1NSQA

Mechanism of phosphate transfer by nucleoside diphosphate kinase: x-ray structures of a phospho-histidine intermediate of the enzymes from drosophila and dictyostelium
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
152
structure length
151
Chain Sequence
AANKERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGLVNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPADSLPGTIRGDFCIQVGRNIIGSDAVESAEKEIALWFNEKELVTWTPAAKDWIYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Phosphotransferase
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title Mechanism of phosphate transfer by nucleoside diphosphate kinase: X-ray structures of the phosphohistidine intermediate of the enzymes from Drosophila and Dictyostelium.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 46
structure length 151
sequence length 152
chains with identical sequence B, C
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1995-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1nsqA00
3VVTA 1K44A 3NGTA 1BHNA 4DI6A 1EHWA 1XQIA 1NUEA 3FCWA 1VYAA 5C7PA 2B8QA 3VVUA 3B6BA 3BH7B 3B54A 3Q83A 1PAEX 3MPDA 3ZTOA 5IOLA 3EE3A 1B99A 1JXVA 3EVMA 3ZTQA 1U8WA 3NGUA 3EVWA 4UOFA 3DDIA 3FCVA 2HVEA 4DUTA 1HHQA 4C6AA 1XIQA 1UCNA 2B8PA 2DY9A 2ZUAA 1B4SA 4FKXA 1NCLA 1MN9A 3DKDA 3ETMA 4O0NA 1HIYA 1NDKA 3EM1A 4F36A 1NSQA 1LWXA 1NDCA 3EMTA 3GP9A 3BBCA 1F6TA 3BH6B 1PKUA 3R9LA 1S5ZA 4FKYA 1HLWA 3FBEA 4ANEA 2HVDA 4WBFA 2DYAA 5BXIA 2BX6A 3JS9A 2BEFA 3EICA 3Q8UA 1NLKL 4UOGA 4ENOA 2DXEA 1WKJA 2NCKL 4CP5A 3VGSA 3Q8VA 3Q89A 3Q8YA 3NGSA 3ELHA 5CABA 5CAAA 1WKLA 4KPCA 3VGTA 4S0MA 3G2XA 3FKBA 4ANCA 1S59A 1F3FA 1BE4A 3ZTSA 1WKKA 3FC9A 4DZ6A 1NHKL 3FBBA 3FBFA 4HR2A 3FBCA 2DXFA 3NGRA 2HURA 3BBFA 1NPKA 1NDLA 3EJMA 1KDNA 3L7UA 3BBBA 2AZ1A 3PRVA 1S57A 2AZ3A 2CWKA 1NSKL 2DXDA 1LEOA 3EVOA 3ENAA 4UOHA 2VU5A 4ANDA 3ZTPA 3PJ9A 3GPAA 4W98A 3VGUA 3ZTRA 1MN7A 4F4AA 1W7WA 1BUXA 1NB2A 4EK2A 3WX8A 3Q86A 1NDPA 3VGVA 1NSPA 1ZS6A
chains in the Genus database with same CATH superfamily
4C0BA 1X9SA 1Y5NB 1S7IA 2RQCA 2LXFA 3V81A 1W25A 2AGQA 3NAIA 2K8GA 3I4HX 4I7FA 1SUQA 2HS3A 4NA1A 2VOPA 1SXLA 2H5IB 4HH0A 4W90B 5J1EA 4A46A 5IWAJ 2OGUA 4DX8H 3CCJS 4YS2A 5G0RB 3M8QA 2NR0A 5D3GB 3HFVA 4DV7J 4CIOA 1RK8A 4FXWA 4NI2B 2NXNA 2QTWA 5KFAA 1R6VA 4K0KJ 3NKYA 2GVZB 2IRUA 4P10A 1Q81T 1CQMA 3MPWA 3NS5A 3CDUA 3HT3A 2E5LF 2MZJA 5L1LA 3UE2A 3PKYA 3UDVA 4MH8A 3BN4A 2NUHA 3LAKA 4G1QA 1XNRJ 5T14A 3BKTA 1T02A 1CJVA 2U2FA 3VAHA 1RTIA 3TP2A 1S7HA 1NJWA 4B3RF 1HBUA 4ZCLA 4XK8C 3S1TA 2IFXA 1FRLA 5LSRA 3VAGA 3IS9B 1LWEA 1UEUA 3JB9k 3N5FA 2WRMA 3K0JA 2PDAA 4NZ6A 1KFDA 1N0VC 4NYZA 2DHAA 2HW3A 3CCMS 2CQGA 3OHBA 2UV8A 1URNA 3KK1B 4DR3J 1N6QB 5C24A 1IQTA 2O5DA 1M5HA 4EO6A 1UKUA 2NYIA 3OVAA 1RAHB 4BS2A 1U49A 1S9GA 2F7VA 4UUWA 3G6ES 3N79A 3LP0B 4YN3B 4DQQA 1WC0A 2HHSA 4BWMA 3HI9A 1IBMJ 2V2QA 3HDSA 1EARA 1VQ8S 1M5VC 2WCXA 2KZMA 2IA6A 2BJEA 4MKVA 5B0GA 4I2QB 3PFOA 3POTA 1QVGR 1J5OA 5AE3A 4OYBA 2VD3A 1YBUA 3KMSA 4OJ1A 3X3UA 2BMBA 3MEGB 2OAUA 3AQOA 3I0RB 1E6YA 4NMXA 2HHUA 1Y11A 2KXNB 1KQKA 3A3OB 4PG7A 4YMEA 3I87A 1SIZA 2EBGA 3HK2A 1RE1B 3DXBA 4IO1A 2R2RA 3UDLA 4MMOA 5L1IA 2YWHA 3KNAA 3LWMA 1F2HA 3PX6A 4R8UA 1FERA 1KD1T 2E5IA 1U26A 3NGRA 2M88A 3QAEA 2R9LA 1HNVA 3CDWA 2AZ1A 2FJBB 2H65B 4NEZA 4C97A 1R0CB 4DLGA 5EGYA 4I67A 2R7OA 3KK3B 4RU2A 3CDEA 3CJ0A 2NZ4A 3DLKB 3OXFA 3KMQA 3PXGa 3X1LB 1PIEA 4Z7YA 3GMGA 5CYQB 2ROPA 2VKRA 5F8NA 2I8EA 1YJNS 4ECUA 1QJHA 1NKBA 2XO7A 4JI7J 5KAKA 1R8BA 2ZUGA 1HQUA 2K3IA 4AL5A 3UN3A 1JK9B 1JLQA 1TKXB 2RKIB 3RAXA 2Y8WA 1KVJA 2CJKA 5LOQA 2VDHA 5A6PA 1KS2A 2M9KA 2O3DA 1IBLF 1MMDA 4BWJA 2HEKA 1N36F 3LUYA 1GX5A 3P96A 1JXEA 1AT1B 2AGPA 2YX7A 2X7IA 1WI6A 1S76D 1WOSA 4DS5A 3G8QA 4LF7J 2C3UA 5KT4A 3QIDA 1ROFA 1HWJA 4LF8F 2ZC3A 4IO9Q 2B9YA 1T05B 3EUNA 3I9V9 1U1KA 4NLUA 4C11B 2IVYA 2MGZB 4J37A 2GC8A 4U9RA 1T9WA 1PAEX 2IC3B 1BQXA 4MFBA 3VAFA 2HIYA 3H20A 3W3SA 2H1YA 5KFBA 2VJVA 3ILJA 2LP4A 2J0SD 2GGPA 3FCVA 3FRYA 3B82A 1QM9A 3S01A 3IRWP 1VIXA 3MOJB 3J7AN 4A8MP 4M95A 2AF6A 4F4KA 4IFYB 2HZAA 3NXZA 2C2EA 1FRIA 3Q23A 1QAYA 5ETMA 2G0CA 1IKXA 1NO8A 1R0BG 1UW4A 3F0NA 3R5JB 3I4PA 4MIAA 3QZ8A 3OLBA 2EC0A 1X5TA 2JX2A 1IJFB 4UOGA 3NL0A 3KK2B 4ICLA 4NOHA 3VR1A 3QJLA 3G2XA 2BZ2A 1GMWA 4AYBD 1C2PA 2JC1A 2EG1A 4TYBA 3U1NA 3DU5A 4MKBA 5HI7A 1BQMA 2F4VF 1BWVA 2EFOA 2R8JA 5KFLA 5A8WB 1KEKA 4U7UK 3VALA 4DN0A 4B9SA 5ETVA 5AE2A 3AOCA 3VHQA 2VC0A 3VVTA 4C8LA 1KQGB 4WFAQ 4DI6A 5L1JA 2UUAJ 2QL7B 1VYAA 4H4OA 4LF1A 3DXSX 2VDIA 5CYMB 2FHKA 5C5JA 4I56A 3OTOJ 1ZAVA 5CXTA 1WEZA 4ZLNA 1I6JA 2MY7A 2YXLA 3R5AA 5B0DA 2WOMA 1S1UA 1S6OA 3G6XA 3OVBA 3WC0A 3PACA 5I3UB 3BBCA 3V81B 1X8DA 2IMOA 2BA9A 3HHLA 4L6V3 2BEFA 1RWWB 1Y4ZB 4AQYJ 1SUQB 4WWSA 2WSCC 2K7JA 5AE1A 2WW8A 5L46A 2ZNZA 1ZBTA 2ZD1A 3ZZYA 2Z30B 4PUOB 1VMBA 4A8SA 2RH3A 4P6QA 5ETTA 4A4JA 4KY3A 5GADU 1RA6A 4P2SA 1N34F 4LIWA 3DOKB 4TKTA 2J76E 1S79A 1SVDA 3G6VA 2L9DA 3A8IA 1VLOA 3HLUA 4USTA 2FIUA 1NDPA 2V2KA 1T9VA 3T9ZA 1B99A 3EVMA 4O0IA 2V0NA 3KOAA 2DT9A 4RR5A 3MWBA 1R31A 3DI6B 3T3FA 2RVJA 4JI1J 4IG3A 2FVCA 4QQBA 2B5JA 2EXUA 1T9UA 3T5LA 4G1QB 1CJVB 1Q53A 2LFVA 2OPPA 1WG4A 5JJBA 2KO1A 4O4GA 3HHNB 4J9LA 2CG8A 2VBZA 2LYVA 3E51A 2ACMA 1LWEB 2VQFF 3RUBL 3D3BJ 4N8OA 5F9NA 2GQCA 4A8FA 5C24B 1GMUA 5EWFA 3ITHA 3IRXA 4KGVB 4PYAA 3PFEA 2X51A 3CD7A 5HN0A 4JI6F 2DIUA 1FESA 4X2BA 5DDPC 3QPIA 4LFCJ 1WJ9A 1TZ0A 1UW9A 3M1VA 5L1KA 1Q1KA 5KFSA 5A2QY 4RL1A 5E41A 5J1NA 1RA7A 2XQCA 2J8AA 3H59A 1QUVA 3CC2S 1CEZA 3B54A 2W2NP 1RT7B 3TI0A 1IBKJ 1YIJS 1R8CA 3UDCA 5DG8A 1Y0HA 3WC2A 3PIOQ 1KN6A 4DUZJ 3KJNB 2F8HA 1U47A 2N4CA 2GMHA 2F4FA 4RNHA 1RTDA 2FZGB 4HACB 1S1VB 1V3SA 2KB2A 2CPXA 2DH9A 1VQOS 4WE1A 4NA2A 5B0FA 4HLBA 4O3NA 4K0KF 2XZDB 2VFUA 4JUZA 9RUBA 3CCQS 4J9RA 4WKYA 1TV6B 1DTQB 2UVVA 1TKZA 5DG9A 4OZ3A 2KFYA 2H51B 2BE2B 4KBIA 2HFNA 1VQNS 2AKWB 2YNFA 2DPIA 4LRFA 3J81Y 1JJ4A 1BXNA 4LT6A 4ZDNA 3O8WA 4AXJA 1HNVB 4PXCA 2OPSA 4LVNP 1S6QA 4OYWA 2OELA 1R43A 4RLEA 3KUGA 2IRYA 2A2CA 5A76A 3P8BB 1XNQJ 1B4SA 4I68A 3CCTA 1RHMB 4I0WA 2B9WA 4E8UA 2DGSA 4CI0B 3PX0A 1PILA 3B8HA 1FEHA 3OV7A 4YFUA 3PEHA 1LW2A 1YRUA 4ZPWR 4F0KA 1SJQA 2BM0A 3T41A 4TQSA 2IVMA 1F9EB 1HQUB 4LJMA 4Q5VA 3O3LA 4OMFG 2FB0A 1IBMF 2R8IA 1L3SA 5IT9Y 4UOCA 4B3MF 4PKDB 2MQ8A 2CDQA 4NL5A 5IC4B 3LAMA 2DXDA 1F5AA 1FNOA 3GIRA 4JV0A 3FEYB 4ED4A 1KC8T 1T03A 5BR8J 1B0PA 4ID5A 1FJGJ 3ISNC 1NEEA 1IM6A 2V67A 1WTFA 4IRKA 2R2SA 3R1LA 4DWIA 2MJUA 3F73A 4DR7F 4U7UD 1KHVA 3AFGA 1MG7A 2I0XA 3PYFA 1JXLA 2JZ5A 3TA0A 3SMZA 1S1WA 2CVEA 2CPEA 1RT3B 2M4MA 4ES3A 1IKXB 1VQSA 4ZVEA 2CPYA 2VH7A 1RJJA 2DHSA 3VF0B 4TY8B 4ICLB 4LSZB 5D4NA 3IP0A 1RBLA 5BYRA 4CWBA 4R0EA 3TJ8A 1KFSA 2CQ4A 2KFNA 4LF9F 1FWKA 3FGVA 2KHCA 4DR2F 4N8NA 4DV0F 2BYCA 4F3MA 4JI7F 1HQEB 2YKPA 2A10A 1SJ1A 2AIRB 4TU9A 1ZTTA 5EN1A 3DRRA 3DDIA 2LQJA 4TNOA 1S4FA 3KLGA 3N9UC 1QAJA 1RBAA 5ADZA 2P6SA 3TX8A 2BDPA 1N33J 1WTBA 2LQ5A 4GKJF 4KKOA 5E3RA 4QU6A 5J2NB 3R9LA 2YWWA 2ZJPQ 1LV5A 3O5TB 2IJNA 1U02A 3W5YA 2M2BA 1RWKB 3OL8A 1I94F 2ALZA 5HP1B 1Z4UA 1S1UB 3JSMA 1UWAA 3NCRA 4C0HA 1U1QA 3G86A 3FBBA 2B6AA 1EP4A 2KM8C 3FRZA 1WOOA 2CJBA 4UF4A 1ZM4A 1RAJA 3MM8A 3RU0A 3DRSA 3EYZA 2ZD1B 4A8OA 4ZVPB 3A3NB 5JXSA 1JLCB 2JOQA 5LMNF 1RTHB 1XN9A 4WP9A 2I9SA 2VG6A 4IOCQ 4P74A 1N5YB 3RB6A 5HSPA 4B9LA 2DNGA 5KFXA 3FCWA 3G96A 3OW2R 2L9WA 2UUWA 1DAXA 2UVWA 3RBDA 3NGDA 4CM2A 3TW0A 5F8IA 3PG9A 2HNZA 1DURA 3TAMB 5LMUJ 1TP7A 2JC0A 1FK9A 3PW4A 2CUYA 4DHVA 2AV5A 2B5JB 2Y3YA 5E3QA 3PV8A 2X3GA 2WBRA 1WKJA 1C1BB 2OPPB 2HNYB 4KH0B 2HGMA 4O4GB 3LGMA 3H5XA 3ZTSA 2UUTA 4NYPA 3SCJE 2DY1A 2V9KA 2ZH7A 4K2XA 2V8DA 2RUGA 4FYDA 4ZN3A 2D3UA 2QX0A 2D1CA 4Z37A 3NP5A 3QRPA 4O3RA 1C0UA 4LSLA 4JI8J 2DKOB 3RAQA 1LWFB 3OHAA 3MUMP 4USJC 2W2QP 3CW2C 2IMWP 4UTGA 4ILLA 1PBAA 4ATNA 3FSXA 1WHVA 1JXVA 2C2DA 2ZVIA 2GHWA 3OXLA 1Q8LA 2J0QD 2BANA 4QW9A 1EX8A 5I3QA 1RABB 1YJ9S 4J9SA 4FKXA 4TN2A 3PYGA 4OX9J 1GT8A 2EEYA 1NSQA 1F9HA 2YY3A 4WP3A 3PO4A 1L3KA 6AT1B 3KUHA 2BRKA 2GAGC 1L5UA 3G71S 2V8VA 4LMZA 2QMWA 2H54B 5CABA 2P9EA 2RU3A 4IG0B 2EFGA 2GFFA 3IAM9 1IKYA 4CTAA 4K5SA 1CBKA 1RKJA 2RJZA 2MQQA 1V3RA 3PCOB 1N88A 1PYOB 4USHA 4IR1A 1SQGA 1WACA 2BXJA 3PYEA 3ENAA 1TK5A 2F40A 2MQLA 3GPAA 2RHQB 1PG5B 2HQCA 4X62F 2I6WA 2VG5B 4F4WA 4JI1F 1FVQA 2XHCA 2ASLA 4LRCA 2E9ZA 1VQKS 2XG8A 2R7SA 1UFKA 2DNZA 2B8PA 2O67A 2IRXA 4ZVOB 4L75A 2FHJA 5EX3A 3FZBA 5B0CA 4DLEA 4EU0A 2F9JA 4J9MA 4JI2F 3J7A1 4QWAA 2KH9A 1DBDA 1LWCA 2DXEA 3UR0A 2H4WB 3KHHA 3UVJA 2MKIA 2V34A 4C3LA 2OH2A 2FJWA 1S0MA 1FRKA 3OFEA 4ZVTB 2OO4A 1T3OA 3CNQP 4YR3A 5GMDA 2AHOB 4ED1A 5KFOA 4U8YA 1LW2B 4OJ3A 3IA0A 3DOLB 4WXOA 2QO3A 4CNZA 2B3TB 1K0VA 4DPTA 2EVZA 2WSFC 2WVEA 2WVFA 1PJ7A 2XNQA 3K89A 2ZZNA 4RX6A 4K7QA 2HMIB 3CIMA 4JV5J 1IBKF 2GVDB 3A3PB 2A18A 2X1FA 2K7KA 1P9YA 3GJSB 2CRLA 3N6LA 2CQBA 4KGKA 4DV6F 1SB6A 4DL5A 4IFVA 2Q6BA 2XTJP 1T03B 4C6AA 1RI7A 5A8RA 2ZE2B 1QSYA 1FI4A 1TK8A 1NHVA 1TVRB 3OSPA 3BH6B 2FVRA 1REVB 3MDFA 1J5EF 3MMCA 2HVDA 3W7BA 4IUFA 3O2IA 3ZZTA 1GXLA 3D1HA 1HWIA 3NLCA 4QPXA 1N5QA 3TWZA 3C15A 1XMQJ 2Y1IA 3C8YA 2AWZA 5KFJA 1VBZA 1FX2A 2E44A 3LGNA 1S59A 2RT3A 2HK2A 1VHIA 3HSDA 2EI5A 1N5SA 4DBQA 2Q66A 5DZ7A 2QYGA 2N3OA 5CA5A 4AL6A 3EPGA 1NZAA 3QYYA 3FK4A 3WZ0A 1P9QC 3C66A 1W7WA 1BMQB 1VBYA 4ZVHA 1UWBB 2DBBA 3H2LA 3B4MA 2IAJA 2D3O1 1H6KX 2RF2A 4F4XA 3FSIA 1IWAA 1U2RA 3TA2A 2ATCB 5HLFB 3NGUA 3R5DA 4MKYA 4KHPF 2VPYB 4QW8A 3C16A 4KFBA 1B7FA 4JI4F 3TJAA 5I3PA 4CO3A 5D6GA 1SC4B 2WHOA 3VQSA 1QY7A 1S4EA 3CCUS 3KLGB 3BO3A 3V6KA 1RT6A 2VHGA 3O44A 4QIFA 1H2UX 3GCXP 2RDIA 2QA1A 1NB7A 3KJVB 4FVCA 3QQCD 2KG1A 2NPIA 4LVOP 1K47A 3HJVA 1FJEB 3G87A 1YVFA 2I38A 4H54A 4ZS6A 5C2CA 1HNZJ 1Q79A 4ZP9A 2HWTA 1YDLA 2GZOA 4NE9C 3JSMB 1UJ6A 4OHYA 4Y3CA 4OJGA 2FUG9 4FDFA 5HMYA 5JMNA 3I0SB 1EP4B 3J80Y 4DS4A 4X4VA 2FJEB 4ED0A 4M8LA 4DV3J 3EWGA 3HHLC 3DRSB 4ZPAA 4ZLJA 5HMWA 2HHTA 1AUSL 2WSEC 3MR2A 2Z2YB 3EVWA 2ABYA 4URQU 3W2WA 3HP6A 2RSQA 2YQ3A 4FXVA 2XC9A 2KHDA 1VISA 3GG0A 4P52A 1SV5B 1XR5A 4FF3A 1CPZA 2FLOA 1VIOA 5F8LA 4GKKF 3IWXA 5BXIA 4HHUA 2DJWA 3I5AA 2R8HA 2ILYA 1KLNA 5DM6Q 1S0OA 2YTCA 4ECSA 2HNZB 1W2IA 2UUCJ 4PQAA 1R0AA 4XO0A 3U27A 5A6WA 3P45B 4CH1A 4X4NA 4FZVA 2C42A 3MCOA 2GJ2A 2EFPA 3M2VA 2H5JB 3UDEA 2J8SA 4P2MA 4MT1A 4PYDA 2EFNA 4NCGB 2HBYB 3ET6A 2E29A 2OP5A 5ITHA 4ZPCA 4NLTA 4K4XA 3V5RA 3DYAB 2IA0A 4ZP6A 3SQGA 1JIHA 2QG9B 3ENQA 1Q82T 9ATCB 4DR5J 2FVPA 1IM4A 2AX1A 4RZRA 2JNJA 3QT7A 2ATLA 4NXNJ 4OI2A 4LBIA 3KYLA 3ZZPA 1YJUA 4J91A 1S6PA 4UOFA 2FJAB 2LMIA 1SBRA 1RT2A 2CA9A 1Q5YA 1PJ5A 4DFPA 4MKAA 2QV6A 1H0HB 1PKUA 3UPFA 3CJSA 3W63A 4C8MA 3G82B 1S9EA 1BQNA 3M30B 1N56A 3PKMA 2MZTA 2YQ1A 1NMEB 4Y2MA 3R6LB 3H2UB 4UUXA 4M5JA 3VTIA 2W1BA 4KIAA 3SQOP 1EAYC 1TMMA 2YX1A 4WP8A 1CJTA 4ELVA 4O4RA 2IYIA 2VOOA 3DRPA 1UAWA 4QIVA 4DQPA 1QE1B 2G0JA 1RT1A 2P6TA 3QSYB 4RWXA 3SYZA 1Q78A 2IM3A 2E66A 1WSVA 3AJ2A 5CCLA 1Q86T 5HBMB 3C14A 1VRUB 2W9CA 4OHWA 1FRHA 2FY1A 3IBFB 4B9UA 2GCFA 3NMAA 1OQ6A 1SKWA 4NLSA 3NBPA 4NXMJ 1MU2B 2DNOA 4DV4J 4I1TA 4ZVGA 3TAPA 1U2FA 2BABA 2FYXA 1LWXA 4NCBA 3TQ1A 5A0YB 1F3VA 3GR0A 1XMOJ 4JYAF 2G9OA 5HROA 3VV2B 2MZQA 3W66A 5B09A 4FVMA 3IAS9 4FN5A 2HVZA 1QSLA 2LQ8A 4DCOB 1T9YA 5AJ3J 2W2MP 3VGSA 1WDDA 2YNGB 2QN6B 2KDOA 1KWMA 3HSZA 2XYHB 5KFPA 3GYXB 3BDPA 2VQEJ 1U6ZA 3K5OA 4FF1A 3DMJA 4DU8A 1E6VA 3JAMY 3LGHA 3V4IA 3G9CA 3DLGB 5E5NA 4JP8A 1LWCB 1SQFA 4KGXB 2MHEA 3PHTA 3F44A 5DQGA 3IR7B 3OJSA 1WD6A 1JLEA 4JI8F 2G0IA 3FFIB 3QFWA 2QZ8A 4R5PA 3BREA 1NHUA 4OQJA 4JOUA 1Y7PA 1TL4A 1L3UA 2YKNA 1JKHA 1GTEA 2MZSA 2JLFA 1HARA 4OV6A 1F5BA 3ZTOA 2W4CA 4DCJB 1SC1B 1HHQA 1N32J 2MTLA 2OD4A 1UVIA 5ETOA 4RW9A 3HZEA 3V6JA 1TKDA 1JX4A 3SI8A 2ZHAA 2JFDA 1GMVA 1F6TA 2APOA 1HNIB 2RB7A 4JI3F 2KT2A 2YQ0A 1FJ7A 3DRYA 3OR1B 1RAOA 2GQ2A 2RRNA 4WFXA 1G3OA 2PGCA 3PJWA 2AU0A 1RACB 4CLLA 2WONB 3IC1A 3R5BA 3W60A 4CO2A 3DN9A 5A8RB 2QMXA 4RW7B 2ZFHA 4KAIA 3QZ7A 4UT4A 2C28A 3MMCB 4YDXA 3SCLE 2XI2A 2D3OR 4DR1F 3C15B 4DR4J 1RXOB 3FEXB 2ZZTA 2F3JA 1DJ0A 2OSQA 2KU7A 1VQMS 2ZVSA 1NJZA 4IDKA 1FKPA 1WORA 4PG4A 4C8YA 2B8QA 1UP1A 4C3MA 3ISZA 4KGZB 5T7LB 4DG1A 3AT1B 3RR8A 2XZTB 2DNMA 2BRLA 3LP2B 2VG7A 2RF2B 3EM1A 1VRTB 3PVXA 3T5KA 3MOZA 3E2EA 3L3CA 5MAOA 3JS9A 2AEJA 2ACYA 3C16B 2XS2A 2ZWPA 2MPUA 1QAIA 1BD6A 2MSSA 4RW8B 3Q8VA 1EQMA 2N7YA 1M5KC 3E3XA 4JV2A 2KTQA 1H2VZ 4EWTA 4LBPA 4QIGA 2ZBRA 2C2ZB 2HG4A 1GXUA 1RT6B 4CLPA 3K58A 1H3DA 2PFDA 2QA2A 4C7QA 1QLNA 5GVQA 5C25A 4KJIA 3KHRA 3CJKB 5GAGI 4ILMA 1V5VA 4AXIA 2UP1A 3KLFA 2QFJA 1IWGA 5CYJA 3QNWB 3UNYA 2HIQA 3BKFA 4A8XA 3KDOA 1IR1A 3FEZA 1T9XA 5HK4A 4F2SA 2JLEA 4Y2IA 2G13A 2FLPA 2KI2A 3RB0A 4QWDA 5E3PA 1TL3A 3JQKA 2J9DE 4O23A 3QIPB 2H5EA 2NS1B 1WNEA 2DHHA 1M5PC 4QCLA 1LFWA 5K9FA 2J6UA 2DR5A 1S0VA 4PABA 3EX7B 1FDDA 3JSRA 3RRGA 5IS2A 2CQ3A 2R3VA 4DR6J 5DS7A 1EETB 3AODA 3IG1A 1QSSA 5F3TA 2K3KA 3AB4B 2VA2A 1VQLS 1WELA 1MLAA 3QSIA 1R0AB 4IKAA 3I31A 4YQWA 2V63A 3ILOA 1YGYA 3VGVA 3ENVA 3WX4A 4GRSA 5KFTA 4EO8A 3ET6B 4PEOA 2MQMA 4YY3J 3DLEA 4QPTA 4KTQA 1S9FA 1LOUA 3OR2B 2GHPA 2CQCA 4J9KA 1MMNA 2FGCA 3M2UA 2WAQD 2GJFA 1TUGB 3SQGB 1R8HA 3AAWB 1DFDA 3CTRA 4RW4B 1VQYA 1Y3KA 1LK5A 4QR2A 3ETOA 2NXEA 4DSKA 3TUIC 3W5ZA 1YI2S 3MECA 1S6PB 5CCMA 3HD1A 1AFJA 2L3MA 2FZCB 4FBUA 4EYIB 4ZITA 2O66A 2RDDA 2MQPA 5AT1B 3CJ3A 2R7WA 4OL8A 4X65J 4HYKA 3UCZP 3J7ZT 3ENWA 3OTDA 2AZ3A 2RDJA 2V6AA 4F0HA 1UMJA 5KFIA 5C2GA 4OX6A 4WK3A 3L9ZA 3MM6B 2AJ4A 3BM7A 1B3TA 3KLHB 1X0FA 1AUDA 1RQ0A 2BKNA 3DRPB 2MB0B 3A8KA 1Z1ZA 1RT5B 2UVUA 5KG5A 3CUNA 2RS2A 3KHGA 1TL7B 1LKZA 2AQ4A 2DNRA 2OLWA 1UCNA 3C14B 4RNMA 1QTNB 4JI5J 3AD9C 2W9CB 3ETMA 1VGYA 3RZAA 3OJUA 2DO4A 4UZCA 2AX0A 2W24A 1AW0A 2I1RA 2OD6A 2ROGA 4Y2CA 1FXDA 2UUCF 1OIAA 2K06A 3JTNA 3RGIA 4Y65A 1EKRA 5KT6A 4ZHRA 2XS7A 1HBMA 4DZDA 5KT7A 2HFZA 1YJWS 3DDNA 4ER8A 3GFZA 3DNCA 2DGXA 5KFRA 2W4PA 4LF5J 2KVQE 5FD1A 3M6XA 4GMKA 5HROB 3QGGA 4NLYA 4LF6F 4CO5A 1NPKA 1EZZB 3SXLA 1TFWA 1ZM9A 2ZNYA 1O8BA 1VDHA 2CWKA 2ZH6A 1JLFA 2YWKA 4BLGA 2FJDB 3BGRA 2ZH5A 1HR0J 2MJNA 5MLCV 1SH2A 4I6YA 3DMJB 2HK3A 4X4OA 3HKWA 3T5HA 3UN2A 1ELOA 3GWCA 4N77A 3GYNA 2XY7A 3BN7A 3HZGA 4I6WA 2WZ1A 1WC4A 3AOBA 3SV4A 3TZYA 1JLEB 4ZJLA 7FDRA 3TX0A 2Q6CA 2JEGA 1V9OA 1H74A 2UU9F 5GAEI 2ALYB 4ZVQB 1WHWA 1JKHB 2DEJA 1TMJA 5BYQA 4FXDA 3R27A 3RG6A 2FHMA 2M8DB 3BGFA 2CDRB 1NPPA 4IQMA 5GMKa 3NAHA 4RW9B 5FJ4A 4NYOA 4TXSA 5A8KA 5HVHA 2WVDA 2JEJA 2OEKA 2VL1A 2LEPA 5DRKA 2VBXA 1LQ9A 4R25A 2U1AA 3DFEA 2PT0A 3QO9B 3UD4P 2FJXA 3M4XA 1X7VA 2Z58B 4H4KA 1QVFR 1S99A 3GG1A 1RWOB 4M5LA 4P7TA 5GMEA 1FXRA 1I5OB 3QBCA 2GV1A 2XMAA 3TA1A 5IM0B 2MQNA 3BQ2A 1OY8A 2KJWA 3EGZA 2UXBF 3RTVA 3DLJA 3DOMA 3PHEA 5LJ5Y 2Y8YA 7FD1A 2V94A 2JJ4D 4RKUC 2KXHA 2KYXA 4ED6A 4IDKB 2F5GA 5GAHI 1PAUB 4NA3A 1N5TA 5KFCA 4P73A 4C3KA 4DSLA 3EGNA 1M5SA 2IM2A 5B0BA 2X3DA 2KXFA 1UPMB 3CCVS 1UA0A 3BB5A 3W1YC 3MD1A 2VQEF 1RZMA 4TVAB 3OPKA 2XI3A 4DV5F 2XYGB 4CT9A 3R8YA 4GO5X 4KV8A 3MAAA 3D0GE 2VG7B 2MKCA 4HT5A 2F8MA 1RWMB 2AP6A 1D9AA 1PGZA 1O6XA 3LP1A 3MMBA 4I64A 3QWPA 4WIIA 5HVFA 2BV3A 4ECQA 3DGPA 1ICEB 4D3HA 2HQ3A 4CNYA 3IO1A 2YNHA 2DHGA 2UUBJ 3NY0A 3SIPB 1P1TA 4ZVUB 3CJRA 4YHHF 4LF4F 3NNHA 2FD2A 5D0HA 1K1SA 2IVFB 5JVHQ 3ZZ0A 2FDNA 3KLEA 1XC9A 2HVEA 2CNLB 2XWXA 5M2UA 4CM0A 3G8TA 3ADAC 3O1LA 1NCLA 3KLFB 4Q2LA 4QWBA 1OYDA 3W8PA 5F41A 3N0VA 1DY3A 1WEYA 3HSGA 3HMJG 4RW6B 3KWMA 3KG1A 1UVMA 4U7CA 1UVJA 2HHXA 5EX0A 4I2PB 2N4DA 3H5YA 1TL3B 1S1TB 3MFIA 2HNDA 3R7SB 4QIWD 1IR2A 4M5DB 3K8WA 4HR2A 2R42A 3LQVA 3IR6B 4L76A 2R7RA 3UD5A 2DK2A 4DFKA 1YQHA 2OPRA 3QATA 2HHHJ 1X31C 3C19A 4OI1A 2H4YB 2DNHA 2KYZA 3D9BA 4EEYA 3HM9A 2BQUA 5H1SV 1OYEA 2JFKA 1NH8A 4FPIA 2J9CA 1RWVB 2DGVA 4OX7A 4H4MB 3D67A 2J6SA 1RAEB 3Q83A 3LANA 4CH0S 3W2VA 2HLUA 4KHMA 1VBXA 4DL4A 1N0UA 1J2VA 1UFLA 4B3TJ 4O0NA 1FD8A 4ZIWA 2CYYA 2GW8A 3DLEB 2XULA 1JLGB 8AT1B 4OYAA 2ZKUA 2VIHA 1RAIB 3M2UB 4LFBJ 1S1XA 5DQHA 1VK3A 3HJFA 3Q8YA 1U45A 3ZZZA 4K5RA 2E9RX 4F02A 3MECB 5AXMA 3QAUA 5KFHA 1X4HA 2ZHOA 4USKA 4QYZJ 3SDEA 1Z2ZA 4DL0C 1ZPWX 1PSDA 3I82A 1NK7A 3GJTB 1Y5LB 4NLGA 3UD3P 1CULA 3UNGC 2YPYA 3DM2B 3L95X 1HBOB 1C1CB 3TJ9A 3WQPA 1SH0A 1VJQA 1U8WA 3M6WA 3IBWA 2Y1JA 1CS4A 1TTHB 1XK8A 4B3SJ 2DD8S 2M0GB 5HMXA 4A8YA 3AD7C 2IDLA 1UZHA 2OJ3A 3IFEA 1LW0A 5CZXA 2CPHA 4FYWB 1FNMA 2WBMA 2E5GA 2ZDPA 1NK6A 2J9EA 4M5IA 4I6AA 3A13A 4OJHA 2Q1LA 1ZTWA 2RS8A 3IM8A 1NHKL 1RSCA 2VODA 2J7WA 4X64J 4DPYA 3MEDA 2BKPA 4ZPVR 4ZHRB 1HBMB 1CSJA 3W9HA 2R4FA 3UN5A 3BO2A 2CQHA 4ZPBA 3D6HB 4NWBA 1SCJB 3AXMA 4EK2A 4FP9A 2YKQA 5DETA 3ZZUA 2DCUB 2DH7A 3NGTA 1U25A 2UXCF 5AXLA 3RBEA 1BLUA 4KR0B 3GIIA 2XGQA 3Q2TC 1T11A 1APSA 4PQUA 2ZUAA 2B4PA 2QRRA 2ZDOA 1SPBP 1KQFB 2GIQA 2IM0A 2XMWA 2GMLA 1UEVA 5T41A 5KT2A 4JI0F 1GEHA 3H0PA 3PO5A 3IXQA 2MSTA 2B43A 2L48A 4DSFA 4X65F 1RTZA 2HGLA 3EGVA 2CVIA 2HHVA 1K9MT 4WZMA 2A1BA 1WKKA 3AXKA 3PNIA 1U6FA 3Q22A 1KP6A 1F2GA 1TKTA 1MW7A 4X4TA 4C8KA 3CB4A 1HWUA 3TUZC 1DQ9A 1K73T 5A8KB 4HKQA 1UA1A 2BUNA 3KXDA 4F4YA 3K5MA 3HT0A 2N7CA 3LALA 2R2TA 3PR5B 1NSPA 1PC5A 3I56S 1DLOA 1VLYA 4OHXA 4KGMA 4F3QA 1NUEA 4UQGA 5C7PA 3M9OB 3CSKA 4P72A 4GC7A 3THVA 1WF1A 3FMWA 3CD6S 4DUTA 3SV3A 3M8WA 1QDUB 3EZ5A 2JLGA 1HKAA 3KLVA 1H72C 2C2RA 2LXIA 2W7PA 1Y5IB 4PR6A 3DOMB 2C3MA 3GIMA 2BX6A 3HFKA 4LF5F 2G4BA 4LRAA 2FY8A 1VK8A 3E01A 2VB6A 3HHEA 4HH1A 2IBOA 1RHQB 2LDYA 5LXRA 1C0TA 4P75A 4ANCA 2JEFA 4HT7A 1DTTB 2HPUA 5J2MA 4X66F 4DL3A 1YSJA 1NKEA 2D69A 4KHRA 1HMVB 2UVRA 1B0VA 1RADB 3HSJA 1G4CA 3MUTP 3H2VE 5IQ6A 4W98A 1P8GA 3LP1B 1V6HA 3MMBB 1JLAB 2ZBCA 2PEHA 2J6TA 4PG6A 4CLUA 1HW8A 2D74B 4N56A 3A1YG 1AA1B 1UJ5A 1AZSB 2EK1A 1NKCA 4M5NA 4QWCA 3P6YC 2MLXA 4O44B 1VC0A 1FKOA 3Q24A 1RWNB 4LFAF 2M5YA 3SSRA 4DU7A 2YNHB 1UZDA 2PD1A 4DXLA 2HKEA 1TQLA 1NDKA 2KN4A 2XMTA 3OVSA 1NDCA 3NOGA 2WVCA 3MUVP 4DSEA 4ZP8A 2CQ1A 4B3RJ 3MMAA 1ZETA 3IWNC 2ZOGA 2VICA 5FLXU 3CXCR 3M9MB 3QRQA 3TZZA 1XJWB 4DX5A 4DL7A 1N4LA 3FBFA 2ZJRQ 4ECWA 5KFFA 2OEJA 1RYRA 4M5GA 2LKZA 4DV1F 3PEJA 4KO0B 4OI4A 3NGKA 3CD5A 1FA0A 4PXEA 1WG5A 1NJXA 2G2OA 2HVIA 3MR6A 3TO8A 2BJ9A 1N52B 2B4VA 4P7VA 2KM8B 1TU0B 1OSDA 3OQ2A 2DRDA 1L3VA 4ES1A 2FGOA 3MCSA 3GR1A 4WIQA 1S97A 3TARA 4I7FB 2ADCA 4PG8A 5J1EB 4N41A 1F1BB 2OMLA 1IR0A 1F9FA 5G0RA 4DX6A 6FD1A 4LR9A 3M8QB 1HI1A 2GA7A 4DSJA 3VAMA 2BE7D 4NI2A 3UR3C 3DGVA 1Y10A 1XR7A 1AB8A 3CCWA 1FFSB 4S0MA 2AYMA 2QLXA 3CO9A 1W26A 1SC3B 1EKSA 2XMVA 2XCAA 2KL8A 1Q8KA 1UVKA 3CJ2A 2PIIA 4QOTA 5LSOA 5DGAA 4F4AA 4B9MA 2QA4G 1WWHA 1RP5A 1M1KT 4XPEA 3PIPQ 2IY5B 4O3OA 1JMTA 5HL7Q 1F5CA 1VQ5S 1RTIB 1K44A 1EHWA 3K59A 1HBUB 3G6YA 3B6BA 2DVIA 4C0OC 4WKRA 4F26A 3KJQB 4RO0A 3IS9A 1S12A 1T94A 2KFZA 2ZH2A 1XIQA 1XTZA 3FDSA 1CULB 3R5GA 5J2PA 1KONA 5K20B 3J81j 1UPPA 2CXEA 3J7YI 1IVZA 4V19X 4NLQA 4ZPDA 3K5LA 2M70A 2QMUB 2AJ2A 1CS4B 2KZZA 3TVKA 2EPIA 1S9GB 1R7IA 1WKLA 3VGTA 1P6TA 2FPHX 5FDLA 1BGXT 2EW9A 3FMBA 5KT3A 3PR4A 3WIUA 3QLHA 3BBFA 4L3KA 1GQEA 1FWPA 3W9JA 4LR8A 4F2RA 2ASYA 3EVOA 4NCAA 2I5JA 5D15A 4C2MA 3ZXWA 1IBLJ 2VFRA 4HTIA 5IWAF 1N36J 1TK0A 3ISND 4NLDA 1YLXA 5LM7E 1NJIT 4I2QA 3VWSA 4Q8EA 2QEXS 2DNLA 3POTB 2HLTA 1ZZNA 3GONA 1D09B 3IWLA 4DV7F 3VVUA 2VV5A 4IRCA 3UI3A 1J5OB 2XGPA 5KOXA 3ULHA 4B3TF 4QYZK 3D1QA 1FRXA 2CNOB 3P5TL 4OI3A 3I0RA 1E6YB 3IGVA 2HHQA 1X4CA 2FVSA 4YB5A 1TELA 3EMTA 4IOAQ 4ANEA 1Y00A 4ENOA 1PYTA 1NJYA 2W9AA 2E1AA 1XNRF 2W25A 4CLZA 2PMZD 2CFXA 1X4AA 4B02A 4OLOA 3WDOA 4DQRA 4R8UB 4C98A 4DMZA 1YWXA 2ZKTA 3EJMA 4DL2A 3B4DA 2HQFA 1T0TV 4ANDA 2DB1A 5IT0A 3KK3A 1A6LA 2W7AA 1KKHA 4DR3F 4ZJQA 1PO6A 1VQ4S 4ZJOA 1GK8A 3DLKA 2RE1A 1RAGB 2P2CB 4ZCKA 4ZK7M 5CYQA 2VUGA 3JTPA 1VQ6S 4CH7A 4B3SF 4O3PA 1FFWB 2YBVA 2F4VJ 4L74A 3BGOP 2KRRA 3Q8RB 4PXDA 1DLOB 4YP3A 3BSCA 5E0OA 4ELTA 1TKXA 1ZM2A 2RKIA 3GILA 1JLQB 3D68A 1D9FA 3HFZB 2BQ3A 4OYPA 2SXLA 1R89A 4DCPB 4H4KC 3H5UA 4F25A 2JDJA 5HVGA 3GIKA 1NAQA 4X64F 5IV4A 1RWPB 1CC7A 4N47A 1CJUA 4URSA 4ED3A 3JSYA 2B9EA 3FUYA 2VC1A 5HANA 4NPOA 4HVZA 4I69A 1M5OC 3FQKA 2HRTA 4I4BA 5DGBA 3MR5A 3BPDA 3M2RA 1T05A 1NSKL 5KG3A 3E01B 4C11A 1C0TB 2ZITA 1WOPA 5K8NA 2OSRA 3KG4A 2MGZA 2IC3A 1FX4A 3V4MA 4MFBB 1VI7A 1N34J 3BSNA 3AJ1A 5IC6B 4OYXA 1WUUA 3UW1A 1NK4A 3E8OA 3R97A 2GGPB 4WU2A 4DN9A 3QGPA 2C2MB 3M8ZA 4GVBA 4DPOA 1KOHA 5F0UA 1JLBA 2OMOA 1HHTP 1RGVA 3I5CA 3BR8A 4FKYA 4KE5A 4N76A 3MPYA 3PX4A 2V5HG 3KK2A 2ERRA 2DNPA 2HWIA 4DEZA 4KRWA 3VZIA 3U7JA 5B0AA 2OEMA 1IJEB 3GSDA 2VFTA 2ZOMA 4F4ZA 5HAOA 1QTMA 3RW6A 3L7UA 1BQMB 4ELUA 2AJ1A 2KKHA 1UTAA 2EFVA 2VQFJ 1RHRB 3Q2SC 2HFSA 3BEGB 3D4JA 1K8AT 1ZA2B 3MM7A 3CJ8A 2ZH1A 1O51A 2HSEB 5CD4H 2F65A 4J5OA 2HHWA 4H4OB 4U96A 3HULA 3NNAA 4RJVA 2MLYA 4JI6J 5E7OB 3W9IA 1KLMA 5HQ8A 4LF7F 3CIZA 4J90A 1FCAA 3OL7A 3DKDA 3L7OA 2WOMB 5CQGA 2WW4A 5I3UA 1T9TA 3C6UA 2LVWA 2HBQB 4WBFA 5K5MA 3HHLB 2H48B 3MCMA 3SSSA 2QA4S 1VJWA 1FRJA 3R2DJ 2CJYB 4PUOA 4K4YA 3KKFA 2DR8A 4X4UA 5KFDA 3RRHA 3DOKA 4DUYJ 2MHNA 4W92B 3CJ5A 3GFYA 3H98A 2JWNA 4OV1A 4DDFA 1NZ8A 1M90T 2HZVA 4CRJA 1IN0A 4LUBA 3A12A 1JB0C 4DQSA 4MIWA 4MIBA 4Q43A 4G3IA 1IXKA 4TU8A 2HWHA 1U2CA 1UFWA 3DI6A 4WZQA 2KT5A 1DRZA 2W8LA 2PO4A 4D3GA 5DG7A 2XLKA 4IG3B 3IMQJ 3ICLA 2JSXA 1X5OA 2ZOFA 1MN9A 2XY6A 1ULRA 3LO3A 3TZWA 4C4WA 1I51B 3IM9A 5KFKA 2RD5C 3H4BA 4OX8A 2PMHA 5J2PB 1RWUA 2ZZMA 3KG0A 4DF4A 2UUAF 3K57A 1Z2LA 1OSCA 3OBIA 3BF4A 3ITHB 3D5MA 3IRXB 2M7SA 3M7VA 4CYUA 3DLBA 3VCDA 3OTOF 3JSBA 1AFIA 2Q43A 3MD3A 1DZ5A 5D4OA 5K8MA 3GFXA 3M1VB 1RAFB 5FDLB 5DQIA 3CULA 2YWEA 2LA6A 3QLHB 4YOEA 1FKAF 4FF4A 5ETKA 4AQYF 1RYSA 2A6OA 1N5VA 2I5JB 1RT7A 3MFHA 2NQPA 1LK7A 3ZTQA 4BBYA 4B3MJ 1HWKA 4XDCA 3TEHB 2V9WA 4CCHA 1CLFA 3B78A 1RLCL 1RB0A 3T1AA 4X4SA 2RILA 3ZC4A 2R8KA 1X4FA 1RTDB 4HACA 1S1VA 4WE1B 5KFYA 4UY8T 1GX6A 4JV1A 5F8JA 7AT1B 3SSQA 3RB3A 4IQXA 3CD0A 3D54A 1FTCA 5E3CA 2IM1A 4F3OA 2GS8A 1WDTA 4M5MA 1TV6A 2JVOA 1U1OA 2J7UA 2IPOB 1DTQA 4QWEA 2D3ZA 4DR7J 2XBPA 2DNNA 3OFGA 1R8AA 1TKZB 3AA9A 1OO0B 5CH7B 2JEIA 2M8HA 2BE2A 3BYRA 3OFFA 4P2FA 3AA8A 4W4MA 3BZQA 4USMA 2YNFB 2V8HA 2OKQA 5KFWA 4X4RA 3MR3A 2CPIA 4OZ1A 2CPJA 3OFHA 3VAKA 4MAKA 2W9BA 2NLWA 2G1DA 1HI8A 3R6GB 1D8ZA 2AMCB 1ZOTA 2QGFB 3L7PA 1PC4A 2MEWA 1KTQA 2OPSB 3FJ2A 1S6QB 2QLBB 3GIJA 2GQQA 4CLYA 3T1YJ 1GMWD 2BJDA 2BJ3A 1HNWJ 3DCAA 4PPDA 4B9VA 1OMSA 4UZBA 3DC2A 3U1MA 4LF9J 3DHWC 4Q8FA 5F8GA 4DR2J 4DV0J 4LFCF 4ZVFA 4DPWA 3P5BP 4DQIA 5DJBA 4K4SA 2PSZA 4ZIVA 2CKWA 3FKBA 2ZC4A 4UW2A 2DCLA 4NLVA 1GAOA 2Z0GA 1FWLA 1AYEA 4GKJJ 3BBBA 3CCLS 1EIYB 3KLIA 1FE4A 3CDBA 2H9ZA 2MZRA 4UOHA 2B7CB 3JQMA 1CJUB 4DUZF 2FC9A 1UL3A 1I94J 1YKWA 3HHLD 3IGNA 1Q0NA 4MK9A 4ID5B 4ZKAA 1BHNA 3FZ2A 2WK4A 1OY6A 3M2RB 2UZAA 3BH7B 3U02A 2N82B 2B4UA 2HS0A 3L4BC 1X5PA 1XEZA 2LDIA 5KFQA 3T19A 3CF5Q 2OPQA 4MYTA 3SFGA 1JNRB 2YVSA 2RQMA 1FD2A 5E3AA 4LQ9A 3QRRA 2YKAA 4KC5A 4LQ3A 5KG6A 3OUYA 2J7KA 3S6EA 3PW2A 5K8OA 2RNEA 3OXGA 2C3OA 2L08A 1HBNA 2GO9A 4LR7A 5LMNJ 3MM9A 3KJFB 3H4DA 2V2ZA 2GAHC 2VFVA 1S1WB 4FF2A 4XPCA 4WPAA 1RT3A 3M8YA 1URRA 4GVBB 3TUPA 3DLLQ 1JLBB 5DDQC 3WBZA 2NUUG 1SL0A 2D9PA 2VKZG 1BE4A 3M8RA 2ZWOA 1O5JA 4TY8A 1G2EA 1JNZB 5KG0A 1YX2A 1XNQF 3LF0A 2KRBA 3O6QA 1YK9A 3RRKA 2N3LA 4PXBA 3RW7A 4DOZA 1SJ4P 2AGOA 1HQEA 5D4LA 4C8ZA 3HO1A 1X4DA 5G4DA 4LRBA 3EE3A 4X84A 4GVLA 1Q95G 1R6YA 3DRRB 3RB4A 3MM7B 2P9CA 4Y6IA 3BGLA 1TUWA 1Q7YT 4KKOB 2POKA 5J2NA 4OYOA 1JJ2R 2VPWB 3RAMA 4EBCA 3TEGA 2HBZB 1TL5A 3Q8UA 1KLMB 2CAJA 4FYYB 5BR8F 1SKSA 3T1HJ 3NGSA 5HP1A 1FJGF 2Z4PA 3QT5A 1WC1A 1B7YB 5CD4A 3C6UB 1X0PA 1YBTA 2B6AB 3TVYA 1S77D 4CO4A 4TY9A 2RRAA 1T7PA 3PRBA 3MM8B 2X1AA 4IRDA 4YR2A 3Q8SB 1RDRA 2PC6A 1JLCA 3C46A 4Q0BA 2DTJA 3HKZD 1RTHA 2PI4A 3HVRA 2EKNA 2VG6B 5F3ZA 1N5YA 2IYGA 4BHQA 1YJTA 4NLWA 2XMKA 4C48A 1HYSA 1B64A 3K17A 1J27A 4NMLA 2CQ0A 2XB2D 2DR6A 3FQLA 3ILIA 4A8QA 2H3EB 3TAMA 5GAGU 1EB0A 2RMLA 5F9LA 1FK9B 4KH1B 4X62J 4J9UE 2CQPA 4FNIA 3IN5A 3NRBA 4FNHA 1C1BA 2HNYA 4ED2A 1KTVA 2WVBA 1V5IB 4DX7A 1GTHA 3FCHA 4HHHA 1JWWA 1M0SA 3H25A 3I96A 3DDKA 2DXFA 1VOMA 4ZMMA 2QJ3A 1SKRA 2MDAA 3PTWA 4JI2J 2NYHA 1N33F 5AXKA 2P5VA 2C2OB 4G1IA 2FVQA 2BJ1A 1OWXA 3R5CA 2MKYA 4OZ5A 3N28A 1C0UB 4CYUB 1T3NA 3M32A 2L41A 2ZHBA 4LSLB 2KVIA 1LWFA 1XQIA 1YRTA 3CCRS 3MPDA 1NNDA 2DGOA 3N6NA 4PWDA 4EBEA 2LEBA 2OIHA 3DRXA 1UETA 2BANB 3J7Z5 4RU9A 4XTTA 3MAHA 5B7WA 2ZJQQ 1A7GE 1A9NB 3T6JA 4ERDA 1VS3A 2GIRA 3CWJA 2RHSB 2LCWA 2R7VA 1YG0A 4ALZA 3HF5A 3QT8A 1M1GA 4CP5A 4DUYF 4DV6J 4NASA 3Q89A 1SQEA 3MZIA 5EWGA 2XNRA 4IG0A 4K4UA 1IKYB 3NCQA 4CTAB 1WC6A 2ASJA 3H42A 4NX9A 2ZBQA 1X4BA 2V4JA 1J5EJ 2VU5A 5LMUF 1IKVA 3GZ7A 4BCAA 3EXYA 4PAAA 2P9GA 1NSAA 1U6BA 2ILZA 4F36A 3UO0A 4LRDA 2VG5A 4A47A 3H40A 1P27B 2DEIA 3BS9A 5C42A 4EZ6A 1VC6A 2E1MC 2UV8G 2BW7A 5D77A 2W9BB 4CLTA 4Q7AA 2DGWA 1MMLA 2UXDJ 4YB7A 3OL9A 4B9NA 4QR0A 5JUMA 1ZYQA 1KNZA 1BC6A 3CEDA 2B56A 3UVJB 3CT9A 3H5SA 4KHPJ 3D0IE 4PWWA 1D9DA 4N7TA 2B4OA 1LXNA 1XWLA 4JI4J 3GB0A 4DZ6A 1MSWD 1HQ2A 4J9NA 3PW7A 5CZVA 2HBRB 2MKHA 4E0DA 2X1GA 5J2QA 3DOLA 1HD1A 1S48A 3EZUA 4OX9F 2AYEA 1DHMA 6FDRA 2DISA 2Z8QA 1ZS6A 1Q4RA 2HMIA 2GVDA 4WFZA 3KLIB 3EXCX 1M1HA 1FJCA 1U0SA 2DRAA 3NNCA 4IFVB 5ETNA 4LIRA 4TLQA 1ZH5A 2W8KA 1N48A 2ASDA 2ZE2A 2LA4A 1RTJA 3R3TA 3S8SA 3W64A 1TVRA 1MWQA 2RU9A 5F0WA 1REVA 2A6MA 2CADA 2OPQB 3EPIA 2W4DA 4R0JA 3TOQA 3JXOA 1FO1A 5K8PA 1HWLA 1H73A 3OUYB 2XM3A 1EJ7L 2MQOA 1HBNB 2KG0A 5GAEU 4A8KA 3MM9B 1TAUA 4NRUA 4XAKA 1Q7LB 2R8GA 1OS5A 2FTRA 4RBVA 2RQ4A 5CHCB 2MXYA 4YB6A 3T9NA 1S57A 2MKSA 2QT7A 2KT3A 4GKKJ 2NPFA 4OHZA 4K2JA 3LW5C 4L72B 1G6BA 1WF2A 1UWBA 1RKIA 3T1YF 2IAJB 3RBZA 4RNOA 2JH3A 4RPFA 1HNWF 2W01A 4BDPA 4B08A 3GCWP 2QLWA 1D8YA 5HO4A 3Q8QB 5HLFA 2OFGX 4KFBB 3JTOA 2XCPA 2RIJA 3HVTA 4ZCMA 4IYQA 5GADI 3CCSS 3RR7A 1NM2A 2WTFA 3BPSP 2RRBA 4AFFA 3D28A 4CLKA 5GAHU 4JV5F 4ZVRB 2PE8A 1HPZA 3AD8C 3LA0A 3KJVA 5KG1A 2IIHA 1VR6A 4HDHA 1QUPA 4J9OA 3W5XA 1KQSR 4LREA 1TR0A 2VONA 2EG2A 2Y1LB 3US5A 3R1HA 5DDRC 1RBOB 4X4QA 4JBCA 2GJIA 3WX8A 5HJXA 3I0SA 2W2OP 4CLFA 4DPXA 3SEOA 3CC4S 3QJJA 4Y2AA 1WC5A 4YUDA 4AUKA 5A2QU 1KBRA 3HPOA 1XMQF 1H7XA 4Q0BB 4OZ2A 5K14A 2MKKA 1WG1A 3W2WB 2JL9A 3CGIA 1RLDA 1TL1A 3BSOA 1SV5A 1HYSB 2QSFA 5KOWA 5L9XA 2AJQA 4BC7A 4F04B 2GIFA 2BOPA 5RUBA 4Q45A 3OSNA 1ZPVA 3ZNUA 1Y3JA 1T8EA 3P4UB 4OYMA 1ITPA 4V1Ak 4AD6A 1HFEL 3C6TA 1PBUA 4KPCA 3H8YA 2DRBA 1S0NA 3M2VB 4YEAA 5M2RA 5HATA 2XY5A 4PWUA 2NZCA 4NCGA 4RUAA 1JQGA 1U7LA 5KFEA 4JYAJ 3N4WA 2FHJD 1VQPS 2VFSA 3DYAA 4DL6A 4ZCIA 4G6VB 3D2WA 2LU2A 4HL9A 4U67Q 1VHFA 4WTOB 3JYTA 2QSWA 4RUHA 1FF2A 1DARA 1HA1A 3J81U 1YITS 1S72S 2B9XA 2ZH4A 1GFWB 3CMAS 4U95A 3MM5A 1X60A 4ID8A 3PW0A 2VBYA 2M3DA 1RT2B 1YHQS 4WU3A 3UCUP 3SBMA 3M32B 1UVNA 1AXQA 1OPZA 2YX4A 2IBKA 3I32A 4OI0A 2Z56B 5KG7A 3T1HF 1HNZF 4PWDB 3G82A 1WHXA 3T5JA 4C9DA 3UWTA 1S9EB 1H2TZ 3M30A 1BQNB 4PPZA 3D66A 1G7CB 2DPJA 4K59A 5IT4A 2LLZA 3QGHA 1FE0A 3VZHA 4K8RA 4DV3F 1CJTB 1HL6A 2HURA 5IQQA 1NDLA 2LU1A 3BR9A 4JI3J 2QLJB 1VFJA 2CIMA 1QE1A 5IT9U 3NEKA 2XWYA 5L38A 1RCXB 1RT1B 5IV3A 4G1PA 2R7XA 1BY9A 4LF2A 1N8RT 5HBMA 1VRUA 3TVZA 2V4JB 4DF8A 4NEYA 1XERA 3GTYX 3G4SS 1RISA 1IKVB 3NBPB 3RBXA 4DR1J 1RHJB 2E5HA 1MU2A 3BYPA 2W7OA 1SH3A 3BJYA 5D78A 2NSBA 2EKYA 1YZ6A 2A2DA 4ECXA 4ZPTR 3ZFVA 5A0YA 2NXJA 2C2KB 3EZOA 4QR1A 4EMDA 2K1RA 5C42B 3C2PA 4HI1A 3IBCB 3CO0P 2YNGA 1XR6A 3TAQA 4DR5F 2A3JA 3GV7B 4ZA1A 2BE9B 1U4BA 4PG5A 4NXNF 1E6VB 3DLGA 3V4IB 5IFMA 3DU6A 3ZNJ1 1R8PA 3V6HA 4NLXA 1SKUB 2J0WA 5H9FJ 4DV2J 3PJ9A 3FFIA 1NK0A 2FZKB 3VGUA 2Y9HA 1A0OB 3KUEA 2CNKB 4J9PA 3ILLA 4R5PB 5I42A 2YKMA 4HDGA 4WFYA 2QIFA 1I1GA 1UJ4A 2YKNB 2HRYA 1H98A 5J2QB 2XLJA 3THPA 4V19J 3TUJC 1V3ZA 1ZA1B 3NOCA 4X4PA 5KG2A 1NBEB 3D0HE 2V69A 2XSJA 3MI7X 2OTJS 1L3TA 1TUVA 1HNIA 1Q16B 1S5ZA 3K7RA 2AD9A 3OR1A 4TU7A 2XLIA 2GMJA 2Z57B 3D3CJ 4CQ1A 1B0TA 1NLKL 2QL9B 2WONA 2ZH9A 1PYSB 2VASA 2G1HA 4RW7A 2FC8A 1RHKB 1RTJB 2I2YA 2VPZB 1R3NA 1HNXJ 4QU7A 3FC9A 3BQ1A 4N5SA 2BOAA 4NXMF 2PN6A 3MMJA 4K4VA 3PRDA 4RUCA 3BV8A 3ONQA 1OQ3A 1KSPA 3KDNA 4DV4F 3N6MA 1CQNA 1MN7A 4URGA 2DH8A 3EDRB 4Y0FA 2MMYA 4ETZA 4ZP7A 1XMOF 1FKPB 1WHYA 3HHKA 4EGLA 3HVAA 1NRKA 4ZOSA 5AJ3F 2XMMA 1NPRA 5T7LA 5KT5A 5M2PA 4DG1B 3N01A 2UXDF 2DIVA 2VZ9A 1IQZA 4KQZA 3LP2A 4M94A 2YH0A 4O3SA 3PM9A 1K1QA 1VRTA 4OHVA 1IKWA 4ECVA 5KFGA 3K5PA 5U47A 5B0EA 1SIWB 2Y0BB 2Q3PA 5EDWA 4PZVA 2NCKL 4TLRA 4RW8A 3HVTB 8ATCB 2OI2A 2ZH8A 3K5NA 3KTQA 4DFMA 3K2YA 2LEAA 1DQAA 5SZTA 3M9NB 1N32F 3GLJA 2F1FA 3R2CJ 2F9DA 3PYDA 2E1PA 2NXUA 2GHVC 4QBUA 1RT4A 3OD2A 1HPZB 5C25B 3CJKA 1QD1A 1SI9A 4AE5A 1C4CA 4ECYA 2C1EB 5KG4A 3QJPA 3CJ4A 4NLOA 2DR7A 4Y28C 2NXCA 2QL5B 3KHLA 4F8RA 2Y0SD 2IHR1 2VA3A 2DITA 1FRMA 1SJ3P 4OLPA 2CJXB 5THWA 3QIPA 5ETRA 2CQDA 4DR4F 1QAXA 2HQDA 2F8EX 2X1BA 5K14B 3A8EA 5LXYA 1NU4A 2JHEA 5DLFA 1TL1B 3CC7S 2BACA 5CAAA 3MXHP 4UQTA 1X5SA 1EETA 3D6FB 2CPDA 4K4TA 2YWGA 3IG1B 1H7WA 4USVA 4QIEA 1Q5VA 3M6VA 4K4ZA 1WEXA 2HRUA 1XBWA 2O1PA 3C6TB 5L9NA 1CC8A 4NZ0A 4K50A 2BR0A 2HZCA 3A8JA 2FLNA 3GU0A 4Q2MA 3BDEA 4B3OA 4ILRA 4MK7A 5D8HB 4ED5A 2AJFE 3BGUA 3OR2A 1SL2A 1SJRA 4LF6J 2M52A 2J9DA 2NREA 1KOOA 2RAQA 2LECA 4RW4A 3JYTB 5L39A 4QYRA 4OI6A 5F8HA 3OLAA 5FLXY 3LTOA 3MM5B 3OT9A 3AHPA 5HQMA 2V4RA 2XS5A 3EGWB 4DFJA 1MWZA 2HGNA 3KFWX 2DGUA 5EHHA 4DSIA 4Y00A 3TYTA 1SC6A 2UU9J 5LL6d 1KRPA 2GNKA 5BJRA 4OYIA 4LBHA 3LWLA 4OYZA 3MGJA 2FJVA 4Q44A 4C8OA 2DGQA 2JVRA 5L8RC 1D1UA 2YWFA 4ZN1A 3MM6A 2AJ0A 2B51A 3TZXA 3KLHA 4P71A 3M05A 1U1MA 2CZ9A 3M8SA 3FVYA 3LPYA 1RT5A 2EWHA 2QC3A 1KHWA 3TRGA 3NS7B 2YNIA 5LSLA 1TL7A 4IOBA 3I6PA 4DR6F 1ZAWA 2ZM6J 3GSIA 4GO7X 4KPYA 2CZVC 5D0EA 3N5BA 2GO8A 3V6DA 3GV5B 2CJ9A 2E9TA 3VQTA 5ETLA 4E2FB 3RJMB 1K0TA 2DO0A 2AW0A 4EBDA 2GX8A 1FVSA 2HQIA 4FBTA 1DQ8A 1W2BR 2DHXA 2VPXB 1FDAA 2EFQA 4XIUA 1S10A 2UXBJ 5DM7Q 2ZEJA 1U24A 2Q79A 1GNKA 2ROEA 5H9EJ 4YY3F 1F0XA 2XHWA 3FBCA 3MEKA 3I9ZA 5AXNA 2K1RB 3J7YU 4ECRA 2BJ8A 3WIVA 1N54B 2OUGA 1JLFB 1KVKA 3BGRB 4CO0A 1VC5A 1CG2A 1ZM3A 3AY0A 2MLZA 1SJFA 4DV5J 3GJQB 4XDDA 3PDNA 4EUVA 4EYHB 3HD2A 3NCPA 5J1PA 2HFOA 1FDNA 2DNQA 4KYZA 1ACMB 3ZZOA 2XEXA 3QWUA 4WXWA 1RCOB 3MR7A 2YH1A 4WYWA 4Z2XA 3OL6A 5D0RA 3AH6A 5FIIA 2Z2LA 5I42B 3I55S 4ITSA 4MJKA 4RUBA 1FFGB 2YKMB 1OJ4A 5HJYA 2HQGA 5KFUA 3H7HB 1HD0A 1SL1A 4ZLPA 2DNYA 3THTA 1MNEA 4YHHJ 4LF4J 2XSJB 5HMZA 5E2QA 5JVGQ 1X4EA 3HCXA 2PFFB 1YJ7A 1F3FA 3VAJA 3TR5A 1B70B 3QO9A 2CZ4A 1JJCB 4KSEB 4USWA 2BJ7A 2QLFB 4JI5F 4OFZA 3QGIA 3WHIA 4ZLLA 5EWEA 3W8GA 5LJ3Y 4J9VA 4DJBA 2AYBA 5IM0A 2XMJA 3LOUA 3TNVA 5IOLA 3HHDA 3J80U 3HVWA 2PEBA 5H9FK 1JJHA 5DO2A 3NS6A 5DDOC 2LXUA 1MROA 3MEEA 3OTCA 2AYGA 1NH7A 3VAIA 2CQ2A 1HR0F 3HX9A 2FLLA 1KR4A 3EDQB 3D1OA 2C3PA 2KJVA 4F50A 4CO1A 3OTEA 1F60B 2C22A 4KV8B 3MAAB 1PJ6A 2COLA 3UCGA 1IKWB 2YKOA 4FYVB 3SFUA 1X9MA 3P49B 4ECTA 4OIXA 4DV2F 2HS4A 3MPVA 4ECZA 2AT1B 1D3WA 4RWWA 2W2PP 3PRVA 3CPWR 4CT8A 5HQLA 1RU1A 2AEFA 2E1CA 5KFZA 3DGPB 2QYCA 3CDAA 2XYPB 3ZTRA 1D0EA 2BVZA 2E5LJ 2BW2A 4WJBA 4NLRA 5B08A 3IR5B 1U0HA 1WF0A 3CCZA 3GE9A 4RBUA 4F7VA 4A8WA 2Z2MA 2MZ1A 2MKJA 4EFAC 8RUCA 2BBEA 4TYAA 5SUHA 1RT4B 3KLEB 4IH6A 3NMRA 4BC9A 4WCEQ 2HYIB 4OZLA 1PCAA 3CJQA 2E5JA 4MK8A 4RW6A 3P3DA 3K8VA 1GH8A 3GFHA 2BKOA 4M63A 1HNXF 2XO6A 1TAQA 3QT6A 4I2PA 1FHTA 3ELHA 1U1NA 1CJKA 1IBCB 3M8PA 1T95A 1S1TA 2ZBIA 4LSNA 2HNDB 3GYGA 4CLSA 3GJRB 4M5DA 4J9QA 1U1PA 1YJVA 2D7SA 2QE5A 1KDNA 1Q8IA 3AJDA 4WYLA 4Z7CA 3FNNA 2L9NA 2OPRB 5ETPA 3ZTPA 4IH5A 1RUSA 3MAQA 1MWYA 3Q86A 1RU2A 2PMWA 4P2XA 4CDIA 4MYUA 1OY9A 4OZ0A 4H4MA 1H38A 4CLWA 4HTJA 1NXIA 4FS2A 4M5KA 2DGTA 5DZ6A 3L09A 4CZCA 2V68A 4YB1P 3W2VB 5D3GA 3MF5A 4FS1A 5E33A 2A0FB 2CG4A 3AB2B 4B3OB 3R7BB 5EUHA 4C8NA 2GVZA 2MY8A 4ZVSB 2B0GA 2RUSA 1JLGA 2OTLS 4YR0A 4USUA 5KTQA 2UXCJ 1S1XB 2VJUA 4KT0C 1U09A 4NRTA 2E7WA 4M5HA 1BWEA 2UUBF 5BYSA 3UFCX 1O0PA 1U1RA 4KB7A 2LQ9A 3U1LA 2ZBPA 1UVLA 2HAIA 3JAMU 4JI0J 3JQJA 2VBWA 3BQ0A 2AEMA 2Y1RI 2WB1D 3SDEB 1WI8A 2K2PA 4RBTA 3CMQA 2D9OA 1ZAXA 1X4GA 2HFUA 2EK6A 1UEKA 2XZWA 4ES2A 3ZZRA 3DM2A 1FDBA 4IH7A 2C3YA 3SCKE 2HVHA 1HBOA 1RWXB 3KK1A 1N6QA 1C1CA 1YZ7A 4B17A 1EQ0A 3NG8A 2V2VA 1RHUB 5D0GA 3LPEA 2ADBA 2FHOB 3D6MB 3I5BA 4Y34A 2JRSA 5I4MA 3BO4A 3W61A 2HHPA 4RNFA 5DLGA 4AT1B 5KFVA 1LNQA 3TANA 2C2NA 3PZPA 3MTJA 4U8VA 1LW0B 3LP0A 4EZ9A 2OHDA 3TQEA 2HHHF 1YJRA 3FBEA 3MPUB 2YNIB 3KNGA 2PA8D 3QMQA 2EBEA 3V6DB 2VF3A 4NLPA 4HI2A 5IZHA 2P8IA 2IJRA 1R27B 3GV8B 4PCQA 2G2YA 3MEDB 2DNKA 3M6UA 5F8MA 3DHXA 4GC6A 3MHYA 1LEOA 3NWGA 4LF8J 2Z2ZA 5D4PA 4UY85 1WC3A 4A48A 1OPIA 3MEGA 2E7XA 4K4WA 3PY8A 1FT8A 1FTRA 1P1LA 4LFBF 4X66J 3Q8PB 1IUJA 1FNXH 2XSFA 1Q8BA 3CE8A 2J0XA 1LXJA 2WB4A 4PQUB 3PW5A 3GP9A 1HHSA 4M1KA 4G65A 1HLWA 1VQ7S 4U6PA 3EICA 3Q0AA 1HI0P 1HW9A 2QFIA 4FYXB 2BQRA 4ETXA 2HFVA 2BM1A 2ZH3A 5LT5A 1VBKA 4LFAJ 2CPFA 2OFHX 4JB8B 4WFNQ 3BSAA 4HEA9 1X9WA 1C4AA 1TKTB 1I3OB 1RAAB 4F0MA 3CVKA 1U8SA 2PI5A 1VQ9S 4WFBQ 2CNNB 1Y9OA 3SZ2A 5H9EK 4DPUA 3G8SA 2ZM6F 2R7UA 3HXMA 2YPZA 1TFYA 3D7SB 4F67A 3FSYA 4RNNA 3SCIE 2DY9A 1S6UA 4DV1J 2CPZA 2V4QA 1REGX 4NZ7A 4B9TA 4AL7A 1U1LA 2RQKA 4PRFA 3RYLA 4MTPA 5IXUA 3CJTA 2IDEA 4P9SA 4ED7A 2HAFA 2B7BB 2D41A 3W62A 3H90A 4L73A 2MYFA 1AROP 1MROB 2FQQB 2O01C 3F56A 3MCNA 3MEEB 1KVIA 3UQSA 1DTTA 5KFMA 3W65A 2DR9A 4OZNA 5J2MB 4J7CA 1FXLA 2E1RA 2EC2A 1HMVA 4QZVB 1G1XA 2R2UA 4ED8A 2CJQA 3OTBA 4FPRA 1CVJA 4L3NA 1NB2A 1NK5A 3MURP 2J5AA 1JLAA 1VCTA 2PA3A 1GXTA 4IFYA 4WTYA 5KFNA 2G2ZA 1FEEA 3F41A 3LH2S 2V8PA 1AZSA 4O44A 4WK1A 3QFHA 1FKOB 1ZZFA 3C3LA 2LQBA 3NWRA 4E98A 1U0HB 3CCES 2E7VA 3CMES 1HIYA 4HHJA 3DLHA 3A4TA 4TQRA 3ZO7A 3GQCA 4Y2KA 1VRQC 3D6TB 2DYAA 4O3QA 1U48A 3MMAB 2V50A 3AOAA 4WF9Q 2R7QA 1S49A 3AQPA 5ETSA 5A8WA 2R7TA 1WSRA 2CJAA 4USIA 3R7NB 2V8GA 1NK9A 4QJVA 1YBAA 4EI2A 1LFPA 2CWXA 3T6BA 5CYMA 1YRXA 5ETQA 1NK8A 4KO0A 1CJKB 3M8PB 4OZJA 3BKUA 2CQIA 2IJFA 4LSNB 3S7RA 1BUXA 3V2UC 1YTYA 3PJXA 2F63A 4YDDB 4IR9A 1XMBA 2NSCA 2XMUA 3MTKA
chains in the Genus database with same CATH topology
3VVTA 1K44A 3NGTA 1BHNA 4DI6A 1EHWA 1XQIA 1NUEA 3FCWA 1VYAA 5C7PA 2B8QA 3VVUA 3B6BA 3BH7B 3B54A 3Q83A 1PAEX 3MPDA 3ZTOA 5IOLA 3EE3A 1B99A 1JXVA 3EVMA 3ZTQA 1U8WA 3NGUA 3EVWA 4UOFA 3DDIA 3FCVA 2HVEA 4DUTA 1HHQA 4C6AA 1XIQA 1UCNA 2B8PA 2DY9A 2ZUAA 1B4SA 4FKXA 1NCLA 1MN9A 3DKDA 3ETMA 4O0NA 1HIYA 1NDKA 3EM1A 4F36A 1NSQA 1LWXA 1NDCA 3EMTA 3GP9A 3BBCA 1F6TA 3BH6B 1PKUA 3R9LA 1S5ZA 4FKYA 1HLWA 3FBEA 4ANEA 2HVDA 4WBFA 2DYAA 5BXIA 2BX6A 3JS9A 2BEFA 3EICA 3Q8UA 1NLKL 4UOGA 4ENOA 2DXEA 1WKJA 2NCKL 4CP5A 3VGSA 3Q8VA 3Q89A 3Q8YA 3NGSA 3ELHA 5CABA 5CAAA 1WKLA 4KPCA 3VGTA 4S0MA 3G2XA 3FKBA 4ANCA 1S59A 1F3FA 1BE4A 3ZTSA 1WKKA 3FC9A 4DZ6A 1NHKL 3FBBA 3FBFA 4HR2A 3FBCA 2DXFA 3NGRA 2HURA 3BBFA 1NPKA 1NDLA 3EJMA 1KDNA 3L7UA 3BBBA 2AZ1A 3PRVA 1S57A 2AZ3A 2CWKA 1NSKL 2DXDA 1LEOA 3EVOA 3ENAA 4UOHA 2VU5A 4ANDA 3ZTPA 3PJ9A 3GPAA 4W98A 3VGUA 3ZTRA 1MN7A 4F4AA 1W7WA 1BUXA 1NB2A 4EK2A 3WX8A 3Q86A 1NDPA 3VGVA 1NSPA 1ZS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VVT A;  1K44 A;  3NGT A;  1BHN A;  4DI6 A;  1EHW A;  1XQI A;  1NUE A;  3FCW A;  1VYA A;  5C7P A;  2B8Q A;  3VVU A;  3B6B A;  3BH7 B;  3B54 A;  3Q83 A;  1PAE X;  3MPD A;  3ZTO A;  5IOL A;  3EE3 A;  1B99 A;  1JXV A;  3EVM A;  3ZTQ A;  1U8W A;  3NGU A;  3EVW A;  4UOF A;  3DDI A;  3FCV A;  2HVE A;  4DUT A;  1HHQ A;  4C6A A;  1XIQ A;  1UCN A;  2B8P A;  2DY9 A;  2ZUA A;  1B4S A;  4FKX A;  1NCL A;  1MN9 A;  3DKD A;  3ETM A;  4O0N A;  1HIY A;  1NDK A;  3EM1 A;  4F36 A;  1NSQ A;  1LWX A;  1NDC A;  3EMT A;  3GP9 A;  3BBC A;  1F6T A;  3BH6 B;  1PKU A;  3R9L A;  1S5Z A;  4FKY A;  1HLW A;  3FBE A;  4ANE A;  2HVD A;  4WBF A;  2DYA A;  5BXI A;  2BX6 A;  3JS9 A;  2BEF A;  3EIC A;  3Q8U A;  1NLK L;  4UOG A;  4ENO A;  2DXE A;  1WKJ A;  2NCK L;  4CP5 A;  3VGS A;  3Q8V A;  3Q89 A;  3Q8Y A;  3NGS A;  3ELH A;  5CAB A;  5CAA A;  1WKL A;  4KPC A;  3VGT A;  4S0M A;  3G2X A;  3FKB A;  4ANC A;  1S59 A;  1F3F A;  1BE4 A;  3ZTS A;  1WKK A;  3FC9 A;  4DZ6 A;  1NHK L;  3FBB A;  3FBF A;  4HR2 A;  3FBC A;  2DXF A;  3NGR A;  2HUR A;  3BBF A;  1NPK A;  1NDL A;  3EJM A;  1KDN A;  3L7U A;  3BBB A;  2AZ1 A;  3PRV A;  1S57 A;  2AZ3 A;  2CWK A;  1NSK L;  2DXD A;  1LEO A;  3EVO A;  3ENA A;  4UOH A;  2VU5 A;  4AND A;  3ZTP A;  3PJ9 A;  3GPA A;  4W98 A;  3VGU A;  3ZTR A;  1MN7 A;  4F4A A;  1W7W A;  1BUX A;  1NB2 A;  4EK2 A;  3WX8 A;  3Q86 A;  1NDP A;  3VGV A;  1NSP A;  1ZS6 A; 
#chains in the Genus database with same CATH topology
 4C0B A;  1X9S A;  1Y5N B;  1S7I A;  2RQC A;  2LXF A;  3V81 A;  1W25 A;  2AGQ A;  3NAI A;  2K8G A;  3I4H X;  4I7F A;  1SUQ A;  2HS3 A;  4NA1 A;  2VOP A;  1SXL A;  2H5I B;  4HH0 A;  4W90 B;  5J1E A;  4A46 A;  5IWA J;  2OGU A;  4DX8 H;  3CCJ S;  4YS2 A;  5G0R B;  3M8Q A;  2NR0 A;  5D3G B;  3HFV A;  4DV7 J;  4CIO A;  1RK8 A;  4FXW A;  4NI2 B;  2NXN A;  2QTW A;  5KFA A;  1R6V A;  4K0K J;  3NKY A;  2GVZ B;  2IRU A;  4P10 A;  1Q81 T;  1CQM A;  3MPW A;  3NS5 A;  3CDU A;  3HT3 A;  2E5L F;  2MZJ A;  5L1L A;  3UE2 A;  3PKY A;  3UDV A;  4MH8 A;  3BN4 A;  2NUH A;  3LAK A;  4G1Q A;  1XNR J;  5T14 A;  3BKT A;  1T02 A;  1CJV A;  2U2F A;  3VAH A;  1RTI A;  3TP2 A;  1S7H A;  1NJW A;  4B3R F;  1HBU A;  4ZCL A;  4XK8 C;  3S1T A;  2IFX A;  1FRL A;  5LSR A;  3VAG A;  3IS9 B;  1LWE A;  1UEU A;  3JB9 k;  3N5F A;  2WRM A;  3K0J A;  2PDA A;  4NZ6 A;  1KFD A;  1N0V C;  4NYZ A;  2DHA A;  2HW3 A;  3CCM S;  2CQG A;  3OHB A;  2UV8 A;  1URN A;  3KK1 B;  4DR3 J;  1N6Q B;  5C24 A;  1IQT A;  2O5D A;  1M5H A;  4EO6 A;  1UKU A;  2NYI A;  3OVA A;  1RAH B;  4BS2 A;  1U49 A;  1S9G A;  2F7V A;  4UUW A;  3G6E S;  3N79 A;  3LP0 B;  4YN3 B;  4DQQ A;  1WC0 A;  2HHS A;  4BWM A;  3HI9 A;  1IBM J;  2V2Q A;  3HDS A;  1EAR A;  1VQ8 S;  1M5V C;  2WCX A;  2KZM A;  2IA6 A;  2BJE A;  4MKV A;  5B0G A;  4I2Q B;  3PFO A;  3POT A;  1QVG R;  1J5O A;  5AE3 A;  4OYB A;  2VD3 A;  1YBU A;  3KMS A;  4OJ1 A;  3X3U A;  2BMB A;  3MEG B;  2OAU A;  3AQO A;  3I0R B;  1E6Y A;  4NMX A;  2HHU A;  1Y11 A;  2KXN B;  1KQK A;  3A3O B;  4PG7 A;  4YME A;  3I87 A;  1SIZ A;  2EBG A;  3HK2 A;  1RE1 B;  3DXB A;  4IO1 A;  2R2R A;  3UDL A;  4MMO A;  5L1I A;  2YWH A;  3KNA A;  3LWM A;  1F2H A;  3PX6 A;  4R8U A;  1FER A;  1KD1 T;  2E5I A;  1U26 A;  3NGR A;  2M88 A;  3QAE A;  2R9L A;  1HNV A;  3CDW A;  2AZ1 A;  2FJB B;  2H65 B;  4NEZ A;  4C97 A;  1R0C B;  4DLG A;  5EGY A;  4I67 A;  2R7O A;  3KK3 B;  4RU2 A;  3CDE A;  3CJ0 A;  2NZ4 A;  3DLK B;  3OXF A;  3KMQ A;  3PXG a;  3X1L B;  1PIE A;  4Z7Y A;  3GMG A;  5CYQ B;  2ROP A;  2VKR A;  5F8N A;  2I8E A;  1YJN S;  4ECU A;  1QJH A;  1NKB A;  2XO7 A;  4JI7 J;  5KAK A;  1R8B A;  2ZUG A;  1HQU A;  2K3I A;  4AL5 A;  3UN3 A;  1JK9 B;  1JLQ A;  1TKX B;  2RKI B;  3RAX A;  2Y8W A;  1KVJ A;  2CJK A;  5LOQ A;  2VDH A;  5A6P A;  1KS2 A;  2M9K A;  2O3D A;  1IBL F;  1MMD A;  4BWJ A;  2HEK A;  1N36 F;  3LUY A;  1GX5 A;  3P96 A;  1JXE A;  1AT1 B;  2AGP A;  2YX7 A;  2X7I A;  1WI6 A;  1S76 D;  1WOS A;  4DS5 A;  3G8Q A;  4LF7 J;  2C3U A;  5KT4 A;  3QID A;  1ROF A;  1HWJ A;  4LF8 F;  2ZC3 A;  4IO9 Q;  2B9Y A;  1T05 B;  3EUN A;  3I9V 9;  1U1K A;  4NLU A;  4C11 B;  2IVY A;  2MGZ B;  4J37 A;  2GC8 A;  4U9R A;  1T9W A;  1PAE X;  2IC3 B;  1BQX A;  4MFB A;  3VAF A;  2HIY A;  3H20 A;  3W3S A;  2H1Y A;  5KFB A;  2VJV A;  3ILJ A;  2LP4 A;  2J0S D;  2GGP A;  3FCV A;  3FRY A;  3B82 A;  1QM9 A;  3S01 A;  3IRW P;  1VIX A;  3MOJ B;  3J7A N;  4A8M P;  4M95 A;  2AF6 A;  4F4K A;  4IFY B;  2HZA A;  3NXZ A;  2C2E A;  1FRI A;  3Q23 A;  1QAY A;  5ETM A;  2G0C A;  1IKX A;  1NO8 A;  1R0B G;  1UW4 A;  3F0N A;  3R5J B;  3I4P A;  4MIA A;  3QZ8 A;  3OLB A;  2EC0 A;  1X5T A;  2JX2 A;  1IJF B;  4UOG A;  3NL0 A;  3KK2 B;  4ICL A;  4NOH A;  3VR1 A;  3QJL A;  3G2X A;  2BZ2 A;  1GMW A;  4AYB D;  1C2P A;  2JC1 A;  2EG1 A;  4TYB A;  3U1N A;  3DU5 A;  4MKB A;  5HI7 A;  1BQM A;  2F4V F;  1BWV A;  2EFO A;  2R8J A;  5KFL A;  5A8W B;  1KEK A;  4U7U K;  3VAL A;  4DN0 A;  4B9S A;  5ETV A;  5AE2 A;  3AOC A;  3VHQ A;  2VC0 A;  3VVT A;  4C8L A;  1KQG B;  4WFA Q;  4DI6 A;  5L1J A;  2UUA J;  2QL7 B;  1VYA A;  4H4O A;  4LF1 A;  3DXS X;  2VDI A;  5CYM B;  2FHK A;  5C5J A;  4I56 A;  3OTO J;  1ZAV A;  5CXT A;  1WEZ A;  4ZLN A;  1I6J A;  2MY7 A;  2YXL A;  3R5A A;  5B0D A;  2WOM A;  1S1U A;  1S6O A;  3G6X A;  3OVB A;  3WC0 A;  3PAC A;  5I3U B;  3BBC A;  3V81 B;  1X8D A;  2IMO A;  2BA9 A;  3HHL A;  4L6V 3;  2BEF A;  1RWW B;  1Y4Z B;  4AQY J;  1SUQ B;  4WWS A;  2WSC C;  2K7J A;  5AE1 A;  2WW8 A;  5L46 A;  2ZNZ A;  1ZBT A;  2ZD1 A;  3ZZY A;  2Z30 B;  4PUO B;  1VMB A;  4A8S A;  2RH3 A;  4P6Q A;  5ETT A;  4A4J A;  4KY3 A;  5GAD U;  1RA6 A;  4P2S A;  1N34 F;  4LIW A;  3DOK B;  4TKT A;  2J76 E;  1S79 A;  1SVD A;  3G6V A;  2L9D A;  3A8I A;  1VLO A;  3HLU A;  4UST A;  2FIU A;  1NDP A;  2V2K A;  1T9V A;  3T9Z A;  1B99 A;  3EVM A;  4O0I A;  2V0N A;  3KOA A;  2DT9 A;  4RR5 A;  3MWB A;  1R31 A;  3DI6 B;  3T3F A;  2RVJ A;  4JI1 J;  4IG3 A;  2FVC A;  4QQB A;  2B5J A;  2EXU A;  1T9U A;  3T5L A;  4G1Q B;  1CJV B;  1Q53 A;  2LFV A;  2OPP A;  1WG4 A;  5JJB A;  2KO1 A;  4O4G A;  3HHN B;  4J9L A;  2CG8 A;  2VBZ A;  2LYV A;  3E51 A;  2ACM A;  1LWE B;  2VQF F;  3RUB L;  3D3B J;  4N8O A;  5F9N A;  2GQC A;  4A8F A;  5C24 B;  1GMU A;  5EWF A;  3ITH A;  3IRX A;  4KGV B;  4PYA A;  3PFE A;  2X51 A;  3CD7 A;  5HN0 A;  4JI6 F;  2DIU A;  1FES A;  4X2B A;  5DDP C;  3QPI A;  4LFC J;  1WJ9 A;  1TZ0 A;  1UW9 A;  3M1V A;  5L1K A;  1Q1K A;  5KFS A;  5A2Q Y;  4RL1 A;  5E41 A;  5J1N A;  1RA7 A;  2XQC A;  2J8A A;  3H59 A;  1QUV A;  3CC2 S;  1CEZ A;  3B54 A;  2W2N P;  1RT7 B;  3TI0 A;  1IBK J;  1YIJ S;  1R8C A;  3UDC A;  5DG8 A;  1Y0H A;  3WC2 A;  3PIO Q;  1KN6 A;  4DUZ J;  3KJN B;  2F8H A;  1U47 A;  2N4C A;  2GMH A;  2F4F A;  4RNH A;  1RTD A;  2FZG B;  4HAC B;  1S1V B;  1V3S A;  2KB2 A;  2CPX A;  2DH9 A;  1VQO S;  4WE1 A;  4NA2 A;  5B0F A;  4HLB A;  4O3N A;  4K0K F;  2XZD B;  2VFU A;  4JUZ A;  9RUB A;  3CCQ S;  4J9R A;  4WKY A;  1TV6 B;  1DTQ B;  2UVV A;  1TKZ A;  5DG9 A;  4OZ3 A;  2KFY A;  2H51 B;  2BE2 B;  4KBI A;  2HFN A;  1VQN S;  2AKW B;  2YNF A;  2DPI A;  4LRF A;  3J81 Y;  1JJ4 A;  1BXN A;  4LT6 A;  4ZDN A;  3O8W A;  4AXJ A;  1HNV B;  4PXC A;  2OPS A;  4LVN P;  1S6Q A;  4OYW A;  2OEL A;  1R43 A;  4RLE A;  3KUG A;  2IRY A;  2A2C A;  5A76 A;  3P8B B;  1XNQ J;  1B4S A;  4I68 A;  3CCT A;  1RHM B;  4I0W A;  2B9W A;  4E8U A;  2DGS A;  4CI0 B;  3PX0 A;  1PIL A;  3B8H A;  1FEH A;  3OV7 A;  4YFU A;  3PEH A;  1LW2 A;  1YRU A;  4ZPW R;  4F0K A;  1SJQ A;  2BM0 A;  3T41 A;  4TQS A;  2IVM A;  1F9E B;  1HQU B;  4LJM A;  4Q5V A;  3O3L A;  4OMF G;  2FB0 A;  1IBM F;  2R8I A;  1L3S A;  5IT9 Y;  4UOC A;  4B3M F;  4PKD B;  2MQ8 A;  2CDQ A;  4NL5 A;  5IC4 B;  3LAM A;  2DXD A;  1F5A A;  1FNO A;  3GIR A;  4JV0 A;  3FEY B;  4ED4 A;  1KC8 T;  1T03 A;  5BR8 J;  1B0P A;  4ID5 A;  1FJG J;  3ISN C;  1NEE A;  1IM6 A;  2V67 A;  1WTF A;  4IRK A;  2R2S A;  3R1L A;  4DWI A;  2MJU A;  3F73 A;  4DR7 F;  4U7U D;  1KHV A;  3AFG A;  1MG7 A;  2I0X A;  3PYF A;  1JXL A;  2JZ5 A;  3TA0 A;  3SMZ A;  1S1W A;  2CVE A;  2CPE A;  1RT3 B;  2M4M A;  4ES3 A;  1IKX B;  1VQS A;  4ZVE A;  2CPY A;  2VH7 A;  1RJJ A;  2DHS A;  3VF0 B;  4TY8 B;  4ICL B;  4LSZ B;  5D4N A;  3IP0 A;  1RBL A;  5BYR A;  4CWB A;  4R0E A;  3TJ8 A;  1KFS A;  2CQ4 A;  2KFN A;  4LF9 F;  1FWK A;  3FGV A;  2KHC A;  4DR2 F;  4N8N A;  4DV0 F;  2BYC A;  4F3M A;  4JI7 F;  1HQE B;  2YKP A;  2A10 A;  1SJ1 A;  2AIR B;  4TU9 A;  1ZTT A;  5EN1 A;  3DRR A;  3DDI A;  2LQJ A;  4TNO A;  1S4F A;  3KLG A;  3N9U C;  1QAJ A;  1RBA A;  5ADZ A;  2P6S A;  3TX8 A;  2BDP A;  1N33 J;  1WTB A;  2LQ5 A;  4GKJ F;  4KKO A;  5E3R A;  4QU6 A;  5J2N B;  3R9L A;  2YWW A;  2ZJP Q;  1LV5 A;  3O5T B;  2IJN A;  1U02 A;  3W5Y A;  2M2B A;  1RWK B;  3OL8 A;  1I94 F;  2ALZ A;  5HP1 B;  1Z4U A;  1S1U B;  3JSM A;  1UWA A;  3NCR A;  4C0H A;  1U1Q A;  3G86 A;  3FBB A;  2B6A A;  1EP4 A;  2KM8 C;  3FRZ A;  1WOO A;  2CJB A;  4UF4 A;  1ZM4 A;  1RAJ A;  3MM8 A;  3RU0 A;  3DRS A;  3EYZ A;  2ZD1 B;  4A8O A;  4ZVP B;  3A3N B;  5JXS A;  1JLC B;  2JOQ A;  5LMN F;  1RTH B;  1XN9 A;  4WP9 A;  2I9S A;  2VG6 A;  4IOC Q;  4P74 A;  1N5Y B;  3RB6 A;  5HSP A;  4B9L A;  2DNG A;  5KFX A;  3FCW A;  3G96 A;  3OW2 R;  2L9W A;  2UUW A;  1DAX A;  2UVW A;  3RBD A;  3NGD A;  4CM2 A;  3TW0 A;  5F8I A;  3PG9 A;  2HNZ A;  1DUR A;  3TAM B;  5LMU J;  1TP7 A;  2JC0 A;  1FK9 A;  3PW4 A;  2CUY A;  4DHV A;  2AV5 A;  2B5J B;  2Y3Y A;  5E3Q A;  3PV8 A;  2X3G A;  2WBR A;  1WKJ A;  1C1B B;  2OPP B;  2HNY B;  4KH0 B;  2HGM A;  4O4G B;  3LGM A;  3H5X A;  3ZTS A;  2UUT A;  4NYP A;  3SCJ E;  2DY1 A;  2V9K A;  2ZH7 A;  4K2X A;  2V8D A;  2RUG A;  4FYD A;  4ZN3 A;  2D3U A;  2QX0 A;  2D1C A;  4Z37 A;  3NP5 A;  3QRP A;  4O3R A;  1C0U A;  4LSL A;  4JI8 J;  2DKO B;  3RAQ A;  1LWF B;  3OHA A;  3MUM P;  4USJ C;  2W2Q P;  3CW2 C;  2IMW P;  4UTG A;  4ILL A;  1PBA A;  4ATN A;  3FSX A;  1WHV A;  1JXV A;  2C2D A;  2ZVI A;  2GHW A;  3OXL A;  1Q8L A;  2J0Q D;  2BAN A;  4QW9 A;  1EX8 A;  5I3Q A;  1RAB B;  1YJ9 S;  4J9S A;  4FKX A;  4TN2 A;  3PYG A;  4OX9 J;  1GT8 A;  2EEY A;  1NSQ A;  1F9H A;  2YY3 A;  4WP3 A;  3PO4 A;  1L3K A;  6AT1 B;  3KUH A;  2BRK A;  2GAG C;  1L5U A;  3G71 S;  2V8V A;  4LMZ A;  2QMW A;  2H54 B;  5CAB A;  2P9E A;  2RU3 A;  4IG0 B;  2EFG A;  2GFF A;  3IAM 9;  1IKY A;  4CTA A;  4K5S A;  1CBK A;  1RKJ A;  2RJZ A;  2MQQ A;  1V3R A;  3PCO B;  1N88 A;  1PYO B;  4USH A;  4IR1 A;  1SQG A;  1WAC A;  2BXJ A;  3PYE A;  3ENA A;  1TK5 A;  2F40 A;  2MQL A;  3GPA A;  2RHQ B;  1PG5 B;  2HQC A;  4X62 F;  2I6W A;  2VG5 B;  4F4W A;  4JI1 F;  1FVQ A;  2XHC A;  2ASL A;  4LRC A;  2E9Z A;  1VQK S;  2XG8 A;  2R7S A;  1UFK A;  2DNZ A;  2B8P A;  2O67 A;  2IRX A;  4ZVO B;  4L75 A;  2FHJ A;  5EX3 A;  3FZB A;  5B0C A;  4DLE A;  4EU0 A;  2F9J A;  4J9M A;  4JI2 F;  3J7A 1;  4QWA A;  2KH9 A;  1DBD A;  1LWC A;  2DXE A;  3UR0 A;  2H4W B;  3KHH A;  3UVJ A;  2MKI A;  2V34 A;  4C3L A;  2OH2 A;  2FJW A;  1S0M A;  1FRK A;  3OFE A;  4ZVT B;  2OO4 A;  1T3O A;  3CNQ P;  4YR3 A;  5GMD A;  2AHO B;  4ED1 A;  5KFO A;  4U8Y A;  1LW2 B;  4OJ3 A;  3IA0 A;  3DOL B;  4WXO A;  2QO3 A;  4CNZ A;  2B3T B;  1K0V A;  4DPT A;  2EVZ A;  2WSF C;  2WVE A;  2WVF A;  1PJ7 A;  2XNQ A;  3K89 A;  2ZZN A;  4RX6 A;  4K7Q A;  2HMI B;  3CIM A;  4JV5 J;  1IBK F;  2GVD B;  3A3P B;  2A18 A;  2X1F A;  2K7K A;  1P9Y A;  3GJS B;  2CRL A;  3N6L A;  2CQB A;  4KGK A;  4DV6 F;  1SB6 A;  4DL5 A;  4IFV A;  2Q6B A;  2XTJ P;  1T03 B;  4C6A A;  1RI7 A;  5A8R A;  2ZE2 B;  1QSY A;  1FI4 A;  1TK8 A;  1NHV A;  1TVR B;  3OSP A;  3BH6 B;  2FVR A;  1REV B;  3MDF A;  1J5E F;  3MMC A;  2HVD A;  3W7B A;  4IUF A;  3O2I A;  3ZZT A;  1GXL A;  3D1H A;  1HWI A;  3NLC A;  4QPX A;  1N5Q A;  3TWZ A;  3C15 A;  1XMQ J;  2Y1I A;  3C8Y A;  2AWZ A;  5KFJ A;  1VBZ A;  1FX2 A;  2E44 A;  3LGN A;  1S59 A;  2RT3 A;  2HK2 A;  1VHI A;  3HSD A;  2EI5 A;  1N5S A;  4DBQ A;  2Q66 A;  5DZ7 A;  2QYG A;  2N3O A;  5CA5 A;  4AL6 A;  3EPG A;  1NZA A;  3QYY A;  3FK4 A;  3WZ0 A;  1P9Q C;  3C66 A;  1W7W A;  1BMQ B;  1VBY A;  4ZVH A;  1UWB B;  2DBB A;  3H2L A;  3B4M A;  2IAJ A;  2D3O 1;  1H6K X;  2RF2 A;  4F4X A;  3FSI A;  1IWA A;  1U2R A;  3TA2 A;  2ATC B;  5HLF B;  3NGU A;  3R5D A;  4MKY A;  4KHP F;  2VPY B;  4QW8 A;  3C16 A;  4KFB A;  1B7F A;  4JI4 F;  3TJA A;  5I3P A;  4CO3 A;  5D6G A;  1SC4 B;  2WHO A;  3VQS A;  1QY7 A;  1S4E A;  3CCU S;  3KLG B;  3BO3 A;  3V6K A;  1RT6 A;  2VHG A;  3O44 A;  4QIF A;  1H2U X;  3GCX P;  2RDI A;  2QA1 A;  1NB7 A;  3KJV B;  4FVC A;  3QQC D;  2KG1 A;  2NPI A;  4LVO P;  1K47 A;  3HJV A;  1FJE B;  3G87 A;  1YVF A;  2I38 A;  4H54 A;  4ZS6 A;  5C2C A;  1HNZ J;  1Q79 A;  4ZP9 A;  2HWT A;  1YDL A;  2GZO A;  4NE9 C;  3JSM B;  1UJ6 A;  4OHY A;  4Y3C A;  4OJG A;  2FUG 9;  4FDF A;  5HMY A;  5JMN A;  3I0S B;  1EP4 B;  3J80 Y;  4DS4 A;  4X4V A;  2FJE B;  4ED0 A;  4M8L A;  4DV3 J;  3EWG A;  3HHL C;  3DRS B;  4ZPA A;  4ZLJ A;  5HMW A;  2HHT A;  1AUS L;  2WSE C;  3MR2 A;  2Z2Y B;  3EVW A;  2ABY A;  4URQ U;  3W2W A;  3HP6 A;  2RSQ A;  2YQ3 A;  4FXV A;  2XC9 A;  2KHD A;  1VIS A;  3GG0 A;  4P52 A;  1SV5 B;  1XR5 A;  4FF3 A;  1CPZ A;  2FLO A;  1VIO A;  5F8L A;  4GKK F;  3IWX A;  5BXI A;  4HHU A;  2DJW A;  3I5A A;  2R8H A;  2ILY A;  1KLN A;  5DM6 Q;  1S0O A;  2YTC A;  4ECS A;  2HNZ B;  1W2I A;  2UUC J;  4PQA A;  1R0A A;  4XO0 A;  3U27 A;  5A6W A;  3P45 B;  4CH1 A;  4X4N A;  4FZV A;  2C42 A;  3MCO A;  2GJ2 A;  2EFP A;  3M2V A;  2H5J B;  3UDE A;  2J8S A;  4P2M A;  4MT1 A;  4PYD A;  2EFN A;  4NCG B;  2HBY B;  3ET6 A;  2E29 A;  2OP5 A;  5ITH A;  4ZPC A;  4NLT A;  4K4X A;  3V5R A;  3DYA B;  2IA0 A;  4ZP6 A;  3SQG A;  1JIH A;  2QG9 B;  3ENQ A;  1Q82 T;  9ATC B;  4DR5 J;  2FVP A;  1IM4 A;  2AX1 A;  4RZR A;  2JNJ A;  3QT7 A;  2ATL A;  4NXN J;  4OI2 A;  4LBI A;  3KYL A;  3ZZP A;  1YJU A;  4J91 A;  1S6P A;  4UOF A;  2FJA B;  2LMI A;  1SBR A;  1RT2 A;  2CA9 A;  1Q5Y A;  1PJ5 A;  4DFP A;  4MKA A;  2QV6 A;  1H0H B;  1PKU A;  3UPF A;  3CJS A;  3W63 A;  4C8M A;  3G82 B;  1S9E A;  1BQN A;  3M30 B;  1N56 A;  3PKM A;  2MZT A;  2YQ1 A;  1NME B;  4Y2M A;  3R6L B;  3H2U B;  4UUX A;  4M5J A;  3VTI A;  2W1B A;  4KIA A;  3SQO P;  1EAY C;  1TMM A;  2YX1 A;  4WP8 A;  1CJT A;  4ELV A;  4O4R A;  2IYI A;  2VOO A;  3DRP A;  1UAW A;  4QIV A;  4DQP A;  1QE1 B;  2G0J A;  1RT1 A;  2P6T A;  3QSY B;  4RWX A;  3SYZ A;  1Q78 A;  2IM3 A;  2E66 A;  1WSV A;  3AJ2 A;  5CCL A;  1Q86 T;  5HBM B;  3C14 A;  1VRU B;  2W9C A;  4OHW A;  1FRH A;  2FY1 A;  3IBF B;  4B9U A;  2GCF A;  3NMA A;  1OQ6 A;  1SKW A;  4NLS A;  3NBP A;  4NXM J;  1MU2 B;  2DNO A;  4DV4 J;  4I1T A;  4ZVG A;  3TAP A;  1U2F A;  2BAB A;  2FYX A;  1LWX A;  4NCB A;  3TQ1 A;  5A0Y B;  1F3V A;  3GR0 A;  1XMO J;  4JYA F;  2G9O A;  5HRO A;  3VV2 B;  2MZQ A;  3W66 A;  5B09 A;  4FVM A;  3IAS 9;  4FN5 A;  2HVZ A;  1QSL A;  2LQ8 A;  4DCO B;  1T9Y A;  5AJ3 J;  2W2M P;  3VGS A;  1WDD A;  2YNG B;  2QN6 B;  2KDO A;  1KWM A;  3HSZ A;  2XYH B;  5KFP A;  3GYX B;  3BDP A;  2VQE J;  1U6Z A;  3K5O A;  4FF1 A;  3DMJ A;  4DU8 A;  1E6V A;  3JAM Y;  3LGH A;  3V4I A;  3G9C A;  3DLG B;  5E5N A;  4JP8 A;  1LWC B;  1SQF A;  4KGX B;  2MHE A;  3PHT A;  3F44 A;  5DQG A;  3IR7 B;  3OJS A;  1WD6 A;  1JLE A;  4JI8 F;  2G0I A;  3FFI B;  3QFW A;  2QZ8 A;  4R5P A;  3BRE A;  1NHU A;  4OQJ A;  4JOU A;  1Y7P A;  1TL4 A;  1L3U A;  2YKN A;  1JKH A;  1GTE A;  2MZS A;  2JLF A;  1HAR A;  4OV6 A;  1F5B A;  3ZTO A;  2W4C A;  4DCJ B;  1SC1 B;  1HHQ A;  1N32 J;  2MTL A;  2OD4 A;  1UVI A;  5ETO A;  4RW9 A;  3HZE A;  3V6J A;  1TKD A;  1JX4 A;  3SI8 A;  2ZHA A;  2JFD A;  1GMV A;  1F6T A;  2APO A;  1HNI B;  2RB7 A;  4JI3 F;  2KT2 A;  2YQ0 A;  1FJ7 A;  3DRY A;  3OR1 B;  1RAO A;  2GQ2 A;  2RRN A;  4WFX A;  1G3O A;  2PGC A;  3PJW A;  2AU0 A;  1RAC B;  4CLL A;  2WON B;  3IC1 A;  3R5B A;  3W60 A;  4CO2 A;  3DN9 A;  5A8R B;  2QMX A;  4RW7 B;  2ZFH A;  4KAI A;  3QZ7 A;  4UT4 A;  2C28 A;  3MMC B;  4YDX A;  3SCL E;  2XI2 A;  2D3O R;  4DR1 F;  3C15 B;  4DR4 J;  1RXO B;  3FEX B;  2ZZT A;  2F3J A;  1DJ0 A;  2OSQ A;  2KU7 A;  1VQM S;  2ZVS A;  1NJZ A;  4IDK A;  1FKP A;  1WOR A;  4PG4 A;  4C8Y A;  2B8Q A;  1UP1 A;  4C3M A;  3ISZ A;  4KGZ B;  5T7L B;  4DG1 A;  3AT1 B;  3RR8 A;  2XZT B;  2DNM A;  2BRL A;  3LP2 B;  2VG7 A;  2RF2 B;  3EM1 A;  1VRT B;  3PVX A;  3T5K A;  3MOZ A;  3E2E A;  3L3C A;  5MAO A;  3JS9 A;  2AEJ A;  2ACY A;  3C16 B;  2XS2 A;  2ZWP A;  2MPU A;  1QAI A;  1BD6 A;  2MSS A;  4RW8 B;  3Q8V A;  1EQM A;  2N7Y A;  1M5K C;  3E3X A;  4JV2 A;  2KTQ A;  1H2V Z;  4EWT A;  4LBP A;  4QIG A;  2ZBR A;  2C2Z B;  2HG4 A;  1GXU A;  1RT6 B;  4CLP A;  3K58 A;  1H3D A;  2PFD A;  2QA2 A;  4C7Q A;  1QLN A;  5GVQ A;  5C25 A;  4KJI A;  3KHR A;  3CJK B;  5GAG I;  4ILM A;  1V5V A;  4AXI A;  2UP1 A;  3KLF A;  2QFJ A;  1IWG A;  5CYJ A;  3QNW B;  3UNY A;  2HIQ A;  3BKF A;  4A8X A;  3KDO A;  1IR1 A;  3FEZ A;  1T9X A;  5HK4 A;  4F2S A;  2JLE A;  4Y2I A;  2G13 A;  2FLP A;  2KI2 A;  3RB0 A;  4QWD A;  5E3P A;  1TL3 A;  3JQK A;  2J9D E;  4O23 A;  3QIP B;  2H5E A;  2NS1 B;  1WNE A;  2DHH A;  1M5P C;  4QCL A;  1LFW A;  5K9F A;  2J6U A;  2DR5 A;  1S0V A;  4PAB A;  3EX7 B;  1FDD A;  3JSR A;  3RRG A;  5IS2 A;  2CQ3 A;  2R3V A;  4DR6 J;  5DS7 A;  1EET B;  3AOD A;  3IG1 A;  1QSS A;  5F3T A;  2K3K A;  3AB4 B;  2VA2 A;  1VQL S;  1WEL A;  1MLA A;  3QSI A;  1R0A B;  4IKA A;  3I31 A;  4YQW A;  2V63 A;  3ILO A;  1YGY A;  3VGV A;  3ENV A;  3WX4 A;  4GRS A;  5KFT A;  4EO8 A;  3ET6 B;  4PEO A;  2MQM A;  4YY3 J;  3DLE A;  4QPT A;  4KTQ A;  1S9F A;  1LOU A;  3OR2 B;  2GHP A;  2CQC A;  4J9K A;  1MMN A;  2FGC A;  3M2U A;  2WAQ D;  2GJF A;  1TUG B;  3SQG B;  1R8H A;  3AAW B;  1DFD A;  3CTR A;  4RW4 B;  1VQY A;  1Y3K A;  1LK5 A;  4QR2 A;  3ETO A;  2NXE A;  4DSK A;  3TUI C;  3W5Z A;  1YI2 S;  3MEC A;  1S6P B;  5CCM A;  3HD1 A;  1AFJ A;  2L3M A;  2FZC B;  4FBU A;  4EYI B;  4ZIT A;  2O66 A;  2RDD A;  2MQP A;  5AT1 B;  3CJ3 A;  2R7W A;  4OL8 A;  4X65 J;  4HYK A;  3UCZ P;  3J7Z T;  3ENW A;  3OTD A;  2AZ3 A;  2RDJ A;  2V6A A;  4F0H A;  1UMJ A;  5KFI A;  5C2G A;  4OX6 A;  4WK3 A;  3L9Z A;  3MM6 B;  2AJ4 A;  3BM7 A;  1B3T A;  3KLH B;  1X0F A;  1AUD A;  1RQ0 A;  2BKN A;  3DRP B;  2MB0 B;  3A8K A;  1Z1Z A;  1RT5 B;  2UVU A;  5KG5 A;  3CUN A;  2RS2 A;  3KHG A;  1TL7 B;  1LKZ A;  2AQ4 A;  2DNR A;  2OLW A;  1UCN A;  3C14 B;  4RNM A;  1QTN B;  4JI5 J;  3AD9 C;  2W9C B;  3ETM A;  1VGY A;  3RZA A;  3OJU A;  2DO4 A;  4UZC A;  2AX0 A;  2W24 A;  1AW0 A;  2I1R A;  2OD6 A;  2ROG A;  4Y2C A;  1FXD A;  2UUC F;  1OIA A;  2K06 A;  3JTN A;  3RGI A;  4Y65 A;  1EKR A;  5KT6 A;  4ZHR A;  2XS7 A;  1HBM A;  4DZD A;  5KT7 A;  2HFZ A;  1YJW S;  3DDN A;  4ER8 A;  3GFZ A;  3DNC A;  2DGX A;  5KFR A;  2W4P A;  4LF5 J;  2KVQ E;  5FD1 A;  3M6X A;  4GMK A;  5HRO B;  3QGG A;  4NLY A;  4LF6 F;  4CO5 A;  1NPK A;  1EZZ B;  3SXL A;  1TFW A;  1ZM9 A;  2ZNY A;  1O8B A;  1VDH A;  2CWK A;  2ZH6 A;  1JLF A;  2YWK A;  4BLG A;  2FJD B;  3BGR A;  2ZH5 A;  1HR0 J;  2MJN A;  5MLC V;  1SH2 A;  4I6Y A;  3DMJ B;  2HK3 A;  4X4O A;  3HKW A;  3T5H A;  3UN2 A;  1ELO A;  3GWC A;  4N77 A;  3GYN A;  2XY7 A;  3BN7 A;  3HZG A;  4I6W A;  2WZ1 A;  1WC4 A;  3AOB A;  3SV4 A;  3TZY A;  1JLE B;  4ZJL A;  7FDR A;  3TX0 A;  2Q6C A;  2JEG A;  1V9O A;  1H74 A;  2UU9 F;  5GAE I;  2ALY B;  4ZVQ B;  1WHW A;  1JKH B;  2DEJ A;  1TMJ A;  5BYQ A;  4FXD A;  3R27 A;  3RG6 A;  2FHM A;  2M8D B;  3BGF A;  2CDR B;  1NPP A;  4IQM A;  5GMK a;  3NAH A;  4RW9 B;  5FJ4 A;  4NYO A;  4TXS A;  5A8K A;  5HVH A;  2WVD A;  2JEJ A;  2OEK A;  2VL1 A;  2LEP A;  5DRK A;  2VBX A;  1LQ9 A;  4R25 A;  2U1A A;  3DFE A;  2PT0 A;  3QO9 B;  3UD4 P;  2FJX A;  3M4X A;  1X7V A;  2Z58 B;  4H4K A;  1QVF R;  1S99 A;  3GG1 A;  1RWO B;  4M5L A;  4P7T A;  5GME A;  1FXR A;  1I5O B;  3QBC A;  2GV1 A;  2XMA A;  3TA1 A;  5IM0 B;  2MQN A;  3BQ2 A;  1OY8 A;  2KJW A;  3EGZ A;  2UXB F;  3RTV A;  3DLJ A;  3DOM A;  3PHE A;  5LJ5 Y;  2Y8Y A;  7FD1 A;  2V94 A;  2JJ4 D;  4RKU C;  2KXH A;  2KYX A;  4ED6 A;  4IDK B;  2F5G A;  5GAH I;  1PAU B;  4NA3 A;  1N5T A;  5KFC A;  4P73 A;  4C3K A;  4DSL A;  3EGN A;  1M5S A;  2IM2 A;  5B0B A;  2X3D A;  2KXF A;  1UPM B;  3CCV S;  1UA0 A;  3BB5 A;  3W1Y C;  3MD1 A;  2VQE F;  1RZM A;  4TVA B;  3OPK A;  2XI3 A;  4DV5 F;  2XYG B;  4CT9 A;  3R8Y A;  4GO5 X;  4KV8 A;  3MAA A;  3D0G E;  2VG7 B;  2MKC A;  4HT5 A;  2F8M A;  1RWM B;  2AP6 A;  1D9A A;  1PGZ A;  1O6X A;  3LP1 A;  3MMB A;  4I64 A;  3QWP A;  4WII A;  5HVF A;  2BV3 A;  4ECQ A;  3DGP A;  1ICE B;  4D3H A;  2HQ3 A;  4CNY A;  3IO1 A;  2YNH A;  2DHG A;  2UUB J;  3NY0 A;  3SIP B;  1P1T A;  4ZVU B;  3CJR A;  4YHH F;  4LF4 F;  3NNH A;  2FD2 A;  5D0H A;  1K1S A;  2IVF B;  5JVH Q;  3ZZ0 A;  2FDN A;  3KLE A;  1XC9 A;  2HVE A;  2CNL B;  2XWX A;  5M2U A;  4CM0 A;  3G8T A;  3ADA C;  3O1L A;  1NCL A;  3KLF B;  4Q2L A;  4QWB A;  1OYD A;  3W8P A;  5F41 A;  3N0V A;  1DY3 A;  1WEY A;  3HSG A;  3HMJ G;  4RW6 B;  3KWM A;  3KG1 A;  1UVM A;  4U7C A;  1UVJ A;  2HHX A;  5EX0 A;  4I2P B;  2N4D A;  3H5Y A;  1TL3 B;  1S1T B;  3MFI A;  2HND A;  3R7S B;  4QIW D;  1IR2 A;  4M5D B;  3K8W A;  4HR2 A;  2R42 A;  3LQV A;  3IR6 B;  4L76 A;  2R7R A;  3UD5 A;  2DK2 A;  4DFK A;  1YQH A;  2OPR A;  3QAT A;  2HHH J;  1X31 C;  3C19 A;  4OI1 A;  2H4Y B;  2DNH A;  2KYZ A;  3D9B A;  4EEY A;  3HM9 A;  2BQU A;  5H1S V;  1OYE A;  2JFK A;  1NH8 A;  4FPI A;  2J9C A;  1RWV B;  2DGV A;  4OX7 A;  4H4M B;  3D67 A;  2J6S A;  1RAE B;  3Q83 A;  3LAN A;  4CH0 S;  3W2V A;  2HLU A;  4KHM A;  1VBX A;  4DL4 A;  1N0U A;  1J2V A;  1UFL A;  4B3T J;  4O0N A;  1FD8 A;  4ZIW A;  2CYY A;  2GW8 A;  3DLE B;  2XUL A;  1JLG B;  8AT1 B;  4OYA A;  2ZKU A;  2VIH A;  1RAI B;  3M2U B;  4LFB J;  1S1X A;  5DQH A;  1VK3 A;  3HJF A;  3Q8Y A;  1U45 A;  3ZZZ A;  4K5R A;  2E9R X;  4F02 A;  3MEC B;  5AXM A;  3QAU A;  5KFH A;  1X4H A;  2ZHO A;  4USK A;  4QYZ J;  3SDE A;  1Z2Z A;  4DL0 C;  1ZPW X;  1PSD A;  3I82 A;  1NK7 A;  3GJT B;  1Y5L B;  4NLG A;  3UD3 P;  1CUL A;  3UNG C;  2YPY A;  3DM2 B;  3L95 X;  1HBO B;  1C1C B;  3TJ9 A;  3WQP A;  1SH0 A;  1VJQ A;  1U8W A;  3M6W A;  3IBW A;  2Y1J A;  1CS4 A;  1TTH B;  1XK8 A;  4B3S J;  2DD8 S;  2M0G B;  5HMX A;  4A8Y A;  3AD7 C;  2IDL A;  1UZH A;  2OJ3 A;  3IFE A;  1LW0 A;  5CZX A;  2CPH A;  4FYW B;  1FNM A;  2WBM A;  2E5G A;  2ZDP A;  1NK6 A;  2J9E A;  4M5I A;  4I6A A;  3A13 A;  4OJH A;  2Q1L A;  1ZTW A;  2RS8 A;  3IM8 A;  1NHK L;  1RSC A;  2VOD A;  2J7W A;  4X64 J;  4DPY A;  3MED A;  2BKP A;  4ZPV R;  4ZHR B;  1HBM B;  1CSJ A;  3W9H A;  2R4F A;  3UN5 A;  3BO2 A;  2CQH A;  4ZPB A;  3D6H B;  4NWB A;  1SCJ B;  3AXM A;  4EK2 A;  4FP9 A;  2YKQ A;  5DET A;  3ZZU A;  2DCU B;  2DH7 A;  3NGT A;  1U25 A;  2UXC F;  5AXL A;  3RBE A;  1BLU A;  4KR0 B;  3GII A;  2XGQ A;  3Q2T C;  1T11 A;  1APS A;  4PQU A;  2ZUA A;  2B4P A;  2QRR A;  2ZDO A;  1SPB P;  1KQF B;  2GIQ A;  2IM0 A;  2XMW A;  2GML A;  1UEV A;  5T41 A;  5KT2 A;  4JI0 F;  1GEH A;  3H0P A;  3PO5 A;  3IXQ A;  2MST A;  2B43 A;  2L48 A;  4DSF A;  4X65 F;  1RTZ A;  2HGL A;  3EGV A;  2CVI A;  2HHV A;  1K9M T;  4WZM A;  2A1B A;  1WKK A;  3AXK A;  3PNI A;  1U6F A;  3Q22 A;  1KP6 A;  1F2G A;  1TKT A;  1MW7 A;  4X4T A;  4C8K A;  3CB4 A;  1HWU A;  3TUZ C;  1DQ9 A;  1K73 T;  5A8K B;  4HKQ A;  1UA1 A;  2BUN A;  3KXD A;  4F4Y A;  3K5M A;  3HT0 A;  2N7C A;  3LAL A;  2R2T A;  3PR5 B;  1NSP A;  1PC5 A;  3I56 S;  1DLO A;  1VLY A;  4OHX A;  4KGM A;  4F3Q A;  1NUE A;  4UQG A;  5C7P A;  3M9O B;  3CSK A;  4P72 A;  4GC7 A;  3THV A;  1WF1 A;  3FMW A;  3CD6 S;  4DUT A;  3SV3 A;  3M8W A;  1QDU B;  3EZ5 A;  2JLG A;  1HKA A;  3KLV A;  1H72 C;  2C2R A;  2LXI A;  2W7P A;  1Y5I B;  4PR6 A;  3DOM B;  2C3M A;  3GIM A;  2BX6 A;  3HFK A;  4LF5 F;  2G4B A;  4LRA A;  2FY8 A;  1VK8 A;  3E01 A;  2VB6 A;  3HHE A;  4HH1 A;  2IBO A;  1RHQ B;  2LDY A;  5LXR A;  1C0T A;  4P75 A;  4ANC A;  2JEF A;  4HT7 A;  1DTT B;  2HPU A;  5J2M A;  4X66 F;  4DL3 A;  1YSJ A;  1NKE A;  2D69 A;  4KHR A;  1HMV B;  2UVR A;  1B0V A;  1RAD B;  3HSJ A;  1G4C A;  3MUT P;  3H2V E;  5IQ6 A;  4W98 A;  1P8G A;  3LP1 B;  1V6H A;  3MMB B;  1JLA B;  2ZBC A;  2PEH A;  2J6T A;  4PG6 A;  4CLU A;  1HW8 A;  2D74 B;  4N56 A;  3A1Y G;  1AA1 B;  1UJ5 A;  1AZS B;  2EK1 A;  1NKC A;  4M5N A;  4QWC A;  3P6Y C;  2MLX A;  4O44 B;  1VC0 A;  1FKO A;  3Q24 A;  1RWN B;  4LFA F;  2M5Y A;  3SSR A;  4DU7 A;  2YNH B;  1UZD A;  2PD1 A;  4DXL A;  2HKE A;  1TQL A;  1NDK A;  2KN4 A;  2XMT A;  3OVS A;  1NDC A;  3NOG A;  2WVC A;  3MUV P;  4DSE A;  4ZP8 A;  2CQ1 A;  4B3R J;  3MMA A;  1ZET A;  3IWN C;  2ZOG A;  2VIC A;  5FLX U;  3CXC R;  3M9M B;  3QRQ A;  3TZZ A;  1XJW B;  4DX5 A;  4DL7 A;  1N4L A;  3FBF A;  2ZJR Q;  4ECW A;  5KFF A;  2OEJ A;  1RYR A;  4M5G A;  2LKZ A;  4DV1 F;  3PEJ A;  4KO0 B;  4OI4 A;  3NGK A;  3CD5 A;  1FA0 A;  4PXE A;  1WG5 A;  1NJX A;  2G2O A;  2HVI A;  3MR6 A;  3TO8 A;  2BJ9 A;  1N52 B;  2B4V A;  4P7V A;  2KM8 B;  1TU0 B;  1OSD A;  3OQ2 A;  2DRD A;  1L3V A;  4ES1 A;  2FGO A;  3MCS A;  3GR1 A;  4WIQ A;  1S97 A;  3TAR A;  4I7F B;  2ADC A;  4PG8 A;  5J1E B;  4N41 A;  1F1B B;  2OML A;  1IR0 A;  1F9F A;  5G0R A;  4DX6 A;  6FD1 A;  4LR9 A;  3M8Q B;  1HI1 A;  2GA7 A;  4DSJ A;  3VAM A;  2BE7 D;  4NI2 A;  3UR3 C;  3DGV A;  1Y10 A;  1XR7 A;  1AB8 A;  3CCW A;  1FFS B;  4S0M A;  2AYM A;  2QLX A;  3CO9 A;  1W26 A;  1SC3 B;  1EKS A;  2XMV A;  2XCA A;  2KL8 A;  1Q8K A;  1UVK A;  3CJ2 A;  2PII A;  4QOT A;  5LSO A;  5DGA A;  4F4A A;  4B9M A;  2QA4 G;  1WWH A;  1RP5 A;  1M1K T;  4XPE A;  3PIP Q;  2IY5 B;  4O3O A;  1JMT A;  5HL7 Q;  1F5C A;  1VQ5 S;  1RTI B;  1K44 A;  1EHW A;  3K59 A;  1HBU B;  3G6Y A;  3B6B A;  2DVI A;  4C0O C;  4WKR A;  4F26 A;  3KJQ B;  4RO0 A;  3IS9 A;  1S12 A;  1T94 A;  2KFZ A;  2ZH2 A;  1XIQ A;  1XTZ A;  3FDS A;  1CUL B;  3R5G A;  5J2P A;  1KON A;  5K20 B;  3J81 j;  1UPP A;  2CXE A;  3J7Y I;  1IVZ A;  4V19 X;  4NLQ A;  4ZPD A;  3K5L A;  2M70 A;  2QMU B;  2AJ2 A;  1CS4 B;  2KZZ A;  3TVK A;  2EPI A;  1S9G B;  1R7I A;  1WKL A;  3VGT A;  1P6T A;  2FPH X;  5FDL A;  1BGX T;  2EW9 A;  3FMB A;  5KT3 A;  3PR4 A;  3WIU A;  3QLH A;  3BBF A;  4L3K A;  1GQE A;  1FWP A;  3W9J A;  4LR8 A;  4F2R A;  2ASY A;  3EVO A;  4NCA A;  2I5J A;  5D15 A;  4C2M A;  3ZXW A;  1IBL J;  2VFR A;  4HTI A;  5IWA F;  1N36 J;  1TK0 A;  3ISN D;  4NLD A;  1YLX A;  5LM7 E;  1NJI T;  4I2Q A;  3VWS A;  4Q8E A;  2QEX S;  2DNL A;  3POT B;  2HLT A;  1ZZN A;  3GON A;  1D09 B;  3IWL A;  4DV7 F;  3VVU A;  2VV5 A;  4IRC A;  3UI3 A;  1J5O B;  2XGP A;  5KOX A;  3ULH A;  4B3T F;  4QYZ K;  3D1Q A;  1FRX A;  2CNO B;  3P5T L;  4OI3 A;  3I0R A;  1E6Y B;  3IGV A;  2HHQ A;  1X4C A;  2FVS A;  4YB5 A;  1TEL A;  3EMT A;  4IOA Q;  4ANE A;  1Y00 A;  4ENO A;  1PYT A;  1NJY A;  2W9A A;  2E1A A;  1XNR F;  2W25 A;  4CLZ A;  2PMZ D;  2CFX A;  1X4A A;  4B02 A;  4OLO A;  3WDO A;  4DQR A;  4R8U B;  4C98 A;  4DMZ A;  1YWX A;  2ZKT A;  3EJM A;  4DL2 A;  3B4D A;  2HQF A;  1T0T V;  4AND A;  2DB1 A;  5IT0 A;  3KK3 A;  1A6L A;  2W7A A;  1KKH A;  4DR3 F;  4ZJQ A;  1PO6 A;  1VQ4 S;  4ZJO A;  1GK8 A;  3DLK A;  2RE1 A;  1RAG B;  2P2C B;  4ZCK A;  4ZK7 M;  5CYQ A;  2VUG A;  3JTP A;  1VQ6 S;  4CH7 A;  4B3S F;  4O3P A;  1FFW B;  2YBV A;  2F4V J;  4L74 A;  3BGO P;  2KRR A;  3Q8R B;  4PXD A;  1DLO B;  4YP3 A;  3BSC A;  5E0O A;  4ELT A;  1TKX A;  1ZM2 A;  2RKI A;  3GIL A;  1JLQ B;  3D68 A;  1D9F A;  3HFZ B;  2BQ3 A;  4OYP A;  2SXL A;  1R89 A;  4DCP B;  4H4K C;  3H5U A;  4F25 A;  2JDJ A;  5HVG A;  3GIK A;  1NAQ A;  4X64 F;  5IV4 A;  1RWP B;  1CC7 A;  4N47 A;  1CJU A;  4URS A;  4ED3 A;  3JSY A;  2B9E A;  3FUY A;  2VC1 A;  5HAN A;  4NPO A;  4HVZ A;  4I69 A;  1M5O C;  3FQK A;  2HRT A;  4I4B A;  5DGB A;  3MR5 A;  3BPD A;  3M2R A;  1T05 A;  1NSK L;  5KG3 A;  3E01 B;  4C11 A;  1C0T B;  2ZIT A;  1WOP A;  5K8N A;  2OSR A;  3KG4 A;  2MGZ A;  2IC3 A;  1FX4 A;  3V4M A;  4MFB B;  1VI7 A;  1N34 J;  3BSN A;  3AJ1 A;  5IC6 B;  4OYX A;  1WUU A;  3UW1 A;  1NK4 A;  3E8O A;  3R97 A;  2GGP B;  4WU2 A;  4DN9 A;  3QGP A;  2C2M B;  3M8Z A;  4GVB A;  4DPO A;  1KOH A;  5F0U A;  1JLB A;  2OMO A;  1HHT P;  1RGV A;  3I5C A;  3BR8 A;  4FKY A;  4KE5 A;  4N76 A;  3MPY A;  3PX4 A;  2V5H G;  3KK2 A;  2ERR A;  2DNP A;  2HWI A;  4DEZ A;  4KRW A;  3VZI A;  3U7J A;  5B0A A;  2OEM A;  1IJE B;  3GSD A;  2VFT A;  2ZOM A;  4F4Z A;  5HAO A;  1QTM A;  3RW6 A;  3L7U A;  1BQM B;  4ELU A;  2AJ1 A;  2KKH A;  1UTA A;  2EFV A;  2VQF J;  1RHR B;  3Q2S C;  2HFS A;  3BEG B;  3D4J A;  1K8A T;  1ZA2 B;  3MM7 A;  3CJ8 A;  2ZH1 A;  1O51 A;  2HSE B;  5CD4 H;  2F65 A;  4J5O A;  2HHW A;  4H4O B;  4U96 A;  3HUL A;  3NNA A;  4RJV A;  2MLY A;  4JI6 J;  5E7O B;  3W9I A;  1KLM A;  5HQ8 A;  4LF7 F;  3CIZ A;  4J90 A;  1FCA A;  3OL7 A;  3DKD A;  3L7O A;  2WOM B;  5CQG A;  2WW4 A;  5I3U A;  1T9T A;  3C6U A;  2LVW A;  2HBQ B;  4WBF A;  5K5M A;  3HHL B;  2H48 B;  3MCM A;  3SSS A;  2QA4 S;  1VJW A;  1FRJ A;  3R2D J;  2CJY B;  4PUO A;  4K4Y A;  3KKF A;  2DR8 A;  4X4U A;  5KFD A;  3RRH A;  3DOK A;  4DUY J;  2MHN A;  4W92 B;  3CJ5 A;  3GFY A;  3H98 A;  2JWN A;  4OV1 A;  4DDF A;  1NZ8 A;  1M90 T;  2HZV A;  4CRJ A;  1IN0 A;  4LUB A;  3A12 A;  1JB0 C;  4DQS A;  4MIW A;  4MIB A;  4Q43 A;  4G3I A;  1IXK A;  4TU8 A;  2HWH A;  1U2C A;  1UFW A;  3DI6 A;  4WZQ A;  2KT5 A;  1DRZ A;  2W8L A;  2PO4 A;  4D3G A;  5DG7 A;  2XLK A;  4IG3 B;  3IMQ J;  3ICL A;  2JSX A;  1X5O A;  2ZOF A;  1MN9 A;  2XY6 A;  1ULR A;  3LO3 A;  3TZW A;  4C4W A;  1I51 B;  3IM9 A;  5KFK A;  2RD5 C;  3H4B A;  4OX8 A;  2PMH A;  5J2P B;  1RWU A;  2ZZM A;  3KG0 A;  4DF4 A;  2UUA F;  3K57 A;  1Z2L A;  1OSC A;  3OBI A;  3BF4 A;  3ITH B;  3D5M A;  3IRX B;  2M7S A;  3M7V A;  4CYU A;  3DLB A;  3VCD A;  3OTO F;  3JSB A;  1AFI A;  2Q43 A;  3MD3 A;  1DZ5 A;  5D4O A;  5K8M A;  3GFX A;  3M1V B;  1RAF B;  5FDL B;  5DQI A;  3CUL A;  2YWE A;  2LA6 A;  3QLH B;  4YOE A;  1FKA F;  4FF4 A;  5ETK A;  4AQY F;  1RYS A;  2A6O A;  1N5V A;  2I5J B;  1RT7 A;  3MFH A;  2NQP A;  1LK7 A;  3ZTQ A;  4BBY A;  4B3M J;  1HWK A;  4XDC A;  3TEH B;  2V9W A;  4CCH A;  1CLF A;  3B78 A;  1RLC L;  1RB0 A;  3T1A A;  4X4S A;  2RIL A;  3ZC4 A;  2R8K A;  1X4F A;  1RTD B;  4HAC A;  1S1V A;  4WE1 B;  5KFY A;  4UY8 T;  1GX6 A;  4JV1 A;  5F8J A;  7AT1 B;  3SSQ A;  3RB3 A;  4IQX A;  3CD0 A;  3D54 A;  1FTC A;  5E3C A;  2IM1 A;  4F3O A;  2GS8 A;  1WDT A;  4M5M A;  1TV6 A;  2JVO A;  1U1O A;  2J7U A;  2IPO B;  1DTQ A;  4QWE A;  2D3Z A;  4DR7 J;  2XBP A;  2DNN A;  3OFG A;  1R8A A;  1TKZ B;  3AA9 A;  1OO0 B;  5CH7 B;  2JEI A;  2M8H A;  2BE2 A;  3BYR A;  3OFF A;  4P2F A;  3AA8 A;  4W4M A;  3BZQ A;  4USM A;  2YNF B;  2V8H A;  2OKQ A;  5KFW A;  4X4R A;  3MR3 A;  2CPI A;  4OZ1 A;  2CPJ A;  3OFH A;  3VAK A;  4MAK A;  2W9B A;  2NLW A;  2G1D A;  1HI8 A;  3R6G B;  1D8Z A;  2AMC B;  1ZOT A;  2QGF B;  3L7P A;  1PC4 A;  2MEW A;  1KTQ A;  2OPS B;  3FJ2 A;  1S6Q B;  2QLB B;  3GIJ A;  2GQQ A;  4CLY A;  3T1Y J;  1GMW D;  2BJD A;  2BJ3 A;  1HNW J;  3DCA A;  4PPD A;  4B9V A;  1OMS A;  4UZB A;  3DC2 A;  3U1M A;  4LF9 J;  3DHW C;  4Q8F A;  5F8G A;  4DR2 J;  4DV0 J;  4LFC F;  4ZVF A;  4DPW A;  3P5B P;  4DQI A;  5DJB A;  4K4S A;  2PSZ A;  4ZIV A;  2CKW A;  3FKB A;  2ZC4 A;  4UW2 A;  2DCL A;  4NLV A;  1GAO A;  2Z0G A;  1FWL A;  1AYE A;  4GKJ J;  3BBB A;  3CCL S;  1EIY B;  3KLI A;  1FE4 A;  3CDB A;  2H9Z A;  2MZR A;  4UOH A;  2B7C B;  3JQM A;  1CJU B;  4DUZ F;  2FC9 A;  1UL3 A;  1I94 J;  1YKW A;  3HHL D;  3IGN A;  1Q0N A;  4MK9 A;  4ID5 B;  4ZKA A;  1BHN A;  3FZ2 A;  2WK4 A;  1OY6 A;  3M2R B;  2UZA A;  3BH7 B;  3U02 A;  2N82 B;  2B4U A;  2HS0 A;  3L4B C;  1X5P A;  1XEZ A;  2LDI A;  5KFQ A;  3T19 A;  3CF5 Q;  2OPQ A;  4MYT A;  3SFG A;  1JNR B;  2YVS A;  2RQM A;  1FD2 A;  5E3A A;  4LQ9 A;  3QRR A;  2YKA A;  4KC5 A;  4LQ3 A;  5KG6 A;  3OUY A;  2J7K A;  3S6E A;  3PW2 A;  5K8O A;  2RNE A;  3OXG A;  2C3O A;  2L08 A;  1HBN A;  2GO9 A;  4LR7 A;  5LMN J;  3MM9 A;  3KJF B;  3H4D A;  2V2Z A;  2GAH C;  2VFV A;  1S1W B;  4FF2 A;  4XPC A;  4WPA A;  1RT3 A;  3M8Y A;  1URR A;  4GVB B;  3TUP A;  3DLL Q;  1JLB B;  5DDQ C;  3WBZ A;  2NUU G;  1SL0 A;  2D9P A;  2VKZ G;  1BE4 A;  3M8R A;  2ZWO A;  1O5J A;  4TY8 A;  1G2E A;  1JNZ B;  5KG0 A;  1YX2 A;  1XNQ F;  3LF0 A;  2KRB A;  3O6Q A;  1YK9 A;  3RRK A;  2N3L A;  4PXB A;  3RW7 A;  4DOZ A;  1SJ4 P;  2AGO A;  1HQE A;  5D4L A;  4C8Z A;  3HO1 A;  1X4D A;  5G4D A;  4LRB A;  3EE3 A;  4X84 A;  4GVL A;  1Q95 G;  1R6Y A;  3DRR B;  3RB4 A;  3MM7 B;  2P9C A;  4Y6I A;  3BGL A;  1TUW A;  1Q7Y T;  4KKO B;  2POK A;  5J2N A;  4OYO A;  1JJ2 R;  2VPW B;  3RAM A;  4EBC A;  3TEG A;  2HBZ B;  1TL5 A;  3Q8U A;  1KLM B;  2CAJ A;  4FYY B;  5BR8 F;  1SKS A;  3T1H J;  3NGS A;  5HP1 A;  1FJG F;  2Z4P A;  3QT5 A;  1WC1 A;  1B7Y B;  5CD4 A;  3C6U B;  1X0P A;  1YBT A;  2B6A B;  3TVY A;  1S77 D;  4CO4 A;  4TY9 A;  2RRA A;  1T7P A;  3PRB A;  3MM8 B;  2X1A A;  4IRD A;  4YR2 A;  3Q8S B;  1RDR A;  2PC6 A;  1JLC A;  3C46 A;  4Q0B A;  2DTJ A;  3HKZ D;  1RTH A;  2PI4 A;  3HVR A;  2EKN A;  2VG6 B;  5F3Z A;  1N5Y A;  2IYG A;  4BHQ A;  1YJT A;  4NLW A;  2XMK A;  4C48 A;  1HYS A;  1B64 A;  3K17 A;  1J27 A;  4NML A;  2CQ0 A;  2XB2 D;  2DR6 A;  3FQL A;  3ILI A;  4A8Q A;  2H3E B;  3TAM A;  5GAG U;  1EB0 A;  2RML A;  5F9L A;  1FK9 B;  4KH1 B;  4X62 J;  4J9U E;  2CQP A;  4FNI A;  3IN5 A;  3NRB A;  4FNH A;  1C1B A;  2HNY A;  4ED2 A;  1KTV A;  2WVB A;  1V5I B;  4DX7 A;  1GTH A;  3FCH A;  4HHH A;  1JWW A;  1M0S A;  3H25 A;  3I96 A;  3DDK A;  2DXF A;  1VOM A;  4ZMM A;  2QJ3 A;  1SKR A;  2MDA A;  3PTW A;  4JI2 J;  2NYH A;  1N33 F;  5AXK A;  2P5V A;  2C2O B;  4G1I A;  2FVQ A;  2BJ1 A;  1OWX A;  3R5C A;  2MKY A;  4OZ5 A;  3N28 A;  1C0U B;  4CYU B;  1T3N A;  3M32 A;  2L41 A;  2ZHB A;  4LSL B;  2KVI A;  1LWF A;  1XQI A;  1YRT A;  3CCR S;  3MPD A;  1NND A;  2DGO A;  3N6N A;  4PWD A;  4EBE A;  2LEB A;  2OIH A;  3DRX A;  1UET A;  2BAN B;  3J7Z 5;  4RU9 A;  4XTT A;  3MAH A;  5B7W A;  2ZJQ Q;  1A7G E;  1A9N B;  3T6J A;  4ERD A;  1VS3 A;  2GIR A;  3CWJ A;  2RHS B;  2LCW A;  2R7V A;  1YG0 A;  4ALZ A;  3HF5 A;  3QT8 A;  1M1G A;  4CP5 A;  4DUY F;  4DV6 J;  4NAS A;  3Q89 A;  1SQE A;  3MZI A;  5EWG A;  2XNR A;  4IG0 A;  4K4U A;  1IKY B;  3NCQ A;  4CTA B;  1WC6 A;  2ASJ A;  3H42 A;  4NX9 A;  2ZBQ A;  1X4B A;  2V4J A;  1J5E J;  2VU5 A;  5LMU F;  1IKV A;  3GZ7 A;  4BCA A;  3EXY A;  4PAA A;  2P9G A;  1NSA A;  1U6B A;  2ILZ A;  4F36 A;  3UO0 A;  4LRD A;  2VG5 A;  4A47 A;  3H40 A;  1P27 B;  2DEI A;  3BS9 A;  5C42 A;  4EZ6 A;  1VC6 A;  2E1M C;  2UV8 G;  2BW7 A;  5D77 A;  2W9B B;  4CLT A;  4Q7A A;  2DGW A;  1MML A;  2UXD J;  4YB7 A;  3OL9 A;  4B9N A;  4QR0 A;  5JUM A;  1ZYQ A;  1KNZ A;  1BC6 A;  3CED A;  2B56 A;  3UVJ B;  3CT9 A;  3H5S A;  4KHP J;  3D0I E;  4PWW A;  1D9D A;  4N7T A;  2B4O A;  1LXN A;  1XWL A;  4JI4 J;  3GB0 A;  4DZ6 A;  1MSW D;  1HQ2 A;  4J9N A;  3PW7 A;  5CZV A;  2HBR B;  2MKH A;  4E0D A;  2X1G A;  5J2Q A;  3DOL A;  1HD1 A;  1S48 A;  3EZU A;  4OX9 F;  2AYE A;  1DHM A;  6FDR A;  2DIS A;  2Z8Q A;  1ZS6 A;  1Q4R A;  2HMI A;  2GVD A;  4WFZ A;  3KLI B;  3EXC X;  1M1H A;  1FJC A;  1U0S A;  2DRA A;  3NNC A;  4IFV B;  5ETN A;  4LIR A;  4TLQ A;  1ZH5 A;  2W8K A;  1N48 A;  2ASD A;  2ZE2 A;  2LA4 A;  1RTJ A;  3R3T A;  3S8S A;  3W64 A;  1TVR A;  1MWQ A;  2RU9 A;  5F0W A;  1REV A;  2A6M A;  2CAD A;  2OPQ B;  3EPI A;  2W4D A;  4R0J A;  3TOQ A;  3JXO A;  1FO1 A;  5K8P A;  1HWL A;  1H73 A;  3OUY B;  2XM3 A;  1EJ7 L;  2MQO A;  1HBN B;  2KG0 A;  5GAE U;  4A8K A;  3MM9 B;  1TAU A;  4NRU A;  4XAK A;  1Q7L B;  2R8G A;  1OS5 A;  2FTR A;  4RBV A;  2RQ4 A;  5CHC B;  2MXY A;  4YB6 A;  3T9N A;  1S57 A;  2MKS A;  2QT7 A;  2KT3 A;  4GKK J;  2NPF A;  4OHZ A;  4K2J A;  3LW5 C;  4L72 B;  1G6B A;  1WF2 A;  1UWB A;  1RKI A;  3T1Y F;  2IAJ B;  3RBZ A;  4RNO A;  2JH3 A;  4RPF A;  1HNW F;  2W01 A;  4BDP A;  4B08 A;  3GCW P;  2QLW A;  1D8Y A;  5HO4 A;  3Q8Q B;  5HLF A;  2OFG X;  4KFB B;  3JTO A;  2XCP A;  2RIJ A;  3HVT A;  4ZCM A;  4IYQ A;  5GAD I;  3CCS S;  3RR7 A;  1NM2 A;  2WTF A;  3BPS P;  2RRB A;  4AFF A;  3D28 A;  4CLK A;  5GAH U;  4JV5 F;  4ZVR B;  2PE8 A;  1HPZ A;  3AD8 C;  3LA0 A;  3KJV A;  5KG1 A;  2IIH A;  1VR6 A;  4HDH A;  1QUP A;  4J9O A;  3W5X A;  1KQS R;  4LRE A;  1TR0 A;  2VON A;  2EG2 A;  2Y1L B;  3US5 A;  3R1H A;  5DDR C;  1RBO B;  4X4Q A;  4JBC A;  2GJI A;  3WX8 A;  5HJX A;  3I0S A;  2W2O P;  4CLF A;  4DPX A;  3SEO A;  3CC4 S;  3QJJ A;  4Y2A A;  1WC5 A;  4YUD A;  4AUK A;  5A2Q U;  1KBR A;  3HPO A;  1XMQ F;  1H7X A;  4Q0B B;  4OZ2 A;  5K14 A;  2MKK A;  1WG1 A;  3W2W B;  2JL9 A;  3CGI A;  1RLD A;  1TL1 A;  3BSO A;  1SV5 A;  1HYS B;  2QSF A;  5KOW A;  5L9X A;  2AJQ A;  4BC7 A;  4F04 B;  2GIF A;  2BOP A;  5RUB A;  4Q45 A;  3OSN A;  1ZPV A;  3ZNU A;  1Y3J A;  1T8E A;  3P4U B;  4OYM A;  1ITP A;  4V1A k;  4AD6 A;  1HFE L;  3C6T A;  1PBU A;  4KPC A;  3H8Y A;  2DRB A;  1S0N A;  3M2V B;  4YEA A;  5M2R A;  5HAT A;  2XY5 A;  4PWU A;  2NZC A;  4NCG A;  4RUA A;  1JQG A;  1U7L A;  5KFE A;  4JYA J;  3N4W A;  2FHJ D;  1VQP S;  2VFS A;  3DYA A;  4DL6 A;  4ZCI A;  4G6V B;  3D2W A;  2LU2 A;  4HL9 A;  4U67 Q;  1VHF A;  4WTO B;  3JYT A;  2QSW A;  4RUH A;  1FF2 A;  1DAR A;  1HA1 A;  3J81 U;  1YIT S;  1S72 S;  2B9X A;  2ZH4 A;  1GFW B;  3CMA S;  4U95 A;  3MM5 A;  1X60 A;  4ID8 A;  3PW0 A;  2VBY A;  2M3D A;  1RT2 B;  1YHQ S;  4WU3 A;  3UCU P;  3SBM A;  3M32 B;  1UVN A;  1AXQ A;  1OPZ A;  2YX4 A;  2IBK A;  3I32 A;  4OI0 A;  2Z56 B;  5KG7 A;  3T1H F;  1HNZ F;  4PWD B;  3G82 A;  1WHX A;  3T5J A;  4C9D A;  3UWT A;  1S9E B;  1H2T Z;  3M30 A;  1BQN B;  4PPZ A;  3D66 A;  1G7C B;  2DPJ A;  4K59 A;  5IT4 A;  2LLZ A;  3QGH A;  1FE0 A;  3VZH A;  4K8R A;  4DV3 F;  1CJT B;  1HL6 A;  2HUR A;  5IQQ A;  1NDL A;  2LU1 A;  3BR9 A;  4JI3 J;  2QLJ B;  1VFJ A;  2CIM A;  1QE1 A;  5IT9 U;  3NEK A;  2XWY A;  5L38 A;  1RCX B;  1RT1 B;  5IV3 A;  4G1P A;  2R7X A;  1BY9 A;  4LF2 A;  1N8R T;  5HBM A;  1VRU A;  3TVZ A;  2V4J B;  4DF8 A;  4NEY A;  1XER A;  3GTY X;  3G4S S;  1RIS A;  1IKV B;  3NBP B;  3RBX A;  4DR1 J;  1RHJ B;  2E5H A;  1MU2 A;  3BYP A;  2W7O A;  1SH3 A;  3BJY A;  5D78 A;  2NSB A;  2EKY A;  1YZ6 A;  2A2D A;  4ECX A;  4ZPT R;  3ZFV A;  5A0Y A;  2NXJ A;  2C2K B;  3EZO A;  4QR1 A;  4EMD A;  2K1R A;  5C42 B;  3C2P A;  4HI1 A;  3IBC B;  3CO0 P;  2YNG A;  1XR6 A;  3TAQ A;  4DR5 F;  2A3J A;  3GV7 B;  4ZA1 A;  2BE9 B;  1U4B A;  4PG5 A;  4NXN F;  1E6V B;  3DLG A;  3V4I B;  5IFM A;  3DU6 A;  3ZNJ 1;  1R8P A;  3V6H A;  4NLX A;  1SKU B;  2J0W A;  5H9F J;  4DV2 J;  3PJ9 A;  3FFI A;  1NK0 A;  2FZK B;  3VGU A;  2Y9H A;  1A0O B;  3KUE A;  2CNK B;  4J9P A;  3ILL A;  4R5P B;  5I42 A;  2YKM A;  4HDG A;  4WFY A;  2QIF A;  1I1G A;  1UJ4 A;  2YKN B;  2HRY A;  1H98 A;  5J2Q B;  2XLJ A;  3THP A;  4V19 J;  3TUJ C;  1V3Z A;  1ZA1 B;  3NOC A;  4X4P A;  5KG2 A;  1NBE B;  3D0H E;  2V69 A;  2XSJ A;  3MI7 X;  2OTJ S;  1L3T A;  1TUV A;  1HNI A;  1Q16 B;  1S5Z A;  3K7R A;  2AD9 A;  3OR1 A;  4TU7 A;  2XLI A;  2GMJ A;  2Z57 B;  3D3C J;  4CQ1 A;  1B0T A;  1NLK L;  2QL9 B;  2WON A;  2ZH9 A;  1PYS B;  2VAS A;  2G1H A;  4RW7 A;  2FC8 A;  1RHK B;  1RTJ B;  2I2Y A;  2VPZ B;  1R3N A;  1HNX J;  4QU7 A;  3FC9 A;  3BQ1 A;  4N5S A;  2BOA A;  4NXM F;  2PN6 A;  3MMJ A;  4K4V A;  3PRD A;  4RUC A;  3BV8 A;  3ONQ A;  1OQ3 A;  1KSP A;  3KDN A;  4DV4 F;  3N6M A;  1CQN A;  1MN7 A;  4URG A;  2DH8 A;  3EDR B;  4Y0F A;  2MMY A;  4ETZ A;  4ZP7 A;  1XMO F;  1FKP B;  1WHY A;  3HHK A;  4EGL A;  3HVA A;  1NRK A;  4ZOS A;  5AJ3 F;  2XMM A;  1NPR A;  5T7L A;  5KT5 A;  5M2P A;  4DG1 B;  3N01 A;  2UXD F;  2DIV A;  2VZ9 A;  1IQZ A;  4KQZ A;  3LP2 A;  4M94 A;  2YH0 A;  4O3S A;  3PM9 A;  1K1Q A;  1VRT A;  4OHV A;  1IKW A;  4ECV A;  5KFG A;  3K5P A;  5U47 A;  5B0E A;  1SIW B;  2Y0B B;  2Q3P A;  5EDW A;  4PZV A;  2NCK L;  4TLR A;  4RW8 A;  3HVT B;  8ATC B;  2OI2 A;  2ZH8 A;  3K5N A;  3KTQ A;  4DFM A;  3K2Y A;  2LEA A;  1DQA A;  5SZT A;  3M9N B;  1N32 F;  3GLJ A;  2F1F A;  3R2C J;  2F9D A;  3PYD A;  2E1P A;  2NXU A;  2GHV C;  4QBU A;  1RT4 A;  3OD2 A;  1HPZ B;  5C25 B;  3CJK A;  1QD1 A;  1SI9 A;  4AE5 A;  1C4C A;  4ECY A;  2C1E B;  5KG4 A;  3QJP A;  3CJ4 A;  4NLO A;  2DR7 A;  4Y28 C;  2NXC A;  2QL5 B;  3KHL A;  4F8R A;  2Y0S D;  2IHR 1;  2VA3 A;  2DIT A;  1FRM A;  1SJ3 P;  4OLP A;  2CJX B;  5THW A;  3QIP A;  5ETR A;  2CQD A;  4DR4 F;  1QAX A;  2HQD A;  2F8E X;  2X1B A;  5K14 B;  3A8E A;  5LXY A;  1NU4 A;  2JHE A;  5DLF A;  1TL1 B;  3CC7 S;  2BAC A;  5CAA A;  3MXH P;  4UQT A;  1X5S A;  1EET A;  3D6F B;  2CPD A;  4K4T A;  2YWG A;  3IG1 B;  1H7W A;  4USV A;  4QIE A;  1Q5V A;  3M6V A;  4K4Z A;  1WEX A;  2HRU A;  1XBW A;  2O1P A;  3C6T B;  5L9N A;  1CC8 A;  4NZ0 A;  4K50 A;  2BR0 A;  2HZC A;  3A8J A;  2FLN A;  3GU0 A;  4Q2M A;  3BDE A;  4B3O A;  4ILR A;  4MK7 A;  5D8H B;  4ED5 A;  2AJF E;  3BGU A;  3OR2 A;  1SL2 A;  1SJR A;  4LF6 J;  2M52 A;  2J9D A;  2NRE A;  1KOO A;  2RAQ A;  2LEC A;  4RW4 A;  3JYT B;  5L39 A;  4QYR A;  4OI6 A;  5F8H A;  3OLA A;  5FLX Y;  3LTO A;  3MM5 B;  3OT9 A;  3AHP A;  5HQM A;  2V4R A;  2XS5 A;  3EGW B;  4DFJ A;  1MWZ A;  2HGN A;  3KFW X;  2DGU A;  5EHH A;  4DSI A;  4Y00 A;  3TYT A;  1SC6 A;  2UU9 J;  5LL6 d;  1KRP A;  2GNK A;  5BJR A;  4OYI A;  4LBH A;  3LWL A;  4OYZ A;  3MGJ A;  2FJV A;  4Q44 A;  4C8O A;  2DGQ A;  2JVR A;  5L8R C;  1D1U A;  2YWF A;  4ZN1 A;  3MM6 A;  2AJ0 A;  2B51 A;  3TZX A;  3KLH A;  4P71 A;  3M05 A;  1U1M A;  2CZ9 A;  3M8S A;  3FVY A;  3LPY A;  1RT5 A;  2EWH A;  2QC3 A;  1KHW A;  3TRG A;  3NS7 B;  2YNI A;  5LSL A;  1TL7 A;  4IOB A;  3I6P A;  4DR6 F;  1ZAW A;  2ZM6 J;  3GSI A;  4GO7 X;  4KPY A;  2CZV C;  5D0E A;  3N5B A;  2GO8 A;  3V6D A;  3GV5 B;  2CJ9 A;  2E9T A;  3VQT A;  5ETL A;  4E2F B;  3RJM B;  1K0T A;  2DO0 A;  2AW0 A;  4EBD A;  2GX8 A;  1FVS A;  2HQI A;  4FBT A;  1DQ8 A;  1W2B R;  2DHX A;  2VPX B;  1FDA A;  2EFQ A;  4XIU A;  1S10 A;  2UXB J;  5DM7 Q;  2ZEJ A;  1U24 A;  2Q79 A;  1GNK A;  2ROE A;  5H9E J;  4YY3 F;  1F0X A;  2XHW A;  3FBC A;  3MEK A;  3I9Z A;  5AXN A;  2K1R B;  3J7Y U;  4ECR A;  2BJ8 A;  3WIV A;  1N54 B;  2OUG A;  1JLF B;  1KVK A;  3BGR B;  4CO0 A;  1VC5 A;  1CG2 A;  1ZM3 A;  3AY0 A;  2MLZ A;  1SJF A;  4DV5 J;  3GJQ B;  4XDD A;  3PDN A;  4EUV A;  4EYH B;  3HD2 A;  3NCP A;  5J1P A;  2HFO A;  1FDN A;  2DNQ A;  4KYZ A;  1ACM B;  3ZZO A;  2XEX A;  3QWU A;  4WXW A;  1RCO B;  3MR7 A;  2YH1 A;  4WYW A;  4Z2X A;  3OL6 A;  5D0R A;  3AH6 A;  5FII A;  2Z2L A;  5I42 B;  3I55 S;  4ITS A;  4MJK A;  4RUB A;  1FFG B;  2YKM B;  1OJ4 A;  5HJY A;  2HQG A;  5KFU A;  3H7H B;  1HD0 A;  1SL1 A;  4ZLP A;  2DNY A;  3THT A;  1MNE A;  4YHH J;  4LF4 J;  2XSJ B;  5HMZ A;  5E2Q A;  5JVG Q;  1X4E A;  3HCX A;  2PFF B;  1YJ7 A;  1F3F A;  3VAJ A;  3TR5 A;  1B70 B;  3QO9 A;  2CZ4 A;  1JJC B;  4KSE B;  4USW A;  2BJ7 A;  2QLF B;  4JI5 F;  4OFZ A;  3QGI A;  3WHI A;  4ZLL A;  5EWE A;  3W8G A;  5LJ3 Y;  4J9V A;  4DJB A;  2AYB A;  5IM0 A;  2XMJ A;  3LOU A;  3TNV A;  5IOL A;  3HHD A;  3J80 U;  3HVW A;  2PEB A;  5H9F K;  1JJH A;  5DO2 A;  3NS6 A;  5DDO C;  2LXU A;  1MRO A;  3MEE A;  3OTC A;  2AYG A;  1NH7 A;  3VAI A;  2CQ2 A;  1HR0 F;  3HX9 A;  2FLL A;  1KR4 A;  3EDQ B;  3D1O A;  2C3P A;  2KJV A;  4F50 A;  4CO1 A;  3OTE A;  1F60 B;  2C22 A;  4KV8 B;  3MAA B;  1PJ6 A;  2COL A;  3UCG A;  1IKW B;  2YKO A;  4FYV B;  3SFU A;  1X9M A;  3P49 B;  4ECT A;  4OIX A;  4DV2 F;  2HS4 A;  3MPV A;  4ECZ A;  2AT1 B;  1D3W A;  4RWW A;  2W2P P;  3PRV A;  3CPW R;  4CT8 A;  5HQL A;  1RU1 A;  2AEF A;  2E1C A;  5KFZ A;  3DGP B;  2QYC A;  3CDA A;  2XYP B;  3ZTR A;  1D0E A;  2BVZ A;  2E5L J;  2BW2 A;  4WJB A;  4NLR A;  5B08 A;  3IR5 B;  1U0H A;  1WF0 A;  3CCZ A;  3GE9 A;  4RBU A;  4F7V A;  4A8W A;  2Z2M A;  2MZ1 A;  2MKJ A;  4EFA C;  8RUC A;  2BBE A;  4TYA A;  5SUH A;  1RT4 B;  3KLE B;  4IH6 A;  3NMR A;  4BC9 A;  4WCE Q;  2HYI B;  4OZL A;  1PCA A;  3CJQ A;  2E5J A;  4MK8 A;  4RW6 A;  3P3D A;  3K8V A;  1GH8 A;  3GFH A;  2BKO A;  4M63 A;  1HNX F;  2XO6 A;  1TAQ A;  3QT6 A;  4I2P A;  1FHT A;  3ELH A;  1U1N A;  1CJK A;  1IBC B;  3M8P A;  1T95 A;  1S1T A;  2ZBI A;  4LSN A;  2HND B;  3GYG A;  4CLS A;  3GJR B;  4M5D A;  4J9Q A;  1U1P A;  1YJV A;  2D7S A;  2QE5 A;  1KDN A;  1Q8I A;  3AJD A;  4WYL A;  4Z7C A;  3FNN A;  2L9N A;  2OPR B;  5ETP A;  3ZTP A;  4IH5 A;  1RUS A;  3MAQ A;  1MWY A;  3Q86 A;  1RU2 A;  2PMW A;  4P2X A;  4CDI A;  4MYU A;  1OY9 A;  4OZ0 A;  4H4M A;  1H38 A;  4CLW A;  4HTJ A;  1NXI A;  4FS2 A;  4M5K A;  2DGT A;  5DZ6 A;  3L09 A;  4CZC A;  2V68 A;  4YB1 P;  3W2V B;  5D3G A;  3MF5 A;  4FS1 A;  5E33 A;  2A0F B;  2CG4 A;  3AB2 B;  4B3O B;  3R7B B;  5EUH A;  4C8N A;  2GVZ A;  2MY8 A;  4ZVS B;  2B0G A;  2RUS A;  1JLG A;  2OTL S;  4YR0 A;  4USU A;  5KTQ A;  2UXC J;  1S1X B;  2VJU A;  4KT0 C;  1U09 A;  4NRT A;  2E7W A;  4M5H A;  1BWE A;  2UUB F;  5BYS A;  3UFC X;  1O0P A;  1U1R A;  4KB7 A;  2LQ9 A;  3U1L A;  2ZBP A;  1UVL A;  2HAI A;  3JAM U;  4JI0 J;  3JQJ A;  2VBW A;  3BQ0 A;  2AEM A;  2Y1R I;  2WB1 D;  3SDE B;  1WI8 A;  2K2P A;  4RBT A;  3CMQ A;  2D9O A;  1ZAX A;  1X4G A;  2HFU A;  2EK6 A;  1UEK A;  2XZW A;  4ES2 A;  3ZZR A;  3DM2 A;  1FDB A;  4IH7 A;  2C3Y A;  3SCK E;  2HVH A;  1HBO A;  1RWX B;  3KK1 A;  1N6Q A;  1C1C A;  1YZ7 A;  4B17 A;  1EQ0 A;  3NG8 A;  2V2V A;  1RHU B;  5D0G A;  3LPE A;  2ADB A;  2FHO B;  3D6M B;  3I5B A;  4Y34 A;  2JRS A;  5I4M A;  3BO4 A;  3W61 A;  2HHP A;  4RNF A;  5DLG A;  4AT1 B;  5KFV A;  1LNQ A;  3TAN A;  2C2N A;  3PZP A;  3MTJ A;  4U8V A;  1LW0 B;  3LP0 A;  4EZ9 A;  2OHD A;  3TQE A;  2HHH F;  1YJR A;  3FBE A;  3MPU B;  2YNI B;  3KNG A;  2PA8 D;  3QMQ A;  2EBE A;  3V6D B;  2VF3 A;  4NLP A;  4HI2 A;  5IZH A;  2P8I A;  2IJR A;  1R27 B;  3GV8 B;  4PCQ A;  2G2Y A;  3MED B;  2DNK A;  3M6U A;  5F8M A;  3DHX A;  4GC6 A;  3MHY A;  1LEO A;  3NWG A;  4LF8 J;  2Z2Z A;  5D4P A;  4UY8 5;  1WC3 A;  4A48 A;  1OPI A;  3MEG A;  2E7X A;  4K4W A;  3PY8 A;  1FT8 A;  1FTR A;  1P1L A;  4LFB F;  4X66 J;  3Q8P B;  1IUJ A;  1FNX H;  2XSF A;  1Q8B A;  3CE8 A;  2J0X A;  1LXJ A;  2WB4 A;  4PQU B;  3PW5 A;  3GP9 A;  1HHS A;  4M1K A;  4G65 A;  1HLW A;  1VQ7 S;  4U6P A;  3EIC A;  3Q0A A;  1HI0 P;  1HW9 A;  2QFI A;  4FYX B;  2BQR A;  4ETX A;  2HFV A;  2BM1 A;  2ZH3 A;  5LT5 A;  1VBK A;  4LFA J;  2CPF A;  2OFH X;  4JB8 B;  4WFN Q;  3BSA A;  4HEA 9;  1X9W A;  1C4A A;  1TKT B;  1I3O B;  1RAA B;  4F0M A;  3CVK A;  1U8S A;  2PI5 A;  1VQ9 S;  4WFB Q;  2CNN B;  1Y9O A;  3SZ2 A;  5H9E K;  4DPU A;  3G8S A;  2ZM6 F;  2R7U A;  3HXM A;  2YPZ A;  1TFY A;  3D7S B;  4F67 A;  3FSY A;  4RNN A;  3SCI E;  2DY9 A;  1S6U A;  4DV1 J;  2CPZ A;  2V4Q A;  1REG X;  4NZ7 A;  4B9T A;  4AL7 A;  1U1L A;  2RQK A;  4PRF A;  3RYL A;  4MTP A;  5IXU A;  3CJT A;  2IDE A;  4P9S A;  4ED7 A;  2HAF A;  2B7B B;  2D41 A;  3W62 A;  3H90 A;  4L73 A;  2MYF A;  1ARO P;  1MRO B;  2FQQ B;  2O01 C;  3F56 A;  3MCN A;  3MEE B;  1KVI A;  3UQS A;  1DTT A;  5KFM A;  3W65 A;  2DR9 A;  4OZN A;  5J2M B;  4J7C A;  1FXL A;  2E1R A;  2EC2 A;  1HMV A;  4QZV B;  1G1X A;  2R2U A;  4ED8 A;  2CJQ A;  3OTB A;  4FPR A;  1CVJ A;  4L3N A;  1NB2 A;  1NK5 A;  3MUR P;  2J5A A;  1JLA A;  1VCT A;  2PA3 A;  1GXT A;  4IFY A;  4WTY A;  5KFN A;  2G2Z A;  1FEE A;  3F41 A;  3LH2 S;  2V8P A;  1AZS A;  4O44 A;  4WK1 A;  3QFH A;  1FKO B;  1ZZF A;  3C3L A;  2LQB A;  3NWR A;  4E98 A;  1U0H B;  3CCE S;  2E7V A;  3CME S;  1HIY A;  4HHJ A;  3DLH A;  3A4T A;  4TQR A;  3ZO7 A;  3GQC A;  4Y2K A;  1VRQ C;  3D6T B;  2DYA A;  4O3Q A;  1U48 A;  3MMA B;  2V50 A;  3AOA A;  4WF9 Q;  2R7Q A;  1S49 A;  3AQP A;  5ETS A;  5A8W A;  2R7T A;  1WSR A;  2CJA A;  4USI A;  3R7N B;  2V8G A;  1NK9 A;  4QJV A;  1YBA A;  4EI2 A;  1LFP A;  2CWX A;  3T6B A;  5CYM A;  1YRX A;  5ETQ A;  1NK8 A;  4KO0 A;  1CJK B;  3M8P B;  4OZJ A;  3BKU A;  2CQI A;  2IJF A;  4LSN B;  3S7R A;  1BUX A;  3V2U C;  1YTY A;  3PJX A;  2F63 A;  4YDD B;  4IR9 A;  1XMB A;  2NSC A;  2XMU A;  3MTK A; 
#chains in the Genus database with same CATH homology
 3VVT A;  1K44 A;  3NGT A;  1BHN A;  4DI6 A;  1EHW A;  1XQI A;  1NUE A;  3FCW A;  1VYA A;  5C7P A;  2B8Q A;  3VVU A;  3B6B A;  3BH7 B;  3B54 A;  3Q83 A;  1PAE X;  3MPD A;  3ZTO A;  5IOL A;  3EE3 A;  1B99 A;  1JXV A;  3EVM A;  3ZTQ A;  1U8W A;  3NGU A;  3EVW A;  4UOF A;  3DDI A;  3FCV A;  2HVE A;  4DUT A;  1HHQ A;  4C6A A;  1XIQ A;  1UCN A;  2B8P A;  2DY9 A;  2ZUA A;  1B4S A;  4FKX A;  1NCL A;  1MN9 A;  3DKD A;  3ETM A;  4O0N A;  1HIY A;  1NDK A;  3EM1 A;  4F36 A;  1NSQ A;  1LWX A;  1NDC A;  3EMT A;  3GP9 A;  3BBC A;  1F6T A;  3BH6 B;  1PKU A;  3R9L A;  1S5Z A;  4FKY A;  1HLW A;  3FBE A;  4ANE A;  2HVD A;  4WBF A;  2DYA A;  5BXI A;  2BX6 A;  3JS9 A;  2BEF A;  3EIC A;  3Q8U A;  1NLK L;  4UOG A;  4ENO A;  2DXE A;  1WKJ A;  2NCK L;  4CP5 A;  3VGS A;  3Q8V A;  3Q89 A;  3Q8Y A;  3NGS A;  3ELH A;  5CAB A;  5CAA A;  1WKL A;  4KPC A;  3VGT A;  4S0M A;  3G2X A;  3FKB A;  4ANC A;  1S59 A;  1F3F A;  1BE4 A;  3ZTS A;  1WKK A;  3FC9 A;  4DZ6 A;  1NHK L;  3FBB A;  3FBF A;  4HR2 A;  3FBC A;  2DXF A;  3NGR A;  2HUR A;  3BBF A;  1NPK A;  1NDL A;  3EJM A;  1KDN A;  3L7U A;  3BBB A;  2AZ1 A;  3PRV A;  1S57 A;  2AZ3 A;  2CWK A;  1NSK L;  2DXD A;  1LEO A;  3EVO A;  3ENA A;  4UOH A;  2VU5 A;  4AND A;  3ZTP A;  3PJ9 A;  3GPA A;  4W98 A;  3VGU A;  3ZTR A;  1MN7 A;  4F4A A;  1W7W A;  1BUX A;  1NB2 A;  4EK2 A;  3WX8 A;  3Q86 A;  1NDP A;  3VGV A;  1NSP A;  1ZS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...