VQOS 1FJEB 4W90B 2JWNA 2MSTA 1ZZNA 5EN1A 1WI6A 2LQ5A 3MI7X 1YTYA 1N8RT 2DITA 5GAHU 1U2FA 5CXTA 4F02A 2DGWA 1QM9A 2M9KA 2JVOA 4YUDA 2DNPA 3LPYA 2MZQA 2FC8A 2L08A 1X5SA 1OWXA 2JX2A 1H2VZ 2CQ1A 1PGZA 1F9FA 3S6EA 4TU7A 2MXYA 3VAJA 1FO1A 2PE8A 5GAGU 3IWNC 2M8HA 3UE2A 5CYJA 2ZJPQ 1H2TZ 2OIHA 2DNOA 2OSRA 4LMZA 2MKJA 5GMKa 1WEXA 2SXLA 4F26A 4PRFA 1UW4A 3RW7A 2X1FA 3VAGA 3VAIA 3S7RA 3R1LA 3ZZYA 4IO9Q 1M5PC 1M90T 3D2WA 1VQ4S 4Z2XA 4C0OC 2GO9A 4IOCQ 2OJ3A 2LMIA 2LYVA 3IRWP 2MZ1A 1WELA 4A8XA 2X1BA 3B4MA 1VQ8S 2KVIA 2GHPA 1JJHA 1H2UX 1YWXA 5LXYA 2LXUA 2DNNA 2YH0A 4CH1A 3CXCR 2KHCA 2Q79A 5LJ5Y 1ZH5A 2N3LA 2CPZA 4WIIA 2DNQA 4LIRA 2M7SA 4IOAQ 5ITHA 5IM0B 3OW2R 3DXBA 1DZ5A 2B0GA 2K8GA 2JRSA 2J76E 2DNZA 4ED5A 2OTJS 1JJ4A 3UD4P 5JVHQ 3BS9A 1G2EA 1UFWA 4CH0S 1U1LA 1Q81T 1K9MT 2ZJQQ 2DISA 4OZ1A 2I38A 2O3DA 1Q86T 1RK8A 2CQ4A 1B7FA 2A3JA 2DH9A 4WF9Q 2DIUA 4F25A 4WFBQ 1X5PA 1FJCA 3R27A 5GAEU 1S79A 2RNEA 1RKJA 2OTLS 1WF1A 1X4DA 2OSQA 3ULHA 3EGZA 3BO4A 2KU7A 1UP1A 1WHVA 5MLCV 5LXRA 1WWHA 3G6ES 2RRAA 1WF0A 2DHAA 2MY8A 1VQKS 2RT3A 3G8TA 1U1QA 1HL6A 3J7ZT 2J0SD 3P5TL 2MQQA 3THPA 4Y0FA 2MQPA 1VBYA 1X5TA 3N9UC 2CJKA 3CCSS 1VC5A 4QU7A 1D9AA 1U1RA 2CPJA 2L41A 2EVZA 1KD1T 4C4WA 2YKAA 3EX7B 5H1SV 2F9DA 3BO2A 1WHXA 2F9JA 3CCMS 3NS5A 2CQDA 2DO4A 1URNA 2E5HA 4Y00A 1VQ7S 2XS2A 3CCES 2CQ3A 2CPEA 2KRBA 2V94A 1VQ9S 3CCJS 1QVGR 2MZRA 2HGMA 1JMTA 5DDPC 1YJWS 1M1KT 3MD3A 1U1MA 2CPXA 2MKKA 2VOPA 2JVRA 1XN9A 5DDRC 3L3CA 1FJ7A 2DHGA 1D8ZA 2AYMA 3G4SS 1HD0A 3UCGA 1VQ6S 1OPIA 2QA4S 2M8DB 3ZZZA 2RRBA 5HO4A 3CC4S 2XB2D 3I56S 2LXIA 2MJUA 2CQ0A 3P3DA 1IQTA 3LQVA 4EGLA 1OIAA 3MURP 2HGLA 4M5DB 1SJ3P 3B4DA 2J8AA 3VALA 2XS5A 2RQ4A 2MB0B 2YH1A 1KQSR 5FJ4A 2MQNA 2MYFA 2KXFA 4WFNQ 5LJ3Y 4UY8T 1U1PA 1N88A 2RVJA 2FHOB 4CQ1A 4YOEA 1WEZA 3Q2TC 3HHNB 1HA1A 1SXLA 4YB1P 3NNHA 2HYIB 4IUFA 2MKIA 1VC0A 1K73T 2LECA 3VAFA 3MDFA 4ERDA 5DM6Q 1X4HA 3MXHP 2MKCA 3Q2SC 2MQLA 2AYBA 2KXNB 2DGSA 5DDQC 1BY9A 1A9NB 1U1OA 5IM0A 2CQPA 4LJMA 4QPTA 5D78A 2AD9A 4WKRA 2KYXA 2M4MA 2PEHA 2FY1A 1WHWA 2MKHA 3NNAA 2KRRA 3NNCA 2VOOA 3RW6A 2DK2A 2LKZA 3CD6S 1YITS 1QVFR 3H2UB 3U1LA 3CMES 3CCRS 2QFJA 1WI8A 2DNKA 1W2BR 2MQMA 1DRZA 2RUGA
chains in the Genus database with same CATH superfamily
4X66F 3MCMA 2P9CA 3J81U 3SMZA 4Q8FA 1RBAA 1UZDA 3EVMA 1XC9A 3CJQA 2GC8A 4CM0A 2MSSA 1Q7YT 4CO1A 3AXMA 5KG3A 1YHQS 2V34A 5F8HA 4RU2A 4PXCA 2QGFB 4DV3J 2HIYA 4J9KA 1D3WA 2IRUA 1S9EB 3HLUA 2D3OR 3CJ0A 4NLXA 1Q7LB 4NA1A 3NAHA 1E6VA 2I0XA 3HSZA 4LRDA 4C97A 1AFIA 4PG4A 3QT8A 2ZH7A 4K4XA 1YK9A 4DL0C 2E44A 1RISA 4M5DA 1X5OA 1HBOA 3TI0A 1Y10A 4Q0BB 5EGYA 1HBNA 2MHNA 1KNZA 2CPFA 4FVCA 4DR6F 2F1FA 4WFYA 4DV7J 2W24A 4H4KA 1RU2A 2YY3A 1YJTA 1EETA 2BE2A 1NM2A 4C8LA 1H7WA 4ANDA 2PC6A 2AMCB 4RW7A 2KT5A 4KIAA 1AZSB 2CYYA 5HVFA 4OHWA 2DGVA 4KQZA 1HNVB 4RKUC 2XI2A 4S0MA 4B3MJ 3BSAA 2B9XA 3HFKA 3D1HA 3KJQB 1HNWJ 3ISND 2XLKA 2IVFB 4KE5A 2OFHX 3FBCA 3MUVP 3A3PB 2D7SA 3EGNA 3QT7A 4C9DA 4MH8A 3QO9A 2XMVA 3KXDA 3AFGA 2E1AA 2ZC4A 5HI7A 2YXLA 1WC1A 2DNRA 4ATNA 4F2SA 2R3VA 1YRTA 2W8KA 3L95X 5D4OA 3WZ0A 5JJBA 3MUTP 3CTRA 4DQPA 5BJRA 1VQLS 1HHTP 3D6TB 1RAHB 1C0UA 3KJVA 1ZZNA 2J9DE 4LVNP 3I0RA 3ET6A 2O66A 4DSJA 3X3UA 4OZ3A 3MMCA 4CO4A 4Q43A 2JZ5A 4UT4A 3KUGA 2E9TA 3S6EA 2LDIA 1VK3A 2WOMB 4IQMA 4LMZA 1UL3A 1ROFA 1IBLJ 4UW2A 4DL2A 3HD1A 3IFEA 4P75A 5IC6B 3VVUA 1GX6A 1M90T 1HQ2A 2LYVA 1R89A 2MZ1A 1VQ8S 5L1IA 5LXYA 2E5LF 5I3UA 2LXUA 3CSKA 3M2VA 4ECRA 1LW2B 2IIHA 1WORA 1J5OA 3H5UA 3BQ0A 4M94A 4RNFA 4ZN1A 3PYGA 2VKZG 2JJ4D 1JJ4A 4CH0S 4N47A 3MF5A 1VISA 1TL7A 4KGVB 2VKRA 1KQFB 4J9RA 1RGVA 4PXBA 2CQ4A 3KOAA 2ZH2A 3BR8A 1RAEB 2HQFA 2VH7A 2NXCA 3ITHA 2K1RA 4UOFA 1PC5A 4BBYA 3A3NB 4TNOA 5H9FJ 1HNXF 3HHDA 1WSVA 1HL6A 1JK9B 2H51B 4LR8A 1RTDA 1GEHA 1C1BA 4ZVSB 2EVZA 1KTQA 5IV3A 4U6PA 2ZE2B 3EX7B 4RW4A 4NA3A 4EYIB 3E01A 3BH6B 4TLRA 2MHEA 3QJLA 4I7FB 1Y3KA 3BGRB 3CCJS 2AEFA 4DCOB 1HR0F 1RA6A 1HMVB 3EVWA 3ZZZA 5KOWA 3A8EA 3RU0A 3P3DA 1WJ9A 3VVTA 1N6QB 2ZKTA 3O1LA 4LRCA 5B09A 2QMUB 1WD6A 2YH1A 2LQBA 2N7YA 2MQNA 1RWKB 2MYFA 1SL2A 4L76A 1SC3B 4YOEA 2RQKA 3JSRA 3IG1A 1NK7A 2VBXA 2VPWB 3DRRA 1JLQB 2YKNA 4EO8A 4LJMA 4LF9F 4I2PB 1MROB 2CJXB 3DM2A 5KFQA 2W7AA 4U7UD 4DN9A 2JEFA 3H2UB 1RCXB 3CMES 2K3IA 1U49A 4IOBA 5HMWA 4LF8J 5E33A 4K59A 2XC9A 4RNHA 1S6QB 4X4NA 6FD1A 2KM8C 5SUHA 2PMHA 1NNDA 1JQGA 4IYQA 2XG8A 1VRUA 3HX9A 2DCLA 4A8MP 4KB7A 1GX5A 2A1BA 1WDDA 3K59A 4PQUA 3ZZUA 2WBRA 1W26A 1X4GA 2WSFC 4NE9C 2HGNA 3P4UB 2DGTA 1FD2A 4YR3A 1UVLA 4WKYA 4ZP7A 1HWKA 2UXDJ 5E3AA 3W2WA 3E2EA 1RHRB 4LREA 2UVUA 3K5NA 3W8GA 4LSNA 4MIWA 1WOSA 3V81A 4ECQA 2KH9A 3RAQA 5E3RA 4F36A 5T7LA 1Z4UA 3TJ8A 1O0PA 1ZAWA 3OL8A 1SIWB 1X0PA 3J7A1 4FKXA 1WG4A 2U2FA 2V8HA 2DNMA 3M30B 3IBFB 2MQOA 1M1GA 1KC8T 1RTHA 3GV5B 1R8HA 1PYOB 1URRA 3CDEA 3VAKA 2H5IB 3H4BA 3OFGA 5ETQA 2X3GA 2RIJA 5IWAF 3OFHA 4N7TA 4O3NA 2ADCA 2QTWA 3CUNA 2YWWA 1YQHA 1Q82T 2WB1D 3CCTA 3ENVA 4I67A 1QAJA 1R8PA 5E3CA 3TO8A 1HWIA 1YSJA 4CLWA 1FWPA 2BBEA 2DH7A 3FVYA 4TXSA 4URSA 4FXVA 2FGCA 4DR1J 2R8KA 1LOUA 4XO0A 5HLFB 3W64A 1S9EA 2C3PA 1TUWA 1NK9A 1EJ7L 2RDIA 4XAKA 2NSBA 2IM0A 4K4ZA 1WI6A 2GCFA 1N8RT 1E6YA 1R43A 1NDLA 2KZMA 2R7OA 3V5RA 4RW6B 1FE0A 1N32F 2QT7A 5KFSA 2ZJPQ 1RWWB 1BWVA 2F4FA 4KR0B 5FDLB 3QAEA 4IRKA 2CNLB 2B4PA 1V3RA 2BANA 2KL8A 4LFAJ 4Q44A 2LMIA 5DZ6A 3R6GB 4A8XA 1JJHA 1RLCL 2Q43A 3M6VA 3JSBA 4RZRA 1NBEB 3L7PA 1ELOA 1HNVA 2ZEJA 3LH2S 4F4AA 4C2MA 4DR5F 1Q8BA 3M1VB 1R8BA 5HJXA 5GAEI 3BS9A 3UNGC 3FBEA 4EMDA 3VCDA 2UUAF 5IT9Y 3QGGA 3R27A 5G0RB 2J6UA 4E0DA 4B3OB 2GJIA 1VHIA 2HNYA 4Y2KA 4J9LA 4ZIVA 2DHAA 3CCWA 4NLPA 3M2RA 1VQKS 2ROGA 4P71A 4MJKA 2FHKA 3THPA 1DAXA 5F8JA 3Q89A 2GV1A 2ZVSA 4C4WA 3VGTA 4J9MA 1WHXA 2F9JA 2B43A 5B08A 3KNGA 4DSFA 2V94A 4CWBA 2IYGA 5K14B 1XMQF 2HHUA 2BX6A 4C0BA 2HHVA 3QWUA 1ZM3A 1FRKA 5DQHA 2PGCA 4WFZA 5AE3A 5KG2A 2ZBRA 1HBMA 4ED2A 1KQSR 4DV5J 3G6YA 3F73A 2P6SA 2XY7A 3G8QA 1N36J 2D1CA 2NREA 2H54B 2RVJA 3DC2A 4NCGB 4Y65A 4JI1J 4NXNF 4U8YA 2J6SA 2B8PA 2FVPA 4B3TJ 3G87A 3QYYA 5DM6Q 3HMJG 1LW2A 3Q2SC 3T1HF 1LXJA 3AJ1A 3CJTA 3AB4B 2HAFA 4OX6A 4UF4A 1TVRA 3L09A 3LAKA 4WKRA 2FY1A 1WHWA 2BQRA 1U02A 4BC9A 1F60B 2RF2B 3CD6S 2G0JA 3MR2A 2QFJA 3KFWX 3SSQA 4M8LA 1W2BR 2MQMA 2ACMA 4YR2A 4GMKA 4AL6A 3GCWP 1N48A 3V6DB 3FEXB 5DDOC 2KG0A 4QYZJ 4QPXA 5J1NA 1TL3A 2RQMA 2JOQA 3EDQB 1C1CB 1BE4A 1VQPS 2EBEA 3D0IE 3D66A 3UR3C 4RR5A 3UD5A 1C4CA 2AJ0A 2ZE2A 4TQSA 1T3NA 4OL8A 3T9ZA 3OUYA 4R5PA 3BGRA 2XY5A 9ATCB 3KK2B 4K5SA 5E5NA 3DLLQ 3TUJC 3WBZA 2CQGA 1T9VA 3A8JA 4DFJA 1DTTA 4O0NA 2ZUGA 2GIQA 2BE7D 3RB0A 1N6QA 3NGKA 1Q16B 4PABA 1GTHA 3NRBA 5D3GA 1YJNS 1DQ9A 4IFYB 4NOHA 3SDEA 4PZVA 3PIOQ 4PCQA 1XQIA 5E41A 2XGPA 2LA4A 1YGYA 5J2NA 3HK2A 1MN7A 5EHHA 4TVAB 3MTKA 4I2PA 2RHSB 4KKOB 2M52A 3A8IA 4QWCA 5CYQB 4U67Q 3KHLA 4H4OB 3I9ZA 3QT5A 2M0GB 2A2CA 2R2UA 2OUGA 2BKPA 3PO4A 2XHWA 2VHGA 2DHSA 4DQIA 3W9HA 2V8PA 4HLBA 4B9VA 4FS2A 4H54A 2F3JA 1MU2B 4O4GA 3MCOA 4FPRA 2PFFB 3CCUS 3MPDA 1U6BA 3IMQJ 1IBMJ 2B9EA 1SVDA 5ETPA 3AJDA 3MOJB 1TQLA 4DPOA 3R5CA 1UMJA 2J7UA 5HSPA 2BRKA 2VU5A 1AW0A 1N5YB 1NKEA 1RXOB 2VZ9A 3N6MA 4FPIA 3OD2A 4MYTA 1Q4RA 2OSRA 1FRMA 2C3UA 2EI5A 4DPUA 2AX1A 3MEGA 3R1LA 1LFPA 3MTJA 3FKBA 2PT0A 2J9DA 1LNQA 1VK8A 2ZKUA 4I4BA 3SCJE 3B4MA 3M8QB 3P45B 4GKKJ 2B7BB 4LFBF 2J5AA 2N3LA 1K44A 3MR5A 3M9MB 1DURA 5DGBA 1RT5A 4WTOB 4ED5A 2VG6B 1IXKA 3DRSB 3DMJB 4C8ZA 5D0EA 3KUHA 2P6TA 4WF9Q 1HWJA 2MLXA 4RUBA 4U9RA 3PR4A 2GGPB 5GAEU 2G13A 5A8WA 1MWZA 4RUCA 3POTB 3Q24A 1WHVA 2I5JA 2H65B 3G8TA 3Q0AA 3MM6B 5HLFA 4O44B 2H5EA 3PXGa 3MM5B 1Q8KA 3GJRB 2HEKA 2YPYA 4OYXA 4P74A 1S6OA 2ALZA 4LF5F 1ICEB 4WBFA 3QLHB 1RWOB 4RW6A 2JVRA 2OPQA 3MPUB 2AYMA 3G4SS 3H5SA 4QW9A 3RBZA 2ZHAA 2OGUA 5HAOA 2XB2D 3PNIA 3KLIB 4O3OA 3N4WA 5L9XA 3PO5A 1EKSA 2XZWA 1HNZJ 3OTBA 3ZNJ1 4WK3A 1N88A 3NCRA 4EU0A 2A18A 3BDPA 1WEZA 2BMBA 1FX4A 4DU8A 2HVDA 3AOBA 1ZA1B 3DRPA 1X4HA 3MXHP 2HRUA 4JI5F 3IA0A 1D1UA 2HBQB 1BY9A 4JI4J 1KLMA 2CQPA 4ED3A 2AD9A 4ZDNA 2KYXA 2XMWA 2VOOA 2UV8A 4PG7A 4C11B 3AAWB 3MR6A 1DRZA 2RUGA 2EC0A 4ES2A 4DX7A 4EBDA 4F0MA 1HNIA 2X1AA 4ETZA 2OI2A 2LEBA 5C2GA 4B3OA 3GFYA 3T9NA 5DM7Q 1ITPA 3CULA 3W5XA 3PDNA 2AYGA 5IT0A 2CDRB 4ZPCA 2GQ2A 2F8HA 5KT4A 1NU4A 1IKWA 1S6UA 3PEJA 4LF7F 4ES1A 1IKXB 1FRIA 1QTNB 4GKJF 4WP3A 1VQ5S 1VGYA 2MZSA 1LEOA 5K14A 1H98A 4DV6J 3UNYA 1TKZA 4XDDA 1C0TB 4DG1B 1RLDA 2VUGA 4CRJA 2KDOA 4R0JA 2XM3A 3JSMA 2ZM6F 3OTOJ 5B0GA 3ZTRA 2NXNA 3PVXA 4JP8A 2EK1A 3OL7A 1U0HA 2X7IA 1MG7A 2VBZA 2ZNZA 4ZPWR 3SZ2A 4ITSA 1Y7PA 4B9MA 1NK4A 3IRXA 4PKDB 2JLFA 2E1PA 2DNLA 2FJVA 3RBDA 4F50A 1BQNB 2HQIA 5B0EA 4KO0B 3ILOA 3CMAS 5KOXA 2QSFA 2XMMA 4DR7F 5IT9U 4CO0A 2U1AA 3PFOA 1JNZB 5LM7E 4E2FB 1FD8A 2NCKL 4HVZA 4U96A 5F41A 2BJDA 2F7VA 3EZUA 3AH6A 2BUNA 4ID5B 3TAMB 3FC9A 1S9FA 3V6DA 5AXNA 3K0JA 3V4MA 1C1CA 1EARA 1YBTA 1B70B 3R2CJ 1FX2A 4NZ0A 3ZO7A 2IPOB 4TY8B 2X3DA 4EEYA 2LDYA 1MMDA 3MM8B 1ZPVA 3VWSA 2LCWA 4B08A 2ZH9A 3KK2A 2RS2A 2MQ8A 1F3FA 2WVCA 3BGUA 1VQOS 4G65A 1I94F 5EN1A 4KBIA 2GO8A 3AT1B 4OX8A 2LXFA 3OTEA 5EDWA 4YUDA 3PFEA 3LPYA 2NXUA 3DYAB 1IKVB 1H2VZ 2FLNA 1CULB 3Q83A 1KFSA 3GJQB 1H2TZ 4WZQA 1U8WA 2QLFB 2CRLA 1WKKA 1RTIB 3W5ZA 1G3OA 4X65F 4I2QB 2RMLA 4C0OC 4Z2XA 2H5JB 3MM7B 3DOLB 4KKOA 4LT6A 3CXCR 3TX8A 5CYQA 2H9ZA 1DZ5A 2B0GA 1GTEA 2Z8QA 1S1UA 4ICLB 2IJRA 2DISA 1FDAA 1XIQA 1MW7A 3MPWA 4E98A 2YKOA 2EFGA 5HQMA 1RAGB 2PEBA 2KU7A 1S7HA 2WW4A 3HHEA 3O44A 1YBUA 3EUNA 1WF0A 1SQEA 3KJNB 1OJ4A 3ZTSA 4K8RA 2HBRB 3CIMA 3CCSS 2LQ9A 4DSIA 4KH1B 4NLYA 1FE4A 2CQDA 3HT0A 1HI1A 1VMBA 3LO3A 1VQ7S 3MOZA 5KFFA 5FIIA 2XMJA 1REVB 4PYAA 2MLYA 3G82B 4CP5A 4KTQA 2DCUB 1XN9A 2KT3A 3EPGA 3K58A 4MFBA 2QSWA 3OLAA 4NLRA 4URGA 2M8DB 2F63A 1RUSA 4ZHRB 2PI4A 1IQTA 3FSYA 1NPKA 4DFKA 4K4YA 3J7AN 2RQ4A 1S57A 4B9NA 4O23A 5B0BA 4PEOA 1U24A 4PYDA 3HXMA 5D8HB 5AE1A 1R6VA 3M8QA 3KLEA 4V1Ak 4M5KA 2EKYA 2FJBB 3W62A 2ATLA 3M8PB 4ZPBA 1NRKA 4OYIA 4OHZA 4G1PA 4CI0B 2DKOB 2M4MA 3CD7A 3MEEB 1SKWA 3OR2B 1QVFR 3H90A 4WYLA 5C42B 4DX5A 3DMJA 4C0HA 5DETA 2HWHA 1KWMA 1PCAA 2B6AB 4LBHA 2V50A 2GX8A 3QGHA 4HTJA 4TLQA 2YWKA 3POTA 4RO0A 3L7UA 4AQYJ 1FRJA 5H9FK 2BJ3A 3MM5A 2IY5B 2PD1A 5A0YB 2VBWA 2BRLA 1R0AB 3M8ZA 3HFVA 4OFZA 4EUVA 4WPAA 4KH0B 5F8MA 4IR1A 3MM9B 1GXTA 3QLHA 4A48A 4F4ZA 1S48A 3QMQA 1Z2LA 1Z1ZA 1TR0A 5L1KA 4WYWA 2YWFA 2XMTA 3SXLA 1H6KX 2J7KA 1N33J 3DGVA 2VONA 4DDFA 2HZVA 1XNRJ 5KG5A 2GMLA 4C8YA 3TANA 4JI0F 4F8RA 1A0OB 1VBXA 2LU2A 4NZ6A 2BOPA 4C11A 1G7CB 4LVOP 4JI3F 1I6JA 4RX6A 4TY9A 3OJUA 4O3RA 4DPXA 1L3TA 1FEHA 1LW0B 2EWHA 3HT3A 1UEUA 2XSFA 1JXVA 1WG1A 3D54A 2G4BA 1FNMA 2C2KB 3PW5A 3LWLA 1P8GA 2VF3A 2CJ9A 1LK5A 2RQCA 1NB7A 4RJVA 4RNMA 2RS8A 3T19A 3MMAA 2MLZA 1IKXA 3LUYA 5CD4A 2RAQA 2ILYA 1SJQA 4R8UA 5F3TA 2M88A 3QATA 4TU9A 1C0TA 4GC7A 4DG1A 2DBBA 4WE1B 2HURA 2KKHA 2MEWA 2JFKA 3OV7A 2OEJA 1FJGF 4C98A 2A2DA 1F9FA 1F0XA 4FBUA 2MXYA 3HVTA 1JLFA 5IC4B 2PE8A 1HQUB 7AT1B 3SI8A 2D3UA 3L7OA 3RW7A 1UJ5A 4ZVHA 3BBCA 3ZZYA 1IWGA 2H3EB 2XZDB 5B0CA 2AJQA 4KO0A 4YHHF 4YN3B 3DI6A 2UUBF 1SKRA 2J0WA 3LP1B 1NHVA 3FGVA 3M4XA 4CO5A 1ZETA 1H2UX 3JQMA 2OHDA 2C3YA 3I87A 1FWKA 5JUMA 1ZH5A 1WC0A 2IBKA 3UDEA 1IQZA 4D3HA 1RT4B 3GG0A 2BJ7A 3TAMA 3EZ5A 4YY3J 2CVEA 2E1CA 4DSEA 2AWZA 2I38A 3BH7B 5K8NA 2VFSA 2QA1A 2R2SA 4F25A 5HJYA 4WFBQ 3TUPA 2IVYA 2QFIA 3ULHA 1N5SA 4ZITA 4TY8A 5MLCV 2HPUA 2BVZA 4I0WA 4QR2A 3JQKA 3MM8A 2CJBA 3TOQA 2WSEC 2KO1A 3CD0A 3WC2A 1L3SA 2VFUA 1UW9A 4ETXA 4EWTA 5BYSA 2MQPA 3KLGA 5A2QU 4YFUA 5HVHA 2ZD1A 4A47A 3M9NB 3NY0A 4FYYB 4Q2MA 4I6YA 3QQCD 3BKTA 2XHCA 2CZ4A 6AT1B 4OYZA 4M5LA 1ZS6A 2CPEA 2ZOFA 1VQ9S 2HGMA 3I6PA 3PJWA 3MPVA 1CULA 3ISNC 2EW9A 3L3CA 4L74A 2UXBF 2FVRA 2LQ8A 2WBMA 1DJ0A 2WSCC 3ILIA 2FLPA 4LUBA 3UDLA 2IYIA 4I2QA 2VASA 2CG4A 2C2OB 1CQMA 4ECZA 3MM7A 4UY8T 1U1PA 3KJFB 3IN5A 1T9TA 3GV8B 3ZTPA 1KR4A 1XMOF 2HS3A 4IR9A 2MKCA 2DGSA 5DDQC 2XLJA 4BDPA 3HVWA 3OL6A 4DL4A 2VQEF 4CYUB 3GIKA 5J1EB 2CADA 4RBTA 1BHNA 4J5OA 1TKTA 2DVIA 3P6YC 2DHHA 2FVCA 1VIXA 3MWBA 5A8KB 2DNHA 5K8MA 4LIWA 1RT3A 3D3CJ 2QC3A 2F8MA 3OL9A 1PSDA 3TWZA 2JDJA 1N5QA 1Q95G 4W4MA 3J81Y 2GHWA 1QDUB 1AUDA 2AT1B 4YMEA 2UUCJ 4OYMA 2QE5A 1SIZA 4CIOA 4KPCA 4ZHRA 5CQGA 1GXLA 5ETRA 3O3LA 4Q8EA 3GYXB 1DTQA 2UU9J 1NZAA 1KOOA 3TR5A 3GPAA 7FDRA 2QEXS 1RAOA 1XNQJ 3VF0B 1F9EB 2C2MB 3DOMA 4FZVA 3ZZRA 3CJKB 3BPSP 5E2QA 4F4XA 1G6BA 1DBDA 5HN0A 4OHYA 4ZLLA 1F5CA 1UKUA 1FK9A 3M8PA 4LR9A 2W7PA 1RYSA 2XULA 2HLTA 5E7OB 2GA7A 3MEEA 4NPOA 2HNZA 2DB1A 4OIXA 3OR2A 1BQXA 2NZ4A 1NZ8A 5C42A 4J9OA 4IDKA 3M8RA 1RT6B 5KFVA 1M5SA 3BKFA 4DV4F 1UZHA 2MJNA 2XS7A 2O67A 4UOHA 2C28A 1S76D 1K47A 1PJ6A 5CD4H 2GFFA 2KFYA 2B9YA 3PX0A 5ETMA 4USMA 1Y9OA 3N6LA 3IXQA 3AXKA 2FUG9 3TA0A 2G2OA 4M5JA 2EK6A 2RU3A 2ROPA 5FLXY 4PAAA 4WFAQ 3W2VB 1R0AA 5D0GA 4K0KF 2KVQE 1BWEA 4OHXA 1J5EJ 2E7VA 1R0CB 1FKOB 1YRXA 1K0VA 2X51A 2FPHX 2CIMA 4PWDA 4DV2J 3HKZD 3MM9A 1AB8A 1PBUA 1IM4A 2ZZMA 4NMXA 3LP2B 4TQRA 5DQGA 1SJ1A 3W65A 5GAHU 2M9KA 2KJVA 3KNAA 3AD8C 2G2YA 2P9EA 4KGMA 3VAJA 4OZ5A 2EPIA 2M8HA 3I32A 3LW5C 2IAJB 3MEDB 3VAIA 4ZLJA 1Y4ZB 3MR7A 1UEVA 4I68A 1V5VA 2FHMA 4P2SA 2VDHA 4DR4J 2GO9A 1JLEB 4DR3J 2Q6BA 4ELTA 2M5YA 2J9EA 4FNIA 4ZPAA 5CZVA 5DG9A 4KGZB 2VD3A 1PAUB 2GAGC 2V2KA 4F3OA 2FD2A 2OEMA 3ZNUA 5LMNF 2OTJS 2EG1A 4HACB 3TRGA 4HEA9 2BACA 1Q81T 1XMBA 5JMNA 3NG8A 4G6VB 1Q86T 1I1GA 1U7LA 4DSLA 2ZBIA 4RUHA 1R6YA 2W4DA 1FTCA 4ER8A 5L46A 4DR2J 1X4DA 2W9CB 3RRGA 4WZMA 2ZH4A 4LF6J 4DUZF 3LANA 1BQMB 1X9WA 4UY85 3AODA 3P5TL 2MQQA 1T11A 3K89A 1VBYA 3GE9A 1RWMB 5H1SV 4DLEA 4USKA 2FHJA 3NS5A 4WE1A 3RB6A 2CQ3A 1SV5A 1UTAA 2HAIA 2KRBA 3PJXA 1SH2A 2V2VA 4ZVGA 2UVWA 3T5LA 3FUYA 2QZ8A 1W7WA 2F40A 4FF2A 2Y8WA 3T1YF 1Q8IA 4JI7J 4L75A 4NXMJ 3SQOP 4K2XA 3PW7A 1RHJB 5C7PA 1TFWA 5AJ3J 4C6AA 4ZVQB 3CVKA 3C15A 4ANEA 3HZEA 2AIRB 5F8NA 1SXLA 2B5JA 1K73T 1AUSL 5J2MB 2V69A 3JTNA 3V6HA 5D78A 1RWPB 3KK1B 2PEHA 1I51B 2OPSB 1CS4B 4J91A 3KLHB 1X60A 5GADI 4NI2B 3JYTB 2VB6A 3DGPB 3CCRS 2OEKA 5K8PA 1YJRA 2ASLA 1R27B 2ACYA 4FYVB 4LQ3A 2YQ0A 1GMWA 2VL1A 4OLOA 4HT5A 2FZGB 2W01A 3NGDA 2HMIB 2F4VF 2ASYA 3HHLB 4CNYA 3V2UC 4CO3A 3LAMA 4U95A 2N82B 5GVQA 2HSEB 5DLFA 3AOAA 4K7QA 4M5NA 3I55S 4WTYA 2CAJA 3P49B 2W2OP 2GJ2A 1T3OA 4HI1A 4FBTA 1T9WA 3FMWA 4AL7A 3IO1A 3ELHA 4I56A 4C8OA 1IM6A 2XSJA 4OJ3A 3RR7A 3N6NA 5EWGA 1VRTB 3TW0A 3R5BA 3N01A 1T8EA 5J2QA 2OPPB 2HQ3A 4QR1A 3QIPB 1H73A 4DL7A 1VDHA 1TKXB 1BGXT 4A8QA 1H38A 3BN4A 2JC0A 1BD6A 3GB0A 3CNQP 2IMOA 4ZPTR 1HBUA 2QIFA 3I5CA 5KFKA 2N4CA 3QZ7A 1IWAA 5AXKA 2N7CA 2DGUA 5IFMA 1VLYA 2HG4A 2VFRA 2XNRA 5J1EA 2E7WA 1U2CA 2XYHB 2YNHB 1B0PA 3QBCA 4USHA 3SQGA 1SC6A 3C16B 3IWXA 5K5MA 3FSIA 2ZHBA 2R7XA 3W5YA 2J7WA 4DS4A 1VBZA 5A8KA 1HPZB 2QYGA 5E3PA 2CXEA 4ELUA 2D9PA 3OHAA 2IHR1 2H1YA 4XIUA 1PIEA 1BXNA 2DGQA 1IBKF 4N76A 2AJ1A 2VQFJ 1OSDA 2OPRB 4UQGA 3SV3A 3GIJA 3DOKB 1IR2A 1J2VA 3NGSA 1C4AA 3JSYA 3Q23A 5CXTA 4FYWB 4MYUA 5A8RA 1N34F 4DZ6A 1RYRA 4NMLA 1NXIA 1JLBB 3O5TB 4DV1F 2UXCJ 2XYPB 3SSSA 2ZITA 2MKJA 4CTAB 4B9SA 4F26A 1UW4A 4PWWA 1VS3A 2YNIB 1MWQA 1PILA 1PAEX 2HHSA 2HFOA 1Y00A 4L3KA 5A6WA 1WNEA 3ENWA 4P52A 3FQLA 3RB3A 2DRAA 2G1HA 2DRDA 3HSJA 1YJ7A 1T05B 5AXLA 2DNQA 2CJYB 4QW8A 2DPIA 4U8VA 2JL9A 3E3XA 4A8FA 1S1TB 1S1VB 3HHKA 4ECWA 2XI3A 3W9IA 4OX7A 3R9LA 3TJ9A 2HQGA 4DPWA 4O4RA 2DH9A 4X62F 2FLOA 3RTVA 4ZPDA 3MAQA 3QFHA 1S1XB 2BYCA 2UUTA 2VG7B 3R7SB 4ZP6A 3T5KA 4NEZA 3J7ZT 3BN7A 2FQQB 1FKOA 4P2MA 4JI6F 2PI5A 2CJKA 1WC3A 1EP4B 4CH7A 2HFVA 3BO2A 2LQJA 1VLOA 3LF0A 2RD5C 2DRBA 2IM2A 3ENQA 2RSQA 8ATCB 3SCIE 3C19A 1IR1A 1H74A 5U47A 1LWEB 2YWHA 1U1MA 3G2XA 1YDLA 1O51A 5HP1A 1NDKA 2QA4S 3H25A 2W7OA 1SI9A 4RU9A 5DG8A 2J8AA 1LXNA 3PYFA 2MB0B 3BB5A 1GMUA 2IFXA 2KXFA 4WFNQ 1XR5A 3T6JA 2KFNA 3MEKA 2OMLA 1CQNA 2HYIB 1RZMA 5EUHA 3VAFA 4ERDA 4OX9F 1LWFB 2MQLA 4I1TA 3OTDA 5IQ6A 5KFAA 2Z57B 1FDBA 2B9WA 1CC7A 3PW2A 3F56A 2PDAA 3WX8A 4JYAJ 5FLXU 3RW6A 1SB6A 4XTTA 4F4WA 1YITS 2XLIA 1S4FA 4YQWA 2XCAA 4RBVA 1LKZA 2AYEA 3Q86A 4PR6A 2O1PA 2VFVA 4B3SF 2W9CA 5GADU 3DLBA 2MKYA 3GSDA 3UD3P 4RBUA 2R7VA 4CT9A 4XDCA 1T7PA 1TTHB 1NO8A 2LFVA 4IG0B 2CG8A 3W1YC 2XWXA 1VOMA 1CJVB 1JJCB 2FGOA 2OD6A 4K4UA 3H2LA 2BW7A 4J9QA 3UO0A 4X4RA 1WC4A 2BJ9A 2GMHA 2HS0A 3AD9C 1VQNS 1CVJA 1CJUB 2DR9A 1SH0A 1M5KC 2P8IA 3GJSB 2HFUA 4NLVA 4N5SA 2BJEA 2LVWA 2ILZA 2JH3A 2JFDA 4LFCJ 2I2YA 2VG5A 4C3LA 4P9SA 4Q2LA 5KFPA 4PUOB 4ECSA 4DF8A 2K3KA 3CD5A 3OR1B 3PIPQ 4LSZB 4JBCA 4JI2J 1S72S 1EIYB 2KM8B 5F8GA 1N52B 2A6MA 1RT1B 3D1QA 2CWXA 5C24B 2Y3YA 4KV8B 2CNKB 4UOGA 3BR9A 4USUA 5LMUF 1WHYA 3N0VA 4KHPJ 1U4BA 1JB0C 2JSXA 5GMDA 5HK4A 3JYTA 3DLGB 4ANCA 3OFFA 4QIGA 4Y34A 2BJ1A 4X64F 2PA8D 1FXLA 2M2BA 5DO2A 1RABB 1RT7B 3G8SA 3EJMA 1RTJB 1SPBP 3HHLA 2JLGA 1WKJA 5L38A 2Z2LA 5HMXA 4B02A 3I0SB 4LSLA 3PM9A 2DTJA 1KVKA 2ZOMA 3ILJA 2HHHF 2I6WA 2AP6A 2RKIA 3M8YA 2HWTA 4DUYF 3R1HA 3LA0A 5BR8J 1JLCB 4Y2IA 2OELA 3NWRA 1GK8A 1T0TV 1PG5B 3OHBA 1RB0A 3BF4A 3G86A 5AE2A 3ZZTA 5HBMA 3PV8A 5F3ZA 1CPZA 2IJNA 2UZAA 2C3OA 4TU7A 4B3RJ 1SCJB 3FZ2A 2C2ZB 1EKRA 5BYQA 2E7XA 1L5UA 4OI1A 4AE5A 2ASDA 5KT6A 4HL9A 4DV0J 1FKPB 4ECXA 4DX8H 5DG7A 1VQ4S 1Q5VA 1UWBB 3PZPA 1RT2B 3J7Z5 3C6UB 5B0DA 1FCAA 2FJXA 5D4PA 3GYNA 2XMKA 3IBWA 4DV3F 3IC1A 5IXUA 2KHCA 1DQAA 1F2GA 4ED8A 2IC3B 3KWMA 3VGVA 5C25B 3CJ8A 2H4YB 2DNZA 2AX0A 3NCPA 2HLUA 3EDRB 4FNHA 1B7FA 2Z2MA 1JKHA 5KFTA 3LOUA 3TA2A 2CNOB 4PG6A 1WSRA 2GW8A 2BV3A 4DV7F 4DL6A 1FWLA 1JLGB 3D28A 1TV6B 2C42A 2IA6A 2OPRA 3MMBB 1URNA 2FY8A 4X84A 5F0UA 2D74B 1QUVA 4ZVPB 5T41A 4O3QA 4B3MF 2Q3PA 3NXZA 4P73A 2OP5A 1NH8A 4HR2A 5DJBA 1JLBA 1RJJA 1QUPA 2R8GA 2RRBA 4A4JA 2FIUA 2MJUA 4LBPA 2DT9A 1HNWF 3PRVA 3MURP 1TZ0A 4HH0A 3NBPB 2YNIA 1RI7A 3LGHA 2HK3A 3FBBA 1CJKA 3PJ9A 3DKDA 3W60A 1YVFA 4CQ1A 3LP0B 3K7RA 5KFHA 1HW9A 3Q2TC 4YB5A 4MT1A 3FZBA 4ED7A 5KFLA 1T05A 3I5AA 1UJ6A 4WK1A 4C8MA 2HNDB 4RWWA 1U1OA 3KUEA 4CM2A 2ZUAA 5ADZA 4WFXA 2HVHA 4A8SA 3AQOA 3PW0A 1S1TA 3CDWA 1FI4A 1QD1A 3FFIB 4DSKA 3J7YI 3NL0A 1AXQA 3AOCA 2BM1A 4MKYA 5T14A 2LA6A 4DCJB 4FKYA 4XPEA 1IBLF 3QPIA 3GR0A 2EBGA 4C48A 3SSRA 4AFFA 2IM1A 1OYDA 1PYSB 3ICLA 4BHQA 2KXHA 4LF4J 3I31A 4JI8J 1FEEA 2B8QA 5IQQA 1VR6A 3VV2B 2CQBA 2ZDOA 3CWJA 3V6JA 1E6VB 1RCOB 3OFEA 1U09A 1S77D 4JV1A 3TYTA 4A8KA 1ZM4A 3PHTA 1FHTA 1K8AT 2M70A 2CPIA 4J7CA 3TNVA 2N3OA 1HBOB 4QYRA 4Q0BA 3A1YG 1YZ7A 1IN0A 3AD7C 3CPWR 2RU9A 3CIZA 1NJXA 5HANA 1FFGB 2V6AA 1WTBA 3HPOA 3BGOP 2HS4A 3S8SA 3EM1A 5A6PA 1RWVB 2VJVA 1FKAF 1RHUB 3GG1A 4B9TA 3Q8UA 3HO1A 3IM8A 1RWNB 2CQHA 1C2PA 2CJQA 1AZSA 1S6PB 5D6GA 1TP7A 4BLGA 1OO0B 2L9NA 4F0KA 1XTZA 3TA1A 3RB4A 3AJ2A 3MMJA 1T9UA 2UVRA 1RBOB 2V8GA 5E0OA 1MLAA 2LEAA 2GAHC 2NPFA 3M8SA 3PW4A 4JUZA 1ZBTA 4C8KA 2H48B 1UWAA 4JV5J 3B6BA 2MPUA 1UA0A 1UVIA 4UOCA 2AEMA 3DHXA 2DO0A 3M8WA 5DS7A 3GFHA 1CJUA 4N8OA 2O01C 1C0UB 1H7XA 3NS7B 1EQ0A 4F02A 3ET6B 1Q5YA 2JEIA 1X5SA 3G6VA 4LF8F 3K5LA 2QLJB 4X66J 4PUOA 3RAXA 5IZHA 1ZM9A 3PTWA 2WOMA 2YX7A 4RWXA 3MHYA 1WEXA 2X1FA 1U6ZA 5I4MA 2CZVC 4HDHA 2F8EX 4FXDA 4PPDA 1RT1A 3UN5A 4NX9A 3DU6A 4IOCQ 4EO6A 4KV8A 3HM9A 1IUJA 3OJSA 1S97A 1DFDA 3HVRA 1FRXA 4HHHA 3RRKA 5EWFA 5I3UB 2HHWA 3DLGA 3M2VB 3BKUA 4DJBA 4WIIA 3A12A 2QX0A 2RDDA 2R7QA 2UXDF 1J5OB 4ZVRB 2DR7A 2W9AA 4NLTA 2EEYA 2OH2A 4NA2A 4A8WA 4FN5A 4MK9A 1K9MT 2PN6A 2O3DA 2W2MP 3GSIA 4EZ9A 3JAMY 5F8LA 3I0SA 2BABA 2HVEA 8AT1B 2AGQA 3ITHB 3RAMA 1S79A 2UVVA 3UFCX 1WF1A 4NRTA 3M9OB 4DR6J 3NLCA 4NWBA 4FYDA 4H4KC 1JLCA 4MAKA 1C1BB 2AJFE 2L41A 4P72A 4G1QB 1O5JA 3WDOA 4RW4B 3R97A 2D69A 3OTCA 1KONA 4I7FA 1B0VA 1T02A 1YJWS 4NYZA 2HZAA 4R25A 4DHVA 2YBVA 3PR5B 3N5BA 1HMVA 3H40A 1LWXA 1NJYA 1NKCA 4ZVTB 2HGLA 1T95A 2BKOA 4ZVOB 2KT2A 1U25A 1FKPA 2XZTB 3I4PA 1XBWA 1UWBA 1RT2A 3LWMA 3K5MA 3C6UA 4DR1F 2VPYB 1RWUA 2V63A 3L9ZA 4DZDA 1WKLA 1NHUA 1JLQA 2YKNB 4ZCLA 4ES3A 3N79A 1Q79A 4QPTA 3M7VA 1S9GB 1YBAA 1MROA 4QR0A 2KB2A 3DM2B 1FVQA 1CSJA 1HFEL 2LLZA 1U8SA 4LRBA 4O3SA 5F0WA 5CA5A 1S49A 1S6QA 4Y2MA 4IQXA 2QJ3A 3CF5Q 3CW2C 1GQEA 3GJTB 4M95A 4FVMA 1JLGA 4QCLA 1VRUB 5DQIA 1NSPA 1TV6A 3H20A 3J7YU 1VQSA 4LFAF 3MMBA 1VHFA 4OI0A 5DZ7A 1U1NA 5ETVA 2PIIA 3RBEA 4PQUB 5RUBA 5KTQA 1NAQA 2BXJA 4OV1A 2E5LJ 1NDPA 2W9BB 2NXEA 1MSWD 5CABA 1SJ4P 3UI3A 4W92B 5IV4A 4RNOA 4R0EA 4OYOA 5CYMB 1VJQA 2ZBQA 5LSLA 3V81B 3NBPA 5C2CA 1HQEB 1REGX 1YZ6A 4ZS6A 3WIVA 2D3ZA 3TQ1A 5T7LB 2WZ1A 3K5PA 2NPIA 3LP0A 3C46A 3QZ8A 2VDIA 4I6WA 3QT6A 4W98A 1D0EA 4YB7A 1HNXJ 3M30A 1T03B 2NSCA 3TP2A 2ZH1A 4IH7A 3CJ5A 3EXYA 1TL4A 3BSNA 3GCXP 1FTRA 3UWTA 1IJEB 3AA9A 3EXCX 4Q45A 4TYAA 5ETKA 1FFWB 4OYAA 1NK6A 3DDKA 1NSKL 1P27B 4ZA1A 3FFIA 3JTPA 3NAIA 3FQKA 1KP6A 1HR0J 5KG0A 3RGIA 3BQ1A 2AGPA 4NYPA 4O0IA 1B7YB 3OVBA 1WACA 1X4BA 3Q8QB 3ZTOA 4DV5F 2F5GA 2LP4A 4KSEB 3CCQS 1OY8A 5K9FA 4YR0A 1N36F 2EG2A 2UP1A 4JI1F 3G71S 4B3TF 1KVJA 1QJHA 1ZTWA 2HZCA 2ATCB 5D15A 4LF9J 4W90B 2BQ3A 4DMZA 1D9FA 3FRYA 2G0IA 2NYIA 3MFIA 1E6YB 2JVOA 2L08A 3VTIA 3UPFA 4U7UK 3ILLA 1ZA2B 1IKYB 3IWNC 4RW8B 4QWEA 2XGQA 2SXLA 2POKA 3S7RA 2BJ8A 3H5YA 4USJC 3TARA 1L3VA 5FDLA 1M5PC 2BANB 1DARA 2XTJP 4N56A 3PACA 2Y1IA 2KVIA 1U45A 2E1RA 1S6PA 2V4RA 2W2NP 3FBFA 2K2PA 2K8GA 2CUYA 3M1VA 4DOZA 1Y5IB 4ZN3A 2JRSA 3HDSA 3UD4P 1UFWA 3NWGA 2HBYB 3HJVA 4F04B 4YP3A 3ZTQA 1OPZA 1HWUA 2XO6A 3K8VA 3K5OA 5G0RA 5L9NA 2IVMA 2R2RA 2OTLS 1NHKL 2W1BA 1UFKA 5KFEA 2HNYB 3R8YA 3M2RB 5ETLA 2RUSA 2VV5A 3G6XA 3CCMS 4DQSA 4WIQA 2K7KA 3TVZA 2FVSA 1QSYA 1R31A 1QVGR 4L3NA 2FHJD 1F5BA 3EGWB 5IWAJ 4HTIA 3T6BA 3HULA 1KBRA 2ZWOA 4LR7A 2CQ0A 4NLGA 1RHKB 3LQVA 1N0VC 3DRYA 2HK2A 2HRYA 3BDEA 5A2QY 1HBMB 1RWXB 2EC2A 4L6V3 1I5OB 1PKUA 3R5GA 4FF3A 4CLUA 4DI6A 2FHOB 4NCGA 3E51A 1KHWA 3MDFA 1IBMF 1V6HA 3BV8A 2AYBA 2V2ZA 1A9NB 1RACB 2DYAA 1T9YA 2XCPA 1TVRB 4LF2A 1JNRB 4DPYA 4ZMMA 2NZCA 3RZAA 4DUTA 4HDGA 3TVKA 4MKVA 1O6XA 1TUVA 1OQ6A 2RF2A 3NOCA 2R7RA 4J9UE 3C66A 2CZ9A 1NPPA 2MGZB 1VQYA 3I5BA 3US5A 3QSIA 4QIVA 2WRMA 1N32J 3VQTA 3GIRA 4F2RA 1TL3B 3R5AA 1NH7A 2Z58B 4ZLPA 1FNOA 1GMWD 1VBKA 2R9LA 3IAM9 2ADBA 2BQUA 2R7WA 4P2XA 4WU3A 4F4YA 4G1QA 4ELVA 3JB9k 1H0HB 2B51A 1NCLA 4GKKF 3H5XA 3OUYB 4R5PB 1G4CA 5KFMA 3MECB 1X4CA 1VRQC 3CJRA 3GV7B 5M2PA 4DR5J 1RHMB 1WOOA 4B9LA 1QSSA 2FC9A 2HHPA 1HHSA 5DGAA 2OFGX 1DTTB 1FNXH 2QRRA 3KYLA 2B56A 1UVKA 2WVDA 4I64A 3M2UB 3GONA 3Q8VA 1KOHA 3NOGA 2UUAJ 1PBAA 4OJGA 5D3GB 4IFYA 3SDEB 3TUIC 3BPDA 1PC4A 4RLEA 4U7CA 2NYHA 1QAXA 2ZZTA 4USIA 5J2NB 3V6KA 2GHVC 1D8YA 3I4HX 3CB4A 5KFJA 3JAMU 4A46A 4TKTA 2AV5A 2BR0A 3M32B 4DLGA 1S9GA 5KFWA 1WDTA 5KFDA 5G4DA 4WCEQ 4K4VA 3GZ7A 5I42B 2QLWA 4P10A 2JNJA 2G0CA 2M3DA 2V68A 1XMQJ 4NCAA 2AEJA 2IJFA 4L72B 2YX1A 2D3O1 4H4OA 1YKWA 2DY1A 1KFDA 5KFUA 3HVAA 4ZK7M 3FCHA 4RNNA 3TX0A 5LOQA 4ZCIA 1D9DA 2KG1A 5ETSA 1HNZF 2CQ2A 1MWYA 3CDUA 1RTZA 1N54B 3UCUP 1I3OB 4NXNJ 1UPPA 1MU2A 2MZTA 4O4GB 4ECUA 4EZ6A 2W9BA 3T1HJ 4JI4F 2WONB 2V67A 3H2VE 3ZFVA 2Y0SD 3AB2B 2AHOB 4OJ1A 1OS5A 3RBXA 5CYMA 3R3TA 4J9PA 2JX2A 1N5YA 3RR8A 1HQEA 3R7NB 4AT1B 2OIHA 2DNOA 7FD1A 4HKQA 3MEGB 4X2BA 1T03A 1ZAVA 1SBRA 3D6FB 2B4VA 2DD8S 4KPYA 1DY3A 1P1LA 3VGUA 1TK5A 2BKNA 3PKYA 1WELA 2X1BA 2GHPA 1QSLA 2FDNA 1M1HA 4IH6A 2Z0GA 4DV6F 5IM0B 1RT5B 2PA3A 1Y5LB 1KTVA 5JVHQ 1G2EA 2VG6A 2R8IA 2RB7A 3DRSA 4ZJQA 3OTOF 4BCAA 2ZJQQ 3D68A 4QBUA 3SYZA 2AGOA 4AD6A 3NEKA 1A6LA 1WOPA 5HMZA 2GGPA 3PY8A 2W2PP 1VCTA 2RNEA 5A8WB 4DX6A 3EGZA 2C3MA 1FFSB 1KDNA 1Q8LA 2I5JB 3F44A 3MM6A 4O44A 3KMSA 3N9UC 3WQPA 1UCNA 1KD1T 1MN9A 2YKQA 5D0HA 2Z4PA 1TFYA 1NSQA 3L4BC 3OPKA 3CCES 2C22A 2RHQB 3IR6B 1NJWA 3KDNA 5DDPC 1JMTA 3H7HB 5E3QA 3PX4A 2OPQB 1APSA 1NLKL 1FJ7A 1IKYA 3FRZA 4RW8A 1HIYA 1K0TA 4FF1A 2COLA 4ZVFA 3T5JA 2KFZA 3KLIA 1FRLA 2V2QA 4RW9B 1SJ3P 3KG1A 1KEKA 5IT4A 4PG8A 2W4CA 2AU0A 5CHCB 3K2YA 2EFVA 5F8IA 3OBIA 4V19J 1S59A 2J0XA 3DRPB 4HT7A 4EBCA 3M6UA 1KLMB 4IKAA 5L1JA 1NK5A 3QIDA 1CBKA 2VBYA 4NLSA 2PMWA 4FP9A 2HQDA 2DK2A 2GVDB 2LKZA 2BE9B 1UEKA 1S0NA 4ALZA 4IG3B 5CAAA 3N28A 4TU8A 1TMMA 2A10A 3Q8RB 1MMNA 1HNIB 3D5MA 3C3LA 4KY3A 3IBCB 4MKAA 2GZOA 1LK7A 2JEJA 1W25A 2DXDA 3B82A 4EYHB 4DQQA 2OO4A 1NUEA 3NKYA 1OY9A 2DHXA 3CDBA 2JEGA 1IKWB 3HI9A 4KGXB 1KKHA 2XWYA 3TVYA 1O8BA 3O6QA 1F3VA 1U0SA 4LFBJ 2Y1LB 3CJSA 3SIPB 2XO7A 2QL5B 2E5GA 4F0HA 3JTOA 1TKZB 4NEYA 1L3KA 3IP0A 2NS1B 3JSMB 2DGXA 4DF4A 4MTPA 1DHMA 3TJAA 3BQ2A 2CFXA 3R7BB 1U0HB 1RQ0A 1KLNA 2DH8A 3IRXB 1IVZA 1BQNA 2P9GA 2OD4A 4CNZA 3TQEA 3DLJA 4ZKAA 1Q78A 3CC7S 4P2FA 3HP6A 2AJ4A 8RUCA 4AYBD 3F41A 1U47A 2A0FB 2Y9HA 4LF5J 1LQ9A 3IR5B 2MGZA 4ID5A 1DLOB 4CLYA 4JV2A 5KG1A 4ZVEA 2VA2A 2IRXA 3KTQA 5ETTA 1EZZB 5J2PB 1YJUA 1BMQB 2YTCA 4M5HA 1X4EA 3MD1A 3TZXA 1HWLA 3HHLD 3V4IB 2HVIA 2Z2YB 1JLAB 2R8JA 2ZZNA 5I3QA 1SKUB 1F9HA 3CMQA 5LL6d 4QQBA 1CC8A 2ZH5A 3SEOA 1RAIB 2H4WB 3TEHB 4JI5J 3MECA 1H3DA 1N56A 4P7VA 1W2IA 5GAGI 1BLUA 1U2FA 4YS2A 2RH3A 5KFBA 3DYAA 1IKVA 1WC6A 1OWXA 3M2UA 1XK8A 1KHVA 1P6TA 3DRXA 5CCMA 4MIAA 3UE2A 1JXLA 1QE1B 2CDQA 2ZH6A 2RDJA 1HYSB 4PRFA 4NLWA 2YKMB 3VAGA 2GS8A 3GIMA 4AQYF 1RTIA 4CO2A 3B8HA 4OMFG 2LEPA 3I96A 3HKWA 5HROB 3M32A 4OZLA 4CLPA 4LF7J 3P5BP 3DOLA 4AUKA 3BSCA 3DLKB 4FDFA 2V0NA 2YH0A 2YWGA 2WCXA 4GKJJ 2CPZA 2EXUA 5J1PA 1ULRA 5I42A 4HI2A 2YNFB 4F4KA 1S1UB 4ICLA 2YNGB 2P2CB 2AZ1A 4DS5A 2ZM6J 1S0MA 2A3JA 4K5RA 1SH3A 5KAKA 3GYGA 1LFWA 4X4QA 2HFNA 2ZDPA 1RKJA 3SCKE 1SC1B 2RRAA 3QGIA 3X1LB 1KQKA 5HMYA 1N33F 2ZFHA 4Y0FA 3LGMA 1XNRF 4K50A 2WONA 2YWEA 4QU7A 1EAYC 5C5JA 4Y2CA 3A8KA 3E8OA 2F9DA 4DR7J 2Q6CA 1YJVA 3GTYX 1NDCA 4ZVUB 2R2TA 1REVA 1RBLA 3G82A 3MD3A 2VOPA 2B4OA 4N41A 1TAQA 4MFBB 4DN0A 3H59A 3MCNA 4KYZA 3OQ2A 1OPIA 3T5HA 2O5DA 4HHJA 1QAIA 3EICA 4BWJA 3B4DA 5LJ3Y 3FCWA 3W8PA 2VC1A 3KLEB 4NLOA 4YB1P 3D6HB 2LECA 3D4JA 3IR7B 2EKNA 2DR6A 3SFUA 4JOUA 1ZOTA 5IM0A 2Y1JA 4USTA 2PSZA 3NNAA 1I94J 1GH8A 3NNCA 1DQ8A 3DLEB 3T3FA 2YPZA 1UVMA 4EK2A 3NGUA 3P8BB 2DNKA 1KQGB 4J90A 2PO4A 2EFOA 4OLPA 4UQTA 4GO7X 2B6AA 4OZ2A 3QNWB 2E5JA 3PG9A 4OV6A 2VA3A 4BWMA 4QYZK 5H9EJ 3HFZB 3CCVS 2UV8G 4X65J 2HRTA 2HVZA 3TUZC 5A0YA 2K7JA 4BS2A 4G3IA 3G9CA 3NMRA 2MKSA 1VFJA 3DN9A 5HL7Q 1KS2A 3C6TB 3R6LB 1FT8A 4NL5A 3PRDA 1U6FA 4YY3F 4FXWA 2HHTA 3BEGB 3AY0A 3NS6A 3Q22A 2J0QD 4NZ7A 2JLEA 3QJJA 3PCOB 3K57A 4ZJLA 4RW9A 1SJFA 1TUGB 2IA0A 3UCZP 1Q0NA 3BO3A 2MDAA 2E5IA 3FJ2A 4K4WA 3CCLS 3GP9A 2V5HG 1RU1A 3ZZ0A 3GIIA 3CC2S 3ONQA 2BZ2A 1X4FA 1H72C 4DXLA 2VJUA 1M0SA 3J80Y 3DU5A 4USVA 3THTA 1HD1A 5MAOA 3NMAA 3HCXA 2GVDA 2EFPA 1JJ2R 3DHWC 4IG3A 3EE3A 4QWDA 9RUBA 1B64A 1LW0A 5KFRA 3U1MA 3G96A 1TL5A 1X9SA 3KHGA 4KT0C 1LV5A 1KRPA 2NR0A 2QMWA 1BUXA 4ED4A 4J9VA 3WHIA 2Z30B 3MMAB 4ED1A 2ZHOA 3BM7A 2UUWA 3PYEA 3AQPA 2DPJA 4R8UB 3HSDA 1WC5A 1PYTA 4JV0A 4IFVB 2LQ5A 1YTYA 4Q5VA 1KN6A 3FNNA 3D9BA 3RUBL 3W3SA 1PGZA 3B54A 3HVTB 1JLFB 1FO1A 1R7IA 1HQUA 5GAGU 4TN2A 2W2QP 2WAQD 3MAHA 4KFBB 1YLXA 2DEIA 2R4FA 4TYBA 3KMQA 1TKDA 1B99A 5ETNA 3TZYA 4IO9Q 4B9UA 2QLBB 3UR0A 2HWIA 4OHVA 3CCZA 1S12A 3DI6B 1X8DA 2Y1RI 4WJBA 3LP1A 2G2ZA 1YWXA 4UZBA 4OZNA 3Q8SB 2L3MA 1EQMA 3TAPA 2DNNA 4CH1A 4NCBA 2MTLA 2Q79A 2BDPA 4ZCMA 1RT4A 4DBQA 2UUCF 4DL3A 1J27A 1N0UA 2V8VA 4Y2AA 4O3PA 3NCQA 3VZHA 1AA1B 1DLOA 2PFDA 1RSCA 5L8RC 4CLFA 4OJHA 2ZH8A 1EX8A 4DPTA 3T41A 2QV6A 1R8CA 4OZ1A 2CNNB 1NK8A 2UU9F 2KZZA 3PRBA 1XNQF 1S4EA 5J2PA 2L9DA 3OVAA 3BBBA 2G9OA 3F0NA 1X5PA 3K17A 2QMXA 4ID8A 2HBZB 3V4IA 4ILMA 1JLAA 3D67A 2R42A 5K20B 5LXRA 1FERA 1WWHA 3IGNA 2GMJA 2VFTA 3HF5A 1L3UA 1ZPWX 5HQ8A 3BREA 3QRRA 1S0VA 3KLGB 1VC5A 1U1RA 2ZD1B 3C8YA 3U7JA 3D3BJ 1Q53A 4JI0J 2XS2A 3MPYA 2QN6B 3ZZOA 4CLLA 2HIQA 3ETOA 4JI3J 1HI0P 5ETOA 4ZCKA 1M1KT 2IM3A 3W61A 2MKKA 1NB2A 1G1XA 1HD0A 3N5FA 3OLBA 3DNCA 1QE1A 2FVQA 4RL1A 1HYSA 3AA8A 2YKMA 4OYBA 4HYKA 3VALA 4QWAA 5B0FA 5THWA 1UETA 2BW2A 2FJEB 2ZH3A 2E9ZA 4FS1A 5HROA 1HKAA 3CE8A 5D4NA 2BEFA 4WP9A 1T9XA 4PPZA 3NNHA 1J5EF 3IWLA 1HARA 3DLKA 2MKIA 1VC0A 1FDDA 4NASA 3PKMA 2XMAA 1UJ4A 1VI7A 4DV2F 2FJDB 1TU0B 5KFGA 2YNFA 3R2DJ 1S99A 1OY6A 1RHQB 2YNGA 3D6MB 1RA7A 2YQ1A 4CYUA 3FEYB 1FJGJ 2DY9A 1B0TA 2DEJA 1TKTB 3EZOA 3QGPA 2R7UA 4ED0A 3KG0A 3C2PA 1XEZA 2XYGB 3NGRA 3KHHA 3THVA 5KFOA 4K4SA 1EB0A 1XR6A 1VYAA 1RT3B 3MCSA 1NMEB 4DR4F 5K8OA 1NJIT 1QY7A 4DR3F 3BBFA 4YHHJ 1F6TA 1CJTB 4RUAA 4CCHA 4LRAA 2UUBJ 1JIHA 5KT3A 1F5AA 2KHDA 2GNKA 1JWWA 1YIJS 1V5IB 3VAHA 1K1QA 1QAYA 4KRWA 4H4MB 2GVZB 2YQ3A 3KKFA 4OQJA 2C2EA 1TK8A 5AT1B 3OXFA 4C7QA 1DTQB 3CEDA 2ZBCA 4PQAA 4CDIA 5B7WA 3SCLE 3DOMB 2A6OA 2I1RA 3CJKA 4DR2F 3MAAB 4LF6F 1X7VA 1RE1B 3OXGA 4ECYA 2N4DA 4MK8A 1FK9B 5D0RA 2CWKA 1ZZFA 2CKWA 4PXDA 1RADB 1AROP 1UPMB 2XBPA 2HNZB 1SQGA 3DLEA 4P6QA 2CPYA 4V19X 4ILLA 4IDKB 1RT6A 2W8LA 3GLJA 1HW8A 4K4TA 3OT9A 4DL5A 4EI2A 3GFZA 2GIFA 1CEZA 2UXBJ 4JI7F 2DGOA 1QTMA 3QRPA 5DLGA 4NXMF 4GC6A 2X1GA 1R0BG 5AJ3F 3U27A 5KFXA 4Y3CA 5JVGQ 2ZJRQ 2L48A 3LALA 4C3KA 2ZWPA 3W2VA 2RRNA 4QU6A 4AXIA 2ZNYA 3HSGA 4NRUA 1XMOJ 3R5JB 3C6TA 2DJWA 4PWDB 2LU1A 2MSTA 3DLHA 2W25A 3LP2A 3MI7X 4MKBA 2VQEJ 5CZXA 2DNPA 2MZQA 4OZJA 1YX2A 2CVIA 4X4OA 4QJVA 3HD2A 4WP8A 4NLDA 2E1MC 5KFYA 1B4SA 2V9KA 3I82A 3ETMA 4ECTA 1RAFB 2IBOA 3CJ2A 2AF6A 2OMOA 2IAJA 3MEDA 3MR3A 2YX4A 3I9V9 3QAUA 5CCLA 2WVEA 3W9JA 5F9LA 3LGNA 1JLEA 2OJ3A 3KHRA 3IRWP 3SFGA 3KDOA 4E8UA 3ZZPA 2KYZA 1CLFA 4J9NA 4LIRA 2M7SA 4IOAQ 5ITHA 2WVBA 3CJ4A 1VIOA 2V4QA 4JB8B 4CLZA 4HACA 5IS2A 1U1LA 2VPZB 1RK8A 4MK7A 4IRDA 1TL1B 5HQLA 3EYZA 1B3TA 2J6TA 1RAJA 4ZOSA 1UVNA 1FXDA 3VR1A 3ZXWA 2WK4A 5B0AA 1OYEA 2HHXA 3QJPA 3G6ES 5GAHI 2FJAB 1Z2ZA 2QL9B 1BQMA 3PEHA 4X4TA 1TMJA 4USWA 3T1AA 2J0SD 3A4TA 5M2UA 1D9AA 2VIHA 3UQSA 3Q8YA 1SUQB 2E5HA 4BC7A 4IFVA 2FZKB 4ENOA 3WX4A 3KLFB 1SV5B 1T94A 2ZOGA 2JC1A 3VGSA 2IRYA 3VZIA 4OI2A 4EFAC 4DV4J 1FXRA 3J80U 1S5ZA 3UCGA 2AQ4A 1VQ6S 1VJWA 3UW1A 3CC4S 2LXIA 5AXMA 1OIAA 4KFBA 1NEEA 2AKWB 3UVJB 3K8WA 1ACMB 2XS5A 2HW3A 2HHQA 1KVIA 3C15B 3GMGA 3QWPA 4IH5A 2NXJA 4L73A 4WU2A 1HA1A 4K0KJ 1WUUA 4MMOA 5KFNA 2VQFF 4IUFA 2B5JB 1KSPA 2KJWA 5J2MA 5KG7A 3GQCA 1RAAB 3WIUA 1S1WB 1NSAA 3OSPA 3VHQA 2KXNB 3H4DA 5L39A 2WB4A 3CGIA 3KK1A 1ZYQA 2NQPA 2MKHA 3JQJA 2OPSA 1CS4A 3KLHA 2GJFA 4NI2A 1SL1A 2F65A 3DGPA 2FJWA 4YEAA 3AHPA 3U1LA 2FB0A 1WI8A 2R8HA 5IOLA 5JXSA 5L1LA 2UXCF 2VODA 4DCPB 3IGVA 1FF2A 4Z7YA 2C2RA 2I8EA 2HMIA 2C1EB 2HFZA 2KTQA 2Z56B 1WG5A 1X0FA 3UDCA 3VAMA 1GFWB 2AZ3A 2Z2ZA 3FCVA 2ZC3A 4M5IA 4QZVB 2QG9B 4ZLNA 2MZJA 1Q1KA 4KHRA 4DU7A 3KLVA 2EFNA 5KT7A 1V9OA 1OQ3A 2XNQA 3QSYB 3CJ3A 1X9MA 3RRHA 3EMTA 3W7BA 4P7TA 5KFZA 2D41A 3IS9B 4AXJA 2DR5A 5KFCA 1MNEA 2J9CA 5LMNJ 1GXUA 3TEGA 2AW0A 1YI2S 1FVSA 2HFSA 3SBMA 2XSJB 4PXEA 4ILRA 4KJIA 1VRTA 2GQQA 2BOAA 4K2JA 5J2QB 3QFWA 2OPPA 4DWIA 2QLXA 3QIPA 1TKXA 2QA2A 1U1KA 4GVBB 3BSOA 4DEZA 1NK0A 3H98A 2DNYA 4I6AA 1A7GE 4DUZJ 5SZTA 2ROEA 3W63A 2I9SA 1TAUA 2ABYA 1M5VC 2DXEA 2QL7B 3P96A 3UN2A 1HBUB 2HQCA 1SJRA 1K1SA 2E9RX 3FMBA 1XR7A 4C3MA 4QWBA 4YDXA 2CQCA 1GAOA 1Y11A 4CLTA 4GVLA 1HHQA 2YNHA 4QIFA 1JXEA 3TZZA 3D1OA 4DQRA 3SQGB 1IBCB 3C16A 3T1YJ 2IMWP 4PG5A 2WW8A 4KC5A 3GR1A 3U02A 2FLLA 1R3NA 1HPZA 2CPHA 2E66A 5EWEA 1FESA 2XMUA 1N5TA 4A8OA 1CJTA 2Q66A 2ALYB 1YJ9S 3BGFA 1NKBA 1VQMS 1WTFA 2L9WA 3GU0A 2G1DA 5F9NA 1JX4A 2ASJA 1LWCB 1WEYA 4N77A 2DNGA 1SQFA 3BYPA 3S1TA 4H4MA 3DOKA 2GVZA 4M5MA 2V4JB 4JYAF 4YDDB 1V3SA 2R7TA 1U2RA 2DITA 2Y0BB 3JXOA 2DGWA 1QM9A 2B3TB 5A8RB 2FC8A 4B17A 2CQ1A 1CG2A 3BYRA 3VQSA 2BM0A 2Q1LA 5CYJA 4FF4A 4UTGA 1S7IA 3MAAA 5KFIA 4F7VA 4CTAA 2F4VJ 1SC4B 2QYCA 5BXIA 4DFMA 1U48A 1GNKA 1D09B 3D2WA 2RILA 2WVFA 2CJAA 5HATA 4KGKA 3KK3B 4LBIA 5LT5A 1UFLA 2VC0A 1OSCA 3A13A 2R7SA 3C14B 3CO0P 1SL0A 2J76E 4ZIWA 4AL5A 3RG6A 1S1VA 1YG0A 4ED6A 4QIWD 4X4SA 4LFCF 3HZGA 3GFXA 3MGJA 2J8SA 4ZP8A 4M5GA 1OMSA 4QIEA 2DIUA 2W4PA 4LF1A 3D0HE 1FJCA 1YRUA 1IJFB 4RPFA 2Y8YA 4URQU 1F1BB 4J9SA 1S1XA 2OSQA 2VG7A 2EFQA 1UP1A 4JI2F 4M63A 2OKQA 4ZP9A 4UUXA 4WWSA 3MZIA 1X5TA 1EP4A 1Y3JA 2CPJA 2YKAA 4KHPF 4OI3A 3RYLA 4Y00A 4Y6IA 3HJFA 2DR8A 3NGTA 5KG6A 3WC0A 2MZRA 1TELA 1R8AA 3DDNA 3TZWA 3ADAC 1LWEA 4WXOA 1XERA 5DDRC 2DHGA 3J81j 3NP5A 4EBEA 5HP1B 2APOA 4QOTA 3EGVA 5HO4A 5EX3A 3I56S 2AJ2A 3PYDA 4M5DB 1RDRA 4ECVA 3LPEA 5FJ4A 3IAS9 1HBNB 4CLSA 1PJ5A 1IBKJ 3O2IA 2NUUG 3A3OB 5BR8F 3QRQA 5I3PA 1LWFA 1HLWA 5M2RA 1EETB 2QO3A 2BE2B 2JHEA 4OYPA 4ZPVR 2KRRA 4XPCA 3SV4A 4RW7B 2P5VA 2OLWA 1N34J 4F3QA 1TL1A 4LRFA 4B3RF 3Q8PB 1MMLA 3FDSA 3TAQA 3ZC4A 3CT9A 4DV1J 2MY7A 4A8YA 5HVGA 3IM9A 1ZM2A 3CDAA 4OYWA 4DV0F 3MUMP 2XEXA 1M5OC 3QO9B 1PO6A 4CZCA 4IG0A 1P1TA 5LSRA 2D9OA 1CJVA 2CA9A 1SUQA 4IO1A 4PWUA 4Z37A 3OSNA 3S01A 3M6WA 4I69A 2GQCA 1WF2A 3KLFA 2V9WA 1S0OA 5LSOA 4F3MA 1X4AA 2DIVA 2ZVIA 1F2HA 4Z7CA 3KJVB 2QA4G 3BJYA 3I0RB 1UVJA 1AYEA 4X4UA 2VG5B 2NLWA 3MMCB 2CQIA 4X62J 3B78A 3UVJA 1S10A 3PHEA 2CPDA 1UAWA 2NUHA 2BA9A 1FA0A 3OR1A 2HKEA 3GILA 4F67A 2FYXA 3M05A 5C24A 1S1WA 2ZBPA 4JI6J 3FK4A 5D4LA 3FSXA 1NJZA 1XWLA 4FYXB 3LTOA 4GRSA 1X31C 3FEZA 1PJ7A 1TK0A 5KT2A 1RT7A 3OVSA 1XJWB 1M5HA 4NLUA 5BYRA 1P9QC 3OXLA 5CH7B 1RTJA 1TL7B 1Y0HA 3R5DA 2WTFA 4LSLB 2E29A 2MMYA 2K1RB 3UDVA 5D77A 5KG4A 5H9EK 2RKIB 3BGLA 2ERRA 2RE1A 4M1KA 4OZ0A 1VC6A 2KN4A 4OX9J 1RTDB 4XK8C 4UUWA 2C2NA 3IS9A 1P9YA 2KI2A 1FJEB 4YB6A 2JWNA 5GMEA 3DFEA 3E01B 2FZCB 1BC6A 1QLNA 4IRCA 3UN3A 1N4LA 2YVSA 2IDLA 2GIRA 5HBMB 3RJMB 3BZQA 3U1NA 4UZCA 4GO5X 2K06A 4B3SJ 2OAUA 4HH1A 5GMKa 4GVBA 3H42A 4ZJOA 3ENAA 4D3GA 4DFPA 1V3ZA 1U26A 1NPRA 3D0GE 4LQ9A 4J37A 5A76A 5DRKA 4LF4F 2B4UA 3IG1B 4JI8F 5LJ5Y 3DRRB 3JS9A 2IC3A 3OW2R 3DXBA 3D7SB 6FDRA 5C25A 1EHWA 1IR0A 1RP5A 4Y28C 4Q7AA 1N5VA 1RKIA 2XY6A 3DDIA 4KAIA 1JKHB 1UA1A 3EWGA 3CO9A 2C2DA 2DXFA 3O8WA 1ZAXA 4C8NA 2IDEA 3BO4A 1FDNA 3GWCA 2PMZD 2MY8A 2RT3A 1U1QA 4OI6A 1LWCA 3PX6A 2VICA 4X4PA 4NLQA 3H0PA 4X4VA 5LMUJ 2V4JA 2DO4A 4HHUA 2XQCA 1AFJA 4MIBA 3EVOA 4CLKA 2CPXA 3W2WB 4X64J 1D8ZA 5EX0A 1ZTTA 5KT5A 1GT8A 1AT1B 4N8NA 4EGLA 5FD1A 2FTRA 3HHLC 4LSNB 3EPIA 3DXSX 4KHMA 1SKSA 4OI4A 3H8YA 3ISZA 3MFHA 1CJKB 4JV5F 2HHHJ 2B7CB 3KK3A 3M6XA 3HHNB 3W66A 4DUYJ 2HNDA 4CT8A 1RTHB 2V8DA 1GMVA 3C14A 1HI8A 4G1IA 4NYOA 3DCAA 2YKPA 2WHOA 2VPXB 1Y5NB 2RJZA 3KG4A 4WXWA 1FRHA
chains in the Genus database with same CATH topology
4X66F 5DETA 1KQGB 2P9CA 2PO4A 3J7YI 3NL0A 1AXQA 3SMZA 2BM1A 2EFOA 2HWHA 4Q8FA 4OLPA 4MKYA 4UQTA 4GO7X 2B6AB 2B6AA 5T14A 2LA6A 2GX8A 2E5JA 1XC9A 3QGHA 4HTJA 4TLQA 2YWKA 3POTA 2GC8A 4XPEA 2VA3A 1IBLF 3QPIA 3GR0A 2EBGA 3SSRA 4AFFA 2MSSA 4BWMA 1Q7YT 4CO1A 5H9EJ 3CCVS 1FRJA 2IM1A 2UV8G 3MM5A 5KG3A 2HVZA 2PD1A 1YHQS 3TUZC 5A0YA 5A0YB 2VBWA 5F8HA 2K7JA 2BRLA 4BS2A 1R0AB 3ICLA 4OFZA 4EUVA 4RU2A 4G3IA 3G9CA 4BHQA 3NMRA 2KXHA 2MKSA 4PXCA 5F8MA 1VFJA 3DN9A 5HL7Q 3I31A 4IR1A 1FEEA 4J9KA 1D3WA 1KS2A 2IRUA 3C6TB 5IQQA 1S9EB 3HLUA 2D3OR 3CJ0A 4NLXA 1FT8A 1Q7LB 4NA1A 4NL5A 3NAHA 2CQBA 3MM9B 2ZDOA 3CWJA 3PRDA 1GXTA 1U6FA 3V6JA 3QLHA 4A48A 1E6VB 1E6VA 2I0XA 4YY3F 1S48A 4FXWA 3QMQA 4C97A 1Z2LA 4F4ZA 2HHTA 3BEGB 3OFEA 1AFIA 1U09A 1Z1ZA 3AY0A 4PG4A 3TYTA 4JV1A 1S77D 4A8KA 3NS6A 3Q22A 2ZH7A 1TR0A 5L1KA 4WYWA 4K4XA 2J0QD 1ZM4A 1FHTA 4NZ7A 1K8AT 2M70A 2JLEA 2CPIA 4DL0C 3QJJA 2E44A 2YWFA 3K57A 1RISA 3TNVA 4M5DA 1X5OA 4RW9A 2N3OA 1HBOB 1HBOA 3TI0A 1SJFA 2IA0A 3UCZP 2XMTA 3BO3A 2MDAA 2E5IA 4QYRA 3FJ2A 4Q0BB 4Q0BA 3A1YG 5EGYA 1IN0A 3CPWR 1HBNA 4K4WA 3SXLA 2RU9A 3CCLS 1H6KX 3CIZA 1NJXA 2MHNA 1KNZA 2V5HG 1WTBA 2CPFA 2J7KA 4FVCA 3HPOA 2HS4A 3ZZ0A 4DR6F 2F1FA 3GIIA 4WFYA 3CC2S 3S8SA 3ONQA 2BZ2A 1X4FA 2W24A 4H4KA 2YY3A 5A6PA 1M0SA 1YJTA 1EETA 1FKAF 2VONA 2BE2A 4DDFA 3GG1A 5KG5A 3J80Y 3DU5A 4B9TA 3THTA 3HO1A 4C8LA 2GMLA 1HD1A 1H7WA 2PC6A 2CQHA 5MAOA 4C8YA 3TANA 3NMAA 4JI0F 4F8RA 1C2PA 2CJQA 1VBXA 2LU2A 4NZ6A 4RW7A 2BOPA 1QSYA 2KT5A 4KIAA 1S6PB 2CYYA 1G7CB 2EFPA 4LVOP 4C11A 5D6GA 4OHWA 1JJ2R 1TP7A 4JI3F 1OO0B 2L9NA 2DGVA 4KQZA 1I6JA 4RX6A 1HNVB 4TY9A 4RKUC 2XI2A 3BSAA 3DHWC 2B9XA 4IG3A 3OJUA 4O3RA 1XTZA 4QWDA 3TA1A 1L3TA 3RB4A 1B64A 3AJ2A 1FEHA 1LW0B 1LW0A 3HFKA 5KFRA 2EWHA 3HT3A 3U1MA 3MMJA 1UEUA 3D1HA 2XSFA 2UVRA 2V8GA 1WG1A 3D54A 5E0OA 3G96A 1TL5A 2G4BA 1X9SA 3KHGA 3ISND 2XLKA 4KT0C 1FNMA 2IVFB 4KE5A 3PW5A 3LWLA 1LV5A 2LEAA 2OFHX 1KRPA 3MUVP 2NPFA 3M8SA 2D7SA 3EGNA 3PW4A 2NR0A 1P8GA 2QMWA 4C9DA 4MH8A 3QO9A 2XMVA 4JUZA 1ZBTA 4C8KA 2CJ9A 1LK5A 2RQCA 1NB7A 2E1AA 2ZC4A 5HI7A 4RNMA 2MPUA 1UA0A 2DNRA 2RS8A 4ATNA 3T19A 4F2SA 3MMAB 3MMAA 1IKXA 3LUYA 1UVIA 1YRTA 4UOCA 2W8KA 4ED1A 2ZHOA 3BM7A 3L95X 5D4OA 2UUWA 2ILYA 3WZ0A 5JJBA 3MUTP 1SJQA 3AQPA 3CTRA 4DQPA 2DPJA 5BJRA 3DHXA 4R8UA 4R8UB 2DO0A 5F3TA 2M88A 1VQLS 1HHTP 4TU9A 5DS7A 3GFHA 4N8OA 2O01C 1C0UB 1C0TA 1C0UA 4JV0A 4DG1A 3KJVA 4GC7A 1ZZNA 1H7XA 4IFVB 2LQ5A 2DBBA 2J9DE 4WE1B 4LVNP 1YTYA 2KKHA 4Q5VA 3I0RA 4F02A 1KN6A 2JFKA 2O66A 2JEIA 3FNNA 4DSJA 3X3UA 3OV7A 3MMCA 4CO4A 1X5SA 3G6VA 4LF8F 4C98A 3W3SA 1FJGF 4Q43A 2JZ5A 3K5LA 2A2DA 4PUOA 3RAXA 1PGZA 1F9FA 5IZHA 2E9TA 3S6EA 1F0XA 1ZM9A 4FBUA 2MXYA 2LDIA 3HVTB 3HVTA 1JLFB 1FO1A 1JLFA 1HQUB 1HQUA 1R7IA 1VK3A 2PE8A 4TN2A 5GAGU 2WOMB 2WOMA 3SI8A 4IQMA 2YX7A 4RWXA 4LMZA 3MHYA 1WEXA 2WAQD 2D3UA 1UL3A 1ROFA 3L7OA 3MAHA 2R4FA 4KFBB 1U6ZA 4TYBA 1UJ5A 3RW7A 2X1FA 4ZVHA 4UW2A 4DL2A 5I4MA 2CZVC 1TKDA 4HDHA 2F8EX 4FXDA 3ZZYA 3IFEA 4PPDA 1RT1A 4IO9Q 4B9UA 1GX6A 4NX9A 1M90T 3DU6A 3UR0A 4IOCQ 5B0CA 2HWIA 4OHVA 2AJQA 4EO6A 4KO0A 4YHHF 3CCZA 4KV8A 3HM9A 2LYVA 1IUJA 1R89A 2MZ1A 3OJSA 3DI6B 1X8DA 3DI6A 1S97A 1DFDA 2Y1RI 1FRXA 4WJBA 3HVRA 1SKRA 5L1IA 1VQ8S 2J0WA 3LP1B 3LP1A 1NHVA 3FGVA 3M4XA 4CO5A 3RRKA 1YWXA 1H2UX 5LXYA 5EWFA 1ZETA 4OZNA 2E5LF 5I3UB 3Q8SB 2L3MA 2LXUA 5I3UA 2HHWA 3TAPA 2C3YA 2DNNA 3CSKA 3DLGA 3I87A 4CH1A 3M2VB 3M2VA 4ECRA 5JUMA 4DJBA 4NCBA 1LW2B 2Q79A 1ZH5A 4WIIA 2IBKA 2BDPA 4ZCMA 1IQZA 2R7QA 2UXDF 1J5OB 1J5OA 4D3HA 1RT4B 1RT4A 3H5UA 4DBQA 3BQ0A 4DL3A 2UUCF 3GG0A 4M94A 1N0UA 2V8VA 4Y2AA 4O3PA 4RNFA 2W9AA 4NLTA 2DR7A 3NCQA 3VZHA 2OH2A 3TAMA 3EZ5A 2CVEA 1DLOA 2VKZG 4NA2A 2JJ4D 1JJ4A 2E1CA 5L8RC 4CH0S 4A8WA 4FN5A 4MK9A 4OJHA 2ZH8A 4N47A 4DSEA 3MF5A 1K9MT 2QV6A 2AWZA 1R8CA 4OZ1A 2VKRA 2PN6A 1KQFB 2I38A 2O3DA 4J9RA 1RGVA 1NK8A 4PXBA 2UU9F 2KZZA 4EZ9A 2CQ4A 3PRBA 3KOAA 3JAMY 2ZH2A 1XNQF 5K8NA 5J2PA 2L9DA 3BR8A 5F8LA 3I0SA 2VFSA 2BABA 3OVAA 2QA1A 2R2SA 2G9OA 2VH7A 4F25A 4WFBQ 2AGQA 1X5PA 3ITHB 3ITHA 2K1RA 2QMXA 4ID8A 3RAMA 1S79A 2UVVA 2IVYA 3UFCX 1PC5A 1WF1A 3V4IA 4ILMA 1JLAA 4BBYA 4NRTA 3ULHA 4TNOA 1N5SA 5H9FJ 4TY8A 5MLCV 2HPUA 2BVZA 4I0WA 1FERA 1WWHA 4QR2A 5LXRA 3M9OB 1HNXF 3IGNA 3MM8A 2CJBA 2GMJA 3NLCA 2VFTA 3HHDA 4NWBA 3HF5A 1L3UA 3TOQA 4FYDA 2WSEC 1HL6A 2KO1A 1ZPWX 3CD0A 1JK9B 4H4KC 1JLCA 3WC2A 1L3SA 2VFUA 5HQ8A 3BREA 4ETXA 4EWTA 1RTDA 5BYSA 2MQPA 4MAKA 1S0VA 3KLGB 3KLGA 1VC5A 4YFUA 1C1BB 1C1BA 2AJFE 2ZD1B 2ZD1A 3C8YA 2EVZA 2L41A 1U1RA 1KTQA 1O5JA 4G1QB 3WDOA 4A47A 2ZE2B 4U6PA 3U7JA 3EX7B 3M9NB 4RW4B 4RW4A 4NA3A 4EYIB 1Q53A 4Q2MA 3E01A 4I6YA 2XS2A 4TLRA 3MPYA 2CZ4A 3OTCA 2MHEA 3QJLA 1KONA 3ZZOA 4I7FB