2EG2A

The crystal structure of pii protein
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
112
structure length
95
Chain Sequence
MKKIEAIIKPFKLDEVKDALVEIGIGGMTVTEVKGFDFLPKVKIEVVVRDEDVEKVVETIVKTAQTGRVGDGKIFIIPVEDVIRIRTGERGEQAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of PII protein
rcsb
source organism Aquifex aeolicus
molecule tags Signaling protein
molecule keywords Nitrogen regulatory protein P-II
total genus 23
structure length 95
sequence length 112
ec nomenclature
pdb deposition date 2007-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2eg2A00
4NYPA 2V5HG 2ZFHA 2VD3A 4E98A 2J9DA 1XK8A 2E66A 1UKUA 4AFFA 3T9ZA 1OSCA 1QY7A 3TA0A 4IYQA 1V6HA 3AHPA 5D4PA 2NS1B 5D4NA 3TA2A 1HWUA 1VFJA 4D3HA 5DS7A 5DRKA 4CO3A 1V3SA 1Q1KA 4USIA 4CNYA 2GW8A 3AA8A 3HLUA 4OZNA 4Y65A 5D4OA 3TA1A 2XG8A 3BZQA 3MHYA 3NCQA 4CO0A 1KR4A 1NAQA 4OZJA 4CO4A 3O8WA 4CO2A 4RWWA 4C3KA 3M05A 1O5JA 2Z0GA 3L7PA 2XULA 2PIIA 4RWXA 4C3MA 4CO5A 3N5BA 4OZLA 1V3RA 4WK3A 1UL3A 3DFEA 2JJ4D 2O66A 1J2VA 3GSDA 2NUUG 1PILA 4RX6A 4C3LA 1H3DA 4WK1A 4Y6IA 4D3GA 4YB5A 1O51A 3AA9A 4R25A 2DCLA 3LF0A 3CE8A 1NH7A 4ZK7M 4USHA 2CZ4A 1NZAA 1NH8A 2J9CA 2NUHA 2ZOMA 4CNZA 1UMJA 2J9DE 3X3UA 2RD5C 1VHFA 2EG1A 2J9EA 3NCRA 1P1LA 2XBPA 3OPKA 4YB6A 1UFLA 2GX8A 4NYOA 5D4LA 5L9NA 1GNKA 2GNKA 3NCPA 2XZWA 3AH6A 1V9OA 4CO1A 2EG2A 2O67A 3O5TB 4USJC 4YB7A 4RLEA
chains in the Genus database with same CATH superfamily
2IBOA 3CO0P 3BYPA 4PG7A 4Z7YA 4DZDA 5LMNF 3CCTA 3M8QA 4DPWA 3O44A 2V5HG 2J0QD 1C0TA 4ID5A 3MCMA 2GAHC 2OEMA 3KG4A 4CLSA 3QLHB 3DDKA 4MIBA 4DX5A 4Q7AA 2VQFF 4EZ9A 1CVJA 3N0VA 1CJUA 2UXDJ 4G3IA 3QMQA 4B3OA 4K0KF 1T8EA 3N9UC 1HNVA 3H8YA 2AJ4A 1ZOTA 2B6AB 2MZQA 4IH7A 4LBIA 2VH7A 4DQRA 1R7IA 2IPOB 1VQ8S 1CS4B 2R2RA 2CG8A 2RAQA 2RQMA 2ASYA 2MQNA 2WONA 3D0IE 2JFKA 3F44A 1HWLA 4OFZA 3TEHB 2GV1A 5L38A 3TUIC 5IV4A 1D9DA 2V67A 3D6TB 3ADAC 4EZ6A 3DGPA 3GJQB 4I4BA 3H25A 5KFUA 4ZHRA 4X4UA 2HQCA 1YK9A 2OKQA 3MTKA 2XYHB 1WSRA 3A1YG 2QL9B 1U6FA 3M4XA 3HMJG 3BQ1A 3ELHA 2DGOA 1Y00A 1S97A 4O3RA 1FCAA 4J9OA 1SC6A 4QWAA 2GC8A 1RXOB 2ACYA 2RKIB 5KT2A 3WDOA 4HHHA 1Z4UA 2HGLA 2ZD1A 2PEBA 4OHYA 4F0KA 3KNAA 4OZ2A 4ENOA 3MM7B 3BN7A 2HGMA 1T9UA 3UI3A 1YBAA 2FC9A 1RWNB 4W4MA 2ZZMA 2CG4A 4RNOA 2DGTA 3C16A 5U47A 1SUQA 1MMNA 4C8NA 4ZKAA 3D9BA 4I7FA 1Q53A 1YRXA 4USMA 3LGNA 3T9NA 1QJHA 1LWXA 4M1KA 1LFWA 1PYOB 4NEZA 2GHWA 2ZE2A 3FNNA 4DL4A 2BDPA 3QWPA 3HULA 3TVKA 4PG6A 1N5YA 1SXLA 3VAIA 1IKVA 2CQDA 1JX4A 4I1TA 4RNMA 2R3VA 2KTQA 1LV5A 3GSDA 2IVMA 2VASA 4DU8A 4NL5A 4DXLA 2VICA 1UA1A 1N0UA 4U8VA 2Z2YB 4Y6IA 3MTJA 2K2PA 3DU5A 1KQKA 2CWXA 2DH9A 5GAHU 3QJLA 5CYJA 3OR2A 2V9WA 1NO8A 3M8ZA 3SFUA 4M5IA 3LH2S 5GADI 1XBWA 1D8ZA 4I2QB 2BJ9A 4V1Ak 5GVQA 4C48A 2VJUA 1RTDB 3PY8A 4ER8A 4LF6J 2I5JB 3OFGA 4OI2A 4TQRA 3QZ8A 2NZCA 1DTQA 3TUJC 2DO4A 1XNRJ 2CJQA 3LTOA 3R7SB 4ALZA 1JWWA 4DQSA 3L09A 4J9LA 5KFVA 4YS2A 1RZMA 3BO4A 3GJSB 2P9CA 1LXNA 1NH8A 2ZHBA 3H4DA 1VBZA 2XI3A 4DI6A 4DL2A 3UCZP 4XAKA 3ETOA 1Y5NB 2R7WA 3QT6A 4JI8J 1NM2A 1Q95G 2E1MC 4DV2J 3H5XA 1B99A 3BF4A 1JLEB 2FJBB 1SQEA 2UZAA 1C1BB 1FRJA 5KFDA 4ECXA 1RTJA 5B0BA 4BS2A 3DOKB 1VQ5S 1RACB 3BKUA 5MAOA 1SJFA 1NK9A 3GIJA 1Y0HA 3ZZ0A 2HS0A 3OR1A 1U1NA 1T9WA 1SH2A 1WHXA 3I0SA 1JXLA 2CQGA 5KFRA 2UUBJ 1V9OA 4F36A 3PV8A 2KT5A 3ENVA 4PUOB 1R89A 2CDRB 3SXLA 3OSPA 1HD0A 2D3UA 3J7YI 4USJC 2C2ZB 3SDEB 4KC5A 1N33J 3MECB 2VB6A 5H9EK 3QSIA 4DX7A 4YDDB 1TKZA 1I3OB 4DQQA 4DF4A 3P6YC 5HVFA 3X1LB 4IDKA 3UD3P 3K5LA 1P9YA 3OLBA 2WK4A 2E66A 3M9MB 3BGRB 4DV6F 4K4VA 3MEEB 1J5OB 3W1YC 4LF8F 3UNGC 4ZP8A 2ASJA 2KHDA 1RBLA 2QMUB 3FZ2A 2AJ2A 4YQWA 2A1BA 1CJKA 1W26A 2LLZA 4USTA 5D4PA 2Q66A 1UPMB 4DFPA 1K9MT 1N4LA 1NPPA 2ZH6A 2MHEA 2MQ8A 4ZCKA 3NKYA 4AUKA 4DV1J 4ECWA 1S0NA 2PI4A 1LWCB 4J7CA 5A8KA 1HBUA 1TL3A 1Q1KA 1WOSA 2A2CA 2GGPA 2HLUA 2M52A 1F0XA 3EXCX 4USIA 5KFKA 3H4BA 5LMUF 1DAXA 3VAGA 2HHHF 3GYGA 1RT2B 2LQBA 3Q8PB 1VK3A 3QT8A 4GMKA 1Q82T 2Z2ZA 1NDPA 1K8AT 4FYDA 4AL6A 2HFZA 4JI6J 3CJ8A 2YPZA 1YJTA 3I9V9 4CH7A 2B7BB 4OV1A 2FLPA 2UXCF 3KOAA 3EZUA 1XMQF 2HYIB 5E7OB 3FBFA 1YX2A 3DGVA 1RAGB 1O8BA 3EE3A 2ADBA 1D1UA 3OT9A 2VKZG 4ECRA 3NMRA 2LU2A 3M7VA 3KLIB 4CDIA 4UQGA 2CIMA 3BS9A 2AJ1A 4IQMA 3US5A 3SQGB 1XERA 4CI0B 4DHVA 1RYSA 1LWEB 3ZTOA 2VJVA 1GXLA 1SH0A 3J80U 2UVWA 2EI5A 2FZKB 4WK3A 1S6PA 4FVMA 2X7IA 4N7TA 3SCLE 4J9KA 4JI4F 1UPPA 1UL3A 2JOQA 3MZIA 3RRHA 2HVZA 1F5BA 1X4AA 3AOCA 3QJJA 4NMLA 2B56A 4OYBA 2BJ8A 2G1HA 5HBMA 4PWUA 3BM7A 4DR3J 2KO1A 3MEGB 3U1MA 3MEKA 2DNKA 2VG7B 4JI5J 1HA1A 2PGCA 3LP1B 4AL7A 4UW2A 3M1VA 1HNVB 2C3YA 3MMBA 1YKWA 2B3TB 3R5AA 4KV8A 1LK5A 3CULA 3R2DJ 3M32B 3FSYA 4YUDA 5HVGA 5IFMA 4XO0A 1HYSA 3BGLA 4WP3A 3CD7A 1LWFA 1RHQB 3TJ8A 3VV2B 5A8RA 2RF2A 3OBIA 5THWA 3WC0A 3MAQA 3CUNA 1P1TA 1RT6A 2ZZTA 5T41A 1KD1T 3QYYA 4PPZA 4F7VA 2V8DA 4OX6A 2FB0A 2Z8QA 1RWUA 4WE1B 4URSA 5EUHA 2LA6A 5E0OA 4YHHF 2VA2A 4CP5A 2J9CA 3OXFA 2V6AA 2CPDA 1OS5A 2W8LA 3P5TL 3RBEA 1YBTA 3PX4A 4CYUA 4DG1A 1NPRA 3QATA 1S4EA 2FGOA 4R5PB 3PCOB 5KFIA 1IKWA 4ATNA 3MMJA 4I6YA 4ZLLA 4QPXA 1WC6A 5KOWA 4KHMA 4A8FA 3GIMA 2Y1IA 1REVA 4H54A 3UVJB 2DRBA 4ZIWA 1O0PA 2XC9A 3ZTSA 5RUBA 1ZPVA 1EETB 1NSPA 3AH6A 2BKNA 2C3MA 2HFNA 1T7PA 1HNZF 3BO2A 2VDHA 3VALA 4YP3A 3AJDA 2JC1A 1VHIA 4M5KA 3GV8B 1TL5A 4DL0C 4YR0A 3EX7B 3N6LA 2CPXA 2JSXA 2IYGA 4I64A 5H9FK 1FWLA 4X2BA 1Q5VA 3SSQA 4DL6A 1CSJA 3QJPA 2VBYA 3K5PA 3LA0A 2N3OA 5HROB 1YJRA 2ADCA 3AB4B 3M2UA 5K5MA 1TP7A 4FP9A 1JLGB 2L9WA 3QT7A 2R7OA 1OSDA 3VR1A 2YNFB 1IBKJ 3GR1A 3MM8B 3H2UB 4G1QB 4J5OA 2AZ3A 2H65B 4UOCA 4HLBA 1S9EA 1LEOA 2V94A 3IBCB 3KJQB 3OR2B 2ILZA 3GFXA 3KLGB 1NDKA 1HR0J 4I2QA 2G2OA 4HVZA 4D3HA 4JI0J 1HBMB 3DRSB 5I3PA 1N6QA 2HNYB 3SMZA 2H3EB 2CJYB 4PWDB 2RT3A 5DRKA 4KB7A 1IBMJ 2KJWA 2MQLA 2W24A 1FXLA 2DY9A 2UUAJ 1YJ9S 1TUWA 4QW8A 1FA0A 3EMTA 1HBOB 2WOMA 3DOMA 1JK9B 3MM9A 4OLOA 2ZOFA 3MURP 1I6JA 1BQNA 3HLUA 4CIOA 3PYFA 4DFJA 3FFIA 2LP4A 5EN1A 3PRBA 1EKSA 4DV5F 3K57A 2UVUA 1R43A 3IG1A 3CCQS 1UWBB 3BEGB 3R9LA 2XHWA 3D0GE 1HARA 1NJIT 5BYQA 2BE7D 3S7RA 2CNOB 2ASDA 1RAIB 4NEYA 1KLNA 2VBZA 2ZZNA 1RTJB 4LREA 2ZNZA 1TK5A 1S7IA 3PIOQ 3PHTA 3V4MA 4I2PB 1UFWA 1XMBA 4OJHA 3AQOA 1HHQA 3AY0A 4E2FB 1FNOA 1X5OA 3D0HE 2R42A 3P49B 4RO0A 3B82A 3ET6A 1MWZA 4IOAQ 3O6QA 3MPUB 1RHMB 4PG4A 1N56A 2W4DA 1XQIA 2CQIA 1AUSL 3MECA 1X9MA 1S59A 4NCAA 4WCEQ 2QX0A 3NP5A 5AXKA 2NREA 4ZPWR 3UDVA 2R7VA 5KT3A 4A8OA 2XTJP 2DK2A 4EK2A 3FCHA 2R7RA 2Z57B 1J5EF 4RW9A 2B9YA 2D7SA 3HHEA 4DSLA 1K0TA 2BABA 4NX9A 4HH0A 1SH3A 1CJTA 4LFCF 2JL9A 4IQXA 2I1RA 3LAMA 3C2PA 4C11A 3QIPB 1CJKB 4R25A 3TUZC 5J2PB 4YFUA 4XPCA 1EZZB 1NLKL 3TAMA 3D3BJ 5HP1A 2GJ2A 4DN9A 1VBXA 3A12A 2KT3A 3PXGa 2VFVA 4F3MA 2AU0A 1S99A 4IG0B 2DNNA 3CDUA 2HHPA 2QL5B 1ICEB 1DQAA 1VLYA 2QYCA 4N76A 1SV5B 3CD0A 3MWBA 2CXEA 3MI7X 3OSNA 2QRRA 5A76A 2GVDA 3KLEB 4X65J 2DXFA 3M8RA 3D2WA 2VQFJ 1YTYA 1LFPA 1VIXA 1FI4A 3T19A 2HG4A 2RJZA 3AD9C 4F67A 4DPOA 4B9NA 3EVMA 1FFGB 4WFXA 5KFXA 1EQ0A 1U24A 1SKSA 2CZ9A 2WVFA 1P1LA 2HAIA 3DLGB 4IFYA 1RHUB 4KGXB 3S6EA 1NJYA 4DSIA 3OPKA 3JAMU 3PKMA 5K8MA 1CC8A 4DV7F 2R8KA 2GO9A 4EYHB 5KFFA 1HD1A 4UZCA 2QLBB 4LSLA 2MLYA 4Y2IA 2ZJQQ 3QGPA 1LKZA 2ZNYA 1G1XA 5DZ7A 1KRPA 4FYVB 4WF9Q 3OL6A 5DG9A 4A48A 4XIUA 2F7VA 3LP2B 3NLCA 2R8HA 4ZDNA 1T3NA 5HMWA 1N33F 3RZAA 4A4JA 4K4WA 3BDPA 1YWXA 3MUTP 1UVJA 5K8NA 4W92B 3QRRA 1WDDA 1SQGA 1VQ7S 4CLYA 3D6MB 4RW7B 4PWWA 3SV3A 2OHDA 3VAMA 4N56A 2E7WA 1FK9B 2OFHX 4USUA 3DLLQ 4NZ6A 2NSCA 4LT6A 1SJ4P 2R8GA 3P5BP 1H6KX 4ZJQA 2W9CB 5KT5A 5EHHA 1OSCA 2GQQA 4X66F 3I0RA 1LNQA 1MNEA 4NASA 5IQQA 7FD1A 1ZTTA 3VVTA 1AXQA 4Q8FA 2HFSA 1NKEA 1DTTB 1NB2A 2QTWA 3CDEA 3FBCA 3I96A 2RU9A 3NEKA 5LMUJ 5DS7A 3FBEA 4B3TF 2YKNB 5A0YA 2WTFA 2UXBF 4DR5F 4Q43A 5SZTA 4JI3F 1MLAA 4Q8EA 1WUUA 4CH1A 1SC3B 3UD5A 4LUBA 1S1XB 1H2VZ 2OLWA 4GVBA 1L3SA 2HZAA 2V2QA 2BQ3A 1CBKA 4EWTA 4QWEA 4MTPA 1UEVA 4P73A 3RAMA 1HNWF 4G65A 3GFYA 4F0MA 4WFYA 2XMTA 1SIZA 2A10A 1FJCA 1F9HA 4DG1B 1RISA 1ZM4A 1FESA 3JQMA 4UUWA 2DNHA 4Y2MA 4M95A 4PQUA 1IKWB 1WOPA 4IRCA 3CT9A 3DRPA 2OD6A 2JH3A 4Z37A 4KYZA 2YNHB 5DO2A 3VHQA 4OZJA 5J2QA 4Q5VA 5I42A 1XN9A 1RBOB 1AFIA 2FGCA 4FBTA 3MAAA 4YMEA 4M5HA 2GJIA 2E1RA 1DZ5A 1VR6A 5HQ8A 2DHAA 4NLUA 4NXMJ 4ZN3A 1S48A 3JQJA 3F56A 1V5IB 5K14A 2BE2A 3EZOA 4OZLA 3TQEA 1X5SA 1V3RA 1KOHA 1JNZB 2E5LJ 4CLFA 2ALZA 4QU7A 2FJEB 2FHJD 2JFDA 4LFBJ 2XWYA 4ICLA 3VF0B 4HI1A 5J2NB 2R8JA 1M5KC 3G82B 3KHHA 1UCNA 2JWNA 3W9HA 1S1UA 2HURA 2E5JA 3C66A 3W2VB 5CXTA 4IRKA 1OPZA 4KAIA 2HQFA 1YBUA 4M63A 4F4WA 1FKOB 4DSFA 8ATCB 4RX6A 1WJ9A 4MFBB 1VJWA 2D9PA 4CLKA 3MM8A 4G1QA 2QLWA 2LXIA 3G8SA 3SCJE 2G13A 2J5AA 4DV4F 1RA7A 3R97A 2WSFC 1I51B 3RB6A 4IR9A 5J2MA 2X1AA 2K7JA 1TU0B 2FVCA 2DNMA 4C98A 3BH7B 3KLGA 1SJ3P 2V8PA 2DBBA 1VC6A 3A4TA 1IR2A 3ZZOA 1FVQA 4WZQA 3DLHA 1HBMA 3DRSA 2HNYA 2R7XA 1IKYA 4DS4A 2IHR1 1SL0A 1TL4A 2LVWA 1NH7A 5KFJA 2A3JA 4X62J 5IZHA 4WU2A 3CJ5A 2VG5B 1TFYA 3UDEA 4RW8B 3DOMB 3IR5B 3ISZA 3IBWA 2M4MA 3FFIB 5JVGQ 2QGFB 2FVSA 3PACA 5DG7A 1N5QA 4AT1B 1GTHA 2GA7A 4PQAA 3NBPB 2GMLA 5LL6d 3T6JA 2W2QP 3NCRA 1TV6B 2PO4A 4WWSA 2C22A 4LQ3A 2CPIA 2XO6A 4YB6A 1UFLA 2DHHA 4NLQA 4KPYA 4C6AA 2XMMA 4KFBB 3TZWA 3IN5A 4M94A 4ZJLA 4DLEA 4WFNQ 2IBKA 4X4OA 3NCPA 3W61A 2HHHJ 2W2PP 3S1TA 4HKQA 3E8OA 3TR5A 3QWUA 3CJQA 3KHRA 3IAM9 1PKUA 3W3SA 4YY3F 4OYMA 5B08A 4DN0A 4NI2A 3UW1A 1N34J 2AKWB 3CDAA 5KFLA 2L08A 2CNLB 2WB4A 2Y0SD 2ZJRQ 3Q8RB 2JDJA 4B9UA 1NSQA 1H72C 1WI6A 1BUXA 1Y9OA 2MMYA 2YWWA 1RI7A 2WSCC 4J9QA 1U1RA 2KZMA 3HJFA 2XZTB 3D7SB 1EB0A 3FKBA 4IOBA 3PIPQ 1TKTB 4RNFA 3IO1A 4ZLJA 1C2PA 3K8VA 3ULHA 3NOCA 3THPA 5IV3A 4M5DA 2GO8A 2XY6A 2XHCA 3KYLA 2R7UA 1ZS6A 2MTLA 3ZZYA 2KU7A 2B8QA 4KQZA 3OJSA 5EDWA 3C46A 2PFDA 4WIIA 4A47A 4ZS6A 5K9FA 2Q1LA 4KSEB 3IWLA 3GFHA 3TX8A 1DURA 3TAPA 5IWAJ 4ED1A 3TAMB 2JLEA 2YKQA 3CCVS 4LBPA 1PJ6A 3HSDA 3D67A 5KT4A 2F8HA 3CMAS 2MZSA 1V3SA 4OHZA 4DQPA 1S0OA 1JLBA 2BXJA 1KNZA 2VL1A 2XMJA 4K5SA 1Q8BA 3TUPA 2C2KB 2V0NA 2UUWA 1R6YA 4B3RF 1WC5A 1U47A 2HGNA 5CCMA 1VQ6S 1IVZA 3DLGA 1JQGA 2IM1A 3NS5A 4OI4A 1N5SA 2OPRA 3MCOA 5BYSA 4O23A 4CO0A 2ZVIA 5AJ3F 2JEGA 1H2TZ 2KRRA 2FLOA 1FDNA 1U1OA 4CO2A 3RBDA 5EWEA 1G6BA 2J0XA 2OPSB 3QNWB 4DEZA 4WFZA 5BXIA 2DKOB 4B9TA 1S9GB 1N5VA 3E3XA 2JVRA 3OQ2A 3ZTRA 1NKBA 2RRBA 2JC0A 4LF9J 1ZA1B 5C5JA 2ROPA 5JXSA 1IM4A 5ADZA 2HHTA 3FEYB 4ZVUB 1SBRA 4K4UA 1VQ4S 3D1OA 1J5EJ 1WKLA 3W63A 1RWWB 5T7LA 3BGFA 1R27B 4NLXA 2IRYA 1C0UB 1F2HA 4ILRA 1SKWA 2HNDA 5EGYA 3HHNB 3BR8A 5KOXA 4P7VA 1MN9A 1FK9A 1EP4B 2VV5A 2IAJB 3M8QB 5KAKA 2D9OA 1HQUA 2DNGA 3HF5A 4JP8A 4QPTA 3QLHA 4EI2A 5DDPC 3DYAB 2HMIA 3M30B 1RU2A 2XCPA 5KG2A 1WI8A 3KJVA 2EFOA 4D3GA 1KHWA 1LW2A 1VRUA 2ZEJA 3OLAA 2B6AA 5HLFA 1VBYA 1N32J 3NGKA 4Y34A 2E9RX 2R7QA 4UOFA 5KG6A 4X4QA 1VQMS 2ACMA 4KHRA 3LANA 1HNIB 4PABA 4DR6F 1NDLA 4DMZA 2V68A 3CCMS 5F8MA 3DLEA 1SL1A 5JUMA 1WOOA 4DL5A 5KFEA 4C9DA 4F2RA 1KC8T 2HBZB 3HHLB 2V8VA 3MOJB 2AX0A 4PKDB 1CULB 1W7WA 3FZBA 3DRRA 3OTDA 1U2RA 2J0SD 2FLLA 1MW7A 1U1KA 1SJRA 4X64F 2AX1A 1T03A 1GXTA 4U96A 1HKAA 1NJWA 2OAUA 1HR0F 3L95X 4DDFA 4Z7CA 3UE2A 4JI2J 4WP9A 3G6ES 1RT4B 3M2VA 5I3QA 1IBMF 3CGIA 1FFSB 4LFAJ 2UUAF 1I5OB 3BKFA 3FMWA 5J1EA 2FPHX 1IWAA 5E2QA 2BRLA 1HFEL 1FJEB 4DX6A 4P52A 4P71A 4Y2AA 4LVNP 5E5NA 3TEGA 2WSEC 4GKJJ 3C19A 2HBRB 4YB7A 5EX0A 3QRQA 2V63A 1FNXH 1B0VA 3E01A 4ICLB 2K1RA 1HMVB 1RKJA 2EKYA 1QVFR 2AW0A 1X4BA 2V8GA 1IKXA 1RHJB 2BE9B 2ZHOA 3TP2A 3UNYA 3BQ0A 2RRAA 1L3UA 3IWXA 3PM9A 2GVZA 1UKUA 3Q2SC 1RA6A 1YJVA 3ITHA 1TUGB 2CQHA 4ZCLA 1NNDA 2W9BA 3PHEA 4DR4J 1K0VA 3AT1B 4ZVGA 4DS5A 4IYQA 4NCGA 2XMUA 1TTHB 3CMQA 4TVAB 3CMES 1UJ5A 1RE1B 4MYUA 4EYIB 1UVLA 2CUYA 5D0EA 3DMJA 2PE8A 5KFOA 3NMAA 1WC1A 2ZWOA 3A8EA 3PRVA 4FDFA 2VA3A 1R8AA 2OPQA 4ECYA 1YVFA 1RLCL 2C1EB 1X4DA 3FVYA 1YRUA 2VBXA 2WRMA 3CVKA 4C97A 1UFKA 3Q24A 3RRKA 4OL8A 4DR1F 3SCKE 4UUXA 4NA2A 4ED8A 1N8RT 2CVIA 2ILYA 1S7HA 3VGSA 2KM8B 1VRTA 5CYQB 3T1HJ 1S9FA 3DDIA 2P9GA 3M2RA 2BACA 4TKTA 3TANA 2H9ZA 5LMNJ 3BQ2A 3H40A 2KG0A 5F0UA 2XYPB 1TMJA 9RUBA 2XI2A 1OYEA 2ABYA 3HVAA 4KFBA 1XMOJ 5F3ZA 4KJIA 5HVHA 3QRPA 2ZBIA 3BGUA 3HI9A 1B64A 1QDUB 5DM7Q 4N77A 1QUPA 1WD6A 2MY8A 3N5BA 4PEOA 2L41A 4Y28C 3H5UA 2B4VA 1JNRB 3SV4A 1N36J 1ROFA 2J7WA 2RE1A 4JYAJ 5FLXY 2GIFA 4K50A 4NRUA 3QGGA 3HK2A 3QO9A 3HM9A 3B54A 3TWZA 1UW9A 1S6OA 3EXYA 4DV7J 4UY8T 1T05A 4ELTA 1WEZA 4FYYB 5L1KA 1VC0A 3GWCA 4RW6B 1S76D 3IMQJ 4LRFA 4JOUA 2DVIA 1H74A 5ETKA 3TQ1A 3CIMA 3R2CJ 1Q0NA 2WB1D 3MXHP 1PJ5A 5AT1B 4ECUA 1CS4A 3HT0A 3ISND 4WIQA 2C2RA 5K8PA 4EBDA 1GEHA 3JSRA 2ZBCA 4OZ5A 2P2CB 4NLOA 1MROA 1Q78A 1WG1A 1AYEA 2MPUA 3H20A 3W66A 3G2XA 4ZK7M 2QFJA 4L3NA 2E9ZA 1HIYA 2XY5A 2UU9F 4DV3J 4HI2A 1F60B 5ITHA 1PO6A 1B4SA 2CAJA 2DEJA 4JV2A 1S49A 3NGUA 4Y3CA 3KMSA 4ZN1A 4FBUA 2O5DA 3MPVA 5I3UB 2HS3A 3X3UA 1OYDA 3PYEA 4MKAA 3GJTB 3CCRS 3OTCA 2RKIA 5G0RB 5JMNA 4K4YA 3GG0A 3VGUA 3FCWA 2ERRA 4ZPTR 2OPRB 1JLCB 4UOGA 4KE5A 1RT7B 3B4MA 4B9VA 2XSJA 2HK2A 3DI6B 4NYOA 1XNQJ 1F3VA 5DLFA 2AGOA 1FRIA 2HZVA 2COLA 1RP5A 1SUQB 1PIEA 4ANCA 4F4XA 1BD6A 3Q83A 3Q86A 2VHGA 2QL7B 1EIYB 3A3NB 1TAUA 2EG2A 4ES1A 3CO9A 2LXUA 4RUHA 3O5TB 2H5EA 3DC2A 4WYWA 1QAYA 4LF6F 4KBIA 2QMWA 2FJXA 2R4FA 4XK8C 4ZOSA 4RUCA 3MPYA 1N5YB 2HNDB 1HI0P 5E33A 3UDLA 5HN0A 3TO8A 1IKVB 2LECA 4LF7J 3RR8A 3HHDA 2BQUA 3UPFA 3V2UC 1XK8A 3Q8YA 3J7Z5 3JB9k 3DYAA 3SSSA 2NXUA 2YWHA 2G0CA 1ZAWA 2YKMA 5GAGI 3GILA 3LP1A 1YJ7A 2Z2LA 3NNHA 1JLFB 3M1VB 5DJBA 3BH6B 2V9KA 4J9NA 4URQU 1IJEB 4WXOA 4ECSA 2B5JB 3AHPA 3TA2A 2H51B 3TAQA 1U09A 2W2MP 2VUGA 4B3SF 2Z56B 2QA4S 4U67Q 1UAWA 1FRHA 3H7HB 1DLOB 3I5CA 3QGIA 1TKXA 2I5JA 4HACA 2DR6A 4RUBA 5CZXA 1SIWB 3W2WA 4CTAA 3MM6A 2FYXA 2UUTA 3LPYA 4CO3A 4WKRA 1FJ7A 3AD7C 3MUMP 2V2ZA 1VRQC 2DGUA 4CLUA 2X1FA 2W1BA 2ZWPA 3RBZA 4O44A 2QC3A 3TA1A 2IJNA 4R0EA 3FC9A 1EHWA 1FDBA 2MHNA 2MQPA 4F4YA 1SKRA 5HL7Q 1L3VA 1DFDA 2DR9A 2BJDA 2QMXA 1HWJA 2ZKTA 3FEZA 3ICLA 4AXIA 2JLGA 2LXFA 2IM0A 4TU7A 4DR7F 3PO5A 4GO7X 2LQ8A 3LQVA 2BQRA 3HP6A 1IQTA 1M5OC 3NCQA 4FF1A 5D8HB 1HLWA 1Y11A 2DISA 1CPZA 3HXMA 4DCPB 1R0AA 2E7VA 1SPBP 3BB5A 1CQMA 2FIUA 2YNGB 2MKHA 2HNZA 4DV6J 4ELVA 5H9EJ 1VK8A 4CQ1A 1EETA 3BV8A 3KMQA 3I0SB 1O5JA 2EFNA 2FJWA 3TVZA 4RWXA 1N54B 5D6GA 4L3KA 2MKCA 4ID8A 1DQ8A 2DJWA 3GZ7A 5AE1A 2DT9A 2CYYA 3DLKA 2KKHA 1KVKA 4NMXA 1RT3A 4OYWA 2R7TA 2GS8A 3CDWA 3PJWA 3HDSA 4NOHA 5IC6B 1YJUA 4PZVA 4IH6A 1Y7PA 1P6TA 4CLPA 4H4OA 4O4GB 3Q2TC 2YNIA 4HT7A 2IVFB 4CT8A 1N32F 3HHKA 2YVSA 4TQSA 4ZVTB 3JYTB 1KVIA 2MZTA 3OFEA 1OIAA 3L4BC 3MEEA 3Q0AA 1DQ9A 2W9BB 1JJ2R 4N8OA 1NSAA 5L1IA 3DOLA 2HAFA 3D4JA 3J80Y 4J9PA 4YY3J 2E29A 1N48A 3C6TB 4LF2A 2RMLA 1B0TA 1N34F 1XR5A 3GMGA 5D0RA 2J7KA 2LU1A 3KJNB 1GFWB 3WX8A 2XNQA 4I0WA 4FF3A 2RNEA 4JI1J 4A8MP 2OTJS 3MCSA 3PEJA 1HBUB 1TL3B 3NY0A 3HFZB 1UJ4A 4USHA 2ZUAA 3N6MA 3A8JA 2HVDA 2YX7A 3EGWB 5A6WA 3MMCA 1GTEA 2D3ZA 4BCAA 3VCDA 2CPJA 1QLNA 3GONA 4DUZJ 3ZNJ1 3W9IA 3HVTA 4ANEA 1S1VB 2ZITA 1BGXT 5C25A 3Q23A 1A9NB 1QSLA 3UR3C 5CA5A 2E1AA 3MFHA 4L73A 2DXEA 1S6QA 3CC4S 2ALYB 3H2LA 3CCZA 3V6HA 2H54B 1FKAF 2W01A 1XR6A 3R3TA 3MD3A 4OI3A 2LEAA 3G8QA 1F5CA 2C3UA 2BUNA 4QOTA 5A6PA 2DGWA 1RWMB 2GNKA 3HD1A 2WW4A 3M8PA 1KONA 1TKDA 1NK0A 3K7RA 5EX3A 5HQLA 3GV5B 2K3KA 3UQSA 4PXCA 4WPAA 2VPXB 3GIIA 1C1CB 2JEJA 1PSDA 1WEXA 1ZBTA 2CPHA 2YWEA 2MGZA 4GRSA 3MDFA 2HMIB 1E6VB 4FXVA 1S6PB 1Q16B 4K59A 1TL1B 3T41A 2OGUA 2P9EA 2FTRA 3QO9B 1XR7A 3AOBA 3AFGA 3AJ2A 1OWXA 3AB2B 4WXWA 1U6BA 4E98A 1WF0A 2VG6B 2J9DA 5GMDA 1YITS 5F8LA 1LW0A 4AFFA 2XEXA 1QY7A 1S5ZA 1BWEA 1M0SA 3LW5C 4I68A 1S72S 1U49A 4J9MA 3G6XA 2Y8YA 2RUGA 1VOMA 4O0NA 1IXKA 3T5HA 4KV8B 5J2PA 4NLGA 3IC1A 1SJQA 5GAEI 3HSGA 3O2IA 3CC2S 4KY3A 1HYSB 1X5PA 5B0CA 2CPZA 5K8OA 5KFYA 1YQHA 2RF2B 5KFBA 4YDXA 1D9AA 3GCXP 1TR0A 4V19J 1MROB 5IXUA 4PPDA 4P74A 4RZRA 4TU9A 3PO4A 1FJGJ 4FXDA 3VAHA 2QG9B 3CTRA 1LOUA 4EMDA 2JVOA 2EVZA 4LBHA 2GMJA 2CA9A 3K8WA 2W7OA 4OHVA 3CCES 2PFFB 2DNRA 2Z4PA 4FNIA 5C42A 4R5PA 4IFYB 4PRFA 4Q2LA 1GMVA 3OL8A 3HHLC 5E3CA 1RT7A 5LJ5Y 2HK3A 1NK8A 4ETXA 4P10A 2GJFA 3QFHA 4NA1A 3UVJA 1NK5A 1F6TA 3R8YA 3M05A 3TVYA 4IOCQ 2FLNA 4MKVA 5LSRA 4KH0B 4DR2J 3LP2A 1RCXB 1NSKL 3H42A 4L74A 1RTDA 2VQEJ 3T6BA 1SB6A 2BYCA 1P9QC 4A8KA 2DCUB 3RW7A 2KDOA 3D5MA 4ZVRB 3HVRA 2CNKB 3OHBA 1IBLJ 1FKPB 3FQLA 1U2FA 4LRCA 2BJ1A 3PR5B 3BKTA 3J7AN 4OLPA 4BLGA 2JJ4D 4FS1A 3C3LA 1J2VA 4ZIVA 2KFZA 2V2KA 4C0OC 2FJAB 3NGDA 3N01A 3CJ3A 4LFAF 2YNFA 1IJFB 1KHVA 3MM5A 4X4PA 4QIEA 1JLFA 1X4EA 4ZVQB 3QBCA 1Q5YA 4C8KA 3HT3A 3QQCD 5MLCV 1O51A 4CWBA 2A18A 3PX0A 3OHAA 1FD2A 4P9SA 2IMWP 3FK4A 1IN0A 1UP1A 3CJ2A 2OIHA 4K8RA 2K7KA 1BHNA 3W2WB 1IR1A 3T1YF 2UU9J 5GAGU 4PWDA 1RT1A 3DM2B 4DF8A 1T0TV 1EX8A 4IG3B 1VBKA 1Q7YT 4OX9J 3CJTA 4Y00A 4TY8A 4WKYA 3BREA 2KL8A 1EQMA 1OQ3A 1UTAA 1BQNB 2P5VA 3D66A 3CJSA 4DZ6A 3VAJA 2CPFA 2HPUA 1OO0B 4O44B 3VAKA 3J7A1 1C4AA 1HW8A 2F63A 4DR4F 3JTNA 3ZZUA 3DU6A 1FDDA 3NGSA 1JJHA 2BV3A 2EEYA 3NGRA 1S12A 3PDNA 3PFEA 4PXBA 5HJYA 3K17A 1PYTA 1W25A 2CQCA 3MUVP 4F2SA 4K4ZA 2DHXA 2Z30B 3OD2A 3PNIA 2W4PA 3G86A 3GIKA 2Q6BA 2GHPA 3H0PA 4IFVA 4WU3A 3KLFA 2YNHA 2MLZA 2DHSA 1UJ6A 5L9NA 3V6DB 3FCVA 2HZCA 1RUSA 2HHUA 1GH8A 2HNZB 2EC0A 4FVCA 2PMWA 4I7FB 4MH8A 2V4JA 4DPYA 3MR3A 2HWTA 2FJVA 3M6UA 1FHTA 2XLKA 1YZ7A 1UVMA 5CH7B 4LF7F 3TARA 1FNMA 1PCAA 1WG4A 2CKWA 3VGVA 4DR1J 3HO1A 2XS2A 3SQOP 3CF5Q 5C24B 5B7WA 2ZH4A 4JI7F 3MMAB 3P3DA 3CCUS 3HX9A 2XMAA 2MKJA 4QIWD 4H4OB 4H4KA 1X0PA 4MK8A 4USKA 1SI9A 4ECZA 1S10A 2RB7A 3HVWA 3AOAA 4X65F 3KK1B 1CG2A 1P27B 3TW0A 5HSPA 4C8OA 3S01A 1RU1A 4PXDA 1GMUA 4QJVA 3T9ZA 3IP0A 4OQJA 1TVRA 2NXEA 3PVXA 5CAAA 4C11B 1PC4A 4WZMA 2F1FA 4QWBA 1VS3A 2FZCB 3V4IA 1N52B 3GCWP 4ZVPB 3OUYB 4X84A 1HWUA 3VQSA 2XLIA 1SCJB 2ZC3A 1IBKF 4JYAF 4ZLPA 3C6UA 2IRUA 3LP0B 2C3PA 2AYBA 3A3PB 3KFWX 1QTNB 1HPZB 4M5JA 4OI1A 4CNYA 1NHKL 3QGHA 5CD4A 2GW8A 2C28A 4NXNJ 5HJXA 4M5MA 2PT0A 1RWVB 4JI0F 2J6UA 4QYRA 2M8HA 3BSCA 1TFWA 3CSKA 5D4OA 4PCQA 2YQ1A 5F9NA 2MQQA 1QAIA 3BR9A 1GX6A 3K5MA 2R8IA 1FERA 5KFSA 5AE3A 1ZZFA 2QE5A 3I55S 4DUYJ 5LT5A 5IS2A 1RWPB 4ZCIA 4BC9A 3GG1A 4DV5J 1FVSA 1JLAB 3EGNA 3U1LA 2B4UA 1KLMB 3TZYA 3LWLA 2EXUA 2NQPA 5D77A 3HD2A 3NS7B 4RKUC 4FNHA 1U02A 4LSLB 1TL7B 2H1YA 1S6UA 3JQKA 4HTIA 1S1WA 3OR1B 3MPDA 4XDDA 2WVCA 3SCIE 5KFMA 1OY9A 2Z0GA 3LGHA 2KRBA 4U8YA 3RBXA 4X66J 1RGVA 3W9JA 1N5TA 4JV1A 2G4BA 5J1NA 2PN6A 2Y3YA 2MGZB 2ZH9A 1U0SA 2LQ9A 2PA8D 3I4HX 2OELA 1TL1A 4ITSA 1TK0A 1RAEB 2BR0A 4DR5J 3DXBA 5DDRC 1FRKA 1XWLA 2CQ2A 3DFEA 3R7NB 5GMEA 4C0BA 4EEYA 1RT5B 3FEXB 1QUVA 4OYXA 3NOGA 3UWTA 1GT8A 1U8SA 2IVYA 3U1NA 4WK1A 2AEMA 2B9XA 3GPAA 2I38A 1NEEA 5KG1A 1JMTA 4OYOA 3CPWR 2HQGA 3KK3A 2W2OP 1DTTA 3NXZA 5GADU 2HRYA 1ZAVA 4KO0A 2H48B 3FGVA 2RIJA 5DDOC 1U45A 3KUHA 4WTYA 2W9AA 2OJ3A 1DY3A 3BSAA 2XMVA 3G87A 2J7UA 4ZCMA 5ETOA 3OV7A 3DLBA 1UEKA 1NK4A 3M9NB 2ZVSA 2B0GA 3R1HA 3KNGA 4DJBA 1VQSA 5F8IA 2BJEA 1RTZA 2GQ2A 1FF2A 1VCTA 2J9EA 2QA1A 2U2FA 3BPDA 3R5CA 3GQCA 4LFBF 4F25A 5M2PA 2DTJA 4CT9A 1BE4A 5C2CA 2ZD1B 3ENWA 1VQOS 3PR4A 4MK9A 2L48A 1KQSR 4ELUA 4AL5A 2CADA 2OD4A 3MM7A 4NPOA 3PEHA 1K47A 5I42B 3D28A 2XS5A 5ETTA 3CJ4A 4W90B 1U0HB 3KLIA 1K44A 1S9GA 4DV4J 5L1LA 2J76E 3OXGA 3LAKA 2EFQA 5DGBA 1L3TA 4L76A 2FY1A 1M1HA 3IWNC 5L1JA 4ECTA 4KGVB 5IT4A 4LSZB 1VLOA 1X31C 4ZLNA 4DR7J 4QYZJ 1FD8A 3R1LA 1C0UA 4RLEA 5KG5A 3G82A 1Z1ZA 5KG4A 2YH1A 1JJ4A 2ZM6J 1EP4A 3GIRA 4OI6A 4LIRA 4ZP6A 1H7XA 3W2VA 5DQGA 4Y0FA 4ED4A 2ZJPQ 4EGLA 4RBVA 2AF6A 4R0JA 4HH1A 2I9SA 5L8RC 2C2MB 5T14A 2OH2A 2AYGA 4ZVOB 3K5OA 3V81A 1QSYA 4B9LA 3N4WA 1U2CA 4EO6A 3DCAA 1V6HA 3HZEA 5J2MB 1FJGF 2L3MA 1KQFB 4B3MF 2A6OA 4ZPVR 4C2MA 2DNQA 1K1SA 4XPEA 2FVQA 2CZVC 5A8RB 3DM2A 4CCHA 1DTQB 2NCKL 1OMSA 4OHWA 2K06A 3MR6A 2XB2D 1KN6A 2DR8A 3KTQA 3H2VE 1KQGB 2VOOA 4RW8A 1FWKA 3AA8A 4I56A 3HHLA 2LA4A 5KT7A 4B3TJ 1VISA 4OZNA 2ZOGA 5JJBA 4NLPA 1AB8A 4RBUA 2RS2A 4JI3J 2ZDOA 2R2UA 2HVIA 1L3KA 3I5AA 4MJKA 3MR5A 2CWKA 2GHVC 2WVDA 3RAXA 1MU2B 4K5RA 1T9TA 2CJAA 2N4DA 1HNWJ 4G1PA 7FDRA 2VC0A 5KFHA 2X1BA 2WBRA 3DOKA 4KPCA 5ETSA 1LXJA 1Q79A 3JTOA 3K2YA 3O8WA 3RU0A 2UV8G 1TAQA 2C2EA 2D1CA 4DCOB 3EZ5A 2V4JB 1SC1B 1SKUB 1IBLF 4DSKA 1KVJA 1X9WA 2V4RA 4DUZF 3MR2A 3EM1A 3OTBA 3E01B 2DY1A 1ZZNA 2AV5A 3CNQP 5LM7E 2MYFA 2RU3A 2KYXA 2CQPA 4RU9A 3RB3A 1Q4RA 2O66A 4CM0A 4NYZA 2J8SA 1NRKA 1HL6A 2N82B 4MKYA 6AT1B 3H59A 3VWSA 2V8HA 3BPSP 2ZH8A 3SZ2A 3OTOJ 3V6KA 2DNYA 1S9EB 2C3OA 2DNZA 3N5FA 3RW6A 3S8SA 2Y1RI 3P8BB 3AJ1A 3V4IB 2GIRA 2Z58B 1Q8KA 4FN5A 3I56S 3KUGA 1WKJA 3Q89A 5AJ3J 1YZ6A 2RVJA 2YXLA 3DMJB 4DLGA 1RLDA 4I6WA 4RBTA 4Q44A 3T3FA 1HPZA 2CQ4A 2M70A 4BWJA 3ILJA 2DGQA 3JS9A 3OL7A 2GIQA 1S77D 2MEWA 4DL3A 2M9KA 1FX4A 1WTFA 2LDYA 3MM9B 1RT2A 2WVEA 3JAMY 1NJXA 2X3GA 3RR7A 2OPPB 2ZBRA 4X4SA 2BKOA 4X62F 3KDNA 2QYGA 1UMJA 4L6V3 4PG8A 1UEUA 2BMBA 5ETVA 4F4ZA 3P45B 2QZ8A 2XS7A 3M2RB 1GX5A 4LRBA 3MR7A 5E3RA 5E41A 4K2XA 2UUCJ 4TU8A 3J7ZT 1NB7A 4LF5F 2MJNA 4FZVA 2LEBA 2CDQA 2MJUA 3WIUA 2ZH7A 1A0OB 3P96A 1HHTP 4DPXA 1FDAA 4ZA1A 5CHCB 3ZZRA 4ILMA 1LWEA 1AZSA 2V69A 3JXOA 1W2BR 2UVRA 2MB0B 2B4OA 3PTWA 5B0FA 3VAFA 4GVLA 2KFNA 1JIHA 2YWKA 4NYPA 3IM8A 3DNCA 5HMXA 2YH0A 2NSBA 2D3OR 5HBMB 3IA0A 1APSA 1U1QA 2BM0A 4NLRA 2CQBA 3MEGA 4KH1B 1B7FA 2GMHA 2QV6A 3BSNA 2AEFA 3V6JA 1Q86T 1HQEB 2CJ9A 5HLFB 2X3DA 2AEJA 1V3ZA 1T9XA 3CDBA 3QIPA 4LR8A 3KLHA 3EGVA 3UFCX 2M5YA 5D4NA 4DCJB 1SVDA 2FHKA 1VFJA 3M32A 2D41A 2QLFB 3AXKA 2NXCA 2MQOA 4O3PA 2AMCB 3HFVA 5KT6A 3CCJS 3GSIA 3G96A 3GLJA 3DHWC 1RT6B 3DLEB 2LYVA 2AYEA 3MEDA 5DZ6A 2XM3A 2PI5A 5BJRA 4DWIA 2IRXA 1AROP 4WE1A 1H0HB 5KFCA 2BW2A 4M5GA 2M0GB 2B8PA 5LXYA 1BC6A 3OFHA 3AD8C 3DXSX 4ZITA 3G71S 2J8AA 1QD1A 4LSNB 4F4KA 2MKSA 4CRJA 2XNRA 2XCAA 2Y1JA 4B3RJ 2CQ0A 1JLCA 1WACA 3C14B 4NWBA 4F3QA 3T1YJ 4J91A 5D0GA 3EWGA 5A2QU 1WNEA 1REVB 2PMHA 1LK7A 1YG0A 3WHIA 1H38A 2JRSA 2KI2A 3PRDA 3I87A 2J0WA 4UZBA 2QJ3A 4P2XA 2VPYB 1U0HA 3T5LA 4NLWA 2IIHA 1D3WA 3OTEA 3VTIA 3SYZA 3FMBA 2RQCA 4ED7A 1U48A 4JV0A 4URGA 3KK2B 4A8YA 2OO4A 1NMEB 1U4BA 2B9EA 1PBAA 2BBEA 1M5SA 2LEPA 1PG5B 2M2BA 3FRYA 4FF2A 1R8CA 2CFXA 2AGQA 4LF9F 1AA1B 3MOZA 4N47A 3GFZA 5KFZA 4E8UA 1RDRA 2DRAA 3LO3A 1WC0A 2MQMA 1C0TB 3PFOA 3J81j 1T02A 2EC2A 2ZH3A 1YHQS 3OL9A 1FTCA 3IS9B 1JLGA 3POTA 1X9SA 2GAGC 3NNAA 4ES3A 2YKMB 2YX4A 3ITHB 4PAAA 3ZTQA 4HTJA 4B3OB 2XLJA 2JHEA 2QIFA 2EBEA 3MAHA 4Y2CA 4YB5A 4ZP7A 1TELA 1HWKA 3SFGA 3UD4P 3AA9A 4QYZK 2HHXA 4X4VA 2BANA 4NLDA 2KH9A 1DHMA 2BX6A 2WONB 4G1IA 3LUYA 5BR8J 1HI1A 3T5KA 2BOPA 4NLSA 1NZ8A 3LF0A 1TKXB 4HHUA 1MG7A 4L72B 4U6PA 1M90T 5F41A 4DU7A 1RTIB 3OVSA 1XMOF 4JUZA 3K0JA 2D74B 2OPQB 1HBOA 2LDIA 3MGJA 5ETRA 2ATCB 1ZM2A 3WIVA 5HMYA 4ED2A 1UA0A 2F4VF 1G2EA 3MF5A 4N5SA 1BWVA 4LIWA 3A13A 2OMLA 5DETA 3G8TA 1NK6A 3IG1B 3N79A 4WFAQ 1N36F 1MWQA 1B3TA 3RB0A 2VFRA 1T11A 2EG1A 3FUYA 2XMWA 4EFAC 2I0XA 2P6SA 3EUNA 3QFWA 4QQBA 3CD6S 2HWHA 2VKRA 4HEA9 5KFWA 1G7CB 1PBUA 2GFFA 5FDLA 2YQ3A 5AXNA 5J1PA 2VFSA 5B0EA 3TJ9A 4CLLA 3GU0A 4YR2A 5D0HA 3ZTPA 3JSYA 5D4LA 3J81U 4X64J 1UVNA 3R5GA 2KZZA 1D0EA 1E6YB 3B4DA 1X7VA 4QIFA 2KXHA 4NXNF 5L39A 3RTVA 1R6VA 3P4UB 4OZ0A 3BGOP 4OYZA 2QSFA 4HYKA 3PW2A 5FLXU 5F8NA 3HSZA 2ZM6F 1KBRA 3H90A 4HT5A 2N4CA 1CJVA 4KT0C 2ZE2B 1RT3B 3GB0A 3W5ZA 4DUYF 2QA4G 1BQXA 4J9SA 1FRXA 5KFAA 3L7OA 2FUG9 2QT7A 2O1PA 1T05B 1F9EB 1OY8A 1ZM3A 3EJMA 4DV3F 2DR5A 4ZJOA 2C42A 5L46A 4DFKA 1WG5A 4FS2A 2Z2MA 4S0MA 3TRGA 1YGYA 3N28A 3DOLB 3CWJA 1RHKB 5I4MA 4KR0B 4DV1F 3ILOA 1KFSA 1RSCA 2JX2A 1V5VA 2LQ5A 3L9ZA 4DSJA 5HP1B 1X4HA 4O3OA 1N0VC 4O0IA 1ZH5A 2MZ1A 2I2YA 1QM9A 4IG0A 4PYDA 1HBNA 2LQJA 2DD8S 3LALA 1OY6A 4OHXA 1UW4A 1SV5A 2UV8A 4DV0F 4YR3A 1NK7A 1UZDA 2AQ4A 5A8WA 2E5GA 2UXCJ 2HS4A 1G4CA 3KLEA 2EFGA 3IRWP 1XMQJ 1FXDA 2B43A 2M88A 1SL2A 2PSZA 4TLRA 3BYRA 2XO7A 2KXFA 4OMFG 2RH3A 5KTQA 2MLXA 1DBDA 1ACMB 2KJVA 4FXWA 4BDPA 1TV6A 2RHSB 4TYBA 5G0RA 1RK8A 1T3OA 3CIZA 1JLEA 1ZPWX 3F0NA 1C1BA 2BKPA 3NG8A 3JSMA 2XSJB 3QAEA 2J6SA 3LOUA 3ILIA 2Y9HA 1AUDA 4B9SA 3NRBA 1A6LA 3TNVA 4CLWA 4IO9Q 2AD9A 2MSTA 3AQPA 1WSVA 2XULA 4JI4J 1A7GE 3ZZTA 4CO5A 3T1AA 3U7JA 4NI2B 4GC7A 1S1TB 2P6TA 4B3SJ 2IDLA 2PA3A 4K4SA 4RU2A 4RW4A 4AQYJ 3SDEA 2PEHA 3TOQA 1FX2A 2RILA 4RW7A 4PR6A 1OJ4A 1WDTA 2BEFA 2R7SA 4MYTA 2JNJA 3IAS9 4TY9A 3UO0A 1NPKA 5DQHA 2CVEA 1Q7LB 1WHVA 1RABB 2G9OA 2VG6A 3B6BA 4ID5B 2HQDA 2QA2A 2ROEA 3MD1A 3B8HA 2E5HA 2HHWA 3BGRA 3M8SA 1F9FA 1F2GA 3ENQA 3OW2R 2PMZD 1MSWD 3ZNUA 4ED0A 4AD6A 3FDSA 2NLWA 2UUBF 1UZHA 4X4TA 1ULRA 1X4FA 1XNQF 3OVAA 1URRA 3QZ7A 5KG3A 5DG8A 2XMKA 4A46A 1H7WA 2ZUGA 4DFMA 3FSIA 1NCLA 2NXJA 1WHYA 4RNNA 1DLOA 2DCLA 3D6HB 1JKHB 4OIXA 5D15A 3IM9A 3RJMB 5F9LA 1HW9A 1FRLA 1RAHB 2OFGX 2E44A 2HQIA 1VI7A 3I6PA 1YDLA 3MM6B 2I6WA 5A8KB 2HHQA 1QTMA 1CLFA 2MKIA 3DGPB 1JLBB 1NZAA 2DNLA 1S1XA 3GYXB 4GVBB 2A6MA 4ZHRB 5GAEU 3LGMA 4KIAA 2PC6A 5IOLA 5D78A 1QVGR 4FF4A 1VIOA 2ZC4A 4RJVA 5DDQC 4CNZA 4LMZA 2V34A 2ATLA 3IXQA 4ED5A 5IC4B 4DX8H 4U9RA 4LSNA 2DPJA 1RAAB 4LF5J 2FD2A 4DBQA 4B3MJ 4USWA 1EJ7L 3EPIA 1XEZA 2W2NP 1X5TA 2F4FA 2VIHA 1R0AB 1PAUB 3RG6A 4ZVHA 2PD1A 3PZPA 2VDIA 2XZWA 1IR0A 2KN4A 4M5LA 5IM0B 1U8WA 4MIAA 2BRKA 5JVHQ 4O4RA 4BC7A 4JI6F 4B02A 2HIYA 4HDGA 3HPOA 1KWMA 1X4GA 1VQKS 3K89A 3R5DA 1RAFB 2V50A 1FKPA 2KM8C 4I69A 3NL0A 1IBCB 1TMMA 4BWMA 1S1UB 4MAKA 1JJCB 2YNIB 1VQNS 2VPWB 3BBFA 4F4AA 2Q43A 1M5VC 1FKOA 3IS9A 3POTB 2C2NA 4EBEA 5EWGA 2D69A 3D1QA 3MMBB 3AAWB 3C6TA 2XGPA 2BANB 2M3DA 4QWCA 5G4DA 4DPTA 1D8YA 4Q0BA 3M6XA 4QIGA 3SSRA 1LWFB 2YBVA 2J6TA 2FDNA 1VDHA 2B9WA 2DEIA 2FQQB 2G0IA 3R27A 4FPIA 2C2DA 4ZMMA 1HI8A 1R8HA 2QSWA 3DDNA 3PYDA 3H5YA 2K8GA 3PG9A 3EYZA 3BBCA 2DGVA 2G1DA 3ETMA 4OV6A 1WC3A 3MMCB 5KFTA 1GMWD 2W8KA 3R7BB 4UT4A 2DO0A 2FHMA 3IRXB 1UVKA 2HVEA 2YKPA 2F9JA 3KDOA 3MCNA 3QIDA 4XTTA 5IT0A 4EBCA 2O01C 4DOZA 3NWGA 1BXNA 5B09A 1X60A 4FKXA 5CQGA 4WJBA 3ZO7A 1S6QB 4B9MA 3OVBA 1RJJA 4JV5F 1KR4A 1NAQA 1R0BG 2AJFE 3H5SA 3V6DA 4DQIA 2F65A 4CO4A 5B0AA 1E6YA 3J7YU 3OJUA 1LQ9A 3GJRB 1R3NA 2DYAA 1WHWA 1VC5A 2KHCA 3R5BA 2AJ0A 1AT1B 4I67A 4YHHJ 1DRZA 5HO4A 2IM2A 1C1CA 2OEKA 3HJVA 2OP5A 2KB2A 4RR5A 2D3O1 1RKIA 5AXMA 1GK8A 3OFFA 1VGYA 3FSXA 2IY5B 1E6VA 3GYNA 5C24A 5SUHA 1SQFA 2KVQE 4RUAA 3UN5A 4NZ0A 1QSSA 4K4TA 2CPYA 1KTVA 2RDDA 3IR6B 2DGSA 2B51A 1RCOB 3KK1A 4A8XA 3LWMA 1ZTWA 2K3IA 4M5DB 3W5YA 5D3GB 5BR8F 4C8YA 3KLVA 1IQZA 4C3LA 1TVRB 2V2VA 3D54A 4FYXB 5B0GA 1MN7A 1J5OA 2E7XA 2RQ4A 2E1CA 2EWHA 4M8LA 1C4CA 4ILLA 4QZVB 2VU5A 3CXCR 2EBGA 1IM6A 3CJRA 3Q8UA 1R31A 4QR1A 2W25A 2YWFA 3C15B 4FKYA 3U02A 2OEJA 1CC7A 1JB0C 2GGPB 2HWIA 2OUGA 2AT1B 1N88A 2HEKA 1PC5A 3PYGA 4DR2F 3FRZA 2CRLA 3HFKA 3ONQA 4HDHA 2VQEF 4PYAA 2Y1LB 4IRDA 2NUHA 4C0HA 5B0DA 4JI1F 2BZ2A 2HSEB 2ZOMA 2A0FB 1UWBA 2W7AA 2RD5C 3IFEA 2W4CA 1T94A 2FJDB 3KXDA 5C42B 3CJKB 1GMWA 1VRTB 2XBPA 5CYQA 2E1PA 3KG0A 3I9ZA 3DN9A 4JB8B 1I94F 4MIWA 1BY9A 1M5HA 2GX8A 4UOHA 3CCSS 4OJ1A 4KKOB 3W8PA 3DHXA 3BSOA 2MSSA 2CQ1A 3SEOA 3EVOA 3KJFB 4FYWB 4RL1A 1OPIA 2JZ5A 1GQEA 5HAOA 5F8HA 3J81Y 2NPFA 2XY7A 4I2PA 4NLYA 4NLTA 4CO1A 3SQGA 4B17A 3PJ9A 4ZVFA 2AZ1A 2HHSA 4LF4J 5ETNA 1S1TA 1WWHA 2O67A 1UETA 3VZIA 1XTZA 3R5JB 4F50A 3Q22A 3CEDA 1KFDA 2HBYB 2DNPA 1Y4ZB 5T7LB 3THVA 2XWXA 3HZGA 2ZHAA 2IC3B 4H4MB 4J9UE 1NHVA 4NE9C 4OX9F 2IAJA 4P7TA 1HQUB 1REGX 4RW9B 3WQPA 3I4PA 3W64A 3KHGA 4N41A 3M30A 3ENAA 4RW6A 4MMOA 2VG7A 1CJTB 4ZPDA 3TA0A 3MFIA 4KHPF 4J9RA 2EPIA 5M2RA 4YEAA 3A8KA 1LW2B 1VRUB 1Q81T 4KGMA 1VQLS 3RB4A 1S0VA 2UXBJ 3G6YA 2QEXS 4DSEA 4MK7A 3KK3B 4ETZA 1XJWB 3NAHA 5KFGA 5F8JA 3CD5A 1HNIA 4KO0B 1JKHA 5HQMA 4F8RA 1RT1B 3UN3A 1DARA 3G4SS 4C7QA 2ZBPA 4QR2A 2OI2A 3NNCA 4NCBA 2VPZB 4LJMA 3VQTA 1KS2A 1FEEA 1RTHB 2GVDB 4ZPCA 3ZZPA 5CYMB 4MT1A 3A8IA 2FVRA 1TZ0A 4DUTA 3CJ0A 2JEFA 4TXSA 5C2GA 5I3UA 1WTBA 4UTGA 1ZM9A 4CYUB 3UCUP 2XG8A 4JI7J 1T03B 2DIUA 3B78A 3BZQA 2G2ZA 5LJ3Y 2P8IA 2H5IB 2BOAA 2QLXA 2ZDPA 2R9LA 1R8BA 4IKAA 4ERDA 3KLFB 3PW0A 4PXEA 5M2UA 3M2VB 4NXMF 1S57A 2HLTA 3DI6A 3W7BA 4WYLA 2ZKUA 4C3KA 2EK6A 2X1GA 4GC6A 2E5LF 4F04B 4AQYF 4K0KJ 1CEZA 4HL9A 2HRTA 2F4VJ 1T95A 2PIIA 5IM0A 2L9DA 4TYAA 2IMOA 2XZDB 1NDCA 5KG7A 4EU0A 5KFQA 2KG1A 2UXDF 2DNOA 1F1BB 1T9VA 3FJ2A 4DL7A 1VQPS 1NKCA 3VVUA 2YWGA 1K73T 1Y3KA 4ES2A 3BDEA 4ZP9A 3DKDA 2KFYA 4WP8A 2E5IA 3MMAA 2K1RB 3TX0A 5LXRA 1HMVA 5GAHI 3U27A 2GCFA 2F5GA 3KUEA 2MKKA 3NGTA 3OTOF 2ZH5A 5HROA 3KHLA 1W2IA 4ZPAA 4ED3A 3M2UB 5ETMA 1B70B 5HMZA 1RAOA 2N7CA 3TI0A 2GVZB 3WBZA 3LPEA 2AYMA 2DXDA 4J37A 4OJ3A 1WELA 1H3DA 5L9XA 3KWMA 4TNOA 1Z2ZA 1KOOA 2H4WB 3I0RB 1WF2A 1NU4A 3CCLS 2CJXB 1G3OA 2HBQB 4NCGB 1FO1A 1H73A 3OUYA 3ZFVA 4ZVEA 2BVZA 4I6AA 2RQKA 3W5XA 1ELOA 3WZ0A 4Q0BB 4GKKJ 1N6QB 2O3DA 2YPYA 3PW5A 1YRTA 2BJ3A 3BBBA 5E3AA 1UWAA 2KVIA 3TZXA 3K5NA 3AXMA 4NA3A 2WOMB 4Z2XA 4OYAA 1FEHA 2DHGA 1HNXF 2APOA 2WAQD 3M6WA 2FY8A 4U7UD 3IRXA 3R6GB 2IJRA 3WX4A 2DH8A 3BN4A 4CZCA 4OX7A 3F73A 4R8UA 3HHLD 1KEKA 2F40A 4PQUB 1MU2A 4OJGA 2OTLS 4F3OA 4J90A 3M8WA 4WBFA 1JLAA 2WZ1A 2DRDA 3PX6A 1U1LA 2DPIA 3W65A 2UVVA 5LOQA 1I1GA 1JXEA 4IO1A 4LR7A 3K59A 1AFJA 3DRXA 2WCXA 1GNKA 2ZBQA 3CB4A 4DV0J 3MAAB 1OQ6A 1D09B 4P6QA 4P75A 4TLQA 2EKNA 2RHQB 3RYLA 3Q8QB 2LFVA 2NYHA 5F0WA 5GMKa 3BJYA 4EO8A 5AXLA 1KKHA 3D68A 4WTOB 5K14B 4JBCA 2M7SA 3D1HA 2IFXA 2IA0A 5AE2A 1YJWS 3ET6B 2BM1A 4C4WA 4YB1P 3ZC4A 2CJBA 3F41A 3ILLA 1Q8IA 1QE1A 5DGAA 1NBEB 1B7YB 1D9FA 2MKYA 1PYSB 1RYRA 4XDCA 1QAXA 2DITA 4LRDA 4O4GA 4U7UK 2ZFHA 4A8SA 3E51A 1KP6A 2YQ0A 3JTPA 8AT1B 4YOEA 1RT5A 1SJ1A 3W62A 1X4CA 8RUCA 4ECQA 3JYTA 3THTA 4RNHA 1ZYQA 5D3GA 4QU6A 4ECVA 3UCGA 2FZGB 1Z2LA 3IBFB 1RWKB 1YIJS 2AJQA 4QIVA 1YJNS 4RPFA 4JI8F 3HSJA 2YKOA 2UP1A 1MWYA 3EDRB 1BQMB 1P8GA 3SBMA 3M6VA 2IA6A 1U6ZA 5FIIA 3N6NA 2RS8A 2EK1A 1IKYB 3C15A 3K58A 2XYGB 2F8MA 4HHJA 1R8PA 1X0FA 4G6VB 1XIQA 1NUEA 4QBUA 1BLUA 4A8QA 6FD1A 3I82A 3CW2C 4EUVA 2KXNB 5LSLA 2LMIA 1Y5LB 2NXNA 3HVTB 1HHSA 3CJKA 3EICA 2OSRA 4KGKA 3GV7B 2GQCA 4LF1A 1WKKA 2OMOA 3AODA 4U95A 1U7LA 1X8DA 4KKOA 1WC4A 1RB0A 1JLQA 3DLJA 3QT5A 2NPIA 3CCWA 4NLVA 2FHOB 2MY7A 4CM2A 3OXLA 4UF4A 4ZPBA 2CNNB 3D3CJ 2F8EX 1U1PA 1NJZA 4C3MA 2JEIA 2MDAA 4ZVSB 1ZA2B 4OYIA 4J9VA 5H9FJ 2AWZA 2YX1A 3H98A 2N3LA 2EFVA 3EVWA 2IC3A 4H4MA 3QSYB 1SC4B 3TJAA 4ED6A 3C8YA 5HATA 3RAQA 1TKTA 1S4FA 2NUUG 1U26A 2B7CB 2HIQA 1PILA 3DRYA 1J27A 3GE9A 4OX8A 4OYPA 2W9CA 1CJUB 1FE0A 1T9YA 2YY3A 4YN3B 3V81B 2R2TA 4DR6J 2E9TA 2F3JA 4KGZB 1F5AA 1PJ7A 1ZAXA 2B5JA 2DIVA 3BO3A 2MZJA 7AT1B 4O3QA 2I8EA 2OSQA 1H98A 1HWIA 2DH7A 3I5BA 4HR2A 3UR0A 1BMQB 1S0MA 2YKAA 1IWGA 4HACB 2NYIA 4K7QA 4CTAB 2YKNA 5A0YB 3CE8A 2VONA 2KT2A 4AXJA 4LR9A 1Y3JA 2FC8A 2KYZA 2RSQA 3PJXA 2CZ4A 2YTCA 5CD4H 1O6XA 2ROGA 5KG0A 1RTHA 2G0JA 4NZ7A 4CLTA 1FE4A 1YLXA 2CPEA 5CYMA 2SXLA 4C8MA 1VJQA 1M5PC 1I94J 2CJKA 1XNRF 5E3PA 2PDAA 1FTRA 5F8GA 4JI2F 3RRGA 1FT8A 1URNA 1TQLA 2X51A 4F26A 5H1SV 5IWAF 1Q8LA 2NZ4A 3JSBA 3NWRA 5ETLA 3DRPB 3C14A 2DR7A 4O3SA 3ZZZA 2BA9A 3GTYX 5J2QB 2POKA 2VC1A 4QR0A 4TN2A 2RRNA 4X4RA 4DV2F 2YNGA 4LF4F 3A3OB 3KG1A 2OPSA 3C16B 2VF3A 4NRTA 2EFPA 3I32A 3VGTA 5LSOA 1AW0A 4LQ9A 5KFPA 4E0DA 2B4PA 1PAEX 2BE2B 2JLFA 2BJ7A 2WHOA 3DLKB 5ETQA 1XC9A 1H2UX 2WW8A 3ZXWA 3I31A 4FPRA 1FWPA 5ETPA 4KTQA 5J2NA 1MMDA 2EW9A 3W8GA 4C8LA 1RHRB 3GP9A 1RBAA 4KHPJ 3Q8VA 4QW9A 4JV5J 2VD3A 1GAOA 2HRUA 3EPGA 4H4KC 4BHQA 1M1KT 2FVPA 4V19X 4MFBA 1F3FA 2LCWA 4AYBD 2MXYA 3KJVB 2VZ9A 3MM5B 2WVBA 2RDJA 3EGZA 2HQ3A 4GO5X 4P2FA 2Q3PA 2VFUA 2NS1B 1WF1A 1ZETA 4LF8J 5IT9U 1VQYA 3ISNC 4QCLA 1IUJA 4USVA 2IYIA 1RTIA 4L75A 5FD1A 3FBBA 3NAIA 4IG3A 4ANDA 4CH0S 3Q8SB 2R2SA 2UUCF 2VG5A 2XSFA 2QLJB 3RUBL 4LVOP 4TY8B 4K4XA 5HI7A 2WBMA 2DGXA 1Y10A 4P72A 3RGIA 4Y65A 2OPPA 3V5RA 3G6VA 4Q45A 3NS6A 1CULA 6FDRA 1HNZJ 1KTQA 9ATCB 3DRRB 2XQCA 2M8DB 3WC2A 3EDQB 4LFCJ 2AIRB 3NBPA 1S1VA 2FHJA 4CLZA 5C25B 4R8UB 3W60A 5EWFA 2V4QA 3G9CA 1B0PA 3E2EA 5K20B 3MHYA 3QAUA 4KRWA 5FDLB 2ZH1A 1KSPA 4IFVB 2IM3A 2DB1A 4OZ3A 4O3NA 4F0HA 1RT4A 1RQ0A 2IDEA 3QPIA 2IJFA 3SIPB 3M8PB 4RWWA 1PGZA 3KKFA 4IR1A 3TZZA 2NR0A 1CQNA 5J1EB 3VZHA 3PW4A 1R0CB 3L7PA 2CQ3A 2RDIA 1YSJA 2VFTA 5CZVA 3IR7B 1TK8A 4PUOA 3IGVA 4LRAA 1AZSB 4OI0A 2H4YB 1EAYC 3O1LA 4M5NA 1CJVB 4OZ1A 1JXVA 1QE1B 2MZRA 1KDNA 5A2QY 3L3CA 4IUFA 1ITPA 4IH5A 5F3TA 2GZOA 1TKZB 4X4NA 3SI8A 1IKXB 1DJ0A 4IDKB 1U25A 4DPUA 4WFBQ 4UY85 1LW0B 3UN2A 2QO3A 4BBYA 2QFIA 4P2SA 3R6LB 2A2DA 1UVIA 2ZH2A 4GKKF 4U7CA 3M9OB 4PG5A 1HQEA 5DM6Q 2LKZA 4DR3F 3CC7S 5BYRA 2AP6A 3KLHB 1U1MA 3HCXA 5HK4A 1BQMA 1GXUA 2U1AA 4GKJF 2HVHA 4JI5F 3GR0A 2Y8WA 2BW7A 1HNXJ 2C2OB 3C6UB 2HFUA 3LP0A 4W98A 4F02A 1HBNB 5IT9Y 2AGPA 1LWCA 2L9NA 4A8WA 3UDCA 2AHOB 2G2YA 5CABA 1VQ9S 2Q79A 3MEDB 5A8WB 3M8YA 1FRMA 1FFWB 1RWXB 2Q6CA 5HANA 4Y2KA 4K2JA 4Q2MA 3FQKA 5FJ4A 1WORA 5DQIA 2J9DE 2F9DA 3HKZD 3HKWA 1FXRA 1VHFA 4MKBA 4N8NA 4QWDA 1MMLA 4P2MA 1TUVA 2HHVA 3MPWA 1K1QA 1NXIA 1RAJA 4B08A 5CCLA 3PKYA 1M1GA 1KLMA 4AE5A 2Y0BB 2ASLA 2HFVA 3JSMB 3TYTA 2W7PA 1S79A 3PW7A 1QAJA 2H5JB 1TL7A 1JLQB 1EARA 5IQ6A 2HFOA 1S1WB 5C7PA 1VYAA 2XGQA 3IGNA 2VBWA 3L7UA 5E3QA 3T5JA 5KFNA 2RUSA 1NHUA 2QN6B 2HW3A 1HQ2A 5DLGA 1Y5IB 1RWOB 3KK2A 4C8ZA 3O3LA 2N7YA 1YI2S 1WEYA 4RW4B 4UQTA 1EKRA 1L5UA 2VOPA 3T1HF 2VODA 2HKEA 3D6FB 1VMBA 1RADB
chains in the Genus database with same CATH topology
2IBOA 5LMNF 4PG7A 2J0QD 3CCTA 3M8QA 3O44A 2V5HG 1C0TA 4ID5A 3KG4A 2VQFF 3QLHB 3DDKA 4MIBA 4EZ9A 4Q7AA 1CVJA 3N0VA 4G3IA 3QMQA 4B3OA 4K0KF 1T8EA 3N9UC 1HNVA 3H8YA 2AJ4A 1ZOTA 2B6AB 2MZQA 4IH7A 4DQRA 2VH7A 1VQ8S 1R7IA 2R2RA 2RQMA 2WONA 2ASYA 2MQNA 3D0IE 5L38A 2JFKA 3F44A 1HWLA 4OFZA 2GV1A 3TUIC 1D9DA 4EZ6A 3DGPA 4I4BA 3H25A 5KFUA 4ZHRA 4X4UA 2OKQA 3MTKA 3A1YG 1U6FA 3M4XA 3HMJG 3BQ1A 2DGOA 1Y00A 1S97A 4O3RA 1FCAA 4J9OA 1SC6A 4QWAA 2GC8A 2ACYA 2RKIB 5KT2A 3WDOA 1Z4UA 2HGLA 2ZD1A 4OHYA 3KNAA 3MM7B 3BN7A 2HGMA 3UI3A 2ZZMA 1YBAA 2FC9A 2CG4A 4RNOA 2DGTA 5U47A 1SUQA 1MMNA 4C8NA 4ZKAA 4I7FA 1Q53A 1YRXA 3LGNA 3T9NA 1QJHA 4M1KA 1LFWA 2GHWA 2ZE2A 3FNNA 4DL4A 2BDPA 3QWPA 1N5YA 3TVKA 4PG6A 1SXLA 3VAIA 1IKVA 2CQDA 1JX4A 4I1TA 4RNMA 2KTQA 1LV5A 3GSDA 2IVMA 2VASA 4NL5A 1UA1A 1N0UA 4Y6IA 3MTJA 2K2PA 3DU5A 1KQKA 2DH9A 5GAHU 3QJLA 5CYJA 3OR2A 2V9WA 1NO8A 3SFUA 3LH2S 5GADI 1XBWA 1D8ZA 4I2QB 5GVQA 1RTDB 3PY8A 2I5JB 3OFGA 4OI2A 4TQRA 3QZ8A 1DTQA 3TUJC 2DO4A 2CJQA 4ALZA 1JWWA 4DQSA 3L09A 4J9LA 5KFVA 3BO4A 1VBZA 2P9CA 1LXNA 1NH8A 2ZHBA 3H4DA 2XI3A 4DL2A 3UCZP 4XAKA 3ETOA 1Y5NB 2R7WA 2E1MC 3H5XA 3BF4A 1JLEB 2FJBB 1SQEA 2UZAA 1C1BB 1FRJA 5KFDA 4ECXA 1RTJA 5B0BA 4BS2A 3DOKB 1VQ5S 5MAOA 1SJFA 1NK9A 3GIJA 1Y0HA 3ZZ0A 2HS0A 3OR1A 1U1NA 1SH2A 1WHXA 3I0SA 1JXLA 2CQGA 5KFRA 1V9OA 3PV8A 2KT5A 3ENVA 4PUOB 1R89A 3SXLA 3OSPA 1HD0A 2D3UA 3J7YI 4USJC 3SDEB 4KC5A 3MECB 2VB6A 4DQQA 4YDDB 1TKZA 4DF4A 3P6YC 3X1LB 4IDKA 3UD3P 3K5LA 3OLBA 2WK4A 2E66A 3M9MB 3BGRB 4DV6F 4K4VA 3MEEB 1J5OB 4LF8F 3UNGC 4ZP8A 2ASJA 2KHDA 3FZ2A 4YQWA 2A1BA 2LLZA 5D4PA 2Q66A 4DFPA 1K9MT 1N4LA 2ZH6A 2MHEA 4ZCKA 4AUKA 3NKYA 1S0NA 4ECWA 2PI4A 1TAUA 1LWCB 5A8KA 1HBUA 1TL3A 1Q1KA 2A2CA 2GGPA 2M52A 2HLUA 3EXCX 1F0XA 4USIA 5KFKA 5LMUF 3H4BA 3VAGA 1DAXA 2HHHF 4LFCF 1RT2B 2LQBA 3Q8PB 1VK3A 1Q82T 4GMKA 1K8AT 4FYDA 4AL6A 2HFZA 1YJTA 3I9V9 4CH7A 2B7BB 4OV1A 2FLPA 2UXCF 3KOAA 3EZUA 1XMQF 2HYIB 5E7OB 1O8BA 2ADBA 1D1UA 2VKZG 4ECRA 3NMRA 2LU2A 3KLIB 4UQGA 2CIMA 3BS9A 2AJ1A 4IQMA 3US5A 3SQGB 1XERA 4CI0B 4DHVA 1RYSA 1LWEB 1GXLA 1SH0A 2UVWA 2EI5A 4WK3A 1S6PA 4FVMA 3SCLE 4J9KA 4JI4F 1UL3A 2JOQA 3MZIA 3RRHA 2HVZA 1F5BA 1X4AA 3QJJA 4NMLA 2B56A 5HBMA 4PWUA 3BM7A 2KO1A 3MEGB 3U1MA 3MEKA 2DNKA 2VG7B 1HA1A 2PGCA 3LP1B 4AL7A 4UW2A 3M1VA 1HNVB 2C3YA 3MMBA 2B3TB 3R5AA 4KV8A 1LK5A 3CULA 3M32B 3FSYA 4YUDA 5IFMA 4XO0A 1HYSA 3BGLA 3CD7A 1LWFA 3WC0A 3MAQA 5A8RA 2RF2A 3OBIA 5THWA 3CUNA 1P1TA 1RT6A 5T41A 1KD1T 3QYYA 4PPZA 2V8DA 4OX6A 2FB0A 2Z8QA 1RWUA 4WE1B 4URSA 5EUHA 2LA6A 5E0OA 4YHHF 2VA2A 2J9CA 3OXFA 2CPDA 1OS5A 2W8LA 3P5TL 3RBEA 3PX4A 4DG1A 2FGOA 4R5PB 5KFIA 1IKWA 4ATNA 3MMJA 4I6YA 4QPXA 5KOWA 4KHMA 4A8FA 3GIMA 2Y1IA 1REVA 4H54A 2DRBA 1O0PA 2XC9A 1ZPVA 1EETB 3AH6A 2C3MA 2HFNA 1T7PA 1HNZF 3VALA 4YP3A 2JC1A 3GV8B 3E2EA 1TL5A 4DL0C 3EX7B 3N6LA 2CPXA 2JSXA 2IYGA 4I64A 4X2BA 3SSQA 4DL6A 1CSJA 3QJPA 2VBYA 3K5PA 2N3OA 5HROB 1YJRA 2ADCA 3AB4B 3M2UA 5K5MA 1TP7A 4FP9A 1JLGB 2L9WA 2R7OA 1OSDA 3VR1A 2YNFB 3GR1A 3MM8B 3H2UB 4G1QB 4J5OA 4UOCA 4HLBA 1S9EA 2V94A 3OR2B 2ILZA 3GFXA 3KLGB 4I2QA 4HVZA 4D3HA 1HBMB 3DRSB 5I3PA 1N6QA 2HNYB 3SMZA 4PWDB 2RT3A 5DRKA 4KB7A 2KJWA 2MQLA 2W24A 1FXLA 1YJ9S 4QW8A 1FA0A 1I6JA 1HBOB 2WOMA 3DOMA 1JK9B 3MM9A 4OLOA 2ZOFA 3MURP 1BQNA 3HLUA 4CIOA 4DFJA 3FFIA 5EN1A 3PRBA 4DV5F 3K57A 2UVUA 1R43A 3IG1A 3CCQS 1UWBB 3BEGB 2XHWA 3D0GE 1HARA 1NJIT 5BYQA 3S7RA 2ASDA 1KLNA 2VBZA 1RTJB 2ZNZA 1TK5A 3PIOQ 3V4MA 4I2PB 1UFWA 1XMBA 4OJHA 3AQOA 3AY0A 1FNOA 1X5OA 3D0HE 3P49B 3B82A 1MWZA 4IOAQ 3O6QA 1N56A 4PG4A 2W4DA 2CQIA 3MECA 1X9MA 4NCAA 4WCEQ 3NP5A 5AXKA 2NREA 4ZPWR 2R7VA 5KT3A 4A8OA 2R7RA 2DK2A 1J5EF 3FCHA 4RW9A 2B9YA 2D7SA 3HHEA 4DSLA 1K0TA 2BABA 4NX9A 4HH0A 1SH3A 2JL9A 4IQXA 2I1RA 3LAMA 3C2PA 4C11A 3QIPB 4R25A 3TUZC 5J2PB 4YFUA 4XPCA 3TAMA 5HP1A 1VBXA 2GJ2A 4DN9A 2KT3A 3PXGa 2VFVA 4F3MA 2AU0A 1S99A 4IG0B 2DNNA 3CDUA 2HHPA 4N76A 1DQAA 1VLYA 2QYCA 1SV5B 3CD0A 3MWBA 3MI7X 3OSNA 2QRRA 3M8RA 3KLEB 3D2WA 1YTYA 1LFPA 1VIXA 3T19A 2HG4A 2RJZA 4F67A 4DPOA 4B9NA 5KFXA 4WFXA 1U24A 1SKSA 1P1LA 2HAIA 3DLGB 4IFYA 4DSIA 3S6EA 1NJYA 3OPKA 3PKMA 5K8MA 1CC8A 4DV7F 2R8KA 2GO9A 4EYHB 5KFFA 4Y2IA 2ZJQQ 4LSLA 3QGPA 1LKZA 2ZNYA 1G1XA 1KRPA 4WF9Q 3OL6A 5DG9A 4A48A 4XIUA 2F7VA 3LP2B 3NLCA 2R8HA 4ZDNA 1T3NA 5HMWA 1N33F 3RZAA 4A4JA 4K4WA 3BDPA 1YWXA 3MUTP 1UVJA 5K8NA 4W92B 1VQ7S 4RW7B 3SV3A 3VAMA 4N56A 2E7WA 1FK9B 2OFHX 3DLLQ 4NZ6A 2NSCA 4LT6A 1SJ4P 2R8GA 1H6KX 2W9CB 5KT5A 5EHHA 1OSCA 2GQQA 4X66F 3I0RA 7FD1A 1MNEA 5IQQA 1ZTTA 1AXQA 4Q8FA 1NKEA 1DTTB 3CDEA 3I96A 2RU9A 5DS7A 2UXBF 4B3TF 2YKNB 5A0YA 2WTFA 4DR5F 4Q43A 5SZTA 4JI3F 4Q8EA 4CH1A 4LUBA 1S1XB 1H2VZ 2OLWA 1L3SA 2BQ3A 4EWTA 4QWEA 4MTPA 1UEVA 3RAMA 1HNWF 3GFYA 1FJCA 4WFYA 2XMTA 1SIZA 2A10A 4DG1B 1RISA 1ZM4A 1FESA 4UUWA 4Y2MA 2DNHA 4M95A 4PQUA 1IKWB 4IRCA 3CT9A 3DRPA 2OD6A 2JH3A 4Z37A 2YNHB 5DO2A 5I42A 4OZJA 5J2QA 4Q5VA 1XN9A 1AFIA 2FGCA 4FBTA 4YMEA 2GJIA 2E1RA 1DZ5A 5HQ8A 2DHAA 4NLUA 1S48A 3F56A 5K14A 2BE2A 4OZLA 1X5SA 1V3RA 1KOHA 1JNZB 4QU7A 2ALZA 2FJEB 2FHJD 2JFDA 2XWYA 4ICLA 3VF0B 4HI1A 5J2NB 2R8JA 1M5KC 3KHHA 2JWNA 1S1UA 2E5JA 3C66A 5CXTA 3W2VB 4IRKA 1OPZA 4KAIA 4M63A 4F4WA 4DSFA 1FKOB 4RX6A 4MFBB 1VJWA 2D9PA 3MM8A 4G1QA 2QLWA 2LXIA 3G8SA 3SCJE 2G13A 2J5AA 4DV4F 1RA7A 2WSFC 3RB6A 4IR9A 5J2MA 2X1AA 2K7JA 2FVCA 4C98A 2DNMA 3KLGA 1SJ3P 2DBBA 3ZZOA 1FVQA 4WZQA 3DLHA 1HBMA 3DRSA 2HNYA 2R7XA 1IKYA 4DS4A 2IHR1 1TL4A 2LVWA 1NH7A 5KFJA 2A3JA 5IZHA 4WU2A 3CJ5A 2VG5B 1TFYA 4RW8B 3IR5B 3ISZA 3IBWA 2M4MA 3FFIB 5JVGQ 2FVSA 3PACA 5DG7A 1N5QA 1GTHA 2GA7A 4PQAA 3NBPB 2GMLA 5LL6d 3T6JA 3NCRA 1TV6B 2PO4A 2C22A 4LQ3A 2CPIA 4YB6A 1UFLA 4NLQA 4KPYA 2XMMA 4KFBB 3IN5A 4M94A 4DLEA 4WFNQ 2IBKA 4X4OA 3NCPA 3S1TA 4HKQA 3E8OA 3TR5A 3QWUA 3KHRA 3IAM9 4YY3F 5B08A 4DN0A 3UW1A 3CDAA 5KFLA 2L08A 2WB4A 2Y0SD 2ZJRQ 3Q8RB 2JDJA 4B9UA 1WI6A 4J9QA 1Y9OA 2MMYA 2KZMA 1RI7A 2WSCC 1U1RA 3HJFA 4IOBA 3PIPQ 1TKTB 4RNFA 3IO1A 1U1LA 1C2PA 3K8VA 3ULHA 3THPA 2XY6A 4M5DA 2GO8A 3KYLA 2R7UA 3ZZYA 2KU7A 4KQZA 3OJSA 5EDWA 3C46A 4WIIA 4A47A 4ZS6A 5K9FA 2Q1LA 4KSEB 3IWLA 3GFHA 3TX8A 1DURA 3TAPA 4ED1A 3TAMB 2JLEA 2YKQA 3CCVS 5KT4A 2F8HA 3CMAS 2MZSA 1V3SA 4OHZA 4DQPA 1S0OA 1JLBA 2BXJA 1KNZA 2VL1A 2XMJA 4K5SA 1Q8BA 2V0NA 2UUWA 1R6YA 4B3RF 1U47A 2HGNA 5CCMA 1VQ6S 3DLGA 2IM1A 3NS5A 4OI4A 1N5SA 2OPRA 5BYSA 5ITHA 4O23A 4CO0A 5AJ3F 2JEGA 1H2TZ 2KRRA 2FLOA 1FDNA 1U1OA 4CO2A 3RBDA 5EWEA 1G6BA 2J0XA 2OPSB 4DEZA 4WFZA 4B9TA 1S9GB 1N5VA 3E3XA 2JVRA 3OQ2A 1NKBA 2RRBA 2JC0A 5C5JA 2ROPA 5JXSA 1IM4A 5ADZA 2HHTA 3FEYB 1SBRA 4K4UA 1VQ4S 3D1OA 5T7LA 3BGFA 1R27B 4NLXA 2IRYA 1C0UB 4ILRA 1SKWA 3HHNB 2HNDA 5EGYA 3BR8A 5KOXA 4P7VA 2VV5A 1FK9A 1EP4B 3M8QB 2IAJB 5KAKA 2D9OA 1HQUA 2DNGA 3HF5A 4QPTA 5DDPC 3QLHA 3DYAB 2HMIA 3M30B 2XCPA 3KJVA 5KG2A 1WI8A 2EFOA 4D3GA 1KHWA 1LW2A 1VRUA 3OLAA 5HLFA 2B6AA 1VBYA 2E9RX 3NGKA 4Y34A 2R7QA 5KG6A 4X4QA 1VQMS 4KHRA 3LANA 1HNIB 4DR6F 4DMZA 3CCMS 5F8MA 3DLEA 1SL1A 5JUMA 4C9DA 5KFEA 4F2RA 1KC8T 3HHLB 2V8VA 3MOJB 2AX0A 4PKDB 3FZBA 3DRRA 3OTDA 1U2RA 2J0SD 2FLLA 1MW7A 1U1KA 1SJRA 4X64F 2AX1A 1T03A 1GXTA 1NJWA 1HR0F 2OAUA 3L95X 4DDFA 3UE2A 3G6ES 1RT4B 3M2VA 5I3QA 1IBMF 3CGIA 2UUAF 3FMWA 5J1EA 2FPHX 5E2QA 2BRLA 1HFEL 1FJEB 4Y2AA 4LVNP 5E5NA 2WSEC 4YB7A 5EX0A 1FNXH 1B0VA 3E01A 4ICLB 2K1RA 1HMVB 1RKJA 2EKYA 1QVFR 2AW0A 1X4BA 2V8GA 1IKXA 2ZHOA 3TP2A 2RRAA 1L3UA 3BQ0A 3IWXA 3PM9A 1UKUA 3Q2SC 1RA6A 1YJVA 3ITHA 2CQHA 4ZCLA 1NNDA 2W9BA 3PHEA 1K0VA 4ZVGA 4DS5A 4IYQA 4NCGA 2XMUA 3CMES 1UJ5A 4MYUA 4EYIB 1UVLA 3DMJA 2PE8A 5KFOA 3NMAA 3A8EA 2VA3A 1R8AA 2OPQA 4ECYA 1YVFA 1X4DA 3FVYA 1YRUA 2VBXA 2WRMA 3CVKA 4C97A 3Q24A 3RRKA 4OL8A 4DR1F 3SCKE 4UUXA 4NA2A 4ED8A 1N8RT 2CVIA 2ILYA 1S7HA 2KM8B 1VRTA 5CYQB 1S9FA 3M2RA 2P9GA 4TKTA 2BACA 3TANA 2H9ZA 3BQ2A 3H40A 2KG0A 5F0UA 2XI2A 2ABYA 3HVAA 4KFBA 4KJIA 5F3ZA 2ZBIA 3BGUA 3HI9A 1B64A 5DM7Q 4N77A 1QUPA 1WD6A 2MY8A 3N5BA 2L41A 4Y28C 3H5UA 2B4VA 1JNRB 3SV4A 1ROFA 2J7WA 2RE1A 5FLXY 4K50A