1S1VB

Crystal structure of l100i mutant hiv-1 reverse transcriptase in complex with tnk-651
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
431
structure length
404
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWGIPHPAGIKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase
publication title Crystal structures of HIV-1 reverse transcriptases mutated at codons 100, 106 and 108 and mechanisms of resistance to non-nucleoside inhibitors
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 118
structure length 404
sequence length 431
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s1vB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1vB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1vB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1vB02
3DLEB 1RT3B 2HNYA 2FJVA 4B3OA 4WE1B 4Q44A 5F8JA 5FDLA 2YNFB 1FK9B 3CJ2A 5J2QA 4LSNA 3BQ0A 1XR7A 1HPZB 1RTIB 2OPSB 5HBMA 4ED2A 3KMQA 4PUOA 1S97A 1REVA 1FKPA 3Q8RB 1S9EA 1JLQA 4MKBA 4ED3A 3I0RA 4IQXA 4WFZA 4IRDA 5HLFB 5EUHA 1QE1B 5HP1B 3PR5B 5C42A 4DL5A 2YNGA 3MECA 5FDLB 4O3PA 1S1XA 3H5XA 2BANB 2E9ZA 4URSA 3G86A 2JLEA 5HBMB 2ASDA 5C24A 1TKZA 4RNHA 3KLVA 1IKYB 5CYQA 2FJWA 4RW7A 3C6TB 3DDKA 5KFIA 1W25A 3V81B 3BGRA 3BJYA 1S9FA 1JLGB 3E51A 1JLBA 4Q8EA 4ZPBA 4KV8A 2WHOA 1IKWA 2W9CA 1S1XB 3G6XA 2W8LA 2B6AA 1TKXB 5EWEA 2WK4A 3M9MB 1IKVA 1UWBB 4EBCA 1RT6A 3E01A 4ZP8A 4ZHRA 3C6UB 4IG0A 2AX1A 3QGIA 4WYWA 4YR0A 1RT4A 2QE5A 4H54A 4G1QB 5CYQB 5KG7A 2E9TA 1RTDB 4RW7B 4H4OB 2BRLA 2YKNB 5KFSA 3DOKA 3LP2B 4J9LA 1C0UA 3NL0A 3BQ1A 3KK1A 2HNZB 3FQKA 5HROB 1RT7A 3DI6A 3QO9B 4R8UA 5KG4A 4DEZA 1HQEA 4KV8B 1DTTA 4RNFA 1IKXA 1S1TA 3NKYA 3N6NA 3GV8B 1ZETA 2B6AB 2VG5A 3MF5A 4RUAA 3E01B 3FFIA 2RKIA 1S0OA 1C1BA 3V6DA 5L1LA 4K4UA 3KLHA 3IGNA 3GIKA 4ECYA 4K4XA 2XI3A 5KG0A 1N6QB 4ZPAA 4YR2A 3T5LA 1RT2A 4Q8FA 1SUQA 4ZMMA 2OPPA 2AU0A 1C0UB 3MEDB 4ZPDA 1RT7B 3DI6B 3ISND 4G3IA 1HQEB 4YQWA 3GV7B 1S1TB 4ZP6A 5JXSA 3KLEB 4EYIB 4ED6A 3H5SA 2RDJA 1S6PA 2ASLA 4KB7A 1C1CB 2CJQA 2F8EX 4DL6A 3H5YA 4J9PA 5I3UB 4PWDA 2IM3A 4J9SA 3TVKA 3KLHB 3V6JA 2EC0A 5DG9A 4ZVFA 2WCXA 5J2PB 4IFVA 2VA3A 2YNIA 4WYLA 4MFBB 4ECQA 3CWJA 2BE2B 3JYTB 5D3GA 3DRSB 3I5BA 4NLUA 4RW4A 2J6TA 2VG6B 3QZ8A 3PW5A 2WONB 4MK9A 4ZVGA 1NHVA 3FRZA 3IG1B 1S6PB 2B43A 4NLQA 2IJFA 3M8QA 5JUMA 2D3ZA 4K4TA 4RUCA 2WRMA 4PWDB 3RBEA 1TV6A 4WXWA 5KFXA 4J9RA 4DL2A 3LALA 2GC8A 1VRTA 5KG6A 3FQLA 4IFVB 2YNIB 3QZ7A 3OHBA 2BQUA 3KLGA 4O4GB 4MIAA 5CYMB 2AWZA 4JV2A 5J2MA 4ICLA 3RBDA 1BQMA 5DQGA 3DYAB 5C25A 4NLGA 4ECZA 4IR9A 1N5YB 4FBTA 1VRUB 3GYNA 3JSMB 4QW9A 2XGQA 5DG7A 4F4XA 4IKAA 4ECVA 1YVFA 5F8GA 4QWDA 2ASJA 4EBEA 2JEGA 2AX0A 3I0SA 1JKHA 1LWFB 1VRTB 3LANA 1SH0A 2W9AA 5KG2A 4R0EA 5KT2A 4O44A 3PZPA 5J1EA 2J6UA 5J2MB 3MFHA 3MEGA 3OLBA 4RW6A 1K1QA 3SFGA 4EEYA 3NGDA 3ISNC 4GC7A 2FLNA 3KK3A 2R2UA 1WNEA 3GQCA 5KFDA 3T5HA 1JLFB 4R5PA 3I0SB 3RB6A 1JKHB 3T5JA 1Z4UA 1S6QA 3MEEA 3IRXB 1GX5A 3NMAA 5KFBA 1NNDA 1MMLA 3KLIA 3MR2A 2I5JA 2YNHB 1I6JA 2AGOA 1RT1A 2BRKA 4O3OA 4DL4A 4IRKA 1S49A 2HNYB 4B3OB 4J9QA 4KHMA 5KG3A 5F8MA 5F8NA 2WTFA 3KOAA 1C0TA 1S0NA 1RTJA 2GIQA 2UVRA 5J2QB 4LSNB 2ZE2A 1RYSA 3Q8SB 2C28A 2W7OA 3QGGA 4O3SA 3HKWA 2C22A 1SV5A 3KLFA 4ECUA 3PW2A 4PUOB 1TKTA 4RW8A 2FJXA 1REVB 4RW9A 3V4IA 1FKPB 1K1SA 1NHUA 2JC1A 1RA7A 4QWAA 2XWYA 1S9EB 1JLQB 4KAIA 3OL6A 3I0RB 3KLIB 3T5KA 5KG1A 2QV6A 4HKQA 3CDWA 3QYYA 1S1WA 5F9NA 3MR5A 4KO0A 5C42B 2YNGB 1T05A 3MECB 3KK2A 2V4QA 1RTJB 4NLWA 3M8PA 2BQRA 2ZE2B 5KFYA 4Y2AA 1N48A 4U6PA 1DTQA 5C24B 2R8KA 2HWHA 1LWEA 1TKZB 4RW8B 3DRRA 3MTKA 4K4SA 4I7FA 4J9OA 3DLGA 3VQSA 3CJ3A 5KFOA 4IFYA 1D1UA 2FVPA 4PQUA 5F8HA 4EBDA 2UVVA 4I2PA 5I42A 3GIIA 3BGRB 4KKOA 1JLBB 4QWCA 3KMSA 1KLMA 1N4LA 1IKWB 2W9CB 2JC0A 2R2RA 1LW2A 3OSPA 1IKVB 1TL3A 1JLEA 1RT6B 3T1AA 3DLKA 4LSLA 4IG0B 1JLCA 1LWEB 4ZHRB 1S1UA 4TLRA 4JUZA 3DRRB 1RT4B 2C2RA 4WFXA 3DLGB 3UPFA 4IFYB 4TY8A 2ZKUA 3DOKB 4I2PB 3ICLA 2R2TA 4ZP7A 1LW0A 3UQSA 3KK1B 2ZD1A 4R8UB 4DL7A 4NLXA 3QIDA 5DGAA 3RAXA 1DTTB 3RB3A 1IKXB 4M94A 2HAIA 4NZ0A 3CVKA 2VG5B 3HVWA 3D28A 2FVCA 3Q8PB 4LQ9A 3FFIB 2RKIB 4LSLB 5F9LA 4EYHB 4IH7A 1C1BB 3V6DB 4NLDA 4YMEA 1EETA 2HNDA 1DLOA 3LP1A 1S48A 3CDEA 4ED0A 2E9RX 4NLRA 3M9NB 4ECTA 4K4VA 1RT2B 1SUQB 3HHKA 2OPPB 4KHRA 4O3RA 2OPQA 1LW0B 4WZQA 2V0NA 5KFNA 1T3NA 2ZD1B 4MH8A 5F8IA 1MU2A 4F4ZA 3PW7A 2OH2A 1RDRA 1HYSA 1QUVA 3OLAA 2ILYA 4XO0A 4K4YA 1RA6A 3IS9A 3HVAA 5L1JA 2W7PA 1BQNA 2IAJA 4HYKA 1EETB 3LP1B 4ZPCA 1HQUA 4IDKA 4NYZA 2BQ3A 4F4YA 4IH5A 3GILA 4H4MA 1LWCA 5L1IA 2B5JA 3NBPA 5KFRA 5KG5A 2OPQB 4RNMA 5D3GB 4ECSA 4ED1A 4RW4B 2IMWP 1MU2B 3GIMA 3H5UA 4O3NA 4ED7A 1T03A 1KHVA 1S1VA 3RB0A 4M95A 2FVSA 4TQSA 3N6LA 3QIPA 5DG8A 2AGPA 3IS9B 3M8QB 3OL7A 2WB4A 3PR4A 1BQNB 2IAJB 1TV6B 4MK8A 3UR0A 3BSAA 2J6SA 4IDKB 3DM2A 4OL8A 4NLTA 2C2DA 4J9KA 3KLGB 1N56A 4NLOA 4ECXA 3DOLA 2YKMA 2R8HA 3MR3A 4NLVA 4ICLB 3FSIA 1BQMB 4O4RA 4F50A 5C25B 2JEIA 4Q45A 3KJVA 1T03B 4TQRA 5DLFA 5EDWA 2VG7A 2RF2A 5K14A 4MK7A 4RZRA 1TVRA 3QIPB 4NLYA 3IGVA 3Q8QB 3OL9A 5J2NA 4FS1A 2FVQA 1J5OA 1HNIA 1RAJA 2D41A 3M9OB 3DLEA 1RT3A 3GV5B 2UVWA 4NRUA 4WE1A 2YNFA 1FK9A 3H4DA 3G6VA 4O44B 5J1EB 3BR9A 4IG3A 1GX6A 4YR3A 3BSCA 2YKMB 4TYBA 1HPZA 1RTIA 2OPSA 4QW8A 2V4RA 3KHHA 3MEGB 3BSNA 4RW6B 2IM1A 3CJ5A 1S10A 2DPJA 2XCAA 5KFQA 2JEFA 5KFEA 4EO6A 1T94A 2VG7B 5L9XA 2XCPA 1TVRB 3LP0A 2JEJA 1U09A 1ZTWA 5J2NB 1IM4A 5DLGA 3KK3B 3BQ2A 3MFIA 1QE1A 3T19A 2OPRA 4R5PB 3H40A 5HP1A 2V9WA 3H98A 4NLSA 3IN5A 2UVUA 4JV1A 4ID5A 4TXSA 4URQU 2GIRA 5KFFA 4ECRA 2ALZA 1S6QB 2R8IA 2BANA 3MEEB 4IG3B 4XPEA 3CIZA 5KFUA 3G6YA 4I2QA 2I5JB 2DPIA 1IKYA 1RT1B 4JV0A 2W9BA 3LP0B 3C6TA 5KT5A 3BSOA 1C0TB 2OPRB 2BR0A 3V81A 3RB4A 4Y34A 3MR6A 4EO8A 5DQHA 1JLGA 3ITHA 4K4WA 2WOMA 4Q0BA 2VA2A 4ID5B 4K50A 4RNOA 2HMIA 1SV5B 3KLFB 4RU9A 2CKWA 1TKTB 4FBUA 4Y3CA 3V4IB 4RW9B 1TKXA 5EWFA 1UWBA 3CJ0A 2XC9A 1C2PA 3C6UA 1S4FA 4I2QB 1S1WB 4G1QA 2IA6A 3QLHA 1TL1A 1RTDA 3N6MA 2W9BB 4H4OA 3KHRA 2AGQA 4WFYA 4IRCA 4KO0B 5KFWA 1T05B 3I5CA 4XPCA 2YKNA 3KK2B 2I1RA 3LP2A 3D5MA 3V6KA 3M8PB 2HNZA 5T14A 3ITHB 2WOMB 5HROA 4Q0BB 3QO9A 4DG1A 3EZUA 3QGHA 2HMIB 1XR5A 1DTQB 5KT4A 2D7SA 3SFUA 4URGA 5DQIA 3DMJA 2UUTA 4LQ3A 1SH3A 5KFPA 1HARA 4I7FB 3SI8A 2IM0A 4IH6A 5KFAA 4PQUB 4GC6A 3LAKA 3QLHB 5I42B 1TL1B 2ATLA 1RYRA 4KKOB 1HMVA 1N6QA 1ZTTA 2XGPA 4WZMA 3MEDA 1KLMB 1TQLA 5KFMA 4DG1B 4TN2A 1JX4A 1LW2B 4QWEA 3KHLA 1TL3B 1JLEB 3BREA 3DLKB 1HNVA 1JLCB 4IR1A 3KLEA 1S1UB 4NCGA 5DGBA 2FLPA 4X2BA 3DMJB 2IM2A 4ECWA 4MIBA 1C1CA 5KFLA 3H2LA 3TQ1A 5I3UA 5KFZA 4TY8B 2IJNA 5J2PA 2UUWA 3CJ4A 5C5JA 1HMVB 1R0AA 4MFBA 1QAJA 3PJWA 3DRPA 2BE2A 3JYTA 3HVTA 4F4WA 4O3QA 3DRSA 4ED8A 2R8GA 2VG6A 3CDUA 4ZP9A 1RT5A 4ZVEA 3RAQA 2IBKA 4TY9A 2WONA 1HNVB 4NCGB 3IG1A 3EPGA 4K4ZA 1FKOA 2HNDB 1DLOB 4WXOA 3GIJA 1JIHA 2IC3A 1JXLA 3PJXA 3PVXA 4NLPA 4TYAA 3TAMA 3H4BA 1JLAA 5KFTA 3UDLA 1R0AB 3DRPB 2W8KA 4J9NA 3HVTB 4O4GA 1QAIA 1CSJA 5CYMA 1TP7A 1HYSB 3CO9A 1RT5B 3DYAA 1D0EA 2FVRA 3PW0A 1SH2A 3I5AA 1N5YA 5KFCA 1VRUA 3OSNA 3JSMA 1RTHA 1FKOB 3OL8A 1HQUB 2C2EA 2IC3B 1S0MA 4H4MB 4KFBA 4YP3A 1LWCB 2B5JB 3NBPB 2O5DA 1EP4A 1LWFA 3TAMB 5KFGA 1JLAB 5KFKA 3V6HA 1XR6A 4MKAA 3NAIA 3LAMA 3OHAA 2R2SA 4ZVHA 1S1VB 3KHGA 3PHEA 3NAHA 1KHWA 5EWGA 4FS2A 5KT7A 2ILZA 2D3UA 4Q43A 1S9GA 4Y2CA 2RDIA 2R8JA 4KBIA 1RTHB 4NRTA 4QWBA 5KFVA 4U7CA 4KSEB 3DM2B 3H59A 5KT3A 1JLFA 4KFBB 4QPXA 3PW4A 5F8LA 3FDSA 4J9MA 5KT6A 3EPIA 1EP4B 3KNAA 3DOLB 4DL3A 5L1KA 2AQ4A 3KJVB 4RNNA 3IRXA 4IOBA 5KFHA 5K14B 2RF2B 2HWIA 2FLLA 5KFJA 1OS5A 1S9GB 4KE5A 5HLFA 2XI2A 2YNHA 1J5OB 1HNIB
chains in the Genus database with same CATH superfamily
4Q44A 3W1YC 4C98A 1U6ZA 3KMQA 3SCIE 2FGCA 4B08A 2L41A 1KD1T 3TWZA 3G86A 3POTA 2EFQA 1DZ5A 1M5KC 2EG1A 1WTFA 3PO4A 1GH8A 1MG7A 1H73A 2EBGA 4UQGA 3UO0A 4JI6F 1YRXA 1RT4A 1D8YA 3J81j 4F04B 2V2KA 3RJMB 1QSYA 4GVBB 3GIKA 4Q8FA 2HVEA 2ZITA 3ISND 3SSRA 4CLWA 1WC3A 4F8RA 3H90A 3F0NA 2RDJA 2MTLA 2F8EX 3H5YA 4ELTA 4DV5F 2KRBA 2EC0A 4WFAQ 2BACA 4WYLA 3KTQA 2DRAA 2XS5A 3JYTB 1UFKA 3HSZA 1F5BA 3AXKA 2J7KA 5AXKA 4J9RA 1E6YA 1FNOA 2HHVA 3HP6A 4IFVB 3KG0A 3HFKA 4OX8A 2DNYA 2IVFB 1U0HB 3EYZA 4NMLA 4ZVRB 2B9YA 3I56S 4V1Ak 1EX8A 1CLFA 3T6JA 1LWXA 2HVHA 1AW0A 1K1QA 4GC7A 3KXDA 4O23A 3HHNB 1GMWA 3EMTA 1NO8A 3MEEA 3O2IA 4B3OB 3B82A 2BVZA 3PX4A 2C22A 1REVB 1X7VA 1EJ7L 4JI6J 1MN9A 2B7CB 1U1NA 1N0VC 2XSFA 5DZ7A 2Q6BA 4OLPA 1N33F 1U1RA 1LWEA 4LRFA 3R8YA 2OELA 1NZAA 5I42A 3OUYA 1TTHB 3IRWP 1LW2A 4ZHRB 4JV5F 1NB7A 2XMKA 4NWBA 4DV5J 3UPFA 1BUXA 2BJ7A 3MR7A 3RB3A 5AXMA 2VG5B 2KYXA 3NNHA 3KWMA 4LQ9A 4LSLB 1Q16B 4O0NA 4YMEA 3HHKA 4OHYA 1HBUB 3OLAA 4QCLA 3GILA 4X84A 1Q79A 3CC2S 3WX8A 1A0OB 1NPRA 4C2MA 4M95A 5L46A 3N6LA 4X4OA 4DSKA 3W66A 1TV6B 3JTPA 3W62A 3M6WA 1SCJB 3QATA 3R5BA 1GNKA 3M9OB 5IOLA 4QIFA 3G6VA 3BBBA 2BKNA 1N8RT 1SKRA 4RW6B 5KFQA 2JEFA 3T19A 4ID8A 1U8SA 4AFFA 1N33J 3CE8A 3CIZA 4I2QA 2KJWA 4YDXA 1UVKA 4FVMA 1N0UA 5HN0A 1WDTA 2CADA 2E7VA 4JV5J 3PYGA 4G1QA 1RTDA 3M30B 3KHRA 2YKNA 2NSBA 3M8PB 1PJ5A 4P72A 1Y4ZB 3ITHB 2O1PA 1T0TV 2UUTA 2HS4A 3HHLC 2ZKTA 4DR2F 1QTMA 1WOOA 2NUUG 1M1GA 4QWEA 3DMJB 4QR0A 4LVOP 3TQ1A 4BS2A 4TY8B 4OYOA 5D0GA 3VAMA 1BWVA 2BE2A 3HVTA 4HDHA 1KSPA 2ZZMA 3RAQA 3DKDA 3GJRB 2LLZA 2GHPA 2J7WA 2NPFA 1HNZF 5BYSA 4ANDA 3IR6B 1ZPWX 1HQUB 4OHWA 2BM1A 2VPXB 3OHAA 1PC5A 4Q43A 3OPKA 4BWMA 5LSLA 4WTOB 4KSEB 1ZH5A 5L1KA 3KJVB 1DFDA 2QMUB 2HNYA 2ZH1A 1FJGF 3CJ2A 3P96A 5A76A 4ITSA 2RMLA 3BQ0A 4ZCLA 3HZEA 5FLXY 2ZZNA 1S9EA 1L3KA 1NDPA 4TLQA 4D3HA 2Y1JA 1U2FA 2CQ2A 2JOQA 1TKZA 3OTDA 1ZA2B 2BE9B 4DR2J 3BJYA 3E51A 3LWLA 3LA0A 2CDRB 2FHKA 1S1XB 2BV3A 5JMNA 4IG0A 2VL1A 1HWUA 4K8RA 2HYIB 2BRLA 4AE5A 2EKYA 4DEZA 1RHUB 1HQEA 5LXRA 2C1EB 2H54B 3KLHA 3DXBA 3D54A 3T5LA 2G1DA 1HNZJ 1RT7B 2D3O1 1WKLA 4KB7A 4DL6A 1ZM4A 2MQPA 3VTIA 3PW5A 3P3DA 2WONB 2E1AA 4UUWA 4HHHA 3M8QA 2D3ZA 4WK1A 2UP1A 3G96A 1OPZA 5KG6A 3NNCA 2BQUA 2NXJA 4MIAA 1S77D 4PABA 2M9KA 3GFHA 2K3KA 1WF0A 3I0SA 1M1KT 1FJGJ 1Y3JA 5CXTA 2CVIA 2BJ3A 1FJCA 3LO3A 3K89A 3Q8VA 2L9WA 3TZZA 1HI1A 4A4JA 3ISNC 2KRRA 1JLFB 1P8GA 1HHSA 5DM6Q 2ZBPA 2JWNA 3OVSA 2JSXA 3MHYA 2HGMA 1QVGR 2F3JA 3QQCD 4PG8A 1VK3A 2GIQA 3WC0A 2QTWA 3LGHA 3A1YG 1SV5A 4ECUA 1PJ6A 3A12A 4KGXB 1RA7A 1JLQB 3CUNA 4DLGA 2KXHA 1S1WA 2P6TA 5C42B 2V4QA 1L3TA 2YWFA 3ENAA 3PKYA 2HWHA 2B51A 4ZVOB 4EBDA 4DX7A 5F8HA 1SJ4P 1JNRB 3ILOA 3HFVA 5L9NA 2HHWA 2V2ZA 1JLCA 5HL7Q 4USMA 2KKHA 4CYUB 2BJ9A 2M4MA 2ZKUA 3ICLA 3UQSA 4USKA 2LXFA 1NMEB 3C14B 4NZ0A 3D28A 3Q8PB 3QT5A 4NLDA 3OVBA 2WVCA 4TKTA 1UZHA 1T3NA 4X4QA 2ZOMA 3O1LA 3TEHB 2GCFA 2ZBRA 1CBKA 3P4UB 3Q2TC 1TZ0A 2HSEB 4FDFA 2R4FA 5D3GB 2JVOA 1HWLA 4PYDA 4O3NA 1S1VA 4RUHA 2CJYB 3R7SB 2VOPA 3CMES 3MXHP 4Q45A 2OTJS 1SKUB 1B0TA 1OMSA 2F40A 3P6YC 2OEMA 2LXIA 1MSWD 1RT3A 3VVTA 3E3XA 2HHHF 2HZVA 2YKMB 2HURA 5K8OA 2DPJA 3ZTRA 4LIRA 2C3UA 3KK3B 1VBKA 2MSSA 3FCVA 3H98A 4NLSA 1TFWA 5THWA 4NZ7A 2Z2ZA 4USUA 1OQ3A 3JTOA 4DN0A 5C7PA 5ETRA 3PYEA 3MCMA 1AUSL 2X1BA 4A47A 3G2XA 1DBDA 1TKXA 3I96A 4QIWD 3ZNUA 2QG9B 3MOJB 2XSJA 2WOMB 4Q0BB 3OR2A 2CQ0A 2RNEA 1H74A 2IMOA 1Y5LB 1TL1B 4KKOB 2K06A 1HMVA 1ZTTA 1SJQA 2JDJA 1CPZA 2B4VA 4OI3A 4DV4F 1KBRA 1NHKL 2O3DA 4NCGA 5I3UA 1AA1B 2WBRA 3PJWA 5IV3A 1TUVA 2Z56B 1H7XA 4HT7A 2HNDB 2CWXA 3ELHA 3TAPA 3R7NB 2L48A 1U1MA 1R0AB 3M8RA 2PFFB 2MHNA 2R7OA 1FKOB 3VZHA 2B5JB 5LT5A 4NA1A 1RCXB 2HHHJ 4ZVHA 1VQ8S 3NAHA 1KHWA 5KT7A 2DCUB 1NCLA 4GMKA 5HMWA 4ZOSA 1KDNA 4RJVA 3ZZPA 2AHOB 2RF2B 1S9GB 4NZ6A 2ALYB 3IP0A 2DO4A 5J2QA 5D78A 3CJKB 2W25A 2A10A 3DDIA 3L7PA 4WFZA 2Y3YA 3EXCX 3ZZZA 5EN1A 3J7AN 3H5XA 1T9TA 2QLXA 2E9ZA 1ZOTA 2HBRB 1R0BG 3PCOB 4DZ6A 2FJWA 3UE2A 2NUHA 1LXJA 2XNQA 4DV4J 5EWEA 1IKVA 3KYLA 3E01A 1H38A 2QL7B 2QE5A 1T02A 1X4CA 3CB4A 2H5JB 2ZUAA 4J9LA 4Q2LA 5HMZA 4R8UA 3VVUA 1AXQA 1O0PA 3GFZA 1S1TA 2BUNA 4RUAA 4MYTA 2XI3A 1RT2A 1SUQA 2AYEA 1XBWA 5D4PA 1NH8A 4PWDA 3ILIA 2KU7A 2WCXA 5J2PB 2Y1RI 2ZVSA 4L76A 1Q1KA 4CWBA 2DNZA 1FFSB 4PPDA 2ADCA 3UI3A 2NCKL 1B99A 2VBYA 3MUVP 1YJRA 1DRZA 2XTJP 4B9UA 2F63A 5K8NA 4OYXA 3MCOA 3N79A 4JV2A 1V5IB 1L3UA 2JVRA 2HEKA 3TJ8A 4IR9A 3C15B 2XGQA 1YVFA 1Q5VA 4CO4A 1JKHA 5B0GA 1P1LA 4A8WA 5KT2A 1FJEB 1FX4A 1G4CA 3MCNA 3CCWA 4FNIA 4KIAA 4WK3A 2RIJA 3CC7S 1RU1A 3L95X 2DIVA 2A2CA 2GO9A 3FMWA 3MURP 1I6JA 1VR6A 4OI4A 1EQMA 2P9CA 3UVJA 1S0NA 3AY0A 4X62F 2ZH7A 4M5IA 3Q8SB 1X31C 4QU6A 5T41A 4RW8A 1FKPB 4KAIA 1WC5A 2OEKA 2QV6A 3CDWA 3MR5A 2WSEC 1VJQA 2YNGB 1T05A 1XERA 4BBYA 1WTBA 2MZTA 4U6PA 2R8KA 1M5SA 2MDAA 3O44A 4JYAF 3CD5A 1H7WA 3VQSA 4A8MP 1Q8BA 4LF2A 4C8OA 4PPZA 3ZTQA 4LF4F 3U1LA 3HF5A 4P71A 4YEAA 4DL0C 1UP1A 1NDCA 2HHXA 1OPIA 5B0BA 3CCES 3MMBB 1T9UA 3BPSP 3DC2A 3D6TB 1SJRA 2FVCA 2I6WA 3OXLA 3TZYA 4UF4A 4ED0A 4CP5A 1LW0B 2ZH6A 1L5UA 3H8YA 3I87A 1RDRA 4WP8A 4JB8B 3OXFA 4KH1B 1IBMF 1D9AA 1RSCA 4IDKA 1VLOA 2FUG9 4M5MA 3HDSA 4IH5A 3C2PA 4RW4B 1I94F 2KYZA 3CMQA 1A7GE 2H65B 2QLJB 5G0RB 2AGPA 3KDNA 1JQGA 3VR1A 4D3GA 3HCXA 1U24A 1FT8A 2CPZA 4ICLB 2OHDA 1TVRA 3QIPB 3IGVA 1YBAA 2UVWA 2M5YA 2C2NA 4X62J 1JB0C 4X66F 2HZAA 3GU0A 2V4RA 2NZCA 2XS2A 3G6ES 2H3EB 3LP0A 3B54A 1IM4A 5DLGA 2LU1A 1RWMB 4JV1A 4URQU 4ECRA 2GJIA 1WORA 3TA0A 1Z1ZA 4JYAJ 2GHWA 2D1CA 2F4VF 2LFVA 3BS9A 1YJVA 1T7PA 4LF4J 1WG4A 3TUIC 3UDVA 2IA6A 3QLHA 1MWQA 3N6MA 2HHSA 5T14A 4JI0F 2IM0A 4PQUB 5IM0B 3EDRB 4ZVPB 1FDBA 3DHWC 3P5TL 3GLJA 2V8PA 4AD6A 1S1UB 1IBMJ 5L8RC 4ED4A 2EBEA 1UVMA 3CJ4A 2VQEF 1I94J 2MKYA 4O3QA 2R8GA 4OZNA 4I6WA 4OYAA 3EPGA 1WHXA 1JIHA 3SCJE 1MW7A 3PJXA 5SUHA 5AE1A 2M52A 5EHHA 3UDLA 4DPOA 3AOAA 4C8ZA 3W3SA 1TP7A 3TOQA 4DQIA 3CDBA 1FI4A 2AEMA 3BB5A 1X0PA 3PXGa 2FD2A 2HLTA 4IYQA 4CT9A 3NBPB 2OSQA 4X66J 1EP4A 3N01A 2ROPA 2XHCA 1JNZB 4EU0A 2R8JA 4NRTA 1OYEA 3G4SS 3FDSA 4J9MA 2ROGA 3LTOA 3IRXA 1BLUA 5KFHA 5K14B 4C8YA 3D1HA 1I5OB 2GAHC 3VAFA 5HLFA 1YHQS 2F4VJ 2MZQA 3DLEB 5F8JA 5FDLA 2YNFB 2MQNA 4KGKA 4HLBA 2B8QA 1KEKA 3DU5A 1E6VA 4FYXB 3PR5B 2DBBA 3HPOA 1QSSA 1MMNA 2MQMA 1UWAA 4JI0J 3PFOA 3GG1A 4RW7A 1WEXA 1X4FA 1W25A 3EX7B 3RBZA 3W61A 1SC3B 4EBCA 4GKKF 2HVZA 3BM7A 2M7SA 1FDDA 4DCPB 1ZAXA 2HNZB 2CNKB 2VQEJ 3BR8A 4ZLPA 2L3MA 2CRLA 2OSRA 3NCQA 1RHRB 2PGCA 2RQMA 3SIPB 1YJTA 4F67A 1U1LA 2VBXA 3M2RB 1M0SA 2DHAA 2KL8A 5DG9A 2YNIA 5IFMA 3I32A 1NB2A 2K8GA 4MK9A 4QIEA 3DLBA 5JUMA 4U8YA 1WSVA 3EDQB 3FQLA 3QNWB 4USVA 1U02A 4I67A 4Y2MA 3KLGA 5CYMB 2XMVA 1CJUB 2OFHX 1A9NB 2OO4A 3JSMB 1R31A 3NS6A 3ENQA 5K5MA 1K9MT 3W2VA 2N3LA 4AL7A 4B3MF 5K8PA 4ZJLA 2WZ1A 4CT8A 4C9DA 2ZWOA 3T5HA 4ILLA 1X5SA 3CIMA 4L74A 3BZQA 2I2YA 1MMLA 4OYWA 4YDDB 5F8MA 4LSZB 3R2DJ 2ZE2A 1RYSA 1JXVA 5GAHI 2D3OR 2M8DB 2ZJPQ 4GKKJ 5KG1A 2A1BA 1Q82T 2V34A 2FGOA 5G4DA 3J7YI 1UVNA 5KFYA 2J76E 1SJ1A 5AE2A 1WHVA 2DGOA 3DRRA 4ES3A 5A8WA 1NK4A 3KMSA 2HBZB 4P2SA 4QR2A 2WSCC 1KVKA 4UTGA 1RT4B 3S7RA 2OIHA 1UEUA 2A18A 2OAUA 3M6UA 4X4SA 4F4KA 3X3UA 2ZH5A 3TUJC 3M9NB 3ZTSA 2IYGA 1UJ5A 1IR2A 1QUVA 4XO0A 3RG6A 3IS9A 2COLA 2IAJA 3PJ9A 2V4JB 4ECSA 3SQOP 3CJ8A 1F5AA 4B3MJ 2FVSA 1UAWA 3DXSX 2QL9B 3PR4A 1VMBA 1E6YB 3UW1A 5IZHA 5F0WA 1XMQF 5EDWA 3BH6B 1P27B 1QJHA 3OL9A 1F9HA 1T9XA 1Q95G 4TYBA 3QT7A 5AE3A 2OPSA 1TUWA 4F3QA 1S10A 2XCAA 5KFEA 2ZZTA 1F3VA 4R25A 1WKKA 1CJVA 1OY6A 4ED5A 5KFFA 3MEEB 2V9KA 5FJ4A 5ETQA 4O0IA 2DEIA 3SQGA 1EKSA 2DPIA 2MJUA 4OI6A 5DQHA 2F7VA 4K4WA 1Q0NA 4C8MA 2PSZA 2XC9A 4FF4A 4M8LA 1YK9A 2G9OA 4WFYA 1MROB 2R3VA 2R7XA 4DV1F 5KT4A 1WC6A 4XDCA 1ZPVA 5I42B 3OUYB 1GFWB 4WZMA 1WHWA 3W65A 1REGX 1LW2B 3R5CA 3J7Z5 4IR1A 2VUGA 1C1CA 3BYPA 2V68A 1QSLA 3UCZP 4FYWB 1KOOA 1FNMA 2IA0A 3U1MA 4A8OA 1Y11A 1JXLA 2R42A 3CPWR 4B9TA 1OIAA 2B56A 3VALA 3N5BA 4UQTA 1XMQJ 2XLJA 3M8YA 1Q8LA 3LF0A 4Y00A 5KFKA 3PX0A 2DGUA 1HL6A 4I1TA 5D4LA 2GHVC 2E1RA 2EG2A 3ZO7A 4WCEQ 2C2ZB 6FDRA 4KE5A 4A8KA 3IBWA 1KQSR 2WW8A 5HBMA 4OJGA 1Z2ZA 4E8UA 3F41A 4M5DA 1RZMA 4RWXA 4O3PA 2EK1A 2ZBIA 3MM8A 4DV1J 2DHHA 2DHXA 5C24A 2Z4PA 3BBFA 1IVZA 4DPUA 4DFJA 3LOUA 3MPDA 1TKDA 2DNMA 4RWWA 3Q83A 4G1QB 1RTDB 4N5SA 2YKNB 1F9EB 1HNXF 3B6BA 3NG8A 3AT1B 3L7UA 4EWTA 4KV8B 1SC1B 4RNFA 4A8FA 3MF5A 4P73A 1S0OA 4UOFA 2V2VA 4JP8A 4P74A 2H51B 4G3IA 1QVFR 2AYBA 2MZJA 2CQGA 2HRYA 2VA3A 4ECQA 3NXZA 2BE2B 2ABYA 2J6TA 5AXNA 4GRSA 1LFWA 4NYOA 2IVMA 3GE9A 1XNRF 4DL2A 1J5EJ 3DLJA 1M5HA 2AWZA 3RBDA 4RLEA 4F4XA 4QWDA 1ZS6A 4MT1A 2AX0A 4G6VB 4U8VA 2OEJA 1YBUA 4PG7A 1ZA1B 2FLNA 5CHCB 1RHJB 2LQBA 3ZZOA 3SSSA 1EKRA 4ZPVR 1RT1A 4O3OA 2B3TB 2HNYB 1C0TA 4K5SA 2VD3A 2RRNA 3PW2A 4QWAA 3OL6A 1S9EB 5B0FA 4HTJA 1NBEB 3H2UB 1HNXJ 1RTJB 2KO1A 3ZZYA 2HPUA 3TRGA 4TU8A 1TKZB 2N7CA 1YTYA 3DLGA 1Q81T 3ZZUA 4OQJA 1FE0A 4DPXA 2JC0A 1F2GA 3IM9A 4IG0B 1BGXT 2ZD1A 3H7HB 4MJKA 4QYZJ 2VIHA 2CQBA 5KTQA 2VU5A 4ZS6A 3W64A 1XNRJ 4K4VA 4YB6A 4O3RA 2YY3A 3WC2A 1UVJA 3HVAA 4LVNP 4F3MA 3NEKA 1EETB 2ZH4A 4X4UA 5DM7Q 1SL0A 2OPQB 4PRFA 4YY3J 3GIMA 2W2MP 1JJ4A 1HA1A 3M8QB 4H4KA 3UFCX 3GG0A 4ECXA 2PC6A 5IXUA 1FTRA 2HQ3A 1T03B 3BN4A 2H48B 3OJSA 1TMJA 3W9IA 4WE1A 1U1PA 2LQ5A 2DGTA 2ZNZA 3C19A 5B0CA 2VG7B 2FY1A 4DFKA 4ZJQA 4F26A 2XYGB 3DLLQ 4AL5A 4ID5A 1GMVA 4PYAA 1SL1A 1IKYA 3RB4A 3EUNA 1Q8KA 4RNOA 1SV5B 2K2PA 2IY5B 2VFSA 2E5LF 3C6UA 1S4FA 1S1WB 3RRHA 2WAQD 3OR1A 2I1RA 3MOZA 3EGZA 1VQLS 4DG1A 3QGHA 2HMIB 1VYAA 1XR5A 1URNA 2H9ZA 3PACA 4OYBA 3D0GE 4LR8A 1N36F 1XC9A 1HNVA 1JLCB 2M88A 2FLPA 1AROP 1WACA 3FGVA 4L6V3 2IJNA 2VG6A 3ETOA 3V4MA 4GVLA 3PVXA 4NLPA 1NSKL 2XEXA 1HD1A 4LR9A 3FCWA 1RT5B 3PW0A 2AJ4A 5RUBA 1XNQF 4L3NA 1PILA 1OSDA 5LOQA 1PAUB 3H42A 1CQMA 4HEA9 4I68A 2RILA 1S1VB 4QIVA 2G0IA 4QWBA 1VQOS 5CCLA 1KOHA 4KFBB 5KT6A 1EARA 3VQTA 4KTQA 1NJZA 3CF5Q 2GA7A 2EEYA 1RT3B 2DGWA 1FWKA 1NK6A 1HBOA 4UT4A 4PUOA 2E5LJ 4ANCA 3Q2SC 4ED3A 3UCGA 4X4RA 5EUHA 3CJTA 2Q66A 4ILMA 2KT5A 1QD1A 3K5MA 4V19J 1FTCA 2DXFA 4OI0A 2LDIA 1N36J 2HGLA 3BGRA 3BPDA 2WVBA 1TKXB 5B0EA 5KG7A 2E9TA 1TK5A 2GO8A 5M2UA 3MUTP 2XSJB 3CSKA 1WNEA 4GO7X 3DI6A 2FLOA 1IKXA 2VONA 2B6AB 2XQCA 1U49A 3G8QA 4YS2A 4DLEA 3AAWB 2RKIA 5IQQA 2HFNA 4K4XA 3NWGA 5KG0A 2HKEA 4EFAC 2AU0A 1VHFA 3MAHA 1SXLA 3T1YF 2ASLA 1XNQJ 5I3UB 4NXMF 4ZVFA 3SBMA 1VC0A 4DV6F 4FF2A 4A8SA 1H6KX 2Z2MA 3KJQB 4WP9A 3M7VA 4P7TA 4HL9A 3H2VE 5GMKa 1BC6A 1BQMA 4KGMA 3R5JB 4B3TF 3A3NB 4I69A 4DU8A 3K58A 3CJQA 4OZ5A 1OSCA 2WSFC 3GQCA 3I55S 1LOUA 3ULHA 3GZ7A 1CJTB 2POKA 1OJ4A 2VZ9A 1NK0A 1GX5A 4UW2A 4PXCA 2PI5A 1FHTA 4OZLA 3MR2A 2MGZB 1V3RA 3KOAA 5J2QB 3KLFA 2CQ1A 5BR8F 4HHUA 3GP9A 1RBOB 3QWPA 1IQTA 4LRCA 3QYYA 1HBMB 1UTAA 2J9EA 1CS4A 4QBUA 4M1KA 4CDIA 1D1UA 2FJEB 4EZ6A 3CD7A 1KLMA 3T1YJ 1IQZA 2HHQA 2Y8WA 2QA4G 1IKVB 2GIFA 3KG4A 4NXMJ 2ZOFA 4PR6A 4DV6J 4C3MA 4R8UB 3SV4A 3RAXA 4OJHA 3LP1A 4H4KC 4NLRA 1RT2B 1SUQB 2V0NA 2GVDA 4ZLNA 3A8KA 2CJBA 2J0WA 2W2QP 2OH2A 1HYSA 1OO0B 3CCLS 3MM6B 4HDGA 4L75A 4M5NA 1BQNA 4Z37A 4B3TJ 1PIEA 1Q5YA 4P6QA 4FYDA 4F0KA 4CCHA 3D66A 3UR0A 2V5HG 4LREA 4NLOA 4C3LA 4DZDA 5A0YA 3HVRA 2WVEA 3TVZA 5B7WA 3H0PA 5JJBA 4YR3A 5BR8J 4DQRA 4N41A 3CJ5A 3LPYA 1Y5NB 2OPRA 5ETNA 3NWRA 1S4EA 4TNOA 5KFUA 4QZVB 2LQ8A 3BGLA 2ZUGA 3Q8UA 3UR3C 3GMGA 2QN6B 3WX4A 3BSOA 3UVJB 4Y34A 3J7A1 1Y3KA 2J7UA 2LP4A 2NXEA 2V67A 4FBUA 1R8CA 3FCHA 3UDCA 3ET6B 3CJ0A 4CI0B 1GXUA 3B8HA 1N5QA 4HI1A 1T05B 2IDLA 2OLWA 4EI2A 2VC1A 5HROA 3HULA 1CQNA 1FRIA 3IAM9 4Y2IA 4HACA 4B9MA 4LQ3A 2W7AA 2DY1A 3ZZ0A 5HJYA 2IRYA 3UNGC 2A2DA 4UUXA 3OVAA 2BJEA 2HAFA 5H9EK 1NPPA 4DV0F 5E3QA 2DITA 3D67A 3I4PA 1KFSA 2DCLA 5KFZA 2JH3A 1AFJA 5IC6B 1U4BA 1PC4A 3SV3A 2XMMA 1HNWJ 3S6EA 5HMXA 5HAOA 2IC3A 2Z58B 4KY3A 4TYAA 3K59A 1V3ZA 2ZEJA 2E44A 5KFCA 2GJFA 2QMWA 3TAMB 3WQPA 2E66A 3QBCA 3LAMA 2VC0A 2KG0A 1NAQA 2CPYA 2U1AA 4CTAA 3W5ZA 5M2PA 3H59A 5D0EA 2C2OB 4XK8C 4IOBA 2YNHA 1SPBP 4LSNA 2BKPA 2K7KA 4DSFA 2LA4A 1S79A 2X1GA 2M8HA 4IQXA 2CIMA 4OMFG 2VF3A 2EW9A 1Q4RA 4DPYA 2HFSA 2XLIA 4WF9Q 1B4SA 2CG8A 2DNPA 4FPIA 4IQMA 3FSYA 1IKWA 3P8BB 1G2EA 4DCOB 4NYPA 2XS7A 1BQXA 2AJFE 4DV0J 4C48A 3FQKA 4LBPA 3GR0A 3C16B 1ULRA 2QO3A 2CUYA 5HVGA 3Q8YA 3MMCA 4RBTA 1R8PA 4P75A 3SCKE 4K4UA 5CD4A 4ZPAA 3CO0P 3GB0A 2DIUA 2HFUA 1BD6A 1RBAA 1TUGB 2Z57B 1XQIA 3KUHA 4J9PA 4J9SA 1HWIA 4IFVA 4ZVUB 3HKZD 1YI2S 4NLUA 2IIHA 3LWMA 3FRZA 3Q22A 5KFXA 4P2MA 3QZ7A 3OHBA 2V6AA 4WWSA 4ZITA 3SXLA 3K2YA 3FBBA 2ASJA 2E5IA 5HQMA 3LANA 4R0EA 2CQHA 5J2MB 3MFHA 3OLBA 2YPZA 4I64A 4M5HA 3HHLD 3NY0A 4DX8H 3IRXB 2V69A 2FZGB 2I5JA 2DXDA 3FC9A 5KG3A 3RAMA 1YDLA 2XZWA 5LL6d 3QGGA 5F41A 2GMLA 1LQ9A 1E6VB 1HWKA 3O8WA 1VQPS 5ETLA 3IWNC 4KO0A 1SIWB 2NSCA 2BMBA 4J9OA 2O01C 4X64F 5GAGU 1RAAB 2CYYA 3T1AA 4LSLA 2MQLA 3T9ZA 3VF0B 4IFYB 4I2PB 2XNRA 1HBUA 3JQMA 4DU7A 1RLCL 4EYHB 1TU0B 1DLOA 2E9RX 2N4DA 3HFZB 2MZRA 1GXLA 2DEJA 1DURA 3HHLA 4U7UK 1NM2A 4H4MA 3G8SA 2KFZA 1LWCA 4OZ2A 1S76D 2VFTA 2Z30B 5JVHQ 5DG8A 1A6LA 3R1HA 3DM2A 3KLGB 4NLVA 3M6VA 4F36A 3QJJA 4DF4A 1HBNB 3NP5A 4U96A 4ZCKA 3FMBA 1CJKB 3CCSS 1X8DA 1FWPA 1GX6A 2R7RA 3PIOQ 2JEJA 2YVSA 2P8IA 4E98A 2DYAA 3CCRS 4KGVB 1V6HA 3C6TA 1UETA 5KT5A 2KM8C 1WF2A 2BR0A 1KQFB 4X64J 3ITHA 5DO2A 4RUBA 5IT9U 3A8IA 2UXBF 4KJIA 1ZM3A 3LP2A 5E3PA 4DPTA 4F0MA 2LA6A 5M2RA 3DMJA 4ZLJA 1GMWD 3AA9A 3K5PA 2ATLA 2HLUA 1X4GA 2XGPA 5A8WB 1TQLA 2LXUA 3HJVA 1S99A 1CVJA 3GPAA 4MFBA 4N8OA 3TVYA 3W63A 3UD4P 2QA2A 2YH1A 5CZXA 5KFTA 3MPYA 4J9NA 9ATCB 2CQCA 4PXBA 2QZ8A 3IWLA 5ETOA 4CZCA 3OSNA 1U7LA 3JSYA 2AZ1A 5BJRA 1XR6A 3I82A 2XY6A 2OD4A 2J0XA 4LT6A 4FS2A 4Y2CA 2ZH3A 5EX0A 2B8PA 4XDDA 1YX2A 3GFYA 4DR6F 2GVZA 2DNOA 3KNAA 4DL3A 2VJVA 3GYXB 2FLLA 1H3DA 2FPHX 3FBCA 3G6YA 2FJVA 3PV8A 1MMDA 1TK8A 4ED2A 2OPSB 4J91A 1S97A 3EWGA 3VGTA 2JX2A 4BCAA 2UXBJ 3MECA 1CJVB 1H2UX 3CD6S 1S1XA 2FDNA 2P2CB 2ATCB 1XEZA 2JLEA 2ASDA 3DDKA 5DETA 4NXNJ 3G6XA 3BEGB 2EFVA 2PEBA 4YUDA 3G9CA 4K5RA 2VH7A 3KK1A 1RT7A 1DTTA 4DCJB 1F0XA 3W60A 5GMDA 1C1BA 3IO1A 3TA1A 3HSGA 2RU9A 1JXEA 4ATNA 1X4BA 1D9FA 1CULB 1VK8A 1GAOA 3H5SA 4DX6A 1C1CB 1M1HA 3TVKA 2BZ2A 4DR7F 2J5AA 2L9DA 3W9HA 2NPIA 3FUYA 2ADBA 4ZVGA 2QGFB 2W01A 3W8GA 2AT1B 4Q7AA 4JI2F 5AJ3F 4DR6J 2GMHA 1YSJA 1SL2A 4QW9A 3EICA 4ECVA 1RHMB 4DV2F 3HHDA 1DQAA 2BW2A 3OW2R 3HT0A 4ZIWA 1SH0A 1I3OB 5KG2A 1R6YA 4NI2B 2J6UA 2AEFA 2RHQB 2RS2A 3KG1A 2R2UA 4ETZA 3PY8A 2VODA 5J1NA 5F3ZA 3T5JA 1YZ7A 1YQHA 3UWTA 4X4TA 2DNGA 4N76A 4Q2MA 2CG4A 4IRKA 1PGZA 1H2VZ 2UVRA 3HO1A 3MPVA 3THVA 2JHEA 1S0VA 4DQPA 3ENWA 3HJFA 3FBEA 3KLIB 4HKQA 2CJXB 4M5DB 4YHHJ 2VBWA 3MM8B 2RU3A 4W98A 4OYMA 5C24B 3GR1A 2UV8A 3MTKA 4KPCA 2YKQA 1V9OA 4QYZK 1RWNB 4CYUA 1N5SA 5FLXU 3BGOP 4DF8A 1UA1A 3C14A 5DDPC 2RB7A 4G65A 4JUZA 1NLKL 3W5XA 1FF2A 4DR7J 1U2CA 4NLXA 2HAIA 2N4CA 1W2BR 1U8WA 1HIYA 4JI2J 3M2VA 1VQ9S 5AJ3J 1TL7B 4MH8A 1ZZNA 2JL9A 4MYUA 4F4ZA 4HHJA 2ILYA 4CO2A 1RA6A 5L1JA 1FKAF 2DR6A 5BYRA 4DV2J 3OTCA 5EX3A 4UY85 3PRDA 4RNMA 1RADB 1RI7A 3OD2A 2QEXS 1KHVA 3A13A 4NA2A 2V8DA 2V8GA 1VIOA 3M2UA 3ZTPA 2J6SA 1YITS 3NCPA 1NRKA 3DOLA 2YKMA 1KQGB 2R8HA 3EGVA 3EVMA 4RZRA 2OTLS 1HNIA 3A3OB 3H25A 3HZGA 4CRJA 4QQBA 1FK9A 3MMAA 5IC4B 1RTIA 3R9LA 2DISA 4EO6A 1T94A 5L9XA 5J2NB 1NJYA 4KH0B 5E3CA 2MB0B 2G2OA 2D9PA 4M5LA 2UVUA 2YTCA 1H2TZ 4A46A 2XYHB 1YZ6A 2B9XA 1RT1B 2AJ0A 1C0TB 3V81A 4C97A 2WOMA 4Q0BA 4WU2A 1T8EA 1JMTA 2HIQA 3BO3A 4B02A 1VBXA 1TL1A 1LEOA 2W9BB 4H4OA 5B09A 2HRUA 3JSBA 4MKYA 3GCWP 4XPCA 4G1IA 4ANEA 1WC1A 3QO9A 1PBUA 3WZ0A 5CAAA 5HANA 1SH3A 3TAQA 1UA0A 1JK9B 3EXYA 1HD0A 3MAAB 4TN2A 1Z2LA 4RL1A 3DOMA 3R5GA 3Q89A 1R0AA 2MKJA 1RB0A 3DRSA 4LMZA 2AIRB 1FKOA 4M5GA 4Z7YA 4DI6A 4DV3F 2HHUA 4R0JA 4O4GA 3CO9A 2FVRA 5SZTA 3QRRA 3I5AA 1FA0A 4YP3A 1D09B 3BKTA 3NAIA 2HWTA 3PHEA 1S9GA 2APOA 2UUBF 3CJKA 3KKFA 1NK8A 3HHEA 1Q7YT 3IBCB 1K47A 3KJNB 2YX7A 2MQQA 1NDLA 2C3PA 4WE1B 2Y1IA 2BJ1A 2E29A 3P5BP 4OJ3A 4QR1A 5I3PA 2HQFA 5KAKA 5HVHA 2E1PA 4M5JA 3JS9A 5E7OB 2IVYA 4NE9C 4ER8A 2KHCA 2QX0A 2AZ3A 1NDKA 1IKYB 1RHKB 1Y9OA 5GMEA 2HQDA 3R1LA 4I6YA 4OX9F 1SC4B 1S9FA 3O5TB 1FRLA 2XY5A 3CD0A 3C6UB 2WB1D 1R0CB 5CYQB 1HHQA 3OR1B 1RCOB 1IM6A 2YWEA 3GIRA 4WKYA 3BQ1A 4MIWA 2BX6A 3FKBA 1FCAA 3OXGA 1PBAA 3TI0A 2UXCF 5CQGA 1VQKS 2XHWA 1C0UB 4DV3J 1J27A 3DGPA 3EGWB 3OV7A 5DRKA 1UL3A 4ZKAA 3QMQA 2VG6B 3QZ8A 3VAHA 1VCTA 3C15A 4FZVA 4KHPF 2B43A 3D0IE 2UUBJ 4LFCF 3MM5B 2H4YB 5ETMA 2RH3A 3J7ZT 2KJVA 4DV7F 5DQGA 2QLBB 1N54B 4EBEA 3PNIA 2DRDA 2ZHBA 1PG5B 1VRTB 3MD1A 3SEOA 2W9AA 4O44A 3QSYB 2J9DA 1UKUA 2ZH9A 3VAJA 5KFDA 2PMHA 1B7YB 1FRMA 4KYZA 4DL4A 2WVDA 4OX9J 5LJ5Y 3IA0A 4YFUA 1NPKA 2Z2LA 4PUOB 1NHUA 5L38A 3BGFA 4PEOA 3J81U 2KTQA 3OFFA 4JI3J 2CZVC 4Y2AA 2G4BA 5I4MA 1UMJA 1TFYA 4TU7A 4I7FA 2UXCJ 2CQIA 2KFNA 4PXDA 1NZ8A 5HVFA 2L9NA 3BGRB 1N4LA 4OZJA 2R2RA 1JJCB 1VFJA 1JLEA 3DLKA 3AA8A 2C2RA 1HW9A 5T7LA 1LW0A 3VWSA 1IKXB 1QLNA 1FE4A 2RKIB 4KHPJ 3PYFA 3QAEA 4K7QA 4WZQA 2XMWA 3IWXA 4LFCJ 1SB6A 1C4CA 4B3SF 4V19X 4DV7J 3W9JA 3PYDA 2OKQA 4KPYA 2CJAA 4PXEA 3EM1A 2ZJRQ 1FFWB 4ZK7M 5L1IA 3RRGA 1T9YA 2J8SA 1N5TA 4FKYA 1RACB 1GEHA 3QIPA 2BE7D 2F8MA 2RQKA 3OL7A 2MXYA 2HG4A 2F5GA 2OUGA 2DK2A 4NMXA 1BQMB 1TR0A 5A8RB 2XULA 1FFGB 2AV5A 4K0KF 3W5YA 5A2QU 4JI1J 4QW8A 3BSNA 3NGRA 2IRUA 3DRXA 1QDUB 1SQGA 1VQNS 1D3WA 1XMOF 2Z0GA 8AT1B 1WHYA 3A4TA 2KDOA 3MR6A 2MLYA 3KLFB 1RBLA 4B9SA 2HQIA 3TYTA 3MGJA 1C2PA 5GAEI 1HW8A 1CS4B 4WBFA 1NH7A 5HATA 2R9LA 1Y5IB 5KFAA 1QUPA 2IHR1 1TAQA 1WELA 3CGIA 1W2IA 2QJ3A 1KLMB 2X3DA 4B3SJ 4N8NA 1B0PA 5KFLA 3B4MA 1YBTA 1KFDA 3JQJA 3LGNA 4NX9A 2X3GA 1FEEA 3OJUA 4C11A 4LFAF 2J9DE 2V2QA 2BOPA 3NNAA 2GVDB 1PYTA 3FEZA 1HYSB 3UD3P 3AQPA 4OI1A 2CPXA 1DQ8A 2JFDA 4K0KJ 1LWFA 2YQ1A 4I0WA 2HQGA 2KVQE 3HLUA 3IR7B 1YJ7A 3T1HF 4U7CA 4FP9A 2MQOA 5D8HB 1XMOJ 1SIZA 4WJBA 4CM2A 3VGSA 2C2MB 2AQ4A 3KJFB 4C0HA 1NJIT 2QFIA 1XR7A 2GJ2A 1WKJA 3W2WB 2OJ3A 3AQOA 4IOAQ 4QOTA 3MEKA 3U1NA 3TR5A 1Y10A 1EQ0A 2K7JA 1KRPA 2W9CA 2R7WA 1WOSA 3HI9A 2XMTA 1NKCA 1V3SA 2P9GA 3ONQA 1RJJA 4LF6F 4RX6A 5HROB 4K2XA 3I4HX 2GQ2A 3GV8B 2R7SA 2AMCB 3UDEA 2IPOB 1IBCB 2HZCA 1TL4A 3VZIA 4LFAJ 2YBVA 4Y6IA 3I9ZA 3TA2A 3GJTB 1NKBA 1FNXH 4DSEA 1WG1A 4U67Q 3TQEA 2YQ0A 4ALZA 2UU9F 5C2CA 3DLHA 2RQ4A 2FJAB 1NHVA 1S6PB 1AUDA 3T1HJ 3N4WA 3NCRA 3PHTA 3MZIA 2HBQB 4IKAA 2JEGA 1UFWA 2PMZD 2ZH2A 5J1EA 1QAYA 1RAHB 5HJXA 3MEGA 4CTAB 4EEYA 1HFEL 1SKWA 2MKIA 3G8TA 4R5PA 3CTRA 2XMAA 2F9JA 4UZBA 2ZDOA 1PKUA 6AT1B 2YNHB 1HHTP 3M8WA 4DDFA 4LSNB 4O3SA 1KQKA 2FJXA 4RW9A 4A8QA 2JC1A 1ZAWA 4Y2KA 1RWKB 4LUBA 1NK9A 5HMYA 3KK2A 4LF6J 2DNLA 2C2KB 2Y9HA 2I0XA 1FDNA 3G71S 4PG6A 2UVVA 1F2HA 3AD7C 2J0SD 1WI6A 1O5JA 1IKWB 4CNYA 4AXJA 5IS2A 1X5PA 3A8JA 4TLRA 4JI8F 4DS5A 2DD8S 3PDNA 4WFXA 3M32B 2R2TA 4WU3A 1EIYB 5HI7A 2UU9J 5HK4A 2BKOA 3MMCB 1C4AA 2GGPA 4ECTA 3DN9A 4NCAA 2V4JA 3SDEA 1FJ7A 4FF1A 1BMQB 4FPRA 2XZTB 3OQ2A 4OFZA 3M1VB 1MU2B 3MM9A 2DB1A 4L3KA 3RB0A 2DGSA 2J0QD 5B08A 5GADI 4F50A 2CNNB 2CZ4A 2DHSA 5DLFA 3Q8QB 4NLYA 2IRXA 4NRUA 5IT9Y 2DR5A 3U27A 4BC7A 1KONA 2J8AA 2HS0A 4EGLA 2DRBA 3I6PA 2BANA 4IG3B 3G82B 2ACYA 7FD1A 2I5JB 2VPZB 1G3OA 1VQSA 1MROA 1WOPA 1VS3A 1JLGA 5ETKA 4K50A 1RP5A 2KG1A 4JI8J 3PFEA 4PG5A 5A8KA 3GONA 3PEHA 2GZOA 1N32F 5GADU 4KO0B 3V6KA 3D5MA 2FHOB 3EZUA 4OX6A 1T3OA 4IH6A 4L72B 2AYMA 2BJDA 5LSRA 3ZZRA 3MEDA 1WUUA 5JVGQ 2EXUA 1ZZFA 1PJ7A 3KLEA 1XK8A 4DFMA 1FX2A 2DXEA 3AJDA 2ZHOA 1SJ3P 4CQ1A 1DLOB 3OBIA 8RUCA 3QJLA 4JI5F 1YJWS 1R3NA 2LQ9A 1HLWA 4CO1A 3DRPB 1CSJA 3DYAA 1SH2A 4DSJA 1N5YA 3HHLB 4OYIA 2C2EA 4H4MB 2XMUA 4RU2A 1LWCB 3R5AA 3V6HA 1JLAB 4RKUC 2R7VA 2OMOA 1CG2A 2B9WA 1RTHB 2LVWA 5KFVA 1N88A 3DM2B 3TX0A 2JLGA 2EFGA 1GMUA 1X4DA 4N7TA 5KFJA 2Q1LA 2PDAA 1VQ4S 4NPOA 2DR9A 2O67A 4QPTA 2KI2A 2FIUA 2PD1A 2HFOA 1RAIB 3U02A 3K5NA 4NL5A 4MKBA 4BHQA 1N32J 2CQ4A 3TJ9A 1F60B 4BWJA 2MLZA 2VJUA 3GYGA 1SKSA 3C6TB 1XTZA 2K3IA 1DHMA 2RT3A 4F7VA 3AH6A 2AKWB 4Q8EA 4KV8A 2WK4A 4C8LA 3POTB 1R27B 2PI4A 4UOHA 4OYPA 2Y8YA 3WIUA 3DOKA 3LP2B 2ZDPA 3DCAA 2EFPA 3JB9k 1X4EA 3O6QA 4RR5A 5HO4A 4DQQA 1AYEA 4JI5J 3I31A 4RBUA 2FTRA 5IV4A 4ED6A 4ELVA 1HR0F 5E0OA 3D1QA 4MFBB 6FD1A 5GAHU 1SI9A 4DUTA 2IJFA 2ZC4A 4PZVA 3RBEA 3LALA 2GC8A 3J7YU 2M70A 3EJMA 3RGIA 2DTJA 3GJQB 4FBTA 2BM0A 1VOMA 5D4OA 2FZCB 1WC0A 3FZ2A 1IBKF 2RQCA 3PZPA 1R8HA 1RXOB 3SYZA 3M8SA 4LF5F 1FXLA 2XO6A 4F02A 4ZVQB 2GVZB 4FVCA 2VASA 2AW0A 2GQQA 1DJ0A 5KFBA 3CCVS 2JJ4D 2BDPA 2YPYA 1S49A 1TELA 4CH7A 1RTJA 3BBCA 2B0GA 1IR1A 3C3LA 3HKWA 3OT9A 5ETSA 4P2XA 2PIIA 3AD9C 3V4IA 3CDAA 1SJFA 1F1BB 3KUGA 3BF4A 2RDDA 3CCTA 2GX8A 2YWKA 3MECB 3LUYA 3JAMU 2CQPA 1N48A 1DTQA 3P45B 1N52B 2QSFA 5E3AA 4MTPA 4XIUA 2FVPA 2CWKA 5F0UA 3JXOA 3M4XA 4FYVB 5AT1B 8ATCB 4G1PA 4PQAA 1LWEB 1HR0J 1WEYA 2HHPA 4ZP7A 3KK1B 3IR5B 2LEBA 2LMIA 5DGAA 3HK2A 1DTTB 2DGQA 3CVKA 1FDAA 1U6FA 1RAEB 2AF6A 1C1BB 1EETA 3CXCR 1S48A 1S7IA 3L9ZA 4KHRA 2OPQA 5E41A 3GWCA 3F73A 2ZH8A 4OIXA 5DDQC 4HH1A 5CABA 1CC7A 4AQYF 4ZPCA 1UZDA 1IBKJ 5KOWA 1O8BA 5KG5A 1XWLA 1G6BA 4Q5VA 5H9FJ 3RW6A 1T03A 3FBFA 4LF5J 4M63A 1VHIA 2KH9A 1F5CA 2IJRA 2Z8QA 2MKHA 4OL8A 3D6MB 1OY8A 4DS4A 2YKOA 2N7YA 2VG7A 2V8HA 2PN6A 1J5OA 1ACMB 2PA8D 1D9DA 4CLKA 2KT2A 2IBOA 1VC5A 1J5EF 1YKWA 1NSQA 1F9FA 3D6HB 4CNZA 4UOCA 1OQ6A 4ZLLA 2MY8A 1QE1A 3H40A 2IFXA 3KUEA 4YB7A 2DO0A 3VGVA 3PO5A 2IYIA 3FRYA 2QYCA 3GSIA 2QFJA 2HMIA 4DUZF 4Y3CA 4P2FA 1UWBA 4U95A 1CC8A 4I2QB 1FVSA 4FF3A 1RLDA 3IFEA 2ZBCA 1FESA 4LF7F 2HVIA 3RUBL 2ZHAA 3UN5A 1HARA 1XMBA 4GC6A 1RWPB 3PTWA 4MIBA 1RKJA 5IT4A 4AQYJ 2CPEA 1KVJA 1RT5A 1F3FA 3IG1A 3HMJG 3GIJA 4NOHA 3M2VB 4LRAA 2DR7A 3HVTB 3TNVA 4DHVA 5MLCV 2X1FA 3G87A 3CNQP 1S0MA 4KFBA 1FERA 3RR7A 2P6SA 2C3OA 3SSQA 1G7CB 2E7WA 3IBFB 4KGZB 1B3TA 1T9WA 2G0JA 3M2UB 2MZ1A 1U45A 3TO8A 3AJ1A 1EAYC 3DOLB 4YY3F 2XI2A 1HNIB 5J1PA 2AD9A 1FK9B 3MMAB 2CQDA 4DUZJ 1RTIB 5D0HA 2OI2A 5K9FA 3LPEA 2ZVIA 1U1KA 2EFNA 2YWWA 2FHJD 3VHQA 4LF7J 1NKEA 4URSA 2Y0BB 2CVEA 4WKRA 1AZSA 4RNHA 3KLVA 1RISA 3OTBA 3MTJA 4YB1P 3V81B 1W26A 1Q7LB 2DH8A 2B6AA 3BH7B 1RT6A 4ZA1A 4H54A 2DVIA 2LKZA 2CPJA 4H4OB 1U1OA 3SCLE 3RZAA 1MWZA 3RW7A 3QO9B 5KOXA 2DR8A 3N6NA 2MY7A 1ZM9A 2DGXA 5DDOC 3D2WA 3ZTOA 3V6DA 1FEHA 4ZMMA 3C66A 4DQSA 3D6FB 4DMZA 2H4WB 1HQEB 4EYIB 4TU9A 3DOMB 3KLHB 3DRSB 4B17A 5D4NA 4O4GB 2G0CA 2W24A 5C25A 2FHJA 1YIJS 3GYNA 2E5JA 1GK8A 5ITHA 2RJZA 3QJPA 3J81Y 1X9MA 1S72S 1CJTA 1VBYA 2XZDB 2MGZA 3ILLA 3THPA 3I0SB 1W7WA 4USJC 3B78A 1S6QA 1CEZA 3NMAA 1VISA 3QPIA 1UJ6A 4DPWA 1HBMA 4J9QA 1M90T 1RUSA 2WW4A 2MJNA 2YX1A 3I9V9 3OFGA 2K1RA 1K1SA 3J80U 5C2GA 2XWYA 3E8OA 4P9SA 3R6LB 2JZ5A 4QU7A 2VHGA 4FNHA 1K0TA 2KT3A 4P7VA 2MKSA 2N3OA 3D0HE 4S0MA 1KP6A 2HIYA 1TL3A 7FDRA 2MKKA 2BXJA 4PG4A 3ETMA 1BE4A 2DKOB 4DL7A 2VB6A 1S7HA 4M94A 2UUCF 5K20B 3HVWA 3MM6A 4DN9A 4JI7F 1DARA 4X4NA 2XBPA 1X9SA 4LRBA 2EVZA 3VGUA 3DGPB 4ZN1A 2MHEA 3CCJS 5A2QY 2BQ3A 4NYZA 1KTQA 1LK5A 4CLUA 3GCXP 5KFRA 2IMWP 1WJ9A 4TQSA 2PO4A 5D6GA 2FC9A 3HD2A 1FXDA 3BSAA 3MCSA 2C3YA 1PSDA 3JTNA 4MK7A 4C0BA 2D41A 4CH0S 1Y7PA 4PKDB 4O44B 2KXNB 2NYHA 2U2FA 4X65F 1HPZA 2AJ1A 2A0FB 1URRA 4XAKA 2BABA 1N5VA 4PAAA 5HP1A 2VKRA 3W8PA 3RR8A 4OJ1A 3ET6A 2HBYB 1LV5A 1SVDA 3TW0A 4E0DA 3Q23A 4B9LA 4EO8A 3ENVA 4USTA 2I9SA 2AGQA 4KC5A 3D4JA 2UUCJ 4I7FB 1UFLA 1ZAVA 2MMYA 4JI7J 3T9NA 1N6QA 4CIOA 3CULA 3OR2B 2MSTA 1JX4A 3L4BC 1JLEB 3NGUA 3DLKB 5T7LB 4ECWA 4RBVA 4OHZA 5E2QA 3K7RA 1JWWA 1HMVB 4F4WA 4ZVEA 2IBKA 3NGTA 4TY9A 4NCGB 2RRAA 5FIIA 3TAMA 2N82B 2W8KA 3MM7A 1RABB 1PO6A 1VRUA 3MUMP 4X4PA 1ELOA 1Q78A 3V2UC 2O5DA 2VFVA 4X65J 3D68A 3KHGA 3BN7A 3CCUS 3QSIA 4KBIA 2OFGX 5KT3A 1L3SA 1RU2A 5U47A 1T95A 1RAOA 7AT1B 3C8YA 1S59A 4RNNA 1RQ0A 3NRBA 3ZZTA 2O66A 4UY8T 3K0JA 3BYRA 4FXDA 4I6AA 4W4MA 4FYYB 1IWAA 3I0RA 2DNHA 4OZ0A 1YRUA 1Q8IA 4CLLA 4A8YA 1RK8A 2F65A 2ZWPA 3TJAA 2RUSA 1UJ4A 1JLBA 2BA9A 4ZPBA 4B9VA 3C16A 1GQEA 2W8LA 2GAGC 2MZSA 2VICA 3M9MB 1JJ2R 2VBZA 1FVQA 2DNRA 3FJ2A 5IQ6A 2V50A 1LXNA 3T3FA 3X1LB 2HQCA 1DY3A 3E01B 3FFIA 2FJDB 1RKIA 5DS7A 3GFXA 3S01A 2XB2D 3ZFVA 2OPPA 5CH7B 2OMLA 1S1TB 2BBEA 1V5VA 3WBZA 1VQMS 5H9EJ 1U25A 4WTYA 2CDQA 5A6PA 3K8WA 4NLQA 1Y0HA 4C11B 4OZ3A 1SC6A 4PWDB 5J2MA 1HNWF 4NLGA 1D8ZA 2AYGA 3HSJA 3FEYB 1LWFB 3MWBA 2UZAA 3SFGA 4QYRA 3A8EA 1JKHB 4CM0A 4ZIVA 1NNDA 3UN3A 3MI7X 2CQ3A 3HM9A 2AGOA 2E5GA 1ZM2A 2WTFA 5CCMA 2C28A 3HT3A 1TKTA 2EPIA 3T5KA 3QFWA 4DX5A 2JRSA 1ROFA 2XLKA 5B0AA 1VJWA 1OY9A 4RW8B 4IFYA 1ICEB 3Q0AA 4I2PA 3TP2A 4P52A 3RRKA 4C0OC 2LU2A 3TZWA 5LJ3Y 2W9CB 2KFYA 4BLGA 1U1QA 3AJ2A 1RWUA 2RRBA 5CYJA 2BW7A 4NASA 5E33A 4LBIA 4CH1A 2LYVA 3VAGA 2NXUA 3PW7A 3MD3A 4FXWA 5AXLA 3IXQA 5H1SV 1HQ2A 3D1OA 1M5PC 2ZFHA 4F4YA 3OTOF 1P9QC 1JJHA 2VPWB 4OHXA 1VQ6S 3Q86A 1HBNA 3VAKA 1MN7A 1G1XA 4IDKB 1CJKA 3R3TA 2HHTA 1KLNA 3K5OA 5I3QA 4TQRA 4KRWA 2VV5A 3R7BB 4C4WA 2QL5B 5J1EB 5LSOA 3BSCA 4ERDA 3MEGB 1TVRB 1U47A 2I8EA 1T11A 5ETTA 2VDIA 5DDRC 3MFIA 2QA4S 4R5PB 2W1BA 4TXSA 3D7SB 4PWUA 1YJNS 2XM3A 1U26A 4HR2A 4MAKA 3LP0B 4LR7A 2M3DA 1U6BA 1R8AA 2LQJA 2CKWA 2X1AA 4RW9B 2ZNYA 3D3BJ 2CPHA 2YKAA 5DZ6A 2Z2YB 3KK2B 2QRRA 3VCDA 3SFUA 3MDFA 2EWHA 3AOBA 5LMNF 4GVBA 2OGUA 3QLHB 1RYRA 2HW3A 2QLWA 1PCAA 3DHXA 1X9WA 2IM2A 2D69A 4USHA 3NGKA 3OTOJ 2NYIA 1SQEA 3JYTA 2MEWA 3SMZA 2GGPB 2GW8A 4K4ZA 2AJ2A 1BWEA 4QJVA 1YWXA 2JFKA 3T41A 3SDEB 4GKJF 1RWWB 3FSXA 2EFOA 2HVDA 1U0HA 4DR3F 1OWXA 2X7IA 3DRYA 1AB8A 4Z7CA 1NK7A 2F9DA 3FZBA 3MM9B 2ILZA 3EVWA 4DR1F 3US5A 1EP4B 3CJRA 3TUZC 4C8NA 4ES2A 1OS5A 1VQYA 2CPFA 1HI8A 4B3OA 2LEPA 3EZ5A 4DBQA 2W4CA 2BOAA 3AB4B 1REVA 3O3LA 1YJUA 5HLFB 1HI0P 3R2CJ 3S8SA 5L39A 5FDLB 2RVJA 2D9OA 2BANB 4HVZA 4EK2A 1S12A 3AHPA 2FB0A 3VV2B 5LMNJ 2G13A 5KFIA 2HRTA 2KB2A 1O6XA 1NU4A 1JLGB 2B4UA 1F6TA 2HFZA 2WHOA 1YLXA 2E7XA 3CT9A 1LNQA 2CAJA 3DDNA 4ZHRA 4WYWA 1QY7A 5A8KB 1X5TA 1U48A 4RW7B 1U0SA 4CO5A 4OX7A 4HT5A 4RO0A 3RYLA 4F3OA 2XYPB 1ZETA 1CULA 2VG5A 1UVIA 4HI2A 3PX6A 3IGNA 4YR2A 1KNZA 2DH9A 3MEDB 4WFNQ 4GKJJ 3F44A 2VQFF 4LIWA 3ZC4A 2QC3A 5JXSA 3KLEB 1UPPA 2NLWA 2RS8A 4DR3J 2CJQA 3M8ZA 4DUYF 4HTIA 3I5BA 2W2PP 2E1CA 4NEYA 4AL6A 4F0HA 4K4TA 4DR1J 1TV6A 3N0VA 1R8BA 1H0HB 2YNIB 4NI2A 2F4FA 4DR5F 3DYAB 4ECZA 1N5YB 1IJEB 4KR0B 2CFXA 1PYOB 2PEHA 4K59A 2P9EA 1KTVA 2KZMA 1X0FA 2UUAF 4RW6A 3WDOA 3JAMY 3NGDA 3TEGA 3PIPQ 4GO5X 4ZJOA 3TUPA 1Z4UA 1VGYA 3W2VB 2B7BB 3JQKA 3KLIA 2HK3A 2BRKA 4KHMA 1S57A 3FK4A 3QRQA 4OZ1A 2G1HA 1RWVB 1YGYA 2EI5A 5DGBA 1QM9A 4J5OA 4EZ9A 3M30A 3NS7B 4NLWA 1XIQA 3M8PA 2ZE2B 1I1GA 3F56A 4K4SA 1FRJA 2WVFA 3VAIA 2R7TA 4IO1A 2VQFJ 3JSRA 3EZOA 3DRRB 4XTTA 2XWXA 4DUYJ 4TY8A 3DOKB 1TL7A 2OP5A 1P1TA 1H98A 4NXNF 2XMJA 1AT1B 2RSQA 4ZPTR 5F9LA 4IH7A 3KFWX 4OYZA 5H9FK 3CDEA 1WD6A 3IMQJ 4OV6A 4LJMA 2BEFA 5KFNA 3OFEA 4Y65A 4DR5J 9RUBA 3NOCA 1K8AT 3AODA 1M5VC 2FZKB 4DSLA 1HQUA 1Q53A 2YQ3A 2UUAJ 4J37A 3IS9B 2IAJB 4MK8A 4F2SA 3LH2S 2ASYA 2NS1B 5BXIA 3MR3A 1KN6A 1NSAA 3KJVA 3PRBA 5J2NA 4FS1A 2FVQA 3CCZA 1R7IA 1WC4A 3HD1A 3ISZA 1MNEA 4E2FB 4J9VA 1VI7A 3R5DA 4DJBA 2LEAA 2IM1A 1GXTA 4WIQA 2NZ4A 4MMOA 4W92B 2ALZA 1UCNA 1GT8A 2W9BA 2VA2A 4C8KA 4YB5A 4RU9A 3L3CA 3V4IB 3SQGB 3LW5C 2CJ9A 4A48A 2UXDF 3UCUP 3MAAA 1NJXA 1DTQB 4U9RA 2ZM6F 1LKZA 4W90B 1DQ9A 2GV1A 2Q3PA 3LAKA 3MPUB 2KHDA 2GMJA 1QAXA 1VLYA 1FRXA 5KFMA 4YHHF 1O51A 1VDHA 2FQQB 2A6MA 3RU0A 3C46A 1KWMA 2RHSB 2V63A 4PWWA 2FC8A 1KS2A 2R7UA 3N28A 4IO9Q 4WP3A 1S5ZA 3CDUA 2B9EA 2WONA 1S6UA 1YG0A 4P10A 1Q86T 1QAIA 1YRTA 1N34F 1EZZB 3OL8A 2V94A 3GJSB 5KFGA 4CO3A 5D0RA 2P5VA 4MKAA 2RDIA 3KNGA 1JLFA 4QPXA 3PW4A 1OYDA 2H1YA 1J5OB 1T9VA 4OV1A 1RWOB 3BO2A 1HWJA 1JLQA 1X60A 1QE1B 3NGSA 5C42A 1B7FA 2UXDJ 2LCWA 2F1FA 2ZM6J 5HBMB 5HSPA 2RE1A 2BYCA 5CYQA 3KDOA 4ZN3A 5E5NA 2FJBB 3OFHA 1FD2A 1B0VA 1UWBB 3EPIA 3QGIA 4YR0A 3OTEA 4I56A 5KFSA 3CCMS 1C0UA 2L08A 3V5RA 3AD8C 4DOZA 4Z2XA 3NKYA 1UVLA 1RE1B 4NEZA 4CLZA 1KC8T 4QIGA 1U2RA 4ZPDA 3D9BA 1GTEA 3DNCA 3QWUA 2C3MA 1MWYA 1FXRA 1NEEA 3GV7B 3E2EA 3R6GB 1N34J 2OD6A 2IM3A 3CWJA 2EKNA 2F8HA 3MM5A 5D3GA 1ZBTA 3U7JA 1BXNA 3IG1B 2ZC3A 3K5LA 4RUCA 2WRMA 2SXLA 5CD4H 4WXWA 2B4OA 1VRTA 3PG9A 4M5KA 3IM8A 3HX9A 4WFBQ 2H5EA 5DG7A 3B4DA 5F8GA 1RAFB 2ZJQQ 3J80Y 3UD5A 4Y28C 2AEJA 5EGYA 1QTNB 3KK3A 3LQVA 3RB6A 2R7QA 4OLOA 5MAOA 3ADAC 3N9UC 1BHNA 4UOGA 2PA3A 2YH0A 2KXFA 5FD1A 4YN3B 1NUEA 2W7OA 4BDPA 3IC1A 4ZDNA 2MQ8A 2HS3A 1NK5A 2CPIA 1AZSB 1X4HA 4K2JA 3HXMA 2ROEA 2AP6A 4JI4F 1WI8A 1VRQC 4KKOA 3MPWA 4QWCA 2WBMA 1FWLA 5E3RA 4AYBD 1RT6B 3ILJA 3DLGB 3K17A 1X4AA 3BKUA 1TK0A 3P49B 4LFBF 3QIDA 4DSIA 1AFIA 1XN9A 2YXLA 4OHVA 2RUGA 1KVIA 3N5FA 4C3KA 3V6DB 2HNDA 1TMMA 2ZD1B 2DNQA 2W7PA 4HYKA 4L73A 3L09A 2B5JA 1EB0A 4A8XA 1WF1A 3PKMA 3H5UA 3M6XA 4ED7A 5A8RA 5LXYA 3L7OA 1RAGB 2WB4A 3CC4S 2ERRA 1IBLF 5IT0A 2C2DA 1UEVA 3ZNJ1 2W4DA 4O4RA 5C25B 1FD8A 2RF2A 2JNJA 3NOGA 4UZCA 1RAJA 3GV5B 5BYQA 3H4DA 2C42A 1L3VA 1WWHA 4C7QA 2XCPA 1ZTWA 3BQ2A 4EMDA 5A6WA 4ZCIA 4ILRA 3AB2B 3IN5A 2GIRA 2D74B 1S6QB 2V8VA 3BV8A 2Q43A 3RTVA 4JI4J 2M0GB 3MMJA 4ID5B 2PMWA 4DR4F 2NR0A 3NS5A 4JBCA 2K1RB 3MAQA 4N56A 4WPAA 1FRKA 4IRCA 1VBZA 3I5CA 2W4PA 4LFBJ 4WIIA 4LF8F 2D7SA 5KFPA 1WDDA 2DNKA 3PRVA 3PM9A 4JI3F 3EVOA 2ZOGA 4DG1B 1K73T 1TL3B 4F25A 3BO4A 3QFHA 5J2PA 5C5JA 4ZVSB 2XO7A 4N77A 4ED8A 2A3JA 4ZP9A 4PCQA 1HNVB 1WSRA 3GSDA 1IBLJ 4USWA 2LECA 2A6OA 1UPMB 1NSPA 2Q6CA 2NQPA 3M05A 1IUJA 4Y0FA 1LK7A 1ZYQA 4J9UE 5GVQA 1PAEX 2PE8A 4JOUA 4U7UD 3HSDA 2YWHA 2D3UA 4KT0C 5D77A 2E5HA 3UNYA 5F8LA 3RBXA 2DH7A 2HWIA 2ACMA 1KR4A 3TARA 3W2WA 5LM7E 1YJ9S 4LBHA 3SZ2A 4DR4J 2VDHA 1IWGA 1HPZB 3CEDA 3H20A 3NMRA 4FKXA 1FKPA 3Q8RB 2Y1LB 1X5OA 4IRDA 3EGNA 5HP1B 2VOOA 3QRPA 4DL5A 2YNGA 1HBOB 3TZXA 1NJWA 1VC6A 4LF8J 2HGNA 2VFUA 4CLTA 1PYSB 2XY7A 4JI1F 3T6BA 2XG8A 4DXLA 4ZCMA 4J90A 5B0DA 4ZP8A 2AX1A 3WIVA 1WEZA 2HK2A 3MMBA 1UW4A 1M5OC 3NL0A 1NXIA 4AXIA 1Y00A 5KG4A 4EUVA 5L1LA 4ECYA 1ITPA 1N6QB 2NXNA 3GTYX 3AFGA 3DI6B 4YQWA 2B4PA 4ZP6A 1K44A 2CNOB 2Q79A 2EC2A 1S6PA 1RGVA 4CLYA 3V6JA 2W2NP 1VQ7S 1TAUA 1RHQB 3PEJA 3WHIA 2AJQA 4DWIA 4RW4A 3AXMA 4N47A 1RTZA 3S1TA 5G0RA 1FRHA 3W7BA 1B70B 2UV8G 3MM7B 4CO0A 4ICLA 1EHWA 4X2BA 1VQ5S 1VRUB 2QT7A 4ZPWR 2Y0SD 2EK6A 2CZ9A 3FVYA 3QAUA 2CNLB 3ZXWA 4DFPA 4YOEA 2H5IB 4ETXA 5ADZA 4B9NA 2CPDA 4IOCQ 2QMXA 3TX8A 1UW9A 5F8NA 3K8VA 2QYGA 4FN5A 1MLAA 1B64A 2QA1A 3I0RB 3CMAS 4CLFA 2NREA 3NLCA 5F9NA 3TANA 3FNNA 2MLXA 3DGVA 1IXKA 2FYXA 2BQRA 2IDEA 4J7CA 4LRDA 3CJ3A 5KFOA 3CCQS 2GS8A 4PQUA 3CW2C 5IM0A 4X4VA 2BJ8A 3M32A 4B3RF 5ETVA 3GIIA 1P6TA 1JLBB 3UN2A 1H72C 3OSPA 3D3CJ 2DJWA 2VPYB 5IWAF 4BC9A 1S1UA 1S6OA 1K0VA 4AT1B 5HQ8A 2X51A 2YWGA 2DGVA 2LDYA 3FFIB 1R89A 2OPPB 2PT0A 5F8IA 3M1VA 1MU2A 4K4YA 3QGPA 4ZVTB 1UEKA 5D15A 3LP1B 4CLSA 2KZZA 3NBPA 2RAQA 4FXVA 3LGMA 4ED1A 2QLFB 5ETPA 1R6VA 3K57A 1I51B 5GAEU 2G2ZA 2VFRA 1BQNB 2M2BA 4NLTA 3DU6A 4AUKA 4J9KA 1N56A 2JEIA 3FSIA 5GAGI 5K14A 3QT6A 5CA5A 3DLEA 2YNFA 3BR9A 4IG3A 5HQLA 3G82A 1DAXA 3BDPA 4MKVA 3KHHA 4ES1A 1SBRA 5A0YB 1SQFA 1U09A 1R43A 2KVIA 3R97A 2V9WA 4LF9F 3BGUA 1LFPA 5LMUF 2R8IA 4XPEA 2MKCA 2J9CA 4JV0A 2YX4A 4B3RJ 2OPRB 2G2YA 2KN4A 2ZBQA 4F2RA 1XJWB 3AOCA 2DNNA 2DT9A 2VKZG 5K8MA 1IR0A 1TKTB 3Q24A 5EWFA 5IWAJ 5KFWA 2HFVA 4USIA 4NA3A 2RD5C 2HNZA 1VIXA 4URGA 4ENOA 5DQIA 3SI8A 1RWXB 3A3PB 4I4BA 3DFEA 3BKFA 2FY8A 3KHLA 3BREA 2I38A 4HACB 3H2LA 3M2RA 2KM8B 1GTHA 3CJSA 2GQCA 2UUWA 5DJBA 3IAS9 3R27A 4OI2A 1QAJA 1IJFB 2DHGA 3DRPA 2MPUA 1KKHA 2JLFA 1WG5A 4WXOA 4KQZA 2DY9A 1FO1A 2MYFA 2GNKA 3H4BA 1JLAA 1HKAA 3EE3A 4ELUA 1BY9A 2NXCA 3THTA 4C6AA 5CYMA 2GFFA 5CZVA 2CXEA 1APSA 1D0EA 2CJKA 2CA9A 1CJUA 3FEXB 3JSMA 2FHMA 1RTHA 3QT8A 3BDEA 2IC3B 2QSWA 1TL5A 4IUFA 4LF1A 2R2SA 1IN0A 1J2VA 2W2OP 5EWGA 1P9YA 4TVAB 4NCBA 2YKPA 4F4AA 4RPFA 5F3TA 2PFDA 4LF9J 5LMUJ 2E1MC 2QIFA 4CLPA 4HH0A
chains in the Genus database with same CATH topology
2C3PA 4UY8T 4Q44A 4WE1B 2Y1IA 3K0JA 4A8KA 4FXDA 2E29A 3IBWA 4I6AA 1KQSR 4OJ3A 2WW8A 4C98A 1U6ZA 5HBMA 4QR1A 5I3PA 3KMQA 5KAKA 3SCIE 3I0RA 2DNHA 2FGCA 5E7OB 2IVYA 4OJGA 1Z2ZA 4OZ0A 4B08A 1YRUA 1Q8IA 4E8UA 3F41A 2L41A 4M5DA 2KHCA 4RWXA 4O3PA 2EK1A 2ZBIA 3MM8A 1KD1T 3G86A 4A8YA 2DHXA 5C24A 3POTA 2EFQA 1DZ5A 1RK8A 2Z4PA 1IKYB 1M5KC 1Y9OA 2EG1A 3R1LA 1WTFA 4I6YA 4OX9F 3LOUA 4DFJA 3PO4A 1GH8A 1S9FA 3O5TB 1FRLA 1UJ4A 1JLBA 2BA9A 2EBGA 4UQGA 4ZPBA 4B9VA 2XY5A 1GQEA 2W8LA 2MZSA 1TKDA 3M9MB 1JJ2R 2VBZA 3CD0A 2DNMA 4JI6F 3C6UB 2WB1D 1YRXA 1RT4A 4RWWA 4G1QB 5CYQB 1RTDB 1FVQA 4N5SA 3OR1B 2DNRA 3FJ2A 2YKNB 1HNXF 2YWEA 4WKYA 3BQ1A 1D8YA 5IQ6A 3NG8A 2V2KA 4MIWA 4EWTA 1LXNA 3T3FA 4KV8B 3X1LB 4RNFA 4A8FA 1FCAA 3MF5A 1QSYA 3E01B 3OXGA 3FFIA 1S0OA 3TI0A 2UXCF 2FJDB 1RKIA 3GIKA 5DS7A 5CQGA 3GFXA 3S01A 1VQKS 2XB2D 4Q8FA 3ZFVA 2OPPA 5CH7B 2XHWA 1C0UB 2ZITA 2OMLA 3ISND 3SSRA 3DGPA 4G3IA 4F8RA 1QVFR 1S1TB 2BBEA 3EGWB 2AYBA 3OV7A 2RDJA 2MZJA 2CQGA 3WBZA 2F8EX 3H5YA 4ELTA 4DV5F 2KRBA 2EC0A 2HRYA 1VQMS 4WFAQ 5DRKA 5H9EJ 2VA3A 2BACA 4WYLA 3KTQA 4ECQA 2DRAA 1UL3A 2BE2B 2XS5A 3JYTB 2ABYA 4ZKAA 2J6TA 3QMQA 2VG6B 1U25A 3QZ8A 3VAHA 4WTYA 2CDQA 1F5BA 5AXNA 4FZVA 5A6PA 4KHPF 3K8WA 2B43A 3D0IE 4NLQA 1Y0HA 4C11B 1LFWA 4NYOA 1SC6A 2J7KA 2IVMA 4PWDB 3GE9A 1XNRF 5AXKA 4J9RA 1E6YA 1FNOA 4DL2A 2HHVA 3HP6A 4IFVB 3KG0A 3HFKA 4LFCF 3DLJA 3MM5B 2DNYA 4OX8A 2IVFB 1M5HA 2AWZA 2RH3A 2KJVA 3J7ZT 5J2MA 4DV7F 3RBDA 5DQGA 1HNWF 4NLGA 1N54B 1D8ZA 4RLEA 3EYZA 4F4XA 4NMLA 4QWDA 2AYGA 4EBEA 2B9YA 3PNIA 2ZHBA 3I56S 2AX0A 3FEYB 4G6VB 1LWFB 1VRTB 1CLFA 3MD1A 3SEOA 3T6JA 2W9AA 4O44A 3MWBA 4PG7A 2J9DA 2HVHA 1AW0A 1UKUA 2UZAA 2ZH9A 3VAJA 1K1QA 3SFGA 4QYRA 4GC7A 2FLNA 1WNEA 5CHCB 5KFDA 2PMHA 2LQBA 3A8EA 4O23A 1JKHB 3HHNB 1NO8A 3MEEA 1FRMA 3O2IA 3ZZOA 3SSSA 1NNDA 3MI7X 2CQ3A 3HM9A 2AGOA 4ZPVR 1RT1A 4O3OA 4DL4A