3SIPB

Crystal structure of drice and diap1-bir1 complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
103
structure length
103
Chain Sequence
b'MSYKIPVHADFLIAYSTVPGFYSWRNTTRGSWFMQSLCAELAANGKRLDILTLLTFVCQRVAVDFESCTPDTPEMHQQKQIPCITTMLTRILRFSDKQLAPAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase
publication title Structural mechanisms of DIAP1 auto-inhibition and DIAP1-mediated inhibition of drICE.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase/ligase/hydrolase
total genus 20
structure length 103
sequence length 103
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 3sipB00
2C2OB 1RHRB 2H54B 3R6GB 4ZVSB 2CJXB 2FQQB 2QLJB 1RWXB 3R7SB 2CNOB 1RWVB 2XYGB 2CNLB 1F9EB 2H48B 3IBCB 4ZVRB 2HBQB 3IBFB 1SC3B 2HBRB 1RWWB 2H5IB 1RHQB 3R7BB 2QL7B 3KJFB 1SC1B 2H5JB 3KJQB 2HBZB 3R6LB 4JB8B 4ZVOB 1NMEB 1RWMB 3EDQB 2Y0BB 3P45B 3GJSB 1RWKB 3NS7B 2H65B 4DCJB 2QLBB 5K20B 2QL5B 3D6HB 1RWNB 4LSZB 1SC4B 2H51B 2XYHB 3D6MB 3RJMB 3R7NB 5IC6B 2H4WB 2C2KB 3EDRB 4DCOB 3D6FB 1RWPB 2HBYB 2P2CB 1IBCB 1RHJB 1I51B 2XZTB 4ZVUB 1RHMB 1GFWB 3QNWB 2XYPB 2C2MB 4ZVTB 3GJTB 2XZDB 1RWOB 2C1EB 1RHUB 2QL9B 2Y1LB 1QDUB 1ICEB 1I3OB 2CNKB 3GJQB 1PYOB 3R5JB 2CNNB 2CJYB 1BMQB 5IC4B 3KJNB 1RHKB 1PAUB 3GJRB 2DKOB 1QTNB 3P4UB 1RE1B 3SIPB 4ZVQB 2QLFB 2C2ZB 4DCPB 2H4YB 2CDRB 4ZVPB
chains in the Genus database with same CATH superfamily
1KKHA 3HSZA 3KOAA 1GEHA 2RHSB 1QSSA 2XMKA 3AD8C 2KI2A 1VBKA 4ZCMA 3HT3A 5M2UA 3W61A 2E44A 2C3MA 1G2EA 1JLAA 4EYHB 1S6OA 3ZXWA 2O66A 2V68A 2HGNA 5T7LA 1MROB 4HH1A 2UXDF 3FZ2A 1FWLA 3MMBB 4JP8A 4OYMA 1R31A 3PIPQ 4JI3F 4QW8A 4ECUA 3AHPA 1NCLA 2G0JA 3C19A 1YJNS 3MPYA 2NPIA 1LWEB 2W25A 3FBFA 5GVQA 2DH9A 2P2CB 3W9JA 4ES1A 2J9EA 1CJTA 2QMWA 4MJKA 2YXLA 4WFNQ 1RTJB 3HM9A 4PQUA 2ALYB 1PC4A 1TMJA 1WACA 1BQNA 1TK0A 2K7JA 1K1QA 3QAEA 5HQ8A 4QWAA 2VU5A 4NRTA 1J5EF 2WVCA 2HNDA 4LMZA 5L1IA 3DRPB 1CBKA 4DUZJ 3PZPA 1NZ8A 2XTJP 2XMAA 1W2IA 3L09A 4P71A 3KJQB 4YB1P 2CPFA 5J2QA 4DPWA 2EFNA 4OI1A 3ICLA 1FKOB 1MU2B 1SIZA 2HVIA 4MK8A 2DIVA 2XZWA 4CLFA 2OUGA 4DR4F 2LEAA 2WSCC 1U1QA 2YTCA 4RW4A 1D3WA 3G6ES 5HK4A 4F0HA 1N6QA 3B4MA 1SC6A 1WEZA 4P74A 1PJ7A 4I6AA 4TYAA 3KLIA 4IR1A 1VQ6S 5D0GA 4I69A 1XMOJ 5J2PA 1C1BB 4XPEA 1NH7A 1RAJA 5EGYA 4L3NA 2PMWA 2FHMA 2BKOA 2ZH4A 1KVIA 2MKJA 2QYGA 2GW8A 1HNVA 5KTQA 2QLJB 4ZOSA 1FFWB 3LP0A 3R7SB 4CLPA 1U1OA 2DT9A 3M6VA 2UV8A 3GB0A 4JYAF 5F9NA 1LWFB 4R5PA 1V6HA 4OLOA 3UCZP 2VQEJ 4DV0J 1P8GA 3KLGB 5JVHQ 2A2DA 5CZVA 4J91A 1U1LA 1ZA1B 5KFQA 2FJBB 2BMBA 2E5LF 1GMUA 1F5CA 3OTOF 3SCJE 5JJBA 4YMEA 4X62F 2R7VA 2ZHOA 2DB1A 1OJ4A 3NCRA 5C42B 2PI4A 2KU7A 3C15B 4KHRA 4ZCKA 4X4PA 4DZ6A 2Y1RI 2MQMA 1SKWA 2BANB 2HQCA 1X4AA 3E01B 1JK9B 1T03A 3TARA 4ANDA 2GGPA 3BPSP 2R4FA 1CJVB 3LOUA 4RUCA 1EQMA 4MK9A 2CDRB 2VUGA 1WNEA 4CWBA 3AB2B 3HMJG 4J9OA 1HBNA 2XO6A 1M5KC 4ZPTR 4HTIA 3MWBA 1NK5A 3CCTA 4CYUB 1JXLA 1IKXB 1JB0C 4ECZA 1XNRJ 1JNRB 3FFIB 2IVFB 3GR0A 3GTYX 3ISNC 2JVOA 3F56A 1UMJA 3F0NA 1SL0A 2DR7A 3D0IE 2G2OA 2E7WA 4WTOB 5HJXA 2BKNA 4KPYA 1NSKL 2VPYB 3MAAB 5L1JA 1REVA 3N01A 1VRQC 1L3SA 2VASA 2UUTA 1RWOB 3UD4P 2V9WA 3V2UC 2PDAA 2Z2YB 1RT4B 4X4VA 3G4SS 4EO6A 2ZKUA 1G3OA 4DWIA 2R8JA 2C2DA 2HURA 3WBZA 1MW7A 2R8KA 3TA1A 3CD6S 4Y2KA 2G2ZA 5A2QU 4I7FA 1WELA 3EVWA 2V69A 3CDUA 2QEXS 3KK2B 1CS4A 1F9EB 4L6V3 2XLKA 3T1HJ 1NJWA 1ZTWA 3FBEA 1SC1B 2AF6A 1Y4ZB 1IBLF 2VG5A 3R6LB 4QR0A 5I3UA 3GIMA 2YNIB 1FRJA 2DGXA 3KFWX 1HQEB 2Y8WA 3R9LA 4DSEA 4M5DA 3FMBA 2WHOA 4NXMF 2AHOB 3J80Y 4HHUA 5KT2A 3BR8A 5H9EK 4XK8C 2DPIA 5G4DA 2LQ8A 3T1AA 4C8ZA 5LMNF 1FRLA 1Z2ZA 2JX2A 1IBMJ 4R0JA 4CI0B 2BQUA 2MGZB 1TV6A 2YVSA 4NLRA 1FJGF 4Y65A 4KT0C 2UUAF 4PG4A 1HWKA 2ZZMA 1GXUA 2KYZA 4YUDA 1RTZA 2C2EA 4B3RF 4KPCA 1PYOB 1JLCA 2RH3A 3T41A 2RRAA 5C25B 2ZBIA 3E51A 2D9OA 5HBMA 2GVZA 3DRSA 3CJQA 2Q1LA 1K73T 2XHWA 1HYSB 4B9VA 4DX7A 1JLFB 4F67A 4IOCQ 1WDTA 2EXUA 4KV8A 4ZPWR 1TK5A 3UR3C 1CPZA 1JLGB 3KJFB 1M1GA 2BACA 3SFGA 3NGKA 2DCLA 1NPKA 2CQ3A 3RGIA 1I6JA 1CJUB 3CIZA 4HH0A 5G0RB 3O5TB 2HHHJ 1S4FA 1EIYB 2YQ0A 2ASYA 2F3JA 4C8NA 2HNYA 4Q0BA 3FUYA 4RU2A 1RT1A 5C24B 3GFHA 3NCQA 3FQLA 2G0CA 2I9SA 4NASA 1IN0A 5KG0A 2AT1B 4ZVTB 4DQRA 3PACA 2LECA 3BZQA 2FVCA 4DR2J 2DRBA 3DOMA 3NNAA 4A8MP 2JEJA 5IC4B 2NZCA 3U1MA 4Z7YA 3H8YA 3TQEA 5F41A 3HHEA 2XCPA 4X4NA 3M2VB 3VAKA 1S1TB 5B0EA 1LW0A 3TVZA 5J1EB 2WBMA 3VAMA 2F8MA 1S0MA 1VQYA 4USWA 4ZJOA 2PN6A 4DHVA 2LU1A 1T02A 3DU5A 3TUIC 4FNHA 1G6BA 2HIYA 3KLHB 2CG8A 4WU3A 3HKZD 5A8KB 2XMVA 1I94F 3MUTP 2L9NA 3CCMS 1X7VA 4DXLA 3QO9B 1GX6A 4J9SA 2M0GB 2B0GA 2H51B 2HHTA 4K5RA 3JQJA 1QD1A 4GKKJ 4GC6A 2AYEA 1XBWA 3C8YA 2VG7A 4X66J 1CQNA 2DY1A 1LQ9A 2W01A 3D7SB 3JXOA 2R7SA 2DCUB 1UWAA 2FD2A 2XG8A 4JV5J 5L8RC 3D5MA 2ATLA 4DSIA 4NZ7A 4FZVA 3ENQA 1IVZA 2NLWA 3ITHA 2QSFA 3BGRA 3MMAA 1FTCA 2F9DA 1XERA 3MEGA 2JEFA 3DOKB 1NRKA 1PJ5A 3HHLC 4GVLA 3HHKA 2Z56B 3GFYA 1VFJA 1RAEB 3VVUA 4NYPA 2CPDA 1OQ3A 1PILA 1FNMA 1HMVA 5RUBA 3AOCA 1T05B 3S8SA 2KXHA 1PAEX 3NY0A 5IC6B 3W9HA 5KFKA 2GA7A 2I6WA 3OR2A 4ANCA 1HLWA 3DRXA 1Q5VA 2OEMA 2V4JA 3M8WA 2B56A 2AEJA 4BWMA 3RBZA 2Y1IA 3Q89A 4O3NA 4TNOA 4B3MF 3MCSA 2GHWA 1MMDA 1TL3A 4UY85 1NLKL 4QU6A 2VBXA 4YFUA 3CTRA 3SQGA 2K1RB 3K5NA 4RUBA 2LXIA 4LFBF 4R8UA 3HZGA 1RAAB 2MZJA 1U0HA 4IFVA 3PCOB 5C2GA 2BUNA 2XBPA 1KFSA 4M5MA 4LSLB 2KFZA 4DR3J 2BJ3A 2LQBA 2IBKA 5CA5A 1REGX 4EFAC 1RWNB 3CSKA 4F3MA 2UXDJ 4Z7CA 2X7IA 3HHNB 2BE2A 2HNZA 2HZAA 1S9GA 3DFEA 1WHWA 4JI3J 3BF4A 3HXMA 4WPAA 3NGSA 3D1HA 1KDNA 1Q8KA 4KHPJ 4KY3A 5GMEA 2LA6A 3AB4B 3Q0AA 4C8MA 3Q8UA 5HJYA 2KVIA 2CPJA 5THWA 1RYRA 4B9TA 5CCLA 2QLXA 2E29A 1HNZF 2DIUA 2C22A 1YKWA 3RR7A 2XMJA 2W4CA 1Q8IA 2GVDA 4ZVSB 2HFSA 3A3OB 5ETTA 1TVRA 2OD6A 2FHKA 3IMQJ 1RHQB 3CC4S 1RA7A 3TEGA 5DG9A 5ETMA 2XGQA 1T9WA 5E41A 4PPZA 3HHLA 3OL8A 1S1XB 1XNQF 4A4JA 1FD8A 3SSRA 4ETZA 2EK1A 2B5JB 2MXYA 2FJXA 4DR4J 3PR4A 1QVGR 1VRUB 1SBRA 5HN0A 2YKOA 5KFAA 4J9NA 3R3TA 1YRUA 1C2PA 2JZ5A 1VQ9S 3UVJB 1UW4A 2ZH7A 3DLJA 3H5UA 3L95X 3W9IA 3CXCR 1KN6A 4GO5X 3GMGA 3C46A 2J9DA 2V94A 4OI2A 4URQU 2G1DA 3RRGA 3JQKA 4ZVPB 4GO7X 5EWGA 3Q2TC 1LWEA 4DR1F 4U8YA 1R0CB 5HSPA 3OLBA 3OR1B 2V67A 5KFFA 4OHZA 2Z57B 1SQFA 3SZ2A 3TVKA 2ZH6A 1UW9A 4JI7J 2WONB 1OSDA 4DMZA 5D8HB 2QA2A 4F2RA 4JI8J 1RLDA 2Z30B 2YH0A 2ZHAA 4YS2A 4DFPA 3D6FB 3QFHA 4LSNB 4Y00A 4I2QA 4C48A 3OTOJ 1IJEB 3AD9C 3QQCD 1TL7A 1XR6A 1IKVB 1SL1A 2WW4A 4LIWA 4X62J 1FD2A 4KSEB 4PYDA 3LW5C 2FLOA 4USVA 2VDHA 2MQ8A 4B3TF 2CJYB 1LOUA 2HWIA 2Z58B 5KFWA 1PGZA 1S9FA 4PWDA 4KGMA 2DNPA 3DI6A 4B08A 2VKZG 3N6NA 3PEHA 1VC6A 1B70B 1U47A 3R6GB 2O3DA 1AYEA 3K89A 2BX6A 3BPDA 1JLQB 1Y5LB 1KHVA 1SUQB 2QJ3A 1F2HA 1RWUA 2PE8A 3TX0A 2V2QA 2BJ9A 2WB4A 5B7WA 4ID8A 3RB4A 3CDBA 3ISZA 1RK8A 3MI7X 1C0TB 5F8IA 5KT6A 2YX4A 2Y3YA 3LQVA 3LGNA 3W2VB 1GMWA 3KNGA 2DITA 1YJTA 3BYRA 3FBBA 5DQHA 1ZAXA 2MKCA 1RTDB 5A8RB 2RQCA 1HWJA 5CYMA 1FKPA 3RAXA 3HJVA 3L3CA 1FK9B 5IS2A 1LFWA 1ZTTA 1R27B 4CO2A 2ZC3A 4RNNA 5HP1B 1QJHA 1E6VB 2XNQA 4FP9A 1YX2A 3BQ0A 4UZCA 3TZWA 2CIMA 4LBPA 1DFDA 3A8JA 2K7KA 4OX6A 2CJQA 2JEIA 1D8YA 3UQSA 2V0NA 3BSCA 1VQ5S 3TYTA 2MQQA 2IHR1 1WD6A 1R0AB 2AGPA 2LMIA 8ATCB 3AOBA 3JQMA 2KRBA 2DEJA 2UVWA 3CCES 4JB8B 3RBDA 3N6MA 4UT4A 4FYVB 3HLUA 3R1HA 5B0FA 4DS4A 2B3TB 5DZ7A 3BGOP 3D0GE 2R7RA 3V5RA 4F36A 3ETMA 4CTAA 1NH8A 4NXMJ 3G9CA 3HF5A 4YDDB 4F4ZA 4QQBA 3LP1A 3MMCA 1RAHB 2R8IA 1S1VA 1IKXA 4TU8A 2M9KA 3I4PA 3MM5B 1HBMB 2YWGA 2OO4A 4C97A 1TUVA 1DLOB 3EE3A 1N54B 1WF1A 2IIHA 2HIQA 4NEYA 4B3RJ 3DYAB 3PW2A 1N5TA 2B6AB 1RCXB 5HL7Q 2ZOFA 3IC1A 5KFBA 1JQGA 4RNHA 3EZ5A 2W9CA 1NO8A 4FYYB 4PKDB 2MZQA 4J9PA 4YEAA 4E8UA 2DH7A 3PKMA 2KKHA 4NRUA 2Z2LA 1M5OC 3BN4A 2YKAA 2D1CA 1RT4A 3UI3A 1RZMA 1BUXA 3GLJA 1M90T 4DOZA 4CDIA 2CYYA 4K4SA 3W1YC 4OZJA 3CCLS 5E3RA 1VQ4S 1NK0A 2BQ3A 3WIUA 1Q86T 2KT2A 3TAMA 3PIOQ 2OHDA 4HACB 3ZZ0A 2JFDA 2MTLA 3NL0A 1RA6A 1RCOB 1VHFA 2P6SA 4WF9Q 4OL8A 4KIAA 4RBTA 3IWXA 1D0EA 4LF4F 3RW6A 4OV6A 3ET6A 1GT8A 4WBFA 2EG2A 3KUGA 1LEOA 5KFCA 3LH2S 1M1KT 4KQZA 3HSGA 4ECQA 2EI5A 4O44A 1RWXB 2HKEA 2IYGA 3J81j 3QPIA 1RWWB 5DS7A 3K8WA 1TL4A 3A8EA 4PCQA 2V8PA 1GQEA 3CO9A 1WG5A 4BCAA 2UUCF 3O1LA 3LPEA 3HD2A 4F25A 1PYTA 4DX6A 1OY9A 1U6BA 4JUZA 3I87A 5CZXA 4Q43A 5K8OA 4E98A 1AA1B 3R5GA 2BQRA 1Y5IB 3BSAA 4JI4F 5FDLA 2V50A 3QRPA 2EBGA 3A1YG 1VLOA 4URSA 5D0EA 1HQ2A 3H2LA 4EU0A 2DVIA 2C28A 3QNWB 2LEPA 4O3QA 3WC2A 2F8EX 1OY6A 3MM7A 3ZO7A 2AYGA 4FYXB 3CD0A 3B54A 1RHKB 4MH8A 4RLEA 5K5MA 5GAGU 1BE4A 1FERA 2GMLA 4NA3A 1HQUB 2OPRB 2CQPA 2IAJB 4UUWA 2AJQA 4ZPDA 2DXEA 1Y7PA 2YKMA 1SJFA 4TY8A 3MOJB 3FEYB 3K2YA 2ASLA 3GG1A 3N0VA 1VS3A 2M4MA 3UCUP 2KRRA 1WHVA 4TU7A 2IMWP 4D3GA 1RT6A 3PHTA 4YR0A 4RW9A 1CJKB 1WF2A 2GFFA 2XMTA 4ZLJA 2VFVA 2OMOA 1IBKJ 1FXDA 2N4CA 1VYAA 3PDNA 5KFTA 2E5GA 1K9MT 8RUCA 1L3UA 2R8HA 1N5QA 1H38A 3QATA 4KAIA 1PSDA 2MKHA 3QIPA 3VF0B 1VK3A 4A8SA 2PEBA 3AY0A 2MJNA 4ALZA 1AZSB 1GFWB 2ADCA 4AL5A 3SSSA 2ZBCA 2C42A 4FF1A 4DSKA 2XLJA 1S1WA 3GIKA 4C2MA 3EVMA 3BH6B 5ADZA 2BJ1A 1R89A 4ZKAA 4M94A 2GQCA 1O8BA 4XAKA 1VQOS 3QAUA 3M9MB 3HKWA 2R8GA 4HKQA 5KFLA 2CJ9A 4H4MB 3NAIA 4OHVA 2HG4A 4B9LA 4EBEA 4OYZA 4UQGA 4ENOA 3EX7B 4P2FA 2PD1A 1YSJA 4A8OA 1YWXA 3IP0A 3C16A 1VBXA 1F9HA 4PG6A 1K0VA 5FJ4A 3GJSB 4NLTA 1YRTA 3OL6A 2VDIA 2Z4PA 3PRDA 2HLTA 3EXCX 2AMCB 3G8QA 2IA6A 2WCXA 2IC3B 2VQFF 1IR1A 2MKSA 3MM8A 1TL1A 3J81Y 1JNZB 7FDRA 5HMWA 4AQYF 5LSRA 5KG6A 2BABA 1RU1A 1V5VA 2C2MB 3GJTB 2B7BB 2HHUA 1B0VA 4S0MA 2I38A 2PGCA 4BHQA 3EGZA 1EKSA 5D77A 3DKDA 2IRYA 3W8PA 2HVDA 3JS9A 1ZYQA 2GQ2A 3TJ9A 1N5VA 3FJ2A 2QG9B 5F8LA 4ED7A 5J2MA 1PCAA 1HNZJ 4JBCA 1TKXB 2L41A 4Y2CA 2RE1A 5KFXA 3V6DB 5IM0A 1R8CA 3PJ9A 4RPFA 3JSMA 4MIAA 3GG0A 2DXDA 2DRDA 3R2CJ 1S0NA 4JV1A 1NKCA 2LXFA 4OLPA 3GU0A 1LWCA 5F0UA 4F04B 1T94A 2QL5B 1C0UB 3FCHA 3RJMB 1DQ8A 3CJ3A 2E1RA 4K4XA 1LK5A 2KVQE 3HVRA 4KR0B 4C11B 1U2FA 3FCWA 1DQ9A 3M32A 1JKHB 5IT0A 1F0XA 2IFXA 4C8LA 1KFDA 3E3XA 3TO8A 2FY1A 3FQKA 2ZD1B 3MTKA 1L5UA 4LBHA 3C14A 1TK8A 2OSQA 4LSLA 2ZKTA 2PI5A 5ITHA 2PMHA 2OP5A 2R2SA 2GAHC 3MPVA 3K8VA 1QSLA 1Q7YT 2G13A 1HHTP 5KT4A 3J7ZT 1TL5A 2C2OB 5KFNA 1GNKA 3IM8A 5AXLA 2MZSA 2ZBQA 2FC9A 2ZE2A 2FGCA 2FLNA 2E5IA 2GS8A 3C3LA 4K59A 2BRKA 4L76A 1GAOA 1A9NB 2CQDA 3ZTPA 4ID5A 2FDNA 2KTQA 1N5YA 4DR1J 4TY9A 3AAWB 1SKSA 5LMUF 5HQLA 4P2MA 3GV7B 3PNIA 2MKIA 4QWBA 2AP6A 3IBWA 4QPXA 1IJFB 3CULA 1Q0NA 1FVSA 4C7QA 5HROB 5KFZA 3K58A 2HS3A 4IG0B 3I55S 4CLKA 4F4YA 3Q2SC 1VLYA 2U2FA 2IM3A 1VIXA 1SKUB 4RW8A 3H5YA 1Q7LB 1RT5A 4O4GA 2PA3A 1WSVA 2AEFA 4C6AA 1NKEA 4DQPA 2X3GA 4F4AA 2HW3A 1RAFB 3SCIE 2MLYA 1IWAA 3P4UB 4B3TJ 3TRGA 5A0YA 4JV0A 1NHUA 4Z2XA 1JLEB 5KT3A 1N32F 1BWVA 3QWPA 3P6YC 5U47A 2BRLA 5D78A 2XSJA 2GV1A 2ZH3A 3KUHA 2NS1B 4I0WA 2W8LA 4OZ3A 1N56A 4PQAA 3ISND 4ICLA 2OD4A 4WK1A 5F0WA 3DRYA 5K20B 4ED5A 5C7PA 2NYHA 4AD6A 4HEA9 4OYPA 4J9UE 3HD1A 1RT2B 1P27B 4NMXA 4PUOB 2J6TA 3KMSA 4OV1A 2EK6A 3OR1A 5KOXA 5ETKA 3DN9A 4NZ0A 3R5CA 4RR5A 4P52A 3HFVA 4DUZF 2EFGA 1M5PC 4A8QA 3QRRA 3AXMA 4DDFA 2W4DA 4HI2A 1UFKA 2J9CA 3EJMA 1FNXH 3B6BA 1YK9A 4M1KA 3EMTA 3I0RB 5IT9U 1PIEA 2D69A 3DU6A 3OXFA 2ZWPA 4ANEA 5L1KA 4QIVA 3IGVA 2VHGA 4UY8T 3ZZOA 3SQOP 2ZOMA 3V81B 2CUYA 3HSJA 5A8WB 1DTTB 1WOPA 5BR8J 2CQBA 3CCVS 1S6PA 2R9LA 3EGNA 1UCNA 3MR3A 3HPOA 3IR5B 3PRBA 1S97A 1KQKA 4DR7J 2P9CA 1WEXA 4NXNJ 3JB9k 2CQ4A 2VONA 2JLGA 2M70A 3PW4A 5IOLA 1FF2A 1H7WA 1EETB 4DLGA 2POKA 3O3LA 3UPFA 1OYDA 1MNEA 4DV1J 2VOPA 2FHOB 4U7UD 4WKYA 1C0TA 3KWMA 4M5HA 4XO0A 2VQEF 1BQMB 5IQQA 3PY8A 3KK1B 3V4IA 2C2ZB 3RW7A 2WAQD 3OVBA 1U1NA 3LWMA 1Y5NB 3R5BA 5GMKa 2LQ9A 4DBQA 2CDQA 5SZTA 2GCFA 2FGOA 3DM2B 2NZ4A 2XY7A 4ECVA 2VOOA 2VC0A 1U26A 1S1UB 5ETVA 2VBYA 4DPUA 4X84A 5HLFB 4ETXA 3V6KA 1FDNA 3CJKA 4L73A 4MIWA 7AT1B 1NB2A 2DY9A 3NG8A 1YBTA 4H4KC 2BJ7A 1H3DA 1HNIA 4A47A 1UJ5A 2HLUA 3TZZA 2DGVA 4C0BA 2N3LA 4KRWA 3IGNA 3L7PA 1RHMB 1R0AA 1HWIA 3M8YA 3HVTA 1S59A 1NPRA 1SV5A 2DR9A 2GQQA 1H74A 3LAMA 3FEXB 3A12A 2FJEB 2DNHA 1YDLA 1RAIB 4CIOA 3QT5A 4LREA 4LF4J 3NGRA 2RDIA 2MY8A 1G4CA 2ZM6F 1U45A 2O01C 4N8OA 4LQ9A 4LQ3A 2I5JB 3UN3A 5HMXA 4RW6A 5ETPA 1HNXF 2F40A 4G1QB 3KLFB 2HBQB 1UL3A 2RAQA 1WC3A 1R6YA 1K47A 3NEKA 2BV3A 2IDLA 2M5YA 1ZPVA 2EVZA 5E2QA 2X1AA 5DETA 2B6AA 4DQQA 2UUCJ 4UF4A 1L3VA 4IOAQ 3B78A 1M5VC 4P72A 1UJ4A 2IM2A 4BLGA 2XEXA 4KGVB 1TKTA 3FGVA 1OWXA 3ZTOA 2R2RA 3UNGC 4ZP8A 2E7XA 3IO1A 4LF7F 2ALZA 3CJRA 4PEOA 3NOGA 3H90A 3PHEA 2DGTA 3QZ8A 1UA1A 1KBRA 1YZ7A 2CWKA 3CPWR 1TU0B 3FDSA 4ELVA 1NJZA 4MK7A 2B9WA 2KG1A 1B7YB 1QTNB 3KYLA 3NAHA 3UD5A 4DPYA 3L7OA 4NLGA 2AEMA 3DXBA 3CNQP 2E1CA 2OEJA 3MEKA 1S6QA 2CJXB 4USMA 4RWWA 4AYBD 1IXKA 2RRNA 2YNFB 1FNOA 5I3QA 1IBMF 3HHLD 3MOZA 2EKNA 3MFHA 4C0OC 3BBCA 3Q8YA 2VG6B 3HVAA 5DDOC 3RZAA 2B4OA 1Q95G 1TKZA 1EHWA 2M8HA 3QGIA 5CYQA 2W9AA 4ED0A 4ZITA 2XYHB 2RILA 4KFBA 5CD4A 3NBPA 4ED6A 1RBAA 3R5AA 4PRFA 4N47A 1CULA 4MTPA 2OPPA 1TQLA 3MM6B 2OI2A 5KFVA 5BYQA 3O44A 3BKFA 3M30B 3JSYA 2A10A 3VV2B 1HKAA 2RDJA 3DOLA 2ACYA 2WOMA 4CCHA 1NSAA 1QUVA 1YHQS 3R27A 2GO9A 2F65A 5LOQA 1NHVA 1QY7A 3PFEA 1RJJA 2UVVA 4N7TA 3HCXA 2FYXA 1N34J 3TWZA 2AJFE 2V5HG 1SQGA 1HWUA 4U7UK 4IFYA 3D3BJ 4LR7A 2BBEA 5DO2A 5KFSA 2JDJA 4F02A 5B0GA 3DLKA 3IBFB 3CCRS 2AU0A 4QIEA 4NCBA 2FHJA 5K14A 5K8PA 3FMWA 2CQ0A 1NK7A 4DCJB 2VH7A 3EVOA 3ZZUA 2RU3A 2P6TA 3CMQA 4EGLA 1XR7A 3W3SA 1H2TZ 1IM4A 2D3OR 3BS9A 5KFHA 3Q8PB 1N0UA 1VBZA 3EDRB 4O0NA 3RB0A 2E9TA 1WI6A 2DNOA 2ILZA 1WHXA 1IKYA 4PR6A 4ZK7M 2RDDA 1U1RA 4OJ3A 2YKNB 3M2UB 3IN5A 1NSPA 1SKRA 3JAMY 2HZVA 2Q43A 1AROP 5E7OB 1T9YA 1FJCA 4J9LA 1KVKA 2CVEA 4ZA1A 3H25A 1RKJA 4DX8H 4TU9A 5GAHI 2A3JA 4IDKB 5IFMA 1XJWB 1Q79A 1VRTB 3CDWA 3TAPA 4X4UA 3PW7A 1Y9OA 1HI0P 2VODA 5JXSA 3RR8A 2MKYA 4DN9A 2ZOGA 2B8PA 1XMBA 5ETSA 1FDDA 2Y0SD 3VCDA 1VC0A 1KRPA 3H20A 1GMWD 3SDEA 1NMEB 1SH2A 3UN5A 3QSYB 2B51A 1QAIA 2AWZA 3WC0A 3C6TB 2OTLS 4QYZJ 3G82B 3QJJA 3IG1B 2HYIB 1DHMA 1LW2B 3EICA 3T5JA 2M88A 3PW0A 4V19J 5CD4H 1NDPA 3CCQS 4RL1A 3I31A 4H4OA 2FJAB 5H9FJ 4FKXA 5E33A 3Q8SB 4RBUA 2MY7A 2W2NP 3IS9A 4P9SA 2PA8D 2A6OA 3RBXA 1OIAA 3TQ1A 2W9BA 1HA1A 2J7UA 2KM8B 3AOAA 5B09A 2RKIA 3OPKA 5A6PA 1W26A 1DTQA 4WJBA 2ZJPQ 2XULA 1UVLA 4I56A 3ZZZA 2FZGB 3DCAA 2H54B 2WVBA 2E66A 3JYTA 3MCNA 1Q78A 1N5SA 4N76A 2NXJA 1RP5A 2ZZNA 4DL7A 4TYBA 5DJBA 2HBZB 1RDRA 3CJ5A 3VALA 4B9MA 4C8KA 4P2XA 1RU2A 2W4PA 3WQPA 1RGVA 3MR2A 1E6YA 1B7FA 4PXCA 3D6HB 5LMUJ 3OFFA 3LP2A 2AJ0A 2G2YA 3KJVB 2UP1A 4OI3A 3ZNUA 3O2IA 3IA0A 2IRUA 4DV7F 4F2SA 1BC6A 2VKRA 2B43A 1I51B 4OZ5A 4P73A 3QMQA 4KB7A 3A3NB 2NXNA 1ZPWX 2FPHX 4KGKA 3CEDA 3D67A 3DDKA 3I5BA 4M8LA 1TR0A 4DL4A 4WE1A 3M4XA 4DR3F 4U96A 3C6UB 5AXKA 4QIWD 4GVBB 1YBUA 5GADI 1RTHA 2FC8A 1KSPA 4MFBB 1ZM4A 4TQRA 4NCGB 4DL3A 1NK8A 3UN2A 4YY3F 4JI0F 2B9EA 1KQGB 2R2TA 1WI8A 2J5AA 1N32J 2OJ3A 2QL7B 2CQ1A 3M9OB 3FSYA 2BJDA 4IRCA 4KHPF 2IM1A 2HVEA 2Y0BB 1I1GA 2MQOA 3VQTA 1EP4A 5IZHA 3NS7B 5I42A 1KHWA 1VQ8S 3ILOA 1S4EA 2N7CA 4C98A 1N4LA 3NGDA 3D6MB 3W5ZA 1X5PA 2CPYA 4IG3A 3DRRA 1H2VZ 3I0SA 4DJBA 2W7AA 1D09B 2P9GA 3CJ2A 3CJTA 2VA2A 4ITSA 3WIVA 3GZ7A 1R3NA 4N8NA 1W7WA 4K2JA 3EM1A 3Q22A 1UVJA 4LF9J 2V8DA 2VJUA 2R7UA 4AT1B 4ES2A 2PMZD 2XS5A 2XI2A 3SIPB 1JLAB 3TNVA 3TUJC 1DURA 5IXUA 3T5HA 3ELHA 1HI1A 1JJ4A 3PX4A 2DO0A 2X3DA 4F7VA 1FDBA 4IOBA 4PG8A 3RYLA 1UVNA 2FB0A 4DG1B 3AJDA 2AD9A 2KT5A 2ROEA 3CC7S 3AA9A 3MPDA 1MWQA 3PXGa 1UEKA 1CJTB 3SMZA 4ILRA 2RF2B 1H0HB 5KT7A 1PO6A 2FZKB 4PQUB 1TFYA 3GPAA 1V3ZA 1BQNB 4I2PA 2NYIA 2KT3A 1RLCL 5KFDA 3K7RA 3ULHA 5BYRA 4OJGA 4M5IA 1NJIT 2AYMA 2QV6A 5IWAJ 2HNDB 2HHWA 4OJ1A 2E7VA 4U8VA 4QPTA 5E3QA 4JI7F 3LGHA 4AXJA 5LM7E 5DQIA 1RT2A 2G4BA 3ADAC 4JI8F 4PUOA 5J2QB 4UQTA 2CNOB 2ZH1A 3T3FA 1SVDA 1SXLA 2ATCB 2IJNA 1KONA 4WFYA 3A4TA 4ELTA 1CC7A 1EQ0A 2WSFC 2RD5C 4J9MA 3H4BA 1NZAA 4UOFA 3N6LA 1QAXA 3PYGA 1N6QB 3BKTA 2RSQA 1KD1T 1Z1ZA 4Y34A 1GH8A 1T0TV 1RSCA 5J2PB 2GNKA 2HAIA 2JLEA 5FLXY 2YWHA 4NOHA 2ZUGA 4AXIA 2HFOA 4MYUA 1RBLA 1WKKA 3BBBA 1SL2A 1XC9A 5BXIA 1OO0B 4JI1F 1DTTA 3OFEA 3LP0B 3QGPA 2B4VA 2BA9A 2IYIA 4KH1B 4NE9C 2AGQA 4FDFA 4Q8FA 3PRVA 4R5PB 5KAKA 4W90B 5AXMA 3MPUB 1B0PA 3H2UB 2F1FA 3RTVA 4EWTA 1FFSB 1FCAA 2ZM6J 4DPXA 2E5HA 5D4PA 3OJSA 4DFJA 1HNXJ 5GAGI 3FNNA 4MKAA 1FO1A 1FESA 3Q24A 3KDNA 2DHSA 1LV5A 3QT7A 4DLEA 3O8WA 4QBUA 2MHNA 1YITS 3M8SA 3IR7B 1TKDA 2WVEA 4B3OA 4GMKA 2YNHA 2P5VA 3MUVP 3PW5A 2QLBB 2IMOA 1KC8T 3OSNA 3J7YU 2AKWB 1FTRA 1HR0F 1X0FA 4NYZA 4P75A 3M2RA 4NLPA 2VC1A 2V4RA 2ZZTA 5E3CA 4KE5A 3SV3A 1F9FA 4FF4A 1UVIA 1IKWA 3KHGA 1T03B 1APSA 4B9SA 3G71S 1EAYC 5B0AA 5KG1A 3S01A 2O1PA 4KTQA 2QMUB 2Y1LB 1QDUB 5HI7A 1F60B 2CQCA 4LF7J 3MM9A 2J0XA 4ZVHA 3MEEA 4FXDA 1HBNB 3VGUA 3MZIA 4AE5A 4EBDA 2XHCA 3DLEA 2RS2A 4BC7A 3KG0A 4DPTA 5A76A 3HX9A 4KC5A 3V4MA 4NYOA 1R8AA 4M95A 2Y8YA 2LDIA 2D74B 3QSIA 5M2PA 3ZZTA 1W25A 1VGYA 3W8GA 1WOSA 3R7BB 4IH6A 4Y2MA 3N5BA 4ED4A 3GCWP 6AT1B 2ZVIA 4DR6F 5E5NA 3OV7A 2C2NA 3CGIA 4YP3A 4ZLPA 2F63A 2QFJA 2I8EA 1REVB 4M5KA 2KZZA 4LRCA 4ATNA 2VIHA 5IQ6A 2RVJA 5KOWA 4DX5A 2QLWA 3NRBA 2LKZA 2PT0A 2YQ1A 2J0WA 5EX0A 3RB3A 4V19X 4I4BA 2PFFB 3KK3A 2HFUA 4DSLA 4RJVA 5K9FA 2JOQA 1WEYA 2ZC4A 3E2EA 2HHXA 1FEEA 4I7FB 4EUVA 1SPBP 2WW8A 5A6WA 3KJNB 3MECA 1CS4B 2MSTA 3PEJA 4NZ6A 3IRXA 1U6ZA 4E0DA 3BM7A 3F73A 2VG5B 3D54A 3WX8A 1HPZA 5I3UB 3TEHB 3VZHA 5CAAA 3QBCA 3RAQA 4M5DB 4XPCA 3WX4A 1FXRA 2DTJA 1JWWA 2BXJA 4ZHRA 3M7VA 5HVFA 3TA0A 4EEYA 1TV6B 4C4WA 3CIMA 4P7VA 1HI8A 4CH1A 2QRRA 5H1SV 3NKYA 1LWXA 4EO8A 4OI4A 1SIWB 1RWPB 5J2NA 4LUBA 2HVHA 5HBMB 1FRIA 2GVZB 3DRSB 4OZ0A 3UFCX 4P2SA 2FZCB 3M6XA 2ZH9A 4K5SA 3QJPA 2YNGA 4KV8B 5HAOA 3UDCA 1YJ7A 1HD1A 3DLGA 5LT5A 4EI2A 2UXBJ 3IFEA 2HRYA 2COLA 1X4CA 4C3KA 3U1NA 1RWVB 4EBCA 2H48B 4F4XA 1G1XA 1SI9A 5L39A 2VF3A 1F5BA 2ZDOA 2C2RA 1J5OA 1HARA 5DRKA 2ZHBA 2OPQA 1DAXA 1U8WA 5F8NA 2ADBA 2HNYB 4Q0BB 5GMDA 1WG1A 2G1HA 1RT1B 2DBBA 2R7XA 4QIGA 4OHXA 2BZ2A 3AJ1A 3KXDA 4NLYA 4UOCA 3J7AN 3AQPA 1FXLA 4PXDA 4QR1A 4LR9A 1ZOTA 1FJ7A 4O3PA 2APOA 3L9ZA 3M8QA 2Z2MA 5F8GA 1T9UA 4RX6A 1YLXA 2G9OA 4DUYF 1NK4A 3W5XA 2K8GA 4ZPVR 1RHUB 1WKJA 4OZNA 2XMMA 2O5DA 5B08A 1GXTA 3ZFVA 3GYNA 3F44A 1LW0B 1FRHA 3CC2S 2UUWA 2LCWA 2Q3PA 4FXVA 3FEZA 4PAAA 1AW0A 4DF4A 2KYXA 2HAFA 1CG2A 3UD3P 1ELOA 1IBKF 1A0OB 2DXFA 3ZZRA 4DEZA 2N4DA 4R25A 3M1VA 1AUSL 2BW2A 5AE2A 3J80U 3VGVA 4J9VA 4ES3A 2YKNA 3CD7A 2HK2A 2M7SA 3DGPA 3HFKA 2VZ9A 3Q8VA 1NAQA 3P5BP 3KLEA 2D3UA 2X1GA 2VG7B 4RO0A 3OTDA 1UETA 4FVMA 4LF6J 1VOMA 3HDSA 4QWEA 1KOOA 1D9FA 2J8SA 2YWEA 4LFCJ 4XDCA 1WC0A 3EWGA 4ZN1A 4IQMA 3AD7C 2BM0A 4KKOA 2MEWA 2V8VA 2B4PA 4RW7A 5AXNA 4K2XA 3QIDA 4HDHA 4DV7J 3ITHB 1A7GE 1RXOB 2DGUA 3JSBA 1GK8A 3BGRB 3MMAB 4WFBQ 3OHBA 1B4SA 1N48A 3GR1A 4LR8A 1IR0A 3MEGB 1WG4A 3G82A 3LF0A 1HBUB 3D28A 1ZZFA 1S49A 4X65F 3DMJB 2W7PA 4FPRA 2XWYA 2O67A 1Y00A 3TVYA 3I6PA 1T3OA 5HMYA 2H1YA 1NXIA 1Y3JA 1DZ5A 1HMVB 1FWPA 5FIIA 4YY3J 4JI0J 2JVRA 4RUAA 3MD1A 1QE1A 4F8RA 2LVWA 1Q5YA 4LF8J 3OR2B 4NMLA 2W2OP 1DRZA 4BS2A 1IQZA 2DGSA 2ASDA 1NJXA 1JX4A 1YG0A 4LRFA 2CPZA 4CT8A 1NDKA 3BO4A 2V4JB 1JXEA 3H2VE 2WTFA 2HQFA 2GO8A 3IWLA 4DL5A 3B82A 2HK3A 4A8KA 1TL3B 2K3IA 1S7IA 4DFMA 2XC9A 2CPEA 2XZDB 3SQGB 3KKFA 4ZPCA 3BH7B 3QJLA 2LYVA 4F50A 2XMUA 3W65A 1PAUB 4TVAB 5KT5A 2FVPA 3W62A 4UW2A 1U0HB 3H40A 4OIXA 4IFVB 1S12A 1P9QC 2YKQA 1QSYA 2J0SD 1X8DA 3ZTRA 3MEDB 2XSFA 4QW9A 4X2BA 5D4OA 4U95A 1SJRA 1CVJA 3PR5B 4Q45A 1XIQA 1GTEA 3IAS9 3T5KA 3H5SA 2RUSA 4ZVEA 2MSSA 2WVFA 3ILIA 1WDDA 5DDPC 3GWCA 2G0IA 1X60A 2M3DA 3OUYA 2BE2B 2PO4A 1X5OA 3BR9A 5EWFA 1JLBB 1S9GB 5GAHU 1ZM2A 3U27A 3NNHA 1F3VA 4L75A 4DL6A 1HHQA 3D6TB 1T3NA 2YX7A 4LVNP 4NLSA 3KHHA 1MROA 2VBWA 2DNYA 2KO1A 4DV2F 3MMBA 2AZ1A 4CLWA 1MMLA 4HVZA 2VFUA 4CLLA 4DV4J 1XMQF 1K8AT 2BEFA 1X4GA 2C1EB 3KG1A 7FD1A 4EK2A 4PXEA 1IQTA 1UPMB 2VB6A 1QAJA 2ERRA 3RU0A 3F41A 3S1TA 2LP4A 2MQPA 1TVRB 1IUJA 3N4WA 1RTJA 4H54A 3MR7A 1R6VA 3U1LA 3PM9A 4DQIA 3AXKA 2J0QD 2ZH8A 4Z37A 2QA1A 4OQJA 4OMFG 4YHHF 2HGMA 3T6JA 2V63A 1D1UA 1YJVA 4CO5A 3G8SA 2YWFA 4OX9J 4LRDA 3U02A 2DR6A 2EWHA 4XIUA 2OFHX 3DRPA 4NLQA 4OYBA 2NXUA 4J7CA 4LJMA 3G87A 1XR5A 1D8ZA 3IM9A 4WIIA 4QZVB 4NLDA 1L3TA 1U6FA 3R8YA 3MTJA 1QLNA 2MB0B 3R97A 3CB4A 1FKOA 1MU2A 2DD8S 4N41A 2QA4S 3NP5A 2XZTB 2CZ9A 3FVYA 3NXZA 2MHEA 2PIIA 2GHPA 1V3RA 3KNAA 4DG1A 3I82A 2D3ZA 1OYEA 3G96A 1PKUA 4JI1J 2RF2A 3ILLA 4OZ2A 1RAOA 4PYAA 4DCPB 3PO5A 2FHJD 1HD0A 1C1BA 2CZVC 3HSDA 2WVDA 2XYGB 2CNLB 5DDRC 4NX9A 2D41A 2DH8A 5MLCV 5DG7A 1TZ0A 3HK2A 4MYTA 4G6VB 3HT0A 4BWJA 1X5SA 2JC1A 3L4BC 5A2QY 1YIJS 3LO3A 3SV4A 4I2QB 3W7BA 3K5LA 5GADU 1LWFA 1AT1B 4NPOA 4LF5J 1TL7B 1VQMS 1N0VC 2RJZA 2W7OA 5F8HA 1EX8A 3MAHA 2QYCA 1IR2A 3BBFA 3BV8A 2JRSA 3KLGA 1HR0J 2Q66A 2V6AA 1LFPA 3C66A 4PWDB 4Q44A 1WKLA 3GV8B 3DI6B 2UZAA 2QL9B 1WC5A 3D3CJ 2KFYA 2RU9A 4ED2A 3I5CA 3DDIA 1KR4A 5C42A 5LJ3Y 3OVSA 3X1LB 4CZCA 3C15A 3TZXA 2CFXA 1FEHA 5BR8F 1PC5A 1P1LA 3OVAA 2W8KA 4CT9A 2BANA 3HZEA 5IV3A 3BN7A 3E01A 3OTCA 3US5A 3UDLA 3GFXA 2VD3A 4DR7F 4NLUA 4NXNF 5B0BA 2I2YA 2JLFA 4DU7A 2UU9F 1CJVA 1S72S 3CJ8A 4ED3A 3M8ZA 2XNRA 1NSQA 3IXQA 5HVGA 4N5SA 1VCTA 1X9SA 2V8GA 2GIRA 4DV1F 1HL6A 4DR6J 1SH0A 3MHYA 2QTWA 1UWBB 5DZ6A 1YVFA 1UFLA 4I6YA 4CYUA 3SI8A 5CYMB 5FD1A 1FKPB 1OPZA 4TXSA 4CLSA 3FFIA 3WHIA 3NCPA 2R2UA 4XDDA 2VV5A 2HBYB 2RT3A 4MKVA 2KB2A 3TP2A 3OLAA 5D4NA 2DO4A 4O3OA 4PWUA 3W64A 3E8OA 2EFOA 1DJ0A 3FCVA 4CLYA 4ZP6A 5KG5A 2RMLA 3MAAA 4B02A 5IV4A 2RQMA 2E9ZA 2NQPA 1KS2A 2OFGX 2ZH2A 1F6TA 1RE1B 4I1TA 2QLFB 2OTJS 4O3SA 3PKYA 4FF3A 1RHRB 2PC6A 1OSCA 2LQJA 1TAUA 4USTA 6FDRA 1ZZNA 3UE2A 2V2VA 1KLMB 1VQLS 2QFIA 3LALA 3T6BA 1NM2A 4QOTA 4KYZA 1B64A 2R7QA 1O51A 2J7KA 1RWMB 3EDQB 1RKIA 4CTAB 3AA8A 3KK2A 1X9MA 1S7HA 2FIUA 1NK9A 3PTWA 1VHIA 1YZ6A 3NWRA 3LP1B 3MMCB 2DNMA 3THPA 3ILJA 4WXOA 3R7NB 1S1VB 1WORA 4DCOB 3MR5A 4IO9Q 2YNIA 3OFHA 4RNOA 1HQEA 5EHHA 3T19A 3OHAA 1B99A 3EXYA 3LUYA 4M5GA 5BYSA 2QZ8A 1RADB 4NLWA 2OGUA 4Q7AA 1NDLA 3OSPA 3IAM9 2MGZA 2W9CB 2OKQA 4P7TA 1S9EB 5C2CA 2MZ1A 4ZDNA 2DNRA 2DRAA 4Y0FA 3VGTA 4RNMA 4DR5J 2D3O1 4OYXA 2MZTA 1WJ9A 5C25A 4LT6A 1N33F 2FVQA 3H4DA 2ZVSA 2XQCA 5HATA 4USUA 2WBRA 1HYSA 4QJVA 1JLFA 4CM2A 4KHMA 2VA3A 3NGUA 3TAMB 4Q5VA 3PO4A 2NCKL 3M8PB 5F3ZA 4QYRA 4GKJF 2JWNA 1JLGA 4QWCA 3TJAA 4I67A 3Q86A 2MJUA 4URGA 1CJUA 4BC9A 5G0RA 1FX4A 3ET6B 2DNLA 2CWXA 1Q82T 3W60A 2IVMA 1WTFA 2VL1A 5C24A 4DUYJ 2Y1JA 4O44B 2QGFB 4ZJQA 1W2BR 2FJDB 2DKOB 4HLBA 1RAGB 4EZ6A 1ITPA 1ZA2B 4OYOA 4ZVQB 4M5JA 3TR5A 5L9XA 3G8TA 2NUUG 4W4MA 2SXLA 1RI7A 3OW2R 3M05A 4WFXA 4ILMA 2KL8A 2HVZA 2W2MP 1YJWS 1NU4A 4ZS6A 2BM1A 1NKBA 2DNKA 3M2VA 4WP9A 4JOUA 3I9V9 2F4VJ 1KVJA 2H5JB 1S1TA 2OSRA 2B7CB 5J1EA 3GQCA 1HW9A 4FYWB 2JC0A 5FDLB 3SFUA 3K57A 4OX8A 1N52B 4WZMA 4G3IA 5D0HA 2KG0A 5LSLA 1GMVA 2H5EA 3KLHA 2HGLA 5A8KA 3MM7B 1CQMA 4K4YA 1ZETA 3QO9A 1N34F 3OL9A 1IBCB 1T9TA 2GJIA 3POTB 5E3PA 4QWDA 3Q23A 4DI6A 1M5HA 5L38A 1V9OA 1PJ6A 3CJ4A 2YKMB 4TY8B 1EKRA 4OFZA 4IQXA 2HEKA 3K5OA 3J7Z5 3G6VA 4HYKA 1UEUA 1N88A 1V5IB 2MMYA 1XWLA 1Y11A 1FI4A 3FK4A 1ZM3A 3W2WB 1RT6B 3P96A 2YWWA 2XM3A 4X65J 2E1AA 4RW9B 2W2PP 3T9ZA 5AJ3J 4Q2LA 5B0CA 9ATCB 2P8IA 4ZVOB 3MXHP 4WZQA 3R1LA 1S57A 2M2BA 1Y10A 1HBOB 4QCLA 1UFWA 3DOKA 3QIPB 2Z8QA 3RRHA 1K44A 2CG4A 1Q8BA 2BVZA 3H0PA 1F5AA 4AL6A 4IRDA 2BYCA 3NMRA 5J1PA 1XEZA 1R8HA 4PG5A 5LXRA 5GAEU 5LJ5Y 3PVXA 1S1WB 2AW0A 2VICA 1NDCA 3LANA 4X4QA 2HZCA 4K4ZA 4IYQA 1T05A 4F26A 1WSRA 2X1BA 1MN7A 4K4WA 5LSOA 3FRYA 4ZCIA 3CDAA 1LXNA 4HL9A 2VPWB 3PV8A 3N9UC 1H2UX 2I0XA 2EEYA 2C3OA 4USHA 2HHVA 3UWTA 4AL7A 2H3EB 1BLUA 1UKUA 4FF2A 3C16B 1RT3B 4I6WA 4RZRA 1VQKS 1H98A 2K1RA 4K4UA 4KH0B 1SCJB 2B9YA 3WZ0A 4FBTA 1ZS6A 3MM8B 1TL1B 4ZP7A 3VGSA 4KO0B 2M8DB 3K0JA 2AX0A 3RUBL 3W66A 1HBUA 3ZC4A 3GYXB 2HRTA 2BW7A 3DMJA 2BOAA 4WTYA 1S99A 2C2KB 4JI6J 2W24A 3SBMA 1MSWD 1Y3KA 1DQAA 3NLCA 1S48A 4K8RA 5JMNA 2VPXB 1T8EA 2KJVA 2N7YA 3AQOA 4C0HA 3TZYA 4DV2J 4CM0A 5HMZA 2OLWA 2LLZA 4NLOA 4OYWA 1YRXA 3KG4A 5DLFA 1AUDA 1XMQJ 2V2KA 5AE3A 1NEEA 5J2MB 3TI0A 2HQIA 3BJYA 2DK2A 5IM0B 3JSMB 3I32A 1GTHA 3VAHA 3OXLA 4MT1A 2CVIA 4HT5A 2JL9A 1NHKL 2FVRA 1LWCB 3GIRA 2XS2A 2AQ4A 4HTJA 3LGMA 2H5IB 4ECRA 4CLZA 3TAQA 3UNYA 1U4BA 3QT8A 2AZ3A 4YHHJ 4C8OA 2R3VA 1WWHA 1OPIA 2D9PA 1GXLA 4USJC 1N36J 2C3PA 3MFIA 3M32B 3MEDA 3SCKE 2EC2A 2DR5A 4NI2B 1O5JA 5K8MA 4X64F 1B0TA 3C14B 1XTZA 2V4QA 3D68A 1X4FA 2HMIB 1SJ1A 1YI2S 2CADA 4UTGA 3D66A 1S1XA 4K50A 3J7YI 1X4BA 1C1CB 1LK7A 2B5JA 1U0SA 3CCUS 1JLBA 4KGXB 4FYDA 2ZE2B 1VRUA 3LAKA 2MYFA 3GFZA 1G7CB 4K0KF 3EYZA 3BYPA 1T9XA 2CZ4A 4ID5B 4ZIWA 1N5YB 5T14A 3UVJA 2OPSB 2N3OA 2CPHA 3ENWA 2OH2A 4O23A 1M5SA 4EMDA 1UEVA 1X5TA 3K17A 4DV3F 3J81U 4J9KA 3NGTA 4W92B 1URNA 1QVFR 3D4JA 3K5PA 4NLVA 3GP9A 3THTA 1J5EJ 4YR3A 4LF9F 2EC0A 4RW8B 5DM7Q 1RT5B 4O4GB 1R0BG 2NUHA 2KJWA 5EDWA 2ZEJA 2WONA 4C8YA 1L3KA 1X4EA 5HO4A 2YKPA 2BKPA 1X9WA 4CP5A 3W5YA 5A0YB 5KFRA 5CYJA 4MAKA 3L7UA 3PYEA 3B4DA 2CNKB 4LSNA 2OIHA 1KP6A 1JXVA 2BE9B 1SB6A 2MKKA 1IKVA 2XSJB 3ENAA 2RNEA 2RUGA 3PJWA 4DS5A 3R5DA 4FXWA 1VI7A 1UA0A 1RUSA 5BJRA 1CC8A 3OFGA 1Q16B 3EPGA 4ICLB 4FS2A 3ZZPA 1PBUA 3D1OA 1S10A 1HW8A 3KUEA 3NMAA 2UU9J 1X4DA 4D3HA 3G6YA 1JLQA 1UAWA 3AODA 4DN0A 3ZNJ1 1SUQA 4U67Q 3VWSA 4DL2A 5IWAF 2HQGA 2QA4G 4ELUA 4QU7A 1UVKA 2MZRA 3QGHA 4V1Ak 4JYAJ 3G86A 1Q53A 3OT9A 2CPIA 2B8QA 1SH3A 3CT9A 4ZVFA 5E0OA 3W2VA 2J6SA 4X4RA 2IM0A 4DF8A 2KDOA 4YR2A 3BDEA 1RTDA 2WB1D 2E5LJ 5DQGA 3HI9A 3P5TL 4TQSA 5A8RA 1LXJA 1FK9A 1XN9A 1OQ6A 3KHRA 1F1BB 3DLBA 2H4YB 5HP1A 2DHAA 1E6VA 1QUPA 4FNIA 3TUPA 1A6LA 3QRQA 5F8MA 1S6PB 1EARA 3H7HB 2FTRA 3W63A 1DARA 4ZPBA 2A6MA 3EZUA 1Q4RA 3FRZA 1SJQA 2ZH5A 2UXCF 1AFJA 3DC2A 1QAYA 2WRMA 2AJ2A 4YDXA 3Q8RB 1TELA 3HP6A 2DHGA 1KEKA 1RHJB 2B4UA 2HHSA 2QMXA 3CCJS 1WC4A 3SYZA 2GIFA 3QGGA 3OTEA 4PPDA 1P6TA 3GIJA 3TX8A 2ZWOA 3V4IB 1YGYA 4A8YA 3LA0A 1J27A 2CNNB 1UVMA 1TP7A 4QR2A 3BREA 1UWBA 2RRBA 2F5GA 1PG5B 4DU8A 3AT1B 3BO2A 2IRXA 3D2WA 2L3MA 5D6GA 3A8KA 1X31C 2J8AA 3MM5A 1HBMA 3UDVA 5ETLA 1WF0A 3DDNA 2CPXA 1FHTA 2J9DE 1DLOA 1NJYA 3ZTSA 3CJKB 2ZJQQ 2ZJRQ 3FBCA 3DYAA 5T41A 2GMJA 3I9ZA 2HRUA 3GCXP 3VZIA 3DHXA 1HNIB 4HHJA 1N33J 4P6QA 1DBDA 1VIOA 1BGXT 2IJFA 3CJ0A 1JIHA 4LRAA 2HWTA 1ZAVA 2CJKA 4WP3A 4M5LA 1IWGA 3HVTB 4NEZA 1S79A 2AIRB 4GKJJ 1SV5B 1VC5A 1AXQA 2KFNA 4XTTA 2W2QP 1LNQA 4WFAQ 1KLMA 2NR0A 1IBLJ 3VTIA 1R7IA 4O4RA 2EKYA 1F3FA 1OMSA 2QE5A 1I3OB 5CCMA 4HACA 2A1BA 4RW6B 5L46A 5KFEA 2BR0A 3H5XA 5LMNJ 4L74A 4LIRA 2JEGA 4USIA 3PJXA 3P3DA 5LL6d 4K4TA 1NBEB 3TOQA 1FJGJ 3Q83A 2UUAJ 4OZ1A 2QO3A 3PX6A 4X4SA 1QTMA 4OX7A 1HFEL 1NNDA 3BSOA 1TKTB 1S9EA 4H4KA 3MMJA 3BSNA 3HHDA 4OYIA 4CNYA 4ED1A 4ER8A 3QLHB 4DUTA 4DZDA 1HNWF 1LKZA 3CJSA 1RQ0A 4FBUA 2HSEB 1S6QB 6FD1A 2EFPA 2JHEA 1BMQB 1V3SA 3M8PA 4P10A 4BBYA 4ZIVA 4FN5A 1VJWA 2KHCA 4NL5A 4UZBA 4IKAA 3UDEA 1XK8A 3T1YF 4RNFA 3FKBA 1TFWA 1EJ7L 3TW0A 3OL7A 3RAMA 3UW1A 1ZM9A 4AFFA 3CUNA 3OTBA 3M9NB 5D3GB 4O0IA 2AYBA 5M2RA 1RTIB 2QSWA 2PFDA 1GX5A 1TKZB 1HQUA 1BD6A 5CYQB 1B3TA 2OPRA 2IAJA 2KXNB 2DNQA 4KFBB 2XY6A 2EG1A 2HPUA 3NBPB 2L9WA 2HWHA 4G1IA 1CULB 3FC9A 2OPPB 3T5LA 2NREA 3AFGA 4JI5F 2XB2D 1YJ9S 4GC7A 1YTYA 1U48A 1FVQA 4DV6F 2YPYA 1WHYA 3H42A 2D7SA 1CJKA 1WC6A 2WOMB 3DOLB 4IO1A 2A18A 1DY3A 4J90A 2UXBF 3CE8A 4ECYA 4B3SF 2NXCA 4ZVUB 1ZH5A 2XCAA 1WUUA 1I94J 1K1SA 1R43A 1VMBA 3THVA 3D0HE 4IFYB 5AE1A 2E1PA 2KN4A 2P9EA 3PFOA 3X3UA 1AZSA 2K2PA 3DLKB 2XS7A 1U24A 3TUZC 4MKYA 4LFAF 5DGAA 2BE7D 3VR1A 5K14B 2DNGA 3POTA 4W98A 2DPJA 1OS5A 1H6KX 5EWEA 2R7WA 2DISA 4ZPAA 3GIIA 4F3OA 1C4AA 2GJFA 4H4MA 3I56S 4EYIB 3EUNA 2ROGA 4BDPA 5ETRA 1IKYB 2FLLA 4B9UA 2L48A 2E1MC 1HWLA 3S7RA 2X1FA 4NCAA 1U25A 1U02A 5SUHA 2XO7A 3W2WA 4DV5F 4UUXA 3NWGA 1U2RA 1RT7B 3GE9A 2HQDA 3FSXA 1O0PA 2IC3A 3I5AA 5KFIA 2DGWA 1Y0HA 1FKAF 2ROPA 1HBOA 3QYYA 1MWYA 4OI6A 4CH7A 3GJRB 4X4OA 5KFUA 4JI2F 4LF6F 2CKWA 2EFQA 3DLHA 2JSXA 4KGZB 4LFCF 2MPUA 3SDEB 2FQQB 3OJUA 4CQ1A 1FRKA 2IVYA 4ZVRB 4R0EA 2DR8A 1T11A 1FDAA 5CQGA 1XQIA 3EPIA 4RU9A 5I3PA 4B3MJ 1NK6A 4C9DA 4L3KA 2V2ZA 2ZUAA 3PYDA 3BDPA 3IRWP 4QIFA 1RISA 1TKXA 1HIYA 4DPOA 1S5ZA 2RS8A 3V6DA 4LFBJ 2UV8G 4H4OB 4UOHA 3M8RA 3JTPA 1RT3A 3BO3A 1BY9A 1SQEA 1JJCB 2LEBA 3RG6A 3IS9B 1FJEB 3CCZA 2W9BB 3BGFA 1IM6A 1C0UA 4X64J 3CMAS 1Q1KA 1S0OA 5KFPA 1MLAA 2RKIB 3OXGA 4F4WA 2GAGC 2LFVA 3H98A 1DTQB 2ZDPA 4USKA 4IR9A 2Z0GA 1WTBA 4CNZA 2R7TA 4C11A 3JYTB 5D15A 4KO0A 1JKHA 4LF8F 2I1RA 3CWJA 2EFVA 2DHXA 2GC8A 4NLXA 2ZD1A 1Z4UA 3A8IA 2H9ZA 4TKTA 2IY5B 2NXEA 4FKYA 2KH9A 2WSEC 4K0KJ 3JTNA 5JUMA 1E6YB 3ZTQA 3LP2B 2OMLA 1U1PA 4MKBA 3K5MA 4ZVGA 4Q2MA 3V6HA 3HULA 5D0RA 1RYSA 3GONA 2PSZA 1RWKB 4DV3J 5IT9Y 1H7XA 2MLXA 3RRKA 4Q8EA 3CW2C 1H73A 3JAMU 3B8HA 3KHLA 2RQKA 2K06A 4PWWA 4HHHA 9RUBA 2CJBA 1RBOB 1VJQA 4IH7A 3N79A 4WE1B 2YH1A 3KLVA 1RTHB 5HROA 5T7LB 5KG7A 4F0MA 4DSFA 1VDHA 4N77A 4IG0A 4YB5A 1XNQJ 3PYFA 2LA4A 5KFOA 2VFTA 1FRMA 4NA1A 4OI0A 4NI2A 2ZNYA 4U6PA 4CH0S 3TANA 5EUHA 2XLIA 2HMIA 5MAOA 2Y9HA 1EP4B 5I42B 4CO4A 2C3YA 1K0TA 1ULRA 2IJRA 1C1CA 4DV4F 1JLEA 2EBEA 4IG3B 3DRRB 3I0SB 2NSCA 3A3PB 3CF5Q 4ERDA 3J7A1 4ZLLA 2X51A 3VHQA 2WK4A 5CXTA 3QT6A 1C4CA 4A8FA 3S6EA 2AV5A 4OJHA 2YPZA 2OPSA 1TUWA 4X4TA 4ZLNA 2UUBF 4WU2A 1YJUA 4DSJA 1VISA 1Q81T 2CJAA 4O3RA 5ETOA 2MLZA 4WKRA 1UP1A 3GJQB 1EB0A 4ECSA 3MCMA 4TLQA 4OX9F 2RQ4A 1CLFA 1UJ6A 1FE4A 4PG7A 3QZ7A 1S6UA 4ED8A 3DHWC 3KMQA 3VAJA 3MUMP 4RW4B 1AB8A 4J9RA 3K59A 5LXYA 4CO1A 4F0KA 2GJ2A 4YQWA 4IRKA 3P49B 3DXSX 5K8NA 1FWKA 3KLIB 2GX8A 3I0RA 3P45B 4OZLA 1T7PA 4I2PB 1U2CA 4Y2AA 2RHQB 3FSIA 4HI1A 3V81A 3KTQA 2UXCJ 2FJVA 2V8HA 4Y3CA 3UR0A 4U7CA 5A8WA 1HNVB 3V6JA 3NS6A 1OY8A 3DNCA 1AFIA 2VPZB 1PBAA 2FVSA 2AJ4A 2MQLA 1UZDA 2NPFA 1ICEB 3UO0A 2E9RX 2DJWA 1VBYA 3N28A 4DFKA 1ACMB 4LBIA 5CH7B 1EETA 2DEIA 5ETNA 4C3LA 1ZAWA 3Q8QB 4RKUC 4KJIA 3MCOA 2CAJA 4LF5F 1ZBTA 2QC3A 3MD3A 2QX0A 4LF1A 2E5JA 5KFYA 1U09A 3MF5A 4CO0A 1BQMA 4YB6A 3TJ8A 3GYGA 1SC3B 2PEHA 1M0SA 1U1KA 2F9JA 4AUKA 3KK1A 4I68A 4ECXA 1JJ2R 4KBIA 3M6UA 2YBVA 3DM2A 3CDEA 2H65B 1KWMA 2GGPB 1S1UA 4I64A 2KHDA 4LSZB 4J37A 2ZITA 3AJ2A 2ZFHA 5F3TA 1Z2LA 5HLFA 1NPPA 4FPIA 1Q8LA 1R8BA 4B17A 2J6UA 4YN3B 2AJ1A 2YX1A 3SXLA 5F8JA 2V34A 4N56A 3BEGB 1XMOF 4A8WA 4ZP9A 1R8PA 3IWNC 1D9DA 3DLLQ 2LU2A 2CQGA 2RIJA 1VQSA 2U1AA 2QT7A 3MPWA 1U7LA 2BDPA 1P9YA 2VJVA 2B9XA 1KQFB 1NUEA 3HVWA 2ABYA 1I5OB 4HDGA 4B3OB 3VAIA 2YNHB 1WOOA 4M5NA 4Y28C 4DV0F 3D1QA 2DNZA 1VK8A 4J9QA 3NOCA 2I5JA 1SJ4P 3M2RB 3M6WA 4LF2A 4IH5A 1S0VA 1FFGB 4G1QA 3ONQA 3KLFA 2F8HA 3G6XA 1J2VA 1IKWB 2Z2ZA 2A2CA 5KFGA 3BB5A 3ETOA 3LTOA 4TLRA 4WYWA 2HFNA 3MM9B 3MEEB 4WYLA 2FUG9 3GSIA 1YJRA 2MDAA 2XWXA 1RACB 3DLEB 1JMTA 1HHSA 3DGVA 1VQNS 2ILYA 1HNWJ 3N5FA 3I96A 1O6XA 2OELA 2UVUA 4UOGA 3PG9A 4TN2A 4HT7A 4ZMMA 5GAEI 3SCLE 1EZZB 1KTVA 3MR6A 1KTQA 1BQXA 3GV5B 3CVKA 2VFSA 2DHHA 3T1YJ 4DQSA 2OAUA 1XNRF 2XMWA 2Q6BA 4OHYA 1FE0A 3FZBA 1RABB 1FT8A 1TMMA 2HQ3A 4YB7A 3O6QA 3ENVA 2J76E 2Q6CA 3EGWB 3VVTA 5FLXU 1JLCB 2YNFA 2IPOB 3PX0A 5DGBA 4G65A 2K3KA 5DM6Q 4FS1A 1T95A 4WIQA 2ACMA 3KK3B 4Y6IA 3MGJA 2FY8A 2VG6A 3EGVA 4B9NA 4JI5J 3GSDA 4MMOA 4ECTA 4DV6J 3MECB 1JJHA 4DR5F 2F7VA 5L9NA 3IRXB 2AGOA 4B3SJ 5KG4A 2CQHA 3R2DJ 3MM6A 5ETQA 4WFZA 1HPZB 2FJWA 3I4HX 2HHPA 3M30A 2ZBRA 2GIQA 3SSQA 2KM8C 2CRLA 4JI4J 4ECWA 1CSJA 4JV2A 2KZMA 1KNZA 3EZOA 2N82B 4CO3A 3T1HF 2GMHA 2C3UA 4RWXA 4ZHRB 3QLHA 4CLTA 4QYZK 3IBCB 2BJEA 5L1LA 2IA0A 3RBEA 3JSRA 1MMNA 4LFAJ 3QWUA 3JTOA 2HBRB 2R42A 1MWZA 1VQ7S 3RB6A 4WK3A 3A13A 1PYSB 1TAQA 2DYAA 2QN6B 4PZVA 4ZJLA 5EX3A 1D9AA 3DOMB 5J2NB 4WXWA 1FX2A 1VR6A 1SC4B 3BQ1A 5H9FK 1T9VA 5D4LA 5H9EJ 3AH6A 4WWSA 3VAGA 1MN9A 1TUGB 5D3GA 2EW9A 1RTIA 4K4VA 2XGPA 5JVGQ 1U49A 1WC1A 2XYPB 1X4HA 2YNGB 4DV5J 4OHWA 4GRSA 1UPPA 1UZHA 4IUFA 3DLGB 2AX1A 2EPIA 2F4VF 3LWLA 2JH3A 3G2XA 3NNCA 2BOPA 2UVRA 3BQ2A 3P8BB 2L08A 1S77D 1M1HA 3M2UA 1J5OB 5HANA 2OPQB 2CXEA 1P1TA 4JI2J 3LPYA 4A48A 3NS5A 1BXNA 1TTHB 4IDKA 4F4KA 4YOEA 1VRTA 5CABA 2JNJA 3BKUA 2HHHF 4C3MA 4ILLA 3M8QB 5AT1B 2Q79A 5KG2A 4A8XA 3HFZB 5HQMA 2ZBPA 3GILA 1F2GA 2YQ3A 3T9NA 3C6TA 5EN1A 2F4FA 3TA2A 1URRA 3ZZYA 3IG1A 1S76D 4K7QA 4DR2F 3OD2A 1LW2A 5B0DA 2HHQA 5AJ3F 3HJFA 1BHNA 1N8RT 3UCGA 2IDEA 2FLPA 2WZ1A 4MIBA 4LRBA 3M1VB 2MQNA 1U1MA 2CQIA 2VQFJ 3MURP 4NA2A 4EZ9A 2V9KA 4U9RA 3DGPB 4AQYJ 2DNNA 1YBAA 3KLEB 3CCSS 4L72B 5CHCB 1KOHA 5KFJA 3U7JA 1RT7A 5HVHA 1MG7A 1CEZA 4A46A 1FRXA 1QM9A 2XI3A 3VQSA 2LDYA 1KLNA 2W1BA 2RB7A 4KKOB 5J1NA 1FA0A 4GKKF 5IT4A 5KG3A 4RW7B 3HO1A 4CRJA 2VBZA 4X66F 2VFRA 4ZCLA 1ROFA 3BGUA 4HR2A 4E2FB 1H72C 2H4WB 3H59A 5DDQC 4R8UB 2R7OA 5C5JA 2OEKA 4Y2IA 4ZN3A 1NB7A 2BJ8A 2CA9A 2IBOA 4JV5F 4PXBA 1KQSR 3KJVA 1RB0A 4PABA 5I4MA 2L9DA 1VQPS 4RBVA 3QFWA 3CCWA 3R5JB 5DLGA 5E3AA 3KDOA 4RUHA 2JJ4D 2QIFA 3MAQA 2DGQA 2GZOA 4CLUA 2HNZB 5KFMA 3OBIA 1X0PA 2HFZA 4DL0C 1QE1B 2GHVC 4F3QA 4JI6F 4WCEQ 3C6UA 4GVBA 1BWEA 3CD5A 4MFBA 2A0FB 2M52A 2YWKA 2LQ5A 4NCGA 3D9BA 2YY3A 4WP8A 2JFKA 3BGLA 4NWBA 4G1PA 1UTAA 2HS4A 4LVOP 3CO0P 3SEOA 3WDOA 3MDFA 3CMES 8AT1B 3OQ2A 2GVDB 3C2PA 2LXUA 3IR6B 2KXFA 2ZNZA 2NSBA 4OYAA 2XY5A 3VAFA 5DG8A 1U8SA 2UUBJ 1YQHA 4FVCA 4M63A 1SJ3P 5F9LA 2HFVA 2ASJA 3HHLB 2HS0A 2CQ2A 2DGOA 1N36F 2J7WA 4J5OA 3OUYB
chains in the Genus database with same CATH topology
2C2OB 1RHRB 2H54B 3R6GB 4ZVSB 2CJXB 2FQQB 2QLJB 1RWXB 3R7SB 2CNOB 1RWVB 2XYGB 2CNLB 1F9EB 2H48B 3IBCB 4ZVRB 2HBQB 3IBFB 1SC3B 2HBRB 1RWWB 2H5IB 1RHQB 3R7BB 2QL7B 3KJFB 1SC1B 2H5JB 3KJQB 2HBZB 3R6LB 4JB8B 4ZVOB 1NMEB 1RWMB 3EDQB 2Y0BB 3P45B 3GJSB 1RWKB 3NS7B 2H65B 4DCJB 2QLBB 5K20B 2QL5B 3D6HB 1RWNB 4LSZB 1SC4B 2H51B 2XYHB 3D6MB 3RJMB 3R7NB 5IC6B 2H4WB 2C2KB 3EDRB 4DCOB 3D6FB 1RWPB 2HBYB 2P2CB 1IBCB 1RHJB 1I51B 2XZTB 4ZVUB 1RHMB 1GFWB 3QNWB 2XYPB 2C2MB 4ZVTB 3GJTB 2XZDB 1RWOB 2C1EB 1RHUB 2QL9B 2Y1LB 1QDUB 1ICEB 1I3OB 2CNKB 3GJQB 1PYOB 3R5JB 2CNNB 2CJYB 1BMQB 5IC4B 3KJNB 1RHKB 1PAUB 3GJRB 2DKOB 1QTNB 3P4UB 1RE1B 3SIPB 4ZVQB 2QLFB 2C2ZB 4DCPB 2H4YB 2CDRB 4ZVPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C2O B;  1RHR B;  2H54 B;  3R6G B;  4ZVS B;  2CJX B;  2FQQ B;  2QLJ B;  1RWX B;  3R7S B;  2CNO B;  1RWV B;  2XYG B;  2CNL B;  1F9E B;  2H48 B;  3IBC B;  4ZVR B;  2HBQ B;  3IBF B;  1SC3 B;  2HBR B;  1RWW B;  2H5I B;  1RHQ B;  3R7B B;  2QL7 B;  3KJF B;  1SC1 B;  2H5J B;  3KJQ B;  2HBZ B;  3R6L B;  4JB8 B;  4ZVO B;  1NME B;  1RWM B;  3EDQ B;  2Y0B B;  3P45 B;  3GJS B;  1RWK B;  3NS7 B;  2H65 B;  4DCJ B;  2QLB B;  5K20 B;  2QL5 B;  3D6H B;  1RWN B;  4LSZ B;  1SC4 B;  2H51 B;  2XYH B;  3D6M B;  3RJM B;  3R7N B;  5IC6 B;  2H4W B;  2C2K B;  3EDR B;  4DCO B;  3D6F B;  1RWP B;  2HBY B;  2P2C B;  1IBC B;  1RHJ B;  1I51 B;  2XZT B;  4ZVU B;  1RHM B;  1GFW B;  3QNW B;  2XYP B;  2C2M B;  4ZVT B;  3GJT B;  2XZD B;  1RWO B;  2C1E B;  1RHU B;  2QL9 B;  2Y1L B;  1QDU B;  1ICE B;  1I3O B;  2CNK B;  3GJQ B;  1PYO B;  3R5J B;  2CNN B;  2CJY B;  1BMQ B;  5IC4 B;  3KJN B;  1RHK B;  1PAU B;  3GJR B;  2DKO B;  1QTN B;  3P4U B;  1RE1 B;  3SIP B;  4ZVQ B;  2QLF B;  2C2Z B;  4DCP B;  2H4Y B;  2CDR B;  4ZVP B; 
#chains in the Genus database with same CATH topology
 1KKH A;  3HSZ A;  3KOA A;  1GEH A;  2RHS B;  1QSS A;  2XMK A;  3AD8 C;  2KI2 A;  1VBK A;  4ZCM A;  3HT3 A;  5M2U A;  3W61 A;  2E44 A;  2C3M A;  1G2E A;  1JLA A;  4EYH B;  1S6O A;  3ZXW A;  2O66 A;  2V68 A;  2HGN A;  5T7L A;  1MRO B;  4HH1 A;  2UXD F;  3FZ2 A;  1FWL A;  3MMB B;  4JP8 A;  4OYM A;  1R31 A;  3PIP Q;  4JI3 F;  4QW8 A;  4ECU A;  3AHP A;  1NCL A;  2G0J A;  3C19 A;  1YJN S;  3MPY A;  2NPI A;  1LWE B;  2W25 A;  3FBF A;  5GVQ A;  2DH9 A;  2P2C B;  3W9J A;  4ES1 A;  2J9E A;  1CJT A;  2QMW A;  4MJK A;  2YXL A;  4WFN Q;  1RTJ B;  3HM9 A;  4PQU A;  2ALY B;  1PC4 A;  1TMJ A;  1WAC A;  1BQN A;  1TK0 A;  2K7J A;  1K1Q A;  3QAE A;  5HQ8 A;  4QWA A;  2VU5 A;  4NRT A;  1J5E F;  2WVC A;  2HND A;  4LMZ A;  5L1I A;  3DRP B;  1CBK A;  4DUZ J;  3PZP A;  1NZ8 A;  2XTJ P;  2XMA A;  1W2I A;  3L09 A;  4P71 A;  3KJQ B;  4YB1 P;  2CPF A;  5J2Q A;  4DPW A;  2EFN A;  4OI1 A;  3ICL A;  1FKO B;  1MU2 B;  1SIZ A;  2HVI A;  4MK8 A;  2DIV A;  2XZW A;  4CLF A;  2OUG A;  4DR4 F;  2LEA A;  2WSC C;  1U1Q A;  2YTC A;  4RW4 A;  1D3W A;  3G6E S;  5HK4 A;  4F0H A;  1N6Q A;  3B4M A;  1SC6 A;  1WEZ A;  4P74 A;  1PJ7 A;  4I6A A;  4TYA A;  3KLI A;  4IR1 A;  1VQ6 S;  5D0G A;  4I69 A;  1XMO J;  5J2P A;  1C1B B;  4XPE A;  1NH7 A;  1RAJ A;  5EGY A;  4L3N A;  2PMW A;  2FHM A;  2BKO A;  2ZH4 A;  1KVI A;  2MKJ A;  2QYG A;  2GW8 A;  1HNV A;  5KTQ A;  2QLJ B;  4ZOS A;  1FFW B;  3LP0 A;  3R7S B;  4CLP A;  1U1O A;  2DT9 A;  3M6V A;  2UV8 A;  3GB0 A;  4JYA F;  5F9N A;  1LWF B;  4R5P A;  1V6H A;  4OLO A;  3UCZ P;  2VQE J;  4DV0 J;  1P8G A;  3KLG B;  5JVH Q;  2A2D A;  5CZV A;  4J91 A;  1U1L A;  1ZA1 B;  5KFQ A;  2FJB B;  2BMB A;  2E5L F;  1GMU A;  1F5C A;  3OTO F;  3SCJ E;  5JJB A;  4YME A;  4X62 F;  2R7V A;  2ZHO A;  2DB1 A;  1OJ4 A;  3NCR A;  5C42 B;  2PI4 A;  2KU7 A;  3C15 B;  4KHR A;  4ZCK A;  4X4P A;  4DZ6 A;  2Y1R I;  2MQM A;  1SKW A;  2BAN B;  2HQC A;  1X4A A;  3E01 B;  1JK9 B;  1T03 A;  3TAR A;  4AND A;  2GGP A;  3BPS P;  2R4F A;  1CJV B;  3LOU A;  4RUC A;  1EQM A;  4MK9 A;  2CDR B;  2VUG A;  1WNE A;  4CWB A;  3AB2 B;  3HMJ G;  4J9O A;  1HBN A;  2XO6 A;  1M5K C;  4ZPT R;  4HTI A;  3MWB A;  1NK5 A;  3CCT A;  4CYU B;  1JXL A;  1IKX B;  1JB0 C;  4ECZ A;  1XNR J;  1JNR B;  3FFI B;  2IVF B;  3GR0 A;  3GTY X;  3ISN C;  2JVO A;  3F56 A;  1UMJ A;  3F0N A;  1SL0 A;  2DR7 A;  3D0I E;  2G2O A;  2E7W A;  4WTO B;  5HJX A;  2BKN A;  4KPY A;  1NSK L;  2VPY B;  3MAA B;  5L1J A;  1REV A;  3N01 A;  1VRQ C;  1L3S A;  2VAS A;  2UUT A;  1RWO B;  3UD4 P;  2V9W A;  3V2U C;  2PDA A;  2Z2Y B;  1RT4 B;  4X4V A;  3G4S S;  4EO6 A;  2ZKU A;  1G3O A;  4DWI A;  2R8J A;  2C2D A;  2HUR A;  3WBZ A;  1MW7 A;  2R8K A;  3TA1 A;  3CD6 S;  4Y2K A;  2G2Z A;  5A2Q U;  4I7F A;  1WEL A;  3EVW A;  2V69 A;  3CDU A;  2QEX S;  3KK2 B;  1CS4 A;  1F9E B;  4L6V 3;  2XLK A;  3T1H J;  1NJW A;  1ZTW A;  3FBE A;  1SC1 B;  2AF6 A;  1Y4Z B;  1IBL F;  2VG5 A;  3R6L B;  4QR0 A;  5I3U A;  3GIM A;  2YNI B;  1FRJ A;  2DGX A;  3KFW X;  1HQE B;  2Y8W A;  3R9L A;  4DSE A;  4M5D A;  3FMB A;  2WHO A;  4NXM F;  2AHO B;  3J80 Y;  4HHU A;  5KT2 A;  3BR8 A;  5H9E K;  4XK8 C;  2DPI A;  5G4D A;  2LQ8 A;  3T1A A;  4C8Z A;  5LMN F;  1FRL A;  1Z2Z A;  2JX2 A;  1IBM J;  4R0J A;  4CI0 B;  2BQU A;  2MGZ B;  1TV6 A;  2YVS A;  4NLR A;  1FJG F;  4Y65 A;  4KT0 C;  2UUA F;  4PG4 A;  1HWK A;  2ZZM A;  1GXU A;  2KYZ A;  4YUD A;  1RTZ A;  2C2E A;  4B3R F;  4KPC A;  1PYO B;  1JLC A;  2RH3 A;  3T41 A;  2RRA A;  5C25 B;  2ZBI A;  3E51 A;  2D9O A;  5HBM A;  2GVZ A;  3DRS A;  3CJQ A;  2Q1L A;  1K73 T;  2XHW A;  1HYS B;  4B9V A;  4DX7 A;  1JLF B;  4F67 A;  4IOC Q;  1WDT A;  2EXU A;  4KV8 A;  4ZPW R;  1TK5 A;  3UR3 C;  1CPZ A;  1JLG B;  3KJF B;  1M1G A;  2BAC A;  3SFG A;  3NGK A;  2DCL A;  1NPK A;  2CQ3 A;  3RGI A;  1I6J A;  1CJU B;  3CIZ A;  4HH0 A;  5G0R B;  3O5T B;  2HHH J;  1S4F A;  1EIY B;  2YQ0 A;  2ASY A;  2F3J A;  4C8N A;  2HNY A;  4Q0B A;  3FUY A;  4RU2 A;  1RT1 A;  5C24 B;  3GFH A;  3NCQ A;  3FQL A;  2G0C A;  2I9S A;  4NAS A;  1IN0 A;  5KG0 A;  2AT1 B;  4ZVT B;  4DQR A;  3PAC A;  2LEC A;  3BZQ A;  2FVC A;  4DR2 J;  2DRB A;  3DOM A;  3NNA A;  4A8M P;  2JEJ A;  5IC4 B;  2NZC A;  3U1M A;  4Z7Y A;  3H8Y A;  3TQE A;  5F41 A;  3HHE A;  2XCP A;  4X4N A;  3M2V B;  3VAK A;  1S1T B;  5B0E A;  1LW0 A;  3TVZ A;  5J1E B;  2WBM A;  3VAM A;  2F8M A;  1S0M A;  1VQY A;  4USW A;  4ZJO A;  2PN6 A;  4DHV A;  2LU1 A;  1T02 A;  3DU5 A;  3TUI C;  4FNH A;  1G6B A;  2HIY A;  3KLH B;  2CG8 A;  4WU3 A;  3HKZ D;  5A8K B;  2XMV A;  1I94 F;  3MUT P;  2L9N A;  3CCM S;  1X7V A;  4DXL A;  3QO9 B;  1GX6 A;  4J9S A;  2M0G B;  2B0G A;  2H51 B;  2HHT A;  4K5R A;  3JQJ A;  1QD1 A;  4GKK J;  4GC6 A;  2AYE A;  1XBW A;  3C8Y A;  2VG7 A;  4X66 J;  1CQN A;  2DY1 A;  1LQ9 A;  2W01 A;  3D7S B;  3JXO A;  2R7S A;  2DCU B;  1UWA A;  2FD2 A;  2XG8 A;  4JV5 J;  5L8R C;  3D5M A;  2ATL A;  4DSI A;  4NZ7 A;  4FZV A;  3ENQ A;  1IVZ A;  2NLW A;  3ITH A;  2QSF A;  3BGR A;  3MMA A;  1FTC A;  2F9D A;  1XER A;  3MEG A;  2JEF A;  3DOK B;  1NRK A;  1PJ5 A;  3HHL C;  4GVL A;  3HHK A;  2Z56 B;  3GFY A;  1VFJ A;  1RAE B;  3VVU A;  4NYP A;  2CPD A;  1OQ3 A;  1PIL A;  1FNM A;  1HMV A;  5RUB A;  3AOC A;  1T05 B;  3S8S A;  2KXH A;  1PAE X;  3NY0 A;  5IC6 B;  3W9H A;  5KFK A;  2GA7 A;  2I6W A;  3OR2 A;  4ANC A;  1HLW A;  3DRX A;  1Q5V A;  2OEM A;  2V4J A;  3M8W A;  2B56 A;  2AEJ A;  4BWM A;  3RBZ A;  2Y1I A;  3Q89 A;  4O3N A;  4TNO A;  4B3M F;  3MCS A;  2GHW A;  1MMD A;  1TL3 A;  4UY8 5;  1NLK L;  4QU6 A;  2VBX A;  4YFU A;  3CTR A;  3SQG A;  2K1R B;  3K5N A;  4RUB A;  2LXI A;  4LFB F;  4R8U A;  3HZG A;  1RAA B;  2MZJ A;  1U0H A;  4IFV A;  3PCO B;  5C2G A;  2BUN A;  2XBP A;  1KFS A;  4M5M A;  4LSL B;  2KFZ A;  4DR3 J;  2BJ3 A;  2LQB A;  2IBK A;  5CA5 A;  1REG X;  4EFA C;  1RWN B;  3CSK A;  4F3M A;  2UXD J;  4Z7C A;  2X7I A;  3HHN B;  2BE2 A;  2HNZ A;  2HZA A;  1S9G A;  3DFE A;  1WHW A;  4JI3 J;  3BF4 A;  3HXM A;  4WPA A;  3NGS A;  3D1H A;  1KDN A;  1Q8K A;  4KHP J;  4KY3 A;  5GME A;  2LA6 A;  3AB4 B;  3Q0A A;  4C8M A;  3Q8U A;  5HJY A;  2KVI A;  2CPJ A;  5THW A;  1RYR A;  4B9T A;  5CCL A;  2QLX A;  2E29 A;  1HNZ F;  2DIU A;  2C22 A;  1YKW A;  3RR7 A;  2XMJ A;  2W4C A;  1Q8I A;  2GVD A;  4ZVS B;  2HFS A;  3A3O B;  5ETT A;  1TVR A;  2OD6 A;  2FHK A;  3IMQ J;  1RHQ B;  3CC4 S;  1RA7 A;  3TEG A;  5DG9 A;  5ETM A;  2XGQ A;  1T9W A;  5E41 A;  4PPZ A;  3HHL A;  3OL8 A;  1S1X B;  1XNQ F;  4A4J A;  1FD8 A;  3SSR A;  4ETZ A;  2EK1 A;  2B5J B;  2MXY A;  2FJX A;  4DR4 J;  3PR4 A;  1QVG R;  1VRU B;  1SBR A;  5HN0 A;  2YKO A;  5KFA A;  4J9N A;  3R3T A;  1YRU A;  1C2P A;  2JZ5 A;  1VQ9 S;  3UVJ B;  1UW4 A;  2ZH7 A;  3DLJ A;  3H5U A;  3L95 X;  3W9I A;  3CXC R;  1KN6 A;  4GO5 X;  3GMG A;  3C46 A;  2J9D A;  2V94 A;  4OI2 A;  4URQ U;  2G1D A;  3RRG A;  3JQK A;  4ZVP B;  4GO7 X;  5EWG A;  3Q2T C;  1LWE A;  4DR1 F;  4U8Y A;  1R0C B;  5HSP A;  3OLB A;  3OR1 B;  2V67 A;  5KFF A;  4OHZ A;  2Z57 B;  1SQF A;  3SZ2 A;  3TVK A;  2ZH6 A;  1UW9 A;  4JI7 J;  2WON B;  1OSD A;  4DMZ A;  5D8H B;  2QA2 A;  4F2R A;  4JI8 J;  1RLD A;  2Z30 B;  2YH0 A;  2ZHA A;  4YS2 A;  4DFP A;  3D6F B;  3QFH A;  4LSN B;  4Y00 A;  4I2Q A;  4C48 A;  3OTO J;  1IJE B;  3AD9 C;  3QQC D;  1TL7 A;  1XR6 A;  1IKV B;  1SL1 A;  2WW4 A;  4LIW A;  4X62 J;  1FD2 A;  4KSE B;  4PYD A;  3LW5 C;  2FLO A;  4USV A;  2VDH A;  2MQ8 A;  4B3T F;  2CJY B;  1LOU A;  2HWI A;  2Z58 B;  5KFW A;  1PGZ A;  1S9F A;  4PWD A;  4KGM A;  2DNP A;  3DI6 A;  4B08 A;  2VKZ G;  3N6N A;  3PEH A;  1VC6 A;  1B70 B;  1U47 A;  3R6G B;  2O3D A;  1AYE A;  3K89 A;  2BX6 A;  3BPD A;  1JLQ B;  1Y5L B;  1KHV A;  1SUQ B;  2QJ3 A;  1F2H A;  1RWU A;  2PE8 A;  3TX0 A;  2V2Q A;  2BJ9 A;  2WB4 A;  5B7W A;  4ID8 A;  3RB4 A;  3CDB A;  3ISZ A;  1RK8 A;  3MI7 X;  1C0T B;  5F8I A;  5KT6 A;  2YX4 A;  2Y3Y A;  3LQV A;  3LGN A;  3W2V B;  1GMW A;  3KNG A;  2DIT A;  1YJT A;  3BYR A;  3FBB A;  5DQH A;  1ZAX A;  2MKC A;  1RTD B;  5A8R B;  2RQC A;  1HWJ A;  5CYM A;  1FKP A;  3RAX A;  3HJV A;  3L3C A;  1FK9 B;  5IS2 A;  1LFW A;  1ZTT A;  1R27 B;  4CO2 A;  2ZC3 A;  4RNN A;  5HP1 B;  1QJH A;  1E6V B;  2XNQ A;  4FP9 A;  1YX2 A;  3BQ0 A;  4UZC A;  3TZW A;  2CIM A;  4LBP A;  1DFD A;  3A8J A;  2K7K A;  4OX6 A;  2CJQ A;  2JEI A;  1D8Y A;  3UQS A;  2V0N A;  3BSC A;  1VQ5 S;  3TYT A;  2MQQ A;  2IHR 1;  1WD6 A;  1R0A B;  2AGP A;  2LMI A;  8ATC B;  3AOB A;  3JQM A;  2KRB A;  2DEJ A;  2UVW A;  3CCE S;  4JB8 B;  3RBD A;  3N6M A;  4UT4 A;  4FYV B;  3HLU A;  3R1H A;  5B0F A;  4DS4 A;  2B3T B;  5DZ7 A;  3BGO P;  3D0G E;  2R7R A;  3V5R A;  4F36 A;  3ETM A;  4CTA A;  1NH8 A;  4NXM J;  3G9C A;  3HF5 A;  4YDD B;  4F4Z A;  4QQB A;  3LP1 A;  3MMC A;  1RAH B;  2R8I A;  1S1V A;  1IKX A;  4TU8 A;  2M9K A;  3I4P A;  3MM5 B;  1HBM B;  2YWG A;  2OO4 A;  4C97 A;  1TUV A;  1DLO B;  3EE3 A;  1N54 B;  1WF1 A;  2IIH A;  2HIQ A;  4NEY A;  4B3R J;  3DYA B;  3PW2 A;  1N5T A;  2B6A B;  1RCX B;  5HL7 Q;  2ZOF A;  3IC1 A;  5KFB A;  1JQG A;  4RNH A;  3EZ5 A;  2W9C A;  1NO8 A;  4FYY B;  4PKD B;  2MZQ A;  4J9P A;  4YEA A;  4E8U A;  2DH7 A;  3PKM A;  2KKH A;  4NRU A;  2Z2L A;  1M5O C;  3BN4 A;  2YKA A;  2D1C A;  1RT4 A;  3UI3 A;  1RZM A;  1BUX A;  3GLJ A;  1M90 T;  4DOZ A;  4CDI A;  2CYY A;  4K4S A;  3W1Y C;  4OZJ A;  3CCL S;  5E3R A;  1VQ4 S;  1NK0 A;  2BQ3 A;  3WIU A;  1Q86 T;  2KT2 A;  3TAM A;  3PIO Q;  2OHD A;  4HAC B;  3ZZ0 A;  2JFD A;  2MTL A;  3NL0 A;  1RA6 A;  1RCO B;  1VHF A;  2P6S A;  4WF9 Q;  4OL8 A;  4KIA A;  4RBT A;  3IWX A;  1D0E A;  4LF4 F;  3RW6 A;  4OV6 A;  3ET6 A;  1GT8 A;  4WBF A;  2EG2 A;  3KUG A;  1LEO A;  5KFC A;  3LH2 S;  1M1K T;  4KQZ A;  3HSG A;  4ECQ A;  2EI5 A;  4O44 A;  1RWX B;  2HKE A;  2IYG A;  3J81 j;  3QPI A;  1RWW B;  5DS7 A;  3K8W A;  1TL4 A;  3A8E A;  4PCQ A;  2V8P A;  1GQE A;  3CO9 A;  1WG5 A;  4BCA A;  2UUC F;  3O1L A;  3LPE A;  3HD2 A;  4F25 A;  1PYT A;  4DX6 A;  1OY9 A;  1U6B A;  4JUZ A;  3I87 A;  5CZX A;  4Q43 A;  5K8O A;  4E98 A;  1AA1 B;  3R5G A;  2BQR A;  1Y5I B;  3BSA A;  4JI4 F;  5FDL A;  2V50 A;  3QRP A;  2EBG A;  3A1Y G;  1VLO A;  4URS A;  5D0E A;  1HQ2 A;  3H2L A;  4EU0 A;  2DVI A;  2C28 A;  3QNW B;  2LEP A;  4O3Q A;  3WC2 A;  2F8E X;  1OY6 A;  3MM7 A;  3ZO7 A;  2AYG A;  4FYX B;  3CD0 A;  3B54 A;  1RHK B;  4MH8 A;  4RLE A;  5K5M A;  5GAG U;  1BE4 A;  1FER A;  2GML A;  4NA3 A;  1HQU B;  2OPR B;  2CQP A;  2IAJ B;  4UUW A;  2AJQ A;  4ZPD A;  2DXE A;  1Y7P A;  2YKM A;  1SJF A;  4TY8 A;  3MOJ B;  3FEY B;  3K2Y A;  2ASL A;  3GG1 A;  3N0V A;  1VS3 A;  2M4M A;  3UCU P;  2KRR A;  1WHV A;  4TU7 A;  2IMW P;  4D3G A;  1RT6 A;  3PHT A;  4YR0 A;  4RW9 A;  1CJK B;  1WF2 A;  2GFF A;  2XMT A;  4ZLJ A;  2VFV A;  2OMO A;  1IBK J;  1FXD A;  2N4C A;  1VYA A;  3PDN A;  5KFT A;  2E5G A;  1K9M T;  8RUC A;  1L3U A;  2R8H A;  1N5Q A;  1H38 A;  3QAT A;  4KAI A;  1PSD A;  2MKH A;  3QIP A;  3VF0 B;  1VK3 A;  4A8S A;  2PEB A;  3AY0 A;  2MJN A;  4ALZ A;  1AZS B;  1GFW B;  2ADC A;  4AL5 A;  3SSS A;  2ZBC A;  2C42 A;  4FF1 A;  4DSK A;  2XLJ A;  1S1W A;  3GIK A;  4C2M A;  3EVM A;  3BH6 B;  5ADZ A;  2BJ1 A;  1R89 A;  4ZKA A;  4M94 A;  2GQC A;  1O8B A;  4XAK A;  1VQO S;  3QAU A;  3M9M B;  3HKW A;  2R8G A;  4HKQ A;  5KFL A;  2CJ9 A;  4H4M B;  3NAI A;  4OHV A;  2HG4 A;  4B9L A;  4EBE A;  4OYZ A;  4UQG A;  4ENO A;  3EX7 B;  4P2F A;  2PD1 A;  1YSJ A;  4A8O A;  1YWX A;  3IP0 A;  3C16 A;  1VBX A;  1F9H A;  4PG6 A;  1K0V A;  5FJ4 A;  3GJS B;  4NLT A;  1YRT A;  3OL6 A;  2VDI A;  2Z4P A;  3PRD A;  2HLT A;  3EXC X;  2AMC B;  3G8Q A;  2IA6 A;  2WCX A;  2IC3 B;  2VQF F;  1IR1 A;  2MKS A;  3MM8 A;  1TL1 A;  3J81 Y;  1JNZ B;  7FDR A;  5HMW A;  4AQY F;  5LSR A;  5KG6 A;  2BAB A;  1RU1 A;  1V5V A;  2C2M B;  3GJT B;  2B7B B;  2HHU A;  1B0V A;  4S0M A;  2I38 A;  2PGC A;  4BHQ A;  3EGZ A;  1EKS A;  5D77 A;  3DKD A;  2IRY A;  3W8P A;  2HVD A;  3JS9 A;  1ZYQ A;  2GQ2 A;  3TJ9 A;  1N5V A;  3FJ2 A;  2QG9 B;  5F8L A;  4ED7 A;  5J2M A;  1PCA A;  1HNZ J;  4JBC A;  1TKX B;  2L41 A;  4Y2C A;  2RE1 A;  5KFX A;  3V6D B;  5IM0 A;  1R8C A;  3PJ9 A;  4RPF A;  3JSM A;  4MIA A;  3GG0 A;  2DXD A;  2DRD A;  3R2C J;  1S0N A;  4JV1 A;  1NKC A;  2LXF A;  4OLP A;  3GU0 A;  1LWC A;  5F0U A;  4F04 B;  1T94 A;  2QL5 B;  1C0U B;  3FCH A;  3RJM B;  1DQ8 A;  3CJ3 A;  2E1R A;  4K4X A;  1LK5 A;  2KVQ E;  3HVR A;  4KR0 B;  4C11 B;  1U2F A;  3FCW A;  1DQ9 A;  3M32 A;  1JKH B;  5IT0 A;  1F0X A;  2IFX A;  4C8L A;  1KFD A;  3E3X A;  3TO8 A;  2FY1 A;  3FQK A;  2ZD1 B;  3MTK A;  1L5U A;  4LBH A;  3C14 A;  1TK8 A;  2OSQ A;  4LSL A;  2ZKT A;  2PI5 A;  5ITH A;  2PMH A;  2OP5 A;  2R2S A;  2GAH C;  3MPV A;  3K8V A;  1QSL A;  1Q7Y T;  2G13 A;  1HHT P;  5KT4 A;  3J7Z T;  1TL5 A;  2C2O B;  5KFN A;  1GNK A;  3IM8 A;  5AXL A;  2MZS A;  2ZBQ A;  2FC9 A;  2ZE2 A;  2FGC A;  2FLN A;  2E5I A;  2GS8 A;  3C3L A;  4K59 A;  2BRK A;  4L76 A;  1GAO A;  1A9N B;  2CQD A;  3ZTP A;  4ID5 A;  2FDN A;  2KTQ A;  1N5Y A;  4DR1 J;  4TY9 A;  3AAW B;  1SKS A;  5LMU F;  5HQL A;  4P2M A;  3GV7 B;  3PNI A;  2MKI A;  4QWB A;  2AP6 A;  3IBW A;  4QPX A;  1IJF B;  3CUL A;  1Q0N A;  1FVS A;  4C7Q A;  5HRO B;  5KFZ A;  3K58 A;  2HS3 A;  4IG0 B;  3I55 S;  4CLK A;  4F4Y A;  3Q2S C;  1VLY A;  2U2F A;  2IM3 A;  1VIX A;  1SKU B;  4RW8 A;  3H5Y A;  1Q7L B;  1RT5 A;  4O4G A;  2PA3 A;  1WSV A;  2AEF A;  4C6A A;  1NKE A;  4DQP A;  2X3G A;  4F4A A;  2HW3 A;  1RAF B;  3SCI E;  2MLY A;  1IWA A;  3P4U B;  4B3T J;  3TRG A;  5A0Y A;  4JV0 A;  1NHU A;  4Z2X A;  1JLE B;  5KT3 A;  1N32 F;  1BWV A;  3QWP A;  3P6Y C;  5U47 A;  2BRL A;  5D78 A;  2XSJ A;  2GV1 A;  2ZH3 A;  3KUH A;  2NS1 B;  4I0W A;  2W8L A;  4OZ3 A;  1N56 A;  4PQA A;  3ISN D;  4ICL A;  2OD4 A;  4WK1 A;  5F0W A;  3DRY A;  5K20 B;  4ED5 A;  5C7P A;  2NYH A;  4AD6 A;  4HEA 9;  4OYP A;  4J9U E;  3HD1 A;  1RT2 B;  1P27 B;  4NMX A;  4PUO B;  2J6T A;  3KMS A;  4OV1 A;  2EK6 A;  3OR1 A;  5KOX A;  5ETK A;  3DN9 A;  4NZ0 A;  3R5C A;  4RR5 A;  4P52 A;  3HFV A;  4DUZ F;  2EFG A;  1M5P C;  4A8Q A;  3QRR A;  3AXM A;  4DDF A;  2W4D A;  4HI2 A;  1UFK A;  2J9C A;  3EJM A;  1FNX H;  3B6B A;  1YK9 A;  4M1K A;  3EMT A;  3I0R B;  5IT9 U;  1PIE A;  2D69 A;  3DU6 A;  3OXF A;  2ZWP A;  4ANE A;  5L1K A;  4QIV A;  3IGV A;  2VHG A;  4UY8 T;  3ZZO A;  3SQO P;  2ZOM A;  3V81 B;  2CUY A;  3HSJ A;  5A8W B;  1DTT B;  1WOP A;  5BR8 J;  2CQB A;  3CCV S;  1S6P A;  2R9L A;  3EGN A;  1UCN A;  3MR3 A;  3HPO A;  3IR5 B;  3PRB A;  1S97 A;  1KQK A;  4DR7 J;  2P9C A;  1WEX A;  4NXN J;  3JB9 k;  2CQ4 A;  2VON A;  2JLG A;  2M70 A;  3PW4 A;  5IOL A;  1FF2 A;  1H7W A;  1EET B;  4DLG A;  2POK A;  3O3L A;  3UPF A;  1OYD A;  1MNE A;  4DV1 J;  2VOP A;  2FHO B;  4U7U D;  4WKY A;  1C0T A;  3KWM A;  4M5H A;  4XO0 A;  2VQE F;  1BQM B;  5IQQ A;  3PY8 A;  3KK1 B;  3V4I A;  2C2Z B;  3RW7 A;  2WAQ D;  3OVB A;  1U1N A;  3LWM A;  1Y5N B;  3R5B A;  5GMK a;  2LQ9 A;  4DBQ A;  2CDQ A;  5SZT A;  2GCF A;  2FGO A;  3DM2 B;  2NZ4 A;  2XY7 A;  4ECV A;  2VOO A;  2VC0 A;  1U26 A;  1S1U B;  5ETV A;  2VBY A;  4DPU A;  4X84 A;  5HLF B;  4ETX A;  3V6K A;  1FDN A;  3CJK A;  4L73 A;  4MIW A;  7AT1 B;  1NB2 A;  2DY9 A;  3NG8 A;  1YBT A;  4H4K C;  2BJ7 A;  1H3D A;  1HNI A;  4A47 A;  1UJ5 A;  2HLU A;  3TZZ A;  2DGV A;  4C0B A;  2N3L A;  4KRW A;  3IGN A;  3L7P A;  1RHM B;  1R0A A;  1HWI A;  3M8Y A;  3HVT A;  1S59 A;  1NPR A;  1SV5 A;  2DR9 A;  2GQQ A;  1H74 A;  3LAM A;  3FEX B;  3A12 A;  2FJE B;  2DNH A;  1YDL A;  1RAI B;  4CIO A;  3QT5 A;  4LRE A;  4LF4 J;  3NGR A;  2RDI A;  2MY8 A;  1G4C A;  2ZM6 F;  1U45 A;  2O01 C;  4N8O A;  4LQ9 A;  4LQ3 A;  2I5J B;  3UN3 A;  5HMX A;  4RW6 A;  5ETP A;  1HNX F;  2F40 A;  4G1Q B;  3KLF B;  2HBQ B;  1UL3 A;  2RAQ A;  1WC3 A;  1R6Y A;  1K47 A;  3NEK A;  2BV3 A;  2IDL A;  2M5Y A;  1ZPV A;  2EVZ A;  5E2Q A;  2X1A A;  5DET A;  2B6A A;  4DQQ A;  2UUC J;  4UF4 A;  1L3V A;  4IOA Q;  3B78 A;  1M5V C;  4P72 A;  1UJ4 A;  2IM2 A;  4BLG A;  2XEX A;  4KGV B;  1TKT A;  3FGV A;  1OWX A;  3ZTO A;  2R2R A;  3UNG C;  4ZP8 A;  2E7X A;  3IO1 A;  4LF7 F;  2ALZ A;  3CJR A;  4PEO A;  3NOG A;  3H90 A;  3PHE A;  2DGT A;  3QZ8 A;  1UA1 A;  1KBR A;  1YZ7 A;  2CWK A;  3CPW R;  1TU0 B;  3FDS A;  4ELV A;  1NJZ A;  4MK7 A;  2B9W A;  2KG1 A;  1B7Y B;  1QTN B;  3KYL A;  3NAH A;  3UD5 A;  4DPY A;  3L7O A;  4NLG A;  2AEM A;  3DXB A;  3CNQ P;  2E1C A;  2OEJ A;  3MEK A;  1S6Q A;  2CJX B;  4USM A;  4RWW A;  4AYB D;  1IXK A;  2RRN A;  2YNF B;  1FNO A;  5I3Q A;  1IBM F;  3HHL D;  3MOZ A;  2EKN A;  3MFH A;  4C0O C;  3BBC A;  3Q8Y A;  2VG6 B;  3HVA A;  5DDO C;  3RZA A;  2B4O A;  1Q95 G;  1TKZ A;  1EHW A;  2M8H A;  3QGI A;  5CYQ A;  2W9A A;  4ED0 A;  4ZIT A;  2XYH B;  2RIL A;  4KFB A;  5CD4 A;  3NBP A;  4ED6 A;  1RBA A;  3R5A A;  4PRF A;  4N47 A;  1CUL A;  4MTP A;  2OPP A;  1TQL A;  3MM6 B;  2OI2 A;  5KFV A;  5BYQ A;  3O44 A;  3BKF A;  3M30 B;  3JSY A;  2A10 A;  3VV2 B;  1HKA A;  2RDJ A;  3DOL A;  2ACY A;  2WOM A;  4CCH A;  1NSA A;  1QUV A;  1YHQ S;  3R27 A;  2GO9 A;  2F65 A;  5LOQ A;  1NHV A;  1QY7 A;  3PFE A;  1RJJ A;  2UVV A;  4N7T A;  3HCX A;  2FYX A;  1N34 J;  3TWZ A;  2AJF E;  2V5H G;  1SQG A;  1HWU A;  4U7U K;  4IFY A;  3D3B J;  4LR7 A;  2BBE A;  5DO2 A;  5KFS A;  2JDJ A;  4F02 A;  5B0G A;  3DLK A;  3IBF B;  3CCR S;  2AU0 A;  4QIE A;  4NCB A;  2FHJ A;  5K14 A;  5K8P A;  3FMW A;  2CQ0 A;  1NK7 A;  4DCJ B;  2VH7 A;  3EVO A;  3ZZU A;  2RU3 A;  2P6T A;  3CMQ A;  4EGL A;  1XR7 A;  3W3S A;  1H2T Z;  1IM4 A;  2D3O R;  3BS9 A;  5KFH A;  3Q8P B;  1N0U A;  1VBZ A;  3EDR B;  4O0N A;  3RB0 A;  2E9T A;  1WI6 A;  2DNO A;  2ILZ A;  1WHX A;  1IKY A;  4PR6 A;  4ZK7 M;  2RDD A;  1U1R A;  4OJ3 A;  2YKN B;  3M2U B;  3IN5 A;  1NSP A;  1SKR A;  3JAM Y;  2HZV A;  2Q43 A;  1ARO P;  5E7O B;  1T9Y A;  1FJC A;  4J9L A;  1KVK A;  2CVE A;  4ZA1 A;  3H25 A;  1RKJ A;  4DX8 H;  4TU9 A;  5GAH I;  2A3J A;  4IDK B;  5IFM A;  1XJW B;  1Q79 A;  1VRT B;  3CDW A;  3TAP A;  4X4U A;  3PW7 A;  1Y9O A;  1HI0 P;  2VOD A;  5JXS A;  3RR8 A;  2MKY A;  4DN9 A;  2ZOG A;  2B8P A;  1XMB A;  5ETS A;  1FDD A;  2Y0S D;  3VCD A;  1VC0 A;  1KRP A;  3H20 A;  1GMW D;  3SDE A;  1NME B;  1SH2 A;  3UN5 A;  3QSY B;  2B51 A;  1QAI A;  2AWZ A;  3WC0 A;  3C6T B;  2OTL S;  4QYZ J;  3G82 B;  3QJJ A;  3IG1 B;  2HYI B;  1DHM A;  1LW2 B;  3EIC A;  3T5J A;  2M88 A;  3PW0 A;  4V19 J;  5CD4 H;  1NDP A;  3CCQ S;  4RL1 A;  3I31 A;  4H4O A;  2FJA B;  5H9F J;  4FKX A;  5E33 A;  3Q8S B;  4RBU A;  2MY7 A;  2W2N P;  3IS9 A;  4P9S A;  2PA8 D;  2A6O A;  3RBX A;  1OIA A;  3TQ1 A;  2W9B A;  1HA1 A;  2J7U A;  2KM8 B;  3AOA A;  5B09 A;  2RKI A;  3OPK A;  5A6P A;  1W26 A;  1DTQ A;  4WJB A;  2ZJP Q;  2XUL A;  1UVL A;  4I56 A;  3ZZZ A;  2FZG B;  3DCA A;  2H54 B;  2WVB A;  2E66 A;  3JYT A;  3MCN A;  1Q78 A;  1N5S A;  4N76 A;  2NXJ A;  1RP5 A;  2ZZN A;  4DL7 A;  4TYB A;  5DJB A;  2HBZ B;  1RDR A;  3CJ5 A;  3VAL A;  4B9M A;  4C8K A;  4P2X A;  1RU2 A;  2W4P A;  3WQP A;  1RGV A;  3MR2 A;  1E6Y A;  1B7F A;  4PXC A;  3D6H B;  5LMU J;  3OFF A;  3LP2 A;  2AJ0 A;  2G2Y A;  3KJV B;  2UP1 A;  4OI3 A;  3ZNU A;  3O2I A;  3IA0 A;  2IRU A;  4DV7 F;  4F2S A;  1BC6 A;  2VKR A;  2B43 A;  1I51 B;  4OZ5 A;  4P73 A;  3QMQ A;  4KB7 A;  3A3N B;  2NXN A;  1ZPW X;  2FPH X;  4KGK A;  3CED A;  3D67 A;  3DDK A;  3I5B A;  4M8L A;  1TR0 A;  4DL4 A;  4WE1 A;  3M4X A;  4DR3 F;  4U96 A;  3C6U B;  5AXK A;  4QIW D;  4GVB B;  1YBU A;  5GAD I;  1RTH A;  2FC8 A;  1KSP A;  4MFB B;  1ZM4 A;  4TQR A;  4NCG B;  4DL3 A;  1NK8 A;  3UN2 A;  4YY3 F;  4JI0 F;  2B9E A;  1KQG B;  2R2T A;  1WI8 A;  2J5A A;  1N32 J;  2OJ3 A;  2QL7 B;  2CQ1 A;  3M9O B;  3FSY A;  2BJD A;  4IRC A;  4KHP F;  2IM1 A;  2HVE A;  2Y0B B;  1I1G A;  2MQO A;  3VQT A;  1EP4 A;  5IZH A;  3NS7 B;  5I42 A;  1KHW A;  1VQ8 S;  3ILO A;  1S4E A;  2N7C A;  4C98 A;  1N4L A;  3NGD A;  3D6M B;  3W5Z A;  1X5P A;  2CPY A;  4IG3 A;  3DRR A;  1H2V Z;  3I0S A;  4DJB A;  2W7A A;  1D09 B;  2P9G A;  3CJ2 A;  3CJT A;  2VA2 A;  4ITS A;  3WIV A;  3GZ7 A;  1R3N A;  4N8N A;  1W7W A;  4K2J A;  3EM1 A;  3Q22 A;  1UVJ A;  4LF9 J;  2V8D A;  2VJU A;  2R7U A;  4AT1 B;  4ES2 A;  2PMZ D;  2XS5 A;  2XI2 A;  3SIP B;  1JLA B;  3TNV A;  3TUJ C;  1DUR A;  5IXU A;  3T5H A;  3ELH A;  1HI1 A;  1JJ4 A;  3PX4 A;  2DO0 A;  2X3D A;  4F7V A;  1FDB A;  4IOB A;  4PG8 A;  3RYL A;  1UVN A;  2FB0 A;  4DG1 B;  3AJD A;  2AD9 A;  2KT5 A;  2ROE A;  3CC7 S;  3AA9 A;  3MPD A;  1MWQ A;  3PXG a;  1UEK A;  1CJT B;  3SMZ A;  4ILR A;  2RF2 B;  1H0H B;  5KT7 A;  1PO6 A;  2FZK B;  4PQU B;  1TFY A;  3GPA A;  1V3Z A;  1BQN B;  4I2P A;  2NYI A;  2KT3 A;  1RLC L;  5KFD A;  3K7R A;  3ULH A;  5BYR A;  4OJG A;  4M5I A;  1NJI T;  2AYM A;  2QV6 A;  5IWA J;  2HND B;  2HHW A;  4OJ1 A;  2E7V A;  4U8V A;  4QPT A;  5E3Q A;  4JI7 F;  3LGH A;  4AXJ A;  5LM7 E;  5DQI A;  1RT2 A;  2G4B A;  3ADA C;  4JI8 F;  4PUO A;  5J2Q B;  4UQT A;  2CNO B;  2ZH1 A;  3T3F A;  1SVD A;  1SXL A;  2ATC B;  2IJN A;  1KON A;  4WFY A;  3A4T A;  4ELT A;  1CC7 A;  1EQ0 A;  2WSF C;  2RD5 C;  4J9M A;  3H4B A;  1NZA A;  4UOF A;  3N6L A;  1QAX A;  3PYG A;  1N6Q B;  3BKT A;  2RSQ A;  1KD1 T;  1Z1Z A;  4Y34 A;  1GH8 A;  1T0T V;  1RSC A;  5J2P B;  2GNK A;  2HAI A;  2JLE A;  5FLX Y;  2YWH A;  4NOH A;  2ZUG A;  4AXI A;  2HFO A;  4MYU A;  1RBL A;  1WKK A;  3BBB A;  1SL2 A;  1XC9 A;  5BXI A;  1OO0 B;  4JI1 F;  1DTT A;  3OFE A;  3LP0 B;  3QGP A;  2B4V A;  2BA9 A;  2IYI A;  4KH1 B;  4NE9 C;  2AGQ A;  4FDF A;  4Q8F A;  3PRV A;  4R5P B;  5KAK A;  4W90 B;  5AXM A;  3MPU B;  1B0P A;  3H2U B;  2F1F A;  3RTV A;  4EWT A;  1FFS B;  1FCA A;  2ZM6 J;  4DPX A;  2E5H A;  5D4P A;  3OJS A;  4DFJ A;  1HNX J;  5GAG I;  3FNN A;  4MKA A;  1FO1 A;  1FES A;  3Q24 A;  3KDN A;  2DHS A;  1LV5 A;  3QT7 A;  4DLE A;  3O8W A;  4QBU A;  2MHN A;  1YIT S;  3M8S A;  3IR7 B;  1TKD A;  2WVE A;  4B3O A;  4GMK A;  2YNH A;  2P5V A;  3MUV P;  3PW5 A;  2QLB B;  2IMO A;  1KC8 T;  3OSN A;  3J7Y U;  2AKW B;  1FTR A;  1HR0 F;  1X0F A;  4NYZ A;  4P75 A;  3M2R A;  4NLP A;  2VC1 A;  2V4R A;  2ZZT A;  5E3C A;  4KE5 A;  3SV3 A;  1F9F A;  4FF4 A;  1UVI A;  1IKW A;  3KHG A;  1T03 B;  1APS A;  4B9S A;  3G71 S;  1EAY C;  5B0A A;  5KG1 A;  3S01 A;  2O1P A;  4KTQ A;  2QMU B;  2Y1L B;  1QDU B;  5HI7 A;  1F60 B;  2CQC A;  4LF7 J;  3MM9 A;  2J0X A;  4ZVH A;  3MEE A;  4FXD A;  1HBN B;  3VGU A;  3MZI A;  4AE5 A;  4EBD A;  2XHC A;  3DLE A;  2RS2 A;  4BC7 A;  3KG0 A;  4DPT A;  5A76 A;  3HX9 A;  4KC5 A;  3V4M A;  4NYO A;  1R8A A;  4M95 A;  2Y8Y A;  2LDI A;  2D74 B;  3QSI A;  5M2P A;  3ZZT A;  1W25 A;  1VGY A;  3W8G A;  1WOS A;  3R7B B;  4IH6 A;  4Y2M A;  3N5B A;  4ED4 A;  3GCW P;  6AT1 B;  2ZVI A;  4DR6 F;  5E5N A;  3OV7 A;  2C2N A;  3CGI A;  4YP3 A;  4ZLP A;  2F63 A;  2QFJ A;  2I8E A;  1REV B;  4M5K A;  2KZZ A;  4LRC A;  4ATN A;  2VIH A;  5IQ6 A;  2RVJ A;  5KOW A;  4DX5 A;  2QLW A;  3NRB A;  2LKZ A;  2PT0 A;  2YQ1 A;  2J0W A;  5EX0 A;  3RB3 A;  4V19 X;  4I4B A;  2PFF B;  3KK3 A;  2HFU A;  4DSL A;  4RJV A;  5K9F A;  2JOQ A;  1WEY A;  2ZC4 A;  3E2E A;  2HHX A;  1FEE A;  4I7F B;  4EUV A;  1SPB P;  2WW8 A;  5A6W A;  3KJN B;  3MEC A;  1CS4 B;  2MST A;  3PEJ A;  4NZ6 A;  3IRX A;  1U6Z A;  4E0D A;  3BM7 A;  3F73 A;  2VG5 B;  3D54 A;  3WX8 A;  1HPZ A;  5I3U B;  3TEH B;  3VZH A;  5CAA A;  3QBC A;  3RAQ A;  4M5D B;  4XPC A;  3WX4 A;  1FXR A;  2DTJ A;  1JWW A;  2BXJ A;  4ZHR A;  3M7V A;  5HVF A;  3TA0 A;  4EEY A;  1TV6 B;  4C4W A;  3CIM A;  4P7V A;  1HI8 A;  4CH1 A;  2QRR A;  5H1S V;  3NKY A;  1LWX A;  4EO8 A;  4OI4 A;  1SIW B;  1RWP B;  5J2N A;  4LUB A;  2HVH A;  5HBM B;  1FRI A;  2GVZ B;  3DRS B;  4OZ0 A;  3UFC X;  4P2S A;  2FZC B;  3M6X A;  2ZH9 A;  4K5S A;  3QJP A;  2YNG A;  4KV8 B;  5HAO A;  3UDC A;  1YJ7 A;  1HD1 A;  3DLG A;  5LT5 A;  4EI2 A;  2UXB J;  3IFE A;  2HRY A;  2COL A;  1X4C A;  4C3K A;  3U1N A;  1RWV B;  4EBC A;  2H48 B;  4F4X A;  1G1X A;  1SI9 A;  5L39 A;  2VF3 A;  1F5B A;  2ZDO A;  2C2R A;  1J5O A;  1HAR A;  5DRK A;  2ZHB A;  2OPQ A;  1DAX A;  1U8W A;  5F8N A;  2ADB A;  2HNY B;  4Q0B B;  5GMD A;  1WG1 A;  2G1H A;  1RT1 B;  2DBB A;  2R7X A;  4QIG A;  4OHX A;  2BZ2 A;  3AJ1 A;  3KXD A;  4NLY A;  4UOC A;  3J7A N;  3AQP A;  1FXL A;  4PXD A;  4QR1 A;  4LR9 A;  1ZOT A;  1FJ7 A;  4O3P A;  2APO A;  3L9Z A;  3M8Q A;  2Z2M A;  5F8G A;  1T9U A;  4RX6 A;  1YLX A;  2G9O A;  4DUY F;  1NK4 A;  3W5X A;  2K8G A;  4ZPV R;  1RHU B;  1WKJ A;  4OZN A;  2XMM A;  2O5D A;  5B08 A;  1GXT A;  3ZFV A;  3GYN A;  3F44 A;  1LW0 B;  1FRH A;  3CC2 S;  2UUW A;  2LCW A;  2Q3P A;  4FXV A;  3FEZ A;  4PAA A;  1AW0 A;  4DF4 A;  2KYX A;  2HAF A;  1CG2 A;  3UD3 P;  1ELO A;  1IBK F;  1A0O B;  2DXF A;  3ZZR A;  4DEZ A;  2N4D A;  4R25 A;  3M1V A;  1AUS L;  2BW2 A;  5AE2 A;  3J80 U;  3VGV A;  4J9V A;  4ES3 A;  2YKN A;  3CD7 A;  2HK2 A;  2M7S A;  3DGP A;  3HFK A;  2VZ9 A;  3Q8V A;  1NAQ A;  3P5B P;  3KLE A;  2D3U A;  2X1G A;  2VG7 B;  4RO0 A;  3OTD A;  1UET A;  4FVM A;  4LF6 J;  1VOM A;  3HDS A;  4QWE A;  1KOO A;  1D9F A;  2J8S A;  2YWE A;  4LFC J;  4XDC A;  1WC0 A;  3EWG A;  4ZN1 A;  4IQM A;  3AD7 C;  2BM0 A;  4KKO A;  2MEW A;  2V8V A;  2B4P A;  4RW7 A;  5AXN A;  4K2X A;  3QID A;  4HDH A;  4DV7 J;  3ITH B;  1A7G E;  1RXO B;  2DGU A;  3JSB A;  1GK8 A;  3BGR B;  3MMA B;  4WFB Q;  3OHB A;  1B4S A;  1N48 A;  3GR1 A;  4LR8 A;  1IR0 A;  3MEG B;  1WG4 A;  3G82 A;  3LF0 A;  1HBU B;  3D28 A;  1ZZF A;  1S49 A;  4X65 F;  3DMJ B;  2W7P A;  4FPR A;  2XWY A;  2O67 A;  1Y00 A;  3TVY A;  3I6P A;  1T3O A;  5HMY A;  2H1Y A;  1NXI A;  1Y3J A;  1DZ5 A;  1HMV B;  1FWP A;  5FII A;  4YY3 J;  4JI0 J;  2JVR A;  4RUA A;  3MD1 A;  1QE1 A;  4F8R A;  2LVW A;  1Q5Y A;  4LF8 J;  3OR2 B;  4NML A;  2W2O P;  1DRZ A;  4BS2 A;  1IQZ A;  2DGS A;  2ASD A;  1NJX A;  1JX4 A;  1YG0 A;  4LRF A;  2CPZ A;  4CT8 A;  1NDK A;  3BO4 A;  2V4J B;  1JXE A;  3H2V E;  2WTF A;  2HQF A;  2GO8 A;  3IWL A;  4DL5 A;  3B82 A;  2HK3 A;  4A8K A;  1TL3 B;  2K3I A;  1S7I A;  4DFM A;  2XC9 A;  2CPE A;  2XZD B;  3SQG B;  3KKF A;  4ZPC A;  3BH7 B;  3QJL A;  2LYV A;  4F50 A;  2XMU A;  3W65 A;  1PAU B;  4TVA B;  5KT5 A;  2FVP A;  3W62 A;  4UW2 A;  1U0H B;  3H40 A;  4OIX A;  4IFV B;  1S12 A;  1P9Q C;  2YKQ A;  1QSY A;  2J0S D;  1X8D A;  3ZTR A;  3MED B;  2XSF A;  4QW9 A;  4X2B A;  5D4O A;  4U95 A;  1SJR A;  1CVJ A;  3PR5 B;  4Q45 A;  1XIQ A;  1GTE A;  3IAS 9;  3T5K A;  3H5S A;  2RUS A;  4ZVE A;  2MSS A;  2WVF A;  3ILI A;  1WDD A;  5DDP C;  3GWC A;  2G0I A;  1X60 A;  2M3D A;  3OUY A;  2BE2 B;  2PO4 A;  1X5O A;  3BR9 A;  5EWF A;  1JLB B;  1S9G B;  5GAH U;  1ZM2 A;  3U27 A;  3NNH A;  1F3V A;  4L75 A;  4DL6 A;  1HHQ A;  3D6T B;  1T3N A;  2YX7 A;  4LVN P;  4NLS A;  3KHH A;  1MRO A;  2VBW A;  2DNY A;  2KO1 A;  4DV2 F;  3MMB A;  2AZ1 A;  4CLW A;  1MML A;  4HVZ A;  2VFU A;  4CLL A;  4DV4 J;  1XMQ F;  1K8A T;  2BEF A;  1X4G A;  2C1E B;  3KG1 A;  7FD1 A;  4EK2 A;  4PXE A;  1IQT A;  1UPM B;  2VB6 A;  1QAJ A;  2ERR A;  3RU0 A;  3F41 A;  3S1T A;  2LP4 A;  2MQP A;  1TVR B;  1IUJ A;  3N4W A;  1RTJ A;  4H54 A;  3MR7 A;  1R6V A;  3U1L A;  3PM9 A;  4DQI A;  3AXK A;  2J0Q D;  2ZH8 A;  4Z37 A;  2QA1 A;  4OQJ A;  4OMF G;  4YHH F;  2HGM A;  3T6J A;  2V63 A;  1D1U A;  1YJV A;  4CO5 A;  3G8S A;  2YWF A;  4OX9 J;  4LRD A;  3U02 A;  2DR6 A;  2EWH A;  4XIU A;  2OFH X;  3DRP A;  4NLQ A;  4OYB A;  2NXU A;  4J7C A;  4LJM A;  3G87 A;  1XR5 A;  1D8Z A;  3IM9 A;  4WII A;  4QZV B;  4NLD A;  1L3T A;  1U6F A;  3R8Y A;  3MTJ A;  1QLN A;  2MB0 B;  3R97 A;  3CB4 A;  1FKO A;  1MU2 A;  2DD8 S;  4N41 A;  2QA4 S;  3NP5 A;  2XZT B;  2CZ9 A;  3FVY A;  3NXZ A;  2MHE A;  2PII A;  2GHP A;  1V3R A;  3KNA A;  4DG1 A;  3I82 A;  2D3Z A;  1OYE A;  3G96 A;  1PKU A;  4JI1 J;  2RF2 A;  3ILL A;  4OZ2 A;  1RAO A;  4PYA A;  4DCP B;  3PO5 A;  2FHJ D;  1HD0 A;  1C1B A;  2CZV C;  3HSD A;  2WVD A;  2XYG B;  2CNL B;  5DDR C;  4NX9 A;  2D41 A;  2DH8 A;  5MLC V;  5DG7 A;  1TZ0 A;  3HK2 A;  4MYT A;  4G6V B;  3HT0 A;  4BWJ A;  1X5S A;  2JC1 A;  3L4B C;  5A2Q Y;  1YIJ S;  3LO3 A;  3SV4 A;  4I2Q B;  3W7B A;  3K5L A;  5GAD U;  1LWF A;  1AT1 B;  4NPO A;  4LF5 J;  1TL7 B;  1VQM S;  1N0V C;  2RJZ A;  2W7O A;  5F8H A;  1EX8 A;  3MAH A;  2QYC A;  1IR2 A;  3BBF A;  3BV8 A;  2JRS A;  3KLG A;  1HR0 J;  2Q66 A;  2V6A A;  1LFP A;  3C66 A;  4PWD B;  4Q44 A;  1WKL A;  3GV8 B;  3DI6 B;  2UZA A;  2QL9 B;  1WC5 A;  3D3C J;  2KFY A;  2RU9 A;  4ED2 A;  3I5C A;  3DDI A;  1KR4 A;  5C42 A;  5LJ3 Y;  3OVS A;  3X1L B;  4CZC A;  3C15 A;  3TZX A;  2CFX A;  1FEH A;  5BR8 F;  1PC5 A;  1P1L A;  3OVA A;  2W8K A;  4CT9 A;  2BAN A;  3HZE A;  5IV3 A;  3BN7 A;  3E01 A;  3OTC A;  3US5 A;  3UDL A;  3GFX A;  2VD3 A;  4DR7 F;  4NLU A;  4NXN F;  5B0B A;  2I2Y A;  2JLF A;  4DU7 A;  2UU9 F;  1CJV A;  1S72 S;  3CJ8 A;  4ED3 A;  3M8Z A;  2XNR A;  1NSQ A;  3IXQ A;  5HVG A;  4N5S A;  1VCT A;  1X9S A;  2V8G A;  2GIR A;  4DV1 F;  1HL6 A;  4DR6 J;  1SH0 A;  3MHY A;  2QTW A;  1UWB B;  5DZ6 A;  1YVF A;  1UFL A;  4I6Y A;  4CYU A;  3SI8 A;  5CYM B;  5FD1 A;  1FKP B;  1OPZ A;  4TXS A;  4CLS A;  3FFI A;  3WHI A;  3NCP A;  2R2U A;  4XDD A;  2VV5 A;  2HBY B;  2RT3 A;  4MKV A;  2KB2 A;  3TP2 A;  3OLA A;  5D4N A;  2DO4 A;  4O3O A;  4PWU A;  3W64 A;  3E8O A;  2EFO A;  1DJ0 A;  3FCV A;  4CLY A;  4ZP6 A;  5KG5 A;  2RML A;  3MAA A;  4B02 A;  5IV4 A;  2RQM A;  2E9Z A;  2NQP A;  1KS2 A;  2OFG X;  2ZH2 A;  1F6T A;  1RE1 B;  4I1T A;  2QLF B;  2OTJ S;  4O3S A;  3PKY A;  4FF3 A;  1RHR B;  2PC6 A;  1OSC A;  2LQJ A;  1TAU A;  4UST A;  6FDR A;  1ZZN A;  3UE2 A;  2V2V A;  1KLM B;  1VQL S;  2QFI A;  3LAL A;  3T6B A;  1NM2 A;  4QOT A;  4KYZ A;  1B64 A;  2R7Q A;  1O51 A;  2J7K A;  1RWM B;  3EDQ B;  1RKI A;  4CTA B;  3AA8 A;  3KK2 A;  1X9M A;  1S7H A;  2FIU A;  1NK9 A;  3PTW A;  1VHI A;  1YZ6 A;  3NWR A;  3LP1 B;  3MMC B;  2DNM A;  3THP A;  3ILJ A;  4WXO A;  3R7N B;  1S1V B;  1WOR A;  4DCO B;  3MR5 A;  4IO9 Q;  2YNI A;  3OFH A;  4RNO A;  1HQE A;  5EHH A;  3T19 A;  3OHA A;  1B99 A;  3EXY A;  3LUY A;  4M5G A;  5BYS A;  2QZ8 A;  1RAD B;  4NLW A;  2OGU A;  4Q7A A;  1NDL A;  3OSP A;  3IAM 9;  2MGZ A;  2W9C B;  2OKQ A;  4P7T A;  1S9E B;  5C2C A;  2MZ1 A;  4ZDN A;  2DNR A;  2DRA A;  4Y0F A;  3VGT A;  4RNM A;  4DR5 J;  2D3O 1;  4OYX A;  2MZT A;  1WJ9 A;  5C25 A;  4LT6 A;  1N33 F;  2FVQ A;  3H4D A;  2ZVS A;  2XQC A;  5HAT A;  4USU A;  2WBR A;  1HYS A;  4QJV A;  1JLF A;  4CM2 A;  4KHM A;  2VA3 A;  3NGU A;  3TAM B;  4Q5V A;  3PO4 A;  2NCK L;  3M8P B;  5F3Z A;  4QYR A;  4GKJ F;  2JWN A;  1JLG A;  4QWC A;  3TJA A;  4I67 A;  3Q86 A;  2MJU A;  4URG A;  1CJU A;  4BC9 A;  5G0R A;  1FX4 A;  3ET6 B;  2DNL A;  2CWX A;  1Q82 T;  3W60 A;  2IVM A;  1WTF A;  2VL1 A;  5C24 A;  4DUY J;  2Y1J A;  4O44 B;  2QGF B;  4ZJQ A;  1W2B R;  2FJD B;  2DKO B;  4HLB A;  1RAG B;  4EZ6 A;  1ITP A;  1ZA2 B;  4OYO A;  4ZVQ B;  4M5J A;  3TR5 A;  5L9X A;  3G8T A;  2NUU G;  4W4M A;  2SXL A;  1RI7 A;  3OW2 R;  3M05 A;  4WFX A;  4ILM A;  2KL8 A;  2HVZ A;  2W2M P;  1YJW S;  1NU4 A;  4ZS6 A;  2BM1 A;  1NKB A;  2DNK A;  3M2V A;  4WP9 A;  4JOU A;  3I9V 9;  2F4V J;  1KVJ A;  2H5J B;  1S1T A;  2OSR A;  2B7C B;  5J1E A;  3GQC A;  1HW9 A;  4FYW B;  2JC0 A;  5FDL B;  3SFU A;  3K57 A;  4OX8 A;  1N52 B;  4WZM A;  4G3I A;  5D0H A;  2KG0 A;  5LSL A;  1GMV A;  2H5E A;  3KLH A;  2HGL A;  5A8K A;  3MM7 B;  1CQM A;  4K4Y A;  1ZET A;  3QO9 A;  1N34 F;  3OL9 A;  1IBC B;  1T9T A;  2GJI A;  3POT B;  5E3P A;  4QWD A;  3Q23 A;  4DI6 A;  1M5H A;  5L38 A;  1V9O A;  1PJ6 A;  3CJ4 A;  2YKM B;  4TY8 B;  1EKR A;  4OFZ A;  4IQX A;  2HEK A;  3K5O A;  3J7Z 5;  3G6V A;  4HYK A;  1UEU A;  1N88 A;  1V5I B;  2MMY A;  1XWL A;  1Y11 A;  1FI4 A;  3FK4 A;  1ZM3 A;  3W2W B;  1RT6 B;  3P96 A;  2YWW A;  2XM3 A;  4X65 J;  2E1A A;  4RW9 B;  2W2P P;  3T9Z A;  5AJ3 J;  4Q2L A;  5B0C A;  9ATC B;  2P8I A;  4ZVO B;  3MXH P;  4WZQ A;  3R1L A;  1S57 A;  2M2B A;  1Y10 A;  1HBO B;  4QCL A;  1UFW A;  3DOK A;  3QIP B;  2Z8Q A;  3RRH A;  1K44 A;  2CG4 A;  1Q8B A;  2BVZ A;  3H0P A;  1F5A A;  4AL6 A;  4IRD A;  2BYC A;  3NMR A;  5J1P A;  1XEZ A;  1R8H A;  4PG5 A;  5LXR A;  5GAE U;  5LJ5 Y;  3PVX A;  1S1W B;  2AW0 A;  2VIC A;  1NDC A;  3LAN A;  4X4Q A;  2HZC A;  4K4Z A;  4IYQ A;  1T05 A;  4F26 A;  1WSR A;  2X1B A;  1MN7 A;  4K4W A;  5LSO A;  3FRY A;  4ZCI A;  3CDA A;  1LXN A;  4HL9 A;  2VPW B;  3PV8 A;  3N9U C;  1H2U X;  2I0X A;  2EEY A;  2C3O A;  4USH A;  2HHV A;  3UWT A;  4AL7 A;  2H3E B;  1BLU A;  1UKU A;  4FF2 A;  3C16 B;  1RT3 B;  4I6W A;  4RZR A;  1VQK S;  1H98 A;  2K1R A;  4K4U A;  4KH0 B;  1SCJ B;  2B9Y A;  3WZ0 A;  4FBT A;  1ZS6 A;  3MM8 B;  1TL1 B;  4ZP7 A;  3VGS A;  4KO0 B;  2M8D B;  3K0J A;  2AX0 A;  3RUB L;  3W66 A;  1HBU A;  3ZC4 A;  3GYX B;  2HRT A;  2BW7 A;  3DMJ A;  2BOA A;  4WTY A;  1S99 A;  2C2K B;  4JI6 J;  2W24 A;  3SBM A;  1MSW D;  1Y3K A;  1DQA A;  3NLC A;  1S48 A;  4K8R A;  5JMN A;  2VPX B;  1T8E A;  2KJV A;  2N7Y A;  3AQO A;  4C0H A;  3TZY A;  4DV2 J;  4CM0 A;  5HMZ A;  2OLW A;  2LLZ A;  4NLO A;  4OYW A;  1YRX A;  3KG4 A;  5DLF A;  1AUD A;  1XMQ J;  2V2K A;  5AE3 A;  1NEE A;  5J2M B;  3TI0 A;  2HQI A;  3BJY A;  2DK2 A;  5IM0 B;  3JSM B;  3I32 A;  1GTH A;  3VAH A;  3OXL A;  4MT1 A;  2CVI A;  4HT5 A;  2JL9 A;  1NHK L;  2FVR A;  1LWC B;  3GIR A;  2XS2 A;  2AQ4 A;  4HTJ A;  3LGM A;  2H5I B;  4ECR A;  4CLZ A;  3TAQ A;  3UNY A;  1U4B A;  3QT8 A;  2AZ3 A;  4YHH J;  4C8O A;  2R3V A;  1WWH A;  1OPI A;  2D9P A;  1GXL A;  4USJ C;  1N36 J;  2C3P A;  3MFI A;  3M32 B;  3MED A;  3SCK E;  2EC2 A;  2DR5 A;  4NI2 B;  1O5J A;  5K8M A;  4X64 F;  1B0T A;  3C14 B;  1XTZ A;  2V4Q A;  3D68 A;  1X4F A;  2HMI B;  1SJ1 A;  1YI2 S;  2CAD A;  4UTG A;  3D66 A;  1S1X A;  4K50 A;  3J7Y I;  1X4B A;  1C1C B;  1LK7 A;  2B5J A;  1U0S A;  3CCU S;  1JLB A;  4KGX B;  4FYD A;  2ZE2 B;  1VRU A;  3LAK A;  2MYF A;  3GFZ A;  1G7C B;  4K0K F;  3EYZ A;  3BYP A;  1T9X A;  2CZ4 A;  4ID5 B;  4ZIW A;  1N5Y B;  5T14 A;  3UVJ A;  2OPS B;  2N3O A;  2CPH A;  3ENW A;  2OH2 A;  4O23 A;  1M5S A;  4EMD A;  1UEV A;  1X5T A;  3K17 A;  4DV3 F;  3J81 U;  4J9K A;  3NGT A;  4W92 B;  1URN A;  1QVF R;  3D4J A;  3K5P A;  4NLV A;  3GP9 A;  3THT A;  1J5E J;  4YR3 A;  4LF9 F;  2EC0 A;  4RW8 B;  5DM7 Q;  1RT5 B;  4O4G B;  1R0B G;  2NUH A;  2KJW A;  5EDW A;  2ZEJ A;  2WON A;  4C8Y A;  1L3K A;  1X4E A;  5HO4 A;  2YKP A;  2BKP A;  1X9W A;  4CP5 A;  3W5Y A;  5A0Y B;  5KFR A;  5CYJ A;  4MAK A;  3L7U A;  3PYE A;  3B4D A;  2CNK B;  4LSN A;  2OIH A;  1KP6 A;  1JXV A;  2BE9 B;  1SB6 A;  2MKK A;  1IKV A;  2XSJ B;  3ENA A;  2RNE A;  2RUG A;  3PJW A;  4DS5 A;  3R5D A;  4FXW A;  1VI7 A;  1UA0 A;  1RUS A;  5BJR A;  1CC8 A;  3OFG A;  1Q16 B;  3EPG A;  4ICL B;  4FS2 A;  3ZZP A;  1PBU A;  3D1O A;  1S10 A;  1HW8 A;  3KUE A;  3NMA A;  2UU9 J;  1X4D A;  4D3H A;  3G6Y A;  1JLQ A;  1UAW A;  3AOD A;  4DN0 A;  3ZNJ 1;  1SUQ A;  4U67 Q;  3VWS A;  4DL2 A;  5IWA F;  2HQG A;  2QA4 G;  4ELU A;  4QU7 A;  1UVK A;  2MZR A;  3QGH A;  4V1A k;  4JYA J;  3G86 A;  1Q53 A;  3OT9 A;  2CPI A;  2B8Q A;  1SH3 A;  3CT9 A;  4ZVF A;  5E0O A;  3W2V A;  2J6S A;  4X4R A;  2IM0 A;  4DF8 A;  2KDO A;  4YR2 A;  3BDE A;  1RTD A;  2WB1 D;  2E5L J;  5DQG A;  3HI9 A;  3P5T L;  4TQS A;  5A8R A;  1LXJ A;  1FK9 A;  1XN9 A;  1OQ6 A;  3KHR A;  1F1B B;  3DLB A;  2H4Y B;  5HP1 A;  2DHA A;  1E6V A;  1QUP A;  4FNI A;  3TUP A;  1A6L A;  3QRQ A;  5F8M A;  1S6P B;  1EAR A;  3H7H B;  2FTR A;  3W63 A;  1DAR A;  4ZPB A;  2A6M A;  3EZU A;  1Q4R A;  3FRZ A;  1SJQ A;  2ZH5 A;  2UXC F;  1AFJ A;  3DC2 A;  1QAY A;  2WRM A;  2AJ2 A;  4YDX A;  3Q8R B;  1TEL A;  3HP6 A;  2DHG A;  1KEK A;  1RHJ B;  2B4U A;  2HHS A;  2QMX A;  3CCJ S;  1WC4 A;  3SYZ A;  2GIF A;  3QGG A;  3OTE A;  4PPD A;  1P6T A;  3GIJ A;  3TX8 A;  2ZWO A;  3V4I B;  1YGY A;  4A8Y A;  3LA0 A;  1J27 A;  2CNN B;  1UVM A;  1TP7 A;  4QR2 A;  3BRE A;  1UWB A;  2RRB A;  2F5G A;  1PG5 B;  4DU8 A;  3AT1 B;  3BO2 A;  2IRX A;  3D2W A;  2L3M A;  5D6G A;  3A8K A;  1X31 C;  2J8A A;  3MM5 A;  1HBM A;  3UDV A;  5ETL A;  1WF0 A;  3DDN A;  2CPX A;  1FHT A;  2J9D E;  1DLO A;  1NJY A;  3ZTS A;  3CJK B;  2ZJQ Q;  2ZJR Q;  3FBC A;  3DYA A;  5T41 A;  2GMJ A;  3I9Z A;  2HRU A;  3GCX P;  3VZI A;  3DHX A;  1HNI B;  4HHJ A;  1N33 J;  4P6Q A;  1DBD A;  1VIO A;  1BGX T;  2IJF A;  3CJ0 A;  1JIH A;  4LRA A;  2HWT A;  1ZAV A;  2CJK A;  4WP3 A;  4M5L A;  1IWG A;  3HVT B;  4NEZ A;  1S79 A;  2AIR B;  4GKJ J;  1SV5 B;  1VC5 A;  1AXQ A;  2KFN A;  4XTT A;  2W2Q P;  1LNQ A;  4WFA Q;  1KLM A;  2NR0 A;  1IBL J;  3VTI A;  1R7I A;  4O4R A;  2EKY A;  1F3F A;  1OMS A;  2QE5 A;  1I3O B;  5CCM A;  4HAC A;  2A1B A;  4RW6 B;  5L46 A;  5KFE A;  2BR0 A;  3H5X A;  5LMN J;  4L74 A;  4LIR A;  2JEG A;  4USI A;  3PJX A;  3P3D A;  5LL6 d;  4K4T A;  1NBE B;  3TOQ A;  1FJG J;  3Q83 A;  2UUA J;  4OZ1 A;  2QO3 A;  3PX6 A;  4X4S A;  1QTM A;  4OX7 A;  1HFE L;  1NND A;  3BSO A;  1TKT B;  1S9E A;  4H4K A;  3MMJ A;  3BSN A;  3HHD A;  4OYI A;  4CNY A;  4ED1 A;  4ER8 A;  3QLH B;  4DUT A;  4DZD A;  1HNW F;  1LKZ A;  3CJS A;  1RQ0 A;  4FBU A;  2HSE B;  1S6Q B;  6FD1 A;  2EFP A;  2JHE A;  1BMQ B;  1V3S A;  3M8P A;  4P10 A;  4BBY A;  4ZIV A;  4FN5 A;  1VJW A;  2KHC A;  4NL5 A;  4UZB A;  4IKA A;  3UDE A;  1XK8 A;  3T1Y F;  4RNF A;  3FKB A;  1TFW A;  1EJ7 L;  3TW0 A;  3OL7 A;  3RAM A;  3UW1 A;  1ZM9 A;  4AFF A;  3CUN A;  3OTB A;  3M9N B;  5D3G B;  4O0I A;  2AYB A;  5M2R A;  1RTI B;  2QSW A;  2PFD A;  1GX5 A;  1TKZ B;  1HQU A;  1BD6 A;  5CYQ B;  1B3T A;  2OPR A;  2IAJ A;  2KXN B;  2DNQ A;  4KFB B;  2XY6 A;  2EG1 A;  2HPU A;  3NBP B;  2L9W A;  2HWH A;  4G1I A;  1CUL B;  3FC9 A;  2OPP B;  3T5L A;  2NRE A;  3AFG A;  4JI5 F;  2XB2 D;  1YJ9 S;  4GC7 A;  1YTY A;  1U48 A;  1FVQ A;  4DV6 F;  2YPY A;  1WHY A;  3H42 A;  2D7S A;  1CJK A;  1WC6 A;  2WOM B;  3DOL B;  4IO1 A;  2A18 A;  1DY3 A;  4J90 A;  2UXB F;  3CE8 A;  4ECY A;  4B3S F;  2NXC A;  4ZVU B;  1ZH5 A;  2XCA A;  1WUU A;  1I94 J;  1K1S A;  1R43 A;  1VMB A;  3THV A;  3D0H E;  4IFY B;  5AE1 A;  2E1P A;  2KN4 A;  2P9E A;  3PFO A;  3X3U A;  1AZS A;  2K2P A;  3DLK B;  2XS7 A;  1U24 A;  3TUZ C;  4MKY A;  4LFA F;  5DGA A;  2BE7 D;  3VR1 A;  5K14 B;  2DNG A;  3POT A;  4W98 A;  2DPJ A;  1OS5 A;  1H6K X;  5EWE A;  2R7W A;  2DIS A;  4ZPA A;  3GII A;  4F3O A;  1C4A A;  2GJF A;  4H4M A;  3I56 S;  4EYI B;  3EUN A;  2ROG A;  4BDP A;  5ETR A;  1IKY B;  2FLL A;  4B9U A;  2L48 A;  2E1M C;  1HWL A;  3S7R A;  2X1F A;  4NCA A;  1U25 A;  1U02 A;  5SUH A;  2XO7 A;  3W2W A;  4DV5 F;  4UUX A;  3NWG A;  1U2R A;  1RT7 B;  3GE9 A;  2HQD A;  3FSX A;  1O0P A;  2IC3 A;  3I5A A;  5KFI A;  2DGW A;  1Y0H A;  1FKA F;  2ROP A;  1HBO A;  3QYY A;  1MWY A;  4OI6 A;  4CH7 A;  3GJR B;  4X4O A;  5KFU A;  4JI2 F;  4LF6 F;  2CKW A;  2EFQ A;  3DLH A;  2JSX A;  4KGZ B;  4LFC F;  2MPU A;  3SDE B;  2FQQ B;  3OJU A;  4CQ1 A;  1FRK A;  2IVY A;  4ZVR B;  4R0E A;  2DR8 A;  1T11 A;  1FDA A;  5CQG A;  1XQI A;  3EPI A;  4RU9 A;  5I3P A;  4B3M J;  1NK6 A;  4C9D A;  4L3K A;  2V2Z A;  2ZUA A;  3PYD A;  3BDP A;  3IRW P;  4QIF A;  1RIS A;  1TKX A;  1HIY A;  4DPO A;  1S5Z A;  2RS8 A;  3V6D A;  4LFB J;  2UV8 G;  4H4O B;  4UOH A;  3M8R A;  3JTP A;  1RT3 A;  3BO3 A;  1BY9 A;  1SQE A;  1JJC B;  2LEB A;  3RG6 A;  3IS9 B;  1FJE B;  3CCZ A;  2W9B B;  3BGF A;  1IM6 A;  1C0U A;  4X64 J;  3CMA S;  1Q1K A;  1S0O A;  5KFP A;  1MLA A;  2RKI B;  3OXG A;  4F4W A;  2GAG C;  2LFV A;  3H98 A;  1DTQ B;  2ZDP A;  4USK A;  4IR9 A;  2Z0G A;  1WTB A;  4CNZ A;  2R7T A;  4C11 A;  3JYT B;  5D15 A;  4KO0 A;  1JKH A;  4LF8 F;  2I1R A;  3CWJ A;  2EFV A;  2DHX A;  2GC8 A;  4NLX A;  2ZD1 A;  1Z4U A;  3A8I A;  2H9Z A;  4TKT A;  2IY5 B;  2NXE A;  4FKY A;  2KH9 A;  2WSE C;  4K0K J;  3JTN A;  5JUM A;  1E6Y B;  3ZTQ A;  3LP2 B;  2OML A;  1U1P A;  4MKB A;  3K5M A;  4ZVG A;  4Q2M A;  3V6H A;  3HUL A;  5D0R A;  1RYS A;  3GON A;  2PSZ A;  1RWK B;  4DV3 J;  5IT9 Y;  1H7X A;  2MLX A;  3RRK A;  4Q8E A;  3CW2 C;  1H73 A;  3JAM U;  3B8H A;  3KHL A;  2RQK A;  2K06 A;  4PWW A;  4HHH A;  9RUB A;  2CJB A;  1RBO B;  1VJQ A;  4IH7 A;  3N79 A;  4WE1 B;  2YH1 A;  3KLV A;  1RTH B;  5HRO A;  5T7L B;  5KG7 A;  4F0M A;  4DSF A;  1VDH A;  4N77 A;  4IG0 A;  4YB5 A;  1XNQ J;  3PYF A;  2LA4 A;  5KFO A;  2VFT A;  1FRM A;  4NA1 A;  4OI0 A;  4NI2 A;  2ZNY A;  4U6P A;  4CH0 S;  3TAN A;  5EUH A;  2XLI A;  2HMI A;  5MAO A;  2Y9H A;  1EP4 B;  5I42 B;  4CO4 A;  2C3Y A;  1K0T A;  1ULR A;  2IJR A;  1C1C A;  4DV4 F;  1JLE A;  2EBE A;  4IG3 B;  3DRR B;  3I0S B;  2NSC A;  3A3P B;  3CF5 Q;  4ERD A;  3J7A 1;  4ZLL A;  2X51 A;  3VHQ A;  2WK4 A;  5CXT A;  3QT6 A;  1C4C A;  4A8F A;  3S6E A;  2AV5 A;  4OJH A;  2YPZ A;  2OPS A;  1TUW A;  4X4T A;  4ZLN A;  2UUB F;  4WU2 A;  1YJU A;  4DSJ A;  1VIS A;  1Q81 T;  2CJA A;  4O3R A;  5ETO A;  2MLZ A;  4WKR A;  1UP1 A;  3GJQ B;  1EB0 A;  4ECS A;  3MCM A;  4TLQ A;  4OX9 F;  2RQ4 A;  1CLF A;  1UJ6 A;  1FE4 A;  4PG7 A;  3QZ7 A;  1S6U A;  4ED8 A;  3DHW C;  3KMQ A;  3VAJ A;  3MUM P;  4RW4 B;  1AB8 A;  4J9R A;  3K59 A;  5LXY A;  4CO1 A;  4F0K A;  2GJ2 A;  4YQW A;  4IRK A;  3P49 B;  3DXS X;  5K8N A;  1FWK A;  3KLI B;  2GX8 A;  3I0R A;  3P45 B;  4OZL A;  1T7P A;  4I2P B;  1U2C A;  4Y2A A;  2RHQ B;  3FSI A;  4HI1 A;  3V81 A;  3KTQ A;  2UXC J;  2FJV A;  2V8H A;  4Y3C A;  3UR0 A;  4U7C A;  5A8W A;  1HNV B;  3V6J A;  3NS6 A;  1OY8 A;  3DNC A;  1AFI A;  2VPZ B;  1PBA A;  2FVS A;  2AJ4 A;  2MQL A;  1UZD A;  2NPF A;  1ICE B;  3UO0 A;  2E9R X;  2DJW A;  1VBY A;  3N28 A;  4DFK A;  1ACM B;  4LBI A;  5CH7 B;  1EET A;  2DEI A;  5ETN A;  4C3L A;  1ZAW A;  3Q8Q B;  4RKU C;  4KJI A;  3MCO A;  2CAJ A;  4LF5 F;  1ZBT A;  2QC3 A;  3MD3 A;  2QX0 A;  4LF1 A;  2E5J A;  5KFY A;  1U09 A;  3MF5 A;  4CO0 A;  1BQM A;  4YB6 A;  3TJ8 A;  3GYG A;  1SC3 B;  2PEH A;  1M0S A;  1U1K A;  2F9J A;  4AUK A;  3KK1 A;  4I68 A;  4ECX A;  1JJ2 R;  4KBI A;  3M6U A;  2YBV A;  3DM2 A;  3CDE A;  2H65 B;  1KWM A;  2GGP B;  1S1U A;  4I64 A;  2KHD A;  4LSZ B;  4J37 A;  2ZIT A;  3AJ2 A;  2ZFH A;  5F3T A;  1Z2L A;  5HLF A;  1NPP A;  4FPI A;  1Q8L A;  1R8B A;  4B17 A;  2J6U A;  4YN3 B;  2AJ1 A;  2YX1 A;  3SXL A;  5F8J A;  2V34 A;  4N56 A;  3BEG B;  1XMO F;  4A8W A;  4ZP9 A;  1R8P A;  3IWN C;  1D9D A;  3DLL Q;  2LU2 A;  2CQG A;  2RIJ A;  1VQS A;  2U1A A;  2QT7 A;  3MPW A;  1U7L A;  2BDP A;  1P9Y A;  2VJV A;  2B9X A;  1KQF B;  1NUE A;  3HVW A;  2ABY A;  1I5O B;  4HDG A;  4B3O B;  3VAI A;  2YNH B;  1WOO A;  4M5N A;  4Y28 C;  4DV0 F;  3D1Q A;  2DNZ A;  1VK8 A;  4J9Q A;  3NOC A;  2I5J A;  1SJ4 P;  3M2R B;  3M6W A;  4LF2 A;  4IH5 A;  1S0V A;  1FFG B;  4G1Q A;  3ONQ A;  3KLF A;  2F8H A;  3G6X A;  1J2V A;  1IKW B;  2Z2Z A;  2A2C A;  5KFG A;  3BB5 A;  3ETO A;  3LTO A;  4TLR A;  4WYW A;  2HFN A;  3MM9 B;  3MEE B;  4WYL A;  2FUG 9;  3GSI A;  1YJR A;  2MDA A;  2XWX A;  1RAC B;  3DLE B;  1JMT A;  1HHS A;  3DGV A;  1VQN S;  2ILY A;  1HNW J;  3N5F A;  3I96 A;  1O6X A;  2OEL A;  2UVU A;  4UOG A;  3PG9 A;  4TN2 A;  4HT7 A;  4ZMM A;  5GAE I;  3SCL E;  1EZZ B;  1KTV A;  3MR6 A;  1KTQ A;  1BQX A;  3GV5 B;  3CVK A;  2VFS A;  2DHH A;  3T1Y J;  4DQS A;  2OAU A;  1XNR F;  2XMW A;  2Q6B A;  4OHY A;  1FE0 A;  3FZB A;  1RAB B;  1FT8 A;  1TMM A;  2HQ3 A;  4YB7 A;  3O6Q A;  3ENV A;  2J76 E;  2Q6C A;  3EGW B;  3VVT A;  5FLX U;  1JLC B;  2YNF A;  2IPO B;  3PX0 A;  5DGB A;  4G65 A;  2K3K A;  5DM6 Q;  4FS1 A;  1T95 A;  4WIQ A;  2ACM A;  3KK3 B;  4Y6I A;  3MGJ A;  2FY8 A;  2VG6 A;  3EGV A;  4B9N A;  4JI5 J;  3GSD A;  4MMO A;  4ECT A;  4DV6 J;  3MEC B;  1JJH A;  4DR5 F;  2F7V A;  5L9N A;  3IRX B;  2AGO A;  4B3S J;  5KG4 A;  2CQH A;  3R2D J;  3MM6 A;  5ETQ A;  4WFZ A;  1HPZ B;  2FJW A;  3I4H X;  2HHP A;  3M30 A;  2ZBR A;  2GIQ A;  3SSQ A;  2KM8 C;  2CRL A;  4JI4 J;  4ECW A;  1CSJ A;  4JV2 A;  2KZM A;  1KNZ A;  3EZO A;  2N82 B;  4CO3 A;  3T1H F;  2GMH A;  2C3U A;  4RWX A;  4ZHR B;  3QLH A;  4CLT A;  4QYZ K;  3IBC B;  2BJE A;  5L1L A;  2IA0 A;  3RBE A;  3JSR A;  1MMN A;  4LFA J;  3QWU A;  3JTO A;  2HBR B;  2R42 A;  1MWZ A;  1VQ7 S;  3RB6 A;  4WK3 A;  3A13 A;  1PYS B;  1TAQ A;  2DYA A;  2QN6 B;  4PZV A;  4ZJL A;  5EX3 A;  1D9A A;  3DOM B;  5J2N B;  4WXW A;  1FX2 A;  1VR6 A;  1SC4 B;  3BQ1 A;  5H9F K;  1T9V A;  5D4L A;  5H9E J;  3AH6 A;  4WWS A;  3VAG A;  1MN9 A;  1TUG B;  5D3G A;  2EW9 A;  1RTI A;  4K4V A;  2XGP A;  5JVG Q;  1U49 A;  1WC1 A;  2XYP B;  1X4H A;  2YNG B;  4DV5 J;  4OHW A;  4GRS A;  1UPP A;  1UZH A;  4IUF A;  3DLG B;  2AX1 A;  2EPI A;  2F4V F;  3LWL A;  2JH3 A;  3G2X A;  3NNC A;  2BOP A;  2UVR A;  3BQ2 A;  3P8B B;  2L08 A;  1S77 D;  1M1H A;  3M2U A;  1J5O B;  5HAN A;  2OPQ B;  2CXE A;  1P1T A;  4JI2 J;  3LPY A;  4A48 A;  3NS5 A;  1BXN A;  1TTH B;  4IDK A;  4F4K A;  4YOE A;  1VRT A;  5CAB A;  2JNJ A;  3BKU A;  2HHH F;  4C3M A;  4ILL A;  3M8Q B;  5AT1 B;  2Q79 A;  5KG2 A;  4A8X A;  3HFZ B;  5HQM A;  2ZBP A;  3GIL A;  1F2G A;  2YQ3 A;  3T9N A;  3C6T A;  5EN1 A;  2F4F A;  3TA2 A;  1URR A;  3ZZY A;  3IG1 A;  1S76 D;  4K7Q A;  4DR2 F;  3OD2 A;  1LW2 A;  5B0D A;  2HHQ A;  5AJ3 F;  3HJF A;  1BHN A;  1N8R T;  3UCG A;  2IDE A;  2FLP A;  2WZ1 A;  4MIB A;  4LRB A;  3M1V B;  2MQN A;  1U1M A;  2CQI A;  2VQF J;  3MUR P;  4NA2 A;  4EZ9 A;  2V9K A;  4U9R A;  3DGP B;  4AQY J;  2DNN A;  1YBA A;  3KLE B;  3CCS S;  4L72 B;  5CHC B;  1KOH A;  5KFJ A;  3U7J A;  1RT7 A;  5HVH A;  1MG7 A;  1CEZ A;  4A46 A;  1FRX A;  1QM9 A;  2XI3 A;  3VQS A;  2LDY A;  1KLN A;  2W1B A;  2RB7 A;  4KKO B;  5J1N A;  1FA0 A;  4GKK F;  5IT4 A;  5KG3 A;  4RW7 B;  3HO1 A;  4CRJ A;  2VBZ A;  4X66 F;  2VFR A;  4ZCL A;  1ROF A;  3BGU A;  4HR2 A;  4E2F B;  1H72 C;  2H4W B;  3H59 A;  5DDQ C;  4R8U B;  2R7O A;  5C5J A;  2OEK A;  4Y2I A;  4ZN3 A;  1NB7 A;  2BJ8 A;  2CA9 A;  2IBO A;  4JV5 F;  4PXB A;  1KQS R;  3KJV A;  1RB0 A;  4PAB A;  5I4M A;  2L9D A;  1VQP S;  4RBV A;  3QFW A;  3CCW A;  3R5J B;  5DLG A;  5E3A A;  3KDO A;  4RUH A;  2JJ4 D;  2QIF A;  3MAQ A;  2DGQ A;  2GZO A;  4CLU A;  2HNZ B;  5KFM A;  3OBI A;  1X0P A;  2HFZ A;  4DL0 C;  1QE1 B;  2GHV C;  4F3Q A;  4JI6 F;  4WCE Q;  3C6U A;  4GVB A;  1BWE A;  3CD5 A;  4MFB A;  2A0F B;  2M52 A;  2YWK A;  2LQ5 A;  4NCG A;  3D9B A;  2YY3 A;  4WP8 A;  2JFK A;  3BGL A;  4NWB A;  4G1P A;  1UTA A;  2HS4 A;  4LVO P;  3CO0 P;  3SEO A;  3WDO A;  3MDF A;  3CME S;  8AT1 B;  3OQ2 A;  2GVD B;  3C2P A;  2LXU A;  3IR6 B;  2KXF A;  2ZNZ A;  2NSB A;  4OYA A;  2XY5 A;  3VAF A;  5DG8 A;  1U8S A;  2UUB J;  1YQH A;  4FVC A;  4M63 A;  1SJ3 P;  5F9L A;  2HFV A;  2ASJ A;  3HHL B;  2HS0 A;  2CQ2 A;  2DGO A;  1N36 F;  2J7W A;  4J5O A;  3OUY B; 
#chains in the Genus database with same CATH homology
 2C2O B;  1RHR B;  2H54 B;  3R6G B;  4ZVS B;  2CJX B;  2FQQ B;  2QLJ B;  1RWX B;  3R7S B;  2CNO B;  1RWV B;  2XYG B;  2CNL B;  1F9E B;  2H48 B;  3IBC B;  4ZVR B;  2HBQ B;  3IBF B;  1SC3 B;  2HBR B;  1RWW B;  2H5I B;  1RHQ B;  3R7B B;  2QL7 B;  3KJF B;  1SC1 B;  2H5J B;  3KJQ B;  2HBZ B;  3R6L B;  4JB8 B;  4ZVO B;  1NME B;  1RWM B;  3EDQ B;  2Y0B B;  3P45 B;  3GJS B;  1RWK B;  3NS7 B;  2H65 B;  4DCJ B;  2QLB B;  5K20 B;  2QL5 B;  3D6H B;  1RWN B;  4LSZ B;  1SC4 B;  2H51 B;  2XYH B;  3D6M B;  3RJM B;  3R7N B;  5IC6 B;  2H4W B;  2C2K B;  3EDR B;  4DCO B;  3D6F B;  1RWP B;  2HBY B;  2P2C B;  1IBC B;  1RHJ B;  1I51 B;  2XZT B;  4ZVU B;  1RHM B;  1GFW B;  3QNW B;  2XYP B;  2C2M B;  4ZVT B;  3GJT B;  2XZD B;  1RWO B;  2C1E B;  1RHU B;  2QL9 B;  2Y1L B;  1QDU B;  1ICE B;  1I3O B;  2CNK B;  3GJQ B;  1PYO B;  3R5J B;  2CNN B;  2CJY B;  1BMQ B;  5IC4 B;  3KJN B;  1RHK B;  1PAU B;  3GJR B;  2DKO B;  1QTN B;  3P4U B;  1RE1 B;  3SIP B;  4ZVQ B;  2QLF B;  2C2Z B;  4DCP B;  2H4Y B;  2CDR B;  4ZVP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...