1VC6A

Crystal structure of the hepatitis delta virus gemonic ribozyme product with c75u mutaion, cleaved in imidazole and mg2+ solutions
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
95
structure length
95
Chain Sequence
PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Conformational Switch controls hepatitis delta virus ribozyme catalysis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation/rna
molecule keywords Hepatitis Delta virus ribozyme
total genus 23
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vc6A00
2ERRA 3SDEA 1U1LA 2MQPA 2DH9A 3U1MA 3L3CA 3G8TA 2LEAA 3DXBA 2MJNA 1X4EA 1U1RA 2D9PA 2CQ0A 2RQ4A 3D2WA 1JJHA 1X5PA 3UD3P 4W92B 2CPJA 3MOJB 2AD9A 3SMZA 1WI6A 1PO6A 1CVJA 2GO9A 3UWTA 3VAMA 2HGLA 1P1TA 2X1FA 2LA6A 2LECA 1ZZFA 1M1KT 2MKJA 1M5VC 3CULA 1OWXA 3P3DA 1FXLA 1X4BA 2OTLS 2MZQA 2MZJA 2DGUA 3EGZA 1VBZA 2KT5A 2FPHX 2N3OA 1SXLA 2DNGA 2ZJQQ 5IM0B 2MKKA 3MURP 2MKHA 2FC9A 1X4CA 2KVIA 2MQLA 5IFMA 2KRRA 2MQMA 4FXVA 2M2BA 3CF5Q 3I55S 2DNNA 1VQ8S 2Q79A 5LSOA 3Q2SC 2MQQA 2J0SD 2DIUA 3IRWP 2LA4A 3K0JA 4UQTA 5LJ5Y 2CPYA 3V4MA 1R8PA 1UW4A 1M5PC 4C4WA 1X5OA 4YB1P 3I56S 4Z2XA 3MUTP 2J8AA 1YJ9S 2WBRA 2XNQA 2DNRA 4IUFA 2NZ4A 2VODA 2CQ3A 2DH8A 1YJNS 3N9UC 3CC2S 2KHCA 2DB1A 1VQKS 2MKSA 2DNPA 3G71S 2VOOA 4M5DB 3TO8A 3VF0B 3THTA 4IOCQ 4FXWA 3TP2A 1WEZA 1SJ4P 2KU7A 2OJ3A 4LJMA 1Q7YT 1WF2A 2CQBA 2KI2A 2DHAA 2D9OA 4W90B 4OZ0A 4ZKAA 1YJWS 1SJRA 2MZ1A 1X4DA 1WF0A 2MB0B 3CMES 2DH7A 2NLWA 3BO2A 3CCRS 2DNZA 1KOOA 3VAGA 2JVRA 3LQVA 1R8HA 2FHOB 3H2UB 1A9NB 2QEXS 2DO0A 3DLLQ 2M0GB 1VQ4S 3P6YC 3SDEB 3BEGB 3UCUP 2MZSA 3G6ES 2M70A 1YHQS 3NMRA 3CTRA 3S01A 5GADU 3Q2TC 3R1HA 1H6KX 5DM6Q 2MZTA 3G4SS 3MD1A 3NNHA 2ADBA 4V19X 2MMYA 1F9FA 4J5OA 2X1GA 2I2YA 2K3KA 2DISA 3ZZZA 2CQIA 1VQPS 4WCEQ 5BJRA 3R27A 1RK8A 3CCJS 5DDRC 2MZRA 5DDPC 1SJQA 5GAEU 2RU3A 3G8SA 2MSSA 2RS2A 1M5KC 4WFAQ 1WHXA 5IQQA 2CPZA 1WWHA 3S8SA 4CQ1A 5GAHU 4ERDA 1X4HA 2AYEA 4CH0S 3NNAA 1HL6A 2DO4A 3J7ZT 4QQBA 4LMZA 2E5JA 2U2FA 3VAJA 2M7SA 2CQHA 2RS8A 4LIRA 5LSLA 1H2TZ 1WF1A 2KXHA 3RW7A 1FO1A 2RT3A 3BO4A 3UCZP 5DDQC 3JB9k 1UP1A 3B4DA 4YOEA 3MI7X 1VC6A 3IWNC 1YI2S 4ED5A 1O0PA 5EN1A 2DK2A 1W2BR 2YWKA 2AYGA 2GHPA 3CXCR 2DNQA 5ITHA 4QU6A 2CQ4A 2PE8A 2CQGA 2DNLA 1DBDA 5CA5A 2DGVA 2EK1A 4TU9A 4WF9Q 2M4MA 2DGWA 2M9KA 2DITA 4Y00A 2ZJPQ 3US5A 2DNKA 1KOHA 4A8XA 2N3LA 2CQDA 2LKZA 1N8RT 4TLQA 1FJ7A 2E44A 2QFJA 1HD1A 2VOPA 2JRSA 3ZZYA 3G96A 1K8AT 3CC4S 1WG5A 3P49B 3VAHA 2RRAA 1A7GE 4WIIA 2LMIA 2EK6A 1VQNS 1WI8A 2LEBA 1U1NA 1S79A 3MUVP 5CXTA 1XN9A 2OIHA 1G2EA 4C0OC 2QA4S 2DHSA 4U67Q 4QU7A 1OIAA 1FT8A 5DDOC 1B7FA 2JVOA 1RKJA 5GVQA 2OTJS 2N82B 2G1DA 3THPA 3H2VE 1ZZNA 1ZH5A 1WHYA 3CCMS 2DGQA 2CJKA 1KQSR 4F25A 1WHWA 2KM8B 5MLCV 5D77A 2CPHA 3NS6A 2DHGA 2CPEA 2DGTA 3EGNA 1VQ6S 1VQOS 2MHNA 2FC8A 4CH1A 1JJ2R 2DNYA 2O3DA 3B4MA 3MUMP 2KXNB 2DNMA 4UY8T 2CPXA 2EVZA 2CQ2A 2V94A 2YKAA 2AYMA 3P5TL 2YH1A 2DGXA 2MYFA 1HD0A 2MPUA 1FJCA 2RNEA 4TU7A 2DNOA 4EGLA 2YTCA 2RRBA 3CCUS 5IM0A 1VQ9S 1K9MT 1NO8A 2RVJA 2HYIB 4TU8A 4P6QA 1YTYA 1X0FA 1FNXH 3G9CA 3S6EA 2E5IA 2MKCA 1VQ5S 5JVGQ 2PEHA 2YH0A 3VAIA 3VALA 3CD6S 2B0GA 2LYVA 1VBXA 1YWXA 5HL7Q 2HZCA 2L08A 5GAGU 5D78A 2CQCA 2K8GA 3VAKA 3NNCA 2LXUA 1N52B 1WELA 1WG4A 1X4GA 1YIJS 2ADCA 3CPWR 1KC8T 1SJ3P 1U1OA 1OO0B 2VONA 5JVHQ 2KG0A 3U1LA 1D8ZA 2D3OR 3LPYA 1WG1A 2DIVA 3BS9A 3EX7B 5DETA 3CCSS 5LJ3Y 2XNRA 3CCVS 2CPFA 1WEYA 2OSQA 3UE2A 1X5TA 2M88A 3FEYB 2KM8C 2BZ2A 2RUGA 1VQ7S 2F9DA 1Q82T 2KYXA 2N7CA 1WEXA 2J0QD 4IOAQ 2DGSA 2JX2A 3J7YU 4WKRA 1U2FA 5DM7Q 1KD1T 1UAWA 4RU2A 4F26A 3CUNA 1NU4A 4PKDB 1JMTA 2I38A 5LXRA 1X4AA 1AUDA 1X4FA 1JJ4A 1L3KA 4QPTA 2M8HA 3S7RA 3UD4P 5GMKa 1FHTA 1DHMA 1U1PA 2XS5A 2RQCA 5HO4A 2HGMA 1NJIT 3ULHA 1M90T 3CCES 3MXHP 1N54B 2CQ1A 2G0CA 2KG1A 4PR6A 1IQTA 1SJFA 1X5SA 3UCGA 2ZJRQ 4WFNQ 1H2VZ 4Y0FA 2KFYA 2J76E 3FEXB 1U1MA 2BOPA 1VC5A 1DRZA 3TYTA 2KXFA 3OW2R 2DHXA 5H1SV 2XSFA 2UP1A 2E5GA 1U1QA 2MQOA 1QVGR 4PRFA 1P27B 1DZ5A 3HHNB 2CPDA 4IO9Q 2U1AA 1WTBA 2G4BA 4YUDA 3R1LA 1YITS 2XB2D 1PGZA 2JWNA 4WFBQ 2MGZB 1BY9A 3CC7S 2F3JA 3SXLA 1FJEB 3CCLS 2KH9A 1U1KA 1M5OC 2KN4A 2HVZA 1Q86T 4C7QA 2M8DB 3MDFA 3PIPQ 4CIOA 2L41A 1K73T 2LXIA 3VAFA 1U6FA 2XS2A 2MQNA 3BO3A 1VQMS 2DGOA 1UFWA 2SXLA 2LQ5A 5LXYA 3CCQS 2LCWA 2M52A 3RW6A 2A3JA 1OPIA 2X1BA 2AYBA 1N88A 3MD3A 2L9WA 2MXYA 1S72S 2X1AA 1WHVA 2XS7A 2CQPA 2MY7A 3NS5A 2FY1A 1QVFR 3CMAS 4F02A 2MY8A 2DNHA 2E5HA 1H2UX 5CYJA 1URNA 1D9AA 2CPIA 5FJ4A 1HA1A 2MKIA 1VC0A 3HI9A 2HGNA 2KRBA 1Q81T 1VQLS 2MJUA 4OZ1A 4BS2A 1QM9A 2OSRA 1VBYA 2F9JA 3PIOQ 2MGZA 2MSTA 1U6BA
chains in the Genus database with same CATH superfamily
2ERRA 3CMQA 2F7VA 1DLOA 1I5OB 4KR0B 3T1YJ 2HHXA 1G3OA 4ECWA 3WIVA 4HKQA 4ZP8A 2J9CA 1SH3A 2JL9A 4B3MF 3L3CA 4F4WA 3G8TA 5H9FK 1CG2A 4K59A 1RLCL 2HEKA 1T94A 2CQ0A 2OP5A 3JQMA 2RQ4A 3RG6A 5EGYA 3J80U 4DL3A 2BE2A 1RWPB 2XLKA 4YS2A 3UD3P 4W92B 3MOJB 2GAGC 4NLQA 4NRTA 5K20B 3KLHB 2OFGX 2OO4A 2GVDA 1TAQA 3K17A 3OLAA 4YEAA 4RNFA 4EMDA 3M8RA 2QO3A 3MR7A 3BR9A 3VAMA 3IM9A 2MKJA 4CO5A 5C42A 5HN0A 4DFMA 1HWUA 1W2IA 4AE5A 2KFNA 1REVB 1B70B 3CW2C 5HATA 5K8OA 2V8DA 2R7UA 2OTLS 1QE1B 2BUNA 4MKAA 2AGPA 2MZJA 2DGUA 3SFGA 1X0PA 3UN5A 1QAYA 2XMUA 4C8ZA 1VBZA 2HLUA 4ZJQA 2Q1LA 3V6KA 3W8GA 2VH7A 2HG4A 2FD2A 3E01B 4KV8A 3RAMA 2DNGA 4MH8A 5DLGA 2NXUA 3OTBA 2MKKA 4ECXA 5H9EK 3VV2B 2Y8YA 2RHQB 1I3OB 2MKHA 1PCAA 1SV5B 1RHMB 1X4CA 2FC9A 2YNIA 3MAHA 4UOCA 1FCAA 4ZVTB 3H8YA 4A48A 2OD4A 3BDEA 5KFXA 4QR0A 5IFMA 4HYKA 4DQRA 3NCQA 2MQMA 3M05A 2GS8A 2B9YA 2G2ZA 2M2BA 3PHTA 3EDQB 1ZAXA 3KJFB 4O44B 3IP0A 4RR5A 1PC5A 1U0HB 5KFWA 2DNNA 2ZHBA 3NL0A 2ZH6A 4J9OA 4JV1A 1KP6A 3D6FB 1YVFA 1ZM3A 1Q4RA 4ZLLA 2C2EA 2LA4A 3EZOA 3F56A 2Y1IA 5LJ5Y 3OTCA 4DSIA 4Q0BA 1WOSA 5LMNJ 2C3UA 2XLIA 3ENVA 3LF0A 3C2PA 1HNXJ 1WSRA 4Y65A 1IKVB 5D8HB 2IJNA 3QFHA 3FQLA 4OYZA 3H98A 2XCAA 3I56S 4PUOA 3GQCA 3J7A1 1S1TA 2NUUG 3NCRA 1LW2B 1QAXA 3KLGB 4I6AA 2JC1A 4B9MA 1OY9A 3A3NB 3PXGa 1PBAA 2IVMA 3BF4A 4H4KC 4W98A 3WC0A 4JV2A 4X4VA 3BGRB 5B0FA 4KGKA 1Q8BA 2B51A 4PPDA 2DH8A 4JI5F 4J90A 3N9UC 3CC2S 4GKKJ 1FRXA 4FF4A 1VQKS 2B5JB 1RWMB 4ER8A 2DNPA 4UOFA 2XY5A 2AKWB 2HRUA 3I87A 4M5DB 3THTA 3HCXA 2J7WA 2XB2D 4KAIA 4RW4B 4A8MP 1WDTA 2XI2A 2ZNYA 3OVSA 2YNGA 3KHGA 2B7CB 2O01C 3N28A 3TUZC 5I3UA 1RT5B 2XY6A 5LMUJ 2WTFA 2BQ3A 4FYDA 1JNRB 1WF2A 2CQBA 2V0NA 3W5XA 2JJ4D 3F41A 5F41A 1NKEA 4OQJA 3F44A 2VU5A 3I0RB 3HSJA 3CEDA 1O51A 3QT6A 1RT2A 4J9LA 1YJWS 2WVCA 4IOBA 4M95A 1XBWA 2IAJB 4KO0A 3CDWA 3DRXA 4U96A 1W7WA 3CMES 3ENAA 1WOOA 2BXJA 2DH7A 3HT3A 3BO2A 1N36F 3CCRS 2D69A 2I9SA 1WC5A 2VQEF 1IJFB 2RIJA 4U9RA 2HHUA 3M2RB 1C1CB 1PAEX 2JVRA 3LQVA 1R8HA 3GV7B 3GTYX 4HI2A 1XNRJ 2EEYA 4LRFA 5KT3A 2QEXS 2OPPA 2RDIA 2YNHB 3GP9A 3H4BA 2X7IA 3TUPA 2IJRA 3MF5A 5A8RB 1VK8A 3IWLA 5EX3A 3GONA 2FQQB 3P6YC 1RISA 3U7JA 4LFBF 5LSRA 3G6ES 1IKXB 2A1BA 2C2OB 1YHQS 2YNGB 2JHEA 3VGSA 1C2PA 5GADU 1JLAB 3GYXB 4OZJA 2ZOFA 3Q2TC 4O44A 5DM6Q 2JFKA 2BANB 9RUBA 3NNHA 4V19X 3HLUA 4DL7A 1HPZB 2B4UA 3H2LA 1Q8IA 4O4GA 4RNHA 1MROB 5HVGA 2HQ3A 2X1GA 4PEOA 3ZZZA 4C8NA 5EUHA 1JXVA 2CQIA 4RUHA 4QU7A 1VQPS 2J7KA 3T19A 5HJXA 2WK4A 3R27A 3ZZRA 1NB7A 3AHPA 4YN3B 5AXMA 3CCJS 1RTJA 4RBVA 2LQ9A 1FX4A 1TVRB 1WC1A 4PXBA 1S1TB 3OSPA 1X9MA 4U8YA 2W8LA 2JH3A 1VRUB 2R7OA 3TEGA 5GAEU 2FLLA 1RCXB 1UETA 3Q8SB 4LSNA 1M5KC 2WVBA 3NWRA 1M0SA 1YKWA 4UY85 1WKJA 1WHXA 1TELA 3GZ7A 4FDFA 5IQQA 3TA1A 3ZFVA 4CT8A 4DPWA 1VHFA 2FLPA 3S8SA 1NZ8A 1CLFA 2VICA 1JKHB 3NXZA 5BXIA 1CULB 1T11A 2N4DA 3GFZA 4YQWA 5L1KA 1X4HA 1UEKA 2DD8S 2YWHA 2WOMB 4CH0S 2BJ3A 2XHCA 1HL6A 2DO4A 4E98A 3J7ZT 1IKYB 1U2RA 2ZDOA 4NOHA 4OI1A 1RKIA 3MAAA 3VAJA 4IRCA 2M7SA 2VKRA 3RW7A 3MM5B 2D74B 1FO1A 4IDKA 5A8KB 2E1CA 4M8LA 2RT3A 4RW6A 3C6UB 4FVMA 2A10A 3IBFB 4C8OA 4FYYB 3M32A 1SUQA 4XPCA 2J5AA 3V81B 1W26A 2ACMA 3VZHA 2FJVA 2DY9A 1L3TA 1FD2A 2QMXA 3I5AA 3LP0B 3R8YA 3PR4A 3IWNC 1EETB 3L7UA 4ED5A 2AGOA 2EBEA 1OMSA 5MAOA 3OTDA 4WE1B 3BGFA 1FX2A 3T41A 1VJQA 1UA1A 2ZHOA 3CXCR 1KTQA 2BJDA 5AE2A 2YQ3A 1SC3B 2B8PA 2CQGA 1DBDA 3ILJA 4OLOA 2RD5C 3I5BA 4PG5A 3UNGC 3K57A 3MPDA 4LBPA 2YY3A 3GG1A 3IR5B 3LP2B 5D4NA 4M5NA 2M9KA 2DITA 2W1BA 3PJWA 4TY8A 1UFKA 1HKAA 3OUYB 3US5A 2ZJPQ 4DR1F 2C3OA 2KVQE 1OY6A 3RBZA 4QIWD 2XGQA 4DSJA 3MCOA 1KOHA 4IKAA 5JUMA 4UTGA 4DV6F 2LKZA 4F7VA 2UVWA 2HQGA 1CEZA 4PAAA 4X4OA 5SZTA 2QFJA 3N0VA 4QIVA 2UUAF 2E9TA 2MLXA 5JXSA 3AXMA 3G96A 4ZVFA 1HD1A 1S0VA 4KKOA 2UUCF 2RRAA 2FHJD 2ZH7A 2WB1D 4X84A 3ADAC 3AY0A 4CLPA 4JI0F 1AA1B 1WI8A 1VQNS 1U1NA 3MUVP 3MHYA 2IM3A 3V6DA 2QMWA 1LWCA 5DS7A 1HWIA 3HHEA 3KUHA 3MM5A 2RQKA 1HBOA 3C15B 7FDRA 3GIRA 4B9SA 2NXJA 3ETMA 4ELVA 4X66F 4JV0A 1B7FA 3DDKA 5H9EJ 5KT5A 4E2FB 3C14B 3W3SA 1K44A 1R8AA 3M2VA 1NPRA 4I0WA 5D4PA 4RBTA 1CJTB 1Y11A 3THPA 2OEJA 4F3QA 2AEJA 1TP7A 1Y0HA 1FJGF 5AE1A 1R89A 1U26A 4I1TA 2HK2A 4I2QA 2CJKA 1RACB 2Y8WA 2UVRA 1SL1A 1FWKA 3CIMA 3DGVA 2KM8B 1S7IA 4NLWA 4WXOA 5L38A 1SI9A 2R8JA 1ZTWA 5D77A 1VR6A 2DR5A 4O3OA 5ETSA 2K3IA 4GRSA 2J9DA 4H4MB 1PJ6A 4NCGB 1XIQA 3N01A 3EGNA 4KYZA 2AJFE 2C2DA 1AXQA 1EP4B 2K06A 3OQ2A 4CLSA 3F0NA 4CH1A 4IFYB 2O3DA 3N6LA 3KK3B 3MEDA 1ZM2A 4KPYA 4X64J 1A6LA 3SI8A 2Q6BA 4Y2KA 4ETXA 5KFPA 4NCAA 1AFIA 2HNDB 4PQUB 3IGNA 1ZM9A 3L95X 3MAAB 4LQ3A 2C3PA 2F63A 2W24A 3CWJA 5C24B 3SQOP 5CAAA 3ZZPA 4DV0J 1BQMB 4CLZA 5KFKA 4WP9A 4F4XA 2YH1A 3T1HF 2DGXA 1S49A 4P73A 4ALZA 4IFVA 5JJBA 4YY3F 3OFGA 1FJCA 4ID5B 2CDQA 3BQ0A 3IMQJ 4B3SJ 4OV6A 1LWFA 3SQGB 3W2VA 4TU7A 3M6WA 3MMCB 4EGLA 3M2RA 3QYYA 3DRSA 2YTCA 4USTA 3WIUA 2RRBA 2PDAA 2V8VA 4OJ1A 3JQJA 1VQ9S 3ITHB 1K9MT 4ZVUB 1AROP 1PYSB 1U6ZA 3D3BJ 4ZVSB 2DR9A 4RW7A 1WKLA 4P6QA 1AW0A 3OL8A 3AOCA 2OIHA 2E5IA 3B54A 5DJBA 2JEFA 2Z2MA 1VQ5S 2WSCC 4CT9A 3VALA 2JSXA 3CD6S 2GQQA 1TKXA 2LYVA 2CKWA 2GIFA 2Z30B 1R8CA 1UJ5A 2HWIA 5FDLA 3OL9A 1YX2A 4OI6A 1YWXA 1FESA 2L08A 3GIMA 4A8FA 3NEKA 1ZS6A 2BX6A 2CQCA 4ZVEA 4LT6A 3NNCA 4CLKA 4F50A 1WG4A 1X4GA 2X51A 3ZZTA 3M7VA 3BN7A 2YWFA 2XO6A 4I64A 1K0TA 4JBCA 1KC8T 4W4MA 3M1VB 4KPCA 1U1OA 2VA2A 3GSDA 2OPRA 4DMZA 3KLGA 3LGNA 2YPZA 1RWXB 2D3OR 5ETRA 4K4VA 3LPYA 4OHYA 2ZBPA 4G1QA 4NXNJ 2GJ2A 4B3MJ 1AB8A 1LEOA 4A47A 2CJAA 2CPFA 4KGXB 3CJ3A 3MOZA 1TK8A 2UUBJ 3HHKA 4PPZA 1KNZA 4FYXB 3CCZA 3ICLA 4R0EA 1TMJA 4LUBA 4NRUA 2EFVA 5D4LA 2AU0A 1JB0C 1K0VA 1KTVA 3NOGA 4I4BA 1LV5A 3CDAA 2W9BA 1QAIA 3FUYA 5A8WB 4EWTA 1Q82T 3FGVA 1I94F 1NDKA 3SIPB 1VLOA 2OELA 5C24A 5HJYA 2F8MA 3UDLA 4WKRA 1UAWA 1URRA 1NMEB 4ECRA 1TQLA 1HBMB 4B3TF 1PYOB 1YZ6A 2VFSA 2COLA 1KFSA 4PKDB 2VJVA 1XQIA 3PYEA 1JMTA 3I0SB 4Q5VA 3IBWA 1AUDA 4MMOA 1S57A 2M8HA 2HWHA 4J9PA 2BE7D 2WVFA 4GO5X 4IH7A 2EXUA 3VWSA 1FHTA 4RWWA 3DLEB 2GX8A 2N4CA 4H54A 4F36A 1H7XA 3CJ4A 3IRXB 2RQCA 3EUNA 1TL1B 2IJFA 5HO4A 1NK8A 2HURA 5IV4A 3HJFA 2GW8A 3ULHA 4LRBA 1C0TB 1JLBB 1OYDA 2J6SA 1YDLA 2W2OP 4OFZA 3V2UC 4CLUA 5FIIA 2E1RA 2PD1A 3R5AA 1DJ0A 3PRBA 2G0CA 2V4RA 4K0KJ 4HT5A 3GR1A 3FK4A 1X5SA 1GTEA 5F8GA 3UCGA 3ENWA 3R5CA 2ZJRQ 1FKAF 4DSKA 4LF5F 1G7CB 2P5VA 2HBZB 3CD5A 2J76E 4EU0A 2V63A 3M9NB 2V69A 2XYHB 3KNGA 2VQEJ 3RZAA 4DV7F 3QMQA 2YKQA 4M5GA 3OT9A 4MTPA 3UN2A 5J2PA 4X4TA 1VC5A 1DRZA 3TYTA 2FLNA 1G1XA 1AT1B 1HBUA 4RW8A 4ZPBA 3SFUA 5L46A 2EC2A 4LRCA 4CDIA 2E5GA 4EYHB 4ZCIA 2H65B 5I42A 3GWCA 1NK4A 2YX4A 1QVGR 2BE2B 2VFTA 2NYHA 3JSYA 4AXJA 2FGOA 2GO8A 3DRRB 1HNZJ 3HHNB 2HK3A 2NXCA 2CPDA 2V68A 1FK9A 3DRRA 3NY0A 5AXLA 4XPEA 4IO9Q 1XNRF 3GJSB 2E9RX 2I5JA 1WTBA 2G4BA 3MR3A 4FZVA 4YUDA 1YITS 4WWSA 5KFNA 4HI1A 4I68A 4MFBB 5KFSA 4C0HA 3NRBA 4M5JA 1RWOB 5IS2A 4J9RA 3EYZA 1LW0B 1NBEB 2IIHA 4DDFA 5G0RB 3VGUA 1RT7B 2F3JA 1FRIA 1REVA 3LWMA 2VHGA 4L76A 5J1EB 2IFXA 2DT9A 2KH9A 1M5OC 2XYPB 1LWEB 4DV0F 1RYSA 5B0BA 2HVIA 3JSRA 4C7QA 4MJKA 4C3KA 3OHBA 1JNZB 4ZVPB 1RXOB 1YRUA 2XMWA 2HQIA 4WE1A 2L41A 1JLBA 4N77A 5A0YA 4RNNA 3PNIA 4QBUA 3VAFA 4J9NA 4V19J 1MSWD 3BSAA 2IMWP 3HFZB 2DXEA 4WTYA 5ADZA 1UFWA 3UDEA 3Q8VA 1N48A 3VCDA 3DLJA 5L9XA 2XG8A 2EFOA 2RB7A 3KK2B 1JKHA 5LXYA 2CG4A 2MHEA 1FTRA 2IDEA 4ZN3A 1FRLA 2M52A 3CJ8A 2F1FA 3RW6A 2AYBA 4ICLA 1MWZA 1T9VA 3RBDA 3Q8PB 4HACA 2K7JA 2QSFA 1FKOA 2BRLA 2MY7A 3DLGA 1RWWB 3LPEA 1VFJA 4USJC 3W63A 2C28A 4BWMA 1XMQJ 1QVFR 3PX4A 1UZDA 2EFQA 2H3EB 2LXFA 2RH3A 4UF4A 4NLRA 1FKPA 2ZH2A 2DYAA 1XR7A 1URNA 4NWBA 4QCLA 1VC0A 2YKPA 2YKOA 3AFGA 2I6WA 3UR0A 3EVMA 5A2QU 2I0XA 2QLBB 2QX0A 3C19A 1GNKA 1KS2A 3LTOA 5KG3A 2QA4G 2O5DA 4O3RA 1GXTA 2W01A 1R43A 1UEVA 4QPXA 2LQBA 3KJQB 2IA6A 2J6TA 4MKBA 3MFIA 3RR8A 1CPZA 3DRSB 2BEFA 2FYXA 2MSTA 3HJVA 2QC3A 1ZBTA 5ETMA 1G6BA 1T9UA 3CCTA 1U1LA 2BM1A 3MMAA 3BR8A 3EDRB 3OVBA 2JLGA 4DWIA 3OR2B 1Q95G 2ZUGA 3OXFA 2LEAA 3DXBA 3FSIA 4C8MA 1HWJA 2W2QP 4ZPVR 2GCFA 3OLBA 2AHOB 1JJHA 3BV8A 1X5PA 4AD6A 4O4GB 5CCMA 2ZH5A 1S6PB 2FB0A 2P2CB 1RT5A 1WI6A 3LAMA 4DUZJ 4DR2J 2W2MP 1HWKA 1Y00A 5C2GA 5KG4A 2GO9A 1HWLA 1PAUB 3ISND 1OYEA 1FXDA 3I0RA 3M4XA 1FD8A 3W9HA 1P1TA 2X1FA 2LA6A 4B3RF 1ZPWX 2AEMA 2D3O1 3IR7B 3NAIA 3EZ5A 1JLCA 3CULA 4K4SA 1OWXA 4Q2MA 1FXLA 3HO1A 2C42A 4X62F 3OL7A 1X4BA 4LBHA 4PG4A 8RUCA 1Y3JA 3W60A 5C2CA 2B9XA 4HACB 2MZQA 2HVDA 4F2SA 4PXDA 3PX6A 4USWA 3RJMB 1B64A 1N6QA 1DFDA 2JEJA 5J2QA 2YKNB 3DYAB 1FE0A 4NMLA 3IAS9 2FPHX 4ED1A 1J5OB 2JDJA 2B5JA 4WBFA 3TUIC 2N3OA 2HMIB 4LRDA 1UVMA 3JTPA 3P96A 5CZXA 3MURP 2YX1A 3RB4A 4P7TA 4OHZA 5HMWA 3PY8A 3D1QA 2VBWA 1Q8KA 1NDCA 1SQGA 3I5CA 1MNEA 2WRMA 4U6PA 5KOXA 1WOPA 5G4DA 2HS0A 3MCSA 4R25A 2QYGA 4HR2A 3H4DA 2F8HA 2D1CA 1CQMA 2CVIA 4NLSA 1VQ8S 2BDPA 2EC0A 1CJVA 2I1RA 2DR7A 4F2RA 3CNQP 3LUYA 1VOMA 3MEEB 4UQGA 1U49A 4Q8FA 3AA8A 2BV3A 2UUWA 2XGPA 3Q23A 1O8BA 2Z8QA 3K0JA 3TQEA 2ZFHA 1UW4A 1M5PC 3HFVA 4X2BA 2MLYA 4JI7J 1X5OA 3QSIA 3R3TA 2XO7A 4A8WA 1N33J 4ANDA 1T03B 2HVHA 3KK1A 4OX9J 2ROGA 1IR2A 2DTJA 2AX0A 1YJ9S 2J8AA 2WBRA 5D0RA 4LSLB 2HW3A 5L1LA 3R7SB 1HNVA 2CDRB 2DNRA 2E7XA 4ECTA 3RB6A 1YBUA 4IUFA 2NZ4A 3A3OB 2VODA 2GV1A 1HMVA 1WSVA 3J7YI 3FVYA 2FJBB 3MXHP 1DTQB 2MKSA 1DY3A 4L3NA 5KFZA 2NREA 1QDUB 1LXJA 2MEWA 3C14A 2VG6B 1H74A 2JC0A 2VOOA 1H7WA 4LVNP 2HHWA 1CS4A 4I2QB 2CNKB 3CJTA 2QL7B 3Q8UA 4FXWA 1LW0A 1SJ4P 1U7LA 4OX7A 1F9HA 3VZIA 1Y3KA 2KT2A 4RNMA 1RTIA 2XEXA 4I2PB 1TK0A 4MK8A 1Q7YT 2VG6A 5GMEA 5LOQA 3AODA 4HEA9 2A18A 1QUPA 2LU2A 5G0RA 3PTWA 3FBEA 3ISNC 2AV5A 1TKZB 3QIPB 3BKFA 1VIXA 2YNIB 4C3MA 4ZKAA 4DQPA 1WACA 3BSCA 2MZ1A 4OZ2A 4DX8H 5KFTA 6AT1B 3V6DB 2UXCF 4JYAJ 4N76A 1VQYA 2FZKB 4OLPA 1EKRA 2NLWA 3CD7A 4BC9A 5K8NA 5F8LA 4J9MA 3PRDA 4IRKA 3I82A 4OIXA 4V1Ak 1EB0A 2UXCJ 3WQPA 4MKVA 3VAGA 3L9ZA 2OKQA 1ZYQA 1QE1A 2OHDA 4J9VA 5HVFA 2NYIA 4B3OA 2V2VA 4ZOSA 2QSWA 2UV8G 2E5LF 1HBNB 5B0AA 3QRRA 1KLNA 1KSPA 1MN7A 1X8DA 4P2MA 2PC6A 1U45A 2MZSA 2M70A 4NX9A 3KG4A 5F8MA 3OJUA 4NXNF 3BB5A 1CULA 1NZAA 4UZBA 4I69A 4HHHA 4WU3A 4Y3CA 4USKA 4X4QA 2ADBA 3DI6B 3K59A 2XHWA 3ILIA 3CB4A 4AXIA 2ZOGA 2V50A 4FBTA 3EXCX 4WXWA 5BR8J 2E7WA 1XNQF 3KUEA 2I2YA 1D3WA 1QTNB 3M2UA 2VJUA 1AFJA 2O1PA 3D3CJ 5AXKA 1RAEB 4WCEQ 1IKWA 1KFDA 3DLHA 5IC4B 1TL5A 2OUGA 4XDCA 2LDYA 2MQ8A 3DNCA 1L3VA 5DDPC 2ATLA 2Q66A 3G8SA 2D3UA 2MSSA 4AL7A 2RS2A 4DQIA 1YRTA 4FYVB 4N56A 5J2MA 3EVWA 4ZPDA 2CPZA 4MYUA 4I6YA 3LP1A 3TAMA 5K9FA 1WWHA 4DPYA 3QLHB 3I0SA 2ZC3A 2H51B 3DKDA 3JSBA 1N0UA 2AYEA 4M5IA 1XMOF 2R7VA 1BD6A 4P74A 2QLWA 3O3LA 5DO2A 2G1HA 3QGPA 1X9SA 2HS4A 3PW7A 3QGHA 4QQBA 3PFOA 4UUWA 2B43A 3SYZA 2E5JA 3ENQA 2DR6A 3E51A 5I3QA 2XLJA 3DGPA 1WF1A 3UDCA 1HNIA 4B08A 2V8PA 5KFHA 2ZBRA 2W9AA 2IC3A 2E7VA 2PO4A 3RGIA 2BKOA 4FVCA 5FLXY 1SIZA 3BO4A 3UCZP 3IM8A 4RX6A 1UA0A 1MLAA 3M9MB 5DDQC 1NJYA 3MMAB 1NKBA 5AT1B 1RTJB 3R6LB 4CO4A 5HQMA 4DLEA 2C22A 5IT9Y 1NM2A 1WD6A 2ZBCA 1FRKA 3D28A 5A6WA 3MZIA 1C1CA 5B09A 3KG1A 2HRYA 1Q7LB 3DRYA 1PG5B 4GC7A 2DK2A 2D7SA 4QWDA 3X3UA 4N8NA 1W2BR 4ZITA 3G6XA 3RAXA 1J5OA 2YWKA 4G1IA 5KG1A 4DPOA 3M30B 3HVRA 2UXDJ 1YJ7A 1FA0A 1TKXB 1LWXA 3OXGA 4ZLPA 2HHQA 4EI2A 1JLAA 4QU6A 2FTRA 2AZ1A 4DCJB 2PFFB 5IC6B 4LIWA 3AD9C 1HQEA 1ROFA 2VC1A 1ACMB 2EK1A 1JLCB 4OYAA 4BBYA 2PEBA 1GMWA 1Q5VA 2M4MA 4IG0B 1IJEB 3GPAA 4GO7X 1TV6B 4HHJA 2ASLA 4Y00A 1RBLA 4GKJF 3SCIE 4M5MA 2HSEB 2B6AB 3PJ9A 2YWEA 5HANA 3W65A 2XCPA 3DDNA 3NGDA 2XULA 4RW7B 4WP3A 1YK9A 4USHA 4A8XA 3GIIA 2BYCA 2CQDA 1TL3B 1MU2A 2JRSA 3AD8C 1C1BB 1F9EB 2HLTA 5BYSA 2VOPA 3MTJA 1A7GE 2HNYB 2Q3PA 1XK8A 3ZTSA 3OR2A 2Y9HA 5CABA 2GVZA 1LQ9A 2H5EA 3MEGB 5U47A 3KOAA 4F4YA 4QR2A 3MFHA 2R7RA 1RABB 4NLOA 1XN9A 2IC3B 4A8YA 3CVKA 4C0OC 5GAHI 4X65J 4M63A 1IKVA 4S0MA 4F4ZA 1KLMA 1LK5A 4U67Q 2RMLA 2OH2A 4I67A 3MEDB 4MK9A 1C0UB 3DFEA 3TARA 1RU2A 4PWDB 4FF3A 5DDOC 1NHUA 2DHHA 3D9BA 3CCWA 4IYQA 5CQGA 1RKJA 5GVQA 2FVCA 1Q78A 2N82B 5DGBA 2V5HG 5EWEA 8AT1B 3H2VE 2PN6A 1LWCB 1RUSA 1Z2LA 2AT1B 3V4IA 1N34F 1KQSR 1KQGB 1VIOA 3IGVA 3M30A 1WHWA 4O3PA 2NPFA 4F25A 2HHPA 4ED4A 3BM7A 1E6YA 4Q45A 4USMA 3H7HB 4PYAA 2CPHA 1MN9A 3NGSA 2WAQD 3OR1A 4YP3A 2CPEA 3I4PA 2HHVA 1CJUA 2QFIA 4F0MA 4EK2A 1VQ6S 1RWKB 1BWVA 4ICLB 3SSRA 2Y0SD 4K4UA 4AL5A 4FN5A 2QA1A 4QYZJ 1BC6A 2MHNA 5K8MA 1JJ2R 2Y3YA 2DNYA 3BBBA 5DG7A 2NQPA 5B0GA 1WTFA 4OX8A 2FJXA 2FGCA 3C15A 1UPMB 2RE1A 2A0FB 2BMBA 4P71A 5I3PA 4ZLNA 2FVSA 2KXNB 1HIYA 1RT1B 3MM8A 4J37A 4Y28C 1TMMA 3SEOA 4RO0A 1V3RA 2DNMA 2FY8A 3HHLC 2ROPA 2CQ2A 3MR2A 3KG0A 2YKAA 4WYWA 4K50A 3FCWA 3P5TL 3CDUA 3DLKB 3TA2A 2GVDB 4Y2AA 3KLHA 5M2RA 2FZGB 3QO9B 4YB6A 1C4CA 2WSFC 3PR5B 3H25A 1S9EA 1U2CA 3MMBA 4ZPTR 3DOKA 4CO0A 4IH5A 1R0AA 1UVNA 1OSDA 4U7UK 3PDNA 3KHRA 2HFSA 3CCUS 4MFBA 4JI0J 1MMNA 4CP5A 4DF8A 1F0XA 4PG6A 5A76A 2RVJA 2R7QA 2I5JB 1SKUB 4QIGA 1RT3B 2XSJB 2G0IA 3BSOA 2GMLA 5HSPA 3BQ2A 3TVZA 1R0AB 2MKCA 3LALA 2YX7A 1B99A 5KG7A 5DG9A 4NXMF 2PEHA 4Q44A 3QWPA 3H5XA 3DI6A 4DX5A 4FNHA 2F4VJ 2VZ9A 4ES1A 3Q0AA 1DURA 4B9UA 1EQ0A 2NS1B 5D78A 2WOMA 1DTQA 1TFYA 4OYOA 5IOLA 1U02A 1WELA 1YIJS 1S9FA 3JS9A 4G3IA 1RAIB 3NP5A 4QW9A 5J1NA 3QQCD 4ED6A 4Y2IA 1D8ZA 4QW8A 5F8NA 1DLOB 5B08A 3BS9A 2FVRA 4K4XA 3EX7B 4RNOA 5DETA 4KE5A 3CCSS 1RE1B 3CCVS 2XMVA 2UXBJ 5HP1A 1S76D 1KVJA 3FEYB 4DG1A 3EJMA 4EBEA 2KM8C 3ONQA 3AT1B 2LDIA 1N33F 3SZ2A 2BZ2A 2RUGA 3FRZA 1DAXA 5F8JA 2GNKA 4NYPA 2N7CA 2J0QD 2PFDA 4GVBA 4X65F 2JX2A 2RKIB 5HI7A 1VLYA 2NXEA 3L7PA 2HPUA 3WBZA 3H42A 5HBMB 5IQ6A 5KG5A 5EWGA 5DM7Q 2QIFA 3BKUA 1KD1T 1UL3A 3MEEA 4DR6J 3M8PA 4JV5F 3I6PA 4MIWA 1JJCB 1JLGB 1MMLA 3L4BC 3HT0A 2W8KA 3FC9A 4ZPAA 1CS4B 4QPTA 2VFRA 2NUHA 3S7RA 4KHPJ 5B0DA 1ZPVA 5KFFA 3M8SA 2EKNA 1DHMA 2HIYA 4DU7A 3JTNA 4CTAB 2V2KA 3LAKA 3MR5A 1XMQF 2JLFA 4OI0A 1FNOA 3DCAA 4LF2A 1GH8A 4FNIA 2W2PP 4DR6F 3RTVA 3V6JA 3AB2B 2C2KB 1S1WB 3M8WA 3HXMA 4P7VA 3OTOJ 1S48A 5KFYA 3JYTA 1N54B 3ETOA 1SL2A 2R8KA 4YHHF 2KG1A 2W2NP 4O3SA 4WZQA 1IQTA 3CIZA 3G82A 3OD2A 2E1MC 4ZVRB 3R5GA 4A8SA 3F73A 1J5EJ 3M6UA 2Z58B 4CYUA 1S4EA 5D15A 2XTJP 2GZOA 2KB2A 2RJZA 3LANA 3MM7A 3W1YC 1RT4A 1S5ZA 3GR0A 4F0KA 2ZZMA 5K5MA 1GMUA 2B4PA 4LFAJ 3VVUA 1T0TV 5IZHA 3R5BA 2V6AA 2J0WA 3RB0A 1LFPA 1V9OA 2KXFA 3GU0A 4LF1A 4J9QA 4M94A 1VYAA 2DHXA 2VPZB 5GAGI 1NDLA 5H1SV 4K4WA 2UP1A 2P9GA 4PYDA 4PRFA 3SSQA 3BBCA 3T9ZA 4LFBJ 4X64F 3T5HA 3IBCB 3PG9A 2GC8A 4KTQA 2BACA 3KKFA 3MECA 3HHDA 2HHSA 3MWBA 3BGRA 3R7NB 4ED0A 2UUBF 2UZAA 1SQEA 2U1AA 3CJ0A 1VGYA 4ECYA 1FWPA 2VA3A 2ABYA 3X1LB 3PZPA 4O3NA 1H72C 2OMLA 2W7AA 5KG2A 4PUOB 3KMQA 3T1HJ 3M8PB 1Q0NA 1WKKA 3BGOP 1JLEB 1BQMA 2O66A 3M2VB 3MECB 3O6QA 3W5YA 4DPXA 3BH7B 4WFZA 5DQHA 3SXLA 5DG8A 3KUGA 1RGVA 4QJVA 1HFEL 1U1KA 4CYUB 4DR3F 4ID5A 3DOLA 2VASA 1OQ3A 2HHHF 1NCLA 2ZH8A 4PWWA 2C3YA 3CJKB 4QYZK 2D41A 3NGKA 4QYRA 3MDFA 3FFIB 5J2NA 3GV8B 4KIAA 2PA3A 3LH2S 1J2VA 4ES3A 2Q6CA 1R31A 4U95A 2G0JA 5ETPA 4DV4J 3EM1A 1GAOA 2FLOA 3HSGA 2DVIA 1EP4A 2XS2A 1Y4ZB 2IRXA 3H90A 4RU9A 5J2MB 4NA2A 2YQ1A 3BJYA 3LGMA 3BO3A 1SV5A 1T9YA 4K4YA 1GQEA 3W9IA 2ZM6J 2B9WA 4P2FA 3TJAA 1IBKJ 1TKTA 1BQXA 1HHSA 3QLHA 2RHSB 2QLJB 1U4BA 3TVYA 2R2RA 3OFHA 4I7FA 1IBKF 2X1BA 3LGHA 1LOUA 3MD3A 1T9TA 2V2ZA 4IG3A 4EZ9A 1IR0A 1Q16B 4X4PA 2X1AA 1WHVA 2BRKA 1CJTA 1RTHA 4F02A 4LR9A 5CYQB 2DY1A 4LF7J 4BCAA 1KEKA 2DEIA 3GE9A 4JI6F 3TA0A 1NK7A 4OHVA 2XMTA 1D9AA 1RAGB 3ET6B 2CPIA 1UVIA 5FJ4A 4FS1A 4J91A 1JLQB 1IWAA 1PJ7A 3KTQA 2BQRA 2NR0A 2UVVA 4IQMA 3TWZA 3NKYA 1UJ6A 2KHDA 2MJUA 2V2QA 2LP4A 3TAQA 4B3TJ 4BS2A 5HP1B 2GJIA 1QM9A 5M2UA 2OPQB 3BN4A 5C5JA 3PIOQ 2UUTA 4F67A 4ZCKA 4KKOB 3G8QA 5L8RC 1EX8A 1T05B 3CJ2A 3TANA 1I94J 3QATA 1SUQB 2MQPA 2DR8A 2PMZD 1NPKA 1KDNA 1Y10A 2CNOB 2BVZA 2DH9A 2Y1LB 2KT3A 2ALYB 4OYMA 4I56A 3RUBL 1SJ1A 3U1MA 2IDLA 2ZITA 4H4OB 5E2QA 1WORA 2XC9A 2MJNA 4DSLA 1JXEA 4JI4J 3JXOA 1V6HA 1GFWB 2D9PA 1FFWB 3D2WA 4MIAA 1W25A 3ZTRA 2W7OA 3K5LA 3TQ1A 2ZVSA 3SMZA 4OJGA 3RRKA 1G4CA 1UVKA 3FBBA 4NLUA 2VF3A 1CVJA 3AQPA 3H40A 4DCPB 3UWTA 2ZHAA 3J81Y 1J5EF 4LSZB 2HGLA 1QSYA 3FZBA 2DKOB 1RB0A 2LECA 1ZZFA 1M1KT 3R2CJ 3Q83A 1R3NA 5J1PA 2ZM6F 4DLGA 4L72B 3P3DA 3TZWA 3J7Z5 5J1EA 3KJVA 5HROA 2V4QA 1R6YA 2VB6A 3HVTB 4FPRA 2DJWA 2BJ1A 2YWGA 3W2WB 1UJ4A 2V34A 4PG7A 1RP5A 3L09A 1VQSA 4XK8C 2R42A 5HQ8A 4RWXA 1S9EB 2FHMA 3MMBB 3HHLA 5A2QY 1E6VA 1FTCA 2ZH9A 3TJ9A 5IT9U 1GXLA 1HYSB 5CH7B 3G87A 3BYRA 3HSDA 3JSMA 2P6TA 2ZJQQ 1Z2ZA 2NSCA 2WVEA 2MQLA 2KVIA 4WFYA 2WVDA 5DZ6A 5GMDA 4A8OA 4CO3A 4J9KA 4KJIA 4DJBA 1HPZA 1EJ7L 3SSSA 2KRRA 4X62J 3DHWC 4HTJA 3GMGA 3Q8YA 3FRYA 5I42B 4XIUA 4JV5J 1KKHA 3D0GE 4QWBA 4RW6B 1BXNA 3FFIA 5J2NB 2Q79A 1HBMA 1L5UA 5LSOA 4JI5J 1Z4UA 3P4UB 2MQQA 1FFSB 2KKHA 4KT0C 2J9DE 3IRWP 4RBUA 1MWYA 2QT7A 4UQTA 2LQ8A 2BQUA 2HBQB 2OEKA 4NZ6A 4IH6A 2GHWA 3PYFA 3QT5A 2UU9F 2EFNA 2CJQA 3SV3A 4L3KA 5HLFB 2XWYA 2FVQA 1FDDA 2VD3A 5AXNA 4YB1P 4RKUC 3NS7B 1MU2B 3GFHA 1X60A 3ZTPA 4BHQA 4KGMA 4Z2XA 4BLGA 1NH7A 4IG3B 1FF2A 1GT8A 1S6OA 2ZDPA 4EYIB 4LSLA 3PFEA 1K1SA 2RF2A 3D6TB 2CQ3A 2ZEJA 2DRDA 3OR1B 2CWKA 4DR1J 1FRMA 1S4FA 1T03A 1PIEA 3QWUA 2OPRB 4NYZA 5E3PA 3ZTQA 3KK1B 2YPYA 2BJEA 1ELOA 2FIUA 4RJVA 3TO8A 3VF0B 4E8UA 4CO1A 4X4SA 4IOCQ 3EICA 5CCLA 4OJHA 4CI0B 1KVIA 4LF6F 1C4AA 1N5SA 3C6TB 4ED8A 2OJ3A 2KU7A 3MTKA 4NLYA 4DR7J 4DV4F 2CWXA 3H5UA 4LJMA 4DV5F 3VR1A 5RUBA 3BDPA 1S1VB 5D4OA 3VGTA 3JAMY 2J0XA 3DOLB 1S10A 1CBKA 2EPIA 1N5TA 1U8WA 1VRQC 1ZA2B 1U47A 2HNYA 4JI8F 5A8WA 3UDVA 3RU0A 3EGVA 4W90B 4OZ0A 4ILRA 2AGQA 1SJRA 4FS2A 1IBLJ 4JI3J 1JWWA 1WF0A 3UN3A 5LM7E 1SL0A 2MB0B 4ZMMA 5B7WA 2X3DA 1KR4A 5KT2A 2HMIA 3OV7A 2DPJA 1L3UA 2EI5A 4OJ3A 4EBDA 4DUYJ 5C25A 2VBYA 1PJ5A 3FQKA 4DQQA 1D1UA 5KFAA 2P9EA 4RPFA 4KFBB 1H98A 1SPBP 2ZBQA 5C25B 3H2UB 4IRDA 1A9NB 1P1LA 2V8GA 1RYRA 2DO0A 4JI4F 4OI4A 2Z4PA 3DLLQ 2M0GB 1M1GA 3SDEB 2H54B 2HNDA 4PQUA 2DCLA 3UCUP 2QE5A 3MM6A 2YNFB 3NMRA 3CTRA 3DU5A 3NBPB 5KAKA 2L9NA 5D0EA 2UV8A 3N6NA 1H6KX 5LMNF 4DQSA 3G4SS 2A6OA 4ECUA 2MMYA 4B9TA 1QLNA 2ZKUA 1RT6A 5I3UB 2RILA 2IBKA 5D3GB 2Y1RI 4NCGA 2VC0A 5HMXA 2K3KA 2DISA 2IA0A 3GB0A 1F2HA 2R8IA 1RHKB 1CJKB 2GIQA 1DTTB 2ZUAA 4IQXA 5KFCA 4K4ZA 5BJRA 1SH0A 2HAFA 3ZNUA 5C7PA 1EAYC 2HQCA 1RTZA 1ICEB 2BJ8A 2HFOA 2NZCA 5AJ3J 3KLEB 4G65A 1X31C 5DDRC 3ITHA 3W64A 2WW4A 2MZRA 2KZMA 1AYEA 2GHVC 1H3DA 1Y9OA 2RU3A 4DV2J 4Q2LA 3P8BB 4YR0A 1Z1ZA 3LO3A 4I6WA 4WFAQ 1UWBB 3D1HA 5FD1A 4DUZF 2CXEA 3MR6A 6FD1A 3HD2A 1FNMA 3GJQB 4N7TA 3VTIA 2VIHA 4B9LA 1M1HA 4KHRA 1T8EA 3MPUB 4Z37A 4ERDA 4Y6IA 1QY7A 4AUKA 2G2YA 1CQNA 1MMDA 2AX1A 4DL0C 3NNAA 1N32F 2HBRB 4K8RA 4URQU 2W25A 3N5BA 4P9SA 1FEHA 4BC7A 5F0WA 2WONB 2M3DA 2Z57B 4LMZA 4HLBA 1IBMF 2NCKL 2YXLA 1YSJA 2U2FA 3HVAA 3PVXA 2CQHA 2M5YA 2RS8A 4LQ9A 1JIHA 4KGVB 5LSLA 5L39A 1F3FA 3PW5A 1S9GB 2FJDB 4ZN1A 3J81U 1RT3A 1M5HA 1VCTA 3D4JA 3D7SB 4DG1B 4IFYA 3JB9k 2R7XA 1UP1A 2QGFB 5JMNA 4YOEA 3MI7X 3ZZ0A 4C48A 1B4SA 1VC6A 2KL8A 2CZ4A 3OBIA 1FRHA 3J81j 2Z0GA 1O0PA 3TX8A 1BLUA 1WC6A 4ZVQB 2RRNA 4KV8B 3Q22A 3FBCA 4ATNA 3K5OA 4URSA 4DV6J 1NH8A 5IV3A 2V8HA 1JX4A 1GMWD 4LVOP 5CZVA 4B3SF 2BE9B 2C2RA 3D1OA 3K5NA 1F60B 4OMFG 4P72A 1S97A 4LF8F 2DNQA 1PSDA 3AA9A 3M8ZA 2CQ4A 1NK5A 1SKRA 2AF6A 2PE8A 1U0SA 3ET6A 4TN2A 2DNLA 2ZD1B 4NLPA 3KHHA 1T9WA 1Y5IB 2DGVA 4OZ5A 4WF9Q 5H9FJ 2DGWA 2ZD1A 1YQHA 3PYDA 3QAEA 4LF9J 5J2PB 4WK1A 1QUVA 4U7CA 4LFCJ 1HMVB 1XERA 1N5YB 3N4WA 3R6GB 3UO0A 3VQTA 2VONA 3SBMA 1B7YB 1N8RT 4TLQA 1FVQA 1HARA 2E44A 1TL1A 4CLTA 3TI0A 3ZZYA 1EETA 1K8AT 4TLRA 4OI3A 3CC4S 4DR4F 1SKSA 2VG5B 1NUEA 3VAHA 3W5ZA 3V81A 1T9XA 2CVEA 2N7YA 2LMIA 2EK6A 4DR5F 5DZ7A 2LEBA 4ECSA 1S79A 4X4UA 4LFAF 3FSXA 4DV3J 1HQ2A 3OXLA 4K2JA 4KSEB 2HFVA 2QA4S 2A2CA 4KY3A 4YB5A 3TOQA 4DFJA 1APSA 2C1EB 2C2ZB 2EW9A 1Y5NB 1FT8A 1O6XA 3LP2A 1Y7PA 1D9FA 4KGZB 1F6TA 2JVOA 2IRUA 4ZJOA 2V9KA 3KJNB 2H4WB 1S1XA 3MM8B 1SBRA 2LQJA 1EIYB 4HHUA 2WZ1A 2HFZA 5F9NA 3PW0A 1MG7A 2VPXB 4ED3A 1VJWA 2DRAA 1WHYA 1I51B 2DGQA 2XWXA 1SC6A 2ZE2B 2F65A 3IG1B 4C11B 3KLEA 4G6VB 3TNVA 4XO0A 2BBEA 3NLCA 1GX6A 4TVAB 1RTDA 1DTTA 1YJTA 3L7OA 4PZVA 1VRUA 1Q53A 4L6V3 4NI2A 2PA8D 2E5LJ 2GJFA 3G6VA 3ZC4A 5ETNA 3T6BA 1VQOS 5IXUA 2WB4A 2GQCA 4MKYA 3DRPB 2DXFA 5BR8F 3H20A 3PW2A 2R7SA 3POTB 1YJVA 1KLMB 1S0NA 3PHEA 1NJXA 4R8UA 1NLKL 1S6QA 4HDHA 4KHMA 3CJKA 1QSLA 4ZJLA 2IVFB 4KH0B 4RZRA 1IKYA 4DZ6A 3Q8RB 2R2UA 3BQ1A 4ELTA 2OPPB 2EVZA 2QRRA 2YNHA 2ZKTA 4UY8T 3RBXA 2AYMA 1H38A 1YGYA 1S99A 2ZBIA 4IO1A 2CJXB 3G86A 1RBAA 2MYFA 2YBVA 3N5FA 4UW2A 4P10A 1NKCA 1UFLA 2CG8A 2MPUA 3FMBA 4ZA1A 4CNYA 2R8HA 1FI4A 3EXYA 3MEGA 2YKNA 2RNEA 1EHWA 3DYAA 4J7CA 5DGAA 3UW1A 4OV1A 4ILLA 1OQ6A 2DNOA 2XMAA 2A6MA 1F3VA 4TKTA 2R3VA 1B0VA 5IM0A 1JXLA 1RAOA 1TVRA 1UVJA 3BGUA 4DFKA 2E1AA 3HULA 4OYBA 2R8GA 4P2SA 2BJ9A 5KG6A 4CLWA 4JP8A 2OD6A 1SQFA 4PXEA 4L74A 1X0FA 2HFNA 2CJYB 2BR0A 2AZ3A 2P8IA 1FNXH 3G9CA 3RAQA 1NEEA 4K5SA 3S6EA 1RT4B 3QGGA 3UNYA 1LXNA 2YH0A 4NZ0A 5F0UA 2B0GA 1YLXA 3VAIA 4DCOB 4A46A 1VISA 3FZ2A 1HHQA 3I96A 4ZCLA 2CZVC 1I6JA 1ZA1B 4X4NA 2OLWA 1ZETA 2HZCA 5GAGU 3T3FA 2QJ3A 1XMBA 2P6SA 3HZGA 5KFRA 4LREA 1VDHA 3DMJB 4NZ7A 2LXUA 1N52B 5T14A 3W61A 4CCHA 1NAQA 3KYLA 2ADCA 4MIBA 3HPOA 3AJ1A 3CPWR 3DRPA 1S6PA 3B78A 3LW5C 4NMXA 1OO0B 3NGRA 3GIKA 1RWUA 3PV8A 1QAJA 3U1LA 3ELHA 4OYWA 1FERA 1N5VA 1U09A 3QAUA 4NEYA 1WG1A 1AUSL 2DIVA 5CD4H 1UZHA 3SCKE 3D54A 2JZ5A 2HQDA 3W2VB 4WKYA 2UXDF 1RADB 3M6XA 1R6VA 2AWZA 1X7VA 4HH0A 1NSAA 1HW8A 1RCOB 2WBMA 3UE2A 2M88A 5EHHA 1N32J 4KHPF 1IBCB 1XJWB 4GKJJ 2IM1A 2RUSA 3AOAA 1FDNA 1HNIB 2LLZA 3O5TB 1VQ7S 4RLEA 4DV3F 1WEXA 4LF9F 2DGSA 3J7YU 1FKPB 4K0KF 1U2FA 3WX8A 2FHKA 1S6QB 2XZTB 3OL6A 1IM6A 4YFUA 1BE4A 1SVDA 4UZCA 4KQZA 4UOGA 3BKTA 1X4AA 1HYSA 1X4FA 1L3KA 2XY7A 4GVBB 5DQGA 3N79A 4LF4J 4ETZA 2X3GA 2OPSA 1B0TA 4NI2B 1XR6A 4QR1A 3M2UB 1U1PA 2FDNA 4LF7F 1KHVA 4DSEA 5ETQA 1NJIT 4UOHA 4OHWA 2B8QA 4KB7A 5C42B 1RHUB 4X4RA 4HDGA 5DLFA 4QWAA 2ASYA 2J7UA 4AFFA 3CCES 1M90T 5DRKA 2PSZA 5D0GA 2CQ1A 1IWGA 2NSBA 4JOUA 4ZVOB 3WDOA 5KT7A 5L1JA 4PR6A 2FUG9 2PMHA 4HL9A 1SJFA 5HLFA 2GA7A 1FRJA 1RDRA 3QGIA 1S59A 2KFYA 2Z56B 3FEXB 4MK7A 2ROEA 4DUYF 4C8KA 1VBKA 1YBTA 2DBBA 4ZVHA 1UW9A 2KJVA 4JI1F 2MKYA 2VKZG 4ZP7A 1HBNA 1UVLA 2JNJA 2IHR1 4YR2A 4JI1J 2ZWPA 1VRTB 1JQGA 1IBLF 4EO8A 1FDBA 3HX9A 4NL5A 3CDBA 1P27B 2PT0A 4XAKA 1F5AA 1WDDA 2W4CA 1OJ4A 4RW9A 4ZPCA 3R9LA 3GYGA 4WTOB 1C0TA 3JSMB 3RBEA 2YKMA 4CLYA 2HRTA 3G2XA 3M32B 3PYGA 4F4AA 3RRHA 3HHLB 1V5IB 1RSCA 2YKMB 3B8HA 3KHLA 2GAHC 1EARA 1S9GA 1RWNB 1RTIB 1PKUA 2FHJA 4WU2A 1FDAA 4JI2F 5E7OB 1IR1A 3ZO7A 3PKYA 2V9WA 1DQ8A 1RBOB 1BY9A 4TY8B 4QWEA 3CC7S 3KFWX 3HVTA 4OYIA 5F8HA 4URGA 1S0OA 3K8VA 3CCLS 3QO9A 1FJEB 1S0MA 3A8JA 3KLFB 4DPUA 1EKSA 1RU1A 2HBYB 2HVZA 4I2PA 3HF5A 4MAKA 1KBRA 2ASJA 1Q86T 2PI5A 1CJVB 5D0HA 3AAWB 2UUCJ 3I9V9 2FJEB 4DV2F 3I9ZA 3N6MA 3PIPQ 5K14A 3EGWB 1R0BG 1KONA 4YR3A 1Q8LA 2Y1JA 2XMJA 3O1LA 2CNLB 2GVZB 2LXIA 3OFFA 1CC8A 1U6FA 4AT1B 1K73T 2XBPA 2JEGA 1VQMS 3HHLD 3OPKA 2DGOA 1NK0A 1T02A 3BREA 2MTLA 4NLGA 2SXLA 3CCQS 1NPPA 3DLEA 4KC5A 3QZ8A 4H4OA 4F0HA 5KFGA 3KXDA 1OPIA 1HNVB 4NYOA 2WSEC 1XMOJ 1N88A 3LA0A 1HQUA 2KO1A 1K47A 2L3MA 2MXYA 2RDJA 2B6AA 1SIWB 2ATCB 2H4YB 3J80Y 4O23A 2XS7A 3C16A 3FCHA 3NS5A 1XWLA 2IVYA 1ZM4A 5D3GA 4WP8A 1UTAA 2DNHA 2E5HA 3FCVA 3CE8A 1V3SA 4DU8A 5SUHA 5KFUA 3U1NA 3R97A 4ANCA 1QSSA 3PO4A 4OX6A 3RRGA 2BJ7A 4NCBA 4B02A 1LK7A 1VHIA 1HA1A 3MEKA 2EBGA 1EQMA 2MKIA 3KMSA 4RL1A 2EG1A 3FBFA 1NSQA 4TNOA 3VQSA 2HGNA 1Q81T 5KFLA 1VQLS 4NPOA 4N47A 2OSRA 1VBYA 3MPWA 5EX0A 1N6QB 1UWBA 3CJQA 4GMKA 5E3QA 5KFMA 2LFVA 1F5BA 4CO2A 2MGZA 4EEYA 3MMCA 2ASDA 2VFUA 2G13A 4OYPA 3ZTOA 3GG0A 3SDEA 4C8YA 4LF5J 2BKPA 1TZ0A 4AYBD 4WYLA 2XMMA 1PBUA 3E8OA 3CGIA 1FE4A 1WNEA 3H5SA 3MPVA 3MMJA 1X4EA 1U1RA 1HHTP 3IWXA 4NE9C 2QV6A 3C66A 4ANEA 2CRLA 3Q8QB 2CYYA 1KN6A 4ZDNA 2RAQA 2CPJA 2AD9A 3GFYA 3QJLA 4DBQA 2IYGA 3M1VA 4IFVB 5FDLB 1S1VA 3EVOA 3HSZA 4DPTA 4DFPA 1PO6A 1GEHA 2R4FA 1RT2B 2Y0BB 2XM3A 2VBZA 1ZTTA 4BWJA 3HM9A 1LKZA 1FVSA 3MM6B 1YJUA 4AL6A 3T1YF 4PCQA 3LP1B 3FNNA 4IG0A 1RHJB 2QZ8A 4OI2A 2RSQA 4C0BA 2FJAB 4USVA 2GMHA 2KZZA 5GADI 3NGTA 2CJBA 3AD7C 1T3NA 3QNWB 3WC2A 5ETVA 3D5MA 1OSCA 4JUZA 4HT7A 2EKYA 2LU1A 4ZVGA 3JYTB 1TUWA 2HNZA 4ITSA 4TQSA 4YB7A 3EGZA 1S1UB 1ZOTA 2KT5A 2NPIA 4O4RA 1TAUA 1T95A 3R5JB 7AT1B 4ZHRA 3D66A 1TL4A 1NHKL 1SXLA 2OI2A 2VG7A 3I31A 5IM0B 3T5JA 6FDRA 3QT7A 1QTMA 3AB4B 3T6JA 3UVJB 4Q7AA 3B6BA 3ZXWA 4FXVA 3EMTA 3CF5Q 5T41A 3SCJE 3AJ2A 3I55S 3JTOA 4Y2MA 2OFHX 3W66A 4F3OA 4TYBA 3BSNA 3NOCA 1WJ9A 3MM9B 3Q2SC 4IR9A 2H9ZA 4LRAA 3UPFA 2W9CA 1P9QC 2DIUA 3C6TA 3CT9A 4U8VA 1EZZB 2QLXA 3QRQA 1X9WA 4QOTA 2CPYA 3V4MA 2VBXA 2GMJA 1R8PA 1Q5YA 1S7HA 4FPIA 4C6AA 4CLFA 2VV5A 2VDIA 3KNAA 2V4JA 4C4WA 4JI3F 2R2TA 3E3XA 1IM4A 2AEFA 2QMUB 4DL2A 3GJRB 2HZVA 4OHXA 4HVZA 1TUGB 1REGX 3A8EA 2QYCA 3TZXA 3MUTP 3TAMB 2EFPA 1HQUB 4L75A 1KHWA 2XNQA 2K7KA 5LMUF 2ZWOA 2DEJA 1FK9B 4TY9A 4WPAA 1HW9A 5KTQA 2F40A 2C3MA 4NASA 1NB2A 5KFDA 1YJNS 1D9DA 1MWQA 2AP6A 1RAFB 3I32A 2KHCA 2DB1A 3IA0A 3E01A 3OFEA 4DR3J 1VRTA 3O44A 4TQRA 2QL5B 4HTIA 1S1XB 3G71S 1SB6A 3CDEA 4AQYJ 1HBUB 5HVHA 3CJRA 3PM9A 1YJRA 3HVWA 3IG1A 1KQFB 3WHIA 3EPGA 1N5YA 1RT7A 3TP2A 3MPYA 1WEZA 3IR6B 4DL4A 2FZCB 5D6GA 3HK2A 2ACYA 2CZ9A 1HNWJ 3QRPA 5KFIA 2IM2A 1HI8A 1XC9A 3THVA 2MLZA 3PW4A 2KI2A 2YQ0A 4R0JA 3TX0A 1HR0J 2LEPA 1KWMA 1SC4B 3D67A 2DHAA 1HBOB 2D9OA 4NA1A 4RW9B 3NCPA 4CZCA 2BM0A 1HNXF 2VQFJ 2IY5B 1AZSA 1X4DA 1YRXA 1RWVB 2CADA 2K1RB 2DCUB 2QG9B 5K8PA 4AQYF 2UVUA 2FVPA 5E3RA 3E2EA 4JI2J 4YMEA 2PI4A 5KT6A 2R7WA 2ALZA 4ZP6A 2DNZA 1VK3A 1KOOA 3V6HA 4F8RA 3EZUA 3DLKA 5IT4A 1N36J 1UWAA 2G9OA 5HK4A 4QIFA 2FHOB 1KQKA 2BW2A 2KTQA 4WK3A 4B3RJ 1K1QA 1WC4A 2RDDA 4MYTA 4UT4A 3PACA 3RR7A 1IVZA 5HAOA 1VQ4S 4JI8J 3TJ8A 4RW8B 2BW7A 2CUYA 1HNZF 1M5SA 3BEGB 3K5MA 2EWHA 4DL6A 3MM9A 4XDDA 3DU6A 3HKWA 4WJBA 3S01A 3R1HA 1HR0F 3QJPA 2HZAA 2MZTA 4GVLA 3OTEA 2L9DA 1FFGB 3MD1A 4CM0A 3A12A 4JI7F 3JAMU 5HQLA 3FDSA 3FMWA 1F9FA 4J5OA 3O8WA 2ZH3A 1ZAVA 2IYIA 4YDXA 2HFUA 3A3PB 3CO0P 1LNQA 3TEHB 4EZ6A 5BYRA 4FKYA 3WX4A 2ZZTA 2C2NA 3BYPA 3UR3C 2XSJA 3FSYA 1GK8A 1UMJA 3AQOA 5J2QB 1RK8A 4G1PA 4C2MA 2F5GA 2OEMA 1IBMJ 4ED2A 1TFWA 3PRVA 4LR8A 2IM0A 1SJQA 3LP0A 2PMWA 1NK9A 3RB3A 2Q43A 4P75A 3W62A 1FJGJ 4YHHJ 3A4TA 1MW7A 2AJ1A 5AE3A 3IS9A 1N34J 5ETLA 4MT1A 4PWDA 2KYZA 1O5JA 4CQ1A 4D3GA 2B4VA 5GAHU 2W9CB 4PG8A 2D3ZA 4IDKB 5A8KA 1B3TA 1P9YA 2K2PA 4J9UE 4NLTA 2ZC4A 1D0EA 2UXBF 1F5CA 4PWUA 4ZCMA 1RAJA 1RHRB 3A8KA 3O2IA 4H4KA 4NLVA 4TYAA 1J27A 2DXDA 3D68A 7FD1A 4B17A 3NAHA 2AMCB 3QPIA 5BYQA 3ZZUA 3M9OB 3VHQA 4LIRA 3BH6B 5T7LB 2AJ0A 2XI3A 1H2TZ 2KXHA 4ENOA 2V67A 4YY3J 3OSNA 2ZOMA 2W7PA 3IXQA 2YWWA 4G1QB 5THWA 3IFEA 4ED7A 1TL3A 2KJWA 4NXMJ 2GQ2A 4UUXA 2H48B 5A8RA 1LFWA 2JEIA 1FXRA 1TR0A 2ILYA 5ETOA 3H0PA 5L9NA 1F2GA 3B4DA 3T9NA 4M5HA 1IXKA 4LSNB 3GLJA 4KFBA 5KFQA 4K2XA 3K58A 1YI2S 1TKTB 3C8YA 3P45B 3W7BA 3PO5A 1C1BA 3DHXA 4FP9A 2CA9A 3QFWA 3BZQA 1Q79A 3HP6A 3PKMA 5EN1A 4OZNA 4ZHRB 1GMVA 1NXIA 1U8SA 3JQKA 3K5PA 3OHAA 3M8YA 2AYGA 2QA2A 1JK9B 1P8GA 1RAAB 4KO0B 2HNZB 2GHPA 3MAQA 1SKWA 4JB8B 3NBPA 5ITHA 2HWTA 1UKUA 2C2MB 1TU0B 3PEHA 1S77D 2PIIA 2XZWA 4RUBA 2PGCA 4O3QA 5CA5A 2ZH4A 2JFDA 1UEUA 3BBFA 5I4MA 2R7TA 1TL7A 4ZIVA 3R7BB 5E3CA 2L48A 3FEZA 5ETKA 2F4FA 4J9SA 4OZLA 3C16B 3SCLE 2R2SA 4DZDA 1JLEA 2DNKA 2QTWA 1VS3A 4NLDA 2CIMA 3AOBA 3SQGA 2N3LA 1HI1A 4A4JA 4O0NA 4DV7J 2HQFA 3OVAA 4C8LA 1FJ7A 4NA3A 1HLWA 1BGXT 2W9BB 1SCJB 4X66J 4Y34A 4TU9A 2P9CA 3QJJA 2IAJA 4LR7A 1ZAWA 3D0HE 1H73A 1WG5A 5E0OA 3T1AA 3DXSX 5EWFA 1RTDB 3S1TA 1T7PA 1S1WA 4DEZA 3ILLA 4KRWA 4WIIA 3AH6A 1KVKA 1U25A 5A0YB 4LF6J 1SC1B 3A1YG 4DL5A 1L3SA 1LW2A 2RU9A 2IRYA 5CXTA 3BPSP 2QN6B 4CTAA 3V5RA 1G2EA 3TW0A 2DHSA 3OJSA 5IWAJ 1OIAA 4RW4A 1R0CB 1TV6A 2RKIA 3MGJA 1VMBA 3C3LA 2OAUA 4Q0BB 4R5PA 2B56A 4DR4J 3UI3A 3GILA 4DX7A 4U7UD 2OTJS 1HQEB 1BWEA 5FLXU 2G1DA 4DV1F 1N5QA 3G82B 1FKOB 3DLGB 5L1IA 4DR2F 2GGPB 1NRKA 3PX0A 1ZZNA 4PXCA 3BGLA 1OY8A 4OZ3A 4O0IA 1ZH5A 3CCMS 2AJQA 1ITPA 1HNWF 2J9EA 4DOZA 3TVKA 3CJ5A 5MLCV 3M6VA 4QWCA 3TRGA 5LL6d 5HMZA 1RZMA 4H4MA 2VG5A 2Z2ZA 3W2WA 5AJ3F 3D0IE 3NS6A 1S6UA 1RQ0A 1JLFA 4DSFA 2BKNA 1XR5A 2DHGA 2DGTA 2POKA 4LBIA 5M2PA 1GXUA 3HD1A 3KJVB 1TKDA 3CJSA 1HI0P 1E6VB 2VDHA 3NGUA 3P5BP 5ETTA 3IN5A 2F4VF 2FC8A 4CH7A 2ZE2A 4C11A 2GIRA 4M5LA 5K14B 4EUVA 1JLGA 2AJ2A 2HVEA 1P6TA 3B4MA 1R7IA 3DM2B 3KWMA 4NEZA 1T3OA 1XTZA 4OX9F 3KLVA 3KLIB 3MUMP 1YG0A 4CLLA 5E5NA 1U0HA 2ZVIA 3A13A 2CPXA 1R27B 2E29A 4A8QA 2VFVA 4RU2A 2V94A 3P49B 3D6MB 5B0EA 4C9DA 3TUJC 8ATCB 5F8IA 4WFXA 4ECQA 1D8YA 1HD0A 3EE3A 1LWEA 3DLBA 9ATCB 2H5IB 3IS9B 4B3OB 1U24A 2E66A 4DS5A 1V5VA 3IO1A 2E9ZA 1D09B 1RAHB 3IRXA 3ILOA 3J7AN 4NLXA 1DQ9A 2YVSA 2OGUA 4FKXA 3M8QB 3I4HX 2IMOA 1UCNA 4XTTA 4PABA 2E1PA 4TXSA 4DHVA 4DR5J 4B9VA 3OUYA 3VVTA 3ZZOA 3A8IA 5GAEI 2MDAA 2OMOA 1Y5LB 1Q1KA 4QIEA 1NO8A 2H1YA 1OS5A 2Z2LA 5HROB 4RUAA 2HYIB 4TU8A 1NK6A 3CD0A 1IKWB 1AZSB 2I8EA 2K1RA 1YTYA 2UUAJ 4ILMA 3TR5A 2CAJA 1TKZA 1NSPA 3QIPA 4IR1A 4QZVB 1JLQA 5JVGQ 2QLFB 1XEZA 3FJ2A 4FXDA 1TK5A 4JYAF 2NXNA 1VBXA 3PCOB 2AQ4A 4OYXA 1RHQB 4C3LA 3GYNA 3MCMA 5HL7Q 5KFBA 2DPIA 3K2YA 1RTHB 2K8GA 4KBIA 3VAKA 3HKZD 3QBCA 1PC4A 2EFGA 2G2OA 3GSIA 5E33A 1NHVA 4ECVA 1YBAA 2VL1A 3DN9A 5KFVA 4D3HA 1SJ3P 1WUUA 3NWGA 3R5DA 3OTOF 4DX6A 2KG0A 5JVHQ 4LF8J 5CYQA 4Y2CA 3DM2A 3UD5A 5HMYA 4FBUA 5KFOA 1A0OB 2OPSB 3D6HB 3DOKB 3AXKA 5LJ3Y 3GV5B 4ELUA 2XNRA 1N56A 4I7FB 5F3TA 1WEYA 2LVWA 2OSQA 1TUVA 4LF4F 1X5TA 2WONA 4RUCA 1CJUB 4DN0A 1WC0A 2J8SA 1JLFB 3C6UA 4ID8A 3TZYA 2HKEA 1T05A 2B4OA 3PEJA 4M5KA 1BHNA 1E6YB 3CSKA 4F3MA 1MROA 4ES2A 3KDNA 2F9DA 4EO6A 2V4JB 1CSJA 2JOQA 3K8WA 4Z7CA 2OPQA 2KYXA 2GFFA 4CWBA 4R5PB 4IOAQ 4EFAC 2B3TB 4DF4A 1WC3A 3FKBA 1RT1A 1NJWA 2GGPA 3KLIA 1FWLA 2YNFA 3W8PA 3NG8A 4F26A 5KOWA 5KFEA 3GIJA 3CUNA 1NU4A 1RA7A 2KFZA 3GCXP 5LXRA 2I38A 4N41A 5F9LA 1BUXA 3BPDA 3KDOA 2AIRB 1GX5A 4ZS6A 1JJ4A 3C46A 3UD4P 5IT0A 1C0UA 5E3AA 3HFKA 3UVJA 1S1UA 4CM2A 5GMKa 1PILA 4WZMA 2CJ9A 2JLEA 2AW0A 2XS5A 4DR7F 2H5JB 2VG7B 4DV5J 1YZ7A 1ULRA 2A2DA 2HGMA 3UQSA 3VGVA 1RT6B 3IC1A 1NJZA 4Q8EA 2FJWA 2HHHJ 4ZLJA 2EG2A 2BANA 2CFXA 3V4IB 3QSYB 3U02A 1CJKA 2XMKA 3Q89A 4CNZA 2ZH1A 5KT4A 1RA6A 2XYGB 3DMJA 1DQAA 5CD4A 2HAIA 4ZP9A 1FEEA 3LOUA 1IKXA 1F1BB 5LT5A 2WCXA 2VQFF 4EBCA 1PYTA 3AJDA 4ECZA 4WFNQ 3G6YA 1TL7B 4WIQA 1H2VZ 4Y0FA 4K4TA 2B7BB 1SH2A 5EDWA 3LWLA 1RLDA 1U1MA 4GC6A 2BOPA 1RJJA 4ZPWR 1KRPA 3DC2A 3T5KA 1GTHA 5A6PA 3PJXA 3OW2R 1U48A 2XSFA 5CYMB 3UFCX 1IQZA 2BOAA 4DXLA 1U1QA 2MQOA 1QJHA 3MCNA 1CC7A 1DZ5A 3ZNJ1 3QIDA 4DV1J 3GFXA 3DDIA 3HZEA 4JI6J 3NMAA 3QT8A 1BQNA 1V3ZA 3DOMB 4YDDB 2VUGA 3R1LA 1N4LA 1M5VC 5CYMA 1BQNB 3DOMA 1TTHB 3Q24A 4K7QA 4P52A 2JWNA 4DUTA 5IWAF 4M1KA 3HMJG 1PGZA 2HHTA 1IUJA 1NNDA 4WFBQ 4Q43A 2MGZB 4A8KA 3DGPB 1LWFB 2ZNZA 2XQCA 1UPPA 3WZ0A 3U27A 4CRJA 2HS3A 4FF1A 2KN4A 4PQAA 3B82A 2XZDB 2ILZA 3CO9A 3GJTB 4R8UB 2M8DB 4USUA 3K89A 5T7LA 3RYLA 5HBMA 2AJ4A 4ZK7M 4CIOA 3MM7B 4HH1A 3KK3A 2RF2B 3IAM9 4DN9A 1OPZA 2QL9B 1B0PA 2VPWB 3EWGA 4N8OA 4M5DA 5F3ZA 1DARA 2MQNA 3GCWP 3KK2A 2J6UA 2VPYB 3POTA 1R8BA 2LQ5A 1I1GA 3ISZA 3SV4A 5E41A 1XNQJ 4DS4A 2WW8A 2LCWA 2Z2YB 3TZZA 2A3JA 5DQIA 2IPOB 2DRBA 2BABA 2KDOA 4GKKF 4F4KA 3W9JA 2CNNB 2L9WA 1S72S 3HDSA 4BDPA 2R9LA 2B9EA 4F04B 2W4DA 4E0DA 2RQMA 1NDPA 2CQPA 4C97A 2FY1A 4FF2A 3CMAS 3R2DJ 2IBOA 2MY8A 1H2UX 2ZZNA 3EPIA 2APOA 3KLFA 4C98A 1IN0A 5CYJA 4DI6A 1NSKL 2BA9A 2F8EX 5KFJA 2UU9J 4LFCF 3T5LA 1BMQB 2J0SD 1S12A 4N5SA 3TAPA 4P2XA 1RI7A 3HI9A 2KRBA 4USIA 4ZIWA 3H59A 3H5YA 1VI7A 4L73A 5B0CA 4OL8A 4OZ1A 2HIQA 5CHCB 1N0VC 3Q86A 1QD1A 2WHOA 1H0HB 2F9JA 3K7RA 2O67A 2W4PA 4Z7YA 4FYWB 3M8QA 4KH1B 5KG0A 4K5RA 4B9NA 3QZ7A 1U6BA
chains in the Genus database with same CATH topology
2ERRA 2F7VA 1DLOA 4KR0B 2HHXA 1G3OA 4ECWA 4HKQA 4ZP8A 2J9CA 1SH3A 2JL9A 4B3MF 3L3CA 4F4WA 3G8TA 1CG2A 4K59A 1T94A 2CQ0A 2OP5A 5EGYA 2RQ4A 4DL3A 2BE2A 2XLKA 3UD3P 4W92B 3MOJB 4NLQA 4NRTA 3KLHB 2OFGX 2OO4A 1TAQA 3OLAA 4YEAA 4RNFA 3M8RA 2QO3A 3BR9A 3VAMA 2MKJA 4CO5A 5C42A 5HN0A 4DFMA 1HWUA 1W2IA 4AE5A 2KFNA 1REVB 5K8OA 2R7UA 2V8DA 2OTLS 1QE1B 2BUNA 4MKAA 2AGPA 2MZJA 2DGUA 3SFGA 1X0PA 4C8ZA 1QAYA 2XMUA 1VBZA 2HLUA 2Q1LA 3V6KA 2VH7A 2HG4A 2FD2A 3E01B 4KV8A 3RAMA 2DNGA 4MH8A 5DLGA 2NXUA 3OTBA 2MKKA 4ECXA 2MKHA 2YNIA 2E9ZA 1SV5B 1X4CA 2FC9A 3MAHA 4UOCA 1FCAA 5IFMA 3H8YA 4A48A 2OD4A 3BDEA 5KFXA 4QR0A 4HYKA 4DQRA 3NCQA 2MQMA 3M05A 3H40A 2B9YA 2M2BA 4F50A 1ZAXA 4O44B 5KFWA 1PC5A 2DNNA 2ZHBA 4J9OA 4JV1A 1YVFA 1ZM3A 1Q4RA 2C2EA 2LA4A 3F56A 2Y1IA 4Q0BA 5LJ5Y 3OTCA 4DSIA 2C3UA 2XLIA 3ENVA 3LF0A 3C2PA 4Y65A 1IKVB 5D8HB 2IJNA 2XCAA 3FQLA 3H98A 3I56S 4PUOA 3GQCA 3J7A1 1S1TA 2NUUG 3NCRA 1LW2B 1QAXA 3KLGB 4I6AA 2JC1A 4B9MA 3PXGa 2IVMA 3BF4A 4H4KC 4X4VA 3WC0A 4JV2A 3BGRB 5B0FA 4KGKA 1Q8BA 2B51A 4PPDA 2DH8A 3N9UC 3CC2S 1FRXA 4FF4A 1VQKS 2B5JB 2DNPA 2XY5A 2HRUA 3I87A 4M5DB 3THTA 2J7WA 4KAIA 4RW4B 4A8MP 2XI2A 2ZNYA 3OVSA 2YNGA 3KHGA 2B7CB 2O01C 3N28A 3TUZC 5I3UA 1RT5B 2XY6A 2BQ3A 2WTFA 4FYDA 1JNRB 1WF2A 2CQBA 2V0NA 2JJ4D 3F41A 5F41A 1NKEA 4OQJA 3F44A 3I0RB 3CEDA 1O51A 1RT2A 4J9LA 1YJWS 4IOBA 4M95A 1XBWA 2IAJB 4KO0A 3CDWA 3DRXA 3CMES 2DH7A 2BXJA 3HT3A 3BO2A 1N36F 3CCRS 2I9SA 2VQEF 1IJFB 2RIJA 4U9RA 2HHUA 3M2RB 1C1CB 2JVRA 3LQVA 1R8HA 3GV7B 4HI2A 2QEXS 5KT3A 2OPPA 2RDIA 2YNHB 3H4BA 3MF5A 5A8RB 1VK8A 3IWLA 5EX3A 3P6YC 1RISA 3U7JA 4LFBF 5LSRA 3G6ES 1IKXB 2A1BA 1YHQS 2YNGB 2JHEA 1C2PA 5GADU 1JLAB 3GYXB 4OZJA 2ZOFA 3Q2TC 4O44A 5DM6Q 2JFKA 2BANB 3NNHA 4V19X 3HLUA 4DL7A 1HPZB 2B4UA 3H2LA 1Q8IA 4O4GA 4RNHA 1MROB 2HQ3A 2X1GA 3ZZZA 4C8NA 5EUHA 4RUHA 2CQIA 1VQPS 2J7KA 3T19A 3ZZRA 2WK4A 3R27A 1NB7A 3AHPA 5AXMA 3CCJS 1RTJA 4RBVA 2LQ9A 1TVRB 4PXBA 1S1TB 3OSPA 1X9MA 2W8LA 2FLLA 2JH3A 1VRUB 2R7OA 5GAEU 1UETA 3Q8SB 4LSNA 1M5KC 1M0SA 4UY85 1WHXA 3GZ7A 5IQQA 3TA1A 3ZFVA 4CT8A 1VHFA 2FLPA 3S8SA 1CLFA 1JKHB 2N4DA 4YQWA 3GFZA 5L1KA 1X4HA 2DD8S 2YWHA 4CH0S 2WOMB 1HL6A 2DO4A 4E98A 3J7ZT 1IKYB 1U2RA 2ZDOA 4NOHA 4OI1A 1RKIA 3VAJA 4IRCA 2M7SA 2VKRA 3RW7A 3MM5B 2D74B 1FO1A 4IDKA 5A8KB 2E1CA 4M8LA 2RT3A 4RW6A 3C6UB 4FVMA 2A10A 4C8OA 3M32A 1SUQA 4XPCA 2J5AA 3V81B 2FJVA 3VZHA 1L3TA 1FD2A 2QMXA 3I5AA 3LP0B 3PR4A 3IWNC 1EETB 4ED5A 2AGOA 2EBEA 5MAOA 3OTDA 4WE1B 3BGFA 1UA1A 2ZHOA 3CXCR 1KTQA 2BJDA 5AE2A 2YQ3A 2CQGA 1DBDA 4OLOA 2RD5C 3I5BA 4PG5A 3UNGC 3K57A 2YY3A 3GG1A 3IR5B 3LP2B 5D4NA 2M9KA 2DITA 3OUYB 3PJWA 4TY8A 4DR1F 2ZJPQ 3US5A 2C3OA 2XGQA 4DSJA 4QIWD 1KOHA 4IKAA 5JUMA 4DV6F 2UVWA 2LKZA 1CEZA 4X4OA 5SZTA 2QFJA 3N0VA 4QIVA 2UUAF 2E9TA 1HD1A 5JXSA 3G96A 4ZVFA 1S0VA 4KKOA 2UUCF 2RRAA 2FHJD 2ZH7A 2WB1D 4X84A 3AY0A 1VQNS 4JI0F 1WI8A 1U1NA 3MUVP 3MHYA 2IM3A 3V6DA 2QMWA 1LWCA 5DS7A 1HWIA 3HHEA 3MM5A 2RQKA 1HBOA 7FDRA 4B9SA 4ELVA 1B7FA 4X66F 4JV0A 3DDKA 5H9EJ 5KT5A 3W3SA 1R8AA 3M2VA 4I0WA 5D4PA 4RBTA 3THPA 4F3QA 1TP7A 1Y0HA 1FJGF 5AE1A 1R89A 1U26A 4I1TA 4I2QA 2CJKA 2UVRA 1SL1A 3CIMA 2KM8B 4NLWA 4WXOA 5L38A 2R8JA 1SI9A 1ZTWA 5D77A 2DR5A 4O3OA 2K3IA 2J9DA 4H4MB 4NCGB 3N01A 3EGNA 2AJFE 2C2DA 1AXQA 1EP4B 3OQ2A 4CH1A 4IFYB 2O3DA 3N6LA 3KK3B 3MEDA 1ZM2A 4KPYA 1A6LA 3SI8A 2Q6BA 4Y2KA 4ETXA 5KFPA 4NCAA 1AFIA 2HNDB 4PQUB 3IGNA 1ZM9A 3L95X 4LQ3A 2C3PA 2W24A 3CWJA 5C24B 3ZZPA 1BQMB 5KFKA 4F4XA 2YH1A 3T1HF 2DGXA 1S49A 4ALZA 5JJBA 4IFVA 4YY3F 3OFGA 1FJCA 4ID5B 2CDQA 3BQ0A 3SQGB 1LWFA 4TU7A 3W2VA 3M6WA 3MMCB 4EGLA 3M2RA 3QYYA 3DRSA 2YTCA 2RRBA 2PDAA 2V8VA 4OJ1A 1VQ9S 3ITHB 1K9MT 1AROP 1U6ZA 2DR9A 4RW7A 4P6QA 1AW0A 3OL8A 2E5IA 5DJBA 2JEFA 2Z2MA 1VQ5S 2WSCC 4CT9A 3VALA 2JSXA 3CD6S 2GQQA 1TKXA 2LYVA 2CKWA 4ZVEA 1S97A 1R8CA 1UJ5A 2HWIA 5FDLA 3OL9A 4OI6A 1YWXA 1FESA 2L08A 3GIMA 4A8FA 2CQCA 3NNCA 4LT6A 1WG4A 1X4GA 2X51A 3ZZTA 3BN7A 2YWFA 1K0TA 4I64A 4JBCA 1KC8T 3M1VB 1U1OA 2VA2A 3GSDA 2OPRA 4DMZA 3KLGA 3LGNA 2D3OR 4K4VA 4OHYA 3LPYA 4G1QA 2GJ2A 4A47A 2CJAA 2CPFA 3CJ3A 3MOZA 1TK8A 3HHKA 4PPZA 1KNZA 3CCZA 3ICLA 4R0EA 2EFVA 4LUBA 4NRUA 2AU0A 5D4LA 1K0VA 1JB0C 1KTVA 4I4BA 1LV5A 3CDAA 1QAIA 5A8WB 4EWTA 1Q82T 3FGVA 1I94F 5C24A 2F8MA 3UDLA 4WKRA 1UAWA 1URRA 4ECRA 1TQLA 1HBMB 4B3TF 1KFSA 2VFSA 2COLA 4PKDB 1JMTA 3I0SB 4Q5VA 3IBWA 1AUDA 4MMOA 2M8HA 2HWHA 4J9PA 4GO5X 4IH7A 3VWSA 1FHTA 4RWWA 3DLEB 2GX8A 2N4CA 4H54A 1H7XA 3CJ4A 3IRXB 2RQCA 3EUNA 1TL1B 2IJFA 5HO4A 1NK8A 3HJFA 2GW8A 3ULHA 2J6SA 1C0TB 1JLBB 4OFZA 3V2UC 2V4RA 5FIIA 2E1RA 2PD1A 3R5AA 1DJ0A 3PRBA 2G0CA 4HT5A 3GR1A 1X5SA 1GTEA 5F8GA 3UCGA 3ENWA 3R5CA 2ZJRQ 1FKAF 4DSKA 4LF5F 1G7CB 2P5VA 3CD5A 4EU0A 2J76E