1NSQA

Mechanism of phosphate transfer by nucleoside diphosphate kinase: x-ray structures of a phospho-histidine intermediate of the enzymes from drosophila and dictyostelium
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
152
structure length
151
Chain Sequence
AANKERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGLVNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPADSLPGTIRGDFCIQVGRNIIGSDAVESAEKEIALWFNEKELVTWTPAAKDWIYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of phosphate transfer by nucleoside diphosphate kinase: X-ray structures of the phosphohistidine intermediate of the enzymes from Drosophila and Dictyostelium.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Phosphotransferase
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
total genus 46
structure length 151
sequence length 152
chains with identical sequence B, C
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1995-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1nsqA00
3ENAA 3EVMA 3BH6B 3EICA 1BHNA 1B4SA 1WKJA 1NSKL 1XIQA 3ZTQA 3VVTA 3BBBA 3ZTRA 5IOLA 2AZ1A 3NGUA 3BBCA 1BE4A 4HR2A 1S57A 2AZ3A 1NDCA 3EVOA 3VGUA 3R9LA 1NDKA 3Q8VA 1W7WA 3FBEA 4F36A 1NHKL 3EE3A 4ANDA 1HHQA 3Q83A 1F6TA 1NSQA 3ELHA 3L7UA 4FKXA 3EM1A 3JS9A 4DUTA 3BBFA 3PRVA 1PAEX 1MN7A 1ZS6A 1U8WA 3EJMA 1XQIA 1NCLA 2DXFA 4W98A 4S0MA 4O0NA 5C7PA 3B6BA 1F3FA 1NUEA 1UCNA 2HVEA 4KPCA 1S5ZA 3FBFA 1NSPA 1HLWA 4UOGA 3ZTSA 4C6AA 2NCKL 2CWKA 3NGSA 3EVWA 1LWXA 1VYAA 3FC9A 5BXIA 1NLKL 1B99A 2VU5A 1JXVA 1NB2A 4DZ6A 4ENOA 3BH7B 1KDNA 2B8QA 1EHWA 1NPKA 2DXDA 2BX6A 1WKLA 3VGSA 3B54A 3VGVA 3VGTA 2HVDA 1S59A 3FBBA 3FCVA 4ANEA 3DKDA 3ZTPA 2BEFA 5CABA 4FKYA 1NDPA 4DI6A 3FCWA 2ZUAA 1NDLA 3WX8A 2DYAA 4WBFA 1K44A 4CP5A 3ETMA 1BUXA 3NGRA 3VVUA 3ZTOA 3Q86A 3GPAA 3NGTA 4F4AA 3GP9A 3MPDA 3FBCA 1MN9A 2DXEA 1WKKA 1HIYA 2DY9A 2HURA 3EMTA 4EK2A 3DDIA 4ANCA 4UOHA 2B8PA 3FKBA 3Q8YA 1LEOA 5CAAA 3G2XA 3Q8UA 3PJ9A 4UOFA 3Q89A 1PKUA
chains in the Genus database with same CATH superfamily
2ROPA 1B7YB 1EETA 4O3PA 1BHNA 1LWEA 2BXJA 4LFBF 2DNOA 3KUHA 1RT3B 4WTYA 3ZTQA 4OMFG 2YKQA 3A1YG 3HHKA 2VFRA 2F8HA 2I2YA 2XWXA 2UV8G 3I55S 1B7FA 3TUZC 2EG2A 2DHHA 2LQ8A 3DOMA 2L41A 3T3FA 4I1TA 3F41A 1H98A 2RILA 1RHJB 2RDIA 3TP2A 4X65J 2HQDA 3OLBA 3VAFA 4YMEA 1WEZA 5LXRA 1S57A 3WDOA 4A8OA 2AJ1A 3VGUA 2BRLA 3Q0AA 2VODA 5FIIA 3IRWP 3FMBA 1NJIT 2B43A 1N48A 2E5LJ 3H5UA 1OY6A 4WE1B 3GV7B 3H5SA 4CH7A 3CJKA 5KFCA 1KC8T 1H3DA 1S79A 3NEKA 2W7OA 3TVYA 2CPXA 2RRNA 3N9UC 4OZ0A 2B9WA 2J7WA 2XMTA 2EKYA 5IFMA 5D3GA 2PD1A 4Y2AA 4U9RA 2RDDA 2MLZA 3BO4A 3PRVA 4OYIA 2RQ4A 1PC4A 4ECVA 5HVHA 3RBZA 4CLZA 5DM6Q 1IBLF 1R0AB 2G2ZA 2HZAA 1TFYA 2AEFA 2BANA 3PZPA 1N34F 3M6WA 4S0MA 3TZZA 1AFJA 3DGPB 3UQSA 2XZTB 2DH7A 3AOAA 2ZEJA 1Q16B 2RIJA 4G1IA 1QD1A 2MZ1A 3W61A 4ICLB 2MQPA 4IRKA 2JWNA 1Y7PA 4MT1A 4U8VA 1JQGA 1UZHA 2RS8A 1ZOTA 3ZTSA 3SQOP 2B9EA 2BMBA 3MR7A 3K5OA 2H65B 1RTDA 4DR7J 3PIPQ 1X0PA 2DVIA 1R6VA 1VYAA 2UUTA 4Y2IA 5DETA 3VWSA 1S99A 3I0RA 3MTKA 4N8OA 3KXDA 2B6AA 2CJXB 3DLGA 2KM8C 2HNYB 2XEXA 1BXNA 4RW8B 2DCUB 6AT1B 1PG5B 2QC3A 4CNZA 3A3NB 5L8RC 1X60A 1TTHB 2KRBA 4F2SA 3C6TA 4I69A 5L9XA 3V4MA 4XDDA 5F8NA 4LFAJ 4NLWA 5HAOA 3R6LB 1IR2A 3J81Y 4OYPA 3PM9A 1GXLA 2RT3A 2R7TA 1ZTTA 1NDPA 1VQOS 4ECRA 3THPA 3MPYA 1A0OB 4PR6A 1E6YB 2CJAA 1NDLA 1VMBA 1HKAA 2B51A 3EDRB 4LQ9A 4DX8H 5D6GA 1RSCA 4M5DA 3TNVA 2ADBA 3MM7B 2LVWA 3NGRA 5E33A 4KC5A 3SCIE 4DN0A 4DPWA 2W25A 3CMQA 3V6HA 3Q86A 1QAJA 4ED6A 2XLIA 5BR8J 2BBEA 5IT9U 2ACMA 1JLAB 1TU0B 2J9EA 1H7WA 1VGYA 2NUUG 4KHPF 2VFUA 2ZBQA 4TQRA 5HROB 3SFUA 3MMAB 3AD7C 1JLCB 2YKAA 4USVA 5EGYA 2DY9A 4P74A 4DR1F 3GCXP 4RZRA 2IA6A 4ED4A 2PN6A 1OQ3A 3M2UB 3QLHA 4CLWA 4O23A 3SZ2A 1XNRF 1AT1B 4ZCLA 2NXUA 1S48A 1AUSL 3OVAA 4M5MA 2CAJA 1LWFA 4ZHRA 4USTA 3R8YA 1SJRA 4NA3A 5K20B 2JDJA 2XQCA 1X4DA 3KKFA 1RYSA 2V4JB 1HBMB 4ID8A 1M5KC 1NZ8A 2JHEA 1OYEA 2M88A 3NS6A 5HP1A 1KFSA 3HHLB 5HQMA 1S1TB 2HHSA 1RISA 3QGGA 3M7VA 4TKTA 2CPZA 2VBZA 3IA0A 2VA3A 2BJEA 1LW2B 1N52B 2WSEC 4CLKA 4U67Q 1FXLA 2IFXA 4WU2A 1I3OB 2RHSB 1R0AA 3S1TA 4LF7J 3CJ8A 3CCES 1JXEA 4HR2A 3LH2S 4DS4A 2R7QA 4MYTA 1GMVA 2HBZB 2GX8A 3HSDA 4URSA 1Q5VA 3ZC4A 4CLSA 2OFGX 3Q8VA 3PCOB 3CD6S 2OHDA 1NU4A 4KPYA 4YOEA 5KFPA 3QT7A 4DLGA 4UT4A 1HHQA 3DRPA 5B0DA 3QPIA 1S1WA 4CM2A 1T9XA 5L1IA 3GFZA 1KHVA 1M5SA 4I64A 1RT6A 2AMCB 3IWLA 4RX6A 3V6DA 3LP2B 3D6MB 3RB6A 3LWMA 3L7UA 2V2QA 1U24A 2WBMA 4NE9C 5LSOA 3I56S 3EM1A 1RYRA 5H9FK 3CWJA 1FJGJ 3O44A 4NZ6A 3JQJA 4KO0B 3SCLE 1RWNB 2RSQA 3AOCA 3D7SB 3RW7A 5RUBA 3OR1A 4YHHF 2XO7A 1OY9A 2FLPA 1Y11A 2ZKTA 4ECZA 1HNVB 4ZK7M 3AD9C 4W98A 2NXJA 3GFXA 1J2VA 1UFLA 3DRYA 2QA1A 3C66A 5C7PA 1Z1ZA 2Z57B 3RJMB 3T6JA 3PX6A 4J9PA 3TOQA 1N88A 4ELUA 3VZHA 2YX7A 2C2RA 4GRSA 3W64A 2QLJB 3UCZP 1S9FA 3IWNC 3CC7S 2DH8A 1IM4A 2OPRB 4RU9A 1YX2A 2UUBF 1CJUB 4KTQA 2CWKA 2KHCA 3HZGA 3JAMY 5IT0A 5DZ7A 1VQKS 4GC7A 1VBKA 2VQFJ 1HARA 3NBPB 3D66A 1S1XB 3HCXA 2OPQB 2DHGA 2Z2YB 4DPYA 1XNRJ 3TZWA 2NSCA 1S6UA 5KG2A 4K5RA 1J5EF 4CM0A 2WK4A 1RA7A 1WI6A 3I5CA 4KAIA 3KLHA 1SKUB 4DV4F 4DL6A 2CJKA 2GO9A 4PQUB 3UO0A 1HQEA 3T1YJ 2HVDA 1FJ7A 5D4LA 1FNXH 3K59A 3A8IA 2VKZG 1HNIB 4M5LA 3O8WA 2XS5A 1LKZA 5T14A 1M0SA 2GGPB 2XSFA 3C14B 3MCMA 4B08A 2XS2A 4DV7J 2HBYB 2VONA 1PILA 1R3NA 4Y2CA 4G1QA 4ID5A 3WC0A 1KNZA 2H5EA 4WBFA 3WX8A 1VS3A 2MJNA 3V6JA 5HK4A 4LF9J 1RT4A 4GKJF 1IM6A 3PFOA 3CDUA 4OFZA 1ZPVA 2A2DA 2DEJA 1FO1A 3IWXA 1A6LA 1S6QB 5KT5A 2NXNA 4KGXB 3E01B 2R2TA 2JLFA 2I9SA 1LW0A 3I5BA 4WFNQ 2UUCJ 1N32F 3BPDA 1WWHA 2CG8A 3DN9A 3W9IA 3FEYB 1H7XA 2M7SA 1SI9A 2VG6A 2O66A 2LYVA 5HMZA 3H59A 2H9ZA 1F5AA 3CIZA 3JTOA 4DU7A 3JB9k 1RAEB 2BV3A 2XYHB 4LQ3A 2U1AA 3R2CJ 1VJQA 2BOPA 4HTJA 2E5JA 1WNEA 2HG4A 1X0FA 1T03B 4L3KA 3R97A 4MFBB 4C0BA 1SBRA 1OY8A 1S10A 3M6VA 4RNOA 1CC8A 3I96A 1S76D 1L3UA 2CQ1A 3M30B 4YB5A 1P27B 3KNGA 4YEAA 3SV3A 1KVJA 1WEXA 4RUHA 2DY1A 4EYIB 1TKXB 7FDRA 1NJWA 1Q82T 4F4KA 2PDAA 4RWWA 1VQ9S 5H9EK 4OI6A 1T9UA 2B5JA 3MPUB 3DOLA 4ZLJA 1SL1A 4U95A 4ZCIA 3WIVA 3N01A 1N5YA 3BBCA 2FVCA 2DT9A 2QMWA 3QGIA 1KVIA 5HANA 2OPPB 1RE1B 1T9YA 2CVIA 1D9DA 2M4MA 1DURA 2ROEA 3HI9A 3Q2SC 5JUMA 1VQ4S 4LF8J 1HMVB 2K2PA 5C2GA 3ZO7A 3GIIA 3N5FA 3CCUS 1IQZA 2VFVA 5F8HA 3B78A 5IC6B 2H4YB 3LP0B 3P4UB 3C16B 1JB0C 4PZVA 4QR2A 3CCMS 2EW9A 3R7SB 4WZMA 2ASLA 3HLUA 2CWXA 3M05A 1S97A 3AJ1A 4IUFA 2QIFA 2LDYA 2BZ2A 5E3QA 3V5RA 1CJTA 1JLBA 4GO5X 3MEGB 5AXMA 2YXLA 1KS2A 2UXDF 3KK2B 4FBTA 1S0MA 3M8QB 4K5SA 4FVMA 2CDRB 3M6UA 4CO5A 2V5HG 2WVFA 3TR5A 1XC9A 1RWUA 1GTHA 1UCNA 2RRBA 5A0YB 1C1BB 2DGSA 1K73T 1FT8A 2CJQA 2EPIA 2V8GA 4JI7F 4K8RA 5IWAF 2ZJQQ 4RBVA 4ILLA 4LBHA 5I3UA 2W9AA 4OHWA 2FD2A 4PAAA 1LK5A 5CCMA 2R8JA 4DL3A 3RBXA 5F8MA 1ACMB 2P6TA 4X66F 2LU2A 1RGVA 3KJVB 4H4MB 1R8HA 4WP8A 3BSNA 1HBNA 3HD2A 1FNMA 3DXSX 1S12A 2FZKB 3N79A 1HNVA 4Y6IA 1NK8A 2DXDA 1NO8A 3G6YA 3TQ1A 2V63A 2QSFA 5HO4A 3PW0A 1SXLA 4OX7A 3OHAA 4X4RA 4ZCMA 2XCPA 1SC3B 1RHRB 1YZ7A 4LF1A 4Y34A 1T94A 2XM3A 4FPIA 1YWXA 1Y5LB 3VQSA 1G3OA 4EFAC 1Q7YT 2F8MA 4XAKA 3T6BA 1X5PA 4QWCA 4RPFA 5HQLA 1A9NB 2UUCF 5A6WA 2KRRA 1U1RA 1TKDA 3UR0A 2MY8A 2DGXA 3AB2B 4UZBA 1HNZJ 3PACA 4OYOA 3TUPA 1OS5A 1N0VC 4C0OC 2W9BB 1S0VA 5J2MB 2HQ3A 3GP9A 4QWDA 2CQCA 2QYCA 4LF8F 2ATLA 3IAM9 3K0JA 4U8YA 1WKKA 3KFWX 4A47A 2GQQA 4E8UA 2ZH3A 5KFQA 4DR3F 1SV5B 1RUSA 2DJWA 4QIGA 1GFWB 3PO5A 2DNYA 2J9CA 2HYIB 2YTCA 2VOOA 4CT8A 3BGFA 2M3DA 4QJVA 2HVHA 4DV1J 2ZH6A 2ZOGA 2GV1A 3HFZB 3H4DA 2KFZA 1JJ2R 1FRIA 2G0CA 3HHLC 1RAAB 3KLFB 2YWWA 1RT4B 1RWVB 4NCGB 2OPSA 3IG1A 4UZCA 4TLQA 2W9CB 3R1LA 3PX0A 2NXEA 2HK3A 3FJ2A 2ZBRA 1T3NA 2IM3A 2CQPA 5IT4A 1H74A 2E9TA 4CLYA 2AQ4A 1V6HA 2V2KA 1YRXA 4NA2A 3CJKB 4F67A 2VD3A 4Z2XA 1R8CA 3M9MB 1CC7A 1OPZA 3Q23A 3CCWA 4R0JA 5FJ4A 2MLYA 4TN2A 3R3TA 4J5OA 4EU0A 4USUA 4DL0C 1MROA 5DJBA 1NK7A 1KSPA 4TXSA 2BE2B 5KFUA 1VK3A 2ASYA 2B7CB 2HHHJ 4NLYA 1F9FA 2FPHX 3OFEA 4RW7B 1NNDA 5D4OA 5GAGU 2DITA 3OUYB 4ED7A 1N4LA 1BMQB 1T9TA 3BQ0A 3T1YF 2GIRA 5HMYA 1TQLA 4DR6J 2YPZA 3T1HF 3DGPA 2R7OA 4JI4J 4OZ2A 3KOAA 3SQGB 3NCRA 3AAWB 3HZEA 4M5GA 2NSBA 3D54A 1TP7A 1TKXA 4F8RA 3GV8B 3NNHA 4EGLA 2EK1A 3OL9A 2HVIA 2OSQA 5HBMA 3H2LA 3PXGa 2HAFA 1U1OA 3DOLB 1RHMB 4FF2A 5KFDA 2NR0A 1KLNA 3QO9A 1FRXA 1CS4A 2E7VA 3DLGB 1N5YB 4H4KA 1ZAXA 4X4OA 5HI7A 4LVNP 1NMEB 2XZDB 4NEZA 3QYYA 4FPRA 2MQQA 3HJFA 1EB0A 2B4VA 5DO2A 3IR7B 3U1NA 8AT1B 5IT9Y 4QPTA 3C3LA 7FD1A 3GCWP 3C6UB 1F2HA 3FBFA 1HPZB 3HJVA 4YB6A 1NK9A 1RT3A 3J80Y 2YQ1A 5CH7B 3OJUA 1OO0B 4HT7A 2APOA 5A76A 4WCEQ 2RQMA 2DNMA 2NCKL 4B3SF 4USJC 1Q7LB 3I31A 2HHUA 1RT5A 3WHIA 1KD1T 3CJQA 2P9EA 3OTDA 2RU3A 2HQCA 1F0XA 3Q8PB 3MM7A 4O3RA 2VFSA 2DIUA 2W8KA 2QSWA 4DZ6A 3OW2R 1OQ6A 4HACB 2GQ2A 1FA0A 2KFYA 5KT2A 2C3UA 3KK2A 3JXOA 4I2PA 4LBIA 4DPUA 2E5LF 2BX6A 3ETOA 4RW4A 3PVXA 3TJ9A 4ZP8A 4BBYA 1V3ZA 2HHPA 1PBAA 2GHPA 3MR3A 3QWUA 3V4IB 1C1BA 1EKRA 3IRXA 4MK7A 4OI0A 4C9DA 2PT0A 3TX0A 2BEFA 3D2WA 3GONA 3LALA 2XB2D 3KLGA 2RVJA 3EUNA 4FNHA 3RBEA 3R5JB 1QAIA 4LSZB 5F0WA 3PEJA 3UVJA 1S0NA 2OEKA 4KGVB 1JLEB 3BO2A 2QZ8A 3BR9A 4WXWA 1Q8IA 3R5DA 2NUHA 4O3NA 3J81j 2K3KA 1LWFB 4ZHRB 4IH5A 3VVUA 4QW9A 2CVEA 1WG5A 2NXCA 2V94A 1NJYA 4E0DA 5KG0A 3BYPA 5DDPC 2ZZMA 3KLEB 5BJRA 3V81A 3VCDA 1R27B 4JI4F 3O5TB 5IQ6A 3QWPA 3ZNJ1 1H2UX 5HMWA 4E2FB 1KBRA 2ACYA 5I3QA 1SJQA 4BC9A 1QVFR 2G4BA 2BKPA 2LCWA 3KDOA 3CJSA 3AJDA 2E66A 2EC2A 2IMOA 4HL9A 3NCQA 1OIAA 1JNRB 2DHXA 5BYSA 2HZVA 4CCHA 4V19X 2BM1A 2YQ3A 3N4WA 2LKZA 4KHRA 3I9ZA 4KBIA 2QFJA 3L95X 4URGA 1ZAVA 3I0RB 2IAJB 4V1Ak 5HATA 4BLGA 1R31A 2B6AB 2D41A 4WF9Q 2DIVA 4J9KA 2IIHA 3UDEA 3I32A 2LU1A 3MHYA 5D0EA 5L46A 4JI7J 2MQOA 2AT1B 2XC9A 3PRDA 4EEYA 2E1RA 1JLFB 2KHDA 3FSYA 2Y9HA 3HKWA 3DRPB 1HHSA 3GIRA 1VQ7S 2DRDA 1DY3A 3M2VB 2Y0BB 1YJNS 3W7BA 2HHHF 2IMWP 1FK9B 1HW8A 1WTBA 2E29A 2EC0A 2RUGA 3P8BB 1UWAA 3OXLA 3R6GB 1NJXA 2Z58B 3GR1A 2A0FB 2R42A 4LRCA 4B3TJ 1F1BB 1YJUA 3RR8A 3LGMA 1E6YA 4WFAQ 1YJ9S 3L09A 2XMVA 4KO0A 3R5GA 4HLBA 3D1HA 4NMLA 3RW6A 3QT8A 4WFYA 3JTPA 1UL3A 1EP4B 2PE8A 2WSFC 4NPOA 2H48B 5KFEA 5L1LA 2UVVA 1KVKA 4NXMF 3A4TA 2V8PA 4NLVA 2XO6A 1KRPA 2W9CA 4PXEA 1KEKA 3M6XA 4N8NA 3PIOQ 4F36A 2YKMA 3VR1A 3Q8QB 2D9PA 2VPZB 3LAMA 2I5JB 3Q83A 3PNIA 1AW0A 2OPRA 1FERA 3HHDA 3UNGC 1U0HA 2PEBA 1NSQA 1NM2A 2RKIA 2FLNA 4K4ZA 2Z2MA 3NNCA 1FFWB 3VTIA 2CADA 2CQBA 3ZZYA 3V6KA 1X5TA 3DLHA 1JLQB 2IM2A 4NRTA 2HEKA 4L75A 1IR1A 2YNGB 3ZZZA 3NS5A 2QMXA 5JMNA 2Q6BA 1CULB 1HWJA 3T5KA 2AGQA 4MJKA 3D0GE 2DGWA 1N34J 4X4PA 1WG1A 1U6BA 4KHMA 3HFKA 5K5MA 2OEMA 4X4VA 4F3QA 2C1EB 4Q5VA 3PW5A 1Y4ZB 1LK7A 2VA2A 1NH8A 4FYWB 4KPCA 2C42A 3OR2B 1LWCA 4P2MA 2FLOA 2BE7D 3HHLA 4USIA 3M4XA 1S1TA 2J6TA 2V2ZA 5H9FJ 3M9OB 3GFHA 2GIQA 2FZCB 2CNOB 4AUKA 4K4UA 3MCSA 4DR7F 1T8EA 1VQSA 5KTQA 4LF7F 3CULA 1LWXA 2ZH2A 2R8GA 4C4WA 5LT5A 4L3NA 1M5VC 1QTMA 1B99A 4EZ6A 4ZITA 4QIVA 4X4UA 1ZBTA 1EJ7L 1GK8A 4BWJA 1WD6A 2KH9A 3J7Z5 2B8QA 3FK4A 2JZ5A 4ZMMA 1IKVB 3G82B 1WKLA 2RB7A 3ILOA 2GVZB 2R4FA 1XR7A 4JI0F 4JI2F 4M5KA 2R3VA 4OYBA 2JFKA 1VDHA 4LVOP 3SDEB 5DQIA 3JYTA 3ITHA 4FS1A 3C6UA 4WKRA 3BKTA 3EXYA 3UFCX 1HPZA 2V67A 3NG8A 2ZC4A 3CGIA 4RJVA 4FKYA 2MSTA 4R8UB 5GMKa 4Y00A 3V6DB 1J5EJ 3LP2A 1FWPA 5LSLA 1U26A 2KG1A 3M32A 2GHWA 3LTOA 1S72S 4FF3A 3IBCB 3R2DJ 2HQGA 2J8AA 3GG0A 4X62J 3IGVA 2HZCA 2NS1B 1IJEB 3IAS9 3UI3A 1VQPS 4QW8A 2ZUGA 2VBWA 4H54A 1Q8LA 3X1LB 3GYGA 2X1BA 2J8SA 4AL7A 4LREA 1G2EA 2HHVA 1RWOB 5JVGQ 4DV2J 2BYCA 2CQIA 2GNKA 4FS2A 4KHPJ 1Y0HA 5M2UA 3V4IA 4Q45A 3TZYA 4GKJJ 4GKKJ 1HI0P 1U2CA 4WYWA 2C3MA 2ZHBA 3CB4A 1YKWA 2DXEA 2MMYA 1JJHA 2X3DA 2J5AA 3EMTA 4NEYA 5CYJA 3KK3A 3VAIA 2LA4A 4OYMA 1EKSA 2EWHA 1N32J 4QIFA 5E0OA 1TL7B 1RK8A 2CUYA 5KFFA 1LEOA 1SVDA 4I0WA 3ENVA 1X31C 3W1YC 2OMOA 2JC0A 2MZTA 2XNRA 4FXVA 3Q8SB 1TAQA 4FF1A 2DISA 2E5IA 1MWZA 4P2XA 4OHVA 5E3CA 2LFVA 5KFBA 1GTEA 5KFKA 1UP1A 4DV4J 2ZH7A 4DS5A 3BGRA 1P6TA 3U1LA 1RT1A 1WC0A 3GYXB 4B3TF 1HQEB 3W5ZA 2JFDA 2EFOA 3HM9A 1BD6A 3G6ES 3D68A 1EZZB 2GMJA 1NHVA 1X4FA 2A3JA 3DI6A 4WFZA 2IYGA 4U96A 2C2EA 2MEWA 2HHQA 2FYXA 1X4BA 4QWBA 1Y5IB 2BJ9A 2GGPA 2VC1A 1PAUB 3C14A 3MMBA 3IBFB 5A8KB 3FCHA 1LXJA 2FC8A 5CZXA 4C8KA 1HR0F 4ID5B 1FTRA 2FUG9 1YLXA 2P6SA 1KQSR 4U7UD 3W62A 2C2ZB 2FQQB 2ZM6F 4KRWA 4C7QA 1GT8A 1UTAA 3VAJA 2CYYA 5B0CA 5IC4B 5KFLA 2MQMA 3G87A 1D1UA 2HHWA 2B56A 3QFHA 4IOBA 1N8RT 3FRZA 3HX9A 5D15A 1K1SA 2HGNA 2HS0A 4DR4J 5CYMB 5I3UB 2EFPA 3FEXB 2HWIA 3CIMA 2IRUA 3K7RA 5CYQA 1FK9A 4TY8B 2UXBJ 1FRJA 3OL7A 2GQCA 1PGZA 1TKTA 2MQ8A 2FVQA 2L3MA 2OMLA 2UVUA 1JLGB 2FVRA 4FP9A 1GH8A 2FIUA 4GC6A 3BEGB 1U02A 3OFHA 2Y1IA 2A6OA 1QLNA 4CTAA 4ZLPA 2F4VF 5D78A 4CLTA 3N5BA 3OSPA 1T03A 4AL5A 3DLJA 3M8PA 3DMJB 1YJ7A 3EGVA 3HXMA 1DTTA 4FYDA 3IN5A 2ZWPA 2YKMB 4G6VB 5C24A 2AHOB 3RRGA 4KJIA 1FDAA 1GMWA 1NXIA 3WC2A 1BLUA 1RU2A 4ZP9A 3LW5C 4GO7X 2IVYA 2E44A 3NAHA 1NAQA 2MHNA 2GA7A 4IO1A 2WW8A 1RJJA 3B82A 4NRUA 3R5BA 1SKWA 4IDKB 4NLDA 4LFCF 2N82B 1Q8BA 2M9KA 3X3UA 4RW6B 4NLUA 3D1OA 5M2PA 4N5SA 3MMCA 2YNGA 4B17A 2LQJA 3QIDA 4CQ1A 1CULA 2YNFB 3GG1A 3MWBA 4OX9F 1RAOA 2N4DA 2Q43A 1S4FA 3LGHA 2JH3A 2AW0A 3IXQA 1B0PA 4DV6F 5J2MA 1ZAWA 5KG4A 2ATCB 1QDUB 3MR2A 3B54A 2C2OB 2CRLA 3BR8A 1PIEA 3OR2A 2CQ3A 4OZ3A 3UR3C 4Z7CA 5JVHQ 2QG9B 4OX6A 3C16A 4ZVPB 2QO3A 3CNQP 3FSIA 5F8LA 1SV5A 2R9LA 1X4EA 1U49A 3NGKA 4ZVEA 5L1JA 3UD3P 2BQ3A 2M2BA 1NPRA 4A8SA 3QZ8A 2DYAA 2DGVA 1U25A 2UXDJ 1CJTB 1JLBB 4M5JA 4XPCA 3F73A 3BDPA 1KTVA 2VG5B 1VRTB 1VCTA 4PWUA 3W63A 1O0PA 4WKYA 2D3O1 4TYBA 3BZQA 3H0PA 2MXYA 3W2VB 2OD4A 3MEDB 2YY3A 5G0RA 2O3DA 2MQNA 3HPOA 4F7VA 1QAYA 2GVZA 1VHFA 2NPIA 5J1NA 4QPXA 4F26A 2DR5A 1HBOA 3LPEA 3GIMA 3N0VA 4TLRA 2B3TB 1ELOA 1U6FA 4LR8A 3SXLA 2JRSA 4Q8FA 4X4NA 2BE2A 2B4UA 2YKOA 4Y3CA 5B0GA 4QZVB 2UV8A 4X66J 1D8YA 1LFWA 2V0NA 3CD0A 1F5BA 4OYXA 4CI0B 3KJVA 2VQEJ 2DR6A 1HBNB 1FD2A 2Z8QA 4WU3A 1RABB 1S9GB 1UW9A 2CZVC 2ZE2A 2DCLA 5A8RA 1BWVA 2BJ3A 1YBAA 3GILA 3C46A 2RAQA 3FFIB 4QR0A 1YI2S 2QLBB 1VI7A 4R25A 1T05A 1WHVA 2AYEA 2Q6CA 3K89A 1RLDA 4NLTA 4WFBQ 4AL6A 1YRUA 2XMAA 5HBMB 4IFYA 2L9DA 3CE8A 2ZC3A 3M8WA 2DEIA 4YQWA 3QO9B 1TL7A 1BQMA 1IUJA 3OTCA 5JJBA 2VG7B 3O3LA 4ES1A 3G96A 4A8MP 2IM0A 3VGSA 2OP5A 2KJWA 1RAHB 1O6XA 2AZ3A 1NDCA 2OIHA 1UMJA 6FDRA 2BE9B 3HMJG 1RKIA 2BQRA 4ZVUB 2PEHA 2BKOA 1AZSB 3R5AA 4RNMA 1QUPA 4DV6J 1AB8A 2QL7B 4K4TA 4DQIA 4QR1A 1B70B 3RAQA 4XDCA 1ZETA 3LAKA 3P3DA 1BQNB 3T1HJ 5A8WA 3DI6B 4ZVSB 3CXCR 1S1UA 1Q1KA 3LA0A 3TWZA 2DO4A 4IFVA 3MAAA 1C0TB 4OV1A 3JS9A 2B9XA 2VBXA 3POTB 2FVPA 1S7IA 4LF4J 2XYPB 2OI2A 3EJMA 4FNIA 3OLAA 4HKQA 2K3IA 2ZBCA 2HMIB 2HLTA 1NK6A 3KG0A 4GKKF 3UDCA 5ITHA 2AYMA 2LLZA 2KYZA 2HVEA 5AT1B 4EBCA 1RZMA 2XHCA 3DOKA 3KG1A 2YWFA 3HO1A 3JQKA 4FYYB 1DARA 1P9QC 2FC9A 1U09A 2A10A 2PMZD 4DFPA 1K47A 1U2RA 4TY8A 4KR0B 3BSAA 3H25A 2VICA 2FB0A 1WF0A 3UD5A 5DDRC 3AA9A 4QYZJ 1MMDA 4OI1A 3FRYA 3I6PA 4DSKA 1R0CB 2GVDB 3I87A 4I6WA 4DQRA 2Z30B 1S77D 5U47A 4LSNA 2P8IA 2ZH9A 1WOSA 3TEGA 2VQFF 2EBGA 4KFBA 4NXNJ 3J7YU 1DTTB 1WC4A 3HP6A 4ZPTR 3BN7A 2XGQA 1NEEA 5CA5A 4ELVA 2HRYA 3ZTPA 3BS9A 1IBMF 4LF6F 5HQ8A 8ATCB 4ED1A 2UVRA 5M2RA 3PKMA 2KT2A 4JYAF 2DHSA 4DMZA 1WF1A 1PC5A 1FXDA 3RBDA 3PFEA 2Q79A 3HSGA 2QL9B 2FJAB 4MIBA 2AKWB 5F41A 3CCSS 4AXJA 4B9UA 4N77A 4RW6A 3MMCB 3MM6B 1KOHA 2C2KB 2KFNA 5F3TA 2YNFA 4U7CA 4IQXA 2HRUA 3BGOP 4KV8A 1JLFA 2VIHA 2KT3A 3KNAA 4KH1B 4J9NA 4Q43A 1DQ9A 5F3ZA 1U7LA 3FBCA 2UU9F 1C1CB 2MTLA 3H8YA 4JV0A 2Q3PA 3SCKE 4DR3J 3RU0A 1CJKA 4LSLB 1EQMA 1AROP 2PFDA 2ZDPA 5K14A 2MGZB 2F4VJ 1UZDA 1XTZA 3NLCA 2IDLA 2B4PA 3EWGA 4LR9A 3VALA 1RT5B 2ASJA 1VC6A 1YHQS 1DFDA 2DR7A 1OPIA 2LEBA 2Q1LA 4RU2A 3N28A 4ZJLA 2H4WB 3UNYA 5LMNJ 1RTIB 2DKOB 1W2BR 1VRTA 3H20A 1R8PA 1YVFA 5E5NA 1H2TZ 2R2UA 4I2PB 1PJ5A 4YN3B 2RS2A 2GIFA 2E7WA 1JJCB 1GXTA 3MEDA 3N6NA 2BOAA 4RW4B 1PYSB 3BSCA 5DRKA 3ZZOA 3TI0A 4JI3F 2VBYA 2J9DE 3IRXB 5E3RA 2V9WA 2FHKA 5HLFA 2GO8A 2K8GA 1O51A 2RKIB 3KUGA 4ATNA 4P9SA 3R1HA 1S1VB 2HAIA 4A48A 2P5VA 1RU1A 3GR0A 2AGOA 2YNIB 1UKUA 4HEA9 2J0WA 2CPEA 2GC8A 3GIKA 4K2XA 1E6VB 3DRRB 5KFOA 4DFJA 3K57A 1VBXA 4PXDA 1S9GA 2ZE2B 3DRXA 1Z4UA 4WIIA 1W7WA 3D5MA 5IQQA 2O1PA 5CHCB 3KLEA 4FVCA 1LWCB 1U45A 2JEFA 1FDNA 1G7CB 2K1RA 2VF3A 3HD1A 4I7FA 3HT3A 1UVNA 4YS2A 4DV7F 4JP8A 1RBOB 4PABA 2XLJA 4IR1A 1C2PA 1FVSA 1FX4A 1SL0A 4K0KJ 4DCOB 1HBUA 4LRFA 1IBMJ 4LF6J 4DU8A 2YX4A 3ILJA 2MZQA 4IKAA 4RNHA 3G8SA 4JYAJ 2N3LA 2OO4A 5G4DA 3GJRB 3FNNA 5KFVA 1N33J 1BQMB 2IAJA 1PAEX 1UEUA 1ZS6A 4Q2MA 3OXGA 4DV0J 2QGFB 4P7VA 1J5OB 1DQAA 2ZBIA 1FKAF 1S49A 2MYFA 2FHJD 3IFEA 3KLIA 1IKYA 4CO2A 2FJXA 1UJ5A 1WSVA 2LEAA 4F50A 4ZLNA 1NUEA 2WVBA 1EETB 4DN9A 1HWIA 1LWEB 1MU2A 3M2VA 5LOQA 5GADI 1R43A 1ZA1B 3MM9B 3QNWB 3RR7A 3KJFB 1AYEA 3I0SA 2KKHA 3RRHA 1BQNA 1LOUA 5DQHA 3H90A 2NYHA 4IYQA 3SMZA 5KT6A 4B3SJ 2C3YA 2XY7A 3L3CA 2AWZA 3PR5B 5BXIA 4UUWA 4J9RA 3PW2A 2OH2A 3W3SA 2QX0A 2V8HA 1SB6A 1MLAA 2WCXA 4Z37A 4ZCKA 2FZGB 2KYXA 3L7OA 2C2MB 3KJNB 2R2SA 3DXBA 3J7A1 3A3OB 4IH6A 3TX8A 4C98A 3HHNB 1FVQA 2J0XA 4RR5A 1HFEL 3VQTA 4J9UE 3MEEA 4J9LA 1YSJA 1RI7A 3IGNA 3D3BJ 3UCUP 2M8HA 4G65A 2HBRB 2KXHA 4WE1A 4C8YA 2YVSA 1EAYC 2XTJP 3FVYA 5KT7A 1MSWD 3TAPA 1R7IA 2P9GA 2BW7A 4LUBA 1ZPWX 2IPOB 3UDLA 4B3RJ 1CVJA 4LBPA 1JLQA 4Y65A 3CMES 5KG7A 2E7XA 1RTHA 2B7BB 2CDQA 3AB4B 4FXDA 1M5PC 1X4GA 2ZD1A 3QIPA 1T02A 4JV1A 1WHYA 4LSNB 2V8DA 4DZDA 4EBEA 2H3EB 3A3PB 2HS4A 3JSMA 5KFAA 4C11A 5EDWA 3QJPA 5AXKA 3VF0B 1PJ6A 2CQ4A 4B9SA 2F8EX 3Q8RB 2UZAA 4YB7A 4WPAA 4C2MA 1HQUB 3PRBA 3MMBB 2LA6A 2W24A 2PO4A 3DDIA 1RB0A 5J2NB 5L1KA 4K0KF 2IY5B 2CPIA 2I6WA 5F9LA 3FKBA 2ZJPQ 2J76E 2RQKA 2KL8A 4I6AA 2UUWA 5ETSA 3C8YA 1KR4A 2RDJA 1N33F 3OBIA 4C8ZA 2LMIA 2G13A 2Y3YA 3QJLA 2XHWA 4PPDA 4WJBA 3MM6A 1APSA 3HDSA 1Q8KA 2BVZA 3Q89A 1ICEB 2F40A 5DZ6A 4U7UK 5CYMA 3GSIA 4Y28C 3IBWA 1U6ZA 4CIOA 3MFHA 1QSSA 4LFBJ 5CYQB 1NSKL 2A18A 4OJ1A 1ZM2A 4ZPDA 4LRDA 3CJ0A 5J1PA 2CNLB 4DSEA 1AXQA 2HFNA 4LSLA 1MMNA 1RTJB 1FRHA 1JLGA 2MLXA 2YQ0A 3E51A 4ZOSA 5ETMA 3Q22A 2AZ1A 2QV6A 4OV6A 4XO0A 3M32B 1I6JA 2DNKA 2W01A 1X7VA 4EBDA 3D6FB 3CDAA 1TKZB 3QGPA 5E2QA 1UW4A 3EVOA 5HN0A 2ERRA 1YJWS 3EXCX 2F9JA 3AQOA 4AYBD 4DV2F 1SPBP 3L4BC 3FBEA 1HR0J 1UVLA 4PUOB 2CJYB 3K17A 1FDDA 1JLAA 3MM5A 5B0AA 3KG4A 1HQ2A 2ZM6J 2EI5A 4M8LA 1SL2A 3BDEA 3EE3A 3IR6B 1F9HA 2LP4A 4QBUA 5HROA 4IG3B 4RNNA 2B4OA 1L3VA 2XSJA 4DX7A 1RCOB 4DV0F 1N56A 4A46A 4LF5J 2PI4A 1S1VA 4FKXA 4FBUA 4DR4F 4KY3A 4KIAA 2IHR1 3JTNA 3OL8A 4CT9A 4P73A 2Y8WA 1WSRA 1YGYA 2GZOA 1JK9B 1XQIA 2KXFA 4JUZA 3PR4A 3KLVA 3RAXA 2AD9A 4ALZA 4QU6A 2JNJA 4CO3A 2BUNA 3DRSB 4AD6A 1VQYA 3S8SA 4RUCA 5LM7E 3BGRB 3TJAA 4F3MA 3AODA 1SKSA 2WSCC 4P7TA 1FKOA 2QN6B 3TA1A 1WOOA 2W2NP 5HP1B 1QE1B 4I7FB 5H9EJ 1AUDA 2BDPA 3FGVA 2G0IA 1HLWA 2QMUB 2ZVSA 4LJMA 4NLQA 4AE5A 1H72C 2J0QD 1BWEA 1DRZA 5GMEA 1VQ6S 1DTQA 1UJ6A 3LP1A 4PXBA 1UJ4A 4FYXB 2CJBA 4M63A 2MKYA 2X7IA 4PG6A 5KT4A 3I4PA 1TL1A 5HL7Q 5J2QA 2I38A 5ETVA 2VPXB 1F9EB 2VG5A 4L72B 3PDNA 2ROGA 1NB2A 4ENOA 2J6SA 1KTQA 2CQDA 3LQVA 5B09A 4MK9A 2BRKA 4NYPA 2XMWA 1HYSB 4ZVHA 2WHOA 3DFEA 3TZXA 3THTA 1MG7A 3OL6A 3KLFA 4YDXA 1U0SA 2E1CA 2N7YA 2QLWA 1Q79A 4DV5J 1VK8A 5FLXY 1S59A 3LPYA 4Q2LA 3HT0A 1YIJS 1KONA 1S4EA 2G9OA 1YJVA 4GVBB 4PYAA 3T19A 1DZ5A 5ETTA 4WP3A 3W8PA 5KFGA 5F9NA 1NK5A 1TL3B 1TKTB 1DHMA 4CLPA 5AE2A 5ETQA 1IWGA 4C3LA 4X62F 4CYUA 4DX6A 4K4YA 4DF8A 4OZ1A 5A8RB 2M52A 3RB3A 4B3MJ 4OHYA 5IM0B 1URNA 1G1XA 4K4VA 2AP6A 3TAMB 4K4WA 3SEOA 4DL4A 2D3ZA 3DMJA 5E7OB 1SIZA 5BR8F 1T05B 4A8YA 3MEEB 4KKOA 4F4YA 2R8KA 4OHXA 4QU7A 2CNKB 2EEYA 3T9ZA 4DPTA 4B9NA 2VPWB 4ECQA 1CEZA 2HS3A 2DRAA 1CJUA 1R6YA 3TQEA 4MKAA 1SC6A 3MMJA 3KJQB 2VDHA 1ZA2B 4UOHA 2FLLA 2VG7A 3FSXA 4IDKA 3W2WB 5E3PA 1X5OA 2MKSA 1RT7A 5AXNA 3I82A 2UVWA 3GB0A 3DDKA 4LF2A 1Q86T 4Z7YA 5CD4A 3PJ9A 2AJ0A 5D77A 2ZD1B 3GU0A 3QIPB 4KYZA 3CCLS 1AZSA 2G2YA 4DOZA 3JSRA 3GWCA 3PO4A 7AT1B 2KTQA 2RF2A 3EICA 3M2RB 3VAHA 4IR9A 4W90B 3DC2A 3P96A 3DLKA 2CPJA 3IP0A 1WKJA 2ZKUA 1M90T 2CIMA 3M8RA 1D9FA 2WRMA 4DUYJ 1XMBA 1PCAA 4HI2A 1FFGB 1HQUA 1HWKA 4I2QB 5T41A 1C0TA 4Q44A 3EGWB 2MKIA 4ECSA 1SQFA 1WEYA 4MKBA 1T0TV 3POTA 4XTTA 3SIPB 5KFZA 4K4XA 1ZM9A 2VV5A 2H1YA 2V2VA 4USKA 4OX8A 5THWA 5MLCV 4NXMJ 1P9YA 2VKRA 4O44A 3A13A 2AEMA 1SH3A 2VH7A 1S6QA 3PW7A 3W2VA 1WHWA 4CNYA 2XCAA 4HDGA 1TV6A 2OELA 4FYVB 3PHEA 4YR0A 1NHKL 4DCJB 2J0SD 1HI8A 2EKNA 2H54B 4OYAA 4TQSA 2DNGA 3OFGA 3W5YA 3KMQA 1UFKA 3SYZA 2L9WA 2HQIA 2W2OP 3ELHA 4NLGA 4ZS6A 3BYRA 3BGUA 4ZIWA 4YDDB 1U47A 4A8KA 5SZTA 1U1NA 3DU6A 5E3AA 1ZYQA 1TK5A 4O3SA 2R7SA 1DBDA 3NOCA 1FJGF 3CC2S 4WYLA 4YP3A 4CO4A 3ISND 2MKKA 4PEOA 3UWTA 2A1BA 4KFBB 2FJWA 3J7AN 2PA8D 3BQ1A 3FFIA 2YKNA 4LF4F 1LQ9A 3MM5B 4C8MA 2HW3A 1VBYA 2JVRA 3A8KA 4CO1A 1WI8A 1NSPA 2XYGB 1IJFB 2HIQA 3MMAA 1JLCA 4YFUA 2OTLS 2W2QP 3T5JA 1U8SA 3MF5A 3TA2A 3J81U 2QEXS 4ZJOA 2B5JB 1GMUA 2XMUA 1X4AA 2IC3A 3HULA 4DG1A 4CH1A 4LFCJ 1S6PB 3UN3A 2GW8A 3M2UA 1NLKL 2J6UA 1KKHA 5D0RA 5ETNA 2HNZB 2C22A 5J1EA 4BDPA 2OPPA 1IN0A 3BH7B 5HVFA 3R7NB 3QZ7A 5J2PA 1ZM3A 3E8OA 2IVFB 3CCTA 2V6AA 5EX0A 1VQMS 2V4JA 4PCQA 2O5DA 3AD8C 3ADAC 3K2YA 5KG5A 3H98A 1VFJA 1FKOB 1PYOB 4GVLA 1QE1A 2GFFA 2PC6A 2V4RA 4JI5F 2XLKA 1CJVB 4RW9B 4I67A 4L6V3 5A8WB 2IA0A 3QFWA 3UCGA 1BC6A 1CPZA 3MAAB 2ADCA 4B9VA 1DTQB 3H7HB 3BF4A 4XK8C 3LP1B 4J9SA 4F4WA 4V19J 1P1TA 3W9JA 2OUGA 2DO0A 5EWFA 3CO9A 1UPMB 1IWAA 2IRXA 5D4NA 4C48A 3ISNC 3CCQS 5KG1A 4H4OB 4K2JA 3ETMA 4KB7A 1O8BA 2E5HA 1XN9A 1V5IB 3GE9A 3L9ZA 3ZTOA 5A2QY 1NJZA 2PGCA 3FUYA 5DLGA 1FI4A 1WDDA 2QLFB 1T7PA 3NNAA 3NAIA 3KUEA 4NLPA 4N56A 1C4AA 2QE5A 2WAQD 4O3OA 5KOWA 5KOXA 2ALYB 3A8JA 1UVMA 2XY5A 5K8MA 2HMIA 2GMLA 3CSKA 3KWMA 1UWBA 3W66A 2YWGA 3C2PA 1RWKB 2WB4A 1SCJB 3QAEA 1RT6B 3J7ZT 1JIHA 3G71S 2KI2A 4L76A 2Y1RI 4WWSA 2JLEA 2ZJRQ 2B8PA 4USMA 5LL6d 4YR3A 5K8OA 1Z2ZA 2D9OA 3MEKA 4ZN1A 2JVOA 5CAAA 3CUNA 2AYBA 4HDHA 4HHHA 4M5IA 3OR1B 2F7VA 5GAEU 4HI1A 1YK9A 4ZA1A 5MAOA 1V3SA 3PW4A 2J7UA 2LXFA 4UOCA 2IYIA 1JXLA 3IC1A 3ENAA 9ATCB 1U1KA 2EFNA 1K0VA 3BH6B 2XS7A 1F2GA 4AT1B 2UUAF 3QBCA 4KKOB 4N47A 2B0GA 3B8HA 4YB1P 2V68A 3CTRA 1T9VA 3D6TB 4WZQA 3BKUA 3BBBA 3JQMA 1T95A 1AA1B 1FRMA 3CJ4A 2ZOFA 2AIRB 5IOLA 2VUGA 2E1PA 2DNZA 2XI2A 3OQ2A 3NGUA 4ILRA 3HVRA 2OPQA 1BE4A 1J5OA 3JAMU 1RT7B 4PQAA 3J7YI 4MKYA 4JI6J 3TARA 3MUVP 3TEHB 3WIUA 1KWMA 3RZAA 2QTWA 3TO8A 3M1VB 2W9BA 3KLHB 4I56A 2AJQA 2AJ2A 1BQXA 2J9DA 1RDRA 2ZH4A 1X9WA 1VC0A 4PQUA 4NZ0A 3LGNA 4MMOA 2HNDB 2GJIA 1MW7A 1XWLA 4NMXA 1C1CA 3CJ3A 5K8NA 3MFIA 4DSFA 2BQUA 2JSXA 2VPYB 5KFIA 1KN6A 2WOMB 1VQ8S 5B0FA 1ZTWA 1TUGB 4MTPA 4G1QB 3AY0A 3OXFA 1TK0A 1FE0A 3H2UB 3PEHA 4NL5A 4EWTA 2AJ4A 1G6BA 5IV3A 2DPIA 2YBVA 1RTZA 1IBCB 4JB8B 4NCGA 2CQGA 2OPSB 1REGX 3IG1B 4J9QA 2YWHA 3D4JA 2BABA 1H2VZ 3ZXWA 1MWYA 1TVRB 2BJ8A 1LW0B 1RAIB 4PG5A 5IWAJ 2MJUA 1SKRA 1URRA 4WP9A 5BYQA 5AJ3J 1D8ZA 4URQU 5I42A 2VG6B 1NZAA 3BB5A 1MROB 5EUHA 3QRRA 3R5CA 1YQHA 2KVQE 1C0UA 2FTRA 3AXKA 3B4MA 3BN4A 3R7BB 5LMUF 4Q0BB 2LDIA 4RW7A 3OUYA 2V4QA 1O5JA 3G4SS 1UVKA 2VU5A 1NKBA 4P71A 3UN5A 5HVGA 2MKHA 1EHWA 1NPKA 3ILIA 3JSMB 4AQYF 3NXZA 3MAHA 3ENQA 4ZDNA 1NKEA 2E9ZA 1GQEA 2K1RB 3E3XA 4DJBA 1KHWA 2DD8S 3M30A 4PWDB 1AFIA 2KXNB 4QWEA 4NA1A 1M1KT 2M5YA 4DR5F 3TAQA 3ZZUA 2POKA 3NY0A 5DM7Q 3L7PA 3SFGA 5B7WA 3D1QA 3FEZA 3CC4S 2CQ2A 3HVWA 1GX6A 4J37A 3ZZTA 2IC3B 4Y2KA 4USHA 4ZLLA 1K44A 1S6PA 3WX4A 1CS4B 1CSJA 2ZNZA 1HA1A 2H5IB 1QY7A 2QFIA 4OLOA 5F0UA 3AOBA 1HNZF 4X84A 1MNEA 5J1EB 1RLCL 3CCZA 2YH0A 4ED3A 4RO0A 1LV5A 5J2PB 4J9OA 3MCNA 2KO1A 2BKNA 2GMHA 2R7WA 1A7GE 2W8LA 1RHKB 4F4AA 1VRQC 4DL7A 2I8EA 2Z0GA 2Y1JA 4BC7A 3MPDA 1NB7A 1VQ5S 1MU2B 2UU9J 3GLJA 2EVZA 1V5VA 1TUVA 1IKXB 1MN9A 2BJ1A 3I0SB 5I3PA 2D3OR 5HJXA 5C5JA 1HIYA 4DEZA 2HURA 1X9MA 3MGJA 3OVBA 4EK2A 2G0JA 2V69A 2VFTA 1KP6A 3NGDA 5ETPA 3FMWA 3IR5B 1LFPA 3MD1A 3H4BA 4CLFA 2R7UA 2JC1A 1IBKF 1R0BG 5AE3A 3EGZA 3G2XA 1FWLA 3MPWA 1WG4A 1B64A 2D3UA 2X3GA 2BM0A 3M8QA 4H4OA 1PJ7A 4Y2MA 3K5NA 3S01A 4A8QA 2CPYA 4C3MA 3K5MA 1JWWA 2OLWA 4DHVA 3GTYX 1P1LA 4ECUA 4JI3J 2ZHAA 4FF4A 1N36J 4TNOA 2HFSA 1KOOA 4MIWA 2OFHX 1LXNA 1V9OA 3VVTA 2YWKA 4QWAA 5DLFA 1YTYA 3A12A 2DR9A 2W4DA 3F0NA 1IR0A 3KK1A 4CZCA 1QJHA 1H6KX 1MMLA 4OX9J 1JNZB 4NCBA 1JLEA 2G1DA 2Z2LA 3EZUA 2R7VA 2OAUA 3K8VA 4AFFA 5F8GA 3CCRS 4LMZA 2M70A 2WW4A 3DRSA 3CF5Q 3EGNA 1N5QA 4Y0FA 3WBZA 4DL2A 2MHEA 4F4XA 1SC4B 4B3OA 1FRLA 2RMLA 1N6QA 4C11B 3MI7X 4IG0B 1FXRA 1XK8A 3D0HE 1Q0NA 3T5LA 2D7SA 4CWBA 4RUAA 2QYGA 1JMTA 4ES2A 1XMQF 4ZN3A 3HHLD 1FHTA 2VDIA 5FLXU 1F6TA 4A4JA 1VR6A 2ZNYA 3OPKA 1FEHA 3B4DA 2FHJA 5KFYA 3PKYA 5J2QB 1OWXA 4PG4A 1IKWB 4QIWD 4EMDA 5C25A 2HGLA 3DLLQ 1NBEB 1MN7A 1Y3JA 1U8WA 2HFZA 2WB1D 1UVIA 4TU9A 5A2QU 2XI3A 2BW2A 2OGUA 1RT2B 5AJ3F 2P2CB 3MR6A 2ZH8A 4LF5F 2CPFA 2FJDB 4A8FA 3W65A 2DRBA 1FRKA 3C19A 2Z4PA 4D3HA 2EBEA 2Y0SD 5LMUJ 1RAGB 4USWA 1SQEA 1U48A 3G6VA 2HQFA 2HNDA 4AXIA 2F65A 3M8ZA 2HPUA 4KQZA 2L08A 3A8EA 2UXCJ 1RTJA 3BSOA 4C97A 4CYUB 1NKCA 4L74A 3TRGA 3ZZ0A 5IXUA 4GMKA 3LWLA 4DUZF 2JEIA 3EDQB 1JXVA 1F3VA 4KH0B 1EP4A 3DM2A 2CQ0A 3MTJA 1OSDA 1NRKA 3IM9A 2L48A 2JOQA 3FZ2A 5GAGI 3H5XA 1FEEA 3OSNA 4PUOA 2KZMA 2KB2A 3SCJE 1FKPA 4PG7A 1L5UA 2DPJA 1REVA 2I5JA 4DV3J 5K9FA 3AFGA 4IG3A 3ILLA 4WXOA 4TY9A 5CABA 1U0HB 4ERDA 4HH1A 1QVGR 5ADZA 1H38A 4Q8EA 3FZBA 4JV5J 4DV5F 4UW2A 1B0TA 2F4FA 3T9NA 3CT9A 2D1CA 3D28A 2NZ4A 1VLOA 4CO0A 2YNHA 3DYAA 1ULRA 5F8JA 1VLYA 4DCPB 2AJFE 2FHOB 2Y1LB 3CO0P 3AA8A 3UE2A 3LOUA 1U1PA 3SQGA 4NCAA 2RNEA 1D9AA 4QOTA 2RF2B 3M2RA 3DHXA 5KFXA 1S9EB 4PWDA 2GHVC 3FQLA 5AXLA 2AU0A 1NH7A 2DH9A 4OZLA 4IOCQ 4YUDA 1TL5A 2IJRA 1OJ4A 3JSBA 4F2RA 3CDWA 4WTOB 1Q78A 1XMQJ 4OJGA 3EYZA 1BGXT 5GADU 5GVQA 2RD5C 6FD1A 3EPGA 1TL1B 3PG9A 4OI4A 2BACA 3RB4A 2FJBB 4LIRA 3ULHA 3RGIA 3MR5A 2E1AA 3KHRA 4O44B 5KAKA 2HFOA 4HT5A 4ZKAA 3TANA 4QCLA 1P8GA 3CDBA 4U6PA 1HYSA 3OTBA 2F3JA 5B0EA 1TV6B 4F0HA 1R89A 1CBKA 2E9RX 3HSZA 2DNQA 1N5TA 1WC6A 3P49B 2C2DA 1OSCA 2DB1A 1VRUA 3ITHB 4PPZA 1SUQA 4K59A 3EPIA 1SJ3P 1XIQA 3AQPA 3NL0A 3MD3A 4GVBA 4ECYA 4K50A 1IKXA 4DSIA 4JI8J 2FGCA 1T11A 1Y9OA 1N5VA 2RE1A 5KFSA 4DQPA 2ILYA 1Q53A 2ZFHA 2X51A 4R0EA 1I94F 1TL3A 2DGTA 3KTQA 3NMAA 4WIQA 4ZVFA 1HI1A 2E1MC 2WVCA 2XMMA 4DFMA 4AQYJ 1HD1A 3ET6A 4NZ7A 4NXNF 2A6MA 2KU7A 2DGQA 2EFVA 4DUYF 5KFTA 4G1PA 5IM0A 4HACA 3BGLA 2ZH5A 2U2FA 3HVTA 4I68A 3TAMA 3R9LA 2KM8B 2HBQB 2LXUA 2WVEA 2V50A 3D67A 1HWLA 4ZP6A 2YKNB 3ZZRA 1VHIA 2OEJA 4BWMA 4ECWA 4B9MA 2HIYA 2BA9A 4LF9F 1ZZFA 4NLOA 3SV4A 2LEPA 4X4TA 3RG6A 1UEKA 3HVAA 2GJ2A 4DSLA 1PYTA 4QQBA 4L73A 3KLGB 2QA4S 4JI1J 3D6HB 1FJCA 3AH6A 4HHJA 3CD7A 3RTVA 4DG1B 5EN1A 3CJ2A 4UUXA 2VC0A 3UVJB 1TZ0A 1XERA 4C8NA 2EK6A 2IVMA 2XBPA 2P9CA 3F56A 3W2WA 4LR7A 4DQQA 1EIYB 2NYIA 1H0HB 3Q2TC 1FESA 4DQSA 3I5AA 1XNQF 5IV4A 2CXEA 4HH0A 5D4PA 2L9NA 3B6BA 3MDFA 4OI3A 2LXIA 1M1HA 1RWPB 4XPEA 3H5YA 3V81B 1RACB 1RT1B 3QATA 3HKZD 3VZIA 2PI5A 2NQPA 3NOGA 3CJTA 2KN4A 2BJ7A 3DLKB 2GJFA 3MAQA 4ECTA 1K9MT 4F0MA 1YJRA 3GYNA 1F60B 4I2QA 3C15A 3WZ0A 5A8KA 1UETA 1HHTP 4ES3A 2XY6A 5CZVA 2VL1A 2ILZA 1YBTA 1T9WA 4UQTA 1B0VA 1I51B 3MOJB 3O6QA 2W2MP 4MK8A 2C3OA 1RT2A 4LRAA 1QUVA 5DQGA 2CZ9A 4NOHA 1L3SA 1UFWA 1K1QA 3EZ5A 4F0KA 2WVDA 3MCOA 4YY3F 2XG8A 3MECA 4JI2J 2VOPA 2HGMA 5L38A 1UWBB 3QQCD 3ZFVA 3BPSP 1FCAA 4ANEA 4RNFA 2R7XA 2M0GB 2AX0A 2ZHOA 3MZIA 3CMAS 1UAWA 3CW2C 2MB0B 1JJ4A 3H42A 3FCWA 1D0EA 1HNWF 3IO1A 3PX4A 3QSYB 3W8GA 4J90A 1GNKA 1GAOA 3N6MA 4IH7A 1RWMB 1BY9A 4X65F 3EX7B 3DM2B 4J91A 1X9SA 4C8OA 3GPAA 3M9NB 4ILMA 2HVZA 4HHUA 2MZSA 2ZBPA 3IMQJ 3NGTA 1ITPA 2HHTA 1RWXB 5KFJA 1QM9A 5FDLA 3DCAA 5T7LA 5C24B 1FKPB 2V34A 4IRDA 1M5HA 1REVB 5DG9A 2ZWOA 2VJVA 1QAXA 4I4BA 4P75A 2Q66A 2F5GA 4CLUA 3EZOA 3G9CA 4F04B 3H2VE 1K8AT 4UY85 5SUHA 5D0GA 4RUBA 3IS9B 3KHLA 4F25A 4M5NA 2HNZA 2DNPA 2YNHB 3AJ2A 1DLOB 3AHPA 3DYAB 3NWGA 2WONA 4OJHA 4WFXA 3T1AA 2I1RA 1MWQA 2RRAA 4OLPA 4DPXA 5F8IA 3S6EA 4CH0S 1PKUA 2W2PP 5ETKA 1I94J 1FX2A 4MH8A 4JI5J 3ENWA 2UXCF 3LANA 3OV7A 1FFSB 4LT6A 4UTGA 2JEGA 4DBQA 1CJVA 3QT6A 2HSEB 1SC1B 2WOMA 4RW9A 5KFRA 3NMRA 2W7AA 3OTOJ 3CD5A 3ZTRA 1RTDB 1H73A 5C42B 3VHQA 2V9KA 2LQBA 4FZVA 2VB6A 4PYDA 5DGAA 4O4GA 2CG4A 2UP1A 3DLEA 3TVKA 1VOMA 2A2CA 3VAGA 2BJDA 2HNYA 1R8AA 2XWYA 5GMDA 1GX5A 3T41A 4PG8A 3G8TA 4A8WA 2EFQA 4JI1F 1U1MA 1VBZA 2N4CA 1IKVA 2NZCA 3G82A 3PJWA 4ZPVR 5G0RB 4PKDB 4C3KA 1CQNA 4CLLA 3GZ7A 4JV2A 3SDEA 3JYTB 3G8QA 1HBOB 1FF2A 1GMWD 2YWEA 4OZNA 1PSDA 4TYAA 1SUQB 1SIWB 5I42B 4R8UA 3P6YC 1ROFA 2OJ3A 2AV5A 3MUTP 3TW0A 1C0UB 2F63A 3CCVS 1VC5A 4Q0BA 4ZVTB 4DR2F 3DOMB 4K4SA 3BBFA 2C28A 4CRJA 2XGPA 3RYLA 1ZM4A 2RH3A 5HJYA 4YHHJ 2R8HA 1QSLA 1WTFA 2G1HA 2KDOA 3QMQA 3RRKA 4OIXA 1W25A 1NCLA 4EI2A 2GAGC 2N7CA 3SI8A 3K5LA 2W4CA 3TUJC 2N3OA 3GSDA 3HVTB 8RUCA 2FVSA 1F3FA 4DV1F 1ZZNA 1YZ6A 3QGHA 3MXHP 1S0OA 4FN5A 3U1MA 5BYRA 4PXCA 3W60A 4DL5A 9RUBA 3LF0A 5EX3A 3KK3B 4G3IA 3P5TL 5ETOA 1XR6A 3GJQB 4IFYB 4NYZA 2CFXA 4C6AA 3QRQA 2HHXA 3GQCA 2JJ4D 2CA9A 1XMOJ 5D3GB 3QLHB 1VQNS 3US5A 3MOZA 2BR0A 2WZ1A 3PY8A 2X1AA 1WDTA 1KDNA 5ETLA 2KZZA 2ZDOA 2BANB 4OYZA 5HMXA 2JX2A 3NCPA 3M1VA 3Q24A 4WK3A 5CQGA 1B3TA 2I0XA 4ZPWR 3VGVA 1HNXF 2IDEA 2QT7A 1KFDA 1WHXA 2XNQA 3FBBA 3KDNA 4IQMA 3QRPA 4QYZK 1D3WA 1YBUA 4ICLA 5B08A 3PJXA 4BHQA 4W4MA 1LW2A 1S1UB 5B0BA 3HF5A 4HTIA 4IFVB 4NWBA 4DI6A 1ZH5A 3QAUA 4O3QA 2MZJA 1X5SA 3GJTB 1V3RA 1WORA 4KGMA 5LSRA 1RAFB 4CP5A 2K7JA 3GIJA 4DR5J 5D0HA 4M5HA 4B9LA 1BUXA 3SSSA 2H51B 3M8SA 1Z2LA 2HFVA 1U1QA 4RW8A 3THVA 2QL5B 4A8XA 4DR1J 1TR0A 1TVRA 4QIEA 5IS2A 3DOKB 1WUUA 3C6TB 3PYFA 2R7RA 2AX1A 2QLXA 2LQ9A 1WOPA 1GEHA 1HD0A 2HKEA 1RBAA 1KQGB 1EARA 4RLEA 4ZP7A 3KK1B 1XBWA 4R5PB 3H40A 1RCXB 4ZPCA 2VASA 2QJ3A 4ECXA 1RXOB 1L3KA 2VQEF 4NLRA 5ETRA 2AYGA 3F44A 3HK2A 2GVDA 2PSZA 3AXMA 1RAJA 5LJ5Y 4CTAB 2X1FA 3TVZA 4M5DB 3FDSA 2AEJA 3S7RA 4YR2A 1EX8A 4PWWA 3G6XA 3M8PB 2HWTA 1L3TA 3HHEA 2FY1A 4B3OB 4CDIA 5LJ3Y 1WJ9A 2FDNA 5CD4H 1N6QB 1Y3KA 4FXWA 3DNCA 1WF2A 3EVMA 2LECA 1B4SA 5EWEA 5T7LB 2PMHA 4X64F 1T3OA 5KG3A 4M95A 2FJEB 2IM1A 3DU5A 3NRBA 2B9YA 3J80U 4ED0A 1WC1A 3DGVA 4NLSA 3VAKA 2IJNA 5KFNA 1VIXA 3BQ2A 1UEVA 3GJSB 1N36F 1SJ4P 5C25B 2HLUA 3CJRA 1FE4A 1X4CA 3NBPA 2W4PA 3K8WA 2F1FA 3FQKA 1S1XA 5FD1A 3RUBL 2KG0A 1XMOF 4W92B 1PBUA 2F9DA 2ZOMA 1S7HA 1YDLA 3IS9A 4YY3J 3UPFA 4EZ9A 3CEDA 1NDKA 2NLWA 1HL6A 3HFVA 2KVIA 4WK1A 1OMSA 4KV8B 5H1SV 3TJ8A 2ZZTA 1RA6A 1I1GA 1RQ0A 1DAXA 1HBMA 2IRYA 2O67A 2XZWA 4DR2J 2COLA 2MKCA 2JL9A 4ANDA 4ETXA 4ZJQA 1JX4A 3GV5B 4C8LA 3E2EA 2GCFA 4OJ3A 5I4MA 1TUWA 2MPUA 1HNIA 3MPVA 5LXYA 4PRFA 4B3MF 4ER8A 5K14B 5K8PA 5EWGA 2MGZA 4MYUA 1WELA 2DGUA 2C2NA 2G2OA 3N6LA 3OTEA 3PYEA 2ZH1A 4QYRA 1TAUA 1CLFA 1UVJA 1YG0A 2XMJA 3VV2B 4TU8A 1TMMA 2OKQA 3BREA 4IRCA 1NHUA 5D8HB 2MQLA 2DHAA 5KG6A 5DGBA 1RTIA 1JKHA 2ABYA 1VQLS 2DXFA 3T5HA 2DTJA 4DFKA 1FTCA 2DNNA 2YX1A 1UPPA 4ZVRB 4RBUA 3I4HX 1DQ8A 3E01A 3PV8A 2EFGA 3KHHA 3GMGA 4ZVOB 3MM8B 5GAEI 4P10A 1Q81T 3CDEA 3R27A 3NWRA 1XEZA 4I6YA 2PIIA 1S1WB 1FD8A 3K5PA 4ETZA 5C2CA 3OFFA 2KT5A 3ICLA 2XMKA 1SH0A 2D74B 3NGSA 2X1GA 1FDBA 2Z2ZA 4OHZA 2DNLA 2RQCA 3ONQA 4M1KA 3FC9A 3RAMA 2FY8A 4HVZA 2NREA 1CQMA 1HNXJ 4B9TA 2CJ9A 1E6VA 3DRRA 1K0TA 1YRTA 4F3OA 2ASDA 2MSSA 4ZVGA 1DJ0A 3TUIC 4RBTA 1IQTA 4DF4A 1X8DA 2ALZA 2RUSA 1QSYA 5KFHA 2O01C 5DDOC 3OVSA 1Q4RA 3QT5A 4IG0A 4LRBA 4NI2A 4RWXA 1QTNB 3VGTA 5E41A 3OTOF 2JEJA 2Y8YA 1RADB 2FGOA 3UD4P 3FCVA 1D09B 3DKDA 3OD2A 3KMSA 1C4CA 1RBLA 1RHUB 2DNRA 1M1GA 5AE1A 2IBOA 3D0IE 1HBUB 2HK2A 3HSJA 3SSQA 5EHHA 2VJUA 2YKPA 1SJFA 2AF6A 5CXTA 2K06A 2MKJA 2ZUAA 3LO3A 2RHQB 1HW9A 4MIAA 2MDAA 3OT9A 3QSIA 1IKWA 4ZPBA 3MUMP 1G4CA 1UA0A 4P2SA 1KLMA 3M8YA 4JBCA 3U7JA 4MAKA 2K7KA 2IBKA 2CKWA 3KLIB 3PTWA 4X4QA 4NYOA 5DS7A 2FJVA 2CNNB 3AT1B 1VRUB 1TK8A 4DXLA 4KGZB 4DSJA 4DWIA 1U2FA 2JLGA 3MM9A 4ED8A 4UQGA 1VISA 3RB0A 2NPFA 3BV8A 5IZHA 4OQJA 4TU7A 4BCAA 4ANCA 3U02A 1KQKA 5DG8A 2D69A 3VAMA 1IBKJ 3ET6B 1XNQJ 2Z56B 3O2IA 3PYGA 2AGPA 4ELTA 2R2RA 3SBMA 3MEGA 3D9BA 3P5BP 4FDFA 3I9V9 2J7KA 2ZITA 5LMNF 3UN2A 4EO8A 1VJWA 4IOAQ 4OL8A 4N7TA 3OJSA 2DK2A 4O4RA 5A0YA 3KYLA 4DV3F 3DDNA 2VZ9A 4JV5F 4X4SA 1LNQA 4KT0C 4JI0J 2RJZA 4N41A 3UW1A 4R5PA 2CPHA 2CZ4A 4JOUA 4K7QA 3BKFA 5HSPA 1WC3A 4LFAF 2PFFB 1RWWB 1PO6A 4DDFA 4ITSA 1NK4A 1TFWA 2OTJS 1N54B 1RTHB 4JI8F 1U1LA 4DLEA 4J9VA 1SJ1A 4DR6F 4F4ZA 1YITS 5GAHI 4MFBA 1N5SA 2EXUA 2R8IA 3P45B 4EO6A 4C0HA 4NASA 2W7PA 4OZ5A 1S9EA 2OSRA 2WBRA 3ISZA 1HWUA 1OYDA 5KFWA 1N0UA 4NX9A 2RU9A 1TMJA 1EQ0A 2CPDA 1KQFB 3IM8A 2DGOA 1NPPA 4H4KC 3C15B 1FJEB 3V2UC 5J2NA 5KT3A 4TVAB 4ZPAA 4DUTA 2HWHA 1Q5YA 3TYTA 1XR5A 3BJYA 1NK0A 1F5CA 4KSEB 1YJTA 1FWKA 1WC5A 4IO9Q 4ZIVA 3PYDA 4N76A 3CJ5A 2H5JB 4O0NA 2DR8A 4KGKA 1J27A 1Y10A 3BM7A 5L9NA 3ZNUA 3MECB 1S5ZA 3PHTA 1HMVA 1Q95G 3WQPA 2MY7A 2HFUA 3JSYA 4UOGA 1RP5A 2FHMA 2V8VA 2IJFA 3GFYA 3LP0A 1CJKB 4ZVQB 4NLXA 3BO3A 5DG7A 1CG2A 2YPYA 3U27A 1NSAA 1M5OC 4D3GA 3EVWA 4UY8T 4DUZJ 3OHBA 2HRTA 4P6QA 3NKYA 5CCLA 4RKUC 4M94A 4X2BA 4EYHB 1TKZA 3LUYA 5KFMA 2UUAJ 2ZZNA 4P52A 1FNOA 4DX5A 1JKHB 4X64J 1WACA 2KJVA 2W1BA 3W5XA 2XULA 4UF4A 2E5GA 5L39A 4J9MA 5FDLB 4RL1A 4BS2A 4LIWA 1RKJA 4OYWA 1VIOA 4B02A 3MM8A 5GAHU 1Y5NB 4O0IA 3KHGA 4HYKA 2GS8A 5HLFB 2XSJB 4F02A 3MURP 2C3PA 3CPWR 4Q7AA 4P72A 4JI6F 2LQ5A 2YNIA 3D3CJ 4J7CA 4KE5A 1IBLJ 2QA2A 1U4BA 4B3RF 3DLBA 2UXBF 1X4HA 2PA3A 1SQGA 1TL4A 1XJWB 3DHWC 1DLOA 4H4MA 5JXSA 4P2FA 2WONB 3TA0A 4DPOA 1IVZA 2DBBA 4ED2A 1GXUA 1HNWJ 4OI2A 3CVKA 3SSRA 2DNHA 1I5OB 2OD6A 3K58A 3NP5A 3QJJA 4OZJA 2EG1A 2WTFA 3G86A 1UA1A 2CQHA 4NI2B 3O1LA 1R8BA 1W26A 3NS7B 4XIUA 3UDVA 2GAHC 4EUVA 1IXKA 4ED5A 4E98A 2PMWA 5C42A 3CCJS 2SXLA 5A6PA 3Q8YA 1RHQB 1S6OA 1TELA 4O4GB 5DDQC 3DLEB 2UUBJ 1W2IA 2YH1A 2VHGA 3Q8UA 1KLMB 2ZVIA 3ZZPA 3W9HA 4UOFA 2QA4G 1Y00A 1IKYB 2MZRA 1SH2A 2M8DB 4MKVA 2QRRA
chains in the Genus database with same CATH topology
3ENAA 3EVMA 3BH6B 3EICA 1BHNA 1B4SA 1WKJA 1NSKL 1XIQA 3ZTQA 3VVTA 3BBBA 3ZTRA 5IOLA 2AZ1A 3NGUA 3BBCA 1BE4A 4HR2A 1S57A 2AZ3A 1NDCA 3EVOA 3VGUA 3R9LA 1NDKA 3Q8VA 1W7WA 3FBEA 4F36A 1NHKL 3EE3A 4ANDA 1HHQA 3Q83A 1F6TA 1NSQA 3ELHA 3L7UA 4FKXA 3EM1A 3JS9A 4DUTA 3BBFA 3PRVA 1PAEX 1MN7A 1ZS6A 1U8WA 3EJMA 1XQIA 1NCLA 2DXFA 4W98A 4S0MA 4O0NA 5C7PA 3B6BA 1F3FA 1NUEA 1UCNA 2HVEA 4KPCA 1S5ZA 3FBFA 1NSPA 1HLWA 4UOGA 3ZTSA 4C6AA 2NCKL 2CWKA 3NGSA 3EVWA 1LWXA 1VYAA 3FC9A 5BXIA 1NLKL 1B99A 2VU5A 1JXVA 1NB2A 4DZ6A 4ENOA 3BH7B 1KDNA 2B8QA 1EHWA 1NPKA 2DXDA 2BX6A 1WKLA 3VGSA 3B54A 3VGVA 3VGTA 2HVDA 1S59A 3FBBA 3FCVA 4ANEA 3DKDA 3ZTPA 2BEFA 5CABA 4FKYA 1NDPA 4DI6A 3FCWA 2ZUAA 1NDLA 3WX8A 2DYAA 4WBFA 1K44A 4CP5A 3ETMA 1BUXA 3NGRA 3VVUA 3ZTOA 3Q86A 3GPAA 3NGTA 4F4AA 3GP9A 3MPDA 3FBCA 1MN9A 2DXEA 1WKKA 1HIYA 2DY9A 2HURA 3EMTA 4EK2A 3DDIA 4ANCA 4UOHA 2B8PA 3FKBA 3Q8YA 1LEOA 5CAAA 3G2XA 3Q8UA 3PJ9A 4UOFA 3Q89A 1PKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ENA A;  3EVM A;  3BH6 B;  3EIC A;  1BHN A;  1B4S A;  1WKJ A;  1NSK L;  1XIQ A;  3ZTQ A;  3VVT A;  3BBB A;  3ZTR A;  5IOL A;  2AZ1 A;  3NGU A;  3BBC A;  1BE4 A;  4HR2 A;  1S57 A;  2AZ3 A;  1NDC A;  3EVO A;  3VGU A;  3R9L A;  1NDK A;  3Q8V A;  1W7W A;  3FBE A;  4F36 A;  1NHK L;  3EE3 A;  4AND A;  1HHQ A;  3Q83 A;  1F6T A;  1NSQ A;  3ELH A;  3L7U A;  4FKX A;  3EM1 A;  3JS9 A;  4DUT A;  3BBF A;  3PRV A;  1PAE X;  1MN7 A;  1ZS6 A;  1U8W A;  3EJM A;  1XQI A;  1NCL A;  2DXF A;  4W98 A;  4S0M A;  4O0N A;  5C7P A;  3B6B A;  1F3F A;  1NUE A;  1UCN A;  2HVE A;  4KPC A;  1S5Z A;  3FBF A;  1NSP A;  1HLW A;  4UOG A;  3ZTS A;  4C6A A;  2NCK L;  2CWK A;  3NGS A;  3EVW A;  1LWX A;  1VYA A;  3FC9 A;  5BXI A;  1NLK L;  1B99 A;  2VU5 A;  1JXV A;  1NB2 A;  4DZ6 A;  4ENO A;  3BH7 B;  1KDN A;  2B8Q A;  1EHW A;  1NPK A;  2DXD A;  2BX6 A;  1WKL A;  3VGS A;  3B54 A;  3VGV A;  3VGT A;  2HVD A;  1S59 A;  3FBB A;  3FCV A;  4ANE A;  3DKD A;  3ZTP A;  2BEF A;  5CAB A;  4FKY A;  1NDP A;  4DI6 A;  3FCW A;  2ZUA A;  1NDL A;  3WX8 A;  2DYA A;  4WBF A;  1K44 A;  4CP5 A;  3ETM A;  1BUX A;  3NGR A;  3VVU A;  3ZTO A;  3Q86 A;  3GPA A;  3NGT A;  4F4A A;  3GP9 A;  3MPD A;  3FBC A;  1MN9 A;  2DXE A;  1WKK A;  1HIY A;  2DY9 A;  2HUR A;  3EMT A;  4EK2 A;  3DDI A;  4ANC A;  4UOH A;  2B8P A;  3FKB A;  3Q8Y A;  1LEO A;  5CAA A;  3G2X A;  3Q8U A;  3PJ9 A;  4UOF A;  3Q89 A;  1PKU A; 
#chains in the Genus database with same CATH topology
 2ROP A;  1B7Y B;  1EET A;  4O3P A;  1BHN A;  1LWE A;  2BXJ A;  4LFB F;  2DNO A;  3KUH A;  1RT3 B;  4WTY A;  3ZTQ A;  4OMF G;  2YKQ A;  3A1Y G;  3HHK A;  2VFR A;  2F8H A;  2I2Y A;  2XWX A;  2UV8 G;  3I55 S;  1B7F A;  3TUZ C;  2EG2 A;  2DHH A;  2LQ8 A;  3DOM A;  2L41 A;  3T3F A;  4I1T A;  3F41 A;  1H98 A;  2RIL A;  1RHJ B;  2RDI A;  3TP2 A;  4X65 J;  2HQD A;  3OLB A;  3VAF A;  4YME A;  1WEZ A;  5LXR A;  1S57 A;  3WDO A;  4A8O A;  2AJ1 A;  3VGU A;  2BRL A;  3Q0A A;  2VOD A;  5FII A;  3IRW P;  3FMB A;  1NJI T;  2B43 A;  1N48 A;  2E5L J;  3H5U A;  1OY6 A;  4WE1 B;  3GV7 B;  3H5S A;  4CH7 A;  3CJK A;  5KFC A;  1KC8 T;  1H3D A;  1S79 A;  3NEK A;  2W7O A;  3TVY A;  2CPX A;  2RRN A;  3N9U C;  4OZ0 A;  2B9W A;  2J7W A;  2XMT A;  2EKY A;  5IFM A;  5D3G A;  2PD1 A;  4Y2A A;  4U9R A;  2RDD A;  2MLZ A;  3BO4 A;  3PRV A;  4OYI A;  2RQ4 A;  1PC4 A;  4ECV A;  5HVH A;  3RBZ A;  4CLZ A;  5DM6 Q;  1IBL F;  1R0A B;  2G2Z A;  2HZA A;  1TFY A;  2AEF A;  2BAN A;  3PZP A;  1N34 F;  3M6W A;  4S0M A;  3TZZ A;  1AFJ A;  3DGP B;  3UQS A;  2XZT B;  2DH7 A;  3AOA A;  2ZEJ A;  1Q16 B;  2RIJ A;  4G1I A;  1QD1 A;  2MZ1 A;  3W61 A;  4ICL B;  2MQP A;  4IRK A;  2JWN A;  1Y7P A;  4MT1 A;  4U8V A;  1JQG A;  1UZH A;  2RS8 A;  1ZOT A;  3ZTS A;  3SQO P;  2B9E A;  2BMB A;  3MR7 A;  3K5O A;  2H65 B;  1RTD A;  4DR7 J;  3PIP Q;  1X0P A;  2DVI A;  1R6V A;  1VYA A;  2UUT A;  4Y2I A;  5DET A;  3VWS A;  1S99 A;  3I0R A;  3MTK A;  4N8O A;  3KXD A;  2B6A A;  2CJX B;  3DLG A;  2KM8 C;  2HNY B;  2XEX A;  1BXN A;  4RW8 B;  2DCU B;  6AT1 B;  1PG5 B;  2QC3 A;  4CNZ A;  3A3N B;  5L8R C;  1X60 A;  1TTH B;  2KRB A;  4F2S A;  3C6T A;  4I69 A;  5L9X A;  3V4M A;  4XDD A;  5F8N A;  4LFA J;  4NLW A;  5HAO A;  3R6L B;  1IR2 A;  3J81 Y;  4OYP A;  3PM9 A;  1GXL A;  2RT3 A;  2R7T A;  1ZTT A;  1NDP A;  1VQO S;  4ECR A;  3THP A;  3MPY A;  1A0O B;  4PR6 A;  1E6Y B;  2CJA A;  1NDL A;  1VMB A;  1HKA A;  2B51 A;  3EDR B;  4LQ9 A;  4DX8 H;  5D6G A;  1RSC A;  4M5D A;  3TNV A;  2ADB A;  3MM7 B;  2LVW A;  3NGR A;  5E33 A;  4KC5 A;  3SCI E;  4DN0 A;  4DPW A;  2W25 A;  3CMQ A;  3V6H A;  3Q86 A;  1QAJ A;  4ED6 A;  2XLI A;  5BR8 J;  2BBE A;  5IT9 U;  2ACM A;  1JLA B;  1TU0 B;  2J9E A;  1H7W A;  1VGY A;  2NUU G;  4KHP F;  2VFU A;  2ZBQ A;  4TQR A;  5HRO B;  3SFU A;  3MMA B;  3AD7 C;  1JLC B;  2YKA A;  4USV A;  5EGY A;  2DY9 A;  4P74 A;  4DR1 F;  3GCX P;  4RZR A;  2IA6 A;  4ED4 A;  2PN6 A;  1OQ3 A;  3M2U B;  3QLH A;  4CLW A;  4O23 A;  3SZ2 A;  1XNR F;  1AT1 B;  4ZCL A;  2NXU A;  1S48 A;  1AUS L;  3OVA A;  4M5M A;  2CAJ A;  1LWF A;  4ZHR A;  4UST A;  3R8Y A;  1SJR A;  4NA3 A;  5K20 B;  2JDJ A;  2XQC A;  1X4D A;  3KKF A;  1RYS A;  2V4J B;  1HBM B;  4ID8 A;  1M5K C;  1NZ8 A;  2JHE A;  1OYE A;  2M88 A;  3NS6 A;  5HP1 A;  1KFS A;  3HHL B;  5HQM A;  1S1T B;  2HHS A;  1RIS A;  3QGG A;  3M7V A;  4TKT A;  2CPZ A;  2VBZ A;  3IA0 A;  2VA3 A;  2BJE A;  1LW2 B;  1N52 B;  2WSE C;  4CLK A;  4U67 Q;  1FXL A;  2IFX A;  4WU2 A;  1I3O B;  2RHS B;  1R0A A;  3S1T A;  4LF7 J;  3CJ8 A;  3CCE S;  1JXE A;  4HR2 A;  3LH2 S;  4DS4 A;  2R7Q A;  4MYT A;  1GMV A;  2HBZ B;  2GX8 A;  3HSD A;  4URS A;  1Q5V A;  3ZC4 A;  4CLS A;  2OFG X;  3Q8V A;  3PCO B;  3CD6 S;  2OHD A;  1NU4 A;  4KPY A;  4YOE A;  5KFP A;  3QT7 A;  4DLG A;  4UT4 A;  1HHQ A;  3DRP A;  5B0D A;  3QPI A;  1S1W A;  4CM2 A;  1T9X A;  5L1I A;  3GFZ A;  1KHV A;  1M5S A;  4I64 A;  1RT6 A;  2AMC B;  3IWL A;  4RX6 A;  3V6D A;  3LP2 B;  3D6M B;  3RB6 A;  3LWM A;  3L7U A;  2V2Q A;  1U24 A;  2WBM A;  4NE9 C;  5LSO A;  3I56 S;  3EM1 A;  1RYR A;  5H9F K;  3CWJ A;  1FJG J;  3O44 A;  4NZ6 A;  3JQJ A;  4KO0 B;  3SCL E;  1RWN B;  2RSQ A;  3AOC A;  3D7S B;  3RW7 A;  5RUB A;  3OR1 A;  4YHH F;  2XO7 A;  1OY9 A;  2FLP A;  1Y11 A;  2ZKT A;  4ECZ A;  1HNV B;  4ZK7 M;  3AD9 C;  4W98 A;  2NXJ A;  3GFX A;  1J2V A;  1UFL A;  3DRY A;  2QA1 A;  3C66 A;  5C7P A;  1Z1Z A;  2Z57 B;  3RJM B;  3T6J A;  3PX6 A;  4J9P A;  3TOQ A;  1N88 A;  4ELU A;  3VZH A;  2YX7 A;  2C2R A;  4GRS A;  3W64 A;  2QLJ B;  3UCZ P;  1S9F A;  3IWN C;  3CC7 S;  2DH8 A;  1IM4 A;  2OPR B;  4RU9 A;  1YX2 A;  2UUB F;  1CJU B;  4KTQ A;  2CWK A;  2KHC A;  3HZG A;  3JAM Y;  5IT0 A;  5DZ7 A;  1VQK S;  4GC7 A;  1VBK A;  2VQF J;  1HAR A;  3NBP B;  3D66 A;  1S1X B;  3HCX A;  2OPQ B;  2DHG A;  2Z2Y B;  4DPY A;  1XNR J;  3TZW A;  2NSC A;  1S6U A;  5KG2 A;  4K5R A;  1J5E F;  4CM0 A;  2WK4 A;  1RA7 A;  1WI6 A;  3I5C A;  4KAI A;  3KLH A;  1SKU B;  4DV4 F;  4DL6 A;  2CJK A;  2GO9 A;  4PQU B;  3UO0 A;  1HQE A;  3T1Y J;  2HVD A;  1FJ7 A;  5D4L A;  1FNX H;  3K59 A;  3A8I A;  2VKZ G;  1HNI B;  4M5L A;  3O8W A;  2XS5 A;  1LKZ A;  5T14 A;  1M0S A;  2GGP B;  2XSF A;  3C14 B;  3MCM A;  4B08 A;  2XS2 A;  4DV7 J;  2HBY B;  2VON A;  1PIL A;  1R3N A;  4Y2C A;  4G1Q A;  4ID5 A;  3WC0 A;  1KNZ A;  2H5E A;  4WBF A;  3WX8 A;  1VS3 A;  2MJN A;  3V6J A;  5HK4 A;  4LF9 J;  1RT4 A;  4GKJ F;  1IM6 A;  3PFO A;  3CDU A;  4OFZ A;  1ZPV A;  2A2D A;  2DEJ A;  1FO1 A;  3IWX A;  1A6L A;  1S6Q B;  5KT5 A;  2NXN A;  4KGX B;  3E01 B;  2R2T A;  2JLF A;  2I9S A;  1LW0 A;  3I5B A;  4WFN Q;  2UUC J;  1N32 F;  3BPD A;  1WWH A;  2CG8 A;  3DN9 A;  3W9I A;  3FEY B;  1H7X A;  2M7S A;  1SI9 A;  2VG6 A;  2O66 A;  2LYV A;  5HMZ A;  3H59 A;  2H9Z A;  1F5A A;  3CIZ A;  3JTO A;  4DU7 A;  3JB9 k;  1RAE B;  2BV3 A;  2XYH B;  4LQ3 A;  2U1A A;  3R2C J;  1VJQ A;  2BOP A;  4HTJ A;  2E5J A;  1WNE A;  2HG4 A;  1X0F A;  1T03 B;  4L3K A;  3R97 A;  4MFB B;  4C0B A;  1SBR A;  1OY8 A;  1S10 A;  3M6V A;  4RNO A;  1CC8 A;  3I96 A;  1S76 D;  1L3U A;  2CQ1 A;  3M30 B;  4YB5 A;  1P27 B;  3KNG A;  4YEA A;  3SV3 A;  1KVJ A;  1WEX A;  4RUH A;  2DY1 A;  4EYI B;  1TKX B;  7FDR A;  1NJW A;  1Q82 T;  4F4K A;  2PDA A;  4RWW A;  1VQ9 S;  5H9E K;  4OI6 A;  1T9U A;  2B5J A;  3MPU B;  3DOL A;  4ZLJ A;  1SL1 A;  4U95 A;  4ZCI A;  3WIV A;  3N01 A;  1N5Y A;  3BBC A;  2FVC A;  2DT9 A;  2QMW A;  3QGI A;  1KVI A;  5HAN A;  2OPP B;  1RE1 B;  1T9Y A;  2CVI A;  1D9D A;  2M4M A;  1DUR A;  2ROE A;  3HI9 A;  3Q2S C;  5JUM A;  1VQ4 S;  4LF8 J;  1HMV B;  2K2P A;  5C2G A;  3ZO7 A;  3GII A;  3N5F A;  3CCU S;  1IQZ A;  2VFV A;  5F8H A;  3B78 A;  5IC6 B;  2H4Y B;  3LP0 B;  3P4U B;  3C16 B;  1JB0 C;  4PZV A;  4QR2 A;  3CCM S;  2EW9 A;  3R7S B;  4WZM A;  2ASL A;  3HLU A;  2CWX A;  3M05 A;  1S97 A;  3AJ1 A;  4IUF A;  2QIF A;  2LDY A;  2BZ2 A;  5E3Q A;  3V5R A;  1CJT A;  1JLB A;  4GO5 X;  3MEG B;  5AXM A;  2YXL A;  1KS2 A;  2UXD F;  3KK2 B;  4FBT A;  1S0M A;  3M8Q B;  4K5S A;  4FVM A;  2CDR B;  3M6U A;  4CO5 A;  2V5H G;  2WVF A;  3TR5 A;  1XC9 A;  1RWU A;  1GTH A;  1UCN A;  2RRB A;  5A0Y B;  1C1B B;  2DGS A;  1K73 T;  1FT8 A;  2CJQ A;  2EPI A;  2V8G A;  4JI7 F;  4K8R A;  5IWA F;  2ZJQ Q;  4RBV A;  4ILL A;  4LBH A;  5I3U A;  2W9A A;  4OHW A;  2FD2 A;  4PAA A;  1LK5 A;  5CCM A;  2R8J A;  4DL3 A;  3RBX A;  5F8M A;  1ACM B;  2P6T A;  4X66 F;  2LU2 A;  1RGV A;  3KJV B;  4H4M B;  1R8H A;  4WP8 A;  3BSN A;  1HBN A;  3HD2 A;  1FNM A;  3DXS X;  1S12 A;  2FZK B;  3N79 A;  1HNV A;  4Y6I A;  1NK8 A;  2DXD A;  1NO8 A;  3G6Y A;  3TQ1 A;  2V63 A;  2QSF A;  5HO4 A;  3PW0 A;  1SXL A;  4OX7 A;  3OHA A;  4X4R A;  4ZCM A;  2XCP A;  1SC3 B;  1RHR B;  1YZ7 A;  4LF1 A;  4Y34 A;  1T94 A;  2XM3 A;  4FPI A;  1YWX A;  1Y5L B;  3VQS A;  1G3O A;  4EFA C;  1Q7Y T;  2F8M A;  4XAK A;  3T6B A;  1X5P A;  4QWC A;  4RPF A;  5HQL A;  1A9N B;  2UUC F;  5A6W A;  2KRR A;  1U1R A;  1TKD A;  3UR0 A;  2MY8 A;  2DGX A;  3AB2 B;  4UZB A;  1HNZ J;  3PAC A;  4OYO A;  3TUP A;  1OS5 A;  1N0V C;  4C0O C;  2W9B B;  1S0V A;  5J2M B;  2HQ3 A;  3GP9 A;  4QWD A;  2CQC A;  2QYC A;  4LF8 F;  2ATL A;  3IAM 9;  3K0J A;  4U8Y A;  1WKK A;  3KFW X;  4A47 A;  2GQQ A;  4E8U A;  2ZH3 A;  5KFQ A;  4DR3 F;  1SV5 B;  1RUS A;  2DJW A;  4QIG A;  1GFW B;  3PO5 A;  2DNY A;  2J9C A;  2HYI B;  2YTC A;  2VOO A;  4CT8 A;  3BGF A;  2M3D A;  4QJV A;  2HVH A;  4DV1 J;  2ZH6 A;  2ZOG A;  2GV1 A;  3HFZ B;  3H4D A;  2KFZ A;  1JJ2 R;  1FRI A;  2G0C A;  3HHL C;  1RAA B;  3KLF B;  2YWW A;  1RT4 B;  1RWV B;  4NCG B;  2OPS A;  3IG1 A;  4UZC A;  4TLQ A;  2W9C B;  3R1L A;  3PX0 A;  2NXE A;  2HK3 A;  3FJ2 A;  2ZBR A;  1T3N A;  2IM3 A;  2CQP A;  5IT4 A;  1H74 A;  2E9T A;  4CLY A;  2AQ4 A;  1V6H A;  2V2K A;  1YRX A;  4NA2 A;  3CJK B;  4F67 A;  2VD3 A;  4Z2X A;  1R8C A;  3M9M B;  1CC7 A;  1OPZ A;  3Q23 A;  3CCW A;  4R0J A;  5FJ4 A;  2MLY A;  4TN2 A;  3R3T A;  4J5O A;  4EU0 A;  4USU A;  4DL0 C;  1MRO A;  5DJB A;  1NK7 A;  1KSP A;  4TXS A;  2BE2 B;  5KFU A;  1VK3 A;  2ASY A;  2B7C B;  2HHH J;  4NLY A;  1F9F A;  2FPH X;  3OFE A;  4RW7 B;  1NND A;  5D4O A;  5GAG U;  2DIT A;  3OUY B;  4ED7 A;  1N4L A;  1BMQ B;  1T9T A;  3BQ0 A;  3T1Y F;  2GIR A;  5HMY A;  1TQL A;  4DR6 J;  2YPZ A;  3T1H F;  3DGP A;  2R7O A;  4JI4 J;  4OZ2 A;  3KOA A;  3SQG B;  3NCR A;  3AAW B;  3HZE A;  4M5G A;  2NSB A;  3D54 A;  1TP7 A;  1TKX A;  4F8R A;  3GV8 B;  3NNH A;  4EGL A;  2EK1 A;  3OL9 A;  2HVI A;  2OSQ A;  5HBM A;  3H2L A;  3PXG a;  2HAF A;  1U1O A;  3DOL B;  1RHM B;  4FF2 A;  5KFD A;  2NR0 A;  1KLN A;  3QO9 A;  1FRX A;  1CS4 A;  2E7V A;  3DLG B;  1N5Y B;  4H4K A;  1ZAX A;  4X4O A;  5HI7 A;  4LVN P;  1NME B;  2XZD B;  4NEZ A;  3QYY A;  4FPR A;  2MQQ A;  3HJF A;  1EB0 A;  2B4V A;  5DO2 A;  3IR7 B;  3U1N A;  8AT1 B;  5IT9 Y;  4QPT A;  3C3L A;  7FD1 A;  3GCW P;  3C6U B;  1F2H A;  3FBF A;  1HPZ B;  3HJV A;  4YB6 A;  1NK9 A;  1RT3 A;  3J80 Y;  2YQ1 A;  5CH7 B;  3OJU A;  1OO0 B;  4HT7 A;  2APO A;  5A76 A;  4WCE Q;  2RQM A;  2DNM A;  2NCK L;  4B3S F;  4USJ C;  1Q7L B;  3I31 A;  2HHU A;  1RT5 A;  3WHI A;  1KD1 T;  3CJQ A;  2P9E A;  3OTD A;  2RU3 A;  2HQC A;  1F0X A;  3Q8P B;  3MM7 A;  4O3R A;  2VFS A;  2DIU A;  2W8K A;  2QSW A;  4DZ6 A;  3OW2 R;  1OQ6 A;  4HAC B;  2GQ2 A;  1FA0 A;  2KFY A;  5KT2 A;  2C3U A;  3KK2 A;  3JXO A;  4I2P A;  4LBI A;  4DPU A;  2E5L F;  2BX6 A;  3ETO A;  4RW4 A;  3PVX A;  3TJ9 A;  4ZP8 A;  4BBY A;  1V3Z A;  2HHP A;  1PBA A;  2GHP A;  3MR3 A;  3QWU A;  3V4I B;  1C1B A;  1EKR A;  3IRX A;  4MK7 A;  4OI0 A;  4C9D A;  2PT0 A;  3TX0 A;  2BEF A;  3D2W A;  3GON A;  3LAL A;  2XB2 D;  3KLG A;  2RVJ A;  3EUN A;  4FNH A;  3RBE A;  3R5J B;  1QAI A;  4LSZ B;  5F0W A;  3PEJ A;  3UVJ A;  1S0N A;  2OEK A;  4KGV B;  1JLE B;  3BO2 A;  2QZ8 A;  3BR9 A;  4WXW A;  1Q8I A;  3R5D A;  2NUH A;  4O3N A;  3J81 j;  2K3K A;  1LWF B;  4ZHR B;  4IH5 A;  3VVU A;  4QW9 A;  2CVE A;  1WG5 A;  2NXC A;  2V94 A;  1NJY A;  4E0D A;  5KG0 A;  3BYP A;  5DDP C;  2ZZM A;  3KLE B;  5BJR A;  3V81 A;  3VCD A;  1R27 B;  4JI4 F;  3O5T B;  5IQ6 A;  3QWP A;  3ZNJ 1;  1H2U X;  5HMW A;  4E2F B;  1KBR A;  2ACY A;  5I3Q A;  1SJQ A;  4BC9 A;  1QVF R;  2G4B A;  2BKP A;  2LCW A;  3KDO A;  3CJS A;  3AJD A;  2E66 A;  2EC2 A;  2IMO A;  4HL9 A;  3NCQ A;  1OIA A;  1JNR B;  2DHX A;  5BYS A;  2HZV A;  4CCH A;  4V19 X;  2BM1 A;  2YQ3 A;  3N4W A;  2LKZ A;  4KHR A;  3I9Z A;  4KBI A;  2QFJ A;  3L95 X;  4URG A;  1ZAV A;  3I0R B;  2IAJ B;  4V1A k;  5HAT A;  4BLG A;  1R31 A;  2B6A B;  2D41 A;  4WF9 Q;  2DIV A;  4J9K A;  2IIH A;  3UDE A;  3I32 A;  2LU1 A;  3MHY A;  5D0E A;  5L46 A;  4JI7 J;  2MQO A;  2AT1 B;  2XC9 A;  3PRD A;  4EEY A;  2E1R A;  1JLF B;  2KHD A;  3FSY A;  2Y9H A;  3HKW A;  3DRP B;  1HHS A;  3GIR A;  1VQ7 S;  2DRD A;  1DY3 A;  3M2V B;  2Y0B B;  1YJN S;  3W7B A;  2HHH F;  2IMW P;  1FK9 B;  1HW8 A;  1WTB A;  2E29 A;  2EC0 A;  2RUG A;  3P8B B;  1UWA A;  3OXL A;  3R6G B;  1NJX A;  2Z58 B;  3GR1 A;  2A0F B;  2R42 A;  4LRC A;  4B3T J;  1F1B B;  1YJU A;  3RR8 A;  3LGM A;  1E6Y A;  4WFA Q;  1YJ9 S;  3L09 A;  2XMV A;  4KO0 A;  3R5G A;  4HLB A;  3D1H A;  4NML A;  3RW6 A;  3QT8 A;  4WFY A;  3JTP A;  1UL3 A;  1EP4 B;  2PE8 A;  2WSF C;  4NPO A;  2H48 B;  5KFE A;  5L1L A;  2UVV A;  1KVK A;  4NXM F;  3A4T A;  2V8P A;  4NLV A;  2XO6 A;  1KRP A;  2W9C A;  4PXE A;  1KEK A;  3M6X A;  4N8N A;  3PIO Q;  4F36 A;  2YKM A;  3VR1 A;  3Q8Q B;  2D9P A;  2VPZ B;  3LAM A;  2I5J B;  3Q83 A;  3PNI A;  1AW0 A;  2OPR A;  1FER A;  3HHD A;  3UNG C;  1U0H A;  2PEB A;  1NSQ A;  1NM2 A;  2RKI A;  2FLN A;  4K4Z A;  2Z2M A;  3NNC A;  1FFW B;  3VTI A;  2CAD A;  2CQB A;  3ZZY A;  3V6K A;  1X5T A;  3DLH A;  1JLQ B;  2IM2 A;  4NRT A;  2HEK A;  4L75 A;  1IR1 A;  2YNG B;  3ZZZ A;  3NS5 A;  2QMX A;  5JMN A;  2Q6B A;  1CUL B;  1HWJ A;  3T5K A;  2AGQ A;  4MJK A;  3D0G E;  2DGW A;  1N34 J;  4X4P A;  1WG1 A;  1U6B A;  4KHM A;  3HFK A;  5K5M A;  2OEM A;  4X4V A;  4F3Q A;  2C1E B;  4Q5V A;  3PW5 A;  1Y4Z B;  1LK7 A;  2VA2 A;  1NH8 A;  4FYW B;  4KPC A;  2C42 A;  3OR2 B;  1LWC A;  4P2M A;  2FLO A;  2BE7 D;  3HHL A;  4USI A;  3M4X A;  1S1T A;  2J6T A;  2V2Z A;  5H9F J;  3M9O B;  3GFH A;  2GIQ A;  2FZC B;  2CNO B;  4AUK A;  4K4U A;  3MCS A;  4DR7 F;  1T8E A;  1VQS A;  5KTQ A;  4LF7 F;  3CUL A;  1LWX A;  2ZH2 A;  2R8G A;  4C4W A;  5LT5 A;  4L3N A;  1M5V C;  1QTM A;  1B99 A;  4EZ6 A;  4ZIT A;  4QIV A;  4X4U A;  1ZBT A;  1EJ7 L;  1GK8 A;  4BWJ A;  1WD6 A;  2KH9 A;  3J7Z 5;  2B8Q A;  3FK4 A;  2JZ5 A;  4ZMM A;  1IKV B;  3G82 B;  1WKL A;  2RB7 A;  3ILO A;  2GVZ B;  2R4F A;  1XR7 A;  4JI0 F;  4JI2 F;  4M5K A;  2R3V A;  4OYB A;  2JFK A;  1VDH A;  4LVO P;  3SDE B;  5DQI A;  3JYT A;  3ITH A;  4FS1 A;  3C6U A;  4WKR A;  3BKT A;  3EXY A;  3UFC X;  1HPZ A;  2V67 A;  3NG8 A;  2ZC4 A;  3CGI A;  4RJV A;  4FKY A;  2MST A;  4R8U B;  5GMK a;  4Y00 A;  3V6D B;  1J5E J;  3LP2 A;  1FWP A;  5LSL A;  1U26 A;  2KG1 A;  3M32 A;  2GHW A;  3LTO A;  1S72 S;  4FF3 A;  3IBC B;  3R2D J;  2HQG A;  2J8A A;  3GG0 A;  4X62 J;  3IGV A;  2HZC A;  2NS1 B;  1IJE B;  3IAS 9;  3UI3 A;  1VQP S;  4QW8 A;  2ZUG A;  2VBW A;  4H54 A;  1Q8L A;  3X1L B;  3GYG A;  2X1B A;  2J8S A;  4AL7 A;  4LRE A;  1G2E A;  2HHV A;  1RWO B;  5JVG Q;  4DV2 J;  2BYC A;  2CQI A;  2GNK A;  4FS2 A;  4KHP J;  1Y0H A;  5M2U A;  3V4I A;  4Q45 A;  3TZY A;  4GKJ J;  4GKK J;  1HI0 P;  1U2C A;  4WYW A;  2C3M A;  2ZHB A;  3CB4 A;  1YKW A;  2DXE A;  2MMY A;  1JJH A;  2X3D A;  2J5A A;  3EMT A;  4NEY A;  5CYJ A;  3KK3 A;  3VAI A;  2LA4 A;  4OYM A;  1EKS A;  2EWH A;  1N32 J;  4QIF A;  5E0O A;  1TL7 B;  1RK8 A;  2CUY A;  5KFF A;  1LEO A;  1SVD A;  4I0W A;  3ENV A;  1X31 C;  3W1Y C;  2OMO A;  2JC0 A;  2MZT A;  2XNR A;  4FXV A;  3Q8S B;  1TAQ A;  4FF1 A;  2DIS A;  2E5I A;  1MWZ A;  4P2X A;  4OHV A;  5E3C A;  2LFV A;  5KFB A;  1GTE A;  5KFK A;  1UP1 A;  4DV4 J;  2ZH7 A;  4DS5 A;  3BGR A;  1P6T A;  3U1L A;  1RT1 A;  1WC0 A;  3GYX B;  4B3T F;  1HQE B;  3W5Z A;  2JFD A;  2EFO A;  3HM9 A;  1BD6 A;  3G6E S;  3D68 A;  1EZZ B;  2GMJ A;  1NHV A;  1X4F A;  2A3J A;  3DI6 A;  4WFZ A;  2IYG A;  4U96 A;  2C2E A;  2MEW A;  2HHQ A;  2FYX A;  1X4B A;  4QWB A;  1Y5I B;  2BJ9 A;  2GGP A;  2VC1 A;  1PAU B;  3C14 A;  3MMB A;  3IBF B;  5A8K B;  3FCH A;  1LXJ A;  2FC8 A;  5CZX A;  4C8K A;  1HR0 F;  4ID5 B;  1FTR A;  2FUG 9;  1YLX A;  2P6S A;  1KQS R;  4U7U D;  3W62 A;  2C2Z B;  2FQQ B;  2ZM6 F;  4KRW A;  4C7Q A;  1GT8 A;  1UTA A;  3VAJ A;  2CYY A;  5B0C A;  5IC4 B;  5KFL A;  2MQM A;  3G87 A;  1D1U A;  2HHW A;  2B56 A;  3QFH A;  4IOB A;  1N8R T;  3FRZ A;  3HX9 A;  5D15 A;  1K1S A;  2HGN A;  2HS0 A;  4DR4 J;  5CYM B;  5I3U B;  2EFP A;  3FEX B;  2HWI A;  3CIM A;  2IRU A;  3K7R A;  5CYQ A;  1FK9 A;  4TY8 B;  2UXB J;  1FRJ A;  3OL7 A;  2GQC A;  1PGZ A;  1TKT A;  2MQ8 A;  2FVQ A;  2L3M A;  2OML A;  2UVU A;  1JLG B;  2FVR A;  4FP9 A;  1GH8 A;  2FIU A;  4GC6 A;  3BEG B;  1U02 A;  3OFH A;  2Y1I A;  2A6O A;  1QLN A;  4CTA A;  4ZLP A;  2F4V F;  5D78 A;  4CLT A;  3N5B A;  3OSP A;  1T03 A;  4AL5 A;  3DLJ A;  3M8P A;  3DMJ B;  1YJ7 A;  3EGV A;  3HXM A;  1DTT A;  4FYD A;  3IN5 A;  2ZWP A;  2YKM B;  4G6V B;  5C24 A;  2AHO B;  3RRG A;  4KJI A;  1FDA A;  1GMW A;  1NXI A;  3WC2 A;  1BLU A;  1RU2 A;  4ZP9 A;  3LW5 C;  4GO7 X;  2IVY A;  2E44 A;  3NAH A;  1NAQ A;  2MHN A;  2GA7 A;  4IO1 A;  2WW8 A;  1RJJ A;  3B82 A;  4NRU A;  3R5B A;  1SKW A;  4IDK B;  4NLD A;  4LFC F;  2N82 B;  1Q8B A;  2M9K A;  3X3U A;  4RW6 B;  4NLU A;  3D1O A;  5M2P A;  4N5S A;  3MMC A;  2YNG A;  4B17 A;  2LQJ A;  3QID A;  4CQ1 A;  1CUL A;  2YNF B;  3GG1 A;  3MWB A;  4OX9 F;  1RAO A;  2N4D A;  2Q43 A;  1S4F A;  3LGH A;  2JH3 A;  2AW0 A;  3IXQ A;  1B0P A;  4DV6 F;  5J2M A;  1ZAW A;  5KG4 A;  2ATC B;  1QDU B;  3MR2 A;  3B54 A;  2C2O B;  2CRL A;  3BR8 A;  1PIE A;  3OR2 A;  2CQ3 A;  4OZ3 A;  3UR3 C;  4Z7C A;  5JVH Q;  2QG9 B;  4OX6 A;  3C16 A;  4ZVP B;  2QO3 A;  3CNQ P;  3FSI A;  5F8L A;  1SV5 A;  2R9L A;  1X4E A;  1U49 A;  3NGK A;  4ZVE A;  5L1J A;  3UD3 P;  2BQ3 A;  2M2B A;  1NPR A;  4A8S A;  3QZ8 A;  2DYA A;  2DGV A;  1U25 A;  2UXD J;  1CJT B;  1JLB B;  4M5J A;  4XPC A;  3F73 A;  3BDP A;  1KTV A;  2VG5 B;  1VRT B;  1VCT A;  4PWU A;  3W63 A;  1O0P A;  4WKY A;  2D3O 1;  4TYB A;  3BZQ A;  3H0P A;  2MXY A;  3W2V B;  2OD4 A;  3MED B;  2YY3 A;  5G0R A;  2O3D A;  2MQN A;  3HPO A;  4F7V A;  1QAY A;  2GVZ A;  1VHF A;  2NPI A;  5J1N A;  4QPX A;  4F26 A;  2DR5 A;  1HBO A;  3LPE A;  3GIM A;  3N0V A;  4TLR A;  2B3T B;  1ELO A;  1U6F A;  4LR8 A;  3SXL A;  2JRS A;  4Q8F A;  4X4N A;  2BE2 A;  2B4U A;  2YKO A;  4Y3C A;  5B0G A;  4QZV B;  2UV8 A;  4X66 J;  1D8Y A;  1LFW A;  2V0N A;  3CD0 A;  1F5B A;  4OYX A;  4CI0 B;  3KJV A;  2VQE J;  2DR6 A;  1HBN B;  1FD2 A;  2Z8Q A;  4WU3 A;  1RAB B;  1S9G B;  1UW9 A;  2CZV C;  2ZE2 A;  2DCL A;  5A8R A;  1BWV A;  2BJ3 A;  1YBA A;  3GIL A;  3C46 A;  2RAQ A;  3FFI B;  4QR0 A;  1YI2 S;  2QLB B;  1VI7 A;  4R25 A;  1T05 A;  1WHV A;  2AYE A;  2Q6C A;  3K89 A;  1RLD A;  4NLT A;  4WFB Q;  4AL6 A;  1YRU A;  2XMA A;  5HBM B;  4IFY A;  2L9D A;  3CE8 A;  2ZC3 A;  3M8W A;  2DEI A;  4YQW A;  3QO9 B;  1TL7 A;  1BQM A;  1IUJ A;  3OTC A;  5JJB A;  2VG7 B;  3O3L A;  4ES1 A;  3G96 A;  4A8M P;  2IM0 A;  3VGS A;  2OP5 A;  2KJW A;  1RAH B;  1O6X A;  2AZ3 A;  1NDC A;  2OIH A;  1UMJ A;  6FDR A;  2BE9 B;  3HMJ G;  1RKI A;  2BQR A;  4ZVU B;  2PEH A;  2BKO A;  1AZS B;  3R5A A;  4RNM A;  1QUP A;  4DV6 J;  1AB8 A;  2QL7 B;  4K4T A;  4DQI A;  4QR1 A;  1B70 B;  3RAQ A;  4XDC A;  1ZET A;  3LAK A;  3P3D A;  1BQN B;  3T1H J;  5A8W A;  3DI6 B;  4ZVS B;  3CXC R;  1S1U A;  1Q1K A;  3LA0 A;  3TWZ A;  2DO4 A;  4IFV A;  3MAA A;  1C0T B;  4OV1 A;  3JS9 A;  2B9X A;  2VBX A;  3POT B;  2FVP A;  1S7I A;  4LF4 J;  2XYP B;  2OI2 A;  3EJM A;  4FNI A;  3OLA A;  4HKQ A;  2K3I A;  2ZBC A;  2HMI B;  2HLT A;  1NK6 A;  3KG0 A;  4GKK F;  3UDC A;  5ITH A;  2AYM A;  2LLZ A;  2KYZ A;  2HVE A;  5AT1 B;  4EBC A;  1RZM A;  2XHC A;  3DOK A;  3KG1 A;  2YWF A;  3HO1 A;  3JQK A;  4FYY B;  1DAR A;  1P9Q C;  2FC9 A;  1U09 A;  2A10 A;  2PMZ D;  4DFP A;  1K47 A;  1U2R A;  4TY8 A;  4KR0 B;  3BSA A;  3H25 A;  2VIC A;  2FB0 A;  1WF0 A;  3UD5 A;  5DDR C;  3AA9 A;  4QYZ J;  1MMD A;  4OI1 A;  3FRY A;  3I6P A;  4DSK A;  1R0C B;  2GVD B;  3I87 A;  4I6W A;  4DQR A;  2Z30 B;  1S77 D;  5U47 A;  4LSN A;  2P8I A;  2ZH9 A;  1WOS A;  3TEG A;  2VQF F;  2EBG A;  4KFB A;  4NXN J;  3J7Y U;  1DTT B;  1WC4 A;  3HP6 A;  4ZPT R;  3BN7 A;  2XGQ A;  1NEE A;  5CA5 A;  4ELV A;  2HRY A;  3ZTP A;  3BS9 A;  1IBM F;  4LF6 F;  5HQ8 A;  8ATC B;  4ED1 A;  2UVR A;  5M2R A;  3PKM A;  2KT2 A;  4JYA F;  2DHS A;  4DMZ A;  1WF1 A;  1PC5 A;  1FXD A;  3RBD A;  3PFE A;  2Q79 A;  3HSG A;  2QL9 B;  2FJA B;  4MIB A;  2AKW B;  5F41 A;  3CCS S;  4AXJ A;  4B9U A;  4N77 A;  4RW6 A;  3MMC B;  3MM6 B;  1KOH A;  2C2K B;  2KFN A;  5F3T A;  2YNF A;  4U7C A;  4IQX A;  2HRU A;  3BGO P;  4KV8 A;  1JLF A;  2VIH A;  2KT3 A;  3KNA A;  4KH1 B;  4J9N A;  4Q43 A;  1DQ9 A;  5F3Z A;  1U7L A;  3FBC A;  2UU9 F;  1C1C B;  2MTL A;  3H8Y A;  4JV0 A;  2Q3P A;  3SCK E;  4DR3 J;  3RU0 A;  1CJK A;  4LSL B;  1EQM A;  1ARO P;  2PFD A;  2ZDP A;  5K14 A;  2MGZ B;  2F4V J;  1UZD A;  1XTZ A;  3NLC A;  2IDL A;  2B4P A;  3EWG A;  4LR9 A;  3VAL A;  1RT5 B;  2ASJ A;  1VC6 A;  1YHQ S;  1DFD A;  2DR7 A;  1OPI A;  2LEB A;  2Q1L A;  4RU2 A;  3N28 A;  4ZJL A;  2H4W B;  3UNY A;  5LMN J;  1RTI B;  2DKO B;  1W2B R;  1VRT A;  3H20 A;  1R8P A;  1YVF A;  5E5N A;  1H2T Z;  2R2U A;  4I2P B;  1PJ5 A;  4YN3 B;  2RS2 A;  2GIF A;  2E7W A;  1JJC B;  1GXT A;  3MED A;  3N6N A;  2BOA A;  4RW4 B;  1PYS B;  3BSC A;  5DRK A;  3ZZO A;  3TI0 A;  4JI3 F;  2VBY A;  2J9D E;  3IRX B;  5E3R A;  2V9W A;  2FHK A;  5HLF A;  2GO8 A;  2K8G A;  1O51 A;  2RKI B;  3KUG A;  4ATN A;  4P9S A;  3R1H A;  1S1V B;  2HAI A;  4A48 A;  2P5V A;  1RU1 A;  3GR0 A;  2AGO A;  2YNI B;  1UKU A;  4HEA 9;  2J0W A;  2CPE A;  2GC8 A;  3GIK A;  4K2X A;  1E6V B;  3DRR B;  5KFO A;  4DFJ A;  3K57 A;  1VBX A;  4PXD A;  1S9G A;  2ZE2 B;  3DRX A;  1Z4U A;  4WII A;  1W7W A;  3D5M A;  5IQQ A;  2O1P A;  5CHC B;  3KLE A;  4FVC A;  1LWC B;  1U45 A;  2JEF A;  1FDN A;  1G7C B;  2K1R A;  2VF3 A;  3HD1 A;  4I7F A;  3HT3 A;  1UVN A;  4YS2 A;  4DV7 F;  4JP8 A;  1RBO B;  4PAB A;  2XLJ A;  4IR1 A;  1C2P A;  1FVS A;  1FX4 A;  1SL0 A;  4K0K J;  4DCO B;  1HBU A;  4LRF A;  1IBM J;  4LF6 J;  4DU8 A;  2YX4 A;  3ILJ A;  2MZQ A;  4IKA A;  4RNH A;  3G8S A;  4JYA J;  2N3L A;  2OO4 A;  5G4D A;  3GJR B;  3FNN A;  5KFV A;  1N33 J;  1BQM B;  2IAJ A;  1PAE X;  1UEU A;  1ZS6 A;  4Q2M A;  3OXG A;  4DV0 J;  2QGF B;  4P7V A;  1J5O B;  1DQA A;  2ZBI A;  1FKA F;  1S49 A;  2MYF A;  2FHJ D;  3IFE A;  3KLI A;  1IKY A;  4CO2 A;  2FJX A;  1UJ5 A;  1WSV A;  2LEA A;  4F50 A;  4ZLN A;  1NUE A;  2WVB A;  1EET B;  4DN9 A;  1HWI A;  1LWE B;  1MU2 A;  3M2V A;  5LOQ A;  5GAD I;  1R43 A;  1ZA1 B;  3MM9 B;  3QNW B;  3RR7 A;  3KJF B;  1AYE A;  3I0S A;  2KKH A;  3RRH A;  1BQN A;  1LOU A;  5DQH A;  3H90 A;  2NYH A;  4IYQ A;  3SMZ A;  5KT6 A;  4B3S J;  2C3Y A;  2XY7 A;  3L3C A;  2AWZ A;  3PR5 B;  5BXI A;  4UUW A;  4J9R A;  3PW2 A;  2OH2 A;  3W3S A;  2QX0 A;  2V8H A;  1SB6 A;  1MLA A;  2WCX A;  4Z37 A;  4ZCK A;  2FZG B;  2KYX A;  3L7O A;  2C2M B;  3KJN B;  2R2S A;  3DXB A;  3J7A 1;  3A3O B;  4IH6 A;  3TX8 A;  4C98 A;  3HHN B;  1FVQ A;  2J0X A;  4RR5 A;  1HFE L;  3VQT A;  4J9U E;  3MEE A;  4J9L A;  1YSJ A;  1RI7 A;  3IGN A;  3D3B J;  3UCU P;  2M8H A;  4G65 A;  2HBR B;  2KXH A;  4WE1 A;  4C8Y A;  2YVS A;  1EAY C;  2XTJ P;  3FVY A;  5KT7 A;  1MSW D;  3TAP A;  1R7I A;  2P9G A;  2BW7 A;  4LUB A;  1ZPW X;  2IPO B;  3UDL A;  4B3R J;  1CVJ A;  4LBP A;  1JLQ A;  4Y65 A;  3CME S;  5KG7 A;  2E7X A;  1RTH A;  2B7B B;  2CDQ A;  3AB4 B;  4FXD A;  1M5P C;  1X4G A;  2ZD1 A;  3QIP A;  1T02 A;  4JV1 A;  1WHY A;  4LSN B;  2V8D A;  4DZD A;  4EBE A;  2H3E B;  3A3P B;  2HS4 A;  3JSM A;  5KFA A;  4C11 A;  5EDW A;  3QJP A;  5AXK A;  3VF0 B;  1PJ6 A;  2CQ4 A;  4B9S A;  2F8E X;  3Q8R B;  2UZA A;  4YB7 A;  4WPA A;  4C2M A;  1HQU B;  3PRB A;  3MMB B;  2LA6 A;  2W24 A;  2PO4 A;  3DDI A;  1RB0 A;  5J2N B;  5L1K A;  4K0K F;  2IY5 B;  2CPI A;  2I6W A;  5F9L A;  3FKB A;  2ZJP Q;  2J76 E;  2RQK A;  2KL8 A;  4I6A A;  2UUW A;  5ETS A;  3C8Y A;  1KR4 A;  2RDJ A;  1N33 F;  3OBI A;  4C8Z A;  2LMI A;  2G13 A;  2Y3Y A;  3QJL A;  2XHW A;  4PPD A;  4WJB A;  3MM6 A;  1APS A;  3HDS A;  1Q8K A;  2BVZ A;  3Q89 A;  1ICE B;  2F40 A;  5DZ6 A;  4U7U K;  5CYM A;  3GSI A;  4Y28 C;  3IBW A;  1U6Z A;  4CIO A;  3MFH A;  1QSS A;  4LFB J;  5CYQ B;  1NSK L;  2A18 A;  4OJ1 A;  1ZM2 A;  4ZPD A;  4LRD A;  3CJ0 A;  5J1P A;  2CNL B;  4DSE A;  1AXQ A;  2HFN A;  4LSL A;  1MMN A;  1RTJ B;  1FRH A;  1JLG A;  2MLX A;  2YQ0 A;  3E51 A;  4ZOS A;  5ETM A;  3Q22 A;  2AZ1 A;  2QV6 A;  4OV6 A;  4XO0 A;  3M32 B;  1I6J A;  2DNK A;  2W01 A;  1X7V A;  4EBD A;  3D6F B;  3CDA A;  1TKZ B;  3QGP A;  5E2Q A;  1UW4 A;  3EVO A;  5HN0 A;  2ERR A;  1YJW S;  3EXC X;  2F9J A;  3AQO A;  4AYB D;  4DV2 F;  1SPB P;  3L4B C;  3FBE A;  1HR0 J;  1UVL A;  4PUO B;  2CJY B;  3K17 A;  1FDD A;  1JLA A;  3MM5 A;  5B0A A;  3KG4 A;  1HQ2 A;  2ZM6 J;  2EI5 A;  4M8L A;  1SL2 A;  3BDE A;  3EE3 A;  3IR6 B;  1F9H A;  2LP4 A;  4QBU A;  5HRO A;  4IG3 B;  4RNN A;  2B4O A;  1L3V A;  2XSJ A;  4DX7 A;  1RCO B;  4DV0 F;  1N56 A;  4A46 A;  4LF5 J;  2PI4 A;  1S1V A;  4FKX A;  4FBU A;  4DR4 F;  4KY3 A;  4KIA A;  2IHR 1;  3JTN A;  3OL8 A;  4CT9 A;  4P73 A;  2Y8W A;  1WSR A;  1YGY A;  2GZO A;  1JK9 B;  1XQI A;  2KXF A;  4JUZ A;  3PR4 A;  3KLV A;  3RAX A;  2AD9 A;  4ALZ A;  4QU6 A;  2JNJ A;  4CO3 A;  2BUN A;  3DRS B;  4AD6 A;  1VQY A;  3S8S A;  4RUC A;  5LM7 E;  3BGR B;  3TJA A;  4F3M A;  3AOD A;  1SKS A;  2WSC C;  4P7T A;  1FKO A;  2QN6 B;  3TA1 A;  1WOO A;  2W2N P;  5HP1 B;  1QE1 B;  4I7F B;  5H9E J;  1AUD A;  2BDP A;  3FGV A;  2G0I A;  1HLW A;  2QMU B;  2ZVS A;  4LJM A;  4NLQ A;  4AE5 A;  1H72 C;  2J0Q D;  1BWE A;  1DRZ A;  5GME A;  1VQ6 S;  1DTQ A;  1UJ6 A;  3LP1 A;  4PXB A;  1UJ4 A;  4FYX B;  2CJB A;  4M63 A;  2MKY A;  2X7I A;  4PG6 A;  5KT4 A;  3I4P A;  1TL1 A;  5HL7 Q;  5J2Q A;  2I38 A;  5ETV A;  2VPX B;  1F9E B;  2VG5 A;  4L72 B;  3PDN A;  2ROG A;  1NB2 A;  4ENO A;  2J6S A;  1KTQ A;  2CQD A;  3LQV A;  5B09 A;  4MK9 A;  2BRK A;  4NYP A;  2XMW A;  1HYS B;  4ZVH A;  2WHO A;  3DFE A;  3TZX A;  3THT A;  1MG7 A;  3OL6 A;  3KLF A;  4YDX A;  1U0S A;  2E1C A;  2N7Y A;  2QLW A;  1Q79 A;  4DV5 J;  1VK8 A;  5FLX Y;  1S59 A;  3LPY A;  4Q2L A;  3HT0 A;  1YIJ S;  1KON A;  1S4E A;  2G9O A;  1YJV A;  4GVB B;  4PYA A;  3T19 A;  1DZ5 A;  5ETT A;  4WP3 A;  3W8P A;  5KFG A;  5F9N A;  1NK5 A;  1TL3 B;  1TKT B;  1DHM A;  4CLP A;  5AE2 A;  5ETQ A;  1IWG A;  4C3L A;  4X62 F;  4CYU A;  4DX6 A;  4K4Y A;  4DF8 A;  4OZ1 A;  5A8R B;  2M52 A;  3RB3 A;  4B3M J;  4OHY A;  5IM0 B;  1URN A;  1G1X A;  4K4V A;  2AP6 A;  3TAM B;  4K4W A;  3SEO A;  4DL4 A;  2D3Z A;  3DMJ A;  5E7O B;  1SIZ A;  5BR8 F;  1T05 B;  4A8Y A;  3MEE B;  4KKO A;  4F4Y A;  2R8K A;  4OHX A;  4QU7 A;  2CNK B;  2EEY A;  3T9Z A;  4DPT A;  4B9N A;  2VPW B;  4ECQ A;  1CEZ A;  2HS3 A;  2DRA A;  1CJU A;  1R6Y A;  3TQE A;  4MKA A;  1SC6 A;  3MMJ A;  3KJQ B;  2VDH A;  1ZA2 B;  4UOH A;  2FLL A;  2VG7 A;  3FSX A;  4IDK A;  3W2W B;  5E3P A;  1X5O A;  2MKS A;  1RT7 A;  5AXN A;  3I82 A;  2UVW A;  3GB0 A;  3DDK A;  4LF2 A;  1Q86 T;  4Z7Y A;  5CD4 A;  3PJ9 A;  2AJ0 A;  5D77 A;  2ZD1 B;  3GU0 A;  3QIP B;  4KYZ A;  3CCL S;  1AZS A;  2G2Y A;  4DOZ A;  3JSR A;  3GWC A;  3PO4 A;  7AT1 B;  2KTQ A;  2RF2 A;  3EIC A;  3M2R B;  3VAH A;  4IR9 A;  4W90 B;  3DC2 A;  3P96 A;  3DLK A;  2CPJ A;  3IP0 A;  1WKJ A;  2ZKU A;  1M90 T;  2CIM A;  3M8R A;  1D9F A;  2WRM A;  4DUY J;  1XMB A;  1PCA A;  4HI2 A;  1FFG B;  1HQU A;  1HWK A;  4I2Q B;  5T41 A;  1C0T A;  4Q44 A;  3EGW B;  2MKI A;  4ECS A;  1SQF A;  1WEY A;  4MKB A;  1T0T V;  3POT A;  4XTT A;  3SIP B;  5KFZ A;  4K4X A;  1ZM9 A;  2VV5 A;  2H1Y A;  2V2V A;  4USK A;  4OX8 A;  5THW A;  5MLC V;  4NXM J;  1P9Y A;  2VKR A;  4O44 A;  3A13 A;  2AEM A;  1SH3 A;  2VH7 A;  1S6Q A;  3PW7 A;  3W2V A;  1WHW A;  4CNY A;  2XCA A;  4HDG A;  1TV6 A;  2OEL A;  4FYV B;  3PHE A;  4YR0 A;  1NHK L;  4DCJ B;  2J0S D;  1HI8 A;  2EKN A;  2H54 B;  4OYA A;  4TQS A;  2DNG A;  3OFG A;  3W5Y A;  3KMQ A;  1UFK A;  3SYZ A;  2L9W A;  2HQI A;  2W2O P;  3ELH A;  4NLG A;  4ZS6 A;  3BYR A;  3BGU A;  4ZIW A;  4YDD B;  1U47 A;  4A8K A;  5SZT A;  1U1N A;  3DU6 A;  5E3A A;  1ZYQ A;  1TK5 A;  4O3S A;  2R7S A;  1DBD A;  3NOC A;  1FJG F;  3CC2 S;  4WYL A;  4YP3 A;  4CO4 A;  3ISN D;  2MKK A;  4PEO A;  3UWT A;  2A1B A;  4KFB B;  2FJW A;  3J7A N;  2PA8 D;  3BQ1 A;  3FFI A;  2YKN A;  4LF4 F;  1LQ9 A;  3MM5 B;  4C8M A;  2HW3 A;  1VBY A;  2JVR A;  3A8K A;  4CO1 A;  1WI8 A;  1NSP A;  2XYG B;  1IJF B;  2HIQ A;  3MMA A;  1JLC A;  4YFU A;  2OTL S;  2W2Q P;  3T5J A;  1U8S A;  3MF5 A;  3TA2 A;  3J81 U;  2QEX S;  4ZJO A;  2B5J B;  1GMU A;  2XMU A;  1X4A A;  2IC3 A;  3HUL A;  4DG1 A;  4CH1 A;  4LFC J;  1S6P B;  3UN3 A;  2GW8 A;  3M2U A;  1NLK L;  2J6U A;  1KKH A;  5D0R A;  5ETN A;  2HNZ B;  2C22 A;  5J1E A;  4BDP A;  2OPP A;  1IN0 A;  3BH7 B;  5HVF A;  3R7N B;  3QZ7 A;  5J2P A;  1ZM3 A;  3E8O A;  2IVF B;  3CCT A;  2V6A A;  5EX0 A;  1VQM S;  2V4J A;  4PCQ A;  2O5D A;  3AD8 C;  3ADA C;  3K2Y A;  5KG5 A;  3H98 A;  1VFJ A;  1FKO B;  1PYO B;  4GVL A;  1QE1 A;  2GFF A;  2PC6 A;  2V4R A;  4JI5 F;  2XLK A;  1CJV B;  4RW9 B;  4I67 A;  4L6V 3;  5A8W B;  2IA0 A;  3QFW A;  3UCG A;  1BC6 A;  1CPZ A;  3MAA B;  2ADC A;  4B9V A;  1DTQ B;  3H7H B;  3BF4 A;  4XK8 C;  3LP1 B;  4J9S A;  4F4W A;  4V19 J;  1P1T A;  3W9J A;  2OUG A;  2DO0 A;  5EWF A;  3CO9 A;  1UPM B;  1IWA A;  2IRX A;  5D4N A;  4C48 A;  3ISN C;  3CCQ S;  5KG1 A;  4H4O B;  4K2J A;  3ETM A;  4KB7 A;  1O8B A;  2E5H A;  1XN9 A;  1V5I B;  3GE9 A;  3L9Z A;  3ZTO A;  5A2Q Y;  1NJZ A;  2PGC A;  3FUY A;  5DLG A;  1FI4 A;  1WDD A;  2QLF B;  1T7P A;  3NNA A;  3NAI A;  3KUE A;  4NLP A;  4N56 A;  1C4A A;  2QE5 A;  2WAQ D;  4O3O A;  5KOW A;  5KOX A;  2ALY B;  3A8J A;  1UVM A;  2XY5 A;  5K8M A;  2HMI A;  2GML A;  3CSK A;  3KWM A;  1UWB A;  3W66 A;  2YWG A;  3C2P A;  1RWK B;  2WB4 A;  1SCJ B;  3QAE A;  1RT6 B;  3J7Z T;  1JIH A;  3G71 S;  2KI2 A;  4L76 A;  2Y1R I;  4WWS A;  2JLE A;  2ZJR Q;  2B8P A;  4USM A;  5LL6 d;  4YR3 A;  5K8O A;  1Z2Z A;  2D9O A;  3MEK A;  4ZN1 A;  2JVO A;  5CAA A;  3CUN A;  2AYB A;  4HDH A;  4HHH A;  4M5I A;  3OR1 B;  2F7V A;  5GAE U;  4HI1 A;  1YK9 A;  4ZA1 A;  5MAO A;  1V3S A;  3PW4 A;  2J7U A;  2LXF A;  4UOC A;  2IYI A;  1JXL A;  3IC1 A;  3ENA A;  9ATC B;  1U1K A;  2EFN A;  1K0V A;  3BH6 B;  2XS7 A;  1F2G A;  4AT1 B;  2UUA F;  3QBC A;  4KKO B;  4N47 A;  2B0G A;  3B8H A;  4YB1 P;  2V68 A;  3CTR A;  1T9V A;  3D6T B;  4WZQ A;  3BKU A;  3BBB A;  3JQM A;  1T95 A;  1AA1 B;  1FRM A;  3CJ4 A;  2ZOF A;  2AIR B;  5IOL A;  2VUG A;  2E1P A;  2DNZ A;  2XI2 A;  3OQ2 A;  3NGU A;  4ILR A;  3HVR A;  2OPQ A;  1BE4 A;  1J5O A;  3JAM U;  1RT7 B;  4PQA A;  3J7Y I;  4MKY A;  4JI6 J;  3TAR A;  3MUV P;  3TEH B;  3WIU A;  1KWM A;  3RZA A;  2QTW A;  3TO8 A;  3M1V B;  2W9B A;  3KLH B;  4I56 A;  2AJQ A;  2AJ2 A;  1BQX A;  2J9D A;  1RDR A;  2ZH4 A;  1X9W A;  1VC0 A;  4PQU A;  4NZ0 A;  3LGN A;  4MMO A;  2HND B;  2GJI A;  1MW7 A;  1XWL A;  4NMX A;  1C1C A;  3CJ3 A;  5K8N A;  3MFI A;  4DSF A;  2BQU A;  2JSX A;  2VPY B;  5KFI A;  1KN6 A;  2WOM B;  1VQ8 S;  5B0F A;  1ZTW A;  1TUG B;  4MTP A;  4G1Q B;  3AY0 A;  3OXF A;  1TK0 A;  1FE0 A;  3H2U B;  3PEH A;  4NL5 A;  4EWT A;  2AJ4 A;  1G6B A;  5IV3 A;  2DPI A;  2YBV A;  1RTZ A;  1IBC B;  4JB8 B;  4NCG A;  2CQG A;  2OPS B;  1REG X;  3IG1 B;  4J9Q A;  2YWH A;  3D4J A;  2BAB A;  1H2V Z;  3ZXW A;  1MWY A;  1TVR B;  2BJ8 A;  1LW0 B;  1RAI B;  4PG5 A;  5IWA J;  2MJU A;  1SKR A;  1URR A;  4WP9 A;  5BYQ A;  5AJ3 J;  1D8Z A;  4URQ U;  5I42 A;  2VG6 B;  1NZA A;  3BB5 A;  1MRO B;  5EUH A;  3QRR A;  3R5C A;  1YQH A;  2KVQ E;  1C0U A;  2FTR A;  3AXK A;  3B4M A;  3BN4 A;  3R7B B;  5LMU F;  4Q0B B;  2LDI A;  4RW7 A;  3OUY A;  2V4Q A;  1O5J A;  3G4S S;  1UVK A;  2VU5 A;  1NKB A;  4P71 A;  3UN5 A;  5HVG A;  2MKH A;  1EHW A;  1NPK A;  3ILI A;  3JSM B;  4AQY F;  3NXZ A;  3MAH A;  3ENQ A;  4ZDN A;  1NKE A;  2E9Z A;  1GQE A;  2K1R B;  3E3X A;  4DJB A;  1KHW A;  2DD8 S;  3M30 A;  4PWD B;  1AFI A;  2KXN B;  4QWE A;  4NA1 A;  1M1K T;  2M5Y A;  4DR5 F;  3TAQ A;  3ZZU A;  2POK A;  3NY0 A;  5DM7 Q;  3L7P A;  3SFG A;  5B7W A;  3D1Q A;  3FEZ A;  3CC4 S;  2CQ2 A;  3HVW A;  1GX6 A;  4J37 A;  3ZZT A;  2IC3 B;  4Y2K A;  4USH A;  4ZLL A;  1K44 A;  1S6P A;  3WX4 A;  1CS4 B;  1CSJ A;  2ZNZ A;  1HA1 A;  2H5I B;  1QY7 A;  2QFI A;  4OLO A;  5F0U A;  3AOB A;  1HNZ F;  4X84 A;  1MNE A;  5J1E B;  1RLC L;  3CCZ A;  2YH0 A;  4ED3 A;  4RO0 A;  1LV5 A;  5J2P B;  4J9O A;  3MCN A;  2KO1 A;  2BKN A;  2GMH A;  2R7W A;  1A7G E;  2W8L A;  1RHK B;  4F4A A;  1VRQ C;  4DL7 A;  2I8E A;  2Z0G A;  2Y1J A;  4BC7 A;  3MPD A;  1NB7 A;  1VQ5 S;  1MU2 B;  2UU9 J;  3GLJ A;  2EVZ A;  1V5V A;  1TUV A;  1IKX B;  1MN9 A;  2BJ1 A;  3I0S B;  5I3P A;  2D3O R;  5HJX A;  5C5J A;  1HIY A;  4DEZ A;  2HUR A;  1X9M A;  3MGJ A;  3OVB A;  4EK2 A;  2G0J A;  2V69 A;  2VFT A;  1KP6 A;  3NGD A;  5ETP A;  3FMW A;  3IR5 B;  1LFP A;  3MD1 A;  3H4B A;  4CLF A;  2R7U A;  2JC1 A;  1IBK F;  1R0B G;  5AE3 A;  3EGZ A;  3G2X A;  1FWL A;  3MPW A;  1WG4 A;  1B64 A;  2D3U A;  2X3G A;  2BM0 A;  3M8Q A;  4H4O A;  1PJ7 A;  4Y2M A;  3K5N A;  3S01 A;  4A8Q A;  2CPY A;  4C3M A;  3K5M A;  1JWW A;  2OLW A;  4DHV A;  3GTY X;  1P1L A;  4ECU A;  4JI3 J;  2ZHA A;  4FF4 A;  1N36 J;  4TNO A;  2HFS A;  1KOO A;  4MIW A;  2OFH X;  1LXN A;  1V9O A;  3VVT A;  2YWK A;  4QWA A;  5DLF A;  1YTY A;  3A12 A;  2DR9 A;  2W4D A;  3F0N A;  1IR0 A;  3KK1 A;  4CZC A;  1QJH A;  1H6K X;  1MML A;  4OX9 J;  1JNZ B;  4NCB A;  1JLE A;  2G1D A;  2Z2L A;  3EZU A;  2R7V A;  2OAU A;  3K8V A;  4AFF A;  5F8G A;  3CCR S;  4LMZ A;  2M70 A;  2WW4 A;  3DRS A;  3CF5 Q;  3EGN A;  1N5Q A;  4Y0F A;  3WBZ A;  4DL2 A;  2MHE A;  4F4X A;  1SC4 B;  4B3O A;  1FRL A;  2RML A;  1N6Q A;  4C11 B;  3MI7 X;  4IG0 B;  1FXR A;  1XK8 A;  3D0H E;  1Q0N A;  3T5L A;  2D7S A;  4CWB A;  4RUA A;  2QYG A;  1JMT A;  4ES2 A;  1XMQ F;  4ZN3 A;  3HHL D;  1FHT A;  2VDI A;  5FLX U;  1F6T A;  4A4J A;  1VR6 A;  2ZNY A;  3OPK A;  1FEH A;  3B4D A;  2FHJ A;  5KFY A;  3PKY A;  5J2Q B;  1OWX A;  4PG4 A;  1IKW B;  4QIW D;  4EMD A;  5C25 A;  2HGL A;  3DLL Q;  1NBE B;  1MN7 A;  1Y3J A;  1U8W A;  2HFZ A;  2WB1 D;  1UVI A;  4TU9 A;  5A2Q U;  2XI3 A;  2BW2 A;  2OGU A;  1RT2 B;  5AJ3 F;  2P2C B;  3MR6 A;  2ZH8 A;  4LF5 F;  2CPF A;  2FJD B;  4A8F A;  3W65 A;  2DRB A;  1FRK A;  3C19 A;  2Z4P A;  4D3H A;  2EBE A;  2Y0S D;  5LMU J;  1RAG B;  4USW A;  1SQE A;  1U48 A;  3G6V A;  2HQF A;  2HND A;  4AXI A;  2F65 A;  3M8Z A;  2HPU A;  4KQZ A;  2L08 A;  3A8E A;  2UXC J;  1RTJ A;  3BSO A;  4C97 A;  4CYU B;  1NKC A;  4L74 A;  3TRG A;  3ZZ0 A;  5IXU A;  4GMK A;  3LWL A;  4DUZ F;  2JEI A;  3EDQ B;  1JXV A;  1F3V A;  4KH0 B;  1EP4 A;  3DM2 A;  2CQ0 A;  3MTJ A;  1OSD A;  1NRK A;  3IM9 A;  2L48 A;  2JOQ A;  3FZ2 A;  5GAG I;  3H5X A;  1FEE A;  3OSN A;  4PUO A;  2KZM A;  2KB2 A;  3SCJ E;  1FKP A;  4PG7 A;  1L5U A;  2DPJ A;  1REV A;  2I5J A;  4DV3 J;  5K9F A;  3AFG A;  4IG3 A;  3ILL A;  4WXO A;  4TY9 A;  5CAB A;  1U0H B;  4ERD A;  4HH1 A;  1QVG R;  5ADZ A;  1H38 A;  4Q8E A;  3FZB A;  4JV5 J;  4DV5 F;  4UW2 A;  1B0T A;  2F4F A;  3T9N A;  3CT9 A;  2D1C A;  3D28 A;  2NZ4 A;  1VLO A;  4CO0 A;  2YNH A;  3DYA A;  1ULR A;  5F8J A;  1VLY A;  4DCP B;  2AJF E;  2FHO B;  2Y1L B;  3CO0 P;  3AA8 A;  3UE2 A;  3LOU A;  1U1P A;  3SQG A;  4NCA A;  2RNE A;  1D9A A;  4QOT A;  2RF2 B;  3M2R A;  3DHX A;  5KFX A;  1S9E B;  4PWD A;  2GHV C;  3FQL A;  5AXL A;  2AU0 A;  1NH7 A;  2DH9 A;  4OZL A;  4IOC Q;  4YUD A;  1TL5 A;  2IJR A;  1OJ4 A;  3JSB A;  4F2R A;  3CDW A;  4WTO B;  1Q78 A;  1XMQ J;  4OJG A;  3EYZ A;  1BGX T;  5GAD U;  5GVQ A;  2RD5 C;  6FD1 A;  3EPG A;  1TL1 B;  3PG9 A;  4OI4 A;  2BAC A;  3RB4 A;  2FJB B;  4LIR A;  3ULH A;  3RGI A;  3MR5 A;  2E1A A;  3KHR A;  4O44 B;  5KAK A;  2HFO A;  4HT5 A;  4ZKA A;  3TAN A;  4QCL A;  1P8G A;  3CDB A;  4U6P A;  1HYS A;  3OTB A;  2F3J A;  5B0E A;  1TV6 B;  4F0H A;  1R89 A;  1CBK A;  2E9R X;  3HSZ A;  2DNQ A;  1N5T A;  1WC6 A;  3P49 B;  2C2D A;  1OSC A;  2DB1 A;  1VRU A;  3ITH B;  4PPZ A;  1SUQ A;  4K59 A;  3EPI A;  1SJ3 P;  1XIQ A;  3AQP A;  3NL0 A;  3MD3 A;  4GVB A;  4ECY A;  4K50 A;  1IKX A;  4DSI A;  4JI8 J;  2FGC A;  1T11 A;  1Y9O A;  1N5V A;  2RE1 A;  5KFS A;  4DQP A;  2ILY A;  1Q53 A;  2ZFH A;  2X51 A;  4R0E A;  1I94 F;  1TL3 A;  2DGT A;  3KTQ A;  3NMA A;  4WIQ A;  4ZVF A;  1HI1 A;  2E1M C;  2WVC A;  2XMM A;  4DFM A;  4AQY J;  1HD1 A;  3ET6 A;  4NZ7 A;  4NXN F;  2A6M A;  2KU7 A;  2DGQ A;  2EFV A;  4DUY F;  5KFT A;  4G1P A;  5IM0 A;  4HAC A;  3BGL A;  2ZH5 A;  2U2F A;  3HVT A;  4I68 A;  3TAM A;  3R9L A;  2KM8 B;  2HBQ B;  2LXU A;  2WVE A;  2V50 A;  3D67 A;  1HWL A;  4ZP6 A;  2YKN B;  3ZZR A;  1VHI A;  2OEJ A;  4BWM A;  4ECW A;  4B9M A;  2HIY A;  2BA9 A;  4LF9 F;  1ZZF A;  4NLO A;  3SV4 A;  2LEP A;  4X4T A;  3RG6 A;  1UEK A;  3HVA A;  2GJ2 A;  4DSL A;  1PYT A;  4QQB A;  4L73 A;  3KLG B;  2QA4 S;  4JI1 J;  3D6H B;  1FJC A;  3AH6 A;  4HHJ A;  3CD7 A;  3RTV A;  4DG1 B;  5EN1 A;  3CJ2 A;  4UUX A;  2VC0 A;  3UVJ B;  1TZ0 A;  1XER A;  4C8N A;  2EK6 A;  2IVM A;  2XBP A;  2P9C A;  3F56 A;  3W2W A;  4LR7 A;  4DQQ A;  1EIY B;  2NYI A;  1H0H B;  3Q2T C;  1FES A;  4DQS A;  3I5A A;  1XNQ F;  5IV4 A;  2CXE A;  4HH0 A;  5D4P A;  2L9N A;  3B6B A;  3MDF A;  4OI3 A;  2LXI A;  1M1H A;  1RWP B;  4XPE A;  3H5Y A;  3V81 B;  1RAC B;  1RT1 B;  3QAT A;  3HKZ D;  3VZI A;  2PI5 A;  2NQP A;  3NOG A;  3CJT A;  2KN4 A;  2BJ7 A;  3DLK B;  2GJF A;  3MAQ A;  4ECT A;  1K9M T;  4F0M A;  1YJR A;  3GYN A;  1F60 B;  4I2Q A;  3C15 A;  3WZ0 A;  5A8K A;  1UET A;  1HHT P;  4ES3 A;  2XY6 A;  5CZV A;  2VL1 A;  2ILZ A;  1YBT A;  1T9W A;  4UQT A;  1B0V A;  1I51 B;  3MOJ B;  3O6Q A;  2W2M P;  4MK8 A;  2C3O A;  1RT2 A;  4LRA A;  1QUV A;  5DQG A;  2CZ9 A;  4NOH A;  1L3S A;  1UFW A;  1K1Q A;  3EZ5 A;  4F0K A;  2WVD A;  3MCO A;  4YY3 F;  2XG8 A;  3MEC A;  4JI2 J;  2VOP A;  2HGM A;  5L38 A;  1UWB B;  3QQC D;  3ZFV A;  3BPS P;  1FCA A;  4ANE A;  4RNF A;  2R7X A;  2M0G B;  2AX0 A;  2ZHO A;  3MZI A;  3CMA S;  1UAW A;  3CW2 C;  2MB0 B;  1JJ4 A;  3H42 A;  3FCW A;  1D0E A;  1HNW F;  3IO1 A;  3PX4 A;  3QSY B;  3W8G A;  4J90 A;  1GNK A;  1GAO A;  3N6M A;  4IH7 A;  1RWM B;  1BY9 A;  4X65 F;  3EX7 B;  3DM2 B;  4J91 A;  1X9S A;  4C8O A;  3GPA A;  3M9N B;  4ILM A;  2HVZ A;  4HHU A;  2MZS A;  2ZBP A;  3IMQ J;  3NGT A;  1ITP A;  2HHT A;  1RWX B;  5KFJ A;  1QM9 A;  5FDL A;  3DCA A;  5T7L A;  5C24 B;  1FKP B;  2V34 A;  4IRD A;  1M5H A;  1REV B;  5DG9 A;  2ZWO A;  2VJV A;  1QAX A;  4I4B A;  4P75 A;  2Q66 A;  2F5G A;  4CLU A;  3EZO A;  3G9C A;  4F04 B;  3H2V E;  1K8A T;  4UY8 5;  5SUH A;  5D0G A;  4RUB A;  3IS9 B;  3KHL A;  4F25 A;  4M5N A;  2HNZ A;  2DNP A;  2YNH B;  3AJ2 A;  1DLO B;  3AHP A;  3DYA B;  3NWG A;  2WON A;  4OJH A;  4WFX A;  3T1A A;  2I1R A;  1MWQ A;  2RRA A;  4OLP A;  4DPX A;  5F8I A;  3S6E A;  4CH0 S;  1PKU A;  2W2P P;  5ETK A;  1I94 J;  1FX2 A;  4MH8 A;  4JI5 J;  3ENW A;  2UXC F;  3LAN A;  3OV7 A;  1FFS B;  4LT6 A;  4UTG A;  2JEG A;  4DBQ A;  1CJV A;  3QT6 A;  2HSE B;  1SC1 B;  2WOM A;  4RW9 A;  5KFR A;  3NMR A;  2W7A A;  3OTO J;  3CD5 A;  3ZTR A;  1RTD B;  1H73 A;  5C42 B;  3VHQ A;  2V9K A;  2LQB A;  4FZV A;  2VB6 A;  4PYD A;  5DGA A;  4O4G A;  2CG4 A;  2UP1 A;  3DLE A;  3TVK A;  1VOM A;  2A2C A;  3VAG A;  2BJD A;  2HNY A;  1R8A A;  2XWY A;  5GMD A;  1GX5 A;  3T41 A;  4PG8 A;  3G8T A;  4A8W A;  2EFQ A;  4JI1 F;  1U1M A;  1VBZ A;  2N4C A;  1IKV A;  2NZC A;  3G82 A;  3PJW A;  4ZPV R;  5G0R B;  4PKD B;  4C3K A;  1CQN A;  4CLL A;  3GZ7 A;  4JV2 A;  3SDE A;  3JYT B;  3G8Q A;  1HBO B;  1FF2 A;  1GMW D;  2YWE A;  4OZN A;  1PSD A;  4TYA A;  1SUQ B;  1SIW B;  5I42 B;  4R8U A;  3P6Y C;  1ROF A;  2OJ3 A;  2AV5 A;  3MUT P;  3TW0 A;  1C0U B;  2F63 A;  3CCV S;  1VC5 A;  4Q0B A;  4ZVT B;  4DR2 F;  3DOM B;  4K4S A;  3BBF A;  2C28 A;  4CRJ A;  2XGP A;  3RYL A;  1ZM4 A;  2RH3 A;  5HJY A;  4YHH J;  2R8H A;  1QSL A;  1WTF A;  2G1H A;  2KDO A;  3QMQ A;  3RRK A;  4OIX A;  1W25 A;  1NCL A;  4EI2 A;  2GAG C;  2N7C A;  3SI8 A;  3K5L A;  2W4C A;  3TUJ C;  2N3O A;  3GSD A;  3HVT B;  8RUC A;  2FVS A;  1F3F A;  4DV1 F;  1ZZN A;  1YZ6 A;  3QGH A;  3MXH P;  1S0O A;  4FN5 A;  3U1M A;  5BYR A;  4PXC A;  3W60 A;  4DL5 A;  9RUB A;  3LF0 A;  5EX3 A;  3KK3 B;  4G3I A;  3P5T L;  5ETO A;  1XR6 A;  3GJQ B;  4IFY B;  4NYZ A;  2CFX A;  4C6A A;  3QRQ A;  2HHX A;  3GQC A;  2JJ4 D;  2CA9 A;  1XMO J;  5D3G B;  3QLH B;  1VQN S;  3US5 A;  3MOZ A;  2BR0 A;  2WZ1 A;  3PY8 A;  2X1A A;  1WDT A;  1KDN A;  5ETL A;  2KZZ A;  2ZDO A;  2BAN B;  4OYZ A;  5HMX A;  2JX2 A;  3NCP A;  3M1V A;  3Q24 A;  4WK3 A;  5CQG A;  1B3T A;  2I0X A;  4ZPW R;  3VGV A;  1HNX F;  2IDE A;  2QT7 A;  1KFD A;  1WHX A;  2XNQ A;  3FBB A;  3KDN A;  4IQM A;  3QRP A;  4QYZ K;  1D3W A;  1YBU A;  4ICL A;  5B08 A;  3PJX A;  4BHQ A;  4W4M A;  1LW2 A;  1S1U B;  5B0B A;  3HF5 A;  4HTI A;  4IFV B;  4NWB A;  4DI6 A;  1ZH5 A;  3QAU A;  4O3Q A;  2MZJ A;  1X5S A;  3GJT B;  1V3R A;  1WOR A;  4KGM A;  5LSR A;  1RAF B;  4CP5 A;  2K7J A;  3GIJ A;  4DR5 J;  5D0H A;  4M5H A;  4B9L A;  1BUX A;  3SSS A;  2H51 B;  3M8S A;  1Z2L A;  2HFV A;  1U1Q A;  4RW8 A;  3THV A;  2QL5 B;  4A8X A;  4DR1 J;  1TR0 A;  1TVR A;  4QIE A;  5IS2 A;  3DOK B;  1WUU A;  3C6T B;  3PYF A;  2R7R A;  2AX1 A;  2QLX A;  2LQ9 A;  1WOP A;  1GEH A;  1HD0 A;  2HKE A;  1RBA A;  1KQG B;  1EAR A;  4RLE A;  4ZP7 A;  3KK1 B;  1XBW A;  4R5P B;  3H40 A;  1RCX B;  4ZPC A;  2VAS A;  2QJ3 A;  4ECX A;  1RXO B;  1L3K A;  2VQE F;  4NLR A;  5ETR A;  2AYG A;  3F44 A;  3HK2 A;  2GVD A;  2PSZ A;  3AXM A;  1RAJ A;  5LJ5 Y;  4CTA B;  2X1F A;  3TVZ A;  4M5D B;  3FDS A;  2AEJ A;  3S7R A;  4YR2 A;  1EX8 A;  4PWW A;  3G6X A;  3M8P B;  2HWT A;  1L3T A;  3HHE A;  2FY1 A;  4B3O B;  4CDI A;  5LJ3 Y;  1WJ9 A;  2FDN A;  5CD4 H;  1N6Q B;  1Y3K A;  4FXW A;  3DNC A;  1WF2 A;  3EVM A;  2LEC A;  1B4S A;  5EWE A;  5T7L B;  2PMH A;  4X64 F;  1T3O A;  5KG3 A;  4M95 A;  2FJE B;  2IM1 A;  3DU5 A;  3NRB A;  2B9Y A;  3J80 U;  4ED0 A;  1WC1 A;  3DGV A;  4NLS A;  3VAK A;  2IJN A;  5KFN A;  1VIX A;  3BQ2 A;  1UEV A;  3GJS B;  1N36 F;  1SJ4 P;  5C25 B;  2HLU A;  3CJR A;  1FE4 A;  1X4C A;  3NBP A;  2W4P A;  3K8W A;  2F1F A;  3FQK A;  1S1X A;  5FD1 A;  3RUB L;  2KG0 A;  1XMO F;  4W92 B;  1PBU A;  2F9D A;  2ZOM A;  1S7H A;  1YDL A;  3IS9 A;  4YY3 J;  3UPF A;  4EZ9 A;  3CED A;  1NDK A;  2NLW A;  1HL6 A;  3HFV A;  2KVI A;  4WK1 A;  1OMS A;  4KV8 B;  5H1S V;  3TJ8 A;  2ZZT A;  1RA6 A;  1I1G A;  1RQ0 A;  1DAX A;  1HBM A;  2IRY A;  2O67 A;  2XZW A;  4DR2 J;  2COL A;  2MKC A;  2JL9 A;  4AND A;  4ETX A;  4ZJQ A;  1JX4 A;  3GV5 B;  4C8L A;  3E2E A;  2GCF A;  4OJ3 A;  5I4M A;  1TUW A;  2MPU A;  1HNI A;  3MPV A;  5LXY A;  4PRF A;  4B3M F;  4ER8 A;  5K14 B;  5K8P A;  5EWG A;  2MGZ A;  4MYU A;  1WEL A;  2DGU A;  2C2N A;  2G2O A;  3N6L A;  3OTE A;  3PYE A;  2ZH1 A;  4QYR A;  1TAU A;  1CLF A;  1UVJ A;  1YG0 A;  2XMJ A;  3VV2 B;  4TU8 A;  1TMM A;  2OKQ A;  3BRE A;  4IRC A;  1NHU A;  5D8H B;  2MQL A;  2DHA A;  5KG6 A;  5DGB A;  1RTI A;  1JKH A;  2ABY A;  1VQL S;  2DXF A;  3T5H A;  2DTJ A;  4DFK A;  1FTC A;  2DNN A;  2YX1 A;  1UPP A;  4ZVR B;  4RBU A;  3I4H X;  1DQ8 A;  3E01 A;  3PV8 A;  2EFG A;  3KHH A;  3GMG A;  4ZVO B;  3MM8 B;  5GAE I;  4P10 A;  1Q81 T;  3CDE A;  3R27 A;  3NWR A;  1XEZ A;  4I6Y A;  2PII A;  1S1W B;  1FD8 A;  3K5P A;  4ETZ A;  5C2C A;  3OFF A;  2KT5 A;  3ICL A;  2XMK A;  1SH0 A;  2D74 B;  3NGS A;  2X1G A;  1FDB A;  2Z2Z A;  4OHZ A;  2DNL A;  2RQC A;  3ONQ A;  4M1K A;  3FC9 A;  3RAM A;  2FY8 A;  4HVZ A;  2NRE A;  1CQM A;  1HNX J;  4B9T A;  2CJ9 A;  1E6V A;  3DRR A;  1K0T A;  1YRT A;  4F3O A;  2ASD A;  2MSS A;  4ZVG A;  1DJ0 A;  3TUI C;  4RBT A;  1IQT A;  4DF4 A;  1X8D A;  2ALZ A;  2RUS A;  1QSY A;  5KFH A;  2O01 C;  5DDO C;  3OVS A;  1Q4R A;  3QT5 A;  4IG0 A;  4LRB A;  4NI2 A;  4RWX A;  1QTN B;  3VGT A;  5E41 A;  3OTO F;  2JEJ A;  2Y8Y A;  1RAD B;  2FGO A;  3UD4 P;  3FCV A;  1D09 B;  3DKD A;  3OD2 A;  3KMS A;  1C4C A;  1RBL A;  1RHU B;  2DNR A;  1M1G A;  5AE1 A;  2IBO A;  3D0I E;  1HBU B;  2HK2 A;  3HSJ A;  3SSQ A;  5EHH A;  2VJU A;  2YKP A;  1SJF A;  2AF6 A;  5CXT A;  2K06 A;  2MKJ A;  2ZUA A;  3LO3 A;  2RHQ B;  1HW9 A;  4MIA A;  2MDA A;  3OT9 A;  3QSI A;  1IKW A;  4ZPB A;  3MUM P;  1G4C A;  1UA0 A;  4P2S A;  1KLM A;  3M8Y A;  4JBC A;  3U7J A;  4MAK A;  2K7K A;  2IBK A;  2CKW A;  3KLI B;  3PTW A;  4X4Q A;  4NYO A;  5DS7 A;  2FJV A;  2CNN B;  3AT1 B;  1VRU B;  1TK8 A;  4DXL A;  4KGZ B;  4DSJ A;  4DWI A;  1U2F A;  2JLG A;  3MM9 A;  4ED8 A;  4UQG A;  1VIS A;  3RB0 A;  2NPF A;  3BV8 A;  5IZH A;  4OQJ A;  4TU7 A;  4BCA A;  4ANC A;  3U02 A;  1KQK A;  5DG8 A;  2D69 A;  3VAM A;  1IBK J;  3ET6 B;  1XNQ J;  2Z56 B;  3O2I A;  3PYG A;  2AGP A;  4ELT A;  2R2R A;  3SBM A;  3MEG A;  3D9B A;  3P5B P;  4FDF A;  3I9V 9;  2J7K A;  2ZIT A;  5LMN F;  3UN2 A;  4EO8 A;  1VJW A;  4IOA Q;  4OL8 A;  4N7T A;  3OJS A;  2DK2 A;  4O4R A;  5A0Y A;  3KYL A;  4DV3 F;  3DDN A;  2VZ9 A;  4JV5 F;  4X4S A;  1LNQ A;  4KT0 C;  4JI0 J;  2RJZ A;  4N41 A;  3UW1 A;  4R5P A;  2CPH A;  2CZ4 A;  4JOU A;  4K7Q A;  3BKF A;  5HSP A;  1WC3 A;  4LFA F;  2PFF B;  1RWW B;  1PO6 A;  4DDF A;  4ITS A;  1NK4 A;  1TFW A;  2OTJ S;  1N54 B;  1RTH B;  4JI8 F;  1U1L A;  4DLE A;  4J9V A;  1SJ1 A;  4DR6 F;  4F4Z A;  1YIT S;  5GAH I;  4MFB A;  1N5S A;  2EXU A;  2R8I A;  3P45 B;  4EO6 A;  4C0H A;  4NAS A;  2W7P A;  4OZ5 A;  1S9E A;  2OSR A;  2WBR A;  3ISZ A;  1HWU A;  1OYD A;  5KFW A;  1N0U A;  4NX9 A;  2RU9 A;  1TMJ A;  1EQ0 A;  2CPD A;  1KQF B;  3IM8 A;  2DGO A;  1NPP A;  4H4K C;  3C15 B;  1FJE B;  3V2U C;  5J2N A;  5KT3 A;  4TVA B;  4ZPA A;  4DUT A;  2HWH A;  1Q5Y A;  3TYT A;  1XR5 A;  3BJY A;  1NK0 A;  1F5C A;  4KSE B;  1YJT A;  1FWK A;  1WC5 A;  4IO9 Q;  4ZIV A;  3PYD A;  4N76 A;  3CJ5 A;  2H5J B;  4O0N A;  2DR8 A;  4KGK A;  1J27 A;  1Y10 A;  3BM7 A;  5L9N A;  3ZNU A;  3MEC B;  1S5Z A;  3PHT A;  1HMV A;  1Q95 G;  3WQP A;  2MY7 A;  2HFU A;  3JSY A;  4UOG A;  1RP5 A;  2FHM A;  2V8V A;  2IJF A;  3GFY A;  3LP0 A;  1CJK B;  4ZVQ B;  4NLX A;  3BO3 A;  5DG7 A;  1CG2 A;  2YPY A;  3U27 A;  1NSA A;  1M5O C;  4D3G A;  3EVW A;  4UY8 T;  4DUZ J;  3OHB A;  2HRT A;  4P6Q A;  3NKY A;  5CCL A;  4RKU C;  4M94 A;  4X2B A;  4EYH B;  1TKZ A;  3LUY A;  5KFM A;  2UUA J;  2ZZN A;  4P52 A;  1FNO A;  4DX5 A;  1JKH B;  4X64 J;  1WAC A;  2KJV A;  2W1B A;  3W5X A;  2XUL A;  4UF4 A;  2E5G A;  5L39 A;  4J9M A;  5FDL B;  4RL1 A;  4BS2 A;  4LIW A;  1RKJ A;  4OYW A;  1VIO A;  4B02 A;  3MM8 A;  5GAH U;  1Y5N B;  4O0I A;  3KHG A;  4HYK A;  2GS8 A;  5HLF B;  2XSJ B;  4F02 A;  3MUR P;  2C3P A;  3CPW R;  4Q7A A;  4P72 A;  4JI6 F;  2LQ5 A;  2YNI A;  3D3C J;  4J7C A;  4KE5 A;  1IBL J;  2QA2 A;  1U4B A;  4B3R F;  3DLB A;  2UXB F;  1X4H A;  2PA3 A;  1SQG A;  1TL4 A;  1XJW B;  3DHW C;  1DLO A;  4H4M A;  5JXS A;  4P2F A;  2WON B;  3TA0 A;  4DPO A;  1IVZ A;  2DBB A;  4ED2 A;  1GXU A;  1HNW J;  4OI2 A;  3CVK A;  3SSR A;  2DNH A;  1I5O B;  2OD6 A;  3K58 A;  3NP5 A;  3QJJ A;  4OZJ A;  2EG1 A;  2WTF A;  3G86 A;  1UA1 A;  2CQH A;  4NI2 B;  3O1L A;  1R8B A;  1W26 A;  3NS7 B;  4XIU A;  3UDV A;  2GAH C;  4EUV A;  1IXK A;  4ED5 A;  4E98 A;  2PMW A;  5C42 A;  3CCJ S;  2SXL A;  5A6P A;  3Q8Y A;  1RHQ B;  1S6O A;  1TEL A;  4O4G B;  5DDQ C;  3DLE B;  2UUB J;  1W2I A;  2YH1 A;  2VHG A;  3Q8U A;  1KLM B;  2ZVI A;  3ZZP A;  3W9H A;  4UOF A;  2QA4 G;  1Y00 A;  1IKY B;  2MZR A;  1SH2 A;  2M8D B;  4MKV A;  2QRR A; 
#chains in the Genus database with same CATH homology
 3ENA A;  3EVM A;  3BH6 B;  3EIC A;  1BHN A;  1B4S A;  1WKJ A;  1NSK L;  1XIQ A;  3ZTQ A;  3VVT A;  3BBB A;  3ZTR A;  5IOL A;  2AZ1 A;  3NGU A;  3BBC A;  1BE4 A;  4HR2 A;  1S57 A;  2AZ3 A;  1NDC A;  3EVO A;  3VGU A;  3R9L A;  1NDK A;  3Q8V A;  1W7W A;  3FBE A;  4F36 A;  1NHK L;  3EE3 A;  4AND A;  1HHQ A;  3Q83 A;  1F6T A;  1NSQ A;  3ELH A;  3L7U A;  4FKX A;  3EM1 A;  3JS9 A;  4DUT A;  3BBF A;  3PRV A;  1PAE X;  1MN7 A;  1ZS6 A;  1U8W A;  3EJM A;  1XQI A;  1NCL A;  2DXF A;  4W98 A;  4S0M A;  4O0N A;  5C7P A;  3B6B A;  1F3F A;  1NUE A;  1UCN A;  2HVE A;  4KPC A;  1S5Z A;  3FBF A;  1NSP A;  1HLW A;  4UOG A;  3ZTS A;  4C6A A;  2NCK L;  2CWK A;  3NGS A;  3EVW A;  1LWX A;  1VYA A;  3FC9 A;  5BXI A;  1NLK L;  1B99 A;  2VU5 A;  1JXV A;  1NB2 A;  4DZ6 A;  4ENO A;  3BH7 B;  1KDN A;  2B8Q A;  1EHW A;  1NPK A;  2DXD A;  2BX6 A;  1WKL A;  3VGS A;  3B54 A;  3VGV A;  3VGT A;  2HVD A;  1S59 A;  3FBB A;  3FCV A;  4ANE A;  3DKD A;  3ZTP A;  2BEF A;  5CAB A;  4FKY A;  1NDP A;  4DI6 A;  3FCW A;  2ZUA A;  1NDL A;  3WX8 A;  2DYA A;  4WBF A;  1K44 A;  4CP5 A;  3ETM A;  1BUX A;  3NGR A;  3VVU A;  3ZTO A;  3Q86 A;  3GPA A;  3NGT A;  4F4A A;  3GP9 A;  3MPD A;  3FBC A;  1MN9 A;  2DXE A;  1WKK A;  1HIY A;  2DY9 A;  2HUR A;  3EMT A;  4EK2 A;  3DDI A;  4ANC A;  4UOH A;  2B8P A;  3FKB A;  3Q8Y A;  1LEO A;  5CAA A;  3G2X A;  3Q8U A;  3PJ9 A;  4UOF A;  3Q89 A;  1PKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...