3VCDA

Computationally designed self-assembling octahedral cage protein, o333, crystallized in space group r32
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
184
structure length
184
Chain Sequence
SQAIGILELTSIAAGMELGDAMLKSANVDLLVSKTISPGKFLLMLGGDIGAIQQAIETGTSQAGELLVDSLVLANIHPSVLPAISGLNSVDKRQAVGIVETWSVAACISAADRAVKGSNVTLVRVHMAFGIGGKCYMVVAGDVSDVALAVTVASSSAGAYGLLVYASLIPRPHEAMWRQMVEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Propanediol utilization polyhedral body protein PduT
publication title Computational design of self-assembling protein nanomaterials with atomic level accuracy.
pubmed doi rcsb
source organism Salmonella enterica
total genus 50
structure length 184
sequence length 184
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3vcdA02
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3vcdA01
2A18A 4DDFA 4P7VA 4LIWA 2A10A 3CIMA 4AXIA 3SSSA 3CGIA 2G13A 4P2SA 2A1BA 3I6PA 4QIFA 3PACA 3DNCA 4OLOA 3BN4A 3SSRA 4OLPA 5DJBA 3NGKA 4P7TA 2EWHA 5L38A 3MPYA 3MPWA 4OX8A 4OX7A 4QIEA 3N79A 3NWGA 4RBVA 4PPDA 4QIGA 4OX6A 3DN9A 4QIVA 4RBUA 3I96A 3IA0A 4AXJA 4RBTA 3VCDA 3H8YA 3SSQA
chains in the Genus database with same CATH superfamily
2V63A 3E01B 5KFZA 5HROB 4J9NA 1P8GA 2GVDA 2CPJA 3KJFB 4NLQA 2H5EA 1HHTP 1EX8A 5HANA 4CQ1A 2UP1A 3PRVA 1SI9A 1NUEA 2QT7A 4J9MA 1T03A 4WIIA 1HMVA 5D3GB 3KG1A 4AYBD 1YTYA 3HHLC 1R0BG 1RTHA 3GTYX 2XQCA 4NLRA 5HI7A 3U1MA 2MJUA 4U7UK 1RWMB 1Y11A 1VC5A 1L3VA 4DL4A 2DYAA 1RKIA 4ERDA 1RTJB 2AHOB 3H8YA 4CP5A 1YJTA 2Y1RI 4DPXA 3GU0A 2HLTA 1AUSL 2RE1A 4MK9A 2VPXB 3QLHB 5M2RA 4V19X 1FJGF 2HG4A 4KHMA 3AY0A 4USTA 4DR3F 2I9SA 4ALZA 2BM0A 1GTEA 4DV4J 2DO0A 4PEOA 3UWTA 2JFKA 5KFHA 2RB7A 1VYAA 4LT6A 4DSEA 4TY8B 2BXJA 3MD3A 3OTOF 2EC2A 3A8KA 2VV5A 2JC0A 4ES2A 2PI4A 2D3O1 1JLGA 3HDSA 1Q82T 1HQ2A 3MF5A 3M9NB 1WHVA 5CYMB 2A10A 4RW6A 4NLXA 3CJKA 1VQ8S 4YY3J 2PO4A 4H54A 5KFTA 4ECWA 4WYWA 4X4OA 3SZ2A 3MAHA 1SKSA 4UZBA 3GSIA 1GAOA 4GKKJ 2GAGC 1N4LA 4WWSA 2V6AA 5IQQA 2XLJA 5GADI 4UF4A 3I56S 2LEPA 4DL6A 4CYUB 1WNEA 1GEHA 4U6PA 4ZVFA 2FVQA 4OJ1A 2DY1A 4ZVTB 2O5DA 4P71A 1T05B 1NJIT 5KT7A 3QT6A 2ZITA 1R89A 3TAMA 3CULA 3ISNC 5LXYA 3Q8PB 3ILJA 3C14A 3HSDA 1U26A 2V8PA 2XCAA 1T02A 2MZSA 5KFYA 4Q2LA 1IUJA 1REGX 3H90A 1H7WA 4FNHA 3RB6A 2R7XA 3PFEA 4ECQA 1UETA 2VFUA 1Q95G 4JV5J 2AGQA 4NLGA 4JI1J 2KFYA 4H4MB 4C3LA 1PSDA 2GQQA 4P2XA 4RW7B 5G0RB 4C2MA 1R8AA 2UXBF 5KFIA 1T0TV 1TMMA 2HKEA 2YKOA 1OY6A 2VFTA 1T3NA 2J5AA 4ILMA 2HS3A 4LR9A 1C0TA 3M05A 5K8OA 1DQ8A 3B78A 3BPDA 1VQ6S 4QYRA 2XG8A 3GB0A 2V9KA 2Y3YA 1HKAA 3GYXB 2K1RB 4EEYA 2UVRA 2UUTA 3FSXA 4F25A 3BKUA 3MUMP 4HACA 2JFDA 2HRUA 1V9OA 3OTBA 4ZPAA 1EP4B 4WXWA 3K5OA 3GYNA 4PG5A 2WW8A 2HW3A 3ILIA 3A8IA 2BJ3A 1TK0A 3G82B 3Q8SB 4HVZA 8ATCB 4Y2IA 2F65A 4NLUA 3K89A 1S6QA 3NGSA 2ASLA 1EQMA 1LWEB 3K5LA 2YVSA 5HO4A 3HF5A 1CJVB 4X4NA 2FY1A 3P5BP 4NYZA 4DBQA 4ZCLA 1TUVA 2CZVC 2Z4PA 1RAAB 4ES1A 1VBKA 4PUOB 1YWXA 2XHWA 3HMJG 1S72S 4G3IA 1FEEA 1W2IA 4FKXA 1KLMB 5A8KA 2GO8A 2DHXA 2N7CA 1VBZA 5KFFA 1FRXA 2C1EB 1QY7A 4J9KA 3QT8A 1K1SA 2QX0A 1VHIA 2GO9A 2YH0A 4OYXA 2X1AA 4DV2J 2D3ZA 4CM2A 3UDVA 1WUUA 3WC2A 1QTNB 2HFUA 4DSIA 5HN0A 3GZ7A 3KUHA 1S1XA 2WHOA 3Q24A 3CD6S 4B3OB 2CNKB 1J5OB 2YNIB 1SCJB 1S48A 1Q8IA 2YXLA 4DZ6A 1TKZA 2B4PA 3M2RB 1M1GA 5LMUJ 2R7SA 3EXYA 3HD1A 1W7WA 3J81j 3P6YC 3H2UB 4OL8A 1LKZA 3A8JA 3MM7B 5LOQA 3N4WA 3N6MA 5SZTA 4BLGA 1HQEB 1R31A 3CJ3A 4RNOA 5GAHI 4NEYA 5IXUA 2MQMA 3BYPA 3ENAA 2ATLA 1GXUA 1KOOA 4JB8B 4OYZA 2E9ZA 5EX0A 1QE1B 1S1WB 2HZCA 4LSNB 4XAKA 3HX9A 2HQCA 3FMWA 2AGOA 3OL6A 3RZAA 3H40A 2BACA 1NEEA 5ADZA 4DL0C 1BQNA 1RZMA 4FYYB 3D6FB 2YKPA 2BYCA 5T7LA 1FTCA 1J5EJ 1BY9A 1EETB 5FLXY 3W65A 1JNRB 2BQUA 3HCXA 2BVZA 2F8EX 1V5VA 2RDIA 3FQKA 2Q43A 3M2UB 2MQ8A 3T1AA 3QO9B 3QIPA 3TVKA 6AT1B 3JSRA 2NPFA 3V4IB 2YNFB 2KFNA 5L1KA 2CQBA 4CO4A 1UEVA 2GFFA 2ZM6J 5F9LA 4Y28C 1FK9B 1JB0C 3GQCA 4PXEA 2BKPA 4KGZB 2CXEA 5E3PA 1WI8A 4PYAA 1XBWA 5K9FA 3GCXP 1KP6A 1FFWB 2V4JA 4KH1B 3G8SA 1OWXA 2HFNA 2A1BA 1H7XA 2DNLA 3HHDA 1HWIA 2EXUA 2C2MB 2GV1A 4I1TA 2JOQA 3TZWA 5F3ZA 5H9EK 1VLOA 4JBCA 3ZZYA 2JEGA 1N5YB 3LGNA 1RTDB 1GK8A 2FC9A 3HJVA 3PW0A 2H9ZA 3I55S 5F0UA 3I5BA 4M5DA 3FRYA 4RR5A 1T7PA 5CYJA 3KMSA 2W01A 2HK3A 2BJDA 4MMOA 5CH7B 2AMCB 1JLFA 4HHUA 4KQZA 2E5LF 3NCRA 4WP3A 1BQMA 1KHVA 4ECXA 3RRKA 4EO8A 2R7TA 3BBFA 5CZXA 4PG7A 5KG6A 1VJWA 2MKHA 5KOWA 2CADA 4M94A 1Q8LA 3DNCA 2DB1A 1X4AA 2AYBA 4AL5A 3FFIB 2FJVA 3BBCA 2KFZA 3WBZA 4WKYA 2XYPB 4KHRA 2HQIA 5ETNA 1RT7A 3TZZA 2YKMB 3NMAA 4I0WA 4J9QA 1X8DA 3T9ZA 1SJFA 3OL9A 1KS2A 3D6HB 4ZHRB 3EMTA 2PA3A 3QQCD 4WE1A 3CJ8A 5DG7A 5BXIA 3J7YI 1YJRA 2E5HA 3CJSA 1U1PA 2IIHA 3VWSA 4QJVA 1HHSA 2C42A 1OYEA 3D54A 4CLSA 1U6BA 1KD1T 1L3KA 3MM8B 1S1UA 2FGCA 1MWZA 3D0HE 1S9EA 5AJ3F 4WU2A 1SKUB 3BS9A 4UOCA 3G2XA 1XNRJ 2GJIA 2RF2A 3AD8C 2APOA 3GV5B 1RT2A 2LQJA 3TRGA 4DR1J 2LYVA 2FY8A 2VZ9A 2RH3A 2XMAA 5I3PA 2VG5B 4IYQA 3EVOA 1U24A 5CHCB 3FQLA 4ZP9A 2A18A 3HHLB 4LF4J 3GIMA 1RP5A 4F3QA 4M5IA 3PYGA 1SQEA 3E01A 2NXUA 4Y2AA 1HNZJ 2AT1B 5HROA 1G3OA 2DGUA 1X5TA 3PW4A 1HBOA 5KG2A 1FDDA 5EDWA 4LF5F 3R27A 2MKSA 2OHDA 5D3GA 1XMQJ 1BUXA 3TOQA 1TK5A 2GQCA 1D9AA 1P9YA 1NHVA 2DR6A 2BZ2A 3DI6B 3AQOA 4YB7A 3R2CJ 4B9SA 3W9IA 4AL7A 4DQSA 1HNWF 2PDAA 3G71S 1RTJA 2KJVA 1RHUB 1JLAB 3Q23A 1X9WA 3FGVA 5KT2A 3TW0A 1K8AT 3QLHA 4I6AA 1U48A 4E8UA 1UPMB 2MGZB 4K0KJ 4ZPCA 1QJHA 2Q6BA 5ETRA 1C4AA 4OI6A 1JKHA 2KU7A 1FNXH 5B7WA 2VQFF 1X9MA 3A8EA 1B0TA 1SQFA 2VOPA 2W2QP 4L74A 3THVA 1WTBA 3CCJS 1WF2A 2C2DA 3KHGA 3TAQA 3PDNA 1O0PA 3PRBA 4TY8A 3P4UB 4KPCA 3GIKA 2DNMA 1U4BA 5D0HA 4F0HA 2ZHOA 3DHWC 3C19A 2OTLS 4C3KA 1AB8A 4CRJA 2XMTA 4C8MA 2XHCA 4UW2A 2DGVA 4TU8A 5CYMA 3NWRA 1RWUA 4HTJA 1Q53A 1UFLA 1Q5YA 1SPBP 1NSAA 1X4BA 2KT5A 1JXLA 2KVQE 3N01A 3AAWB 1IR0A 4C7QA 4YHHF 2VBZA 4CO2A 3CCMS 5CXTA 4AE5A 1VMBA 4HHHA 3MM5B 2D3UA 3QJLA 3IMQJ 1X4HA 4J9PA 3BREA 1PJ6A 5HBMB 4CYUA 4L3KA 4M5JA 2BMBA 3LGMA 5KT5A 4M5KA 1YJUA 4HI2A 4X4UA 1T05A 3DKDA 3CUNA 3IM9A 4LF8F 3CCRS 3QJPA 3OVBA 3ONQA 4DFKA 4ZJQA 2DNQA 4CLLA 1N32F 1R6YA 3R7SB 3CE8A 1RLCL 2C3UA 3IRXB 4KHPJ 2KN4A 4C8ZA 1QVFR 1RTZA 2IRUA 2UUCJ 1SL1A 1M5KC 3QGIA 2ROGA 2NXCA 1IBCB 5KFLA 2ATCB 5E33A 1WC3A 2DHSA 5LXRA 3AODA 3CO0P 1U47A 4RW7A 2CQIA 1FRIA 2IVYA 5G0RA 3Q2SC 3H20A 5D4OA 2AP6A 3T3FA 2QLJB 1FTRA 2E29A 1AA1B 2Z56B 5F3TA 4PXBA 3BB5A 3QGGA 5L46A 1I94F 2CPXA 2WONA 1RAEB 1HPZB 4DQQA 5D8HB 3J7AN 3M8ZA 4OZ2A 2BJ8A 1K9MT 3HVAA 3SMZA 2K1RA 2HNZB 1MMNA 4DR4F 4QYZJ 2GMLA 4RJVA 3F73A 2LQ9A 2MZQA 2UU9J 4M5HA 3IGVA 1P27B 2P2CB 1RHMB 4Q2MA 2LECA 1SJ3P 2F4VJ 1YZ7A 2WB4A 3IS9B 2N4CA 1RACB 3HHNB 4KYZA 1JLBB 3AXKA 2FLOA 3KNGA 4YB6A 2W9BB 2PEBA 1MN9A 2RRNA 4LRBA 4PAAA 1S4FA 1HLWA 1RWPB 5ETVA 1I3OB 1FRMA 1N34J 4AQYJ 3DCAA 1VRTB 3DLKB 2IDEA 1IBLF 1CJVA 3UD4P 2HFOA 1T94A 2WW4A 5F8MA 4IG0B 2VPZB 3Q8YA 3R6LB 4QWDA 1SV5B 3VHQA 4JV1A 1GMUA 4PUOA 2CPFA 3DDNA 2OAUA 5CYQB 5HMYA 2DHAA 1KLMA 4DZDA 1Q0NA 4LF9F 4RUBA 2ALZA 3VVUA 4DLGA 3MM9B 4ZCMA 5L1IA 4WCEQ 3Q89A 4OYPA 3HM9A 3G4SS 2DCUB 2WBMA 1WWHA 4FF1A 2R42A 4HDHA 2PFDA 3POTB 3RR8A 3B6BA 1NJWA 4DX8H 2E7WA 1FX2A 1WC1A 3OTDA 1KSPA 1IKVA 4HT5A 4DSKA 1J5OA 2FJXA 2BQ3A 3W63A 3M2RA 1EAYC 2AW0A 2CNNB 5L38A 4USWA 3MM7A 3PX6A 2WVBA 4O3SA 5KFGA 4FXDA 2DGTA 1HQEA 1D3WA 3EDQB 1X4FA 1EARA 3HVRA 3KLGA 4FS2A 1KBRA 4R0EA 4ZP7A 3MAQA 1TUGB 2HEKA 1YBTA 2RKIA 2HFZA 4ZVEA 3H5YA 1QE1A 1S1WA 3UCUP 4LSNA 2O66A 3TUZC 4ED3A 3H5XA 3IXQA 3UN3A 3ZTSA 1YX2A 3H25A 5F0WA 2YKQA 3V6KA 1RXOB 1IKYB 2F40A 2BA9A 2CQDA 3EZOA 4K5SA 3BQ2A 4RW8B 5LSOA 1MWQA 4UOFA 1MLAA 4C11B 4WXOA 3LP2B 1EETA 4JI6F 2QIFA 4RBVA 2M2BA 4H4OB 1VQPS 1WELA 4TKTA 3R1LA 2VA3A 3M2UA 4JV2A 2BJ9A 3OPKA 1HNVA 2W9AA 5IT9Y 1Y7PA 3V81B 4DV1F 1IKXB 3QO9A 3ZNUA 4F0KA 3QBCA 4K5RA 2VFVA 3V4IA 2YNFA 2DR8A 2E1MC 3ZZTA 1NDPA 1AFIA 2GIFA 1O5JA 3Q83A 3GIRA 1JWWA 3NBPA 1FK9A 3I9V9 1UEUA 5U47A 5IWAJ 3KJNB 3BO3A 4DCPB 1HBMB 3PCOB 5GAEU 1NJYA 1D09B 1TFYA 4JI7J 4DS5A 1ROFA 3KK2B 3DFEA 3SQGB 1KHWA 1Q4RA 2NSBA 1N0UA 5DDQC 4CLWA 7FDRA 1ZTWA 2MLYA 3KG4A 4Y3CA 1Q8KA 1S7IA 4QCLA 4ZKAA 3MCOA 3HHLD 3EGVA 2IMOA 4I69A 4YS2A 4GVLA 3FK4A 1N5YA 1RTDA 2DBBA 3WZ0A 3R8YA 3J80U 4K4TA 2GCFA 1WOOA 5D6GA 2DXFA 3QRPA 1UA0A 5IFMA 4ZVPB 3C2PA 4O3RA 2L9DA 5H1SV 2HGLA 2W25A 2YQ0A 3G6XA 4BBYA 2U2FA 1FKAF 2QA2A 1BLUA 3PR5B 2CJQA 1DFDA 3BGFA 4TQSA 2FIUA 5C42B 5KFWA 1LWCB 4TXSA 3FFIA 2J0QD 3ILLA 5KFJA 2HVHA 3JTPA 3CC7S 5J2MB 2YKMA 2ZH5A 2W2MP 5GAGU 4NEZA 1C1BB 5EN1A 4URSA 5LSRA 1JJ2R 1REVB 2AJ2A 3AA9A 2YWFA 4DR5J 4ZHRA 1H6KX 4K2XA 4TU9A 2LVWA 3DU6A 3CJ4A 1LOUA 4WZMA 3S7RA 4KC5A 2D9OA 3O1LA 3LTOA 2KB2A 1HWKA 1YRXA 3TJAA 1S0NA 4KIAA 2CPZA 3J81Y 1ZOTA 1UVNA 4PRFA 2V2VA 4X64J 4X4QA 1RWVB 3MM8A 1IR2A 4OX8A 1XTZA 2WTFA 2YH1A 4FVCA 1WG4A 2IDLA 4YOEA 2NXEA 1VQKS 3ISZA 4P74A 4DUYJ 2CQ4A 3MECB 4YB1P 2QLWA 2VG5A 3G6ES 2W2NP 4FYVB 2R8GA 4K2JA 2MY7A 1RHKB 3RAXA 2C2NA 2M7SA 3M4XA 3OHAA 4X62J 2E1RA 3ISND 5B0CA 2Q3PA 3PZPA 4RO0A 1YJ7A 2CA9A 4A8WA 5L9XA 2EPIA 5C7PA 2HHPA 4W92B 1T9UA 4NCBA 3AOBA 4LJMA 4B3RF 4C6AA 2MPUA 5KG3A 5A8WB 1D8YA 2UXDJ 3AT1B 4XIUA 1PC5A 3Q2TC 1RAHB 1WF0A 4IUFA 3EZ5A 3UDEA 1V3SA 1VGYA 2WSFC 3T9NA 1EZZB 2C3MA 1JLAA 2M52A 1DLOB 2EFPA 5H9FK 1F3VA 3OXLA 3I0SB 3OSPA 2R9LA 3T19A 1PCAA 3FSIA 3GG0A 3M7VA 5H9FJ 4ZVGA 2KH9A 2J6TA 2HRTA 2OO4A 4N76A 4MFBB 5A8RA 3OHBA 2J6SA 4MH8A 1UJ5A 5DQIA 3NNAA 3CCVS 3GSDA 4UOHA 2FTRA 3D5MA 4ZCIA 1VC0A 1U7LA 3C16B 5ETPA 3H42A 4C48A 5G4DA 2B8QA 4EMDA 2GIRA 4EZ9A 1TUWA 2NLWA 2PD1A 1UCNA 3NEKA 1VQ4S 1S77D 2JHEA 1MW7A 3SV3A 5AE2A 3AH6A 4I68A 4X65F 4X2BA 3ICLA 4OJGA 1PYOB 2V50A 4I64A 1QSSA 1RBOB 1H72C 1OS5A 1E6VB 4DR3J 4WU3A 2BABA 4OQJA 4NCGA 3RBEA 2XI2A 4TLRA 2AKWB 3DRXA 3DMJB 4ENOA 2XY6A 3MMCA 3MM5A 1T8EA 4Y0FA 2XB2D 2YKNB 3KXDA 1Z4UA 3JTNA 1F3FA 5HBMA 3KDOA 2DRDA 1WEYA 2K2PA 1X0PA 2E1AA 5J1EB 4UUWA 3RAMA 3ZTOA 4RW4A 3TQ1A 2RRAA 3LAKA 1VBXA 1PG5B 4ILLA 4LBHA 4RUCA 2I6WA 4FPIA 4HKQA 3HT0A 5DG8A 1AUDA 4WFAQ 1CLFA 2FC8A 4OYMA 3I32A 2MKIA 4H4KA 3LQVA 5HLFB 2G9OA 3DOMB 1AW0A 1RT4B 5JUMA 3RBXA 1S9FA 1X4GA 2GAHC 1BD6A 3AA8A 1NKEA 1R27B 4Q0BB 1Q5VA 2HPUA 2BE2B 1TR0A 3FSYA 4IG3B 4C3MA 1DQ9A 2ZHAA 3SEOA 1U2RA 2IY5B 2B8PA 2KHDA 3NWGA 3I96A 4QR2A 1HPZA 4JI0F 4DXLA 1RAJA 3PKMA 1PYSB 2H5IB 3ZZUA 2R7QA 2HNZA 3L3CA 3ETMA 2HYIB 3GLJA 4FNIA 3Q86A 5AXLA 3G8QA 2W2OP 4ZVQB 1S6UA 4OX9J 5ETSA 3CMQA 5DDOC 1VI7A 2V67A 1CJUB 1U1RA 5B09A 4FXVA 3IS9A 5B0EA 3NL0A 5AE3A 3QT7A 3UNGC 5AE1A 3JAMY 5HK4A 5T41A 3JYTB 1JLBA 2C2RA 2ZH4A 4UT4A 4YB5A 4DLEA 2MKJA 2OPRB 2PMZD 3SCJE 1MROB 5BYQA 1BQXA 2BW2A 1W2BR 1Q81T 1VRTA 3DLKA 4J9SA 3MMJA 3SSQA 3OR1B 1RI7A 5AT1B 4IG0A 5D4PA 1XMOJ 4ZCKA 4C0BA 4C8LA 1N5TA 3DXBA 2WK4A 4CLUA 1SV5A 4B08A 4F36A 4J9VA 3OUYB 1RAFB 1HR0J 4W90B 3QSIA 2ZEJA 4NLOA 1VRUB 5CYQA 2YPYA 2HVDA 2V68A 3R5BA 2EFNA 4TQRA 3MM9A 4OI1A 4Y2CA 4V19J 1IN0A 1KLNA 1EKSA 3B4DA 1OSDA 2HFVA 3H5SA 3L09A 2IJRA 5KOXA 4ZS6A 2KJWA 3JQJA 4ZPWR 5D77A 1NH8A 3LUYA 4O3OA 3MMBB 4EYIB 5KFNA 4O4GB 2FUG9 3A4TA 3CJ2A 1UWAA 3C15B 1FKPA 2BEFA 4E0DA 3HXMA 3W9JA 1JK9B 4FP9A 1NRKA 1I6JA 4OHYA 5CCLA 1XC9A 4U7CA 4KGMA 5EWGA 1VHFA 2R7UA 2ASYA 1WKKA 2QFJA 2QMUB 1PGZA 1LK7A 4ED4A 2B9YA 3OFHA 2ZZNA 3WC0A 2RDDA 2QC3A 4DMZA 1SC1B 4CNZA 4IFYB 3QFWA 1RT1B 4YEAA 4DF8A 2NR0A 1HQUB 4YMEA 1UVLA 4I7FB 2D3OR 3FZ2A 4CO5A 4Q43A 1IKYA 1PBAA 2PGCA 2DPJA 2ADCA 1K47A 3AB4B 5A2QY 4RW8A 2RUSA 3W2VA 1YJ9S 4C11A 3MR7A 3LP2A 4BWMA 4LBPA 2MQPA 5GAHU 4B9TA 3W3SA 4H4OA 4DR2F 4OZNA 1NBEB 1JLQB 1YIJS 1S79A 1TAQA 2LP4A 3V81A 3D2WA 3QPIA 4F02A 2YWKA 4LF6F 3CCTA 4LSLB 4M5NA 2FJEB 2DR9A 2Z2MA 3IRWP 1XR5A 5HVFA 2WBRA 3GP9A 3MFHA 1RT5B 3TAPA 4LR7A 4WPAA 5D0RA 4I6YA 1HBMA 2LQ5A 3PYEA 2B5JB 4OMFG 5K8MA 3OXFA 3MEEB 3A12A 3D6MB 1B7YB 2KXHA 2OP5A 2CDQA 2W1BA 4OV1A 1XIQA 3FRZA 3KK2A 4R25A 4CH1A 2DNYA 2W8LA 3SQGA 1RCOB 2C2OB 5RUBA 2CG8A 1U2FA 5DDRC 1SJRA 1VK8A 2D7SA 4ID5B 2E1CA 2CQ0A 4KH0B 1FNOA 3RBZA 2VOOA 3MR5A 2HVZA 4DV6F 4XK8C 2DNNA 4DCJB 4CLYA 2ZHBA 1YGYA 5IV4A 4DV3F 2BKOA 3OTCA 3GFXA 3VAFA 4JI4F 4DV4F 3WX4A 2PI5A 4G1QB 2NSCA 2DNKA 4Q44A 3DLGB 3NG8A 5F8NA 3H7HB 4USUA 1F60B 3GR0A 2LXUA 3E2EA 4QPTA 2KM8C 2Z8QA 2QYGA 2B0GA 4KGVB 5C42A 2L9NA 1LWCA 2XI3A 4LREA 3Q8QB 2MHNA 2DEIA 1QSYA 5J2MA 4WIQA 1M5VC 1D9DA 1I1GA 4YY3F 2JX2A 1JLCB 1C1BA 2J0SD 3SV4A 2HQDA 1REVA 2DGSA 4GKKF 4PABA 3GJTB 3SSRA 3PEJA 1FWLA 4JI8F 2E5LJ 1DY3A 1TK8A 4TY9A 2ZBPA 5LL6d 1C0UB 2O1PA 3ZTPA 2XS7A 1FD8A 2VJUA 2JEFA 3MHYA 1A7GE 1WDTA 4YR3A 1P9QC 3NGRA 5EWFA 4M5LA 3DLEB 3LA0A 1RGVA 3T5JA 1WKJA 4LIRA 3Q8RB 4FZVA 2WZ1A 3IN5A 4CTAA 2HGMA 3U1LA 2KZZA 3MTKA 1NB2A 4G65A 3MECA 3DHXA 2OPQB 2OPPB 5KG1A 2IYIA 1CG2A 2VKRA 2EG1A 3D1OA 2GNKA 2PMWA 4P7TA 4PWUA 3PJ9A 1PILA 4WK3A 3DOLB 2ZJRQ 1RADB 5D0EA 3HVTB 2V4RA 2QL7B 2GVZB 1DURA 5A8WA 4N41A 2MHEA 2M4MA 3V6HA 5AJ3J 2VL1A 1NK0A 2RAQA 2HS4A 4FYXB 3TO8A 1Z1ZA 2SXLA 4TU7A 3BKFA 2HHWA 4ANEA 3BN4A 1A9NB 1BGXT 4LVOP 4DFJA 1D1UA 3NAHA 2ZVSA 3QNWB 1HWUA 2FJDB 3I0SA 2YKAA 4F4WA 2ACYA 3KNAA 4CZCA 2RUGA 2EFVA 1WSVA 2ZWPA 1J2VA 3IFEA 1HNXF 3TVZA 4F04B 4XDDA 1ELOA 4DL2A 1BWVA 2HWTA 1R0CB 2XY7A 2IBKA 1HNIB 4G6VB 1R8HA 2FVCA 5K8NA 2P6SA 2Z0GA 3PHTA 4K4UA 3C16A 1FDBA 1GTHA 1P6TA 4X4RA 1HNWJ 4X4VA 4B9LA 3BGOP 4X4PA 4MK8A 1F5BA 2AEMA 3DLBA 1GNKA 1AXQA 4J9LA 2FJAB 3K58A 4EGLA 1TL1A 1WC0A 1VS3A 4RW9B 1XK8A 1E6VA 1U8WA 1X4EA 5B0DA 1U8SA 4P7VA 4DPWA 4ATNA 1KTVA 3BQ0A 2XMMA 3P3DA 1IJFB 3DMJA 2ZNYA 2R2UA 5CQGA 2ZE2B 2X7IA 1IJEB 4B9VA 1SH0A 4LFCF 2RS2A 1NK8A 2MZ1A 5J1EA 3KLIB 4A8YA 1NPRA 4NA1A 1HWJA 5KFEA 2H4WB 3WIVA 3CMAS 4ETXA 2J8AA 2QA1A 3TYTA 3ZC4A 2CWXA 3CTRA 2NZCA 3Q8VA 2X51A 4ITSA 5HJXA 1ZPWX 1VQ5S 1IWAA 3JTOA 3DOMA 4CT8A 3A3OB 3VQSA 2K3KA 2ZC4A 1RT4A 5E3CA 3RYLA 1IWGA 3TI0A 2BOPA 4MYUA 3IR5B 2OH2A 2CJAA 3P96A 4QIVA 4EO6A 2ZDOA 3NOGA 2MB0B 2DGOA 2ZBCA 4OI0A 1IVZA 4Q0BA 2WOMB 2BE2A 5B0GA 4OLOA 2LKZA 3KJVA 2VONA 1VQSA 4KO0B 3N6LA 1G6BA 1HL6A 3IO1A 4AUKA 1PBUA 1J5EF 4FN5A 4WP9A 1ZYQA 3O2IA 1TVRB 2XMJA 3KLHB 2BJ1A 3P8BB 1WEZA 3K7RA 4KE5A 4GC7A 4KKOB 1TKDA 4DX5A 4RNHA 4ECZA 4F67A 2JLEA 5L39A 4DUTA 1CJUA 2DEJA 2Y8YA 2OIHA 2G0CA 1HHQA 3MI7X 4FXWA 3TQEA 3JYTA 3OVAA 4OYOA 5IQ6A 1PC4A 1NPKA 3UCZP 4DR7F 2JH3A 3H4BA 1I94J 2OPRA 4U8VA 1RBAA 2ZJPQ 5J2NB 2CZ4A 1XWLA 2CPIA 4O0IA 5ETOA 3MTJA 4IOAQ 3L95X 2GW8A 4E98A 3OR2B 3MZIA 1G2EA 1NCLA 3E3XA 3OUYA 3ITHB 4LF7J 3TX0A 2AF6A 3TZXA 3AD7C 4NMXA 3Q22A 2FVRA 4ZA1A 2UXCF 3RTVA 3LWLA 4USHA 2MSTA 4CCHA 2F4FA 4W98A 2HBZB 3IGNA 3SFGA 2YPZA 1S57A 1IBKJ 1S1VB 2X3DA 3EVWA 2UUBF 2ZH3A 2ZKTA 3MMBA 2HHSA 1YJNS 1RAOA 1IBLJ 2GMHA 2DH8A 4ED7A 3C15A 2DKOB 1CSJA 4IO1A 2CQGA 1UJ4A 4P9SA 8AT1B 1N5VA 2QO3A 1U0SA 5KFOA 3CCQS 4LVNP 4IDKA 4W4MA 4ZN3A 1OY9A 3D3CJ 5C25B 4LF9J 1M5SA 2CQ2A 3B8HA 3NMRA 1M5PC 4I67A 3JB9k 1TTHB 2BX6A 3UD3P 1NK5A 3I0RA 1QUPA 4IFYA 3GCWP 1RT1A 5IV3A 3T1YJ 1HQUA 2C3PA 2DNZA 2DD8S 2I5JB 3NNHA 5DM6Q 5J2PB 2VUGA 1X0FA 4ZN1A 4N56A 3EGZA 3PACA 1BE4A 4MIAA 4OHXA 3PNIA 4NL5A 3EPGA 4I7FA 1FJ7A 2Y0BB 2O3DA 4B9NA 5I42B 3KLVA 5LM7E 3EZUA 2ZH9A 3M8RA 4DX7A 4FVMA 3PR4A 1B4SA 2P5VA 3R5CA 3V6DB 2I1RA 5IT0A 3UI3A 3HSGA 2R2RA 1KRPA 4FDFA 1RTIB 1JLQA 1FT8A 3ZZOA 4EK2A 4BDPA 3GV8B 1F5CA 3MAAB 4KRWA 1ZA1B 3GJSB 4C0OC 4MJKA 5CCMA 2G0JA 4LF4F 2ZC3A 2H51B 1VCTA 4XDCA 1HNZF 4CLPA 3M30B 1RCXB 5THWA 3H0PA 3I87A 1RWNB 4OYIA 1RT5A 5KFXA 1TL3B 4YR2A 4C8OA 2KO1A 5IS2A 2DRAA 4NLWA 1XERA 4FF4A 2M5YA 3MEEA 3BSAA 1H2TZ 4DN0A 2XMKA 1RU2A 2VQEJ 1NKBA 4JI6J 3D0IE 1HYSB 5KFSA 5ETKA 2E5JA 1HD0A 5ETLA 2UVVA 3FCHA 2WAQD 3KUGA 3KHLA 2XZTB 2ABYA 3K8VA 4D3GA 4DV1J 5DGAA 2XS5A 1RSCA 4A4JA 2RT3A 3SXLA 5FLXU 2R8JA 4X66F 5DS7A 2OKQA 5I3UB 2N3OA 3FKBA 2CJ9A 1CJKA 2GVDB 3D28A 1NO8A 2MLXA 3BSCA 3M9MB 2MZTA 1U1NA 4OHZA 2DXDA 1WKLA 4RWWA 3H98A 3VVTA 3QIDA 1M5OC 4DQPA 4WBFA 4NRUA 2YWEA 4DG1B 4MTPA 4G1QA 1T03B 2OI2A 4FF2A 3DLGA 1S0MA 2F1FA 1TU0B 2ZH1A 3ZTRA 2G2YA 3AB2B 7FD1A 4UTGA 3CVKA 3QT5A 3M1VB 2AEFA 1SQGA 4NLDA 2FHOB 2FDNA 4BC9A 4FF3A 1UAWA 4HH1A 1NKCA 2R3VA 2NREA 2W9CB 1JLCA 3CC2S 4K4XA 1JJCB 3LP0B 2IAJA 2BKNA 2ZH2A 2QSWA 2R4FA 3CO9A 1D9FA 3SCLE 1NZAA 3HK2A 4QBUA 4NCAA 2K06A 1CQMA 4IKAA 1S0VA 2EWHA 1NDLA 4WFXA 4WKRA 3MUTP 2DY9A 2VPYB 4AFFA 4DCOB 1YRTA 3ILOA 2PE8A 2J6UA 2HHHJ 3LF0A 1ZA2B 3G6VA 3BN7A 3UPFA 2D69A 1C0UA 2ZH6A 1RISA 3OFGA 4YN3B 3FCVA 2C2EA 3CEDA 4USIA 2EKYA 3DLEA 2E7XA 3IR7B 3D67A 5DZ7A 2J9EA 4LR8A 3CJKB 3HVWA 2MQOA 2CRLA 4IOBA 4KHPF 2NUUG 3I9ZA 2OGUA 1VQYA 2OPQA 2J7KA 3OJSA 4RU2A 2GJFA 3FUYA 2DHGA 4P75A 4KY3A 4PYDA 1S49A 3RRGA 3MOZA 1KC8T 2VPWB 2HGNA 5EHHA 3N5FA 3M6XA 2OMLA 3TVYA 5LJ3Y 5F8GA 3C46A 2WB1D 3HVTA 1OSCA 4CI0B 5HVHA 4ECVA 2GVZA 4DS4A 3T41A 5F8LA 3VAIA 1MNEA 1VQMS 1NNDA 1PAEX 1UTAA 1YVFA 3UR3C 3C6UB 1VFJA 4PR6A 3KDNA 4FS1A 1F5AA 3C14B 1QAIA 2MXYA 1OMSA 4DPOA 1S4EA 1U0HB 1F1BB 1XNQF 1KQSR 1NDKA 2HAIA 2UU9F 1S97A 1FRLA 5E3QA 4JYAF 2V8GA 2EC0A 5E5NA 3SCIE 5DZ6A 1ACMB 3CDBA 3AJ1A 3ADAC 1B0PA 2JVOA 3MCNA 1EB0A 1VJQA 2D74B 3EX7B 4K8RA 4P72A 4B3RJ 4DEZA 1Q7YT 2HIQA 2RJZA 5K5MA 2AGPA 4MT1A 1JMTA 1HNIA 3NNCA 5CAAA 3CD0A 2POKA 4AQYF 4NLPA 1M1HA 5HP1B 3OFEA 3ZZZA 4PKDB 3BH6B 3R6GB 3TJ9A 1RHJB 2IMWP 3UNYA 4JI5J 4MK7A 1TZ0A 3PKYA 2FLLA 4RW9A 2EW9A 2G2ZA 4QOTA 1N6QB 3R1HA 5FDLB 4OYBA 2CJBA 3OJUA 2G0IA 3QAEA 4DUZF 1R0AA 3VQTA 2OEJA 3VAGA 1NK6A 2HZAA 4OZ5A 2ZE2A 4K50A 3D7SB 2BM1A 4NYPA 1YJWS 3CGIA 5KAKA 3S1TA 2IM0A 3TUJC 2N82B 4ZMMA 3DRPB 1XR6A 4ECRA 4XPEA 3KLIA 4RWXA 3W5ZA 3TX8A 3NGTA 1RA7A 3TR5A 3T1HJ 2KT2A 2BANB 4X65J 5F41A 1NK9A 4OX7A 1N5QA 3EE3A 5EGYA 5KT4A 5A8KB 4Y00A 4WJBA 2ZUGA 1Y0HA 3NXZA 4GMKA 1YBUA 3IR6B 3LP1B 1U1OA 3KMQA 4KGXB 4Q7AA 4I2PB 4TYAA 1IBMJ 4B9MA 4KB7A 1ZM2A 4PPDA 2MMYA 2G4BA 2JLGA 2IYGA 1HBUB 3CMES 1K0TA 1L3TA 3TNVA 1F2GA 4NZ6A 2J9DA 2W4DA 2WOMA 5CD4H 1S1XB 3MPWA 3UW1A 5LMNF 2ALYB 3ZFVA 4DU7A 4KO0A 2KVIA 1QD1A 2BW7A 4ZJOA 3OV7A 1EHWA 3L7UA 1B3TA 3BF4A 3QRRA 5ETQA 1TVRA 1BMQB 3K2YA 4R0JA 3KLHA 2QA4G 4M95A 1KN6A 1MMDA 4DR6F 3CCES 2MEWA 4WFZA 4E2FB 4CO1A 2IM2A 4RL1A 4OZ3A 3ZTQA 4F4YA 4KV8A 2XWXA 5KFDA 1QTMA 4M63A 3UR0A 3ETOA 2C3YA 2HWIA 4TYBA 4X4TA 1RK8A 4PQAA 4F0MA 2MKYA 2HBYB 2YY3A 2H5JB 1QLNA 4A8OA 2HHXA 5GAEI 3PX0A 1QVGR 4JI7F 1VC6A 4F4XA 2CJKA 2X3GA 5KFUA 1CC7A 1SJ1A 1ZZFA 3FZBA 4LUBA 3OR2A 5M2PA 4NLVA 2ZOGA 1KVKA 4IOCQ 2RDJA 3IWLA 3MOJB 2QEXS 1S1TB 3QGHA 1R8CA 1XR7A 3UVJB 4TNOA 4ED2A 4GO5X 2DIUA 1YSJA 2J9DE 5IOLA 2ASDA 4OYWA 1RWOB 1FESA 2RQ4A 1WG5A 4B3SJ 2VHGA 1S1VA 4DSFA 2V4QA 4C8NA 2W4CA 5KFCA 1Y10A 2V4JB 4A47A 1FVSA 4LF1A 2OSRA 1MWYA 1XN9A 3EVMA 1FNMA 4DFPA 4EWTA 1NJZA 3LALA 4HYKA 3T5LA 2PC6A 1VQLS 4C4WA 4Y6IA 1AZSB 1QM9A 2P6TA 1JIHA 4QWEA 1UWBB 4CO0A 4QW9A 2J76E 2RIJA 3JXOA 1Q16B 5GAGI 1RYSA 4EBDA 3MPUB 2QLBB 4M5DB 2ZH8A 3HSJA 4CLTA 4KPYA 1ITPA 1V3RA 2I5JA 5J2PA 3F56A 2VG6B 5DJBA 2FZGB 2M8DB 2HMIB 1VR6A 4YUDA 3C8YA 2K8GA 1TL5A 2A2DA 2NCKL 3CPWR 4C0HA 5I42A 3VZHA 1NMEB 2KTQA 1OPIA 2XULA 4X64F 6FDRA 2CPEA 2F7VA 1N36F 2UV8G 1S10A 2JRSA 5EWEA 2DO4A 3OLBA 2ZDPA 2B4VA 1WF1A 5KFVA 1GFWB 2KG0A 4MYTA 1WC5A 4URGA 1SKWA 1XJWB 1DTTB 2QJ3A 2IA0A 2WRMA 1C1CB 4TN2A 3CJ5A 2AJFE 3MAAA 4ECYA 2FHJD 4FKYA 3G8TA 8RUCA 4UQTA 3MD1A 1KONA 2M3DA 2Q66A 4ETZA 3K5NA 2LMIA 2IC3B 2AIRB 3M30A 4YR0A 3DLJA 4NYOA 4BWJA 1S6OA 1TL3A 3B4MA 3K0JA 2B6AB 3BDPA 3CF5Q 1WORA 4H4MA 2UVUA 3FNNA 2I2YA 2UXDF 1HYSA 1KR4A 2ROPA 3LPEA 1CVJA 4TVAB 1F9EB 4QYZK 1C4CA 1WC6A 5KG7A 3P45B 2F63A 3MEDB 2V9WA 3TEHB 4QW8A 4LQ9A 3JQKA 5GMDA 1SUQB 5I3UA 3GE9A 1Y9OA 1F6TA 3FDSA 5IT9U 1U2CA 4IH7A 4Q45A 1HBOB 1N0VC 1EP4A 3KKFA 1KQKA 4DG1A 1P1LA 4U8YA 4FBTA 1HD1A 3HKZD 3KTQA 3MM6B 1NSQA 2JDJA 3CCWA 3G82A 1U1KA 1XQIA 4JI3J 3DGPB 1Z2LA 4B3MF 2IA6A 3R97A 3W5XA 2HIYA 2QGFB 3M1VA 3BGRB 2VBYA 2CG4A 2W7AA 2OELA 3IG1B 2MDAA 5AXNA 3W9HA 1EIYB 3PX4A 3E8OA 1LWEA 1IM6A 2U1AA 3OFFA 3DRYA 1CS4B 2W9CA 4DV6J 2CIMA 4MKAA 2XMVA 3BZQA 3MCSA 1JKHB 2HSEB 2XGQA 3LP0A 3G6YA 3SI8A 3MDFA 2HAFA 1BXNA 2CNOB 2VBWA 4DV3J 4GKJF 1H73A 2FLNA 3L7OA 4JI4J 3F0NA 1WSRA 2D1CA 3RW6A 2FHJA 4DPTA 2YNHB 4WFNQ 4QIWD 2WVEA 4HEA9 3BGUA 5J2QB 4KBIA 2R8IA 3IAS9 4B3TF 2UUAJ 1U09A 2CQPA 1VQOS 2Z30B 1RHQB 4F3OA 3THPA 4HLBA 2ZBIA 4DX6A 4U95A 3GILA 1SB6A 4FYWB 7AT1B 2GZOA 1RA6A 2P9CA 4PWDB 1SXLA 3KUEA 1SJ4P 2GQ2A 3W8PA 4LSZB 2V8VA 4B3OA 1H74A 2AYGA 2YNIA 3UN5A 2MTLA 2J0XA 2M70A 3HI9A 3U1NA 3DGVA 3FEZA 4CLKA 4RU9A 4JI8J 2VH7A 3QAUA 3CCLS 2BV3A 1TELA 2C22A 1ZAWA 3W64A 4K4ZA 1SL0A 1SH2A 2VG7B 1FO1A 1VQ9S 2RU9A 2XMWA 1N52B 3U02A 1VLYA 4ANCA 3TJ8A 2J0WA 3J81U 3C6UA 5IZHA 3AHPA 3J7Z5 2KRRA 5E7OB 2E9TA 5L8RC 4K7QA 1TKXB 4DQRA 3N0VA 4C97A 1Y5NB 1U0HA 3ENVA 3M8QB 2D9PA 3S6EA 3WX8A 4OX9F 3ZZPA 2ASJA 1Q7LB 4ZVRB 4F4KA 1Z2ZA 2W24A 1NXIA 3IM8A 1OIAA 2OFGX 2ZVIA 2PA8D 1S9GB 1RT3B 3RB3A 3MWBA 2HHVA 4H4KC 1NAQA 1UZDA 2LU1A 1HBNB 2EKNA 3SQOP 1HFEL 3CNQP 3D4JA 2WONB 2HRYA 5HJYA 4KJIA 4NXMF 2LXIA 5HP1A 2JWNA 1X7VA 3C66A 2KYZA 4B9UA 1DQAA 2F9DA 3R3TA 1XMOF 4YDXA 2AU0A 2F8MA 2MYFA 4QIGA 1HR0F 1YZ6A 3DLHA 1N6QA 4Q8EA 1ZS6A 5FDLA 4DV5F 1HNXJ 1IQZA 3W7BA 5E2QA 2RQCA 2AX0A 2QV6A 5BR8F 3RGIA 4DDFA 4F50A 2LXFA 1F9FA 5FD1A 3V6JA 2OD6A 2XBPA 3DRPA 2VB6A 5HQLA 3HP6A 3TA2A 2DNHA 1ZM3A 2M9KA 2DR7A 2E5IA 4Y65A 4NZ7A 3PHEA 1MMLA 4I4BA 4OI2A 1Y3KA 2F8HA 4GO7X 2BANA 4DV0J 2M88A 1WC4A 4OX6A 2E5GA 5AXKA 3M8PB 2DCLA 1IXKA 1KEKA 3PO5A 3LPYA 3LP1A 1TFWA 2KL8A 3EGNA 2IJFA 5HMWA 2ERRA 3BPSP 4I2PA 4WTOB 2HQFA 4F3MA 2XS2A 1CJTB 2DXEA 1A6LA 2BRKA 3I31A 4NLSA 5K20B 3CXCR 1ZH5A 4DFMA 2K7JA 1HBUA 4LFCJ 2DNGA 4U96A 4RZRA 5HAOA 3DRRB 3VAHA 2V8HA 1RWXB 1IKVB 3KWMA 3MR6A 4QWCA 2DIVA 2W8KA 3PM9A 1HI8A 3NGUA 4HI1A 2MKCA 1T9VA 3N28A 2DHHA 5IC6B 2GJ2A 2VBXA 4OZLA 1YK9A 1FXDA 2AJ1A 4QWAA 1URNA 2LA6A 4L75A 5IC4B 2XCPA 2VKZG 2OTJS 1OO0B 3OXGA 1NM2A 3AQPA 2UUWA 2M8HA 3KLGB 4ECUA 4PPZA 4ECTA 2RKIB 1UPPA 4UY85 4R8UB 4JI2J 1I5OB 1X4DA 1WD6A 2XNQA 3I5AA 4MAKA 2ZJQQ 2KZMA 3NCQA 4Z7YA 4Y34A 4Q5VA 4L72B 2R7OA 2BE9B 3TARA 2KT3A 1ULRA 2GMJA 3W60A 3M2VB 3THTA 4ER8A 3HHLA 4IFVB 1FCAA 1FE4A 2R8KA 3ZZ0A 2X1FA 1VISA 4OJHA 1DHMA 1ZAVA 3HLUA 1NPPA 2LA4A 4N8NA 4RPFA 1OYDA 3NKYA 3AJDA 1HNVB 2G13A 3QWUA 3ELHA 3RRHA 1S1TA 3HULA 3UDCA 1NHKL 1KWMA 3UVJA 4ZVHA 3GJRB 1QSLA 2XEXA 4ED8A 3MCMA 3DI6A 3GFYA 5L9NA 5E3AA 3P5TL 5D4NA 1ZTTA 1TMJA 2RVJA 2JEIA 1G1XA 3MFIA 3NBPB 2DNRA 1HW9A 4DR7J 5BJRA 4NPOA 3SBMA 3MPYA 3BV8A 2GGPB 2FHMA 1Q78A 3HZGA 4IRCA 3S01A 2MGZA 3LO3A 4RKUC 1V6HA 4NMLA 4YDDB 3JAMU 1ZPVA 1WHYA 3GPAA 4BCAA 3PIPQ 4L3NA 1UVKA 3KK1B 9RUBA 4LFBF 3GIIA 1QUVA 5HMZA 5HSPA 3MUVP 3NY0A 5KFAA 2IM1A 2UV8A 4D3HA 3AOCA 1AZSA 3FBFA 2DJWA 2OFHX 4Z37A 2HURA 1UWBA 1R6VA 2UXCJ 3UFCX 1P1TA 1B64A 3CDUA 5GMEA 3K5MA 2CWKA 2ZD1B 1JQGA 2CPHA 5H9EJ 1T9TA 3HT3A 1HI0P 3LW5C 4LFAF 2Y0SD 4P6QA 5LSLA 3EM1A 2VG6A 2UUBJ 1F2HA 2HMIA 4NXNF 1FJGJ 3WQPA 3FBEA 3BSNA 2IJNA 4N7TA 3DRSB 1FKOB 3CJQA 3QZ7A 3MURP 2HFSA 3CD5A 2ZBRA 2NPIA 3CJTA 5DLFA 4UQGA 2VFSA 3SIPB 2YNGB 3DOKB 2DPIA 3T6JA 1WOSA 1SIWB 2LQ8A 1GXLA 5HMXA 4URQU 4A8SA 1S6PB 3ZO7A 5C24B 2E1PA 1Y4ZB 3OTOJ 2AEJA 3IWNC 5DGBA 1GX6A 2CFXA 4P52A 1HARA 5L1JA 3PTWA 4HR2A 3HPOA 3T5HA 2KRBA 2G1HA 4O44B 1DTTA 1U02A 2GS8A 1C1CA 4LBIA 5KG4A 1HA1A 1UFWA 2X1GA 2VDHA 1MSWD 4AXIA 5JVGQ 1FJEB 2IRXA 3OLAA 2QLXA 1UFKA 1N88A 4HH0A 3IRXA 3M6UA 2NYHA 2IC3A 4Z7CA 1W26A 5KFBA 2V8DA 2HQ3A 2QTWA 4HHJA 4L76A 3DDIA 1X9SA 3PW5A 1KOHA 2B6AA 3AJ2A 3PW2A 3QMQA 5GADU 2XTJP 3K5PA 2XC9A 4OHWA 2PSZA 5DDPC 3QYYA 2EEYA 4PCQA 3O44A 1E6YB 1Y5LB 1M90T 1LW0B 4DOZA 5A2QU 1NH7A 2J7WA 2R7WA 3CDEA 1FX4A 4YFUA 1YHQS 3MEDA 2AJQA 1L5UA 1WOPA 2KXFA 4GVBB 2D41A 1UJ6A 1UA1A 2J7UA 1KQGB 1DJ0A 1QAYA 1SUQA 1CEZA 3M8SA 3QFHA 2JSXA 4KAIA 2FB0A 5D78A 2NQPA 2NUHA 1YG0A 4Y2MA 2HVIA 3TANA 1U25A 2QYCA 3BDEA 3Q0AA 1VRQC 3MM6A 3PO4A 2V34A 2YBVA 1UW4A 4ELVA 4A8QA 3DGPA 2UXBJ 2H48B 3IBCB 3MMAB 2IM3A 2HHUA 4F7VA 2GX8A 2C2ZB 2W9BA 3BGRA 1T95A 3DU5A 3IG1A 5HVGA 4OJ3A 5B0AA 1R3NA 1RUSA 2W4PA 1WEXA 4DV7F 4X66J 1CS4A 1TL7B 2C2KB 3EDRB 4EYHB 4ZPBA 2V94A 2DNOA 4AL6A 2C28A 3I5CA 4P2MA 2LDIA 2A0FB 5A8RB 4J5OA 2OD4A 4JOUA 2Z2LA 2YNHA 4IRKA 1PO6A 4C98A 4F8RA 5E3RA 3G86A 5KFMA 1U6ZA 2JLFA 5J2QA 1QAXA 2KXNB 5F9NA 2DTJA 2I8EA 1JX4A 1N33F 2EK6A 4A8KA 2QLFB 3VAJA 3POTA 4XTTA 3KK3B 5DQGA 4O0NA 2ROEA 2PEHA 2DGQA 4PWDA 4I56A 1JJ4A 3K17A 2H4YB 4NCGB 1O51A 2CDRB 2E9RX 5ETTA 3EJMA 3O8WA 3MMCB 2Q1LA 1UMJA 4DSJA 3AFGA 3J7ZT 2XMUA 5A76A 1AFJA 1RJJA 4DPYA 2MKKA 4RNNA 1X5PA 3VAMA 2JZ5A 4ED6A 3QATA 5D15A 2DNPA 4RNFA 4QIEA 4RW4B 1RT6B 2VC1A 4K4VA 2VG7A 4DHVA 4OYAA 5MAOA 1RQ0A 4JP8A 1ZZNA 3K59A 4WTYA 1RKJA 2YX4A 2R7RA 5KT3A 3SDEB 1TKXA 1JNZB 1UL3A 3M8QA 4NA2A 1FHTA 3CIMA 2HK2A 1UVIA 4ED1A 2IVMA 2JL9A 1GQEA 1T11A 2ILZA 4YQWA 2YWHA 1S9GA 4ZDNA 1TL4A 1WHXA 1RT3A 5SUHA 1LXJA 1MU2B 5F8JA 3PY8A 1KFDA 1HBNA 1IKXA 2XYGB 3OW2R 3G9CA 5JVHQ 2W2PP 2LEBA 3GFZA 2O67A 3MR2A 3M32B 2CAJA 1FWPA 4N8OA 1VK3A 1HW8A 1KFSA 2I38A 3N6NA 3TEGA 1DARA 2JC1A 1FF2A 1NDCA 2P9GA 2Q6CA 4LRAA 2HWHA 1XNQJ 1CULB 2L3MA 5J1NA 4DJBA 3M9OB 4LF7F 4K4WA 4JYAJ 3W62A 4USKA 4XPCA 1LWXA 1HI1A 3R9LA 4BC7A 2NXJA 2AYMA 4M8LA 1KVIA 2RNEA 3EUNA 1NZ8A 3UD5A 3UDLA 3K57A 4CLFA 5IM0B 2MJNA 5DQHA 3V2UC 3W2WB 1VQ7S 2FJBB 1IBKF 5E41A 2EBGA 2OPSB 5LT5A 5DLGA 2P8IA 4X4SA 3UO0A 1N5SA 4ELUA 2V5HG 3QZ8A 5A6PA 2VASA 2BUNA 4WK1A 2XYHB 2FZKB 2CUYA 4UUXA 2EBEA 1FVQA 3OSNA 3MGJA 4F26A 2V69A 1R8PA 2R8HA 4ZIWA 1NSPA 3BGLA 3LOUA 1NHUA 3TUIC 3OL7A 2ZFHA 2PT0A 3M8PA 1NLKL 4EBCA 3MXHP 4OV6A 4OFZA 4ZLPA 3O5TB 4DUZJ 1MN7A 3O3LA 5KG0A 3H5UA 1DRZA 4UOGA 2HLUA 1B7FA 1CJTA 3TZYA 3FJ2A 4FYDA 2BOAA 3T1YF 2Y1IA 3UQSA 5F8IA 3H2VE 1RWWB 3ENWA 5DM7Q 4DU8A 3FMBA 4KTQA 3DRRA 4O23A 2GA7A 2MQNA 1NK7A 4O3PA 1FKPB 2RQMA 4O3QA 2VDIA 2JNJA 4IQXA 4UY8T 3PFOA 2H3EB 5C2GA 3FCWA 4A8FA 4O3NA 4PG8A 1G4CA 3AXMA 3R7NB 1OPZA 3LAMA 2B4UA 1R8BA 1LQ9A 2XLIA 5I4MA 1J27A 3TA0A 3HZEA 3GIJA 1OY8A 1VIOA 4BS2A 2CYYA 1L3SA 1K1QA 4IR9A 4R8UA 2L48A 2AJ0A 2LEAA 3W5YA 4OZ1A 2QL5B 1YITS 2DVIA 4G1PA 2UZAA 2OEKA 4AD6A 3NP5A 3CDWA 3CCZA 5LMNJ 4WZQA 4P73A 2KG1A 4M5GA 1EKRA 3M2VA 4JV5F 4JI1F 3PRDA 2NZ4A 3TP2A 3W2VB 4IFVA 3J7YU 2ZUAA 1JXVA 2VQEF 3MPVA 1N56A 4TLQA 3IC1A 5KFPA 4ZPVR 4RUHA 3VAKA 4DR6J 1K73T 3EWGA 5BYRA 1RWKB 2QN6B 1OJ4A 2HQGA 4IO9Q 5JXSA 2WVCA 4P10A 2QE5A 5CZVA 5A6WA 2KDOA 2MSSA 3CSKA 2B56A 5AXMA 4KFBB 2B9XA 1UEKA 2HNYB 4F2SA 2L9WA 3MR3A 4MKBA 4FBUA 2FYXA 2O01C 2V2KA 1X31C 3FBCA 1DLOA 2FGOA 1Q8BA 1T9WA 3HHEA 3BYRA 4J7CA 3KOAA 2GGPA 3PV8A 3NS6A 5EUHA 2CKWA 4ZITA 2LCWA 2VIHA 2MQQA 4Q8FA 4J91A 3VGUA 4I2QB 3KK1A 4NZ0A 3NRBA 1TV6B 1JLEB 4MFBA 1U45A 3C6TB 3GYGA 4LF5J 2FQQB 2CNLB 4K4SA 2RU3A 4PWWA 3QRQA 5E0OA 4CT9A 3PYFA 1B99A 1FFGB 1YQHA 2AZ1A 2Z58B 2ZD1A 3IA0A 4IH5A 4ILRA 1URRA 1LWFB 2BRLA 3IP0A 4WFBQ 1KNZA 3BR9A 4NLYA 2LLZA 1UVMA 3MEKA 4OHVA 1LFWA 2CPYA 5L1LA 3JSMB 3DRSA 1FKOA 1DZ5A 4KSEB 4CH0S 2XWYA 2HHHF 3KLEB 2VQFJ 3EYZA 2YX7A 4V1Ak 1EQ0A 4X84A 2YNGA 3A1YG 5EX3A 4DV2F 4RLEA 3DOKA 1S59A 5B0FA 3FEXB 1S6PA 2YKNA 5C24A 2KKHA 2IFXA 3I82A 3M8WA 3IBWA 1JJHA 2WCXA 4ZLLA 3US5A 4WYLA 1VDHA 2VC0A 1GX5A 1RAGB 3PYDA 4NX9A 5ETMA 4O44A 2BDPA 1FJCA 2I0XA 2F3JA 4DPUA 5LMUF 2PIIA 1PKUA 2JJ4D 5LJ5Y 2AD9A 1UVJA 1V5IB 2YQ1A 3WDOA 3VZIA 3DYAB 2FPHX 4YHHJ 5HLFA 2MZRA 3KHHA 3CB4A 1S7HA 1N36J 1ZAXA 3R5AA 1VIXA 3SCKE 2HHQA 2JEJA 4QU6A 1N8RT 2OUGA 2H65B 2Z57B 4RNMA 4A8MP 4CTAB 1E6YA 3FBBA 3S8SA 3TUPA 4IG3A 1PIEA 4OLPA 1JXEA 1LW0A 4ZVUB 1TKTB 3B54A 4LF8J 3MEGB 5ITHA 4AXJA 2OLWA 1N32J 4Z2XA 4GVBA 1H38A 3JQMA 1H2UX 2HNDB 1RHRB 1Q79A 2GHPA 2RHQB 3DC2A 3L7PA 1SC3B 4QQBA 1XEZA 1LNQA 4EBEA 3QGPA 2MZJA 5B0BA 4USJC 5DETA 4DL7A 5C5JA 3GFHA 1IKWB 3BH7B 4OI4A 1LW2B 4OIXA 4A46A 2KYXA 3MMAA 1LXNA 2ZM6F 3QWPA 4J37A 4PQUB 4P2FA 4JI5F 2L41A 1S99A 2R2TA 4R5PB 1MROA 3PEHA 4PG4A 5J1PA 1RABB 2WVFA 2DGWA 2V0NA 3OR1A 1TL7A 1F0XA 4DR4J 3CJRA 5K14B 5MLCV 2ZH7A 4USVA 1GH8A 2DITA 4ZK7M 3KLFB 1U1LA 3CDAA 1IM4A 2XNRA 3ENQA 3U7JA 3J80Y 1PAUB 1D8ZA 1VRUA 1YBAA 3RB4A 2RILA 3OL8A 1Q86T 2BJ7A 3GG1A 3CD7A 4B3MJ 1YKWA 3K8WA 4B17A 3G87A 3VCDA 3SSSA 3R5JB 2VJVA 3T1HF 2CZ9A 1TL1B 3KK3A 3JSBA 5DO2A 3D9BA 1XMBA 4ZVSB 1B70B 3NOCA 2VICA 1ZETA 3ZZRA 5A0YB 3ET6B 3D68A 4UZCA 4O4GA 4S0MA 3OT9A 3KJQB 3BBBA 3PJXA 3F41A 4QIFA 3T6BA 3OQ2A 2GC8A 3GV7B 4GKJJ 2HS0A 3RJMB 3RW7A 3W8GA 1IBMF 3QSYB 1SIZA 1GMWD 3Q8UA 4QZVB 5FJ4A 1RYRA 2AJ4A 1FA0A 3UE2A 2QZ8A 3LWMA 4MIWA 1RLDA 2NXNA 1N54B 4B3TJ 3DM2B 2H54B 1RT6A 4ID8A 3CT9A 2LDYA 3FVYA 2OMOA 2AV5A 2ZZMA 2ZNZA 2QA4S 3A3NB 2OSQA 3D1HA 2IPOB 2ZBQA 3SDEA 2OJ3A 1WG1A 1X5OA 1F9HA 2ZWOA 3VTIA 2WSEC 4GRSA 2A6OA 4C8KA 3JSYA 1FFSB 1DTQB 3NCPA 3IBFB 2CJYB 2QMXA 1FE0A 4AT1B 1ZM9A 1XNRF 4C8YA 1M1KT 4DR1F 3I6PA 4ICLB 1R7IA 1MU2A 4U7UD 1FEHA 3BEGB 5IT4A 2K7KA 3KJVB 4C9DA 2KI2A 5D0GA 4CIOA 3JS9A 3LH2S 4LSLA 4I6WA 2ZZTA 3M32A 2KHCA 2XZDB 4KR0B 2BBEA 3PW7A 3HO1A 1H2VZ 2B7BB 2FD2A 4PG6A 5B08A 2EFOA 2Z2ZA 1KDNA 1CULA 2Y9HA 2A6MA 2B5JA 3CW2C 1FRJA 2RS8A 2XSJB 1UKUA 3D1QA 1XMQF 4IQMA 4NI2B 3VF0B 2ILYA 4WF9Q 1PYTA 2YX1A 3BO4A 2V2ZA 4N5SA 3HFVA 4ED0A 3WHIA 4ID5A 4B3SF 2ZOMA 5IM0A 1R43A 3D66A 1GMWA 3W2WA 1YRUA 2HZVA 1Q1KA 2OPSA 3A3PB 2QG9B 4NXMJ 1O8BA 4K0KF 1SJQA 4EUVA 1GT8A 2KM8B 4Y2KA 1FD2A 1FDAA 1PJ7A 3ULHA 5M2UA 1D0EA 4RUAA 4ES3A 2AWZA 1CBKA 3KG0A 4NOHA 3U27A 1HMVB 3VGTA 1RTHB 4KGKA 2XM3A 4DV5J 2N7YA 3EXCX 1M0SA 1W25A 5F8HA 4DL3A 1A0OB 5BR8J 1LK5A 4K59A 4ZP8A 2F5GA 1GXTA 4LRDA 2AX1A 3BJYA 1LV5A 1FI4A 3CJ0A 3GJQB 2B9WA 2FJWA 3CIZA 1S76D 2GHWA 2AYEA 2HHTA 4PXCA 1FRKA 3PIOQ 1LFPA 1I51B 5DG9A 4MKVA 1SVDA 1WHWA 2PN6A 4J9UE 1T3OA 5KT6A 2Y1LB 3EPIA 3X3UA 4IDKB 4ZIVA 1BHNA 2LFVA 2GIQA 3RU0A 3CCUS 4ANDA 1WJ9A 1JLGB 1NJXA 5I3QA 5BYSA 3I0RB 3CCSS 1G7CB 3G96A 5C2CA 4DWIA 4RW6B 2RHSB 3HD2A 3OVSA 2FVSA 2HBQB 5CD4A 2QMWA 4O4RA 4GC6A 2UUCF 3NAIA 2OPPA 1FXLA 3PXGa 2DK2A 2H1YA 1YI2S 2B3TB 2EVZA 3E51A 3NGKA 5KFQA 3J7A1 4ZPTR 5T14A 3OBIA 3DOLA 1APSA 3BR8A 2P9EA 3UN2A 2EG2A 2CVEA 2BR0A 3RR7A 2BQRA 2PFFB 3F44A 1U6FA 4YP3A 4KFBA 3N9UC 3I4PA 3TAMB 2E66A 2HNYA 4LIWA 4F2RA 3VV2B 2IVFB 3HJFA 4LRCA 1KVJA 2RMLA 2CQ1A 3HFKA 3WIUA 3BQ1A 2DH7A 4WFYA 1X4CA 2F4VF 2XZWA 3GONA 2LQBA 4JI3F 1KTQA 4I2QA 5JMNA 1TV6A 3M6VA 1JLEA 3PJWA 2Y8WA 4BHQA 3RUBL 3C6TA 4NA3A 4PZVA 1QAJA 4ZLNA 3EICA 1C0TB 5DRKA 2JVRA 1N34F 1L3UA 3H59A 3L4BC 2CPDA 4EFAC 1S0OA 2AZ3A 1S12A 1WDDA 3X1LB 1CJKB 1T9XA 1LWFA 4LF2A 4HACB 1LEOA 3R5GA 3V4MA 2XGPA 2A2CA 2NS1B 3O6QA 4CDIA 3R5DA 1H0HB 4CO3A 2WSCC 1UW9A 4ECSA 1CC8A 4OZJA 3JSMA 4ZJLA 3D6TB 4PXDA 2FZCB 3BKTA 2XY5A 3KLEA 4LFBJ 4NRTA 1RU1A 2CJXB 3CWJA 4EZ6A 1FRHA 2HBRB 1AYEA 4HL9A 4RX6A 1WACA 2UUAF 1BC6A 1T9YA 3DLLQ 4HDGA 2X1BA 3RBDA 1N48A 1S6QB 4OZ0A 2MLZA 2F9JA 4F4ZA 1ICEB 3M8YA 1SH3A 5GVQA 4DL5A 2RRBA 3B82A 2EI5A 2AQ4A 4LQ3A 1UZHA 2DISA 1TAUA 2IAJB 4USMA 2QL9B 2B51A 4LFAJ 4LMZA 4ED5A 2R2SA 3RG6A 3ZXWA 4G1IA 4J90A 1TP7A 4IRDA 4CNYA 4NXNJ 2XO7A 3VALA 2CQHA 3HHKA 2XO6A 4ELTA 3DYAA 4OI3A 2VFRA 4WP8A 2DT9A 1VQNS 2E44A 3HSZA 3SYZA 1M5HA 3KYLA 4CLZA 1U1MA 1U1QA 1WI6A 1CPZA 3A13A 5HL7Q 1KQFB 2DGXA 1ZM4A 4M5MA 5HQMA 2DRBA 1RBLA 1IQTA 2B4OA 3VGSA 4ZLJA 2IRYA 4K4YA 1IR1A 1TKTA 2LU2A 3GR1A 2COLA 2J9CA 1O6XA 3MEGA 1TKZB 4N77A 5KTQA 1CQNA 4M1KA 2OEMA 4MIBA 3NS7B 1X60A 2VD3A 3R7BB 4NE9C 3LGHA 2Z2YB 2HVEA 3PVXA 2HNDA 4IH6A 4CM0A 4ZVOB 3FEYB 4KKOA 3IWXA 2RSQA 2FLPA 4F4AA 5CA5A 5HATA 2CQ3A 1RAIB 5JJBA 3NGDA 4DSLA 4N47A 4A8XA 6FD1A 2VU5A 1GMVA 3HFZB 1H98A 1IKWA 3W61A 1X5SA 5KG5A 2B7CB 1LW2A 4NLTA 1FDNA 1S5ZA 3CC4S 1VBYA 1RE1B 3FC9A 4P2SA 1RB0A 4U67Q 1NSKL 1YLXA 4PQUA 1TQLA 3HKWA 2G2OA 5IWAF 1BQNB 2ADBA 4XO0A 5J2NA 4A48A 1BWEA 4DN9A 2J8SA 4R5PA 4JI0J 5T7LB 1V3ZA 2QFIA 4LRFA 1OQ6A 2RD5C 5D4LA 4B02A 4NWBA 4QPXA 5CABA 5K14A 1HIYA 2IHR1 2ZOFA 4ZP6A 3EGWB 4KT0C 3MPDA 3KLFA 4QR1A 4JUZA 2QRRA 3ITHA 5KFRA 2QSFA 1SC6A 2CQCA 4IR1A 3QIPB 3W1YC 4DF4A 2W7PA 2XLKA 3GWCA 1AROP 3D3BJ 1SBRA 3N79A 3RAQA 4U9RA 3LANA 1PJ5A 3BO2A 2XSFA 3BSOA 3M6WA 3T5KA 4MKYA 1AT1B 3DDKA 2YWGA 2B9EA 2BE7D 2FVPA 2UVWA 2E7VA 2EFQA 1YJVA 1OQ3A 2ZKUA 2PMHA 4DV0F 2WVDA 3SFUA 3DXSX 5A0YA 4RBUA 3ET6A 3H4DA 4DV7J 2IBOA 2NYIA 5FIIA 3N5BA 2CVIA 1KKHA 4HTIA 3H2LA 1R0AB 5HQ8A 5GMKa 1K44A 4EU0A 3V5RA 2EFGA 3KHRA 2EK1A 2YTCA 1UP1A 2L08A 4FPRA 3W66A 2GHVC 5C25A 1Y3JA 1VOMA 1SC4B 5KFKA 1FWKA 4NASA 3DM2A 1N33J 1NK4A 4DR5F 2VF3A 4DI6A 3R2DJ 3BM7A 1JLFB 2N4DA 3L9ZA 1WTFA 1C2PA 1DAXA 3TA1A 4ZOSA 1BQMB 1B0VA 2ACMA 3GMGA 1MG7A 2V2QA 1FERA 3ZNJ1 4CWBA 1DTQA 4QR0A 4JV0A 3AD9C 2MQLA 1Y5IB 2B43A 1FXRA 4JI2F 3AOAA 3OTEA 3P49B 3V6DA 1RT7B 5K8PA 4ZPDA 2DR5A 4QU7A 4L6V3 4ICLA 2C3OA 4DUYF 1RTIA 1YDLA 3IAM9 1RDRA 3RB0A 1K0VA 3DN9A 2YWWA 4HT7A 4DQIA 1EJ7L 1DBDA 3VR1A 2MY8A 3UCGA 2M0GB 2VODA 1SKRA 2K3IA 4WE1B 4X62F 2R7VA 3OD2A 1U49A 3QJJA 3VGVA 4J9RA 1SL2A 3C3LA 9ATCB 3I4HX 4EI2A 4QWBA 1Y00A 3NS5A 2W7OA 2BJEA 3NLCA 1S1UB 2XSJA 3PG9A 2YQ3A 1NB7A 1S9EB 2FHKA 2RF2B 2DH9A 4NI2A 4L73A 4KV8B 2Y1JA 2A3JA 1NU4A 1RT2B 4DR2J 1HWLA 3TWZA 1QDUB 4J9OA 3KFWX 2VA2A 2G1DA 1ZBTA 3D0GE 1H3DA 2Q79A 4LF6J 2N3LA 2RQKA 4RBTA 4CH7A
chains in the Genus database with same CATH topology
4K4WA 4DEZA 1V3SA 3E01B 1Q7YT 1VGYA 2HIQA 2RJZA 2WSFC 3T9NA 5KFZA 5K5MA 5HROB 4XPCA 4J9NA 2AGPA 1JMTA 1P8GA 2C3MA 1HNIA 1HI1A 2CPJA 1JLAA 2M52A 4NLQA 3NNCA 1DLOB 2EFPA 3CD0A 4BC7A 2H5EA 2POKA 4AQYF 4NLPA 1HHTP 2AYMA 4M8LA 3OXLA 4CQ1A 2UP1A 1KVIA 5HP1B 2RNEA 3OFEA 3ZZZA 3I0SB 4PKDB 1SI9A 3EUNA 2QT7A 3OSPA 3K57A 3UDLA 2R9LA 4J9MA 1T03A 4WIIA 3T19A 1HMVA 3FSIA 5D3GB 3GG0A 3KG1A 4AYBD 2MJNA 5IM0B 5DQHA 1YTYA 5H9FJ 3V2UC 3HHLC 4ZVGA 3W2WB 1VQ7S 1RTHA 2IMWP 2FJBB 1IBKF 2KH9A 5E41A 2EBGA 2OPSB 2J6TA 4NLRA 5LT5A 4MK7A 5DLGA 1TZ0A 5HI7A 3U1MA 2MJUA 2OO4A 4U7UK 4N76A 3PKYA 4MFBB 5A8RA 2FLLA 4X4SA 3OHBA 4RW9A 1VC5A 2J6SA 1L3VA 4DL4A 4MH8A 1RKIA 4ERDA 1UJ5A 1RTJB 2EW9A 5DQIA 3H8YA 1N5SA 3NNAA 4ELUA 1YJTA 2V5HG 2Y1RI 4QOTA 3CCVS 1N6QB 3GSDA 3QZ8A 5A6PA 2VASA 3R1HA 2FTRA 3D5MA 5FDLB 2CJBA 2HLTA 4ZCIA 2BUNA 3OJUA 4WK1A 1VC0A 2RE1A 3QAEA 4MK9A 4DUZF 1U7LA 1R0AA 4UUXA 2EBEA 2VPXB 3VQTA 3QLHB 3VAGA 1FVQA 5M2RA 5G4DA 1NK6A 4V19X 2GIRA 1FJGF 4EZ9A 2HG4A 4KHMA 3AY0A 3MGJA 4F26A 3OSNA 4DR3F 1R8PA 2NLWA 4OZ5A 2R8HA 2PD1A 2ZE2A 3BGLA 3LOUA 1NHUA 3TUIC 3OL7A 4K50A 1VQ4S 2ZFHA 2PT0A 1S77D 2BM1A 2I9SA 3M8PA 4NYPA 4ALZA 2JHEA 1YJWS 1KD1T 4EBCA 2BM0A 3CGIA 3MXHP 1MW7A 5KAKA 3S1TA 2IM0A 1GTEA 5AE2A 3SV3A 3TUJC 4OFZA 3AH6A 4I68A 4ZLPA 4X65F 2N82B 3O5TB 4X2BA 4ZMMA 3DRPB 1XR6A 3ICLA 3O3LA 4OJGA 5KG0A 4ECRA 3H5UA 2DO0A 1DRZA 4I64A 1QSSA 3UWTA 2HLUA 1OS5A 1B7FA 2JFKA 4XPEA 3KLIA 1E6VB 4RWXA 5KFHA 4WU3A 2RB7A 2BABA 3FJ2A 4OQJA 3TX8A 4LT6A 4NCGA 4DSEA 3RBEA 4TY8B 2BXJA 4FYDA 3MD3A 2XI2A 3OTOF 1RA7A 3T1YF 2Y1IA 3TR5A 4TLRA 2KT2A 3DRXA 2BANB 3UQSA 3DMJB 5F8IA 5F41A 2XY6A 2VV5A 3H2VE 3MM5A 3MMCA 5DM7Q 3ENWA 1NK9A 2JC0A 4OX7A 4ES2A 3FMBA 2PI4A 4KTQA 1N5QA 3DRRA 4O23A 2GA7A 5EGYA 1T8EA 1JLGA 4Y0FA 2MQNA 3HDSA 5KT4A 1Q82T 2XB2D 1NK7A 5A8KB 2YKNB 3MF5A 4O3PA 1FKPB 4Y00A 1WHVA 2RQMA 5CYMB 4WJBA 3M9NB 2ZUGA 1Y0HA 1Z4UA 4GMKA 4O3QA 2A10A 3IR6B 3JTNA 3LP1B 1U1OA 5HBMA 3KMQA 4IQXA 4RW6A 4UY8T 1WEYA 2K2PA 4NLXA 1X0PA 3CJKA 4Q7AA 4I2PB 1VQ8S 2E1AA 3PFOA 4TYAA 5J1EB 4UUWA 4B9MA 4A8FA 2PO4A 4H54A 4KB7A 4O3NA 1ZM2A 4PG8A 5KFTA 3RAMA 4PPDA 4RW4A 2MMYA 4ECWA 2G4BA 4WYWA 2JLGA 3TQ1A 1OPZA 2IYGA 2RRAA 4X4OA 1HBUB 3LAKA 3SZ2A 3LAMA 3MAHA 1VBXA 2B4UA 1R8BA 1LQ9A 2XLIA 4ILLA 3CMES 4RUCA 1SKSA 4HKQA 1K0TA 5DG8A 5I4MA 1L3TA 3TNVA 1AUDA 3TA0A 1GAOA 1F2GA 4NZ6A 3HZEA 3GIJA 2J9DA 2W4DA 2WOMA 1N4LA 5CD4H 1VIOA 4BS2A 4WFAQ 1S1XB 3MPWA 1CLFA 2CYYA 3UW1A 5LMNF 5IQQA 1L3SA 2FC8A 2XLJA 3I32A 2MKIA 3ZFVA 5GADI 1K1QA 4H4KA 4KO0A 3I56S 2KVIA 3LQVA 4R8UA 4IR9A 2L48A 2AJ0A 2LEPA 2LEAA 5HLFB 4DL6A 2G9OA 4OZ1A 1WNEA 1AW0A 1YITS 4U6PA 2DVIA 4G1PA 2UZAA 4ZVFA 1RT4B 3OV7A 2FVQA 5JUMA 4OJ1A 1S9FA 2O5DA 3NP5A 3CDWA 3BF4A 1X4GA 1TVRA 1T05B 3K2YA 1NJIT 3CCZA 4WZQA 4R0JA 3KLHA 2QA4G 1BD6A 3AA8A 4M95A 1KN6A 5KT7A 1MMDA 2KG1A 1NKEA 4DR6F 3CCES 1R27B 4Q0BB 4WFZA 3M2VA 4JV5F 2HPUA 2ZITA 1R89A 2BE2B 1TR0A 4JI1F 3FSYA 3PRDA 3TAMA 2NZ4A 3CULA 3TP2A 3ISNC 3W2VB 5LXYA 4IFVA 3J7YU 3Q8PB 4IG3B 4CO1A 2IM2A 4C3MA 2VQEF 3MPVA 1U26A 1DQ9A 2ZHAA 1N56A 4TLQA 3SEOA 1U2RA 3IC1A 5KFPA 2KHDA 1T02A 2MZSA 3NWGA 4Q2LA 4ZPVR 5KFYA 1IUJA 4RUHA 3VAKA 3I96A 1H7WA 4FNHA 4F4YA 4QR2A 4KV8A 2XWXA 5KFDA 1HPZA 3RB6A 4M63A 3UR0A 4JI0F 1K73T 3ETOA 3PFEA 4ECQA 1QTMA 1UETA 2VFUA 2C3YA 2AGQA 3PKMA 1RAJA 5BYRA 2HWIA 3TARA 4NLGA 2KFYA 4H4MB 4TYBA 4C3LA 4IO9Q 5JXSA 4X4TA 1RK8A 3ZZUA 1PSDA 5CZVA 2GQQA 2QE5A 2R7QA 2HNZA 3L3CA 5A6WA 4RW7B 2KDOA 2HYIB 4PQAA 4FNIA 2MSSA 3CSKA 2B56A 5G0RB 4C2MA 5AXLA 2YY3A 1R8AA 5AXMA 3G8QA 2UXBF 5KFIA 4KFBB 2B9XA 1S6UA 1QLNA 4A8OA 2HHXA 2HNYB 2YKOA 5DDOC 4F2SA 2VFTA 1VI7A 2L9WA 1T3NA 2J5AA 5GAEI 4ILMA 3MR3A 3PX0A 2HS3A 4MKBA 1U1RA 1QVGR 1C0TA 5B09A 4FXVA 4FBUA 4JI7F 3M05A 1VC6A 4F4XA 2CJKA 2X3GA 2O01C 5KFUA 3IS9A 5B0EA 5K8OA 1DQ8A 2V2KA 1CC7A 3B78A 1SJ1A 5AE3A 1ZZFA 1DLOA 3FZBA 2FGOA 1Q8BA 3HHEA 4LUBA 1VQ6S 3OR2A 4QYRA 3KOAA 2XG8A 3UNGC 5M2PA 5AE1A 2GGPA 4NLVA 5T41A 3GB0A 2ZOGA 3JAMY 3JYTB 1JLBA 3NS6A 5EUHA 3PV8A 2CKWA 2V9KA 3GYXB 4IOCQ 2RDJA 3IWLA 2LCWA 2K1RB 2C2RA 2QEXS 3MOJB 4EEYA 2MQQA 4Q8FA 1S1TB 2ZH4A 3QGHA 1R8CA 1XR7A 2UVRA 2UUTA 3FSXA 4TNOA 4F25A 3MUMP 4YB5A 4DLEA 2MKJA 4ED2A 2OPRB 4GO5X 4I2QB 2DIUA 2JFDA 3KK1A 4NZ0A 1YSJA 2HRUA 3NRBA 1V9OA 3OTBA 2PMZD 3SCJE 1TV6B 4ZPAA 1EP4B 1JLEB 4WXWA 1MROB 3K5OA 5BYQA 3GYNA 2J9DE 1BQXA 2BW2A 4MFBA 1W2BR 1U45A 3C6TB 2ASDA 4PG5A 2WW8A 1Q81T 1VRTA 3DLKA 4J9SA 2HW3A 3MMJA 3SSQA 3OR1B 1RI7A 1FESA 2RQ4A 4IG0A 4K4SA 2RU3A 1TK0A 1WG5A 5D4PA 4ZCKA 5E0OA 4C0BA 4CT9A 4C8LA 1N5TA 3DXBA 2WK4A 3Q8SB 1S1VA 1SV5A 4HVZA 4B08A 4DSFA 4Y2IA 2V4QA 3OUYB 4C8NA 1YQHA 4W90B 2W4CA 2ZD1A 5KFCA 3IA0A 2V4JB 4NLOA 4NLUA 4A47A 4IH5A 1VRUB 4ILRA 1URRA 1FVSA 1LWFB 2BRLA 5CYQA 4WFBQ 1S6QA 3R5BA 2OSRA 1KNZA 2ASLA 2EFNA 1MWYA 4TQRA 3MM9A 1LWEB 3BR9A 4OI1A 3K5LA 4NLYA 1XN9A 4Y2CA 1IN0A 2LLZA 1FNMA 2YVSA 4DFPA 4EWTA 1NJZA 1KLNA 3B4DA 3LALA 5HO4A 1OSDA 4HYKA 1UVMA 3HF5A 3H5SA 3L09A 3T5LA 3MEKA 4X4NA 4OHVA 1LFWA 2CPYA 2PC6A 5L1LA 1VQLS 4Y6IA 2FY1A 4C4WA 1QM9A 3JSMB 3DRSA 1FKOA 4NYZA 1DZ5A 2P6TA 4KSEB 4DBQA 4CH0S 1JIHA 5KOXA 4ZCLA 4ZS6A 2XWYA 2HHHF 4QWEA 3KLEB 1TUVA 2CZVC 3EYZA 2Z4PA 1UWBB 2KJWA 4ES1A 2YX7A 4CO0A 4QW9A 4ZPWR 2J76E 5D77A 1NH8A 2RIJA 4PUOB 4X84A 2YNGA 3A1YG 1YWXA 3LUYA 5EX3A 4O3OA 3MMBB 4RLEA 3DOKA 4DV2F 4EYIB 5B0FA 2XHWA 3HMJG 1Q16B 5KFNA 1S72S 4O4GB 5GAGI 1RYSA 4G3IA 1FEEA 4EBDA 1W2IA 2FUG9 4M5DB 3CJ2A 3FEXB 1KLMB 2ZH8A 1S6PA 2GO8A 2DHXA 5A8KA 2YKNA 2N7CA 5C24A 1VBZA 5KFFA 1FRXA 1FKPA 1QY7A 4KPYA 4J9KA 4E0DA 3HXMA 1K1SA 2KKHA 2IFXA 1V3RA 3I82A 1JK9B 2I5JA 4FP9A 1NRKA 3IBWA 1JJHA 5J2PA 3F56A 2VG6B 5DJBA 1I6JA 2GO9A 2WCXA 2M8DB 2HMIB 4OHYA 2YH0A 5CCLA 3US5A 4WYLA 2X1AA 1XC9A 4YUDA 3C8YA 2VC0A 4U7CA 2K8GA 1GX5A 4KGMA 5EWGA 1TL5A 2A2DA 2D3ZA 3CPWR 4NX9A 1VHFA 4C0HA 5I42A 4O44A 3VZHA 2BDPA 3WC2A 1FJCA 2KTQA 2I0XA 2R7UA 2ASYA 2F3JA 1OPIA 2XULA 2QFJA 5LMUF 4X64F 2PIIA 6FDRA 4DSIA 2JJ4D 1PGZA 1LK7A 5LJ5Y 2CPEA 2F7VA 2B9YA 3OFHA 2AD9A 1UVJA 1N36F 2UV8G 3WDOA 2ZZNA 3WC0A 3GZ7A 5HN0A 1S1XA 2JRSA 1S10A 4DMZA 4CNZA 4IFYB 2WHOA 3Q24A 3CD6S 5EWEA 4B3OB 3VZIA 3DYAB 1J5OB 2YNIB 2DO4A 3OLBA 1RT1B 1S48A 2FPHX 1Q8IA 4YEAA 4DF8A 2ZDPA 2NR0A 1HQUB 2B4VA 1TKZA 4YMEA 5HLFA 2MZRA 2B4PA 3KHHA 3M2RB 1UVLA 2R7SA 1WF1A 5KFVA 3EXYA 3CB4A 4I7FB 1S7HA 2D3OR 2KG0A 4MYTA 3P6YC 3H2UB 3FZ2A 4OL8A 1ZAXA 1LKZA 4CO5A 4URGA 3MM7B 1SKWA 3R5AA 1VIXA 4Q43A 1DTTB 3N4WA 2IA0A 3SCKE 3N6MA 2WRMA 1C1CB 1IKYA 4TN2A 3CJ5A 2HHQA 2JEJA 4QU6A 5SZTA 1N8RT 2PGCA 2DPJA 2AJFE 1HQEB 4ECYA 2FHJD 3G8TA 2ADCA 4RNMA 1R31A 4A8MP 3CJ3A 4RNOA 4CTAB 5GAHI 1E6YA 3AB4B 4UQTA 5A2QY 4RW8A 3MD1A 3S8SA 5IXUA 3W2VA 1KONA 1YJ9S 2MQMA 4IG3A 4C11A 2M3DA 4OLPA 2Q66A 4ETZA 3K5NA 1JXEA 1LW0A 2LMIA 2IC3B 3M30A 3LP2A 2ATLA 1GXUA 1KOOA 3DLJA 4YR0A 1TKTB 4BWMA 2E9ZA 4NYOA 5EX0A 4BWJA 1QE1B 1S1WB 2HZCA 4LSNB 3MEGB 4XAKA 1S6OA 2MQPA 5GAHU 5ITHA 4B9TA 4AXJA 3W3SA 4H4OA 4DR2F 4OZNA 1TL3A 2OLWA 3B4MA 3K0JA 3HX9A 2B6AB 4Z2XA 3BDPA 1H38A 3FMWA 3CF5Q 2AGOA 3OL6A 3RZAA 3H40A 4H4MA 1H2UX 1JLQB 2UVUA 1YIJS 3FNNA 2I2YA 1S79A 2UXDF 2BACA 1TAQA 2HNDB 3V81A 1NEEA 5ADZA 3D2WA 4DL0C 3QPIA 4F02A 1Q79A 2YWKA 1BQNA 4LF6F 2GHPA 3CCTA 1HYSA 4LSLB 3DC2A 3L7PA 2YKPA 2FJEB 1KR4A 4QQBA 2BYCA 2ROPA 5T7LA 2DR9A 2Z2MA 1XEZA 3IRWP 1XR5A 1FTCA 2WBRA 4EBEA 1CVJA 3QGPA 1BY9A 1EETB 2MZJA 5B0BA 5FLXY 4USJC 5DETA 3MFHA 4DL7A 5C5JA 1RT5B 1JNRB 3GFHA 1IKWB 1C4CA 5KG7A 2BQUA 2BVZA 2F8EX 3TAPA 3MEDB 4OI4A 1LW2B 4OIXA 2RDIA 3FQKA 4I6YA 2Q43A 1HBMA 2KYXA 4A46A 2V9WA 3MMAA 1LXNA 3M2UB 2LQ5A 2ZM6F 4QW8A 2B5JB 4OMFG 5K8MA 3QWPA 4LQ9A 1SUQB 3OXFA 5I3UA 3GE9A 3MEEB 4J37A 2KXHA 2OP5A 3T1AA 4PQUB 1Y9OA 2CDQA 3QO9B 3QIPA 4JI5F 3FDSA 4OV1A 4IH7A 2L41A 3FRZA 3TVKA 1S99A 4Q45A 3JSRA 2NPFA 3KK2A 4R25A 1HBOB 1N0VC 3V4IB 4CH1A 2DNYA 2YNFB 1EP4A 2R2TA 2KFNA 4R5PB 1MROA 2W8LA 3SQGA 5L1KA 3KKFA 1KQKA 3PEHA 4PG4A 5J1PA 2CQBA 4CO4A 1UEVA 2GFFA 4DG1A 1P1LA 1U2FA 4FBTA 2DGWA 2V0NA 1HD1A 3HKZD 3OR1A 5F9LA 3KTQA 1F0XA 3MM6B 4Y28C 1FK9B 5DDRC 1SJRA 1VK8A 2D7SA 4ID5B 2JDJA 2E1CA 3CCWA 5K14B 1JB0C 3GQCA 5MLCV 2ZH7A 4PXEA 1U1KA 2CQ0A 1GH8A 5E3PA 2DITA 1FNOA 1Z2LA 4ZK7M 3KLFB 1U1LA 1WI8A 3CDAA 4B3MF 2IA6A 2VOOA 1XBWA 5K9FA 1IM4A 3MR5A 2HVZA 2XNRA 4DV6F 4XK8C 2DNNA 3ENQA 3U7JA 3J80Y 3M1VA 3BGRB 2V4JA 1D8ZA 2VBYA 1VRUA 3G8SA 2CG4A 2W7AA 1OWXA 3IG1B 2ZHBA 2HFNA 1YGYA 2A1BA 2MDAA 1H7XA 1YBAA 5AXNA 2DNLA 3HHDA 4DV3F