3VCDA

Computationally designed self-assembling octahedral cage protein, o333, crystallized in space group r32
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
184
structure length
184
Chain Sequence
SQAIGILELTSIAAGMELGDAMLKSANVDLLVSKTISPGKFLLMLGGDIGAIQQAIETGTSQAGELLVDSLVLANIHPSVLPAISGLNSVDKRQAVGIVETWSVAACISAADRAVKGSNVTLVRVHMAFGIGGKCYMVVAGDVSDVALAVTVASSSAGAYGLLVYASLIPRPHEAMWRQMVEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Propanediol utilization polyhedral body protein PduT
publication title Computational design of self-assembling protein nanomaterials with atomic level accuracy.
pubmed doi rcsb
source organism Salmonella enterica
molecule tags Electron transport
total genus 50
structure length 184
sequence length 184
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3vcdA02
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3vcdA01
2A1BA 2EWHA 3H8YA 3NGKA 4QIVA 4P2SA 2G13A 4LIWA 5DJBA 3CIMA 3VCDA 4QIFA 4OX6A 4OLOA 3CGIA 3IA0A 3NWGA 4DDFA 3DN9A 3MPYA 4OLPA 3I96A 4P7TA 4RBTA 3SSRA 3N79A 4RBVA 3SSSA 2A10A 3DNCA 3BN4A 2A18A 4PPDA 3PACA 4RBUA 4AXJA 3I6PA 4P7VA 4OX7A 3SSQA 3MPWA 4QIGA 4AXIA 5L38A 4QIEA 4OX8A
chains in the Genus database with same CATH superfamily
4K5SA 2ALYB 2Y8WA 1XR7A 3VZIA 4EFAC 1IJEB 3GFYA 3L7PA 1CJTB 2W25A 3ZZOA 4ZJLA 3K59A 3T1YF 4OYWA 1FKOA 2QZ8A 2ZH1A 4NI2A 2OFHX 4WFBQ 2DNOA 1HWLA 1JJCB 2PA8D 5IT9U 2KXHA 1U1RA 3D1HA 2R4FA 5B0EA 3JSBA 1RXOB 1C0UA 4CQ1A 3ZTQA 1NZAA 2WW8A 2V6AA 3ETMA 4YEAA 3LALA 5GAHU 3PX4A 1PG5B 3N01A 4CP5A 3JQJA 2DGQA 4JV5F 4NWBA 3KKFA 4DFMA 1VQOS 3DC2A 2YTCA 4USWA 2RVJA 2XULA 3K0JA 4HL9A 1WHYA 2XWYA 1YJVA 2QO3A 2HRTA 2LKZA 4WP9A 4MKYA 3TNVA 1WD6A 3QFWA 4OYIA 3A8KA 4B3OB 1V5VA 2QL9B 1YBUA 3MI7X 3ETOA 2V69A 2BJEA 3LP0A 3MD1A 4DN9A 3C14B 1PCAA 4WXOA 1UCNA 5T41A 1UEKA 1MMDA 1C1CB 3VAHA 4JI8J 4XPCA 1NDLA 4USHA 2EG2A 3W65A 2UUTA 1LW0A 1LKZA 3CGIA 3HZGA 2NPFA 1JNZB 2VJUA 3I4HX 5EGYA 4RW7B 4YB6A 2WBRA 3U02A 2MKIA 1FJ7A 1X0FA 4DV3F 4LT6A 3FDSA 2XMAA 1JB0C 1JLEB 4M5MA 5CH7B 1PKUA 2QE5A 2C28A 3MM9A 5B0FA 2FHKA 3PYFA 2J8AA 4F50A 4R8UB 2GW8A 4Z7YA 1FT8A 3A12A 4C11A 3NGDA 4Q2MA 3DU6A 4ZVOB 3LP1A 2JZ5A 4NLXA 3MM7A 1KLNA 4OV6A 3DRSA 4P52A 4JP8A 1E6VB 4A8OA 4WYLA 1X9WA 3GG0A 1VHIA 2HGLA 2RF2A 2B5JB 4EEYA 2VF3A 3KK3A 3DLEA 1FEHA 4KHPJ 3PJWA 2DGTA 1XNQJ 3DKDA 4J7CA 5H9EK 4LRCA 4DV7F 3A3PB 4M5NA 1TVRA 2C42A 2WOMB 4OJHA 4ED3A 1JLBB 4NA3A 4NASA 3V5RA 2MKHA 4NLDA 4AXIA 4NXMJ 1J5EF 2JJ4D 1A7GE 2OMOA 3TAMA 3MTJA 2QIFA 2NXJA 3IM9A 1UPMB 4N76A 3DMJB 1NB7A 2XS2A 1O6XA 4TYAA 2FJVA 1YWXA 1Q82T 2EBGA 2VG5B 5CXTA 4P10A 3QIPA 1TK5A 3GIIA 2EVZA 2R3VA 3DOKB 2I5JA 3L7OA 4RWXA 2ZNZA 5KFDA 4ILRA 1F5CA 4C9DA 4F4KA 1I3OB 2EKYA 1U0HB 1M5SA 3WHIA 4KGMA 2CPJA 5F8GA 3RRKA 4ES1A 4NA1A 3QRPA 1PGZA 2XNQA 3Q2SC 1QSSA 4OYMA 4F4YA 4G1QA 2JC1A 5JXSA 1BQMB 3T5LA 4WFZA 3M7VA 4YB7A 2FY8A 2OGUA 4M5DA 2J0XA 1SQFA 4HDGA 1RHRB 1CJUA 2DRBA 2YKQA 1KBRA 3SFUA 5D3GA 3PFEA 1TKZB 2KG1A 4Q2LA 1MLAA 2C3MA 2N3OA 5F0WA 4W4MA 3H20A 1RHKB 3G6YA 4CO2A 3S7RA 1VCTA 1N5SA 5A8KB 3IG1B 4B3TJ 2DNNA 2J0SD 1U26A 1RKJA 3WC2A 3R7SB 1PYOB 1S1XB 2HAFA 5DQHA 1RT6A 3SQOP 4JI6F 2RDJA 2HVZA 4GO5X 4KRWA 4FYXB 3FBBA 3AB2B 3FSYA 4KV8A 1WG1A 2N82B 2W9CB 2B43A 2MGZA 1UPPA 4BDPA 4QWBA 1ZPWX 1FK9B 1X4FA 2AYEA 3J7AN 1WC4A 1U09A 4J91A 5FJ4A 3HI9A 3IS9B 1FVSA 4DR1J 5DG9A 3H59A 2HIYA 1YZ6A 3DDNA 2ZJRQ 1FVQA 4DV1J 2E1RA 2YPYA 2Y1IA 1UVLA 2XMVA 4J9NA 2KT2A 4FNHA 3V4IA 2E5HA 3W9JA 4DR3F 5AXMA 3OHBA 1VJWA 4QIEA 1RBAA 4M1KA 2LDIA 2FZCB 4NRTA 4RNNA 5I42A 3VAGA 3DOLB 5F8IA 3TEGA 2RRBA 4I2PA 3IM8A 3LANA 3JAMY 1UJ4A 3CCES 3MR3A 2JDJA 3JS9A 2E29A 1R6YA 1XBWA 4NLPA 1S6PB 2F8HA 4FS1A 1JX4A 2DR8A 3CCRS 2CQCA 3TUJC 3ZZRA 3FNNA 3MPDA 2D3OR 2M3DA 2LXUA 4B9UA 3I4PA 4DPUA 2E9ZA 3W62A 2D9OA 1PJ6A 2BM1A 4O3SA 3DGVA 5AJ3J 2ZBRA 4KAIA 2ZM6J 3EWGA 2HNYB 3PM9A 1RT1A 1WEYA 4FXWA 3W7BA 3GFZA 2ZBCA 4DXLA 2PEHA 4UY8T 3MM8B 2PN6A 4RW4B 1FWLA 5EDWA 2EC2A 3R6LB 5I3UB 4O44A 2B7CB 2FJXA 1V3SA 2OHDA 3AJ2A 2OKQA 3J7ZT 4C0OC 5LJ5Y 2ZHOA 5EWEA 1VJQA 5D8HB 5KFYA 1U1MA 1KC8T 1AUDA 1KLMB 2D74B 2ZHAA 4RBTA 4ZCLA 3MMAB 2DK2A 2VPWB 4OHWA 5F9LA 3M32B 1SV5A 4LRDA 4F4AA 3OLBA 3NS5A 2QLXA 3D7SB 3KXDA 1RKIA 2C2RA 3RGIA 3G96A 3W5ZA 1RU1A 3ZZYA 5BR8F 3GV5B 1DHMA 3AD7C 3RU0A 4FF4A 3N5FA 1HWKA 2DHHA 1IVZA 4OZ0A 1YRXA 1IKXA 4K4SA 5HROA 1X4DA 1RAEB 4KC5A 1JMTA 3POTA 1Q78A 1NSAA 4PWUA 2LQ9A 3DFEA 2KZZA 4A8MP 4WIQA 4A8WA 2V50A 1GEHA 2QRRA 2L9WA 1R0BG 3EZUA 3V6DB 3UWTA 3MD3A 2AEJA 5J2MB 1NKBA 1SKWA 3RW7A 1RE1B 3VVTA 1S12A 1JJHA 1RYSA 2B9XA 4PABA 4OYOA 2AX1A 1XR6A 4ZP8A 2CPHA 4TVAB 4I2QB 4JV0A 1TL3A 1VBKA 3P96A 3QMQA 4KO0B 3GIMA 1Y5IB 1WHXA 1XMBA 5M2RA 5EX3A 1NNDA 5K20B 4E2FB 4RUAA 1FHTA 1HI8A 2EI5A 4R25A 1IKWA 1D09B 1EP4A 1U1NA 1JLCA 5A8WA 1U4BA 1M5HA 4A8YA 1IM4A 4KE5A 2XYHB 3M6WA 2DCLA 3W2VA 3FK4A 2BANB 2CG8A 2QLJB 4CLZA 2UXCJ 4OZ5A 4QYRA 3M8PA 3ZZTA 2RRNA 1YJ9S 3N5BA 3FJ2A 1IBCB 4X66F 1S10A 4P71A 1KEKA 4NPOA 4EYHB 5MAOA 2B6AA 3Q8YA 2VA2A 2UUBF 4OHZA 5D4PA 1N33F 3P5TL 2V8VA 4UZCA 3QIDA 1HD0A 3WIVA 3E01B 1TP7A 1CG2A 1FJCA 3TVZA 1NKCA 2XO6A 4C3MA 4DL3A 4DSEA 3GZ7A 2IAJA 2HWHA 3H90A 2KFZA 1F0XA 2K3IA 2UU9J 5L39A 4BBYA 1N36J 3NOCA 4DR6F 3JAMU 5J2PB 1VRUA 1VQMS 3P5BP 2VB6A 3HHLA 1F5BA 2IM2A 2BOAA 1FKOB 1E6YA 2HQ3A 4F4XA 4QIVA 4NI2B 3B82A 1D0EA 5LMNJ 1Y00A 2IY5B 1RAGB 4U95A 3QGIA 3QJLA 2SXLA 2XG8A 4M63A 1H6KX 2MKCA 4LR9A 4WK3A 3CWJA 3H8YA 1KD1T 1HW8A 4IRCA 2CWXA 2CVIA 1RWWB 3I9V9 1RT4A 1TU0B 4PPZA 1TUGB 4DQQA 3OR2B 4NCGA 1F2HA 2HW3A 4OL8A 4OHYA 2RS8A 4V19X 1DTTA 1Q8IA 4KGZB 3EICA 3KK2B 4TLQA 3MM6B 3V81A 4CH0S 2J7UA 5C2CA 1VI7A 5DQIA 3LQVA 1R7IA 2AD9A 3GYXB 3GJSB 4F7VA 1VHFA 2ZH9A 3DHXA 3FCHA 3W9IA 4FYWB 2AP6A 1LW0B 1UVMA 2MY8A 5IWAF 3CJ3A 1XMOJ 4DSFA 4PWDA 3JYTA 2DGWA 2GCFA 2ZEJA 2G13A 4ZVUB 1YSJA 4HACB 3I0SA 1Q5VA 1NO8A 2EK1A 3RZAA 1UFLA 3CC7S 3QLHB 2UVVA 2PA3A 2YNHB 1ZZNA 1HD1A 1HL6A 4AQYJ 1O5JA 2OI2A 3UW1A 1TQLA 2W7PA 1LWXA 1U0SA 3V6KA 4G3IA 3CUNA 2VG7B 3EDRB 4LFBJ 5SZTA 3ENVA 1FTRA 1WKLA 1VQ9S 3A3NB 1FRJA 5CYQB 3LP1B 3OSNA 3NS6A 4IH5A 3OLAA 6AT1B 4K5RA 4DFKA 1X60A 5EN1A 5E3CA 2E9TA 1N6QA 2GGPA 1SKRA 3P8BB 4DL5A 4WE1A 2O3DA 2P9GA 2ZZNA 3D1QA 3ENQA 4B9SA 1SL1A 5HBMA 4O3PA 2FUG9 4ECYA 1FKPB 1I51B 4R0EA 3NAIA 1RLDA 2O66A 3DLEB 3AXMA 2QL7B 1SUQA 1ZPVA 2DHSA 2HMIB 4ECXA 4LF4J 1I94J 4QBUA 3DNCA 2N4DA 1OY6A 2GO9A 5E3AA 1PAUB 1CULB 1IBLF 5KFKA 1RAHB 1R27B 1C4CA 3KLEA 4EGLA 4LFCF 3PDNA 5HVHA 5K5MA 4CTAA 4H4KC 5IV3A 2RILA 3HSZA 2UXBF 2W24A 1QTNB 1KP6A 5IT0A 2R42A 3NGSA 3X1LB 1HNWF 1S6OA 4YHHF 2ZDOA 3G9CA 1S6UA 4AL5A 4FXVA 3H5UA 3GMGA 2MZTA 1FD2A 2Q1LA 2XI3A 1CSJA 1GQEA 1T02A 4FPRA 4WCEQ 2XLJA 4O4GB 1JLGB 1MSWD 1BC6A 4LF5J 2DH8A 2AGOA 1U6FA 2HFNA 3RB6A 2HFSA 3TO8A 2CA9A 1S57A 3UDEA 4WTOB 2CXEA 3KUHA 3NBPA 4QW8A 4JYAF 3J7Z5 3UD3P 1B70B 3KDNA 1HBNA 1QAXA 2CPIA 2IJRA 2W1BA 4YY3J 5HL7Q 2VBXA 4X64J 3CT9A 2V8PA 3OFGA 3DLKA 2VFVA 1YLXA 2NREA 1EX8A 4X4RA 1S6QA 2PFFB 2F4VJ 5F8JA 1Z4UA 1WEZA 3K7RA 4QR1A 4OI4A 3GR0A 2OPRB 3G2XA 5KFZA 1NUEA 4CDIA 3K5LA 4OMFG 4F0HA 4DV6F 3RRGA 2HS0A 4FF1A 3Q24A 3Q23A 2DNZA 1WDTA 4CT9A 1RT6B 4JI2F 1HBOA 1NCLA 1H98A 4C98A 1EB0A 2XZWA 2R8HA 4OJ1A 2DR9A 1F9FA 4CLUA 1S1VA 3M6XA 1OPZA 4IG3B 2X3GA 1HNVA 3A3OB 2LEBA 5HP1A 1N4LA 2PMZD 2MZQA 1HYSA 4K2JA 4EK2A 2E5LJ 2CADA 1RBOB 3FFIB 2E5GA 3A8EA 3D67A 4RBVA 3T41A 2ZH4A 3BH6B 1NK5A 1IQTA 5KFVA 5LSLA 1EARA 1AFIA 1B64A 3AOCA 3THTA 3R7BB 1IKYA 1VQSA 3B4DA 1X5SA 3I56S 1UETA 3W8GA 2J5AA 2GJ2A 4M95A 4URQU 2XLIA 3IR5B 2IJNA 2PT0A 1PC5A 3GU0A 5A76A 3OVBA 1S7HA 4AXJA 3GILA 1RTIA 3BSAA 3MEGA 3CVKA 4UW2A 4HTIA 4KYZA 4ZJOA 3NMAA 4ZPTR 3FEYB 3ISND 2C2KB 4O3RA 4DLEA 1OO0B 1WOOA 3PR4A 2DNGA 4HHHA 2ZKUA 1SH0A 5HANA 3UR3C 5DGBA 2HURA 3WBZA 1NKEA 1VK8A 2IMWP 3L4BC 4IKAA 5E5NA 1SCJB 4QW9A 3H4BA 4NZ0A 2J9CA 3QSYB 2FVQA 1S72S 3GSDA 2B56A 3I0RB 2PE8A 3TAPA 4C7QA 1CJVA 1N5YA 1HA1A 3TZYA 4X62F 4MYTA 2VONA 2G9OA 2OPSB 4L73A 3OXLA 2JL9A 2I9SA 1G3OA 4CRJA 2JVOA 2MQQA 5E0OA 2PD1A 3N6NA 3BGUA 1SJQA 1ZM2A 5KFXA 3TJ9A 4K4XA 4USJC 1RUSA 2KRRA 1WTFA 2YXLA 3MAHA 3OHAA 4RUBA 4GVBB 2B8PA 4DZ6A 2DVIA 2IMOA 4WF9Q 2Y0SD 3KMQA 4H4OB 1MROA 3D6FB 4NLOA 1KQSR 2OEKA 2V8DA 3NOGA 4YS2A 3MHYA 2M88A 1PC4A 2KJVA 1R8BA 4LSLA 3PG9A 5HLFB 1JXVA 3W2WA 1NAQA 1BWVA 3FEZA 4I1TA 2YX1A 1FDBA 2M70A 4YP3A 2IYGA 3CW2C 3W5XA 2LU1A 1VQLS 3MAAA 5F8HA 3CCSS 2DGVA 4AUKA 4MTPA 4BCAA 1IUJA 3N6LA 1TL3B 1B7FA 2C1EB 5DZ7A 1UJ6A 1JLAA 3QAEA 1T11A 3Q8PB 5I3QA 3ILJA 1DURA 1WC0A 3MM5A 1GTEA 2KHCA 2ZNYA 3HHEA 4LBIA 3PKMA 1JJ2R 1KS2A 4I6YA 5HJYA 3P3DA 2IC3A 4IR1A 5DZ6A 3EVMA 4ZCMA 3RR7A 1UW9A 5HMWA 5KFBA 2FB0A 2HRYA 2MQOA 4IO9Q 3DLJA 2IHR1 1S9GA 1AYEA 2NLWA 5HVFA 2AU0A 1M90T 3ENAA 2ZD1A 5KFFA 1CVJA 2HPUA 1S97A 1L3SA 3KJVA 3I82A 3PHTA 5KFHA 3BSCA 2ZFHA 1SJ3P 2JSXA 1NJYA 3PO5A 1UWBB 4L76A 2DIVA 4YDXA 1PBAA 3LTOA 4WTYA 3NL0A 3OW2R 3J7YI 4QIWD 1HLWA 3MPWA 1S9EA 2J9EA 1RA6A 2ZBQA 1D3WA 1NDPA 1QE1B 2CNNB 4LF1A 2KRBA 2RJZA 3EX7B 2ZWPA 1GMWA 2AV5A 1F9EB 2BBEA 4LSNB 3MXHP 3U27A 4J37A 3CPWR 2R7OA 3MR7A 1FO1A 5ETQA 4PG6A 1XK8A 4PUOA 3LA0A 1T05A 2Z2MA 3BBBA 1GMUA 1QAIA 1RHJB 4LF9J 2ABYA 3R1HA 1RWMB 4IQXA 1ELOA 2BR0A 3PRVA 4KFBA 4P2SA 3VGTA 1FJGF 5ITHA 5ETVA 4YUDA 2EK6A 4GVLA 1HFEL 4WZMA 2MKYA 2KH9A 4TYBA 2CQ3A 2DNQA 4ZVFA 1DTQA 3JB9k 2UV8G 3KLHB 4ETZA 5F0UA 1RT7B 4ALZA 3T1HJ 1N8RT 4F3QA 2LVWA 2JLFA 4F36A 5CYMB 1EZZB 2C3YA 3FCWA 4UF4A 5L9XA 1KOHA 3S6EA 2V67A 4NLSA 4LF8F 2V0NA 1WKJA 1B0PA 2W2MP 2V2KA 4O3QA 3PW7A 2D3UA 1DBDA 5C7PA 4HT5A 3F44A 4ED1A 3T6BA 2CZ4A 1LFWA 4LJMA 2D1CA 1Q7YT 3TEHB 4PYDA 3W63A 4A8XA 2VZ9A 1H7WA 3GFHA 3U1NA 3TJAA 2HSEB 3KJFB 5F41A 1WSVA 5F9NA 3HPOA 1QJHA 4CLFA 4ZOSA 4N56A 3DXSX 1N52B 1RTHB 1YX2A 2AYBA 3PHEA 3NNHA 4OHXA 4RU2A 3I9ZA 4CLYA 3BSOA 3SV3A 3AQPA 3CCZA 4DV5F 5IC6B 2QG9B 3OBIA 4C6AA 3DGPA 1H2TZ 4DUZF 1VDHA 3DRPA 1TUVA 5J2NB 4RNHA 3OTOJ 2UVRA 2CQHA 3M4XA 4P72A 1U2FA 4OLOA 3PRDA 4UQGA 1Y0HA 4LF7J 3DRRB 3EE3A 4GKJJ 3KNGA 4CWBA 3EGWB 1VMBA 5KG4A 2DGXA 1V9OA 3O1LA 8AT1B 1GAOA 2CQIA 1YI2S 5C2GA 3G8QA 5DM6Q 2FC8A 3D68A 2ZOMA 3V6JA 2CDRB 2HIQA 2OD4A 3HVTA 2I6WA 1LEOA 7FDRA 4LIWA 1D9DA 3FMWA 2BEFA 3BGLA 5CZVA 2LXFA 3CD6S 3TARA 2WSEC 4H4KA 3X3UA 5C25B 2XGQA 2YWWA 5KFWA 2FGOA 4AL6A 4I68A 1MN7A 3SCIE 4FBUA 1KTQA 2XWXA 1S1WA 2HQFA 4DV4F 2NZCA 1QUPA 2FVPA 1TV6B 2HBQB 2ROPA 1LWFA 3I6PA 3UO0A 3NNCA 3OTDA 1H38A 4DR2F 1MWQA 5ETNA 1M5OC 4X65J 4H4MB 2HHXA 2VKRA 2PI4A 3TZZA 4IRDA 4HI1A 2ZE2A 1BXNA 4U8YA 4A48A 2E1MC 4IYQA 4WFYA 3F41A 4TU7A 3D0HE 1VIOA 3R8YA 3CJKA 1BHNA 2DR6A 4LBHA 1AW0A 3N9UC 2ALZA 3FVYA 4WFXA 3OJSA 2ASYA 4KIAA 1S59A 4DG1B 3OVAA 3W1YC 2O5DA 3M8QA 2E5IA 4ZP9A 1OMSA 4NOHA 4URGA 2HVHA 1IR0A 2IM0A 4ZPVR 3SCLE 3MPYA 2EFGA 4ECTA 2R7VA 3ET6A 2BJ3A 2BJDA 2DH7A 1KKHA 2Z2ZA 4ZCKA 5AXNA 1FRHA 4NXNF 3UVJB 3T9NA 3IR6B 4ANEA 4P73A 1U02A 3R9LA 2VBWA 4DR5J 1JLFB 3ENWA 4J9VA 2DTJA 3RAQA 3EMTA 1UA0A 4MT1A 4TQSA 1HNVB 1R8AA 4ZN3A 1HYSB 2UP1A 2CJYB 2YVSA 1U2CA 3D3CJ 2A6MA 2CIMA 4A8FA 2WRMA 1VOMA 1C0TB 2Y1JA 3CJ0A 1C4AA 5IM0B 2KT3A 1T9WA 1RT5A 2HLUA 3A8IA 4BC7A 3M9OB 4B08A 4FF2A 4B3MJ 3BGOP 2D7SA 5ETPA 1X5PA 5HN0A 4EZ6A 1HBUB 3G71S 2KN4A 3VGSA 4DN0A 2V68A 4DS5A 2GHWA 4HT7A 3EPIA 5KT5A 1A6LA 2QT7A 3BPDA 2C22A 1JWWA 3KHLA 2I38A 3KWMA 2KHDA 2R7UA 1LXNA 2V2ZA 6FDRA 4JI3J 2DH9A 3IAS9 1DFDA 4MK9A 4F4WA 2ZH8A 2LMIA 3DHWC 4X84A 5K8NA 3OUYB 1X4CA 2EKNA 2EWHA 2A3JA 2A2CA 3D28A 4YFUA 2AX0A 4O0IA 3PV8A 4QWDA 5ETTA 3ITHA 2DD8S 3TJ8A 3TX8A 2JRSA 5BYRA 2VC0A 2ZUGA 4JI4J 4ZLLA 3D6HB 3TAQA 1DJ0A 4N8NA 2RDDA 1U6BA 3I32A 1TAQA 2VUGA 2D9PA 1Y7PA 3Q8SB 4B9NA 3MCNA 3QT5A 1WF1A 2V9WA 3EXYA 4F4ZA 4Y2KA 1B0TA 1N34J 2HBZB 2AZ3A 2DGSA 2FLPA 1RQ0A 3JTOA 1JIHA 2J0QD 4YR3A 1IBMF 4ELUA 1CC8A 3CTRA 3H98A 1HNIB 3NGRA 4Q0BB 2BUNA 2RS2A 1QD1A 2FHMA 4KY3A 4M5HA 1MU2B 4M5GA 2YWHA 1IN0A 3FBEA 1RAJA 3MEEA 2ADBA 2M9KA 5LMUF 3DU5A 1CS4B 5K8MA 1RT3B 4OJGA 3I5BA 3L9ZA 3IXQA 5CD4A 1A0OB 3RBZA 1HHQA 4LMZA 4Q43A 4K50A 2WZ1A 2AT1B 2ATLA 3DOMB 4OI2A 4K0KJ 2BE2A 1MROB 2AGPA 5LL6d 3A4TA 1ZTWA 4CO3A 4NYOA 2F8MA 4UQTA 5J1NA 1EKRA 2HZCA 3T3FA 3KHGA 4ILMA 3B6BA 2GMJA 4MFBB 4LSLB 3M2RB 1RTDB 4WXWA 3TZWA 2VBYA 4IFYA 2R8GA 4ZLNA 3EJMA 2PFDA 1ZYQA 4DX8H 5KFLA 2UXDJ 2WONB 3SCKE 2M5YA 4RW6A 2KYXA 2L3MA 4JI1J 2YKNA 4JV1A 5A0YA 1UEVA 4OYAA 2GQCA 3VF0B 1HQUA 3GPAA 3RR8A 2MLZA 4A46A 1D9AA 2AZ1A 1KTVA 4U7UD 1TKTB 4DR7F 3C15B 3OR1B 1O51A 2HFZA 3P4UB 3MM5B 3SFGA 1J5OA 4ZDNA 2VQFJ 1KN6A 2F3JA 4GC6A 1KOOA 4PR6A 1JKHB 3UQSA 3V2UC 1FRLA 2LQBA 1XMQF 2IVYA 2GMHA 2KTQA 4QU6A 2YQ1A 3I5AA 4G1PA 1T03A 1Z2LA 1NMEB 1HARA 2FJAB 4ECVA 4R5PB 3K58A 2Y1RI 4ECSA 3HFZB 4IFVB 1ZBTA 3NGTA 4C8YA 4ZHRB 1FF2A 2Y8YA 2XBPA 2YWGA 2QYGA 4F26A 4N41A 3H4DA 4OJ3A 5KFSA 1XC9A 2HZAA 1TELA 2W9BB 2MLXA 4KKOA 5D4OA 3GR1A 1TL7A 1Q4RA 3PR5B 1EHWA 1Q8BA 2N7CA 2YNIA 5G0RB 4DF4A 2DKOB 1S9EB 1VR6A 3IRXA 3C16B 3GYNA 2R2TA 2DRDA 1YG0A 5ETOA 2BACA 3JQMA 3QT6A 3J81U 2I2YA 2I0XA 2CYYA 4OQJA 2DO0A 5IFMA 4G1IA 4DQIA 1QVFR 1ZTTA 3V4MA 1B4SA 1NZ8A 3KFWX 2MPUA 3S01A 3FMBA 1LWCA 3UR0A 4WBFA 2AMCB 3KLIA 2VASA 4KJIA 2DNRA 2CNKB 5LSRA 1K1QA 2ZVSA 4KFBB 4KB7A 2DISA 4ZPCA 2HQGA 2HWIA 4Q7AA 3UNGC 3MURP 4ZVQB 1RZMA 5L9NA 4M94A 4YOEA 5K14B 4LFAF 2ILZA 4ED8A 4CLSA 2OPPA 2HGMA 5DQGA 2MJUA 5ETSA 3KUGA 1UJ5A 4QOTA 2Y0BB 1FWPA 2GVZA 3VAJA 1WHVA 2DT9A 4M8LA 3WQPA 3S1TA 5CHCB 3IN5A 2KKHA 3HKWA 1SB6A 3TA0A 3HULA 1YTYA 3AB4B 1NB2A 4NLTA 3MECA 2F5GA 2WVBA 2CPEA 2OLWA 1J27A 3QGHA 2O1PA 5HK4A 4WU2A 5U47A 3PX6A 2YKPA 5A8RB 5GAEU 4ZVSB 1FJEB 3MUMP 1P1LA 4DV0J 3CMQA 3BKUA 4OYZA 4JB8B 3U1LA 3ZNUA 1R0AA 1V3RA 1WJ9A 3HZEA 4RW9B 5DLFA 1SXLA 3G8TA 2VFSA 3ZTOA 2GHVC 5B0AA 5K8OA 2RMLA 1RWXB 2LCWA 3NRBA 1QSYA 4P75A 1RISA 4NEYA 3NLCA 1GMVA 3CDWA 4U7UK 2OPQA 1X5TA 1VRTB 4CLTA 2RHSB 3BGRA 1N5VA 2D3ZA 2OO4A 2VODA 1UVJA 1QLNA 1NJIT 3DGPB 4NLWA 2H4YB 2BZ2A 5KT3A 4GKKF 3DRPB 4DPWA 3MR5A 5RUBA 4B3SF 3GV7B 1ACMB 1JQGA 1WWHA 4DR4J 3M2UB 1R8HA 1TKXA 3IA0A 4KGXB 3TA1A 3LW5C 1NJWA 3SIPB 2RUSA 4OX9F 3IBFB 2IFXA 2KU7A 3UPFA 2E66A 3BYPA 3DI6A 2R7QA 4NRUA 1UVKA 4ZJQA 4DBQA 4Q8EA 2RDIA 4TY9A 4I7FA 3V6HA 2LDYA 4KTQA 2UZAA 5L46A 2V94A 2H48B 3HVTB 3QGPA 3M8YA 2MZJA 1VQPS 3D1OA 4NA2A 4BC9A 1NJXA 3VR1A 1PAEX 1U49A 1SPBP 4ITSA 4RX6A 5KT7A 4WKRA 3M8ZA 2V34A 3J7YU 2HHHF 1GH8A 2YWFA 1RWNB 2B4VA 4JI7J 2UUCJ 1DLOA 5KFCA 3GONA 3KNAA 2UUAF 2YX4A 3KLVA 5BJRA 3VAMA 4TNOA 3MTKA 1EETB 3AY0A 2ACYA 3M2VB 1PO6A 1VIXA 3KK1B 5J1EB 3Q83A 1FCAA 3Q8VA 4HYKA 4DCOB 5K8PA 3BO3A 3CDAA 1YDLA 1S1UA 1HR0J 2KXFA 5D0EA 2AEFA 2NSBA 3RUBL 3RAMA 2AEMA 2GS8A 1T8EA 3QO9A 4DZDA 5J2QA 1RDRA 1JLQB 4EBEA 1ZAXA 2GIQA 4K4YA 3M30B 3RBEA 1FWKA 3DM2A 4F2SA 4BLGA 4MJKA 4FDFA 4RZRA 4RW8A 2JEIA 2JHEA 1GTHA 2GX8A 1AZSA 3W5YA 2X3DA 2UUWA 3OFHA 2RD5C 2F40A 3TANA 1RAIB 3JSMB 3MEKA 1B7YB 2QA4G 2I1RA 2DHXA 1TAUA 1UTAA 3A13A 3OPKA 1XNRJ 2BKNA 3WZ0A 2C3OA 1RP5A 4BHQA 3CIMA 4PXDA 4ANCA 2YNGA 2J7WA 4CO1A 4L6V3 3LAMA 2E1CA 3JSYA 1WF0A 2HBYB 4JI5J 4B3RJ 1WI8A 3GCWP 4OV1A 2DNPA 3VV2B 2CQDA 2Z8QA 3DLLQ 2BJ7A 4ZVHA 2QYCA 3EDQB 4X4PA 3HSJA 4Y00A 4K8RA 1OYEA 3RTVA 2RRAA 1BGXT 3R1LA 1GX5A 1BWEA 3C8YA 3KG4A 3BS9A 4ZLPA 1U48A 4MIWA 3UCUP 1RLCL 2ZC4A 1ZOTA 4EI2A 2W7AA 2XMWA 3Q2TC 1OPIA 1W2IA 2C3UA 2XO7A 2ZH7A 1UFKA 2F65A 1RTJA 5LM7E 2EPIA 2N3LA 3QRRA 2C2MB 2CUYA 5D15A 1K44A 2AQ4A 4HHJA 4RUHA 1XQIA 3MCMA 1NJZA 2GFFA 3MMBA 5LMUJ 2XSJB 3GV8B 5IC4B 1IBKJ 1WF2A 4LF6F 1WOPA 1H0HB 4TY8A 4K4ZA 3AFGA 4ID5B 3BF4A 4QU7A 2QFIA 3H7HB 4U96A 3U7JA 4A8QA 4MKBA 5KFQA 4XDDA 3BZQA 3QPIA 3AODA 2RKIB 2VPZB 1SKUB 1ZZFA 2DNHA 2OFGX 1G1XA 4A8KA 3OFEA 1SL0A 2QV6A 2DCUB 4PRFA 2YKMA 4J9UE 4ZCIA 3MWBA 2Z0GA 1Y3JA 5HVGA 3WIUA 5FDLA 3C6TA 1HNXJ 3K89A 1RWUA 3EVOA 1SJRA 1PSDA 3MF5A 2VG6A 3IGVA 2N4CA 2MMYA 3U1MA 1QDUB 4J9LA 4CYUB 1IWAA 2ASLA 1FXRA 1QUVA 4ZP7A 1KSPA 2BE2B 1CPZA 1CJTA 5GMKa 4PQAA 1SJ1A 4L75A 3EGZA 1X4GA 1SH2A 3PTWA 4JI0F 2FPHX 1RBLA 2YQ3A 4CNYA 3CJTA 4RL1A 1S0OA 1PJ5A 1S9FA 1WELA 2CJKA 4IFYB 4K7QA 1QAJA 4JBCA 2DEJA 2JVRA 2LP4A 3RJMB 3KYLA 2PMWA 4NE9C 3SV4A 3RW6A 2E7WA 3DDKA 4DUYF 3LP2B 5EX0A 2YKNB 1QTMA 1IKVB 1P9YA 1VBXA 3KLFB 3AAWB 1WTBA 4DEZA 1X4EA 4OYPA 1ZM9A 2LA4A 4ANDA 3ISNC 2W4DA 3C14A 4PQUB 1N88A 5JVGQ 1X9SA 2DHAA 1C1CA 4KQZA 1YQHA 1SC1B 3C6UB 4ECWA 1JXLA 2AF6A 1ZA1B 3NWRA 4HI2A 4X4TA 3OQ2A 1F5AA 2XC9A 4DV2J 4IDKB 1RACB 2IRYA 5EHHA 4N7TA 3G8SA 2B9YA 1X5OA 5DS7A 5DLGA 4RW7A 3CC2S 2VICA 4DHVA 3NKYA 5J1PA 1JLEA 3IGNA 3MGJA 3QRQA 4KKOB 1VQ4S 3W3SA 1JK9B 1T95A 2P8IA 3DYAB 4R8UA 2QL5B 2YNIB 1HPZA 3THVA 2QFJA 4JI8F 1VGYA 3PJ9A 2RU3A 1E6VA 2D41A 1GX6A 1V3ZA 1DQAA 5C42B 1NPPA 1F9HA 1YKWA 2B5JA 1LOUA 5KG1A 4KPCA 2FVRA 1NSQA 1WSRA 3PW5A 3BO4A 2GAGC 3HDSA 4AL7A 3Q86A 2PGCA 4RPFA 2ILYA 2XNRA 2CJBA 1UA1A 1VC5A 2ADCA 4KBIA 3KLGA 2BX6A 3GE9A 5FIIA 1PYTA 4QQBA 1N32J 2WOMA 2DGUA 1JLBA 4WK1A 4IQMA 3OL7A 1I5OB 4IO1A 1REVB 3LPYA 5DDQC 3NEKA 5C24B 3GJTB 3O8WA 2PSZA 2ZBIA 3TVYA 5LT5A 1U24A 3EGVA 4I67A 5A6WA 3ZNJ1 3W61A 4ZMMA 9RUBA 3VALA 1IR1A 2YNFB 5CCMA 2VG5A 3B78A 2AW0A 3T9ZA 3D0IE 4NZ7A 2GVDB 3DOKA 2VQEJ 4NLVA 4C97A 3CCJS 4QYZK 4DMZA 1LW2B 4ECUA 2BABA 4OZLA 5HMXA 3ZZZA 4KHPF 2NXNA 1XNQF 1FI4A 1URNA 1UW4A 4ECQA 1U0HA 1V6HA 2COLA 1HMVB 4CH7A 3DLGB 1KDNA 1NXIA 4EO6A 3L09A 4NXMF 4TLRA 4QWEA 1D1UA 1ZH5A 3AOBA 1U45A 2IIHA 2ZDPA 3HFKA 3CCLS 2CKWA 2MQLA 2OEMA 3DDIA 4F8RA 1UP1A 2RIJA 3D54A 1P6TA 1YJ7A 4PKDB 3CO9A 5T7LB 1UL3A 4OYXA 2R7SA 1CBKA 2W8LA 3D2WA 1TKZA 2OPQB 3GSIA 4AE5A 1C1BB 3RYLA 1OQ6A 2F9JA 4J9OA 1O0PA 3CEDA 4NMXA 4QWAA 5A8KA 2E1AA 2EW9A 3IG1A 1TTHB 2MDAA 1S1XA 2FDNA 2QX0A 3H25A 1Q5YA 1KQGB 3MUTP 1XWLA 3O44A 2CNOB 1FRKA 2OH2A 1FD8A 1KVJA 4ICLB 3GIRA 4NCBA 1W26A 1EAYC 2W9CA 4J9QA 5F3ZA 4PWWA 4LRAA 3SDEB 3AXKA 3OL6A 2HFOA 1L3UA 2QTWA 1FK9A 2ZWOA 5SUHA 3EZOA 4I7FB 3HP6A 2JH3A 4DL0C 4DSLA 4B17A 3IS9A 2LFVA 4FPIA 3BYRA 4B3TF 2DNLA 2ZZTA 2VD3A 2KVIA 4I69A 2L08A 4UUXA 5E2QA 4DL6A 3VAIA 2WTFA 3IBCB 1RT2B 2LEPA 3GIJA 3QNWB 4L3KA 1K0TA 3OL8A 1S48A 4WFNQ 5KTQA 3IFEA 1GNKA 1LWEB 1YVFA 2QLBB 5AE3A 2POKA 2LLZA 1G6BA 2E7XA 1G7CB 4TQRA 1SQGA 3T1YJ 2MQPA 3M9NB 2GNKA 3DOLA 2QEXS 1URRA 2W2QP 2KB2A 4LF2A 1AXQA 2IBKA 1S6PA 3HK2A 2CPFA 2OJ3A 1CJKB 4H54A 2XHWA 4DR1F 3GJRB 3SMZA 4TXSA 3G6ES 4LQ9A 3KUEA 4JV5J 2HYIB 2H1YA 4DV1F 2RE1A 1HQEB 3CSKA 3ILOA 2IA0A 2IVFB 2HNYA 2BE7D 1AUSL 4GRSA 1SVDA 4CLLA 2FJWA 1CLFA 3HLUA 5D0RA 2B8QA 2GJIA 3MM8A 5E7OB 4RW4A 3T5HA 2VA3A 4GC7A 1GXUA 6FD1A 3CB4A 2AJ2A 2FLOA 2O01C 3VAFA 3OV7A 1C0UB 3D9BA 4ERDA 3C19A 3DM2B 5F3TA 1UEUA 2LQJA 2R7XA 5D0GA 2CRLA 1KLMA 1OQ3A 2IDLA 2KVQE 3MMAA 5AJ3F 2ZH2A 1U2RA 3CCVS 3RB4A 1X7VA 2ZM6F 4CNZA 4ZPAA 2WVFA 3M32A 3E2EA 4DV3J 4DQSA 2HK2A 4OZ2A 3VTIA 3K57A 4FF3A 2G1DA 2IRXA 3LP0B 1Q95G 3CJQA 4UOCA 1M5PC 2CQ1A 1HQ2A 2EG1A 3FQKA 1EJ7L 2RSQA 3UDVA 3UN2A 1Q86T 3HT3A 3ZTSA 3VWSA 3M1VA 1M5KC 1NSPA 3PYDA 4RNMA 1NEEA 3CIZA 3A1YG 1SJ4P 4Y2MA 3ONQA 3SBMA 3VVUA 3MPUB 2XCPA 3GFXA 1F6TA 3RB0A 4FZVA 2MZSA 4IH6A 1RAOA 2B7BB 4LR7A 5B7WA 3V6DA 2BDPA 4D3HA 1KONA 2PO4A 3CDBA 5J2MA 2NPIA 4DV7J 4EYIB 4ZVPB 5E33A 5L1LA 2O67A 3MM9B 3NCQA 5H9FK 1NH8A 1NLKL 1IQZA 5KG2A 1N54B 2HG4A 1U1QA 2FZGB 4C11B 1J5EJ 3BH7B 1KWMA 2LQ8A 4CCHA 4I2QA 3MM7B 3DRSB 1SJFA 3CJ8A 3KHRA 4C8KA 2R9LA 2IYIA 2E1PA 3ULHA 2D69A 4LUBA 2R2SA 4KO0A 3CD5A 1F3FA 2Y3YA 2VL1A 2RF2B 2X1GA 2HVEA 1T3OA 2VFUA 4R0JA 2UVWA 1UMJA 3MMBB 5KT6A 4HTJA 3KK3B 1FE4A 1U8WA 2KDOA 3QJPA 4PAAA 4TY8B 3FKBA 2J6TA 2BANA 3GQCA 3R6GB 4UT4A 1TVRB 2QC3A 7AT1B 3HD1A 3E8OA 3BN7A 2ZOFA 4L74A 1WACA 3OVSA 1H7XA 3TAMB 2CJQA 1XJWB 1RWVB 4V19J 3GTYX 4IG0A 5HQMA 2WCXA 4U7CA 2WAQD 3E01A 3PIPQ 3QIPB 3IWLA 2VG6B 2I5JB 2L9DA 2HHSA 1W25A 3HVAA 3R5CA 3HHNB 2W2PP 3UE2A 2G0JA 5J2PA 1TFYA 3W60A 2UXCF 5A6PA 1FTCA 2J76E 4ZVTB 1SBRA 4UY85 4W92B 3M6VA 1XTZA 3AA8A 5ETKA 2EFOA 4G1QB 4JI6J 3AJ1A 2K1RA 2ZZMA 2MSSA 3KDOA 3T19A 1FNOA 3DRXA 4DUTA 3G82A 4M5DB 1WDDA 4JOUA 1CJUB 2ZJPQ 3L3CA 1XR5A 5D3GB 1KVKA 2K06A 2HQIA 2KFNA 5CABA 2IA6A 3OR2A 1VLYA 3GJQB 5D4NA 3IMQJ 4PG4A 2UU9F 1N36F 3CULA 1IWGA 3OJUA 3FRYA 3KK2A 4FXDA 3MM6A 1ZS6A 4IUFA 4C0HA 1T7PA 1S5ZA 1NSKL 3PO4A 2ZHBA 5LMNF 1ROFA 3H5XA 5E3RA 4ZP6A 4DR3J 1RWKB 3BEGB 5ETLA 2M2BA 4KV8B 3VGVA 4F2RA 1OSCA 2I8EA 2H4WB 4C3LA 2MGZB 3P49B 3ZZ0A 2DB1A 1NH7A 5IZHA 4F04B 4KR0B 4HACA 3HHDA 4EUVA 5I3PA 1HWUA 2VH7A 3QLHA 2YNHA 1KR4A 3FCVA 1FRXA 3EXCX 1L3TA 1FDAA 2DBBA 5KFRA 3H5SA 4P7VA 2YH1A 4EZ9A 2RT3A 1ZETA 5L38A 3E3XA 3UNYA 2VG7A 2QLFB 3RAXA 5A2QU 2CQPA 1HPZB 1RAAB 3R2CJ 2DR5A 2QA1A 2OAUA 5CYQA 2GA7A 3V4IB 2Y1LB 4WU3A 4BWJA 3OTBA 4ELTA 2BKOA 1XMOF 1H72C 5DG8A 1SI9A 4ZPDA 1FE0A 5I42B 3RBDA 3J7A1 4DL7A 4E98A 4I2PB 3CMAS 1FKPA 3R7NB 2H54B 2VV5A 3Q22A 3UCZP 2RQKA 3KLGB 5DG7A 2HMIA 2DIUA 1LFPA 4AQYF 2OUGA 1YIJS 4HVZA 2WB4A 3O2IA 2KI2A 3VAKA 4CIOA 2NUUG 1CULA 4LFBF 4NZ6A 4NYZA 2R7RA 1VQ5S 1TMMA 1KNZA 4B9MA 1M5VC 2ASDA 3NCPA 2DNYA 2OD6A 5CZXA 2Q43A 4DPTA 4DQRA 2XMMA 1RT1B 4OIXA 2OIHA 2F8EX 3FBFA 3Q89A 3W9HA 5BR8J 4MIAA 2CNLB 2KM8B 4FN5A 2FD2A 1REGX 2PDAA 4O44B 4LVOP 2HGNA 2B0GA 2J6UA 3BKTA 2J9DE 4LF4F 1I94F 4O4GA 1JLGA 3UD4P 8RUCA 1W7WA 4DS4A 4QYZJ 4Z37A 2G2OA 2LYVA 4CLKA 1U1LA 2Q79A 3WX4A 5CAAA 3CCTA 4Q45A 1YJRA 3K2YA 1SV5B 4NYPA 2K8GA 5LXYA 2G0CA 1KQFB 5KFTA 4P2MA 3LWLA 4QPTA 3P45B 3TI0A 4OYBA 3QZ8A 1GT8A 2WB1D 2VBZA 3H2UB 3TZXA 1FXDA 1F2GA 2J6SA 2P5VA 4S0MA 1IKXB 5HROB 2H5IB 3LOUA 2W9AA 4LF5F 1K73T 2OPRA 5GAEI 3POTB 4DX7A 1U1KA 4DF8A 3PZPA 4CLPA 4CLWA 4X4OA 2GIFA 5CA5A 4ETXA 3N6MA 3CCMS 1NPRA 1S77D 4MKVA 1FA0A 5GAGU 4YY3F 4EBDA 1DQ9A 4X64F 3K8VA 3OD2A 2OTLS 3G6VA 1R8CA 3B4MA 4EBCA 1OY9A 2XM3A 3Q8UA 2GHPA 1TR0A 4IG3A 3HCXA 2YX7A 3DRYA 3TRGA 4X66J 3BN4A 4G65A 4HHUA 2QSFA 2F4VF 2UUBJ 1XIQA 1TZ0A 3FFIA 1W2BR 1B0VA 3G6XA 1N33J 5B0BA 1TK8A 4J90A 3DN9A 3GWCA 1Y4ZB 2VC1A 1S7IA 3KJQB 3EVWA 3US5A 1RSCA 2MQMA 3SSQA 4NMLA 2CQ4A 2M7SA 4PEOA 2LQ5A 1IKWB 3FSIA 1EP4B 1JLCB 5A8WB 1Y5LB 4HLBA 3W2VB 4PYAA 4DR6J 2MXYA 1SL2A 1G4CA 2HQCA 4QIGA 2W4PA 3M8PB 2OSQA 3IWNC 2DY1A 4P9SA 1N48A 4AYBD 2V63A 2GQ2A 2B6AB 3NP5A 2DPJA 4CO0A 2E5LF 1MN9A 2Z58B 4CH1A 2ZVIA 8ATCB 1UZDA 3QWPA 1RA7A 4J5OA 4DU8A 3TW0A 4NLYA 1BMQB 1R31A 3K5NA 1WUUA 2HHWA 4WYWA 4CO4A 4C4WA 4TU8A 4MIBA 2H5JB 2XZDB 2KO1A 2RB7A 5AE1A 1LK7A 4I56A 2IAJB 5B0CA 5JMNA 3CXCR 2NUHA 2IJFA 4WIIA 1VRUB 1S79A 1RGVA 3M05A 1KFDA 3HHLB 1KFSA 3AD9C 2JEFA 2Z4PA 1HHTP 1E6YB 2RHQB 4OI3A 2OMLA 2HNDA 1YJWS 3ZFVA 2Z2LA 1HIYA 4CI0B 1SQEA 1K9MT 4LREA 2E9RX 1ULRA 3MCSA 1M1GA 4MAKA 2OP5A 3OFFA 5IWAJ 1OJ4A 3CCUS 1VS3A 4M5LA 1L3VA 3HSGA 1PIEA 3I0RA 2ZJQQ 4J9PA 1NU4A 1RT4B 4ED0A 4HR2A 1OS5A 2WBMA 5GADI 1VC0A 1Y9OA 2OPSA 4NCGB 5AXKA 2WSFC 4X4SA 1IM6A 1DTTB 4ED4A 4U9RA 3V81B 2AJ4A 1CC7A 3IBWA 1I6JA 3CE8A 2ZH6A 3NY0A 2IVMA 2BW7A 3BPSP 3P6YC 2VPYB 3PCOB 4GVBA 3S8SA 2E7VA 3PJXA 3M1VB 2VDIA 4OZ3A 3M9MB 1X4BA 4FYYB 4H4OA 3JYTB 4P2FA 4PWDB 1T94A 1YJUA 3K8WA 2HS3A 4QZVB 2HZVA 2NYIA 4IRKA 1AB8A 4QWCA 3J81j 3PYEA 2NR0A 1RU2A 2XMKA 3IAM9 3IO1A 2AYGA 5HLFA 3I0SB 4UOFA 2WVDA 3DLHA 3CDUA 4X4VA 3HHKA 5ETRA 3N4WA 1PBUA 2W2NP 5HAOA 1X31C 4NLQA 1R3NA 2EC0A 1IBLJ 3M6UA 3SQGA 2FHOB 2KJWA 3PW0A 2ROEA 4LFCJ 5H9FJ 3TWZA 4YDDB 2LXIA 3UDCA 4UOGA 1N6QB 2GGPB 1YRTA 2UXBJ 3QAUA 3CDEA 3MZIA 4WE1B 2XYPB 2OELA 5DGAA 3KG0A 5HBMB 3ILIA 2BV3A 1HNWJ 4YHHJ 2HQDA 4WJBA 3VZHA 4PG7A 2R8KA 2EXUA 1SUQB 4USVA 1FKAF 1Q8KA 2LU2A 2K2PA 4IOAQ 2HEKA 3CD0A 1ZAVA 4FKYA 1OIAA 1YITS 4XK8C 3D3BJ 4Z2XA 1YZ7A 4Y2CA 3KLEB 1X9MA 1APSA 4JYAJ 3OTCA 5L1JA 3H5YA 2A10A 3WC0A 1N5TA 3BDPA 4AFFA 4CTAB 4FBTA 2G2YA 3VGUA 4IG0B 1HI0P 2V8GA 1X4AA 1UWBA 4U67Q 3SZ2A 3EUNA 3F0NA 1S1TA 5FD1A 2FHJA 4DOZA 4YB5A 4P2XA 5DETA 1WNEA 4GMKA 4RR5A 1F1BB 3NGUA 1DQ8A 1QE1A 3EYZA 4A8SA 4FP9A 2BMBA 1Q1KA 4LSNA 1DRZA 4ZKAA 1WHWA 2IRUA 4O4RA 2HHQA 4DV6J 1CQMA 2NXCA 1S76D 1ZAWA 1Q7LB 4B02A 1NBEB 3NBPB 2OTJS 1XEZA 5KFGA 2HLTA 2BQ3A 2HBRB 3I5CA 4DL4A 3C46A 4JI2J 1AFJA 2K1RB 1HBNB 2WW4A 3SSRA 2HFVA 3G82B 3NS7B 3DLKB 2FTRA 2MZ1A 3HX9A 4ZITA 4YR0A 3QJJA 3PX0A 1S6QB 1FNXH 2Z57B 1NPKA 2XS7A 1Q79A 3KMSA 3R5JB 2GQQA 3KLHA 2V9KA 5HJXA 5B08A 1WC1A 1NK9A 1RT7A 1NM2A 4Q44A 5CYMA 2APOA 3AOAA 1PJ7A 4L72B 4UUWA 2FQQB 2P9EA 4XIUA 1HBOB 4LF9F 1IXKA 2VOPA 2V4JA 3HKZD 1ZM4A 3IR7B 1K1SA 3BBFA 4O3NA 4P6QA 1RABB 3T6JA 2F63A 2RH3A 5M2PA 1S1VB 3HHLD 1Z2ZA 5HP1B 2MLYA 2CPDA 2NQPA 1WC5A 1VC6A 5JVHQ 4RNOA 5AXLA 1CQNA 2HHTA 5KOXA 2HAIA 3KOAA 2EFPA 3HVWA 5GMDA 2PI5A 4C8LA 1PYSB 3OTEA 1R89A 4RKUC 4ED7A 3T1HF 1U1OA 1SH3A 5CD4H 2A2DA 1IKYB 3NAHA 3TP2A 4LR8A 4BS2A 2U2FA 3UN5A 1OWXA 1RTHA 2NZ4A 3HXMA 1BLUA 1A9NB 1LXJA 1RTZA 4DSJA 2Q3PA 2MHNA 2KFYA 1VQ7S 3NWGA 1YRUA 3AH6A 4J9SA 1U7LA 3SCJE 2JLGA 5J2NA 2FJDB 2G1HA 3CF5Q 1RTIB 3MEGB 4X4QA 3J81Y 3THPA 1WG5A 2GC8A 4D3GA 3GCXP 3DRRA 5DRKA 4FVCA 4F0KA 4EMDA 2MKSA 1YJTA 2C2EA 2XB2D 2U1AA 4MH8A 5KG7A 4L3NA 5KG5A 1OY8A 3UFCX 4YQWA 2ASJA 4DL2A 4X62J 5H9EJ 2C2DA 4MYUA 2GV1A 1T9XA 5D77A 4DSIA 1QY7A 5KFEA 2Q66A 4HDHA 2JX2A 2XHCA 2XQCA 4NX9A 3WX8A 2PEBA 5F8NA 2HVIA 2QGFB 4EWTA 2MHEA 3B8HA 2CZVC 1FNMA 3OTOF 1F3VA 4BWMA 4OI6A 5KG0A 3UN3A 5C25A 2AYMA 1TL1A 4LF7F 1VQKS 2RAQA 4CZCA 3O6QA 2BJ9A 4GKJF 1NHUA 4XAKA 1L5UA 2MYFA 5F8LA 1TV6A 1CJVB 3GP9A 1N5YB 1XERA 5D0HA 3DXBA 3TA2A 1RB0A 4PG5A 3GLJA 4W90B 4I64A 3TQEA 4H4MA 1U6ZA 1N56A 4X4NA 1B3TA 2V4RA 1YGYA 2DRAA 2DJWA 4U6PA 1AA1B 3G87A 4TN2A 1TKDA 4AT1B 3B54A 2HK3A 1VQNS 4K4VA 4LRBA 4DCJB 4DG1A 3MR2A 2QLWA 2FJBB 3MAQA 2YKOA 4WWSA 3VCDA 4DQPA 3BQ2A 1WKKA 5KFOA 4WFAQ 4P7TA 3OXFA 4DWIA 3N79A 3ZZPA 2V8HA 4I6AA 2EEYA 3W2WB 3NMRA 2FYXA 4X65F 2HS4A 1PILA 5EWFA 4QR2A 3UVJA 3QSIA 2NSCA 2R8JA 5FLXY 3MAAB 3PVXA 1JLFA 3H2VE 1FDNA 3MR6A 2QMWA 2W4CA 1V5IB 4KGVB 2VKZG 3M8WA 4NLRA 3EGNA 2RUGA 2VPXB 1JLAB 1C0TA 2WVCA 1S49A 3JXOA 2DR7A 5IM0A 3TR5A 3TQ1A 1HI1A 5HSPA 2CWKA 4DJBA 3KHHA 2M4MA 3ZZUA 4KT0C 1TK0A 4RWWA 3F56A 1H74A 3R5AA 1HBUA 2J7KA 2IC3B 1WORA 3ISZA 2XI2A 1YBTA 1S9GB 2RQ4A 4Y2IA 1EIYB 4DR5F 2E44A 4QPXA 2JLEA 4ZK7M 3HF5A 1P1TA 5EUHA 3BV8A 1Q81T 2IPOB 3CCWA 2W8KA 1S4EA 2ZD1B 3BQ0A 2N7YA 2GO8A 2X1FA 3KJVB 3PNIA 1I1GA 1S0NA 1UWAA 4Y34A 4FVMA 2LA6A 3HSDA 4U8VA 1VLOA 1QVGR 1FJGJ 3OUYA 1NK6A 1GXTA 2HFUA 4B3MF 4DPXA 2CQ0A 1HW9A 1GFWB 3IC1A 2D3O1 1KQKA 1H2UX 1NDCA 2WVEA 3CJRA 2YWEA 1ZA2B 4RU9A 1AROP 1MWYA 4PUOB 1T05B 1X8DA 1IR2A 2HNDB 1RJJA 2G2ZA 3FUYA 4JI3F 4LF8J 4YB1P 4IOBA 5ETMA 1B99A 2XCAA 3I55S 3LGHA 4Y65A 2KYZA 3CO0P 1U47A 2FZKB 1FX4A 1HNIA 1RI7A 2V2VA 1DTQB 2WHOA 3ILLA 4Q0BA 3K5OA 3SEOA 3D6MB 3LH2S 2BYCA 2W7OA 1MU2A 3HJFA 4ZVGA 1NK7A 3BJYA 4HEA9 2MKKA 4JI4F 1Q8LA 5H1SV 2NYHA 4ZVRB 3I87A 1CS4A 4ECRA 4N47A 1WI6A 4C8NA 4DI6A 1RT3A 3R5GA 1K47A 1T3NA 1AT1B 2ACMA 1S4FA 4N8OA 1N34F 4DV5J 2V5HG 3DOMA 5DDRC 1FESA 3HJVA 2BKPA 1N0VC 4Q5VA 3QFHA 2VDHA 1QAYA 4DUZJ 2PC6A 2ZOGA 3M8RA 5JUMA 1QM9A 4DPYA 1JJ4A 4MFBA 3QGGA 3M2RA 2YBVA 5IS2A 4PXCA 2J0WA 1RTDA 1Q16B 5JJBA 4USIA 3T5JA 4JV2A 2UV8A 4OFZA 1X0PA 4OX6A 3BM7A 4XTTA 2WONA 5T14A 4UOHA 4PPDA 3SQGB 2M8HA 1RHMB 3BB5A 1NK8A 1VK3A 4ECZA 2JWNA 2XMTA 4K0KF 4C48A 3R3TA 1JNRB 2DXDA 1TKTA 3C15A 2F7VA 3OR1A 1DY3A 3NG8A 5FLXU 3A8JA 1KHWA 2MZRA 5LJ3Y 2FVSA 2R7TA 3G86A 3CCQS 3BDEA 1JKHA 4RBUA 2VJVA 4ZVEA 2PIIA 1EKSA 2XZTB 4DV4J 2UXDF 1ICEB 3TVKA 3QT7A 4R5PA 3QBCA 4CT8A 1SIWB 3K5MA 4ES2A 2FLNA 4IFVA 2M8DB 4JI1F 4DR2J 2Z30B 4ZHRA 4RLEA 1NHKL 2EFVA 3Q8RB 4M5KA 1D8YA 1L3KA 2L41A 3RRHA 1WC6A 4P74A 4Y3CA 5B09A 2W9BA 4DDFA 1RHQB 4A47A 1S1TB 3L95X 2CAJA 2QMUB 4GO7X 5G0RA 2DPIA 4MK7A 2KXNB 2VQFF 1M0SA 4LQ3A 1YK9A 3C16A 4B9TA 1MWZA 2FVCA 2CZ9A 2MEWA 2H5EA 2CQ2A 1RK8A 3BGFA 1S1WB 3QATA 1YHQS 2MY7A 4USMA 1TUWA 3JSRA 9ATCB 1LWFB 1WC3A 4TKTA 1RAFB 3DCAA 1EQMA 3OT9A 4I6WA 4ZIWA 3R97A 4NXNJ 4OZ1A 3H0PA 4ZIVA 2ZE2B 1T0TV 2VIHA 2NCKL 3FZ2A 3CNQP 5G4DA 4MKAA 1BUXA 3SSSA 1OSDA 4C8MA 3UD5A 2YH0A 3PKYA 2BQUA 4UTGA 3CJKB 2P6SA 1H73A 5D6GA 1HBMA 5K14A 5CYJA 3NGKA 1HKAA 2CG4A 4XO0A 3LO3A 3HD2A 3M8QB 1LV5A 5GADU 1HWIA 2XMJA 2JFDA 4DX6A 3GYGA 4USUA 4KPYA 4C3KA 3ET6B 5AT1B 2YWKA 3JTNA 2H51B 1LQ9A 4PG8A 5GAHI 2KG0A 3EM1A 4QIFA 2V4JB 5B0DA 4C2MA 2CPZA 4I0WA 1TFWA 2X7IA 1GMWD 2JC0A 5L1IA 1VBYA 1UVIA 2G4BA 1M1HA 5LOQA 2YPZA 4K2XA 3LF0A 4TU9A 5A8RA 2UVUA 1SC3B 2ZBPA 2A1BA 2CQGA 3W8PA 1RT5B 2BOPA 4RW9A 3MCOA 2XYGB 3I96A 2Q6BA 2M52A 3H42A 4NEZA 4UZBA 1R6VA 5HQLA 5LSOA 3PY8A 1SC6A 2BXJA 1VRTA 2AJFE 4PXEA 4HKQA 1ITPA 4RUCA 2IM3A 3MEDA 4J9KA 4KSEB 3RBXA 2XEXA 2HNZA 4LVNP 3H40A 2HHUA 4C8ZA 3M2UA 3MMJA 1BQNA 4FKXA 2FIUA 2XGPA 1MMNA 2ZC3A 2B9WA 2C3PA 3MMCA 4DV0F 3OL9A 4ED2A 4IOCQ 4Y0FA 2YQ0A 4ID8A 3PYGA 3LAKA 2BRLA 3MFHA 1IBMJ 5EWGA 4ED5A 4FYDA 1R0CB 3BREA 5I4MA 5IT4A 1FDDA 2VHGA 3DLBA 2DYAA 2FGCA 4M5JA 4B9LA 5AE2A 4CM0A 2BJ8A 2Z56B 3ITHB 2WSCC 3VQTA 5KFIA 2AHOB 2A0FB 2F4FA 3D5MA 1S99A 2L9NA 4PXBA 2JFKA 1T9YA 4DR4F 2K7JA 2K7KA 1RHUB 2H65B 1N5QA 3AT1B 3R2DJ 4Y28C 2RNEA 2VOOA 4YN3B 1TL1B 4LRFA 5KFAA 5BXIA 1U25A 2CJXB 1TL4A 4ZPBA 4Z7CA 1FFGB 5L8RC 3NCRA 4ENOA 4Y2AA 2AKWB 3TOQA 2BRKA 1EETA 1UVNA 3C66A 2A18A 2BW2A 3M2VA 2P2CB 3FSXA 3RG6A 2BA9A 3KK1A 5J1EA 3D4JA 3FEXB 3MEEB 5F8MA 1FRMA 3RB3A 1UKUA 2XY7A 1DARA 2AIRB 3BR8A 3BQ1A 1K0VA 3EPGA 1RADB 3PACA 1VYAA 3HT0A 3FRZA 3LWMA 2NS1B 2XTJP 2F1FA 2F9DA 4RJVA 5BYSA 1UFWA 4DR7J 2CJ9A 4OZNA 4JI7F 2UUCF 4N5SA 2ZUAA 2DNKA 2FHJD 4YMEA 3OSPA 3C2PA 1HNZF 2C2NA 3HO1A 2AJQA 2R7WA 1JLQA 3IWXA 4ILLA 1XMQJ 1VISA 4OHVA 4Q8FA 5KT4A 4KH0B 2QSWA 3M30A 2HVDA 3ELHA 4KH1B 4RW6B 2J9DA 5A0YB 4F3OA 3SXLA 2JNJA 1HQUB 3PW2A 1Y11A 2YKAA 3HM9A 5E3QA 5KFPA 2GJFA 3JSMA 1HR0F 5HQ8A 1T9VA 1Y3KA 5HO4A 2QJ3A 4B3OA 5GAGI 1H3DA 3AHPA 3JQKA 3D0GE 1J5OB 1T9UA 1IJFB 2HHVA 5KG6A 3FBCA 3TUIC 5CQGA 2Q6CA 3TYTA 5E41A 3G4SS 1NHVA 3BSNA 2CFXA 4XDCA 1LK5A 2HHPA 2XY6A 2DHGA 1T03B 2CPXA 4USTA 1XN9A 3J80Y 1VQ6S 2CDQA 4NLUA 2P9CA 3Q0AA 1ZM3A 2K3KA 3CJ2A 5IOLA 2KT5A 2DNMA 3UDLA 1XNRF 1GXLA 2V2QA 2AGQA 1T9TA 1BD6A 1TL7B 3LGMA 4OX7A 3AD8C 1RYRA 4DCPB 2DXFA 2JOQA 4Y6IA 1D9FA 4PZVA 4XPEA 3IRXB 4DSKA 4JI5F 4B3RF 3Q8QB 4LFAJ 2RQMA 2NXEA 2MKJA 3N0VA 4OZJA 1NRKA 2B3TB 3M8SA 1Q53A 1H2VZ 5LXRA 1WG4A 2XSJA 4CM2A 5HMZA 2MTLA 2XY5A 1LWCB 2EFNA 3KLIB 4ES3A 4V1Ak 3BO2A 4ID5A 4K59A 3TUZC 4YR2A 1OYDA 5DJBA 3I31A 4EU0A 3MDFA 2ZH3A 4AD6A 1KVIA 5ADZA 2B9EA 4ZA1A 2CPYA 2RKIA 3UCGA 3QQCD 5KT2A 2AWZA 3QZ7A 5DDPC 2OPPB 3QYYA 3ZTRA 1YBAA 2AJ0A 3DMJA 5GVQA 4JUZA 3PEHA 2OEJA 2GVZB 3UI3A 1D8ZA 4W98A 2QA4S 2H3EB 1TMJA 3T1AA 2H9ZA 4N77A 1IBKF 4C8OA 1BE4A 3GB0A 4ELVA 4O23A 4CYUA 1P8GA 2KL8A 1R8PA 2JEGA 3MECB 4F67A 4CO5A 2VFTA 5D4LA 4G6VB 1GK8A 2XMUA 4GKKJ 1KRPA 3AA9A 4F3MA 1U1PA 3PFOA 2CVEA 5K9FA 3GIKA 4B3SJ 3BR9A 2LECA 2Y9HA 5KFNA 4K4WA 2GZOA 3MFIA 1SKSA 1BQMA 4X2BA 3ZC4A 3GG1A 2Z2YB 5GMEA 4WPAA 1R0AB 4OX9J 2HRUA 2IM1A 1HNXF 2DXEA 3VQSA 1WOSA 2VU5A 4KHRA 3LP2A 3PIOQ 2FJEB 3NXZA 2EFQA 3BBCA 2DEIA 2BM0A 3R5BA 3KG1A 3MOJB 5KG3A 1IKVA 3FZBA 3KLFA 5E3PA 4LBPA 1S0MA 3BGRB 2W2OP 1U8SA 4FS2A 5HMYA 5DDOC 1VQYA 3CJ5A 4URSA 2QMXA 1NK4A 3D66A 2M0GB 4J9RA 1MMLA 2X51A 2VFRA 4PQUA 2IBOA 3NNAA 1TKXB 3C6UA 4M5IA 2HWTA 2C2OB 2HHHJ 4X4UA 2X1BA 2ATCB 4DFJA 4F0MA 4IDKA 4O0NA 1KHVA 4ED6A 3DI6B 3E51A 1M1KT 2MSTA 4FNIA 2FLLA 1Z1ZA 7FD1A 2DGOA 2UUAJ 2PMHA 4J9MA 2MQNA 3AQOA 4ZLJA 3O3LA 1HWJA 4MK8A 1RCOB 2YY3A 4F25A 3PW4A 2MQ8A 5HI7A 4DPOA 3FGVA 3DYAA 1HHSA 1FFSB 3J80U 5KFJA 2OSRA 1SC4B 1Q0NA 1VRQC 2C2ZB 3MPVA 5DM7Q 4E0DA 3CC4S 2P6TA 4DV2F 3MOZA 2L48A 1BY9A 1VQ8S 4ZN1A 5C42A 4E8UA 1DLOB 2CJAA 1UAWA 4QR0A 3HFVA 2JEJA 1P9QC 2AJ1A 4KGKA 4ER8A 2W01A 4OX8A 3IP0A 1MW7A 1QSLA 3W64A 3AJDA 2XLKA 3QWUA 2DO4A 1DZ5A 1RCXB 5IT9Y 1X4HA 3K5PA 3SI8A 1K8AT 4QCLA 5D78A 1REVA 1RWPB 1R43A 4MMOA 1BQXA 3CD7A 4KHMA 5C24A 1S1UB 1HBMB 2GAHC 4WP8A 2KM8C 1P27B 1MG7A 5C5JA 2NXUA 2LEAA 5KFUA 2DITA 4QJVA 3LUYA 2YNFA 1F60B 2B51A 3EZ5A 4DFPA 3QO9B 3WDOA 4ATNA 4IR9A 2DY9A 5J2QB 2GVDA 4DLGA 1FRIA 4DU7A 1WEXA 3VHQA 5I3UA 1LW2A 3LGNA 4DX5A 2GIRA 5MLCV 2MB0B 4LIRA 1S0VA 3CMES 1N32F 1HMVA 3DLGA 5KOWA 4RW8B 1EQ0A 1CEZA 4C0BA 2BJ1A 1AZSB 4NL5A 3R5DA 1YJNS 2ERRA 4EO8A 4WZQA 5DO2A 1O8BA 2B4PA 3PRBA 3T5KA 3JTPA 3IRWP 4NCAA 4HH1A 2FY1A 4B9VA 3KTQA 2YNGB 1Y5NB 5T7LA 5KAKA 4F02A 4LSZB 5CCLA 2VQEF 2ZITA 3LPEA 4K4TA 3FC9A 1NK0A 4NLGA 1C1BA 2WK4A 2RU9A 4HH0A 2MJNA 3PEJA 5BYQA 3D6TB 4USKA 1FX2A 2IDEA 5A2QY 2BQRA 1FFWB 3QT8A 3MEDB 2HKEA 3F73A 5IQQA 3KJNB 2HNZB 4OI1A 3MUVP 4LF6J 5KFMA 3O5TB 2EBEA 3FQLA 2J8SA 1BQNB 1UZHA 3R27A 4WP3A 3HMJG 1MNEA 3MMCB 4A4JA 4ICLA 4FYVB 2ZH5A 1FXLA 4O3OA 4OI0A 5M2UA 3N28A 3W66A 3OXGA 1RTJB 3PXGa 1VBZA 3SDEA 2R2RA 3BKFA 1Y10A 5IV4A 1N0UA 2B4OA 3K17A 4I4BA 2BE9B 2R2UA 2B4UA 1FEEA 1NDKA 3TX0A 5IXUA 1FERA 1DAXA 2ZKTA 2QA2A 2RQCA 2V4QA 4PCQA 3TUPA 5IQ6A 4K4UA 4RNFA 2R8IA 4RO0A 1JXEA 4ZS6A 1RT2A 4ZPWR 1J2VA 3HVRA 2GMLA 1LWEA 2CQBA 3ICLA 4WKYA 3C3LA 3ADAC 3CJ4A 1VFJA 4JI0J 5HATA 5B0GA 2BVZA 1RWOB 4OLPA 2A6OA 1HNZJ 2E5JA 2XSFA 1SIZA 2YKMB 2QN6B 2G0IA 2XS5A 4IH7A 3SYZA 3L7UA 1CJKA 1G2EA 3H2LA 5FDLB 3C6TB 3ZTPA 4DUYJ 1C2PA 2X1AA 2KZMA 2FC9A 3ZXWA 3HHLC 1TL5A 5THWA 5L1KA 1LNQA 1HQEA 3CJSA 3ZO7A 2ROGA
chains in the Genus database with same CATH topology
4K5SA 3T9ZA 4KFBA 4P2SA 3TA2A 3D0IE 1XR7A 3VZIA 1FJGF 4PG5A 4EFAC 4NZ7A 1IJEB 3GFYA 4W90B 5ITHA 3DOKA 3L7PA 4I64A 4YUDA 4NLVA 4C97A 4H4MA 2W25A 1U6ZA 3CCJS 3ZZOA 2EK6A 4DMZA 1LW2B 4ECUA 3K59A 1HFEL 3T1YF 1N56A 2BABA 4WZMA 4X4NA 4OZLA 5HMXA 3ZZZA 4KHPF 2V4RA 1FKOA 1XNQF 2KH9A 1YGYA 2QZ8A 2DRAA 1URNA 4TYBA 2CQ3A 2DNQA 2ZH1A 4ZVFA 1UW4A 2DJWA 1DTQA 4ECQA 4WFBQ 2OFHX 4U6PA 1V6HA 1HWLA 2DNOA 2COLA 3JB9k 2PA8D 2KXHA 2UV8G 3KLHB 1HMVB 1U1RA 4TN2A 3D1HA 4CH7A 3DLGB 2R4FA 1TKDA 5B0EA 3JSBA 4EO6A 4ETZA 5F0UA 1RT7B 3L09A 4ALZA 1VQNS 4NXMF 4K4VA 1C0UA 1N8RT 4TLRA 4CQ1A 1NZAA 2WW8A 4QWEA 4F3QA 2LVWA 2JLFA 1D1UA 1ZH5A 4YEAA 5CYMB 3LALA 5GAHU 2C3YA 3PX4A 1U45A 2ZDPA 4DG1A 3MR2A 2QLWA 3HFKA 3CCLS 5L9XA 2CKWA 2FJBB 3N01A 1KOHA 3MAQA 2MQLA 2DGQA 4JV5F 4NWBA 2YKOA 3KKFA 3S6EA 4NLSA 4DFMA 4LF8F 3VCDA 4DQPA 3BQ2A 1VQOS 2V0NA 2YTCA 3DC2A 5KFOA 4F8RA 2RVJA 2XULA 4WFAQ 4P7TA 3OXFA 4DWIA 3K0JA 1UP1A 3N79A 2RIJA 3D54A 4HL9A 1B0PA 1P6TA 4PKDB 2V2KA 3ZZPA 2V8HA 4I6AA 1WHYA 2XWYA 4O3QA 1YJVA 3CO9A 2QO3A 3W2WB 3PW7A 3NMRA 5T7LB 2D3UA 1UL3A 1DBDA 2LKZA 4HT5A 3F44A 4MKYA 3TNVA 4X65F 2HS4A 1PILA 2W8LA 4ED1A 2R7SA 1WD6A 4B3OB 3D2WA 5EWFA 4QR2A 1TKZA 2OPQB 3MI7X 3ETOA 2BJEA 3LP0A 3MD1A 4DN9A 4AE5A 1C1BB 2NSCA 3RYLA 1OQ6A 2R8JA 5FLXY 2F9JA 4J9OA 3T6BA 4WXOA 3PVXA 1O0PA 2CZ4A 5T41A 1LFWA 1JLFA 4LJMA 2D1CA 1Q7YT 3H2VE 3CEDA 1MMDA 1C1CB 3VAHA 4QWAA 4XPCA 1FDNA 3MR6A 4A8XA 2VZ9A 5A8KA 2E1AA 2QMWA 4USHA 1H7WA 2W4CA 2EG2A 2EW9A 3GFHA 3IG1A 2UUTA 2VKZG 3U1NA 2MDAA 5F41A 1S1XA 1LW0A 5F9NA 3HPOA 1LKZA 3CGIA 1QJHA 2FDNA 3HZGA 4NLRA 3EGNA 3H25A 4ZOSA 4N56A 2RUGA 2VPXB 1JLAB 1C0TA 3DXSX 1S49A 1N52B 1RTHB 1JNZB 2NPFA 1KQGB 3MUTP 1XWLA 3O44A 2AYBA 2DR7A 3PHEA 5IM0A 3NNHA 4OHXA 4RU2A 3I9ZA 3BSOA 1FRKA 2OH2A 1FD8A 3TR5A 4ICLB 3TQ1A 1KVJA 3SV3A 1HI1A 3AQPA 4NCBA 3I4HX 5EGYA 4RW7B 4YB6A 4DJBA 2WBRA 3KHHA 3U02A 2W9CA 2MKIA 3CCZA 2M4MA 1X0FA 1FJ7A 4J9QA 4DV5F 3ZZUA 4KT0C 5F3ZA 4DV3F 1TK0A 4RWWA 3F56A 4LT6A 3R5AA 3OBIA 1HBUA 3FDSA 1JB0C 1JLEB 3SDEB 5CH7B 3OL6A 3DGPA 1H2TZ 2J7KA 4DUZF 2IC3B 3DRPA 2HFOA 1L3UA 2QE5A 1TUVA 5J2NB 2C28A 3MM9A 1FK9A 4RNHA 5SUHA 2UVRA 5B0FA 2CQHA 2FHKA 3ISZA 4I7FB 2XI2A 2J8AA 3M4XA 3HP6A 2JH3A 4DL0C 1U2FA 4F50A 1S9GB 2RQ4A 4Y2IA 2E44A 2GW8A 4QPXA 4R8UB 2JLEA 1FT8A 4ZK7M 4DR5F 4OLOA 4C11A 3NGDA 4Q2MA 4B17A 3PRDA 4UQGA 3HF5A 4DSLA 1Y0HA 3IS9A 3DU6A 1P1TA 5EUHA 3DRRB 3LP1A 2JZ5A 1Q81T 4NLXA 3MM7A 3CCWA 1KLNA 4B3TF 2DNLA 2W8KA 3DRSA 2VD3A 2ZD1B 2KVIA 3BQ0A 3KNGA 2L08A 4I69A 2N7YA 1E6VB 1VMBA 3EGWB 4UUXA 5KG4A 4A8OA 5E2QA 4DL6A 2DGXA 4WYLA 3VAIA 2GO8A 2WTFA 1V9OA 3O1LA 1X9WA 1RT2B 2X1FA 2LEPA 3GG0A 3KJVB 3PNIA 3GIJA 1I1GA 1GAOA 2CQIA 1S0NA 1YI2S 4Y34A 1K0TA 2HGLA 2RF2A 3OL8A 1S48A 4FVMA 3G8QA 4WFNQ 5KTQA 2LA6A 2B5JB 2FC8A 5DM6Q 2ZOMA 3IFEA 1GNKA 3V6JA 1LWEB 1QVGR 1YVFA 2HIQA 5AE3A 3OUYA 1GXTA 4EEYA 1NK6A 2POKA 2LLZA 3KK3A 1G6BA 2E7XA 1G7CB 2OD4A 4TQRA 4B3MF 3DLEA 1FEHA 3HVTA 2CQ0A 1HW9A 2MQPA 3M9NB 3PJWA 2GNKA 3DOLA 7FDRA 4LIWA 2QEXS 2DGTA 1D9DA 3FMWA 3IC1A 4DV7F 1URRA 1KQKA 1H2UX 3BGLA 5CZVA 2KB2A 2LXFA 3CD6S 1TVRA 2C42A 1AXQA 3TARA 2WOMB 4OJHA 4ED3A 2IBKA 1JLBB 2YWEA 1S6PA 2WSEC 4NA3A 3HK2A 4H4KA 3V5RA 3X3UA 2MKHA 4NLDA 4AXIA 4RU9A 5C25B 1AROP 1J5EF 2CPFA 2XGQA 2JJ4D 2OJ3A 4H54A 2XHWA 5KFWA 1MWYA 4DR1F 1A7GE 2FGOA 4PUOB 4AL6A 3SMZA 4TXSA 4I68A 2OMOA 1T05B 3SCIE 1X8DA 3G6ES 3TAMA 4FBUA 2HNDB 3MTJA 1KTQA 2XWXA 2QIFA 4LQ9A 1RJJA 1S1WA 2HYIB 4JI3F 4DV4F 4N76A 1QUPA 3DMJB 4DV1F 1TV6B 1NB7A 4YB1P 2ROPA 2FVPA 1LWFA 3I6PA 2XS2A 4IOBA 2RE1A 3NNCA 3OTDA 1H38A 4TYAA 2FJVA 1YWXA 4DR2F 1HQEB 2EBGA 2VG5B 1Q82T 3CSKA 5CXTA 2IA0A 3QIPA 2IVFB 1TK5A 2HNYA 3GIIA 2EVZA 2XCAA 3I55S 3DOKB 4Y65A 1M5OC 2I5JA 2KYZA 3L7OA 1U47A 4H4MB 2FJWA 2HHXA 4RWXA 2VKRA 2PI4A 1CLFA 3HLUA 1HNIA 4IRDA 2ZNZA 4HI1A 5KFDA 1RI7A 4ILRA 1F5CA 2ZE2A 2GJIA 4C9DA 3MM8A 5E7OB 4F4KA 4RW4A 3T5HA 2EKYA 1DTQB 2WHOA 4Q0BA 2VA3A 3K5OA 1M5SA 4GC7A 4A48A 3SEOA 1GXUA 2CPJA 4KGMA 2E1MC 6FD1A 3CB4A 3LH2S 4IYQA 4WFYA 2BYCA 5F8GA 2W7OA 3RRKA 4ES1A 2FLOA 1MU2A 3F41A 4TU7A 3HJFA 4ZVGA 4NA1A 1NK7A 3D0HE 1VIOA 2O01C 1PGZA 3VAFA 3BJYA 3OV7A 2XNQA 4HEA9 1C0UB 3CJKA 2MKKA 3Q2SC 4JI4F 1AW0A 1Q8LA 5H1SV 3N9UC 1QSSA 4ERDA 3I87A 2ALZA 3FVYA 4G1QA 4F4YA 3DM2B 4WFXA 1UEUA 5F3TA 2LQJA 3OJSA 2R7XA 2ASYA 4KIAA 4ECRA 4DG1B 4N47A 1WI6A 2JC1A 4C8NA 2CRLA 5JXSA 3OVAA 1BQMB 2O5DA 1RT3A 3M8QA 3T5LA 1KLMA 2E5IA 4WFZA 4ZP9A 4NOHA 4YB7A 4URGA 2HVHA 1IR0A 2IM0A 4ZPVR 1T3NA 1OQ3A 3SCLE 3MPYA 2EFGA 4ECTA 3MMAA 5AJ3F 2R7VA 1S4FA 4N8OA 4M5DA 2ZH2A 1U2RA 3CCVS 3RB4A 1X7VA 2ZM6F 1N34F 2J0XA 4CNZA 4ZPAA 2V5HG 3M32A 3E2EA 3DOMA 5DDRC 4DQSA 1FESA 2BJDA 4HDGA 2DH7A 1N0VC 2DRBA 4Q5VA 4ZCKA 2YKQA 1QAYA 3VTIA 3SFUA 5AXNA 2PC6A 1FRHA 3K57A 4FF3A 5D3GA 3PFEA 4NXNF 2ZOGA 3M8RA 1TKZB 5JUMA 3T9NA 3IR6B 4Q2LA 2G1DA 2IRXA 2KG1A 1QM9A 3LP0B 2C3MA 1JJ4A 4UOCA 2N3OA 4MFBA 5F0WA 3QGGA 3M2RA 3H20A 2CQ1A 5IS2A 1M5PC 4PXCA 2VBWA 3G6YA 1JLFB 2J0WA 3ENWA 2EG1A 4CO2A 1RTDA 3S7RA 3FQKA 2DTJA 3RAQA 1N5SA 2RSQA 1Q16B 1UA0A 5JJBA 1Q86T 4TQSA 1HNVB 5A8KB 3HT3A 4USIA 3T5JA 4JV2A 3IG1B 1R8AA 2DNNA 1HYSB 1U26A 2UV8A 1RKJA 2UP1A 4OFZA 2YVSA 3M1VA 3VWSA 1M5KC 1X0PA 4OX6A 3WC2A 3BM7A 1S1XB 2WONA 5DQHA 1RT6A 5T14A 2CIMA 4A8FA 4RNMA 4JI6F 2WRMA 1VOMA 1NEEA 3CIZA 4PPDA 1C0TB 3A1YG 2RDJA 1SJ4P 3SQGB 4Y2MA 2Y1JA 2HVZA 3ONQA 2M8HA 3CJ0A 2XCPA 3GFXA 1C4AA 5IM0B 2KT3A 4GO5X 1RT5A 3BB5A 4KRWA 2HLUA 1NK8A 1VK3A 3RB0A 4BC7A 3AB2B 3FSYA 2J0SD 4KV8A 1WG1A 2N82B 3M9OB 4ECZA 4FZVA 2MZSA 4B08A 4FF2A 2JWNA 2D7SA 4IH6A 2W9CB 2B43A 2B7BB 2XMTA 5B7WA 3V6DA 2MGZA 2BDPA 4K0KF 1X5PA 4D3HA 5HN0A 1KONA 4EZ6A 2PO4A 3CDBA 1HBUB 3R3TA 1JNRB 5J2MA 4BDPA 1TKTA 3G71S 2NPIA 2KN4A 4QWBA 4EYIB 2F7VA 3OR1A 5E33A 4DN0A 4DS5A 2GHWA 1ZPWX 2O67A 5L1LA 3MM9B 3NCQA 1FK9B 3NG8A 1KHWA 4HT7A 1X4FA 2AYEA 2MZRA 1NH8A 5LJ3Y 3EPIA 5KT5A 2FVSA 1IQZA 2R7TA 1U09A 1A6LA 1N54B 2HG4A 2QT7A 3G86A 5KG2A 3CCQS 3BDEA 1U1QA 5FJ4A 4C11B 2C22A 1JWWA 3HI9A 3IS9B 1JKHA 1FVSA 4CCHA 3KHLA 5DG9A 2I38A 4I2QA 3KWMA 3MM7B 3H59A 4RBUA 2KHDA 2R7UA 3DRSB 1SJFA 3KHRA 1LXNA 4ZVEA 2PIIA 4C8KA 2R9LA 2IYIA 6FDRA 3DDNA 3ULHA 4LUBA 2R2SA 2ZJRQ 2UXDF 4KO0A 1FVQA 3TVKA 2DH9A 4R5PA 3CD5A 3IAS9 1DFDA 4CT8A 1SIWB 3K5MA 4ES2A 2FLNA 4IFVA 2M8DB 2VL1A 4MK9A 2RF2B 4F4WA 2X1GA 2ZH8A 2E1RA 2Y1IA 4JI1F 1T3OA 2LMIA 4ZHRA 2VFUA 2XMVA 2KT2A 3DHWC 4FNHA 4R0JA 4RLEA 4J9NA 3V4IA 2UVWA 2EFVA 1UMJA 2E5HA 3MMBB 4X84A 5KT6A 3Q8RB 5K8NA 4DR3F 3OUYB 4HTJA 5AXMA 1D8YA 1X4CA 1L3KA 3OHBA 1VJWA 2L41A 3KK3B 1FE4A 4QIEA 2KDOA 4M1KA 2EWHA 2LDIA 4NRTA 2A3JA 2A2CA 3D28A 4RNNA 3RRHA 3QJPA 4Y3CA 4TY8B 5B09A 5I42A 3VAGA 4YFUA 3DOLB 2W9BA 5F8IA 2J6TA 4DDFA 2BANA 2AX0A 3GQCA 4O0IA 2RRBA 4I2PA 4A47A 1S1TB 3PV8A 4QWDA 3L95X 1TVRB 3LANA 3JAMY 1UJ4A 3CCES 3MR3A 2JDJA 4GO7X 5G0RA 2E29A 1R6YA 3E8OA 3ITHA 1XBWA 2DPIA 4NLPA 1S6PB 2DD8S 3BN7A 4MK7A 2KXNB 2VQFF 2F8HA 2ZOFA 3TX8A 4FS1A 1JX4A 2DR8A 2JRSA 3CCRS 2CQCA 5BYRA 1WACA 1M0SA 3TUJC 4LQ3A 4B9TA 1MWZA 2VC0A 2FVCA 2ZUGA 3ZZRA 3FNNA 3OVSA 2D3OR 2H5EA 1H7XA 2M3DA 2LXUA 4B9UA 3I4PA 2CQ2A 3TAQA 1DJ0A 1RK8A 3TAMB 4N8NA 3BGFA 2CJQA 1S1WB 2E9ZA 1U6BA 2D9OA 3I32A 2MY7A 1YHQS 1TAQA 2VUGA 2D9PA 1Y7PA 3Q8SB 4B9NA 4V19J 3JSRA 1LWFB 2BM1A 4TKTA 4IG0A 4O3SA 1WF1A 2WCXA 4U7CA 2V9WA 3EXYA 2WAQD 3E01A 4F4ZA 4KAIA 4Y2KA 3DCAA 1B0TA 4I6WA 3PIPQ 3QIPB 3IWLA 2HNYB 2DGSA 2FLPA 1RQ0A 3JTOA 3PM9A 1JIHA 1RT1A 2VG6B 2I5JB 2L9DA 2J0QD 1WEYA 4YR3A 4FXWA 2HHSA 1IBMF 1W25A 4ELUA 3W7BA 4OZ1A 1CC8A 3GFZA 3CTRA 2ZBCA 3HVAA 3H98A 1HNIB 3R5CA 3HHNB 2PEHA 3UE2A 2ZE2B 4UY8T 3MM8B 2PN6A 4RW4B 3FZ2A 5J2PA 1TFYA 2UXCF 5A6PA 4Q0BB 1FTCA 2BUNA 2J76E 5EDWA 2RS2A 1SBRA 5G4DA 4UY85 4W92B 2FHMA 5I3UB 3M6VA 4MKAA 4O44A 2B7CB 2FJXA 1V3SA 3SSSA 1MU2B 1OSDA 1XTZA 3AJ2A 4C8MA 3AA8A 2YH0A 2OKQA 2YWHA 3J7ZT 3PKYA 2BQUA 3CJKB 2P6SA 1IN0A 4C0OC 5D6GA 1HBMA 5K14A 5LJ5Y 2ZHOA 1RAJA 2EFOA 2M9KA 3MEEA 5CYJA 3NGKA 5EWEA 4G1QB 3DU5A 5LMUF 2ADBA 5D8HB 2CG4A 5K8MA 3AJ1A 4XO0A 2K1RA 2ZZMA 5KFYA 3LO3A 2MSSA 1U1MA 3M8QB 1RT3B 1KC8T 3T19A 1AUDA 1KLMB 4OJGA 2D74B 1FNOA 1LV5A 3I5BA 3IXQA 3DRXA 5GADU 2ZHAA 4RBTA 1HWIA 2XMJA 2JFDA 4ZCLA 4LMZA 4Q43A 4K50A 3MMAB 2DK2A 2VPWB 4OHWA 4KPYA 4M5DB 5F9LA 4C3KA 3M32B 1SV5A 2ATLA 4OI2A 2YWKA 3JTNA 3OLBA 4JOUA 2BE2A 1LQ9A 1MROB 2ZJPQ 4PG8A 2AGPA 5LL6d 5GAHI 3L3CA 2KG0A 4CO3A 4QIFA 3NS5A 2QLXA 4NYOA 1XR5A 2V4JB 1ZTWA 2F8MA 4UQTA 5B0DA 5J1NA 4C2MA 2HZCA