2DXDA

Crystal structure of nucleoside diphosphate kinase in complex with atp analog
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
154
structure length
154
Chain Sequence
SETERTLVIIKPDAVVRGLIGEIISRFEKKGLKIVGMKMIWIDRELAEKHYEEHREKPFFKALIDYITKTPVVVMVLEGRYAVEVVRKMAGATDPKDAAPGTIRGDFGLEVSDAICNVIHASDSKESAEREISLFFKPEELFEYPRAADWFYKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
publication title Crystal structure of nucleoside diphosphate kinase in complex with ATP analog
rcsb
source organism Pyrococcus horikoshii
total genus 49
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2006-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 2dxdA00
1B4SA 1NSPA 3Q83A 3DKDA 3VVUA 3BBCA 1NB2A 2CWKA 1BUXA 1NCLA 1F6TA 4UOGA 1XQIA 3ZTQA 1ZS6A 3FBBA 3BBFA 1MN9A 3EM1A 3FBEA 4KPCA 3B54A 1LWXA 3ZTRA 1S57A 3BH7B 2DY9A 3EJMA 1NDKA 3FBCA 2HVEA 3DDIA 3VVTA 1BHNA 2DYAA 2DXDA 3Q89A 4FKXA 4S0MA 5BXIA 3EE3A 3ZTSA 3FKBA 3ZTOA 3L7UA 3GPAA 3VGSA 1EHWA 3WX8A 2AZ1A 4ANCA 4EK2A 3NGRA 3ELHA 3ZTPA 1NHKL 3Q8UA 1NDPA 4ANEA 2B8PA 3ENAA 3ETMA 1UCNA 1B99A 2HVDA 3FCVA 2NCKL 1LEOA 3VGTA 3BBBA 1BE4A 1U8WA 3JS9A 1NDLA 5CABA 4W98A 1XIQA 1F3FA 4HR2A 4DZ6A 1VYAA 3EVWA 1KDNA 1NDCA 1S59A 3FC9A 2B8QA 2BEFA 2BX6A 2DXFA 4F4AA 3Q8VA 1HLWA 4FKYA 1MN7A 1NUEA 1WKKA 3EMTA 3FCWA 4F36A 3FBFA 3PJ9A 4DUTA 3VGVA 3EVOA 4DI6A 1W7WA 1HIYA 1NLKL 4ANDA 1WKLA 1NSQA 2DXEA 3G2XA 1S5ZA 4UOHA 2VU5A 3MPDA 4O0NA 1K44A 3GP9A 4CP5A 2ZUAA 5IOLA 3EICA 3Q8YA 4C6AA 3PRVA 1JXVA 1HHQA 3VGUA 3NGTA 2AZ3A 4WBFA 3R9LA 2HURA 4UOFA 3Q86A 1NPKA 3B6BA 1PAEX 1WKJA 3NGSA 5CAAA 3BH6B 5C7PA 3NGUA 3EVMA 1PKUA 1NSKL 4ENOA
chains in the Genus database with same CATH superfamily
4RUCA 1FRXA 4JV5J 3AOBA 3PYFA 3GG1A 4IH6A 1VQYA 2L48A 4OLPA 3R2CJ 1FTCA 2EFVA 2IMOA 6FDRA 4OL8A 4DR7F 1V6HA 1U1RA 4C11B 2VFVA 2RDJA 1S9GA 2ZWPA 4J5OA 4PEOA 3V4IA 2VV5A 5KT3A 3I31A 2GX8A 2HEKA 3MR7A 1XNRJ 1NM2A 1GH8A 2F4VJ 1U1QA 3WIUA 4X66F 2UVWA 4PXBA 3IRXB 4NA2A 1PBUA 2JC1A 1UVLA 5D6GA 1WEYA 1QUVA 4L6V3 4F2RA 7FD1A 1OY9A 2HFUA 2ACYA 2HYIB 4DFMA 3VAJA 2N4CA 3RB4A 5D0HA 2K1RA 2QZ8A 2QN6B 4ZS6A 5LMUF 3M32B 2DR5A 2FJVA 2OUGA 3FCHA 1F3VA 1C4AA 1H74A 2W9BB 1TELA 3NGUA 4ZPTR 1WG4A 1BMQB 4OHWA 2PIIA 2DCLA 3B4DA 2GQ2A 2DHAA 3VZHA 3BGUA 2R9LA 4DMZA 2ILYA 1HBOA 2DYAA 4JI7F 4M5KA 4CNYA 2VIHA 1N48A 1M5VC 4U6PA 3BSNA 2FY8A 3A3OB 3E51A 1KHWA 2KXHA 4USJC 2JC0A 3TQEA 2MYFA 1GMWA 2L41A 2NREA 3MMJA 1KQFB 2OPPA 2CQ3A 1UFWA 3PV8A 5KFEA 3Q22A 4Y34A 3J7A1 2HVHA 3OBIA 1FI4A 4USWA 4D3HA 2POKA 1VQSA 3OL7A 4ECSA 4DU8A 4ETXA 1Y5LB 1UVJA 1N5YA 1APSA 5D4NA 2BW7A 3AA9A 3CCWA 1ZYQA 4GKJJ 1M5PC 4YB1P 3KLEA 3IA0A 3MECA 3G8TA 1KVIA 1FJEB 3PEHA 2XHWA 1Q0NA 3ENQA 2QMWA 2ZBRA 2HAIA 1KLMB 1ICEB 2KM8B 4ECUA 3KLHA 2CNLB 1SV5A 5I4MA 3KG0A 1K8AT 3DRYA 1VIOA 4B3RF 2KXFA 3DLGB 4TYAA 1UCNA 3D0HE 4Y2AA 3FCVA 2Y9HA 2VDHA 1B3TA 2GIQA 4V19J 4O4GB 1S59A 2V68A 2BX6A 5C25A 3QO9A 4DLEA 2KJWA 1C1CB 2ZBCA 4C8KA 4WZMA 5EX3A 3E8OA 3D1HA 1RTIA 5EWGA 1VQ8S 1C1BB 4X4NA 1C0TB 3N5BA 3OL8A 3BSOA 3PRVA 1C2PA 1R3NA 3QPIA 3H25A 3ZZPA 1IBMJ 1SCJB 5IS2A 2GIRA 3CJKA 2DNHA 4J9LA 1RT7B 4ID5B 1T9VA 1DJ0A 2XMWA 2XMVA 4TY9A 2KG1A 3NL0A 3R7SB 1M5OC 5K8MA 2HG4A 2HRYA 2LFVA 2CQPA 4FS2A 4CM0A 4LF6J 2ATLA 4IOAQ 1RLCL 1LWXA 3O2IA 2N4DA 4KV8B 2ASDA 2E5HA 2QSFA 1REVA 2XYGB 3KHHA 1RAJA 2UUAF 1TL1B 3GPAA 5H9FK 4ZPBA 2J9CA 1NDPA 2EVZA 1T3NA 1VRTA 4UQTA 1H2TZ 3FQLA 2AF6A 4N76A 5DGBA 1F9FA 1KP6A 2QO3A 3ZFVA 1JJHA 4OZ0A 5HVFA 2JJ4D 2ZBIA 2DGQA 4LF2A 2AU0A 3CCZA 3RYLA 2V9WA 3POTA 2V94A 2VJUA 1LK5A 4PXCA 3CDBA 4ERDA 4Q0BB 2IA6A 2H3EB 1UA0A 3WC2A 2W9CB 2C2ZB 1LXJA 1NMEB 1OPIA 1QE1B 3SYZA 1OSCA 5HLFA 1ZOTA 5CAAA 3FNNA 4BBYA 2OPRA 4EI2A 4OV1A 2HKEA 4YB5A 4O0IA 4JI8F 1OY8A 5T41A 2Q6BA 2OSRA 1N88A 1RAHB 2DGSA 3MPWA 5DDPC 4QIWD 2FHJD 2E66A 4AL7A 2LEPA 4ILLA 1Q8KA 4F50A 3GFZA 4RPFA 1CJKA 4UW2A 1AROP 3VQTA 1C4CA 4HEA9 4QPXA 5ETQA 2VBYA 1NK9A 1IXKA 1AZSB 3W1YC 2DNMA 3ZNJ1 5DDQC 1U0HB 1P8GA 4N8OA 5IWAF 4KR0B 4OHVA 1HQUB 1NK6A 3QT5A 2IM1A 1T9TA 2OAUA 4TQSA 3LP1B 4X66J 2IIHA 1H2UX 3J80Y 1Q7YT 4ILMA 2H1YA 4IG3A 1ZA1B 3L7OA 3PTWA 1OS5A 2RDIA 2JEIA 3IG1B 3QIPA 4NX9A 1URNA 1W25A 1YBTA 3D3CJ 3NNHA 3TP2A 2WBRA 1TKXA 1R0CB 1SC4B 4RNHA 3CCVS 1NO8A 4ZPAA 1N6QA 1NPPA 1RTJB 4DS5A 3UD5A 1MWZA 1SH0A 3G6ES 1S49A 4I0WA 2K06A 1D9AA 1SJ1A 4RWWA 3HSDA 1RT4A 4PXEA 2BJ7A 4A48A 2IAJA 3M9MB 1E6VA 2XI3A 3RBDA 1D1UA 1R8AA 1NHKL 4NLXA 2QGFB 4A8FA 2XO6A 1MU2B 3FSYA 5KG5A 4XPEA 1CPZA 3LGHA 3QT6A 4L74A 3QRRA 3F41A 2V67A 4ZCIA 2R7OA 3SQGB 5GADI 3EDRB 3UD3P 3CSKA 2YH1A 1FWLA 2I1RA 2QRRA 4G1QB 4OI1A 4CLKA 3K2YA 4IG0B 4J9QA 2Z2MA 1PYTA 3P6YC 1YRTA 4P75A 4DPOA 1N33J 1X4GA 1YZ6A 3TZZA 3Q0AA 4WKRA 3GCWP 4ID8A 1WC6A 1Y9OA 3W62A 1X9SA 2YWEA 2GHPA 5DLFA 4PPDA 2J8SA 2X3GA 4CLSA 2GV1A 3KJQB 2NZCA 2MDAA 3VHQA 1SL2A 3H2UB 2UV8A 2BQ3A 4XPCA 4JP8A 3HO1A 4PG5A 1U1NA 4IR1A 4PUOA 3VR1A 2IJNA 4DQIA 2DR7A 5T7LA 1QAYA 5KG6A 2IRYA 1A6LA 4X4PA 2RHQB 2M8HA 5D77A 3MMBA 2A0FB 4MK8A 1IJFB 2VH7A 3FFIB 2M52A 2DK2A 2NCKL 2ALYB 5HMXA 3MFHA 3BBBA 3KLIB 1SUQA 5FDLB 2OEMA 2UVRA 4QYZJ 4LSZB 2EFPA 1P27B 5JXSA 1HPZA 3Q8SB 4RNNA 3U1MA 3EMTA 1P9QC 2YQ0A 5B0GA 1N36J 4DL0C 4CCHA 3Q2TC 2IHR1 3UD4P 1TL4A 3ENWA 3EGNA 5KT5A 1DRZA 2MEWA 2V4RA 1IWGA 3CD7A 4DR2J 4OZNA 1HHQA 2LQJA 5G0RA 1NJXA 1VRQC 1N5QA 4YN3B 2VFTA 1S9EB 4QCLA 3TA1A 3IS9A 4WYLA 2J0SD 1S1VA 4LQ9A 2R8GA 1WF0A 5L1IA 3ZZRA 3FBBA 1QD1A 3K8VA 2BE2A 1T02A 1T9YA 1JLAB 3GV5B 4PWDB 1TK8A 2DRAA 1VS3A 1NEEA 2VBXA 5CA5A 2G9OA 3OR1A 4Q45A 3VAHA 4OHXA 3OTCA 2HIQA 4FVMA 5ETRA 2B8QA 4KE5A 5JJBA 2EKNA 4FDFA 2OEJA 2BM0A 3M2UB 5J1NA 4ICLA 2RRNA 2HHTA 5D4LA 4DV6J 1S1UB 3CCTA 2BJ8A 4FXWA 1RWMB 5HJXA 3OFEA 2ZBPA 3K57A 3D6FB 2R7TA 2YKNB 3H98A 2LKZA 2LDIA 3OXFA 2KM8C 4BC7A 2YNFA 2DITA 3D6TB 3TR5A 1UP1A 4JI8J 3I9ZA 2CYYA 1ZPWX 3BR9A 1T05A 3G82B 1IBLF 3M30A 3MR6A 1JJ2R 4PWUA 3PW7A 4E0DA 4ZHRA 3E01A 3SFGA 3QAUA 2V8VA 2YKAA 3BSAA 2RQCA 2HVEA 3TAMB 2W25A 3KJVB 3N6MA 1TAUA 1X8DA 1EHWA 3DI6A 1ITPA 2ZM6J 2HQGA 4OYPA 3CC7S 1E6YB 3U1LA 5HSPA 4R8UB 1T03B 4KGVB 2JOQA 5K8PA 3QYYA 3QGPA 3KOAA 3FZ2A 1NH7A 3RBEA 4B3TF 3DOKB 3C6UB 4NEZA 1IVZA 4TNOA 5F0WA 1U02A 3HXMA 2JH3A 1VJQA 5CYMB 5ETNA 4AT1B 4RNOA 2MGZB 4NLRA 3T5HA 3TEHB 3PW4A 3TZWA 4HH1A 4R25A 1RTHA 1NHVA 2HQ3A 1Y5NB 5KFKA 1KRPA 5CYQA 1MG7A 2DCUB 4ES2A 1QAXA 4YY3J 2YNHA 3KNGA 3KG1A 3GQCA 5I42B 2GGPB 2VODA 3J7AN 3NCPA 2XWYA 1FA0A 3CO9A 1A9NB 1XBWA 4PRFA 5HL7Q 3QJPA 4IRCA 3LP0A 3H59A 3LGMA 2X1FA 2F8HA 2MHNA 5CXTA 3W5XA 4LF9J 5BXIA 1B64A 4PKDB 2DH7A 1MROB 5HVGA 4RWXA 4XAKA 4RUHA 1YX2A 3OXLA 3OUYB 1LWEB 5ETPA 3QT7A 1T95A 2IYIA 5C24A 3DRXA 1WG1A 1Q8IA 1HNVA 2A10A 1TQLA 1RXOB 1VBYA 2CQ4A 1HW9A 5MLCV 2HHPA 5M2UA 2MZQA 1HWUA 1X0FA 4R5PB 2XS5A 3SCJE 4IQMA 2FIUA 3SSSA 2HWTA 1QSSA 1TAQA 2JHEA 5DO2A 3O1LA 2GFFA 3M1VA 2AEFA 1GTHA 2PMWA 2P5VA 3CCRS 2XZWA 1XMQF 1KHVA 3BEGB 4P6QA 1FJGJ 2KDOA 3HVWA 4AQYF 3TI0A 2DH9A 4UZCA 4HT5A 1PC4A 1QY7A 2W4DA 5K9FA 2XTJP 1YGYA 2C3PA 1GK8A 4H4MA 4M5DB 4WE1B 2HGLA 1DQ9A 3I87A 4DV2F 4DR5J 1VQLS 4F2SA 3H4BA 4ZJQA 3J7ZT 1HLWA 1D0EA 1EETB 3EVOA 1S6QB 5F3TA 1ULRA 1KONA 1X9WA 1BWVA 1RAIB 4LRDA 5KFLA 2V34A 2EEYA 4N7TA 2R2UA 1VBZA 4HT7A 2QT7A 4WFZA 2B6AB 1RT6A 4M63A 1UWAA 1KWMA 3OPKA 2D1CA 4RO0A 1JLGA 3KKFA 1G1XA 1FRHA 2W7PA 4MKBA 4P2SA 2J5AA 4BS2A 1R0AB 2C3MA 4I56A 4L3KA 2DVIA 1EZZB 1RKJA 3TO8A 3O3LA 3TVKA 1REGX 5KG1A 3H5XA 1XK8A 1N8RT 1LFWA 3J7YU 3T41A 3OTOJ 3ELHA 2OELA 3RAXA 4I1TA 2FVRA 2G1HA 4DL7A 5KFOA 1YHQS 3QFWA 3KK3A 1O8BA 4X4QA 3AJDA 4X65F 3QQCD 3Q8RB 3NS7B 2W24A 3I96A 1F5AA 4B3OB 4ES3A 1U49A 1JB0C 1WORA 2WTFA 1R8PA 1IUJA 5C5JA 1HNWJ 3FBFA 5F0UA 2ZKTA 2KT3A 2CJBA 2NZ4A 3W3SA 2QL9B 3R1LA 3A12A 3NRBA 1SC3B 4UT4A 5IOLA 2PMZD 2MMYA 2WOMA 2EPIA 3DOMA 4DOZA 1QSYA 5G4DA 2NPIA 4P2FA 4CT9A 3H40A 3V4IB 4GO5X 3VF0B 1AUSL 3EGZA 3C66A 2UVUA 2FVSA 2LQ8A 2F5GA 1Q8BA 1AW0A 2JEGA 2WSCC 1ACMB 1CJVA 1Z2ZA 3UVJA 2V8PA 4TU8A 1MMDA 4IFYA 1UFKA 1M0SA 4N47A 4UF4A 3OSPA 2AJFE 2RB7A 4MK7A 2FJWA 3I6PA 4NI2A 2J0XA 3JAMU 3W2VA 2G0JA 2QA1A 3CJQA 5HROA 2IDEA 2A6MA 2R8HA 4CO3A 5KT4A 2K1RB 3CCLS 3AOAA 1OWXA 4OZ3A 2ZOMA 2FUG9 4ZLNA 1YG0A 2DNNA 5IQ6A 3SSRA 1R31A 3RBZA 4OIXA 1NSQA 3TYTA 3TUIC 4QIEA 2VDIA 4L75A 2AJ1A 1FESA 4CP5A 3V6HA 2E7XA 1HBOB 4W92B 3EXCX 4FNHA 3PRDA 3R9LA 3NXZA 1I1GA 1NK8A 1NBEB 4B17A 1S6UA 3BO3A 2M7SA 1Z1ZA 3BDEA 1EKRA 1RU2A 3CVKA 1LWCA 2GAGC 2AKWB 1PAUB 3M8PA 3S01A 2HQFA 3EJMA 3IAM9 3OTBA 5C2GA 1TV6A 1J5EF 1S76D 2GVZA 3CJ8A 4OJGA 3TNVA 2HZAA 1PGZA 2KN4A 4CI0B 1L3VA 1DLOA 1AB8A 3GR1A 1VGYA 2Z2ZA 4GKKF 4CYUA 2XNRA 2CNKB 4H54A 1N5YB 1S7IA 2V69A 3MR5A 2R7RA 2YBVA 1WC1A 3I5AA 2B51A 4MKAA 1AFIA 2G2OA 3MECB 3FDSA 3UCGA 2J8AA 3RB3A 1CLFA 3GIIA 1SV5B 2WW4A 3PYEA 2B9EA 1B7FA 3PYDA 2L9WA 1D9FA 3GCXP 2W2OP 1QVFR 4A8SA 1HBUA 1F5CA 3D6MB 3KHLA 3EPIA 4JI6F 4C98A 3QAEA 2MQPA 1UEKA 5C25B 3OLBA 2UXBF 3QO9B 4KGMA 4A8MP 2RUGA 4F4YA 4NASA 4LR8A 1GMVA 4DS4A 1RTIB 4ED0A 3KHRA 1FVQA 2MKSA 3R7NB 3CTRA 4DV2J 1UTAA 2XMUA 2ZITA 4CO1A 2HHSA 3G6VA 3CJ5A 2E7WA 3PW5A 3CJKB 4AL5A 1N56A 3A13A 5FLXU 2IA0A 2OLWA 4DQRA 2M5YA 3NOCA 3Q8PB 2J9DA 2LA6A 1IBKJ 2DNYA 1IBCB 1ZM3A 3EGVA 1HARA 2AJQA 2IRUA 4P9SA 3NGTA 3DLKA 1AFJA 4WBFA 4CM2A 2VBZA 4QIVA 1LW2A 1VRTB 1WDDA 3KLVA 2VFRA 3AQOA 4QU6A 5KFVA 2OTLS 1D8ZA 3BF4A 1JLBA 1RYRA 1HNIA 2FHKA 2FLLA 5ETVA 3VGSA 4OYAA 5A8RA 3HJVA 1FNMA 1S1XA 1FXRA 2MZRA 4X65J 5KG7A 1DZ5A 4LF7F 4WWSA 3RR8A 1WSVA 4WF9Q 2EG1A 2CJQA 2OPRB 5KOWA 3C6TA 4DN0A 1IR1A 4O3QA 4KFBB 2R2SA 2JEFA 4PG6A 1PBAA 2APOA 2LVWA 1VI7A 1CJKB 1XMBA 4LIWA 1YIJS 1FERA 3ENVA 4TU7A 2DRDA 3LAKA 2MSTA 4RL1A 2ZH9A 2MJUA 3UFCX 4K5RA 3W63A 3LAMA 3MM5A 4WJBA 1O5JA 2V8GA 3X3UA 2HZVA 1Q95G 1XQIA 2XMTA 3ZTQA 4U9RA 3WHIA 1X31C 3IBCB 1JLFA 4F8RA 2B4PA 2BKOA 5H9FJ 3M8ZA 1OSDA 4TU9A 2PEHA 2WONB 5IFMA 5L8RC 4GC6A 3N4WA 2D7SA 4IG3B 5L39A 2CZ4A 4K4WA 4F3MA 1XTZA 3AAWB 1HMVA 4OZ1A 5KFMA 3OHBA 3QIPB 3M8QB 3D28A 5D15A 3QSIA 3EDQB 4GVBA 1TKXB 3KFWX 2HIYA 3T1HF 1N6QB 1RP5A 4DX5A 3BQ2A 2FYXA 1ZAVA 3MPDA 3PKYA 3ISNC 1RT4B 2VICA 5CH7B 2KVIA 4ED5A 2IAJB 1E6VB 2Q79A 4KRWA 3B82A 2F9JA 4DCOB 3EVMA 2RAQA 4KBIA 4FYWB 2F9DA 2CPHA 2X7IA 4HDHA 1XN9A 3GTYX 1PIEA 2XLJA 1NDKA 1TU0B 2A2DA 2CPZA 4ZPWR 3N28A 3JAMY 1FJCA 2R7QA 4X4SA 2H48B 1HWIA 1HR0J 1VIXA 1GMUA 1UJ6A 4ZP8A 2AHOB 3ETOA 1FKOA 3AA8A 2KKHA 2DPJA 1F5BA 2BW2A 1RAOA 2ZZNA 1RAEB 2MJNA 4LFCF 2CQ2A 1XR6A 3NWGA 2WBMA 1SKRA 3UR3C 5DG9A 1D09B 3BDPA 1GQEA 1TUWA 2L08A 5KG4A 2B9XA 2EFQA 1FT8A 1MNEA 3CNQP 2NR0A 4K0KF 4PUOB 5T7LB 2LXUA 1LNQA 1WKJA 4GC7A 3MMBB 5KFCA 4EMDA 2QA2A 1NSKL 1GXUA 1HNXF 2YQ3A 4JI6J 1SPBP 3H2VE 1SUQB 5M2RA 2N7YA 2OI2A 1UPMB 3DU6A 3I4PA 3IO1A 1HPZB 2EFOA 3MCOA 1TKTA 2WSEC 4DPTA 4M5GA 4QWAA 3H5YA 1LWFA 2LXIA 4JI3F 4U7UD 3PHEA 1FRLA 2ABYA 2DRBA 2EG2A 1PSDA 4LF5F 5G0RB 4QR0A 1BQNA 2CAJA 3TZYA 1Q78A 2YTCA 1MN7A 1NUEA 4WU2A 1QTMA 3PFEA 4YR2A 3FUYA 5LOQA 4DQSA 3D1OA 3RBXA 3H2LA 4X64J 2BE2B 1WG5A 2CKWA 4RUAA 2MQQA 3IWLA 2PN6A 4OX6A 2XLKA 2ZJQQ 1NPKA 3FSXA 3BO2A 3WQPA 3PX4A 3OR1B 1RAFB 1WD6A 4JI2J 4ZVRB 4C0OC 4U7CA 2NSCA 4ECVA 3RAQA 2VA3A 3PIPQ 4DR3J 1U47A 3HK2A 4F26A 3DLJA 4URSA 4DDFA 4HTIA 2HFSA 3O8WA 4AL6A 4RW7A 1BHNA 4ICLB 2OFGX 4ECXA 3Q89A 4NCBA 1VQ5S 3D0GE 4EK2A 3C15A 3T3FA 4MKYA 3OXGA 2VG6A 5FLXY 2V2ZA 1AZSA 2IY5B 3PFOA 2JNJA 2JVRA 4NMLA 5LSOA 4ELVA 5J2NA 2WVFA 2HFOA 2Y1IA 4P10A 4YB6A 1GXLA 3SFUA 2GA7A 3I9V9 4UOCA 1FFGB 2R2RA 1T05B 2ZD1A 3HFVA 3M30B 3VAGA 4M5IA 3U27A 4ZHRB 3E01B 2CPIA 4ED6A 4IH5A 4I2PA 2CQBA 2DKOB 3HKWA 1UPPA 3KDOA 2MKJA 1BQMB 4UOFA 3GV8B 3DI6B 3MTKA 4LFBJ 1ZETA 1G4CA 1Y3KA 1KLNA 2XI2A 2DIVA 2DY1A 1S1TA 4LREA 5A76A 2E1CA 5AXLA 1YDLA 1G6BA 2HFZA 4HACA 1RT2A 4KPCA 3CMAS 1OQ6A 2KG0A 3UQSA 4KT0C 3JXOA 3GB0A 2ZEJA 2DXDA 5DETA 3HHDA 2EC2A 5AXKA 1T9WA 1F9EB 1BGXT 2QL5B 1WC5A 1SKSA 1H98A 3MF5A 2WVEA 1DARA 2CFXA 4RW9B 2EFGA 1RTHB 2K8GA 4LF8F 1MU2A 1VYAA 5CYQB 4IO1A 2ZJPQ 3UCZP 1CS4A 2IMWP 2YNHB 3MXHP 2LEAA 2XWXA 4YR3A 3EX7B 4X4OA 2HQIA 3H8YA 5E3PA 4YQWA 4JI0J 2VF3A 1NJZA 2CRLA 4USKA 3J81U 3SDEA 3GP9A 3H4DA 3LP0B 3MPVA 2WAQD 4ED7A 2LEBA 1DTQB 4DCPB 4QYRA 4OFZA 2J7KA 3CEDA 1WI6A 4NCGA 2FHMA 3DHXA 4H4OA 3W9JA 1ZA2B 1Y5IB 2ZNZA 1EP4A 2XULA 1X4DA 1UETA 2L9NA 2BACA 4ILRA 2UP1A 2CDQA 2BZ2A 4A8OA 4KKOA 2BJDA 3OT9A 2RU9A 5C24B 2BMBA 1HNVB 2WSFC 1YJRA 1XC9A 2D9PA 1I94F 3EE3A 3P49B 3OD2A 3LO3A 4F0HA 4OZ2A 5L1JA 3SCKE 2B3TB 5AXMA 1Y7PA 3HPOA 3UN3A 4HR2A 1G3OA 5C2CA 3EYZA 4CLPA 3BQ0A 4LFCJ 4EU0A 2CWXA 4UY85 3M1VB 4KH1B 2GJ2A 2V2QA 2LQBA 2QJ3A 4Q44A 1EJ7L 2KVQE 4K0KJ 4BLGA 3N5FA 1Y3JA 4LRFA 2NS1B 4ZVHA 2O67A 5KOXA 2Y0SD 5AXNA 3DHWC 3M6VA 2PO4A 4ZDNA 4OX7A 1HNXJ 1UVNA 1B4SA 1W2BR 2E1PA 5DDRC 3OSNA 4HHJA 1H7XA 1X4EA 2QLXA 2KL8A 1S7HA 4USVA 1JLCB 3R97A 1LFPA 1RT1A 4OX9F 4BWMA 4JI5F 4IUFA 4KGKA 4N5SA 3G8SA 2HHWA 3UPFA 4QWDA 5DZ7A 5HANA 2HVDA 1GAOA 1ZH5A 1RBOB 1P9YA 1JLGB 4NPOA 5DQHA 5GMKa 2DXFA 1X7VA 3NG8A 3CT9A 1HQ2A 4CLYA 3AFGA 1RWKB 1XJWB 1SJ4P 3D67A 1RA6A 3PM9A 2NXCA 1FRJA 1EQMA 1T0TV 5LT5A 3Q8YA 2V4JB 1SKUB 2DHHA 2MKKA 3EZOA 4F3QA 3M9OB 3KK2B 2ZUGA 2H5EA 4ZN1A 3H20A 1FXLA 4FBUA 1U24A 1N34J 1CEZA 3KK3B 4NYZA 3GR0A 5A8WA 2C2OB 3MZIA 2KYZA 2NYIA 2R7XA 4UY8T 1X5PA 1XNRF 1UZDA 5EUHA 2F4VF 4ZVSB 4WP9A 4B3SJ 3JTOA 5J2MA 2R7VA 4FZVA 2CZVC 2XS2A 3KJVA 3G6YA 1V3ZA 2Z57B 3S7RA 2CG4A 3DOMB 2F63A 5KFGA 1TK5A 3AH6A 5IT0A 1KR4A 1KOOA 2DGUA 4NRUA 3TARA 1CJVB 2QX0A 1VK8A 1URRA 4MYTA 3UVJB 4JYAJ 4QQBA 4IFYB 4K4XA 4QBUA 2HMIA 4GVLA 3ZZYA 3SBMA 1L3TA 2J9EA 2NXJA 4A8YA 3W2VB 5HROB 3CXCR 2PSZA 1UL3A 3V4MA 2GGPA 3GYXB 1N32J 1SC1B 3L4BC 1RHUB 1W2IA 3A1YG 1NJYA 1LOUA 2GQQA 4IQXA 3LTOA 2W7AA 5J1PA 2FDNA 2ZH8A 1RISA 2J6TA 2B9YA 2V63A 4LF8J 2QLFB 4DR6F 4DX8H 2OSQA 1D8YA 2AW0A 3JQKA 3HP6A 1NZAA 5LSLA 1Y4ZB 1JLEB 4YEAA 3GMGA 1HIYA 4I6WA 3UDCA 3H0PA 3C2PA 1LWCB 4NCAA 2VU5A 3M8PB 2OPQB 3MM7A 4USUA 4GKJF 1TV6B 1X5SA 1K0VA 2XYHB 4PR6A 5M2PA 4DUYJ 3JYTA 2LQ9A 2D3O1 1HNZJ 4G6VB 3BJYA 3DGVA 4R5PA 1DLOB 4A8WA 4ENOA 2YX1A 4CLWA 2GIFA 5E3CA 2PD1A 3B4MA 5I3PA 3R3TA 4UOGA 1T94A 1YRUA 4CYUB 4F7VA 1OY6A 2VPZB 3B54A 2XNQA 3EZ5A 3CCQS 4DPWA 2EFNA 5KFJA 1I94J 3JTNA 4OZJA 5U47A 4WFXA 4ANCA 2P6TA 2I6WA 1L3KA 2BJ1A 4QWBA 3ENAA 4IH7A 4OZLA 2YWGA 2AMCB 3CCUS 2RUSA 1U8WA 2YKOA 3FGVA 2BEFA 4CH0S 3GFYA 5H9EK 1HBUB 5BYQA 3J81Y 3UE2A 1R0BG 3UN2A 2I0XA 3G71S 1XMOF 1IBMF 2F3JA 3LANA 4HHHA 4DV3J 4N41A 2JEJA 3DM2A 2B43A 1FRIA 2DEIA 2EI5A 3EZUA 1SVDA 4JOUA 4LF6F 4C48A 2CPYA 1Q16B 3NNAA 2B6AA 2AGPA 4DV5F 1WI8A 3Q24A 3OV7A 1GX6A 1M1GA 4K8RA 1RTZA 5F8MA 2MQNA 4HI2A 5AJ3J 5KG2A 3FBEA 3V6DB 2E7VA 1AT1B 2P9CA 2CQCA 2JFKA 3GIJA 1RAAB 2DY9A 2GVDA 4FBTA 4ECRA 4B02A 2D9OA 1JNZB 1AUDA 2KZZA 1A7GE 1Q7LB 4A8KA 2AZ1A 2O01C 1SB6A 3CDWA 2ZH2A 1TL5A 3LUYA 4Y3CA 4DF4A 3DLKB 4Q7AA 2J7WA 1XIQA 2QA4G 4OV6A 2ZDOA 5HAOA 4RW8A 4DR1J 5K20B 1LW2B 2C2EA 1WKKA 1RWUA 4NLWA 4ETZA 1HWLA 4Z37A 3BPDA 4L73A 3HHLA 1FK9A 1SH3A 4MIAA 1WUUA 2CIMA 1JLBB 5A0YA 3KXDA 1HNIB 2YKQA 1EAYC 1QLNA 3RG6A 2OD6A 1RHMB 5B0DA 2RVJA 5A8RB 3N6LA 1S1XB 2IVMA 4ZLPA 1ZS6A 2OMLA 3ZXWA 2MB0B 4HTJA 1YZ7A 4AFFA 2HBRB 4WK1A 2GZOA 3TUPA 1WJ9A 3C6TB 2F1FA 4O3NA 2KB2A 2M70A 1S9FA 5IXUA 5I3QA 3MUMP 3A3NB 2KTQA 5DZ6A 3BGRA 4I7FA 2CADA 1EIYB 4CH1A 2XGPA 4PG8A 3OTEA 5EGYA 4J9NA 4NLTA 1VDHA 3MM5B 2AJ2A 2ZDPA 4C8LA 1WHXA 1VQ7S 3MHYA 1T9XA 1TUVA 2JLFA 2HS0A 2PI5A 1JLFB 4M95A 2NYHA 4M94A 2HHQA 2E5LJ 1QJHA 1S4FA 5E3AA 3KHGA 4DSIA 1QDUB 1MWYA 1RADB 2LCWA 4Y00A 3DLEA 2W2QP 1HMVB 3WBZA 3K58A 1SI9A 1SJFA 4IDKA 1U48A 2MLZA 1BQXA 4GVBB 3AD7C 3F0NA 1DURA 4G3IA 1H2VZ 4OYOA 1GTEA 3DXSX 4HH0A 4MYUA 3HHKA 5KFZA 3DRRA 4HI1A 2X3DA 3ULHA 4N8NA 4A4JA 3X1LB 4DR6J 2IBOA 2XC9A 4QOTA 3HD1A 3KUGA 2BM1A 3NP5A 2VHGA 4FXVA 2VONA 4DV0J 1G2EA 1N33F 3RAMA 1FRMA 2H5IB 2CVIA 5EX0A 4FN5A 1U26A 3G8QA 4DV1J 4LBPA 2HHUA 4F25A 2Y0BB 2C3UA 2ROGA 2RQ4A 4J9PA 4KYZA 4NXMJ 3HVAA 4UTGA 2AD9A 1Q81T 3DNCA 4FYXB 5B0AA 4LUBA 1F9HA 1MLAA 2E9RX 4NYPA 4A47A 3OFGA 2C3YA 4WXOA 3GU0A 3OFHA 4X2BA 4P71A 2PFFB 3IGNA 3BBCA 5L1LA 1FKOB 3DYAA 2ERRA 3KMQA 4ZLJA 2LQ5A 5BR8F 2C3OA 3GIKA 3BS9A 4LF4J 2KU7A 4S0MA 1B7YB 3M7VA 1FX4A 1J2VA 3ZC4A 1WF2A 3F44A 1WACA 2B8PA 1S10A 1N36F 1TL3A 2YKMA 4XK8C 1RGVA 3GJQB 2HSEB 3G87A 5CHCB 1BE4A 3P96A 1QUPA 1SH2A 1KSPA 1BWEA 2UUTA 2HRUA 3GJTB 4ECZA 2I2YA 1UAWA 3QMQA 1H6KX 4NLOA 4DR2F 1KTQA 4OYZA 5KFYA 1XMOJ 5K8NA 2QIFA 4DI6A 2R8JA 2VA2A 3VAIA 3PIOQ 4BDPA 2B0GA 2CQ0A 5KFRA 2AYGA 5DLGA 2HW3A 3AXKA 1DFDA 1YKWA 1M1KT 3QGIA 1RBAA 1TKTB 2GC8A 5GAEI 1R27B 1G7CB 1PG5B 1LWFB 3LGNA 4Y2IA 3MEDA 4OI0A 4DV5J 2B9WA 2UV8G 4HL9A 2QE5A 3HMJG 4KHPJ 1PYOB 3QATA 3W64A 1BQNB 3FEXB 4B9UA 2N82B 1FD2A 1S99A 4KC5A 2VB6A 4UUXA 4C0HA 1YI2S 1RYSA 1UWBA 3ILIA 1HQEA 3TANA 2SXLA 4IRDA 3T1AA 4KTQA 4DV6F 1X60A 1SQGA 3ILLA 2BYCA 2XHCA 2LMIA 1WDTA 4DU7A 2XCPA 1RSCA 3PZPA 1CVJA 2YVSA 3HHNB 2WCXA 2E1RA 3AXMA 2K7JA 1N0UA 5ETMA 1NH8A 4NLDA 2NXNA 1RQ0A 5GADU 2DISA 3W2WA 2WRMA 4RW7B 1XR7A 4KFBA 1AA1B 3OQ2A 1A0OB 1XNQJ 1UVMA 4DUZF 2I5JA 3C15B 2R7UA 3T1YF 4J9UE 5FIIA 1GMWD 3D0IE 2BANB 2H9ZA 4QWEA 4CO5A 1NB2A 2DHSA 2VG6B 3I4HX 5KFWA 2ZM6F 3MCSA 4UQGA 3CIMA 5J2NB 3P45B 4ZIVA 4JI1J 5F9LA 1C0UA 8ATCB 2DNOA 4C97A 1FDAA 2J6UA 3A8IA 2ZD1B 1FVSA 2WONA 1DQAA 4LF1A 1HI8A 4I2PB 3FEZA 2Z2YB 1R6VA 4Q2MA 1Q82T 3KJFB 3M8QA 5IM0A 4WXWA 4LIRA 1KKHA 1S1TB 1NLKL 3ISZA 3PNIA 2CQGA 2O3DA 4YY3F 4HACB 1RT2B 3TUJC 3EWGA 4P72A 2HNDA 4C6AA 4LVOP 4JV1A 2AIRB 3I0RA 2C2MB 3TAQA 2RKIA 3SCLE 2DPIA 3UW1A 2OPSA 1MMNA 2AGQA 4NEYA 4LF9F 2Y8YA 4IRKA 4CO4A 3IGVA 3S1TA 1S48A 2WVDA 4DL5A 1CS4B 1VLOA 2YX4A 3GFHA 5BYRA 3VVTA 2FJXA 3CB4A 1U0SA 1TKZA 2ZH1A 4R0EA 2RF2B 1R7IA 1UVKA 3LQVA 3RRGA 3SDEB 5KFPA 1ZM9A 3KWMA 3ZZ0A 2Z0GA 2MHEA 2CJXB 2YPZA 1IKXB 2ZJRQ 4F04B 4NE9C 1QVGR 4DZ6A 5CYJA 3AD8C 3HDSA 3N0VA 3PY8A 4NCGB 1YITS 4H4OB 1RCOB 5L1KA 8RUCA 1SJ3P 1EP4B 4EZ9A 3UR0A 3VZIA 2ZVIA 3QJLA 3K5MA 5DM6Q 1KC8T 4KKOB 2E5GA 3BPSP 3VWSA 4JV0A 1I51B 1U2CA 4DQPA 1FNOA 1FJGF 2KO1A 2GMJA 4LRAA 4LRCA 1XR5A 4PWWA 3NGSA 4M5MA 3N01A 3ZZUA 4P2XA 4YS2A 2NPFA 5J2QA 2MZ1A 2R7SA 2FLNA 5BR8J 3UO0A 2J0QD 4DR5F 4MK9A 4HHUA 2EW9A 4FYDA 4B9TA 1EQ0A 3NNCA 5E2QA 1LK7A 2MKCA 2J9DE 3L95X 1X4FA 3MCMA 2DNKA 4PYAA 1DHMA 4CQ1A 1KQSR 1P6TA 5DQIA 3GONA 2H5JB 2HLTA 2MZTA 1RWVB 1HBNA 3IM8A 3DLHA 2FHOB 3VALA 3CO0P 4DUTA 1HKAA 3C14A 3QIDA 2B4VA 2R2TA 3QWUA 2MXYA 4O0NA 2ZH5A 2UXDF 1RT1B 5A6PA 1JKHA 1UKUA 2CNOB 2VOOA 2H4WB 3W9HA 4DG1A 2AYBA 1YBUA 4W4MA 1Q86T 4FS1A 4YB7A 3BH6B 3NMAA 2E1MC 2A3JA 1NNDA 5ADZA 2F7VA 4ZK7M 2WK4A 4I67A 2DGOA 1S0NA 3OTOF 3WIVA 4NLUA 2CUYA 1WF1A 2F40A 4P52A 1KNZA 2C1EB 4OJ3A 2VQFJ 1OMSA 4MAKA 1T8EA 3R5DA 3K5OA 2AYEA 4ED4A 1WHVA 3OVSA 3EGWB 4ED3A 3D6HB 1O0PA 3M8WA 3A8EA 3GYNA 1HNWF 3ADAC 3AB2B 1TMJA 1M1HA 4X84A 1FXDA 4LFAJ 3JS9A 4MIWA 1Z2LA 1YJUA 2VPYB 1RJJA 1NKEA 1H7WA 3KUHA 1YVFA 3KYLA 3MPYA 4J9SA 1NKCA 3RJMB 2RQMA 3C19A 1NB7A 2FY1A 2IBKA 2XBPA 2Q66A 5LSRA 5A8WB 1O51A 3W60A 5HMYA 2HNZA 2KZMA 2OO4A 2ZUAA 2DR6A 2QL7B 2QFIA 2AZ3A 3VQSA 3LW5C 2HZCA 4DUZJ 4DSLA 3TJAA 1K9MT 4KSEB 3T1YJ 2XZTB 5J2MB 3CJ2A 1U09A 1AXQA 1IM6A 3IFEA 1BQMA 3JSYA 3I5CA 2EC0A 5CZVA 4ECWA 1VFJA 3U02A 4ZKAA 1F6TA 3DMJA 5A8KA 2BBEA 4DX6A 2OHDA 2B7CB 3MM8B 5AT1B 4BC9A 3PEJA 4ELTA 3HM9A 3JSRA 2V6AA 1IR2A 5J1EB 3ZTPA 3Q8QB 1YJTA 2HRTA 2QG9B 2V2VA 1I6JA 5I3UA 1K0TA 5LJ3Y 2HMIB 5RUBA 1EB0A 4Y0FA 1ZM2A 2EBGA 2UUBF 4RW9A 2DTJA 3PHTA 2K3IA 3GV7B 1ZAWA 2MLXA 2KI2A 2CPFA 2KYXA 2HBZB 2G2YA 3W8GA 2CJKA 3QZ7A 1S5ZA 3SSQA 2BJ9A 2V4QA 2HWHA 3WX4A 3TEGA 2DGXA 2DGVA 2FJEB 2H65B 2NXUA 5D3GB 3RZAA 2PEBA 5EDWA 3BV8A 2QEXS 3CE8A 4X4VA 1PAEX 2EBEA 4EUVA 4WU3A 1DTQA 1RWPB 1JK9B 1OJ4A 5GAGU 1ZBTA 4X62J 3TW0A 4WCEQ 2MQOA 1KTVA 4B08A 3PW2A 5B09A 4O23A 1VQMS 4JB8B 2FGOA 4K4ZA 1CC8A 2HQDA 2HS4A 3LWLA 3L7UA 5IV3A 2CPJA 1DQ8A 4CRJA 4KGZB 5KG3A 4DBQA 3KLGA 5KG0A 3MM7B 3UN5A 2MQLA 3HSJA 2HPUA 2M8DB 4X4RA 1ZTWA 4HDGA 3JYTB 4DPUA 1U6BA 2X1BA 2FGCA 3A4TA 2RE1A 2ADCA 1TTHB 4AUKA 5E3RA 2KT5A 1W7WA 2YNIA 1QM9A 4OX8A 3ONQA 3E2EA 1J27A 3K8WA 1JXVA 5DM7Q 3P5BP 2FZGB 2J7UA 2M2BA 3DXBA 3M4XA 4LSLA 3J80U 4YUDA 1VQ6S 2EKYA 1Q53A 4I4BA 3MAQA 1R8HA 4ZVUB 4ECYA 2CJYB 3JQMA 2ASLA 2NSBA 2VG7A 5IQQA 3FRZA 4XDDA 3ZNUA 3MGJA 3M2RA 4WP8A 3GZ7A 4DXLA 1FD8A 2ROPA 3WX8A 2P9GA 2U2FA 1R43A 1JLCA 3PDNA 2DHGA 1HYSA 3ZZTA 1UFLA 3DM2B 4YHHJ 5FJ4A 3W66A 4DL3A 3GSIA 3QNWB 3ET6A 2MSSA 3PX0A 2BOPA 4EZ6A 1IBKF 4WFYA 2IPOB 2X1GA 1CQNA 3WDOA 1S0MA 2QA4S 3PACA 4K7QA 3MMAA 2AX0A 2HNYB 3PW0A 1HL6A 2PA8D 3CCMS 2UXDJ 2GVDB 2OMOA 4OYMA 3RTVA 2BA9A 1N0VC 2V4JA 4M5JA 3SZ2A 2XM3A 4KJIA 5A2QU 2IDLA 3KK2A 3DC2A 2AGOA 3C46A 2DGTA 2Q1LA 2ILZA 3W5ZA 4RW8B 4O44A 2V0NA 2G2ZA 1U1OA 3W9IA 1SBRA 3HHLB 1FK9B 1JJ4A 3W65A 2BJEA 4ZOSA 4WYWA 3RW7A 2VL1A 1FDBA 4K4VA 5A0YB 2IFXA 1S97A 4B3MJ 1V5VA 5H9EJ 2IC3A 3K89A 5THWA 3WZ0A 6FD1A 4W98A 2IM3A 1WOSA 3EVWA 4ZCLA 3QRPA 4DV4J 3UNYA 4ZLLA 2HBQB 4RW6A 1I3OB 4OMFG 2PA3A 2FHJA 1RZMA 2VC0A 4B9MA 5IC6B 5GAHI 1VHFA 2AV5A 5ETTA 4M5LA 2A1BA 5DDOC 4XO0A 1NZ8A 1IKYA 3KDNA 4B9NA 3HVTA 2PMHA 3GFXA 3R5GA 3OFFA 1TP7A 2XSJA 5CQGA 2YQ1A 3RB6A 4NLSA 3BGRB 4I7FB 3R8YA 3R7BB 3VAMA 1XWLA 3THVA 3BBFA 1MN9A 4X4UA 2AEJA 4KY3A 2ZNYA 2WZ1A 2V2KA 1VCTA 3K7RA 2W2PP 3IC1A 5HP1A 1GT8A 2BRLA 1FFWB 2V8DA 4DCJB 2V8HA 4C8NA 2RU3A 1IN0A 1RA7A 1VR6A 1H72C 1Y0HA 1VJWA 1S4EA 4ZVEA 3CDUA 2VBWA 4CLZA 2PT0A 2XMMA 1JIHA 2OD4A 4LVNP 5D0EA 3MR3A 3MMCA 4YDXA 4Z7YA 2UUBJ 2AWZA 2YX7A 4NMXA 1UZHA 5CZXA 3DLEB 5LM7E 3LP2A 3TAPA 2GHVC 4F4XA 2CPDA 3M6XA 5KFUA 4IDKB 2DXEA 1JLEA 4DR4J 1PJ6A 4CO0A 4F3OA 2MQMA 3ITHA 1S6PB 4CTAA 1CBKA 3BGLA 3S6EA 1ZZFA 2OPQA 1NK5A 4XTTA 4ZJLA 4PPZA 3IR5B 3DRRB 4NOHA 2UU9J 1FEHA 1YJNS 1M5SA 1WOPA 1HR0F 2CJAA 1F2HA 1X4CA 3VAFA 1NJWA 2MLYA 4JI4J 1J5OA 3T6BA 4P73A 3D2WA 1WHWA 2MY7A 1K73T 2DNGA 1FKPB 2MZJA 3NGRA 3H90A 4C3LA 2O1PA 4B9LA 1N4LA 2L9DA 3BYPA 4KB7A 3THTA 1W26A 2R42A 4CLFA 2X51A 3H42A 2W1BA 4F36A 2MY8A 5K14A 1ZAXA 4OI2A 2KXNB 4O3RA 4URGA 3DYAB 5KFXA 1B0PA 2Y8WA 3M6WA 4MH8A 3KK1B 5KFAA 2KRBA 4RUBA 5L9NA 1JJCB 2UUCJ 4I2QA 4HKQA 1ELOA 2VPWB 1MWQA 2GMLA 2FJBB 4EBCA 4TXSA 3FQKA 3MD3A 1TL3B 2YKMB 3TQ1A 3M2VB 2WHOA 3MWBA 3NCRA 4USIA 4EBDA 4NLYA 3AODA 2GJFA 3LF0A 3RRKA 3V6DA 4J7CA 3NAHA 3CJRA 4C9DA 2N3OA 3US5A 2DO4A 2KRRA 3BKTA 5EWEA 1MSWD 3NS6A 3AJ1A 4RX6A 4OI3A 4DR7J 4X64F 2UZAA 2CVEA 3DDNA 3MEDB 4RNMA 3T5JA 2IRXA 5IZHA 1VQOS 2PGCA 5DG7A 5B08A 5GMEA 3G2XA 4JI2F 5JMNA 1VMBA 3K59A 1CG2A 4DR3F 2VKZG 1HW8A 4MT1A 5F8GA 1UWBB 3BN4A 1RHKB 1HQEB 1RLDA 4Q2LA 1HD1A 4CZCA 5LMUJ 1FWPA 1M5KC 2RRBA 1NJIT 4O3SA 5JVGQ 4EO8A 4PABA 3ICLA 5F8LA 5HMZA 2FZCB 1X4BA 1WHYA 2YY3A 2XGQA 4U95A 2HGNA 3TX8A 4PG7A 3DRPA 3QLHB 1KD1T 3W2WB 5CCLA 2CQDA 4JI7J 1CJUA 5F8JA 4OZ5A 1TUGB 4LRBA 2I5JB 2WB4A 5F3ZA 2LYVA 4DHVA 1FTRA 3TVYA 1TR0A 3BN7A 4WKYA 2DHXA 5HQ8A 2AYMA 4LFBF 4MFBA 2VKRA 4ZIWA 5A2QY 3AY0A 2B5JA 1C0UB 2A6OA 5B0CA 3Q86A 4ZJOA 2P9EA 2FC9A 2CQIA 1I5OB 2D3ZA 3AHPA 2RT3A 2WVBA 3D66A 3OR2A 2FJAB 4CT8A 2DNQA 3V81A 2FQQB 5IM0B 2M3DA 3RR7A 7AT1B 4ZP9A 2BDPA 1KBRA 2HNDB 1B99A 1RACB 1SQEA 4JI0F 3BQ1A 3I0RB 4B3RJ 2EK1A 2RKIB 2O66A 3UNGC 1T3OA 1RAGB 9ATCB 2OPSB 2P2CB 3NAIA 2MKHA 1PO6A 5C42A 3TX0A 4IFVA 3OJSA 3B8HA 2VJVA 3DDKA 5LJ5Y 4P74A 3OL9A 3VAKA 3TUZC 2XG8A 1TKZB 2DEJA 3BO4A 3HHLC 3T9ZA 3BB5A 2CPXA 1FDNA 2BABA 2P6SA 2ZFHA 3JB9k 2ZHBA 3MI7X 3D68A 4WFAQ 3GJSB 2DD8S 1OPZA 4EYIB 1B0VA 3CUNA 1EARA 3QGGA 1Q8LA 3GE9A 3UDLA 4FPRA 2Z58B 2D3UA 2C2KB 1IM4A 4YDDB 3BREA 2NUHA 3C3LA 5HN0A 1U45A 1HHTP 4KPYA 4QIGA 1VLYA 5K5MA 2RS2A 2W9AA 1HI0P 5EWFA 3SXLA 2YWKA 2FD2A 2UUAJ 2QLBB 3CGIA 1S6OA 3H5SA 3AD9C 1WEZA 1YTYA 4RR5A 5F9NA 1QTNB 3OVAA 3PR4A 4WZQA 5J2QB 4PG4A 3MTJA 4ZVPB 3BM7A 3EICA 1GX5A 3CJ3A 4OI6A 2ZHOA 2RILA 5HVHA 2JFDA 3DU5A 4DJBA 3HZEA 2BOAA 3TRGA 3M8SA 4UZBA 4ECQA 3FK4A 1LQ9A 4Y2MA 1VC5A 4DSJA 2D69A 1OQ3A 1HBNB 2ZOGA 1L5UA 1CC7A 5IC4B 4C3KA 3HLUA 4ER8A 1N5VA 4YFUA 2IVFB 1U8SA 2HLUA 3C14B 3QGHA 5KT7A 4V1Ak 3IR7B 5D8HB 2I38A 3DRSA 2CG8A 2W4PA 2H51B 2VC1A 1JKHB 3BKUA 4DG1B 1VQPS 4PZVA 3DLLQ 4ZVTB 4Y2CA 2FB0A 2CJ9A 2QC3A 3MM6A 4RZRA 1QSLA 3CC2S 5IWAJ 4J9OA 1JXEA 2ZH4A 2QLWA 3CCJS 3T19A 3HI9A 1X4AA 5SUHA 2L3MA 1HBMA 3R6GB 4NWBA 1N34F 4PYDA 4H4KC 4RLEA 1S1WA 4K59A 3O44A 2CQHA 2DGWA 3M6UA 2HS3A 4QW9A 2R8IA 4USHA 2MKYA 2DNZA 5E0OA 4E98A 3VVUA 1HA1A 4FYYB 1S79A 4B3SF 1VRUA 2ASYA 2D3OR 2BANA 4ZVGA 3J7Z5 1S57A 2C2RA 2ZOFA 3NWRA 3MUVP 2XY5A 4Q8FA 1UJ4A 2ZKUA 2HNZB 5KAKA 5D0RA 4N77A 1IJEB 1P1TA 3V6KA 2HHHF 1K1QA 4KHRA 4NXNF 5DG8A 1S0VA 3G96A 3CIZA 3BGOP 3KLFA 4ELUA 4ZP7A 2M0GB 5F41A 4DF8A 1NDCA 1NPRA 1X9MA 3P5TL 2LP4A 3K5NA 5EHHA 2G0IA 1EX8A 1CULA 4JYAF 4G1IA 3DMJB 4DL4A 5A8KB 3Q2SC 4ALZA 4FF3A 1M5HA 4MTPA 1KVJA 1CQMA 3RGIA 3DN9A 1FDDA 4J9MA 3M8YA 2G13A 1N32F 3MAAA 1RE1B 4C8YA 4WK3A 5HI7A 3QWPA 2VPXB 1NSPA 4RNFA 2QLJB 5I3UB 3T9NA 1RT3A 1UA1A 4C3MA 3MEKA 2HAFA 2BQRA 3IBFB 1QAJA 3K17A 3D9BA 2JX2A 3CW2C 4Z2XA 1F0XA 3UCUP 2FLPA 1YLXA 4WIIA 1RT5B 2RF2A 3N79A 2PFDA 3MD1A 3IMQJ 2JRSA 3R5CA 5LL6d 3E3XA 2I9SA 2YXLA 2NLWA 4LMZA 4RW4A 1IKXA 1RBLA 1JQGA 3HT0A 4EGLA 4GMKA 4Q43A 3BR8A 4DUYF 4URQU 1HNZF 2O5DA 3VTIA 1U7LA 4QR2A 3AT1B 4B9VA 5HQMA 2EWHA 1UVIA 4B9SA 4ES1A 4AE5A 2EK6A 1FE4A 2HURA 4F4ZA 4RU9A 3HZGA 4KGXB 3OW2R 1SKWA 1TL7A 2WW8A 4QZVB 2KH9A 2Y1RI 2Z4PA 3FRYA 3PX6A 1CJTA 5KFFA 3KLGB 3AQPA 2KJVA 2RIJA 5GAGI 3FVYA 1JLQA 2ZE2A 2JLGA 2Z56B 3FMWA 1WEXA 2RS8A 3C8YA 4EO6A 2VZ9A 4E8UA 4O3OA 2K7KA 2YNIB 3F73A 1VK3A 1VBXA 3MEGA 3V2UC 5LXYA 2B4OA 2UUWA 1JNRB 2F4FA 2ZC4A 1VQ4S 1VOMA 5H1SV 4OI4A 4J9VA 5DRKA 3TA0A 1M90T 4DV3F 1Q5YA 2F8MA 2GJIA 3N9UC 4LSLB 3PJ9A 1U2FA 4O3PA 3BKFA 4YR0A 2K3KA 1HWKA 2Z8QA 2XB2D 3W7BA 1LW0A 5D0GA 1MMLA 4LSNA 3LPYA 4L76A 3Q23A 2VG7B 3OTDA 4DPXA 2E5IA 3M2RB 3ILOA 5AE2A 2PE8A 3NLCA 5MAOA 2HBYB 3GILA 5AJ3F 3LH2S 4C4WA 2OP5A 5BYSA 2VFSA 3NCQA 1HYSB 1HI1A 3BGFA 4K4YA 3Q83A 5E41A 5DJBA 1RTDA 3I0SA 3HJFA 1RCXB 3I32A 3ET6B 4KO0A 4IOCQ 2DJWA 4Y2KA 3FZBA 2COLA 3FBCA 1S9GB 3R27A 2KFZA 1SL1A 2PDAA 3MMAB 1NXIA 4MJKA 4DR1F 1IBLJ 1S77D 2QV6A 2RH3A 4ZCMA 4WP3A 3K5LA 2AEMA 2M4MA 4M5NA 4TN2A 5LMNF 3EPGA 4TY8A 2FJDB 5J2PA 3NY0A 3FJ2A 3VV2B 1YQHA 4LBIA 1RHRB 2ZBQA 3W61A 3MAHA 4OYBA 4LBHA 1NAQA 3IBWA 5L9XA 2OH2A 4O44B 2DB1A 3W8PA 1UW9A 4C8MA 4U7UK 2HGMA 2C28A 1EKSA 4G65A 4B3TJ 2ZC3A 2E44A 2HHXA 1YJVA 3GIMA 2Y1LB 3TVZA 3HT3A 2BUNA 3JSMA 2IC3B 1NCLA 3KUEA 4NZ6A 9RUBA 3J7YI 4USTA 1SJQA 2A18A 1BC6A 3I82A 4LJMA 1WC4A 2D74B 5HMWA 4RW6B 1NU4A 2R4FA 2ZHAA 5KT2A 1X4HA 3MM8A 1GNKA 1IKWA 3UWTA 5BJRA 2HHHJ 3AJ2A 4NXNJ 3CD5A 1FKAF 1IKYB 4BWJA 2B56A 3HVTB 5J1EA 3NBPA 1TVRA 2OPPB 2VG5A 2XSJB 3PO4A 2GNKA 2BE9B 4OHZA 3RU0A 3P4UB 4U8VA 4ED1A 2E5LF 1IKVA 3RRHA 4PXDA 4ATNA 1WSRA 4UOHA 3K0JA 1UJ5A 3SV3A 5ETOA 1K44A 1T7PA 3GG0A 2ADBA 5HP1B 3GYGA 1X5TA 3MFIA 4FF1A 4PQUA 3DGPA 2FC8A 3KLEB 3NGDA 4K4TA 4K2XA 5D3GA 1GFWB 2QYCA 1BY9A 4I6YA 3KLHB 3MMCB 1NRKA 4KQZA 2JLEA 4GRSA 1IWAA 1DY3A 5CCMA 1S0OA 3LP2B 1DTTA 3MEEA 4OHYA 3CJSA 1UEUA 1YJ9S 3HFZB 3ZTOA 4UUWA 2P8IA 4DV0F 1XMQJ 3R5BA 4OQJA 4DL6A 2IJFA 1T11A 1X5OA 1D9DA 2A2CA 2HHVA 2YKPA 3QBCA 4J90A 2VASA 4Z7CA 3ITHB 4DV1F 4AQYJ 4ITSA 2BR0A 4CTAB 1NDLA 2NQPA 4DZDA 1IR0A 1FNXH 4DQQA 1OYDA 4F4AA 1NK0A 4WPAA 1TFYA 3CCES 6AT1B 3FCWA 4NXMF 1NKBA 1R8BA 4Y6IA 2ACMA 4DV7F 4P7TA 3G4SS 3C16A 3DOLA 3QRQA 5HBMA 4FF2A 4DSKA 1J5OB 5B7WA 3OLAA 4G1PA 4DWIA 4E2FB 5ETSA 4CIOA 4I68A 5AE1A 2NUUG 3PXGa 3T6JA 5L46A 4W90B 4XIUA 4LF4F 3IWNC 3FEYB 3KMSA 3I55S 1Y11A 3O6QA 3ZZZA 3EM1A 1REVB 3ZTRA 2J76E 4FVCA 3MR2A 2GO9A 1K47A 3MM9A 1NK4A 1VHIA 1DAXA 5K14B 2GCFA 2RMLA 1B0TA 2XMKA 4DFJA 1VC0A 1TZ0A 2N7CA 2YNGA 5HK4A 4I6AA 2DT9A 1SIZA 4LR9A 1JXLA 2QMUB 3LALA 2XSFA 1KDNA 4I2QB 1WOOA 3POTB 1Y00A 2GAHC 2XMAA 3HX9A 5AE3A 3VGVA 3K5PA 1IQTA 4C11A 1U6FA 2XO7A 4DL2A 2LXFA 5KFSA 5KT6A 8AT1B 1PJ7A 4KHPF 5HLFB 1KVKA 2HNYA 1U25A 2XQCA 3MCNA 1S72S 1U1KA 3OL6A 4EBEA 3D3BJ 4WTYA 3IRXA 1PKUA 3MUTP 2W2MP 2VFUA 3NGKA 5ETKA 4DSEA 4IYQA 5HO4A 4KHMA 3J81j 1ROFA 3CMQA 5E33A 1WC0A 3M32A 3QJJA 2V50A 1VQNS 2W9BA 2Q43A 2HWIA 1YJWS 3ETMA 3DFEA 5E5NA 4AYBD 1ZM4A 2G4BA 5DS7A 5FD1A 5LMNJ 3D4JA 3HHEA 1OO0B 4NLGA 3CF5Q 5HQLA 4CLTA 1XERA 2IM0A 2E9TA 1BD6A 1XNQF 3KG4A 4LT6A 3THPA 1SIWB 4NA1A 2QTWA 1H73A 2J6SA 1PC5A 1ZTTA 4TVAB 1O6XA 4M8LA 3ZZOA 2HVZA 3LA0A 5DQGA 4NLQA 2DNLA 4ZPDA 3HSGA 3DRPB 4JI1F 2JVOA 3OVBA 5D4OA 3DKDA 1CJUB 1BUXA 4K2JA 3PCOB 4DX7A 2C42A 4O4RA 2AP6A 4DPYA 1MW7A 2YWWA 3R5AA 4ZA1A 2JL9A 1U1LA 3FKBA 1PYSB 2IJRA 3OHAA 4ZCKA 3Q8UA 4MFBB 4EFAC 4U67Q 2Q6CA 2XYPB 1J5EJ 2B5JB 4C8ZA 4PAAA 2Y3YA 2UXCF 1FF2A 1PILA 2RD5C 2RSQA 3CC4S 1X0PA 2X1AA 1RHQB 1KLMA 2VQEF 5D4PA 2B4UA 2KHDA 4WIQA 2BV3A 4QIFA 2VOPA 2XZDB 4XDCA 2EXUA 5ITHA 4GKKJ 2NXEA 3I5BA 3OR2B 3DLGA 4FPIA 1Q4RA 2LU2A 2GW8A 1PJ5A 4MIBA 3V81B 1RUSA 1U6ZA 4JBCA 4CNZA 1ZZNA 1T9UA 4A46A 1KFSA 4O4GA 5KFQA 3DCAA 3V5RA 2XY7A 1DBDA 1S6PA 1C1CA 4ED8A 3SMZA 5GAEU 4YMEA 4K50A 1C1BA 3EUNA 1U4BA 5LXRA 2AX1A 4DEZA 1C0TA 2V9KA 2YWFA 2J0WA 3HVRA 4F0KA 1R89A 4H4KA 1YBAA 3M9NB 1RT7A 4KH0B 4RJVA 5C42B 4ID5A 5B0EA 4IFVB 4LQ3A 2UXBJ 1FKPA 4FYVB 3VCDA 1LEOA 2Z2LA 3D54A 3NS5A 3BZQA 2PC6A 3IN5A 1IQZA 4KV8A 2OKQA 3T5KA 4IKAA 1YWXA 1RWNB 5EN1A 1TL1A 4DV7J 4DLGA 1LV5A 4GO7X 3ISND 2ALZA 3LOUA 3GIRA 2BVZA 4QR1A 3TJ8A 3NEKA 3IS9B 4K5SA 2GQCA 3B6BA 3KK1A 3M8RA 1Y10A 1S1VB 3FSIA 1KOHA 1D3WA 2GHWA 2CWKA 4FP9A 2H54B 3UDEA 3TA2A 2MTLA 1OIAA 2HK3A 1WWHA 5D78A 1TK0A 3HHLD 4Q0BA 3M2VA 2GS8A 3DDIA 3RB0A 3PYGA 2W9CA 3SI8A 4OLOA 4RKUC 2G0CA 4QWCA 1QE1A 1WTBA 3CDEA 1U2RA 4NZ0A 5KFDA 4OJ1A 2R7WA 4C8OA 2GO8A 2IVYA 3CD0A 4AXJA 2DR8A 1Q1KA 4PQAA 3HKZD 5CABA 3CJTA 1SQFA 4CH7A 4FF4A 1FRKA 4HYKA 3CJ4A 2VUGA 5T14A 3KNAA 2HQCA 4KAIA 1XEZA 3CJ0A 1CSJA 5F8NA 3A8JA 3CD6S 3IRWP 4LF7J 2F65A 1RB0A 1U0HA 2YNFB 2ROEA 1HQUA 2QSWA 4N56A 1FEEA 2CPEA 4WFBQ 3LP1A 2Y1JA 4R0JA 2VQFF 4MMOA 4L3NA 3DLBA 3HFKA 1N52B 2CDRB 3DRSB 2C2NA 2Z30B 3CDAA 4L72B 2PI4A 3AOCA 4ZVFA 4EWTA 4ZPCA 3PRBA 1H38A 4Y65A 5K8OA 5KTQA 3FMBA 3IG1A 1FCAA 4Q8EA 3MM6B 4LFAF 1HD0A 3GLJA 4QJVA 1HBMB 3QSYB 1RTJA 1F60B 1FE0A 1F1BB 2FPHX 1AYEA 2OEKA 3QLHA 1S1WB 2CZ9A 3LPEA 3BYRA 1WC3A 7FDRA 1RWWB 3F56A 3HULA 3R5JB 4QYZK 2JWNA 2FLOA 2W7OA 1VRUB 4CDIA 4JV2A 4U96A 2AJ4A 4TLRA 3HSZA 3D5MA 3CMES 5IT9U 3T1HJ 2KT2A 2N3LA 4X4TA 3GSDA 5HATA 3HD2A 3SQGA 5B0BA 1N54B 2OTJS 2CXEA 3CWJA 3O5TB 5F8HA 1TFWA 3HCXA 4OYWA 4QU7A 4G1QA 4TYBA 3SV4A 2RRAA 3A8KA 3PO5A 2CQ1A 3KLFB 4F0MA 4M5HA 4IG0A 3IR6B 4J37A 2RNEA 1CULB 4HVZA 4J9KA 1KFDA 2DR9A 1NK7A 3RUBL 4Y28C 2MQ8A 2IM2A 2W8KA 4J9RA 3PR5B 3B78A 2KHCA 2UXCJ 3TZXA 4KIAA 4F67A 1HHSA 4V19X 1RI7A 3FC9A 2XS7A 2VQEJ 3MAAB 3SQOP 3IAS9 1V3SA 4I69A 1JMTA 3M05A 2Q3PA 3NOGA 4ANDA 2E1AA 4Q5VA 1R6YA 1RT3B 4M1KA 4RBUA 1YSJA 1RWXB 3PKMA 2D41A 1VISA 4NYOA 3FFIA 4X62F 2AQ4A 3R1HA 3G9CA 3MPUB 1LKZA 4HLBA 2YH0A 3KLIA 2OJ3A 1RWOB 5FDLA 1GXTA 5L38A 4EYHB 5C7PA 4FXDA 2XCAA 4DN9A 5GMDA 1K1SA 3ILJA 1V5IB 2FVQA 4RW4B 4H4MB 3R2DJ 2FZKB 4NL5A 4NRTA 1S9EA 3LWMA 4QW8A 1B70B 1Q79A 4ANEA 2HFVA 5KFIA 2YPYA 1YRXA 4PCQA 1RABB 1UMJA 1F3FA 1BXNA 2JDJA 1JLAA 1TL7B 4A8XA 4P7VA 3I56S 4FKYA 4JI3J 1CJTB 1HFEL 1SC6A 2LLZA 4PWDA 2GMHA 1JX4A 4AXIA 3L3CA 1WTFA 4C0BA 4LF5J 1RKIA 1JLQB 1RT6B 2R3VA 3UI3A 2ZE2B 4ZITA 2HVIA 1VQ9S 3H5UA 1N5TA 2F8EX 2CA9A 1FJ7A 3RW6A 4K4UA 3MEGB 4IR9A 4ECTA 3M2UA 2ZH6A 3IM9A 3TWZA 1S1UA 4C2MA 2MZSA 1RHJB 4JV5F 1KS2A 3QT8A 2G1DA 2OIHA 2LU1A 3R6LB 2LECA 4RBVA 1V3RA 2YKNA 4YHHF 4NZ7A 2FVCA 1QAIA 2RHSB 3JSBA 2QMXA 1P1LA 1FFSB 1LW0B 4K4SA 3HF5A 4LSNB 3P8BB 5E3QA 1WELA 3G82A 4TQRA 2OFHX 4CLUA 5KFNA 2R8KA 1U1PA 4DFPA 1Q5VA 5IT4A 3TAMA 1FWKA 1NSAA 1V9OA 3QZ8A 2W8LA 4DSFA 1RTDB 4P2MA 3I0SB 3ZO7A 1WKLA 4ZVQB 5KFBA 3T5LA 4ZVOB 4KO0B 3PJWA 2ZH7A 2ZZTA 1R8CA 2M88A 2WOMB 1E6YA 2DO0A 4R8UA 3SEOA 1T03A 4NLPA 4J91A 2XEXA 2E29A 1YJ7A 2C2DA 2U1AA 2XMJA 1SL0A 3OJUA 3H7HB 1FO1A 4IO9Q 3G6XA 3DOKA 4BHQA 3C6UA 1KQGB 4NA3A 4D3GA 3L9ZA 2LDYA 3NMRA 2DBBA 5CYMA 4TY8B 2DNPA 5J2PB 4F4WA 2MGZA 3BH7B 4B3MF 2RDDA 3CULA 5KFTA 4NI2B 2M9KA 4FKXA 1RDRA 3MDFA 4DV4F 4CO2A 1KEKA 2DIUA 5I42A 3KTQA 2MKIA 2MPUA 5JUMA 1JWWA 5SZTA 4U8YA 3GWCA 2BXJA 3JSMB 2IYGA 5CD4H 1U1MA 3UDVA 2OGUA 4A8QA 3S8SA 1MROA 4NLVA 4ZN3A 1SXLA 4TLQA 5ETLA 5GVQA 3AB4B 3L7PA 3VGUA 3OUYA 1LWEA 2XY6A 1UW4A 4WFNQ 2ATCB 3PG9A 2YWHA 5A6WA 1IKWB 2JZ5A 2ZVSA 1VC6A 4AD6A 3KJNB 5HJYA 3NBPB 4TKTA 1RK8A 1TVRB 2AJ0A 4RU2A 3CPWR 2VG5B 2GVZB 2W4CA 3P3DA 2KFYA 5KFHA 2DH8A 2QFJA 2CNNB 2C22A 1KN6A 4EEYA 1IKVB 4OYXA 1Z4UA 3IWXA 2BE7D 1YK9A 1PCAA 5IV4A 4F4KA 1H0HB 3N6NA 2DNRA 2WVCA 2H4YB 3JTPA 4LR7A 4PQUB 2BJ3A 3DGPB 4DR4F 2ZZMA 2HFNA 3QFHA 1RT5A 3L09A 3U7JA 4ED2A 3G86A 4BCAA 4FNIA 1WNEA 2XLIA 3IP0A 1TMMA 2HK2A 2RQKA 3TJ9A 3MOZA 5E7OB 2LA4A 1UEVA 3A3PB 3GJRB 5IT9Y 3BSCA 1BLUA 1GEHA 1H3DA 4CLLA 3NKYA 4M5DA 4WE1A 3WC0A 2UU9F 3MURP 2K2PA 1ZPVA 2E9ZA 2WB1D 2AT1B 4WTOB 1DTTB 3SCIE 3MEEB 1LXNA 4CWBA 4YOEA 3CCSS 3EXYA 1L3SA 2UVVA 2VD3A 4RBTA 4JI4F 2QYGA 5B0FA 3IXQA 1EETA 1SJRA 2I8EA 1S6QA 5F8IA 4ZP6A 4IOBA 1RU1A 2V5HG 3JQJA 4ZMMA 1F2GA 3SIPB 4OYIA 2BQUA 3TOQA 1L3UA 4OJHA 2W2NP 3V6JA 2RJZA 3MOJB 3ZTSA 2FTRA 1TKDA 1S12A 4DFKA 3C16B 3DOLB 5HBMB 2JSXA 1VBKA 4MKVA 1R0AA 4OX9J 4JI5J 2BRKA 3VGTA 3PJXA 2BKNA 4USMA 3PVXA 3Q8VA 2ASJA 5DGAA 1N5SA 1FHTA 1NHUA 2UUCF 2B7BB 1VQKS 4F02A 1KQKA 1HWJA 4I64A 2ZWOA 2BKPA 4C7QA 2FVPA 2KFNA 3MM9B 3D1QA 2E5JA 5CD4A 3D7SB 2ZH3A 4YP3A 4JUZA 5GAHU 4B3OA 4ZPVR 1FX2A 3W5YA 2W01A 4QPTA 3U1NA 5JVHQ 1OYEA 2YNGB
chains in the Genus database with same CATH topology
1B4SA 1NSPA 3Q83A 3DKDA 3VVUA 3BBCA 1NB2A 2CWKA 1BUXA 1NCLA 1F6TA 4UOGA 1XQIA 3ZTQA 1ZS6A 3FBBA 3BBFA 1MN9A 3EM1A 3FBEA 4KPCA 3B54A 1LWXA 3ZTRA 1S57A 3BH7B 2DY9A 3EJMA 1NDKA 3FBCA 2HVEA 3DDIA 3VVTA 1BHNA 2DYAA 2DXDA 3Q89A 4FKXA 4S0MA 5BXIA 3EE3A 3ZTSA 3FKBA 3ZTOA 3L7UA 3GPAA 3VGSA 1EHWA 3WX8A 2AZ1A 4ANCA 4EK2A 3NGRA 3ELHA 3ZTPA 1NHKL 3Q8UA 1NDPA 4ANEA 2B8PA 3ENAA 3ETMA 1UCNA 1B99A 2HVDA 3FCVA 2NCKL 1LEOA 3VGTA 3BBBA 1BE4A 1U8WA 3JS9A 1NDLA 5CABA 4W98A 1XIQA 1F3FA 4HR2A 4DZ6A 1VYAA 3EVWA 1KDNA 1NDCA 1S59A 3FC9A 2B8QA 2BEFA 2BX6A 2DXFA 4F4AA 3Q8VA 1HLWA 4FKYA 1MN7A 1NUEA 1WKKA 3EMTA 3FCWA 4F36A 3FBFA 3PJ9A 4DUTA 3VGVA 3EVOA 4DI6A 1W7WA 1HIYA 1NLKL 4ANDA 1WKLA 1NSQA 2DXEA 3G2XA 1S5ZA 4UOHA 2VU5A 3MPDA 4O0NA 1K44A 3GP9A 4CP5A 2ZUAA 5IOLA 3EICA 3Q8YA 4C6AA 3PRVA 1JXVA 1HHQA 3VGUA 3NGTA 2AZ3A 4WBFA 3R9LA 2HURA 4UOFA 3Q86A 1NPKA 3B6BA 1PAEX 1WKJA 3NGSA 5CAAA 3BH6B 5C7PA 3NGUA 3EVMA 1PKUA 1NSKL 4ENOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B4S A;  1NSP A;  3Q83 A;  3DKD A;  3VVU A;  3BBC A;  1NB2 A;  2CWK A;  1BUX A;  1NCL A;  1F6T A;  4UOG A;  1XQI A;  3ZTQ A;  1ZS6 A;  3FBB A;  3BBF A;  1MN9 A;  3EM1 A;  3FBE A;  4KPC A;  3B54 A;  1LWX A;  3ZTR A;  1S57 A;  3BH7 B;  2DY9 A;  3EJM A;  1NDK A;  3FBC A;  2HVE A;  3DDI A;  3VVT A;  1BHN A;  2DYA A;  2DXD A;  3Q89 A;  4FKX A;  4S0M A;  5BXI A;  3EE3 A;  3ZTS A;  3FKB A;  3ZTO A;  3L7U A;  3GPA A;  3VGS A;  1EHW A;  3WX8 A;  2AZ1 A;  4ANC A;  4EK2 A;  3NGR A;  3ELH A;  3ZTP A;  1NHK L;  3Q8U A;  1NDP A;  4ANE A;  2B8P A;  3ENA A;  3ETM A;  1UCN A;  1B99 A;  2HVD A;  3FCV A;  2NCK L;  1LEO A;  3VGT A;  3BBB A;  1BE4 A;  1U8W A;  3JS9 A;  1NDL A;  5CAB A;  4W98 A;  1XIQ A;  1F3F A;  4HR2 A;  4DZ6 A;  1VYA A;  3EVW A;  1KDN A;  1NDC A;  1S59 A;  3FC9 A;  2B8Q A;  2BEF A;  2BX6 A;  2DXF A;  4F4A A;  3Q8V A;  1HLW A;  4FKY A;  1MN7 A;  1NUE A;  1WKK A;  3EMT A;  3FCW A;  4F36 A;  3FBF A;  3PJ9 A;  4DUT A;  3VGV A;  3EVO A;  4DI6 A;  1W7W A;  1HIY A;  1NLK L;  4AND A;  1WKL A;  1NSQ A;  2DXE A;  3G2X A;  1S5Z A;  4UOH A;  2VU5 A;  3MPD A;  4O0N A;  1K44 A;  3GP9 A;  4CP5 A;  2ZUA A;  5IOL A;  3EIC A;  3Q8Y A;  4C6A A;  3PRV A;  1JXV A;  1HHQ A;  3VGU A;  3NGT A;  2AZ3 A;  4WBF A;  3R9L A;  2HUR A;  4UOF A;  3Q86 A;  1NPK A;  3B6B A;  1PAE X;  1WKJ A;  3NGS A;  5CAA A;  3BH6 B;  5C7P A;  3NGU A;  3EVM A;  1PKU A;  1NSK L;  4ENO A; 
#chains in the Genus database with same CATH topology
 4RUC A;  1FRX A;  4JV5 J;  3AOB A;  3PYF A;  3GG1 A;  4IH6 A;  1VQY A;  2L48 A;  4OLP A;  3R2C J;  1FTC A;  2EFV A;  2IMO A;  6FDR A;  4OL8 A;  4DR7 F;  1V6H A;  1U1R A;  4C11 B;  2VFV A;  2RDJ A;  1S9G A;  2ZWP A;  4J5O A;  4PEO A;  3V4I A;  2VV5 A;  5KT3 A;  3I31 A;  2GX8 A;  2HEK A;  3MR7 A;  1XNR J;  1NM2 A;  1GH8 A;  2F4V J;  1U1Q A;  3WIU A;  4X66 F;  2UVW A;  4PXB A;  3IRX B;  4NA2 A;  1PBU A;  2JC1 A;  1UVL A;  5D6G A;  1WEY A;  1QUV A;  4L6V 3;  4F2R A;  7FD1 A;  1OY9 A;  2HFU A;  2ACY A;  2HYI B;  4DFM A;  3VAJ A;  2N4C A;  3RB4 A;  5D0H A;  2K1R A;  2QZ8 A;  2QN6 B;  4ZS6 A;  5LMU F;  3M32 B;  2DR5 A;  2FJV A;  2OUG A;  3FCH A;  1F3V A;  1C4A A;  1H74 A;  2W9B B;  1TEL A;  3NGU A;  4ZPT R;  1WG4 A;  1BMQ B;  4OHW A;  2PII A;  2DCL A;  3B4D A;  2GQ2 A;  2DHA A;  3VZH A;  3BGU A;  2R9L A;  4DMZ A;  2ILY A;  1HBO A;  2DYA A;  4JI7 F;  4M5K A;  4CNY A;  2VIH A;  1N48 A;  1M5V C;  4U6P A;  3BSN A;  2FY8 A;  3A3O B;  3E51 A;  1KHW A;  2KXH A;  4USJ C;  2JC0 A;  3TQE A;  2MYF A;  1GMW A;  2L41 A;  2NRE A;  3MMJ A;  1KQF B;  2OPP A;  2CQ3 A;  1UFW A;  3PV8 A;  5KFE A;  3Q22 A;  4Y34 A;  3J7A 1;  2HVH A;  3OBI A;  1FI4 A;  4USW A;  4D3H A;  2POK A;  1VQS A;  3OL7 A;  4ECS A;  4DU8 A;  4ETX A;  1Y5L B;  1UVJ A;  1N5Y A;  1APS A;  5D4N A;  2BW7 A;  3AA9 A;  3CCW A;  1ZYQ A;  4GKJ J;  1M5P C;  4YB1 P;  3KLE A;  3IA0 A;  3MEC A;  3G8T A;  1KVI A;  1FJE B;  3PEH A;  2XHW A;  1Q0N A;  3ENQ A;  2QMW A;  2ZBR A;  2HAI A;  1KLM B;  1ICE B;  2KM8 B;  4ECU A;  3KLH A;  2CNL B;  1SV5 A;  5I4M A;  3KG0 A;  1K8A T;  3DRY A;  1VIO A;  4B3R F;  2KXF A;  3DLG B;  4TYA A;  1UCN A;  3D0H E;  4Y2A A;  3FCV A;  2Y9H A;  2VDH A;  1B3T A;  2GIQ A;  4V19 J;  4O4G B;  1S59 A;  2V68 A;  2BX6 A;  5C25 A;  3QO9 A;  4DLE A;  2KJW A;  1C1C B;  2ZBC A;  4C8K A;  4WZM A;  5EX3 A;  3E8O A;  3D1H A;  1RTI A;  5EWG A;  1VQ8 S;  1C1B B;  4X4N A;  1C0T B;  3N5B A;  3OL8 A;  3BSO A;  3PRV A;  1C2P A;  1R3N A;  3QPI A;  3H25 A;  3ZZP A;  1IBM J;  1SCJ B;  5IS2 A;  2GIR A;  3CJK A;  2DNH A;  4J9L A;  1RT7 B;  4ID5 B;  1T9V A;  1DJ0 A;  2XMW A;  2XMV A;  4TY9 A;  2KG1 A;  3NL0 A;  3R7S B;  1M5O C;  5K8M A;  2HG4 A;  2HRY A;  2LFV A;  2CQP A;  4FS2 A;  4CM0 A;  4LF6 J;  2ATL A;  4IOA Q;  1RLC L;  1LWX A;  3O2I A;  2N4D A;  4KV8 B;  2ASD A;  2E5H A;  2QSF A;  1REV A;  2XYG B;  3KHH A;  1RAJ A;  2UUA F;  1TL1 B;  3GPA A;  5H9F K;  4ZPB A;  2J9C A;  1NDP A;  2EVZ A;  1T3N A;  1VRT A;  4UQT A;  1H2T Z;  3FQL A;  2AF6 A;  4N76 A;  5DGB A;  1F9F A;  1KP6 A;  2QO3 A;  3ZFV A;  1JJH A;  4OZ0 A;  5HVF A;  2JJ4 D;  2ZBI A;  2DGQ A;  4LF2 A;  2AU0 A;  3CCZ A;  3RYL A;  2V9W A;  3POT A;  2V94 A;  2VJU A;  1LK5 A;  4PXC A;  3CDB A;  4ERD A;  4Q0B B;  2IA6 A;  2H3E B;  1UA0 A;  3WC2 A;  2W9C B;  2C2Z B;  1LXJ A;  1NME B;  1OPI A;  1QE1 B;  3SYZ A;  1OSC A;  5HLF A;  1ZOT A;  5CAA A;  3FNN A;  4BBY A;  2OPR A;  4EI2 A;  4OV1 A;  2HKE A;  4YB5 A;  4O0I A;  4JI8 F;  1OY8 A;  5T41 A;  2Q6B A;  2OSR A;  1N88 A;  1RAH B;  2DGS A;  3MPW A;  5DDP C;  4QIW D;  2FHJ D;  2E66 A;  4AL7 A;  2LEP A;  4ILL A;  1Q8K A;  4F50 A;  3GFZ A;  4RPF A;  1CJK A;  4UW2 A;  1ARO P;  3VQT A;  1C4C A;  4HEA 9;  4QPX A;  5ETQ A;  2VBY A;  1NK9 A;  1IXK A;  1AZS B;  3W1Y C;  2DNM A;  3ZNJ 1;  5DDQ C;  1U0H B;  1P8G A;  4N8O A;  5IWA F;  4KR0 B;  4OHV A;  1HQU B;  1NK6 A;  3QT5 A;  2IM1 A;  1T9T A;  2OAU A;  4TQS A;  3LP1 B;  4X66 J;  2IIH A;  1H2U X;  3J80 Y;  1Q7Y T;  4ILM A;  2H1Y A;  4IG3 A;  1ZA1 B;  3L7O A;  3PTW A;  1OS5 A;  2RDI A;  2JEI A;  3IG1 B;  3QIP A;  4NX9 A;  1URN A;  1W25 A;  1YBT A;  3D3C J;  3NNH A;  3TP2 A;  2WBR A;  1TKX A;  1R0C B;  1SC4 B;  4RNH A;  3CCV S;  1NO8 A;  4ZPA A;  1N6Q A;  1NPP A;  1RTJ B;  4DS5 A;  3UD5 A;  1MWZ A;  1SH0 A;  3G6E S;  1S49 A;  4I0W A;  2K06 A;  1D9A A;  1SJ1 A;  4RWW A;  3HSD A;  1RT4 A;  4PXE A;  2BJ7 A;  4A48 A;  2IAJ A;  3M9M B;  1E6V A;  2XI3 A;  3RBD A;  1D1U A;  1R8A A;  1NHK L;  4NLX A;  2QGF B;  4A8F A;  2XO6 A;  1MU2 B;  3FSY A;  5KG5 A;  4XPE A;  1CPZ A;  3LGH A;  3QT6 A;  4L74 A;  3QRR A;  3F41 A;  2V67 A;  4ZCI A;  2R7O A;  3SQG B;  5GAD I;  3EDR B;  3UD3 P;  3CSK A;  2YH1 A;  1FWL A;  2I1R A;  2QRR A;  4G1Q B;  4OI1 A;  4CLK A;  3K2Y A;  4IG0 B;  4J9Q A;  2Z2M A;  1PYT A;  3P6Y C;  1YRT A;  4P75 A;  4DPO A;  1N33 J;  1X4G A;  1YZ6 A;  3TZZ A;  3Q0A A;  4WKR A;  3GCW P;  4ID8 A;  1WC6 A;  1Y9O A;  3W62 A;  1X9S A;  2YWE A;  2GHP A;  5DLF A;  4PPD A;  2J8S A;  2X3G A;  4CLS A;  2GV1 A;  3KJQ B;  2NZC A;  2MDA A;  3VHQ A;  1SL2 A;  3H2U B;  2UV8 A;  2BQ3 A;  4XPC A;  4JP8 A;  3HO1 A;  4PG5 A;  1U1N A;  4IR1 A;  4PUO A;  3VR1 A;  2IJN A;  4DQI A;  2DR7 A;  5T7L A;  1QAY A;  5KG6 A;  2IRY A;  1A6L A;  4X4P A;  2RHQ B;  2M8H A;  5D77 A;  3MMB A;  2A0F B;  4MK8 A;  1IJF B;  2VH7 A;  3FFI B;  2M52 A;  2DK2 A;  2NCK L;  2ALY B;  5HMX A;  3MFH A;  3BBB A;  3KLI B;  1SUQ A;  5FDL B;  2OEM A;  2UVR A;  4QYZ J;  4LSZ B;  2EFP A;  1P27 B;  5JXS A;  1HPZ A;  3Q8S B;  4RNN A;  3U1M A;  3EMT A;  1P9Q C;  2YQ0 A;  5B0G A;  1N36 J;  4DL0 C;  4CCH A;  3Q2T C;  2IHR 1;  3UD4 P;  1TL4 A;  3ENW A;  3EGN A;  5KT5 A;  1DRZ A;  2MEW A;  2V4R A;  1IWG A;  3CD7 A;  4DR2 J;  4OZN A;  1HHQ A;  2LQJ A;  5G0R A;  1NJX A;  1VRQ C;  1N5Q A;  4YN3 B;  2VFT A;  1S9E B;  4QCL A;  3TA1 A;  3IS9 A;  4WYL A;  2J0S D;  1S1V A;  4LQ9 A;  2R8G A;  1WF0 A;  5L1I A;  3ZZR A;  3FBB A;  1QD1 A;  3K8V A;  2BE2 A;  1T02 A;  1T9Y A;  1JLA B;  3GV5 B;  4PWD B;  1TK8 A;  2DRA A;  1VS3 A;  1NEE A;  2VBX A;  5CA5 A;  2G9O A;  3OR1 A;  4Q45 A;  3VAH A;  4OHX A;  3OTC A;  2HIQ A;  4FVM A;  5ETR A;  2B8Q A;  4KE5 A;  5JJB A;  2EKN A;  4FDF A;  2OEJ A;  2BM0 A;  3M2U B;  5J1N A;  4ICL A;  2RRN A;  2HHT A;  5D4L A;  4DV6 J;  1S1U B;  3CCT A;  2BJ8 A;  4FXW A;  1RWM B;  5HJX A;  3OFE A;  2ZBP A;  3K57 A;  3D6F B;  2R7T A;  2YKN B;  3H98 A;  2LKZ A;  2LDI A;  3OXF A;  2KM8 C;  4BC7 A;  2YNF A;  2DIT A;  3D6T B;  3TR5 A;  1UP1 A;  4JI8 J;  3I9Z A;  2CYY A;  1ZPW X;  3BR9 A;  1T05 A;  3G82 B;  1IBL F;  3M30 A;  3MR6 A;  1JJ2 R;  4PWU A;  3PW7 A;  4E0D A;  4ZHR A;  3E01 A;  3SFG A;  3QAU A;  2V8V A;  2YKA A;  3BSA A;  2RQC A;  2HVE A;  3TAM B;  2W25 A;  3KJV B;  3N6M A;  1TAU A;  1X8D A;  1EHW A;  3DI6 A;  1ITP A;  2ZM6 J;  2HQG A;  4OYP A;  3CC7 S;  1E6Y B;  3U1L A;  5HSP A;  4R8U B;  1T03 B;  4KGV B;  2JOQ A;  5K8P A;  3QYY A;  3QGP A;  3KOA A;  3FZ2 A;  1NH7 A;  3RBE A;  4B3T F;  3DOK B;  3C6U B;  4NEZ A;  1IVZ A;  4TNO A;  5F0W A;  1U02 A;  3HXM A;  2JH3 A;  1VJQ A;  5CYM B;  5ETN A;  4AT1 B;  4RNO A;  2MGZ B;  4NLR A;  3T5H A;  3TEH B;  3PW4 A;  3TZW A;  4HH1 A;  4R25 A;  1RTH A;  1NHV A;  2HQ3 A;  1Y5N B;  5KFK A;  1KRP A;  5CYQ A;  1MG7 A;  2DCU B;  4ES2 A;  1QAX A;  4YY3 J;  2YNH A;  3KNG A;  3KG1 A;  3GQC A;  5I42 B;  2GGP B;  2VOD A;  3J7A N;  3NCP A;  2XWY A;  1FA0 A;  3CO9 A;  1A9N B;  1XBW A;  4PRF A;  5HL7 Q;  3QJP A;  4IRC A;  3LP0 A;  3H59 A;  3LGM A;  2X1F A;  2F8H A;  2MHN A;  5CXT A;  3W5X A;  4LF9 J;  5BXI A;  1B64 A;  4PKD B;  2DH7 A;  1MRO B;  5HVG A;  4RWX A;  4XAK A;  4RUH A;  1YX2 A;  3OXL A;  3OUY B;  1LWE B;  5ETP A;  3QT7 A;  1T95 A;  2IYI A;  5C24 A;  3DRX A;  1WG1 A;  1Q8I A;  1HNV A;  2A10 A;  1TQL A;  1RXO B;  1VBY A;  2CQ4 A;  1HW9 A;  5MLC V;  2HHP A;  5M2U A;  2MZQ A;  1HWU A;  1X0F A;  4R5P B;  2XS5 A;  3SCJ E;  4IQM A;  2FIU A;  3SSS A;  2HWT A;  1QSS A;  1TAQ A;  2JHE A;  5DO2 A;  3O1L A;  2GFF A;  3M1V A;  2AEF A;  1GTH A;  2PMW A;  2P5V A;  3CCR S;  2XZW A;  1XMQ F;  1KHV A;  3BEG B;  4P6Q A;  1FJG J;  2KDO A;  3HVW A;  4AQY F;  3TI0 A;  2DH9 A;  4UZC A;  4HT5 A;  1PC4 A;  1QY7 A;  2W4D A;  5K9F A;  2XTJ P;  1YGY A;  2C3P A;  1GK8 A;  4H4M A;  4M5D B;  4WE1 B;  2HGL A;  1DQ9 A;  3I87 A;  4DV2 F;  4DR5 J;  1VQL S;  4F2S A;  3H4B A;  4ZJQ A;  3J7Z T;  1HLW A;  1D0E A;  1EET B;  3EVO A;  1S6Q B;  5F3T A;  1ULR A;  1KON A;  1X9W A;  1BWV A;  1RAI B;  4LRD A;  5KFL A;  2V34 A;  2EEY A;  4N7T A;  2R2U A;  1VBZ A;  4HT7 A;  2QT7 A;  4WFZ A;  2B6A B;  1RT6 A;  4M63 A;  1UWA A;  1KWM A;  3OPK A;  2D1C A;  4RO0 A;  1JLG A;  3KKF A;  1G1X A;  1FRH A;  2W7P A;  4MKB A;  4P2S A;  2J5A A;  4BS2 A;  1R0A B;  2C3M A;  4I56 A;  4L3K A;  2DVI A;  1EZZ B;  1RKJ A;  3TO8 A;  3O3L A;  3TVK A;  1REG X;  5KG1 A;  3H5X A;  1XK8 A;  1N8R T;  1LFW A;  3J7Y U;  3T41 A;  3OTO J;  3ELH A;  2OEL A;  3RAX A;  4I1T A;  2FVR A;  2G1H A;  4DL7 A;  5KFO A;  1YHQ S;  3QFW A;  3KK3 A;  1O8B A;  4X4Q A;  3AJD A;  4X65 F;  3QQC D;  3Q8R B;  3NS7 B;  2W24 A;  3I96 A;  1F5A A;  4B3O B;  4ES3 A;  1U49 A;  1JB0 C;  1WOR A;  2WTF A;  1R8P A;  1IUJ A;  5C5J A;  1HNW J;  3FBF A;  5F0U A;  2ZKT A;  2KT3 A;  2CJB A;  2NZ4 A;  3W3S A;  2QL9 B;  3R1L A;  3A12 A;  3NRB A;  1SC3 B;  4UT4 A;  5IOL A;  2PMZ D;  2MMY A;  2WOM A;  2EPI A;  3DOM A;  4DOZ A;  1QSY A;  5G4D A;  2NPI A;  4P2F A;  4CT9 A;  3H40 A;  3V4I B;  4GO5 X;  3VF0 B;  1AUS L;  3EGZ A;  3C66 A;  2UVU A;  2FVS A;  2LQ8 A;  2F5G A;  1Q8B A;  1AW0 A;  2JEG A;  2WSC C;  1ACM B;  1CJV A;  1Z2Z A;  3UVJ A;  2V8P A;  4TU8 A;  1MMD A;  4IFY A;  1UFK A;  1M0S A;  4N47 A;  4UF4 A;  3OSP A;  2AJF E;  2RB7 A;  4MK7 A;  2FJW A;  3I6P A;  4NI2 A;  2J0X A;  3JAM U;  3W2V A;  2G0J A;  2QA1 A;  3CJQ A;  5HRO A;  2IDE A;  2A6M A;  2R8H A;  4CO3 A;  5KT4 A;  2K1R B;  3CCL S;  3AOA A;  1OWX A;  4OZ3 A;  2ZOM A;  2FUG 9;  4ZLN A;  1YG0 A;  2DNN A;  5IQ6 A;  3SSR A;  1R31 A;  3RBZ A;  4OIX A;  1NSQ A;  3TYT A;  3TUI C;  4QIE A;  2VDI A;  4L75 A;  2AJ1 A;  1FES A;  4CP5 A;  3V6H A;  2E7X A;  1HBO B;  4W92 B;  3EXC X;  4FNH A;  3PRD A;  3R9L A;  3NXZ A;  1I1G A;  1NK8 A;  1NBE B;  4B17 A;  1S6U A;  3BO3 A;  2M7S A;  1Z1Z A;  3BDE A;  1EKR A;  1RU2 A;  3CVK A;  1LWC A;  2GAG C;  2AKW B;  1PAU B;  3M8P A;  3S01 A;  2HQF A;  3EJM A;  3IAM 9;  3OTB A;  5C2G A;  1TV6 A;  1J5E F;  1S76 D;  2GVZ A;  3CJ8 A;  4OJG A;  3TNV A;  2HZA A;  1PGZ A;  2KN4 A;  4CI0 B;  1L3V A;  1DLO A;  1AB8 A;  3GR1 A;  1VGY A;  2Z2Z A;  4GKK F;  4CYU A;  2XNR A;  2CNK B;  4H54 A;  1N5Y B;  1S7I A;  2V69 A;  3MR5 A;  2R7R A;  2YBV A;  1WC1 A;  3I5A A;  2B51 A;  4MKA A;  1AFI A;  2G2O A;  3MEC B;  3FDS A;  3UCG A;  2J8A A;  3RB3 A;  1CLF A;  3GII A;  1SV5 B;  2WW4 A;  3PYE A;  2B9E A;  1B7F A;  3PYD A;  2L9W A;  1D9F A;  3GCX P;  2W2O P;  1QVF R;  4A8S A;  1HBU A;  1F5C A;  3D6M B;  3KHL A;  3EPI A;  4JI6 F;  4C98 A;  3QAE A;  2MQP A;  1UEK A;  5C25 B;  3OLB A;  2UXB F;  3QO9 B;  4KGM A;  4A8M P;  2RUG A;  4F4Y A;  4NAS A;  4LR8 A;  1GMV A;  4DS4 A;  1RTI B;  4ED0 A;  3KHR A;  1FVQ A;  2MKS A;  3R7N B;  3CTR A;  4DV2 J;  1UTA A;  2XMU A;  2ZIT A;  4CO1 A;  2HHS A;  3G6V A;  3CJ5 A;  2E7W A;  3PW5 A;  3CJK B;  4AL5 A;  1N56 A;  3A13 A;  5FLX U;  2IA0 A;  2OLW A;  4DQR A;  2M5Y A;  3NOC A;  3Q8P B;  2J9D A;  2LA6 A;  1IBK J;  2DNY A;  1IBC B;  1ZM3 A;  3EGV A;  1HAR A;  2AJQ A;  2IRU A;  4P9S A;  3NGT A;  3DLK A;  1AFJ A;  4WBF A;  4CM2 A;  2VBZ A;  4QIV A;  1LW2 A;  1VRT B;  1WDD A;  3KLV A;  2VFR A;  3AQO A;  4QU6 A;  5KFV A;  2OTL S;  1D8Z A;  3BF4 A;  1JLB A;  1RYR A;  1HNI A;  2FHK A;  2FLL A;  5ETV A;  3VGS A;  4OYA A;  5A8R A;  3HJV A;  1FNM A;  1S1X A;  1FXR A;  2MZR A;  4X65 J;  5KG7 A;  1DZ5 A;  4LF7 F;  4WWS A;  3RR8 A;  1WSV A;  4WF9 Q;  2EG1 A;  2CJQ A;  2OPR B;  5KOW A;  3C6T A;  4DN0 A;  1IR1 A;  4O3Q A;  4KFB B;  2R2S A;  2JEF A;  4PG6 A;  1PBA A;  2APO A;  2LVW A;  1VI7 A;  1CJK B;  1XMB A;  4LIW A;  1YIJ S;  1FER A;  3ENV A;  4TU7 A;  2DRD A;  3LAK A;  2MST A;  4RL1 A;  2ZH9 A;  2MJU A;  3UFC X;  4K5R A;  3W63 A;  3LAM A;  3MM5 A;  4WJB A;  1O5J A;  2V8G A;  3X3U A;  2HZV A;  1Q95 G;  1XQI A;  2XMT A;  3ZTQ A;  4U9R A;  3WHI A;  1X31 C;  3IBC B;  1JLF A;  4F8R A;  2B4P A;  2BKO A;  5H9F J;  3M8Z A;  1OSD A;  4TU9 A;  2PEH A;  2WON B;  5IFM A;  5L8R C;  4GC6 A;  3N4W A;  2D7S A;  4IG3 B;  5L39 A;  2CZ4 A;  4K4W A;  4F3M A;  1XTZ A;  3AAW B;  1HMV A;  4OZ1 A;  5KFM A;  3OHB A;  3QIP B;  3M8Q B;  3D28 A;  5D15 A;  3QSI A;  3EDQ B;  4GVB A;  1TKX B;  3KFW X;  2HIY A;  3T1H F;  1N6Q B;  1RP5 A;  4DX5 A;  3BQ2 A;  2FYX A;  1ZAV A;  3MPD A;  3PKY A;  3ISN C;  1RT4 B;  2VIC A;  5CH7 B;  2KVI A;  4ED5 A;  2IAJ B;  1E6V B;  2Q79 A;  4KRW A;  3B82 A;  2F9J A;  4DCO B;  3EVM A;  2RAQ A;  4KBI A;  4FYW B;  2F9D A;  2CPH A;  2X7I A;  4HDH A;  1XN9 A;  3GTY X;  1PIE A;  2XLJ A;  1NDK A;  1TU0 B;  2A2D A;  2CPZ A;  4ZPW R;  3N28 A;  3JAM Y;  1FJC A;  2R7Q A;  4X4S A;  2H48 B;  1HWI A;  1HR0 J;  1VIX A;  1GMU A;  1UJ6 A;  4ZP8 A;  2AHO B;  3ETO A;  1FKO A;  3AA8 A;  2KKH A;  2DPJ A;  1F5B A;  2BW2 A;  1RAO A;  2ZZN A;  1RAE B;  2MJN A;  4LFC F;  2CQ2 A;  1XR6 A;  3NWG A;  2WBM A;  1SKR A;  3UR3 C;  5DG9 A;  1D09 B;  3BDP A;  1GQE A;  1TUW A;  2L08 A;  5KG4 A;  2B9X A;  2EFQ A;  1FT8 A;  1MNE A;  3CNQ P;  2NR0 A;  4K0K F;  4PUO B;  5T7L B;  2LXU A;  1LNQ A;  1WKJ A;  4GC7 A;  3MMB B;  5KFC A;  4EMD A;  2QA2 A;  1NSK L;  1GXU A;  1HNX F;  2YQ3 A;  4JI6 J;  1SPB P;  3H2V E;  1SUQ B;  5M2R A;  2N7Y A;  2OI2 A;  1UPM B;  3DU6 A;  3I4P A;  3IO1 A;  1HPZ B;  2EFO A;  3MCO A;  1TKT A;  2WSE C;  4DPT A;  4M5G A;  4QWA A;  3H5Y A;  1LWF A;  2LXI A;  4JI3 F;  4U7U D;  3PHE A;  1FRL A;  2ABY A;  2DRB A;  2EG2 A;  1PSD A;  4LF5 F;  5G0R B;  4QR0 A;  1BQN A;  2CAJ A;  3TZY A;  1Q78 A;  2YTC A;  1MN7 A;  1NUE A;  4WU2 A;  1QTM A;  3PFE A;  4YR2 A;  3FUY A;  5LOQ A;  4DQS A;  3D1O A;  3RBX A;  3H2L A;  4X64 J;  2BE2 B;  1WG5 A;  2CKW A;  4RUA A;  2MQQ A;  3IWL A;  2PN6 A;  4OX6 A;  2XLK A;  2ZJQ Q;  1NPK A;  3FSX A;  3BO2 A;  3WQP A;  3PX4 A;  3OR1 B;  1RAF B;  1WD6 A;  4JI2 J;  4ZVR B;  4C0O C;  4U7C A;  2NSC A;  4ECV A;  3RAQ A;  2VA3 A;  3PIP Q;  4DR3 J;  1U47 A;  3HK2 A;  4F26 A;  3DLJ A;  4URS A;  4DDF A;  4HTI A;  2HFS A;  3O8W A;  4AL6 A;  4RW7 A;  1BHN A;  4ICL B;  2OFG X;  4ECX A;  3Q89 A;  4NCB A;  1VQ5 S;  3D0G E;  4EK2 A;  3C15 A;  3T3F A;  4MKY A;  3OXG A;  2VG6 A;  5FLX Y;  2V2Z A;  1AZS A;  2IY5 B;  3PFO A;  2JNJ A;  2JVR A;  4NML A;  5LSO A;  4ELV A;  5J2N A;  2WVF A;  2HFO A;  2Y1I A;  4P10 A;  4YB6 A;  1GXL A;  3SFU A;  2GA7 A;  3I9V 9;  4UOC A;  1FFG B;  2R2R A;  1T05 B;  2ZD1 A;  3HFV A;  3M30 B;  3VAG A;  4M5I A;  3U27 A;  4ZHR B;  3E01 B;  2CPI A;  4ED6 A;  4IH5 A;  4I2P A;  2CQB A;  2DKO B;  3HKW A;  1UPP A;  3KDO A;  2MKJ A;  1BQM B;  4UOF A;  3GV8 B;  3DI6 B;  3MTK A;  4LFB J;  1ZET A;  1G4C A;  1Y3K A;  1KLN A;  2XI2 A;  2DIV A;  2DY1 A;  1S1T A;  4LRE A;  5A76 A;  2E1C A;  5AXL A;  1YDL A;  1G6B A;  2HFZ A;  4HAC A;  1RT2 A;  4KPC A;  3CMA S;  1OQ6 A;  2KG0 A;  3UQS A;  4KT0 C;  3JXO A;  3GB0 A;  2ZEJ A;  2DXD A;  5DET A;  3HHD A;  2EC2 A;  5AXK A;  1T9W A;  1F9E B;  1BGX T;  2QL5 B;  1WC5 A;  1SKS A;  1H98 A;  3MF5 A;  2WVE A;  1DAR A;  2CFX A;  4RW9 B;  2EFG A;  1RTH B;  2K8G A;  4LF8 F;  1MU2 A;  1VYA A;  5CYQ B;  4IO1 A;  2ZJP Q;  3UCZ P;  1CS4 A;  2IMW P;  2YNH B;  3MXH P;  2LEA A;  2XWX A;  4YR3 A;  3EX7 B;  4X4O A;  2HQI A;  3H8Y A;  5E3P A;  4YQW A;  4JI0 J;  2VF3 A;  1NJZ A;  2CRL A;  4USK A;  3J81 U;  3SDE A;  3GP9 A;  3H4D A;  3LP0 B;  3MPV A;  2WAQ D;  4ED7 A;  2LEB A;  1DTQ B;  4DCP B;  4QYR A;  4OFZ A;  2J7K A;  3CED A;  1WI6 A;  4NCG A;  2FHM A;  3DHX A;  4H4O A;  3W9J A;  1ZA2 B;  1Y5I B;  2ZNZ A;  1EP4 A;  2XUL A;  1X4D A;  1UET A;  2L9N A;  2BAC A;  4ILR A;  2UP1 A;  2CDQ A;  2BZ2 A;  4A8O A;  4KKO A;  2BJD A;  3OT9 A;  2RU9 A;  5C24 B;  2BMB A;  1HNV B;  2WSF C;  1YJR A;  1XC9 A;  2D9P A;  1I94 F;  3EE3 A;  3P49 B;  3OD2 A;  3LO3 A;  4F0H A;  4OZ2 A;  5L1J A;  3SCK E;  2B3T B;  5AXM A;  1Y7P A;  3HPO A;  3UN3 A;  4HR2 A;  1G3O A;  5C2C A;  3EYZ A;  4CLP A;  3BQ0 A;  4LFC J;  4EU0 A;  2CWX A;  4UY8 5;  3M1V B;  4KH1 B;  2GJ2 A;  2V2Q A;  2LQB A;  2QJ3 A;  4Q44 A;  1EJ7 L;  2KVQ E;  4K0K J;  4BLG A;  3N5F A;  1Y3J A;  4LRF A;  2NS1 B;  4ZVH A;  2O67 A;  5KOX A;  2Y0S D;  5AXN A;  3DHW C;  3M6V A;  2PO4 A;  4ZDN A;  4OX7 A;  1HNX J;  1UVN A;  1B4S A;  1W2B R;  2E1P A;  5DDR C;  3OSN A;  4HHJ A;  1H7X A;  1X4E A;  2QLX A;  2KL8 A;  1S7H A;  4USV A;  1JLC B;  3R97 A;  1LFP A;  1RT1 A;  4OX9 F;  4BWM A;  4JI5 F;  4IUF A;  4KGK A;  4N5S A;  3G8S A;  2HHW A;  3UPF A;  4QWD A;  5DZ7 A;  5HAN A;  2HVD A;  1GAO A;  1ZH5 A;  1RBO B;  1P9Y A;  1JLG B;  4NPO A;  5DQH A;  5GMK a;  2DXF A;  1X7V A;  3NG8 A;  3CT9 A;  1HQ2 A;  4CLY A;  3AFG A;  1RWK B;  1XJW B;  1SJ4 P;  3D67 A;  1RA6 A;  3PM9 A;  2NXC A;  1FRJ A;  1EQM A;  1T0T V;  5LT5 A;  3Q8Y A;  2V4J B;  1SKU B;  2DHH A;  2MKK A;  3EZO A;  4F3Q A;  3M9O B;  3KK2 B;  2ZUG A;  2H5E A;  4ZN1 A;  3H20 A;  1FXL A;  4FBU A;  1U24 A;  1N34 J;  1CEZ A;  3KK3 B;  4NYZ A;  3GR0 A;  5A8W A;  2C2O B;  3MZI A;  2KYZ A;  2NYI A;  2R7X A;  4UY8 T;  1X5P A;  1XNR F;  1UZD A;  5EUH A;  2F4V F;  4ZVS B;  4WP9 A;  4B3S J;  3JTO A;  5J2M A;  2R7V A;  4FZV A;  2CZV C;  2XS2 A;  3KJV A;  3G6Y A;  1V3Z A;  2Z57 B;  3S7R A;  2CG4 A;  3DOM B;  2F63 A;  5KFG A;  1TK5 A;  3AH6 A;  5IT0 A;  1KR4 A;  1KOO A;  2DGU A;  4NRU A;  3TAR A;  1CJV B;  2QX0 A;  1VK8 A;  1URR A;  4MYT A;  3UVJ B;  4JYA J;  4QQB A;  4IFY B;  4K4X A;  4QBU A;  2HMI A;  4GVL A;  3ZZY A;  3SBM A;  1L3T A;  2J9E A;  2NXJ A;  4A8Y A;  3W2V B;  5HRO B;  3CXC R;  2PSZ A;  1UL3 A;  3V4M A;  2GGP A;  3GYX B;  1N32 J;  1SC1 B;  3L4B C;  1RHU B;  1W2I A;  3A1Y G;  1NJY A;  1LOU A;  2GQQ A;  4IQX A;  3LTO A;  2W7A A;  5J1P A;  2FDN A;  2ZH8 A;  1RIS A;  2J6T A;  2B9Y A;  2V63 A;  4LF8 J;  2QLF B;  4DR6 F;  4DX8 H;  2OSQ A;  1D8Y A;  2AW0 A;  3JQK A;  3HP6 A;  1NZA A;  5LSL A;  1Y4Z B;  1JLE B;  4YEA A;  3GMG A;  1HIY A;  4I6W A;  3UDC A;  3H0P A;  3C2P A;  1LWC B;  4NCA A;  2VU5 A;  3M8P B;  2OPQ B;  3MM7 A;  4USU A;  4GKJ F;  1TV6 B;  1X5S A;  1K0V A;  2XYH B;  4PR6 A;  5M2P A;  4DUY J;  3JYT A;  2LQ9 A;  2D3O 1;  1HNZ J;  4G6V B;  3BJY A;  3DGV A;  4R5P A;  1DLO B;  4A8W A;  4ENO A;  2YX1 A;  4CLW A;  2GIF A;  5E3C A;  2PD1 A;  3B4M A;  5I3P A;  3R3T A;  4UOG A;  1T94 A;  1YRU A;  4CYU B;  4F7V A;  1OY6 A;  2VPZ B;  3B54 A;  2XNQ A;  3EZ5 A;  3CCQ S;  4DPW A;  2EFN A;  5KFJ A;  1I94 J;  3JTN A;  4OZJ A;  5U47 A;  4WFX A;  4ANC A;  2P6T A;  2I6W A;  1L3K A;  2BJ1 A;  4QWB A;  3ENA A;  4IH7 A;  4OZL A;  2YWG A;  2AMC B;  3CCU S;  2RUS A;  1U8W A;  2YKO A;  3FGV A;  2BEF A;  4CH0 S;  3GFY A;  5H9E K;  1HBU B;  5BYQ A;  3J81 Y;  3UE2 A;  1R0B G;  3UN2 A;  2I0X A;  3G71 S;  1XMO F;  1IBM F;  2F3J A;  3LAN A;  4HHH A;  4DV3 J;  4N41 A;  2JEJ A;  3DM2 A;  2B43 A;  1FRI A;  2DEI A;  2EI5 A;  3EZU A;  1SVD A;  4JOU A;  4LF6 F;  4C48 A;  2CPY A;  1Q16 B;  3NNA A;  2B6A A;  2AGP A;  4DV5 F;  1WI8 A;  3Q24 A;  3OV7 A;  1GX6 A;  1M1G A;  4K8R A;  1RTZ A;  5F8M A;  2MQN A;  4HI2 A;  5AJ3 J;  5KG2 A;  3FBE A;  3V6D B;  2E7V A;  1AT1 B;  2P9C A;  2CQC A;  2JFK A;  3GIJ A;  1RAA B;  2DY9 A;  2GVD A;  4FBT A;  4ECR A;  4B02 A;  2D9O A;  1JNZ B;  1AUD A;  2KZZ A;  1A7G E;  1Q7L B;  4A8K A;  2AZ1 A;  2O01 C;  1SB6 A;  3CDW A;  2ZH2 A;  1TL5 A;  3LUY A;  4Y3C A;  4DF4 A;  3DLK B;  4Q7A A;  2J7W A;  1XIQ A;  2QA4 G;  4OV6 A;  2ZDO A;  5HAO A;  4RW8 A;  4DR1 J;  5K20 B;  1LW2 B;  2C2E A;  1WKK A;  1RWU A;  4NLW A;  4ETZ A;  1HWL A;  4Z37 A;  3BPD A;  4L73 A;  3HHL A;  1FK9 A;  1SH3 A;  4MIA A;  1WUU A;  2CIM A;  1JLB B;  5A0Y A;  3KXD A;  1HNI B;  2YKQ A;  1EAY C;  1QLN A;  3RG6 A;  2OD6 A;  1RHM B;  5B0D A;  2RVJ A;  5A8R B;  3N6L A;  1S1X B;  2IVM A;  4ZLP A;  1ZS6 A;  2OML A;  3ZXW A;  2MB0 B;  4HTJ A;  1YZ7 A;  4AFF A;  2HBR B;  4WK1 A;  2GZO A;  3TUP A;  1WJ9 A;  3C6T B;  2F1F A;  4O3N A;  2KB2 A;  2M70 A;  1S9F A;  5IXU A;  5I3Q A;  3MUM P;  3A3N B;  2KTQ A;  5DZ6 A;  3BGR A;  4I7F A;  2CAD A;  1EIY B;  4CH1 A;  2XGP A;  4PG8 A;  3OTE A;  5EGY A;  4J9N A;  4NLT A;  1VDH A;  3MM5 B;  2AJ2 A;  2ZDP A;  4C8L A;  1WHX A;  1VQ7 S;  3MHY A;  1T9X A;  1TUV A;  2JLF A;  2HS0 A;  2PI5 A;  1JLF B;  4M95 A;  2NYH A;  4M94 A;  2HHQ A;  2E5L J;  1QJH A;  1S4F A;  5E3A A;  3KHG A;  4DSI A;  1QDU B;  1MWY A;  1RAD B;  2LCW A;  4Y00 A;  3DLE A;  2W2Q P;  1HMV B;  3WBZ A;  3K58 A;  1SI9 A;  1SJF A;  4IDK A;  1U48 A;  2MLZ A;  1BQX A;  4GVB B;  3AD7 C;  3F0N A;  1DUR A;  4G3I A;  1H2V Z;  4OYO A;  1GTE A;  3DXS X;  4HH0 A;  4MYU A;  3HHK A;  5KFZ A;  3DRR A;  4HI1 A;  2X3D A;  3ULH A;  4N8N A;  4A4J A;  3X1L B;  4DR6 J;  2IBO A;  2XC9 A;  4QOT A;  3HD1 A;  3KUG A;  2BM1 A;  3NP5 A;  2VHG A;  4FXV A;  2VON A;  4DV0 J;  1G2E A;  1N33 F;  3RAM A;  1FRM A;  2H5I B;  2CVI A;  5EX0 A;  4FN5 A;  1U26 A;  3G8Q A;  4DV1 J;  4LBP A;  2HHU A;  4F25 A;  2Y0B B;  2C3U A;  2ROG A;  2RQ4 A;  4J9P A;  4KYZ A;  4NXM J;  3HVA A;  4UTG A;  2AD9 A;  1Q81 T;  3DNC A;  4FYX B;  5B0A A;  4LUB A;  1F9H A;  1MLA A;  2E9R X;  4NYP A;  4A47 A;  3OFG A;  2C3Y A;  4WXO A;  3GU0 A;  3OFH A;  4X2B A;  4P71 A;  2PFF B;  3IGN A;  3BBC A;  5L1L A;  1FKO B;  3DYA A;  2ERR A;  3KMQ A;  4ZLJ A;  2LQ5 A;  5BR8 F;  2C3O A;  3GIK A;  3BS9 A;  4LF4 J;  2KU7 A;  4S0M A;  1B7Y B;  3M7V A;  1FX4 A;  1J2V A;  3ZC4 A;  1WF2 A;  3F44 A;  1WAC A;  2B8P A;  1S10 A;  1N36 F;  1TL3 A;  2YKM A;  4XK8 C;  1RGV A;  3GJQ B;  2HSE B;  3G87 A;  5CHC B;  1BE4 A;  3P96 A;  1QUP A;  1SH2 A;  1KSP A;  1BWE A;  2UUT A;  2HRU A;  3GJT B;  4ECZ A;  2I2Y A;  1UAW A;  3QMQ A;  1H6K X;  4NLO A;  4DR2 F;  1KTQ A;  4OYZ A;  5KFY A;  1XMO J;  5K8N A;  2QIF A;  4DI6 A;  2R8J A;  2VA2 A;  3VAI A;  3PIO Q;  4BDP A;  2B0G A;  2CQ0 A;  5KFR A;  2AYG A;  5DLG A;  2HW3 A;  3AXK A;  1DFD A;  1YKW A;  1M1K T;  3QGI A;  1RBA A;  1TKT B;  2GC8 A;  5GAE I;  1R27 B;  1G7C B;  1PG5 B;  1LWF B;  3LGN A;  4Y2I A;  3MED A;  4OI0 A;  4DV5 J;  2B9W A;  2UV8 G;  4HL9 A;  2QE5 A;  3HMJ G;  4KHP J;  1PYO B;  3QAT A;  3W64 A;  1BQN B;  3FEX B;  4B9U A;  2N82 B;  1FD2 A;  1S99 A;  4KC5 A;  2VB6 A;  4UUX A;  4C0H A;  1YI2 S;  1RYS A;  1UWB A;  3ILI A;  1HQE A;  3TAN A;  2SXL A;  4IRD A;  3T1A A;  4KTQ A;  4DV6 F;  1X60 A;  1SQG A;  3ILL A;  2BYC A;  2XHC A;  2LMI A;  1WDT A;  4DU7 A;  2XCP A;  1RSC A;  3PZP A;  1CVJ A;  2YVS A;  3HHN B;  2WCX A;  2E1R A;  3AXM A;  2K7J A;  1N0U A;  5ETM A;  1NH8 A;  4NLD A;  2NXN A;  1RQ0 A;  5GAD U;  2DIS A;  3W2W A;  2WRM A;  4RW7 B;  1XR7 A;  4KFB A;  1AA1 B;  3OQ2 A;  1A0O B;  1XNQ J;  1UVM A;  4DUZ F;  2I5J A;  3C15 B;  2R7U A;  3T1Y F;  4J9U E;  5FII A;  1GMW D;  3D0I E;  2BAN B;  2H9Z A;  4QWE A;  4CO5 A;  1NB2 A;  2DHS A;  2VG6 B;  3I4H X;  5KFW A;  2ZM6 F;  3MCS A;  4UQG A;  3CIM A;  5J2N B;  3P45 B;  4ZIV A;  4JI1 J;  5F9L A;  1C0U A;  8ATC B;  2DNO A;  4C97 A;  1FDA A;  2J6U A;  3A8I A;  2ZD1 B;  1FVS A;  2WON A;  1DQA A;  4LF1 A;  1HI8 A;  4I2P B;  3FEZ A;  2Z2Y B;  1R6V A;  4Q2M A;  1Q82 T;  3KJF B;  3M8Q A;  5IM0 A;  4WXW A;  4LIR A;  1KKH A;  1S1T B;  1NLK L;  3ISZ A;  3PNI A;  2CQG A;  2O3D A;  4YY3 F;  4HAC B;  1RT2 B;  3TUJ C;  3EWG A;  4P72 A;  2HND A;  4C6A A;  4LVO P;  4JV1 A;  2AIR B;  3I0R A;  2C2M B;  3TAQ A;  2RKI A;  3SCL E;  2DPI A;  3UW1 A;  2OPS A;  1MMN A;  2AGQ A;  4NEY A;  4LF9 F;  2Y8Y A;  4IRK A;  4CO4 A;  3IGV A;  3S1T A;  1S48 A;  2WVD A;  4DL5 A;  1CS4 B;  1VLO A;  2YX4 A;  3GFH A;  5BYR A;  3VVT A;  2FJX A;  3CB4 A;  1U0S A;  1TKZ A;  2ZH1 A;  4R0E A;  2RF2 B;  1R7I A;  1UVK A;  3LQV A;  3RRG A;  3SDE B;  5KFP A;  1ZM9 A;  3KWM A;  3ZZ0 A;  2Z0G A;  2MHE A;  2CJX B;  2YPZ A;  1IKX B;  2ZJR Q;  4F04 B;  4NE9 C;  1QVG R;  4DZ6 A;  5CYJ A;  3AD8 C;  3HDS A;  3N0V A;  3PY8 A;  4NCG B;  1YIT S;  4H4O B;  1RCO B;  5L1K A;  8RUC A;  1SJ3 P;  1EP4 B;  4EZ9 A;  3UR0 A;  3VZI A;  2ZVI A;  3QJL A;  3K5M A;  5DM6 Q;  1KC8 T;  4KKO B;  2E5G A;  3BPS P;  3VWS A;  4JV0 A;  1I51 B;  1U2C A;  4DQP A;  1FNO A;  1FJG F;  2KO1 A;  2GMJ A;  4LRA A;  4LRC A;  1XR5 A;  4PWW A;  3NGS A;  4M5M A;  3N01 A;  3ZZU A;  4P2X A;  4YS2 A;  2NPF A;  5J2Q A;  2MZ1 A;  2R7S A;  2FLN A;  5BR8 J;  3UO0 A;  2J0Q D;  4DR5 F;  4MK9 A;  4HHU A;  2EW9 A;  4FYD A;  4B9T A;  1EQ0 A;  3NNC A;  5E2Q A;  1LK7 A;  2MKC A;  2J9D E;  3L95 X;  1X4F A;  3MCM A;  2DNK A;  4PYA A;  1DHM A;  4CQ1 A;  1KQS R;  1P6T A;  5DQI A;  3GON A;  2H5J B;  2HLT A;  2MZT A;  1RWV B;  1HBN A;  3IM8 A;  3DLH A;  2FHO B;  3VAL A;  3CO0 P;  4DUT A;  1HKA A;  3C14 A;  3QID A;  2B4V A;  2R2T A;  3QWU A;  2MXY A;  4O0N A;  2ZH5 A;  2UXD F;  1RT1 B;  5A6P A;  1JKH A;  1UKU A;  2CNO B;  2VOO A;  2H4W B;  3W9H A;  4DG1 A;  2AYB A;  1YBU A;  4W4M A;  1Q86 T;  4FS1 A;  4YB7 A;  3BH6 B;  3NMA A;  2E1M C;  2A3J A;  1NND A;  5ADZ A;  2F7V A;  4ZK7 M;  2WK4 A;  4I67 A;  2DGO A;  1S0N A;  3OTO F;  3WIV A;  4NLU A;  2CUY A;  1WF1 A;  2F40 A;  4P52 A;  1KNZ A;  2C1E B;  4OJ3 A;  2VQF J;  1OMS A;  4MAK A;  1T8E A;  3R5D A;  3K5O A;  2AYE A;  4ED4 A;  1WHV A;  3OVS A;  3EGW B;  4ED3 A;  3D6H B;  1O0P A;  3M8W A;  3A8E A;  3GYN A;  1HNW F;  3ADA C;  3AB2 B;  1TMJ A;  1M1H A;  4X84 A;  1FXD A;  4LFA J;  3JS9 A;  4MIW A;  1Z2L A;  1YJU A;  2VPY B;  1RJJ A;  1NKE A;  1H7W A;  3KUH A;  1YVF A;  3KYL A;  3MPY A;  4J9S A;  1NKC A;  3RJM B;  2RQM A;  3C19 A;  1NB7 A;  2FY1 A;  2IBK A;  2XBP A;  2Q66 A;  5LSR A;  5A8W B;  1O51 A;  3W60 A;  5HMY A;  2HNZ A;  2KZM A;  2OO4 A;  2ZUA A;  2DR6 A;  2QL7 B;  2QFI A;  2AZ3 A;  3VQS A;  3LW5 C;  2HZC A;  4DUZ J;  4DSL A;  3TJA A;  1K9M T;  4KSE B;  3T1Y J;  2XZT B;  5J2M B;  3CJ2 A;  1U09 A;  1AXQ A;  1IM6 A;  3IFE A;  1BQM A;  3JSY A;  3I5C A;  2EC0 A;  5CZV A;  4ECW A;  1VFJ A;  3U02 A;  4ZKA A;  1F6T A;  3DMJ A;  5A8K A;  2BBE A;  4DX6 A;  2OHD A;  2B7C B;  3MM8 B;  5AT1 B;  4BC9 A;  3PEJ A;  4ELT A;  3HM9 A;  3JSR A;  2V6A A;  1IR2 A;  5J1E B;  3ZTP A;  3Q8Q B;  1YJT A;  2HRT A;  2QG9 B;  2V2V A;  1I6J A;  5I3U A;  1K0T A;  5LJ3 Y;  2HMI B;  5RUB A;  1EB0 A;  4Y0F A;  1ZM2 A;  2EBG A;  2UUB F;  4RW9 A;  2DTJ A;  3PHT A;  2K3I A;  3GV7 B;  1ZAW A;  2MLX A;  2KI2 A;  2CPF A;  2KYX A;  2HBZ B;  2G2Y A;  3W8G A;  2CJK A;  3QZ7 A;  1S5Z A;  3SSQ A;  2BJ9 A;  2V4Q A;  2HWH A;  3WX4 A;  3TEG A;  2DGX A;  2DGV A;  2FJE B;  2H65 B;  2NXU A;  5D3G B;  3RZA A;  2PEB A;  5EDW A;  3BV8 A;  2QEX S;  3CE8 A;  4X4V A;  1PAE X;  2EBE A;  4EUV A;  4WU3 A;  1DTQ A;  1RWP B;  1JK9 B;  1OJ4 A;  5GAG U;  1ZBT A;  4X62 J;  3TW0 A;  4WCE Q;  2MQO A;  1KTV A;  4B08 A;  3PW2 A;  5B09 A;  4O23 A;  1VQM S;  4JB8 B;  2FGO A;  4K4Z A;  1CC8 A;  2HQD A;  2HS4 A;  3LWL A;  3L7U A;  5IV3 A;  2CPJ A;  1DQ8 A;  4CRJ A;  4KGZ B;  5KG3 A;  4DBQ A;  3KLG A;  5KG0 A;  3MM7 B;  3UN5 A;  2MQL A;  3HSJ A;  2HPU A;  2M8D B;  4X4R A;  1ZTW A;  4HDG A;  3JYT B;  4DPU A;  1U6B A;  2X1B A;  2FGC A;  3A4T A;  2RE1 A;  2ADC A;  1TTH B;  4AUK A;  5E3R A;  2KT5 A;  1W7W A;  2YNI A;  1QM9 A;  4OX8 A;  3ONQ A;  3E2E A;  1J27 A;  3K8W A;  1JXV A;  5DM7 Q;  3P5B P;  2FZG B;  2J7U A;  2M2B A;  3DXB A;  3M4X A;  4LSL A;  3J80 U;  4YUD A;  1VQ6 S;  2EKY A;  1Q53 A;  4I4B A;  3MAQ A;  1R8H A;  4ZVU B;  4ECY A;  2CJY B;  3JQM A;  2ASL A;  2NSB A;  2VG7 A;  5IQQ A;  3FRZ A;  4XDD A;  3ZNU A;  3MGJ A;  3M2R A;  4WP8 A;  3GZ7 A;  4DXL A;  1FD8 A;  2ROP A;  3WX8 A;  2P9G A;  2U2F A;  1R43 A;  1JLC A;  3PDN A;  2DHG A;  1HYS A;  3ZZT A;  1UFL A;  3DM2 B;  4YHH J;  5FJ4 A;  3W66 A;  4DL3 A;  3GSI A;  3QNW B;  3ET6 A;  2MSS A;  3PX0 A;  2BOP A;  4EZ6 A;  1IBK F;  4WFY A;  2IPO B;  2X1G A;  1CQN A;  3WDO A;  1S0M A;  2QA4 S;  3PAC A;  4K7Q A;  3MMA A;  2AX0 A;  2HNY B;  3PW0 A;  1HL6 A;  2PA8 D;  3CCM S;  2UXD J;  2GVD B;  2OMO A;  4OYM A;  3RTV A;  2BA9 A;  1N0V C;  2V4J A;  4M5J A;  3SZ2 A;  2XM3 A;  4KJI A;  5A2Q U;  2IDL A;  3KK2 A;  3DC2 A;  2AGO A;  3C46 A;  2DGT A;  2Q1L A;  2ILZ A;  3W5Z A;  4RW8 B;  4O44 A;  2V0N A;  2G2Z A;  1U1O A;  3W9I A;  1SBR A;  3HHL B;  1FK9 B;  1JJ4 A;  3W65 A;  2BJE A;  4ZOS A;  4WYW A;  3RW7 A;  2VL1 A;  1FDB A;  4K4V A;  5A0Y B;  2IFX A;  1S97 A;  4B3M J;  1V5V A;  5H9E J;  2IC3 A;  3K89 A;  5THW A;  3WZ0 A;  6FD1 A;  4W98 A;  2IM3 A;  1WOS A;  3EVW A;  4ZCL A;  3QRP A;  4DV4 J;  3UNY A;  4ZLL A;  2HBQ B;  4RW6 A;  1I3O B;  4OMF G;  2PA3 A;  2FHJ A;  1RZM A;  2VC0 A;  4B9M A;  5IC6 B;  5GAH I;  1VHF A;  2AV5 A;  5ETT A;  4M5L A;  2A1B A;  5DDO C;  4XO0 A;  1NZ8 A;  1IKY A;  3KDN A;  4B9N A;  3HVT A;  2PMH A;  3GFX A;  3R5G A;  3OFF A;  1TP7 A;  2XSJ A;  5CQG A;  2YQ1 A;  3RB6 A;  4NLS A;  3BGR B;  4I7F B;  3R8Y A;  3R7B B;  3VAM A;  1XWL A;  3THV A;  3BBF A;  1MN9 A;  4X4U A;  2AEJ A;  4KY3 A;  2ZNY A;  2WZ1 A;  2V2K A;  1VCT A;  3K7R A;  2W2P P;  3IC1 A;  5HP1 A;  1GT8 A;  2BRL A;  1FFW B;  2V8D A;  4DCJ B;  2V8H A;  4C8N A;  2RU3 A;  1IN0 A;  1RA7 A;  1VR6 A;  1H72 C;  1Y0H A;  1VJW A;  1S4E A;  4ZVE A;  3CDU A;  2VBW A;  4CLZ A;  2PT0 A;  2XMM A;  1JIH A;  2OD4 A;  4LVN P;  5D0E A;  3MR3 A;  3MMC A;  4YDX A;  4Z7Y A;  2UUB J;  2AWZ A;  2YX7 A;  4NMX A;  1UZH A;  5CZX A;  3DLE B;  5LM7 E;  3LP2 A;  3TAP A;  2GHV C;  4F4X A;  2CPD A;  3M6X A;  5KFU A;  4IDK B;  2DXE A;  1JLE A;  4DR4 J;  1PJ6 A;  4CO0 A;  4F3O A;  2MQM A;  3ITH A;  1S6P B;  4CTA A;  1CBK A;  3BGL A;  3S6E A;  1ZZF A;  2OPQ A;  1NK5 A;  4XTT A;  4ZJL A;  4PPZ A;  3IR5 B;  3DRR B;  4NOH A;  2UU9 J;  1FEH A;  1YJN S;  1M5S A;  1WOP A;  1HR0 F;  2CJA A;  1F2H A;  1X4C A;  3VAF A;  1NJW A;  2MLY A;  4JI4 J;  1J5O A;  3T6B A;  4P73 A;  3D2W A;  1WHW A;  2MY7 A;  1K73 T;  2DNG A;  1FKP B;  2MZJ A;  3NGR A;  3H90 A;  4C3L A;  2O1P A;  4B9L A;  1N4L A;  2L9D A;  3BYP A;  4KB7 A;  3THT A;  1W26 A;  2R42 A;  4CLF A;  2X51 A;  3H42 A;  2W1B A;  4F36 A;  2MY8 A;  5K14 A;  1ZAX A;  4OI2 A;  2KXN B;  4O3R A;  4URG A;  3DYA B;  5KFX A;  1B0P A;  2Y8W A;  3M6W A;  4MH8 A;  3KK1 B;  5KFA A;  2KRB A;  4RUB A;  5L9N A;  1JJC B;  2UUC J;  4I2Q A;  4HKQ A;  1ELO A;  2VPW B;  1MWQ A;  2GML A;  2FJB B;  4EBC A;  4TXS A;  3FQK A;  3MD3 A;  1TL3 B;  2YKM B;  3TQ1 A;  3M2V B;  2WHO A;  3MWB A;  3NCR A;  4USI A;  4EBD A;  4NLY A;  3AOD A;  2GJF A;  3LF0 A;  3RRK A;  3V6D A;  4J7C A;  3NAH A;  3CJR A;  4C9D A;  2N3O A;  3US5 A;  2DO4 A;  2KRR A;  3BKT A;  5EWE A;  1MSW D;  3NS6 A;  3AJ1 A;  4RX6 A;  4OI3 A;  4DR7 J;  4X64 F;  2UZA A;  2CVE A;  3DDN A;  3MED B;  4RNM A;  3T5J A;  2IRX A;  5IZH A;  1VQO S;  2PGC A;  5DG7 A;  5B08 A;  5GME A;  3G2X A;  4JI2 F;  5JMN A;  1VMB A;  3K59 A;  1CG2 A;  4DR3 F;  2VKZ G;  1HW8 A;  4MT1 A;  5F8G A;  1UWB B;  3BN4 A;  1RHK B;  1HQE B;  1RLD A;  4Q2L A;  1HD1 A;  4CZC A;  5LMU J;  1FWP A;  1M5K C;  2RRB A;  1NJI T;  4O3S A;  5JVG Q;  4EO8 A;  4PAB A;  3ICL A;  5F8L A;  5HMZ A;  2FZC B;  1X4B A;  1WHY A;  2YY3 A;  2XGQ A;  4U95 A;  2HGN A;  3TX8 A;  4PG7 A;  3DRP A;  3QLH B;  1KD1 T;  3W2W B;  5CCL A;  2CQD A;  4JI7 J;  1CJU A;  5F8J A;  4OZ5 A;  1TUG B;  4LRB A;  2I5J B;  2WB4 A;  5F3Z A;  2LYV A;  4DHV A;  1FTR A;  3TVY A;  1TR0 A;  3BN7 A;  4WKY A;  2DHX A;  5HQ8 A;  2AYM A;  4LFB F;  4MFB A;  2VKR A;  4ZIW A;  5A2Q Y;  3AY0 A;  2B5J A;  1C0U B;  2A6O A;  5B0C A;  3Q86 A;  4ZJO A;  2P9E A;  2FC9 A;  2CQI A;  1I5O B;  2D3Z A;  3AHP A;  2RT3 A;  2WVB A;  3D66 A;  3OR2 A;  2FJA B;  4CT8 A;  2DNQ A;  3V81 A;  2FQQ B;  5IM0 B;  2M3D A;  3RR7 A;  7AT1 B;  4ZP9 A;  2BDP A;  1KBR A;  2HND B;  1B99 A;  1RAC B;  1SQE A;  4JI0 F;  3BQ1 A;  3I0R B;  4B3R J;  2EK1 A;  2RKI B;  2O66 A;  3UNG C;  1T3O A;  1RAG B;  9ATC B;  2OPS B;  2P2C B;  3NAI A;  2MKH A;  1PO6 A;  5C42 A;  3TX0 A;  4IFV A;  3OJS A;  3B8H A;  2VJV A;  3DDK A;  5LJ5 Y;  4P74 A;  3OL9 A;  3VAK A;  3TUZ C;  2XG8 A;  1TKZ B;  2DEJ A;  3BO4 A;  3HHL C;  3T9Z A;  3BB5 A;  2CPX A;  1FDN A;  2BAB A;  2P6S A;  2ZFH A;  3JB9 k;  2ZHB A;  3MI7 X;  3D68 A;  4WFA Q;  3GJS B;  2DD8 S;  1OPZ A;  4EYI B;  1B0V A;  3CUN A;  1EAR A;  3QGG A;  1Q8L A;  3GE9 A;  3UDL A;  4FPR A;  2Z58 B;  2D3U A;  2C2K B;  1IM4 A;  4YDD B;  3BRE A;  2NUH A;  3C3L A;  5HN0 A;  1U45 A;  1HHT P;  4KPY A;  4QIG A;  1VLY A;  5K5M A;  2RS2 A;  2W9A A;  1HI0 P;  5EWF A;  3SXL A;  2YWK A;  2FD2 A;  2UUA J;  2QLB B;  3CGI A;  1S6O A;  3H5S A;  3AD9 C;  1WEZ A;  1YTY A;  4RR5 A;  5F9N A;  1QTN B;  3OVA A;  3PR4 A;  4WZQ A;  5J2Q B;  4PG4 A;  3MTJ A;  4ZVP B;  3BM7 A;  3EIC A;  1GX5 A;  3CJ3 A;  4OI6 A;  2ZHO A;  2RIL A;  5HVH A;  2JFD A;  3DU5 A;  4DJB A;  3HZE A;  2BOA A;  3TRG A;  3M8S A;  4UZB A;  4ECQ A;  3FK4 A;  1LQ9 A;  4Y2M A;  1VC5 A;  4DSJ A;  2D69 A;  1OQ3 A;  1HBN B;  2ZOG A;  1L5U A;  1CC7 A;  5IC4 B;  4C3K A;  3HLU A;  4ER8 A;  1N5V A;  4YFU A;  2IVF B;  1U8S A;  2HLU A;  3C14 B;  3QGH A;  5KT7 A;  4V1A k;  3IR7 B;  5D8H B;  2I38 A;  3DRS A;  2CG8 A;  2W4P A;  2H51 B;  2VC1 A;  1JKH B;  3BKU A;  4DG1 B;  1VQP S;  4PZV A;  3DLL Q;  4ZVT B;  4Y2C A;  2FB0 A;  2CJ9 A;  2QC3 A;  3MM6 A;  4RZR A;  1QSL A;  3CC2 S;  5IWA J;  4J9O A;  1JXE A;  2ZH4 A;  2QLW A;  3CCJ S;  3T19 A;  3HI9 A;  1X4A A;  5SUH A;  2L3M A;  1HBM A;  3R6G B;  4NWB A;  1N34 F;  4PYD A;  4H4K C;  4RLE A;  1S1W A;  4K59 A;  3O44 A;  2CQH A;  2DGW A;  3M6U A;  2HS3 A;  4QW9 A;  2R8I A;  4USH A;  2MKY A;  2DNZ A;  5E0O A;  4E98 A;  3VVU A;  1HA1 A;  4FYY B;  1S79 A;  4B3S F;  1VRU A;  2ASY A;  2D3O R;  2BAN A;  4ZVG A;  3J7Z 5;  1S57 A;  2C2R A;  2ZOF A;  3NWR A;  3MUV P;  2XY5 A;  4Q8F A;  1UJ4 A;  2ZKU A;  2HNZ B;  5KAK A;  5D0R A;  4N77 A;  1IJE B;  1P1T A;  3V6K A;  2HHH F;  1K1Q A;  4KHR A;  4NXN F;  5DG8 A;  1S0V A;  3G96 A;  3CIZ A;  3BGO P;  3KLF A;  4ELU A;  4ZP7 A;  2M0G B;  5F41 A;  4DF8 A;  1NDC A;  1NPR A;  1X9M A;  3P5T L;  2LP4 A;  3K5N A;  5EHH A;  2G0I A;  1EX8 A;  1CUL A;  4JYA F;  4G1I A;  3DMJ B;  4DL4 A;  5A8K B;  3Q2S C;  4ALZ A;  4FF3 A;  1M5H A;  4MTP A;  1KVJ A;  1CQM A;  3RGI A;  3DN9 A;  1FDD A;  4J9M A;  3M8Y A;  2G13 A;  1N32 F;  3MAA A;  1RE1 B;  4C8Y A;  4WK3 A;  5HI7 A;  3QWP A;  2VPX B;  1NSP A;  4RNF A;  2QLJ B;  5I3U B;  3T9N A;  1RT3 A;  1UA1 A;  4C3M A;  3MEK A;  2HAF A;  2BQR A;  3IBF B;  1QAJ A;  3K17 A;  3D9B A;  2JX2 A;  3CW2 C;  4Z2X A;  1F0X A;  3UCU P;  2FLP A;  1YLX A;  4WII A;  1RT5 B;  2RF2 A;  3N79 A;  2PFD A;  3MD1 A;  3IMQ J;  2JRS A;  3R5C A;  5LL6 d;  3E3X A;  2I9S A;  2YXL A;  2NLW A;  4LMZ A;  4RW4 A;  1IKX A;  1RBL A;  1JQG A;  3HT0 A;  4EGL A;  4GMK A;  4Q43 A;  3BR8 A;  4DUY F;  4URQ U;  1HNZ F;  2O5D A;  3VTI A;  1U7L A;  4QR2 A;  3AT1 B;  4B9V A;  5HQM A;  2EWH A;  1UVI A;  4B9S A;  4ES1 A;  4AE5 A;  2EK6 A;  1FE4 A;  2HUR A;  4F4Z A;  4RU9 A;  3HZG A;  4KGX B;  3OW2 R;  1SKW A;  1TL7 A;  2WW8 A;  4QZV B;  2KH9 A;  2Y1R I;  2Z4P A;  3FRY A;  3PX6 A;  1CJT A;  5KFF A;  3KLG B;  3AQP A;  2KJV A;  2RIJ A;  5GAG I;  3FVY A;  1JLQ A;  2ZE2 A;  2JLG A;  2Z56 B;  3FMW A;  1WEX A;  2RS8 A;  3C8Y A;  4EO6 A;  2VZ9 A;  4E8U A;  4O3O A;  2K7K A;  2YNI B;  3F73 A;  1VK3 A;  1VBX A;  3MEG A;  3V2U C;  5LXY A;  2B4O A;  2UUW A;  1JNR B;  2F4F A;  2ZC4 A;  1VQ4 S;  1VOM A;  5H1S V;  4OI4 A;  4J9V A;  5DRK A;  3TA0 A;  1M90 T;  4DV3 F;  1Q5Y A;  2F8M A;  2GJI A;  3N9U C;  4LSL B;  3PJ9 A;  1U2F A;  4O3P A;  3BKF A;  4YR0 A;  2K3K A;  1HWK A;  2Z8Q A;  2XB2 D;  3W7B A;  1LW0 A;  5D0G A;  1MML A;  4LSN A;  3LPY A;  4L76 A;  3Q23 A;  2VG7 B;  3OTD A;  4DPX A;  2E5I A;  3M2R B;  3ILO A;  5AE2 A;  2PE8 A;  3NLC A;  5MAO A;  2HBY B;  3GIL A;  5AJ3 F;  3LH2 S;  4C4W A;  2OP5 A;  5BYS A;  2VFS A;  3NCQ A;  1HYS B;  1HI1 A;  3BGF A;  4K4Y A;  3Q83 A;  5E41 A;  5DJB A;  1RTD A;  3I0S A;  3HJF A;  1RCX B;  3I32 A;  3ET6 B;  4KO0 A;  4IOC Q;  2DJW A;  4Y2K A;  3FZB A;  2COL A;  3FBC A;  1S9G B;  3R27 A;  2KFZ A;  1SL1 A;  2PDA A;  3MMA B;  1NXI A;  4MJK A;  4DR1 F;  1IBL J;  1S77 D;  2QV6 A;  2RH3 A;  4ZCM A;  4WP3 A;  3K5L A;  2AEM A;  2M4M A;  4M5N A;  4TN2 A;  5LMN F;  3EPG A;  4TY8 A;  2FJD B;  5J2P A;  3NY0 A;  3FJ2 A;  3VV2 B;  1YQH A;  4LBI A;  1RHR B;  2ZBQ A;  3W61 A;  3MAH A;  4OYB A;  4LBH A;  1NAQ A;  3IBW A;  5L9X A;  2OH2 A;  4O44 B;  2DB1 A;  3W8P A;  1UW9 A;  4C8M A;  4U7U K;  2HGM A;  2C28 A;  1EKS A;  4G65 A;  4B3T J;  2ZC3 A;  2E44 A;  2HHX A;  1YJV A;  3GIM A;  2Y1L B;  3TVZ A;  3HT3 A;  2BUN A;  3JSM A;  2IC3 B;  1NCL A;  3KUE A;  4NZ6 A;  9RUB A;  3J7Y I;  4UST A;  1SJQ A;  2A18 A;  1BC6 A;  3I82 A;  4LJM A;  1WC4 A;  2D74 B;  5HMW A;  4RW6 B;  1NU4 A;  2R4F A;  2ZHA A;  5KT2 A;  1X4H A;  3MM8 A;  1GNK A;  1IKW A;  3UWT A;  5BJR A;  2HHH J;  3AJ2 A;  4NXN J;  3CD5 A;  1FKA F;  1IKY B;  4BWJ A;  2B56 A;  3HVT B;  5J1E A;  3NBP A;  1TVR A;  2OPP B;  2VG5 A;  2XSJ B;  3PO4 A;  2GNK A;  2BE9 B;  4OHZ A;  3RU0 A;  3P4U B;  4U8V A;  4ED1 A;  2E5L F;  1IKV A;  3RRH A;  4PXD A;  4ATN A;  1WSR A;  4UOH A;  3K0J A;  1UJ5 A;  3SV3 A;  5ETO A;  1K44 A;  1T7P A;  3GG0 A;  2ADB A;  5HP1 B;  3GYG A;  1X5T A;  3MFI A;  4FF1 A;  4PQU A;  3DGP A;  2FC8 A;  3KLE B;  3NGD A;  4K4T A;  4K2X A;  5D3G A;  1GFW B;  2QYC A;  1BY9 A;  4I6Y A;  3KLH B;  3MMC B;  1NRK A;  4KQZ A;  2JLE A;  4GRS A;  1IWA A;  1DY3 A;  5CCM A;  1S0O A;  3LP2 B;  1DTT A;  3MEE A;  4OHY A;  3CJS A;  1UEU A;  1YJ9 S;  3HFZ B;  3ZTO A;  4UUW A;  2P8I A;  4DV0 F;  1XMQ J;  3R5B A;  4OQJ A;  4DL6 A;  2IJF A;  1T11 A;  1X5O A;  1D9D A;  2A2C A;  2HHV A;  2YKP A;  3QBC A;  4J90 A;  2VAS A;  4Z7C A;  3ITH B;  4DV1 F;  4AQY J;  4ITS A;  2BR0 A;  4CTA B;  1NDL A;  2NQP A;  4DZD A;  1IR0 A;  1FNX H;  4DQQ A;  1OYD A;  4F4A A;  1NK0 A;  4WPA A;  1TFY A;  3CCE S;  6AT1 B;  3FCW A;  4NXM F;  1NKB A;  1R8B A;  4Y6I A;  2ACM A;  4DV7 F;  4P7T A;  3G4S S;  3C16 A;  3DOL A;  3QRQ A;  5HBM A;  4FF2 A;  4DSK A;  1J5O B;  5B7W A;  3OLA A;  4G1P A;  4DWI A;  4E2F B;  5ETS A;  4CIO A;  4I68 A;  5AE1 A;  2NUU G;  3PXG a;  3T6J A;  5L46 A;  4W90 B;  4XIU A;  4LF4 F;  3IWN C;  3FEY B;  3KMS A;  3I55 S;  1Y11 A;  3O6Q A;  3ZZZ A;  3EM1 A;  1REV B;  3ZTR A;  2J76 E;  4FVC A;  3MR2 A;  2GO9 A;  1K47 A;  3MM9 A;  1NK4 A;  1VHI A;  1DAX A;  5K14 B;  2GCF A;  2RML A;  1B0T A;  2XMK A;  4DFJ A;  1VC0 A;  1TZ0 A;  2N7C A;  2YNG A;  5HK4 A;  4I6A A;  2DT9 A;  1SIZ A;  4LR9 A;  1JXL A;  2QMU B;  3LAL A;  2XSF A;  1KDN A;  4I2Q B;  1WOO A;  3POT B;  1Y00 A;  2GAH C;  2XMA A;  3HX9 A;  5AE3 A;  3VGV A;  3K5P A;  1IQT A;  4C11 A;  1U6F A;  2XO7 A;  4DL2 A;  2LXF A;  5KFS A;  5KT6 A;  8AT1 B;  1PJ7 A;  4KHP F;  5HLF B;  1KVK A;  2HNY A;  1U25 A;  2XQC A;  3MCN A;  1S72 S;  1U1K A;  3OL6 A;  4EBE A;  3D3B J;  4WTY A;  3IRX A;  1PKU A;  3MUT P;  2W2M P;  2VFU A;  3NGK A;  5ETK A;  4DSE A;  4IYQ A;  5HO4 A;  4KHM A;  3J81 j;  1ROF A;  3CMQ A;  5E33 A;  1WC0 A;  3M32 A;  3QJJ A;  2V50 A;  1VQN S;  2W9B A;  2Q43 A;  2HWI A;  1YJW S;  3ETM A;  3DFE A;  5E5N A;  4AYB D;  1ZM4 A;  2G4B A;  5DS7 A;  5FD1 A;  5LMN J;  3D4J A;  3HHE A;  1OO0 B;  4NLG A;  3CF5 Q;  5HQL A;  4CLT A;  1XER A;  2IM0 A;  2E9T A;  1BD6 A;  1XNQ F;  3KG4 A;  4LT6 A;  3THP A;  1SIW B;  4NA1 A;  2QTW A;  1H73 A;  2J6S A;  1PC5 A;  1ZTT A;  4TVA B;  1O6X A;  4M8L A;  3ZZO A;  2HVZ A;  3LA0 A;  5DQG A;  4NLQ A;  2DNL A;  4ZPD A;  3HSG A;  3DRP B;  4JI1 F;  2JVO A;  3OVB A;  5D4O A;  3DKD A;  1CJU B;  1BUX A;  4K2J A;  3PCO B;  4DX7 A;  2C42 A;  4O4R A;  2AP6 A;  4DPY A;  1MW7 A;  2YWW A;  3R5A A;  4ZA1 A;  2JL9 A;  1U1L A;  3FKB A;  1PYS B;  2IJR A;  3OHA A;  4ZCK A;  3Q8U A;  4MFB B;  4EFA C;  4U67 Q;  2Q6C A;  2XYP B;  1J5E J;  2B5J B;  4C8Z A;  4PAA A;  2Y3Y A;  2UXC F;  1FF2 A;  1PIL A;  2RD5 C;  2RSQ A;  3CC4 S;  1X0P A;  2X1A A;  1RHQ B;  1KLM A;  2VQE F;  5D4P A;  2B4U A;  2KHD A;  4WIQ A;  2BV3 A;  4QIF A;  2VOP A;  2XZD B;  4XDC A;  2EXU A;  5ITH A;  4GKK J;  2NXE A;  3I5B A;  3OR2 B;  3DLG A;  4FPI A;  1Q4R A;  2LU2 A;  2GW8 A;  1PJ5 A;  4MIB A;  3V81 B;  1RUS A;  1U6Z A;  4JBC A;  4CNZ A;  1ZZN A;  1T9U A;  4A46 A;  1KFS A;  4O4G A;  5KFQ A;  3DCA A;  3V5R A;  2XY7 A;  1DBD A;  1S6P A;  1C1C A;  4ED8 A;  3SMZ A;  5GAE U;  4YME A;  4K50 A;  1C1B A;  3EUN A;  1U4B A;  5LXR A;  2AX1 A;  4DEZ A;  1C0T A;  2V9K A;  2YWF A;  2J0W A;  3HVR A;  4F0K A;  1R89 A;  4H4K A;  1YBA A;  3M9N B;  1RT7 A;  4KH0 B;  4RJV A;  5C42 B;  4ID5 A;  5B0E A;  4IFV B;  4LQ3 A;  2UXB J;  1FKP A;  4FYV B;  3VCD A;  1LEO A;  2Z2L A;  3D54 A;  3NS5 A;  3BZQ A;  2PC6 A;  3IN5 A;  1IQZ A;  4KV8 A;  2OKQ A;  3T5K A;  4IKA A;  1YWX A;  1RWN B;  5EN1 A;  1TL1 A;  4DV7 J;  4DLG A;  1LV5 A;  4GO7 X;  3ISN D;  2ALZ A;  3LOU A;  3GIR A;  2BVZ A;  4QR1 A;  3TJ8 A;  3NEK A;  3IS9 B;  4K5S A;  2GQC A;  3B6B A;  3KK1 A;  3M8R A;  1Y10 A;  1S1V B;  3FSI A;  1KOH A;  1D3W A;  2GHW A;  2CWK A;  4FP9 A;  2H54 B;  3UDE A;  3TA2 A;  2MTL A;  1OIA A;  2HK3 A;  1WWH A;  5D78 A;  1TK0 A;  3HHL D;  4Q0B A;  3M2V A;  2GS8 A;  3DDI A;  3RB0 A;  3PYG A;  2W9C A;  3SI8 A;  4OLO A;  4RKU C;  2G0C A;  4QWC A;  1QE1 A;  1WTB A;  3CDE A;  1U2R A;  4NZ0 A;  5KFD A;  4OJ1 A;  2R7W A;  4C8O A;  2GO8 A;  2IVY A;  3CD0 A;  4AXJ A;  2DR8 A;  1Q1K A;  4PQA A;  3HKZ D;  5CAB A;  3CJT A;  1SQF A;  4CH7 A;  4FF4 A;  1FRK A;  4HYK A;  3CJ4 A;  2VUG A;  5T14 A;  3KNA A;  2HQC A;  4KAI A;  1XEZ A;  3CJ0 A;  1CSJ A;  5F8N A;  3A8J A;  3CD6 S;  3IRW P;  4LF7 J;  2F65 A;  1RB0 A;  1U0H A;  2YNF B;  2ROE A;  1HQU A;  2QSW A;  4N56 A;  1FEE A;  2CPE A;  4WFB Q;  3LP1 A;  2Y1J A;  4R0J A;  2VQF F;  4MMO A;  4L3N A;  3DLB A;  3HFK A;  1N52 B;  2CDR B;  3DRS B;  2C2N A;  2Z30 B;  3CDA A;  4L72 B;  2PI4 A;  3AOC A;  4ZVF A;  4EWT A;  4ZPC A;  3PRB A;  1H38 A;  4Y65 A;  5K8O A;  5KTQ A;  3FMB A;  3IG1 A;  1FCA A;  4Q8E A;  3MM6 B;  4LFA F;  1HD0 A;  3GLJ A;  4QJV A;  1HBM B;  3QSY B;  1RTJ A;  1F60 B;  1FE0 A;  1F1B B;  2FPH X;  1AYE A;  2OEK A;  3QLH A;  1S1W B;  2CZ9 A;  3LPE A;  3BYR A;  1WC3 A;  7FDR A;  1RWW B;  3F56 A;  3HUL A;  3R5J B;  4QYZ K;  2JWN A;  2FLO A;  2W7O A;  1VRU B;  4CDI A;  4JV2 A;  4U96 A;  2AJ4 A;  4TLR A;  3HSZ A;  3D5M A;  3CME S;  5IT9 U;  3T1H J;  2KT2 A;  2N3L A;  4X4T A;  3GSD A;  5HAT A;  3HD2 A;  3SQG A;  5B0B A;  1N54 B;  2OTJ S;  2CXE A;  3CWJ A;  3O5T B;  5F8H A;  1TFW A;  3HCX A;  4OYW A;  4QU7 A;  4G1Q A;  4TYB A;  3SV4 A;  2RRA A;  3A8K A;  3PO5 A;  2CQ1 A;  3KLF B;  4F0M A;  4M5H A;  4IG0 A;  3IR6 B;  4J37 A;  2RNE A;  1CUL B;  4HVZ A;  4J9K A;  1KFD A;  2DR9 A;  1NK7 A;  3RUB L;  4Y28 C;  2MQ8 A;  2IM2 A;  2W8K A;  4J9R A;  3PR5 B;  3B78 A;  2KHC A;  2UXC J;  3TZX A;  4KIA A;  4F67 A;  1HHS A;  4V19 X;  1RI7 A;  3FC9 A;  2XS7 A;  2VQE J;  3MAA B;  3SQO P;  3IAS 9;  1V3S A;  4I69 A;  1JMT A;  3M05 A;  2Q3P A;  3NOG A;  4AND A;  2E1A A;  4Q5V A;  1R6Y A;  1RT3 B;  4M1K A;  4RBU A;  1YSJ A;  1RWX B;  3PKM A;  2D41 A;  1VIS A;  4NYO A;  3FFI A;  4X62 F;  2AQ4 A;  3R1H A;  3G9C A;  3MPU B;  1LKZ A;  4HLB A;  2YH0 A;  3KLI A;  2OJ3 A;  1RWO B;  5FDL A;  1GXT A;  5L38 A;  4EYH B;  5C7P A;  4FXD A;  2XCA A;  4DN9 A;  5GMD A;  1K1S A;  3ILJ A;  1V5I B;  2FVQ A;  4RW4 B;  4H4M B;  3R2D J;  2FZK B;  4NL5 A;  4NRT A;  1S9E A;  3LWM A;  4QW8 A;  1B70 B;  1Q79 A;  4ANE A;  2HFV A;  5KFI A;  2YPY A;  1YRX A;  4PCQ A;  1RAB B;  1UMJ A;  1F3F A;  1BXN A;  2JDJ A;  1JLA A;  1TL7 B;  4A8X A;  4P7V A;  3I56 S;  4FKY A;  4JI3 J;  1CJT B;  1HFE L;  1SC6 A;  2LLZ A;  4PWD A;  2GMH A;  1JX4 A;  4AXI A;  3L3C A;  1WTF A;  4C0B A;  4LF5 J;  1RKI A;  1JLQ B;  1RT6 B;  2R3V A;  3UI3 A;  2ZE2 B;  4ZIT A;  2HVI A;  1VQ9 S;  3H5U A;  1N5T A;  2F8E X;  2CA9 A;  1FJ7 A;  3RW6 A;  4K4U A;  3MEG B;  4IR9 A;  4ECT A;  3M2U A;  2ZH6 A;  3IM9 A;  3TWZ A;  1S1U A;  4C2M A;  2MZS A;  1RHJ B;  4JV5 F;  1KS2 A;  3QT8 A;  2G1D A;  2OIH A;  2LU1 A;  3R6L B;  2LEC A;  4RBV A;  1V3R A;  2YKN A;  4YHH F;  4NZ7 A;  2FVC A;  1QAI A;  2RHS B;  3JSB A;  2QMX A;  1P1L A;  1FFS B;  1LW0 B;  4K4S A;  3HF5 A;  4LSN B;  3P8B B;  5E3Q A;  1WEL A;  3G82 A;  4TQR A;  2OFH X;  4CLU A;  5KFN A;  2R8K A;  1U1P A;  4DFP A;  1Q5V A;  5IT4 A;  3TAM A;  1FWK A;  1NSA A;  1V9O A;  3QZ8 A;  2W8L A;  4DSF A;  1RTD B;  4P2M A;  3I0S B;  3ZO7 A;  1WKL A;  4ZVQ B;  5KFB A;  3T5L A;  4ZVO B;  4KO0 B;  3PJW A;  2ZH7 A;  2ZZT A;  1R8C A;  2M88 A;  2WOM B;  1E6Y A;  2DO0 A;  4R8U A;  3SEO A;  1T03 A;  4NLP A;  4J91 A;  2XEX A;  2E29 A;  1YJ7 A;  2C2D A;  2U1A A;  2XMJ A;  1SL0 A;  3OJU A;  3H7H B;  1FO1 A;  4IO9 Q;  3G6X A;  3DOK A;  4BHQ A;  3C6U A;  1KQG B;  4NA3 A;  4D3G A;  3L9Z A;  2LDY A;  3NMR A;  2DBB A;  5CYM A;  4TY8 B;  2DNP A;  5J2P B;  4F4W A;  2MGZ A;  3BH7 B;  4B3M F;  2RDD A;  3CUL A;  5KFT A;  4NI2 B;  2M9K A;  4FKX A;  1RDR A;  3MDF A;  4DV4 F;  4CO2 A;  1KEK A;  2DIU A;  5I42 A;  3KTQ A;  2MKI A;  2MPU A;  5JUM A;  1JWW A;  5SZT A;  4U8Y A;  3GWC A;  2BXJ A;  3JSM B;  2IYG A;  5CD4 H;  1U1M A;  3UDV A;  2OGU A;  4A8Q A;  3S8S A;  1MRO A;  4NLV A;  4ZN3 A;  1SXL A;  4TLQ A;  5ETL A;  5GVQ A;  3AB4 B;  3L7P A;  3VGU A;  3OUY A;  1LWE A;  2XY6 A;  1UW4 A;  4WFN Q;  2ATC B;  3PG9 A;  2YWH A;  5A6W A;  1IKW B;  2JZ5 A;  2ZVS A;  1VC6 A;  4AD6 A;  3KJN B;  5HJY A;  3NBP B;  4TKT A;  1RK8 A;  1TVR B;  2AJ0 A;  4RU2 A;  3CPW R;  2VG5 B;  2GVZ B;  2W4C A;  3P3D A;  2KFY A;  5KFH A;  2DH8 A;  2QFJ A;  2CNN B;  2C22 A;  1KN6 A;  4EEY A;  1IKV B;  4OYX A;  1Z4U A;  3IWX A;  2BE7 D;  1YK9 A;  1PCA A;  5IV4 A;  4F4K A;  1H0H B;  3N6N A;  2DNR A;  2WVC A;  2H4Y B;  3JTP A;  4LR7 A;  4PQU B;  2BJ3 A;  3DGP B;  4DR4 F;  2ZZM A;  2HFN A;  3QFH A;  1RT5 A;  3L09 A;  3U7J A;  4ED2 A;  3G86 A;  4BCA A;  4FNI A;  1WNE A;  2XLI A;  3IP0 A;  1TMM A;  2HK2 A;  2RQK A;  3TJ9 A;  3MOZ A;  5E7O B;  2LA4 A;  1UEV A;  3A3P B;  3GJR B;  5IT9 Y;  3BSC A;  1BLU A;  1GEH A;  1H3D A;  4CLL A;  3NKY A;  4M5D A;  4WE1 A;  3WC0 A;  2UU9 F;  3MUR P;  2K2P A;  1ZPV A;  2E9Z A;  2WB1 D;  2AT1 B;  4WTO B;  1DTT B;  3SCI E;  3MEE B;  1LXN A;  4CWB A;  4YOE A;  3CCS S;  3EXY A;  1L3S A;  2UVV A;  2VD3 A;  4RBT A;  4JI4 F;  2QYG A;  5B0F A;  3IXQ A;  1EET A;  1SJR A;  2I8E A;  1S6Q A;  5F8I A;  4ZP6 A;  4IOB A;  1RU1 A;  2V5H G;  3JQJ A;  4ZMM A;  1F2G A;  3SIP B;  4OYI A;  2BQU A;  3TOQ A;  1L3U A;  4OJH A;  2W2N P;  3V6J A;  2RJZ A;  3MOJ B;  3ZTS A;  2FTR A;  1TKD A;  1S12 A;  4DFK A;  3C16 B;  3DOL B;  5HBM B;  2JSX A;  1VBK A;  4MKV A;  1R0A A;  4OX9 J;  4JI5 J;  2BRK A;  3VGT A;  3PJX A;  2BKN A;  4USM A;  3PVX A;  3Q8V A;  2ASJ A;  5DGA A;  1N5S A;  1FHT A;  1NHU A;  2UUC F;  2B7B B;  1VQK S;  4F02 A;  1KQK A;  1HWJ A;  4I64 A;  2ZWO A;  2BKP A;  4C7Q A;  2FVP A;  2KFN A;  3MM9 B;  3D1Q A;  2E5J A;  5CD4 A;  3D7S B;  2ZH3 A;  4YP3 A;  4JUZ A;  5GAH U;  4B3O A;  4ZPV R;  1FX2 A;  3W5Y A;  2W01 A;  4QPT A;  3U1N A;  5JVH Q;  1OYE A;  2YNG B; 
#chains in the Genus database with same CATH homology
 1B4S A;  1NSP A;  3Q83 A;  3DKD A;  3VVU A;  3BBC A;  1NB2 A;  2CWK A;  1BUX A;  1NCL A;  1F6T A;  4UOG A;  1XQI A;  3ZTQ A;  1ZS6 A;  3FBB A;  3BBF A;  1MN9 A;  3EM1 A;  3FBE A;  4KPC A;  3B54 A;  1LWX A;  3ZTR A;  1S57 A;  3BH7 B;  2DY9 A;  3EJM A;  1NDK A;  3FBC A;  2HVE A;  3DDI A;  3VVT A;  1BHN A;  2DYA A;  2DXD A;  3Q89 A;  4FKX A;  4S0M A;  5BXI A;  3EE3 A;  3ZTS A;  3FKB A;  3ZTO A;  3L7U A;  3GPA A;  3VGS A;  1EHW A;  3WX8 A;  2AZ1 A;  4ANC A;  4EK2 A;  3NGR A;  3ELH A;  3ZTP A;  1NHK L;  3Q8U A;  1NDP A;  4ANE A;  2B8P A;  3ENA A;  3ETM A;  1UCN A;  1B99 A;  2HVD A;  3FCV A;  2NCK L;  1LEO A;  3VGT A;  3BBB A;  1BE4 A;  1U8W A;  3JS9 A;  1NDL A;  5CAB A;  4W98 A;  1XIQ A;  1F3F A;  4HR2 A;  4DZ6 A;  1VYA A;  3EVW A;  1KDN A;  1NDC A;  1S59 A;  3FC9 A;  2B8Q A;  2BEF A;  2BX6 A;  2DXF A;  4F4A A;  3Q8V A;  1HLW A;  4FKY A;  1MN7 A;  1NUE A;  1WKK A;  3EMT A;  3FCW A;  4F36 A;  3FBF A;  3PJ9 A;  4DUT A;  3VGV A;  3EVO A;  4DI6 A;  1W7W A;  1HIY A;  1NLK L;  4AND A;  1WKL A;  1NSQ A;  2DXE A;  3G2X A;  1S5Z A;  4UOH A;  2VU5 A;  3MPD A;  4O0N A;  1K44 A;  3GP9 A;  4CP5 A;  2ZUA A;  5IOL A;  3EIC A;  3Q8Y A;  4C6A A;  3PRV A;  1JXV A;  1HHQ A;  3VGU A;  3NGT A;  2AZ3 A;  4WBF A;  3R9L A;  2HUR A;  4UOF A;  3Q86 A;  1NPK A;  3B6B A;  1PAE X;  1WKJ A;  3NGS A;  5CAA A;  3BH6 B;  5C7P A;  3NGU A;  3EVM A;  1PKU A;  1NSK L;  4ENO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...