1VC6A

Crystal structure of the hepatitis delta virus gemonic ribozyme product with c75u mutaion, cleaved in imidazole and mg2+ solutions
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
95
structure length
95
Chain Sequence
PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Conformational Switch controls hepatitis delta virus ribozyme catalysis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation/rna
molecule keywords Hepatitis Delta virus ribozyme
total genus 23
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vc6A00
4QU7A 2MKKA 3MD3A 3HI9A 2EK1A 3G8TA 1U1PA 3UD4P 2MB0B 3G8SA 2MZ1A 1L3KA 1YWXA 1FJEB 1FJ7A 1U1KA 1H2VZ 1RK8A 4WCEQ 5DDRC 4TU7A 2XS2A 2E5JA 2LA6A 3CULA 2DGXA 2M70A 1RKJA 3MXHP 1URNA 2DNLA 3G6ES 1VQ5S 4ED5A 4M5DB 3CPWR 1S79A 2DGUA 3VAGA 2OSRA 2L9WA 2KG1A 1WI8A 1JJ2R 2QFJA 1X4AA 2AYGA 2DH9A 2F3JA 4W92B 2CQ2A 1WELA 1ZZFA 5LSOA 2Q79A 1VBYA 2QA4S 2M0GB 1SJRA 2KRBA 2J76E 1M5VC 1VC5A 3DLLQ 4CH1A 4IOAQ 2FC9A 2DNNA 2K8GA 3IWNC 4J5OA 3P49B 2U1AA 2MKSA 3CD6S 2YWKA 1R8HA 2F9DA 4ZKAA 1SJ4P 2JVRA 3CC7S 2MZQA 3EX7B 1U1LA 2NLWA 2MZSA 2J8AA 4F26A 1UP1A 2CQHA 5FJ4A 1KOHA 4C0OC 2KXHA 2MQQA 5GAHU 3D2WA 1Q86T 1VC0A 2ADBA 4Y00A 2KHCA 1VBZA 1WF2A 2QEXS 2CQ3A 1D8ZA 2MSTA 2ZJRQ 3P3DA 3V4MA 2JRSA 5DDQC 5D77A 1FT8A 4IUFA 1WHWA 2M2BA 4PR6A 1M1KT 2XNRA 1XN9A 3UCGA 1Q82T 2X1BA 1JMTA 1OO0B 3FEXB 3UCZP 1Q81T 3VAHA 2KYXA 2MJNA 1H2TZ 2U2FA 2LECA 2D9OA 2CQGA 2RT3A 2I2YA 3IRWP 1DZ5A 3S6EA 2JWNA 2AYMA 1K73T 4WKRA 2O3DA 3BS9A 3MD1A 3VAIA 4FXVA 5LJ3Y 1HD1A 4EGLA 2LKZA 1YHQS 3HHNB 2M88A 4WFNQ 3ZZZA 1JJ4A 2FY1A 2KN4A 2PE8A 1X5TA 2YH1A 2F9JA 2LA4A 3VAJA 2DH7A 1SXLA 3UE2A 1NO8A 1NU4A 3CCSS 2FPHX 2MMYA 3OW2R 2UP1A 2CPEA 1UFWA 3R1LA 2OIHA 1FJCA 1KOOA 3TP2A 3Q2TC 2MKHA 2YTCA 1HD0A 1OWXA 3MUTP 1YJNS 5BJRA 1ZH5A 2DNRA 3H2VE 4QPTA 4CIOA 3Q2SC 1VQ6S 2MQNA 3CCLS 2LXUA 3G71S 1FO1A 1U1MA 2DO0A 2DHXA 2B0GA 2LCWA 1D9AA 3CTRA 5DDPC 1WEXA 1WEYA 2KU7A 3S7RA 5LXYA 2M9KA 5GADU 1U1OA 2PEHA 1SJ3P 2X1GA 2DISA 4OZ0A 1ZZNA 3UD3P 1HL6A 4FXWA 1W2BR 2M8HA 2DIUA 1KQSR 3THTA 2E44A 1VQMS 2X1AA 1YIJS 4TLQA 2RQ4A 2KG0A 2J0QD 1OPIA 3MDFA 5CYJA 1M5KC 2I38A 3I55S 1VQ8S 2RUGA 3H2UB 1AUDA 4LMZA 2LYVA 4YOEA 3VALA 3CC4S 2RRAA 4LJMA 2DNOA 5JVGQ 2DGQA 4UY8T 3ZZYA 2RS2A 2CPXA 3CC2S 3CUNA 2RQCA 4CH0S 4YUDA 1N8RT 2VONA 1P27B 2MKCA 1IQTA 2LXIA 4ERDA 2DGSA 2DGOA 1VQLS 2G4BA 2DNQA 1VQ4S 2DNKA 1N52B 2XS7A 2EK6A 2HGMA 2MJUA 5DM7Q 1JJHA 1P1TA 1U1RA 2KI2A 3SXLA 2KXNB 4QU6A 2KM8C 1DHMA 2CQCA 1PGZA 3MUMP 2NZ4A 3BEGB 2WBRA 2DNGA 1UAWA 3CCVS 4BS2A 2DO4A 3RW6A 2FC8A 2DHAA 5LXRA 2DNHA 3RW7A 3R27A 2GO9A 2CPFA 3ULHA 2OTJS 2DB1A 2FHOB 4YB1P 1VBXA 1SJFA 4TU9A 3L3CA 4LIRA 2XNQA 3CMAS 1DRZA 2RRBA 3CMES 2M4MA 1F9FA 2KVIA 3CXCR 1WG5A 1WWHA 3B4DA 2KRRA 2CPDA 5HO4A 3THPA 1VQOS 3DXBA 3VF0B 3TYTA 1VQ7S 4V19X 1U2FA 1H6KX 2DGWA 3U1LA 1X5PA 2L41A 3NNAA 1FNXH 3MUVP 1WTBA 2OTLS 1O0PA 1YITS 1SJQA 2DK2A 1X4DA 2CPIA 1YJWS 4PRFA 3PIPQ 4P6QA 1N88A 2KXFA 2YKAA 1BY9A 2CJKA 3CCJS 1HA1A 2VODA 2VOPA 1R8PA 3BO3A 3CF5Q 3NMRA 2JVOA 2CQ1A 1QVFR 3NNHA 5MLCV 2DNZA 1X0FA 2KFYA 2XB2D 5CXTA 3J7ZT 3JB9k 1WF1A 1QVGR 1VQKS 2MXYA 4IOCQ 3R1HA 1WEZA 3S01A 2AYEA 4F25A 2YH0A 1VC6A 3NS6A 5D78A 1X4FA 2VOOA 4WIIA 1CVJA 1PO6A 3I56S 2OSQA 2DH8A 2RS8A 2CQPA 2SXLA 4RU2A 1YJ9S 1X5OA 4WF9Q 2A3JA 1A7GE 2N7CA 3MOJB 3BO2A 3K0JA 2E5HA 5LJ5Y 2CQ0A 1YI2S 5CA5A 1U1NA 3VAMA 4Y0FA 2ZJQQ 1KC8T 5H1SV 2D3OR 1VQPS 2ZJPQ 1M5OC 2M7SA 2CQIA 2DHSA 2L08A 5GVQA 4PKDB 4A8XA 2GHPA 2MYFA 2N3OA 3G9CA 2JX2A 3BO4A 1X4CA 1U6FA 3SMZA 1WG4A 2DHGA 3CCMS 3LQVA 2E5IA 3VAFA 1WHYA 1U6BA 1X5SA 3VAKA 4Z2XA 1QM9A 1VQNS 2CQBA 3S8SA 2CQDA 5EN1A 2CPYA 3CCES 1K8AT 1YTYA 3J7YU 5DM6Q 4WFAQ 2CPZA 2G0CA 1VQ9S 2AYBA 2MQLA 5JVHQ 2LEAA 2XS5A 3NS5A 2M8DB 1FXLA 5IQQA 4QQBA 1X4HA 2DNPA 3EGNA 3SDEB 2MGZA 3CCQS 2AD9A 4WFBQ 5IFMA 3U1MA 3NNCA 2RVJA 2DGVA 5LSLA 1M5PC 3LPYA 1G2EA 1X4BA 1U1QA 2OJ3A 3CCUS 1H2UX 2DITA 2MZRA 5GAEU 1WI6A 4IO9Q 1N54B 2MHNA 4TU8A 2LMIA 2ERRA 2E5GA 3G96A 2K3KA 2RNEA 3N9UC 2V94A 4F02A 1WHVA 5DETA 2N82B 4OZ1A 2HGLA 1S72S 5IM0A 3PIOQ 3CCRS 3FEYB 3P5TL 2MKJA 3US5A 3B4MA 2M52A 3UWTA 2RU3A 2HYIB 5DDOC 2D9PA 5GAGU 2DNMA 2HVZA 2J0SD 1Q7YT 3EGZA 2DGTA 2MZTA 3P6YC 3TO8A 4CQ1A 4W90B 1DBDA 1KD1T 3SDEA 2MGZB 2CPHA 2CQ4A 2MKIA 1FHTA 2BOPA 1A9NB 2MQPA 2KM8B 3MURP 4C4WA 1OIAA 1NJIT 2KH9A 2LEBA 2HZCA 2CPJA 1WG1A 2G1DA 2KT5A 2MPUA 4C7QA 3MI7X 1X4GA 2MY8A 2DNYA 3G4SS 2MZJA 2EVZA 2X1FA 1UW4A 4UQTA 2MQOA 5GMKa 1X4EA 1M90T 2XSFA 2BZ2A 2ADCA 4U67Q 2N3LA 2DIVA 2LQ5A 2MQMA 1WF0A 3UCUP 2HGNA 1B7FA 1WHXA 1K9MT 5IM0B 5HL7Q 5ITHA 2MSSA 2MY7A
chains in the Genus database with same CATH superfamily
4QU7A 3MD3A 4CH7A 2DY9A 1RBAA 1RTDB 2OLWA 4QPXA 3K89A 1R0AA 2LU2A 2GJ2A 3G8SA 2MZ1A 4HYKA 3L7PA 4JI0F 1G4CA 3HVTA 3TA1A 2ZWPA 5L9XA 4NCGA 3N28A 3V5RA 2BJ3A 1FJ7A 5DZ7A 1KWMA 5FLXU 1U1KA 1UCNA 4YHHF 1Y9OA 3ZNUA 1Y5IB 2O01C 4WK3A 5E3RA 1WC5A 3RGIA 2XS2A 4P71A 4RJVA 2DGXA 2M70A 1MG7A 2R7TA 2IFXA 1RKJA 2OHDA 3MXHP 1YJTA 3AJ2A 2XCAA 5KFSA 2QMUB 2W2MP 4J90A 4CYUB 3G6ES 2H5EA 3IM9A 4NEZA 4OLOA 2XMVA 5ETLA 3RBEA 4LF6J 3EXCX 3H4BA 2R2TA 3DLEB 4ANEA 3C66A 4ED5A 4W98A 4C8MA 1P9QC 3FC9A 3GJQB 4YFUA 2CAJA 4WXWA 2CZ4A 2XHCA 3V2UC 4DV7F 2ZOFA 1NRKA 1TKXA 1NZ8A 5T7LA 3KYLA 4CLFA 1KFSA 2J0WA 3V4IB 4ZVSB 1HARA 1D8YA 4LF2A 3CDAA 2L9NA 1VRQC 3EM1A 3R6LB 4DUYF 4OZJA 4RW9B 1KKHA 2FJXA 3PJWA 3OL8A 3EXYA 4UOHA 3GCWP 2F3JA 3V6JA 1BQXA 1RA7A 1WELA 1ZZFA 2XULA 4M63A 1R3NA 5LSOA 3GP9A 4RW9A 1NKEA 2M0GB 4DN0A 4OHVA 1JLEA 3WIVA 3RB4A 1M5VC 4IOBA 4CH1A 2X51A 4I2QB 5T7LB 2DHHA 1PJ5A 2Q6BA 2YKNB 2FC9A 2HWTA 3DDNA 1H38A 3RUBL 2CFXA 2ZNZA 2ZH1A 4LF6F 4DZDA 2DEIA 3T5HA 2WBMA 2MKSA 1R8HA 2PO4A 2IMOA 1KVJA 2JVRA 3N01A 3DRSB 3CC7S 4JI5J 4WZQA 3MCMA 3FKBA 4K4YA 1GMVA 2NLWA 5HBMA 1X60A 4XPCA 2VL1A 4DX8H 3GV8B 3HKZD 4Q45A 4H4MA 2CQHA 4DPUA 4ZIVA 3RR7A 3R2DJ 2VUGA 5FJ4A 4ECZA 3E2EA 5GAHU 2K1RA 1RWNB 2QA1A 1MWQA 3D2WA 1IBLF 2V63A 3R7SB 1VC0A 1E6YA 4KGZB 3W9HA 3D6TB 2NREA 1KNZA 1Y11A 1H74A 2LQ8A 3ICLA 1H3DA 1HBUB 5A0YA 1FWPA 1AROP 3KLEB 4URQU 2HHTA 4ZIWA 2ILZA 4JB8B 4WTOB 2MSTA 3EGVA 2NSBA 1LWEB 2DBBA 2RHQB 3RB0A 3ETOA 3TAPA 4IUFA 1HW9A 2HURA 1WHWA 4BCAA 5EWFA 2M2BA 3M32A 3Q83A 2HHSA 4PUOA 1N5TA 5AE3A 1M1GA 2AEFA 4B08A 4F3MA 6FD1A 4ELTA 1RT4B 4PYAA 3LW5C 3D4JA 4OQJA 2RILA 1ITPA 2FVCA 3VCDA 2BE9B 3FZBA 2A6MA 1PKUA 4H4KA 5J1EA 2AJ2A 1OO0B 1WUUA 3J81Y 5FIIA 4DWIA 4DR6F 4LSLB 1FDNA 2BMBA 2QJ3A 4J37A 5CZVA 1H2TZ 2PFDA 2V9WA 3V6HA 3PTWA 4O3SA 1S4EA 5ETMA 3KK1A 4IR9A 1F3VA 4Y6IA 2HQFA 4UZCA 1RHUB 5DG7A 4CCHA 2QRRA 5KFJA 1QAYA 1S4FA 2ROGA 2W4PA 2J9DE 3GLJA 2XSJA 4KGKA 3VQSA 1SL2A 2CUYA 3Q8SB 2XZWA 3BS9A 3MD1A 4USKA 3VAIA 4IRCA 3FFIA 5LJ3Y 2VG6B 1IKWB 3MM8A 5BYSA 1DAXA 4C3KA 2XMAA 3KK3B 4A8SA 4J9PA 1X31C 2RB7A 3BGUA 4WFZA 5HQ8A 4WP3A 3BH6B 3IGVA 4CLSA 2FY1A 2Y8YA 2D3UA 3H5SA 1OSCA 1IKWA 3MM8B 1UVJA 3C16B 4OJHA 4M5JA 1SXLA 3R5DA 2OGUA 1F0XA 2FPHX 2MMYA 2YQ1A 3GILA 1LWXA 1UFWA 3C19A 4YR3A 2HFNA 1T9YA 2Q66A 1WDDA 5LMUF 3ILOA 3A3PB 5FLXY 4U9RA 4I2PA 2C1EB 3K58A 4NCBA 5THWA 1PIEA 4U7CA 2R2RA 5A6PA 4B9NA 1IKXA 3AQPA 1HWUA 2B4PA 2JNJA 2DNRA 4U96A 2XYHB 3BN7A 4E98A 5D3GB 3FSXA 3KLIA 3BQ0A 1N5QA 2CZVC 2MQNA 2Q43A 3TNVA 4LSLA 3GJSB 1FO1A 2EPIA 2R3VA 2B0GA 2B7BB 2YNFA 4HVZA 3MR5A 2ZZNA 3TX8A 2KJWA 2CA9A 3DI6A 3IA0A 5DDPC 4IFYB 1U1OA 3S7RA 4K4ZA 1SJ3P 5EWGA 2M9KA 1VBKA 4DV5F 1ZPWX 1NDCA 3H5UA 2BA9A 1Q8BA 2FY8A 5LMNJ 2B9XA 4K5RA 4PG4A 4FXWA 3EICA 3RZAA 4KHPF 3MPYA 8RUCA 1FK9B 2YNGB 3DU6A 5ETVA 1KQSR 3LGNA 2HHWA 3MMJA 1TVRA 4MKAA 1VQMS 1SI9A 2JL9A 3I5CA 1NB2A 3BBCA 3DLGB 4TLQA 1RLCL 3CD0A 2KG0A 1TKDA 1KS2A 3MDFA 3M8PB 3ZZ0A 4YY3J 2I38A 2PD1A 2KYZA 1FCAA 4PXBA 1FNMA 3UDLA 1PC4A 4IDKB 3W2VA 4XPEA 2RUGA 4GVBA 4Q43A 3DRRB 2XHWA 4P73A 4HI1A 1HLWA 3FGVA 3SFGA 2HS3A 4U7UD 4WE1B 3QGIA 3GB0A 3H42A 1FFWB 2HSEB 3BDEA 4GC7A 2DGQA 4IKAA 4UY8T 3ZZYA 1Q0NA 3CC2S 2RS2A 2VONA 1UZDA 4PWDB 3LP2B 1ZA2B 3M8QA 2LXFA 2LXIA 1TL3A 3CE8A 3DXSX 3B54A 4Y34A 2QMXA 4HACB 1NJZA 3HD2A 1QSYA 3W2VB 4DS4A 1TQLA 1VQLS 3K5PA 2DNQA 4UOFA 1D9DA 5KT5A 5HLFB 1SCJB 4FYDA 4OLPA 4KHPJ 1N52B 4RNNA 4FVCA 2MJUA 2W9BA 1NHUA 4LRBA 1R8BA 1P1TA 1FVQA 4G65A 3HJFA 2QSFA 1JLQB 4B02A 3GMGA 4RKUC 2HQIA 8AT1B 3CGIA 4IG3B 2CQCA 4U6PA 3QZ7A 2F1FA 2OEKA 3IAS9 3QT5A 1BQMB 1XNQF 1HQUA 3PCOB 5HVGA 3DI6B 3KDNA 4PG5A 5KT4A 1WJ9A 3AQOA 1PJ7A 5IOLA 2B43A 3R8YA 2G9OA 3AOBA 4C11A 2WBRA 2B3TB 4EMDA 2Y1IA 4B3RF 4JBCA 4GVLA 2IA0A 4DV0F 2ASDA 1YG0A 4BS2A 3UFCX 2AHOB 3LP0B 4NLYA 4FYWB 2NYIA 4CZCA 2VU5A 2GCFA 3D5MA 4N77A 3RW7A 1MU2B 4DUTA 1CPZA 3TX0A 3BSNA 3ULHA 2A10A 4GC6A 1H73A 4HH0A 1VBXA 2BANB 4RBVA 1BXNA 4QWDA 1HNVB 1FKPB 3C14B 4I69A 1HBMA 2V4JA 3J81U 4TU9A 5CD4A 1NEEA 2XNQA 3PYGA 3MMCB 4ZPDA 3KMSA 3I9ZA 4OZ2A 3ZC4A 2G2YA 2AT1B 2FLOA 2EG2A 2QLFB 4A8OA 5CCMA 2VQEJ 2A2CA 3VVUA 2A0FB 3MOZA 5ETNA 1DRZA 2M4MA 1N56A 1SBRA 1F9FA 4NE9C 5ETPA 3CXCR 2KRRA 3EZUA 4C9DA 3IM8A 3JQMA 4RW4B 4Q5VA 3THPA 3C2PA 1EJ7L 3RR8A 2ZHBA 3JSRA 5C25A 4WIQA 3UQSA 2WCXA 3LGMA 2EFOA 4DDFA 4ZP6A 3SI8A 3NL0A 2XZDB 1U2FA 1VYAA 2VPXB 3O5TB 3ZTSA 4LRCA 3GCXP 3R5GA 2C2EA 3HFKA 4IRKA 1X5PA 3GYGA 2VJVA 5C25B 3KLFB 3CJRA 1R8CA 4DMZA 2QZ8A 1TUWA 2PA8D 3MM9A 5FD1A 4NLVA 4Y2KA 2CNLB 1Y3JA 4AE5A 1N0VC 5KFDA 1FDBA 2YKPA 3NOGA 3MR2A 2BABA 2CPIA 3GTYX 4HDHA 4NLDA 3LWLA 3SZ2A 5KG1A 2G13A 2HS0A 3PIPQ 3UR3C 4B3MF 4P2MA 2KXFA 2QYCA 2YKAA 3NWGA 2YX7A 3PFEA 2ZH2A 2VQEF 2VPWB 2GIFA 5J2QB 1QTMA 4A46A 4CLKA 2HQ3A 1X9WA 2V4QA 1NBEB 1R8PA 3BO3A 4L6V3 4OHWA 4NXNF 3AA9A 3QATA 5C7PA 3MM9B 4USIA 4BDPA 5ADZA 5IT4A 4B17A 5IV3A 4ALZA 3VGVA 5L1KA 2IJFA 3OV7A 2DNZA 3PXGa 2KFYA 1YZ7A 2XB2D 1BC6A 2GX8A 5KFOA 4B9TA 2H54B 1WF1A 3GFHA 1QVGR 1VQKS 2V2KA 1V6HA 2COLA 1JKHB 1UEVA 2V6AA 3D3CJ 5F8LA 3R1HA 1Y00A 4DF4A 2AJQA 2GZOA 4RW4A 4ZCKA 3K5OA 4AT1B 2HVEA 2AMCB 1UTAA 3A8EA 3KWMA 4I56A 4F25A 2E7VA 2IBOA 5MAOA 1HNIA 2NCKL 3QAUA 1S77D 1F5AA 3CO9A 3GR0A 4RWWA 4YB7A 2P9GA 4P72A 3TVYA 5D78A 5A8WB 4MAKA 3G2XA 5J2NB 4DOZA 2HNDA 2ZEJA 4WIIA 5HQLA 3M2UB 1LKZA 2HMIB 3I9V9 3T1HJ 2DR5A 3FBBA 3QIPA 1T9WA 4PXDA 2AEMA 4ZK7M 2FB0A 1VK8A 4BC7A 2W9CA 1HWLA 5HJXA 5AJ3J 1T8EA 4WF9Q 3HT3A 1NSPA 2Y0BB 3KTQA 3RB3A 3FDSA 3W65A 2MLYA 1NK6A 2E5HA 3TUPA 1Q5YA 1F9HA 3OR2A 5CA5A 3SV3A 2ZDPA 4LF1A 2R2SA 3TA0A 1U1NA 2E5LJ 1XNQJ 1YKWA 1TK0A 4A4JA 4M5LA 5G4DA 4Y0FA 1KC8T 1N36J 1KDNA 1VQPS 1M5OC 3PR5B 2RF2A 3R5JB 4F4WA 1RCOB 2ZUAA 4MK8A 1NUEA 2CQIA 1SPBP 4PKDB 4X84A 4A8XA 4ELVA 4R5PB 2K06A 1TP7A 2JX2A 1S9EA 1YBAA 3ZNJ1 2Q1LA 2R7RA 3CCMS 3LQVA 3M7VA 3Q0AA 3R5CA 3I0RB 5HSPA 2B5JB 3SSSA 2V67A 2C2ZB 4JI6J 1U6BA 4NZ0A 4ZPAA 4OI1A 4M5GA 4DSKA 1IBMF 3C6TA 2XTJP 4ZJLA 1M0SA 4EUVA 2X7IA 1HNWF 4LIWA 1KQFB 4MKYA 3CW2C 2C2OB 3S8SA 4DLEA 2BKNA 4DX6A 4GO7X 3PYEA 3FBFA 1O8BA 3IP0A 1FVSA 4I1TA 2MQLA 3D3BJ 5KFYA 2LP4A 5GADI 3OVSA 4DV3F 3DRRA 4FF3A 5A8RA 1RAGB 4UY85 1T02A 4OYIA 2OD4A 3JTPA 1R0CB 3NWRA 4O4RA 1WC4A 1CJTB 2KL8A 5AXMA 1NK5A 5SUHA 4WP9A 3DLKB 2Y1LB 5KOXA 2JZ5A 5HN0A 2DR9A 3EGNA 3IR7B 2DT9A 2V2QA 3CCQS 4B9MA 3OVBA 2Y1RI 4RW7A 2QV6A 3PW7A 2WONA 3NS7B 4ZS6A 3U1MA 4WFBQ 4DU7A 2QL5B 1ACMB 2ASJA 2F4VF 4DEZA 2RVJA 5E33A 1KTQA 2BE2B 4HT5A 5LSLA 2WOMA 5L1IA 4DFKA 4BC9A 1M5PC 3KJFB 3LPYA 4B3OB 3RBZA 1TL7B 2ZC3A 3F0NA 5K8OA 2GGPA 2YKMA 1S76D 2H4WB 3FEZA 5KFKA 1TMJA 4OYBA 1Y0HA 5C5JA 2MZRA 2HHHJ 1WI6A 1U49A 4B3TF 2HNYA 1HBMB 3AH6A 5ETOA 2VHGA 4TU8A 5FDLB 2J6TA 4ECVA 2ERRA 2E5GA 3CDUA 3OFGA 4HLBA 2GMJA 2K3KA 4DV2J 4LF4J 2CWXA 2V68A 4M1KA 4ZVTB 1RHQB 3CSKA 3KK1B 1W7WA 1YQHA 3DNCA 1J5EF 2V94A 3LPEA 1S9FA 2AX1A 2DXFA 2RSQA 2ATCB 3KKFA 2R7XA 5IM0A 2V2VA 3VV2B 3J7AN 5KG6A 4JI8F 4CM2A 3ET6B 3NMAA 2FGCA 1BHNA 1VQYA 2QLXA 3DFEA 1S1XB 1YZ6A 3EUNA 2UXDF 1JQGA 1O5JA 4R0JA 2XLJA 4Q44A 4XIUA 2JOQA 4UT4A 2F4VJ 1FJGF 5GAGU 4IG3A 4NLXA 2UUBJ 2F40A 5CYQB 1MMDA 2HBQB 4ZPCA 4NZ7A 4ED1A 2OPQB 3N6LA 1UEKA 5LM7E 4KPYA 1XEZA 3RAMA 1IWAA 5H9EK 1N4LA 3R97A 1JIHA 3SQGA 4CQ1A 3ITHA 1HI0P 4PWWA 4CM0A 2E1CA 4W90B 1GEHA 2CQ4A 3FBEA 3CJ8A 3MM7B 4H4KC 5J1NA 4RNFA 4B3TJ 4DSJA 3SV4A 1UL3A 3W66A 5JJBA 3KHGA 2ZHAA 1NJIT 1V5IB 2J9EA 1YJVA 3M2RB 2LEBA 5A0YB 4AXJA 1CQNA 4B9VA 2CPJA 4LVNP 4DUZJ 3O44A 2NXCA 4CLTA 1E6YB 3PACA 2B6AA 2NXNA 2HBYB 5F3TA 3M6UA 3R7NB 1UMJA 4AL6A 2OEMA 3DLBA 3SSQA 2DRBA 4X4RA 4M8LA 3G4SS 2BRKA 4URSA 2GQ2A 2EVZA 3UI3A 2NPFA 5B0DA 5J1EB 5HBMB 2R8JA 1ZYQA 2UXDJ 3IS9B 5IZHA 5DZ6A 2D41A 2OFHX 1W26A 5B08A 2OPPA 4LF8F 2ROEA 3M32B 4Y3CA 3GV5B 1IM4A 5E7OB 2V8DA 2XSFA 2BZ2A 4GO5X 5KFEA 3GV7B 2N3LA 3DOKA 1FD8A 4RWXA 3H5XA 3X1LB 1U2RA 1VHFA 4KIAA 2BR0A 3H5YA 2ZOMA 1FEHA 1QLNA 3MF5A 2HHUA 1GQEA 1SC6A 1WHXA 3CD7A 1K9MT 5I4MA 2PI4A 3PO4A 1Q5VA 2MSSA 4DU8A 2UUWA 4USHA 4ES3A 5HVFA 3OR1A 2MKKA 4PPDA 4BWJA 2EK1A 1NM2A 2IYIA 1U1PA 4F4AA 2F8MA 1YJRA 2V8VA 3DDKA 4DV3J 2KZZA 4MYTA 4WP8A 1I3OB 3KJVB 3NGKA 1NB7A 2VF3A 3E8OA 3V4IA 4FBUA 4CDIA 1LW0B 2MTLA 4F0HA 1S0OA 3GYXB 3HVAA 4DV5J 1FJEB 2FLPA 1S59A 4NZ6A 2Y9HA 1G1XA 4WCEQ 2FJDB 5DDRC 9ATCB 4TU7A 4WK1A 5DRKA 4YS2A 2W9CB 5BXIA 4DR1F 1ZM4A 1H72C 3A8JA 3WHIA 5L38A 5IQ6A 4NLGA 1BQNA 2ZOGA 3UN2A 5H9FJ 3NGDA 2DNLA 1RZMA 3IRXA 2CXEA 3CJ5A 4U8VA 3K8WA 3ZZPA 5L1JA 2HZVA 2YKNA 5A8WA 4NEYA 1S99A 4BWMA 1VQ5S 1NH8A 3HHDA 2MLZA 2IAJB 4NLQA 1X9MA 4ILLA 3FMBA 1GH8A 2DCLA 2FIUA 4OZNA 1KFDA 4M5DB 4C8NA 1S79A 3LANA 2DR7A 2OSRA 3GR1A 1DTTB 2HAIA 3RB6A 1QAJA 2GC8A 2PMZD 4DV7J 1JJ2R 4WFYA 3H7HB 2AYGA 4LBIA 4DG1A 1FERA 1D3WA 2DH9A 5F8MA 2C28A 4O3QA 4W92B 1HQEA 3I5BA 1WKJA 4C8YA 1OY9A 2AF6A 1N32F 2H4YB 2WTFA 2UU9F 4M95A 5AXNA 1VBYA 4QR0A 2QA4S 1NPRA 2QLWA 3PW4A 1P8GA 4C8KA 4QIFA 2VQFF 1N5VA 2OPSA 1VC5A 1EQ0A 3J7YI 2ZM6F 2K8GA 3D1HA 3IWNC 3H2LA 3O8WA 3ZXWA 3P49B 3DLKA 4KR0B 5CH7B 5EWEA 3Q8RB 2U1AA 1N5SA 1V3RA 2YWKA 4YDDB 2F9DA 3IAM9 4ICLB 2L3MA 2GVDB 2H65B 3EX7B 1XMBA 2EEYA 3RAQA 1U1LA 4F26A 2D7SA 3TAQA 3W60A 2OMOA 3CT9A 4ES2A 4B9SA 2H1YA 3BB5A 1HHQA 2RRNA 4G1QB 4DL4A 2A6OA 5HROB 1R0AB 1Q86T 4O3RA 1TAQA 3VGSA 3IN5A 3LAKA 4KV8A 2VBYA 4TKTA 4DUZF 1U47A 3CEDA 3TEHB 5BR8F 2KT2A 1NCLA 1TKTB 1JNRB 3AXMA 2J9CA 3MAAA 3MFHA 2KHCA 3HHLB 4KBIA 4LFCJ 5EX3A 1B3TA 2AGOA 2QEXS 3SBMA 3CDBA 4XDCA 5RUBA 5E3AA 4ECQA 4E8UA 4DL2A 4CT9A 3K2YA 1C0UB 4O44A 1N33F 3JTNA 2EI5A 4KGVB 4OX7A 1XERA 4NXMF 4ECRA 5DDQC 4H4MB 4RW8B 5HJYA 2ZH7A 5KFRA 2VB6A 2V5HG 3IGNA 3NGTA 2GAGC 4OYZA 5ETTA 3QT6A 1NZAA 5HI7A 1BQNB 5T14A 1HNXF 3RRGA 2XNRA 1LNQA 2OD6A 2MEWA 2KHDA 3UCGA 2HS4A 3EPIA 2D74B 4DR5F 4J9QA 1HPZA 1JMTA 3QT7A 2R2UA 1NXIA 4DPTA 5EDWA 1LW0A 5F41A 4USUA 4JI7F 2V4RA 4JI1J 2GQCA 4EFAC 5ETQA 2IVMA 4NLUA 3A4TA 1Q79A 2HHVA 1SH2A 3O1LA 1U8SA 1FDAA 2CQGA 2FTRA 1HBOB 2RT3A 2I2YA 5F0UA 1DZ5A 4ED6A 4EEYA 3AJ1A 2AYMA 2A1BA 2OMLA 1X9SA 2F63A 2CJBA 1FXRA 4EZ9A 2PA3A 3E01B 1OJ4A 3TZXA 2EXUA 4FXVA 4LF7F 1RAIB 1I5OB 1RE1B 1XNRF 4FXDA 1Q8KA 3DOKB 2IC3A 3I4PA 3QWUA 3H40A 5M2PA 2M88A 2YBVA 3RBXA 3LTOA 3TEGA 4I6WA 4QBUA 3GIKA 3ZZZA 4O3NA 1JLFA 2PE8A 2VPYB 3ENAA 4YN3B 4ER8A 4A47A 2F9JA 3VAJA 4PZVA 3T1YJ 2J9DA 4WXOA 1NO8A 1UFLA 3M8QB 5AE1A 2FLNA 3HT0A 4IFVB 2VFVA 1VRTA 2RKIA 1XMOF 2JEGA 3OUYA 1KOOA 2HFSA 4B9LA 3I0SB 1T0TV 1B64A 3Q2TC 3M9MB 5L9NA 2YWEA 1HD0A 2HHQA 1IR0A 1OWXA 3M2VB 4KGXB 4X66J 3Q2SC 1IKVA 3TWZA 3CCLS 4Z7CA 2LXUA 2YQ0A 2NQPA 3BSCA 3AA8A 1ZOTA 2Z2LA 3ADAC 3NBPB 3DGVA 5HROA 1S7IA 3CTRA 2YY3A 1RHMB 1SIWB 1YRXA 1EP4A 5SZTA 5C2CA 1L3VA 4Q0BB 3MEGB 3UD5A 2XQCA 1ZZNA 3FZ2A 3I6PA 3UD3P 1HL6A 2VC0A 3UVJA 2AJFE 2W4CA 3OXLA 3CNQP 1VIXA 3SCIE 4QWCA 1SB6A 2DIUA 3PW5A 1Q8LA 3BYPA 1IM6A 2E44A 2EFQA 5I3UA 1R6VA 3JSBA 4DL5A 1N5YA 3MEDB 1S1XA 2V8PA 4KPCA 1CS4B 4MK9A 4TYBA 4ZVFA 1UKUA 4N5SA 2JLEA 1WACA 2J0QD 3C3LA 1M5KC 2UUTA 1ZAWA 3D66A 3IC1A 3KLIB 4UUWA 2AZ3A 3H2UB 2C3UA 2LYVA 3I55S 1MN7A 1I6JA 1AUDA 2IYGA 4G1IA 4C2MA 3VALA 2XY5A 1PG5B 3M1VB 2DRAA 1P6TA 5BR8J 4LJMA 3MPDA 1TV6A 3I32A 5IT0A 1NNDA 3OFHA 3L3CA 4H4OB 2CPXA 3O3LA 5C42B 2MKCA 3H0PA 1S1UB 1AA1B 1K44A 2ZITA 3AFGA 3T41A 4OX9F 1N33J 4I0WA 3C16A 1G3OA 2AGPA 4KB7A 4DR3F 2EKYA 2GJIA 2NXUA 3TVKA 1YGYA 3C6UB 2HW3A 3RG6A 2EK6A 3KNGA 4CO4A 1R89A 5D0GA 2XWYA 5HQMA 3I31A 4FS1A 1VQ8S 4P74A 3JTOA 2E9ZA 4L75A 4DI6A 4B3SF 3IWLA 2HFZA 1MW7A 3QSYB 2CADA 4ZLLA 2DJWA 1JWWA 2BANA 1B4SA 4X62F 2UUCF 1TMMA 3AD7C 2XLIA 3MUMP 3QRQA 3KUEA 3LP1A 3QO9B 3VGUA 3PY8A 4LFAF 5A6WA 3OFFA 1QTNB 1VQ9S 3BF4A 1VFJA 2DO4A 3RW6A 2FC8A 3SYZA 1KEKA 2DHAA 1S10A 1CJVB 4HHUA 2LEPA 4RX6A 3IXQA 2IRXA 3E3XA 3FCHA 3QQCD 3V81B 3RBDA 2AWZA 4JI4F 3BKFA 2DB1A 1SV5A 4YB1P 3L7OA 1NH7A 2KDOA 5HATA 1RT4A 1SJFA 1RTIA 2PDAA 2LVWA 4NI2B 1MWYA 1WDTA 3CMAS 4AYBD 1REGX 2JEJA 1EETA 2NYHA 1QE1A 4LSNA 1D0EA 4Q2LA 4CLUA 4K4VA 2QT7A 4RUAA 2P6TA 4F2RA 4WTYA 1GTEA 2GIQA 4YQWA 3THVA 4DSLA 3B4DA 4KKOA 1LK7A 2OP5A 2CPDA 4R5PA 5E3QA 2FQQB 1ICEB 2OPPB 2BJEA 4K4UA 4X62J 4DR2F 4MT1A 5HP1B 1VQ7S 4V19X 1S1WB 2O5DA 1ZM2A 2J7UA 3N6MA 3WX4A 2K1RB 1FTCA 2RU9A 2BDPA 4X4NA 2V8GA 3SCLE 1QSLA 5G0RA 3JAMY 1XTZA 2RUSA 2L41A 4ETXA 3OUYB 1WTBA 1BGXT 3FNNA 3JYTA 2B6AB 2B56A 3K59A 4DFPA 2UUBF 4IFVA 3RRKA 4YP3A 4K0KJ 3RJMB 3ISND 2M3DA 2DK2A 2HIYA 3FUYA 2UV8G 1SL1A 4IDKA 1N6QA 1XWLA 1F5BA 3NP5A 3BBBA 1TZ0A 3MTJA 1BWEA 1KLMB 4P6QA 1N88A 1YRTA 2AW0A 1NSAA 2G1HA 2ZBCA 2I9SA 2WVCA 3MPUB 4IYQA 4KKOB 1ZPVA 1BY9A 3ZZRA 4UOGA 3I4HX 1WSRA 5K20B 1JXLA 9RUBA 3SQGB 3U27A 2GVZB 1V9OA 3D0GE 1KQKA 5F8JA 3NMRA 2OPQA 4HH1A 1H98A 2JVOA 1QVFR 1DY3A 3CJTA 2DVIA 4DQSA 2FVPA 1KVIA 3KLVA 2ZH9A 2P9EA 3N5FA 1X0FA 1NJWA 1T7PA 4DL7A 4UQGA 1BE4A 1GX5A 1HBOA 2ASYA 1YVFA 1IJEB 2EFGA 2VH7A 2XZTB 3HHEA 3J7ZT 3G6YA 3BQ2A 3V81A 1JLCA 2E7WA 4JV1A 4Q2MA 2VASA 2BKPA 3Q86A 5D3GA 1RABB 2KO1A 5LMUJ 4H54A 1WEZA 3GJRB 2H5IB 3HK2A 5LL6d 2YH0A 3F44A 1YX2A 1D09B 2ALYB 4DL3A 3GQCA 1O6XA 3NS6A 1KSPA 3CCZA 3QNWB 4JUZA 3KLHB 3DRPA 3W8PA 4NLTA 2QLBB 3BGRA 3OTOJ 2W7AA 4F3QA 3UNYA 5AJ3F 2HBZB 2WW8A 2KFZA 2W1BA 2VJUA 2BJ9A 5D4OA 4DQRA 4NX9A 2ZH6A 2CQPA 2O66A 4URGA 4PEOA 4RU2A 4EBDA 5KFZA 4PAAA 1JB0C 2XI2A 3UPFA 3OJUA 5CCLA 1U0HB 2CDRB 4ZVEA 1JLBB 2QGFB 4FYVB 4ZN1A 2A3JA 3A8IA 2XGPA 3MOJB 2C2NA 1GNKA 1DQ9A 3N0VA 4L3NA 5LJ5Y 3RU0A 2CQ0A 2YNIA 1YI2S 3K0JA 1SC1B 4MKBA 1UPMB 2YWFA 4ZPVR 1TK5A 1SKWA 2IM0A 3BM7A 2HKEA 1IWGA 3LAMA 4LUBA 4ZVPB 1UWAA 1LFPA 1TR0A 4ZJOA 5H1SV 1XC9A 1S1VA 2ZD1B 1CJTA 2ZH5A 1PBAA 1EARA 3J81j 1HHSA 3FK4A 4N7TA 5LT5A 4RPFA 2CWKA 3BBFA 5GVQA 1N36F 3GG1A 2RH3A 3QRPA 1RT1B 1GTHA 2GHPA 2MYFA 2QTWA 2GVDA 4ZVGA 1HI8A 1UJ4A 3TAMB 2Z8QA 1X4CA 2JH3A 4J9SA 4JI4J 2QSWA 5CQGA 3SMZA 1WG4A 1WOSA 4OYWA 3DOMB 3EVWA 1M1HA 3GE9A 3QLHB 1EX8A 4LR8A 4NOHA 3E51A 1ELOA 5KFWA 3MMCA 4WPAA 3UR0A 3HSZA 4ID8A 3OPKA 5I3UB 1X5SA 2WSFC 5IC6B 4CNZA 2W2QP 2XI3A 4EBCA 2ILYA 1XR7A 4MH8A 3KHLA 2CJYB 2VBZA 3I0RA 2CQBA 2FHJA 5E5NA 4DV6F 4OYMA 4LF5J 1WC1A 2CQDA 2R8GA 2CPYA 2VKZG 2W24A 1K8AT 5GADU 1S6PB 1WKLA 2WAQD 1JJCB 2XMTA 4G6VB 4ECWA 3C46A 4KQZA 5J2PA 1N32J 3KLEA 5JVHQ 1QUPA 1IKVB 4P9SA 1TU0B 2VPZB 2VDHA 2F4FA 5DO2A 2P6SA 3M2VA 2VG5A 3W64A 4EO8A 1WORA 2ZUGA 3WC2A 2ZBIA 3SDEB 1RQ0A 2AD9A 3BN4A 3GFZA 4IH6A 5IFMA 3QSIA 5ETKA 3KNAA 1FKOA 2IVYA 4CWBA 4ED8A 1B0VA 2GW8A 4XO0A 5HLFA 4FP9A 1G2EA 5IT9U 4S0MA 3FCVA 1Z2ZA 3KUHA 1JLFB 3NCRA 4XTTA 2R7WA 2DRDA 1U1QA 2OJ3A 1H2UX 5H9FK 4DV2F 4LF4F 3M2UA 4DQIA 1VRUB 2GA7A 4Q8EA 3OTCA 1UZHA 2DY1A 3WZ0A 2RD5C 1Y10A 2MHNA 2VBXA 4ZJQA 3JAMU 4X4VA 3A1YG 2AU0A 3GPAA 2CKWA 4QZVB 3V6DA 4O0NA 5D4LA 3MAHA 2VG5B 4F0MA 3FSIA 1JXEA 1U8WA 3C15B 2E29A 2HK2A 3N9UC 1WHVA 3UN3A 5DLGA 1S1TA 3DGPA 4FVMA 4X4SA 3ILJA 1HMVA 4GVBB 4OI6A 4X4QA 1S72S 3GIJA 3BYRA 3DKDA 3CCRS 1OS5A 2MKJA 3M8PA 3KUGA 5F9LA 1UVNA 2ZNYA 2F5GA 3NGSA 3POTB 3US5A 5KG7A 4DX7A 2ZBQA 2RU3A 3UWTA 4DFMA 4EZ6A 4KFBB 1UWBA 2XYGB 4OYAA 1RT2B 5KG2A 4OJ1A 2H51B 1QE1B 2GMHA 1TL1B 3MM6A 3SIPB 4MJKA 4QW9A 4GKKF 4ZVHA 4A8QA 3HJVA 1HQ2A 2MZTA 3BSAA 3HVRA 3TOQA 1RTIB 3EGZA 3LF0A 4RW6B 3TO8A 1NK7A 4NYOA 4KHMA 2C3YA 3A3NB 5F3ZA 4J9RA 4EU0A 1U4BA 2NZ4A 4QWBA 2MGZB 2CPHA 2MKIA 1FHTA 1FI4A 3D6HB 2BOPA 3DC2A 2HFVA 1A9NB 2KM8B 3DOMA 1ZETA 4Y2MA 1CJVA 1SH0A 2WZ1A 4C4WA 4I6YA 2KH9A 1YSJA 2CNNB 2B7CB 1DQ8A 2BJ7A 3W7BA 3KFWX 4F7VA 4M5MA 3TAMA 2NUUG 4I4BA 4Y2CA 2CVIA 4CO3A 4HT7A 4ZVRB 3W61A 3MR3A 2YVSA 4M5KA 4Q7AA 4NLWA 1FJGJ 3MI7X 1X4GA 5F8NA 3MMBA 3LGHA 1IBKF 2DNYA 3DOLB 3IBWA 5KFAA 3HP6A 3GSIA 3BSOA 1DARA 1P9YA 3FRYA 4QOTA 4FS2A 4ED2A 1MMNA 2MLXA 2EBGA 2JLGA 3AAWB 4TY8A 3MM5A 5CYMB 4LQ3A 2WVBA 2O1PA 3NGUA 1KN6A 3BPSP 1JX4A 1NSQA 2MQOA 3PG9A 4K5SA 4ZCMA 2BXJA 5GMKa 1PYTA 2E1MC 1S9GB 1M90T 5JUMA 4ANCA 1RTHA 4ZP7A 3NCPA 4X4UA 4DHVA 5HMXA 3W5ZA 4OX6A 1RU2A 4C8LA 2EC0A 1J5OA 4LF8J 1WF0A 1T95A 4ID5A 3UCUP 4LQ9A 3L7UA 5KG3A 3AB2B 2BV3A 1XIQA 5IM0B 1NK8A 1RHKB 2I8EA 2GMLA 4BBYA 3MCOA 2ZHOA 2PMWA 3ZTOA 2XEXA 3AY0A 3HI9A 3G8TA 4DUYJ 3CJ2A 3UD4P 2NR0A 1RT7A 4ANDA 3PJXA 2E5LF 1MROB 4DR1J 1L3KA 5GMEA 4KO0B 2EFVA 4DS5A 2OPRA 5KFFA 3UN5A 5GMDA 4I67A 1RK8A 4M5HA 4NLSA 3AJDA 3P5BP 1OYEA 1A0OB 2PSZA 2E5JA 4LREA 4JI3J 3SFUA 3L09A 2PGCA 3LA0A 2X1FA 4BLGA 4J9LA 1RWKB 4ED0A 4HHJA 3ISNC 1U7LA 1C1BB 2AJ0A 2VKRA 1IBCB 5DGAA 1QSSA 2PMHA 2PN6A 4YDXA 2AQ4A 2EBEA 2W9BB 5HK4A 5A8KA 5CYMA 4Z37A 3TUJC 4USMA 3HZEA 3I5AA 3AOCA 1Y5NB 1LV5A 1PC5A 1URRA 2DGUA 2DTJA 1PAEX 3U1NA 3VAGA 4YB6A 3K7RA 4OI2A 5LSRA 4EBEA 5DQGA 4KH0B 1WI8A 2CJXB 1C4AA 2QFJA 1X4AA 4JP8A 4O3PA 5DQIA 1NJYA 4PWDA 2IY5B 1G6BA 1RISA 2GV1A 4QIEA 2WB4A 4P7VA 4DR3J 2CQ2A 4ZHRA 1S97A 2DPJA 1WOPA 5KTQA 2Q79A 1IQZA 1UFKA 2YWGA 4DSFA 1S1WA 1O51A 2H9ZA 2KRBA 1WKKA 2J76E 5KFGA 3ZO7A 1T9TA 3DLLQ 2HHXA 4IOAQ 3T5JA 2OH2A 2J5AA 3PRDA 3T6BA 1CJUA 2OI2A 1BD6A 1KBRA 1NKBA 2KTQA 4J5OA 4BHQA 4GKJF 3Q8YA 4PXEA 4I7FB 4R8UB 3GIIA 3OSPA 3CD6S 1R7IA 3QMQA 1XR6A 3HPOA 2ZM6J 1TK8A 1V5VA 1EETB 4LFAJ 4OHZA 2MZQA 2MZSA 3W8GA 4N8NA 1X7VA 2BJDA 3A3OB 3ZFVA 2BRLA 4GKJJ 1YJ7A 4KE5A 3OTBA 3DGPB 4I6AA 1N34J 2ROPA 4TVAB 3D6MB 2FVSA 1TL4A 3BREA 5M2RA 4YR0A 2ADBA 4ZHRB 2WVDA 4ZN3A 4IO1A 2CJ9A 2XCPA 2FZGB 1YLXA 2ZVSA 2YXLA 3OR2B 1VBZA 4F2SA 1GAOA 4PYDA 1ZM9A 1D8ZA 1FD2A 1PJ6A 2BE7D 1LWCA 4K7QA 3T9NA 1F3FA 4FF1A 4I2PB 4C6AA 2WW4A 1ZTWA 1RBOB 3P3DA 3V4MA 1JNZB 3TZZA 4LFCF 2RAQA 1CULB 2QN6B 4CO1A 3VZIA 1HFEL 1M1KT 5J2NA 5B0EA 1QAXA 1NPKA 2G2ZA 3G87A 4O4GB 1JLGB 1R6YA 1Z1ZA 4P75A 4JI7J 1U09A 1Q82T 1REVA 2QE5A 2QL9B 3DRXA 4USJC 5K14A 6FDRA 4TQRA 4ECTA 1CQMA 3HX9A 3UCZP 1Q81T 3SQOP 2BKOA 4V1Ak 1Q53A 1ZAXA 3VAHA 2KYXA 3CJ4A 4FZVA 3UDCA 1RADB 2B8QA 3UDVA 1UA1A 1SC4B 3D1OA 1GX6A 2H5JB 2D9OA 2LECA 4B3RJ 2QLJB 4U8YA 4KRWA 4FF2A 3S6EA 2GIRA 4WJBA 4DZ6A 1K73T 4DPXA 3NAHA 4WKRA 1YBUA 1DTQA 4I68A 3HXMA 4ECXA 3NGRA 2WVFA 4F04B 4A48A 3IWXA 1F2HA 4ICLA 2V8HA 2DXEA 1KQGB 2YX4A 5U47A 4EGLA 1HD1A 1YHQS 5E3CA 1RTJA 2Z2YB 5J2QA 2UVUA 4OI4A 3HHNB 4DPYA 3PRBA 3K5LA 2Y1JA 4WFNQ 2IMWP 1RUSA 3QLHA 2HEKA 1BLUA 2GGPB 3KJQB 3IR6B 3R6GB 4HR2A 4QIVA 3VHQA 2LA4A 3PV8A 2YH1A 2WSCC 2DH7A 2EC2A 4G3IA 5BYRA 2FJBB 4NCAA 4DR4F 4B9UA 3UE2A 4PCQA 2PIIA 2BE2A 5DG8A 1Q95G 2IHR1 2UP1A 2CPEA 3R9LA 4F8RA 1FJCA 1HQEB 3V6DB 4FNIA 1LWEA 4A8KA 2MKHA 2YTCA 1DQAA 1Y5LB 1U0SA 1LW2B 2JC1A 4CNYA 3LUYA 3DCAA 3MUTP 1VJQA 4DPWA 5BJRA 4ZP8A 1F1BB 1YJNS 4C3MA 1KP6A 1Q4RA 3H2VE 4QPTA 4CIOA 4UOCA 4P2FA 5A8RB 4LT6A 4QWEA 1HWKA 1VMBA 1KHWA 1LQ9A 3EWGA 1FX2A 3G71S 4KH1B 2VICA 2DHXA 4P10A 4I64A 1VOMA 1FF2A 1U24A 1D9AA 1R31A 3R3TA 4QR2A 3P96A 1JK9B 1WEYA 1XR5A 2KU7A 4OHXA 4MMOA 4OV1A 3W2WA 2PEHA 1EKSA 1NLKL 3FCWA 5LXYA 3NLCA 1I94F 2DISA 4MFBB 3KK2B 4N76A 1C1CB 3W5YA 1IKYA 5K8PA 4ED3A 4CO5A 3FQLA 1R8AA 1LEOA 3WBZA 3EZ5A 3THTA 1C4CA 1UEUA 2B5JA 2X1AA 1YIJS 2RQ4A 1FKOB 3AB4B 4WBFA 5C24B 1UVLA 1RBLA 5EHHA 1UPPA 3ZTPA 2UUAF 4AUKA 2L48A 1WD6A 2BQRA 2B9WA 2HFUA 4OI3A 2KKHA 3DLHA 3CIMA 4LMZA 4YOEA 2R7QA 3CC4S 2RRAA 4IH7A 1TUVA 2FDNA 3TZYA 4DV0J 2DNOA 4PXCA 5L39A 5JVGQ 1HQUB 4PQUB 3CUNA 1EHWA 2RQCA 1N8RT 1FE4A 4YUDA 1P27B 2BQUA 2V0NA 3MR6A 1U26A 1NK9A 5KFXA 1WC6A 2GJFA 4O0IA 2XLKA 1NK0A 4MK7A 1IR2A 1BMQB 1C2PA 1TKXB 1QD1A 4QJVA 1XK8A 2DNKA 2JSXA 2ZWOA 4UUXA 1IUJA 3AD8C 4KGMA 5DM7Q 2LQJA 4RBTA 3QFWA 3GJTB 4DCPB 1EQMA 4ZITA 3K5MA 1NHKL 2VA3A 2HBRB 2KI2A 2GFFA 2HNZB 1AXQA 5D15A 3TQEA 3SXLA 2KXNB 4QU6A 4YY3F 2W2OP 3MPWA 4LSZB 2KM8C 2UUAJ 1DHMA 4DR6J 3BGLA 3M8ZA 1FEEA 1OY8A 2GS8A 2V2ZA 2PEBA 1PGZA 1M5SA 5E3PA 3HVWA 3BJYA 3DN9A 3MEEA 3DYAB 4ZPBA 2YQ3A 2UVRA 2DNGA 1TKZB 3BKUA 2BEFA 1J2VA 1M5HA 3DU5A 3HVTB 2FZKB 3HHLA 3NEKA 3M2RA 5B0GA 2UUCJ 2JJ4D 1TKTA 5LXRA 2ASLA 2DNHA 2WB1D 4CTAB 3R27A 3RTVA 2C3MA 2QYGA 2GO9A 3JXOA 1KTVA 2UVVA 1LFWA 1VR6A 4PQAA 1UVKA 4U7UK 2FHOB 3BV8A 5KOWA 2YNIB 4LFBJ 1WC0A 1QJHA 2WK4A 2CG4A 3PX0A 1T9UA 1S12A 3CVKA 3O6QA 4NI2A 4OJ3A 1U0HA 2CVEA 3IG1B 5CYQA 2R8HA 3O2IA 4JI6F 1TFWA 3J7A1 4C0BA 4J9VA 2Z4PA 1PILA 2YKQA 1B70B 4MYUA 3TA2A 3CMES 4OFZA 1U25A 1WG5A 1WWHA 3BPDA 5JMNA 5HO4A 2R7UA 4OMFG 3BGOP 3ELHA 1T9XA 3BGRB 3HZGA 3MGJA 3DXBA 1VQOS 2DD8S 2RHSB 2Z2MA 4MTPA 4OX8A 2BVZA 3VF0B 3Q8QB 2UXCF 3EYZA 3WIUA 3CB4A 5I3QA 1RI7A 5GAGI 4WKYA 1RGVA 5HANA 1H6KX 1FX4A 2FD2A 1GXLA 3U1LA 3LWMA 4DXLA 1HYSA 2DCUB 2IVFB 1F6TA 3ETMA 3M30B 4JV5F 1RDRA 2NUHA 4NWBA 2XC9A 3B78A 3ONQA 3NNAA 1FE0A 3IFEA 1FRMA 3MZIA 1O0PA 4CLZA 3OQ2A 3OJSA 1YITS 3LO3A 1TUGB 1I1GA 2J6UA 1APSA 1U6ZA 4YEAA 4OJGA 4LFBF 4FYXB 1GK8A 4ENOA 5H9EJ 3HSJA 4ED4A 4OZ5A 1NJXA 2VFTA 3N6NA 5KFLA 3V6KA 4K0KF 4NLRA 2WOMB 3T3FA 3KHHA 2IA6A 4IQXA 4RO0A 5AE2A 5GAHI 4J9MA 2JFDA 3T1HF 2GVZA 2H48B 3EGWB 3S1TA 3CCJS 2ATLA 2HPUA 4N47A 5KFUA 2HG4A 2R9LA 2JHEA 3MM5B 3CF5Q 4JI2J 1QDUB 3P8BB 2CQ1A 3IRXB 1XJWB 2Z30B 5KFHA 2I1RA 1HNVA 4HTIA 1LOUA 5KT6A 2W9AA 3DRPB 5MLCV 3NNHA 3H4DA 3D0IE 4ILRA 3M30A 3T1AA 1HHTP 3T1YF 3FMWA 5J1PA 4R25A 1TKZA 1IBKJ 4JV2A 1DFDA 3KG1A 3GFXA 1S0MA 2YNHB 1XMOJ 2FHMA 2FLLA 3JYTB 4RU9A 2MXYA 2VBWA 3QYYA 2C2DA 2KVQE 2YKOA 2K7KA 4J91A 3S01A 2AYEA 3PHEA 3N5BA 4ATNA 3HMJG 4K59A 1BQMA 3ZZTA 4AQYF 3VGTA 4KYZA 5DS7A 3ENQA 4TNOA 1S7HA 2DPIA 1X4FA 4U95A 2VOOA 2RQMA 2IM1A 3G82B 1S0VA 5F8GA 2OSQA 4CP5A 4KJIA 3PKMA 2N4CA 1WTFA 2IRUA 3NRBA 3H25A 4PQUA 3AHPA 3J80Y 4KFBA 1YJ9S 3MECA 2AEJA 4DV4J 2BJ1A 3J7Z5 1A7GE 3GG0A 2N7CA 1SL0A 4DPOA 4HACA 3G6VA 4ZLJA 1R0BG 4MIWA 1N6QB 4MIBA 1G7CB 1YRUA 4A8YA 2ZJQQ 2D3OR 2ZZMA 2CNOB 5KT2A 3B82A 3OTEA 4NASA 5KFVA 1UJ6A 2FUG9 1DJ0A 4JI3F 2DHSA 2L08A 3T5LA 1VRTB 3I82A 1AZSB 3DMJA 2D3ZA 2N3OA 3DRSA 2FHKA 3EE3A 4O3OA 4L74A 3BO4A 2C2RA 3MWBA 1U6FA 1MSWD 3SCKE 1ZTTA 2CZ9A 1FWLA 4F50A 3HSGA 5KFMA 3PW0A 1MMLA 2E5IA 5DQHA 3VAFA 5A8KB 4JYAF 1T11A 1IXKA 3KK2A 1WHYA 1D9FA 2J7WA 3D0HE 3D9BA 4X4OA 1RWXB 1SUQB 3VAKA 5F8IA 1HNIB 4DQPA 4IR1A 1U45A 3E01A 1K0VA 1QM9A 1VQNS 3JSMA 2HHHF 2O67A 4RL1A 2I0XA 2LFVA 2G0JA 4P52A 2XY7A 2IM2A 3D54A 2QL7B 4C8ZA 2YNFB 4WYLA 1YTYA 4PG8A 4B3SJ 2XO7A 5DM6Q 5J2PB 2CPZA 2E1AA 2R42A 2AYBA 2BOAA 2NSCA 5C42A 1TTHB 2A2DA 4DSIA 3NS5A 2D69A 3OLAA 4DL0C 4DJBA 2M8DB 2KFNA 2IJNA 1D1UA 2Z2ZA 4AD6A 3MPVA 4OZ3A 5IQQA 4LVOP 4QQBA 4JI8J 2E9RX 4FBTA 2D1CA 1WC3A 3GIRA 7AT1B 1NHVA 2HFOA 2ZBPA 4F4XA 4CLWA 1OSDA 3HHKA 2GHVC 3PW2A 1U48A 4IRDA 1VGYA 3KDOA 3NNCA 2KJVA 2AP6A 2DGVA 1CS4A 4NMXA 1J5OB 2R8IA 1FRKA 1VS3A 8ATCB 3P4UB 2CJAA 2YKMB 1FRIA 4RW8A 5K5MA 3PKYA 2XWXA 1TL7A 1IBMJ 4P7TA 2J6SA 5L1LA 5D8HB 2DITA 3ENVA 4JI2F 5B7WA 4IO9Q 1N48A 1PYSB 2YX1A 4DLGA 4NCGB 2EKNA 1N54B 3PVXA 2LMIA 3CWJA 4KT0C 5CHCB 4Q0BA 2YWHA 3G96A 3TRGA 2OELA 3LH2S 5HMYA 2I5JA 1ROFA 5I42B 1HR0F 1HWIA 4K4SA 1F2GA 2Q3PA 3TJ9A 1LW2A 1L5UA 4CTAA 5IT9Y 1ULRA 1RHJB 3D28A 5DETA 4OZLA 2ALZA 4KY3A 4UW2A 3TVZA 3MEKA 2NPIA 1U2CA 3FEYB 1RCXB 2QA2A 2XYPB 1ZAVA 2HLUA 4ZLPA 1T94A 1VDHA 2M52A 3CJSA 2HYIB 4KTQA 5DDOC 1REVB 2D9PA 3B8HA 4L3KA 1YDLA 2OFGX 4TN2A 2DNMA 2HVZA 1RYRA 2J0SD 1Q7YT 4AL5A 2LQBA 5KG4A 3P6YC 4K2XA 4HTJA 3QRRA 2DEJA 2WVEA 4RNOA 2XM3A 1VCTA 1DBDA 2V50A 3GIMA 2CYYA 4ECUA 1TL1A 3MM6B 2C3OA 3EVMA 3U7JA 1XMQJ 2MQPA 4USTA 4DBQA 2IC3B 3MURP 2L9DA 5B0FA 2AGQA 3KXDA 3ISZA 4USVA 4RUBA 3MAQA 2F7VA 1Q7LB 2QFIA 4NA3A 3VZHA 3DLJA 2B4VA 2ZDOA 1JLCB 1RWOB 3ENWA 4ZDNA 2G1DA 3AOAA 4LR9A 1RT5B 2KT5A 2Z56B 2MPUA 1HBUA 4C7QA 3NKYA 4K4XA 4DL6A 2MY8A 2HHPA 2VG7B 5HMWA 2MZJA 5K14B 4QYRA 3HSDA 3IO1A 1ZS6A 4F67A 7FD1A 3JSMB 3TZWA 3PX6A 4OHYA 3DHXA 1SUQA 3J80U 1RAHB 2VIHA 3Q8VA 2XY6A 4NXMJ 2KZMA 1TAUA 1UW4A 4R8UA 4JOUA 3DM2A 2GO8A 1Z4UA 3ZTRA 2FYXA 1X4EA 1SVDA 5E0OA 2HQDA 4QW8A 2HZAA 5KFIA 2HVDA 1BWVA 1K1SA 3ILIA 3M9NB 4CRJA 2ADCA 2EWHA 2P5VA 4U67Q 3QIPB 1EAYC 5D0RA 1AW0A 4OV6A 4X65F 4CLYA 2MQMA 2K3IA 5KFBA 1RKIA 4A8MP 1LWCB 2ZC4A 4QCLA 1B7FA 3DRYA 3LP2A 3ZZUA 4L72B 1VJWA 2HIQA 5HL7Q 5ITHA 5DJBA 4X4PA 3OHBA 5G0RB 5KT3A 2AV5A 1CJKB 4HDGA 1Z2LA 1C0UA 4O44B 4DCOB 5IWAJ 3KHRA 2Y0SD 4EYIB 3KG4A 3W9JA 1T3NA 4YHHJ 4ZVQB 1VHIA 2BX6A 2ZZTA 2AX0A 4X64F 1MN9A 2MB0B 4F4YA 3PM9A 4C0HA 1IJFB 5HP1A 2HVHA 1RT5A 1I51B 1JLAB 1YWXA 1I94J 1GXUA 1JXVA 1ZM3A 1CLFA 1H2VZ 1S6PA 2UU9J 2B9EA 4ZVUB 1HBNA 3MECB 1FRLA 2IJRA 2LDYA 2LA6A 3GSDA 3U02A 4DCJB 4JV0A 3Q8UA 4WU2A 4ZPTR 2VQFJ 1SKSA 3CULA 3CDEA 5L8RC 3EPGA 1Q1KA 2P8IA 1S48A 3PYDA 1C1BA 4NPOA 2W8KA 3DLEA 2W7OA 1SC3B 2CDQA 1GMWA 3IS9A 1W2IA 4YR2A 1OYDA 2HK3A 2BACA 2QMWA 1FRXA 2NXEA 3ZZOA 1DURA 1AUSL 1SKUB 2X3GA 3CPWR 2CRLA 4RUCA 3H90A 2I6WA 2QG9B 1B0PA 2L9WA 3LOUA 4FKXA 4M5NA 3WQPA 1NAQA 2ZKUA 3TJ8A 2KG1A 2UV8A 1J5EJ 3EZOA 3A8KA 4FDFA 4WU3A 2VC1A 2FJEB 3F41A 2DXDA 2VZ9A 4RLEA 2X3DA 4E0DA 4WYWA 1E6VB 4KV8B 1KLNA 3X3UA 2QIFA 1SJRA 3PHTA 3PEHA 2HWHA 3ITHB 4NMLA 2IBKA 3BKTA 1C0TB 3CCTA 3HLUA 4QYZJ 2WRMA 2OEJA 2DNNA 3OFEA 4KHRA 2ZH3A 1HI1A 1VLYA 4ZOSA 3PO5A 5IS2A 2IAJA 2Y3YA 4C48A 1MNEA 3KK3A 2JC0A 5E2QA 3GU0A 3PNIA 4FPRA 5J2MA 1SJ4P 3BZQA 4ZKAA 1AB8A 2ACMA 1NDPA 1Q78A 3PRVA 5KFPA 1EKRA 2NZCA 3CJ0A 3KLGB 1RA6A 2J8AA 1XMQF 1UP1A 1FKPA 5B0BA 2ZE2A 4N56A 3F56A 1FTRA 3MMBB 1R27B 3CJKA 2UVWA 1KOHA 4C0OC 2KXHA 5KAKA 3MR7A 1V3ZA 2MQQA 1TFYA 2N7YA 1H7XA 2KB2A 4EI2A 4OYPA 3QWPA 4Y00A 1SIZA 1H7WA 4F4KA 1SH3A 4J7CA 3LP0A 3N4WA 1B99A 3HFZB 1N34F 1WF2A 3OVAA 2CQ3A 3GFYA 2VD3A 3N79A 5ETSA 2W2PP 3CJQA 2HQCA 4D3HA 1DTTA 1FNOA 2ZJRQ 4DV1J 2VFSA 4K50A 4CLLA 3MFIA 4K4WA 3T19A 1RWVB 2JRSA 4M5IA 4M5DA 5D77A 1FT8A 2XG8A 3M6XA 4ELUA 4PR6A 2LDIA 3W1YC 1JLQA 3MCNA 4G1PA 2AJ4A 2LLZA 5DG9A 1XN9A 2UZAA 2R8KA 1EB0A 2HLTA 3UW1A 1Y3KA 2M5YA 1UWBB 2F65A 2RDIA 2X1BA 4GKKJ 3K57A 4K2JA 3CIZA 4CT8A 2OKQA 1CJUB 3UO0A 1RXOB 3FEXB 1TELA 2ABYA 3HF5A 4D3GA 2GAHC 1TL3B 2RIJA 3LALA 4LR7A 2MJNA 5DGBA 2E7XA 1LK5A 1L3UA 2E1RA 3UDEA 3DYAA 1SQEA 2LU1A 1NDLA 2U2FA 3D7SB 3FVYA 1OQ6A 4MIAA 2ZH4A 4X64J 2JLFA 2Z58B 3D6FB 4NA1A 5D0HA 1CJKA 3EMTA 1HIYA 4X66F 3KJVA 3IRWP 3K5NA 4J9NA 4P2SA 1F9EB 3BGFA 3QGGA 2JWNA 4WE1A 4XK8C 5C2GA 3M8WA 2R7SA 1AYEA 2O3DA 4KSEB 2JDJA 4M94A 2NXJA 1V3SA 3QGPA 4DF8A 1J27A 3IBCB 3OL7A 2LKZA 4EO6A 2RDJA 3QAEA 3SSRA 2H3EB 2IIHA 4IG0B 3KOAA 2FHJD 2J0XA 4A8WA 1JJ4A 2B4UA 2KN4A 1N0UA 4PG7A 4EYHB 2HRYA 2NS1B 1X5TA 4ED7A 5KT7A 2HRUA 3D67A 3Q24A 3FBCA 1L3TA 1NU4A 1RWWB 2VFUA 1RAFB 3CCSS 3QZ8A 3OW2R 2QX0A 1XQIA 2G2OA 2CG8A 3R1LA 2OIHA 2VG7A 3H59A 4DR2J 1SV5B 3TP2A 5CABA 3AXKA 1Y7PA 4DR4J 4ZCIA 3NOCA 1CC7A 1U02A 3C15A 1RTZA 3IBFB 4AFFA 3GZ7A 4QIGA 1OPZA 4F4ZA 4DR7J 1ZH5A 1F5CA 4Z7YA 1VQ6S 1MROA 1SQGA 3MHYA 1RT7B 2DYAA 1U1MA 2DO0A 4C97A 1CEZA 2DKOB 2LCWA 1NK4A 4GRSA 1HPZB 5IXUA 2GNKA 4UZBA 1WEXA 5DLFA 2AIRB 4F36A 3TANA 1GXTA 3A13A 5FDLA 4WZMA 1WNEA 2X1GA 2YPYA 4OZ0A 4F0KA 2OAUA 3KLGA 2HNDB 2HMIA 2JFKA 5K9FA 1HWJA 1W2BR 3JSYA 2M8HA 3HHLD 4NLPA 5B0CA 2RE1A 5J2MB 2ZFHA 2R4FA 4QIWD 2DR8A 1RTHB 3EJMA 4FN5A 3VWSA 3FSYA 4QYZK 3BH7B 1OPIA 3M8YA 4ES1A 5CYJA 2JEFA 2B8PA 4W4MA 2ZVIA 5F0WA 3QJPA 1C0TA 1CSJA 1IVZA 3PEJA 1JKHA 2EG1A 4KC5A 5D4NA 4ZP9A 1UVMA 4TY8B 3G9CA 1S1VB 2ZD1A 3DHWC 2EFNA 1E6VA 3TJAA 3ZTQA 4DV6J 4DR7F 1GFWB 3MMAB 4RBUA 1SQFA 4H4OA 4G1QA 5AXKA 4K4TA 1KR4A 3QIDA 4J9KA 1ZBTA 1HYSB 1S49A 4CH0S 2XMMA 3W62A 1GMWD 2VA2A 1RHRB 2V34A 2BBEA 3BR9A 1Q8IA 3QGHA 3R7BB 5HMZA 2BQ3A 2RDDA 1IQTA 1RACB 1UETA 2N4DA 4DV1F 2ZBRA 2YWWA 2DGSA 4ERDA 3L95X 2BM0A 3OTOF 2DGOA 2GQQA 2G4BA 2FJWA 1RT3A 4NLOA 1VQ4S 3MCSA 3IMQJ 3MEDA 5KFTA 1T3OA 3Q22A 4GMKA 2XS7A 2HGMA 2KT3A 1RTJB 1JJHA 1SKRA 4Y65A 1U1RA 4B3OA 4RW6A 3KLHA 3IG1A 2LQ9A 4PUOB 2C2MB 2A18A 3CMQA 3OT9A 4Y28C 1YK9A 2FVRA 3W3SA 4OL8A 2FZCB 3TQ1A 2ZH8A 1RYSA 3M8RA 2MKYA 4DG1B 3HO1A 3MMAA 1HBNB 3M6WA 3NBPA 4CO0A 3HULA 3BEGB 4JI5F 1FA0A 4IQMA 2FVQA 1K47A 1KVKA 2HRTA 3KMQA 2HQGA 1OQ3A 1UAWA 3PR4A 3CCVS 1EIYB 3T9ZA 3FJ2A 1FXDA 3HHLC 3PFOA 4TYAA 1S1TB 1IBLJ 4LRFA 3HDSA 3CDWA 2W2NP 3MEEB 1JLBA 1UJ5A 5K8NA 5KG0A 2CPFA 2UXBJ 2CNKB 2OTJS 1FRJA 1JLGA 1BUXA 4YMEA 1TL5A 5LOQA 4FYYB 1SJ1A 3VR1A 2R7OA 4LIRA 1URNA 3C6TB 2Y8WA 2V4JB 2AJ1A 5KFQA 1NMEB 2B51A 2RRBA 2Z0GA 4DSEA 3CD5A 1VK3A 2KVIA 3PJ9A 2UXCJ 3Q89A 1HR0J 1AZSA 1MU2A 1PAUB 3DMJB 3IR5B 3DM2B 3VVTA 1T05A 4I2QA 4ECSA 2BUNA 5KFCA 2IM3A 4JV5J 1AFJA 2XO6A 3TYTA 1JLEB 1VI7A 4NYPA 3PZPA 1FKAF 2R7VA 4ZLNA 4N41A 3OR1B 4IH5A 2DGWA 4FPIA 2W25A 5F9NA 1W25A 2CJQA 4LRAA 3TR5A 3BDPA 4RR5A 4AL7A 1FNXH 3MUVP 2ZKTA 2PC6A 3DDIA 4NA2A 4OYOA 3W5XA 5A2QU 2OTLS 3M05A 4B3MJ 3OXFA 1SJQA 3A12A 5KFNA 4ECYA 3R2CJ 1X4DA 3AT1B 3MTKA 1T05B 5F8HA 3L4BC 5CZXA 1YJWS 5EUHA 4PRFA 2HWIA 4RNMA 3KG0A 2C22A 2CIMA 4N8OA 2XMJA 3H20A 4IG0A 2CJKA 1FDDA 1HA1A 1NDKA 1UW9A 3KJNB 5E41A 2VODA 5K8MA 3BQ1A 2VOPA 1NPPA 3R5BA 2WHOA 4P2XA 1IKYB 2PFFB 1LXJA 4MFBA 4Q8FA 4EWTA 3OL9A 1HKAA 3RRHA 2PT0A 4J9OA 3TARA 1F60B 1RAEB 1CC8A 4C98A 5CXTA 4NXNJ 4ZMMA 4CLPA 3JB9k 5KG5A 2RQKA 5BYQA 3JQJA 2IDLA 2XMWA 7FDRA 4IOCQ 3LP1B 3QO9A 1RWPB 2BJ8A 1H0HB 3NAIA 3NG8A 3UNGC 1PBUA 1FFSB 3H8YA 1RTDA 2MQ8A 1AFIA 3QBCA 2I5JB 5I42A 1VC6A 1HNZJ 3EVOA 4LBPA 5L46A 4OX9J 3GWCA 1GMUA 2ACYA 3AD9C 1RJJA 3NCQA 2Z57B 1K0TA 1FK9A 2YNGA 2POKA 3GYNA 1RB0A 3M4XA 4LSNB 5I3PA 5B09A 3R5AA 2VV5A 1T03A 3QJJA 2PI5A 3JS9A 1K1QA 4AXIA 2W7PA 3I56S 1PO6A 1CVJA 4HKQA 1XBWA 3WDOA 3TI0A 3NXZA 2DH8A 4AQYJ 2RS8A 2SXLA 4Y2AA 4ZA1A 5LMNF 4JYAJ 5IWAF 1X5OA 1R43A 1YBTA 1RT3B 3HCXA 5D6GA 4V19J 1RWUA 1A6LA 4WWSA 1FWKA 1PSDA 3C14A 5B0AA 4DN9A 2OPRB 4ETZA 3BO2A 3RAXA 4R0EA 2FGOA 2OPSB 1RWMB 3GONA 5AXLA 3VAMA 3ILLA 1Y4ZB 4O23A 4XDDA 1IKXB 4OYXA 1MWZA 1DTQB 4NL5A 3W63A 4RZRA 4J9UE 4LF9J 3G86A 3HKWA 1OMSA 3KLFA 2W8LA 2M7SA 2ZJPQ 1KONA 2BW2A 2E9TA 3CJKB 4QWAA 6AT1B 2ZE2B 3EDRB 4NRUA 1MLAA 4C11B 1S0NA 1N5YB 2UXBF 5IC4B 4OI0A 1VLOA 2DR6A 3Q8PB 3OD2A 1RP5A 4K8RA 2DHGA 1KHVA 1HNWJ 4C3LA 3VQTA 3TUZC 4TQSA 4DQQA 1PCAA 3AODA 4LBHA 1T03B 3FRZA 4LF7J 3RYLA 2F8EX 2VG6A 2WONB 2F8HA 1IN0A 4O4GA 4ZPWR 4CI0B 1KRPA 4ZCLA 4Z2XA 3CO0P 4NYZA 2XSJB 2APOA 1S6QB 1CULA 3DOLA 1KLMA 1UVIA 1LWFA 3K8VA 5CAAA 5A76A 3G6XA 5EN1A 1T9VA 3CCES 4RUHA 1TV6B 2MDAA 3F73A 2K2PA 4Y2IA 3QPIA 3I96A 4WFAQ 3J7YU 2G0CA 2YPZA 3D68A 1X0PA 3TW0A 4CO2A 3HM9A 1B0TA 1UA0A 1RLDA 2LEAA 2XS5A 1RSCA 2XMUA 2BYCA 4TLRA 3W9IA 4JI0J 3I0SA 3SEOA 1FXLA 1FRHA 3OLBA 1QY7A 2C42A 2P2CB 2QO3A 1RAOA 1VIOA 2RKIB 2W01A 1X4HA 2K7JA 5AT1B 1WOOA 2DNPA 3I87A 2MGZA 2HNZA 5D4PA 1DLOA 2MHEA 1NSKL 2OUGA 4MKVA 2OO4A 5HVHA 4DX5A 3BR8A 1OY6A 4UTGA 2FJVA 3D1QA 5EGYA 2AZ1A 1RT6A 1TVRB 4I7FA 1EP4B 1RT2A 1X4BA 4HL9A 1RT6B 4PABA 3CCUS 4ILMA 4L73A 1S9EB 3G82A 4FNHA 1HW8A 3POTA 5GAEU 3T5KA 3OSNA 3HD1A 2G0IA 3QT8A 1NKCA 1JLAA 3L9ZA 1Q16B 5ETRA 4LF5F 2P9CA 3SCJE 1HMVB 2IRYA 2RMLA 1DLOB 4IFYA 4TXSA 4USWA 5A2QY 3TUIC 2RF2B 2RNEA 2V9KA 4ITSA 3P45B 1RU1A 5IV4A 3OHAA 4F02A 3G8QA 3HFVA 4TY9A 4WFXA 2J7KA 3EDQB 2N82B 4OZ1A 2HGLA 4ZVOB 1FESA 4PWUA 3PIOQ 4C8OA 3P5TL 1CG2A 2XMKA 2YNHA 5C24A 4X2BA 3K17A 3C8YA 2Q6CA 1VRUA 2B9YA 1HNZF 3WX8A 3B4MA 3M8SA 3FQKA 2VFRA 1HNXJ 2JEIA 1LWFB 2IDEA 2QC3A 1S6QA 2W4DA 2BM1A 4EK2A 1VISA 2AKWB 3DLGA 3MM7A 3VTIA 4DR5J 1QAIA 4FF4A 1C1CA 2DGTA 4UF4A 5T41A 5JXSA 4DFJA 2C3PA 3PDNA 3CCWA 3QFHA 4QR1A 4RNHA 3W2WB 1KD1T 3SDEA 4JI1F 1S5ZA 2IPOB 4FKYA 4YB5A 3C6UA 1L3SA 4LRDA 1OIAA 2HAFA 4A8FA 3QJLA 1GT8A 1CBKA 2HZCA 3JQKA 3CJ3A 1WG1A 3ET6A 1QUVA 1S1UA 2EW9A 4PG6A 5M2UA 4LF9F 3M6VA 2E1PA 4KO0A 4KAIA 4E2FB 3OL6A 1EZZB 1ZA1B 1IR1A 1P1LA 1XNRJ 2EFPA 3B6BA 1FFGB 5GAEI 3NY0A 2J8SA 3M1VA 1RAAB 1VQSA 1S6OA 3M9OB 1YJUA 2C2KB 1S57A 4X4TA 4HHHA 3Q23A 4NRTA 2BW7A 1X8DA 4UQTA 1RAJA 4PPZA 3T6JA 2HNYB 1S6UA 2VDIA 4CYUA 4X65J 1B7YB 1PYOB 2GHWA 3OTDA 4ID5B 2WSEC 3H98A 4XAKA 5EX0A 5CD4H 2RJZA 2B4OA 4F3OA 3WC0A 2DIVA 4OIXA 2LQ5A 2HVIA 5HAOA 1WSVA 3UVJB 2FJAB 3PX4A 1S9GA 2HGNA 1RT1A 2E66A 4L76A 2XBPA 3MEGA 1LXNA 1AT1B 2V69A 3FFIB 4HI2A 4RW7B 3PYFA 3OBIA 3OXGA 3MAAB 2XGQA 4HEA9 2D3O1 4DV4F 2QA4G 5D0EA 2MY7A
chains in the Genus database with same CATH topology
4QU7A 3MD3A 4CH7A 1RTDB 2OLWA 4QPXA 1R0AA 2LU2A 2GJ2A 3G8SA 2MZ1A 4HYKA 3L7PA 4JI0F 3HVTA 3TA1A 5L9XA 4NCGA 3N28A 3V5RA 1FJ7A 1U1KA 4YHHF 1Y9OA 1Y5IB 2O01C 4WK3A 5E3RA 2XS2A 2DGXA 2M70A 2IFXA 1RKJA 3MXHP 1YJTA 3AJ2A 2XCAA 5KFSA 3G6ES 2H5EA 3RBEA 4OLOA 2XMVA 3EXCX 3H4BA 2R2TA 3DLEB 3C66A 4ED5A 4C8MA 1P9QC 4YFUA 4WXWA 2CZ4A 3V2UC 4DV7F 2ZOFA 1NRKA 1TKXA 5T7LA 3KYLA 2J0WA 3V4IB 1HARA 1D8YA 3CDAA 2L9NA 4DUYF 4OZJA 4RW9B 2FJXA 3PJWA 3OL8A 3EXYA 2F3JA 3V6JA 1BQXA 1RA7A 1WELA 1ZZFA 2XULA 4M63A 1R3NA 5LSOA 4RW9A 1NKEA 2M0GB 4DN0A 4OHVA 1JLEA 3RB4A 1M5VC 4IOBA 4CH1A 2X51A 4I2QB 5T7LB 2Q6BA 2YKNB 3DDNA 2FC9A 2HWTA 1H38A 2CFXA 2ZNZA 2ZH1A 4LF6F 3T5HA 2WBMA 2MKSA 1R8HA 2PO4A 2IMOA 1KVJA 2JVRA 3N01A 3DRSB 3CC7S 4WZQA 4K4YA 5HBMA 2NLWA 4XPCA 3GV8B 2VL1A 4DX8H 3HKZD 4Q45A 4H4MA 2CQHA 3RR7A 2VUGA 5FJ4A 4ECZA 3E2EA 5GAHU 2K1RA 2QA1A 3D2WA 1IBLF 1VC0A 1E6YA 1KNZA 3ICLA 1H3DA 1HBUB 5A0YA 1AROP 3KLEB 4URQU 2HHTA 2ILZA 2MSTA 2NSBA 1LWEB 2DBBA 3RB0A 3ETOA 3TAPA 4IUFA 1HW9A 1WHWA 4BCAA 5EWFA 2M2BA 3M32A 2HHSA 4PUOA 1N5TA 5AE3A 4ELTA 4B08A 4F3MA 6FD1A 1RT4B 3LW5C 4OQJA 2RILA 2FVCA 3VCDA 3FZBA 4H4KA 5J1EA 3J81Y 1OO0B 5FIIA 4DWIA 4DR6F 4LSLB 1FDNA 4J37A 5CZVA 1H2TZ 2V9WA 3V6HA 4O3SA 3KK1A 4IR9A 4Y6IA 5DG7A 4CCHA 2QRRA 5KFJA 1QAYA 1S4FA 2ROGA 2W4PA 2J9DE 4KGKA 2XSJA 1SL2A 3VQSA 2UVUA 4IRCA 3Q8SB 2XZWA 3BS9A 3MD1A 3VAIA 3FFIA 5LJ3Y 2VG6B 1IKWB 3MM8A 5BYSA 1DAXA 4C3KA 3KK3B 4A8SA 4J9PA 2RB7A 3BGUA 4WFZA 5HQ8A 3IGVA 2FY1A 2D3UA 3H5SA 1OSCA 1IKWA 3MM8B 1UVJA 4OJHA 1SXLA 3R5DA 1F0XA 2FPHX 2MMYA 3GILA 1UFWA 4YR3A 2HFNA 2Q66A 5LMUF 3K58A 4NCBA 5FLXY 4U9RA 4I2PA 5THWA 2R2RA 4U7CA 5A6PA 4B9NA 1IKXA 3AQPA 1HWUA 2B4PA 2DNRA 3BN7A 4E98A 5D3GB 3FSXA 3KLIA 3BQ0A 1N5QA 2CZVC 2MQNA 2Q43A 3TNVA 4LSLA 1FO1A 2EPIA 2B0GA 2B7BB 2YNFA 4HVZA 3MR5A 2ZZNA 3TX8A 2KJWA 3DI6A 3IA0A 5DDPC 4IFYB 1U1OA 3S7RA 4K4ZA 1SJ3P 5EWGA 2M9KA 4DV5F 1ZPWX 4JYAF 3H5UA 2BA9A 1Q8BA 2B9XA 4K5RA 4PG4A 4FXWA 3RZAA 4KHPF 3MPYA 1FK9B 2YNGB 3DU6A 1KQSR 3LGNA 2HHWA 3MMJA 1TVRA 4MKAA 1VQMS 1SI9A 2JL9A 3I5CA 3DLGB 3X1LB 4TLQA 3CD0A 2KG0A 1TKDA 1KS2A 3MDFA 3M8PB 3ZZ0A 2I38A 2PD1A 2KYZA 1FCAA 4PXBA 1FNMA 3UDLA 1PC4A 4IDKB 3W2VA 4XPEA 2RUGA 4Q43A 4A8QA 3DRRB 2XHWA 4HI1A 3FGVA 3SFGA 2HS3A 4WE1B 3QGIA 3GB0A 3BDEA 4GC7A 2DGQA 4IKAA 4UY8T 3ZZYA 2RS2A 3CC2S 2VONA 4PWDB 3LP2B 3M8QA 2LXFA 2LXIA 1TL3A 3CE8A 3DXSX 4Y34A 2QMXA 1NJZA 1QSYA 3W2VB 4DS4A 1TQLA 1VQLS 3K5PA 2DNQA 1D9DA 5KT5A 5HLFB 4FYDA 4OLPA 1N52B 4RNNA 4FVCA 2MJUA 2W9BA 1NHUA 1R8BA 1P1TA 1FVQA 2QSFA 1JLQB 4B02A 3GMGA 4RKUC 2HQIA 3CGIA 4IG3B 2CQCA 4U6PA 3QZ7A 2F1FA 3IAS9 1BQMB 1XNQF 1HQUA 5KT4A 4PQUA 3DI6B 4F8RA 4PG5A 3AQOA 2B43A 2G9OA 4C11A 2WBRA 2B3TB 2Y1IA 4B3RF 4JBCA 4DV0F 2IA0A 2ASDA 1YG0A 4BS2A 3UFCX 3LP0B 4NLYA 2NYIA 4CZCA 2GCFA 3D5MA 3RW7A 1MU2B 1CPZA 3BSNA 3ULHA 2A10A 4GC6A 4HH0A 1VBXA 2BANB 4RBVA 4QWDA 1HNVB 1FKPB 4I69A 1HBMA 2V4JA 4TU9A 3L3CA 1NEEA 2XNQA 4ZPDA 3MMCB 3KMSA 3I9ZA 3ZC4A 2FLOA 5CCMA 2EG2A 4A8OA 2A2CA 1DRZA 3MOZA 2M4MA 1N56A 1SBRA 1F9FA 3CXCR 2KRRA 3EZUA 4C9DA 4RW4B 4Q5VA 3THPA 3C2PA 3RR8A 2ZHBA 3JSRA 5C25A 3UQSA 2WCXA 3LGMA 2EFOA 4DDFA 4ZP6A 3SI8A 3NL0A 1U2FA 2VPXB 3O5TB 2C2EA 3HFKA 4IRKA 1X5PA 5C25B 3KLFB 1R8CA 4DMZA 2QZ8A 2PA8D 3MM9A 5FD1A 4NLVA 4Y2KA 1Y3JA 4AE5A 1N0VC 5KFDA 1FDBA 2YKPA 3MR2A 3LWLA 2BABA 2CPIA 4HDHA 3SZ2A 4NLDA 5KG1A 2G13A 2HS0A 3PIPQ 3UR3C 4B3MF 2KXFA 2QYCA 2YKAA 3NWGA 2YX7A 3PFEA 2ZH2A 2VQEF 2VPWB 5J2QB 1QTMA 4A46A 2HQ3A 1X9WA 2V4QA 1R8PA 3BO3A 4L6V3 4OHWA 4NXNF 3AA9A 3MM9B 4USIA 4BDPA 5ADZA 5IT4A 4B17A 5L1KA 4ALZA 2IJFA 3OV7A 2DNZA 3PXGa 2KFYA 2XB2D 1BC6A 2GX8A 5KFOA 4B9TA 1WF1A 3GFHA 1QVGR 1VQKS 2V2KA 1V6HA 2COLA 1JKHB 1UEVA 5F8LA 3R1HA 1Y00A 4DF4A 2AJQA 4RW4A 4ZCKA 3K5OA 4F25A 3A8EA 3KWMA 4I56A 2IBOA 5MAOA 1HNIA 3QAUA 1S77D 1F5AA 3CO9A 3GR0A 4RWWA 4YB7A 2P9GA 3TVYA 5D78A 5A8WB 4MAKA 5J2NB 4DOZA 2HNDA 4WIIA 2HMIB 3M2UB 1LKZA 3I9V9 2DR5A 3QIPA 4PXDA 4ZK7M 2FB0A 1VK8A 4BC7A 2W9CA 1HWLA 1T8EA 4WF9Q 3HT3A 3KTQA 3RB3A 3FDSA 1NK6A 2E5HA 3OR2A 3SV3A 5CA5A 1U1NA 2ZDPA 2R2SA 3TA0A 1TK0A 4A4JA 4Y0FA 5G4DA 1KC8T 1VQPS 1M5OC 3PR5B 2RF2A 4F4WA 4MK8A 2CQIA 4PKDB 4X84A 4A8XA 4ELVA 4R5PB 1TP7A 2JX2A 1S9EA 1YBAA 2Q1LA 2R7RA 3CCMS 3LQVA 3Q0AA 3R5CA 3I0RB 2B5JB 3SSSA 1U6BA 4NZ0A 4ZPAA 4OI1A 4DSKA 1IBMF 3C6TA 4EUVA 1HNWF 1M0SA 4LIWA 1KQFB 4MKYA 3S8SA 4DLEA 4GO7X 1O8BA 1FVSA 4I1TA 2MQLA 5KFYA 5GADI 3OVSA 4DV3F 3DRRA 4FF3A 5A8RA 4UY85 1T02A 2OD4A 3JTPA 4O4RA 5AXMA 1NK5A 5SUHA 3DLKB 5KOXA 2JZ5A 5HN0A 2DR9A 3EGNA 3IR7B 2DT9A 3CCQS 4B9MA 3OVBA 2Y1RI 4RW7A 2QV6A 3PW7A 2WONA 4ZS6A 4WFBQ 3U1MA 2ASJA 2F4VF 2R7TA 4DEZA 2RVJA 5E33A 1KTQA 2BE2B 4HT5A 5LSLA 2WOMA 5L1IA 4DFKA 4BC9A 1M5PC