2YNGB

Hiv-1 reverse transcriptase in complex with inhibitor gsk560
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
424
structure length
411
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Rational Design of Potent Non-Nucleoside Inhibitors of HIV-1 Reverse Transcriptase.
pubmed doi rcsb
source organism Hiv-1 m\:b_hxb2r
total genus 114
structure length 411
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2yngB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yngB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yngB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yngB03
1FK9A 2HNDA 1TP7A 3DOLB 4IRCA 3DOKA 5F8HA 3HKWA 3UR0A 3RAXA 3KHLA 1BQNA 1R0AA 5KFXA 2GIRA 2R8HA 1GX6A 2IM1A 2YKMA 3DYAA 2ZKUA 3OSNA 5F8GA 2BQ3A 4RW9A 3JSMB 4G1QA 4J9QA 4ZP6A 2C2EA 1J5OB 4RW4A 2OPRB 5C25B 4Q44A 4ZHRB 5EUHA 5HP1A 2IAJA 3IG1A 3I0SB 1RT4B 3KLGA 4ZVFA 1S1VA 4RNMA 4IH6A 2VG7B 1TKZA 3KK2B 4YP3A 3C6UA 2W9CA 4JV2A 3NGDA 5KFLA 3BJYA 1S10A 4EYIB 2RDIA 3QGGA 4IR9A 2HNZA 4TY9A 3NAIA 1OS5A 4NLOA 1RTIA 1UWBA 5FDLB 3KK1A 3CJ3A 3FDSA 3DMJA 4HYKA 5KFVA 1T3NA 5I42B 4M94A 3PR4A 2I5JB 4O4GB 3EPGA 4TXSA 1S1UA 1JLBA 2B43A 5C42B 4EBEA 1C1CA 4QWCA 3PW0A 4R0EA 3DOLA 1N48A 3IGNA 4DL7A 1HPZB 4H4OB 3C6TB 1EETB 2IC3B 4I7FB 4IRKA 1NNDA 4NRTA 2WTFA 3JSMA 3BQ0A 4IR1A 4Y3CA 3T19A 4NLXA 3CJ0A 2XWYA 1J5OA 3RB6A 1DLOB 4ZHRA 3FQLA 1RT5A 2FVCA 3CWJA 1DTQB 4Q0BB 1TQLA 5KFYA 3NBPB 3E51A 1S97A 2VG7A 3QZ7A 1LW2B 2ASDA 3KHGA 2YNGB 4KO0B 4K4YA 3PW5A 1U09A 4NLSA 1S6PB 3KK3A 4DL4A 3RB4A 4XO0A 5FDLA 4O3QA 2ALZA 3Q8PB 1RT1B 4O3SA 3LP2B 2B5JB 1JLCB 4KFBB 3H5SA 1JLEA 3PJXA 2ASJA 3KMQA 1IKVB 1BQMA 2IM2A 1VRUA 4O4GA 3V6JA 3G6VA 3FFIB 5J2PB 5C42A 2V4QA 4WE1B 2HWHA 2RKIB 5J2QB 3KLVA 4K4WA 3E01B 2YKNB 3M9NB 5L1LA 1CSJA 3GV8B 1XR5A 1HPZA 2ZE2A 4H4OA 4YR3A 5F8JA 1S1XB 3C6TA 2HWIA 1TKXA 3DLGB 5DG7A 1LWFA 3DLEB 3RBEA 1LW0B 1EETA 2IC3A 4I7FA 5J2NB 1DTTB 5KFSA 3H5YA 5J2MB 4J9OA 2ILZA 4KB7A 4QWBA 1DLOA 1S0NA 3V4IB 4Q0BA 3GIJA 4MFBB 3H59A 4WFXA 1W25A 2AX0A 1LW2A 4TYBA 2YNGA 4MK8A 4KO0A 4H4MB 2R2UA 2FVQA 1YVFA 2VA2A 4RW7A 1SUQB 5K14A 1S6PA 4MK9A 4NLTA 5F9NA 3CJ4A 4J9SA 1HNIB 4IKAA 3TAMB 2WRMA 4ECYA 4EO8A 2B5JA 3QIPB 4Y2CA 1JLCA 3BQ2A 1LWEB 2CKWA 4ZPAA 5KFTA 3PW2A 1IKVA 3H5XA 2E9RX 3QLHA 1RT3B 2ASLA 3FFIA 5J2PA 3H40A 2RKIA 5J2QA 3DLKB 5I3UB 2YKNA 4O3NA 1RYRA 1T05A 2YNHB 4MIBA 1S1XA 3GIKA 1IKYA 4O44B 2AGOA 3DLEA 4ECXA 1LW0A 3IS9A 4ECVA 4K4VA 5J2NA 1DTTA 4G3IA 3BSOA 1HQUA 1RT6B 3FSIA 5KG7A 5J1EA 5KFBA 2CJQA 3OHAA 1NHUA 3G6XA 1REVA 3BSNA 4MKBA 4F4ZA 2R8JA 5T14A 1KLMA 5KFIA 2XCPA 4ECUA 3BSCA 4ZP8A 2HMIB 5F8IA 4DL6A 4QW9A 2XC9A 3CDWA 4ZMMA 4NCGA 4U6PA 4H4MA 3FQKA 5DQHA 3OLBA 4WFYA 4IH5A 2R8IA 3DRPA 1SUQA 4EYHB 3MFHA 3GIMA 5KT7A 4EEYA 1HNIA 2FLPA 1HMVB 2RF2B 1TL1B 3TAMA 1S48A 5KFPA 3MFIA 1N4LA 1RDRA 3HVWA 1LWEA 3H4DA 4ECRA 3ITHA 4Y34A 2HNYB 3QGIA 1JLQB 3DRSB 2IM0A 4LQ9A 4NLDA 3OL9A 1JXLA 2JEGA 1S0MA 1TV6A 4RNHA 5KFMA 5KFKA 4IFVB 5I3UA 2FVPA 5KG4A 3PW4A 3M8PB 5KT4A 3UQSA 4IH7A 4O44A 2V0NA 2JEIA 1EP4B 4QWEA 2UVUA 1RTJA 4NLUA 4ECWA 2C2RA 3N6MA 2AGQA 2V9WA 1RT6A 3IRXA 4O3RA 1JIHA 2IMWP 3CJ2A 2W9BB 3I0RB 4KSEB 2HMIA 4F50A 1T03B 3T5HA 3RB3A 4ICLB 1RTDA 4X2BA 3BQ1A 3CJ5A 2WCXA 5HLFB 5KT2A 1HMVA 2RF2A 1TL1A 1GX5A 4Q8FA 3ICLA 1D0EA 2OPSB 2HNYA 4LSLB 1JLQA 4ID5B 1HYSB 2BANB 4ECQA 1N56A 3M8QB 1S0OA 3DM2B 2RDJA 2OPRA 5C25A 5L1IA 4IFVA 3I0SA 1RT4A 3M8PA 5HROB 2BE2B 2JEJA 3KK2A 2W7OA 3TQ1A 1SH3A 4FBUA 2I1RA 3NL0A 3QZ8A 3T5LA 4TLRA 4I2PB 2WHOA 3I5CA 2D3UA 4MIAA 3MEGB 1C0TB 5KFZA 2UUWA 2D41A 3DRRB 3MEEB 4NLVA 4ECZA 1ZETA 3G6YA 2YNIB 3KNAA 4R8UB 2GIQA 2ILYA 4F4XA 2B6AB 3KLHB 5KG5A 4ZVEA 3LALA 2W9BA 4IG3B 4RUCA 1C1BB 5I42A 4ED8A 4KKOB 1I6JA 5EWEA 2I5JA 1T03A 3T5JA 4ICLA 4IFYB 1S9EB 1RA7A 4QPXA 5KFHA 4KV8B 3MEDB 5HLFA 2BRKA 4ZP7A 5KG3A 4I2QB 4J9MA 1JLAB 4DEZA 3VQSA 1HQEB 2OPSA 3QO9B 3V81B 2J6SA 1HYSA 3QGHA 4ID5A 2E9TA 2BANA 4WYLA 3M8QA 1C0UB 3ISND 3LP0B 1S9GB 3DM2A 4M95A 5L1KA 3LP1B 4K4ZA 2FLLA 1QE1B 3M9MB 1DTQA 1S49A 2D3ZA 2QV6A 4O3OA 5KG0A 5C5JA 4FBTA 3NBPA 2BE2A 4JUZA 5DLGA 1S6QB 3LAMA 4WXOA 3BR9A 4NYZA 2ATLA 2WOMB 4PUOB 3I5AA 5DQIA 3Q8QB 1VRTB 2XI3A 2OH2A 2W8LA 2GC8A 3DRRA 3MEEA 2AX1A 5KG2A 5L1JA 2YNIA 4R8UA 2JC1A 3KMSA 3MR3A 1IKXB 1RT1A 1TVRB 3LP2A 3KLHA 4TYAA 2BR0A 4KFBA 2D7SA 1RT7B 4KHRA 1C1BA 4WFZA 4KKOA 4MK7A 2VA3A 1WNEA 4O4RA 3HHKA 1TKTB 4IFYA 3KLFB 3MTKA 4IDKB 1S9EA 1SH2A 4K4UA 1RTHB 3MEDA 4WE1A 5EDWA 3BGRB 3E01A 4FS2A 3CO9A 5L9XA 3KLIB 3GQCA 4JV1A 4IOBA 4K4SA 3DI6B 1JLAA 3DLGA 1RA6A 2BRLA 2YNFB 3LAKA 3QO9A 3V81A 1FK9B 5J2MA 1C0UA 4WXWA 1S9GA 3GYNA 2C2DA 4HKQA 4KBIA 5CYMB 3G86A 3QYYA 1JX4A 5DGAA 4PQUB 1QE1A 3V4IA 4MFBA 4Y2AA 2C22A 3OLAA 2YKMB 1TL3B 4NLYA 1S6QA 3KLEB 5C24B 2AQ4A 1RT2B 3FRZA 4G1QB 4R5PB 2C28A 4PUOA 4ED7A 1QUVA 4NLQA 1VRTA 5DLFA 5HP1B 3IG1B 4GC7A 3KLGB 3RAQA 2FVSA 4B3OB 1N5YB 1TKZB 2J6UA 4KAIA 3C6UB 5KFRA 5KFDA 4ECSA 1C2PA 3QIPA 1LWCB 3D28A 3GV7B 1RT7A 2BQUA 4XPCA 4GC6A 2HNZB 2IM3A 4URGA 5KT3A 3ISNC 2UVVA 1NHVA 4KE5A 1TKTA 1RT3A 3KLFA 3KK1B 4IDKA 2R2SA 4NLPA 5KFFA 3H5UA 1RTHA 4WYWA 3DLKA 1KHWA 4H54A 4ED3A 1K1SA 2YNHA 3V6KA 3DI6A 2WK4A 3PR5B 4ZPDA 2UUTA 5JXSA 5DG9A 2XCAA 3CDUA 5DQGA 2J6TA 2FLNA 4RZRA 2XI2A 5CYMA 4Q8EA 1S9FA 4IG0B 1S4FA 4PQUA 4NLGA 3CVKA 3H4BA 4K50A 1TL3A 3BREA 3KLEA 2R8GA 5C24A 2W8KA 1RT2A 4R5PA 5CYQB 4EBDA 2O5DA 4DL3A 2F8EX 3EPIA 1RT5B 3PVXA 4IRDA 4FS1A 4U7CA 3Q8SB 4B3OA 1N5YA 2AWZA 4DG1B 2IJNA 2IA6A 5KFUA 4QWDA 1JLGB 3N6NA 1LWCA 2FJVA 3IN5A 2OPQB 3V6DB 4J9NA 3IGVA 4QWAA 2FJWA 1ZTWA 3DRSA 3KK3B 3H2LA 5KFQA 4KHMA 2IJFA 3GILA 2UVWA 4Q45A 5EWGA 1SV5B 4OL8A 3HVAA 1JLEB 5HBMB 3H98A 1BQMB 3DDKA 1VRUB 4ED0A 1S1TB 4RNOA 4K4TA 4WZMA 3I5BA 1EP4A 3HVTB 3LANA 5KFEA 5KG1A 3OSPA 1S1WB 5KFOA 5F9LA 2ZE2B 1JKHB 4XPEA 4IG0A 4TQRA 2W9AA 4F4WA 1TKXB 1XR6A 2QE5A 5DG8A 3GV5B 1LWFB 5KFCA 4F4YA 3V6HA 4ZP9A 4ED1A 4O3PA 2JEFA 3I0RA 4MKAA 2BQRA 4Q43A 4LQ3A 3JYTB 3MR5A 2R2TA 3SFGA 4IQXA 2DPIA 5CYQA 4J9LA 3KOAA 1MU2B 3T5KA 2FJXA 2JLEA 2V4RA 4NZ0A 5D3GB 4EO6A 3GIIA 4DG1A 1IM4A 3OL8A 4J9RA 3N6LA 1JLGA 4YR2A 2OPQA 3V6DA 1FKPB 3PJWA 1N6QB 4LSLA 1K1QA 3NKYA 4ZPBA 3UDLA 4RW7B 3BSAA 5K14B 5F8MA 3CIZA 3OHBA 2VG5B 4YQWA 2W7PA 3KHHA 3MECB 4J9PA 3OL6A 1SV5A 4YR0A 2FVRA 4ZVHA 5HBMA 2E9ZA 3MR2A 5HROA 4TY8B 3MF5A 3Q8RB 1S1TA 4RNFA 4RNNA 2ZD1B 5DGBA 3QLHB 2AU0A 1IKWB 3HVTA 1QAJA 1RAJA 2OPPB 1D1UA 4I2PA 4URQU 1S1WA 4NLRA 3MEGA 1C0TA 4RW6B 2R2RA 1Z4UA 2VG6B 3PHEA 1T05B 3KJVB 4PWDB 1JKHA 3SI8A 4DL5A 1T94A 5F8NA 1IKYB 3PZPA 4LSNB 1JLFB 2B6AA 1HNVB 2WONB 3IS9B 3CDEA 3SFUA 4IG3A 3MR6A 1HQUB 3PW7A 4RW8B 3JYTA 5J1EB 3NMAA 4RUAA 1REVB 1MU2A 4MH8A 4NRUA 3EZUA 2XGPA 4KV8A 4ZVGA 3OL7A 4K4XA 4RU9A 1KLMB 5D3GA 1FKOB 4I2QA 4NCGB 1HQEA 2WB4A 1FKPA 5KG6A 1N6QA 5KT6A 3DRPB 2HNDB 2HAIA 3LP0A 3TVKA 2VG5A 3RBDA 3DOKB 3LP1A 3M9OB 5KFGA 3MECA 4EBCA 1BQNB 1R0AB 4ED6A 1MMLA 3ITHB 1ZTTA 3T1AA 4WZQA 3DYAB 4TY8A 5KFNA 2UVRA 2DPJA 2ZD1A 4RW9B 3KHRA 1IKWA 5KT5A 2WOMA 5F8LA 5KFJA 2OPPA 1QAIA 4ED2A 4RW4B 2AGPA 1TV6B 2JC0A 1HARA 5EWFA 2IAJB 4RW6A 2R8KA 1S1VB 2VG6A 4PWDA 3KJVA 3UPFA 2W9CB 1XR7A 1IKXA 1TVRA 4LSNA 1JLFA 1HNVA 2WONA 3QIDA 1RTJB 3IRXB 4RW8A 4QW8A 4ZPCA 4ECTA 3D5MA 1KHVA 3RB0A 1RTIB 1UWBB 3DMJB 2XGQA 4JV0A 4URSA 5JUMA 2IBKA 5KFWA 3BGRA 2EC0A 5KFAA 4DL2A 3KLIA 4NLWA 4YMEA 1FKOA 4TN2A 1RYSA 1RTDB 1SH0A 1S1UB 3NAHA 2YNFA 1JLBB 4TQSA 1C1CB 4J9KA
chains in the Genus database with same CATH superfamily
5I3QA 1L3VA 4IRCA 1N32F 2M9KA 1HNXF 2B51A 3W9JA 3RAXA 2FJEB 3UD3P 6FD1A 4N8OA 2ZHOA 4HT5A 5F3TA 2VG7B 3J7A1 2GGPB 3ET6B 3EGWB 2PA8D 4P52A 3I55S 1OWXA 1UWBA 4CLKA 1KVKA 3Q2TC 3Q23A 2X51A 1WC0A 3TJ9A 4ED4A 3D67A 3IWNC 2NUHA 2PFFB 4M63A 4CYUB 2CPEA 5ETPA 4WBFA 1WKLA 4CO4A 2VODA 1J5OA 3DXBA 1RT5A 3M6XA 3NBPB 2BJ7A 3FEZA 4NLSA 5K8MA 2Q1LA 1NEEA 1S77D 1FJ7A 5J2PB 4ZLJA 1CSJA 3IC1A 2HWIA 1RQ0A 5DG7A 5CHCB 2QMXA 3FK4A 2Z30B 2QIFA 2LECA 3KG4A 2FVQA 2FDNA 3TAMB 4EO8A 1JLCA 1IR0A 4ZVUB 4DN9A 5CD4A 3KDOA 2CRLA 1IKYA 2AW0A 4K4VA 1DTTA 2UU9J 1HQUA 5KG7A 2CJQA 1REVA 4F4ZA 3D6MB 2KZMA 5F8IA 2HMIB 2H65B 1XK8A 1HNIA 2GV1A 3IWLA 4FYDA 1T9XA 2YKPA 3OTDA 4KC5A 2VFRA 2A10A 2C3OA 4YEAA 1TAQA 2MLYA 1RAEB 1U2CA 4DV3J 4LF9J 2QA4G 3VVTA 1DZ5A 2HBRB 3NL0A 4FBUA 1OJ4A 2GJ2A 3JSRA 2KM8B 4TLRA 3O3LA 2VQFJ 2MQMA 5B0AA 1JJ4A 3ETOA 2GW8A 3TZWA 4BLGA 2YNIB 3KNAA 4IG3B 2B9WA 2I5JA 4YDXA 1WJ9A 3CPWR 3FCHA 4EUVA 2VPYB 3PDNA 2H54B 1HQEB 2HRTA 3PNIA 1HYSA 3TX8A 1KC8T 4A4JA 2BANA 4K4ZA 1QE1B 1CC7A 2A6OA 4CZCA 1SCJB 4DFJA 2CJAA 3WDOA 2MZJA 1I1GA 4PRFA 3DRRA 3MEEA 1KSPA 3TA1A 3GFHA 1AYEA 3BEGB 4USVA 1YJTA 2Z58B 4L73A 2DGXA 2B4OA 1FK9B 2QMUB 1RWMB 2QO3A 2XS2A 1NLKL 5B0GA 2CAJA 1NSAA 4OQJA 2VJVA 4KE5A 4C11B 3DLKA 2EFNA 3MCOA 2Q3PA 4P73A 4JI7J 2RQMA 2J0QD 3C16B 5IV4A 5HK4A 4IG0B 4EU0A 5HANA 4WTYA 4F0MA 3CC2S 1WORA 3P49B 2FTRA 4Y0FA 4CO5A 2XLKA 2JVRA 1FHTA 3WIVA 3CMAS 4L75A 4F4YA 1W2BR 2KFZA 1GMWA 3CJ8A 4DX5A 5D3GB 4LF5F 1ZA1B 2QEXS 2DR6A 1FRXA 1LOUA 3NKYA 1FRJA 3KHHA 5HROA 2AU0A 2C2NA 3HVTA 5ETTA 3KTQA 2W25A 1JLFB 3CJQA 4JV5F 4YUDA 1AZSA 3OXLA 3PW7A 4RW8B 4MIWA 3UW1A 2DISA 4FYWB 5IFMA 3M2UB 1MWYA 1Q8IA 2RIJA 2FD2A 2X3GA 3C15A 3SBMA 4GO7X 2YKQA 4EBCA 1BQNB 3ZZZA 2ZD1A 2AGPA 3D1HA 2HURA 5DDRC 8ATCB 4LR7A 4KJIA 3BGRA 4NPOA 1ACMB 2E1AA 1SIZA 2OEMA 1CEZA 3IM9A 2MQNA 1VHIA 4AFFA 5B7WA 1J5EF 2I38A 3JSYA 2AJ2A 2R8HA 3DYAA 3GCXP 1RHUB 1PIEA 4IR9A 1U24A 2PDAA 3EGZA 3GP9A 4NLOA 2COLA 1FA0A 2HFZA 1U1PA 1IBCB 3HHLA 4FXDA 3ILIA 2J5AA 4IR1A 3GTYX 3HJFA 2AJ4A 4DCJB 2NXUA 2W24A 2PIIA 3PW5A 1R27B 5A8KB 5M2RA 2F8MA 1M1HA 4NEZA 1IKVB 2CQ4A 2IM2A 3J7AN 5FJ4A 2QC3A 2F5GA 2ZE2A 2JZ5A 1FWPA 1CQMA 1IUJA 1RZMA 4I7FA 2UUBF 4J9OA 4DR5F 5E41A 5B0CA 3V4IB 4PG8A 4MFBB 1K44A 2KHDA 3H59A 4FNHA 2DTJA 3B8HA 2LMIA 2M3DA 2VA2A 1ELOA 4DR7J 3VHQA 3T1HJ 4QZVB 3U27A 1EQMA 2XO7A 3BO3A 1FD2A 3QLHA 1OY6A 3D0GE 4DPTA 5G0RB 1S1XA 4AYBD 5CD4H 3CJTA 2LVWA 1XNRF 3OHAA 1HBMA 1UFKA 1FE4A 4NCGA 2DEJA 1KOOA 4H4KA 4LF7F 3MEKA 2YWGA 5D8HB 2CNOB 2P2CB 2ZNZA 1JNZB 2DO0A 3QGIA 2F9DA 3JXOA 3DRSB 2UXCF 4GKJJ 5KG4A 3D3BJ 4OX9F 2E5LF 3P3DA 4O3RA 2RUGA 1WC5A 2KZZA 2FGCA 3RB3A 1RTDA 1FJCA 3OVBA 3J81U 3CJ5A 5HLFB 2L9DA 2FIUA 3MXHP 4GRSA 2XMAA 1DQAA 3DM2B 3QT7A 2BJ9A 2OPRA 4YOEA 5CCMA 3GB0A 4DBQA 2B4UA 2AJ0A 3TWZA 4NLVA 4F4XA 5I42A 2XMUA 1GMVA 1RA7A 3MEDB 2BRKA 3J80Y 1WC6A 1HFEL 4CWBA 3QO9B 4LRFA 2KHCA 3U1MA 4RBTA 4A8KA 1GMUA 3LP0B 3HO1A 4ANCA 2HQDA 2BOAA 2LQBA 1KQFB 2F4VJ 1YHQS 5AJ3F 1LEOA 1URNA 5DLGA 2I0XA 4M5IA 4OZ5A 1XMQJ 2R7WA 5AXLA 2BR0A 2D7SA 3I6PA 2P9GA 1SH2A 2UUCJ 3EYZA 1JLAA 2LQJA 1HNWJ 4HKQA 2VFSA 2M5YA 3PACA 2CVIA 3K57A 4U95A 4F2SA 1CJTB 3TYTA 2QLWA 4NCAA 5F41A 1VC0A 3IA0A 1UFLA 4HH1A 1PYOB 2ERRA 3ENAA 4F02A 3H4BA 3NOGA 1B3TA 1MN9A 5KFUA 1JLGB 3FC9A 1RBAA 1BQXA 2IJFA 1VQKS 5FD1A 4NWBA 2OMLA 1EP4A 4FPIA 1RAIB 3GYXB 1U0HB 3BKFA 4L3KA 1TKXB 2XMVA 3DHXA 1EB0A 2E44A 4AQYJ 4CI0B 2XSJA 2JLEA 2Y9HA 3GIIA 2UU9F 4LSZB 3A12A 2PEHA 5K14B 5IT9U 4YQWA 2FHJA 3MECB 2CQ3A 5IQ6A 5D4PA 2LKZA 4TY8B 4ID8A 3R7NB 3MMAB 1IKWB 3DNCA 2OPPB 3CJSA 1B99A 4NI2A 1C0TA 1KP6A 2G0CA 1FRKA 2YWFA 3TARA 3JYTA 1AA1B 4EGLA 4QR0A 4D3GA 2ZH4A 2PD1A 1RHMB 3BR8A 3M9OB 5IZHA 2B4PA 4RW9B 5F3ZA 1QAIA 3RRGA 4DV3F 5IT0A 3QJJA 3W2WA 2QTWA 3IRXB 4Y65A 4QW8A 4ZPCA 2NR0A 4EZ6A 1F6TA 3FGVA 4ANEA 2NCKL 1WOOA 1RWKB 2VQFF 4PPZA 1VC6A 2DGUA 2L9NA 3DOKA 5ADZA 5E33A 5B0BA 3G8QA 3UCZP 4DX8H 3TQEA 1XNQJ 1NBEB 5CCLA 4JOUA 2KXFA 4FZVA 4NL5A 4C9DA 3D2WA 5LJ3Y 1WG5A 2AEFA 1PBAA 4N56A 4FKYA 1HPZB 4DL7A 1L3UA 3EUNA 2DNMA 2A6MA 1HA1A 2D69A 1AFIA 2EK6A 1O8BA 3KK3A 3NGRA 2K2PA 1NK5A 4O3SA 4PWWA 2HQFA 1HBUB 2HWHA 1XTZA 5BYQA 4FYYB 1K0TA 3GSDA 4Q0BA 3SCLE 3QWUA 4JI7F 2JSXA 4WTOB 3G96A 1T9VA 4OZ2A 1KRPA 5KOWA 5B0FA 3GIKA 4O44B 4KTQA 3IS9A 4G3IA 1RT6B 2KKHA 1KLMA 4UOCA 1RACB 2GMLA 3PX0A 4EYHB 3FJ2A 3V4MA 2RB7A 2YBVA 3ITHA 2UXDJ 3UWTA 4WJBA 3UDCA 1RKIA 1X60A 3IBWA 1CQNA 1V6HA 2I9SA 2FVPA 1NK4A 1P9QC 3BF4A 4P72A 4OZLA 3R7BB 5J1PA 5JMNA 4UW2A 3BYPA 1ZS6A 1H2VZ 2WCXA 4LF8J 1OY9A 1RWXB 4AL7A 1TL1A 1GX5A 1FWKA 3OTEA 5H9FJ 2GQQA 1WKJA 2HHHJ 5C25A 4W92B 1WWHA 4B9VA 2W7OA 4I2PB 5KTQA 4MIAA 3EDRB 3GLJA 2QYGA 5EWEA 2RJZA 1YJUA 4ICLA 3W63A 2V4JB 5KG3A 1NZ8A 4DEZA 1Q8KA 3QGHA 3LW5C 4M95A 2WW8A 2VIHA 3MM9B 5K8OA 2IJRA 1RBOB 1VRTB 1KTQA 3PX4A 2HBZB 3MR3A 2FB0A 1QD1A 1U1LA 1OSCA 3BM7A 4IFYA 3PEHA 3E01A 2QL7B 1N36F 2BRLA 2HVIA 1RP5A 1S9GA 1WC1A 4AUKA 4USMA 2KL8A 1PJ7A 4KAIA 3R7SB 2BMBA 1C2PA 2B7BB 1WSRA 2HNZB 4F67A 2V34A 3H5UA 3EXYA 1RCOB 3TNVA 1YDLA 2ZITA 2L08A 5DG9A 1Q79A 3QFHA 3HVRA 2DXFA 2XI2A 4NLGA 3KLEA 1RT2A 3CC4S 1QDUB 4EBDA 4K2XA 4X4NA 4QWDA 1LWCA 1R3NA 2DHSA 2OPQB 1FXDA 2H5EA 5EWGA 4WKRA 2GVZA 3I5BA 3WQPA 4L3NA 4DR7F 3PRBA 5KFOA 2U1AA 2M8HA 3HHDA 1CJKB 1Q16B 2BQRA 4HTIA 3PRVA 2FJXA 4HH0A 2PO4A 3IR5B 1X5OA 4MJKA 1UJ4A 3LH2S 4W90B 2VBZA 2VG5B 2C2OB 3AFGA 1UA0A 1Q5VA 4ZVHA 3OFGA 1S1TA 2UV8A 1QAJA 1OQ6A 4QPTA 2H4YB 1SKSA 4GKJF 1GH8A 2CQDA 5CAAA 1FKOB 4OZ1A 1QVFR 5KG6A 3OR1B 2XZDB 3R9LA 4HDHA 2IAJB 1YJ9S 4NCBA 4F25A 1TVRA 1RBLA 1TL7A 3O8WA 3HD2A 5F0WA 2CPZA 1SJ1A 1IWAA 5GAHU 2DXEA 3FSYA 4UY85 3KYLA 3S01A 4IOAQ 3AY0A 4TQSA 1C1CB 1SKRA 3BGFA 1MWZA 5KFXA 3M6VA 2C2EA 3LPYA 2VDHA 2VHGA 1GTHA 2OGUA 4QJVA 4ZCKA 3WC2A 3GPAA 3NWRA 4EYIB 1Z2ZA 2RDIA 1NK0A 4TKTA 2F4VF 3FDSA 3D0IE 1WD6A 4GKKJ 2VF3A 3EZ5A 1XMQF 4R0EA 2ZWOA 4H4OB 3PHTA 3K0JA 1J27A 2AYGA 4IRKA 1ZBTA 2WTFA 4KGZB 2KRBA 2UUCF 1FESA 2X7IA 3TVYA 2QL9B 2ROGA 4K2JA 1HNWF 3KHGA 1FDAA 1U09A 3SDEA 1Q8LA 2BA9A 4DPUA 1JLEA 1M0SA 2BW2A 2YQ1A 2MGZB 3MAAA 4WE1B 1VQLS 2YKNB 1OY8A 1MROB 3K7RA 1YGYA 2YQ0A 3W5YA 1X7VA 2XS5A 4HACB 4MK8A 1TFWA 3LGMA 3M8YA 5CXTA 1OMSA 1YK9A 2HHSA 5KFTA 3H5XA 3ZZYA 4K5SA 5J2QA 3OVSA 3ZZOA 3DLEA 4C8KA 2FHKA 3MCMA 2ABYA 4KHPJ 3KNGA 2XCPA 3T6JA 1IJFB 3CDWA 4H4MA 4IH5A 5D0HA 3W8PA 4I6AA 1GXLA 3VAFA 3QAUA 4N7TA 2BABA 3H4DA 1RDRA 4ECRA 1JLQB 4AQYF 2XMKA 1F9EB 1GT8A 4X64J 2D3O1 3N5BA 4I4BA 3VWSA 5I4MA 4ER8A 2O01C 3G6ES 3L7UA 4PYDA 1N0UA 3MHYA 2DCLA 2RSQA 1RT4A 2Z56B 4OJHA 3C14B 3T5LA 4F2RA 3CUNA 1LNQA 3KLHB 3PCOB 1WOSA 5D4OA 5IV3A 1WSVA 4JI8J 4LBHA 5E0OA 3W65A 4FVCA 3CGIA 2PE8A 3UVJB 2V2KA 5IC4B 3PG9A 2H9ZA 1NSPA 3LP1B 2HFOA 2ADCA 3LAMA 2BVZA 2NZCA 2NQPA 4PUOB 1DY3A 1O5JA 2DRBA 3H42A 1SQGA 4E0DA 1ZAVA 1FJEB 1CJUA 1Y10A 3GYNA 1JX4A 5DGAA 2NXJA 3HP6A 2ZBQA 4OIXA 3QJPA 2FZGB 5ETOA 4M5KA 1S0VA 1TKZB 4ES3A 1FFGB 4URGA 3ISNC 3BO2A 3AOAA 3KLFA 4N77A 4IDKA 3K89A 4PZVA 4DSEA 3ILOA 4CIOA 2DGWA 4XAKA 3G4SS 2QA4S 1IBMJ 2F8EX 2CVEA 4OYBA 3SXLA 1L3SA 4CDIA 2IA6A 3KWMA 2G2YA 1U1RA 1ZTWA 3MMCA 4DSKA 3C2PA 5GAEU 2VQEF 3RW7A 1U2RA 2J8AA 3M32A 1S99A 4XPEA 1OQ3A 3I0RA 2F1FA 4J9LA 1MU2B 4KGVB 1IJEB 3AA8A 2QSWA 1ZOTA 2VPXB 4QYZJ 3NNCA 3CIZA 4YR0A 4Q5VA 2PI4A 5C7PA 2ZJPQ 3PO5A 3MEGA 3D1QA 2KXHA 4F7VA 3KJVB 4B3TJ 3SSQA 1FX2A 2B6AA 1HNVB 2VKRA 4OZ3A 3LGNA 4DU7A 5IM0A 2CYYA 1FKPA 3MOZA 1YITS 2GMHA 3CC7S 1FEHA 1G2EA 2UUAJ 2F3JA 4LF8F 5KT5A 4MYTA 1E6YA 3CCJS 4HDGA 3TP2A 1IKXA 4OZJA 1U02A 4NASA 2HHHF 3SCJE 1FTRA 1UWBB 4B08A 3KLIA 3MAQA 3K5MA 3UI3A 2HFNA 3KHLA 2DR7A 3R1LA 5CZVA 2ZKUA 1J5OB 1NPRA 4M5DA 5E3CA 4IH6A 2U2FA 2OIHA 2CDRB 5LSLA 4TY9A 2IVYA 3DOMB 5D15A 4M94A 2DNYA 2J0WA 2KT2A 3TI0A 4OI6A 2V8PA 3QQCD 5H9FK 1FNOA 3R5AA 3BBBA 4ZS6A 1FD8A 3ETMA 3B6BA 2WSFC 4B9TA 2RH3A 3QZ7A 1FRMA 1DJ0A 3OBIA 3NY0A 1BHNA 1JLCB 3W61A 1VISA 4DX6A 1A7GE 2V4QA 4IQMA 3WBZA 3HMJG 2KN4A 1DTTB 4EZ9A 1BUXA 3P5BP 3J81Y 1SC1B 5K8NA 2ZUAA 1NDKA 3R5JB 5B0DA 1LW2A 4TYBA 2QFIA 2E7XA 3NLCA 5F9NA 1S57A 1HNIB 3NRBA 2ATCB 2HK2A 2CKWA 2ASLA 1H74A 3AQPA 3UDVA 4ECVA 2J7KA 2DNQA 2XLIA 4Y28C 4C8ZA 1WG4A 5D0RA 4FXWA 2B8PA 1GXTA 2VKZG 3DRPA 5JVGQ 2H4WB 4UY8T 4JI3J 5ETVA 2XYGB 4Q2LA 4PG7A 1YBTA 4DL0C 3OFEA 4ECWA 2V9WA 3UN3A 1SQFA 1R8AA 2EBGA 2HWTA 2RRAA 4X2BA 4BC7A 2B9YA 4FKXA 2HHUA 1HMVA 2CNNB 4WFBQ 2HLTA 1HYSB 2CA9A 3G8SA 3PIOQ 2BANB 2DRAA 3GCWP 2JNJA 5H9EJ 3K5PA 2VZ9A 3LO3A 2K7JA 3FVYA 3DRRB 3MEEB 1ZPWX 1YZ6A 2QN6B 4ZVRB 1F3FA 2IRYA 1MWQA 1PILA 5HO4A 1FVSA 2LU1A 1OPIA 1LK5A 3UNYA 4CLUA 2FLLA 5CH7B 1NJYA 2BE2A 2C2KB 4ENOA 2W8LA 2DR9A 4KFBA 1C1BA 2VA3A 3PFEA 5B09A 2YPYA 3EMTA 3GR1A 3M4XA 3M7VA 4RU2A 3DLGA 2YNFB 5FLXU 2DEIA 4OHZA 4KBIA 4OLPA 5ETKA 3IXQA 5A8RA 2HBQB 1F60B 1HR0F 1UPMB 3SMZA 4HEA9 3IG1B 2N4CA 3DN9A 5IT9Y 3QSIA 1CC8A 4NZ6A 4XPCA 3FBBA 5HQ8A 2FY1A 3MUVP 4U7UD 3GWCA 1RTHA 2EFVA 4ED3A 2YNHA 4EK2A 4KH1B 4PQUA 1RCXB 4K50A 1HWUA 5F0UA 1D9FA 1FI4A 2MKYA 1QUPA 2HSEB 3G9CA 4ZLPA 1SL0A 2CIMA 4QWAA 4HHJA 3T3FA 1S6OA 1WHVA 5K20B 1NRKA 1BQMB 1RABB 4RNOA 3HVTB 1B0TA 3KXDA 5KFEA 2G0JA 1T9UA 4K7QA 1XR6A 2VUGA 2BM1A 4ED1A 1AZSB 4IQXA 3SFGA 2VPWB 2HW3A 4L74A 2ADBA 4DPWA 4KHPF 2EEYA 1VS3A 4HT7A 1OYEA 4AL6A 2VBWA 3NGUA 4RO0A 2JJ4D 2FVRA 2E9ZA 4OYMA 2ZD1B 1Y7PA 2R2RA 4QU6A 4IUFA 3QRRA 4X64F 2YWWA 2K1RA 3J7YI 5J1EB 3VZHA 4FYXB 1VQMS 4I2QA 4JI1J 1U4BA 2OD4A 4DU8A 2UP1A 2LCWA 1P8GA 3PX6A 4C48A 3JB9k 1O6XA 3D68A 3DYAB 2DPJA 1TAUA 3KHRA 3KKFA 3G82B 4RBUA 2Z57B 4ZCIA 2WONA 2V2ZA 2LEPA 1NKBA 3FMWA 2F4FA 5HVFA 4JV0A 2OTJS 4V19X 1PYSB 2A1BA 1TP7A 2WVEA 1R0AA 1HKAA 3ZTPA 2NXNA 3PKYA 1H3DA 4J9QA 4V1Ak 4P71A 4RW4A 1RWNB 4Q44A 4KT0C 4A8YA 3C6UA 1FNXH 3W8GA 1WTFA 3QGGA 1LFWA 3F56A 1KQGB 5T7LA 3OTCA 2ZVSA 2MKIA 3DMJA 4G65A 2XG8A 1T3NA 1PYTA 3RRKA 2CZVC 4WIIA 5BR8J 3UO0A 4UZCA 4I7FB 4NRTA 1UEKA 1J2VA 1VJQA 3I56S 2B9EA 3RB4A 2M4MA 3Q8PB 3OUYA 3LP2B 4U67Q 1M5PC 3KMQA 4RLEA 2LDYA 2YH1A 3KLVA 1F5BA 4I64A 1S1XB 2XHWA 2HBYB 4PEOA 2C3UA 4OI2A 5J2MB 1WC3A 3MOJB 1HBMB 1FEEA 3ONQA 1VJWA 4WFXA 1HWIA 2QLXA 4YHHJ 5IS2A 3I9ZA 1JXVA 2W2QP 1IBMF 1U25A 4B02A 4UOGA 4C8MA 1RT3B 5U47A 5DRKA 4WU3A 2V8GA 3A4TA 2CPIA 2IMOA 1CBKA 4RR5A 2Q6CA 4ECXA 2DNGA 3BSNA 1IVZA 2CQBA 4WFYA 1NJZA 3O5TB 2BDPA 3TUZC 1FTCA 4LIRA 2ACMA 1PSDA 3OL9A 4RL1A 1KVJA 1SKUB 2JEIA 2IYGA 2C2RA 3N6MA 1T02A 4KSEB 3BYRA 2J9CA 3UNGC 1FJGJ 3W1YC 3MURP 2HVEA 4B3TF 4Q8FA 1KEKA 2ZFHA 2QLJB 5DM6Q 3DCAA 2GO8A 2OMOA 2I1RA 3ET6A 1HHTP 1CPZA 4J9VA 1U1NA 2PSZA 2PI5A 2UUAF 4I6YA 2AHOB 1Q1KA 1P27B 2FZCB 4QYZK 4KPYA 2LLZA 2XNRA 3VR1A 1JLAB 3VQSA 4ES1A 2J6SA 4A47A 4WYLA 1IBLJ 1H7XA 1RLCL 2QYCA 1IQZA 3EICA 3NBPA 4FXVA 3AB4B 3Q24A 5HL7Q 4NYZA 2E1MC 3PTWA 2YVSA 5KG2A 2DNNA 3AOBA 2KXNB 4K4UA 1RAAB 2A2CA 3OTOJ 3LF0A 1WTBA 4A46A 4X4SA 2MSSA 3QYYA 1Y5LB 2W7AA 4GO5X 1S6QA 1ICEB 1F2HA 4CT9A 3PRDA 2ROPA 3HULA 2H5JB 4EMDA 2ACYA 2MQOA 3KK1B 3TO8A 2R2SA 1GTEA 4NLPA 2ZH7A 3NXZA 2BV3A 2OTLS 1U6ZA 2BKOA 4ETZA 3JQJA 4LRBA 3I4HX 2MSTA 1PKUA 1OO0B 2PC6A 4R5PA 3EPIA 2XSJB 3PVXA 2FC9A 4U7CA 4B3OA 3EX7B 2IJNA 4DPXA 2VICA 3B78A 5CYJA 2VFUA 3ZTRA 3A1YG 3H98A 3MD3A 4FF3A 1UJ6A 2EG1A 2YKOA 4NI2B 3TX0A 5F9LA 5LXRA 3GV5B 3VAHA 1LKZA 1M5SA 4Q43A 3RU0A 3JYTB 5CYQA 2H5IB 5D0EA 3ZZUA 4DR2J 2QA1A 2OD6A 2R8JA 1KNZA 4RW7B 2VOOA 2HFUA 1VBYA 5M2PA 3SFUA 4IG3A 4RUAA 4MH8A 1NJIT 3PY8A 3BDPA 4YS2A 2HGLA 4B3MJ 4K8RA 1HQEA 1PC4A 3D0HE 3K5LA 2MY7A 1QSLA 3DOKB 2CWKA 2NS1B 5E3QA 4C0BA 4WP8A 1ZTTA 3T1AA 1GMWD 2BXJA 5L38A 4RWXA 1TV6B 1GK8A 4DLEA 3HF5A 3B82A 3AAWB 1KHVA 3MR7A 2ZBPA 4UZBA 4DL2A 3I96A 3OQ2A 2JX2A 1FK9A 2HNDA 1CLFA 3HKWA 3I31A 3OSNA 4ZP6A 2FUG9 5EUHA 1DQ8A 1S1VA 3EVWA 4LFBJ 4JV2A 3Q8YA 5KFLA 3IFEA 5ETSA 1CVJA 1B64A 4NOHA 3SV4A 1JLBA 1T95A 1R8CA 4Q2MA 1Q7LB 4DFMA 2QL5B 2E1PA 4LREA 3CCUS 3RZAA 1D8YA 8AT1B 5H9EK 2R7TA 3H20A 4Q0BB 2N7YA 3JS9A 5L9NA 3ENQA 1JXEA 5K9FA 5LSRA 3H5SA 1SPBP 4ZVQB 3P5TL 3V6JA 4K4WA 2HKEA 2WSEC 3DDNA 1EETA 1WEZA 1RKJA 2F7VA 3H5YA 1V3SA 3RYLA 3GFXA 1RWVB 2Z4PA 3HHLD 2QJ3A 3J7Z5 3FNNA 3D6TB 1SJQA 2M88A 1VGYA 4CO0A 5E2QA 3BQ2A 2CXEA 2E9RX 3M2VA 3L3CA 4O3NA 4MIBA 3QBCA 3NEKA 4F0HA 5J2NA 3R8YA 3MM5A 4NMXA 1D09B 5KFIA 4DF8A 1VQ6S 5DQHA 3GJTB 3HSGA 1TL1B 1BGXT 3M2RB 4DDFA 4WFAQ 1LFPA 4JI5J 5DS7A 2AZ3A 4NLDA 2JEGA 4N8NA 4YN3B 2LA6A 2EPIA 3A3PB 4IH7A 2HHTA 2QG9B 2V0NA 2YWEA 1VQ7S 2CQIA 3OTBA 2RT3A 1XQIA 2KJWA 3D66A 4ZCMA 4GMKA 4ICLB 1KS2A 2E5IA 5CQGA 1RSCA 4JYAJ 2D1CA 4W98A 1X4GA 3D6FB 3ICLA 4C3KA 1S0OA 1N52B 5HVHA 4FNIA 2ZZTA 3BN4A 3I4PA 4JI1F 3TQ1A 3WHIA 2RAQA 4ES2A 3G6YA 3PYDA 4ZVEA 1T7PA 4FPRA 2ZBCA 4IFYB 2P6SA 3V5RA 4NXNJ 1XIQA 2OPSA 2A2DA 4ID5A 1S9GB 3K2YA 3GZ7A 3HSZA 4C8NA 1FRHA 2E5JA 3D7SB 3BR9A 4Z2XA 3I5AA 2ZHAA 3KMSA 5IWAJ 2OLWA 4M5HA 4WFZA 4KKOA 4MK7A 2V2QA 2ZJQQ 4FS2A 2Y1LB 1LXNA 4LUBA 3GQCA 1X9WA 3HT3A 1TMMA 3ADAC 1B70B 1C0UA 3KG0A 1YTYA 4MTPA 3IAM9 1FKAF 3V4IA 3MI7X 4MFBA 1U8WA 2F63A 4B17A 4DWIA 3KLEB 2AQ4A 1RT2B 2CJ9A 3FRZA 2C28A 5BR8F 4ZJQA 4GC7A 3RAQA 3KLGB 5KFRA 1LWCB 1U6FA 1HD0A 2RU9A 4WYWA 3I9V9 5G0RA 4LR8A 3DI6A 2DT9A 5JXSA 3CDUA 3S7RA 5DQGA 1SQEA 1KLNA 4Q8EA 1XMOJ 4M8LA 1EHWA 3M6UA 1PO6A 2DY9A 1UETA 2O5DA 4RX6A 5GMKa 3P4UB 1IR1A 1U0SA 4OX8A 3DRSA 2D74B 3UD5A 1MMNA 3QRPA 4YHHF 1S1TB 3D1OA 2EVZA 3G71S 2KFNA 4HLBA 5DG8A 2W2NP 2K8GA 3NGKA 1DARA 3CO0P 4B9MA 4I67A 3O44A 5EHHA 3BH7B 4P2SA 4A8OA 2IBOA 4PABA 2CZ4A 3OJSA 3UDLA 2GQCA 2E5HA 1FXLA 1SV5A 2MHNA 3DLLQ 3FEXB 1F3VA 3L7PA 1RAJA 3LTOA 3SI8A 4IO9Q 3NMAA 2EXUA 2CPFA 2Y1IA 1U45A 4RU9A 4GVBA 1HWLA 4A48A 2C42A 4DS5A 2MZ1A 3LP0A 1G1XA 4AT1B 1S59A 1TKDA 1FJGF 4X4OA 2Z2LA 2GAHC 2DD8S 4AE5A 3CCVS 5EWFA 2XB2D 2VBYA 5GMEA 3EGVA 1RTJB 2FHJD 4ECTA 3ZC4A 2B7CB 2BJ8A 4DSFA 1U2FA 2VC1A 1RYSA 1SH0A 2WVFA 1ZA2B 3VV2B 2DNOA 1S12A 4DLGA 1KFSA 3A13A 3ZNUA 3HHEA 2HHXA 2CPJA 2HFVA 3SDEB 1IBLF 4YY3J 2GJFA 2XMWA 4XK8C 5M2UA 2BYCA 1F1BB 1OIAA 4KRWA 2WSCC 4G1IA 3FEYB 1TK0A 1RK8A 3HDSA 3OTOF 4ZHRA 3CWJA 1DTQB 2DH8A 5KFYA 1FFWB 1ITPA 2LFVA 2ALZA 5I3PA 4LF4J 5C42A 5J2QB 4X4VA 2MYFA 1TKXA 3DLEB 2IC3A 2WB1D 4KB7A 2LP4A 3W5ZA 4QIGA 4QU7A 4H4MB 5K14A 2OELA 2OSRA 4X66J 3W9HA 1UVJA 3QIPB 1P9YA 3MMAA 3M8ZA 1VQYA 2GX8A 1K47A 1Q8BA 1UW9A 4ITSA 3THPA 2YQ3A 4HHUA 3FSIA 4DCPB 4MKBA 1UEUA 2J0XA 3AODA 3R5DA 2XC9A 3FQKA 1VYAA 1Y3JA 3ENVA 1SUQA 3Q2SC 4LBIA 3HJVA 2CJXB 1R0BG 4WP9A 4DR2F 4RNHA 5I3UA 3IR6B 2IPOB 4NLUA 4BC9A 2AGQA 3IRXA 1P6TA 2CDQA 4A8SA 3T5HA 2L3MA 2CQCA 3BQ1A 2ZOFA 3TJAA 5FLXY 4ZOSA 1X8DA 5KT2A 2YX1A 4ECQA 4UOHA 3RGIA 1ULRA 2P8IA 5BYRA 4B3MF 3QFWA 2JEJA 1KR4A 2KG1A 3VF0B 4K59A 1TUGB 2RHSB 5EX3A 3N28A 2LEAA 1YBUA 4CTAA 2QT7A 5GVQA 4ED8A 4RUCA 5DJBA 1PCAA 1CJUB 5KFHA 4KV8B 1RWPB 1E6VA 3KG1A 3NMRA 3Q8UA 1BY9A 4J9MA 3R3TA 3K8WA 2ZZMA 1X4BA 2KH9A 1N54B 4O3OA 5C5JA 1M1GA 2MMYA 4JUZA 1K9MT 3NWGA 5DDPC 3CULA 3BS9A 4QYRA 1T8EA 4R8UA 1KQSR 1HBUA 5THWA 4DXLA 3KLFB 4AL5A 4IDKB 1S9EA 4LFBF 4DPYA 4HTJA 1NJXA 3QSYB 4BCAA 1RA6A 3LAKA 3EXCX 4DOZA 4WXWA 3AXKA 2V50A 3OLAA 1EKSA 3HK2A 4NLQA 1UEVA 3CJRA 3CT9A 2FVSA 3CCWA 2XY7A 5KT3A 1SC6A 2WZ1A 2HHQA 3R5GA 2FQQB 3PO4A 1ZPVA 2FLNA 4QR2A 4M5LA 5CYMA 3IMQJ 2W01A 3TZYA 1S4EA 1KQKA 7AT1B 2DJWA 3MPYA 3VAGA 3N6NA 3IN5A 4J9NA 4NA3A 5KFQA 1UFWA 1RHJB 3HVAA 3MDFA 2F40A 3D6HB 2DGTA 3LANA 2KB2A 4CLFA 1CS4A 2J6UA 3NNHA 1LWFB 1Q95G 1V3ZA 4MKAA 4DSLA 4PG5A 2AYMA 3BPDA 5IM0B 4KR0B 2MJUA 1UPPA 1FKPB 4MYUA 4ZPBA 1K1QA 1X4DA 1RWOB 5A0YA 4B9NA 2DGSA 2KVQE 4ZJLA 3AD7C 2LQ5A 3OL6A 3MF5A 4R0JA 1HL6A 4I2PA 2QMWA 3UDEA 1PJ5A 4P10A 1MW7A 1T05B 4JI5F 3OFFA 1NZAA 1T11A 3TZXA 2V4JA 4PKDB 5KT6A 2HYIB 4DZDA 2HVDA 4L72B 4ED6A 4JP8A 3MM9A 4JYAF 4ILMA 4M5DB 1FERA 4UOFA 4PWDA 2PMWA 4LSNA 1HD1A 3RUBL 3NGTA 2O67A 3KFWX 5LSOA 3DGPB 2EC0A 4YMEA 5J1NA 3CCRS 3AJ1A 3DLJA 1XJWB 4ZCLA 2M70A 3MM6A 3R5BA 2B4VA 1WKKA 3T9NA 4QIEA 1YJNS 2V8VA 2HNZA 2XHCA 2ZJRQ 1HI8A 1RTIA 2DIVA 3ZNJ1 4HYKA 1B0VA 2B43A 3CJKA 5C2CA 1UL3A 4ILRA 5IWAF 3IGNA 2JRSA 4P2MA 1YG0A 3I32A 3JSMA 3Q89A 2XWYA 3BH6B 1LW2B 3E3XA 3SCIE 4K4YA 2PA3A 2L9WA 2OKQA 4O3QA 3NCQA 4MAKA 2CQGA 2EKYA 1B7YB 5DO2A 1R0CB 2HFSA 5HQMA 1CJKA 2W1BA 4YDDB 1UW4A 2W4PA 1B0PA 3ZZ0A 2ILZA 2M52A 5HMXA 3TZZA 3U7JA 3OFHA 1TL4A 2J9EA 1U47A 4NMLA 1XMOF 1HLWA 3X3UA 4LRCA 1HBNB 1NMEB 3FFIA 1QAXA 3H40A 2RKIA 1F2GA 2E1RA 3W60A 1TTHB 3VGVA 2KJVA 2AGOA 4LRAA 2OP5A 2ZC3A 1TZ0A 1KVIA 4ZP8A 5D0GA 4QW9A 2DNZA 3OLBA 1AXQA 4ZPTR 1PBUA 3PV8A 2XY5A 3IWXA 1FT8A 1HMVB 3OR1A 1S48A 3MMJA 2PMZD 3HVWA 2ZVIA 1WDTA 3H2VE 2NSCA 5IQQA 2IM0A 1UVNA 3C3LA 4UT4A 3PW4A 5DZ6A 1MMDA 4Y00A 2UVUA 3QMQA 3FRYA 4DV6J 4ZPVR 3W5XA 4CP5A 1CJVB 3R1HA 4PXCA 1Q81T 3OD2A 4LT6A 4KYZA 2GS8A 1D0EA 1PAUB 2DNKA 2EFPA 1RU1A 1SKWA 2FGOA 4KGXB 3KUHA 4C8OA 5LJ5Y 2RDJA 5L1IA 3EJMA 3M8PA 4LMZA 2XSFA 2BE2B 4DR6J 2MJNA 2E5GA 2D3UA 2UUWA 3ISZA 4F8RA 1HIYA 1C1BB 2M0GB 2XLJA 3W62A 1FO1A 4HVZA 3M8QA 4UQGA 3EWGA 3KJFB 3TUJC 3DLBA 2WOMB 2KT5A 3P45B 2OH2A 1U1MA 6FDRA 3QGPA 4RBVA 1RTHB 4WE1A 1IN0A 3CO9A 5L9XA 2GHWA 3VCDA 3CXCR 4K4SA 3SYZA 2EFOA 4YY3F 3T9ZA 2RQ4A 2C2DA 1R31A 1WDDA 4PQUB 1NK8A 4Y2AA 1WC4A 2YKMB 1Y3KA 4OHXA 5A8WA 4ALZA 5HP1B 2CQ1A 3THTA 1JQGA 4LF9F 2JH3A 1AB8A 1TKTA 4UUXA 2HAFA 3MPUB 4H54A 1K1SA 4ZLLA 3MM8B 3V6KA 2UUTA 2J6TA 1EQ0A 3C19A 1X0PA 1VDHA 5HSPA 4IRDA 1N5SA 3AT1B 1N5YA 4ELTA 3BO4A 4YB7A 2V8HA 2VBXA 2JHEA 1A9NB 3LOUA 4CNZA 4OL8A 1VRUB 1SC4B 1N5TA 1HI1A 1SL1A 2V69A 1UMJA 4FN5A 1VK3A 2R2TA 3KOAA 4WPAA 2AEJA 3BDEA 4BWMA 1RWWB 3UE2A 4DG1A 2KM8C 1R8HA 3V6DA 3P6YC 4DQIA 1KFDA 4OI0A 3ZO7A 2KRRA 5HBMA 1YLXA 1I3OB 1JJHA 3Q22A 2MKHA 3VZIA 2WONB 4NA2A 3CB4A 4K4XA 2X3DA 1XEZA 4DR4J 1FRLA 4C4WA 5E3AA 2Y0BB 2HHPA 1N6QA 2FHMA 3TVKA 3LP1A 2YWKA 1R0AB 1MG7A 1RI7A 4ED2A 4RW4B 2VC0A 3ILLA 2AF6A 4RW6A 5GAGI 3ZXWA 2ZUGA 3D4JA 1H2TZ 2VDIA 4LR9A 2H48B 1VQSA 3U1NA 5T7LB 2MZQA 3DMJB 4DR5J 3DRYA 3H2UB 3DLHA 5HN0A 2EG2A 5F8GA 5JVHQ 3LGHA 1TKZA 3KK2B 5LMNJ 4G1PA 4PXEA 2IHR1 4XIUA 1XNRJ 3QT5A 2EFQA 1SIWB 4J9UE 1S1UA 1Z1ZA 1VQPS 1N48A 4DSIA 3FUYA 1LK7A 2JOQA 1NNDA 1F9HA 4F4AA 1S97A 1DHMA 2GJIA 2J8SA 3WZ0A 4QQBA 2MQLA 3JTOA 5FDLA 3K58A 1RT1B 1FDNA 2O3DA 3EZOA 3GV8B 3C6TA 5ETLA 4ERDA 1G7CB 2ZH8A 1IBKJ 5CABA 4K0KJ 2QFJA 3CD7A 3IAS9 3TW0A 2YNGA 3OVAA 4KO0A 2LDIA 4OX6A 4NLTA 2B5JA 2Q43A 3PW2A 2XZWA 2DO4A 1XWLA 3DC2A 1LW0A 1ZM3A 1UWAA 3QNWB 3C66A 1WUUA 4ZN3A 3RRHA 2DBBA 2R8IA 1TFYA 3GIMA 4X4QA 1C4CA 1LWEA 4WIQA 3JSBA 1FDBA 3HZEA 4OHYA 1RLDA 5KFMA 1VCTA 3R97A 1NK6A 5KAKA 1FVQA 2CPHA 1RADB 2IMWP 1KBRA 3DXSX 5HJYA 1RAHB 2IYIA 2YPZA 2M8DB 3S1TA 4LSLB 2MXYA 2MLXA 4IFVA 1W7WA 3GYGA 3BN7A 1SH3A 2QGFB 2KG0A 1NPPA 3T1HF 2Y0SD 3DOMA 4ECZA 2AMCB 2ILYA 2G4BA 5KG5A 1X9SA 2KYXA 1X4HA 1T03A 4RJVA 2DH9A 4O0IA 3QAEA 3N01A 1T3OA 1W2IA 4CLZA 5HMYA 5BJRA 3DU6A 3U1LA 1QTNB 3PYEA 1S6QB 2B56A 3GONA 1BWVA 1H38A 1D8ZA 5L1JA 2JC1A 4HI2A 2APOA 4KHRA 3HLUA 2R42A 3MMBA 4F4KA 1WNEA 3HHKA 4O0NA 3MTKA 2G1DA 2I8EA 3HI9A 3MCSA 4IOBA 2RHQB 3V81A 4HL9A 2KT3A 3JQMA 3J7YU 3DDIA 1Y0HA 2NXEA 4DUTA 5L46A 1Q86T 3UN5A 2XWXA 2ZH5A 4G1QB 4R5PB 2LEBA 2BM0A 1R6VA 2LXIA 4B3OB 2ZM6J 2MKKA 2BQUA 3PKMA 3M1VB 3RTVA 3VGSA 1XN9A 1KN6A 4CH7A 2HK3A 2XCAA 3VGTA 2GNKA 5DDQC 1SJ4P 1EJ7L 2J0SD 1TL3A 4ZK7M 5CYQB 1X4EA 1QTMA 1N0VC 2AWZA 3R6GB 2HQ3A 4OLOA 4A8MP 3GU0A 1N34J 4QOTA 4I0WA 3E2EA 3OSPA 2DIUA 3KDNA 4YB6A 4QIVA 2QE5A 4O3PA 2V94A 2OEJA 3T1YJ 5MLCV 3L95X 2DPIA 5AXMA 4KGKA 1VLYA 2NXCA 5F8MA 1YKWA 1ZZFA 2K06A 2HVHA 4ANDA 3K59A 3HHNB 5DGBA 3MUMP 2GA7A 2V63A 4NLRA 4CLLA 1JKHA 3AD9C 4F3QA 2CPDA 1JNRB 2OO4A 3W2VB 4V19J 1APSA 4OZ0A 1GQEA 1PC5A 2GMJA 4D3HA 4DV6F 2HNDB 1EARA 3Q8VA 3IBFB 4DV4J 1VC5A 2XYHB 4I68A 5KFJA 5E5NA 1G3OA 1XBWA 3DGVA 1S1VB 2VG6A 5FIIA 2E7WA 2UZAA 1WHYA 4Z37A 1HNZJ 1JK9B 4ZITA 4DR6F 4OJGA 2C2MB 5ETMA 2YNFA 1JLBB 1AW0A 2IVMA 5LL6d 4M5MA 2XY6A 2BQ3A 4B9SA 5HATA 1EIYB 2VASA 4ETXA 2BJDA 3IG1A 3I0SB 2GAGC 2W9CA 1D9AA 2UXBJ 1OS5A 1LXJA 4WKYA 3FBCA 1NKCA 3CD0A 4BHQA 4USKA 1X5SA 1L5UA 2BOPA 3UCUP 2G0IA 3I82A 5LMUJ 1EZZB 3DOLA 4NA1A 1M1KT 3GJSB 4JI4J 1ZM4A 2ALYB 1EETB 2EFGA 3T19A 3HFZB 2AEMA 4IYQA 4CM2A 1TQLA 4TU7A 4DFPA 1NXIA 1BQMA 3RAMA 2DHAA 3M2VB 5DETA 1D3WA 3DRXA 1UTAA 1JJCB 3L4BC 5J2NB 5KFSA 3FBEA 2MKJA 3MM5B 2R7VA 3VVUA 4TNOA 1DLOA 3F41A 5GADI 4P6QA 2FZKB 3GIJA 3C8YA 3ZFVA 3RW6A 2R2UA 2R7XA 4EI2A 3CJ4A 4USHA 4Y2CA 2CJYB 2PMHA 2VV5A 4CNYA 3GE9A 4OYAA 1XNQF 3W9IA 1FWLA 5A6WA 3K5NA 3BSOA 5J1EA 2NUUG 4DR1J 1BE4A 2V9KA 4DL6A 2HG4A 2KFYA 1FF2A 3HZGA 1KD1T 4J90A 1YJRA 3G82A 1NUEA 3BPSP 2CG4A 4YFUA 1N36J 2M2BA 1N5QA 1H2UX 1JIHA 4ZLNA 2C3YA 2YXLA 4X65J 2RF2A 1H73A 4B3SJ 5L8RC 2BZ2A 2VH7A 3P8BB 2OPSB 4ID5B 1N56A 1BMQB 2B9XA 2CQHA 2RU3A 4DR4F 1XERA 2IIHA 1RE1B 1M5VC 1M90T 3R27A 1AUDA 2CNLB 4OI3A 1B7FA 4OI4A 1ZETA 2X1FA 4OYWA 2AJQA 1NJWA 3LALA 2W9BA 1TK5A 2J7WA 4KKOB 3H25A 4OX7A 1BD6A 1URRA 3L09A 3F0NA 2E9TA 1C0UB 3LWMA 1HW8A 1S49A 3I87A 3H0PA 2ATLA 5HAOA 5DQIA 4MKYA 2XI3A 2GC8A 3AJDA 2UXDF 3LP2A 4TYAA 2RDDA 2WVCA 4O4RA 2LXFA 1VQNS 3G8TA 5LMNF 2N82B 3UR3C 3DI6B 2QRRA 5J2MA 2NLWA 4R25A 3UCGA 1QUVA 3CCZA 2OAUA 4DMZA 3EDQB 4HR2A 3EM1A 4ECSA 1HW9A 3GV7B 3D28A 1HBOA 1RT7A 1NHVA 1RT3A 1UVMA 4L6V3 4RPFA 2JFKA 4E8UA 1KHWA 2N4DA 5HMWA 3RBXA 3HFVA 1QSYA 3ZZRA 3BREA 4C3LA 5T41A 2IDEA 1RT5B 4B3RJ 1LWXA 4M5NA 1IBKF 2BBEA 4KHMA 2UVWA 4K0KF 5D78A 4Y2IA 1SV5B 3EE3A 5A76A 2EBEA 1R89A 3X1LB 4TQRA 2W9AA 3RR8A 1U1KA 2JEFA 2ZH9A 3KUEA 2W4DA 2G9OA 2V4RA 4C0HA 4GVBB 5A2QU 2FY8A 4ZA1A 4FF2A 4LIWA 1S79A 2MEWA 4RNNA 1CULA 3OR2A 3MD1A 1IKYB 3PZPA 1Y5NB 3DU5A 3CDEA 1HQUB 1TU0B 2AP6A 2RVJA 1REVB 1TELA 1VLOA 4J5OA 2LYVA 3A8JA 3BGOP 2RS8A 3IO1A 3M30A 1VFJA 5F8LA 4PAAA 2JFDA 1UVIA 2DB1A 2RD5C 3D5MA 1QSSA 3M05A 3BBCA 1WELA 1KKHA 3CMQA 2WBMA 4XDCA 5F8HA 3EGNA 1ZM2A 4ZHRB 4X4PA 4J37A 3NGDA 3BJYA 2FHOB 5HMZA 3NAIA 3KK1A 3CJ3A 4CQ1A 3P96A 1U8SA 3AB2B 3PR4A 1P1LA 2I5JB 5C42B 4DUYJ 3N9UC 5LXYA 4FVMA 2IC3B 3OW2R 4JI2J 1K73T 1DURA 2W2OP 3HSJA 3KJNB 1VK8A 1YX2A 2Q79A 3G87A 4XO0A 4UQTA 3OXGA 4O4GA 4CLTA 2ZM6F 5F8JA 1REGX 3M6WA 4QWBA 2P5VA 1ZAXA 2CQ0A 1W25A 2AX0A 2B3TB 3K17A 1YVFA 2G2OA 4RW7A 1SUQB 3N79A 1S6PA 3B4MA 1I94J 4C97A 2QZ8A 4NZ7A 4USJC 2DKOB 2WVDA 3DLKB 5I3UB 2GFFA 1N34F 4DV7J 2BUNA 2YX7A 1Y9OA 1NHUA 2LXUA 3ZZPA 2Z2ZA 4GKKF 3H8YA 3BSCA 2MKCA 4U6PA 2ZH2A 2O1PA 3RJMB 4OJ1A 3T1YF 3QRQA 4QCLA 2GQ2A 1JXLA 1TV6A 4WP3A 2KU7A 4WU2A 4ATNA 1ZM9A 2HVZA 5SUHA 3HD1A 2OSQA 2HS3A 3CJ2A 3KJQB 3BZQA 4CTAB 4DQQA 2VL1A 3AH6A 4U96A 1ZH5A 5D6GA 1E6VB 4CH1A 2GHVC 4Y6IA 5RUBA 1Q5YA 1X4AA 2HNYA 1H72C 4CRJA 3PYGA 1R8PA 2AZ1A 3ILJA 1N33J 1VIXA 5HROB 1WI8A 4CLWA 5K8PA 5A6PA 4DV4F 4R8UB 2R4FA 1HWKA 2D9OA 1S9EB 4X4UA 3HCXA 3VAMA 2G1HA 1TL5A 1F0XA 3HFKA 1HNZF 3C15B 2GO9A 2KYZA 4FBTA 2D3ZA 5KG0A 3PEJA 4F3OA 1N88A 2VQEJ 1ZAWA 5IT4A 4DV1J 1LQ9A 2GZOA 1NSKL 5EN1A 2Y1RI 4WFNQ 4JBCA 1SXLA 1T0TV 2V67A 3BGRB 4JV1A 4ZPWR 4CLPA 2UXBF 4CLYA 7FDRA 2B8QA 5CYMB 3TA2A 1H0HB 2J7UA 4NLYA 2BACA 5LMUF 2QLFB 2QLBB 3NG8A 3PXGa 5DLFA 4JI4F 2ZDPA 3VAKA 2N3LA 1TR0A 4M1KA 4TU9A 1S76D 3HHLB 4B9UA 1CS4B 4RZRA 3CVKA 4JI8F 5E3PA 5C24A 3ZZTA 1FRIA 3Q8SB 2LU2A 3M2RA 3JTNA 2FJVA 2DHHA 2FJWA 4A8XA 5A0YB 3H2LA 2CQ2A 3MAHA 1DFDA 2GHPA 1KTVA 2JLFA 2IY5B 4DHVA 1X31C 2ZE2B 1OPZA 4EFAC 1WEYA 4LBPA 2HS0A 3SQGA 3T5KA 3POTA 1U7LA 5D4NA 4ELVA 3BSAA 4DR1F 3C46A 3RG6A 1JMTA 4RNFA 3QLHB 1MN7A 4AXIA 4C8YA 2F8HA 1S1WA 2MZSA 4PWDB 2QSFA 4LSNB 2DYAA 2E66A 3A8KA 3MZIA 2FJBB 1AROP 2Z8QA 4NCGB 1Q0NA 4DFKA 1FX4A 3N5FA 4PPDA 3SSSA 1RTZA 2A18A 3MM6B 1Q53A 1MNEA 5KFNA 4X65F 2R7UA 4B3SF 3D9BA 2IA0A 1Y00A 3BGUA 2KDOA 5AE1A 3RB0A 1RTIB 4ELUA 2IBKA 3THVA 4O23A 2G2ZA 2XMTA 3MM7A 1RTDB 3NAHA 5BYSA 3AD8C 6AT1B 3CJKB 1ZZNA 1YSJA 4F3MA 1Z2LA 2AYBA 1JWWA 4USIA 2IM1A 2RRBA 3JSMB 4GVLA 2GVDA 3LPEA 2OPRB 3KLGA 1NO8A 4RNMA 2QA2A 3L9ZA 3GMGA 1S7HA 2AIRB 5I42B 3AHPA 4DN0A 3CCQS 2ZZNA 1K0VA 4U7UK 3CD5A 4Q7AA 2ZC4A 1SC3B 5HQLA 4Y3CA 5HVGA 2I6WA 3CE8A 1NCLA 3E51A 2VG7A 3L7OA 2CWXA 2GGPA 2JVOA 4DL4A 1H98A 2JDJA 4ZVSB 4IOCQ 4OI1A 2A3JA 2R7OA 3FFIB 4DPOA 2RKIB 2XMMA 4CYUA 3QPIA 1Y11A 1DQ9A 4NYPA 2RS2A 2H51B 3OPKA 5KOXA 4RUBA 3WX8A 4G6VB 2SXLA 4IKAA 3AOCA 1RHRB 2VFTA 4WK1A 5J2PA 2DHGA 2V5HG 1RYRA 4B3RF 1U26A 1KOHA 1WF1A 1NAQA 5T14A 4LF2A 1NPKA 3NS5A 4ZMMA 3O2IA 3MFHA 2B0GA 3TAMA 4BS2A 1N4LA 1RJJA 2DY1A 2ZWPA 1RHKB 4LQ9A 3GSIA 2Y3YA 3M8PB 1OSDA 5KT4A 1FE0A 3AA9A 1EP4B 1RTJA 2YH0A 2ZDOA 1R6YA 4K5RA 2HMIA 4F50A 4LF1A 3NGSA 2MQ8A 2P6TA 1HR0J 1OYDA 2MY8A 3M8QB 3CCMS 2BEFA 4M5JA 3QZ8A 2HQIA 1UZHA 3I5CA 3JAMU 1C0TB 5KFZA 2D41A 2DNHA 2GIQA 2XO6A 2X1BA 1RGVA 4DQSA 2OHDA 1T9YA 4YB5A 3WC0A 3QJLA 3ISND 1NB7A 3CCLS 2E1CA 1DTQA 1O0PA 4ZVTB 5A8WB 1FXRA 2AX1A 2L48A 2YNIA 2JL9A 3W2WB 4JI3F 2Y1JA 4OZNA 1TKTB 1W26A 5EDWA 4U9RA 4YB1P 2DNLA 4KY3A 4OYXA 5LT5A 1MSWD 1QLNA 1QE1A 2C22A 5CA5A 2VONA 4OMFG 4DUYF 4DV0J 1N5YB 4TU8A 4JI2F 2BKNA 3QIPA 2IM3A 4FP9A 5KFFA 2RQCA 3ELHA 4USUA 4FF4A 4UF4A 2DNRA 2AJ1A 2R8GA 4DL3A 4U8YA 1WEXA 4DG1B 4X84A 3SZ2A 5DM7Q 3V6DB 3CDAA 3AQOA 3DHWC 3KK3B 1S7IA 3T41A 4C11A 4Q45A 1EKRA 4XTTA 1D9DA 1S72S 5HBMB 3DDKA 2NYIA 4K4TA 5EX0A 1G4CA 3C16A 4J91A 1I94F 1G6BA 4IG0A 5ETQA 2WVBA 1RAOA 5KFCA 1NH8A 4LQ3A 3MR5A 2XM3A 4NZ0A 4Y2MA 1S5ZA 4CO3A 4DV7F 2F9JA 4PG6A 1NB2A 1N6QB 2Z2YB 4DX7A 2W7PA 4J9PA 4TLQA 2MZRA 4TVAB 3IM8A 1WF2A 5B08A 4RW6B 3LUYA 1T94A 1HI0P 4NYOA 3IS9B 3W7BA 1VOMA 4NRUA 4KV8A 4ZVGA 2OFHX 1KLMB 5D3GA 2ZH3A 1IM6A 2LQ8A 4ZVPB 2LA4A 1MMLA 3ITHB 3K5OA 3GFYA 1DBDA 1RAGB 5AXKA 2JC0A 1HARA 2R8KA 2ROEA 2NZ4A 3D54A 2O66A 3MPWA 1JLFA 2DVIA 1Q4RA 3QIDA 1N33F 2KVIA 4P2XA 4RW8A 2CG8A 3GG1A 1GEHA 3CEDA 5KFAA 4NLWA 4TN2A 3M2UA 1S1UB 4WWSA 1VHFA 4X62J 2XQCA 1KWMA 4E2FB 2EW9A 1BQNA 4LFCJ 3SIPB 5C25B 3PM9A 1M5OC 2AV5A 3FZBA 1WG1A 1VRQC 1Q82T 4CO2A 1QVGR 3ZTSA 5FDLB 2ZH6A 4OV6A 4L76A 3MWBA 3EPGA 1YIJS 2J9DE 4DV1F 4FYVB 1H7WA 3OV7A 3MCNA 3C6TB 1VMBA 1M5KC 1NSQA 3BQ0A 2DXDA 3FQLA 3NS7B 3R5CA 1RB0A 3EVMA 2YNGB 4KO0B 2CJBA 3R2CJ 1U1QA 3IR7B 4OV1A 3CSKA 1VQ4S 1VI7A 2B5JB 2KI2A 2ASJA 3PJXA 1VBKA 5AXNA 1S6UA 2J9DA 4DF4A 3E01B 1NDCA 4IO1A 4CH0S 2AJFE 3QT8A 4C98A 4YR3A 3M8RA 1LWFA 1LW0B 1EX8A 3A3NB 1NKEA 3GIRA 4OFZA 3FCVA 2BE9B 1UJ5A 2VOPA 4DR3J 2BJEA 4LFAJ 2IFXA 4MK9A 5A8KA 1EAYC 1LWEB 4ZPAA 1IKVA 3TUIC 2DR5A 3NNAA 3S8SA 1QM9A 4OJ3A 1T05A 1NDPA 4P75A 4OYPA 1F5CA 4ECUA 5AE3A 1KDNA 2FC8A 2XULA 3HPOA 3AXMA 5KT7A 1GNKA 2RE1A 3JTPA 3MFIA 4Y34A 2R7QA 3CF5Q 5GMDA 3R2DJ 1H6KX 4IFVB 1GAOA 4AD6A 3UQSA 2GVZB 4PXBA 3HHLC 2D9PA 3GJRB 2DCUB 3UN2A 4N5SA 1PG5B 3DGPA 4M5GA 1SJFA 1T03B 4LF6J 1MLAA 2OI2A 3IBCB 2CUYA 3B54A 3FSXA 4KPCA 2GCFA 3TRGA 2CFXA 2JLGA 2EWHA 1UVKA 1HWJA 1QY7A 4N47A 4EWTA 2RRNA 5E7OB 1YQHA 3MMBB 3T5JA 4C2MA 1RAFB 5IC6B 2OJ3A 5HLFA 1UZDA 3BV8A 4FF1A 2R7SA 3V81B 2PGCA 3M8SA 3DM2A 3FKBA 2OFGX 4QIWD 3M9MB 3GFZA 3QT6A 3TEGA 1RU2A 1AT1B 1TVRB 1TL7B 3A8IA 3MEDA 3ZTOA 9RUBA 3QO9A 3MUTP 3N4WA 2YWHA 4DUZJ 4BDPA 4H4KC 5ETNA 1A6LA 2HHWA 3G86A 1YJWS 4S0MA 1SBRA 2EK1A 1TL3B 1Y5IB 4ZJOA 1SVDA 5A2QY 4ED7A 2R3VA 2BJ3A 2NPIA 2HRUA 4NX9A 1HBNA 3BBFA 2E29A 1DRZA 3TR5A 3MPVA 2HEKA 5GAGU 4A8FA 2WK4A 5DDOC 2G13A 2V8DA 1SL2A 1S9FA 4X4RA 3HKZD 1S4FA 1VR6A 2AD9A 3ENWA 1XC9A 1WI6A 8RUCA 2HQCA 4A8WA 4P74A 3U02A 1CJTA 2RUSA 3D3CJ 3GILA 1F5AA 5G4DA 1X0FA 4F36A 1JLEB 1NDLA 5HI7A 7FD1A 5JJBA 4DS4A 4ED0A 3FCWA 3WIUA 2ZNYA 3MAAB 2OUGA 2CJKA 2HZCA 2DR8A 1JKHB 4QR1A 2XTJP 1PJ6A 4NXMJ 1CJVA 4BBYA 2C1EB 4JI6J 1O51A 1IM4A 3OL8A 3N6LA 1JLGA 1IWGA 1AUSL 4C8LA 1KONA 2OEKA 1YRUA 2HGNA 2CNKB 2MQQA 2UV8G 3PHEA 2VG6B 1U0HA 1UVLA 2XNQA 2DNPA 3QATA 3OT9A 2ZKTA 1PAEX 2HS4A 1TUWA 3FBFA 2XGPA 3EZUA 4DQRA 3NOCA 4N76A 2XMJA 4OHWA 2WB4A 2HAIA 3MECA 5EGYA 2K3IA 4TY8A 3TEHB 1IKWA 2WOMA 2OPPA 4HI1A 3UPFA 2W9CB 2CQPA 4DV2J 1JB0C 9ATCB 2XS7A 3BGLA 2R7RA 4Z7CA 4URSA 5KFWA 3W64A 1T9TA 1GXUA 5LM7E 1CG2A 3UD4P 2YKAA 4J9KA 4DI6A 1N5VA 3DOLB 1WHWA 1SJRA 2GIRA 2YKMA 4RW9A 3N0VA 3Q86A 1R7IA 5HP1A 2KTQA 1RT4B 3MGJA 1RUSA 2AT1B 4F26A 2YX4A 3CMES 2MLZA 2X1AA 1WOPA 2LQ9A 3MM8A 4TXSA 4QWCA 4P9SA 3F44A 4PXDA 1B4SA 4B9LA 1VQ5S 2DGOA 1FCAA 3CJ0A 3RB6A 1DLOB 2DK2A 3EVOA 2FVCA 2ASDA 2FLOA 1PGZA 2RNEA 2Y8WA 3SV3A 4I56A 4DCOB 1VRUA 4W4MA 4DV0F 1N8RT 3M9NB 5L1LA 5SZTA 1HPZA 3WX4A 3FMBA 1FFSB 5IXUA 1Q7YT 1I51B 3NCPA 2NYHA 3US5A 5D77A 4PCQA 4USTA 2XEXA 1YRXA 1P1TA 4J9SA 4ECYA 1BC6A 4NEYA 1VQ9S 1Q78A 2K7KA 5GAHI 3J7ZT 2ZHBA 3VGUA 1VIOA 2KO1A 5MAOA 4ZIVA 5KFBA 2Q6BA 3PIPQ 3PJ9A 4EEYA 2RF2B 4PQAA 3VAJA 1NK9A 2DITA 3MMCB 2W2MP 1S0MA 2EC2A 3HT0A 4JI0J 4O44A 3M32B 2N7CA 1VBZA 4USWA 1RT6A 3F73A 2HGMA 1UP1A 2W9BB 3I0RB 4DV5J 3VAIA 4C6AA 4ZIWA 3CW2C 4OYIA 1WACA 3E8OA 3TJ8A 3SQOP 3KK2A 2WHOA 3MEGB 2DH7A 4AXJA 1N32J 2B6AB 1HNXJ 3MPDA 2V2VA 2W4CA 4OHVA 4QPXA 1M5HA 3NS6A 4PR6A 5L1KA 1U1OA 3O1LA 4JB8B 4X62F 4WXOA 1E6YB 1IKXB 1RT1A 4LFCF 3BKUA 1HBOB 1RT7B 1X9MA 4KGMA 3CIMA 2HPUA 2MTLA 2L41A 3KLIB 3RBZA 3LA0A 4WF9Q 2HIQA 2IRXA 2MZTA 2FYXA 3A8EA 5D4LA 1U6BA 1VRTA 2P9EA 4RKUC 4WCEQ 2Z2MA 4GC6A 2HHVA 2MQPA 1QJHA 3T6BA 3IP0A 4KH0B 3PR5B 4ZPDA 2F65A 3J80U 1XMBA 3TVZA 3G2XA 2VB6A 4FS1A 1X5PA 1X5TA 4NXNF 3B4DA 2MDAA 2AYEA 3IGVA 4LVNP 2MB0B 5DZ7A 4DR3F 4PYAA 4WZMA 4LFAF 1CULB 3OR2B 1SJ3P 1NH7A 3H7HB 3V6HA 3M8WA 1I5OB 4U8VA 2DHXA 1L3KA 2EI5A 5K5MA 1VBXA 4UUWA 4J9RA 2C3PA 2IDLA 2OPQA 3PJWA 4LSLA 1IXKA 3NP5A 3M30B 1UCNA 4MT1A 3MR2A 3Q8RB 2HIYA 3PYFA 1V5VA 1D1UA 2CADA 3ULHA 1Z4UA 3RR7A 3DKDA 4MMOA 5F8NA 2POKA 3CCSS 2BX6A 1NHKL 4CO1A 3OL7A 1RXOB 1X4CA 1UA1A 3LQVA 2RILA 4HHHA 3DRPB 5BXIA 2VG5A 5GADU 2YTCA 4CLSA 2UVRA 2V68A 2WBRA 1C4AA 4LF6F 2VFVA 2C3MA 4F04B 1XR7A 1HHSA 1SB6A 4RWWA 2NPFA 2XGQA 4CT8A 1FKOA 1DAXA 4RUHA 2YY3A 4C3MA 1TMJA 1U48A 2W2PP 3UR0A 4ILLA 1GX6A 3GR0A 4G1QA 3TAPA 2IAJA 3GG0A 4ZVFA 3HX9A 2N3OA 2ZOMA 5GAEI 4YP3A 4Z7YA 1S10A 3VTIA 1HHQA 2WW4A 3M1VA 3VQTA 5KFVA 3HM9A 3CD6S 2HZVA 4O4GB 4EBEA 1C1CA 3PW0A 2ZEJA 3MTJA 2PT0A 2C2ZB 4I6WA 4X4TA 1V3RA 4DJBA 4NLXA 3OJUA 3H90A 4BWJA 2NSBA 4KQZA 1LV5A 4DUZF 3CNQP 5H1SV 2RQKA 1S6PB 4KFBB 1HQ2A 1L3TA 1NK7A 3G6VA 2ZH1A 1XR5A 4H4OA 1NM2A 3DLGB 3TAQA 3RBEA 1TUVA 4P7VA 2DGVA 4ZDNA 2HRYA 1S0NA 4FDFA 2PN6A 2Z0GA 5A8RB 4LJMA 5ITHA 3TA0A 2WRMA 1QAYA 4QIFA 5HJXA 1F9FA 2MGZA 3W66A 5C2GA 2IRUA 1UKUA 2YKNA 3JAMY 4J7CA 1A0OB 2YNHB 1MROA 4LF5J 2IVFB 4Y2KA 3A3OB 3G6XA 3CDBA 3HXMA 2AKWB 3W2VA 1VQ8S 4ED5A 3V2UC 4HACA 3W3SA 2K3KA 4ZVOB 4DZ6A 4NXMF 2XZTB 2FLPA 5KFPA 2HNYB 2BJ1A 5IOLA 1YBAA 4JV5J 2H3EB 4JI6F 1BXNA 5KFKA 2RMLA 1IQTA 2H1YA 4QWEA 4N41A 1R8BA 4LF4F 3TANA 3HSDA 1V9OA 4C7QA 3AJ2A 3JQKA 3ZTQA 4XDDA 2PEBA 4PG4A 1JLQA 2VD3A 2HZAA 1FDDA 4OYZA 4CCHA 2BKPA 3VALA 3I0SA 3QWPA 2PFDA 2NREA 2ZBIA 3TUPA 1RHQB 4X66F 1YRTA 2DRDA 4LRDA 2I2YA 1J5EJ 2CZ9A 4ZKAA 4OYOA 2K1RB 1I6JA 2MKSA 4I1TA 5B0EA 1YWXA 4ZP7A 3SSRA 4DV2F 4I2QB 2JWNA 5AT1B 3BKTA 4PWUA 2ZOGA 3S6EA 3IRWP 2XBPA 2VU5A 1X4FA 2QV6A 1TK8A 1ZYQA 1YI2S 3C14A 3Q8QB 3CCES 4UTGA 3KLHA 1U49A 5ETRA 3GJQB 3DFEA 4P7TA 3UVJA 5E3RA 4E98A 1K8AT 3O6QA 1GFWB 3K8VA 3SEOA 1VQOS 4I69A 5C24B 4PUOA 3FZ2A 1YJVA 2FPHX 2HQGA 3BB5A 3C6UB 5KFDA 1BWEA 2Y8YA 2A0FB 2MHEA 2UVVA 2ASYA 1SI9A 3CCTA 2UUBJ 2P9CA 2FJDB 2MPUA 4CM0A 3LWLA 4MKVA 1UAWA 4A8QA 2V6AA 4C0OC 2W8KA 3SQGB 3POTB 4LVOP 2M7SA 1AFJA 2EKNA 3Q83A 2J76E 4QBUA 2X1GA 1JJ2R 3OUYB 2QX0A 5KG1A 2DGQA 1S1WB 4NE9C 4F4WA 4LF7J 1NU4A 4ZP9A 2WAQD 2HLUA 4ZN1A 5L39A 1RISA 3CTRA 4WK3A 2UXCJ 4EO6A 4YR2A 5AE2A 2CPYA 1RWUA 4P2FA 3OHBA 2VJUA 2E7VA 4OX9J 2E5LJ 1FNMA 5LOQA 4URQU 1R43A 3OXFA 2R9LA 4DL5A 1IR2A 1WHXA 3MR6A 4DQPA 1MU2A 4DSJA 1V5IB 1T9WA 4JI0F 3MM7B 5CZXA 2GIFA 2D3OR 2XYPB 3Q0AA 4KIAA 3RBDA 5KFGA 2VPZB 1YJ7A 1YZ7A 4DV5F 4WZQA 1WF0A 1Y4ZB 2GVDB 1ROFA 1BLUA 3KJVA 2Q66A 3SCKE 3J81j 1HNVA 3R6LB 3UFCX 2BW7A 2CPXA 5JUMA 4F0KA 2FJAB 2BE7D 3PFOA 3TOQA 5AJ3J 3NCRA 3KUGA 2ZBRA
chains in the Genus database with same CATH topology
5I3QA 1YSJA 4F3MA 1L3VA 4IRCA 1N32F 2M9KA 3MAQA 3K5MA 2B51A 1Z2LA 2HFNA 3UI3A 1HNXF 3RAXA 3KHLA 3DLJA 2FJEB 4ZCLA 2AYBA 2M70A 3UD3P 3MM6A 4USIA 3R1LA 2DR7A 1JWWA 6FD1A 5CZVA 3R5BA 4N8OA 2B4VA 2IM1A 2ZKUA 2RRBA 3JSMB 1J5OB 2ZHOA 2OPRB 4HT5A 3T9NA 4M5DA 3KLGA 5E3CA 1NO8A 4RNMA 5F3TA 4IH6A 2U2FA 2VG7B 3J7A1 2GGPB 2QA2A 4QIEA 3EGWB 1YJNS 2V8VA 3GMGA 2PA8D 2OIHA 2HNZA 1S7HA 2IVYA 1OWXA 4TY9A 5LSLA 3I55S 2ZJRQ 1HI8A 1RTIA 1UWBA 2DIVA 4HYKA 3Q2TC 1B0VA 3Q23A 2X51A 5I42B 4M94A 2DNYA 3AHPA 2J0WA 4DN0A 3CCQS 2KT2A 2ZZNA 3IWNC 3TI0A 2NUHA 4OI6A 2B43A 3CJKA 1FNOA 2PFFB 1UL3A 4M63A 2CPEA 4ILRA 4U7UK 1K0VA 3CD5A 3IGNA 3R5AA 5IWAF 4Q7AA 2JRSA 2ZC4A 4ZS6A 1FD8A 1YG0A 3I32A 4CO4A 2WSFC 3JSMA 4B9TA 4Y3CA 2VODA 2XWYA 1J5OA 3DXBA 1RT5A 3CE8A 2RH3A 3M6XA 3NBPB 3E51A 2VG7A 3QZ7A 3L7OA 1LW2B 2GGPA 3E3XA 3SCIE 4K4YA 2PA3A 1FRMA 2L9WA 1DJ0A 2JVOA 3FEZA 4NLSA 4DL4A 1H98A 2JDJA 2OKQA 3OBIA 4IOCQ 4O3QA 3NCQA 4OI1A 5K8MA 2Q1LA 1JLCB 2A3JA 4MAKA 1NEEA 2CQGA 2EKYA 2R7OA 5DO2A 1A7GE 1S77D 3FFIB 5J2PB 2V4QA 1FJ7A 4DPOA 2RKIB 2XMMA 3QPIA 1CSJA 4IQMA 3WBZA 3IC1A 2HWIA 1RQ0A 3HMJG 2KN4A 5DG7A 5CHCB 4YDDB 1DTTB 1UW4A 4EZ9A 2QMXA 2W4PA 1B0PA 3ZZ0A 2ILZA 2M52A 1DQ9A 5HMXA 4NYPA 2RS2A 3J81Y 5K8NA 3U7JA 3OFHA 3OPKA 1TL4A 5B0DA 5KOXA 2QIFA 1LW2A 2J9EA 4TYBA 2LECA 4NMLA 1U47A 2E7XA 3KG4A 2FVQA 1XMOF 3NLCA 2FDNA 5F9NA 4G6VB 2SXLA 1HNIB 4IKAA 3NRBA 3TAMB 3X3UA 4EO8A 1JLCA 1HBNB 2CKWA 2VFTA 4WK1A 2ASLA 1IR0A 3FFIA 5J2PA 1QAXA 3H40A 2RKIA 1F2GA 2DHGA 2V5HG 4DN9A 2E1RA 1RYRA 4B3RF 2CRLA 3AQPA 1U26A 1IKYA 1KOHA 2KJVA 2AGOA 2AW0A 4K4VA 4ECVA 1WF1A 2OP5A 1DTTA 2J7KA 1HQUA 2DNQA 5KG7A 2XLIA 1NAQA 2CJQA 2ZC3A 4Y28C 1REVA 4F4ZA 1TZ0A 5T14A 4C8ZA 1WG4A 1KVIA 2KZMA 4ZP8A 5F8IA 2HMIB 3NS5A 4FXWA 4QW9A 4ZMMA 2DNZA 3OLBA 1AXQA 4ZPTR 1GXTA 2VKZG 3DRPA 3O2IA 5JVGQ 3PV8A 1XK8A 2XY5A 3IWXA 1FT8A 3MFHA 2B0GA