1S1VB

Crystal structure of l100i mutant hiv-1 reverse transcriptase in complex with tnk-651
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
431
structure length
404
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWGIPHPAGIKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase
publication title Crystal structures of HIV-1 reverse transcriptases mutated at codons 100, 106 and 108 and mechanisms of resistance to non-nucleoside inhibitors
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 118
structure length 404
sequence length 431
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s1vB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1vB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1vB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1vB02
4ZPAA 3H4DA 4TXSA 1T94A 2OPRB 2FVQA 4LQ9A 1SV5B 3CO9A 5C24A 3PHEA 3DLEB 1DTQA 4K4VA 5KFEA 5F8HA 3BQ1A 3C6TB 2FLPA 1JXLA 3G6VA 1RT2B 1N6QB 4O4RA 2W8KA 4KSEB 2J6UA 4QPXA 3T5JA 3PW2A 4IKAA 4ID5A 5KFJA 4RZRA 2WOMA 3I0RB 2ALZA 3RBDA 1JLGA 1HMVA 1S6PA 4IG3A 4U7CA 5KG4A 4LSLA 3BREA 4FS2A 3IG1A 4O4GB 1XR7A 3RB0A 3LANA 1S9EA 2UVVA 2XI2A 3MEDB 5CYQB 1GX5A 4RUCA 4EYIB 4F4WA 3Q8SB 1JLEB 1S97A 3BGRB 3LP1A 3DRRA 3OHBA 3KNAA 1RTIA 3E01B 1RA7A 4TN2A 1TKTB 3PJXA 5KT3A 3IS9B 4MK7A 2UVWA 3GQCA 3M8QA 3MEEB 3QGHA 2FJXA 5J2QB 5HP1A 2J6SA 5DGBA 4ECTA 4ECQA 4NLXA 5HLFA 2RKIB 4PUOA 3CWJA 5KFAA 4Q0BA 3BSOA 4IRKA 2VG6A 3MEGA 3T5LA 3T19A 5J2NA 4WFZA 4Y34A 1RT4A 3MR3A 1QE1A 2ASDA 1QUVA 5DQGA 5T14A 2W9CA 5C25B 3OL7A 4IFVA 3KHLA 1TV6B 3DM2B 4NYZA 4ZPDA 3OL8A 3FFIA 3DI6A 1VRTA 2GIQA 3KLEB 1S1UB 5KG2A 2YKNB 2YNIA 2JEJA 1IKVB 2OPPA 4JV0A 1VRUB 4IG0A 2YNGA 4ZVGA 2HNDB 5KFUA 3H59A 1FKPB 2GIRA 1RT5B 4G1QA 3HVTB 3QIPB 3T1AA 5J2MB 2R2SA 3HVWA 4ZPCA 3KHGA 1S1TB 4J9KA 3LP0B 4I2PB 2JC0A 5KFCA 2IA6A 1C1BA 1FK9A 1SH3A 4IH7A 4LSNA 4RW6B 3OLBA 2XCPA 3JYTA 4K4ZA 3HVAA 2CJQA 3N6MA 4I7FA 4KE5A 4F4ZA 1Z4UA 1SUQB 3IN5A 1W25A 1EETB 3DOLB 1REVA 1N4LA 4QW9A 3QO9A 1BQMA 2R2UA 1S4FA 3H5XA 1KLMB 2I5JB 1S1WB 1ZTTA 5J2PB 5HROB 2QV6A 4YR3A 3KMQA 4KKOB 3KLGB 2W7PA 1LWEA 1TKXA 2OPSA 3V6JA 3V6KA 3MECA 1TVRB 5K14B 5F8MA 1BQNB 3GIIA 4NLGA 4U6PA 3BSNA 3DLKA 1GX6A 3MTKA 3H5SA 5F8LA 3CDWA 4NRUA 1ZETA 4R0EA 4RW8A 2UUTA 4URSA 1C0UB 3LP2B 1TQLA 1RT7A 1T05A 5L1IA 2BR0A 3KLIA 4H4OB 5DG7A 2OPQA 4ZP7A 3GYNA 4RNFA 3KK3B 3M8PB 3QGGA 1S9GA 4RW7B 4KO0B 3MR5A 4XPCA 1S0NA 5CYMB 2BRLA 4R5PB 5DQHA 2B6AB 4YR0A 4ICLB 4O44A 5F8IA 3PW7A 3DOKA 2BANA 3QLHB 4X2BA 5C42B 1DLOB 3EZUA 3GIMA 2D3ZA 4ZP6A 2W8LA 4QWBA 3TAMB 5L9XA 3V4IB 4DG1A 4O3SA 3FRZA 3GIJA 4ZMMA 1C1CA 4IR1A 2E9TA 1HQEA 3Q8PB 4DL6A 2UVRA 1HNIB 4H4MB 4WE1A 3KOAA 1HYSB 5C5JA 1NHVA 1HNVB 3RB4A 1C0TB 1TP7A 1JKHA 1S1XA 3DRPA 5KFVA 3QZ7A 2WONA 3QZ8A 1UWBA 2AGPA 2JEGA 4PQUA 3KLHB 5I3UB 1RTHB 4HYKA 4ED6A 2ASJA 5HBMA 4RW4B 4QWCA 4WFXA 4QWEA 5KFMA 2J6TA 3DMJA 1LW2B 3KJVB 3NBPB 5I42B 3V6DA 4J9LA 1EP4B 1JLBA 4ECWA 2YKMB 3PR5B 2WCXA 2FVRA 2R8JA 4FBTA 4TY8A 3PW5A 5JXSA 5KFLA 3C6TA 4ECXA 4IRDA 3JSMA 1HARA 5EWFA 4J9MA 3V81A 3NKYA 3HKWA 4NLOA 2VA2A 3IRXA 4WYWA 3MR2A 4DEZA 3M9NB 1RT3B 3CJ5A 3CJ3A 4YR2A 5KFXA 4HKQA 3GIKA 3D28A 1IKWA 4FS1A 5KFRA 3PVXA 3M9OB 2DPIA 2XC9A 4ED3A 5KT2A 4O3OA 3MEDA 3NMAA 1TL1B 2HNZA 4NLYA 1KHWA 1JLEA 2ZD1A 1FKOA 2V9WA 3DRSB 3I0SB 4MH8A 1TKTA 1RT6A 5J1EB 1RTJB 2R2TA 4NLPA 3ITHA 4PWDA 3G6YA 4MIBA 5F8NA 5C24B 1S49A 4TYBA 1DTQB 4EYHB 3GILA 1JLQA 4Y2AA 2I1RA 4Q45A 2FVSA 1TKZA 3LALA 1S1VA 2XGPA 1IKXA 3BSAA 1WNEA 2W9BA 2IC3A 1LWCA 3D5MA 3E51A 3H40A 4NZ0A 2AWZA 4LQ3A 3ISND 2E9RX 1TL3A 4MK9A 1JLFB 4ID5B 1S6QB 2WOMB 2QE5A 1N5YA 1RDRA 1JLGB 1HMVB 1LW0A 1S6PB 4IG3B 4IFYA 1RT1A 4LSLB 2IJFA 3IG1B 2ILYA 3KHRA 4K4XA 4ECUA 1S9EB 1LWFA 1IKYA 3CDUA 2D3UA 1KHVA 4NLSA 4RW9A 2HAIA 3ICLA 2IJNA 2YKNA 1IM4A 2XWYA 3BR9A 3PR4A 3T5HA 3LP1B 3DRRB 5KFZA 4WZQA 3Q8RB 2ASLA 4IH6A 3DLGA 3RAXA 3UPFA 2AX0A 1QAIA 1RAJA 4TY9A 4WXWA 3QIPA 1HQUA 1RTDB 5F9NA 2V4QA 1N48A 4O3NA 5EWEA 4B3OA 4EBDA 4EEYA 4MFBA 3SI8A 5HP1B 1J5OB 2YNHA 4GC6A 2XI3A 4PUOB 3GV5B 2JLEA 3PJWA 3C6UA 2IM0A 2HNYA 1EETA 2FJVA 4Q0BB 3MEGB 5J2NB 4ZHRA 2C2EA 4ZVEA 3M9MB 1RT4B 1QE1B 1KLMA 2I5JA 2O5DA 5KG3A 2W9CB 2AX1A 2BQRA 1U09A 1HPZA 5KFHA 3FFIB 4KV8A 3UR0A 1VRTB 3DYAB 4K4UA 1TVRA 4ZP9A 2YNIB 2UUWA 5DG9A 2OPPB 4QWAA 4ZP8A 5KG7A 2YNGB 3H98A 1JLCA 2R8IA 4I2QA 2HMIB 4K50A 2VG5A 2ZE2A 1SH0A 4O3PA 2RDIA 4ECRA 1S0OA 2YNFA 4YQWA 4KFBB 3OLAA 4TYAA 1CSJA 3BQ2A 4NCGB 3CJ0A 4IDKB 1C1BB 1FK9B 3CVKA 5EUHA 4LSNB 4RU9A 1RYRA 3JYTB 4QWDA 4FBUA 3KK1B 3MFIA 4I7FB 4RW7A 2B43A 1T3NA 2AGQA 1REVB 4R5PA 3QO9B 1R0AA 1BQMB 2B6AA 4NLDA 1XR6A 4NLTA 3UDLA 4ECYA 4NLQA 4R8UA 1DTTB 5C42A 2V0NA 1DLOA 3UQSA 1LWEB 1TKXB 3T5KA 4ED2A 4DL5A 1D1UA 3KK2A 3MECB 5KT6A 2VG7A 5KFWA 1K1QA 1NHUA 4YMEA 3V4IA 2B5JA 4NLWA 1MU2A 3DLKB 3OL9A 3IGVA 4ED1A 4TQSA 5DQIA 2UVUA 4RW8B 4MIAA 2RF2B 4IQXA 1T05B 3MF5A 1HNVA 1C0TA 3KLIB 4Q8FA 1MMLA 2OPQB 3CJ4A 3G86A 3KLFA 2OH2A 1S9GB 2D7SA 3KHHA 3NL0A 3I5CA 5DLGA 4IR9A 3FSIA 1ZTWA 5FDLA 2IAJA 2W7OA 3EPIA 5D3GA 2HWIA 4O44B 3PZPA 5L1KA 3DOKB 3IGNA 4J9OA 5F9LA 5DG8A 4TLRA 1C2PA 2WK4A 4RNOA 2YKMA 4EBCA 4DL7A 2OPRA 1SV5A 5KG0A 3DLEA 5KFQA 3H5YA 1K1SA 3HHKA 4F4YA 4DG1B 2AU0A 2JEIA 2F8EX 2FLNA 3GV7B 4DL3A 3RAQA 5DGAA 1RT2A 4ED7A 1N6QA 4H54A 4RNMA 4WE1B 4ZVFA 1JX4A 1JIHA 3OSPA 1S48A 5KFKA 4ZVHA 1JKHB 1S1XB 3DRPB 3I0RA 3CDEA 1JLAB 2WONB 1UWBB 5KFBA 2WB4A 4PQUB 4O4GA 2BE2B 5HBMB 1T03B 4KBIA 5CYQA 2GC8A 4KB7A 1S0MA 3DMJB 4F50A 3KLVA 1SH2A 3BGRA 5J1EA 4EO6A 1RTJA 4DL2A 3V6DB 3E01A 5KG5A 1JLBB 3H5UA 3IS9A 2IMWP 3MEEA 4TY8B 4JV1A 4GC7A 3H2LA 3OHAA 5F8JA 3JSMB 4URQU 3RB3A 3V81B 2DPJA 5J2QA 5KFDA 4J9QA 2EC0A 2IBKA 4XO0A 2RKIA 3IRXB 1JLFA 1S6QA 4J9NA 4MKAA 2C28A 2WTFA 4WYLA 1IKWB 4F4XA 3SFUA 3LAMA 2IM3A 3DDKA 4EO8A 2ATLA 4NLVA 5C25A 2HNZB 1TV6A 3DM2A 4Y2CA 3CJ2A 2ZD1B 1FKOB 3KLEA 1S1UA 1NNDA 4QW8A 2CKWA 3NAIA 1IKVA 3BSCA 1RT6B 1VRUA 2BQ3A 5KFPA 3PW0A 1RTIB 3ITHB 4PWDB 2R8GA 2HNDA 1RTDA 3ISNC 1JLQB 1FKPA 3M8QB 1RT5A 1TKZB 3HVTA 1S1VB 5J2MA 1IKXB 1J5OA 3N6LA 4XPEA 4WXOA 1S1TA 2IC3B 3LP0A 4I2PA 3MR6A 2W9BB 1LWCB 4KAIA 4Q44A 1RA6A 4RW6A 3G6XA 1TL3B 3BJYA 5HLFB 1SUQA 2FJWA 2ILZA 4G3IA 3DOLA 1N5YB 5KFTA 1LW0B 2VG6B 4IFYB 2AGOA 1RT1B 3EPGA 2IM2A 2HWHA 2XCAA 1LWFB 1IKYB 1S1WA 3FDSA 3QYYA 3GV8B 3OL6A 5J2PA 5HROA 4IFVB 4RW9B 3DYAA 4KHRA 4KKOA 5EWGA 5F8GA 2WHOA 3KLGA 3DI6B 4RUAA 2RDJA 2C2RA 5K14A 4ECVA 1BQNA 3BQ0A 1S10A 4MK8A 3RB6A 3Q8QB 2HMIA 4IG0B 3DLGB 5EDWA 3NAHA 2FVCA 1HQUB 3SFGA 4KFBA 5KT7A 5L1LA 4B3OB 5JUMA 4MFBB 1C0UA 3LP2A 4G1QB 4NCGA 4IDKA 4O3QA 5KFFA 2YNHB 5KFOA 4H4OA 4RNHA 3KK1A 5KFYA 4NLRA 3C6UB 2HNYB 3KK3A 3M8PA 2R2RA 1QAJA 4KO0A 4ZHRB 4RNNA 4NLUA 4K4WA 4JV2A 5CYMA 4IH5A 4TQRA 2FLLA 3I5AA 2IM1A 4ICLA 4K4YA 4Q8EA 2E9ZA 1DTTA 1HPZB 3FQKA 1OS5A 4KV8B 4NRTA 3QLHA 4ZPBA 2JC1A 4Q43A 3TVKA 1YVFA 2OPSB 1JLCB 3TAMA 4MKBA 4I2QB 3VQSA 3RBEA 2VG5B 2ZE2B 1I6JA 3QIDA 1XR5A 5KFIA 2RF2A 2YNFB 4IOBA 5KFSA 1D0EA 5KFNA 5KG6A 3OSNA 1HNIA 4H4MA 2AQ4A 1HYSA 1RT7B 5L1JA 4J9SA 3FQLA 4ECZA 2C22A 4WFYA 4J9PA 4WZMA 3KLHA 5I3UA 1RTHA 4K4SA 4M94A 3I5BA 5KT5A 4K4TA 2C2DA 4Y3CA 4RW4A 1R0AB 2BQUA 2BRKA 4IRCA 3N6NA 4R8UB 2R8HA 1LW2A 3KJVA 3NBPA 5I42A 3H4BA 5KT4A 4EBEA 2BANB 1EP4A 5DLFA 3KK2B 2VG7B 2XGQA 4OL8A 5KG1A 3QGIA 4KHMA 4URGA 3PW4A 4J9RA 1S9FA 2B5JB 3TQ1A 5KFGA 1N56A 1MU2B 2FVPA 3NGDA 4DL4A 4ECSA 4YP3A 1C1CB 2V4RA 2VA3A 2R8KA 1HQEB 3V6HA 1RT3A 2JEFA 1JLAA 2ZKUA 1RYSA 4O3RA 2D41A 3KLFB 2BE2A 4JUZA 3MFHA 4ED0A 1T03A 4ED8A 1TL1A 3LAKA 3KMSA 4M95A 5FDLB 2IAJB 3CIZA 5D3GB 2WRMA 2W9AA 3DRSA 3I0SA
chains in the Genus database with same CATH superfamily
4OFZA 2G0CA 4B3TF 2HHHJ 4LQ9A 3W65A 2LEPA 1O51A 1N6QB 3WZ0A 1U2FA 8AT1B 1Q8KA 3HSGA 4ZDNA 1S6PA 2ZH8A 1YIJS 3GSDA 4C3MA 2PSZA 4UOFA 1RKJA 4CO4A 3BGRB 2NCKL 2VJVA 4LT6A 3IS9B 3TA2A 3MEEB 3QGHA 1WDTA 2H5EA 4USUA 2N7YA 2Z58B 4PUOA 2UXCJ 1EHWA 3OXGA 2P9CA 2W2QP 5GADI 1B99A 4DR6J 3WC2A 1U8SA 3DGPA 4X62F 5KFUA 3RTVA 2MKSA 4JI7J 1UJ6A 4EK2A 4AXIA 2HZVA 3DFEA 1ZTTA 3BGFA 4EGLA 1YG0A 1FFGB 4EZ9A 4DQIA 4CRJA 1D9AA 2G4BA 1VIOA 2UUTA 4IUFA 4L76A 1I5OB 2HVDA 4IO1A 5HANA 2YXLA 4LRAA 5LJ3Y 3M1VA 3RRKA 3M8YA 1S59A 4NPOA 5MLCV 4DV7F 2JZ5A 4P52A 3KOAA 2YX4A 3J7Z5 2HVIA 1FA0A 1RTHB 4RW4B 5HMYA 4DV1J 3V6DA 3TJ9A 3THTA 5JXSA 4ZVSB 5LJ5Y 5ETVA 4USHA 2VBZA 3IRXA 4DF8A 2DXDA 4FS1A 2DYAA 2E5JA 4DOZA 1Y7PA 2JNJA 5F8NA 1JLQA 2V2KA 1K0TA 3DLBA 3UN3A 2P9GA 5LMUF 1JLFB 2NREA 4U7UK 1HMVB 3KHRA 3JTOA 1SJFA 2XY5A 2Q6BA 3PR4A 1NPPA 1YBAA 3NGSA 5J1PA 4ZVOB 5SUHA 1Y4ZB 2XMMA 4Q0BB 4C0OC 5CAAA 2ZWPA 1JNZB 3J7YU 2PMHA 3TZWA 4NXMJ 3HHDA 1CBKA 4KH0B 1YK9A 2BVZA 4I2QA 3TAPA 2MLXA 3P5BP 4PCQA 1C1BB 3TOQA 1K8AT 1SI9A 2AGQA 2GHPA 3QFHA 4OV1A 1DTTB 4KGKA 3R8YA 1RTZA 2ZH2A 2KDOA 1BGXT 3IGVA 1T05B 3NS6A 2W2NP 3CJ4A 3G86A 1S9GB 2X1GA 3NRBA 3A3OB 4WIIA 2VL1A 2F8MA 1SV5A 2KJWA 4C8ZA 2DXEA 1XNRJ 4NA2A 2EKNA 1S1XB 1JLAB 1S72S 4P9SA 3EMTA 2CQBA 2F7VA 5T7LA 3CW2C 1REGX 1WEXA 1HR0J 1RACB 2MEWA 1WC3A 3E01A 4K2JA 2O66A 4DUYF 3W64A 1YSJA 1HNZF 4WYLA 4HI1A 3R1LA 3MCOA 1SJRA 4B9UA 4DCOB 4F2SA 4NLVA 1RU2A 5E2QA 4JI2F 5HMZA 1S1UA 1NSKL 4QW8A 3HVRA 1RTIB 1M5OC 1FKPA 4EFAC 2HFOA 3N6LA 1M90T 2NPFA 4XDDA 1KQSR 1E6YA 3WDOA 4USJC 4F36A 4H4OA 3HO1A 1IJEB 2OP5A 2KKHA 2MQOA 3T1YJ 3HZEA 4Q8EA 4ZPBA 2XHWA 1UW4A 1PBAA 1X4HA 4QYZK 1RHUB 3SYZA 5KFNA 4OZNA 1CC8A 4USWA 3LUYA 3LGHA 3KJVA 3M4XA 1KNZA 3E8OA 4DN9A 3OR1B 4NZ6A 1VS3A 3CMES 3SCIE 1R6YA 3ENQA 1SKSA 3WX4A 1GK8A 3F41A 1XMOJ 3C16A 5AE1A 4OYAA 1T03A 2XLKA 3TAQA 4I6AA 2E66A 3N28A 3EICA 3MPVA 3UN5A 5KFEA 2FLPA 2EW9A 2I0XA 2VJUA 3GLJA 2BW7A 2V67A 3IG1A 2DH8A 1FRHA 1Y5NB 4U9RA 3KNAA 2ZKTA 3I96A 2JOQA 3W7BA 1K47A 2VBWA 5EN1A 5HVHA 5J2NA 3MM9B 4UZCA 2W9CA 4ZPDA 1T02A 1X0PA 4YDDB 3T3FA 2VPXB 2YNIA 3W2VB 4AL7A 4PG6A 2DGXA 4CTAB 4ELTA 4FYVB 1VIXA 3QIPB 1Y5LB 1CJVB 2HKEA 3KUEA 3UWTA 5LMUJ 1VC5A 5J2PB 2IJRA 3I9ZA 1XWLA 4BDPA 4ZJOA 1TKXA 2V4JB 1HL6A 4BBYA 2QA4S 3JAMY 4LFBJ 2V8VA 1FERA 1NJWA 4KO0B 3B78A 1LK7A 5LSRA 4YB5A 1U45A 4YR0A 4DR1J 2M88A 1RGVA 1N8RT 1A0OB 2D3ZA 2OGUA 1FRKA 2JVOA 2DGWA 4DPUA 3BPSP 4WWSA 1KONA 2R7QA 3KLHB 2KB2A 3DKDA 4OX7A 5KFMA 4J9LA 2WCXA 4RWXA 4FBTA 3C6TA 1HARA 4A4JA 2DY9A 3GONA 3W63A 4ZCIA 3AD7C 3MEDA 5H9FK 2V9WA 3I0SB 1JJ2R 2LQBA 4MIBA 4EYHB 2DGSA 4DFPA 4DFJA 1NZAA 1LWCA 3E51A 3QT7A 3U1NA 2M9KA 2DT9A 3DRYA 4RR5A 5EGYA 1YJ7A 1IM4A 1R31A 2MMYA 3CCES 2ASLA 3J7ZT 3RAXA 2LA6A 1PJ7A 4WXWA 1RTDB 1T7PA 5ETTA 1L3KA 4FVMA 1QDUB 2CDQA 2XULA 3G96A 4G65A 2QGFB 1U26A 4ZVEA 1HNZJ 3CULA 5KG3A 4RBUA 4JP8A 3NCPA 1GMWD 5D0HA 4V19J 4AD6A 1FRLA 1R43A 7FDRA 2ZBPA 1AUDA 2N7CA 1WTBA 1URNA 3A8IA 1U7LA 3GFXA 4GKJF 2XM3A 4NXNF 2RQKA 1H98A 1RZMA 3ZZTA 4TQSA 2PMWA 2CQ3A 2UVUA 1EIYB 3W8GA 1YTYA 1HNVA 2WSCC 3JB9k 2OPQB 2V8DA 3A1YG 1FE4A 1R0BG 4N47A 4RNOA 4C3KA 2MKKA 2VBXA 3HHKA 3RAQA 2UXBJ 3R5BA 1SJ1A 3BEGB 3MCNA 3OV7A 1UWBB 3AXMA 3I82A 2E29A 1DRZA 3H2VE 3DMJB 4YB6A 3MTJA 2IMWP 2HBRB 1DFDA 2BE7D 3THVA 3UI3A 2MQLA 4J9QA 3ULHA 2AZ1A 4XO0A 1S6QA 5E7OB 1QSYA 4OHWA 2IYGA 1WI6A 4EO8A 1SC3B 2FC9A 3KLEA 1VOMA 3CMQA 2JLFA 3PX4A 5J2MA 1DARA 2LXFA 1M1HA 1RSCA 1TMJA 4Y00A 4NI2A 3NEKA 5KFTA 2AGOA 2COLA 2WHOA 3DI6B 3GSIA 1S10A 3DHXA 2XB2D 3I4HX 3OJUA 5JUMA 4KTQA 2CPHA 4TU9A 2HIYA 4LF7J 4C8KA 3BYRA 3VZIA 1VHFA 2R7XA 5GVQA 3VQSA 3TUJC 1I6JA 4M63A 4DPXA 5KG6A 4YHHF 1KFDA 4DV6F 1RT7B 2XO6A 1X60A 4B3RF 2FGCA 4Y3CA 2HHXA 2ZBIA 4IRCA 2BBEA 4W90B 3WC0A 3FZBA 4URGA 5ETLA 2GVZA 3EYZA 4FVCA 2AZ3A 5J1NA 1F2HA 1RCOB 2Y0BB 1UEVA 1VQ7S 2WRMA 2W9AA 1ZH5A 2AW0A 2JVRA 3BQ1A 1NMEB 1S99A 3PW2A 3T5JA 1NH8A 3I0RB 5IXUA 3FNNA 2HGLA 2QRRA 4EYIB 4KR0B 3Q8SB 1JLEB 1S97A 2Y9HA 2HRUA 3AHPA 4TKTA 3BB5A 3ZO7A 4DLEA 2RKIB 1RWMB 2LXIA 3D6TB 1QE1A 4OI4A 1QUVA 1CPZA 4YOEA 2XS5A 3M30A 2H48B 3T1AA 2OSRA 4QU6A 2JC0A 2F5GA 3E3XA 4I7FA 4OZ5A 4JI4F 4KY3A 4LF4F 2YKAA 3R7NB 2OPSA 3V6JA 3W3SA 3EDQB 5BYSA 3OQ2A 3UO0A 2FIUA 2B7BB 2YBVA 4LREA 4R0EA 3D6HB 3RUBL 2VQEF 3GYNA 2OI2A 3ET6B 4R5PB 1KOHA 3GYGA 4RKUC 4BCAA 2KXHA 3EZUA 3GIMA 4ZP6A 1SIWB 1SPBP 4ELUA 4AYBD 1C1CA 2UVRA 2MZ1A 3FBEA 2NXJA 2MLYA 2QL7B 4E98A 4LF8F 2WONA 3ZTRA 2ASJA 2ZH9A 4WFXA 2LDIA 3WBZA 4GKJJ 4HT7A 2XWXA 5KFLA 4C2MA 1VHIA 3HKWA 2I6WA 5IC4B 5KFRA 2EPIA 4GO7X 3JSBA 4DV5J 3PY8A 3SCKE 2NS1B 3AJDA 4OHVA 1FRXA 5DS7A 1QTMA 1TL3A 2XS2A 2POKA 4CO3A 4IG3B 1LW0A 4K4XA 1QAXA 2JH3A 2YKNA 2OUGA 4DPWA 3Q2SC 4W92B 1NLKL 2DH9A 2DHGA 3MM7A 5SZTA 1WSRA 1H72C 2V4QA 5F9NA 1MN9A 5I3PA 3M2VA 2DHHA 1P1TA 2FZCB 4UUXA 4P74A 4ZHRA 3HJVA 3TANA 3PX0A 1B70B 4K4UA 1WOPA 4PR6A 4ZP8A 1H38A 3PRVA 2R8IA 4OZ0A 2MZJA 3DOMA 4UY85 4D3GA 3CCQS 4FBUA 4PWWA 3NGKA 1VQ8S 1T3NA 2JX2A 2K7KA 2YQ1A 3T5KA 4B3MJ 3KK2A 2VG7A 1PC5A 1K1QA 4YMEA 2B5JA 1MU2A 2BDPA 1G3OA 3VAHA 4J7CA 3KLFA 1IVZA 2ZVSA 4O44B 2WK4A 3W61A 4QIVA 3H5YA 1ZS6A 4PXDA 2RHSB 2UUBF 1U0HB 1JIHA 1FDDA 1PIEA 2M3DA 2L3MA 4FXWA 2BE2B 3K5NA 1FF2A 4F50A 4GO5X 3O6QA 2UUAF 4CLWA 4OLPA 1RTJA 4IYQA 4USTA 1RXOB 1SL2A 4DR7J 3CUNA 1HWUA 2NUHA 2Z0GA 2ZITA 3MI7X 3VR1A 1IKWB 4FF3A 2DCLA 4FXDA 4MYUA 3LPEA 2ZH4A 1Q81T 1KKHA 2IRYA 4WXOA 1NK0A 4I2PA 3U02A 3G6XA 4Z7YA 3VZHA 3D66A 2AEFA 1FTRA 1UP1A 2MZRA 1LWFB 3C3LA 3PEJA 1VYAA 4DR4F 3NMRA 2MQPA 5CA5A 1G4CA 2V9KA 5KFOA 2G2ZA 2J7UA 2GMHA 1HWIA 1GNKA 2DISA 2F65A 3FQKA 4USVA 2HS3A 1JXVA 2G13A 2ZFHA 4GKKF 2AQ4A 1HNIA 1MWYA 4ZKAA 3ENVA 2C22A 4DV4J 1YI2S 1Z1ZA 3V4MA 1FFWB 5A8KB 3NBPA 3MM6A 2C2MB 1GAOA 2HGMA 5E0OA 1R89A 4MT1A 5F3ZA 3NP5A 2HAFA 1KOOA 2BOPA 4C7QA 1OQ6A 3KMSA 3QATA 2J0WA 2ROGA 2RRBA 1T94A 2J0XA 1I94J 4MJKA 2CWKA 5C24A 1DTQA 3CCTA 3ILIA 1I1GA 2HHWA 4LR7A 1G6BA 2AEJA 2OEKA 3CD7A 3MM5B 3RBDA 3HFVA 4X66F 5CYQB 2IVMA 4C98A 2GQQA 2NXEA 3KJFB 1LV5A 2K1RA 4WTOB 2A6OA 2QN6B 2L9WA 5J2QB 5DGBA 1WD6A 4ENOA 1YJUA 1LFPA 2IIHA 3TRGA 3BSOA 4WFZA 1CQMA 3DM2B 4NYZA 4B08A 5B7WA 1RLCL 1VQMS 3HVTB 2YPYA 1U49A 3NOCA 1RBLA 2VFVA 4OX6A 3PHTA 4XIUA 2PI4A 1KLMB 5HROB 2GHVC 3BBFA 4KPYA 1KLNA 2C1EB 3VTIA 2PI5A 4K0KJ 5F8LA 2DNLA 1X4DA 3CCSS 2GGPA 4ZP7A 3QJPA 3KK3B 5CYMB 3ZZOA 3G6ES 1ZA1B 1YJWS 3M6VA 3A8EA 4B02A 4H4MB 3K59A 4QBUA 4PQUA 1DURA 3FSXA 2BJDA 2KO1A 3IWLA 3LF0A 2YKMB 5H1SV 4NYPA 3NKYA 1NSAA 3BH6B 4DUZF 1IBMJ 5DO2A 3ILJA 4PG7A 3KDOA 3PVXA 5IC6B 2MZSA 3VGTA 1XNQJ 2ZD1A 1FKOA 2PEBA 1TKTA 3G6YA 1TKZA 2UXDF 3HHLA 2HFZA 2WOMB 4ZCKA 2QE5A 1N5YA 4JOUA 2YWKA 2HPUA 4RW9A 3I9V9 5ITHA 2QEXS 3OTCA 1HW9A 3TUPA 3OUYB 2Y0SD 3VCDA 2CPFA 4WFNQ 2R7RA 2U2FA 4KGMA 4B3OA 4EBDA 1CULA 4FYWB 3RU0A 1GTHA 1X31C 3MOZA 3TVZA 2AX1A 1LEOA 3ZZZA 1LK5A 3JAMU 1VRTB 2OPPB 4DR5J 3MURP 3W5XA 1VQ4S 4B3SJ 1N33J 1SXLA 3LGNA 4CYUA 3QO9B 1R0AA 2Z2ZA 3PV8A 4NLQA 4WCEQ 3Q0AA 3MMAA 4ZLJA 4ED2A 4DL5A 3A4TA 3DLKB 2VQFF 4PXBA 3HXMA 4AE5A 1FWLA 4ZVTB 4C6AA 4NZ7A 2EI5A 3M8SA 5HQ8A 2D7SA 1RWUA 1Z2ZA 1RHJB 3NL0A 5D4PA 5D3GA 4CQ1A 4LRBA 4ED4A 3IGNA 3BBCA 2HRTA 4F4YA 4DUTA 3JQJA 1N6QA 4WE1B 4MYTA 1WG1A 1MMDA 3CDEA 4DSEA 5IV3A 2CG4A 2WB4A 4DBQA 2XZDB 1S0MA 1WORA 1CJUB 3BGRA 4UY8T 1FXRA 3IS9A 3NS5A 3MEEA 2IDLA 2BA9A 3V81B 2HVEA 5KFDA 4O0NA 3FBBA 1N5QA 2FY1A 5CCMA 3GCWP 1TR0A 3C15B 2CKWA 4AFFA 5CZXA 3ITHB 2VZ9A 3D54A 2CQGA 4B9LA 4XPEA 3OR2B 4KAIA 3CC7S 2DXFA 2E1RA 1Q8BA 2VG6B 3BV8A 2KZZA 3MGJA 4DQRA 1L3SA 1D8YA 3UCZP 4YN3B 3CJKB 2KVQE 1NKBA 3PX6A 4CM2A 2Y8YA 4JBCA 1PC4A 1LOUA 5KFFA 3CO0P 1HBUB 4RNHA 4DX5A 2R2RA 3IWXA 2JHEA 2PO4A 3AB4B 5G0RB 3WX8A 1NO8A 3DNCA 4NRTA 4ED5A 1J2VA 4DX8H 2HK3A 1B7YB 2EK6A 3P3DA 4KRWA 1ZM9A 2WSFC 3QIDA 1H2TZ 1D0EA 2ZHBA 1VDHA 4J9SA 3MMCA 1RTHA 3UD3P 4RW4A 1XMQJ 4UW2A 4E2FB 1E6VB 1RISA 3EM1A 1TUGB 5KG1A 5GAGU 3DLHA 1H2VZ 2FVPA 4TVAB 3FEYB 3SQGB 1S79A 2R8KA 2NR0A 2CQDA 3W9HA 4Y6IA 4O3RA 1V3ZA 2KVIA 4ED8A 4ZPAA 1FNMA 2XLJA 3PG9A 3P45B 4ZVUB 2APOA 4WU2A 1T9WA 2KL8A 3Q86A 2PA8D 1HMVA 2XHCA 4OI6A 2G2OA 1ROFA 4B9TA 1QAYA 3K8WA 4R25A 2HBYB 1U6FA 2A1BA 4LF1A 1AB8A 4Q0BA 3TI0A 2J76E 2PD1A 1PYTA 2RU9A 5JVGQ 3KHLA 1N34F 1MG7A 2CXEA 3QFWA 2GAHC 3AXKA 4MAKA 3H59A 4ZPCA 2XY6A 2QA1A 3K58A 1C1BA 5JVHQ 4NEYA 4QW9A 1AUSL 2R2UA 2QL5B 3MMJA 1FE0A 3KLGB 2RQMA 1TVRB 3MUMP 5DRKA 1C4AA 2R7VA 1T05A 5FIIA 3GG1A 2IY5B 4ZS6A 2IMOA 1S9GA 4I69A 2AT1B 5F8IA 2NYIA 3QLHB 3D1QA 3HD1A 2DRBA 5GAEU 3N5BA 2NZ4A 1HQEA 1IR1A 3Q8PB 4A8YA 1S1XA 2EKYA 2AGPA 1UKUA 4HYKA 2MLZA 4QWEA 3TW0A 2Z4PA 3RW6A 4BC9A 4J5OA 4F0HA 4ITSA 4WYWA 3IXQA 3EVOA 3M9OB 3DRSB 4MH8A 5GAGI 3WIVA 5J1EB 4A48A 3C46A 2G2YA 1JJ4A 4FYDA 4NE9C 4TYBA 2MKJA 3BSAA 2X3DA 4P72A 3BF4A 4NZ0A 2AWZA 5BYQA 4ID5B 3IC1A 4DQQA 3HZGA 4DX6A 3KG1A 5KFZA 4MIWA 4TY9A 3PDNA 2XI3A 1P9YA 2IM0A 5K20B 3R9LA 3CDBA 4ZITA 4ZP9A 3EUNA 3RYLA 1XN9A 3MPWA 1NK6A 4I56A 3D0IE 5CH7B 3JXOA 5D4OA 4YEAA 2WW4A 2HS4A 3UD4P 3G82A 1UL3A 3EZ5A 1DJ0A 3OR1A 1DLOA 3MECB 1J5EF 5IT9Y 3MEKA 4DPYA 1FEEA 2VFSA 2ZVIA 4TNOA 4X65J 4MIAA 3AQPA 2Z2LA 5B0EA 3I5CA 3JTNA 3EPIA 1K0VA 2QFIA 4C8OA 5DG8A 4DL7A 2ZZTA 1VBYA 2FLNA 4RNMA 3VVUA 2ZH5A 3T6JA 4AL6A 1ZM3A 3P5TL 5GAEI 4Y2IA 4H4KA 4JV1A 2F4FA 5F8JA 4URQU 1EKRA 2CZVC 2IBKA 3HKZD 4FKXA 5AE2A 3DDIA 5HJXA 3MM9A 4PQAA 2ATLA 2V8PA 4UT4A 4X84A 2MKIA 3W2VA 1VQYA 3ISNC 3FCHA 2W9BB 1NDLA 1CJVA 3POTB 5E33A 2DIUA 3FGVA 2V94A 3AQOA 3QYYA 5J2PA 5E3PA 2JSXA 5HMWA 4P2FA 2HMIA 1UW9A 1UA1A 2V4JA 1D9DA 4JI6F 3ZZUA 2YNHB 4LFCJ 4W98A 3KK1A 2LQ8A 4NLRA 3C6UB 2AJ1A 1IM6A 1QAJA 4KO0A 4TQRA 5B08A 5LMNF 2FGOA 2H54B 4DLGA 3LW5C 2QMWA 4Z2XA 2VB6A 1N34J 5E41A 4UUWA 2ZE2B 2LXUA 4IOBA 3AD8C 3HSDA 1HBNB 5L1JA 4ELVA 4K2XA 4J9VA 3KLHA 3SBMA 4K4TA 4ZLLA 2BANB 2V34A 1N56A 4RBVA 5AT1B 3SV3A 3VVTA 4Y65A 3N5FA 2HZAA 4RO0A 2MPUA 2EXUA 1RB0A 3I0SA 4LR9A 2X3GA 4UQTA 4RUHA 4ZCLA 2CQ2A 1U1RA 5K8MA 5F8HA 1UVKA 2JL9A 2Z2MA 4RZRA 3FK4A 1IBLF 2QJ3A 3BREA 2CFXA 1N5VA 3CIMA 4RUCA 4YY3F 3U1LA 3PJXA 2OSQA 2J6SA 2CVIA 3MMBA 3HHLD 3Q8UA 3BN4A 1AA1B 2KG1A 3T5LA 3NG8A 3OL8A 3RR7A 2MQQA 1G1XA 1IKVB 1TL7B 3OW2R 4GVBB 1CJTB 2GIRA 1FVQA 1GXTA 2BJ3A 3IN5A 3DOLB 2LFVA 5CABA 4KKOB 2W4DA 2CQ4A 2DNPA 5K14B 4LF5F 2VF3A 3CCVS 3MTKA 4LJMA 1HNWF 4J9UE 2CQPA 5DG7A 2OPQA 1N32F 3KXDA 3MR5A 3IM8A 1PBUA 1WSVA 5DQHA 4IOCQ 3D4JA 3FRZA 2JDJA 3MAAB 2G9OA 1UWBA 2BJ8A 4G6VB 3P6YC 2NSBA 3OD2A 3DMJA 3G71S 2FJBB 1EB0A 1H6KX 2FHJA 2RUGA 5D77A 1EP4B 3HPOA 1RAEB 2MGZB 4C4WA 2H51B 4I64A 4O3OA 3OXFA 1S0VA 4DU8A 2DNQA 1KHWA 3MCSA 5FJ4A 4HACB 5GMDA 2WBRA 4X4TA 2I1RA 3LALA 4CLKA 3BKFA 2HQIA 2ZOFA 2CQCA 3BO2A 4IR1A 4LRCA 2CDRB 1HBOB 4A47A 4O0IA 2AX0A 2GMLA 1WWHA 2C2EA 1RT4B 1TMMA 1YGYA 4QIWD 3DYAB 3QT6A 4NOHA 4DU7A 4KJIA 4QWAA 4USKA 5KG7A 1X5SA 3BM7A 4RU2A 4YQWA 4AXJA 3W9JA 5DJBA 2HQ3A 2R9LA 4LSNB 4F4AA 3BO3A 2B6AA 3UDLA 4DXLA 3SZ2A 1LWEB 1BUXA 2GQ2A 2VUGA 3FBCA 3OL9A 5DQIA 5T41A 2V2VA 3D67A 1C0TA 4Q8FA 1PCAA 4JI6J 1TFWA 1KFSA 1UZHA 3ZTQA 1Q5YA 2H5JB 3PZPA 1F1BB 3W5ZA 4EBCA 5LMNJ 4TU8A 4UOHA 2WSEC 3TA0A 4DG1B 2CPYA 3I0RA 2UV8G 4DX7A 5HBMB 1TAQA 3P8BB 1F9EB 4PEOA 4L75A 4DL2A 1FXLA 1RWVB 1RBOB 4RPFA 4CH0S 2RKIA 2EC2A 3H42A 3VGUA 2E1AA 3IFEA 2HIQA 4NYOA 1CJKA 4GVLA 3NAIA 4OX9F 2R8GA 3GU0A 5LM7E 3N0VA 3M6WA 4P6QA 1WHWA 3M8WA 3TZYA 2ILZA 2K06A 1RT1B 1IKYB 3GV8B 4KHRA 5F8GA 4X4RA 2X1FA 2E5IA 1T9TA 4DN0A 5DM6Q 4EZ6A 5BR8F 4MFBB 2CADA 3S1TA 4X64J 5B0DA 4FNHA 2OJ3A 2DNHA 1R8HA 3ET6A 1NK8A 4RNNA 4NLUA 1M1KT 3QT5A 5LXYA 4PG5A 3TO8A 4ID8A 5AXKA 2VG5B 4ZVRB 5KFIA 3BGLA 1HI1A 2BW2A 1HD1A 4ECZA 1R3NA 3HFKA 3K5PA 2AJ2A 1EKSA 2DR8A 3QGIA 1S9FA 1FXDA 1SB6A 2QYCA 2WAQD 4WKYA 5K8PA 1S7HA 3BDEA 1T8EA 2DNNA 2NSCA 3I4PA 1NSPA 1VC0A 2L9DA 3OFFA 2DEJA 5FDLB 2CJYB 4HI2A 3PHEA 3DLEB 1AYEA 1YBTA 3FC9A 3AA9A 3S8SA 1RT2B 1GXLA 3MCMA 3NWRA 1RWPB 3L95X 4IG3A 5KG4A 5A0YB 1JQGA 4X4PA 3GQCA 3SCJE 1ICEB 2EWHA 2KZMA 1Y3JA 1JK9B 3KG4A 4ZJLA 3TX0A 1BWEA 2FZGB 1NEEA 5T14A 4IFVA 3HSJA 3KG0A 2ZUAA 5HVGA 5IZHA 4FF1A 2GIQA 2D69A 4USIA 1A9NB 3MHYA 1BXNA 3NWGA 4J9KA 1U1LA 2OD4A 3RBXA 4C3LA 4RW6B 3N6MA 3C14B 3IBFB 1NKEA 1IXKA 2JRSA 4OX8A 4F3QA 1IN0A 1CQNA 1Y5IB 1QLNA 3EX7B 3GIIA 2O01C 5E3CA 3LO3A 3W5YA 3M8PB 1H74A 4DSFA 2BRLA 2GFFA 4O44A 3PW7A 3FRYA 1V5IB 2BM1A 4JI5J 4ZPTR 4ZMMA 4FP9A 4JI3J 1P9QC 5K5MA 1U0HA 3S7RA 3RB4A 1XC9A 1RAOA 1HNXF 4OI0A 1U02A 4ED6A 4P2MA 2DK2A 3GIRA 4ECWA 3O3LA 1X9WA 4ECXA 4F04B 1YJVA 4C8YA 3PRDA 4ZLNA 1TU0B 1IKWA 4OMFG 4OYMA 4N8OA 3T1HF 4ED3A 3J80Y 1URRA 2DJWA 2JFDA 4DFMA 3JTPA 2GHWA 3PXGa 3M6XA 2AYMA 4A8SA 5A8WB 3EGNA 1WKJA 2ZWOA 1JLGB 1N36J 1TK8A 4QYZJ 4FYYB 1PILA 4ECUA 1LWFA 2D3UA 1KHVA 2IJNA 2HZCA 3DRRB 2A2CA 1YJRA 5ADZA 1QAIA 1RAJA 1FO1A 4AQYJ 2XMKA 1EETA 2XS7A 5F0WA 2I5JA 1ULRA 1P1LA 3UCUP 4ZIVA 3L7PA 3K17A 3PJ9A 4B17A 3D0GE 1B4SA 2L41A 1WG5A 4TYAA 2D74B 5EUHA 2ERRA 5HMXA 4RW7A 2NXNA 2ZEJA 2YVSA 2DGTA 2XYGB 1C4CA 1HWKA 5A8KA 2CQIA 2HQDA 1WEZA 3MUTP 1APSA 2H4WB 3NCQA 2E7WA 1S6UA 2AD9A 4M5MA 5CXTA 3UFCX 5L1KA 2FPHX 2RB7A 2LEAA 1S5ZA 4DV0F 4WP9A 4MMOA 2ROPA 1K1SA 4CLSA 1V3RA 3MM5A 4QR0A 2C3OA 4DV2F 1T03B 4KBIA 5CYQA 2X7IA 3K8VA 2DBBA 3LQVA 3ZNUA 1AT1B 3JSMB 4JV5F 4YFUA 2EC0A 5J2QA 2D3O1 4M1KA 5HVFA 1XQIA 2M7SA 2MZQA 1QD1A 3DM2A 4OZLA 1TL4A 5HK4A 5HO4A 1EX8A 2BMBA 3AODA 3R7BB 1L5UA 2AJ0A 3HVTA 3OTDA 2OAUA 5DZ6A 1JJHA 2Z8QA 2XMWA 3TARA 4G3IA 4IFYB 3FCWA 3GG0A 2HWHA 3PFOA 1S0NA 5HROA 1FWKA 2CPXA 4CO2A 1Q95G 1T3OA 4N76A 3EGZA 3N01A 3M6UA 5IT9U 2QLWA 4N56A 3KK3A 2RIJA 3OVSA 5CYMA 2L9NA 4JYAF 4X4UA 2AF6A 3QAUA 4A8KA 4E8UA 2AHOB 2WVEA 3B4MA 4I0WA 4XAKA 3OSNA 4H4MA 5CQGA 2PFFB 1WKLA 2RRAA 4A46A 4K4SA 4M94A 3I5BA 1I3OB 1SQFA 1AFJA 2P6SA 1RWKB 4OL8A 1WDDA 2GA7A 4Y28C 3GFYA 2SXLA 1UA0A 4DSIA 2EVZA 3B8HA 2B8PA 4DHVA 2NUUG 2ZM6F 1X4GA 1OYEA 2YWHA 5EX0A 3ETOA 5IWAF 3PO4A 4ANCA 2FHJD 2XSFA 3CO9A 3LTOA 2KJVA 2KRBA 3C6TB 1SC4B 3K5LA 2W8KA 2ADBA 5GMEA 4QPXA 2WOMA 4PABA 3MEDB 3HT0A 3OUYA 3K0JA 2ZJRQ 1KS2A 1HI8A 3FBFA 1YHQS 5D0GA 3IWNC 1N5TA 1RLDA 2UP1A 1R8AA 2AJ4A 5C25B 5A6WA 2F8HA 3BZQA 1VRTA 4NL5A 3U27A 2OPPA 4JI1J 4RX6A 5G4DA 1OSCA 1BMQB 2FLOA 3CE8A 2W4PA 1W2BR 3ZTPA 2XCPA 1T9XA 6FD1A 4F4ZA 1SUQB 1YITS 1N4LA 3QO9A 4OLOA 2OFGX 1TUWA 2LECA 4Y0FA 2QV6A 2H9ZA 5ETKA 2W7AA 4P75A 3V6KA 3DLKA 5LSOA 4KH1B 1RAGB 3IRWP 2EFOA 4I6YA 2B51A 3US5A 3CF5Q 4ICLB 1Q82T 4EWTA 4WFBQ 8ATCB 2O67A 3UVJB 2CJAA 1ZAVA 1KR4A 3PYDA 3BBBA 4WE1A 1HNVB 5KFVA 4LFAJ 2BE9B 1PAUB 4WP8A 4IOAQ 3L4BC 1LW2B 1CJUA 3GTYX 4U67Q 2B3TB 3PR5B 2VD3A 3RZAA 5IS2A 3WQPA 3A8JA 2QZ8A 4WK3A 3V81A 3FMBA 3MR2A 1X8DA 4DEZA 1KQGB 4CM0A 3D28A 1VQ5S 4QOTA 3QGPA 3C15A 3X1LB 3ITHA 1FDBA 2FZKB 3NNCA 3OR2A 1U48A 4UQGA 2NQPA 1S6QB 2ILYA 1S12A 2EG1A 1RWWB 3CJKA 1IBKF 4B3TJ 3I6PA 3KYLA 1HBUA 3IP0A 4JI8F 4JV5J 3TZXA 1D8ZA 1WC4A 1S4EA 1NK7A 5G0RA 3K57A 4PXEA 4M5DB 2UUWA 1Q5VA 2W2PP 4F7VA 4HDGA 2CNKB 1EZZB 2CPJA 4BS2A 2RDIA 1S0OA 3GJRB 1RUSA 3CJ8A 1FK9B 2EFPA 4HR2A 5L39A 2LU1A 1VFJA 1E6VA 5C42A 3UQSA 1X0FA 3BN7A 5E3QA 3SQGA 4OZJA 4X62J 2ZDPA 1F6TA 1NDPA 5B09A 3SXLA 2BZ2A 1MMLA 1XERA 1WTFA 2MQMA 1PYSB 1U24A 3DOKB 5F9LA 4TLRA 4HTIA 4JYAJ 1HHSA 1L3UA 4RWWA 3GV7B 4DL3A 5DGAA 1Y0HA 4ZVFA 1PJ6A 2P2CB 2HYIB 5D8HB 2GC8A 1X4AA 2PT0A 2D3OR 4TY8B 3RJMB 3AH6A 3H25A 3MD1A 4DV7J 4L73A 2LQ5A 1VI7A 4OZ2A 5MAOA 2QLXA 1RK8A 1KVJA 4AT1B 1VQPS 2HBQB 1WOOA 1VR6A 2DIVA 3QRQA 1O5JA 1IKXB 3W2WB 2R7WA 3AJ1A 4LIWA 2N82B 2HQGA 3KNGA 4DL6A 2WVFA 3KLGA 2VPZB 1UVNA 4KQZA 3DRXA 1ZPVA 4IDKA 1Y00A 5ETOA 2MZTA 2GJIA 5KFYA 2MTLA 3FMWA 1HQ2A 4K4WA 2ZNZA 2I9SA 2IM1A 1BWVA 1RWOB 3QLHA 3ELHA 3CSKA 1RAAB 2OPSB 2YWWA 5IFMA 2RF2A 3ZFVA 1ZA2B 4OYXA 3QJLA 2PE8A 2WVDA 5HJYA 2QYGA 4CLTA 4OQJA 4KHPF 1N5SA 4X4QA 1OMSA 4KPCA 5DLFA 4QJVA 2QIFA 2ZOMA 1C1CB 4B9NA 1ZPWX 2ZKUA 3OT9A 1SCJB 2BV3A 2IAJB 1IQZA 1KRPA 3DRSA 2RNEA 3SV4A 2OPRB 1EQ0A 2NLWA 2E5LF 2AP6A 2GX8A 2J6UA 3EGVA 2FDNA 4ID5A 2V8HA 4LUBA 4N7TA 3LANA 1FJCA 3G87A 2M4MA 2CIMA 2UVWA 3M8QA 5DZ7A 2CRLA 2XMTA 4ES1A 3IO1A 4NLXA 5E3AA 5B0FA 1X5OA 2J7KA 5JMNA 3F73A 2FD2A 2KI2A 2DGQA 1TV6B 1ZZFA 1FT8A 2NXCA 2YKNB 1VRUB 3OTOF 4DSJA 2OEJA 1S1TB 1YZ6A 2PEHA 3LWLA 4DUYJ 1F3FA 1KDNA 2IA6A 3K2YA 2N4DA 3M05A 3HVAA 1TKDA 2CZ4A 2KTQA 2HHTA 1S1WB 3KMQA 1RWXB 1NSQA 4JI2J 2W7PA 1QM9A 3MECA 5H9EK 2OEMA 4LRDA 4NLGA 2V5HG 1ZETA 1Q7LB 5D78A 1SL1A 1VLYA 4A8FA 4PG8A 2F4VF 1TK5A 3UNGC 3FSYA 4I4BA 2IVFB 4LF6F 2R3VA 4QWBA 1BE4A 4DPOA 1AZSB 4C97A 2FYXA 5C5JA 1VGYA 2VHGA 2IFXA 1XIQA 4CWBA 2BM0A 3TYTA 3DDNA 5HI7A 2VDHA 2J6TA 5I42B 1Q86T 1B0VA 4LMZA 2I2YA 2HFUA 1RAHB 4RJVA 1RT3B 1QY7A 2E7VA 2HHQA 1F3VA 4XDCA 1LXJA 1RTJB 3MPYA 1WNEA 4DR2F 5KOWA 2W9BA 3OVAA 3T9ZA 3POTA 2K8GA 2AIRB 4PG4A 2E1MC 4QIFA 2FC8A 3AB2B 2YNHA 5AJ3F 4GC6A 3C6UA 3MEGB 3HP6A 1V3SA 2ZBCA 2O5DA 1UEUA 5DETA 3FFIB 2HFNA 2KFYA 4M5KA 2YNGB 2BUNA 2ZE2A 4Z37A 1U1NA 1HBNA 3JYTB 3IM9A 5D0RA 3MFIA 5BXIA 2B43A 2IRUA 2FJDB 1REVB 2XEXA 3D6FB 2HHHF 3QMQA 2HGNA 3V4IA 2C2ZB 2BXJA 1SJ3P 1WG4A 1F5BA 5CHCB 1AXQA 4M5GA 4WBFA 2QMXA 2W7OA 5D6GA 2GQCA 1KP6A 2LU2A 3J80U 2Z2YB 4BC7A 3DCAA 2UXCF 3L7UA 2CYYA 5KFKA 1JKHB 1NH7A 4L3NA 3A12A 3CCJS 1O6XA 5CD4H 2BACA 4DR6F 2VH7A 4EO6A 1VJWA 1JLBB 1U0SA 2YKOA 4JI7F 1JMTA 2VBYA 2EBGA 3JS9A 3KJNB 1LNQA 2L08A 1WUUA 3IA0A 4J90A 3RW7A 1IKVA 3D1OA 2F1FA 1TL7A 1FD8A 4GVBA 2RQCA 1RKIA 1KQFB 2DR9A 2K1RB 4UOCA 1YJNS 1J5OA 3VAGA 1LQ9A 2XSJA 2O3DA 3DOLA 8RUCA 1BC6A 1N0VC 1P27B 1R8CA 4KKOA 2Q79A 3G8QA 5K14A 2CNNB 1KVKA 5L1LA 4KFBA 2RH3A 1IWAA 1T95A 3R2CJ 5JJBA 2U1AA 4DV1F 2DNMA 2G1DA 1HPZB 1VLOA 2DEIA 1NZ8A 3M8ZA 1Q8LA 3A13A 1JLCB 1XR5A 4X4OA 1WJ9A 4ZVQB 1EAYC 2R7SA 1HW8A 1KBRA 1EP4A 1KN6A 2DNZA 1D3WA 3W66A 5LL6d 5A6PA 1OPZA 1VCTA 2MGZA 3DN9A 2V4RA 4OJ1A 1Y11A 4L6V3 3W62A 2VFUA 2GJ2A 1XTZA 3CXCR 4P10A 4BWMA 4AL5A 2EBEA 1RHMB 4HACA 5K8OA 4NXNJ 2LKZA 1FI4A 2RU3A 2W25A 4LF6J 1FHTA 4KSEB 2VFTA 3CJSA 4LBHA 2CPDA 3H20A 3I32A 2HLUA 4C9DA 1HKAA 2VC0A 4NXMF 4B9SA 1TKTB 3OFGA 4ILLA 2FJXA 4ECTA 5LT5A 5HLFA 1F9HA 3R5DA 1YWXA 1RT4A 5D0EA 4DV3F 1GMWA 1CEZA 2DHSA 5FD1A 4PRFA 4CDIA 4DZDA 1V9OA 5A8RB 1CULB 2OTJS 4NMLA 4K4ZA 4LSNA 3G2XA 4FPRA 4KE5A 3AY0A 1M5KC 1W25A 4X4NA 4MTPA 3IBWA 1LWEA 3CC4S 2ZH1A 3UDCA 1VQ9S 1XNRF 3VGSA 4U6PA 3BSNA 2H1YA 1WF2A 4Y2KA 3M2UB 5D15A 5L1IA 1JJCB 2J9DE 5LXRA 1HR0F 2M8HA 1Q16B 3EXYA 1SKUB 4A8QA 3EWGA 2W8LA 3TAMB 4DG1A 2V69A 3VHQA 2F9DA 2I38A 3QZ7A 5I3UB 1P8GA 5HBMA 4ATNA 2ZZNA 2B9XA 3JQMA 3HJFA 1UCNA 2WZ1A 1Q53A 1ZBTA 2R7UA 3J81Y 2DNKA 2DY1A 3CJ3A 4YR2A 4YHHJ 4DV6J 3QPIA 1TL1B 4NLYA 4DDFA 4B3RJ 4G1IA 2G1HA 4NLPA 3G4SS 2YKPA 4Q45A 2XGPA 1PGZA 2C3YA 1RDRA 5B0BA 3T1YF 1RT1A 4LSLB 2IJFA 1IKYA 3Q89A 1KC8T 4KIAA 3RG6A 3BDPA 4EEYA 4MFBA 1SKRA 4HL9A 3M9MB 4NWBA 1UVJA 1F9FA 2LQJA 4K50A 2VG5A 1SH0A 3EXCX 1XMOF 1U1PA 3HLUA 2B8QA 2YQ0A 4LVOP 4FYXB 3KKFA 4CO1A 2W4CA 1BQMB 4NLDA 1WELA 4OYBA 3HFZB 5BYRA 5ETPA 4YDXA 1LFWA 1D1UA 3BO4A 1TL5A 2RT3A 1K44A 4YB1P 5DDPC 2FHMA 3MMCB 5A2QU 4JI4J 1VQ6S 2O1PA 5FDLA 1S6OA 2HWIA 2C3PA 1OQ3A 4LF4J 3DLEA 5KFQA 4P73A 3CCZA 1RT2A 4ED7A 4K5RA 1H73A 2VQEJ 2VPYB 5A0YA 4M5HA 3LOUA 3NNHA 4PPDA 3BPDA 1N52B 2RDDA 4GC7A 3RB3A 4P7TA 1NDKA 1UFKA 2QX0A 2LCWA 4LF8J 3L3CA 3K7RA 1NNDA 1M1GA 1RT6B 2BQ3A 2AYBA 7AT1B 3PW0A 4PWDB 2YKQA 4HTJA 9RUBA 3EZOA 4LFBF 1FJ7A 3CCMS 4RW6A 4C48A 4NEZA 3C14A 3GMGA 2CQ0A 4DR1F 3PFEA 3CD0A 4IRDA 1PJ5A 1F0XA 3BQ0A 3CMAS 2W1BA 3DLGB 3NAHA 4CH7A 1HQUB 2CNLB 4HHJA 2BEFA 4NCGA 2OIHA 3M8PA 2MHEA 3ENWA 4KV8B 1YVFA 2ZBQA 4DV3J 4FDFA 3P49B 4MKBA 3RBEA 4C8MA 4GMKA 2YNFB 2DNGA 3FQLA 2CJBA 2WW8A 2ZH3A 3KDNA 3C19A 1T11A 1WKKA 4R8UB 2R8HA 4CLYA 3R7SB 5EX3A 3DLJA 1TAUA 2UUCF 1FKAF 4ECSA 1OY8A 1HQEB 1S57A 1VBZA 4OYZA 2JEFA 1RYSA 1FRIA 2GMJA 1SL0A 3M8RA 5A8WA 1FX2A 3B4DA 1H7XA 1T0TV 4IKAA 5KFJA 1HWLA 1JLGA 3BH7B 4O4GB 2BJ1A 4FKYA 1FNXH 4O23A 1D9FA 3DRRA 2V50A 4OHYA 2EFGA 4F67A 4ILMA 3SSQA 3EVWA 1X4BA 4HVZA 2UUBJ 2HW3A 4NMXA 2MY8A 5K8NA 4Y34A 1U2CA 3BGUA 2YWGA 1HA1A 1PKUA 2JEJA 4JV0A 1HHQA 2UUAJ 4IG0A 1MN7A 2AEMA 2HNDB 2MJUA 4G1QA 4NA3A 1FX4A 3TZZA 4ZN3A 1VQLS 1UAWA 2XLIA 2UXBF 2KYXA 3TEGA 2KHDA 4NRUA 1B3TA 2BR0A 5B0CA 1RCXB 3QGGA 3PO5A 1DAXA 3J7YI 5A76A 2EG2A 2V8GA 3G82B 2M5YA 4X2BA 1DLOB 5CYJA 3D68A 4QU7A 4DR4J 2MYFA 2DR7A 1HYSB 4NCAA 1NHVA 4PWUA 3QZ8A 3DLLQ 1U1MA 2P9EA 2RD5C 3CCRS 2FVRA 3JSMA 1GT8A 2HBZB 4GKKJ 5KFXA 3GIKA 3GJTB 4G1PA 3J81j 3IBCB 1ELOA 1HBMB 2XNQA 1S49A 4U95A 4LF7F 5GMKa 4LQ3A 4F25A 1UJ5A 2QLBB 4IFYA 2R7TA 3A8KA 2M70A 1S9EB 4J37A 2HAIA 3BR9A 4OJHA 3LP1B 3JSRA 1WC0A 2A2DA 3H2UB 3T41A 4ZN1A 5L9NA 4I1TA 4FXVA 2KM8C 5CD4A 3HI9A 2HS0A 4X66J 2XG8A 1NAQA 3UDVA 2HMIB 2JJ4D 2ADCA 1H7WA 2FJEB 3OLAA 3KK1B 5BJRA 4U7UD 2MY7A 1DHMA 2QLFB 4CCHA 5AXNA 2PDAA 4OJGA 2OH2A 1XMBA 4KYZA 2KU7A 1D09B 2OLWA 2R7OA 2CPZA 3S6EA 2ZUGA 3ZC4A 5HL7Q 2HSEB 4IQMA 1UJ4A 4H54A 3MZIA 4ZVHA 3DRPB 4K5SA 2XQCA 1NK9A 4KB7A 1UFLA 4N77A 4EI2A 2CZ9A 3OVBA 3H2LA 3OHAA 3TNVA 5ETNA 2UUCJ 3N4WA 2ABYA 5HQLA 1JLFA 2ROEA 3O44A 2WTFA 1VQOS 3SFUA 1YRUA 3DDKA 2VOPA 2OFHX 5C25A 2KT5A 3GPAA 2QG9B 3AOBA 5FLXU 4OZ3A 1GMUA 2JFKA 1UVMA 5KG5A 2DCUB 1PAEX 2EFVA 4KC5A 3MMBB 1PYOB 3QQCD 3F56A 4DUZJ 1FTCA 1SUQA 3VAMA 1B64A 2XCAA 4F02A 3EVMA 4RUAA 4C0HA 2BYCA 3SDEB 3SFGA 4PKDB 2C3UA 2C42A 2Y8WA 2UXDJ 2E1CA 4A8MP 4JV2A 3MM8B 2FLLA 4USMA 4ICLA 1DTTA 1OS5A 3F44A 4Q2LA 3UVJA 1ITPA 1GH8A 1NUEA 3PIPQ 2K3KA 5IQQA 1Q4RA 3B82A 1FNOA 4DV5F 3RGIA 4CIOA 2DNRA 1M0SA 1LW2A 4XTTA 4F4KA 5IM0B 4EBEA 4CLPA 3Q23A 2XGQA 1NCLA 1X9SA 5KFGA 3NGDA 4F26A 1U8WA 4YP3A 1VK8A 2Y1JA 3VALA 1JLAA 7FD1A 1R7IA 2CUYA 1W2IA 4TXSA 3PRBA 4ES2A 4R0JA 2J8SA 5F41A 1N54B 3JSYA 2VQFJ 1AW0A 3AA8A 1FDAA 2GAGC 1RTIA 4ECQA 1TTHB 1TUVA 4IRKA 1OO0B 3T19A 2B7CB 1KSPA 1JWWA 5DQGA 1DQAA 1QSLA 4B3MF 1W7WA 3VAIA 4M5DA 1U6BA 3CT9A 1FVSA 2QC3A 4M5JA 2J0SD 3L09A 3LP0B 3M2RB 1FK9A 4OYPA 4ER8A 1UFWA 3HSZA 1RP5A 3NGTA 1Q0NA 3UR3C 3FJ2A 2FTRA 3ZNJ1 3ZZYA 4HDHA 2XO7A 1UTAA 2PC6A 5F8MA 1Z2LA 1MROB 1BQNB 3ENAA 1FJEB 2MKCA 1GX6A 2N4CA 3CDWA 1UVLA 4WZMA 3LP2B 1G7CB 1NRKA 3W8PA 4ZPWR 2IHR1 2OMLA 2B6AB 2B9WA 3DOKA 3SIPB 1XJWB 3TVYA 4YB7A 3TUIC 4DR7F 4CO5A 4OJ3A 5L9XA 3GIJA 2E9TA 3D3BJ 3IR7B 5CZVA 2W2MP 3RR8A 1C0TB 1KWMA 1DZ5A 2AYGA 3O2IA 1MMNA 2V63A 2B56A 1HI0P 1H3DA 1B0PA 4Q5VA 4TY8A 4F0MA 3HM9A 3ISZA 1CVJA 3UE2A 3C2PA 4ILRA 3B54A 1ZZNA 3PKMA 1MLAA 1SIZA 3B6BA 1R8BA 3OJSA 3GILA 1IKXA 3PM9A 3W2WA 2MQNA 4ANEA 4CLLA 4ZCMA 2X1BA 3ICLA 1CJKB 2J8AA 4CTAA 2LEBA 5M2PA 3ZTOA 3QIPA 3NGRA 5HP1B 1DQ8A 3PJWA 4DV4F 2RVJA 4PYDA 4CLUA 2AYEA 3NGUA 5CCLA 3D3CJ 4ZOSA 2GS8A 4CT8A 3H0PA 4CLZA 3D2WA 3OBIA 3MPDA 4XK8C 1H0HB 5ETQA 3PIOQ 2DGVA 4WTYA 2MQ8A 2ZC4A 2YWFA 4ECYA 2EEYA 1CLFA 4OYOA 1I94F 2HHUA 1MWQA 4DR3F 1JB0C 2OO4A 2MKYA 2QA4G 4RW8B 1R0CB 1NHKL 3L7OA 3PACA 3KLIB 4K59A 1NB2A 3GB0A 3J81U 1YRTA 2IAJA 4HHUA 2OPRA 1U25A 4C11B 1Y9OA 3VAFA 1S48A 5IV4A 3MR7A 1Q7YT 1W26A 2Y3YA 5L46A 4ZVPB 2HEKA 3VF0B 3PYFA 1VC6A 4MKAA 2X1AA 3LAMA 1J27A 2HNZB 1TV6A 2DR5A 1YKWA 3PEHA 2KFNA 3M32B 3BSCA 3O5TB 1VRUA 1TFYA 4TU7A 4K0KF 1G2EA 2BABA 1RTDA 3VAKA 1S1VB 2I8EA 2FUG9 1S1TA 2IC3B 3R1HA 5IT4A 1RA6A 4ZA1A 3EPGA 2NXUA 1S1WA 4IFVB 3KUHA 2VDIA 3CJQA 4HEA9 2C2RA 4QYRA 3QSYB 4ECVA 3UD5A 3R2DJ 1ZAWA 3AOCA 5AXMA 2FVCA 2ZJPQ 4GRSA 2UV8A 2HNYB 2X51A 1OJ4A 2XBPA 4WKRA 3RBZA 3TVKA 2LA4A 2K2PA 1DY3A 1FD2A 4ES3A 2OD6A 1RADB 3VQTA 1IBMF 1Q8IA 2RAQA 1AZSA 3UCGA 5I3QA 1BHNA 1XNQF 1IJFB 2N3LA 5I42A 3KUGA 4I68A 4RL1A 2GVDB 2R4FA 1U1QA 2Y1LB 2XMJA 1KEKA 3BR8A 2QA2A 2GCFA 4V1Ak 3CJRA 1RT3A 2D41A 1YZ7A 4JUZA 3MFHA 3LAKA 2HQFA 1XK8A 4LSZB 2VONA 2RQ4A 3ILOA 1J5EJ 2V2QA 4O4RA 1RU1A 2H4YB 1AROP 5B0GA 1WI8A 3AD9C 4OIXA 4U96A 1VQNS 1OWXA 4DR5F 1CS4B 2YH1A 3KWMA 4B3SF 1N33F 2CPEA 3CWJA 3QWPA 3TUZC 1U1OA 4WPAA 3MEGA 2A3JA 1OY9A 2AKWB 1GMVA 3FFIA 3DI6A 1VK3A 5KG2A 3CD5A 2BJEA 3KFWX 2YNGA 4ZVGA 1S77D 1RT5B 2YTCA 3HVWA 3AJ2A 2KRRA 5KFCA 3JYTA 2CJQA 1EETB 1REVA 3TR5A 3N9UC 2I5JB 3DU5A 1JNRB 3CJTA 1EJ7L 2QL9B 2Z56B 1Y3KA 3GR0A 3MUVP 1RI7A 2VU5A 2DD8S 4LF9F 1HHTP 1C0UB 1RT7A 1NJIT 4RNFA 4RW7B 1U6ZA 4UF4A 4XPCA 2HURA 4BLGA 5HN0A 5RUBA 1DQ9A 3AT1B 1OPIA 2M2BA 4M5NA 1JKHA 1F60B 2Z30B 4CI0B 3FZ2A 3O1LA 2DVIA 1VJQA 2LP4A 1FESA 4LVNP 1JLBA 2R8JA 4CNZA 3L9ZA 4DR3J 5EWFA 4WFAQ 4ZIWA 2GZOA 3DHWC 3M9NB 5L8RC 1K73T 4HKQA 1ZM2A 2KH9A 3HMJG 3KJQB 2XMAA 3C8YA 2DTJA 1YJ9S 1JLEA 4PPZA 1PO6A 3CTRA 2BKNA 1SC6A 2J9DA 2DKOB 3SEOA 2FVSA 2ACMA 3H40A 3GZ7A 5U47A 2LDYA 5GAHU 3A3NB 1S6PB 3HK2A 1YRXA 5IQ6A 1V5VA 1QSSA 1HIYA 4WZQA 2IA0A 4IH6A 4LBIA 3HHLC 3SI8A 2DNYA 4PUOB 2XYPB 2FJVA 1XMQF 1OSDA 1IBLJ 1HPZA 5KFHA 4N41A 1CG2A 2VFRA 4YY3J 3DGPB 3H98A 1JLCA 5B0AA 3NOGA 3W1YC 1CSJA 3BQ2A 3TJ8A 2ATCB 4B9VA 1X4FA 1BLUA 4R5PA 2Q6CA 2OTLS 1XR6A 3SSSA 3TA1A 1L3VA 3HHNB 3E2EA 2VOOA 2B4UA 5KAKA 1IBCB 1VQKS 3MF5A 3G8SA 1UMJA 4MKYA 2NZCA 4L3KA 3M1VB 3VAJA 3NCRA 4OI2A 4ZLPA 3Q2TC 5KG0A 4LF5J 3R5JB 1WC6A 2AU0A 3K89A 3TEHB 1VQSA 1HNWJ 3TX8A 2F9JA 1QUPA 3R6GB 1JX4A 2XMVA 5HSPA 1N32J 4OYIA 3KLVA 1NXIA 2H5IB 4DS5A 4JI0F 3V6DB 3U7JA 1VBKA 2QMUB 3TQEA 1X9MA 3IAS9 1KD1T 1Q79A 2EFQA 2DNOA 2VV5A 4X4VA 2A18A 4PXCA 3IRXB 2C28A 3I87A 1X5TA 2QFJA 3MPUB 4Y2CA 1H2UX 3CJ2A 2HHPA 2LVWA 2Z57B 3HDSA 5F3TA 4P2SA 4CLFA 1JLQB 2RS8A 5A8RA 1QJHA 4DS4A 1WF0A 3BJYA 4X4SA 1QVFR 2HG4A 2IM2A 4OHXA 3NXZA 2MB0B 3OL6A 3H4BA 4J91A 1OY6A 3IR6B 3Q8QB 1F5AA 5GAHI 2ALYB 3M2UA 5ETRA 2DO0A 5KTQA 1N88A 2KFZA 3AFGA 2FB0A 2ZJQQ 4Q43A 3PYEA 3CCWA 3T6BA 4FZVA 1CC7A 3TAMA 4I2QB 1YDLA 2J0QD 1NJYA 3GE9A 4MKVA 3QRPA 5I3UA 3C66A 3THPA 4NA1A 2JLGA 2BRKA 4L72B 2DHAA 2R42A 1YBUA 2MDAA 2RRNA 3V6HA 4LF9J 1KVIA 2BE2A 3NLCA 2Y1RI 5IT0A 1TL1A 2C2NA 2ZC3A 2H65B 2BKOA 3R3TA 2J9CA 1WHVA 1SV5B 1JXLA 3G6VA 3LGMA 4ZK7M 1NB7A 1IWGA 5F0UA 2ZHOA 2VKZG 1A6LA 4LSLA 2KT3A 5HAOA 4F3MA 5T7LB 2E7XA 4LIRA 3NY0A 3T9NA 3E01B 1RA7A 3Q83A 2ZH7A 4MK7A 1PSDA 2F3JA 2L48A 2ZH6A 4D3HA 4N5SA 2RHQB 2A0FB 2RILA 3D0HE 5I4MA 4UZBA 2HK2A 1S1UB 1NBEB 2CWXA 4X65F 1FKPB 2HFSA 1IUJA 2R2SA 5M2RA 2PA3A 4F0KA 1SH3A 3OLBA 4CP5A 3CEDA 3GCXP 2KHCA 1BQMA 2QLJB 4YR3A 2HRYA 4A8XA 3GJSB 1M5PC 1SC1B 5C2GA 4OX9J 1E6YB 3ONQA 3BYPA 2ZHAA 1RJJA 2VASA 1B7FA 4H4OB 3PYGA 3R27A 4NASA 3PCOB 3HD2A 2Q1LA 4DQPA 2GW8A 5C42B 1KTVA 1BD6A 1FFSB 2RS2A 5BR8J 2DH7A 4KGZB 4DCJB 3BKTA 2P5VA 4QWCA 1M5VC 5DM7Q 1F2GA 3W9IA 1FWPA 2F63A 1KQKA 3KJVB 1FJGF 4CH1A 3PW5A 4J9MA 1GTEA 2N3OA 6FDRA 2LQ9A 2VPWB 2J9EA 4ETZA 3C16B 2CJKA 1ZM4A 5E3RA 1MSWD 2J5AA 1RT6A 4WU3A 2R2TA 4PWDA 3CDAA 4LFCF 3H90A 2HFVA 3ISND 1RAIB 2Q43A 3FEXB 3IG1B 4NLSA 4C8NA 1U1KA 2C2OB 3Q8RB 1HFEL 3DLGA 4JI0J 1HQUA 4O3NA 3DXSX 5J2NB 3HF5A 3G9CA 1KLMA 4OYWA 3NS7B 2W9CB 4DPTA 1U09A 4KV8A 1IR0A 1MNEA 2YNIB 4L74A 4ETXA 9ATCB 4O3PA 2YNFA 4QR2A 1WOSA 4IDKB 1VRQC 4ZPVR 4RU9A 2DHXA 3GP9A 4HLBA 4QWDA 4DZ6A 1WF1A 1FRJA 5DDRC 2ZOGA 2GJFA 2IPOB 4R8UA 4WF9Q 3N79A 4DF4A 3R6LB 1TKXB 3ZZPA 5H9FJ 1WHXA 2D1CA 4ZJQA 5HQMA 2RF2B 4IQXA 3CPWR 1JXEA 3W60A 4DSLA 1Q78A 4IR9A 1ZTWA 1PG5B 2HVZA 1YX2A 2CVEA 4J9OA 1NU4A 5EHHA 2YKMA 3ILLA 2YX1A 2B9EA 5LOQA 2VC1A 2F8EX 1P6TA 1B0TA 5ETSA 4O4GA 2QSFA 3TWZA 2FHOB 1SH2A 2LMIA 3D9BA 3DC2A 1GEHA 1FEHA 3FEZA 3V2UC 4QCLA 2MXYA 3TJAA 5H9EJ 2HHSA 3A3PB 2VIHA 1HNXJ 1M5HA 4QPTA 4CZCA 2IRXA 1X7VA 3CGIA 2IDEA 4H4KC 2QO3A 5E5NA 2HNDA 4PZVA 3M8QB 4Y2MA 3GR1A 1LWCB 3HHEA 1RABB 1NPRA 1YJTA 2AV5A 3SMZA 2KM8B 3R97A 3RRGA 3T1HJ 2GO8A 2KT2A 2JWNA 3FKBA 4I67A 2IYIA 3JQKA 5EDWA 3RRHA 2FHKA 5KT7A 3UNYA 3GWCA 1Q1KA 2IBOA 2AMCB 1HD0A 3VWSA 4K4YA 2ACYA 1RHKB 2LYVA 3GFHA 3IR5B 4PAAA 3GFZA 3U1MA 2C2KB 1SQGA 3F0NA 1HYSA 4WFYA 2C2DA 2V68A 1MW7A 3R5GA 1XBWA 4LBPA 2B9YA 2LLZA 2F40A 2KXNB 4P2XA 3Q22A 2EFNA 3H5XA 3PW4A 4J9RA 3VGVA 4N8NA 4M95A 2HLTA 3CIZA 2YH0A 1HBMA 3H4DA 1RAFB 4K4VA 1NJZA 5A2QY 4FPIA 1SJ4P 4B9MA 2YY3A 3RB0A 3ETMA 1S9EA 1XEZA 2UVVA 1VMBA 2OHDA 2VKRA 3LP1A 2P8IA 1R27B 3HCXA 5KT3A 1FJGJ 1X4EA 3X3UA 1LKZA 1NPKA 4DV0J 3HT3A 1A7GE 4P7VA 2MJNA 2A10A 2VG6A 3K5OA 1TELA 4DV2J 3KLEB 1GQEA 4UTGA 5J2MB 1TK0A 1Z4UA 4NI2B 3OPKA 2D9OA 2BJ7A 1RHQB 4A8OA 3O8WA 3J7A1 1V6HA 1HLWA 2RUSA 1T9VA 1HWJA 4URSA 1TQLA 3Q8VA 3BS9A 2KYZA 4CO0A 2QSWA 4F2RA 1X4CA 1IR2A 1AFIA 2RJZA 3CD6S 3V4IB 4O3SA 4DWIA 4HHHA 1MWZA 1TP7A 2CAJA 3DRPA 2VODA 2JEGA 5IOLA 5D4NA 2MSTA 4QIEA 1L3TA 2AJQA 2GVZB 2CQ1A 2GO9A 4NLOA 6AT1B 2VA2A 4KGVB 3CJ5A 3V5RA 2E44A 2XC9A 1OIAA 3BGOP 1SJQA 1OYDA 1R6VA 1NKCA 1WEYA 3QWUA 3GYXB 4X64F 3FUYA 1R8PA 1U2RA 4MK9A 3CNQP 3EGWB 1ZOTA 2ZM6J 2Q66A 4FNIA 3SQOP 2ZDOA 2XWYA 3T5HA 3CCLS 4U8YA 3WHIA 5IWAJ 3QBCA 3UPFA 2UU9F 1NK5A 3SDEA 1T9YA 1J5OB 3IAM9 2XSJB 2D9PA 2XZTB 1QE1B 3MM8A 1SBRA 4C0BA 4DQSA 2MHNA 2BQRA 1M5SA 4OV6A 4OI1A 1ACMB 3UR0A 3M30B 1TVRA 5DG9A 3QSIA 3I31A 3QJJA 4ECRA 2OELA 4WJBA 4KFBB 3CJ0A 3Q24A 3CVKA 4HH0A 2IVYA 4I7FB 1RBAA 4NLTA 2W24A 3NNAA 5IM0A 2CA9A 2V0NA 2H3EB 2J7WA 3SCLE 5KFWA 1NHUA 3BKUA 5C7PA 3ZTSA 1BY9A 4RUBA 3EDRB 2FY8A 4QQBA 1GFWB 3KHHA 1K9MT 5DLGA 3FSIA 1WACA 5THWA 3QAEA 1C2PA 4HH1A 3ZZ0A 3DXBA 2NPIA 3IMQJ 4QIGA 2DB1A 1WC5A 1RE1B 2RMLA 4M5LA 2WONB 1X5PA 2XMUA 1EARA 1U4BA 5J1EA 3MAQA 2CNOB 2MKHA 3H5UA 3LH2S 1QVGR 2DPJA 3OTBA 1UPMB 2XNRA 4J9NA 4A8WA 4F4XA 4LR8A 2CJ9A 3RAMA 2Y1IA 3PNIA 3D7SB 3QNWB 2RSQA 2YWEA 3MOJB 3LP0A 3M2RA 4Q44A 4NX9A 1TL3B 5HLFB 1N0UA 2DITA 1WC1A 1LW0B 1KTQA 4AUKA 2E1PA 5EWGA 5AE3A 4JI5F 2RDJA 3J7AN 2B4PA 1MROA 2WVCA 1BQNA 4MK8A 3RB6A 2QTWA 3MM7B 4JI3F 3MAHA 3I55S 4NCBA 1UWAA 3LP2A 4O3QA 4DMZA 3I56S 3M2VB 1GXUA 4ZHRB 2GV1A 3I5AA 1S76D 1UVIA 2E9ZA 3R5CA 3D1HA 1IBKJ 3DOMB 4QZVB 2CG8A 2G0IA 2P6TA 1EQMA 4JI8J 4J9PA 3MDFA 2BQUA 1SKWA 3EJMA 5KT4A 2ZNYA 1TZ0A 3KK2B 2M52A 2Q3PA 2VG7B 2MSSA 2AJFE 4KHMA 2B5JB 3TQ1A 1MU2B 4LRFA 4DL4A 4TLQA 4CNYA 5AXLA 4DI6A 2NYHA 2RE1A 1N36F 3UW1A 3KLFB 2BJ9A 2DO4A 4ED0A 5HATA 2WVBA 3CC2S 2FVQA 1UPPA 4OZ1A 4AQYF 3TP2A 2XZWA 4IO9Q 2ALZA 4U7CA 4FS2A 1XR7A 3AAWB 2G0JA 1O8BA 1S7IA 2PGCA 2XI2A 2DGOA 1GX5A 4F4WA 4ERDA 3OHBA 5LSLA 4TN2A 2K7JA 3UDEA 5HP1A 1U47A 3FCVA 2OKQA 5KFAA 4KGXB 4DJBA 2HHVA 1DBDA 3MR3A 2ASDA 4YS2A 2W2OP 3OL7A 1VBXA 3VV2B 3OFEA 3FVYA 1VISA 2KN4A 2E5GA 3QT8A 3P4UB 3EE3A 3KHGA 4I2PB 4IH7A 1RQ0A 2PN6A 5FLXY 2EK1A 4V19X 1S4FA 1NK4A 4OI3A 4YUDA 2HQCA 3R5AA 3LWMA 4F8RA 3UN2A 1LWXA 4C8LA 3D6MB 4WK1A 3H5SA 2VICA 2XYHB 4RW8A 2UU9J 4OHZA 3KLIA 3PKYA 2KG0A 4PYAA 3ADAC 2BANA 1UETA 4E0DA 3ZZRA 4C11A 2XTJP 4Q2MA 5K9FA 1HNIB 2ASYA 4KT0C 2B4OA 5DDOC 3NBPB 3MWBA 2ZZMA 4DSKA 3MM6B 2GIFA 4CT9A 2PFDA 1YLXA 2BOAA 2V6AA 5ETMA 3H8YA 1IQTA 4LF2A 4HT5A 2M8DB 2DPIA 5KT2A 3NMAA 5D4LA 2FJAB 2HNZA 3M32A 3LPYA 4KHPJ 2XY7A 4U8VA 2K3IA 5C24B 1DTQB 1LXNA 4Y2AA 1S1VA 2IC3A 3CCUS 3D5MA 1I51B 2E9RX 1ZYQA 2HVHA 1O0PA 2CJXB 3CDUA 4BHQA 3P96A 1Y10A 3OTEA 3MXHP 3LA0A 4DCPB 1CJTA 4RLEA 1N48A 5EWEA 2E5LJ 3GV5B 2JLEA 2HNYA 3KTQA 4WIQA 4Q7AA 4P71A 2DGUA 3QRRA 4NCGB 1RWNB 1RYRA 3ZXWA 4FN5A 4FF4A 4F3OA 4Z7CA 2GVDA 4DFKA 5KT6A 2DRDA 2YQ3A 2KXFA 2YX7A 5KOXA 1UZDA 4NLWA 3OTOJ 4ED1A 2YPZA 5C2CA 5DDQC 3MAAA 2GGPB 1NJXA 3PTWA 1NM2A 1FCAA 1FDNA 3M7VA 1SVDA 2ZBRA 3SSRA 2DRAA 2C3MA 2JEIA 1NDCA 3OSPA 2WBMA 5KFBA 4PQUB 1UEKA 4M8LA 4JI1F 1F5CA 3HULA 5GADU 1CS4A 2CPIA 4QR1A 4I6WA 4WP3A 2F4VJ 3K5MA 4ALZA 2BKPA 2W01A 2IM3A 1SQEA 1HBOA 2B4VA 2ZD1B 1FKOB 4EMDA 3Q8YA 5KFPA 1WHYA 2B0GA 3H7HB 1RT5A 1TKZB 4ANDA 3MR6A 3HHLB 2A6MA 3HX9A 2FJWA 1N5YB 2WB1D 2FQQB 3FDSA 4EU0A 4RW9B 3DYAA 4BWJA 2GNKA 1QTNB 5M2UA 4IG0B 4JB8B 2DR6A 4B3OB 1FRMA 1C0UA 4G1QB 4LFAF 4DR2J 3OXLA 4UOGA 2M0GB 2CQHA 4DL0C 3AOAA 4IH5A 1T9UA 2JC1A 3GJQB 2E5HA 4RBTA 3DU6A 2OMOA 2V2ZA 4K7QA 5KFSA 4S0MA 2UZAA 5AJ3J 3S01A 4CYUB 5KT5A 1BQXA 1R0AB 3MD3A 4M5IA 3N6NA 3OFHA 3WIUA 3MMAB 1YQHA 4W4MA 2BX6A 3CB4A 2QT7A 4EUVA 4FF2A 3DGVA 2VA3A 2PIIA 1RHRB 4K8RA 2PMZD 3G8TA 5L38A 1ZAXA 2HWTA 5D3GB
chains in the Genus database with same CATH topology
4OFZA 4ZPAA 2G0CA 1FNMA 2RNEA 2XLJA 1XK8A 4B3TF 2VONA 2RQ4A 3SV4A 2OPRB 4LQ9A 2LEPA 2NLWA 2E5LF 2APOA 1O51A 4WU2A 2AP6A 2GX8A 1N6QB 4O4RA 3WZ0A 1U2FA 2PA8D 2J6UA 1AROP 2FDNA 4ID5A 2V8HA 4LUBA 4ZDNA 1HMVA 1S6PA 2ZH8A 1YIJS 3GSDA 5B0GA 1WI8A 4OI6A 3LANA 4C3MA 4OIXA 2PSZA 1OWXA 1VQNS 4DR5F 1ROFA 1RKJA 4CO4A 3BGRB 1FJCA 4LT6A 4B9TA 2YH1A 2M4MA 2CIMA 3IS9B 2UVWA 3KWMA 1QAYA 3TA2A 3M8QA 3MEEB 4B3SF 3QGHA 1N33F 3K8WA 2H5EA 4R25A 2CRLA 1U6FA 2XMTA 2A1BA 2CPEA 3IO1A 4ES1A 4NLXA 5E3AA 5B0FA 2N7YA 4PUOA 3CWJA 3QWPA 1X5OA 3TUZC 1U1OA 3OXGA 4Q0BA 3MEGA 3TI0A 2J7KA 2J76E 2PD1A 3F73A 2FD2A 2P9CA 2A3JA 2KI2A 2DR9A 2RU9A 5GADI 2DGQA 3KHLA 1TV6B 5JVGQ 1N34F 1ZZFA 3FFIA 1FT8A 3DI6A 1VK3A 5KG2A 2YKNB 3WC2A 3CD5A 1VRUB 1U8SA 3DGPA 2BJEA 3KFWX 2YNGA 3OTOF 4MAKA 4ZVGA 4X62F 5KFUA 1S77D 3H59A 3RTVA 2MKSA 4DSJA 1RT5B 2YTCA 3HVWA 4ZPCA 2XY6A 1S1TB 2PEHA 3AJ2A 3LWLA 2KRRA 2QA1A 5KFCA 1C1BA 3K58A 2IA6A 3K2YA 2N4DA 3M05A 3JYTA 3HVAA 1UJ6A 2CJQA 5JVHQ 1TKDA 2CZ4A 4AXIA 1EETB 1REVA 3TR5A 4QW9A 2KTQA 2HHTA 3DFEA 3N9UC 2R2UA 2I5JB 1S1WB 3DU5A 1ZTTA 3MMJA 3KMQA 1JNRB 1FE0A 3KLGB 2W7PA 2RQMA 3BGFA 1QM9A 3MECA 1TVRB 1Y3KA 3GR0A 3MUVP 4EGLA 1RI7A 1YG0A 4NLGA 4EZ9A 4DQIA 2DD8S 3MUMP 1D9AA 4LF9F 2V5HG 5DRKA 1ZETA 1HHTP 2G4BA 1C4AA 1VIOA 2UUTA 4IUFA 1C0UB 1Q7LB 2R7VA 1RT7A 1T05A 5FIIA 1NJIT 5D78A 3GG1A 1SL1A 4ZS6A 4IO1A 4RNFA 2IMOA 1S9GA 4RW7B 1U6ZA 5LJ3Y 4XPCA 3M1VA 5HN0A 4I69A 1VLYA 3RRKA 4A8FA 4PG8A 5F8IA 2NYIA 3QLHB 3D1QA 2F4VF 1TK5A 2DRBA 3UNGC 3FSYA 4NPOA 4I4BA 5MLCV 2IVFB 1DQ9A 4LF6F 4QWBA 5GAEU 4DV7F 3N5BA 4DPOA 2NZ4A 2JZ5A 1HQEA 1OPIA 3Q8PB 4C97A 2M2BA 3KOAA 5C5JA 1VGYA 4A8YA 1JKHA 1S1XA 1F60B 2EKYA 2YX4A 2AGPA 3J7Z5 1UKUA 2IFXA 4CI0B 2HVIA 1FA0A 1RTHB 2BM0A 3TYTA 4HYKA 3DDNA 3FZ2A 3O1LA 5HI7A 4RW4B 2DVIA 5HMYA 4QWEA 3TW0A 2J6TA 5I42B 2Z4PA 1Q86T 1FESA 3V6DA 3RW6A 4BC9A 4LVNP