1NSQA

Mechanism of phosphate transfer by nucleoside diphosphate kinase: x-ray structures of a phospho-histidine intermediate of the enzymes from drosophila and dictyostelium
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
152
structure length
151
Chain Sequence
AANKERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGLVNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPADSLPGTIRGDFCIQVGRNIIGSDAVESAEKEIALWFNEKELVTWTPAAKDWIYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title Mechanism of phosphate transfer by nucleoside diphosphate kinase: X-ray structures of the phosphohistidine intermediate of the enzymes from Drosophila and Dictyostelium.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Phosphotransferase
total genus 46
structure length 151
sequence length 152
chains with identical sequence B, C
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1995-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1nsqA00
5IOLA 3NGRA 1EHWA 3BH7B 3Q86A 4DUTA 3VGTA 3ZTOA 3Q8YA 3PRVA 1LWXA 4DZ6A 3Q83A 4F4AA 1WKKA 5CAAA 3EICA 5BXIA 1PKUA 3G2XA 3ZTQA 2VU5A 1HLWA 5C7PA 3NGSA 3DKDA 1U8WA 4W98A 1NHKL 3MPDA 1S57A 3NGUA 3ZTSA 4EK2A 3B6BA 1VYAA 1KDNA 1XQIA 1NDPA 4ANEA 3EMTA 4UOHA 1MN9A 4ENOA 1ZS6A 1BHNA 2B8QA 4UOFA 3VGVA 3VGSA 2AZ1A 2AZ3A 3BBCA 3EM1A 2HVEA 1NUEA 1MN7A 3Q89A 3FBEA 4FKXA 2HVDA 1F3FA 4CP5A 3VVUA 3FCWA 3ETMA 1WKJA 3JS9A 4ANDA 3L7UA 1NSKL 3BBBA 1BUXA 3ELHA 5CABA 1NCLA 3ZTPA 3EVMA 4F36A 1XIQA 2HURA 2BEFA 3GPAA 3FBFA 3VVTA 3FCVA 3BBFA 1PAEX 1NSPA 3EE3A 2B8PA 1WKLA 2BX6A 4FKYA 1JXVA 3BH6B 1NB2A 4KPCA 1NDKA 3EVOA 4O0NA 3R9LA 4DI6A 2DXEA 2ZUAA 1HIYA 3FBBA 1B99A 1NLKL 1UCNA 3GP9A 3EVWA 3FKBA 1NPKA 4ANCA 2NCKL 3WX8A 4C6AA 1BE4A 1S5ZA 1S59A 1HHQA 3FC9A 1F6TA 3PJ9A 3NGTA 3Q8VA 1NSQA 4S0MA 1W7WA 2DXFA 2DY9A 3Q8UA 1LEOA 4HR2A 2DXDA 2DYAA 3EJMA 3ENAA 3ZTRA 4WBFA 2CWKA 4UOGA 1NDCA 3VGUA 1NDLA 1B4SA 1K44A 3FBCA 3B54A 3DDIA
chains in the Genus database with same CATH superfamily
5IM0B 3NAIA 1WKKA 1SXLA 3BKTA 5AE3A 3POTB 5K20B 4ZITA 3OTBA 4AL5A 1NJYA 1LWEB 4OYOA 3KJVA 3DHWC 4OZ3A 3MMCA 3OL7A 4A8WA 4EO8A 1RE1B 3SDEA 4OYMA 1C2PA 2HQCA 1NU4A 2CYYA 2D9OA 2IVFB 5DZ7A 2BM1A 3RRHA 2RSQA 1U1PA 5D0RA 2YKNA 4N47A 1SUQA 4AL6A 3BS9A 3M1VB 5DGAA 4URSA 1FRJA 3RB3A 2DO0A 3O44A 1X60A 3AAWB 2PFDA 2IVYA 3R3TA 5DO2A 3S8SA 2DNRA 2PD1A 2ZM6F 4ZVOB 2UVWA 1GXLA 2XLIA 2E1CA 4ZHRA 2CWKA 4ZVUB 1N8RT 1FKAF 1NH8A 3PYGA 1FRLA 2QFIA 1ZM2A 5KFCA 2M8DB 4KFBB 2VPYB 4USUA 1LW0B 3KLIB 1NJZA 4DDFA 3GSDA 1KC8T 4PKDB 4O3QA 3UDLA 2OLWA 1J5OB 4TYAA 5BXIA 4A8FA 3FQLA 2GQCA 2WOMB 3H90A 2YNHB 2XMVA 4ANEA 1RT1A 3ZZZA 5F8MA 2B3TB 2LCWA 4KGVB 1TKZA 3W62A 1FFWB 1MMNA 2XEXA 3V4IB 3QRQA 2GVZB 2D3UA 3UDEA 4HHJA 2HAFA 1HWJA 2AP6A 2WVBA 4K0KJ 3CE8A 2XO7A 4TU8A 2YTCA 5IM0A 3ZO7A 3L7UA 4AXIA 2H5JB 4KRWA 2V8VA 1X4CA 3UWTA 3UN5A 2OEKA 3KG1A 3HXMA 4DQIA 3POTA 5G0RB 1CG2A 2HFOA 4KHRA 4TLQA 3ZZPA 4DU8A 3E01B 1U09A 1LWEA 1NZ8A 2VV5A 1U25A 2HGNA 4IRDA 3FCHA 4CT9A 2KT2A 2CJYB 3S1TA 4ZP6A 1K0TA 1HR0J 4HKQA 3UD5A 3U7JA 2HRYA 4KGKA 1WC1A 4M5JA 3M1VA 3IGNA 3EPIA 3ADAC 3K5NA 4KH0B 1OSCA 4UQTA 1A0OB 5CD4H 3O1LA 1B70B 1M5SA 3EGNA 3H20A 4FVCA 1KDNA 4QWBA 2C2ZB 5G4DA 1VJWA 3W9IA 5M2PA 1NO8A 3MOJB 4BLGA 2R2TA 3CNQP 1SC6A 3HCXA 3KNAA 4OYXA 3T19A 4JI0J 5EWGA 4YEAA 4RWWA 1VBKA 1UJ4A 4KFBA 1RP5A 3IG1B 3W5ZA 2AJ4A 3Q24A 1LW0A 4YB6A 4WFAQ 3KLIA 5E5NA 2HFZA 2VFVA 3QSYB 1J5OA 5DQGA 1YI2S 3LAMA 2WOMA 3CJQA 4LRAA 2YNHA 1SKUB 4DV7F 1KTQA 2BJEA 1I6JA 3H5SA 3U1LA 2KXNB 1WG1A 1BLUA 4LSNB 3L7OA 5K9FA 3I0RB 4Q45A 3V4IA 1GXUA 4FYDA 2GVZA 4I7FB 3HX9A 2LFVA 5KTQA 2WSCC 3BN7A 3QMQA 5F8JA 2N3LA 2HHSA 4IFVB 1HWUA 2I1RA 3K8VA 2B5JB 2LYVA 5G0RA 4IH7A 2CJQA 3E01A 4DR5J 2G9OA 2DEIA 1S76D 1LFPA 3H98A 4C98A 2XLKA 4DEZA 1WG5A 4EZ6A 3MD1A 5H9FJ 2XG8A 4JI0F 2XWXA 3ISZA 2HBQB 3OXLA 1SKRA 3GR0A 4DR3F 1LXJA 4Y2CA 3ZZYA 3E51A 4DX6A 2ZVSA 2DGWA 3E8OA 3CCJS 2GO9A 2YH0A 2R7VA 3IXQA 1RKJA 1UW4A 3HD2A 1TP7A 5KG3A 5ETPA 2OPRB 4P73A 1G7CB 3TAQA 4QYZJ 1BWEA 2JH3A 1D8ZA 4G1QB 2R8GA 4M63A 4I6AA 2FVRA 3IG1A 1WC0A 2ZEJA 2ZJQQ 5KFTA 3BGFA 1EQMA 4F7VA 1EHWA 3KLHB 2C3MA 2W01A 2UVUA 1FFSB 3A1YG 2EK6A 2K3IA 4ZVPB 1SB6A 5KG2A 3W3SA 3OL6A 3G9CA 1FRKA 2BE9B 2RHSB 1V3ZA 1QTNB 3B6BA 4DR5F 2DEJA 4LSNA 1V6HA 5KAKA 1BHNA 3SI8A 3I0RA 4FF4A 2R7QA 5RUBA 4I7FA 1P27B 4YB5A 2VOOA 2CZ9A 4FF1A 4TQRA 2LU2A 4IFVA 5FIIA 3ZTPA 2B5JA 3CJRA 2E7WA 5ETKA 2XZDB 3S01A 3EPGA 4QIFA 3DRSB 3ENQA 4MIAA 1PJ5A 8RUCA 4GO5X 1AA1B 4DCPB 2XM3A 1JJ2R 2MQNA 1LKZA 3NGTA 1SV5B 3OFHA 2F8EX 2ZH8A 3GB0A 2PDAA 3W5XA 4A8XA 2R4FA 2M88A 3OUYB 3I9ZA 1QUPA 4IFYB 3GTYX 5IV3A 2KO1A 3IS9B 2IVMA 1PGZA 3HM9A 5J2NB 5HATA 1HW9A 3CJTA 4YB7A 1FWKA 1QVFR 3I31A 1NDPA 1WOSA 3PACA 2X1GA 2OPRA 2RDDA 3K5PA 2RU3A 4G1QA 5D78A 1Q5YA 1MN7A 4ETXA 1JLAB 3TOQA 1LQ9A 1WORA 1HI1A 3IWXA 4C8OA 4QPXA 5HMZA 4NCGB 2Y8WA 3KLHA 4ELUA 1H74A 3TR5A 5MLCV 2A18A 2Q3PA 1C0UB 1JLCB 4L74A 3CC4S 1O0PA 1KOHA 2MQPA 2NCKL 1KKHA 1S59A 4OQJA 3M05A 3KHHA 3IBCB 2MB0B 5JMNA 3OBIA 5SZTA 4WFYA 2BE7D 2F63A 3CSKA 3DXBA 2CPIA 3SCLE 4KE5A 3QIPB 4ZVFA 3NGRA 3EZUA 3ULHA 1FCAA 1VQSA 1U48A 2MKSA 1FDDA 2ALYB 4Y2MA 3DRSA 1WELA 3BSAA 3CDEA 3MAAB 4ED3A 2GS8A 2NXUA 3R2CJ 1NZAA 1SV5A 5KG0A 3SQGB 2XS5A 3J7ZT 1N5TA 2V9WA 3AA8A 3OPKA 3OUYA 3Q22A 2N4CA 3VQSA 4IFYA 2BM0A 1TAQA 2ZITA 3IS9A 5F41A 5CZXA 2GMJA 2QLBB 5J2NA 2C2OB 1N4LA 3LGNA 1HQUB 4WP3A 2OELA 2J8SA 4NLGA 2HG4A 4LMZA 4ZPBA 1JLAA 4NMLA 4Q8EA 2ROPA 4NCGA 1R6VA 1RWNB 2W25A 5IOLA 2AKWB 4DPUA 5KT2A 2Q6BA 4JV0A 4DR6J 3GIKA 1C0UA 1JLCA 4JI6F 3C46A 2PT0A 4K7QA 5KOWA 4DF4A 2R8KA 4TLRA 1IXKA 4DPYA 1N5SA 1JLFB 2VL1A 4J9PA 2U1AA 4P7VA 2F1FA 2ZVIA 1IUJA 2V4QA 2KG1A 1JLBB 2XYPB 3DLGB 1ZPVA 2QLFB 4ECUA 4C8LA 1RISA 4WP9A 3EGWB 3CTRA 3QIPA 1G3OA 1TV6A 4JI8J 2CNLB 2J6SA 2DNKA 2Y1LB 4F4YA 1B3TA 2HHWA 1JKHB 3H5XA 5BR8J 5HLFB 1KBRA 3MAAA 4IDKB 5KFGA 1IBKJ 1TKTB 4F2RA 2YX1A 1ZETA 3SQGA 3KYLA 3PW5A 4L73A 3UE2A 4PPDA 3EJMA 1H0HB 2IJRA 4H4KC 1T8EA 2JC1A 2YKAA 2DO4A 2QL5B 2LEAA 4WF9Q 5KFQA 3RGIA 2XZTB 3I5BA 2FJWA 2QZ8A 5DDOC 5KFHA 2QL7B 4DR6F 3I56S 1NHVA 1HQUA 3RB4A 2M2BA 3KTQA 5F3ZA 1HA1A 4Z7YA 4N8OA 3CIMA 4K4VA 5HJXA 3PY8A 1NKEA 2MMYA 3R1HA 4Q0BB 4OL8A 2WCXA 1RAEB 1RA7A 4HL9A 5LJ5Y 4MAKA 3TQEA 3RAXA 4JI8F 5B0FA 4LSZB 4FN5A 4OJ3A 1VQMS 2MLZA 2FHKA 2A6OA 5KFYA 1JLFA 5IQ6A 5BR8F 1S72S 4QOTA 1IBKF 1JLEB 3J80U 3SMZA 1JLBA 3JSMB 4Q8FA 1U47A 3DLGA 4MFBB 5KFZA 1TK5A 4O23A 5EX3A 1ZA2B 3BQ2A 3TNVA 4QIVA 1C1BB 4ALZA 1S77D 1N5QA 4NWBA 4DZ6A 1JKHA 2E5HA 1Y11A 2C2MB 5GAEI 3LANA 5HLFA 1TMJA 3A3NB 2OTJS 4IDKA 3H8YA 3C19A 1TKTA 5C2GA 1KFDA 4QWCA 1GEHA 4C0HA 2NXCA 4PWDB 2GC8A 3N0VA 1Y3JA 4DFJA 1DQ8A 2CJ9A 1G6BA 5JUMA 4M5LA 1P1TA 2Z8QA 4RR5A 2O67A 2DNMA 2V69A 1QAJA 4EZ9A 3PCOB 5ETVA 1ZZFA 1SBRA 1R8BA 2HIYA 1Q8IA 1R8PA 1NMEB 4X4OA 2ZD1B 3B82A 5ETNA 2ZOMA 3PFEA 4ZPTR 2Z57B 4NLXA 4O3PA 4B3MJ 3MEDB 4Q0BA 4YHHJ 2AD9A 2C42A 3NRBA 1KS2A 4ZVGA 2BXJA 1VC5A 3LGHA 3OVSA 4QR0A 2BA9A 2B7CB 4NLUA 1T05B 2FHJA 1JK9B 3VF0B 1R43A 2DNHA 2ZH2A 2XS7A 1AFIA 2Z2YB 1X5OA 5ETSA 1JLEA 4LIRA 3JSMA 3AJ2A 3SSQA 1FHTA 2CAJA 1DRZA 4MFBA 4PZVA 3MMBB 1BWVA 1GNKA 1NK5A 2H1YA 1C1BA 5AE1A 4ZVRB 2EFOA 4P75A 3A13A 5J1EB 4QWEA 2HQGA 2JEGA 4DR2J 4K5RA 2H65B 1NLKL 2R7XA 5I42B 3PRDA 1XBWA 7AT1B 3AHPA 1GQEA 4PWDA 1B0PA 1XK8A 4DV5J 2L3MA 1N0VC 4B3MF 4YS2A 2J6TA 4HR2A 5I3PA 2XWYA 3QJJA 4UOGA 1RCOB 2J9CA 1MMDA 3KJNB 2ZD1A 3IN5A 3T6BA 1KR4A 5AJ3J 3G86A 2W9AA 1P9QC 4IO1A 1S57A 4TXSA 1ICEB 2ZC4A 3V81B 3CCRS 4V19J 2AGQA 3MEDA 3DLKB 1LWCB 1NPPA 2MKCA 4LF1A 1U2RA 4YQWA 5LSOA 4B02A 3GV8B 4ECRA 3CXCR 2N7YA 2PMHA 4F04B 2ADBA 1NSKL 1NCLA 5CYQB 1T05A 3FUYA 2BEFA 3AOBA 2E9TA 4X66J 5CCLA 2MLXA 4P52A 5E2QA 2W9CB 4AQYF 4NLPA 6FDRA 4X84A 1FRXA 4ANCA 2RT3A 1DTTB 4OI3A 2H54B 2JEFA 4JB8B 1WJ9A 1WHXA 3PJ9A 4DV5F 2N4DA 3MMAB 3MMBA 1TKDA 3RB6A 5DZ6A 3CCZA 3WDOA 4IYQA 1W2BR 3QT7A 1PG5B 1CJKB 2YNFA 1QY7A 2GHWA 3CMQA 5J1EA 2EW9A 3NWRA 2BRKA 4U67Q 3RJMB 3MI7X 5KFRA 3OTOJ 1HBNB 1MROB 1RTZA 3OFFA 3SV4A 1HNZJ 4NYOA 1VI7A 5I42A 5AJ3F 3HO1A 1NXIA 4OZNA 1RA6A 3MR3A 3UI3A 3A8IA 1IBMJ 4C97A 3FK4A 3I96A 4ILRA 4ZJOA 1NK6A 1WHWA 2CPHA 3SQOP 4LVNP 2ZKTA 1U24A 1T3OA 4BWMA 3MCNA 2J7WA 1D1UA 4X4RA 1VQYA 3VAKA 2VBZA 4X66F 2JC0A 3CC7S 4YFUA 3V81A 1KOOA 5I3UB 3DLKA 2IDEA 1LWCA 4BWJA 1RT6B 3DLJA 4C4WA 5L1IA 2E5JA 2R2RA 2IA6A 3JSRA 4UUWA 3BO3A 5HVHA 2OPQB 1RWWB 2XO6A 5CYQA 5B0DA 2RS2A 5JXSA 4M94A 2J9EA 1R8HA 1U6BA 2AF6A 1LWXA 2BV3A 1U1OA 3OTOF 3B8HA 2W9CA 2B4PA 1X0PA 1NHKL 1HNZF 1F2GA 3B4MA 1DTTA 3G96A 1IR0A 2BW7A 3PYDA 1IBMF 3RAMA 3MMAA 1L3KA 2DHAA 2NYHA 4JOUA 3W9HA 1DY3A 2HVEA 3V6KA 3NBPB 1RCXB 1P6TA 1M1KT 1CJKA 2VFSA 2CVEA 3IFEA 3D4JA 2R7UA 2B4UA 4DPOA 1HBNA 2F9JA 4N56A 4DUYF 3C16B 1MROA 1K1SA 2RMLA 2CADA 1JXLA 4MKVA 3THVA 5L1KA 1EAYC 2BJ9A 4NRUA 3UCUP 1LWFB 3M2RB 2GJFA 2V8HA 3MPVA 1O5JA 4LF7J 2MJUA 4DS4A 4IQMA 2D3O1 3BN4A 1QTMA 2DH7A 1UFWA 2ASYA 5L8RC 3CJKB 1ZAWA 4ZPCA 2YXLA 3MWBA 2E7VA 1N33J 3NGUA 4OI1A 4GC7A 3ZTSA 5I3UA 2XHWA 2ZH1A 2W24A 3VAHA 1RT6A 4N41A 3NEKA 2E9ZA 3VGSA 3OJSA 4B3TJ 4PG4A 4QW8A 2F4FA 4J9LA 4IH6A 4RUAA 2OPQA 3CCES 1KN6A 3DCAA 5GAGI 2MZSA 3IRXB 1L3UA 1QUVA 4RO0A 1IQZA 5ETQA 2NZ4A 2W4PA 5HSPA 3UN3A 2RDIA 5B0CA 1GX6A 2C3UA 5KFAA 1NKBA 3W2VB 4AT1B 3BGLA 4HT5A 4LFAJ 3DLBA 3DRYA 4B9TA 2DGOA 2YX4A 1RT2B 3NBPA 5K14B 3D5MA 4OZ0A 4LF7F 2DHSA 1XR5A 4ZS6A 2AJ1A 3AD8C 3NOGA 3K57A 2IC3B 1ZTWA 3C16A 4B9MA 3HK2A 2FHJD 4OYPA 5DG8A 4TYBA 3TW0A 4DXLA 2BDPA 1R8AA 2VOPA 2GW8A 2HQDA 2XZWA 1N33F 3EX7B 1LWFA 3RBXA 3LWMA 3M2RA 4KBIA 4ERDA 2FYXA 1HMVB 4TY8B 4MYTA 2RVJA 4B3TF 1IM6A 4WZMA 3T5KA 4P9SA 1VQ6S 3TO8A 2P6SA 2DTJA 4TY9A 4LF9F 3CJKA 2QFJA 3FCVA 2HWHA 4USKA 1BY9A 1A6LA 3QWPA 1WC5A 3THPA 1FESA 4QU7A 5I3QA 1RAAB 1SJFA 4OLOA 5CQGA 3L4BC 2GIFA 4LFAF 4DS5A 2ZBIA 4WIQA 2JHEA 4CLWA 1FKPB 3RRGA 1T3NA 4IOAQ 3SFUA 1FDNA 2HNYB 3IRXA 3CVKA 4NXNJ 1J2VA 4PYAA 1U49A 4DN0A 2AT1B 4BS2A 4P2XA 1WTFA 1UJ6A 1TTHB 2VKRA 3W2VA 4CRJA 2R7OA 1VYAA 4J5OA 1KHWA 4DL5A 1RT2A 5K14A 3G6ES 4USMA 1U6FA 3BBCA 2WVDA 4QZVB 4C0BA 1RHMB 3V4MA 2M7SA 3QGGA 2KXFA 2W2QP 2DISA 2IC3A 5K8MA 4ECTA 1VQKS 2B8PA 1HBUB 4ITSA 4DL7A 1FEEA 4B9UA 2FJAB 4LRDA 2W1BA 3BF4A 4AL7A 2ROEA 2OPPB 1RWMB 3L09A 4P74A 2FHMA 2NSCA 1QAIA 4AUKA 2DCUB 1HMVA 4TY8A 4PQUB 2YNGB 2BVZA 3TVYA 3I87A 2L9WA 2YWEA 3SCJE 1NSAA 3ENAA 3MCMA 4NEZA 3ZTRA 4EWTA 2XCAA 1JLGB 5M2RA 2DRAA 4WP8A 3RG6A 3NY0A 1ACMB 1ZAXA 3V2UC 4NXNF 4P6QA 4DV1J 3D1HA 1UZHA 2KFYA 1TZ0A 1EQ0A 2UVVA 4PUOB 1B7YB 2J8AA 4OZ1A 2WONB 3GG0A 1VQ4S 2HVIA 3VAGA 3KDNA 1JJCB 3BYPA 2EFGA 4F25A 4DR4J 3MAHA 1ZM9A 1FKPA 1UPMB 2GAGC 2HNYA 4ZLNA 2RB7A 2V2KA 3OSPA 1VISA 2OO4A 2LQBA 1QAXA 1S6QB 2RH3A 3C6UB 1QE1B 5HMYA 4ED6A 3KJQB 3CD7A 3MUTP 5C2CA 2LQ8A 2YPYA 5GVQA 3DDKA 4LR7A 1X31C 4ED0A 2FQQB 3FEYB 3RBZA 1P1LA 2CPXA 2KJVA 2YKQA 4P2FA 1NDCA 1WG4A 1HNXJ 2XY6A 3K0JA 1VFJA 5DM6Q 2BACA 3MCOA 3MFIA 3Q8YA 2ASLA 5LL6d 2DPIA 1HBUA 5K5MA 3JQKA 1RGVA 4DV1F 1URRA 1GMWA 3CC2S 1MW7A 1KQKA 3DKDA 2C2NA 2OPPA 3VCDA 1VCTA 2MTLA 1X4HA 2MKIA 3F0NA 1SL0A 4DV3J 4PQUA 2YNGA 3P4UB 3WX4A 3TZZA 4CI0B 3MECB 1S97A 1JLGA 3MM9B 3I5CA 2C2EA 4WZQA 4DUZJ 4DR4F 1M90T 1DJ0A 4WKYA 2YQ3A 2G4BA 1XJWB 2OH2A 4NASA 3GPAA 2VB6A 5LOQA 4IR1A 4LUBA 4FXVA 4PUOA 4MYUA 4RW9B 3N6MA 2LQ5A 2DGUA 3X3UA 5T41A 2WONA 2OEJA 1UVKA 2L9DA 3UPFA 4IH5A 2AEJA 1S9FA 1BQMB 3ZZRA 3R5GA 1QSSA 4KIAA 3KLFB 1PJ6A 3D1OA 2FY8A 5DJBA 2K7KA 1HNXF 4J9KA 2V63A 1N34J 2XC9A 1AUSL 1S6QA 3C6UA 1QE1A 3J7A1 1SQFA 1RAGB 3HFVA 3RB0A 3C3LA 2BQUA 3MPDA 4DSFA 1UZDA 3TJ9A 2GHPA 3GJRB 2NXJA 1N0UA 1DZ5A 2PIIA 4RUCA 4X4PA 2M8HA 4DV3F 3IR6B 4I56A 3GIJA 2C3PA 1CS4B 3MEKA 3T41A 4H4MB 2V34A 4RWXA 4K4ZA 5M2UA 3OHBA 2C22A 1WF0A 4DUZF 1QLNA 3G82B 3ETMA 1MWZA 2ZZNA 4TN2A 5MAOA 4ZVEA 4ZCIA 2YWGA 3SCKE 4I4BA 4Z2XA 5A2QU 5AXKA 1NDKA 1B99A 3EVWA 4QQBA 3IMQJ 1F5AA 4A8YA 2RILA 3CJ8A 3MECA 5IT9Y 1EP4B 3TEGA 3MM9A 3H4DA 4OJGA 2Z4PA 2HQIA 2W2NP 1Q8LA 3B78A 1S1XB 2ACMA 3BGRB 1WHVA 3JAMU 2UZAA 4RW9A 4C2MA 2JVOA 2VKZG 3T1AA 1Q86T 2ZNYA 3J7YU 3PEHA 4K4UA 4CDIA 3M8PB 4AFFA 2EWHA 3PIPQ 4RUBA 4JI5J 2QA4S 3SZ2A 4P2MA 1BQMA 1PC5A 3M30B 3OLAA 3KLFA 4FNIA 4WK3A 3T5HA 1Q0NA 1Y5NB 4KQZA 3BGUA 1B64A 4U7UK 5AXNA 2GCFA 1TL3B 4ZK7M 2E66A 3D6MB 3LP0B 1D0EA 4J90A 3EWGA 4EGLA 3O8WA 1APSA 5FJ4A 3HD1A 3JTNA 3THTA 3GV7B 2YNIB 2L08A 1H2VZ 4RJVA 3AXMA 3AFGA 1FWLA 1CS4A 3CJ0A 4H4MA 4PXBA 5DQHA 1JWWA 1URNA 1WF1A 2GFFA 4X62J 3KG4A 1JNZB 2AYMA 3G82A 3FBCA 5KT7A 3IO1A 1G1XA 4Z37A 1FXRA 2DGSA 1RU1A 4IRCA 5HI7A 1OWXA 2Z56B 1RT3B 3D9BA 2L9NA 2OMOA 3MMJA 5EWEA 4A8QA 3GSIA 2CQBA 1EP4A 4JI5F 3GYGA 1P9YA 3PDNA 7FDRA 1XTZA 1WD6A 2B4OA 3MEEB 3M6VA 3GG1A 2GGPB 4OHWA 1GMUA 3MM8B 3QNWB 1Y5IB 2CQDA 4OX6A 1RXOB 3BREA 2Z2LA 2WRMA 5HL7Q 1S1XA 1UA0A 3BGRA 3CB4A 1Y7PA 1ITPA 1X4FA 2M0GB 3AA9A 4DL0C 2MKYA 3M8PA 3NP5A 3JYTB 1U1LA 1BE4A 1ZH5A 3K5MA 1RTDB 5B7WA 3M30A 4JYAJ 1AW0A 3Q8PB 2GJ2A 1SJQA 4CLZA 3W5YA 4OFZA 3CWJA 4GC6A 4DWIA 3BB5A 3DMJB 4X62F 4P72A 5HVGA 1FVSA 3K7RA 1TL3A 2YKPA 3LP0A 4YB1P 2UXCJ 4FBUA 5HROB 3FZ2A 3DLEB 5A0YB 2W4DA 2YNIA 4ECZA 2KDOA 1VK8A 1K73T 1RTIB 3EXCX 4HH1A 3GIIA 2F9DA 3MDFA 3M2VB 3MR2A 4NCAA 4C8ZA 2KYZA 2VFRA 1HWLA 1YBAA 1EKRA 2WVCA 4ECWA 4A46A 2L48A 1VQ7S 3VTIA 3D3BJ 4PG7A 4IOBA 4ZN1A 4WCEQ 3EVMA 1VIOA 4MH8A 2HBRB 5AXMA 1RT3A 5KT3A 2EFVA 3BSOA 3M7VA 1Z2LA 1IWGA 2BJ1A 5B08A 1HKAA 3C14B 1VJQA 3AOAA 1IM4A 1ELOA 2I5JB 2JEIA 4JYAF 2HW3A 3QT5A 2ZJPQ 3MEEA 5IFMA 5LXRA 2GGPA 2QA2A 2P9GA 3WIUA 3HPOA 1YJTA 3MM8A 3HT3A 6AT1B 3LF0A 1E6YB 2H5EA 4WFZA 1SH2A 2UXCF 5IC4B 4HTJA 2NR0A 3FFIB 1GMWD 3NGSA 4N76A 3CO0P 3JYTA 1S99A 2FLPA 1RTDA 3N9UC 1XC9A 4C8YA 1TK8A 2BRLA 3C15B 1RK8A 2HHPA 4G6VB 2VC1A 5GADU 4DCOB 3DMJA 2PSZA 4LBPA 2DGXA 2FPHX 4EYHB 2MY7A 5HROA 5ITHA 3O3LA 3DLEA 5A0YA 2PA3A 2EEYA 3SV3A 2QLXA 1RTIA 3I9V9 2P8IA 4MIWA 1ZYQA 3M2VA 4DG1B 2GZOA 1L5UA 2XI2A 4F02A 4ZLJA 4F4ZA 5JJBA 3F41A 1RAHB 1RT7B 4MK7A 4NL5A 3R97A 1K9MT 1UEUA 5D0GA 3HSZA 5DG9A 1OYDA 3J81U 4L3KA 2F8MA 4F4AA 5LM7E 5F0UA 4LF5J 4YR2A 2VPZB 3MTKA 4A47A 3C14A 3VAJA 1WOPA 3O2IA 2HHVA 4N7TA 3K2YA 4DQPA 2GO8A 1Q81T 4RBVA 3GQCA 2I5JA 3DGPB 4PWWA 4F3QA 3PR4A 1JJHA 4YR3A 3K58A 2KB2A 1YGYA 4FS2A 4WXOA 5LXYA 3UQSA 5EGYA 1WC3A 1W26A 1E6YA 2G1DA 3M9OB 2H9ZA 4A48A 2LVWA 3FFIA 2YKOA 4JI4J 5C42B 4DI6A 2CQGA 1FX2A 2KVQE 3HHKA 2AGOA 2XNQA 3W2WB 2ZDOA 3B4DA 3C15A 1JX4A 4JI1J 1WDTA 2HMIB 1FK9B 3MPUB 3VGUA 3CDAA 2IM3A 5I4MA 1IKYB 2ZZTA 1TUGB 5D8HB 4O0IA 2HHHJ 1A7GE 3GWCA 5D0HA 2VODA 4HI2A 3C8YA 5E0OA 5KFVA 3G6XA 4LF5F 1N6QB 1RB0A 2ZWOA 4LF8J 4DG1A 4F0MA 3GFHA 1AZSB 3QSIA 1OY9A 1FERA 2IYGA 4KHMA 2NUHA 1RT7A 1UPPA 2RIJA 4O4RA 2J76E 2GQQA 1GAOA 4LIWA 2CZVC 2CQ2A 3MD3A 4A8MP 2F40A 2FUG9 1R3NA 4J9RA 3OTEA 1IKXB 3JB9k 4FPIA 2VA3A 2BMBA 2DIUA 3M6UA 1RBLA 3NCQA 3LQVA 4QYZK 1U26A 2V2VA 2VDIA 3EVOA 4JI4F 4U8VA 5B0BA 2HHTA 3DGPA 5HVFA 1Q16B 3D6TB 4JI1F 4J9OA 1AUDA 3OHAA 1WTBA 2CFXA 4LR9A 3MPYA 3SBMA 2HHHF 2NXNA 2HPUA 5C42A 4DFMA 2OJ3A 1WSVA 4QYRA 4LF8F 3W2WA 2IMOA 1Y4ZB 2SXLA 3PJXA 1MWQA 3UNGC 1Q79A 4U95A 3VGVA 2HMIA 1FK9A 4J7CA 2JJ4D 5LT5A 3O5TB 1IKYA 2UXBJ 2MXYA 2P9CA 4PWUA 1HWIA 2FY1A 5GADI 2LA6A 2D7SA 2Q79A 3WBZA 2WSFC 1N6QA 5DDQC 4LBHA 4KPCA 3N5BA 1AZSA 2R42A 2JNJA 2QX0A 4I67A 1FE4A 2X3GA 4ED8A 1WNEA 3W60A 2ILYA 2MPUA 3P8BB 2KU7A 1QD1A 3FSXA 2LECA 4LF2A 3TYTA 2HBZB 3RZAA 1IKXA 2FLNA 2FZKB 2HRTA 3DOMB 2ADCA 4XDCA 1YZ6A 2CPYA 2YWHA 4FXDA 2HK2A 4NLDA 1S9GB 5A6WA 9RUBA 1IQTA 2DNLA 1IJEB 1FJ7A 1K1QA 3H5YA 5DDRC 2CA9A 5F9LA 5E3CA 2E1RA 1VQ5S 4CLSA 4GKKJ 3LP2B 4CCHA 1VRUB 3ZFVA 2NUUG 4P71A 4OV6A 1OJ4A 1CC8A 4KKOB 4DJBA 5CABA 1YJWS 2UXBF 1U7LA 1FWPA 3D3CJ 4H4OB 2VQFF 4ZCMA 3UVJB 1KLNA 4KJIA 1F5BA 4CWBA 4RNNA 3OL8A 4NLYA 4BCAA 1YTYA 2HRUA 3DI6B 4N77A 3MM7B 4ZVSB 3CCQS 1WHYA 1CBKA 2CQ1A 3MCSA 2XLJA 5L46A 2D41A 4DL6A 5E3QA 4J9UE 3V5RA 1FJCA 1VBXA 1ZM3A 2FTRA 1PYOB 1X4GA 4JUZA 3M8YA 3KOAA 2FC9A 3LPEA 1RWVB 2DRBA 2KVIA 3PYFA 4MK8A 2LEBA 2MY8A 3ZZOA 3QATA 4FF3A 4ER8A 2IIHA 4DL2A 2R9LA 3ETOA 2RRBA 3KJFB 2D3OR 4IUFA 1NH7A 4NMXA 2H3EB 4GKKF 2VG7B 4DV7J 1W25A 5ADZA 1AB8A 1CC7A 4PABA 2GIRA 1EB0A 1TK0A 1YBTA 1T0TV 1V9OA 3TZYA 1RAJA 3DOMA 2FJVA 3QT8A 4F0KA 3ZNJ1 4YR0A 4EI2A 2QTWA 5BYQA 2QA4G 1B7FA 2HEKA 2LEPA 3BH6B 3CDBA 2HZVA 1S9GA 3PKYA 2BABA 4C3MA 3IWNC 2ZH5A 2F65A 4YY3J 4M5DB 3BYRA 4HYKA 3LP2A 3MGJA 4X2BA 1VRUA 2EFQA 3HP6A 4KKOA 1Z1ZA 2MYFA 4M5KA 3N5FA 2V4JB 3BH7B 4G65A 1RWKB 1VLYA 4H4OA 4L72B 3UVJA 4DR3J 3JQMA 3PO5A 3DI6A 3MR5A 2KN4A 3OD2A 3MM7A 3PX4A 3RW6A 4ILLA 2MLYA 1YX2A 5GAHU 3AQPA 3QJLA 1FXLA 1H7XA 2OGUA 1XMBA 4ID5B 3IM9A 4LSLB 2DR9A 1RTJB 5KFEA 2HVHA 2UUBJ 4HT7A 3J81j 4Y3CA 4LT6A 4E2FB 4DPXA 1VQNS 3QGHA 4KT0C 1LW2B 1X4AA 1WWHA 3PG9A 5F0WA 1UWBB 5EWFA 1CEZA 1NBEB 2VBXA 2KRRA 1MG7A 2B7BB 2LQJA 2RD5C 2I38A 2RF2B 3HKZD 4YY3F 1DTQB 3T5LA 2V94A 1EARA 2VG7A 2FJEB 1SIZA 3OJUA 2ERRA 4GVLA 3N4WA 1ZZNA 4WK1A 4ZOSA 2WVEA 3PRVA 4GKJJ 2AEMA 3LPYA 2EKYA 3T9ZA 3Q2SC 2HNZB 4OLPA 2VA2A 1XQIA 2J6UA 3FQKA 4M5DA 9ATCB 4KSEB 2E1AA 3GFYA 3A8EA 2AQ4A 5D3GB 2DIVA 3M2UB 1KRPA 4J91A 3D68A 3NCPA 1RWUA 4OI0A 4QPTA 1YHQS 2M70A 3A4TA 1CQNA 2QGFB 4NZ0A 1BD6A 2GHVC 4UTGA 2V4JA 3D6FB 4FYXB 2ZOGA 2HSEB 4I68A 2UUBF 1GFWB 2C3OA 5KFWA 4M5GA 4Y2AA 3AT1B 4DR1J 1HQEB 3JXOA 1NK0A 1M5VC 3G6VA 5F8GA 1SPBP 2OFHX 3BPDA 2IY5B 2UU9F 1YWXA 4CO2A 3ENWA 4PG5A 4CM0A 2DYAA 2QL9B 3WIVA 3I0SB 3NS6A 1B4SA 5D77A 4ID5A 4LSLA 2X1BA 1RTJA 3HDSA 4UUXA 4ZCKA 1ZBTA 1FD2A 2KHCA 2J0SD 1PJ7A 1SKWA 5A6PA 1S7IA 1UVJA 4GKJF 1T11A 2MJNA 1TMMA 1LW2A 2UUTA 3FRYA 4NLVA 1UWBA 1NPRA 3L9ZA 2W7PA 2JFKA 2NZCA 2ZJRQ 3V6DB 2RF2A 5FDLB 4ENOA 2EC0A 2W7AA 4HTIA 4USWA 4XPEA 1DTQA 3LH2S 4JI2J 2V8DA 1JMTA 2V2QA 3VZIA 1Z2ZA 2V9KA 2LXUA 1F9FA 3PZPA 4DR7J 2UVRA 2LXIA 3R5AA 3ZZUA 2ZBPA 3D28A 1T02A 2VJUA 4B3RJ 2Q66A 1S49A 4OV1A 2KT5A 2QA1A 3R5CA 5LMNJ 2HNZA 4ZIVA 3DRPB 3UN2A 4EBDA 2OHDA 1VDHA 3BR9A 3DU5A 1TL1B 2HHUA 3GJSB 2XTJP 4DR1F 2LLZA 4U6PA 4DHVA 4OYBA 5D3GA 3M2UA 2AWZA 2KFZA 3DFEA 1U1QA 2R7WA 1WDDA 1T9WA 3EXYA 4YN3B 1Y10A 5IT0A 5KFFA 2CVIA 4WKRA 4UQGA 1UVIA 2RJZA 3CJ4A 5KFNA 4NA2A 3SSRA 4WFBQ 2VC0A 1HQEA 3ZZ0A 3IAS9 1UETA 4I6YA 4DFKA 1TAUA 3HVWA 3QIDA 3J7AN 2DNYA 4I64A 1ZS6A 4YMEA 4O3NA 3UDCA 2CQHA 5L39A 2CRLA 2OD6A 4JI2F 3BV8A 4KYZA 3I0SA 1HL6A 5H9EJ 4J9VA 1MU2B 4ZN3A 1KVJA 3G6YA 3ITHB 4DR7F 1QJHA 2DH8A 4B3RF 4IKAA 3CULA 4C8NA 2FGCA 3BBFA 1VBZA 1YRTA 1HHSA 1QSYA 2ZNZA 2XY7A 5GAHI 1HI8A 5LMNF 1QVGR 1VQOS 3D54A 2QMWA 3V6DA 3T1HF 5FDLA 4KGMA 3OR1B 1TV6B 3PRBA 1TFWA 1UP1A 1F60B 2Z0GA 4URQU 4JI6J 2X3DA 3IM8A 3MZIA 2I9SA 2BR0A 4OZJA 1RYSA 2JWNA 2Z30B 2VICA 4HHUA 5IXUA 2OKQA 3DRPA 1U1NA 3FDSA 1TL1A 2Q1LA 2KT3A 5KFPA 4DL3A 3NG8A 3HSGA 1DURA 3GYXB 5KFXA 4CO1A 2C2DA 3G71S 3KKFA 1FT8A 1Q7LB 1NNDA 1H72C 2CJXB 4FKXA 2IAJB 2KI2A 3PEJA 4M95A 3MEGB 1TFYA 2HGMA 2RQMA 2HURA 2V0NA 4KY3A 4EYIB 3KG0A 1Q4RA 4DOZA 2MQ8A 3LUYA 2WZ1A 2ZFHA 4WYLA 3JTOA 3SXLA 1IJFB 1DBDA 2DD8S 4CO3A 1MU2A 3LAKA 4BBYA 1FDBA 1NDLA 2GAHC 3ITHA 2E5GA 2OI2A 1SJ3P 8AT1B 2ZHAA 3VAFA 3GJTB 3H4BA 3U1NA 1FNOA 4OX7A 3OR1A 3NMRA 4IRKA 1Z4UA 2F3JA 4YUDA 4CYUB 3GV5B 2IM0A 3NKYA 2XNRA 1WEXA 2VONA 3TUJC 4K8RA 3QWUA 2GV1A 2IBOA 4I69A 2DR6A 4FNHA 1PCAA 3OTDA 2ZHBA 3F44A 2DGTA 2DY1A 3HKWA 4O3SA 4CO0A 2C3YA 3BBBA 2CDRB 3BPSP 2G2ZA 3MM5B 1F3VA 3R5DA 3DM2B 4I1TA 4NXMJ 3G4SS 3FRZA 2OSRA 1HD1A 3QAUA 3DNCA 4A8KA 1S6OA 3MURP 3R2DJ 5HMXA 3IGVA 2G0JA 1ROFA 2WW4A 7FD1A 2PFFB 2IAJA 1T9VA 3OFGA 4PXEA 3MEGA 4UY85 2Y3YA 4IQXA 1X7VA 5GMDA 3R8YA 3TAMB 1IBCB 4BC7A 5DDPC 1T9TA 5CHCB 2JLEA 3NMAA 1EJ7L 3TA0A 2CPJA 1FRHA 3I4HX 4WE1B 2JOQA 3IC1A 4ZMMA 3CD6S 1M5KC 1OSDA 1UJ5A 2HBYB 3EZ5A 2AGPA 4QCLA 3DRXA 1TL5A 3HHLC 1X4EA 5DRKA 4PAAA 3WC2A 2OFGX 2ZC3A 1SH0A 4NXMF 1XEZA 2D1CA 2W8KA 4CYUA 2K2PA 3TA2A 2XMTA 3HFZB 4IO9Q 1MMLA 3MPWA 3I5AA 1I94F 2YY3A 1D9AA 2HYIB 2B0GA 1EETB 2UUCF 1RAOA 3DHXA 1U2CA 4R5PB 3QZ8A 4RNFA 1NKCA 2OEMA 2DBBA 3BKFA 1YLXA 2RQ4A 3MM5A 3M9MB 5CD4A 3RR8A 3VV2B 1U1RA 3DM2A 2MZQA 2JLFA 2NREA 2GQ2A 2DKOB 2CQ0A 2ZHOA 2ZZMA 1BMQB 4HI1A 5HO4A 3EDQB 1M0SA 2KL8A 5IZHA 1U8SA 4E8UA 4W90B 3ZC4A 4RL1A 2ILZA 3LW5C 2HVZA 2KYXA 2DNNA 2J9DE 3LA0A 4ELVA 3QGPA 1RHKB 3NCRA 5EN1A 1HQ2A 2UUAJ 1H7WA 5B09A 3HSJA 5IWAJ 2A2CA 5CYJA 1I5OB 3FSIA 2QG9B 3I82A 3TAMA 2FDNA 5B0AA 1L3SA 2EFPA 2YWWA 3GYNA 1TUWA 4X4TA 3CW2C 3FKBA 1TQLA 4CM2A 4WE1A 1YITS 1AROP 2RRNA 2AX1A 4ZPDA 1SIWB 5HP1B 5L9XA 1RADB 2OSQA 1AT1B 2ZOFA 2I0XA 3M6XA 4FDFA 3ISND 2FLOA 1YJNS 3UR3C 2V5HG 4J9QA 2JDJA 2KRBA 4OX9F 2YNFB 1VHFA 3BR8A 2XMJA 3MR6A 2KZZA 4D3HA 1XNQF 2ZH7A 2FZCB 3VAMA 1EETA 4AQYJ 3Q89A 3G8QA 3UCGA 3PHTA 4O3RA 4KH1B 4R5PA 1RWPB 1Y9OA 5IC6B 2GNKA 2NQPA 3T5JA 2M4MA 5CCMA 1M5OC 2UUAF 5HQLA 3OTCA 4V1Ak 5IWAF 2FLLA 5H1SV 4OMFG 4RW8B 4RZRA 3L7PA 1UCNA 4X64J 5DQIA 2XMWA 3I6PA 5KT4A 1KEKA 4PR6A 2EBGA 3MFHA 3H59A 2XULA 2VG6B 4GVBB 1AYEA 4MIBA 2FHOB 2AYEA 4PG6A 2Y0BB 2HFSA 2IFXA 5CXTA 3GZ7A 3PX0A 1CJUB 2HNDB 3B54A 2O1PA 4ZP7A 3DLHA 1VBYA 4ZDNA 4CNZA 3BGOP 1PKUA 2GVDB 1IKVB 2QC3A 1YRUA 2NYIA 2POKA 1WEYA 2RUSA 5U47A 5KFLA 2JX2A 3T6JA 3KK1B 3TUPA 2AZ3A 1JB0C 2IM1A 2X7IA 4KHPJ 5D4PA 5HP1A 3CCSS 1NJIT 2CNNB 1SCJB 2QT7A 3IBWA 4ED4A 2DNPA 1TKXB 4FVMA 4V19X 4CLUA 2AV5A 2P5VA 4NYZA 4X64F 5FLXY 1RABB 2EBEA 2X1AA 1XWLA 3GONA 3K17A 3DDNA 3KUEA 2V68A 2BUNA 3VWSA 2W2OP 1KQGB 4CO4A 1H38A 4XPCA 2KFNA 2D74B 3QZ7A 4RW8A 4OIXA 4QIEA 3M6WA 2E5IA 2V8PA 1SJ1A 3H40A 2DR5A 2HFUA 3ZTQA 3QPIA 3AJ1A 2ACYA 3QQCD 4WPAA 3S6EA 3J80Y 3AJDA 2H4YB 4NA1A 4DUYJ 1FNMA 2VG6A 4GVBA 2WB1D 3MTJA 4HDHA 2K06A 1U02A 3BM7A 1FA0A 2EPIA 3BSNA 4OHYA 3OQ2A 1CJUA 2HNDA 3FCWA 1T03B 4KHPF 4J9MA 4ECVA 2IRUA 1W2IA 5HMWA 3V6HA 1H6KX 2VFUA 1QDUB 2EXUA 2KZMA 1PAEX 3DC2A 2GVDA 1IKVA 2BX6A 4KC5A 4QIGA 2C2KB 4HVZA 3CO9A 4AYBD 1R6YA 1VOMA 2MZ1A 1NK7A 2RRAA 1OMSA 3DOKB 3WZ0A 4K0KF 4Y28C 5KFUA 4DSLA 1GH8A 3KK1A 4F8RA 4Y00A 4CTAB 4JV5J 5E33A 2AW0A 2ZH9A 5DLGA 1Y3KA 3KWMA 5HQMA 2A0FB 2VDHA 2ZBRA 4PPZA 3GU0A 3VGTA 4EMDA 3Q8SB 2CIMA 1KLMB 3NGKA 1TKXA 3FGVA 4QR1A 2GX8A 4W98A 1NRKA 4KO0B 2KM8B 3OVAA 3TZXA 3HLUA 4NZ7A 1HR0F 1MWYA 4LBIA 3DLLQ 1HYSB 2FB0A 4RPFA 1R0AB 3CUNA 2PI4A 2QSFA 1S4FA 2YPZA 2CJBA 4XIUA 3H2VE 4A8OA 1FD8A 4LQ3A 2BQ3A 3KLGB 5LSRA 1WI8A 3PW2A 3HZGA 4TU9A 2BE2B 2RE1A 1IR1A 2BJ3A 4OHZA 2MSSA 2BANB 2OUGA 1NPKA 3HHDA 2IDLA 3A3OB 4FBTA 4M5HA 3MF5A 1N88A 2MDAA 2VUGA 1VC0A 2DJWA 3NOCA 3FEXB 5KG5A 4B17A 4JI3J 1F9EB 2DXFA 4X4UA 4NCBA 4JV5F 1X9WA 3GE9A 3ZZTA 1FX4A 1KD1T 2UP1A 3AD9C 1S79A 1T03A 5J2QB 1C1CB 1TUVA 4CH0S 2R2SA 1U0HB 4P2SA 2QSWA 3TVZA 3HSDA 2V67A 1Q5VA 2XCPA 3OFEA 5EDWA 1N48A 3Q83A 5CAAA 5B0EA 4C11B 3ILOA 2UXDJ 4X4QA 1S1UB 3MAQA 2A2DA 2DNZA 4LVOP 3GMGA 3DOKA 2J7KA 4LF9J 2ATLA 2ZH6A 4DLGA 2ZBQA 2VZ9A 1Q78A 2YWKA 4CTAA 2IJFA 4XTTA 1HW8A 2J0QD 2HGLA 3J7Z5 4YDXA 2CQPA 3JTPA 1KQSR 2NSBA 3QAEA 1UAWA 1XR7A 3K89A 1KLMA 4WYWA 1S0MA 1NHUA 3MUMP 4GO7X 1I3OB 3NAHA 3UW1A 4KO0A 4DSEA 3Q8RB 3FBBA 3GP9A 2J7UA 4O44B 4CNYA 5EHHA 4M5IA 1HYSA 1R0AA 1F5CA 1FE0A 3C66A 2Y1JA 1IBLJ 4JI3F 2VJVA 4K4XA 3OV7A 1Q7YT 3U27A 2K1RB 4PG8A 4MKAA 5JVHQ 3KLGA 2Y8YA 2I2YA 5KG1A 3JQJA 4RNHA 1S6UA 2CQ3A 2MKHA 4Q43A 3RW7A 4DN9A 2B9YA 2BE2A 1WEZA 3HZEA 1MLAA 2RQCA 2UXDF 2BANA 3N79A 1WC4A 3H25A 1YSJA 4DX8H 4UOFA 1R0BG 4DSKA 1YIJS 3D0IE 1L3VA 3I55S 2Z58B 3OT9A 1T9UA 1XR6A 3ENVA 2QJ3A 2A1BA 1WSRA 5J2QA 1C1CA 2QMUB 2FZGB 1U0HA 1DHMA 4K5SA 4F3MA 3N28A 1RAFB 2C2RA 4H54A 4OJ1A 4ATNA 1PO6A 3NNAA 1U45A 3BEGB 3DYAB 5A8WB 2HQ3A 4Q7AA 1SC3B 5HK4A 4C11A 1S1UA 2ZH4A 3BO4A 2FIUA 4FZVA 5J1NA 3RUBL 1HBOB 3RBEA 4GRSA 3VQTA 2RUGA 3QGIA 1Y0HA 3FC9A 3R27A 2DB1A 3Q8VA 3D2WA 2HZAA 4F26A 1T7PA 2QMXA 1IBLF 4X4VA 1B0TA 1KVIA 3ZXWA 3M8WA 4KGXB 1FO1A 3DDIA 2R8HA 1XMQJ 4NZ6A 2JRSA 1YRXA 2DH9A 3FVYA 8ATCB 3EICA 3VALA 1CULB 2RNEA 3CGIA 3P3DA 4FPRA 5GAEU 4ED7A 1F0XA 4O44A 2EK1A 2CQIA 2G0IA 5ETRA 3PV8A 4RW4B 1N56A 2CJAA 3P6YC 2X51A 3RAQA 5HJYA 4CH1A 3W63A 1FXDA 2BJ7A 4JP8A 1JQGA 2WAQD 2K1RA 3MUVP 2AJ2A 5E41A 2FC8A 2YWFA 1OPIA 2HS3A 2DT9A 3R5JB 3NS7B 1I1GA 2W9BB 4IOCQ 1UWAA 4P10A 2WTFA 3KLEB 2ZBCA 1HHQA 1LXNA 5FD1A 4QJVA 3RR7A 3PIOQ 3E2EA 2C28A 2DXDA 4HEA9 4NLOA 3D6HB 3EGVA 2WK4A 2IJNA 2P2CB 2E29A 4ID8A 1PBAA 2O01C 2PEBA 1UTAA 2CNKB 4EU0A 1S6PB 1XMQF 3DYAA 5A8WA 2AEFA 2PGCA 3PYEA 2DITA 1U8WA 1RWOB 5E3RA 4AXJA 1HBOA 2EG1A 1J27A 2JSXA 4IG3B 4ZCLA 1O8BA 1S9EB 1UFKA 5D4NA 4CT8A 1U6ZA 1FJGJ 3CCTA 4Y2KA 4W4MA 1S0NA 5IQQA 2CZ4A 2LA4A 1SJRA 3SIPB 1RT5B 3GLJA 2IBKA 3U1MA 2RU9A 2MZJA 1UFLA 3BDEA 1N5VA 4Y65A 1CULA 4ECYA 4F2SA 5ETTA 4JV1A 1JLQB 2DXEA 2FJDB 2XHCA 4C7QA 2A3JA 4RW4A 3CD5A 3GILA 4ZPAA 1KFSA 4PEOA 1Q8BA 1W7WA 3NNCA 1KWMA 5D4LA 4UZCA 4B9LA 2R7RA 2BKPA 4DX5A 1TU0B 2JLGA 2FJBB 2LDIA 3H0PA 4BDPA 3G2XA 1PILA 1CQMA 2W9BA 2VQEJ 4ZPVR 3TQ1A 4KAIA 3PW7A 3KLEA 4UOHA 3RBDA 2B8QA 1ZM4A 4MMOA 1YDLA 2E1MC 4MT1A 1FI4A 2CNOB 2DNOA 1GTEA 4DV4J 4U7CA 1XNRJ 1FJGF 2HVDA 4USTA 1V3RA 1S12A 1S6PA 4ETZA 5K8OA 3M9NB 1U1KA 2R7SA 3M4XA 3W7BA 2P6TA 2IM2A 2NPFA 5FLXU 3KK3B 5L1LA 4IG3A 4PQAA 1VLOA 4C8KA 1F6TA 2F4VJ 1S9EA 5IV4A 4RNOA 3UD3P 4HDGA 2ZE2B 3H2UB 2BW2A 2N82B 3R7BB 2BJDA 2G0CA 2N3OA 1RT5A 2NXEA 2XMAA 3UR0A 1JLQA 5CH7B 1L3TA 2OAUA 2B4VA 1GXTA 2Y1RI 2VQEF 3U02A 3CD0A 4JBCA 5DG7A 4CZCA 5ETOA 3EMTA 5HN0A 1S7HA 1D9DA 1XERA 3QT6A 4HACB 5J1PA 2RAQA 3G8SA 1M1GA 4X4NA 1E6VB 4DV4F 1XNRF 4EBCA 2DR8A 3R6LB 3K5OA 1HD0A 4B3SJ 1D09B 3D0HE 3VVTA 1TL4A 2Z2ZA 4K4YA 2ZUGA 1T9YA 1RJJA 3EYZA 1SQGA 2B9XA 4EO6A 1NSQA 3EZOA 2F4VF 3OXFA 1VIXA 4URGA 2QLWA 1JIHA 4PCQA 1LK7A 1DQAA 1C0TB 4C9DA 3CCUS 4DQQA 3PXGa 4ED1A 2BOPA 5KFJA 4FP9A 3KK3A 5DLFA 4ZLPA 4B9VA 1RACB 4F4WA 1DLOB 2V4RA 1IKWB 1PIEA 2ZE2A 1YVFA 2OP5A 1T94A 2XSJB 4R0EA 4NLRA 5DGBA 1H2UX 3TUIC 1WKJA 2MZTA 3N01A 4NYPA 4B3SF 5CYMB 2FVQA 3I4PA 3W1YC 3FZBA 4R0JA 2QE5A 1D8YA 4KB7A 1V5IB 4UW2A 3KMQA 2FVCA 4HACA 2JZ5A 3BJYA 1GT8A 1VGYA 4DPWA 5A8KB 3G87A 1E6VA 4WBFA 4C3LA 1VC6A 3QLHB 3HVTB 1AFJA 3W66A 1VQPS 5LSLA 3NXZA 1VRTB 4DBQA 2LP4A 2YX7A 4F3OA 4FS1A 3LWLA 4YHHF 2QYCA 1VHIA 2B51A 1H3DA 2WVFA 1QSLA 4G3IA 3MM6B 3BQ1A 1N5YB 1Q53A 4OZ5A 2VH7A 2V50A 4NE9C 5CA5A 4FYVB 4Y34A 5DM7Q 1GX5A 3D67A 3EM1A 4HH0A 2G2YA 3N6LA 3PR5B 1C0TA 2AMCB 2MHEA 5GAGU 4PXCA 3CIZA 3K59A 1JJ4A 1DAXA 2P9EA 2QEXS 3KK2B 3BSCA 1KHVA 2W2MP 4J9SA 3SEOA 3PHEA 2DNQA 3A8JA 1DLOA 1JNRB 1RYRA 1IKWA 1S5ZA 2VASA 3A3PB 2XSJA 4CLKA 4ZP9A 2KXHA 3HI9A 4DR2F 4WU2A 3HHEA 5L1JA 3M8QB 2WBMA 1CJVB 1SQEA 3SYZA 3PJWA 2VFTA 2DK2A 4OYAA 5CYMA 1DARA 4TU7A 2XMMA 3KUHA 4WFNQ 4OI6A 3KDOA 3TVKA 4XO0A 3IWLA 4AD6A 2QLJB 2AHOB 2AYGA 5A8KA 2B43A 2PEHA 4NX9A 1X9SA 1UVLA 1PBUA 3QLHA 3HVTA 3FMWA 3US5A 1R7IA 4DV0J 4FXWA 3NWGA 1VRTA 1J5EJ 3FBFA 3F56A 1RKIA 3DOLB 3PW0A 2BBEA 2I6WA 3BDPA 4PXDA 3MM6A 3M8ZA 5HQ8A 3ILIA 1N5YA 3JSYA 1SC1B 3WX8A 1RWXB 3GCXP 5C24B 4XDDA 4N5SA 3LO3A 2OD4A 4OI4A 5ETLA 4M5NA 5DS7A 1FVQA 4DL4A 4TKTA 5A2QY 3KXDA 1V3SA 1H2TZ 2E44A 3KFWX 4P7TA 1Y5LB 1X0FA 2PMZD 1BGXT 3KK2A 1T9XA 3D0GE 3MXHP 2EG2A 1KONA 3TUZC 3D1QA 3LGMA 3J7YI 2ASJA 1KTVA 3AODA 4KV8B 1FRIA 3Q23A 2N7CA 2ROGA 2D3ZA 2ALZA 2YBVA 2HWIA 5KFSA 5J2MB 5E7OB 2MEWA 1RZMA 3KHGA 3QFHA 3M8QA 2MZRA 1CPZA 3W8PA 1CJVA 2W2PP 5HANA 4ANDA 1SH3A 2ATCB 3EUNA 2ZDPA 4DSIA 1RHRB 2BKNA 3JAMY 2RKIB 2VHGA 4DV0F 5D0EA 4WJBA 1J5EF 5IT4A 3ISNC 3TWZA 3UCZP 3TARA 2ASDA 1N52B 2OTLS 4DCJB 3FMBA 4F0HA 5KT5A 1FNXH 3AB2B 2FJXA 2HQFA 2JVRA 5F8NA 1G4CA 3HF5A 3ILLA 2QO3A 4OHXA 3TANA 2WHOA 4B9SA 4QWDA 3H5UA 3DOLA 1UW9A 4U8YA 5D6GA 1HBMB 4LJMA 6FD1A 2KHDA 2VD3A 2F7VA 1K47A 2OIHA 1GMVA 1S0OA 2DR7A 2Y0SD 2DHGA 5C24A 2DVIA 2H48B 2AU0A 4TNOA 2YKMB 4K4WA 3A12A 4J37A 2E9RX 1NM2A 1R0CB 2BQRA 2OPSB 3GIMA 2W8LA 2IA0A 1HNIB 2KG0A 4F36A 2VBYA 3M8SA 1WKLA 1JXVA 5EUHA 3NLCA 4KV8A 2LDYA 4O3OA 2DGVA 4ILMA 3Q8QB 1VQLS 5J2MA 1OO0B 4YDDB 2H4WB 1V5VA 1CJTB 2HIQA 5H9FK 1K8AT 4K4TA 3CEDA 4NI2B 3BO2A 3IA0A 5DETA 2RKIA 4EUVA 1S4EA 3SFGA 3RU0A 1KSPA 5C7PA 2EFNA 4EK2A 3VZHA 1UEKA 1UA1A 3VR1A 1XN9A 4L3NA 1EX8A 1IN0A 2JL9A 2EC2A 3M32B 4ECSA 1OPZA 3CDUA 3FBEA 4ZVHA 1UKUA 2EVZA 3GFXA 3VVUA 3GFZA 2DHHA 3DU6A 3H7HB 2QIFA 2K3KA 1BUXA 3MHYA 4OYZA 2CPEA 2M9KA 4L75A 1TL7B 1HBMA 4K2JA 2IMWP 4ZPWR 1NB2A 3R9LA 4M8LA 3SSSA 4ZIWA 4XK8C 2CPZA 4ES1A 3KUGA 3HHLB 1REVB 2YKMA 2V2ZA 1YJ9S 2PE8A 3Q2TC 1RAIB 1UEVA 2YH1A 3DRRB 5F8LA 2CDQA 1PAUB 2E7XA 3NS5A 1M5HA 3DN9A 4EEYA 4LREA 1H73A 4FYYB 2OPSA 1HNIA 4WFXA 3HMJG 1KQFB 3CMAS 4GMKA 3IRWP 2CPFA 4L76A 3KHLA 2F5GA 2VF3A 3MR7A 1ULRA 2RHQB 2X1FA 1BQXA 1MN9A 3TX0A 5KFIA 2G1HA 3Q0AA 4DV6J 2VQFJ 2AZ1A 4H4KA 4MTPA 3LTOA 2GMHA 1CJTA 1IVZA 4K4SA 1B0VA 1SI9A 5IT9U 4NI2A 1SL1A 4U7UD 3QRRA 1SJ4P 2OMLA 4F4KA 1ZAVA 4E0DA 4YOEA 2MQOA 3LP1B 3PW4A 3M32A 5KT6A 1I51B 1NK9A 3W65A 1SL2A 3M8RA 3CCVS 1VQ9S 4LFCJ 1D9FA 4RBUA 3TRGA 1CLFA 3HJFA 2JFDA 3Q86A 1TL7A 3TP2A 2DNGA 1YJ7A 1C4AA 1X9MA 4LF4J 2E5LJ 5H9EK 1UVMA 3P96A 3R6GB 3P5TL 4ZLLA 4WIIA 3HHLA 2WW8A 1REVA 4B08A 3PM9A 3GIRA 2Y1IA 4DV6F 3DRRA 4HLBA 5LMUJ 2XBPA 1VRQC 1KP6A 3J81Y 2BYCA 2MQQA 2Q6CA 1S48A 1VQ8S 3OLBA 4RW7B 1YBUA 1CVJA 3EE3A 1RLDA 2RS8A 1X4BA 2AYBA 1Q82T 4DPTA 1YJVA 1LV5A 5LJ3Y 3NGDA 4MKBA 4ES2A 2A10A 2CXEA 4USVA 3PTWA 2QRRA 1RUSA 3WC0A 1O6XA 5F3TA 4NLSA 4LFCF 4JI7J 4DLEA 2R3VA 3TI0A 1U4BA 5KG4A 2QN6B 4ECQA 2LKZA 4MJKA 1VR6A 3NL0A 2AJQA 1HHTP 4MK9A 3OW2R 1HLWA 2IRXA 1RDRA 4LF4F 4OYIA 2E5LF 1YQHA 4Q2LA 4C3KA 1HI0P 3LP1A 2L41A 4ECXA 2Q43A 2YQ1A 5K8PA 1RLCL 5AT1B 3HFKA 1FRMA 1X5SA 2GJIA 1NUEA 3OVBA 1F1BB 3DXSX 4M1KA 2DRDA 5LMUF 5J2PB 2XMUA 5A76A 5D4OA 1BC6A 3EDRB 3S7RA 4WU3A 2W4CA 5F8IA 3F73A 3P45B 3SCIE 3HVRA 3VHQA 2HS0A 1KNZA 1N54B 4C6AA 1OYEA 2B9WA 3TA1A 2H51B 4S0MA 4NLTA 1HFEL 3RRKA 1WC6A 4LQ9A 1RI7A 2Z2MA 1R8CA 4OZ2A 4RW7A 4JI7F 2HHXA 2CG4A 3OSNA 3PVXA 4X65J 3FEZA 3K8WA 4ZA1A 3AB4B 3UFCX 1ZTTA 2LMIA 3R1LA 3VAIA 2HZCA 2HS4A 1UMJA 2GMLA 1C4CA 2DHXA 4K59A 4NRTA 4ZKAA 4LR8A 2R2UA 5EX0A 2DCLA 2J0WA 1WI6A 1RHUB 4CP5A 2JEJA 1U2FA 3LALA 4OJHA 2UU9J 1ZOTA 1H98A 3OR2B 1Q95G 1ZA1B 2G2OA 5C5JA 3I32A 4QIWD 4BC9A 2FVPA 4NLQA 4LF6J 2ZUAA 4F50A 1EIYB 4G1IA 1Q1KA 1S1VB 3FSYA 4UZBA 5B0GA 1SVDA 3ZNUA 4OZLA 1R89A 4Y2IA 4Q2MA 2ABYA 4DQSA 1RU2A 5GMEA 3L95X 4ZJLA 2F8HA 3Q8UA 3P5BP 2PMWA 2WBRA 2M3DA 4Y6IA 3UO0A 1MNEA 4I6WA 5C25B 2RQKA 5BJRA 5J2PA 1K44A 1MSWD 1M1HA 4ES3A 3CJ5A 4G1PA 1GK8A 5D15A 3R5BA 4DUTA 4ZVTB 4CH7A 2WSEC 4USIA 2BZ2A 4X65F 2KH9A 2AJFE 2PO4A 4ED5A 2XYHB 5BYSA 3CCLS 4L6V3 1HNWJ 3CCWA 2XGQA 1S1TB 3CJ3A 2AIRB 1RHJB 1RBOB 5L9NA 3MOZA 4I0WA 1N34F 5E3PA 1RHQB 1FTCA 4M5MA 2XY5A 5T14A 2C1EB 3TJ8A 1OQ6A 4C48A 3JS9A 4F67A 2CQCA 3CF5Q 3ONQA 1LOUA 4K2XA 3HHNB 4OHVA 4A8SA 2NPIA 3HT0A 4KR0B 4LF6F 2PN6A 3T3FA 4I2QB 3X1LB 4IR9A 1BQNB 4CLLA 1IWAA 2MKKA 1XMOJ 1UL3A 4LRCA 4TVAB 5KG7A 3CT9A 3C2PA 4RUHA 2MSTA 4CLPA 3IP0A 3QYYA 4Q5VA 4J9NA 3OR2A 4ICLB 4KPYA 4WTYA 5KG6A 1OQ3A 2B6AB 2NS1B 2UV8G 1NB7A 4B9NA 3AQOA 3CDWA 1S1VA 1Y00A 3JSBA 4R25A 1HNWF 1NK4A 3KLVA 2WB4A 3AH6A 3FNNA 1D3WA 2HAIA 2KJWA 2G13A 5C25A 2V6AA 4D3GA 1OS5A 1TELA 1WACA 3T1HJ 1U0SA 1AXQA 2CUYA 4UF4A 4N8NA 3BZQA 4KGZB 4DX7A 1S1WB 2GIQA 4WXWA 2XSFA 5HAOA 2HK3A 4EFAC 2CWXA 4QR2A 4OYWA 1S1TA 3WHIA 1EKSA 3W8GA 4QW9A 4Y0FA 4U9RA 3C6TB 4CLTA 4QU6A 2PI5A 5A8RB 2U2FA 1N36J 1FF2A 1R31A 1OY6A 4QBUA 2BJ8A 1XMOF 4RKUC 1U1MA 5KFBA 1WUUA 4JV2A 4W92B 3PO4A 3BQ0A 3OL9A 3WQPA 1NAQA 2IRYA 5BYRA 1F2HA 2HWTA 3NNHA 4I2QA 3TX8A 4I2PB 3W61A 4CQ1A 3IR5B 3KNGA 1VK3A 4UOCA 1Q8KA 1BQNA 1DQ9A 2UV8A 2CQ4A 3HHLD 4CLFA 1P8GA 3CMES 1N32J 1F3FA 5CZVA 2ZWPA 1K0VA 2COLA 3HJVA 3TZWA 1YK9A 4RW6B 2HLTA 4ICLA 1TR0A 2MKJA 1X5PA 4FYWB 3CJSA 4DZDA 2B6AA 1YJUA 1REGX 2QYGA 3TAPA 3UDVA 2M52A 1FFGB 1FJEB 2M5YA 3UNYA 2CKWA 1X5TA 1NJWA 3D7SB 2CJKA 4E98A 4ZJQA 3P49B 1N36F 3IR7B 4WTOB 1LNQA 3R7NB 2B56A 2AX0A 2GA7A 1YKWA 2R8IA 4DU7A 3CCMS 2J9DA 1S1WA 5KFOA 2O66A 1WF2A 3KHRA 4USHA 2EKNA 2AJ0A 3IAM9 2VU5A 1IR2A 4DV2J 1R27B 2KM8C 2XI3A 4Q44A 1PSDA 5SUHA 2XQCA 3C6TA 3T1YJ 3GCWP 2DGQA 3H42A 4UT4A 4NPOA 5A8RA 1RTHB 4CO5A 2FD2A 2J0XA 1X8DA 2CPDA 3TEHB 1JXEA 2MGZB 3R7SB 5KOXA 3ET6B 4CLYA 2PA8D 1PC4A 1N32F 2APOA 4DQRA 4NOHA 3A8KA 2MQLA 4DSJA 2MQMA 2MHNA 1XIQA 2CG8A 3O6QA 3D66A 3V6JA 4OX8A 1NSPA 2D69A 2VG5B 1LK5A 1FTRA 4I2PA 4DFPA 4QWAA 1HARA 1YJRA 2PC6A 3T9NA 2HFNA 2XYGB 2ZH3A 4Z7CA 3QBCA 2DY9A 4IG0B 4RU2A 5AXLA 1PYSB 1S0VA 2IHR1 1BXNA 4RW6A 5KFMA 1A9NB 3EGZA 4B3OB 2O3DA 3QJPA 5KFKA 3RTVA 2RDJA 1YG0A 4DV2F 1RBAA 3QRPA 4C0OC 3T1YF 4HHHA 5HBMB 3DGVA 3BKUA 2I8EA 3UD4P 2UUWA 4ELTA 2XMKA 1HNVB 4ED2A 2HKEA 3FJ2A 2J5AA 5IS2A 2HLUA 1NEEA 3IBFB 3QO9B 4R8UB 1I94J 5KFDA 2UUCJ 4FKYA 4YP3A 5AE2A 3GR1A 4RX6A 4EBEA 1G2EA 3GJQB 1RTHA 1DFDA 1FDAA 3TJAA 4C8MA 5T7LB 3HULA 1F9HA 1OY8A 3HVAA 2MGZA 4ZVQB 2VPXB 3ET6A 2A6MA 2O5DA 1SC4B 3RYLA 2ZKUA 3PFOA 3CJ2A 5JVGQ 3LOUA 1LEOA 1RT4B 3E3XA 2LXFA 3QFWA 3W9JA 2XGPA 2LU1A 4USJC 3PNIA 2VG5A 2K8GA 2IPOB 4RU9A 3ICLA 2B9EA 1HPZB 4O4GB 4A4JA 3AXKA 3PKMA 4DMZA 4IG0A 2QV6A 1VS3A 1NJXA 1FKOB 4RBTA 4RLEA 2VBWA 2VPWB 4NEYA 1TVRB 5GMKa 5THWA 4LRFA 4RNMA 4B3OA 4TQSA 4PYDA 1PYTA 2W7OA 3H2LA 3CPWR 1QM9A 2R8JA 5K8NA 4O0NA 4WWSA 5ETMA 4LFBJ 1RSCA 1ZPWX 4U96A 1YZ7A 4KTQA 4LRBA 5HBMA 2BOAA 3KJVB 1X4DA 5F8HA 3AOCA 5E3AA 3MMCB 4ZP8A 1HNVA 3SDEB 2XB2D 4OX9J 1WOOA 1QAYA 4FF2A 4K50A 2YQ0A 3G8TA 2V8GA 1OIAA 2KKHA 3QO9A 2Y9HA 2R7TA 4R8UA 1T95A 2YKNB 1XNQJ 3ZTOA 1SUQB 1EZZB 1RQ0A 4X4SA 2K7JA 4NLWA 2FGOA 1M5PC 1UVNA 3KMSA 2IYIA 5L38A 2XS2A 4OI2A 5F9NA 2NLWA 3OXGA 5T7LA 4MKYA 1GTHA 1LFWA 2LQ9A 3PX6A 4NA3A 2VIHA 4CIOA 1HWKA 1CSJA 2KTQA 4ZHRB 2DPJA 3L3CA 1RT4A 2H5IB 1KVKA 3ELHA 2YVSA 4PRFA 1FEHA 1S10A 2EI5A 4F4XA 2BKOA 1SKSA 3AY0A 4DF8A 1HIYA 4LFBF 2E1PA 4XAKA 1HPZA 1VMBA 2FVSA 2HFVA 3N6NA 4O4GA 2ZM6J 3ILJA 1RT1B 3W64A 3K5LA 4BHQA 2D9PA 1FKOA 1TKZB 1TVRA 4UY8T 1NK8A 1O51A 3AD7C 2HHQA 4AE5A
chains in the Genus database with same CATH topology
5IOLA 3NGRA 1EHWA 3BH7B 3Q86A 4DUTA 3VGTA 3ZTOA 3Q8YA 3PRVA 1LWXA 4DZ6A 3Q83A 4F4AA 1WKKA 5CAAA 3EICA 5BXIA 1PKUA 3G2XA 3ZTQA 2VU5A 1HLWA 5C7PA 3NGSA 3DKDA 1U8WA 4W98A 1NHKL 3MPDA 1S57A 3NGUA 3ZTSA 4EK2A 3B6BA 1VYAA 1KDNA 1XQIA 1NDPA 4ANEA 3EMTA 4UOHA 1MN9A 4ENOA 1ZS6A 1BHNA 2B8QA 4UOFA 3VGVA 3VGSA 2AZ1A 2AZ3A 3BBCA 3EM1A 2HVEA 1NUEA 1MN7A 3Q89A 3FBEA 4FKXA 2HVDA 1F3FA 4CP5A 3VVUA 3FCWA 3ETMA 1WKJA 3JS9A 4ANDA 3L7UA 1NSKL 3BBBA 1BUXA 3ELHA 5CABA 1NCLA 3ZTPA 3EVMA 4F36A 1XIQA 2HURA 2BEFA 3GPAA 3FBFA 3VVTA 3FCVA 3BBFA 1PAEX 1NSPA 3EE3A 2B8PA 1WKLA 2BX6A 4FKYA 1JXVA 3BH6B 1NB2A 4KPCA 1NDKA 3EVOA 4O0NA 3R9LA 4DI6A 2DXEA 2ZUAA 1HIYA 3FBBA 1B99A 1NLKL 1UCNA 3GP9A 3EVWA 3FKBA 1NPKA 4ANCA 2NCKL 3WX8A 4C6AA 1BE4A 1S5ZA 1S59A 1HHQA 3FC9A 1F6TA 3PJ9A 3NGTA 3Q8VA 1NSQA 4S0MA 1W7WA 2DXFA 2DY9A 3Q8UA 1LEOA 4HR2A 2DXDA 2DYAA 3EJMA 3ENAA 3ZTRA 4WBFA 2CWKA 4UOGA 1NDCA 3VGUA 1NDLA 1B4SA 1K44A 3FBCA 3B54A 3DDIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IOL A;  3NGR A;  1EHW A;  3BH7 B;  3Q86 A;  4DUT A;  3VGT A;  3ZTO A;  3Q8Y A;  3PRV A;  1LWX A;  4DZ6 A;  3Q83 A;  4F4A A;  1WKK A;  5CAA A;  3EIC A;  5BXI A;  1PKU A;  3G2X A;  3ZTQ A;  2VU5 A;  1HLW A;  5C7P A;  3NGS A;  3DKD A;  1U8W A;  4W98 A;  1NHK L;  3MPD A;  1S57 A;  3NGU A;  3ZTS A;  4EK2 A;  3B6B A;  1VYA A;  1KDN A;  1XQI A;  1NDP A;  4ANE A;  3EMT A;  4UOH A;  1MN9 A;  4ENO A;  1ZS6 A;  1BHN A;  2B8Q A;  4UOF A;  3VGV A;  3VGS A;  2AZ1 A;  2AZ3 A;  3BBC A;  3EM1 A;  2HVE A;  1NUE A;  1MN7 A;  3Q89 A;  3FBE A;  4FKX A;  2HVD A;  1F3F A;  4CP5 A;  3VVU A;  3FCW A;  3ETM A;  1WKJ A;  3JS9 A;  4AND A;  3L7U A;  1NSK L;  3BBB A;  1BUX A;  3ELH A;  5CAB A;  1NCL A;  3ZTP A;  3EVM A;  4F36 A;  1XIQ A;  2HUR A;  2BEF A;  3GPA A;  3FBF A;  3VVT A;  3FCV A;  3BBF A;  1PAE X;  1NSP A;  3EE3 A;  2B8P A;  1WKL A;  2BX6 A;  4FKY A;  1JXV A;  3BH6 B;  1NB2 A;  4KPC A;  1NDK A;  3EVO A;  4O0N A;  3R9L A;  4DI6 A;  2DXE A;  2ZUA A;  1HIY A;  3FBB A;  1B99 A;  1NLK L;  1UCN A;  3GP9 A;  3EVW A;  3FKB A;  1NPK A;  4ANC A;  2NCK L;  3WX8 A;  4C6A A;  1BE4 A;  1S5Z A;  1S59 A;  1HHQ A;  3FC9 A;  1F6T A;  3PJ9 A;  3NGT A;  3Q8V A;  1NSQ A;  4S0M A;  1W7W A;  2DXF A;  2DY9 A;  3Q8U A;  1LEO A;  4HR2 A;  2DXD A;  2DYA A;  3EJM A;  3ENA A;  3ZTR A;  4WBF A;  2CWK A;  4UOG A;  1NDC A;  3VGU A;  1NDL A;  1B4S A;  1K44 A;  3FBC A;  3B54 A;  3DDI A; 
#chains in the Genus database with same CATH topology
 5IM0 B;  3NAI A;  1WKK A;  1SXL A;  3BKT A;  5AE3 A;  3POT B;  5K20 B;  4ZIT A;  3OTB A;  4AL5 A;  1NJY A;  1LWE B;  4OYO A;  3KJV A;  3DHW C;  4OZ3 A;  3MMC A;  3OL7 A;  4A8W A;  4EO8 A;  1RE1 B;  3SDE A;  4OYM A;  1C2P A;  2HQC A;  1NU4 A;  2CYY A;  2D9O A;  2IVF B;  5DZ7 A;  2BM1 A;  3RRH A;  2RSQ A;  1U1P A;  5D0R A;  2YKN A;  4N47 A;  1SUQ A;  4AL6 A;  3BS9 A;  3M1V B;  5DGA A;  4URS A;  1FRJ A;  3RB3 A;  2DO0 A;  3O44 A;  1X60 A;  3AAW B;  2PFD A;  2IVY A;  3R3T A;  5DO2 A;  3S8S A;  2DNR A;  2PD1 A;  2ZM6 F;  4ZVO B;  2UVW A;  1GXL A;  2XLI A;  2E1C A;  4ZHR A;  2CWK A;  4ZVU B;  1N8R T;  1FKA F;  1NH8 A;  3PYG A;  1FRL A;  2QFI A;  1ZM2 A;  5KFC A;  2M8D B;  4KFB B;  2VPY B;  4USU A;  1LW0 B;  3KLI B;  1NJZ A;  4DDF A;  3GSD A;  1KC8 T;  4PKD B;  4O3Q A;  3UDL A;  2OLW A;  1J5O B;  4TYA A;  5BXI A;  4A8F A;  3FQL A;  2GQC A;  2WOM B;  3H90 A;  2YNH B;  2XMV A;  4ANE A;  1RT1 A;  3ZZZ A;  5F8M A;  2B3T B;  2LCW A;  4KGV B;  1TKZ A;  3W62 A;  1FFW B;  1MMN A;  2XEX A;  3V4I B;  3QRQ A;  2GVZ B;  2D3U A;  3UDE A;  4HHJ A;  2HAF A;  1HWJ A;  2AP6 A;  2WVB A;  4K0K J;  3CE8 A;  2XO7 A;  4TU8 A;  2YTC A;  5IM0 A;  3ZO7 A;  3L7U A;  4AXI A;  2H5J B;  4KRW A;  2V8V A;  1X4C A;  3UWT A;  3UN5 A;  2OEK A;  3KG1 A;  3HXM A;  4DQI A;  3POT A;  5G0R B;  1CG2 A;  2HFO A;  4KHR A;  4TLQ A;  3ZZP A;  4DU8 A;  3E01 B;  1U09 A;  1LWE A;  1NZ8 A;  2VV5 A;  1U25 A;  2HGN A;  4IRD A;  3FCH A;  4CT9 A;  2KT2 A;  2CJY B;  3S1T A;  4ZP6 A;  1K0T A;  1HR0 J;  4HKQ A;  3UD5 A;  3U7J A;  2HRY A;  4KGK A;  1WC1 A;  4M5J A;  3M1V A;  3IGN A;  3EPI A;  3ADA C;  3K5N A;  4KH0 B;  1OSC A;  4UQT A;  1A0O B;  5CD4 H;  3O1L A;  1B70 B;  1M5S A;  3EGN A;  3H20 A;  4FVC A;  1KDN A;  4QWB A;  2C2Z B;  5G4D A;  1VJW A;  3W9I A;  5M2P A;  1NO8 A;  3MOJ B;  4BLG A;  2R2T A;  3CNQ P;  1SC6 A;  3HCX A;  3KNA A;  4OYX A;  3T19 A;  4JI0 J;  5EWG A;  4YEA A;  4RWW A;  1VBK A;  1UJ4 A;  4KFB A;  1RP5 A;  3IG1 B;  3W5Z A;  2AJ4 A;  3Q24 A;  1LW0 A;  4YB6 A;  4WFA Q;  3KLI A;  5E5N A;  2HFZ A;  2VFV A;  3QSY B;  1J5O A;  5DQG A;  1YI2 S;  3LAM A;  2WOM A;  3CJQ A;  4LRA A;  2YNH A;  1SKU B;  4DV7 F;  1KTQ A;  2BJE A;  1I6J A;  3H5S A;  3U1L A;  2KXN B;  1WG1 A;  1BLU A;  4LSN B;  3L7O A;  5K9F A;  3I0R B;  4Q45 A;  3V4I A;  1GXU A;  4FYD A;  2GVZ A;  4I7F B;  3HX9 A;  2LFV A;  5KTQ A;  2WSC C;  3BN7 A;  3QMQ A;  5F8J A;  2N3L A;  2HHS A;  4IFV B;  1HWU A;  2I1R A;  3K8V A;  2B5J B;  2LYV A;  5G0R A;  4IH7 A;  2CJQ A;  3E01 A;  4DR5 J;  2G9O A;  2DEI A;  1S76 D;  1LFP A;  3H98 A;  4C98 A;  2XLK A;  4DEZ A;  1WG5 A;  4EZ6 A;  3MD1 A;  5H9F J;  2XG8 A;  4JI0 F;  2XWX A;  3ISZ A;  2HBQ B;  3OXL A;  1SKR A;  3GR0 A;  4DR3 F;  1LXJ A;  4Y2C A;  3ZZY A;  3E51 A;  4DX6 A;  2ZVS A;  2DGW A;  3E8O A;  3CCJ S;  2GO9 A;  2YH0 A;  2R7V A;  3IXQ A;  1RKJ A;  1UW4 A;  3HD2 A;  1TP7 A;  5KG3 A;  5ETP A;  2OPR B;  4P73 A;  1G7C B;  3TAQ A;  4QYZ J;  1BWE A;  2JH3 A;  1D8Z A;  4G1Q B;  2R8G A;  4M63 A;  4I6A A;  2FVR A;  3IG1 A;  1WC0 A;  2ZEJ A;  2ZJQ Q;  5KFT A;  3BGF A;  1EQM A;  4F7V A;  1EHW A;  3KLH B;  2C3M A;  2W01 A;  2UVU A;  1FFS B;  3A1Y G;  2EK6 A;  2K3I A;  4ZVP B;  1SB6 A;  5KG2 A;  3W3S A;  3OL6 A;  3G9C A;  1FRK A;  2BE9 B;  2RHS B;  1V3Z A;  1QTN B;  3B6B A;  4DR5 F;  2DEJ A;  4LSN A;  1V6H A;  5KAK A;  1BHN A;  3SI8 A;  3I0R A;  4FF4 A;  2R7Q A;  5RUB A;  4I7F A;  1P27 B;  4YB5 A;  2VOO A;  2CZ9 A;  4FF1 A;  4TQR A;  2LU2 A;  4IFV A;  5FII A;  3ZTP A;  2B5J A;  3CJR A;  2E7W A;  5ETK A;  2XZD B;  3S01 A;  3EPG A;  4QIF A;  3DRS B;  3ENQ A;  4MIA A;  1PJ5 A;  8RUC A;  4GO5 X;  1AA1 B;  4DCP B;  2XM3 A;  1JJ2 R;  2MQN A;  1LKZ A;  3NGT A;  1SV5 B;  3OFH A;  2F8E X;  2ZH8 A;  3GB0 A;  2PDA A;  3W5X A;  4A8X A;  2R4F A;  2M88 A;  3OUY B;  3I9Z A;  1QUP A;  4IFY B;  3GTY X;  5IV3 A;  2KO1 A;  3IS9 B;  2IVM A;  1PGZ A;  3HM9 A;  5J2N B;  5HAT A;  1HW9 A;  3CJT A;  4YB7 A;  1FWK A;  1QVF R;  3I31 A;  1NDP A;  1WOS A;  3PAC A;  2X1G A;  2OPR A;  2RDD A;  3K5P A;  2RU3 A;  4G1Q A;  5D78 A;  1Q5Y A;  1MN7 A;  4ETX A;  1JLA B;  3TOQ A;  1LQ9 A;  1WOR A;  1HI1 A;  3IWX A;  4C8O A;  4QPX A;  5HMZ A;  4NCG B;  2Y8W A;  3KLH A;  4ELU A;  1H74 A;  3TR5 A;  5MLC V;  2A18 A;  2Q3P A;  1C0U B;  1JLC B;  4L74 A;  3CC4 S;  1O0P A;  1KOH A;  2MQP A;  2NCK L;  1KKH A;  1S59 A;  4OQJ A;  3M05 A;  3KHH A;  3IBC B;  2MB0 B;  5JMN A;  3OBI A;  5SZT A;  4WFY A;  2BE7 D;  2F63 A;  3CSK A;  3DXB A;  2CPI A;  3SCL E;  4KE5 A;  3QIP B;  4ZVF A;  3NGR A;  3EZU A;  3ULH A;  1FCA A;  1VQS A;  1U48 A;  2MKS A;  1FDD A;  2ALY B;  4Y2M A;  3DRS A;  1WEL A;  3BSA A;  3CDE A;  3MAA B;  4ED3 A;  2GS8 A;  2NXU A;  3R2C J;  1NZA A;  1SV5 A;  5KG0 A;  3SQG B;  2XS5 A;  3J7Z T;  1N5T A;  2V9W A;  3AA8 A;  3OPK A;  3OUY A;  3Q22 A;  2N4C A;  3VQS A;  4IFY A;  2BM0 A;  1TAQ A;  2ZIT A;  3IS9 A;  5F41 A;  5CZX A;  2GMJ A;  2QLB B;  5J2N A;  2C2O B;  1N4L A;  3LGN A;  1HQU B;  4WP3 A;  2OEL A;  2J8S A;  4NLG A;  2HG4 A;  4LMZ A;  4ZPB A;  1JLA A;  4NML A;  4Q8E A;  2ROP A;  4NCG A;  1R6V A;  1RWN B;  2W25 A;  5IOL A;  2AKW B;  4DPU A;  5KT2 A;  2Q6B A;  4JV0 A;  4DR6 J;  3GIK A;  1C0U A;  1JLC A;  4JI6 F;  3C46 A;  2PT0 A;  4K7Q A;  5KOW A;  4DF4 A;  2R8K A;  4TLR A;  1IXK A;  4DPY A;  1N5S A;  1JLF B;  2VL1 A;  4J9P A;  2U1A A;  4P7V A;  2F1F A;  2ZVI A;  1IUJ A;  2V4Q A;  2KG1 A;  1JLB B;  2XYP B;  3DLG B;  1ZPV A;  2QLF B;  4ECU A;  4C8L A;  1RIS A;  4WP9 A;  3EGW B;  3CTR A;  3QIP A;  1G3O A;  1TV6 A;  4JI8 J;  2CNL B;  2J6S A;  2DNK A;  2Y1L B;  4F4Y A;  1B3T A;  2HHW A;  1JKH B;  3H5X A;  5BR8 J;  5HLF B;  1KBR A;  3MAA A;  4IDK B;  5KFG A;  1IBK J;  1TKT B;  4F2R A;  2YX1 A;  1ZET A;  3SQG A;  3KYL A;  3PW5 A;  4L73 A;  3UE2 A;  4PPD A;  3EJM A;  1H0H B;  2IJR A;  4H4K C;  1T8E A;  2JC1 A;  2YKA A;  2DO4 A;  2QL5 B;  2LEA A;  4WF9 Q;  5KFQ A;  3RGI A;  2XZT B;  3I5B A;  2FJW A;  2QZ8 A;  5DDO C;  5KFH A;  2QL7 B;  4DR6 F;  3I56 S;  1NHV A;  1HQU A;  3RB4 A;  2M2B A;  3KTQ A;  5F3Z A;  1HA1 A;  4Z7Y A;  4N8O A;  3CIM A;  4K4V A;  5HJX A;  3PY8 A;  1NKE A;  2MMY A;  3R1H A;  4Q0B B;  4OL8 A;  2WCX A;  1RAE B;  1RA7 A;  4HL9 A;  5LJ5 Y;  4MAK A;  3TQE A;  3RAX A;  4JI8 F;  5B0F A;  4LSZ B;  4FN5 A;  4OJ3 A;  1VQM S;  2MLZ A;  2FHK A;  2A6O A;  5KFY A;  1JLF A;  5IQ6 A;  5BR8 F;  1S72 S;  4QOT A;  1IBK F;  1JLE B;  3J80 U;  3SMZ A;  1JLB A;  3JSM B;  4Q8F A;  1U47 A;  3DLG A;  4MFB B;  5KFZ A;  1TK5 A;  4O23 A;  5EX3 A;  1ZA2 B;  3BQ2 A;  3TNV A;  4QIV A;  1C1B B;  4ALZ A;  1S77 D;  1N5Q A;  4NWB A;  4DZ6 A;  1JKH A;  2E5H A;  1Y11 A;  2C2M B;  5GAE I;  3LAN A;  5HLF A;  1TMJ A;  3A3N B;  2OTJ S;  4IDK A;  3H8Y A;  3C19 A;  1TKT A;  5C2G A;  1KFD A;  4QWC A;  1GEH A;  4C0H A;  2NXC A;  4PWD B;  2GC8 A;  3N0V A;  1Y3J A;  4DFJ A;  1DQ8 A;  2CJ9 A;  1G6B A;  5JUM A;  4M5L A;  1P1T A;  2Z8Q A;  4RR5 A;  2O67 A;  2DNM A;  2V69 A;  1QAJ A;  4EZ9 A;  3PCO B;  5ETV A;  1ZZF A;  1SBR A;  1R8B A;  2HIY A;  1Q8I A;  1R8P A;  1NME B;  4X4O A;  2ZD1 B;  3B82 A;  5ETN A;  2ZOM A;  3PFE A;  4ZPT R;  2Z57 B;  4NLX A;  4O3P A;  4B3M J;  3MED B;  4Q0B A;  4YHH J;  2AD9 A;  2C42 A;  3NRB A;  1KS2 A;  4ZVG A;  2BXJ A;  1VC5 A;  3LGH A;  3OVS A;  4QR0 A;  2BA9 A;  2B7C B;  4NLU A;  1T05 B;  2FHJ A;  1JK9 B;  3VF0 B;  1R43 A;  2DNH A;  2ZH2 A;  2XS7 A;  1AFI A;  2Z2Y B;  1X5O A;  5ETS A;  1JLE A;  4LIR A;  3JSM A;  3AJ2 A;  3SSQ A;  1FHT A;  2CAJ A;  1DRZ A;  4MFB A;  4PZV A;  3MMB B;  1BWV A;  1GNK A;  1NK5 A;  2H1Y A;  1C1B A;  5AE1 A;  4ZVR B;  2EFO A;  4P75 A;  3A13 A;  5J1E B;  4QWE A;  2HQG A;  2JEG A;  4DR2 J;  4K5R A;  2H65 B;  1NLK L;  2R7X A;  5I42 B;  3PRD A;  1XBW A;  7AT1 B;  3AHP A;  1GQE A;  4PWD A;  1B0P A;  1XK8 A;  4DV5 J;  2L3M A;  1N0V C;  4B3M F;  4YS2 A;  2J6T A;  4HR2 A;  5I3P A;  2XWY A;  3QJJ A;  4UOG A;  1RCO B;  2J9C A;  1MMD A;  3KJN B;  2ZD1 A;  3IN5 A;  3T6B A;  1KR4 A;  5AJ3 J;  3G86 A;  2W9A A;  1P9Q C;  4IO1 A;  1S57 A;  4TXS A;  1ICE B;  2ZC4 A;  3V81 B;  3CCR S;  4V19 J;  2AGQ A;  3MED A;  3DLK B;  1LWC B;  1NPP A;  2MKC A;  4LF1 A;  1U2R A;  4YQW A;  5LSO A;  4B02 A;  3GV8 B;  4ECR A;  3CXC R;  2N7Y A;  2PMH A;  4F04 B;  2ADB A;  1NSK L;  1NCL A;  5CYQ B;  1T05 A;  3FUY A;  2BEF A;  3AOB A;  2E9T A;  4X66 J;  5CCL A;  2MLX A;  4P52 A;  5E2Q A;  2W9C B;  4AQY F;  4NLP A;  6FDR A;  4X84 A;  1FRX A;  4ANC A;  2RT3 A;  1DTT B;  4OI3 A;  2H54 B;  2JEF A;  4JB8 B;  1WJ9 A;  1WHX A;  3PJ9 A;  4DV5 F;  2N4D A;  3MMA B;  3MMB A;  1TKD A;  3RB6 A;  5DZ6 A;  3CCZ A;  3WDO A;  4IYQ A;  1W2B R;  3QT7 A;  1PG5 B;  1CJK B;  2YNF A;  1QY7 A;  2GHW A;  3CMQ A;  5J1E A;  2EW9 A;  3NWR A;  2BRK A;  4U67 Q;  3RJM B;  3MI7 X;  5KFR A;  3OTO J;  1HBN B;  1MRO B;  1RTZ A;  3OFF A;  3SV4 A;  1HNZ J;  4NYO A;  1VI7 A;  5I42 A;  5AJ3 F;  3HO1 A;  1NXI A;  4OZN A;  1RA6 A;  3MR3 A;  3UI3 A;  3A8I A;  1IBM J;  4C97 A;  3FK4 A;  3I96 A;  4ILR A;  4ZJO A;  1NK6 A;  1WHW A;  2CPH A;  3SQO P;  4LVN P;  2ZKT A;  1U24 A;  1T3O A;  4BWM A;  3MCN A;  2J7W A;  1D1U A;  4X4R A;  1VQY A;  3VAK A;  2VBZ A;  4X66 F;  2JC0 A;  3CC7 S;  4YFU A;  3V81 A;  1KOO A;  5I3U B;  3DLK A;  2IDE A;  1LWC A;  4BWJ A;  1RT6 B;  3DLJ A;  4C4W A;  5L1I A;  2E5J A;  2R2R A;  2IA6 A;  3JSR A;  4UUW A;  3BO3 A;  5HVH A;  2OPQ B;  1RWW B;  2XO6 A;  5CYQ A;  5B0D A;  2RS2 A;  5JXS A;  4M94 A;  2J9E A;  1R8H A;  1U6B A;  2AF6 A;  1LWX A;  2BV3 A;  1U1O A;  3OTO F;  3B8H A;  2W9C A;  2B4P A;  1X0P A;  1NHK L;  1HNZ F;  1F2G A;  3B4M A;  1DTT A;  3G96 A;  1IR0 A;  2BW7 A;  3PYD A;  1IBM F;  3RAM A;  3MMA A;  1L3K A;  2DHA A;  2NYH A;  4JOU A;  3W9H A;  1DY3 A;  2HVE A;  3V6K A;  3NBP B;  1RCX B;  1P6T A;  1M1K T;  1CJK A;  2VFS A;  2CVE A;  3IFE A;  3D4J A;  2R7U A;  2B4U A;  4DPO A;  1HBN A;  2F9J A;  4N56 A;  4DUY F;  3C16 B;  1MRO A;  1K1S A;  2RML A;  2CAD A;  1JXL A;  4MKV A;  3THV A;  5L1K A;  1EAY C;  2BJ9 A;  4NRU A;  3UCU P;  1LWF B;  3M2R B;  2GJF A;  2V8H A;  3MPV A;  1O5J A;  4LF7 J;  2MJU A;  4DS4 A;  4IQM A;  2D3O 1;  3BN4 A;  1QTM A;  2DH7 A;  1UFW A;  2ASY A;  5L8R C;  3CJK B;  1ZAW A;  4ZPC A;  2YXL A;  3MWB A;  2E7V A;  1N33 J;  3NGU A;  4OI1 A;  4GC7 A;  3ZTS A;  5I3U A;  2XHW A;  2ZH1 A;  2W24 A;  3VAH A;  1RT6 A;  4N41 A;  3NEK A;  2E9Z A;  3VGS A;  3OJS A;  4B3T J;  4PG4 A;  4QW8 A;  2F4F A;  4J9L A;  4IH6 A;  4RUA A;  2OPQ A;  3CCE S;  1KN6 A;  3DCA A;  5GAG I;  2MZS A;  3IRX B;  1L3U A;  1QUV A;  4RO0 A;  1IQZ A;  5ETQ A;  2NZ4 A;  2W4P A;  5HSP A;  3UN3 A;  2RDI A;  5B0C A;  1GX6 A;  2C3U A;  5KFA A;  1NKB A;  3W2V B;  4AT1 B;  3BGL A;  4HT5 A;  4LFA J;  3DLB A;  3DRY A;  4B9T A;  2DGO A;  2YX4 A;  1RT2 B;  3NBP A;  5K14 B;  3D5M A;  4OZ0 A;  4LF7 F;  2DHS A;  1XR5 A;  4ZS6 A;  2AJ1 A;  3AD8 C;  3NOG A;  3K57 A;  2IC3 B;  1ZTW A;  3C16 A;  4B9M A;  3HK2 A;  2FHJ D;  4OYP A;  5DG8 A;  4TYB A;  3TW0 A;  4DXL A;  2BDP A;  1R8A A;  2VOP A;  2GW8 A;  2HQD A;  2XZW A;  1N33 F;  3EX7 B;  1LWF A;  3RBX A;  3LWM A;  3M2R A;  4KBI A;  4ERD A;  2FYX A;  1HMV B;  4TY8 B;  4MYT A;  2RVJ A;  4B3T F;  1IM6 A;  4WZM A;  3T5K A;  4P9S A;  1VQ6 S;  3TO8 A;  2P6S A;  2DTJ A;  4TY9 A;  4LF9 F;  3CJK A;  2QFJ A;  3FCV A;  2HWH A;  4USK A;  1BY9 A;  1A6L A;  3QWP A;  1WC5 A;  3THP A;  1FES A;  4QU7 A;  5I3Q A;  1RAA B;  1SJF A;  4OLO A;  5CQG A;  3L4B C;  2GIF A;  4LFA F;  4DS5 A;  2ZBI A;  4WIQ A;  2JHE A;  4CLW A;  1FKP B;  3RRG A;  1T3N A;  4IOA Q;  3SFU A;  1FDN A;  2HNY B;  3IRX A;  3CVK A;  4NXN J;  1J2V A;  4PYA A;  1U49 A;  4DN0 A;  2AT1 B;  4BS2 A;  4P2X A;  1WTF A;  1UJ6 A;  1TTH B;  2VKR A;  3W2V A;  4CRJ A;  2R7O A;  1VYA A;  4J5O A;  1KHW A;  4DL5 A;  1RT2 A;  5K14 A;  3G6E S;  4USM A;  1U6F A;  3BBC A;  2WVD A;  4QZV B;  4C0B A;  1RHM B;  3V4M A;  2M7S A;  3QGG A;  2KXF A;  2W2Q P;  2DIS A;  2IC3 A;  5K8M A;  4ECT A;  1VQK S;  2B8P A;  1HBU B;  4ITS A;  4DL7 A;  1FEE A;  4B9U A;  2FJA B;  4LRD A;  2W1B A;  3BF4 A;  4AL7 A;  2ROE A;  2OPP B;  1RWM B;  3L09 A;  4P74 A;  2FHM A;  2NSC A;  1QAI A;  4AUK A;  2DCU B;  1HMV A;  4TY8 A;  4PQU B;  2YNG B;  2BVZ A;  3TVY A;  3I87 A;  2L9W A;  2YWE A;  3SCJ E;  1NSA A;  3ENA A;  3MCM A;  4NEZ A;  3ZTR A;  4EWT A;  2XCA A;  1JLG B;  5M2R A;  2DRA A;  4WP8 A;  3RG6 A;  3NY0 A;  1ACM B;  1ZAX A;  3V2U C;  4NXN F;  4P6Q A;  4DV1 J;  3D1H A;  1UZH A;  2KFY A;  1TZ0 A;  1EQ0 A;  2UVV A;  4PUO B;  1B7Y B;  2J8A A;  4OZ1 A;  2WON B;  3GG0 A;  1VQ4 S;  2HVI A;  3VAG A;  3KDN A;  1JJC B;  3BYP A;  2EFG A;  4F25 A;  4DR4 J;  3MAH A;  1ZM9 A;  1FKP A;  1UPM B;  2GAG C;  2HNY A;  4ZLN A;  2RB7 A;  2V2K A;  3OSP A;  1VIS A;  2OO4 A;  2LQB A;  1QAX A;  1S6Q B;  2RH3 A;  3C6U B;  1QE1 B;  5HMY A;  4ED6 A;  3KJQ B;  3CD7 A;  3MUT P;  5C2C A;  2LQ8 A;  2YPY A;  5GVQ A;  3DDK A;  4LR7 A;  1X31 C;  4ED0 A;  2FQQ B;  3FEY B;  3RBZ A;  1P1L A;  2CPX A;  2KJV A;  2YKQ A;  4P2F A;  1NDC A;  1WG4 A;  1HNX J;  2XY6 A;  3K0J A;  1VFJ A;  5DM6 Q;  2BAC A;  3MCO A;  3MFI A;  3Q8Y A;  2ASL A;  5LL6 d;  2DPI A;  1HBU A;  5K5M A;  3JQK A;  1RGV A;  4DV1 F;  1URR A;  1GMW A;  3CC2 S;  1MW7 A;  1KQK A;  3DKD A;  2C2N A;  2OPP A;  3VCD A;  1VCT A;  2MTL A;  1X4H A;  2MKI A;  3F0N A;  1SL0 A;  4DV3 J;  4PQU A;  2YNG A;  3P4U B;  3WX4 A;  3TZZ A;  4CI0 B;  3MEC B;  1S97 A;  1JLG A;  3MM9 B;  3I5C A;  2C2E A;  4WZQ A;  4DUZ J;  4DR4 F;  1M90 T;  1DJ0 A;  4WKY A;  2YQ3 A;  2G4B A;  1XJW B;  2OH2 A;  4NAS A;  3GPA A;  2VB6 A;  5LOQ A;  4IR1 A;  4LUB A;  4FXV A;  4PUO A;  4MYU A;  4RW9 B;  3N6M A;  2LQ5 A;  2DGU A;  3X3U A;  5T41 A;  2WON A;  2OEJ A;  1UVK A;  2L9D A;  3UPF A;  4IH5 A;  2AEJ A;  1S9F A;  1BQM B;  3ZZR A;  3R5G A;  1QSS A;  4KIA A;  3KLF B;  1PJ6 A;  3D1O A;  2FY8 A;  5DJB A;  2K7K A;  1HNX F;  4J9K A;  2V63 A;  1N34 J;  2XC9 A;  1AUS L;  1S6Q A;  3C6U A;  1QE1 A;  3J7A 1;  1SQF A;  1RAG B;  3HFV A;  3RB0 A;  3C3L A;  2BQU A;  3MPD A;  4DSF A;  1UZD A;  3TJ9 A;  2GHP A;  3GJR B;  2NXJ A;  1N0U A;  1DZ5 A;  2PII A;  4RUC A;  4X4P A;  2M8H A;  4DV3 F;  3IR6 B;  4I56 A;  3GIJ A;  2C3P A;  1CS4 B;  3MEK A;  3T41 A;  4H4M B;  2V34 A;  4RWX A;  4K4Z A;  5M2U A;  3OHB A;  2C22 A;  1WF0 A;  4DUZ F;  1QLN A;  3G82 B;  3ETM A;  1MWZ A;  2ZZN A;  4TN2 A;  5MAO A;  4ZVE A;  4ZCI A;  2YWG A;  3SCK E;  4I4B A;  4Z2X A;  5A2Q U;  5AXK A;  1NDK A;  1B99 A;  3EVW A;  4QQB A;  3IMQ J;  1F5A A;  4A8Y A;  2RIL A;  3CJ8 A;  3MEC A;  5IT9 Y;  1EP4 B;  3TEG A;  3MM9 A;  3H4D A;  4OJG A;  2Z4P A;  2HQI A;  2W2N P;  1Q8L A;  3B78 A;  1S1X B;  2ACM A;  3BGR B;  1WHV A;  3JAM U;  2UZA A;  4RW9 A;  4C2M A;  2JVO A;  2VKZ G;  3T1A A;  1Q86 T;  2ZNY A;  3J7Y U;  3PEH A;  4K4U A;  4CDI A;  3M8P B;  4AFF A;  2EWH A;  3PIP Q;  4RUB A;  4JI5 J;  2QA4 S;  3SZ2 A;  4P2M A;  1BQM A;  1PC5 A;  3M30 B;  3OLA A;  3KLF A;  4FNI A;  4WK3 A;  3T5H A;  1Q0N A;  1Y5N B;  4KQZ A;  3BGU A;  1B64 A;  4U7U K;  5AXN A;  2GCF A;  1TL3 B;  4ZK7 M;  2E66 A;  3D6M B;  3LP0 B;  1D0E A;  4J90 A;  3EWG A;  4EGL A;  3O8W A;  1APS A;  5FJ4 A;  3HD1 A;  3JTN A;  3THT A;  3GV7 B;  2YNI B;  2L08 A;  1H2V Z;  4RJV A;  3AXM A;  3AFG A;  1FWL A;  1CS4 A;  3CJ0 A;  4H4M A;  4PXB A;  5DQH A;  1JWW A;  1URN A;  1WF1 A;  2GFF A;  4X62 J;  3KG4 A;  1JNZ B;  2AYM A;  3G82 A;  3FBC A;  5KT7 A;  3IO1 A;  1G1X A;  4Z37 A;  1FXR A;  2DGS A;  1RU1 A;  4IRC A;  5HI7 A;  1OWX A;  2Z56 B;  1RT3 B;  3D9B A;  2L9N A;  2OMO A;  3MMJ A;  5EWE A;  4A8Q A;  3GSI A;  2CQB A;  1EP4 A;  4JI5 F;  3GYG A;  1P9Y A;  3PDN A;  7FDR A;  1XTZ A;  1WD6 A;  2B4O A;  3MEE B;  3M6V A;  3GG1 A;  2GGP B;  4OHW A;  1GMU A;  3MM8 B;  3QNW B;  1Y5I B;  2CQD A;  4OX6 A;  1RXO B;  3BRE A;  2Z2L A;  2WRM A;  5HL7 Q;  1S1X A;  1UA0 A;  3BGR A;  3CB4 A;  1Y7P A;  1ITP A;  1X4F A;  2M0G B;  3AA9 A;  4DL0 C;  2MKY A;  3M8P A;  3NP5 A;  3JYT B;  1U1L A;  1BE4 A;  1ZH5 A;  3K5M A;  1RTD B;  5B7W A;  3M30 A;  4JYA J;  1AW0 A;  3Q8P B;  2GJ2 A;  1SJQ A;  4CLZ A;  3W5Y A;  4OFZ A;  3CWJ A;  4GC6 A;  4DWI A;  3BB5 A;  3DMJ B;  4X62 F;  4P72 A;  5HVG A;  1FVS A;  3K7R A;  1TL3 A;  2YKP A;  3LP0 A;  4YB1 P;  2UXC J;  4FBU A;  5HRO B;  3FZ2 A;  3DLE B;  5A0Y B;  2W4D A;  2YNI A;  4ECZ A;  2KDO A;  1VK8 A;  1K73 T;  1RTI B;  3EXC X;  4HH1 A;  3GII A;  2F9D A;  3MDF A;  3M2V B;  3MR2 A;  4NCA A;  4C8Z A;  2KYZ A;  2VFR A;  1HWL A;  1YBA A;  1EKR A;  2WVC A;  4ECW A;  4A46 A;  2L48 A;  1VQ7 S;  3VTI A;  3D3B J;  4PG7 A;  4IOB A;  4ZN1 A;  4WCE Q;  3EVM A;  1VIO A;  4MH8 A;  2HBR B;  5AXM A;  1RT3 A;  5KT3 A;  2EFV A;  3BSO A;  3M7V A;  1Z2L A;  1IWG A;  2BJ1 A;  5B08 A;  1HKA A;  3C14 B;  1VJQ A;  3AOA A;  1IM4 A;  1ELO A;  2I5J B;  2JEI A;  4JYA F;  2HW3 A;  3QT5 A;  2ZJP Q;  3MEE A;  5IFM A;  5LXR A;  2GGP A;  2QA2 A;  2P9G A;  3WIU A;  3HPO A;  1YJT A;  3MM8 A;  3HT3 A;  6AT1 B;  3LF0 A;  1E6Y B;  2H5E A;  4WFZ A;  1SH2 A;  2UXC F;  5IC4 B;  4HTJ A;  2NR0 A;  3FFI B;  1GMW D;  3NGS A;  4N76 A;  3CO0 P;  3JYT A;  1S99 A;  2FLP A;  1RTD A;  3N9U C;  1XC9 A;  4C8Y A;  1TK8 A;  2BRL A;  3C15 B;  1RK8 A;  2HHP A;  4G6V B;  2VC1 A;  5GAD U;  4DCO B;  3DMJ A;  2PSZ A;  4LBP A;  2DGX A;  2FPH X;  4EYH B;  2MY7 A;  5HRO A;  5ITH A;  3O3L A;  3DLE A;  5A0Y A;  2PA3 A;  2EEY A;  3SV3 A;  2QLX A;  1RTI A;  3I9V 9;  2P8I A;  4MIW A;  1ZYQ A;  3M2V A;  4DG1 B;  2GZO A;  1L5U A;  2XI2 A;  4F02 A;  4ZLJ A;  4F4Z A;  5JJB A;  3F41 A;  1RAH B;  1RT7 B;  4MK7 A;  4NL5 A;  3R97 A;  1K9M T;  1UEU A;  5D0G A;  3HSZ A;  5DG9 A;  1OYD A;  3J81 U;  4L3K A;  2F8M A;  4F4A A;  5LM7 E;  5F0U A;  4LF5 J;  4YR2 A;  2VPZ B;  3MTK A;  4A47 A;  3C14 A;  3VAJ A;  1WOP A;  3O2I A;  2HHV A;  4N7T A;  3K2Y A;  4DQP A;  2GO8 A;  1Q81 T;  4RBV A;  3GQC A;  2I5J A;  3DGP B;  4PWW A;  4F3Q A;  3PR4 A;  1JJH A;  4YR3 A;  3K58 A;  2KB2 A;  1YGY A;  4FS2 A;  4WXO A;  5LXY A;  3UQS A;  5EGY A;  1WC3 A;  1W26 A;  1E6Y A;  2G1D A;  3M9O B;  2H9Z A;  4A48 A;  2LVW A;  3FFI A;  2YKO A;  4JI4 J;  5C42 B;  4DI6 A;  2CQG A;  1FX2 A;  2KVQ E;  3HHK A;  2AGO A;  2XNQ A;  3W2W B;  2ZDO A;  3B4D A;  3C15 A;  1JX4 A;  4JI1 J;  1WDT A;  2HMI B;  1FK9 B;  3MPU B;  3VGU A;  3CDA A;  2IM3 A;  5I4M A;  1IKY B;  2ZZT A;  1TUG B;  5D8H B;  4O0I A;  2HHH J;  1A7G E;  3GWC A;  5D0H A;  2VOD A;  4HI2 A;  3C8Y A;  5E0O A;  5KFV A;  3G6X A;  4LF5 F;  1N6Q B;  1RB0 A;  2ZWO A;  4LF8 J;  4DG1 A;  4F0M A;  3GFH A;  1AZS B;  3QSI A;  1OY9 A;  1FER A;  2IYG A;  4KHM A;  2NUH A;  1RT7 A;  1UPP A;  2RIJ A;  4O4R A;  2J76 E;  2GQQ A;  1GAO A;  4LIW A;  2CZV C;  2CQ2 A;  3MD3 A;  4A8M P;  2F40 A;  2FUG 9;  1R3N A;  4J9R A;  3OTE A;  1IKX B;  3JB9 k;  4FPI A;  2VA3 A;  2BMB A;  2DIU A;  3M6U A;  1RBL A;  3NCQ A;  3LQV A;  4QYZ K;  1U26 A;  2V2V A;  2VDI A;  3EVO A;  4JI4 F;  4U8V A;  5B0B A;  2HHT A;  3DGP A;  5HVF A;  1Q16 B;  3D6T B;  4JI1 F;  4J9O A;  1AUD A;  3OHA A;  1WTB A;  2CFX A;  4LR9 A;  3MPY A;  3SBM A;  2HHH F;  2NXN A;  2HPU A;  5C42 A;  4DFM A;  2OJ3 A;  1WSV A;  4QYR A;  4LF8 F;  3W2W A;  2IMO A;  1Y4Z B;  2SXL A;  3PJX A;  1MWQ A;  3UNG C;  1Q79 A;  4U95 A;  3VGV A;  2HMI A;  1FK9 A;  4J7C A;  2JJ4 D;  5LT5 A;  3O5T B;  1IKY A;  2UXB J;  2MXY A;  2P9C A;  4PWU A;  1HWI A;  2FY1 A;  5GAD I;  2LA6 A;  2D7S A;  2Q79 A;  3WBZ A;  2WSF C;  1N6Q A;  5DDQ C;  4LBH A;  4KPC A;  3N5B A;  1AZS A;  2R42 A;  2JNJ A;  2QX0 A;  4I67 A;  1FE4 A;  2X3G A;  4ED8 A;  1WNE A;  3W60 A;  2ILY A;  2MPU A;  3P8B B;  2KU7 A;  1QD1 A;  3FSX A;  2LEC A;  4LF2 A;  3TYT A;  2HBZ B;  3RZA A;  1IKX A;  2FLN A;  2FZK B;  2HRT A;  3DOM B;  2ADC A;  4XDC A;  1YZ6 A;  2CPY A;  2YWH A;  4FXD A;  2HK2 A;  4NLD A;  1S9G B;  5A6W A;  9RUB A;  1IQT A;  2DNL A;  1IJE B;  1FJ7 A;  1K1Q A;  3H5Y A;  5DDR C;  2CA9 A;  5F9L A;  5E3C A;  2E1R A;  1VQ5 S;  4CLS A;  4GKK J;  3LP2 B;  4CCH A;  1VRU B;  3ZFV A;  2NUU G;  4P71 A;  4OV6 A;  1OJ4 A;  1CC8 A;  4KKO B;  4DJB A;  5CAB A;  1YJW S;  2UXB F;  1U7L A;  1FWP A;  3D3C J;  4H4O B;  2VQF F;  4ZCM A;  3UVJ B;  1KLN A;  4KJI A;  1F5B A;  4CWB A;  4RNN A;  3OL8 A;  4NLY A;  4BCA A;  1YTY A;  2HRU A;  3DI6 B;  4N77 A;  3MM7 B;  4ZVS B;  3CCQ S;  1WHY A;  1CBK A;  2CQ1 A;  3MCS A;  2XLJ A;  5L46 A;  2D41 A;  4DL6 A;  5E3Q A;  4J9U E;  3V5R A;  1FJC A;  1VBX A;  1ZM3 A;  2FTR A;  1PYO B;  1X4G A;  4JUZ A;  3M8Y A;  3KOA A;  2FC9 A;  3LPE A;  1RWV B;  2DRB A;  2KVI A;  3PYF A;  4MK8 A;  2LEB A;  2MY8 A;  3ZZO A;  3QAT A;  4FF3 A;  4ER8 A;  2IIH A;  4DL2 A;  2R9L A;  3ETO A;  2RRB A;  3KJF B;  2D3O R;  4IUF A;  1NH7 A;  4NMX A;  2H3E B;  4GKK F;  2VG7 B;  4DV7 J;  1W25 A;  5ADZ A;  1AB8 A;  1CC7 A;  4PAB A;  2GIR A;  1EB0 A;  1TK0 A;  1YBT A;  1T0T V;  1V9O A;  3TZY A;  1RAJ A;  3DOM A;  2FJV A;  3QT8 A;  4F0K A;  3ZNJ 1;  4YR0 A;  4EI2 A;  2QTW A;  5BYQ A;  2QA4 G;  1B7F A;  2HEK A;  2LEP A;  3BH6 B;  3CDB A;  2HZV A;  1S9G A;  3PKY A;  2BAB A;  4C3M A;  3IWN C;  2ZH5 A;  2F65 A;  4YY3 J;  4M5D B;  3BYR A;  4HYK A;  3LP2 A;  3MGJ A;  4X2B A;  1VRU A;  2EFQ A;  3HP6 A;  4KKO A;  1Z1Z A;  2MYF A;  4M5K A;  3N5F A;  2V4J B;  3BH7 B;  4G65 A;  1RWK B;  1VLY A;  4H4O A;  4L72 B;  3UVJ A;  4DR3 J;  3JQM A;  3PO5 A;  3DI6 A;  3MR5 A;  2KN4 A;  3OD2 A;  3MM7 A;  3PX4 A;  3RW6 A;  4ILL A;  2MLY A;  1YX2 A;  5GAH U;  3AQP A;  3QJL A;  1FXL A;  1H7X A;  2OGU A;  1XMB A;  4ID5 B;  3IM9 A;  4LSL B;  2DR9 A;  1RTJ B;  5KFE A;  2HVH A;  2UUB J;  4HT7 A;  3J81 j;  4Y3C A;  4LT6 A;  4E2F B;  4DPX A;  1VQN S;  3QGH A;  4KT0 C;  1LW2 B;  1X4A A;  1WWH A;  3PG9 A;  5F0W A;  1UWB B;  5EWF A;  1CEZ A;  1NBE B;  2VBX A;  2KRR A;  1MG7 A;  2B7B B;  2LQJ A;  2RD5 C;  2I38 A;  2RF2 B;  3HKZ D;  4YY3 F;  1DTQ B;  3T5L A;  2V94 A;  1EAR A;  2VG7 A;  2FJE B;  1SIZ A;  3OJU A;  2ERR A;  4GVL A;  3N4W A;  1ZZN A;  4WK1 A;  4ZOS A;  2WVE A;  3PRV A;  4GKJ J;  2AEM A;  3LPY A;  2EKY A;  3T9Z A;  3Q2S C;  2HNZ B;  4OLP A;  2VA2 A;  1XQI A;  2J6U A;  3FQK A;  4M5D A;  9ATC B;  4KSE B;  2E1A A;  3GFY A;  3A8E A;  2AQ4 A;  5D3G B;  2DIV A;  3M2U B;  1KRP A;  4J91 A;  3D68 A;  3NCP A;  1RWU A;  4OI0 A;  4QPT A;  1YHQ S;  2M70 A;  3A4T A;  1CQN A;  2QGF B;  4NZ0 A;  1BD6 A;  2GHV C;  4UTG A;  2V4J A;  3D6F B;  4FYX B;  2ZOG A;  2HSE B;  4I68 A;  2UUB F;  1GFW B;  2C3O A;  5KFW A;  4M5G A;  4Y2A A;  3AT1 B;  4DR1 J;  1HQE B;  3JXO A;  1NK0 A;  1M5V C;  3G6V A;  5F8G A;  1SPB P;  2OFH X;  3BPD A;  2IY5 B;  2UU9 F;  1YWX A;  4CO2 A;  3ENW A;  4PG5 A;  4CM0 A;  2DYA A;  2QL9 B;  3WIV A;  3I0S B;  3NS6 A;  1B4S A;  5D77 A;  4ID5 A;  4LSL A;  2X1B A;  1RTJ A;  3HDS A;  4UUX A;  4ZCK A;  1ZBT A;  1FD2 A;  2KHC A;  2J0S D;  1PJ7 A;  1SKW A;  5A6P A;  1S7I A;  1UVJ A;  4GKJ F;  1T11 A;  2MJN A;  1TMM A;  1LW2 A;  2UUT A;  3FRY A;  4NLV A;  1UWB A;  1NPR A;  3L9Z A;  2W7P A;  2JFK A;  2NZC A;  2ZJR Q;  3V6D B;  2RF2 A;  5FDL B;  4ENO A;  2EC0 A;  2W7A A;  4HTI A;  4USW A;  4XPE A;  1DTQ A;  3LH2 S;  4JI2 J;  2V8D A;  1JMT A;  2V2Q A;  3VZI A;  1Z2Z A;  2V9K A;  2LXU A;  1F9F A;  3PZP A;  4DR7 J;  2UVR A;  2LXI A;  3R5A A;  3ZZU A;  2ZBP A;  3D28 A;  1T02 A;  2VJU A;  4B3R J;  2Q66 A;  1S49 A;  4OV1 A;  2KT5 A;  2QA1 A;  3R5C A;  5LMN J;  2HNZ A;  4ZIV A;  3DRP B;  3UN2 A;  4EBD A;  2OHD A;  1VDH A;  3BR9 A;  3DU5 A;  1TL1 B;  2HHU A;  3GJS B;  2XTJ P;  4DR1 F;  2LLZ A;  4U6P A;  4DHV A;  4OYB A;  5D3G A;  3M2U A;  2AWZ A;  2KFZ A;  3DFE A;  1U1Q A;  2R7W A;  1WDD A;  1T9W A;  3EXY A;  4YN3 B;  1Y10 A;  5IT0 A;  5KFF A;  2CVI A;  4WKR A;  4UQG A;  1UVI A;  2RJZ A;  3CJ4 A;  5KFN A;  4NA2 A;  3SSR A;  4WFB Q;  2VC0 A;  1HQE A;  3ZZ0 A;  3IAS 9;  1UET A;  4I6Y A;  4DFK A;  1TAU A;  3HVW A;  3QID A;  3J7A N;  2DNY A;  4I64 A;  1ZS6 A;  4YME A;  4O3N A;  3UDC A;  2CQH A;  5L39 A;  2CRL A;  2OD6 A;  4JI2 F;  3BV8 A;  4KYZ A;  3I0S A;  1HL6 A;  5H9E J;  4J9V A;  1MU2 B;  4ZN3 A;  1KVJ A;  3G6Y A;  3ITH B;  4DR7 F;  1QJH A;  2DH8 A;  4B3R F;  4IKA A;  3CUL A;  4C8N A;  2FGC A;  3BBF A;  1VBZ A;  1YRT A;  1HHS A;  1QSY A;  2ZNZ A;  2XY7 A;  5GAH I;  1HI8 A;  5LMN F;  1QVG R;  1VQO S;  3D54 A;  2QMW A;  3V6D A;  3T1H F;  5FDL A;  4KGM A;  3OR1 B;  1TV6 B;  3PRB A;  1TFW A;  1UP1 A;  1F60 B;  2Z0G A;  4URQ U;  4JI6 J;  2X3D A;  3IM8 A;  3MZI A;  2I9S A;  2BR0 A;  4OZJ A;  1RYS A;  2JWN A;  2Z30 B;  2VIC A;  4HHU A;  5IXU A;  2OKQ A;  3DRP A;  1U1N A;  3FDS A;  1TL1 A;  2Q1L A;  2KT3 A;  5KFP A;  4DL3 A;  3NG8 A;  3HSG A;  1DUR A;  3GYX B;  5KFX A;  4CO1 A;  2C2D A;  3G71 S;  3KKF A;  1FT8 A;  1Q7L B;  1NND A;  1H72 C;  2CJX B;  4FKX A;  2IAJ B;  2KI2 A;  3PEJ A;  4M95 A;  3MEG B;  1TFY A;  2HGM A;  2RQM A;  2HUR A;  2V0N A;  4KY3 A;  4EYI B;  3KG0 A;  1Q4R A;  4DOZ A;  2MQ8 A;  3LUY A;  2WZ1 A;  2ZFH A;  4WYL A;  3JTO A;  3SXL A;  1IJF B;  1DBD A;  2DD8 S;  4CO3 A;  1MU2 A;  3LAK A;  4BBY A;  1FDB A;  1NDL A;  2GAH C;  3ITH A;  2E5G A;  2OI2 A;  1SJ3 P;  8AT1 B;  2ZHA A;  3VAF A;  3GJT B;  3H4B A;  3U1N A;  1FNO A;  4OX7 A;  3OR1 A;  3NMR A;  4IRK A;  1Z4U A;  2F3J A;  4YUD A;  4CYU B;  3GV5 B;  2IM0 A;  3NKY A;  2XNR A;  1WEX A;  2VON A;  3TUJ C;  4K8R A;  3QWU A;  2GV1 A;  2IBO A;  4I69 A;  2DR6 A;  4FNH A;  1PCA A;  3OTD A;  2ZHB A;  3F44 A;  2DGT A;  2DY1 A;  3HKW A;  4O3S A;  4CO0 A;  2C3Y A;  3BBB A;  2CDR B;  3BPS P;  2G2Z A;  3MM5 B;  1F3V A;  3R5D A;  3DM2 B;  4I1T A;  4NXM J;  3G4S S;  3FRZ A;  2OSR A;  1HD1 A;  3QAU A;  3DNC A;  4A8K A;  1S6O A;  3MUR P;  3R2D J;  5HMX A;  3IGV A;  2G0J A;  1ROF A;  2WW4 A;  7FD1 A;  2PFF B;  2IAJ A;  1T9V A;  3OFG A;  4PXE A;  3MEG A;  4UY8 5;  2Y3Y A;  4IQX A;  1X7V A;  5GMD A;  3R8Y A;  3TAM B;  1IBC B;  4BC7 A;  5DDP C;  1T9T A;  5CHC B;  2JLE A;  3NMA A;  1EJ7 L;  3TA0 A;  2CPJ A;  1FRH A;  3I4H X;  4WE1 B;  2JOQ A;  3IC1 A;  4ZMM A;  3CD6 S;  1M5K C;  1OSD A;  1UJ5 A;  2HBY B;  3EZ5 A;  2AGP A;  4QCL A;  3DRX A;  1TL5 A;  3HHL C;  1X4E A;  5DRK A;  4PAA A;  3WC2 A;  2OFG X;  2ZC3 A;  1SH0 A;  4NXM F;  1XEZ A;  2D1C A;  2W8K A;  4CYU A;  2K2P A;  3TA2 A;  2XMT A;  3HFZ B;  4IO9 Q;  1MML A;  3MPW A;  3I5A A;  1I94 F;  2YY3 A;  1D9A A;  2HYI B;  2B0G A;  1EET B;  2UUC F;  1RAO A;  3DHX A;  1U2C A;  4R5P B;  3QZ8 A;  4RNF A;  1NKC A;  2OEM A;  2DBB A;  3BKF A;  1YLX A;  2RQ4 A;  3MM5 A;  3M9M B;  5CD4 A;  3RR8 A;  3VV2 B;  1U1R A;  3DM2 A;  2MZQ A;  2JLF A;  2NRE A;  2GQ2 A;  2DKO B;  2CQ0 A;  2ZHO A;  2ZZM A;  1BMQ B;  4HI1 A;  5HO4 A;  3EDQ B;  1M0S A;  2KL8 A;  5IZH A;  1U8S A;  4E8U A;  4W90 B;  3ZC4 A;  4RL1 A;  2ILZ A;  3LW5 C;  2HVZ A;  2KYX A;  2DNN A;  2J9D E;  3LA0 A;  4ELV A;  3QGP A;  1RHK B;  3NCR A;  5EN1 A;  1HQ2 A;  2UUA J;  1H7W A;  5B09 A;  3HSJ A;  5IWA J;  2A2C A;  5CYJ A;  1I5O B;  3FSI A;  2QG9 B;  3I82 A;  3TAM A;  2FDN A;  5B0A A;  1L3S A;  2EFP A;  2YWW A;  3GYN A;  1TUW A;  4X4T A;  3CW2 C;  3FKB A;  1TQL A;  4CM2 A;  4WE1 A;  1YIT S;  1ARO P;  2RRN A;  2AX1 A;  4ZPD A;  1SIW B;  5HP1 B;  5L9X A;  1RAD B;  2OSQ A;  1AT1 B;  2ZOF A;  2I0X A;  3M6X A;  4FDF A;  3ISN D;  2FLO A;  1YJN S;  3UR3 C;  2V5H G;  4J9Q A;  2JDJ A;  2KRB A;  4OX9 F;  2YNF B;  1VHF A;  3BR8 A;  2XMJ A;  3MR6 A;  2KZZ A;  4D3H A;  1XNQ F;  2ZH7 A;  2FZC B;  3VAM A;  1EET A;  4AQY J;  3Q89 A;  3G8Q A;  3UCG A;  3PHT A;  4O3R A;  4KH1 B;  4R5P A;  1RWP B;  1Y9O A;  5IC6 B;  2GNK A;  2NQP A;  3T5J A;  2M4M A;  5CCM A;  1M5O C;  2UUA F;  5HQL A;  3OTC A;  4V1A k;  5IWA F;  2FLL A;  5H1S V;  4OMF G;  4RW8 B;  4RZR A;  3L7P A;  1UCN A;  4X64 J;  5DQI A;  2XMW A;  3I6P A;  5KT4 A;  1KEK A;  4PR6 A;  2EBG A;  3MFH A;  3H59 A;  2XUL A;  2VG6 B;  4GVB B;  1AYE A;  4MIB A;  2FHO B;  2AYE A;  4PG6 A;  2Y0B B;  2HFS A;  2IFX A;  5CXT A;  3GZ7 A;  3PX0 A;  1CJU B;  2HND B;  3B54 A;  2O1P A;  4ZP7 A;  3DLH A;  1VBY A;  4ZDN A;  4CNZ A;  3BGO P;  1PKU A;  2GVD B;  1IKV B;  2QC3 A;  1YRU A;  2NYI A;  2POK A;  1WEY A;  2RUS A;  5U47 A;  5KFL A;  2JX2 A;  3T6J A;  3KK1 B;  3TUP A;  2AZ3 A;  1JB0 C;  2IM1 A;  2X7I A;  4KHP J;  5D4P A;  5HP1 A;  3CCS S;  1NJI T;  2CNN B;  1SCJ B;  2QT7 A;  3IBW A;  4ED4 A;  2DNP A;  1TKX B;  4FVM A;  4V19 X;  4CLU A;  2AV5 A;  2P5V A;  4NYZ A;  4X64 F;  5FLX Y;  1RAB B;  2EBE A;  2X1A A;  1XWL A;  3GON A;  3K17 A;  3DDN A;  3KUE A;  2V68 A;  2BUN A;  3VWS A;  2W2O P;  1KQG B;  4CO4 A;  1H38 A;  4XPC A;  2KFN A;  2D74 B;  3QZ7 A;  4RW8 A;  4OIX A;  4QIE A;  3M6W A;  2E5I A;  2V8P A;  1SJ1 A;  3H40 A;  2DR5 A;  2HFU A;  3ZTQ A;  3QPI A;  3AJ1 A;  2ACY A;  3QQC D;  4WPA A;  3S6E A;  3J80 Y;  3AJD A;  2H4Y B;  4NA1 A;  4DUY J;  1FNM A;  2VG6 A;  4GVB A;  2WB1 D;  3MTJ A;  4HDH A;  2K06 A;  1U02 A;  3BM7 A;  1FA0 A;  2EPI A;  3BSN A;  4OHY A;  3OQ2 A;  1CJU A;  2HND A;  3FCW A;  1T03 B;  4KHP F;  4J9M A;  4ECV A;  2IRU A;  1W2I A;  5HMW A;  3V6H A;  1H6K X;  2VFU A;  1QDU B;  2EXU A;  2KZM A;  1PAE X;  3DC2 A;  2GVD A;  1IKV A;  2BX6 A;  4KC5 A;  4QIG A;  2C2K B;  4HVZ A;  3CO9 A;  4AYB D;  1R6Y A;  1VOM A;  2MZ1 A;  1NK7 A;  2RRA A;  1OMS A;  3DOK B;  3WZ0 A;  4K0K F;  4Y28 C;  5KFU A;  4DSL A;  1GH8 A;  3KK1 A;  4F8R A;  4Y00 A;  4CTA B;  4JV5 J;  5E33 A;  2AW0 A;  2ZH9 A;  5DLG A;  1Y3K A;  3KWM A;  5HQM A;  2A0F B;  2VDH A;  2ZBR A;  4PPZ A;  3GU0 A;  3VGT A;  4EMD A;  3Q8S B;  2CIM A;  1KLM B;  3NGK A;  1TKX A;  3FGV A;  4QR1 A;  2GX8 A;  4W98 A;  1NRK A;  4KO0 B;  2KM8 B;  3OVA A;  3TZX A;  3HLU A;  4NZ7 A;  1HR0 F;  1MWY A;  4LBI A;  3DLL Q;  1HYS B;  2FB0 A;  4RPF A;  1R0A B;  3CUN A;  2PI4 A;  2QSF A;  1S4F A;  2YPZ A;  2CJB A;  4XIU A;  3H2V E;  4A8O A;  1FD8 A;  4LQ3 A;  2BQ3 A;  3KLG B;  5LSR A;  1WI8 A;  3PW2 A;  3HZG A;  4TU9 A;  2BE2 B;  2RE1 A;  1IR1 A;  2BJ3 A;  4OHZ A;  2MSS A;  2BAN B;  2OUG A;  1NPK A;  3HHD A;  2IDL A;  3A3O B;  4FBT A;  4M5H A;  3MF5 A;  1N88 A;  2MDA A;  2VUG A;  1VC0 A;  2DJW A;  3NOC A;  3FEX B;  5KG5 A;  4B17 A;  4JI3 J;  1F9E B;  2DXF A;  4X4U A;  4NCB A;  4JV5 F;  1X9W A;  3GE9 A;  3ZZT A;  1FX4 A;  1KD1 T;  2UP1 A;  3AD9 C;  1S79 A;  1T03 A;  5J2Q B;  1C1C B;  1TUV A;  4CH0 S;  2R2S A;  1U0H B;  4P2S A;  2QSW A;  3TVZ A;  3HSD A;  2V67 A;  1Q5V A;  2XCP A;  3OFE A;  5EDW A;  1N48 A;  3Q83 A;  5CAA A;  5B0E A;  4C11 B;  3ILO A;  2UXD J;  4X4Q A;  1S1U B;  3MAQ A;  2A2D A;  2DNZ A;  4LVO P;  3GMG A;  3DOK A;  2J7K A;  4LF9 J;  2ATL A;  2ZH6 A;  4DLG A;  2ZBQ A;  2VZ9 A;  1Q78 A;  2YWK A;  4CTA A;  2IJF A;  4XTT A;  1HW8 A;  2J0Q D;  2HGL A;  3J7Z 5;  4YDX A;  2CQP A;  3JTP A;  1KQS R;  2NSB A;  3QAE A;  1UAW A;  1XR7 A;  3K89 A;  1KLM A;  4WYW A;  1S0M A;  1NHU A;  3MUM P;  4GO7 X;  1I3O B;  3NAH A;  3UW1 A;  4KO0 A;  4DSE A;  3Q8R B;  3FBB A;  3GP9 A;  2J7U A;  4O44 B;  4CNY A;  5EHH A;  4M5I A;  1HYS A;  1R0A A;  1F5C A;  1FE0 A;  3C66 A;  2Y1J A;  1IBL J;  4JI3 F;  2VJV A;  4K4X A;  3OV7 A;  1Q7Y T;  3U27 A;  2K1R B;  4PG8 A;  4MKA A;  5JVH Q;  3KLG A;  2Y8Y A;  2I2Y A;  5KG1 A;  3JQJ A;  4RNH A;  1S6U A;  2CQ3 A;  2MKH A;  4Q43 A;  3RW7 A;  4DN9 A;  2B9Y A;  2BE2 A;  1WEZ A;  3HZE A;  1MLA A;  2RQC A;  2UXD F;  2BAN A;  3N79 A;  1WC4 A;  3H25 A;  1YSJ A;  4DX8 H;  4UOF A;  1R0B G;  4DSK A;  1YIJ S;  3D0I E;  1L3V A;  3I55 S;  2Z58 B;  3OT9 A;  1T9U A;  1XR6 A;  3ENV A;  2QJ3 A;  2A1B A;  1WSR A;  5J2Q A;  1C1C A;  2QMU B;  2FZG B;  1U0H A;  1DHM A;  4K5S A;  4F3M A;  3N28 A;  1RAF B;  2C2R A;  4H54 A;  4OJ1 A;  4ATN A;  1PO6 A;  3NNA A;  1U45 A;  3BEG B;  3DYA B;  5A8W B;  2HQ3 A;  4Q7A A;  1SC3 B;  5HK4 A;  4C11 A;  1S1U A;  2ZH4 A;  3BO4 A;  2FIU A;  4FZV A;  5J1N A;  3RUB L;  1HBO B;  3RBE A;  4GRS A;  3VQT A;  2RUG A;  3QGI A;  1Y0H A;  3FC9 A;  3R27 A;  2DB1 A;  3Q8V A;  3D2W A;  2HZA A;  4F26 A;  1T7P A;  2QMX A;  1IBL F;  4X4V A;  1B0T A;  1KVI A;  3ZXW A;  3M8W A;  4KGX B;  1FO1 A;  3DDI A;  2R8H A;  1XMQ J;  4NZ6 A;  2JRS A;  1YRX A;  2DH9 A;  3FVY A;  8ATC B;  3EIC A;  3VAL A;  1CUL B;  2RNE A;  3CGI A;  3P3D A;  4FPR A;  5GAE U;  4ED7 A;  1F0X A;  4O44 A;  2EK1 A;  2CQI A;  2G0I A;  5ETR A;  3PV8 A;  4RW4 B;  1N56 A;  2CJA A;  3P6Y C;  2X51 A;  3RAQ A;  5HJY A;  4CH1 A;  3W63 A;  1FXD A;  2BJ7 A;  4JP8 A;  1JQG A;  2WAQ D;  2K1R A;  3MUV P;  2AJ2 A;  5E41 A;  2FC8 A;  2YWF A;  1OPI A;  2HS3 A;  2DT9 A;  3R5J B;  3NS7 B;  1I1G A;  2W9B B;  4IOC Q;  1UWA A;  4P10 A;  2WTF A;  3KLE B;  2ZBC A;  1HHQ A;  1LXN A;  5FD1 A;  4QJV A;  3RR7 A;  3PIO Q;  3E2E A;  2C28 A;  2DXD A;  4HEA 9;  4NLO A;  3D6H B;  3EGV A;  2WK4 A;  2IJN A;  2P2C B;  2E29 A;  4ID8 A;  1PBA A;  2O01 C;  2PEB A;  1UTA A;  2CNK B;  4EU0 A;  1S6P B;  1XMQ F;  3DYA A;  5A8W A;  2AEF A;  2PGC A;  3PYE A;  2DIT A;  1U8W A;  1RWO B;  5E3R A;  4AXJ A;  1HBO A;  2EG1 A;  1J27 A;  2JSX A;  4IG3 B;  4ZCL A;  1O8B A;  1S9E B;  1UFK A;  5D4N A;  4CT8 A;  1U6Z A;  1FJG J;  3CCT A;  4Y2K A;  4W4M A;  1S0N A;  5IQQ A;  2CZ4 A;  2LA4 A;  1SJR A;  3SIP B;  1RT5 B;  3GLJ A;  2IBK A;  3U1M A;  2RU9 A;  2MZJ A;  1UFL A;  3BDE A;  1N5V A;  4Y65 A;  1CUL A;  4ECY A;  4F2S A;  5ETT A;  4JV1 A;  1JLQ B;  2DXE A;  2FJD B;  2XHC A;  4C7Q A;  2A3J A;  4RW4 A;  3CD5 A;  3GIL A;  4ZPA A;  1KFS A;  4PEO A;  1Q8B A;  1W7W A;  3NNC A;  1KWM A;  5D4L A;  4UZC A;  4B9L A;  2R7R A;  2BKP A;  4DX5 A;  1TU0 B;  2JLG A;  2FJB B;  2LDI A;  3H0P A;  4BDP A;  3G2X A;  1PIL A;  1CQM A;  2W9B A;  2VQE J;  4ZPV R;  3TQ1 A;  4KAI A;  3PW7 A;  3KLE A;  4UOH A;  3RBD A;  2B8Q A;  1ZM4 A;  4MMO A;  1YDL A;  2E1M C;  4MT1 A;  1FI4 A;  2CNO B;  2DNO A;  1GTE A;  4DV4 J;  4U7C A;  1XNR J;  1FJG F;  2HVD A;  4UST A;  1V3R A;  1S12 A;  1S6P A;  4ETZ A;  5K8O A;  3M9N B;  1U1K A;  2R7S A;  3M4X A;  3W7B A;  2P6T A;  2IM2 A;  2NPF A;  5FLX U;  3KK3 B;  5L1L A;  4IG3 A;  4PQA A;  1VLO A;  4C8K A;  1F6T A;  2F4V J;  1S9E A;  5IV4 A;  4RNO A;  3UD3 P;  4HDG A;  2ZE2 B;  3H2U B;  2BW2 A;  2N82 B;  3R7B B;  2BJD A;  2G0C A;  2N3O A;  1RT5 A;  2NXE A;  2XMA A;  3UR0 A;  1JLQ A;  5CH7 B;  1L3T A;  2OAU A;  2B4V A;  1GXT A;  2Y1R I;  2VQE F;  3U02 A;  3CD0 A;  4JBC A;  5DG7 A;  4CZC A;  5ETO A;  3EMT A;  5HN0 A;  1S7H A;  1D9D A;  1XER A;  3QT6 A;  4HAC B;  5J1P A;  2RAQ A;  3G8S A;  1M1G A;  4X4N A;  1E6V B;  4DV4 F;  1XNR F;  4EBC A;  2DR8 A;  3R6L B;  3K5O A;  1HD0 A;  4B3S J;  1D09 B;  3D0H E;  3VVT A;  1TL4 A;  2Z2Z A;  4K4Y A;  2ZUG A;  1T9Y A;  1RJJ A;  3EYZ A;  1SQG A;  2B9X A;  4EO6 A;  1NSQ A;  3EZO A;  2F4V F;  3OXF A;  1VIX A;  4URG A;  2QLW A;  1JIH A;  4PCQ A;  1LK7 A;  1DQA A;  1C0T B;  4C9D A;  3CCU S;  4DQQ A;  3PXG a;  4ED1 A;  2BOP A;  5KFJ A;  4FP9 A;  3KK3 A;  5DLF A;  4ZLP A;  4B9V A;  1RAC B;  4F4W A;  1DLO B;  2V4R A;  1IKW B;  1PIE A;  2ZE2 A;  1YVF A;  2OP5 A;  1T94 A;  2XSJ B;  4R0E A;  4NLR A;  5DGB A;  1H2U X;  3TUI C;  1WKJ A;  2MZT A;  3N01 A;  4NYP A;  4B3S F;  5CYM B;  2FVQ A;  3I4P A;  3W1Y C;  3FZB A;  4R0J A;  2QE5 A;  1D8Y A;  4KB7 A;  1V5I B;  4UW2 A;  3KMQ A;  2FVC A;  4HAC A;  2JZ5 A;  3BJY A;  1GT8 A;  1VGY A;  4DPW A;  5A8K B;  3G87 A;  1E6V A;  4WBF A;  4C3L A;  1VC6 A;  3QLH B;  3HVT B;  1AFJ A;  3W66 A;  1VQP S;  5LSL A;  3NXZ A;  1VRT B;  4DBQ A;  2LP4 A;  2YX7 A;  4F3O A;  4FS1 A;  3LWL A;  4YHH F;  2QYC A;  1VHI A;  2B51 A;  1H3D A;  2WVF A;  1QSL A;  4G3I A;  3MM6 B;  3BQ1 A;  1N5Y B;  1Q53 A;  4OZ5 A;  2VH7 A;  2V50 A;  4NE9 C;  5CA5 A;  4FYV B;  4Y34 A;  5DM7 Q;  1GX5 A;  3D67 A;  3EM1 A;  4HH0 A;  2G2Y A;  3N6L A;  3PR5 B;  1C0T A;  2AMC B;  2MHE A;  5GAG U;  4PXC A;  3CIZ A;  3K59 A;  1JJ4 A;  1DAX A;  2P9E A;  2QEX S;  3KK2 B;  3BSC A;  1KHV A;  2W2M P;  4J9S A;  3SEO A;  3PHE A;  2DNQ A;  3A8J A;  1DLO A;  1JNR B;  1RYR A;  1IKW A;  1S5Z A;  2VAS A;  3A3P B;  2XSJ A;  4CLK A;  4ZP9 A;  2KXH A;  3HI9 A;  4DR2 F;  4WU2 A;  3HHE A;  5L1J A;  3M8Q B;  2WBM A;  1CJV B;  1SQE A;  3SYZ A;  3PJW A;  2VFT A;  2DK2 A;  4OYA A;  5CYM A;  1DAR A;  4TU7 A;  2XMM A;  3KUH A;  4WFN Q;  4OI6 A;  3KDO A;  3TVK A;  4XO0 A;  3IWL A;  4AD6 A;  2QLJ B;  2AHO B;  2AYG A;  5A8K A;  2B43 A;  2PEH A;  4NX9 A;  1X9S A;  1UVL A;  1PBU A;  3QLH A;  3HVT A;  3FMW A;  3US5 A;  1R7I A;  4DV0 J;  4FXW A;  3NWG A;  1VRT A;  1J5E J;  3FBF A;  3F56 A;  1RKI A;  3DOL B;  3PW0 A;  2BBE A;  2I6W A;  3BDP A;  4PXD A;  3MM6 A;  3M8Z A;  5HQ8 A;  3ILI A;  1N5Y A;  3JSY A;  1SC1 B;  3WX8 A;  1RWX B;  3GCX P;  5C24 B;  4XDD A;  4N5S A;  3LO3 A;  2OD4 A;  4OI4 A;  5ETL A;  4M5N A;  5DS7 A;  1FVQ A;  4DL4 A;  4TKT A;  5A2Q Y;  3KXD A;  1V3S A;  1H2T Z;  2E44 A;  3KFW X;  4P7T A;  1Y5L B;  1X0F A;  2PMZ D;  1BGX T;  3KK2 A;  1T9X A;  3D0G E;  3MXH P;  2EG2 A;  1KON A;  3TUZ C;  3D1Q A;  3LGM A;  3J7Y I;  2ASJ A;  1KTV A;  3AOD A;  4KV8 B;  1FRI A;  3Q23 A;  2N7C A;  2ROG A;  2D3Z A;  2ALZ A;  2YBV A;  2HWI A;  5KFS A;  5J2M B;  5E7O B;  2MEW A;  1RZM A;  3KHG A;  3QFH A;  3M8Q A;  2MZR A;  1CPZ A;  3W8P A;  1CJV A;  2W2P P;  5HAN A;  4AND A;  1SH3 A;  2ATC B;  3EUN A;  2ZDP A;  4DSI A;  1RHR B;  2BKN A;  3JAM Y;  2RKI B;  2VHG A;  4DV0 F;  5D0E A;  4WJB A;  1J5E F;  5IT4 A;  3ISN C;  3TWZ A;  3UCZ P;  3TAR A;  2ASD A;  1N52 B;  2OTL S;  4DCJ B;  3FMB A;  4F0H A;  5KT5 A;  1FNX H;  3AB2 B;  2FJX A;  2HQF A;  2JVR A;  5F8N A;  1G4C A;  3HF5 A;  3ILL A;  2QO3 A;  4OHX A;  3TAN A;  2WHO A;  4B9S A;  4QWD A;  3H5U A;  3DOL A;  1UW9 A;  4U8Y A;  5D6G A;  1HBM B;  4LJM A;  6FD1 A;  2KHD A;  2VD3 A;  2F7V A;  1K47 A;  2OIH A;  1GMV A;  1S0O A;  2DR7 A;  2Y0S D;  2DHG A;  5C24 A;  2DVI A;  2H48 B;  2AU0 A;  4TNO A;  2YKM B;  4K4W A;  3A12 A;  4J37 A;  2E9R X;  1NM2 A;  1R0C B;  2BQR A;  2OPS B;  3GIM A;  2W8L A;  2IA0 A;  1HNI B;  2KG0 A;  4F36 A;  2VBY A;  3M8S A;  1WKL A;  1JXV A;  5EUH A;  3NLC A;  4KV8 A;  2LDY A;  4O3O A;  2DGV A;  4ILM A;  3Q8Q B;  1VQL S;  5J2M A;  1OO0 B;  4YDD B;  2H4W B;  1V5V A;  1CJT B;  2HIQ A;  5H9F K;  1K8A T;  4K4T A;  3CED A;  4NI2 B;  3BO2 A;  3IA0 A;  5DET A;  2RKI A;  4EUV A;  1S4E A;  3SFG A;  3RU0 A;  1KSP A;  5C7P A;  2EFN A;  4EK2 A;  3VZH A;  1UEK A;  1UA1 A;  3VR1 A;  1XN9 A;  4L3N A;  1EX8 A;  1IN0 A;  2JL9 A;  2EC2 A;  3M32 B;  4ECS A;  1OPZ A;  3CDU A;  3FBE A;  4ZVH A;  1UKU A;  2EVZ A;  3GFX A;  3VVU A;  3GFZ A;  2DHH A;  3DU6 A;  3H7H B;  2QIF A;  2K3K A;  1BUX A;  3MHY A;  4OYZ A;  2CPE A;  2M9K A;  4L75 A;  1TL7 B;  1HBM A;  4K2J A;  2IMW P;  4ZPW R;  1NB2 A;  3R9L A;  4M8L A;  3SSS A;  4ZIW A;  4XK8 C;  2CPZ A;  4ES1 A;  3KUG A;  3HHL B;  1REV B;  2YKM A;  2V2Z A;  1YJ9 S;  2PE8 A;  3Q2T C;  1RAI B;  1UEV A;  2YH1 A;  3DRR B;  5F8L A;  2CDQ A;  1PAU B;  2E7X A;  3NS5 A;  1M5H A;  3DN9 A;  4EEY A;  4LRE A;  1H73 A;  4FYY B;  2OPS A;  1HNI A;  4WFX A;  3HMJ G;  1KQF B;  3CMA S;  4GMK A;  3IRW P;  2CPF A;  4L76 A;  3KHL A;  2F5G A;  2VF3 A;  3MR7 A;  1ULR A;  2RHQ B;  2X1F A;  1BQX A;  1MN9 A;  3TX0 A;  5KFI A;  2G1H A;  3Q0A A;  4DV6 J;  2VQF J;  2AZ1 A;  4H4K A;  4MTP A;  3LTO A;  2GMH A;  1CJT A;  1IVZ A;  4K4S A;  1B0V A;  1SI9 A;  5IT9 U;  4NI2 A;  1SL1 A;  4U7U D;  3QRR A;  1SJ4 P;  2OML A;  4F4K A;  1ZAV A;  4E0D A;  4YOE A;  2MQO A;  3LP1 B;  3PW4 A;  3M32 A;  5KT6 A;  1I51 B;  1NK9 A;  3W65 A;  1SL2 A;  3M8R A;  3CCV S;  1VQ9 S;  4LFC J;  1D9F A;  4RBU A;  3TRG A;  1CLF A;  3HJF A;  2JFD A;  3Q86 A;  1TL7 A;  3TP2 A;  2DNG A;  1YJ7 A;  1C4A A;  1X9M A;  4LF4 J;  2E5L J;  5H9E K;  1UVM A;  3P96 A;  3R6G B;  3P5T L;  4ZLL A;  4WII A;  3HHL A;  2WW8 A;  1REV A;  4B08 A;  3PM9 A;  3GIR A;  2Y1I A;  4DV6 F;  3DRR A;  4HLB A;  5LMU J;  2XBP A;  1VRQ C;  1KP6 A;  3J81 Y;  2BYC A;  2MQQ A;  2Q6C A;  1S48 A;  1VQ8 S;  3OLB A;  4RW7 B;  1YBU A;  1CVJ A;  3EE3 A;  1RLD A;  2RS8 A;  1X4B A;  2AYB A;  1Q82 T;  4DPT A;  1YJV A;  1LV5 A;  5LJ3 Y;  3NGD A;  4MKB A;  4ES2 A;  2A10 A;  2CXE A;  4USV A;  3PTW A;  2QRR A;  1RUS A;  3WC0 A;  1O6X A;  5F3T A;  4NLS A;  4LFC F;  4JI7 J;  4DLE A;  2R3V A;  3TI0 A;  1U4B A;  5KG4 A;  2QN6 B;  4ECQ A;  2LKZ A;  4MJK A;  1VR6 A;  3NL0 A;  2AJQ A;  1HHT P;  4MK9 A;  3OW2 R;  1HLW A;  2IRX A;  1RDR A;  4LF4 F;  4OYI A;  2E5L F;  1YQH A;  4Q2L A;  4C3K A;  1HI0 P;  3LP1 A;  2L41 A;  4ECX A;  2Q43 A;  2YQ1 A;  5K8P A;  1RLC L;  5AT1 B;  3HFK A;  1FRM A;  1X5S A;  2GJI A;  1NUE A;  3OVB A;  1F1B B;  3DXS X;  4M1K A;  2DRD A;  5LMU F;  5J2P B;  2XMU A;  5A76 A;  5D4O A;  1BC6 A;  3EDR B;  3S7R A;  4WU3 A;  2W4C A;  5F8I A;  3F73 A;  3P45 B;  3SCI E;  3HVR A;  3VHQ A;  2HS0 A;  1KNZ A;  1N54 B;  4C6A A;  1OYE A;  2B9W A;  3TA1 A;  2H51 B;  4S0M A;  4NLT A;  1HFE L;  3RRK A;  1WC6 A;  4LQ9 A;  1RI7 A;  2Z2M A;  1R8C A;  4OZ2 A;  4RW7 A;  4JI7 F;  2HHX A;  2CG4 A;  3OSN A;  3PVX A;  4X65 J;  3FEZ A;  3K8W A;  4ZA1 A;  3AB4 B;  3UFC X;  1ZTT A;  2LMI A;  3R1L A;  3VAI A;  2HZC A;  2HS4 A;  1UMJ A;  2GML A;  1C4C A;  2DHX A;  4K59 A;  4NRT A;  4ZKA A;  4LR8 A;  2R2U A;  5EX0 A;  2DCL A;  2J0W A;  1WI6 A;  1RHU B;  4CP5 A;  2JEJ A;  1U2F A;  3LAL A;  4OJH A;  2UU9 J;  1ZOT A;  1H98 A;  3OR2 B;  1Q95 G;  1ZA1 B;  2G2O A;  5C5J A;  3I32 A;  4QIW D;  4BC9 A;  2FVP A;  4NLQ A;  4LF6 J;  2ZUA A;  4F50 A;  1EIY B;  4G1I A;  1Q1K A;  1S1V B;  3FSY A;  4UZB A;  5B0G A;  1SVD A;  3ZNU A;  4OZL A;  1R89 A;  4Y2I A;  4Q2M A;  2ABY A;  4DQS A;  1RU2 A;  5GME A;  3L95 X;  4ZJL A;  2F8H A;  3Q8U A;  3P5B P;  2PMW A;  2WBR A;  2M3D A;  4Y6I A;  3UO0 A;  1MNE A;  4I6W A;  5C25 B;  2RQK A;  5BJR A;  5J2P A;  1K44 A;  1MSW D;  1M1H A;  4ES3 A;  3CJ5 A;  4G1P A;  1GK8 A;  5D15 A;  3R5B A;  4DUT A;  4ZVT B;  4CH7 A;  2WSE C;  4USI A;  2BZ2 A;  4X65 F;  2KH9 A;  2AJF E;  2PO4 A;  4ED5 A;  2XYH B;  5BYS A;  3CCL S;  4L6V 3;  1HNW J;  3CCW A;  2XGQ A;  1S1T B;  3CJ3 A;  2AIR B;  1RHJ B;  1RBO B;  5L9N A;  3MOZ A;  4I0W A;  1N34 F;  5E3P A;  1RHQ B;  1FTC A;  4M5M A;  2XY5 A;  5T14 A;  2C1E B;  3TJ8 A;  1OQ6 A;  4C48 A;  3JS9 A;  4F67 A;  2CQC A;  3CF5 Q;  3ONQ A;  1LOU A;  4K2X A;  3HHN B;  4OHV A;  4A8S A;  2NPI A;  3HT0 A;  4KR0 B;  4LF6 F;  2PN6 A;  3T3F A;  4I2Q B;  3X1L B;  4IR9 A;  1BQN B;  4CLL A;  1IWA A;  2MKK A;  1XMO J;  1UL3 A;  4LRC A;  4TVA B;  5KG7 A;  3CT9 A;  3C2P A;  4RUH A;  2MST A;  4CLP A;  3IP0 A;  3QYY A;  4Q5V A;  4J9N A;  3OR2 A;  4ICL B;  4KPY A;  4WTY A;  5KG6 A;  1OQ3 A;  2B6A B;  2NS1 B;  2UV8 G;  1NB7 A;  4B9N A;  3AQO A;  3CDW A;  1S1V A;  1Y00 A;  3JSB A;  4R25 A;  1HNW F;  1NK4 A;  3KLV A;  2WB4 A;  3AH6 A;  3FNN A;  1D3W A;  2HAI A;  2KJW A;  2G13 A;  5C25 A;  2V6A A;  4D3G A;  1OS5 A;  1TEL A;  1WAC A;  3T1H J;  1U0S A;  1AXQ A;  2CUY A;  4UF4 A;  4N8N A;  3BZQ A;  4KGZ B;  4DX7 A;  1S1W B;  2GIQ A;  4WXW A;  2XSF A;  5HAO A;  2HK3 A;  4EFA C;  2CWX A;  4QR2 A;  4OYW A;  1S1T A;  3WHI A;  1EKS A;  3W8G A;  4QW9 A;  4Y0F A;  4U9R A;  3C6T B;  4CLT A;  4QU6 A;  2PI5 A;  5A8R B;  2U2F A;  1N36 J;  1FF2 A;  1R31 A;  1OY6 A;  4QBU A;  2BJ8 A;  1XMO F;  4RKU C;  1U1M A;  5KFB A;  1WUU A;  4JV2 A;  4W92 B;  3PO4 A;  3BQ0 A;  3OL9 A;  3WQP A;  1NAQ A;  2IRY A;  5BYR A;  1F2H A;  2HWT A;  3NNH A;  4I2Q A;  3TX8 A;  4I2P B;  3W61 A;  4CQ1 A;  3IR5 B;  3KNG A;  1VK3 A;  4UOC A;  1Q8K A;  1BQN A;  1DQ9 A;  2UV8 A;  2CQ4 A;  3HHL D;  4CLF A;  1P8G A;  3CME S;  1N32 J;  1F3F A;  5CZV A;  2ZWP A;  1K0V A;  2COL A;  3HJV A;  3TZW A;  1YK9 A;  4RW6 B;  2HLT A;  4ICL A;  1TR0 A;  2MKJ A;  1X5P A;  4FYW B;  3CJS A;  4DZD A;  2B6A A;  1YJU A;  1REG X;  2QYG A;  3TAP A;  3UDV A;  2M52 A;  1FFG B;  1FJE B;  2M5Y A;  3UNY A;  2CKW A;  1X5T A;  1NJW A;  3D7S B;  2CJK A;  4E98 A;  4ZJQ A;  3P49 B;  1N36 F;  3IR7 B;  4WTO B;  1LNQ A;  3R7N B;  2B56 A;  2AX0 A;  2GA7 A;  1YKW A;  2R8I A;  4DU7 A;  3CCM S;  2J9D A;  1S1W A;  5KFO A;  2O66 A;  1WF2 A;  3KHR A;  4USH A;  2EKN A;  2AJ0 A;  3IAM 9;  2VU5 A;  1IR2 A;  4DV2 J;  1R27 B;  2KM8 C;  2XI3 A;  4Q44 A;  1PSD A;  5SUH A;  2XQC A;  3C6T A;  3T1Y J;  3GCW P;  2DGQ A;  3H42 A;  4UT4 A;  4NPO A;  5A8R A;  1RTH B;  4CO5 A;  2FD2 A;  2J0X A;  1X8D A;  2CPD A;  3TEH B;  1JXE A;  2MGZ B;  3R7S B;  5KOX A;  3ET6 B;  4CLY A;  2PA8 D;  1PC4 A;  1N32 F;  2APO A;  4DQR A;  4NOH A;  3A8K A;  2MQL A;  4DSJ A;  2MQM A;  2MHN A;  1XIQ A;  2CG8 A;  3O6Q A;  3D66 A;  3V6J A;  4OX8 A;  1NSP A;  2D69 A;  2VG5 B;  1LK5 A;  1FTR A;  4I2P A;  4DFP A;  4QWA A;  1HAR A;  1YJR A;  2PC6 A;  3T9N A;  2HFN A;  2XYG B;  2ZH3 A;  4Z7C A;  3QBC A;  2DY9 A;  4IG0 B;  4RU2 A;  5AXL A;  1PYS B;  1S0V A;  2IHR 1;  1BXN A;  4RW6 A;  5KFM A;  1A9N B;  3EGZ A;  4B3O B;  2O3D A;  3QJP A;  5KFK A;  3RTV A;  2RDJ A;  1YG0 A;  4DV2 F;  1RBA A;  3QRP A;  4C0O C;  3T1Y F;  4HHH A;  5HBM B;  3DGV A;  3BKU A;  2I8E A;  3UD4 P;  2UUW A;  4ELT A;  2XMK A;  1HNV B;  4ED2 A;  2HKE A;  3FJ2 A;  2J5A A;  5IS2 A;  2HLU A;  1NEE A;  3IBF B;  3QO9 B;  4R8U B;  1I94 J;  5KFD A;  2UUC J;  4FKY A;  4YP3 A;  5AE2 A;  3GR1 A;  4RX6 A;  4EBE A;  1G2E A;  3GJQ B;  1RTH A;  1DFD A;  1FDA A;  3TJA A;  4C8M A;  5T7L B;  3HUL A;  1F9H A;  1OY8 A;  3HVA A;  2MGZ A;  4ZVQ B;  2VPX B;  3ET6 A;  2A6M A;  2O5D A;  1SC4 B;  3RYL A;  2ZKU A;  3PFO A;  3CJ2 A;  5JVG Q;  3LOU A;  1LEO A;  1RT4 B;  3E3X A;  2LXF A;  3QFW A;  3W9J A;  2XGP A;  2LU1 A;  4USJ C;  3PNI A;  2VG5 A;  2K8G A;  2IPO B;  4RU9 A;  3ICL A;  2B9E A;  1HPZ B;  4O4G B;  4A4J A;  3AXK A;  3PKM A;  4DMZ A;  4IG0 A;  2QV6 A;  1VS3 A;  1NJX A;  1FKO B;  4RBT A;  4RLE A;  2VBW A;  2VPW B;  4NEY A;  1TVR B;  5GMK a;  5THW A;  4LRF A;  4RNM A;  4B3O A;  4TQS A;  4PYD A;  1PYT A;  2W7O A;  3H2L A;  3CPW R;  1QM9 A;  2R8J A;  5K8N A;  4O0N A;  4WWS A;  5ETM A;  4LFB J;  1RSC A;  1ZPW X;  4U96 A;  1YZ7 A;  4KTQ A;  4LRB A;  5HBM A;  2BOA A;  3KJV B;  1X4D A;  5F8H A;  3AOC A;  5E3A A;  3MMC B;  4ZP8 A;  1HNV A;  3SDE B;  2XB2 D;  4OX9 J;  1WOO A;  1QAY A;  4FF2 A;  4K50 A;  2YQ0 A;  3G8T A;  2V8G A;  1OIA A;  2KKH A;  3QO9 A;  2Y9H A;  2R7T A;  4R8U A;  1T95 A;  2YKN B;  1XNQ J;  3ZTO A;  1SUQ B;  1EZZ B;  1RQ0 A;  4X4S A;  2K7J A;  4NLW A;  2FGO A;  1M5P C;  1UVN A;  3KMS A;  2IYI A;  5L38 A;  2XS2 A;  4OI2 A;  5F9N A;  2NLW A;  3OXG A;  5T7L A;  4MKY A;  1GTH A;  1LFW A;  2LQ9 A;  3PX6 A;  4NA3 A;  2VIH A;  4CIO A;  1HWK A;  1CSJ A;  2KTQ A;  4ZHR B;  2DPJ A;  3L3C A;  1RT4 A;  2H5I B;  1KVK A;  3ELH A;  2YVS A;  4PRF A;  1FEH A;  1S10 A;  2EI5 A;  4F4X A;  2BKO A;  1SKS A;  3AY0 A;  4DF8 A;  1HIY A;  4LFB F;  2E1P A;  4XAK A;  1HPZ A;  1VMB A;  2FVS A;  2HFV A;  3N6N A;  4O4G A;  2ZM6 J;  3ILJ A;  1RT1 B;  3W64 A;  3K5L A;  4BHQ A;  2D9P A;  1FKO A;  1TKZ B;  1TVR A;  4UY8 T;  1NK8 A;  1O51 A;  3AD7 C;  2HHQ A;  4AE5 A; 
#chains in the Genus database with same CATH homology
 5IOL A;  3NGR A;  1EHW A;  3BH7 B;  3Q86 A;  4DUT A;  3VGT A;  3ZTO A;  3Q8Y A;  3PRV A;  1LWX A;  4DZ6 A;  3Q83 A;  4F4A A;  1WKK A;  5CAA A;  3EIC A;  5BXI A;  1PKU A;  3G2X A;  3ZTQ A;  2VU5 A;  1HLW A;  5C7P A;  3NGS A;  3DKD A;  1U8W A;  4W98 A;  1NHK L;  3MPD A;  1S57 A;  3NGU A;  3ZTS A;  4EK2 A;  3B6B A;  1VYA A;  1KDN A;  1XQI A;  1NDP A;  4ANE A;  3EMT A;  4UOH A;  1MN9 A;  4ENO A;  1ZS6 A;  1BHN A;  2B8Q A;  4UOF A;  3VGV A;  3VGS A;  2AZ1 A;  2AZ3 A;  3BBC A;  3EM1 A;  2HVE A;  1NUE A;  1MN7 A;  3Q89 A;  3FBE A;  4FKX A;  2HVD A;  1F3F A;  4CP5 A;  3VVU A;  3FCW A;  3ETM A;  1WKJ A;  3JS9 A;  4AND A;  3L7U A;  1NSK L;  3BBB A;  1BUX A;  3ELH A;  5CAB A;  1NCL A;  3ZTP A;  3EVM A;  4F36 A;  1XIQ A;  2HUR A;  2BEF A;  3GPA A;  3FBF A;  3VVT A;  3FCV A;  3BBF A;  1PAE X;  1NSP A;  3EE3 A;  2B8P A;  1WKL A;  2BX6 A;  4FKY A;  1JXV A;  3BH6 B;  1NB2 A;  4KPC A;  1NDK A;  3EVO A;  4O0N A;  3R9L A;  4DI6 A;  2DXE A;  2ZUA A;  1HIY A;  3FBB A;  1B99 A;  1NLK L;  1UCN A;  3GP9 A;  3EVW A;  3FKB A;  1NPK A;  4ANC A;  2NCK L;  3WX8 A;  4C6A A;  1BE4 A;  1S5Z A;  1S59 A;  1HHQ A;  3FC9 A;  1F6T A;  3PJ9 A;  3NGT A;  3Q8V A;  1NSQ A;  4S0M A;  1W7W A;  2DXF A;  2DY9 A;  3Q8U A;  1LEO A;  4HR2 A;  2DXD A;  2DYA A;  3EJM A;  3ENA A;  3ZTR A;  4WBF A;  2CWK A;  4UOG A;  1NDC A;  3VGU A;  1NDL A;  1B4S A;  1K44 A;  3FBC A;  3B54 A;  3DDI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...