2YNGB

Hiv-1 reverse transcriptase in complex with inhibitor gsk560
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
424
structure length
411
Chain Sequence
b'IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Rational Design of Potent Non-Nucleoside Inhibitors of HIV-1 Reverse Transcriptase.
pubmed doi rcsb
source organism Hiv-1 m\:b_hxb2r
molecule tags Hydrolase
total genus 114
structure length 411
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2yngB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yngB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yngB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yngB03
4H4OA 4LSNA 4ECQA 1HQUA 1IKWB 3C6UB 5KFFA 2W9CA 4ECXA 1TQLA 4QWCA 2V4RA 5KFWA 1HQUB 5C25A 3GIJA 2HWIA 2BE2B 4RW7B 4KBIA 2V4QA 4MK9A 3QZ8A 1KLMA 3M8QA 5C25B 4NLRA 4NYZA 1VRTA 3OHBA 3DM2A 1WNEA 1J5OB 4TN2A 4FS2A 3T5KA 3UQSA 3FQLA 1S9FA 2XGQA 3KMSA 2ATLA 1VRTB 4RUCA 4F4WA 3MEDA 3GIIA 4NLQA 4J9LA 4MIBA 4DL5A 4H54A 1Z4UA 1IKVA 3MFIA 3LP1B 3MEDB 5HLFB 2D3ZA 1QAJA 4NLXA 2OPRA 1HNVB 1S49A 3SI8A 1IKVB 1TVRB 2HNYA 4ZMMA 4RW6B 4QW9A 2VG7A 1NNDA 4NLVA 2ASJA 2OPRB 1D0EA 2AX1A 5KG3A 4NLUA 2HNYB 2WTFA 2FVQA 2AX0A 1DLOA 5DLGA 3CJ5A 4J9MA 2OH2A 3BQ0A 4KSEB 3DLKA 2QE5A 5KFUA 4DG1A 1RTJA 2BRKA 5KG6A 4GC6A 5KG5A 4EO8A 4ECSA 4K4SA 4QWDA 4KB7A 3RAXA 1TKZA 4DG1B 4PQUA 3V6DA 1JLBA 1RTIA 4RW8B 4ED7A 1FK9A 3LAKA 3LP2B 4TLRA 5C24A 4PQUB 2UUWA 3V6DB 1JLBB 2C28A 4NLWA 1FK9B 2YKNA 3KNAA 5C24B 3Q8PB 4O44A 3PR4A 4EEYA 3DRRA 3KLIA 4IG0A 2AGPA 3PW7A 5J2NA 5KFAA 2W7OA 2YKNB 2JLEA 4ECZA 4O44B 1LW0A 3SFUA 1S48A 1JKHA 2GIQA 1S97A 3FFIA 1LWCA 5J2NB 1TL3B 1RAJA 4ICLA 3T19A 1LW0B 3KHRA 4ZP6A 3KHGA 5DG9A 3FFIB 1C0TA 2V9WA 4JV0A 4ICLB 1N48A 2YKMA 1BQNA 4I2QA 3GILA 4QWEA 1C0TB 2ASDA 3I0RB 3KMQA 5F8JA 5J1EB 1C0UA 1BQNB 2YKMB 4I2QB 1S1XA 5KG4A 1QE1B 3D5MA 1C1BB 1RT5A 5EWFA 4DL6A 4NLDA 1C0UB 1JLCA 3DOLA 3E51A 1S1XB 4ZVFA 4IKAA 4J9KA 3ITHA 1RT5B 3MEGB 4DL2A 1SH3A 1JLCB 2OPSB 3DOLB 3BGRA 3MECA 1MU2B 3V81A 4KHRA 5EWGA 3OSNA 4FBTA 3PJWA 3OHAA 3H5SA 4OL8A 4KKOA 3FSIA 3BJYA 3BGRB 4Q0BA 3KLVA 1TV6A 4J9PA 3KLEA 4IRKA 4WZMA 2HMIA 4ECRA 5F9LA 1JLGA 1IKXA 4KKOB 1S6QA 4Q0BB 1TV6B 1S1UA 1HNIA 1OS5A 4NLTA 4JV2A 4WFXA 1JLGB 4TQSA 2BRLA 2YNHA 1T3NA 1S6QB 3HVTA 4H4MA 3RB4A 4PWDA 2R8KA 1S1UB 3MR5A 4RNMA 1HNIB 3V6JA 2R8JA 1RYRA 3HVTB 2FJWA 4YMEA 1HYSB 4PWDB 5KFXA 1RT3A 3MFHA 4O4RA 2YNIA 2QV6A 3NKYA 4Y2AA 1C2PA 2HAIA 4I7FB 4NRUA 1T94A 3NMAA 1RT3B 3M9MB 4ECWA 2YNIB 1ZTTA 4ZPDA 4O3QA 2DPJA 4O4GB 3I5AA 3CVKA 5KFVA 1ZETA 3ISNC 5KFNA 2B5JA 1SV5B 4NLSA 2O5DA 5KT4A 4ZP9A 1KHVA 5EDWA 2B5JB 2B6AB 2ZKUA 5KG1A 4TXSA 3IRXB 4WXWA 2C2DA 2XCPA 4Q8EA 2AWZA 3DRSB 1GX5A 1TP7A 4YQWA 1LWEA 4MH8A 4ZHRB 4DL3A 4MK8A 2IM3A 5KT6A 4PUOA 4NLGA 2XWYA 1REVA 2ILYA 4WZQA 1LWEB 3RB0A 4K4ZA 3MEEA 1RT4A 5L1KA 4ECTA 1BQMA 5KFBA 2W7PA 1S10A 3T5LA 4H4OB 4LSNB 1RTDA 2BR0A 4R5PA 3FDSA 2RF2A 3MEEB 1BQMB 3HHKA 2W9CB 5DG7A 5C42A 3I5BA 5DQIA 1IKYA 4R5PB 4F50A 2RF2B 4RUAA 4ED3A 3PW2A 5C42B 1N4LA 1HQEA 1KLMB 1IKYB 3M8QB 3OL6A 2AGOA 1MMLA 3DI6A 3DM2B 4URGA 3FRZA 2RKIA 1HQEB 5F9NA 5KFMA 2ZD1A 3BSNA 2J6TA 1RYSA 5KT7A 3H5UA 4MK7A 2DPIA 1SH2A 3GQCA 4RW9A 4ED6A 1GX6A 3BSOA 4K4WA 3M8PA 3Q8QB 3PW4A 1I6JA 1HARA 2YNGA 2VG7B 3CJ4A 4RW9B 5KFLA 4I2PA 2UVRA 1S6PA 3KHLA 3IGVA 3DRPA 2FVSA 3MR6A 5KT2A 1DLOB 2YNGB 1N6QA 4Q45A 4I2PB 4XPEA 4IQXA 1S6PB 3DLKB 1RTJB 1N6QB 4KE5A 5KT5A 1TL1A 3KK1A 4R0EA 4Q8FA 4WFYA 1TKZB 1RTIB 1TL1B 5J2PA 3KK1B 2HNDA 4URSA 3H4DA 3BQ2A 1DTTA 3JYTA 5L1JA 5J2PB 2XI3A 4Q43A 2W8LA 2IM2A 4ED0A 3KHHA 2W8KA 1XR5A 3MTKA 3DRRB 3KLIB 4IG0B 5I42A 3JYTB 2B43A 3LAMA 4URQU 5T14A 4J9RA 2GIRA 4O3PA 1T03A 4IFYA 3I5CA 3C6TA 4KAIA 4YR3A 4FS1A 1JKHB 4ZPAA 1LWCB 4IOBA 4LSLA 3N6LA 3G6XA 1T03B 1FKPA 2GC8A 3IS9A 4RW4A 3M9NB 2XGPA 4EBDA 4O3RA 3TVKA 3OLAA 5J2MA 4LSLB 1U09A 2JC1A 1FKPB 2VA3A 3IS9B 4IR9A 2UUTA 3DLEA 4TY8A 2FVRA 5J2MB 4Q44A 3E01A 4MKAA 3CIZA 3DDKA 3PZPA 3RBDA 1JLFA 4IR1A 2E9TA 3CJ2A 5F8GA 3E01B 1LWFA 3H98A 4YR2A 1JLFB 5CYMA 3G6YA 2EC0A 1N56A 3ITHB 2D7SA 2WOMA 4R8UA 3NGDA 1LWFB 4WXOA 1RT1A 1RT2A 4WYWA 3KLFA 3MECB 3V81B 2J6SA 1LW2A 3OL7A 4O3NA 2WOMB 1XR6A 4R8UB 4WE1A 3QYYA 1RT1B 1RT2B 4F4ZA 3KLFB 2XCAA 3KLEB 4XO0A 1YVFA 2HMIB 4DEZA 3GIMA 1IKXB 4WE1B 1NHUA 2J6UA 5J2QA 3G86A 3RB3A 5KFQA 4QW8A 3KK2A 4GC7A 2YNHB 1S1VA 4H4MB 1C1CA 2HNZA 3VQSA 4F4YA 3V4IA 3T1AA 5DGAA 2VA2A 4MKBA 5HROA 3KK3A 3D28A 2BQRA 4WFZA 4HYKA 4B3OA 3KK2B 4IH6A 1S1VB 1C1CB 2HNZB 2WONA 4ZPCA 3V4IB 3PW5A 4FBUA 1FKOA 2I5JA 4EBEA 2RDJA 3ICLA 4X2BA 2C2RA 4M94A 4B3OB 2WB4A 1DTQA 2WONB 1RT7A 3DOKA 2ILZA 3QIPA 1FKOB 2I5JB 1JLQA 4ID5A 2IM1A 2VG6A 1DTQB 5L1IA 3T5HA 4J9OA 5KFHA 4K4VA 3H59A 2VG6B 3HKWA 4ZP7A 3MF5A 4NZ0A 2JEFA 1EETA 4RNHA 5KFDA 3V6KA 2R8GA 1TKTA 5KFYA 4ZP8A 3LALA 2XC9A 2AGQA 2JEIA 1ZTWA 4MIAA 1EETB 5KFCA 4NLOA 2OPPA 3QO9A 3CDWA 2BQ3A 4KO0A 2HWHA 3OLBA 3NBPA 1N5YA 3G6VA 2FJXA 5KFPA 4MFBA 4PUOB 4KO0B 1REVB 2JC0A 1N5YB 1NHVA 3CO9A 2W9AA 4DL4A 4LQ9A 4MFBB 1RT4B 3EPIA 1XR7A 3QIDA 4IG3A 3ISND 1RTDB 5JXSA 3GIKA 4ECYA 2JEJA 3BSCA 2IM0A 1T05A 4G1QA 3CDEA 1S4FA 5KG7A 2VG5A 5KG0A 1T05B 4G1QB 5KG2A 2IAJA 3UPFA 3GV5B 5KFRA 2CKWA 2UVWA 4NRTA 4TY9A 2VG5B 2IBKA 5KFTA 3DI6B 2F8EX 2C2EA 4YP3A 3QLHA 2IAJB 2RKIB 4NLPA 1RA6A 4K50A 5HP1A 2BE2A 2ZD1B 4RW7A 4K4TA 3QLHB 3IGNA 1SUQA 1J5OA 1HPZA 5F8IA 3DLGA 5HP1B 2CJQA 4RNFA 3DMJA 2R8HA 1SUQB 2WRMA 3M8PB 1HPZB 5C5JA 3DLGB 4ED2A 4RNNA 3DMJB 1RT6A 2W9BA 5KFZA 5EUHA 3LP1A 5HLFA 4KHMA 4K4XA 3HVAA 3DRPB 3N6NA 1HNVA 1RT6B 1TVRA 2W9BB 4EYHB 4RW6A 1IM4A 4ZVHA 1K1QA 1JLEA 5D3GA 3BSAA 4RU9A 3BQ1A 5L9XA 3IG1A 3H4BA 3NL0A 5DQHA 2I1RA 3NAIA 1S9GA 2AQ4A 1JLEB 5D3GB 1R0AA 4M95A 3HVWA 1D1UA 3CJ0A 3IG1B 2FVPA 3CJ3A 4IH5A 3KLGA 2HNDB 1S9GB 5FDLA 3RBEA 2BQUA 5F8NA 4WYLA 3QGGA 2IMWP 1DTTB 1R0AB 3QGIA 1TKXA 5F8LA 3V6HA 3JSMA 3KLGB 3KJVA 4KV8A 5FDLB 4LQ3A 4RW8A 3N6MA 4J9QA 3H2LA 5I42B 4TQRA 3LP2A 3Q8RB 4ECUA 1TKXB 1QAIA 4ED8A 3JSMB 3BR9A 2UVVA 4O3SA 3KJVB 4KV8B 5KFGA 4IFYB 3C6TB 2BANA 3CDUA 3TAMA 2ALZA 1W25A 2RDIA 3BREA 5KFSA 5KFIA 2BANB 4RW4B 1KHWA 5KFKA 5F8HA 1S0OA 3TAMB 4NCGA 4F4XA 2R2RA 2WK4A 4QPXA 3EPGA 2FLLA 1TL3A 2FLNA 3DLEB 4NCGB 1QUVA 4TY8B 4TYAA 4ZVEA 2C22A 1S0NA 2YNFA 3OL8A 2UVUA 2R2UA 3EZUA 5KT3A 4J9NA 3UDLA 4KFBA 4JV1A 2YNFB 2R2TA 3OL9A 3I0SA 5CYMB 3I0RA 4Y3CA 1EP4A 5J1EA 5I3UA 1CSJA 3FQKA 4KFBB 3LP0A 1QE1A 4HKQA 1RDRA 1C1BA 1S1TA 3I0SB 3NAHA 3GYNA 1EP4B 5I3UB 4U6PA 1LW2B 3MR3A 3UR0A 5F8MA 5KFEA 1UWBA 3LP0B 3H40A 4IFVA 5CYQA 1S1TB 3MEGA 3MR2A 4EYIB 3KOAA 5DQGA 2IJNA 5EWEA 3QZ7A 2OPSA 1SH0A 1MU2A 1UWBB 4IFVB 5CYQB 1K1SA 5J2QB 3OSPA 3PVXA 2AU0A 3KLHA 1JLAA 3SFGA 1S1WA 4RZRA 2IA6A 3IN5A 2WHOA 3KLHB 1JLAB 3PJXA 1S1WB 5HROB 3KK3B 3M9OB 4IRDA 3CWJA 5DLFA 4Y34A 4YR0A 3PW0A 2FVCA 4DL7A 4ZVGA 4EO6A 1RT7B 3DOKB 3QIPB 3GV8B 3H5XA 1JLQB 3RB6A 1HYSA 4ID5B 4ZPBA 2E9RX 1RA7A 4JUZA 5DG8A 3PR5B 5JUMA 4ECVA 5KFJA 4I7FA 4Y2CA 5L1LA 3RAQA 4J9SA 1HMVA 4XPCA 2JEGA 3PHEA 2FLPA 4EBCA 4O4GA 3LANA 1TKTB 1S0MA 3QGHA 1JIHA 1VRUA 1HMVB 2D41A 4NLYA 4TYBA 2E9ZA 4IDKA 1SV5A 3H5YA 2OPPB 2OPQA 4U7CA 2IJFA 3QO9B 4RNOA 1VRUB 3NBPB 4ED1A 4IDKB 2B6AA 5K14A 2OPQB 2V0NA 2ZE2A 1JX4A 3IRXA 5KFOA 2IC3A 1S9EA 4QWBA 4K4YA 4K4UA 2XI2A 4QWAA 4O3OA 3GV7B 2WCXA 3DRSA 5K14B 1RTHA 4ZHRA 2ZE2B 3T5JA 4IG3B 2IC3B 2ASLA 5HBMA 1S9EB 4IH7A 5DGBA 3Q8SB 2R8IA 2FJVA 3TQ1A 1JXLA 4IRCA 3DYAA 4G3IA 1RTHB 1IKWA 3C6UA 5HBMB 2D3UA 2R2SA 3DYAB
chains in the Genus database with same CATH superfamily
1MMNA 2KJWA 2JVRA 1TQLA 2CG4A 3MMAA 3BKUA 1NH7A 4KBIA 3QATA 1U1KA 1HNWJ 3T5KA 5DJBA 4F4WA 3DOMA 4OJ1A 1D8ZA 5HLFB 4G6VB 4JI7F 2B9EA 3VV2B 4WIIA 3LF0A 1XEZA 1VFJA 1MW7A 5KAKA 4LRBA 4L3KA 4PQUA 5DM7Q 1NKEA 4ID8A 3I32A 3H42A 5C24B 1WKKA 5J2NA 4DS5A 3TVZA 5HN0A 4ZP6A 3BBCA 3KHGA 2E5IA 5EHHA 1Y5IB 5SUHA 5KTQA 3I0RB 4NLDA 3MEGB 3IFEA 3BGRA 1MU2B 4FBTA 3HHDA 2KT5A 1R8BA 4DR2F 2DR9A 3CXCR 4Q0BA 1IKXA 1GMUA 2MZ1A 4JV2A 1FD2A 4TQSA 2VDHA 4TU9A 4DZ6A 1RT3A 1HR0F 3UW1A 1TMJA 5K8OA 2CNOB 1UZDA 4X62J 4DR6J 1KQKA 2BYCA 3T9ZA 4OHZA 2W24A 4LF8J 4WXWA 2QFJA 1LWEB 2QFIA 1H2VZ 1R8CA 3T5LA 3LGNA 3MUTP 1JMTA 2QLJB 2EWHA 4ED3A 3CDAA 1NBEB 3OL6A 2MZJA 1B3TA 1HQEB 4OYZA 4ITSA 5F9NA 4BS2A 2ZHOA 1NB7A 3EGWB 2GS8A 2HGLA 4DHVA 1I6JA 5F0WA 4QIWD 3K0JA 3HM9A 5LM7E 5KT2A 4IQXA 5JJBA 1RTJB 2DNZA 3S6EA 3EMTA 1TKZB 1KNZA 2YXLA 3UNYA 4KR0B 4PXBA 2YWKA 2DHGA 2EFGA 2W8KA 2DNRA 3DRRB 2MTLA 1H0HB 4HR2A 3HKZD 4DCJB 1UW9A 3W2WA 1UKUA 2AEMA 4LSLB 2V67A 2V34A 5K8NA 1N5VA 2E9TA 3I56S 3HHLA 2N4DA 4OX8A 2R42A 3CJKA 2BKOA 4H4MB 3VQSA 5AE1A 3V4IA 2VA2A 4HYKA 3KK2B 3W7BA 2QEXS 2CDQA 4X2BA 2WONB 4C8LA 3RZAA 3GSDA 1VBZA 5BJRA 3HKWA 4L76A 2OGUA 1VQKS 2JEFA 2CYYA 2VDIA 3MHYA 3EXCX 2GGPA 2HWHA 3M1VB 3OLBA 1PILA 1N5YA 3EPIA 2B56A 2ACMA 4DF4A 1NRKA 3Q89A 1YIJS 5KG0A 3IBFB 2F8EX 3NWRA 3G9CA 3RRGA 2BJ1A 4USUA 1IM4A 2F63A 3OW2R 3BSAA 2KFZA 1UEUA 1JLEB 2AQ4A 1X4AA 3PFEA 2IMWP 3KJVB 2GO8A 5KFGA 2H5JB 2LEPA 4OMFG 4PAAA 2BANB 1VYAA 1TL3A 3DLEB 4NCGB 4TY8B 4ZVEA 4ZLNA 2PD1A 1EB0A 3US5A 1NJZA 3ZXWA 2R2TA 4KGVB 1FDAA 3N01A 3MTJA 5JVGQ 1UWBA 5CYQA 2FQQB 2OPSA 3HF5A 2ACYA 4QJVA 5HAOA 2AU0A 5E33A 3KLHB 3HXMA 2UUCF 3ENQA 1FEEA 2ZH7A 2XMKA 2UU9J 2C2MB 1RT7B 1TUVA 3GV8B 3T41A 1XNQF 4ZPBA 1SJ4P 2X1GA 4RWWA 3P5TL 4Y2CA 5FLXU 5L1LA 2NLWA 4EBCA 4PWWA 1GTEA 4A8KA 3M2UA 4HT5A 4J9VA 2ZE2A 1U0HA 3ILLA 1AYEA 1FRKA 4K4YA 2XI2A 4HI1A 1RTHA 2NXUA 1U1LA 3AQOA 1NMEB 5K8MA 4ECQA 2R4FA 1OMSA 4R25A 4C8MA 3JQKA 4RBTA 2N3OA 1Q78A 2JRSA 3DM2A 1U47A 1QLNA 3OXFA 5IXUA 3TA1A 3AD9C 2ROGA 1HNVB 3MM8A 2DNGA 1D0EA 5IC6B 4C98A 3KXDA 3BQ0A 5GAHI 4NCAA 2H5EA 4EEYA 3KLIA 2KXHA 2GIQA 1X9WA 4B3RJ 5IT9Y 2HWTA 1RAJA 4WK1A 4YDDB 3OVAA 4ICLB 4DV1F 1RU2A 1C0TB 4ZVPB 2MKCA 1KRPA 1A6LA 4IKAA 3EVWA 2J9DA 2NSBA 2MQOA 4U9RA 4ECRA 2OTLS 1JLGA 2XLJA 1YJVA 3AB4B 4NE9C 3MR5A 4O23A 2N4CA 2Z2ZA 4USHA 4DPUA 3M9MB 3W63A 2DPJA 3GJTB 3K2YA 5KT4A 2J8AA 4TXSA 4FPRA 3UVJA 3FSXA 1DZ5A 2IM3A 4NLGA 3MEEA 5L1KA 1SVDA 2RF2A 2VD3A 2N3LA 2PMWA 3KKFA 2H3EB 1U02A 3CCES 3W65A 3MCNA 4U8YA 3GYGA 1DBDA 2MY8A 2VFSA 3JSRA 2CJ9A 2HS0A 3WQPA 2LQ5A 1HARA 5E3RA 3CEDA 4FDFA 4I2PB 5HQ8A 4CO5A 4R0EA 1LEOA 2KTQA 1R43A 1NEEA 2SXLA 1HBOA 2E1MC 3MD3A 1UA0A 3GTYX 4J9RA 4JI7J 3C6TA 1V3SA 4WCEQ 4YR3A 2M8DB 3BGOP 2FZGB 2WSEC 4O3RA 1VISA 3IA0A 1UW4A 4IO9Q 3PZPA 1DFDA 2VPXB 5CYMA 3D0GE 2GQQA 3FUYA 2YQ3A 3QYYA 1RT2B 3MURP 4RWXA 4C0OC 1F5AA 4IH6A 2HNZB 1FKOA 2I5JA 3MMBA 4WP9A 2CAJA 1N0UA 4LFBF 2CQGA 4DR2J 2MZQA 2CQ2A 2PMHA 1X5OA 2D3O1 4GVBA 3GFYA 2FZCB 4ZP8A 1IUJA 3LTOA 2HHUA 3TUIC 3BS9A 1HR0J 2AJ1A 5IM0A 2L48A 3LA0A 3ZC4A 2CKWA 2GW8A 3OVSA 3IR7B 2IAJB 1FFSB 3QLHB 5F8IA 1CJUB 1B4SA 3DLGB 4DFKA 2PDAA 5HLFA 1HWLA 1S6OA 3ETMA 1KOOA 3EVOA 2XS2A 3NL0A 1JK9B 2X1BA 1DJ0A 1S9GB 3Q23A 3SYZA 2DNOA 5I42B 4DUZF 4XK8C 3L7OA 4AL7A 1FKAF 2HKEA 1B70B 1N36F 2ZNYA 2RMLA 1JB0C 4BWJA 1U24A 2YKPA 3I0RA 3FQKA 2LP4A 4U6PA 3BF4A 3MEGA 2ZC4A 4FYDA 2MQNA 1MU2A 2MKKA 3VGUA 1FWLA 3CE8A 4JI5F 4ETXA 1T02A 3PJXA 2FHJA 3CWJA 4PRFA 4YR0A 1HWIA 4EZ9A 1IJEB 4ID5B 5L39A 5HANA 3E2EA 5KFJA 2CJYB 3X3UA 4UZCA 1HMVB 2E9ZA 3P4UB 1YHQS 1QSSA 1FDNA 2Y1RI 4IQMA 3CCMS 3GV7B 4ELUA 4FF2A 4G3IA 1JNRB 1HQUA 1IKWB 3NEKA 1SKWA 5KFFA 5C25A 1ZM4A 1K44A 2HRYA 2HWIA 4MK9A 3QZ8A 4X4UA 3MEDA 1Z4UA 5K5MA 1UFWA 1SC3B 2NS1B 2BV3A 4F0MA 4QOTA 4M8LA 2Z4PA 3CB4A 1FJCA 1RTJA 3RAXA 1TKZA 4RR5A 2VJVA 3OJUA 1CBKA 4HVZA 3V6DB 2MJNA 3PR4A 3DRRA 2HRTA 3CMES 4DV3J 1ZAWA 2HFUA 2HSEB 1OQ3A 4XDDA 4AQYF 1U1PA 3PRVA 3GU0A 3W2VA 4QWEA 1S1XA 3M6XA 3D5MA 2HPUA 2B9XA 3EX7B 3C19A 3M6WA 3E51A 1SPBP 3EDQB 2V8PA 3OFGA 3Q2TC 2OTJS 1XMQF 2E5GA 1RHJB 3HSJA 4KRWA 2EXUA 2HQFA 4UUXA 2W7AA 3TUPA 2YY3A 4H4MA 1T3NA 3D0IE 4UOGA 3LH2S 5LXYA 4Y2AA 1C2PA 4MMOA 2D74B 3ISZA 1EKSA 2Y3YA 4N77A 2CWXA 1ELOA 4OFZA 4DPXA 4ZP9A 2UUCJ 2XY6A 1N34F 3TRGA 2AWZA 1GX5A 1IM6A 3M1VA 3PTWA 2DNYA 4K4ZA 1R6VA 5DG7A 2Y9HA 4OHVA 1X4GA 4QIEA 1YITS 4R5PB 3PW2A 5C42B 4PABA 3ILJA 4WK3A 2NYIA 2KJVA 4W90B 4MK7A 1VIXA 3BSOA 2ERRA 3BKFA 3PW4A 1HQ2A 2CVEA 1BXNA 3K5NA 3CCQS 2Q6BA 4DL0C 3IR6B 3FVYA 4ED0A 3KHHA 1XR5A 2JHEA 5T14A 5E3CA 1BMQB 1E6YB 2QMUB 3AD8C 3N6LA 4MKVA 4I68A 4Z7YA 4OI1A 2DGUA 1QSYA 1VQLS 1U7LA 3DLEA 4TY8A 1QVFR 4Q44A 4P2XA 1FRIA 5F8GA 2RQCA 2ZBIA 4K7QA 1N56A 3C66A 2WOMA 5A2QU 2J6SA 1L3TA 3CCSS 4DXLA 3AH6A 2C3UA 2Z56B 1S7IA 4P74A 2KXNB 4DV1J 1K8AT 4Y2IA 2EC2A 2XMMA 1M5OC 4M94A 1RT7A 1WTFA 4ZVOB 4NXMF 2FY8A 2HBZB 4ZIWA 4Q2LA 5LSOA 2RRBA 4CM2A 2CPIA 1GXTA 1LXJA 3G6VA 2DCUB 1F2HA 4X4PA 1GMWD 2NPIA 2W9AA 2P5VA 5JXSA 4ECYA 4KH0B 1T05A 3CDEA 2LECA 1KDNA 3BO4A 4DX8H 3GV5B 2HVZA 2DXFA 2C2EA 1XQIA 3R3TA 2RKIB 4X66F 4NMLA 3CJRA 1P9QC 2FGCA 4DPYA 4DR7F 2B8PA 3M8PB 3TAQA 1G1XA 3ADAC 1CPZA 1HNVA 4GO7X 3NGSA 3HJFA 4RU9A 2MKYA 5D3GB 2LQJA 2NQPA 5ETOA 4RJVA 2YBVA 1SJRA 2M70A 2RQKA 5F8NA 1TKXA 1IN0A 3MM9B 5FDLB 4PKDB 3JSMB 4I67A 3VZHA 1JNZB 4B9MA 2NCKL 4AUKA 2QA4S 2C22A 3OL8A 4C11A 5HQMA 4AFFA 3I87A 4LRCA 4OJHA 4ES3A 1RLCL 4ZS6A 3LP0A 2LXUA 4ILLA 4YB5A 3NRBA 2LU2A 5KFEA 2GJIA 1EHWA 5EWEA 7FDRA 5FD1A 2AT1B 1S6UA 2EEYA 1S1WA 2DGOA 4PWUA 4LBHA 1LNQA 3R9LA 4N7TA 2EBGA 3PACA 3V2UC 5GADU 2ZOMA 4QIVA 4IOAQ 1RISA 4JUZA 3D2WA 3PR5B 2AF6A 2HLUA 3O44A 5LMUF 4EI2A 2XZDB 4FYYB 3LANA 4TLQA 4TYBA 4JI4F 5IT0A 4ED1A 5GAEI 5D6GA 4YFUA 1YK9A 4ZJOA 1WOOA 3T5JA 4IG3B 2WVDA 1S9EB 4IRCA 2ZFHA 1HHSA 1EJ7L 4LFBJ 3D68A 2BRKA 1HBUB 1T3OA 2UUBF 4QWCA 3KDOA 4RW7B 2E7WA 5H1SV 4TN2A 2CA9A 2K7KA 4J9LA 2A2CA 1L5UA 4WWSA 2OJ3A 2MQLA 6FDRA 3QSYB 2AX0A 5B0AA 1F5CA 1Z2LA 3D1HA 3HVRA 1YRUA 1GFWB 1PCAA 4KTQA 4DG1B 4G1IA 3RBZA 4RW8B 1FK9A 3TUJC 4F25A 2ZZNA 1Y3KA 1MSWD 3Q8PB 1X31C 2BW7A 1FO1A 1YJ7A 1OPZA 2LDYA 4JV0A 2NXCA 3FEYB 4ZA1A 1P27B 1C0UA 1XN9A 3GWCA 1NUEA 3CJ8A 1Q5YA 1SH3A 1N88A 3OSNA 5EWGA 1WDTA 3OJSA 4WZMA 2LLZA 1TV6B 2PO4A 3KUGA 4PWDA 1S1UB 2EKNA 1SKRA 1U26A 3MFHA 2HYIB 1HI8A 4I7FB 4ANDA 5AXMA 3D1OA 2BJ9A 4HEA9 1DQAA 3ZO7A 1IWGA 2Z2LA 2KL8A 4JI5J 1RHMB 1S12A 2F4VF 2C2DA 4BHQA 4FZVA 4DL3A 1I5OB 3CD0A 1ZM3A 2KVQE 3MM5B 1B64A 4OZ3A 4UT4A 2F7VA 4K2XA 2ALYB 4U8VA 3C15B 4RUAA 2P9GA 1VQOS 1CJVB 3THVA 2AGOA 3NS7B 3BSNA 3GE9A 1IBCB 4ELTA 1TL4A 4LFAF 3PCOB 4QU7A 5IT9U 3VALA 1KVJA 1IVZA 5KFLA 3TO8A 2FVSA 4M5NA 1VMBA 2WVEA 2PEBA 3F73A 4OYBA 3RW6A 1PKUA 1FERA 4LVOP 2IM2A 5I42A 5ADZA 3CT9A 4FS1A 1FXRA 4ZPAA 1LWCB 4JB8B 1RABB 2DR7A 3AJ1A 1AFJA 3CJ2A 1LWFA 3TYTA 3J81j 5LSRA 1VC6A 4R8UB 3UCGA 2W2MP 4AQYJ 4N8NA 5LL6d 4GC7A 2XG8A 3VGSA 3MOJB 4HDHA 4OI6A 1PYSB 4ZPCA 5BYSA 1RHUB 4ID5A 3A8IA 2K1RA 1XMQJ 1HBMB 5DRKA 2E7VA 3V4MA 3M2RB 3W64A 2AGQA 3PFOA 5KFCA 5I3PA 5A8WA 2NR0A 1URNA 3NWGA 1SBRA 2XSJB 2YWHA 1SJ3P 3M8RA 3M8YA 2VG5B 3J7A1 1N5SA 3U1LA 2LEBA 1S0VA 5HP1B 3F0NA 3ENWA 4CLLA 5AXKA 1SUQB 4OLOA 3P49B 1RUSA 4PPZA 2BJDA 4ZVHA 4X65F 2I1RA 3QAUA 1R0AB 1HBNB 5L9NA 4DV0F 4ZN1A 3CJQA 2ZJQQ 2RRNA 4KV8B 2CFXA 4IFYB 3TANA 3TAMA 2DJWA 3SSQA 4CQ1A 1WC3A 3M2VB 4E0DA 4QPXA 4ZCMA 1WEYA 1F3FA 3Q22A 5IWAF 3UDLA 5K20B 3I0SA 4Y3CA 2MGZB 1CSJA 2ROEA 2DYAA 4WKYA 1R8HA 3EDRB 4UTGA 5D0RA 5I3UB 2G13A 4F2SA 3MCOA 2XWXA 4DSFA 5DQGA 1JLAA 4LUBA 4OX7A 3KK3B 4KGXB 4TU8A 1RWOB 1FDBA 1X4EA 4DZDA 3RB6A 4BWMA 1VS3A 3SCKE 4U67Q 5HO4A 3PX0A 2E1AA 1YJWS 3M8SA 2FJAB 3QGHA 1JIHA 1VRUA 2RU3A 2ADBA 1LKZA 4OI4A 1QTNB 4IH7A 3PYFA 3OXLA 5ETMA 2CPXA 5HBMB 3DYAB 1Q81T 3C6UB 2IDLA 1VQYA 3B82A 1N33F 2C3OA 2G2OA 3QT5A 3EZOA 3GPAA 3VAIA 2YPYA 4G1PA 2K8GA 1OSCA 1Q95G 4QU6A 3LP1B 3B54A 3MAHA 3R97A 4ZMMA 4RW6B 3CC4S 2FVQA 4PXCA 4ZVTB 2MKSA 4X66J 3ENAA 2C28A 2HHTA 5HI7A 3HFZB 2YWFA 1UPPA 4F4KA 4ECZA 3UN5A 1LW0A 1U8SA 1VQ9S 4C8KA 4OZJA 3NCPA 2ZVSA 3KMQA 2YKMB 1FRHA 1TMMA 4NASA 5D8HB 2B7CB 1KVKA 4FVCA 3PYDA 3CSKA 4J9PA 4CLZA 1S6QA 4V19J 2RRAA 1A0OB 3RB4A 2A10A 1Y5NB 2YWEA 3K59A 3RUBL 2YNIB 4PG7A 2WVFA 1F2GA 3MDFA 4Z2XA 2OMOA 4RBVA 1BY9A 3T9NA 1NLKL 2B5JB 1H74A 1IBKJ 3M4XA 4GKKF 4Q8EA 3C16B 4CH7A 5A8RB 1FFGB 3ONQA 5KT6A 4LF5F 1RWNB 4JI0J 1BQMA 5LMUJ 1HIYA 1X4BA 4RUHA 2CXEA 2HFOA 4JI4J 1BC6A 2Z58B 1X4DA 1N4LA 2BEFA 4DR4J 1MMLA 4OHYA 4Y2MA 2RKIA 2F1FA 3M8PA 3Q8QB 2AZ3A 1WI8A 1N6QA 3O5TB 2UUBJ 2HZVA 1FT8A 3DLKB 3CD5A 4WFYA 4Q7AA 4M5KA 1TL1B 3DXBA 4NI2B 1RAFB 2XI3A 3M30B 4Q43A 1UEKA 2W8LA 3MTKA 2B51A 2KYXA 3JYTB 2ZH8A 1U45A 1JKHB 1D9DA 4LF6J 1X5TA 4O0NA 3IS9B 2FYXA 4IR9A 2DT9A 3FEZA 1PBAA 4X4RA 1KP6A 2CZVC 1UCNA 3NGDA 1QY7A 4F3QA 4CLTA 5SZTA 1NJYA 2DKOB 3VVTA 1T0TV 4DR5F 4WE1A 4UOHA 1RT1B 4FXVA 4LRFA 2KFYA 1HKAA 3CNQP 4JYAF 1UPMB 4I0WA 4CO3A 4B3OA 3OTBA 1NJXA 2PFFB 2ILZA 2IM1A 4HACA 3MGJA 3IMQJ 3T5HA 5K9FA 5RUBA 2PEHA 5L8RC 2CJAA 1RAEB 2JEIA 1YJ9S 2E44A 1EETB 2FJEB 1JXVA 2QT7A 3G82B 4JI3J 4E8UA 1RT4B 1RHKB 3QIDA 4IG3A 2YH1A 3CD7A 4G1QA 4I69A 4WIQA 1Y3JA 3Q8UA 4NLPA 4K50A 4RW7A 3NS6A 4WTYA 2R3VA 1SJ1A 1HPZA 2J9EA 2B4OA 1Q8LA 1RWKB 3NNAA 4UUWA 4DI6A 3CCJS 3BGFA 3DRPB 4ES2A 1RT6B 3J81Y 3IG1A 4DLGA 3CMAS 2BQUA 2AJ2A 2BJEA 4LFAJ 4RW8A 2LMIA 5DDPC 3BR9A 3HP6A 2RHSB 4NXNF 2W4DA 1S0OA 2R2RA 2FPHX 2VFUA 3EPGA 4HHJA 2Q1LA 5HMWA 2JFDA 4M5IA 1KD1T 4F26A 1MN7A 1U48A 3IAS9 3BO3A 3MR3A 4M5DB 1HI0P 4LRDA 3LUYA 4KPCA 2FGOA 5J2QB 1VI7A 4A46A 1ITPA 4LREA 4A8YA 4IRDA 2PI4A 1S57A 2FVCA 4IOCQ 2I0XA 3QIPB 3DRXA 3D3BJ 3VR1A 1KVIA 3ZZPA 4I7FA 1U0SA 4RO0A 2AHOB 3B4MA 2CPHA 3E3XA 1XWLA 4L74A 3SXLA 2D41A 3H5YA 4Y00A 2UZAA 1JJCB 4IDKB 4PG8A 3EGVA 1JXEA 1OY6A 3C3LA 2VASA 3VAMA 3GFHA 4ILRA 2V8HA 3JQMA 4ZVQB 1N52B 3C15A 3M8ZA 3N9UC 3TW0A 3MMAB 3E8OA 1AZSA 4B9UA 1BGXT 2XGQA 4NWBA 1IKVA 2C2NA 3K58A 4EK2A 1NSAA 4RKUC 2DD8S 3GMGA 2ZVIA 1AXQA 2Y8YA 1NB2A 4I6WA 2OSRA 4N5SA 4CO2A 2MHNA 3BZQA 2AYBA 3LP2B 1F1BB 3KUHA 4PQUB 2K2PA 1HNXF 3KNAA 2AGPA 1B0TA 1FRXA 5KFAA 1H2UX 2BBEA 4X65J 1LWCA 2IVFB 5J2NB 3TJAA 4N56A 5IC4B 1HLWA 3KHRA 4ZJLA 2CQHA 4CNYA 1YTYA 4DV0J 3QT8A 2KZMA 5KG4A 4AL5A 4AXIA 2EFOA 2HG4A 3GONA 4C2MA 1RQ0A 2YTCA 2Y1LB 4OL8A 3NP5A 3BGRB 4CLPA 4IRKA 3KJFB 5F9LA 4OI2A 4Q0BB 2Y1JA 2JWNA 2ZH5A 3V6JA 2ZDPA 3W9HA 4L75A 3PKYA 1CULB 2HAIA 1RT3B 4M63A 3I5AA 1HBMA 5IZHA 1NK9A 1YBTA 2O5DA 1KHVA 3M2RA 1APSA 4KT0C 3A13A 3MUMP 3DGVA 2LXFA 4ZCKA 3UI3A 2P9CA 2H54B 1CVJA 2BA9A 1S10A 2XSJA 2G2ZA 1KN6A 3HD2A 2J7KA 2LVWA 2W9CB 4WF9Q 3HI9A 1IKYA 4UZBA 1HNZJ 1YJTA 4URGA 2OLWA 3A8JA 3T6BA 3BR8A 2AMCB 3H5UA 4L72B 2A6OA 1S79A 4QR2A 1RB0A 1S6PA 2FHKA 1X7VA 4CLYA 1N33J 4USVA 2MQMA 4OJGA 2OEJA 1J2VA 1EKRA 3RR7A 3MCSA 4MIWA 4IFYA 2XMAA 4OIXA 4IOBA 3TVKA 3W2WB 1M90T 3UD3P 2H1YA 1YGYA 3CIZA 4DSIA 2UXCF 4ZPWR 2IDEA 4P72A 5H9EJ 4ZPVR 1C4CA 2DRDA 1W26A 1XR6A 2OUGA 3TZXA 3HHLB 3MPVA 3KLEB 2HMIB 1GQEA 3RB3A 3M05A 3LPEA 3KK3A 1RTZA 3AOCA 3CJKB 3V4IB 1SL1A 5IT4A 3N28A 4YN3B 2HGNA 4ZCIA 1ZPVA 2N7CA 1YJRA 4PG4A 1UFLA 3LW5C 3VVUA 2FD2A 2VPYB 4RNHA 2M2BA 2XTJP 3CW2C 4KO0A 2B4PA 2FJXA 2VV5A 4PUOB 1W7WA 2PC6A 2GGPB 1N5YB 1O51A 4CWBA 5DS7A 1WC1A 1GMVA 1UMJA 4C3LA 1PO6A 4B9LA 1SQEA 2QL9B 2CJQA 5IOLA 4LF5J 1I94F 3ELHA 3G8QA 3LP1A 1S59A 1F6TA 1RLDA 4RW6A 1KLNA 1FXLA 3RU0A 4CYUB 3UR3C 4ENOA 1DTTB 2R7WA 4J9QA 2QA1A 1TTHB 2VJUA 2ALZA 4EMDA 4RW4B 2FLNA 4OZ1A 2E5LF 3MM7B 2UVUA 3HJVA 1N54B 3AHPA 1S1TA 3NAHA 4F4AA 2L08A 5F8MA 2W25A 5EX0A 1UWBB 2YKQA 5CYQB 2ZNZA 3DGPA 2K3KA 3IN5A 1FJGF 2HS3A 1TK8A 2JZ5A 4KJIA 3H5XA 4HH1A 3SIPB 5ITHA 4DR5J 2AV5A 4JYAJ 2B9YA 4NYPA 4DU8A 1WHVA 3RR8A 3M32A 4NZ7A 5CZVA 2H65B 3M2UB 3FGVA 4QWAA 2ZE2B 1E6VB 1U0HB 5A8RA 3Q8SB 1Q7LB 2FJVA 1JXLA 1RTHB 2IRUA 1CLFA 1UJ5A 2RS2A 1UZHA 5LJ3Y 4C8ZA 4DQPA 2E5JA 2PIIA 1K0TA 2V4RA 3CGIA 1SIZA 5D4NA 2QLBB 2RVJA 4X4QA 4H54A 4JI1F 4BDPA 3OTOF 1NNDA 1VQ6S 4NLUA 4CLKA 3DDIA 1T9YA 3DLKA 2R7QA 1B0PA 3W62A 2GHVC 4NI2A 3AOAA 2BE7D 1QSLA 1AB8A 1BD6A 3UFCX 2JLEA 1YWXA 1JKHA 5GAEU 3FFIA 2Z2MA 4ZKAA 4NCBA 4UQGA 1BQNA 3MEKA 2AP6A 5E3PA 3TR5A 2G9OA 1OY9A 4NXNJ 5HVFA 5IQQA 2XLKA 3AY0A 3KLVA 1TAQA 2VQEF 2B4VA 3VAFA 2XY5A 1D9AA 4WFXA 1JLGB 4ED4A 4IUFA 3EGNA 2GFFA 4LJMA 2C2ZB 1M5HA 3FMBA 1Q7YT 2ZC3A 2DNHA 2KI2A 2OEMA 3NMAA 1LK5A 2MYFA 4O3QA 3O8WA 3CCUS 5IFMA 2R7OA 3IWLA 1RBAA 5AJ3F 2AYMA 4C6AA 3TEGA 2Q66A 4Q2MA 3UVJB 1R89A 5ETVA 2Q43A 1RT4A 2DEIA 5LSLA 5D4LA 3FDSA 3MEEB 3HHKA 4TU7A 2RF2B 5C2GA 1VK8A 4ZVSB 2E1CA 1WC6A 2WBRA 1QAYA 4HH0A 2I2YA 2FDNA 1R0CB 1NK4A 4G65A 2HVEA 3K8VA 2BM1A 2A6MA 5IS2A 2VG7B 3DRPA 1PJ7A 3OR2A 1AUDA 1ZPWX 2IY5B 5GADI 3FCVA 3D0HE 5J2PA 5HJXA 2FY1A 4UQTA 1NSPA 2BVZA 1M1HA 5L1JA 1FXDA 2YVSA 4CRJA 1UVLA 4IG0B 3I31A 2CQDA 4DQIA 2GIRA 4JV5F 1T03A 3OPKA 1NO8A 1TK5A 2XM3A 1FKPA 2GC8A 3UN2A 5D78A 3OLAA 2GIFA 4X4OA 2KFNA 7AT1B 2CQBA 3R5BA 4YR2A 4PZVA 4PCQA 1HNXJ 3H8YA 1Y4ZB 4M5DA 4F4ZA 3OR1A 1YVFA 2XSFA 1S5ZA 5J2QA 4WFNQ 2YNHB 1S1VA 1C1CA 3D28A 2P6TA 3ULHA 2X3GA 2G0JA 2RDJA 2RJZA 4LBIA 3QIPA 1FKOB 2I5JB 2DGWA 3I4PA 3RRKA 3SV3A 3CJTA 3BDPA 1TKDA 3MF5A 2MQ8A 5KFYA 2VBZA 1ZTWA 1L3SA 3CUNA 2VL1A 3UNGC 2EPIA 2JC0A 4M5LA 2RUGA 4USMA 3L7UA 2HZAA 1XC9A 2V2QA 2HBQB 1T9TA 2I38A 5HMZA 1EARA 3PO4A 3D54A 5THWA 3MPDA 1O8BA 1Y5LB 2FUG9 1SI9A 4EYHB 1CEZA 2QIFA 1FTCA 3DC2A 4DR1F 5H9EK 1PAUB 3KLGA 3K57A 3RBEA 1IBLF 4WYLA 3TAPA 3C46A 3GYXB 3LP2A 4ED8A 1H98A 2DIUA 3JQJA 3LWMA 3HO1A 2DRBA 1YG0A 3OV7A 2AEJA 1HL6A 4WJBA 4F8RA 3FKBA 2V63A 5MLCV 3WX4A 3EZUA 3U1MA 3VF0B 2A0FB 1KEKA 2ZEJA 1VQNS 2OKQA 1X4CA 3QZ7A 3Q83A 2C3PA 4UF4A 3PEJA 2BDPA 1TUWA 2EBEA 5CHCB 2H5IB 3EUNA 2U1AA 4Y34A 2DY1A 2UXCJ 2I8EA 4ZVGA 3D6MB 1YRXA 5DDOC 1VK3A 2DNKA 5DDRC 1VQSA 5DG8A 1CULA 1HHTP 4PXEA 1TKTB 2M52A 1M5SA 3W5XA 4RNOA 1YZ6A 5KFOA 1X4FA 3H0PA 2QYCA 1QD1A 3HT3A 1U8WA 3J81U 3NMRA 5A8KA 2F9JA 1URRA 4LR9A 2W9CA 1HQUB 1M5KC 3HPOA 2MLXA 2XY7A 5C25B 1TL7A 4JP8A 4MT1A 1NZAA 2FLOA 4DS4A 3MEDB 3QAEA 4FNIA 1S49A 2LQ9A 3QWUA 1OSDA 1IR1A 3CJ5A 5KFUA 3QJJA 4B9SA 1RKJA 2BUNA 3NCRA 4QWDA 4KHPF 4NMXA 2WSFC 2WZ1A 3RG6A 2NSCA 4NOHA 5E41A 1Q86T 3PRDA 4BLGA 1UVKA 4C3KA 2DITA 4I2QA 5GAGU 2ASDA 1OYDA 3MAAA 4N76A 3W2VB 3L3CA 2F8HA 3LGHA 4C8NA 1S1XB 2ATCB 3O3LA 2Y8WA 1Z2ZA 4QIFA 3KLEA 2HMIA 1I3OB 2E5LJ 2NYHA 2LA4A 2WVBA 4X4TA 1RYRA 1HYSB 1IQTA 3UD4P 2PT0A 4O4RA 1K47A 1ZBTA 1ZETA 4I6YA 2HVDA 2MHEA 4N47A 2R7SA 2R7XA 4LF2A 1FJ7A 4B3SF 1Y00A 4PUOA 2ILYA 3PX6A 4H4OB 2XYGB 3G6ES 7FD1A 4DX5A 1SC1B 5JMNA 2DEJA 1P9YA 1KLMB 4CIOA 3CJSA 1RAGB 2QRRA 4H4KC 1GT8A 2HIQA 2RNEA 4CYUA 3KK1A 2DXDA 2MPUA 5F41A 4X64F 1RTIB 3P45B 2WBMA 3H4DA 1DTTA 4YY3J 1G4CA 9ATCB 5GMEA 5E7OB 3I5CA 1CQNA 2QJ3A 4RW4A 1VQ8S 3PHTA 2UUAF 3AJDA 2QL5B 3UDEA 4QR1A 3OVBA 4MKAA 2OD4A 3MM7A 1VLYA 9RUBA 2XZTB 2L9DA 2AYGA 2XB2D 1F5BA 4LFCF 1V3RA 3SDEA 3KLFA 1Y9OA 4RLEA 2WOMB 3W3SA 4OZ2A 1MN9A 1RAOA 5KFQA 1U1QA 4U7UD 5DGAA 2XMTA 4WFZA 1U6BA 1BUXA 3SSRA 2MLZA 4HLBA 1PG5B 5H9FJ 4KH1B 5KFHA 4ZP7A 3W8PA 2RD5C 4XTTA 4JBCA 3ET6A 1SL2A 1V5IB 1SC4B 4DV5F 2QLFB 5KFPA 1D9FA 1N5QA 1RE1B 5ETLA 2E5HA 1E6VA 2M5YA 3ISND 4W92B 5HMYA 5EN1A 1T05B 4C7QA 1QJHA 4Q5VA 2UVWA 2FIUA 4TY9A 2XYPB 4ANEA 5AJ3J 2AJQA 3PY8A 2E29A 1NKCA 3DMJA 2NZCA 2FJDB 2M0GB 5FIIA 4ED2A 4O0IA 4ZVRB 5ETNA 2BM0A 3TVYA 1M0SA 3A3OB 3RTVA 4USIA 4Y2KA 5D4OA 2FVPA 1F60B 3H2LA 3UDCA 1TKXB 2BJ7A 5D77A 2OFHX 3CCWA 1SKUB 2HIYA 5B0GA 1WHYA 2W4PA 2HK3A 4K8RA 4C11B 1EP4A 2A3JA 2EFPA 3DU6A 4JV5J 3LP0B 3AODA 3CIMA 4P7VA 2D9OA 3N5FA 1MG7A 3T1YF 3FMWA 4B9TA 5LMNJ 4L73A 1S1WB 3W60A 4K5SA 2Q6CA 1OO0B 2DHAA 3NOCA 2MDAA 1Y10A 4ECVA 2J76E 2D3OR 3RAQA 2C3YA 2KRRA 1HNWF 4YUDA 3BKTA 3MCMA 3UCZP 5K14A 4LF9F 4K4UA 2YX1A 1O6XA 2EW9A 2R8IA 2VZ9A 2QGFB 2VC1A 1PJ6A 2GVZB 4ERDA 2MJUA 2B8QA 3GP9A 2HBYB 4NYZA 3LPYA 1VQ4S 1S9FA 4MIBA 3MFIA 1MWZA 3CCVS 2VG7A 2QLWA 2Y1IA 1FHTA 2LCWA 5KG3A 4P73A 2VBXA 1P6TA 4C0BA 1UETA 2LKZA 2MXYA 1G7CB 1VQ5S 1FK9B 2YKNA 4L3NA 4O44A 4IG0A 1OIAA 4MYUA 4DQQA 2DB1A 4CZCA 2ZH2A 4DR1J 4DPTA 1WOSA 2HFSA 3FK4A 2I9SA 4BC7A 2O66A 1CJTB 2GMJA 1IBLJ 2CJXB 3QWPA 1RWPB 5EWFA 2CQCA 1P1LA 3KG1A 1C0UB 1JLCA 3DOLA 4DR6F 2HQGA 1NKBA 3PIOQ 1SC6A 2CPEA 4CO1A 1FVSA 1NAQA 1RBLA 2RE1A 1HNIA 2IFXA 4NLTA 3QPIA 2YNHA 2GX8A 4USKA 2R8JA 1YJNS 2FJWA 4PWDB 2QTWA 5DO2A 1IJFB 3OXGA 2QV6A 1WHWA 3TZWA 1R7IA 3KYLA 2AJ0A 1FJEB 5CCMA 3ISNC 1F9HA 4OZNA 5ETTA 3ZZUA 1VQPS 4OYAA 4X4VA 1JJ2R 2VPZB 2XCPA 4FYWB 3AXMA 3JSBA 2LXIA 1BE4A 4WZQA 1RWUA 4CP5A 2XNQA 2HQ3A 3VAGA 3HMJG 2VQFF 4LSNB 2BR0A 1YKWA 1K73T 3K8WA 4DFJA 4F0KA 2IMOA 3GQCA 4RW9A 2HGMA 3JTPA 3BN7A 4DX7A 3DLHA 3Q8VA 3R5DA 3R1HA 2R7UA 3CPWR 3G2XA 1LQ9A 1KC8T 2J5AA 1RWVB 2UXBF 3WBZA 4URQU 5BYQA 3QFWA 4OYXA 3D6FB 2JC1A 2NXNA 5I4MA 4DF8A 4KHPJ 3FJ2A 2HHVA 4OI3A 1RXOB 2RQ4A 1LWFB 3L9ZA 4EWTA 1KSPA 2KT2A 3IBWA 5HK4A 4DEZA 3GG1A 1NDLA 4CI0B 4JI2F 4F4YA 1UVMA 3B6BA 4EBEA 2DIVA 1DTQA 1XIQA 2VG6A 1P1TA 2ZKTA 3H59A 2GQ2A 3TJ8A 1U4BA 2K1RB 2LQBA 1CQMA 3V6KA 1TKTA 2R8GA 2I6WA 4J7CA 1H2TZ 4PQAA 5A8WB 2GVDB 5HSPA 1HD0A 4FPIA 2ZWPA 4K4TA 5F3ZA 5LT5A 2KN4A 1HI1A 3TA2A 4RNNA 5L38A 1S77D 2MSSA 1OJ4A 4KHMA 4K4XA 4Y0FA 3OTCA 5B0BA 4ZLLA 3VAKA 3HVWA 3EE3A 5C2CA 4PR6A 4TQRA 3Q8RB 4C3MA 3R27A 3GJRB 3BBFA 4WTOB 2JJ4D 5F8HA 3TAMB 4F4XA 1O5JA 1QUVA 4X64J 5H9FK 4MKYA 3OUYB 2VU5A 4RU2A 1RDRA 3I0SB 3D7SB 4FXWA 3W5YA 1K1SA 2UUAJ 3A8EA 2DNNA 3D9BA 3JSYA 3VAHA 1JLAB 5A76A 1GK8A 3HFKA 4LFCJ 2KYZA 1JLQB 1HYSA 2QZ8A 2HZCA 1ZM9A 2W2QP 1IBMF 4Z7CA 3HZGA 2IIHA 4NLYA 4U7CA 1VRUB 5FJ4A 1WACA 3FBEA 4I56A 1UEVA 2DO4A 2ASLA 1UA1A 4V1Ak 4A48A 3H90A 3BM7A 2IRYA 1XNQJ 3LO3A 4H4OA 1X0PA 1BLUA 3QJLA 2JSXA 2V4QA 1KLMA 1KFSA 4DV5J 1J5OB 4QQBA 1T9UA 4RUCA 4NLQA 2YPZA 3VTIA 1I1GA 1LV5A 2OMLA 3MMCA 4NLXA 4D3GA 2W2NP 2HNYA 4QW9A 2J7UA 3V5RA 4OHWA 3FBBA 3N79A 3A3PB 3D4JA 1UVJA 3PIPQ 1RU1A 2B3TB 5M2RA 4PEOA 1JLBA 1RTIA 4UOFA 3MZIA 1X9MA 3CCTA 1WKJA 2V4JA 3GR1A 3PW7A 2W7OA 1FF2A 2EFQA 3BYRA 3CCRS 1S97A 2CNLB 1U2CA 4KYZA 1RHQB 1MWQA 1LW0B 2CQ3A 1WELA 2AIRB 2BACA 2VBYA 1FTRA 2DH8A 1A7GE 4DL2A 1M1KT 4J5OA 4KHRA 2VH7A 2BX6A 4QIGA 4JI8F 2JNJA 4LMZA 1S6QB 3SMZA 2VC0A 4LIWA 4JI6F 1PYOB 4B02A 3NKYA 5GVQA 4LSZB 2Q79A 4ZPDA 1KTQA 4M5GA 4O4GB 5B0FA 3T1YJ 2JL9A 1NK0A 2OD6A 5GMKa 1WEZA 3AJ2A 2QSFA 1TP7A 3OBIA 2MZTA 2GAGC 2KH9A 1KR4A 2RH3A 3OT9A 4FVMA 2W7PA 4A8SA 1BQMB 1RWWB 1VHIA 1FRMA 1UJ6A 2BZ2A 2ZM6F 3IAM9 1JQGA 1A9NB 3R1LA 4LF9J 3OTEA 5D0EA 3ZNUA 4ED6A 1DHMA 2UXDF 2YNGA 2V69A 3K5OA 3TX0A 4E98A 4XPEA 3H2UB 1N6QB 4F02A 4QBUA 3HDSA 4CT9A 4YB1P 2DBBA 4Y28C 4F3OA 4Y65A 4O3PA 4A8WA 4B3TF 5J2MA 1LOUA 3G96A 4KPYA 2EK6A 1HW8A 4DN9A 1FX2A 5F0UA 3SQGB 1JLFA 4DV6F 3RBDA 2D9PA 2DVIA 3QJPA 1Q1KA 4O3NA 4A8MP 1ZZFA 3DLJA 4ANCA 1R8PA 2J6UA 4WE1B 4QW8A 3S7RA 1T11A 2BOAA 4OYIA 3TNVA 5L46A 3EXYA 5LJ5Y 4XIUA 1WEXA 3ICLA 4B3OB 2DNPA 4C4WA 5A2QY 2VIHA 4K4VA 1PJ5A 1F9EB 2W2PP 4HACB 2POKA 4NZ0A 3M8WA 1SQFA 3OFFA 2IPOB 3MD1A 4YB7A 1REVB 4OHXA 1RAHB 1ZAVA 1WSVA 3PEHA 1EX8A 3NCQA 3B4DA 1RSCA 2GVZA 4AXJA 4G1QB 4DCOB 2IBKA 2M3DA 3N0VA 3A1YG 1ZOTA 3U02A 3EICA 3QRQA 4DBQA 3N4WA 3Q24A 1HPZB 5C5JA 3NGTA 2VQFJ 3N6NA 5CD4A 2ZHAA 3QRPA 3NAIA 2VICA 3IG1B 2HNDB 1G2EA 2GZOA 2JH3A 2A18A 2KDOA 1PGZA 2W01A 1ZH5A 1W25A 5KFIA 3R7BB 5BXIA 1CC8A 2MEWA 2CADA 2HS4A 3QT6A 4NA3A 3TZZA 4TYAA 2X51A 1CJTA 1RWMB 4J9NA 2UXBJ 3ZZZA 2DGVA 4OYMA 1H6KX 4IFVA 4FKXA 3QFHA 4DUZJ 4GKJF 3SFGA 2M9KA 1UTAA 2J9CA 2WHOA 3D6HB 3M9OB 5HROB 1N36J 2V8DA 2GA7A 3UE2A 4EO6A 3NNCA 4F04B 1NU4A 4X4NA 4DLEA 4WFAQ 2WVCA 4NA2A 1DRZA 4JI2J 2OPQA 3ZZ0A 3QO9B 5K8PA 1Q79A 1QTMA 2UP1A 2VFVA 5ETQA 4O3OA 2WCXA 4I6AA 3ILOA 1VRQC 2J7WA 4DJBA 2ZBCA 4LSNA 2GO9A 4KGZB 4P6QA 5JVHQ 4P2MA 3HSZA 1VRTA 2XO7A 4J37A 3FQLA 2XMVA 1AZSB 3KMSA 4NX9A 3GIIA 2H9ZA 3R5GA 4DV3F 3AA8A 2QG9B 1FX4A 1QAJA 1PIEA 2OPRA 2NPFA 1IKVB 2NUUG 5C7PA 4DWIA 5DLGA 3DLLQ 3ZZTA 3M6UA 4KB7A 4ED5A 3R5AA 3RRHA 3LAKA 3AAWB 3CULA 4TLRA 4I1TA 1S7HA 2GCFA 1NDKA 2HURA 1WC5A 2APOA 4BC9A 2KO1A 4DR3F 1U6ZA 3HT0A 1QE1B 1RT5A 4FYXB 5KOXA 1MROB 1XNRF 1NDCA 5CAAA 4KKOA 1RZMA 3T1HF 3THTA 1OS5A 2BRLA 5AE2A 3HVTA 3NS5A 1AA1B 4NRUA 4ECWA 1WDDA 1KQFB 4WPAA 4P2FA 1S76D 4NLSA 5EDWA 4C48A 3OFEA 2B6AB 3IRXB 4B3MF 3KWMA 3D6TB 3CC2S 3D3CJ 1X5SA 4PYAA 2GVDA 2F4FA 1IBMJ 4H4KA 4NEZA 2CQIA 3I5BA 4F50A 4I4BA 2N82B 1IKYB 2CUYA 3P5BP 5KFMA 1K0VA 1N34J 3MR7A 3M7VA 1TFWA 3HZEA 6AT1B 3O6QA 2LDIA 1S6PB 3POTA 2OAUA 1FD8A 1DQ8A 1AW0A 3UWTA 4B9VA 3I9V9 3SV4A 4YDXA 4FXDA 1DARA 1T9XA 2CQ4A 5ETSA 3QT7A 1L3UA 2EFNA 1NK6A 4CH1A 3E01A 2XO6A 1G6BA 4KGMA 3OUYA 2XMUA 2ZOGA 3QBCA 2IVMA 8RUCA 1KTVA 5B0CA 3GB0A 3GIMA 1NHUA 2BJ8A 4PXDA 3GG0A 2GHWA 2DGQA 4DN0A 4W98A 4KQZA 1SQGA 3K5PA 2DGSA 4HHUA 1FWPA 2ZHBA 3GJQB 2Z57B 3ZZYA 1JLQA 4K5RA 2MZRA 3MPYA 4TKTA 4JI8J 1SXLA 2XC9A 1JJ4A 1HFEL 2W1BA 1QDUB 4JI6J 4MFBA 1Z1ZA 2A2DA 4WP3A 1W2IA 4KO0B 3GLJA 1RTDB 2HHSA 2IM0A 1R0BG 3IM9A 3TARA 2AJ4A 4WU3A 4NXMJ 5GAGI 5KG2A 3PRBA 3OD2A 3DI6B 2NUHA 4FKYA 1RA6A 2MSTA 2ZD1B 2HVIA 1J5OA 4MAKA 5M2UA 2R8HA 2HAFA 2W9BA 5KFZA 5HMXA 2QLXA 2ZM6J 3BQ1A 5DQHA 2DH7A 3S1TA 2F8MA 3QGGA 3QGIA 3V6HA 4ECUA 1QAIA 2UXDJ 1SJQA 3CDUA 4DR7J 1NJIT 3C14B 1X4HA 2X7IA 2YNFA 3NG8A 4KFBA 2C2KB 5G0RB 4HKQA 2EK1A 3J7YU 1VR6A 4FYVB 1LW2B 3MR2A 1S1TB 2QL7B 3KOAA 1JWWA 1SH0A 4B3TJ 3B78A 1TAUA 1UVNA 2IRXA 3DGPB 4OYOA 4DV6J 2V6AA 4I64A 5AE3A 2L9NA 1WKLA 1T9VA 1RA7A 2P6SA 2BABA 3ENVA 5M2PA 2KM8C 1YQHA 2JEGA 2FLPA 4RX6A 4O4GA 1UFKA 3KG0A 2OPPB 1ZM2A 2DR8A 1EQMA 4CTAB 4WP8A 2V0NA 3M32B 2IC3A 5DZ7A 2DGXA 1RACB 3TZYA 3CMQA 2HHHF 3SBMA 2D3UA 1WF1A 2CZ9A 4ECXA 3AB2B 3GIJA 4DV2F 4RUBA 2XYHB 2ZDOA 1R6YA 1BWEA 1AROP 2PMZD 2BXJA 1RCXB 2OP5A 2ASJA 2AX1A 2GHPA 4WU2A 2GAHC 1PSDA 2B4UA 5BR8F 4DCPB 3D66A 4J9MA 2OH2A 3J7AN 3BB5A 4EO8A 4ECSA 4K4SA 2HVHA 4ED7A 2ASYA 4DU7A 3KTQA 5C24A 5DETA 4RBUA 3MPWA 1REGX 2J0WA 2HQDA 2V94A 1MLAA 2PA3A 6FD1A 2Z8QA 3TJ9A 1IR0A 3N5BA 3EVMA 4OYPA 3SZ2A 3FFIB 1WHXA 4EZ6A 4QCLA 3RAMA 5CYJA 2G0IA 3SQGA 1BQNB 2BMBA 4DL6A 2LEAA 4LBPA 4YS2A 5B09A 3EM1A 5DM6Q 3H5SA 2DR5A 5T7LB 4UY8T 1D8YA 2RU9A 2FC9A 1QM9A 2M8HA 1B99A 2RILA 1EZZB 2B9WA 4USJC 4CCHA 1H38A 4GKJJ 3BN4A 3BDEA 3D67A 3PM9A 5KFNA 4S0MA 4K0KF 2ZKUA 3DCAA 4OJ3A 1LWEA 5D0HA 1WF2A 1FNMA 1IQZA 1XBWA 1REVA 4ECTA 2AKWB 3W66A 5A6WA 4MYTA 3ZZOA 5E2QA 2EVZA 4P9SA 5HVGA 2RS8A 1HQEA 3R6LB 2H4YB 3MM6B 4ZITA 3K7RA 1ACMB 1L3VA 4UY85 4A8FA 2F4VJ 4C9DA 4X4SA 2HHXA 1GX6A 2DXEA 2C2OB 3DNCA 1ZYQA 3CJ4A 1PBUA 1VBYA 1WORA 3PNIA 3OR2B 4A8OA 2XMJA 1R3NA 2HNDA 1M5VC 5CCLA 2CWKA 1HHQA 5J2PB 1AT1B 2HRUA 4DSEA 2MQPA 3QRRA 4HTJA 2ADCA 2XS5A 4KAIA 5G4DA 4LSLA 1PYTA 1VC5A 1T03B 3JAMY 1U09A 1VLOA 1FKPB 3PG9A 3TQEA 2CQ1A 1SL0A 1TZ0A 5CABA 3DDKA 1Q53A 5E5NA 3R8YA 4U95A 4K59A 2DH9A 3V81B 3BGLA 2DGTA 1KWMA 4N41A 2XCAA 3H7HB 4NPOA 3OR1B 5HL7Q 2MQQA 3KK2A 3DHWC 1Q8IA 3T1AA 4MKBA 5HROA 4DR3J 1S1VB 4LF1A 1C1CB 3PW5A 2WONA 2HLTA 4DMZA 4EUVA 4DQRA 4CLSA 1XNRJ 4USTA 1YJUA 1Y7PA 5AXNA 3T1HJ 3O2IA 1N5TA 4KIAA 3KNGA 2CPJA 1HW9A 3QO9A 1Q4RA 2BQ3A 2QMXA 1FE0A 1N32F 3A12A 1V9OA 2PE8A 1AFIA 3Q0AA 2JEJA 3TOQA 1GH8A 5KG7A 4OQJA 1QUPA 4ZJQA 5KFTA 4F2RA 1GEHA 4OZ5A 4B3MJ 3R5CA 3DN9A 3DLBA 3GFZA 2WRMA 1EIYB 2V2VA 2XZWA 1JLEA 1Q5VA 3H4BA 2ZITA 3CJ0A 3W1YC 3SSSA 4AL6A 5F8LA 3QQCD 3KLGB 3KJVA 1TU0B 4DDFA 4OZLA 1PC5A 2QYGA 3UDVA 2BANA 1VJWA 2BOPA 2JLGA 5KFSA 1KHWA 4NCGA 2L3MA 3AT1B 3JS9A 2KKHA 3P6YC 4CLFA 2CIMA 3JTOA 1QE1A 2AYEA 2JLFA 4ELVA 2V9WA 2JVOA 2IJNA 1MROA 3FCHA 3OSPA 1XERA 3KLHA 1TL5A 3H20A 3MAQA 1U1MA 2C42A 4BBYA 5IWAJ 3DOKB 1Q8BA 1WI6A 4ZK7M 1U49A 1V6HA 3DDNA 2QN6B 4XPCA 1UP1A 2VKRA 3A8KA 3HK2A 2IJRA 2M4MA 2B6AA 3IR5B 2YKAA 3IRXA 5ETKA 1WWHA 4NZ6A 5CD4H 2YWWA 4A8XA 4R0JA 3ILIA 3RJMB 3U27A 1AUSL 4DV7F 3FEXB 1C4AA 5A8KB 2XHCA 2BE2B 4PG6A 3UQSA 1TL7B 1U1RA 2D3ZA 3SEOA 1TVRB 5CH7B 3DKDA 2WTFA 3K5LA 2HFZA 1WD6A 5KG5A 3PKMA 4NEYA 3L4BC 3G8TA 3S8SA 1QAXA 3SFUA 2E66A 4ICLA 3T19A 2ZUAA 1C0TA 1OPIA 4HI2A 3R7NB 5F8JA 1U1NA 4I2QB 3UCUP 3MAAB 2ZJRQ 4J9KA 1UAWA 4DFPA 4USWA 2KM8B 3OHAA 3NOGA 5AXLA 4WKRA 1IBKF 1NXIA 2G0CA 3W8GA 2PN6A 4DSLA 2JFKA 4B17A 2R8KA 4RNMA 4JI0F 1LXNA 2B7BB 2V50A 1KQGB 5ETRA 1T94A 5KFVA 1V5VA 4DR4F 4F36A 2MKHA 1H72C 5KG1A 3CCLS 4MH8A 1VBXA 2XWYA 4C0HA 2EI5A 2KU7A 1RTDA 2G4BA 4IO1A 4J91A 4ZCLA 1DQ9A 1F9FA 3DI6A 2R7RA 3UO0A 1R27B 2IHR1 2ZD1A 3SQOP 4ZIVA 4GKKJ 2HHHJ 4K4WA 3ZFVA 3IO1A 4HTIA 4I2PA 4LF6F 1NSQA 4JOUA 3MR6A 1SIWB 4W4MA 4DV2J 5KT5A 5B08A 1FVQA 2RUSA 4LF4F 1UWAA 3O1LA 3KK1B 1KS2A 2B43A 1EQ0A 4LR7A 3LAMA 3TEHB 2CNKB 3M6VA 4ETZA 5IV3A 1GXUA 5BR8J 3VGTA 4QPTA 4U96A 3C14A 2ABYA 3HX9A 2UUTA 1FWKA 4IR1A 1U2FA 2NREA 3H98A 1UL3A 2EC0A 3ITHB 5G0RA 1RT2A 3CTRA 3MECB 2QC3A 5A6PA 2WW8A 1LW2A 3SDEB 4OX6A 2V8VA 3KLFB 4LIRA 4A47A 4XO0A 1HWUA 1T7PA 1VQMS 2HNZA 3KG4A 2QA4G 5E3AA 1TUGB 5LOQA 4JI3F 4FBUA 1NZ8A 2C2RA 1FRJA 4ATNA 2EKYA 2OELA 5KFDA 4MIAA 4F0HA 1Q16B 4KY3A 4NLOA 2OPPA 3ET6B 4AYBD 4RPFA 4CTAA 1RI7A 3GSIA 1PAEX 3GCXP 1UJ4A 3ZTPA 1RADB 3GIKA 3BSCA 2EG1A 2AZ1A 2DISA 2W2OP 1U2RA 2BJ3A 2IAJA 1ZA2B 3R2DJ 1N0VC 5GMDA 4YP3A 3QLHA 4K0KJ 4GRSA 3K5MA 1CJUA 2ZBPA 4C8YA 3BH7B 2RB7A 4P52A 2NZ4A 3DLGA 1I51B 3VQTA 4GMKA 3FCWA 5HATA 3DMJB 2AJFE 5KOWA 1NK5A 1CS4B 5D4PA 2ZZTA 1S9GA 3D1QA 3BPDA 3NLCA 2U2FA 2OHDA 3EJMA 4LR8A 3AQPA 3NGRA 1HD1A 2IA0A 2FJBB 2LFVA 4CLWA 4P7TA 2DCLA 2WK4A 3W5ZA 2LYVA 1S0NA 1B7FA 1IXKA 2EG2A 4JV1A 2ZBQA 3NGKA 4OV1A 3Q8YA 3GYNA 1EP4B 1CG2A 1G3OA 2J0SD 4A8QA 4M1KA 3TI0A 2CPFA 3J80Y 1GMWA 3AD7C 2XEXA 5T7LA 3ZTQA 2B0GA 2F5GA 3PO5A 3U1NA 3PW0A 3RW7A 4DV4F 1R31A 2DNLA 5JUMA 2O67A 2YH0A 2BW2A 1HMVA 4CLUA 2IYGA 4DPWA 3P8BB 1NK8A 1T9WA 1QVGR 3B8HA 3NBPB 5LXRA 2O01C 3HHLD 2V5HG 5K14B 3WX8A 3BYPA 2WB1D 5DGBA 3KJNB 2DHXA 1IKWA 4P71A 1VJQA 1FESA 2CQPA 1V3ZA 2E7XA 2IVYA 5I3QA 2MMYA 2YQ0A 3X1LB 5D15A 1S99A 2R9LA 3MM6A 4F3MA 1N32J 1RCOB 4DL5A 2D69A 2Z2YB 3F44A 4DPOA 3BGUA 1H7WA 5F3TA 1SKSA 4NLVA 1UVIA 3K89A 2CPDA 1ICEB 3VGVA 2QE5A 1GAOA 2WSCC 3VHQA 4DOZA 2KVIA 2OIHA 3V6DA 2PA8D 1VC0A 1GTHA 4OX9F 2VONA 1DY3A 2YKNB 4O44B 1NHKL 1S48A 3WZ0A 1B7YB 1RAAB 1XMOF 1R8AA 2CPZA 1VCTA 1N48A 4ZVFA 1JLCB 3DOLB 3V81A 3PJWA 2HK2A 3FSIA 2DY9A 3PYGA 3BH6B 3A3NB 3HHEA 4L6V3 1BWVA 1HNIB 2M88A 1OQ6A 2PGCA 2O1PA 3H25A 1ZTTA 4X84A 1HNZF 3G4SS 1SCJB 3WIVA 3CVKA 3L09A 2F3JA 4HT7A 1U25A 2KZZA 3JB9k 2G1DA 1GXLA 1H73A 3DRSB 2J9DE 4B08A 1TR0A 3BPSP 2RT3A 5MAOA 3P96A 2GQCA 4DUYF 3KDNA 4R5PA 5C42A 3AA9A 2WAQD 1KFDA 3M8QB 2AW0A 1FA0A 2ZH4A 4NA1A 3RGIA 2CJKA 3UN3A 5KT7A 2RDDA 2QO3A 1SH2A 4EFAC 1HWKA 4RW9B 4DV7J 2FZKB 1DLOB 2H4WB 2RHQB 3GFXA 2PI5A 4KE5A 4Q8FA 3FSYA 3BBBA 4P75A 1P8GA 4DQSA 4E2FB 1KQSR 3DHXA 1E6YA 1RP5A 2M7SA 3IP0A 2KHDA 3W61A 3K17A 2OI2A 3G6XA 1SB6A 4EBDA 2BKNA 2VA3A 5D0GA 3HLUA 2FVRA 4GVLA 3SCJE 1RK8A 3G6YA 2V2KA 4DSKA 1Y11A 4CT8A 4WYWA 3MI7X 1ZAXA 8ATCB 4ER8A 3C2PA 1CJKB 2LU1A 5E3QA 1GNKA 4A4JA 1J5EF 3Q2SC 4CM0A 5GAHU 2WB4A 3DOKA 4OLPA 3PXGa 3HHLC 4QZVB 3I82A 1DTQB 2HFVA 2OEKA 2VG6B 3KJQB 2JDJA 4XDCA 3GR0A 1X8DA 2XMWA 1H3DA 2VFTA 3LALA 1HWJA 3F56A 3QGPA 2AD9A 2GMLA 4DL4A 1ULRA 2HQCA 4FF3A 3A4TA 2ZH6A 3R5JB 2G1HA 2E1PA 1FCAA 3UPFA 4NRTA 2MKJA 1LWXA 2JOQA 1RGVA 1FNOA 2BE2A 4LVNP 1Q0NA 4RNFA 2GJFA 3JAMU 1YBUA 5CXTA 5EUHA 1YLXA 1TVRA 1NK7A 2ZBRA 5D3GA 3WDOA 4M95A 2HBRB 3CJ3A 2KRBA 4IH5A 3MM9A 5E0OA 5FDLA 2GJ2A 3SCLE 3JSMA 3IM8A 3JXOA 4LF7F 3L95X 2V68A 1I94J 5A0YB 3HCXA 4YHHF 4XAKA 2KG1A 4LF4J 3EYZA 4M5JA 5KT3A 3GIRA 2CPYA 3VCDA 2NXEA 1ROFA 2HHPA 2J8SA 1YSJA 3UR0A 3H40A 4KGKA 5T41A 1WJ9A 1VDHA 1WOPA 2YKOA 2DRAA 3LOUA 2IA6A 1WTBA 5DLFA 4P10A 3VAJA 2OFGX 4DL7A 1U6FA 2XQCA 2CZ4A 3R6GB 3G8SA 3FBFA 4UW2A 3WC0A 4OI0A 1OWXA 1RJJA 3FZBA 1T95A 2PSZA 2O3DA 1FJGJ 4MTPA 1S9EA 4QWBA 1NPRA 1HBUA 2R2SA 2F40A 4NLRA 1XK8A 2ATLA 2MB0B 3SCIE 2COLA 1WG4A 3SI8A 3LGMA 3MMCB 2HNYB 4TVAB 2Z30B 4DG1A 2DK2A 3CD6S 2KB2A 3H2VE 1M5PC 2XNRA 3KUEA 5DZ6A 3ZNJ1 3R2CJ 3BV8A 1JLBB 2K06A 4N8OA 4NLWA 3DFEA 2V4JB 3I55S 4JI1J 2VOOA 4M5MA 1VQ7S 2BE9B 3OTOJ 2UV8A 3THPA 5B0DA 5IQ6A 3GILA 1WG5A 5J1EB 1KONA 2VPWB 1C1BB 1NPKA 2RQMA 3ITHA 1VHFA 3FC9A 2CG8A 3W9IA 1ZS6A 3MECA 4HHHA 2QA2A 3UD5A 3BJYA 1TV6A 2YWGA 4TNOA 4ZLJA 1S1UA 4Y6IA 3J7ZT 2KXFA 3G87A 2V9KA 1MWYA 3MPUB 2XBPA 3FZ2A 1SV5B 5ETPA 2VQEJ 4KC5A 2J0XA 1WG1A 4ZHRB 3CCZA 4MK8A 1DAXA 3AOBA 4DV4J 3MM5A 3RB0A 5U47A 3Q86A 3VZIA 3NNHA 4QYRA 2VKZG 2FHJD 1CJVA 1NSKL 2CJBA 1Q8KA 3HD1A 1NDPA 1B0VA 4QYZJ 3J7YI 3FRZA 2X1FA 2YQ1A 3DOMB 1RYSA 3RYLA 2DPIA 3TWZA 3IRWP 3J7Z5 1KBRA 2UVRA 3KHLA 2YNGB 2VBWA 4RL1A 3HFVA 1CS4A 3BO2A 3CO0P 4OV6A 4URSA 4ZOSA 4ZLPA 1MMDA 1NJWA 2W4CA 4UOCA 2Y0BB 3NXZA 3ZTSA 4FN5A 1RAIB 4LRAA 1IWAA 3M9NB 2XGPA 3OQ2A 3EGZA 4DSJA 2RSQA 5J2MB 3BEGB 1JLFB 3PYEA 5EX3A 2D7SA 4OX9J 4R8UA 2DO0A 1VBKA 3PX4A 3EZ5A 1XMOJ 1IKXB 3G86A 1FFWB 2L41A 2FHMA 5CQGA 2IYIA 2AEFA 2NXJA 1DURA 1LFWA 8AT1B 1O0PA 3GCWP 2GV1A 4WFBQ 1D3WA 3ZTOA 5L1IA 2FC8A 3HHNB 3HULA 2ROPA 4P2SA 2UV8G 3NBPA 4B9NA 3QNWB 1X5PA 2DNMA 3CO9A 4LQ9A 2V8GA 4AT1B 1S4FA 2VFRA 1LK7A 2D1CA 2P9EA 2VG5A 1OY8A 4ZN3A 3MOZA 3OFHA 5FLXY 1NH8A 5HP1A 2ZJPQ 1SUQA 1VOMA 4DUYJ 2F9DA 1MNEA 4IYQA 4DFMA 2OO4A 1H7XA 5HVHA 2Z0GA 5B0EA 4MJKA 5L9XA 1X60A 1R0AA 3EWGA 1FRLA 1HBNA 5BYRA 2ZZMA 2C1EB 4KV8A 3N6MA 4O3SA 5J1PA 1HA1A 5J1NA 2RDIA 3M2VA 3CDBA 2KT3A 1FDDA 3HSDA 4GO5X 2MGZA 3MWBA 4M5HA 4J9UE 3OL9A 5I3UA 2F65A 3U7JA 3I96A 1Q82T 2PFDA 4AE5A 4X62F 4CH0S 2YX7A 4IFVB 3WC2A 3PVXA 1SJFA 5IV4A 4RZRA 2G2YA 4HDGA 1KKHA 4C97A 4LF8F 2DHSA 4OYWA 3TX8A 4J9SA 1YX2A 3PHEA 1S0MA 1YRTA 2HHQA 2DNQA 1L3KA 3AXKA 2OPQB 1J5EJ 3DRSA 4ZVUB 5EGYA 5HBMA 3TQ1A 3DYAA 2FB0A 1NM2A 1W2BR 3PDNA 3C6UA 2DHHA 4PG5A 1N8RT 3RBXA 2ZH9A 2J0QD 2QX0A 1KOHA 5KFWA 3QMQA 3M8QA 3OHBA 3I9ZA 1EAYC 1WNEA 3VWSA 4FS2A 2ZH1A 2YX4A 4F67A 3GJSB 1VRTB 2XS7A 1WSRA 3IXQA 2X1AA 1WUUA 2OPRB 5DDQC 1DLOA 4KSEB 2KHCA 2VOPA 1YBAA 2K7JA 5KG6A 4GC6A 3QSIA 3NGUA 2EFVA 2CRLA 1NCLA 1S4EA 2UUWA 2CNNB 2XULA 2FHOB 2MZSA 1YDLA 3J80U 3LWLA 3T3FA 1K9MT 1TL3B 2MLYA 2P2CB 1YI2S 1OYEA 5DG9A 3IWNC 4C8OA 2YKMA 4ILMA 3NY0A 1F0XA 2XLIA 4FF4A 2P8IA 2ZUGA 1JJHA 4LF7J 1RT5B 2OPSB 3FNNA 4YHHJ 5HQLA 4KKOB 1VGYA 3FRYA 2H51B 3TA0A 1CJKA 4U7UK 1S72S 4CO0A 3HVTB 1F3VA 4YMEA 4Z37A 5KFXA 2QSWA 2GNKA 2YNIA 3ETOA 4CNZA 4DUTA 3F41A 2RAQA 1TK0A 3AFGA 4AD6A 1ZA1B 2B5JA 1FNXH 4BCAA 4YB6A 3C16A 3PV8A 4YQWA 2VODA 5CZXA 1J27A 1X9SA 5KFBA 4ES1A 5DQIA 3S01A 3DRYA 4K2JA 3DM2B 4NL5A 4YY3F 2VHGA 2J6TA 1RWXB 3DXSX 1IR2A 4B3SJ 3MM8B 1CC7A 3IGVA 2QMWA 1U1OA 4V19X 4Q45A 1YZ7A 4EU0A 2E1RA 1TL1A 3POTB 3MUVP 3M30A 3GZ7A 3BQ2A 1XMBA 3JYTA 2R7TA 3KLIB 1RBOB 3C8YA 1FE4A 2CDRB 3L7PA 1VIOA 2XHWA 3IS9A 3W9JA 5A0YA 4OZ0A 5HJYA 2DTJA 3TUZC 4CDIA 4PPDA 2CQ0A 3E01B 2UU9F 1RHRB 4CO4A 4WXOA 1RT1A 3OL7A 4YOEA 1NPPA 2MKIA 3CF5Q 3DU5A 3T6JA 3MXHP 2BQRA 2X3DA 2HEKA 2GMHA 1D09B 1BHNA 4QYZK 4J9OA 2N7YA 2R7VA 2HFNA 3FBCA 3P3DA 3MMJA 4QR0A 1EETA 1XTZA 2VB6A 4EGLA 3G82A 3CDWA 4ZDNA 4NYOA 2A1BA 4J90A 2VUGA 1NHVA 2H48B 3IC1A 4MFBB 2RIJA 1XR7A 3WIUA 3OTDA 1WC0A 2HQIA 2ZWOA 2DR6A 5KFRA 3I4HX 4D3HA 2HHWA 1WF0A 1BQXA 2ZH3A 3IGNA 1Y0HA 2VF3A 3I6PA 3JTNA 2ZOFA 2BKPA 2LQ8A 3ZTRA 3IBCB 1RT6A 3R7SB 3HVAA 2W9BB 1K1QA 3IWXA 4B3RF 5B7WA 1XJWB 1D1UA 1PC4A 1HBOB 4LT6A 4LQ3A 4PYDA 3TP2A 2L9WA 2UVVA 1TELA 3C6TB 4YEAA 3BREA 4WBFA 5KFKA 4F7VA 5LMNF 3ZZRA 3LQVA 1X0FA 1WC4A 2FLLA 2K3IA 4HL9A 2R2UA 2FTRA 3PJ9A 4ZPTR 2YNFB 5CYMB 2IBOA 5J1EA 4KFBB 1C1BA 3KFWX 4EYIB 2V2ZA 2MY7A 2Y0SD 1T8EA 3G71S 2WW4A 1TFYA 1M1GA 3MMBB 4FF1A 1LFPA 3WHIA 5CA5A 2E9RX 2JX2A 2C3MA 2Q3PA 2OSQA 4FP9A 4GVBB 2KG0A 4FNHA 2HW3A 4IDKA 1SV5A 1ZZNA 3CC7S 2IJFA 1FEHA 4DX6A 1JX4A 4ALZA 2LA6A 5AT1B 4ZHRA 2IC3B 1RKIA 5IM0B 2CVIA 3HSGA 1FI4A
chains in the Genus database with same CATH topology
1MMNA 4DV7F 2KJWA 3C6UB 1C4AA 3FEXB 1Q81T 2JVRA 5A8KB 1TQLA 2CG4A 3B82A 1VQYA 3MMAA 4ERDA 1N33F 2MJUA 1NH7A 2C3OA 2BE2B 4KBIA 1U1KA 4NYZA 3VAIA 4PG6A 3LPYA 1VQ4S 3T5KA 3UQSA 1S9FA 5DJBA 4G1PA 1U1RA 2K8GA 4F4WA 1OSCA 3DOMA 4MIBA 4OJ1A 1D8ZA 4QU6A 3MFIA 3LP1B 5HLFB 2D3ZA 3MAHA 4G6VB 4JI7F 3SEOA 1TVRB 5CH7B 4ZMMA 4RW6B 1MWZA 3CCVS 2VG7A 4WIIA 2QLWA 3CC4S 2Y1IA 3LF0A 1FHTA 2LCWA 5KG3A 2WTFA 1XEZA 2FVQA 4PXCA 2VBXA 3K5LA 1VFJA 2MKSA 1P6TA 2HFZA 1MW7A 5KAKA 1WD6A 4C0BA 5KG5A 3PKMA 4PQUA 1UETA 2LKZA 5DM7Q 1NKEA 2MXYA 1G7CB 4ID8A 2C28A 3I32A 2HHTA 1VQ5S 5HI7A 3G8TA 1FK9B 3S8SA 2YKNA 5C24B 2YWFA 4O44A 4L3NA 4IG0A 4JV2A 1OIAA 5J2NA 4MYUA 1QAXA 4F4KA 4DQQA 4ECZA 1LW0A 3SFUA 4DS5A 1U8SA 2DB1A 2E66A 3TVZA 4CZCA 2ZH2A 1VQ9S 4ICLA 5HN0A 3T19A 4C8KA 4OZJA 4ZP6A 2I9SA 3KHGA 2E5IA 5EHHA 4BC7A 3NCPA 1C0TA 2O66A 1OPIA 1Y5IB 2GMJA 4HI2A 5SUHA 2ZVSA 5KTQA 3I0RB 3QWPA 3KMQA 1U1NA 5F8JA 2YKMB 4I2QB 3UCUP 1FRHA 5EWFA 2CQCA 1P1LA 3KG1A 4NLDA 2ZJRQ 1C0UB 1JLCA 3DOLA 4DR6F 4J9KA 1UAWA 4DFPA 3MEGB 5D8HB 2B7CB 3IFEA 1NKBA 3BGRA 1MU2B 3PIOQ 2KM8B 4FBTA 3HHDA 3OHAA 1SC6A 2CPEA 4FVCA 2KT5A 1R8BA 5AXLA 4DR2F 3CSKA 4CO1A 3CXCR 4Q0BA 4J9PA 2DR9A 4WKRA 1FVSA 1IBKF 1IKXA 1NAQA 1S6QA 4V19J 2MZ1A 2RRAA 2G0CA 2PN6A 1HNIA 2IFXA 2RE1A 3QPIA 1FD2A 2JFKA 4NLTA 4B17A 4TQSA 2YNHA 3RB4A 2A10A 2R8KA 2GX8A 4RNMA 4TU9A 2R8JA 1YJNS 1Y5NB 2FJWA 4PWDB 4JI0F 1RT3A 1IJFB 3OXGA 5DO2A 2YWEA 1LXNA 2B7BB 2QV6A 3UW1A 3K59A 1HR0F 5K8OA 1KQGB 1WHWA 1T94A 2YNIB 1R7IA 3KYLA 4PG7A 2AJ0A 1FJEB 1KQKA 1F2GA 3MDFA 5KFVA 5CCMA 3ISNC 4Z2XA 2BYCA 2OMOA 4DR4F 4OZNA 4RBVA 3T9ZA 1BY9A 3T9NA 4OHZA 2MKHA 2W24A 2B5JB 3ZZUA 1VQPS 5KG1A 3CCLS 3M4XA 4WXWA 4X4VA 1JJ2R 2VPZB 4GKKF 2XCPA 4Q8EA 4MH8A 4CH7A 3JSBA 2QFJA 5A8RB 3ONQA 5KT6A 1VBXA 2LXIA 2XWYA 4LF5F 4C0HA 4WZQA 1RWUA 1LWEB 1H2VZ 2EI5A 1BQMA 2XNQA 2HQ3A 1R8CA 2KU7A 3VAGA