2DXDA

Crystal structure of nucleoside diphosphate kinase in complex with atp analog
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
154
structure length
154
Chain Sequence
b'SETERTLVIIKPDAVVRGLIGEIISRFEKKGLKIVGMKMIWIDRELAEKHYEEHREKPFFKALIDYITKTPVVVMVLEGRYAVEVVRKMAGATDPKDAAPGTIRGDFGLEVSDAICNVIHASDSKESAEREISLFFKPEELFEYPRAADWFYKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title Crystal structure of nucleoside diphosphate kinase in complex with ATP analog
rcsb
source organism Pyrococcus horikoshii
molecule tags Transferase
total genus 49
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2006-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 2dxdA00
1EHWA 4F4AA 3EVMA 3ZTQA 3VGUA 3Q8VA 3FBCA 3EVOA 1W7WA 3VVTA 3ZTPA 1S5ZA 1B99A 1WKLA 2BX6A 3Q8YA 1NDKA 3ELHA 3NGSA 4DUTA 3Q8UA 3R9LA 1VYAA 3B6BA 3PJ9A 1NLKL 1B4SA 2HVDA 2DYAA 2DXDA 2B8PA 1MN9A 3JS9A 3EICA 1HIYA 3BH7B 5BXIA 2DY9A 4ANCA 1LEOA 4UOFA 3NGTA 4S0MA 1KDNA 4DZ6A 1NSPA 1S59A 3EMTA 4ANEA 3EM1A 1BHNA 1PKUA 3BBCA 3EVWA 1XQIA 3PRVA 3BBFA 3ENAA 3VGVA 1HHQA 2VU5A 1S57A 3ZTOA 4UOGA 3NGRA 3FC9A 4FKYA 1NSQA 1MN7A 1NDLA 1U8WA 3ETMA 1WKJA 4WBFA 3WX8A 4UOHA 3Q86A 1LWXA 4CP5A 1JXVA 1BE4A 2NCKL 1HLWA 3FBFA 3MPDA 3FKBA 2HURA 1XIQA 4F36A 3ZTRA 2DXFA 3GP9A 3VGSA 3VGTA 5IOLA 1NSKL 3Q89A 3L7UA 1NUEA 2DXEA 1UCNA 4DI6A 2B8QA 2HVEA 3EJMA 4ENOA 4HR2A 4KPCA 1NB2A 1BUXA 3G2XA 5C7PA 4W98A 1NDPA 4EK2A 3FBEA 1NCLA 1NHKL 1F3FA 3BBBA 2BEFA 2CWKA 4C6AA 3FBBA 4ANDA 3B54A 1F6TA 1PAEX 3EE3A 3FCWA 1NDCA 2AZ3A 2ZUAA 3GPAA 4FKXA 4O0NA 3BH6B 1ZS6A 1WKKA 3FCVA 5CABA 3Q83A 3ZTSA 1K44A 2AZ1A 3DDIA 1NPKA 3NGUA 3DKDA 3VVUA 5CAAA
chains in the Genus database with same CATH superfamily
3ADAC 4X4SA 4A8SA 3M2RB 4EUVA 1WKLA 5T7LA 4X4OA 2MHNA 5ETOA 2XLJA 3R9LA 3M05A 4N47A 2HNZA 4H4MA 4IFVA 1K1SA 1OY6A 4PAAA 3DM2A 2NXJA 1ITPA 2EEYA 4DUZJ 1NHVA 1F5BA 4A8WA 3LGHA 4NL5A 3QJJA 4J9MA 2CAJA 3VV2B 1RISA 4QYRA 4CI0B 5GAEI 1XMOJ 1KFSA 4BC9A 3DOLA 3KG1A 2UZAA 4UQGA 3CEDA 3MCMA 2HMIB 1U8WA 2DGTA 3HJVA 2VBZA 2R4FA 2NCKL 2C22A 4F02A 3CDUA 1RT5A 1RTIA 1HNWF 2FPHX 5KG6A 4ENOA 1MMDA 3UVJA 3MEDB 3W9JA 4EBEA 4LRBA 1XR6A 2JC0A 2KI2A 3GQCA 1GNKA 3R5DA 4P73A 4F2SA 1X4FA 3MMAB 5D4NA 2R7SA 2JRSA 2Y8YA 1RT1B 3Q8QB 3UQSA 4XK8C 1MU2B 2DGWA 3NNCA 5CYMB 1HQEB 5LXRA 5LMNF 2Z30B 5FDLB 1KLNA 3W2WB 5DJBA 5BXIA 1CS4B 3ZNUA 2ZDOA 2FLNA 5F0WA 3T1YJ 3BQ2A 2ZH9A 1T0TV 1VRUB 2HYIB 5IC4B 4DF8A 3D5MA 2UUBF 4CLFA 2EXUA 2B6AB 4DBQA 4LF5J 3AJ1A 2LQ9A 4DV3J 3FGVA 4ZIVA 3ZZRA 1FKPA 1FRHA 2Q1LA 1ZA1B 2VASA 2V67A 3G6VA 2PN6A 2DO0A 2GMJA 1SKWA 5CCMA 4PG8A 3S1TA 3O2IA 5E7OB 4NLRA 1DARA 5BYQA 2WONA 1N6QA 2YNHA 1G2EA 1WTBA 1UWBB 4F25A 2XEXA 1IWAA 4L72B 5AXMA 2VFTA 3W5XA 3VGUA 3MUVP 2POKA 2QT7A 3PEHA 4ZCKA 2VFVA 3RYLA 2ZBPA 3HD2A 4LF6F 5A8RB 2HNDB 4YR2A 3HT3A 1ZTWA 1RLDA 4K5RA 2YPYA 1RAEB 4USWA 2XZTB 1HNWJ 4CLLA 2QLXA 1V5IB 3HFZB 2BZ2A 4FVMA 1M5SA 5KFYA 4DN9A 1QVFR 1T03A 1Z4UA 4QQBA 4YB5A 4MK9A 1NK9A 1HLWA 1RT3B 1YBTA 4CLUA 2KHCA 4PXBA 4E2FB 4CRJA 1NJYA 4I2QB 1EKRA 5JUMA 1NDPA 1AT1B 5CCLA 2LQBA 2ZWOA 1UTAA 2CG8A 2CA9A 3C6TA 3LH2S 4LF2A 2ZH2A 1SC4B 2HQFA 2W2OP 3CJ3A 3T1AA 1NMEB 5T14A 4DEZA 2ZVIA 4RW6B 3PYEA 2C28A 2DNNA 2ZZMA 1HW9A 1W26A 3BO2A 3K5MA 3ZZOA 2UUBJ 4ZLPA 1VS3A 4LVNP 5L39A 1X4BA 3D9BA 4B9LA 3DNCA 4DR3J 3ETOA 5FLXY 1TK0A 5LL6d 2DGOA 2N3OA 1B7YB 2XHWA 3V6JA 2ZNYA 3DC2A 4ZKAA 4RU2A 3X1LB 3KLGB 4DR7F 3UN3A 2K3IA 1T94A 3DOKA 1YX2A 4YN3B 2OMOA 3E2EA 5L9NA 5EDWA 4H4KA 1AYEA 1NSKL 3F41A 1S6OA 3M8RA 3R7BB 1K8AT 3JAMU 3NS7B 1NBEB 3GIKA 1XC9A 5KFKA 2Y1JA 4DQSA 1QAJA 3R27A 1VFJA 3M8PB 1O5JA 2Z2ZA 5B0CA 1ZM2A 1D09B 4LF6J 5KFJA 2PIIA 2HLUA 2OD6A 1HNIA 2APOA 2I0XA 5L1LA 4IG0B 2YNIB 1VCTA 1CBKA 2Z0GA 2GVZA 5SUHA 1VQSA 3MM5B 1BLUA 4P75A 1C1CA 1N34F 3T5KA 2C3MA 1HI1A 1RT2B 3ITHA 2W8LA 4Y6IA 4EWTA 3EMTA 3HHNB 2EK1A 2DNZA 3DCAA 3VQTA 3DM2B 3HHLA 2DPIA 3IG1A 2MPUA 1NK7A 1NXIA 3RW6A 2PMHA 4BDPA 1RA6A 3G82A 4QWBA 2ZC3A 4EFAC 3PO5A 1Y7PA 2GQQA 1A9NB 2XULA 2GFFA 4USTA 5K9FA 4MJKA 1LK7A 2KO1A 3KLEA 1MSWD 2KZZA 2KRRA 2EG1A 3N01A 2ROPA 3KK1B 1VLYA 2IBOA 4DFMA 2E29A 2VG6A 3MDFA 3R7NB 3HPOA 1N33F 1N0VC 4DZDA 1VIOA 4E98A 2JLFA 4DR7J 4ANEA 3EM1A 5J1PA 4KKOA 3KLHB 4V19X 1KQFB 4QBUA 1X4CA 3AQOA 5CXTA 5BYRA 4LREA 3L95X 3QMQA 5ETLA 1FVSA 1VQPS 5G0RA 4ECYA 3UDEA 2IYIA 3KUEA 1CULA 1Q82T 2V2ZA 3ZC4A 1RTJA 2XTJP 2GAHC 3BSCA 3D0HE 4C6AA 5D0GA 3C15B 1F6TA 1WD6A 2O3DA 2BR0A 4WU2A 4ZA1A 3OL6A 4OYBA 2R7WA 2HRUA 2QLFB 4DPTA 1N34J 4J9NA 5KFPA 3IM9A 3RG6A 1XMQF 1M1GA 4C7QA 2YNHB 3LAMA 2CQ1A 1M1HA 1J5EF 1PJ7A 5EX0A 5EUHA 2ZBRA 1TL1B 2MB0B 2E5HA 5HANA 2H4WB 2DNGA 5KFDA 2J6UA 1WI8A 2FQQB 3F56A 3THTA 4DL7A 3MR7A 5K8MA 4Z37A 1S6QB 2VU5A 3JTPA 4K8RA 2V34A 2Y0BB 2L08A 2ALYB 1KHVA 5M2PA 1UL3A 4DDFA 3DOMA 2CJAA 2FZCB 3T6JA 4IFYB 4P2FA 3KJVA 3BZQA 2P8IA 4WCEQ 1MWYA 4OZJA 3UO0A 4CZCA 4HDHA 3JXOA 4LR7A 2J76E 1RUSA 2BJ1A 4W98A 1HYSB 2BMBA 4TY8B 4ECZA 2BYCA 1M5KC 1T7PA 1N33J 5FJ4A 3FMWA 4DQIA 3KDNA 2MLYA 3C6TB 2YWEA 4JB8B 5ETVA 4NLPA 4OYAA 2QN6B 5CD4A 2JJ4D 5F8GA 4ZN3A 3H4DA 4PRFA 2FLLA 2B7BB 4C97A 1FJ7A 1KKHA 4NI2B 5CZVA 3OL8A 4X66J 4DV0F 3CJTA 1YVFA 1PGZA 2ZHAA 1Y0HA 2ZJQQ 1YJ9S 3VGVA 1HQUA 3UCGA 2HBQB 4CIOA 2ZEJA 3CDAA 4WTYA 1FRMA 2KXNB 4F4XA 3T5JA 4WFYA 2DK2A 3OUYA 4DN0A 4H54A 3TUZC 3MEKA 5GMKa 5LJ5Y 2BJEA 3OTBA 2BJDA 4RW9B 4RW4B 4I64A 4FN5A 1OY8A 1LXNA 5HROA 1NM2A 2VG5B 3UWTA 3PFEA 1XMQJ 1X0PA 1XR7A 3DRPB 1J5EJ 1CJUB 2R8GA 4DQRA 4A8XA 3CCRS 2HVHA 1XERA 1S1XB 2F40A 1K0VA 2CUYA 3QRPA 5IS2A 2XWXA 4PXCA 1WORA 3IR5B 3MM9A 3PG9A 4YDXA 5KG0A 1VQKS 4RKUC 3TEGA 2ZE2A 3SCLE 2GGPA 1WHXA 1K1QA 2NPIA 2QL7B 4HTJA 4Q43A 1RADB 2HZAA 1AROP 2WRMA 3WHIA 1I3OB 3LP1B 2FDNA 3Q2TC 2YWFA 2WOMB 4P7VA 4DLGA 3GG0A 3GZ7A 5GAEU 2HHWA 2Y3YA 4F4KA 3HSJA 3RR7A 4ED8A 3TZWA 2CJ9A 1R6VA 3SCIE 2QA4G 1N5VA 1O8BA 4XO0A 3VZIA 1UZDA 4KRWA 2C3OA 3ZFVA 2DNHA 3KTQA 2MZ1A 2OPSA 1UJ6A 3G2XA 4Q7AA 3RAQA 4R8UA 3D0IE 1UMJA 1H38A 3M2UB 3QJLA 2HSEB 2M9KA 2L41A 1RDRA 4DX5A 3FCWA 2QA4S 5E3PA 1O51A 1D3WA 1N36F 3HCXA 3HJFA 2DR7A 1FRXA 4KHPF 5M2RA 1L3UA 1N5SA 4PUOB 2OEKA 3CCZA 4DV0J 4OHVA 2BX6A 4M5MA 1J2VA 1FDDA 3ELHA 2JLGA 1RTHA 4R25A 1FJEB 2GQCA 5HVHA 4KYZA 4Y65A 1U26A 1SV5B 2KM8C 3OL7A 4NLGA 4RUBA 2B9YA 2RVJA 1FK9A 1L3TA 4P7TA 1QSLA 3EVWA 3VAFA 1TL7B 1LKZA 3FC9A 5D6GA 3MAAA 4OYWA 2MYFA 2R8IA 4DX8H 2UU9F 2WVFA 4HR2A 2NQPA 4JV1A 3NEKA 1TR0A 1RAFB 5G0RB 5F8NA 1HMVA 4ED5A 2E7VA 3K89A 3QZ8A 1HBNB 4OMFG 2J0XA 3VVUA 4J9VA 1FNXH 1RHQB 4OZ0A 2FYXA 3HHDA 5C2GA 4DR4F 5HSPA 3S8SA 1H2VZ 1BGXT 1T9WA 2D1CA 2NXEA 2CPJA 2RE1A 3A8KA 5I4MA 1Y9OA 5KOXA 2OIHA 1CJVA 3DRRB 2PC6A 1N52B 5AJ3F 2AJ1A 2FJXA 1VR6A 2JWNA 2F1FA 3N6LA 2W2MP 2E9RX 2MLXA 3DOMB 4ZP7A 4CH7A 1N36J 2V63A 4TXSA 5CD4H 2J0QD 4ELTA 5KT5A 3H8YA 1XR5A 2VBWA 2LU1A 3B54A 3C46A 1R0AB 2HNYA 3V4IA 2QSFA 1H6KX 1RU2A 3ZTSA 3DDIA 2D69A 2R2TA 4C8YA 2CWXA 3AOAA 4ZP6A 1TFYA 3EVOA 1WACA 2CQDA 5L1JA 3MM8A 5KFEA 2CPIA 1P9QC 1I6JA 5HMXA 4OIXA 2LDIA 1WC3A 1SB6A 4Y2MA 2MZJA 3AXKA 5JVHQ 4FNIA 2VJVA 1FTCA 2W2QP 2AGPA 4XPCA 2DHGA 1N32F 5C24B 3P4UB 1JK9B 1HHQA 2J6SA 2COLA 2UU9J 2CRLA 3R97A 4KC5A 3VAMA 3BKTA 1MN7A 1CJKA 2BOPA 3K58A 3IR6B 3FZ2A 4OHWA 1DTQA 3FKBA 2C2RA 2HWHA 4QU7A 4CLZA 2VC0A 3PW2A 3EYZA 1BXNA 1S1TB 3LUYA 3CJ2A 1F3FA 2VBYA 3OHBA 1WC4A 2Y0SD 3TO8A 2JX2A 3LAKA 3EUNA 2VB6A 4WTOB 2BRLA 4V1Ak 4DR4J 3SDEB 1NRKA 3VZHA 5DM7Q 3DDKA 1RTDB 3SQGA 1GEHA 2BANA 4C8ZA 2GIRA 4DPXA 3UR0A 4IH7A 5AJ3J 4IQMA 5J1EB 1U45A 2M4MA 1LW0B 3I4HX 4FPRA 5ETSA 4X62F 2JEGA 3HSDA 3KJNB 1FWLA 5BJRA 3KJFB 4F67A 3MCOA 1NK0A 3ETMA 5F8HA 1BE4A 3V2UC 4N7TA 3BKUA 1RKIA 3QPIA 2W8KA 3C6UB 4DL6A 3CB4A 2UVUA 2ZD1B 2WAQD 1LW2A 2XMUA 1FRJA 1YSJA 1DJ0A 1RZMA 4NOHA 1QSSA 1DURA 4L75A 1RAJA 5KG3A 1UFLA 1PAUB 3GFZA 3V6HA 1N5YA 5HMWA 3I9V9 1UFWA 3QIPA 1N32J 5HLFA 1VYAA 3A8JA 4ZJQA 4NWBA 3EX7B 4U7UK 3V81B 2XSJB 2HQ3A 5GMDA 1IXKA 3GYGA 3TZZA 1WC5A 1ZM3A 1BQXA 5IWAJ 4KR0B 2OGUA 1FE4A 3DDNA 3OR1A 1O6XA 4C48A 3RBEA 4DR1F 3FMBA 3LP0B 1JKHA 2B3TB 5D0HA 3QGHA 1RQ0A 4RW7B 1UEUA 1HNXF 1YIJS 2FLPA 1F9EB 3PEJA 3CIZA 1T8EA 3D67A 1ZA2B 1TUGB 4IG3A 1F9FA 1YRXA 1KVKA 1TAQA 1ZS6A 3TQ1A 2MKHA 3MCSA 5IT0A 2CQPA 3EDQB 4NYOA 2E44A 4GVBA 4JI5F 1TELA 1Q8BA 2AEMA 2QMUB 4KB7A 4ILMA 1ZAVA 3HM9A 2AJ0A 2LA4A 4X62J 4ZVEA 3DHWC 4H4OB 2EKYA 3MF5A 3S6EA 3GTYX 4UW2A 2HBYB 2HK3A 1LXJA 2KRBA 2R7RA 1LEOA 2XO7A 1JNRB 3M2VA 4B9NA 4NCGB 2XB2D 2W24A 2PE8A 1U6ZA 1KOHA 4OI3A 1ZYQA 4OZLA 2RF2A 2NZ4A 4WXWA 4HH1A 2CIMA 2PI4A 2DTJA 5J2NB 3W64A 5FIIA 1KQSR 4R0JA 3DI6A 3MR3A 3I5CA 2DEJA 4BWMA 2C3PA 3B8HA 5IT9U 4D3HA 4KH0B 2YNFB 5KG7A 3L09A 4QWCA 3VTIA 3U1NA 2P2CB 3G96A 2CQ0A 3FCVA 5K8NA 3Q83A 4NASA 3JSMB 2HGNA 2CQHA 4CYUA 4ELVA 1LQ9A 2BQ3A 3M8QB 2H9ZA 3EDRB 3V4IB 3OHAA 1PSDA 5KT2A 4JI3F 2JOQA 3EGZA 3C66A 3FEZA 2CZ9A 2DGUA 4F3OA 2K7JA 2IFXA 4PWDB 5KT6A 4U7UD 4ANCA 1ZOTA 1S6PB 1DLOB 3MWBA 4MK8A 3TYTA 2EPIA 1K73T 4O4RA 3AODA 5LSLA 4G65A 4I6YA 3VAJA 1Q5VA 4JP8A 4U95A 1HNXJ 1XBWA 1KNZA 1HBMB 2ILYA 2FJDB 4DOZA 3I31A 1DAXA 1CC8A 1JLQA 3PJWA 1S99A 3Q89A 3QFWA 1C0TB 3NP5A 4TU7A 3CC7S 2M2BA 3BDEA 2OEMA 4JI5J 4LIRA 2JEIA 4B3TF 1S4FA 4CO3A 3J81Y 3DGPA 4ZVTB 1RT7B 4X65J 5DRKA 5ETQA 1RACB 1IKYA 2RB7A 4ZLNA 2OTJS 3A3NB 3WQPA 1SKUB 3MM7A 3CJSA 3SQGB 1FJCA 2CXEA 3V6DB 1IKXB 2M8DB 7FD1A 4F4ZA 1KDNA 3HX9A 1GX6A 2YH1A 3R7SB 3KK2B 2BJ7A 1UVNA 3CCVS 4DX7A 2ZBQA 4U6PA 4EYIB 3GILA 4Q0BB 1BWEA 3HO1A 1V6HA 4OHZA 1LWXA 2DRAA 1DHMA 3K5OA 4NMLA 1CC7A 3VGSA 2PGCA 4MTPA 2MY7A 4W90B 1AFIA 1E6VA 3H2LA 5CZXA 2DCLA 4OYZA 1YZ7A 3OR2B 4WJBA 1JJ4A 4JI3J 3IWNC 2DIVA 3J80Y 3I82A 1Y3KA 2IHR1 2MQ8A 4CWBA 3HLUA 1LW2B 2Z57B 3SSRA 1UPPA 2GJ2A 1K44A 2W9BB 4NA1A 3HZGA 2Q6CA 2F65A 1Y5IB 1VQ4S 2BUNA 1LWFB 2ROGA 1XNQJ 2ASYA 3MEEB 2VFSA 2FVPA 1VRTA 4RX6A 4OZ5A 2VZ9A 2HHQA 4ICLA 3CDWA 3P5BP 1HBOA 1EQ0A 1OIAA 3HFVA 2OSQA 2P6TA 2RJZA 5GAGU 3KLIA 2IC3B 3N5FA 1SJ3P 2FHOB 3T9NA 4M1KA 2VG7B 3QT8A 3PX4A 3FZBA 4OX6A 4FBUA 1P9YA 2XY5A 1UA0A 3LTOA 1S7IA 2ZBIA 4FP9A 4QZVB 3BS9A 3HD1A 2HWTA 1WHVA 3QJPA 3MD1A 2EW9A 4M5KA 2FJEB 3AA8A 2VDHA 2GO9A 4PQUB 3KHRA 2CZ4A 2V2QA 4F36A 2U1AA 4QYZJ 1HPZB 3GJTB 2V8HA 2YPZA 3KG4A 4KO0B 3CCQS 2MEWA 1PBUA 1URNA 4ZVGA 2FVRA 4LSLA 4D3GA 3POTB 3TVZA 3BBBA 5HAOA 1Q8IA 4ED4A 3PM9A 2DHAA 2J9DE 2KVQE 1WWHA 2EC2A 2V0NA 4ALZA 4JI2F 2EFNA 3BGFA 1JLBA 3PR5B 3MURP 2OSRA 2VL1A 2BOAA 2NREA 3UD5A 2H1YA 3QYYA 4ELUA 5CYJA 3M1VA 2M70A 2MQMA 1IVZA 2UXBF 2FHMA 1FRIA 5KAKA 3CMES 5J2MA 3EXCX 4TYAA 3PV8A 4ZVSB 1YI2S 3CJ8A 3AB2B 5AE2A 4LBIA 5AT1B 3VAIA 3OFHA 4U67Q 1NJIT 3G71S 6FD1A 3IR7B 5FD1A 1GXUA 3IN5A 2AYEA 2DO4A 1RT4B 1OSCA 2GMHA 2FGCA 1JXVA 5HJYA 3D6MB 5F8MA 1NU4A 3GWCA 3KJQB 1YRUA 5J2QB 2J7KA 4C0BA 1S1UA 1X8DA 1IQZA 5KFGA 3BYRA 1IJEB 4L76A 2DGQA 3MMBA 4OV6A 1KONA 3I4PA 2R7UA 2ZOFA 3IWLA 3NKYA 1RHRB 2FC9A 2IAJB 1IBMF 2VA3A 1DTTB 2BV3A 5IV3A 3MCNA 5LSRA 3LP2A 2W2NP 3VHQA 2N7CA 3RR8A 3CJKB 3H40A 4DCPB 1U02A 4XDCA 4C11A 4M5DA 2MSSA 4NEZA 2V4QA 2XMTA 5D0EA 3DYAB 5DLFA 4YS2A 2ZH8A 1S7HA 4YFUA 5A2QY 4WP8A 1U1NA 2Y1RI 1LWCB 2CJQA 3LQVA 1ULRA 2I5JB 2UV8G 4UOHA 3OLBA 2DBBA 5L9XA 4NEYA 1Y11A 4DR5F 4O44A 3D2WA 5EN1A 2HS0A 1YLXA 4LFAF 1TKTB 2B8QA 3QO9A 1HW8A 4JI2J 3I32A 1S79A 3FVYA 1YJWS 2AZ3A 4HT7A 1R3NA 3PW4A 2UXBJ 3Q22A 3PKYA 2DRDA 2IJFA 2CPXA 1OO0B 1B7FA 1GMUA 2VV5A 2RRBA 2CKWA 1VQ7S 1U2FA 2QV6A 1B0VA 1TMMA 3GJRB 3OXGA 3CDBA 3W61A 5I3QA 1JLAB 3JSRA 4LF9F 1IKWA 2K8GA 3IAS9 2UUCF 3V5RA 1PIEA 4HACA 3SV3A 1OMSA 1RT6B 1JX4A 2R7XA 2YKPA 3UN5A 2BXJA 3KK3A 2QYGA 2B9WA 5GADI 2AHOB 1GQEA 5F8LA 4DSIA 2HURA 2GMLA 2DT9A 2B5JA 2KG1A 4I69A 2UVWA 1ZTTA 1U49A 4CM2A 3V4MA 1IBMJ 2BQRA 1TVRB 2E66A 4NRUA 1RWXB 4FYYB 3TP2A 2LQ5A 3FK4A 1YRTA 2JVRA 3BGRB 1TK8A 2A6MA 4ILLA 1XN9A 1VHIA 2F8MA 2WB1D 3H5YA 4J7CA 4WFXA 1SQFA 3TQEA 2IA0A 3QSIA 4RO0A 3QQCD 1TP7A 2GV1A 1ZPVA 3Q8YA 2N7YA 4NLXA 2R2SA 4DUTA 4WXOA 3B6BA 1PC4A 2C1EB 4Q2MA 3DRSB 4X4TA 1G7CB 3E01B 2UP1A 5CYQA 4KJIA 3ZZTA 3L7PA 1RCXB 5J2PA 5I42A 2OMLA 4LBHA 4DR5J 3NBPA 2CPHA 4LFAJ 1R8BA 4RZRA 3I87A 3L7OA 2NS1B 2VKRA 3D6FB 2D3O1 1NKCA 3PW0A 1WG5A 1JJHA 1FEHA 6FDRA 4MFBB 2K7KA 1M0SA 1U6BA 1TZ0A 1X4GA 4K5SA 3TR5A 2ALZA 3A8IA 2CJKA 4ED7A 3WZ0A 2B43A 4BBYA 1NJWA 2AGOA 4CTAA 3KHHA 4CT8A 5ETTA 3G6XA 4G1QB 4TLQA 4I7FB 1QVGR 4P71A 2LEBA 4ZPVR 3GFXA 3DLEB 4UZBA 4LSLB 3MR2A 3GMGA 4CDIA 3IMQJ 1QE1B 4LF9J 1GXTA 4CM0A 4E0DA 3KLFA 1KR4A 4WK3A 2YQ1A 1U0HB 3N9UC 2W9CA 3NCPA 1MLAA 2GVDB 2OJ3A 1X31C 2HBZB 1JLEA 4LVOP 4FS1A 2P9CA 2YTCA 4KGMA 1C1BA 1VLOA 2F4FA 2B9XA 5SZTA 3ZO7A 1CQNA 4KH1B 1GH8A 3GV5B 4YY3F 3RUBL 2XG8A 3KUHA 4IOBA 2LCWA 4B3RF 4EEYA 2HW3A 5DDOC 3TANA 4LF4F 1U8SA 4C8OA 3PY8A 1FTRA 3M2RA 3HVAA 2Z2MA 1KQKA 2LEPA 4NYZA 4KFBB 2V4RA 3MAHA 2O5DA 4OX9F 4A48A 4ZOSA 1YHQS 3AXMA 1RWMB 2G0IA 3ZZPA 1M5HA 4PG5A 4M8LA 4DU7A 1C2PA 1Q81T 5D77A 4ZPDA 4UTGA 2RH3A 4TNOA 2LKZA 2KH9A 2KN4A 3CCWA 2H5JB 4EZ9A 1LFPA 1TL5A 4PYAA 3L3CA 3BREA 2J7WA 3NCRA 2HMIA 4EYHB 4M5HA 1EP4B 4MT1A 1OYEA 2WSCC 1BQNB 5AXNA 1KC8T 4PXDA 4AL6A 2K1RB 2RDIA 2WZ1A 5DZ7A 3MEDA 2VD3A 1NJXA 1HI8A 3GIRA 4DFPA 2OFHX 3LGMA 4OYPA 4ED1A 3MMAA 2Z2YB 1JXLA 1RT1A 1UCNA 1MU2A 3N79A 2C2DA 2P9GA 1NCLA 5CYMA 1HQEA 5FDLA 2CG4A 3O1LA 2DNQA 3JSBA 3W2WA 4LUBA 1CS4A 3HVTB 2H4YB 2HLTA 2XY7A 1AFJA 2N82B 1G4CA 3LANA 3A3PB 5D4LA 4DPUA 5A8KA 4DR6F 3IGVA 1VRUA 3AQPA 3W60A 2YKQA 3MM6B 1W7WA 1VDHA 1Y10A 2CPYA 4YY3J 2B6AA 4KGXB 3H0PA 1AZSB 4WF9Q 1VC5A 4PCQA 1FEEA 2P5VA 4B3RJ 5EHHA 3BH7B 4G6VB 4BWJA 2QIFA 2MZQA 1JNZB 4YB7A 1YQHA 4TQSA 1R27B 2DHHA 1GAOA 3PO4A 1ZZFA 2QZ8A 4K4TA 2SXLA 4F8RA 3LO3A 3KFWX 3DLLQ 4OX9J 4CLTA 1UWBA 3ZZ0A 5DDQC 1HD0A 1VQNS 5IQQA 2M8HA 2LVWA 4Y00A 2HGMA 4WE1B 5KFQA 3BGOP 3TNVA 1VMBA 4MIAA 4O4GB 2ZKTA 4M5NA 3CC2S 3T5HA 5A8RA 2HNDA 3EE3A 2Z2LA 1IKVB 4DFJA 1SL2A 1FRKA 1KFDA 2VICA 2C3UA 3Q8PB 4TQRA 5F41A 3MECB 5BR8J 3KOAA 3R2CJ 1REGX 3CUNA 1F1BB 3Q8VA 2YWHA 3AH6A 2I8EA 5DO2A 2XSFA 2N4CA 3QGGA 2DNOA 4X4PA 2GIFA 5I3UB 3CSKA 1RT3A 4MKVA 3TX0A 2G2OA 3PVXA 1VQ8S 3VWSA 4L3KA 4I2QA 3M8WA 3D66A 4AQYF 1OJ4A 3EXYA 5EGYA 3GR0A 4QOTA 3R6LB 1QJHA 2YKNB 2MY8A 3H2UB 2PA3A 1WELA 3WX8A 3H42A 5DDPC 3RGIA 4HYKA 5E41A 1S0OA 1HD1A 4RW6A 2G2YA 4Q45A 4J9LA 1GTEA 4DR6J 1NB2A 1IR2A 4F3MA 4A8OA 3D3BJ 2LXFA 2HS3A 3DU6A 2EFQA 3VAKA 4IRCA 2AP6A 2XZDB 1RHMB 3A12A 1ZETA 2R7TA 2BE9B 4IDKB 3PYDA 4OFZA 5H9EJ 1S5ZA 2LMIA 4ZN1A 2QA1A 2Z56B 4WFAQ 3KLGA 1F3VA 3Q8UA 4EBDA 1HARA 1XTZA 3O6QA 5HP1B 3Q23A 2B4PA 4B9TA 1U7LA 3SFGA 3IS9B 5D4PA 2HVIA 4IQXA 2P9EA 2KYXA 2NXUA 4CLPA 3M32B 1G3OA 3IAM9 1JLFB 4ED3A 2JVOA 4FDFA 2A10A 3M8PA 3EZUA 5KFZA 2DNRA 1X4HA 1UVLA 3N4WA 2MHEA 3AT1B 4N5SA 1GMWA 1N4LA 3DU5A 1RAOA 4ZVQB 4IG0A 4F0MA 2YNIA 4F26A 3H5UA 4G1IA 3R8YA 1ZM9A 4CO0A 1FXLA 5JJBA 3B82A 3MM5A 4O3QA 2ADBA 5DM6Q 3BN7A 4W92B 3DLBA 1RT2A 3JQKA 4YUDA 1M90T 1HNVB 4K0KF 4MK7A 5L38A 2EWHA 2IPOB 1SXLA 4K4SA 1QAYA 1KS2A 4HEA9 2RHQB 3J7A1 4ZPTR 2ATCB 3M30B 3QAEA 3DRXA 1WF2A 2YX7A 4J37A 4ES1A 2XYGB 4AQYJ 2ZHOA 4J9SA 4N41A 1KOOA 1YJUA 4C9DA 4Y2CA 2Q43A 4PPZA 4B9VA 1JB0C 2O66A 3UE2A 2BQUA 1TKXB 1Y5LB 2YX4A 3M8YA 2BACA 2IY5B 2ZH1A 2W4DA 4ETXA 4ZS6A 3KK1A 1QM9A 3H59A 5A8WB 2WW8A 4HI1A 1LK5A 4K4WA 4TYBA 1FFGB 4NXNF 1YDLA 1Y5NB 1Q4RA 2OFGX 4DWIA 2GCFA 3VAHA 1U47A 1HNZF 1WOOA 1RWPB 2E1CA 3CIMA 4KGVB 3A1YG 1G6BA 2ZZNA 2OELA 4TN2A 3R5CA 5B08A 3JQJA 1HHTP 3KLHA 1UJ4A 3C14B 4DUYF 3I0RB 5A8KB 4I0WA 3SIPB 3LGNA 4A46A 3V6KA 3PW5A 4ZVHA 3QRRA 1VOMA 2FY1A 2WVEA 4IRKA 5JVGQ 3CJ0A 3PJXA 1SQGA 2RMLA 1X5OA 3AB4B 4DV4F 1PCAA 1NSPA 5DGBA 1NK4A 1TL3B 2IMOA 2OPRB 1NK5A 4NX9A 2NR0A 1DZ5A 2HFOA 4CLSA 1A0OB 4UOGA 1SPBP 3C15A 3LPEA 1NSQA 4MIBA 3B78A 2MJNA 2A6OA 1OSDA 5JXSA 2DR6A 1SIZA 2DVIA 5GADU 4K0KJ 2W25A 1EAYC 3GYXB 1F2GA 2HZCA 4I2PB 4ED0A 1TL1A 4OYIA 4ZK7M 3ULHA 2CPFA 5KFRA 2AMCB 3CCMS 1GK8A 1PAEX 3NCQA 4C0OC 2D9PA 2J8SA 3CJ5A 3IRXB 3HZEA 4P52A 1PILA 1S6QA 3BDPA 5KFWA 4ZVFA 2X51A 4NZ7A 1S48A 3MEGB 3NGSA 1Z2ZA 4Y2IA 4C8LA 4IFYA 4X4UA 4QW8A 3IRWP 2ZH5A 4Y0FA 2NYHA 2QLJB 4FYXB 1R0CB 4Q44A 4F50A 4ITSA 3ENWA 2W1BA 1FKOB 1PG5B 1KVIA 2ZOMA 3BJYA 1X4AA 5HBMB 3NWGA 5LOQA 4M5GA 4NXNJ 1REVB 1S57A 1HYSA 5E2QA 4TY8A 2ZH7A 1HNZJ 2YQ0A 4NMXA 2P6SA 2WB4A 1FE0A 2VQEF 2KG0A 3PIPQ 2VOOA 1X9WA 3LWLA 3RB6A 2XMKA 5LMNJ 4J9UE 4NLSA 3RJMB 2LXIA 2MLZA 3WIVA 1EETB 2EG2A 4HL9A 1UETA 2XMJA 1S9GB 4ANDA 4IUFA 3MPYA 3GPAA 4NI2A 2QYCA 4O0NA 2X7IA 1ROFA 5K14B 1R8HA 4LSNB 3ZXWA 4U8VA 4A8KA 1FDBA 1QD1A 5FLXU 4DV4J 1DQ9A 1T3OA 1TKZB 4YDDB 4EO6A 4LFCF 2KHDA 2D3OR 4ILRA 1H2UX 4IOCQ 3A3OB 1KLMB 1F5AA 3VAGA 1GMWD 2J9EA 4BHQA 3PFOA 1UP1A 4YB1P 4RW9A 4RW4A 2Z8QA 4BLGA 3I9ZA 4PR6A 1NK8A 3NGTA 1CJTA 3GYNA 1YITS 2VG5A 3DRPA 5DGAA 3N6NA 1CJUA 3GE9A 1SC1B 1WF1A 3VF0B 3M8SA 2XMVA 4IR1A 1S1XA 5KFAA 2OPQB 1FO1A 1T95A 5KFTA 4EO8A 3H7HB 4R5PB 4JI4F 2RKIB 3PX0A 1SUQB 1BMQB 5H1SV 1UEVA 4OJ1A 4JI1F 1WHYA 3SBMA 3CCES 2CQIA 3R3TA 2G4BA 1V3RA 3I0SB 5CABA 5D0RA 3I96A 3MMJA 1XEZA 3DN9A 3LP1A 2VQFF 2HHPA 3GIMA 1UWAA 3SV4A 2UUTA 2WOMA 2WW4A 3DLGB 2QLWA 4CO4A 5D4OA 2ERRA 1PYOB 1NZAA 2UUAF 2VA2A 3RBXA 1KTVA 1TFWA 4OZ1A 4MKYA 1MN9A 2NSBA 1FESA 4PXEA 4TY9A 4S0MA 2W01A 1WI6A 2VQEJ 4X84A 1FXRA 1IBKF 3BBFA 2EK6A 2KZMA 3PRDA 5EWGA 3M2UA 5C42B 2WHOA 3AHPA 2IVFB 1WKJA 4IRDA 6AT1B 2ADCA 4OZ3A 2JLEA 4AXIA 5ADZA 2BW7A 2ZH6A 2R7OA 4GVLA 5HVFA 4QWEA 4PUOA 5H9EK 5A0YB 1HBUA 1WEZA 2ZNZA 1KVJA 5K20B 1T05B 1UVIA 4ZPCA 3TOQA 2VJUA 4I68A 1SV5A 2ZUAA 4JUZA 4LFCJ 5B7WA 3D54A 2JHEA 1JMTA 2FHKA 4FVCA 2QE5A 5C25B 2B0GA 2M0GB 4ZP8A 3FRYA 4YP3A 1HWIA 1TL7A 4UUXA 3UFCX 4IH5A 2XI2A 4KY3A 3BEGB 3OVSA 4EGLA 1R8PA 5ETRA 3QLHB 1Q79A 4K4VA 1N48A 4RW8B 2O01C 4RLEA 4QR0A 2DGXA 1HWJA 4O3PA 3BO3A 3GFYA 2EFGA 4RNOA 3SYZA 5LSOA 1MROB 4JV2A 4K50A 2GA7A 3F73A 3NL0A 1SBRA 5E3QA 4JI1J 1HBNA 1H2TZ 3TUJC 3T6BA 2EI5A 4NLTA 3CCSS 1C4CA 3ET6B 4LSZB 3W5ZA 4L3NA 5F9NA 1XIQA 2X3DA 2OO4A 2AF6A 2FB0A 1JWWA 2BBEA 1KEKA 2LXUA 2V8VA 2GJFA 2DR5A 2ZHBA 3HDSA 2KJVA 3LALA 1NB7A 1HWLA 2UUAJ 1WKKA 2IMWP 3DFEA 2GJIA 1OQ6A 3FFIB 4UUWA 4RNNA 3UDLA 3DGVA 3DRRA 3S01A 1H72C 3MAQA 1IBKJ 4FF3A 1C0UB 1NDKA 3TW0A 5F9LA 2ZITA 3BPDA 1P27B 1SH0A 3SSSA 3OTEA 2C2ZB 3Q2SC 3LPYA 2HHSA 2Z4PA 1R6YA 2E5JA 2DNMA 3KMSA 1X9MA 1PYTA 2DY1A 2FUG9 2LA6A 2XYHB 4DPYA 1R0AA 2DNPA 3O8WA 4PKDB 2FIUA 1UEKA 4WK1A 2HFSA 2BDPA 1H74A 4IYQA 1H73A 3WC0A 2JSXA 3KKFA 3FEYB 2GQ2A 4USKA 2RHSB 2WBRA 3SFUA 4OX8A 2VKZG 3FDSA 4USUA 3QATA 4XAKA 4I1TA 4C3MA 4DL3A 2HFNA 2AZ1A 1X4DA 5C24A 1H7XA 2MGZB 1T9VA 1UKUA 3P5TL 1TAUA 4CO1A 4KHMA 3K57A 5A6WA 2J9DA 2AGQA 3PR4A 3B4MA 1S6UA 1WDTA 1SJ4P 3KDOA 2PO4A 2HKEA 3QZ7A 1B0TA 2YH0A 2F3JA 1UW9A 1PJ5A 1QUVA 1VC0A 1S1TA 4O3NA 3TAMB 1CPZA 2E1MC 2E7WA 5AXKA 1CJTB 3CGIA 1KRPA 5C5JA 1NDLA 1SL1A 2RQCA 3SDEA 3CO9A 2BVZA 4NYPA 1RTDA 1F9HA 3UCUP 3JB9k 2AEFA 2XO6A 4KTQA 4LQ3A 3PIOQ 5HATA 2QFJA 2LP4A 3R6GB 2BEFA 2FLOA 2QO3A 1HI0P 3D68A 7AT1B 4P2XA 2PA8D 2IJNA 5J1EA 2OP5A 5MLCV 1LW0A 4HT5A 3FQLA 2KM8B 4DSJA 3GSIA 4N8NA 4OX7A 1U1PA 2V4JB 2XS5A 1RBLA 1SJ1A 2IDLA 2NLWA 4DSLA 4J90A 3K5NA 1WG1A 2MSTA 3GV8B 1TUWA 2QA2A 3IWXA 3DLHA 1U2CA 3FRZA 2HHHF 3LF0A 1X5SA 3K17A 2R8JA 3C6UA 2Y1LB 4U9RA 4LT6A 4DZ6A 4IOAQ 3J7YU 2UUWA 2ZD1A 2I1RA 4DL5A 2A18A 4RBUA 1FDAA 2RQ4A 5IM0B 1RCOB 3P45B 3FSYA 2EC0A 1ZPWX 1YJRA 4JOUA 3VR1A 1KD1T 4LMZA 1RB0A 5F8IA 2U2FA 3OV7A 5KTQA 4K2JA 3D7SB 2BKNA 2MQOA 3UCZP 1R31A 2E5GA 4EK2A 3U1MA 1NHKL 4ECRA 3FBBA 1D9DA 4DUZF 1HBUB 1O0PA 4DHVA 2XGQA 4YR0A 4OLOA 1UA1A 5K8PA 2FZGB 3V81A 1XMOF 2XSJA 5GAGI 1HFEL 1K47A 2KDOA 1H7WA 1SJRA 4MH8A 1SI9A 2EFVA 2YKMB 2QJ3A 3C19A 2G0CA 3N6MA 3GLJA 2KVIA 4DL4A 5K5MA 3LP0A 2CQCA 1P1TA 4ZLLA 3SI8A 3G8QA 2B8PA 4RW7A 5BYSA 2E1RA 4YOEA 3MPUB 4WIIA 2K2PA 2XHCA 3OVAA 2J0SD 3QGIA 2WSEC 4GRSA 4OZ2A 3NGDA 2GHPA 4KPYA 1NO8A 2BW2A 3PHEA 2CYYA 1JLGB 3NS5A 3D1OA 1XNRF 3NAHA 4A47A 1TTHB 3UNGC 3RRKA 3MPDA 1L5UA 3TI0A 1NZ8A 3L4BC 2O1PA 4DG1B 4USMA 1BC6A 4H4OA 4YB6A 5DQGA 4KQZA 3C16B 4J9PA 1VC6A 1WG4A 3WIUA 1MG7A 3T1YF 2IRUA 4ZHRA 2OKQA 4CNYA 4NCGA 2PMZD 4RNMA 2HHHJ 4LF5F 3CTRA 1ACMB 2W2PP 4DV3F 3N28A 3AOBA 3H20A 3K7RA 1AUDA 3PKMA 2YNGA 2CQ4A 4KGZB 4F7VA 1LNQA 5GMEA 5J2NA 1D1UA 4XPEA 2F8EX 1M5OC 3OTCA 4YHHF 4U96A 2YNFA 2NPFA 3UD4P 1S49A 4KHPJ 2MQLA 2UV8A 4O23A 1FNOA 3JSMA 8RUCA 2L9DA 2KTQA 2A3JA 3M8QA 2UVVA 2VPWB 2VHGA 4ZPWR 3KXDA 2OPPB 4XTTA 2NUUG 1WEYA 2MKKA 2HK2A 1RTZA 1RWKB 2BKOA 3A13A 1HWUA 1TU0B 1S1WB 2VONA 3I56S 1GTHA 4B3OB 4PWDA 5AXLA 4FPIA 4DV5F 1S6PA 1DLOA 4C3KA 1NAQA 4WFZA 4TU9A 3QFHA 2NSCA 2RDJA 3O5TB 3E3XA 1QY7A 1S1VB 3IA0A 4OJHA 2VFUA 2BRKA 4NCAA 2KXHA 3BQ0A 2CDQA 2FHJA 3D6HB 4KSEB 1HBMA 2VBXA 1DFDA 1FA0A 4UOCA 1VK3A 2HFUA 2CADA 3JS9A 2YVSA 3OT9A 1FF2A 1XNRJ 5HQLA 3W63A 2VIHA 4QCLA 4ER8A 2J8AA 3LW5C 2A0FB 1Y4ZB 1C0TA 4HI2A 3DLKB 2XMWA 2H54B 2IM2A 1QTMA 2LU2A 5IQ6A 1S10A 4OI0A 3UD3P 2QFIA 3ZTOA 1S76D 2CQBA 4C0HA 2NYIA 4K2XA 2AU0A 1EQMA 2ZM6F 5J1NA 4J9KA 5KT3A 1RE1B 4ECQA 3OPKA 4PYDA 4NLQA 2ASLA 3ICLA 2QG9B 1LWEB 1RT7A 4MAKA 1J5OB 4WYLA 2XGPA 3L7UA 2AJ2A 2HHUA 2DH9A 3T41A 3CDEA 1JLCB 3CE8A 1MNEA 1SQEA 4FYDA 3PNIA 4DR3F 3V6DA 1IKXA 2MQQA 3K59A 2G1HA 3RRHA 4ECSA 4F0KA 1NEEA 3KK2A 1D0EA 3CF5Q 3AJ2A 4RR5A 4Q0BA 4YHHJ 3GU0A 3RTVA 4Z7CA 4PG7A 4ERDA 3SEOA 3BR8A 2PFFB 1FD2A 1DQ8A 2RRNA 5L1IA 4J5OA 2VUGA 4KGKA 2R2RA 3NY0A 1VI7A 3W9IA 2C2EA 4ECTA 1KHWA 1YJNS 1ZBTA 5ITHA 3OR2A 4KV8B 2B7CB 1I94F 3RBDA 3GFHA 1S0NA 3OXFA 1PBAA 4DV1F 2YXLA 3GV7B 2W9BA 1OY9A 3J81j 1HKAA 1S72S 1LWFA 3I5AA 4DV5J 1KP6A 2B9EA 3MEEA 5KG5A 3WX4A 2W7PA 4EU0A 2X3GA 2ABYA 3T1HF 2DR8A 2JEFA 5IV4A 3FBEA 2FJAB 2BE2B 3EGNA 5HJXA 2IC3A 2D41A 2V2KA 3SQOP 4C8KA 3NXZA 3BN4A 2VG7A 1E6YB 3ILJA 4IO9Q 1TQLA 1U6FA 2Q66A 4PABA 3G9CA 3TEHB 4IH6A 4DSKA 1MMLA 1B99A 4WP3A 2RUGA 3MR5A 3D1QA 4OI6A 4PQUA 2R9LA 4K4UA 2XI3A 3AJDA 1IR0A 2ZM6J 2IRXA 4FYVB 4C98A 1HPZA 1JJ2R 4KO0A 5E3AA 2QX0A 1YK9A 2W4PA 3MMCB 5LM7E 3BBCA 3POTA 2YY3A 5KFUA 3CPWR 5IFMA 2KJWA 1RHUB 5JMNA 1VRQC 3Q86A 4LRCA 1Q86T 1Q1KA 4M63A 1VQ9S 5KG4A 1N5TA 1FT8A 5IT4A 2MJUA 1Q95G 4LF1A 4Y2AA 2XMAA 4NCBA 2L9NA 4K4ZA 2C2OB 2IRYA 5KG1A 3NS6A 2Y1IA 2PEBA 3K5LA 3OLAA 1W25A 2ATLA 2CDRB 3ILIA 2BM1A 4ZHRB 3EVMA 2H51B 5CH7B 2CNKB 3JAMY 1RT4A 3JYTA 4G3IA 3W2VB 3THPA 3DMJB 3EPGA 1I94J 2J6TA 2DXDA 4DV1J 5J2QA 3QNWB 2YNGB 4ZVOB 4UT4A 1X9SA 4QJVA 4AUKA 1U1RA 3TVYA 1UVKA 4C8MA 2AWZA 3HKZD 4WBFA 3T1HJ 5T7LB 2RQKA 5A76A 2ZFHA 1Y3JA 4OI2A 2IAJA 2ZZTA 4WFNQ 1DTTA 2HNZB 4H4MB 4IFVB 1TMJA 3NOGA 4FZVA 2Y9HA 2LDYA 4AT1B 1PO6A 2MKJA 4EZ6A 2FHJD 3O3LA 3IXQA 3CJKA 3X3UA 1V3ZA 1IM6A 4NLVA 1AW0A 3M8ZA 3DOLB 1B3TA 3I5BA 2HHXA 4U7CA 4KT0C 3GIJA 2JL9A 3GCWP 3DYAA 2MKYA 3KG0A 1FRLA 2EBEA 1RT5B 1U1QA 1RTIB 4DR1J 3ISNC 3TJ8A 1LWCA 2I5JA 2X1BA 3UVJB 3QGPA 2PSZA 2LQ8A 3PJ9A 4RBTA 8ATCB 4M5LA 1TKTA 1UW4A 3PCOB 4UF4A 2X1GA 1D9FA 3MFIA 3OJSA 4X2BA 3OFEA 5HQMA 4CNZA 1FXDA 3W3SA 4ZVRB 3M6UA 1WJ9A 4HH0A 4B17A 2H5IB 3D0GE 3H4BA 3HHKA 3ZTRA 3C8YA 4QWAA 3J81U 1FDNA 3BPSP 1ZAWA 1ZH5A 2VODA 1U25A 4U8YA 3MGJA 2XLIA 4X66F 3QWUA 4OJGA 3RW7A 2GW8A 1JLAA 2Z58B 2DITA 3T5LA 1MMNA 1PC5A 2IIHA 2JDJA 2GO8A 2HAIA 1RWOB 1NJZA 2L3MA 1FKPB 1FVQA 1RT6A 1WUUA 1RU1A 3PACA 1PYSB 4CH1A 2A2CA 4MIWA 4LJMA 3T9ZA 3KHLA 1RBAA 4OYXA 2MKIA 2JNJA 1DBDA 1A7GE 5B0DA 1QSYA 4YEAA 3DLJA 4DF4A 2WONB 1N6QB 3IBCB 1BWVA 2DNYA 2WSFC 1JJCB 2ZBCA 1TVRA 1Q7YT 1WC0A 3O44A 3CNQP 2O67A 3HFKA 4NA3A 3G86A 4JV5F 1D8ZA 3K2YA 4O0IA 2GIQA 4HVZA 5KFLA 3BGRA 2YKAA 3J80U 3OFFA 3QWPA 3M7VA 1BY9A 3GP9A 1N0UA 3CWJA 1DRZA 1VISA 2XBPA 5CQGA 1EB0A 3DRSA 2DNKA 4B08A 3E01A 2L9WA 1T03B 3BH6B 4C8NA 4QIFA 4NLDA 4C3LA 1BQMA 4FXWA 4KIAA 3CT9A 5HMYA 2FVQA 1IBCB 5GVQA 4AE5A 4MFBA 2C2KB 2HIQA 4OHYA 1T9XA 4RNFA 5M2UA 2DB1A 1RSCA 4DXLA 2CVIA 3D4JA 4B3TJ 4G1QA 3TA0A 4I7FA 3DLEA 2RQMA 4DPOA 1QUPA 3FUYA 1KN6A 1RLCL 2EVZA 1QE1A 2FJBB 3MI7X 4BCAA 2CNNB 3IM8A 4AYBD 1U0HA 2DNLA 1T02A 2GVDA 2YKOA 5DQHA 1KTQA 4OL8A 2AW0A 3MUMP 2FC8A 1IWGA 1P6TA 1MWQA 3EZOA 2FD2A 4F3QA 3DOKB 1KWMA 1B70B 3QBCA 4GKJF 1RAAB 5KFCA 2AJ4A 3P49B 4AL5A 4C4WA 2R2UA 1W2IA 3VQSA 2F9DA 3GR1A 2DIUA 1WC6A 5DZ6A 3JYTB 4JV5J 3CCUS 2KFZA 2V69A 2B4OA 3BR9A 1CQMA 1H98A 3HHLD 2IM0A 3FNNA 4KFBA 3MXHP 1RWUA 2LQJA 4WYWA 3JQMA 1HNIB 2GZOA 2UXDF 4QWDA 1WEXA 2NXCA 3LA0A 3MOJB 2GVZB 4MYUA 1C1CB 3H2VE 1VQYA 3ITHB 2PFDA 4DI6A 5DLGA 3G6ES 1F2HA 4USJC 2HS4A 1EP4A 3QT5A 2KKHA 1BQNA 1YZ6A 2RU3A 3DXBA 5ETMA 1Z1ZA 3HHLB 4ZJOA 3IG1B 1LFWA 3CXCR 4A8QA 2K1RA 4K4YA 4OYMA 3OTDA 4RWXA 3UPFA 2DISA 4DFKA 3PX6A 3G82B 2DPJA 3HVWA 4NPOA 1RWWB 1IR1A 1RWVB 4ZIWA 5A2QU 2VOPA 4G1PA 2QL9B 3KLEB 4FBTA 3E51A 2AX1A 2DHSA 1FWPA 3R5GA 1WOSA 2EFOA 2JH3A 2ZWPA 1S59A 5KFIA 1OPIA 5E3CA 4M5JA 4TKTA 4P72A 1VHFA 2MKSA 3VALA 1SL0A 2KYZA 2VG6B 3HVTA 1N54B 2M52A 3HK2A 2YQ3A 1ZZNA 5EWFA 2EKNA 3U1LA 1M5PC 3MM6A 3P6YC 1HQ2A 4NE9C 1ZM4A 1G1XA 5LJ3Y 2FY8A 4HTIA 1AZSA 4GKJJ 4HHHA 4KKOB 3MD3A 1N56A 1RWNB 2PI5A 4ZPBA 7FDRA 1EKSA 2GX8A 2IVMA 3HSZA 3TRGA 2DH8A 2HZVA 1NKEA 3BGUA 1YWXA 4MKBA 3SCKE 1FJGF 4YMEA 3BQ1A 2ZUGA 1CULB 1RTJB 2UXDJ 2HGLA 1GFWB 1ZAXA 1R7IA 4WE1A 4FXDA 4OHXA 4UOFA 4LR8A 2QGFB 4O4GA 1OS5A 2ZC4A 4ZJLA 3ZZZA 5D78A 1U48A 1IKVA 3NGRA 3RZAA 1SVDA 2V8GA 2R8KA 1YGYA 1XMBA 4M94A 3MECA 1CG2A 2FVCA 1FFSB 4KE5A 1TKDA 5HVGA 3HMJG 1Q8LA 1RI7A 3OTOF 1YBUA 2J7UA 4GC6A 2LFVA 5I3UA 1RJJA 4OV1A 3W7BA 2OH2A 3H98A 1X60A 2GHVC 4FKXA 3IC1A 3K5PA 4DV2F 2HAFA 2L48A 3WC2A 3SCJE 3KJVB 5DS7A 4YR3A 3M6WA 3BM7A 2YKNA 2XY6A 2HQCA 3E8OA 1OYDA 1BQMB 4NLOA 3LWMA 4DL2A 3HT0A 3SSQA 2UXCF 5G4DA 2BABA 2FZKB 2V68A 4DLEA 2GNKA 5B0BA 1D8YA 1EIYB 1X5TA 2G0JA 4ATNA 1P1LA 5L46A 3G6YA 2HHTA 4WZMA 2YWWA 4QPXA 1KBRA 4B3MF 4IDKA 5C2CA 2RT3A 4PG6A 2CJXB 4WU3A 3NMRA 4DS5A 1IM4A 1RKJA 2BE7D 1V9OA 2ZH3A 2UUCJ 1FJGJ 1HQUB 3GSDA 5HMZA 1YJ7A 5E5NA 5HP1A 3KLVA 4CH0S 3IS9A 2C2NA 4PEOA 5IWAF 3OUYB 1RHKB 1J27A 2CPZA 1QLNA 3ONQA 2ZVSA 3PYGA 2FJVA 1EHWA 5F3TA 3M32A 5RUBA 1I5OB 1JLFA 3CD5A 2MDAA 5HROB 1Q53A 4RPFA 4WWSA 1AXQA 5B09A 2CNOB 3P96A 4P10A 3OQ2A 3NNAA 3FEXB 2VH7A 2D7SA 5HN0A 3EPIA 2J9CA 5IXUA 4USIA 5KFSA 4OJ3A 1PKUA 2YWGA 4K59A 1XQIA 4OZNA 5KT4A 2CQ2A 3K8WA 3GCXP 2JFDA 4I6AA 1HNVA 3UNYA 3MM9B 4M95A 3OTOJ 1Q7LB 3GB0A 3BV8A 3FJ2A 4O3OA 2V8DA 1N88A 2ZE2B 1UZHA 5L1KA 2IDEA 2GGPB 3M30A 1NUEA 4DV2J 1VQ5S 4MYTA 3AFGA 4Y2KA 5D3GA 5C7PA 4JV0A 1GT8A 3KUGA 1HA1A 1S97A 1YJTA 3THVA 3KNGA 2FGOA 1NDCA 2CVEA 2MQNA 4GO5X 1SJFA 2CPDA 3TZYA 1L3KA 2UXCJ 3UW1A 2DH7A 1TKXA 4DX6A 2E5IA 4F4AA 3W9HA 1TL4A 4AXJA 1NK6A 4DSFA 3NOCA 2R3VA 3P8BB 4LR9A 4RNHA 2OPSB 1YKWA 4JI8F 5A8WA 2H5EA 4R8UB 3MTKA 4NXMF 1NNDA 3EICA 3IO1A 2DY9A 4O3SA 1PJ6A 4OLPA 1VQ6S 2N4DA 1WC1A 5KFMA 4AFFA 4B3MJ 4R0EA 4QW9A 2KT5A 3AD8C 1SKRA 4JI7F 4PZVA 3PZPA 5F8JA 1HL6A 1UJ5A 3QRQA 1RTHB 3TA2A 2M5YA 1TK5A 3C14A 4L73A 1FX4A 1NSAA 1RGVA 3CCLS 3I0RA 4B9MA 3MHYA 1FK9B 4X64F 2QMXA 1FX2A 5ETPA 4ZVUB 4A8MP 1H0HB 4L6V3 3DHXA 1IJFB 4F4YA 4P9SA 4HHUA 3D1HA 4LRAA 1FI4A 1WDDA 1TL3A 2G13A 4I6WA 1YJVA 2OPRA 4BC7A 3MAAB 1X7VA 4XDDA 1SKSA 4LF4J 3W1YC 2OD4A 1VK8A 3OL9A 2B56A 4J9OA 2E9TA 3WDOA 1Q78A 1B4SA 1FWKA 1HMVB 4X4RA 2W4CA 4FF4A 2GC8A 2VPYB 2J5AA 2IA6A 4I2PA 4TU8A 1F0XA 2XCPA 1CEZA 2KFNA 4XIUA 1C4AA 2R8HA 2KT2A 2LLZA 1U1LA 4L74A 1S77D 1OPZA 4WP9A 2NUHA 3K8VA 3NG8A 4QU6A 2DGSA 3IRXA 4X65F 4CP5A 3FBFA 2D3UA 5K8OA 4M5IA 4Q2LA 1U09A 3HKWA 4K4XA 4ZDNA 2PD1A 1NH8A 3MEGA 4USHA 1BUXA 4QIVA 2HRTA 1CJVB 4KAIA 4RUHA 4JI8J 3U27A 1FKOA 4NXMJ 1T3NA 1WSVA 5HBMA 4F0HA 1VGYA 1REVA 2AYBA 4UY85 5IT9Y 3EZ5A 2HG4A 2CNLB 3UN2A 3CW2C 2KXFA 3CJQA 4JI7J 5LMUF 5KG2A 4ES3A 2HNYB 2ZDPA 4HLBA 2B4VA 4P2SA 1EETA 2WVCA 2RNEA 2WK4A 4WZQA 1RK8A 2WVBA 4ZCLA 1WSRA 1Q0NA 1S9GA 1RA7A 5K14A 4X64J 3MM8B 1NH7A 1XNQF 4LSNA 3QIDA 1XJWB 3HVRA 1TKZA 2JC1A 2RS8A 3HP6A 3AD7C 1KLMA 2IM3A 3HI9A 2F63A 5HO4A 3KMQA 3QAUA 4O3RA 2E1PA 1CJKB 4LIWA 4ID8A 3DKDA 3NGKA 1DTQB 3D6TB 3FCHA 3BSOA 1N8RT 5T41A 4ZCIA 3CO0P 4ED6A 2OPQA 2ZKUA 4R5PA 1T9UA 1NKBA 3LOUA 1GXLA 2RKIA 3TUPA 2AQ4A 3C2PA 1WHWA 5B0EA 4F4WA 2GS8A 1SUQA 5H9FJ 1WF0A 1UAWA 2AYMA 1S4EA 3I6PA 3J7Z5 1BHNA 4ZVPB 4P6QA 2CQGA 1SC3B 2ZOGA 4LF7F 1RABB 2LEAA 4WPAA 3H5XA 3I0SA 2BANB 1V3SA 2CJYB 4ID5A 3T3FA 2E7XA 3NLCA 1VBYA 3OSPA 1UFKA 3DLGA 1U4BA 5KOWA 3G8SA 4WKYA 4PWWA 1FKAF 5F3ZA 4DCJB 4NLYA 1SIWB 1VBZA 3UDVA 4Q5VA 1M1KT 2QRRA 4LF8F 2PDAA 4NLWA 4Q8FA 3CD7A 5U47A 5D3GB 4NZ6A 1WTFA 2XWYA 2QC3A 1X5PA 3MPWA 2IBKA 2W7OA 1S9FA 5LMUJ 2K3KA 5D8HB 2VC1A 2XNQA 5KT7A 3J7YI 3US5A 5C42A 3ZTQA 4CO2A 3BYPA 4DR2F 3Q8SB 3JTNA 3ZZUA 2V5HG 2HVZA 4DCOB 5F0UA 4C2MA 4A8YA 4HDGA 1TV6A 1B0PA 3OVBA 3PXGa 1W2BR 4B02A 2GHWA 2FTRA 2YWKA 5THWA 2E9ZA 5A0YA 3A4TA 3K0JA 4JI6F 5A6PA 4URGA 2DHXA 2E1AA 1HR0F 4WKRA 3BF4A 3JSYA 1T05A 1LOUA 1F5CA 4DQQA 3D28A 2DR9A 3OBIA 2AV5A 3DRYA 5KFFA 4ES2A 1URRA 1N5YB 3CD0A 2OEJA 9ATCB 4B9SA 3QIPB 5C25A 5HLFB 2YX1A 1MW7A 2XLKA 5GAHI 4QIEA 1R8CA 2Q79A 1CVJA 5DQIA 3QLHA 3IBWA 2BA9A 1RAIB 1R0BG 3CJRA 4QPTA 4FF1A 1VQOS 3WBZA 4RW8A 2CFXA 1T9TA 2ASDA 2H48B 3OR1B 4AD6A 2PT0A 3Q0AA 4OI1A 3J7AN 1JKHB 1M5VC 2MMYA 3M6VA 3PYFA 2A2DA 4X4NA 2F7VA 1MROA 2ACYA 3QT6A 1GX5A 2HEKA 3TJ9A 9RUBA 4J9RA 2I2YA 5KFVA 2RAQA 3VCDA 1CSJA 2HQDA 3R5AA 4QIWD 1VJWA 2IYGA 4GC7A 4LF7J 3ET6A 4DMZA 1TUVA 4KHRA 1QAIA 4IG3B 5B0AA 2BJ3A 1VBXA 5B0FA 2C42A 2M3DA 5LT5A 2CPEA 3RU0A 3ENAA 2M88A 4URSA 3QSYB 4UZCA 1HHSA 4GVBB 5AE3A 3OSNA 3NWRA 2BKPA 3UDCA 4EI2A 3GJQB 2K06A 3CULA 2AJFE 2CQ3A 2D9OA 4LF8J 3FFIA 4X4VA 2DXFA 4RJVA 3MOZA 2V2VA 1LV5A 2VPZB 3MPVA 3NAIA 2DEIA 1EJ7L 2KT3A 3RB4A 4K7QA 3M2VB 5DG9A 3KNAA 3EGVA 2KB2A 1C0UA 4ETZA 1S12A 4DR2J 2RF2B 3HHEA 4ECUA 5HI7A 2OTLS 4F04B 4I4BA 2QL5B 1APSA 5IZHA 1QDUB 2OAUA 1K0TA 3DI6B 4J91A 4JI6J 2JEJA 1HR0J 2X1AA 2I6WA 4B9UA 4ECVA 3G4SS 4BS2A 1U24A 2MQPA 2Y8WA 4P2MA 1OQ3A 2OUGA 2W7AA 4PWUA 2WCXA 4CQ1A 3TZXA 1U0SA 3UI3A 2DCUB 2HRYA 2XZWA 1JQGA 4CYUB 5KFXA 2RD5C 4PQAA 2XS7A 4FKYA 2X1FA 3M9OB 4DUYJ 5D15A 3BSAA 3R5JB 2AKWB 4H4KC 2IVYA 2DKOB 4PPDA 2MGZA 2GAGC 3HF5A 5EWEA 2DXEA 3ISND 2RS2A 4ZPAA 4EBCA 3GONA 4N77A 4EMDA 2C3YA 4CCHA 3ILLA 1R89A 1RHJB 3HXMA 1VQLS 3C3LA 4GKKF 3TAMA 2DRBA 1JLQB 2M7SA 2D74B 2XMMA 3F44A 3FBCA 1A6LA 1WOPA 4USVA 4DU8A 4IKAA 1U1OA 2AEJA 1T11A 1VQMS 2EBGA 1U1MA 3TX8A 4FNHA 2MXYA 1U2RA 3NMAA 3CJ4A 4RU9A 2C2MB 1XK8A 2RSQA 4ECWA 3SZ2A 3DGPB 4NZ0A 1FERA 3OJUA 1S9EA 3HHLC 1Z2LA 1YBAA 3AA9A 1RBOB 4RBVA 1IKYB 5CHCB 3ISZA 2RDDA 3BGLA 2XQCA 3MM7B 1HWKA 2AYGA 2XM3A 2FJWA 3NRBA 2QMWA 1AA1B 2V4JA 1X4EA 2Q6BA 4Z2XA 2B51A 2V50A 4ID5B 2FVSA 4IR9A 3H90A 3ILOA 4RWWA 4DJBA 1VBKA 5E3RA 2VDIA 1ELOA 4A4JA 1SJQA 2RUSA 3HSGA 5KFHA 2HFZA 1SH2A 2F8HA 3RB3A 2AIRB 3IBFB 1JIHA 2QTWA 2XS2A 1DQAA 4ED2A 3PW7A 2HHVA 5IM0A 3OFGA 4JI0F 3N5BA 1E6VB 1Q8KA 2ILZA 1KSPA 1KQGB 4DV7F 1IBLF 1HIYA 2RU9A 2UVRA 3IP0A 5CA5A 4F2RA 3W8GA 3AD9C 4NLUA 3CMAS 1TV6B 3RAXA 2OI2A 3CCJS 3GG1A 2J0WA 1SC6A 3PTWA 4X4QA 3Q8RB 2MZSA 2KU7A 3N0VA 2HBRB 1YTYA 1VRTB 3U7JA 4WIQA 4ICLB 3W65A 5LXYA 3I55S 4QIGA 1HBOB 2YKMA 4ZCMA 5IC6B 2R7QA 3KLIB 1JXEA 1S0MA 1FD8A 3BSNA 3UR3C 1IN0A 4GKKJ 3R5BA 2V9WA 3CCTA 3OW2R 4DQPA 4W4MA 1F60B 3FSXA 5H9FK 3ENVA 3OD2A 5DG7A 4FYWB 3P3DA 3CVKA 1NPKA 2V94A 2DD8S 4LFBF 4ECXA 4DSEA 1JLGA 4I67A 5L8RC 2WBMA 4Q8EA 4JI4J 1RP5A 2CZVC 2BM0A 3ENQA 3T19A 1FNMA 3TAPA 2KL8A 1Y00A 1EX8A 3RRGA 4LRDA 3A8EA 4CT9A 5ETKA 3CC4S 4HHJA 2XC9A 4DG1A 1JLBB 1Q16B 4Y28C 4I56A 1VJQA 3C16A 2LECA 3RB0A 3BB5A 2VQFJ 3TUIC 4JYAF 1GMVA 1I1GA 3M1VB 3EGWB 1B64A 5KFOA 1H3DA 3W62A 5KFNA 3D3CJ 5J2MB 3SMZA 2LYVA 5EX3A 2HVEA 3EJMA 1OWXA 2E5LF 1Q5YA 3AOCA 3BKFA 1P8GA 3RBZA 3GIIA 1RXOB 2G1DA 4CLWA 4JI0J 1NPPA 2MZRA 3KYLA 1K9MT 5CAAA 4DV7J 1IBLJ 1UVMA 2BJ9A 3F0NA 4P74A 3EWGA 1S1UB 4YQWA 3ZTPA 4DV6F 5I3PA 3OXLA 2MZTA 2QSWA 1NLKL 2HVDA 4Y3CA 1CLFA 4JBCA 1FHTA 3MMBB 3W66A 2DJWA 1UVJA 1RAHB 2OPPA 1QTNB 1IQTA 1EZZB 3R1LA 4E8UA 3R2DJ 2IM1A 3PRVA 4N76A 1S1WA 3HULA 3PRBA 2QLBB 4B3SF 4B3OA 5MAOA 3LP2B 4QYZK 2VF3A 2HQGA 5BR8F 4J9QA 2AT1B 3M4XA 1S1VA 2I38A 3VGTA 4DS4A 4C11B 4M5DB 2WVDA 3TVKA 2HWIA 4LFBJ 1NHUA 4LQ9A 2CWKA 1VIXA 3FQKA 2G2ZA 3DLKA 3MTJA 1XWLA 4MMOA 1RAGB 1L3VA 5DG8A 2A1BA 2F4VF 1RYSA 2AX0A 4O44B 4OYOA 2R42A 3RAMA 2XNRA 2W9AA 2AJQA 2HIYA 3QO9B 1U1KA 4FF2A 4OQJA 2R7VA 3NNHA 3SXLA 2ASJA 1LWEA 1J5OA 2HFVA 3M9NB 4JYAJ 2PMWA 2NXNA 1JLCA 4DL0C 2KFYA 3TA1A 2V9KA 5HQ8A 1R43A 3MFHA 4QR2A 8AT1B 4NRTA 3Q24A 2JFKA 3KHGA 2E5LJ 1BD6A 1S9EB 2B4UA 3MR6A 1AUSL 2BJ8A 3S7RA 4GMKA 4CO5A 2AD9A 1IKWB 1RYRA 5DETA 4IO1A 5E0OA 4UY8T 3R1HA 4TVAB 4LBPA 1R8AA 4HACB 3CMQA 3JTOA 3L9ZA 4DV6J 3G8TA 4LRFA 1UPMB 2NZCA 3KK3B 3ZNJ1 2QEXS 2H65B 2YBVA 3NGUA 2Q3PA 3IGNA 4GO7X 4KV8A 4QR1A 2ZJRQ 2B5JB 3VVTA 4PG4A 4ZMMA 1IUJA 2WTFA 2ACMA 4URQU 4ZP9A 3TJAA 4B3SJ 2DYAA 1AB8A 5E33A 1V5VA 4KBIA 1YG0A 1S0VA 2F9JA 3BO4A 1EARA 5DDRC 2RILA 4ZITA 5AE1A 4CLYA 2N3LA 2BE2A 4TLRA 4MKAA 3TWZA 1SCJB 1T9YA 3ZZYA 4AL7A 4RUAA 4FXVA 3GJSB 2MKCA 2D3ZA 1MWZA 1E6YA 3AAWB 1ICEB 5ETNA 5KFBA 4NA2A 2JZ5A 1SH3A 5CYQB 3DXSX 3TARA 5GAHU 5J2PB 2OLWA 2F4VJ 2XYPB 5I42B 2VPXB 3NBPB 3CD6S 1L3SA 2HQIA 2XCAA 3W5YA 4Y34A 2H3EB 3PDNA 1QAXA 3MMCA 1X0FA 2OHDA 2CJBA 1N5QA 1NPRA 5HK4A 3J7ZT 4V19J 3FSIA 2G9OA 4Z7YA 5HL7Q 2RIJA 3U02A 4CTAB 2ZJPQ 2EFPA 4A8FA 2V6AA 4RL1A 3IFEA 3W8PA 4RUCA 2IJRA 3H5SA 3H25A 4ZLJA 4N8OA 2VFRA 3M6XA 3MUTP 1FFWB 3KLFB 3MZIA 2I9SA 4WFBQ 2W9CB 2DGVA 3QT7A 2MTLA 1JLEB 2F5GA 3M9MB 1I51B 5IOLA 1C1BB 1FCAA 3PHTA 3B4DA 2RRAA 3AY0A 3KWMA 2HPUA 4KPCA 3W2VA 4FS2A 3DMJA 4DPWA 4CLKA 2PEHA 4UQTA 3G87A 2V8PA 2ZH4A 1WNEA 1D9AA 4OI4A 5B0GA 4N56A 3TAQA 4HKQA 1DY3A 2ROEA
chains in the Genus database with same CATH topology
1EHWA 4F4AA 3EVMA 3ZTQA 3VGUA 3Q8VA 3FBCA 3EVOA 1W7WA 3VVTA 3ZTPA 1S5ZA 1B99A 1WKLA 2BX6A 3Q8YA 1NDKA 3ELHA 3NGSA 4DUTA 3Q8UA 3R9LA 1VYAA 3B6BA 3PJ9A 1NLKL 1B4SA 2HVDA 2DYAA 2DXDA 2B8PA 1MN9A 3JS9A 3EICA 1HIYA 3BH7B 5BXIA 2DY9A 4ANCA 1LEOA 4UOFA 3NGTA 4S0MA 1KDNA 4DZ6A 1NSPA 1S59A 3EMTA 4ANEA 3EM1A 1BHNA 1PKUA 3BBCA 3EVWA 1XQIA 3PRVA 3BBFA 3ENAA 3VGVA 1HHQA 2VU5A 1S57A 3ZTOA 4UOGA 3NGRA 3FC9A 4FKYA 1NSQA 1MN7A 1NDLA 1U8WA 3ETMA 1WKJA 4WBFA 3WX8A 4UOHA 3Q86A 1LWXA 4CP5A 1JXVA 1BE4A 2NCKL 1HLWA 3FBFA 3MPDA 3FKBA 2HURA 1XIQA 4F36A 3ZTRA 2DXFA 3GP9A 3VGSA 3VGTA 5IOLA 1NSKL 3Q89A 3L7UA 1NUEA 2DXEA 1UCNA 4DI6A 2B8QA 2HVEA 3EJMA 4ENOA 4HR2A 4KPCA 1NB2A 1BUXA 3G2XA 5C7PA 4W98A 1NDPA 4EK2A 3FBEA 1NCLA 1NHKL 1F3FA 3BBBA 2BEFA 2CWKA 4C6AA 3FBBA 4ANDA 3B54A 1F6TA 1PAEX 3EE3A 3FCWA 1NDCA 2AZ3A 2ZUAA 3GPAA 4FKXA 4O0NA 3BH6B 1ZS6A 1WKKA 3FCVA 5CABA 3Q83A 3ZTSA 1K44A 2AZ1A 3DDIA 1NPKA 3NGUA 3DKDA 3VVUA 5CAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EHW A;  4F4A A;  3EVM A;  3ZTQ A;  3VGU A;  3Q8V A;  3FBC A;  3EVO A;  1W7W A;  3VVT A;  3ZTP A;  1S5Z A;  1B99 A;  1WKL A;  2BX6 A;  3Q8Y A;  1NDK A;  3ELH A;  3NGS A;  4DUT A;  3Q8U A;  3R9L A;  1VYA A;  3B6B A;  3PJ9 A;  1NLK L;  1B4S A;  2HVD A;  2DYA A;  2DXD A;  2B8P A;  1MN9 A;  3JS9 A;  3EIC A;  1HIY A;  3BH7 B;  5BXI A;  2DY9 A;  4ANC A;  1LEO A;  4UOF A;  3NGT A;  4S0M A;  1KDN A;  4DZ6 A;  1NSP A;  1S59 A;  3EMT A;  4ANE A;  3EM1 A;  1BHN A;  1PKU A;  3BBC A;  3EVW A;  1XQI A;  3PRV A;  3BBF A;  3ENA A;  3VGV A;  1HHQ A;  2VU5 A;  1S57 A;  3ZTO A;  4UOG A;  3NGR A;  3FC9 A;  4FKY A;  1NSQ A;  1MN7 A;  1NDL A;  1U8W A;  3ETM A;  1WKJ A;  4WBF A;  3WX8 A;  4UOH A;  3Q86 A;  1LWX A;  4CP5 A;  1JXV A;  1BE4 A;  2NCK L;  1HLW A;  3FBF A;  3MPD A;  3FKB A;  2HUR A;  1XIQ A;  4F36 A;  3ZTR A;  2DXF A;  3GP9 A;  3VGS A;  3VGT A;  5IOL A;  1NSK L;  3Q89 A;  3L7U A;  1NUE A;  2DXE A;  1UCN A;  4DI6 A;  2B8Q A;  2HVE A;  3EJM A;  4ENO A;  4HR2 A;  4KPC A;  1NB2 A;  1BUX A;  3G2X A;  5C7P A;  4W98 A;  1NDP A;  4EK2 A;  3FBE A;  1NCL A;  1NHK L;  1F3F A;  3BBB A;  2BEF A;  2CWK A;  4C6A A;  3FBB A;  4AND A;  3B54 A;  1F6T A;  1PAE X;  3EE3 A;  3FCW A;  1NDC A;  2AZ3 A;  2ZUA A;  3GPA A;  4FKX A;  4O0N A;  3BH6 B;  1ZS6 A;  1WKK A;  3FCV A;  5CAB A;  3Q83 A;  3ZTS A;  1K44 A;  2AZ1 A;  3DDI A;  1NPK A;  3NGU A;  3DKD A;  3VVU A;  5CAA A; 
#chains in the Genus database with same CATH topology
 3ADA C;  4X4S A;  4A8S A;  3M2R B;  4EUV A;  1WKL A;  5T7L A;  4X4O A;  2MHN A;  5ETO A;  2XLJ A;  3R9L A;  3M05 A;  4N47 A;  2HNZ A;  4H4M A;  4IFV A;  1K1S A;  1OY6 A;  4PAA A;  3DM2 A;  2NXJ A;  1ITP A;  2EEY A;  4DUZ J;  1NHV A;  1F5B A;  4A8W A;  3LGH A;  4NL5 A;  3QJJ A;  4J9M A;  2CAJ A;  3VV2 B;  1RIS A;  4QYR A;  4CI0 B;  5GAE I;  1XMO J;  1KFS A;  4BC9 A;  3DOL A;  3KG1 A;  2UZA A;  4UQG A;  3CED A;  3MCM A;  2HMI B;  1U8W A;  2DGT A;  3HJV A;  2VBZ A;  2R4F A;  2NCK L;  2C22 A;  4F02 A;  3CDU A;  1RT5 A;  1RTI A;  1HNW F;  2FPH X;  5KG6 A;  4ENO A;  1MMD A;  3UVJ A;  3MED B;  3W9J A;  4EBE A;  4LRB A;  1XR6 A;  2JC0 A;  2KI2 A;  3GQC A;  1GNK A;  3R5D A;  4P73 A;  4F2S A;  1X4F A;  3MMA B;  5D4N A;  2R7S A;  2JRS A;  2Y8Y A;  1RT1 B;  3Q8Q B;  3UQS A;  4XK8 C;  1MU2 B;  2DGW A;  3NNC A;  5CYM B;  1HQE B;  5LXR A;  5LMN F;  2Z30 B;  5FDL B;  1KLN A;  3W2W B;  5DJB A;  5BXI A;  1CS4 B;  3ZNU A;  2ZDO A;  2FLN A;  5F0W A;  3T1Y J;  3BQ2 A;  2ZH9 A;  1T0T V;  1VRU B;  2HYI B;  5IC4 B;  4DF8 A;  3D5M A;  2UUB F;  4CLF A;  2EXU A;  2B6A B;  4DBQ A;  4LF5 J;  3AJ1 A;  2LQ9 A;  4DV3 J;  3FGV A;  4ZIV A;  3ZZR A;  1FKP A;  1FRH A;  2Q1L A;  1ZA1 B;  2VAS A;  2V67 A;  3G6V A;  2PN6 A;  2DO0 A;  2GMJ A;  1SKW A;  5CCM A;  4PG8 A;  3S1T A;  3O2I A;  5E7O B;  4NLR A;  1DAR A;  5BYQ A;  2WON A;  1N6Q A;  2YNH A;  1G2E A;  1WTB A;  1UWB B;  4F25 A;  2XEX A;  1IWA A;  4L72 B;  5AXM A;  2VFT A;  3W5X A;  3VGU A;  3MUV P;  2POK A;  2QT7 A;  3PEH A;  4ZCK A;  2VFV A;  3RYL A;  2ZBP A;  3HD2 A;  4LF6 F;  5A8R B;  2HND B;  4YR2 A;  3HT3 A;  1ZTW A;  1RLD A;  4K5R A;  2YPY A;  1RAE B;  4USW A;  2XZT B;  1HNW J;  4CLL A;  2QLX A;  1V5I B;  3HFZ B;  2BZ2 A;  4FVM A;  1M5S A;  5KFY A;  4DN9 A;  1QVF R;  1T03 A;  1Z4U A;  4QQB A;  4YB5 A;  4MK9 A;  1NK9 A;  1HLW A;  1RT3 B;  1YBT A;  4CLU A;  2KHC A;  4PXB A;  4E2F B;  4CRJ A;  1NJY A;  4I2Q B;  1EKR A;  5JUM A;  1NDP A;  1AT1 B;  5CCL A;  2LQB A;  2ZWO A;  1UTA A;  2CG8 A;  2CA9 A;  3C6T A;  3LH2 S;  4LF2 A;  2ZH2 A;  1SC4 B;  2HQF A;  2W2O P;  3CJ3 A;  3T1A A;  1NME B;  5T14 A;  4DEZ A;  2ZVI A;  4RW6 B;  3PYE A;  2C28 A;  2DNN A;  2ZZM A;  1HW9 A;  1W26 A;  3BO2 A;  3K5M A;  3ZZO A;  2UUB J;  4ZLP A;  1VS3 A;  4LVN P;  5L39 A;  1X4B A;  3D9B A;  4B9L A;  3DNC A;  4DR3 J;  3ETO A;  5FLX Y;  1TK0 A;  5LL6 d;  2DGO A;  2N3O A;  1B7Y B;  2XHW A;  3V6J A;  2ZNY A;  3DC2 A;  4ZKA A;  4RU2 A;  3X1L B;  3KLG B;  4DR7 F;  3UN3 A;  2K3I A;  1T94 A;  3DOK A;  1YX2 A;  4YN3 B;  2OMO A;  3E2E A;  5L9N A;  5EDW A;  4H4K A;  1AYE A;  1NSK L;  3F41 A;  1S6O A;  3M8R A;  3R7B B;  1K8A T;  3JAM U;  3NS7 B;  1NBE B;  3GIK A;  1XC9 A;  5KFK A;  2Y1J A;  4DQS A;  1QAJ A;  3R27 A;  1VFJ A;  3M8P B;  1O5J A;  2Z2Z A;  5B0C A;  1ZM2 A;  1D09 B;  4LF6 J;  5KFJ A;  2PII A;  2HLU A;  2OD6 A;  1HNI A;  2APO A;  2I0X A;  5L1L A;  4IG0 B;  2YNI B;  1VCT A;  1CBK A;  2Z0G A;  2GVZ A;  5SUH A;  1VQS A;  3MM5 B;  1BLU A;  4P75 A;  1C1C A;  1N34 F;  3T5K A;  2C3M A;  1HI1 A;  1RT2 B;  3ITH A;  2W8L A;  4Y6I A;  4EWT A;  3EMT A;  3HHN B;  2EK1 A;  2DNZ A;  3DCA A;  3VQT A;  3DM2 B;  3HHL A;  2DPI A;  3IG1 A;  2MPU A;  1NK7 A;  1NXI A;  3RW6 A;  2PMH A;  4BDP A;  1RA6 A;  3G82 A;  4QWB A;  2ZC3 A;  4EFA C;  3PO5 A;  1Y7P A;  2GQQ A;  1A9N B;  2XUL A;  2GFF A;  4UST A;  5K9F A;  4MJK A;  1LK7 A;  2KO1 A;  3KLE A;  1MSW D;  2KZZ A;  2KRR A;  2EG1 A;  3N01 A;  2ROP A;  3KK1 B;  1VLY A;  2IBO A;  4DFM A;  2E29 A;  2VG6 A;  3MDF A;  3R7N B;  3HPO A;  1N33 F;  1N0V C;  4DZD A;  1VIO A;  4E98 A;  2JLF A;  4DR7 J;  4ANE A;  3EM1 A;  5J1P A;  4KKO A;  3KLH B;  4V19 X;  1KQF B;  4QBU A;  1X4C A;  3AQO A;  5CXT A;  5BYR A;  4LRE A;  3L95 X;  3QMQ A;  5ETL A;  1FVS A;  1VQP S;  5G0R A;  4ECY A;  3UDE A;  2IYI A;  3KUE A;  1CUL A;  1Q82 T;  2V2Z A;  3ZC4 A;  1RTJ A;  2XTJ P;  2GAH C;  3BSC A;  3D0H E;  4C6A A;  5D0G A;  3C15 B;  1F6T A;  1WD6 A;  2O3D A;  2BR0 A;  4WU2 A;  4ZA1 A;  3OL6 A;  4OYB A;  2R7W A;  2HRU A;  2QLF B;  4DPT A;  1N34 J;  4J9N A;  5KFP A;  3IM9 A;  3RG6 A;  1XMQ F;  1M1G A;  4C7Q A;  2YNH B;  3LAM A;  2CQ1 A;  1M1H A;  1J5E F;  1PJ7 A;  5EX0 A;  5EUH A;  2ZBR A;  1TL1 B;  2MB0 B;  2E5H A;  5HAN A;  2H4W B;  2DNG A;  5KFD A;  2J6U A;  1WI8 A;  2FQQ B;  3F56 A;  3THT A;  4DL7 A;  3MR7 A;  5K8M A;  4Z37 A;  1S6Q B;  2VU5 A;  3JTP A;  4K8R A;  2V34 A;  2Y0B B;  2L08 A;  2ALY B;  1KHV A;  5M2P A;  1UL3 A;  4DDF A;  3DOM A;  2CJA A;  2FZC B;  3T6J A;  4IFY B;  4P2F A;  3KJV A;  3BZQ A;  2P8I A;  4WCE Q;  1MWY A;  4OZJ A;  3UO0 A;  4CZC A;  4HDH A;  3JXO A;  4LR7 A;  2J76 E;  1RUS A;  2BJ1 A;  4W98 A;  1HYS B;  2BMB A;  4TY8 B;  4ECZ A;  2BYC A;  1M5K C;  1T7P A;  1N33 J;  5FJ4 A;  3FMW A;  4DQI A;  3KDN A;  2MLY A;  3C6T B;  2YWE A;  4JB8 B;  5ETV A;  4NLP A;  4OYA A;  2QN6 B;  5CD4 A;  2JJ4 D;  5F8G A;  4ZN3 A;  3H4D A;  4PRF A;  2FLL A;  2B7B B;  4C97 A;  1FJ7 A;  1KKH A;  4NI2 B;  5CZV A;  3OL8 A;  4X66 J;  4DV0 F;  3CJT A;  1YVF A;  1PGZ A;  2ZHA A;  1Y0H A;  2ZJQ Q;  1YJ9 S;  3VGV A;  1HQU A;  3UCG A;  2HBQ B;  4CIO A;  2ZEJ A;  3CDA A;  4WTY A;  1FRM A;  2KXN B;  4F4X A;  3T5J A;  4WFY A;  2DK2 A;  3OUY A;  4DN0 A;  4H54 A;  3TUZ C;  3MEK A;  5GMK a;  5LJ5 Y;  2BJE A;  3OTB A;  2BJD A;  4RW9 B;  4RW4 B;  4I64 A;  4FN5 A;  1OY8 A;  1LXN A;  5HRO A;  1NM2 A;  2VG5 B;  3UWT A;  3PFE A;  1XMQ J;  1X0P A;  1XR7 A;  3DRP B;  1J5E J;  1CJU B;  2R8G A;  4DQR A;  4A8X A;  3CCR S;  2HVH A;  1XER A;  1S1X B;  2F40 A;  1K0V A;  2CUY A;  3QRP A;  5IS2 A;  2XWX A;  4PXC A;  1WOR A;  3IR5 B;  3MM9 A;  3PG9 A;  4YDX A;  5KG0 A;  1VQK S;  4RKU C;  3TEG A;  2ZE2 A;  3SCL E;  2GGP A;  1WHX A;  1K1Q A;  2NPI A;  2QL7 B;  4HTJ A;  4Q43 A;  1RAD B;  2HZA A;  1ARO P;  2WRM A;  3WHI A;  1I3O B;  3LP1 B;  2FDN A;  3Q2T C;  2YWF A;  2WOM B;  4P7V A;  4DLG A;  3GG0 A;  3GZ7 A;  5GAE U;  2HHW A;  2Y3Y A;  4F4K A;  3HSJ A;  3RR7 A;  4ED8 A;  3TZW A;  2CJ9 A;  1R6V A;  3SCI E;  2QA4 G;  1N5V A;  1O8B A;  4XO0 A;  3VZI A;  1UZD A;  4KRW A;  2C3O A;  3ZFV A;  2DNH A;  3KTQ A;  2MZ1 A;  2OPS A;  1UJ6 A;  3G2X A;  4Q7A A;  3RAQ A;  4R8U A;  3D0I E;  1UMJ A;  1H38 A;  3M2U B;  3QJL A;  2HSE B;  2M9K A;  2L41 A;  1RDR A;  4DX5 A;  3FCW A;  2QA4 S;  5E3P A;  1O51 A;  1D3W A;  1N36 F;  3HCX A;  3HJF A;  2DR7 A;  1FRX A;  4KHP F;  5M2R A;  1L3U A;  1N5S A;  4PUO B;  2OEK A;  3CCZ A;  4DV0 J;  4OHV A;  2BX6 A;  4M5M A;  1J2V A;  1FDD A;  3ELH A;  2JLG A;  1RTH A;  4R25 A;  1FJE B;  2GQC A;  5HVH A;  4KYZ A;  4Y65 A;  1U26 A;  1SV5 B;  2KM8 C;  3OL7 A;  4NLG A;  4RUB A;  2B9Y A;  2RVJ A;  1FK9 A;  1L3T A;  4P7T A;  1QSL A;  3EVW A;  3VAF A;  1TL7 B;  1LKZ A;  3FC9 A;  5D6G A;  3MAA A;  4OYW A;  2MYF A;  2R8I A;  4DX8 H;  2UU9 F;  2WVF A;  4HR2 A;  2NQP A;  4JV1 A;  3NEK A;  1TR0 A;  1RAF B;  5G0R B;  5F8N A;  1HMV A;  4ED5 A;  2E7V A;  3K89 A;  3QZ8 A;  1HBN B;  4OMF G;  2J0X A;  3VVU A;  4J9V A;  1FNX H;  1RHQ B;  4OZ0 A;  2FYX A;  3HHD A;  5C2G A;  4DR4 F;  5HSP A;  3S8S A;  1H2V Z;  1BGX T;  1T9W A;  2D1C A;  2NXE A;  2CPJ A;  2RE1 A;  3A8K A;  5I4M A;  1Y9O A;  5KOX A;  2OIH A;  1CJV A;  3DRR B;  2PC6 A;  1N52 B;  5AJ3 F;  2AJ1 A;  2FJX A;  1VR6 A;  2JWN A;  2F1F A;  3N6L A;  2W2M P;  2E9R X;  2MLX A;  3DOM B;  4ZP7 A;  4CH7 A;  1N36 J;  2V63 A;  4TXS A;  5CD4 H;  2J0Q D;  4ELT A;  5KT5 A;  3H8Y A;  1XR5 A;  2VBW A;  2LU1 A;  3B54 A;  3C46 A;  1R0A B;  2HNY A;  3V4I A;  2QSF A;  1H6K X;  1RU2 A;  3ZTS A;  3DDI A;  2D69 A;  2R2T A;  4C8Y A;  2CWX A;  3AOA A;  4ZP6 A;  1TFY A;  3EVO A;  1WAC A;  2CQD A;  5L1J A;  3MM8 A;  5KFE A;  2CPI A;  1P9Q C;  1I6J A;  5HMX A;  4OIX A;  2LDI A;  1WC3 A;  1SB6 A;  4Y2M A;  2MZJ A;  3AXK A;  5JVH Q;  4FNI A;  2VJV A;  1FTC A;  2W2Q P;  2AGP A;  4XPC A;  2DHG A;  1N32 F;  5C24 B;  3P4U B;  1JK9 B;  1HHQ A;  2J6S A;  2COL A;  2UU9 J;  2CRL A;  3R97 A;  4KC5 A;  3VAM A;  3BKT A;  1MN7 A;  1CJK A;  2BOP A;  3K58 A;  3IR6 B;  3FZ2 A;  4OHW A;  1DTQ A;  3FKB A;  2C2R A;  2HWH A;  4QU7 A;  4CLZ A;  2VC0 A;  3PW2 A;  3EYZ A;  1BXN A;  1S1T B;  3LUY A;  3CJ2 A;  1F3F A;  2VBY A;  3OHB A;  1WC4 A;  2Y0S D;  3TO8 A;  2JX2 A;  3LAK A;  3EUN A;  2VB6 A;  4WTO B;  2BRL A;  4V1A k;  4DR4 J;  3SDE B;  1NRK A;  3VZH A;  5DM7 Q;  3DDK A;  1RTD B;  3SQG A;  1GEH A;  2BAN A;  4C8Z A;  2GIR A;  4DPX A;  3UR0 A;  4IH7 A;  5AJ3 J;  4IQM A;  5J1E B;  1U45 A;  2M4M A;  1LW0 B;  3I4H X;  4FPR A;  5ETS A;  4X62 F;  2JEG A;  3HSD A;  3KJN B;  1FWL A;  5BJR A;  3KJF B;  4F67 A;  3MCO A;  1NK0 A;  3ETM A;  5F8H A;  1BE4 A;  3V2U C;  4N7T A;  3BKU A;  1RKI A;  3QPI A;  2W8K A;  3C6U B;  4DL6 A;  3CB4 A;  2UVU A;  2ZD1 B;  2WAQ D;  1LW2 A;  2XMU A;  1FRJ A;  1YSJ A;  1DJ0 A;  1RZM A;  4NOH A;  1QSS A;  1DUR A;  4L75 A;  1RAJ A;  5KG3 A;  1UFL A;  1PAU B;  3GFZ A;  3V6H A;  1N5Y A;  5HMW A;  3I9V 9;  1UFW A;  3QIP A;  1N32 J;  5HLF A;  1VYA A;  3A8J A;  4ZJQ A;  4NWB A;  3EX7 B;  4U7U K;  3V81 B;  2XSJ B;  2HQ3 A;  5GMD A;  1IXK A;  3GYG A;  3TZZ A;  1WC5 A;  1ZM3 A;  1BQX A;  5IWA J;  4KR0 B;  2OGU A;  1FE4 A;  3DDN A;  3OR1 A;  1O6X A;  4C48 A;  3RBE A;  4DR1 F;  3FMB A;  3LP0 B;  1JKH A;  2B3T B;  5D0H A;  3QGH A;  1RQ0 A;  4RW7 B;  1UEU A;  1HNX F;  1YIJ S;  2FLP A;  1F9E B;  3PEJ A;  3CIZ A;  1T8E A;  3D67 A;  1ZA2 B;  1TUG B;  4IG3 A;  1F9F A;  1YRX A;  1KVK A;  1TAQ A;  1ZS6 A;  3TQ1 A;  2MKH A;  3MCS A;  5IT0 A;  2CQP A;  3EDQ B;  4NYO A;  2E44 A;  4GVB A;  4JI5 F;  1TEL A;  1Q8B A;  2AEM A;  2QMU B;  4KB7 A;  4ILM A;  1ZAV A;  3HM9 A;  2AJ0 A;  2LA4 A;  4X62 J;  4ZVE A;  3DHW C;  4H4O B;  2EKY A;  3MF5 A;  3S6E A;  3GTY X;  4UW2 A;  2HBY B;  2HK3 A;  1LXJ A;  2KRB A;  2R7R A;  1LEO A;  2XO7 A;  1JNR B;  3M2V A;  4B9N A;  4NCG B;  2XB2 D;  2W24 A;  2PE8 A;  1U6Z A;  1KOH A;  4OI3 A;  1ZYQ A;  4OZL A;  2RF2 A;  2NZ4 A;  4WXW A;  4HH1 A;  2CIM A;  2PI4 A;  2DTJ A;  5J2N B;  3W64 A;  5FII A;  1KQS R;  4R0J A;  3DI6 A;  3MR3 A;  3I5C A;  2DEJ A;  4BWM A;  2C3P A;  3B8H A;  5IT9 U;  4D3H A;  4KH0 B;  2YNF B;  5KG7 A;  3L09 A;  4QWC A;  3VTI A;  3U1N A;  2P2C B;  3G96 A;  2CQ0 A;  3FCV A;  5K8N A;  3Q83 A;  4NAS A;  3JSM B;  2HGN A;  2CQH A;  4CYU A;  4ELV A;  1LQ9 A;  2BQ3 A;  3M8Q B;  2H9Z A;  3EDR B;  3V4I B;  3OHA A;  1PSD A;  5KT2 A;  4JI3 F;  2JOQ A;  3EGZ A;  3C66 A;  3FEZ A;  2CZ9 A;  2DGU A;  4F3O A;  2K7J A;  2IFX A;  4PWD B;  5KT6 A;  4U7U D;  4ANC A;  1ZOT A;  1S6P B;  1DLO B;  3MWB A;  4MK8 A;  3TYT A;  2EPI A;  1K73 T;  4O4R A;  3AOD A;  5LSL A;  4G65 A;  4I6Y A;  3VAJ A;  1Q5V A;  4JP8 A;  4U95 A;  1HNX J;  1XBW A;  1KNZ A;  1HBM B;  2ILY A;  2FJD B;  4DOZ A;  3I31 A;  1DAX A;  1CC8 A;  1JLQ A;  3PJW A;  1S99 A;  3Q89 A;  3QFW A;  1C0T B;  3NP5 A;  4TU7 A;  3CC7 S;  2M2B A;  3BDE A;  2OEM A;  4JI5 J;  4LIR A;  2JEI A;  4B3T F;  1S4F A;  4CO3 A;  3J81 Y;  3DGP A;  4ZVT B;  1RT7 B;  4X65 J;  5DRK A;  5ETQ A;  1RAC B;  1IKY A;  2RB7 A;  4ZLN A;  2OTJ S;  3A3N B;  3WQP A;  1SKU B;  3MM7 A;  3CJS A;  3SQG B;  1FJC A;  2CXE A;  3V6D B;  1IKX B;  2M8D B;  7FD1 A;  4F4Z A;  1KDN A;  3HX9 A;  1GX6 A;  2YH1 A;  3R7S B;  3KK2 B;  2BJ7 A;  1UVN A;  3CCV S;  4DX7 A;  2ZBQ A;  4U6P A;  4EYI B;  3GIL A;  4Q0B B;  1BWE A;  3HO1 A;  1V6H A;  4OHZ A;  1LWX A;  2DRA A;  1DHM A;  3K5O A;  4NML A;  1CC7 A;  3VGS A;  2PGC A;  4MTP A;  2MY7 A;  4W90 B;  1AFI A;  1E6V A;  3H2L A;  5CZX A;  2DCL A;  4OYZ A;  1YZ7 A;  3OR2 B;  4WJB A;  1JJ4 A;  4JI3 J;  3IWN C;  2DIV A;  3J80 Y;  3I82 A;  1Y3K A;  2IHR 1;  2MQ8 A;  4CWB A;  3HLU A;  1LW2 B;  2Z57 B;  3SSR A;  1UPP A;  2GJ2 A;  1K44 A;  2W9B B;  4NA1 A;  3HZG A;  2Q6C A;  2F65 A;  1Y5I B;  1VQ4 S;  2BUN A;  1LWF B;  2ROG A;  1XNQ J;  2ASY A;  3MEE B;  2VFS A;  2FVP A;  1VRT A;  4RX6 A;  4OZ5 A;  2VZ9 A;  2HHQ A;  4ICL A;  3CDW A;  3P5B P;  1HBO A;  1EQ0 A;  1OIA A;  3HFV A;  2OSQ A;  2P6T A;  2RJZ A;  5GAG U;  3KLI A;  2IC3 B;  3N5F A;  1SJ3 P;  2FHO B;  3T9N A;  4M1K A;  2VG7 B;  3QT8 A;  3PX4 A;  3FZB A;  4OX6 A;  4FBU A;  1P9Y A;  2XY5 A;  1UA0 A;  3LTO A;  1S7I A;  2ZBI A;  4FP9 A;  4QZV B;  3BS9 A;  3HD1 A;  2HWT A;  1WHV A;  3QJP A;  3MD1 A;  2EW9 A;  4M5K A;  2FJE B;  3AA8 A;  2VDH A;  2GO9 A;  4PQU B;  3KHR A;  2CZ4 A;  2V2Q A;  4F36 A;  2U1A A;  4QYZ J;  1HPZ B;  3GJT B;  2V8H A;  2YPZ A;  3KG4 A;  4KO0 B;  3CCQ S;  2MEW A;  1PBU A;  1URN A;  4ZVG A;  2FVR A;  4LSL A;  4D3G A;  3POT B;  3TVZ A;  3BBB A;  5HAO A;  1Q8I A;  4ED4 A;  3PM9 A;  2DHA A;  2J9D E;  2KVQ E;  1WWH A;  2EC2 A;  2V0N A;  4ALZ A;  4JI2 F;  2EFN A;  3BGF A;  1JLB A;  3PR5 B;  3MUR P;  2OSR A;  2VL1 A;  2BOA A;  2NRE A;  3UD5 A;  2H1Y A;  3QYY A;  4ELU A;  5CYJ A;  3M1V A;  2M70 A;  2MQM A;  1IVZ A;  2UXB F;  2FHM A;  1FRI A;  5KAK A;  3CME S;  5J2M A;  3EXC X;  4TYA A;  3PV8 A;  4ZVS B;  1YI2 S;  3CJ8 A;  3AB2 B;  5AE2 A;  4LBI A;  5AT1 B;  3VAI A;  3OFH A;  4U67 Q;  1NJI T;  3G71 S;  6FD1 A;  3IR7 B;  5FD1 A;  1GXU A;  3IN5 A;  2AYE A;  2DO4 A;  1RT4 B;  1OSC A;  2GMH A;  2FGC A;  1JXV A;  5HJY A;  3D6M B;  5F8M A;  1NU4 A;  3GWC A;  3KJQ B;  1YRU A;  5J2Q B;  2J7K A;  4C0B A;  1S1U A;  1X8D A;  1IQZ A;  5KFG A;  3BYR A;  1IJE B;  4L76 A;  2DGQ A;  3MMB A;  4OV6 A;  1KON A;  3I4P A;  2R7U A;  2ZOF A;  3IWL A;  3NKY A;  1RHR B;  2FC9 A;  2IAJ B;  1IBM F;  2VA3 A;  1DTT B;  2BV3 A;  5IV3 A;  3MCN A;  5LSR A;  3LP2 A;  2W2N P;  3VHQ A;  2N7C A;  3RR8 A;  3CJK B;  3H40 A;  4DCP B;  1U02 A;  4XDC A;  4C11 A;  4M5D A;  2MSS A;  4NEZ A;  2V4Q A;  2XMT A;  5D0E A;  3DYA B;  5DLF A;  4YS2 A;  2ZH8 A;  1S7H A;  4YFU A;  5A2Q Y;  4WP8 A;  1U1N A;  2Y1R I;  1LWC B;  2CJQ A;  3LQV A;  1ULR A;  2I5J B;  2UV8 G;  4UOH A;  3OLB A;  2DBB A;  5L9X A;  4NEY A;  1Y11 A;  4DR5 F;  4O44 A;  3D2W A;  5EN1 A;  2HS0 A;  1YLX A;  4LFA F;  1TKT B;  2B8Q A;  3QO9 A;  1HW8 A;  4JI2 J;  3I32 A;  1S79 A;  3FVY A;  1YJW S;  2AZ3 A;  4HT7 A;  1R3N A;  3PW4 A;  2UXB J;  3Q22 A;  3PKY A;  2DRD A;  2IJF A;  2CPX A;  1OO0 B;  1B7F A;  1GMU A;  2VV5 A;  2RRB A;  2CKW A;  1VQ7 S;  1U2F A;  2QV6 A;  1B0V A;  1TMM A;  3GJR B;  3OXG A;  3CDB A;  3W61 A;  5I3Q A;  1JLA B;  3JSR A;  4LF9 F;  1IKW A;  2K8G A;  3IAS 9;  2UUC F;  3V5R A;  1PIE A;  4HAC A;  3SV3 A;  1OMS A;  1RT6 B;  1JX4 A;  2R7X A;  2YKP A;  3UN5 A;  2BXJ A;  3KK3 A;  2QYG A;  2B9W A;  5GAD I;  2AHO B;  1GQE A;  5F8L A;  4DSI A;  2HUR A;  2GML A;  2DT9 A;  2B5J A;  2KG1 A;  4I69 A;  2UVW A;  1ZTT A;  1U49 A;  4CM2 A;  3V4M A;  1IBM J;  2BQR A;  1TVR B;  2E66 A;  4NRU A;  1RWX B;  4FYY B;  3TP2 A;  2LQ5 A;  3FK4 A;  1YRT A;  2JVR A;  3BGR B;  1TK8 A;  2A6M A;  4ILL A;  1XN9 A;  1VHI A;  2F8M A;  2WB1 D;  3H5Y A;  4J7C A;  4WFX A;  1SQF A;  3TQE A;  2IA0 A;  3QSI A;  4RO0 A;  3QQC D;  1TP7 A;  2GV1 A;  1ZPV A;  3Q8Y A;  2N7Y A;  4NLX A;  2R2S A;  4DUT A;  4WXO A;  3B6B A;  1PC4 A;  2C1E B;  4Q2M A;  3DRS B;  4X4T A;  1G7C B;  3E01 B;  2UP1 A;  5CYQ A;  4KJI A;  3ZZT A;  3L7P A;  1RCX B;  5J2P A;  5I42 A;  2OML A;  4LBH A;  4DR5 J;  3NBP A;  2CPH A;  4LFA J;  1R8B A;  4RZR A;  3I87 A;  3L7O A;  2NS1 B;  2VKR A;  3D6F B;  2D3O 1;  1NKC A;  3PW0 A;  1WG5 A;  1JJH A;  1FEH A;  6FDR A;  4MFB B;  2K7K A;  1M0S A;  1U6B A;  1TZ0 A;  1X4G A;  4K5S A;  3TR5 A;  2ALZ A;  3A8I A;  2CJK A;  4ED7 A;  3WZ0 A;  2B43 A;  4BBY A;  1NJW A;  2AGO A;  4CTA A;  3KHH A;  4CT8 A;  5ETT A;  3G6X A;  4G1Q B;  4TLQ A;  4I7F B;  1QVG R;  4P71 A;  2LEB A;  4ZPV R;  3GFX A;  3DLE B;  4UZB A;  4LSL B;  3MR2 A;  3GMG A;  4CDI A;  3IMQ J;  1QE1 B;  4LF9 J;  1GXT A;  4CM0 A;  4E0D A;  3KLF A;  1KR4 A;  4WK3 A;  2YQ1 A;  1U0H B;  3N9U C;  2W9C A;  3NCP A;  1MLA A;  2GVD B;  2OJ3 A;  1X31 C;  2HBZ B;  1JLE A;  4LVO P;  4FS1 A;  2P9C A;  2YTC A;  4KGM A;  1C1B A;  1VLO A;  2F4F A;  2B9X A;  5SZT A;  3ZO7 A;  1CQN A;  4KH1 B;  1GH8 A;  3GV5 B;  4YY3 F;  3RUB L;  2XG8 A;  3KUH A;  4IOB A;  2LCW A;  4B3R F;  4EEY A;  2HW3 A;  5DDO C;  3TAN A;  4LF4 F;  1U8S A;  4C8O A;  3PY8 A;  1FTR A;  3M2R A;  3HVA A;  2Z2M A;  1KQK A;  2LEP A;  4NYZ A;  4KFB B;  2V4R A;  3MAH A;  2O5D A;  4OX9 F;  4A48 A;  4ZOS A;  1YHQ S;  3AXM A;  1RWM B;  2G0I A;  3ZZP A;  1M5H A;  4PG5 A;  4M8L A;  4DU7 A;  1C2P A;  1Q81 T;  5D77 A;  4ZPD A;  4UTG A;  2RH3 A;  4TNO A;  2LKZ A;  2KH9 A;  2KN4 A;  3CCW A;  2H5J B;  4EZ9 A;  1LFP A;  1TL5 A;  4PYA A;  3L3C A;  3BRE A;  2J7W A;  3NCR A;  2HMI A;  4EYH B;  4M5H A;  1EP4 B;  4MT1 A;  1OYE A;  2WSC C;  1BQN B;  5AXN A;  1KC8 T;  4PXD A;  4AL6 A;  2K1R B;  2RDI A;  2WZ1 A;  5DZ7 A;  3MED A;  2VD3 A;  1NJX A;  1HI8 A;  3GIR A;  4DFP A;  2OFH X;  3LGM A;  4OYP A;  4ED1 A;  3MMA A;  2Z2Y B;  1JXL A;  1RT1 A;  1UCN A;  1MU2 A;  3N79 A;  2C2D A;  2P9G A;  1NCL A;  5CYM A;  1HQE A;  5FDL A;  2CG4 A;  3O1L A;  2DNQ A;  3JSB A;  3W2W A;  4LUB A;  1CS4 A;  3HVT B;  2H4Y B;  2HLT A;  2XY7 A;  1AFJ A;  2N82 B;  1G4C A;  3LAN A;  3A3P B;  5D4L A;  4DPU A;  5A8K A;  4DR6 F;  3IGV A;  1VRU A;  3AQP A;  3W60 A;  2YKQ A;  3MM6 B;  1W7W A;  1VDH A;  1Y10 A;  2CPY A;  4YY3 J;  2B6A A;  4KGX B;  3H0P A;  1AZS B;  4WF9 Q;  1VC5 A;  4PCQ A;  1FEE A;  2P5V A;  4B3R J;  5EHH A;  3BH7 B;  4G6V B;  4BWJ A;  2QIF A;  2MZQ A;  1JNZ B;  4YB7 A;  1YQH A;  4TQS A;  1R27 B;  2DHH A;  1GAO A;  3PO4 A;  1ZZF A;  2QZ8 A;  4K4T A;  2SXL A;  4F8R A;  3LO3 A;  3KFW X;  3DLL Q;  4OX9 J;  4CLT A;  1UWB A;  3ZZ0 A;  5DDQ C;  1HD0 A;  1VQN S;  5IQQ A;  2M8H A;  2LVW A;  4Y00 A;  2HGM A;  4WE1 B;  5KFQ A;  3BGO P;  3TNV A;  1VMB A;  4MIA A;  4O4G B;  2ZKT A;  4M5N A;  3CC2 S;  3T5H A;  5A8R A;  2HND A;  3EE3 A;  2Z2L A;  1IKV B;  4DFJ A;  1SL2 A;  1FRK A;  1KFD A;  2VIC A;  2C3U A;  3Q8P B;  4TQR A;  5F41 A;  3MEC B;  5BR8 J;  3KOA A;  3R2C J;  1REG X;  3CUN A;  1F1B B;  3Q8V A;  2YWH A;  3AH6 A;  2I8E A;  5DO2 A;  2XSF A;  2N4C A;  3QGG A;  2DNO A;  4X4P A;  2GIF A;  5I3U B;  3CSK A;  1RT3 A;  4MKV A;  3TX0 A;  2G2O A;  3PVX A;  1VQ8 S;  3VWS A;  4L3K A;  4I2Q A;  3M8W A;  3D66 A;  4AQY F;  1OJ4 A;  3EXY A;  5EGY A;  3GR0 A;  4QOT A;  3R6L B;  1QJH A;  2YKN B;  2MY8 A;  3H2U B;  2PA3 A;  1WEL A;  3WX8 A;  3H42 A;  5DDP C;  3RGI A;  4HYK A;  5E41 A;  1S0O A;  1HD1 A;  4RW6 A;  2G2Y A;  4Q45 A;  4J9L A;  1GTE A;  4DR6 J;  1NB2 A;  1IR2 A;  4F3M A;  4A8O A;  3D3B J;  2LXF A;  2HS3 A;  3DU6 A;  2EFQ A;  3VAK A;  4IRC A;  2AP6 A;  2XZD B;  1RHM B;  3A12 A;  1ZET A;  2R7T A;  2BE9 B;  4IDK B;  3PYD A;  4OFZ A;  5H9E J;  1S5Z A;  2LMI A;  4ZN1 A;  2QA1 A;  2Z56 B;  4WFA Q;  3KLG A;  1F3V A;  3Q8U A;  4EBD A;  1HAR A;  1XTZ A;  3O6Q A;  5HP1 B;  3Q23 A;  2B4P A;  4B9T A;  1U7L A;  3SFG A;  3IS9 B;  5D4P A;  2HVI A;  4IQX A;  2P9E A;  2KYX A;  2NXU A;  4CLP A;  3M32 B;  1G3O A;  3IAM 9;  1JLF B;  4ED3 A;  2JVO A;  4FDF A;  2A10 A;  3M8P A;  3EZU A;  5KFZ A;  2DNR A;  1X4H A;  1UVL A;  3N4W A;  2MHE A;  3AT1 B;  4N5S A;  1GMW A;  1N4L A;  3DU5 A;  1RAO A;  4ZVQ B;  4IG0 A;  4F0M A;  2YNI A;  4F26 A;  3H5U A;  4G1I A;  3R8Y A;  1ZM9 A;  4CO0 A;  1FXL A;  5JJB A;  3B82 A;  3MM5 A;  4O3Q A;  2ADB A;  5DM6 Q;  3BN7 A;  4W92 B;  3DLB A;  1RT2 A;  3JQK A;  4YUD A;  1M90 T;  1HNV B;  4K0K F;  4MK7 A;  5L38 A;  2EWH A;  2IPO B;  1SXL A;  4K4S A;  1QAY A;  1KS2 A;  4HEA 9;  2RHQ B;  3J7A 1;  4ZPT R;  2ATC B;  3M30 B;  3QAE A;  3DRX A;  1WF2 A;  2YX7 A;  4J37 A;  4ES1 A;  2XYG B;  4AQY J;  2ZHO A;  4J9S A;  4N41 A;  1KOO A;  1YJU A;  4C9D A;  4Y2C A;  2Q43 A;  4PPZ A;  4B9V A;  1JB0 C;  2O66 A;  3UE2 A;  2BQU A;  1TKX B;  1Y5L B;  2YX4 A;  3M8Y A;  2BAC A;  2IY5 B;  2ZH1 A;  2W4D A;  4ETX A;  4ZS6 A;  3KK1 A;  1QM9 A;  3H59 A;  5A8W B;  2WW8 A;  4HI1 A;  1LK5 A;  4K4W A;  4TYB A;  1FFG B;  4NXN F;  1YDL A;  1Y5N B;  1Q4R A;  2OFG X;  4DWI A;  2GCF A;  3VAH A;  1U47 A;  1HNZ F;  1WOO A;  1RWP B;  2E1C A;  3CIM A;  4KGV B;  3A1Y G;  1G6B A;  2ZZN A;  2OEL A;  4TN2 A;  3R5C A;  5B08 A;  3JQJ A;  1HHT P;  3KLH A;  1UJ4 A;  3C14 B;  4DUY F;  3I0R B;  5A8K B;  4I0W A;  3SIP B;  3LGN A;  4A46 A;  3V6K A;  3PW5 A;  4ZVH A;  3QRR A;  1VOM A;  2FY1 A;  2WVE A;  4IRK A;  5JVG Q;  3CJ0 A;  3PJX A;  1SQG A;  2RML A;  1X5O A;  3AB4 B;  4DV4 F;  1PCA A;  1NSP A;  5DGB A;  1NK4 A;  1TL3 B;  2IMO A;  2OPR B;  1NK5 A;  4NX9 A;  2NR0 A;  1DZ5 A;  2HFO A;  4CLS A;  1A0O B;  4UOG A;  1SPB P;  3C15 A;  3LPE A;  1NSQ A;  4MIB A;  3B78 A;  2MJN A;  2A6O A;  1OSD A;  5JXS A;  2DR6 A;  1SIZ A;  2DVI A;  5GAD U;  4K0K J;  2W25 A;  1EAY C;  3GYX B;  1F2G A;  2HZC A;  4I2P B;  4ED0 A;  1TL1 A;  4OYI A;  4ZK7 M;  3ULH A;  2CPF A;  5KFR A;  2AMC B;  3CCM S;  1GK8 A;  1PAE X;  3NCQ A;  4C0O C;  2D9P A;  2J8S A;  3CJ5 A;  3IRX B;  3HZE A;  4P52 A;  1PIL A;  1S6Q A;  3BDP A;  5KFW A;  4ZVF A;  2X51 A;  4NZ7 A;  1S48 A;  3MEG B;  3NGS A;  1Z2Z A;  4Y2I A;  4C8L A;  4IFY A;  4X4U A;  4QW8 A;  3IRW P;  2ZH5 A;  4Y0F A;  2NYH A;  2QLJ B;  4FYX B;  1R0C B;  4Q44 A;  4F50 A;  4ITS A;  3ENW A;  2W1B A;  1FKO B;  1PG5 B;  1KVI A;  2ZOM A;  3BJY A;  1X4A A;  5HBM B;  3NWG A;  5LOQ A;  4M5G A;  4NXN J;  1REV B;  1S57 A;  1HYS A;  5E2Q A;  4TY8 A;  2ZH7 A;  1HNZ J;  2YQ0 A;  4NMX A;  2P6S A;  2WB4 A;  1FE0 A;  2VQE F;  2KG0 A;  3PIP Q;  2VOO A;  1X9W A;  3LWL A;  3RB6 A;  2XMK A;  5LMN J;  4J9U E;  4NLS A;  3RJM B;  2LXI A;  2MLZ A;  3WIV A;  1EET B;  2EG2 A;  4HL9 A;  1UET A;  2XMJ A;  1S9G B;  4AND A;  4IUF A;  3MPY A;  3GPA A;  4NI2 A;  2QYC A;  4O0N A;  2X7I A;  1ROF A;  5K14 B;  1R8H A;  4LSN B;  3ZXW A;  4U8V A;  4A8K A;  1FDB A;  1QD1 A;  5FLX U;  4DV4 J;  1DQ9 A;  1T3O A;  1TKZ B;  4YDD B;  4EO6 A;  4LFC F;  2KHD A;  2D3O R;  4ILR A;  1H2U X;  4IOC Q;  3A3O B;  1KLM B;  1F5A A;  3VAG A;  1GMW D;  2J9E A;  4BHQ A;  3PFO A;  1UP1 A;  4YB1 P;  4RW9 A;  4RW4 A;  2Z8Q A;  4BLG A;  3I9Z A;  4PR6 A;  1NK8 A;  3NGT A;  1CJT A;  3GYN A;  1YIT S;  2VG5 A;  3DRP A;  5DGA A;  3N6N A;  1CJU A;  3GE9 A;  1SC1 B;  1WF1 A;  3VF0 B;  3M8S A;  2XMV A;  4IR1 A;  1S1X A;  5KFA A;  2OPQ B;  1FO1 A;  1T95 A;  5KFT A;  4EO8 A;  3H7H B;  4R5P B;  4JI4 F;  2RKI B;  3PX0 A;  1SUQ B;  1BMQ B;  5H1S V;  1UEV A;  4OJ1 A;  4JI1 F;  1WHY A;  3SBM A;  3CCE S;  2CQI A;  3R3T A;  2G4B A;  1V3R A;  3I0S B;  5CAB A;  5D0R A;  3I96 A;  3MMJ A;  1XEZ A;  3DN9 A;  3LP1 A;  2VQF F;  2HHP A;  3GIM A;  1UWA A;  3SV4 A;  2UUT A;  2WOM A;  2WW4 A;  3DLG B;  2QLW A;  4CO4 A;  5D4O A;  2ERR A;  1PYO B;  1NZA A;  2UUA F;  2VA2 A;  3RBX A;  1KTV A;  1TFW A;  4OZ1 A;  4MKY A;  1MN9 A;  2NSB A;  1FES A;  4PXE A;  4TY9 A;  4S0M A;  2W01 A;  1WI6 A;  2VQE J;  4X84 A;  1FXR A;  1IBK F;  3BBF A;  2EK6 A;  2KZM A;  3PRD A;  5EWG A;  3M2U A;  5C42 B;  2WHO A;  3AHP A;  2IVF B;  1WKJ A;  4IRD A;  6AT1 B;  2ADC A;  4OZ3 A;  2JLE A;  4AXI A;  5ADZ A;  2BW7 A;  2ZH6 A;  2R7O A;  4GVL A;  5HVF A;  4QWE A;  4PUO A;  5H9E K;  5A0Y B;  1HBU A;  1WEZ A;  2ZNZ A;  1KVJ A;  5K20 B;  1T05 B;  1UVI A;  4ZPC A;  3TOQ A;  2VJU A;  4I68 A;  1SV5 A;  2ZUA A;  4JUZ A;  4LFC J;  5B7W A;  3D54 A;  2JHE A;  1JMT A;  2FHK A;  4FVC A;  2QE5 A;  5C25 B;  2B0G A;  2M0G B;  4ZP8 A;  3FRY A;  4YP3 A;  1HWI A;  1TL7 A;  4UUX A;  3UFC X;  4IH5 A;  2XI2 A;  4KY3 A;  3BEG B;  3OVS A;  4EGL A;  1R8P A;  5ETR A;  3QLH B;  1Q79 A;  4K4V A;  1N48 A;  4RW8 B;  2O01 C;  4RLE A;  4QR0 A;  2DGX A;  1HWJ A;  4O3P A;  3BO3 A;  3GFY A;  2EFG A;  4RNO A;  3SYZ A;  5LSO A;  1MRO B;  4JV2 A;  4K50 A;  2GA7 A;  3F73 A;  3NL0 A;  1SBR A;  5E3Q A;  4JI1 J;  1HBN A;  1H2T Z;  3TUJ C;  3T6B A;  2EI5 A;  4NLT A;  3CCS S;  1C4C A;  3ET6 B;  4LSZ B;  3W5Z A;  4L3N A;  5F9N A;  1XIQ A;  2X3D A;  2OO4 A;  2AF6 A;  2FB0 A;  1JWW A;  2BBE A;  1KEK A;  2LXU A;  2V8V A;  2GJF A;  2DR5 A;  2ZHB A;  3HDS A;  2KJV A;  3LAL A;  1NB7 A;  1HWL A;  2UUA J;  1WKK A;  2IMW P;  3DFE A;  2GJI A;  1OQ6 A;  3FFI B;  4UUW A;  4RNN A;  3UDL A;  3DGV A;  3DRR A;  3S01 A;  1H72 C;  3MAQ A;  1IBK J;  4FF3 A;  1C0U B;  1NDK A;  3TW0 A;  5F9L A;  2ZIT A;  3BPD A;  1P27 B;  1SH0 A;  3SSS A;  3OTE A;  2C2Z B;  3Q2S C;  3LPY A;  2HHS A;  2Z4P A;  1R6Y A;  2E5J A;  2DNM A;  3KMS A;  1X9M A;  1PYT A;  2DY1 A;  2FUG 9;  2LA6 A;  2XYH B;  4DPY A;  1R0A A;  2DNP A;  3O8W A;  4PKD B;  2FIU A;  1UEK A;  4WK1 A;  2HFS A;  2BDP A;  1H74 A;  4IYQ A;  1H73 A;  3WC0 A;  2JSX A;  3KKF A;  3FEY B;  2GQ2 A;  4USK A;  2RHS B;  2WBR A;  3SFU A;  4OX8 A;  2VKZ G;  3FDS A;  4USU A;  3QAT A;  4XAK A;  4I1T A;  4C3M A;  4DL3 A;  2HFN A;  2AZ1 A;  1X4D A;  5C24 A;  1H7X A;  2MGZ B;  1T9V A;  1UKU A;  3P5T L;  1TAU A;  4CO1 A;  4KHM A;  3K57 A;  5A6W A;  2J9D A;  2AGQ A;  3PR4 A;  3B4M A;  1S6U A;  1WDT A;  1SJ4 P;  3KDO A;  2PO4 A;  2HKE A;  3QZ7 A;  1B0T A;  2YH0 A;  2F3J A;  1UW9 A;  1PJ5 A;  1QUV A;  1VC0 A;  1S1T A;  4O3N A;  3TAM B;  1CPZ A;  2E1M C;  2E7W A;  5AXK A;  1CJT B;  3CGI A;  1KRP A;  5C5J A;  1NDL A;  1SL1 A;  2RQC A;  3SDE A;  3CO9 A;  2BVZ A;  4NYP A;  1RTD A;  1F9H A;  3UCU P;  3JB9 k;  2AEF A;  2XO6 A;  4KTQ A;  4LQ3 A;  3PIO Q;  5HAT A;  2QFJ A;  2LP4 A;  3R6G B;  2BEF A;  2FLO A;  2QO3 A;  1HI0 P;  3D68 A;  7AT1 B;  4P2X A;  2PA8 D;  2IJN A;  5J1E A;  2OP5 A;  5MLC V;  1LW0 A;  4HT5 A;  3FQL A;  2KM8 B;  4DSJ A;  3GSI A;  4N8N A;  4OX7 A;  1U1P A;  2V4J B;  2XS5 A;  1RBL A;  1SJ1 A;  2IDL A;  2NLW A;  4DSL A;  4J90 A;  3K5N A;  1WG1 A;  2MST A;  3GV8 B;  1TUW A;  2QA2 A;  3IWX A;  3DLH A;  1U2C A;  3FRZ A;  2HHH F;  3LF0 A;  1X5S A;  3K17 A;  2R8J A;  3C6U A;  2Y1L B;  4U9R A;  4LT6 A;  4DZ6 A;  4IOA Q;  3J7Y U;  2UUW A;  2ZD1 A;  2I1R A;  4DL5 A;  2A18 A;  4RBU A;  1FDA A;  2RQ4 A;  5IM0 B;  1RCO B;  3P45 B;  3FSY A;  2EC0 A;  1ZPW X;  1YJR A;  4JOU A;  3VR1 A;  1KD1 T;  4LMZ A;  1RB0 A;  5F8I A;  2U2F A;  3OV7 A;  5KTQ A;  4K2J A;  3D7S B;  2BKN A;  2MQO A;  3UCZ P;  1R31 A;  2E5G A;  4EK2 A;  3U1M A;  1NHK L;  4ECR A;  3FBB A;  1D9D A;  4DUZ F;  1HBU B;  1O0P A;  4DHV A;  2XGQ A;  4YR0 A;  4OLO A;  1UA1 A;  5K8P A;  2FZG B;  3V81 A;  1XMO F;  2XSJ A;  5GAG I;  1HFE L;  1K47 A;  2KDO A;  1H7W A;  1SJR A;  4MH8 A;  1SI9 A;  2EFV A;  2YKM B;  2QJ3 A;  3C19 A;  2G0C A;  3N6M A;  3GLJ A;  2KVI A;  4DL4 A;  5K5M A;  3LP0 A;  2CQC A;  1P1T A;  4ZLL A;  3SI8 A;  3G8Q A;  2B8P A;  4RW7 A;  5BYS A;  2E1R A;  4YOE A;  3MPU B;  4WII A;  2K2P A;  2XHC A;  3OVA A;  2J0S D;  3QGI A;  2WSE C;  4GRS A;  4OZ2 A;  3NGD A;  2GHP A;  4KPY A;  1NO8 A;  2BW2 A;  3PHE A;  2CYY A;  1JLG B;  3NS5 A;  3D1O A;  1XNR F;  3NAH A;  4A47 A;  1TTH B;  3UNG C;  3RRK A;  3MPD A;  1L5U A;  3TI0 A;  1NZ8 A;  3L4B C;  2O1P A;  4DG1 B;  4USM A;  1BC6 A;  4H4O A;  4YB6 A;  5DQG A;  4KQZ A;  3C16 B;  4J9P A;  1VC6 A;  1WG4 A;  3WIU A;  1MG7 A;  3T1Y F;  2IRU A;  4ZHR A;  2OKQ A;  4CNY A;  4NCG A;  2PMZ D;  4RNM A;  2HHH J;  4LF5 F;  3CTR A;  1ACM B;  2W2P P;  4DV3 F;  3N28 A;  3AOB A;  3H20 A;  3K7R A;  1AUD A;  3PKM A;  2YNG A;  2CQ4 A;  4KGZ B;  4F7V A;  1LNQ A;  5GME A;  5J2N A;  1D1U A;  4XPE A;  2F8E X;  1M5O C;  3OTC A;  4YHH F;  4U96 A;  2YNF A;  2NPF A;  3UD4 P;  1S49 A;  4KHP J;  2MQL A;  2UV8 A;  4O23 A;  1FNO A;  3JSM A;  8RUC A;  2L9D A;  2KTQ A;  2A3J A;  3M8Q A;  2UVV A;  2VPW B;  2VHG A;  4ZPW R;  3KXD A;  2OPP B;  4XTT A;  2NUU G;  1WEY A;  2MKK A;  2HK2 A;  1RTZ A;  1RWK B;  2BKO A;  3A13 A;  1HWU A;  1TU0 B;  1S1W B;  2VON A;  3I56 S;  1GTH A;  4B3O B;  4PWD A;  5AXL A;  4FPI A;  4DV5 F;  1S6P A;  1DLO A;  4C3K A;  1NAQ A;  4WFZ A;  4TU9 A;  3QFH A;  2NSC A;  2RDJ A;  3O5T B;  3E3X A;  1QY7 A;  1S1V B;  3IA0 A;  4OJH A;  2VFU A;  2BRK A;  4NCA A;  2KXH A;  3BQ0 A;  2CDQ A;  2FHJ A;  3D6H B;  4KSE B;  1HBM A;  2VBX A;  1DFD A;  1FA0 A;  4UOC A;  1VK3 A;  2HFU A;  2CAD A;  3JS9 A;  2YVS A;  3OT9 A;  1FF2 A;  1XNR J;  5HQL A;  3W63 A;  2VIH A;  4QCL A;  4ER8 A;  2J8A A;  3LW5 C;  2A0F B;  1Y4Z B;  1C0T A;  4HI2 A;  3DLK B;  2XMW A;  2H54 B;  2IM2 A;  1QTM A;  2LU2 A;  5IQ6 A;  1S10 A;  4OI0 A;  3UD3 P;  2QFI A;  3ZTO A;  1S76 D;  2CQB A;  4C0H A;  2NYI A;  4K2X A;  2AU0 A;  1EQM A;  2ZM6 F;  5J1N A;  4J9K A;  5KT3 A;  1RE1 B;  4ECQ A;  3OPK A;  4PYD A;  4NLQ A;  2ASL A;  3ICL A;  2QG9 B;  1LWE B;  1RT7 A;  4MAK A;  1J5O B;  4WYL A;  2XGP A;  3L7U A;  2AJ2 A;  2HHU A;  2DH9 A;  3T41 A;  3CDE A;  1JLC B;  3CE8 A;  1MNE A;  1SQE A;  4FYD A;  3PNI A;  4DR3 F;  3V6D A;  1IKX A;  2MQQ A;  3K59 A;  2G1H A;  3RRH A;  4ECS A;  4F0K A;  1NEE A;  3KK2 A;  1D0E A;  3CF5 Q;  3AJ2 A;  4RR5 A;  4Q0B A;  4YHH J;  3GU0 A;  3RTV A;  4Z7C A;  4PG7 A;  4ERD A;  3SEO A;  3BR8 A;  2PFF B;  1FD2 A;  1DQ8 A;  2RRN A;  5L1I A;  4J5O A;  2VUG A;  4KGK A;  2R2R A;  3NY0 A;  1VI7 A;  3W9I A;  2C2E A;  4ECT A;  1KHW A;  1YJN S;  1ZBT A;  5ITH A;  3OR2 A;  4KV8 B;  2B7C B;  1I94 F;  3RBD A;  3GFH A;  1S0N A;  3OXF A;  1PBA A;  4DV1 F;  2YXL A;  3GV7 B;  2W9B A;  1OY9 A;  3J81 j;  1HKA A;  1S72 S;  1LWF A;  3I5A A;  4DV5 J;  1KP6 A;  2B9E A;  3MEE A;  5KG5 A;  3WX4 A;  2W7P A;  4EU0 A;  2X3G A;  2ABY A;  3T1H F;  2DR8 A;  2JEF A;  5IV4 A;  3FBE A;  2FJA B;  2BE2 B;  3EGN A;  5HJX A;  2IC3 A;  2D41 A;  2V2K A;  3SQO P;  4C8K A;  3NXZ A;  3BN4 A;  2VG7 A;  1E6Y B;  3ILJ A;  4IO9 Q;  1TQL A;  1U6F A;  2Q66 A;  4PAB A;  3G9C A;  3TEH B;  4IH6 A;  4DSK A;  1MML A;  1B99 A;  4WP3 A;  2RUG A;  3MR5 A;  3D1Q A;  4OI6 A;  4PQU A;  2R9L A;  4K4U A;  2XI3 A;  3AJD A;  1IR0 A;  2ZM6 J;  2IRX A;  4FYV B;  4C98 A;  1HPZ A;  1JJ2 R;  4KO0 A;  5E3A A;  2QX0 A;  1YK9 A;  2W4P A;  3MMC B;  5LM7 E;  3BBC A;  3POT A;  2YY3 A;  5KFU A;  3CPW R;  5IFM A;  2KJW A;  1RHU B;  5JMN A;  1VRQ C;  3Q86 A;  4LRC A;  1Q86 T;  1Q1K A;  4M63 A;  1VQ9 S;  5KG4 A;  1N5T A;  1FT8 A;  5IT4 A;  2MJU A;  1Q95 G;  4LF1 A;  4Y2A A;  2XMA A;  4NCB A;  2L9N A;  4K4Z A;  2C2O B;  2IRY A;  5KG1 A;  3NS6 A;  2Y1I A;  2PEB A;  3K5L A;  3OLA A;  1W25 A;  2ATL A;  2CDR B;  3ILI A;  2BM1 A;  4ZHR B;  3EVM A;  2H51 B;  5CH7 B;  2CNK B;  3JAM Y;  1RT4 A;  3JYT A;  4G3I A;  3W2V B;  3THP A;  3DMJ B;  3EPG A;  1I94 J;  2J6T A;  2DXD A;  4DV1 J;  5J2Q A;  3QNW B;  2YNG B;  4ZVO B;  4UT4 A;  1X9S A;  4QJV A;  4AUK A;  1U1R A;  3TVY A;  1UVK A;  4C8M A;  2AWZ A;  3HKZ D;  4WBF A;  3T1H J;  5T7L B;  2RQK A;  5A76 A;  2ZFH A;  1Y3J A;  4OI2 A;  2IAJ A;  2ZZT A;  4WFN Q;  1DTT A;  2HNZ B;  4H4M B;  4IFV B;  1TMJ A;  3NOG A;  4FZV A;  2Y9H A;  2LDY A;  4AT1 B;  1PO6 A;  2MKJ A;  4EZ6 A;  2FHJ D;  3O3L A;  3IXQ A;  3CJK A;  3X3U A;  1V3Z A;  1IM6 A;  4NLV A;  1AW0 A;  3M8Z A;  3DOL B;  1B3T A;  3I5B A;  2HHX A;  4U7C A;  4KT0 C;  3GIJ A;  2JL9 A;  3GCW P;  3DYA A;  2MKY A;  3KG0 A;  1FRL A;  2EBE A;  1RT5 B;  1U1Q A;  1RTI B;  4DR1 J;  3ISN C;  3TJ8 A;  1LWC A;  2I5J A;  2X1B A;  3UVJ B;  3QGP A;  2PSZ A;  2LQ8 A;  3PJ9 A;  4RBT A;  8ATC B;  4M5L A;  1TKT A;  1UW4 A;  3PCO B;  4UF4 A;  2X1G A;  1D9F A;  3MFI A;  3OJS A;  4X2B A;  3OFE A;  5HQM A;  4CNZ A;  1FXD A;  3W3S A;  4ZVR B;  3M6U A;  1WJ9 A;  4HH0 A;  4B17 A;  2H5I B;  3D0G E;  3H4B A;  3HHK A;  3ZTR A;  3C8Y A;  4QWA A;  3J81 U;  1FDN A;  3BPS P;  1ZAW A;  1ZH5 A;  2VOD A;  1U25 A;  4U8Y A;  3MGJ A;  2XLI A;  4X66 F;  3QWU A;  4OJG A;  3RW7 A;  2GW8 A;  1JLA A;  2Z58 B;  2DIT A;  3T5L A;  1MMN A;  1PC5 A;  2IIH A;  2JDJ A;  2GO8 A;  2HAI A;  1RWO B;  1NJZ A;  2L3M A;  1FKP B;  1FVQ A;  1RT6 A;  1WUU A;  1RU1 A;  3PAC A;  1PYS B;  4CH1 A;  2A2C A;  4MIW A;  4LJM A;  3T9Z A;  3KHL A;  1RBA A;  4OYX A;  2MKI A;  2JNJ A;  1DBD A;  1A7G E;  5B0D A;  1QSY A;  4YEA A;  3DLJ A;  4DF4 A;  2WON B;  1N6Q B;  3IBC B;  1BWV A;  2DNY A;  2WSF C;  1JJC B;  2ZBC A;  1TVR A;  1Q7Y T;  1WC0 A;  3O44 A;  3CNQ P;  2O67 A;  3HFK A;  4NA3 A;  3G86 A;  4JV5 F;  1D8Z A;  3K2Y A;  4O0I A;  2GIQ A;  4HVZ A;  5KFL A;  3BGR A;  2YKA A;  3J80 U;  3OFF A;  3QWP A;  3M7V A;  1BY9 A;  3GP9 A;  1N0U A;  3CWJ A;  1DRZ A;  1VIS A;  2XBP A;  5CQG A;  1EB0 A;  3DRS A;  2DNK A;  4B08 A;  3E01 A;  2L9W A;  1T03 B;  3BH6 B;  4C8N A;  4QIF A;  4NLD A;  4C3L A;  1BQM A;  4FXW A;  4KIA A;  3CT9 A;  5HMY A;  2FVQ A;  1IBC B;  5GVQ A;  4AE5 A;  4MFB A;  2C2K B;  2HIQ A;  4OHY A;  1T9X A;  4RNF A;  5M2U A;  2DB1 A;  1RSC A;  4DXL A;  2CVI A;  3D4J A;  4B3T J;  4G1Q A;  3TA0 A;  4I7F A;  3DLE A;  2RQM A;  4DPO A;  1QUP A;  3FUY A;  1KN6 A;  1RLC L;  2EVZ A;  1QE1 A;  2FJB B;  3MI7 X;  4BCA A;  2CNN B;  3IM8 A;  4AYB D;  1U0H A;  2DNL A;  1T02 A;  2GVD A;  2YKO A;  5DQH A;  1KTQ A;  4OL8 A;  2AW0 A;  3MUM P;  2FC8 A;  1IWG A;  1P6T A;  1MWQ A;  3EZO A;  2FD2 A;  4F3Q A;  3DOK B;  1KWM A;  1B70 B;  3QBC A;  4GKJ F;  1RAA B;  5KFC A;  2AJ4 A;  3P49 B;  4AL5 A;  4C4W A;  2R2U A;  1W2I A;  3VQS A;  2F9D A;  3GR1 A;  2DIU A;  1WC6 A;  5DZ6 A;  3JYT B;  4JV5 J;  3CCU S;  2KFZ A;  2V69 A;  2B4O A;  3BR9 A;  1CQM A;  1H98 A;  3HHL D;  2IM0 A;  3FNN A;  4KFB A;  3MXH P;  1RWU A;  2LQJ A;  4WYW A;  3JQM A;  1HNI B;  2GZO A;  2UXD F;  4QWD A;  1WEX A;  2NXC A;  3LA0 A;  3MOJ B;  2GVZ B;  4MYU A;  1C1C B;  3H2V E;  1VQY A;  3ITH B;  2PFD A;  4DI6 A;  5DLG A;  3G6E S;  1F2H A;  4USJ C;  2HS4 A;  1EP4 A;  3QT5 A;  2KKH A;  1BQN A;  1YZ6 A;  2RU3 A;  3DXB A;  5ETM A;  1Z1Z A;  3HHL B;  4ZJO A;  3IG1 B;  1LFW A;  3CXC R;  4A8Q A;  2K1R A;  4K4Y A;  4OYM A;  3OTD A;  4RWX A;  3UPF A;  2DIS A;  4DFK A;  3PX6 A;  3G82 B;  2DPJ A;  3HVW A;  4NPO A;  1RWW B;  1IR1 A;  1RWV B;  4ZIW A;  5A2Q U;  2VOP A;  4G1P A;  2QL9 B;  3KLE B;  4FBT A;  3E51 A;  2AX1 A;  2DHS A;  1FWP A;  3R5G A;  1WOS A;  2EFO A;  2JH3 A;  2ZWP A;  1S59 A;  5KFI A;  1OPI A;  5E3C A;  4M5J A;  4TKT A;  4P72 A;  1VHF A;  2MKS A;  3VAL A;  1SL0 A;  2KYZ A;  2VG6 B;  3HVT A;  1N54 B;  2M52 A;  3HK2 A;  2YQ3 A;  1ZZN A;  5EWF A;  2EKN A;  3U1L A;  1M5P C;  3MM6 A;  3P6Y C;  1HQ2 A;  4NE9 C;  1ZM4 A;  1G1X A;  5LJ3 Y;  2FY8 A;  4HTI A;  1AZS A;  4GKJ J;  4HHH A;  4KKO B;  3MD3 A;  1N56 A;  1RWN B;  2PI5 A;  4ZPB A;  7FDR A;  1EKS A;  2GX8 A;  2IVM A;  3HSZ A;  3TRG A;  2DH8 A;  2HZV A;  1NKE A;  3BGU A;  1YWX A;  4MKB A;  3SCK E;  1FJG F;  4YME A;  3BQ1 A;  2ZUG A;  1CUL B;  1RTJ B;  2UXD J;  2HGL A;  1GFW B;  1ZAX A;  1R7I A;  4WE1 A;  4FXD A;  4OHX A;  4UOF A;  4LR8 A;  2QGF B;  4O4G A;  1OS5 A;  2ZC4 A;  4ZJL A;  3ZZZ A;  5D78 A;  1U48 A;  1IKV A;  3NGR A;  3RZA A;  1SVD A;  2V8G A;  2R8K A;  1YGY A;  1XMB A;  4M94 A;  3MEC A;  1CG2 A;  2FVC A;  1FFS B;  4KE5 A;  1TKD A;  5HVG A;  3HMJ G;  1Q8L A;  1RI7 A;  3OTO F;  1YBU A;  2J7U A;  4GC6 A;  2LFV A;  5I3U A;  1RJJ A;  4OV1 A;  3W7B A;  2OH2 A;  3H98 A;  1X60 A;  2GHV C;  4FKX A;  3IC1 A;  3K5P A;  4DV2 F;  2HAF A;  2L48 A;  3WC2 A;  3SCJ E;  3KJV B;  5DS7 A;  4YR3 A;  3M6W A;  3BM7 A;  2YKN A;  2XY6 A;  2HQC A;  3E8O A;  1OYD A;  1BQM B;  4NLO A;  3LWM A;  4DL2 A;  3HT0 A;  3SSQ A;  2UXC F;  5G4D A;  2BAB A;  2FZK B;  2V68 A;  4DLE A;  2GNK A;  5B0B A;  1D8Y A;  1EIY B;  1X5T A;  2G0J A;  4ATN A;  1P1L A;  5L46 A;  3G6Y A;  2HHT A;  4WZM A;  2YWW A;  4QPX A;  1KBR A;  4B3M F;  4IDK A;  5C2C A;  2RT3 A;  4PG6 A;  2CJX B;  4WU3 A;  3NMR A;  4DS5 A;  1IM4 A;  1RKJ A;  2BE7 D;  1V9O A;  2ZH3 A;  2UUC J;  1FJG J;  1HQU B;  3GSD A;  5HMZ A;  1YJ7 A;  5E5N A;  5HP1 A;  3KLV A;  4CH0 S;  3IS9 A;  2C2N A;  4PEO A;  5IWA F;  3OUY B;  1RHK B;  1J27 A;  2CPZ A;  1QLN A;  3ONQ A;  2ZVS A;  3PYG A;  2FJV A;  1EHW A;  5F3T A;  3M32 A;  5RUB A;  1I5O B;  1JLF A;  3CD5 A;  2MDA A;  5HRO B;  1Q53 A;  4RPF A;  4WWS A;  1AXQ A;  5B09 A;  2CNO B;  3P96 A;  4P10 A;  3OQ2 A;  3NNA A;  3FEX B;  2VH7 A;  2D7S A;  5HN0 A;  3EPI A;  2J9C A;  5IXU A;  4USI A;  5KFS A;  4OJ3 A;  1PKU A;  2YWG A;  4K59 A;  1XQI A;  4OZN A;  5KT4 A;  2CQ2 A;  3K8W A;  3GCX P;  2JFD A;  4I6A A;  1HNV A;  3UNY A;  3MM9 B;  4M95 A;  3OTO J;  1Q7L B;  3GB0 A;  3BV8 A;  3FJ2 A;  4O3O A;  2V8D A;  1N88 A;  2ZE2 B;  1UZH A;  5L1K A;  2IDE A;  2GGP B;  3M30 A;  1NUE A;  4DV2 J;  1VQ5 S;  4MYT A;  3AFG A;  4Y2K A;  5D3G A;  5C7P A;  4JV0 A;  1GT8 A;  3KUG A;  1HA1 A;  1S97 A;  1YJT A;  3THV A;  3KNG A;  2FGO A;  1NDC A;  2CVE A;  2MQN A;  4GO5 X;  1SJF A;  2CPD A;  3TZY A;  1L3K A;  2UXC J;  3UW1 A;  2DH7 A;  1TKX A;  4DX6 A;  2E5I A;  4F4A A;  3W9H A;  1TL4 A;  4AXJ A;  1NK6 A;  4DSF A;  3NOC A;  2R3V A;  3P8B B;  4LR9 A;  4RNH A;  2OPS B;  1YKW A;  4JI8 F;  5A8W A;  2H5E A;  4R8U B;  3MTK A;  4NXM F;  1NND A;  3EIC A;  3IO1 A;  2DY9 A;  4O3S A;  1PJ6 A;  4OLP A;  1VQ6 S;  2N4D A;  1WC1 A;  5KFM A;  4AFF A;  4B3M J;  4R0E A;  4QW9 A;  2KT5 A;  3AD8 C;  1SKR A;  4JI7 F;  4PZV A;  3PZP A;  5F8J A;  1HL6 A;  1UJ5 A;  3QRQ A;  1RTH B;  3TA2 A;  2M5Y A;  1TK5 A;  3C14 A;  4L73 A;  1FX4 A;  1NSA A;  1RGV A;  3CCL S;  3I0R A;  4B9M A;  3MHY A;  1FK9 B;  4X64 F;  2QMX A;  1FX2 A;  5ETP A;  4ZVU B;  4A8M P;  1H0H B;  4L6V 3;  3DHX A;  1IJF B;  4F4Y A;  4P9S A;  4HHU A;  3D1H A;  4LRA A;  1FI4 A;  1WDD A;  1TL3 A;  2G13 A;  4I6W A;  1YJV A;  2OPR A;  4BC7 A;  3MAA B;  1X7V A;  4XDD A;  1SKS A;  4LF4 J;  3W1Y C;  2OD4 A;  1VK8 A;  3OL9 A;  2B56 A;  4J9O A;  2E9T A;  3WDO A;  1Q78 A;  1B4S A;  1FWK A;  1HMV B;  4X4R A;  2W4C A;  4FF4 A;  2GC8 A;  2VPY B;  2J5A A;  2IA6 A;  4I2P A;  4TU8 A;  1F0X A;  2XCP A;  1CEZ A;  2KFN A;  4XIU A;  1C4A A;  2R8H A;  2KT2 A;  2LLZ A;  1U1L A;  4L74 A;  1S77 D;  1OPZ A;  4WP9 A;  2NUH A;  3K8V A;  3NG8 A;  4QU6 A;  2DGS A;  3IRX A;  4X65 F;  4CP5 A;  3FBF A;  2D3U A;  5K8O A;  4M5I A;  4Q2L A;  1U09 A;  3HKW A;  4K4X A;  4ZDN A;  2PD1 A;  1NH8 A;  3MEG A;  4USH A;  1BUX A;  4QIV A;  2HRT A;  1CJV B;  4KAI A;  4RUH A;  4JI8 J;  3U27 A;  1FKO A;  4NXM J;  1T3N A;  1WSV A;  5HBM A;  4F0H A;  1VGY A;  1REV A;  2AYB A;  4UY8 5;  5IT9 Y;  3EZ5 A;  2HG4 A;  2CNL B;  3UN2 A;  3CW2 C;  2KXF A;  3CJQ A;  4JI7 J;  5LMU F;  5KG2 A;  4ES3 A;  2HNY B;  2ZDP A;  4HLB A;  2B4V A;  4P2S A;  1EET A;  2WVC A;  2RNE A;  2WK4 A;  4WZQ A;  1RK8 A;  2WVB A;  4ZCL A;  1WSR A;  1Q0N A;  1S9G A;  1RA7 A;  5K14 A;  4X64 J;  3MM8 B;  1NH7 A;  1XNQ F;  4LSN A;  3QID A;  1XJW B;  3HVR A;  1TKZ A;  2JC1 A;  2RS8 A;  3HP6 A;  3AD7 C;  1KLM A;  2IM3 A;  3HI9 A;  2F63 A;  5HO4 A;  3KMQ A;  3QAU A;  4O3R A;  2E1P A;  1CJK B;  4LIW A;  4ID8 A;  3DKD A;  3NGK A;  1DTQ B;  3D6T B;  3FCH A;  3BSO A;  1N8R T;  5T41 A;  4ZCI A;  3CO0 P;  4ED6 A;  2OPQ A;  2ZKU A;  4R5P A;  1T9U A;  1NKB A;  3LOU A;  1GXL A;  2RKI A;  3TUP A;  2AQ4 A;  3C2P A;  1WHW A;  5B0E A;  4F4W A;  2GS8 A;  1SUQ A;  5H9F J;  1WF0 A;  1UAW A;  2AYM A;  1S4E A;  3I6P A;  3J7Z 5;  1BHN A;  4ZVP B;  4P6Q A;  2CQG A;  1SC3 B;  2ZOG A;  4LF7 F;  1RAB B;  2LEA A;  4WPA A;  3H5X A;  3I0S A;  2BAN B;  1V3S A;  2CJY B;  4ID5 A;  3T3F A;  2E7X A;  3NLC A;  1VBY A;  3OSP A;  1UFK A;  3DLG A;  1U4B A;  5KOW A;  3G8S A;  4WKY A;  4PWW A;  1FKA F;  5F3Z A;  4DCJ B;  4NLY A;  1SIW B;  1VBZ A;  3UDV A;  4Q5V A;  1M1K T;  2QRR A;  4LF8 F;  2PDA A;  4NLW A;  4Q8F A;  3CD7 A;  5U47 A;  5D3G B;  4NZ6 A;  1WTF A;  2XWY A;  2QC3 A;  1X5P A;  3MPW A;  2IBK A;  2W7O A;  1S9F A;  5LMU J;  2K3K A;  5D8H B;  2VC1 A;  2XNQ A;  5KT7 A;  3J7Y I;  3US5 A;  5C42 A;  3ZTQ A;  4CO2 A;  3BYP A;  4DR2 F;  3Q8S B;  3JTN A;  3ZZU A;  2V5H G;  2HVZ A;  4DCO B;  5F0U A;  4C2M A;  4A8Y A;  4HDG A;  1TV6 A;  1B0P A;  3OVB A;  3PXG a;  1W2B R;  4B02 A;  2GHW A;  2FTR A;  2YWK A;  5THW A;  2E9Z A;  5A0Y A;  3A4T A;  3K0J A;  4JI6 F;  5A6P A;  4URG A;  2DHX A;  2E1A A;  1HR0 F;  4WKR A;  3BF4 A;  3JSY A;  1T05 A;  1LOU A;  1F5C A;  4DQQ A;  3D28 A;  2DR9 A;  3OBI A;  2AV5 A;  3DRY A;  5KFF A;  4ES2 A;  1URR A;  1N5Y B;  3CD0 A;  2OEJ A;  9ATC B;  4B9S A;  3QIP B;  5C25 A;  5HLF B;  2YX1 A;  1MW7 A;  2XLK A;  5GAH I;  4QIE A;  1R8C A;  2Q79 A;  1CVJ A;  5DQI A;  3QLH A;  3IBW A;  2BA9 A;  1RAI B;  1R0B G;  3CJR A;  4QPT A;  4FF1 A;  1VQO S;  3WBZ A;  4RW8 A;  2CFX A;  1T9T A;  2ASD A;  2H48 B;  3OR1 B;  4AD6 A;  2PT0 A;  3Q0A A;  4OI1 A;  3J7A N;  1JKH B;  1M5V C;  2MMY A;  3M6V A;  3PYF A;  2A2D A;  4X4N A;  2F7V A;  1MRO A;  2ACY A;  3QT6 A;  1GX5 A;  2HEK A;  3TJ9 A;  9RUB A;  4J9R A;  2I2Y A;  5KFV A;  2RAQ A;  3VCD A;  1CSJ A;  2HQD A;  3R5A A;  4QIW D;  1VJW A;  2IYG A;  4GC7 A;  4LF7 J;  3ET6 A;  4DMZ A;  1TUV A;  4KHR A;  1QAI A;  4IG3 B;  5B0A A;  2BJ3 A;  1VBX A;  5B0F A;  2C42 A;  2M3D A;  5LT5 A;  2CPE A;  3RU0 A;  3ENA A;  2M88 A;  4URS A;  3QSY B;  4UZC A;  1HHS A;  4GVB B;  5AE3 A;  3OSN A;  3NWR A;  2BKP A;  3UDC A;  4EI2 A;  3GJQ B;  2K06 A;  3CUL A;  2AJF E;  2CQ3 A;  2D9O A;  4LF8 J;  3FFI A;  4X4V A;  2DXF A;  4RJV A;  3MOZ A;  2V2V A;  1LV5 A;  2VPZ B;  3MPV A;  3NAI A;  2DEI A;  1EJ7 L;  2KT3 A;  3RB4 A;  4K7Q A;  3M2V B;  5DG9 A;  3KNA A;  3EGV A;  2KB2 A;  1C0U A;  4ETZ A;  1S12 A;  4DR2 J;  2RF2 B;  3HHE A;  4ECU A;  5HI7 A;  2OTL S;  4F04 B;  4I4B A;  2QL5 B;  1APS A;  5IZH A;  1QDU B;  2OAU A;  1K0T A;  3DI6 B;  4J91 A;  4JI6 J;  2JEJ A;  1HR0 J;  2X1A A;  2I6W A;  4B9U A;  4ECV A;  3G4S S;  4BS2 A;  1U24 A;  2MQP A;  2Y8W A;  4P2M A;  1OQ3 A;  2OUG A;  2W7A A;  4PWU A;  2WCX A;  4CQ1 A;  3TZX A;  1U0S A;  3UI3 A;  2DCU B;  2HRY A;  2XZW A;  1JQG A;  4CYU B;  5KFX A;  2RD5 C;  4PQA A;  2XS7 A;  4FKY A;  2X1F A;  3M9O B;  4DUY J;  5D15 A;  3BSA A;  3R5J B;  2AKW B;  4H4K C;  2IVY A;  2DKO B;  4PPD A;  2MGZ A;  2GAG C;  3HF5 A;  5EWE A;  2DXE A;  3ISN D;  2RS2 A;  4ZPA A;  4EBC A;  3GON A;  4N77 A;  4EMD A;  2C3Y A;  4CCH A;  3ILL A;  1R89 A;  1RHJ B;  3HXM A;  1VQL S;  3C3L A;  4GKK F;  3TAM A;  2DRB A;  1JLQ B;  2M7S A;  2D74 B;  2XMM A;  3F44 A;  3FBC A;  1A6L A;  1WOP A;  4USV A;  4DU8 A;  4IKA A;  1U1O A;  2AEJ A;  1T11 A;  1VQM S;  2EBG A;  1U1M A;  3TX8 A;  4FNH A;  2MXY A;  1U2R A;  3NMA A;  3CJ4 A;  4RU9 A;  2C2M B;  1XK8 A;  2RSQ A;  4ECW A;  3SZ2 A;  3DGP B;  4NZ0 A;  1FER A;  3OJU A;  1S9E A;  3HHL C;  1Z2L A;  1YBA A;  3AA9 A;  1RBO B;  4RBV A;  1IKY B;  5CHC B;  3ISZ A;  2RDD A;  3BGL A;  2XQC A;  3MM7 B;  1HWK A;  2AYG A;  2XM3 A;  2FJW A;  3NRB A;  2QMW A;  1AA1 B;  2V4J A;  1X4E A;  2Q6B A;  4Z2X A;  2B51 A;  2V50 A;  4ID5 B;  2FVS A;  4IR9 A;  3H90 A;  3ILO A;  4RWW A;  4DJB A;  1VBK A;  5E3R A;  2VDI A;  1ELO A;  4A4J A;  1SJQ A;  2RUS A;  3HSG A;  5KFH A;  2HFZ A;  1SH2 A;  2F8H A;  3RB3 A;  2AIR B;  3IBF B;  1JIH A;  2QTW A;  2XS2 A;  1DQA A;  4ED2 A;  3PW7 A;  2HHV A;  5IM0 A;  3OFG A;  4JI0 F;  3N5B A;  1E6V B;  1Q8K A;  2ILZ A;  1KSP A;  1KQG B;  4DV7 F;  1IBL F;  1HIY A;  2RU9 A;  2UVR A;  3IP0 A;  5CA5 A;  4F2R A;  3W8G A;  3AD9 C;  4NLU A;  3CMA S;  1TV6 B;  3RAX A;  2OI2 A;  3CCJ S;  3GG1 A;  2J0W A;  1SC6 A;  3PTW A;  4X4Q A;  3Q8R B;  2MZS A;  2KU7 A;  3N0V A;  2HBR B;  1YTY A;  1VRT B;  3U7J A;  4WIQ A;  4ICL B;  3W65 A;  5LXY A;  3I55 S;  4QIG A;  1HBO B;  2YKM A;  4ZCM A;  5IC6 B;  2R7Q A;  3KLI B;  1JXE A;  1S0M A;  1FD8 A;  3BSN A;  3UR3 C;  1IN0 A;  4GKK J;  3R5B A;  2V9W A;  3CCT A;  3OW2 R;  4DQP A;  4W4M A;  1F60 B;  3FSX A;  5H9F K;  3ENV A;  3OD2 A;  5DG7 A;  4FYW B;  3P3D A;  3CVK A;  1NPK A;  2V94 A;  2DD8 S;  4LFB F;  4ECX A;  4DSE A;  1JLG A;  4I67 A;  5L8R C;  2WBM A;  4Q8E A;  4JI4 J;  1RP5 A;  2CZV C;  2BM0 A;  3ENQ A;  3T19 A;  1FNM A;  3TAP A;  2KL8 A;  1Y00 A;  1EX8 A;  3RRG A;  4LRD A;  3A8E A;  4CT9 A;  5ETK A;  3CC4 S;  4HHJ A;  2XC9 A;  4DG1 A;  1JLB B;  1Q16 B;  4Y28 C;  4I56 A;  1VJQ A;  3C16 A;  2LEC A;  3RB0 A;  3BB5 A;  2VQF J;  3TUI C;  4JYA F;  1GMV A;  1I1G A;  3M1V B;  3EGW B;  1B64 A;  5KFO A;  1H3D A;  3W62 A;  5KFN A;  3D3C J;  5J2M B;  3SMZ A;  2LYV A;  5EX3 A;  2HVE A;  3EJM A;  1OWX A;  2E5L F;  1Q5Y A;  3AOC A;  3BKF A;  1P8G A;  3RBZ A;  3GII A;  1RXO B;  2G1D A;  4CLW A;  4JI0 J;  1NPP A;  2MZR A;  3KYL A;  1K9M T;  5CAA A;  4DV7 J;  1IBL J;  1UVM A;  2BJ9 A;  3F0N A;  4P74 A;  3EWG A;  1S1U B;  4YQW A;  3ZTP A;  4DV6 F;  5I3P A;  3OXL A;  2MZT A;  2QSW A;  1NLK L;  2HVD A;  4Y3C A;  1CLF A;  4JBC A;  1FHT A;  3MMB B;  3W66 A;  2DJW A;  1UVJ A;  1RAH B;  2OPP A;  1QTN B;  1IQT A;  1EZZ B;  3R1L A;  4E8U A;  3R2D J;  2IM1 A;  3PRV A;  4N76 A;  1S1W A;  3HUL A;  3PRB A;  2QLB B;  4B3S F;  4B3O A;  5MAO A;  3LP2 B;  4QYZ K;  2VF3 A;  2HQG A;  5BR8 F;  4J9Q A;  2AT1 B;  3M4X A;  1S1V A;  2I38 A;  3VGT A;  4DS4 A;  4C11 B;  4M5D B;  2WVD A;  3TVK A;  2HWI A;  4LFB J;  1NHU A;  4LQ9 A;  2CWK A;  1VIX A;  3FQK A;  2G2Z A;  3DLK A;  3MTJ A;  1XWL A;  4MMO A;  1RAG B;  1L3V A;  5DG8 A;  2A1B A;  2F4V F;  1RYS A;  2AX0 A;  4O44 B;  4OYO A;  2R42 A;  3RAM A;  2XNR A;  2W9A A;  2AJQ A;  2HIY A;  3QO9 B;  1U1K A;  4FF2 A;  4OQJ A;  2R7V A;  3NNH A;  3SXL A;  2ASJ A;  1LWE A;  1J5O A;  2HFV A;  3M9N B;  4JYA J;  2PMW A;  2NXN A;  1JLC A;  4DL0 C;  2KFY A;  3TA1 A;  2V9K A;  5HQ8 A;  1R43 A;  3MFH A;  4QR2 A;  8AT1 B;  4NRT A;  3Q24 A;  2JFK A;  3KHG A;  2E5L J;  1BD6 A;  1S9E B;  2B4U A;  3MR6 A;  1AUS L;  2BJ8 A;  3S7R A;  4GMK A;  4CO5 A;  2AD9 A;  1IKW B;  1RYR A;  5DET A;  4IO1 A;  5E0O A;  4UY8 T;  3R1H A;  4TVA B;  4LBP A;  1R8A A;  4HAC B;  3CMQ A;  3JTO A;  3L9Z A;  4DV6 J;  3G8T A;  4LRF A;  1UPM B;  2NZC A;  3KK3 B;  3ZNJ 1;  2QEX S;  2H65 B;  2YBV A;  3NGU A;  2Q3P A;  3IGN A;  4GO7 X;  4KV8 A;  4QR1 A;  2ZJR Q;  2B5J B;  3VVT A;  4PG4 A;  4ZMM A;  1IUJ A;  2WTF A;  2ACM A;  4URQ U;  4ZP9 A;  3TJA A;  4B3S J;  2DYA A;  1AB8 A;  5E33 A;  1V5V A;  4KBI A;  1YG0 A;  1S0V A;  2F9J A;  3BO4 A;  1EAR A;  5DDR C;  2RIL A;  4ZIT A;  5AE1 A;  4CLY A;  2N3L A;  2BE2 A;  4TLR A;  4MKA A;  3TWZ A;  1SCJ B;  1T9Y A;  3ZZY A;  4AL7 A;  4RUA A;  4FXV A;  3GJS B;  2MKC A;  2D3Z A;  1MWZ A;  1E6Y A;  3AAW B;  1ICE B;  5ETN A;  5KFB A;  4NA2 A;  2JZ5 A;  1SH3 A;  5CYQ B;  3DXS X;  3TAR A;  5GAH U;  5J2P B;  2OLW A;  2F4V J;  2XYP B;  5I42 B;  2VPX B;  3NBP B;  3CD6 S;  1L3S A;  2HQI A;  2XCA A;  3W5Y A;  4Y34 A;  2H3E B;  3PDN A;  1QAX A;  3MMC A;  1X0F A;  2OHD A;  2CJB A;  1N5Q A;  1NPR A;  5HK4 A;  3J7Z T;  4V19 J;  3FSI A;  2G9O A;  4Z7Y A;  5HL7 Q;  2RIJ A;  3U02 A;  4CTA B;  2ZJP Q;  2EFP A;  4A8F A;  2V6A A;  4RL1 A;  3IFE A;  3W8P A;  4RUC A;  2IJR A;  3H5S A;  3H25 A;  4ZLJ A;  4N8O A;  2VFR A;  3M6X A;  3MUT P;  1FFW B;  3KLF B;  3MZI A;  2I9S A;  4WFB Q;  2W9C B;  2DGV A;  3QT7 A;  2MTL A;  1JLE B;  2F5G A;  3M9M B;  1I51 B;  5IOL A;  1C1B B;  1FCA A;  3PHT A;  3B4D A;  2RRA A;  3AY0 A;  3KWM A;  2HPU A;  4KPC A;  3W2V A;  4FS2 A;  3DMJ A;  4DPW A;  4CLK A;  2PEH A;  4UQT A;  3G87 A;  2V8P A;  2ZH4 A;  1WNE A;  1D9A A;  4OI4 A;  5B0G A;  4N56 A;  3TAQ A;  4HKQ A;  1DY3 A;  2ROE A; 
#chains in the Genus database with same CATH homology
 1EHW A;  4F4A A;  3EVM A;  3ZTQ A;  3VGU A;  3Q8V A;  3FBC A;  3EVO A;  1W7W A;  3VVT A;  3ZTP A;  1S5Z A;  1B99 A;  1WKL A;  2BX6 A;  3Q8Y A;  1NDK A;  3ELH A;  3NGS A;  4DUT A;  3Q8U A;  3R9L A;  1VYA A;  3B6B A;  3PJ9 A;  1NLK L;  1B4S A;  2HVD A;  2DYA A;  2DXD A;  2B8P A;  1MN9 A;  3JS9 A;  3EIC A;  1HIY A;  3BH7 B;  5BXI A;  2DY9 A;  4ANC A;  1LEO A;  4UOF A;  3NGT A;  4S0M A;  1KDN A;  4DZ6 A;  1NSP A;  1S59 A;  3EMT A;  4ANE A;  3EM1 A;  1BHN A;  1PKU A;  3BBC A;  3EVW A;  1XQI A;  3PRV A;  3BBF A;  3ENA A;  3VGV A;  1HHQ A;  2VU5 A;  1S57 A;  3ZTO A;  4UOG A;  3NGR A;  3FC9 A;  4FKY A;  1NSQ A;  1MN7 A;  1NDL A;  1U8W A;  3ETM A;  1WKJ A;  4WBF A;  3WX8 A;  4UOH A;  3Q86 A;  1LWX A;  4CP5 A;  1JXV A;  1BE4 A;  2NCK L;  1HLW A;  3FBF A;  3MPD A;  3FKB A;  2HUR A;  1XIQ A;  4F36 A;  3ZTR A;  2DXF A;  3GP9 A;  3VGS A;  3VGT A;  5IOL A;  1NSK L;  3Q89 A;  3L7U A;  1NUE A;  2DXE A;  1UCN A;  4DI6 A;  2B8Q A;  2HVE A;  3EJM A;  4ENO A;  4HR2 A;  4KPC A;  1NB2 A;  1BUX A;  3G2X A;  5C7P A;  4W98 A;  1NDP A;  4EK2 A;  3FBE A;  1NCL A;  1NHK L;  1F3F A;  3BBB A;  2BEF A;  2CWK A;  4C6A A;  3FBB A;  4AND A;  3B54 A;  1F6T A;  1PAE X;  3EE3 A;  3FCW A;  1NDC A;  2AZ3 A;  2ZUA A;  3GPA A;  4FKX A;  4O0N A;  3BH6 B;  1ZS6 A;  1WKK A;  3FCV A;  5CAB A;  3Q83 A;  3ZTS A;  1K44 A;  2AZ1 A;  3DDI A;  1NPK A;  3NGU A;  3DKD A;  3VVU A;  5CAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...