4TNOA

Hypothetical protein pf1117 from pyrococcus furiosus: structure solved by sulfur-sad using swiss light source data
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
84
structure length
84
Chain Sequence
b'MYIVVVYDVGVERVNKVKKFLRMHLNWVQNSVFEGEVTLAEFERIKEGLKKIIDENSDSVIIYKLRSMPPRETLGIEKNPIEEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRISPR-associated endoribonuclease Cas2
publication title Fast native-SAD phasing for routine macromolecular structure determination.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 17
structure length 84
sequence length 84
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09827 CRISPR_Cas2 CRISPR associated protein Cas2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4tnoA01
4MYUA 4TNOA 4ES3A 4M1KA 3LH2S 3ZZ0A 3B82A 1U2RA 2EFGA 4ZCLA 1VI7A 1ELOA 1KTVA 4MAKA 2KDOA 4MYTA 2XEXA 3OQ2A 2IVYA 1N0VC 2I0XA 3B8HA 3ZZUA 5G4DA 2BM0A 4ZCKA 2E1RA 2WBMA 4ES2A 4ES1A 1ZM9A 1T95A 2CVEA 3ZZTA 1P9QC 4ZCMA 1ZPWX 1DARA 4QR2A 3B78A 4FN5A 4QR1A 2I8EA 4QR0A 1ZM3A 3E3XA 4ZCIA 1ZM2A 2L9NA 2J7KA 3EXCX 1N0UA 1ZM4A 2BM1A 1FNMA 2BV3A 2ZITA 2NPFA 3UI3A
chains in the Genus database with same CATH superfamily
1U47A 3BN7A 2KH9A 2KJWA 2FY8A 1YRUA 2KM8B 1FJ7A 2I9SA 3EX7B 3HSDA 3MTKA 4DUYF 2BANA 5KFEA 2V9KA 4C11B 3D1QA 1PIEA 3KLHB 1F2GA 3KG4A 4WIIA 2K1RB 1HNWJ 2D69A 2MZRA 4N7TA 2C42A 3NOGA 2J9EA 3LGHA 4K59A 5G0RA 3MPVA 2AYEA 3BGRA 3PYFA 2J5AA 3PW2A 4ED0A 2J9DA 4PZVA 4PQUA 2MKIA 2AGOA 3KWMA 3K8VA 1RP5A 1NKCA 3A12A 3IM9A 2UVWA 4UQGA 5H9EK 1DZ5A 1TL7A 4RO0A 2XGQA 3HDSA 4I7FB 3MUVP 4CH0S 2MQQA 3SV3A 4PYAA 2XEXA 4EO6A 5I3PA 4J9MA 1NNDA 2DJWA 2RQKA 2H5JB 4NLGA 2GMHA 3DDKA 2XBPA 4JV5J 1H73A 4WF9Q 3BN4A 4LIRA 1VHIA 1HKAA 2CQ1A 1GXLA 1FRKA 2PEBA 2OTJS 3BBCA 3SDEA 2GQCA 1T05B 1JKHB 5J2MA 2QL7B 3IR6B 3AD8C 5GMEA 3ETMA 2IAJB 5L1KA 5D0HA 5J2PB 3VGSA 1T3NA 3KLGB 1JLBA 3LWLA 1PAEX 3H4BA 2HVDA 4BHQA 4ANEA 4X2BA 4NA1A 4NASA 3T9ZA 2J9DE 3M32A 3V5RA 3GU0A 3SXLA 4DV4F 3MECB 3D66A 4KHPF 3EXCX 4KHRA 2BXJA 4DPYA 2WVDA 4D3GA 4DPWA 4USWA 3HVAA 2LQ9A 2HHVA 2XGPA 2MZ1A 1RK8A 2DRBA 3FC9A 1CJVB 2KHDA 2FLLA 4WXOA 1CPZA 3DRRA 4PR6A 4LR9A 1U25A 3UD3P 4DV1J 2XYHB 2PMWA 2FHMA 1R8PA 4CIOA 1NB7A 1VQ5S 3OFFA 5KG3A 1PJ5A 4CI0B 3N6MA 1DFDA 5T41A 1EJ7L 1M5HA 4FXVA 2XS5A 1WKJA 4RW4A 3CO9A 3P6YC 2IC3B 1LK7A 1VMBA 1Y4ZB 1U6BA 3T5HA 2XNQA 3I4HX 4OJGA 3CPWR 2WW8A 3LUYA 3Q8QB 4GKJJ 4UOFA 5GAHU 4LF8F 2BRLA 4C0BA 1VC5A 2OP5A 1XNRJ 3TQEA 2XCAA 4ED7A 2RDJA 4J9QA 2LKZA 5E3QA 1R6YA 2I6WA 3ADAC 1CLFA 1E6YB 3MFHA 3DRPB 4TY8A 1S9EA 3DRSB 2ZH2A 5IV4A 2R7UA 3G8SA 2RRAA 1P27B 3R7SB 3MPWA 5KFAA 4B3TJ 5T14A 1ZH5A 3IMQJ 2N7YA 4QR0A 3EZOA 3QIPA 1LWCB 2OELA 2BQRA 4J9RA 1S48A 3VGUA 4JB8B 3IR5B 2XY6A 1SUQA 1TL1A 3BSAA 1WHXA 4USTA 2IY5B 3HLUA 3ZZTA 4WPAA 4DUZF 3PY8A 5KOXA 1UFKA 2G2YA 2M3DA 2LXFA 1S6UA 4JUZA 1R43A 2I5JA 2MQMA 3UVJA 2HQ3A 2AZ3A 4YY3J 4LF1A 3HVWA 4CLPA 5LJ3Y 1S76D 1REGX 4HDHA 1VGYA 4DV5F 2GA7A 2BJ9A 3GR1A 3AD9C 2ZC3A 3NCQA 4EGLA 1URNA 4MJKA 3AB2B 3W9HA 4DX7A 3NXZA 1IKWA 2C2KB 3NCRA 4FF3A 1OQ6A 2ROPA 3GJQB 1RTDB 2DEJA 3HKWA 1D3WA 3DLHA 5F8JA 4ZJOA 2WHOA 5LMUJ 2DIUA 2WK4A 3QNWB 5K5MA 4EUVA 2AV5A 1RJJA 3BSNA 5GAHI 3KKFA 5JXSA 2HGNA 3R1HA 2ALZA 2BW7A 2GJ2A 4K4ZA 2OPRA 3FRYA 4X4RA 3AHPA 5KFLA 2WVBA 2EG1A 3KJFB 3A1YG 1HQUB 1PG5B 3IA0A 2NZ4A 2ZUGA 4HACA 2W9CB 1VRQC 1HBUB 2JEFA 4CCHA 4P7VA 1DLOB 3D67A 1SL1A 2Z57B 3M8PB 1ITPA 3C2PA 2O5DA 5D0GA 2YWFA 2ZHAA 1YKWA 3LANA 1JJ2R 2HNDA 1O0PA 2DHSA 4MK8A 2KXFA 4WTYA 3NMRA 3D2WA 5D4OA 1XIQA 2KU7A 1KFDA 2JLEA 2AEMA 1FWKA 1RTJB 2M7SA 3T1AA 2V69A 4O3RA 1LW2A 4DV2F 2Q79A 2I1RA 5B0GA 3PEJA 1LFPA 4NCBA 4QW9A 1NU4A 2HVZA 3T9NA 4K4SA 2HW3A 1IXKA 3R5AA 4IDKA 1DARA 1J5OB 2Y8YA 4LJMA 1H0HB 1WWHA 4I0WA 1NLKL 3DLEB 1VIOA 2B4UA 3HI9A 3UI3A 1N5VA 1T03B 4URQU 4HH1A 1WDDA 3PYGA 4NWBA 5I42B 4OHXA 2L9WA 4LSZB 1IUJA 1YX2A 3D0HE 5F8LA 3Q86A 4N47A 3DDIA 1RI7A 5CCLA 3HT3A 4N8NA 1UPPA 2YPZA 1T8EA 5LSRA 4DR2F 2NZCA 1WSVA 4NA2A 3TX8A 3W2WB 4DSIA 4MMOA 3KJVA 3KLEB 1MWYA 2BUNA 2HKEA 1VQNS 2CWXA 4ID5B 1WF2A 3G6XA 1WC6A 2A1BA 3CJ0A 3HM9A 3LP1B 4I2QA 1K0TA 1TK0A 4E8UA 5K20B 1B0PA 5MLCV 3FCVA 5KFVA 3LAMA 5D0RA 3BS9A 3CCWA 5DZ7A 4DR7J 3LP0B 1IWAA 2YKMA 4P2MA 3QMQA 2J6TA 2H9ZA 3KK3B 2IA6A 3K57A 1SIZA 3D68A 3DOLB 1U1LA 2QA4S 2CQIA 1SBRA 2VF3A 1P6TA 4OJ1A 4R0JA 2EW9A 3HHLC 4QJVA 5D15A 5KFYA 1KQSR 4NYPA 4O3NA 5BYRA 4GVBA 4X4NA 2F5GA 5AE2A 2HFSA 1SCJB 3RRKA 4OHWA 2IJNA 4IH6A 2DR8A 2DVIA 2EFVA 2N3LA 2MKSA 2HHSA 4ECYA 2OFGX 4UZBA 3FCHA 3ZZRA 4LR8A 5IFMA 3A8JA 3WIUA 3C6UB 3WIVA 1S1WB 2AX1A 2EWHA 1HPZB 3TA0A 1YDLA 2OTLS 1V9OA 1XC9A 4DR5F 3PVXA 2NREA 3MEDB 4X66J 1QE1A 4IOAQ 2GVDA 4ED1A 5FDLB 3GTYX 1P1LA 1N54B 4H4MA 1VOMA 2VUGA 1U45A 4ZCKA 4OZNA 2YKNB 2V8DA 3MM8A 4LF9J 1TUVA 2NUHA 4IFVB 3H40A 4MKVA 2G1DA 3TP2A 2ZH1A 3RG6A 4NMLA 2HGLA 4FNHA 3KLIB 2BE9B 1VQ8S 1NCLA 3LAKA 2V2QA 3ENAA 3LWMA 4WFXA 3EGWB 4OZ5A 1SXLA 1DQ8A 3EICA 4IRKA 4ZK7M 2K8GA 4QCLA 3NCPA 4WP3A 3OR1A 1WHVA 2GZOA 2QV6A 1DBDA 3CDUA 2FC8A 4RNNA 4GKKJ 4KY3A 3L95X 1YBUA 1TQLA 4WFYA 1IKVA 1AZSA 2R2UA 1GMWD 2BJEA 2ZBIA 1TMMA 3C8YA 2CYYA 2V5HG 2GGPA 1LW0B 5J2NB 2YWWA 2V8VA 1UEKA 4B17A 4ZIWA 1WDTA 1UEVA 1HWKA 3JXOA 3QJJA 4V19J 4DMZA 2RS8A 3PXGa 4DF8A 4P71A 2BR0A 5DGAA 3SQOP 2A18A 4A48A 3MEEA 3NL0A 1JLAA 3DYAB 1VRTA 4RNMA 1R8BA 2AU0A 2XMVA 2UUCJ 3PJWA 4WP9A 4NRUA 2VA2A 2FLOA 2KXNB 3V2UC 2DCLA 2PC6A 3V6HA 3HULA 5T7LB 2KVIA 4OI6A 4MKYA 4OI0A 4ED5A 1G6BA 1N33J 1KVKA 2OSRA 4KE5A 3BGUA 3FBCA 3A8IA 1OJ4A 3FEYB 1QVGR 4CZCA 3OHBA 4DQPA 1OS5A 4NCGB 3ET6B 1JNZB 3N9UC 5HLFB 4K4YA 4ZCLA 2Q1LA 3CO0P 1RGVA 5D8HB 3M8YA 2COLA 4DUTA 5A8KA 1HL6A 2U1AA 4UZCA 3M05A 2UVVA 2AF6A 4J9PA 2LECA 1ZS6A 4RUAA 3OL6A 1YITS 4NYOA 1VQ4S 3W63A 3ZXWA 4RWWA 2R7TA 3JTOA 1RT7B 1RZMA 2HQIA 3R7BB 4CYUA 3UE2A 4TQSA 4DS5A 1I1GA 3DLBA 2B56A 3CD0A 3R5CA 1WHWA 2C3YA 2LU1A 4DFJA 5EX0A 1FE4A 3W5YA 1WACA 2LA6A 4NLPA 3PRBA 1HI8A 1U1MA 4DCPB 4DX8H 4ITSA 2DNZA 3E8OA 1T9WA 1Q7YT 2AT1B 2H5IB 4Q45A 1IKYA 4ECRA 3Q2TC 3GILA 2PD1A 1R0CB 3GQCA 1IBLJ 3N4WA 5H9EJ 4TY9A 3I96A 2DNOA 2EFQA 1VQ7S 2W9BB 2CXEA 1RT1A 1N8RT 3T3FA 3D0IE 1ZPWX 3B78A 4HT7A 2EVZA 5IQQA 4EI2A 3UW1A 1FD2A 2CQPA 3FKBA 2DGQA 2F9JA 3KK2B 3BZQA 4WJBA 2YKPA 2Y0BB 2N4CA 1K1SA 1IJEB 3K5OA 3QPIA 1PKUA 4AFFA 1C1CA 2LQ8A 4JBCA 2ZITA 4PRFA 1IWGA 3KLHA 3DFEA 2ZM6J 5F3ZA 3EM1A 2RD5C 4G1QB 2VASA 4JYAF 2UV8G 4J9OA 2DISA 1DTTB 5KT3A 1OYDA 5DDOC 1WSRA 3UN5A 4WTOB 4CQ1A 2R8JA 1NM2A 4DN0A 2E9RX 1HYSB 1U6FA 3MR6A 1OO0B 1UL3A 1CJKA 2OLWA 4OFZA 3Q8VA 3TZYA 3N28A 1VBYA 1ROFA 4ZJLA 3OTEA 4LFCF 2AGPA 2YH0A 4B9UA 4I7FA 1Q8KA 3PYDA 5J1PA 2Z2YB 1PSDA 2CDRB 5IT9U 1BD6A 1UVLA 2QMUB 2DKOB 4U67Q 4C8NA 1RT2B 3GV5B 4Y2MA 4RW9B 3R8YA 7FD1A 2DHGA 4Y28C 1NK5A 1VI7A 3L7PA 3EWGA 1L3UA 2GQ2A 2LEPA 3RU0A 3UNGC 5C5JA 2RDDA 2C22A 5J2PA 4ANCA 1SL2A 1RAAB 3GFYA 3KLGA 3J80U 2MKJA 2VV5A 3GR0A 1X9SA 4B9LA 1JLGB 3D7SB 3ZC4A 1WEXA 3GIJA 4LR7A 4F2RA 2CRLA 2NPFA 2WZ1A 1RWXB 2HZCA 1NAQA 4C3MA 4CP5A 3RW6A 3HHLB 2GAHC 1S77D 2LLZA 5JJBA 2WRMA 1U1PA 3ILLA 4LFAF 2NR0A 2B9WA 4MIBA 2B4VA 5KFBA 4OZJA 1C0TB 1SC6A 4PABA 3M4XA 4FN5A 5E3RA 1RHRB 1YVFA 3NAIA 4U7CA 1S1UB 2VFSA 1CQNA 2ACYA 3CCUS 5M2PA 4WBFA 2R8HA 4A8FA 4NLTA 2C3OA 2RRBA 2UP1A 3THTA 3CMES 1AW0A 3OLBA 1QUVA 4JI6J 1IBKF 4P74A 4KSEB 1YTYA 5LMNJ 3N5FA 2WVCA 3VHQA 4OX9F 1NZAA 2UUBJ 2Z4PA 2IC3A 2XTJP 1SJQA 1S79A 1OPZA 3RB6A 2ZVIA 3TZXA 3QGIA 2HHUA 3PDNA 4CLSA 5HP1B 2UXCJ 2VG6A 2DH7A 4J9VA 2RKIB 2EBEA 2FGOA 1E6YA 2CKWA 3DRPA 1ZA2B 2B8PA 2VPXB 1NBEB 2HHHJ 2V8GA 2BKNA 2ZFHA 2FJAB 4CTAB 5G4DA 2QSFA 3MMBB 2FHKA 4QIFA 2LCWA 1UETA 2AJQA 1R8CA 4WYLA 2AD9A 3HSJA 1LWCA 3MM9B 4G6VB 4O4RA 2N7CA 3UR3C 3MAHA 2B9XA 4DU7A 1S57A 4DPTA 3CC4S 3K0JA 1YJTA 2E7VA 2EEYA 3J7YI 1WC1A 4C8YA 4DXLA 2E44A 2PA3A 3L7OA 1G7CB 3OSPA 3K89A 3KDOA 4EEYA 1AFJA 3ILOA 4C6AA 3G8QA 1TUWA 2YQ1A 1EQ0A 4EBEA 1KBRA 2W9AA 4F0KA 4DLGA 4CLZA 2XO7A 4Z7CA 1S9FA 1ZAWA 3TAMB 1U0HA 2HLUA 4UF4A 4DZDA 2EFNA 3FRZA 5JUMA 4JV2A 2O1PA 2CPXA 3VTIA 1GXTA 3H4DA 2B7BB 5FLXU 2O3DA 1F1BB 4LBPA 1HHTP 3W60A 4YEAA 1J2VA 2QA4G 1ZAVA 1LWXA 2CDQA 3VAHA 5GAEU 2ACMA 3QAEA 1DY3A 1JLEA 5D78A 4V1Ak 2CPFA 3HSGA 5CZVA 2Z8QA 3P4UB 3T6BA 1HQUA 2CG8A 3HHLD 4CLTA 2DH9A 1LNQA 2UZAA 3V6DB 1X4GA 1Y3KA 2AYMA 1OSCA 2W9CA 4IO1A 1HBUA 2KFYA 1KC8T 2OIHA 2ZJRQ 1FESA 3W8PA 1KS2A 3VQTA 3W3SA 2CNNB 3CCMS 1N5QA 2CJYB 3TANA 4JV0A 2V4JB 4DL5A 2VA3A 1RLDA 4TU8A 4DSJA 2GVZB 2HWIA 2OHDA 4CO1A 4OHZA 4IQMA 2F63A 1NXIA 3HXMA 1VQ6S 1SH2A 1WJ9A 5HANA 1XMOF 2F4VF 1R0AB 4RUBA 3RB0A 3M6XA 2HFUA 3R6LB 4YR2A 1RTJA 2LQBA 4JI7J 2DNYA 2EFGA 2ZNYA 1UMJA 3UWTA 2HEKA 4NE9C 3QQCD 1RBOB 4CDIA 4ZDNA 1S12A 5HN0A 1WOSA 3H2VE 2HRTA 1LQ9A 2YBVA 4ATNA 1J5OA 4X62J 3TZWA 1RHQB 4USUA 3DLEA 1NO8A 2B0GA 2U2FA 2G9OA 5IZHA 1D9AA 2MZQA 2NYHA 4QWBA 4CO0A 5I42A 4NXMJ 4WE1B 1FVSA 1CS4B 4ZP9A 1I5OB 3P5TL 3X3UA 2KN4A 3ZTSA 2LYVA 4N77A 2M70A 4PXCA 1VYAA 2B43A 2DPIA 1FXRA 5K8OA 1QAIA 1KHVA 1GMWA 1SVDA 4B9SA 1FFSB 3E01B 4X4TA 2JVOA 4AE5A 5KT7A 2XULA 4QIVA 3EPGA 3W2WA 3PW4A 1X7VA 2G0JA 3UCGA 4DV6J 1RAEB 5CYJA 3EJMA 4F8RA 3DHXA 2HVIA 3SI8A 4WFNQ 1RDRA 1FJGF 2V67A 4DFPA 2MSTA 1U1RA 2BM1A 2PT0A 4YHHF 2RS2A 4PXBA 2R2RA 3DCAA 3LP1A 3J81U 2C2MB 2PFFB 3OW2R 3LPYA 1WKLA 1ACMB 3NGKA 3HZGA 2O67A 1RKJA 2VPYB 2GC8A 3DLJA 2VBYA 1BQXA 3LP0A 4DZ6A 3BO2A 5IT0A 3N6LA 4I68A 4ZPDA 1FDDA 3KK3A 2BANB 4YDDB 4WU2A 4OMFG 2R7QA 3ZZOA 4PG8A 3DOLA 3DOKB 4A46A 1TZ0A 3FSYA 4NLRA 3DLGB 4FF1A 4FYXB 2DK2A 2W2MP 2UXDJ 1VK3A 4ED8A 5L8RC 2W2QP 2EXUA 5ADZA 3OT9A 5G0RB 4A8XA 2MEWA 2DR9A 4P2SA 2RE1A 3RAMA 4F4YA 1C1BB 2CNOB 5GAGI 4TNOA 2JEJA 5ETTA 3TOQA 1YRTA 3NG8A 4XO0A 1T9VA 4KO0B 1U0SA 1TL7B 4RJVA 4DQSA 3HP6A 3CCLS 2DY9A 1UZHA 3BGFA 3C6UA 3FUYA 5CD4H 1S1WA 2XZTB 1HPZA 3BF4A 5KFMA 3I87A 4AL6A 1SJ4P 1PYSB 5KFTA 1HHQA 2W7PA 4XDDA 2AZ1A 3K7RA 1I3OB 5FDLA 1OQ3A 4L75A 1I51B 2B9YA 3NMAA 2RJZA 4DJBA 1HNWF 2JL9A 2YKNA 1RHKB 3LTOA 5LM7E 4IFVA 4B3MJ 2RQCA 2ZD1B 5DLFA 2VJUA 5HK4A 2HFOA 4LSLB 5GMKa 4PWDA 3KLIA 3AJDA 5DS7A 2C2OB 5AXKA 2BJ1A 2ZWOA 1OY8A 5E3CA 2HYIB 1JNRB 2RT3A 4OZ0A 3AXKA 2WSEC 2WW4A 3NGTA 3MF5A 2CPDA 1MSWD 3M8SA 5K9FA 2YQ3A 1KEKA 3TUZC 4NXNJ 2CZ4A 3G82B 2PN6A 4HHJA 3ZTPA 4O44A 4JV5F 1FF2A 1MN7A 5J2QB 2BYCA 1IQZA 2FLNA 3AOBA 4LF6J 3ZTOA 1RBLA 3R5JB 1ZM2A 5L39A 4JP8A 4OLPA 4CLWA 1LW0A 5J2NA 4DDFA 1TFYA 2IRYA 2IFXA 1A6LA 2HZVA 2G0CA 1CC8A 1U4BA 2LFVA 4C8ZA 5B0EA 1F6TA 2VL1A 3B4DA 4BWMA 4Y65A 4I67A 2D9PA 5B08A 5C24A 1N5SA 4QYRA 3IS9B 4MYTA 2B4PA 3DYAA 1FT8A 1I6JA 1PYOB 2WSCC 4QW8A 2FVSA 4C8LA 2QFIA 4FYYB 2PIIA 3HFKA 3QSIA 2ZBCA 4X64J 5T7LA 4DR1F 1QAJA 3OD2A 4DL2A 2FJDB 3ENWA 3K5MA 2MTLA 2YVSA 2VIHA 4GRSA 4CNYA 3H25A 3UCZP 2W4DA 1M5PC 1XR6A 5A2QU 2DNGA 4LRFA 2IMOA 4Y2AA 1XEZA 1WD6A 1HD0A 3AJ2A 3SV4A 2LDYA 1EKSA 4NCGA 4OL8A 5AE1A 1TMJA 5HLFA 3GIRA 4DEZA 3FMWA 4N41A 4IG3B 2JFKA 4M95A 4UOHA 1QM9A 1VFJA 3PJXA 2ZH6A 1NB2A 3HJFA 4ZPBA 4F3QA 3A3OB 3BH7B 3ZTRA 4DV1F 5HVHA 2EI5A 3PZPA 1NSAA 1Q82T 5HROB 4EWTA 2IBKA 2ASYA 2DD8S 3OFHA 1GEHA 2DR7A 2XYPB 1RT7A 4NEYA 2XM3A 4HDGA 4QIEA 2M4MA 4PWUA 4ZITA 2V2KA 1BHNA 3SMZA 2VONA 1NPKA 5EGYA 4I1TA 2IM1A 2VFUA 1UP1A 4PWWA 2FB0A 4RNFA 1RWPB 2IJFA 1U09A 2ZHOA 1HWLA 1N52B 4ICLB 2E1PA 4MIWA 1T0TV 4KGZB 2KT5A 1SKRA 3JQKA 4QYZK 3H5SA 2UXBJ 4IOCQ 1XNRF 1FK9B 1IKWB 2FLPA 4P2FA 2QMWA 5KAKA 4ZN3A 4FPRA 2PO4A 2P9EA 1D8ZA 2PMZD 3CD6S 3UD5A 8RUCA 2W9BA 5DDQC 3D1OA 2XY7A 3V81B 4OX7A 2IVFB 3C16B 5I3UA 5HI7A 2ZH4A 3NAHA 3MR7A 1UA1A 5B0BA 3KK2A 1Y5NB 5EWFA 3KFWX 2LQ5A 2CA9A 4P10A 5L1JA 4NOHA 3LP2B 2FIUA 3PX6A 2K06A 1SC3B 2OGUA 4YN3B 3GYGA 4OV6A 1FEHA 1RHMB 2LDIA 2EBGA 1X31C 4O4GB 3FJ2A 1UPMB 1P1TA 3MUTP 4YY3F 4G1QA 1D1UA 3PW5A 1FWPA 1DTTA 2MKHA 4FF2A 4ES3A 4PKDB 3MEGB 2HNDB 4HLBA 1XNQF 1N0VC 1ZBTA 4ZVPB 5F8GA 3R2CJ 4N56A 3AODA 2QMXA 4J5OA 3P45B 4ID8A 1BWVA 2R2TA 2F8EX 1KWMA 2PMHA 5LMUF 1VS3A 2W2PP 2CPIA 4DV0J 2Z2MA 2A10A 1SQFA 1VBKA 4H4OB 4KH0B 3TVYA 1AA1B 1HW8A 4OI1A 4ZLPA 4KPCA 4NZ6A 2NSBA 4KGKA 1UCNA 2B9EA 3SSSA 1LXNA 4AQYJ 3LF0A 2ILZA 3IO1A 4KGVB 1FO1A 4KHPJ 2CAJA 5C2GA 5KFRA 1RAIB 3JSRA 4TKTA 2AYGA 5B0CA 1YJUA 2IRXA 2G0IA 3FZBA 4A8SA 1RT2A 4K4WA 4NLYA 4C4WA 3KUEA 4RW9A 4ZJQA 3EGNA 1JLFB 1ZETA 4UOGA 3VALA 1WC5A 1WF0A 4BC7A 4NL5A 2BOPA 1NDCA 5DG8A 4ZVSB 1S59A 2GS8A 4FYVB 3KHHA 1U1OA 1SH3A 1RACB 4M8LA 2UVRA 3M2UB 3PKMA 2CVEA 1RTZA 2D7SA 1G1XA 2KRRA 5HAOA 5KFWA 1JLGA 1YG0A 1XWLA 2UUAJ 4MIAA 4BS2A 2HFZA 1PJ6A 2YNIB 4LF5J 1Q16B 3CCQS 4MKAA 4DG1A 3HHLA 3D0GE 2MHEA 1R0BG 4C97A 3P3DA 3M1VB 1R7IA 1C4CA 4DL4A 2FJVA 3PFEA 3OQ2A 3S1TA 2M5YA 1SC4B 3IRWP 2VICA 4J7CA 4LF8J 3T1YJ 3RGIA 2L9DA 1PILA 1C0TA 1FWLA 3MCNA 1S1UA 2B6AA 2M2BA 1FJCA 3KNAA 3R7NB 1TKTB 1BE4A 1WTBA 3H59A 1QDUB 4KAIA 4GVBB 2G13A 3D5MA 3JAMU 1O8BA 2CJAA 4TU9A 2DNHA 3PG9A 4G3IA 2H4WB 1RHUB 2BJ3A 4ZLJA 3MEKA 4LQ3A 2HQFA 1CC7A 3CDEA 4M5KA 2Q43A 3HT0A 3ZO7A 3I9ZA 2CPYA 4DUZJ 3A4TA 4URSA 2VFRA 2F8MA 2ATLA 4IH7A 5HP1A 4F7VA 2WTFA 3NGDA 2QLBB 2C28A 2RB7A 4HI1A 3D4JA 4ZIVA 1YK9A 3MCOA 3IP0A 2RKIA 4K2XA 1EP4A 1S0NA 1JJHA 3B8HA 3N01A 1XMQJ 2NLWA 2K7JA 3QRRA 4CTAA 3MMBA 3CEDA 4NLSA 5E41A 2JLFA 3K17A 3CD5A 2AW0A 3QGPA 1SKUB 3MM9A 3W62A 2ATCB 4EFAC 1UZDA 4EZ6A 2FHOB 2HHTA 1FDAA 1LV5A 3TUPA 1VJWA 1J27A 1EAYC 2CZ9A 3SCKE 1TKXB 3OR1B 3JB9k 5E7OB 1S9GB 2AKWB 1ZZNA 4TYAA 1S1VB 4J9LA 3RRGA 1RSCA 3TAMA 2FJEB 3AD7C 1J5EF 5KG4A 2R7VA 4ZCIA 2ERRA 4F4WA 1HFEL 1URRA 3G71S 3W61A 1ZM9A 4LVOP 2VC1A 1K8AT 1KONA 4P2XA 1S72S 2HFVA 2J7UA 2HNZB 2XS7A 2KKHA 2MZSA 4KQZA 5IS2A 4LF9F 2XHWA 1H72C 5IT9Y 3X1LB 4RNHA 1JLAB 4DV2J 5AJ3F 4C7QA 3M30B 3TJ9A 5HJYA 3D6FB 2ABYA 4ZVQB 3GG1A 1FRHA 2H51B 4RKUC 5GMDA 3KUGA 2FGCA 2W25A 1FKOB 3BO4A 1SI9A 2BABA 3O2IA 1HBNB 3GCWP 4GKKF 1NSQA 2V4JA 2O01C 1JXEA 3SBMA 2BZ2A 4JOUA 4OV1A 3ZZPA 1TKDA 4P7TA 4AYBD 3J80Y 2GVZA 4PXEA 2W7OA 2R8KA 1GH8A 1WNEA 3DLKB 3CCRS 5A0YB 2QN6B 3BSCA 5CZXA 5FD1A 5L9XA 3DLLQ 4OYBA 2RDIA 4RU2A 1R0AA 2BEFA 2DH8A 3M2VB 4OYIA 4DU8A 2QA1A 1F2HA 2LA4A 2Y9HA 5H9FK 4DX6A 4F4AA 3G87A 4F02A 5K8PA 2RIJA 3H8YA 1FNMA 1YRXA 4QPXA 1QJHA 4F36A 4PG4A 1FVQA 3NWRA 1EIYB 4QQBA 1NZ8A 4J37A 1OSDA 2CQGA 3S8SA 4ZLLA 3NRBA 5RUBA 1N48A 2VBXA 4WE1A 1FERA 1NEEA 2YX4A 1CS4A 3R27A 3QZ7A 1HW9A 3JTPA 3A13A 4KIAA 2J0WA 1N33F 2I8EA 1V3SA 5CHCB 2J76E 2G2ZA 3E01A 2CPZA 2YWEA 2Z30B 3CJTA 5AXNA 3C15B 4M5NA 2HG4A 4DFMA 2HZAA 2X7IA 2V8PA 3L3CA 4ZN1A 3QGHA 1TTHB 1PJ7A 3ISNC 5DLGA 2V2ZA 1LFWA 1U02A 1JLCA 4NYZA 5B0AA 2IVYA 5BR8F 3PX4A 4ZVFA 4BDPA 2H48B 2P6SA 3OXLA 3KYLA 4KB7A 1VIXA 1ZM4A 3KLVA 5E33A 2C1EB 4IFYB 3EE3A 1B70B 4M63A 1OY6A 2F7VA 4RUHA 3GE9A 2JX2A 2P9GA 4K5RA 5E3PA 1RT3A 1HI0P 1TL3B 1C1CB 1W25A 3ZZYA 3OL8A 5FJ4A 3DOKA 4FVCA 2MXYA 3B6BA 3M6VA 5IXUA 1UFLA 1MMNA 5EHHA 5IC4B 2F65A 5E0OA 1GK8A 3DLGA 1H3DA 2UUTA 4RR5A 3FMBA 4ZS6A 1MROB 3DRYA 2Y0SD 3OV7A 3EYZA 2XMTA 3BGOP 2JOQA 1V5VA 1C1BA 1CJKB 3ENVA 4NLUA 1IBLF 3Q24A 1X9MA 1WF1A 4OYOA 5F0UA 4HKQA 1FA0A 4USIA 5ETSA 1HBOB 2RU9A 4YFUA 3GFXA 4KO0A 3BM7A 5L46A 1B4SA 1FKPB 3GSIA 1HD1A 2OMOA 1NK8A 5LSLA 3CIZA 1X4HA 2MZTA 1Y00A 3WX4A 3QYYA 3O3LA 2KFNA 1PBAA 4KHMA 3DU5A 4NLXA 4G65A 5FLXY 5CQGA 3T1HF 3CJSA 2V0NA 1T9XA 4RBTA 1YJ9S 2AJ1A 4NZ7A 1EKRA 2HMIA 3IRXB 4Q2LA 3GZ7A 3DM2B 5KFDA 2VG5A 1RWUA 2M8DB 2IM2A 2XZWA 2ZD1A 2E1RA 3AOAA 1N32J 4K2JA 4LSLA 4Y0FA 4OJ3A 4A8YA 4AL7A 2MPUA 4F50A 1Q8LA 4E2FB 3MTJA 1XMBA 2IJRA 4ALZA 3JSYA 4K8RA 4ECUA 2J6SA 3NNCA 4MT1A 3OR2B 4DFKA 3R3TA 3L9ZA 2ASDA 5HL7Q 2PDAA 1QSLA 3SSRA 2JDJA 2MKYA 3G82A 3MR3A 3SEOA 3THVA 1IBMJ 2FVQA 4BBYA 5J2QA 2AWZA 2D3O1 2QTWA 3CSKA 5LSOA 1FNXH 3DNCA 1TKZA 4WP8A 4DPXA 4A47A 3GP9A 2YNGA 1EB0A 2HPUA 3CJ3A 3IN5A 3BKUA 5KFOA 1BLUA 4L72B 4C8OA 2XS2A 1FFGB 1HNIB 1Q5YA 2KYXA 3TR5A 3Q8PB 4K4TA 2OFHX 4BWJA 3FBFA 1RWVB 1F5CA 3IWNC 4DR3J 2XHCA 1NMEB 1RT5A 2DHHA 1B0VA 5E3AA 2OMLA 4R5PB 3T5KA 4A8OA 3K8WA 3IS9A 3DC2A 1LK5A 5HVFA 2P9CA 3MD3A 3MPYA 4JI5F 1ELOA 1U1NA 4DSLA 4X4VA 3MHYA 1UWAA 2Y1IA 3UD4P 4QYZJ 1V6HA 1FTCA 4F25A 3JQMA 3QJPA 1OPIA 4LSNB 3BGLA 2R8IA 2HQCA 5D0EA 4F3MA 1HI1A 3LGMA 5ETOA 1HWIA 1RADB 1KR4A 2VG6B 5K14B 2BJ8A 2E5JA 3OTOJ 4IG3A 4ZP8A 3P96A 5CYMB 4JI0J 5IOLA 1W2IA 1FCAA 3FZ2A 2V2VA 1WTFA 1RT4B 3J81Y 3VAKA 1B64A 5HROA 2KYZA 4OX8A 1N88A 1IJFB 2HFNA 3JTNA 4JI6F 1H2UX 1MMLA 2K2PA 3NGRA 1P9YA 3OJSA 1DAXA 3MGJA 1IR1A 2WBMA 4L6V3 3OLAA 5AXMA 2KT3A 3OSNA 4DV7F 2GJIA 2JRSA 1TP7A 2Q3PA 4LF7J 3NOCA 3IWXA 4XK8C 2DGVA 3O44A 3CMQA 3OUYB 2QYGA 5D77A 4DSFA 4ICLA 1Y5LB 2YWKA 2XMUA 1HNVB 3CJKB 1Q4RA 1U0HB 2J7KA 1FK9A 2Y1JA 2ZZNA 1RU2A 3AA9A 2UXCF 1H2VZ 3CF5Q 2FC9A 4CNZA 3MPUB 4DS4A 4FKXA 4WKRA 2HHHF 2BMBA 1X9WA 3R2DJ 1KQKA 4P73A 2BX6A 4LFBJ 2MQLA 3V81A 3C16A 4ELVA 3IC1A 4DR6J 6FD1A 1R27B 3PFOA 3QBCA 1NK6A 1JLEB 5ETRA 3FSXA 4DV3F 3LP2A 1U8WA 3GYXB 2QC3A 2C2DA 2AJ2A 4C9DA 1S1XA 4YMEA 5HQLA 2GHPA 4O4GA 2OPQB 4O3SA 4KV8A 4YQWA 2HWHA 2IYIA 3CE8A 1N56A 4ZVOB 3TX0A 2FJWA 3MEGA 3Q8RB 2RU3A 3EGVA 4F4ZA 1N5YB 3EPIA 1X4CA 5KFPA 4LT6A 1TV6B 1IBCB 4QIWD 4H4OA 3CMAS 2W2OP 4ZMMA 3MR2A 2RMLA 3HFVA 2KM8C 2C3PA 4DPUA 4KTQA 4QWAA 1YJVA 1LWEA 2XZDB 3NS7B 4OYZA 1KRPA 2HS0A 3MFIA 8AT1B 4EZ9A 1HNZJ 1MW7A 4FYWB 5M2UA 3CT9A 1TELA 1VQOS 1KSPA 1JLFA 2R4FA 3CGIA 5U47A 1M1HA 2EFOA 4U8YA 1HR0J 4ILMA 3M8ZA 4HHHA 1Q8IA 2RUSA 4U8VA 3G8TA 3GB0A 3AA8A 1P9QC 4NMXA 5C25B 2OUGA 3M2UA 1N0UA 1F9HA 4ZVUB 1UTAA 2FY1A 4HHUA 3B82A 2HNYA 1K1QA 2NXJA 3RBDA 2CJKA 4JI7F 3F0NA 1EETB 3PHEA 2YX1A 4RLEA 2YNIA 3K58A 1SL0A 3LPEA 3GMGA 3UR0A 1EQMA 4B3RJ 4I56A 4NLDA 3M1VA 1VLYA 4DQIA 3UFCX 1VQMS 3U1LA 4PYDA 3ILJA 3OHAA 3IFEA 3H2LA 2ZDOA 2E5LJ 4Y6IA 2AP6A 3KMQA 2BBEA 4CO5A 2DIVA 1G3OA 2DGSA 4UY85 4P9SA 1M0SA 2AJ4A 1RWNB 1MWZA 1VDHA 4UT4A 3Q8UA 1TKTA 2B7CB 3I55S 2A6OA 4BCAA 1RE1B 2AGQA 4QWEA 2E9ZA 2DYAA 4JI2J 2I0XA 3CWJA 2DO4A 2R7XA 1NJYA 4XPCA 1BGXT 4DL7A 2XB2D 3OFEA 2XSFA 2AJ0A 2GHWA 4OYPA 4DV6F 3I6PA 2DNMA 1V3ZA 4Q7AA 2JHEA 1N34J 4E0DA 4WWSA 3CVKA 5HMZA 1GX5A 3MXHP 5HMXA 3F41A 1VHFA 3P49B 1KLMB 4KFBB 5F8IA 1Q78A 3DKDA 4KT0C 1ZM3A 3T6JA 3MM7B 5KFQA 5F0WA 5ETQA 1AT1B 1NHVA 2NPIA 2JWNA 4CLFA 2XWXA 3PO5A 2CJ9A 1QSSA 4YP3A 2QT7A 4RZRA 3DI6B 2J9CA 3KG1A 5THWA 2Z56B 1JJ4A 1YIJS 4OZ2A 1IR2A 4O23A 2IYGA 2ALYB 1CULB 5D4PA 2VODA 4DOZA 2DRDA 2VQFJ 2RHSB 3W1YC 1FNOA 1W2BR 2GO8A 2GIRA 4FNIA 4PWDB 2DGWA 3I82A 1EARA 3PIPQ 2Y1LB 1T11A 1TKXA 2LEBA 3PV8A 3CCJS 2XMMA 1C2PA 2WOMB 2YNFB 1S9GA 2J8AA 3D28A 4F67A 1S1VA 1Y0HA 3WC0A 4LF4J 2EC0A 3KOAA 1DHMA 4O44B 3QT7A 4KGXB 2V9WA 2EC2A 2QYCA 4UUXA 4DSEA 1NHKL 2L3MA 2XWYA 3H90A 2MQPA 3C14B 4HL9A 1HBMB 1L3TA 5H9FJ 1CJUB 4WZMA 5KG5A 1VLOA 2LXUA 4USMA 1CJTB 4WCEQ 2QZ8A 2HHPA 1NUEA 2HNZA 2BDPA 4FZVA 3QJLA 1Y5IB 4B3MF 4U95A 4ECTA 3RW7A 4H4KA 3FVYA 5C24B 2XMJA 2ZZTA 2NSCA 1SJ1A 3V6KA 4ELTA 4ZVHA 6FDRA 3M30A 3H7HB 1YHQS 3CJ8A 3TEGA 3ELHA 3OTCA 4F04B 3K5PA 1CEZA 2M9KA 1E6VB 4JI4F 5IM0B 4Y2IA 1G4CA 4M5DA 2B4OA 2HBRB 4WYWA 4QU7A 1FKOA 1NJZA 2EK6A 3NWGA 4PG6A 3IBCB 3RUBL 1X4DA 1HBNA 4NXNF 3QLHB 4ZKAA 3EVWA 3VGVA 2J0XA 1YJRA 1TUGB 4EBCA 3PR5B 2FUG9 4LUBA 4KGMA 4LF6F 3DLKA 5HATA 1MWQA 2QA2A 5A0YA 3FCWA 5B7WA 3RZAA 2G1HA 1MLAA 4PPDA 3HMJG 5A76A 3M2VA 1IM6A 1FRXA 2Z2LA 2MLYA 4CLKA 2RVJA 4NLVA 2EKNA 1S4FA 4C3LA 3GWCA 1CVJA 3QZ8A 2B51A 2YKOA 5KTQA 3DU6A 1VQYA 2XYGB 3TZZA 2YX7A 4CO4A 1KDNA 4X64F 2XCPA 4NLWA 4OI2A 3KHRA 1RABB 1TK8A 3LW5C 2WAQD 1Y7PA 3HVTB 3LGNA 3TVZA 1NDLA 2AYBA 4MYUA 4RW7B 5KG6A 3NLCA 4Q43A 2Q6BA 3EDQB 2W1BA 5KG2A 3JAMY 1D9FA 2C2RA 3C15A 3EUNA 3SFUA 2YNHA 1RYSA 3MAAB 4B3OB 3T5LA 2B8QA 5I3UB 4IUFA 3EXYA 2NXNA 3HO1A 4A8QA 2BJDA 3IXQA 4GMKA 1Q0NA 5A8WB 3OJUA 3OL7A 3BSOA 5KT6A 3EZ5A 2BA9A 4IFYA 4F3OA 2UU9J 2K7KA 2CVIA 2AQ4A 1TL3A 1SB6A 1VC6A 3A8KA 3QFWA 5J1EB 5KT4A 2ZOGA 3T41A 4FF4A 1ICEB 3IG1A 1VC0A 2OJ3A 4K0KJ 2IIHA 3WHIA 1F60B 3BQ1A 4LREA 2HHWA 4FPIA 1MROA 3PO4A 1P8GA 2UXBF 4YUDA 2VJVA 1IVZA 3RBEA 4LQ9A 3K59A 1N36J 1S0VA 1D8YA 2GQQA 5L9NA 5LL6d 1BQNB 2V4RA 2V94A 2ZBPA 1HBOA 2D74B 4ZP7A 5A8RA 4OHVA 1Q1KA 2J8SA 2HRYA 1JXLA 1FKPA 4Q44A 4Q8FA 4G1PA 3N5BA 3Q22A 4N8OA 3CJ2A 4FP9A 5DQGA 2KTQA 2HIYA 4HTIA 3ZZ0A 1RAOA 4MK9A 1K44A 1F0XA 2XMKA 3G6YA 1XN9A 4JI1J 3NY0A 3NEKA 2XNRA 3M8QA 3A3NB 1PGZA 4ED2A 2OSQA 3CCSS 1S1TA 3AY0A 4OJHA 1S6PA 2ZOFA 2BQUA 2GCFA 4OZ1A 3IRXA 4PCQA 3IBWA 4OI3A 2MJNA 4QPTA 3DM2A 3ONQA 2MYFA 3FK4A 1AFIA 4TVAB 5AXLA 2EPIA 3W66A 2DT9A 3FGVA 3RB4A 2DNNA 1T9TA 2GNKA 3PW7A 1JB0C 4GVLA 1H2TZ 3M2RB 3MMAB 1JLQA 1WI8A 1S6QB 2BW2A 5EUHA 2BVZA 4DV0F 2L08A 1BY9A 3LALA 5AE3A 4IOBA 1Y9OA 1UEUA 1C0UA 3TAQA 4PAAA 3OR2A 2JEGA 4DG1B 3BBBA 2CQCA 1Y10A 3RRHA 3WC2A 2FTRA 4AQYF 4DR1J 4PEOA 2YXLA 1H74A 5HQMA 1RQ0A 3ISZA 3GJSB 1UJ6A 1RWWB 4HH0A 1UA0A 4YOEA 3BQ0A 2GJFA 2JEIA 4ZLNA 2QLWA 1L3VA 2FJXA 2VBZA 2X1AA 2FDNA 2DGOA 1NJIT 3BKFA 3CDAA 3N0VA 1Q8BA 1OMSA 1HNXJ 2DB1A 2B6AB 1HNIA 2QJ3A 4ECWA 4PUOB 1NDKA 2RRNA 4QZVB 2BM0A 2L41A 3NGUA 3UDEA 4EBDA 1RU1A 3V4MA 4R5PA 2CFXA 2MY7A 2V6AA 1QTMA 4PG5A 4S0MA 2DHAA 3KXDA 1S5ZA 2HQGA 3MOZA 2MHNA 2RQMA 4WU3A 1S97A 3CC2S 3ZZUA 1RTHB 5HBMB 1X5SA 2UUAF 2B5JB 3RYLA 5CABA 4LF5F 1RCXB 2RF2B 2VFTA 4LSNA 1YJ7A 1WG1A 4DSKA 4MH8A 3US5A 2BE2B 2HLTA 1WKKA 3UCUP 4WZQA 1NSPA 3MM6B 2QFJA 4XDCA 1M5SA 2QGFB 5K14A 1EP4B 1WG5A 3T1YF 2Y1RI 2E5GA 4IKAA 5CYMA 5LJ5Y 3POTB 1H7WA 5BXIA 1O51A 1PC5A 4ZPWR 3M6WA 1UJ5A 1XERA 1RT4A 3OXFA 2YQ0A 2J0SD 3BB5A 2ASLA 1SQEA 2H4YB 3OL9A 4YS2A 2QLFB 3QWPA 3WDOA 4TU7A 1FD8A 1FI4A 2LVWA 2HBZB 2GIFA 4ED6A 3FFIB 2WVEA 4DPOA 3R5DA 1U26A 1HLWA 4B9NA 5JMNA 4MAKA 4OYMA 3CULA 9RUBA 2UV8A 3OUYA 3HHKA 2JNJA 3M6UA 3QT8A 1U1QA 1SH0A 1HNVA 1YZ6A 3CJKA 1SV5B 3BPSP 2DGTA 3R5GA 4RWXA 3E2EA 2N82B 3DOMB 3MD1A 2GX8A 3I31A 5IWAF 2IM3A 3ENQA 2FPHX 1XMQF 1XNQJ 2IDLA 3HPOA 2LQJA 3ETOA 6AT1B 5ETVA 4JI8J 3DGPB 3NNAA 3TARA 1AB8A 1FX4A 1MU2B 2NUUG 2MZJA 4NRTA 1S6OA 2NYIA 2WONB 3R1LA 1Z1ZA 4TN2A 2HIQA 1RKIA 2CPEA 2VQEF 4L73A 4ERDA 5AT1B 2HBYB 1M5OC 1KOHA 1ZPVA 5KT2A 4ZOSA 3VAMA 1KN6A 3J7AN 7AT1B 3TVKA 2VH7A 2OPQA 2ADCA 4UY8T 5F8NA 4WIQA 4CT9A 1X0PA 3VWSA 4XPEA 1QVFR 4IYQA 5DZ6A 1B7FA 5C7PA 2FVPA 1M90T 3W64A 1N5YA 1BQMA 1K0VA 1X8DA 3D6MB 1TV6A 2DTJA 1M1KT 4N76A 5KT5A 3IGNA 1TL4A 4C48A 4UOCA 4X4PA 4OYWA 3O5TB 1U2RA 1H7XA 1L5UA 1VQPS 2A2CA 1S0MA 1S0OA 4B9MA 2NQPA 4NI2B 3NP5A 2JFDA 2CNKB 4YR0A 4JI3J 1WEZA 3HF5A 1S4EA 4IR9A 1KVJA 3KDNA 1JMTA 4RPFA 4OQJA 3PKYA 3TI0A 3PJ9A 4ZCMA 5GAEI 2ZZMA 3V4IB 1VK8A 4OYAA 2P2CB 3G96A 1SJFA 1BXNA 4M1KA 3PIOQ 2VDHA 1LOUA 1KQGB 1TK5A 3LOUA 1QY7A 5MAOA 3PW0A 1UVNA 1O6XA 1FE0A 1KOOA 2R42A 5C25A 2N3OA 4NLQA 3SCIE 2GMJA 5KG7A 3MAQA 2VZ9A 3NBPA 1VCTA 1W26A 2CPJA 2FZGB 4ZP6A 1TVRB 4X65J 1FDNA 2GHVC 4BLGA 1EETA 1JLCB 2DGXA 1T02A 3H98A 3VAIA 2ZH8A 1I94J 3ITHB 2FJBB 2CPHA 2HK2A 4ES1A 1PO6A 1T95A 3I5CA 1RWKB 3BKTA 1HMVB 4LF2A 2SXLA 3UDLA 2XMAA 3BR8A 4GO7X 4LIWA 3RBZA 3HZEA 3CNQP 1RT3B 2CNLB 2AHOB 4C8KA 4RBUA 1M1GA 2QX0A 3D3BJ 1JX4A 4W4MA 4BC9A 1Z4UA 2GAGC 3K2YA 4WFBQ 1RAGB 3S01A 2R3VA 3RR8A 1OIAA 4XTTA 1HIYA 4R8UA 5CYQA 4CH7A 1Y11A 1SIWB 2RSQA 1FRLA 1C4AA 2QE5A 2P5VA 1TAQA 1YZ7A 2LU2A 1KLMA 4KFBA 2E29A 1GXUA 2XLJA 4ZA1A 3MM7A 5IV3A 2ZH9A 5ETNA 1OWXA 3RJMB 3F73A 1WG4A 4LRDA 3HHEA 2MMYA 5F3TA 4LBIA 2DXFA 1RYRA 1LKZA 3D6TB 3DI6A 1BC6A 4ZHRA 4YB1P 4GC7A 1J5EJ 4MFBB 5F9NA 3I0SB 4C98A 3NGSA 4CRJA 2JVRA 2PI4A 2MY8A 1PC4A 3D54A 2XI2A 2HMIB 1CULA 3R5BA 4LRCA 4I6YA 2VG5B 2E66A 3DXSX 2MJUA 2V63A 2X3DA 1RA6A 3RR7A 3VAFA 4HYKA 3C6TB 2WB4A 5KFJA 2C2ZB 4DR4J 5A6WA 4CH1A 2HQDA 3P5BP 1GMVA 2Y8WA 3RB3A 2DNKA 1NPRA 3NKYA 3H20A 3GFZA 2MSSA 5AJ3J 2WOMA 2YNFA 3EDRB 3VAJA 4OHYA 4DL6A 3MCSA 4C8MA 2UVUA 3VV2B 2JH3A 2H1YA 4WFAQ 1QSYA 2CQDA 3HSZA 2QLJB 1UAWA 2EKYA 1QD1A 5B09A 7FDRA 2KVQE 3BREA 3U1MA 2C2NA 2VHGA 2HS3A 1F5BA 2IMWP 4HTJA 3CCVS 4QR2A 3VQSA 1AUDA 4K4VA 1TKZB 3KK1A 3C14A 1HBMA 5BYSA 4J9KA 2YNGB 1CJUA 4I2PB 4RU9A 1VQLS 1Q95G 1VQ9S 4ENOA 4B9TA 1CJTA 4FS2A 2EG2A 3T19A 4B3SJ 1XK8A 3GJTB 4ECSA 2XMWA 1NK4A 1N32F 4A8KA 1RT5B 3G9CA 3IAS9 3TNVA 2XSJB 2IDEA 2M0GB 3BBFA 5C42B 3Q2SC 4K50A 2CG4A 1E6VA 1NK0A 3JYTB 1U7LA 2RH3A 5JVGQ 1F9FA 5IM0A 2AMCB 2E7XA 4O3OA 4F26A 2ZEJA 3AQOA 3R9LA 3MPDA 3KG0A 4PG7A 4J9NA 2VC0A 4H54A 3J7Z5 2QG9B 2BRKA 3QLHA 4USHA 3FDSA 5B0DA 4L3NA 1HWUA 2I2YA 4W90B 3TA1A 2ZOMA 1IBMF 1UWBB 4RW8B 2QL5B 4IG0A 3SQGA 3BEGB 3MMCB 4FBUA 1VQKS 1RT6B 3BDPA 2E5IA 3I56S 2D3OR 3E51A 4M5JA 1CQMA 3O8WA 1SPBP 2XO6A 4RW6B 2VD3A 2DPJA 2XLKA 4PPZA 2NXUA 1V5IB 4ZPTR 4DR3F 4B08A 1KTQA 1U1KA 4UQTA 3MM5B 4ED3A 2DY1A 2P8IA 2CQHA 5BR8J 1LWFB 2AEJA 2ZE2B 5E5NA 4IR1A 2R7SA 2W4PA 4CWBA 1YLXA 3OBIA 4DCJB 2Z0GA 1RBAA 4ZPAA 4ILLA 3TJAA 2ZBRA 3L7UA 2OD4A 3HKZD 5EX3A 3HVTA 4GKJF 4DUYJ 3KJNB 3MWBA 4URGA 4Q0BB 4J91A 2D3UA 4RW7A 5SZTA 5KFZA 2MLXA 4KR0B 4K4XA 1REVA 2HS4A 1EZZB 2GV1A 4KH1B 2AEFA 5EDWA 3OTOF 3L4BC 4CLUA 2DITA 3MAAA 2FVCA 4JI0F 4B3OA 4W92B 4B3TF 3CTRA 1WORA 2MGZB 1YBTA 4LVNP 4CLYA 4I6WA 4DN9A 5A8WA 2MKKA 1B3TA 3QT5A 2CQ0A 3ILIA 5F9LA 4F4XA 2HWTA 3OTDA 1S1XB 3CCZA 4LF7F 3ICLA 1GT8A 1M5KC 5J1EA 4OI4A 1S49A 1UJ4A 2DNQA 2R8GA 4KV8B 3JSMB 1UVMA 2E7WA 2KJVA 3T5JA 3T1HJ 5DG7A 4C11A 4I69A 2RAQA 2F8HA 3U27A 1RAFB 2K1RA 1D9DA 3TUIC 4PQAA 2GFFA 2HRUA 1IKXB 3MZIA 3FNNA 4Y2CA 4QU6A 2DNPA 2E1AA 4TLQA 1BQNA 2H54B 1BMQB 4CM0A 4LFBF 1TL5A 4DR6F 3C46A 1ZTWA 4EU0A 1LWEB 3HFZB 1XJWB 4DV4J 4M94A 4ZPVR 2R7WA 3MMJA 3NS6A 3H5UA 3TAPA 1U2FA 3PR4A 3C19A 1XR7A 2ZH5A 3KNGA 5ETMA 2NCKL 1VRUB 2V68A 3AQPA 3GYNA 2APOA 1NH8A 4P52A 2MQNA 3QAUA 4CO3A 1YGYA 2H65B 3UNYA 2CZVC 1F9EB 5CH7B 2KL8A 1NSKL 4CM2A 3N6NA 4ILRA 1T05A 5M2RA 1JKHA 2DO0A 1PCAA 3I9V9 2W2NP 1X4AA 3M2RA 3MMAA 1S6QA 2IHR1 1VBZA 2L9NA 2HNYB 2IAJA 5ETLA 3D6HB 3A3PB 4NZ0A 5D3GB 1MN9A 1DTQB 2YWHA 3DN9A 1JIHA 2D9OA 3OFGA 1FXDA 5F41A 3V6JA 2I38A 3W2VB 1SJ3P 4JI5J 3GIKA 4TQRA 3MECA 3MR5A 4AT1B 1F3FA 1N6QB 3LA0A 3FEXB 2KI2A 2L48A 2OH2A 3OXGA 2OPPB 1HNZF 2ZDPA 2PI5A 2M88A 5DDRC 2W01A 1NDPA 4OZLA 2DHXA 1FKAF 4KPYA 1KTVA 1CJVA 3DXBA 1RWMB 4PUOA 1NH7A 1HR0F 2VDIA 5L1IA 1B7YB 5HVGA 3J7YU 3PX0A 5L1LA 5KFGA 2V34A 1SKSA 2ZH7A 3CCTA 3G6ES 4GC6A 2BQ3A 5HMYA 3JS9A 2VFVA 1R3NA 3DGVA 1RTHA 1NKEA 5HBMA 3GIMA 1DJ0A 2B5JA 2YKAA 3TJ8A 1PYTA 4UTGA 3PTWA 3K5LA 2HGMA 4W98A 1HQEB 2MKCA 2RF2A 4DV7J 3EVOA 1GTHA 2OEMA 3IWLA 4B3RF 1TR0A 4EO8A 2BE2A 5EWEA 3GCXP 5LXYA 4DR7F 4DV5J 3MM6A 1UVIA 4G1IA 4Q2MA 4E98A 2F1FA 4MK7A 1W7WA 2E5LF 1AYEA 2GIQA 3WX8A 3POTA 4A8MP 2M8HA 2FVRA 2DRAA 3KLFB 3DHWC 4AD6A 2VG7B 3DRSA 2ZC4A 1L3KA 3GONA 5DRKA 2A6MA 4JI2F 3IGVA 5J1NA 1VR6A 1Q79A 3I0RB 2YKQA 3FFIA 1RAHB 4WXWA 4XAKA 2HSEB 3H42A 4AXIA 1KP6A 2FHJD 3GPAA 3VGTA 4DV3J 2HURA 3VZHA 1N34F 2IRUA 2OEKA 3FBBA 3HHNB 1ZYQA 3FBEA 1SV5A 3SZ2A 2YY3A 3R97A 2LP4A 1G2EA 3DOMA 3TO8A 4AL5A 2OPSB 5GADU 1GX6A 5KFCA 2UUWA 2C2EA 4X66F 2KRBA 1YJWS 1X5TA 2IM0A 3HVRA 1OY9A 3DGPA 3CJQA 1RTDA 2NXEA 2WB1D 4DL0C 3C3LA 4FDFA 2CIMA 1MU2A 5D4LA 3ZNJ1 4NA3A 2VQFF 4DHVA 4USVA 1LXJA 2WONA 4YB7A 5H1SV 4K4UA 3F56A 4B9VA 3J7A1 1KLNA 5IC6B 5D6GA 1ZTTA 3UDCA 2PA8D 2Z58B 3DMJB 1R89A 2OAUA 2D41A 2FZKB 4N5SA 2XY5A 2WBRA 3AH6A 4M5DB 4Z7YA 2QEXS 3AT1B 3HCXA 3HHDA 3CW2C 4LF4F 1FDBA 1Q86T 3KHGA 4M5LA 1DLOA 3H0PA 3M8PA 1QAXA 4KKOB 3UN2A 4OYXA 1S10A 2ROGA 1S7HA 4FXWA 1LEOA 4F0HA 4DR2J 2EFPA 4RUCA 2KZZA 1HHSA 2Y3YA 2RHQB 1TAUA 3A8EA 1X5OA 2CJXB 1F5AA 3D3CJ 4R0EA 3QO9B 2A2DA 5DQHA 2DNRA 3OVAA 4IO9Q 5GADI 2OD6A 4NI2A 4FS1A 5ITHA 3HD1A 3QGGA 5KG0A 2XLIA 2NS1B 3EGZA 3TRGA 5K8NA 2UUCF 3CUNA 4DBQA 1U2CA 3V4IA 1K73T 5DQIA 2DXEA 4KC5A 3KMSA 3TYTA 5F8MA 1N5TA 5CD4A 1T03A 4GO5X 4EYIB 1YQHA 5GAGU 5HJXA 2AJFE 4HI2A 3QIDA 1R8HA 1RTIB 1NHUA 5I3QA 4M5GA 5KFSA 5EN1A 3CB4A 2YNHB 1TVRA 4FKYA 2KG1A 2ZVSA 2BJ7A 3KLEA 3SIPB 1X5PA 3KTQA 4RNOA 3QFHA 1IQTA 5KFIA 3ITHA 4L76A 3UPFA 4ID5A 3QSYB 1UVJA 3ZFVA 3QRPA 4HR2A 1HMVA 4ED4A 3U02A 1RA7A 2ZJPQ 1T94A 2N4DA 2R7OA 4CT8A 3EVMA 1GTEA 3BJYA 1KHWA 1CG2A 1VBXA 1WELA 4X4SA 5IT4A 3SSQA 3IG1B 4DR5J 1T7PA 1HQ2A 5E2QA 3NNHA 2AX0A 4QWCA 2HAIA 1WC4A 2J6UA 2DR6A 5K8MA 1JXVA 2AIRB 4FYDA 2NXCA 5F8HA 4Y3CA 2MDAA 3LH2S 4L3KA 2CADA 4O3QA 4D3HA 5HQ8A 1DQ9A 5KFHA 3WBZA 3BGRB 5A8RB 1U6ZA 1FEEA 2XQCA 2C3MA 3CIMA 5DETA 3Q8SB 1OYEA 4PQUB 3CDWA 3W7BA 1SQGA 3PNIA 3J7ZT 2E1CA 2M52A 1XTZA 1A0OB 3AAWB 1FRJA 3G86A 2UU9F 3M9MB 1A7GE 4KBIA 3H5XA 3CDBA 3K5NA 4ZVEA 3M8QB 2D1CA 2JSXA 2VPZB 2VB6A 3HX9A 3PRVA 4MFBA 1S1TB 3I0SA 4U7UD 4HEA9 2ZM6F 1S6PB 3FSIA 2IBOA 3MI7X 3ULHA 3MEDA 4K0KF 1WI6A 4LRBA 4KJIA 3R6GB 2ZHBA 5JVHQ 3BV8A 3SDEB 3PHTA 3U1NA 3C6TA 3Q83A 5J2MB 3VF0B 4F4KA 1N36F 3FEZA 1FRMA 1JLQB 3W9IA 2ASJA 4IRDA 1WC0A 1C0UB 4IQXA 2K3IA 1JLBB 5KFUA 1O5JA 5CCMA 3W5ZA 4J9SA 5IQ6A 4RX6A 5DJBA 3M32B 2R2SA 2MQOA 3QATA 4DQQA 4JI4J 1UKUA 2ZNZA 1PBUA 1WC3A 2ZBQA 3RBXA 3H2UB 1NRKA 4ECQA 3KJQB 1AXQA 4JI1F 3O1LA 3PCOB 5HMWA 1A9NB 1Z2ZA 4B02A 1B99A 1WOOA 4I2PA 1H38A 5GVQA 1UW4A 2G2OA 1HARA 5HSPA 5DG9A 3GJRB 1GFWB 2G4BA 4C3KA 3DRRB 2KXHA 3UN3A 3Q8YA 2KDOA 1L3SA 4DF4A 4WK1A 2XSJA 2GMLA 3LQVA 2ZWPA 3SCLE 1YSJA 5C42A 2F3JA 2X51A 3JYTA 2GO9A 4C0HA 3M9NB 1X0FA 1QTNB 2LEAA 2VPWB 3IBFB 2CQ3A 4RW4B 4ZPCA 4RL1A 2HHQA 4YR3A 3C66A 3D1HA 4IRCA 1ULRA 2QLXA 3THPA 1TFWA 3AOCA 3BYRA 2X3GA 1KVIA 4OX6A 1UWBA 2D3ZA 2IVMA 4RW8A 3MMCA 2LXIA 3BDEA 4H4KC 1RT6A 1HNXF 3HK2A 3ET6A 3M7VA 3I5BA 2O66A 2CUYA 4DQRA 4NEZA 1Q53A 4TY8B 3SFGA 2QRRA 1S9EB 2XC9A 4QR1A 4RW6A 2F9DA 1X4FA 4QBUA 2HBQB 1YBAA 3QT6A 3MM5A 4R25A 3CJ5A 2OEJA 2W8LA 1LWFA 4X4QA 2ZE2A 5CA5A 1D09B 4O0NA 5EWGA 5LMNF 3QIPB 2JC0A 2UUBF 2FQQB 1SUQB 3F44A 1S7IA 3BYPA 1TL1B 4YDXA 2YH1A 3Q23A 1U8SA 1X4BA 3VVUA 3JSBA 4Q0BA 2I5JB 3G4SS 3UVJB 3DRXA 2HHXA 4UW2A 2W8KA 3S7RA 1XR5A 4JYAJ 3G2XA 1RWOB 4EK2A 4M5HA 4FVMA 1Y3JA 2B3TB 3AFGA 1EX8A 3WZ0A 3GV8B 3TWZA 3AJ1A 2DXDA 2CQ2A 3M8RA 3MOJB 4OZ3A 3PACA 3ZTQA 2ZH3A 2PEHA 2MGZA 1F3VA 4MTPA 1HA1A 1SC1B 2K3KA 4ECVA 4LFCJ 5D4NA 1NK9A 4ANDA 2DBBA 3IM8A 2KHCA 2WCXA 3BR9A 2OPRB 4F0MA 3GV7B 1WOPA 4ETZA 4NCAA 1BWEA 1RUSA 1IN0A 3I32A 1QAYA 4USJC 3JSMA 2BV3A 1RB0A 2QO3A 2W4CA 4C0OC 1U48A 1QUPA 4HACB 1JWWA 1YWXA 2ILYA 2XG8A 4J9UE 5DO2A 2A3JA 1IKXA 4X4OA 1BQMB 5B0FA 3HJVA 4ELUA 1UW9A 3OPKA 2VOPA 2E1MC 3TW0A 3W8GA 1HYSA 2FYXA 2VOOA 1NPPA 4JI8F 5HO4A 3OTBA 3QWUA 4Y00A 1T9YA 1AROP 3U7JA 3CJ4A 1SJRA 2IPOB 2HVEA 2FHJA 3PEHA 3AXMA 2E5HA 3W65A 1LW2B 5CAAA 1RLCL 3VCDA 5FIIA 3TA2A 1DRZA 3PYEA 2VKZG 1FJEB 1N4LA 1WEYA 4DX5A 4IDKB 4P75A 2ADBA 4X4UA 1Q7LB 4WKYA 1KNZA 4LFAJ 4PXDA 1VRUA 2X1GA 1DQAA 2GW8A 4A4JA 2HK3A 1QLNA 1VQSA 4CO2A 3PRDA 4U7UK 1R6VA 4Z2XA 2W7AA 1GQEA 4U6PA 4M5MA 3NBPB 3S6EA 2Q66A 3UQSA 3KUHA 2YWGA 3CXCR 5BJRA 3B4MA 2W24A 1H98A 3VAGA 1IBKJ 4YB6A 3CJRA 5D3GA 4F2SA 1DTQA 4Y2KA 1T3OA 3KJVB 4OX9J 5A2QY 3SCJE 1ZOTA 3W2VA 3IAM9 2YPYA 3M8WA 4X62F 1GMUA 1S99A 4JI3F 2OO4A 4TLRA 1GAOA 5ETPA 1N6QA 3OVSA 5BYQA 4HVZA 3E3XA 4I2QB 2OPPA 3BO3A 4DCOB 5KFFA 4NX9A 2XI3A 1U49A 3P8BB 4YB5A 3BQ2A 2C3UA 4NXMF 4Q8EA 3I4PA 3RAQA 2YKMB 2Z2ZA 1K9MT 3MUMP 4I4BA 4DL3A 3CC7S 3EMTA 1IM4A 4V19X 3GG0A 2J0QD 3PM9A 4TYBA 5KOWA 3WQPA 4CLLA 2YTCA 2FD2A 4QWDA 2KT2A 1EHWA 4DI6A 2WSFC 2OKQA 1RAJA 2ROEA 4R8UB 5CYQB 2BKPA 4X65F 2RUGA 3O6QA 9ATCB 2HAFA 2F40A 4DWIA 5KG1A 2P6TA 2ZUAA 1KKHA 1HQEA 2MQ8A 1I94F 3N79A 1R31A 1B0TA 2JJ4D 3VVTA 2JZ5A 4XIUA 5ETKA 3G6VA 5DGBA 3IR7B 3ZNUA 4ES2A 2KG0A 5KFNA 1FXLA 4LRAA 1ZAXA 4ZHRB 2VKRA 1M5VC 1JQGA 1MG7A 1JJCB 2H5EA 1NJWA 4O0IA 2KFZA 2R7RA 2LMIA 3M9OB 1KFSA 1X60A 2JC1A 1R8AA 3Q89A 5IWAJ 4KYZA 3KLFA 2UXDF 2VG7A 1QE1B 2RILA 2GVDB 1UVKA 1KQFB 1U24A 4IH5A 1V3RA 4Q5VA 4H4MB 4ETXA 5LT5A 4KRWA 2RQ4A 3D9BA 4MKBA 3MM8B 3BPDA 3I0RA 1JK9B 1APSA 2CQ4A 3MURP 1K47A 4ZVTB 4WK3A 1FX2A 2E9TA 3AB4B 1FFWB 2VQEJ 3OVBA 2BACA 1SKWA 2R9LA 4P72A 1NK7A 5L38A 3ISND 1X4EA 4FXDA 2DNLA 2BE7D 1CSJA 2KB2A 1D0EA 2PSZA 2EK1A 4LMZA 2DGUA 3CCES 1AUSL 4P6QA 4K7QA 4AXJA 2OPSA 3KK1B 3Q0AA 2IA0A 4ZVRB 2KO1A 4C2MA 3GSDA 3RTVA 2CJBA 1Q5VA 3H5YA 1IKVB 1ZA1B 1FTRA 1AZSB 4Z37A 2ZJQQ 2CWKA 3JQJA 1KD1T 5DM7Q 3ZZZA 2GGPB 1NKBA 1XMOJ 1FRIA 1Q81T 1T9UA 2F4VJ 3TEHB 4I6AA 4TXSA 3TQ1A 3VR1A 2DR5A 2J7WA 5CXTA 2WVFA 3W9JA 3QRQA 1DURA 2JLGA 4DR4F 3DMJA 4ECXA 4U9RA 2CJQA 4OLOA 3MEEB 2PFDA 4USKA 1VRTB 1XBWA 2X1BA 3V6DA 2DCUB 4K5SA 1YJNS 4QIGA 1RHJB 1WHYA 4ER8A 4FBTA 3FQKA 3DDNA 1VJQA 2A0FB 4QOTA 1GNKA 2QIFA 2FZCB 4KKOA 3I5AA 5DM6Q 4L74A 2QSWA 2QL9B 2HVHA 4IG0B 4O3PA 1MMDA 3SQGB 4Y34A 3EZUA 8ATCB 4UUWA 4U96A 5KFKA 4WFZA 1CBKA 2RNEA 3BH6B 5LXRA 4B3SF 4HT5A 3LO3A 3QO9A 1H6KX 4AUKA 3GLJA 5SUHA 3UO0A 5A8KB 1FJGJ 1RXOB 2CQBA 1UFWA 4YHHJ 3CD7A 1RISA 3MCMA 5C2CA 4DLEA 4J90A 2H3EB 3TUJC 3FQLA 2OI2A 5KFXA 4JV1A 1Z2LA 2ZKTA 4A8WA 5DDPC 3KHLA 2POKA 4CYUB 4ECZA 1TU0B 1IR0A 3GIIA 1ZZFA 2MLZA 1RCOB 2PE8A 4EYHB 2BOAA 3HD2A 1REVB 1WUUA 3W5XA 2F4FA 1XQIA 1RTIA 5A6PA 1FHTA 1MNEA 3B54A 5LOQA 2PGCA 3NS5A 3L09A 2MB0B 1IKYB 4NLOA 2V4QA 4ZVGA 4M5IA 3VZIA 2VU5A 2DEIA 2ZKUA 4I64A 1BUXA 4NPOA 5I4MA 2KZMA 1PAUB 1VISA 1RT1B 4X84A 3UDVA 1YI2S 2V50A 3RAXA 4EMDA 1NJXA 4RBVA 3GFHA 2VBWA 2Q6CA 2X1FA 3SYZA 3MDFA 2V8HA 3J81j 1HWJA 2BKOA 4LBHA 4OIXA
chains in the Genus database with same CATH topology
1U47A 4TLQA 3BN7A 2KH9A 2KJWA 1BQNA 1X7VA 1MW7A 1YRUA 3UCGA 5M2UA 2KM8B 1FJ7A 2I9SA 5CYJA 3EX7B 4LFBF 3CT9A 1TL5A 3MTKA 4DR6F 4F8RA 3DHXA 2HVIA 1VQOS 3SI8A 1KSPA 4WFNQ 1JLFA 2R4FA 4DUYF 2BANA 5KFEA 1RDRA 3C46A 1ZTWA 1FJGF 3CGIA 2V9KA 5U47A 3D1QA 4C11B 4EU0A 4DFPA 2MSTA 1U1RA 3KLHB 2EFOA 2BM1A 1F2GA 3KG4A 2PT0A 1LWEB 4WIIA 4ILMA 4YHHF 2RS2A 2K1RB 1Q8IA 4M94A 4PXBA 4ZPVR 2R2RA 3DCAA 3LP1A 2PFFB 2R7WA 3OW2R 3MMJA 3LPYA 3G8TA 2MZRA 3GB0A 3AA8A 3NS6A 3H5UA 3TAPA 2C42A 1P9QC 3NGKA 5C25B 2J9EA 3HZGA 1U2FA 2O67A 3PR4A 1RKJA 2VPYB 3M2UA 2GC8A 4K59A 1XR7A 2ZH5A 5G0RA 1N0UA 3DLJA 2VBYA 3MPVA 2AYEA 1BQXA 3BGRA 3LP0A 3KNGA 2J5AA 3PW2A 4ED0A 3BO2A 2J9DA 2FY1A 5IT0A 3B82A 2HNYA 3N6LA 1K1QA 4I68A 4ZPDA 1VRUB 1FDDA 4PQUA 2MKIA 2BANB 3KK3A 2AGOA 3RBDA 4YDDB 2CJKA 4WU2A 4OMFG 3AQPA 4JI7F 3GYNA 2R7QA 3ZZOA 4PG8A 2APOA 1NH8A 1EETB 3DOKB 3DOLA 3K8VA 1RP5A 3KWMA 2MQNA 3PHEA 2YX1A 3QAUA 1YGYA 4RLEA 4A46A 4CO3A 1NKCA 1TZ0A 2YNIA 3K58A 2UVWA 3FSYA 4NLRA 2CZVC 1SL0A 5CH7B 4UQGA 3DLGB 4FF1A 3GMGA 1DZ5A 3UR0A 2DK2A 1VK3A 3HDSA 4I7FB 5L8RC 4CH0S 2XGQA 4I56A 2MQQA 3MUVP 3N6NA 3SV3A 4NLDA 4ED8A 3M1VA 1VLYA 4DQIA 4ILRA 2XEXA 1T05A 3UFCX 4EO6A 5I3PA 5ADZA 5M2RA 4J9MA 1JKHA 1VQMS 3U1LA 1NNDA 2DO0A 2DJWA 2RQKA 3I9V9 5G0RB 4A8XA 2DR9A 4NLGA 1X4AA 3OHAA 2GMHA 3DDKA 2XBPA 3M2RA 3MMAA 4P2SA 2RE1A 3RAMA 1S6QA 2IHR1 3IFEA 4F4YA 1VBZA 1C1BB 2L9NA 2HNYB 3H2LA 2IAJA 2ZDOA 5GAGI 4WF9Q 4Y6IA 2AP6A 4NZ0A 4TNOA 2JEJA 5D3GB 3KMQA 1DTQB 2BBEA 4CO5A 2YWHA 2DIVA 3DN9A 1JIHA 2D9OA 3BN4A 1G3OA 3TOQA 4LIRA 2DGSA 1YRTA 3OFGA 4UY85 1FXDA 3NG8A 4XO0A 5F41A 1M0SA 2AJ4A 3V6JA 2CQ1A 1GXLA 1FRKA 2I38A 4KO0B 1MWZA 3W2VB 4DQSA 2OTJS 1SJ3P 3SDEA 1TKTA 3GIKA 4TQRA 2GQCA 3MECA 3HP6A 3MR5A 3CCLS 2B7CB 1T05B 3I55S 1JKHB 4BCAA 5J2MA 2AGQA 4QWEA 1N6QB 3FEXB 3IR6B 3BGFA 3C6UA 5CD4H 2E9ZA 2KI2A 2I0XA 1S1WA 2L48A 3CWJA 2DO4A 2OH2A 2R7XA 1HPZA 1NJYA 4XPCA 3BF4A 1BGXT 2IAJB 5L1KA 4DL7A 5KFMA 3OXGA 5J2PB 2XB2D 2OPPB 3OFEA 1HNZF 2ZDPA 3I87A 4AL6A 2PI5A 2XSFA 1SJ4P 1T3NA 2AJ0A 2GHWA 4DV6F 2M88A 2DNMA 3I6PA 5DDRC 3KLGB 1JLBA 3LWLA 1V3ZA 4Q7AA 4OZLA 2DHXA 3H4BA 5KFTA 2JHEA 4BHQA 4E0DA 3CVKA 2W7PA 1FKAF 4XDDA 4KPYA 1KTVA 4NA1A 3K7RA 4X2BA 3DXBA 5FDLA 1OQ3A 3T9ZA 2J9DE 5HMZA 1GX5A 4PUOA 2B9YA 3MXHP 5HMXA 3M32A 3V5RA 1NH7A 3F41A 1HR0F 5L1IA 1VHFA 2RJZA 4DJBA 3P49B 3NMAA 3SXLA 1KLMB 4KFBB 4DV4F 3J7YU 3MECB 1HNWF 3PX0A 5L1LA 5KFGA 5F8IA 1Q78A 4KHPF 4KT0C 2JL9A 1ZM3A 2YKNA 3T6JA 3EXCX 4KHRA 3MM7B 5KFQA 2BXJA 5F0WA 4IFVA 1SKSA 2ZH7A 3CCTA 3G6ES 4D3GA 1NHVA 2RQCA 2ZD1B 3HVAA 4GC6A 5DLFA 2BQ3A 2HFOA 2LQ9A 2NPIA 2JWNA 4LSLB 5GMKa 5HMYA 2HHVA 2XWXA 3PO5A 2CJ9A 2XGPA 4PWDA 1QSSA 2VFVA 3KLIA 2MZ1A 1RK8A 5DS7A 4YP3A 2QT7A 1R3NA 4RZRA 2DRBA 1RTHA 3DI6B 5HBMA 5AXKA 1NKEA 3GIMA 2J9CA 1DJ0A 2B5JA 2YKAA 3KG1A 5E3CA 2KHDA 2HYIB 5THWA 2FLLA 3K5LA 1JNRB 4WXOA 1JJ4A 1YIJS 2RT3A 2HGMA 4OZ0A 1HQEB 2MKCA 2RF2A 1CPZA 3DRRA 2IYGA 2WSEC 4O23A 4PR6A 5D4PA 1GTHA 2VODA 1U25A 3UD3P 3MF5A 3IWLA 4DOZA 4B3RF 2CPDA 1MSWD 3M8SA 2FHMA 5K9FA 1R8PA 4CIOA 1NB7A 1TR0A 4EO8A 1FNOA 2BE2A 1W2BR 5EWEA 2YQ3A 1VQ5S 2GO8A 2GIRA 3OFFA 5LXYA 4DR7F 5KG3A 3MM6A 1UVIA 4CI0B 1KEKA 3TUZC 4G1IA 3N6MA 4FNIA 4Q2MA 2CZ4A 1DFDA 2PN6A 4HHJA 4JV5F 4O44A 2DGWA 2F1FA 4E98A 4MK7A 4PWDB 3I82A 1FF2A 2E5LF 5T41A 3PIPQ 5J2QB 2BYCA 1IQZA 2FLNA 2GIQA 1M5HA 4FXVA 2XS5A 3POTA 1TKXA 2LEBA 1ZM2A 5L39A 3CCJS 4A8MP 3PV8A 2M8HA 2XMMA 4RW4A 4OLPA 2FVRA 1C2PA 2DRAA 2WOMB 2YNFB 3KLFB 1LW0A 3CO9A 1S9GA 3DHWC 5J2NA 4DDFA 2VG7B 2J8AA 3D28A 3P6YC 3DRSA 4F67A 1TFYA 2IC3B 2IRYA 1LK7A 2ZC4A 1L3KA 1S1VA 1VMBA 2IFXA 1Y0HA 1Y4ZB 1U6BA 3WC0A 1A6LA 3T5HA 2XNQA 3I4HX 4OJGA 2G0CA 2EC0A 1CC8A 1DHMA 5DRKA 3CPWR 2WW8A 1U4BA 5B0EA 3KOAA 3LUYA 4C8ZA 4JI2F 3IGVA 3Q8QB 4O44B 2VL1A 3B4DA 5J1NA 4BWMA 4Y65A 5GAHU 4I67A 4LF8F 2BRLA 1Q79A 4C0BA 1VC5A 2D9PA 3I0RB 2YKQA 5B08A 3FFIA 2V9WA 2OP5A 4WXWA 2QYCA 5C24A 4UUXA 1N5SA 4DSEA 3IS9B 2L3MA 4MYTA 4QYRA 4XAKA 2B4PA 2FHJD 2XWYA 4AXIA 2XCAA 3DYAA 2MQPA 4ED7A 1FT8A 3VZHA 2RDJA 4J9QA 2LKZA 5E3QA 4HL9A 1HBMB 1L3TA 1I6JA 1R6YA 5H9FJ 2WSCC 1N34F 2IRUA 4WZMA 5KG5A 1CLFA 4QW8A 2LXUA 2FVSA 1E6YB 3MFHA 3DRPB 4TY8A 4C8LA 1S9EA 2PIIA 3HFKA 3HHNB 2ZBCA 3DRSB 5T7LA 2ZH2A 4DR1F 4WCEQ 2QZ8A 1QAJA 2HHPA 1ZYQA 4DL2A 2R7UA 2BDPA 2FJDB 2HNZA 1SV5A 4FZVA 3SZ2A 3ENWA 3G8SA 2RRAA 2YY3A 1P27B 3K5MA 3QJLA 1Y5IB 2YVSA 3MPWA 5KFAA 4CNYA 4B3MF 5T14A 1ZH5A 3H25A 4ECTA 3UCZP 1G2EA 2W4DA 1M5PC 1XR6A 3DOMA 2N7YA 2DNGA 3RW7A 4QR0A 4H4KA 3TO8A 3QIPA 2IMOA 4AL5A 3FVYA 1LWCB 2BQRA 5C24B 2XMJA 4Y2AA 1S48A 1SJ1A 2NSCA 2OPSB 1GX6A 5KFCA 5GADU 4J9RA 1XEZA 3V6KA 1WD6A 3IR5B 1HD0A 3AJ2A 2XY6A 4ELTA 3SV4A 2LDYA 2UUWA 2C2EA 4X66F 4ZVHA 1SUQA 2KRBA 3M30A 6FDRA 4NCGA 1YHQS 1TL1A 4OL8A 3BSAA 5AE1A 3OTCA 1YJWS 3K5PA 1CEZA 2M9KA 1WHXA 1E6VB 1X5TA 2IM0A 3HVRA 5HLFA 4DEZA 3HLUA 3FMWA 4N41A 4IG3B 3ZZTA 2JFKA 4JI4F 4M95A 5IM0B 3DGPA 1QM9A 1VFJA 3PJXA 1RTDA 4DUZF 2ZH6A 3HJFA 3PY8A 5KOXA 4ZPBA 4F3QA 4Y2IA 2WB1D 4DL0C 2M3DA 3C3LA 4M5DA 2B4OA 2CIMA 1MU2A 1S6UA 2LXFA 4WYWA 4DV1F 4JUZA 1R43A 2I5JA 2EI5A 2MQMA 4NA3A 5D4LA 4QU7A 2HQ3A 1FKOA 3PZPA 3HVWA 2VQFF 5LJ3Y 1S76D 4DHVA 1LXJA 1Q82T 1NJZA 2EK6A 3NWGA 4PG6A 5HROB 2WONA 4EWTA 1X4DA 4YB7A 1HBNA 4HDHA 5H1SV 2IBKA 4K4UA 3F56A 2ASYA 4B9VA 3J7A1 1VGYA 4DV5F 2GA7A 3GR1A 4NXNF 3QLHB 4ZKAA 2DD8S 2ZC3A 3NCQA 3OFHA 2J0XA 1KLNA 1YJRA 4EGLA 1URNA 5D6GA 4EBCA 4MJKA 3AB2B 3PR5B 2DR7A 1ZTTA 3UDCA 2FUG9 1RT7A 4HDGA 4QIEA 2M4MA 4PWUA 4LUBA 2PA8D 4KGMA 4LF6F 3DMJB 3DLKA 1IKWA 1R89A 2OAUA 2QA2A 2V2KA 5A0YA 3NCRA 4FF3A 1OQ6A 2ROPA 2D41A 3SMZA 2VONA 1RTDB 5B7WA 3HKWA 3RZAA 5EGYA 4N5SA 1D3WA 2WBRA 2IM1A 4I1TA 3AH6A 2XY5A 3DLHA 4PPDA 2VFUA 3HMJG 5F8JA 4M5DB 2WHOA 3M2VA 1UP1A 2QEXS 2FB0A 1FRXA 2Z2LA 4RNFA 2DIUA 2WK4A 2IJFA 1U09A 5K5MA 4EUVA 3HHDA 2AV5A 2ZHOA 4LF4F 1FDBA 1HWLA 1RJJA 3BSNA 1N52B 2RVJA 4NLVA 5GAHI 1Q86T 3KKFA 4ICLB 4MIWA 5JXSA 3KHGA 2KT5A 2HGNA 1DLOA 1SKRA 3R1HA 1S4FA 2ALZA 4C3LA 2GJ2A 3M8PA 3GWCA 1QAXA 3H5SA 4KKOB 1S10A 4K4ZA 1CVJA 2OPRA 2ROGA 3FRYA 4IOCQ 4X4RA 1FK9B 1S7HA 4FXWA 1XNRF 1IKWB 3AHPA 2FLPA 5KFLA 2QMWA 3QZ8A 2B51A 2EG1A 2YKOA 5KAKA 5KTQA 3DU6A 3A1YG 1VQYA 2EFPA 4FPRA 2PO4A 2P9EA 2YX7A 4RUCA 1D8ZA 2PMZD 4CO4A 2KZZA 3CD6S 1HHSA 1HQUB 4X64F 2XCPA 4NLWA 1TAUA 3IA0A 4OI2A 3KHRA 3A8EA 1X5OA 2W9BA 2NZ4A 5DDQC 1F5AA 1TK8A 3LW5C 4R0EA 3QO9B 2A2DA 3D1OA 2ZUGA 2XY7A 3V81B 4OX7A 2WAQD 2IVFB 2W9CB 5DQHA 1Y7PA 2DNRA 5I3UA 1HBUB 2JEFA 3HVTB 5HI7A 3OVAA 3LGNA 4P7VA 2ZH4A 1DLOB 3NAHA 4CCHA 4IO9Q 5GADI 2OD6A 3TVZA 1SL1A 1UA1A 4FS1A 4MYUA 3M8PB 2AYBA 4RW7B 5KG6A 3NLCA 5ITHA 3C2PA 2O5DA 4Q43A 5B0BA 3KK2A 1Y5NB 5EWFA 2Q6BA 3QGGA 3KFWX 2LQ5A 5KG0A 2YWFA 3JAMY 5KG2A 2ZHAA 5L1JA 2XLIA 2NS1B 3LANA 3LP2B 4NOHA 2HNDA 1O0PA 1JJ2R 3TRGA 1D9FA 3EGZA 2FIUA 2C2RA 5K8NA 3PX6A 2DHSA 2UUCF 3CUNA 4MK8A 2KXFA 3EUNA 1FEHA 4DBQA 4WTYA 3NMRA 3D2WA 3SFUA 3V4IA 2LDIA 2YNHA 5D4OA 1K73T 5DQIA 1RYSA 2KU7A 1KFDA 4KC5A 2EBGA 3KMSA 3TYTA 5F8MA 1N5TA 4O4GB 3FJ2A 1P1TA 3T5LA 3MUTP 4B3OB 2JLEA 4YY3F 5I3UB 1T03A 4IUFA 3EXYA 4GO5X 4G1QA 3HO1A 1D1UA 4EYIB 2M7SA 1RTJB 1YQHA 4A8QA 3T1AA 3PW5A 5GAGU 2BJDA 1DTTA 3IXQA 4GMKA 4O3RA 2AJFE 1LW2A 2MKHA 4DV2F 2Q79A 5A8WB 2I1RA 4FF2A 4HI2A 3PEJA 1LFPA 5B0GA 4ES3A 4NCBA 4PKDB 4QW9A 3OJUA 3QIDA 3OL7A 1NU4A 1R8HA 1RTIB 2HNDB 3MEGB 2HVZA 5KT6A 3BSOA 1NHUA 4HLBA 3T9NA 1XNQF 1N0VC 2BA9A 3EZ5A 4K4SA 2HW3A 1ZBTA 4IFYA 5F8GA 1IXKA 5I3QA 4F3OA 4N56A 2K7KA 5KFSA 3R5AA 4IDKA 1DARA 1J5OB 5EN1A 3CB4A 4LJMA 2YNHB 2QMXA 4J5OA 1H0HB 1TVRA 1WWHA 4ID8A 2CVIA 4I0WA 2R2TA 2AQ4A 2F8EX 1VIOA 3DLEB 1TL3A 2KG1A 2B4UA 2PMHA 1SB6A 3HI9A 5LMUF 1VC6A 3UI3A 1VS3A 2ZVSA 2CPIA 5J1EB 2Z2MA 5KT4A 1N5VA 2A10A 2ZOGA 1T03B 4FF4A 4URQU 4HH1A 3KLEA 1X5PA 4NWBA 4H4OB 3KTQA 3IG1A 4RNOA 5I42B 3TVYA 4OHXA 1VC0A 1HW8A 2OJ3A 1IQTA 2L9WA 5KFIA 3ITHA 4OI1A 1F60B 4ZLPA 1IUJA 3BQ1A 3UPFA 4ID5A 3D0HE 2NSBA 4NZ6A 2HHWA 4KGKA 1MROA 1UVJA 5F8LA 3SSSA 3PO4A 3ZFVA 1P8GA 1LXNA 4N47A 1HMVA 2UXBF 4YUDA 1RI7A 5CCLA 3LF0A 2ILZA 3IO1A 3HT3A 1FO1A 4N8NA 3U02A 1T8EA 1RA7A 2ZJPQ 5LSRA 1T94A 2N4DA 2R7OA 4CT8A 3RBEA 4DR2F 4LQ9A 3K59A 5KFRA 1S0VA 3JSRA 1GTEA 4NA2A 4TKTA 3BJYA 2AYGA 3TX8A 3W2WB 1D8YA 5B0CA 1KHWA 1YJUA 2GQQA 5L9NA 4DSIA 5LL6d 4MMOA 1CG2A 3KJVA 3KLEB 1BQNB 2IRXA 2V4RA 2V94A 1VBXA 1WELA 4X4SA 3FZBA 4A8SA 5IT4A 1HBOA 1MWYA 1RT2A 2D74B 4NLYA 4ZP7A 5A8RA <