3ETMA

Crystal structure of the mimivirus ndk +kpn-n62l-r107g triple mutant complexed with cdp
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
133
structure length
133
Chain Sequence
QRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTDAISKIRRLQGNTNPLASAPGTIRGDLANDIGENLIHASDSEDSAVDEISIWFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Transferase
total genus 40
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2008-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3etmA00
3DKDA 2DXFA 1NDPA 4EK2A 1NDCA 3ZTOA 3BBFA 1F6TA 2NCKL 5IOLA 1K44A 3EM1A 1VYAA 2AZ3A 3Q8YA 3B54A 3BBBA 1WKLA 3GPAA 3L7UA 3VGUA 4WBFA 2HVDA 3FBCA 3ETMA 1S5ZA 3DDIA 1BUXA 3ENAA 2B8QA 3VGVA 4ENOA 1LWXA 3FBEA 4F4AA 1B4SA 1HHQA 1PKUA 2VU5A 3NGTA 1BHNA 2CWKA 1WKJA 3VGSA 1EHWA 1BE4A 4DUTA 2BEFA 5CABA 1MN9A 2HVEA 3ZTSA 1XIQA 4ANEA 1NLKL 1W7WA 1LEOA 5BXIA 2HURA 1NDKA 3G2XA 1S57A 3VVUA 2ZUAA 2DY9A 1JXVA 3NGUA 1ZS6A 4W98A 3R9LA 1NDLA 1NPKA 4ANDA 3Q8VA 1HLWA 3ZTRA 1PAEX 3EMTA 3EVOA 5CAAA 3VVTA 1NUEA 2DXEA 3ZTQA 1HIYA 4DI6A 3WX8A 4KPCA 3EVWA 3Q83A 2DXDA 1XQIA 4FKXA 5C7PA 4HR2A 3ELHA 3EE3A 2B8PA 1NCLA 1MN7A 4UOHA 3FKBA 3BH6B 2AZ1A 3PJ9A 3EJMA 4FKYA 1F3FA 4F36A 3NGRA 1S59A 3EICA 1NSQA 3Q89A 1UCNA 1WKKA 3FCVA 4ANCA 3Q8UA 4CP5A 3EVMA 3JS9A 4S0MA 4DZ6A 3BBCA 3NGSA 1KDNA 3GP9A 3FC9A 3PRVA 4O0NA 1NB2A 1NSKL 4C6AA 4UOGA 1NSPA 3Q86A 3BH7B 3FBBA 1U8WA 3FCWA 1NHKL 2DYAA 3ZTPA 2BX6A 3B6BA 3VGTA 3MPDA 1B99A 3FBFA 4UOFA
chains in the Genus database with same CATH superfamily
1W26A 4DX6A 1FNOA 4IG3A 1C1BB 3KK2B 5HQLA 1ZAVA 1H6KX 3ITHB 4F4YA 4DS5A 1VRTB 2XMKA 5ETNA 1Y9OA 2B4PA 1WKJA 2XZDB 1FFWB 3TX8A 5SUHA 1I5OB 2R7RA 1NDKA 5HROA 2BVZA 4J37A 3VAJA 4YOEA 3VAFA 2BA9A 2H3EB 1SKRA 2V63A 1D09B 1XQIA 3BKFA 4OJ3A 3PJ9A 2W9AA 1RQ0A 2B0GA 2R2SA 4JYAF 3Q8UA 1AT1B 3HVTB 1S0VA 3GP9A 3K0JA 4J9NA 3MM7A 1N88A 4P6QA 2Z4PA 2W9CA 2HYIB 1O6XA 3DKDA 2UUCJ 1ZPVA 3QPIA 1OYDA 3QYYA 5KG2A 2KFYA 3KHLA 4LF9F 2I0XA 2NXJA 4NEZA 3QJJA 4B9SA 2DNGA 3HZEA 2D74B 1LKZA 3ENAA 2B8QA 3J80U 4F4KA 2XI3A 3VV2B 1ACMB 3NY0A 4O3RA 2PFDA 3CW2C 1PILA 5EUHA 4DQSA 1KKHA 4PRFA 2HRYA 1FXDA 5KFMA 5IQQA 3RBXA 3W5YA 1UEVA 1RHQB 1YJ9S 1WF0A 3MDFA 2J7WA 2MSSA 4B3SJ 5IXUA 1S6UA 2J6UA 4UF4A 1NKEA 4DHVA 1YRUA 2ALYB 3M2UB 3HI9A 3PW2A 2VBZA 4M1KA 3FFIB 3VQSA 5RUBA 4YY3J 3EUNA 3DHWC 1HD0A 2VICA 5BR8J 2ZKUA 2NREA 3LA0A 2AEMA 1WHYA 3MURP 3F56A 2YXLA 2VA3A 5K20B 2OFGX 3MR5A 2XCPA 3TQEA 4DV7F 4RO0A 3JQJA 2MKIA 1DJ0A 4ZPTR 1HHSA 2A18A 4FXWA 4OHWA 4ILMA 1GH8A 4TXSA 2CPDA 1VQLS 2IMOA 3CDAA 2V34A 3FBCA 3BGFA 2QFIA 4F3QA 4PQAA 2C42A 2C3UA 4KH1B 3TVYA 5A8KB 4LF4F 3ZFVA 4CQ1A 2EK1A 2OI2A 1XNQF 1NJWA 3HULA 3C6TB 2VIHA 1VQ7S 1HNWJ 1S97A 2HG4A 1IR1A 1IQZA 1D9DA 5D0RA 4B9UA 1PJ6A 3QNWB 1YJ7A 3ET6A 4HACA 3M4XA 1X5TA 4DR3J 1TK8A 2RU9A 2B6AB 3A8IA 4GVBA 3U27A 1FD8A 4UZBA 1C4CA 1BQMA 1RCOB 4J90A 2QRRA 1N34F 2B4OA 4JI1F 1PYOB 3TRGA 2CQ0A 3UNYA 4UOGA 4P10A 5KFEA 4ZVOB 2CJXB 2V4JB 1LNQA 3GR1A 3VAGA 5H9EJ 1SL2A 2WVDA 4KR0B 3T5LA 1UFWA 5KT2A 3S1TA 2I5JA 2NZCA 5ETOA 1HBNB 2MEWA 1TMMA 3OSNA 4JI7J 3T1AA 5CCMA 3NEKA 2HHSA 3KHGA 2KHCA 2P5VA 2HURA 3DGPA 3MMBB 4DR6F 1NK4A 3TR5A 1Y7PA 3WQPA 2WW8A 1HIYA 4DI6A 2CA9A 1NJZA 2F9JA 3AJ2A 3CF5Q 3DC2A 3P3DA 5KOXA 1M5VC 3TA2A 2Y1JA 1B64A 3DCAA 2DR9A 2AYBA 3PVXA 4DV6F 4IG3B 4CLLA 1SQGA 2LDIA 4NL5A 3GIJA 1UL3A 1HQEB 1WI6A 1HQUA 3FQKA 2BW7A 3RRKA 1Q1KA 4PR6A 2DEIA 3HT3A 2K3KA 2LVWA 2UXDF 3D0HE 2YNIB 5DQIA 1T7PA 5HROB 3O44A 2L9WA 2MQLA 1FRXA 4ENOA 1HMVA 2VU5A 1BHNA 2AHOB 1O8BA 1SIZA 5CQGA 1X9MA 2QTWA 4C8NA 4DV3F 1U1LA 2L41A 1BWVA 1S57A 2M7SA 3W2WA 5KAKA 4ZPBA 4M95A 4AQYJ 5LT5A 3NWGA 4XTTA 2WVFA 2W8KA 2MZJA 4C98A 4PEOA 4NASA 1NB7A 2NPFA 1RXOB 3QT6A 2ZOGA 2HWTA 1IQTA 2BJDA 5KFTA 3CCWA 3MM7B 2YH1A 4KRWA 5KFQA 1KONA 5KFPA 5FDLA 1N8RT 1K1SA 4ZCLA 4JUZA 2GIFA 4G3IA 3JAMY 5B7WA 2EKNA 2HW3A 2KU7A 3WC2A 3HCXA 3PJWA 4TYAA 3FBBA 5LMUF 2DGWA 4XK8C 1S0MA 2CPYA 1OY9A 4DPTA 2CDRB 3KK3A 3H5SA 5LXRA 4IR9A 1N32J 5ETVA 2Q43A 5HANA 4TLQA 2MJUA 4K4TA 3TYTA 2D41A 2XQCA 2MDAA 4K4YA 1ZYQA 4M5JA 4M5MA 2Z2YB 4USKA 3IBFB 4DSFA 1CULA 4ID5A 3OXLA 4RKUC 4X64F 1X4EA 1PKUA 3ETOA 4CLTA 3MOZA 1YI2S 1TUWA 4LIRA 4NA1A 5I42A 3U1MA 2GW8A 5LL6d 3M8ZA 3ISNC 3L09A 4RU2A 2BQ3A 3PEHA 4YR0A 3LWMA 3EVWA 2Z8QA 5E3RA 4BC9A 5L1IA 3D54A 2IYIA 1H98A 4WFXA 4QR0A 2XY7A 4X65F 3A13A 4H54A 5EX3A 4DPUA 2ZEJA 2CPZA 3UWTA 4LBIA 3CJ0A 2R42A 3P96A 3CJ2A 5KT5A 3KXDA 3MMJA 4DFPA 3EDQB 5MAOA 4KFBA 4OLOA 3VGUA 1IR2A 3PM9A 2DEJA 1ZPWX 4F04B 1S6OA 1UETA 5DZ6A 1U02A 3AHPA 1HI0P 2OPSA 2VDHA 3I5BA 4Y2MA 2IBOA 2D3UA 2EEYA 2YWKA 2IPOB 4DPOA 4RWXA 2JFKA 1Q8LA 2RB7A 5L38A 4CLZA 1R3NA 5BYSA 5HL7Q 4J9SA 3PYEA 1RDRA 3ET6B 4HACB 2RKIA 3LF0A 1AUDA 1RUSA 1UEKA 5L1LA 1WORA 4B02A 3QWPA 5E41A 5IC6B 3RTVA 4GVBB 2YBVA 2AU0A 4M5KA 4RJVA 4CNZA 3LPEA 1U1NA 3N79A 2MZQA 3O5TB 4NLTA 3GFYA 2MLXA 2QV6A 3TARA 2XNRA 2OEMA 2RUGA 4MK9A 5ETQA 1SUQA 4DPWA 2ZDPA 2LQBA 1S4FA 3QJLA 2FLOA 2I5JB 4L75A 1W2IA 5T7LA 4IYQA 3TUIC 1Q79A 3AJ1A 1VK3A 3ZZRA 4O3QA 3KLEA 2FVPA 2BX6A 1RTIA 3RUBL 2KVIA 4KV8A 3LO3A 3CJ8A 2CYYA 5KFCA 2MKSA 3GJRB 3O2IA 1Y5NB 1X4AA 3G82A 4OZ3A 5A6WA 5B0FA 3DGPB 3PX4A 4DL0C 1S1TA 2NYHA 2E7XA 4UQGA 1YHQS 2DNRA 2EFQA 2LQ5A 1RABB 4QWCA 2OEJA 4FYYB 2XY6A 1G2EA 5KT4A 3M2VA 4X62F 1Q16B 2L08A 5I3PA 4O3PA 1UW4A 2BRLA 3BS9A 1N5QA 2IY5B 4ECUA 1MROA 4J5OA 3UD3P 2BBEA 3EGNA 5IT9Y 4I2QA 3R97A 1RWOB 3FSXA 2GMLA 1RJJA 1HQUB 1U1MA 3BM7A 1VHIA 1PBAA 4DV4F 3X1LB 1LWFA 2LXIA 3T5JA 3W62A 3GIIA 3L7PA 1RU2A 2XYHB 3L7OA 2FHKA 2DHSA 1T3NA 4KQZA 4W90B 2N3LA 2UV8A 4M8LA 4JI5J 4DCPB 1R89A 1UVKA 1BGXT 4EMDA 1FE0A 3CMQA 4EYIB 3IFEA 4ED6A 1BUXA 2ZBIA 3W2WB 1JKHA 1RE1B 1IBKJ 3KJFB 2HAFA 2VFVA 4C4WA 4X4TA 4TU9A 3MCNA 2XYGB 5KG5A 2V2QA 1RTDA 1YGYA 3QMQA 4I6WA 4C7QA 3T5HA 1VS3A 3G6VA 2AIRB 3FZBA 5DQGA 5LJ5Y 3CD5A 3HHLD 4WU3A 3TAMA 2DXEA 1R6YA 5F8HA 2XHCA 2CPXA 5FDLB 3NAIA 2ZBRA 2Y8YA 4UOHA 3CC2S 5B0EA 3AJDA 4IQMA 4N5SA 4EGLA 2ADCA 3CT9A 2Z30B 3KK3B 3H0PA 1YVFA 2OIHA 1QAXA 2A3JA 2QGFB 4O0NA 3TEHB 2WVBA 4U8VA 3NAHA 2JLFA 3IBWA 3CJKA 2Z2ZA 4NRTA 1CULB 3LAKA 4ID5B 3O8WA 2XMTA 1NDCA 3V6JA 2R2RA 4K4XA 1SL1A 5I42B 4CM0A 3TOQA 3M7VA 1ZOTA 1B4SA 1JB0C 3AT1B 1FI4A 4ZP8A 4CH0S 3R5GA 2DR6A 1X8DA 2K7JA 4LVNP 5D4LA 3KUEA 3MAAB 3RAQA 5KT3A 1YZ7A 5DGBA 1FT8A 1TL5A 4A8MP 4CRJA 1VC5A 3ZZPA 2PMHA 1UWBA 2AP6A 1EKRA 2F5GA 4A48A 2ZJQQ 4KFBB 2LXFA 2ZHAA 3G96A 4WKRA 5HMWA 5BJRA 5KFXA 1CLFA 4C3LA 1RWUA 3RB4A 2L9NA 2OPSB 4TN2A 2UUCF 2QLJB 2IM0A 4X2BA 3VZIA 1SJ4P 3CIMA 3PR4A 4P2FA 2GVDA 2RKIB 2R7XA 2E5GA 1APSA 1PBUA 1NAQA 1S6PA 1LWXA 4NOHA 3MFIA 4PG4A 3C46A 4IFVA 2B56A 2RJZA 4QIFA 2RQMA 2DCUB 2JVOA 3GG1A 1L5UA 2A1BA 2LEAA 1FRJA 4FYDA 4B3SF 2HGMA 2X3GA 2OPRA 3T6BA 2MY7A 1Q7LB 1SUQB 4LSLA 4ZVTB 2J7UA 1N5TA 2C2EA 5CZVA 5D3GA 2IRXA 4YY3F 1JLFA 4QIGA 3P5TL 2MPUA 4C97A 5T7LB 4WKYA 2V6AA 1QVGR 4UY85 5BR8F 4MMOA 3KLEB 4OMFG 4PXDA 1RTIB 4JV5J 1S1VA 4KV8B 3HHDA 4C9DA 3UCZP 4HT7A 1WC6A 4V19X 3HD2A 4X4UA 4DLEA 3RW6A 1YKWA 4DG1A 1VBYA 2QZ8A 1WDDA 2VF3A 3G82B 4F67A 1F0XA 2PFFB 4JB8B 2E1CA 3IA0A 2C28A 4WJBA 4WFBQ 2JVRA 3R5BA 1S1TB 1B0PA 4LRAA 2Z57B 4G1IA 4IH7A 1EX8A 1FESA 3C14A 3M2VB 3DLJA 1WHXA 1T3OA 3I5AA 4XPCA 1VDHA 2XO6A 1K0VA 3KUHA 3HFZB 4CLPA 1MROB 4FYWB 2V2ZA 4MKAA 1F9HA 1HNWF 4YMEA 2DGSA 2O67A 1WJ9A 4I2QB 2WB4A 3B4DA 3VAIA 2IA6A 3OL8A 1H2UX 3SV3A 3M8WA 2H65B 2FVSA 1NSAA 4FPIA 1XMOJ 3A3PB 3R1HA 1LWFB 2R7OA 4LFAJ 2UVWA 3MMCA 3B4MA 1M1KT 2ZH2A 5AE3A 3DGVA 5IS2A 3RAMA 3IS9A 1G1XA 3G9CA 2MTLA 4IOCQ 3GV8B 3CCES 1FDDA 2BJ9A 2FY8A 5J2NA 1X4CA 3X3UA 3V4IA 4USHA 5A8WA 5ETMA 2EBGA 5F8NA 3DRPA 4QIEA 3PJXA 4J9LA 1JKHB 1NKBA 1NDPA 1VQ4S 2W01A 4Q45A 2NCKL 5IOLA 1B7FA 2DRDA 3NWRA 1X60A 1IUJA 3R3TA 2FHJD 1BQXA 4OI1A 4ES1A 1RTDB 2FGCA 4C0HA 4WTYA 4JI7F 1M1HA 1GTHA 2FGOA 2GIQA 2K06A 2FJVA 3TAMB 1M1GA 2CQHA 1FNXH 4QYZJ 1Q8KA 2ATCB 2FZGB 1HWJA 4Q8EA 1NXIA 3H8YA 1ZM4A 2I6WA 1S9EA 4WK1A 3FEXB 1WEXA 1VBKA 2I1RA 3M30A 4K4WA 2Y1LB 2ROPA 2LXUA 1I1GA 2WB1D 4IQXA 1U49A 3O6QA 3CJKB 4NLOA 3G86A 2DPIA 1KOHA 1B7YB 1P9QC 4DZ6A 4DFKA 2F40A 3EWGA 4ECSA 5GAHI 4KO0A 3HSZA 2DR8A 2FVRA 3AXMA 3DLBA 1YRXA 4M5NA 2YNHA 3OL9A 4C0BA 4C8ZA 2Q1LA 1YJWS 3IN5A 1UPMB 3GYXB 1YIJS 1DLOA 2HZAA 1UFLA 5DZ7A 2YKOA 2H54B 2AJ1A 5CYQA 2P9CA 1Y3KA 2W1BA 2CWKA 2L9DA 4DV5J 4I4BA 3A8JA 4BLGA 2B4UA 4YS2A 4AQYF 3D6MB 1UWBB 3CCZA 1T94A 4PXBA 2F4VJ 2HBZB 4NLQA 4PCQA 4FPRA 2KT3A 1FEHA 2E7WA 3SBMA 3EZUA 3ENWA 1GEHA 3TNVA 5KFOA 4KBIA 4LRBA 4YB6A 1RKJA 4DDFA 2R2TA 1U09A 1QSSA 5EWEA 3TUPA 3Q24A 2P8IA 3V6HA 4XDCA 2GVDB 3EPGA 2Z2LA 2KRBA 3W5ZA 3QFWA 1N32F 2D7SA 1S6PB 2PSZA 4A4JA 1VYAA 3D3CJ 2IJFA 3PFEA 4IFVB 3IO1A 4WK3A 3MTKA 5DDQC 4ZCKA 1WC1A 2OPRB 2W9BA 3UO0A 3GB0A 3OQ2A 4CCHA 1HNIB 1SC6A 4LSLB 1L3VA 5D3GB 4NMXA 1OS5A 2BE2A 1SKSA 2QYGA 1S1WA 1JLFB 3R6GB 2HFSA 4AXIA 3NCQA 3UVJA 3GMGA 1RAOA 5HJYA 4E0DA 3GV5B 1S1VB 5HMYA 4EBDA 1S1UA 3WC0A 5C7PA 3BR8A 4RPFA 4P71A 4DG1B 3OV7A 4ERDA 3OLBA 2VJVA 2E9RX 5K8MA 3W5XA 5IM0B 5B0BA 1PC5A 3OJUA 1HBUA 5E3QA 4GRSA 1QDUB 3CB4A 2FJBB 2NR0A 1H38A 1X4GA 2DJWA 1KWMA 2JC1A 1NSPA 2KT2A 4U7CA 2ALZA 2AV5A 2YX1A 3C14B 4MYUA 3TZXA 3CXCR 2ZH3A 2CG4A 2KKHA 1VHFA 4K4ZA 4PQUA 2FLLA 3BQ0A 1K8AT 1H72C 2DKOB 3EGZA 5B0CA 3GSDA 8AT1B 1YRTA 3SZ2A 4ZVUB 1LW2A 1RACB 2G13A 2VKRA 2ZBPA 3R2DJ 3MEGA 4MK8A 2QL7B 3NGUA 4UT4A 3MMCB 5D4NA 1KNZA 2AQ4A 4OYMA 1TK5A 3F73A 1S76D 1MN7A 3LWLA 3EJMA 2DH7A 4A8QA 2VG6B 5J2NB 3EICA 1FD2A 3V4IB 5A8WB 2DNPA 2EFGA 4DR1J 1S7HA 3DRPB 4BCAA 2X1FA 4IRKA 4CI0B 2WZ1A 1XNRJ 3QT8A 5L9NA 1SH3A 4WIQA 3I87A 3B6BA 1CJKA 2BOAA 2FPHX 3UFCX 2JLEA 4IG0A 1HKAA 4GC7A 4RNFA 1VBZA 4Q8FA 1OMSA 4OIXA 2HBYB 1HNVA 3MEEA 1S9EB 1HL6A 5DQHA 4ELVA 1HNXJ 4KHMA 1F2HA 4H4KC 5MLCV 2EVZA 3VVUA 2KB2A 1ITPA 2CQ2A 3N28A 5LSLA 3J7Z5 2DGQA 5DGAA 1ZM9A 2UXBJ 3PFOA 1PAEX 2ZOFA 1PYTA 2R9LA 1NJXA 1C0TA 2HKEA 4OX9J 2W2MP 3MR6A 2DPJA 5IT0A 1EB0A 4KO0B 2IVFB 5K5MA 1RBLA 2VKZG 5KFWA 1NM2A 1EJ7L 7AT1B 4Q7AA 2YNHB 3HFKA 4NA3A 3MHYA 4RUHA 1NPPA 1OO0B 2EG2A 1DLOB 4F2SA 3ZC4A 2RVJA 4JI6J 1UVLA 4LF6J 5CYQB 4OYZA 3RW7A 4JI5F 3WDOA 3FEYB 3PHEA 3K59A 1A9NB 3W64A 2DH9A 2PT0A 2XLIA 1IBKF 3UDEA 1IBLF 2AF6A 1TL1A 4HDGA 5DM6Q 1YBAA 2BJ7A 4P2MA 2MKCA 3JTOA 2V9KA 1IKWA 1GAOA 2BJ8A 2EI5A 3UN5A 2ZM6J 1CBKA 4HEA9 1Q8IA 3MMAA 2XMAA 3TJAA 2DRAA 5GAGI 3E51A 2B7BB 1FX4A 3H2LA 2QSWA 2ZWOA 4F36A 2FZCB 2WVEA 4A8FA 2KN4A 1HD1A 2LU1A 4LJMA 4ZN1A 1L3UA 5H9FJ 1BC6A 3WIVA 1BD6A 2UUWA 4QIWD 2JZ5A 2E5JA 3UN3A 3TA1A 3V4MA 2V4RA 3GFHA 4ED4A 3K5PA 4LREA 1EQ0A 3GPAA 2PI5A 1TKZB 1AFJA 3TAPA 2OJ3A 2HQGA 2MSTA 4B3OA 4NXNJ 2BE2B 4MYTA 1S1WB 4P73A 2HQFA 4U67Q 3UVJB 4URGA 2BQUA 3M1VA 4RWWA 4F02A 1S1UB 4CLYA 3J7ZT 4HDHA 3M6VA 1R8HA 3EZOA 4U7UD 3RZAA 1LWCA 2DY9A 2OUGA 2PA8D 3C15A 4AXJA 3SQGA 2C2ZB 2XEXA 3ZTRA 4OZ0A 2W7AA 3UPFA 1ZH5A 1X7VA 4ZVFA 1XBWA 2WRMA 1LQ9A 1HBUB 3MCMA 5E3AA 1TZ0A 2HQIA 5JXSA 3CJSA 3PDNA 2ASJA 1VC0A 1IKXA 3KHHA 1JK9B 4YQWA 4CLUA 1IWAA 3Q89A 5DLFA 2CZ4A 4C3MA 5K14A 3D5MA 4EO8A 4PQUB 1IVZA 2CUYA 1OWXA 5D15A 1Z4UA 2GNKA 4M94A 3P5BP 1YJVA 2AYGA 3H59A 2FD2A 2KFNA 3FRYA 3MM6A 2HFNA 1VQOS 2KXHA 2PMWA 1LW2B 1PYSB 1WC3A 2RH3A 3V5RA 4OYXA 3MEGB 4NLSA 4LBHA 3W1YC 4F4WA 4ED0A 1QUPA 2CG8A 4N76A 4QWDA 4J9RA 1OSDA 1UVIA 2VL1A 4HLBA 4K59A 3PXGa 4ZA1A 4N47A 1Y4ZB 3MEKA 3UDCA 5CCLA 4JV1A 4NLGA 2LP4A 2F8HA 2HZVA 3WX8A 3QWUA 4OHVA 4LF2A 1VQ5S 4NRUA 1PC4A 4USTA 1FKPA 2IVYA 3BPSP 1GXTA 2WBMA 4NX9A 4JV5F 2L48A 3PX0A 1N5VA 4AD6A 2ILYA 2JH3A 4NCAA 1AXQA 1FDAA 1CJKB 4ZPDA 4FP9A 1MG7A 4IG0B 4RLEA 1SJRA 3OXFA 4EI2A 4IH5A 4L76A 4CO0A 3D66A 3J7AN 2R8KA 1N33J 4YDDB 3VGTA 4RZRA 1B99A 2G0JA 3PG9A 4K2XA 4QU6A 3UNGC 4M5IA 1HNVB 3MEEB 1U1OA 5A2QU 1X31C 1HWKA 2MQOA 1FVQA 2HVZA 2IMWP 2OSQA 1RWWB 3GWCA 5FLXY 1TFYA 3I6PA 3AY0A 3BN7A 4DCJB 3VCDA 1DAXA 1GMWD 1MN9A 3BO3A 3MPWA 2MQMA 3HVRA 1C0TB 2VHGA 1TV6A 3RB3A 2C2OB 3CNQP 2RQKA 4Y2AA 3SCJE 4DQIA 2MB0B 3GJTB 3DNCA 3ZTQA 1XMOF 4DL6A 2OLWA 4LFAF 4OHZA 3IGVA 2DCLA 5I3UA 3OXGA 3IRWP 3AXKA 5AXMA 1RHKB 3JB9k 1FE4A 2UUBF 1HFEL 2MXYA 1U2RA 1PSDA 2BE7D 1HBMA 3Q8QB 1RT6A 1EIYB 3HXMA 4K50A 2DT9A 3ZO7A 1PJ7A 2DHGA 2CJBA 2FIUA 4OI6A 1TL1B 5C25A 2XI2A 1S0NA 2Q79A 1S0OA 2XMUA 1KN6A 1RAEB 1X5SA 4JOUA 3H20A 3AOBA 4DFMA 1YJRA 1DQAA 1FTRA 4KSEB 3WX4A 3EZ5A 2PA3A 1NMEB 3JSMA 4M5HA 1QTMA 2Q6BA 1X9SA 2QA2A 1VMBA 2RMLA 4DZDA 2J5AA 4FS1A 2PGCA 5CAAA 1VQYA 5CH7B 4FKXA 1A0OB 4NWBA 3ELHA 3OVBA 4KB7A 2ZVSA 3NXZA 4R0EA 5A8RA 1Y5LB 2DIUA 1FO1A 2BUNA 2P9EA 1CG2A 2CQ3A 1NRKA 5K8PA 2BABA 2OAUA 5AT1B 1M5KC 2HQCA 4NXMJ 1JXLA 1G3OA 2C3PA 2V4QA 2R7SA 4PWDA 4B3OB 1VQ6S 3QZ8A 3GE9A 3N0VA 2AX1A 2RE1A 3C16A 3IG1A 5IV4A 3SFUA 4O4RA 1KFDA 3CGIA 1DTQA 3M1VB 2I9SA 3FZ2A 4PG8A 3FVYA 1LWCB 3FMBA 3C15B 3VWSA 2VPWB 4NLDA 3SQGB 2FTRA 4O44A 3MECA 2HK2A 2DIVA 1W7WA 3OTOJ 3BO2A 1YJNS 4LRCA 4DV1J 4N8OA 1S99A 1IKXB 3MEDB 1U8SA 3M8PA 3VZHA 3UI3A 1YX2A 3KG0A 3VVTA 1KRPA 5K14B 5EDWA 4FKYA 2ZKTA 2XMVA 4ECWA 1SH2A 4NLVA 4YDXA 1KEKA 4OI0A 5HI7A 3D9BA 4J91A 2CPIA 4B3TJ 1S6QA 2SXLA 3AQPA 2R7VA 3MM6B 2GX8A 2JEIA 2RT3A 2PDAA 1TFWA 3MUVP 5D6GA 4ZP7A 3DDKA 3PY8A 3S7RA 4ZOSA 1R8AA 3CDEA 4R8UA 2CFXA 3LP0A 3DMJA 4HH1A 2CJYB 1F60B 2MLYA 4OYBA 3J7A1 3NGTA 4RR5A 4FYXB 3NMRA 4G1QA 3EPIA 4J9OA 4OI4A 1I94J 3C66A 3F41A 2BDPA 5GAEI 2E5HA 3HT0A 1FKPB 3IGNA 4CO1A 4NLXA 5GADU 3IR5B 4DR5J 1WELA 3DXSX 2QLWA 2D3ZA 1FKOA 4DPXA 3W2VA 1Y10A 4EZ9A 3HVTA 4ES2A 4ANCA 4B9NA 3P45B 2EFNA 2CJ9A 1JQGA 2ABYA 4PYAA 1WSRA 3KDOA 2DITA 3S6EA 1XK8A 3JQMA 2E5IA 5B0DA 2ACYA 3AFGA 3D0GE 3KMQA 4HHJA 5EWGA 4C48A 2HFZA 4J9UE 1TV6B 2HVDA 2W2NP 3ETMA 2R4FA 2LA6A 4QOTA 5HVFA 4CO3A 4JI0J 3IBCB 4DUTA 1VFJA 2XO7A 5KT6A 1RT4A 2HGLA 3Q2SC 4DUZJ 5I3UB 2XSFA 3IAM9 3U1NA 2IRUA 2P6TA 2LCWA 2NXEA 4JI8J 1JLEA 2HVHA 2KZZA 2HLTA 2DNNA 2YPZA 3I56S 1HBMB 4PWUA 1WD6A 1RT6B 3CDBA 5KFZA 5FLXU 1BLUA 3P6YC 3Q22A 3MF5A 1S59A 4DR1F 2X1AA 2QEXS 3K58A 1CSJA 1E6YA 1UCNA 1CQNA 3MD3A 3SXLA 3PR5B 4K5RA 5C25B 1XNRF 1U6BA 2C3YA 3BO4A 1CQMA 1Q53A 1DARA 3FDSA 3K5MA 3GSIA 4NI2A 3OUYA 4R0JA 1NK5A 4Q5VA 3BREA 2B51A 3RU0A 3JSMB 3QBCA 3CJ5A 4B9LA 2AYEA 3I82A 3ZNUA 4DV0J 3OHAA 4X66J 1S5ZA 2YKQA 3K8WA 2RF2A 2A6MA 3RRGA 3QFHA 4ED1A 2XWYA 1WEZA 5LOQA 1HNXF 1GFWB 2BJEA 3K5OA 3IWXA 1RA6A 2UXBF 4HTIA 3MGJA 2QLBB 2YX4A 2R8JA 4OX9F 1VI7A 4ZLJA 1FKAF 2D3O1 1JWWA 4TU7A 2J9DA 4IO1A 4I7FA 3FKBA 3HP6A 4P72A 4ATNA 1FX2A 2OGUA 3MM9A 2QMUB 2M3DA 3D6FB 1EZZB 3FCHA 1KDNA 3C16B 4F50A 2OD4A 1DTQB 4JI6F 5DG8A 1RHJB 2FVCA 4LF6F 2V4JA 3QZ7A 1PAUB 1SJ1A 4D3GA 3JSYA 1H0HB 1Q5VA 4O44B 3MECB 2BKPA 3QGIA 3KKFA 3BYRA 2M5YA 3LAMA 2CPEA 2CVIA 3JXOA 3M8PB 5FJ4A 2K1RA 5LSRA 3VGSA 1JLQB 2M9KA 3SMZA 2JC0A 3V81A 2ZM6F 4OYOA 4DL3A 4ZP9A 3DLEA 2EXUA 2VOPA 4ZITA 2AW0A 1GNKA 4RX6A 5LM7E 4Y2KA 3CCJS 4GO5X 1LWEA 1Z1ZA 1MWQA 1RHRB 3AQOA 1S6QB 2ERRA 2OSRA 1DFDA 2NSCA 4DFJA 3BGOP 1R8PA 2DTJA 3OVAA 1RT3A 1S7IA 3ZZZA 1HQEA 1SIWB 2QMWA 4R8UB 4Y0FA 1N56A 2D9OA 3PW0A 2YWWA 4DL7A 3MPDA 3LP0B 3DMJB 2WONA 4G65A 4N7TA 2R8GA 2YNIA 4G1QB 4NXNF 4CH1A 1S77D 2MGZA 3EYZA 3Q2TC 3OFHA 3H4DA 1ROFA 1SQFA 3OTBA 3SSSA 2QLFB 3GR0A 3NP5A 4ELTA 5T14A 1OQ3A 1FNMA 3H2UB 5CYJA 1ZA2B 2P2CB 1H73A 1LEOA 1V5VA 4RNNA 4WFAQ 3M2RB 2BACA 4U8YA 3RJMB 4Y28C 1FKOB 1UZHA 2YKMA 4RUBA 1JJ4A 4OX7A 1J2VA 3OL7A 3W2VB 3CTRA 3UR3C 4A8WA 4I64A 1H7WA 3HO1A 4C2MA 4DPYA 1MMLA 3AA9A 2M88A 3FEZA 1YWXA 4F4ZA 1QAIA 1SXLA 4NCGA 4B08A 2XM3A 1SL0A 1MLAA 4EEYA 2IYGA 3RYLA 1D8ZA 4BHQA 3PRVA 1JLAB 1LK5A 3CCLS 2OP5A 5KG6A 4MIBA 3T1HJ 1REVB 2E1RA 2J6TA 3HHNB 1CJVB 1DRZA 3UW1A 3KLGA 3PIOQ 2HHXA 2VBXA 1TMJA 2H4YB 3BBBA 2V2KA 5KTQA 3A1YG 1RT4B 4AL6A 4FXDA 3VGVA 2ZZTA 1JLEB 4I56A 2KG1A 1D9AA 3PW4A 1B3TA 3SI8A 2CQCA 3S01A 1ZS6A 1VRQC 3D68A 3SEOA 1AFIA 4X4SA 1RK8A 3AAWB 1E6YB 2GAHC 3AB2B 3B82A 3H2VE 3CVKA 3KNGA 1VK8A 2RU3A 4ZVPB 5AE1A 5CD4H 2GJ2A 1YG0A 2CNOB 3THVA 2C3MA 3K57A 3NCPA 5DDPC 4NI2B 3OUYB 1MMNA 2PIIA 4S0MA 2IIHA 1TAUA 2KH9A 1KSPA 1U2CA 3DLLQ 4N56A 1R0AA 3KJVB 3T3FA 2QC3A 2DRBA 4JV2A 1HW8A 1NHKL 2GC8A 1WI8A 2RF2B 3NKYA 1EKSA 1WTFA 4V1Ak 3PYFA 4JYAJ 5HSPA 1U48A 1N48A 2GQ2A 2DB1A 2GJFA 2KG0A 2VG7A 2KXFA 1URNA 1TELA 1SPBP 2HZCA 2CXEA 1ZAXA 4K7QA 2FC9A 2K7KA 3CCVS 1RAGB 2OKQA 3CMES 1PO6A 3H4BA 4I7FB 2GVZA 2X7IA 2XLJA 1BXNA 3T1YJ 5HAOA 1NHVA 3MM9B 2CQGA 4KPCA 4IUFA 4OHYA 4RUCA 2W24A 1LK7A 2CIMA 1RP5A 4A8KA 1A7GE 3B8HA 3JSBA 1UMJA 4J9PA 4FBTA 2YWGA 4FF1A 1K1QA 2EK6A 1P27B 3RGIA 3CD7A 1UVMA 1VBXA 3VALA 1BY9A 3A8EA 2K1RB 3MFHA 3ZZ0A 1J5OA 2AJ4A 1NBEB 3V81B 1U47A 2DGOA 3DLEB 3CULA 4ED7A 4DV7J 2NZ4A 3LANA 3N5FA 2G2YA 1SKUB 2WSEC 3KHRA 3R5CA 1LWEB 5B09A 2V9WA 3BPDA 2CPFA 3HSDA 2DD8S 2GQQA 5F8GA 4F26A 1AYEA 1Q4RA 1XN9A 2YNGA 1WG1A 5GMKa 4LF4J 1OYEA 1RT3B 1EP4B 1ZBTA 3ENQA 5IC4B 2K3IA 2B9WA 4PXEA 2E5LJ 3DI6A 4QBUA 4OYWA 2M2BA 1UJ4A 1RSCA 2N4CA 4DX5A 2F9DA 2WONB 3ISND 2B43A 4NXMF 2UV8G 3D1OA 5LXYA 5KFSA 2DHHA 5HO4A 3G87A 3Q86A 4M5GA 4YUDA 2MGZB 5JUMA 4WF9Q 3PYGA 2DXFA 1PG5B 2AZ3A 5F8MA 5F8IA 3VHQA 1Q8BA 5K8OA 1N34J 3J81j 4OZ2A 1J5EF 2YKMB 1QJHA 2IM2A 3E3XA 3OTOF 3Q0AA 4TQRA 3AODA 4MKVA 2UUAJ 4DV1F 4A8SA 4TY9A 2COLA 1N0VC 4TLRA 1NDLA 5E7OB 2A2DA 4UUXA 1NH8A 3LGNA 3KLFA 1X0FA 4NCGB 4USWA 1ZETA 3D1QA 1UTAA 4TYBA 3E8OA 1X5PA 4FF3A 3SCLE 4YB7A 3D3BJ 5I3QA 1VRUA 2DH8A 2JHEA 2Q66A 2FJWA 4Z7CA 4RNMA 1WKKA 3EVMA 1RI7A 4B3TF 3BEGB 5U47A 1YJUA 1RWKB 3GJQB 2R7TA 3KLGB 4URSA 2C2DA 2ZE2A 4GC6A 4ECZA 1V6HA 2IVMA 3GJSB 2DYAA 3A12A 4DN0A 2KM8C 1QAYA 1RA7A 4F8RA 1IJEB 3GFZA 1RT5A 2H5EA 2NQPA 3CJQA 2G0CA 3QRRA 3ONQA 1P1TA 2DR7A 4MT1A 1IM4A 3SYZA 1IWGA 4CNYA 2PO4A 3CCQS 1I94F 1EHWA 1U0SA 2DNHA 3DRSB 1BQNA 4LT6A 2W4DA 3M6XA 4ZVEA 2M8DB 1KP6A 3MAAA 1OPIA 3W8GA 4XDDA 8ATCB 2J9CA 4OLPA 3GCXP 2WVCA 2KFZA 2MLZA 4LBPA 4KE5A 1S79A 3WIUA 1R0AB 4KGKA 2HHWA 4ILRA 4DQPA 2CQBA 3QRPA 3Q8RB 5KFIA 2ZJRQ 4GO7X 1TU0B 2F4FA 2DBBA 4ID8A 2VG7B 1IBMJ 1HR0J 4C8OA 2UP1A 1N0UA 4DX8H 3NRBA 2BANA 2LKZA 1UPPA 3WHIA 2DK2A 4ZVGA 3GU0A 4MAKA 4Q2MA 1NK8A 4GKJJ 2DO0A 4ZLLA 2CJAA 2GVZB 4JI0F 4ECVA 4X4NA 1FWKA 1U1PA 4DR7F 4DUZF 4LR7A 1EQMA 4TNOA 4JI8F 3OFGA 2V8DA 3LTOA 1HI8A 4WCEQ 4K8RA 3UD5A 2HIQA 2CNKB 2ZZNA 1PCAA 4X64J 4GKKF 1G4CA 2DNQA 2XMMA 2B9EA 2LQ8A 2HS0A 1U1RA 2HNDA 4JI4F 4KGXB 4HTJA 2RHQB 1UWAA 2RILA 4EBEA 3DLGA 4LF8J 1EETA 2HGNA 3B78A 3OR2A 5F9LA 4ZJLA 1FRLA 1L3SA 2VDIA 4DUYJ 1FTCA 1J5OB 4JBCA 4IR1A 4A8YA 1Q5YA 3ILIA 2G2OA 1RZMA 3HPOA 3C6UB 1Z2ZA 5HJXA 2DGTA 4DV0F 5KG3A 4X66F 2ZH4A 3QATA 1UVNA 4TY8A 2XGPA 3QAEA 1SI9A 2P9GA 2N82B 5E0OA 1XEZA 2YNGB 2HHHJ 5HP1A 3CO9A 1RTJB 1T9UA 3KLVA 4QJVA 4HT5A 4ANDA 1WDTA 1RLCL 3G6XA 2ZH5A 3DI6B 2BZ2A 2VV5A 4WP8A 1K9MT 3NNCA 2RUSA 2HNYA 2A2CA 1I51B 1LW0A 1XMQJ 1G6BA 2J0XA 1SH0A 3M8RA 1U2FA 2V94A 4G1PA 4M63A 2HNZA 4JI3J 5LMNJ 3CC4S 4EFAC 2J8AA 2RDJA 2H5JB 2Y0SD 1TKDA 3BBFA 1R6VA 3H42A 2VONA 3DRXA 3K7RA 4WIIA 2ZFHA 3IP0A 1FWPA 3MM5A 3TAQA 1X4DA 4RBVA 3Q8YA 4WZMA 2KXNB 5LJ3Y 4KH0B 4I2PA 4YFUA 4LIWA 3DYAA 3PO4A 2YWFA 2LLZA 5EWFA 3IXQA 5A0YA 3KLFB 2ZH6A 4KHPF 4OYIA 4HI1A 4RW6B 1VQ9S 3CMAS 3KG4A 3TEGA 2LEPA 2YY3A 4ECRA 1LV5A 1VRUB 2M4MA 3EVOA 2BV3A 1YDLA 4L73A 3PV8A 3R5JB 2ZITA 2YKAA 1CJTA 4RW9A 2ZE2B 2C1EB 3HVAA 1CVJA 2Q3PA 1KHVA 3AD8C 3H5YA 1RT5B 4ED2A 2OELA 1M0SA 5HQ8A 1OIAA 1RAJA 4KHRA 2CKWA 3JAMU 2XS7A 5C5JA 4ER8A 4IOAQ 2MKYA 3SFGA 4DL4A 3JQKA 3R7NB 4JV0A 1BQNB 4RW7A 1SKWA 1OSCA 3OW2R 3IM9A 2I2YA 2KYXA 2KM8B 5T41A 2BE9B 1M90T 2LFVA 2UZAA 1U4BA 5KFVA 3HDSA 3M9MB 3ULHA 3TX0A 1QY7A 2E66A 5KG4A 1W25A 1QM9A 1RAFB 1KQFB 2YPYA 4IOBA 4MTPA 2B4VA 4P7TA 3WZ0A 5HMXA 4QWEA 3MPUB 1OY8A 3R2CJ 1PJ5A 3JS9A 1WG5A 4F0MA 2BANB 3NGSA 5ETRA 1MWYA 3T1HF 1S49A 4LVOP 2EBEA 2J0WA 4DR4J 5L9XA 4B9MA 2QO3A 3MOJB 2XBPA 2V8PA 4NPOA 3PEJA 3LW5C 2XWXA 5AXLA 3EGVA 4TU8A 1QE1B 2BJ3A 4LRDA 2BQRA 2B5JA 3F0NA 1NPRA 3D7SB 4HKQA 1GMVA 2CWXA 3MR2A 1HNIA 5F8LA 1V3SA 4KGZB 3QJPA 2QA4G 1RKIA 1KFSA 4OI2A 1FF2A 3FQLA 3PRDA 4LF7J 3AB4B 2FHOB 1YTYA 3DRYA 2EFVA 1VIOA 2LECA 2HNDB 3I0SA 3V2UC 2OPQA 5AE2A 4DEZA 2CJKA 4Y2IA 2B7CB 2O3DA 2YX7A 2LMIA 3DLGB 1EETB 3TVKA 3OR2B 2LA4A 5D4OA 2VJUA 4QW8A 1TL7A 1TR0A 3UD4P 5IM0A 4EU0A 1IKYA 4ECXA 4CP5A 2C2NA 1NNDA 3MUMP 2JNJA 2XZTB 1H74A 5DO2A 4USUA 4RW4A 2HSEB 2PMZD 3PKYA 1TKTA 2YNFB 3T6JA 4QR1A 2I8EA 4DBQA 3M6UA 5H9EK 5F9NA 4YHHJ 1CC7A 3GIKA 4TY8B 4AFFA 2R2UA 1IKVA 3IAS9 1Q82T 1VQ8S 3NGKA 5JVHQ 2GQCA 2WBRA 5HP1B 2RRBA 4NLPA 4ZHRA 1FK9A 1IR0A 3MD1A 3AH6A 4WFNQ 1TL3A 3SSQA 4XAKA 4IFYB 4LR9A 5C2CA 4DR3F 2A10A 3HF5A 3TANA 1FEEA 4R5PA 3GZ7A 2HNYB 3T1YF 1WC5A 5M2PA 1LW0B 3R7SB 3H5XA 2XCAA 1KQSR 2NYIA 1NK9A 3QSIA 4UUWA 2GHWA 2W25A 2E1MC 4NZ6A 3MPVA 2ASYA 4I68A 2VG6A 1F3FA 5KG0A 2FQQB 4F7VA 2VB6A 3LP1A 1XWLA 2HNZB 1RAHB 3DU5A 2ADBA 5IT9U 4C8YA 5EN1A 3MM5B 4D3HA 1HWLA 2FHMA 3ILJA 4DF4A 7FDRA 1V3RA 4I2PB 4IRCA 3QAUA 3DYAB 4DU7A 3C8YA 2FJAB 2DNKA 3MUTP 3T5KA 1Q95G 5A0YB 5DG7A 3E2EA 2AYMA 2IAJA 3GV7B 2JEJA 2DGXA 3N6LA 3PX6A 1JLGA 4CM2A 1RYSA 3GYNA 1NHUA 2KHDA 3OJSA 5L1KA 5DM7Q 3BKTA 5FD1A 1ULRA 3RB6A 1IN0A 2GMHA 4K4SA 1QD1A 3KG1A 2X3DA 1BE4A 4DF8A 4W92B 3ZTSA 3CDWA 2FJXA 2DR5A 2HVIA 4UY8T 4ECTA 1T11A 4EWTA 1REGX 4ECQA 1CJTB 4RW9B 2VH7A 4RUAA 1U25A 2HHTA 1RYRA 4B9TA 1S9GA 2ACMA 3V6DA 2FVQA 5KG7A 4NLRA 2Y9HA 2DNZA 2W2PP 2C2MB 2CQPA 3W60A 2E5LF 3C19A 3PRBA 3CEDA 4OX6A 1FXLA 5C24A 3M6WA 3R1LA 3R7BB 3JYTA 4M5DB 1URRA 2LQ9A 3QIPA 4F0HA 2VQFJ 2MQQA 3MCSA 4RW7B 4FF4A 5M2UA 3QLHA 3SCIE 4NA2A 3H40A 3MM8A 3FRZA 4C8MA 2J6SA 3DU6A 4DL2A 2IC3A 1AW0A 1WC4A 1TUGB 3ILOA 3NGDA 1HNZJ 3HZGA 2QG9B 4BBYA 2ZH9A 2GMJA 2QL9B 2UUAF 4X4QA 5IFMA 3CE8A 3HKWA 5B0AA 4EO6A 1DBDA 1KVKA 1HQ2A 1WSVA 2C2KB 3VAHA 2AEJA 3P4UB 1Q81T 5ETTA 1Y0HA 4NLWA 1NK7A 1UFKA 1KTQA 2HQ3A 3KFWX 3FNNA 4YB1P 2E44A 3H98A 5J2MA 5HVGA 2ROEA 4ITSA 1RISA 5CXTA 1VQMS 4ZCMA 5ADZA 1TKXA 2F3JA 1N4LA 1RGVA 4NEYA 2GS8A 1T03A 1RWMB 3GLJA 3IWNC 4NMLA 4USIA 2EC2A 3OSPA 2U2FA 3TP2A 4JP8A 3UR0A 3OHBA 2B5JB 3H90A 1OJ4A 3A3NB 2JX2A 2CQ4A 2YH0A 3FCWA 2XHWA 4CDIA 4J9KA 5LSOA 2VBYA 3EXCX 1TKZA 4P74A 4QU7A 2ZH1A 3I9ZA 3CCMS 4DS4A 2YKPA 4J7CA 2MZ1A 1U1KA 5D8HB 4ED5A 3I0SB 4P2SA 1KVIA 1CEZA 4DWIA 2OPQB 3DOKA 1JXEA 1KR4A 2DY1A 1TL7B 1N52B 1FJ7A 3GTYX 1IKYB 2FC8A 2GZOA 3BZQA 2FDNA 1RT1A 4LQ3A 4NZ0A 1R31A 4RW4B 4ZVQB 1DHMA 4AT1B 1TKTB 3O3LA 4LFBJ 2ZHOA 4I69A 4E8UA 4PPZA 3KYLA 1ZTTA 1IKVB 2E1PA 3NS6A 4LSNA 1RADB 2OMLA 2ROGA 2OO4A 1IBMF 1HR0F 4ETZA 4XPEA 4L3NA 4ZHRB 1FK9B 4DLGA 2W9CB 1TL3B 4CTAA 4ZVRB 4DQRA 1RBAA 4GKJF 3DDIA 5KT7A 4R5PB 3L9ZA 4X4VA 2DO4A 3T41A 5J1NA 4PWWA 2BEFA 4CO2A 4L74A 4PAAA 4ZP6A 2VUGA 2QE5A 1TTHB 3GILA 1FRKA 1Q86T 1NJIT 4AUKA 1U0HA 4DR2J 3D28A 5KFBA 3FMWA 3LP1B 2CQDA 3GIMA 4XIUA 1M5HA 1UP1A 4WWSA 3HFVA 3CC7S 1R0CB 3LALA 2HFVA 5J1EA 3OBIA 1N5YA 3PACA 1H2TZ 4FN5A 2M52A 2PC6A 4OZ5A 1JJCB 2V5HG 3NGRA 4HVZA 5CD4A 3L3CA 4LF8F 1JLBA 2ZBCA 4WYLA 4EUVA 1F9FA 4DUYF 2UU9J 3R5DA 2IAJB 3MCOA 5F3ZA 3OD2A 1DQ8A 2RAQA 1JLGB 2O1PA 4N8NA 4ZVSB 1SCJB 1N6QA 1HHTP 1JMTA 3D4JA 2DNOA 3U02A 4QCLA 1LXJA 4UOFA 2ZBQA 4RW8A 2VC0A 3SSRA 4L6V3 2N7YA 2FYXA 2JOQA 3HM9A 4IDKA 4USVA 4KGMA 4ICLA 4PABA 2N7CA 4CT9A 2VFRA 1B0VA 2HHHF 4W4MA 1S9GB 1T0TV 4ANEA 2XNQA 2V67A 3V6DB 1O51A 2R7WA 2Y1IA 1WTBA 4KAIA 4I1TA 4ETXA 4YP3A 1N36J 3VQTA 3NG8A 1X9WA 1GQEA 3H25A 2QA1A 9ATCB 4BWMA 5C24B 1LFWA 1C0UA 5A6PA 3JYTB 2IRYA 2FUG9 1SC3B 3D67A 3QIPB 4KJIA 4C0OC 2GV1A 1XMQF 4QPXA 4OV1A 4IO9Q 4QWAA 2DGVA 1AZSA 1F3VA 5HVHA 4DSLA 2OTJS 2J0SD 3QLHB 3TVZA 3MM8B 1BQMB 2JRSA 4UOCA 4IH6A 1P6TA 2IC3B 3MR3A 4JI3F 5LMNF 2W2OP 5F0WA 4B3RJ 3AOAA 1IBCB 1R8CA 3NNAA 4PUOA 3MXHP 3HJFA 2ZVIA 3OPKA 3HKZD 5DJBA 2BKNA 2MJNA 4FZVA 3W7BA 2HIYA 4USJC 2DNLA 2V68A 2ZD1A 3HK2A 4U6PA 1Q0NA 2EC0A 2VODA 1ZM2A 1HWUA 3QQCD 2HHUA 4O3OA 2AEFA 3TO8A 1N54B 3NBPA 2J9DE 1CS4A 2F8EX 4MKYA 1XTZA 3PYDA 5KFLA 2ZZMA 1EARA 5GMDA 5J2MB 2Q6CA 4ZPVR 1FWLA 2KVQE 4A8XA 1JXVA 4KC5A 4O3NA 2G1HA 2ZC4A 3KOAA 5IT4A 1OY6A 1VR6A 2HS4A 3M9NB 1TKXB 4JI2J 1S72S 6FD1A 1T03B 3UDVA 3Q83A 2CPHA 2KYZA 2MHNA 3BH6B 3CD0A 2JJ4D 1P1LA 3W63A 1U45A 2F63A 2ASLA 4FYVB 2NSBA 4P9SA 3W8PA 4HHHA 1C4AA 1VQSA 4YEAA 4CO5A 3QGHA 2DHAA 3RBEA 3CCSS 5KFYA 2XULA 4DSKA 1TQLA 5D0GA 3DOKB 1T9TA 2EFOA 4LRFA 3Q23A 4E98A 1KQGB 5F41A 4V19J 1YK9A 1HMVB 3N9UC 3I55S 1RT1B 1UW9A 2HPUA 3MAQA 3MEDA 3WBZA 3OTDA 3P8BB 3BQ1A 1IBLJ 2W7OA 3CD6S 1KQKA 2O5DA 1J27A 2HHQA 4LSNB 1T8EA 2GHPA 3PIPQ 2CZVC 2ASDA 5E3PA 1TP7A 4WPAA 1R43A 5HQMA 4DR4F 2IHR1 2ZWPA 3CO0P 5D0EA 4CTAB 2Y8WA 4MIWA 4K0KJ 3A8KA 2H1YA 1C1CA 1HI1A 2MKHA 2A6OA 4H4OA 2YWEA 2UXCJ 2PN6A 3VAMA 5E33A 2KL8A 4P2XA 4A46A 4O3SA 5L1JA 2XSJA 1X4FA 5GMEA 4U95A 4GMKA 1FDBA 2E9ZA 1AROP 1GT8A 1U0HB 4F4AA 2DHXA 2MY8A 4MH8A 5IQ6A 4LF7F 1YSJA 5IWAJ 4DL5A 5HBMA 4FDFA 3KNAA 3OTEA 4C8KA 5J1EB 2ZDOA 1N5YB 2ZUAA 1VQNS 2IJNA 2BM1A 2VFSA 2CNLB 3HJVA 1VJQA 4NYOA 3TZWA 1JLBB 1WHVA 2JLGA 3Q8PB 3SDEA 1MSWD 2C2RA 4ZJQA 1VQKS 2MQNA 2AZ1A 3TI0A 1FXRA 4HYKA 5J2PA 1N6QB 1E6VA 2PI4A 1GXUA 1RWXB 1Y00A 3BBCA 4WXWA 4RW8B 1NB2A 1NSKL 3PTWA 1DURA 1D9FA 3LUYA 3I31A 4YHHF 7FD1A 2CAJA 4IDKB 4ICLB 3BGUA 3HSJA 3HHLC 2LDYA 1QUVA 2H5IB 3L7UA 4Y3CA 2UUTA 4KT0C 2D1CA 2RIJA 2GHVC 4ECYA 2MZSA 2R3VA 4U9RA 1OPZA 3I0RA 2NXNA 5HLFA 1XIQA 1C0UB 4QYZK 4HL9A 3IM8A 1S4EA 3I9V9 2NS1B 4P52A 4OYPA 2EPIA 3OT9A 1NUEA 1U6ZA 2MMYA 1AZSB 3HHLA 1V9OA 2HMIA 1IJFB 5THWA 4RU9A 3L4BC 2IM3A 4M5LA 5HK4A 5KOWA 2GCFA 3SQOP 1D0EA 2MQ8A 4CZCA 1UZDA 1YJTA 4PUOB 4I0WA 2GO8A 3KLHA 5ITHA 2DISA 2RQ4A 2MQPA 4MKBA 1PIEA 1MU2A 1T02A 2PE8A 2IDLA 1FJEB 2ZD1B 3BN4A 1Q78A 3BQ2A 1RLDA 3BB5A 3D1HA 3T19A 5D78A 4FVMA 2O66A 3NBPB 1CS4B 4IKAA 1T9VA 3UCUP 3FSYA 1FRHA 4L3KA 2DNYA 3K5LA 3ZXWA 1RBOB 2RSQA 2RS8A 1XJWB 4MIAA 5AXKA 1FA0A 3CUNA 5CZXA 3PCOB 3EX7B 2AX0A 2ILZA 3EMTA 2WHOA 3T9ZA 2W7PA 5D0HA 5GAHU 1GTEA 3HSGA 1YQHA 2XS2A 3SV4A 2NXUA 2HHPA 1WOSA 2QYCA 3QO9A 1XR7A 4PG7A 3T9NA 5ETLA 3BSOA 3W65A 2FY1A 2VQFF 1QVFR 2VPZB 2BR0A 1HARA 2AJFE 3THPA 3G4SS 3RB0A 1VJWA 3CCUS 1K73T 2VQEJ 4DV5F 2FLPA 2OTLS 4F2RA 3JTNA 1GX5A 2UUBJ 2V8GA 3QGPA 1F6TA 2IM1A 4Z7YA 4G6VB 1NEEA 5KFAA 3SCKE 3GCWP 3CDUA 2F1FA 1HNZF 3KJNB 2F4VF 1H3DA 5KFJA 4WBFA 3R8YA 3EGWB 2IDEA 2H4WB 1JLQA 3ENVA 4LF1A 3NL0A 2QLXA 3NS5A 2C22A 2G1DA 3KTQA 1BMQB 1T9WA 5DETA 4HI2A 4OL8A 1RAIB 3NMAA 3OTCA 1K47A 2HRTA 5EGYA 2AWZA 1SQEA 1RTZA 2HBQB 1UEUA 2PD1A 4PZVA 1C1CB 2RHSB 2ZUGA 1D8YA 2CPJA 4H4OB 3CPWR 1HPZA 4KKOA 1RU1A 1U26A 4ZLPA 5E3CA 2XSJB 3TUJC 3RR8A 3CJRA 3AD7C 3SIPB 2MKKA 4E2FB 2UVUA 3AOCA 4CH7A 4LF5J 5HBMB 3TUZC 1KVJA 3QIDA 4OJ1A 4ZMMA 4AL5A 3TJ9A 3G8SA 1IM6A 2F7VA 3DFEA 4O0IA 2VZ9A 3BGLA 1W2BR 3N4WA 1S1XA 2VG5A 1JNZB 3M2RA 4H4MA 3RAXA 3VTIA 1TVRA 4WU2A 2G4BA 3SDEB 1I3OB 5H1SV 1R0BG 3MTJA 3PKMA 2HFOA 2N4DA 1FFSB 2LU2A 2EWHA 1WUUA 2APOA 2WTFA 5J2PB 3TA0A 1RHUB 4ZKAA 4OZLA 1CPZA 1R27B 3UQSA 1LOUA 1E6VB 3CIZA 3EDRB 5G4DA 4LFBF 2KT5A 2YKNA 4U7UK 1VLYA 1AUSL 2V50A 5KFRA 2MYFA 1LFPA 1JLAA 4RNOA 4YR2A 1XERA 2KJWA 1KOOA 1REVA 3ADAC 1QLNA 1CJVA 3BH7B 2CJQA 5BYQA 1HA1A 1BWEA 1NZ8A 3TW0A 3BGRA 3I0RB 4BWJA 3IWLA 5HLFB 3BYPA 3LOUA 2KI2A 1WACA 2CVEA 2ZNZA 4URQU 3OVSA 3D2WA 2YTCA 4DU8A 2FHJA 5BYRA 4WXOA 2GFFA 4O4GA 1RWNB 4OQJA 2DGUA 3PZPA 4ES3A 2EFPA 3HHLB 4C11A 2HMIB 4DR2F 2V0NA 2HFUA 1YITS 3CCTA 3MR7A 1NPKA 4MJKA 4ZPCA 2FB0A 1HLWA 2AGPA 4Q44A 1EAYC 3KLHB 1XC9A 3OFFA 3EE3A 1MU2B 1WOOA 3QT7A 4N77A 3V6KA 4ELUA 3POTA 5HATA 3I4PA 2LYVA 2LEBA 3FCVA 4DV2J 3VF0B 2UU9F 4CLWA 4Y6IA 3KJVA 3DLKA 2B9YA 3K17A 4PG6A 2LQJA 5AXNA 4U96A 2BKOA 5GADI 2RS2A 5AJ3J 4CIOA 2UVRA 2VPYB 1U24A 2MZTA 4DN9A 3OFEA 5DDRC 2I38A 4EBCA 4DJBA 2E29A 3ISZA 1VOMA 4OV6A 5K9FA 2VC1A 3CJ4A 2Y0BB 3BSNA 2JEGA 3LPYA 3BSAA 5BXIA 4F4XA 1VCTA 1N36F 4Y2CA 1A6LA 4RL1A 2XYPB 3N6MA 1RWPB 3QO9B 4TVAB 4ZJOA 1DZ5A 2BXJA 4ZDNA 2Z2MA 2M0GB 4WZQA 4X84A 3MWBA 3G8TA 4NCBA 3N5BA 2A0FB 1F2GA 4KTQA 3KJQB 1WC0A 3R27A 4FNHA 1SJ3P 3CSKA 5H9FK 2VPXB 4FBUA 3IS9B 2KTQA 3KK1A 4WP9A 2RQCA 4B3RF 2UVVA 4K4UA 2D9PA 1NJYA 4WE1A 5A2QY 2XLKA 4B3MJ 3J7YU 2O01C 1K44A 3EM1A 1NK6A 1QSYA 2AGQA 3Q8SB 3HHEA 5GAGU 1HBOA 1LXNA 4P75A 4QW9A 3FBEA 3G8QA 2C3OA 3HLUA 1M5OC 3KDNA 4ZK7M 2HVEA 3ZZOA 2BMBA 4KIAA 2M8HA 4ZVHA 2F65A 4NYZA 1H7XA 2W4CA 2NUHA 2VA2A 5DDOC 3PO5A 1RWVB 2V2VA 4JI2F 1VISA 1AA1B 4OJHA 4ZN3A 2RDDA 1EP4A 2DNMA 4DMZA 3NCRA 2DXDA 1NKCA 1NCLA 3TZZA 1HPZB 4KKOB 4TKTA 4X4PA 1WF2A 2QN6B 3M30B 2X1BA 1VQPS 3CJ3A 3UN2A 1TAQA 3GYGA 3J81Y 4X4OA 3U7JA 4L72B 2KRRA 1YBTA 1S12A 3M8SA 1JNRB 1RB0A 1RT2A 4KPYA 4HH0A 2CZ9A 3W66A 4ED3A 5D77A 1S1XB 2IFXA 2VG5B 2BJ1A 4XO0A 2AMCB 1KD1T 4H4MB 1SC1B 1WEYA 4Y00A 2XMWA 2W4PA 1TVRB 4H4KA 3L95X 3R5AA 5EHHA 4OZNA 3K89A 3D0IE 2ZHBA 5JVGQ 1NLKL 3C3LA 1SBRA 2XTJP 2WOMA 4W98A 2YKNB 4EYHB 3LQVA 1GMUA 3QT5A 5ETPA 1FJGJ 3FK4A 2ZJPQ 2OHDA 2M70A 2EW9A 4HR2A 2R8HA 3J7YI 3US5A 1T9XA 2V8HA 3DOLA 2R7UA 4Z37A 1MMDA 2AJ0A 4B17A 3EXYA 3O1LA 4K5SA 4O23A 2P6SA 3DOMA 2HS3A 4X4RA 2QX0A 3I5CA 5L8RC 4K0KF 1B70B 1FHTA 3BGRB 1FRMA 2YVSA 3BV8A 4LUBA 2J9EA 2QIFA 2F8MA 4LFCJ 5G0RA 5J2QA 2XC9A 4K2JA 4ILLA 5C42A 2UXCF 1SV5A 4QYRA 4O4GB 3ZZTA 6AT1B 3RRHA 1Z2LA 5KFUA 4NZ7A 2AJ2A 2FJDB 1KLNA 2IA0A 4C11B 4OI3A 1MWZA 3BF4A 2VFTA 5B08A 1WOPA 2OEKA 2RNEA 5IWAF 5CYMA 2RRAA 3BJYA 4NLUA 3DRSA 1ELOA 2W9BB 4WYWA 4HHUA 3IR7B 2OFHX 1ZZFA 5SZTA 3FGVA 2CRLA 3ILLA 3ZNJ1 3POTB 3I32A 4FXVA 4TQSA 4YB5A 1JJ2R 3DLKB 1N33F 3F44A 2J0QD 3ICLA 1T05A 5K8NA 2QT7A 4YN3B 1H2VZ 2KDOA 4CYUA 1FVSA 1YBUA 4I67A 4DX7A 2WW4A 2OD6A 2HQDA 3M32A 1QTNB 2Y1RI 1RT7A 2JL9A 3B54A 1Y5IB 2L3MA 3QRQA 2NLWA 2CQIA 2GGPA 4GVLA 2PEHA 3G71S 4DSEA 4LF9J 1FERA 1L3KA 2E7VA 3JSRA 3P49B 3PW7A 3QGGA 2GIRA 3LP2A 1RHMB 5E5NA 1Q7YT 3AA8A 1UJ5A 1XMBA 3HHKA 3IC1A 3R9LA 3D6TB 1D3WA 4Z2XA 2VFUA 1CJUA 1VLOA 2YQ3A 4OFZA 3KK1B 2WSFC 1U6FA 4WFZA 3UCGA 4WE1B 1WHWA 2XMJA 2CDQA 4PXCA 5KFHA 4KYZA 1X4BA 4Q43A 2E9TA 4QPTA 5J1PA 1UVJA 4ZPWR 1Y11A 2ZH7A 4WP3A 2YQ0A 2OPPA 3C6UA 2U1AA 1FDNA 5KG1A 3CCRS 3C2PA 1HBOB 3PNIA 1N5SA 3ZTOA 2Z58B 1M5SA 3DN9A 2ZOMA 2J76E 1SB6A 2HLUA 4ZCIA 4FF2A 5E2QA 3BKUA 3U1LA 2RD5C 3DM2A 3S8SA 2EKYA 5JMNA 4Q0BA 1S48A 5CABA 4RNHA 1MNEA 1RTJA 4OJGA 3IR6B 1S9FA 3M8QA 3G2XA 2ZH8A 2H48B 5KFKA 1XNQJ 2JDJA 1V5IB 5FIIA 3W9JA 2CADA 2JSXA 2B8PA 1UJ6A 2DVIA 4ZS6A 2J7KA 5DG9A 1RT2B 3CJTA 1FCAA 1YZ6A 3HVWA 2G2ZA 1ZM3A 5EX0A 3PHTA 4AYBD 4PYDA 2OMOA 4JI1J 4WFYA 4LQ9A 2B3TB 2HEKA 2NXCA 2VQEF 4LSZB 1RTHA 1KLMA 3NOCA 1GK8A 1U7LA 1NZAA 4J9VA 3M8YA 4QQBA 2H9ZA 3THTA 2IBKA 2WAQD 1I6JA 2XG8A 6FDRA 3PW5A 1HW9A 2K8GA 2VBWA 3UE2A 2AD9A 2WOMB 2RRNA 4RW6A 3J81U 4OZJA 5KFDA 4UW2A 3GG0A 4ZIWA 4DXLA 1IKWB 3BSCA 1DQ9A 3DOLB 3K8VA 4DR6J 1DTTA 3QSYB 2ZC3A 2HK3A 3MMAB 3DDNA 3DHXA 1JIHA 3DLHA 3DOMB 1X5OA 4N41A 3N01A 2JFDA 4J9MA 1KS2A 5G0RB 5J2QB 1NSQA 1KBRA 5C42B 2FLNA 5M2RA 1WNEA 1SV5B 1PGZA 2PEBA 2G9OA 4DV6J 2J8SA 4B9VA 4PPDA 2CNNB 2JWNA 3KMSA 3GQCA 3MPYA 3RG6A 3FBFA 1F5AA 4CT8A 1S10A 2BW2A 1SJFA 1UKUA 4LF5F 1NO8A 5CYMB 2R7QA 1AB8A 1XR6A 2K2PA 5GAEU 1YLXA 3N6NA 3LGHA 2OH2A 1UAWA 1KHWA 2UXDJ 1FFGB 3DRRA 2QJ3A 3OR1A 4DR5F 1RAAB 4FS2A 1HYSA 3TQ1A 1IXKA 2KJVA 3CWJA 3FJ2A 4DQQA 4MFBA 1ICEB 3G6YA 1NH7A 1O5JA 3TJ8A 2B9XA 3W9IA 2XB2D 5CA5A 3W61A 4FVCA 2NUUG 2HAIA 4CO4A 1GMWA 4DV3J 1M5PC 3Q8VA 4IRDA 3LGMA 1T05B 3KLIA 1JLCA 4F3MA 1V3ZA 1J5EJ 5ETKA 4CYUB 2QFJA 1X4HA 5F3TA 5A76A 3A3OB 2QL5B 1SJQA 4USMA 1F9EB 4PKDB 3IRXA 1O0PA 1G7CB 4BS2A 1JX4A 4DSIA 4DCOB 5DRKA 3E01A 1HWIA 3M32B 4Y65A 3FC9A 3H5UA 1RT7B 1F5BA 2Z56B 4A47A 5KFGA 2FZKB 4MK7A 2V69A 3VAKA 4KY3A 2GGPB 4CWBA 3ZTPA 5LMUJ 1QE1A 1TL4A 1JJHA 4EK2A 1QAJA 2D69A 5GVQA 1FRIA 5CHCB 3LP2B 5JJBA 2MKJA 2WCXA 4QZVB 4UTGA 3MI7X 3TZYA 5L39A 4Q2LA 2FJEB 2Z0GA 1CC8A 2HWIA 1P8GA 2MZRA 1HHQA 5KFFA 4WTOB 1C2PA 1C1BA 3M9OB 3KK2A 2V8VA 1CJUB 1UA1A 4J9QA 2ATLA 4QWBA 1DY3A 3GIRA 3IMQJ 2HBRB 5F0UA 3ITHA 2W8LA 1VRTA 1SC4B 3MZIA 4QIVA 1L3TA 3HMJG 8RUCA 4OHXA 2AKWB 1R7IA 3I4HX 3GONA 1VC6A 4BC7A 2JEFA 1K0TA 3NOGA 3HD1A 1P9YA 2XS5A 3RBDA 4DV2F 2QMXA 1WF1A 2OPPB 2RDIA 3NNHA 3D6HB 4FNIA 4P7VA 3J80Y 4A8OA 4X65J 1D1UA 2YNFA 2MHEA 4F0KA 5AJ3F 3DXBA 4F25A 3W3SA 3MAHA 5HMZA 5IV3A 2VASA 3BDPA 3OLAA 2X51A 3DM2B 3A4TA 2AT1B 4Q0BB 1ZA1B 2VD3A 2WSCC 2GAGC 2AGOA 3TWZA 3M8QB 4CLSA 4DSJA 2R8IA 2W2QP 4IFYA 1F1BB 3M05A 2BOPA 4YR3A 1UA0A 2IJRA 4LMZA 1VIXA 4BDPA 3VR1A 1GXLA 4I6AA 3OL6A 2HRUA 2NPIA 5DS7A 2GO9A 2KZMA 2QSFA 4UZCA 1T95A 1TK0A 5ETSA 4DR7J 3JTPA 4OZ1A 4OYAA 3FSIA 1RTHB 2POKA 1SVDA 1KLMB 5KFNA 3M2UA 2VOOA 1B0TA 3FFIA 5L46A 2BYCA 4GKKJ 2N3OA 4CLFA 2XY5A 1X0PA 4RBTA 2G0IA 4B3MF 1WG4A 2KO1A 4ALZA 1U8WA 1QSLA 4JI4J 3LH2S 5I4MA 5F8JA 5IZHA 1WKLA 2QA4S 3NS7B 3GFXA 3BR9A 4AE5A 2CQ1A 2ZNYA 2YQ1A 1Y3JA 9RUBA 1DTTB 2BRKA 3UDLA 3I96A 5A8KA 4X62J 4LR8A 1GX6A 4PG5A 4C8LA 4C3KA 1FJCA 2YWHA 4ZIVA 3C6TA 2D3OR 1F5CA 4AL7A 1ZAWA 2XGQA 4DOZA 1XR5A 5A8RB 2WK4A 4M5DA 1WWHA 4EZ6A 2GA7A 3KUGA 1NK0A 3AD9C 2E1AA 4DV4J 3BDEA 1KC8T 2B6AA 4C6AA 4NYPA 3DRRB 4OX8A 1KTVA 4K4VA 3HX9A 3OR1B 4ED8A 4PWDB 1HYSB 1RCXB 1OQ6A 1U1QA 5D4PA 4MFBB 3IG1B 4UQTA 3KWMA 2AJQA 2GJIA 3ZZUA 1NU4A 2HHVA 4KGVB 3RR7A 3KLIB 1ZZNA 1TUVA 1JLCB 4ZLNA 3ZZYA 3G6ES 5DLGA 2X1GA 1HBNA 3FUYA 4NLYA 1FJGF 4CLKA 3IRXB 3K5NA 1T9YA 4NE9C 4Y34A 2Y3YA 4R25A 3E01B 5HN0A 4ZPAA 4KHPJ 1MW7A 3MMBA 2BM0A 4F3OA 4QR2A 5C2GA 4I6YA 2HWHA 1VGYA 3K2YA 3RBZA 3R6LB 2XZWA 4LFCF 2EG1A 3NLCA 5B0GA 1ZTWA 1R8BA 3H7HB 3W9HA 4RBUA 2H51B
chains in the Genus database with same CATH topology
3DKDA 2DXFA 1NDPA 4EK2A 1NDCA 3ZTOA 3BBFA 1F6TA 2NCKL 5IOLA 1K44A 3EM1A 1VYAA 2AZ3A 3Q8YA 3B54A 3BBBA 1WKLA 3GPAA 3L7UA 3VGUA 4WBFA 2HVDA 3FBCA 3ETMA 1S5ZA 3DDIA 1BUXA 3ENAA 2B8QA 3VGVA 4ENOA 1LWXA 3FBEA 4F4AA 1B4SA 1HHQA 1PKUA 2VU5A 3NGTA 1BHNA 2CWKA 1WKJA 3VGSA 1EHWA 1BE4A 4DUTA 2BEFA 5CABA 1MN9A 2HVEA 3ZTSA 1XIQA 4ANEA 1NLKL 1W7WA 1LEOA 5BXIA 2HURA 1NDKA 3G2XA 1S57A 3VVUA 2ZUAA 2DY9A 1JXVA 3NGUA 1ZS6A 4W98A 3R9LA 1NDLA 1NPKA 4ANDA 3Q8VA 1HLWA 3ZTRA 1PAEX 3EMTA 3EVOA 5CAAA 3VVTA 1NUEA 2DXEA 3ZTQA 1HIYA 4DI6A 3WX8A 4KPCA 3EVWA 3Q83A 2DXDA 1XQIA 4FKXA 5C7PA 4HR2A 3ELHA 3EE3A 2B8PA 1NCLA 1MN7A 4UOHA 3FKBA 3BH6B 2AZ1A 3PJ9A 3EJMA 4FKYA 1F3FA 4F36A 3NGRA 1S59A 3EICA 1NSQA 3Q89A 1UCNA 1WKKA 3FCVA 4ANCA 3Q8UA 4CP5A 3EVMA 3JS9A 4S0MA 4DZ6A 3BBCA 3NGSA 1KDNA 3GP9A 3FC9A 3PRVA 4O0NA 1NB2A 1NSKL 4C6AA 4UOGA 1NSPA 3Q86A 3BH7B 3FBBA 1U8WA 3FCWA 1NHKL 2DYAA 3ZTPA 2BX6A 3B6BA 3VGTA 3MPDA 1B99A 3FBFA 4UOFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DKD A;  2DXF A;  1NDP A;  4EK2 A;  1NDC A;  3ZTO A;  3BBF A;  1F6T A;  2NCK L;  5IOL A;  1K44 A;  3EM1 A;  1VYA A;  2AZ3 A;  3Q8Y A;  3B54 A;  3BBB A;  1WKL A;  3GPA A;  3L7U A;  3VGU A;  4WBF A;  2HVD A;  3FBC A;  3ETM A;  1S5Z A;  3DDI A;  1BUX A;  3ENA A;  2B8Q A;  3VGV A;  4ENO A;  1LWX A;  3FBE A;  4F4A A;  1B4S A;  1HHQ A;  1PKU A;  2VU5 A;  3NGT A;  1BHN A;  2CWK A;  1WKJ A;  3VGS A;  1EHW A;  1BE4 A;  4DUT A;  2BEF A;  5CAB A;  1MN9 A;  2HVE A;  3ZTS A;  1XIQ A;  4ANE A;  1NLK L;  1W7W A;  1LEO A;  5BXI A;  2HUR A;  1NDK A;  3G2X A;  1S57 A;  3VVU A;  2ZUA A;  2DY9 A;  1JXV A;  3NGU A;  1ZS6 A;  4W98 A;  3R9L A;  1NDL A;  1NPK A;  4AND A;  3Q8V A;  1HLW A;  3ZTR A;  1PAE X;  3EMT A;  3EVO A;  5CAA A;  3VVT A;  1NUE A;  2DXE A;  3ZTQ A;  1HIY A;  4DI6 A;  3WX8 A;  4KPC A;  3EVW A;  3Q83 A;  2DXD A;  1XQI A;  4FKX A;  5C7P A;  4HR2 A;  3ELH A;  3EE3 A;  2B8P A;  1NCL A;  1MN7 A;  4UOH A;  3FKB A;  3BH6 B;  2AZ1 A;  3PJ9 A;  3EJM A;  4FKY A;  1F3F A;  4F36 A;  3NGR A;  1S59 A;  3EIC A;  1NSQ A;  3Q89 A;  1UCN A;  1WKK A;  3FCV A;  4ANC A;  3Q8U A;  4CP5 A;  3EVM A;  3JS9 A;  4S0M A;  4DZ6 A;  3BBC A;  3NGS A;  1KDN A;  3GP9 A;  3FC9 A;  3PRV A;  4O0N A;  1NB2 A;  1NSK L;  4C6A A;  4UOG A;  1NSP A;  3Q86 A;  3BH7 B;  3FBB A;  1U8W A;  3FCW A;  1NHK L;  2DYA A;  3ZTP A;  2BX6 A;  3B6B A;  3VGT A;  3MPD A;  1B99 A;  3FBF A;  4UOF A; 
#chains in the Genus database with same CATH topology
 1W26 A;  4DX6 A;  1FNO A;  4IG3 A;  1C1B B;  3KK2 B;  5HQL A;  1ZAV A;  1H6K X;  3ITH B;  4F4Y A;  4DS5 A;  1VRT B;  2XMK A;  5ETN A;  1Y9O A;  2B4P A;  1WKJ A;  2XZD B;  1FFW B;  3TX8 A;  5SUH A;  1I5O B;  2R7R A;  1NDK A;  5HRO A;  2BVZ A;  4J37 A;  3VAJ A;  4YOE A;  3VAF A;  2BA9 A;  2H3E B;  1SKR A;  2V63 A;  1D09 B;  1XQI A;  3BKF A;  4OJ3 A;  3PJ9 A;  2W9A A;  1RQ0 A;  2B0G A;  2R2S A;  4JYA F;  3Q8U A;  1AT1 B;  3HVT B;  1S0V A;  3GP9 A;  3K0J A;  4J9N A;  3MM7 A;  1N88 A;  4P6Q A;  2Z4P A;  2W9C A;  2HYI B;  1O6X A;  3DKD A;  2UUC J;  1ZPV A;  3QPI A;  1OYD A;  3QYY A;  5KG2 A;  2KFY A;  3KHL A;  4LF9 F;  2I0X A;  2NXJ A;  4NEZ A;  3QJJ A;  4B9S A;  2DNG A;  3HZE A;  2D74 B;  1LKZ A;  3ENA A;  2B8Q A;  3J80 U;  4F4K A;  2XI3 A;  3VV2 B;  1ACM B;  3NY0 A;  4O3R A;  2PFD A;  3CW2 C;  1PIL A;  5EUH A;  4DQS A;  1KKH A;  4PRF A;  2HRY A;  1FXD A;  5KFM A;  5IQQ A;  3RBX A;  3W5Y A;  1UEV A;  1RHQ B;  1YJ9 S;  1WF0 A;  3MDF A;  2J7W A;  2MSS A;  4B3S J;  5IXU A;  1S6U A;  2J6U A;  4UF4 A;  1NKE A;  4DHV A;  1YRU A;  2ALY B;  3M2U B;  3HI9 A;  3PW2 A;  2VBZ A;  4M1K A;  3FFI B;  3VQS A;  5RUB A;  4YY3 J;  3EUN A;  3DHW C;  1HD0 A;  2VIC A;  5BR8 J;  2ZKU A;  2NRE A;  3LA0 A;  2AEM A;  1WHY A;  3MUR P;  3F56 A;  2YXL A;  2VA3 A;  5K20 B;  2OFG X;  3MR5 A;  2XCP A;  3TQE A;  4DV7 F;  4RO0 A;  3JQJ A;  2MKI A;  1DJ0 A;  4ZPT R;  1HHS A;  2A18 A;  4FXW A;  4OHW A;  4ILM A;  1GH8 A;  4TXS A;  2CPD A;  1VQL S;  2IMO A;  3CDA A;  2V34 A;  3FBC A;  3BGF A;  2QFI A;  4F3Q A;  4PQA A;  2C42 A;  2C3U A;  4KH1 B;  3TVY A;  5A8K B;  4LF4 F;  3ZFV A;  4CQ1 A;  2EK1 A;  2OI2 A;  1XNQ F;  1NJW A;  3HUL A;  3C6T B;  2VIH A;  1VQ7 S;  1HNW J;  1S97 A;  2HG4 A;  1IR1 A;  1IQZ A;  1D9D A;  5D0R A;  4B9U A;  1PJ6 A;  3QNW B;  1YJ7 A;  3ET6 A;  4HAC A;  3M4X A;  1X5T A;  4DR3 J;  1TK8 A;  2RU9 A;  2B6A B;  3A8I A;  4GVB A;  3U27 A;  1FD8 A;  4UZB A;  1C4C A;  1BQM A;  1RCO B;  4J90 A;  2QRR A;  1N34 F;  2B4O A;  4JI1 F;  1PYO B;  3TRG A;  2CQ0 A;  3UNY A;  4UOG A;  4P10 A;  5KFE A;  4ZVO B;  2CJX B;  2V4J B;  1LNQ A;  3GR1 A;  3VAG A;  5H9E J;  1SL2 A;  2WVD A;  4KR0 B;  3T5L A;  1UFW A;  5KT2 A;  3S1T A;  2I5J A;  2NZC A;  5ETO A;  1HBN B;  2MEW A;  1TMM A;  3OSN A;  4JI7 J;  3T1A A;  5CCM A;  3NEK A;  2HHS A;  3KHG A;  2KHC A;  2P5V A;  2HUR A;  3DGP A;  3MMB B;  4DR6 F;  1NK4 A;  3TR5 A;  1Y7P A;  3WQP A;  2WW8 A;  1HIY A;  4DI6 A;  2CA9 A;  1NJZ A;  2F9J A;  3AJ2 A;  3CF5 Q;  3DC2 A;  3P3D A;  5KOX A;  1M5V C;  3TA2 A;  2Y1J A;  1B64 A;  3DCA A;  2DR9 A;  2AYB A;  3PVX A;  4DV6 F;  4IG3 B;  4CLL A;  1SQG A;  2LDI A;  4NL5 A;  3GIJ A;  1UL3 A;  1HQE B;  1WI6 A;  1HQU A;  3FQK A;  2BW7 A;  3RRK A;  1Q1K A;  4PR6 A;  2DEI A;  3HT3 A;  2K3K A;  2LVW A;  2UXD F;  3D0H E;  2YNI B;  5DQI A;  1T7P A;  5HRO B;  3O44 A;  2L9W A;  2MQL A;  1FRX A;  4ENO A;  1HMV A;  2VU5 A;  1BHN A;  2AHO B;  1O8B A;  1SIZ A;  5CQG A;  1X9M A;  2QTW A;  4C8N A;  4DV3 F;  1U1L A;  2L41 A;  1BWV A;  1S57 A;  2M7S A;  3W2W A;  5KAK A;  4ZPB A;  4M95 A;  4AQY J;  5LT5 A;  3NWG A;  4XTT A;  2WVF A;  2W8K A;  2MZJ A;  4C98 A;  4PEO A;  4NAS A;  1NB7 A;  2NPF A;  1RXO B;  3QT6 A;  2ZOG A;  2HWT A;  1IQT A;  2BJD A;  5KFT A;  3CCW A;  3MM7 B;  2YH1 A;  4KRW A;  5KFQ A;  1KON A;  5KFP A;  5FDL A;  1N8R T;  1K1S A;  4ZCL A;  4JUZ A;  2GIF A;  4G3I A;  3JAM Y;  5B7W A;  2EKN A;  2HW3 A;  2KU7 A;  3WC2 A;  3HCX A;  3PJW A;  4TYA A;  3FBB A;  5LMU F;  2DGW A;  4XK8 C;  1S0M A;  2CPY A;  1OY9 A;  4DPT A;  2CDR B;  3KK3 A;  3H5S A;  5LXR A;  4IR9 A;  1N32 J;  5ETV A;  2Q43 A;  5HAN A;  4TLQ A;  2MJU A;  4K4T A;  3TYT A;  2D41 A;  2XQC A;  2MDA A;  4K4Y A;  1ZYQ A;  4M5J A;  4M5M A;  2Z2Y B;  4USK A;  3IBF B;  4DSF A;  1CUL A;  4ID5 A;  3OXL A;  4RKU C;  4X64 F;  1X4E A;  1PKU A;  3ETO A;  4CLT A;  3MOZ A;  1YI2 S;  1TUW A;  4LIR A;  4NA1 A;  5I42 A;  3U1M A;  2GW8 A;  5LL6 d;  3M8Z A;  3ISN C;  3L09 A;  4RU2 A;  2BQ3 A;  3PEH A;  4YR0 A;  3LWM A;  3EVW A;  2Z8Q A;  5E3R A;  4BC9 A;  5L1I A;  3D54 A;  2IYI A;  1H98 A;  4WFX A;  4QR0 A;  2XY7 A;  4X65 F;  3A13 A;  4H54 A;  5EX3 A;  4DPU A;  2ZEJ A;  2CPZ A;  3UWT A;  4LBI A;  3CJ0 A;  2R42 A;  3P96 A;  3CJ2 A;  5KT5 A;  3KXD A;  3MMJ A;  4DFP A;  3EDQ B;  5MAO A;  4KFB A;  4OLO A;  3VGU A;  1IR2 A;  3PM9 A;  2DEJ A;  1ZPW X;  4F04 B;  1S6O A;  1UET A;  5DZ6 A;  1U02 A;  3AHP A;  1HI0 P;  2OPS A;  2VDH A;  3I5B A;  4Y2M A;  2IBO A;  2D3U A;  2EEY A;  2YWK A;  2IPO B;  4DPO A;  4RWX A;  2JFK A;  1Q8L A;  2RB7 A;  5L38 A;  4CLZ A;  1R3N A;  5BYS A;  5HL7 Q;  4J9S A;  3PYE A;  1RDR A;  3ET6 B;  4HAC B;  2RKI A;  3LF0 A;  1AUD A;  1RUS A;  1UEK A;  5L1L A;  1WOR A;  4B02 A;  3QWP A;  5E41 A;  5IC6 B;  3RTV A;  4GVB B;  2YBV A;  2AU0 A;  4M5K A;  4RJV A;  4CNZ A;  3LPE A;  1U1N A;  3N79 A;  2MZQ A;  3O5T B;  4NLT A;  3GFY A;  2MLX A;  2QV6 A;  3TAR A;  2XNR A;  2OEM A;  2RUG A;  4MK9 A;  5ETQ A;  1SUQ A;  4DPW A;  2ZDP A;  2LQB A;  1S4F A;  3QJL A;  2FLO A;  2I5J B;  4L75 A;  1W2I A;  5T7L A;  4IYQ A;  3TUI C;  1Q79 A;  3AJ1 A;  1VK3 A;  3ZZR A;  4O3Q A;  3KLE A;  2FVP A;  2BX6 A;  1RTI A;  3RUB L;  2KVI A;  4KV8 A;  3LO3 A;  3CJ8 A;  2CYY A;  5KFC A;  2MKS A;  3GJR B;  3O2I A;  1Y5N B;  1X4A A;  3G82 A;  4OZ3 A;  5A6W A;  5B0F A;  3DGP B;  3PX4 A;  4DL0 C;  1S1T A;  2NYH A;  2E7X A;  4UQG A;  1YHQ S;  2DNR A;  2EFQ A;  2LQ5 A;  1RAB B;  4QWC A;  2OEJ A;  4FYY B;  2XY6 A;  1G2E A;  5KT4 A;  3M2V A;  4X62 F;  1Q16 B;  2L08 A;  5I3P A;  4O3P A;  1UW4 A;  2BRL A;  3BS9 A;  1N5Q A;  2IY5 B;  4ECU A;  1MRO A;  4J5O A;  3UD3 P;  2BBE A;  3EGN A;  5IT9 Y;  4I2Q A;  3R97 A;  1RWO B;  3FSX A;  2GML A;  1RJJ A;  1HQU B;  1U1M A;  3BM7 A;  1VHI A;  1PBA A;  4DV4 F;  3X1L B;  1LWF A;  2LXI A;  3T5J A;  3W62 A;  3GII A;  3L7P A;  1RU2 A;  2XYH B;  3L7O A;  2FHK A;  2DHS A;  1T3N A;  4KQZ A;  4W90 B;  2N3L A;  2UV8 A;  4M8L A;  4JI5 J;  4DCP B;  1R89 A;  1UVK A;  1BGX T;  4EMD A;  1FE0 A;  3CMQ A;  4EYI B;  3IFE A;  4ED6 A;  1BUX A;  2ZBI A;  3W2W B;  1JKH A;  1RE1 B;  1IBK J;  3KJF B;  2HAF A;  2VFV A;  4C4W A;  4X4T A;  4TU9 A;  3MCN A;  2XYG B;  5KG5 A;  2V2Q A;  1RTD A;  1YGY A;  3QMQ A;  4I6W A;  4C7Q A;  3T5H A;  1VS3 A;  3G6V A;  2AIR B;  3FZB A;  5DQG A;  5LJ5 Y;  3CD5 A;  3HHL D;  4WU3 A;  3TAM A;  2DXE A;  1R6Y A;  5F8H A;  2XHC A;  2CPX A;  5FDL B;  3NAI A;  2ZBR A;  2Y8Y A;  4UOH A;  3CC2 S;  5B0E A;  3AJD A;  4IQM A;  4N5S A;  4EGL A;  2ADC A;  3CT9 A;  2Z30 B;  3KK3 B;  3H0P A;  1YVF A;  2OIH A;  1QAX A;  2A3J A;  2QGF B;  4O0N A;  3TEH B;  2WVB A;  4U8V A;  3NAH A;  2JLF A;  3IBW A;  3CJK A;  2Z2Z A;  4NRT A;  1CUL B;  3LAK A;  4ID5 B;  3O8W A;  2XMT A;  1NDC A;  3V6J A;  2R2R A;  4K4X A;  1SL1 A;  5I42 B;  4CM0 A;  3TOQ A;  3M7V A;  1ZOT A;  1B4S A;  1JB0 C;  3AT1 B;  1FI4 A;  4ZP8 A;  4CH0 S;  3R5G A;  2DR6 A;  1X8D A;  2K7J A;  4LVN P;  5D4L A;  3KUE A;  3MAA B;  3RAQ A;  5KT3 A;  1YZ7 A;  5DGB A;  1FT8 A;  1TL5 A;  4A8M P;  4CRJ A;  1VC5 A;  3ZZP A;  2PMH A;  1UWB A;  2AP6 A;  1EKR A;  2F5G A;  4A48 A;  2ZJQ Q;  4KFB B;  2LXF A;  2ZHA A;  3G96 A;  4WKR A;  5HMW A;  5BJR A;  5KFX A;  1CLF A;  4C3L A;  1RWU A;  3RB4 A;  2L9N A;  2OPS B;  4TN2 A;  2UUC F;  2QLJ B;  2IM0 A;  4X2B A;  3VZI A;  1SJ4 P;  3CIM A;  3PR4 A;  4P2F A;  2GVD A;  2RKI B;  2R7X A;  2E5G A;  1APS A;  1PBU A;  1NAQ A;  1S6P A;  1LWX A;  4NOH A;  3MFI A;  4PG4 A;  3C46 A;  4IFV A;  2B56 A;  2RJZ A;  4QIF A;  2RQM A;  2DCU B;  2JVO A;  3GG1 A;  1L5U A;  2A1B A;  2LEA A;  1FRJ A;  4FYD A;  4B3S F;  2HGM A;  2X3G A;  2OPR A;  3T6B A;  2MY7 A;  1Q7L B;  1SUQ B;  4LSL A;  4ZVT B;  2J7U A;  1N5T A;  2C2E A;  5CZV A;  5D3G A;  2IRX A;  4YY3 F;  1JLF A;  4QIG A;  3P5T L;  2MPU A;  4C97 A;  5T7L B;  4WKY A;  2V6A A;  1QVG R;  4UY8 5;  5BR8 F;  4MMO A;  3KLE B;  4OMF G;  4PXD A;  1RTI B;  4JV5 J;  1S1V A;  4KV8 B;  3HHD A;  4C9D A;  3UCZ P;  4HT7 A;  1WC6 A;  4V19 X;  3HD2 A;  4X4U A;  4DLE A;  3RW6 A;  1YKW A;  4DG1 A;  1VBY A;  2QZ8 A;  1WDD A;  2VF3 A;  3G82 B;  4F67 A;  1F0X A;  2PFF B;  4JB8 B;  2E1C A;  3IA0 A;  2C28 A;  4WJB A;  4WFB Q;  2JVR A;  3R5B A;  1S1T B;  1B0P A;  4LRA A;  2Z57 B;  4G1I A;  4IH7 A;  1EX8 A;  1FES A;  3C14 A;  3M2V B;  3DLJ A;  1WHX A;  1T3O A;  3I5A A;  4XPC A;  1VDH A;  2XO6 A;  1K0V A;  3KUH A;  3HFZ B;  4CLP A;  1MRO B;  4FYW B;  2V2Z A;  4MKA A;  1F9H A;  1HNW F;  4YME A;  2DGS A;  2O67 A;  1WJ9 A;  4I2Q B;  2WB4 A;  3B4D A;  3VAI A;  2IA6 A;  3OL8 A;  1H2U X;  3SV3 A;  3M8W A;  2H65 B;  2FVS A;  1NSA A;  4FPI A;  1XMO J;  3A3P B;  3R1H A;  1LWF B;  2R7O A;  4LFA J;  2UVW A;  3MMC A;  3B4M A;  1M1K T;  2ZH2 A;  5AE3 A;  3DGV A;  5IS2 A;  3RAM A;  3IS9 A;  1G1X A;  3G9C A;  2MTL A;  4IOC Q;  3GV8 B;  3CCE S;  1FDD A;  2BJ9 A;  2FY8 A;  5J2N A;  1X4C A;  3X3U A;  3V4I A;  4USH A;  5A8W A;  5ETM A;  2EBG A;  5F8N A;  3DRP A;  4QIE A;  3PJX A;  4J9L A;  1JKH B;  1NKB A;  1NDP A;  1VQ4 S;  2W01 A;  4Q45 A;  2NCK L;  5IOL A;  1B7F A;  2DRD A;  3NWR A;  1X60 A;  1IUJ A;  3R3T A;  2FHJ D;  1BQX A;  4OI1 A;  4ES1 A;  1RTD B;  2FGC A;  4C0H A;  4WTY A;  4JI7 F;  1M1H A;  1GTH A;  2FGO A;  2GIQ A;  2K06 A;  2FJV A;  3TAM B;  1M1G A;  2CQH A;  1FNX H;  4QYZ J;  1Q8K A;  2ATC B;  2FZG B;  1HWJ A;  4Q8E A;  1NXI A;  3H8Y A;  1ZM4 A;  2I6W A;  1S9E A;  4WK1 A;  3FEX B;  1WEX A;  1VBK A;  2I1R A;  3M30 A;  4K4W A;  2Y1L B;  2ROP A;  2LXU A;  1I1G A;  2WB1 D;  4IQX A;  1U49 A;  3O6Q A;  3CJK B;  4NLO A;  3G86 A;  2DPI A;  1KOH A;  1B7Y B;  1P9Q C;  4DZ6 A;  4DFK A;  2F40 A;  3EWG A;  4ECS A;  5GAH I;  4KO0 A;  3HSZ A;  2DR8 A;  2FVR A;  3AXM A;  3DLB A;  1YRX A;  4M5N A;  2YNH A;  3OL9 A;  4C0B A;  4C8Z A;  2Q1L A;  1YJW S;  3IN5 A;  1UPM B;  3GYX B;  1YIJ S;  1DLO A;  2HZA A;  1UFL A;  5DZ7 A;  2YKO A;  2H54 B;  2AJ1 A;  5CYQ A;  2P9C A;  1Y3K A;  2W1B A;  2CWK A;  2L9D A;  4DV5 J;  4I4B A;  3A8J A;  4BLG A;  2B4U A;  4YS2 A;  4AQY F;  3D6M B;  1UWB B;  3CCZ A;  1T94 A;  4PXB A;  2F4V J;  2HBZ B;  4NLQ A;  4PCQ A;  4FPR A;  2KT3 A;  1FEH A;  2E7W A;  3SBM A;  3EZU A;  3ENW A;  1GEH A;  3TNV A;  5KFO A;  4KBI A;  4LRB A;  4YB6 A;  1RKJ A;  4DDF A;  2R2T A;  1U09 A;  1QSS A;  5EWE A;  3TUP A;  3Q24 A;  2P8I A;  3V6H A;  4XDC A;  2GVD B;  3EPG A;  2Z2L A;  2KRB A;  3W5Z A;  3QFW A;  1N32 F;  2D7S A;  1S6P B;  2PSZ A;  4A4J A;  1VYA A;  3D3C J;  2IJF A;  3PFE A;  4IFV B;  3IO1 A;  4WK3 A;  3MTK A;  5DDQ C;  4ZCK A;  1WC1 A;  2OPR B;  2W9B A;  3UO0 A;  3GB0 A;  3OQ2 A;  4CCH A;  1HNI B;  1SC6 A;  4LSL B;  1L3V A;  5D3G B;  4NMX A;  1OS5 A;  2BE2 A;  1SKS A;  2QYG A;  1S1W A;  1JLF B;  3R6G B;  2HFS A;  4AXI A;  3NCQ A;  3UVJ A;  3GMG A;  1RAO A;  5HJY A;  4E0D A;  3GV5 B;  1S1V B;  5HMY A;  4EBD A;  1S1U A;  3WC0 A;  5C7P A;  3BR8 A;  4RPF A;  4P71 A;  4DG1 B;  3OV7 A;  4ERD A;  3OLB A;  2VJV A;  2E9R X;  5K8M A;  3W5X A;  5IM0 B;  5B0B A;  1PC5 A;  3OJU A;  1HBU A;  5E3Q A;  4GRS A;  1QDU B;  3CB4 A;  2FJB B;  2NR0 A;  1H38 A;  1X4G A;  2DJW A;  1KWM A;  2JC1 A;  1NSP A;  2KT2 A;  4U7C A;  2ALZ A;  2AV5 A;  2YX1 A;  3C14 B;  4MYU A;  3TZX A;  3CXC R;  2ZH3 A;  2CG4 A;  2KKH A;  1VHF A;  4K4Z A;  4PQU A;  2FLL A;  3BQ0 A;  1K8A T;  1H72 C;  2DKO B;  3EGZ A;  5B0C A;  3GSD A;  8AT1 B;  1YRT A;  3SZ2 A;  4ZVU B;  1LW2 A;  1RAC B;  2G13 A;  2VKR A;  2ZBP A;  3R2D J;  3MEG A;  4MK8 A;  2QL7 B;  3NGU A;  4UT4 A;  3MMC B;  5D4N A;  1KNZ A;  2AQ4 A;  4OYM A;  1TK5 A;  3F73 A;  1S76 D;  1MN7 A;  3LWL A;  3EJM A;  2DH7 A;  4A8Q A;  2VG6 B;  5J2N B;  3EIC A;  1FD2 A;  3V4I B;  5A8W B;  2DNP A;  2EFG A;  4DR1 J;  1S7H A;  3DRP B;  4BCA A;  2X1F A;  4IRK A;  4CI0 B;  2WZ1 A;  1XNR J;  3QT8 A;  5L9N A;  1SH3 A;  4WIQ A;  3I87 A;  3B6B A;  1CJK A;  2BOA A;  2FPH X;  3UFC X;  2JLE A;  4IG0 A;  1HKA A;  4GC7 A;  4RNF A;  1VBZ A;  4Q8F A;  1OMS A;  4OIX A;  2HBY B;  1HNV A;  3MEE A;  1S9E B;  1HL6 A;  5DQH A;  4ELV A;  1HNX J;  4KHM A;  1F2H A;  4H4K C;  5MLC V;  2EVZ A;  3VVU A;  2KB2 A;  1ITP A;  2CQ2 A;  3N28 A;  5LSL A;  3J7Z 5;  2DGQ A;  5DGA A;  1ZM9 A;  2UXB J;  3PFO A;  1PAE X;  2ZOF A;  1PYT A;  2R9L A;  1NJX A;  1C0T A;  2HKE A;  4OX9 J;  2W2M P;  3MR6 A;  2DPJ A;  5IT0 A;  1EB0 A;  4KO0 B;  2IVF B;  5K5M A;  1RBL A;  2VKZ G;  5KFW A;  1NM2 A;  1EJ7 L;  7AT1 B;  4Q7A A;  2YNH B;  3HFK A;  4NA3 A;  3MHY A;  4RUH A;  1NPP A;  1OO0 B;  2EG2 A;  1DLO B;  4F2S A;  3ZC4 A;  2RVJ A;  4JI6 J;  1UVL A;  4LF6 J;  5CYQ B;  4OYZ A;  3RW7 A;  4JI5 F;  3WDO A;  3FEY B;  3PHE A;  3K59 A;  1A9N B;  3W64 A;  2DH9 A;  2PT0 A;  2XLI A;  1IBK F;  3UDE A;  1IBL F;  2AF6 A;  1TL1 A;  4HDG A;  5DM6 Q;  1YBA A;  2BJ7 A;  4P2M A;  2MKC A;  3JTO A;  2V9K A;  1IKW A;  1GAO A;  2BJ8 A;  2EI5 A;  3UN5 A;  2ZM6 J;  1CBK A;  4HEA 9;  1Q8I A;  3MMA A;  2XMA A;  3TJA A;  2DRA A;  5GAG I;  3E51 A;  2B7B B;  1FX4 A;  3H2L A;  2QSW A;  2ZWO A;  4F36 A;  2FZC B;  2WVE A;  4A8F A;  2KN4 A;  1HD1 A;  2LU1 A;  4LJM A;  4ZN1 A;  1L3U A;  5H9F J;  1BC6 A;  3WIV A;  1BD6 A;  2UUW A;  4QIW D;  2JZ5 A;  2E5J A;  3UN3 A;  3TA1 A;  3V4M A;  2V4R A;  3GFH A;  4ED4 A;  3K5P A;  4LRE A;  1EQ0 A;  3GPA A;  2PI5 A;  1TKZ B;  1AFJ A;  3TAP A;  2OJ3 A;  2HQG A;  2MST A;  4B3O A;  4NXN J;  2BE2 B;  4MYT A;  1S1W B;  4P73 A;  2HQF A;  4U67 Q;  3UVJ B;  4URG A;  2BQU A;  3M1V A;  4RWW A;  4F02 A;  1S1U B;  4CLY A;  3J7Z T;  4HDH A;  3M6V A;  1R8H A;  3EZO A;  4U7U D;  3RZA A;  1LWC A;  2DY9 A;  2OUG A;  2PA8 D;  3C15 A;  4AXJ A;  3SQG A;  2C2Z B;  2XEX A;  3ZTR A;  4OZ0 A;  2W7A A;  3UPF A;  1ZH5 A;  1X7V A;  4ZVF A;  1XBW A;  2WRM A;  1LQ9 A;  1HBU B;  3MCM A;  5E3A A;  1TZ0 A;  2HQI A;  5JXS A;  3CJS A;  3PDN A;  2ASJ A;  1VC0 A;  1IKX A;  3KHH A;  1JK9 B;  4YQW A;  4CLU A;  1IWA A;  3Q89 A;  5DLF A;  2CZ4 A;  4C3M A;  5K14 A;  3D5M A;  4EO8 A;  4PQU B;  1IVZ A;  2CUY A;  1OWX A;  5D15 A;  1Z4U A;  2GNK A;  4M94 A;  3P5B P;  1YJV A;  2AYG A;  3H59 A;  2FD2 A;  2KFN A;  3FRY A;  3MM6 A;  2HFN A;  1VQO S;  2KXH A;  2PMW A;  1LW2 B;  1PYS B;  1WC3 A;  2RH3 A;  3V5R A;  4OYX A;  3MEG B;  4NLS A;  4LBH A;  3W1Y C;  4F4W A;  4ED0 A;  1QUP A;  2CG8 A;  4N76 A;  4QWD A;  4J9R A;  1OSD A;  1UVI A;  2VL1 A;  4HLB A;  4K59 A;  3PXG a;  4ZA1 A;  4N47 A;  1Y4Z B;  3MEK A;  3UDC A;  5CCL A;  4JV1 A;  4NLG A;  2LP4 A;  2F8H A;  2HZV A;  3WX8 A;  3QWU A;  4OHV A;  4LF2 A;  1VQ5 S;  4NRU A;  1PC4 A;  4UST A;  1FKP A;  2IVY A;  3BPS P;  1GXT A;  2WBM A;  4NX9 A;  4JV5 F;  2L48 A;  3PX0 A;  1N5V A;  4AD6 A;  2ILY A;  2JH3 A;  4NCA A;  1AXQ A;  1FDA A;  1CJK B;  4ZPD A;  4FP9 A;  1MG7 A;  4IG0 B;  4RLE A;  1SJR A;  3OXF A;  4EI2 A;  4IH5 A;  4L76 A;  4CO0 A;  3D66 A;  3J7A N;  2R8K A;  1N33 J;  4YDD B;  3VGT A;  4RZR A;  1B99 A;  2G0J A;  3PG9 A;  4K2X A;  4QU6 A;  3UNG C;  4M5I A;  1HNV B;  3MEE B;  1U1O A;  5A2Q U;  1X31 C;  1HWK A;  2MQO A;  1FVQ A;  2HVZ A;  2IMW P;  2OSQ A;  1RWW B;  3GWC A;  5FLX Y;  1TFY A;  3I6P A;  3AY0 A;  3BN7 A;  4DCJ B;  3VCD A;  1DAX A;  1GMW D;  1MN9 A;  3BO3 A;  3MPW A;  2MQM A;  3HVR A;  1C0T B;  2VHG A;  1TV6 A;  3RB3 A;  2C2O B;  3CNQ P;  2RQK A;  4Y2A A;  3SCJ E;  4DQI A;  2MB0 B;  3GJT B;  3DNC A;  3ZTQ A;  1XMO F;  4DL6 A;  2OLW A;  4LFA F;  4OHZ A;  3IGV A;  2DCL A;  5I3U A;  3OXG A;  3IRW P;  3AXK A;  5AXM A;  1RHK B;  3JB9 k;  1FE4 A;  2UUB F;  1HFE L;  2MXY A;  1U2R A;  1PSD A;  2BE7 D;  1HBM A;  3Q8Q B;  1RT6 A;  1EIY B;  3HXM A;  4K50 A;  2DT9 A;  3ZO7 A;  1PJ7 A;  2DHG A;  2CJB A;  2FIU A;  4OI6 A;  1TL1 B;  5C25 A;  2XI2 A;  1S0N A;  2Q79 A;  1S0O A;  2XMU A;  1KN6 A;  1RAE B;  1X5S A;  4JOU A;  3H20 A;  3AOB A;  4DFM A;  1YJR A;  1DQA A;  1FTR A;  4KSE B;  3WX4 A;  3EZ5 A;  2PA3 A;  1NME B;  3JSM A;  4M5H A;  1QTM A;  2Q6B A;  1X9S A;  2QA2 A;  1VMB A;  2RML A;  4DZD A;  2J5A A;  4FS1 A;  2PGC A;  5CAA A;  1VQY A;  5CH7 B;  4FKX A;  1A0O B;  4NWB A;  3ELH A;  3OVB A;  4KB7 A;  2ZVS A;  3NXZ A;  4R0E A;  5A8R A;  1Y5L B;  2DIU A;  1FO1 A;  2BUN A;  2P9E A;  1CG2 A;  2CQ3 A;  1NRK A;  5K8P A;  2BAB A;  2OAU A;  5AT1 B;  1M5K C;  2HQC A;  4NXM J;  1JXL A;  1G3O A;  2C3P A;  2V4Q A;  2R7S A;  4PWD A;  4B3O B;  1VQ6 S;  3QZ8 A;  3GE9 A;  3N0V A;  2AX1 A;  2RE1 A;  3C16 A;  3IG1 A;  5IV4 A;  3SFU A;  4O4R A;  1KFD A;  3CGI A;  1DTQ A;  3M1V B;  2I9S A;  3FZ2 A;  4PG8 A;  3FVY A;  1LWC B;  3FMB A;  3C15 B;  3VWS A;  2VPW B;  4NLD A;  3SQG B;  2FTR A;  4O44 A;  3MEC A;  2HK2 A;  2DIV A;  1W7W A;  3OTO J;  3BO2 A;  1YJN S;  4LRC A;  4DV1 J;  4N8O A;  1S99 A;  1IKX B;  3MED B;  1U8S A;  3M8P A;  3VZH A;  3UI3 A;  1YX2 A;  3KG0 A;  3VVT A;  1KRP A;  5K14 B;  5EDW A;  4FKY A;  2ZKT A;  2XMV A;  4ECW A;  1SH2 A;  4NLV A;  4YDX A;  1KEK A;  4OI0 A;  5HI7 A;  3D9B A;  4J91 A;  2CPI A;  4B3T J;  1S6Q A;  2SXL A;  3AQP A;  2R7V A;  3MM6 B;  2GX8 A;  2JEI A;  2RT3 A;  2PDA A;  1TFW A;  3MUV P;  5D6G A;  4ZP7 A;  3DDK A;  3PY8 A;  3S7R A;  4ZOS A;  1R8A A;  3CDE A;  4R8U A;  2CFX A;  3LP0 A;  3DMJ A;  4HH1 A;  2CJY B;  1F60 B;  2MLY A;  4OYB A;  3J7A 1;  3NGT A;  4RR5 A;  4FYX B;  3NMR A;  4G1Q A;  3EPI A;  4J9O A;  4OI4 A;  1I94 J;  3C66 A;  3F41 A;  2BDP A;  5GAE I;  2E5H A;  3HT0 A;  1FKP B;  3IGN A;  4CO1 A;  4NLX A;  5GAD U;  3IR5 B;  4DR5 J;  1WEL A;  3DXS X;  2QLW A;  2D3Z A;  1FKO A;  4DPX A;  3W2V A;  1Y10 A;  4EZ9 A;  3HVT A;  4ES2 A;  4ANC A;  4B9N A;  3P45 B;  2EFN A;  2CJ9 A;  1JQG A;  2ABY A;  4PYA A;  1WSR A;  3KDO A;  2DIT A;  3S6E A;  1XK8 A;  3JQM A;  2E5I A;  5B0D A;  2ACY A;  3AFG A;  3D0G E;  3KMQ A;  4HHJ A;  5EWG A;  4C48 A;  2HFZ A;  4J9U E;  1TV6 B;  2HVD A;  2W2N P;  3ETM A;  2R4F A;  2LA6 A;  4QOT A;  5HVF A;  4CO3 A;  4JI0 J;  3IBC B;  4DUT A;  1VFJ A;  2XO7 A;  5KT6 A;  1RT4 A;  2HGL A;  3Q2S C;  4DUZ J;  5I3U B;  2XSF A;  3IAM 9;  3U1N A;  2IRU A;  2P6T A;  2LCW A;  2NXE A;  4JI8 J;  1JLE A;  2HVH A;  2KZZ A;  2HLT A;  2DNN A;  2YPZ A;  3I56 S;  1HBM B;  4PWU A;  1WD6 A;  1RT6 B;  3CDB A;  5KFZ A;  5FLX U;  1BLU A;  3P6Y C;  3Q22 A;  3MF5 A;  1S59 A;  4DR1 F;  2X1A A;  2QEX S;  3K58 A;  1CSJ A;  1E6Y A;  1UCN A;  1CQN A;  3MD3 A;  3SXL A;  3PR5 B;  4K5R A;  5C25 B;  1XNR F;  1U6B A;  2C3Y A;  3BO4 A;  1CQM A;  1Q53 A;  1DAR A;  3FDS A;  3K5M A;  3GSI A;  4NI2 A;  3OUY A;  4R0J A;  1NK5 A;  4Q5V A;  3BRE A;  2B51 A;  3RU0 A;  3JSM B;  3QBC A;  3CJ5 A;  4B9L A;  2AYE A;  3I82 A;  3ZNU A;  4DV0 J;  3OHA A;  4X66 J;  1S5Z A;  2YKQ A;  3K8W A;  2RF2 A;  2A6M A;  3RRG A;  3QFH A;  4ED1 A;  2XWY A;  1WEZ A;  5LOQ A;  1HNX F;  1GFW B;  2BJE A;  3K5O A;  3IWX A;  1RA6 A;  2UXB F;  4HTI A;  3MGJ A;  2QLB B;  2YX4 A;  2R8J A;  4OX9 F;  1VI7 A;  4ZLJ A;  1FKA F;  2D3O 1;  1JWW A;  4TU7 A;  2J9D A;  4IO1 A;  4I7F A;  3FKB A;  3HP6 A;  4P72 A;  4ATN A;  1FX2 A;  2OGU A;  3MM9 A;  2QMU B;  2M3D A;  3D6F B;  1EZZ B;  3FCH A;  1KDN A;  3C16 B;  4F50 A;  2OD4 A;  1DTQ B;  4JI6 F;  5DG8 A;  1RHJ B;  2FVC A;  4LF6 F;  2V4J A;  3QZ7 A;  1PAU B;  1SJ1 A;  4D3G A;  3JSY A;  1H0H B;  1Q5V A;  4O44 B;  3MEC B;  2BKP A;  3QGI A;  3KKF A;  3BYR A;  2M5Y A;  3LAM A;  2CPE A;  2CVI A;  3JXO A;  3M8P B;  5FJ4 A;  2K1R A;  5LSR A;  3VGS A;  1JLQ B;  2M9K A;  3SMZ A;  2JC0 A;  3V81 A;  2ZM6 F;  4OYO A;  4DL3 A;  4ZP9 A;  3DLE A;  2EXU A;  2VOP A;  4ZIT A;  2AW0 A;  1GNK A;  4RX6 A;  5LM7 E;  4Y2K A;  3CCJ S;  4GO5 X;  1LWE A;  1Z1Z A;  1MWQ A;  1RHR B;  3AQO A;  1S6Q B;  2ERR A;  2OSR A;  1DFD A;  2NSC A;  4DFJ A;  3BGO P;  1R8P A;  2DTJ A;  3OVA A;  1RT3 A;  1S7I A;  3ZZZ A;  1HQE A;  1SIW B;  2QMW A;  4R8U B;  4Y0F A;  1N56 A;  2D9O A;  3PW0 A;  2YWW A;  4DL7 A;  3MPD A;  3LP0 B;  3DMJ B;  2WON A;  4G65 A;  4N7T A;  2R8G A;  2YNI A;  4G1Q B;  4NXN F;  4CH1 A;  1S77 D;  2MGZ A;  3EYZ A;  3Q2T C;  3OFH A;  3H4D A;  1ROF A;  1SQF A;  3OTB A;  3SSS A;  2QLF B;  3GR0 A;  3NP5 A;  4ELT A;  5T14 A;  1OQ3 A;  1FNM A;  3H2U B;  5CYJ A;  1ZA2 B;  2P2C B;  1H73 A;  1LEO A;  1V5V A;  4RNN A;  4WFA Q;  3M2R B;  2BAC A;  4U8Y A;  3RJM B;  4Y28 C;  1FKO B;  1UZH A;  2YKM A;  4RUB A;  1JJ4 A;  4OX7 A;  1J2V A;  3OL7 A;  3W2V B;  3CTR A;  3UR3 C;  4A8W A;  4I64 A;  1H7W A;  3HO1 A;  4C2M A;  4DPY A;  1MML A;  3AA9 A;  2M88 A;  3FEZ A;  1YWX A;  4F4Z A;  1QAI A;  1SXL A;  4NCG A;  4B08 A;  2XM3 A;  1SL0 A;  1MLA A;  4EEY A;  2IYG A;  3RYL A;  1D8Z A;  4BHQ A;  3PRV A;  1JLA B;  1LK5 A;  3CCL S;  2OP5 A;  5KG6 A;  4MIB A;  3T1H J;  1REV B;  2E1R A;  2J6T A;  3HHN B;  1CJV B;  1DRZ A;  3UW1 A;  3KLG A;  3PIO Q;  2HHX A;  2VBX A;  1TMJ A;  2H4Y B;  3BBB A;  2V2K A;  5KTQ A;  3A1Y G;  1RT4 B;  4AL6 A;  4FXD A;  3VGV A;  2ZZT A;  1JLE B;  4I56 A;  2KG1 A;  1D9A A;  3PW4 A;  1B3T A;  3SI8 A;  2CQC A;  3S01 A;  1ZS6 A;  1VRQ C;  3D68 A;  3SEO A;  1AFI A;  4X4S A;  1RK8 A;  3AAW B;  1E6Y B;  2GAH C;  3AB2 B;  3B82 A;  3H2V E;  3CVK A;  3KNG A;  1VK8 A;  2RU3 A;  4ZVP B;  5AE1 A;  5CD4 H;  2GJ2 A;  1YG0 A;  2CNO B;  3THV A;  2C3M A;  3K57 A;  3NCP A;  5DDP C;  4NI2 B;  3OUY B;  1MMN A;  2PII A;  4S0M A;  2IIH A;  1TAU A;  2KH9 A;  1KSP A;  1U2C A;  3DLL Q;  4N56 A;  1R0A A;  3KJV B;  3T3F A;  2QC3 A;  2DRB A;  4JV2 A;  1HW8 A;  1NHK L;  2GC8 A;  1WI8 A;  2RF2 B;  3NKY A;  1EKS A;  1WTF A;  4V1A k;  3PYF A;  4JYA J;  5HSP A;  1U48 A;  1N48 A;  2GQ2 A;  2DB1 A;  2GJF A;  2KG0 A;  2VG7 A;  2KXF A;  1URN A;  1TEL A;  1SPB P;  2HZC A;  2CXE A;  1ZAX A;  4K7Q A;  2FC9 A;  2K7K A;  3CCV S;  1RAG B;  2OKQ A;  3CME S;  1PO6 A;  3H4B A;  4I7F B;  2GVZ A;  2X7I A;  2XLJ A;  1BXN A;  3T1Y J;  5HAO A;  1NHV A;  3MM9 B;  2CQG A;  4KPC A;  4IUF A;  4OHY A;  4RUC A;  2W24 A;  1LK7 A;  2CIM A;  1RP5 A;  4A8K A;  1A7G E;  3B8H A;  3JSB A;  1UMJ A;  4J9P A;  4FBT A;  2YWG A;  4FF1 A;  1K1Q A;  2EK6 A;  1P27 B;  3RGI A;  3CD7 A;  1UVM A;  1VBX A;  3VAL A;  1BY9 A;  3A8E A;  2K1R B;  3MFH A;  3ZZ0 A;  1J5O A;  2AJ4 A;  1NBE B;  3V81 B;  1U47 A;  2DGO A;  3DLE B;  3CUL A;  4ED7 A;  4DV7 J;  2NZ4 A;  3LAN A;  3N5F A;  2G2Y A;  1SKU B;  2WSE C;  3KHR A;  3R5C A;  1LWE B;  5B09 A;  2V9W A;  3BPD A;  2CPF A;  3HSD A;  2DD8 S;  2GQQ A;  5F8G A;  4F26 A;  1AYE A;  1Q4R A;  1XN9 A;  2YNG A;  1WG1 A;  5GMK a;  4LF4 J;  1OYE A;  1RT3 B;  1EP4 B;  1ZBT A;  3ENQ A;  5IC4 B;  2K3I A;  2B9W A;  4PXE A;  2E5L J;  3DI6 A;  4QBU A;  4OYW A;  2M2B A;  1UJ4 A;  1RSC A;  2N4C A;  4DX5 A;  2F9D A;  2WON B;  3ISN D;  2B43 A;  4NXM F;  2UV8 G;  3D1O A;  5LXY A;  5KFS A;  2DHH A;  5HO4 A;  3G87 A;  3Q86 A;  4M5G A;  4YUD A;  2MGZ B;  5JUM A;  4WF9 Q;  3PYG A;  2DXF A;  1PG5 B;  2AZ3 A;  5F8M A;  5F8I A;  3VHQ A;  1Q8B A;  5K8O A;  1N34 J;  3J81 j;  4OZ2 A;  1J5E F;  2YKM B;  1QJH A;  2IM2 A;  3E3X A;  3OTO F;  3Q0A A;  4TQR A;  3AOD A;  4MKV A;  2UUA J;  4DV1 F;  4A8S A;  4TY9 A;  2COL A;  1N0V C;  4TLR A;  1NDL A;  5E7O B;  2A2D A;  4UUX A;  1NH8 A;  3LGN A;  3KLF A;  1X0F A;  4NCG B;  4USW A;  1ZET A;  3D1Q A;  1UTA A;  4TYB A;  3E8O A;  1X5P A;  4FF3 A;  3SCL E;  4YB7 A;  3D3B J;  5I3Q A;  1VRU A;  2DH8 A;  2JHE A;  2Q66 A;  2FJW A;  4Z7C A;  4RNM A;  1WKK A;  3EVM A;  1RI7 A;  4B3T F;  3BEG B;  5U47 A;  1YJU A;  1RWK B;  3GJQ B;  2R7T A;  3KLG B;  4URS A;  2C2D A;  2ZE2 A;  4GC6 A;  4ECZ A;  1V6H A;  2IVM A;  3GJS B;  2DYA A;  3A12 A;  4DN0 A;  2KM8 C;  1QAY A;  1RA7 A;  4F8R A;  1IJE B;  3GFZ A;  1RT5 A;  2H5E A;  2NQP A;  3CJQ A;  2G0C A;  3QRR A;  3ONQ A;  1P1T A;  2DR7 A;  4MT1 A;  1IM4 A;  3SYZ A;  1IWG A;  4CNY A;  2PO4 A;  3CCQ S;  1I94 F;  1EHW A;  1U0S A;  2DNH A;  3DRS B;  1BQN A;  4LT6 A;  2W4D A;  3M6X A;  4ZVE A;  2M8D B;  1KP6 A;  3MAA A;  1OPI A;  3W8G A;  4XDD A;  8ATC B;  2J9C A;  4OLP A;  3GCX P;  2WVC A;  2KFZ A;  2MLZ A;  4LBP A;  4KE5 A;  1S79 A;  3WIU A;  1R0A B;  4KGK A;  2HHW A;  4ILR A;  4DQP A;  2CQB A;  3QRP A;  3Q8R B;  5KFI A;  2ZJR Q;  4GO7 X;  1TU0 B;  2F4F A;  2DBB A;  4ID8 A;  2VG7 B;  1IBM J;  1HR0 J;  4C8O A;  2UP1 A;  1N0U A;  4DX8 H;  3NRB A;  2BAN A;  2LKZ A;  1UPP A;  3WHI A;  2DK2 A;  4ZVG A;  3GU0 A;  4MAK A;  4Q2M A;  1NK8 A;  4GKJ J;  2DO0 A;  4ZLL A;  2CJA A;  2GVZ B;  4JI0 F;  4ECV A;  4X4N A;  1FWK A;  1U1P A;  4DR7 F;  4DUZ F;  4LR7 A;  1EQM A;  4TNO A;  4JI8 F;  3OFG A;  2V8D A;  3LTO A;  1HI8 A;  4WCE Q;  4K8R A;  3UD5 A;  2HIQ A;  2CNK B;  2ZZN A;  1PCA A;  4X64 J;  4GKK F;  1G4C A;  2DNQ A;  2XMM A;  2B9E A;  2LQ8 A;  2HS0 A;  1U1R A;  2HND A;  4JI4 F;  4KGX B;  4HTJ A;  2RHQ B;  1UWA A;  2RIL A;  4EBE A;  3DLG A;  4LF8 J;  1EET A;  2HGN A;  3B78 A;  3OR2 A;  5F9L A;  4ZJL A;  1FRL A;  1L3S A;  2VDI A;  4DUY J;  1FTC A;  1J5O B;  4JBC A;  4IR1 A;  4A8Y A;  1Q5Y A;  3ILI A;  2G2O A;  1RZM A;  3HPO A;  3C6U B;  1Z2Z A;  5HJX A;  2DGT A;  4DV0 F;  5KG3 A;  4X66 F;  2ZH4 A;  3QAT A;  1UVN A;  4TY8 A;  2XGP A;  3QAE A;  1SI9 A;  2P9G A;  2N82 B;  5E0O A;  1XEZ A;  2YNG B;  2HHH J;  5HP1 A;  3CO9 A;  1RTJ B;  1T9U A;  3KLV A;  4QJV A;  4HT5 A;  4AND A;  1WDT A;  1RLC L;  3G6X A;  2ZH5 A;  3DI6 B;  2BZ2 A;  2VV5 A;  4WP8 A;  1K9M T;  3NNC A;  2RUS A;  2HNY A;  2A2C A;  1I51 B;  1LW0 A;  1XMQ J;  1G6B A;  2J0X A;  1SH0 A;  3M8R A;  1U2F A;  2V94 A;  4G1P A;  4M63 A;  2HNZ A;  4JI3 J;  5LMN J;  3CC4 S;  4EFA C;  2J8A A;  2RDJ A;  2H5J B;  2Y0S D;  1TKD A;  3BBF A;  1R6V A;  3H42 A;  2VON A;  3DRX A;  3K7R A;  4WII A;  2ZFH A;  3IP0 A;  1FWP A;  3MM5 A;  3TAQ A;  1X4D A;  4RBV A;  3Q8Y A;  4WZM A;  2KXN B;  5LJ3 Y;  4KH0 B;  4I2P A;  4YFU A;  4LIW A;  3DYA A;  3PO4 A;  2YWF A;  2LLZ A;  5EWF A;  3IXQ A;  5A0Y A;  3KLF B;  2ZH6 A;  4KHP F;  4OYI A;  4HI1 A;  4RW6 B;  1VQ9 S;  3CMA S;  3KG4 A;  3TEG A;  2LEP A;  2YY3 A;  4ECR A;  1LV5 A;  1VRU B;  2M4M A;  3EVO A;  2BV3 A;  1YDL A;  4L73 A;  3PV8 A;  3R5J B;  2ZIT A;  2YKA A;  1CJT A;  4RW9 A;  2ZE2 B;  2C1E B;  3HVA A;  1CVJ A;  2Q3P A;  1KHV A;  3AD8 C;  3H5Y A;  1RT5 B;  4ED2 A;  2OEL A;  1M0S A;  5HQ8 A;  1OIA A;  1RAJ A;  4KHR A;  2CKW A;  3JAM U;  2XS7 A;  5C5J A;  4ER8 A;  4IOA Q;  2MKY A;  3SFG A;  4DL4 A;  3JQK A;  3R7N B;  4JV0 A;  1BQN B;  4RW7 A;  1SKW A;  1OSC A;  3OW2 R;  3IM9 A;  2I2Y A;  2KYX A;  2KM8 B;  5T41 A;  2BE9 B;  1M90 T;  2LFV A;  2UZA A;  1U4B A;  5KFV A;  3HDS A;  3M9M B;  3ULH A;  3TX0 A;  1QY7 A;  2E66 A;  5KG4 A;  1W25 A;  1QM9 A;  1RAF B;  1KQF B;  2YPY A;  4IOB A;  4MTP A;  2B4V A;  4P7T A;  3WZ0 A;  5HMX A;  4QWE A;  3MPU B;  1OY8 A;  3R2C J;  1PJ5 A;  3JS9 A;  1WG5 A;  4F0M A;  2BAN B;  3NGS A;  5ETR A;  1MWY A;  3T1H F;  1S49 A;  4LVO P;  2EBE A;  2J0W A;  4DR4 J;  5L9X A;  4B9M A;  2QO3 A;  3MOJ B;  2XBP A;  2V8P A;  4NPO A;  3PEJ A;  3LW5 C;  2XWX A;  5AXL A;  3EGV A;  4TU8 A;  1QE1 B;  2BJ3 A;  4LRD A;  2BQR A;  2B5J A;  3F0N A;  1NPR A;  3D7S B;  4HKQ A;  1GMV A;  2CWX A;  3MR2 A;  1HNI A;  5F8L A;  1V3S A;  4KGZ B;  3QJP A;  2QA4 G;  1RKI A;  1KFS A;  4OI2 A;  1FF2 A;  3FQL A;  3PRD A;  4LF7 J;  3AB4 B;  2FHO B;  1YTY A;  3DRY A;  2EFV A;  1VIO A;  2LEC A;  2HND B;  3I0S A;  3V2U C;  2OPQ A;  5AE2 A;  4DEZ A;  2CJK A;  4Y2I A;  2B7C B;  2O3D A;  2YX7 A;  2LMI A;  3DLG B;  1EET B;  3TVK A;  3OR2 B;  2LA4 A;  5D4O A;  2VJU A;  4QW8 A;  1TL7 A;  1TR0 A;  3UD4 P;  5IM0 A;  4EU0 A;  1IKY A;  4ECX A;  4CP5 A;  2C2N A;  1NND A;  3MUM P;  2JNJ A;  2XZT B;  1H74 A;  5DO2 A;  4USU A;  4RW4 A;  2HSE B;  2PMZ D;  3PKY A;  1TKT A;  2YNF B;  3T6J A;  4QR1 A;  2I8E A;  4DBQ A;  3M6U A;  5H9E K;  5F9N A;  4YHH J;  1CC7 A;  3GIK A;  4TY8 B;  4AFF A;  2R2U A;  1IKV A;  3IAS 9;  1Q82 T;  1VQ8 S;  3NGK A;  5JVH Q;  2GQC A;  2WBR A;  5HP1 B;  2RRB A;  4NLP A;  4ZHR A;  1FK9 A;  1IR0 A;  3MD1 A;  3AH6 A;  4WFN Q;  1TL3 A;  3SSQ A;  4XAK A;  4IFY B;  4LR9 A;  5C2C A;  4DR3 F;  2A10 A;  3HF5 A;  3TAN A;  1FEE A;  4R5P A;  3GZ7 A;  2HNY B;  3T1Y F;  1WC5 A;  5M2P A;  1LW0 B;  3R7S B;  3H5X A;  2XCA A;  1KQS R;  2NYI A;  1NK9 A;  3QSI A;  4UUW A;  2GHW A;  2W25 A;  2E1M C;  4NZ6 A;  3MPV A;  2ASY A;  4I68 A;  2VG6 A;  1F3F A;  5KG0 A;  2FQQ B;  4F7V A;  2VB6 A;  3LP1 A;  1XWL A;  2HNZ B;  1RAH B;  3DU5 A;  2ADB A;  5IT9 U;  4C8Y A;  5EN1 A;  3MM5 B;  4D3H A;  1HWL A;  2FHM A;  3ILJ A;  4DF4 A;  7FDR A;  1V3R A;  4I2P B;  4IRC A;  3QAU A;  3DYA B;  4DU7 A;  3C8Y A;  2FJA B;  2DNK A;  3MUT P;  3T5K A;  1Q95 G;  5A0Y B;  5DG7 A;  3E2E A;  2AYM A;  2IAJ A;  3GV7 B;  2JEJ A;  2DGX A;  3N6L A;  3PX6 A;  1JLG A;  4CM2 A;  1RYS A;  3GYN A;  1NHU A;  2KHD A;  3OJS A;  5L1K A;  5DM7 Q;  3BKT A;  5FD1 A;  1ULR A;  3RB6 A;  1IN0 A;  2GMH A;  4K4S A;  1QD1 A;  3KG1 A;  2X3D A;  1BE4 A;  4DF8 A;  4W92 B;  3ZTS A;  3CDW A;  2FJX A;  2DR5 A;  2HVI A;  4UY8 T;  4ECT A;  1T11 A;  4EWT A;  1REG X;  4ECQ A;  1CJT B;  4RW9 B;  2VH7 A;  4RUA A;  1U25 A;  2HHT A;  1RYR A;  4B9T A;  1S9G A;  2ACM A;  3V6D A;  2FVQ A;  5KG7 A;  4NLR A;  2Y9H A;  2DNZ A;  2W2P P;  2C2M B;  2CQP A;  3W60 A;  2E5L F;  3C19 A;  3PRB A;  3CED A;  4OX6 A;  1FXL A;  5C24 A;  3M6W A;  3R1L A;  3R7B B;  3JYT A;  4M5D B;  1URR A;  2LQ9 A;  3QIP A;  4F0H A;  2VQF J;  2MQQ A;  3MCS A;  4RW7 B;  4FF4 A;  5M2U A;  3QLH A;  3SCI E;  4NA2 A;  3H40 A;  3MM8 A;  3FRZ A;  4C8M A;  2J6S A;  3DU6 A;  4DL2 A;  2IC3 A;  1AW0 A;  1WC4 A;  1TUG B;  3ILO A;  3NGD A;  1HNZ J;  3HZG A;  2QG9 B;  4BBY A;  2ZH9 A;  2GMJ A;  2QL9 B;  2UUA F;  4X4Q A;  5IFM A;  3CE8 A;  3HKW A;  5B0A A;  4EO6 A;  1DBD A;  1KVK A;  1HQ2 A;  1WSV A;  2C2K B;  3VAH A;  2AEJ A;  3P4U B;  1Q81 T;  5ETT A;  1Y0H A;  4NLW A;  1NK7 A;  1UFK A;  1KTQ A;  2HQ3 A;  3KFW X;  3FNN A;  4YB1 P;  2E44 A;  3H98 A;  5J2M A;  5HVG A;  2ROE A;  4ITS A;  1RIS A;  5CXT A;  1VQM S;  4ZCM A;  5ADZ A;  1TKX A;  2F3J A;  1N4L A;  1RGV A;  4NEY A;  2GS8 A;  1T03 A;  1RWM B;  3GLJ A;  3IWN C;  4NML A;  4USI A;  2EC2 A;  3OSP A;  2U2F A;  3TP2 A;  4JP8 A;  3UR0 A;  3OHB A;  2B5J B;  3H90 A;  1OJ4 A;  3A3N B;  2JX2 A;  2CQ4 A;  2YH0 A;  3FCW A;  2XHW A;  4CDI A;  4J9K A;  5LSO A;  2VBY A;  3EXC X;  1TKZ A;  4P74 A;  4QU7 A;  2ZH1 A;  3I9Z A;  3CCM S;  4DS4 A;  2YKP A;  4J7C A;  2MZ1 A;  1U1K A;  5D8H B;  4ED5 A;  3I0S B;  4P2S A;  1KVI A;  1CEZ A;  4DWI A;  2OPQ B;  3DOK A;  1JXE A;  1KR4 A;  2DY1 A;  1TL7 B;  1N52 B;  1FJ7 A;  3GTY X;  1IKY B;  2FC8 A;  2GZO A;  3BZQ A;  2FDN A;  1RT1 A;  4LQ3 A;  4NZ0 A;  1R31 A;  4RW4 B;  4ZVQ B;  1DHM A;  4AT1 B;  1TKT B;  3O3L A;  4LFB J;  2ZHO A;  4I69 A;  4E8U A;  4PPZ A;  3KYL A;  1ZTT A;  1IKV B;  2E1P A;  3NS6 A;  4LSN A;  1RAD B;  2OML A;  2ROG A;  2OO4 A;  1IBM F;  1HR0 F;  4ETZ A;  4XPE A;  4L3N A;  4ZHR B;  1FK9 B;  4DLG A;  2W9C B;  1TL3 B;  4CTA A;  4ZVR B;  4DQR A;  1RBA A;  4GKJ F;  3DDI A;  5KT7 A;  4R5P B;  3L9Z A;  4X4V A;  2DO4 A;  3T41 A;  5J1N A;  4PWW A;  2BEF A;  4CO2 A;  4L74 A;  4PAA A;  4ZP6 A;  2VUG A;  2QE5 A;  1TTH B;  3GIL A;  1FRK A;  1Q86 T;  1NJI T;  4AUK A;  1U0H A;  4DR2 J;  3D28 A;  5KFB A;  3FMW A;  3LP1 B;  2CQD A;  3GIM A;  4XIU A;  1M5H A;  1UP1 A;  4WWS A;  3HFV A;  3CC7 S;  1R0C B;  3LAL A;  2HFV A;  5J1E A;  3OBI A;  1N5Y A;  3PAC A;  1H2T Z;  4FN5 A;  2M52 A;  2PC6 A;  4OZ5 A;  1JJC B;  2V5H G;  3NGR A;  4HVZ A;  5CD4 A;  3L3C A;  4LF8 F;  1JLB A;  2ZBC A;  4WYL A;  4EUV A;  1F9F A;  4DUY F;  2UU9 J;  3R5D A;  2IAJ B;  3MCO A;  5F3Z A;  3OD2 A;  1DQ8 A;  2RAQ A;  1JLG B;  2O1P A;  4N8N A;  4ZVS B;  1SCJ B;  1N6Q A;  1HHT P;  1JMT A;  3D4J A;  2DNO A;  3U02 A;  4QCL A;  1LXJ A;  4UOF A;  2ZBQ A;  4RW8 A;  2VC0 A;  3SSR A;  4L6V 3;  2N7Y A;  2FYX A;  2JOQ A;  3HM9 A;  4IDK A;  4USV A;  4KGM A;  4ICL A;  4PAB A;  2N7C A;  4CT9 A;  2VFR A;  1B0V A;  2HHH F;  4W4M A;  1S9G B;  1T0T V;  4ANE A;  2XNQ A;  2V67 A;  3V6D B;  1O51 A;  2R7W A;  2Y1I A;  1WTB A;  4KAI A;  4I1T A;  4ETX A;  4YP3 A;  1N36 J;  3VQT A;  3NG8 A;  1X9W A;  1GQE A;  3H25 A;  2QA1 A;  9ATC B;  4BWM A;  5C24 B;  1LFW A;  1C0U A;  5A6P A;  3JYT B;  2IRY A;  2FUG 9;  1SC3 B;  3D67 A;  3QIP B;  4KJI A;  4C0O C;  2GV1 A;  1XMQ F;  4QPX A;  4OV1 A;  4IO9 Q;  4QWA A;  2DGV A;  1AZS A;  1F3V A;  5HVH A;  4DSL A;  2OTJ S;  2J0S D;  3QLH B;  3TVZ A;  3MM8 B;  1BQM B;  2JRS A;  4UOC A;  4IH6 A;  1P6T A;  2IC3 B;  3MR3 A;  4JI3 F;  5LMN F;  2W2O P;  5F0W A;  4B3R J;  3AOA A;  1IBC B;  1R8C A;  3NNA A;  4PUO A;  3MXH P;  3HJF A;  2ZVI A;  3OPK A;  3HKZ D;  5DJB A;  2BKN A;  2MJN A;  4FZV A;  3W7B A;  2HIY A;  4USJ C;  2DNL A;  2V68 A;  2ZD1 A;  3HK2 A;  4U6P A;  1Q0N A;  2EC0 A;  2VOD A;  1ZM2 A;  1HWU A;  3QQC D;  2HHU A;  4O3O A;  2AEF A;  3TO8 A;  1N54 B;  3NBP A;  2J9D E;  1CS4 A;  2F8E X;  4MKY A;  1XTZ A;  3PYD A;  5KFL A;  2ZZM A;  1EAR A;  5GMD A;  5J2M B;  2Q6C A;  4ZPV R;  1FWL A;  2KVQ E;  4A8X A;  1JXV A;  4KC5 A;  4O3N A;  2G1H A;  2ZC4 A;  3KOA A;  5IT4 A;  1OY6 A;  1VR6 A;  2HS4 A;  3M9N B;  1TKX B;  4JI2 J;  1S72 S;  6FD1 A;  1T03 B;  3UDV A;  3Q83 A;  2CPH A;  2KYZ A;  2MHN A;  3BH6 B;  3CD0 A;  2JJ4 D;  1P1L A;  3W63 A;  1U45 A;  2F63 A;  2ASL A;  4FYV B;  2NSB A;  4P9S A;  3W8P A;  4HHH A;  1C4A A;  1VQS A;  4YEA A;  4CO5 A;  3QGH A;  2DHA A;  3RBE A;  3CCS S;  5KFY A;  2XUL A;  4DSK A;  1TQL A;  5D0G A;  3DOK B;  1T9T A;  2EFO A;  4LRF A;  3Q23 A;  4E98 A;  1KQG B;  5F41 A;  4V19 J;  1YK9 A;  1HMV B;  3N9U C;  3I55 S;  1RT1 B;  1UW9 A;  2HPU A;  3MAQ A;  3MED A;  3WBZ A;  3OTD A;  3P8B B;  3BQ1 A;  1IBL J;  2W7O A;  3CD6 S;  1KQK A;  2O5D A;  1J27 A;  2HHQ A;  4LSN B;  1T8E A;  2GHP A;  3PIP Q;  2CZV C;  2ASD A;  5E3P A;  1TP7 A;  4WPA A;  1R43 A;  5HQM A;  4DR4 F;  2IHR 1;  2ZWP A;  3CO0 P;  5D0E A;  4CTA B;  2Y8W A;  4MIW A;  4K0K J;  3A8K A;  2H1Y A;  1C1C A;  1HI1 A;  2MKH A;  2A6O A;  4H4O A;  2YWE A;  2UXC J;  2PN6 A;  3VAM A;  5E33 A;  2KL8 A;  4P2X A;  4A46 A;  4O3S A;  5L1J A;  2XSJ A;  1X4F A;  5GME A;  4U95 A;  4GMK A;  1FDB A;  2E9Z A;  1ARO P;  1GT8 A;  1U0H B;  4F4A A;  2DHX A;  2MY8 A;  4MH8 A;  5IQ6 A;  4LF7 F;  1YSJ A;  5IWA J;  4DL5 A;  5HBM A;  4FDF A;  3KNA A;  3OTE A;  4C8K A;  5J1E B;  2ZDO A;  1N5Y B;  2ZUA A;  1VQN S;  2IJN A;  2BM1 A;  2VFS A;  2CNL B;  3HJV A;  1VJQ A;  4NYO A;  3TZW A;  1JLB B;  1WHV A;  2JLG A;  3Q8P B;  3SDE A;  1MSW D;  2C2R A;  4ZJQ A;  1VQK S;  2MQN A;  2AZ1 A;  3TI0 A;  1FXR A;  4HYK A;  5J2P A;  1N6Q B;  1E6V A;  2PI4 A;  1GXU A;  1RWX B;  1Y00 A;  3BBC A;  4WXW A;  4RW8 B;  1NB2 A;  1NSK L;  3PTW A;  1DUR A;  1D9F A;  3LUY A;  3I31 A;  4YHH F;  7FD1 A;  2CAJ A;  4IDK B;  4ICL B;  3BGU A;  3HSJ A;  3HHL C;  2LDY A;  1QUV A;  2H5I B;  3L7U A;  4Y3C A;  2UUT A;  4KT0 C;  2D1C A;  2RIJ A;  2GHV C;  4ECY A;  2MZS A;  2R3V A;  4U9R A;  1OPZ A;  3I0R A;  2NXN A;  5HLF A;  1XIQ A;  1C0U B;  4QYZ K;  4HL9 A;  3IM8 A;  1S4E A;  3I9V 9;  2NS1 B;  4P52 A;  4OYP A;  2EPI A;  3OT9 A;  1NUE A;  1U6Z A;  2MMY A;  1AZS B;  3HHL A;  1V9O A;  2HMI A;  1IJF B;  5THW A;  4RU9 A;  3L4B C;  2IM3 A;  4M5L A;  5HK4 A;  5KOW A;  2GCF A;  3SQO P;  1D0E A;  2MQ8 A;  4CZC A;  1UZD A;  1YJT A;  4PUO B;  4I0W A;  2GO8 A;  3KLH A;  5ITH A;  2DIS A;  2RQ4 A;  2MQP A;  4MKB A;  1PIE A;  1MU2 A;  1T02 A;  2PE8 A;  2IDL A;  1FJE B;  2ZD1 B;  3BN4 A;  1Q78 A;  3BQ2 A;  1RLD A;  3BB5 A;  3D1H A;  3T19 A;  5D78 A;  4FVM A;  2O66 A;  3NBP B;  1CS4 B;  4IKA A;  1T9V A;  3UCU P;  3FSY A;  1FRH A;  4L3K A;  2DNY A;  3K5L A;  3ZXW A;  1RBO B;  2RSQ A;  2RS8 A;  1XJW B;  4MIA A;  5AXK A;  1FA0 A;  3CUN A;  5CZX A;  3PCO B;  3EX7 B;  2AX0 A;  2ILZ A;  3EMT A;  2WHO A;  3T9Z A;  2W7P A;  5D0H A;  5GAH U;  1GTE A;  3HSG A;  1YQH A;  2XS2 A;  3SV4 A;  2NXU A;  2HHP A;  1WOS A;  2QYC A;  3QO9 A;  1XR7 A;  4PG7 A;  3T9N A;  5ETL A;  3BSO A;  3W65 A;  2FY1 A;  2VQF F;  1QVF R;  2VPZ B;  2BR0 A;  1HAR A;  2AJF E;  3THP A;  3G4S S;  3RB0 A;  1VJW A;  3CCU S;  1K73 T;  2VQE J;  4DV5 F;  2FLP A;  2OTL S;  4F2R A;  3JTN A;  1GX5 A;  2UUB J;  2V8G A;  3QGP A;  1F6T A;  2IM1 A;  4Z7Y A;  4G6V B;  1NEE A;  5KFA A;  3SCK E;  3GCW P;  3CDU A;  2F1F A;  1HNZ F;  3KJN B;  2F4V F;  1H3D A;  5KFJ A;  4WBF A;  3R8Y A;  3EGW B;  2IDE A;  2H4W B;  1JLQ A;  3ENV A;  4LF1 A;  3NL0 A;  2QLX A;  3NS5 A;  2C22 A;  2G1D A;  3KTQ A;  1BMQ B;  1T9W A;  5DET A;  4HI2 A;  4OL8 A;  1RAI B;  3NMA A;  3OTC A;  1K47 A;  2HRT A;  5EGY A;  2AWZ A;  1SQE A;  1RTZ A;  2HBQ B;  1UEU A;  2PD1 A;  4PZV A;  1C1C B;  2RHS B;  2ZUG A;  1D8Y A;  2CPJ A;  4H4O B;  3CPW R;  1HPZ A;  4KKO A;  1RU1 A;  1U26 A;  4ZLP A;  5E3C A;  2XSJ B;  3TUJ C;  3RR8 A;  3CJR A;  3AD7 C;  3SIP B;  2MKK A;  4E2F B;  2UVU A;  3AOC A;  4CH7 A;  4LF5 J;  5HBM B;  3TUZ C;  1KVJ A;  3QID A;  4OJ1 A;  4ZMM A;  4AL5 A;  3TJ9 A;  3G8S A;  1IM6 A;  2F7V A;  3DFE A;  4O0I A;  2VZ9 A;  3BGL A;  1W2B R;  3N4W A;  1S1X A;  2VG5 A;  1JNZ B;  3M2R A;  4H4M A;  3RAX A;  3VTI A;  1TVR A;  4WU2 A;  2G4B A;  3SDE B;  1I3O B;  5H1S V;  1R0B G;  3MTJ A;  3PKM A;  2HFO A;  2N4D A;  1FFS B;  2LU2 A;  2EWH A;  1WUU A;  2APO A;  2WTF A;  5J2P B;  3TA0 A;  1RHU B;  4ZKA A;  4OZL A;  1CPZ A;  1R27 B;  3UQS A;  1LOU A;  1E6V B;  3CIZ A;  3EDR B;  5G4D A;  4LFB F;  2KT5 A;  2YKN A;  4U7U K;  1VLY A;  1AUS L;  2V50 A;  5KFR A;  2MYF A;  1LFP A;  1JLA A;  4RNO A;  4YR2 A;  1XER A;  2KJW A;  1KOO A;  1REV A;  3ADA C;  1QLN A;  1CJV A;  3BH7 B;  2CJQ A;  5BYQ A;  1HA1 A;  1BWE A;  1NZ8 A;  3TW0 A;  3BGR A;  3I0R B;  4BWJ A;  3IWL A;  5HLF B;  3BYP A;  3LOU A;  2KI2 A;  1WAC A;  2CVE A;  2ZNZ A;  4URQ U;  3OVS A;  3D2W A;  2YTC A;  4DU8 A;  2FHJ A;  5BYR A;  4WXO A;  2GFF A;  4O4G A;  1RWN B;  4OQJ A;  2DGU A;  3PZP A;  4ES3 A;  2EFP A;  3HHL B;  4C11 A;  2HMI B;  4DR2 F;  2V0N A;  2HFU A;  1YIT S;  3CCT A;  3MR7 A;  1NPK A;  4MJK A;  4ZPC A;  2FB0 A;  1HLW A;  2AGP A;  4Q44 A;  1EAY C;  3KLH B;  1XC9 A;  3OFF A;  3EE3 A;  1MU2 B;  1WOO A;  3QT7 A;  4N77 A;  3V6K A;  4ELU A;  3POT A;  5HAT A;  3I4P A;  2LYV A;  2LEB A;  3FCV A;  4DV2 J;  3VF0 B;  2UU9 F;  4CLW A;  4Y6I A;  3KJV A;  3DLK A;  2B9Y A;  3K17 A;  4PG6 A;  2LQJ A;  5AXN A;  4U96 A;  2BKO A;  5GAD I;  2RS2 A;  5AJ3 J;  4CIO A;  2UVR A;  2VPY B;  1U24 A;  2MZT A;  4DN9 A;  3OFE A;  5DDR C;  2I38 A;  4EBC A;  4DJB A;  2E29 A;  3ISZ A;  1VOM A;  4OV6 A;  5K9F A;  2VC1 A;  3CJ4 A;  2Y0B B;  3BSN A;  2JEG A;  3LPY A;  3BSA A;  5BXI A;  4F4X A;  1VCT A;  1N36 F;  4Y2C A;  1A6L A;  4RL1 A;  2XYP B;  3N6M A;  1RWP B;  3QO9 B;  4TVA B;  4ZJO A;  1DZ5 A;  2BXJ A;  4ZDN A;  2Z2M A;  2M0G B;  4WZQ A;  4X84 A;  3MWB A;  3G8T A;  4NCB A;  3N5B A;  2A0F B;  1F2G A;  4KTQ A;  3KJQ B;  1WC0 A;  3R27 A;  4FNH A;  1SJ3 P;  3CSK A;  5H9F K;  2VPX B;  4FBU A;  3IS9 B;  2KTQ A;  3KK1 A;  4WP9 A;  2RQC A;  4B3R F;  2UVV A;  4K4U A;  2D9P A;  1NJY A;  4WE1 A;  5A2Q Y;  2XLK A;  4B3M J;  3J7Y U;  2O01 C;  1K44 A;  3EM1 A;  1NK6 A;  1QSY A;  2AGQ A;  3Q8S B;  3HHE A;  5GAG U;  1HBO A;  1LXN A;  4P75 A;  4QW9 A;  3FBE A;  3G8Q A;  2C3O A;  3HLU A;  1M5O C;  3KDN A;  4ZK7 M;  2HVE A;  3ZZO A;  2BMB A;  4KIA A;  2M8H A;  4ZVH A;  2F65 A;  4NYZ A;  1H7X A;  2W4C A;  2NUH A;  2VA2 A;  5DDO C;  3PO5 A;  1RWV B;  2V2V A;  4JI2 F;  1VIS A;  1AA1 B;  4OJH A;  4ZN3 A;  2RDD A;  1EP4 A;  2DNM A;  4DMZ A;  3NCR A;  2DXD A;  1NKC A;  1NCL A;  3TZZ A;  1HPZ B;  4KKO B;  4TKT A;  4X4P A;  1WF2 A;  2QN6 B;  3M30 B;  2X1B A;  1VQP S;  3CJ3 A;  3UN2 A;  1TAQ A;  3GYG A;  3J81 Y;  4X4O A;  3U7J A;  4L72 B;  2KRR A;  1YBT A;  1S12 A;  3M8S A;  1JNR B;  1RB0 A;  1RT2 A;  4KPY A;  4HH0 A;  2CZ9 A;  3W66 A;  4ED3 A;  5D77 A;  1S1X B;  2IFX A;  2VG5 B;  2BJ1 A;  4XO0 A;  2AMC B;  1KD1 T;  4H4M B;  1SC1 B;  1WEY A;  4Y00 A;  2XMW A;  2W4P A;  1TVR B;  4H4K A;  3L95 X;  3R5A A;  5EHH A;  4OZN A;  3K89 A;  3D0I E;  2ZHB A;  5JVG Q;  1NLK L;  3C3L A;  1SBR A;  2XTJ P;  2WOM A;  4W98 A;  2YKN B;  4EYH B;  3LQV A;  1GMU A;  3QT5 A;  5ETP A;  1FJG J;  3FK4 A;  2ZJP Q;  2OHD A;  2M70 A;  2EW9 A;  4HR2 A;  2R8H A;  3J7Y I;  3US5 A;  1T9X A;  2V8H A;  3DOL A;  2R7U A;  4Z37 A;  1MMD A;  2AJ0 A;  4B17 A;  3EXY A;  3O1L A;  4K5S A;  4O23 A;  2P6S A;  3DOM A;  2HS3 A;  4X4R A;  2QX0 A;  3I5C A;  5L8R C;  4K0K F;  1B70 B;  1FHT A;  3BGR B;  1FRM A;  2YVS A;  3BV8 A;  4LUB A;  2J9E A;  2QIF A;  2F8M A;  4LFC J;  5G0R A;  5J2Q A;  2XC9 A;  4K2J A;  4ILL A;  5C42 A;  2UXC F;  1SV5 A;  4QYR A;  4O4G B;  3ZZT A;  6AT1 B;  3RRH A;  1Z2L A;  5KFU A;  4NZ7 A;  2AJ2 A;  2FJD B;  1KLN A;  2IA0 A;  4C11 B;  4OI3 A;  1MWZ A;  3BF4 A;  2VFT A;  5B08 A;  1WOP A;  2OEK A;  2RNE A;  5IWA F;  5CYM A;  2RRA A;  3BJY A;  4NLU A;  3DRS A;  1ELO A;  2W9B B;  4WYW A;  4HHU A;  3IR7 B;  2OFH X;  1ZZF A;  5SZT A;  3FGV A;  2CRL A;  3ILL A;  3ZNJ 1;  3POT B;  3I32 A;  4FXV A;  4TQS A;  4YB5 A;  1JJ2 R;  3DLK B;  1N33 F;  3F44 A;  2J0Q D;  3ICL A;  1T05 A;  5K8N A;  2QT7 A;  4YN3 B;  1H2V Z;  2KDO A;  4CYU A;  1FVS A;  1YBU A;  4I67 A;  4DX7 A;  2WW4 A;  2OD6 A;  2HQD A;  3M32 A;  1QTN B;  2Y1R I;  1RT7 A;  2JL9 A;  3B54 A;  1Y5I B;  2L3M A;  3QRQ A;  2NLW A;  2CQI A;  2GGP A;  4GVL A;  2PEH A;  3G71 S;  4DSE A;  4LF9 J;  1FER A;  1L3K A;  2E7V A;  3JSR A;  3P49 B;  3PW7 A;  3QGG A;  2GIR A;  3LP2 A;  1RHM B;  5E5N A;  1Q7Y T;  3AA8 A;  1UJ5 A;  1XMB A;  3HHK A;  3IC1 A;  3R9L A;  3D6T B;  1D3W A;  4Z2X A;  2VFU A;  1CJU A;  1VLO A;  2YQ3 A;  4OFZ A;  3KK1 B;  2WSF C;  1U6F A;  4WFZ A;  3UCG A;  4WE1 B;  1WHW A;  2XMJ A;  2CDQ A;  4PXC A;  5KFH A;  4KYZ A;  1X4B A;  4Q43 A;  2E9T A;  4QPT A;  5J1P A;  1UVJ A;  4ZPW R;  1Y11 A;  2ZH7 A;  4WP3 A;  2YQ0 A;  2OPP A;  3C6U A;  2U1A A;  1FDN A;  5KG1 A;  3CCR S;  3C2P A;  1HBO B;  3PNI A;  1N5S A;  3ZTO A;  2Z58 B;  1M5S A;  3DN9 A;  2ZOM A;  2J76 E;  1SB6 A;  2HLU A;  4ZCI A;  4FF2 A;  5E2Q A;  3BKU A;  3U1L A;  2RD5 C;  3DM2 A;  3S8S A;  2EKY A;  5JMN A;  4Q0B A;  1S48 A;  5CAB A;  4RNH A;  1MNE A;  1RTJ A;  4OJG A;  3IR6 B;  1S9F A;  3M8Q A;  3G2X A;  2ZH8 A;  2H48 B;  5KFK A;  1XNQ J;  2JDJ A;  1V5I B;  5FII A;  3W9J A;  2CAD A;  2JSX A;  2B8P A;  1UJ6 A;  2DVI A;  4ZS6 A;  2J7K A;  5DG9 A;  1RT2 B;  3CJT A;  1FCA A;  1YZ6 A;  3HVW A;  2G2Z A;  1ZM3 A;  5EX0 A;  3PHT A;  4AYB D;  4PYD A;  2OMO A;  4JI1 J;  4WFY A;  4LQ9 A;  2B3T B;  2HEK A;  2NXC A;  2VQE F;  4LSZ B;  1RTH A;  1KLM A;  3NOC A;  1GK8 A;  1U7L A;  1NZA A;  4J9V A;  3M8Y A;  4QQB A;  2H9Z A;  3THT A;  2IBK A;  2WAQ D;  1I6J A;  2XG8 A;  6FDR A;  3PW5 A;  1HW9 A;  2K8G A;  2VBW A;  3UE2 A;  2AD9 A;  2WOM B;  2RRN A;  4RW6 A;  3J81 U;  4OZJ A;  5KFD A;  4UW2 A;  3GG0 A;  4ZIW A;  4DXL A;  1IKW B;  3BSC A;  1DQ9 A;  3DOL B;  3K8V A;  4DR6 J;  1DTT A;  3QSY B;  2ZC3 A;  2HK3 A;  3MMA B;  3DDN A;  3DHX A;  1JIH A;  3DLH A;  3DOM B;  1X5O A;  4N41 A;  3N01 A;  2JFD A;  4J9M A;  1KS2 A;  5G0R B;  5J2Q B;  1NSQ A;  1KBR A;  5C42 B;  2FLN A;  5M2R A;  1WNE A;  1SV5 B;  1PGZ A;  2PEB A;  2G9O A;  4DV6 J;  2J8S A;  4B9V A;  4PPD A;  2CNN B;  2JWN A;  3KMS A;  3GQC A;  3MPY A;  3RG6 A;  3FBF A;  1F5A A;  4CT8 A;  1S10 A;  2BW2 A;  1SJF A;  1UKU A;  4LF5 F;  1NO8 A;  5CYM B;  2R7Q A;  1AB8 A;  1XR6 A;  2K2P A;  5GAE U;  1YLX A;  3N6N A;  3LGH A;  2OH2 A;  1UAW A;  1KHW A;  2UXD J;  1FFG B;  3DRR A;  2QJ3 A;  3OR1 A;  4DR5 F;  1RAA B;  4FS2 A;  1HYS A;  3TQ1 A;  1IXK A;  2KJV A;  3CWJ A;  3FJ2 A;  4DQQ A;  4MFB A;  1ICE B;  3G6Y A;  1NH7 A;  1O5J A;  3TJ8 A;  2B9X A;  3W9I A;  2XB2 D;  5CA5 A;  3W61 A;  4FVC A;  2NUU G;  2HAI A;  4CO4 A;  1GMW A;  4DV3 J;  1M5P C;  3Q8V A;  4IRD A;  3LGM A;  1T05 B;  3KLI A;  1JLC A;  4F3M A;  1V3Z A;  1J5E J;  5ETK A;  4CYU B;  2QFJ A;  1X4H A;  5F3T A;  5A76 A;  3A3O B;  2QL5 B;  1SJQ A;  4USM A;  1F9E B;  4PKD B;  3IRX A;  1O0P A;  1G7C B;  4BS2 A;  1JX4 A;  4DSI A;  4DCO B;  5DRK A;  3E01 A;  1HWI A;  3M32 B;  4Y65 A;  3FC9 A;  3H5U A;  1RT7 B;  1F5B A;  2Z56 B;  4A47 A;  5KFG A;  2FZK B;  4MK7 A;  2V69 A;  3VAK A;  4KY3 A;  2GGP B;  4CWB A;  3ZTP A;  5LMU J;  1QE1 A;  1TL4 A;  1JJH A;  4EK2 A;  1QAJ A;  2D69 A;  5GVQ A;  1FRI A;  5CHC B;  3LP2 B;  5JJB A;  2MKJ A;  2WCX A;  4QZV B;  4UTG A;  3MI7 X;  3TZY A;  5L39 A;  4Q2L A;  2FJE B;  2Z0G A;  1CC8 A;  2HWI A;  1P8G A;  2MZR A;  1HHQ A;  5KFF A;  4WTO B;  1C2P A;  1C1B A;  3M9O B;  3KK2 A;  2V8V A;  1CJU B;  1UA1 A;  4J9Q A;  2ATL A;  4QWB A;  1DY3 A;  3GIR A;  3IMQ J;  2HBR B;  5F0U A;  3ITH A;  2W8L A;  1VRT A;  1SC4 B;  3MZI A;  4QIV A;  1L3T A;  3HMJ G;  8RUC A;  4OHX A;  2AKW B;  1R7I A;  3I4H X;  3GON A;  1VC6 A;  4BC7 A;  2JEF A;  1K0T A;  3NOG A;  3HD1 A;  1P9Y A;  2XS5 A;  3RBD A;  4DV2 F;  2QMX A;  1WF1 A;  2OPP B;  2RDI A;  3NNH A;  3D6H B;  4FNI A;  4P7V A;  3J80 Y;  4A8O A;  4X65 J;  1D1U A;  2YNF A;  2MHE A;  4F0K A;  5AJ3 F;  3DXB A;  4F25 A;  3W3S A;  3MAH A;  5HMZ A;  5IV3 A;  2VAS A;  3BDP A;  3OLA A;  2X51 A;  3DM2 B;  3A4T A;  2AT1 B;  4Q0B B;  1ZA1 B;  2VD3 A;  2WSC C;  2GAG C;  2AGO A;  3TWZ A;  3M8Q B;  4CLS A;  4DSJ A;  2R8I A;  2W2Q P;  4IFY A;  1F1B B;  3M05 A;  2BOP A;  4YR3 A;  1UA0 A;  2IJR A;  4LMZ A;  1VIX A;  4BDP A;  3VR1 A;  1GXL A;  4I6A A;  3OL6 A;  2HRU A;  2NPI A;  5DS7 A;  2GO9 A;  2KZM A;  2QSF A;  4UZC A;  1T95 A;  1TK0 A;  5ETS A;  4DR7 J;  3JTP A;  4OZ1 A;  4OYA A;  3FSI A;  1RTH B;  2POK A;  1SVD A;  1KLM B;  5KFN A;  3M2U A;  2VOO A;  1B0T A;  3FFI A;  5L46 A;  2BYC A;  4GKK J;  2N3O A;  4CLF A;  2XY5 A;  1X0P A;  4RBT A;  2G0I A;  4B3M F;  1WG4 A;  2KO1 A;  4ALZ A;  1U8W A;  1QSL A;  4JI4 J;  3LH2 S;  5I4M A;  5F8J A;  5IZH A;  1WKL A;  2QA4 S;  3NS7 B;  3GFX A;  3BR9 A;  4AE5 A;  2CQ1 A;  2ZNY A;  2YQ1 A;  1Y3J A;  9RUB A;  1DTT B;  2BRK A;  3UDL A;  3I96 A;  5A8K A;  4X62 J;  4LR8 A;  1GX6 A;  4PG5 A;  4C8L A;  4C3K A;  1FJC A;  2YWH A;  4ZIV A;  3C6T A;  2D3O R;  1F5C A;  4AL7 A;  1ZAW A;  2XGQ A;  4DOZ A;  1XR5 A;  5A8R B;  2WK4 A;  4M5D A;  1WWH A;  4EZ6 A;  2GA7 A;  3KUG A;  1NK0 A;  3AD9 C;  2E1A A;  4DV4 J;  3BDE A;  1KC8 T;  2B6A A;  4C6A A;  4NYP A;  3DRR B;  4OX8 A;  1KTV A;  4K4V A;  3HX9 A;  3OR1 B;  4ED8 A;  4PWD B;  1HYS B;  1RCX B;  1OQ6 A;  1U1Q A;  5D4P A;  4MFB B;  3IG1 B;  4UQT A;  3KWM A;  2AJQ A;  2GJI A;  3ZZU A;  1NU4 A;  2HHV A;  4KGV B;  3RR7 A;  3KLI B;  1ZZN A;  1TUV A;  1JLC B;  4ZLN A;  3ZZY A;  3G6E S;  5DLG A;  2X1G A;  1HBN A;  3FUY A;  4NLY A;  1FJG F;  4CLK A;  3IRX B;  3K5N A;  1T9Y A;  4NE9 C;  4Y34 A;  2Y3Y A;  4R25 A;  3E01 B;  5HN0 A;  4ZPA A;  4KHP J;  1MW7 A;  3MMB A;  2BM0 A;  4F3O A;  4QR2 A;  5C2G A;  4I6Y A;  2HWH A;  1VGY A;  3K2Y A;  3RBZ A;  3R6L B;  2XZW A;  4LFC F;  2EG1 A;  3NLC A;  5B0G A;  1ZTW A;  1R8B A;  3H7H B;  3W9H A;  4RBU A;  2H51 B; 
#chains in the Genus database with same CATH homology
 3DKD A;  2DXF A;  1NDP A;  4EK2 A;  1NDC A;  3ZTO A;  3BBF A;  1F6T A;  2NCK L;  5IOL A;  1K44 A;  3EM1 A;  1VYA A;  2AZ3 A;  3Q8Y A;  3B54 A;  3BBB A;  1WKL A;  3GPA A;  3L7U A;  3VGU A;  4WBF A;  2HVD A;  3FBC A;  3ETM A;  1S5Z A;  3DDI A;  1BUX A;  3ENA A;  2B8Q A;  3VGV A;  4ENO A;  1LWX A;  3FBE A;  4F4A A;  1B4S A;  1HHQ A;  1PKU A;  2VU5 A;  3NGT A;  1BHN A;  2CWK A;  1WKJ A;  3VGS A;  1EHW A;  1BE4 A;  4DUT A;  2BEF A;  5CAB A;  1MN9 A;  2HVE A;  3ZTS A;  1XIQ A;  4ANE A;  1NLK L;  1W7W A;  1LEO A;  5BXI A;  2HUR A;  1NDK A;  3G2X A;  1S57 A;  3VVU A;  2ZUA A;  2DY9 A;  1JXV A;  3NGU A;  1ZS6 A;  4W98 A;  3R9L A;  1NDL A;  1NPK A;  4AND A;  3Q8V A;  1HLW A;  3ZTR A;  1PAE X;  3EMT A;  3EVO A;  5CAA A;  3VVT A;  1NUE A;  2DXE A;  3ZTQ A;  1HIY A;  4DI6 A;  3WX8 A;  4KPC A;  3EVW A;  3Q83 A;  2DXD A;  1XQI A;  4FKX A;  5C7P A;  4HR2 A;  3ELH A;  3EE3 A;  2B8P A;  1NCL A;  1MN7 A;  4UOH A;  3FKB A;  3BH6 B;  2AZ1 A;  3PJ9 A;  3EJM A;  4FKY A;  1F3F A;  4F36 A;  3NGR A;  1S59 A;  3EIC A;  1NSQ A;  3Q89 A;  1UCN A;  1WKK A;  3FCV A;  4ANC A;  3Q8U A;  4CP5 A;  3EVM A;  3JS9 A;  4S0M A;  4DZ6 A;  3BBC A;  3NGS A;  1KDN A;  3GP9 A;  3FC9 A;  3PRV A;  4O0N A;  1NB2 A;  1NSK L;  4C6A A;  4UOG A;  1NSP A;  3Q86 A;  3BH7 B;  3FBB A;  1U8W A;  3FCW A;  1NHK L;  2DYA A;  3ZTP A;  2BX6 A;  3B6B A;  3VGT A;  3MPD A;  1B99 A;  3FBF A;  4UOF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...