1VC6A

Crystal structure of the hepatitis delta virus gemonic ribozyme product with c75u mutaion, cleaved in imidazole and mg2+ solutions
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
95
structure length
95
Chain Sequence
PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation/rna
molecule keywords Hepatitis Delta virus ribozyme
publication title A Conformational Switch controls hepatitis delta virus ribozyme catalysis
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vc6A00
1VBXA 3VAHA 4OZ1A 3L3CA 2LXUA 2MQOA 2ZJRQ 3R1HA 2YH1A 1VQ6S 2LECA 3HHNB 3NNAA 3THTA 4Y00A 3CPWR 2LEAA 1P1TA 1R8PA 2DB1A 2QEXS 1U2FA 3SXLA 1K73T 2RVJA 3VALA 1M5VC 2RQ4A 2I2YA 5LJ3Y 1WHXA 2CQPA 2FPHX 3UWTA 5IM0B 5JVHQ 4YUDA 1N52B 5GVQA 1WEXA 3G8TA 2MB0B 5HL7Q 5GAHU 3NNHA 2MJNA 1HA1A 2FY1A 2BOPA 1SXLA 1N88A 3BO2A 2RT3A 2LXIA 2AYBA 2DHAA 2M8DB 2XS5A 4CQ1A 2MPUA 5HO4A 1VQNS 2CQGA 2N3LA 4C0OC 2MZJA 2SXLA 3CCLS 2N82B 2AYEA 2XB2D 3PIPQ 1VQLS 1H2TZ 2M7SA 2HYIB 1VQ4S 2CQ3A 1IQTA 1M90T 5DDPC 1JJ2R 2N3OA 1YTYA 2MQPA 2NLWA 3R27A 1X4BA 2CQ0A 1DRZA 2DNHA 3CXCR 1N54B 3RW7A 3S8SA 3MXHP 3CCJS 2DHSA 2U2FA 2N7CA 4ED5A 1SJ4P 2CQ2A 3VAGA 1KC8T 2CQIA 2L41A 2MKSA 2WBRA 2PE8A 3LPYA 2YTCA 3CCMS 3TP2A 3S01A 1FXLA 2MKIA 3VAIA 1U1LA 1OO0B 2HGNA 2LQ5A 3N9UC 3LQVA 4UQTA 1YI2S 2X1BA 3CD6S 1WTBA 2AYGA 1YJNS 2UP1A 2F9DA 4CIOA 1XN9A 2U1AA 1VQPS 3H2VE 2CPHA 1WEZA 5H1SV 1D9AA 1FO1A 2A3JA 1FT8A 3MUMP 2QA4S 3CC7S 3S7RA 1D8ZA 1U6BA 2RQCA 1K8AT 1VQMS 2ADBA 3NS6A 1QVFR 2E5IA 2L08A 2F3JA 4LMZA 2KU7A 1U6FA 3B4MA 5DM6Q 2MYFA 1HD1A 3MD1A 3JB9k 1VQ5S 3BO3A 1A7GE 1CVJA 3ZZZA 1YIJS 2YKAA 2MQQA 3CCQS 2M88A 1WG5A 2O3DA 2MGZA 3US5A 5JVGQ 1WEYA 2DGUA 4F25A 2DISA 2E44A 2LMIA 2Q79A 2B0GA 2DGOA 3CCVS 4UY8T 2XS7A 5DDQC 1PO6A 1YHQS 1Q86T 1Q7YT 1M5KC 5CA5A 3NMRA 2JRSA 2MJUA 1K9MT 2I38A 2CQHA 2DNZA 1O0PA 1X4CA 4CH0S 1FHTA 3G4SS 2LA6A 3FEYB 1WI8A 2MQLA 2OSQA 3UD3P 1YITS 2MZRA 2X1AA 2JWNA 3D2WA 1PGZA 2DNLA 2K8GA 3ULHA 4FXVA 2ZJPQ 4RU2A 2OTJS 1WF0A 1X5SA 2DK2A 1X4AA 5LSOA 2KXHA 2JVRA 1SJFA 4ERDA 4WIIA 2DHGA 4C4WA 3MD3A 1NU4A 1X4HA 1OWXA 2MZSA 4QU6A 2E5GA 2DNQA 2DGVA 2M52A 2VOPA 1URNA 2RRBA 3R1LA 4YB1P 3BEGB 1X5OA 1VQ7S 4WKRA 5ITHA 2VOOA 1M1KT 1M5PC 1WWHA 2D3OR 3IWNC 1F9FA 1WG1A 2CQDA 1HD0A 1S72S 3G9CA 1X4EA 2OSRA 2KG1A 2RU3A 4WFNQ 4W90B 3HI9A 2GHPA 3P6YC 3THPA 5IM0A 2J76E 1FJEB 3I55S 2CQ4A 3UD4P 2VODA 2DNKA 2DO4A 3EGZA 5CXTA 2RRAA 2KT5A 1VQ8S 1Q82T 2M2BA 4TU9A 2MKJA 4WCEQ 3FEXB 3UCUP 2FC8A 1H2VZ 2OTLS 1UW4A 1L3KA 2J0SD 2G0CA 2MZ1A 3RW6A 1HL6A 1JJ4A 1S79A 2X1FA 5DM7Q 5GAGU 2JX2A 2CQCA 2CPDA 1JJHA 2KN4A 4Z2XA 3MURP 1NO8A 2EK6A 4YOEA 3P3DA 5D77A 2KI2A 2RS8A 1WELA 3VAFA 2DO0A 2HGMA 1VQOS 2KG0A 2KYXA 2KH9A 1U1RA 2MGZB 2CPZA 1DHMA 1WHYA 3CCES 2CPFA 1P27B 2KXFA 2BZ2A 3CCRS 3SDEB 2CQ1A 2HZCA 1FJ7A 1SJRA 4QQBA 3P5TL 1YJ9S 1NJIT 4W92B 3S6EA 5D78A 1WF2A 2KHCA 2X1GA 1X5PA 4IOCQ 1QM9A 1WHWA 1UAWA 3PIOQ 1KOHA 2AYMA 2MKHA 3BS9A 2ERRA 3CCUS 2FC9A 4TLQA 3K0JA 3I56S 1B7FA 3DLLQ 2DH9A 2MY8A 1UP1A 1RKJA 5EN1A 1A9NB 4F02A 1BY9A 1SJ3P 4WFAQ 2E5HA 1WF1A 2EVZA 2K3KA 2L9WA 2KXNB 3CC4S 2GO9A 2DNMA 5GAEU 1U1NA 2DH7A 1KD1T 3VAJA 1DBDA 1VC0A 1G2EA 3IRWP 2RS2A 2MZQA 3G8SA 1U1KA 2G4BA 2D9PA 2M9KA 1X5TA 4PKDB 2CPYA 3V4MA 2CPJA 3G96A 3EX7B 4FXWA 1VQ9S 2MSSA 3UCZP 4Y0FA 1W2BR 1X4GA 3VAMA 1WHVA 2CQBA 2DNGA 3CTRA 1U1OA 3ZZYA 1X4DA 3NNCA 2KM8B 2LA4A 2OJ3A 1QVGR 4TU7A 3VF0B 2PEHA 3CC2S 5DETA 2OIHA 2DNNA 4PR6A 1H6KX 2MXYA 4M5DB 4CH1A 1VC5A 2XS2A 2YWKA 2MKKA 5IFMA 1OPIA 2DITA 2DGWA 5LXYA 2M70A 3SMZA 1VC6A 1OIAA 3MUVP 4LJMA 1U1PA 5FJ4A 2XNQA 1KQSR 2DHXA 2KRRA 1U1MA 1VQKS 3Q2TC 2MMYA 3UE2A 3MUTP 4V19X 4IO9Q 3DXBA 2AD9A 2XNRA 2J0QD 1RK8A 2KRBA 2HGLA 4WFBQ 4LIRA 2CJKA 2YH0A 2D9OA 3Q2SC 1N8RT 3B4DA 2MHNA 3U1MA 2DGXA 1VBZA 1SJQA 2JVOA 5DDRC 2G1DA 3U1LA 1VBYA 2LYVA 3VAKA 1WI6A 2MSTA 1R8HA 2F9JA 2LKZA 2DNOA 3NS5A 2DGQA 3UCGA 1X4FA 3MOJB 4QU7A 5DDOC 2V94A 2M0GB 4F26A 3BO4A 1JMTA 2KFYA 4J5OA 1X0FA 2M4MA 1WG4A 2MQMA 4OZ0A 3CULA 1DZ5A 2MY7A 2DNYA 3P49B 2DIUA 4P6QA 2DH8A 2DGTA 1UFWA 5IQQA 3J7ZT 4QPTA 5BJRA 3OW2R 4U67Q 4A8XA 2M8HA 1U1QA 2DNPA 5GMKa 1AUDA 3EGNA 4C7QA 2QFJA 3H2UB 2CPXA 2RUGA 2HVZA 4WF9Q 5GADU 3J7YU 1ZH5A 1Q81T 2DNRA 4IUFA 5LXRA 2XSFA 4EGLA 5CYJA 2E5JA 1FJCA 2FHOB 2KM8C 2ADCA 2KVIA 5MLCV 4ZKAA 1H2UX 1FNXH 4TU8A 3CMAS 2CPIA 1YJWS 2MQNA 4PRFA 2EK1A 3MDFA 1M5OC 1ZZNA 3CCSS 2CPEA 4BS2A 3G6ES 3CUNA 2LCWA 3CMES 2RNEA 2MKCA 2VONA 1YWXA 3TYTA 2DIVA 5LJ5Y 3TO8A 1ZZFA 2MZTA 2DGSA 2ZJQQ 2J8AA 4IOAQ 1KOOA 3MI7X 3SDEA 3CF5Q 5LSLA 2NZ4A 3G71S 2LEBA
chains in the Genus database with same CATH superfamily
2GV1A 1HARA 4OZ1A 2RKIB 3CO0P 2DB1A 3IGNA 2UXCJ 2VFUA 2RQ4A 3TNVA 3RR8A 2CQPA 5JVHQ 4C6AA 3Q89A 4DN9A 4O0IA 2FY1A 3EXCX 2LXIA 2OPPA 5I3QA 2Z2MA 1KVKA 5KFHA 2DBBA 1RT2A 2QC3A 2VPXB 3NY0A 5A8KA 2WVDA 3OFHA 2FGCA 1PILA 1KNZA 1AYEA 1PJ7A 1CJTA 2DNHA 1UZDA 3D67A 3T1AA 4DR1F 4DL3A 4L72B 2UVVA 1G4CA 2PN6A 3D6MB 3GMGA 4Q43A 1DLOB 3JXOA 3DOMA 4NCAA 1KLMB 1APSA 2ZNYA 3LQVA 4YHHF 4UQTA 1CLFA 1Q8LA 2OUGA 1LW2A 4M5IA 1ACMB 4CM0A 5ETPA 3T1HF 5HQLA 2PA3A 3G82B 2UVUA 4RO0A 2QA4S 4WU3A 3R5CA 2Z58B 4I6AA 1VQMS 2GJ2A 2E5IA 2GGPA 3B4MA 1I51B 3R7NB 4IRCA 1L3SA 1RWUA 4QR0A 2PI4A 1JLCB 2VBXA 4ZHRA 4F25A 2NUUG 4DJBA 3JQJA 4NLYA 4IG3B 4OYIA 1Q7YT 4NCGB 2YX4A 2MJUA 3LUYA 4Y65A 3JQKA 2XMUA 1CJVA 1H73A 2EBGA 2UXBF 1BC6A 1Y10A 1HHQA 5CCLA 1EX8A 3C16B 3M6VA 1SC6A 4KH0B 3BSAA 1KBRA 3AOCA 2VOPA 3GYXB 5JMNA 3ELHA 2UZAA 2ROEA 4J9QA 4WFYA 4NMLA 4EWTA 3SYZA 3R9LA 4I6YA 2N4CA 4JV1A 2AZ3A 4U7UK 4JI6J 4H4KA 4DZDA 3KOAA 3PYDA 3P6YC 3DCAA 1IBLF 4RU9A 3N4WA 2CG8A 3ISND 5E3PA 3IWXA 3CSKA 1SKRA 5KG1A 3OL8A 1S1VB 5DM7Q 3UO0A 2CPDA 1JLGB 3HF5A 1KS2A 2KH9A 1R27B 1U1RA 1DHMA 2RU9A 3BM7A 3F44A 9RUBA 3OTDA 5DG9A 1NJWA 3P5TL 4ZP6A 5D78A 4F67A 4OV6A 1MMDA 2WTFA 3CIMA 5J1NA 3M7VA 4HLBA 2JFKA 1SPBP 3I56S 4J9NA 2VASA 4NEYA 2QLWA 1HI1A 5SUHA 3W9JA 1SV5A 2EVZA 1YZ7A 5GAEU 5I3UA 2DRBA 4WXOA 2UV8A 1ZM4A 2EFGA 1N6QB 4QOTA 4ZVPB 4O0NA 1VMBA 3FZ2A 3EICA 4JOUA 2YNIB 4U96A 2BJ3A 5HBMA 4ETXA 3L7UA 4DX5A 5ETOA 3P5BP 5IOLA 2W9BA 1VC5A 3M9NB 2M70A 4JI8J 4WZMA 1OIAA 4CO4A 3CJ2A 5C42B 3BN4A 3P8BB 3AA9A 3ADAC 1NM2A 3ZNJ1 4B9LA 3MMBB 1FDNA 2MHNA 1S7IA 3W7BA 2AEJA 4ELTA 2JNJA 4WIQA 3VAKA 4ZP8A 1IVZA 1QLNA 1Y5NB 4IYQA 2DNOA 1X4FA 5J2NA 3CCWA 3C19A 2XLIA 1AUSL 1U2CA 1WG4A 5IC4B 5T41A 3CULA 2MY7A 3HKZD 2XULA 3V6HA 2VV5A 4I68A 4DSEA 4DUZJ 3MEEB 4A8XA 2QO3A 2BJEA 2B5JA 5EX0A 4J9VA 4C7QA 2QFJA 2RUGA 2BKPA 2RUSA 4WF9Q 4KGKA 4IUFA 1PC4A 5HROB 1E6YB 2WONB 1C0UB 2KM8C 3KJVA 5A8RB 3HXMA 1NKEA 3OFGA 4I0WA 3RYLA 4DX6A 4JV0A 1W26A 1N5YB 3CUNA 5HANA 1RAHB 2YKNB 3TYTA 4F3QA 5KFFA 1EQMA 4I7FA 2VBZA 1ICEB 7FD1A 3O1LA 2HNDB 4Q44A 4G1IA 1P1TA 1KVJA 3VCDA 4CO2A 2GIRA 2GQCA 2CZVC 1YBTA 4KGZB 4LRBA 1J5EJ 4DPYA 1FWLA 1VRQC 1JLBA 1NSKL 2V8VA 4DFJA 4CT9A 1QSSA 3WZ0A 4CQ1A 3S1TA 4P2FA 3MMJA 1HNIA 5AJ3F 2VIHA 3C46A 3TX0A 1D09B 2N3OA 3MMAA 3TI0A 4DQQA 2MQPA 4FF3A 4MJKA 4DUYF 5KG6A 2VPWB 2MDAA 3RRKA 3EDRB 3O44A 1T7PA 1B3TA 3KTQA 3IXQA 2R8KA 3C6TA 1H98A 4B3OB 1N36F 2HFSA 4N56A 3WX8A 1WTBA 4XDDA 5E5NA 2UP1A 2F9DA 2W9CB 2ZWOA 5DRKA 1IXKA 3S7RA 1RXOB 3HMJG 5ETVA 1UCNA 2JEFA 1NHUA 4URQU 5CABA 3I5AA 1VQSA 4JI4F 4JYAJ 1VQ5S 5A2QU 2MGZA 3US5A 5KG5A 1YK9A 2LMIA 1P1LA 2B0GA 4U8YA 1YDLA 1BQXA 3TX8A 4C0BA 4PUOB 1VISA 2RF2B 2CQHA 4PYAA 3M1VB 2JWNA 4HTIA 3A8EA 1X4AA 5DZ6A 1SJFA 2DHGA 2PI5A 1VOMA 3GU0A 2H9ZA 1C1BB 1X5OA 2VOOA 4ITSA 2Y9HA 3EXYA 1WKJA 1S0OA 4X4PA 3HI9A 5T14A 3BKTA 5F41A 4RNMA 4NZ0A 1ZS6A 1KN6A 4P75A 1AB8A 3PRVA 3EZ5A 4K8RA 3M9OB 4AL6A 2AGQA 2CNLB 3W5ZA 2WCXA 3M8SA 3CVKA 1WC0A 1GQEA 4K50A 4FNIA 3E01A 4EI2A 3D1HA 3KXDA 2DO0A 2KG0A 4PG8A 1EJ7L 2VG5B 1NJYA 4F4XA 3GR1A 2A1BA 1DURA 3I0SB 3CJTA 5A8WA 1VIOA 4DPTA 2GX8A 3KJNB 3BS9A 3K5MA 4TLQA 3KLGA 2L3MA 2MY8A 4F02A 1G1XA 4A8YA 1U1NA 1VC0A 1HWKA 1JLEB 3N6LA 4QIVA 3GYGA 5M2RA 3QNWB 3MEGB 4CO0A 2E9TA 3BSOA 1RTIB 3ZZTA 4O4GA 3DC2A 3NCPA 3HHEA 3PEJA 4XIUA 3ZZOA 1RAIB 1NK0A 2LVWA 4U6PA 1BQNB 4X65F 3UDLA 2RKIA 3IR7B 4JP8A 1IKVA 1RK8A 3HFVA 4R0JA 3PW2A 5A6WA 5CAAA 3Q2SC 2RDIA 3PJXA 1D3WA 5DDRC 2V8PA 5H9FJ 4DV2F 3HVAA 4LRCA 5GAEI 3R97A 3NS5A 4C8KA 3I87A 4I2PB 1YZ6A 3H25A 2EFOA 3MAHA 1PKUA 2B7BB 3E51A 3J7ZT 4OHYA 3NEKA 1HNXJ 2O67A 1TR0A 3VVTA 1IKXB 4ICLB 2BQRA 1OQ6A 3V81B 3ILJA 1DLOA 4CI0B 4TU8A 4N77A 1TL3B 1M5OC 2JL9A 1IM4A 3TVZA 1LWCB 1KHVA 1R8CA 2E1PA 4ED4A 1ZZFA 1VJWA 3OT9A 4F4AA 3GQCA 1MMLA 4KKOA 5SZTA 5CH7B 4I4BA 1S9GB 1C0TB 3HHDA 4Y00A 1JLQA 3QWUA 2BUNA 3MAQA 3VALA 3H5UA 2VHGA 5IM0B 3KNGA 4WYWA 4H4OA 4P52A 3JQMA 5GAHU 1NDLA 1JXLA 1RABB 2FVSA 4LF9F 2Y8WA 4X84A 4RW4B 3DNCA 3HSGA 4IG3A 2XZTB 3LP1A 4D3HA 3L7PA 4NCGA 4C0OC 4YB6A 3CCLS 2GIQA 4X62F 4UUXA 1WUUA 1QE1B 4Q0BB 2QL7B 4HKQA 3FMWA 4X66F 5AXLA 1S1XA 1Y7PA 4TY8B 2N7CA 3HSDA 4LR8A 5EUHA 4RWXA 1SC3B 3HJFA 2PMWA 4WP3A 1EP4B 4U9RA 3DLJA 1FXLA 2A6OA 3GIKA 4GKJJ 3FNNA 2CFXA 4K4VA 2VD3A 2ZZNA 1KR4A 3BV8A 3OTOF 2RDDA 4ECZA 4WE1B 2NQPA 3T1HJ 4USKA 1NJZA 2FYXA 1RDRA 1RBOB 1RT6B 1N56A 4H4KC 1JLGA 2Q6CA 2G0IA 1TFWA 4B3MF 2GA7A 1I94J 1ITPA 5CQGA 4YQWA 2E1CA 5DDQC 1ULRA 1RHUB 2EFQA 3J7AN 4OI6A 4IH6A 4ZS6A 2ZH5A 4ZIWA 3EZOA 3R8YA 4R5PA 1ZTWA 2Q43A 1KQFB 2K2PA 3C66A 3GG0A 2OSQA 3MM6B 2IRYA 3D2WA 3A8IA 4CRJA 4FF1A 3J80U 1ZYQA 5KFIA 2CJYB 3PY8A 3KNAA 1UTAA 4JI1J 2P2CB 2QMXA 2AGOA 4TQSA 1U45A 2OD4A 4FYDA 2FHJD 2VG6B 2YNIA 4LF5J 3N5BA 3IWNC 1HD0A 2KG1A 2G1HA 2RU3A 2ZHBA 1FA0A 5H9EJ 2CZ9A 1XMOF 3LALA 4JI7J 4L74A 1YBAA 1A6LA 3V6DA 3UD4P 2XCAA 5K14B 2KT5A 3UNYA 2FVCA 1S1TB 4C2MA 4YB7A 3CCZA 1UL3A 2W4DA 3KK2A 2CDQA 4KHPJ 3K5OA 3P3DA 4J9LA 2RS8A 1WC4A 2CPZA 3PHEA 1FJGJ 2H4YB 1FJ7A 1TMJA 5D6GA 4NI2B 3HSJA 3GG1A 1WF2A 2OPRB 3BGUA 1GXUA 2GHWA 1U4BA 3TAMA 1KRPA 3MCNA 1KOHA 2CG4A 2XWXA 3MR2A 3NS7B 1KFSA 3D0IE 4OZJA 1VCTA 1ZETA 1E6YA 4LF4J 1RHKB 1Z4UA 4ZVSB 2CQBA 4I6WA 2HVDA 1B99A 4C3MA 3QRQA 2LA4A 3M8WA 1TUWA 1N5YA 2OIHA 2DNNA 4DHVA 4PR6A 2ASLA 5H9FK 1OPIA 2HRYA 5LXYA 4LJMA 4RUAA 1G7CB 2F40A 3HHLB 2BBEA 2IDEA 2DPIA 2ASDA 2C1EB 3D1OA 2HMIB 4IO9Q 2XHWA 2KRBA 1XERA 1NKCA 4ES3A 4F4ZA 1IR0A 1CJKB 4WP8A 1Q78A 1FX2A 1U24A 3SI8A 1QUPA 2OH2A 2C3PA 1IJEB 4JV5J 2UUBJ 2HHWA 5IT9Y 1S1UB 1GAOA 4PWUA 3MPDA 1I5OB 1UWBB 2DNYA 1Z2ZA 4DL0C 4QPTA 4N5SA 4ED6A 1RA7A 3N0VA 5GMKa 3H2UB 2HVZA 1X8DA 4UOFA 1PAUB 2XSFA 4NLQA 5CYJA 1HWJA 2K1RB 1BGXT 1CQMA 2FVQA 5EWEA 4CP5A 4USJC 4OI0A 3DRYA 1LWXA 3PYFA 2DPJA 2W4PA 3KLEB 4B9MA 2CYYA 2BE2B 3CCSS 2JSXA 3QT5A 2GMLA 3AQOA 3CJSA 3M8PB 1HPZA 4DF8A 2FLLA 1RT7B 4M8LA 1UPPA 4HH0A 2WB1D 1BUXA 2LECA 1RZMA 4E2FB 3G86A 3DRRA 1N34J 3K58A 1M5SA 2J7KA 3M4XA 3FRYA 2RHSB 1AT1B 5GVQA 1BXNA 1WEXA 2MJNA 3F0NA 4ER8A 2ZC4A 3PYGA 4WXWA 1HI8A 2Y1LB 5HO4A 2I8EA 1R8BA 4DR4F 2J7UA 3Q8RB 3R5AA 2GNKA 4RBUA 3M1VA 2XMAA 4G1QA 1FKPB 3CDWA 4HT5A 2OEJA 4C9DA 4ZVQB 2H51B 2GAGC 1FVQA 3QO9B 4X64J 1C1BA 2KT3A 3VAIA 4B3SJ 2LLZA 4DR7F 4PYDA 5AXMA 3HVTB 2FTRA 3IO1A 2FD2A 3AB2B 2QSWA 4MFBA 1TK0A 5DGBA 5GAHI 4FYXB 4DU8A 1VRUB 4PG4A 1TL4A 2RB7A 1KDNA 1IKYA 2KFZA 5IC6B 4L3NA 3QFWA 3OBIA 4TY9A 3VZIA 2YPYA 5AT1B 1YIJS 2RIJA 4OZ2A 2B4UA 5L1IA 2VG5A 2PO4A 4N41A 4FF2A 4HI1A 1OJ4A 1N33F 4FKXA 4LF2A 1Q5VA 5CA5A 4KGXB 2XI2A 4LF6F 4YY3J 5E2QA 1RWNB 2GMJA 3FEYB 4HACB 4HHJA 1MU2B 1F60B 2J9DE 2HIYA 2OD6A 2V4JB 1NB7A 3KK3B 2JVRA 5EHHA 3MEGA 2DGVA 1FKOB 5HVFA 3FSIA 1LWEB 2RSQA 3OFFA 4USUA 3GSIA 1M5PC 2CRLA 4I2QB 4WFZA 1RYSA 2YX1A 3UW1A 4I1TA 3T6JA 3M32A 2YQ0A 4F4KA 2OAUA 3BDEA 4FZVA 2MTLA 2PSZA 2R3VA 1VQYA 1FESA 2MKJA 2P5VA 2VU5A 2CNOB 5DZ7A 1HYSA 3NOCA 1FRXA 1JJ4A 3Q24A 2X1FA 2YNHA 2YNFA 1DTTB 2JX2A 4X4NA 3LANA 2QSFA 4DU7A 1EETB 3ZNUA 1KSPA 1RADB 2K7JA 1V6HA 3IAM9 2DYAA 2ZITA 4DQSA 3AJ2A 4J37A 2KHCA 1HNZJ 1QM9A 2BJDA 3K89A 2R8IA 2YQ1A 5E33A 2IFXA 1Y0HA 5BYQA 3VV2B 3MF5A 1B7FA 2L9WA 2DNMA 4J91A 1R43A 2MZQA 1PIEA 5T7LA 1VQ9S 2C2KB 1LKZA 4CNYA 3IG1A 1NAQA 2DR8A 2J9CA 2AJ0A 4ZVOB 1QVGR 2ZVIA 2HNYB 3O8WA 4ANDA 1TVRA 1EARA 3T9NA 2Y0SD 1IKWA 4UT4A 2Y1JA 4MTPA 1D8YA 2MMYA 3HP6A 2BVZA 4DEZA 2CJKA 2VPZB 4OZNA 2QT7A 1K0TA 5HJYA 3KLFA 3SV3A 3PVXA 2I1RA 2IVYA 1UW9A 4RW4A 1S0MA 2DGQA 4DX7A 4ALZA 4J7CA 5K8OA 3G6XA 1QE1A 2AZ1A 5CYMB 4LF8F 1DZ5A 3W64A 5AXKA 4DR6F 2B4OA 3PRBA 2HRTA 4ZJQA 4DV1J 2ATLA 4TY8A 3OW2R 2NUHA 5KFMA 3T5KA 5F9LA 3HD1A 3FQLA 2YNGB 1X60A 3FFIB 4P2SA 3AB4B 3H42A 4RW8B 4OHXA 3D54A 3RBDA 1H2UX 1KP6A 4F4YA 5BR8J 3GJSB 5B0GA 4CDIA 2R7OA 2WSFC 1S9EB 2XI3A 4GC7A 4WE1A 1TU0B 2XEXA 1GTEA 1C1CA 4IOAQ 4C3LA 3SDEA 1WOPA 4K4SA 3K0JA 3OL9A 2I5JA 3V4IB 1S9FA 4N76A 4Q45A 1RT6A 3EJMA 3M8QA 5J1PA 2OPQB 4FXDA 2QLJB 8AT1B 3PX0A 3TUJC 1NJXA 4YUDA 3IRXA 2M8DB 2MPUA 3PKMA 1XJWB 3CDBA 1GFWB 4ECUA 2XLKA 3PIPQ 3MM6A 2HYIB 1TZ0A 1JJ2R 1RWPB 4B02A 2YBVA 2NLWA 2C2EA 3NL0A 2G2ZA 3S8SA 4ED5A 4LIWA 4CO3A 2QV6A 3X3UA 1NPRA 4KTQA 1U6ZA 2VG6A 3ZZ0A 1NCLA 2XY6A 3N9UC 4Y2CA 1NEEA 2XMVA 2ABYA 1HBNB 4DV5J 2LXFA 4IFVB 4LF7F 4CO5A 1UA0A 3CIZA 5HP1B 3H2VE 4PG6A 3WDOA 3DM2B 1FDDA 4XO0A 5F8IA 1K8AT 1BD6A 4IKAA 3PO5A 5M2PA 2UU9F 3QT6A 3QJPA 2O3DA 2BANA 3KWMA 5JVGQ 3FCVA 2LP4A 4B3MJ 3FBBA 4NI2A 2ILZA 3M6UA 2ZM6J 9ATCB 4IOBA 1C4AA 2GQQA 1K9MT 2I38A 3QFHA 1O0PA 3CJKB 1V3ZA 4JI2F 3UD3P 1NK7A 3IMQJ 4F4WA 2JDJA 2QA2A 3H5YA 3N5FA 4KGVB 2ZJPQ 3LP2A 1Y11A 4ELUA 3GFXA 2C2DA 1FK9B 4QU6A 4OYBA 5FDLB 4OX9F 4X2BA 4YB1P 3M30B 4RJVA 1ZBTA 2CA9A 2ZHAA 5JJBA 1XBWA 2DRAA 3G9CA 3NLCA 3MPVA 1TMMA 3THPA 4GKKF 3MCMA 2CQ4A 3D7SB 2AF6A 4FBUA 1DQ8A 4EBDA 1Q82T 4PXDA 2HMIA 3UQSA 1H2VZ 4CLPA 2B6AB 2UUAF 2QE5A 2B9YA 3WBZA 3MZIA 4CT8A 2UUCJ 5E3QA 1WELA 4IRKA 2K06A 1GH8A 4DN0A 4LFAF 1WHYA 3F41A 2VQEF 3NGUA 2C3MA 3UNGC 2G2YA 1S1UA 3ETOA 2HHPA 3NGKA 2R8GA 1UWBA 3RBZA 1SCJB 2HHXA 3PIOQ 4CM2A 2BM1A 2E5LJ 3DHWC 2GAHC 4PQAA 3DLLQ 2DH9A 1UP1A 3DXSX 3ZTSA 1Q95G 2ZZMA 3IBCB 2ACYA 1W2BR 3VAMA 1WHVA 4ECSA 3SSRA 3ZTPA 1U1OA 1X4DA 3L9ZA 2BE2A 2OJ3A 3CJ8A 1CJUB 4C8YA 4JI0F 3WQPA 2PEHA 3CC2S 2JEGA 2MXYA 2JZ5A 3MEDB 4L76A 4DF4A 1UZHA 2ROPA 1NK6A 2AP6A 3R2DJ 3W61A 3I4PA 3KDNA 1FXRA 2RDJA 3TQ1A 2HGLA 5HN0A 1J2VA 2RQKA 1NMEB 3RUBL 3JYTB 2UVRA 3QGHA 3TJAA 2G1DA 3I6PA 3RZAA 3I9ZA 4K4TA 1RLDA 5I4MA 5RUBA 5LMUF 1TQLA 1BQMB 2LU2A 5F3ZA 2H1YA 2DXEA 4ZVEA 4CTAB 4KJIA 1IBMJ 4DSIA 2FY8A 2FLNA 4P6QA 5IWAJ 5BXIA 2VBWA 4U67Q 3HZGA 4B3RF 1GX6A 2CPXA 3CDEA 3QO9A 4XPCA 1RAFB 3AD9C 2W2QP 2V2VA 3L95X 5MLCV 2BE7D 2QRRA 4O44A 3HVTA 2C2OB 2MQNA 3TVYA 3BQ0A 4CLKA 2L48A 3RBEA 4DV0F 2DTJA 8RUCA 3O5TB 3G6ES 3G6YA 4B9UA 2A2DA 4YS2A 1YWXA 2V4QA 1RT4B 2MZTA 3BN7A 3OVBA 3BR9A 3IS9A 4H4MB 4Y2MA 3GYNA 4C98A 5B08A 3DRXA 5KT5A 2ROGA 5D4PA 1R89A 3FCHA 2ZEJA 2V50A 3FDSA 3QQCD 3BGRA 3MMCA 2VKRA 2HRUA 2B51A 3RB4A 3TWZA 4QWAA 3K5PA 3IP0A 1L3VA 1PAEX 2B4VA 1MU2A 3CXCR 4O23A 3RW7A 2O5DA 2QX0A 1NZAA 4FVCA 1RGVA 3L09A 2NCKL 3OLAA 4Q8EA 3BYPA 3VQTA 2IRUA 2WSEC 1V5VA 4M5JA 1FFWB 1L3UA 3C6UB 1RHQB 2J6UA 2HFUA 2E66A 1REGX 2FJBB 3K17A 4XK8C 3DDNA 3CD7A 2FZKB 4NPOA 2V4RA 1SI9A 1HLWA 1WC6A 1QD1A 1U02A 4XTTA 1EETA 1A7GE 4OYAA 3IR5B 4ZCKA 2JHEA 1T9XA 1F9HA 2HZAA 1S0NA 4WWSA 4LSLB 5EX3A 5C2CA 3BR8A 1X7VA 4L6V3 2ASJA 2IJNA 2C28A 2GIFA 2ZOFA 1MROA 1TL1B 4K4ZA 2HS0A 2K8GA 3E8OA 5J2PB 3JTOA 2G2OA 4DFKA 2DT9A 3KK1B 5F3TA 3A1YG 2E7VA 3MOZA 2HPUA 1EZZB 2E5GA 2XG8A 1NH8A 3FCWA 5AE3A 4K4XA 3KJFB 3Q8PB 3DKDA 2PEBA 1HW9A 2HNYA 4QW8A 3OPKA 3CWJA 1AA1B 2HHVA 1K1QA 3I0RB 4OI1A 2W1BA 1AROP 3RB3A 5ETRA 5CXTA 2HK3A 4PWDA 4DFMA 1RAGB 2M2BA 2CJXB 5C2GA 1N4LA 1L3KA 2Z57B 4RX6A 3OVSA 1T02A 1YGYA 2Z2YB 3QRRA 3JTNA 2C22A 2VC1A 2XM3A 2KI2A 2VQFF 4USIA 5D0EA 4IH7A 2ZH4A 2IC3B 3I5BA 1YSJA 3CCRS 1YG0A 4XPEA 2YWHA 2IMWP 5CYMA 1RTJB 5D4NA 1KQKA 1XNRJ 1XMBA 4MK9A 2WZ1A 5E0OA 3QIPA 4ZPBA 2RE1A 1HFEL 1SJ3P 3CC4S 4EZ9A 4I64A 4QYZJ 4RBTA 3G8SA 2D9PA 3FFIA 1M1GA 1I6JA 1T9WA 3M2RB 1KWMA 1N5QA 4PKDB 4NXNJ 2P9CA 2P8IA 2KKHA 1RLCL 1B7YB 3GCXP 2PMHA 1YJTA 4M5DB 1OY8A 5KFCA 2H48B 1QSYA 1SL0A 4K5SA 1JLAA 1REVA 3HX9A 2D3ZA 3OUYB 3SMZA 4N8NA 1RBLA 1F5CA 3OHBA 1R6YA 4J9RA 4BWMA 3HD2A 4NE9C 2QYGA 1XR6A 2GVZB 1ZA2B 1RWXB 2GC8A 1SJQA 3QAEA 1N32J 1LW0B 4FP9A 1TL7B 1Z1ZA 3POTB 2M0GB 4F26A 2ZOMA 1TV6A 1RAJA 4HDGA 4JBCA 2MQMA 5G4DA 2HW3A 3G8QA 1UMJA 2RH3A 2DIUA 3MM9B 3EPGA 2D74B 3B78A 3MTKA 2R8JA 3HSZA 5GADU 4LSNB 1ZH5A 2HFNA 3M6XA 3FZBA 4DQIA 2Y1IA 3H20A 3AQPA 4A8KA 1CS4A 4IFVA 2ALYB 2HFOA 3FMBA 4OMFG 2BM0A 1GNKA 1DJ0A 3DM2A 4DLEA 4B9SA 2H5JB 1Y3JA 2V2KA 3ZTOA 2QJ3A 4F2RA 2KZZA 2Y0BB 2VPYB 2ZWPA 3D6HB 2C2RA 2VDIA 2F8HA 1JLFB 4ZP7A 2XQCA 4ZVHA 2XGPA 3G2XA 4MK7A 4YR3A 2MB0B 4DR2F 4RNHA 1R6VA 2RT3A 3HHLD 4K2XA 4CLTA 3TZZA 4ED0A 4C8LA 3QAUA 2MZJA 4B9TA 2AYEA 5HI7A 3ICLA 5DDPC 1DQAA 4JI3F 3C14B 3ITHB 4WPAA 4WU2A 4USMA 4LFCF 3UN3A 3CCJS 3I9V9 3RJMB 5KG3A 3QJLA 1FK9A 2C3YA 3TRGA 5C24B 3W8PA 1E6VA 3M30A 5F8MA 2IYIA 3GIRA 2UV8G 1HR0F 2HWIA 1TKXB 2X3GA 4CZCA 4USTA 3DU6A 1PYTA 1HW8A 3T41A 2U1AA 5KTQA 1RT5A 1S77D 1WEZA 3NG8A 4OX7A 3H98A 1FT8A 3MUMP 3W5YA 1OSDA 3HVWA 1TKZB 3CJRA 3BH7B 1S6QA 3KG0A 3LAKA 2AKWB 1LQ9A 2L08A 4LMZA 3CNQP 2FVPA 4MKVA 3RAQA 1NHVA 3Q8SB 2E1RA 3Q0AA 2Y3YA 3KLHB 3U1NA 2NXJA 2Q66A 5K8PA 2FZCB 3CCVS 4OJHA 4URGA 5KFUA 3UFCX 3IM8A 3PNIA 4KV8B 4PPDA 1NDCA 4YR2A 1D9DA 4CYUA 4CH0S 2FLOA 3QLHB 3MR5A 2IRXA 2BW2A 4A8FA 1SVDA 3RG6A 1HBMB 2ZBPA 1VHIA 1OWXA 2VFRA 3K57A 2IHR1 1GMWA 4DOZA 4DS4A 4OX9J 1VRTB 5HMZA 4UF4A 3MEDA 5J2MA 5KFLA 4DL7A 1EIYB 4DR5F 1LFPA 2V0NA 4TU9A 4P72A 1NBEB 3FEXB 4U8VA 4YN3B 1HL6A 2PFFB 5KFBA 2KO1A 2KTQA 1NO8A 1NDKA 3BGOP 1BE4A 1FTCA 5L1KA 3QSIA 2GJFA 2CPFA 1P27B 2BZ2A 4ZMMA 2CQ1A 4LFAJ 2VQEJ 1QTMA 3PRDA 3VGSA 2F65A 2EPIA 1SKWA 4IOCQ 4FDFA 3WIVA 2QTWA 4WK3A 3AY0A 4OHVA 4ZLNA 3FSYA 2J5AA 4TLRA 3OTCA 3OVAA 3I82A 1G2EA 1X5TA 4OJ3A 1RA6A 1X4GA 2DRDA 2GVDB 4ID5A 3OTBA 5D0HA 2KM8B 1Q79A 2XC9A 1CBKA 1FRIA 3KHGA 2HHQA 3GIMA 2EC0A 1S12A 1NLKL 3DOLA 2XO6A 1RT4A 2YWKA 4OI3A 2DITA 5KFSA 1SL1A 1KQSR 3VWSA 4OI4A 2VICA 1VJQA 1U1MA 3Q2TC 1ROFA 2IAJA 1SUQB 5EDWA 1P9YA 2F4VF 5K8MA 1HMVB 5J2QB 4C8ZA 2W2PP 4RNFA 5D15A 5IT9U 4AXIA 3TJ8A 3JSMA 4DV3F 1GMUA 1RTHA 4ZLLA 1JKHB 2AW0A 1EQ0A 3NMAA 3GWCA 3VGVA 3ET6B 2B3TB 3QBCA 3RBXA 4NXMF 5ETSA 1YRTA 1HNWJ 1QAYA 1TP7A 2V8GA 2QMUB 3O3LA 1FRHA 2YKMB 4WK1A 2EW9A 3AH6A 2J9DA 1FI4A 1AUDA 4Y6IA 5CYQB 2HLTA 2OP5A 5HMWA 4NLTA 1BHNA 2ZNZA 3DU5A 5HQMA 4LFBJ 2VJUA 1Z2LA 2LCWA 4EFAC 2MKCA 3M8RA 2GFFA 2LU1A 3PZPA 3FUYA 3K59A 1KOOA 2VJVA 3K8WA 1G3OA 5LSLA 2NZ4A 1YLXA 1UVLA 2IBOA 5GAGI 1MSWD 2RVJA 2YX7A 1T9YA 1VFJA 3DYAB 4X4RA 2HHUA 2W2MP 3UD5A 3OR2A 1NXIA 2R2UA 1CULB 5KFAA 4I56A 4NYOA 4PXCA 3CJ3A 2WBMA 1PG5B 2BOPA 1SXLA 5KAKA 1XQIA 2MKYA 2GS8A 4DL2A 2FJEB 5GADI 2DY9A 2N3LA 2C2ZB 3EPIA 1FNOA 2FJAB 1KHWA 1Q5YA 1M90T 1FFSB 1S7HA 1TFYA 2CQ0A 4H54A 3VR1A 5IXUA 1LV5A 2XZDB 1JB0C 4NCBA 5LSRA 4NLDA 2NZCA 2ZD1A 5L46A 3CCMS 4Q7AA 3MM8A 1BMQB 3S01A 3BYRA 3BKUA 4OYMA 2W7AA 3KHLA 3T1YF 3I0RA 2CVEA 1S99A 4DCPB 4J9MA 2HQFA 1AFIA 2CPHA 3V6KA 3PX4A 5KFGA 3UR0A 4DV6F 3T5LA 3CCTA 1J5OA 3GR0A 2IJFA 4DCOB 2ZUGA 3TA1A 3ZZZA 3EVOA 2YKAA 4RW9B 4AQYJ 1WG5A 4UZCA 1WEYA 4UOHA 1OS5A 2NXCA 4NLRA 1U49A 2CJAA 2UXCF 2ZBIA 1RWKB 5I42B 1R0AB 3KKFA 3SSSA 1M5KC 2EKNA 1AZSA 2XHCA 2AJ2A 4N47A 3A13A 3D0HE 1L5UA 1UFLA 1M1HA 4RU2A 2H65B 4HI2A 1Q4RA 3J81Y 1VGYA 4OX8A 1HQUA 3ISNC 2KXHA 4KPYA 4ZVRB 3TA0A 1FVSA 4D3GA 4YMEA 2W24A 1SL2A 2V9KA 3LWMA 4ECWA 2MEWA 2RRBA 3DGVA 1RQ0A 5IV3A 1Q8KA 3M8ZA 2CNNB 1VQ7S 4WKRA 3VQSA 4RUCA 1B0PA 4AD6A 5DQIA 4M5DA 3HLUA 2ZH8A 4B3TJ 4F7VA 4BHQA 1WTFA 1FRMA 3MGJA 3ILOA 4EU0A 1V3RA 2GVZA 5IV4A 4C11B 2FHJA 3DOKB 1HQEB 3GJRB 1LW0A 2F8MA 3BBCA 1GXLA 2CVIA 2KXFA 4KO0A 5J1EB 1R7IA 3ENQA 3GV7B 4HT7A 2OMLA 2R7VA 2FHKA 2J8SA 3GILA 1B64A 4DDFA 5HSPA 5G0RA 2DCUB 2D41A 2EBEA 4E8UA 4K4YA 3VGUA 2OKQA 5L8RC 2KXNB 2DH7A 2Z2LA 1KD1T 3V2UC 2OPPB 1LK7A 1JK9B 3QZ7A 3FKBA 2M9KA 4IFYB 5D3GB 3EX7B 4FXWA 5ETLA 3W3SA 2LQ8A 5BYRA 3C8YA 2HBYB 5A8KB 3WC0A 2HS3A 1SH3A 1CJTB 1WKLA 2W8LA 2ATCB 1H6KX 1XMQJ 3H0PA 4ZPTR 2ZC3A 1YKWA 3BZQA 2R7RA 3LWLA 4DR3J 5KFKA 1JNZB 4FNHA 5LMNJ 1VC6A 5KFQA 5FJ4A 1DQ9A 2DHXA 3IFEA 3QWPA 2VFTA 2AIRB 4JI6F 4OIXA 1FDAA 2YH0A 3HFKA 5DO2A 4LUBA 2AHOB 5B0AA 1S6PB 3EMTA 2YWEA 2W7OA 1LW2B 2JVOA 3SEOA 3FQKA 2LYVA 4Y2KA 2W9AA 5HVHA 4EZ6A 3U27A 5MAOA 5KOWA 4RW7A 2V94A 2IY5B 1ZM9A 4IQXA 3BO4A 2GGPB 2AU0A 2FUG9 3ZZRA 4EUVA 4ZCMA 2R7XA 3C14A 3FK4A 4NMXA 1HWLA 2OEMA 3CJ4A 2ZHOA 5E41A 3J7YU 2E7WA 1KFDA 4EGLA 2OO4A 1ZAWA 1ZAVA 1CJVB 1TKXA 3M2UA 4DFPA 2CPEA 5KFJA 4YEAA 4C8MA 3CMES 2VONA 3VZHA 4ZLJA 2J8AA 1VBXA 3HVRA 1GMWD 3FBFA 5K9FA 3CPWR 1K73T 4QIEA 1HHTP 1WHXA 1XNQJ 2R42A 1F2GA 1WJ9A 2QN6B 1HNVA 4F2SA 1NK4A 1F0XA 4DQPA 4QIFA 4HEA9 5KT3A 3D6FB 2RILA 2GO8A 1VQLS 3B82A 2H3EB 2CQ3A 4ID8A 1ELOA 2WVFA 4PXEA 2QL9B 2BX6A 4B08A 1GX5A 2AEMA 5JUMA 1KC8T 3DLHA 2CQIA 2L41A 4NEZA 1TUGB 2V2ZA 3LPYA 1FXDA 1MWQA 1MWZA 1T9TA 1RCXB 4DUZF 2VFSA 2LQ5A 2ZE2B 1UVNA 4DG1A 1FNMA 2IVFB 2OPSB 3HHKA 5I3UB 1VQPS 4NA2A 1SIZA 1FO1A 4QBUA 1T3OA 4USHA 1KONA 1SJ1A 2FQQB 4LREA 3NS6A 2BJ9A 2MLYA 3GIIA 5DM6Q 4LSZB 3C15B 4A47A 3D0GE 3W2VA 2QL5B 2Z0GA 2V69A 4N7TA 4QWEA 5KFVA 4NZ7A 1QSLA 3I31A 5B0FA 2HIQA 5DGAA 2E44A 1MWYA 3GSDA 5DS7A 1YHQS 1Q86T 1J5EF 2OHDA 1FHTA 3N01A 2ZZTA 1L3TA 4V1Ak 4NLSA 1RE1B 3ULHA 2QG9B 4QYRA 3OLBA 3AJDA 5HQ8A 1QAIA 2IMOA 5J2NB 5IS2A 2A0FB 1NU4A 1X4HA 3MD3A 1LWFA 2X7IA 3V5RA 3D28A 3WC2A 2DKOB 2NPFA 4OYXA 3KUGA 1M1KT 4F0KA 2AGPA 1S72S 2WSCC 4JI5J 1O8BA 2E1AA 4W90B 2GHPA 3IBWA 3E3XA 2B5JB 2IBKA 1Q8BA 4DSKA 2RRAA 5HK4A 3TAPA 3CJ5A 1SUQA 3KJVB 2IA0A 2FC8A 4JUZA 1UW4A 4HHHA 2BV3A 1IQZA 3TW0A 3TZXA 1S79A 1HMVA 2CQCA 2KN4A 5J2QA 4YOEA 5D77A 2IVMA 3VAFA 3HT3A 1HWIA 2CJ9A 2J6SA 4LF1A 4I7FB 2HZCA 2A2CA 4JYAF 2HNZB 2P9GA 1HHSA 2XWYA 2ZH2A 4M5LA 5F8JA 1KLMA 2EXUA 4DPOA 2ILYA 1VLOA 1FRKA 5EN1A 1SQEA 2YKMA 2QYCA 5D4OA 2YWGA 2BKOA 3G82A 3MEKA 1NB2A 3TOQA 2CPYA 3TR5A 3V4MA 2M5YA 1HNIB 4ECTA 1KEKA 3DLBA 3GFYA 1Y3KA 3MMAB 4CH7A 1KVIA 5FIIA 4EMDA 4HTJA 3EGVA 1JLCA 2ZKUA 5KT7A 3C6TB 4UY85 1B70B 4OLOA 4F3MA 3DYAA 5C7PA 4NA1A 2GCFA 1VBZA 1T03B 3EUNA 1ZAXA 3PDNA 3C16A 1IN0A 4P71A 3MCOA 1I1GA 3PW0A 4ILLA 4LR7A 4X4TA 4DR1J 1PCAA 1XR7A 2M8HA 1U1QA 4QWDA 2VH7A 4A8QA 4YHHJ 3LGNA 2R8HA 1NH7A 1WNEA 2WAQD 2WOMB 2JOQA 5L39A 4OYWA 2ADCA 4RPFA 1C4CA 1YJWS 1S1VA 2F1FA 4P74A 3F56A 4HR2A 4B17A 3W2WB 4FKYA 2VDHA 3PG9A 1XC9A 4DV7F 3AA8A 5GMEA 4M5GA 2LXUA 1VQ6S 3NNAA 2IA6A 5CCMA 2ZBQA 2P6SA 4RW9A 1S6UA 1UVIA 4M5MA 2V34A 1HA1A 5I42A 2UXBJ 1R0AA 2C3UA 3A12A 2CWXA 3J7YI 1VQNS 2NYHA 5ETMA 3UPFA 1N6QA 5DQGA 2SXLA 4NWBA 3I5CA 3ZXWA 2N82B 2EWHA 3BGLA 2HBRB 1AFJA 2B8PA 4DCJB 4NX9A 4Z37A 4DPUA 1OMSA 3MXHP 2B7CB 5JXSA 4EBEA 4KFBB 2CQ2A 1DY3A 4Q2MA 2YTCA 1XWLA 4RWWA 3DRSB 5C42A 2XCPA 1HIYA 4M95A 1IBLJ 2HGNA 1HNXF 1F5AA 2I6WA 5KFXA 2KB2A 3MMBA 2OGUA 1YJNS 2C42A 5KFRA 1PJ6A 4DX8H 1XN9A 2BRLA 3ISZA 1R31A 4IDKB 2WRMA 4O4GB 3UDVA 4WBFA 4EO8A 2EI5A 5HJXA 3MD1A 3JB9k 5L9XA 3O2IA 4WFXA 4TNOA 3TJ9A 2ASYA 3DLEB 4W4MA 3MEEA 1PYOB 3AD8C 4NA3A 3AD7C 4KC5A 2DXDA 1K0VA 4F8RA 1IKVB 5HROA 2KT2A 4C8NA 1JNRB 2WONA 2DNZA 1C0UA 5A8RA 4NRTA 2LA6A 1WI8A 1FRJA 1RU2A 2MZRA 1MG7A 4F0MA 4BDPA 3QYYA 2BQ3A 1FCAA 1WF0A 2LFVA 1GXTA 4IFYA 5D3GA 2YKNA 3SSQA 2RD5C 5ETNA 4ZDNA 4DBQA 3R5JB 3R3TA 2UXDF 2DNQA 3L4BC 3PKYA 2HNDA 1W2IA 3BEGB 2R7WA 1WWHA 2B43A 2LQBA 3KHRA 1N0VC 3SIPB 2J0WA 4HYKA 2E9ZA 4O3PA 2AT1B 1S59A 4P7TA 1FJEB 4GKJF 2VODA 4RLEA 3EGZA 3OTEA 4AFFA 4B9VA 4CNZA 4F36A 1YBUA 4NL5A 1F9EB 2J0SD 2AJQA 1S6PA 3H90A 3MURP 1AW0A 1UJ4A 2IM1A 2RRNA 2ZVSA 2BOAA 4RR5A 3MECB 2MLZA 4KH1B 2A18A 2J9EA 1LFWA 2RHQB 4CLUA 4KKOB 3BSCA 4Q8FA 3AHPA 4G3IA 2F4FA 4EO6A 1IJFB 1JLQB 1X31C 4Y28C 1I94F 1U0HB 3D9BA 2EC2A 4B3OA 4ILMA 2MKHA 2D1CA 4ANEA 1XIQA 3D4JA 4H4OB 4IG0B 4NASA 4O3QA 1YJUA 2W9CA 4DUTA 3LP1B 1U1KA 2G4BA 1T11A 2BQUA 1LXNA 1MW7A 5B0DA 4GVLA 1U09A 1JIHA 2Z2ZA 3T19A 5C5JA 4JI1F 4PZVA 5DETA 3VGTA 3SFGA 1S1XB 2XS2A 2J7WA 5IFMA 4J9OA 4LF5F 2XNQA 4Q5VA 1KTVA 2LDIA 2B9XA 3LTOA 4ED2A 2XNRA 4PUOA 4JI7F 2G13A 2RF2A 3H4DA 2FJVA 3CDAA 2Q6BA 4WZQA 4DLGA 4ED8A 2W01A 5AJ3J 3FBCA 5E3CA 2MSTA 4TKTA 3HT0A 3M05A 3MOJB 5D8HB 5DDOC 4KHPF 5B09A 4DUYJ 2WVEA 1B0VA 4G65A 1UFKA 2O66A 4ZK7M 2KFYA 3PM9A 1FJGF 3HKWA 2DH8A 1UFWA 2ACMA 1N36J 3R2CJ 4JV2A 3N79A 1OYDA 6FDRA 2XYHB 3DDKA 4R5PB 2KVIA 2ZE2A 1JWWA 5E3RA 2HHTA 4LF4F 1B0TA 2OPSA 1SC4B 4BS2A 3WHIA 2IPOB 3EZUA 1NZ8A 3PTWA 1PSDA 2VZ9A 1H7XA 1S5ZA 4JI4J 2DGSA 4F50A 3CO9A 2XMJA 4PXBA 3CF5Q 2HVIA 4DPWA 2MQOA 3I0SA 4RBVA 2AWZA 4ZOSA 3C15A 3KLIB 5EGYA 4A8MP 5LJ3Y 3OR1B 3UWTA 2OFGX 2A10A 2JEIA 3V6DB 3NNHA 2QMWA 1URRA 1SIWB 1JLEA 3PEHA 2ZH6A 1M5HA 1GMVA 2D69A 1Q7LB 2CQGA 2Z4PA 4KR0B 3KK2B 1RTIA 3OSNA 3CB4A 2HKEA 4JV5F 1N5SA 2FIUA 4PPZA 3VHQA 3GB0A 2VBYA 1ZM2A 2UUBF 3DLGB 3C2PA 3PCOB 1UVKA 3PHTA 4QZVB 3NGRA 1W7WA 4ZVUB 1BQNA 3UN5A 3TAMB 1F3VA 1X0PA 1R0CB 2XMWA 2QLBB 4NYZA 4DQRA 4X4OA 1SC1B 2XTJP 3SQOP 3NCQA 1PJ5A 1FWPA 5DJBA 2HFVA 2AYGA 2DD8S 3IA0A 2BYCA 4FS2A 3CT9A 1KKHA 2V5HG 2PFDA 1BLUA 3UR3C 3TQEA 1SB6A 4CO1A 2RQCA 2V2QA 3OXLA 2ADBA 2HBQB 4OZ5A 3MFHA 2HAFA 4I2PA 1S49A 3A8JA 4LRDA 1HBUB 4BLGA 3KG4A 5FLXY 2HNZA 1IKXA 4ICLA 1N34F 5F0UA 3V81A 2JRSA 2WHOA 3NBPB 1Q0NA 2HURA 1SBRA 1TL3A 2QZ8A 2DNLA 4LVOP 2QA1A 4FXVA 4OYZA 1LWCA 2DEIA 2DEJA 5LSOA 3FEZA 4K5RA 1S9GA 1C0TA 4X65J 2R7UA 1IUJA 2OSRA 4WFNQ 4ZVTB 5L9NA 4X64F 1C2PA 5IM0A 1S57A 2AJFE 4B3SF 4YP3A 2DO4A 3RRGA 4ED3A 5LT5A 3PFOA 4DXLA 5KG7A 4DV2J 2OTLS 3H4BA 3AT1B 1YJRA 4Q0BA 4OX6A 1T03A 1RAAB 1X9WA 1HPZB 3VTIA 2GHVC 1VIXA 3F73A 1EP4A 2QA4G 3DRRB 3T5JA 4MYTA 1KQGB 1MN7A 2X51A 4ETZA 3GTYX 1YRXA 1WF1A 2GO9A 1TKDA 4YY3F 1ZTTA 3VAJA 3QATA 4J9SA 3IRWP 5F8NA 1X9MA 2WOMA 3JS9A 2A6MA 2NPIA 3UCZP 2HHHF 3NWGA 4IH5A 1J27A 5L1JA 3NNCA 1NSPA 2AMCB 2G0JA 1QAJA 4G1QB 1FF2A 4TU7A 1RTDB 3NKYA 3ENAA 2KL8A 4QW9A 3AXMA 3W2WA 3CD0A 1TKTB 1RHJB 3SZ2A 5IT4A 2HQIA 5DLGA 4ZPAA 1FERA 3BREA 4LF9J 2Q1LA 2D9OA 3B4DA 4MFBB 2W25A 2VL1A 3ZZUA 4X62J 3QIDA 1RHMB 2F9JA 2BABA 2Z56B 4UOGA 1IKYB 4X66J 2WW4A 1JMTA 3GPAA 5I3PA 4AXJA 3AFGA 2AQ4A 4KBIA 2YWFA 3PXGa 2JC0A 3W1YC 3QT7A 5E7OB 5F8LA 3IC1A 4KFBA 1HNZF 4IR9A 3ZTQA 1DARA 2XY7A 2E9RX 2DNRA 3DRSA 5C25B 5K14A 3UDEA 2Q3PA 4P2MA 1PYSB 3U7JA 1FJCA 1FEHA 1W25A 1S1TA 3HK2A 2MHEA 3OTOJ 4MMOA 1WACA 2BA9A 2V9WA 2EK1A 3IBFB 3A3PB 1RAEB 2ZH9A 1T3NA 3W63A 1SQFA 1S4EA 3UN2A 4ZA1A 4X4QA 2WVBA 2DIVA 2ZDOA 1EB0A 4IDKA 3G71S 3L3CA 3R1HA 4DV7J 4ES1A 3AAWB 3THTA 2CKWA 2OPRA 2P9EA 4ZP9A 2DXFA 3SXLA 4OLPA 2KJWA 4FPIA 1F2HA 3M32B 5KFOA 2I2YA 3DLKB 3DLEA 1N52B 6FD1A 4IRDA 3PJ9A 1R3NA 3OL6A 3BO2A 1WDDA 1HYSB 2JC1A 1Y9OA 2YNHB 2YNFB 3NGTA 3ENVA 3R7SB 2XB2D 2FDNA 2JJ4D 1VQ4S 1U7LA 1YTYA 5E3AA 1U25A 2BMBA 3KHHA 1DRZA 1Y4ZB 3LOUA 1N48A 5IQ6A 1SJ4P 3GJTB 3KMQA 5A76A 1CQNA 2OFHX 2V68A 3NRBA 5HAOA 4DV1F 1XMOJ 1PBUA 1TK8A 3HHLA 3D5MA 3GIJA 3TARA 4CLFA 4TQRA 1YI2S 2I0XA 5HMXA 1OY6A 2JLGA 1CJKA 4CIOA 4DL4A 3BDPA 3DHXA 4YB5A 2ZH3A 4FYVB 5T7LB 2V8HA 5BR8F 3CC7S 4C48A 1D8ZA 1IM6A 2ALZA 1H72C 1UEKA 3IG1B 4RNOA 3I32A 2FJDB 1U6FA 1UA1A 1VK3A 4ZCLA 3KYLA 2QIFA 3BJYA 5ETQA 5A6PA 1TVRB 3MECA 3RRHA 3W9HA 1IKWB 4KYZA 2NXEA 5K5MA 2HAIA 1EAYC 3FC9A 2F5GA 4S0MA 1U0HA 2PGCA 2K1RA 3DI6B 5LOQA 3GJQB 1X4CA 3JTPA 3J81U 2LEPA 4OYOA 3KLFB 2DVIA 4IG0A 2CADA 2R7SA 1S0VA 1PGZA 3KLEA 1NK8A 3DRPB 2VA2A 2NSCA 4QPXA 1FD2A 1X5SA 3M8PA 4C4WA 5U47A 4ED1A 2PIIA 4PAAA 1RT7A 2M52A 1YQHA 2RJZA 3IM9A 4DSFA 4DSJA 5ETKA 3BH6B 4Y2AA 2UXDJ 2BR0A 3MWBA 4MKYA 1T8EA 2EFPA 1FD8A 2DR6A 4MIAA 2W8KA 1RT1B 4RZRA 1VQ8S 3JAMY 3ETMA 3PW4A 3BQ1A 4DV5F 1NPPA 3HFZB 3NGDA 2MZ1A 3W8GA 2E7XA 4TYBA 1DTQB 4E0DA 3TEGA 3W62A 1FE4A 3DFEA 4UUWA 2ZDPA 1VQOS 1FKPA 3WX4A 3AOBA 3CCES 1RISA 1C1CB 2HQCA 1LXJA 1RHRB 3SDEB 4K4UA 1Q16B 2I5JB 1NHKL 2AJ4A 2F7VA 1LOUA 3KJQB 2D3UA 3M8QB 4MIBA 1EKRA 3O6QA 1X9SA 2L9DA 1VK8A 2CIMA 3MCSA 2ZM6F 3IRXB 1FE0A 3PR4A 4RKUC 3KMSA 4FVMA 3GV8B 1IR2A 1P9QC 2BW7A 2R9LA 1JJCB 1VRUA 4ZJOA 3FSXA 3D68A 1TAUA 3CTRA 3ZZYA 2XYPB 1DAXA 3SBMA 1VS3A 3VF0B 3EE3A 5L1LA 4F3OA 4DL5A 4K4WA 2MKKA 1VBKA 3K8VA 1U1PA 1UVMA 2KRRA 3HZEA 4BCAA 4O3SA 5B0BA 4USVA 3DXBA 3R5DA 3QSYB 3KLIA 4OJGA 2NR0A 3OR1A 3R6GB 4RUHA 2H54B 4MT1A 1FRLA 4HACA 3KG1A 3U1MA 2W4CA 4DR4J 1RSCA 3E2EA 3U1LA 2R2TA 3Q8QB 2B4PA 1NNDA 2HWHA 1BWEA 3PO4A 2OELA 3H59A 2RMLA 2V4JA 4YDDB 3T6BA 3UCGA 2AX1A 3KK3A 2UUCF 3CDUA 4AUKA 1FKOA 4J90A 1LWEA 3ZZPA 2VG7B 5HLFB 4OL8A 2BRKA 4WTYA 2LQ9A 4I2QA 2BANB 1F6TA 2DGTA 2B8QA 3DLGA 2K3IA 4DR7J 3W60A 5A0YB 1FX4A 3EGNA 4FBTA 2E5LF 1Q81T 2CDRB 2WVCA 4NLWA 3ZFVA 4X4SA 4GO7X 5L38A 4NYPA 1H7WA 5DLFA 1H3DA 3CMAS 4LRAA 2CPIA 4PRFA 1DTTA 3AJ1A 4XDCA 1LNQA 3LP2B 4Z7YA 2GZOA 1ZPWX 4KIAA 3TO8A 2H5EA 3G87A 3D3CJ 3LP0B 2PD1A 3VAHA 3QZ8A 2ZJRQ 3OQ2A 1R8PA 1U8SA 4QCLA 3PV8A 3GFHA 4LQ9A 1N33J 1HBUA 4LT6A 2VF3A 4AL5A 1HKAA 1K44A 4LF6J 1RWVB 4QR1A 1VR6A 2XMKA 1ZM3A 2VKZG 3BSNA 1KLNA 4AT1B 1YX2A 3T5HA 4OV1A 3NBPA 1VYAA 1H2TZ 2DY1A 1RKIA 2CAJA 1IQTA 4A46A 4RW6B 3SCLE 2KFNA 2DHSA 4WYLA 2YKPA 2F63A 3QJJA 1IBMF 1UJ5A 3BBBA 2O1PA 2BKNA 2PE8A 5IWAF 4U95A 1KTQA 3TP2A 2GJIA 3CE8A 1V5IB 2HLUA 2HQ3A 2X1BA 4MAKA 3CD6S 2BXJA 3D66A 1F1BB 1N5VA 4OZLA 4ED7A 3ONQA 5H1SV 2W2NP 1U6BA 3OD2A 2X3DA 4NOHA 1QVFR 2F3JA 3H40A 4M5KA 2FJWA 4UOCA 1CVJA 2NSBA 4F04B 2M88A 4DMZA 4EBCA 4QWCA 2DGUA 3HPOA 1Y5LB 2I9SA 4NLUA 2DJWA 3J7Z5 3HO1A 3ZO7A 3RR7A 4KAIA 4TXSA 2ZFHA 3TEHB 2BEFA 3HDSA 2YNGA 1PO6A 2XYGB 3UVJB 2KYZA 4WKYA 3R5BA 1G6BA 2AJ1A 4RW8A 3JSRA 3PFEA 1EKSA 1RBAA 3QGIA 1WD6A 2J6TA 1WC5A 5F9NA 4EYIB 1QAXA 1I3OB 2W7PA 1S9EA 3W9IA 2OTJS 3KUEA 4K2JA 1FFGB 4PWWA 4WIIA 4MYUA 3SCKE 4YFUA 3R1LA 1NRKA 2ZUAA 3V4IA 2L9NA 4JB8B 2XO7A 2D3OR 4DL6A 1RTDA 2OPQA 4UQGA 5CD4A 4ZN1A 5CHCB 1TKTA 2J76E 4KHRA 1S1WB 4M1KA 3ILIA 1CG2A 2APOA 4ECYA 3M6WA 1F5BA 2XBPA 2G0CA 2IIHA 4O44B 5GAGU 1JJHA 3IN5A 2UVWA 1CSJA 2FGOA 2V63A 3W66A 4LF8J 3HM9A 4DR6J 3RGIA 3N6MA 3IS9B 2CJBA 4X4UA 4A8SA 3TZYA 4ECQA 3HULA 1JX4A 1UAWA 4FYWB 3IGVA 2GQ2A 4RUBA 3OJSA 4LQ3A 4DV4F 1YRUA 3NP5A 1A9NB 1BY9A 4WFAQ 2FZGB 1HBNA 3MR6A 4LBIA 3TZWA 5C25A 2RS2A 5HP1A 2DR9A 3BGRB 2WK4A 3R7BB 1NPKA 3MMCB 3ZC4A 2XMTA 3TA2A 2UUTA 1P6TA 1RU1A 6AT1B 3EM1A 1VI7A 3P45B 4LR9A 2HHHJ 1YJVA 4OHWA 4WTOB 2QFIA 1HQ2A 5H9EK 4J9KA 3BKFA 2CNKB 3PYEA 1FKAF 4M94A 4G1PA 1T05B 4IR1A 1XK8A 1VQKS 2CUYA 4PG5A 5K8NA 2NYIA 2AD9A 4Q2LA 4GO5X 3Q22A 3CJKA 3DLKA 5KFPA 1RB0A 3DN9A 4WP9A 4DS5A 4KSEB 4B9NA 1WI6A 4DWIA 4CLLA 3DGPB 1WSVA 4QU7A 1O51A 2R7TA 2CZ4A 2PA8D 1O5JA 3PR5B 4OZ0A 5FDLA 3RAMA 3A4TA 2HQGA 2YVSA 3J81j 3LO3A 5IQQA 4P10A 1H38A 1XNRF 3RAXA 1QDUB 4LF7J 4KQZA 3RB0A 1MROB 2EG1A 2B6AA 3NAIA 4NXNF 1NDPA 4O4RA 4KB7A 5LJ5Y 3HHLC 2UU9J 2ZJQQ 1OYEA 5B0CA 1XR5A 2LEBA 3QGPA 1WKKA 3HHNB 5KG4A 2LEAA 5LM7E 5LL6d 3X1LB 5D0RA 4DSLA 1GT8A 3EGWB 1JXVA 5DG8A 2MLXA 1UWAA 1UEVA 1TK5A 1UVJA 4K0KF 4JI2J 4A8WA 4PWDB 4GC6A 2XS5A 4DPXA 3GP9A 2PDAA 3DI6A 1HBOB 3IAS9 2D7SA 4I69A 1N32F 2Z8QA 3TANA 2M7SA 4P7VA 4ZIVA 2F8EX 1CJUA 3RTVA 3DRPA 2DHHA 1S10A 1N54B 2PT0A 2U2FA 2QLXA 3K5NA 3Q8UA 3MPUB 1R8AA 5KT2A 2WBRA 4IO1A 5F0WA 5IT0A 1UJ6A 2JLFA 4GKKJ 8ATCB 1OO0B 7FDRA 2KVQE 3AODA 4LVNP 1XEZA 1QUVA 3QIPB 4KGMA 3SV4A 3HJVA 3JYTA 4G6VB 4ZCIA 3C3LA 4NLXA 1YVFA 2AX0A 1RT1A 3MHYA 1PC5A 4CLYA 2UUAJ 4F0HA 1BQMA 4OQJA 1EHWA 1DTQA 2KU7A 4CTAA 2MYFA 1V9OA 1HD1A 4R8UB 2NXNA 4MK8A 3CGIA 1BWVA 1FWKA 1JLAB 1REVB 1K47A 2E1MC 2V6AA 3PACA 4ZPVR 4M63A 4GVBB 4QR2A 5A2QY 4P9SA 4XAKA 1S4FA 3NMRA 2QLFB 4NLOA 1YITS 2IM3A 2X1AA 5ADZA 1HWUA 2NREA 3PX6A 3T3FA 3DMJB 3I4HX 2C3OA 5M2UA 3MM5B 4ZPDA 4JI0J 1TV6B 4LBHA 1V3SA 4ATNA 2ZBCA 1JQGA 1URNA 4TYAA 1RTZA 4H4MA 5ITHA 3EDQB 3GCWP 4HDHA 1F9FA 4NLVA 1X4EA 1NSQA 5D0GA 2CXEA 3EWGA 1QTNB 5IZHA 3I55S 1JXEA 2YWWA 3MM7B 3ZTRA 4URSA 5EWGA 2YKOA 4WCEQ 5KFEA 3UCUP 1WORA 3MAAB 1CS4B 2XSJB 1IWAA 5LMUJ 4WJBA 4PQUB 1N5TA 3M8YA 2HGMA 3IR6B 4ZLPA 2ZH7A 4KPCA 2XY5A 5AE2A 1T0TV 4QQBA 1WOSA 4RNNA 4MH8A 4QIGA 1YJ9S 4W92B 2JEJA 4DI6A 2GW8A 2VG7A 2X1GA 2H4WB 5HLFA 1X5PA 4B3RJ 5ETTA 1K1SA 4K7QA 2FC9A 5GMDA 3EYZA 1RKJA 1SKUB 3C6UA 3Q83A 5A0YA 2BJ7A 2KDOA 4CLWA 1UEUA 2FLPA 2AV5A 2J0XA 1VDHA 2EG2A 4DV0J 1VLYA 4PABA 2DNGA 2VC0A 4AYBD 1RI7A 5KFNA 1IBKF 4MIWA 3KLVA 5KFDA 4AE5A 3R5GA 4ILRA 4C3KA 3BPDA 2IM2A 4L75A 1U8WA 4OYPA 3LP0A 1E6VB 4LSLA 3Q8VA 4ANCA 3SQGB 3H8YA 4LIRA 1XTZA 1N8RT 2DGXA 1TL1A 2O01C 1RT5B 5J2PA 3M9MB 1R8HA 1ZOTA 3BBFA 2LKZA 5KG0A 3KK1A 3QGGA 1S6QB 1RYRA 4IQMA 1WC3A 4FPRA 3N6NA 2M4MA 2R2RA 1UPMB 3FRZA 4X4VA 4RW6A 1RT3B 4A4JA 3OHAA 4GRSA 4U7CA 3KUHA 5DG7A 1SH2A 4CYUB 4ZKAA 4A48A 4UZBA 3WIUA 1TAQA 1ZZNA 1ZA1B 2BJ1A 3GZ7A 2RNEA 1YJ7A 3NGSA 1IR1A 2IC3A 4UTGA 3MI7X 1D0EA 3G6VA 4EK2A 2YH1A 4QIWD 2RQMA 2QEXS 1RTJA 1M5VC 5J2MB 3TUIC 2FPHX 3GLJA 3G8TA 2OMOA 5HL7Q 1NK5A 1SH0A 4RL1A 3SFUA 2DHAA 3UVJA 3J7A1 1MLAA 4BC9A 1SKSA 3M2RA 1N0UA 1LEOA 4KY3A 2HBZB 4OHZA 4J9PA 2WB4A 4QJVA 4U7UD 1T9UA 5HMYA 1X4BA 1FEEA 3OL7A 3MPWA 4YR0A 4DZ6A 2GMHA 2ZH1A 3VAGA 3LW5C 3A8KA 3OUYA 4M5NA 2DR5A 1NUEA 1HNWF 2MKIA 3V6JA 2DCLA 2HVHA 3M2VB 1S97A 1S1WA 4ENOA 1OPZA 3RB6A 3ENWA 3DDIA 1TL7A 2A3JA 3POTA 3K2YA 2VQFJ 2K7KA 4ID5B 4LFBF 4P73A 1MN9A 2B9EA 2QGFB 5FLXU 3Q23A 3MM9A 4ECVA 1U0SA 4CLSA 4AL7A 3DOLB 3CMQA 4L3KA 3P4UB 2HWTA 4ELVA 5CZVA 3MFIA 2DISA 2Q79A 2DGOA 4UY8T 1RWMB 2IAJB 1CC8A 3NAHA 1NKBA 4LSNA 3BB5A 1NK9A 2ZOGA 3JSBA 2AEFA 3G4SS 1RT2B 2HS4A 2BE9B 5KFTA 2YPZA 3OSPA 4O3OA 5HATA 2H5IB 2XLJA 3W5XA 2ZBRA 4O3RA 4TVAB 3JSMB 4TN2A 3KFWX 3OXGA 3NCRA 2IYGA 4ERDA 4FF4A 4GMKA 1RTHB 2MZSA 1GK8A 3J80Y 3GV5B 2G9OA 2NXUA 3LF0A 3DOMB 1WG1A 1JLFA 3PJWA 3FJ2A 1RWOB 4HVZA 1T05A 3FBEA 2DNKA 2COLA 5KT6A 4PEOA 2Y8YA 3MPYA 1ZPVA 3MTJA 4BWJA 3RW6A 2HEKA 1TL5A 4Z2XA 2EK6A 2EFVA 4KHMA 1P8GA 1TUVA 5THWA 3ITHA 1T9VA 4ZHRB 1U47A 3DGPA 1CEZA 4N8OA 5D4LA 1SJRA 3D1QA 2C2MB 4Y34A 3JSYA 1NJIT 2B9WA 4AQYF 5C24A 2LDYA 3LGMA 1T95A 1WHWA 1VHFA 4FYYB 3OR2B 2ERRA 2Z30B 3CCUS 4KRWA 3QPIA 2E29A 3MR3A 1AXQA 2E5HA 4DV4J 2JH3A 1DBDA 1IWGA 1FTRA 2N7YA 3CD5A 2EEYA 2FHMA 3LGHA 1TKZA 3IWLA 3TAQA 4ZJLA 2HFZA 3Q86A 3OJUA 1H0HB 4JI8F 3KLHA 4OZ3A 3B8HA 7AT1B 2MQ8A 3TUZC 2ZD1B 3MM8B 1TTHB 2HK2A 4KV8A 2J0QD 4DR2J 1H74A 4WFBQ 2IM0A 4B3TF 3FGVA 3EVMA 4ZVFA 3QLHA 4HL9A 1HI0P 1UETA 4L73A 4MKBA 1S6OA 1VBYA 3U02A 1HBMA 1RCOB 5CD4H 1Q1KA 3NOGA 2HG4A 5AE1A 3GFZA 2C2NA 5KFYA 4JI3J 1HBOA 2PMZD 1J5OB 4LFCJ 3GONA 1X0FA 2KHDA 3A3NB 2BACA 3P49B 1GEHA 4USWA 1VRTA 1RP5A 2BDPA 5F8GA 1WC1A 3QMQA 2DNPA 4ZVGA 1SV5B 3W65A 2KZMA 2B56A 1HR0J 5AXNA 3TVKA 2HSEB 2E5JA 1B4SA 3Q8YA 1AZSB 5B0EA 4NRUA 4MKAA 3B54A 2V8DA 2RAQA 3MDFA 1UKUA 1WDTA 1OQ3A 5HBMB 1RUSA 3BF4A 1HQUB 3GE9A 2HQDA 2W9BB 1IBCB 3BPSP 1XMQF 3FVYA 4DR3F 1MMNA 4HHUA 1U2FA 4EEYA 4R8UA 5LMNF 3NXZA 5EWFA 1WSRA 4GVBA 5KFZA 5K20B 4BBYA 4ZPWR 1N88A 1OY9A 2AYBA 4K0KJ 2EKYA 1DFDA 1Y00A 2GVDA 4YDXA 5BYSA 3R27A 3DMJA 3QT8A 4P2XA 4ZPCA 4KO0B 3MM5A 2OEKA 2MKSA 3OFEA 1T94A 4E98A 2HVEA 1U1LA 1QJHA 5G0RB 4DR5J 1PBAA 2YQ3A 2HZVA 4K59A 4CWBA 3EVWA 3I96A 2CWKA 4OJ1A 2D3O1 1Q53A 3MM7A 1RWWB 2V67A 2VFVA 1D9AA 2IDLA 2Y1RI 4A8OA 4NLGA 3N28A 3MAAA 3H7HB 4LRFA 4J9UE 2YKQA 2XSJA 1JKHA 4PQUA 3BO3A 5FD1A 1Q8IA 3D6TB 3ET6A 1GTHA 2MQQA 3CCQS 1SQGA 3B6BA 2M3DA 1JLBB 3NWRA 3AOAA 4HH1A 2XS7A 3AXKA 4ES2A 5CYQA 1XNQF 2DR7A 1S48A 4I67A 1QY7A 3OXFA 3UI3A 2MQLA 3R6LB 4Y2IA 2P6TA 4UW2A 1D1UA 4FN5A 2N4DA 3D3BJ 2IJRA 4ECXA 1FDBA 2DK2A 3SCJE 5HVGA 3P96A 4RW7B 3UDCA 3SCIE 4V19J 1WOOA 3H2LA 2FJXA 5F8HA 4NZ6A 4R0EA 4Y3CA 4O3NA 2CJQA 3A3OB 2CQDA 4R25A 3JAMU 1CULA 3ILLA 2F4VJ 5KG2A 4C0HA 3SQGA 2R7QA 4ZN3A 1Y5IB 5KFWA 1A0OB 2UUWA 1M0SA 4DV3J 2JLEA 2OI2A 4EYHB 4C97A 3M2UB 4BC7A 4Z7CA 1U48A 5KOXA 2KJVA 3BGFA 2KYXA 3H5SA 3PW7A 2MGZB 3LAMA 1RACB 2BJ8A 4M5HA 1D9FA 1F3FA 1CPZA 4NXMJ 3KDOA 3S6EA 2OLWA 2LQJA 3THVA 3LA0A 4OI2A 2AYMA 4C8OA 1RT3A 4FS1A 4ECRA 2K3KA 1HNVB 1U26A 3TUPA 2XZWA 1OSCA 2XGQA 1NSAA 3G96A 2CPJA 2MSSA 4Y0FA 3HCXA 2WW8A 2YXLA 3T9ZA 1RAOA 5CZXA 2JFDA 3RU0A 1O6XA 2R2SA 4CH1A 2DGWA 1IBKJ 1RJJA 1R0BG 3MUVP 2HHSA 1S76D 4JI5F 3VVUA 4OFZA 1CC7A 3UE2A 3MUTP 4V19X 2PC6A 1TELA 3CJQA 3LPEA 4NLPA 2VA3A 4KT0C 4DG1B 3E01B 4LBPA 4CLZA 3K7RA 2W2OP 2VUGA 5KT4A 3OV7A 4KE5A 3CJ0A 3L7OA 4ZITA 4J5OA 3MR7A 3PW5A 5A8WB 1LK5A 2FB0A 2ZKTA 3QRPA 3W2VB 3H5XA 3CW2C 1MNEA 3KLGB 2YY3A 5BJRA 4QYZK 2NS1B 1U2RA 2POKA 5DQHA 3BQ2A 4PG7A 2EFNA 2R4FA 3T1YJ 2FVRA 5LXRA 2VB6A 2FHOB 3CEDA 2XMMA 5B7WA 1FNXH 4PCQA 3M2VA 4W98A 4DV6J 4C11A 3DOKA 1HQEA 3LH2S 4QWBA 1LWFB 5J1EA 4CCHA 3K5LA
chains in the Genus database with same CATH topology
1VBXA 3OL9A 2GV1A 2I5JA 3VAHA 1HARA 4OZ1A 3V4IB 1S9FA 3QZ8A 3HVRA 2ZJRQ 2RKIB 4N76A 4Q45A 1RT6A 5K9FA 3CPWR 3OQ2A 1R8PA 2DB1A 3M8QA 5J1PA 1U8SA 2OPQB 1K73T 3IGNA 3PV8A 3GFHA 4LQ9A 4QIEA 4FXDA 1HHTP 4QCLA 2VFUA 2RQ4A 1HBUA 4LT6A 4AL5A 3TNVA 1WHXA 3PX0A 3RR8A 3TUJC 2CQPA 1NJXA 5JVHQ 4YUDA 4DN9A 3IRXA 4O0IA 4QR1A 1F2GA 2FY1A 1HNVA 4F2SA 3EXCX 2XMKA 2LXIA 1NK4A 1ZM3A 2OPPA 5I3QA 2Z2MA 1F0XA 4DQPA 2M8DB 4QIFA 2MPUA 4HEA9 3PKMA 2VKZG 3CDBA 3BSNA 1KLNA 5KT3A 4ECUA 5KFHA 2DBBA 3T5HA 2XLKA 4OV1A 2RILA 1RT2A 3NBPA 2VPXB 2GO8A 3PIPQ 3MM6A 3B82A 1VQLS 1H2TZ 2HYIB 5A8KA 1RKIA 2CQ3A 3OFHA 4ID8A 1ELOA 1TZ0A 1IQTA 1JJ2R 2FGCA 4A46A 4PXEA 1PILA 1KNZA 4B02A 2NLWA 2C2EA 4RW6B 2DNHA 4B08A 3NL0A 1GX5A 3SCLE 3S8SA 3T1AA 2KFNA 2DHSA 4WYLA 2YKPA 4DR1F 4DL3A 5JUMA 4ED5A 3QJJA 1IBMF 1UJ5A 4L72B 2QV6A 2CQIA 4LIWA 3X3UA 4CO3A 2L41A 1KC8T 2UVVA 3DLHA 2O1PA 2PN6A 4KTQA 2PE8A 3LPYA 3GMGA 4Q43A 5IWAF 1U6ZA 1FXDA 1KTQA 3TP2A 1DLOB 1MWZA 2VG6A 2GJIA 3CE8A 4DUZF 2VFSA 3ZZ0A 3DOMA 4NCAA 1KLMB 2XY6A 2LQ5A 2HLUA 2HQ3A 1APSA 3N9UC 4Y2CA 2ZE2B 2ZNYA 3LQVA 4YHHF 4UQTA 1UVNA 1NEEA 2XMVA 1CLFA 2X1BA 1FNMA 2IVFB 4MAKA 4DG1A 3CD6S 1Q8LA 2ABYA 1HBNB 2BXJA 2OPSB 2LXFA 1N5VA 1LW2A 4IFVB 4OZLA 4LF7F 3HHKA 4CO5A 5I3UB 1UA0A 3CIZA 1VQPS 4ED7A 3T1HF 4NA2A 5HP1B 1SIZA 2PA3A 3H2VE 3ONQA 5H1SV 2UVUA 4PG6A 1FO1A 4QBUA 1T3OA 3WDOA 2QA4S 4WU3A 4USHA 3DM2B 3R5CA 1U6BA 1KONA 1FDDA 4XO0A 1SJ1A 5F8IA 4I6AA 1K8AT 1VQMS 1BD6A 2GJ2A 3NS6A 4NOHA 1QVFR 2E5IA 4IKAA 2GGPA 2F3JA 3B4MA 3PO5A 3GIIA 5DM6Q 3H40A 5M2PA 2UU9F 4IRCA 4A47A 1L3SA 1RWUA 4QR0A 2FJWA 4UOCA 1CVJA 3D0GE 2PI4A 2NSBA 1JLCB 2M88A 2O3DA 2VBXA 2BANA 3W2VA 4DMZA 3QJPA 2Z0GA 3KWMA 4ZHRA 4QWEA 4QWCA 5JVGQ 4EBCA 2DGUA 5KFVA 2NUUG 4F25A 3HPOA 4NZ7A 1Y5LB 1QSLA 3I31A 2I9SA 5B0FA 4NLUA 2DJWA 2HIQA 3J7Z5 5DGAA 2E44A 3HO1A 1MWYA 3RR7A 4DJBA 4KAIA 4TXSA 3GSDA 2ZFHA 2ILZA 3M6UA 3HDSA 2YNGA 4IG3B 4NLYA 5DS7A 4IOBA 1YHQS 1PO6A 1C4AA 1Q86T 1Q7YT 1J5EF 2KYZA 4NCGB 4WKYA 3R5BA 2YX4A 1G6BA 2GQQA 2MJUA 1K9MT 2I38A 3LUYA 4Y65A 2AJ1A 4RW8A 1O0PA 3CJKB 1V3ZA 3JSRA 3PFEA 1FHTA 4JI2F 3N01A 2XMUA 3UD3P 1L3TA 2EBGA 3QGIA 4F4WA 1WD6A 1NK7A 2UXBF 2J6TA 2JDJA 2QA2A 1BC6A 5F9NA 4EYIB 4NLSA 1QAXA 3N5FA 3H5YA 5CCLA 2W7PA 3ULHA 4QYRA 1S9EA 3OLBA 2ZJPQ 2OTJS 5HQ8A 3LP2A 1QAIA 3M6VA 4ELUA 2IMOA 1SC6A 3GFXA 2C2DA 5J2NB 5IS2A 4WIIA 3BSAA 1NU4A 1FK9B 1X4HA 3MD3A 4MYUA 4QU6A 1LWFA 3SCKE 3V5RA 2VOPA 4YFUA 3R1LA 3D28A 1NRKA 3GYXB 5FDLB 4OX9F 4YB1P 3WC2A 4X2BA 2NPFA 2UZAA 2ROEA 3M30B 3V4IA 2L9NA 2XO7A 4J9QA 1M1KT 2AGPA 4WFYA 1ZBTA 4DL6A 2D3OR 1RTDA 2ZHAA 5JJBA 4NMLA 1XBWA 2OPQA 4EWTA 4UQGA 1S72S 2WSCC 2DRAA 3SYZA 3G9CA 1O8BA 2E1AA 3NLCA 4I6YA 2N4CA 4JV1A 4W90B 4U7UK 3MPVA 5CHCB 2GHPA 1TKTA 4H4KA 3KOAA 3IBWA 3P6YC 3E3XA 3THPA 2B5JB 3DCAA 4GKKF 2J76E 1IBLF 4KHRA 4RU9A 1S1WB 2CQ4A 3N4WA 4M1KA 1Q8BA 2AF6A 2IBKA 4DSKA 3ISND 2RRAA 4FBUA 1DQ8A 4EBDA 1CG2A 5E3PA 2APOA 3TAPA 1Q82T 4PXDA 3CJ5A 2HMIA 4ECYA 3IWXA 1SUQA 3CSKA 3KJVB 2IA0A 3UQSA 3M6WA 1F5BA 2FC8A 1H2VZ 4JUZA 1SKRA 1UW4A 2BV3A 2XBPA 1IQZA 2G0CA 3TW0A 4O44B 5KG1A 3OL8A 1S1VB 1S79A 5DM7Q 2B6AB 5GAGU 1HMVA 2CQCA 2CPDA 1JJHA 2KN4A 5J2QA 2UUAF 1JLGB 2B9YA 2QE5A 3WBZA 3HF5A 3MZIA 4YOEA 3IN5A 4CT8A 5D77A 2UVWA 2IVMA 1CSJA 2FGOA 5E3QA 1WELA 3VAFA 4IRKA 3HT3A 1HWIA 1KS2A 2KH9A 1GH8A 2CJ9A 4DN0A 1R27B 1U1RA 4LFAF 1DHMA 1WHYA 3F41A 3HM9A 2RU9A 3BM7A 2VQEF 2J6SA 4I7FB 2C3MA 2HZCA 3F44A 3N6MA 2A2CA 3UNGC 3OTDA 5DG9A 4JYAF 3IS9B 2CJBA 2HNZB 4X4UA 1NJWA 4A8SA 3P5TL 4ZP6A 1S1UA 4ECQA 5D78A 4F67A 3ETOA 2HHPA 3NGKA 1MMDA 2WTFA 2R8GA 2P9GA 1UWBA 3CIMA 1HHSA 5J1NA 2XWYA 1JX4A 1UAWA 2ZH2A 2HHXA 3PIOQ 2BM1A 3IGVA 4HLBA 2GQ2A 5F8JA 1KLMA 3OJSA 2JFKA 3DHWC 4LQ3A 4DV4F 1YRUA 3I56S 4J9NA 2VASA 2ILYA 4DPOA 4PQAA 2QLWA 2DH9A 3DLLQ 1FRKA 1UP1A 3NP5A 5EN1A 1SQEA 1A9NB 2YKMA 1HI1A 1BY9A 5SUHA 1SV5A 2EVZA 4WFAQ 1HBNA 2QYCA 5GAEU 5D4OA 2YWGA 5I3UA 3MR6A 5C25A 3DXSX 2RS2A 2DRBA 4WXOA 2UV8A 5HP1A 1ZM4A 3MEKA 2DR9A 3BGRB 2WK4A 2CPYA 3TOQA 3TR5A 3V4MA 2ZZMA 2EFGA 3MMCB 3ZC4A 2M5YA 1HNIB 2XMTA 4ECTA 1N6QB 3TA2A 2ACYA 1W2BR 2UUTA 1P6TA 4QOTA 3VAMA 1KEKA 1WHVA 1VI7A 4ECSA 3DLBA 1VMBA 3FZ2A 3GFYA 3SSRA 1Y3KA 1U1OA 1X4DA 3MMAB 4JOUA 4CH7A 2YNIB 2BE2A 2OJ3A 1YJVA 1KVIA 4OHWA 5HBMA 4ETXA 4C8YA 4JI0F 5FIIA 2PEHA 3CC2S 4J9KA 2JEGA 2MXYA 4HTJA 2JZ5A 1JLCA 3MEDB 2W9BA 1VC5A 4DF4A 2ROPA 1FKAF 3M9NB 4M94A 1NK6A 4G1PA 2M70A 1T05B 4WZMA 1OIAA 2AP6A 4IR1A 1XK8A 2ZKUA 5KT7A 1VQKS 4CO4A 3CJ2A 5C42B 3C6TB 3I4PA 4PG5A 5K8NA 3BN4A 2NYIA 4UY85 3AA9A 1FXRA 4OLOA 2RDJA 2AD9A 3TQ1A 2HGLA 4Q2LA 4F3MA 3DYAA 4GO5X 5HN0A 1J2VA 3Q22A 2RQKA 4B9LA 3CJKA 4NA1A 3MMBB 3DLKA 5KFPA 3JYTB 2UVRA 1FDNA 3DN9A 2MHNA 2GCFA 3QGHA 3W7BA 1VBZA