1FRIA

Azotobacter vinelandii ferredoxin i: alteration of individual surface charges and the [4fe-4s] cluster reduction potential
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
b'AFVVTDNCIKCKYTDCVEVCPVNCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN
publication title Azotobacter vinelandii ferredoxin I. Alteration of individual surface charges and the [4FE-4S]2+/+ cluster reduction potential.
pubmed rcsb
source organism Azotobacter vinelandii
molecule tags Electron transport
total genus 31
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1993-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1friA00
1FDAA 1FRMA 1WTFA 1BLUA 2FGOA 1VJWA 3MMAB 2PA8D 5E7OB 3MMAA 3MM8B 3MM8A 2V2KA 1FRIA 1JNZB 1KEKA 2FJEB 1FRKA 2FD2A 1R27B 1Y4ZB 4XDCA 2FJDB 1FXDA 2V4JB 2V4JA 2VPYB 5CH7B 1FDBA 1H98A 2C3UA 3MMBB 1FRXA 1Y5IB 3EUNA 1C4CA 1FDDA 3MM5B 1PC5A 1SIZA 1A6LA 3MM5A 1JB0C 1SIWB 1H7XA 2Z8QA 4XK8C 3GYXB 1FRHA 1BWEA 1FERA 6FD1A 1GTHA 1GTEA 1DAXA 2GMJA 5L8RC 5BYQA 1D3WA 3MM9B 1XERA 1B0TA 3MM9A 1CLFA 1FF2A 7FD1A 5BYRA 1DFDA 1FCAA 3HKZD 1BC6A 1SJ1A 1F5CA 2WSFC 1B0VA 1H7WA 2XSJB 2VPWB 2WB1D 2XSJA 3MM7A 2VPXB 1JNRB 4Y28C 1GT8A 1FRLA 4RKUC 1ROFA 1K0TA 3LW5C 4ID8A 1FTCA 1KQGB 1BD6A 4L6V3 3EXYA 3IR6B 3OR2A 1DURA 1BQXA 1Q16B 1FXRA 2IVFB 2VKRA 3C8YA 1G6BA 2FJBB 2UZAA 4KT0C 7FDRA 4OV1A 2C3OA 1F2GA 1H0HB 5CHCB 2Y0SD 2C3YA 3MM7B 2ZVSA 2PMZD 3MMCB 1HFEL 1F5BA 1RGVA 3MMCA 1KQFB 2FJAB 1B0PA 1Y5NB 4YDDB 3MM6A 1PC4A 3IR7B 2O01C 3IR5B 3PNIA 1IR0A 3OR2B 4XDDA 1GAOA 4OMFG 2WAQD 3EGWB 2C3PA 4CI0B 1AXQA 1IQZA 2PDAA 2WSEC 1Y5LB 1FEHA 1G3OA 2VPZB 3OR1B 3OR1A 2FDNA 1FD2A 2WSCC 3MMBA 5BYSA 5FD1A 2C3MA 1FRJA 2GMHA 6FDRA 2C42A 4AYBD 1FDNA 4DHVA 1C4AA 3MM6B
chains in the Genus database with same CATH superfamily
5L39A 5EWGA 2E7XA 5D8HB 2DJWA 3OXFA 3KNAA 2D9PA 4DV7F 2JZ5A 3QLHB 3GIJA 2W2PP 4DG1B 3IS9B 4IH5A 1FHTA 3A13A 4PXDA 3DN9A 3KLHB 1CULB 3BM7A 2CJBA 4RNMA 4Y2KA 2M88A 3LWLA 1IKXA 4Q8EA 3GONA 1OS5A 1F3VA 3DXBA 3VV2B 4DL0C 3AAWB 1TMMA 5IWAJ 4OZJA 4USTA 1TAUA 1JLAB 2D69A 3OV7A 3VF0B 3PEJA 3K2YA 4K2XA 2HWHA 1ZA1B 3JSRA 2YKOA 2UUWA 1E6YB 3OHBA 3NWGA 2NXCA 3QAEA 1Q8BA 3UNGC 3MR7A 3UWTA 1UZHA 2LXFA 3OD2A 4I6YA 4ZK7M 2LQBA 1YIJS 3W3SA 5BYSA 2GIQA 2A2DA 3I0SA 2GMHA 1SXLA 2CYYA 2E9TA 2V9KA 1UVMA 1WG5A 4JI7J 1YSJA 3NY0A 5C2GA 2BW2A 4XO0A 2VH7A 2BJ1A 1S9GA 2UV8A 1VJQA 1YBTA 1FX2A 4NXNF 1C4CA 4ELVA 2X3DA 4RLEA 4YR3A 5EX0A 6AT1B 4GKJF 3WC0A 2MQQA 4FBUA 3K58A 1VQ6S 1R8CA 4YY3F 3DRPA 2NUHA 3BS9A 1H3DA 1Y9OA 2OH2A 5E3PA 4HYKA 3OXGA 3E01A 2XMJA 4EYHB 2JSXA 5F8LA 4WP9A 3Q8UA 2MQOA 1L3SA 3AB4B 1VIOA 4OYPA 2CXEA 5EHHA 4RNFA 2XMWA 2FJBB 5DM7Q 5DQGA 3CCES 4DR7F 1N6QB 2WVCA 5RUBA 4LR7A 1NDCA 4OZ3A 1JLBB 1MSWD 5J2MB 2UUTA 3QQCD 1P9QC 2DB1A 1QVGR 2WSEC 2X1GA 2UP1A 4MMOA 2AYEA 4JI3F 3GG1A 3P96A 3M9NB 3POTA 4W90B 1SQEA 2HW3A 4WF9Q 2LYVA 4JI4J 2YKQA 2BV3A 4NXMF 1WWHA 1VQMS 1FDDA 4F0HA 4PKDB 3NP5A 4DUZF 3P5BP 4U7UD 2HEKA 3OLBA 4OYXA 4JI5F 3DLGA 3KNGA 3I4HX 4QZVB 4DL2A 1EIYB 3LA0A 3DGPB 2HZVA 1NO8A 2VBXA 4ID5A 5BR8J 1MLAA 1UA1A 2AYGA 3CCTA 4LF6J 4I69A 1XR7A 4LRFA 2CQIA 3NGRA 4JYAF 1NUEA 3QWPA 2H48B 3HX9A 1NU4A 2KM8C 1X5SA 1FKOB 2XGPA 2L9DA 1RT1A 3P49B 4HACB 1S79A 2IRXA 1T0TV 3FEXB 3SIPB 3T1AA 1U25A 2F4VF 2QL5B 3C16B 1X9SA 5ETPA 4B9TA 1KWMA 2R8GA 4L76A 1U45A 3X3UA 1WG4A 2HFVA 3T41A 1HQ2A 1Z1ZA 2B9YA 4OX8A 2BQ3A 1WEXA 5LMNF 1QSSA 2BE9B 2CJKA 4BDPA 2EFNA 3J7Z5 2BR0A 2JEFA 5AXKA 2RKIA 3BSCA 3UDEA 4ELTA 2LXUA 4GKKF 2J7KA 1N48A 4ED0A 3SBMA 3SSQA 3D2WA 4TU8A 5FIIA 3TX8A 1URNA 1K0TA 4NLTA 3PW2A 1BQXA 5H9EJ 3M2RA 1QUVA 2UUAF 1IJFB 1RHKB 2AJQA 1S12A 1HI1A 3BGRB 2VOOA 1IR2A 2CQGA 3QAUA 3D3CJ 3F56A 4C8KA 3VZHA 1JKHB 1ZM9A 5GAEU 1T9XA 5K20B 2M9KA 4P52A 1HPZA 1K44A 4NRTA 3DU6A 4AL7A 3KLEB 3T3FA 4B3OA 1FDAA 1PIEA 4NA3A 2Q6BA 5LT5A 3CULA 3MPVA 3WIUA 4DL4A 3LAKA 5A6PA 2UVVA 1BY9A 2MZRA 4ZVSB 5G0RA 1M5KC 1NPKA 2A2CA 2VUGA 3CJKA 1CVJA 1TELA 1SJQA 4KHPF 3A4TA 3NNAA 3Q8QB 3L7UA 3GV8B 4OYWA 3ENQA 4LRBA 1FK9B 1S0VA 3DRRA 3TX0A 4B3SJ 2HHUA 1DQ9A 2A18A 4DV3J 4DPOA 2XI2A 4O3OA 1LEOA 2HHSA 3QT5A 4EMDA 4ILLA 3DOKA 1KLMA 1G4CA 4ZP6A 4LVNP 2MJNA 2HHHJ 1U6FA 2V8VA 5IS2A 2NSBA 2F8MA 3IAM9 5CD4A 1L3KA 4KV8B 3OJUA 1X60A 3WDOA 2KU7A 3WIVA 3M8SA 2BANA 1QAYA 4QIFA 2AW0A 2C2KB 5IOLA 1TUVA 1M5VC 4E98A 2JJ4D 2J6UA 3M30A 5L1JA 4DFJA 4Q45A 1XMOF 3DKDA 2QLWA 1M90T 4JI8J 4YHHF 5CA5A 2ZKTA 2N3LA 1Z4UA 3CO0P 2OTLS 2YKNB 3FCVA 1YGYA 4C0BA 1KOOA 2IPOB 4L3KA 3DMJB 1WKJA 3GR0A 3K7RA 5LMUJ 5KFXA 4DCPB 2ZWOA 3EZUA 5KFUA 3HI9A 2C2RA 4P75A 4WIIA 3THPA 1LXJA 2LEAA 2ZBQA 1KQSR 4DOZA 4DPXA 2IDLA 1FJGF 1KSPA 4ES1A 1Q53A 4NYPA 1S9EA 4USHA 1KRPA 2HKEA 2VFSA 4ZVHA 4MFBA 1AROP 1YJ9S 1YBUA 3CIZA 1HQEB 4WXWA 4G3IA 3HO1A 3T1HF 4OYBA 4CRJA 2CNKB 4JI0F 2RRBA 4YDXA 4DJBA 4HEA9 2KDOA 3LP2A 4H4OB 3RGIA 2MJUA 1SJFA 5JVGQ 3MM6B 3DLEA 1RAFB 3AT1B 2IJFA 4GMKA 4QW8A 5LSOA 1U8SA 3MMBB 4ENOA 5KT6A 2ZH5A 1TU0B 5BYQA 3J81j 3CB4A 2YWEA 2KXNB 2ZITA 2ZDOA 1VQOS 3TVKA 2GZOA 5L46A 4ZPWR 4NMLA 5KFSA 3WX4A 4LRDA 2I38A 4LRCA 4IG3B 1U09A 1KFSA 3EVOA 2U2FA 3D0GE 1JXVA 1IBMJ 1DQ8A 2V94A 3HHLA 4HL9A 3IR6B 4TY8B 4NCAA 4CH0S 1R8BA 3ITHA 4ED7A 1UFKA 1MU2B 2G0JA 4ANEA 2HAFA 3HM9A 1RWWB 1B4SA 4IYQA 2W2QP 3LGHA 3MM7B 4QU6A 2ZZMA 2N4CA 3MEEB 3EXCX 4IH7A 2PE8A 3QGIA 4PABA 1HLWA 3ZTSA 3M9MB 4OLPA 3QLHA 2KRBA 2XMAA 4DG1A 5H1SV 3IS9A 4F02A 4UT4A 3W62A 4N76A 4CDIA 2YWFA 2W9AA 3SQGB 3KLHA 2HBZB 1CULA 3LALA 3KUHA 5KG5A 3FMBA 1CJVB 4KGKA 2D3UA 3D1QA 3KLGA 4LT6A 1HWKA 1FWKA 1S1TB 2GMJA 1NLKL 2KT5A 2DGTA 4DV5F 3IG1B 3PACA 2YKMA 2Z2ZA 2AMCB 5GAHI 4L74A 3TR5A 2JWNA 1RQ0A 4NLWA 1D9FA 1WKLA 3QMQA 5I3UB 2IBOA 3DOLA 3RU0A 3L4BC 1UCNA 1V9OA 5K14B 2BM1A 1TUGB 2X7IA 1OY8A 3MPYA 9ATCB 1LQ9A 4UOHA 2RUSA 3D4JA 1X4BA 1KTVA 4OHZA 4CLYA 2DBBA 4ZLPA 3GJQB 2HRTA 1JXLA 5J2QB 1FVSA 1HD1A 5A2QY 1B7FA 1RWOB 3ZTOA 3KG4A 2EC0A 3AQPA 3BH7B 3VGVA 3I32A 4ZVUB 4ZCMA 5E0OA 3V6DA 1CSJA 5I42A 2ZH9A 4U95A 3MM5B 6FD1A 3NL0A 1HNVB 2ZNZA 4ZS6A 4WKYA 2R7SA 2BOAA 1W25A 3IRXB 1UP1A 4WU3A 3G6ES 3JYTB 3AOAA 2MXYA 2NYIA 1N6QA 5H9FK 5HL7Q 4X84A 2V50A 2FIUA 1KQGB 4M5DB 2H1YA 5J2MA 3GWCA 2AX1A 2J7UA 2KM8B 3C8YA 4DQPA 3SZ2A 2FJAB 4A8SA 1QAXA 4CCHA 1MMNA 1RHRB 4YR2A 1NPRA 3D6TB 2UXDF 2JVRA 1JLEB 3KUEA 1RAJA 2ATCB 2Z56B 3R5DA 1WC5A 1URRA 1C2PA 1NZ8A 2BM0A 4A8YA 5AJ3J 3NS7B 4MK7A 1S59A 2JOQA 5IC6B 2B6AA 1EAYC 3QFHA 4QYRA 1Q81T 3BKUA 5KFFA 2ZJRQ 3PRDA 3GU0A 2IHR1 2DRBA 3KUGA 2ZHBA 2EWHA 4C97A 1S97A 1T95A 3KKFA 2AHOB 8ATCB 4P9SA 5DG9A 2IFXA 1Q82T 3PO4A 2FHJA 4PQAA 4C8NA 2GJ2A 2VODA 2HK2A 3EDQB 4NI2A 2BQRA 3BGLA 1NK6A 1FTCA 5J2NA 2YWGA 2MKJA 1LFWA 4TU7A 4PYAA 2L08A 5EX3A 1GEHA 2PC6A 4ZHRB 5F8JA 5MLCV 2CG4A 2BRLA 3V4IB 1IKWA 1WNEA 5IC4B 3G8QA 3TZZA 2DXDA 3MFHA 4ZIVA 3OR1B 3SFUA 5LXRA 2O1PA 1X4FA 4GC7A 4CTAA 2AGOA 2NZ4A 4DSKA 3NXZA 1I6JA 4OYMA 4DPUA 4OI1A 1RAEB 2RAQA 1PCAA 3RUBL 3FBFA 3U7JA 3QZ8A 3FFIA 1S4EA 2DH9A 2K8GA 4XIUA 2R2RA 4LF4F 4IO9Q 4ECXA 2FY1A 1APSA 5HO4A 2DVIA 1KVJA 5KFPA 4TVAB 3PO5A 1X5TA 1LWFB 5GVQA 2AP6A 1Q16B 5J2PA 5HSPA 4X65F 4NLSA 3L3CA 3PW4A 3J7YI 5AE3A 1N33J 2GNKA 1FKPB 2J9DA 2BMBA 4EO8A 2Q3PA 2DT9A 3U27A 2ZC4A 3OR2B 2MLYA 3CC2S 3CCUS 4FS1A 1JLFA 1KONA 4KPCA 3QNWB 1S6PA 2I1RA 3UFCX 1NZAA 4C8ZA 3GFHA 1S6QB 4EZ6A 3FBCA 1N34F 2V4JB 1G2EA 4EZ9A 2KHCA 2QYGA 2OFGX 3BBFA 1FK9A 4IG0B 4WWSA 3VVUA 4IOBA 5DZ7A 3GJRB 7FD1A 4QIGA 2GJFA 3FQLA 1FJCA 4LF5F 3M2VA 4K5RA 1VOMA 2KHDA 2PGCA 1UEVA 4OHYA 2W4DA 1BQMA 3WBZA 2NXNA 4L6V3 4IH6A 3AQOA 1ZAXA 2HHXA 2GHWA 4IOCQ 2E5JA 2VG6A 1AZSB 2R8HA 2VA2A 2G2YA 4DS5A 2MQLA 2OJ3A 2OD4A 3Q22A 1NSKL 1XNRF 2IYIA 1DJ0A 4DPYA 4QR0A 4DZ6A 3R6GB 1VQ7S 1HD0A 3VAKA 3JQJA 3HJVA 2AJFE 3H90A 1YJTA 2YKNA 4EGLA 1WTBA 1I5OB 3Q2SC 3U1LA 3BDEA 3PEHA 3MM8A 1HIYA 1EHWA 1U7LA 1SH3A 1MW7A 3SDEB 1FRXA 3CJ3A 3L7OA 3BO3A 4UUXA 3DRSB 4IUFA 4LSZB 4URGA 2ZZNA 3J7A1 3LO3A 5GADI 2FQQB 3Q86A 1VQPS 2FZCB 4FXDA 5C25B 1OQ6A 4DMZA 3FC9A 2FYXA 3PRVA 2GA7A 2XY5A 4G65A 5A8RB 2W4CA 1RU1A 4WFYA 4NZ7A 1VMBA 3QYYA 4O0IA 4PWUA 1TL3B 4H4OA 3N0VA 2R8KA 3NGKA 2YPYA 3MM6A 4H54A 3WHIA 1BQNB 2EG1A 4TQSA 1TP7A 2V68A 3N28A 1J2VA 1RXOB 2XEXA 3HJFA 2HSEB 2DK2A 3MMBA 1GXUA 2ZWPA 4DHVA 1PYTA 4RNNA 1NB2A 1DLOA 2LEPA 1Q7YT 2VPYB 4I68A 4IG3A 4DR3F 3KHRA 5DZ6A 4OHVA 4IFVA 3CDUA 3NCQA 1RSCA 4LRAA 2E1RA 3W5ZA 4DV4J 1LWCA 2B4UA 3WZ0A 5FJ4A 4TY8A 3JSMB 3K5LA 3R27A 4DUYF 1MU2A 3W9IA 2IY5B 2CJ9A 4A8WA 3KLIB 1WDTA 4NA2A 5E5NA 3MM7A 3M6WA 3UPFA 2AT1B 4XAKA 3ENVA 2G9OA 2Y1LB 4RJVA 2IM2A 3DOMA 2L41A 5E41A 3G8SA 1VQSA 4QW9A 4ECYA 2DIVA 1IM4A 2DR6A 1RKIA 1F9HA 2HGMA 3NS6A 4CNZA 3FK4A 1ZM2A 2FHKA 2ZZTA 3Q8YA 2C2MB 1XBWA 1UEUA 4ZVPB 4CO0A 1P6TA 3B78A 3MTJA 1SC1B 2M7SA 3D67A 3K5NA 1ZAWA 3I87A 4DFKA 1FVQA 4AQYF 2PIIA 1UL3A 1FNMA 4DV2J 3RR7A 2HAIA 3R8YA 2LU1A 5I3UA 2JEGA 2XO7A 1WSRA 3AY0A 1HARA 2G1HA 3CJ2A 4O3PA 3ZNJ1 4DS4A 2MZTA 5B0FA 3NAHA 2M8HA 4OI3A 4ZJQA 4K4VA 2DNMA 3H59A 2VZ9A 1JNRB 2BE2A 5ETQA 2XHCA 2M8DB 5HLFA 2J5AA 3EZOA 3MECB 4C6AA 1YRXA 5HVFA 2HMIB 5F8IA 3KHHA 3TUPA 2HQCA 3A1YG 5DS7A 5A8KB 1WKKA 5A0YA 4LR9A 3Q8PB 1Q95G 3EYZA 3A8JA 1WHYA 1Q7LB 3IR5B 1QAJA 2UXCJ 3TZYA 2VB6A 2MDAA 3ZFVA 3SEOA 4BWMA 3WX8A 4FF2A 4PG7A 1HNVA 2FGOA 5KG1A 4ED5A 4MYTA 4F0MA 1AUDA 1FRIA 1LOUA 1VQKS 2PO4A 1VQ5S 2V2VA 4DV1J 1RUSA 3N6LA 3OVAA 3QT8A 4Z7CA 1EKRA 3BEGB 1UJ6A 3PW7A 1EX8A 4Q2MA 1GTHA 3EICA 2P2CB 3PX0A 4I2QB 2QGFB 3CCLS 2DNYA 5F8NA 1SJ1A 1HR0J 3KJVA 2W9BA 1RT2B 3K57A 2MY8A 1MROA 3TEGA 2OELA 2ZBRA 1PGZA 4OZ0A 1X4GA 2MZSA 4KTQA 1ZM4A 1JLEA 3PHTA 2UU9F 2XLJA 4LF2A 2IJRA 3HD2A 1NK8A 1CG2A 2VDHA 1C0TB 1VBYA 2QLXA 1VC6A 3K0JA 1KN6A 1TKTA 4KO0B 2RRAA 3DDIA 1I3OB 3U02A 5KG2A 3FEZA 2BE7D 2Y8YA 2C3MA 4WJBA 3NBPB 1C4AA 1FRMA 1WTFA 3CO9A 2R2UA 4NWBA 4AT1B 3MMAA 5KOWA 2HS0A 3TJ9A 4TY9A 4I0WA 2E1PA 2ZH3A 4M5NA 3ELHA 3CMES 3UD5A 2MY7A 4MH8A 2ZEJA 5B0DA 4EFAC 4KPYA 1YTYA 3V4IA 2WB4A 3CIMA 3QGPA 3OJSA 3VAGA 2NZCA 2HGLA 1R31A 3SMZA 2XS2A 2HLUA 3GP9A 2EBEA 4L75A 4O0NA 4LF1A 2ZM6J 5C24B 3UQSA 3AD9C 2YQ1A 1W7WA 5F0WA 5LSRA 2ADBA 2JDJA 4EBDA 5C42A 1KQFB 2K2PA 2H3EB 1B0PA 2QA1A 4GRSA 1WJ9A 1I1GA 2BYCA 2Q6CA 3SCKE 4AE5A 1QVFR 3KG1A 5SUHA 2D3O1 2CZ4A 4WP3A 4F2SA 1RKJA 2ZH7A 1VYAA 3RAQA 2DHHA 3LF0A 2WTFA 5K5MA 2N3OA 1HKAA 3TVZA 4XDCA 4DQRA 1FXDA 3NKYA 3D5MA 4M5HA 2DR8A 4ZDNA 4RW9A 1IBLJ 2IVMA 1JK9B 1LWFA 3LUYA 1B64A 4ITSA 1RCXB 4KKOA 2ROEA 4J9NA 4DX7A 3DYAB 2J0QD 3D1OA 3RBZA 2W24A 4LMZA 3IN5A 1VI7A 4KE5A 2BRKA 1REVB 2BJ8A 4NMXA 1ZAVA 1FKPA 4FN5A 4O44B 1VK8A 5LM7E 2OGUA 3OR2A 4FNIA 4OZ5A 2Q43A 2VQEJ 3AJ2A 3MXHP 2MSTA 2F40A 1N52B 1FD8A 1F2GA 3G6XA 4UQGA 4GVBB 3GV5B 1RGVA 5ITHA 4DSJA 3HT0A 3O8WA 4P2XA 1C0UA 4K4WA 1PSDA 3GYNA 2B5JB 1DTTB 3DU5A 2BOPA 5HQLA 3OVBA 1YJRA 2VG7A 1S4FA 2OPQA 3VGSA 4IG0A 2J0WA 1T9TA 4RU2A 5E3RA 3MUVP 2ILYA 1LNQA 3MAAB 1C1BB 2JC0A 5HANA 3BB5A 2YVSA 1YLXA 3JXOA 3TYTA 4X62J 2KFNA 1XR6A 4ECTA 3PRBA 2W25A 3H20A 1SIZA 2CRLA 2MZ1A 3I0RB 3THVA 3HT3A 3M9OB 4DEZA 3EJMA 3PX6A 5KG6A 4ED4A 1R6YA 2YNFA 3LGMA 3K5PA 5CCMA 2JFDA 3H4BA 4IRCA 3PHEA 1T9UA 5JUMA 3N4WA 1YI2S 5KG0A 1WOSA 2XSFA 5FLXU 4IKAA 4V19J 4NE9C 3KLFA 4F3QA 4DR5J 2A0FB 2Z2YB 3M6XA 2W7OA 4EUVA 2A3JA 3QIDA 4DV7J 3ZNUA 4EO6A 3HFZB 2F65A 2PEHA 2ZH6A 1GMUA 4BLGA 2R4FA 2J6TA 5CYJA 3R6LB 5HP1B 3MR6A 1SUQB 1SCJB 3SDEA 3HP6A 3BPSP 1MWZA 1M0SA 4KHMA 1WD6A 1VBKA 2ACYA 1NH7A 1O8BA 4QQBA 2GIRA 3T5KA 1HBNA 5A6WA 4KGZB 1RADB 4PPZA 1FJ7A 2KN4A 1Q78A 2VBWA 5DETA 4KFBB 2HQIA 3D66A 1H2TZ 1S0OA 5L1LA 3DXSX 2LQ9A 4QPXA 4HT7A 4WZMA 5CYMB 1M5SA 3E51A 4DR6F 2C1EB 3RW7A 3CEDA 4FXVA 1SKWA 3T19A 4LIRA 3T5LA 1U48A 1ROFA 2WVBA 4DUTA 5ETMA 1PAEX 1UVJA 1DURA 4MIAA 4ED8A 1VS3A 5ETOA 3J80U 1W26A 4NXNJ 3R5JB 1OYEA 4WZQA 4JI7F 3H0PA 4URQU 1S1UB 2AIRB 4KRWA 2ROPA 1A9NB 2MLZA 3HHLD 2FDNA 5B7WA 3KLVA 2AF6A 3VWSA 3ZZ0A 1HMVA 2DCUB 2XLKA 3GQCA 2MB0B 4DSIA 3R3TA 4ZLNA 2MKIA 1AA1B 2DNZA 4PXBA 3PVXA 3AHPA 2KJVA 1PO6A 1XJWB 3KLIA 2KO1A 3UCGA 1VHFA 4HR2A 3JAMY 1DBDA 1LKZA 1HBUA 5DG8A 2K7KA 5I3PA 2HZAA 3RBXA 2V9WA 4NLDA 3MFIA 2HIQA 4JI3J 3UD3P 1Q8LA 2LCWA 5GMEA 2Q1LA 4QYZK 1VLYA 4NXMJ 2B56A 3V2UC 5D4OA 4C7QA 4AXIA 1NK4A 1U1QA 2QLBB 1BGXT 4Q5VA 2IMOA 2VBZA 1YRUA 2RSQA 4HVZA 2HBYB 4JI5J 5EGYA 2CPDA 4S0MA 1ZZNA 2BEFA 1YK9A 2PA3A 4RUCA 4ZPBA 4EYIB 4F4WA 3T1YF 3LAMA 2AKWB 3ISND 2J0SD 4DX8H 2NQPA 3TAPA 1RK8A 2DGUA 1Y5IB 3A8IA 4JP8A 5BR8F 4FXWA 4LF7F 1NH8A 2QTWA 3JQKA 3CJSA 3MECA 2OHDA 1N5YA 1JLGA 2ZD1A 2V8HA 1CJKA 3DRPB 4J37A 4UOFA 2AYMA 4DQIA 4NLYA 2XMMA 4YEAA 3QIPA 4JB8B 5HN0A 2IBKA 3ICLA 5IT4A 3RJMB 1R0CB 2RIJA 2F4VJ 2RRNA 5KFOA 4NOHA 5B0BA 3KYLA 1CJUA 4OFZA 5F8MA 2V4QA 2E7WA 2RDJA 1TL4A 5LMNJ 3OVSA 2J6SA 3RB6A 3DRYA 2I2YA 1VRUA 4M8LA 2VV5A 2OSRA 4GKKJ 1IWGA 3GIKA 2DISA 1FI4A 3IA0A 6FDRA 4TN2A 2JLGA 3POTB 3F44A 3HMJG 1RAOA 3RYLA 1NRKA 1EZZB 2EFGA 3BF4A 4MK8A 2DHXA 3UI3A 3B4DA 3PW5A 4A8XA 5HVHA 3ONQA 1B70B 4PWDA 2HPUA 2UUAJ 3R5AA 5F3TA 2XMTA 1QY7A 4XK8C 4ZLJA 2AGPA 5IT0A 1WEYA 2NREA 4F67A 2HRUA 3HHNB 3C14B 3DLGB 1L3VA 2D41A 2DIUA 1BXNA 2XSJA 1NSQA 2J9EA 2V8DA 2CADA 1P8GA 2KI2A 4O3RA 2L9NA 4U9RA 1G1XA 2B4VA 3Q89A 3CC4S 4KO0A 2DGQA 2B3TB 3AFGA 2RQMA 3RB4A 2JL9A 2AYBA 3CJ8A 2FHJD 5LJ3Y 3NBPA 4X4PA 2BJ3A 2HFNA 4KHRA 4ZPVR 4P2MA 2GVZA 3FKBA 3K5OA 5L1IA 3RAXA 4KHPJ 2RU9A 3CJRA 1RT1B 2CIMA 2IRUA 4OZ1A 2LDYA 1CEZA 2OPPB 3MTKA 2XMUA 4DQSA 4OX9F 1EB0A 2BJ7A 3I5CA 4MIBA 4MKYA 5AE2A 1AFJA 3SYZA 2KXHA 4DBQA 3MPUB 1JWWA 4B3SF 2RVJA 3BGFA 3CD6S 1LW0A 4DV3F 1GTEA 4C11B 2VASA 1T3OA 3PFOA 2ZE2A 5C24A 2OLWA 4P2SA 2HHHF 4RO0A 3ILOA 2XNQA 2X1FA 1B99A 4EBEA 4O3NA 1QM9A 3EM1A 1YJNS 2K1RB 2MZJA 1J5OA 3NGDA 1U1MA 4FYVB 3HULA 3GE9A 3FBEA 3N6MA 4FVMA 4ZVTB 1ZTWA 3I55S 1U24A 1UPPA 3AODA 1NK9A 2K3IA 3ENWA 1QTNB 4DR1F 4ZA1A 2MGZA 5CAAA 1U47A 3LOUA 4TQRA 2RHSB 2VF3A 2B4PA 3KG0A 1UJ5A 1KLNA 2N7YA 4DL5A 4B3OB 4PPDA 3DFEA 4RUAA 2AV5A 2QN6B 2MMYA 1R43A 3DYAA 2V2KA 2MSSA 3DDKA 2HFOA 4CP5A 1S48A 4RZRA 3DHWC 1RBLA 3BR9A 3M8QB 1FJGJ 2FVPA 2A1BA 1DHMA 5F3ZA 2VG5A 2R9LA 3CJKB 1ULRA 2QFJA 1A6LA 2R8JA 2ERRA 2MKKA 1UFWA 4QR1A 2ZDPA 5MAOA 3CCZA 3TW0A 4CIOA 4M1KA 2DNRA 3ZZPA 1N5TA 3F0NA 3T1HJ 4K4UA 2L3MA 4DU8A 3JB9k 4JI0J 3C6UA 1FA0A 4FP9A 5B0CA 3MPWA 3QO9A 1X8DA 2A6OA 4ETZA 1LWXA 3OHAA 3K5MA 1YX2A 3LTOA 4TYAA 3HSZA 1LWEA 4EEYA 3JS9A 2LU2A 3H7HB 5KFVA 2HBRB 3MAAA 1NK5A 1C1BA 1MWYA 1F2HA 1N88A 3HSJA 3ZZRA 1WC3A 2XB2D 1FFGB 3EWGA 1OQ3A 4NL5A 2IM0A 4NRUA 4OJHA 2UUCJ 1U2CA 1S77D 2LQJA 2F4FA 4OYAA 1S99A 4RW7B 2VBYA 3UR0A 3BJYA 2D7SA 2BA9A 4CLSA 5HBMB 2WVDA 4B9LA 1RHMB 2V63A 2J0XA 1KDNA 1R89A 3NNCA 4P6QA 3R5CA 3A12A 4G1IA 1WC4A 3U1MA 1SQFA 5ETTA 3T5HA 2M2BA 4QIEA 1WC1A 2YBVA 1SJRA 1RWVB 2QA2A 2JLFA 4PWWA 2IVFB 4LSLA 3IM8A 1SUQA 1S9EB 1QE1B 3BN4A 2FJXA 4MFBB 3LGNA 2VL1A 3OFFA 2P6TA 4L3NA 3IR7B 4F4ZA 3BQ2A 3DM2A 3KK1B 4DN0A 4LQ3A 3HVTA 2DYAA 5B0GA 1JLCA 2KXFA 3V5RA 5HMWA 1PJ6A 3M6UA 2B9WA 2AJ1A 2POKA 1FRJA 3TWZA 4KFBA 2E5LF 4UUWA 1M5PC 2CQ3A 2QA4G 1ZZFA 4BS2A 1NXIA 2W9CB 4V1Ak 4ZVOB 4Q2LA 4C3LA 1FDBA 5K8MA 1OYDA 3QPIA 2Z8QA 1YDLA 4HT5A 1CQNA 4ZCLA 2HVHA 4L72B 3CD5A 4J9SA 1CLFA 4ILMA 2DD8S 3OW2R 4B02A 2EG2A 2Y0BB 1WF1A 3IMQJ 4OI2A 4CLUA 2QLFB 2VD3A 1NKBA 4C3KA 3ETMA 3DC2A 4TXSA 2XS7A 1F5AA 3TP2A 3ITHB 3LWMA 2RUGA 1UZDA 1Q0NA 3MUMP 4KJIA 2UZAA 3ILIA 2YWKA 1RT4B 2DNKA 4IDKA 3ZZZA 1RAGB 4C0OC 1DRZA 2FGCA 3RBDA 5DQIA 1GMWA 1FXLA 1RT3A 3RBEA 3BQ0A 1Z2ZA 5F8GA 3CMQA 2MKCA 2B9XA 2Z4PA 3VAHA 4PUOA 3FCHA 2Y1RI 4WIQA 4OHWA 4KQZA 2CQHA 1MG7A 1RA7A 1RT5B 3KLGB 3OXLA 1NJYA 2GFFA 2IIHA 3AXMA 4X4OA 1D3WA 1FFWB 2YKMB 1XERA 2J7WA 4Y65A 2Y9HA 4WXOA 1HNZF 1UETA 2Q79A 1RTDB 1IUJA 2Z57B 1QLNA 4K50A 3W61A 3AJ1A 2BXJA 3EPGA 3TANA 3BN7A 4DWIA 4F8RA 3DOLB 2K06A 3FCWA 8RUCA 4O3SA 4URSA 3V6KA 4F2RA 2EEYA 2ZUAA 2AU0A 4BC7A 3R7BB 4N8NA 2DH7A 1HYSA 1OPZA 3KHLA 3W8PA 5AJ3F 2PFDA 2OFHX 1ZYQA 2HIYA 3HZEA 2I5JB 4KGXB 2EKYA 2GQQA 2XM3A 1CQMA 1WG1A 4U8YA 3TUJC 3CCRS 2C42A 2OMOA 1HW8A 3D1HA 4WBFA 4K4SA 1VJWA 2EFOA 1LW2A 3H5UA 2YY3A 3W2WA 2AGQA 2RT3A 1N5QA 1JJ2R 4QWDA 1FWPA 2R7VA 5LOQA 3V6DB 5I42B 4U7CA 4DR4F 4HH0A 2VC0A 2EVZA 3FQKA 2GO9A 4RWXA 2SXLA 1U1KA 4CH7A 4CLPA 4DL3A 2CNLB 2GW8A 2IM3A 3OL7A 3V4MA 4G1QB 4G1PA 1XIQA 2R7UA 3MCSA 4KC5A 4R0JA 3MAQA 2ZOMA 1DZ5A 2HQ3A 4QOTA 2BX6A 1NAQA 4JV1A 4JI1F 4J9RA 3RRHA 4LF4J 1RLDA 4KSEB 1YZ6A 4LVOP 2QSFA 4RBTA 3DDNA 5ETKA 3GJSB 4NCBA 1RAHB 4B3TJ 3GSDA 3J7ZT 4LFCJ 2MEWA 2B6AB 3C14A 2YPZA 1R0AB 3LQVA 3R7NB 1HHQA 4X65J 3JTPA 4U6PA 1SIWB 4C8OA 1R0BG 2EI5A 3MR5A 2IDEA 3UDCA 2KVQE 4C8LA 1A0OB 5AXMA 5AE1A 1LV5A 4X4NA 4UW2A 1FFSB 2VQFF 3QGGA 2DH8A 1JJ4A 4I6WA 1HI0P 4NI2B 1D1UA 3G4SS 5DO2A 2RMLA 4JI6F 3HFKA 5J2NB 2E44A 5KT3A 3T9ZA 1TQLA 1FXRA 1XMBA 3HSDA 4GO7X 3MR3A 2GAHC 4PCQA 2F1FA 3CGIA 1N34J 2CQ1A 2OPPA 2MQNA 1IKWB 2VA3A 2EW9A 4CYUB 3CF5Q 2DHSA 4WP8A 2MKHA 4ZP8A 1TFWA 1RABB 4K4XA 3W66A 2GJIA 2PD1A 2PI4A 4QR2A 4PEOA 2FLPA 4CTAB 3CCJS 4LF5J 1WC6A 4C11A 2W8LA 2DRAA 4M5MA 2ZJQQ 2HHVA 4ZPAA 3FFIB 1NEEA 5CZVA 1WORA 4P7TA 2K1RA 2FLNA 3I56S 1B0TA 3MM9A 2GGPA 5HMZA 1XNRJ 3HKZD 4HH1A 3N01A 2WSFC 1Q5VA 3K8VA 3WC2A 1S76D 2QT7A 2XZDB 1SB6A 1IXKA 2VIHA 1T02A 5J2PB 2RB7A 1BWVA 3IP0A 1QTMA 4B9SA 2E66A 3MDFA 2XO6A 4OHXA 1UEKA 3IWXA 2R7OA 3PYDA 3BV8A 4FS2A 2HNYA 1JLFB 4F4KA 3M8QA 1DQAA 2V8PA 1S6PB 2H65B 2H54B 1Y7PA 3FBBA 2CPZA 3BO2A 4V19X 5KFTA 1VQ4S 4ELUA 2JEJA 2B7CB 4NZ0A 3CD7A 4YUDA 4YOEA 2W1BA 4CLWA 1WOPA 4FF4A 4UQTA 4X66J 1WUUA 3D0IE 1SPBP 3S8SA 2ZH2A 2CVIA 2RJZA 3TJAA 3O5TB 2FC8A 1NJXA 5IZHA 4Q43A 1RWUA 1S7HA 3Q83A 2OSQA 1NKEA 2QL7B 4RUHA 3M2VB 2HVIA 1UW9A 1RDRA 2CPHA 1BQMB 3MI7X 8AT1B 2JLEA 5J1EB 3SXLA 2QRRA 2VG6B 1CC7A 3W2VA 1KTQA 4WPAA 4LR8A 4QIVA 1F5BA 4DR3J 2GV1A 2M70A 3M6VA 1VQ8S 4RW7A 4JV5F 2V34A 1RWKB 4OMFG 4WKRA 1BUXA 4DV0F 3IBCB 4DUYJ 5HBMA 5FD1A 1OSDA 3D28A 3M32B 4OZLA 2FC9A 2W7PA 4Y2AA 3MM8B 2XG8A 2I6WA 5JVHQ 2F63A 3M7VA 3CTRA 1F3FA 2AJ4A 1KKHA 4C8YA 1N8RT 1L3UA 2OTJS 4DF4A 1TKZA 3GILA 4FYXB 2H5EA 2YNHA 3I5AA 4UOCA 3PDNA 4P10A 1F5CA 1UAWA 1P1TA 1QE1A 2FJVA 4WFZA 2DITA 2KG0A 4OX7A 4IQMA 3KK1A 1KQKA 1AB8A 3N79A 3A3PB 4AQYJ 2L48A 4FF1A 3EGVA 3NGUA 2X51A 4CLKA 5H9FJ 5IT9U 2M5YA 4L73A 4UOGA 4N5SA 2VHGA 3IBFB 4E8UA 5D78A 2C2EA 2W9CA 2Z30B 3NAIA 2G4BA 3H5XA 1HBMB 4I2PB 2F5GA 1D9DA 4YR0A 1NSPA 1U4BA 1WEZA 2V67A 1RHUB 1DLOB 3P6YC 1OSCA 1KFDA 3RRGA 1OO0B 1Q86T 3CW2C 2RQKA 5KT2A 1N32J 3DCAA 3GPAA 1YITS 4IFVB 5KFLA 1GK8A 1LWCB 3PTWA 3NCRA 2DY9A 4LF8F 3CE8A 2CVEA 4B3RJ 1K8AT 1O51A 1S1VA 2HQDA 3B6BA 3LPYA 1RT4A 5EUHA 1WHXA 2XZTB 5HMYA 4N77A 5L1KA 2VOPA 3EXYA 4ZVQB 3CD0A 5G4DA 1WI8A 1TL5A 1YJUA 4KBIA 4IRDA 5DG7A 3DOMB 1S9FA 2A6MA 4RNOA 1R6VA 2P9GA 3W7BA 5F0UA 3BO4A 3KHGA 5KFRA 1UW4A 5A76A 2VICA 4CLFA 1WACA 3VAMA 4J7CA 4Y0FA 1N5SA 4J9MA 1RT5A 2ABYA 1EJ7L 4R5PA 1UFLA 5T14A 3PJ9A 3FVYA 1X4DA 5L38A 2JX2A 5D3GB 1FDNA 4DF8A 4AL6A 3UVJA 1GX6A 1TUWA 5IV3A 2HWIA 2IC3A 1HR0F 4XPCA 3CSKA 3LP0A 1RTDA 4NLQA 1UWAA 1Y00A 2UU9J 4DR2F 4UY85 3HHKA 4R8UA 2RDDA 3ULHA 1U8WA 2HK3A 2KFZA 5BYRA 1DFDA 1FESA 3BKFA 4I4BA 4RX6A 4RNHA 3PW0A 3VTIA 5D0HA 2BE2B 4K0KF 5HLFB 3CJ4A 1TKXA 1PILA 3DLBA 1Z2LA 2I5JA 1TK8A 3AA9A 5A0YB 4CM2A 4Z7YA 4EWTA 2HHTA 4ZP7A 3QSYB 4Z2XA 1S72S 4USWA 5LSLA 3F41A 1T03B 5HROB 4I7FB 3M8PB 5DM6Q 2YTCA 4OI6A 2QE5A 2PMWA 1J5EF 4CI0B 1IJEB 2YNGB 2BDPA 2GHPA 3TRGA 3IO1A 3MWBA 1VCTA 5E7OB 4AUKA 3CDWA 3E8OA 4J9QA 4FDFA 3ENAA 2YX7A 5D4PA 1SVDA 3HD1A 1H98A 2GX8A 4G1QA 3GLJA 3FUYA 1JB0C 3QBCA 2OD6A 4UF4A 1RP5A 1JLQB 7AT1B 5L8RC 4PXCA 2CQ4A 1BMQB 1N36F 2HNZA 2LDIA 4H4KA 5D0GA 3DLJA 3KJVB 1H7WA 2W9BB 3R1LA 3H2LA 1G7CB 1VC5A 3TQ1A 1MROB 4WFBQ 1FRLA 3BGUA 2V2QA 5I3QA 1B7YB 3ADAC 2ZVIA 1JIHA 3OTOF 3NMRA 2Y1JA 1S0MA 3W9HA 3DI6A 4G6VB 2F9DA 3QGHA 1OIAA 4W98A 1MMDA 4NLOA 3R97A 2R7RA 1MWQA 4OYIA 3HKWA 3KMSA 1TKTB 5L9XA 3Q8RB 3BBCA 1R0AA 2W2MP 3OL9A 2OMLA 1OWXA 1IBLF 1UVIA 4M5LA 1DARA 2NCKL 1B3TA 3PIPQ 1TR0A 3OFEA 3L95X 2FZGB 2XCAA 3MMAB 1WSVA 2KT2A 2EBGA 3AH6A 2Z0GA 4YB6A 1MN7A 1RI7A 3BYPA 1LXNA 1ACMB 2DHGA 2HRYA 2VQEF 4J9LA 2BJEA 3BBBA 3O3LA 2XYPB 1CJTA 1B0VA 2CJYB 1Y3KA 5ETNA 1ITPA 2B9EA 5ADZA 3CCSS 4CYUA 3A3OB 1ZH5A 2F9JA 2ASLA 2KZZA 1G6BA 4Y00A 4E0DA 5C42B 5KFDA 2JVOA 3MEDA 3UCUP 2DR9A 2HVZA 1PC4A 3OLAA 1WF2A 3PJWA 4IR9A 4X62F 5D6GA 2NPIA 2RF2B 1HNXF 2DCLA 5KTQA 2BQUA 1RJJA 1FT8A 4DI6A 5KFBA 3VAFA 4IFYA 1T05A 1CPZA 4FYWB 2FUG9 4DV6F 2X3GA 1HWIA 2FD2A 5GMDA 2GO8A 5J1NA 4RW9B 4ZVGA 1RTHA 2YWHA 3OSNA 2LVWA 4AXJA 2E5GA 1BWEA 4KKOB 2NSCA 2W4PA 5GAGI 1C1CA 2GMLA 4ERDA 3B54A 4R25A 5T7LB 3PYGA 3EGZA 1FJEB 1QD1A 4A8QA 2H5IB 2GQCA 5D15A 1YQHA 2ZH8A 2WBRA 2P9EA 3UO0A 5KT7A 2AEJA 1H72C 2ZHAA 4KT0C 2WVFA 1V6HA 2R42A 2Z2LA 3MMCA 4TNOA 5EDWA 1R3NA 1C0UB 3M8YA 2G13A 1TKDA 2VG7B 2OPQB 2XYGB 2FVRA 4DR6J 1JQGA 5KFKA 5U47A 4RBUA 3FRZA 1TAQA 1FWLA 4CLTA 2ACMA 5M2UA 1UWBB 4LUBA 3QRPA 2EPIA 2R7XA 4ZVFA 4Q0BB 2YX1A 1BE4A 2ROGA 5J1EA 5ETLA 2CPIA 2KB2A 3H42A 4M95A 4YFUA 2YNFB 2RH3A 4PZVA 1F1BB 2KL8A 4FVCA 4KR0B 3KLFB 4ID8A 2EK6A 4A47A 5C2CA 3G6VA 4USKA 3UN5A 2XNRA 3OPKA 1DY3A 2W2OP 2IAJA 1VK3A 1K1SA 4USUA 1FE0A 2ZUGA 3KOAA 5GMKa 1SH2A 3M32A 2GAGC 2V0NA 1IR0A 1T9WA 4LIWA 2PDAA 3QZ7A 3MMJA 3KDNA 2XHWA 5FDLA 1XNQF 2JNJA 3P4UB 3QJLA 2LEBA 5HQMA 3KK3A 1UMJA 4BWJA 2OPRA 2UUBJ 2UVWA 2KYXA 4QIWD 1HBNB 3AOBA 4DN9A 5GAHU 1WHWA 2F7VA 3M1VA 4USMA 1HQUB 4DLEA 1BHNA 2JEIA 4OYZA 2H4WB 4N56A 3Q2TC 1T11A 3BSAA 1S1WA 2CG8A 1XMQJ 3GSIA 4ZN3A 5CZXA 4PG4A 3T1YJ 2EFPA 2FVCA 1JMTA 2FLLA 2B7BB 2J8AA 4ALZA 2DO4A 4ECRA 2IVYA 2AX0A 2CPXA 3MEGB 3Q8SB 4WFNQ 1HBMA 4I2PA 3VAIA 4LF7J 5B08A 2HNDB 3NOCA 1GAOA 3PXGa 4K59A 5KG7A 3FSYA 1H74A 2DTJA 3X1LB 4YP3A 1ELOA 4DFMA 1HMVB 3R9LA 5IM0A 1L5UA 1S6UA 2PA8D 3BSNA 1IBCB 1WOOA 1KEKA 1MNEA 2OEMA 3SSRA 3PR4A 4NPOA 1TFYA 1GMWD 2JFKA 5EWFA 1NDPA 2XBPA 2H4YB 2AEMA 1HBUB 3KJFB 4NLGA 3VQSA 1I94J 1FCAA 1CS4A 4X4VA 1U49A 4NLPA 1HHSA 5KFHA 4Y28C 3ILLA 1VLOA 5DRKA 4OL8A 3NS5A 2EC2A 1SV5B 2XI3A 4X4QA 1JX4A 4X4TA 3CDBA 1UVLA 1NHVA 2V8GA 3KK2B 1RT7B 2FLOA 2CNOB 3CJTA 3KXDA 5D3GA 4ER8A 3S7RA 4PAAA 1IKYB 3GCXP 1KBRA 3MF5A 4WE1A 1S57A 3W9JA 1S7IA 2LECA 2DNOA 3DGVA 3W64A 2UXBF 2WONA 1S6OA 1YKWA 2RS2A 4NEZA 5L9NA 1X4CA 2FY8A 3QRQA 1NJZA 4NZ6A 2BBEA 1RWNB 1X5PA 4FZVA 5IQQA 2A10A 3NLCA 5CXTA 4RPFA 2JRSA 2MZQA 1JJHA 1K73T 5CYQB 4HKQA 1VQLS 1FE4A 3RB0A 4LFAF 2WCXA 2DNGA 2QEXS 3MCOA 1LK5A 4EI2A 2CFXA 2HFUA 4B3MJ 1OY6A 2RD5C 4CT8A 1N5YB 9RUBA 1JLGB 2ZD1B 1CJKB 3HVWA 1P27B 1XR5A 3CJ0A 3A8KA 3MR2A 2EXUA 1V5VA 3QIPB 1EETA 3PX4A 2E1MC 4C8MA 1T03A 5HROA 4I7FA 3M8PA 4OX9J 4M5JA 1QSLA 1D9AA 3DLKA 5HATA 3VALA 1CJUB 4WYLA 3CCWA 2DY1A 2CJQA 1FNOA 4P72A 2YNGA 3IAS9 1HWJA 2CQBA 2LFVA 3IFEA 3UE2A 3G9CA 1UKUA 3FNNA 1ZM3A 2LLZA 4H4MA 2WAQD 1N0UA 1VRUB 4KH0B 4LSNB 4Q7AA 2RS8A 1SKSA 1K0VA 1RTJB 4RU9A 1KHWA 4ED3A 1JLQA 1K47A 3WQPA 2XTJP 1S1XB 1DTQA 3CDEA 4WYWA 1R27B 2E5IA 3RW6A 4PWDB 3N5BA 1NDLA 4ICLA 3G82B 1U0HB 1V5IB 2M52A 4UTGA 1DAXA 4BCAA 5GAGU 1YJ7A 2MTLA 4DR1J 2NXEA 2MQPA 1X5OA 3R2CJ 1VDHA 3J7YU 2E29A 2XSJB 1RTIA 2QYCA 1RLCL 2XULA 1U1RA 1SL0A 2YQ3A 3TQEA 3OTBA 4DXLA 4JI2J 1PAUB 4USVA 2XC9A 5E3CA 5KG4A 3MZIA 1F9FA 4HHJA 3V81A 1UJ4A 4QU7A 2DGOA 4LFBF 2BUNA 3DLHA 2GVZB 2ZC3A 3P8BB 2CQ0A 5BJRA 2G1DA 4E2FB 3NMAA 5DLFA 4QWCA 2WSCC 3I6PA 1D0EA 1HL6A 1ICEB 4RW6B 3QJJA 1U26A 4DFPA 1U1OA 3UCZP 2C2NA 2ILZA 5IXUA 1QDUB 2QMUB 1WELA 2RQCA 1YJVA 5D0EA 3E2EA 4F4AA 3KMQA 1LW0B 1RAAB 5E3QA 1H7XA 2ZJPQ 3CJQA 1FERA 4Y2MA 3GV7B 2CNNB 2RDIA 2ZE2B 3IWNC 1EP4A 5H9EK 2GVDA 2OP5A 2VPXB 4PQUA 2QIFA 3A3NB 1PJ7A 1OPIA 2N4DA 1BD6A 4A46A 4F0KA 1J5OB 5D4LA 2U1AA 4DDFA 2ZNYA 5CCLA 2RF2A 1I51B 3J81Y 5A2QU 4C2MA 2UUCF 1SKUB 1QJHA 3D54A 1T9YA 2Z58B 4B9VA 2NR0A 1M1KT 1LK7A 3JQMA 2MGZB 3UN3A 3P3DA 4IRKA 1SL2A 2H51B 3PYEA 3ZZOA 4ECVA 1HNWF 1NCLA 2HFSA 4X2BA 3M8RA 4NASA 2GHVC 3W5YA 3VVTA 3W8GA 3C66A 4JV2A 5T7LA 5GADU 3BH6B 1T94A 4DPWA 2VG5B 3SCLE 3NG8A 3ZC4A 3NGTA 3GYXB 4C4WA 3CDAA 1NB7A 2OIHA 2LQ5A 1FEEA 3RAMA 1GXTA 4LF9F 5T41A 1GFWB 3RR8A 4RW4B 2OEJA 4RWWA 3C6UB 2KZMA 2MPUA 3GMGA 3QO9B 4AL5A 2LP4A 2E5LJ 1JLAA 2I8EA 5JJBA 4CO5A 1N0VC 2J8SA 1LWEB 3LP1B 3H8YA 4M5IA 1RWPB 1E6YA 2HQFA 3VGUA 4X64F 5KFQA 4IQXA 1IBKF 4ZPDA 4PRFA 2HZCA 2WW4A 2KFYA 4QYZJ 2QZ8A 2JC1A 1UWBA 1H38A 1VIXA 1G3OA 3UDVA 4ECQA 4Q0BA 3H4DA 2FJWA 4ZIWA 3HHDA 3SFGA 4OX6A 3UN2A 4OV6A 4N8OA 2HWTA 3W1YC 2GQ2A 4IO1A 4NCGB 1RWXB 1U6ZA 4O3QA 5KG3A 1RTZA 2DXFA 1UVNA 3K59A 1UA0A 2D9OA 2B4OA 3M8WA 3HVRA 4P2FA 1NNDA 4Y6IA 2ZHOA 3Q24A 1H73A 1V3SA 4AFFA 2WK4A 3PV8A 2VKRA 4LSLB 4PXEA 2C3OA 1H0HB 3PR5B 1XEZA 5DGBA 2XY7A 1TL7B 4EU0A 3M4XA 1JLBA 1RZMA 3DM2B 3PM9A 2Y1IA 1R8AA 3HVTB 3GTYX 1JLCB 1UTAA 4K5SA 1HNZJ 1PBUA 4FYDA 1HQUA 3AJDA 1U02A 5E2QA 1R7IA 2HHWA 5IWAF 2DNHA 1IVZA 3R5BA 1PBAA 2E9RX 2M3DA 3T6JA 1F9EB 4OLOA 2FB0A 4ZP9A 2V5HG 2PI5A 3I9V9 4WTOB 1TK0A 4DSEA 5E33A 3MPDA 4Y3CA 2N82B 4FBTA 2BJ9A 4A8FA 2GC8A 4NLUA 1AFIA 4J9KA 4DX6A 3ISZA 2RHQB 3K8WA 3DGPA 3MEGA 2AQ4A 1RYSA 3NEKA 1RISA 4GKJJ 4W4MA 2HNDA 3LH2S 3R2DJ 4YY3J 4KY3A 4DL7A 1XN9A 2WRMA 2NLWA 3TA0A 4C48A 2R7TA 3AOCA 1VR6A 4IDKB 4DR4J 4TLQA 5FLXY 1RT3B 3AD7C 1FKOA 1UPMB 1CC8A 3TA1A 1YJWS 4PUOB 2BKPA 3EMTA 2AWZA 4HACA 4WK1A 4DR7J 3IWLA 3ZZYA 3I82A 5KOXA 1RU2A 3MHYA 3W60A 4J9PA 4YN3B 3C16A 3FEYB 2FJEB 4YB5A 4A48A 5A8WB 2ZOGA 3T6BA 4JI1J 3C2PA 5LXYA 1FRHA 3Q0AA 1KNZA 3I31A 3OUYB 4CLZA 1SV5A 3AD8C 1QUPA 4UZCA 1GQEA 4ATNA 2DR5A 5KFCA 1S0NA 1ZPVA 3MOJB 4DSFA 1F60B 3KJNB 3NOGA 3KK2A 1RT7A 2WVEA 4YS2A 2V6AA 2HBQB 2MQ8A 5DLGA 5F9LA 4JI4F 4RKUC 1FNXH 1IKYA 5ETRA 1VRQC 3J7AN 1M5HA 2HS3A 3M05A 2V4RA 1X9MA 1R8PA 4DUZJ 5JMNA 1KHVA 2DKOB 1HI8A 2HFZA 4F26A 2ALZA 3TAMB 4ECZA 3MEKA 2VONA 4B3TF 1HYSB 4QCLA 1L3TA 3BGRA 4LFCF 4AD6A 3CT9A 4Z37A 5HQ8A 2B0GA 1NHUA 1JKHA 1F6TA 3JSYA 5CYQA 4M94A 2C28A 1IQTA 3DRXA 2VQFJ 3AA8A 4OI0A 3KLEA 2IRYA 4OJGA 4MIWA 1SC4B 3J80Y 5DDPC 4JYAJ 4Q44A 1LW2B 4JI6J 3W2WB 3GYGA 3BDPA 4LF6F 3BREA 2CQDA 2G2OA 2AJ0A 3GFYA 4NA1A 4R0EA 1ZBTA 2WBMA 4C9DA 3VR1A 1IWAA 2EFVA 3HPOA 1NBEB 5D4NA 2N7CA 2R7QA 2I9SA 1H6KX 1XWLA 1M1GA 3TAQA 1VGYA 5CABA 2G0IA 4I6AA 2ALYB 2WW8A 4LSNA 3ET6B 1YHQS 1U1LA 2LA6A 1RTJA 3D68A 1HBOB 5KFAA 2KRRA 3D7SB 3G86A 4J9UE 1X0FA 1YWXA 4KH1B 3W65A 2EK1A 4KV8A 3G71S 1S1XA 4F3OA 5JXSA 4MKVA 3TI0A 2XY6A 1K9MT 2IM1A 1MMLA 3G82A 2DR7A 1V3RA 1U0HA 5AXNA 2CJAA 3EDRB 1VBXA 4B9NA 2CDRB 2E9ZA 3IC1A 1ZA2B 5I4MA 1NKCA 2KH9A 3NGSA 1SH0A 5CH7B 3HF5A 2VFUA 3H98A 2QMXA 3BSOA 3GIIA 1TV6B 3TARA 1SL1A 2HGNA 1Q1KA 3A8EA 3DMJA 4DSLA 2KG1A 2ZH1A 2QC3A 2EFQA 3LANA 4UZBA 2WB1D 1P9YA 4HI2A 3ZTRA 5IFMA 4J91A 4LBIA 1U6BA 2P8IA 3OTDA 2CQCA 4X4RA 1E6VB 2YH0A 4H4KC 1Q4RA 1MN9A 4U7UK 4NLRA 1X9WA 4EBCA 3B4MA 2J9DE 3I4PA 4RW6A 2P6SA 1EQMA 2FVQA 2LKZA 2OAUA 1HQEA 2DNPA 2XMVA 2B8PA 1M1HA 3GG0A 5EN1A 5LJ5Y 2XGQA 3SCIE 4KAIA 3HLUA 1F0XA 4X66F 1AT1B 4CWBA 3FJ2A 2ZOFA 2XQCA 3PKYA 4ZN1A 4YMEA 4N7TA 2Z2MA 4A8KA 1Y4ZB 5CQGA 1JJCB 1RYRA 1RT6B 3G2XA 1JXEA 3HCXA 4ANDA 1TTHB 2CZVC 2RNEA 1PYSB 3E3XA 2OPSB 4O4RA 4F7VA 3MM9B 4JV5J 2CPJA 4ES3A 2GGPB 4Y2IA 3GZ7A 4ETXA 1VQNS 1XMOJ 4ZKAA 4P74A 4YHHJ 4DV0J 2HHQA 4ZVRB 4TKTA 1GT8A 5D0RA 1S10A 2DEJA 1ZETA 4XPEA 4JI8F 5KAKA 4F25A 4MKBA 3SSSA 2YNIB 1TZ0A 2XLIA 3MEEA 4GO5X 4K4TA 2RQ4A 4WFAQ 4M63A 5LMUF 4NX9A 5SZTA 2MLXA 2HNYB 2NYHA 3CJ5A 3OT9A 3C6TB 3RG6A 3PCOB 1BLUA 3NCPA 3SQGA 5KFGA 4LQ9A 1CJVA 3QWUA 1NJWA 4RW4A 3L9ZA 1D8YA 5IV4A 4OIXA 2UVUA 2ZKUA 3FSIA 1S1TA 2WOMB 2XCPA 3IG1A 1OMSA 2IYGA 2MYFA 1RE1B 4YB7A 5K8OA 4KGMA 2W01A 3LP1A 3ZTQA 3AB2B 2CWKA 2MKSA 3HXMA 4ECUA 3H2VE 4K7QA 4FKYA 3I9ZA 2H5JB 2W2NP 3PYFA 4DPTA 4A4JA 3MOZA 4RW8B 3W2VB 2BJDA 4RR5A 1VBZA 3HFVA 1NM2A 4NLVA 2DNNA 2ATLA 4YB1P 5K14A 3IGNA 3CVKA 1AW0A 3FZ2A 3OTEA 2OI2A 1SQGA 4DQQA 1FO1A 4LF8J 1X0PA 2BZ2A 1N32F 2BKOA 2KT3A 4LREA 5J2QA 4HHUA 5J1PA 1SC3B 2IA6A 4NCGA 1IBMF 3EZ5A 4AYBD 3G6YA 2D3OR 1N4LA 4X4SA 1N54B 5KFZA 2R8IA 2EKNA 3S1TA 5E3AA 4B3RF 1PKUA 1X31C 4HLBA 1OY9A 4I56A 2PMHA 1NK0A 4J9OA 2YH1A 3MM5A 4MTPA 1TKZB 1KC8T 1IN0A 2YNHB 3CWJA 1RB0A 3PFEA 3SV3A 4CO1A 3TEHB 2M4MA 3IRXA 3JYTA 5KT5A 3BR8A 1TL7A 2CPEA 1HNIB 3C15B 1S5ZA 2XYHB 3HVAA 4M5DA 1PG5B 3J81U 4GC6A 4FPIA 2HVDA 4DV5J 3FZBA 5K9FA 2XWXA 1FTRA 4A8OA 2F8HA 2ASJA 2NXUA 3D0HE 3GB0A 4OQJA 4DR2J 3N5FA 3H5SA 4O23A 3H5YA 3BPDA 2W8KA 3EGWB 1IR1A 4PG8A 4GVLA 3B82A 3UD4P 4TYBA 1Y11A 4HHHA 4MAKA 5HK4A 3GFZA 1NSAA 1ZPWX 4K0KJ 3Q23A 4LJMA 3OFHA 4ANCA 2C2ZB 1SJ3P 2X1AA 2DPIA 2BACA 4MYUA 1KVKA 3P5TL 3JTOA 1GMVA 2QV6A 3D9BA 3THTA 1AUSL 2OEKA 4P73A 4PG6A 1S1VB 1J27A 1J5EJ 2AEFA 2ZFHA 3QJPA 3BZQA 3C46A 4ZPTR 3VAJA 3SI8A 2PFFB 1TL1B 3RB3A 4LBPA 2BW7A 2C2DA 4ZHRA 2LXIA 2OKQA 3TJ8A 1T3NA 1EKSA 2QSWA 4OV1A 2DNLA 1Q79A 2J9CA 2CQPA 4BBYA 2VFRA 4CH1A 2LMIA 2LQ8A 3CMAS 1U0SA 4PR6A 4R5PB 4F36A 5A8WA 3DHXA 1IQZA 1N36J 4DCJB 4K8RA 3OR1A 2ADCA 5ETSA 5CD4H 1S49A 1RA6A 3M2UB 3RZAA 3UVJB 4NYZA 3TNVA 3OUYA 4J5OA 1JNZB 2IC3B 1PYOB 2O3DA 2UXDJ 3LP0B 2AJ2A 2VJUA 3OTOJ 1OJ4A 2DO0A 3VQTA 3HHEA 2ASDA 2NS1B 4R8UB 3D6HB 3QSIA 3UR3C 1RACB 4RL1A 1HHTP 3TAMA 2DGSA 2UV8G 1YVFA 3ILJA 1TKXB 4MT1A 1W2BR 4ECWA 2L9WA 5B0AA 2ZBIA 1TVRB 1TMJA 1N56A 1SJ4P 3TVYA 4OYOA 1VRTB 4I67A 4MJKA 4WU2A 3UW1A 2Q66A 3GR1A 5HJXA 3OTCA 2GIFA 4WK3A 1EARA 1Q8KA 1Q8IA 1TK5A 1SC6A 4U67Q 4ZJOA 2HHPA 4WCEQ 4CO3A 4CO2A 2IJNA 2QLJB 3O2IA 4N47A 4QPTA 1S6QA 1SI9A 1RHJB 3MCNA 4KB7A 5DGAA 1Y10A 2PEBA 2V4JA 3O6QA 3W5XA 3VCDA 2HNZB 2ZH4A 3ET6A 1U2RA 4CQ1A 3U1NA 1HNXJ 2CUYA 1WC0A 1KS2A 3TA2A 1VISA 2G0CA 1CBKA 1HBOA 5DJBA 2PT0A 3R5GA 1U1NA 1RCOB 3HSGA 1IKVB 4JOUA 2CPYA 4B9MA 5ETVA 3DI6B 4DV6J 1AZSA 2ZVSA 4B17A 1T9VA 4ZJLA 3H2UB 2JHEA 2R2SA 4BC9A 1KVIA 3GIMA 2DGWA 2E5HA 3JAMU 1FD2A 4FF3A 3IXQA 2YWWA 4DU7A 1TV6A 1REGX 2X1BA 4O4GB 2XZWA 5C7PA 3K17A 2FHMA 3QT7A 2K7JA 4JUZA 5F8HA 1N33F 3FDSA 1GH8A 4MKAA 3MUTP 2QL9B 3D6FB 4QWAA 1ZTTA 3DRSA 1E6VA 3NNHA 1NHKL 3CPWR 3EGNA 3GJTB 1RBOB 1CJTB 1O0PA 4QWBA 4J9VA 1HW9A 3CNQP 2D74B 2E7VA 2RILA 2XWYA 3D3BJ 5D77A 5C25A 4WTYA 3NWRA 1RBAA 3TO8A 4ZCKA 2KJWA 5A8RA 1O6XA 4JV0A 3CUNA 2HVEA 5CHCB 1TL3A 1YRTA 1AYEA 2OO4A 3MEDB 3OL6A 1UVKA 2Y3YA 4HI1A 1U2FA 1Y5NB 2HQGA 2XMKA 3TUIC 2LA4A 5B09A 2O01C 4ZVEA 1BQNA 4XDDA 4ILRA 3ZXWA 4QJVA 3I5BA 5DDRC 1W2IA 1Y5LB 3FRYA 2UVRA 1RT6A 4C98A 3P45B 3MAHA 2AD9A 1SKRA 2YQ0A 2OPSA 1WHVA 2RE1A 4IFYB 1T05B 3C19A 2YKPA 2WZ1A 1FRKA 1XTZA 3VZIA 1XK8A 2FJDB 5DDOC 4DX5A 1RTHB 1T7PA 4TU9A 4ED6A 2CA9A 2FHOB 1C1CB 3JSMA 4ZITA 2CKWA 2WHOA 2R7WA 1Y0HA 1H2VZ 1X7VA 4F3MA 2YNIA 1Q5YA 4HTIA 4BHQA 1O5JA 4KGVB 1XNQJ 4K4ZA 2VJVA 2O5DA 4F50A 2VC1A 4K2JA 2DHAA 4FNHA 1Y3JA 1VHIA 5HI7A 3FMWA 1VQYA 4USIA 1IKXB 5KFMA 2E1AA 2I0XA 2HS4A 2D1CA 5F41A 3OBIA 3V6HA 4Q8FA 3MMCB 4K4YA 1HFEL 2BVZA 3C6TA 2UUBF 3T5JA 4MK9A 3PY8A 2NXJA 2HYIB 3PZPA 3KWMA 2B43A 1T8EA 4A8MP 1RHQB 2D3ZA 4LBHA 2G2ZA 3CCQS 4IOAQ 4YQWA 5KFWA 2QX0A 3HHLC 1YBAA 2WOMA 5HVGA 4HTJA 3I96A 2P9CA 3PJXA 3NRBA 1WI6A 4FKXA 3OL8A 4CT9A 2COLA 1XMQF 2C3UA 4HDHA 3EUNA 1WDDA 2MHNA 1P1LA 3I0SB 3VHQA 3HZGA 2CPFA 5KT4A 2H9ZA 3GCWP 4DCOB 3CXCR 1RWMB 4KIAA 4OZ2A 1FF2A 2VDIA 1S9GB 4RW8A 3RRKA 4KYZA 4USJC 4CZCA 3BQ1A 2XS5A 2F8EX 3TZXA 2HMIA 4OZNA 1A7GE 1NDKA 3N9UC 2IAJB 5A8KA 2DNQA 7FDRA 3E01B 1NJIT 4DV4F 3TOQA 3PNIA 3MURP 3ZO7A 3KJQB 2OUGA 5AT1B 3H25A 5FDLB 3IM9A 4CO4A 1FX4A 2VKZG 3MGJA 4DZDA 3KK3B 2DEIA 2OPRB 1I94F 5M2RA 3PKMA 3G87A 3F73A 3ETOA 2BABA 3M1VB 3ISNC 4TLRA 4F4XA 5EWEA 4FYYB 1HNIA 4Y34A 4ECSA 4JBCA 3C15A 3SV4A 4EK2A 1VFJA 2DXEA 3KDOA 4I2QA 5HJYA 3US5A 1QAIA 1N5VA 4NYOA 1EQ0A 1S1WB 1BC6A 2ZBCA 2QMWA 2UXBJ 3GIRA 1KP6A 1GNKA 1RT2A 2FTRA 2YX4A 3L7PA 1HA1A 3TUZC 4DV2F 3JSBA 2BKNA 1U1PA 4RUBA 4LFAJ 4NEYA 4ID5B 4YDDB 2CZ9A 1C0TA 2F3JA 3RTVA 3HDSA 2HLTA 3QATA 3IBWA 4ZMMA 1NPPA 4B3MF 4ES2A 5IM0B 4UY8T 3N6NA 1H2UX 2FVSA 2VU5A 3FGVA 3KFWX 4OJ1A 3IGVA 2J76E 3M8ZA 4QBUA 3O1LA 4C3MA 1ZOTA 4CM0A 5HMXA 4M5GA 2UXCF 4D3HA 1TL1A 3CCMS 3SCJE 1CS4B 1WF0A 3S01A 2PN6A 3KTQA 3R7SB 3Q8VA 4P7VA 2RKIB 2APOA 1SBRA 5AXLA 4DV1F 1X4HA 3BGOP 3QFWA 3OFGA 3M2UA 4J90A 4WE1B 4ZPCA 2V69A 1PJ5A 1K1QA 5LL6d 4ZCIA 3G8TA 3M2RB 2WONB 3JTNA 4M5KA 1QSYA 1FEHA 3DLLQ 3SQOP 4CLLA 4F04B 3W63A 5IT9Y 2JH3A 3K89A 4PYDA 5THWA 3UNYA 5BXIA 1HWUA 2DPJA 3ZZTA 1HPZB 3BYRA 5HAOA 3ZZUA 1PC5A 4ZOSA 1IM6A 3OQ2A 3QRRA 2B8QA 4JI2F 3LPEA 4LFBJ 1HWLA 1TVRA 1EETB 3S6EA 5G0RB 2VPWB 1VRTA 3GFXA 4W92B 1RAIB 4QWEA 1REVA 3LW5C 2P5VA 4O44A 3DLKB 2YXLA 2V2ZA 2DGXA 3TZWA 2C3YA 3DRRB 2YKAA 2C2OB 4GVBA 1NK7A 3MCMA 5KFIA 4N41A 5F9NA 1X4EA 4OI4A 2B5JA 3UDLA 4H4MB 1DTTA 2MKYA 2QO3A 5C5JA 3DOKB 1KLMB 3MD3A 2K3KA 2IMWP 4I1TA 5K8PA 4B9UA 3ZTPA 2QA4S 2AZ3A 2W7AA 2PSZA 1XQIA 2ZM6F 2FZKB 3PIOQ 1DTQB 2BANB 5DQHA 3EE3A 2AZ1A 4HDGA 2QFIA 1KD1T 2DRDA 4ICLB 1V3ZA 4FPRA 4I64A 1IKVA 3I0RA 3M30B 4XTTA 4Y2CA 1RTIB 3D6MB 1HNWJ 4ED1A 5KFNA 2E1CA 5M2PA 1NMEB 1ZS6A 2HURA 1GXLA 4OJ3A 2DGVA 3HK2A 1R8HA 4U8VA 3QT6A 2CQ2A 1YG0A 2CJXB 3V81B 2Y0SD 3L09A 4CNYA 2Y8WA 3B8HA 3PG9A 4RBVA 4O4GA 3EVWA 3EVMA 2KKHA 2B51A 5IQ6A 5GAEI 3EX7B 2KYZA 1AXQA 5HP1A 5KFJA 5B0EA 2ASYA 4LF9J 3EPIA 3R1HA 3CC7S 5K8NA 3AXKA 4F4YA 2R3VA 4B08A 3T9NA 4DL6A 2ZBPA 3MD1A 3DNCA 3V6JA 2O66A 4PG5A 2KTQA 4U96A 3LP2B 3FSXA 1M5OC 4IR1A 1KR4A 2CDQA 3DLEB 2CAJA 1VQ9S 2MQMA 4X64J 2CWXA 1IBKJ 2QG9B 2C22A 5CYMA 1LFPA 1EP4B 1XC9A 2IA0A 3VGTA 2NPFA 2GVDB 2GS8A 2MHEA 2GCFA 5KFEA 3H40A 2HG4A 4PQUB 2NUUG 1YZ7A 4WFXA 4ED2A 1KOHA 3IRWP 1VC0A 1FKAF 4C0HA 3G96A 5KFYA 3O44A 2R2TA 3BKTA 4D3GA 2PMZD 4ZLLA 1X4AA 2O67A 5DDQC 2RU3A 3HHLB 3OSPA 1D09B 1S1UA 2C3PA 1GX5A 2KVIA 3CCVS 2M0GB 2VPZB 2VFTA 2VFVA 3C3LA 4DLGA 2FPHX 2QJ3A 4X4UA 4NLXA 4P71A 4DR5F 1D8ZA
chains in the Genus database with same CATH topology
1FRMA 4OJGA 1WTFA 3CO9A 4MIWA 2FC9A 4NWBA 5L39A 1LW2B 2E7XA 5DDPC 5EWGA 4Q44A 2R2UA 5D8HB 3MMAA 3W2WB 2W7PA 4Y2AA 3BDPA 2DJWA 5KOWA 3OXFA 3MM8B 4LF6F 3KNAA 2XG8A 2D9PA 5JVHQ 4DV7F 3BREA 3CTRA 2HS0A 2JZ5A 3QLHB 3GIJA 4TY9A 2AJ4A 4I0WA 4DG1B 3IS9B 4IH5A 1FHTA 2CQDA 4C8YA 2ZH3A 4PXDA 2AJ0A 1N8RT 1L3UA 2OTJS 3CMES 4DF4A 1TKZA 3DN9A 3GILA 3KLHB 2H5EA 2MY7A 2YNHA 3BM7A 3GFYA 4NA1A 2CJBA 4MH8A 4R0EA 1ZBTA 3I5AA 4RNMA 2WBMA 4Y2KA 5B0DA 2M88A 4UOCA 3LWLA 4C9DA 4EFAC 1IKXA 3VR1A 3PDNA 4Q8EA 1F5CA 1UAWA 1P1TA 1QE1A 4KPYA 1YTYA 2FJVA 3V4IA 2WB4A 1OS5A 4WFZA 2EFVA 3DXBA 3CIMA 3QGPA 3HPOA 3OJSA 3VAGA 2HGLA 1R31A 2DITA 5D4NA 3SMZA 2KG0A 2XS2A 2HLUA 2R7QA 2I9SA 2N7CA 4DL0C 3AAWB 1H6KX 4OX7A 1XWLA 2EBEA 4IQMA 4OZJA 3KK1A 3TAQA 1TAUA 1JLAB 1VGYA 5C24B 1KQKA 3OV7A 4I6AA 3VF0B 3UQSA 2WW8A 4LSNA 3PEJA 3K2YA 4K2XA 2HWHA 3N79A 4FF1A 2L48A 3JSRA 2YKOA 1YHQS 1U1LA 5F0WA 5LSRA 2X51A 2JDJA 2LA6A 1E6YB 2UUWA 5C42A 1RTJA 4EBDA 2ADBA 3OHBA 5H9FJ 1HBOB 3NWGA 3QAEA 2K2PA 1Q8BA 2M5YA 2KRRA 1B0PA 3G86A 1KQFB 1X0FA 2QA1A 1YWXA 1I1GA 2BYCA 3UNGC 2Q6CA 4N5SA 3SCKE 2EK1A 4AE5A 1QVFR 3KG1A 4KV8A 3G71S 3UWTA 1S1XA 5SUHA 4E8UA 5D78A 4F3OA 2LXFA 2C2EA 5JXSA 4I6YA 2W9CA 4ZK7M 2LQBA 2CZ4A 1YIJS 4F2SA 3TI0A 2XY6A 2ZH7A 1RKJA 1K9MT 3W3SA 5BYSA 3NAIA 3RAQA 2GIQA 2A2DA 2IM1A 3I0SA 1MMLA 2GMHA 2G4BA 3H5XA 2DR7A 1V3RA 5AXNA 1HBMB 4I2PB 3LF0A 2CJAA 1SXLA 2CYYA 2WTFA 5K5MA 1VBXA 2N3OA 4B9NA 2E9ZA 2E9TA 1D9DA 4YR0A 2V9KA 1UVMA 3IC1A 1WG5A 1U4BA 1WEZA 1YSJA 1DLOB 5I4MA 3TVZA 2BW2A 4XO0A 3P6YC 1NKCA 2VH7A 1OSCA 1S9GA 4XDCA 4DQRA 1FXDA 1KFDA 2UV8A 1OO0B 2KH9A 1Q86T 3RRGA 3NKYA 1SH0A 2RQKA 5CH7B 3D5MA 3HF5A 5KT2A 2VFUA 2DR8A 3H98A 4ZDNA 3DCAA 1YITS 4NXNF 4RW9A 1C4CA 4ELVA 4IFVB 5KFLA 2QMXA 3BSOA 3GIIA 1TV6B 4RLEA 3TARA 4YR3A 5EX0A 1SL1A 2IVMA 1JK9B 1LWFA 3LUYA 4GKJF 3WC0A 1B64A 4ITSA 1LWCB 2MQQA 4KKOA 2HGNA 3NCRA 4FBUA 3K58A 4LF8F 1R8CA 1VQ6S 1Q1KA 2ROEA 3A8EA 3CE8A 4YY3F 4J9NA 3DRPA 3DMJA 2NUHA 3DYAB 2J0QD 3BS9A 3D1OA 4DSLA 2CVEA 2KG1A 1H3DA 1Y9OA 2OH2A 2ZH1A 2EFQA 5E3PA 4HYKA 3LANA 1K8AT 3OXGA 1O51A 2W24A 4LMZA 1S1VA 3E01A 2WB1D 2XMJA 3IN5A 1VI7A 4HI2A 4KE5A 3LPYA 4EYHB 2BRKA 2JSXA 1RT4A 5IFMA 1REVB 5EUHA 1WHXA 1ZAVA 1FKPA 5F8LA 1U6BA 5HMYA 4N77A 4FN5A 4O44B 1VK8A 3OTDA 5L1KA 2VOPA 2MQOA 2CQCA 1L3SA 4X4RA 3EXYA 1E6VB 3AB4B 3CD0A 3OR2A 4FNIA 1VIOA 4OZ5A 2Q43A 5G4DA 3AJ2A 2YH0A 4H4KC 1WI8A 1TL5A 1YJUA 4KBIA 4IRDA 5DG7A 5EHHA 4RNFA 2XMWA 3MXHP 1Q4RA 2MSTA 2F40A 1S9FA 2FJBB 4U7UK 1N52B 4RNOA 5DM7Q 1FD8A 5DQGA 3CCES 4DR7F 4NLRA 1F2GA 1X9WA 3G6XA 4UQGA 2P9GA 3W7BA 4EBCA 5F0UA 3GV5B 1N6QB 3BO4A 1RGVA 2J9DE 3B4MA 3KHGA 3I4PA 4RW6A 5ITHA 5KFRA 4DSJA 1UW4A 2P6SA 3O8WA 1JLBB 1C0UA 1MSWD 4K4WA 1PSDA 1WACA 2FVQA 5J2MB 3GYNA 2LKZA 3VAMA 2B5JB 1DTTB 3DU5A 4Y0FA 1N5SA 2UUTA 4J9MA 1RT5A 1HQEA 2ABYA 2DNPA 1P9QC 2DB1A 2OAUA 2XMVA 4R5PA 2BOPA 3GG0A 1QVGR 3OVBA 5EN1A 1UFLA 5T14A 2WSEC 1YJRA 5LJ5Y 2VG7A 1S4FA 2X1GA 3FVYA 1X4DA 3SCIE 2OPQA 4KAIA 2XGQA 2UP1A 3HLUA 1F0XA 4X66F 4MMOA 2AYEA 5L38A 4JI3F 2JX2A 3GG1A 3P96A 4IG0A 2J0WA 3FJ2A 5D3GB 3M9NB 1FDNA 2ZOFA 4DF8A 4RU2A 3POTA 5E3RA 3PKYA 4AL6A 3MUVP 4W90B 1SQEA 2HW3A 2ILYA 4WF9Q 1GX6A 2LYVA 4YMEA 1C1BB 2YKQA 2BV3A 2JC0A 2Z2MA 4A8KA 4NXMF 3BB5A 2YVSA 2HWIA 2IC3A 1HR0F 1Y4ZB 3TYTA 5CQGA 4XPCA 3CSKA 3LP0A 1WWHA 1XR6A 1RTDA 2KFNA 4NLQA 4ECTA 1RYRA 1Y00A 1RT6B 1VQMS 1JXEA 3PRBA 4DR2F 2W25A 1FDDA 3H20A 1SIZA 2CZVC 4UY85 2RNEA 4PKDB 3HHKA 4R8UA 2CRLA 3ULHA 3E3XA 2MZ1A 3I0RB 2OPSB 3NP5A 4O4RA 3THVA 4DUZF 3HT3A 3M9OB 2KFZA 3MM9B 4DEZA 2CPJA 4ES3A 3OLBA 2GGPB 4Y2IA 3GZ7A 4ETXA 1VQNS 5BYRA 4JI5F 3DLGA 1DFDA 1FESA 5KG6A 3PX6A 3KNGA 3I4HX 4I4BA 4QZVB 1R6YA 2YNFA 4DL2A 4ZKAA 3LGMA 3K5PA 4RX6A 5CCMA 2JFDA 3H4BA 2HHQA 4IRCA 3PHEA 4RNHA 3PW0A 5JUMA 3N4WA 4TKTA 1YI2S 3VTIA 5KG0A 2XSFA 2BE2B 4K0KF 1NO8A 5HLFB 1GT8A 4IKAA 2VBXA 4ID5A 1S10A 4V19J 3CJ4A 1TKXA 3KLFA 1ZETA 4F3QA 4XPEA 4JI8F 1PILA 3DLBA 5KAKA 3M6XA 1UA1A 2AYGA 3CCTA 2W7OA 1Z2LA 2I5JA 1TK8A 4I69A 1XR7A 4EUVA 3AA9A 2A3JA 4F25A 5A0YB 3QIDA 4MKBA 3SSSA 2YNIB 4EWTA 4ZP7A 1TZ0A 2HHTA 4EO6A 4Z2XA 1S72S 2PEHA 2CQIA 5LSLA 3F41A 2ZH6A 4JYAF 2XLIA 3MEEA 1T03B 4GO5X 5HROB 4K4TA 2RQ4A 3QWPA 4I7FB 3M8PB 4WFAQ 4M63A 5LMUF 3HX9A 1NU4A 5DM6Q 2R4FA 4NX9A 5SZTA 2KM8C 1X5SA 2YTCA 1FKOB 4OI6A 2J6TA 2QE5A 5CYJA 1J5EF 4CI0B 5HP1B 2HNYB 2L9DA 2XGPA 3MR6A 3CJ5A 1RT1A 1SUQB 1IJEB 3P49B 2YNGB 3SDEA 1S79A 2IRXA 3HP6A 2BDPA 2GHPA 1MWZA 1M0SA 3FEXB 3TRGA 3IO1A 4KHMA 3T1AA 3C6TB 1U25A 3MWBA 1WD6A 2F4VF 1BLUA 3NCPA 3SQGA 2ACYA 5E7OB 4AUKA 1NH7A 5KFGA 3CDWA 3E8OA 4LQ9A 1O8BA 4QQBA 1X9SA 4B9TA 2GIRA 3QWUA 2R8GA 3T5KA 1HBNA 4J9QA 1U45A 3X3UA 5A6WA 2YX7A 5D4PA 1WG4A 1NJWA 1H98A 4RW4A 4PPZA 1FJ7A 2GX8A 4G1QA 1Z1ZA 2B9YA 2KN4A 4OX8A 2BQ3A 1Q78A 1D8YA 2VBWA 5DETA 1WEXA 1JB0C 4KFBB 5LMNF 4OIXA 2HQIA 2OD6A 1QSSA 2UVUA 2CJKA 1RP5A 1JLQB 4BDPA 2ZKUA 1H2TZ 3FSIA 2EFNA 3J7Z5 2BR0A 1S0OA 5L1LA 2JEFA 1S1TA 5AXKA 2RKIA 2WOMB 2LQ9A 3BSCA 3DXSX 5L8RC 4QPXA 4HT7A 4WZMA 5CYMB 1M5SA 4PXCA 2XCPA 3E51A 2CQ4A 4ELTA 3IG1A 1N36F 2IYGA 2MYFA 2HNZA 2LXUA 4GKKF 2J7KA 4DR6F 2LDIA 4H4KA 1N48A 4YB7A 3RW7A 4ED0A 3DLJA 3KJVB 3CEDA 3SSQA 5K8OA 4FXVA 1H7WA 4KGMA 2W9BB 3D2WA 4TU8A 3R1LA 3LP1A 1SKWA 5FIIA 3H2LA 3T19A 1G7CB 3AB2B 1VC5A 3TQ1A 1MROB 2MKSA 4LIRA 3HXMA 3TX8A 4WFBQ 3T5LA 1FRLA 1U48A 1ROFA 1URNA 1K0TA 4ECUA 3BGUA 3H2VE 4NLTA 3PW2A 5I3QA 3I9ZA 1UVJA 1DURA 1BQXA 4MIAA 1JIHA 4ED8A 5H9EJ 3M2RA 1QUVA 3OTOF 4A4JA 3NMRA 2Y1JA 1S0MA 3MOZA 3DI6A 4RW8B 3W2VB 2UUAF 2BJDA 1VBZA 4G6VB 1IJFB 2AJQA 2F9DA 4NLVA 1VS3A 2DNNA 2ATLA 4YB1P 3QGHA 1OIAA 5K14A 1HI1A 1MMDA 3IGNA 4NLOA 2R7RA 3BGRB 2VOOA 3CVKA 1AW0A 2CQGA 4WZQA 3FZ2A 3HKWA 3KMSA 4JI7F 3OTEA 3QAUA 3F56A 4C8KA 4DQQA 1TKTB 1FO1A 4URQU 1S1UB 3VZHA 1JKHB 5L9XA 3Q8RB 1ZM9A 5GAEU 1R0AA 1X0PA 4KRWA 3OL9A 2M9KA 2OMLA 2ROPA 1A9NB 2BZ2A 1OWXA 1N32F 3HHLD 2KT3A 1HPZA 2FDNA 1IBLF 5B7WA 1UVIA 3KLVA 1DARA 2AF6A 3VWSA 5J2QA 5J1PA 2IA6A 4NRTA 3DU6A 3ZZ0A 4NCGA 1HMVA 1IBMF 3EZ5A 4AYBD 3PIPQ 1TR0A 3KLEB 4AL7A 2DCUB 3OFEA 3L95X 3T3FA 2XLKA 4B3OA 3G6YA 2XCAA 1FDAA 3GQCA 2D3OR 1N4LA 2MB0B 3R3TA 4NA3A 4DSIA 4X4SA 3MMAB 2MKIA 1N54B 2Q6BA 5KFZA 2DNZA 4PXBA 5LT5A 3CULA 2R8IA 3PVXA 2KT2A 3MPVA 3AHPA 3S1TA 5E3AA 4DL4A 2KJVA 1PO6A 4B3RF 4HLBA 3LAKA 5A6PA 2EBGA 3AH6A 2UVVA 1BY9A 4I56A 2Z0GA 2MZRA 2KO1A 2PMHA 3KLIA 4YB6A 5G0RA 1NK0A 1M5KC 2A2CA 3UCGA 1RI7A 1VHFA 2VUGA 3CJKA 4J9OA 2YH1A 1LXNA 1CVJA 3MM5A 4MTPA 1TKZB 1DBDA 3JAMY 1KC8T 2DHGA 1IN0A 2HRYA 1LKZA 1SJQA 2VQEF 2YNHB 3CWJA 4J9LA 4KHPF 2BJEA 1HBUA 3PFEA 3SV3A 5DG8A 3NNAA 3O3LA 4CO1A 2K7KA 3Q8QB 5I3PA 3GV8B 2M4MA 3IRXA 1B0VA 3ENQA 1FK9B 1Y3KA 5KT5A 3DRRA 3JYTA 1S0VA 2V9WA 3BR8A 2CPEA 1HNIB 4NLDA 3MFIA 5ADZA 3CCSS 2HIQA 2HHUA 1DQ9A 3HVAA 1ZH5A 2A18A 3UD3P 4M5DA 1Q8LA 2F9JA 4DPOA 2XI2A 4O3OA 2HHSA 2LCWA 2ASLA 4GC6A 2Q1LA 2KZZA 4ILLA 1VLYA 3FZBA 3DOKA 5K9FA 1KLMA 2B56A 1FTRA 2XWXA 5D4OA 4ZP6A 3V2UC 1G6BA 4LVNP 2MJNA 4A8OA 4C7QA 4Y00A 4AXIA 2F8HA 1NK4A 1U6FA 1U1QA 4E0DA 5C42B 2ASJA 2NXUA 2V8VA 5KFDA 5IS2A 3D0HE 2JVOA 1BGXT 3MEDA 3GB0A 2NSBA 3UCUP 2DR9A 2F8MA 3IAM9 4OQJA 2HVZA 1PC4A 1L3KA 3N5FA 3H5SA 4Q5VA 2IMOA 4O23A 4KV8B 3OJUA 3H5YA 3OLAA 1WF2A 2VBZA 3WDOA 2W8KA 1YRUA 3PJWA 2KU7A 2RSQA 4IR9A 4X62F 3EGWB 3M8SA 5D6GA 4PG8A 2BANA 2NPIA 2RF2B 1HNXF 2DCLA 3B82A 1QAYA 4HVZA 5KTQA 2BQUA 3UD4P 4QIFA 4TYBA 5EGYA 2CPDA 4MAKA 3GFZA 2AW0A 1ZZNA 1RJJA 1TUVA 1M5VC 1FT8A 4E98A 2PA3A 4RUCA 4ZPBA 5KFBA 3VAFA 1ZPWX 4EYIB 4F4WA 2JJ4D 3T1YF 3LAMA 2J6UA 3Q23A 3M30A 5L1JA 3ISND 2J0SD 4IFYA 1T05A 1CPZA 4LJMA 2FUG9 4Q45A 3OFHA 4DV6F 4DFJA 2X3GA 1HWIA 1XMOF 2QLWA 1M90T 4DX8H 1SJ3P 2FD2A 2X1AA