1S1VB

Crystal structure of l100i mutant hiv-1 reverse transcriptase in complex with tnk-651
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
431
structure length
404
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWGIPHPAGIKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of HIV-1 reverse transcriptases mutated at codons 100, 106 and 108 and mechanisms of resistance to non-nucleoside inhibitors
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Reverse transcriptase
total genus 118
structure length 404
sequence length 431
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s1vB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1vB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1vB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1vB02
4X2BA 2XI3A 2YNHB 4ZPDA 4TN2A 3V4IB 1TKZB 2YKNB 3PR4A 1K1QA 3V6JA 2UVWA 4G3IA 4WE1B 4K4VA 2R8IA 1C0UA 5F8JA 5KG3A 4ZVHA 2FLPA 1REVA 2FJXA 3PW5A 4TY9A 3KLVA 4IOBA 1S0MA 3NMAA 1SV5B 1TL1A 2ZE2A 3C6TB 3DOLA 4ZVGA 4LSNB 3H5YA 2HMIB 3NAHA 4O3NA 5F8HA 2IM3A 3PW2A 2UVUA 4DL7A 1NHVA 2HNYA 1SH2A 4Y2AA 2VG6A 4M94A 2FJWA 2ZKUA 4IH5A 5L9XA 1S49A 4QW8A 5KFDA 1RT2A 1XR5A 4ED6A 3NL0A 3GILA 1HPZA 3CJ4A 1S1VB 3QO9A 3BSOA 3HKWA 5F8LA 4Q0BB 1JIHA 5KFLA 5HBMA 3BGRA 4MH8A 4MIAA 4K50A 4PQUA 1S9EB 2C2DA 4HKQA 5DG9A 3DRRA 3QLHA 2ASJA 2AGPA 2IJFA 4O4RA 3DI6A 1RT6B 4WFXA 5KFOA 4ED1A 2R2UA 4NLUA 3QYYA 5DG7A 3FFIA 5KFRA 3LAMA 2YNIA 1KHVA 1FKPA 3KLIA 3QIPB 1QAIA 4MK9A 1S1UB 4NRUA 1T94A 3LP0B 1VRTB 1VRUA 4XO0A 3DMJA 2IA6A 4R0EA 1GX5A 5J2NA 4WFYA 4MK7A 1TVRA 3JYTA 3UQSA 4RUAA 3OHAA 4NCGB 3Q8QB 3LP2A 1RT7B 1JLAA 1S6QB 1JKHB 2WOMB 1RDRA 1TQLA 1IKYB 1JLBA 5I42A 1XR7A 3BREA 4NZ0A 2AGOA 4G1QB 4F4XA 3T1AA 4RW9A 1FKOB 2OPQA 4YMEA 1JLEB 2J6SA 4URGA 3ISNC 4IG3B 4TYAA 4YR2A 3UPFA 1LWEA 1EETA 1S9FA 3GV7B 4RW8A 1IKXA 4B3OB 3IGVA 1S9GA 3RB0A 5KT3A 2HNZB 5CYQA 3LALA 3GYNA 1JLFB 1R0AB 5JXSA 4DL4A 5EWFA 1YVFA 3H59A 2F8EX 1RTJA 2IMWP 4F4WA 1RTHA 1WNEA 1C1CA 2WB4A 4TY8B 1TV6A 2YNGA 5EUHA 3BSNA 1C1BB 4PUOB 1S1XB 2ALZA 2ASLA 4ECUA 4K4ZA 3TVKA 5C42A 3I0RA 2AX0A 3EPIA 2DPIA 5J2QA 4RUCA 1J5OB 3JSMA 1RTDA 4DL2A 4RNMA 3G6VA 3KLFB 3OL8A 1W25A 2D3ZA 1S97A 2ATLA 5HLFB 5KG4A 2E9TA 4ICLA 1LW0A 2ILZA 5KFYA 4RW4B 3Q8RB 5DQHA 5L1LA 4ECVA 2WONA 3H4DA 1C0TA 1TP7A 4NLWA 1UWBB 4EBEA 2OPSB 3D28A 5KFFA 4FBTA 1JLQB 1LWCA 2WTFA 3GIIA 1N6QB 1RA6A 1IKWB 3BR9A 3PW0A 3DYAB 1DTQA 1DLOA 2RKIA 4IDKB 4URQU 3CJ5A 2W8LA 4RNFA 1QE1A 5EWGA 4K4WA 4Q8FA 4KE5A 1S0OA 1TKTB 2YKMA 5F8IA 4IH7A 4ZHRA 4XPEA 1HQUB 4JUZA 1HNIA 2D3UA 1N5YA 1GX6A 3FQKA 3N6NA 1QUVA 1Z4UA 2IAJA 4ZVEA 2R2RA 3Q8SB 5L1JA 4IR9A 2HNDA 4EYHB 4TXSA 3KHLA 4ID5A 4Y2CA 4QW9A 2FLNA 2VA2A 1MMLA 2IC3B 3MR6A 4ECQA 3FSIA 1S10A 3KNAA 5KFUA 5DQGA 4YP3A 3CO9A 3LP1B 2AU0A 2BQUA 3DLGB 4ZP6A 1HNVB 3DLKA 4H4MA 2B43A 4J9QA 5C25B 5C24A 1S1WB 4RNOA 2XGPA 1SUQA 3OSNA 4IQXA 3DRPA 4DG1A 3RB6A 4RNNA 5T14A 4IR1A 5J2PB 5D3GA 4K4XA 1TL3A 4WYWA 2FVQA 3MEDB 4ED0A 4TQRA 3MECB 4O3OA 4LQ9A 5CYMA 4KBIA 2VG5A 3UDLA 5HROA 1RT1A 1JLGB 4QWAA 2VG7A 1S1TA 4NLDA 2WRMA 3IN5A 4TQSA 4IKAA 3TQ1A 5KFBA 5I3UB 1LWFA 3IS9B 4KKOA 4KV8A 1NHUA 2UVVA 3RBDA 4OL8A 4LQ3A 3E01A 1BQMB 3CJ3A 1RTIA 3DOKB 2W9BB 1RT4A 4IG0A 3I5CA 3BJYA 4RW7A 2XC9A 1HYSA 4KSEB 4H4OB 4MFBB 4ZPCA 2WK4A 2RF2B 3G6XA 1EP4B 4I2QB 2W9CB 4IFYB 1RT3A 3KLGB 4M95A 3H98A 3BQ2A 1MU2A 4EEYA 4KO0B 1KLMB 4NLSA 5KFZA 5F8MA 1BQNB 3NGDA 3DLEA 4O4GA 4KHMA 5KFCA 2J6TA 3KK2B 3CDWA 2YNFA 3MEGB 1TKXB 2AX1A 4I2PB 1HQEA 3I5AA 3KHHA 3M8PA 4I7FA 3KK3A 2JEJA 4NYZA 3MEEB 4KB7A 5J2MB 3M8QB 1LW2A 3IRXB 4R8UA 4DL3A 1FK9A 1S6PA 2D41A 1RT5A 5DLGA 4KFBA 2FVPA 4O44A 5KG1A 2XCPA 2ASDA 2JEGA 2XI2A 3NBPA 3HVAA 4YR0A 5KG7A 1DTTA 5KFEA 1TKZA 3RB3A 3GQCA 2JC0A 4K4YA 3RBEA 1T03B 1C0UB 2V0NA 4EO8A 3KMQA 4RW6B 3M9MB 3I5BA 4IH6A 1REVB 2D7SA 2JEFA 3QGHA 3SFGA 4EYIB 3MR3A 3KHGA 2C2EA 4XPCA 3KJVB 4IRDA 1SV5A 1TL1B 2WHOA 5HP1A 3DOLB 4IRCA 2JEIA 2B5JB 1KHWA 3OLAA 3T5JA 5EWEA 3C6UA 2IJNA 4ZP9A 4O3QA 3MTKA 4FBUA 3NAIA 2VA3A 4DL6A 2AQ4A 4NLPA 2VG6B 2ZD1B 4NLGA 2FVCA 5J1EB 4R5PA 5KFHA 1RT2B 1IKVB 3GIKA 3KK1A 3TAMA 2WCXA 4ZPBA 5KFNA 2I5JB 1HPZB 3D5MA 5KFXA 4Q43A 1S1VA 3FDSA 3MR2A 2BANB 3DRSA 3KLEA 5HBMB 3EZUA 3BGRB 1HARA 4ZP8A 4YQWA 3BSCA 1RYRA 4PQUB 2BE2B 3KOAA 2GIQA 5KT5A 5K14B 5KFWA 3V81A 4F50A 3E51A 3ICLA 2JC1A 3QLHB 4PWDB 2W8KA 4O3PA 3DI6B 5FDLA 3OLBA 3KLHA 3VQSA 3V6DA 3IG1B 3T5LA 3RAQA 1C2PA 3CJ0A 1FKPB 3HVTB 2B6AB 3Q8PB 1VRTA 4Q8EA 1VRUB 5DLFA 1SH3A 3DMJB 2V4QA 3DM2A 4Q45A 4DEZA 4GC6A 3OSPA 5F9LA 1TVRB 2UUTA 4NCGA 3LP2B 3I0SA 1JLAB 2WOMA 1JKHA 3N6LA 3EPGA 3H5XA 1IKYA 1JLBB 5I42B 3DDKA 1S0NA 1HMVA 4WZQA 3QGGA 5KFGA 4F4ZA 2OPRA 1JLCA 5KG6A 4RW9B 4LSLB 4DL5A 4IFVB 3HVWA 3PW4A 1JLEA 3OHBA 4ECWA 2OPPB 1T05A 1LWEB 5KG5A 3PHEA 1IM4A 1JX4A 2FVRA 4HYKA 4RW8B 3ITHA 4TLRA 4TYBA 2YNHA 3IGNA 4Q44A 3PZPA 3V4IA 3BQ1A 4J9MA 2HNZA 2BQRA 4URSA 2YKNA 1JLFA 4WE1A 4J9KA 4NLXA 1RTHB 5KFPA 1C1CB 2UVRA 4TY8A 1C1BA 2CJQA 4PUOA 2HWIA 3MFIA 3SI8A 2GC8A 2AGQA 4EBCA 3I0RB 5KFMA 5DG8A 2ZE2B 3C6TA 5JUMA 3OL7A 4ED8A 2FVSA 1J5OA 4LSNA 3GV5B 2HMIA 3KLFA 4J9RA 4ED2A 2HNYB 5HLFA 4ZMMA 5KT6A 4RW4A 2RDJA 3T5KA 2IM2A 3HHKA 2FLLA 2OH2A 4K4TA 4WXWA 1UWBA 3QO9B 3G6YA 4J9PA 4QWCA 4Q0BA 2E9ZA 2QE5A 2C2RA 3FRZA 3V6KA 2HAIA 5KG0A 1JLQA 4K4UA 1N56A 4ECSA 1S9EA 1N6QA 2IM0A 1IKWA 4O3SA 1DTQB 2RKIB 4MK8A 3DRRB 4WXOA 1RT6A 1S48A 2YKMB 3FFIB 4ZHRB 2XGQA 2R2TA 2YNIB 1ZTWA 3KLIB 3QIPA 2IBKA 1N5YB 1S1UA 2JLEA 4ZVFA 3LP0A 2R2SA 3LAKA 2CKWA 2J6UA 5KFTA 5J2NB 2BRKA 3JYTB 5DGAA 3T19A 1RT7A 1S6QA 3QZ8A 3LP1A 3CWJA 1I6JA 1OS5A 4Y3CA 4WFZA 4G1QA 1HNVA 4H4MB 3M9OB 3NKYA 5L1IA 1FKOA 2OPQB 5C24B 3MF5A 4IG3A 3H40A 2R8JA 1U09A 1EETB 2XCAA 3M9NB 1S4FA 2I1RA 4ZP7A 1IKXB 4B3OA 1S9GB 3RAXA 2O5DA 5KT4A 5CYQB 3MECA 1R0AA 1RTJB 5HROB 1RT1B 3T5HA 5EDWA 3KHRA 1TV6B 3CJ2A 2YNGB 4ED3A 2EC0A 1S1XA 2BR0A 5KFQA 4K4SA 1LWFB 4KKOB 5C42B 5J2QB 3E01B 3JSMB 1RTDB 4EBDA 5L1KA 4NLTA 4NLQA 4GC7A 4ECRA 2W9BA 1RT4B 4ICLB 2IM1A 1LW0B 3SFUA 2W7OA 4RW7B 4H4OA 2WONB 2RF2A 2GIRA 1EP4A 4I2QA 2W9CA 4ED7A 4IFYA 1C0TB 3KLGA 4WYLA 4NLRA 1MU2B 1RAJA 3PW7A 5KG2A 1D0EA 3G86A 4NRTA 2E9RX 1RA7A 2RDIA 2OPSA 4ECTA 4QPXA 3QIDA 1LWCB 4FS2A 2YNFB 3H2LA 1SH0A 3DYAA 3BQ0A 1DLOB 4IDKA 4J9OA 4I2PA 2QV6A 3UR0A 3KK3B 5C5JA 4EO6A 1QE1B 4J9NA 5J2MA 1LW2B 1TKTA 3LANA 1K1SA 2BQ3A 1S6PB 1HQUA 5F8NA 1HNIB 2IAJB 4NLVA 4RNHA 1JXLA 2HNDB 2V9WA 4ID5B 3NBPB 4ECZA 4ECYA 2IC3A 1DTTB 4QWBA 2FJVA 3H5SA 2V4RA 3GIMA 1T03A 1CSJA 3FQLA 5F8GA 3QZ7A 3DLGA 4JV0A 4RW6A 3DLKB 3GIJA 3CDUA 5C25A 4MKBA 1S1WA 3OL9A 1SUQB 5KFJA 3H5UA 1XR6A 3KJVA 3DRPB 4DG1B 4RZRA 5HP1B 3CVKA 3CIZA 2B5JA 5DQIA 1RYSA 5J2PA 3C6UB 5D3GB 3KMSA 1N48A 1TL3B 1D1UA 1T3NA 3MEDA 3H4BA 4YR3A 5CYMB 2VG5B 2ZD1A 1JLGA 5J1EA 2HWHA 4H54A 4MKAA 4R5PB 2VG7B 2BRLA 1S1TB 1IKVA 2UUWA 3KK1B 4MIBA 3TAMB 4U7CA 1ZTTA 3CDEA 2I5JA 4IRKA 5I3UA 3BSAA 3IS9A 4KV8B 4KHRA 1ZETA 5KFSA 2R8GA 2BANA 3DRSB 3KLEB 2ILYA 5KFIA 4F4YA 1BQMA 4NLYA 5DGBA 2BE2A 3QGIA 4RU9A 5KFKA 2C28A 4QWEA 5K14A 1RTIB 3DOKA 5KT7A 3V81B 4IG0B 4PWDA 2W7PA 3PVXA 1HYSB 5FDLB 5KT2A 3KLHB 4MFBA 3V6DB 2DPJA 5F9NA 3IG1A 4ECXA 2R8KA 1RT3B 3MFHA 3V6HA 5KFAA 4J9LA 4ZPAA 4KO0A 4J9SA 3HVTA 1KLMA 2B6AA 2R8HA 1BQNA 4FS1A 4U6PA 3MR5A 3DLEB 3GV8B 4O4GB 2W9AA 2AWZA 3DM2B 2C22A 4O3RA 3KK2A 4JV1A 4Y34A 3ISND 3MEGA 1TKXA 3PJXA 5KFVA 4NLOA 3RB4A 1HQEB 3I0SB 3M8PB 4I7FB 2XWYA 1NNDA 3MEEA 1QAJA 4QWDA 1HMVB 3M8QA 3IRXA 2OPRB 4KAIA 1JLCB 4R8UB 1FK9B 4LSLA 4IFVA 4WZMA 4JV2A 3PJWA 1RT5B 3PR5B 2OPPA 1T05B 4KFBB 4O44B 1N4LA 3N6MA 3OL6A 3ITHB
chains in the Genus database with same CATH superfamily
1SQGA 3LPYA 5LOQA 2YNHB 4ZPDA 1NPPA 3I6PA 2ZNYA 3IAS9 1TKZB 5IQ6A 3IBCB 3E3XA 3QFHA 4G3IA 4K4VA 4DI6A 1ICEB 3NRBA 3QSIA 1D8ZA 4K5SA 4ZVHA 4L75A 2IVYA 3TJAA 4C7QA 2FLPA 2FJXA 2J5AA 2ZH2A 4NA3A 2FC8A 3BKFA 2MQNA 4ANCA 1S0MA 2XNRA 3NMAA 4TU8A 4UOHA 5ETRA 4ZVGA 3CCSS 1Z2LA 4UOFA 4D3GA 1FDNA 1BUXA 4NE9C 4EFAC 3H8YA 2XULA 1PJ6A 2JOQA 3NAHA 4O3NA 4DZDA 3I82A 1Q8LA 1NHVA 3KJQB 4Y2AA 4M63A 2LKZA 3IC1A 2C2ZB 2YWFA 3M05A 2WZ1A 3OT9A 5T7LA 5L9XA 5ITHA 4DR1F 2WW8A 1XMOJ 2HRYA 1T8EA 4ED6A 2CQ3A 3GILA 1S1VB 1R89A 2ZBPA 3CCVS 1UJ5A 2LQ8A 3W7BA 8ATCB 4CT8A 2C2MB 2KDOA 2QA4S 1NXIA 2M7SA 1KQFB 4BC9A 3GR1A 4H4KC 4K59A 3MCOA 2IRXA 2A6OA 1WF1A 3JTOA 1TK8A 1RAAB 3OPKA 4DSIA 5DG7A 3MCMA 2CPZA 3FFIA 2XM3A 3LAMA 2YNIA 2FQQB 5IC4B 1S1UB 2BJEA 2X51A 1OQ6A 3M1VB 1VRTB 4DCOB 2IYGA 1HIYA 2IA6A 1BXNA 4UT4A 2U2FA 1GX5A 4WWSA 4WFYA 3C19A 5JVGQ 2AYMA 3NWGA 3HFKA 2XSJB 4L76A 5CAAA 3LH2S 4NCGB 3Q8QB 2LDIA 1RT7B 1S6QB 2WOMB 1R8AA 1TQLA 1XR7A 3CC4S 1JLBA 5I42A 1HHQA 4TU9A 5HVFA 2M8HA 3D54A 4OHXA 5AT1B 4F4XA 2MQOA 1FKOB 1JLEB 2J6SA 1ZPVA 2DEIA 2BJ7A 4CYUB 4YR2A 3EX7B 2PFDA 1EETA 2E1RA 1TK5A 3CF5Q 4DV7J 1FKAF 1KRPA 1TZ0A 3BKTA 3IGVA 1GH8A 2HNZB 1PYSB 4UUXA 4HACA 4J9KA 1B64A 1R0AB 5JXSA 4DL4A 1SQEA 2IJRA 2R42A 2VJUA 1VQNS 5LSRA 1YBUA 2ROEA 1M5KC 1RTHA 4OX9J 2DK2A 3ET6B 1TV6A 2HFUA 2YNGA 2YWKA 3CCRS 2NXCA 1S1XB 2YTCA 3LF0A 2F8MA 3AA9A 2ALZA 4K4ZA 2AX0A 4RBUA 4WP3A 3EPIA 4A8SA 2IBOA 5J2QA 3FGVA 4F3QA 4NMXA 4RNMA 2E1MC 3BO4A 1NKEA 3KG0A 3MM5A 3M8RA 1M5VC 2N3LA 2V63A 1S97A 4N8NA 3AB2B 3HD2A 5HLFB 1E6YB 3Q24A 2DH7A 1SB6A 3ZXWA 2G0CA 4RW4B 1Q5VA 2BE9B 1PO6A 1CJKB 1XC9A 2WONA 2RSQA 1LXNA 1VISA 4EI2A 1TP7A 1RABB 3OUYB 3T1YF 1UWBB 1FEHA 3CJKB 4EBEA 2V50A 3BB5A 3OXLA 1PJ5A 4OZ0A 2WTFA 2E7WA 1H3DA 3W9HA 3PW0A 3W9IA 1Y3JA 1YG0A 2ZZMA 2NCKL 2I2YA 3K0JA 3OTCA 1W2IA 2W2QP 4RNFA 4USMA 1H2UX 1U1MA 4YB6A 4Q8FA 4V19J 1QTNB 4KE5A 2CWXA 1S0OA 3SDEA 2HZAA 5IXUA 5J1PA 3TWZA 1HQUB 1T02A 1Y5LB 2MQMA 2D3UA 2YQ0A 4KGZB 2ZNZA 4J91A 4G1IA 4WFBQ 3W2WB 1D3WA 1Z4UA 2IAJA 1WC3A 3Q8SB 3DDIA 3GPAA 1V3SA 2BUNA 1L3VA 4TXSA 2FLNA 4Y2CA 3HSDA 2CADA 2KT2A 4DR4F 3UN2A 3PRDA 4ECQA 1X4HA 4F4KA 3PDNA 5D0RA 2FHJD 3UW1A 1V3RA 2WSCC 1XMBA 2CQPA 1P9QC 5DO2A 4DV6F 2O3DA 1SIWB 1UW9A 1HNVB 3DLKA 2HQGA 3G4SS 2I38A 3UD4P 2EFQA 5C25B 1C4AA 2CPDA 5C24A 3AJ2A 4LR8A 2DXEA 3FBCA 1SUQA 3W63A 4JI2J 4ILRA 1XMOF 1WHXA 2CZ4A 1U02A 4UY85 2G13A 2EKYA 3MCNA 4RNNA 4ZVSB 3IXQA 2VOPA 2KFZA 5D3GA 1FRXA 3PG9A 4BHQA 4WYWA 2AJQA 1GK8A 2X3DA 1FJ7A 4X4RA 2M4MA 5A8KB 5CYMA 3BS9A 4KBIA 2PI5A 4KRWA 3UDLA 4B3TJ 1JLGB 1GT8A 4BC7A 2KHCA 4U96A 1Y00A 2BJ9A 2MQQA 3EGVA 2HHPA 4TQSA 4DF4A 3TQ1A 3GSIA 4KKOA 1RAEB 2V2ZA 4OL8A 2RRAA 3E01A 2LQJA 2VBZA 5LXYA 3A4TA 1U6BA 3EGWB 1RTIA 3DOKB 3K89A 1QVFR 1RT4A 3FRYA 2OKQA 2BW2A 5DZ7A 2J7WA 3L95X 4UOGA 2NXNA 2DNRA 4MFBB 1SL1A 2RF2B 1FWKA 1EP4B 2ZWOA 3MPWA 4ZLNA 1IQZA 2IDEA 4EEYA 1N36F 1NO8A 1MU2A 2A6MA 2FPHX 1HI0P 2GAGC 4JI1J 2HK2A 1R31A 3QAEA 5F8MA 1BQNB 3NGDA 1Z1ZA 4O4GA 1TL7B 3JSRA 4KHMA 2M9KA 5KFCA 3PIOQ 1MWQA 2KT3A 4KR0B 3NEKA 4UQTA 4WU3A 1YJNS 1UVJA 1TKXB 2AX1A 4LIRA 1X31C 4ZCLA 4DV4J 3KHHA 3K5MA 1XNRF 1G7CB 5A8WA 1S76D 1T7PA 1KQGB 2NR0A 4R8UA 2QRRA 1FK9A 5LMUJ 4WJBA 2K1RB 1AUDA 1XNQJ 4X62J 1U8WA 1RT5A 1P9YA 1TELA 2IVFB 3G9CA 1FFSB 4KHPJ 2FVPA 2XCPA 3HPOA 5H9EK 3R2CJ 2XI2A 1TKDA 1QD1A 2XMAA 2MZQA 2V2KA 3KJNB 5KG7A 2A2CA 5KFEA 1HR0F 4RBVA 4RLEA 3GQCA 2JC0A 5L9NA 2MLZA 2RU9A 4YS2A 1XJWB 1U4BA 2IRUA 2VPYB 3J81Y 4RW6B 4DQQA 3AOAA 3M9MB 3F41A 1YKWA 2AEMA 1HBNB 2G2YA 4EYIB 3JXOA 3KHGA 4F0HA 1TL1B 3AA8A 5HP1A 1X4CA 2J76E 1IBLJ 3B8HA 1HR0J 1WC1A 5EWEA 3C6UA 4ZP9A 2HVEA 2VC1A 2HFNA 4CLFA 1WD6A 4M5GA 1KEKA 5CD4H 2UUCJ 4DQPA 2R7XA 2HFSA 2AQ4A 4NI2B 1WEZA 3R8YA 4E2FB 3CUNA 4RBTA 1DURA 2VPWB 4D3HA 6FDRA 1U0SA 3MCSA 1QSYA 3MD3A 4QBUA 2UUBF 1MWZA 1IR1A 3TAMA 2WCXA 2G0IA 2MPUA 3D5MA 4ZPBA 2GAHC 2JVOA 4IOCQ 1DFDA 3JTNA 3LUYA 1DHMA 4FN5A 3TX8A 3DRSA 2CQ1A 4DBQA 5HBMB 2IHR1 3MR2A 2V4RA 2QEXS 3KOAA 3BSCA 4GRSA 4LRDA 2BE2B 1DBDA 1FTCA 1Q8IA 5KFWA 2DNQA 4F50A 3LA0A 5LT5A 1HHSA 3QLHB 4ES3A 2W8KA 5CCLA 2EXUA 4PG5A 3VQSA 3V6DA 3CCQS 1FKPB 1RBOB 2AHOB 4PG6A 1NK7A 2NLWA 1HWLA 1I1GA 1PIEA 2DBBA 1FWPA 3DFEA 4LRBA 3Q8PB 1X4FA 4ZLLA 1VRUB 1X4GA 1SH3A 3DMJB 1WSRA 3D0GE 1NH7A 4RUBA 1AZSA 2WBRA 1R8PA 2W2NP 5I3PA 4DEZA 3OTOF 4ITSA 2XYGB 3HSZA 2UUTA 3I32A 3ZFVA 1O0PA 1WDTA 5F8LA 1NJXA 3PO5A 3LP2B 3UVJA 1JLAB 2NS1B 3EPGA 3H5XA 1IKYA 2RQMA 3AFGA 1HLWA 4GO7X 4PWWA 1X9MA 2G2OA 1S0NA 4WZQA 1WACA 3IM9A 2DR8A 2L08A 5KG6A 4RW9B 2ZM6J 4OFZA 3OR1A 2R7UA 5IM0B 1T11A 3MMJA 4FF3A 3I9V9 2FVRA 3ULHA 4HYKA 4RW8B 4TLRA 3RU0A 1UW4A 2CNNB 3UDVA 3VAKA 2YNHA 4WP9A 5HMZA 4Q44A 3BQ1A 4DN0A 4J9MA 1PYTA 2VL1A 2D1CA 3MM9B 1N0VC 4KY3A 1PCAA 4URSA 5JJBA 9ATCB 2UXBF 4KT0C 4CQ1A 4NLXA 5GMDA 3TUJC 3DGPA 4QOTA 2F8HA 2F9DA 3G96A 1C1CB 4TY8A 1A9NB 3HSJA 4LT6A 2CJQA 2XHCA 2HWIA 3MFIA 2H4YB 2NSCA 2EBGA 1V5VA 4EBCA 2AGQA 4NCAA 3I0RB 4ED8A 4DV2J 5HAOA 4UF4A 2FVSA 3U02A 3C46A 3A8EA 4K2XA 4MTPA 4WPAA 2VIHA 4J9RA 3CD0A 1FESA 1CVJA 2ZC4A 2BJ3A 4ED5A 2P9CA 2B9YA 4LFCF 4WKRA 4FVCA 1Y9OA 1HW9A 2RRNA 3VVUA 5T7LB 4FP9A 1YBAA 4QIGA 4CLLA 3DXSX 4USIA 3A12A 2NUUG 3T3FA 4K4TA 2B9WA 2HHSA 4WXWA 1MLAA 3G6YA 1NSPA 3ZO7A 3WDOA 1NRKA 2CJBA 2C2RA 1UA1A 1D9DA 4I64A 1V3ZA 1JLQA 5KG0A 2QFIA 4K4UA 4CO5A 4ECSA 2I8EA 1N6QA 5LXRA 1IKWA 5ETTA 4A47A 1DTQB 2RKIB 2QYCA 3B54A 4H4KA 2JLFA 1RU2A 1QAYA 3PYFA 2VFUA 1TMMA 3TOQA 5GMEA 2KH9A 1TL5A 1YJ7A 1NSQA 2AJ1A 3GJQB 1SJ3P 3BV8A 3FFIB 4ZHRB 2R7SA 2YNIB 1ZTWA 3AD7C 1PGZA 2IBKA 1S1UA 4AUKA 4CLWA 2R9LA 3M1VA 5HSPA 3DGVA 4JI3F 1P1LA 4QYRA 2R2SA 3OW2R 4I67A 3LAKA 1PAEX 1UETA 4LVNP 3NCQA 3QRQA 3Q2SC 5DGAA 3F0NA 3T19A 3O44A 4WK3A 1WOOA 4DFJA 3GFHA 1L3SA 1RT7A 1S6QA 4OX8A 1SKRA 3CWJA 1OS5A 4WFZA 4LF8F 5A0YB 3M6VA 1Q95G 4X66J 3NNHA 1FKOA 1SVDA 3G6ES 1U2RA 2C3UA 4X4UA 1VMBA 2G9OA 1EETB 3M9NB 2Y8WA 3RR8A 5ETKA 1S4FA 2I1RA 4P75A 4WTYA 3CCWA 2WBMA 4KGKA 4A8XA 3D6MB 3RAXA 1S72S 2B8PA 5J1NA 3LWMA 1KOOA 3BZQA 1Y0HA 3MECA 1R0AA 3TJ8A 3RGIA 4NXMJ 4CDIA 2NUHA 1HD0A 3NS5A 5EDWA 3OVAA 1TV6B 1KDNA 2YNGB 2BW7A 5I3QA 5SZTA 3WX8A 1S1XA 2BR0A 1RHQB 3B4MA 3G87A 1LWFB 4DR6F 2KTQA 4N7TA 4YY3J 2E5HA 5J2QB 5DZ6A 2DNMA 1N88A 1ZAWA 2AV5A 3GYGA 3CEDA 2W9BA 2GVDA 1E6YA 2HRUA 3RYLA 1FJGJ 1Q78A 1CJKA 4H4OA 2WONB 4PXEA 4I2QA 1LKZA 2HLUA 4PABA 3KLGA 3SMZA 3BBFA 2GFFA 3PW7A 2F1FA 1D0EA 1IR2A 1H73A 2DNZA 3EXCX 3JQMA 4NRTA 4DLEA 4ECTA 2VOOA 4PRFA 2CNLB 2ZM6F 3Q0AA 3DLBA 3W8GA 2L48A 1Q16B 2LLZA 4HH1A 4FS2A 4MIWA 2YNFB 3WZ0A 1HW8A 3NCPA 4J9OA 1VK8A 3W8PA 5C5JA 3POTA 2BJDA 4OI1A 2ZOFA 2COLA 2VQFJ 5J2MA 1LK5A 4LFBF 4ZVOB 3DKDA 2QL9B 3EVOA 4FXVA 4LRAA 3CCMS 1HQUA 3AY0A 3Q83A 4FXDA 1H6KX 1WG5A 3QPIA 3ENAA 2IAJB 4U9RA 4ZVPB 5IQQA 1NKCA 1UVLA 2R7QA 5IV4A 2V9WA 1U0HB 4PZVA 1LK7A 2DY1A 2QLXA 3UN3A 5HVHA 3R5JB 3GJRB 2FJVA 2UU9J 1NK0A 4CTAB 4AD6A 2ZHBA 2F65A 2JWNA 5AE1A 1CSJA 1GNKA 2GJ2A 4W4MA 3LTOA 3FBEA 3DLKB 3GIJA 4UY8T 2FB0A 3CDUA 5C25A 2VBXA 1UJ6A 3OL9A 3VGUA 3ZZOA 1SUQB 4P7TA 5KOWA 5KFJA 3H5UA 3BH6B 3KKFA 3O5TB 4RZRA 1IBCB 4KGMA 2B5JA 1FD2A 2GCFA 5DQIA 3G8SA 1VQYA 1YWXA 5D3GB 1P8GA 2HS3A 3FKBA 2W4PA 1D1UA 1T3NA 3GFYA 3G8TA 1KQKA 1M1GA 3H4BA 5D4LA 1YQHA 5CYMB 3HT3A 3P6YC 2HHWA 2ZD1A 1IM6A 3I4HX 1U1LA 1JLGA 5J1EA 3O6QA 2CPFA 4HL9A 4R5PB 4Z7CA 4F4YA 1NJZA 4YEAA 4UOCA 1ZTTA 3CDEA 2V8PA 2R8GA 1M5OC 4PPDA 4PXDA 3J7YI 2DITA 1FVQA 1BQXA 3VAMA 1FD8A 3AXMA 3QGIA 1XIQA 2UUAF 3IA0A 4K5RA 1H72C 1RTIB 3DOKA 1Y5IB 2G2ZA 1RWVB 3B82A 3R5DA 4LF2A 7AT1B 5EHHA 4C0HA 4KIAA 4ES2A 4F04B 2Y1JA 4PWDA 3MDFA 2W01A 1IXKA 2FGOA 5FDLB 2ACMA 4MFBA 2DPJA 1OPZA 5F9NA 4ECXA 4HT7A 1VRQC 4M5KA 1AYEA 4WIQA 4B08A 4DUZJ 4J9LA 4DV3F 1BQNA 2FHMA 4O4GB 2BKPA 1OY6A 3CJRA 4G6VB 4OX7A 3THPA 4F36A 3DM2B 5C2CA 3R1HA 2C22A 3C3LA 2Q66A 1ZM9A 1TKXA 2MTLA 2MZSA 4HTIA 5HQMA 1OJ4A 3J7AN 3I0SB 5GADI 2QLJB 2XWYA 5A8WB 5IS2A 3LGNA 4FKXA 3D6TB 4Q2LA 4QWDA 2IA0A 4ER8A 4R8UB 4B3SJ 1FK9B 2Q43A 4DS5A 1NB2A 3PJWA 1HWKA 4DR4J 1RT5B 3PR5B 3MUMP 1YITS 3S1TA 3K17A 3N6MA 2HYIB 3CD7A 2MKCA 2X7IA 4DQIA 3HULA 3L09A 4HHUA 2NPIA 3V4IB 2GS8A 3GJSB 2ZH7A 2MGZB 4LIWA 4DFMA 3CDAA 1N0UA 4OYMA 1LNQA 1WHVA 2R8IA 3QWPA 1APSA 2YH0A 3AT1B 2AZ3A 2HVDA 1PC5A 1Q7YT 2XYPB 2ZH1A 4OHWA 4TY9A 4V1Ak 2C2OB 1U1KA 1JJCB 1KLNA 3PKMA 3H20A 2X1AA 3IR6B 5M2PA 1HI1A 4KGXB 3OFEA 1TL1A 2RDDA 4Q5VA 2FY8A 2ZH9A 3MUVP 3TO8A 3JAMY 1NJWA 2Q6BA 1NMEB 3CSKA 3BDPA 2RU3A 1UP1A 4EZ9A 4LSNB 1YGYA 3QNWB 2K7KA 2HMIB 3J81j 1ZZNA 3PW2A 3I96A 2HHQA 1CJVA 4DL7A 1SH2A 2KXHA 3WQPA 4M94A 3MUTP 4IH5A 5D4PA 1VIXA 1S49A 1T95A 1UPMB 1XR5A 2Z2MA 2BM0A 1UWAA 3FEXB 5DDPC 3L7UA 4PXCA 3F73A 2HGNA 3BSOA 3HKWA 4OZ2A 3DLJA 5KFLA 4DPOA 5HBMA 4MH8A 4MIAA 4K50A 1SC1B 2HSEB 3R6GB 4DS4A 4TU7A 4USWA 1S9EB 1VK3A 1M5SA 2YY3A 4ATNA 4DV3J 1K9MT 2C2NA 1UVNA 2RILA 3IR5B 3QLHA 4C48A 2AGPA 2ACYA 1KVIA 2B4PA 2FHKA 4WTOB 3MAAA 1DQ8A 3MM6B 1ULRA 2WSEC 4FF4A 4OMFG 1FKPA 1YSJA 3EE3A 1VRUA 3DMJA 2KG1A 2HBZB 3SQGB 1QSLA 4LBHA 2E5LJ 1E6VA 1WC4A 3PYEA 4K8RA 2VKRA 3OHAA 2B7BB 3LP2A 2E7XA 1JLAA 5KG1A 3RUBL 1RDRA 3UVJB 4NXNJ 1IKYB 3SYZA 1YJVA 1QM9A 3CMQA 4W98A 3K58A 3T1YJ 2FY1A 1T3OA 4LF5F 3T1AA 4RW9A 2YWGA 1J27A 2BOAA 4YMEA 2XLJA 2FJBB 5ETOA 4URGA 4WCEQ 3ISNC 1VFJA 2XMUA 4TYAA 4UW2A 4A8WA 4YOEA 3F56A 5IM0A 1SL2A 1S9FA 1GMVA 4OYWA 5MAOA 3HLUA 1UVMA 4RW8A 4WFNQ 5K9FA 1LOUA 3H7HB 2B8QA 4TVAB 2C2KB 2CPJA 3GYNA 3MM9A 1G6BA 2M2BA 1VR6A 2DB1A 1YVFA 2F8EX 3DGPB 3SSRA 4F4WA 1C1CA 2WB4A 3LW5C 3CD5A 1WDDA 4TY8B 1U49A 1IBLF 2R7RA 3UNYA 1ZPWX 2HW3A 5C42A 3I0RA 2DPIA 4C97A 4RUCA 5C7PA 4C8NA 3JSMA 5B09A 2UXCJ 4DL2A 4NZ6A 3EDRB 4DF8A 1U2FA 5KG4A 3THTA 2EEYA 4ECVA 5EX3A 3OV7A 5DQHA 2MKKA 5L1LA 2DNOA 2YKOA 3CNQP 3KG1A 2H5EA 1RCOB 4E8UA 1W2BR 2VICA 4AL5A 3NMRA 1ZM4A 3W9JA 4DPTA 5A2QY 2OPSB 1HBOA 3MPDA 4X4TA 4WP8A 5IT4A 4AQYJ 1JLQB 1LWCA 2W4CA 3GIIA 4C4WA 1N6QB 1MROB 1IKWB 2BJ8A 2XMTA 3DYAB 1DTQA 2RKIA 4IDKB 3BR9A 3D7SB 1RAIB 5D77A 1I5OB 2W8LA 1U48A 1QE1A 5EWGA 2KU7A 1S59A 3TZYA 2XS2A 1FE0A 2M70A 4ZHRA 2Z2YB 3J7YU 1WF0A 1K0TA 1N34F 3TARA 4MYUA 1I94J 2OHDA 4IR9A 4GO5X 2HNDA 2GMHA 2UXDF 4C0BA 2QMWA 2EFPA 3DNCA 1BD6A 4YN3B 1Y7PA 2IC3B 2J0XA 4UZCA 5AXMA 1JNRB 2LDYA 5KFUA 2W4DA 3CO9A 4DPXA 2AU0A 2EKNA 2BQUA 2A2DA 1L3UA 3DLGB 5HL7Q 4ZP6A 2CQGA 5A0YA 1B99A 1QUPA 3CXCR 5BJRA 4RNOA 2XGPA 2XLKA 2V2QA 2G1DA 4B9SA 4DG1A 1TR0A 4ZOSA 1Y3KA 3TYTA 2ZH4A 3Q22A 1OIAA 1RGVA 4YB7A 4NA2A 4YB5A 3TP2A 1TL3A 1X5SA 1N33F 2XZWA 4PR6A 5DS7A 4ED0A 3MECB 3HHLB 5HK4A 4OI0A 4LQ9A 2ATCB 1DAXA 2UV8G 4XDDA 1H7XA 4CLPA 3KYLA 4QWAA 3ELHA 1FFWB 2VG7A 3RZAA 2YKAA 1O5JA 1RWMB 3R5CA 2PGCA 5A8RB 5KFBA 3AJDA 1U47A 1LWFA 3IS9B 1VJWA 2V69A 1KTVA 1WC6A 4YDXA 3SQOP 2UVVA 4B9TA 4OYAA 4LF9F 4LQ3A 4DV0J 2AYEA 4P71A 4EGLA 1FO1A 3CJ3A 4WFAQ 2W9BB 4CLZA 2GVDB 3I5CA 1CS4A 2WVDA 1BWVA 3BJYA 4RL1A 2XC9A 3MXHP 1HYSA 4H4OB 4ZPCA 2KVIA 4I2QB 3A3OB 3KLGB 1RT3A 1W7WA 1XEZA 2K3KA 1V5IB 2F40A 2XMKA 4QZVB 1KLMB 2MQ8A 2A18A 2LA6A 3QQCD 4AE5A 2HG4A 4DR3J 1Q86T 1HQ2A 4CLYA 1R8CA 1T9UA 3KK2B 1F9HA 3CDWA 2YNFA 3EVMA 3MEGB 4BLGA 1EQMA 2BACA 4ZN1A 4I7FA 3POTB 1O51A 2BVZA 3MEEB 4USHA 5J2MB 3R3TA 4JI3J 5B7WA 2NQPA 1IJFB 2CG8A 1A0OB 2K3IA 3GZ7A 3M30A 2ABYA 2Y1LB 3MR7A 4CIOA 4ANDA 5ETVA 2D41A 4AL6A 2ZZNA 1SC3B 2BEFA 3K57A 4KFBA 2DNHA 2JEGA 1RLCL 3GIRA 3PJ9A 3MURP 5BXIA 2RH3A 3HVAA 1U0HA 5E3CA 3WBZA 2HVIA 3CB4A 5B0GA 1F5AA 2ZVIA 4CTAA 5C2GA 3S7RA 4P6QA 1URNA 3FSXA 1FWLA 1U1QA 4X4NA 2X1BA 2DGSA 4PXBA 3EZ5A 1NJYA 2Y9HA 2UZAA 3I5BA 3WIVA 2W2MP 2Z57B 2E5IA 2XO6A 2D7SA 4M5JA 4ILMA 1SI9A 1YTYA 5IOLA 3SFGA 1MWYA 2M52A 2C2EA 4ZJLA 4XPCA 1U24A 4IRDA 1KNZA 1SV5A 1RWWB 4CO3A 2I9SA 2JEIA 2B5JB 1KHWA 2YPZA 3OLAA 4DV1F 2OTLS 4TNOA 3W66A 4X4OA 2VB6A 4DL6A 2YWWA 4P2XA 3EWGA 4NLPA 4K0KF 2VG6B 3AB4B 2ZD1B 4M1KA 2I0XA 4BCAA 3NGSA 2FVCA 5J1EB 2DRDA 3L7PA 1F5CA 4R5PA 2CDRB 3VVTA 1RT2B 5KFNA 3Q8UA 4OZ3A 3N79A 2L9NA 3BDEA 4OI2A 3IM8A 5CZXA 1M1KT 2CUYA 4L6V3 5CA5A 4NPOA 4RJVA 4CNZA 4F67A 1RYRA 5IT9U 1RI7A 2GHPA 2UXBJ 1KR4A 2IYIA 4FNIA 1QVGR 1M0SA 1Q4RA 1FDAA 3A3PB 4Y6IA 1FNMA 5DETA 4PG4A 3MGJA 3ICLA 3SXLA 4A8YA 4PWDB 1ROFA 2H5IB 3OLBA 5FDLA 2MLXA 2XBPA 2VPZB 3RAQA 1R8HA 2Y3YA 2Q79A 1C2PA 3TA2A 3EDQB 2HRTA 3KNGA 5F0WA 2VJVA 1EARA 4Q8EA 2M88A 3SZ2A 3CTRA 4I1TA 2V4QA 3DM2A 2ZBRA 3BYPA 2CQCA 1XQIA 2HGMA 4C8ZA 4CLUA 2PA8D 3I0SA 1YZ6A 1UL3A 1JKHA 4LF8J 3QGPA 4B17A 4LF4J 2C3MA 5KFGA 2K2PA 2K8GA 3H2UB 3OVBA 1D09B 1RHRB 2ZH6A 3PW4A 1YRXA 1T9YA 2V5HG 4PG7A 5G0RB 1MSWD 3ZTSA 5HO4A 4ECWA 1VHFA 2J9CA 1LWEB 4F7VA 5KG5A 1VC6A 1IWGA 5LL6d 3LGHA 5EX0A 3OTBA 5KAKA 4TYBA 5D0HA 2ZBQA 3MEKA 4JI4J 3V4IA 3KWMA 2MGZA 1XTZA 2OGUA 3HHNB 1JLFA 2CRLA 1VQSA 2N4CA 3CIMA 2CPYA 2DGQA 2V34A 3OFGA 1NDLA 4K7QA 2QLFB 6FD1A 1YX2A 3MI7X 3UDEA 3G82A 4X65F 1C1BA 2QX0A 4PUOA 2HLTA 4Y2MA 2HPUA 1UVIA 2K7JA 4O23A 2VASA 4GVLA 5DG8A 5JUMA 3OL7A 2WAQD 1WEXA 2C3PA 2B4VA 2V68A 2VV5A 4ZS6A 4ZJQA 4LSNA 5FD1A 2HMIA 2XNQA 3GSDA 1CJVB 1EX8A 1NM2A 4QIFA 1WHYA 1VHIA 2VU5A 1VIOA 3EMTA 4RPFA 4ZMMA 1EIYB 5KT6A 1GTEA 2NZCA 3T5KA 1ZZFA 2IM2A 4Y65A 3HHKA 4OHYA 3DXBA 2MKSA 4ZITA 2DTJA 5DM7Q 1QY7A 4P2SA 3VZHA 3FCWA 4QWCA 1GXUA 3G2XA 2IY5B 2QE5A 3D3CJ 3FRZA 2DR9A 2F5GA 2HAIA 2ZWPA 4BWJA 3GCXP 2AEFA 3W5ZA 1S9EA 3DOMA 2QIFA 1VYAA 4KPCA 4LR9A 3D6HB 4HH0A 4O3SA 1GFWB 4JB8B 3HHEA 2ZBCA 4EMDA 2WVFA 5CQGA 2OSQA 3IFEA 1OWXA 2MKIA 1RE1B 4IO9Q 4M5LA 1KVJA 2MQLA 1JK9B 3MAAB 2YKMB 3MM6A 3Q89A 3N5BA 4YY3F 2P2CB 3T6BA 2DHAA 4F2SA 2JLEA 1PG5B 3B6BA 4ZVFA 4C9DA 5IC6B 2W25A 1JB0C 2KVQE 3PTWA 4FVMA 4IQMA 2BKOA 2CKWA 2FHJA 3CCUS 3SQGA 2J6UA 4C3LA 5KFTA 3U27A 4IUFA 3OVSA 4LFAF 1E6VB 5HMXA 1WKJA 1B3TA 3ENWA 2PEBA 5CHCB 4DSKA 1KN6A 2G0JA 1S99A 4CLSA 3LP1A 2H3EB 4X4QA 3LWLA 4U7UD 2QA4G 3D0IE 1Y5NB 5E41A 1GMWD 2ZITA 4H4MB 4PPZA 4RWXA 2HQDA 2L9DA 3NKYA 3ZTOA 2AMCB 3KDNA 5DRKA 4YHHF 1RWKB 2E44A 3HMJG 3QFWA 2HQFA 3ZNUA 5CH7B 1U09A 3H40A 2XCAA 1IBKJ 3NWRA 2UP1A 2R8JA 1HD1A 1JNZB 4ZP7A 4M5IA 3EYZA 2OI2A 1OO0B 3SIPB 4L72B 3OJSA 4B3MJ 1S4EA 2LP4A 5K20B 2LEBA 3HDSA 1FRJA 3BGLA 4F4AA 3IBFB 2EVZA 2PA3A 4UZBA 4OZLA 1F3VA 3M8WA 3HJVA 1RT1B 4QR2A 1RHMB 5ETMA 3HJFA 2NSBA 3BGFA 3CJ2A 3WIUA 4DCPB 4ED3A 1EAYC 3CJSA 3NP5A 2DR7A 1B4SA 2JJ4D 2JSXA 4K4SA 5C42B 4DX5A 3CGIA 1FRLA 3UN5A 3JSMB 2OEJA 2HHHJ 1NCLA 3QJLA 4ECRA 4J7CA 3AXKA 3G71S 3TVZA 1B0PA 1OSDA 4U8YA 4NEZA 4ZVRB 2DJWA 3SFUA 4DSFA 2JVRA 1RTZA 3MPYA 1GEHA 2W9CA 4LF4F 4ZDNA 3WX4A 3VGTA 2B4OA 3G86A 2OFGX 2E9RX 4B9VA 2RDIA 2OPSA 1HBOB 2HBQB 3NGRA 3Q8VA 3VZIA 3JQKA 4QPXA 1LWCB 2ZBIA 4LFCJ 2CJYB 3P3DA 1MROA 3DYAA 1RSCA 4IDKA 2EW9A 2HS0A 4I2PA 3N5FA 4LVOP 4J9NA 3KK3B 1QE1B 3VQTA 2JDJA 4ZCKA 1CBKA 2YKPA 1UZHA 2BM1A 1K1SA 3MMBB 1S6PB 2F63A 2RS8A 4OYZA 5JMNA 3H2VE 3TZXA 3ENQA 5ETNA 1VQPS 2BABA 2M3DA 1NB7A 2E29A 3PCOB 4RNHA 2XG8A 2HNDB 1WI6A 3QATA 3D6FB 5U47A 4ECYA 1RHUB 2IC3A 4C3MA 1TFWA 1RHJB 1X4BA 4LMZA 3R5BA 1TAQA 3H5SA 4LSZB 2F4VJ 2XY6A 3NNCA 4PCQA 2BA9A 4DUZF 1T03A 5F8GA 3W62A 1VQMS 1RKJA 3DLGA 3LQVA 4ZCIA 4LRCA 1CG2A 2DGWA 1IBMF 2RB7A 1RZMA 2Z0GA 1Q8KA 1XR6A 3UCUP 2GMJA 4DR2J 3KJVA 1EJ7L 4A8FA 4DG1B 1K44A 2QO3A 4AFFA 4JYAJ 1IJEB 2Z30B 3NS6A 1SBRA 1N48A 1TL3B 4DJBA 4OYXA 1VBXA 4B3SF 2YWHA 3HHLA 1F60B 3BBBA 1KFDA 3OFFA 1RWOB 4MKAA 2HWHA 1RBAA 1S7HA 1HBUB 2VG7B 2BRLA 2UUWA 1IKVA 4MIBA 3KK1B 2CVIA 5DJBA 4U7CA 5A8RA 2QC3A 3IS9A 3FUYA 1F9FA 4KHRA 3BO3A 1ZETA 4CO2A 2BANA 3KLEB 2ILYA 1SQFA 1YRTA 2EFGA 3PNIA 5DGBA 3Q8YA 3QT6A 4QWEA 2LECA 3QAUA 3T9NA 2GNKA 4OJ1A 4P74A 5KT7A 3T1HF 1HWIA 1CS4B 2KXNB 2P8IA 5FLXU 1U45A 3A8IA 1HYSB 4FXWA 3CCJS 1KS2A 5AJ3J 3D1QA 1FNXH 1TFYA 3PRVA 2QGFB 2VODA 1RT3B 1NLKL 3MFHA 3D1HA 5KFAA 3V6HA 4MJKA 1HHTP 2HFZA 3HVTA 1KLMA 1WSVA 2OMLA 3QT5A 4OYPA 2R8HA 4U6PA 3MR5A 3CCTA 2FTRA 2NYIA 3GV8B 2KJVA 2W9AA 3BO2A 5EN1A 1WKKA 2M0GB 2XQCA 4O3RA 3KK2A 1AT1B 4OX6A 2D74B 4XIUA 1OSCA 3MEGA 1NPKA 4ENOA 4NLOA 3RB4A 2ZKTA 3EM1A 4IO1A 4I7FB 1FFGB 2LVWA 3P4UB 3C16A 3MEEA 5HANA 2V8VA 2XTJP 1AFIA 1L3KA 2OPRB 4DUYJ 1JLCB 3M30B 4LSLA 1WG1A 2MY8A 4JV2A 3TA0A 3PFEA 4ZPVR 1T05B 1RHKB 3P45B 4KFBB 4HT5A 5GAEI 3GB0A 3EICA 3CO0P 1FA0A 3THVA 3ITHB 5L8RC 3Q23A 1WTBA 1OPIA 2XI3A 3CULA 3PM9A 2G1HA 3MOZA 4J9UE 4O0NA 2PIIA 2LFVA 3PR4A 2W1BA 2LXIA 4DLGA 4WE1B 3UD5A 2GHVC 1U1PA 3K5NA 3RTVA 4ZIVA 5F8JA 5KG3A 2RNEA 2CQ0A 5CCMA 2V8GA 3AOBA 1D9AA 1DJ0A 1UJ4A 3C15B 3PW5A 3KLVA 2M5YA 2FJAB 2VPXB 4DSEA 2KHDA 1SV5B 3C6TB 2OLWA 2HFVA 3SSQA 5E0OA 4X65J 2L9WA 3KG4A 3SEOA 2B7CB 1FJGF 5H9FK 1EQ0A 5F8HA 2IM3A 2B3TB 3GG1A 3HVRA 2ZOMA 2HNYA 2D9PA 2VG6A 3AODA 2ZKUA 2XMMA 4DV4F 1UEVA 4MKYA 2ZDPA 2YXLA 1RT2A 2KKHA 2PSZA 5BYSA 2MXYA 2R4FA 3MZIA 2HQIA 3M6XA 2LQ5A 4ERDA 4EUVA 3HT0A 3M7VA 3BKUA 1FX4A 1JIHA 1XN9A 2WVBA 3LPEA 3O3LA 4NOHA 3RAMA 4CZCA 1YHQS 3K8WA 1FXDA 2R7WA 1JQGA 3BH7B 2W7AA 3TZWA 2C2DA 4C8YA 2VFVA 2BMBA 5DG9A 2YQ3A 4EWTA 2P6SA 4QU6A 2IJFA 4O4RA 4WFXA 1RT6B 5KFOA 4ED1A 2R2UA 1Q0NA 5KFRA 2LXUA 1KHVA 1VI7A 3TAQA 1QAIA 3QIPB 3BGOP 4MK9A 3ILOA 5BYQA 1NJIT 2AYBA 4NRUA 1T94A 1VS3A 1Q53A 3TNVA 3KDOA 4XO0A 3HF5A 4L3NA 2UU9F 1TMJA 1UFLA 1H98A 4MK7A 3JYTA 2CFXA 5DDRC 4DR2F 3UDCA 1AA1B 1TUVA 1JKHB 1IUJA 2AGOA 2CQBA 1G4CA 1RAGB 2DGUA 1WC0A 1BWEA 4M5HA 5I4MA 2Z4PA 3GWCA 3FNNA 4ED4A 2OPQA 1CULA 2YH1A 3RW7A 2QMUB 3LGMA 5G0RA 4ZLPA 3J80U 2BOPA 5E2QA 1LWEA 5GAHU 1KC8T 4C11B 3GV7B 4DR5J 4B3OB 4F2RA 3K5PA 5GMKa 1LFPA 3RB0A 1NDKA 5KT3A 2OUGA 3LALA 2CZ9A 1JLFB 4JI6F 3W1YC 1N5QA 2FC9A 3OD2A 5L46A 5EWFA 2QFJA 1RTJA 1VLYA 1ZAVA 2HFOA 3ZZRA 2IMWP 1U1RA 3PO4A 2MZTA 2ADCA 4N76A 2Y1RI 1VBYA 1WNEA 2R7TA 3G82B 3BSNA 1C1BB 2HWTA 4PUOB 2QLWA 2KI2A 3BPDA 4ECUA 1Y4ZB 4B9LA 1LQ9A 2W24A 3MPVA 3R7SB 5LJ5Y 3UNGC 1I3OB 2LXFA 3RRKA 4P7VA 1R6YA 2H4WB 2CNKB 1W25A 2D3ZA 2MJNA 3QBCA 2C3OA 2VD3A 2CIMA 2KYZA 3PHTA 1ZM2A 4M5MA 5GAEU 4ICLA 4RUHA 2ILZA 5KFYA 2ATLA 1K8AT 4BS2A 4JI7J 1X0PA 5D4OA 2CDQA 3NY0A 4DR3F 1YDLA 4B3RF 4EZ6A 2DT9A 4NLWA 3ZZTA 1RU1A 4FNHA 3TRGA 2PFFB 4CO0A 5HMYA 1RWXB 3D28A 3GE9A 1CQNA 4LF7F 2V94A 9RUBA 3DOMB 2MZ1A 2AT1B 2Y8YA 1WELA 1GAOA 4URQU 3HO1A 1NUEA 3LO3A 1XK8A 3KUHA 4W92B 3AD9C 4MYTA 3MAQA 4K4WA 5T41A 1TKTB 2YKMA 5F8IA 1B70B 4PAAA 1JJHA 1HNIA 3D1OA 1GX6A 3HCXA 3PYDA 1OMSA 1QAXA 1WORA 3FQKA 3N6NA 5D4NA 3VR1A 3AHPA 5L1JA 2GQCA 2JX2A 1BHNA 1GXLA 3L7OA 1F1BB 3I87A 3KHLA 2VA2A 4KTQA 4QW9A 1KQSR 4DFKA 1F2GA 3MR6A 3FBBA 1S10A 2KZZA 3PKYA 3IWLA 2EG2A 3LP1B 3OXFA 2ZHAA 4RWWA 4H4MA 3J81U 3C8YA 1N52B 2B43A 3ETMA 5AXKA 1KBRA 4J9QA 1VDHA 1X8DA 2PMZD 3W64A 3WC0A 3OSNA 4KC5A 1AW0A 4ZVQB 4BBYA 2GVZA 3VAGA 3DRPA 5CXTA 4IQXA 1NSAA 3M2UB 2KB2A 2KM8B 2DNGA 5T14A 5J2PB 2F3JA 4K4XA 3CPWR 1RACB 2FVQA 4QIVA 1SKSA 2ALYB 2RQCA 4ZPWR 3BBCA 1T9XA 3OQ2A 4CH0S 2DO0A 3NGKA 2VH7A 3HM9A 5LMNJ 1SL0A 1RT1A 4JV5J 2ZJQQ 1S1TA 4NLDA 3IN5A 1BLUA 2XY5A 1L3TA 3CJTA 4IKAA 3Q86A 5CYJA 2H54B 4P72A 5I3UB 2RS2A 4KV8A 1NHUA 3CT9A 2V9KA 3RBDA 3TANA 2A10A 2AP6A 2DO4A 3GONA 2DNNA 2GO8A 1F6TA 3I55S 4DV6J 3TUPA 4QJVA 4X4PA 2B56A 4B9NA 4IG0A 2RQ4A 1WWHA 3FCVA 3M8ZA 4CNYA 4DSLA 4OYIA 2YWEA 3EGNA 1A6LA 4KSEB 1SCJB 3G6XA 3N0VA 2BX6A 4ZVTB 5IT0A 2W9CB 4M95A 3H98A 3IBWA 5A2QU 1ZYQA 4KO0B 5K8NA 4X66F 5KFZA 2PMWA 2Z2LA 2QSWA 4R25A 1U25A 2KRRA 2XMVA 1KOHA 2FGCA 3BR8A 3FZ2A 3HI9A 4OLPA 4QPTA 5B0DA 2J6TA 3QJPA 3R27A 4PEOA 4DX8H 4I2PB 3I5AA 4LF5J 3KK3A 4RKUC 1VQ5S 4NYZA 4KB7A 4Y0FA 2L3MA 1ZS6A 2WB1D 3IMQJ 5LSOA 4M8LA 5ETQA 5M2UA 2Y0SD 3FMBA 3VALA 3JQJA 2QZ8A 1S6PA 3MMBA 3R5GA 1KKHA 2JRSA 1VOMA 5LMUF 4O44A 1CC7A 3BPSP 4P2MA 4ELVA 1KTQA 4YR0A 2GHWA 1FCAA 2CJXB 3IO1A 2EC2A 3RB3A 2D3O1 3ENVA 1KWMA 2XWXA 3RBEA 2JFDA 2KL8A 1T03B 4JI1F 4FDFA 1C0UB 2V0NA 4EO8A 2HHHF 1S5ZA 1VBKA 4WKYA 4IH6A 3FZBA 1FT8A 1REVB 1AB8A 2Z58B 3K8VA 2AW0A 1N34J 2EWHA 3QGHA 3TZZA 1K0VA 3TW0A 5DDQC 2VUGA 3MR3A 3KJVB 1VQ9S 2RT3A 3HFZB 2NREA 1FVSA 3DOLB 1D8YA 4W90B 3T5JA 1S6OA 3I56S 4K2JA 2IJNA 4FBUA 3MTKA 3DU6A 2MEWA 1GQEA 1VBZA 2ZZTA 3ZZZA 2LEPA 2VA3A 2DXDA 4LF7J 2GMLA 3UE2A 4ES1A 1BC6A 4E98A 1RQ0A 4NLGA 1F0XA 2QN6B 2VFSA 3FCHA 1IN0A 1HBUA 1SJ1A 2CPXA 2MDAA 1IKVB 2I6WA 3KK1A 1YJTA 2BKNA 5KFHA 1JJ2R 2AKWB 1HPZB 3A8KA 3FBFA 4GVBB 2DNLA 3FDSA 2BANB 2XZTB 3KLEA 2CVEA 3EZUA 3BGRB 1UPPA 3MM8B 4ZP8A 4YQWA 4PQUB 4NZ7A 2FYXA 1RISA 4DHVA 2MY7A 4WF9Q 3GFXA 4R0JA 2XO7A 1V6HA 2JC1A 3L9ZA 3CMES 1FNOA 3DI6B 2DHSA 1P1TA 1SC4B 2N3OA 4BWMA 3DC2A 2DH9A 2HQ3A 4CH1A 1PYOB 3HVTB 1ITPA 2EFNA 4Y00A 3Q2TC 5DLFA 5AXNA 4AL7A 4OYBA 5HATA 3DRYA 5KOXA 2KXFA 4Q45A 4GC6A 1TVRB 1EZZB 1U7LA 4DV2F 4DZ6A 1VQ4S 2VBWA 4C2MA 5HVGA 3N6LA 2V8DA 4U8VA 1EB0A 4NWBA 3A13A 3C16B 2OJ3A 3VF0B 3E2EA 3DHWC 1CJTA 2YPYA 4GMKA 3N28A 1M5HA 1WTFA 2OPRA 1JLCA 2HVZA 2QYGA 3N01A 4LSLB 1SIZA 2HIQA 3VHQA 2ZUGA 5LMNF 1H2TZ 3OTDA 3OBIA 5HQLA 3RBZA 5GAGI 1HA1A 1T05A 2ZH8A 3PHEA 4Y2KA 1JX4A 3C14B 3FMWA 3NG8A 4A48A 5CABA 1HNXJ 3ITHA 3BYRA 3X1LB 2LU2A 4TLQA 3IGNA 5E3PA 5E33A 3RG6A 2QMXA 1ZA1B 2D9OA 2LEAA 3M2VB 4CRJA 2E5LF 2WVEA 4WE1A 3QJJA 3GJTB 1NSKL 2QL5B 1XWLA 3PACA 2V67A 2FIUA 3MAHA 4I6WA 1BMQB 2PE8A 4J90A 5E5NA 3VGVA 2UVRA 3ILLA 5MLCV 2DNYA 3C15A 2PN6A 3DDNA 4Y2IA 2FD2A 3NS7B 3SI8A 3VTIA 1KD1T 1H0HB 3KUGA 3C6TA 1RJJA 3LOUA 3V4MA 2DNPA 1J5OA 4X4SA 3HZEA 3K7RA 2E66A 3R5AA 1XERA 2JZ5A 2N4DA 3KLFA 3D3BJ 1FJCA 3V2UC 4ETZA 4ED2A 1S57A 2H48B 3P8BB 2HNYB 4YHHJ 1N8RT 5D15A 2YQ1A 2KJWA 2RDJA 2CJAA 2OIHA 1VC5A 1Q5YA 3QT8A 1NK5A 2FLLA 2OH2A 2JHEA 1R3NA 2OO4A 2YVSA 3UD3P 2HAFA 1HI8A 2AJ0A 4J9PA 4DCJB 1UAWA 1KFSA 3T41A 3D0HE 1RP5A 1PAUB 1FHTA 1N56A 4QYZJ 1FE4A 2RUSA 1HNZJ 2V8HA 5H1SV 4MK8A 3D4JA 3G8QA 3H0PA 4LUBA 4N47A 3MOJB 2IDLA 1QLNA 4CLKA 2ZJRQ 1KONA 1RT6A 2LMIA 4X64J 1NK9A 4CT9A 4C98A 6AT1B 1FDBA 1HKAA 5CD4A 1N54B 2M8DB 4NXMF 1DRZA 3QIPA 1FI4A 1N5YB 4BDPA 3K5OA 2ZOGA 3M2RA 4CM0A 1HBMB 4ZPTR 1HL6A 1X5PA 2DR6A 4N41A 2NZ4A 2LA4A 3U7JA 2MSSA 3MD1A 3JYTB 2VQEF 2GQQA 1G1XA 1D9FA 2DGVA 4DL0C 2KFYA 1FEEA 2DHXA 2AJ4A 1N36J 3T1HJ 2L41A 3PX6A 2OEKA 2HBRB 2QSFA 2BQ3A 2OPQB 1CULB 2FDNA 2OMOA 1G3OA 2ROGA 1SKWA 1YLXA 5F41A 1JMTA 4C11A 5THWA 4DFPA 4DR7F 4B3OA 5GADU 2AD9A 1NK6A 2GX8A 2GGPA 1RLDA 2O5DA 3TVYA 3RRHA 3C66A 1NK4A 4B3TF 1N32J 1BGXT 2YX1A 4XDCA 2QTWA 2C42A 4ELUA 1RTJB 5HROB 3AJ1A 3V5RA 1AROP 2CG4A 3T5HA 3RW6A 4CM2A 1ZOTA 2EC0A 2HQCA 1L5UA 2VDIA 1OQ3A 1N5TA 3GTYX 4JV5F 2NYHA 4PQAA 3U1MA 4EBDA 2KN4A 4F02A 5L1KA 4NLTA 2ZVSA 4NLQA 4GC7A 2RE1A 3GLJA 4AXIA 2QLBB 1NU4A 2BXJA 8RUCA 2J7KA 3AD8C 1NK8A 4ICLB 2AIRB 4CH7A 1F5BA 2W7OA 4RW7B 2IFXA 2ZHOA 3JSYA 1TU0B 3A3NB 2N7CA 2F9JA 1B7YB 4AT1B 3ZZPA 4IFYA 4WYLA 4N8OA 4NLRA 4USVA 2P9EA 5KG2A 2JLGA 1AXQA 3QIDA 3KJFB 1U6FA 3VAFA 2QG9B 2XS5A 1YJWS 3GR0A 3H2LA 3CCES 4DV0F 1SH0A 1IQTA 3BQ0A 1IR0A 1WOPA 2QA1A 1PBAA 1W26A 2QV6A 1AUSL 3SBMA 2B9EA 4KPYA 2O01C 3MMCA 5RUBA 1NBEB 3S6EA 1LW2B 1TKTA 1F2HA 3BM7A 5F8NA 1HNIB 3X3UA 2EG1A 4DUTA 1PBUA 3SCLE 2BDPA 3HK2A 2E9TA 2ZEJA 1JXLA 3GFZA 4A4JA 1KSPA 2DGTA 1SPBP 3NBPB 3CC2S 1VQ7S 2HHUA 2MKYA 2Q6CA 1DTTB 2KG0A 5GAGU 4CCHA 5F3ZA 5A6PA 3GIMA 2KO1A 3FQLA 5H9EJ 4FZVA 4QIEA 4JV0A 1RAFB 3K59A 3AQPA 2PI4A 3H42A 1WC5A 1BE4A 4F0KA 3D66A 7FD1A 4ALZA 2ERRA 2VONA 4HI2A 3QSYB 2GVZB 3DRPB 2OD6A 4NYOA 5E3QA 1OYDA 3M2UA 1Y10A 3CIZA 5EGYA 1RYSA 2H1YA 5J2PA 3KMSA 2ASYA 3ZTQA 4C3KA 2UUBJ 3TA1A 3HX9A 3J7Z5 4DUYF 3KFWX 4YR3A 2J0WA 1FRKA 3CCZA 4DU8A 2WW4A 3U1NA 2QT7A 4H54A 4QR0A 1WKLA 4UTGA 4QCLA 1S1TB 2DIVA 2OSRA 4I6AA 4KH1B 2I5JA 4DU7A 2XHWA 5I3UA 3BSAA 4KV8B 2PT0A 4ZLJA 4OX9F 5KFSA 2KZMA 3CD6S 1Q81T 4NX9A 3TX0A 1FRIA 3NGTA 4RU9A 5KFKA 1UCNA 4O0IA 4I4BA 4DXLA 5K14A 4QU7A 3V81B 4IG0B 2CQ2A 2H65B 2WVCA 4DR5F 1CJUA 3HHLD 2BV3A 3PVXA 1B0VA 2HVHA 5KT2A 3KLHB 3HFVA 2YBVA 3IG1A 4Z37A 4X62F 2DKOB 2DR5A 4KO0A 4J9SA 4N77A 4ZA1A 2B6AA 1RADB 4HLBA 4IYQA 1ZM3A 1FX2A 2DY9A 3D68A 1OYEA 5GVQA 2CJ9A 3TEHB 4B9UA 4DDFA 4RX6A 1VLOA 2AWZA 1UA0A 4JV1A 4Y34A 4DX7A 2MKJA 3VAJA 4A8KA 3I31A 2ZJPQ 5K8MA 1QAJA 5AE3A 5D78A 2PDAA 1HMVB 3PX4A 1RBLA 2CAJA 4Y28C 2FHOB 4KAIA 1J5EJ 2KT5A 4LF6J 3E8OA 4IFVA 4WZMA 1VJQA 2VFTA 3AOCA 1Q8BA 1U6ZA 2FZCB 2OPPA 2GW8A 3S01A 5IZHA 4DQRA 5IT9Y 4O44B 1UMJA 3K2YA 5D0EA 5K8PA 3OL6A 2J9DE 4HHHA 4X2BA 4LF9J 4TN2A 2A1BA 2MHEA 3PV8A 4OIXA 2YKNB 4DOZA 1K1QA 2XZDB 3V6JA 2UVWA 4B02A 1JWWA 3ZTRA 1C0UA 1PSDA 4WU2A 3CW2C 2LQBA 1IVZA 2YX7A 1REVA 5IWAJ 2O1PA 2X1FA 3SCIE 2VC0A 3IR7B 2NXEA 2J9DA 2ZUAA 4IOBA 4KQZA 4JI8F 4C8LA 3HXMA 2ZE2A 4MT1A 3DOLA 1Q1KA 2R3VA 4OHZA 5DM6Q 5HMWA 4JBCA 3H5YA 3MTJA 4KYZA 4N5SA 2UVUA 3GP9A 1HWUA 2MZRA 3SSSA 3W60A 4DN9A 1IBMJ 2FJWA 1X5TA 2GZOA 3NXZA 4NASA 3SCKE 5IWAF 4QW8A 5ETPA 5KFDA 1DY3A 4U67Q 1NH8A 2BYCA 4HDGA 3NL0A 4DV5J 1U1NA 2Y1IA 1YBTA 1HPZA 3CJ4A 3DCAA 4GVBA 4GKJJ 3IWNC 3QO9A 1NPRA 4Q0BB 2VDHA 3OR2B 3SV3A 3BGRA 4TKTA 3MM8A 4FYYB 4PQUA 4ELTA 3IRWP 1FF2A 3IAM9 2EFVA 1GTHA 3CDBA 4KH0B 4HKQA 3D2WA 3DRRA 1FJEB 5AE2A 3O8WA 2ASJA 4GKKF 3DI6A 4NLUA 3QYYA 1TAUA 3DLHA 1X9SA 3KLIA 1U26A 2RHQB 2N7YA 2GA7A 1YZ7A 2N82B 3LP0B 1SJRA 2P5VA 3GYXB 3P96A 2F4VF 1RWUA 4R0EA 5J2NA 1VQLS 1TVRA 1UKUA 4G1PA 3UQSA 1GMWA 4HTJA 4RUAA 1JJ4A 4NL5A 4ZKAA 4NXNF 2DD8S 5K5MA 4I69A 1X5OA 3BREA 5KFMA 2XMWA 4HVZA 4C8OA 3ETOA 3L4BC 4B3RJ 4NZ0A 1CJTB 4OI6A 4G1QB 4K0KJ 3TJ9A 4OV1A 2MKHA 2GO9A 4USKA 3FSYA 4OJ3A 3AH6A 4OZJA 4IG3B 2E1PA 4CWBA 5HN0A 1QSSA 4OI3A 3ILJA 1Q79A 3UPFA 1PKUA 2XMJA 1J5EF 2PC6A 3C14A 3B4DA 1IKXA 4JI5F 2CQ4A 1S9GA 3HD1A 5CYQA 3HHLC 3M2VA 1O8BA 5BYRA 1RUSA 2B51A 3NLCA 3H59A 4Q7AA 4LFBJ 2E1AA 5G4DA 1LFWA 4X84A 3UFCX 5B0CA 3CC7S 5EUHA 4FKYA 2ASLA 4CLTA 1X4EA 3TVKA 2FZKB 3GMGA 4RO0A 2C28A 1UZDA 1J5OB 1RTDA 2LU1A 2W2PP 4DWIA 3UI3A 3R2DJ 3G6VA 3KLFB 2QL7B 1SKUB 3W65A 5F0UA 1OY8A 3OL8A 2ZH3A 4DQSA 2APOA 3EUNA 1XBWA 2VQEJ 3R97A 1LW0A 3Q8RB 4OZ1A 3W2VA 3RBXA 2F4FA 2U1AA 1S0VA 3UCZP 3H4DA 1C0TA 4ID8A 4ZCMA 2CPEA 1XNQF 1X7VA 2DIUA 1MN7A 1FXRA 3R6LB 5KFFA 4FBTA 4OZNA 1RA6A 3M32A 4C8KA 2CZVC 2VBYA 1DLOA 3NOCA 3PEJA 3FK4A 4XK8C 3CJ5A 5M2RA 4CO1A 4JI4F 1TK0A 1XMQF 3T9ZA 4Q2MA 3ZTPA 4LRFA 4ILLA 2HURA 2MB0B 4IH7A 3BEGB 3H90A 4XPEA 3RRGA 4JUZA 1N5YA 1M90T 1R0CB 2MYFA 3M2RB 1HBMA 1QUVA 4ZVEA 2R2RA 1YRUA 3W61A 1WG4A 3HHDA 4EYHB 2XS7A 4ID5A 1Y11A 4M5DB 4A46A 4N56A 1I94F 3EGZA 1MMLA 1X0FA 3KNAA 3AAWB 3FSIA 2UXDJ 3TAPA 5DQGA 4A8MP 2H9ZA 4Z7YA 5AXLA 4YP3A 4OHVA 5SUHA 3KXDA 4P9SA 3NOGA 3QT7A 3VWSA 4PWUA 1R6VA 2DGOA 2EBEA 2NPFA 3TUZC 1ZBTA 2HBYB 1S1WB 2DVIA 1RCXB 3PY8A 7FDRA 2V6AA 4LF6F 1KP6A 2HHXA 3DLLQ 1AFJA 5F3TA 1H74A 5CZVA 3RB6A 4NCBA 1RWNB 4IR1A 3MM7B 2GGPB 2BJ1A 3QMQA 3P49B 1REGX 3MEDB 1R43A 2MSTA 3FC9A 4TQRA 3HP6A 1M5PC 4O3OA 2RHSB 3NCRA 1UEUA 1N33J 2VG5A 2AEJA 1TTHB 5HROA 2DEJA 2XEXA 1NEEA 2J7UA 2HIYA 1CC8A 4USUA 2VHGA 2WRMA 1R27B 2R7OA 5LJ3Y 2C3YA 4LF1A 4JI0F 2DYAA 1MMNA 3GCWP 2UUAJ 3M4XA 2X3GA 2VF3A 2V4JA 2VZ9A 4DPUA 1BQMB 4AXJA 5K8OA 2IIHA 4U95A 2D3OR 1P27B 1S79A 1SJFA 3TQEA 3OTOJ 1EKRA 3L3CA 4A8OA 4ANEA 2XLIA 4S0MA 4CO4A 4J5OA 4RW7A 4B9MA 3DN9A 3MMAB 1R0BG 2WK4A 4JI0J 1NDCA 4IFYB 3DRXA 3US5A 3BQ2A 2ADBA 4NLSA 4DV5F 3WC2A 1RB0A 4L73A 3DLEA 1URRA 2F7VA 3FJ2A 4U7UK 5LM7E 4GKJF 3M8YA 2OELA 1R8BA 4IRKA 4USTA 3OJUA 1WJ9A 2JH3A 1T9WA 3HZGA 2E7VA 1HQEA 2YKQA 3M8PA 3F44A 3N9UC 4CI0B 1WHWA 2JEJA 3NNAA 3MMCB 4KJIA 4P73A 4PG8A 3M8QB 1LW2A 3IRXB 3TEGA 1HWJA 2E5JA 5KTQA 1MMDA 4DL3A 4J37A 1K47A 2GV1A 4NA1A 1N5VA 1X60A 5DLGA 2B9XA 3A1YG 1VQOS 3BN7A 2CQIA 1ZAXA 2ASDA 1LV5A 3M8SA 1ZH5A 3N4WA 3NBPA 3JAMU 1GXTA 1UEKA 3UO0A 4L74A 1CLFA 4PKDB 1DTTA 2EK1A 1TKZA 1LWXA 2RRBA 3VV2B 5B0EA 4K4YA 2EPIA 1VQ8S 3KMQA 4NEYA 1RK8A 2NXJA 2JEFA 2MZJA 1FRHA 1SJQA 5E7OB 5FJ4A 4YFUA 2WHOA 3HSGA 3ILIA 4FF2A 4IRCA 1NAQA 3TR5A 5HJYA 3CMAS 5DDOC 4O3QA 3QRRA 1MG7A 5HJXA 3NAIA 4DSJA 4DMZA 4XAKA 2O67A 5ETLA 1Q7LB 2RD5C 2R7VA 1XNRJ 3ZZUA 1B0TA 4FF1A 3CJQA 2RMLA 3GIKA 5ADZA 4Q43A 1X4AA 1YIJS 1XMQJ 2I5JB 3R7BB 5KFXA 1HNXF 5ETSA 2CPHA 1S1VA 1PC4A 4QR1A 2J0QD 2H5JB 4M5NA 4DPYA 4B3MF 1HARA 2DGXA 3ONQA 1HNZF 2RQKA 2DCUB 1UFKA 2VFRA 3O2IA 3MPUB 2GIQA 4Z2XA 1VC0A 5KT5A 4DR6J 5K14B 1RAHB 2A0FB 2HZCA 3V81A 1MW7A 1UFWA 3E51A 4JP8A 1VCTA 4MAKA 1QTMA 2E5GA 2G4BA 2HHTA 1CJUB 1ELOA 2P6TA 4LBIA 4WK1A 2DCLA 4O3PA 1N32F 3KLHA 3PYGA 2KYXA 1F9EB 2OTJS 3IG1B 3T5LA 4RU2A 2OD4A 3CJ0A 1U8SA 2X1GA 2VKZG 1WUUA 2B6AB 3D9BA 3R9LA 2BZ2A 4YB1P 1VRTA 1WOSA 2OEMA 1JXEA 4HEA9 2EK6A 5B08A 3OSPA 5F9LA 4P10A 2XSJA 4MMOA 1U1OA 2J9EA 4F3MA 4NCGA 1S6UA 2HEKA 4F26A 2WOMA 4FYVB 1DQAA 2YX4A 2HZVA 1JLBB 5I42B 2ZDOA 2FUG9 3B78A 1HMVA 2LYVA 3DDKA 3QGGA 2Z2ZA 1A7GE 4HR2A 4OZ5A 5D6GA 4F4ZA 1CPZA 4DL5A 4IFVB 2MLYA 2J8SA 1JLEA 3HVWA 3PX0A 3OHBA 4AQYF 1RAOA 2OPPB 1J2VA 4CYUA 2IMOA 2DHHA 5LSLA 1IM4A 2Q3PA 3S8SA 4KHPF 4OYOA 4X64F 3PZPA 2BQRA 2HNZA 3BGUA 4HACB 2YKNA 3I9ZA 1ACMB 4QQBA 4RR5A 1NZAA 3ZZ0A 2QA2A 3C2PA 1MN9A 3VCDA 1RTHB 4HI1A 5KFPA 1X4DA 3ET6A 4EU0A 4OJHA 2W2OP 5AJ3F 1DQ9A 1NKBA 2J0SD 2UXCF 4QYZK 2GC8A 2ZC3A 2MQPA 5L38A 5IV3A 3IWXA 4F8RA 2ZE2B 1H7WA 2OAUA 2JFKA 2A3JA 2LCWA 3MM5B 4C0OC 3VGSA 3GV5B 3A8JA 1CQMA 5HLFA 3R1LA 4RW4A 2GIFA 4F25A 4P2FA 4JI6J 1QDUB 3QRPA 3PIPQ 3KTQA 3OTEA 1UVKA 2O66A 1VQ6S 3OUYA 4DR7J 4ETXA 1IWAA 1TUGB 1UWBA 3QO9B 1VQKS 2E9ZA 3CJKA 4Q0BA 3OR2A 2OP5A 2XSFA 3V6KA 4YDDB 3P5TL 3RJMB 5B0BA 2KRBA 4V19X 4USJC 4OQJA 3R7NB 1HNWJ 1EKSA 2IM0A 2NXUA 1BY9A 2B0GA 3DRRB 1KVKA 4WXOA 4I6YA 4C6AA 1NHKL 5HI7A 1S48A 1O6XA 4I0WA 2UV8A 1LXJA 3J7ZT 1B7FA 1Z2ZA 1FDDA 4G65A 3SDEB 1WI8A 2R2TA 3OFHA 5D0GA 2XGQA 4X4VA 3KLIB 4NMLA 3J80Y 1NDPA 3W2WA 3LP0A 3EXYA 1HNWF 3TUIC 2PO4A 1Q82T 5J2NB 2BRKA 3EVWA 4FYWB 2IRYA 5HQ8A 4UQGA 2DRAA 2XB2D 1X9WA 2DXFA 2Z8QA 4PYAA 4J9VA 3QZ8A 1EHWA 3SCJE 1I6JA 1SXLA 3JS9A 4Y3CA 2Z56B 4LBPA 4G1QA 3ZZYA 5D8HB 1HNVA 3M9OB 4EK2A 1IBKF 5L1IA 5JVHQ 5C24B 2DISA 5IFMA 3MF5A 4IG3A 5H9FJ 4ZVUB 1I51B 3JSBA 2DRBA 2FJEB 3DHXA 1IKXB 4LREA 4PYDA 1S9GB 1FXLA 2LQ9A 5CYQB 4YUDA 3ZNJ1 5KT4A 4DR1J 5A8KA 2IVMA 1ZA2B 4DX6A 2AYGA 3FVYA 2BE7D 4HHJA 3UWTA 2MHNA 2CNOB 3SV4A 3KHRA 4FPRA 1G2EA 4LFAJ 1T9VA 1T9TA 3GU0A 5KFQA 4KKOB 1FTRA 1S7IA 2P9GA 5A6WA 1HFEL 3E01B 5A76A 2CJKA 1RTDB 3EZOA 4ZJOA 2HKEA 2AJ2A 2K06A 3PEHA 4ZK7M 1YK9A 3JB9k 1RT4B 4F3OA 4KGVB 2IM1A 1LW0B 3W5YA 4WBFA 3W2VB 4NYPA 2RF2A 2GIRA 1EP4A 3GG0A 2RIJA 4ED7A 3UCGA 1C0TB 4A8QA 1MU2B 4OI4A 1RAJA 1QJHA 4P52A 1YJ9S 2PMHA 3ISZA 2H51B 4DV1J 5E3AA 1RA7A 1YJUA 3BF4A 1TL7A 1SC6A 1YI2S 2FLOA 2E1CA 4GKKJ 3M32B 3PRBA 3D67A 1DLOB 3W3SA 3RR7A 2HGLA 4JYAF 3UR0A 3M6UA 2AJFE 3NGUA 2AZ1A 2WSFC 4EO6A 3CE8A 3LANA 2CXEA 3IP0A 1UTAA 1K73T 1H38A 2Q1LA 1SJ4P 2K1RA 3M6WA 4DV7F 1YJRA 2FZGB 4CP5A 3H25A 1TUWA 3TI0A 4NLVA 2D69A 1R7IA 4E0DA 2RJZA 4ID5B 4M5DA 4ECZA 2B4UA 1F3FA 3FEYB 1S12A 1RWPB 2RUGA 4QWBA 2CQHA 2ZFHA 3WHIA 4FPIA 3DU5A 1OY9A 1PILA 1U2CA 2XYHB 4JI2F 2OFHX 3QZ7A 3JTPA 4RW6A 4LJMA 2KM8C 1DARA 3KUEA 4MKBA 1S1WA 4JI7F 1HBNA 1V9OA 2CYYA 2SXLA 1MNEA 2DH8A 2JNJA 2POKA 2AF6A 3CCLS 4FYDA 2KFNA 5HP1B 1C4CA 3CVKA 4I56A 4OV6A 1H2VZ 3T6JA 3MM7A 3C6UB 1P6TA 2CA9A 4UUWA 3PXGa 5BR8F 1RKIA 2PD1A 2GQ2A 3MEDA 2PEHA 1FERA 1VGYA 1RXOB 4NI2A 2UUCF 1GMUA 5E3RA 2VG5B 3K5LA 4IOAQ 4MKVA 2C1EB 3TAMB 3UR3C 4QIWD 1WF2A 2V2VA 2CWKA 2BBEA 3DRSB 2ROPA 5KFIA 2V4JB 2EFOA 3P5BP 5BR8J 3BN4A 3I4PA 1BQMA 4NLYA 4I68A 2BE2A 5B0AA 4L3KA 4ZN3A 2MMYA 3ADAC 1FRMA 3AQOA 2RVJA 2FJDB 2J8AA 2DNKA 4ZIWA 2HK3A 5B0FA 4JI5J 5GAHI 5FIIA 2W7PA 3FEZA 8AT1B 1NZ8A 4JI8J 3MMAA 3V6DB 4OLOA 5FLXY 3MHYA 2R8KA 2JL9A 2Y0BB 4ZPAA 3ZC4A 4HDHA 3QWUA 4FS1A 3DLEB 3U1LA 2XY7A 3EJMA 4JOUA 1PJ7A 2DHGA 1AZSB 3CJ8A 3VAIA 3ISND 1DZ5A 2QJ3A 3PJXA 5KFVA 3W5XA 1JXVA 1HQEB 1T0TV 1TL4A 2CQDA 3M8PB 4AYBD 5L39A 4DPWA 1NNDA 2ZH5A 4C8MA 3MWBA 2CPIA 3VAHA 1M1HA 3M8QA 3IRXA 1N5SA 2RAQA 1LEOA 2EI5A 3HKZD 4OJGA 3J7A1 2HS4A 4XTTA 2VQFF 1CEZA 4LR7A 4WIIA 2HHVA 1WEYA 3OR1B 4F0MA 4FYXB 3O1LA 2GJIA 2GJFA 3PFOA 2IPOB 1N4LA 2MJUA 1S77D 3OXGA
chains in the Genus database with same CATH topology
3LPYA 2YNHB 4ZPDA 3I6PA 2ZNYA 3IAS9 1TKZB 5IQ6A 3E3XA 4G3IA 4K4VA 1G1XA 3NRBA 1D8ZA 4K5SA 4ZVHA 4C7QA 2IVYA 2FLPA 2FJXA 2J5AA 2ZH2A 4NA3A 2FC8A 2MQNA 1S0MA 2XNRA 3NMAA 4TU8A 4ZVGA 3CCSS 1Z2LA 4D3GA 1FDNA 4EFAC 3H8YA 2XULA 3NAHA 2JOQA 4O3NA 3I82A 1Q8LA 1NHVA 4Y2AA 4M63A 2LKZA 3IC1A 2YWFA 3M05A 5L9XA 4DR1F 5T7LA 5ITHA 1T8EA 2WW8A 2HRYA 4ED6A 2CQ3A 3GILA 1S1VB 1R89A 3CCVS 1UJ5A 3W7BA 4CT8A 2KDOA 2QA4S 2M7SA 1KQFB 4BC9A 3GR1A 4H4KC 4K59A 2IRXA 1WF1A 3JTOA 1TK8A 3OPKA 4DSIA 5DG7A 2CPZA 3FFIA 3LAMA 2YNIA 1S1UB 2BJEA 2X51A 1OQ6A 3M1VB 1VRTB 2IYGA 2IA6A 2U2FA 1GX5A 4WFYA 5JVGQ 2AYMA 3NWGA 3HFKA 2XSJB 3LH2S 4NCGB 3Q8QB 2LDIA 1RT7B 1S6QB 2WOMB 1R8AA 1TQLA 1XR7A 3CC4S 1JLBA 5I42A 4TU9A 4F4XA 2M8HA 3D54A 4OHXA 2MQOA 1FKOB 1JLEB 2J6SA 1ZPVA 4YR2A 3EX7B 1EETA 2E1RA 1TK5A 3CF5Q 1FKAF 1KRPA 1TZ0A 3IGVA 1GH8A 2HNZB 4UUXA 1B64A 1R0AB 5JXSA 4DL4A 1SQEA 1VQNS 5LSRA 2ROEA 1M5KC 1RTHA 2DK2A 1TV6A 2YWKA 2YNGA 3CCRS 1S1XB 2YTCA 3LF0A 2F8MA 3AA9A 2ALZA 4K4ZA 2AX0A 4RBUA 3EPIA 4A8SA 2IBOA 5J2QA 3FGVA 4F3QA 4RNMA 2E1MC 3BO4A 1NKEA 3KG0A 3MM5A 3M8RA 1M5VC 2N3LA 1S97A 4N8NA 3AB2B 3Q24A 5HLFB 1E6YB 2DH7A 1SB6A 2G0CA 4RW4B 1PO6A 2WONA 2RSQA 1LXNA 1TP7A 3OUYB 3T1YF 1UWBB 1FEHA 3CJKB 4EBEA 3BB5A 3OXLA 4OZ0A 2WTFA 2E7WA 1H3DA 3PW0A 1Y3JA 1YG0A 2ZZMA 2I2YA 3K0JA 3OTCA 1W2IA 1U1MA 4RNFA 1H2UX 4YB6A 4Q8FA 4V19J 4KE5A 1S0OA 3SDEA 5IXUA 5J1PA 1HQUB 1T02A 1Y5LB 2MQMA 2D3UA 4WFBQ 2ZNZA 4G1IA 3W2WB 1D3WA 1Z4UA 2IAJA 3Q8SB 1V3SA 2BUNA 1L3VA 4TXSA 2FLNA 4Y2CA 2KT2A 4DR4F 3PRDA 4ECQA 1X4HA 4F4KA 3PDNA 3UW1A 2FHJD 1V3RA 2WSCC 1XMBA 2CQPA 1P9QC 5DO2A 4DV6F 2O3DA 1SIWB 1HNVB 3DLKA 3G4SS 3UD4P 2I38A 2EFQA 5C25B 1C4AA 2CPDA 5C24A 3AJ2A 4OX6A 1SUQA 4ILRA 1XMOF 1WHXA 2CZ4A 4UY85 2G13A 2EKYA 4RNNA 3IXQA 2VOPA 2KFZA 5D3GA 1FRXA 4BHQA 4WYWA 2AJQA 1FJ7A 4X4RA 2M4MA 5A8KB 5CYMA 3BS9A 4KBIA 2PI5A 4KRWA