1H2UX

Structure of the human nuclear cap-binding-complex (cbc) in complex with a cap analogue m7gpppg
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
149
structure length
149
Chain Sequence
b'GLLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 80 KDA NUCLEAR CAP BINDING PROTEIN
publication title Large-Scale Induced Fit Recognition of an M(7)Gpppg CAP Analogue by the Human Nuclear CAP-Binding Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
total genus 41
structure length 149
sequence length 149
chains with identical sequence Y
ec nomenclature
pdb deposition date 2002-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1h2uX00
1SJFA 1WHXA 5LSOA 3I55S 2YH0A 3FEXB 2BOPA 1WEZA 1U1LA 2CPXA 1VBYA 1A7GE 5HL7Q 3MD1A 5GMKa 2L9WA 3Q2SC 3CCJS 3UD3P 2UP1A 2AYMA 2J0SD 3NNHA 4CQ1A 4FXVA 2KRRA 2DH9A 1H2VZ 4U67Q 1G2EA 5DDQC 1SJ4P 2XS5A 1VQMS 2KG1A 2AYBA 1D9AA 2DGQA 3MUVP 2OSRA 1VQ6S 2N3LA 1D8ZA 5JVHQ 5DM7Q 2DITA 2MKCA 2F3JA 2HZCA 3G4SS 2GHPA 3P49B 3CC4S 5LXRA 2DNYA 3VAKA 2MZ1A 3R1LA 2YWKA 2MQMA 3VALA 3SDEB 2MSSA 5BJRA 3THPA 1U1OA 2EVZA 1JJHA 2V94A 3CCVS 2KU7A 2N82B 3PIOQ 3NNAA 3TYTA 2YH1A 4IOCQ 1FNXH 5GAGU 5GVQA 4PKDB 3PIPQ 4WFAQ 5DETA 4WKRA 1M5KC 2MHNA 2PEHA 4PR6A 1SXLA 2DIVA 1X4DA 3ULHA 4V19X 4P6QA 2OJ3A 3VAIA 3CD6S 2VONA 1U1NA 1FJCA 2CPJA 1P27B 4CH1A 3UE2A 1SJQA 3U1MA 1X0FA 2JVRA 1H2TZ 2MQNA 2MMYA 2CQDA 3CCLS 2LMIA 2MQLA 1WG4A 2CQ4A 3VAGA 1QVGR 3TO8A 2PE8A 3SDEA 1WHVA 1VQOS 2DNKA 2DNMA 2KH9A 2RS2A 3VAMA 2DH8A 1X4EA 2YTCA 1VQ4S 4W90B 1PO6A 2MZQA 2MQPA 2F9DA 4LJMA 3MDFA 1KD1T 2M8DB 2D9PA 2VOPA 2RVJA 1DRZA 5IFMA 1VBXA 2JWNA 1M5PC 2LA6A 2XNRA 1M5VC 5LJ5Y 2VOOA 1IQTA 1N54B 5GAHU 2CQ2A 2KHCA 2M2BA 2DNZA 1SJRA 3BEGB 5CA5A 2MZSA 2RUGA 2E5IA 2MQOA 1WEXA 1YHQS 2DNOA 4YB1P 3IRWP 3H2UB 2AYGA 2A3JA 5DDRC 2G0CA 1WTBA 2DNPA 2LA4A 1JMTA 2E44A 2KM8B 3N9UC 1U1MA 3SXLA 3J7YU 2DGOA 2J8AA 2L41A 1S79A 1XN9A 4WCEQ 2DISA 1URNA 2CQGA 4YUDA 3CCSS 1UAWA 1YI2S 4F26A 2RRBA 3ZZZA 2N7CA 3CUNA 3DLLQ 1JJ2R 2LEAA 4LMZA 2DHAA 1L3KA 3B4MA 5H1SV 2KRBA 4TLQA 1PGZA 2K3KA 3UCZP 2RNEA 3D2WA 4RU2A 4LIRA 2OSQA 1OIAA 2CPYA 4IOAQ 2FC8A 1WHWA 2MQQA 4C0OC 2DHSA 4BS2A 2DGXA 3CMES 2DGVA 2LEBA 1U1QA 1NO8A 1Q81T 2CPIA 5FJ4A 2M7SA 2NZ4A 2MKIA 4ED5A 1O0PA 3CMAS 1N52B 5D78A 2LXIA 2EK6A 3MD3A 4UQTA 2FC9A 1YJNS 2QEXS 1WHYA 2MZTA 2FPHX 2DNRA 3CC2S 1VQNS 2MPUA 4CH0S 1JJ4A 2KFYA 1YJWS 3L3CA 1VQKS 2DGWA 4W92B 2MKSA 5LXYA 2BZ2A 2RU3A 2CPZA 2LECA 1N88A 3UCUP 4QQBA 5DDOC 1KC8T 2LYVA 1R8HA 5JVGQ 2LKZA 1VBZA 2DB1A 1RKJA 1ZH5A 3MUTP 5HO4A 1HA1A 3R1HA 1VC0A 2KG0A 5CXTA 1HL6A 3FEYB 3S7RA 2WBRA 1WG5A 1R8PA 2DNQA 1YIJS 1UFWA 2DHXA 3BO4A 2QFJA 2ADCA 1X4FA 3LQVA 2M88A 2JVOA 2F9JA 1ZZFA 1X5PA 2CQ1A 3UWTA 3P3DA 1H6KX 2RS8A 1S72S 2CPHA 1X5OA 2MJNA 3UCGA 3I56S 1BY9A 2CPDA 2HGMA 3EGNA 2E5HA 4EGLA 5CYJA 3MXHP 1VQPS 4OZ1A 2J76E 2MSTA 1YTYA 2CQ0A 1VQ7S 3NS5A 3G6ES 2DGTA 4WIIA 2QA4S 1ZZNA 3S8SA 2J0QD 2KXHA 2DNHA 2DO0A 2MKHA 1OO0B 2HYIB 2OIHA 3CCUS 1OPIA 3CC7S 3P6YC 2M70A 3CF5Q 1P1TA 2KN4A 2HGNA 1VQ8S 1UP1A 1WF0A 1A9NB 2CQPA 2KM8C 3VAHA 4F02A 2DIUA 4YOEA 3JB9k 2ZJRQ 2VODA 1N8RT 4Z2XA 1U6BA 1YWXA 4FXWA 2L08A 2DGSA 1VQ5S 2MKJA 2KT5A 3CCMS 1WI8A 1FXLA 3US5A 1YITS 2MJUA 2KXFA 1DHMA 2MY7A 2X1FA 1HD1A 1K8AT 4J5OA 2X1GA 2FHOB 4PRFA 2RT3A 2CPFA 1K73T 1X4CA 3P5TL 3UD4P 3BS9A 3BO3A 2E5JA 3MURP 2X1AA 1Q7YT 3HHNB 5GAEU 2DNNA 3G96A 1KQSR 4QU6A 2ZJPQ 1HD0A 2KYXA 3LPYA 2DK2A 2DGUA 3CCQS 2OTJS 2LCWA 2D3OR 2OTLS 1X5TA 1X4GA 1WWHA 3G71S 1DBDA 5LJ3Y 1B7FA 1WG1A 3RW6A 2JRSA 3Q2TC 4C7QA 1Q86T 1U6FA 2XS2A 3IWNC 3MUMP 4WF9Q 2AD9A 2CQIA 3G8TA 1X4BA 1FJ7A 3H2VE 2K8GA 3VAJA 3NS6A 5DDPC 1H2UX 1FT8A 3CTRA 4QPTA 2CQBA 4TU8A 2O3DA 2I38A 3CPWR 3K0JA 1Q82T 1OWXA 5DM6Q 2U2FA 3HI9A 2ADBA 1SJ3P 2ERRA 2M4MA 2NLWA 2CJKA 3G9CA 3SMZA 4IO9Q 3EGZA 1YJ9S 2AYEA 3CCES 1FJEB 2KI2A 5GADU 1AUDA 4Y00A 2I2YA 1X4HA 3S6EA 2ZJQQ 2U1AA 1FO1A 1U1PA 1VC5A 4ERDA 1NU4A 1U1RA 2FY1A 2Q79A 1WEYA 2N3OA 2DO4A 3EX7B 5MLCV 2MB0B 3THTA 1F9FA 1U2FA 1WI6A 1M90T 2LXUA 2MY8A 4F25A 5D77A 2X1BA 2JX2A 2SXLA 4OZ0A 2HGLA 1CVJA 2DH7A 4WFNQ 2MZRA 3CCRS 1K9MT 1X5SA 2M0GB 1KOHA 3U1LA 5IQQA 3TP2A 1WELA 1U1KA 2XS7A 2RQCA 1FHTA 2MKKA 2GO9A 1VQLS 2XB2D 2YKAA 3BO2A 2D9OA 3VF0B 2M9KA 1VC6A 4UY8T 5IM0B 1X4AA 3S01A 3VAFA 2B0GA 2RQ4A 2XNQA 1DZ5A 1RK8A 2CQ3A 2M8HA 3R27A 3MOJB 1WF1A 3DXBA 2E5GA 4IUFA 3NMRA 2MGZB 2MYFA 2EK1A 3CULA 4WFBQ 3NNCA 3V4MA 3MI7X 1M5OC 2XSFA 3B4DA 4C4WA 2G4BA 3CXCR 2LQ5A 2MZJA 4CIOA 2MXYA 3OW2R 1QM9A 4ZKAA 2KXNB 4M5DB 2KVIA 2DHGA 2CQCA 2DNGA 2M52A 4A8XA 5ITHA 3ZZYA 4TU9A 5IM0A 3G8SA 1M1KT 5LSLA 1UW4A 2RRAA 3J7ZT 1QVFR 5EN1A 1VQ9S 4QU7A 2CQHA 1WF2A 2CPEA 1KOOA 1NJIT 4TU7A 2DNLA 2G1DA 1W2BR 2MGZA 2HVZA 4Y0FA 3RW7A
chains in the Genus database with same CATH superfamily
1XERA 2YH0A 1KTVA 3LWLA 3KLIB 2XI2A 4KV8B 2B9XA 5L9XA 3FQKA 4QWDA 4NMXA 4Q5VA 5B0DA 1TL7A 3NNHA 2NREA 1OY9A 2DH9A 4M94A 4YY3J 4DR1J 3N5BA 2PN6A 4ECXA 3T1HF 4DV6F 4DR3F 5GAEI 5CABA 5DM7Q 3G8QA 5KFKA 1Y10A 4ECVA 1KLMB 2MQMA 1YJ7A 2OEKA 3THPA 8AT1B 5C25B 1YSJA 5A8KA 1S1UB 1QAJA 4HT7A 3V5RA 1F5CA 3C16A 2V69A 1HBUA 1SJQA 1RT3B 3I0SB 4R0JA 1ZM2A 2DEJA 3PW0A 2CG8A 1WG4A 1QVGR 1FKAF 3SDEA 3NL0A 3G6XA 4ELUA 2DVIA 4DPTA 4OYBA 2E1CA 5KFBA 2XNRA 3UN2A 3K58A 3D1OA 2NPIA 1WEXA 2QLBB 3CDUA 5KG7A 3JTOA 3IRWP 4J9LA 3FSIA 3IFEA 2ZE2B 4CLFA 4DQIA 1UKUA 3J7YU 1WKJA 4RUBA 1HNXF 3MPYA 5IT9Y 1PBAA 3DM2B 5B0CA 2DY9A 2JC1A 5L1LA 3P96A 1KWMA 4ZPTR 2E5LJ 4ECQA 1OIAA 2MQQA 1B70B 1FRXA 3BPDA 2R2TA 4JI5F 3KTQA 2EG2A 1IKVB 4R8UA 3E01B 1O0PA 3K59A 2YNGA 1Y4ZB 2GGPA 4KQZA 2HLTA 2BEFA 1FRIA 2YKMA 3NBPA 1FTRA 4K4ZA 4DG1B 3MEGA 1AROP 3NOCA 2DR9A 2GMHA 2ZWPA 4DV3J 4GVBB 3DRPB 5CYMB 2CPZA 1ZPWX 4M5KA 5C7PA 1KVJA 3MGJA 2VA2A 2PMWA 4MYTA 5KG0A 1VRTA 1KN6A 2F63A 3VVUA 1RWOB 3L9ZA 2WBRA 2EFNA 2DNQA 3KLFB 4WZMA 3C3LA 1ZBTA 1UETA 2GJ2A 1S72S 2CPHA 3DLGB 4JI4F 4C98A 1RAHB 4NMLA 2E5HA 4KKOA 5CYJA 2W01A 3KDNA 4KPCA 2ZHOA 3NS5A 3U7JA 2OIHA 1T03A 2GV1A 2CFXA 4YOEA 3BZQA 1N8RT 2RSQA 2ZITA 1YG0A 3U27A 1S9EB 4KB7A 2W9AA 5M2PA 3HHDA 4J5OA 4PRFA 1CJTB 2A0FB 3GIIA 4ZJQA 3H90A 3JSBA 3LPEA 5GAEU 3PR4A 2KYXA 2C2DA 8ATCB 3DLHA 1RWPB 5FDLB 3MM8B 3DDNA 4R5PB 2OTJS 1X5TA 1DBDA 2ZM6F 4DR7F 2V63A 3RW6A 2RKIB 3TUIC 4USKA 3Q24A 2ZH2A 2CADA 3H2VE 1SKSA 3A8IA 1WOSA 4JI1F 2CVIA 2JHEA 5DM6Q 5ETTA 5B7WA 1QE1A 4DR6J 2FJEB 2UUAF 2RD5C 1X4HA 3CDBA 1FO1A 4USWA 3OL7A 3H5UA 4Z7CA 4PPDA 5A8RB 3MR3A 3QNWB 2V4JA 4J90A 3QGIA 2XS7A 3CCWA 3D67A 2MKKA 1CJKA 3ZZOA 2W8LA 4K4YA 4F50A 4IUFA 4WZQA 2XMJA 2PA8D 4G3IA 1S1UA 4WFBQ 3TJAA 3CJ0A 3V4MA 4AE5A 3KK2B 2R8KA 5FLXY 2G4BA 1OY8A 4LUBA 4J7CA 5CYQA 5T14A 4CO0A 4HDGA 4FNIA 1L3VA 3GYNA 3K2YA 2BXJA 1RT2A 1M1KT 2B56A 2Y0BB 4QU7A 2CQHA 1KOOA 4NLVA 3BDEA 2WOMB 1RWVB 1PG5B 4Q43A 2HHHF 3UW1A 3PW4A 1RTIA 2QTWA 2IYGA 1FDAA 2OMLA 3A8KA 3QO9A 2KG1A 2AYBA 3RB4A 3RR7A 2ZE2A 3MUVP 3LP0B 2XEXA 5KT4A 2UVVA 3NP5A 4FBUA 2JEIA 2MZ1A 5BYRA 5KFWA 1CS4B 1T7PA 3MECB 2HHVA 4R0EA 3PX4A 3W8GA 4WKRA 1C1BB 5HQMA 1FWPA 2K3IA 2V2KA 4PG7A 4Z7YA 3KLVA 4YDXA 4U6PA 3Q89A 2EWHA 3D6MB 4QR2A 1PAEX 4DSJA 1RU1A 4X4PA 2QV6A 2XMVA 3UDEA 1N34J 3MM5A 4Q8FA 4RUHA 1RADB 3MMJA 3DRPA 5CYMA 1LW2B 2M8DB 2WHOA 2VOPA 5F3TA 4EO8A 4H4OB 1F2GA 4JI0J 2X3GA 4ZMMA 2BKNA 1HQ2A 4KYZA 4DV0F 4DSIA 3C14B 2G0CA 3RAXA 1WTBA 2DNPA 2LA4A 4JV5J 2L41A 1S79A 4NCBA 2CQGA 3VZIA 2C28A 2D7SA 2VFVA 4LMZA 1ZM9A 1KEKA 1PGZA 3HHLA 3TEGA 2K7JA 4CH7A 4HKQA 1ZM4A 2R8HA 1L3TA 4BS2A 2LXFA 1NJXA 2L9DA 2XGQA 3OUYA 2ZFHA 1AXQA 4LF4F 2E7VA 1S9EA 2KFYA 2DR7A 4DSFA 1WDTA 3OR2B 1FJGF 3UCUP 4F67A 3ET6B 2KYZA 3A3OB 1VBZA 5DLFA 1HNZJ 2KG0A 2HEKA 2K7KA 3UFCX 4LREA 3W5YA 2RKIA 1OSCA 4KHMA 4DS5A 4NLRA 1RWKB 2M88A 3DRSB 4ZLJA 1RSCA 2CQ1A 4WBFA 3P3DA 3TQ1A 3QLHB 2ZKUA 4ICLA 4EEYA 2ASYA 4G1IA 5I42A 4FYVB 1RTDB 5KT2A 3M8YA 5HVGA 7FD1A 2QMXA 4CI0B 5J2QB 2KXHA 4NCAA 2Q6BA 1P1TA 3KG0A 3QZ8A 3W9IA 4Q44A 1R6YA 5A8RA 1REVB 4J9NA 2GQ2A 2UUTA 3MOZA 3W9HA 4WU2A 2YXLA 3US5A 1YKWA 2DR8A 2RT3A 6AT1B 3BO3A 3TANA 2IJNA 4PWDB 2JDJA 3BPSP 3R7NB 1B64A 1HR0F 2D69A 3OJSA 4EBEA 2VPWB 2VQEJ 2ASLA 4UOCA 4LF6J 3D0HE 4LFBF 1YLXA 1LNQA 2HQCA 1LWCA 2JLGA 1VRUA 1S48A 2UXBJ 4M5GA 1QDUB 3T41A 1WC3A 3VAJA 2PI5A 3R6GB 2DHHA 1S12A 5EWGA 4ECWA 4GO7X 2BJDA 2ZBPA 3PJ9A 4XAKA 2AYEA 4Z37A 4ED8A 4GVLA 3OQ2A 3BSCA 3S6EA 1IJFB 1VRQC 5L39A 3QZ7A 1B0TA 2OO4A 2ZHBA 2ZUAA 3ILIA 1DURA 3KLGB 1F9FA 3CCRS 3K17A 3TQEA 3U1LA 4QWBA 1FEEA 1VQLS 1BQXA 4NLYA 2D9OA 3KK3B 3O6QA 3OHBA 2VH7A 1EKRA 1RK8A 2CQ3A 2M8HA 1JLQA 2KJWA 3E8OA 2GQQA 3CULA 1S6PB 2C42A 4CNYA 1PJ5A 4DV5J 3MMCA 4XDCA 3VVTA 1NMEB 1LKZA 1XWLA 4OX9F 1U09A 1BXNA 4UOFA 5F8LA 1FE0A 4JI3F 3OL9A 4DR2J 4FPRA 2Z0GA 1SUQB 4O3QA 1FKOB 4PXDA 2BJ8A 2WBMA 2H48B 1RT7A 3OLAA 1P9YA 2VQFJ 3OBIA 4RBVA 4FXVA 2A2DA 4J37A 3O5TB 5HQLA 1LXNA 4UZBA 2IRXA 1XNQJ 2R3VA 1RT5B 1H7XA 4BWJA 1JWWA 5F8GA 3OTDA 2R8IA 3PEHA 3D0IE 1DLOA 2FLLA 1S1XA 4X64J 3D7SB 1P1LA 3TJ9A 3AD9C 4DR5F 1TAQA 4FPIA 3M8ZA 4FF1A 4LR8A 5KFLA 2W4CA 3LAKA 2CPJA 2VKZG 1BGXT 4H4MB 1TL4A 4DLGA 1Q53A 2VG6B 3R5AA 1RHQB 1FERA 3GU0A 5L38A 3IBFB 5K9FA 4BLGA 3HVAA 3UI3A 1G3OA 4NI2B 3C15B 5HJXA 2W8KA 4NRUA 2EFQA 2YWFA 1UCNA 2CQ2A 1H74A 2VPYB 4KJIA 4NLPA 3GG1A 4K5SA 5C2CA 5DDRC 4L73A 3W8PA 1RI7A 2YNFB 2YKNA 3K8VA 2ALZA 3AOBA 1N5YA 4PXEA 3DLLQ 1XEZA 3B4MA 1Y5LB 3T1YF 3SCJE 1GX6A 5J2QA 1KSPA 1S57A 1X0PA 3UDCA 2LEBA 2ALYB 1NO8A 1K47A 5HN0A 4RNMA 1LW0B 1REVA 5D78A 2Z2LA 1AZSB 3TZZA 4QW8A 5LMUF 3SV4A 2C3UA 2MZTA 5EUHA 2E1MC 4WIQA 2DGWA 1HFEL 1UVKA 3KFWX 2CAJA 2PMZD 4PWDA 2EPIA 3TX0A 2RU3A 2YX4A 3BQ0A 4H4KA 2Q3PA 5JVGQ 2LKZA 2VICA 2MHEA 5HO4A 4DX6A 4GMKA 1SIWB 2I8EA 4RWXA 5A8WB 1C1CB 3VZHA 3HVWA 5D3GB 2Z56B 1YIJS 3SIPB 4Q2LA 2YQ0A 1H0HB 2OUGA 4YR0A 4IQMA 4RLEA 5A0YB 2R2RA 2EFOA 5G0RA 3EGNA 3TA1A 4DV7J 3WZ0A 3ZTOA 1FFWB 2W2QP 1F9EB 1OPIA 3DMJB 2VU5A 3HKWA 1D8YA 3SCLE 4UOGA 3VAHA 4CT9A 3OD2A 4FYYB 5K8NA 1U8WA 2FIUA 3GILA 4RL1A 2FJXA 5I3PA 2VG5B 1K8AT 3KK3A 1BUXA 1BMQB 4ZVTB 3RBZA 3OHAA 2X1AA 2B43A 2YWHA 4C9DA 3BJYA 2FLNA 1S6PA 1ZYQA 2W4PA 1NK0A 3DOLB 3VTIA 2OTLS 3QJPA 3ILJA 3C6TB 5KG1A 3OVSA 2Z4PA 2HS3A 4NLUA 1NEEA 2QRRA 3SV3A 4Y2MA 4X65F 3IR7B 2NXEA 4O3PA 1FKOA 3CTRA 2VFSA 3G82B 5KFVA 1J27A 4QR1A 2HQFA 5E3AA 3ETMA 1PYTA 2Y9HA 2FZGB 3EGZA 3LTOA 3CJRA 1X31C 1AUDA 1Z2ZA 1JLEB 2J6TA 3V6DA 4LR7A 1GMUA 1U1PA 4X66J 1U1RA 3PY8A 3SZ2A 2ASJA 1XBWA 2CUYA 2W2OP 2KTQA 7FDRA 1VC6A 3H8YA 2HPUA 1R6VA 2HNYA 4DUZF 4DOZA 3QWUA 1VR6A 3CO9A 3D66A 2QSFA 5IT4A 1M5OC 4CTAB 4B3RF 1XK8A 3DRRB 4NYOA 1K1QA 3PACA 1KHWA 5J2PB 2KXNB 3OFGA 1CG2A 3MWBA 1VISA 5HBMB 4G6VB 2IVYA 4TU9A 1FRMA 1UW4A 4W4MA 4I4BA 2WCXA 3J7ZT 5KG2A 1U24A 2AJFE 2ZKTA 4KGKA 3DHXA 4URGA 1Y00A 5SUHA 2HVZA 5LSOA 4ETXA 3I55S 1U1LA 3PW2A 5I3UB 3AJDA 3CCJS 2VBYA 2QT7A 4P2XA 1UJ5A 3BF4A 4X4OA 3NLCA 1TL1A 1X9WA 1C4AA 4DV4F 2OSRA 3SFGA 4ZHRA 5A2QU 4DX5A 5JVHQ 2YNIB 2B4UA 1YGYA 2GHPA 3KYLA 1SC4B 1XR7A 1R3NA 3M30A 3R1LA 3DRYA 1F9HA 2M3DA 2DEIA 2BQ3A 1EP4A 1WACA 3PIOQ 1KP6A 1IXKA 4QZVB 4OHZA 1KNZA 3TVZA 1NH8A 2OEMA 1Q78A 4DSEA 5DZ6A 2LQJA 2HKEA 3M2VB 1LW0A 4ANDA 1RTHB 4NLGA 2MLZA 1G4CA 4WPAA 3I5AA 1FVSA 4O0NA 1CJVA 3QIPB 4L74A 1R7IA 2VBXA 1PO6A 2F9DA 3MDFA 2FVRA 2XWXA 2JWNA 2XULA 5GAHU 4K0KJ 2KKHA 3W7BA 2A6MA 5A8WA 2VPZB 1C1CA 1R89A 2FHKA 2EXUA 2DNOA 3SQOP 4LVOP 3HO1A 3MEEA 3WC0A 1JMTA 4Q45A 1VK8A 2KB2A 4MKBA 1KONA 2VD3A 4FYXB 3JAMU 5A0YA 4YP3A 2EEYA 4DU7A 4DL3A 2CNLB 3CD5A 1IBLJ 1FESA 4DEZA 4QOTA 3P5BP 2OSQA 2ZH5A 3DMJA 1WHWA 3PKYA 2XYHB 2UZAA 4P7TA 2CPIA 5JJBA 2NZ4A 2MKIA 4KH1B 4LIWA 4DQSA 3NAHA 1TKXB 2YY3A 2V2ZA 2DD8S 2QMWA 1YJWS 2R7UA 4ZPBA 3L95X 3F73A 3QQCD 2IFXA 3SCIE 4U8YA 2LQ8A 4NA3A 1FF2A 3N4WA 3OXFA 2L3MA 1Q95G 1K44A 1VC0A 4KHPF 2FGCA 1X60A 4LF7F 4NXNJ 4ALZA 1X5PA 4JI7J 2P8IA 3GV8B 4LF5J 2QLFB 4AD6A 4C8OA 4OJHA 2MJNA 1S6UA 4CO5A 4FF2A 4CNZA 3VGTA 1F5AA 4O3RA 1Q5YA 3JQJA 1IBKF 1R27B 3FEZA 5FD1A 3CCUS 3EPIA 1F5BA 2IA6A 3WQPA 2WSCC 4FVMA 5DZ7A 1YJUA 1ITPA 1UW9A 1PJ7A 4GC6A 3R2DJ 2KT5A 4QIWD 4LF8F 4HHUA 1N4LA 3R2CJ 2IHR1 3C8YA 1DHMA 4X84A 4B9LA 4OV1A 3ISNC 5RUBA 3KUHA 4N7TA 1S7HA 2E5JA 3DOKB 4Q0BB 1R0BG 1E6VA 3LALA 3B78A 2OMOA 1YRTA 4I68A 1XMOF 3DRRA 2VBZA 4NZ7A 3Q2TC 1JLFB 2UVUA 1CSJA 2WB4A 2CKWA 4DR2F 4QPXA 3G8TA 4LFCJ 3HSJA 5HBMA 3RAQA 4WYLA 4W98A 1H2UX 2YPYA 3BQ1A 1PBUA 1Q82T 4PXCA 2U2FA 2A6OA 4UUXA 2VQFF 3TA0A 4MJKA 3RB0A 4JYAJ 5I3UA 1NM2A 4B17A 2VASA 1VC5A 1HNVB 3M32B 3OTBA 4JOUA 3EVMA 2MB0B 2Q1LA 4ZVUB 3H40A 4EMDA 3M6XA 2LU1A 2MZRA 1GXTA 3DU5A 5HLFA 2ZWOA 5ETPA 2NPFA 5KOWA 2ZZTA 1MLAA 2XZWA 2YKAA 4X64F 4LSZB 2BE9B 3I4HX 1DTQB 5CQGA 2QL9B 4IFYA 3DXBA 3NGUA 5KFCA 2Z2YB 5KFQA 5E41A 3FMWA 3ZZUA 2N4CA 1GX5A 3TAPA 2F65A 1UVLA 4DSKA 1I94J 3FNNA 4ZP9A 1V9OA 2AX1A 3MMBA 2QA4G 3RUBL 3NCPA 3MM6B 1XNRF 3LP1B 1DQ8A 5HMWA 2MGZA 4RO0A 1T05A 1BLUA 4O3NA 5HL7Q 4QR0A 3UVJB 1L3SA 2AJ4A 3G87A 3UD3P 5AJ3J 2JJ4D 2UP1A 2CA9A 4CQ1A 4AQYF 4M5DA 2G0IA 5D4LA 1NPKA 3MPUB 4H54A 2DITA 2HZCA 2HS4A 4HTJA 1C4CA 3HVRA 3C6UB 4CO2A 4V1Ak 4LSLB 1K0VA 2R7SA 4RU9A 3BKTA 2DIVA 1IQZA 2VIHA 1B4SA 5IQ6A 5H9EK 4CH1A 2NXJA 5KTQA 2FHMA 3RAMA 3A8JA 1Y3KA 2ZVIA 3PO4A 4IFVB 2DYAA 2HK3A 1NHUA 3CCTA 5C24B 4LSNA 1TL5A 2KVQE 3FBCA 2YTCA 2AGQA 5KFJA 3M9OB 3LP2B 4WXOA 1N6QA 4ECYA 2XM3A 4EO6A 1HBMB 1DRZA 5K8PA 4ILRA 3G2XA 1TU0B 4UOHA 4KO0A 1Q5VA 2RUGA 3EZUA 1HI1A 1YHQS 3PDNA 4GO5X 3Q0AA 4WE1B 4QIVA 4JI8J 3R5BA 5HP1A 2J8AA 1MROB 1AFIA 4I1TA 2QA2A 3OTCA 1AYEA 3AD7C 2RH3A 3ZZZA 4EFAC 5H9FK 3BN7A 6FDRA 3H4BA 5EWEA 3ICLA 2K3KA 2J7UA 2JLEA 3J80U 1CBKA 4HH1A 2EI5A 1VQSA 2BRKA 8RUCA 4QYRA 3NCRA 2C2EA 3T5LA 2XYPB 5B0BA 5KT3A 1RWUA 3IA0A 1JLBB 3SBMA 2FPHX 2IC3A 4KIAA 4QWAA 3M6VA 4B9UA 1HWLA 4Q0BA 2BA9A 2ILYA 2I5JB 1RB0A 4WJBA 2DXEA 4M5HA 4OI1A 2YWWA 3GIRA 3W2WA 1PC5A 1L3UA 5L9NA 5IS2A 2XO6A 2QYGA 4O4RA 2CJAA 1JLFA 4NRTA 1QD1A 1YK9A 4A4JA 2QFJA 3BBCA 4TYAA 4RUAA 2VC1A 1RHMB 3DC2A 3QGHA 1BQMB 2HVIA 2R7TA 1DY3A 1TQLA 5KG5A 1TK5A 1NXIA 4OZJA 3M8WA 2FVCA 4OL8A 2H54B 3T5JA 2RF2A 5D0GA 1NPPA 4LRFA 4WP8A 2HBYB 3JB9k 1QUVA 2HWIA 4L3KA 2LQBA 4IYQA 2L08A 2BKPA 1S4EA 3EZOA 1IWGA 2FGOA 2IDEA 3GFXA 2FHOB 4JI2J 2UU9J 1TKTA 3CD7A 3P5TL 2RRNA 3JQMA 1KQGB 1LWXA 4YEAA 2EC2A 1KKHA 3TX8A 2LCWA 5DQHA 1EKSA 4X4QA 1LFWA 2JRSA 1U6FA 2BE7D 3DGPB 1AB8A 3MM6A 3LP1A 2HNDB 1T8EA 4I2QB 4J9MA 4FBTA 4DUTA 2YKPA 2OLWA 2ADBA 4Q2MA 3B8HA 2NLWA 3HLUA 2CJKA 2OPSA 4IO9Q 1J5OB 4ZA1A 5KFUA 1CC7A 3CJKB 2F8MA 2AU0A 1RAAB 2UUBF 4UQGA 2MY8A 5IWAJ 1TK0A 2DR6A 2DH7A 3GSIA 3ZNJ1 2E1AA 5IQQA 1FX2A 3TP2A 2UUCF 1U1KA 1NJWA 2PMHA 4LSLA 2CJXB 4WWSA 3D3BJ 1DFDA 4DFPA 4YHHJ 3SSRA 2BE2B 3JTNA 1KVKA 2NUUG 3V4IB 1ZA1B 3I0RB 3OXLA 4BC7A 4UY85 3R8YA 2ZOFA 4QYZJ 4RW9A 5D0RA 2CNOB 1QM9A 1SQGA 4G1QA 3RYLA 1NKBA 5C42B 3EDRB 1T3NA 1NSAA 3I9V9 2DNGA 2M52A 2K06A 3DYAB 3MAHA 3QYYA 4PG8A 5DG9A 3JYTB 1JB0C 4HACB 3LP2A 4OYZA 1HWKA 2B6AA 2AQ4A 4LF1A 3MD1A 3D28A 4U7UK 1X9MA 3OR1B 4CLLA 2HK2A 5K8MA 2ACMA 4RX6A 4U67Q 3M2UA 5D6GA 1H72C 1WC0A 1KFDA 2LDIA 1RYRA 5JMNA 1YJVA 5LXRA 2DNYA 3CC4S 1IBLF 5BJRA 1NDCA 4TXSA 3KK1A 2V94A 2C2KB 1R0CB 2CJBA 2VJUA 2MHNA 2HVEA 1SKUB 2OFHX 4LQ9A 3NGDA 3D1QA 1Q7LB 2ZH4A 1FJCA 2WZ1A 3RRGA 3JSMA 4C8MA 4HHHA 3C66A 1N33J 4I67A 4Y2IA 1RT4B 4B3OA 3KUEA 2H5IB 1IR0A 3I82A 2DH8A 1X4EA 1S7IA 3NWGA 3O8WA 5KFTA 1IWAA 3OLBA 1NK5A 3VGUA 4MYUA 4XPCA 1VBXA 2ZH3A 2BQRA 5LJ5Y 1IQTA 5DQGA 1NPRA 5CA5A 1JLCB 4J9QA 2AYGA 2A3JA 1LWEB 5J2NB 1HNIB 4EI2A 3GR0A 1BQMA 3ILLA 3D54A 4DI6A 2LEAA 3DLKA 2HSEB 2UXCJ 4XK8C 4P73A 2GQCA 3MFHA 3G6VA 1Q0NA 4PQUA 1RTJB 3H5YA 5KFEA 1BD6A 3CMES 4PZVA 1TKZA 1K0TA 1MU2B 1Q81T 2Y0SD 5I4MA 4Q8EA 2NZCA 3HD2A 4LF9F 1WHYA 1RAGB 2B9YA 4YS2A 1VQNS 3TVYA 1GQEA 4AL6A 1D09B 5ETRA 4EBDA 4AYBD 2DPIA 3I32A 2XCAA 3S1TA 4B3MF 3AQOA 4OI6A 1E6YA 4DL6A 1JNRB 1QAIA 1NRKA 1JIHA 1OYDA 4IRCA 4PPZA 3EICA 4X4UA 1A6LA 1V6HA 4FDFA 3OTOJ 4CLPA 3HF5A 1CPZA 5L8RC 3TUZC 5CZXA 4NWBA 3LGHA 1RJJA 1VHFA 4CO1A 4BWMA 5F8HA 1J5OA 3OTEA 3BGFA 4WIIA 3M2RB 2QL5B 3K7RA 3RR8A 3A13A 3OL6A 1JQGA 2XSJB 4K4TA 2CYYA 1KR4A 4Z2XA 5EHHA 3M8QB 2DGSA 4HDHA 3MR2A 4ZVFA 2WVBA 3FK4A 2MJUA 3KMQA 1LEOA 2FHJD 1PIEA 1WSVA 4P74A 3TEHB 1PAUB 1SCJB 1Q7YT 4I2PA 3CJQA 1VHIA 3I0RA 1XMQJ 2MQ8A 4JI6J 2D3OR 2VB6A 4FYWB 2XCPA 3BB5A 2DPJA 2HW3A 2OP5A 3DCAA 3GWCA 4JUZA 2CQIA 2A18A 2XBPA 2RDIA 4Y65A 3DYAA 1MWQA 2K8GA 4TU8A 3EYZA 3CPWR 1H7WA 4HACA 2GAGC 4FZVA 5C5JA 1TL3B 2EKNA 5HMZA 4XO0A 3CCES 2WK4A 3OR1A 4TY8B 3QRRA 4YFUA 1R8BA 1RXOB 2HGLA 3KJNB 1K9MT 2M0GB 5K8OA 3HT3A 2RQCA 1YJTA 3DI6B 2XB2D 2AJQA 1JLAA 4GKKJ 4ZLPA 2XZTB 2R7VA 2YNHB 4ZIVA 4KR0B 1T94A 1GEHA 4J9VA 3OV7A 1S59A 4P72A 1SL2A 3KMSA 2IVFB 2I1RA 4DUYF 2OPQA 4ZDNA 2MXYA 1TL7B 1N0VC 3NKYA 1WKKA 5ETOA 1RT4A 3MAQA 5HVFA 4K4VA 4M63A 3IS9B 1ZPVA 3HCXA 2X7IA 2C2ZB 4OZLA 4HHJA 1G2EA 3D0GE 5J2NA 2HHPA 1HYSA 3C16B 3AT1B 2DRBA 2QLWA 2R8JA 1HBUB 3HSGA 1AFJA 3H7HB 2ZVSA 3SDEB 1RGVA 3BKUA 2KT2A 2XZDB 3GFHA 2XLJA 2WVEA 4WFAQ 4L3NA 3RJMB 4FP9A 4PR6A 3GIKA 1SXLA 2V68A 5BXIA 3FGVA 1X7VA 2VONA 1MU2A 2VC0A 4WTOB 4RW7A 2MQNA 2A1BA 2V9KA 4C8YA 4OFZA 1VQOS 2RIJA 1N5VA 2W7PA 1HIYA 3PTWA 4RW6B 1HQUA 2XMUA 1U0HA 4USJC 1M5PC 2N7YA 2VOOA 5DRKA 1YRUA 4LRCA 3BEGB 4OI4A 3ZTQA 2CDQA 2MQOA 4EYHB 3AA8A 1AW0A 1HNWF 4WTYA 2DGOA 4R8UB 4WCEQ 4KGZB 1URNA 2YNGB 1IBMJ 2WRMA 1Y5IB 1HWIA 2FJAB 4IO1A 2YKMB 2EBGA 2K1RA 3M2RA 4ZPAA 1OY6A 3GFZA 4IOAQ 3HZGA 2RQKA 3J7YI 3OJUA 1OMSA 5B09A 4I56A 3W1YC 1LOUA 4RNHA 4FYDA 1S1WA 2PIIA 4ED0A 4A46A 2ABYA 5F8JA 2LFVA 4U95A 2A2CA 1SIZA 4W92B 4IDKA 4OLPA 5B08A 4X4SA 2HHTA 5B0FA 1MN9A 1S0OA 3PZPA 2C1EB 4DN9A 2V34A 4WKYA 1LFPA 4QQBA 1KC8T 4KKOB 5IV4A 1TFWA 3MUTP 2HBRB 2KJVA 4DQRA 2J6UA 1HL6A 1RHJB 1N36F 4P9SA 3S7RA 3VGVA 2F9JA 4MMOA 1ZA2B 2XGPA 1RA7A 1T9YA 1U26A 1UPMB 4E8UA 2F4VJ 2AEFA 3HHLC 2R7QA 4HI2A 2W7OA 2BKOA 1TL3A 2DRDA 2J76E 4UW2A 2ZDPA 2GNKA 2BYCA 2J0QD 1UEKA 4URSA 2HS0A 3CC7S 5D8HB 2KM8C 3EE3A 4ZVOB 1WTFA 1VLOA 2GMLA 2QG9B 1FK9A 2ZC4A 3DDKA 3L4BC 1KBRA 4K4SA 2D74B 1FXLA 2XY7A 2KXFA 3W3SA 3DI6A 1HHTP 3BN4A 3KLHA 4KGVB 4RNFA 2GZOA 4DR4F 3BR9A 3HHNB 1NJZA 2DGUA 1QE1B 2PO4A 2HFNA 3TOQA 3I9ZA 1WG1A 1J2VA 2OD4A 2RJZA 2C3PA 4USTA 3ETOA 4ZVHA 1YQHA 1IKYB 2FJDB 3K0JA 2V4JB 3IS9A 2YX1A 4KSEB 9RUBA 3LOUA 4F4KA 4K59A 1CJKB 3A4TA 4B02A 1EIYB 3DLJA 2XMKA 1UVMA 2ZJQQ 2E7XA 4NOHA 4OYWA 1ELOA 3GJSB 5KFDA 1UWBA 2FUG9 3THTA 1FWKA 5CYQB 2FJWA 4OI0A 4ZCLA 4N41A 1WELA 4PYAA 5HI7A 1U2RA 3QRQA 1RT2B 4A8QA 3ENVA 2G9OA 1Q16B 3KHGA 2RQ4A 1IKXA 1SC1B 5DO2A 2OPPA 4N8NA 5LMNJ 2RMLA 1FD8A 2IMWP 3IGVA 1RTIB 1YBTA 2AHOB 4KPYA 3CXCR 2BW7A 1U45A 5KFPA 4FXDA 4URQU 3QO9B 5D4OA 2CQCA 2XMMA 3BQ2A 4C3MA 4DV1J 3N28A 2IMOA 5HROA 4RW6A 4X62J 3CGIA 2B5JB 2HBZB 2B7BB 2CPXA 2Y8YA 3Q2SC 3TNVA 4IH6A 2HNZB 3ELHA 3CNQP 1UA1A 4IG3B 1ULRA 3TARA 5I3QA 2HWHA 2N3LA 3SI8A 2H3EB 3N79A 5E33A 3FRZA 5HANA 3K8WA 4B9MA 3LW5C 1S6QA 3J7A1 2UXDJ 2F8EX 4O0IA 3AY0A 2MKYA 3D9BA 2B8PA 5ETNA 3MM5B 4NYPA 2DCLA 3EWGA 3W5XA 1WD6A 2Z2ZA 3A3PB 1NUEA 4KT0C 4OYXA 1FNXH 3J80Y 1X4DA 4C0BA 2EW9A 1S77D 2ZH7A 3HJVA 1KQFB 1WJ9A 3EMTA 3ZZRA 4OZ2A 1CQNA 3CVKA 1MMLA 4LFAF 3KWMA 4U8VA 2MZQA 2MQPA 1NB2A 4LRAA 3L7UA 1RUSA 3HHLB 2QLJB 4NZ6A 2KHCA 2M2BA 4FKYA 3M8RA 1TV6A 4QIGA 4YR2A 1FFSB 4NLDA 3BKFA 2KM8B 1SBRA 5LT5A 3OUYB 2BW2A 4EU0A 3CUNA 3GMGA 3NOGA 5H1SV 2KRBA 5AXMA 2WSFC 3LGNA 3GP9A 3HFVA 4DQQA 1B3TA 2H65B 1VI7A 2VL1A 3D2WA 3KG1A 3V2UC 4B3TF 3TVKA 2RE1A 5JUMA 3K5PA 2M7SA 3PR5B 4KHRA 1W26A 4CH0S 4ICLB 5I42B 3MR7A 4DXLA 2V67A 1TAUA 4Q7AA 1URRA 3GJRB 5E3RA 3R1HA 2OFGX 2AW0A 4I69A 4X4NA 4E2FB 3G86A 1S99A 4BHQA 3OFFA 4DLEA 1IKYA 2OEJA 4B9VA 3D6TB 4K5RA 2NUHA 3BYPA 2HQIA 2OPRA 4JBCA 3SCKE 4C3LA 3H5XA 1JK9B 2QA4S 1DTTA 1A0OB 5E3PA 4KBIA 3L7PA 3TZWA 1UP1A 4MK7A 1N0UA 2XQCA 4ZN1A 3T1HJ 4DV6J 1MWYA 4DR3J 3IR5B 2E29A 4BBYA 2FVSA 1LWCB 3RG6A 4CZCA 3CCMS 1GMWA 1VRUB 3KKFA 4RPFA 2EC0A 3QMQA 4B3SF 2CPFA 2OI2A 4H4KC 2KFNA 2GVZA 2P9EA 2P6TA 5HVHA 4YR3A 2NXUA 1N32F 4C8ZA 1XJWB 1J5EF 1QJHA 5J1EA 3DLEA 3VCDA 4L72B 1RAJA 5F41A 2HFVA 1EQMA 2AD9A 3DDIA 2VG7B 1FJ7A 2ZHAA 2P5VA 3F56A 3NS6A 1XR6A 2GJFA 1RAIB 2F1FA 1OWXA 2M4MA 2B5JA 3PX0A 1NK4A 3ISZA 4DMZA 3GZ7A 5GADU 2HNZA 1JLQB 3IWLA 3KLEA 2BVZA 4IG3A 3IRXA 3MMCB 4OZ0A 5AXLA 3RBXA 1GTHA 4A8KA 2FJVA 2EFVA 1HNXJ 4P2SA 4ID5B 2F4FA 1FRLA 2YQ3A 4OZ5A 3BO2A 2OD6A 4DPOA 4WP3A 3WIVA 5KFAA 1RT7B 2CJQA 1RHRB 3VQSA 3AODA 3MI7X 4PXBA 3NGRA 1RBLA 4JI5J 2HFSA 2MZJA 2ACYA 2Y3YA 5E0OA 3WC2A 1FRJA 1SVDA 4GKJF 1U4BA 3ZZYA 1VQ9S 2NCKL 2E9TA 4TU7A 4ZIWA 3MEKA 1DLOB 2BJ3A 1S1XB 2R4FA 4ZCIA 1PILA 4ZPVR 3AAWB 2KRRA 1QY7A 1VQMS 2BDPA 5F3ZA 2V4QA 4KFBA 3G4SS 5AE2A 1VS3A 2J7KA 3X3UA 3EXCX 3VAKA 2YWKA 4DV2F 4JI4J 2FVPA 2XLKA 3MM7A 2ROEA 5GVQA 4B9TA 3T19A 3ZTPA 3G6YA 2DR5A 2PEHA 5ETQA 1WC5A 3CSKA 3ZZ0A 4TQRA 4USIA 4IKAA 4I6YA 3CCLS 2XY6A 4OIXA 4O44B 3CJSA 3BGUA 1OJ4A 4CCHA 2DNMA 3M9NB 4USUA 2YKNB 3ZNUA 4MKYA 2GW8A 4W90B 1N5YB 2RHSB 4AT1B 2HAIA 3QGGA 2VJVA 3IO1A 5KFYA 3HSZA 2IM0A 4DR7J 5KT7A 3FCVA 2ATLA 3DKDA 3TW0A 1K1SA 1RAFB 3QSIA 3PYEA 5H9FJ 3T9NA 4TQSA 4M5IA 4JI1J 4P7VA 4A8WA 3C46A 3CWJA 3NGTA 3SQGB 2QL7B 4MFBB 5E2QA 4PG5A 2E9RX 2JSXA 2UUAJ 2PDAA 2KO1A 2QFIA 2R42A 3T9ZA 3J7AN 4C0OC 4D3HA 1BHNA 1P8GA 5FJ4A 3KDOA 2PA3A 2FC9A 4A8SA 2X3DA 3HK2A 1UEVA 2CIMA 2H9ZA 1JJ4A 2JL9A 3CEDA 3V6KA 2BBEA 3ZFVA 4ZJOA 2POKA 1JLGA 3MCNA 1V5VA 4MIBA 2LECA 2BRLA 5G0RB 1VOMA 5DDOC 3OL8A 4CLSA 1VJQA 3OSPA 1V5IB 5KAKA 2YKOA 3PHEA 2CZ9A 4YY3F 4DR1F 4ZVSB 4DPWA 1R8PA 2CZ4A 1T02A 1RABB 2VHGA 2IA0A 4M8LA 2ZH1A 2VG7A 1SV5A 1RLDA 3W63A 3UNGC 4D3GA 2CPDA 2HGMA 3UPFA 2LQ9A 4EGLA 4K4WA 1FWLA 3K57A 5BR8J 2HHHJ 4OHWA 2DGTA 4Y6IA 4J9KA 4KC5A 3CF5Q 3GIJA 2CQPA 4ES3A 4OYAA 1CULA 1FNMA 1VQ5S 2FY8A 3ADAC 3AQPA 4PWWA 2RHQB 2ZBIA 4NEZA 4RUCA 4ID5A 5IOLA 1RT6A 2MY7A 5KFZA 2HVHA 2UVRA 3MMAA 1KQSR 1QAYA 3I96A 1UJ6A 1YJRA 4RW4B 3CCQS 3CW2C 2UV8A 1MMDA 3PCOB 2LP4A 2NSCA 3CJ3A 1EETB 1FXDA 3V6DB 3TZYA 4PEOA 1S49A 2LDYA 2HHWA 4QWCA 4DV1F 4ECZA 2IPOB 2GFFA 3D5MA 4DL2A 4ZK7M 2GIQA 1N48A 2I38A 3F0NA 3KJQB 3F41A 1LWFA 3MFIA 2AJ1A 2E5LF 4F36A 3QRPA 3AB4B 2IJRA 2HNYB 4Y00A 3M8SA 2XO7A 2U1AA 1UEUA 2QN6B 5L1IA 1X9SA 4DV0J 2ZH9A 2VF3A 4CLYA 4LRDA 2WB1D 1T0TV 3X1LB 4RR5A 3B6BA 1NHKL 2CZVC 3EPGA 2W4DA 4C8KA 1FXRA 5SZTA 3W60A 5CH7B 3PEJA 4DV3F 1WF1A 4DL0C 3OXGA 1MN7A 3NNCA 3T5KA 1VMBA 2XSFA 3NAIA 4X4VA 4J91A 4IG0B 4DZDA 1RWMB 1TL1B 2KVIA 4LF4J 3MEDA 4O44A 1NKCA 3HSDA 4NCGA 4A48A 4ZHRB 5IM0A 5B0EA 5HMXA 4QJVA 1WF2A 1OSDA 1NJIT 1ZOTA 4I64A 1W7WA 3HHEA 3M30B 2C3YA 4Y0FA 1WHXA 3FEXB 4RW8A 1FJGJ 3J7Z5 1EP4B 4KE5A 3Q8PB 2W9BA 3UR0A 2DBBA 4DFMA 3FKBA 4USVA 4ZPWR 2XS5A 2IAJA 3OVBA 2LVWA 2DGQA 4N77A 1KQKA 3SSQA 1HBOA 1SQEA 1IVZA 4DX7A 1T3OA 2YPZA 1U1OA 3ITHB 3SQGA 4BC9A 3LWMA 4LBIA 4MFBA 2BUNA 1N56A 1CJVB 2G2YA 4DN0A 5A6PA 5GAGU 1M5KC 4HVZA 2MTLA 4ITSA 2BJEA 3ULHA 3MHYA 2AEJA 2LLZA 3CD6S 4C48A 3HKZD 3BYRA 4NLTA 4F0MA 4OYIA 1X0FA 1RT1A 5D4PA 3DHWC 3MEEB 2HRTA 1RZMA 4ZVRB 2PE8A 4CLZA 3DOMA 1Q79A 5LSRA 3SEOA 3NGKA 1RWXB 4DR6F 1AUSL 2NYHA 4ECTA 1RWNB 1HR0J 2YWEA 4OX7A 2NXCA 3K5MA 4Y2CA 3W66A 3H4DA 1NK8A 4LFBJ 1B7YB 5ETMA 4ZVPB 1R0AA 2B3TB 5GMEA 3POTA 4YB1P 3H2UB 1Q8IA 1WDDA 1F2HA 2QX0A 4ECUA 4MKAA 3KG4A 3IG1A 1NDKA 2DISA 3ILOA 4PAAA 4C11B 4FF3A 5GAHI 3A1YG 3AXKA 4TLQA 2OKQA 3SYZA 1NSKL 3Q86A 2DGXA 3FCWA 2GMJA 2GO8A 4ELTA 1I3OB 4ED5A 3EUNA 4N8OA 4HL9A 2GHWA 3FFIA 4P10A 2MPUA 1FEHA 2R7XA 3PW7A 1UVIA 3LAMA 1GFWB 4ZITA 4PQAA 3Q8UA 2CNNB 4CP5A 3T6JA 3W2VA 1UA0A 4WFYA 4RW4A 2LYVA 2XTJP 4K2JA 4QCLA 3DNCA 1EETA 3MPVA 4JP8A 2BX6A 5CCLA 3J81j 2ZH8A 3QFWA 4OX9J 1TUVA 2KHDA 2DHXA 3PJXA 2ADCA 1X4FA 4LF2A 3UWTA 1NHVA 4JI3J 4ZVEA 5ETKA 4NLOA 1EZZB 2FDNA 1H73A 1BY9A 3UDVA 1TK8A 5M2UA 1WNEA 1UJ4A 3V6JA 3G6ES 3VWSA 1NAQA 1IKWA 2DNHA 2HFZA 2DO0A 1OYEA 1UTAA 4N56A 4AL7A 3IMQJ 3GR1A 4J9SA 1E6VB 2KN4A 4DU8A 1U6BA 4FF4A 3KJVA 2MKJA 1RU2A 1WI8A 2JFKA 4F4YA 2O66A 1N34F 2R2SA 4DFKA 3IM9A 1SC6A 2AGOA 1IBCB 2OGUA 3R5JB 4LR9A 4ED3A 4DR5J 1IM4A 2ZJPQ 2L9NA 3Q8QB 1Q4RA 2IM3A 4JI0F 3PVXA 4TVAB 1QTNB 1B99A 4IG0A 4J9UE 4DL5A 2AZ1A 1C0TB 3HVTA 1H3DA 1LK7A 4JV5F 2KL8A 2EG1A 4F0KA 1FT8A 3CDWA 1T9VA 4CYUB 5HLFB 2C3OA 1SJ3P 2ERRA 3SMZA 2QGFB 2BABA 4CT8A 1S1TB 1H98A 1MNEA 4IFYB 4M95A 5MLCV 4OHYA 1SB6A 2JEJA 1Y11A 4UZCA 3AXMA 1U2FA 2YBVA 3UQSA 1TKDA 3H98A 1CVJA 2NS1B 3V81A 3MMBB 4HI1A 2WONB 1M1GA 4EZ6A 1SI9A 3K5OA 1HARA 3NEKA 2AJ2A 3ITHA 1FX4A 3T1YJ 2LU2A 3R27A 3MCMA 2MGZB 5A76A 1P9QC 1T05B 4M1KA 2HWTA 1HNZF 4DPYA 3FRYA 2ZD1B 3TZXA 3KOAA 4DSLA 3HZEA 2QIFA 3BREA 4M5DB 2B9WA 1QSYA 4C97A 1KS2A 3N6LA 5LMUJ 4DCOB 2J9DE 1P6TA 1LXJA 1HBNB 2RRAA 5E5NA 1S76D 1O6XA 1KHVA 3DRXA 3GYXB 1LK5A 2DNLA 3K5LA 3QAUA 1W2BR 2UVWA 5EGYA 2BOPA 3CE8A 5ETSA 3IXQA 5KG3A 4ZCMA 4IH7A 3ONQA 3CJTA 1NDPA 1UL3A 2B4VA 2F8HA 1D8ZA 2FB0A 2J8SA 3PHTA 4PG4A 2F3JA 2G1HA 5D4NA 3QT5A 2RU9A 1BWEA 1S4FA 2W9CA 4C11A 2H5EA 3CD0A 3M7VA 2FTRA 3CIZA 3KLIA 1C0UB 3O44A 4LSNB 4KV8A 1U0SA 5KFSA 5KOXA 2ZOGA 2UUWA 3NNAA 9ATCB 3TYTA 1VBKA 2GAHC 3PIPQ 2H5JB 1TMJA 4IRKA 1N6QB 4B9SA 4V19X 2VQEF 2ZBRA 4P6QA 4LF6F 3AD8C 3Q8YA 3BH7B 3UE2A 4KO0B 4DS4A 3GTYX 4UTGA 2UXBF 5EWFA 3RU0A 1KLMA 2LMIA 2MQLA 3GJTB 1D9DA 3QSYB 4I7FB 2IRYA 5HP1B 2ZNYA 5HSPA 5LOQA 2QYCA 3GJQB 4GRSA 5C25A 4PG6A 2RB7A 4LVNP 1VQ4S 4N47A 3RZAA 5IFMA 3R5GA 2LA6A 1QLNA 2I0XA 4ZP6A 2JEGA 2MZSA 1RT3A 4K8RA 3I0SA 4QYZK 2KZZA 1I51B 5D15A 4X65J 1XN9A 1JKHB 5CZVA 4F26A 1S0MA 4LT6A 3AOAA 3NMAA 2DHAA 1L3KA 5BR8F 1EQ0A 1UMJA 1WC4A 2ZBQA 2IC3B 3N5FA 3M9MB 4DCPB 4LIRA 1F1BB 1B0VA 2COLA 2N4DA 1XMBA 4DV5F 2FLOA 2CWKA 2DGVA 3D6HB 4RKUC 3W2WB 5F9NA 2XY5A 4B9NA 3R3TA 2HVDA 3IC1A 3DM2A 2R8GA 2D3ZA 1U49A 3DU6A 2XMAA 3CC2S 4NZ0A 3BH6B 1Y3JA 2V8PA 2C2RA 4OX8A 1RYSA 1IM6A 3IGNA 2Q6CA 4DUZJ 2W7AA 4K2XA 1N88A 1GNKA 2ZH6A 4B3RJ 1RBAA 1IKVA 3E01A 2OHDA 4F04B 2RF2B 4HYKA 1HHQA 3HT0A 1QSSA 1XNQF 1C0TA 1UFWA 1FE4A 2OAUA 1KTQA 4DG1A 2W25A 3PFEA 1VFJA 1AA1B 5HK4A 1RWWB 3IBCB 2RS8A 1C2PA 4CYUA 3FCHA 2Y1IA 4GVBA 3RBDA 3CJ2A 4ZPCA 5A6WA 1VQPS 4OZ1A 2MSTA 3H0PA 1YTYA 2G13A 1TKTB 2CVEA 1S1TA 5EX3A 4PWUA 3E3XA 4GC7A 2P2CB 4AXIA 3KLFA 1WF0A 3J81Y 1S0VA 4J9RA 2VODA 4DV4J 2RQMA 1NK6A 1V3RA 1RHUB 3DLGA 3I4PA 3WHIA 5KFOA 3MPDA 3Q8RB 2WONA 2C2MB 1R8AA 2QJ3A 4ER8A 1SJ1A 4IRDA 1NZ8A 1HD0A 3UN5A 2OPSB 4HH0A 2BM1A 2DRAA 3MTJA 2ZD1A 3PFOA 4MK9A 4ZJLA 4J9OA 5IZHA 1OPZA 3PNIA 3IWNC 4EWTA 3MUMP 2PEBA 3OVAA 1CJTA 1HBNA 2ZNZA 3VR1A 3TAQA 1NB7A 5KFFA 1WUUA 4USHA 3ENQA 5FDLA 3MM8A 4R5PA 2AP6A 4YMEA 2FZCB 3T1AA 4X2BA 4PYDA 1HLWA 1NU4A 4ED2A 2Q79A 4A8MP 3A12A 1WI6A 3SSSA 2LXUA 2CJ9A 4RW9B 4A47A 1TFYA 4G1QB 5C2GA 3GPAA 4ENOA 3AH6A 2QLXA 1C0UA 4HTIA 2KZMA 4C3KA 3TR5A 3KHLA 3MM9B 5AT1B 2JC0A 1O8BA 1SC3B 2ZEJA 3BBBA 2B6AB 4DFJA 4F2RA 5E7OB 3M05A 2BMBA 1BC6A 3M2UB 3W9JA 1MSWD 2XHCA 3QT8A 3P8BB 4I7FA 5ITHA 1W2IA 2HZAA 2CRLA 1PC4A 3G8SA 5LSLA 3FBEA 2G2ZA 3JS9A 4ZLLA 4FNHA 2VA3A 3RW7A 1WORA 1SQFA 4DV7F 3KK1B 3KK2A 3AB2B 5GMKa 2BQUA 1VYAA 1FNOA 4C8NA 4QIEA 2AYMA 3GONA 1Z4UA 4KHPJ 2PD1A 5F8NA 2RILA 1H2VZ 3FDSA 1S97A 2R9LA 3HULA 1TZ0A 3CCZA 2NXNA 3FVYA 2BJ1A 4LF7J 2W1BA 3HP6A 3L09A 4OJ1A 1JKHA 3JSMB 2WOMA 3BSAA 3E51A 2AZ3A 2GJIA 4B3OB 2XYGB 4TLRA 4NASA 2MDAA 3UN3A 3D68A 3FUYA 4TY9A 2AJ0A 4CRJA 3D4JA 1N5SA 1WKLA 1IBKJ 5J2MB 3N6MA 2PT0A 2Y8WA 3LP0A 4F4AA 1HI0P 2OJ3A 4ZOSA 4A8YA 4EUVA 4QBUA 4CM2A 2B4PA 2JVRA 1UWAA 3CDEA 1SH2A 4LF8J 2IM2A 4FS2A 2PFDA 1CS4A 4C8LA 2KH9A 3MECA 1VQYA 3VAMA 2HMIB 2YKQA 1C1BA 4S0MA 4O23A 3DLKB 2RVJA 2B7CB 3R6LB 1XIQA 1N54B 2XMWA 1XMOJ 1S1VB 4X66F 3B82A 4PQUB 2O67A 4HEA9 1D1UA 2BACA 1TKZB 5CHCB 4K4XA 1UAWA 1YI2S 4CLTA 4C2MA 1FDDA 4A8FA 1LW2A 4P75A 3I87A 3VV2B 1PCAA 2X51A 3LO3A 4H4OA 3UCZP 1FDNA 2RNEA 2JLFA 2CPYA 3O1LA 1E6YB 3C14A 2HZVA 3K5NA 4F8RA 1TMMA 2F40A 3PJWA 3MD3A 3EM1A 4UQTA 5BYQA 2F7VA 3CDAA 1AT1B 5FIIA 1UPPA 4V19J 1JNZB 1PYOB 5LXYA 2V8HA 1GXLA 2GX8A 2BZ2A 4F3MA 1XC9A 4L75A 2DB1A 1RKJA 4OLOA 1HA1A 5CXTA 2BV3A 1FD2A 2VFUA 4JV1A 3HM9A 2Z58B 4LRBA 3LQVA 3R97A 1XNRJ 4ANCA 4P2FA 5IC6B 2H4YB 3OR2A 2ZOMA 2J5AA 3ET6A 2CQ0A 1XQIA 1DAXA 4I2PB 5F8IA 2H51B 3P6YC 2CDRB 5B0GA 4AQYJ 2M70A 1RBOB 3BR8A 2ZUGA 1HPZB 2DTJA 5K5MA 3DRSA 3NY0A 1CJUB 2MLXA 1M1HA 3QLHA 2H4WB 1SL0A 3H59A 1HWJA 1RTDA 1JXEA 2DT9A 1HW9A 1KLNA 1Y0HA 2X1GA 4CM0A 3GCWP 3TUPA 1HWUA 4MK8A 5DGBA 3MM9A 4DBQA 1IR1A 3P45B 5LL6d 4K0KF 3C19A 4ILMA 4PABA 2C3MA 1R8CA 2YVSA 3EJMA 4NXMJ 2OELA 3KNGA 4CWBA 1RDRA 3BM7A 3JSRA 4DZ6A 3AHPA 2IBKA 1APSA 3BGRB 5DDPC 5DG8A 3PM9A 3HI9A 1CC8A 2KT3A 3G9CA 1JLAB 1FJEB 2BANB 1SKWA 2B8QA 3FSYA 4XPEA 1WEYA 2N3OA 3R7SB 2BR0A 3AOCA 1IN0A 5D77A 2JX2A 2OPQB 3VHQA 4DJBA 3UDLA 1KOHA 1U2CA 3TUJC 4KRWA 1GXUA 3NGSA 2M9KA 2IM1A 2C2OB 1NH7A 4OYOA 3VAFA 1CLFA 4MAKA 5J2MA 1M5HA 3KLGA 2AV5A 2VZ9A 3EXYA 1EX8A 4ZKAA 2QC3A 4NXNF 4MIWA 4JI7F 4A8XA 4LF5F 4DPXA 1HYSB 1DJ0A 1G7CB 2VFTA 3PYDA 2HMIA 1ZS6A 4ECSA 3RB3A 1QTMA 1Z1ZA 2J0SD 3W62A 1S1VA 3GE9A 2Y1JA 2LEPA 3KHRA 1VQ6S 1GTEA 1SUQA 2IDLA 4NLSA 1O5JA 2NYIA 2V9WA 5CD4H 4RBTA 4RW7B 4JV2A 2NSBA 3VALA 3U02A 4DX8H 1KRPA 2N82B 1EB0A 2XHWA 1TVRB 1HQUB 2Z57B 3RB6A 5U47A 3O3LA 1F3FA 2AGPA 3OT9A 3HX9A 1U0HB 5L1JA 1YZ7A 1RT5A 3Q22A 3M8PB 2CQDA 1NZAA 1YVFA 2V2VA 2CQ4A 4LFCF 3TO8A 4M5MA 5AXNA 2BOAA 4DHVA 2QMUB 4JYAF 2K1RB 4H4MA 3RRKA 2DNZA 2M5YA 2HURA 4WYWA 2E5IA 2DY1A 2VG6A 5GMDA 1MG7A 4NLWA 2JH3A 2UV8G 1U1MA 3SXLA 3QT7A 3OPKA 4YUDA 1Q8BA 3KUGA 2GVDB 5KT6A 1RISA 3F44A 1S1WB 2PGCA 1NKEA 4NI2A 1V3ZA 3C15A 1HQEB 4EYIB 2V8DA 4IDKB 1YRXA 2E1PA 1V3SA 5HJYA 2RDDA 1NBEB 1HPZA 1QUPA 1ZAWA 1I94F 2V6AA 1U1QA 1CJUA 2UUBJ 3U1NA 2YNFA 3PV8A 5EX0A 3UNYA 3ENWA 4OJ3A 1YJNS 4M5LA 2XG8A 2UUCJ 4MTPA 4DF8A 2L48A 1S10A 2DNRA 1D3WA 1B0PA 2MKSA 1RE1B 1RQ0A 3DN9A 3LGMA 2GC8A 3PYFA 2HHSA 4A8OA 3MR5A 5AJ3F 3MCOA 3FEYB 1OS5A 4AXJA 1AZSA 2RUSA 3BO4A 1FK9B 3BGRA 3ISND 5IT0A 4M5NA 2C22A 1LQ9A 3RBEA 1GMVA 3UCGA 3BGOP 3WBZA 2PSZA 4ZP8A 3Q83A 4CLWA 1Y7PA 1VK3A 3KLHB 3P4UB 2BANA 1FA0A 1PSDA 4QW9A 4ATNA 4B08A 5D3GA 3IWXA 2AEMA 2I9SA 2DIUA 2J0WA 4E0DA 5KFIA 3H42A 1WC1A 5KFXA 5HMYA 2J9CA 1YITS 1K73T 3L7OA 5G4DA 2DJWA 2DNNA 4QU6A 3O2IA 3HJFA 4FVCA 3PRVA 4ZPDA 1HKAA 2W24A 4K4UA 1X4GA 4QWEA 1WWHA 2IY5B 1ACMB 2P9GA 3NWRA 4JI8F 1Q86T 3E2EA 4YB5A 2J9EA 2VG5A 4WF9Q 1UWBB 4IOBA 4CO4A 2O3DA 1UVNA 4DL4A 4P52A 2GA7A 3DOLA 4JB8B 4DWIA 3C6TA 1IKXB 2HRYA 2OPPB 3EZ5A 1PYSB 1I5OB 4ERDA 2Y1LB 1T9WA 1SL1A 2AF6A 2ZBCA 4F25A 1WOOA 2FVQA 5F9LA 4WFNQ 1SH3A 3G82A 1RLCL 1Q1KA 1RTZA 4TKTA 5HATA 3S01A 1NNDA 4ZS6A 2B0GA 4M5JA 2H1YA 2XNQA 1JLEA 5HROB 4WFXA 1TVRA 2EK1A 2HBQB 4BDPA 2LQ5A 4NA2A 4YDDB 4CIOA 2W2PP 3M8PA 1TTHB 4YN3B 2DHGA 1O51A 4LF9J 4TYBA 3PO5A 2CPEA 4ETZA 1GH8A 1S6QB 2E66A 2KDOA 1OQ6A 4B3MJ 3M6WA 4CTAA 2WAQD 1EJ7L 5J2PA 2Q43A 4RNNA 3IM8A 2QE5A 1U48A 2CXEA 4WK1A 2F5GA 1N5QA 4I6AA 5F8MA 2J7WA 2GVDA 3MTKA 3R5CA 2MSSA 4JI2F 4PUOB 2UU9F 3V6HA 1I6JA 1HQEA 2KU7A 5E3QA 1T11A 2YH1A 4ELVA 5DQIA 4PKDB 1Y5NB 3EVOA 5DETA 2XI3A 3FMBA 1FVQA 5IV3A 1FI4A 1MWZA 3THVA 1Q8LA 2YNIA 4ILLA 4ED1A 3U1MA 1TV6B 2V4RA 2IYIA 4O4GB 2B4OA 2JNJA 2DNKA 5MAOA 2Y1RI 1SPBP 4X4TA 4OJGA 3QWPA 1FCAA 1Q8KA 2D9PA 2G2OA 2RAQA 3CB4A 2IIHA 1M5VC 3M2VA 1RCXB 2O5DA 1RTHA 2HHQA 3B54A 1I1GA 2E7WA 2B9EA 2APOA 5IWAF 3MF5A 1HI8A 2E44A 3N9UC 4QIFA 4NYZA 3FZBA 3QIPA 2ZC3A 1N5TA 3CCSS 1EHWA 4O3OA 1M0SA 1JXVA 4YHHF 4UUWA 1S9GB 2DHSA 2YWGA 2DXFA 2FD2A 4ZVGA 3T5HA 2J6SA 3NS7B 2EK6A 4KH0B 3QFHA 3GLJA 4G65A 1VQKS 1YBAA 5KG6A 3GV7B 1T9UA 1GT8A 4NLXA 3QBCA 4I6WA 2OPRB 2P6SA 5J1NA 1DTTB 2PC6A 4DUYJ 2Z2MA 2FZKB 4NXMF 1EARA 1HHSA 1RCOB 1TKXA 1WG5A 1F6TA 1BWVA 2HAFA 1JX4A 1WOPA 5IT9U 2R7OA 2I6WA 5E3CA 1H6KX 2Z30B 3MPWA 2RDJA 3I56S 3H5SA 4F4ZA 3CIMA 1S9FA 3JQKA 1VDHA 3EDQB 2FQQB 4X4RA 4MT1A 3BGLA 2HGNA 3JXOA 2GVZB 4F02A 2P9CA 1ICEB 1ZAVA 5KFMA 4RNOA 4FXWA 4EZ9A 2AIRB 5J1EB 3DLEB 1N33F 4OI2A 4ECRA 2V50A 4U7UD 1Y9OA 4G1PA 1RHKB 2HG4A 3PXGa 2AKWB 1HD1A 5JXSA 2XC9A 1SKRA 2EBEA 1T9XA 3WX4A 3BS9A 1WC6A 4MKVA 4ED4A 3NXZA 1RACB 1Z2LA 3G96A 3GQCA 2VUGA 5BYSA 4DF4A 2WSEC 4OV6A 5KFHA 4YQWA 3EVWA 3QT6A 3KLEB 4F2SA 4F0HA 2XLIA 3K89A 5T41A 5B0AA 2GHVC 1X4BA 3ZZPA 3IRXB 1ROFA 1NLKL 2ATCB 4QPTA 2HRUA 3HFKA 3TAMB 3DOKA 1D0EA 1PKUA 3R9LA 2UXCF 2JEFA 1YJ9S 5DJBA 2FY1A 1L5UA 3D6FB 2WVDA 1M90T 1HNWJ 6FD1A 1YDLA 1JJCB 3HDSA 4J9PA 3I5CA 3BSOA 4FS1A 2ZDOA 2GO9A 5GADI 4U7CA 2O01C 3QGPA 4I0WA 2JFDA 4PUOA 1DQAA 2WW8A 4F7VA 4U9RA 3NMRA 3GG0A 2DCUB 2J0XA 1HNVA 2MYFA 3M32A 5HAOA 4C0HA 5ETVA 1REGX 2CG4A 2V8VA 4Y3CA 3OW2R 3WX8A 2FYXA 3GCXP 2EFPA 1NSPA 3OTOF 3JSYA 4O4GA 2MEWA 3CJ5A 4IR9A 1QVFR 1DTQA 3M4XA 4KFBB 4NX9A 5KFNA 1F0XA 2G1DA 3RRHA 1SJFA 3W64A 1A7GE 1PJ6A 2L9WA 5THWA 5T7LB 5KFGA 3MM7B 2AX0A 5EDWA 1N36J 4NLQA 5DDQC 1DARA 1SJ4P 3QJJA 2ROPA 3BV8A 3PYGA 3FZ2A 1OQ3A 4OZNA 1JXLA 4TN2A 1G1XA 2IJFA 4ES1A 5K14B 2VDHA 4F4WA 3UVJA 2JZ5A 3CCVS 1U25A 2CNKB 3AFGA 1S9GA 4ZVQB 1XMQF 2DKOB 3IAS9 2PFFB 4JI6F 5FLXU 3VAIA 2GS8A 5K20B 1FTCA 1NK7A 4N76A 3EGWB 2E1RA 1H2TZ 2MMYA 5DLGA 2D1CA 3C6UA 1WHVA 1EAYC 4RBUA 2RS2A 3A3NB 4KTQA 4DR4J 3VQTA 3GB0A 1FRHA 1KD1T 2FHJA 3OFHA 3M1VB 4K7QA 2QA1A 1UZHA 5DS7A 2GCFA 4IFVA 1VLYA 2GIFA 3IBWA 2YQ1A 5C24A 1ZM3A 4F3OA 4HT5A 1TR0A 2RRBA 4FKXA 2N7CA 1JJ2R 3UR3C 1HBMA 2HIYA 2VPXB 4GKKF 5LM7E 1JLGB 1R31A 3R7BB 4WE1A 3R5DA 4OYPA 3MAAB 1U47A 1MROA 3FJ2A 2YX7A 2HLUA 1CEZA 1ZETA 1UFLA 3HHKA 4OHVA 4RJVA 4ED6A 1SV5B 5KT5A 1X8DA 2A10A 1FKPB 1U8SA 2WTFA 3RTVA 3C2PA 3I5BA 5D0HA 2ZZMA 3W5ZA 3NRBA 3N01A 5IXUA 1UZDA 4CLKA 5ADZA 1JLBA 2C2NA 3J81U 1ZZFA 1CULB 3CMQA 4AUKA 4HLBA 1KVIA 1U7LA 2NR0A 3OSNA 3TAMA 1X5OA 1BQNB 3MR6A 4OYMA 2I5JA 5F0WA 1RT6B 3MXHP 1S5ZA 1QAXA 2V0NA 1ZZNA 3S8SA 2MKHA 2HQGA 3MMAB 3BSNA 2HYIB 1VGYA 2CJYB 1VQ8S 1A9NB 4ES2A 1GK8A 5AE3A 1YWXA 2R2UA 2QZ8A 1UFKA 4DQPA 1RKIA 1DQ9A 3GV5B 4NE9C 3NCQA 2O1PA 3PW5A 2VKRA 1X4CA 3UD4P 4RWWA 3MURP 4F3QA 3W65A 3MZIA 4F4XA 2VV5A 3AJ1A 3LANA 1LWFB 1VIXA 1SH0A 5J1PA 1R43A 2D3UA 3ZTSA 5LJ3Y 1B7FA 1FDBA 5HQ8A 4ZCKA 5F0UA 4C7QA 1T9TA 1G6BA 2D3O1 2VBWA 5L46A 2ILZA 4MH8A 4L6V3 5D0EA 1IBMF 2CQBA 4LFAJ 2IRUA 3BBFA 1YX2A 3BDPA 3AJ2A 2KI2A 5CCMA 5T7LA 4R25A 2HIQA 3QJLA 1HMVB 3GFYA 3LF0A 5H9EJ 3DGPA 2CWXA 2DO4A 3I31A 3EX7B 3IR6B 3W61A 2HNDA 4I2QA 1X5SA 1TUWA 3KJFB 1FHTA 3MEDB 3AA9A 4NCGB 3VF0B 4UY8T 1RP5A 5K14A 3EGVA 5IM0B 1X4AA 3D1HA 1DZ5A 3KNAA 2QO3A 3DFEA 5IC4B 3FSXA 3VGSA 2V5HG 3CJKA 3ZC4A 1ZTTA 3HD1A 4RW8B 1KFSA 3TWZA 4B3TJ 2W9BB 2IBOA 1FRKA 4AFFA 4RZRA 2ZM6J 2IAJB 3D3CJ 1TUGB 3N6NA 1W25A 4ZP7A 3UD5A 5EN1A 3LA0A 1F60B 4JV0A 2BE2A 1HBOB 3Q8VA 3V4IA 4OI3A 2F4VF 1LV5A 5CAAA 3M1VA 1XR5A 2WVFA 3RGIA 1WEZA 2PI4A 1VBYA 4OMFG 4O3SA 1MW7A 5C42A 4ZN3A 1NSQA 3TRGA 2HQDA 1GMWD 1WSRA 4DDFA 1RA6A 1D9AA 3N0VA 2HQ3A 2XWYA 2MKCA 3JYTA 4Y2KA 3P49B 1RT1B 4N5SA 4ID8A 2E9ZA 4OX6A 2EVZA 1JJHA 3DOMB 4ED7A 4C6AA 2HHXA 4K50A 4BCAA 3PRDA 4IOCQ 3WIUA 3Q8SB 3MAAA 3HFZB 1MMNA 1H38A 3I6PA 1U1NA 5A2QY 1P27B 1RAEB 1T95A 1R0AB 2EKYA 4NL5A 3POTB 3H20A 2BM0A 3VAGA 4B3SJ 5GAGI 3IG1B 4WXWA 3GIMA 4KGXB 1FKPA 3HXMA 2AT1B 1BE4A 4Y34A 4NA1A 4LJMA 3TI0A 2V2QA 4NPOA 3T6BA 1SJRA 4P2MA 1D9FA 1N32J 1J5EJ 4HR2A 4CLUA 2NQPA 4IQXA 2EFGA 4LBPA 2R7WA 3WDOA 5CD4A 2WW4A 1NJYA 2OH2A 4CO3A 1NDLA 3PX6A 4U96A 1CQMA 4TNOA 2FLPA 3A8EA 4UF4A 3FFIB 5ETLA 1BQNA 3GYGA 1NK9A 3LUYA 2FJBB 5LMNF 2VDIA 3IN5A 5A8KB 4RU2A 2G0JA 1JLCA 3DLBA 3W2VB 2FC8A 1LWEA 4NEYA 1HNIA 1XTZA 3CJ4A 2Q66A 3IAM9 3FC9A 1ZAXA 1VIOA 3CMAS 1N52B 2LXIA 4KGMA 2BJ7A 4EK2A 3JAMY 2QEXS 1UVJA 4XTTA 3L3CA 3DXSX 1GAOA 3HHLD 3FBBA 1TELA 4X62F 1RTJA 3IP0A 2Z8QA 5DGAA 2MLYA 3QPIA 1R8HA 1ZH5A 4OZ3A 1S6OA 1IKWB 1YZ6A 1KDNA 3ZZTA 2J9DA 4DPUA 4MIAA 2JVOA 5L1KA 2ZZNA 1F3VA 4GKJJ 1ZTWA 5AXKA 3KXDA 2K2PA 2UXDF 3KJVB 4PCQA 2QSWA 2W2NP 5KFRA 3FQLA 4L76A 3TA2A 3MCSA 2AMCB 4UT4A 1VQ7S 3JTPA 4ZLNA 1YBUA 3H2LA 1OO0B 2ASDA 4XDDA 2D41A 1HMVA 2KFZA 3PKMA 1NCLA 4OQJA 4XIUA 7AT1B 3ZO7A 2ZJRQ 5AE1A 1M5SA 4FN5A 2WVCA 2GGPB 3HVTB 2X1FA 3NBPB 4DV2J 3NG8A 3MEGB 3UO0A 3TJ8A 1RAOA 1U6ZA 3QATA 3ZTRA 2HFUA 4EBCA 3ZXWA 3LPYA 2DK2A 1U02A 5M2RA 2XSJA 3GSDA 3G71S 1VRTB 3M8QA 3FBFA 2XS2A 2B51A 3KHHA 3Q23A 4ANEA 2R7RA 4USMA 5KG4A 4E98A 3V81B 1S0NA 4OHXA 1IJEB 3ENAA 1IUJA 4CDIA 1IR2A 2I2YA 1VJWA 2IVMA 1T03B 3DGVA 4KY3A 2ROGA 2X1BA 4IR1A 4DL7A 2SXLA 1HW8A 4DCJB 2GIRA 4LQ3A 2DXDA 4WU3A 1QSLA 2XMTA 3H25A 3OFEA 4IH5A 3CT9A 3M6UA 4Y2AA 4LBHA 2JOQA 3T3FA 2V8GA 1VCTA 2VFRA 4WP9A 3MOJB 2E5GA 4TY8A 4KAIA 3QAEA 4YB7A 2AWZA 3HMJG 3B4DA 3PRBA 4C4WA 4AL5A 4P71A 4WFZA 3SFUA 4YB6A 4Y28C 1FFGB 3LH2S 3CO0P 2HFOA 3CJ8A 3PG9A 3QIDA 5DG7A 2HHUA 4WK3A 3HPOA 2BJ9A 2W2MP 1TP7A 2YNHA 2W9CB
chains in the Genus database with same CATH topology
1XERA 3RB3A 1QTMA 3MEKA 1T05A 2YH0A 1BLUA 4O3NA 1DLOB 1KTVA 1S1XB 5HL7Q 3LWLA 3KLIB 2XI2A 2R4FA 4QR0A 4KV8B 2B9XA 1Z1ZA 1L3SA 2AJ4A 3UD3P 2JJ4D 4ZCIA 1PILA 5L9XA 3FQKA 4QWDA 2UP1A 4Q5VA 5B0DA 4ZPVR 4CQ1A 1S1VA 3GE9A 2NREA 3AAWB 2J0SD 3NNHA 4AQYF 4M5DA 2KRRA 5D4LA 1QY7A 2DH9A 4M94A 3N5BA 2PN6A 1VQMS 2Y1JA 4ECXA 3T1HF 4DV6F 2LEPA 4DR3F 3KHRA 1VQ6S 1GTEA 5GAEI 2BDPA 5F3ZA 5DM7Q 1SUQA 3G8QA 4H54A 4NLSA 2V4QA 4KFBA 1O5JA 2NYIA 5KFKA 2DITA 2V9WA 5CD4H 3G4SS 2HZCA 2HS4A 4RBTA 4RW7B 5AE2A 1VS3A 2J7KA 1C4CA 3EXCX 4HTJA 3X3UA 3HVRA 3VAKA 1KLMB 2NSBA 2YWKA 4ECVA 4JV2A 2MQMA 4DV2F 3C6UB 3VALA 3U02A 4DX8H 4CO2A 1KRPA 3THPA 2FVPA 2XLKA 4LSLB 5C25B 2N82B 1YSJA 1K0VA 2R7SA 2XHWA 4RU9A 1TVRB 3MM7A 5A8KA 1HQUB 2ROEA 5GVQA 3RB6A 4B9TA 3T19A 5U47A 3O3LA 3G6YA 1S1UB 1QAJA 2DR5A 2PEHA 2AGPA 2DIVA 4HT7A 3HX9A 1IQZA 3CSKA 5L1JA 3V5RA 3ZZ0A 1F5CA 4TQRA 1RT5A 5IQ6A 3Q22A 4CH1A 4USIA 5KTQA 1HBUA 2FHMA 1SJQA 3M8PB 1RT3B 4IKAA 3I0SB 4R0JA 3RAMA 1Y3KA 1ZM2A 3PO4A 3PW0A 2CQDA 4I6YA 3CCLS 1NZAA 2XY6A 1YVFA 4IFVB 4OIXA 1WG4A 2CQ4A 4O44B 4LFCF 1QVGR 1FKAF 3BGUA 3TO8A 3SDEA 3NL0A 1NHUA 4CCHA 3CCTA 3G6XA 2DNMA 5C24B 3M9NB 4LSNA 5AXNA 2YKNB 1TL5A 4ELUA 4MKYA 2DVIA 2GW8A 2YTCA 2AGQA 5KFJA 3M9OB 4W90B 1N5YB 4DHVA 3LP2B 4WXOA 1N6QA 4ECYA 5KFBA 2E1CA 4EO6A 1HBMB 2HAIA 3QGGA 1DRZA 4JYAF 5K8PA 2XNRA 2K1RB 4ILRA 3K58A 4H4MA 3D1OA 3RRKA 2DNZA 2M5YA 3IO1A 5KFYA 2NPIA 4KO0A 4WYWA 2RUGA 2E5IA 2IM0A 3EZUA 1WEXA 1HI1A 3CDUA 5KG7A 5KT7A 3PDNA 3JTOA 4GO5X 3IRWP 2VG6A 4WE1B 4QIVA 3Q0AA 4J9LA 3FSIA 2ATLA 3TW0A 1K1SA 3IFEA 2ZE2B 3R5BA 4NLWA 5HP1A 4DQIA 2JH3A 1UKUA 5H9FJ 2UV8G 1U1MA 3SXLA 3J7YU 3T9NA 2J8AA 1MROB 4TQSA 1AFIA 4I1TA 2QA2A 1HNXF 3OTCA 3MPYA 3OPKA 4YUDA 5IT9Y 3DM2B 5B0CA 1Q8BA 4P7VA 2JC1A 5KT6A 5L1LA 2RH3A 3ZZZA 1RISA 4EFAC 4A8WA 3BN7A 3C46A 3F44A 3CWJA 6FDRA 1S1WB 3P96A 2PGCA 1NKEA 3H4BA 3SQGB 1V3ZA 1HQEB 4MFBB 4EYIB 2V8DA 5E2QA 5EWEA 4PG5A 4ZPTR 2E9RX 3ICLA 4IDKB 2JSXA 2K3KA 4ECQA 1YRXA 2PDAA 1V3SA 2KO1A 2J7UA 2JLEA 3T9ZA 1OIAA 4HH1A 2MQQA 4C0OC 2EI5A 1VQSA 4D3HA 2BRKA 1FRXA 2R2TA 1HPZA 4QYRA 3NCRA 1QUPA 1ZAWA 1I94F 4JI5F 2C2EA 1U1QA 1P8GA 3T5LA 5FJ4A 3KTQA 2EG2A 3U1NA 2YNFA 3PV8A 5EX0A 1IKVB 5B0BA 4R8UA 3E01B 5KT3A 2PA3A 1O0PA 3K59A 1RWUA 2YNGA 2FC9A 3ENWA 4A8SA 1Y4ZB 4OJ3A 1YJNS 3IA0A 1JLBB 2GGPA 4KQZA 3HK2A 2XG8A 2HLTA 4MTPA 4DF8A 2YKMA 1FRIA 1UEVA 2DNRA 2FPHX 2CIMA 1FTRA 2L48A 3NBPA 1S10A 2H9ZA 1JJ4A 4K4ZA 1D3WA 2JL9A 3CEDA 1B0PA 3MEGA 4DG1B 1AROP 2IC3A 3V6KA 2BBEA 3ZFVA 2DR9A 2MKSA 2GMHA 4KIAA 4QWAA 1RQ0A 2POKA 3DN9A 3M6VA 4B9UA 1HWLA 3LGMA 2GC8A 1JLGA 4Q0BA 3DRPB 5CYMB 2BA9A 2CPZA 4MIBA 2LECA 2ILYA 2BRLA 2HHSA 1ZPWX 5G0RB 2I5JB 1VOMA 5DDOC 3OL8A 4WJBA 4A8OA 1KVJA 3MR5A 3MGJA 4OI1A 3W2WA 5AJ3F 1PC5A 2VA2A 1L3UA 3OSPA 4MYTA 5KG0A 5L9NA 1VRTA 5KAKA 2YKOA 3PHEA 5IS2A 3FEYB 1KN6A 4YY3F 4DR1F 1OS5A 4AXJA 4O4RA 2WBRA 1R8PA 1JLFA 2CJAA 1T02A 2CZ4A 2EFNA 2DNQA 4NRTA 3KLFB 4A4JA 3BO4A 2QFJA 4WZMA 4TYAA 3C3LA 1ZBTA 2IA0A 1UETA 4M8LA 2ZH1A 2VG7A 1SV5A 1FK9B 4RUAA 2VC1A 3BGRA 3ISND 5IT0A 3DC2A 3UNGC 3QGHA 1BQMB 2GJ2A 1LQ9A 2C22A 1S72S 2CPHA 3RBEA 3DLGB 2HVIA 3UCGA 4JI4F 4D3GA 2CPDA 4C98A 2HGMA 3UPFA 2R7TA 2LQ9A 4NMLA 2E5HA 4EGLA 4KKOA 5CYJA 3WBZA 4K4WA 2PSZA 1TQLA 4ZP8A 3K57A 5KG5A 1TK5A 1Y7PA 4OZJA 2ZHOA 4OHWA 3NS5A 1VK3A 2DGTA 3KLHB 2FVCA 4Y6IA 4OL8A 2BANA 1FA0A 1PSDA 3U7JA 4QW9A 4J9KA 4ATNA 3T5JA 2OIHA 4KC5A 2RF2A 1T03A 4B08A 3CF5Q 3GIJA 5D3GA 3IWXA 2GV1A 2I9SA 2CFXA 2CQPA 4ES3A 2DIUA 4YOEA 2J0WA 4E0DA 3JB9k 3BZQA 5KFIA 1N8RT 1QUVA 2HWIA 2RSQA 2LQBA 4IYQA 2L08A 1FNMA 1VQ5S 3AQPA 2ZITA 2ZBIA 4RUCA 4ID5A 5KFXA 5HMYA 2J9CA 1YITS 1YG0A 3U27A 1RT6A 2MY7A 1S9EB 4KB7A 2FGOA 2W9AA 3GFXA 5M2PA 3HHDA 5KFZA 4J5OA 2HVHA 2FHOB 4PRFA 2UVRA 3GIIA 1K73T 1TKTA 3CD7A 3L7OA 3P5TL 2RRNA 3JSBA 5G4DA 3MMAA 1KQGB 5GAEU 2DJWA 2DNNA 1QAYA 1KQSR 4QU6A 3O2IA 3HJFA 4FVCA 3I96A 4YEAA 3PR4A 2KYXA 1UJ6A 1YJRA 2C2DA 4RW4B 3TX8A 3DLHA 5FDLB 3MM8B 3CCQS 3DDNA 4ZPDA 4R5PB 2UV8A 2OTJS 2LCWA 1MMDA 2W24A 5DQHA 1X5TA 2NSCA 4K4UA 3CJ3A 1X4GA 1EETB 4X4QA 4QWEA 1WWHA 1DBDA 2ZM6F 1FXDA 1LFWA 4DR7F 3V6DB 3RW6A 2JRSA 1S49A 2P9GA 2RKIB 3TUIC 2LDYA 4JI8F 1Q86T 1U6FA 3E2EA 4YB5A 2J9EA 2VG5A 4QWCA 3Q24A 2HHWA 3MM6A 4WF9Q 4DV1F 1UWBB 4ECZA 2ZH2A 3LP1A 4IOBA 4CO4A 2HNDB 3H2VE 2GFFA 1SKSA 3D5MA 4DL2A 4ZK7M 2GIQA 1T8EA 4JI1F 2CVIA 1N48A 4I2QB 4J9MA 4FBTA 2O3DA 2I38A 2JHEA 5DM6Q 4DL4A 1UVNA 2YKPA 2OLWA 2ADBA 2GA7A 4Q2MA 5B7WA 3F41A 3B8HA 2NLWA 3HLUA 2CJKA 1LWFA 1QE1A 2OPSA 4IO9Q 1J5OB 3DOLA 3MFIA 2AJ1A 2E5LF 2FJEB 3AB4B 2UUAF 2RD5C 4DWIA 3C6TA 4ZA1A 1IKXB 2HNYB 4Y00A 1X4HA 2HRYA 3M8SA 2OPPB 2XO7A 3EZ5A 3CDBA 2U1AA 1FO1A 4ERDA 1UEUA 1SL1A 5KFUA 1CC7A