1S1VB

Crystal structure of l100i mutant hiv-1 reverse transcriptase in complex with tnk-651
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
431
structure length
404
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWGIPHPAGIKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of HIV-1 reverse transcriptases mutated at codons 100, 106 and 108 and mechanisms of resistance to non-nucleoside inhibitors
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Reverse transcriptase
total genus 118
structure length 404
sequence length 431
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s1vB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1vB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1vB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1vB02
5DQGA 2EC0A 1C1BA 1LW2A 5CYQB 1I6JA 4NLUA 4WYLA 5KFJA 2W9CB 1N6QA 2W7OA 1BQNB 3DI6A 4X2BA 5EWGA 4YR0A 4TQRA 3LP1A 4URSA 3GIMA 2R2TA 1SH3A 5J2QB 4K4SA 4NLDA 3LP2B 3QLHA 1HPZA 3JSMA 5KT6A 2AGQA 4J9PA 1HNVB 5KFCA 1N5YA 3EZUA 2XC9A 1GX6A 2D41A 2DPJA 3OHAA 4ZVEA 3H40A 1FK9B 2ILYA 1RT4B 4O3OA 3TAMA 4O3QA 3T5JA 2UVWA 3KK2B 2YNIB 1LW0A 1C1BB 5D3GA 2RF2B 5DQIA 1IKVA 3JSMB 2W9CA 4M95A 5DGAA 2YKNA 1T3NA 3LP0A 5HROB 4IDKA 4ZP8A 4O3PA 3BQ0A 1S0MA 2XGPA 2OPQA 1LWEA 4IKAA 4JV1A 2FJXA 3OSPA 1RTJB 1S0NA 1OS5A 3M9MB 1RTIA 2RKIB 3LALA 2WONA 2W8KA 2BANA 3E51A 5HLFB 3RB0A 4MKBA 1UWBA 3DM2B 3QGGA 1LWEB 1MU2B 2FVQA 4LSNA 3JYTB 1NHVA 3QIDA 4RNNA 1JX4A 2YNIA 5D3GB 4KFBB 3PW2A 1IKVB 2ZKUA 2BANB 2IBKA 4QWDA 1D1UA 1JLAB 2IM0A 2IM1A 4JUZA 2HWIA 5F9NA 3G6YA 5FDLA 3GIJA 4J9RA 3JYTA 5JUMA 5KG2A 4I2PA 2D7SA 2V0NA 5KFZA 4DL4A 4RW6A 3NBPB 1C2PA 4EO8A 4XPEA 3Q8SB 5J1EA 3I0RB 1HYSA 3IRXB 5KT2A 5C25B 4ZHRA 1QE1B 1C1CB 2J6SA 3QIPB 2WCXA 3FSIA 1S0OA 1S9EA 3G86A 1FKOA 5KFKA 3MEEB 3DRSB 4ID5A 4IG3A 5T14A 4MKAA 3I0RA 4O4GA 2HNZA 4I7FA 2IA6A 1JLGB 2WOMA 3C6UA 4NLTA 1C0TB 1J5OA 1VRUB 3BGRA 3DLGB 3RAXA 2CJQA 4Q0BA 1RT6A 5F8NA 2C22A 4IG3B 1S1UB 2HMIB 4RNHA 4ZVHA 4ZP9A 5KFRA 1JLBA 3IRXA 4ZP7A 5KFBA 1KHWA 1C1CA 1J5OB 3GV7B 5L1IA 2FJVA 1BQMB 3IS9B 3EPIA 1XR5A 3QZ8A 3BSCA 4O4GB 1JLBB 3DI6B 2AWZA 2FLPA 2JEFA 2QE5A 3ISNC 2XCPA 4ED3A 3BREA 4QWBA 4WXWA 2C2DA 2E9TA 5DLGA 1RT6B 2B5JB 3MR3A 4ECQA 4EYIB 3RBDA 1YVFA 2R8KA 3H2LA 4WFYA 4Y2AA 3KK1A 4B3OA 1HPZB 2YNGA 3PR5B 4RNOA 1REVB 3ISND 3I5BA 1JLEA 4URQU 3T5HA 3PR4A 5KG7A 1TL1B 3LAMA 4F4YA 3QO9A 5DQHA 4R8UA 2ZE2A 4DG1A 4QW8A 2BQUA 1DTTB 1T03A 5I42A 2C2RA 3DYAB 5KFHA 2IC3B 2IAJA 1RTDA 2B5JA 3TAMB 2RDIA 3E01B 3KK3A 2ZE2B 4DG1B 3KK2A 1TKZA 4PUOB 5J2MB 1DTTA 4U7CA 3Q8QB 3KHGA 3HVTB 2ZD1B 1K1SA 3H5YA 1SV5A 4TXSA 2IM3A 3UR0A 3NKYA 1CSJA 5KFAA 2OPQB 4LSNB 1S49A 1NNDA 3V4IA 3KLHB 5C24B 3KLFB 1N4LA 3UDLA 4RW9A 4YQWA 1S6QA 4KE5A 5I42B 3PW4A 4FBUA 2J6UA 5F8JA 1TV6A 1FKPB 2V9WA 3DRRA 2D3UA 3ITHB 4EEYA 3RB4A 1IM4A 5I3UB 5KG3A 5EWFA 4O3RA 5HP1B 5J2MA 4FS1A 3LP2A 3QLHB 5KFGA 5F8HA 3SI8A 3LANA 3C6TA 3IN5A 1HYSB 3T5KA 1RAJA 4IFYB 4LQ3A 4TN2A 5L1LA 2JC0A 4WYWA 3PZPA 1DLOB 3D28A 5KT7A 4DL7A 3V81A 3ITHA 2FVCA 4Y34A 2XCAA 2JEJA 3TQ1A 2GIQA 2ASDA 4R5PB 4ID5B 4QW9A 4TYBA 4ECYA 4IG0B 1S1VB 5CYMA 1SUQA 1S6QB 4RW8A 2HNYB 4PWDA 3H59A 4F4WA 4NLGA 1TP7A 3CJ3A 3MEGB 4ZPDA 3RBEA 1QE1A 3I5AA 3MEDA 1LWFA 4DL6A 3MECA 3FDSA 4DL3A 3EPGA 1C0UA 3KLGB 5F8IA 1RT1B 1S1TB 3UQSA 5KFEA 4Q8FA 5KFSA 3MR6A 2OH2A 1SUQB 4RW8B 4PWDB 2HNYA 4IRKA 4IR9A 1BQNA 1VRTA 4Q44A 5KG1A 4QWAA 4PQUA 4NLSA 3OL9A 4JV0A 5KG0A 3CJ5A 3HKWA 3V81B 4LSLA 4ECTA 1TL3A 1C0UB 4Q0BB 4J9OA 1HQUA 4RUAA 4KFBA 2WTFA 4K4VA 3OLBA 2W9AA 3D5MA 4I2QA 4NLVA 3VQSA 2AGOA 4MK9A 4ED6A 5KFLA 3SFUA 3GIIA 3PHEA 5JXSA 4LSLB 1NHUA 2YNHB 4F4XA 3CVKA 2OPRA 2FVPA 3ICLA 1HQEA 3KLEA 2WK4A 1DTQB 4IFVA 1QUVA 1SH2A 4TLRA 2VA3A 4DEZA 4RW4A 1JLEB 3LP0B 5KFYA 2J6TA 4OL8A 2AQ4A 4F4ZA 5HBMB 1TL3B 1IKWA 3BSOA 2AX1A 3M9NB 4R8UB 1RTIB 3NAHA 4KHRA 2WONB 2BRLA 3IGNA 3BSAA 4O44A 3H4BA 1JKHA 3DLKA 3DLGA 2IAJB 4H54A 4NRUA 1RTDB 4H4OB 3HVAA 3CJ4A 3HHKA 4ECVA 4K4UA 4O44B 5DG7A 2E9RX 2E9ZA 2R2RA 5J2PB 1LWCB 3N6LA 5K14A 3DOKA 2DPIA 1S1WA 3M8PA 1IKWB 3PVXA 3HVWA 1TKXB 3NMAA 3E01A 3KK3B 4PUOA 2YNFB 4NLPA 5C24A 1MMLA 1S48A 5DG9A 4YP3A 3KHHA 2B43A 3CO9A 1IKYB 3G6VA 3MF5A 5C5JA 4ED1A 1S4FA 3MTKA 2BE2A 4H4MA 3QGIA 3NL0A 1JKHB 3DLKB 2OPSA 1FK9A 3OL7A 3I0SA 1JLQA 2GC8A 5KT4A 4KAIA 4ZPAA 3DOLB 2ATLA 4J9KA 4IDKB 4TY8A 1XR6A 1WNEA 1VRUA 3BGRB 3FQKA 4ED8A 2HNDB 4MIBA 5KG5A 3H4DA 5I3UA 1HNIA 5EWEA 2YNFA 2F8EX 3DOLA 3DMJA 1T03B 2OPPB 2CKWA 2VG5B 2UVRA 3KLVA 4WZQA 4ZVFA 4ECXA 2FJWA 3RAQA 5KFMA 1HNIB 3H5SA 1S1TA 3NBPA 4NZ0A 4G1QB 4NLRA 3IGVA 3KLIB 3MEGA 3CIZA 2VG7A 2YKMB 1TKTB 1S9EB 5FDLB 1R0AB 1QAIA 1S9FA 3DLEB 3H5XA 4YMEA 1RT1A 3OL8A 2VG6A 3IG1B 3KLFA 3NAIA 4RW9B 1RT2A 1RDRA 5KFPA 5J1EB 2YNGB 4NLYA 1JLFA 3BSNA 3DLEA 4QWCA 4KSEB 2BQ3A 5HP1A 3DRSA 3M9OB 1S10A 4IFVB 2O5DA 4ZPBA 4KKOA 2HAIA 4NLOA 4GC6A 2BQRA 1S1XA 4MFBB 1QAJA 3KLIA 2IJFA 5KFIA 3BJYA 4WE1A 4IR1A 4ECZA 1DLOA 1C0TA 5KFOA 4YR3A 5KG4A 3DYAA 4YR2A 2FVRA 4ICLA 5KFDA 4TQSA 3IG1A 1DTQA 2UVUA 1RT2B 1S1XB 5F8MA 5F9LA 1SV5B 3H5UA 1T94A 4U6PA 1N48A 1EP4A 1SH0A 4IRCA 4XPCA 5HBMA 2FLLA 1RA6A 4RW7A 2XGQA 3V6HA 2FVSA 3KLHA 4EBCA 4GC7A 2YKNB 1EETA 2C28A 2WHOA 2I5JB 3FFIA 4WE1B 4IOBA 4WFXA 3BQ1A 3PJWA 3BR9A 3Q8RB 4LQ9A 4DL2A 4Y2CA 1RT4A 4WFZA 1RT3B 4J9MA 2BR0A 4I2QB 3G6XA 2ASJA 1EETB 1REVA 2BE2B 5HROA 2XWYA 3DM2A 2XI3A 1KLMA 3N6NA 5DGBA 1RTHB 2R2UA 1TKXA 2JEGA 4R5PA 2AGPA 1S1VA 2I5JA 3FFIB 3CWJA 5L1JA 4Y3CA 2GIRA 1RT5A 1RYRA 2OPSB 2AX0A 3MECB 4ED0A 2HNDA 4Q8EA 5F8LA 2C2EA 3KLGA 5J2QA 4ECUA 4JV2A 1GX5A 2W9BA 3H98A 4ECWA 4MH8A 5KFQA 4ECSA 4ECRA 2WRMA 2RDJA 4K4TA 3QIPA 1RA7A 1FKPA 2R8IA 4KO0A 1FKOB 4WZMA 1RT7B 4NLXA 1HMVA 3KOAA 5DLFA 1RYSA 1KHVA 4IH7A 2VA2A 2FLNA 3DRPA 1XR7A 5KG6A 4IFYA 3KJVA 4NLWA 3DOKB 1W25A 3M8PB 3KNAA 1RT7A 3OSNA 3MFHA 2OPRB 1HARA 3MEEA 2RKIA 2QV6A 3CJ2A 4IG0A 4NYZA 4EBDA 1S6PB 4EO6A 4G1QA 4M94A 4ZMMA 5F8GA 4H4MB 1JLGA 2WOMB 3GV5B 3CDUA 4KBIA 1MU2A 1BQMA 5KFFA 1Z4UA 2JLEA 3IS9A 2BRKA 1HMVB 4ZP6A 3T5LA 2VG6B 3KHRA 4MK8A 5CYMB 4G3IA 2UVVA 3GYNA 2R8HA 1N5YB 4J9QA 1N56A 1JLFB 4TYAA 1S9GA 5C42A 4K50A 3Q8PB 4K4XA 1LW0B 3KK1B 2RF2A 4KV8A 4NRTA 2R8GA 1TVRB 4MFBA 5KFTA 2W7PA 4PQUB 3MR2A 4Q45A 1EP4B 4IRDA 1TL1A 5K14B 4K4YA 3V6DA 3QO9B 3DDKA 4IH6A 4B3OB 1IKYA 3PW0A 1ZETA 2R8JA 4IQXA 3T1AA 5HLFA 3C6UB 4R0EA 4RNFA 3NGDA 3GV8B 1UWBB 4WXOA 5J2NB 2HWHA 4RW7B 1RT3A 3KLEB 4ZPCA 2I1RA 1JLQB 4K4ZA 4K4WA 2B6AA 1TVRA 1N6QB 2JEIA 4MIAA 4J9SA 2AU0A 3GILA 3CDWA 3KHLA 5J2NA 2V4RA 3GQCA 5KFUA 2IC3A 4H4OA 3OHBA 2V4QA 3FQLA 4I2PB 3GIKA 4ED2A 4RU9A 4MK7A 4RW6B 3CDEA 2B6AB 5KFWA 5L1KA 2ZD1A 4O3NA 2OPPA 3V6JA 4NLQA 4HYKA 2VG5A 5J2PA 4FS2A 4ZHRB 2UUWA 3KMQA 2ILZA 3KMSA 1TV6B 1TQLA 5KFXA 2ALZA 3QYYA 4URGA 1RTJA 3BQ2A 2ASLA 5L9XA 2W9BB 4TY9A 2HNZB 4J9NA 4I7FB 3UPFA 1LWCA 1RT5B 3RB6A 2VG7B 2YKMA 3LAKA 1S97A 1S1WB 5EDWA 3MFIA 3I0SB 1K1QA 4J9LA 3TVKA 4EYHB 3DRPB 4IH5A 4EBEA 4QWEA 4TY8B 3MEDB 1D0EA 3FRZA 3CJ0A 4DL5A 4KO0B 3M8QB 3PW7A 4RUCA 3SFGA 1JLCA 4ED7A 4FBTA 2XI2A 3DMJB 1S6PA 3HVTA 3OL6A 4Q43A 4HKQA 2JC1A 3N6MA 4F50A 1JLAA 5C25A 1T05A 3KJVB 4XO0A 2R2SA 1RTHA 3M8QA 4QPXA 1HQUB 4ICLB 3V4IB 2D3ZA 5DG8A 5KFVA 1IKXB 1VRTB 2IM2A 5KT5A 5KT3A 4RNMA 2IMWP 1TKTA 4KHMA 3DRRB 2YNHA 4NCGA 1JLCB 2IJNA 4KV8B 3C6TB 4RW4B 3PW5A 1T05B 3MR5A 3I5CA 1U09A 5EUHA 2W8LA 3LP1B 4RZRA 1R0AA 1S9GB 5C42B 3V6DB 4NCGB 3T19A 2UUTA 1HQEB 1S1UA 2HMIA 4KKOB 1TKZB 1LW2B 5CYQA 4KB7A 1IKXA 1HNVA 2WB4A 3PJXA 4ZVGA 4O4RA 3V6KA 1LWFB 3OLAA 3QGHA 1ZTTA 1KLMB 5KFNA 3QZ7A 1JXLA 3RB3A 4O3SA 1JIHA 1ZTWA
chains in the Genus database with same CATH superfamily
1FDDA 3MM7A 3OR2B 5CYQB 2A18A 4WYLA 4NLUA 2Y1IA 1PYTA 4E8UA 5KFJA 3D6MB 3FRYA 4JI3J 3NGTA 1HWLA 3HO1A 2HHXA 1FJ7A 1QD1A 3JSRA 4OYMA 4AXIA 4OJHA 4URSA 3T41A 5CA5A 1VQMS 4F25A 2GZOA 3HHNB 3GIMA 1SH3A 3PTWA 5IWAJ 1T9UA 2DO4A 3TA2A 1IN0A 3FBBA 3M8ZA 3PDNA 5HAOA 5KFCA 1QAXA 1CQNA 2GQQA 2NS1B 1RAAB 2IIHA 2E7WA 1RWXB 1UL3A 3L95X 3QWPA 4NZ6A 4ANDA 1MWZA 4O3OA 2ILYA 1E6VB 5E0OA 2A10A 1M5OC 2ZBQA 3T9ZA 2CQ2A 2RF2B 2H54B 1EHWA 3SQOP 2KL8A 3MAQA 1HKAA 3EE3A 3THVA 3KDNA 5ETPA 1X9MA 3BBFA 3BQ0A 2MZTA 1S0MA 1WC3A 2OPQA 2QN6B 1RWNB 3DRXA 4JV1A 1SC3B 4HT7A 1S0NA 2E1AA 1OS5A 3RUBL 1KN6A 2RKIB 2NXUA 3VV2B 2AT1B 2RQMA 4QR2A 3L09A 1HBNA 4NI2B 2A0FB 1T0TV 2H4WB 4OHZA 1Q7LB 4RBTA 1UWBA 3DM2B 1FRKA 3RAMA 4CLUA 2LEBA 2D69A 2QMXA 1LV5A 2FVQA 3QIDA 3JYTB 4M5GA 3SQGB 4BC7A 2JZ5A 2YNIA 1VQSA 1WI6A 4OYBA 4QOTA 4NPOA 2MZQA 2V2QA 2Z2YB 1VRQC 1NPRA 4H4KC 4QWDA 4JUZA 2IM1A 3G6YA 1LEOA 2H65B 3GIJA 2R7UA 1YX2A 4Q7AA 2R4FA 3IO1A 2F1FA 2V0NA 2ZH9A 5KFZA 4CI0B 1HD1A 4RW6A 3BEGB 4JI5J 4XPEA 2AYMA 2G2ZA 2HK3A 2JRSA 1BQXA 5CZXA 4DU7A 3R5DA 4F04B 2IHR1 3F0NA 1YI2S 4YOEA 1NSKL 2YY3A 3OXGA 4F3MA 3VAIA 3M30B 3VAMA 3FSIA 4OJ1A 1YZ6A 4OMFG 1S0OA 2B9YA 3UDEA 2MHEA 1UETA 1N5QA 3MEEB 3DRSB 2V8GA 2QO3A 3O44A 4X4UA 1ITPA 1Q8KA 1ZM9A 5E41A 3DGPB 2XQCA 2HNZA 4Y00A 2ZHAA 1C0TB 3MCSA 2ZFHA 4Q0BA 2CQIA 1UAWA 4USHA 1OQ6A 1PAEX 2C22A 4OLOA 1SIZA 2HMIB 4RNHA 4PG4A 1K0VA 3BN7A 3RR8A 2KXFA 3O5TB 1HL6A 3KUEA 4ZP7A 1UFKA 3GFHA 4X65J 3BDPA 3IAS9 5L1IA 1BQMB 3L7OA 2R7RA 1R8CA 2JOQA 4IO1A 5IT4A 7AT1B 5KAKA 3QZ8A 2B4PA 1YJNS 5HO4A 3BSCA 4FNHA 3MAAB 4V19X 5C7PA 3GU0A 1HWKA 2QYCA 1UPMB 3ISNC 4DLEA 3K5MA 1NPPA 4OI4A 4ED3A 4QWBA 3CJ8A 4WXWA 3CF5Q 2J7WA 2KYZA 3H2VE 2RH3A 4Y2AA 3R7SB 4TU7A 5DM7Q 2R8KA 1WHVA 4DUYF 4F0KA 1REVB 4URQU 3I5BA 3G8QA 2HAFA 3HHEA 1NK0A 2GS8A 3K89A 1NB7A 1FDNA 3HD1A 4LT6A 4GVLA 3M05A 4E0DA 3NGUA 2ZZNA 2ZE2A 1CJTB 4C2MA 5AT1B 2BQUA 3SCJE 1B99A 5A8WA 1SL2A 2YQ1A 1SJ3P 3D9BA 3LOUA 4DX6A 2IC3B 2H5EA 2B5JA 4GKJF 3P5BP 3KK2A 3AOBA 3KHGA 3KNGA 2NPIA 1K1SA 4C98A 1SV5A 4TXSA 4JI6F 2YX1A 3G8TA 1IBCB 1RBOB 2IM3A 3R5CA 4HI1A 1HBOA 4CLSA 2BE9B 4KGZB 4PG8A 3UVJB 1PIEA 4BLGA 1AUSL 4DXLA 1X5PA 1OSCA 4DX7A 1NNDA 1U25A 1WOPA 3IA0A 1NKEA 4YQWA 4CH1A 3U7JA 2M4MA 1B7YB 3MM6A 3BO2A 4WBFA 1R6YA 5F41A 2UUAJ 4IO9Q 3DRRA 3CSKA 3RB4A 1IM4A 1F60B 4KGVB 2HIYA 4FVMA 5EWFA 2YTCA 5CABA 2M0GB 2UUBJ 3SI8A 3QLHB 4DV3F 3C6TA 2GA7A 1HYSB 1RAJA 5LSOA 3OUYB 2ZH3A 1WF0A 3GWCA 1AFJA 3ITHA 4YB6A 2FVCA 2YWEA 3I55S 3ENVA 1HI0P 1UEKA 3HJVA 5D6GA 1SBRA 3LGNA 4IG0B 1YRUA 1CJKA 2XZWA 1NB2A 5CYMA 1SUQA 4TYBA 4BCAA 4USMA 2VJUA 3MMCB 4ZPDA 3OUYA 3I5AA 3MEDA 3IP0A 3BBBA 2VJVA 1EZZB 4B3MJ 4IYQA 3GR0A 3KLGB 3LA0A 2WW4A 2H48B 2XMAA 4B3MF 1NSQA 4C3MA 3C14A 3TO8A 2OH2A 4PWDB 1JMTA 2UU9F 2HNYA 4LFCJ 1PJ7A 1JJCB 2EFVA 2DT9A 1CULB 2AKWB 4PQUA 2M88A 2ROPA 4HEA9 3V81B 1FRIA 4ZCLA 1X7VA 4D3GA 2Z2LA 5BYSA 5CCLA 2IJRA 1HQUA 4ECTA 4RUAA 4OX9J 3BYPA 1APSA 3FEZA 2EK6A 3AAWB 3LGMA 5ETNA 3T6BA 3VQSA 1WELA 3H2UB 1SJ1A 5KFLA 3G96A 1I94F 3PHEA 1WDTA 5JXSA 4C0OC 3J81j 1W2IA 4CH0S 1LOUA 2OPRA 3B82A 3FEXB 1T9YA 2GCFA 4NWBA 2D74B 3EXYA 4TLRA 3D3BJ 1TMJA 1VS3A 3F56A 4FDFA 4DEZA 2F3JA 4RW4A 1H98A 2W25A 3GPAA 1XK8A 1TELA 2MQQA 3EMTA 4A8MP 4WCEQ 1XQIA 4F4ZA 5MLCV 1VQ5S 1IKWA 1KRPA 4OZ5A 2CADA 3I9ZA 1NK5A 2WONB 2BRLA 4K2XA 3SBMA 3W2WA 1WI8A 3PX6A 1U49A 2X1FA 2UXBJ 2V69A 3UFCX 4DV2J 3DLKA 3Q86A 3JXOA 4QCLA 2IAJB 2V50A 4OYXA 3OR1B 2V8VA 4DSEA 1VQ7S 2BBEA 1FD8A 1F5BA 3QAUA 2ZITA 3CD0A 4ECVA 4O44B 1B0TA 1WEZA 1QUPA 2FHJA 5DG7A 1M1KT 3S6EA 4Y2KA 2R2RA 2E9ZA 1LWCB 1VQPS 3N6LA 1F9EB 4ZOSA 1TUVA 4ZCMA 3M8PA 1GXTA 2KRBA 4H4KA 3MPWA 1R89A 5BYQA 3J81U 3MR7A 4P10A 1MMLA 3FCVA 1RJJA 3HSZA 1IKYB 2QGFB 2FC9A 5C5JA 1S6UA 1S4FA 2YQ3A 2YWFA 3HSDA 3MTKA 1SCJB 3V4MA 1ZH5A 2ZBIA 2OPSA 4DCJB 2IDLA 2KJWA 4CIOA 1VQ4S 2BW2A 3WZ0A 2FZKB 2VPZB 1JLQA 2GC8A 3I4PA 4KAIA 1RTZA 4GMKA 4ZPAA 5KT4A 2D3O1 1NJZA 4K5SA 1Q8BA 1XNRJ 3EVWA 2HS0A 2UUCF 2AEFA 4FPRA 4IDKB 2G13A 4A8KA 1XR6A 2AHOB 1VRUA 3BGRB 2ZDOA 4CTAA 2HNDB 1TUGB 2QLBB 3E3XA 3NOCA 4CM2A 5KG5A 1HNIA 3H4DA 2UXCJ 4GVBA 4QIVA 2KXNB 1GMWD 2VUGA 8RUCA 1T03B 2CKWA 1S76D 4UY85 1S12A 4P7VA 4WF9Q 3MPVA 2JH3A 4HH0A 2EVZA 4DS4A 1VQNS 3AA8A 4OJGA 4ES3A 1S1TA 5AE1A 1F5CA 2KJVA 4B02A 1K8AT 3G6ES 4FZVA 2VG7A 2E7XA 1TKTB 1S9EB 1CJVA 2E29A 2JDJA 2PA3A 2XMKA 1YJTA 1U2RA 4OI1A 4C11A 1S9FA 3H5XA 3DKDA 4YDXA 3I4HX 2MXYA 1CQMA 1RE1B 2ZH7A 4DR4F 3NLCA 3W3SA 4NLYA 2YNGB 5AE3A 1TL4A 4DV7J 3T1YJ 2E1CA 1DBDA 1S6OA 1Q1KA 2W2MP 3N5BA 2M3DA 2YQ0A 3DRSA 1JNRB 4ETZA 4ZPBA 3ZTPA 3DHXA 2HFVA 4GC6A 2MZRA 1S1XA 3BF4A 4LFCF 5KFIA 4WE1A 1EKRA 1GQEA 1DLOA 2DBBA 1FE4A 2GVZA 4XDCA 1FNMA 4AQYJ 2FVRA 1O8BA 4AQYF 3K2YA 1G1XA 4B3TF 1WKKA 3TARA 3IG1A 3A8EA 2UVUA 1RT2B 2HHPA 1S1XB 3JS9A 3LGHA 1U47A 2DRAA 1NMEB 2DNZA 1A7GE 2IA0A 4G65A 2WBRA 4U6PA 4IRCA 2MB0B 2FGOA 2KM8C 4XPCA 5DDQC 3JSYA 2KFYA 3DOMA 1OSDA 3LWLA 2FHOB 3V6HA 4DPOA 1A9NB 5B09A 2YH1A 4DZDA 5CXTA 2EG2A 3VAKA 2HVEA 2C28A 2WHOA 4ZVSB 1PKUA 3BQ1A 2AZ1A 3EM1A 3G2XA 2OMLA 3Q8RB 2B4UA 4P74A 4DL2A 2KVQE 5G4DA 2VDHA 2FZCB 2V4JB 2BUNA 3B54A 3GZ7A 4PXBA 1RAHB 2K1RB 4JP8A 2F7VA 3V2UC 4I2QB 3TJ8A 1P27B 1EETB 3G6XA 1AZSA 3H42A 5JVHQ 4LF9F 2CNKB 4LF1A 5ETMA 4TLQA 4WJBA 4BWMA 2XY5A 3P3DA 2C3YA 1N8RT 2JEGA 2O1PA 2ZVSA 3LO3A 3N5FA 5LMNF 1HHTP 3MURP 1X4BA 1BUXA 4L74A 1B0PA 3HJFA 1WD6A 2I5JA 3CWJA 1NM2A 2AP6A 3NXZA 3V5RA 2HQGA 5GMDA 4HH1A 3HHLD 3M6WA 1N54B 1RK8A 2AX0A 2O3DA 3PYFA 5F8LA 2X3GA 2N3OA 4J9UE 4ES1A 4JV2A 1J2VA 2DIUA 2LDYA 2X3DA 2VONA 4MH8A 2VDIA 3W7BA 1RI7A 5KFQA 4ECSA 2WRMA 2ZC3A 5E5NA 1VJWA 4NMXA 1G2EA 4IQMA 3EGWB 1FKPA 4WIIA 3U02A 3EDQB 4KO0A 4KHPF 2HFUA 4C8YA 1RT7B 1U1LA 4QQBA 4DV6J 3BKFA 1KHVA 5SUHA 2G2OA 1F3FA 2BJEA 3EX7B 1N36F 1IBKJ 2DRBA 2FLNA 4IFYA 1H2VZ 2HRTA 2DHXA 2FY8A 1WOOA 2V5HG 4NLWA 2L9DA 4J7CA 1M5PC 1RT7A 2RHQB 3IC1A 3MFHA 1TK0A 4YFUA 4IG0A 3P96A 2CAJA 1RWOB 1S6PB 2DY1A 2X51A 4EO6A 2OO4A 2QA2A 3ENAA 4WU2A 4M94A 1L5UA 3ULHA 4ITSA 3DU5A 1XMQJ 1MU2A 5HQMA 5JVGQ 2DCUB 2CVIA 2JFDA 3IMQJ 1EIYB 1HWUA 3IS9A 3MM5A 4NA3A 1FRJA 4FVCA 4CLLA 4QBUA 3CULA 3G82A 5LT5A 3CEDA 4L72B 4NE9C 3KHRA 2C2OB 3QPIA 5CYMB 4WFAQ 3J7YU 1HWJA 2E1MC 2Z56B 2Z58B 1IWGA 3FC9A 5AJ3J 3CCRS 4DUZJ 2ZBPA 1JWWA 3Q2SC 1VQYA 2VFTA 4O0IA 4N5SA 2N82B 3JTOA 1WUUA 2Y1JA 4K50A 3BZQA 4DQQA 1FERA 5D8HB 3KK1B 4NRTA 2F8MA 1TVRB 1Y11A 3D1QA 4MFBA 5AXNA 3FBEA 3RG6A 2XO6A 1Y5NB 1TFYA 3W62A 3CXCR 1EP4B 2GGPA 3M2UA 4X66F 2VHGA 2HHHF 5E33A 2F9DA 3QO9B 5E3CA 4JI7J 3VGVA 5I3PA 1T9WA 3MPYA 1TMMA 2PIIA 1RU1A 1Q7YT 5IWAF 3R1LA 2C42A 1HLWA 1KQGB 4DV1J 4DQSA 1TK5A 4FKXA 2F4VJ 1QTMA 3T1AA 4B9MA 2BKPA 1WDDA 5HATA 4ZIVA 4OYAA 5B0BA 4DV1F 2F4VF 5J2NB 2ALYB 2GJFA 1QSLA 1ZAVA 2OHDA 5IV3A 2HVIA 1RT3A 4X4VA 2HEKA 1JLQB 1MWQA 2NYIA 1CJTA 3HHDA 2BZ2A 1KDNA 3GTYX 2LLZA 3MM7B 1TFWA 2JEIA 1UZDA 4MIAA 4J9SA 1V9OA 4QPTA 4C8MA 3CDWA 2BJ7A 3GILA 2HHQA 1S59A 4LBHA 4LRAA 3PEHA 2IC3A 4H4OA 3W1YC 2DHHA 2MYFA 3FQLA 4MK7A 3CDEA 3R5GA 1H72C 3TX8A 1R8AA 1SQGA 4ETXA 3HM9A 2OPPA 3FVYA 4NLQA 4WWSA 4ZHRB 1PBAA 2V8PA 3IR5B 4FS2A 5KFXA 3ILJA 5HANA 2Y8WA 5FD1A 2A3JA 2RQKA 4I7FB 2OGUA 5DETA 3UPFA 2E44A 1RXOB 4ZN1A 5GAGI 2VG7B 2FGCA 3EZOA 3LAKA 2W2NP 3RB6A 1S97A 2DR5A 5EDWA 2HGNA 2ZM6J 2DXDA 1K1QA 1UW9A 2VC0A 4DR5J 3TVKA 2OTJS 4EYHB 3BPDA 4DHVA 1X0PA 5K8OA 4CO1A 4JI5F 4EBEA 3ZZTA 1X5SA 2AJQA 2PFFB 2OAUA 4I64A 4DQPA 2WSEC 3PW7A 3L9ZA 2YKPA 4DSJA 3TR5A 2JVRA 1RBLA 3BN4A 3OL6A 2K3KA 2JC1A 4F50A 2BXJA 1JLAA 5C25A 1T05A 2J9CA 5A8KA 1JB0C 4LVNP 4ZLJA 1WTBA 2GV1A 4CTAB 1RTHA 3UDVA 1YRTA 1LXJA 3UO0A 4QPXA 1ACMB 2C2KB 2D9PA 4U9RA 5D78A 5F3TA 1X4CA 1R6VA 1NDKA 3AB2B 3CCZA 1OWXA 1VRTB 2F8HA 5B0FA 1S99A 4OI6A 2DH9A 3DC2A 4RNMA 2IMWP 1DJ0A 2V8HA 4A8XA 1FESA 2IVMA 2YNHA 3DFEA 4KC5A 1FI4A 4RO0A 4X4PA 3OTBA 2JHEA 1JLCB 3N4WA 4C0HA 1FA0A 1OIAA 2IJNA 4KGMA 1WJ9A 2XS5A 4DSIA 1RAOA 1SKSA 1IJFB 3M6XA 2HRUA 4HACA 1R0AA 3V6DB 3OXFA 4NCGB 3CO0P 1NKCA 4EI2A 1S1UA 2HW3A 4KKOB 2LYVA 5G0RA 1SB6A 4B3TJ 5T7LB 1VDHA 2LQJA 5H1SV 1LWFB 4JB8B 1SL0A 3QGHA 1ZTTA 1KLMB 2M9KA 5KFNA 4YHHF 2GMJA 4J91A 2W01A 4Y0FA 2QC3A 3OTEA 2EC0A 4Q2LA 3ILOA 3CCSS 2AYGA 1RWPB 2WVCA 2D3OR 1BQNB 1R3NA 2AW0A 1SPBP 3SDEA 1CULA 3J7YI 5F3ZA 5LJ3Y 1U24A 1YBAA 3CTRA 5HL7Q 3UCUP 2P5VA 5CD4A 1RGVA 2R2TA 1T9VA 1YTYA 5J2QB 1YQHA 2GMHA 3CJKA 4QYZK 3CJRA 1I51B 1VLOA 4RUBA 3QLHA 4DI6A 1OJ4A 2EG1A 5KT6A 1FX2A 3HPOA 1HNVB 1O6XA 2C2NA 2HFNA 3EZUA 1M1HA 1GX6A 3CD5A 3OT9A 2J9DE 3UD4P 4ZPVR 4ZVEA 4DR6J 4JI2F 5K8MA 4DR7J 2VQEF 4MIWA 5D4NA 1Q82T 1CC8A 3KK2B 5D3GA 1LW0A 1M5HA 2RS8A 2V2ZA 4MMOA 1MNEA 4UUWA 5DQIA 5A2QU 1T3NA 3RBDA 4EZ6A 3D6TB 3LP0A 3Q8YA 4WP8A 4IDKA 1FDAA 1GFWB 2DR6A 3ONQA 4LUBA 2POKA 4RL1A 2IDEA 5A0YA 3W9HA 2XGPA 2DNQA 2FJAB 3UN2A 3OSPA 3VZHA 1RTJB 3MDFA 1QSSA 4BS2A 3M9MB 3CC7S 1RTIA 1A6LA 4J9VA 2BX6A 5HVHA 3RRGA 2J7UA 2ADBA 4J90A 2GQ2A 3E51A 3W5YA 2XY6A 1GMWA 1T9XA 3O3LA 4NA1A 4I56A 1S0VA 3QGGA 2E5HA 4C97A 2YPZA 2XMJA 4I6YA 3T1HF 1NHVA 4JI3F 3GCXP 4OIXA 4RNNA 1VI7A 4OHXA 3RR7A 4KFBB 2QSFA 1IKVB 1I5OB 1WG4A 2ZKUA 2XMVA 3R5BA 4M5DA 3TP2A 1HNZJ 2IBKA 4F2RA 5A76A 4UOHA 4ZDNA 1XWLA 4DV4F 2ZUAA 5FDLA 4JI6J 4X84A 3OTOF 5HSPA 3CPWR 4J9RA 3JYTA 2QA1A 3SQGA 4I2PA 1WWHA 2D7SA 1NH7A 3MM9B 4KR0B 4YY3J 4DL4A 3NBPB 1QDUB 4EO8A 2NZ4A 3MTJA 3Q8SB 3UCGA 1HYSA 3IRXB 2CXEA 1CG2A 2KU7A 2HZCA 1QE1B 2I6WA 3QIPB 1NZAA 3R97A 2WCXA 3G86A 2D9OA 2V8DA 4TKTA 3K8WA 1WC1A 2CQ4A 4JV5F 1K47A 2QL9B 1YJ9S 4ID5A 2HS4A 5T14A 1L3UA 4O4GA 4NMLA 3NS5A 3CDAA 1J5OA 1X4AA 2PE8A 3DLGB 4M5NA 1R0BG 1HBMA 5A8RB 5D4PA 5IXUA 1VBXA 3GJSB 3J80U 3Q22A 2MQNA 4BDPA 3B6BA 2B8PA 3MAHA 4ZVHA 5LSRA 4KIAA 1WTFA 3Q23A 4EWTA 1G4CA 2RUSA 1KHWA 4M5KA 4ZJQA 3R27A 1J5OB 1EKSA 3Q0AA 2FJVA 4DV7F 1FE0A 3T1YF 1U8SA 1HBMB 2F63A 2FIUA 3HSGA 5A8RA 2RU3A 4KTQA 2DGTA 3EWGA 2XMUA 3QGPA 4YB5A 3MUVP 1RAFB 4O4GB 2ZBCA 1JLBB 2LXIA 4USWA 3DGVA 2JEFA 2QE5A 2OEMA 1L3VA 4KY3A 4JI2J 3TUPA 3ZXWA 1N88A 2NXEA 3IWNC 2C2DA 1YDLA 3PXGa 3IR7B 1RT6B 2NYHA 1SI9A 4J5OA 1P8GA 1KP6A 1AA1B 2BM0A 2HQCA 3KUHA 1TR0A 1GNKA 2CPIA 3KK1A 1H2TZ 2M8HA 1HPZB 1KQKA 4OX9F 3UR3C 3PR5B 5H9EJ 3T5HA 4OHYA 1FX4A 2CZ9A 3CCTA 1TL1B 2F65A 3KTQA 5CHCB 1LK5A 3OFGA 3QNWB 1RWMB 4R8UA 4N77A 4OYWA 3W9JA 3ET6A 1T03A 1FWLA 4CO5A 1VQLS 4HHHA 5I42A 2MMYA 2C2RA 4LFBJ 3NCPA 1GTHA 3DYAB 2EC2A 2B0GA 5KFHA 4UOFA 1OMSA 4XAKA 4M5LA 1KBRA 3PO4A 2RDIA 3D0HE 3E01B 3KK3A 4NZ0A 3AODA 1WC6A 5J2MB 1DTTA 4NA2A 3RJMB 3BM7A 2BE7D 3BPSP 3H5YA 2VD3A 3OW2R 4DR2J 3NMRA 1CJUA 2MKSA 2MKKA 3MM6B 5AXLA 2XLIA 4G6VB 5A0YB 2ZWOA 3QATA 2OPQB 1H6KX 2L9WA 3VHQA 3TX0A 5BJRA 4LSNB 1X0FA 1D9DA 2CDQA 2CG4A 1S49A 5DZ7A 1LFPA 4OV6A 2E1RA 5C24B 3KLFB 2J0XA 4RW9A 2KB2A 1S6QA 4KE5A 1U1MA 1HI8A 4XIUA 1KOOA 2XULA 5HMWA 1TV6A 1FKPB 3B78A 3PV8A 1GTEA 2CVEA 2V9WA 2KVIA 4EEYA 4WIQA 2CJ9A 5KG3A 4DR1J 5HP1B 3JAMY 3GJTB 1PSDA 4FS1A 4JI8F 3I87A 4Z2XA 5ETLA 3IN5A 3T5KA 2HFOA 2HGMA 4TN2A 2IFXA 5L1LA 2NUHA 2OEJA 2MKHA 3PZPA 2DB1A 3HFKA 3R7NB 5IQQA 2K3IA 5I3QA 1IBMF 6FDRA 3TQ1A 1T8EA 4DV5F 4AYBD 1H73A 1M90T 1E6YB 4B3RF 3GYXB 4NLGA 5F8JA 2HNYB 2LQ8A 2ZC4A 1VCTA 2EFPA 2PO4A 2YKOA 3SYZA 2UP1A 4DL6A 1LWFA 5HVGA 2W2QP 3ZTSA 1R8PA 3CJSA 3FDSA 5GVQA 3BH6B 1TZ0A 1C0UA 4DSLA 5F8IA 1RT1B 5KFEA 4PG5A 5KFSA 4RW8B 1KTVA 1LWXA 3BS9A 3US5A 2MZSA 4IR9A 1QM9A 4Q44A 1DFDA 2HFZA 5KG1A 4NLSA 3OL9A 3NOGA 4JV0A 3HKWA 2QT7A 4HTJA 1BLUA 4EU0A 2HHSA 1C0UB 2D1CA 2DO0A 4UZCA 1Y5LB 5D15A 3ZFVA 3W9IA 4CQ1A 4K4VA 1MROA 1NRKA 2MQLA 3WBZA 5ITHA 4ZS6A 2MLYA 1S57A 3G8SA 4I0WA 4ED6A 4K0KF 2E1PA 5D0GA 4ELVA 4HLBA 2I2YA 1NHUA 2YNHB 3A1YG 2CZ4A 4OZ0A 1E6VA 3ICLA 3M32A 4EUVA 3DLHA 2WK4A 1DTQB 3MHYA 4CLFA 2FHJD 2V67A 4QYRA 2EKYA 1XNQJ 4N56A 3LP0B 1PYSB 4OL8A 1NK7A 1G3OA 1M1GA 2IRXA 1FT8A 1FXDA 5HBMB 2C2ZB 2LEPA 2MKYA 3P4UB 4LVOP 4X65F 2AX1A 3PG9A 4TNOA 3M9NB 1RTIB 2WAQD 3ADAC 4KHRA 4OX7A 3RZAA 3CD6S 2R3VA 4O44A 4B08A 3M1VA 2G0CA 3FSXA 3DLGA 4H54A 4OZJA 4ZA1A 5IV4A 1GMVA 3GJRB 2QTWA 4YB1P 2AJ1A 3R1HA 2I0XA 4YUDA 3SDEB 1H0HB 3M2UB 4CYUA 2HS3A 2M5YA 2DPIA 2AD9A 1IKWB 3K58A 3PVXA 1TKXB 3IM9A 3MCNA 3SEOA 4PUOA 4CO2A 4CNZA 1S48A 3HMJG 4F7VA 3TEHB 2B43A 4N47A 2EPIA 3HKZD 2FLOA 4JI8J 3NL0A 4WK3A 2Q6BA 2J9EA 2N7CA 3U1MA 5JJBA 1FK9A 1YZ7A 3OL7A 3Q83A 5M2PA 1URRA 1W2BR 5LXRA 1G6BA 2ATLA 1NO8A 4P2FA 4L75A 2M7SA 3HZEA 1HFEL 2BA9A 2FJBB 4TY8A 3FQKA 1B64A 3MD1A 1T7PA 3J80Y 4DCPB 2RS2A 2B3TB 2E7VA 5A8WB 1K0TA 3OFEA 1J27A 1IUJA 3QRQA 3KLVA 1CEZA 4QIFA 1UVMA 2HLTA 4K8RA 4ANEA 4QU6A 3P49B 3VWSA 5CH7B 4CLKA 1X4FA 2CQPA 4PCQA 4ELTA 3KLIB 1KEKA 2XC9A 3CIZA 4KH1B 2YKMB 5FDLB 1I3OB 3BDEA 3L7UA 3RBZA 3TOQA 3X3UA 1AUDA 1D9FA 1CS4A 2NXJA 2VG6A 3NAIA 4RW9B 2ZH1A 1YK9A 3WHIA 4DF8A 4RU2A 4QIEA 5CYJA 3G9CA 3RGIA 3A8IA 3BGLA 1A0OB 3UDCA 3ENWA 1HNWJ 4ATNA 3R3TA 2MGZB 1IJEB 3M8SA 4KSEB 2DNGA 2GO9A 2U1AA 5HP1A 2VFUA 5B7WA 3M9OB 3PNIA 2BQ3A 1SC4B 1QLNA 2BACA 3D67A 6AT1B 4DZ6A 1QAJA 3KLIA 3NEKA 4K5RA 4L6V3 3BJYA 3VAGA 3M6VA 3UD3P 1U6FA 2AIRB 3DYAA 2DGQA 5KG4A 4YR3A 3GIRA 7FD1A 4ICLA 2C3MA 4TQSA 1K9MT 2ERRA 4FXDA 1SV5B 1AYEA 1VYAA 3H5UA 1D8ZA 2V9KA 1T94A 3W8PA 5ETOA 1GMUA 3LQVA 5HBMA 1ZYQA 3ZTRA 3S01A 1RA6A 1VHFA 3BH7B 4OHVA 4CRJA 5GAHU 1HQ2A 2HZVA 1TK8A 4EBCA 2A2DA 5HJXA 2ACYA 3FFIA 2Q43A 4WE1B 1H7XA 4KRWA 3J7Z5 2NR0A 3BR9A 4EK2A 1X4DA 2HPUA 4USKA 4EMDA 2NXCA 1RT3B 2CYYA 2BR0A 5DZ6A 1Y9OA 1WEXA 2DK2A 4LREA 2B4VA 1VHIA 2IRUA 2XHWA 1CBKA 2HQIA 1REVA 2K8GA 2CPDA 1BHNA 4GO7X 3SIPB 4DWIA 1P1TA 5DGBA 3ISZA 1KLMA 1RTHB 2UVWA 2OFHX 1TKXA 3JAMU 2XZDB 4R5PA 1UFLA 3DDNA 4M5DB 4DFKA 4Y3CA 4M5MA 1KQSR 2GIRA 1RT5A 2FUG9 2WB1D 3QT6A 3VGTA 3QT8A 4ED0A 1U1KA 2ATCB 2C2EA 3KG0A 1GAOA 2X1BA 1S7IA 2Q79A 3TAQA 1BE4A 1AZSB 1KQFB 4ZITA 1NJXA 1IBLJ 5K20B 4K4TA 4KYZA 2IRYA 1IR0A 1RA7A 2R8IA 1YG0A 5EX3A 1XIQA 3MMBB 5ADZA 3GJQB 3Q8VA 2XLJA 5GAEU 3DDIA 5IOLA 5DLFA 1IBMJ 2VA2A 4GKJJ 1XMOJ 2COLA 2W4DA 1M5SA 3DRPA 1XR7A 2OSRA 4DPXA 3TNVA 3ZTQA 1MN9A 3KJVA 2CG8A 1C4AA 4C48A 3DOKB 1D8YA 1FO1A 4UZBA 1Q4RA 2ZKTA 3M32B 3KWMA 2QV6A 2UXCF 4USIA 7FDRA 4K2JA 4G1QA 5IC4B 4ZMMA 2IY5B 4U8VA 3LPEA 1Q8IA 4K59A 1H3DA 1S79A 2GO8A 1WACA 3CDUA 4KBIA 3SMZA 1KONA 1OPZA 2DTJA 5KOXA 2CNOB 2E5LF 2V94A 2G9OA 2XYHB 4LF6F 4DN0A 1L3KA 1B7FA 1F3VA 2UVVA 1RU2A 1DY3A 1FRHA 1RISA 4TYAA 1KSPA 4W4MA 3K57A 1U1OA 4RX6A 3VR1A 2ABYA 3MMAA 3NRBA 4L3KA 3DXBA 4Y2IA 1SQFA 3Q8PB 4B9VA 2R8GA 5HMXA 3UNGC 1OPIA 3AB4B 3NWRA 4LFBF 2VFVA 1YLXA 2XMWA 3DCAA 2W7PA 4Q45A 1UEUA 4RWXA 1TL1A 1U1RA 4DLGA 3V6DA 2GW8A 4X62F 4X66J 3I56S 4KPCA 2HHHJ 2XMTA 1SXLA 2DGSA 3OHAA 1EQ0A 4HVZA 4LBPA 4ZLLA 3CCUS 3PW0A 4R0EA 3D2WA 4RNFA 5IM0A 2R8JA 3GV8B 3QJPA 4LF5F 2UXBF 4CLPA 3MM8B 2BKNA 4RW7B 2J9DA 2CDRB 2V4JA 3A3NB 1G7CB 3P8BB 4W92B 1FRMA 2LXFA 2XYPB 2MSTA 4KPYA 1Y5IB 2XMMA 2ZJPQ 1U6BA 1N6QB 1DQ9A 2H1YA 4JI4J 3KHLA 4DPTA 2VFSA 5J2NA 1AT1B 3ZZRA 2V4QA 3PYEA 3GIKA 4BWJA 5D0RA 4RW6B 4DMZA 1UA0A 3VAHA 5KFWA 3K59A 2DVIA 1CJUB 1VMBA 2YXLA 2VG5A 3IWLA 1X60A 2OMOA 2UUWA 3E8OA 2KI2A 4PG6A 3KMSA 3M30A 3VF0B 5B0GA 4DV5J 3PY8A 4LF8F 2ASLA 3QJLA 4R0JA 2LQ5A 2C3UA 4C8NA 5L9XA 3AQOA 4LMZA 3PRVA 4C6AA 4DV6F 2W24A 4M63A 3EGZA 4LF9J 1ZBTA 5D4OA 4AD6A 4UUXA 1LWCA 1RT5B 9RUBA 3OFHA 3POTA 2ZM6F 3K7RA 2DNMA 2P8IA 5DM6Q 2AMCB 3CC2S 1U26A 3CGIA 3TI0A 5C2CA 2H5JB 2DH7A 3DRPB 4ZK7M 1U1PA 2BABA 2F9JA 3PYGA 5IZHA 2XSJA 2OI2A 4QWEA 2UV8A 1VBKA 3MEDB 4PPDA 4F26A 3TZXA 3MMBA 1TL7A 1OY9A 4B9SA 4LR8A 4RUCA 4UQGA 3SFGA 1JLCA 1YGYA 4LF4J 2XI2A 1S6PA 1VQKS 1FF2A 1VIOA 2EFNA 4Q43A 1FFSB 3N6MA 3QSYB 2CJBA 4LF6J 1WC5A 2R2SA 4ZCKA 3HP6A 3CB4A 3M8QA 3C15A 3NP5A 5DG8A 2KFNA 3AXKA 2AYBA 2DCLA 3Q24A 1U6ZA 1R8HA 3HFZB 5KT5A 2O66A 3D1HA 1SKUB 2G1HA 2Q66A 2HVHA 1U2CA 1F6TA 5HVFA 3HD2A 5K8NA 1BWEA 3MM5B 2KRRA 2HRYA 3TAPA 5E3QA 2JX2A 2VC1A 2Q6CA 2YWHA 3CJQA 4KV8B 3JB9k 4GKKF 3DGPA 3FEYB 2JLFA 3GSIA 3PW5A 2R7SA 2HVZA 3C19A 4GKKJ 1UFWA 1U09A 2W8LA 1KVKA 5C42B 2CJXB 1ELOA 4HT5A 2Z30B 3T19A 3H20A 2HQ3A 4LRCA 1KTQA 1TL5A 2HVDA 2UUTA 4PXDA 3BO4A 2UXDF 5CYQA 4KB7A 1Q5YA 2DH8A 1S7HA 2VB6A 2YX4A 4ZN3A 2DR9A 3NGKA 4ZVGA 4O4RA 5IM0B 1FNXH 4OYZA 3MCOA 4IOCQ 1JXLA 2XM3A 2VBWA 2CNLB 2MEWA 2MHNA 3RB3A 4O3SA 1J5EF 1JIHA 4JI1J 1ZTWA 1C1BA 1LW2A 2W9CB 1I6JA 3E2EA 2Z57B 4X2BA 4OYIA 3DI6A 1Q86T 5EWGA 1WKJA 3QJJA 2BW7A 1ZS6A 2WSFC 3HULA 3LP1A 2APOA 3DNCA 3WDOA 4AL7A 1Z2ZA 2RT3A 1MSWD 1FJGF 2MKCA 3THTA 2ROGA 3H90A 3QQCD 3LP2B 1SQEA 1HPZA 3JSMA 4P75A 4NI2A 4J9PA 2AGQA 4NXNF 4DR7F 2ZOFA 2DPJA 3RW6A 3MWBA 1NAQA 1VBZA 4CYUB 3H40A 3F44A 1RT4B 1JJHA 3CMQA 3OD2A 4OYPA 3TAMA 2RVJA 3HDSA 4HTIA 2GFFA 4O3QA 4DX5A 4PKDB 3AH6A 4UT4A 4FXWA 3RU0A 4A8YA 4M95A 5DGAA 1O51A 4RJVA 1PO6A 4P2MA 2LA6A 5HROB 4P6QA 4DDFA 4O3PA 4DJBA 2M2BA 3VCDA 3S8SA 1LWEA 4A8QA 4B9TA 4ZVUB 3KJQB 2ADCA 3VTIA 1KKHA 3LALA 5ETVA 3JQMA 5HLFB 2V2VA 3GFZA 2BJ3A 1VR6A 3U27A 1LWEB 1MU2B 4OI0A 1RWKB 2QG9B 4LSNA 3LTOA 4X4OA 2R7VA 1ZM3A 5D3GB 1MN7A 3PW2A 2V6AA 3HT0A 2BANB 1X5TA 5B08A 1T11A 1XEZA 2CPFA 4FYVB 5GADU 1JXEA 3NG8A 1JLAB 3ZZYA 4U67Q 1N0UA 2HWIA 3EYZA 4B3RJ 3SV4A 2KT3A 4YDDB 1FHTA 5EX0A 5JUMA 5LXYA 3UWTA 2VPXB 2AEJA 1C2PA 1GXUA 4P2SA 2CUYA 1SC6A 3T6JA 3I0RB 1F2GA 1IQTA 3O6QA 2QL7B 4ZVRB 5KT2A 2J6SA 2N4CA 3KDOA 1WOSA 2L41A 4DSKA 1FKOA 4UW2A 3M8RA 1NPKA 2IBOA 4DSFA 1X9SA 5L38A 4K0KJ 1YJWS 3I0RA 1RBAA 4I7FA 2IA6A 2Y1LB 1JLGB 2WOMA 2NLWA 1VRUB 3BGRA 2DR7A 4Z7YA 2CJQA 3IAM9 1RT6A 2FJDB 2H5IB 3M4XA 2MPUA 4CZCA 4DR4J 4IG3B 1S1UB 3QAEA 2VF3A 5E3AA 5IS2A 1MLAA 2PI5A 2VODA 1WEYA 5KFRA 1JLBA 3MI7X 2AZ3A 1YSJA 4DR3F 1C1CA 4PWUA 3GV7B 2HKEA 4DPYA 5HMZA 4GRSA 2XTJP 4JYAJ 2YBVA 3J81Y 1ICEB 1YKWA 1VK3A 3PJ9A 2XNQA 2KXHA 1LK7A 1KOHA 2AWZA 3HHLB 2FLPA 4F2SA 3HVRA 2CQDA 2Y1RI 1NSAA 3BREA 3SCLE 3Q2TC 1S4EA 5M2UA 3EJMA 2B5JB 1X31C 5ETTA 3UNYA 3MR3A 4EYIB 1UVIA 4WFYA 2JL9A 2YWWA 2YNGA 1N0VC 4F36A 2Z4PA 4UF4A 1KWMA 1ZOTA 4DQRA 1QY7A 5KG7A 1DZ5A 2Y9HA 1VK8A 2NUUG 3LAMA 4F4YA 1VJQA 4X4RA 3CCJS 4HHUA 4QW8A 2ASYA 1DTTB 4RBUA 3P5TL 4N7TA 2AJFE 4O23A 2DISA 2DITA 1CC7A 3K17A 1RTDA 3TAMB 2MQ8A 5LM7E 3W66A 2ZE2B 2CQCA 3NCRA 4BC9A 4U7CA 2MKIA 1BMQB 3Q8QB 3ETOA 5T7LA 3HVTB 1LXNA 1HBNB 2P9EA 2DR8A 1JJ2R 3UR0A 1CSJA 1QSYA 2KZMA 3A4TA 2KG0A 1UP1A 2GHWA 2DNHA 2EKNA 3V4IA 4OZ1A 2RDDA 4LFAF 4LIWA 3UDLA 2LQ9A 2OD6A 3IFEA 1Q5VA 5J1NA 2FHKA 4JBCA 2KO1A 3PW4A 3EDRB 4FBUA 5BR8J 1R8BA 4PRFA 1NEEA 4JV5J 1KFDA 2UUAF 5I3UB 4R25A 4DN9A 4C8LA 4O3RA 1TKDA 5J2MA 2EFOA 5KFGA 5F8HA 4PEOA 5U47A 2BJ9A 4X4QA 4IFYB 2XEXA 4LQ3A 4A8SA 4WYWA 1OQ3A 1REGX 1DLOB 1WKLA 2LKZA 5KT7A 4DL7A 1VC6A 5I4MA 1RHUB 4Y34A 5GMEA 2JEJA 2EBEA 2ASDA 4R5PB 4QW9A 1U0HA 4ECYA 4KHPJ 1S1VB 1OO0B 1UJ5A 4RW8A 1S6QB 5CAAA 3ZZZA 1SVDA 2DRDA 1NLKL 2M52A 3VZIA 3CJ3A 3OVSA 1HNZF 4B3SJ 5FIIA 4DL3A 4JYAF 4E2FB 3EPGA 3FSYA 2AF6A 3UI3A 2CRLA 1S1TB 4Q8FA 2E5JA 3WIVA 1O0PA 2YX7A 4F3OA 1R27B 4IRKA 1DHMA 1BQNA 2MY8A 1OYDA 3MPUB 5MAOA 4QWAA 5KG0A 3TEGA 2MGZA 4LSLA 1N33J 4Q0BB 2LQBA 4J9OA 1U8WA 3EGNA 3OLBA 3CCVS 3D5MA 3OV7A 2GHVC 4I2QA 4U8YA 4MK9A 1KLNA 1Y4ZB 5D0EA 1OYEA 2NQPA 2CQ3A 4PPZA 4MTPA 2V34A 5DRKA 1IR1A 1RWVB 4F4XA 2R42A 2FVPA 3CVKA 3IM8A 1HQEA 4WZMA 4IFVA 4G1PA 1NUEA 2P9CA 1PILA 3JTPA 2KN4A 4A8FA 3HSJA 4DX8H 1JLEB 4ID8A 5KFYA 4C4WA 1X9WA 4X4NA 2JLGA 1EB0A 4U96A 4TU9A 4MYUA 5HN0A 2AQ4A 1N5VA 1KFSA 3TW0A 3BSOA 5L8RC 4AL6A 3NAHA 1NU4A 3T9NA 2NCKL 3W63A 3J7ZT 2K7KA 4NASA 3LWMA 1Q79A 3H4BA 3I6PA 1M0SA 4CM0A 1Q8LA 1R31A 2RD5C 4U7UK 3TANA 2VASA 1VLYA 4C9DA 4FKYA 3ET6B 3FZBA 2ZOMA 1LFWA 1YBTA 2ZNYA 4KGXB 4W98A 5BXIA 3SV3A 2CIMA 4FF3A 1LKZA 5HQLA 2E9RX 5J2PB 3QRPA 2HBQB 2BMBA 3D0GE 2KYXA 5D0HA 1S1WA 4C3LA 3PIPQ 4NYOA 1PBUA 1XMBA 3IR6B 5B0AA 4YP3A 5C24A 1D3WA 3MAAA 3KHHA 4JI1F 5IT9Y 2FHMA 3CO9A 2MSSA 2BJDA 4H4MA 2M8DB 2FJEB 2MDAA 3DLKB 4UOCA 1P6TA 1XN9A 3WC0A 3N0VA 2I9SA 2OD4A 2GNKA 2I38A 1BD6A 3I0SA 3AOCA 4CWBA 3VALA 4USUA 2LU1A 4FP9A 4LBIA 3WC2A 5SZTA 2XS2A 1HW9A 4B9UA 2V68A 1EARA 4NXNJ 4OLPA 2MLXA 2OKQA 1RHJB 2DNYA 2HBZB 4MIBA 4YS2A 4ED8A 3C16B 1UKUA 5EWEA 2R7OA 1CS4B 2IVYA 2YNFA 2PA8D 4Q5VA 1AXQA 3DOLA 1CJKB 3DMJA 5L9NA 1R7IA 3NMAA 2OPPB 1RHQB 1L3SA 3NY0A 3G87A 4WZQA 3RTVA 4ECXA 3P6YC 2FJWA 3RAQA 5KFMA 1HNIB 3TA1A 3K5OA 1UMJA 4G1QB 2VBZA 3IGVA 1L3TA 4YEAA 4DL0C 2VZ9A 3M2RA 2B8QA 2B9WA 1FEEA 1QAIA 3PKYA 4A8OA 2IMOA 1UEVA 3OL8A 3IG1B 2DEIA 4F02A 3IBCB 1LQ9A 1RDRA 2RILA 5J1EB 1SJRA 3CUNA 2Y0SD 4PXEA 3AQPA 2NXNA 2QA4S 3AOAA 2LEAA 2VH7A 4LIRA 1JLFA 3A8JA 1Q16B 3UN5A 4DFMA 1FCAA 4WKRA 3DLEA 2Z8QA 4DV4J 3VVTA 1S10A 2CQHA 4C8OA 3TUIC 3FCWA 4KKOA 1MMNA 1N34J 1AFIA 2BQRA 1UJ6A 4XK8C 4AUKA 4MFBB 1NKBA 2IJFA 3NGRA 2OTLS 4X4TA 4ECZA 2FYXA 2CJYB 1NCLA 1P1LA 3BGFA 5IT0A 1T02A 4OZLA 4WTYA 2X1GA 2Z2ZA 5RUBA 2R7WA 8AT1B 1DTQA 4F8RA 4OJ3A 3PX4A 2LECA 3FGVA 1Q53A 3W2WB 3FJ2A 5F8MA 5F9LA 3M6UA 3NNHA 4A8WA 3GG1A 2L48A 1SKWA 2PGCA 1XBWA 3G71S 4ZJLA 4MKVA 3J7AN 1GT8A 1WSRA 3BB5A 2OIHA 2GAGC 1HA1A 2YKNB 2DXEA 3AJ2A 4RKUC 1XNQF 3PJWA 1FJEB 2EWHA 3AHPA 4LQ9A 2C3OA 3RRHA 1V3RA 4J9MA 2ASJA 1RAIB 2HURA 3DXSX 1QTNB 2DNKA 3OPKA 4GO5X 4XTTA 3W60A 5HROA 1KS2A 2DNRA 2XI3A 3N6NA 2CQBA 2HQFA 2R2UA 1IWAA 2Q1LA 2QJ3A 3H7HB 3TVZA 2FTRA 5CD4H 5HK4A 1NHKL 1YRXA 3GE9A 1UVJA 1SC1B 3FFIB 3O8WA 4RUHA 5L1JA 1RCOB 1RYRA 3I31A 2EFQA 1NJWA 2WBMA 3RYLA 2GMLA 5T41A 4CLTA 4Q8EA 1N52B 3KLGA 4ECUA 4DV3J 1GX5A 2BV3A 2RRNA 2PDAA 3R5AA 3TJ9A 3H98A 4FXVA 4DR1F 4ECWA 2H9ZA 4ECRA 1QAYA 2RDJA 4ILLA 3OBIA 3PCOB 1AROP 3ZZ0A 3R7BB 1RCXB 4EGLA 3KUGA 2ZH2A 1UA1A 1SJFA 5HMYA 1FKOB 4NCBA 3RRKA 5IT9U 1HMVA 3I9V9 4HDGA 2F40A 1VQOS 2LA4A 4A46A 3CD7A 2QFJA 4ED4A 3BO3A 4B9LA 1N36J 5AXKA 1IBKF 4QYZJ 4C8ZA 1W25A 3KNAA 2OPRB 1HARA 3MEEA 4NYZA 4TVAB 3GCWP 3H8YA 4NYPA 2EW9A 2GJ2A 2BYCA 1NZ8A 4PXCA 2QIFA 3IBWA 1JLGA 2WOMB 1WC4A 2W7AA 3QSIA 2N3LA 5KFFA 3GV5B 2MJNA 3DN9A 1Z4UA 2JLEA 2Z2MA 4I6AA 1V6HA 4ZP6A 1TAUA 1VOMA 5AJ3F 4LF4F 1FXLA 3ZZUA 2VOPA 1N5YB 5LSLA 3L7PA 4J9QA 1DARA 5ETRA 1S9GA 1RHRB 4OI3A 3SZ2A 8ATCB 2BM1A 4NEZA 2O01C 4K4XA 4F4AA 4CO3A 2RF2A 2WZ1A 3O1LA 5B0CA 2CZVC 3DU6A 1BWVA 2B7CB 4I69A 4LF2A 4DQIA 4PQUB 3QBCA 2UZAA 5HQ8A 2R7QA 2DGOA 3MR2A 4CP5A 4IRDA 2DEJA 2QEXS 4EBDA 3DDKA 2ZJQQ 5LMUF 1YWXA 3ZNUA 3I96A 3QT5A 4ED5A 2DNOA 1VISA 3O2IA 1ZETA 5HLFA 3C6UB 4OV1A 1UWBB 2MQOA 3FK4A 3GB0A 2HWHA 1XJWB 1HIYA 3BR8A 1ZZFA 4WXOA 3TA0A 1FRXA 3W2VB 4DUTA 4D3HA 2EXUA 3KLEB 5CCMA 2I1RA 2VQEJ 4BBYA 4HHJA 4N8NA 3CMES 4K4ZA 4K4WA 4PQAA 1TVRA 2N4DA 2HHTA 2XB2D 2AU0A 2BVZA 1HR0J 5DDRC 2QRRA 5KFUA 3BYRA 1HNXF 5A2QY 4RU9A 4PZVA 2DJWA 4P52A 2RQ4A 4Y65A 1NK8A 3MOJB 2W4CA 5L1KA 2ZD1A 4O3NA 2W1BA 3QWUA 4N8OA 4OFZA 3V6JA 3TVYA 4LSZB 5J2PA 1ZZNA 5A6PA 3AD8C 1TV6B 1WHWA 4DV0F 2A6OA 3EXCX 3HFVA 3QYYA 3W2VA 1RTJA 4URGA 5E2QA 1BC6A 2ZHOA 1MWYA 2RU9A 1TU0B 2QYGA 3GLJA 4OI2A 4YN3B 1R0CB 2K2PA 1RP5A 4DFJA 1U45A 1NK9A 3TWZA 4F4KA 1GEHA 5DS7A 4DR2F 1NK4A 3PRBA 3HI9A 3H25A 4DR5F 4F3QA 4FPIA 4HR2A 2BOPA 3I0SB 2ACMA 1YBUA 4F0HA 1KD1T 4DBQA 3MCMA 3M8YA 3ILLA 3J7A1 2LU2A 5EN1A 4TY8B 3FRZA 4DL5A 2PMZD 2RNEA 3CJTA 3D68A 4KO0B 3M8QB 1NXIA 2C1EB 1IQZA 5L46A 4ED7A 1FXRA 3DMJB 3CCLS 1CVJA 3HVTA 1SL1A 1FDBA 2QMWA 4HKQA 4LR7A 1RAEB 4WFBQ 4ZVOB 1HHQA 4M8LA 4USJC 3KJVB 4XO0A 2DGXA 2EI5A 4KGKA 3FNNA 2MY7A 1TL7B 2B9EA 2V63A 2PEHA 3C16A 1ZAXA 4WU3A 1U1NA 4ICLB 2OJ3A 3MM9A 2D3ZA 2FD2A 2JVOA 3CE8A 3K5PA 2HK2A 4RR5A 5G0RB 5KFVA 1F9FA 2HIQA 4ANCA 4AT1B 1N5TA 2LFVA 2IM2A 3R6LB 3S1TA 5EHHA 2VIHA 4CCHA 2MZJA 1TKTA 1NDPA 1UCNA 3DRRB 4KHMA 3OXLA 3LUYA 2AEMA 4NCGA 2VKRA 4ZVTB 5C2GA 3M7VA 1R43A 4HL9A 4B17A 3KYLA 1M5KC 2DHAA 2YKAA 4V1Ak 4RW4B 2RSQA 1HD0A 3MR5A 2DGVA 1N33F 3I5CA 3PEJA 1SKRA 4RZRA 1S9GB 2A1BA 3F41A 2XS7A 1PJ5A 4QJVA 3P45B 1HQEB 1U0HB 2HMIA 2E5IA 3GONA 2HHUA 1TKZB 1Q78A 4IOAQ 2J8SA 4ALZA 1HNVA 3IWXA 1YITS 2HHVA 4CLZA 3OLAA 2XG8A 1QVFR 4AE5A 3A12A 4JI4F 1HWIA 1NBEB 3W64A 4LR9A 3B4DA 5DQGA 1RKJA 2W7OA 2B4OA 3GMGA 2AJ4A 3OTDA 2JSXA 3FKBA 3KFWX 1N6QA 3SSRA 4DPUA 4FF4A 4CT8A 4NOHA 2Q3PA 1X4EA 2QX0A 3IXQA 4YR0A 4TQRA 3A3PB 1HNWF 3MM8A 2J0WA 3HCXA 1Q95G 2QLWA 2PEBA 4NLDA 1MROB 2KKHA 2MQMA 4K4SA 4X64F 2MKJA 2UV8G 5LMUJ 1EJ7L 1N5YA 2Y0BB 4F0MA 3PRDA 2D41A 5K5MA 3PKMA 3DHWC 1FK9B 1X8DA 1RLDA 2G0IA 2MLZA 3T5JA 4PAAA 3CDBA 2AYEA 3U1NA 2YNIB 4C7QA 1C1BB 2W9CA 3A8KA 1IKVA 3JSMB 3BGUA 3UN3A 2YKNA 3FBFA 3LW5C 2ZBRA 4ZP8A 4DUYJ 4V19J 2NZCA 3PHTA 4IUFA 4IKAA 2LVWA 3UW1A 2FJXA 1WORA 2CQ0A 1SJ4P 1V3ZA 4DOZA 2CPHA 1VFJA 5GADI 2WONA 2W8KA 1M5VC 2HFSA 2BANA 2B51A 2MZ1A 4ELUA 3D0IE 3RB0A 2P2CB 4MKBA 1IBLF 4UTGA 1PC4A 3GSDA 4ER8A 2KT2A 1NJYA 2JFKA 1RADB 2QLFB 4QIWD 2KHDA 4E98A 2OUGA 3M2VB 3UD5A 1JX4A 4LRFA 2GVDA 1S72S 4B9NA 3D3CJ 1H38A 1D1UA 3Q8UA 2VQFJ 2IM0A 5F9NA 1C4CA 3NS7B 3QT7A 3FUYA 4FYDA 1FTRA 2FY1A 5KG2A 4NCAA 4NZ7A 1RHMB 5J1EA 2CPEA 2EK1A 3NNCA 5C25B 4ZHRA 2QFIA 1C1CB 4PG7A 3CCES 3CMAS 1S9EA 1CJVB 2YH0A 5KFKA 4IG3A 2GVDB 4MKAA 2E5LJ 2IYGA 1PYOB 1YJUA 2YPYA 4ES2A 1X4GA 2XY7A 2G4BA 2K06A 3BGOP 3C6UA 1JXVA 4NLTA 5KTQA 3PIOQ 4NXMJ 3TZWA 4WKYA 4DUZF 1RWUA 3A3OB 3R8YA 2KG1A 2YWGA 3RAXA 2PI4A 5F8NA 2AJ0A 3W61A 3OVBA 1ZA2B 3GFYA 3NS6A 4M5HA 4ZP9A 1AB8A 1RHKB 1NDLA 3ZC4A 3IRXA 5K8PA 5KFBA 2N7YA 1RZMA 4ILRA 2ROEA 4A48A 4J37A 4HACB 2FDNA 4WP9A 3TUJC 1IR2A 4WP3A 2DKOB 2W2OP 3IS9B 1ZA1B 3EPIA 1XR5A 3MXHP 2QLJB 3EUNA 1H74A 2PD1A 3C66A 1FJGJ 1XTZA 5CZVA 3DI6B 4DV2F 3WX4A 3MMJA 2XCPA 5D77A 1NSPA 1Q0NA 3PX0A 2YKQA 3LH2S 1S5ZA 3CC4S 2E9TA 2XYGB 2ZZMA 2XZTB 5DLGA 5LMNJ 4ECQA 4LF5J 6FD1A 1KNZA 1TAQA 1WG1A 1RWWB 1YVFA 1P9QC 3H2LA 4ZIWA 5THWA 4B3OA 3ZTOA 2HGLA 4RNOA 3ISND 1U1QA 1JLEA 4Q2MA 4CO0A 3M1VB 2CPJA 3PR4A 3N01A 3AXMA 3SXLA 2QA4G 4X4SA 4UY8T 2V2KA 3QO9A 3SSSA 5DQHA 2FC8A 2DY9A 4CT9A 2KTQA 4DG1A 1Y7PA 2VPYB 1XC9A 4FF2A 3VQTA 1U4BA 5KOWA 2VL1A 2LP4A 1UW4A 5IC6B 1WHXA 3T1HJ 4ILMA 4ZLPA 2IAJA 2XBPA 5A6WA 3WIUA 2ZH6A 2CQGA 4PUOB 2ZZTA 4DG1B 2PSZA 2CPZA 1TKZA 4ZPWR 4ZCIA 1XNRF 3D6FB 4AL5A 2ZD1B 5F0UA 4EFAC 2G1DA 2MJUA 2L3MA 5EGYA 4FNIA 3NKYA 1W7WA 1VQ6S 1U02A 2SXLA 5KFAA 3VVUA 1FEHA 1FVSA 2GAHC 2J0QD 3KLHB 1N4LA 5B0DA 1U7LA 2NPFA 4O0NA 3SCKE 2QL5B 3TZYA 5I42B 2YVSA 4N76A 2J6UA 1P9YA 1RQ0A 4ZJOA 3G4SS 1WC0A 3MUMP 2DIVA 4OYOA 2D3UA 3ITHB 2WVEA 2ZOGA 4KQZA 1V5IB 4GVBB 3KJFB 3LP2A 3LANA 3D6HB 1HW8A 3CCMS 1NH8A 5D4LA 3C2PA 2JC0A 2RRBA 1RAGB 3AD7C 3D28A 3V81A 1FTCA 4LF8J 2XCAA 4F4WA 2GIQA 3GYGA 4ID5B 2JJ4D 3WX8A 1PAUB 4PWDA 3H59A 2NSCA 2BJ1A 1TP7A 3MEGB 4RPFA 1JK9B 1ZPVA 1QE1A 3RBEA 1PG5B 1FNOA 3MECA 2VFRA 3N28A 4JOUA 1Y3KA 3HLUA 2GQCA 4QZVB 3UQSA 1VIXA 3L4BC 4L73A 3MR6A 2DGWA 2DNNA 1SUQB 3VGUA 4K7QA 1N34F 1VRTA 4P71A 5DO2A 1DAXA 1WF1A 4W90B 1MG7A 4NL5A 3CJ5A 3I32A 3MD3A 3PM9A 4P9SA 1BGXT 1TL3A 2OEKA 4ZVQB 1W26A 2LXUA 1HI1A 2WVBA 4KFBA 2DNPA 3A13A 2WTFA 4OQJA 2W9AA 1AW0A 2CQ1A 1H2UX 3B4MA 1WG5A 4NLVA 2AGOA 1NK6A 3SFUA 3GIIA 2JWNA 4MKYA 5H9FK 5HJYA 3SCIE 4LSLB 4RLEA 2HBYB 2VV5A 3C8YA 3SSQA 1KVJA 2NREA 1MW7A 2J76E 4Y6IA 3KLEA 4M1KA 1QUVA 1SH2A 2XNRA 3C14B 3EICA 1S77D 2HWTA 4YB7A 4OX6A 3T3FA 2VA3A 5AE2A 2J6TA 1RUSA 1F0XA 1FD2A 2QMUB 4JI0F 4C3KA 3GR1A 4ENOA 4CDIA 2ZHBA 4Z7CA 2RE1A 3NCQA 2VU5A 1TL3B 1RSCA 4LRDA 3DOMB 5GMKa 3F73A 3UCZP 2G0JA 1UVKA 4R8UB 3KG4A 2PT0A 1KC8T 3IGNA 3BSAA 4DCOB 1BY9A 3N79A 2X1AA 3NNAA 4UQTA 5LOQA 3THPA 1RLCL 4WK1A 1JKHA 4NRUA 4NEYA 3ZO7A 1RTDB 4H4OB 3HVAA 1FRLA 3M2VA 3CJ4A 3AJDA 2WVDA 3N9UC 5ETQA 3EVOA 2QZ8A 4I4BA 1ULRA 1GXLA 2J5AA 3HHKA 4ZVPB 3CT9A 1N5SA 2F4FA 2RHSB 5BR8F 4CLWA 5K14A 4MYTA 3DOKA 5E7OB 2FB0A 3HVWA 1B3TA 4I6WA 3E01A 3KK3B 3R6GB 2YNFB 4NLPA 4OZ3A 5DG9A 2CJAA 1UPPA 1D09B 1NJIT 3G6VA 1FFGB 2LDIA 3MF5A 5F0WA 4ED1A 2BE2A 2CWKA 3PYDA 2XSJB 3QGIA 3HX9A 4MJKA 3R2DJ 1JKHB 2J8AA 3NGSA 1Q81T 3W65A 3MEKA 2NSBA 3OTCA 1FWPA 2ZWPA 4ZLNA 1JNZB 2VQFF 5DDOC 3DOLB 3TUZC 4TU8A 5IFMA 2BDPA 2XLKA 4I67A 4J9KA 4G1IA 1XERA 1QJHA 3HXMA 1LNQA 3AD9C 4X64J 1U0SA 4I1TA 4A47A 1WNEA 2UUCJ 3I82A 5DDPC 1URNA 2VOOA 3HT3A 4B3SF 5I3UA 3ILIA 3R9LA 3HF5A 4KJIA 2F8EX 1E6YA 3GG0A 4NX9A 4KT0C 3EZ5A 5H9EK 3D7SB 2EBGA 4OHWA 1WHYA 1QVGR 4K4UA 2VG5B 2WW8A 2UVRA 1UVLA 1T95A 4ZVFA 5J1PA 2WSCC 2DYAA 3H5SA 3OFFA 3NBPA 2A6MA 3AA9A 1HBUB 5HI7A 4WPAA 1YIJS 1ZM2A 4NLRA 1IXKA 1JQGA 4CH7A 3MEGA 1HBOB 3VGSA 3QRRA 2O67A 2I8EA 3POTB 4FN5A 3JQJA 1R0AB 5FLXY 3K0JA 3DLEB 2OFGX 1I94J 5GAHI 2DHGA 4YMEA 1RT1A 1O5JA 3KLFA 1UZHA 4WTOB 1RT2A 2FZGB 5KFPA 4FYXB 3U1LA 1TTHB 4DFPA 1CLFA 3W8GA 2R7XA 3BSNA 4LF7J 2ZDPA 2GVZB 2DNLA 3PFEA 4QWCA 1T9TA 1FFWB 4DU8A 1KR4A 3HHLC 4IFVB 2O5DA 4QR0A 1FVQA 3JSBA 2HAIA 2CWXA 4NLOA 3QFHA 5K9FA 4X62J 3GFXA 3VAFA 2UU9J 3DLLQ 4IR1A 1EX8A 1C0TA 5KFOA 4YR2A 2LMIA 3CCWA 1GK8A 1SJQA 4FYWB 3W5XA 2CPYA 5KFDA 1YHQS 1XMQF 2J7KA 3MMAB 2RQCA 1ZAWA 2VPWB 2UXDJ 3MMCA 2GJIA 2P6TA 3HHLA 4OX8A 3HZGA 4S0MA 2DXFA 5E3PA 4PR6A 3TQEA 3FCHA 1VBYA 1EP4A 1SH0A 2GGPB 1HHSA 2IVFB 4Z37A 1N48A 3K8VA 2FLLA 4RW7A 2XGQA 3D1OA 3K5NA 2C2MB 1Y0HA 2IPOB 2FVSA 3KLHA 4PYDA 1F5AA 3CJKB 3TZZA 4ZKAA 1V5VA 4GC7A 4JI0J 1EETA 5E3RA 5CQGA 2I5JB 1Z2LA 4IOBA 4WFXA 4DV0J 1PCAA 2VBYA 4JI7F 1IVZA 1B4SA 2BOAA 3KJNB 4Y2CA 1RT4A 1VGYA 2U2FA 4WFZA 3TYTA 2ZH8A 2BKOA 1UWAA 5GAEI 2XSFA 4EZ9A 2HBRB 2XHCA 4L3NA 4A4JA 2BE2B 2ZEJA 2VKZG 4OZNA 3NWGA 3TRGA 2XWYA 3DM2A 4FYYB 1ROFA 1VQ8S 1PC5A 4C0BA 4YY3F 2XWXA 1PGZA 2K7JA 1FWKA 3D66A 4HI2A 2DGUA 1WSVA 2AGPA 3RW7A 4P7TA 1S1VA 3JTNA 1FKAF 2W2PP 2ZJRQ 4KH0B 4XDDA 2FPHX 5M2RA 3ZNJ1 1Y10A 2MTLA 1OY6A 2OPSB 4UOGA 3MECB 3LPYA 2HNDA 1PJ6A 1WF2A 4MT1A 1Y3JA 2OSQA 5J2QA 1RACB 9ATCB 3X1LB 2W9BA 2UUBF 4U95A 2M70A 3CIMA 3C46A 2CFXA 4N41A 2X7IA 2GIFA 4DPWA 2OLWA 3R2CJ 2KDOA 3QIPA 3MOZA 4NLXA 2JNJA 3AFGA 2Z0GA 3S7RA 3L3CA 3KOAA 3CNQP 3G82B 3BKUA 3KKFA 4RWWA 4IH7A 4ZPTR 5ETSA 1RYSA 5KG6A 4DF4A 2OP5A 3IRWP 2CPXA 1V3SA 3OTOJ 2HLUA 3OJUA 3M8PB 4C11B 3OSNA 1YJRA 3PACA 1RB0A 2CJKA 2RKIA 2RJZA 3CJ2A 2RIJA 3PO5A 3OR2A 1N32F 1DQAA 4M5IA 5LJ5Y 5F8GA 5FLXU 4H4MB 4USVA 3DLJA 2CA9A 1BQMA 1X4HA 1DURA 1RKIA 2F5GA 3C15B 2HQDA 2ZNZA 2BRKA 1HMVB 3H0PA 2E66A 1F2HA 3TJAA 3T5LA 2FQQB 2VG6B 4C8KA 2MQPA 4MK8A 4P73A 4OZ2A 4G3IA 3OVAA 3GYNA 4U7UD 2R8HA 2GHPA 2KZZA 1N56A 1JLFB 2G2YA 3EGVA 4Y2MA 3ZZPA 5C42A 2ZH4A 1K73T 2LCWA 1RABB 3IBFB 2BJ8A 3FMBA 3MGJA 1EAYC 3MUTP 3Q89A 1B70B 2B7BB 4M5JA 1LW0B 2RB7A 1KVIA 4KV8A 5FJ4A 5LL6d 3FZ2A 3MPDA 5KFTA 1DRZA 4DR3J 1U48A 5K14B 4K4YA 3KXDA 2PFDA 2L08A 3PFOA 2KFZA 1SIWB 2YWKA 2R7TA 3CCQS 5JMNA 4IH6A 4B3OB 2PN6A 2QSWA 1IKYA 1T3OA 3BKTA 3VAJA 2EFGA 2OELA 4CNYA 4IQXA 3NGDA 4QR1A 1ZPWX 3ELHA 2L9NA 4ZPCA 4AXJA 1ZM4A 2K1RA 2A2CA 2B6AA 4LJMA 3D4JA 2WVFA 4YHHJ 2H3EB 1J5EJ 3W5ZA 2V4RA 3GQCA 3OHBA 2PMWA 3R5JB 3WQPA 4ED2A 4I2PB 1I1GA 2CNNB 3D54A 3QMQA 2XO7A 3DLBA 3ETMA 3BV8A 2B6AB 2RUGA 1UJ4A 2BEFA 4LRBA 2B56A 5GAGU 4HYKA 3KMQA 1YJ7A 2ILZA 3OQ2A 1TQLA 4MAKA 3K5LA 2GX8A 2HZAA 2ALZA 3C3LA 5B0EA 3BQ2A 4CO4A 3OR1A 3BBCA 3B8HA 1XMOF 1K44A 2W9BB 3OJSA 1YJVA 4TY9A 2HNZB 4J9NA 3HK2A 1UVNA 4USTA 2YKMA 3FBCA 4QU7A 2E5GA 1S1WB 1DQ8A 1MMDA 4I68A 3MFIA 1N32J 3ENQA 4CLYA 4DR6F 1D9AA 3GP9A 4J9LA 1VC5A 1B0VA 4ERDA 1JJ4A 4LFAJ 4IH5A 2KT5A 1VC0A 1NDCA 3KG1A 1IM6A 1D0EA 1OY8A 2HSEB 2Y3YA 2ZVIA 3CJ0A 1H7WA 4P2XA 4AFFA 5L39A 2AV5A 2VBXA 3CW2C 2HHWA 2ZH5A 4FBTA 2P6SA 3LF0A 5ETKA 3MZIA 1Z1ZA 3FMWA 4NXMF 2RRAA 4RBVA 3AY0A 4WFNQ 5IQ6A 1BXNA 1CPZA 2VICA 1HQUB 3V4IB 2DHSA 2P9GA 2HG4A 2HYIB 2R9LA 2W4PA 2KH9A 4P72A 1IKXB 2B9XA 5KT3A 2KHCA 3M2RB 3AJ1A 2J0SD 4L76A 3JQKA 1TUWA 4FF1A 1Y00A 2AJ2A 3UE2A 4LF7F 4F67A 5DJBA 4BHQA 1HBUA 1UTAA 2EEYA 3C6TB 2H4YB 3RBXA 4PABA 1T05B 5A8KB 2C3PA 1EQMA 4HDHA 5EUHA 1U2FA 3LP1B 2IYIA 1F1BB 2H51B 2RAQA 2PMHA 3EVMA 3M8WA 4Y28C 5H9FJ 2ZUGA 1X5OA 5AXMA 4DS5A 5BYRA 2PC6A 2RMLA 4PYAA 1LW2B 3QFWA 2KM8B 2Y8YA 1FJCA 1GH8A 3AT1B 1IKXA 2QLXA 2WB4A 3PJXA 3ZZOA 3V6KA 1HNXJ 3QZ7A 2DD8S 1VQ9S 1F9HA 3DRYA 4QIGA 3UVJA 4PWWA 1HR0F
chains in the Genus database with same CATH topology
1FDDA 3MM7A 3OR2B 5CYQB 2A18A 4WYLA 4NLUA 2Y1IA 4E8UA 5KFJA 3FRYA 2HHXA 1HWLA 3HO1A 1FJ7A 3JSRA 4AXIA 1VQMS 4OJHA 4URSA 5CA5A 4F25A 3HHNB 3GIMA 1SH3A 2DO4A 3TA2A 1IN0A 3PDNA 5KFCA 1QAXA 1CQNA 2GQQA 2NS1B 4NZ6A 2XC9A 2E7WA 3L95X 1UL3A 3QWPA 3OHAA 1MWZA 4O3OA 2ILYA 1E6VB 5E0OA 2A10A 1M5OC 3T9ZA 2CQ2A 2RF2B 3MAQA 3THVA 1X9MA 3BQ0A 2MZTA 1S0MA 2OPQA 3DRXA 4JV1A 4HT7A 1S0NA 2E1AA 1OS5A 1KN6A 2RKIB 2NXUA 2RQMA 4QR2A 3L09A 1HBNA 4OHZA 1Q7LB 4RBTA 1UWBA 3DM2B 1FRKA 3RAMA 2LEBA 1LV5A 2QMXA 2FVQA 3QIDA 3JYTB 3SQGB 4BC7A 2JZ5A 2YNIA 1VQSA 1WI6A 4QOTA 4NPOA 2MZQA 4QWDA 4H4KC 4JUZA 2IM1A 3G6YA 3GIJA 2R7UA 4Q7AA 2R4FA 3IO1A 2F1FA 2V0NA 2ZH9A 5KFZA 4CI0B 1HD1A 4RW6A 3BEGB 4XPEA 2AYMA 5CZXA 2JRSA 1BQXA 1YI2S 3R5DA 2IHR1 2YY3A 3OXGA 4F3MA 3VAIA 3M30B 3VAMA 3FSIA 4OJ1A 4OMFG 1S0OA 2B9YA 2MHEA 1UETA 1N5QA 3MEEB 3DRSB 2V8GA 2QO3A 3O44A 4X4UA 1ZM9A 5E41A 2HNZA 4Y00A 2ZHAA 1C0TB 3MCSA 2ZFHA 4Q0BA 2CQIA 1UAWA 4USHA 1OQ6A 2C22A 4OLOA 1SIZA 2HMIB 4RNHA 4PG4A 1K0VA 3BN7A 3RR8A 2KXFA 3O5TB 1HL6A 4ZP7A 3GFHA 3IAS9 5L1IA 1BQMB 3L7OA 2R7RA 1R8CA 2JOQA 4IO1A 5IT4A 5KAKA 3QZ8A 1YJNS 2B4PA 1VC0A 5HO4A 3BSCA 4FNHA 4V19X 1HWKA 2QYCA 3ISNC 4DLEA 3K5MA 4OI4A 4ED3A 4QWBA 3CF5Q 4WXWA 2J7WA 2KYZA 3H2VE 2RH3A 4Y2AA 4TU7A 5DM7Q 2R8KA 1WHVA 4DUYF 1NK0A 1REVB 4URQU 3I5BA 3G8QA 3HHEA 1NB7A 1FDNA 4LT6A 4E0DA 3M05A 2ZZNA 2ZE2A 4C2MA 2BQUA 3SCJE 5A8WA 1SL2A 3LOUA 2IC3B 2H5EA 2B5JA 4GKJF 3KK2A 3KHGA 3KNGA 2NPIA 1K1SA 4C98A 1SV5A 4TXSA 4JI6F 2YX1A 3G8TA 2IM3A 4HI1A 3R5CA 1HBOA 4PG8A 1X5PA 1OSCA 1NNDA 1U25A 3IA0A 1NKEA 4YQWA 4CH1A 3U7JA 2M4MA 3MM6A 3BO2A 1R6YA 5F41A 4IO9Q 3DRRA 3CSKA 3RB4A 1IM4A 1F60B 5EWFA 4FVMA 2YTCA 2M0GB 3SI8A 3QLHB 4DV3F 3C6TA 2GA7A 1HYSB 1RAJA 5LSOA 3OUYB 2ZH3A 1WF0A 3GWCA 1AFJA 3ITHA 4YB6A 2FVCA 2YWEA 3I55S 3ENVA 1HI0P 5D6GA 1SBRA 3LGNA 4IG0B 1YRUA 2XZWA 4TYBA 5IFMA 5CYMA