2YNGB

Hiv-1 reverse transcriptase in complex with inhibitor gsk560
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
424
structure length
411
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Rational Design of Potent Non-Nucleoside Inhibitors of HIV-1 Reverse Transcriptase.
pubmed doi rcsb
source organism Hiv-1 m\:b_hxb2r
molecule tags Hydrolase
total genus 114
structure length 411
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2yngB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yngB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yngB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yngB03
3V6DB 1OS5A 5J2MB 1RYRA 4Q0BB 1UWBB 2IA6A 3KHGA 3KOAA 5T14A 1GX6A 5EWEA 2OPRA 4NLQA 3H5XA 1FK9B 1HNIA 2WCXA 3GV7B 2GC8A 1JLGA 1S1WA 2VA2A 3NAIA 3NL0A 4Q44A 3QLHB 2BQRA 4ZVHA 1JXLA 4YQWA 3JSMA 2OPPB 3RAXA 3N6MA 3TAMB 1TKXA 1JLFA 4NLOA 2W9CA 1EETB 1C0TA 2VG6A 5DG9A 2UVWA 5F8IA 3HKWA 2HMIB 4TY8A 4IG0A 2V4RA 4B3OA 1RTIA 4OL8A 1C1CB 2RDIA 3D28A 3FDSA 5KFQA 1IM4A 4WXWA 1S6QA 3BGRB 2XCPA 4IRKA 5KT6A 4KV8B 4FS2A 1TVRA 3KLEB 5HLFA 2HNDA 1TV6B 3MEEB 3IRXA 3DI6B 1S4FA 4K4WA 3T5HA 2E9TA 1IKVA 1HMVB 2ZE2A 4H4MA 3PR5B 3DYAA 1JLCA 3SFGA 4MFBB 1FKPB 4MK7A 4O3QA 4KKOB 3H5UA 1TKXB 4F4YA 4H54A 1YVFA 5F9NA 4O3NA 4RW8A 1JLEA 1BQNA 2E9RX 3BR9A 3H98A 3ISND 4QWEA 4WYWA 1RDRA 2W9BA 3KK1B 4O3SA 3KK2B 3I5CA 4DL6A 2D41A 4KB7A 5J2QA 4NLRA 4RNFA 3G6YA 5HBMA 2W7PA 1S0MA 2ZD1B 4RW4B 4TY9A 5DLGA 4ECQA 1K1SA 3BREA 3GQCA 2R8JA 3NKYA 2DPIA 4ED2A 3T19A 4I7FB 3DLEA 4PQUA 5EWGA 1MU2A 3OL7A 3M9MB 4I2QA 4ECWA 2FLNA 3T5LA 4KFBA 2W8LA 1DTTA 2YNGA 4WE1A 5KG6A 2BRLA 1JKHB 4QWBA 4O44A 3HVTA 1RAJA 5KFZA 1QE1B 5KFIA 4RUAA 4XPCA 3IGVA 4R5PA 1R0AA 5DQGA 2IM0A 3DOLA 3KJVA 3HVWA 5KFRA 2UVRA 4ZPCA 3EZUA 3V6JA 4IFVA 3N6LA 2FLLA 3BQ1A 2R2UA 5HBMB 1LWEA 2FJXA 2WOMA 1TL3B 2IAJB 1DLOB 3H2LA 5C42A 5L9XA 3KNAA 1JLAA 1IKXA 1HNVB 5FDLA 2JC1A 3Q8SB 3M8PA 1S9FA 4Y2AA 3DRPA 1HPZA 1SV5B 1LW0B 4RW7B 4IH6A 4WZMA 3OHAA 1LWCB 1HQEB 5D3GA 1JLQA 5DG7A 2RF2A 4ZVFA 3GV8B 3DMJA 2FVQA 1C1BA 1S9GB 4WFYA 1C0UB 5KFGA 2RDJA 4G1QB 3IG1A 5DGAA 1S1UB 4LSNA 4F4ZA 3DM2B 4KAIA 4HYKA 3QIPA 1SUQB 2YNIA 2B6AA 5I42B 5J2NA 4NLUA 4QWDA 4IFYA 2W9AA 4NLDA 2I1RA 4XPEA 3QGIA 1TP7A 3MECB 1KHVA 4LQ3A 1FKOB 3TQ1A 2AU0A 3QGHA 1T03A 3BQ2A 3DMJB 4K4SA 3I0SB 5KG1A 2BQUA 1C1BB 3KLIB 3H4DA 4M95A 3LALA 2ASJA 4JV2A 3C6TB 4NLVA 4ZP9A 3GV5B 5C5JA 1S10A 2R8KA 4H4OB 2B43A 5KFMA 3RB3A 3RAQA 3NMAA 4MKBA 4KHMA 2YNHA 2B5JA 1N4LA 3D5MA 4TYBA 5KFWA 3IS9B 3V6DA 4IG3B 4J9SA 5KFDA 5J2MA 1LWFB 5KFCA 4Q0BA 1UWBA 5HP1B 1SH2A 1JX4A 4URSA 3E01B 4NCGB 2CJQA 5EWFA 1FK9A 2YKNB 3PJWA 1RT7B 4ZMMA 5KT3A 2RKIB 3M8QB 3QLHA 5KFOA 4EBEA 1RYSA 1RTHB 2OPPA 2ASDA 3TAMA 5DG8A 1EETA 2YNFA 1S9EB 1XR7A 2IC3B 4WXOA 3VQSA 4ZPBA 1S97A 2HMIA 2WK4A 2WHOA 4WYLA 1C1CA 5KFUA 1QUVA 3BGRA 5JUMA 3ITHB 1REVB 1RT1B 4KV8A 3CDEA 3CJ5A 3SFUA 5KFVA 3KLEA 1JIHA 5EUHA 4ICLB 3GIMA 1TV6A 3MEEA 2HNZB 3DI6A 4KBIA 5KFTA 3MTKA 1HMVA 3MEDB 3CJ3A 4RU9A 2XGPA 3KK3B 3MR3A 4RW9B 4MFBA 1FKPA 4J9KA 3NBPB 4KKOA 1W25A 3BSOA 3OLBA 3GILA 2OPSA 2YNFB 5KG4A 3T1AA 4K4YA 1WNEA 1TKTB 2XCAA 4ED6A 2O5DA 5JXSA 2FVCA 1XR6A 5KT5A 4DEZA 3KK1A 5F8GA 3KK2A 1HQUB 3PW2A 3QIDA 1JLBB 1SH3A 4ZP7A 1RTJB 5CYQB 5J1EB 2ZD1A 2C28A 4RW4A 4JV1A 3BSCA 4ECVA 4K50A 2D3UA 5KFLA 3UPFA 3OHBA 3LAMA 2HAIA 2BANB 5F8MA 4I7FA 4U6PA 4K4UA 3KHHA 3PW0A 3KLVA 3CJ2A 4Q8EA 1RA7A 4O4GB 4DL3A 4IH7A 4R8UB 2VG5B 2OPSB 4WFZA 4ED7A 1JKHA 4QW9A 4J9OA 2D7SA 1QE1A 4QPXA 5CYMB 3M9NB 5KG0A 4J9MA 4Y34A 4TQRA 1VRTB 5F8NA 3KLHB 1RT4B 2AGPA 3H5SA 1RTDB 2YKMB 4ZP6A 1S1XB 3LP2B 5DQIA 1TL3A 2IAJA 1DLOA 3LP1B 2GIQA 4IOBA 3M9OB 1IKWB 4J9RA 1HNVA 2JEIA 3KLGB 2IM2A 4IKAA 1KLMB 1SV5A 4RW7A 1LW0A 3BQ0A 4O4RA 4TQSA 4MK9A 2FVRA 1LWCA 1HQEA 4EYIB 3DLKB 1GX5A 3DLGB 5DLFA 3DOKB 3PVXA 1S9GA 2AX1A 1N48A 1C0UA 3EPIA 4ED0A 3Q8RB 3C6UB 2R2SA 2FJWA 2IJNA 4YMEA 4G1QA 1S1UA 4PUOA 4ID5B 3DM2A 2UVVA 1SUQA 5I42A 4ZVGA 1D1UA 4O3PA 3KHRA 4LSLB 3GIKA 2CKWA 1RT5B 2GIRA 2V9WA 1Z4UA 2VG7B 4ECTA 4FBTA 2IMWP 4RNHA 3MECA 4K4TA 1FKOA 3PW4A 3RB4A 2ILYA 3IN5A 2WRMA 1IKYB 3GYNA 4TXSA 4RZRA 2E9ZA 3I0SA 4MIAA 3KLIA 1S0OA 1NNDA 2IM3A 3C6TA 3MEGB 3QZ8A 3EPGA 4ED8A 1T3NA 4RW6B 4YR0A 2BE2B 2JLEA 3V6HA 4PUOB 3QGGA 2IBKA 4NZ0A 4H4OA 4HKQA 4U7CA 2JEFA 2AX0A 3DRSB 3IS9A 2C2DA 1N6QB 4IG3A 1T94A 4J9QA 1LWFA 3KMSA 5F9LA 5HP1A 2VA3A 1I6JA 2AGQA 1N5YB 3QZ7A 1LW2B 5F8LA 4RNNA 3E01A 4NCGA 1J5OB 2YKNA 5I3UB 5KG5A 1RT7A 3KLFB 2AWZA 4IDKB 1NHVA 4PWDB 3H59A 4MIBA 2RKIA 3M8QA 4QWAA 5C24B 4M94A 4J9PA 4O3RA 3CDWA 3KMQA 1RTHA 1DTQB 4URQU 4YR3A 4DL4A 1S9EA 4KO0B 5KFFA 2IC3A 5KFPA 3T5KA 4EEYA 2OH2A 3JYTB 4IRDA 4J9LA 4F4WA 4WZQA 2OPQB 3I5BA 2ILZA 3ITHA 1REVA 5KFBA 1RT1A 1QAIA 3V4IB 3RBEA 4ICLA 5HROB 1S0NA 2HNZA 5C25B 3G6XA 3T5JA 2HNYB 3MEDA 2R2RA 3CIZA 3KK3A 4TN2A 2ZKUA 4RW9A 4FS1A 4DL7A 3DDKA 5J2PB 3NBPA 3PZPA 3OL9A 3UQSA 2WTFA 2J6SA 2JC0A 4NLYA 1TKTA 4NLWA 3MR6A 4EYHB 4Q45A 2I5JB 4JV0A 3MR2A 2FVSA 2W7OA 1HQUA 1EP4B 1JLBA 4NRUA 3Q8QB 3KHLA 3RBDA 1SH0A 1RT2B 2EC0A 3PW7A 3MF5A 1RTJA 1ZETA 2UVUA 5CYQA 5J1EA 4DG1A 5KG7A 4RNOA 4JUZA 2R8IA 4F4XA 3UDLA 1S1VB 2BANA 2HWHA 5KFYA 2XGQA 1T05B 3DRRB 4I2PB 4O4GA 1S6PB 2FJVA 4R8UA 3NGDA 2VG5A 1D0EA 3NAHA 1C2PA 3LAKA 4XO0A 5L1IA 4LQ9A 2AQ4A 5KFSA 3BSAA 3V81B 3I5AA 5L1LA 5CYMA 5L1KA 1HARA 1VRTA 3KLHA 1RT4A 1HYSB 1XR5A 3Q8PB 4X2BA 1RTDA 2XI2A 3UR0A 3FRZA 2YKMA 5KFJA 1S1XA 3LP2A 4DG1B 3MR5A 4G3IA 3LP1A 2WB4A 1IKWA 1S1TB 3KLGA 1ZTWA 1KLMA 1TQLA 3CVKA 3I0RB 3HVAA 4EO6A 4ED1A 4NYZA 3OSPA 4MK8A 3LP0B 3DLKA 1VRUB 1TKZB 1RT6B 3DLGA 4J9NA 2BR0A 2JEGA 3DOKA 1ZTTA 1CSJA 2WONB 1S48A 5KFAA 1TL1B 3QO9A 3OL6A 3H5YA 2ATLA 3C6UA 3RB6A 3TVKA 2C2EA 4ID5A 3H4BA 1NHUA 2OPRB 4ZHRA 4ZVEA 1HNIB 4LSLA 3CO9A 3N6NA 4NLSA 1JLGB 1RT5A 1S1WB 3FQLA 4ECRA 2VG7A 3JSMB 5KFXA 1IKYA 1JLFB 2W9CB 4K4XA 1MMLA 1C0TB 2VG6B 3QO9B 4ZP8A 5F8HA 3OL8A 4ECXA 3MEGA 4TY8B 4IG0B 4RW6A 4B3OB 1RTIB 2BE2A 2XWYA 1BQMA 3SI8A 1S6QB 2FLPA 5KFHA 4IQXA 1TVRB 5HLFB 2HNDB 4ZHRB 3IRXB 3G6VA 3DRSA 1IKVB 2ZE2B 4H4MB 2HWIA 1N6QA 4WFXA 3DYAB 5KG3A 1JLCB 3PR4A 3CDUA 4K4ZA 1K1QA 2C22A 4GC7A 1N5YA 3OLAA 4ED3A 1LW2A 1J5OA 4IR9A 4RNMA 4RW8B 1JLEB 5I3UA 3KLFA 2IJFA 4IDKA 1BQNB 4PWDA 5C24A 3BSNA 3CJ0A 4Y3CA 2W9BB 4O3OA 1BQMB 5EDWA 1DTQA 2ASLA 5J2QB 4KO0A 4EBCA 2J6UA 3E51A 4DL5A 2D3ZA 3JYTA 2BQ3A 5KFNA 2XC9A 2XI3A 1RT3A 3PHEA 2OPQA 3DLEB 4PQUB 1MU2B 5KT4A 4I2QB 4MH8A 2BRKA 3GIIA 2R8GA 4KFBB 3V4IA 1DTTB 2YNGB 4WE1B 4R0EA 5KT2A 5HROA 3HHKA 3G86A 5KFEA 5L1JA 4O44B 3HVTB 5C25A 4ZPDA 2HNYA 1KHWA 4NRTA 4R5PB 1R0AB 2IM1A 3DOLB 4F50A 5F8JA 3KJVB 4QWCA 4NLPA 5J2PA 3PW5A 3BJYA 1N56A 4NLXA 3ICLA 4IFVB 2FVPA 4EBDA 5DGBA 1LWEB 4YR2A 2WOMB 2W8KA 4GC6A 5K14A 4TLRA 5C42B 2I5JA 1JLAB 1IKXB 1RT3B 4KSEB 3LANA 5FDLB 3M8PB 2JEJA 3DRPB 1EP4A 1HPZB 4KHRA 1RT2A 3CWJA 2C2RA 5D3GB 1JLQB 1RA6A 3CJ4A 2RF2B 2AGOA 2R2TA 4ECSA 4ZPAA 4YP3A 1S1VA 3FFIA 4QW8A 2V4QA 4EO8A 1T05A 3QYYA 4ECZA 3DRRA 4I2PA 4FBUA 3IG1B 2UUWA 1S6PA 4LSNB 1U09A 4Q8FA 3OSNA 2DPJA 1S49A 4NLTA 3QIPB 2QV6A 4DL2A 2ALZA 4IR1A 5J2NB 2YNIB 2B6AB 1QAJA 3V81A 5K14B 4IFYB 5KG2A 3FSIA 4Q43A 4IRCA 3IGNA 4KE5A 1HYSA 2F8EX 4MKAA 4Y2CA 3PJXA 2QE5A 2R8HA 4IH5A 3V6KA 3H40A 1T03B 4ECUA 1S1TA 4URGA 3ISNC 3MFIA 3FQKA 3MFHA 3FFIB 2V0NA 3I0RA 2UUTA 4TYAA 4RUCA 5KFKA 3LP0A 1VRUA 1TKZA 1RT6A 4NLGA 5KT7A 5DQHA 2WONA 1TL1A 2YNHB 3GIJA 2B5JB 3RB0A 4K4VA 4ECYA 2J6TA
chains in the Genus database with same CATH superfamily
3V6DB 2R7VA 3FBBA 3KHGA 2OPRA 3BBBA 3O3LA 1S77D 2W2NP 1RWPB 2CQCA 3VAKA 1F2HA 5T7LB 2RDIA 2JVRA 4ZPTR 7FD1A 3TJAA 1RLCL 4FYYB 4MK7A 3H5UA 2ZHOA 3U7JA 1U26A 4BHQA 3C15A 2DNLA 4LR7A 1U02A 4RNFA 2CIMA 4LSZB 3D3BJ 1AUDA 1J27A 1VQOS 5CYJA 4DL0C 2F65A 1JKHB 4QWBA 1RZMA 2CVEA 2Z30B 2GQCA 2QA2A 4M5HA 1HBNB 4HLBA 2FJXA 1NK8A 5FDLA 1S9FA 2XSFA 2MQ8A 2DR8A 3PY8A 3F44A 3DMJA 1VC5A 1PC5A 1UA0A 1V5IB 3AA8A 2BW2A 1GQEA 4NLDA 3VAFA 4B3TJ 1DARA 3MMCB 2AU0A 2MGZB 3SZ2A 2C1EB 3GLJA 3T6BA 1M5KC 1TUWA 2EXUA 3GE9A 3V4MA 1U4BA 4GRSA 2ZOFA 3SYZA 2B7CB 3M32A 3MM8A 3IBFB 1UVLA 4ZMMA 1Q7LB 3QLHA 6AT1B 2BMBA 4OHZA 1B0VA 1Y0HA 4WYLA 1QUVA 3DLHA 3A8EA 5EUHA 2M7SA 3CJ3A 2R4FA 4PABA 3P5TL 2R3VA 5KTQA 2DNZA 3TX8A 4DEZA 3KK2A 1L5UA 4MT1A 1TK0A 4RW4A 2OLWA 2G0JA 3QNWB 3PW0A 3IMQJ 3EUNA 1CVJA 3RU0A 5AJ3J 1YRTA 3LO3A 4M8LA 1RTDB 1WG1A 5DQIA 1B4SA 3M9OB 2GQQA 4IKAA 1KLMB 4O4RA 3MGJA 4MK9A 1LWCA 4GVBA 3DLKB 1HWJA 3OJUA 2K06A 1RBAA 1S1UA 4PUOA 3A3PB 3CD6S 3DDIA 3OD2A 4RBVA 1FKOA 2J9DE 4ED8A 4USVA 1R27B 4U7UK 3QGGA 4Y00A 2MTLA 4QR1A 1NDCA 2XS5A 4O0IA 2DHHA 1LW2B 3AD8C 1L3UA 2DO0A 4DU7A 4IDKB 4MIBA 3NEKA 4PG8A 5C24B 3DGPB 4KT0C 4F26A 2HNZA 3DXBA 5H1SV 3BKUA 5LOQA 1WTFA 4CO2A 1N36J 3P5BP 1PGZA 3AT1B 2IVFB 1X5OA 1E6YA 3UDLA 2J8SA 4EWTA 1S6PB 4R8UA 4CH7A 3L09A 2AQ4A 2L41A 3KLHA 4DZDA 3HFVA 4L76A 1PAUB 1UZHA 1GMWA 2PDAA 2GJFA 3KLGA 4F25A 1WEXA 2AP6A 1VRUB 2UXBF 1U1LA 5KFAA 3IWLA 3R5BA 2DT9A 4WP9A 4YY3F 3TVKA 1RK8A 3CO9A 3B54A 5E3QA 3W9HA 2CYYA 3SI8A 4B3SJ 1WEZA 2LEAA 5IC6B 2HWIA 1JQGA 1SC1B 2QMUB 2FY1A 1NUEA 3PRVA 3POTA 2R7SA 4F3OA 2ZJPQ 2W4CA 1RADB 3CJ0A 4WKYA 2I6WA 5J2QB 5J1PA 3NWRA 3OPKA 3SCJE 1X4DA 4MKYA 4C4WA 5DDPC 2VJUA 2DXDA 4AXIA 4DV3J 2FB0A 2AEJA 3IR7B 2AF6A 1WACA 3M1VB 3ICLA 1AFJA 1P6TA 3O44A 3ZTPA 2F4VJ 4KHRA 3R5JB 2AGOA 2R2TA 2DO4A 3G96A 3QBCA 3IG1B 2CFXA 3FC9A 2BE7D 2EFQA 1RAOA 5GADU 4ZVUB 4P2XA 2V0NA 4DPUA 2XMWA 2NXCA 2V6AA 2HIQA 4LR8A 4E98A 4OHXA 4NXNJ 3K0JA 4LVNP 2EK6A 3AD7C 4C2MA 2VA2A 5CAAA 1RKIA 2OPPB 1UFLA 1U0HA 2W9CA 5AE1A 2MZ1A 1I3OB 4RU2A 1SC4B 4ATNA 2B4UA 2HFNA 4OI3A 3NS6A 1SL2A 2ZE2A 4CO0A 2GA7A 1TKXB 2OMLA 4RW8A 3KK1B 5IT9Y 2EFGA 1S0MA 2DPIA 4KFBA 2HGMA 4C0BA 4K2XA 2V5HG 4R5PA 4KHPJ 1JK9B 1HKAA 2D3OR 3BQ1A 1OYEA 3R8YA 2H1YA 2Q6CA 4IH6A 3AJ1A 3GR1A 3TJ8A 1RGVA 3HHEA 4G1QB 2DHGA 3D6MB 1TFWA 4UUWA 1HBUB 5A0YB 3A3OB 2G1HA 4V1Ak 1CG2A 2W9AA 1T11A 4TLQA 4C8KA 2W24A 4WK1A 1SB6A 4H4OB 4DV2J 4CI0B 4OJ1A 1UWBA 2XY7A 3JQKA 3FGVA 2FHMA 4E8UA 2M88A 2DGQA 2K7JA 2DR5A 3C14B 1XQIA 3MD3A 2HMIA 2HHTA 4LT6A 2G13A 1NSQA 3MEDB 3TA2A 4MFBA 3QATA 1TKTB 3N0VA 4C97A 3EYZA 4G1PA 4RWWA 4RBTA 1X4GA 4N77A 5G4DA 5CHCB 3BR8A 1PBAA 4FXDA 2BDPA 4IH7A 2DCUB 2GVZA 3U1MA 1DY3A 3UVJA 4DCPB 3CCSS 5EX3A 3FSXA 3LP2B 1ZAXA 3GG1A 1SV5A 3BQ0A 2HBZB 5DLFA 4QCLA 1T9YA 4WIIA 1BWVA 4ED0A 3C6UB 2V8HA 4CO4A 3R1HA 1GH8A 1VQPS 2V9WA 2GIRA 2YQ0A 1SC6A 5AXMA 2ILYA 2Z2YB 1NNDA 2IM3A 2H48B 4RW6B 1R8BA 2IBKA 4QIGA 1TMMA 5K8PA 2YX1A 2HQDA 2NYHA 1WC0A 2OI2A 4YHHF 2WZ1A 2M3DA 1HHTP 4DZ6A 5IXUA 1WDTA 5F8LA 3E01A 1S9EA 4OZ2A 1XMOF 2OPQB 3OTOF 2UP1A 3ZTRA 3DHWC 3T5JA 2F9DA 4CCHA 2HHUA 4FXVA 2HBQB 4LF1A 4DR3J 1FEEA 2JC0A 1VYAA 4Q45A 3LPYA 1NK4A 2U1AA 2HVEA 3MF5A 2BYCA 4JV5F 5GMEA 1TU0B 2HQCA 4O4GA 1VQ4S 1HARA 2P8IA 1JJ2R 1WWHA 2NZ4A 3AA9A 1Q5VA 4BDPA 9RUBA 3LGMA 3P8BB 4L75A 2P9GA 2VBZA 3OFEA 1GAOA 3EVMA 1NHUA 1HNIB 3EGWB 4YEAA 3OXLA 3C2PA 2XSJA 5E2QA 4EU0A 2VG6B 3NWGA 3OL8A 5HVFA 2FJEB 2VC0A 4IG0B 3HPOA 5D8HB 1WKLA 1RCOB 1UW9A 2CJXB 2YKQA 4M5GA 2PMZD 5U47A 3EDQB 4WFNQ 5I3UA 3BSNA 2XG8A 4W90B 1FKAF 4USJC 1DBDA 3D6TB 3TQEA 3Q22A 4DBQA 3TO8A 5GVQA 5AE2A 4F50A 1CJKA 1EZZB 4EBDA 2AJ1A 1QTMA 3M8PB 2AYGA 5ETRA 2A2DA 1Y9OA 3CWJA 5HQLA 1IBKJ 5DJBA 1U09A 3I96A 2DPJA 1VQSA 3HULA 2B6AB 3MAQA 2F8EX 2OGUA 1HL6A 2RE1A 4M5KA 4LJMA 4ZJQA 4B3TF 4N8OA 3FFIB 3MCOA 1PJ5A 4WBFA 1TKZA 4M5LA 4NLGA 2LA6A 4DF8A 2Q1LA 1OS5A 3M8WA 5EWEA 5E5NA 1TL7A 1TKXA 4NLOA 3BF4A 3V2UC 3FNNA 2Z56B 5F8IA 4DFPA 4B3OA 2G4BA 2XO7A 3TANA 2MEWA 1BD6A 5HLFA 3IRXA 3T5HA 1YWXA 3PR5B 3N9UC 4WFAQ 1FKPB 2RU3A 3ETMA 1VJWA 2ZOMA 5A8RB 2WW8A 5ITHA 3AH6A 3NKYA 4FYXB 3T19A 3VZHA 2QEXS 2FLNA 4WE1A 2QGFB 1RWXB 3R7SB 2IM0A 3KJVA 2VF3A 2L9WA 1LWEA 2WW4A 5EN1A 1LW0B 3MM7A 1HQEB 1TL4A 2DGTA 2MHEA 2IIHA 4CH1A 4LSNA 1RE1B 4YB7A 5ETVA 2BJEA 2DITA 5C5JA 4QIFA 4QOTA 2IDLA 1R0CB 3NGTA 3RAQA 3OVSA 4TYBA 3UI3A 5FLXU 1B7FA 2VBYA 2VQFJ 2R7XA 1G7CB 3OTCA 1XMQJ 3PEJA 4OHYA 3TUIC 2QA4G 4B02A 2I38A 1QAXA 4ETXA 3B78A 4XIUA 4I68A 2LQJA 3ITHB 5KFVA 5A6PA 1TV6A 2V94A 3K5PA 4P52A 2CQBA 3KYLA 2FVCA 2EFNA 2VPWB 5KFLA 1KBRA 2G2ZA 2GAHC 5E3AA 1QE1A 2D9OA 4J9MA 4JI4F 2QJ3A 4CLZA 1AZSA 3QWUA 3NLCA 3LP1B 3J7AN 5HATA 1BQXA 4TQSA 3CB4A 1OQ3A 3UCUP 2PIIA 1FA0A 5IQ6A 4DX8H 1H2VZ 3R7NB 2DH7A 1FE0A 4CO1A 4CO3A 1U6BA 2VG7B 4X84A 1FX4A 4F0HA 3C6TA 5HO4A 2DR7A 4U7CA 3MPVA 3KG0A 4B3MJ 3K8WA 3R5DA 4J7CA 2B4PA 2AEMA 1WF1A 1T9XA 3KLFB 2GO8A 4FYVB 4K5SA 3I55S 4DL4A 1FJCA 2AT1B 2XNRA 2C3UA 4J9LA 2J9EA 1N5QA 2GZOA 4B9NA 1QAIA 3V4IB 3CC7S 1Y11A 1F5CA 3I6PA 4DL7A 3PZPA 4NA1A 3I9V9 4XAKA 4TU9A 5ETQA 3NXZA 4OV6A 5H9EK 2DB1A 3PYGA 4DFJA 1NKEA 2ZBIA 4OZ5A 1UCNA 1T9WA 5JJBA 1U6ZA 2F63A 2Y1JA 1RT4A 4V19X 2C3MA 1S1TB 2UUAF 4LF6J 4C8MA 2KRBA 5DRKA 2K2PA 5HL7Q 4HT5A 3BN4A 3DOKA 2V9KA 4Y28C 4OJGA 2G2OA 2CQIA 1QAYA 3W9JA 3FMBA 2GIFA 4DUTA 4X65F 2SXLA 3VVTA 1S1WB 1P9YA 1ZZNA 2VHGA 2XS2A 2GCFA 3MCSA 2ZH1A 1N54B 2DIVA 4ZHRB 1CULA 4K4ZA 3CDUA 1N5YA 4WPAA 2IVMA 1R8AA 1R8CA 2ZM6J 2W9BB 3SMZA 2Q3PA 4U8YA 5CCMA 2HAFA 3GZ7A 4C3MA 1J2VA 3GR0A 3HHKA 2ACMA 5IT4A 1DJ0A 4JI3F 3OV7A 3DOLB 4Q5VA 3AODA 4EZ6A 2AD9A 2ZHAA 3LANA 3DRPB 1R6YA 5JMNA 1XNRF 4OX9F 3QMQA 4A46A 2H9ZA 2IRXA 1Y10A 3DOMB 4ES2A 3FFIA 1WOSA 3NY0A 2UV8G 2QV6A 3JTPA 2ALZA 1ICEB 4ZKAA 4P10A 2QYGA 3PJXA 2VB6A 4URGA 4RUCA 2CZ9A 1FX2A 4ANDA 1FDDA 4NMXA 3GIJA 2FZGB 1ZA2B 4ECYA 2J6TA 1YLXA 2E1AA 1RWKB 3ZNJ1 4NLQA 3D68A 1Q5YA 4FP9A 4DOZA 3EZOA 2EG1A 3PV8A 3QRQA 4TY8A 3MI7X 3W60A 1S79A 4IRKA 4K59A 1HMVB 1IBCB 2IYGA 1Q53A 4KKOB 3W64A 3TA1A 4F4YA 4GO7X 4O3NA 3ET6A 3MM5B 1NDLA 2MSTA 1UPMB 1NBEB 3M6VA 3TX0A 2O67A 1BXNA 2E5HA 2ZD1B 3RYLA 3UD5A 3G71S 2HRYA 4ECWA 5KG6A 4USHA 4L3KA 2W4PA 2LQBA 2QMWA 4IFVA 4DV5F 2RILA 3Q8SB 1HNVB 3HHLB 1KD1T 3PKYA 5LXRA 4KYZA 1C0UB 2OEJA 4IO9Q 2DRDA 4L73A 1AT1B 2RUGA 3QAUA 1RHKB 1KHVA 2VFVA 3EXYA 3SCKE 1Y5IB 4B17A 5DM7Q 3M2UA 1H2UX 1J5EF 2BKNA 4JV2A 3EZ5A 3D66A 3RG6A 1V9OA 1WTBA 4JI1J 3KDOA 3QSYB 4Q0BA 1SH2A 4ZDNA 3PJWA 2RKIB 3OTEA 2IC3B 2DNMA 2RQKA 1IBMF 2FTRA 4P71A 3J80Y 3GIMA 4DI6A 3DI6A 1NZ8A 2CQPA 2IYIA 5D0GA 3OR1B 3T1AA 4IOAQ 1XR6A 2B9YA 4DR3F 3CSKA 4ENOA 4G65A 1RTJB 2OKQA 3KFWX 4DN0A 2HFUA 2R7OA 3KDNA 1WOPA 3K7RA 3IWXA 4LRBA 3RAMA 2I0XA 2ERRA 5A2QY 3RBZA 2GIQA 2JDJA 4B9VA 1Q16B 3CGIA 3DLGB 1PJ6A 2CAJA 3G9CA 3UE2A 1H7WA 2AV5A 1S72S 4IO1A 2CKWA 3PW4A 3RB4A 3IM8A 3SBMA 3TRGA 1HHQA 5CH7B 2DEJA 3DFEA 3UNGC 3IS9A 2NQPA 2HS0A 4IYQA 1SJQA 1T7PA 3Q8YA 1MWZA 4BC7A 4FPIA 1S6OA 4ZA1A 4PWDB 1YX2A 1QD1A 2V8VA 5B0FA 1T0TV 3RRHA 3H25A 4DV1J 3PRDA 5FD1A 1UJ5A 2HHPA 5CQGA 1CLFA 4QIVA 1FWLA 3B4DA 1N5VA 1YJ9S 4ICLA 3LPEA 4OZ1A 3HLUA 3MAAA 1CJVA 2E29A 1L3VA 3UQSA 4JV0A 2E7XA 3MR2A 1JLBA 4DCJB 5CYQA 2HKEA 1B0PA 1T05B 2LQ8A 1CJTA 1QY7A 4WTOB 4FPRA 5KFSA 1WC6A 4B9LA 2DD8S 3QRRA 1S1XA 1GMVA 3I31A 4DJBA 1YBAA 5K8MA 2K1RA 4WU2A 4AUKA 2BR0A 3ZO7A 2WONB 1MN7A 1RI7A 4QR2A 4ID5A 3HSDA 1VQKS 2Z57B 4C6AA 4ZHRA 3N6NA 3CNQP 2QLJB 1JLGB 2X7IA 4HHUA 2H65B 1DQ8A 3BN7A 4ECXA 2KKHA 4M63A 3G6VA 1N6QA 2KT3A 3TVYA 1EKSA 4Y3CA 1BQMB 5D6GA 5BJRA 2D1CA 2J5AA 4WCEQ 2BQ3A 1WF0A 4DR6J 3CMQA 3GIIA 2E66A 5HROA 1KVIA 2YX7A 4NLPA 5J2PA 4WFBQ 1REGX 3PW5A 4JI2J 3TOQA 1RWWB 2WOMB 3O2IA 1RT3B 2ROPA 3IXQA 3SQOP 4JI7F 3CT9A 2HHSA 4NMLA 2D9PA 1FTRA 1G6BA 3R7BB 4NZ7A 5GAEU 4Q8FA 3B8HA 1QAJA 5K14B 4DSLA 2N4CA 2GW8A 3V6KA 1PILA 1KFDA 1VK3A 2VZ9A 4LFAF 1FRMA 3LP0A 3VF0B 4JI0J 4USKA 1VLYA 1FHTA 1KQSR 1XNQF 2E1PA 3ONQA 5LMNF 1RBOB 2HIYA 3MM5A 3HKWA 1F9HA 3BGRB 5KT6A 4FNHA 1A0OB 4H4MA 2YTCA 1JLCA 2V2ZA 1PBUA 3RW7A 5F9NA 4G1IA 4QWEA 4DL6A 4KB7A 4NI2A 2ABYA 4I7FB 1MU2A 4I2QA 1ZAVA 2LXUA 2B9WA 1R0AA 1ITPA 1S57A 1AXQA 2V8PA 1FF2A 1JJHA 2FLLA 4PRFA 4X4NA 1YDLA 1KTQA 1X4BA 5F3ZA 3JAMY 1S9GB 4WFYA 3NGKA 5ETKA 1WD6A 2CDQA 3OTBA 2E7WA 1YZ7A 2PMHA 4FF4A 2W2MP 1SUQB 5J2NA 4WF9Q 4KC5A 1HNXJ 3TARA 1TP7A 3QJJA 1T03A 3I0SB 3KLIB 3BO2A 2HWTA 1FJEB 2CQ3A 4QYZK 5D78A 4MKBA 1QTNB 2L08A 4CLPA 5H9EJ 2B5JA 5LT5A 2JRSA 3W5XA 3GYXB 4B3MF 3ZTQA 3QAEA 2ZH3A 5DG8A 3VAJA 1Q86T 1S4EA 3VQSA 1SQFA 4BWJA 4OYIA 1TAUA 4DUYJ 1JIHA 1AYEA 1GMUA 2I2YA 5C2GA 1Q82T 3JSYA 3ZFVA 3FKBA 1NJIT 3HO1A 3QT7A 2CJYB 3N28A 3WZ0A 5KT5A 1KQFB 2F3JA 1KS2A 2BANB 4KGKA 4C11B 2DVIA 4ED7A 4YOEA 5KG0A 2BJ8A 4F02A 2AGPA 2VKRA 3D7SB 1TL3A 5B7WA 2QN6B 4OLOA 3CULA 5HAOA 3H42A 2KZMA 3CUNA 1FFWB 2ROGA 2A3JA 2ZUGA 3GYNA 3MEGB 1X4HA 2DGOA 4PAAA 4DSJA 1Y5NB 3I82A 1T94A 1YK9A 2NLWA 5HQMA 1BGXT 1U8WA 2ZZMA 2HG4A 2DXEA 3H59A 4F3MA 4J9PA 4NXMJ 3KUGA 3J7A1 5D0HA 4F4WA 1NJWA 1FCAA 4ZLPA 2BOPA 1RT1A 3HT3A 2R2RA 2DYAA 3U27A 2OO4A 3OL9A 1RP5A 2KYXA 3GONA 1U8SA 3IR5B 3K5LA 3KUEA 2W7OA 1SJ4P 2DHAA 1NDPA 1QSYA 2HHHJ 5ETSA 3ZZUA 1JNRB 7AT1B 2XNQA 1FNMA 3NAHA 2IJRA 1D9DA 2MQMA 2GGPA 1VQ7S 5KFJA 3GP9A 1Y00A 3CVKA 1TQLA 4LFCJ 3I0RB 2ZFHA 7FDRA 1QDUB 1ELOA 2QO3A 3WHIA 4KGZB 1BE4A 3ZZZA 3D6HB 1FD8A 3JTOA 3QO9B 4ZP8A 2XWYA 1BQMA 1UVJA 4E2FB 1HR0F 1S7HA 3DRSA 1IKVB 5CZXA 2X1BA 2Q79A 5MAOA 2VV5A 1DQAA 1KVJA 3P4UB 1HBMA 2XULA 1VC6A 2FZCB 4ZIVA 1U48A 1RT3A 1FRJA 4DQIA 3CDAA 3PRBA 5HSPA 4DV4F 2R8GA 2E5LJ 4CTAB 2Z4PA 3PO4A 1I51B 2H3EB 1Y3JA 5K14A 2CXEA 2LDYA 2I5JA 1JLAB 3DN9A 1PKUA 4DR1J 2KTQA 1S76D 2Z2LA 3NCRA 3GIRA 2YH0A 2V4QA 4ECZA 3DRRA 2OIHA 3OSNA 4IRCA 1HYSA 3EE3A 3MMBB 4CYUA 4I6WA 1CJUB 3PFOA 3GJRB 2DNNA 5KFKA 4C8LA 1OY8A 1U6FA 5KT7A 1FXDA 2BJ3A 2KM8C 3H90A 3I4PA 2EFPA 4Z37A 3P49B 2WSCC 2XY6A 1FWKA 4K0KF 2ZC4A 2WSEC 2KRRA 1JLFA 5DG9A 2UVWA 2RRAA 2V4RA 5G0RA 4DSFA 3LF0A 1N34F 2ASYA 2LLZA 2X1AA 1VQ8S 3SSRA 4TU7A 1JLEA 1OMSA 1C4CA 2RNEA 1RDRA 3D0GE 3BH6B 2W7PA 1WOOA 2R8JA 1RJJA 5IM0A 1X60A 3DLEA 4PQUA 2ZBPA 1I94J 2EBEA 4OYOA 3OR2B 2YNGA 2BM0A 1RAJA 4PG6A 3TAQA 3ELHA 2UVRA 1S0VA 2DNKA 3GJSB 2JC1A 4PPDA 3TW0A 4C8ZA 2XMJA 4F4ZA 4QR0A 2CADA 4ILRA 3L7PA 4QWDA 3FEXB 2UU9J 3SQGA 3QGIA 4HACB 4FNIA 3BM7A 4A8SA 4QYRA 1C1BB 5CCLA 4PQAA 1F6TA 3BO4A 3C66A 5KFMA 5ETPA 2BXJA 1OJ4A 1HWKA 5HVHA 2FC8A 2B8QA 4URSA 1FK9A 2NSCA 3P96A 5ETMA 2A6MA 5DETA 1E6VA 1EARA 2LCWA 3OFGA 1Q8BA 3TEHB 1C1CA 4K8RA 1REVB 4KV8A 3CJ5A 4RU9A 2PI4A 2NYIA 3ADAC 1IBLF 2KHCA 3NBPB 2P9CA 3T1HF 3THTA 3CCVS 4KIAA 2PFFB 1XJWB 5JXSA 3G82A 3QIDA 2E1CA 3MM9A 1VRQC 3CJ8A 3G8QA 1IQZA 5F0UA 2OD4A 3OHBA 2RS2A 4K4UA 3VTIA 1RQ0A 2ZZTA 2DNGA 3UDVA 3KKFA 4QPXA 3OQ2A 4Y34A 4JI5F 5F8NA 5L39A 1DLOA 2P6TA 4AQYJ 1IKWB 3T6JA 1UETA 3BV8A 5CD4A 1N5SA 5LJ3Y 3DM2A 3FK4A 1NSKL 1D1UA 4DUZJ 1NPKA 3TNVA 1ULRA 4AL6A 1UVMA 2L48A 2F5GA 2CPFA 1CQNA 4PZVA 3BEGB 2JLEA 3V6HA 5K5MA 2P2CB 4RR5A 2R9LA 4F8RA 3QT8A 2CJKA 4CH0S 4IG3A 1LWFA 4RWXA 3GFYA 2DGXA 4FVMA 4JI6F 1RTHA 4KO0B 4P2MA 3W62A 4PYDA 5HMXA 3LUYA 2BE9B 2CQHA 3PX4A 4GKKJ 3PTWA 3I87A 1MN9A 1VK8A 2CWXA 4AYBD 4RX6A 3Q2TC 2EPIA 1HQUA 3KHLA 1H98A 2PD1A 2OP5A 5HJXA 5LXYA 2R8IA 2W25A 2DIUA 5CYMA 1UZDA 1Z1ZA 2LKZA 4NASA 2XI2A 2YKMA 1IM6A 5ETNA 4ED1A 2RQMA 3QO9A 1VQ5S 2OPRB 2GMJA 3CMES 4J91A 1N33J 1SJ1A 2XYHB 5CXTA 2XEXA 3CJKA 4ANEA 2XWXA 1UFKA 3J7ZT 3CE8A 1SL0A 3ZC4A 5CABA 3TYTA 3RJMB 1J5OA 1N52B 3C15B 4F4AA 4EBCA 2XLJA 4JBCA 1R8PA 2N7YA 3G87A 4ZLJA 5L1JA 2XMUA 2HNYA 4NWBA 1N56A 3Q89A 4FXWA 4KSEB 5FDLB 2ZH6A 1U1OA 3GFXA 3VVUA 1CJUA 2MQPA 1S1VA 4EO8A 4I2PA 1IWAA 4JP8A 5A2QU 1D09B 4QBUA 3HP6A 3NNCA 1KC8T 4MYUA 2QLFB 3PO5A 4A8QA 2PT0A 4OI6A 1U1PA 3ILLA 2Y0BB 1Q8KA 4QPTA 3SV4A 4OZ0A 1KQKA 1NJZA 2GAGC 1FO1A 3MM8B 3M32B 2GC8A 3QLHB 3JSMA 4Y0FA 4X4SA 1RB0A 3U1LA 3DRYA 1RKJA 2M8HA 4X4VA 2HNDA 1X31C 1W2IA 5D0EA 1IWGA 2RRBA 3OR2A 4CLFA 3WX8A 1UP1A 1YVFA 5A8WA 2CPEA 3FBCA 3X3UA 4WYWA 1VR6A 3KK2B 2UUBJ 2HS3A 1R8HA 1KQGB 2E44A 4RW4B 1K47A 2F1FA 4ILLA 2ZZNA 3OL7A 4LRCA 2MQLA 1EKRA 4A8XA 4IQMA 5DQGA 4HEA9 1DZ5A 3R9LA 2ALYB 1D8YA 2WBRA 2GVDA 5C42A 2KN4A 3BYPA 1PC4A 1LWCB 4GVBB 1TUVA 1C1BA 1YJWS 3CCRS 1URNA 1DFDA 2ZDOA 1S1UB 3W1YC 2YNIA 3CTRA 4EUVA 2KXFA 2I1RA 4PXCA 5J1NA 4B08A 2RT3A 1TL5A 1FKOB 3C19A 5KG1A 2BQUA 4M95A 3W2VA 2EKNA 3GJQB 3TJ9A 5ETTA 2VJVA 1CQMA 5KAKA 2F4FA 5AE3A 4OYBA 3F41A 2AYEA 1RYSA 3E2EA 4ZPVR 4B9SA 4LBIA 3N4WA 1W2BR 2M5YA 4U7UD 2E5GA 1WC3A 4ZCKA 4ZK7M 3MEEA 2HNZB 3BSOA 3DU5A 1RSCA 4ES1A 4ED6A 1NM2A 1U0SA 1HA1A 3ETOA 3S6EA 3MDFA 2C28A 4U6PA 4R8UB 5IC4B 4LF5J 1NH8A 3FCWA 4ED5A 1X8DA 4PR6A 3KLHB 2CQ2A 4JI8F 4GKJJ 2MLYA 2IAJA 1X5PA 4YDDB 3KLGB 4RW7A 2FJDB 3M05A 2GHPA 2DNPA 3W5YA 4IOCQ 4R25A 2M4MA 1SCJB 1RWUA 4O3PA 5IWAJ 4DV6F 3PCOB 2FUG9 1PO6A 1WELA 3VGSA 1VDHA 3CCQS 4HKQA 2NSBA 2JEFA 4DV7J 3CCWA 3DU6A 4C98A 3M2VB 3BKTA 1NK7A 5HP1A 2AZ1A 3P6YC 3QZ7A 4P2FA 3J81Y 3POTB 4TVAB 4LF7J 1NHVA 4ALZA 4QWAA 2QYCA 2M8DB 1GXUA 2I9SA 3T5KA 2N82B 1FDBA 2ZNZA 3HHDA 4A8YA 1VHFA 2CNLB 4NZ6A 4FS1A 2ZH7A 3GYGA 2MKSA 2W4DA 3LWMA 2XM3A 1SH0A 4X64J 1G1XA 2HLUA 3BGOP 2J0WA 3HT0A 1VFJA 1HQ2A 2KH9A 3PDNA 5L1IA 2Y1IA 4DR2J 1NH7A 1W26A 5GMKa 1XR5A 4CLLA 2V4JB 1HNZJ 2LU2A 4B3RJ 4N76A 4EFAC 2N7CA 3DCAA 4NE9C 3MUMP 1OIAA 1FJGJ 2JEGA 1NKBA 2QG9B 3AY0A 1FRKA 2NPIA 4LRDA 2XYPB 3CW2C 4LSLA 4NLSA 1RT5A 1F9FA 5SZTA 5BYQA 1U0HB 5KFXA 2JFKA 2W9CB 5HQ8A 5THWA 4CIOA 4PXDA 5AXNA 4P6QA 4ZPWR 3OTDA 3WC2A 2ZE2B 4LRAA 1HI0P 1K1QA 4IR9A 4RNMA 2KT2A 4RW8B 2WSFC 2IJFA 1A9NB 2CZVC 2Q43A 4HR2A 3E51A 1X4EA 2Z0GA 1P8GA 4KFBB 4CQ1A 4R5PB 3HD2A 3T1YF 1I94F 5F8JA 1KKHA 3PEHA 1M5OC 2FVPA 2ZKTA 2DK2A 5DGBA 2W8KA 3VGUA 1FRXA 1EP4A 4XTTA 2IHR1 3RUBL 2MZQA 1DHMA 2GMLA 4F36A 4LIWA 2B8PA 3NRBA 2BABA 3CCZA 5B0EA 1FFSB 4Q43A 3W2WA 3CJRA 4MKAA 4EI2A 1RAHB 5C7PA 1TELA 2UU9F 3MFHA 4UZCA 4FVCA 2IVYA 1RT6A 4DX7A 4MIWA 1D9FA 2IBOA 4USUA 4UOCA 2ZBRA 1UWBB 4PWWA 3G8SA 3H5XA 1Y4ZB 1WI8A 4U95A 2CPIA 2EFVA 3NL0A 1HWLA 4YQWA 3SSSA 1R6VA 4C8OA 1Z2LA 2HMIB 1RTIA 1Y7PA 4X66J 1TVRA 3JTNA 4MFBB 2V63A 1B7YB 1B70B 2FJBB 2V69A 4O3SA 1YZ6A 2ZC3A 4NLRA 2D74B 1NZAA 3ULHA 3M2RA 1S99A 3T5LA 1DTTA 2PEBA 2QIFA 2GVZB 3MEKA 3UVJB 2Y9HA 4YS2A 2BJDA 3H0PA 4IUFA 3H2LA 5GADI 3MMAB 2QLXA 4QQBA 4Y2AA 5B0GA 1SV5B 3KJNB 4AQYF 3F73A 4N56A 2VUGA 4OI0A 3QIPA 4IFYA 2YWFA 2HEKA 2YWEA 1SC3B 3D0IE 3VAMA 1YRUA 1NSPA 4JYAJ 3MOZA 3GMGA 2OSQA 3R6LB 2XZWA 4ZS6A 2YNHA 3D9BA 2LQ9A 2F8MA 3I4HX 4CRJA 3GU0A 5J2MA 2CG4A 4Q2MA 2MZSA 3E01B 1XBWA 4EBEA 2YWGA 3TAMA 1S9EB 4WXOA 2X51A 4ZPBA 3Q8VA 3A8KA 3KLEA 3QJLA 1SVDA 4P74A 4CZCA 3OLBA 2Y1RI 1URRA 5F8GA 1Q7YT 1VC0A 1LFWA 3PYEA 1NK0A 3BSCA 4O4GB 5A6WA 3CD7A 2VPXB 4QW9A 1B3TA 1RHUB 1YJNS 3H5SA 3NOCA 1NJYA 2QL9B 3D1QA 2ROEA 1VIOA 3GB0A 1SL1A 6FD1A 3TZYA 1RWNB 5LMUJ 2MJUA 4QIWD 1TAQA 1N32F 3THVA 3RRKA 2WVCA 3HM9A 3KHRA 2VASA 2ADBA 3M2VA 2DISA 2G1DA 9ATCB 2XSJB 4LFBJ 2RIJA 4MIAA 1S0OA 2I8EA 3QZ8A 4KY3A 4LREA 2XMKA 3TZXA 4C9DA 1FWPA 4LF9F 2CJ9A 4DR4J 4O23A 5I3UB 1RAGB 3M8QA 4OJHA 1QSLA 1V6HA 4DPOA 5D0RA 2YWWA 1F60B 3S01A 1FERA 2J0SD 2HRTA 2Q6BA 4WWSA 4DR7J 1M5PC 5LJ5Y 3AJDA 4AXJA 4RW9A 3DDKA 1CJKB 5M2RA 2J6SA 3N5BA 3MR6A 4W98A 4PWUA 4I1TA 2V4JA 3F0NA 2M70A 1H6KX 1FE4A 3FRYA 4C48A 3HHLC 3K5OA 2FZKB 4XDDA 3SEOA 3W9IA 2QZ8A 1LOUA 1Q8LA 3NNAA 4ZCLA 5BR8F 2XS7A 1YITS 1TKZB 4X4PA 2ZJRQ 2ATLA 3OFFA 1R3NA 4X62J 5K8NA 2OUGA 4NL5A 2KDOA 5I3QA 3A8IA 4LF2A 3FQLA 4ECRA 1ZPVA 1TL7B 2VL1A 2G0IA 1T3OA 2FY8A 4P7TA 4B3OB 2BE2A 3H20A 2C2NA 5KFHA 2JZ5A 3W66A 5HLFB 2MZTA 4Q2LA 3IRXB 2DNOA 3ZTOA 4YN3B 4M5NA 2BBEA 5ETOA 5IOLA 1IXKA 2FHOB 2UUBF 5KT4A 4WE1B 1DRZA 1KHWA 3KJVB 1S5ZA 3AD9C 4W4MA 2QA4S 2HK2A 1LWEB 5JVGQ 4WU3A 1FXRA 1UAWA 3MM7B 4ECSA 4ZPAA 3NCQA 4LSNB 2R7WA 1I1GA 2R7RA 1BHNA 5IZHA 4WP8A 5KG2A 2C2ZB 3IGNA 4ZVPB 2QE5A 4X4UA 5L46A 2BUNA 1HNWF 1FRHA 1H72C 1VBYA 1CS4A 4DFKA 5L9NA 4F0MA 2ZDPA 2YQ1A 1M0SA 2HPUA 1RAFB 2IRUA 1GX6A 1MW7A 3L4BC 4HTIA 3TWZA 4HH0A 3RAXA 1QVFR 1HIYA 3MWBA 4OL8A 1OSDA 2LDIA 4AE5A 1IVZA 2RJZA 2KXHA 1TV6B 1S4FA 4DX6A 3DYAA 2CRLA 3T41A 4H54A 2YWKA 4C3KA 3I5CA 4UT4A 4PPZA 1WSVA 1ACMB 5DLGA 3MMAA 1NB2A 1ZYQA 2GHWA 1H74A 4O44A 1WF2A 1QE1B 2NCKL 4N47A 3UW1A 3BPSP 2UXCJ 3NS5A 4BC9A 1AZSB 1IR2A 4YB6A 1B99A 5DG7A 4ZVFA 4ID8A 2FVQA 1Q78A 2DHXA 1APSA 1U47A 2YY3A 1F3VA 5HI7A 1AROP 1NRKA 3ENAA 3GJTB 2ZVSA 3C16A 4NA2A 4N5SA 4OYXA 5IWAF 2W7AA 1WHVA 3C6TB 4ZP9A 2M2BA 3SDEA 3AFGA 3D5MA 4A8OA 4ZLNA 2IRYA 2UXBJ 5KFOA 2B9EA 4YY3J 3EJMA 4DV0F 2NUHA 1EETA 2Y8YA 2H51B 4OMFG 4UOHA 1RUSA 2XHWA 3Q24A 3H8YA 4KBIA 4CO5A 1EAYC 3VAGA 1UMJA 1U25A 5GAHI 1IQTA 3A1YG 3GILA 1GT8A 1AW0A 3JSBA 5KG4A 2O66A 1RWOB 3QGPA 1H0HB 2OSRA 4ED4A 2E5IA 2E5JA 2D3UA 2B4OA 3LAMA 4I6YA 4F04B 4X64F 3A3NB 1EJ7L 2OPSB 1B64A 4J9OA 4KGXB 4KH0B 5LSLA 3M9NB 2JSXA 1RT4B 1PYOB 3KUHA 3MURP 2HQIA 2FVRA 1O51A 1GX5A 3DOKB 4J37A 2P6SA 3IAS9 5I42A 4ZVGA 1MMDA 4H4KC 3ENWA 3HMJG 4ECTA 2H4YB 4QIEA 1U45A 4RJVA 1KONA 3NG8A 1Y5LB 1MROA 1CULB 2J76E 4X4QA 3LWLA 2VA3A 1N5YB 2DTJA 4X4OA 4Y6IA 1SJ3P 3GCXP 2C3PA 1UTAA 3FCVA 2ILZA 4USTA 2HQFA 3QQCD 3GFZA 2H5IB 3TR5A 1T9UA 3CIZA 3KK3A 1NHKL 2CQ0A 4NLYA 4NLWA 2DRBA 2FVSA 1NXIA 4NRUA 3RBDA 1FDNA 2OAUA 3UCGA 3LW5C 3L95X 1UVKA 3VAIA 5EHHA 3I5AA 1VRTA 4X4RA 3Q8PB 3HD1A 1YI2S 3BBFA 3MR5A 4HL9A 5LSOA 2DGWA 1ZTWA 2LQ5A 5HMWA 2KVIA 4EO6A 4B9MA 4J9NA 4UF4A 1ROFA 2AJ4A 4CLTA 4ZITA 1X9WA 3B6BA 4ELUA 1Z2ZA 4NEZA 3JQMA 4C0HA 2C2OB 1H73A 1IKYA 5E3PA 3IP0A 2DRAA 2NUUG 1BMQB 4TY8B 2HSEB 2VIHA 3ENQA 2VFRA 4GO5X 1T8EA 4DWIA 4WFXA 4O0NA 4GC7A 4XK8C 1QM9A 3OLAA 2KT5A 3ET6B 5MLCV 3D2WA 3CCES 2R7UA 2CVIA 5F0WA 1EIYB 1GEHA 5AJ3F 2J6UA 3HZGA 5C25A 3G4SS 5KOWA 4NLXA 4IFVB 4YR2A 3OVBA 1YJUA 1GXLA 1RT2A 3K89A 2AJQA 4P72A 2UUWA 3A12A 4RLEA 3V81A 3FSIA 3HKZD 1HBOA 3DHXA 3PYFA 4A48A 3KNGA 2IA0A 3VAHA 3M2UB 3FQKA 4DPXA 1WHYA 4PCQA 2V8GA 2H5EA 1TFYA 4Q0BB 1NSAA 4DHVA 2BQRA 1C0TA 2YPYA 3K17A 2VBWA 3PIOQ 1IM4A 1S6QA 3DI6B 1N36F 2LYVA 3EVOA 5IS2A 4OZJA 5F3TA 1BQNA 2KVQE 1X0PA 4OI2A 4L6V3 4OFZA 4TKTA 2MKCA 1OQ6A 3HVTA 4OQJA 3ISZA 1XMOJ 3V6JA 1RBLA 3N6LA 4Z7YA 3IM9A 2DBBA 5D3GA 2RF2A 3NCPA 1AFIA 1UVIA 3ZXWA 4I4BA 3MPDA 2A2CA 2QLBB 5HK4A 1Q8IA 4B3SF 3QGHA 3UCZP 3IAM9 3RW6A 1M1KT 2MLXA 3GFHA 3IS9B 1VIXA 2UZAA 4ZVTB 3KWMA 1U1RA 3EGNA 3H2UB 1FVQA 3CMAS 4ER8A 3TAPA 3J81j 4MJKA 1TKDA 2HRUA 4DV3F 3CD0A 3BGFA 5JUMA 4ICLB 5KFTA 3W65A 2F4VF 2FD2A 3MAAB 4KGVB 1CJVB 4DPYA 1N0VC 2CWKA 2OPSA 4DR7F 4USIA 4K4YA 4G6VB 2V8DA 4OX8A 3UDEA 1JLBB 4FYWB 4ZP7A 5CYQB 2CA9A 4ECVA 3KHHA 2AYBA 1RA7A 1K0TA 1CJTB 4QU6A 4A8KA 3M30A 4PG5A 4PXBA 2PGCA 1NK5A 1S1XB 5T41A 4U8VA 4J9RA 3U02A 4NXNF 2K1RB 2CNNB 3R2CJ 1NDKA 2W01A 2C3YA 1N48A 2YKPA 4KJIA 2HZVA 4ETZA 4ID5B 3DLJA 2NXEA 2MY7A 1FXLA 3PIPQ 3GIKA 2HVHA 4X62F 1Z4UA 2IMWP 2A0FB 4ZJLA 3QFHA 3MECA 2K3KA 3ZZRA 4HHJA 3AXMA 4LIRA 2CG8A 4OI1A 1TMJA 3EPGA 1GTEA 2DGSA 1RAAB 5HJYA 4J90A 4E0DA 1N6QB 3KMSA 3M8RA 4NCGA 2YKNA 1RT7A 1UW4A 3BB5A 1EQ0A 4URQU 2LP4A 4B9UA 4XDCA 4KHPF 4WZQA 2IPOB 2X1FA 3K57A 3QSIA 1TZ0A 2IFXA 5HROB 1S0NA 2DR6A 3W61A 4UUXA 1AA1B 4ZJOA 5J2PB 3WC0A 4EYHB 2WVDA 2YPZA 5DDOC 5BYSA 5J1EA 2ZBQA 4JUZA 3LTOA 2HWHA 2VG5A 2JH3A 2MZRA 2EVZA 3S7RA 1LXJA 2DNRA 2CJAA 4X2BA 2PE8A 3D1OA 2OJ3A 3NOGA 4DV2F 4N7TA 4DQSA 2BACA 3LP0B 1LK5A 2FLOA 3AB2B 4J9UE 1HLWA 2QTWA 2N3OA 2B0GA 4J5OA 1EQMA 3QRPA 4M5MA 2Z58B 1RAIB 1SKRA 4K4XA 2EBGA 3EX7B 5HMYA 4H4MB 3WBZA 4UY8T 1JLCB 3PR4A 1O6XA 2KM8B 2C22A 1SPBP 1JJCB 4FN5A 1O8BA 1DTQA 1YGYA 2HFOA 3JYTA 4NI2B 3WX4A 1MU2B 4I2QB 1RHRB 2YVSA 2C3OA 3HSJA 1R0AB 2B9XA 4QWCA 2A6OA 4GC6A 4TLRA 2JEJA 1YIJS 2UXCF 4EK2A 4DS5A 2HGLA 3CJ4A 1OY9A 2KJVA 1PIEA 2R7TA 3DLBA 2NXNA 1X4FA 6FDRA 4NLTA 1LQ9A 4DL2A 5J2NB 2RUSA 2FGCA 2J7KA 3B4MA 1RCXB 2V2KA 3RR7A 2R42A 1T03B 3ISNC 2BM1A 4JI4J 1RAEB 4TYAA 3CC2S 1TL1A 2B5JB 2V34A 3KOAA 2WVEA 2XHCA 1NAQA 2XO6A 1QJHA 2YBVA 1PYTA 4U96A 3S1TA 4C7QA 4PG7A 5KFQA 3CDBA 2PSZA 5CD4H 8RUCA 2D41A 1RWVB 5E3RA 2GJ2A 3G6YA 2DY1A 2B4VA 2YKOA 4DCOB 3HK2A 1M5SA 2VBXA 1H3DA 2QL5B 3IGVA 5GAEI 3X1LB 1RACB 3AB4B 3R2DJ 3ILOA 1SQEA 1YJVA 2UUCJ 5HBMB 1TL3B 1N8RT 2HHXA 1IKXA 2JWNA 1HPZA 1VQLS 5AXKA 3QJPA 1JLQA 2O01C 2J7WA 4DR5J 1NO8A 4KAIA 3ILJA 3NS7B 2OFHX 4CM0A 3R5GA 5EGYA 4LQ3A 3TQ1A 1SKSA 3CJQA 2EG2A 1QSSA 3GV5B 3AOBA 1K9MT 3NMAA 1N4LA 4F3QA 4YUDA 2UUAJ 3V6DA 1RU2A 3OXFA 5IT9U 2MZJA 1KWMA 4X65J 3VWSA 5T7LA 1BLUA 3JSRA 5B09A 4OYWA 1RT1B 2DHSA 3FJ2A 1TTHB 2EI5A 4KTQA 2MMYA 2XGPA 4KPCA 3TUPA 2MKHA 1IBKF 2J9CA 3PW2A 4MAKA 4ITSA 3CJ2A 3UDCA 2OHDA 1JKHA 2DCLA 3IFEA 4TQRA 2GGPB 1UEKA 1HBNA 2KG1A 4JI3J 1X7VA 2LA4A 4FF2A 5SUHA 1KVKA 4UOFA 3MOJB 2IJNA 1NLKL 4K7QA 1XNRJ 4OX9J 1HW8A 1PSDA 2EWHA 1M5VC 3MMCA 2MGZA 2HVIA 2Q66A 2RD5C 1IR0A 3FZBA 1WC5A 2CPXA 2AX0A 3DRSB 1F1BB 1QVGR 3NMRA 3JB9k 2AGQA 1WKKA 4RNNA 5E3CA 4O3RA 1HBMB 2J7UA 3AXKA 3C8YA 3RBEA 1YHQS 2CPHA 1DQ9A 2HLTA 4PKDB 2BW7A 3BBCA 2I5JB 3O5TB 2QSWA 3PXGa 2HZAA 4CLWA 3DRRB 5D77A 1ZM4A 3MUVP 4BWMA 2BA9A 4P75A 3F56A 3L9ZA 2MQOA 1HYSB 1T02A 4DF4A 1RTDA 4CYUB 1N0UA 2VODA 2W2QP 2WB4A 2H5JB 3AOCA 3UN2A 3VV2B 1KLMA 2VQFF 4NYZA 1H7XA 3DLKA 4DV5J 2CQDA 3OL6A 1XMQF 1Q95G 3H4BA 2EFOA 1JJ4A 1HI1A 5D4NA 3KXDA 2ZVIA 1JLFB 4RUHA 1RWMB 1OSCA 5G0RB 1LFPA 1YTYA 2DNYA 3FCHA 3VHQA 5KG3A 1J5EJ 2AJ0A 3HHLD 1ZH5A 2V2QA 1LW2A 3WIVA 4DSIA 1JMTA 1L3TA 1JLEB 1FVSA 4IDKA 1HHSA 5C24A 3DGPA 1K0VA 4DL5A 4LRFA 5IM0B 3DLEB 4PQUB 3AQOA 1X5TA 3UR3C 4GMKA 2RRNA 2YNGB 4ZPDA 2XB2D 1X9SA 4A8WA 1IBMJ 4CLKA 4F7VA 2F7VA 1H38A 1XTZA 3BGUA 2EW9A 2DR9A 2VDIA 4QW8A 3PM9A 3IRWP 1S6PA 3UN5A 1NPRA 4IR1A 3I56S 3SQGB 1OY6A 1N88A 3SIPB 4IH5A 1SKUB 2D69A 3MFIA 3MUTP 2HK3A 3DDNA 1F0XA 4KGMA 2ZH2A 1VRUA 4CM2A 1FESA 3RB0A 1SXLA 1YJ7A 1FD2A 1RYRA 2HQGA 1YBUA 2QX0A 3ZTSA 1FK9B 3GV7B 4ZVHA 1ZM2A 3FBFA 3N6MA 4OV1A 1E6VB 1WHWA 1WKJA 2C2MB 3K58A 1ZBTA 1C1CB 2XCPA 4KV8B 2PN6A 4FS2A 2CJBA 2E9TA 4P9SA 1WDDA 5DM6Q 1U7LA 3M6WA 1KFSA 3ZZ0A 3J7Z5 2JFDA 1M90T 1VMBA 3G82B 3MM9B 1KN6A 5J2QA 5HBMA 2KYZA 1JNZB 4LF4J 2BRLA 2CPYA 4XPCA 4LF6F 2FPHX 2BVZA 3M1VA 3J7YI 2H54B 1DLOB 3HI9A 4ZCMA 4A4JA 4OYMA 2ZH4A 4WKRA 3IG1A 3I9ZA 2VPZB 4ZLLA 3DM2B 2ZWOA 2BKOA 3HSGA 2CPZA 3BQ2A 3OFHA 3H4DA 4GVLA 4QZVB 3PACA 4NCAA 4I67A 4KH1B 2KXNB 2ZM6F 3A4TA 3N79A 3UD4P 2DJWA 4J9SA 4IG3B 1LWFB 2AJFE 1A6LA 5EWFA 3QT5A 1KLNA 1RTHB 3EICA 2OPPA 1ZPWX 4C0OC 3BDEA 4OIXA 1S97A 2WK4A 4CT8A 1LK7A 2XMTA 4JOUA 4WJBA 4K4TA 2LFVA 1IJEB 1XN9A 4AL7A 5BXIA 2YNFB 2O5DA 4ZVOB 3ZZOA 3KK1A 1R89A 1HQUB 1SH3A 4Y2MA 2PO4A 3MPWA 4K50A 5F8MA 4LBPA 3PG9A 1P9QC 1C4AA 5CYMB 4R0JA 1D9AA 3LOUA 2YKMB 4RBUA 2C2KB 2IDEA 1ZA1B 5GAHU 2HFVA 3GSDA 2E1MC 3FMWA 3Q8RB 5LM7E 5GMDA 4C8NA 4G1QA 4JI7J 2RQCA 1HBUA 5A0YA 3BH7B 1L3KA 4DQPA 3HJFA 1GXTA 2UXDJ 1U1KA 4FBTA 4NOHA 4RNHA 2RB7A 2NPFA 1G2EA 2Y0SD 3CJKB 3K8VA 1IN0A 4H4OA 3D6FB 4MYTA 2L3MA 4ZVRB 4J9QA 4LFAJ 1F3FA 1J5OB 5KG5A 2AWZA 4M94A 2V2VA 2WB1D 2BJ9A 3RZAA 3C14A 1FEHA 3W5ZA 4IRDA 1XNQJ 5KFBA 1U49A 5LMNJ 1OYDA 2HNYB 2MKKA 3MEDA 1VQ9S 4C8YA 3OJSA 2LEPA 3K5MA 5EX0A 1F5BA 1TKTA 3M8ZA 2P5VA 3PW7A 2UVUA 3BGLA 3FEZA 2XLKA 3HFZB 3HF5A 1S1VB 3OVAA 5KFYA 4I2PB 2FJVA 3NGDA 3M8SA 1C2PA 1HWIA 4LQ9A 3B82A 1NK6A 2JJ4D 4DQQA 4JI1F 3LP2A 4DG1B 1QLNA 2PA8D 2AEFA 3HVAA 4TNOA 1S48A 3H5YA 3C6UA 4OYPA 4OZ3A 4U9RA 2GO9A 3JSMB 3MD1A 3IWNC 3BO3A 4RW6A 2HNDB 1KRPA 1BY9A 3MTJA 1N5TA 2LEBA 3O8WA 5A8WB 5I3PA 2ASLA 4FF1A 2MYFA 1XC9A 2M9KA 3PHEA 2OPQA 1KNZA 3EM1A 4R0EA 4WTYA 3G86A 1SI9A 1U2FA 2CZ4A 2RU9A 2W2OP 2GVDB 4ES3A 2E1RA 5C42B 4TU8A 3BPDA 2OTLS 1MWYA 2C2RA 2EKYA 1ZOTA 2UUCF 1RISA 4DPWA 3QYYA 4CT9A 4DR5F 2YNIB 2QLWA 4Y2KA 4V19J 2AW0A 3PFEA 3W2VB 4K5RA 4ZIWA 2MDAA 5DQHA 4ZCIA 4DV1F 3BS9A 3CXCR 1HNIA 2WCXA 1JXLA 3VZIA 2OFGX 1RABB 2VG6A 2AMCB 4IG0A 3WDOA 1F2GA 3GSIA 2QSFA 3MEEB 2LMIA 3SFGA 1DURA 2GNKA 4NPOA 2KI2A 2BX6A 4OHVA 1K8AT 1MSWD 4HI1A 3M7VA 1UJ4A 2J0XA 3FEYB 5DZ6A 1FDAA 4I64A 2UV8A 5B0CA 3PKMA 2C42A 2IAJB 3M8PA 1ZS6A 4RW7B 4WZMA 1RLDA 3GV8B 4WK3A 2FHJD 4PG4A 1SIWB 5GAGI 5D4OA 2B6AA 3OBIA 1KEKA 2EC2A 3CCLS 2XMAA 3UFCX 1ZAWA 4NLVA 3RR8A 1WC4A 5KFCA 5HP1B 4MTPA 1D8ZA 3UD3P 4AL5A 3CCTA 1KTVA 4DR6F 1SQGA 2KL8A 2YNFA 2FJAB 4RL1A 3VCDA 2A1BA 5D4LA 1IR1A 4JI2F 4CP5A 4A8FA 2GS8A 2WBMA 3AAWB 4WIQA 3MR3A 1FKPA 1R43A 1HR0J 1CC8A 4L3NA 3R1LA 1WNEA 3WIUA 5A8RA 1EX8A 3O1LA 4DLEA 4JV1A 2HAIA 3CEDA 3CJSA 3M6UA 4WFZA 2AZ3A 4I69A 3ZZYA 1WORA 1U1QA 5IQQA 2ZNYA 3OXGA 4JI0F 4ZP6A 4DV4J 4IOBA 1L3SA 1LW0A 3Q8UA 1HQEA 4EYIB 2ADCA 4CWBA 2AHOB 2QT7A 2PI5A 4DDFA 1MNEA 1EHWA 4DPTA 3IO1A 4LSLB 3Q0AA 1RT5B 3IBWA 2HBRB 2HFZA 2K8GA 4NEYA 3TA0A 2E9ZA 1VI7A 2YH1A 3AQPA 1XIQA 4NZ0A 3J80U 2VQEJ 3K2YA 3HHNB 2VONA 1G3OA 3R5AA 1FTCA 2C2DA 1UWAA 2X3GA 3CJTA 5FIIA 1DAXA 1O5JA 3P45B 3CDWA 3QT6A 4YR3A 2MHNA 4DXLA 4P73A 4K0KJ 5H9FK 3I5BA 3ITHA 3FVYA 4FF3A 2FGOA 1S7IA 4TN2A 5HANA 2JNJA 1N34J 4NX9A 5E33A 5DS7A 1EP4B 1FT8A 3Q8QB 1XEZA 2CQGA 4DG1A 4F2RA 1HNXF 1KOOA 2XGQA 1LKZA 1LNQA 2ZOGA 5L1KA 3OT9A 4J9VA 3W2WB 3LQVA 4LUBA 5CZVA 1X0FA 3L7UA 1LWXA 3LP1A 3MPUB 1FJ7A 5AT1B 3D3CJ 1VHIA 4MK8A 2V68A 2MJNA 1RT6B 2OD6A 1VQYA 5E0OA 2KFNA 3O6QA 4DS4A 2KZZA 3MZIA 3WQPA 1HW9A 4HTJA 2VG7A 3FSYA 4DX5A 1FNOA 4DUYF 1MMLA 1Q4RA 1HWUA 1RTIB 1NPPA 4K2JA 1TVRB 3PX0A 2RAQA 3D54A 5ADZA 3PYDA 4ELVA 1WG4A 3KLFA 3N5FA 4NCBA 1M5HA 4FZVA 4HI2A 5KFNA 3M2RB 2K3IA 3AOAA 2BRKA 1JXEA 3V4IA 1DTTB 3C3LA 2YQ3A 3DXSX 4BBYA 4LF4F 2J0QD 3BJYA 2Y8WA 1V3ZA 5IFMA 3K5NA 3IR6B 1IBLJ 3T1HJ 2DKOB 3GCWP 4LR9A 2QL7B 3GTYX 4CLSA 5L8RC 3QIPB 4YB5A 4IFYB 2DH9A 4Y2CA 2R8HA 1S1TA 2VPYB 4X4TA 4JI5J 2CNOB 1P1TA 2YNHB 2MY8A 2D3O1 2LXFA 5J2MB 4N41A 4NXMF 4UZBA 1S1WA 2Z2MA 3G2XA 2Y3YA 3TAMB 1K44A 4BLGA 1LXNA 1RHMB 3GWCA 2NZCA 2KHDA 3KLEB 1EB0A 2B56A 1NU4A 2HHHF 2FHKA 2E9RX 3H98A 1VGYA 3ISND 2W9BA 1X4AA 4EZ9A 3EGZA 4LF8J 2NS1B 3FBEA 4TY9A 2MPUA 2N4DA 2CPDA 4JI6J 5DZ7A 4RUAA 3EGVA 3MAHA 1U2RA 2P9EA 2BKPA 4LFCF 3DOLA 3ILIA 5KFRA 2XMMA 3HX9A 3TUJC 2OTJS 4ZN1A 1XMBA 5L9XA 3KNAA 2YWHA 3HSZA 3RBXA 3DRPA 2ZJQQ 2HZCA 3OHAA 3HXMA 3DOMA 3T3FA 2E7VA 1NB7A 4DQRA 3W7BA 4XPEA 2DGVA 1PJ7A 3CO0P 1S6UA 1UL3A 2UXDF 5IT0A 2A18A 2BJ1A 5JVHQ 2NREA 2DNHA 1XWLA 1LV5A 2XBPA 2B7BB 2CJQA 3E3XA 2XYGB 4ANCA 4HT7A 1RU1A 3M8QB 2QA1A 2E5LF 3KG1A 4A47A 3BKFA 1OO0B 3KTQA 2NR0A 3D67A 1BC6A 4D3GA 1HMVA 1FRLA 1X4CA 4DR1F 4RW9B 4Y2IA 4KKOA 3Q23A 3RTVA 3JAMU 1R31A 2ZD1A 4Q8EA 2KFZA 3US5A 2IMOA 2FDNA 2WAQD 3T9ZA 1KDNA 2D7SA 2KU7A 2HYIB 2XY5A 3JXOA 4LBHA 4MKVA 2XTJP 1HNVA 2IM2A 3HHLA 4I0WA 2ZH9A 3HZEA 2EEYA 1C0UA 1CBKA 2FJWA 4YMEA 2ZWPA 2UVVA 2MXYA 4AFFA 5CA5A 1TK5A 1CPZA 2VC1A 3CPWR 2WRMA 1WC1A 3EMTA 4HVZA 2AYMA 2BZ2A 3IC1A 4N8NA 2BE2B 2B3TB 2FC9A 1WSRA 2QFJA 1CC7A 1GTHA 3DRXA 5F9LA 2RDDA 5B08A 1TR0A 3VALA 2KB2A 1GNKA 4DN9A 4YB1P 2RKIA 3ENVA 3A8JA 2QC3A 2IC3A 1TUGB 2OH2A 2VFSA 2BOAA 3QWPA 5AXLA 2OEKA 1Q81T 4OHWA 3OR1A 3NGRA 4HHHA 2RHSB 3ZZPA 1AUSL 5HVGA 1VS3A 2HFSA 3U1NA 1VQNS 1RTJA 1ZETA 4RNOA 2GFFA 1SBRA 4F4XA 2XZDB 4HDGA 4ELTA 3DGVA 1WHXA 2V67A 3HFKA 3IBCB 4G3IA 1CS4B 2VU5A 2OMOA 2ATCB 3DLGA 2LVWA 1ZTTA 4HDHA 3RB6A 1UPPA 3MM6B 3G8TA 1LEOA 4ZN3A 2ZH5A 3W8GA 4P7VA 1SJRA 2DGUA 4ILMA 1R0BG 2U2FA 4UTGA 2ZITA 1Q79A 1VLOA 2HGNA 1PG5B 4IQXA 1X9MA 2JLFA 1FNXH 1YKWA 3DYAB 3MCMA 4CNZA 1TK8A 5DO2A 4PWDA 1P27B 2POKA 4LVOP 3E8OA 2D3ZA 2XC9A 3CCUS 5C2CA 4F4KA 3MXHP 5KFEA 2DNQA 2QFIA 4O44B 4CLYA 2IM1A 3EDRB 3KJQB 3V5RA 1B0TA 2CQ4A 3MR7A 4DUZF 3HJVA 3KMQA 1T05A 2XZTB 3R97A 3H2VE 2QRRA 2PA3A 3C16B 4OX6A 1JWWA 5LSRA 2Z2ZA 4ECUA 1HD1A 2Y1LB 2PMWA 2UUTA 4JI8J 1NMEB 2YKAA 3SDEB 2WONA 4QU7A 1KSPA 4L74A 1MLAA 1JLGA 2X3DA 3NAIA 3CCMS 4Q44A 3M6XA 1EETB 4GKKF 2DXFA 3C46A 4DV6J 8AT1B 3D28A 4WXWA 4F67A 1VCTA 1GMWD 4K4WA 2LECA 2DEIA 2M0GB 3CC4S 4OJ3A 3H7HB 4O3QA 2H4WB 3LGHA 2HHWA 3BR9A 1Y3KA 2GV1A 1UEVA 1UEUA 5EWGA 4DSKA 2GJIA 1M1GA 4M5DB 3HVWA 1GFWB 2MLZA 3EZUA 2R2UA 2WOMA 3LGNA 2XMVA 4Z2XA 5ETLA 5IV4A 1U1MA 1N33F 5DGAA 2R7QA 5H9FJ 3R6GB 4NLUA 5I42B 1RHJB 2HURA 3CIMA 4OYZA 2BJ7A 4K4SA 4UOGA 4H4KA 2ASJA 1F9EB 1S10A 1MROB 8ATCB 2B43A 3RB3A 4DLGA 3J7YU 2NXJA 5D4PA 3OUYB 5KFDA 2DY9A 4UQGA 2VQEF 4FKXA 1F5AA 4RO0A 4WP3A 2WVFA 3NGUA 2ASDA 1OPZA 2PC6A 2N3LA 2WHOA 4OLPA 5KFUA 5DDRC 3BGRA 3CDEA 3D1HA 2HHVA 5K9FA 3KK3B 1ZZFA 4CNYA 1CEZA 4J9KA 3SCLE 2ZUAA 1UVNA 2GX8A 2HQ3A 3M8YA 3JQJA 3UN3A 2RQ4A 3SXLA 1VBXA 2CPJA 4DSEA 4FDFA 1HFEL 1UKUA 2JX2A 4KQZA 3UPFA 4I7FA 4DL3A 1ZM3A 2ACYA 2VH7A 1VRTB 4EMDA 3GPAA 5B0BA 5L38A 3T9NA 1H2TZ 3T1YJ 1SJFA 3ZZTA 3W3SA 1S9GA 4YFUA 4W92B 2LU1A 1T9TA 2HS4A 1SUQA 4KPYA 2J9DA 4Y65A 3IN5A 1IKYB 4RZRA 3I0SA 1RXOB 3KLIA 1JB0C 3DNCA 1T3NA 4F2SA 1S59A 1OWXA 1HI8A 1QUPA 2JLGA 3N01A 4M5IA 2XQCA 3A13A 1VOMA 4U67Q 3AJ2A 4LMZA 1XK8A 4EEYA 1KP6A 1K73T 3KJFB 2FIUA 5C25B 4NYOA 4JB8B 2O1PA 2EK1A 5K8OA 2O3DA 5LL6d 1HD0A 2RHQB 1RT2B 2AJ2A 2KO1A 2RVJA 3MCNA 2VKZG 3TUZC 2BANA 4OI4A 4C11A 1D0EA 4USWA 3LAKA 4XO0A 3AHPA 4PXEA 3BSAA 3V81B 2RSQA 2CQ1A 3MM6A 1VQ6S 1HBOB 2AIRB 5M2UA 2OELA 2YX4A 5HN0A 5A76A 3OSPA 3CF5Q 1CSJA 3EWGA 5FJ4A 4ZVEA 1NCLA 1WI6A 5A8KB 2CDRB 1C0TB 3BYRA 1U2CA 2KG0A 3MEGA 4DU8A 4I56A 1S6QB 1YG0A 2MKYA 3TZWA 1XERA 1BQNB 3IA0A 2FHJA 5EDWA 4LF5F 3LH2S 2ZBCA 3R5CA 3K59A 2VOOA 4LF8F 4GKJF 1PAEX 4KR0B 2MSSA 1YBTA 3HVTB 2GHVC 4NRTA 4RUBA 1MMNA 1KR4A 1OPIA 3VGVA 2MQNA 4ZOSA 3HVRA 3I32A 2Z8QA 2HVZA 2JHEA 2IY5B 5D3GB 1RA6A 2RF2B 3GG0A 1FI4A 4Z7CA 2MKJA 4FBUA 1P1LA 1I5OB 2HW3A 4KE5A 1V3RA 2COLA 4DV7F 1GK8A 2DH8A 1VJQA 3I0RA 2X1GA 3Q86A 4K4VA 4LF7F 1VISA 3UO0A 2ZEJA 2IA6A 5IV3A 5T14A 2L9DA 2B51A 3PJ9A 4F0KA 4EGLA 1N32J 3TI0A 1IJFB 2GQ2A 4BS2A 3D0HE 3FDSA 2F40A 4OZLA 2ZH8A 4YDXA 4DFMA 4C3LA 1IKVA 2L9NA 1PCAA 2KJWA 5DDQC 3NGSA 4M5DA 5I4MA 4LF9J 1UJ6A 4DR2F 5KOXA 4UY85 3VR1A 3TZZA 4AD6A 1V5VA 4ECQA 1K1SA 3BREA 3GQCA 4ED2A 3EVWA 3M9MB 2VD3A 2W8LA 1T9VA 1HNZF 1W7WA 4OX7A 1SKWA 3M30B 4CTAA 5KFZA 4P2SA 4B3RF 5KFIA 1UA1A 4ZPCA 3KG4A 2GMHA 1FJGF 4MMOA 5F8HA 3M4XA 1Q0NA 1JLAA 4L72B 1WUUA 2FYXA 3MHYA 1A7GE 1RHQB 4S0MA 4Q7AA 1VBZA 4NA3A 4QYZJ 5KFGA 2RDJA 3TP2A 3TVZA 4HYKA 4DMZA 2MB0B 3SCIE 3RRGA 5K20B 3OUYA 4UQTA 4FKYA 3MECB 3MMBA 2PEHA 3DMJB 3LALA 4PEOA 2R8KA 2F8HA 4KHMA 4RKUC 5KFWA 3RGIA 1D3WA 4M5JA 5BR8J 1MWQA 2W2PP 5HMZA 1JX4A 4NCGB 1WG5A 2YKNB 1RT7B 1G4CA 2V50A 5KT3A 1M1HA 1R7IA 2HHQA 4D3HA 1XR7A 3QPIA 5GAGU 3UWTA 1FFGB 1YRXA 4OZNA 3SFUA 3R3TA 2G9OA 2M52A 3NP5A 3MTKA 1NEEA 1T95A 1W25A 2XCAA 3CD5A 3TEGA 1PYSB 1V3SA 3W8PA 5RUBA 5J1EB 3KLVA 1UFWA 2VG5B 2KFYA 1U24A 3S8SA 2ZHBA 3L7OA 3NNHA 3DKDA 2JEIA 1YSJA 3PVXA 2AX1A 3R27A 3EPIA 2R2SA 3G6ES 3W63A 2K7KA 4AT1B 2VICA 2MQQA 4CDIA 2FQQB 5E41A 1BUXA 1AB8A 2MKIA 3P3DA 4UW2A 4HACA 2J8AA 4X66F 3VGTA 4TXSA 2A10A 3Q83A 4YR0A 3DC2A 4PUOB 1X5SA 1YJTA 1HNWJ 1Q1KA 3BDPA 1VBKA 1I6JA 2RS8A 5B0DA 3DLLQ 1DTQB 3QFWA 5KFFA 1IUJA 5KFPA 3JYTB 3HDSA 2HBYB 1REVA 2JOQA 1YQHA 3G6XA 2ZKUA 2VFTA 3PNIA 3NBPA 2JL9A 3MPYA 2WTFA 3SV3A 2QMXA 2RMLA 1NJXA 3LA0A 2EC0A 3MMJA 5KG7A 2APOA 3HCXA 1VQMS 2W1BA 4JYAF 5L1LA 1BWEA 4NYPA 2BV3A 3PX6A 4I6AA 3SSQA 3FRZA 3UR0A 5D15A 4FYDA 1IKWA 1E6YB 4RPFA 1MG7A 3Q2SC 2G2YA 5A8KA 3EXCX 1FRIA 1NKCA 1TL1B 2JVOA 2NXUA 1ZM9A 5B0AA 2AKWB 2C2EA 3JS9A 3J81U 4BCAA 4ERDA 4A8MP 3ZNUA 5FLXY 3PHTA 1NK9A 5BYRA 3BZQA 2HVDA 1SIZA 2RH3A 5E7OB 4YHHJ 3VQTA 2FLPA 1YJRA 2XLIA 4ZVQB 5M2PA 4ED3A 2YXLA 3FUYA 4O3OA 3OTOJ 4KO0A 3OW2R 2XI3A 4KRWA 4MH8A 4PYAA 2F9JA 4DV0J 4OYAA 5KT2A 4QJVA 2CNKB 2OEMA 1RTZA 2VFUA 4CLUA 2PFDA 5LMUF 2LXIA 4JV5J 1IKXB 3CCJS 1HPZB 5F41A 1JLQB 1WEYA 1WJ9A 4YP3A 4USMA 1U1NA 1S12A 3L3CA 4LFBF 1S49A 2VDHA 3D4JA 3FZ2A 4ZVSB 3H40A 1O0PA 2G0CA 2VOPA 4HH1A 2WVBA 2BEFA 2CUYA 3UNYA 1JXVA 4DR4F 3THPA 1KOHA 4B9TA 4M1KA
chains in the Genus database with same CATH topology
2IRUA 3V6DB 2R7VA 4DV1F 1FHTA 3KHGA 1GX6A 2OPRA 1KQSR 3BS9A 1MW7A 3CXCR 1HNIA 2WCXA 1XNQF 1JXLA 4HTIA 4HH0A 3O3LA 3RAXA 3ONQA 3VZIA 1S77D 2OFGX 5LMNF 1QVFR 2CQCA 2VG6A 3VAKA 3MM5A 3HKWA 5T7LB 3MWBA 4IG0A 2RDIA 4OL8A 1OSDA 3WDOA 2LDIA 2JVRA 3BGRB 1F2GA 5KT6A 4ZPTR 4AE5A 2QSFA 2RJZA 2KXHA 4FNHA 7FD1A 1TV6B 3MEEB 1S4FA 4H4MA 2YTCA 3DYAA 2LMIA 1JLCA 3SFGA 4MK7A 2CRLA 1DURA 3H5UA 2ZHOA 3RW7A 4H54A 2GNKA 3U7JA 5F9NA 2YWKA 1U26A 4BHQA 4G1IA 4NPOA 4C3KA 2DNLA 4QWEA 2KI2A 3I5CA 4DL6A 4KB7A 4OHVA 4RNFA 2CIMA 4PPZA 1K8AT 1MSWD 5DLGA 3MMAA 4HI1A 1AUDA 2ABYA 4I7FB 1MU2A 4I2QA 1ZYQA 1VQOS 1ZAVA 2GHWA 1UJ4A 2LXUA 2B9WA 5CYJA 4DL0C 1JKHB 4QWBA 4O44A 2CVEA 1WF2A 1QE1B 2GQCA 2J0XA 1R0AA 2QA2A 4N47A 3FEYB 3UW1A 1AXQA 1FDAA 1HBNB 4HLBA 4I64A 2UV8A 3NS5A 4BC9A 1FF2A 1JJHA 5B0CA 2FLLA 3PKMA 4PRFA 4X4NA 2FJXA 2C42A 1NK8A 2IAJB 4YB6A 1KTQA 5FDLA 1S9FA 2XSFA 3M8PA 4RW7B 2DR8A 4WZMA 1X4BA 3PY8A 5F3ZA 5DG7A 3F44A 4ZVFA 3DMJA 4ID8A 4WK3A 3JAMY 3GV8B 1VC5A 2FVQA 1S9GB 1Q78A 4WFYA 1PC5A 3NGKA 2DHXA 1WD6A 1UA0A 1APSA 2CDQA 1U47A 2FHJD 2YY3A 3OTBA 4PG4A 1SIWB 2E7WA 2PMHA 3AA8A 5HI7A 1AROP 4FF4A 5GAGI 5D4OA 1SUQB 5J2NA 2B6AA 1NRKA 2BW2A 1GQEA 4NLDA 2ZVSA 3VAFA 4WF9Q 3OBIA 4KC5A 1KEKA 4NA2A 3TARA 1TP7A 4N5SA 1DARA 3MMCB 3CCLS 3QJJA 2AU0A 1T03A 2MGZB 3I0SB 5IWAF 3KLIB 2W7AA 3BO2A 3SZ2A 3UFCX 1WHVA 1ZAWA 3T6BA 3C6TB 4NLVA 4ZP9A 3RR8A 1M5KC 2HWTA 2M2BA 1FJEB 2CQ3A 3GE9A 3V4MA 5D78A 3SDEA 4MKBA 2L08A 5H9EJ 2B5JA 3D5MA 1U4BA 4A8OA 5LT5A 2JRSA 2ZOFA 3SYZA 5KFCA 5HP1B 4MTPA 1D8ZA 2B7CB 3GYXB 3M32A 3MM8A 4B3MF 2IRYA 3UD3P 4AL5A 3CCTA 1UVLA 4ZMMA 1KTVA 1Q7LB 3QAEA 5KFOA 3QLHA 4DR6F 4DV0F 2ZH3A 2NUHA 5DG8A 1EETA 2YNFA 2FJAB 4OHZA 1B0VA 1Y0HA 3VAJA 3VCDA 1Q86T 3VQSA 2A1BA 4BWJA 5D4LA 4OMFG 4WYLA 1QUVA 2XHWA 4JI2F 1TAUA 4A8FA 3Q24A 3DLHA 1JIHA 3A8EA 5EUHA 3H8YA 2WBMA 2M7SA 4KBIA 3AAWB 2I2YA