3ETMA

Crystal structure of the mimivirus ndk +kpn-n62l-r107g triple mutant complexed with cdp
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
133
structure length
133
Chain Sequence
QRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTDAISKIRRLQGNTNPLASAPGTIRGDLANDIGENLIHASDSEDSAVDEISIWFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
total genus 40
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2008-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3etmA00
4ANEA 1BE4A 2BEFA 2CWKA 4CP5A 4EK2A 1NDLA 3DKDA 5BXIA 3VGVA 1NDKA 3EVOA 4O0NA 1LEOA 1NCLA 3EE3A 4DZ6A 2HVEA 4UOHA 1F3FA 1BUXA 1BHNA 3NGTA 4F36A 3L7UA 3PRVA 4ENOA 3Q8VA 1W7WA 1NPKA 1ZS6A 3PJ9A 2NCKL 3JS9A 3EVWA 1LWXA 1WKKA 3ENAA 1U8WA 1S5ZA 1MN7A 1HHQA 1NSKL 1NUEA 1S57A 3BH6B 5CABA 1NB2A 4C6AA 3NGUA 1PKUA 4KPCA 1MN9A 2DYAA 3DDIA 1EHWA 3Q89A 1VYAA 3EICA 1NLKL 3FCWA 3NGSA 1B99A 3GP9A 1NSPA 2DY9A 3MPDA 1NHKL 3ZTRA 3Q8UA 1XQIA 3VVTA 4ANCA 2BX6A 1JXVA 4FKXA 1B4SA 4F4AA 1K44A 3VGUA 4UOFA 2DXEA 3BBBA 3Q83A 1UCNA 4UOGA 3FKBA 3FCVA 3NGRA 3ZTSA 2HVDA 2AZ1A 3EMTA 1NSQA 3ZTOA 3BBFA 1XIQA 5IOLA 2DXDA 4DUTA 2B8PA 3Q8YA 4W98A 5C7PA 1F6TA 3EM1A 4DI6A 3VGTA 1PAEX 3FBBA 3FBFA 3EJMA 2B8QA 3G2XA 1HIYA 3FC9A 3B6BA 3FBEA 1WKLA 1NDCA 4FKYA 3Q86A 2HURA 4S0MA 3BBCA 3VGSA 3ZTPA 2VU5A 3BH7B 4WBFA 3WX8A 1S59A 3ELHA 4HR2A 1WKJA 1KDNA 4ANDA 1NDPA 2DXFA 3R9LA 3FBCA 3ZTQA 1HLWA 3GPAA 3ETMA 3VVUA 5CAAA 2AZ3A 3EVMA 3B54A 2ZUAA
chains in the Genus database with same CATH superfamily
1F60B 3K5MA 1EQ0A 4WCEQ 2V63A 1HI1A 3DOKA 5THWA 1UPMB 1L3SA 2D69A 2FIUA 2WCXA 3MM7B 4AT1B 5B0BA 3VAFA 4DZ6A 4DR3J 1A0OB 1RKJA 5B09A 1X0FA 2KFZA 5HSPA 3SQGB 5ETMA 5ETTA 4MK8A 2V2ZA 2ATCB 2I1RA 4IOAQ 2OUGA 5D0EA 4LF4F 1S79A 5D6GA 4I6WA 3H5UA 1T94A 2HBZB 1WC5A 4PR6A 3R7SB 3BF4A 4OYMA 3MCNA 2JWNA 3SV4A 4ID5A 3D4JA 3MM9A 3MEKA 2VBYA 3M2RA 2DRAA 1CS4A 4BC9A 2BW7A 2V34A 5DETA 1H2UX 2GC8A 2MQNA 1RHKB 4M5DB 2VC0A 4Q2LA 2BM1A 4WFZA 4F4WA 3ZC4A 2ADCA 1RBAA 2CPEA 5AXLA 3JSMB 1HHTP 3C15B 4N76A 1WHYA 2DISA 1VQ9S 1HBNA 2IDLA 2YKNA 5K8OA 1IM4A 2H51B 2CJ9A 1XNRJ 2BOPA 2FC8A 1BE4A 3JTNA 1JLEB 4KKOA 1E6VB 1OQ6A 2DR5A 4I2QA 1F9EB 2C22A 4DV2J 1DBDA 3GYNA 4N8NA 1IXKA 1OMSA 2FD2A 1LW0B 2EFOA 2DGTA 4OZ1A 2QYCA 3GLJA 2OH2A 4ICLB 2BJ9A 1FRJA 4I1TA 1KS2A 3RRHA 4JV5F 1JLQB 5J1EA 5DG7A 2DTJA 1HNVB 2U1AA 2D74B 4URGA 2X3DA 4ZCKA 1U7LA 2H65B 2BMBA 3W1YC 3ZTSA 2KG1A 4K4VA 4HHUA 1OSCA 1S6QB 4AL5A 1U2RA 1WF0A 2K1RA 8ATCB 1CVJA 4ED8A 1HNXJ 5F0UA 4HH0A 3OVAA 1RBOB 3PW4A 5KFGA 4HKQA 4DU7A 2LFVA 2FY8A 3TEHB 1U6ZA 4DSIA 3J7Z5 1HQEB 2Q3PA 2V67A 1S6PA 2DPJA 1F1BB 3T9NA 3FEYB 3UCZP 1XR7A 1FCAA 5DG8A 3QT7A 1CC8A 3OD2A 3EPIA 1TU0B 2QLFB 3T9ZA 3P6YC 2PFDA 2CVIA 1P8GA 2CIMA 2VHGA 2AJ2A 1RGVA 2GVZA 4DUZF 2DIVA 5C24B 4DV4F 1N0VC 2BYCA 4UOFA 4NCBA 4PQUB 2C3PA 4N8OA 3R5AA 3IRWP 3MGJA 5FDLB 3Q83A 3UDEA 4UT4A 2YNGA 2KN4A 1NSQA 4URQU 1V3SA 3PVXA 3LO3A 2M7SA 4AXIA 2E5LF 1S1TA 2CQ3A 2X7IA 4JI6F 2VBXA 1HWUA 3SSQA 5F0WA 3QIPA 2MQOA 2HHHF 1FHTA 1UEUA 2K7JA 3IBCB 4ED1A 4TXSA 1H2TZ 2JLEA 4NXNF 2CJQA 2EK6A 4FNIA 3DOKB 2VA3A 1EAYC 5FIIA 3M7VA 4A8YA 3I4HX 2N3LA 1U02A 2XGPA 1NK7A 1LW2B 2MKKA 4C8MA 2EC2A 1PKUA 3KLFA 4DR3F 3KNAA 1VYAA 1DLOA 2DO4A 2KM8B 2D41A 1R0CB 1VFJA 2B9YA 4ID5B 2M70A 3KHLA 2F8HA 4ZMMA 3Q8PB 3M2RB 1NJIT 1CS4B 2F9JA 3T1AA 2W24A 1QAJA 2QSWA 4F02A 3MUMP 2EG2A 3PDNA 3TX8A 5BYSA 4UQTA 1TK8A 2B0GA 4RNFA 4EZ9A 2M4MA 3D28A 4WBFA 4B9MA 1AXQA 4M95A 2QG9B 3CMQA 5L46A 2OIHA 4WJBA 5K8NA 3R2DJ 1HBNB 1U6FA 2YKNB 4KFBA 2KJWA 2XI2A 2VOOA 4EO6A 3RAMA 3Q8QB 2G2ZA 2I38A 4KKOB 3P49B 2VPZB 1WDDA 3MM5A 1O51A 4ZVOB 1DFDA 1J2VA 1H7XA 1LEOA 4ZP7A 5E2QA 2GHPA 3V81B 1VQPS 1Q5VA 4QYZJ 2CPYA 5KG1A 1SC6A 4DR4J 1N5VA 4DDFA 3H5SA 3GIJA 1OWXA 3MOZA 3D1OA 4DV7J 1DARA 4ZS6A 3Q8UA 4JI5F 2BJ1A 2VONA 3D6FB 2G13A 3OTDA 2JEGA 4MJKA 3OTEA 1TL1A 2QLBB 3K7RA 1CJTA 4FXDA 3IA0A 3UCGA 1WEXA 4F26A 4TYBA 2RRBA 4P2SA 3O5TB 3ZZRA 2HS4A 2K1RB 5IM0A 1HBOA 4B3RJ 3JQJA 3C14B 5LMUF 3VZIA 4N41A 2FHOB 3EX7B 4M5MA 3D0GE 4CO5A 5B0GA 4NPOA 3R6GB 2OHDA 1N32J 1EETB 2ZH1A 1XMQJ 1HNXF 2W9BA 2WW8A 1UA1A 2IVMA 3QMQA 3MURP 2M52A 3JAMU 2CPHA 1MMLA 2QTWA 1LXNA 2PEBA 1LFWA 3CWJA 3W5XA 4RW4A 2AT1B 1HI0P 1V5IB 2ZDOA 3MR6A 2GVZB 2RDDA 2J6TA 1Q81T 4PABA 2V9WA 1T9VA 2V2QA 1S1WA 1RU1A 2YNGB 5H9FJ 4DFJA 4WWSA 2K3KA 1Q8BA 3W63A 4PG8A 3DGPA 1OYDA 3KG4A 2IAJA 1H73A 1D09B 1OPIA 1S1TB 2VBWA 3L4BC 2VA2A 3N0VA 1WKLA 3A3PB 3QIPB 2E5GA 1JXEA 2F8EX 2ZH8A 1XR6A 4YN3B 2XYHB 4C9DA 2KXHA 3TAMA 1N0UA 3OT9A 3GYGA 4ILMA 3R6LB 2CDQA 2ZHAA 4RUCA 5L9XA 4BLGA 1XC9A 3CJ8A 2Z4PA 2E7WA 3UD3P 5DGBA 2OD6A 3O1LA 2HS0A 1T05A 5HLFB 1RDRA 3I9ZA 1QVFR 3AQOA 2OLWA 4DN0A 2HFOA 3KLFB 2DRBA 1DLOB 2V4QA 3PXGa 2C2ZB 5HQ8A 1FK9A 1UVKA 2OPPA 4M1KA 4OHXA 1WSRA 2FJEB 3D0IE 1FF2A 4CI0B 4P72A 2HHSA 2ZNYA 1XMOF 2J5AA 2ZUGA 2E7XA 4RL1A 2DD8S 4U8VA 3UWTA 3DU5A 4ECRA 9RUBA 3QO9A 3HDSA 3DGVA 2FB0A 4PZVA 2UXBJ 2OELA 3C2PA 2J8SA 1XBWA 4QBUA 2ZBQA 2GIFA 2VFSA 1JLFA 5CYMA 4ECYA 2VPXB 4KFBB 4CLKA 4ETZA 1WC4A 2HIYA 2W8KA 1YZ6A 5KFEA 3MM5B 2KT2A 3LW5C 1JJHA 3BEGB 2NZ4A 1RAAB 3RJMB 1DQ8A 4AUKA 1RHJB 2LXIA 1GX5A 2OEMA 1SIZA 5KOXA 1FNOA 5F8GA 5EX3A 4USWA 5D8HB 2VUGA 4QWEA 2ZBPA 3T5HA 4FBTA 4F4AA 3NMRA 3UD4P 1F9HA 3I87A 2DH9A 4KIAA 4CLLA 4J9PA 2HSEB 1TL1B 1H98A 1CJTB 4DMZA 2BE9B 1T7PA 4OHZA 4C3LA 3WQPA 1FD8A 4ZOSA 2CZVC 3F41A 2DEJA 1WTFA 2J0WA 2A10A 3VTIA 2E5HA 2F65A 4IRDA 5IM0B 2HHXA 1HBOB 5DDPC 1KBRA 2BANA 4KBIA 3MTJA 1KQSR 2ZZMA 2CQIA 1X31C 4DSKA 2L9DA 4J9QA 1RAIB 3HMJG 4CH1A 2W9BB 1ACMB 3TA0A 1RLDA 3PO4A 4B3RF 2KDOA 3WIVA 5F8LA 1G3OA 4OIXA 1XMQF 2OI2A 1Q5YA 5CYQA 3M1VA 3NGDA 1HWIA 4EBDA 2FPHX 1DTTB 4CLTA 2YNIA 3CDWA 4OYWA 2PE8A 1NNDA 4F4YA 4X62F 1FRLA 4XAKA 1T03A 4Y2CA 4AYBD 4IH5A 2HWIA 4PG4A 4Z7YA 2FLOA 4B3OA 1S1WB 2VPWB 3ISND 3DNCA 1FRHA 1YJTA 2Z8QA 2OFGX 3AB4B 3CEDA 3PIPQ 5D4PA 3DGPB 2IAJB 2PC6A 3Q8YA 1HNWJ 1UFLA 4RW8A 1C2PA 1YG0A 1RCOB 4ELUA 4Y0FA 4GC6A 1VMBA 3POTA 3BH7B 1VBZA 3C6UA 1I51B 5LMNJ 3TAMB 3IMQJ 1R27B 1Z1ZA 4CWBA 4PCQA 3PZPA 2UUTA 2XY5A 4O44A 3O44A 3NOCA 3HI9A 5IXUA 4O4GA 4CLYA 3GV8B 1VHFA 1T05B 1HWLA 1UA0A 3P96A 2AW0A 4Z7CA 1NXIA 2HQ3A 3PACA 5K14A 4TLRA 4DPYA 1B70B 5GAGU 1Y9OA 1YIJS 3T19A 1HR0J 2M2BA 2QA4G 3RAQA 5EN1A 1FK9B 3BPSP 4K0KJ 2OPPB 1Q95G 2V2KA 3RB6A 2HK3A 1Y5LB 3M8QA 2AGQA 1VIXA 1FX4A 5HVFA 4CNZA 1AW0A 3QO9B 2HEKA 5E3RA 4PWUA 2KRRA 1VQ7S 4X4PA 5BJRA 1TTHB 2WBRA 4UQGA 2YWFA 5HVGA 4R25A 4OI4A 1JXLA 1MSWD 5CYMB 2YWKA 4ZK7M 1QD1A 3CDEA 3ZTQA 3MAQA 2RQ4A 2JRSA 3M30A 1NPPA 4ELVA 3HFKA 2N7CA 4O4RA 4QQBA 9ATCB 2FVPA 3T5KA 5HMZA 1VC6A 2AIRB 2LECA 3DOMB 4LSLA 3CXCR 1HNZF 1ZETA 1WELA 3DLKA 2DY1A 4U7UD 1B64A 5A76A 1WKKA 3PRBA 4OX9F 5KFYA 2MTLA 5EHHA 5A0YA 1TV6A 3AB2B 4DSFA 3QFWA 1R43A 3CCES 1ZAVA 4IOBA 2ZBCA 3DRYA 2Z2MA 1VQ5S 1P9QC 2UV8A 2QJ3A 3VF0B 2CQBA 1TKDA 2HHWA 3NGRA 3OFGA 2BABA 5HO4A 2ZOFA 4QWDA 2C2MB 4LRDA 2KH9A 2CRLA 5L8RC 1JX4A 3ENQA 3NKYA 2BANB 5KFSA 1RWOB 3J80Y 2ZE2B 2WVDA 4MFBA 3RB0A 2Z2ZA 3IBFB 4ECZA 3D1QA 1VQOS 1VI7A 2AYGA 1H2VZ 4X4TA 2Y0BB 2AEJA 1V5VA 5HMXA 2WAQD 4F0MA 2HVIA 4ANEA 1N36J 2MHEA 3BDPA 1B0PA 4G1QA 1S6UA 3M1VB 1ZYQA 3IWNC 4I64A 4LBHA 3A1YG 3Q8VA 1ZS6A 5AE1A 3TVYA 2AP6A 2YNIB 3BR8A 2H4YB 1IBLF 4EWTA 2HAFA 2HWTA 3DDIA 5F3TA 1T03B 3PR4A 2WW4A 4W92B 4ZDNA 4OV1A 4IH7A 2W4CA 2CA9A 1NKEA 3FNNA 4B3OB 4DQPA 2YKAA 2DHSA 3MM8A 3QLHB 2C2EA 2CNLB 4FYDA 4KYZA 1VJWA 5JXSA 3W5ZA 3PJXA 1PBAA 3EM1A 4KGKA 4RW8B 4PWWA 5IV3A 6AT1B 2IMWP 1RSCA 3NNHA 3OHAA 1VK3A 1IBCB 1FX2A 1KTVA 3NS5A 3POTB 3C6UB 4TU9A 1HNWF 4H4KC 1PILA 1P27B 3VVUA 2DNKA 3RYLA 1FERA 4GVLA 3GTYX 1HPZB 2VFUA 4YEAA 4O44B 5LMNF 4X66F 4O4GB 2V68A 1LWCA 2MEWA 3EGVA 2E1MC 5D0GA 4G1PA 1X8DA 5K14B 2V6AA 4A8XA 4AL6A 3BO2A 3KMSA 1H74A 5K5MA 2OAUA 3MTKA 3SXLA 5GADI 1BWVA 3GG1A 3GYXB 4P2FA 2KM8C 1XNQJ 3Q2SC 4AXJA 3HD1A 3HKWA 3UR3C 1RT6A 3D5MA 4USJC 1HR0F 4RX6A 4MKAA 4USUA 3M8QB 5B0EA 2MYFA 1MU2A 3S01A 4ZPTR 4OJGA 1PC5A 4K0KF 1NH8A 1R6YA 3KLHA 4WXWA 3FC9A 4LRBA 5KTQA 1YZ7A 5J2NA 1N4LA 3GSIA 4OYXA 3W7BA 5CXTA 1CULA 1T11A 4ED6A 1NRKA 3VAGA 1FRMA 4E2FB 3GU0A 3GPAA 2BOAA 3JQMA 2EKYA 4FF3A 2I2YA 3KG1A 4B3TJ 4MIAA 5F41A 4LSLB 2HQCA 1DRZA 1RTZA 3K8VA 1NZ8A 3QRRA 2UU9J 1TK5A 2VG6A 1R7IA 3UVJA 2V69A 2VKZG 2DEIA 5A0YB 2DHHA 2PA3A 2PI5A 1YTYA 3MPDA 2FHJD 1R0AA 2DVIA 2HHTA 4ECUA 3CJ4A 4FP9A 2C3UA 1QVGR 3CD7A 2ASDA 4FVMA 3RW6A 4TN2A 1W2BR 3DLEA 3AD7C 4NLDA 3N6MA 3P5TL 5T41A 4LQ3A 2PI4A 4DOZA 1YJWS 3VGSA 3GJSB 3HFVA 1Q4RA 4RZRA 1KTQA 2VDHA 2CPIA 4M5KA 3PHEA 5I4MA 2OMLA 2VQEF 1Q79A 3GFXA 3C66A 4IO1A 2ACYA 4U7CA 3QJLA 5IC4B 4G1QB 1PJ7A 1S4FA 3DU6A 4YY3J 2LQBA 3R5JB 2RH3A 3EUNA 5HQMA 2ZH9A 3FZ2A 3TW0A 1J5OA 2R7OA 1NK5A 3EICA 4EBEA 3K5OA 4PG7A 3KNGA 4DV1F 2KI2A 1SPBP 4BWJA 3MM8B 4C0HA 5FD1A 2RS8A 1M0SA 3C16A 3BBFA 3T3FA 4ZVGA 1WI6A 3OPKA 1OYEA 3W2VA 4P75A 1SJ4P 1S7IA 3HO1A 2BQRA 3W62A 2KXFA 1VBKA 2AYBA 4F04B 3VAJA 3CCWA 1KD1T 1NDPA 2GAHC 3KUGA 3KLGA 2QEXS 2ZH2A 4NI2A 1GT8A 1KRPA 4L3NA 3TJ8A 4YDXA 4DG1A 1RCXB 3A13A 4CO3A 1K9MT 1VISA 1LWCB 4RBTA 2CQCA 3M9MB 3OUYA 1GXLA 4ES1A 2ZNZA 4L72B 1C0UA 2QO3A 2KL8A 3HP6A 1BMQB 4G1IA 5A6WA 3CJTA 4P52A 1UVNA 3D7SB 5DS7A 4U67Q 1PCAA 5HAOA 2QRRA 1NHKL 1U48A 1RT6B 2R7RA 3KK1B 3M32A 2XMTA 2PSZA 1V6HA 5IT9U 5DZ6A 4CDIA 2QL7B 1QJHA 1MU2B 4C8NA 2GAGC 3H2VE 1NMEB 1XMBA 4DPTA 3KLHB 1YHQS 3B8HA 2F1FA 3RR8A 3AODA 2ILYA 2PDAA 5J2NB 2UZAA 1ZM4A 2V8GA 1CULB 4CLUA 4C48A 2MKCA 2ZKUA 1LOUA 3MMBB 2XO6A 3PX0A 2K7KA 4C7QA 4XPCA 1PSDA 3SCJE 4UW2A 1MMDA 3Q0AA 4LRCA 3ILIA 3MEEA 2QV6A 2R7WA 2JX2A 2H5JB 3UN2A 4TKTA 3CCJS 2VDIA 3TZZA 2ZKTA 2HPUA 1D3WA 5HL7Q 5HQLA 5D78A 5HVHA 4NE9C 5GMDA 2DHGA 2VG6B 3JS9A 3UVJB 4B3TF 3BN7A 3QT5A 2HHVA 2F4FA 4DV6F 2HQGA 3GV5B 2ZM6J 4N7TA 2IM3A 2KU7A 4XDDA 2EKNA 1R0AB 2UU9F 1R8HA 1BWEA 2WHOA 2R7QA 2A6OA 1QM9A 3ISNC 3BBBA 4WP8A 2DNPA 4RLEA 1HKAA 2B9XA 4OZ0A 4J5OA 4WFNQ 1OY8A 3DLEB 2B8PA 1VS3A 2MXYA 2CJAA 2QL5B 5K8MA 1YJ7A 4PRFA 3V6KA 2OFHX 4KO0B 1RABB 4C4WA 2RJZA 3RBDA 4J9OA 2LQ9A 4WZQA 1YJVA 5AJ3J 4WFYA 1N54B 4LF8J 3IR6B 4DPUA 5F8IA 5I3UA 2GMLA 3ITHB 2W2MP 3IWLA 4WKYA 2B56A 4EK2A 3KLIA 1MW7A 1WF2A 4LRAA 1UFKA 2A3JA 2WVEA 4KB7A 3M2UA 4FYYB 4ECVA 1U1PA 5D4NA 4GRSA 2UXDJ 3RAXA 1XTZA 4DLEA 2AYMA 1J5OB 1DURA 4C6AA 4L74A 4P7VA 1IKVA 4ZJQA 1AB8A 5KG4A 2MZRA 4ES2A 1S0MA 3JYTA 2V2VA 4MT1A 2IBOA 2QLJB 2KZMA 1VRQC 3S7RA 5KFOA 3CJ2A 5KFKA 3OBIA 1GQEA 3C16B 2CJXB 2R7TA 2V50A 2L9NA 1C4AA 3BPDA 3GIIA 5HATA 4CRJA 1OS5A 4A8KA 4QCLA 3W2VB 4LSNB 1VQLS 5H1SV 3FBFA 4DCJB 4NLQA 1VR6A 1UW9A 7FD1A 1RT2B 3TA1A 2O1PA 1VBXA 4CLFA 3WZ0A 2HURA 3HZEA 3K89A 1QSSA 2OTJS 2AJQA 4TQRA 3BM7A 2O01C 2EFPA 4NLPA 3N6LA 1Q78A 2HNDB 4DG1B 4KH0B 2CQHA 3GJRB 4ILRA 4CH7A 3DKDA 2R2SA 3OJSA 3OUYB 3N5BA 3NY0A 3DLBA 4K7QA 1WWHA 1C0UB 3WIUA 3GSDA 4GKKJ 1NSAA 4DV3J 5J2QA 4HVZA 4E0DA 3H25A 2AX1A 4WTOB 1JNZB 3H4BA 2P5VA 4YR3A 5IC6B 1M5PC 2CJKA 1QE1A 3HD2A 5A8RA 1FA0A 4X4QA 3M32B 2ZH6A 3NBPA 3P45B 3FQKA 3J81j 4L6V3 3PYDA 3IAS9 1FRXA 2FJDB 3E8OA 3KFWX 1MNEA 2GGPA 3CJKB 2BVZA 3E01A 1HQ2A 5EUHA 5JJBA 2C2RA 3D6MB 1UEKA 4D3GA 3G8TA 2IJFA 4LSZB 4ECWA 1R6VA 1U6BA 4NYZA 2IC3B 7AT1B 3MEEB 5KG6A 2BKPA 3HHDA 1SC4B 1U0HB 1XJWB 1NK0A 3DLLQ 1W25A 3SCIE 3R7BB 4OYPA 3NGTA 2DIUA 4K5RA 2XS2A 3QGHA 4ZP9A 4NLOA 3OXFA 2XSJA 1Q53A 2L3MA 1KSPA 1TMMA 5CABA 5DLGA 2W7PA 3IRXA 3J7YU 3AXMA 2N4CA 4X84A 3F44A 3Q8SB 1KLNA 4Q0BA 2KJVA 3TARA 2B9EA 1YLXA 3HHLA 2HVDA 2D7SA 4RNHA 4OI3A 3SDEB 2D9PA 1U09A 2HGNA 2G1HA 2FZGB 4KV8A 3I5AA 2W4PA 2UUAJ 1YWXA 2ZOMA 1VRTB 1TELA 5LXYA 2HHQA 5J2PA 1YSJA 4R5PA 4LUBA 5E33A 3UNYA 2CG8A 2KYXA 3N4WA 4IFYA 2RRNA 1C4CA 1JIHA 4C3MA 4UUXA 2DGSA 4I2PA 1T9UA 1RZMA 4DPXA 5AJ3F 3M2UB 4GKJJ 3W66A 3BKTA 2IM1A 3FRYA 1LWXA 1S10A 2HG4A 4U9RA 3IM9A 4K2XA 4CH0S 1IKVB 4IR9A 1M5OC 5HJXA 3H40A 3D1HA 3K58A 3JYTB 1ELOA 2UXDF 1KWMA 1PAUB 1BQNA 5HANA 3J7AN 4X65J 2QE5A 4C98A 3FCVA 2HRTA 3J7ZT 5E41A 2DH8A 4FDFA 2Q43A 1N48A 1L5UA 3IAM9 2HRUA 4PYAA 4D3HA 1FDDA 3RBXA 1RAFB 1NM2A 1Q82T 3RR7A 3EDQB 1REVB 1EZZB 2KHCA 4JI8F 4X2BA 3HCXA 3WX8A 4DBQA 3GILA 2EBGA 4HR2A 3H5XA 5C42B 2P8IA 2HBRB 2Y3YA 4QWCA 2RQCA 3BN4A 3L09A 1YRXA 3B78A 2KRBA 5HN0A 1Q1KA 1VQMS 1IWGA 4KHRA 2GIRA 4DR5F 5A8WA 2LDIA 1NDLA 3WC2A 3E3XA 3UW1A 1TZ0A 2A1BA 3ISZA 3H42A 3TQ1A 1WG1A 1S1XA 4H4OB 3GE9A 1NJWA 4NL5A 1Q8LA 5J2QB 2VPYB 3UO0A 4L73A 2DITA 3MCMA 2UVRA 1CJVA 2WB1D 3GP9A 3TR5A 5A8RB 4DV3F 3K0JA 3NBPB 2DXEA 4C3KA 5GVQA 1WHXA 2V8DA 1C1CA 1QUPA 1HW8A 1SI9A 3NAHA 3BGOP 3F73A 4K4SA 3BO4A 5KFXA 1GTEA 1N5SA 3TQEA 1LV5A 1X4CA 3A3OB 2J8AA 3AY0A 1FFGB 1MROA 3FBEA 3MM6A 4LBPA 2V94A 3MPWA 4JYAF 1RU2A 2MB0B 1UZHA 4URSA 1ULRA 4NA2A 2FDNA 1FJGF 5MAOA 2YX7A 3MUVP 3VR1A 2MKYA 4AQYJ 5HJYA 4HTJA 3ZZZA 3OL9A 2VASA 5CZVA 2OTLS 4CTAA 4DR7J 1DQAA 3BSCA 3QZ8A 3OVSA 4YHHJ 3CJQA 2XSJB 3GFHA 3IRXB 1UMJA 2GVDB 5IQ6A 1DHMA 2LU1A 2ALZA 2G0CA 4IKAA 2JLGA 1JXVA 2H3EB 4JV0A 3I0SA 4MYTA 4HLBA 4Q0BB 2V0NA 1R8BA 3EWGA 2IPOB 2J7UA 3HHLB 2XZTB 5IS2A 4A4JA 3MPUB 4JV1A 2EK1A 1MLAA 2KO1A 2RKIB 5A2QY 2M3DA 1LXJA 3VQSA 1HIYA 3NXZA 4HDGA 2MY8A 4CT9A 1T9XA 5J2PB 3ET6A 5DDRC 1Y3JA 4DL5A 3M9OB 3R9LA 4IFYB 5DG9A 1N34J 2G2OA 4NLYA 4I2PB 3K2YA 1UWAA 5K8PA 2F40A 1VDHA 2UVWA 4B17A 2IY5B 2NXEA 3G6YA 2Q66A 2RIJA 1SC3B 1VC0A 2CFXA 2XZWA 4XPEA 1IN0A 1NJZA 2Z2LA 4FZVA 5LT5A 1K1SA 4M5HA 2I5JA 2D3UA 3HKZD 2ZWOA 4OMFG 4H4MA 4A46A 1PBUA 2AX0A 3AJDA 3H20A 4WU2A 1BQNB 1RACB 3OL8A 3ADAC 4RUHA 2AD9A 3HHLD 1N5TA 3EZUA 5GADU 4YR2A 1S97A 4I6AA 3HF5A 3NOGA 2NYHA 1E6YA 2CZ4A 3D9BA 2HYIB 2H54B 4X65F 3R2CJ 3MEGA 1SUQA 3KJNB 4IOCQ 4Q8EA 2OMOA 3OSPA 4KTQA 1A6LA 2DXFA 1OO0B 4WK1A 4YDDB 3UPFA 1P1TA 4FS1A 1PYSB 5CAAA 3MFIA 4MMOA 3SQGA 5CA5A 4Q45A 4NASA 3OTOF 2NXCA 5A8WB 1VCTA 4DWIA 1RWKB 1UZDA 4K5SA 3R1HA 2HVEA 4UOHA 1S1XB 2ZD1A 3DLGA 3HX9A 2RS2A 4JI7F 2UXCJ 4B9VA 1OQ3A 1X9SA 2PN6A 4R0JA 3OL7A 3U1LA 3DMJB 4DCPB 1CJVB 1K8AT 1HNIA 1JKHA 1M1GA 1Q7YT 2CZ9A 1PGZA 2WSCC 4F25A 4FF1A 2PMWA 3HSDA 5JVHQ 3M8SA 1VQ6S 3CC2S 3KKFA 1C1CB 3BDEA 4B9TA 4WYLA 1N56A 2DPIA 3KLVA 4IQXA 2XYPB 4AD6A 2VOPA 4MKYA 1HD0A 1MROB 1WACA 3MM6B 4FVCA 4DR6J 2M0GB 5ETLA 3OVBA 5F8HA 3KYLA 2C3YA 4K8RA 1B7FA 2GCFA 2BM0A 4OZ2A 3R8YA 2ZC4A 3SQOP 3KUHA 3HSJA 4ZLNA 3FCHA 3G8QA 2BZ2A 4Y6IA 2R2TA 2HIQA 3IFEA 2RHSB 4CTAB 2CNNB 5KT3A 3CCLS 4BBYA 2CUYA 1HNVA 4AQYF 3CJRA 1RAOA 4DR7F 2QFIA 3LGNA 1PJ5A 1HW9A 5KFHA 3ZXWA 3CMES 2OP5A 5EX0A 2LKZA 3QZ7A 1S6QA 3I0SB 2ZH7A 3T6BA 1J5EF 1FO1A 4X4NA 4OYIA 3GB0A 2XLJA 3GIRA 1Y3KA 2MDAA 4CZCA 2OJ3A 2W7OA 4JI2J 3TEGA 4RJVA 4U96A 3ET6B 2W2OP 1WC6A 3BSAA 4KSEB 2HNZB 2LEPA 3CCSS 3G4SS 4X64J 3CMAS 1VLOA 2QSFA 3HVAA 1SJ1A 2DGOA 4TLQA 4QR0A 4ZLLA 5KFDA 2B51A 3S1TA 1PG5B 2P9GA 1WC3A 3MR7A 1FXLA 4TYAA 1NKBA 2ILZA 5KG3A 1RHUB 3SCKE 1KR4A 3SSSA 4PQUA 1F9FA 2VZ9A 3GQCA 3QGPA 2Y8WA 3THPA 3CIMA 3HT3A 5EWGA 4UF4A 3MUTP 4H4MB 4USKA 4OZJA 4QIWD 2D1CA 3NCQA 3PCOB 4JI0F 1X5SA 4FPRA 5B0AA 5IT0A 2IRYA 1G6BA 2CDRB 3J7A1 2VQFJ 4F2SA 4RW7A 2PO4A 4USTA 4LBIA 5L1IA 1VHIA 4PYDA 2XMKA 4EMDA 4U8YA 2E7VA 3LF0A 1R3NA 4ERDA 2FVQA 1QDUB 2CNKB 1E6YB 5F9NA 1IKWB 4ALZA 4JB8B 3MI7X 3FBBA 1S48A 4N77A 1SJFA 1ZOTA 3MEGB 1SUQB 1QAYA 3OFFA 1NKCA 1ITPA 2RQKA 3LP0A 1UKUA 1FWPA 4DV5F 4U95A 3LGHA 1PO6A 3ONQA 1Y4ZB 4P7TA 1RTDA 1LW2A 2Z56B 2XMJA 3BYPA 4NWBA 1S9FA 2WOMA 2HVHA 5LOQA 1B7YB 2MHNA 2ZD1B 3LQVA 3DLGB 3X1LB 3PRVA 3FMWA 2JZ5A 1LWFA 2AJ0A 3FJ2A 3IG1A 8RUCA 4J9VA 2VODA 2CPJA 3PTWA 1UEVA 3F0NA 2LP4A 1HNIB 3X3UA 1JKHB 4YS2A 3A8EA 4DQQA 2F4VF 2EVZA 2XQCA 4F3OA 4LF6J 3FKBA 1UFWA 2QA4S 4LR8A 5KFCA 2DR9A 1WOSA 2IRUA 1X4DA 2LLZA 4F67A 2MKSA 3WDOA 4OJ3A 1K0TA 1D9AA 4C8ZA 1F2GA 2VL1A 3C46A 3CO9A 3RZAA 4FXVA 2MQLA 3V81A 2DO0A 4LFBJ 1TL4A 2JFKA 2ROEA 4EI2A 1BD6A 2JC0A 4ZLPA 1FTCA 2G0IA 4TNOA 3M6VA 2FQQB 2AJ1A 2E66A 1KC8T 3CD6S 2W4DA 1RT1A 5M2PA 2CJBA 2M8HA 2DR6A 3GR1A 2HBQB 4ZCMA 1U24A 4KPCA 3W65A 4Y00A 5J1NA 1YRUA 1PC4A 1RKIA 4K59A 3HPOA 4WKRA 3FSXA 5DO2A 2CPDA 3PW2A 3FDSA 4KE5A 4JP8A 2BV3A 3C14A 1MWYA 2GQQA 4DFKA 3TUZC 1EETA 2RU9A 1U2FA 1F5AA 4YB6A 3NCRA 2VU5A 4EBCA 2NSCA 2V5HG 1ZPVA 1YRTA 1TK0A 2CPFA 4ZCIA 3LGMA 4BC7A 1G4CA 1KQFB 4JI2F 2MGZA 4IRCA 2DNLA 4LF2A 2PEHA 2FGOA 3HLUA 3BR9A 2HQDA 2C1EB 4JI3J 4PXCA 1S0NA 1SL1A 4WXOA 1U1MA 3UN5A 4X64F 3ENWA 3DLJA 2B4PA 4RNOA 2OGUA 2CQ0A 3G6VA 2NCKL 4DLGA 2I0XA 4F2RA 4OQJA 2IMOA 1ZBTA 2LXUA 3BJYA 1JLBA 1FWLA 1ZTTA 2BKOA 4DJBA 2EFVA 4HYKA 4RW7B 2OKQA 4I67A 2X51A 3MMJA 1AYEA 2B43A 3ZTOA 2XMAA 3D3CJ 3O3LA 3KLEA 3T1YF 4ZVHA 2JC1A 2IYIA 5GMKa 4Q2MA 3LP0B 4ZJOA 4C11A 4ZVTB 2DR7A 1WKJA 3TP2A 3T1HJ 3SI8A 4OHYA 5HLFA 1IBKF 2WVCA 1SL2A 1RTDB 3B54A 4UOCA 1Y7PA 3K57A 2CWKA 2WOMB 1X0PA 3GG0A 1N5YB 4NLXA 3VV2B 4LF9J 2F9DA 4FYVB 2XMUA 1N6QA 1DQ9A 3LAKA 1LWFB 4ZA1A 3KDOA 2AQ4A 1HD1A 1AUDA 3IG1B 4DR2J 2R3VA 3V6HA 1HQUA 3R1LA 2E5IA 3NGUA 4KHMA 4DL0C 4C8KA 3PYEA 5KFPA 2Z58B 3MXHP 4Y28C 3P4UB 4U6PA 3VGUA 2IBKA 4ZVUB 3JXOA 4WIIA 1HFEL 4RBVA 4DL7A 2KVQE 2KTQA 3TJAA 4USIA 2P6SA 2QT7A 2JSXA 3ZNJ1 4BCAA 1X4FA 2IRXA 4LF6F 3VQTA 3AD9C 3H59A 1X4BA 1DTQB 3QATA 2FGCA 4DF4A 1OIAA 1YX2A 4DQIA 1SKSA 1XNRF 1HLWA 1TUWA 3EZOA 1RWMB 5ETQA 3TZXA 2XNRA 2B5JB 3NNAA 4ZPVR 5DRKA 2MZQA 2Y8YA 1YGYA 4DV2F 3H98A 3IN5A 4KHPJ 3BSNA 4LFBF 1RT1B 3W9IA 4NYPA 4HHHA 1KVJA 2RF2A 3H8YA 4ECQA 3BGLA 2RNEA 2Y1IA 4ED7A 1F5BA 3IBWA 2XYGB 4NLSA 3V2UC 1QSLA 3OR1B 3D66A 1B3TA 4LF5J 4FF2A 5F3ZA 3HULA 3T41A 1EIYB 3I82A 3HHLC 5K20B 2KYZA 3RB3A 2HGMA 3LA0A 1GFWB 4V19J 1EX8A 2DNHA 2HWHA 5IWAJ 3CF5Q 2O3DA 4B08A 2J6UA 4EUVA 1SC1B 1SQGA 2ZH5A 1PAEX 1KN6A 2ASLA 2DNGA 4ZN1A 2ZOGA 2R8KA 1I3OB 5C25A 2O67A 2DNQA 1NK6A 3WX4A 4ES3A 4Z2XA 2RDJA 3P3DA 2GJ2A 2HFSA 2JEJA 2MGZB 3GIKA 2FZKB 1DTTA 2MQPA 3KOAA 2HFZA 2VJUA 2HZAA 1QAIA 4Z37A 1GXTA 1RE1B 3TRGA 2RQMA 5CZXA 2XM3A 3HVRA 1QTNB 3RRKA 3M8RA 4A8QA 1HA1A 2E29A 4CO0A 4NLUA 3TZYA 2HQFA 1F3VA 2WONA 3HM9A 3DRRB 2RRAA 3W60A 1NB2A 2MQQA 2BJ7A 1JLBB 2ZH3A 3DXBA 1T0TV 2Y1RI 1RXOB 5LSLA 3LP2A 3BQ0A 2W9AA 5DQIA 1UL3A 1IR2A 2ABYA 4YR0A 2BRKA 3KLEB 4QWBA 2ZJRQ 4W98A 1OPZA 3FEZA 2B8QA 4NYOA 4RNNA 3M2VB 2QA1A 5D0HA 4C11B 3JAMY 4DL3A 5EWEA 3V6DA 3FGVA 2YWGA 2BR0A 1EQMA 5KG2A 1YVFA 3QBCA 3M8YA 5T14A 1W26A 2RHQB 2C28A 1D0EA 2YH0A 4O3RA 1NCLA 1N6QB 4PXEA 1VJQA 3EXCX 2YNHB 4F36A 4JOUA 3V4IA 1HQUB 3ZZPA 2CQ2A 2BJEA 3I6PA 3UDVA 3LPEA 3HSZA 4YMEA 3RW7A 2R2UA 2EEYA 3V6JA 2YPZA 1FRKA 3C3LA 4WK3A 2YXLA 3CC4S 2PA8D 1V3ZA 4V1Ak 3PW5A 1SKWA 2FUG9 2NS1B 3NG8A 5E3PA 1IKXA 2HS3A 1OSDA 5BYRA 4Y2IA 3AJ2A 1B0VA 3L9ZA 4FXWA 2CPXA 5ETOA 3U27A 1U4BA 1U2CA 5B7WA 3O8WA 2B7BB 4NEYA 3UCUP 3TVKA 3J81U 3LWMA 4WFBQ 4ECSA 1J27A 3C19A 4CM2A 1WOOA 3M8PA 4PXBA 3DOMA 3DLHA 1RHRB 1RTIA 1D8ZA 2LMIA 3PX4A 3K8WA 2FYXA 3Q2TC 4B9LA 1EKRA 1SH0A 1WJ9A 3TAPA 2UUBJ 1S12A 1IR1A 4DR4F 2MSSA 1C1BA 2VF3A 5CQGA 1HMVB 4DV7F 2RF2B 3FUYA 3PIOQ 3DHXA 3AT1B 6FDRA 4CLZA 4KAIA 4NA1A 1NLKL 2I8EA 3MHYA 1S4EA 4H54A 5KFUA 4LF4J 3DOLA 1DAXA 2X1GA 5D0RA 2R4FA 1JLGA 2AEMA 4N56A 2ZE2A 2UP1A 4BWMA 2LA4A 4CQ1A 1QY7A 5BR8J 2J7KA 4Y2AA 4L75A 4K4TA 2H5IB 2XC9A 2IVYA 1FWKA 2J0XA 1NHUA 5C25B 5IWAF 3J7YI 4JI4J 1N32F 3NP5A 2YKMA 2VJVA 1NJXA 1AROP 3SFGA 1U1RA 2ZUAA 3L7OA 1R89A 4KRWA 1H7WA 3EE3A 3AHPA 4C2MA 4DQRA 3PJ9A 2WONB 4LMZA 2AWZA 3QLHA 3HXMA 2XBPA 2XTJP 1KFDA 3BB5A 2D3OR 4F50A 5KFJA 1EARA 2BJ8A 2HAIA 4N47A 4X4UA 3KWMA 2LA6A 1O8BA 2ZHBA 2JDJA 2GS8A 3LP2B 4WFAQ 3TUJC 5LL6d 4P71A 3CJSA 3BO3A 3EMTA 2AYEA 3PM9A 5JUMA 4F0KA 2IYGA 3ZFVA 3F56A 2CQ1A 1HPZA 3B82A 4FKYA 2RB7A 5C5JA 2GHWA 3V6DB 4QU6A 2E9ZA 2W2PP 3SZ2A 3PFOA 1YQHA 1KLMB 5C2CA 2ADBA 4NOHA 2P9CA 4TQSA 4OX8A 1TVRA 3HHEA 4DQSA 1TMJA 3RB4A 2FHJA 5I3QA 3V4IB 4NLRA 3UNGC 2RE1A 1VGYA 1TKTB 2BA9A 1KOHA 2XO7A 1YK9A 1EHWA 4RWWA 4M5NA 3MD1A 4F3QA 4ZVFA 3KTQA 2MSTA 3FRZA 4DV4J 1IKXB 1YKWA 3D2WA 4KR0B 2RD5C 4RR5A 5IZHA 4FS2A 3HFZB 1M5HA 5DJBA 5HK4A 1QSYA 2H1YA 2UXBF 3G96A 2DGVA 1NO8A 4KGZB 2E9RX 4IFVA 2FLPA 2YWHA 5LJ5Y 2W9CA 2K8GA 4OFZA 4Y65A 3M8PB 3R5CA 1GNKA 1RWVB 3T6JA 3W9JA 4Y2KA 1RAJA 3ILJA 1U1NA 1RTIB 2C42A 3HJFA 2NXJA 1IQTA 2HHHJ 2VFRA 4TY9A 1U1OA 4O3PA 1UJ6A 1GTHA 4OZ5A 2C3OA 3SYZA 2IA0A 2K06A 2E1AA 4MIBA 3GIMA 4DS5A 2IM0A 3HVTA 3NS7B 5LSRA 1BHNA 2RUSA 1FNXH 5L1KA 1CLFA 3HHKA 1C1BB 2VFVA 1FEEA 2GHVC 1OY6A 3N9UC 4KJIA 1N52B 5DQGA 2L08A 5G4DA 1WF1A 2L9WA 4LVOP 2XHCA 2UUBF 2BRLA 2WBMA 4K4UA 3DOLB 1JQGA 5K9FA 3CVKA 4UUWA 2Y1LB 1TL3A 1JLGB 1SXLA 2OPRA 3W2WA 4W90B 3FMBA 3CSKA 3KHGA 1I94J 5BR8F 5KFMA 2RAQA 4ILLA 3CB4A 1RYRA 2HNYA 3H0PA 1A7GE 3ZZ0A 2YKMB 3QYYA 1WHVA 3EZ5A 3LP1A 3TAQA 1HL6A 1I5OB 3CCTA 1KP6A 1YDLA 3QRPA 4JI4F 2R8GA 1ZA2B 2WK4A 1RWPB 1S72S 4NMLA 2UVUA 4DUYJ 2P6TA 3UDLA 1EJ7L 1U25A 2R7XA 5ITHA 1TL7A 1KFSA 4YP3A 1K47A 2VG5A 2PMZD 2VIHA 3ZO7A 2YX4A 2NUHA 2PGCA 1WOPA 3JTPA 2DCUB 1KEKA 2IM2A 2QMXA 2N4DA 5D15A 1NPRA 4JI5J 2Z57B 1ZA1B 1UCNA 1FJEB 3DC2A 1N88A 1KQKA 4DUTA 4DCOB 4RWXA 3W8GA 2FJBB 3PYGA 3CTRA 3L3CA 5LMUJ 4USHA 1LFPA 2ASYA 2YH1A 3ETMA 2AZ3A 3GONA 4G3IA 5B0DA 1TVRB 1GXUA 3QRQA 1Y5NB 2EW9A 1N5QA 4DN9A 1RWXB 2IDEA 1XK8A 2MZJA 1U47A 2GNKA 3GCXP 5RUBA 1IKYB 4A8FA 3KK1A 4LF7J 4RU2A 2Y0SD 1G7CB 2CQDA 4OI2A 3DN9A 2B7CB 3DDKA 3OTCA 3WC0A 4J9RA 3OSNA 5JVGQ 2HHPA 4HL9A 3SSRA 4ANCA 1REGX 1NK9A 4QOTA 1TP7A 5KG0A 2ATLA 1FXDA 3AOBA 2GX8A 3G8SA 4P2XA 3M9NB 3H2UB 3MMBA 1ZTWA 4WU3A 4OYOA 4OV6A 3SEOA 5EGYA 4IFVB 1SH3A 2W9CB 5A6PA 4J91A 2RT3A 1RISA 4DSJA 3IP0A 3ELHA 5KT7A 3CPWR 2H5EA 4DL2A 2AJ4A 2YWEA 3RBZA 4U7UK 2YY3A 2HZCA 2QGFB 1HWJA 2HZVA 2G1DA 3HVTB 3TX0A 1Q86T 1GMWD 1FDNA 1FD2A 5KFVA 4YFUA 2HVZA 4ENOA 1APSA 4K2JA 2W01A 4V19X 2HKEA 2J6SA 3R7NB 3LALA 2CQGA 5CCLA 4B3SJ 4PG5A 5HI7A 1VLYA 1TL3B 1ZAWA 2JHEA 3NMAA 1H6KX 2ZVIA 4DSLA 4KO0A 5BYQA 2QFJA 2XI3A 2OPRB 3W2WB 2MLYA 3LANA 3GFYA 3K5LA 1XMOJ 1VRUA 4ED2A 2R8HA 3GJQB 4J90A 1AUSL 2XNQA 3Q8RB 4HH1A 1WORA 3OR2A 4RPFA 3M8WA 3UN3A 1P6TA 3ITHA 3ICLA 4QR1A 2IFXA 1SCJB 2JJ4D 4CNYA 3MM9B 2HNYB 3KHHA 2GIQA 5F9LA 1VIOA 1EP4A 3LP1B 5KT5A 3QNWB 4KGXB 1I94F 3ENVA 1N36F 3SCLE 2JH3A 1T9YA 5G0RA 4IR1A 1R8CA 3QSYB 5HROA 5E3AA 4DU8A 2DKOB 2QZ8A 5U47A 1TL7B 1RBLA 1FJ7A 2VG5B 4DL6A 4MK7A 2YKOA 4HDHA 2AGPA 1SJ3P 2C2NA 1NSKL 4DUYF 3TANA 1NUEA 3BH6B 3BQ2A 4I2QB 1DZ5A 1VQ8S 3AQPA 4M5JA 2DY9A 2GW8A 5L1LA 2JLFA 4LSNA 3W9HA 5KFBA 3HT0A 1RT2A 3QWUA 1H38A 1FT8A 2XS7A 2DHAA 2AZ1A 2O66A 2YQ1A 2HLUA 5J1EB 1GK8A 2BW2A 4ELTA 2HNDA 5D4LA 1ZH5A 3KXDA 1X4GA 3PY8A 3PHTA 5DDQC 3Q86A 3O6QA 3MOJB 1R8AA 5DQHA 1FJCA 4RUBA 2XULA 2GQ2A 4ITSA 2QLXA 1VQNS 1M5SA 3TZWA 2QN6B 2K2PA 4DFPA 4HACA 1PYTA 1KONA 4DPOA 1YJRA 1S49A 2PIIA 3ZZUA 4M5IA 1S6PB 2FLNA 2YVSA 2C3MA 1XNQF 2ZZNA 4LR7A 3HJVA 1WHWA 4ZVRB 3VAKA 5KT2A 4UY85 4DR1J 4LF7F 2YX1A 3CJKA 4X62J 1RLCL 2HGLA 1TL5A 4G65A 3NLCA 1G1XA 4NZ0A 3RUBL 2IC3A 4NRUA 3MR3A 2X1BA 3R5DA 1U0HA 3TI0A 1FEHA 2JVOA 3QSIA 4RW6A 4NLGA 3R5BA 2E1RA 2EFNA 2QLWA 1UVIA 4DX8H 5CCMA 2BXJA 4PPDA 3U1MA 1KNZA 2E44A 4CLPA 3PYFA 4MH8A 3TWZA 2V8HA 1SVDA 2KXNB 4USVA 1FE0A 4IG3A 1S9GA 5AXMA 3EGNA 1RWNB 4WE1A 5GAEI 4PQAA 1ICEB 1FVQA 4P10A 2XB2D 5AXNA 3DDNA 3ENAA 4ZPCA 1JWWA 2KG0A 3W8PA 1AA1B 2J76E 5IT9Y 3SFUA 1N8RT 2AV5A 3SDEA 2MQMA 3OHBA 2VG7A 2OEJA 2HW3A 3A8IA 3BV8A 2WSEC 4XTTA 4AFFA 1VRTA 2HQIA 2GO9A 2F7VA 1VRUB 4BS2A 3PEHA 5IOLA 2XLIA 4B3SF 1F6TA 3OR2B 3HVWA 4JV2A 1CQMA 4PPZA 3AA8A 1R0BG 1XEZA 1EP4B 1X5PA 2ERRA 1NZAA 2W25A 5KFFA 3MCSA 2KT5A 3DM2A 1YBAA 4OYAA 4UZCA 3N79A 2A2DA 3KJQB 5G0RB 2YBVA 3TO8A 4QZVB 4YY3F 2FZCB 3VGVA 5HROB 4HI1A 4HI2A 2AEFA 2V4JA 2Q6BA 1HNZJ 3FVYA 4A47A 1GH8A 4QJVA 4GMKA 1M1KT 4HEA9 1WTBA 4OX9J 1LK7A 2QYGA 2J9CA 3NAIA 1W2IA 4WZMA 1XR5A 2JEFA 4CLSA 2BUNA 1REVA 5J1PA 4DHVA 5E7OB 1P1LA 1YJUA 2ZBRA 2MKIA 4DX7A 1BXNA 2Z2YB 1SBRA 5L39A 2P2CB 1U49A 2I6WA 5C42A 1JJCB 2R2RA 3M6WA 5CD4H 2DR8A 2VKRA 2ZHOA 3I0RA 3G2XA 2HFNA 4CIOA 2MZ1A 3B6BA 5D4OA 4ZLJA 4Q8FA 1IVZA 4S0MA 1RA7A 1T8EA 4PG6A 4H4OA 2QX0A 4OZNA 2EXUA 2H48B 3BREA 4CP5A 2BDPA 1Z4UA 3AAWB 4C0OC 4HACB 2J7WA 1PJ6A 4RBUA 1D9FA 1GX6A 4Q43A 3DRSA 2EI5A 3OV7A 1GAOA 5CH7B 2N7YA 2M5YA 2V8PA 4OX6A 1IBLJ 2ZC3A 1SJRA 4QIGA 2NR0A 1HBMA 4OZLA 1L3TA 1NB7A 5ETVA 4RW4B 4K4WA 4DFMA 3M6UA 4YQWA 3TA2A 4UZBA 5I3PA 1FXRA 1O5JA 3IS9A 2CADA 4DR1F 3WHIA 1VQYA 1HYSA 1WC0A 1F5CA 3TOQA 3AD8C 3TYTA 2HBYB 4F7VA 3H90A 3ZZTA 2JL9A 4J9SA 4WP9A 2ZJQQ 4BDPA 2NXUA 3RTVA 1Y10A 4RW6B 2CYYA 2E9TA 4X4OA 2DGUA 2XY7A 4J37A 1CQNA 2XG8A 2GVDA 3QAUA 4IG3B 4X66J 1VK8A 3G71S 1BUXA 1S9GB 1UETA 4WE1B 5GAHI 2Q1LA 2QC3A 1UPPA 1HBUA 4ZVSB 4LJMA 2ZM6F 1S57A 1JK9B 3CT9A 4OL8A 5F8JA 3VAMA 1BQXA 2VG7B 1VQKS 2NREA 2RKIA 3CCQS 3KK2A 5ETPA 2FC9A 4IDKA 3H2LA 3W64A 4YB5A 3GFZA 2CAJA 2VD3A 4MK9A 4PKDB 1X5OA 4QYRA 3U1NA 2FLLA 4A8WA 4DXLA 3VGTA 5DGAA 1TQLA 1KKHA 1JLCA 4ZKAA 2ZWPA 4F4ZA 2FVSA 4ED5A 4ID8A 4LF8F 1RT3A 4OJHA 2HLTA 1FTRA 3PKYA 1A9NB 3DM2B 4DS4A 4ZCLA 3J80U 2NUUG 3PX6A 1X60A 5M2RA 4QIVA 2XS5A 4TU8A 1SV5A 1YITS 3ZZYA 2WVBA 3SV3A 2BQUA 1JLFB 4NCGA 2V4JB 3NL0A 1X7VA 2FY1A 1NPKA 3IR5B 3CNQP 2YNFA 4OI0A 4MTPA 2CNOB 1MN7A 1SKUB 2RDIA 5H9EK 5KT6A 2EC0A 2LQ8A 2MKHA 3CDAA 1UJ4A 1RAHB 4CT8A 5C2GA 4ZVEA 5IQQA 2A18A 3BQ1A 4LIRA 4WFXA 2YKQA 1U45A 4DI6A 3I0RB 1VC5A 1X4EA 2ZJPQ 2LXFA 3BSOA 3K17A 4B9NA 3EDRB 4IQMA 1T95A 3CDBA 4LFCJ 3P5BP 4XIUA 3AOCA 1FVSA 4OLOA 1KVIA 2DGXA 5SUHA 4HTIA 3PNIA 2MMYA 1RA6A 3DHWC 2VQEJ 5ETSA 3W3SA 1FDAA 4JBCA 3DMJA 3NRBA 3MDFA 3G86A 3PG9A 1HHSA 3C8YA 3NS6A 4GKKF 3DRSB 1OY9A 1SJQA 3QT8A 2HRYA 1IR0A 5F8MA 4USMA 4O3NA 1T9TA 2BJ3A 2L41A 4O23A 1D1UA 1HBMB 3VALA 5CYQB 1IUJA 1P9YA 2JNJA 4DV1J 2NLWA 4I0WA 1LQ9A 4J9NA 1V3RA 2E1CA 2R7VA 3IS9B 3LWLA 1HYSB 1M5VC 4C8LA 1IQZA 4WYWA 2CWXA 3BGRA 1FE4A 4QPXA 4KQZA 1WC1A 1RI7A 1IWAA 4FF4A 4O3SA 2FVCA 1NJYA 3JSBA 1M90T 4BHQA 2MLZA 2GV1A 4KT0C 2AF6A 5ETKA 2BJDA 1AT1B 2HMIA 3NNCA 1HBUB 4X4VA 3D67A 3LTOA 3TNVA 3RGIA 4EYHB 2M9KA 5DDOC 3TUIC 1B99A 3G6ES 3KK2B 4IDKB 1JJ2R 3I32A 3BGUA 5J2MA 1NK8A 2IVFB 3R27A 1RHQB 5ETNA 4J7CA 3UR0A 1ZZFA 2HNZA 1XWLA 2UUAF 3FK4A 4IO9Q 1B0TA 3SIPB 1JLCB 1WG5A 2EPIA 4OX7A 1RWWB 2J9DA 1NEEA 2LEAA 5IT4A 1UVLA 3CW2C 4A8MP 1UJ5A 2HFVA 4B9UA 1F0XA 3OW2R 4B3MJ 5KFNA 1RT3B 1WDTA 2MJUA 2J9EA 3Q22A 3MAAA 1HI8A 4QW8A 2JVRA 4R0EA 1TAUA 3I5CA 4ED0A 1SV5B 4F3MA 4Q44A 4GKJF 2IIHA 4NCGB 4OHVA 2KFYA 1JMTA 2EG1A 4LFAJ 1H0HB 5IV4A 3M30B 1Y11A 2YNFB 4NZ7A 1T3OA 4CO4A 2CVEA 2G0JA 2NPIA 2W2QP 4UTGA 3MR5A 3I31A 2GQCA 3CDUA 2IJNA 4P73A 1CJUA 3FCWA 1YJNS 3E2EA 1T02A 1IKWA 4DV6J 3IGVA 4ER8A 3DLKB 3TUPA 2XY6A 4K50A 2DRDA 2IHR1 4FYXB 1LK5A 3A8JA 1FKAF 4MYUA 4EFAC 4M94A 5HBMA 2P9EA 1ZM3A 3RU0A 1TV6B 3IWXA 5CHCB 2DXDA 3MECA 3B4DA 3LPYA 3EGZA 4QW9A 5I42A 3JQKA 4DX6A 1RK8A 3BYRA 1O0PA 2M88A 3G87A 4KH1B 4J9LA 4I6YA 3FSIA 5HP1A 3EVMA 2ROGA 1FDBA 5D77A 3CD5A 3FQLA 5ETRA 5CYJA 4MFBB 4LFCF 2AGOA 1S1UA 1SQFA 1NHVA 4NMXA 2Q6CA 3QFHA 1BGXT 5SZTA 2ZEJA 2FHKA 1VOMA 3CCRS 2W8LA 1K0VA 4OYBA 3N01A 3ZTRA 3QPIA 2UUCJ 3PV8A 4GC7A 2DGWA 4A8OA 4FPIA 3QJJA 2B4VA 2LQ5A 5B0CA 1Y5IB 3OFHA 3OXLA 2DNOA 4M8LA 4GO7X 3PW7A 3D0HE 4IH6A 3BS9A 2V8VA 4O3QA 5C7PA 1QAXA 3BGRB 5M2UA 3VAHA 1TAQA 5GMEA 2FJAB 3QIDA 2QIFA 5KG5A 3NEKA 4PUOA 3Q23A 2XCAA 4HHJA 1CSJA 1TUGB 2DCLA 2UUWA 4YHHF 4MKVA 5KFQA 2HMIB 4OI6A 1GMUA 2RU3A 4M5GA 3GMGA 5F8NA 4DPWA 3OXGA 3AOAA 3VWSA 1TFWA 3SMZA 4A48A 1S1VA 2XEXA 1KOOA 4DL4A 2BACA 4LR9A 1LNQA 2WB4A 4I69A 5J2MB 3UD5A 2CKWA 3MD3A 4WPAA 1MMNA 2Q79A 1AFJA 2ALYB 1EKSA 4ECTA 2M8DB 2Y9HA 5KFTA 1FKOA 1PIEA 1U1QA 2J9DE 2DHXA 4E98A 5L1JA 1I6JA 1ROFA 2LEBA 1PYOB 1N34F 3MAAB 2GMHA 2XHWA 3O2IA 1Z2ZA 4HT5A 2XSFA 1WD6A 1DY3A 1FFWB 1ZPWX 4B3MF 1ZM9A 2L48A 3T5LA 2AKWB 3MAHA 3RBEA 4Y34A 2BE7D 1UTAA 2XMMA 2VB6A 3L95X 2WVFA 3CCZA 3I96A 2D9OA 3U02A 2ZBIA 1CJUB 1YI2S 4LF1A 4LFAF 1RT7A 3H4DA 3ZZOA 3A4TA 1SB6A 4P6QA 4XK8C 2C2DA 4KC5A 2NZCA 4LQ9A 1L3UA 2V4RA 5HBMB 4TU7A 3L7PA 5KFRA 2HFUA 2HK2A 1S99A 3MECB 4ZITA 1IBMJ 2XCPA 1ZM2A 4OLPA 2POKA 2CJYB 6FD1A 3EJMA 5I42B 2XMWA 2CXEA 4I7FA 3N28A 2MY7A 1H3DA 2RSQA 1N5YA 1S59A 4ZP8A 3CCUS 3DCAA 1HWKA 4NA3A 3BZQA 5HP1B 4X4RA 4LREA 5AE2A 4DEZA 2CPZA 2ZVSA 3QWPA 1S1UB 2A0FB 1Q8IA 3K5PA 4O0NA 4YOEA 4QIFA 2UXCF 2GFFA 3R5GA 4J9UE 2Z30B 4OYZA 3GCWP 2BQ3A 4C8OA 2A6MA 2NYIA 1S5ZA 5CD4A 2ZZTA 3G9CA 3KK3A 1YBTA 1Y00A 2MPUA 4FKXA 3D3BJ 3GV7B 4WP3A 5GAEU 1SQEA 4J9MA 2XZDB 1AZSA 2QMUB 2ASJA 3PFEA 1X5TA 2COLA 1DTQA 2R42A 3KJVA 4KGVB 4KY3A 2VICA 5HMYA 3PEJA 2UUCF 1WEZA 2AU0A 1G2EA 4DR6F 1FI4A 2HHUA 2RMLA 2F3JA 2B5JA 4PXDA 3KJFB 3V5RA 3CC7S 1MWQA 4JI8J 2IJRA 1GMVA 4ZPWR 4JUZA 4NLTA 4N5SA 3G6XA 2YKPA 4PUOB 4PWDA 3P8BB 4C8YA 2PD1A 3I9V9 3UE2A 5AE3A 1H72C 5MLCV 1D9DA 1S9EA 2DH7A 1YJ9S 3M4XA 1NDKA 4QR2A 2F8MA 3QT6A 1Z2LA 2ACMA 2I9SA 4DR5J 3TVZA 3MFHA 3KLGB 2B3TB 4NI2B 3OR1A 2YQ3A 5D3GA 5KAKA 3MMCA 4IYQA 4WIQA 2BE2A 1S1VB 2ZFHA 1U26A 2D3O1 3KHRA 2BX6A 3C6TA 1B4SA 3KDNA 4ZN3A 1RB0A 1KQGB 1N33J 3NCPA 1K1QA 4NCAA 4J9KA 4B9SA 1JLAA 3I4PA 4ZPAA 1X9WA 2KVIA 1RUSA 8AT1B 1FKOB 3IXQA 3QQCD 2OPSA 4EU0A 3BKFA 5E5NA 1U1KA 4JYAJ 4O3OA 5DM7Q 4PAAA 4YB7A 3CCMS 1CG2A 4IUFA 1FJGJ 3DRRA 2F63A 3DYAA 3U7JA 3EYZA 2OSRA 4LIWA 4M63A 2DNZA 1UVMA 4EEYA 2DNRA 3S6EA 1RJJA 2CG4A 2W1BA 4CYUA 5DLFA 1CEZA 3ILOA 3CUNA 1TKZA 3EPGA 2DYAA 1RT7B 4PEOA 3AH6A 2B6AA 2VQFF 3GWCA 3THVA 2ZDPA 3M2VA 2JEIA 3CE8A 2PFFB 5FJ4A 2GJFA 4FBUA 3R3TA 3QGGA 4NZ6A 2VBZA 1S0VA 4Q7AA 2OO4A 3I5BA 4I4BA 4I7FB 3GJTB 2LDYA 4W4MA 1QLNA 2C2OB 5KOWA 1IBMF 2RVJA 2GO8A 5EWFA 4K4XA 2YNHA 3VHQA 2GMJA 2WTFA 3THTA 2DGQA 4CLWA 2EFQA 2MQ8A 3R97A 2W2NP 3LH2S 1S7HA 2XLKA 2RUGA 2KZZA 1BQMA 3PW0A 2R7UA 1YBUA 2BBEA 4I68A 5KFZA 2Z0GA 2DT9A 1WSVA 1WG4A 5I3UB 1OJ4A 4RW9A 4R8UA 3PRDA 2DBBA 3KLIB 2NQPA 2APOA 3AJ1A 3KK3B 2AMCB 1NK4A 3Q89A 3NGSA 3NWGA 4JI1J 4DV0J 2PT0A 3IM8A 5LJ3Y 2K3IA 2RILA 5E3CA 5GAHU 1AZSB 4O0IA 5H9EJ 1CBKA 2CQ4A 3MEDA 2H4WB 3KJVB 2C2KB 4P2MA 2LVWA 2NXNA 4GVBA 3T5JA 1K73T 1IJFB 4ZJLA 2W7AA 2V9KA 1Q16B 5LXRA 1HARA 2X1FA 4CO1A 3ZTPA 4G6VB 1UAWA 3CCVS 1NU4A 2EBEA 2KT3A 3EXYA 3TJ9A 3FBCA 2WRMA 1L3KA 4QU7A 3VZHA 4ETXA 4PWDB 3UQSA 4TY8A 2KFNA 1HMVA 1RT4A 4QYZK 4NEZA 4ZHRA 3A8KA 1S9EB 1UWBA 2NPFA 4ZPBA 2AJFE 3EGWB 3B4MA 4HT7A 1ZZNA 3OTOJ 1C0TA 1GEHA 4OJ1A 1RYSA 2YQ0A 3US5A 3MMAA 4TVAB 4ED4A 1LKZA 2OPQA 5D3GB 3I55S 3MMCB 2DJWA 4ATNA 2VH7A 1I1GA 4JI7J 1HHQA 4F4XA 3DXSX 3CJ0A 3OL6A 1U8SA 2BE2B 1WI8A 2G2YA 3HZGA 1VQSA 2GA7A 1T9WA 4NLVA 3FFIA 1D8YA 3UDCA 1JJ4A 1R31A 2B4UA 1SL0A 4CO2A 3C6TB 2B9WA 3D6TB 4I56A 2O5DA 5B0FA 4EYIB 4UOGA 2UVVA 2DNYA 1JLAB 1QE1B 3CULA 1FKPA 2AHOB 4WF9Q 1NH7A 1RT5A 5L9NA 1N33F 2OPSB 2VFTA 3D6HB 3JB9k 1U0SA 3PKMA 3BBCA 3MPVA 2KHDA 4A8SA 1BLUA 5A2QU 3MCOA 4OI1A 3W61A 1S77D 2NSBA 2GGPB 2JFDA 3E01B 3PJWA 3QJPA 2DB1A 2R9LA 1S76D 4E8UA 4JI3F 3DYAB 2X1AA 3ZNUA 2BEFA 3ULHA 4Y3CA 5FLXU 4ZIWA 1DJ0A 2QMWA 5BXIA 2YTCA 1F3FA 1KHVA 1FNMA 1M1HA 1W7WA 3KUEA 4ZVQB 3QGIA 2JOQA 4CYUB 2B4OA 1TKZB 2EFGA 2LU2A 2J0QD 3MZIA 2LQJA 2XMVA 5H9FK 1RTHA 4IG0A 2B6AB 3HHNB 1SKRA 5KFIA 3E51A 3LUYA 4K4ZA 4M5LA 4LT6A 4WTYA 1XERA 1AFIA 1TKXA 3DI6A 3OLBA 5HMWA 2GZOA 4NLWA 3CJ3A 1J5EJ 4EGLA 2X3GA 4EO8A 3VCDA 2U2FA 4ZIVA 4NX9A 1X4AA 4XO0A 3CIZA 4AE5A 2N3OA 1KLMA 3LAMA 3T1HF 2FTRA 5A8KA 5DZ7A 4AL7A 4Y2MA 3PO5A 4DF8A 1KDNA 4LRFA 4FYWB 4KV8B 2MJNA 4F4KA 3AXKA 2A2CA 3BGFA 4C0BA 1TKTA 3GR0A 2MLXA 2XGQA 4F8RA 4LF9F 4RKUC 1O6XA 1JB0C 1XN9A 2R8JA 3HK2A 1TR0A 1BQMB 3NWRA 4R5PB 4DZDA 5EDWA 5FLXY 4QPTA 1UW4A 1CJKA 4DR2F 3HSGA 1RAEB 1V9OA 4X4SA 2ZH4A 3MF5A 4NXMJ 4RW9B 4R8UB 1RTJA 3DRPA 4L76A 4Q5VA 3A3NB 5AXKA 3MPYA 3DFEA 1NAQA 3IO1A 3G82A 3MWBA 1CC7A 2ROPA 2GJIA 1IJEB 1K44A 3FEXB 3ETOA 3GZ7A 4JI0J 1X9MA 1TUVA 3JSYA 3MEDB 4JI1F 3ILLA 4DV0F 2VV5A 4GVBB 4RUAA 3N5FA 4LVNP 1KHWA 7FDRA 3CO0P 5LSOA 1UP1A 3D68A 2XWXA 4RNMA 4RU9A 1L3VA 2OEKA 3LOUA 5T7LA 1RADB 3N6NA 2R8IA 2J0SD 2UV8G 1LWEA 3D54A 4ZVPB 4DV5J 2KB2A 4NRTA 4TY8B 1RT4B 1Q7LB 1BY9A 4ZHRB 1UWBB 4UY8T 4KHPF 2IA6A 4ECXA 2F5GA 3EVOA 3MM7A 1C0TB 5KFLA 4MAKA 2YPYA 3MMAB 3L7UA 2OPQB 2DK2A 3AFGA 3RG6A 1U8WA 5B08A 1QUVA 2XWYA 1FFSB 2FVRA 1MN9A 3QAEA 4F0HA 3AA9A 3H5YA 3FFIB 3K5NA 4FNHA 4LF5F 1XQIA 3K59A 3KG0A 1TFYA 4KGMA 3H7HB 1Q8KA 3IGNA 4L3KA 3M8ZA 2F4VJ 5ADZA 3J81Y 4YB1P 2PMHA 2YWWA 2Y1JA 1WUUA 2KKHA 1F2HA 3MR2A 3DRXA 1FKPB 1VBYA 1RT5B 4M5DA 1UVJA 3BKUA 2DNNA 5DM6Q 2H9ZA 1RWUA 4ZP6A 1RHMB 4DX5A 3JTOA 4C97A 3JSMA 3FSYA 2WZ1A 4ANDA 2G9OA 3C15A 3M05A 5GAGI 5KG7A 4CM0A 2FJVA 1T3NA 3OJUA 4MIWA 5KT4A 1JLEA 1E6VA 4OZ3A 1IM6A 3W5YA 1FRIA 2BKNA 1LW0A 1RAGB 4FN5A 4JV5J 5JMNA 1NBEB 5IFMA 3EVWA 4ICLA 2D3ZA 5E0OA 1RTHB 1QTMA 4IG0B 1NSPA 3VAIA 2FJXA 1JLQA 2MZTA 5AT1B 2N82B 3CGIA 4P9SA 1S0OA 1TKXB 2OD4A 3DI6B 2CQPA 2SXLA 3V4MA 3PR5B 3IR7B 3OQ2A 3CD0A 2G4BA 1MG7A 3M6XA 5L38A 1S6OA 2EWHA 1URNA 2QL9B 1URRA 1M5KC 1NDCA 5A8KB 1WNEA 2LCWA 3CJ5A 2R7SA 1WEYA 2WSFC 4DSEA 4K4YA 1GMWA 2E1PA 4QIEA 3UI3A 1IKYA 1U1LA 1HQEA 3UFCX 3KMQA 2ZITA 4ZPDA 1SH2A 4RO0A 1FESA 1RQ0A 2QA2A 1RP5A 1CJKB 4QWAA 4DUZJ 3OFEA 1Q0NA 1R8PA 4XDCA 1MWZA 1RTJB 3DRPB 1VQ4S 2E5JA 3IC1A 3SBMA 5LM7E 5KFWA 3RRGA 2DNMA 1JNRB 3Q24A 3G82B 3OTBA 3VVTA 5C24A 5E3QA 4NXMF 2FJWA 1SIWB 5KFAA 3OLAA 2E5LJ 5FDLA 4JI6J 4EZ6A 2I5JB 2MZSA 1KVKA 3S8SA 1ZAXA 1XIQA 3I56S 3A12A 3WBZA 3NGKA 1EB0A 2FHMA 4YUDA 1CPZA 3JSRA 2MKJA 3T1YJ 4NXNJ 4GO5X 2VC1A 5T7LB 1Y0HA 1X4HA 4P74A 4IRKA 1BC6A 4MKBA 3FZBA 4KPYA 4H4KA 4OHWA 1LWEB 4B02A 2LYVA 4ED3A 1IBKJ 4CCHA 2OSQA
chains in the Genus database with same CATH topology
4ANEA 1BE4A 2BEFA 2CWKA 4CP5A 4EK2A 1NDLA 3DKDA 5BXIA 3VGVA 1NDKA 3EVOA 4O0NA 1LEOA 1NCLA 3EE3A 4DZ6A 2HVEA 4UOHA 1F3FA 1BUXA 1BHNA 3NGTA 4F36A 3L7UA 3PRVA 4ENOA 3Q8VA 1W7WA 1NPKA 1ZS6A 3PJ9A 2NCKL 3JS9A 3EVWA 1LWXA 1WKKA 3ENAA 1U8WA 1S5ZA 1MN7A 1HHQA 1NSKL 1NUEA 1S57A 3BH6B 5CABA 1NB2A 4C6AA 3NGUA 1PKUA 4KPCA 1MN9A 2DYAA 3DDIA 1EHWA 3Q89A 1VYAA 3EICA 1NLKL 3FCWA 3NGSA 1B99A 3GP9A 1NSPA 2DY9A 3MPDA 1NHKL 3ZTRA 3Q8UA 1XQIA 3VVTA 4ANCA 2BX6A 1JXVA 4FKXA 1B4SA 4F4AA 1K44A 3VGUA 4UOFA 2DXEA 3BBBA 3Q83A 1UCNA 4UOGA 3FKBA 3FCVA 3NGRA 3ZTSA 2HVDA 2AZ1A 3EMTA 1NSQA 3ZTOA 3BBFA 1XIQA 5IOLA 2DXDA 4DUTA 2B8PA 3Q8YA 4W98A 5C7PA 1F6TA 3EM1A 4DI6A 3VGTA 1PAEX 3FBBA 3FBFA 3EJMA 2B8QA 3G2XA 1HIYA 3FC9A 3B6BA 3FBEA 1WKLA 1NDCA 4FKYA 3Q86A 2HURA 4S0MA 3BBCA 3VGSA 3ZTPA 2VU5A 3BH7B 4WBFA 3WX8A 1S59A 3ELHA 4HR2A 1WKJA 1KDNA 4ANDA 1NDPA 2DXFA 3R9LA 3FBCA 3ZTQA 1HLWA 3GPAA 3ETMA 3VVUA 5CAAA 2AZ3A 3EVMA 3B54A 2ZUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ANE A;  1BE4 A;  2BEF A;  2CWK A;  4CP5 A;  4EK2 A;  1NDL A;  3DKD A;  5BXI A;  3VGV A;  1NDK A;  3EVO A;  4O0N A;  1LEO A;  1NCL A;  3EE3 A;  4DZ6 A;  2HVE A;  4UOH A;  1F3F A;  1BUX A;  1BHN A;  3NGT A;  4F36 A;  3L7U A;  3PRV A;  4ENO A;  3Q8V A;  1W7W A;  1NPK A;  1ZS6 A;  3PJ9 A;  2NCK L;  3JS9 A;  3EVW A;  1LWX A;  1WKK A;  3ENA A;  1U8W A;  1S5Z A;  1MN7 A;  1HHQ A;  1NSK L;  1NUE A;  1S57 A;  3BH6 B;  5CAB A;  1NB2 A;  4C6A A;  3NGU A;  1PKU A;  4KPC A;  1MN9 A;  2DYA A;  3DDI A;  1EHW A;  3Q89 A;  1VYA A;  3EIC A;  1NLK L;  3FCW A;  3NGS A;  1B99 A;  3GP9 A;  1NSP A;  2DY9 A;  3MPD A;  1NHK L;  3ZTR A;  3Q8U A;  1XQI A;  3VVT A;  4ANC A;  2BX6 A;  1JXV A;  4FKX A;  1B4S A;  4F4A A;  1K44 A;  3VGU A;  4UOF A;  2DXE A;  3BBB A;  3Q83 A;  1UCN A;  4UOG A;  3FKB A;  3FCV A;  3NGR A;  3ZTS A;  2HVD A;  2AZ1 A;  3EMT A;  1NSQ A;  3ZTO A;  3BBF A;  1XIQ A;  5IOL A;  2DXD A;  4DUT A;  2B8P A;  3Q8Y A;  4W98 A;  5C7P A;  1F6T A;  3EM1 A;  4DI6 A;  3VGT A;  1PAE X;  3FBB A;  3FBF A;  3EJM A;  2B8Q A;  3G2X A;  1HIY A;  3FC9 A;  3B6B A;  3FBE A;  1WKL A;  1NDC A;  4FKY A;  3Q86 A;  2HUR A;  4S0M A;  3BBC A;  3VGS A;  3ZTP A;  2VU5 A;  3BH7 B;  4WBF A;  3WX8 A;  1S59 A;  3ELH A;  4HR2 A;  1WKJ A;  1KDN A;  4AND A;  1NDP A;  2DXF A;  3R9L A;  3FBC A;  3ZTQ A;  1HLW A;  3GPA A;  3ETM A;  3VVU A;  5CAA A;  2AZ3 A;  3EVM A;  3B54 A;  2ZUA A; 
#chains in the Genus database with same CATH topology
 1F60 B;  3K5M A;  1EQ0 A;  4WCE Q;  2V63 A;  1HI1 A;  3DOK A;  5THW A;  1UPM B;  1L3S A;  2D69 A;  2FIU A;  2WCX A;  3MM7 B;  4AT1 B;  5B0B A;  3VAF A;  4DZ6 A;  4DR3 J;  1A0O B;  1RKJ A;  5B09 A;  1X0F A;  2KFZ A;  5HSP A;  3SQG B;  5ETM A;  5ETT A;  4MK8 A;  2V2Z A;  2ATC B;  2I1R A;  4IOA Q;  2OUG A;  5D0E A;  4LF4 F;  1S79 A;  5D6G A;  4I6W A;  3H5U A;  1T94 A;  2HBZ B;  1WC5 A;  4PR6 A;  3R7S B;  3BF4 A;  4OYM A;  3MCN A;  2JWN A;  3SV4 A;  4ID5 A;  3D4J A;  3MM9 A;  3MEK A;  2VBY A;  3M2R A;  2DRA A;  1CS4 A;  4BC9 A;  2BW7 A;  2V34 A;  5DET A;  1H2U X;  2GC8 A;  2MQN A;  1RHK B;  4M5D B;  2VC0 A;  4Q2L A;  2BM1 A;  4WFZ A;  4F4W A;  3ZC4 A;  2ADC A;  1RBA A;  2CPE A;  5AXL A;  3JSM B;  1HHT P;  3C15 B;  4N76 A;  1WHY A;  2DIS A;  1VQ9 S;  1HBN A;  2IDL A;  2YKN A;  5K8O A;  1IM4 A;  2H51 B;  2CJ9 A;  1XNR J;  2BOP A;  2FC8 A;  1BE4 A;  3JTN A;  1JLE B;  4KKO A;  1E6V B;  1OQ6 A;  2DR5 A;  4I2Q A;  1F9E B;  2C22 A;  4DV2 J;  1DBD A;  3GYN A;  4N8N A;  1IXK A;  1OMS A;  2FD2 A;  1LW0 B;  2EFO A;  2DGT A;  4OZ1 A;  2QYC A;  3GLJ A;  2OH2 A;  4ICL B;  2BJ9 A;  1FRJ A;  4I1T A;  1KS2 A;  3RRH A;  4JV5 F;  1JLQ B;  5J1E A;  5DG7 A;  2DTJ A;  1HNV B;  2U1A A;  2D74 B;  4URG A;  2X3D A;  4ZCK A;  1U7L A;  2H65 B;  2BMB A;  3W1Y C;  3ZTS A;  2KG1 A;  4K4V A;  4HHU A;  1OSC A;  1S6Q B;  4AL5 A;  1U2R A;  1WF0 A;  2K1R A;  8ATC B;  1CVJ A;  4ED8 A;  1HNX J;  5F0U A;  4HH0 A;  3OVA A;  1RBO B;  3PW4 A;  5KFG A;  4HKQ A;  4DU7 A;  2LFV A;  2FY8 A;  3TEH B;  1U6Z A;  4DSI A;  3J7Z 5;  1HQE B;  2Q3P A;  2V67 A;  1S6P A;  2DPJ A;  1F1B B;  3T9N A;  3FEY B;  3UCZ P;  1XR7 A;  1FCA A;  5DG8 A;  3QT7 A;  1CC8 A;  3OD2 A;  3EPI A;  1TU0 B;  2QLF B;  3T9Z A;  3P6Y C;  2PFD A;  2CVI A;  1P8G A;  2CIM A;  2VHG A;  2AJ2 A;  1RGV A;  2GVZ A;  4DUZ F;  2DIV A;  5C24 B;  4DV4 F;  1N0V C;  2BYC A;  4UOF A;  4NCB A;  4PQU B;  2C3P A;  4N8O A;  3R5A A;  3IRW P;  3MGJ A;  5FDL B;  3Q83 A;  3UDE A;  4UT4 A;  2YNG A;  2KN4 A;  1NSQ A;  4URQ U;  1V3S A;  3PVX A;  3LO3 A;  2M7S A;  4AXI A;  2E5L F;  1S1T A;  2CQ3 A;  2X7I A;  4JI6 F;  2VBX A;  1HWU A;  3SSQ A;  5F0W A;  3QIP A;  2MQO A;  2HHH F;  1FHT A;  1UEU A;  2K7J A;  3IBC B;  4ED1 A;  4TXS A;  1H2T Z;  2JLE A;  4NXN F;  2CJQ A;  2EK6 A;  4FNI A;  3DOK B;  2VA3 A;  1EAY C;  5FII A;  3M7V A;  4A8Y A;  3I4H X;  2N3L A;  1U02 A;  2XGP A;  1NK7 A;  1LW2 B;  2MKK A;  4C8M A;  2EC2 A;  1PKU A;  3KLF A;  4DR3 F;  3KNA A;  1VYA A;  1DLO A;  2DO4 A;  2KM8 B;  2D41 A;  1R0C B;  1VFJ A;  2B9Y A;  4ID5 B;  2M70 A;  3KHL A;  2F8H A;  4ZMM A;  3Q8P B;  3M2R B;  1NJI T;  1CS4 B;  2F9J A;  3T1A A;  2W24 A;  1QAJ A;  2QSW A;  4F02 A;  3MUM P;  2EG2 A;  3PDN A;  3TX8 A;  5BYS A;  4UQT A;  1TK8 A;  2B0G A;  4RNF A;  4EZ9 A;  2M4M A;  3D28 A;  4WBF A;  4B9M A;  1AXQ A;  4M95 A;  2QG9 B;  3CMQ A;  5L46 A;  2OIH A;  4WJB A;  5K8N A;  3R2D J;  1HBN B;  1U6F A;  2YKN B;  4KFB A;  2KJW A;  2XI2 A;  2VOO A;  4EO6 A;  3RAM A;  3Q8Q B;  2G2Z A;  2I38 A;  4KKO B;  3P49 B;  2VPZ B;  1WDD A;  3MM5 A;  1O51 A;  4ZVO B;  1DFD A;  1J2V A;  1H7X A;  1LEO A;  4ZP7 A;  5E2Q A;  2GHP A;  3V81 B;  1VQP S;  1Q5V A;  4QYZ J;  2CPY A;  5KG1 A;  1SC6 A;  4DR4 J;  1N5V A;  4DDF A;  3H5S A;  3GIJ A;  1OWX A;  3MOZ A;  3D1O A;  4DV7 J;  1DAR A;  4ZS6 A;  3Q8U A;  4JI5 F;  2BJ1 A;  2VON A;  3D6F B;  2G13 A;  3OTD A;  2JEG A;  4MJK A;  3OTE A;  1TL1 A;  2QLB B;  3K7R A;  1CJT A;  4FXD A;  3IA0 A;  3UCG A;  1WEX A;  4F26 A;  4TYB A;  2RRB A;  4P2S A;  3O5T B;  3ZZR A;  2HS4 A;  2K1R B;  5IM0 A;  1HBO A;  4B3R J;  3JQJ A;  3C14 B;  5LMU F;  3VZI A;  4N41 A;  2FHO B;  3EX7 B;  4M5M A;  3D0G E;  4CO5 A;  5B0G A;  4NPO A;  3R6G B;  2OHD A;  1N32 J;  1EET B;  2ZH1 A;  1XMQ J;  1HNX F;  2W9B A;  2WW8 A;  1UA1 A;  2IVM A;  3QMQ A;  3MUR P;  2M52 A;  3JAM U;  2CPH A;  1MML A;  2QTW A;  1LXN A;  2PEB A;  1LFW A;  3CWJ A;  3W5X A;  4RW4 A;  2AT1 B;  1HI0 P;  1V5I B;  2ZDO A;  3MR6 A;  2GVZ B;  2RDD A;  2J6T A;  1Q81 T;  4PAB A;  2V9W A;  1T9V A;  2V2Q A;  1S1W A;  1RU1 A;  2YNG B;  5H9F J;  4DFJ A;  4WWS A;  2K3K A;  1Q8B A;  3W63 A;  4PG8 A;  3DGP A;  1OYD A;  3KG4 A;  2IAJ A;  1H73 A;  1D09 B;  1OPI A;  1S1T B;  2VBW A;  3L4B C;  2VA2 A;  3N0V A;  1WKL A;  3A3P B;  3QIP B;  2E5G A;  1JXE A;  2F8E X;  2ZH8 A;  1XR6 A;  4YN3 B;  2XYH B;  4C9D A;  2KXH A;  3TAM A;  1N0U A;  3OT9 A;  3GYG A;  4ILM A;  3R6L B;  2CDQ A;  2ZHA A;  4RUC A;  5L9X A;  4BLG A;  1XC9 A;  3CJ8 A;  2Z4P A;  2E7W A;  3UD3 P;  5DGB A;  2OD6 A;  3O1L A;  2HS0 A;  1T05 A;  5HLF B;  1RDR A;  3I9Z A;  1QVF R;  3AQO A;  2OLW A;  4DN0 A;  2HFO A;  3KLF B;  2DRB A;  1DLO B;  2V4Q A;  3PXG a;  2C2Z B;  5HQ8 A;  1FK9 A;  1UVK A;  2OPP A;  4M1K A;  4OHX A;  1WSR A;  2FJE B;  3D0I E;  1FF2 A;  4CI0 B;  4P72 A;  2HHS A;  2ZNY A;  1XMO F;  2J5A A;  2ZUG A;  2E7X A;  4RL1 A;  2DD8 S;  4U8V A;  3UWT A;  3DU5 A;  4ECR A;  9RUB A;  3QO9 A;  3HDS A;  3DGV A;  2FB0 A;  4PZV A;  2UXB J;  2OEL A;  3C2P A;  2J8S A;  1XBW A;  4QBU A;  2ZBQ A;  2GIF A;  2VFS A;  1JLF A;  5CYM A;  4ECY A;  2VPX B;  4KFB B;  4CLK A;  4ETZ A;  1WC4 A;  2HIY A;  2W8K A;  1YZ6 A;  5KFE A;  3MM5 B;  2KT2 A;  3LW5 C;  1JJH A;  3BEG B;  2NZ4 A;  1RAA B;  3RJM B;  1DQ8 A;  4AUK A;  1RHJ B;  2LXI A;  1GX5 A;  2OEM A;  1SIZ A;  5KOX A;  1FNO A;  5F8G A;  5EX3 A;  4USW A;  5D8H B;  2VUG A;  4QWE A;  2ZBP A;  3T5H A;  4FBT A;  4F4A A;  3NMR A;  3UD4 P;  1F9H A;  3I87 A;  2DH9 A;  4KIA A;  4CLL A;  4J9P A;  2HSE B;  1TL1 B;  1H98 A;  1CJT B;  4DMZ A;  2BE9 B;  1T7P A;  4OHZ A;  4C3L A;  3WQP A;  1FD8 A;  4ZOS A;  2CZV C;  3F41 A;  2DEJ A;  1WTF A;  2J0W A;  2A10 A;  3VTI A;  2E5H A;  2F65 A;  4IRD A;  5IM0 B;  2HHX A;  1HBO B;  5DDP C;  1KBR A;  2BAN A;  4KBI A;  3MTJ A;  1KQS R;  2ZZM A;  2CQI A;  1X31 C;  4DSK A;  2L9D A;  4J9Q A;  1RAI B;  3HMJ G;  4CH1 A;  2W9B B;  1ACM B;  3TA0 A;  1RLD A;  3PO4 A;  4B3R F;  2KDO A;  3WIV A;  5F8L A;  1G3O A;  4OIX A;  1XMQ F;  2OI2 A;  1Q5Y A;  5CYQ A;  3M1V A;  3NGD A;  1HWI A;  4EBD A;  2FPH X;  1DTT B;  4CLT A;  2YNI A;  3CDW A;  4OYW A;  2PE8 A;  1NND A;  4F4Y A;  4X62 F;  1FRL A;  4XAK A;  1T03 A;  4Y2C A;  4AYB D;  4IH5 A;  2HWI A;  4PG4 A;  4Z7Y A;  2FLO A;  4B3O A;  1S1W B;  2VPW B;  3ISN D;  3DNC A;  1FRH A;  1YJT A;  2Z8Q A;  2OFG X;  3AB4 B;  3CED A;  3PIP Q;  5D4P A;  3DGP B;  2IAJ B;  2PC6 A;  3Q8Y A;  1HNW J;  1UFL A;  4RW8 A;  1C2P A;  1YG0 A;  1RCO B;  4ELU A;  4Y0F A;  4GC6 A;  1VMB A;  3POT A;  3BH7 B;  1VBZ A;  3C6U A;  1I51 B;  5LMN J;  3TAM B;  3IMQ J;  1R27 B;  1Z1Z A;  4CWB A;  4PCQ A;  3PZP A;  2UUT A;  2XY5 A;  4O44 A;  3O44 A;  3NOC A;  3HI9 A;  5IXU A;  4O4G A;  4CLY A;  3GV8 B;  1VHF A;  1T05 B;  1HWL A;  1UA0 A;  3P96 A;  2AW0 A;  4Z7C A;  1NXI A;  2HQ3 A;  3PAC A;  5K14 A;  4TLR A;  4DPY A;  1B70 B;  5GAG U;  1Y9O A;  1YIJ S;  3T19 A;  1HR0 J;  2M2B A;  2QA4 G;  3RAQ A;  5EN1 A;  1FK9 B;  3BPS P;  4K0K J;  2OPP B;  1Q95 G;  2V2K A;  3RB6 A;  2HK3 A;  1Y5L B;  3M8Q A;  2AGQ A;  1VIX A;  1FX4 A;  5HVF A;  4CNZ A;  1AW0 A;  3QO9 B;  2HEK A;  5E3R A;  4PWU A;  2KRR A;  1VQ7 S;  4X4P A;  5BJR A;  1TTH B;  2WBR A;  4UQG A;  2YWF A;  5HVG A;  4R25 A;  4OI4 A;  1JXL A;  1MSW D;  5CYM B;  2YWK A;  4ZK7 M;  1QD1 A;  3CDE A;  3ZTQ A;  3MAQ A;  2RQ4 A;  2JRS A;  3M30 A;  1NPP A;  4ELV A;  3HFK A;  2N7C A;  4O4R A;  4QQB A;  9ATC B;  2FVP A;  3T5K A;  5HMZ A;  1VC6 A;  2AIR B;  2LEC A;  3DOM B;  4LSL A;  3CXC R;  1HNZ F;  1ZET A;  1WEL A;  3DLK A;  2DY1 A;  4U7U D;  1B64 A;  5A76 A;  1WKK A;  3PRB A;  4OX9 F;  5KFY A;  2MTL A;  5EHH A;  5A0Y A;  1TV6 A;  3AB2 B;  4DSF A;  3QFW A;  1R43 A;  3CCE S;  1ZAV A;  4IOB A;  2ZBC A;  3DRY A;  2Z2M A;  1VQ5 S;  1P9Q C;  2UV8 A;  2QJ3 A;  3VF0 B;  2CQB A;  1TKD A;  2HHW A;  3NGR A;  3OFG A;  2BAB A;  5HO4 A;  2ZOF A;  4QWD A;  2C2M B;  4LRD A;  2KH9 A;  2CRL A;  5L8R C;  1JX4 A;  3ENQ A;  3NKY A;  2BAN B;  5KFS A;  1RWO B;  3J80 Y;  2ZE2 B;  2WVD A;  4MFB A;  3RB0 A;  2Z2Z A;  3IBF B;  4ECZ A;  3D1Q A;  1VQO S;  1VI7 A;  2AYG A;  1H2V Z;  4X4T A;  2Y0B B;  2AEJ A;  1V5V A;  5HMX A;  2WAQ D;  4F0M A;  2HVI A;  4ANE A;  1N36 J;  2MHE A;  3BDP A;  1B0P A;  4G1Q A;  1S6U A;  3M1V B;  1ZYQ A;  3IWN C;  4I64 A;  4LBH A;  3A1Y G;  3Q8V A;  1ZS6 A;  5AE1 A;  3TVY A;  2AP6 A;  2YNI B;  3BR8 A;  2H4Y B;  1IBL F;  4EWT A;  2HAF A;  2HWT A;  3DDI A;  5F3T A;  1T03 B;  3PR4 A;  2WW4 A;  4W92 B;  4ZDN A;  4OV1 A;  4IH7 A;  2W4C A;  2CA9 A;  1NKE A;  3FNN A;  4B3O B;  4DQP A;  2YKA A;  2DHS A;  3MM8 A;  3QLH B;  2C2E A;  2CNL B;  4FYD A;  4KYZ A;  1VJW A;  5JXS A;  3W5Z A;  3PJX A;  1PBA A;  3EM1 A;  4KGK A;  4RW8 B;  4PWW A;  5IV3 A;  6AT1 B;  2IMW P;  1RSC A;  3NNH A;  3OHA A;  1VK3 A;  1IBC B;  1FX2 A;  1KTV A;  3NS5 A;  3POT B;  3C6U B;  4TU9 A;  1HNW F;  4H4K C;  1PIL A;  1P27 B;  3VVU A;  2DNK A;  3RYL A;  1FER A;  4GVL A;  3GTY X;  1HPZ B;  2VFU A;  4YEA A;  4O44 B;  5LMN F;  4X66 F;  4O4G B;  2V68 A;  1LWC A;  2MEW A;  3EGV A;  2E1M C;  5D0G A;  4G1P A;  1X8D A;  5K14 B;  2V6A A;  4A8X A;  4AL6 A;  3BO2 A;  3KMS A;  1H74 A;  5K5M A;  2OAU A;  3MTK A;  3SXL A;  5GAD I;  1BWV A;  3GG1 A;  3GYX B;  4P2F A;  2KM8 C;  1XNQ J;  3Q2S C;  4AXJ A;  3HD1 A;  3HKW A;  3UR3 C;  1RT6 A;  3D5M A;  4USJ C;  1HR0 F;  4RX6 A;  4MKA A;  4USU A;  3M8Q B;  5B0E A;  2MYF A;  1MU2 A;  3S01 A;  4ZPT R;  4OJG A;  1PC5 A;  4K0K F;  1NH8 A;  1R6Y A;  3KLH A;  4WXW A;  3FC9 A;  4LRB A;  5KTQ A;  1YZ7 A;  5J2N A;  1N4L A;  3GSI A;  4OYX A;  3W7B A;  5CXT A;  1CUL A;  1T11 A;  4ED6 A;  1NRK A;  3VAG A;  1FRM A;  4E2F B;  3GU0 A;  3GPA A;  2BOA A;  3JQM A;  2EKY A;  4FF3 A;  2I2Y A;  3KG1 A;  4B3T J;  4MIA A;  5F41 A;  4LSL B;  2HQC A;  1DRZ A;  1RTZ A;  3K8V A;  1NZ8 A;  3QRR A;  2UU9 J;  1TK5 A;  2VG6 A;  1R7I A;  3UVJ A;  2V69 A;  2VKZ G;  2DEI A;  5A0Y B;  2DHH A;  2PA3 A;  2PI5 A;  1YTY A;  3MPD A;  2FHJ D;  1R0A A;  2DVI A;  2HHT A;  4ECU A;  3CJ4 A;  4FP9 A;  2C3U A;  1QVG R;  3CD7 A;  2ASD A;  4FVM A;  3RW6 A;  4TN2 A;  1W2B R;  3DLE A;  3AD7 C;  4NLD A;  3N6M A;  3P5T L;  5T41 A;  4LQ3 A;  2PI4 A;  4DOZ A;  1YJW S;  3VGS A;  3GJS B;  3HFV A;  1Q4R A;  4RZR A;  1KTQ A;  2VDH A;  2CPI A;  4M5K A;  3PHE A;  5I4M A;  2OML A;  2VQE F;  1Q79 A;  3GFX A;  3C66 A;  4IO1 A;  2ACY A;  4U7C A;  3QJL A;  5IC4 B;  4G1Q B;  1PJ7 A;  1S4F A;  3DU6 A;  4YY3 J;  2LQB A;  3R5J B;  2RH3 A;  3EUN A;  5HQM A;  2ZH9 A;  3FZ2 A;  3TW0 A;  1J5O A;  2R7O A;  1NK5 A;  3EIC A;  4EBE A;  3K5O A;  4PG7 A;  3KNG A;  4DV1 F;  2KI2 A;  1SPB P;  4BWJ A;  3MM8 B;  4C0H A;  5FD1 A;  2RS8 A;  1M0S A;  3C16 A;  3BBF A;  3T3F A;  4ZVG A;  1WI6 A;  3OPK A;  1OYE A;  3W2V A;  4P75 A;  1SJ4 P;  1S7I A;  3HO1 A;  2BQR A;  3W62 A;  2KXF A;  1VBK A;  2AYB A;  4F04 B;  3VAJ A;  3CCW A;  1KD1 T;  1NDP A;  2GAH C;  3KUG A;  3KLG A;  2QEX S;  2ZH2 A;  4NI2 A;  1GT8 A;  1KRP A;  4L3N A;  3TJ8 A;  4YDX A;  4DG1 A;  1RCX B;  3A13 A;  4CO3 A;  1K9M T;  1VIS A;  1LWC B;  4RBT A;  2CQC A;  3M9M B;  3OUY A;  1GXL A;  4ES1 A;  2ZNZ A;  4L72 B;  1C0U A;  2QO3 A;  2KL8 A;  3HP6 A;  1BMQ B;  4G1I A;  5A6W A;  3CJT A;  4P52 A;  1UVN A;  3D7S B;  5DS7 A;  4U67 Q;  1PCA A;  5HAO A;  2QRR A;  1NHK L;  1U48 A;  1RT6 B;  2R7R A;  3KK1 B;  3M32 A;  2XMT A;  2PSZ A;  1V6H A;  5IT9 U;  5DZ6 A;  4CDI A;  2QL7 B;  1QJH A;  1MU2 B;  4C8N A;  2GAG C;  3H2V E;  1NME B;  1XMB A;  4DPT A;  3KLH B;  1YHQ S;  3B8H A;  2F1F A;  3RR8 A;  3AOD A;  2ILY A;  2PDA A;  5J2N B;  2UZA A;  1ZM4 A;  2V8G A;  1CUL B;  4CLU A;  4C48 A;  2MKC A;  2ZKU A;  1LOU A;  3MMB B;  2XO6 A;  3PX0 A;  2K7K A;  4C7Q A;  4XPC A;  1PSD A;  3SCJ E;  4UW2 A;  1MMD A;  3Q0A A;  4LRC A;  3ILI A;  3MEE A;  2QV6 A;  2R7W A;  2JX2 A;  2H5J B;  3UN2 A;  4TKT A;  3CCJ S;  2VDI A;  3TZZ A;  2ZKT A;  2HPU A;  1D3W A;  5HL7 Q;  5HQL A;  5D78 A;  5HVH A;  4NE9 C;  5GMD A;  2DHG A;  2VG6 B;  3JS9 A;  3UVJ B;  4B3T F;  3BN7 A;  3QT5 A;  2HHV A;  2F4F A;  4DV6 F;  2HQG A;  3GV5 B;  2ZM6 J;  4N7T A;  2IM3 A;  2KU7 A;  4XDD A;  2EKN A;  1R0A B;  2UU9 F;  1R8H A;  1BWE A;  2WHO A;  2R7Q A;  2A6O A;  1QM9 A;  3ISN C;  3BBB A;  4WP8 A;  2DNP A;  4RLE A;  1HKA A;  2B9X A;  4OZ0 A;  4J5O A;  4WFN Q;  1OY8 A;  3DLE B;  2B8P A;  1VS3 A;  2MXY A;  2CJA A;  2QL5 B;  5K8M A;  1YJ7 A;  4PRF A;  3V6K A;  2OFH X;  4KO0 B;  1RAB B;  4C4W A;  2RJZ A;  3RBD A;  4J9O A;  2LQ9 A;  4WZQ A;  1YJV A;  5AJ3 J;  4WFY A;  1N54 B;  4LF8 J;  3IR6 B;  4DPU A;  5F8I A;  5I3U A;  2GML A;  3ITH B;  2W2M P;  3IWL A;  4WKY A;  2B56 A;  4EK2 A;  3KLI A;  1MW7 A;  1WF2 A;  4LRA A;  1UFK A;  2A3J A;  2WVE A;  4KB7 A;  3M2U A;  4FYY B;  4ECV A;  1U1P A;  5D4N A;  4GRS A;  2UXD J;  3RAX A;  1XTZ A;  4DLE A;  2AYM A;  1J5O B;  1DUR A;  4C6A A;  4L74 A;  4P7V A;  1IKV A;  4ZJQ A;  1AB8 A;  5KG4 A;  2MZR A;  4ES2 A;  1S0M A;  3JYT A;  2V2V A;  4MT1 A;  2IBO A;  2QLJ B;  2KZM A;  1VRQ C;  3S7R A;  5KFO A;  3CJ2 A;  5KFK A;  3OBI A;  1GQE A;  3C16 B;  2CJX B;  2R7T A;  2V50 A;  2L9N A;  1C4A A;  3BPD A;  3GII A;  5HAT A;  4CRJ A;  1OS5 A;  4A8K A;  4QCL A;  3W2V B;  4LSN B;  1VQL S;  5H1S V;  3FBF A;  4DCJ B;  4NLQ A;  1VR6 A;  1UW9 A;  7FD1 A;  1RT2 B;  3TA1 A;  2O1P A;  1VBX A;  4CLF A;  3WZ0 A;  2HUR A;  3HZE A;  3K89 A;  1QSS A;  2OTJ S;  2AJQ A;  4TQR A;  3BM7 A;  2O01 C;  2EFP A;  4NLP A;  3N6L A;  1Q78 A;  2HND B;  4DG1 B;  4KH0 B;  2CQH A;  3GJR B;  4ILR A;  4CH7 A;  3DKD A;  2R2S A;  3OJS A;  3OUY B;  3N5B A;  3NY0 A;  3DLB A;  4K7Q A;  1WWH A;  1C0U B;  3WIU A;  3GSD A;  4GKK J;  1NSA A;  4DV3 J;  5J2Q A;  4HVZ A;  4E0D A;  3H25 A;  2AX1 A;  4WTO B;  1JNZ B;  3H4B A;  2P5V A;  4YR3 A;  5IC6 B;  1M5P C;  2CJK A;  1QE1 A;  3HD2 A;  5A8R A;  1FA0 A;  4X4Q A;  3M32 B;  2ZH6 A;  3NBP A;  3P45 B;  3FQK A;  3J81 j;  4L6V 3;  3PYD A;  3IAS 9;  1FRX A;  2FJD B;  3E8O A;  3KFW X;  1MNE A;  2GGP A;  3CJK B;  2BVZ A;  3E01 A;  1HQ2 A;  5EUH A;  5JJB A;  2C2R A;  3D6M B;  1UEK A;  4D3G A;  3G8T A;  2IJF A;  4LSZ B;  4ECW A;  1R6V A;  1U6B A;  4NYZ A;  2IC3 B;  7AT1 B;  3MEE B;  5KG6 A;  2BKP A;  3HHD A;  1SC4 B;  1U0H B;  1XJW B;  1NK0 A;  3DLL Q;  1W25 A;  3SCI E;  3R7B B;  4OYP A;  3NGT A;  2DIU A;  4K5R A;  2XS2 A;  3QGH A;  4ZP9 A;  4NLO A;  3OXF A;  2XSJ A;  1Q53 A;  2L3M A;  1KSP A;  1TMM A;  5CAB A;  5DLG A;  2W7P A;  3IRX A;  3J7Y U;  3AXM A;  2N4C A;  4X84 A;  3F44 A;  3Q8S B;  1KLN A;  4Q0B A;  2KJV A;  3TAR A;  2B9E A;  1YLX A;  3HHL A;  2HVD A;  2D7S A;  4RNH A;  4OI3 A;  3SDE B;  2D9P A;  1U09 A;  2HGN A;  2G1H A;  2FZG B;  4KV8 A;  3I5A A;  2W4P A;  2UUA J;  1YWX A;  2ZOM A;  1VRT B;  1TEL A;  5LXY A;  2HHQ A;  5J2P A;  1YSJ A;  4R5P A;  4LUB A;  5E33 A;  3UNY A;  2CG8 A;  2KYX A;  3N4W A;  4IFY A;  2RRN A;  1C4C A;  1JIH A;  4C3M A;  4UUX A;  2DGS A;  4I2P A;  1T9U A;  1RZM A;  4DPX A;  5AJ3 F;  3M2U B;  4GKJ J;  3W66 A;  3BKT A;  2IM1 A;  3FRY A;  1LWX A;  1S10 A;  2HG4 A;  4U9R A;  3IM9 A;  4K2X A;  4CH0 S;  1IKV B;  4IR9 A;  1M5O C;  5HJX A;  3H40 A;  3D1H A;  3K58 A;  3JYT B;  1ELO A;  2UXD F;  1KWM A;  1PAU B;  1BQN A;  5HAN A;  3J7A N;  4X65 J;  2QE5 A;  4C98 A;  3FCV A;  2HRT A;  3J7Z T;  5E41 A;  2DH8 A;  4FDF A;  2Q43 A;  1N48 A;  1L5U A;  3IAM 9;  2HRU A;  4PYA A;  4D3H A;  1FDD A;  3RBX A;  1RAF B;  1NM2 A;  1Q82 T;  3RR7 A;  3EDQ B;  1REV B;  1EZZ B;  2KHC A;  4JI8 F;  4X2B A;  3HCX A;  3WX8 A;  4DBQ A;  3GIL A;  2EBG A;  4HR2 A;  3H5X A;  5C42 B;  2P8I A;  2HBR B;  2Y3Y A;  4QWC A;  2RQC A;  3BN4 A;  3L09 A;  1YRX A;  3B78 A;  2KRB A;  5HN0 A;  1Q1K A;  1VQM S;  1IWG A;  4KHR A;  2GIR A;  4DR5 F;  5A8W A;  2LDI A;  1NDL A;  3WC2 A;  3E3X A;  3UW1 A;  1TZ0 A;  2A1B A;  3ISZ A;  3H42 A;  3TQ1 A;  1WG1 A;  1S1X A;  4H4O B;  3GE9 A;  1NJW A;  4NL5 A;  1Q8L A;  5J2Q B;  2VPY B;  3UO0 A;  4L73 A;  2DIT A;  3MCM A;  2UVR A;  1CJV A;  2WB1 D;  3GP9 A;  3TR5 A;  5A8R B;  4DV3 F;  3K0J A;  3NBP B;  2DXE A;  4C3K A;  5GVQ A;  1WHX A;  2V8D A;  1C1C A;  1QUP A;  1HW8 A;  1SI9 A;  3NAH A;  3BGO P;  3F73 A;  4K4S A;  3BO4 A;  5KFX A;  1GTE A;  1N5S A;  3TQE A;  1LV5 A;  1X4C A;  3A3O B;  2J8A A;  3AY0 A;  1FFG B;  1MRO A;  3FBE A;  3MM6 A;  4LBP A;  2V94 A;  3MPW A;  4JYA F;  1RU2 A;  2MB0 B;  1UZH A;  4URS A;  1ULR A;  4NA2 A;  2FDN A;  1FJG F;  5MAO A;  2YX7 A;  3MUV P;  3VR1 A;  2MKY A;  4AQY J;  5HJY A;  4HTJ A;  3ZZZ A;  3OL9 A;  2VAS A;  5CZV A;  2OTL S;  4CTA A;  4DR7 J;  1DQA A;  3BSC A;  3QZ8 A;  3OVS A;  4YHH J;  3CJQ A;  2XSJ B;  3GFH A;  3IRX B;  1UMJ A;  2GVD B;  5IQ6 A;  1DHM A;  2LU1 A;  2ALZ A;  2G0C A;  4IKA A;  2JLG A;  1JXV A;  2H3E B;  4JV0 A;  3I0S A;  4MYT A;  4HLB A;  4Q0B B;  2V0N A;  1R8B A;  3EWG A;  2IPO B;  2J7U A;  3HHL B;  2XZT B;  5IS2 A;  4A4J A;  3MPU B;  4JV1 A;  2EK1 A;  1MLA A;  2KO1 A;  2RKI B;  5A2Q Y;  2M3D A;  1LXJ A;  3VQS A;  1HIY A;  3NXZ A;  4HDG A;  2MY8 A;  4CT9 A;  1T9X A;  5J2P B;  3ET6 A;  5DDR C;  1Y3J A;  4DL5 A;  3M9O B;  3R9L A;  4IFY B;  5DG9 A;  1N34 J;  2G2O A;  4NLY A;  4I2P B;  3K2Y A;  1UWA A;  5K8P A;  2F40 A;  1VDH A;  2UVW A;  4B17 A;  2IY5 B;  2NXE A;  3G6Y A;  2Q66 A;  2RIJ A;  1SC3 B;  1VC0 A;  2CFX A;  2XZW A;  4XPE A;  1IN0 A;  1NJZ A;  2Z2L A;  4FZV A;  5LT5 A;  1K1S A;  4M5H A;  2I5J A;  2D3U A;  3HKZ D;  2ZWO A;  4OMF G;  4H4M A;  4A46 A;  1PBU A;  2AX0 A;  3AJD A;  3H20 A;  4WU2 A;  1BQN B;  1RAC B;  3OL8 A;  3ADA C;  4RUH A;  2AD9 A;  3HHL D;  1N5T A;  3EZU A;  5GAD U;  4YR2 A;  1S97 A;  4I6A A;  3HF5 A;  3NOG A;  2NYH A;  1E6Y A;  2CZ4 A;  3D9B A;  2HYI B;  2H54 B;  4X65 F;  3R2C J;  3MEG A;  1SUQ A;  3KJN B;  4IOC Q;  4Q8E A;  2OMO A;  3OSP A;  4KTQ A;  1A6L A;  2DXF A;  1OO0 B;  4WK1 A;  4YDD B;  3UPF A;  1P1T A;  4FS1 A;  1PYS B;  5CAA A;  3MFI A;  4MMO A;  3SQG A;  5CA5 A;  4Q45 A;  4NAS A;  3OTO F;  2NXC A;  5A8W B;  1VCT A;  4DWI A;  1RWK B;  1UZD A;  4K5S A;  3R1H A;  2HVE A;  4UOH A;  1S1X B;  2ZD1 A;  3DLG A;  3HX9 A;  2RS2 A;  4JI7 F;  2UXC J;  4B9V A;  1OQ3 A;  1X9S A;  2PN6 A;  4R0J A;  3OL7 A;  3U1L A;  3DMJ B;  4DCP B;  1CJV B;  1K8A T;  1HNI A;  1JKH A;  1M1G A;  1Q7Y T;  2CZ9 A;  1PGZ A;  2WSC C;  4F25 A;  4FF1 A;  2PMW A;  3HSD A;  5JVH Q;  3M8S A;  1VQ6 S;  3CC2 S;  3KKF A;  1C1C B;  3BDE A;  4B9T A;  4WYL A;  1N56 A;  2DPI A;  3KLV A;  4IQX A;  2XYP B;  4AD6 A;  2VOP A;  4MKY A;  1HD0 A;  1MRO B;  1WAC A;  3MM6 B;  4FVC A;  4DR6 J;  2M0G B;  5ETL A;  3OVB A;  5F8H A;  3KYL A;  2C3Y A;  4K8R A;  1B7F A;  2GCF A;  2BM0 A;  4OZ2 A;  3R8Y A;  2ZC4 A;  3SQO P;  3KUH A;  3HSJ A;  4ZLN A;  3FCH A;  3G8Q A;  2BZ2 A;  4Y6I A;  2R2T A;  2HIQ A;  3IFE A;  2RHS B;  4CTA B;  2CNN B;  5KT3 A;  3CCL S;  4BBY A;  2CUY A;  1HNV A;  4AQY F;  3CJR A;  1RAO A;  4DR7 F;  2QFI A;  3LGN A;  1PJ5 A;  1HW9 A;  5KFH A;  3ZXW A;  3CME S;  2OP5 A;  5EX0 A;  2LKZ A;  3QZ7 A;  1S6Q A;  3I0S B;  2ZH7 A;  3T6B A;  1J5E F;  1FO1 A;  4X4N A;  4OYI A;  3GB0 A;  2XLJ A;  3GIR A;  1Y3K A;  2MDA A;  4CZC A;  2OJ3 A;  2W7O A;  4JI2 J;  3TEG A;  4RJV A;  4U96 A;  3ET6 B;  2W2O P;  1WC6 A;  3BSA A;  4KSE B;  2HNZ B;  2LEP A;  3CCS S;  3G4S S;  4X64 J;  3CMA S;  1VLO A;  2QSF A;  3HVA A;  1SJ1 A;  2DGO A;  4TLQ A;  4QR0 A;  4ZLL A;  5KFD A;  2B51 A;  3S1T A;  1PG5 B;  2P9G A;  1WC3 A;  3MR7 A;  1FXL A;  4TYA A;  1NKB A;  2ILZ A;  5KG3 A;  1RHU B;  3SCK E;  1KR4 A;  3SSS A;  4PQU A;  1F9F A;  2VZ9 A;  3GQC A;  3QGP A;  2Y8W A;  3THP A;  3CIM A;  3HT3 A;  5EWG A;  4UF4 A;  3MUT P;  4H4M B;  4USK A;  4OZJ A;  4QIW D;  2D1C A;  3NCQ A;  3PCO B;  4JI0 F;  1X5S A;  4FPR A;  5B0A A;  5IT0 A;  2IRY A;  1G6B A;  2CDR B;  3J7A 1;  2VQF J;  4F2S A;  4RW7 A;  2PO4 A;  4UST A;  4LBI A;  5L1I A;  1VHI A;  4PYD A;  2XMK A;  4EMD A;  4U8Y A;  2E7V A;  3LF0 A;  1R3N A;  4ERD A;  2FVQ A;  1QDU B;  2CNK B;  1E6Y B;  5F9N A;  1IKW B;  4ALZ A;  4JB8 B;  3MI7 X;  3FBB A;  1S48 A;  4N77 A;  1SJF A;  1ZOT A;  3MEG B;  1SUQ B;  1QAY A;  3OFF A;  1NKC A;  1ITP A;  2RQK A;  3LP0 A;  1UKU A;  1FWP A;  4DV5 F;  4U95 A;  3LGH A;  1PO6 A;  3ONQ A;  1Y4Z B;  4P7T A;  1RTD A;  1LW2 A;  2Z56 B;  2XMJ A;  3BYP A;  4NWB A;  1S9F A;  2WOM A;  2HVH A;  5LOQ A;  1B7Y B;  2MHN A;  2ZD1 B;  3LQV A;  3DLG B;  3X1L B;  3PRV A;  3FMW A;  2JZ5 A;  1LWF A;  2AJ0 A;  3FJ2 A;  3IG1 A;  8RUC A;  4J9V A;  2VOD A;  2CPJ A;  3PTW A;  1UEV A;  3F0N A;  2LP4 A;  1HNI B;  3X3U A;  1JKH B;  4YS2 A;  3A8E A;  4DQQ A;  2F4V F;  2EVZ A;  2XQC A;  4F3O A;  4LF6 J;  3FKB A;  1UFW A;  2QA4 S;  4LR8 A;  5KFC A;  2DR9 A;  1WOS A;  2IRU A;  1X4D A;  2LLZ A;  4F67 A;  2MKS A;  3WDO A;  4OJ3 A;  1K0T A;  1D9A A;  4C8Z A;  1F2G A;  2VL1 A;  3C46 A;  3CO9 A;  3RZA A;  4FXV A;  2MQL A;  3V81 A;  2DO0 A;  4LFB J;  1TL4 A;  2JFK A;  2ROE A;  4EI2 A;  1BD6 A;  2JC0 A;  4ZLP A;  1FTC A;  2G0I A;  4TNO A;  3M6V A;  2FQQ B;  2AJ1 A;  2E66 A;  1KC8 T;  3CD6 S;  2W4D A;  1RT1 A;  5M2P A;  2CJB A;  2M8H A;  2DR6 A;  3GR1 A;  2HBQ B;  4ZCM A;  1U24 A;  4KPC A;  3W65 A;  4Y00 A;  5J1N A;  1YRU A;  1PC4 A;  1RKI A;  4K59 A;  3HPO A;  4WKR A;  3FSX A;  5DO2 A;  2CPD A;  3PW2 A;  3FDS A;  4KE5 A;  4JP8 A;  2BV3 A;  3C14 A;  1MWY A;  2GQQ A;  4DFK A;  3TUZ C;  1EET A;  2RU9 A;  1U2F A;  1F5A A;  4YB6 A;  3NCR A;  2VU5 A;  4EBC A;  2NSC A;  2V5H G;  1ZPV A;  1YRT A;  1TK0 A;  2CPF A;  4ZCI A;  3LGM A;  4BC7 A;  1G4C A;  1KQF B;  4JI2 F;  2MGZ A;  4IRC A;  2DNL A;  4LF2 A;  2PEH A;  2FGO A;  3HLU A;  3BR9 A;  2HQD A;  2C1E B;  4JI3 J;  4PXC A;  1S0N A;  1SL1 A;  4WXO A;  1U1M A;  3UN5 A;  4X64 F;  3ENW A;  3DLJ A;  2B4P A;  4RNO A;  2OGU A;  2CQ0 A;  3G6V A;  2NCK L;  4DLG A;  2I0X A;  4F2R A;  4OQJ A;  2IMO A;  1ZBT A;  2LXU A;  3BJY A;  1JLB A;  1FWL A;  1ZTT A;  2BKO A;  4DJB A;  2EFV A;  4HYK A;  4RW7 B;  2OKQ A;  4I67 A;  2X51 A;  3MMJ A;  1AYE A;  2B43 A;  3ZTO A;  2XMA A;  3D3C J;  3O3L A;  3KLE A;  3T1Y F;  4ZVH A;  2JC1 A;  2IYI A;  5GMK a;  4Q2M A;  3LP0 B;  4ZJO A;  4C11 A;  4ZVT B;  2DR7 A;  1WKJ A;  3TP2 A;  3T1H J;  3SI8 A;  4OHY A;  5HLF A;  1IBK F;  2WVC A;  1SL2 A;  1RTD B;  3B54 A;  4UOC A;  1Y7P A;  3K57 A;  2CWK A;  2WOM B;  1X0P A;  3GG0 A;  1N5Y B;  4NLX A;  3VV2 B;  4LF9 J;  2F9D A;  4FYV B;  2XMU A;  1N6Q A;  1DQ9 A;  3LAK A;  1LWF B;  4ZA1 A;  3KDO A;  2AQ4 A;  1HD1 A;  1AUD A;  3IG1 B;  4DR2 J;  2R3V A;  3V6H A;  1HQU A;  3R1L A;  2E5I A;  3NGU A;  4KHM A;  4DL0 C;  4C8K A;  3PYE A;  5KFP A;  2Z58 B;  3MXH P;  4Y28 C;  3P4U B;  4U6P A;  3VGU A;  2IBK A;  4ZVU B;  3JXO A;  4WII A;  1HFE L;  4RBV A;  4DL7 A;  2KVQ E;  2KTQ A;  3TJA A;  4USI A;  2P6S A;  2QT7 A;  2JSX A;  3ZNJ 1;  4BCA A;  1X4F A;  2IRX A;  4LF6 F;  3VQT A;  3AD9 C;  3H59 A;  1X4B A;  1DTQ B;  3QAT A;  2FGC A;  4DF4 A;  1OIA A;  1YX2 A;  4DQI A;  1SKS A;  1XNR F;  1HLW A;  1TUW A;  3EZO A;  1RWM B;  5ETQ A;  3TZX A;  2XNR A;  2B5J B;  3NNA A;  4ZPV R;  5DRK A;  2MZQ A;  2Y8Y A;  1YGY A;  4DV2 F;  3H98 A;  3IN5 A;  4KHP J;  3BSN A;  4LFB F;  1RT1 B;  3W9I A;  4NYP A;  4HHH A;  1KVJ A;  2RF2 A;  3H8Y A;  4ECQ A;  3BGL A;  2RNE A;  2Y1I A;  4ED7 A;  1F5B A;  3IBW A;  2XYG B;  4NLS A;  3V2U C;  1QSL A;  3OR1 B;  3D66 A;  1B3T A;  4LF5 J;  4FF2 A;  5F3Z A;  3HUL A;  3T41 A;  1EIY B;  3I82 A;  3HHL C;  5K20 B;  2KYZ A;  3RB3 A;  2HGM A;  3LA0 A;  1GFW B;  4V19 J;  1EX8 A;  2DNH A;  2HWH A;  5IWA J;  3CF5 Q;  2O3D A;  4B08 A;  2J6U A;  4EUV A;  1SC1 B;  1SQG A;  2ZH5 A;  1PAE X;  1KN6 A;  2ASL A;  2DNG A;  4ZN1 A;  2ZOG A;  2R8K A;  1I3O B;  5C25 A;  2O67 A;  2DNQ A;  1NK6 A;  3WX4 A;  4ES3 A;  4Z2X A;  2RDJ A;  3P3D A;  2GJ2 A;  2HFS A;  2JEJ A;  2MGZ B;  3GIK A;  2FZK B;  1DTT A;  2MQP A;  3KOA A;  2HFZ A;  2VJU A;  2HZA A;  1QAI A;  4Z37 A;  1GXT A;  1RE1 B;  3TRG A;  2RQM A;  5CZX A;  2XM3 A;  3HVR A;  1QTN B;  3RRK A;  3M8R A;  4A8Q A;  1HA1 A;  2E29 A;  4CO0 A;  4NLU A;  3TZY A;  2HQF A;  1F3V A;  2WON A;  3HM9 A;  3DRR B;  2RRA A;  3W60 A;  1NB2 A;  2MQQ A;  2BJ7 A;  1JLB B;  2ZH3 A;  3DXB A;  1T0T V;  2Y1R I;  1RXO B;  5LSL A;  3LP2 A;  3BQ0 A;  2W9A A;  5DQI A;  1UL3 A;  1IR2 A;  2ABY A;  4YR0 A;  2BRK A;  3KLE B;  4QWB A;  2ZJR Q;  4W98 A;  1OPZ A;  3FEZ A;  2B8Q A;  4NYO A;  4RNN A;  3M2V B;  2QA1 A;  5D0H A;  4C11 B;  3JAM Y;  4DL3 A;  5EWE A;  3V6D A;  3FGV A;  2YWG A;  2BR0 A;  1EQM A;  5KG2 A;  1YVF A;  3QBC A;  3M8Y A;  5T14 A;  1W26 A;  2RHQ B;  2C28 A;  1D0E A;  2YH0 A;  4O3R A;  1NCL A;  1N6Q B;  4PXE A;  1VJQ A;  3EXC X;  2YNH B;  4F36 A;  4JOU A;  3V4I A;  1HQU B;  3ZZP A;  2CQ2 A;  2BJE A;  3I6P A;  3UDV A;  3LPE A;  3HSZ A;  4YME A;  3RW7 A;  2R2U A;  2EEY A;  3V6J A;  2YPZ A;  1FRK A;  3C3L A;  4WK3 A;  2YXL A;  3CC4 S;  2PA8 D;  1V3Z A;  4V1A k;  3PW5 A;  1SKW A;  2FUG 9;  2NS1 B;  3NG8 A;  5E3P A;  1IKX A;  2HS3 A;  1OSD A;  5BYR A;  4Y2I A;  3AJ2 A;  1B0V A;  3L9Z A;  4FXW A;  2CPX A;  5ETO A;  3U27 A;  1U4B A;  1U2C A;  5B7W A;  3O8W A;  2B7B B;  4NEY A;  3UCU P;  3TVK A;  3J81 U;  3LWM A;  4WFB Q;  4ECS A;  1J27 A;  3C19 A;  4CM2 A;  1WOO A;  3M8P A;  4PXB A;  3DOM A;  3DLH A;  1RHR B;  1RTI A;  1D8Z A;  2LMI A;  3PX4 A;  3K8W A;  2FYX A;  3Q2T C;  4B9L A;  1EKR A;  1SH0 A;  1WJ9 A;  3TAP A;  2UUB J;  1S12 A;  1IR1 A;  4DR4 F;  2MSS A;  1C1B A;  2VF3 A;  5CQG A;  1HMV B;  4DV7 F;  2RF2 B;  3FUY A;  3PIO Q;  3DHX A;  3AT1 B;  6FDR A;  4CLZ A;  4KAI A;  4NA1 A;  1NLK L;  2I8E A;  3MHY A;  1S4E A;  4H54 A;  5KFU A;  4LF4 J;  3DOL A;  1DAX A;  2X1G A;  5D0R A;  2R4F A;  1JLG A;  2AEM A;  4N56 A;  2ZE2 A;  2UP1 A;  4BWM A;  2LA4 A;  4CQ1 A;  1QY7 A;  5BR8 J;  2J7K A;  4Y2A A;  4L75 A;  4K4T A;  2H5I B;  2XC9 A;  2IVY A;  1FWK A;  2J0X A;  1NHU A;  5C25 B;  5IWA F;  3J7Y I;  4JI4 J;  1N32 F;  3NP5 A;  2YKM A;  2VJV A;  1NJX A;  1ARO P;  3SFG A;  1U1R A;  2ZUA A;  3L7O A;  1R89 A;  4KRW A;  1H7W A;  3EE3 A;  3AHP A;  4C2M A;  4DQR A;  3PJ9 A;  2WON B;  4LMZ A;  2AWZ A;  3QLH A;  3HXM A;  2XBP A;  2XTJ P;  1KFD A;  3BB5 A;  2D3O R;  4F50 A;  5KFJ A;  1EAR A;  2BJ8 A;  2HAI A;  4N47 A;  4X4U A;  3KWM A;  2LA6 A;  1O8B A;  2ZHB A;  2JDJ A;  2GS8 A;  3LP2 B;  4WFA Q;  3TUJ C;  5LL6 d;  4P71 A;  3CJS A;  3BO3 A;  3EMT A;  2AYE A;  3PM9 A;  5JUM A;  4F0K A;  2IYG A;  3ZFV A;  3F56 A;  2CQ1 A;  1HPZ A;  3B82 A;  4FKY A;  2RB7 A;  5C5J A;  2GHW A;  3V6D B;  4QU6 A;  2E9Z A;  2W2P P;  3SZ2 A;  3PFO A;  1YQH A;  1KLM B;  5C2C A;  2ADB A;  4NOH A;  2P9C A;  4TQS A;  4OX8 A;  1TVR A;  3HHE A;  4DQS A;  1TMJ A;  3RB4 A;  2FHJ A;  5I3Q A;  3V4I B;  4NLR A;  3UNG C;  2RE1 A;  1VGY A;  1TKT B;  2BA9 A;  1KOH A;  2XO7 A;  1YK9 A;  1EHW A;  4RWW A;  4M5N A;  3MD1 A;  4F3Q A;  4ZVF A;  3KTQ A;  2MST A;  3FRZ A;  4DV4 J;  1IKX B;  1YKW A;  3D2W A;  4KR0 B;  2RD5 C;  4RR5 A;  5IZH A;  4FS2 A;  3HFZ B;  1M5H A;  5DJB A;  5HK4 A;  1QSY A;  2H1Y A;  2UXB F;  3G96 A;  2DGV A;  1NO8 A;  4KGZ B;  2E9R X;  4IFV A;  2FLP A;  2YWH A;  5LJ5 Y;  2W9C A;  2K8G A;  4OFZ A;  4Y65 A;  3M8P B;  3R5C A;  1GNK A;  1RWV B;  3T6J A;  3W9J A;  4Y2K A;  1RAJ A;  3ILJ A;  1U1N A;  1RTI B;  2C42 A;  3HJF A;  2NXJ A;  1IQT A;  2HHH J;  2VFR A;  4TY9 A;  1U1O A;  4O3P A;  1UJ6 A;  1GTH A;  4OZ5 A;  2C3O A;  3SYZ A;  2IA0 A;  2K06 A;  2E1A A;  4MIB A;  3GIM A;  4DS5 A;  2IM0 A;  3HVT A;  3NS7 B;  5LSR A;  1BHN A;  2RUS A;  1FNX H;  5L1K A;  1CLF A;  3HHK A;  1C1B B;  2VFV A;  1FEE A;  2GHV C;  1OY6 A;  3N9U C;  4KJI A;  1N52 B;  5DQG A;  2L08 A;  5G4D A;  1WF1 A;  2L9W A;  4LVO P;  2XHC A;  2UUB F;  2BRL A;  2WBM A;  4K4U A;  3DOL B;  1JQG A;  5K9F A;  3CVK A;  4UUW A;  2Y1L B;  1TL3 A;  1JLG B;  1SXL A;  2OPR A;  3W2W A;  4W90 B;  3FMB A;  3CSK A;  3KHG A;  1I94 J;  5BR8 F;  5KFM A;  2RAQ A;  4ILL A;  3CB4 A;  1RYR A;  2HNY A;  3H0P A;  1A7G E;  3ZZ0 A;  2YKM B;  3QYY A;  1WHV A;  3EZ5 A;  3LP1 A;  3TAQ A;  1HL6 A;  1I5O B;  3CCT A;  1KP6 A;  1YDL A;  3QRP A;  4JI4 F;  2R8G A;  1ZA2 B;  2WK4 A;  1RWP B;  1S72 S;  4NML A;  2UVU A;  4DUY J;  2P6T A;  3UDL A;  1EJ7 L;  1U25 A;  2R7X A;  5ITH A;  1TL7 A;  1KFS A;  4YP3 A;  1K47 A;  2VG5 A;  2PMZ D;  2VIH A;  3ZO7 A;  2YX4 A;  2NUH A;  2PGC A;  1WOP A;  3JTP A;  2DCU B;  1KEK A;  2IM2 A;  2QMX A;  2N4D A;  5D15 A;  1NPR A;  4JI5 J;  2Z57 B;  1ZA1 B;  1UCN A;  1FJE B;  3DC2 A;  1N88 A;  1KQK A;  4DUT A;  4DCO B;  4RWX A;  3W8G A;  2FJB B;  3PYG A;  3CTR A;  3L3C A;  5LMU J;  4USH A;  1LFP A;  2ASY A;  2YH1 A;  3ETM A;  2AZ3 A;  3GON A;  4G3I A;  5B0D A;  1TVR B;  1GXU A;  3QRQ A;  1Y5N B;  2EW9 A;  1N5Q A;  4DN9 A;  1RWX B;  2IDE A;  1XK8 A;  2MZJ A;  1U47 A;  2GNK A;  3GCX P;  5RUB A;  1IKY B;  4A8F A;  3KK1 A;  4LF7 J;  4RU2 A;  2Y0S D;  1G7C B;  2CQD A;  4OI2 A;  3DN9 A;  2B7C B;  3DDK A;  3OTC A;  3WC0 A;  4J9R A;  3OSN A;  5JVG Q;  2HHP A;  4HL9 A;  3SSR A;  4ANC A;  1REG X;  1NK9 A;  4QOT A;  1TP7 A;  5KG0 A;  2ATL A;  1FXD A;  3AOB A;  2GX8 A;  3G8S A;  4P2X A;  3M9N B;  3H2U B;  3MMB A;  1ZTW A;  4WU3 A;  4OYO A;  4OV6 A;  3SEO A;  5EGY A;  4IFV B;  1SH3 A;  2W9C B;  5A6P A;  4J91 A;  2RT3 A;  1RIS A;  4DSJ A;  3IP0 A;  3ELH A;  5KT7 A;  3CPW R;  2H5E A;  4DL2 A;  2AJ4 A;  2YWE A;  3RBZ A;  4U7U K;  2YY3 A;  2HZC A;  2QGF B;  1HWJ A;  2HZV A;  2G1D A;  3HVT B;  3TX0 A;  1Q86 T;  1GMW D;  1FDN A;  1FD2 A;  5KFV A;  4YFU A;  2HVZ A;  4ENO A;  1APS A;  4K2J A;  2W01 A;  4V19 X;  2HKE A;  2J6S A;  3R7N B;  3LAL A;  2CQG A;  5CCL A;  4B3S J;  4PG5 A;  5HI7 A;  1VLY A;  1TL3 B;  1ZAW A;  2JHE A;  3NMA A;  1H6K X;  2ZVI A;  4DSL A;  4KO0 A;  5BYQ A;  2QFJ A;  2XI3 A;  2OPR B;  3W2W B;  2MLY A;  3LAN A;  3GFY A;  3K5L A;  1XMO J;  1VRU A;  4ED2 A;  2R8H A;  3GJQ B;  4J90 A;  1AUS L;  2XNQ A;  3Q8R B;  4HH1 A;  1WOR A;  3OR2 A;  4RPF A;  3M8W A;  3UN3 A;  1P6T A;  3ITH A;  3ICL A;  4QR1 A;  2IFX A;  1SCJ B;  2JJ4 D;  4CNY A;  3MM9 B;  2HNY B;  3KHH A;  2GIQ A;  5F9L A;  1VIO A;  1EP4 A;  3LP1 B;  5KT5 A;  3QNW B;  4KGX B;  1I94 F;  3ENV A;  1N36 F;  3SCL E;  2JH3 A;  1T9Y A;  5G0R A;  4IR1 A;  1R8C A;  3QSY B;  5HRO A;  5E3A A;  4DU8 A;  2DKO B;  2QZ8 A;  5U47 A;  1TL7 B;  1RBL A;  1FJ7 A;  2VG5 B;  4DL6 A;  4MK7 A;  2YKO A;  4HDH A;  2AGP A;  1SJ3 P;  2C2N A;  1NSK L;  4DUY F;  3TAN A;  1NUE A;  3BH6 B;  3BQ2 A;  4I2Q B;  1DZ5 A;  1VQ8 S;  3AQP A;  4M5J A;  2DY9 A;  2GW8 A;  5L1L A;  2JLF A;  4LSN A;  3W9H A;  5KFB A;  3HT0 A;  1RT2 A;  3QWU A;  1H38 A;  1FT8 A;  2XS7 A;  2DHA A;  2AZ1 A;  2O66 A;  2YQ1 A;  2HLU A;  5J1E B;  1GK8 A;  2BW2 A;  4ELT A;  2HND A;  5D4L A;  1ZH5 A;  3KXD A;  1X4G A;  3PY8 A;  3PHT A;  5DDQ C;  3Q86 A;  3O6Q A;  3MOJ B;  1R8A A;  5DQH A;  1FJC A;  4RUB A;  2XUL A;  2GQ2 A;  4ITS A;  2QLX A;  1VQN S;  1M5S A;  3TZW A;  2QN6 B;  2K2P A;  4DFP A;  4HAC A;  1PYT A;  1KON A;  4DPO A;  1YJR A;  1S49 A;  2PII A;  3ZZU A;  4M5I A;  1S6P B;  2FLN A;  2YVS A;  2C3M A;  1XNQ F;  2ZZN A;  4LR7 A;  3HJV A;  1WHW A;  4ZVR B;  3VAK A;  5KT2 A;  4UY8 5;  4DR1 J;  4LF7 F;  2YX1 A;  3CJK A;  4X62 J;  1RLC L;  2HGL A;  1TL5 A;  4G65 A;  3NLC A;  1G1X A;  4NZ0 A;  3RUB L;  2IC3 A;  4NRU A;  3MR3 A;  2X1B A;  3R5D A;  1U0H A;  3TI0 A;  1FEH A;  2JVO A;  3QSI A;  4RW6 A;  4NLG A;  3R5B A;  2E1R A;  2EFN A;  2QLW A;  1UVI A;  4DX8 H;  5CCM A;  2BXJ A;  4PPD A;  3U1M A;  1KNZ A;  2E44 A;  4CLP A;  3PYF A;  4MH8 A;  3TWZ A;  2V8H A;  1SVD A;  2KXN B;  4USV A;  1FE0 A;  4IG3 A;  1S9G A;  5AXM A;  3EGN A;  1RWN B;  4WE1 A;  5GAE I;  4PQA A;  1ICE B;  1FVQ A;  4P10 A;  2XB2 D;  5AXN A;  3DDN A;  3ENA A;  4ZPC A;  1JWW A;  2KG0 A;  3W8P A;  1AA1 B;  2J76 E;  5IT9 Y;  3SFU A;  1N8R T;  2AV5 A;  3SDE A;  2MQM A;  3OHB A;  2VG7 A;  2OEJ A;  2HW3 A;  3A8I A;  3BV8 A;  2WSE C;  4XTT A;  4AFF A;  1VRT A;  2HQI A;  2GO9 A;  2F7V A;  1VRU B;  4BS2 A;  3PEH A;  5IOL A;  2XLI A;  4B3S F;  1F6T A;  3OR2 B;  3HVW A;  4JV2 A;  1CQM A;  4PPZ A;  3AA8 A;  1R0B G;  1XEZ A;  1EP4 B;  1X5P A;  2ERR A;  1NZA A;  2W25 A;  5KFF A;  3MCS A;  2KT5 A;  3DM2 A;  1YBA A;  4OYA A;  4UZC A;  3N79 A;  2A2D A;  3KJQ B;  5G0R B;  2YBV A;  3TO8 A;  4QZV B;  4YY3 F;  2FZC B;  3VGV A;  5HRO B;  4HI1 A;  4HI2 A;  2AEF A;  2V4J A;  2Q6B A;  1HNZ J;  3FVY A;  4A47 A;  1GH8 A;  4QJV A;  4GMK A;  1M1K T;  4HEA 9;  1WTB A;  4OX9 J;  1LK7 A;  2QYG A;  2J9C A;  3NAI A;  1W2I A;  4WZM A;  1XR5 A;  2JEF A;  4CLS A;  2BUN A;  1REV A;  5J1P A;  4DHV A;  5E7O B;  1P1L A;  1YJU A;  2ZBR A;  2MKI A;  4DX7 A;  1BXN A;  2Z2Y B;  1SBR A;  5L39 A;  2P2C B;  1U49 A;  2I6W A;  5C42 A;  1JJC B;  2R2R A;  3M6W A;  5CD4 H;  2DR8 A;  2VKR A;  2ZHO A;  3I0R A;  3G2X A;  2HFN A;  4CIO A;  2MZ1 A;  3B6B A;  5D4O A;  4ZLJ A;  4Q8F A;  1IVZ A;  4S0M A;  1RA7 A;  1T8E A;  4PG6 A;  4H4O A;  2QX0 A;  4OZN A;  2EXU A;  2H48 B;  3BRE A;  4CP5 A;  2BDP A;  1Z4U A;  3AAW B;  4C0O C;  4HAC B;  2J7W A;  1PJ6 A;  4RBU A;  1D9F A;  1GX6 A;  4Q43 A;  3DRS A;  2EI5 A;  3OV7 A;  1GAO A;  5CH7 B;  2N7Y A;  2M5Y A;  2V8P A;  4OX6 A;  1IBL J;  2ZC3 A;  1SJR A;  4QIG A;  2NR0 A;  1HBM A;  4OZL A;  1L3T A;  1NB7 A;  5ETV A;  4RW4 B;  4K4W A;  4DFM A;  3M6U A;  4YQW A;  3TA2 A;  4UZB A;  5I3P A;  1FXR A;  1O5J A;  3IS9 A;  2CAD A;  4DR1 F;  3WHI A;  1VQY A;  1HYS A;  1WC0 A;  1F5C A;  3TOQ A;  3AD8 C;  3TYT A;  2HBY B;  4F7V A;  3H90 A;  3ZZT A;  2JL9 A;  4J9S A;  4WP9 A;  2ZJQ Q;  4BDP A;  2NXU A;  3RTV A;  1Y10 A;  4RW6 B;  2CYY A;  2E9T A;  4X4O A;  2DGU A;  2XY7 A;  4J37 A;  1CQN A;  2XG8 A;  2GVD A;  3QAU A;  4IG3 B;  4X66 J;  1VK8 A;  3G71 S;  1BUX A;  1S9G B;  1UET A;  4WE1 B;  5GAH I;  2Q1L A;  2QC3 A;  1UPP A;  1HBU A;  4ZVS B;  4LJM A;  2ZM6 F;  1S57 A;  1JK9 B;  3CT9 A;  4OL8 A;  5F8J A;  3VAM A;  1BQX A;  2VG7 B;  1VQK S;  2NRE A;  2RKI A;  3CCQ S;  3KK2 A;  5ETP A;  2FC9 A;  4IDK A;  3H2L A;  3W64 A;  4YB5 A;  3GFZ A;  2CAJ A;  2VD3 A;  4MK9 A;  4PKD B;  1X5O A;  4QYR A;  3U1N A;  2FLL A;  4A8W A;  4DXL A;  3VGT A;  5DGA A;  1TQL A;  1KKH A;  1JLC A;  4ZKA A;  2ZWP A;  4F4Z A;  2FVS A;  4ED5 A;  4ID8 A;  4LF8 F;  1RT3 A;  4OJH A;  2HLT A;  1FTR A;  3PKY A;  1A9N B;  3DM2 B;  4DS4 A;  4ZCL A;  3J80 U;  2NUU G;  3PX6 A;  1X60 A;  5M2R A;  4QIV A;  2XS5 A;  4TU8 A;  1SV5 A;  1YIT S;  3ZZY A;  2WVB A;  3SV3 A;  2BQU A;  1JLF B;  4NCG A;  2V4J B;  3NL0 A;  1X7V A;  2FY1 A;  1NPK A;  3IR5 B;  3CNQ P;  2YNF A;  4OI0 A;  4MTP A;  2CNO B;  1MN7 A;  1SKU B;  2RDI A;  5H9E K;  5KT6 A;  2EC0 A;  2LQ8 A;  2MKH A;  3CDA A;  1UJ4 A;  1RAH B;  4CT8 A;  5C2G A;  4ZVE A;  5IQQ A;  2A18 A;  3BQ1 A;  4LIR A;  4WFX A;  2YKQ A;  1U45 A;  4DI6 A;  3I0R B;  1VC5 A;  1X4E A;  2ZJP Q;  2LXF A;  3BSO A;  3K17 A;  4B9N A;  3EDR B;  4IQM A;  1T95 A;  3CDB A;  4LFC J;  3P5B P;  4XIU A;  3AOC A;  1FVS A;  4OLO A;  1KVI A;  2DGX A;  5SUH A;  4HTI A;  3PNI A;  2MMY A;  1RA6 A;  3DHW C;  2VQE J;  5ETS A;  3W3S A;  1FDA A;  4JBC A;  3DMJ A;  3NRB A;  3MDF A;  3G86 A;  3PG9 A;  1HHS A;  3C8Y A;  3NS6 A;  4GKK F;  3DRS B;  1OY9 A;  1SJQ A;  3QT8 A;  2HRY A;  1IR0 A;  5F8M A;  4USM A;  4O3N A;  1T9T A;  2BJ3 A;  2L41 A;  4O23 A;  1D1U A;  1HBM B;  3VAL A;  5CYQ B;  1IUJ A;  1P9Y A;  2JNJ A;  4DV1 J;  2NLW A;  4I0W A;  1LQ9 A;  4J9N A;  1V3R A;  2E1C A;  2R7V A;  3IS9 B;  3LWL A;  1HYS B;  1M5V C;  4C8L A;  1IQZ A;  4WYW A;  2CWX A;  3BGR A;  1FE4 A;  4QPX A;  4KQZ A;  1WC1 A;  1RI7 A;  1IWA A;  4FF4 A;  4O3S A;  2FVC A;  1NJY A;  3JSB A;  1M90 T;  4BHQ A;  2MLZ A;  2GV1 A;  4KT0 C;  2AF6 A;  5ETK A;  2BJD A;  1AT1 B;  2HMI A;  3NNC A;  1HBU B;  4X4V A;  3D67 A;  3LTO A;  3TNV A;  3RGI A;  4EYH B;  2M9K A;  5DDO C;  3TUI C;  1B99 A;  3G6E S;  3KK2 B;  4IDK B;  1JJ2 R;  3I32 A;  3BGU A;  5J2M A;  1NK8 A;  2IVF B;  3R27 A;  1RHQ B;  5ETN A;  4J7C A;  3UR0 A;  1ZZF A;  2HNZ A;  1XWL A;  2UUA F;  3FK4 A;  4IO9 Q;  1B0T A;  3SIP B;  1JLC B;  1WG5 A;  2EPI A;  4OX7 A;  1RWW B;  2J9D A;  1NEE A;  2LEA A;  5IT4 A;  1UVL A;  3CW2 C;  4A8M P;  1UJ5 A;  2HFV A;  4B9U A;  1F0X A;  3OW2 R;  4B3M J;  5KFN A;  1RT3 B;  1WDT A;  2MJU A;  2J9E A;  3Q22 A;  3MAA A;  1HI8 A;  4QW8 A;  2JVR A;  4R0E A;  1TAU A;  3I5C A;  4ED0 A;  1SV5 B;  4F3M A;  4Q44 A;  4GKJ F;  2IIH A;  4NCG B;  4OHV A;  2KFY A;  1JMT A;  2EG1 A;  4LFA J;  1H0H B;  5IV4 A;  3M30 B;  1Y11 A;  2YNF B;  4NZ7 A;  1T3O A;  4CO4 A;  2CVE A;  2G0J A;  2NPI A;  2W2Q P;  4UTG A;  3MR5 A;  3I31 A;  2GQC A;  3CDU A;  2IJN A;  4P73 A;  1CJU A;  3FCW A;  1YJN S;  3E2E A;  1T02 A;  1IKW A;  4DV6 J;  3IGV A;  4ER8 A;  3DLK B;  3TUP A;  2XY6 A;  4K50 A;  2DRD A;  2IHR 1;  4FYX B;  1LK5 A;  3A8J A;  1FKA F;  4MYU A;  4EFA C;  4M94 A;  5HBM A;  2P9E A;  1ZM3 A;  3RU0 A;  1TV6 B;  3IWX A;  5CHC B;  2DXD A;  3MEC A;  3B4D A;  3LPY A;  3EGZ A;  4QW9 A;  5I42 A;  3JQK A;  4DX6 A;  1RK8 A;  3BYR A;  1O0P A;  2M88 A;  3G87 A;  4KH1 B;  4J9L A;  4I6Y A;  3FSI A;  5HP1 A;  3EVM A;  2ROG A;  1FDB A;  5D77 A;  3CD5 A;  3FQL A;  5ETR A;  5CYJ A;  4MFB B;  4LFC F;  2AGO A;  1S1U A;  1SQF A;  1NHV A;  4NMX A;  2Q6C A;  3QFH A;  1BGX T;  5SZT A;  2ZEJ A;  2FHK A;  1VOM A;  3CCR S;  2W8L A;  1K0V A;  4OYB A;  3N01 A;  3ZTR A;  3QPI A;  2UUC J;  3PV8 A;  4GC7 A;  2DGW A;  4A8O A;  4FPI A;  3QJJ A;  2B4V A;  2LQ5 A;  5B0C A;  1Y5I B;  3OFH A;  3OXL A;  2DNO A;  4M8L A;  4GO7 X;  3PW7 A;  3D0H E;  4IH6 A;  3BS9 A;  2V8V A;  4O3Q A;  5C7P A;  1QAX A;  3BGR B;  5M2U A;  3VAH A;  1TAQ A;  5GME A;  2FJA B;  3QID A;  2QIF A;  5KG5 A;  3NEK A;  4PUO A;  3Q23 A;  2XCA A;  4HHJ A;  1CSJ A;  1TUG B;  2DCL A;  2UUW A;  4YHH F;  4MKV A;  5KFQ A;  2HMI B;  4OI6 A;  1GMU A;  2RU3 A;  4M5G A;  3GMG A;  5F8N A;  4DPW A;  3OXG A;  3AOA A;  3VWS A;  1TFW A;  3SMZ A;  4A48 A;  1S1V A;  2XEX A;  1KOO A;  4DL4 A;  2BAC A;  4LR9 A;  1LNQ A;  2WB4 A;  4I69 A;  5J2M B;  3UD5 A;  2CKW A;  3MD3 A;  4WPA A;  1MMN A;  2Q79 A;  1AFJ A;  2ALY B;  1EKS A;  4ECT A;  2M8D B;  2Y9H A;  5KFT A;  1FKO A;  1PIE A;  1U1Q A;  2J9D E;  2DHX A;  4E98 A;  5L1J A;  1I6J A;  1ROF A;  2LEB A;  1PYO B;  1N34 F;  3MAA B;  2GMH A;  2XHW A;  3O2I A;  1Z2Z A;  4HT5 A;  2XSF A;  1WD6 A;  1DY3 A;  1FFW B;  1ZPW X;  4B3M F;  1ZM9 A;  2L48 A;  3T5L A;  2AKW B;  3MAH A;  3RBE A;  4Y34 A;  2BE7 D;  1UTA A;  2XMM A;  2VB6 A;  3L95 X;  2WVF A;  3CCZ A;  3I96 A;  2D9O A;  3U02 A;  2ZBI A;  1CJU B;  1YI2 S;  4LF1 A;  4LFA F;  1RT7 A;  3H4D A;  3ZZO A;  3A4T A;  1SB6 A;  4P6Q A;  4XK8 C;  2C2D A;  4KC5 A;  2NZC A;  4LQ9 A;  1L3U A;  2V4R A;  5HBM B;  4TU7 A;  3L7P A;  5KFR A;  2HFU A;  2HK2 A;  1S99 A;  3MEC B;  4ZIT A;  1IBM J;  2XCP A;  1ZM2 A;  4OLP A;  2POK A;  2CJY B;  6FD1 A;  3EJM A;  5I42 B;  2XMW A;  2CXE A;  4I7F A;  3N28 A;  2MY7 A;  1H3D A;  2RSQ A;  1N5Y A;  1S59 A;  4ZP8 A;  3CCU S;  3DCA A;  1HWK A;  4NA3 A;  3BZQ A;  5HP1 B;  4X4R A;  4LRE A;  5AE2 A;  4DEZ A;  2CPZ A;  2ZVS A;  3QWP A;  1S1U B;  2A0F B;  1Q8I A;  3K5P A;  4O0N A;  4YOE A;  4QIF A;  2UXC F;  2GFF A;  3R5G A;  4J9U E;  2Z30 B;  4OYZ A;  3GCW P;  2BQ3 A;  4C8O A;  2A6M A;  2NYI A;  1S5Z A;  5CD4 A;  2ZZT A;  3G9C A;  3KK3 A;  1YBT A;  1Y00 A;  2MPU A;  4FKX A;  3D3B J;  3GV7 B;  4WP3 A;  5GAE U;  1SQE A;  4J9M A;  2XZD B;  1AZS A;  2QMU B;  2ASJ A;  3PFE A;  1X5T A;  2COL A;  1DTQ A;  2R42 A;  3KJV A;  4KGV B;  4KY3 A;  2VIC A;  5HMY A;  3PEJ A;  2UUC F;  1WEZ A;  2AU0 A;  1G2E A;  4DR6 F;  1FI4 A;  2HHU A;  2RML A;  2F3J A;  2B5J A;  4PXD A;  3KJF B;  3V5R A;  3CC7 S;  1MWQ A;  4JI8 J;  2IJR A;  1GMV A;  4ZPW R;  4JUZ A;  4NLT A;  4N5S A;  3G6X A;  2YKP A;  4PUO B;  4PWD A;  3P8B B;  4C8Y A;  2PD1 A;  3I9V 9;  3UE2 A;  5AE3 A;  1H72 C;  5MLC V;  1D9D A;  1S9E A;  2DH7 A;  1YJ9 S;  3M4X A;  1NDK A;  4QR2 A;  2F8M A;  3QT6 A;  1Z2L A;  2ACM A;  2I9S A;  4DR5 J;  3TVZ A;  3MFH A;  3KLG B;  2B3T B;  4NI2 B;  3OR1 A;  2YQ3 A;  5D3G A;  5KAK A;  3MMC A;  4IYQ A;  4WIQ A;  2BE2 A;  1S1V B;  2ZFH A;  1U26 A;  2D3O 1;  3KHR A;  2BX6 A;  3C6T A;  1B4S A;  3KDN A;  4ZN3 A;  1RB0 A;  1KQG B;  1N33 J;  3NCP A;  1K1Q A;  4NCA A;  4J9K A;  4B9S A;  1JLA A;  3I4P A;  4ZPA A;  1X9W A;  2KVI A;  1RUS A;  8AT1 B;  1FKO B;  3IXQ A;  3QQC D;  2OPS A;  4EU0 A;  3BKF A;  5E5N A;  1U1K A;  4JYA J;  4O3O A;  5DM7 Q;  4PAA A;  4YB7 A;  3CCM S;  1CG2 A;  4IUF A;  1FJG J;  3DRR A;  2F63 A;  3DYA A;  3U7J A;  3EYZ A;  2OSR A;  4LIW A;  4M63 A;  2DNZ A;  1UVM A;  4EEY A;  2DNR A;  3S6E A;  1RJJ A;  2CG4 A;  2W1B A;  4CYU A;  5DLF A;  1CEZ A;  3ILO A;  3CUN A;  1TKZ A;  3EPG A;  2DYA A;  1RT7 B;  4PEO A;  3AH6 A;  2B6A A;  2VQF F;  3GWC A;  3THV A;  2ZDP A;  3M2V A;  2JEI A;  3CE8 A;  2PFF B;  5FJ4 A;  2GJF A;  4FBU A;  3R3T A;  3QGG A;  4NZ6 A;  2VBZ A;  1S0V A;  4Q7A A;  2OO4 A;  3I5B A;  4I4B A;  4I7F B;  3GJT B;  2LDY A;  4W4M A;  1QLN A;  2C2O B;  5KOW A;  1IBM F;  2RVJ A;  2GO8 A;  5EWF A;  4K4X A;  2YNH A;  3VHQ A;  2GMJ A;  2WTF A;  3THT A;  2DGQ A;  4CLW A;  2EFQ A;  2MQ8 A;  3R97 A;  2W2N P;  3LH2 S;  1S7H A;  2XLK A;  2RUG A;  2KZZ A;  1BQM A;  3PW0 A;  2R7U A;  1YBU A;  2BBE A;  4I68 A;  5KFZ A;  2Z0G A;  2DT9 A;  1WSV A;  1WG4 A;  5I3U B;  1OJ4 A;  4RW9 A;  4R8U A;  3PRD A;  2DBB A;  3KLI B;  2NQP A;  2APO A;  3AJ1 A;  3KK3 B;  2AMC B;  1NK4 A;  3Q89 A;  3NGS A;  3NWG A;  4JI1 J;  4DV0 J;  2PT0 A;  3IM8 A;  5LJ3 Y;  2K3I A;  2RIL A;  5E3C A;  5GAH U;  1AZS B;  4O0I A;  5H9E J;  1CBK A;  2CQ4 A;  3MED A;  2H4W B;  3KJV B;  2C2K B;  4P2M A;  2LVW A;  2NXN A;  4GVB A;  3T5J A;  1K73 T;  1IJF B;  4ZJL A;  2W7A A;  2V9K A;  1Q16 B;  5LXR A;  1HAR A;  2X1F A;  4CO1 A;  3ZTP A;  4G6V B;  1UAW A;  3CCV S;  1NU4 A;  2EBE A;  2KT3 A;  3EXY A;  3TJ9 A;  3FBC A;  2WRM A;  1L3K A;  4QU7 A;  3VZH A;  4ETX A;  4PWD B;  3UQS A;  4TY8 A;  2KFN A;  1HMV A;  1RT4 A;  4QYZ K;  4NEZ A;  4ZHR A;  3A8K A;  1S9E B;  1UWB A;  2NPF A;  4ZPB A;  2AJF E;  3EGW B;  3B4M A;  4HT7 A;  1ZZN A;  3OTO J;  1C0T A;  1GEH A;  4OJ1 A;  1RYS A;  2YQ0 A;  3US5 A;  3MMA A;  4TVA B;  4ED4 A;  1LKZ A;  2OPQ A;  5D3G B;  3I55 S;  3MMC B;  2DJW A;  4ATN A;  2VH7 A;  1I1G A;  4JI7 J;  1HHQ A;  4F4X A;  3DXS X;  3CJ0 A;  3OL6 A;  1U8S A;  2BE2 B;  1WI8 A;  2G2Y A;  3HZG A;  1VQS A;  2GA7 A;  1T9W A;  4NLV A;  3FFI A;  1D8Y A;  3UDC A;  1JJ4 A;  1R31 A;  2B4U A;  1SL0 A;  4CO2 A;  3C6T B;  2B9W A;  3D6T B;  4I56 A;  2O5D A;  5B0F A;  4EYI B;  4UOG A;  2UVV A;  2DNY A;  1JLA B;  1QE1 B;  3CUL A;  1FKP A;  2AHO B;  4WF9 Q;  1NH7 A;  1RT5 A;  5L9N A;  1N33 F;  2OPS B;  2VFT A;  3D6H B;  3JB9 k;  1U0S A;  3PKM A;  3BBC A;  3MPV A;  2KHD A;  4A8S A;  1BLU A;  5A2Q U;  3MCO A;  4OI1 A;  3W61 A;  1S77 D;  2NSB A;  2GGP B;  2JFD A;  3E01 B;  3PJW A;  3QJP A;  2DB1 A;  2R9L A;  1S76 D;  4E8U A;  4JI3 F;  3DYA B;  2X1A A;  3ZNU A;  2BEF A;  3ULH A;  4Y3C A;  5FLX U;  4ZIW A;  1DJ0 A;  2QMW A;  5BXI A;  2YTC A;  1F3F A;  1KHV A;  1FNM A;  1M1H A;  1W7W A;  3KUE A;  4ZVQ B;  3QGI A;  2JOQ A;  4CYU B;  2B4O A;  1TKZ B;  2EFG A;  2LU2 A;  2J0Q D;  3MZI A;  2LQJ A;  2XMV A;  5H9F K;  1RTH A;  4IG0 A;  2B6A B;  3HHN B;  1SKR A;  5KFI A;  3E51 A;  3LUY A;  4K4Z A;  4M5L A;  4LT6 A;  4WTY A;  1XER A;  1AFI A;  1TKX A;  3DI6 A;  3OLB A;  5HMW A;  2GZO A;  4NLW A;  3CJ3 A;  1J5E J;  4EGL A;  2X3G A;  4EO8 A;  3VCD A;  2U2F A;  4ZIV A;  4NX9 A;  1X4A A;  4XO0 A;  3CIZ A;  4AE5 A;  2N3O A;  1KLM A;  3LAM A;  3T1H F;  2FTR A;  5A8K A;  5DZ7 A;  4AL7 A;  4Y2M A;  3PO5 A;  4DF8 A;  1KDN A;  4LRF A;  4FYW B;  4KV8 B;  2MJN A;  4F4K A;  3AXK A;  2A2C A;  3BGF A;  4C0B A;  1TKT A;  3GR0 A;  2MLX A;  2XGQ A;  4F8R A;  4LF9 F;  4RKU C;  1O6X A;  1JB0 C;  1XN9 A;  2R8J A;  3HK2 A;  1TR0 A;  1BQM B;  3NWR A;  4R5P B;  4DZD A;  5EDW A;  5FLX Y;  4QPT A;  1UW4 A;  1CJK A;  4DR2 F;  3HSG A;  1RAE B;  1V9O A;  4X4S A;  2ZH4 A;  3MF5 A;  4NXM J;  4RW9 B;  4R8U B;  1RTJ A;  3DRP A;  4L76 A;  4Q5V A;  3A3N B;  5AXK A;  3MPY A;  3DFE A;  1NAQ A;  3IO1 A;  3G82 A;  3MWB A;  1CC7 A;  2ROP A;  2GJI A;  1IJE B;  1K44 A;  3FEX B;  3ETO A;  3GZ7 A;  4JI0 J;  1X9M A;  1TUV A;  3JSY A;  3MED B;  4JI1 F;  3ILL A;  4DV0 F;  2VV5 A;  4GVB B;  4RUA A;  3N5F A;  4LVN P;  1KHW A;  7FDR A;  3CO0 P;  5LSO A;  1UP1 A;  3D68 A;  2XWX A;  4RNM A;  4RU9 A;  1L3V A;  2OEK A;  3LOU A;  5T7L A;  1RAD B;  3N6N A;  2R8I A;  2J0S D;  2UV8 G;  1LWE A;  3D54 A;  4ZVP B;  4DV5 J;  2KB2 A;  4NRT A;  4TY8 B;  1RT4 B;  1Q7L B;  1BY9 A;  4ZHR B;  1UWB B;  4UY8 T;  4KHP F;  2IA6 A;  4ECX A;  2F5G A;  3EVO A;  3MM7 A;  1C0T B;  5KFL A;  4MAK A;  2YPY A;  3MMA B;  3L7U A;  2OPQ B;  2DK2 A;  3AFG A;  3RG6 A;  1U8W A;  5B08 A;  1QUV A;  2XWY A;  1FFS B;  2FVR A;  1MN9 A;  3QAE A;  4F0H A;  3AA9 A;  3H5Y A;  3FFI B;  3K5N A;  4FNH A;  4LF5 F;  1XQI A;  3K59 A;  3KG0 A;  1TFY A;  4KGM A;  3H7H B;  1Q8K A;  3IGN A;  4L3K A;  3M8Z A;  2F4V J;  5ADZ A;  3J81 Y;  4YB1 P;  2PMH A;  2YWW A;  2Y1J A;  1WUU A;  2KKH A;  1F2H A;  3MR2 A;  3DRX A;  1FKP B;  1VBY A;  1RT5 B;  4M5D A;  1UVJ A;  3BKU A;  2DNN A;  5DM6 Q;  2H9Z A;  1RWU A;  4ZP6 A;  1RHM B;  4DX5 A;  3JTO A;  4C97 A;  3JSM A;  3FSY A;  2WZ1 A;  4AND A;  2G9O A;  3C15 A;  3M05 A;  5GAG I;  5KG7 A;  4CM0 A;  2FJV A;  1T3N A;  3OJU A;  4MIW A;  5KT4 A;  1JLE A;  1E6V A;  4OZ3 A;  1IM6 A;  3W5Y A;  1FRI A;  2BKN A;  1LW0 A;  1RAG B;  4FN5 A;  4JV5 J;  5JMN A;  1NBE B;  5IFM A;  3EVW A;  4ICL A;  2D3Z A;  5E0O A;  1RTH B;  1QTM A;  4IG0 B;  1NSP A;  3VAI A;  2FJX A;  1JLQ A;  2MZT A;  5AT1 B;  2N82 B;  3CGI A;  4P9S A;  1S0O A;  1TKX B;  2OD4 A;  3DI6 B;  2CQP A;  2SXL A;  3V4M A;  3PR5 B;  3IR7 B;  3OQ2 A;  3CD0 A;  2G4B A;  1MG7 A;  3M6X A;  5L38 A;  1S6O A;  2EWH A;  1URN A;  2QL9 B;  1URR A;  1M5K C;  1NDC A;  5A8K B;  1WNE A;  2LCW A;  3CJ5 A;  2R7S A;  1WEY A;  2WSF C;  4DSE A;  4K4Y A;  1GMW A;  2E1P A;  4QIE A;  3UI3 A;  1IKY A;  1U1L A;  1HQE A;  3UFC X;  3KMQ A;  2ZIT A;  4ZPD A;  1SH2 A;  4RO0 A;  1FES A;  1RQ0 A;  2QA2 A;  1RP5 A;  1CJK B;  4QWA A;  4DUZ J;  3OFE A;  1Q0N A;  1R8P A;  4XDC A;  1MWZ A;  1RTJ B;  3DRP B;  1VQ4 S;  2E5J A;  3IC1 A;  3SBM A;  5LM7 E;  5KFW A;  3RRG A;  2DNM A;  1JNR B;  3Q24 A;  3G82 B;  3OTB A;  3VVT A;  5C24 A;  5E3Q A;  4NXM F;  2FJW A;  1SIW B;  5KFA A;  3OLA A;  2E5L J;  5FDL A;  4JI6 J;  4EZ6 A;  2I5J B;  2MZS A;  1KVK A;  3S8S A;  1ZAX A;  1XIQ A;  3I56 S;  3A12 A;  3WBZ A;  3NGK A;  1EB0 A;  2FHM A;  4YUD A;  1CPZ A;  3JSR A;  2MKJ A;  3T1Y J;  4NXN J;  4GO5 X;  2VC1 A;  5T7L B;  1Y0H A;  1X4H A;  4P74 A;  4IRK A;  1BC6 A;  4MKB A;  3FZB A;  4KPY A;  4H4K A;  4OHW A;  1LWE B;  4B02 A;  2LYV A;  4ED3 A;  1IBK J;  4CCH A;  2OSQ A; 
#chains in the Genus database with same CATH homology
 4ANE A;  1BE4 A;  2BEF A;  2CWK A;  4CP5 A;  4EK2 A;  1NDL A;  3DKD A;  5BXI A;  3VGV A;  1NDK A;  3EVO A;  4O0N A;  1LEO A;  1NCL A;  3EE3 A;  4DZ6 A;  2HVE A;  4UOH A;  1F3F A;  1BUX A;  1BHN A;  3NGT A;  4F36 A;  3L7U A;  3PRV A;  4ENO A;  3Q8V A;  1W7W A;  1NPK A;  1ZS6 A;  3PJ9 A;  2NCK L;  3JS9 A;  3EVW A;  1LWX A;  1WKK A;  3ENA A;  1U8W A;  1S5Z A;  1MN7 A;  1HHQ A;  1NSK L;  1NUE A;  1S57 A;  3BH6 B;  5CAB A;  1NB2 A;  4C6A A;  3NGU A;  1PKU A;  4KPC A;  1MN9 A;  2DYA A;  3DDI A;  1EHW A;  3Q89 A;  1VYA A;  3EIC A;  1NLK L;  3FCW A;  3NGS A;  1B99 A;  3GP9 A;  1NSP A;  2DY9 A;  3MPD A;  1NHK L;  3ZTR A;  3Q8U A;  1XQI A;  3VVT A;  4ANC A;  2BX6 A;  1JXV A;  4FKX A;  1B4S A;  4F4A A;  1K44 A;  3VGU A;  4UOF A;  2DXE A;  3BBB A;  3Q83 A;  1UCN A;  4UOG A;  3FKB A;  3FCV A;  3NGR A;  3ZTS A;  2HVD A;  2AZ1 A;  3EMT A;  1NSQ A;  3ZTO A;  3BBF A;  1XIQ A;  5IOL A;  2DXD A;  4DUT A;  2B8P A;  3Q8Y A;  4W98 A;  5C7P A;  1F6T A;  3EM1 A;  4DI6 A;  3VGT A;  1PAE X;  3FBB A;  3FBF A;  3EJM A;  2B8Q A;  3G2X A;  1HIY A;  3FC9 A;  3B6B A;  3FBE A;  1WKL A;  1NDC A;  4FKY A;  3Q86 A;  2HUR A;  4S0M A;  3BBC A;  3VGS A;  3ZTP A;  2VU5 A;  3BH7 B;  4WBF A;  3WX8 A;  1S59 A;  3ELH A;  4HR2 A;  1WKJ A;  1KDN A;  4AND A;  1NDP A;  2DXF A;  3R9L A;  3FBC A;  3ZTQ A;  1HLW A;  3GPA A;  3ETM A;  3VVU A;  5CAA A;  2AZ3 A;  3EVM A;  3B54 A;  2ZUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...