2EG2A

The crystal structure of pii protein
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
112
structure length
95
Chain Sequence
MKKIEAIIKPFKLDEVKDALVEIGIGGMTVTEVKGFDFLPKVKIEVVVRDEDVEKVVETIVKTAQTGRVGDGKIFIIPVEDVIRIRTGERGEQAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Nitrogen regulatory protein P-II
publication title The crystal structure of PII protein
rcsb
source organism Aquifex aeolicus
total genus 23
structure length 95
sequence length 112
ec nomenclature
pdb deposition date 2007-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2eg2A00
2EG2A 1Q1KA 1XK8A 3TA2A 1VFJA 3M05A 2PIIA 5D4PA 3NCPA 4D3HA 4CO3A 3BZQA 4RX6A 4CO5A 2J9DA 1V9OA 1V6HA 5D4NA 4CO1A 3AH6A 4CNZA 4YB5A 3TA0A 3L7PA 3OPKA 2J9CA 2VD3A 2XULA 2XZWA 4WK3A 2ZOMA 4WK1A 1PILA 1NH8A 1P1LA 4NYOA 3N5BA 5D4LA 4CO0A 4RWWA 4YB7A 2NUUG 1UKUA 4AFFA 2XG8A 1H3DA 5L9NA 5D4OA 1NZAA 3T9ZA 2XBPA 4IYQA 2EG1A 3NCRA 4D3GA 3LF0A 3AA9A 1V3RA 3DFEA 4USJC 1QY7A 4R25A 1NAQA 4USHA 5DRKA 1GNKA 1UMJA 3MHYA 3O5TB 2J9DE 2Z0GA 2ZFHA 2DCLA 2JJ4D 4E98A 1O51A 3AHPA 2GX8A 4YB6A 4C3MA 3CE8A 2NS1B 3X3UA 1V3SA 1NH7A 2O67A 4OZNA 4OZJA 4C3LA 4RLEA 1OSCA 1VHFA 4CNYA 4Y65A 2O66A 1J2VA 4RWXA 2GNKA 3NCQA 3HLUA 1UFLA 2CZ4A 2J9EA 3TA1A 2E66A 2V5HG 4ZK7M 2GW8A 3GSDA 4CO2A 4OZLA 4USIA 2NUHA 4C3KA 1KR4A 3O8WA 1O5JA 4NYPA 4Y6IA 2RD5C 4CO4A 3AA8A 1HWUA 5DS7A 1UL3A
chains in the Genus database with same CATH superfamily
2HURA 3MMJA 4JV1A 2DIUA 4OJ1A 4EGLA 2F3JA 3LA0A 2VJUA 2FHOB 2ZVIA 3G82A 2QFIA 3IS9B 1P9YA 4M5JA 2W25A 1S6QA 5KG7A 3GYGA 5B0AA 2DXDA 1VS3A 3DLGA 4TLQA 4FF2A 4Y00A 2HGLA 8ATCB 1HBNB 4ZVUB 4EWTA 4OL8A 4DV0J 2OD6A 2VFVA 1XC9A 3I96A 2RDJA 4HTJA 2CNLB 2ZC4A 5K8PA 1NPPA 4DPWA 5BXIA 3KDOA 4QBUA 3OUYB 5LMUJ 3QGIA 3R6LB 2MLZA 2OSRA 1T9VA 1TU0B 2NZ4A 5GAHI 1ZTTA 1HNZF 1FJCA 3LUYA 2WRMA 1GXTA 3I55S 2F8EX 3MZIA 1FO1A 1FE0A 2EVZA 4TLRA 2XYPB 5F8LA 1IM4A 3V4IA 1IUJA 3MEKA 4K4TA 2B9YA 5F41A 4XIUA 4I1TA 4DFPA 2IVMA 4WFYA 3LH2S 3NGRA 5KFDA 1GMVA 3O8WA 3HP6A 3TUJC 4AQYF 4WKRA 2CQCA 3PW0A 1UJ6A 2UUCJ 4RU9A 3MPDA 2DITA 2IM0A 1X7VA 2XYHB 1TFYA 5K9FA 4CO1A 4ZN3A 1W7WA 4A47A 4ATNA 1U48A 3M30B 4C7QA 4RW4B 1FXRA 4LF2A 1WHYA 2B5JB 2QJ3A 3ILIA 3N5BA 2M5YA 1U45A 1RAEB 3CCMS 2Y1LB 1FHTA 3IAS9 4HI1A 2YPZA 1OPZA 3RB3A 5L1LA 4JI8F 3P3DA 4KFBB 3M8QA 1T9YA 1TL7B 3C6UB 2CPIA 2HVZA 4PXBA 1G7CB 2UZAA 3I4PA 1B64A 2H5IB 2YY3A 4XPCA 3L3CA 1EQ0A 4ZHRB 4CM2A 2HBZB 2KHCA 2P8IA 3IWLA 3N6LA 1OQ3A 3W66A 1JK9B 4UW2A 3SFGA 3CD6S 2R7UA 1V5IB 4C8MA 2M8HA 3PEHA 5D0GA 3CDBA 2PDAA 1WF0A 1M5SA 1KS2A 2RNEA 3PFOA 1HBUA 3M2VA 3TR5A 3VAKA 3FDSA 5LJ5Y 3I5BA 1ZZFA 5ETMA 1KRPA 2FLPA 1T9WA 5L1IA 5KFRA 3O6QA 3HFKA 4UOFA 1JLFA 3PO5A 3MDFA 3BQ1A 3TJ9A 1WEYA 4PYDA 2BACA 3CJ8A 3CJ2A 5K14B 1X60A 4F4KA 2XMMA 1NJYA 4ZMMA 2AYEA 4A8OA 1DLOB 2QFJA 3KJQB 3M8ZA 4ECQA 4N8OA 3KKFA 3D0HE 2R8IA 4WE1B 1RGVA 3GP9A 4DSJA 1IQZA 1WHXA 2V4JA 3R7SB 4DV5F 1HFEL 3TZXA 3ETOA 2XSJA 2X51A 3OVBA 1X5PA 3NBPB 3KNGA 4HI2A 2J7WA 3VGSA 4KYZA 4BDPA 4M5LA 2VKRA 2AZ1A 3NG8A 5DM7Q 4EK2A 5F8NA 3MR5A 2R9LA 4LF4J 5HBMB 4C8NA 1RDRA 2XLJA 3FSIA 4HTIA 3BH6B 3M9NB 3F41A 2IYGA 1WELA 1J5EJ 3DOKA 4U7UD 4Q2MA 1KFSA 4DF4A 2G2ZA 4NLOA 4MIWA 2UVWA 3PFEA 5DLFA 4V1Ak 2QA4S 4OZNA 1TAUA 5ITHA 1BWEA 1BD6A 3EPIA 2VG7A 1DARA 2V2ZA 4KY3A 1RWOB 2R7QA 3AD7C 1WEZA 2HNYB 2ASLA 3VVTA 2CDRB 4YHHF 1S72S 2K8GA 3CJKB 2AX0A 1XJWB 2V2KA 3I0SB 4C48A 4P2MA 3MUTP 1LWCB 2YVSA 2G9OA 4ZPAA 3A8KA 1Q16B 1T9UA 5CHCB 1RHRB 1CJTA 2GJFA 3CW2C 1RT4A 1IBCB 2CJBA 5CCMA 2J6TA 2GIQA 5D77A 3V2UC 5LSRA 3W8PA 2BM0A 5RUBA 4I69A 1ZS6A 3CJ3A 2WSCC 4QWAA 4IH7A 4ZVRB 1F9FA 5LXYA 1O51A 1CLFA 5HLFA 3V6KA 3R7BB 3FRYA 4PG4A 1BXNA 3UDLA 1BGXT 4CLFA 4NZ7A 2N7CA 5A6WA 4FXWA 2QA2A 4C98A 4Y28C 1S77D 4LFBF 3MAAA 2KDOA 1FRJA 3RYLA 2NSBA 4WXWA 1VC5A 1P1TA 1Q1KA 1T9TA 1GEHA 1Q0NA 3ENVA 1H2VZ 3O3LA 3A12A 4IH5A 4OX9F 3FQLA 4HT7A 3UD3P 5HROB 4OYPA 1YZ7A 1RHJB 3PEJA 2ADBA 4FS1A 4NLRA 2YWGA 2KU7A 1R31A 1H3DA 2WSEC 2FIUA 3JB9k 3DRPB 1RHKB 3IWNC 3K58A 3RTVA 3HHLA 2BANB 3W2WB 1SUQA 2KG1A 4UY85 1Q5VA 3MMBB 2HWTA 2HRUA 3EPGA 4B9TA 3P45B 1V3SA 5AXKA 2EK6A 4X66F 2GHPA 2MQLA 4PG6A 3EGNA 2YKMB 4DV4F 1SCJB 2PA8D 1HNZJ 3ISNC 1KR4A 5C25B 4RKUC 1M0SA 2PFDA 2BW2A 2IY5B 3NAHA 3D6MB 3MEDB 3G6ES 1VOMA 2CQGA 3RR8A 1PCAA 3QT5A 1EIYB 1R89A 5CZXA 3I9V9 3N9UC 3ZZ0A 4JI6F 1NDLA 2OHDA 2XC9A 2QLBB 2HGMA 1TKZA 1RADB 3G96A 2IJNA 2LECA 5F8GA 3D66A 1V3RA 1PKUA 2M0GB 1QY7A 3AD8C 4KAIA 2MXYA 3HXMA 2HVIA 2OPQB 2WB1D 1NNDA 3H4BA 4L76A 1PJ5A 4OI4A 5KFCA 2FYXA 5SUHA 2IIHA 1NK4A 4DMZA 4JI8J 2WSFC 4KJIA 1FVQA 1RTDB 4P71A 2KZZA 2D69A 3VAFA 2BRLA 4USIA 1QUVA 1E6VA 2ADCA 1TELA 3KHHA 1FT8A 3GR1A 2E1CA 2V0NA 2YPYA 4H54A 1Y3JA 3ITHB 2ALYB 3KJNB 4P6QA 3R2DJ 3N6MA 1B7YB 1YK9A 3KJVA 2XEXA 8RUCA 5H9FK 4AYBD 2CNOB 5A0YB 2ZE2A 1S10A 4ZJLA 4UOCA 1PYTA 2XBPA 3QATA 1W25A 3C8YA 4B3TF 3PG9A 4DL2A 4C9DA 2FZCB 1RACB 2CKWA 4YMEA 2UUBF 3CB4A 1T02A 2MQ8A 2ZKUA 4B3MF 5CYQA 1LWFA 4DPYA 5KFPA 1KSPA 4O44B 3HVWA 4RW7B 2QMUB 3M7VA 4JI1J 1J5OA 4OI0A 3IM8A 1AZSB 5E33A 3M2RA 1RISA 3J81Y 1HARA 1RTJB 4EI2A 2V69A 3CCUS 2H4WB 3BSNA 1C1BA 1BWVA 3FEZA 1FK9B 3TOQA 1MROB 1HYSA 1EETA 3DRRA 1JJHA 5GVQA 1UPPA 3BEGB 4WFNQ 2UUAJ 3QO9B 2C3PA 4DI6A 3R5AA 4NLPA 2CG4A 2JLFA 4Q8EA 3N01A 4N41A 2BVZA 2HQDA 2HQFA 3MD1A 3H2UB 3LTOA 3LP0A 2K3IA 3PW4A 3CPWR 2JNJA 2MGZB 1FWLA 2Q66A 1RHQB 3MR6A 4A4JA 5J2QB 2I38A 3EWGA 1IN0A 1Q5YA 4BWJA 4P2FA 2ZH7A 1XQIA 4ZP9A 4Y2AA 1ZM2A 2GVDB 4OZ5A 4TQSA 2P6TA 4OYMA 3FBCA 1QSYA 1T05A 4QWEA 3QFHA 2ATCB 2L08A 1S1WA 3OTBA 1L3KA 3PRDA 4CWBA 2R2SA 3GJSB 3FBFA 5F9NA 1EJ7L 1JJ4A 3N4WA 4KBIA 1WC3A 1RKJA 1QD1A 3C46A 5DS7A 1N6QB 4NXMJ 2N7YA 1XBWA 3CD0A 2ZNYA 4DJBA 4LMZA 3K5NA 2HHQA 1MMLA 2AW0A 3BN7A 4YHHJ 2VODA 2ZOMA 4I64A 3G6YA 4BC7A 4Q0BB 3LAKA 1EARA 4IO9Q 2AJ4A 3UW1A 3CCQS 1JXVA 5I42B 3UWTA 1RLDA 2HAFA 3Q2TC 3QT6A 2AF6A 3O5TB 3AXMA 4O3NA 2DH8A 4WU2A 2DCUB 3VAIA 4GKKF 1X8DA 2VIHA 4PQUB 1UWBA 2OPSB 3R5CA 3B8HA 4LR8A 4YR3A 1N5VA 2DXEA 3FFIB 1VQ5S 4NL5A 1E6YA 4DV2F 4DN0A 3HKZD 2P6SA 4DPOA 1D09B 5B08A 3CCVS 5C24B 3GU0A 1W26A 1IKVA 2HVHA 2GHVC 4Q8FA 4CT8A 5J1PA 2RHSB 1ACMB 2V9WA 1FX2A 2MKCA 4LFBJ 4ZS6A 4RZRA 1C0TB 3OFHA 2WONA 1Y00A 2BQUA 4NLQA 1TVRB 4DSKA 2LVWA 1UKUA 2KXHA 1Y5LB 5KFNA 5A8RA 2GS8A 4BS2A 1S1XB 3KK1A 3KOAA 2A18A 5KT6A 2ZH5A 3CCLS 3CCWA 2ZH2A 2GQCA 2VZ9A 4PZVA 2D3OR 4MT1A 1VQKS 2Y1RI 1B4SA 5HQ8A 3BPSP 4DPUA 3SCJE 2J0QD 2FLOA 5BYQA 2DNYA 4J9MA 2ABYA 1RWKB 2VV5A 2JFDA 2VQEJ 4CLLA 4G6VB 4ZVEA 1RT3A 4FDFA 4DR7F 5M2RA 2GO9A 4FXDA 3HJVA 1HBOB 1TQLA 1U6BA 1U1QA 4NLSA 1R6VA 3IAM9 4WFXA 1RTIB 5DO2A 1CQNA 3VGTA 4DV4J 1LW2B 5J2NB 2IHR1 3MEEB 1NJWA 4LIWA 2E9ZA 1DTTA 3TW0A 1FKOB 4B3OA 3VAMA 4DX8H 1D8YA 1M1KT 2MYFA 1RT6A 4ZOSA 2VBYA 4TYAA 4QU6A 3CF5Q 2W2PP 2OEJA 4FPIA 5KFJA 3J7YU 4C8ZA 3KLGB 3Q86A 1A6LA 4JI6J 4KO0B 4ZVQB 1SL1A 4M8LA 3KK2B 4P9SA 3EX7B 2V94A 2VL1A 4DWIA 3E3XA 3CE8A 4CCHA 3UE2A 2GMLA 1XNQJ 4ALZA 2ZC3A 3EZ5A 4IR9A 2RVJA 4TKTA 4Y65A 3OL9A 3IN5A 1FA0A 1OMSA 2YWEA 2J5AA 1IKWB 1FNMA 2ACMA 1WKKA 3IC1A 1RAGB 1CBKA 2FHKA 4C8YA 1S1UB 1S4FA 2HHPA 5D8HB 3G87A 3S01A 4RPFA 3QQCD 5D0EA 3UQSA 2XLIA 3DYAA 4F4YA 4J91A 3W65A 4DQPA 4MTPA 3VF0B 5ETVA 5E41A 4S0MA 2ZOFA 1EAYC 4CTAB 2ZH9A 2MZQA 4YB7A 4ZVHA 2EBEA 2IBOA 4B3SF 4KGZB 4GVBA 1FWPA 1ULRA 1G3OA 3BB5A 3HT3A 2E29A 2XM3A 1I94J 3C66A 4TU7A 4IUFA 2O3DA 4J5OA 1Z2LA 2ZFHA 4R8UB 2UXCF 4MFBA 2MMYA 4ZJQA 5KT2A 1R43A 3SIPB 3MEGB 2HFUA 2HS4A 4MH8A 4B3TJ 4JBCA 3DLGB 2UUBJ 3R1LA 4R5PB 1WTBA 4B3MJ 2W9CA 1IKXA 1O5JA 4L74A 4O4GB 1NK5A 3D4JA 5EX3A 3UCUP 1VQ8S 1OWXA 3PHEA 5HI7A 2W2NP 2RH3A 3VAHA 1R7IA 4USTA 1BQXA 1M5VC 2WOMA 4M5DA 2G1HA 1TZ0A 3MI7X 3CJQA 3NGTA 4HL9A 4ZPVR 1P27B 5DDOC 3JSMA 4NRUA 1U0SA 1WC1A 3T5HA 3V4IB 3L09A 3ZZPA 4ZPWR 2LXIA 3LOUA 3E8OA 4PG7A 1NLKL 3OTDA 1RT2A 1WD6A 5GMEA 2VU5A 1U2CA 2DGVA 1RTHB 1HKAA 2FJBB 2XY7A 2BE9B 4RW8A 3EGWB 3PACA 3K8WA 2QG9B 4LJMA 1B0TA 4PAAA 4IDKB 1CULA 3QGPA 5EX0A 4FYXB 3QIDA 2CA9A 2XCPA 2RS8A 2HQ3A 4HH0A 4LF8J 3JSBA 2CJYB 2XWXA 3R5GA 3TQEA 1DBDA 3HFVA 3ZTRA 4YB1P 4NASA 4UOGA 2MLXA 4DX5A 1PO6A 2Y3YA 1CG2A 3UPFA 2N3LA 3FSYA 3T41A 3MMAA 4YEAA 1VFJA 4C0HA 1SC6A 2D3ZA 1HMVA 2ZDPA 1R0AB 3OLBA 2XS7A 3KUGA 1M5KC 2B4OA 4ILMA 1F5CA 2KVIA 2RIJA 3CMES 2W8KA 3A8IA 1G4CA 1XR6A 4DCJB 1KQSR 3IS9A 2V34A 4ED3A 2J6UA 2MKKA 2GC8A 4DSEA 2L9WA 5MLCV 3J7YI 3BO2A 1UTAA 5MAOA 3TYTA 2DRDA 1V5VA 4XK8C 1ZM9A 3KFWX 4HDHA 1HBNA 1R8BA 4M95A 2EBGA 4QIFA 3AQOA 1S1TB 4O0IA 2LQJA 1ZM4A 3F56A 2CPDA 2E9RX 4JI7F 1UFWA 1ZZNA 1WTFA 4RUCA 2BJEA 3MECB 3GILA 2VBZA 4RNNA 3H5SA 3DRSB 4LQ3A 3DLLQ 5J2PA 3LPYA 2E66A 4ELVA 1NEEA 1VJQA 1SVDA 2ROEA 4PR6A 4GKKJ 5KFGA 4NX9A 1FE4A 4CLSA 3SSQA 4NXNJ 3G4SS 4EU0A 4X4RA 1JNRB 3PIPQ 4ZLLA 1SJ1A 1FI4A 2IFXA 4DV2J 2FUG9 3K17A 3TZYA 1U4BA 4M5NA 3BGLA 3Q2SC 4LRAA 4NLYA 5DGAA 1Q8BA 1PILA 2OO4A 2NYHA 1FRMA 2LA4A 1DFDA 4DXLA 3G8SA 4CIOA 3M30A 4DLGA 1YRTA 3FC9A 4RW4A 2CQHA 2PEHA 4QIWD 3RAXA 2B5JA 4C6AA 3DGPB 4GC7A 2BW7A 1KVIA 4TY8B 3OL6A 4L3NA 1JB0C 2OGUA 4IG3B 3BYRA 4HHJA 4KFBA 4TNOA 1TL7A 5B0BA 4L72B 3VQTA 2YBVA 3C16A 3OSPA 2Y8WA 2ZH4A 4MK9A 2OFGX 2W2QP 3OXGA 1VHFA 1JLBB 3T9NA 3EVMA 2D3UA 4RWXA 3BO4A 2DYAA 2IM2A 1YVFA 2WVBA 4URSA 1X4FA 4AD6A 4ZHRA 1PG5B 3HJFA 4ZCMA 4ZN1A 2W7PA 4U6PA 1S1VB 4ZLNA 4OYIA 3OSNA 1RUSA 3ZZTA 4ZDNA 1U2FA 3W3SA 4RL1A 3S1TA 3SV4A 1PAUB 3NWGA 3VGUA 3T3FA 3PYEA 5HQMA 5L46A 2A0FB 1GTEA 4YB5A 5JVGQ 1RAHB 1Y5IB 2E1RA 3MTKA 2UVUA 2XZTB 4W92B 3I87A 5T41A 1H98A 1NKEA 2DNQA 3NCRA 5F8MA 2HK2A 3SYZA 1UP1A 4MKBA 2HNDB 3J7A1 2D74B 3R8YA 2DHAA 3CCZA 4EMDA 3V81B 1AROP 4N5SA 2RQMA 2UV8A 3G8TA 5KFSA 3GIKA 2JZ5A 5K14A 2FC8A 5B7WA 2VPYB 2JC1A 1MU2A 1RWUA 5IT4A 1DLOA 5LM7E 2W4DA 3TAPA 2AEFA 1OYDA 1B3TA 1RKIA 2ZHAA 2MHNA 3OT9A 2R2RA 2XMKA 4I6AA 2R7SA 2WCXA 2L9DA 4WJBA 4MKVA 3MM6B 4K59A 2RMLA 2PIIA 2BQ3A 1DZ5A 4KT0C 1QLNA 4J90A 3GFHA 4KV8B 5LL6d 3UR0A 4CNZA 2I8EA 3NBPA 2OEKA 1XERA 4ZVOB 5D0RA 4ZP8A 2F40A 4NEYA 5HAOA 5HBMA 1VBYA 1NZAA 3CEDA 2N4CA 3JYTB 2XI3A 5CAAA 1F1BB 2ZHOA 4LBHA 2K06A 5LMNF 5KG5A 2QLJB 1N36F 2XI2A 2DCLA 5IV3A 5A8KB 2BXJA 4YB6A 2DR7A 4RBTA 1R6YA 4RLEA 5E3AA 4F3OA 1S12A 1S7HA 3DKDA 4G1QA 2XS2A 2W9BB 2CQ0A 2E44A 3OHBA 4EBDA 2LFVA 1VBKA 1YJ9S 9ATCB 2MQNA 4QWCA 4XAKA 1YGYA 4ZPTR 3ZTSA 3GLJA 3DGVA 4E8UA 2G2YA 1GTHA 2GZOA 3NY0A 2HNYA 1KHVA 4HHHA 2F4FA 2HBRB 1U2RA 5D4NA 3CJKA 1OS5A 1DRZA 3I0SA 2O5DA 4JI4F 1H74A 1T3OA 2RAQA 1LWCA 1FX4A 3NLCA 2A2DA 2FY1A 3FQKA 1KHWA 5GMKa 4QCLA 3OVAA 1XMQF 1F6TA 1IKYB 3E51A 2PI4A 4ZPBA 2E7XA 1Y3KA 1XN9A 1YLXA 3SCKE 1XEZA 2QYCA 2HHVA 4ED4A 5FLXY 2Q6CA 3AHPA 2G0CA 4X4NA 1KQFB 2NXNA 1RZMA 1SKWA 3NNAA 4F67A 3Q89A 4NOHA 3QGHA 4O4RA 3EZOA 3MR2A 3DU6A 3H2VE 2BMBA 2MZRA 1LKZA 4ZCLA 3L4BC 2IJRA 4B08A 1UA0A 3BDPA 3PRVA 3H25A 2IYIA 1QVFR 2ZNZA 3MPUB 4OHXA 3F44A 3BF4A 1C0UB 2COLA 1NSQA 2ASDA 4K4UA 4LSLB 1XR7A 2QMXA 3RAQA 3QFWA 2V63A 4DSFA 4FF1A 2AGQA 4MYTA 3HHLC 1VK8A 2QTWA 2K1RB 4DUZF 4DPXA 4DR5F 2WB4A 3K8VA 3GQCA 1N56A 1NH8A 4GO5X 2FGCA 2B3TB 2GQ2A 5HROA 3O44A 4WP3A 2E5GA 3CO0P 2GVZB 1VQMS 1YKWA 3DRPA 2ATLA 1SIWB 2RU9A 2R7TA 3LPEA 2BANA 2RUSA 2FVQA 2CPYA 2KH9A 3D2WA 3IMQJ 3MM7A 3MMBA 3MAHA 3TZZA 4C11B 2OH2A 1FF2A 4K5RA 4E2FB 4JI7J 4OYWA 1XMBA 1UEKA 3ETMA 3J7AN 1MSWD 2YKMA 1PC5A 1Y9OA 1K9MT 5C25A 1XNRF 5KFBA 2HMIB 3MEDA 1H72C 1VRTB 1W2BR 1TUGB 2WK4A 3DDNA 3RU0A 3RRHA 2DO4A 1Q7YT 3K57A 1G6BA 4OI1A 4Y2KA 2XG8A 3UN2A 2KRRA 1FJGF 1KVKA 4TN2A 1Q8KA 3RGIA 1UVNA 2F4VF 2AJ0A 3GIMA 4CLKA 1C1BB 2QYGA 3KNAA 1F3FA 3C2PA 1EETB 1L5UA 3DHWC 4C8KA 2JJ4D 4J9KA 1IJEB 2E7VA 2V4QA 3FK4A 4RO0A 2XMAA 1RABB 3GE9A 5EHHA 2ZBIA 5DG8A 2OPQA 4OMFG 2ZBCA 1IXKA 3I31A 4CLUA 4ELUA 3CMAS 2KFNA 4CO2A 2Z58B 4MKYA 4FVMA 3J80U 2YQ0A 1RTDA 3PX0A 4NZ6A 4KHMA 2ZJPQ 4H4MB 5DETA 4DR3F 1QSLA 2F5GA 4QZVB 3ITHA 4A8QA 2DGWA 1UAWA 2W4PA 1T9XA 3QMQA 2YQ1A 2ZWPA 4FN5A 3CMQA 2CQDA 3D6FB 4L75A 2J0XA 1OIAA 3WX4A 3UDVA 1VI7A 4TYBA 3THPA 1SL0A 2HS0A 1U7LA 3Q83A 5A0YA 1Z2ZA 2OAUA 4X4QA 3GJTB 4GO7X 3BM7A 4K0KF 3QWUA 2YNFA 3W7BA 5C2GA 2IDEA 4NLXA 4C0BA 4WYLA 1MG7A 4Y2CA 3NOCA 2YNHA 1CS4B 2CDQA 1SXLA 2HWIA 2EC0A 1S48A 2ZM6F 2M88A 4O44A 3ZO7A 3D6HB 2CFXA 2Q3PA 4N76A 1AZSA 3VALA 4LQ9A 5CD4H 4ECTA 1RTJA 3LGNA 1BLUA 2KVQE 5FDLB 3TA2A 4Z2XA 1WSRA 1WKJA 2MKHA 5KFYA 1WC5A 1FK9A 1BY9A 2R2TA 5A6PA 4WTOB 2YKAA 4B9UA 2MZSA 2ZBQA 2J6SA 1UWBB 2EPIA 2J7KA 4U96A 3D3CJ 2HHHF 2CXEA 4ECXA 3QO9A 1VJWA 5F8JA 1Y0HA 5HJYA 4QYRA 4NWBA 1NPKA 3H40A 2ACYA 2RB7A 4BC9A 3T5KA 2W7OA 4L6V3 3C6TB 5IS2A 1IR1A 2ZKTA 1EP4B 2RUGA 1WSVA 2KG0A 5ETSA 3OTCA 2MGZA 2E9TA 5BYSA 4OZ1A 3SXLA 4RW6B 5J2QA 2DNHA 3CJTA 4X4SA 1SJQA 2DXFA 1QTNB 3UCGA 2GVDA 3KUEA 2RT3A 3EXCX 2O66A 4MAKA 4WPAA 5LMNJ 1I6JA 1UFLA 1N36J 3D5MA 1N32F 5H9EJ 3BO3A 4LUBA 1ZA2B 1K1SA 2M3DA 3KK1B 5CD4A 1JLGB 2RRBA 2KYZA 4ANDA 4CYUA 3F73A 2H3EB 2OD4A 1RT7B 4ANCA 3CIZA 3MPYA 3IP0A 5LSLA 2XY6A 1N6QA 2HAIA 3MTJA 2GAGC 2IMWP 2PD1A 5IQ6A 3KK3A 3H8YA 1DQ9A 3W60A 5I4MA 4PRFA 1X4GA 2WAQD 1T0TV 3CXCR 4ZIWA 4F0HA 2Z30B 3P6YC 3K5PA 3OFEA 5GADI 3U7JA 5AT1B 4LRFA 1YSJA 4JI4J 4ETXA 2BJ9A 4Q0BA 3P5BP 3EXYA 1B0PA 4F36A 5F8HA 5I42A 5D3GB 3D54A 2W9AA 3KLVA 2DHSA 2FDNA 3B4DA 1IR0A 4F2RA 1XMQJ 4OHZA 4CT9A 1NO8A 3FBEA 4DV3F 4F4ZA 3TA1A 4PQUA 3N79A 1U6FA 1NMEB 2DEIA 1I51B 3MWBA 3AJ1A 3TVYA 2RKIA 2HVEA 3UVJB 4BWMA 2OP5A 4M5HA 4OI6A 1ELOA 3CD5A 4D3HA 4CO3A 3EMTA 4J9QA 4AE5A 5HJXA 2WVFA 1S5ZA 4OI2A 1WHVA 1FJEB 3I6PA 3CJ0A 1QSSA 3HPOA 2CG8A 5KT3A 3BREA 1IBLF 4LRBA 2LEAA 5I3QA 2JVOA 4YQWA 3T9ZA 2RRAA 3PDNA 3EDQB 4GKJF 3M6WA 1C0TA 3PKYA 3ZXWA 1X5SA 1TVRA 1HA1A 5C42B 2RDDA 4WYWA 2VHGA 4EEYA 1MW7A 4DR5J 5KFMA 1VQOS 4OFZA 1M5OC 2FHMA 2IJFA 3IG1B 3RG6A 3DYAB 1NSKL 2CADA 3G9CA 1RHUB 3DLJA 1FEHA 3PNIA 4P73A 3QBCA 2UUTA 2CQ2A 3VV2B 2DNRA 5IC4B 2EKYA 1VLYA 3GG1A 4TU9A 1WC4A 4LR7A 1S49A 3W5XA 2MHEA 3UDEA 2VDIA 3POTA 3PJ9A 1HBOA 1V9OA 1XR5A 4F3QA 4MFBB 4DCOB 4RUBA 4DQQA 1RTIA 2J7UA 3H59A 3LQVA 1P1LA 2P9GA 1LW2A 2W1BA 5J2NA 3MEEA 5L8RC 4D3GA 1QAYA 1XNRJ 1GMUA 3HD2A 4B9NA 5H9EK 3NNHA 3SCIE 1IKXB 1TL3A 2MTLA 4F26A 3K59A 3HVTB 1JXEA 2LQBA 3DMJB 4H4OB 3QZ7A 3QT7A 1XMOF 4ECUA 3KLGA 2F8HA 4KO0A 1FJGJ 1H2UX 2P9EA 3KK2A 3WX8A 4I4BA 4CDIA 4C8OA 2F4VJ 4M5DB 2V8DA 3BGRB 3TJAA 3EICA 2H48B 4ZP6A 3NL0A 2M52A 2V68A 2DKOB 5JUMA 3K2YA 3HDSA 2H54B 3FUYA 1IKWA 3IXQA 5B0DA 3M2UB 3RJMB 1S1UA 3CDAA 3D6TB 1V6HA 3ZZUA 3WIVA 1MWQA 4BCAA 3K5MA 4ED7A 1TL5A 1N48A 2XULA 1RQ0A 2VA3A 5AE1A 1R0BG 4PYAA 3HK2A 4I7FB 3DM2B 3HSDA 3SSRA 4KH1B 2G1DA 2MZTA 4MK8A 4DR3J 1K1QA 4CTAA 3D67A 2DK2A 4A8WA 1KEKA 5EWFA 4USHA 2C3MA 1SI9A 3QJPA 2QL7B 2CPHA 1I1GA 4I2PB 3OR2B 1PYOB 2NXEA 4I0WA 2DRBA 2H5EA 4PWDB 4OYAA 1LXNA 1MN9A 3Q8SB 1R8AA 1TR0A 3CDUA 3GWCA 3TEHB 1U1MA 4R8UA 2BOPA 3HM9A 4K0KJ 3M32A 4UUXA 3HHKA 3ZNUA 4IRDA 4OZLA 3L7UA 3T1HF 1ROFA 5KFHA 3MEGA 3THTA 5KFTA 1ZETA 1RWVB 2QV6A 4UF4A 3NXZA 3M8PB 3VQSA 2V67A 4R5PA 3TARA 4O4GA 3TVZA 4M5MA 2B9XA 1QJHA 4A8KA 3ULHA 3ZTQA 1UJ4A 1Q8LA 4FYYB 5KFLA 4ZPCA 3PKMA 1MWZA 3ZZOA 4F4XA 4AFFA 1WOOA 4UY8T 3JTNA 2DISA 2UU9F 5J2PB 1NXIA 2EK1A 3AB4B 1HNVB 4XPEA 4USUA 4CLPA 3QSYB 3K5LA 2A6MA 2MY8A 4MK7A 1TMMA 4HKQA 5IM0B 1HNWF 1QUPA 1VR6A 2FB0A 4ECWA 2VC0A 5HMWA 2CVIA 1DJ0A 2LQ8A 4M5GA 3WQPA 2MJUA 4LVNP 3GV5B 3JTOA 1RTHA 4B02A 3SSSA 2YWFA 3GYNA 4LF5F 4KH0B 1EKRA 2DNGA 3JTPA 2HBYB 1FRKA 4IDKA 2BOAA 1YBUA 2C3UA 2JH3A 2PO4A 4OJGA 3RUBL 1LWXA 1HWJA 3TZWA 2MKJA 3MFIA 2EC2A 2XNQA 1HL6A 2OELA 1D0EA 1YRXA 1U8SA 3R3TA 1N32J 3QLHB 1IJFB 2VD3A 3C16B 1ITPA 2NR0A 1R0AA 1SL2A 2JLEA 1F5BA 1NK0A 5LOQA 4OLOA 2DT9A 1RWPB 4ED2A 4AL7A 1V3ZA 4IYQA 1PJ6A 3MMCB 1JLQB 4LF9J 1B0VA 4F0MA 3NRBA 2XTJP 2QSFA 2VG5B 1WNEA 4HDGA 3GZ7A 4F0KA 1S1TA 2V8VA 4YR2A 3PXGa 2PA3A 4O3OA 2W24A 2BJDA 5KOWA 1HPZA 4FYWB 4HEA9 2CRLA 3MECA 2DH9A 2PC6A 3ZNJ1 1X4EA 3DLEB 2C2EA 4IOAQ 1YX2A 2IRXA 2J0SD 3AA8A 3DRSA 5C5JA 2FVPA 3R2CJ 1OYEA 4X62F 4BBYA 4QU7A 3T6JA 2EKNA 4DV3J 1SKSA 2GIFA 2CIMA 3LGHA 5HN0A 4DL0C 3ISND 2YWKA 2JEGA 3EGVA 4A8MP 4RR5A 2CNKB 1X4HA 2R2UA 1MU2B 4TQRA 3H5YA 4DU8A 4ZVGA 1NK8A 2ZBPA 1YRUA 3QNWB 2N3OA 2DGOA 2JFKA 2WBRA 5ETTA 1HNIB 1UFKA 4PWUA 2AYMA 1IBLJ 4CZCA 2G0JA 3DGPA 1TKDA 3HKWA 2VC1A 1IQTA 4TY8A 1DURA 3P5TL 3T19A 2R8GA 1UVIA 2YH1A 4WIIA 1SPBP 4IG3A 1TK8A 4LF6F 1UJ5A 2V8HA 1A9NB 1OJ4A 4QWBA 1U0HB 2MDAA 4HR2A 2DO0A 2W7AA 1JLBA 4YDXA 3KLFB 3BS9A 3FZ2A 1ZOTA 3J81j 3TWZA 5F3TA 2DH7A 5KOXA 2EEYA 2C2MB 3TX8A 1CQMA 1NKBA 2VOPA 1WOPA 4K2XA 1S1VA 7AT1B 4LR9A 3OL8A 1FNOA 4Z7YA 1SQGA 4A8YA 1JLAB 1M1GA 1D3WA 4U9RA 1YWXA 1HHQA 4DUYJ 4NCGA 4CH1A 2ZDOA 5IC6B 4G1QB 5D15A 5F9LA 1SC3B 3D28A 3BGUA 2VF3A 2B0GA 2LA6A 3X1LB 4KIAA 2L9NA 4DF8A 2OJ3A 2DTJA 5DJBA 3CJ4A 4E98A 3VAJA 4JI5F 2V8PA 2JLGA 2HNDA 2R4FA 3OBIA 3UI3A 1AT1B 1IBMF 4DSLA 3V81A 2Z8QA 1N0VC 2JL9A 5B0CA 5THWA 1XMOJ 3ZFVA 1RWWB 3FCHA 3GV7B 3RAMA 2RD5C 2IM1A 2X7IA 5DDRC 2ZD1A 3QJLA 4DL7A 1P8GA 3IRWP 1VC0A 2QO3A 2IRUA 4CO5A 1SC4B 4P7VA 2ZEJA 3C15B 1VQ4S 3MM6A 1RBOB 4DX7A 1WG1A 1FXLA 4IQXA 4DG1B 4KV8A 2XMWA 4KTQA 5H9FJ 2WVCA 3DOLA 5JXSA 2K7KA 3EVWA 2F63A 2HWHA 3JQJA 3LWLA 2ZH3A 1IWAA 2LP4A 4EBEA 2A2CA 3EZUA 2VFUA 4OYXA 1X4AA 1KQGB 3JYTA 3NKYA 3RRGA 2LYVA 2MEWA 1ZAXA 3GV8B 3NEKA 5CH7B 2VDHA 4PQAA 3EJMA 5A8KA 2UUWA 2XY5A 4FKYA 2J9EA 2HLTA 2UP1A 1F9HA 5EUHA 5ETPA 3D1HA 3IBCB 3RBEA 3EYZA 3JSYA 3K89A 4AL5A 4NLVA 3Q8YA 2DY9A 1X0FA 2KN4A 2W9BA 2IA6A 2XLKA 5HVGA 3CNQP 3OQ2A 1PGZA 3BV8A 4DQIA 1BE4A 4KE5A 1CEZA 1DQ8A 2UVVA 4MKAA 3T1HJ 5K8NA 3QGGA 4O3PA 4FNHA 1D9DA 4MMOA 3SQGA 1PBUA 4DV0F 4B9SA 3MM7B 2CJXB 2FVSA 4PUOB 3KG4A 4Z7CA 2C2DA 2GA7A 1WDTA 4JOUA 1H2TZ 2M70A 1EB0A 2WZ1A 5I3PA 2EW9A 2V50A 4ED1A 1NK6A 1H73A 1IKYA 3R1HA 3G6VA 3Q24A 2UU9J 3R27A 1FDNA 1Q86T 3O1LA 4ELTA 2RRNA 3PZPA 5T14A 4UT4A 2CQBA 2M7SA 2NXJA 1OY6A 2DGTA 2BJ3A 3CCJS 3KMSA 1L3VA 4X4VA 4ECRA 2UUCF 3EGZA 1UL3A 3BGOP 4AQYJ 2IMOA 2Z2LA 2DRAA 3LO3A 4U7UK 2KI2A 2X1BA 2D3O1 1L3SA 3CGIA 2HIQA 1QDUB 1YZ6A 2EFQA 1C0UA 4EO6A 2BQRA 5DLGA 4LSLA 4DBQA 1YTYA 3J81U 5J2MB 1FDDA 3GCWP 4KGKA 4CO0A 4RWWA 4WP8A 2K1RA 2Y9HA 4KRWA 1BQMB 1RA6A 4HT5A 3AOAA 1C2PA 2B6AA 3GSIA 4AL6A 4M94A 2KRBA 4P72A 5DM6Q 3VZHA 1WORA 1VQLS 1NAQA 5EN1A 5L1JA 4LF7F 1N5YB 4HVZA 4PPZA 5DGBA 3C14A 2GVZA 4DS5A 1AUSL 3D9BA 5IT9U 2E5IA 3H42A 4BHQA 1BQNB 2GNKA 3RW6A 3MFHA 3A4TA 1TUWA 1S9EB 1BHNA 4C11A 3UNYA 3H7HB 4ZVTB 5B0EA 3OLAA 1LW0B 4PCQA 3UD4P 4WIQA 2A6OA 4DDFA 4HYKA 3BZQA 5JJBA 2YNFB 4DU7A 1WF1A 2ZJRQ 4DV7F 4DL4A 2VONA 1GT8A 3V6DB 2C28A 4YS2A 4R0JA 2YNHB 4KB7A 4OV1A 3RZAA 2HMIA 2VFSA 3N0VA 5HVFA 3B82A 7FD1A 5E3RA 1VRTA 2VFTA 3IFEA 2B56A 1RAFB 1M1HA 3GPAA 1QAJA 1T03B 5E3QA 1VMBA 2FY8A 2BJ8A 5HO4A 5EWGA 3BBBA 1RAOA 4X4UA 3VVUA 3G86A 2BKPA 1URRA 4QPTA 2BKOA 4K4ZA 2DY1A 3JQMA 1KTQA 1S9FA 3B54A 4IFYB 2VKZG 3KYLA 5KT7A 2DGXA 4DV5J 1K73T 4Q44A 2HRTA 1X4BA 2YQ3A 3HD1A 2LEBA 3L7OA 1C1CB 3T1YF 4QWDA 4OX8A 3NCPA 4LF6J 2ZUAA 1RYSA 2X1FA 1TL4A 4ICLB 3ZZYA 1VISA 4H4MA 2KTQA 1K8AT 2LQ9A 1S4EA 2HHSA 5HQLA 1UCNA 4QIVA 4UOHA 1ZA1B 1J5EF 4DQRA 2BE7D 3IR5B 4USJC 4ETZA 4FP9A 4DN9A 3CDEA 3MURP 3MOJB 1RAJA 2ZBRA 2Z0GA 3WDOA 4CYUB 1U1LA 1N88A 4B9LA 3PM9A 3OHAA 1O8BA 4CH0S 4KKOB 4DL3A 1FKPA 2KXFA 3KK3B 1T7PA 1Q79A 5M2PA 3MOZA 5J1NA 2AYBA 2M4MA 4GVLA 4XO0A 1CS4A 4NEZA 2GAHC 1NBEB 2C2RA 2E1MC 2RQKA 4ES1A 3SZ2A 2M8DB 1XK8A 5IT0A 1IBMJ 1HQEB 2GFFA 3Q8VA 2UV8G 1NM2A 3EVOA 2VBXA 2B8QA 3DLBA 3BQ0A 3OFFA 3AH6A 4NE9C 2IC3B 2XMUA 5FDLA 4OHVA 5HVHA 2VPZB 2WVDA 4IRKA 2B51A 3PIOQ 5CYMB 2QL5B 2QT7A 1SJ3P 3HO1A 1UW9A 3CCSS 1A7GE 4URGA 4FF3A 5A8WB 1PYSB 4J9PA 2ERRA 4U7CA 3LP1B 4HH1A 2F7VA 3US5A 4V19X 4DV6F 2C1EB 2L48A 2CAJA 3MM8B 2VFRA 3NS5A 3CC4S 1RK8A 2RKIB 1EHWA 3H20A 2OIHA 1F0XA 1KVJA 4DR1F 4DUTA 2GGPB 3C6TA 4QR0A 1HWIA 1WI8A 2OFHX 1EP4A 3GR0A 3IA0A 2WW8A 3GIJA 1HI1A 4RW6A 2R8JA 2QIFA 3LAMA 2FLLA 1DTQB 4M5KA 1NSAA 1VLOA 4EUVA 3OTEA 2PMHA 4RJVA 1GH8A 4V19J 3M9OB 3AOBA 1Z1ZA 3VCDA 1R8PA 3WC0A 1DAXA 3BKFA 2VG6A 1JLGA 3DU5A 2D7SA 3U1NA 2DPJA 4OX9J 4F2SA 5CXTA 1RT7A 1SH3A 3FZBA 3QPIA 5HP1A 3ENQA 3P96A 2MLYA 2C2ZB 5KG1A 1HQ2A 2BA9A 2YWWA 1VQ9S 2ALZA 2XZDB 3ILLA 2BM1A 3POTB 1ZAVA 4TXSA 2FTRA 4X66J 1YJWS 5KFEA 1HHTP 1B7FA 2AGOA 5ETQA 2V2VA 1BC6A 5D3GA 1JWWA 2JEJA 4XDDA 5KFUA 2FPHX 3KWMA 2IPOB 1FKAF 2EWHA 3KHRA 4FBUA 1MMDA 1F2HA 1Y5NB 4IFVA 4G3IA 1MN7A 2E1AA 1TL3B 2RQCA 2B9EA 1G1XA 2DNOA 3I0RB 4IG0B 3UVJA 2PEBA 5KG0A 2P9CA 2WTFA 1X0PA 1RBAA 2H65B 4CI0B 5AE2A 1LQ9A 3MPWA 1X5TA 4Y34A 1TL1B 2JDJA 2IAJB 2C3OA 7FDRA 4K5SA 3TP2A 3HHEA 4DZ6A 3BR9A 3UDCA 2YNGB 1CC7A 1S97A 4L73A 4OQJA 3U1LA 3DOMB 5C42A 4ED8A 5CYJA 1T3NA 1XIQA 2RS2A 3W2VA 1URNA 2AX1A 2LU1A 3OL7A 1NB2A 3IG1A 4LF7J 1SJFA 2QEXS 2OEMA 1VQPS 2HHTA 1U25A 4NYPA 2XGPA 1DY3A 4ED5A 5T7LB 3CSKA 4MJKA 1S0MA 4DEZA 4J9VA 4O23A 4J37A 4NI2A 2DVIA 4JV0A 1LEOA 4NA1A 2CNNB 4W90B 2LQ5A 1F3VA 8AT1B 3LP2B 1N4LA 3OW2R 1YI2S 4NYOA 1N52B 2MSTA 2HZVA 3CD7A 2AEMA 4AXIA 3M32B 4ITSA 4U8VA 1X9MA 2Q43A 1NCLA 4DV7J 2C42A 1UW4A 3AODA 1KNZA 1TKTB 2Q79A 5HANA 4K4SA 2LLZA 3KMQA 5JMNA 2J9DE 2FJXA 2B4VA 2C3YA 2AGPA 1TP7A 3CDWA 1VRUB 4KC5A 4JI1F 3BBFA 1H0HB 3PRBA 1U8WA 3HVTA 2QMWA 3DMJA 4H4OA 2V8GA 5J1EB 3TANA 2HHXA 2OLWA 1D1UA 1ZBTA 4HACB 2F9JA 3BGRA 3DN9A 1UETA 2MQPA 4X4TA 3MM5B 1RU2A 3N5FA 5DQIA 3BGFA 2YKNB 3NS6A 4RW9B 1TFWA 3M6UA 4WTYA 2UUAF 3AOCA 3HMJG 3HHNB 3LALA 1REVB 3BKUA 3TA0A 2JEIA 1JX4A 2Z2MA 3M2UA 2DHXA 2N82B 2P2CB 2V9KA 5AXLA 1FFSB 2CVEA 4WFZA 3T1YJ 4JV5F 5KAKA 2I5JA 2R42A 1LWEB 1P9QC 1FD2A 1KDNA 4I56A 4I7FA 3DM2A 5E2QA 3J7ZT 4JUZA 5GAEU 1TK5A 4C2MA 2KZMA 1VDHA 2R7OA 2FC9A 5HK4A 2GQQA 4J9SA 1AFJA 3FMWA 1I5OB 3K5OA 2H51B 2Y1JA 4JI0F 3GMGA 1SV5B 4I2PA 3OR2A 5K20B 4Q45A 2PMWA 1S6PB 4PWDA 2YNIB 3RBZA 3IRXB 1S9GB 3PCOB 4I67A 2CPEA 1J27A 4FF4A 1FERA 4NXMF 2QSWA 4M1KA 2HFOA 1VBXA 1T11A 2XWYA 3VGVA 2EI5A 1PIEA 1N5QA 1QVGR 5IWAF 5AJ3F 2HEKA 1ZM3A 1RCXB 1VCTA 3M8PA 3CJ5A 1WOSA 1RAIB 1EX8A 2BE2B 4WKYA 1U1NA 1U1KA 2C2KB 3TUPA 5KFQA 4IQMA 1DHMA 1JXLA 1HPZB 3ISZA 3LF0A 4F02A 1U47A 3K7RA 2G13A 3PJXA 5I3UB 4KGXB 2VJVA 2QA1A 2JHEA 1HW8A 2GJIA 3GONA 4N7TA 2CQIA 1T8EA 2E5LF 4LBPA 4ZITA 4B3RF 1HNVA 3KG1A 2EFVA 3LWMA 3ZTPA 2YTCA 5GAGU 5E5NA 1CJUB 4DV6J 4NLUA 5IM0A 2QGFB 2FJVA 2XHWA 4KQZA 4O3RA 4FXVA 4DR1J 1RI7A 4C3KA 1A0OB 3NGDA 3IBFB 2U2FA 1XTZA 2EFNA 3MCMA 2DNKA 1OSDA 4CO4A 3PVXA 3I32A 2U1AA 2O1PA 4CRJA 2QLXA 4OIXA 3DI6B 3ET6B 2BEFA 3GIRA 5BYRA 2GHWA 3T6BA 5E3PA 1S0OA 3TVKA 3C19A 2RF2B 4I2QB 5DDPC 2KT2A 2OPRB 3QLHA 2NUUG 3DC2A 2YXLA 1VQ7S 4NRTA 4DPTA 1UWAA 2FQQB 3ONQA 2J8AA 3HHLD 3HSGA 4LSZB 4O3QA 4ZKAA 2XGQA 4R25A 1M5HA 1GNKA 4J9LA 4USWA 2VA2A 3OJUA 2X1AA 1HWLA 5D78A 4A8SA 1H7WA 4P7TA 2MQOA 3A3OB 3MMCA 1X4CA 1JLQA 2PFFB 3MAQA 4C3LA 3FCWA 3W5ZA 2HZAA 1KD1T 1K0VA 5HMXA 2VQEF 5SZTA 2VG5A 2B4UA 2CZ4A 4P2XA 4J9UE 3V6JA 2ROPA 1WUUA 4NCGB 3BR8A 2CJQA 3M8WA 4ZPDA 3PW7A 2R7VA 4DR7J 3NNCA 2M9KA 1YJTA 2R7RA 2EG2A 4ENOA 2CZ9A 3DCAA 1IR2A 2C22A 3DLEA 3CVKA 1TUVA 4A48A 2GMJA 2A1BA 1HBMB 4A8FA 1FXDA 2DGQA 1NPRA 3TAMA 5D4LA 2D9OA 2QLFB 4DR6F 2HIYA 2ZZMA 1GAOA 3TJ8A 1SH2A 2XS5A 3DLHA 4LRDA 1KLMB 2WW4A 4WP9A 5GAEI 1YJUA 2OSQA 3QJJA 2MKIA 3RRKA 2ZD1B 1QAXA 1LK5A 4RNOA 3I82A 1XNQF 2FVCA 3WHIA 4ECYA 4NPOA 3U27A 1GMWA 2IVYA 3PTWA 4DFKA 1HNIA 2AP6A 4OJ3A 2MJNA 3PYGA 4ES3A 2MQQA 3EUNA 4PWWA 5D0HA 1NHKL 2NUHA 2DR9A 3OD2A 3DOLB 4OZ0A 3T1AA 4QR2A 3B4MA 1U0HA 3CCES 5FLXU 3T5LA 2G4BA 3KLFA 4G1PA 2W8LA 2HPUA 3GFZA 1OPIA 3QZ8A 2KT5A 2NPIA 2FLNA 5IFMA 4ZLJA 2XNRA 3QWPA 2ZITA 3M6VA 2I9SA 2Z56B 3A8JA 4B3SJ 1R8CA 2BUNA 1BUXA 1JLAA 5KFVA 3DFEA 3CCTA 3HULA 4ZCKA 2CUYA 1I94F 1RJJA 1FDBA 2HQCA 3S8SA 1GK8A 5GAGI 2UXCJ 1QE1A 3T5JA 5G4DA 1OSCA 2CWXA 2CJKA 3CJRA 5KG6A 4AT1B 1UA1A 4XDCA 3NCQA 2V4RA 2BV3A 2DNMA 2DBBA 2KL8A 3PY8A 4LSNB 4LRCA 1YJRA 3SQGB 4WF9Q 2WBMA 1VGYA 2AMCB 1CSJA 4TVAB 1IBKF 4OJHA 2XSFA 4M5IA 1GFWB 2LCWA 1KQKA 5AE3A 2CQ4A 3HHDA 1TKXB 5G0RB 3CO9A 1GXLA 3GFYA 2JVRA 1JQGA 4B9MA 3AJDA 2YH0A 2RQ4A 3D3BJ 3W9IA 2B7BB 4DR2F 1SIZA 4RU2A 3GCXP 3C15A 1TMJA 1KOHA 1CJVB 3DRYA 3U1MA 2HFNA 3AXKA 3PV8A 4DG1A 2CPZA 3UD5A 5IT9Y 2KFYA 3E2EA 2FZKB 3W8GA 1JLEB 3PW5A 4E0DA 2BYCA 1ICEB 3SCLE 4JV5J 4K7QA 2DNLA 1NU4A 4OX6A 1UVKA 4LF8F 3QYYA 4FKXA 4NYZA 1AXQA 1CJKB 4MYUA 2CQPA 2ROGA 2PSZA 3QRRA 2GJ2A 4CLZA 2IBKA 1O0PA 2NLWA 1QM9A 2KFZA 5HMYA 5FD1A 1HWUA 3PX4A 3NGSA 2CJ9A 4QW9A 3PJWA 2B6AB 4ED6A 3SBMA 4JP8A 4JI0J 4LFCF 4ED0A 4AUKA 2YKOA 3BSOA 4HHUA 3I5CA 4FYDA 2B8PA 4Y2MA 5JVHQ 3MM9A 4YUDA 2QX0A 4FPRA 3C14B 3KLHB 1RT1A 4F3MA 1RU1A 2ZZTA 2QE5A 3BYPA 2I1RA 2YKPA 2OUGA 1VC6A 3H90A 4EZ9A 4X4OA 1JKHB 5L38A 5CQGA 3TX0A 5IWAJ 5AJ3J 3QIPB 3HI9A 4PUOA 3DLKA 2DIVA 1T94A 4KGMA 1NKCA 2HW3A 1YQHA 2OKQA 4N77A 2B9WA 3D7SB 2DJWA 2MZ1A 3TRGA 2C2OB 3WBZA 2WVEA 1WDDA 2HK3A 3M4XA 2HQIA 3DHXA 3FVYA 2E5LJ 3CC2S 1HQUB 2OPPB 3CC7S 4ID8A 4B3RJ 4UQGA 3ENWA 5K8OA 4YFUA 3I5AA 4NXNF 1HLWA 3IWXA 4ERDA 1M5PC 2BJ1A 2GO8A 3JAMU 1U6ZA 1CPZA 2X3GA 3OVSA 2D41A 2DGSA 2LMIA 1Y11A 4X65F 3RB0A 3NGUA 3NWRA 2HQGA 4F04B 1PSDA 5CA5A 3E01B 2J76E 4YP3A 2QC3A 4DL6A 4CM0A 5L9NA 4J7CA 3V5RA 1R8HA 3H5XA 1YG0A 5J2MA 2AJ2A 3NS7B 1YJ7A 1Q53A 4ECSA 5DRKA 3W62A 4YN3B 5IZHA 4X64F 1UVLA 4QIGA 5DDQC 2GCFA 1BQMA 2XO6A 3M9MB 4PPDA 2DR8A 4ZVPB 4OZ3A 1M90T 2OMOA 4N56A 5HSPA 2E7WA 1N5YA 3NMRA 2P5VA 3D1OA 5ETNA 3I4HX 1D9AA 2KT3A 4HLBA 1LK7A 2YX4A 3GSDA 2NCKL 2Y1IA 1JLCB 4USMA 3SV3A 1BQNA 4OZ2A 4Y6IA 5DQHA 2AWZA 4OX7A 4WWSA 3R9LA 1S7IA 1S9EA 5DG7A 1AW0A 3H5UA 4R0EA 3M8SA 1HNXF 3A3NB 1RT5B 5A2QU 4LFAF 3SDEB 1NRKA 4B9VA 3H98A 1LW0A 2HNZB 1ZPWX 3M1VA 1FKPB 3ICLA 3R7NB 1NHVA 1R3NA 2Z2ZA 1PAEX 2JWNA 3V6DA 2PN6A 3V6HA 3THVA 3CJSA 1KBRA 1GX6A 3MCNA 3FSXA 1RLCL 2W2MP 1EKSA 1S79A 5KFKA 4JI3F 3MUVP 5KTQA 1QAIA 1FEEA 3KTQA 4DR6J 3W9JA 4KHPF 2EXUA 4P2SA 3HSZA 1T03A 1RWMB 2CZVC 3KJFB 1D9FA 1ZAWA 2K7JA 4H4KC 3GB0A 1YBAA 4DL5A 4OHYA 1TV6B 5HMZA 4ZK7M 2CPXA 2ASYA 4K4WA 1AFIA 1F9EB 1IWGA 1MNEA 2CPFA 2H5JB 3QSIA 3TNVA 4NLTA 4IFYA 4JB8B 2SXLA 2W2OP 1TK0A 4NLGA 1N5SA 1Y7PA 2VOOA 2JRSA 2KXNB 1C1CA 2KKHA 1VHIA 2HGNA 1TTHB 4ICLA 1SQEA 1KFDA 1GXUA 3FBBA 4CP5A 3OR1B 1R0CB 2A3JA 3BQ2A 4X4PA 1YJVA 2YKQA 4OYBA 2QLWA 3KHLA 3QAEA 3KLEB 2ZUGA 3MHYA 3W63A 4JYAF 1YBTA 5KG2A 2VG6B 5BJRA 1NH7A 2O67A 4UUWA 1YDLA 3GYXB 2JOQA 2PI5A 3FMBA 3KLIB 2I6WA 3KDNA 4KKOA 1HD0A 1JNZB 4PXCA 3G82B 5HP1B 1KP6A 5DQGA 4W98A 3BDEA 5KFFA 1VRQC 1S6QB 4ZP7A 1VK3A 4I68A 2DHHA 3R5DA 1GQEA 2JEFA 4C4WA 1IBKJ 1HQEA 1S76D 3RW7A 1FNXH 2GMHA 4YY3F 3IBWA 4IO1A 2DNPA 2FJEB 2F8MA 4FBTA 3GJRB 2HZCA 2QRRA 4QYZJ 3NAIA 3TQ1A 2R8HA 1WWHA 2IC3A 2XO7A 3W9HA 1FFWB 4WZQA 5CYMA 2Y8YA 2BBEA 5DZ6A 1PC4A 4DR2J 5A8WA 4QQBA 1RA7A 3LP1A 4IFVB 3R5BA 2AJ1A 4DFJA 3MM8A 3CCRS 1U1OA 4CLTA 2UXBF 1KOOA 1HW9A 2NREA 4ZIVA 4K50A 2KYXA 3HLUA 2PT0A 2GGPA 4Y0FA 4OI3A 1F60B 9RUBA 4X84A 2CQ1A 3FEYB 1Q95G 3S7RA 1DTQA 6FDRA 4U95A 4DSIA 4NA2A 2E5JA 3DNCA 3PYDA 3VAGA 1N33F 1VIOA 2MKSA 3IM9A 4W4MA 2DB1A 5KFZA 1SQFA 2AQ4A 2LDIA 3CULA 3ZTOA 5CZVA 4K2JA 5F0WA 3RB4A 3OPKA 4P52A 4O0NA 4DUZJ 2ZHBA 3M8QB 1SH0A 3W2VB 2R7XA 2A10A 2CYYA 1F5AA 4LFCJ 3HVAA 4ID5A 3NMAA 1REGX 2FJDB 5DZ7A 4F50A 4DR4F 3A1YG 5GMDA 1FWKA 4X2BA 1RE1B 3AFGA 4WCEQ 3MXHP 4OZJA 1UZHA 3EE3A 2IRYA 4NI2B 2XYGB 1Y10A 2MY7A 3IR6B 5KFOA 3AT1B 3KUHA 4KPCA 2LEPA 1WEXA 2V5HG 3W1YC 1HBUB 3M2VB 2HSEB 3OUYA 4NCAA 1X5OA 1N8RT 3FJ2A 1UZDA 4A8XA 3DDKA 1H7XA 2AV5A 2N4DA 3G8QA 3MCOA 1L3UA 4NCBA 3UCZP 1EZZB 2WHOA 3VWSA 2W01A 2JX2A 1JLFB 4URQU 5F8IA 4NMXA 3MUMP 2JSXA 1H6KX 4RBVA 2X1GA 2LXFA 1SJRA 3I0RA 4IG0A 2KB2A 4DQSA 3W61A 4USKA 3JQKA 5AXMA 2F65A 3MPVA 1RHMB 3VHQA 1TL1A 4U8YA 2DEJA 3OTOF 4X65J 2IAJA 2HFZA 1X4DA 1NDPA 4JI2F 4K4VA 3D1QA 5DG9A 4C3MA 1NSPA 4A46A 2YNGA 4KR0B 1Q8IA 3HX9A 3IO1A 5D6GA 2IDLA 4QW8A 2RU3A 1FFGB 2V4JB 5KFIA 3OXFA 2Z57B 1C4CA 4TU8A 1RTZA 4JV2A 3M8YA 2UXDF 1Y4ZB 1S6UA 3DOMA 3BJYA 4X64J 5E3CA 1HI0P 3I56S 2HFVA 4DZDA 2XSJB 2UVRA 1SB6A 3ZZZA 3C6UA 4QYZK 1S57A 4LF1A 1NDKA 2I5JB 4PEOA 5IXUA 1NDCA 2FJAB 1U02A 3RR7A 4KGVB 2FHJA 3CIMA 2B43A 5B0GA 3R97A 2ASJA 3CUNA 4QOTA 5IV4A 1W2IA 3LGMA 2ZOGA 3JSRA 5T7LA 2AEJA 2HS3A 2J9CA 3QRQA 3EDRB 4F25A 2GIRA 1X31C 3HF5A 3DOKB 2VQFF 2NSCA 1NJIT 1HNXJ 2NXUA 3LP2A 2EG1A 5EDWA 1B70B 2RILA 2Z4PA 4LFAJ 4ANEA 1SC1B 2MQMA 2DD8S 3Q8PB 2HHUA 4WBFA 2B7CB 3BSCA 1RCOB 2Q6BA 3NP5A 2VG7B 1FRHA 1O6XA 4LBIA 2ZZNA 2MKYA 4G65A 3CTRA 2BDPA 4RUHA 1TKTA 3X3UA 1N5TA 1WC0A 2NZCA 5BR8F 3MCSA 5C2CA 4EBCA 2G0IA 3FCVA 1RSCA 1NB7A 1VRUA 5LT5A 4JI3J 4IH6A 2XMTA 2GV1A 2ZM6J 1YJNS 2I0XA 4OYOA 2LXUA 1FRXA 4OYZA 2YX7A 3DDIA 2HBQB 5J1EA 4KHPJ 1GMWD 4ZA1A 1CJTB 1NUEA 3SQOP 1MWYA 3N28A 4HACA 1WACA 1RT4B 1KLNA 3GJQB 3VTIA 3MM5A 1KTVA 1JIHA 2YKNA 1KKHA 4RW9A 4WE1A 5L1KA 3IR7B 2V2QA 4RNFA 4O3SA 3PYFA 3ILOA 1Q81T 1REVA 2HHHJ 2CPJA 1EQMA 4DLEA 3HSJA 3GFXA 3AA9A 4C0OC 5HLFB 5A76A 1YIJS 2BJ7A 1KC8T 3TUIC 2B4PA 4GRSA 3UN3A 4LREA 3W5YA 1WG4A 4UZBA 1LWEA 1L3TA 1CVJA 2NS1B 1MLAA 4LVOP 5KT5A 3FGVA 2BR0A 4IKAA 2CQ3A 4RBUA 3MAAB 4WZMA 3BPDA 2VPXB 2K3KA 3PHTA 3TEGA 4NLDA 4JYAJ 1N34F 1SV5A 4CLYA 1FVSA 3UO0A 1S6PA 1JJCB 3H0PA 2YNIA 3IRXA 1S9GA 3QAUA 4MIAA 4Q5VA 4QR1A 2LDYA 2VH7A 1YITS 3LW5C 2HHWA 1JJ2R 3P8BB 3HHLB 3VZIA 1U1PA 2IA0A 4XTTA 1SUQB 1H38A 2LU2A 2BE2A 2IM3A 5E0OA 1S0VA 2DNNA 5LJ3Y 1XWLA 1K0TA 1OY8A 4YY3J 1FCAA 1WI6A 5I3UA 2J8SA 1NK9A 2AD9A 1TAQA 2BABA 5FJ4A 1RYRA 3KG0A 2QA4G 4WFBQ 4TY9A 1U49A 1CJUA 3TAMB 3BH7B 3RB6A 3OV7A 2EFGA 5M2UA 4ZVSB 3J7Z5 2UXBJ 3QRPA 3MD3A 3BSAA 1TKZB 3K0JA 4PG8A 2YX1A 2AU0A 1FRIA 1LXJA 3HVRA 4J9NA 2I2YA 2KJWA 3DI6A 1AYEA 3ET6A 4Q7AA 4ILLA 4PABA 1N33J 1SJ4P 1Q82T 5D4OA 3P49B 2RF2A 4I2QA 4GKJJ 2EFPA 2OPRA 1U09A 1S6OA 1SKUB 1K47A 3TAQA 2G2OA 2VBWA 2R3VA 2RE1A 4DOZA 4WXOA 4YOEA 6FD1A 1E6VB 4Q43A 3AJ2A 4CNYA 1UVMA 4K8RA 4EO8A 1DQAA 4DR4J 4DV1F 2APOA 3HZGA 3CT9A 1RWNB 1AA1B 3W2WA 2XB2D 4F4WA 2KO1A 4QIEA 4DHVA 1G2EA 3H4DA 3KJVB 2J0WA 3FKBA 3GTYX 3WIUA 1RB0A 2ZE2B 3OXLA 4RX6A 3NGKA 3PO4A 2LKZA 5FIIA 1QE1B 1LV5A 4Q2LA 3EM1A 4FZVA 1NJZA 1HBMA 3ADAC 2KHDA 5CABA 5CYQB 1LWFB 3JXOA 3AAWB 1UMJA 1J5OB 1N0UA 3Q0AA 4U67Q 1WKLA 3M2RB 3SEOA 1KLMA 3TO8A 2H1YA 1U1RA 1T95A 1AB8A 1NK7A 1U24A 5GADU 4WFAQ 3UR3C 1IM6A 1SKRA 1QTMA 3OTOJ 1HYSB 3MR3A 4JI2J 3DRRB 1X9WA 2XQCA 2PGCA 1UPMB 2VASA 2Z2YB 2RJZA 3RBXA 2DGUA 4EFAC 2RDIA 4DX6A 2KM8B 4PXDA 2UXDJ 2YWHA 1RBLA 3JS9A 3SI8A 2RHQB 4KSEB 5AXNA 2AJFE 3LP0B 1HR0F 3R5JB 4FYVB 2XHCA 1UEUA 4ECZA 4OV6A 3VR1A 2K2PA 4OHWA 2Y0SD 5HATA 2X3DA 4NLWA 2H9ZA 1APSA 1FESA 2FD2A 3UNGC 1UVJA 3ELHA 2AJQA 1T05B 1FJ7A 3AD9C 1S1WB 1VQNS 2DPIA 2GX8A 2VQFJ 4F4AA 1B99A 1VQSA 3GG0A 2NXCA 5H1SV 1HHSA 1D8ZA 3MM9B 2PE8A 1ZTWA 3WC2A 1RT1B 3MGJA 4K4YA 4EZ6A 1LOUA 5B0FA 2EFOA 2CJAA 3JAMY 1CC8A 1MMNA 1I3OB 5CCLA 4DFMA 3Q8QB 4IOCQ 2HYIB 2BKNA 1ZPVA 4LSNA 5BR8J 2NPFA 1U26A 4BLGA 3P4UB 2F1FA 3Q8UA 4PG5A 2HFSA 3M05A 1GX5A 2AZ3A 5D4PA 2D9PA 3DLKB 4RW7A 2ILYA 1FTCA 2HVDA 5LMUF 2KM8C 1TKXA 1WJ9A 4M63A 5G0RA 5B09A 4WK3A 1WHWA 2W4CA 4OLPA 4QPXA 1MROA 2FVRA 2XMVA 4EYHB 3J80Y 3ZZRA 4CQ1A 3G71S 2BZ2A 1CJVA 1JMTA 4Y2IA 1HNWJ 1HWKA 1SBRA 3O2IA 1E6YB 2OTLS 3DXBA 4UZCA 5KFWA 5L9XA 1HD1A 4ZLPA 4LIRA 2D1CA 4LF5J 1P6TA 1J2VA 2NYIA 1JLEA 3A3PB 2R8KA 4KPYA 5ETLA 2RSQA 4LT6A 4I6WA 1IKVB 3ENAA 3SFUA 5A2QY 1VQ6S 6AT1B 5LSOA 4Y3CA 1CJKA 3F0NA 1K44A 5ETOA 4CH7A 2VPWB 3KXDA 2WONB 1ZH5A 3BBCA 1IVZA 3L95X 3G2XA 1BMQB 5A8RB 3MR7A 1KWMA 1N34J 4PXEA 1NHUA 2XZWA 1R27B 2HKEA 2ZH1A 2POKA 2ZH8A 4N8NA 1ZYQA 2Y0BB 2MSSA 1HI8A 3KLHA 4LF9F 4ZCIA 3S6EA 2JC0A 1F2GA 1S99A 4N47A 4PKDB 2HG4A 3UN5A 4IR1A 2PMZD 1OY9A 2NQPA 1JKHA 3M6XA 3PW2A 4YR0A 4FS2A 3QIPA 4C97A 1RT3B 3B78A 3B6BA 2AYGA 4NMLA 5L39A 3M1VB 3L9ZA 2GW8A 4P10A 5KT4A 1RAAB 3A8EA 4GC6A 2QZ8A 5IOLA 2L3MA 1Q7LB 3M8RA 2F9DA 2OI2A 4ES2A 3RBDA 1LNQA 1HQUA 2AKWB 2OPPA 4X62J 1DTTB 4B3OB 2ZH6A 4ER8A 3TUZC 2OPSA 3QT8A 3ILJA 1RT6B 5ADZA 3L7PA 3OJSA 3FFIA 3BKTA 2DNZA 2VUGA 4I6YA 5LXRA 4AXJA 5F0UA 3UFCX 1VBZA 5C24A 3U02A 5KFXA 3FRZA 2QL9B 3E01A 4QJVA 2Q1LA 1FD8A 5KFAA 4B17A 3HZEA 4RNHA 4P74A 3H2LA 5GAHU 1PBAA 2H4YB 4ZJOA 3HCXA 4J9RA 1LFPA 2FGOA 5K5MA 2C2NA 3MF5A 3HFZB 3HT0A 1S1XA 2QN6B 4H4KA 1FDAA 3GIIA 4LF4F 1N54B 2DR6A 2VICA 1Z4UA 4WU3A 1VIXA 3FNNA 1UEVA 4ECVA 4FNIA 4IOBA 3PR4A 1JLCA 1S59A 4DV1J 1C4AA 3AQPA 4G1IA 2MB0B 1FTRA 2L41A 5KG3A 4GMKA 1RXOB 5F3ZA 4MIBA 4GVBB 4DUYF 1RT5A 4FVCA 2OMLA 4NZ0A 4F7VA 2E5HA 3D68A 3SDEA 3PR5B 5E7OB 1KONA 3IGNA 3Q23A 2KJVA 3W64A 1S0NA 2HNZA 5EWEA 4KHRA 5C7PA 2VB6A 2ZJQQ 1WG5A 4USVA 3C3LA 4J9OA 3D0IE 2AIRB 3DRXA 1WC6A 2O01C 3LANA 5U47A 2ZVSA 4JI5J 2M2BA 5IQQA 2CWKA 3KHGA 2FJWA 2AT1B 1FKOA 4RNMA 4Z37A 1RWXB 3FEXB 3V4MA 1VQYA 2W9CB 2DHGA 5ETKA 1PJ7A 3R6GB 3I9ZA 4ZVFA 2BX6A 1OQ6A 1NZ8A 3G6XA 2MZJA 1X9SA 3OFGA 3TI0A 3CWJA 1AUDA 2WOMB 1TV6A 5KG4A 1KN6A 3JSMB 3AB2B 1Q78A 1RP5A 3Q22A 2ZWOA 2J9DA 1YHQS 5EGYA 3IGVA 2FZGB 4UTGA 4RUAA 4C8LA 1RT2B 4CLWA 4WK1A 3D0GE 3N6NA 2MPUA 2XCAA 2FHJD 4RW8B 1HIYA 4F8RA 4NA3A 1WF2A 1CULB 4L3KA 1HR0J 2XMJA 3WZ0A 4ILRA 2DR5A 3ZC4A 1VYAA 3PX6A 5K8MA 1Q4RA 1OO0B 3OR1A 3SMZA 3DXSX 4EYIB 2BRKA 2HRYA 3KLEA 3NOGA 1FRLA 3BN4A 3AY0A 2HLUA 4YDDB 4DS4A 2R7WA 5HL7Q 2AHOB 3Q8RB 3MMAB 1HMVB 1LFWA 4P75A 4ID5B 4IRCA 3A13A 2V6AA 4UQTA 4DCPB 3KLIA 4K4XA 2OTJS 2ILZA 1NJXA 2E1PA 5ETRA 2IVFB
chains in the Genus database with same CATH topology
4ZDNA 3MMJA 4JV1A 1S9EA 1U2FA 5DG7A 1PGZA 2DIUA 1AW0A 3W3SA 3H5UA 4OJ1A 4R0EA 4EGLA 3M8SA 2F3JA 3S1TA 1HNXF 2FHOB 3SV4A 1RT5B 4DQIA 4KE5A 3NWGA 3T3FA 1CEZA 1DQ8A 3IS9B 4LFAF 2UVVA 4MKAA 3SDEB 1GTEA 1NRKA 4B9VA 4YB5A 3H98A 5K8NA 5JVGQ 1LW0A 1S6QA 2W25A 3QGGA 4O3PA 2HNZB 4FNHA 5KG7A 1Y5IB 5B0AA 2E1RA 1D9DA 1VS3A 3DLGA 4MMOA 1ZPWX 3M1VA 4TLQA 4FF2A 4Y00A 3SQGA 2HGLA 1FKPB 3MTKA 3ICLA 4DV0F 4B9SA 1HBNB 1NHVA 1R3NA 2UVUA 4W92B 4EWTA 3MM7B 4OL8A 3I87A 2FVSA 2OD6A 2VFVA 5T41A 2JWNA 1XC9A 4PUOB 3KG4A 1H98A 3I96A 3V6DA 2RDJA 2DNQA 2C2DA 1NKEA 3NCRA 2PN6A 4HTJA 3V6HA 2GA7A 5F8MA 2ZC4A 3SYZA 3THVA 1UP1A 5K8PA 4MKBA 1GX6A 4JOUA 1H2TZ 2M70A 2HNDB 4QBUA 3J7A1 2D74B 3OUYB 3FSXA 3QGIA 1S79A 5KFKA 5I3PA 2DHAA 4JI3F 2OSRA 3CCZA 2EW9A 2NZ4A 5GAHI 4ED1A 1ZTTA 1HNZF 1FJCA 3V81B 3MUVP 1NK6A 1AROP 4N5SA 1IKYA 3LUYA 2RQMA 2WRMA 5KTQA 3R1HA 1GXTA 2UV8A 1QAIA 3I55S 1FEEA 3G8TA 3KTQA 3G6VA 5KFSA 2F8EX 3Q24A 3MZIA 3GIKA 1FO1A 4KHPF 2JZ5A 3R27A 1FDNA 5K14A 1FE0A 2EVZA 2FC8A 4P2SA 4TLRA 5B7WA 5F8LA 1Q86T 2VPYB 1T03A 1IM4A 2CZVC 3V4IA 1D9FA 1ZAWA 1IUJA 3O1LA 2JC1A 1MU2A 1RWUA 3MEKA 5IT4A 4ELTA 2RRNA 4K4TA 2B9YA 1DLOA 2K7JA 4H4KC 3GB0A 5F41A 2W4DA 4XIUA 1YBAA 4DL5A 3PZPA 5T14A 3TAPA 4OHYA 4I1TA 1TV6B 4DFPA 5HMZA 2CQBA 4ZK7M 1RKIA 2IVMA 4WFYA 3LH2S 2CPXA 2ZHAA 2MHNA 2M7SA 5KFDA 2ASYA 4K4WA 1AFIA 2DGTA 2R2RA 2XMKA 3O8WA 3HP6A 1MNEA 3TUJC 2CPFA 4I6AA 3CCJS 2R7SA 2WCXA 3KMSA 1L3VA 4X4VA 4ECRA 4AQYF 2UUCF 3EGZA 1UL3A 4WKRA 2L9DA 2CQCA 3PW0A 4WJBA 1UJ6A 3MM6B 2IMOA 4RU9A 4K59A 3TNVA 2RMLA 4IFYA 2DITA 2IM0A 2PIIA 4NLTA 2Z2LA 2BQ3A 1DZ5A 2DRAA 3LO3A 1X7VA 4U7UK 2KI2A 2X1BA 1L3SA 3CGIA 2SXLA 1TFYA 2HIQA 5K9FA 1TK0A 4NLGA 2EFQA 1C0UA 4KT0C 1QLNA 4EO6A 3GFHA 4KV8B 1N5SA 5LL6d 4CO1A 3UR0A 2BQRA 4CNZA 1Y7PA 4A47A 4ATNA 5DLGA 2VOOA 4LSLA 2JRSA 4DBQA 3M30B 2KXNB 1YTYA 1C1CA 2I8EA 3NBPA 4C7QA 1U48A 5J2MB 4RW4B 1FDDA 1XERA 1FXRA 2KKHA 1WHYA 2B5JB 4KGKA 2HGNA 3N5BA 4CO0A 2M5YA 4RWWA 4ZP8A 2F40A 1U45A 4ICLA 3CCMS 1FHTA 1SQEA 5HBMA 1KFDA 1VBYA 2K1RA 1GXUA 1NZAA 3IAS9 4HI1A 3CEDA 1BQMB 2N4CA 3OR1B 4KRWA 3JYTB 1RA6A 1OPZA 4HT5A 2A3JA 3RB3A 5L1LA 3BQ2A 2XI3A 1C2PA 2B6AA 4JI8F 4AL6A 4M94A 2KRBA 3P3DA 4KFBB 4X4PA 3M8QA 5DM6Q 3VZHA 1VQLS 1YJVA 2YKQA 2ZHOA 1NAQA 3C6UB 2QLWA 5LMNF 5KG5A 2CPIA 5EN1A 2HVZA 3QAEA 3KHLA 3KLEB 1N36F 2ZUGA 4PXBA 2XI2A 3MHYA 1G7CB 5L1JA 4LF7F 2UZAA 1N5YB 2DCLA 4HVZA 3I4PA 4JYAF 5A8KB 1B64A 4PPZA 2BXJA 4YB6A 4XPCA 2YY3A 5DGBA 5KG2A 2DR7A 2VG6B 5BJRA 3L3CA 1NH7A 2O67A 4DS5A 4RBTA 1R6YA 4RLEA 5E3AA 4F3OA 2E5IA 4UUWA 4ZHRB 4BHQA 1S7HA 2KHCA 3GYXB 3IWLA 4G1QA 1BQNB 2JOQA 2PI5A 2XS2A 2W9BB 2CQ0A 2GNKA 3FMBA 2E44A 3N6LA 3OHBA 3RW6A 3MFHA 4EBDA 3KLIB 1OQ3A 1YJ9S 1JK9B 1S9EB 4KKOA 4UW2A 3SFGA 3CD6S 2MQNA 2R7UA 1HD0A 4C8MA 2M8HA 1JNZB 3PEHA 4PXCA 4QWCA 5HP1B 4XAKA 1YGYA 4ZPTR 5DQGA 4E8UA 3BDEA 4C11A 5KFFA 3CDBA 1GTHA 5B0EA 3OLAA 2PDAA 1LW0B 1S6QB 2HNYA 1WF0A 4PCQA 1KHVA 1M5SA 3UD4P 1KS2A 2RNEA 4DDFA 3PFOA 4ZP7A 1HBUA 3M2VA 4HYKA 1VK3A 3TR5A 3BZQA 3VAKA 3FDSA 5JJBA 5LJ5Y 3I5BA 2YNFB 4DV7F 1WF1A 2ZJRQ 4DL4A 4I68A 1ZZFA 1U2RA 5D4NA 3CJKA 1KRPA 1OS5A 2VONA 3R5DA 2FLPA 1GQEA 5L1IA 1DRZA 1GT8A 3I0SA 3V6DB 2JEFA 2O5DA 4C4WA 4JI4F 5KFRA 1HQEA 1S76D 2C28A 3RW7A 1T3OA 2GMHA 1FNXH 4YY3F 3IBWA 4IO1A 2YNHB 1LWCA 4R0JA 4KB7A 4OV1A 2DNPA 3RZAA 2FJEB 2HMIA 2F8MA 2VFSA 4FBTA 3O6QA 3HFKA 3NLCA 2HZCA 3N0VA 1JLFA 2QRRA 2A2DA 2FY1A 3NAIA 4QYZJ 3PO5A 3FQKA 2R8HA 3TQ1A 1WWHA 3MDFA 2IC3A 3B82A 1KHWA 7FD1A 5GMKa 2XO7A 4QCLA 3OVAA 5E3RA 3BQ1A 1XMQF 1VRTA 2VFTA 1IKYB 3E51A 1WEYA 2PI4A 4ZPBA 2E7XA 3IFEA 2BACA 4WZQA 1Y3KA 5CYMA 2BBEA 1XN9A 2B56A 1PC4A 3SCKE 1XEZA 3CJ2A 5K14B 2QYCA 5A8WA 4QQBA 4F4KA 1RA7A 3LP1A 2HHVA 4IFVB 2XMMA 1T03B 1NJYA 5E3QA 1QAJA 3R5BA 4ZMMA 5FLXY 2Q6CA 2AJ1A 2AYEA 1VMBA 2G0CA 3AHPA 1KQFB 4DFJA 4X4NA 3MM8A 4A8OA 1DLOB 3CCRS 2QFJA 1U1OA 1SKWA 2UXBF 3NNAA 1KOOA 4F67A 1HW9A 2NREA 4NOHA 3QGHA 4ECQA 5HO4A 5EWGA 4O4RA 4K50A 4N8OA 3MR2A 3DU6A 3H2VE 2MZRA 1LKZA 3KKFA 3D0HE 4X4UA 2R8IA 2KYXA 3HLUA 4WE1B 2PT0A 4ZCLA 3G86A 2GGPA 1RGVA 1URRA 4QPTA 4Y0FA 4OI3A 4K4ZA 1F60B 1KTQA 4B08A 1UA0A 4X84A 2CQ1A 1S9FA 3BDPA 4IFYB 4DSJA 1IQZA 1WHXA 2V4JA 3FEYB 2VKZG 3H25A 2IYIA 3S7RA 4DV5F 3KYLA 5KT7A 1QVFR 2ZNZA 2DGXA 4OHXA 3F44A 1HFEL 1DTQA 3BF4A 6FDRA 1K73T 1C0UB 4Q44A 2COLA 1X4BA 4DSIA 4NA2A 2E5JA 3ETOA 3DNCA 2YQ3A 2XSJA 2X51A 3VAGA 2LEBA 2ASDA 3OVBA 4K4UA 4LSLB 1N33F 1X5PA 1C1CB 1VIOA 3L7OA 1XR7A 3KNGA 2MKSA 3NBPB 4HI2A 2J7WA 3T1YF 4BDPA 2QMXA 4QWDA 4OX8A 2DB1A 2VKRA 3NCPA 5KFZA 3RAQA 3NG8A 5DM7Q 2AQ4A 2LDIA 1RYSA 2X1FA 4DSFA 4FF1A 3CULA 2AGQA 1TL4A 4ICLB 4MYTA 3HHLC 5F8NA 3MR5A 2R9LA 5CZVA 5F0WA 1VK8A 5HBMB 3ZZYA 2K1RB 4DUZF 3RB4A 4DR5F 3OPKA 4C8NA 1RDRA 2WB4A 4H4MA 2ZHBA 3K8VA 2XLJA 3GQCA 1N56A 2KTQA 1NH8A 4GO5X 3M8QB 3FSIA 4HTIA 1SH0A 2FGCA 2LQ9A 3W2VB 1K8AT 2B3TB 2R7XA 2A10A 3M9NB 2HHSA 2CYYA 2GQ2A 1F5AA 3F41A 3O44A 5HROA 3HVAA 4ID5A 2IYGA 3NMAA 1WELA 2E5GA 2FJDB 4F50A 4QIVA 1J5EF 4DQRA 3IR5B 3DOKA 4USJC 4Q2MA 4DR4F 4ETZA 4FP9A 1KFSA 4DN9A 1VQMS 4DF4A 3A1YG 3CDEA 3DRPA 3MURP 4NLOA 2ATLA 3MOJB 1RAJA 1SIWB 2Z0GA 4X2BA 3WDOA 4MIWA 2RU9A 2UVWA 2R7TA 3PFEA 1U1LA 5DLFA 1N88A 4B9LA 2BANA 3PM9A 3OHAA 1O8BA 2QA4S 4WCEQ 4CH0S 4OZNA 3MXHP 4OZJA 1TAUA 4KKOB 4DL3A 5ITHA 1BWEA 2FVQA 1BD6A 1FKPA 2CPYA 2KXFA 2KH9A 3EPIA 2IRYA 2VG7A 3D2WA 1DARA 3KK3B 1T7PA 3MM7A 3MMBA 3MAHA 1Q79A 2MY7A 3IR6B 5M2PA 5KFOA 2R7QA 3MOZA 4C11B 5J1NA 2AYBA 2M4MA 2LEPA 1WEXA 2V5HG 2OH2A 1WEZA 1FF2A 4XO0A 2HNYB 2ASLA 4K5RA 1XMBA 1HBUB 3M2VB 3OUYA 4NCAA 2C2RA 4YHHF 2E1MC 1X5OA 2RQKA 3FJ2A 1N8RT 4ES1A 1MSWD 4A8XA 3DDKA 1S72S 2K8GA 1H7XA 3CJKB 2AV5A 2YKMA 3SZ2A 2AX0A 2N4DA 3G8QA 2M8DB 2V2KA 1XK8A 5IT0A 3I0SB 1PC5A 1HQEB 2GFFA 1Y9OA 1L3UA 4NCBA 1K9MT 3MUTP 2UV8G 3UCZP 1LWCB 2YVSA 5C25A 2G9OA 1XNRF 2VBXA 2WHOA 4ZPAA 3VWSA 5KFBA 1Q16B 2HMIB 3DLBA 5CHCB 3BQ0A 3OFFA 2JX2A 3AH6A 1JLFB 2IC3B 3MEDA 4URQU 5F8IA 2XMUA 5FDLA 4OHVA 1VRTB 1W2BR 2VPZB 3MUMP 1RT4A 2CJBA 5CCMA 2J6TA 2JSXA 2WK4A 3DDNA 4IRKA 2GIQA 3RU0A 2B51A 1H6KX 2DO4A 3PIOQ 5CYMB 4RBVA 3RRHA 2QT7A 2X1GA 5D77A 2LXFA 3K57A 1G6BA 1SJRA 1SJ3P 4OI1A 3HO1A 4Y2KA 3I0RA 3V2UC 4IG0A 2XG8A 5LSRA 3CCSS 1A7GE 4URGA 2BM0A 5A8WB 2KB2A 4J9PA 4FF3A 4DQSA 2KRRA 2ERRA 1FJGF 4U7CA 3LP1B 4HH1A 4TN2A 2F7VA 3US5A 4V19X 4I69A 1UVNA 3CJ3A 2F4VF 4DV6F 2L48A 5AXMA 2AJ0A 3MM8B 3GIMA 2WSCC 3MPVA 4QWAA 4IH7A 1C1BB 1TL1A 2VFRA 3OTOF 3NS5A 3KNAA 3CC4S 2IAJA 2HFZA 1RK8A 1X4DA 4JI2F 3C2PA 2RKIB 1EETB 3H20A 1L5UA 2OIHA 1F9FA 1F0XA 3DHWC 4C8KA 5LXYA 4DR1F 1KVJA 2JJ4D 4J9KA 4K4VA 1O51A 1IJEB 1CLFA 3D1QA 5HLFA 5DG9A 4C3MA 2GGPB 3C6TA 4QR0A 3V6KA 3FRYA 4A46A 4PG4A 2YNGA 4KR0B 2V4QA 1HWIA 1WI8A 1Q8IA 3UDLA 3HX9A 3IO1A 5D6GA 3GE9A 4QW8A 5EHHA 2OFHX 2ZBIA 5DG8A 2RU3A 1EP4A 2OPQA 4OMFG 2V4JB 1BGXT 3GR0A 3OXFA 5KFIA 1C4CA 3IA0A 4TU8A 4NZ7A 2ZBCA 1IXKA 2WW8A 4JV2A 3GIJA 2UXDF 1Y4ZB 1HI1A 1S6UA 4RW6A 2QIFA 3LAMA 2FLLA 2R8JA 1DTQB 3DOMA 3BJYA 3I31A 4ELUA 5E3CA 1HI0P 2N7CA 3I56S 2XSJB 3CMAS 2KFNA 2UVRA 5A6WA 4CO2A 4EUVA 4FXWA 2QA2A 4C98A 4MKYA 1SB6A 4Y28C 3OTEA 3ZZZA 1S77D 3C6UA 4LFBF 2PMHA 4FVMA 2KDOA 1FRJA 3RYLA 1GH8A 2I5JB 1RTDA 2NSBA 4WXWA 4V19J 3PX0A 4NZ6A 4KHMA 5IXUA 3M9OB 1VC5A 1Z1ZA 1P1TA 2ZJPQ 2FJAB 1Q1KA 3RR7A 3VCDA 1R8PA 3WC0A 1DAXA 2FHJA 4H4MB 3CIMA 5DETA 2B43A 2VG6A 3ENVA 5B0GA 1H2VZ 2ASJA 3O3LA 4IH5A 3CUNA 4QOTA 4DR3F 1JLGA 1W2IA 1QSLA 3LGMA 2ZOGA 3DU5A 4OX9F 2D7SA 4QZVB 3U1NA 3FQLA 4HT7A 3JSRA 3UD3P 3ITHA 5HROB 5T7LA 2DPJA 4A8QA 4F2SA 2HS3A 2J9CA 2DGWA 1UAWA 2W4PA 5CXTA 4F25A 1RT7A 3QMQA 2GIRA 3HF5A 4FN5A 3PEJA 1SH3A 3DOKB 2ADBA 3FZBA 4FS1A 2VQFF 2CQDA 4NLRA 2J0XA 1OIAA 2KU7A 2NSCA 2YWGA 3WX4A 1R31A 1NJIT 1H3DA 2WSEC 2FIUA 3JB9k 3QPIA 1VI7A 4TYBA 2NXUA 3DRPB 5HP1A 3LP2A 2EG1A 3THPA 5EDWA 3IWNC 2RILA 3K58A 1SL0A 3ENQA 2HS0A 3P96A 1U7LA 2Z4PA 5A0YA 1Z2ZA 3RTVA 3HHLA 2OAUA 2BANB 4X4QA 2MQMA 4GO7X 3W2WB 1SUQA 3BM7A 5KG1A 2BA9A 2DD8S 3Q8PB 2KG1A 4UY85 4K0KF 2HHUA 2B7CB 3QWUA 3BSCA