4TNOA

Hypothetical protein pf1117 from pyrococcus furiosus: structure solved by sulfur-sad using swiss light source data
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
84
structure length
84
Chain Sequence
MYIVVVYDVGVERVNKVKKFLRMHLNWVQNSVFEGEVTLAEFERIKEGLKKIIDENSDSVIIYKLRSMPPRETLGIEKNPIEEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRISPR-associated endoribonuclease Cas2
publication title Fast native-SAD phasing for routine macromolecular structure determination.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 17
structure length 84
sequence length 84
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09827 CRISPR_Cas2 CRISPR associated protein Cas2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4tnoA01
3E3XA 1DARA 1ZM4A 4QR2A 4ZCKA 3ZZ0A 2WBMA 2E1RA 4MYUA 3UI3A 2L9NA 3EXCX 4ZCMA 3OQ2A 1VI7A 4TNOA 3B8HA 4ES2A 2CVEA 1T95A 2BM1A 3ZZTA 2KDOA 2ZITA 3B78A 3ZZUA 2I8EA 4ES1A 1N0UA 1N0VC 2EFGA 4ZCIA 2I0XA 1KTVA 1ZPWX 1FNMA 2BM0A 4MYTA 3LH2S 3B82A 1P9QC 2XEXA 2NPFA 4M1KA 4ES3A 4QR1A 5G4DA 4FN5A 4MAKA 1ZM9A 4QR0A 4ZCLA 1ELOA 1U2RA 2BV3A 1ZM2A 2IVYA 2J7KA 1ZM3A
chains in the Genus database with same CATH superfamily
1ZM4A 4QYRA 2AJ2A 2KDOA 3W2WA 1FRMA 2GJIA 2MQQA 3WDOA 2DPJA 3FZBA 1DAXA 3T5JA 3KLEB 4D3GA 4URQU 1UW4A 1AUDA 1MLAA 1M1GA 4HEA9 2MSTA 3RB4A 4TYBA 1RT4B 4QWBA 1S6UA 3DRPA 3FSXA 4DR7J 3W1YC 2BXJA 3HZEA 4QPTA 1JQGA 1S49A 4Q43A 3UDCA 2M0GB 2WONB 3TJAA 1WDTA 2WVEA 4DQSA 4J90A 2RD5C 3TJ9A 3PO4A 2JVRA 2I38A 2I6WA 3NL0A 1B70B 1D09B 2JX2A 4X4RA 4FYVB 3I9V9 5BR8F 2YPYA 4QIGA 1VK3A 1IBKJ 1FWPA 3RRHA 3SQGA 3CCJS 3MECA 1XN9A 3GSDA 4I4BA 2P8IA 4LF7F 2DR7A 3QGIA 5L1JA 1HBOB 3E01B 4OI2A 2XY6A 1L3KA 1SJ3P 4OZNA 4C3KA 2E7WA 2FLOA 1H72C 2CQBA 5B0EA 1CPZA 3I56S 1VBKA 1M5HA 3VAJA 2NXCA 1UZHA 2PT0A 4HACA 1B64A 3FEZA 1XNQF 1JLGA 3VR1A 4EUVA 5D3GA 1Y0HA 3OT9A 3V6JA 3SQOP 1T7PA 1IWGA 3O3LA 1XQIA 4IH7A 3A4TA 2J6TA 5SUHA 1HNWF 3RTVA 2GCFA 2W01A 3MAAB 3PYFA 1FDNA 2L48A 3KLIB 4LFAJ 3L9ZA 4BC7A 4B08A 2F3JA 3KYLA 3NAHA 1HBUB 1T9YA 3C16A 2W8KA 2DCUB 2IVYA 1UPMB 2G0CA 1EARA 2ZFHA 3CD6S 1WG5A 4R0JA 2DGXA 4ECQA 1OY6A 1U8SA 5D4OA 1S1WA 1HR0J 4ED3A 5K14A 4QU6A 3T1YJ 3CT9A 5DDPC 1S0VA 4R25A 1Q81T 4J7CA 1ZPWX 2OMOA 3PJWA 4C8OA 3GV5B 4DV3J 1FWLA 5K8PA 5GADI 2PSZA 2HAIA 1T94A 1CULB 4LF4F 1NDPA 2R8IA 5E3QA 1REGX 1KVKA 2BJ1A 4U9RA 3PRBA 4RBTA 2XMMA 4FYYB 3BN7A 3N6MA 4IFYB 2RSQA 3CDBA 3HSJA 4DV2J 1U09A 3H2VE 2JJ4D 4ECWA 4QPXA 2PEBA 2QLXA 3ZTOA 3QZ8A 2VPYB 3M2RA 4K2XA 2ZH2A 4JP8A 2WW8A 2HURA 4LF6J 4F4XA 3C15B 4QBUA 4DV5F 3CE8A 4XTTA 4YB6A 4CTAB 4JV1A 2F8EX 4WP8A 4WFAQ 1S5ZA 1DLOB 2R8JA 4WU2A 4WYLA 1BQNA 1JJ4A 5GAGI 5L46A 3LALA 1SQGA 1S1VA 2U1AA 2IRUA 2GJFA 3MPYA 3QAEA 4J9UE 1JXEA 1KFDA 1OY8A 4H4OA 4LR7A 3AXKA 2CWXA 3IMQJ 1DTQA 2EK1A 2Y9HA 4RUBA 5ETVA 2HIQA 2IRXA 3KJVA 3QZ7A 3PEHA 2HHTA 1SH0A 3CJ5A 4LF9F 4DV7F 4WP3A 3HFZB 5IT9Y 3RR8A 1X4FA 3NXZA 4DJBA 5FD1A 2RDJA 4DLEA 1SQFA 4NXMJ 3THTA 2VOPA 2K1RB 3DHXA 1RB0A 1FWKA 2BJ8A 2J6SA 2QYGA 4P10A 3PYGA 5CXTA 5ETOA 4DFMA 4MK7A 4LRBA 1RHQB 4OV6A 1HKAA 3FFIA 2FJAB 3IAS9 1C0TA 4M5NA 2VICA 3WX8A 5LXRA 3AD9C 3TAMB 1N33J 3W9IA 1MWQA 2V4QA 2KHCA 4ETZA 3QIPB 1RAIB 2VASA 2QLJB 3FQKA 1WHYA 5K5MA 5B0AA 2IJRA 3TW0A 4H54A 1UTAA 4FXDA 4WKYA 3HULA 3FMWA 3H8YA 2ADBA 2DNZA 4OHVA 1S0OA 3P49B 1RAAB 1CSJA 2JNJA 1N8RT 4I68A 2AF6A 4NMLA 2E1PA 1Z1ZA 4KFBB 4RU2A 5G4DA 1H2TZ 3CC4S 1FESA 2YNGA 2CQHA 1ZA2B 1OJ4A 4P74A 3EWGA 3MCMA 3LPYA 1IR2A 3P96A 2ATCB 1OYDA 4N47A 3KTQA 3IP0A 5K8MA 2QFJA 2BJ7A 3OR2A 2FTRA 2ZM6F 1NDLA 2P9GA 3DYAB 4C8MA 1K73T 3JQKA 1KBRA 3MGJA 2LEAA 1A6LA 3J7YI 2MMYA 2D1CA 2OSQA 4YR0A 4EU0A 3TVYA 5F8MA 3G87A 3PZPA 4RW6B 4CLLA 4Q45A 1WTFA 2LDIA 3DOMA 4IUFA 3S8SA 2QT7A 2HS3A 3D6HB 2XNQA 1I94J 3E2EA 1IQTA 2ZBCA 2Y3YA 3M6VA 2FPHX 2QMUB 2RIJA 3BPDA 4E8UA 1KQFB 2QEXS 4R0EA 1TL7B 1RTDB 3GLJA 2QMWA 2BW2A 5U47A 1GEHA 3MMAB 3D67A 4ALZA 5A8RB 2ZHBA 1RAHB 3DKDA 2I1RA 3QT8A 1KS2A 3N28A 4U95A 2B6AB 1FD8A 1RA6A 4DG1A 5KT3A 1S77D 5T7LA 2LFVA 3PDNA 1TL4A 1FK9A 1RT6B 4JI3F 1PJ6A 4IR1A 1Y3KA 1WUUA 1AZSB 2EC0A 3GFXA 3RB0A 4OZ3A 4OYWA 2CZ4A 2FY1A 3NMRA 5A0YA 3DMJB 3FZ2A 2DR6A 1FTRA 4FP9A 1RE1B 3TZZA 4FF4A 5F3ZA 2HGNA 3EXCX 2HK2A 4IFVA 4I6WA 2GJ2A 3PW4A 3M6UA 3ONQA 3BGLA 1X4AA 3R8YA 3MCOA 4DR4F 3FEXB 4DV0J 4OJGA 4PG6A 1GMVA 4M95A 4WFXA 3KNAA 3G6ES 2V5HG 2KRBA 1FX2A 2MZSA 3NNAA 3MAQA 1SBRA 3PG9A 4ER8A 1SL1A 2XC9A 4ZP6A 3TQEA 1FCAA 4RW7B 4XO0A 2MZTA 1VLOA 3ZXWA 3WBZA 3NS5A 2AJ1A 4YHHJ 3BGFA 2XB2D 4DU7A 1EETB 1JLFB 2RHSB 4RW4B 3ZZPA 1RHRB 2DNMA 4X64F 2V4JB 5KG7A 1UKUA 4F4AA 2M5YA 3RBEA 1S0MA 1EHWA 1WDDA 1YJ7A 2VH7A 1VQPS 4M5DA 3MURP 4QW9A 4P2MA 1XMQF 3MEGB 4ZN3A 4ED2A 3TANA 4OYAA 1S4EA 1X4BA 1TKXA 2C2OB 3I5CA 2Y1JA 3F73A 3TAQA 4OX9J 4A46A 4HI2A 2ZITA 3ET6B 5L1IA 3R1LA 1NRKA 1JB0C 1UZDA 2BANA 3POTA 3LP1A 1RADB 1U6ZA 1R3NA 4RBVA 2CJQA 2ROEA 2O5DA 4DPOA 2J7UA 5KFIA 2X1BA 3BQ1A 2YQ3A 3PO5A 1P6TA 4OZ1A 1CJTA 1FRKA 2QGFB 5KFBA 2GQQA 4ZVUB 2HS0A 1FDAA 2V34A 3M9MB 2HKEA 5B08A 4WP9A 5EWFA 2MQLA 3BQ0A 1XR6A 3UDEA 5CA5A 1WKJA 4RW9A 4WYWA 4PWWA 4JI8F 4ZCMA 4KHRA 3CCVS 1JKHB 2RKIA 5DQGA 2VQEJ 2DKOB 1VJWA 4KT0C 4KGMA 5LJ5Y 4DL5A 2FHMA 4Q5VA 2QL5B 1S57A 3D0GE 2CUYA 3KMSA 1U25A 2ACYA 1MG7A 3BDEA 2GZOA 2MTLA 3NOCA 4DI6A 2W4DA 1WD6A 4QOTA 4J91A 1NXIA 2F1FA 3MI7X 3HFVA 3QJLA 5J2NB 1TMJA 4F3MA 4DFPA 2DGSA 5C24B 3GCXP 4ZVEA 3LPEA 5AE1A 1TL1A 5DM7Q 4UOHA 3ZC4A 1RHUB 3OR1B 5D0GA 4O0IA 3UCUP 4CLWA 4JI1J 1U0HA 4DF4A 1JXLA 3KLGB 2VDHA 3V4MA 3HVAA 5CYQA 4DL7A 1S48A 3T6BA 1IKXB 4IDKA 1S1XB 1EKSA 2NXUA 3U7JA 1BY9A 1TFWA 4K4TA 2YXLA 3VCDA 2IC3B 3J7AN 2W4CA 3CDAA 2IPOB 3U02A 3OUYB 4W90B 2PE8A 5HBMB 4WK1A 2GVZB 1Q86T 3MAHA 2HNZA 1VC5A 2Q3PA 2K3IA 2YH0A 3RBXA 4C4WA 2GVDB 2ZH5A 4OHXA 2LLZA 3FJ2A 1GFWB 3DRSA 2FZKB 2B8PA 3ZZZA 4HDGA 1IBLF 2YX1A 4CTAA 2BJ3A 2V67A 2ZEJA 2F40A 2BVZA 4KAIA 1RAFB 4I2QB 1HNZF 4LR9A 3ZZ0A 1QE1A 2CA9A 4K0KJ 1PC4A 3IA0A 4R8UA 4OX7A 4K4ZA 1PSDA 3MM9B 4P73A 1NH8A 4DHVA 2XGPA 1YRXA 2EC2A 3KJNB 1SUQB 2F8HA 5KG0A 4NLSA 4DWIA 2EVZA 1K47A 3MUMP 2Y1RI 4ETXA 1UFLA 1NSKL 2W8LA 5KT5A 1NHKL 4C8YA 2XSJB 2JFDA 3AOBA 1NJXA 5KFMA 3C6TA 4DOZA 1KOHA 4JI4J 4K7QA 2AJ4A 3I96A 4WIQA 3FQLA 2D3OR 1H2VZ 1KLNA 4KE5A 3DLLQ 4PYAA 3W65A 1TV6A 4KKOB 1NKCA 4F2RA 2WVDA 2C2MB 5HROA 3KUEA 1VMBA 4W4MA 5HI7A 2EKYA 3RAMA 4LRFA 4FVMA 2VL1A 1YJVA 1T9TA 2MPUA 2J6UA 2KXFA 2UU9J 3QFWA 2QA2A 2BKPA 1A7GE 5ETNA 5KG1A 3OJSA 1WEYA 2AYBA 4AD6A 3EX7B 5BYRA 1VQKS 1NJWA 2CFXA 4ELTA 5B0BA 1SJ1A 2XY7A 4ICLA 2HNYB 4O0NA 5JVHQ 1NU4A 2GC8A 3J7Z5 1JXVA 2GAHC 3QIDA 2ZH4A 1R0BG 1DURA 3RB6A 7AT1B 1LWFB 2EBEA 4RX6A 1JLEA 2GGPA 4HTJA 1MNEA 4DR6J 1WSRA 1H7XA 5L1KA 4RBUA 1A9NB 4B3SJ 2H54B 5J2MA 3WZ0A 3NNCA 3JYTB 4B3OA 3K0JA 4TU8A 4P9SA 4LBIA 1FJ7A 2H4WB 5ADZA 3U1NA 2K7KA 1D0EA 2CDRB 5ETQA 4KC5A 4CLUA 4J9NA 4D3HA 1G4CA 3PYEA 4DPUA 3K7RA 1UAWA 4IG3A 1NKEA 2L08A 4X2BA 4I7FB 1NHVA 2B4OA 5FLXU 2DR5A 1XJWB 3T5HA 1BMQB 2WSEC 2F9DA 3PR4A 3PW7A 4Y34A 3DLBA 2AJFE 1K0VA 1RABB 4DV1F 2DEIA 1LWEB 4NZ7A 4L73A 4DR1F 3KXDA 1CJKA 5C7PA 1RT1B 3CC2S 2WVBA 4CLZA 1VGYA 3MEKA 1QLNA 2V8GA 2XLJA 1ZBTA 1YG0A 1H6KX 5L38A 3TRGA 1IBCB 1U1QA 2NXEA 5HLFA 3DHWC 2YKMA 4ELVA 2NYIA 1PBAA 4MJKA 4DR3F 1T9XA 2QN6B 2YH1A 3UW1A 5A8RA 2QLWA 2DGQA 4ID8A 3OLAA 2GFFA 1F5CA 1DTTA 4C0HA 1HQ2A 1QSLA 1TTHB 2FHOB 3W5YA 1V6HA 4NEZA 1VQYA 3GP9A 4ZITA 3AHPA 3D0IE 4DV6F 4ZVSB 1WC4A 2LEBA 2KL8A 3QLHB 1NB7A 2K2PA 1TMMA 3B4DA 2ROGA 4Q2LA 1U1PA 2JC1A 4GVBB 3K8WA 1FEEA 3DRRB 2RE1A 1T05A 3OTOF 1HQUA 4FNIA 3IGNA 3MEDB 2HHHJ 3CJSA 1M5PC 4IQXA 2EG2A 1LK7A 1ZAWA 3IG1A 2Y1LB 3H4BA 2DXFA 4HH1A 1N36F 2RU3A 1J5OA 3SSRA 4NXNJ 1NK0A 1B0TA 1NJYA 2JFKA 2DEJA 5A8WB 1C1CB 2ZWPA 3NGSA 4GRSA 4CLFA 1Q7YT 2QTWA 3DI6A 4DR3J 1CJUA 4XAKA 4IYQA 5HMXA 2DRBA 2OPPB 4DFKA 2B56A 1FXRA 1N0UA 2XO6A 1OYEA 1UVLA 3BEGB 3I82A 3G6YA 4DUYF 2XS2A 2YNHA 3FBCA 3A8JA 1Q5VA 2G1DA 4AQYF 2XYGB 1F9EB 2GW8A 4NI2A 3A3PB 3B82A 2Z56B 3M2UA 4NZ0A 1H2UX 3CMES 1QAYA 2NUHA 2U2FA 3B4MA 2MY7A 5EDWA 3KKFA 3HO1A 1Y9OA 1FNXH 5I3QA 2FJXA 2GIQA 4OYPA 2VG6B 1EB0A 2XBPA 4MKVA 1C2PA 4X66J 3VAFA 1I1GA 3C14A 2CNOB 1XMBA 2HFZA 3TR5A 2BRLA 3RAXA 4Q44A 4E98A 1JLQA 3H0PA 2VJUA 1LWCB 4FKXA 4H4KC 3Q23A 2BMBA 4DUZF 1LV5A 5LT5A 2W24A 2WVFA 2K8GA 2XZTB 3W8GA 1TKZB 4ED4A 3EM1A 1SXLA 1HHTP 1JKHA 3OQ2A 2E5HA 2AQ4A 5B0FA 2ZH1A 3CPWR 1LWXA 1S6QA 2AHOB 3PX6A 4OQJA 1V3ZA 2OPRB 2LQBA 3LWLA 2J9EA 2CQ0A 4NCGB 4L6V3 1RWPB 2RS8A 1HL6A 1NH7A 1S9GB 1KHWA 3G8SA 2J0QD 5J1EB 1WI6A 2QE5A 4DF8A 1H38A 2R7QA 2IM2A 1GH8A 2D3UA 2E9RX 2M8HA 4Y28C 4EZ9A 2JLGA 2MGZB 4Z37A 1N5VA 3VAMA 1UW9A 2YY3A 3UN2A 3GZ7A 3EPIA 4ZVQB 4CYUA 3L09A 2B7CB 1O8BA 3R5DA 3DLEA 2J76E 2UXDF 3DLGB 1SV5A 3AODA 3FNNA 3IN5A 4FYDA 1S10A 1HNVB 1N56A 3K5OA 3V4IA 1GXTA 1JX4A 4KSEB 4NA3A 4LF5J 1GT8A 3D6TB 3W2VB 4N77A 5AXLA 4X65J 2F4FA 3IR7B 3AJDA 2IC3A 4X84A 2I5JB 4LF1A 4N41A 5KG5A 3HSZA 4J9QA 3TUIC 5GMDA 2BOAA 2KHDA 4ZIWA 2GVDA 3J80Y 4JI7F 1WHXA 1U1RA 3LAKA 3KK3A 2Y8YA 5HSPA 5IXUA 3H7HB 4PWUA 4ZPBA 1NO8A 4G1QB 3NY0A 4UF4A 1EQMA 1UWBA 2HBYB 2WVCA 3LP0A 3T9NA 1R6YA 2VBYA 1P27B 1C0UA 1RDRA 2X1GA 5AJ3J 2KG1A 4HVZA 2L9NA 2HHUA 1QY7A 2HFUA 3N6LA 5CH7B 4NLUA 1G1XA 2RAQA 3BYRA 3TX0A 5KOXA 1Y00A 3EVMA 5E3PA 2I2YA 1WELA 2CPEA 2B7BB 3S1TA 4UQGA 2XMVA 3P45B 3G82A 3BR8A 2ILYA 2GV1A 1RHMB 5DGAA 1R43A 2YWWA 1MMLA 4RUAA 5F41A 4PXBA 4PQUA 1Q8BA 1U8WA 2C22A 4FYWB 4Y2AA 2AEFA 3MPDA 4F4WA 4MIWA 2IA6A 4QR1A 3R5AA 2WSCC 1VDHA 1PKUA 2KI2A 4NRTA 5LM7E 1YTYA 3BGUA 3CB4A 4CLPA 2F8MA 1LW0B 2HG4A 2Q66A 1HWUA 1PILA 3OHAA 2KU7A 3FBEA 2UP1A 2JC0A 5F9LA 1XNRJ 4USMA 4CCHA 3M32B 2FHJA 4F4YA 5KAKA 3I32A 2DHGA 1S1TB 2KFYA 5DG9A 4ZVTB 2HVDA 4X4SA 4FPIA 3MFHA 4AL5A 1Q8LA 1LKZA 1UFKA 2XTJP 1YZ7A 2CVEA 1AT1B 2YTCA 3BBBA 1FA0A 4DDFA 3MMBB 1HYSB 4LQ9A 2CADA 4UZBA 4USVA 2UV8G 5F0UA 5D0EA 3Q83A 5LJ3Y 3HM9A 4ZIVA 1VQ6S 1TL5A 1WEZA 2JEFA 1RT3B 1B4SA 3MXHP 4C97A 1T8EA 2QLFB 4ES3A 4WU3A 4JV5J 2VA3A 1KRPA 3MMCB 3WX4A 2FYXA 3L7UA 3FRZA 5CABA 4CT9A 1YJ9S 1IR0A 5LSOA 1NK7A 2HVIA 3DGPB 1BC6A 5KFPA 2B0GA 3JYTA 3C66A 4DX7A 4P75A 1RWWB 3SCIE 2VHGA 1RHKB 4WFYA 5HO4A 3GIJA 2HGLA 4IKAA 4QIEA 3QRQA 4M5MA 4ATNA 2GX8A 4XDCA 5L8RC 1T9UA 4IR9A 4RNHA 5D4PA 2LECA 2RRNA 4ZHRB 3HHLC 4NLGA 4F67A 3H40A 5DLFA 2QRRA 2OO4A 3BGRB 1UVIA 2B9EA 5L9XA 1T95A 2DXEA 2V6AA 4P6QA 2VQFJ 1R8BA 2MY8A 3HKZD 4OZ2A 3I31A 1LW2A 3QWPA 1FJCA 2KKHA 2GAGC 4ZJQA 5D78A 2VJVA 2RDIA 4IRCA 3NWRA 2HQDA 1RGVA 2UVVA 4PCQA 4ED6A 3GIMA 3GU0A 4V1Ak 1FFWB 4K59A 2XMWA 4E0DA 3R6LB 1YRTA 3LP2B 4NZ6A 1NK6A 3QSYB 2PIIA 3GJTB 4HLBA 2DY9A 2F9JA 3KFWX 2H9ZA 3MWBA 1FKPA 1HMVB 5G0RA 3V81B 3K5LA 5KFFA 3JTNA 2ZHOA 3C6UA 3IR5B 5CCLA 1RISA 3NGUA 3H4DA 1NEEA 2XWXA 3DCAA 1U2FA 4YY3F 2IM3A 3BN4A 3QLHA 4O4GA 2CZ9A 3PCOB 4LF8F 1GQEA 3U27A 1JJHA 2LQJA 2RU9A 2VFRA 3TUPA 2FVRA 3HVWA 3MFIA 2VKRA 3GIKA 3EVOA 4Z2XA 3UR0A 2KVIA 3W7BA 1XBWA 3CIZA 3MEDA 4CT8A 3H5UA 3L7OA 2DNKA 4AT1B 2OEJA 3A3OB 5J1NA 1RAGB 5AXKA 3I9ZA 2CG4A 2PA3A 1QVGR 3OLBA 4LFBF 1IKYB 3J81U 2VG7B 1J2VA 2W25A 3SSQA 4C8NA 1PCAA 3LAMA 2OKQA 1DQ8A 2YPZA 1KN6A 1B7YB 4N5SA 2MLXA 1ZM2A 3CMQA 4ED5A 2RS2A 1UVMA 1QD1A 3Q89A 3TI0A 1D8ZA 2M7SA 2ZBRA 4LUBA 1HWJA 3BKTA 5B0CA 2WTFA 4YY3J 5F8GA 3J81Y 1R0AA 3Q8RB 1TAQA 2WCXA 2BKNA 2VPZB 3D66A 2E29A 2WW4A 4USJC 2NXNA 4FXVA 3HPOA 3D54A 3H5SA 4JOUA 1KONA 3KK2B 4RNNA 3VQTA 1WI8A 2CPFA 4P2SA 3J7YU 1MMNA 3QAUA 1H98A 5DJBA 4G65A 1RQ0A 3CJKA 3O8WA 2RDDA 2DHSA 4OFZA 1HPZA 3FBFA 2J0WA 4KHMA 1OO0B 3KLFB 1SB6A 2K7JA 1SJ4P 2GO9A 3JQJA 2QA4S 1L3TA 2EBGA 1HW9A 4QWEA 3ZZOA 1BLUA 2C3YA 1BQMA 4ZKAA 4TYAA 4ZPTR 2G4BA 3MOZA 3UI3A 4QIVA 1X5OA 3C3LA 3P8BB 1N0VC 1WHWA 1FRLA 4I2PB 2V2KA 3M9OB 1SI9A 4C3MA 1DQ9A 4I67A 3D0HE 3LGHA 3NAIA 4LSZB 2MKJA 5CD4A 1XMOJ 2DNQA 4IG0A 3ETMA 2HNDA 3NBPA 2RQKA 1UP1A 3PJXA 5THWA 2BDPA 4LVNP 4ELUA 4H4MB 1NDCA 4IOAQ 1IN0A 3FSYA 2QG9B 2CVIA 2PO4A 3EMTA 3NLCA 4NLDA 3M30A 1U24A 1RUSA 2ZDPA 2W2OP 3P5TL 1FE0A 2C2EA 3PACA 2MGZA 4ILRA 1RT7B 1QAIA 3G4SS 2BV3A 4I64A 3RW6A 3NGRA 5KFDA 2DJWA 4ZP7A 2F4VJ 4UY8T 5KFZA 2UZAA 2ZZNA 4V19J 6FDRA 3TZXA 2HBQB 3GB0A 3MR3A 4K4WA 3CD7A 1RWUA 2CQIA 2WBMA 2VB6A 3VGSA 2AWZA 2UXCF 4USIA 1ZA1B 4TY8B 1TUGB 1FKOA 4WBFA 3HJFA 3PFEA 4PWDB 3VAKA 2AIRB 4MK9A 1JLBB 2I5JA 2MEWA 3G86A 3EGNA 4USWA 1Q5YA 5EGYA 4NASA 1T0TV 1YJUA 1IXKA 2OFHX 3ISND 4BDPA 5IQ6A 7FDRA 4JYAJ 4BLGA 4IQMA 3VQSA 2HFVA 3OJUA 1QVFR 4Y2IA 1X0FA 4Q0BB 3OPKA 3M1VB 2ZJPQ 3H2LA 3LWMA 4BS2A 1TL3B 4NRUA 3KHRA 3T1HJ 5DO2A 1IR1A 3HLUA 1VQNS 1NK5A 1VQ9S 2JWNA 2WOMB 1K1SA 4IO1A 3UNGC 2VPWB 1RAEB 4KTQA 3GMGA 3ZZTA 2ZOMA 2KJWA 4J9SA 5KFGA 3ZFVA 2NREA 4JUZA 4WFNQ 5D4NA 3HJVA 5IQQA 4CH1A 2VD3A 3WC2A 1UMJA 2AGOA 1K8AT 3M8RA 1VFJA 1CC8A 1FXDA 3AXMA 1HBMA 5E41A 1N34F 1GMWD 5L1LA 3ITHB 4LF2A 2J7KA 3KLHA 2R2SA 5D77A 4OZ0A 3W61A 4ED7A 2O3DA 3CJQA 1AROP 2Z0GA 5C2GA 2CWKA 2WSFC 3SI8A 1ULRA 1GMWA 2D9PA 1GMUA 1GXLA 3IR6B 3TA1A 1Q95G 2KB2A 2IFXA 3T5KA 3I5BA 2AYGA 3MHYA 3S6EA 3BO4A 2A18A 4ZJOA 1TUWA 2J5AA 3MTJA 2MB0B 4QCLA 5E0OA 4DR2F 5D15A 4ECVA 1LXNA 4ZP9A 5LMUF 5H9EJ 4NCBA 1T9WA 2YQ1A 2ZD1A 2HFNA 3H2UB 1RWMB 3DNCA 3NKYA 3G8TA 2VDIA 3UVJB 5SZTA 4PUOA 1NZAA 2LU1A 8AT1B 4GVLA 2JLEA 2Z2MA 3M8QB 1YX2A 2L3MA 1CQNA 1JLAA 3BDPA 1RTJB 2L9DA 2XI2A 1TFYA 2MYFA 3MMBA 5HN0A 5KT6A 5GAHI 3HHNB 4MMOA 1VLYA 2OD6A 2ZNZA 2YX4A 5I42B 5FJ4A 1FFGB 4A8YA 2RQMA 2KT2A 4ZA1A 2ZBPA 3G71S 4ECSA 4DXLA 4ECRA 5AE3A 3R27A 2ZE2A 2NPFA 5EHHA 4JI2F 2Y8WA 2EFQA 1MMDA 5DG7A 4GKJJ 2IBOA 3Q24A 2NLWA 1E6VB 2QMXA 2Q1LA 2PDAA 3PFOA 4G6VB 2YKQA 4ID5A 3MM8B 5HP1B 4ZCKA 2OPSB 3SXLA 4CRJA 3V2UC 2E66A 1X5SA 1S9EB 4B3TJ 3OTEA 3T9ZA 4QYZJ 1KR4A 5FDLB 2GS8A 1HNXJ 3I87A 2HSEB 2DY1A 4PRFA 2OH2A 4DQIA 1X4CA 3JSMA 3KG0A 4PQAA 4FKYA 4TU7A 3D9BA 5DDRC 4LSLB 3OVBA 1HA1A 3M4XA 1S6PA 3SMZA 5HMZA 3FKBA 2OFGX 3R3TA 2EEYA 2HVEA 2B5JA 1MSWD 4TVAB 3H20A 3SDEA 4I56A 2LA6A 3O1LA 3BO3A 2AGPA 2FUG9 3SFUA 4K4UA 4C11B 3G8QA 3DM2B 1UVNA 1VC6A 1HBNB 1YWXA 1RWVB 2G0JA 2NSCA 1U49A 2GHWA 3HHLB 1G6BA 3PIOQ 4X62F 2KVQE 2MQPA 1R6VA 4DSFA 2HMIB 3ADAC 4GC6A 3MM5B 4KH0B 4K8RA 3VGUA 3AQPA 3K57A 5E3CA 2CQ1A 2KZMA 2F5GA 4AL7A 1FJGF 1FHTA 4QU7A 3GR1A 3NCQA 3MCSA 3PM9A 3K59A 4F2SA 1KEKA 3PJ9A 1U2CA 4YUDA 1TVRA 1UA1A 2R7TA 4DV4F 3I0SA 1ZOTA 3LW5C 3PW5A 2DIVA 3OFEA 4BHQA 1K9MT 1MU2B 1VQLS 3MDFA 4TKTA 4HHHA 3I4HX 2QSFA 2H5JB 3KK1A 2ZUAA 2UXBJ 5KFTA 5KG4A 4LT6A 1HNIA 4C98A 4MK8A 2UUAJ 5HQLA 2C2NA 3PW2A 1KD1T 2A1BA 5LMNF 3NOGA 1N5YB 4OYOA 3K5MA 4JI5J 4J9PA 2X1FA 2OELA 4M5LA 1VQSA 1F5AA 1IKVA 3K17A 5ITHA 4LR8A 3DDNA 1YKWA 3IC1A 4B3RF 2E5LJ 4R5PA 5JVGQ 3H98A 1YBUA 3BR9A 3QO9A 3EICA 4C9DA 4Q7AA 2W9BA 2D9OA 1O6XA 5KFNA 1E6YB 2BE2A 1WKKA 4ZPDA 4MFBB 3R6GB 3CO9A 4QR0A 5CZXA 4WTYA 3GCWP 2B8QA 4FNHA 3QYYA 4RJVA 3OD2A 1T03B 2HHXA 2L41A 3AA9A 4NOHA 1WG4A 2BE9B 4UT4A 4XK8C 2YKPA 2P6SA 2RHQB 3DXSX 1C4AA 4A8XA 4A8OA 1ZM9A 3HHDA 4Y2CA 2R7VA 2P6TA 1RWOB 5IWAJ 1IQZA 3O44A 4WCEQ 1RWKB 2RJZA 1HWIA 1REVB 4PG5A 4LFCJ 2CPJA 1H7WA 2C2KB 3D3CJ 2E7VA 3DOKA 5IV3A 3I0RB 1EZZB 1XR7A 3SV4A 5EX3A 4KV8B 2JEJA 1EQ0A 2YWEA 5C42A 4RNFA 2DNYA 4FBUA 1RTHA 4L3KA 2PI5A 2V94A 2HQIA 3QT5A 4HTIA 2HFSA 3BPSP 2KZZA 1CLFA 1UL3A 1O0PA 1C1BB 1FVQA 1SL0A 4J9OA 4KO0A 4KJIA 4OYXA 1FJEB 1WOSA 5E2QA 1JLCA 3PX0A 3LQVA 1X4DA 3B54A 2RF2A 4WWSA 5BR8J 4WE1A 3SCJE 2C1EB 3OSNA 4EBCA 5E3RA 3Q0AA 3MPUB 1XWLA 3J81j 3M6XA 1Z4UA 2KFNA 2JEGA 3HSGA 4ENOA 4KRWA 2VUGA 4LF7J 4W98A 4B9SA 2ALZA 1QTMA 1ROFA 4KY3A 3IS9A 2AGQA 3RZAA 2B9YA 4A8WA 3N4WA 2M8DB 2KJVA 2IBKA 3VZIA 3GIIA 4Z7CA 5F8JA 4HH0A 2YWHA 3IO1A 1XNQJ 1NK8A 3K2YA 2DBBA 1DQAA 3FVYA 4ZVPB 1SH3A 1S76D 1BWVA 4ED8A 5I3UB 4ECUA 4PWDA 4MTPA 2ZH6A 3EGVA 1HNWJ 1RTIA 2QX0A 2MJUA 2K3KA 5HMYA 1WSVA 1TZ0A 2FJBB 3Q8SB 2PMWA 3CVKA 2CQ4A 2BW7A 3JAMU 4XPCA 3M2VB 2BOPA 2XM3A 1U6FA 4YMEA 1R0CB 2VG5A 2CNLB 2B4PA 3GJSB 4YFUA 1NCLA 2DVIA 5F9NA 1FERA 4J9VA 4X4VA 5ETSA 1N6QB 3Q8YA 1S99A 4O44B 4MYTA 3DLKB 1FDDA 1KLMB 4PXCA 5J2PB 4NWBA 4KH1B 5DG8A 3K58A 1V5IB 5F8NA 3TA0A 3UR3C 2MKSA 3FEYB 1JJCB 4FBTA 4AXJA 2ASLA 2IHR1 1T02A 1CC7A 2G2ZA 1IKWA 1H74A 2ZC4A 4LF4J 1RYSA 4GKKF 1ZTWA 1NSQA 2N7CA 4FYXB 5DDQC 2YX7A 3BBFA 4RW8B 3CC7S 2ASJA 1L3VA 1F1BB 2W4PA 4EBDA 3HHEA 3TWZA 3JTPA 1CS4A 1KHVA 4OI1A 4RZRA 4CH7A 2YKAA 2FJWA 1NMEB 4L74A 3HXMA 2YWKA 4AFFA 5KT4A 3M8PA 3NEKA 3M8SA 3CO0P 4Q8FA 2P9CA 2R7OA 3DRXA 4WK3A 2P9EA 1RACB 3HMJG 4DV5J 1CJVA 1WTBA 1YRUA 4ZPCA 2E44A 3RR7A 3DRPB 4O3SA 1EJ7L 2O66A 2DCLA 3EGWB 4LVOP 3NWGA 2Z30B 1ZYQA 5CHCB 2XCAA 6FD1A 3OV7A 2QA4G 1Q16B 4Y2KA 4FN5A 4ILMA 2CJAA 4P71A 2RILA 2BABA 3THPA 2HIYA 3SQGB 3CJ8A 5BJRA 3B6BA 3BKUA 3MECB 3H90A 2LA4A 4ERDA 3EXYA 2CQ3A 1GAOA 4KBIA 2EFOA 4LF9J 4DV7J 4HKQA 2Z2YB 2PMZD 8RUCA 5ETPA 1TR0A 2W9CA 2MKCA 2ROPA 2M3DA 2E5JA 2MZJA 3MM6A 3H5XA 3HT3A 3SCKE 4CI0B 2MXYA 1QSSA 4HACB 3T41A 2R4FA 4KGVB 4OZ5A 4DMZA 5D3GB 2H65B 1X4GA 2IDLA 2G1HA 2YKNA 4KHPF 2OPQB 5DM6Q 1TK0A 2VC0A 1D9DA 3NGKA 2N3OA 1PIEA 3MM7A 2O01C 3PY8A 2LYVA 3Q8UA 4TLRA 2FC9A 3VAIA 2IAJA 3EZUA 2WRMA 4X4PA 4ZCLA 1FRIA 2XS7A 3OTBA 4P72A 3C16B 4JV0A 5EN1A 4TNOA 1Y7PA 5DZ6A 4M5GA 1UCNA 1WC0A 2RNEA 1S0NA 4LSLA 2N7YA 2WAQD 4QQBA 2MLZA 2KT3A 1GTHA 1N32F 1S1WB 1KNZA 2MHNA 1AA1B 4M5HA 1S6OA 5K14B 4DCPB 3K5NA 5KFSA 3HHLD 2FB0A 4YR2A 2QL9B 2BRKA 4C11A 2N4DA 3LF0A 4JI0F 3IWLA 3ZZYA 4AE5A 3PRDA 3V6DA 4OYMA 5EWGA 1HBNA 3QBCA 4NLXA 3IWXA 2HQ3A 4M1KA 2AKWB 1Z2ZA 1JNRB 6AT1B 2ZM6J 3OFFA 3NP5A 3BH7B 2APOA 2HMIA 1QTNB 2DNGA 3T19A 2J8AA 3QGPA 2H48B 3JSBA 3QQCD 3CSKA 2F7VA 1ZH5A 4JI6F 2NPIA 2R7XA 1TKTA 1RP5A 2E5IA 2RB7A 5BYQA 4X4OA 1M5SA 3M2RB 4KGXB 1RSCA 2A0FB 1UJ4A 2AEJA 2HZVA 2IYGA 1SC4B 2J8SA 3AB4B 1HI8A 2NYHA 2WB1D 4A8QA 3R5BA 1EIYB 4LJMA 2I8EA 1NPKA 3KLEA 1KSPA 1FD2A 1SC3B 3SZ2A 3ZTPA 2CQCA 1KQGB 1BQNB 1RT4A 3L7PA 1I5OB 1S1VB 4B3MF 1RCOB 1RWNB 3AT1B 1OWXA 3NS7B 2WONA 4H4OB 3ZTSA 4ANEA 2AV5A 2PA8D 2RUSA 1DTQB 3TX8A 4NLTA 3TNVA 8ATCB 4NLRA 5HJXA 1SC6A 2E5GA 2NZCA 3KJVB 1QAXA 2CPXA 4C0BA 4CDIA 2DB1A 4JV2A 2HVZA 1X60A 4JI3J 3J7ZT 2DGOA 3EYZA 1YK9A 1UVKA 2KH9A 4F7VA 2CPZA 1F3VA 1HBOA 3E01A 1KOOA 1PO6A 1MN7A 2AX0A 4PABA 2EKNA 2HQCA 4ZOSA 3TP2A 1U1MA 4F4ZA 3TVKA 3MZIA 4DR5F 5H1SV 4DN0A 3QJPA 3FFIB 4J9MA 4DR4J 4ZVRB 1C0TB 1JJ2R 3OTCA 3DLJA 5J1PA 3K89A 3UN5A 1SVDA 3BSNA 4QJVA 3FSIA 2JH3A 2WBRA 1ZS6A 3FK4A 1HWKA 3MAAA 5CD4H 1PAEX 3CDWA 3UD5A 4IH5A 4KQZA 3KLIA 4ZJLA 2VONA 1RT2B 2DNHA 4M63A 1CBKA 2M70A 2DPIA 1HBUA 4X64J 5KG2A 5JXSA 3HSDA 5BYSA 3RUBL 2AJQA 2QLBB 4WZQA 1Q8IA 2J0SD 1HFEL 5LSRA 3PV8A 2CRLA 2YNGB 2Z2LA 2DIUA 2HWHA 5EUHA 1NLKL 1XMQJ 2RRAA 1J5EF 1UJ5A 1SL2A 3K8VA 4QZVB 2KTQA 3HZGA 2FGCA 3AJ2A 3MEEB 3SEOA 4ZVFA 1AW0A 3OR2B 2XGQA 1U45A 4CO5A 4X4TA 5B0DA 1T3NA 1FNMA 3W9JA 1U02A 5HANA 2EW9A 3R5JB 1IM4A 3EZ5A 1CULA 4K4YA 2XULA 4PXEA 4UZCA 3FC9A 3H25A 2MQMA 4ILLA 2JDJA 1FRXA 4MKAA 5KT2A 4CLKA 4IFYA 1U4BA 1NB2A 4OJ3A 4WXOA 1WKLA 2PFDA 5HJYA 3DOMB 3OSPA 5I3UA 2AZ3A 1WHVA 3R5GA 1NKBA 1QUVA 1W2IA 2FLPA 2KRRA 4ECTA 4QIWD 2ZH8A 4JI8J 3C15A 4EWTA 1YI2S 2CPDA 2A3JA 2UVWA 1YLXA 3TVZA 3P4UB 4DR7F 4DZ6A 2IM0A 1DLOA 1YBAA 3MTKA 1QSYA 3HD1A 7FD1A 1IM6A 5KFLA 1S9FA 1VQ8S 3AOAA 1WOPA 3H59A 4DG1B 2YWGA 3CCWA 5T7LB 2BX6A 4XPEA 4MIBA 3M8ZA 2W9AA 1IBKF 3PHTA 4NEYA 1FK9B 1PG5B 5DS7A 3BM7A 3TARA 4ZVHA 3VV2B 3D28A 4RNMA 2CDQA 4DZDA 3A8KA 3I4PA 1U1NA 2AP6A 3WC0A 4QWDA 3HD2A 5KFEA 2VA2A 2IJFA 2AYEA 4NYPA 3ENQA 5K20B 2PEHA 4IFVB 2QZ8A 3VGTA 4IRDA 1Q1KA 1WJ9A 1T3OA 2ILZA 1D8YA 5GVQA 2K1RA 1Q79A 4EI2A 2XWYA 4MH8A 5K8OA 5CYMB 3OXGA 2WHOA 1BWEA 3IAM9 3EE3A 5IFMA 2OSRA 4NLWA 1UEKA 1MW7A 4EFAC 1VRQC 1IBLJ 1CEZA 2J9CA 3G6XA 3TAMA 1BGXT 4LFAF 1HNZJ 2XEXA 4CO0A 2NCKL 3QIPA 1VBYA 3KUGA 4NA2A 1WC1A 2O1PA 2XZDB 3CGIA 4KPYA 3QJJA 3GYNA 5GMEA 2DH8A 5A8KB 2XQCA 4M5DB 4C3LA 1VQOS 1RKJA 1S1UB 2V50A 1HR0F 1TKXB 1Y11A 5HVGA 3N6NA 2OD4A 3KUHA 4KFBA 3T1YF 3F41A 4OLPA 2EFGA 3GTYX 2JVOA 2YQ0A 3OHBA 4DV3F 2BANB 3POTB 3LP1B 3MMJA 2EFPA 4PAAA 4C8LA 2ZOFA 4V19X 1DY3A 2LCWA 1X5PA 3MR2A 2RH3A 3D2WA 4K50A 1CJTB 1D9FA 2HBRB 5B0GA 3DYAA 2R8KA 1M0SA 2XHCA 2J0XA 5H9FK 1RLCL 2OPQA 1F5BA 4FPRA 4DV2F 2B4UA 1B0PA 3BREA 3L4BC 5LXYA 3TEGA 3E51A 3PYDA 3OBIA 4ED1A 1HIYA 3GFZA 2HW3A 1VR6A 1YGYA 5T41A 2A6OA 4RW9B 1NNDA 4RW6A 2HYIB 4LF6F 4EO8A 3IXQA 3GR0A 5ETMA 4ZP8A 2RKIB 2YBVA 5KG6A 4U67Q 4C0OC 1K44A 3EPGA 2V8PA 2AT1B 5DQIA 2G2YA 3IBCB 1TL7A 1PJ7A 1RTDA 3QRRA 4DBQA 1M90T 4XIUA 5KFVA 1B7FA 1SIZA 5FLXY 2M4MA 5D0HA 3MMAA 1U1LA 2GMLA 2W1BA 2BQRA 3I55S 1M5VC 4OMFG 2GA7A 1TL1B 4QWAA 1XK8A 3AB2B 4TXSA 4J9RA 2B6AA 4IOBA 4OZJA 1XTZA 1U0HB 4CQ1A 2ZKUA 1YBTA 1NK9A 1U48A 5AT1B 2CPYA 1RT6A 4ANDA 5CYQB 4W92B 2D69A 2BA9A 2RRBA 4MKBA 1AZSA 4PYDA 4IDKB 3C46A 2KYXA 4NXMF 2VFSA 2AZ1A 3OL6A 3DMJA 3KNGA 5IT0A 1OQ3A 2B3TB 2R3VA 3UWTA 2AX1A 3NCRA 3HX9A 2MZ1A 2HNZB 1SPBP 1GX5A 4G1IA 2R42A 4YB1P 1G3OA 3T6JA 4DV1J 3DRSB 2HHQA 2LXUA 4DR1J 1FNOA 2UUTA 1N33F 3DC2A 5M2RA 2OEKA 3AD8C 4CH0S 1TQLA 4DSLA 1LXJA 4OL8A 1HQEB 1QE1B 5GAHU 1JNZB 4RW7A 1WACA 3AFGA 4R8UB 1IUJA 5IT9U 1N52B 4EO6A 2KM8C 1EETA 3WIVA 3CXCR 3GG1A 4NCAA 1JLFA 2FQQB 4RW4A 2N3LA 3PXGa 4DLGA 2KXNB 2CJXB 3PKMA 2V4JA 4WFZA 4RUCA 2IRYA 2E1AA 2X7IA 4DU8A 1QUPA 4RWWA 2LKZA 2KT5A 2ZJQQ 2DGVA 4DV6J 3KDOA 2VKZG 2DT9A 3MEGA 2XMUA 1LFPA 1RBLA 3V6KA 3C6TB 1EP4B 1SC1B 2DGUA 2D41A 1WG1A 1JWWA 3BSOA 1U7LA 3CJ0A 3ET6A 3KHHA 3HP6A 2BEFA 3KJQB 3M6WA 2ATLA 4K5RA 5ETLA 1F9FA 2IJNA 3OTOJ 4K2JA 3TAPA 1TV6B 3HF5A 1KVJA 2VBWA 4M5IA 2AEMA 3A1YG 2WK4A 4P7TA 5HROB 1DARA 3VTIA 4GO5X 4EBEA 1N36J 4BC9A 2PD1A 1VHFA 4NYOA 4ZLPA 4B9VA 2DHAA 3SSSA 3Q22A 2BQUA 4DPXA 4O3PA 4B9TA 2IVFB 3VZHA 1F9HA 1I94F 5J2QB 3HK2A 5LOQA 2VZ9A 1RYRA 3PIPQ 5E7OB 4RWXA 4UW2A 4B9LA 2MKHA 1RT2A 2ZKTA 3R7BB 3ZZRA 3PVXA 5KG3A 3CCQS 3RBZA 5HVFA 2DK2A 2VBXA 5FIIA 3PRVA 5DGBA 3FGVA 4ICLB 1SKSA 2NS1B 2FGOA 4DUYJ 3RGIA 4U8YA 5F3TA 3FDSA 2POKA 2VFVA 2J9DA 4AQYJ 1JLEB 2GGPB 2KXHA 4OI0A 1UEVA 1OIAA 4PPDA 4PKDB 5J2NA 1U26A 1RU1A 4YDDB 5J2MB 3MEEA 1VISA 5C24A 1R8HA 2V69A 3SIPB 4B3OB 3Q2TC 2X3DA 4G1PA 4PG8A 1UA0A 3OR1A 1P1TA 3AY0A 3ZTRA 2CXEA 2ZBQA 3UDLA 2C42A 4OI3A 3BGOP 2ZH7A 2RVJA 3KLGA 2FLNA 3HHKA 2PGCA 1IKXA 4IG3B 2DNOA 1S1XA 1RKIA 3TEHB 4DV0F 2LP4A 1NJZA 2CKWA 1F0XA 1NPPA 3OUYA 5HBMA 4DUZJ 1CJKB 4B9UA 2DD8S 2GVZA 4LMZA 3HT0A 2FJDB 1OPZA 1YZ6A 5IV4A 2BUNA 4WXWA 3VALA 3HDSA 2B51A 1PC5A 3KHLA 4DQRA 1M1KT 5HLFB 4C8KA 2YKMB 3D68A 4YHHF 3ILLA 4I2QA 3V5RA 3CJ3A 2EWHA 1IJFB 2P2CB 4Y2MA 2OJ3A 2CNNB 3MF5A 3CNQP 1DTTB 1X8DA 2R9LA 4HYKA 3MM9A 3ENWA 1KP6A 3KG4A 2HRUA 1SUQA 2P5VA 1VJQA 1TU0B 1MWYA 2OTJS 4K4VA 2MHEA 5KFUA 3NS6A 2O67A 4CIOA 4ED0A 1RXOB 1LFWA 1PBUA 1P8GA 2UXDJ 4OX9F 4ZK7M 4K4XA 4WFBQ 3K5PA 3GYXB 2XSJA 2LEPA 1RWXB 2N4CA 4FVCA 4AUKA 3R1HA 1T05B 1SJFA 2FVSA 4YB5A 2DNLA 1HQUB 1VHIA 3W62A 4KR0B 4DQQA 3W3SA 2A2CA 1V5VA 4CNYA 2D7SA 4ZVGA 2QSWA 2QO3A 3IG1B 3BF4A 1X9MA 4L3NA 2GHPA 5DQHA 4Z7YA 1RAJA 2HHWA 4CM0A 1J5OB 5CYMA 4KKOA 2CJKA 4LRCA 2QJ3A 1UPPA 4CWBA 4JI7J 3HCXA 2V68A 5I3PA 4NX9A 5HK4A 3RU0A 1T9VA 1MWZA 2CIMA 1TP7A 4A8FA 1DJ0A 4DN9A 3GV8B 3DI6B 1PAUB 1CJUB 3NG8A 3PEJA 4KYZA 2OI2A 1Y5IB 4DFJA 3TZWA 3TUJC 3OVSA 5IOLA 2VQEF 2X3GA 3QFHA 5KT7A 4QWCA 5F8IA 3Q8VA 2NXJA 3NCPA 4N7TA 5A8KA 2YNHB 4KGZB 4Q8EA 2NZ4A 1PGZA 3IWNC 4NA1A 1Q0NA 4P2XA 1S1UA 4LBHA 3UPFA 4U7UK 5KTQA 3ZO7A 4NI2B 2HNYA 1YJWS 2QYCA 2ZH9A 4DL0C 3M2UB 1RCXB 1F3FA 4WTOB 3A3NB 4LRAA 2M2BA 3CWJA 1RTZA 4F26A 3FRYA 1LNQA 2H4YB 1LWFA 2JZ5A 4I6AA 2ZNYA 2A2DA 3RRKA 2GMHA 3PX4A 2DRAA 2VBZA 4MIAA 4JI1F 2ZDOA 5IC6B 2D74B 1M5KC 2SXLA 3DGVA 3QGGA 5F8LA 2G9OA 3CIMA 1S7IA 2PI4A 2HZCA 1LEOA 3C14B 1FEHA 4A48A 5MLCV 3W5ZA 4OLOA 1RBOB 1AB8A 1TKDA 3ZNJ1 5DLGA 4U7CA 3THVA 2YVSA 1JLQB 2V9WA 4NLQA 3C8YA 1NK4A 4YQWA 2HHPA 3IBFB 1YJNS 3LANA 3N79A 4HI1A 5F8HA 4I7FA 3W5XA 3GONA 3CMAS 1D3WA 5HAOA 3OXFA 1FF2A 3UFCX 1LWEA 1VIOA 2EFVA 2W2NP 3ILIA 1S6QB 4N8OA 1ZZNA 5C25B 1RT1A 3FCHA 1AYEA 3LGNA 5C5JA 4O3RA 1APSA 4HT7A 5CZVA 4JB8B 3HFKA 4P7VA 3QT7A 4K0KF 3EVWA 4I6YA 4PG7A 2WB4A 3EDRB 3CUNA 1KFSA 1VBZA 1SQEA 5KFXA 3MUVP 1Z2LA 2CQDA 2QFIA 3N0VA 3CD0A 2I0XA 1OSCA 3A12A 4CYUB 1Q8KA 3D6MB 3DLEB 1L3UA 1Q53A 1QDUB 2PN6A 2XSFA 3ISNC 1SV5B 4UOCA 2FVPA 4Y0FA 3W9HA 1HWLA 3V4IB 2ABYA 4DPTA 4JI4F 2CJ9A 4BWJA 2HVHA 1H73A 1VRTB 3V6HA 4BBYA 4GVBA 5D4LA 2NUUG 3DRRA 4ES2A 4ZPWR 1RT5B 5L9NA 2E7XA 2R8HA 4NYZA 1D9AA 2MZRA 2ZZMA 2ACMA 4Y65A 1T11A 2Q6BA 1PYTA 3KK3B 5GAEU 1O5JA 3QMQA 4I69A 4F25A 1OMSA 4IH6A 2IY5B 3T1AA 4F8RA 3ILJA 2F65A 1UWBB 4F3QA 1ZZFA 3LP0B 3CTRA 5KFAA 4DL2A 1C0UB 3GE9A 2UU9F 1ZM3A 1NPRA 4OYZA 3R7SB 3OL9A 4E2FB 1FDBA 5M2PA 5DDOC 1HQEA 2FZCB 5A8WA 4RKUC 1C1CA 2CZVC 1W26A 3F56A 2GMJA 3R9LA 1EX8A 3CEDA 3P3DA 2ZBIA 3AD7C 4J9LA 4EEYA 5HVHA 2OPPA 1N54B 4IOCQ 3TO8A 3UCZP 1G2EA 2HS4A 1KTVA 2E1MC 3CJ2A 4QW8A 1HLWA 2HWIA 1WC6A 3G82B 4ZPVR 4HDHA 5A2QU 1FRJA 5HQMA 1U6BA 1S7HA 1JIHA 3AAWB 1UJ6A 4N8NA 2FD2A 1VBXA 3E3XA 1KDNA 1EP4A 4LF8J 4C8ZA 4DR6F 2R7WA 1F2HA 4KIAA 2CNKB 4P52A 1F2GA 1FTCA 4PQUB 4NLOA 1HI0P 4B3SF 3HKWA 3GJRB 3T5LA 3C19A 4F3OA 2IMWP 3U1LA 4RU9A 1X4EA 5A2QY 3UDVA 1I6JA 3MD3A 5HMWA 5KFWA 2VG6A 2KM8B 5JMNA 4TQRA 4DUTA 2UUBF 1HARA 1AFJA 2KYZA 2V0NA 1WF2A 1Y3JA 3BB5A 3N9UC 3IBWA 4CZCA 5HL7Q 2B43A 3S7RA 4LFBJ 1LWCA 3UQSA 4PZVA 2R7RA 4HHJA 1CG2A 3MD1A 3MPWA 5KFYA 4TQSA 3SFGA 1R8PA 1IJEB 3CF5Q 4LQ3A 5J2QA 3VF0B 3JQMA 1TKZA 3DU5A 4RLEA 3ICLA 1QJHA 4ZPAA 4U8VA 4UUXA 1FT8A 2M88A 1GX6A 3DDIA 2L9WA 2C3OA 2OPRA 2OAUA 2EI5A 3CJTA 3GFHA 4LREA 4NCGA 1X31C 1S9GA 1TAUA 1X9SA 2YNFB 5KFRA 5J1EA 2XZWA 1ICEB 3FUYA 4DX5A 3EUNA 3OTDA 2ZC3A 4DL6A 4HL9A 3P5BP 4LIRA 1ZETA 2B9XA 3RAQA 2HQGA 3KDNA 1NSAA 5H9FJ 1FFSB 2IIHA 5K9FA 3WQPA 1YDLA 2AMCB 1X7VA 2IM1A 3G6VA 4NL5A 3DLGA 3JS9A 1L5UA 2IMOA 2CJYB 4DCOB 4PXDA 2DH9A 4DS5A 4GC7A 1BUXA 1HNVA 5KFJA 2UUBJ 5KOWA 4NMXA 4UTGA 4X4NA 4Y3CA 2MKYA 2HHHF 3W2VA 5B09A 5E3AA 2OUGA 2R2UA 2GIRA 4ZDNA 2XLKA 3VWSA 1VS3A 1LK5A 2DO4A 3KHGA 3ENVA 4DS4A 2W7OA 2DYAA 1Q78A 3KMQA 1LW2B 3DDKA 3ISZA 4NXNF 1NDKA 5CAAA 4F0HA 1FXLA 1PYSB 2HLUA 3UNYA 4G1QA 4NLPA 3BV8A 5D8HB 2C2DA 4EK2A 4NLVA 1FKPB 1KTQA 2QL7B 4L76A 4F50A 5G0RB 4PPZA 2MKIA 2OHDA 3C6UB 5IS2A 3OFGA 4K4SA 2V8DA 1XC9A 4EYIB 3QWUA 4DCJB 4RUHA 1A0OB 2HQFA 1WF1A 2C3PA 3CJRA 3CCES 3MPVA 4O4GB 2FLLA 2HRYA 3KG1A 4NLYA 2C3MA 2V2QA 2XYHB 2BBEA 3FMBA 2GO8A 1JMTA 3NMAA 2Y1IA 5LSLA 3C2PA 4PEOA 2R8GA 3UO0A 2UXCJ 4X4UA 2VPXB 2E1RA 2W2QP 1RZMA 1UETA 3CCSS 4N56A 2QA1A 3TJ8A 4X66F 3FBBA 2RT3A 2RUGA 2JOQA 1KWMA 4LSNB 1S4FA 1H0HB 1LW0A 1OQ6A 4OJ1A 5K8NA 2C28A 2KFZA 3M32A 3HVRA 4LIWA 2EG1A 2VV5A 2N82B 1S1TA 2R2TA 1WEXA 5H9EK 2BQ3A 4WIIA 1HHQA 5A76A 2X51A 4CO2A 2ZVSA 4ZLNA 1RJJA 4OIXA 1URRA 1R0AB 1OSDA 3QSIA 3PTWA 2ERRA 1HYSA 3LH2S 2QV6A 2CYYA 2LU2A 2WZ1A 4I0WA 3BKFA 4M5JA 4USTA 5EX0A 1RT3A 3CDUA 4QIFA 3QGHA 4L75A 4BCAA 4DL4A 1N34J 2IYIA 1K1QA 3CJKB 2NR0A 3UD3P 3MMCA 1HI1A 4F36A 1S59A 3AQOA 4O3OA 5DRKA 3S01A 3DGPA 1RAOA 1HPZB 3R2CJ 1KQKA 1U1OA 2EPIA 4LF5F 3PNIA 4TN2A 4A8SA 4FF1A 3RYLA 1U2RA 2B4VA 4X65F 1BQMB 2Z58B 2KN4A 1S79A 1HW8A 4X4QA 4DR2J 4EGLA 4ZHRA 1NJIT 5LMUJ 3A8IA 1FI4A 1VOMA 3D4JA 3CDEA 2V63A 1BE4A 4C6AA 3BGRA 2HZAA 1NHUA 2GQCA 2FVCA 4RL1A 4UOFA 4QYZK 1SJRA 4ECYA 2V2ZA 1N4LA 2EK6A 4IG0B 3BJYA 5C25A 2HNDB 2UVUA 3NBPB 2CPIA 2UV8A 5AJ3F 3RG6A 1DFDA 4C48A 3D1HA 3QATA 5A6WA 3M30B 3LP2A 1PJ5A 4O23A 3O5TB 4M94A 1HMVA 3ETOA 2XNRA 1NZ8A 5DZ7A 1ELOA 1YSJA 2JLFA 2VOOA 1RBAA 3V81A 2Z2ZA 2C3UA 3LOUA 2W7AA 2K06A 1PYOB 1WWHA 4JI2J 2C2RA 3Q2SC 2V2VA 3JXOA 3J80U 2LQ5A 1XERA 1W25A 5IM0B 4P2FA 2CQ2A 1X4HA 1VRTA 4RNOA 3MR7A 2Z4PA 1FKOB 3DOLB 1TK5A 2OMLA 2CJBA 1ZTTA 4QR2A 1RT5A 2IDEA 4ZVOB 2HWTA 2W2MP 1R89A 3JSYA 4YOEA 1FE4A 1ZAVA 1SKUB 2DR9A 4DL3A 3G9CA 3N5FA 2DNRA 1XNRF 2FVQA 1JK9B 2DXDA 1TK8A 3ULHA 4CLTA 1BD6A 1J27A 2V8HA 5RUBA 3BS9A 1KC8T 2ZUGA 1IKYA 2VG7A 4O3NA 4F0KA 3I5AA 1YVFA 2PMHA 2FIUA 5AXMA 1Q82T 2HPUA 4DQPA 3ELHA 1S97A 3GYGA 4ZCIA 2RQCA 2BZ2A 1N48A 3AH6A 5E5NA 2DR8A 2OEMA 2OLWA 3I6PA 2ZHAA 3JB9k 1R27B 4WZMA 3BSAA 2IA0A 2E1CA 1N5SA 3IGVA 5I4MA 2IVMA 1ACMB 2DGWA 3EDQB 4X62J 1XIQA 2LXIA 2FJEB 1HBMB 4OX8A 4JV5F 4DSJA 4U96A 1AUSL 4Q2MA 3KLHB 1RLDA 3D3BJ 1VCTA 1OPIA 1R8CA 4NE9C 3KK2A 1RA7A 2G13A 4F0MA 1VQ4S 2HRTA 4B17A 1FJGJ 3BH6B 2UUCF 2XLIA 3TA2A 3KJFB 2FHJD 2EFNA 2ZZTA 4K5SA 3GV7B 1VK8A 1VI7A 2Y0SD 5GMKa 1URNA 4UUWA 3GPAA 3MR6A 4DV4J 1CQMA 3P6YC 2HFOA 2ZVIA 1MROB 3KLFA 3G96A 1RI7A 3E8OA 4DSKA 4U6PA 3PHEA 3TQ1A 1Y4ZB 1WNEA 4YP3A 2RMLA 2ZD1B 2Z8QA 5JJBA 5A6PA 5LMNJ 3BSCA 3VAHA 4TU9A 2JSXA 2AJ0A 1KVIA 3NGDA 2VQFF 2VFTA 2FY8A 4LRDA 4PUOB 3BZQA 4I2PA 1JLAB 2XG8A 4AYBD 1HD0A 5C2CA 4B3RJ 4I1TA 5IZHA 4M8LA 5GADU 1TUVA 3GILA 3X1LB 1ITPA 1YITS 2DGTA 2XYPB 3SCLE 1AXQA 2V4RA 1UFWA 2DH7A 2VIHA 1G7CB 4H4MA 2D3O1 3CULA 2ZWOA 4CO1A 4B9MA 2YNFA 1NUEA 4Y6IA 3M8YA 2ZE2B 1VYAA 2H3EB 2ALYB 1YQHA 2XS5A 2BM1A 2XHWA 1OS5A 3TZYA 2Q6CA 1RT7A 3A13A 3FCVA 2UUCJ 3U1MA 4A8KA 2VU5A 2BJ9A 2QC3A 4ID5B 4H4KA 2XCPA 2MQ8A 2BE7D 3DXBA 2DISA 3M7VA 2AYMA 3LGMA 4A8MP 4OYIA 1FVSA 4TY8A 1R31A 2UVRA 4ZN1A 1CVJA 1JLBA 3JSMB 2LXFA 5GAGU 3TUZC 3X3UA 2BJEA 1VRUB 4JBCA 1VC0A 4J9KA 1ZPVA 3D1QA 1S6PB 3MCNA 5KFQA 3SBMA 4ZLJA 1XR5A 2B5JB 3MR5A 5ETKA 2I9SA 4WKRA 3RW7A 4Q0BA 2H1YA 2BACA 3F44A 3SDEB 2X1AA 3M1VA 2XMKA 2AU0A 1GK8A 5KFCA 1TL3A 2BYCA 1VQ5S 2WOMA 4DX8H 2YNIB 2A6MA 3JAMY 1I3OB 4HT5A 3T3FA 1ZAXA 2DTJA 4IO9Q 3L3CA 4EMDA 4PG4A 5CCMA 4GMKA 2HGMA 3HI9A 4OV1A 4DSEA 3RB3A 3PKYA 4AL6A 1VQMS 2V9KA 4ZMMA 2E9TA 2PFFB 2NSBA 4WF9Q 2JEIA 2KO1A 4A47A 2BM0A 3ITHA 1YJRA 1K0TA 3IRXB 1TVRB 4OHZA 4ECZA 3I0SB 1WC5A 5LL6d 3CW2C 4ITSA 3HVTB 3QNWB 3W2WB 4A4JA 4LSNA 3KK1B 4YDXA 1HNIB 2FZGB 2MKKA 2BJDA 3KOAA 3BQ2A 1FO1A 3KLVA 2MLYA 2XMAA 2R2RA 4RR5A 4RO0A 4ANCA 3VAGA 4HR2A 2MDAA 2Z57B 1IKVB 1EKRA 2DNNA 3EZOA 3UCGA 4CLSA 2ZJRQ 3L95X 4R5PB 4OI4A 2COLA 3UVJA 4C7QA 4YEAA 2VC1A 3QO9B 1XMOF 3H5YA 1FKAF 5GAEI 4OHWA 5BXIA 5KFKA 5MAOA 5D0RA 3IM8A 1Y5NB 2W9BB 1IVZA 3M8QA 4O3QA 2BE2B 3R5CA 1U1KA 1RTJA 3W60A 2DHHA 4GO7X 4CO3A 4L72B 1S12A 3VVTA 3VGVA 1WORA 3OFHA 4USKA 3GWCA 2Q43A 5CQGA 9RUBA 1O51A 3M05A 1B3TA 2C2ZB 5I42A 1X0PA 3ILOA 4GKKJ 5IC4B 1YIJS 3MUTP 2OIHA 3OL7A 4TY9A 2ADCA 2F4VF 1UEUA 1U0SA 2E9ZA 3TOQA 1RHJB 1UVJA 3O2IA 1E6VA 2FHKA 2LMIA 2AW0A 1JLGB 3UE2A 1D1UA 2BKOA 1F6TA 3D5MA 1IWAA 3DOKB 2W2PP 3MM8A 4CLYA 4ES1A 5HP1A 5B7WA 1SCJB 4OYBA 2HHVA 4ZS6A 5C42B 4ZLLA 2OPSA 4BWMA 4J5OA 5EWEA 1P9YA 1S9EA 3WHIA 1RTHB 3G2XA 4HHUA 4XDDA 5HATA 5L39A 5FDLA 3WIUA 5KFOA 1IBMF 2RQ4A 2CAJA 4EZ6A 4YS2A 3Q86A 4JYAF 2MJNA 1H3DA 4KO0B 2DRDA 3BYPA 1M1HA 3D6FB 1GNKA 3B78A 1GTEA 1DZ5A 1JLCB 3QPIA 2RF2B 3W8PA 4OJHA 3CCLS 4CP5A 3IFEA 4WE1B 4CNZA 3PR5B 3T1HF 5D6GA 1BXNA 1WOOA 2G2OA 4J37A 3F0NA 3W64A 2YWFA 2HK3A 3GG0A 1SH2A 4B9NA 2GNKA 3JTOA 4NPOA 4O4RA 3UD4P 4OZLA 3IS9B 3DM2A 3DU6A 1QAJA 1B99A 1YJTA 3AJ1A 2R7UA 3HHLA 2VFUA 3ENAA 1S72S 3NGTA 1RK8A 2FJVA 2MQNA 1NSPA 3CCTA 5AXNA 4KB7A 2CQGA 2H51B 1NAQA 3OXLA 3UN3A 3GFYA 3R7NB 3MM5A 1MN9A 1KQSR 2DO0A 4KHPJ 2H5IB 5IM0A 3LTOA 3DFEA 4PR6A 2M52A 3M9NB 2XMJA 3DOLA 3LA0A 1X5TA 2BR0A 1YHQS 1RTIB 2ZH3A 4FS1A 3SYZA 1IBMJ 9ATCB 2DNPA 1DRZA 1VQ7S 4KGKA 1MU2A 2OGUA 4F4KA 2VG5B 4YR3A 1HD1A 4RPFA 3MOJB 2KG0A 3EJMA 4KPCA 4C2MA 2QIFA 1SIWB 1P1LA 1N5YA 3W66A 1R8AA 2DITA 4MAKA 4FS2A 2W7PA 3CJ4A 1N32J 2ASDA 2OTLS 4FZVA 1FRHA 3GJQB 2LQ8A 3BO2A 3DN9A 4MT1A 5KFHA 4DEZA 3N01A 3VVUA 1SJQA 4JI0J 2J7WA 3VHQA 2AD9A 2D3ZA 3JSRA 2PC6A 1IKWB 1E6YA 3Q8PB 4MFBA 5T14A 1P9QC 1BHNA 4USUA 3QT6A 5IT4A 1I51B 2F63A 1T03A 4F04B 3RRGA 2CPHA 2G0IA 3SV3A 4GKJF 4JI6J 2UUWA 3RJMB 1CS4B 1DBDA 4FF2A 3M8PB 1HHSA 3RBDA 4OX6A 2Y0BB 2HAFA 3BBCA 1L3SA 1REVA 2EXUA 1W2BR 2R7SA 4DPWA 3R97A 2GIFA 4URSA 4USHA 3W63A 1LOUA 2ZOGA 1MROA 1N5TA 3FCWA 1CJVB 4WPAA 2JL9A 4B3TF 3I0RA 4IRKA 2MZQA 3CCUS 4KV8A 5JUMA 2LQ9A 1Q7LB 4UOGA 1HNXF 3NNHA 1EAYC 2ASYA 5ETTA 1SKWA 2HBZB 1WC3A 2FDNA 1TELA 3LUYA 4B3MJ 2GQ2A 1AFIA 4DX6A 2HLTA 2VF3A 1C1BA 3OL8A 2Q79A 2XY5A 3QRPA 1LQ9A 4CO4A 3H42A 3CD5A 1XEZA 3A8EA 2OP5A 1F60B 3AA8A 3GSIA 2VODA 3ZNUA 5M2UA 2W9CB 4FDFA 5AE2A 1Y10A 3GQCA 3MM6B 4Y00A 2HHSA 4G3IA 1V3RA 1N5QA 2CG8A 3D1OA 1WF0A 3ZZUA 3D7SB 2XMTA 1C4CA 5E33A 2YKNB 1VIXA 4DSIA 4WJBA 1R7IA 1RU2A 2XI3A 1M5OC 4EYHB 5DETA 1FX4A 3EGZA 4DR5J 3KWMA 1X9WA 4MKYA 3J7A1 1Y5LB 3MM7B 5HQ8A 1NM2A 4LBPA 1DHMA 4YB7A 1UWAA 3OW2R 3DLHA 2IAJB 4FXWA 1Q4RA 2MQOA 3ZTQA 2LVWA 5ETRA 4FF3A 4UQTA 2JRSA 4YN3B 3IRWP 1VRUA 2UXBF 3CCZA 3US5A 2UUAF 3M2VA 1U47A 3IM9A 4JI5F 2JHEA 3O6QA 2CQPA 1GXUA 2DHXA 2J9DE 3N5BA 4DPYA 1W7WA 4AXIA 4CM2A 3LO3A 2NQPA 1N6QA 2E5LF 1V9OA 4O44A 4N76A 3B8HA 3DLKA 2H5EA 4TLQA 1J5EJ 3CCMS 4U7UD 4M5KA 3V6DB 1KLMA 3NRBA 2GHVC 3PW0A 5J2PA 4F02A 2YNIA 3OVAA 3AOCA 2FC8A 1QM9A 4B02A 4UY85 3TYTA 2B9WA 4MYUA 1BQXA 2XO7A 4OI6A 2YKOA 4URGA 3M8WA 5CYJA 1N88A 1V3SA 3DRYA 1B0VA 4ECXA 2HEKA 1NBEB 1TKTB 5A0YB 2V8VA 3CCRS 2LDYA 2M9KA 4RW8A 2A10A 5IWAF 5F0WA 4S0MA 1SKRA 1KKHA 4OHYA 3R2DJ 3IRXA 1OY9A 3GIRA 2MSSA 4LFCF 3Q8QB 3HVTA
chains in the Genus database with same CATH topology
4X84A 2UUBF 1HARA 1ZM4A 4QYRA 1AFJA 2I5JB 2KYZA 2V0NA 3MM7A 4N41A 1WF2A 2O01C 3PY8A 1Y3JA 2KDOA 2LYVA 3W2WA 5KG5A 1FRMA 4J9QA 2GJIA 3BB5A 3TUIC 2MQQA 4TLRA 3WDOA 2FC9A 2KHDA 3VAIA 2IAJA 3N9UC 3IBWA 4CZCA 2DPJA 3FZBA 1DAXA 3T5JA 3EZUA 5HL7Q 2B43A 3S7RA 3KLEB 4D3GA 2WRMA 1LWCA 1UW4A 4URQU 3UQSA 1WHXA 4X4PA 3J80Y 1AUDA 4JI7F 2R7RA 1U1RA 4HHJA 4ZCLA 1FRIA 1CG2A 3LAKA 3MD1A 3MPWA 3OTBA 5KFYA 4TQSA 3KK3A 2XS7A 4HEA9 2MSTA 3SFGA 5IXUA 3RB4A 1R8PA 1IJEB 4TYBA 4PWUA 4JV0A 3CF5Q 4ZPBA 1NO8A 5J2QA 3VF0B 4G1QB 4LQ3A 5EN1A 4TNOA 1RT4B 4QWBA 1Y7PA 1S6UA 3DRPA 2RNEA 1UWBA 3FSXA 3LP0A 3T9NA 1R6YA 1TKZA 2BXJA 3DU5A 1S0NA 2VBYA 1P27B 1C0UA 3HZEA 4LSLA 1RDRA 2N7YA 4QPTA 4RLEA 3ICLA 1QJHA 1S49A 2X1GA 4Q43A 2WAQD 4ZPAA 3UDCA 2M0GB 2WONB 4QQBA 4UUXA 2KT3A 4DQSA 1GTHA 1FT8A 2M88A 2KG1A 1GX6A 2RD5C 4HVZA 1N32F 3PO4A 1S1WB 2L9WA 2L9NA 1KNZA 2MHNA 2HHUA 1QY7A 2JVRA 2C3OA 2OPRA 2OAUA 2I38A 1S6OA 5K14B 3N6LA 3K5NA 3NL0A 5KFSA 2EI5A 2JX2A 3GFHA 4X4RA 4NCGA 5CH7B 3HHLD 2FB0A 3I9V9 4NLUA 1G1XA 1S9GA 5BR8F 1TAUA 4QIGA 1VK3A 4YR2A 5KOXA 1Y00A 2BRKA 4C11A 2N4DA 2YNFB 3LF0A 4JI0F 3IWLA 5KFRA 1X9SA 3RRHA 5E3PA 3ZZYA 5J1EA 2I2YA 1WELA 2CPEA 4AE5A 3SQGA 2XZWA 3PRDA 2B7BB 3V6DA 3CCJS 3S1TA 5EWGA 3EUNA 4UQGA 2XMVA 1HBNA 3MECA 1XN9A 3BR8A 3GSDA 3OTDA 4I4BA 2ILYA 2ZC3A 4LF7F 4NLXA 4DL6A 2GV1A 4HL9A 2DR7A 3QGIA 3IWXA 4LIRA 2HQ3A 5L1JA 1ZETA 5DGAA 4M1KA 2B9XA 1Z2ZA 3RAQA 1HBOB 1R43A 3E01B 1JNRB 4OI2A 2XY6A 1L3KA 5H9FJ 1SJ3P 3OFFA 4OZNA 5K9FA 3NP5A 4C3KA 2APOA 2E7WA 2HMIA 2FLOA 2DNGA 2CQBA 3T19A 1MMLA 1X7VA 2J8AA 2IM1A 3QGPA 5F41A 5B0EA 4RUAA 3G6VA 4PXBA 3JSBA 4PQUA 3CSKA 4NL5A 1Q8BA 3DLGA 1CPZA 2F7VA 2C22A 1ZH5A 4JI6F 2NPIA 4Y2AA 3I56S 1L5UA 2R7XA 1M5HA 3VAJA 2IMOA 1TKTA 4PXDA 4F4WA 2PT0A 2DH9A 4MIWA 4DS5A 1RP5A 4GC7A 1HNVA 4QR1A 5KFJA 2IA6A 2E5IA 1B64A 3FEZA 1XNQF 1JLGA 2RB7A 5BYQA 3VR1A 5KOWA 4EUVA 4X4OA 5D3GA 3R5AA 1M5SA 1Y0HA 3V6JA 2WSCC 1T7PA 4X4NA 4Y3CA 3O3LA 3M2RB 2KI2A 4NRTA 2HHHF 3W2VA 5B09A 5E3AA 4IH7A 1YTYA 3BGUA 3CB4A 1H38A 2F8MA 2R2UA 1LW0B 2GIRA 2HG4A 2Q66A 2J6TA 1UJ4A 1HWUA 1PILA 3OHAA 2KU7A 2UP1A 4ZDNA 2XLKA 2JC0A 5SUHA 1HNWF 2IYGA 3VWSA 5F9LA 3RTVA 1VS3A 2GCFA 1LK5A 2DO4A 4CCHA 3KHGA 3M32B 2FHJA 3ENVA 4DS4A 2W7OA 1FDNA 4F4YA 1Q78A 3AB4B 1HI8A 2L48A 2WB1D 5KAKA 1LW2B 3KMQA 4A8QA 3I32A 3KLIB 2DHGA 3R5BA 4LJMA 1S1TB 2KFYA 5DG9A 3DDKA 4BC7A 3ISZA 2I8EA 4NXNF 3KLEA 4B08A 1KSPA 2F3JA 1FD2A 1FXLA 3KYLA 3SZ2A 3NAHA 2HLUA 2CQCA 1HBUB 4X4SA 1KQGB 3MFHA 2W8KA 1BQNB 4G1QA 4NLPA 2DCUB 2IVYA 1RT4A 4AL5A 1Q8LA 1LKZA 3L7PA 2G0CA 2ZFHA 1S1VB 4B3MF 3CD6S 5D8HB 1WG5A 4R0JA 2CVEA 2C2DA 2YTCA 1FKPB 4NLVA 1OWXA 2DGXA 4ECQA 1KTQA 2WONA 4H4OB 1FA0A 2AV5A 4DDFA 3MMBB 4F50A 2PA8D 5G0RB 4PPZA 1HYSB 1DTQB 4LQ9A 3TX8A 2MKIA 4NLTA 3TNVA 3C6UB 1U8SA 3OFGA 5IS2A 5D4OA 4K4SA 4NLRA 1S1WA 2V8DA 1SC6A 1XC9A 2E5GA 2UV8G 4EYIB 4ED3A 5F0UA 3QWUA 5K14A 4QU6A 3KJVB 1QAXA 5LJ3Y 3HM9A 3CT9A 2CPXA 4C0BA 4RUHA 5DDPC 1TL5A 1VQ6S 1S0VA 1WEZA 2DB1A 4JV2A 2HVZA 1RT3B 2JEFA 4R25A 1Q81T 3MXHP 1ZPWX 2OMOA 1WF1A 3PJWA 4C97A 1T8EA 4C8OA 3GV5B 2C3PA 3J7ZT 3CCES 2DGOA 3MPVA 4O4GB 4ES3A 3EYZA 5K8PA 4WU3A 2VA3A 1UVKA 2FLLA 1KRPA 5GADI 2KH9A 2HRYA 3MMCB 2PSZA 2HAIA 3KG1A 3WX4A 4NLYA 2C3MA 3FRZA 1T94A 2CPZA 4CT9A 1YJ9S 4LF4F 1IR0A 5LSOA 2R8IA 1NK7A 2HVIA 1BC6A 5E3QA 5KFPA 2B0GA 3JYTA 2BBEA 1HBOA 3C66A 3E01A 1KOOA 1PO6A 3SCIE 2AX0A 3FMBA 4U9RA 2GO8A 3PRBA 4RBTA 1JMTA 2XMMA 3NMAA 4WFYA 3BN7A 3N6MA 4IFYB 5HO4A 2Y1IA 5LSLA 3GIJA 3C2PA 2HGLA 2R8GA 4X4UA 4ZOSA 3TP2A 4IKAA 1U1MA 4QIEA 4F4ZA 2RSQA 2VPXB 2E1RA 3CDBA 4ATNA 3TVKA 1UETA 2GX8A 3MZIA 1U09A 3H2VE 4XDCA 5H1SV 4DR5F 4DN0A 3CCSS 4N56A 3QJPA 2QA1A 2JJ4D 3FFIB 4ECWA 4J9MA 4QPXA 5L8RC 4X66F 1C0TB 4IR9A 1JJ2R 4RNHA 2QLXA 5D4PA 2LECA 3OTCA 2RT3A 2RUGA 3QZ8A 2JOQA 2RRNA 2VPYB 4ZHRB 4LSNB 3DLJA 3M2RA 4K2XA 2ZH2A 5J1PA 3HHLC 2WW8A 4NLGA 4F67A 3H40A 5DLFA 1S4FA 1H0HB 3BSNA 2QRRA 2OO4A 3BGRB 1UVIA 4QJVA 1LW0A 4F4XA 5L9XA 1T95A 3FSIA 1OQ6A 4QBUA 4DV5F 2JH3A 2WBRA 4OJ1A 5K8NA 2C28A 3CE8A 2KFZA 4YB6A 1HWKA 3M32A 4P6QA 1R8BA 5CD4H 2MY8A 3HKZD 3HVRA 4CTAB 4LIWA 4JV1A 2EG1A 2F8EX 3CDWA 3I31A 2VV5A 1LW2A 3QWPA 4IH5A 4KQZA 4WFAQ 2N82B 3KLIA 1FJCA 2KKHA 1S1TA 2VONA 1DLOB 2R2TA 1WEXA 1RT2B 2DNHA 4M63A 5D78A 2RDIA 2BQ3A 2UVVA 4IRCA 1RGVA 2M70A 2R8JA 2DPIA 4PCQA 1HBUA 4WU2A 4WIIA 5KG2A 4ED6A 5JXSA 3GIMA 4WYLA 4K59A 2XMWA 1BQNA 4E0DA 1JJ4A 1YRTA 5BYSA 5GAGI 2X51A 4CO2A 2ZVSA 2AJQA 3LP2B 3LALA 4NZ6A 1NK6A 1RJJA 1S1VA 2U1AA 4WZQA 2PIIA 1Q8IA 2IRUA 2J0SD 1HFEL 4HLBA 2F9JA 4OIXA 5LSRA 1URRA 3KFWX 2H9ZA 3MWBA 1FKPA 1HMVB 3MPYA 3QAEA 3PV8A 2CRLA 1R0AB 1OSDA 1JXEA 2YNGB 1KFDA 2Z2LA 4H4OA 2DIUA 2HWHA 5EUHA 2ERRA 5G0RA 3V81B 1DTQA 5KFFA 3JTNA 3K5LA 1HYSA 2ZHOA 3C6UA 2EK1A 3LH2S 3IR5B 2RRAA 1J5EF 5CCLA 1RISA 1UJ5A 2HIQA 2QV6A 3H4DA 2CYYA 1SL2A 3K8VA 4QZVB 2LU2A 2KTQA 2IRXA 3HZGA 3KJVA 4I0WA 1NEEA 2FGCA 2XWXA 3DCAA 3AJ2A 3QZ7A 3PEHA 1U2FA 4YY3F 1SH0A 3MEEB 2HHTA 3CJ5A 5EX0A 2IM3A 1RT3A 3CDUA 4LF9F 4DV7F 3SEOA 4ZVFA 4QIFA 1AW0A 3QGHA 3BN4A 3OR2B 3QLHA 2XGQA 1U45A 4O4GA 4BCAA 4CO5A 4X4TA 5B0DA 5IT9Y 3RR8A 4DL4A 1T3NA 1FNMA 4LF8F 1GQEA 2IYIA 1K1QA 1X4FA 2EW9A 3CJKB 3U27A 4DJBA 2NR0A 5FD1A 3MMCA 1JJHA 1HI1A 3UD3P 2LQJA 1IM4A 2RDJA 3EZ5A 2RU9A 3AQOA 4DLEA 4O3OA 2VFRA 4K4YA 2XULA 5DRKA 4PXEA 3DGPA 3S01A 1HPZB 3THTA 3H25A 2FVRA 2MQMA 2K1RB 3DHXA 3HVWA 2JDJA 3MFIA 4ILLA 2VKRA 2VOPA 1FRXA 4MKAA 3GIKA 1KQKA 4Z2XA 5KT2A 4IFYA 3UR0A 2EPIA 1U1OA 1U4BA 2J6SA 2KVIA 4LF5F 3PNIA 4TN2A 3W7BA 4A8SA 4FF1A 1XBWA 5CXTA 3CIZA 3MEDA 4OJ3A 3RYLA 4DFMA 4MK7A 4CT8A 1U2RA 4WXOA 3H5UA 2B4VA 3L7OA 3OSPA 4X65F 5I3UA 2DNKA 1BQMB 3FFIA 1WHVA 2FJAB 2KN4A 1NKBA 1QUVA 3IAS9 1S79A 1HW8A 4X4QA 1C0TA 1W2IA 4EGLA 5J1NA 2FLPA 4ZHRA 5LXRA 2KRRA 1NJIT 5AXKA 1VOMA 4ECTA 3TAMB 3I9ZA 2CG4A 3CDEA 2PA3A 1QVGR 3OLBA 2V4QA 4QIWD 2ZH8A 2KHCA 3BGRA 1NHUA 2GQCA 2FVCA 4ETZA 3QIPB 4EWTA 4LFBF 1IKYB 1YI2S 2CPDA 2VG7B 2VASA 2A3JA 2UVWA 3FQKA 1SJRA 1J2VA 2W25A 3SSQA 4ECYA 1WHYA 5K5MA 4C8NA 3TVZA 5B0AA 3TW0A 1N4LA 2EK6A 4H54A 4IG0B 3BJYA 5C25A 3LAMA 2HNDB 4FXDA 2UVUA 2OKQA 3NBPB 4DR7F 1DQ8A 2IM0A 1KN6A 2CPIA 4WKYA 1DLOA 3FMWA 3H8YA 4N5SA 1YBAA 2ADBA 3MTKA 1ZM2A 2DNZA 4OHVA 1QSYA 2UV8A 4ED5A 5AJ3F 2RS2A 7FD1A 1S0OA 3P49B 1DFDA 1UVMA 1CSJA 1N8RT 4I68A 3D1HA 2AF6A 3TI0A 5KFLA 5A6WA 4NMLA 1S9FA 1VQ8S 1D8ZA 3M30B 3LP2A 2M7SA 4LUBA 4O23A 1Z1ZA 3H59A 1HWJA 4DG1B 2YWGA 4KFBB 3CCWA 4RU2A 3O5TB 5G4DA 1H2TZ 5T7LB 1HMVA 3ETOA 5B0CA 2WTFA 4XPEA 3CC4S 4M94A 2XNRA 1FESA 5F8GA 3J81Y 1R0AA 1ELOA 2YNGA 4MIBA 3Q8RB 1YSJA 1TAQA 2CQHA 2JLFA 2VOOA 2W9AA 2WCXA 1IBKF 3V81A 1FK9B 2C3UA 5DS7A 2VPZB 3LOUA 3BM7A 3TARA 3LPYA 2E29A 2W7AA 4ZVHA 4USJC 1WWHA 3D28A 3P96A 4RNMA 4FXVA 3HPOA 3D54A 3H5SA 4JOUA 4N47A 2CDQA 1KONA 3KTQA 3KK2B 4RNNA 2C2RA 5K8MA 3VQTA 1WI8A 2CPFA 4P2SA 3Q2SC 3I4PA 3J7YU 2QFJA 1U1NA 1MMNA 3QAUA 1H98A 3OR2A 2FTRA 2ZM6F 2AP6A 2LQ5A 3WC0A 4QWDA 5DJBA 1XERA 5KFEA 2VA2A 2P9GA 1W25A 1RQ0A 2IJFA 2AYEA 3CJKA 4NYPA 3DYAB 3ENQA 4C8MA 3O8WA 5IM0B 1K73T 2PEHA 4IFVB 2QZ8A 4IRDA 2CQ2A 1Q1KA 1X4HA 2LEAA 1VRTA 3MGJA 4RNOA 2DHSA 4OFZA 2Z4PA 1FKOB 1T3OA 3DOLB 1TK5A 1HPZA 2ILZA 2J0WA 1D8YA 4KHMA 1A6LA 1OO0B 2OMLA 5GVQA 3J7YI 2K1RA 2MMYA 2D1CA 1Q79A 1SB6A 2OSQA 3KLFB 2CJBA 2XWYA 1ZTTA 4QR2A 4MH8A 4YR0A 4EU0A 2K7JA 1RT5A 5K8OA 1SJ4P 2HWTA 2GO9A 5CYMB 3TVYA 2QA4S 5F8MA 1L3TA 2EBGA 1HW9A 3OXGA 2WHOA 1R89A 3JSYA 1BWEA 3PZPA 4YOEA 3IAM9 4QWEA 1FE4A 1ZAVA 4RW6B 3ZZOA 4Q45A 5IFMA 1WTFA 2LDIA 2OSRA 1BLUA 2DR9A 3DOMA 4DL3A 3G9CA 2C3YA 1BQMA 3N5FA 4ZKAA 4IUFA 4NLWA 4TYAA 4ZPTR 2DNRA 3S8SA 2QT7A 2G4BA 2HS3A 1MW7A 1XNRF 3MOZA 4EFAC 2FVQA 1JK9B 2XNQA 3UI3A 4QIVA 1TK8A 3ULHA 3E2EA 1IQTA 2ZBCA 1CEZA 1X5OA 2J9CA 3G6XA 3C3LA 1BD6A 3M6VA 3TAMA 2FPHX 2V8HA 1N0VC 1WHWA 1BGXT 1FRLA 4LFAF 2RIJA 4I2PB 2V2KA 2XEXA 4CO0A 3BS9A 3M9OB 1KC8T 2ZUGA 3QIPA 1SI9A 1IKYA 4C3MA 1VBYA 1DQ9A 4E8UA 1KQFB 2VG7A 4I67A 3D0HE 4O3NA 2QEXS 4R0EA 3NAIA 3I5AA 4NA2A 1YVFA 2PMHA 2FIUA 1RTDB 5AXMA 2O1PA 2MKJA 1Q82T 2DNQA 3CGIA 2HPUA 2BW2A 2QMWA 5U47A 4DQPA 4KPYA 4IG0A 1S97A 2HNDA 3MMAB 3NBPA 3QJJA 2RQKA 3GYNA 1UP1A 3PJXA 5THWA 2DH8A 4ZCIA 2BDPA 2RQCA 4LVNP 2BZ2A 4ALZA 5A8KB 4H4MB 4ELUA 1N48A 4M5DB 3AH6A 4C3LA 4IOAQ 1IN0A 5A8RB 1VQOS 5E5NA 2DR8A 3FSYA 1RKJA 2ZHBA 2OLWA 1S1UB 3I6PA 2CVIA 2ZHAA 2PO4A 3JB9k 1R27B 2I1RA 4WZMA 3BSAA 2IA0A 3NLCA 4NLDA 1KS2