3SIPB

Crystal structure of drice and diap1-bir1 complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
103
structure length
103
Chain Sequence
MSYKIPVHADFLIAYSTVPGFYSWRNTTRGSWFMQSLCAELAANGKRLDILTLLTFVCQRVAVDFESCTPDTPEMHQQKQIPCITTMLTRILRFSDKQLAPAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/ligase/hydrolase
molecule keywords Caspase
publication title Structural mechanisms of DIAP1 auto-inhibition and DIAP1-mediated inhibition of drICE.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 20
structure length 103
sequence length 103
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 3sipB00
2QLJB 3D6HB 1IBCB 3R6LB 5IC4B 4ZVQB 1PAUB 3R5JB 1RWOB 1RHMB 4ZVRB 1ICEB 4DCJB 4ZVSB 1RE1B 1RHKB 2H5IB 2H4YB 1RWXB 4DCPB 3GJRB 2XZDB 3KJQB 3EDRB 3P4UB 1RWNB 2QLBB 3IBFB 3GJQB 3SIPB 2HBQB 2C2OB 3GJSB 2H65B 1RWKB 3R7SB 1QDUB 2H4WB 2CNKB 2QLFB 2CNNB 1RHJB 3KJFB 2C2ZB 2H54B 4ZVOB 5K20B 1BMQB 2H51B 1RHRB 2FQQB 5IC6B 2H5JB 2CDRB 1RWVB 2CNOB 1RHUB 3NS7B 3GJTB 1PYOB 3R6GB 2C1EB 3D6FB 3EDQB 3P45B 1F9EB 2XYHB 3IBCB 3R7BB 2CJYB 1I51B 2C2KB 2C2MB 2Y1LB 3QNWB 4ZVPB 2QL5B 1QTNB 2XZTB 2DKOB 3RJMB 1NMEB 1SC1B 2XYGB 2QL7B 2CJXB 2Y0BB 3KJNB 2XYPB 4ZVUB 2HBYB 2HBZB 1SC3B 2QL9B 3R7NB 2H48B 2P2CB 4LSZB 1RWMB 4JB8B 4DCOB 1RWWB 1RHQB 2HBRB 1GFWB 4ZVTB 3D6MB 1I3OB 2CNLB 1SC4B 1RWPB
chains in the Genus database with same CATH superfamily
3LWMA 3DGPA 4PG6A 3WX4A 1PAUB 4A8MP 4QW8A 4AQYJ 4YY3F 4IUFA 4EU0A 1SJFA 1Z1ZA 2ATCB 2GFFA 1RTZA 4LSLB 4ZJOA 3SI8A 1FRIA 4ZHRA 2IVMA 2MJUA 2VG6A 5F41A 2M4MA 1XMQJ 2E5IA 3I32A 5AE3A 2RF2A 3W7BA 3M8QB 3UVJB 1U1PA 4CLLA 4DFKA 5KFZA 1RT1A 2RS8A 5A8WB 1Q8BA 4YR3A 1RWUA 2VA2A 1N5TA 2HFVA 3G96A 3JYTB 1C1CB 4BC7A 3W5ZA 3FZ2A 4NLSA 3AAWB 3GLJA 8RUCA 5HSPA 1JXVA 1LK5A 3IS9B 4B08A 1B70B 1R31A 2DXFA 5I3QA 4PXDA 3T5LA 2DR8A 4CLYA 4RW6A 1VJWA 2HFZA 4NCGA 3GFXA 5F9NA 1QTMA 4WK1A 2C3MA 2VKRA 4EK2A 3GV7B 2W9CA 2G4BA 5H1SV 4HHJA 3MM6A 4DR4J 2YNFA 3K5NA 3UCUP 1UVIA 2EKYA 4ZA1A 4LREA 5DM6Q 4C8NA 2CPJA 3THPA 2GIFA 2AP6A 3TQ1A 1VISA 1NO8A 2YNIA 2OELA 3MM9A 1MG7A 4PUOA 5CYJA 3HHLA 4B9TA 4R8UB 2RNEA 5LSRA 1UFWA 1LQ9A 5LSOA 1FX2A 2CJ9A 3P5BP 2G2ZA 2G1DA 1VHFA 3RBZA 5HP1B 4M5JA 1BLUA 1KBRA 1OPZA 3CVKA 4U8VA 2HGLA 3HSDA 2N3LA 3MCMA 1S6PB 2MQNA 3FMBA 5EWEA 3B4DA 4IRKA 1U1MA 3OUYA 3TVYA 4UZBA 4I56A 2RAQA 1M90T 4M5GA 1RT6A 2V67A 4X4PA 4LFBJ 2MZJA 2V2ZA 2WSEC 1HNIA 2BX6A 4ECVA 2G2YA 3RGIA 1JJ2R 4RL1A 3PEHA 4DV0F 1QLNA 3SXLA 1YJVA 2VJVA 2KT5A 4FYXB 3DYAB 1M5OC 2PI5A 2GJIA 4DG1B 2OP5A 2YNHA 2RE1A 1FNXH 4CH1A 1H7WA 1TP7A 3OPKA 2LLZA 2H3EB 4GKJF 1RUSA 4LJMA 3J7ZT 2V9WA 4Y3CA 4B3OA 3MECB 4ECWA 3NGUA 3SZ2A 3PX6A 2P9GA 3AOBA 2DCLA 3M2RA 2HQDA 1TUGB 1TL3B 1BD6A 1SJRA 2AX1A 1XJWB 4JV0A 1L3KA 1NMEB 2F8EX 3VGSA 5KFFA 4C3KA 4NYZA 4WPAA 3F0NA 3V4IB 4CCHA 2ZOMA 4DSJA 3MMCB 4A8QA 1HNXJ 2CNLB 5AJ3J 4OX8A 3VAKA 3PYGA 6FD1A 2W2NP 1NK6A 1RTJB 1JLCB 3RG6A 4ETXA 1WUUA 4U9RA 4FF2A 3OTOJ 4FS1A 2K3IA 4P73A 1AT1B 1WG4A 4OZ0A 2B5JB 1LEOA 3RR7A 1PJ5A 3DM2A 4C97A 2XS7A 3SCIE 4I2QA 2LYVA 1NDCA 3KJVB 2VQEJ 2H4WB 1V3SA 1CJTB 5DDRC 4HT7A 5F3TA 5MAOA 1KLMB 3A1YG 2WTFA 3CCZA 1EX8A 1VRTB 4UY8T 3Q89A 2E7XA 3TAMB 4LFCJ 3MTJA 5F8MA 4B9UA 2DR7A 1UJ5A 5CYMA 1UL3A 3FSYA 2R2TA 3JQKA 3NBPA 3I9ZA 2CPFA 4TNOA 2ZH8A 5FDLB 2BKNA 3B54A 4NLQA 3EXYA 3BH7B 2Y1RI 4X4QA 2ZH9A 3ZNJ1 5EGYA 3HZGA 3LW5C 3HULA 5IOLA 4RR5A 5I3UA 1Q81T 4RW4B 2NYHA 3OW2R 4NLRA 5E5NA 4LSLA 5CD4A 3KXDA 3AD9C 3B6BA 4AUKA 2CQ0A 3M30B 2VG5A 3M9MB 1YZ6A 2E1CA 1LKZA 2HFSA 3Q22A 2YBVA 5KFEA 1NK9A 2PIIA 4Y34A 2PEHA 1HMVA 4BWJA 4YB7A 2HQGA 4OZLA 3JYTA 1C1CA 2VFVA 1NPKA 2KJVA 4WTYA 2VIHA 3FFIA 5L46A 2HHTA 1FRJA 3KK1A 1A7GE 2XZTB 2R7QA 4C8MA 3L7OA 3OSPA 4UOCA 3HT3A 1AUSL 2Y8WA 4DCOB 1RWWB 1KWMA 3B78A 1RAAB 3AOCA 3ONQA 4NLDA 5F9LA 2HEKA 4LUBA 2M9KA 3EGNA 4YR0A 1TR0A 1JB0C 1UCNA 1RYSA 4C8LA 4HACA 2AMCB 5F0WA 3BKTA 1RA6A 3VR1A 2IY5B 3T19A 3IR5B 4ED7A 1X9SA 3K8VA 1M5KC 4OJHA 1HARA 2DGQA 3KHHA 4B3SF 3CW2C 3L7UA 5MLCV 4GVLA 2DHSA 1WSRA 2K06A 3EZUA 5KFDA 4A8WA 2FC8A 4GKKF 1DLOA 4FYYB 1T11A 2IBKA 2AZ1A 2ACYA 2HWTA 2O01C 5AXKA 3U1NA 2M7SA 2ZE2B 3LF0A 1S6PA 4A4JA 1TL1B 2MSTA 1VYAA 4PXCA 4ECRA 3MWBA 1NKEA 2EBEA 2V8VA 3KMSA 4ZVTB 2ACMA 3EVWA 5DLGA 1I5OB 1PGZA 3FSIA 4DV7J 1L5UA 2CVIA 1V5IB 3ET6B 3GQCA 3DYAA 3KFWX 1RHKB 2YWFA 1BQMB 4K5RA 2IA0A 4J5OA 1VMBA 3U27A 2PDAA 3CCSS 4WP9A 3J7YU 4NE9C 1WWHA 4QR2A 4TU7A 1UETA 2JEJA 1KC8T 3NMRA 1IKXB 4ZVEA 2J8SA 1BGXT 4JV5J 2R7OA 3CCRS 3PRBA 2MXYA 3PCOB 3TRGA 3MM7B 2VZ9A 4ED3A 1R0AA 4CO3A 2VG7B 1TL3A 3MCOA 1Q53A 2RD5C 3PIOQ 4O4GA 2HIYA 4ID8A 3OR2B 2C2NA 2HNZB 2LXIA 2FPHX 3QZ7A 3KNGA 1RQ0A 4NXMJ 3V4IA 1NHKL 5E2QA 2DHXA 1MMDA 1NCLA 4I1TA 3MMCA 2LU1A 4X65F 1SH3A 4FXDA 4ID5B 3KTQA 4DR7J 3OVBA 2Z2YB 1CBKA 4IG0A 1IXKA 2GV1A 3I0RB 3QGGA 2JLGA 3I9V9 4USVA 3VF0B 2B5JA 3X3UA 2CQHA 4DCPB 2KDOA 4FZVA 5KG4A 3BR9A 3R3TA 2BE7D 2BV3A 4LF4F 2HIQA 4F0KA 1T0TV 2FLOA 1SV5B 2W24A 4Y6IA 4CP5A 5KT4A 4C2MA 2IAJA 1HHSA 1U47A 2B9WA 4ZCMA 1X4DA 1PBUA 5LJ5Y 1HW9A 3M2VB 4KYZA 2GVZB 3JTPA 3ILJA 1B99A 4CLTA 1NSAA 1WNEA 3HHNB 4DPOA 2B9XA 3RRKA 1B0TA 2NUUG 4URQU 5GADU 5FDLA 4IRDA 1K0VA 1PIEA 2HMIA 4R25A 2PA8D 2DGWA 2YKNB 2AQ4A 3HPOA 2J0XA 4RUBA 2VDHA 3KNAA 3CULA 5FLXU 4EMDA 1UA1A 2WOMA 2DNHA 4KHMA 3D67A 2AHOB 3SFUA 3LTOA 2MPUA 2V4RA 1U48A 5B08A 4DR1F 3OQ2A 3OR1A 4RW9A 3MMBA 4LR7A 3TZXA 3M30A 4FXVA 2QLWA 3KLVA 3Q8YA 1U2FA 1XN9A 3QYYA 4NLGA 2A2DA 1C1BA 5L9NA 3HJFA 4K4SA 4DV1F 4Q8FA 3H40A 1BC6A 4OYPA 1TVRA 4KKOB 4G3IA 3C8YA 3QWUA 4QWEA 2GHPA 2AJ2A 4F4AA 2DNZA 2VFSA 2C2KB 5U47A 2ZZMA 3QNWB 4FNIA 4A46A 1M5HA 1IKYB 1IM4A 2I5JB 1TL4A 3GR1A 1T3NA 2WCXA 1F6TA 1EAYC 1L3UA 1N33J 3EJMA 3KLGA 3ZTOA 2VH7A 4LF8J 4IKAA 1RADB 3ULHA 5E0OA 3PW4A 5HVFA 2BJ3A 2FJAB 2LQBA 3K0JA 3NS6A 3OVSA 1R89A 4MKVA 2XY5A 1CS4A 3LA0A 2EPIA 5SZTA 1EZZB 4LF9J 4JOUA 2BE9B 4CRJA 3GIMA 1S1XB 4ZIVA 5E3PA 1HKAA 4Q43A 1R6VA 1FJ7A 2YKAA 1KONA 1RBAA 4LF1A 2H1YA 3W66A 3H5UA 2A3JA 3EMTA 2X1AA 2DHHA 2JFKA 2ALZA 2QMWA 5FLXY 5L1IA 4HLBA 3RBDA 1TK0A 3QRPA 3D7SB 1JJCB 3GJTB 1TL1A 3V6DB 4JUZA 4DV2J 2OPQB 2V2VA 2OHDA 3GSDA 4ZKAA 3OL9A 4ES2A 5J2MB 3RJMB 3SQOP 4P2XA 2XMTA 5LL6d 2CPZA 4G65A 4F3QA 5CAAA 4GO7X 1RAHB 3ENQA 3ETMA 1NJWA 1S9GA 3RRGA 2YQ0A 1R7IA 3GB0A 1U1RA 3R5JB 1RWOB 2R7SA 1FTCA 1TL7B 1ZA1B 3BSCA 3TANA 1FEHA 3SYZA 4RX6A 3VVUA 2HWIA 3KMQA 4WXWA 3MDFA 1TAUA 4FVCA 1SPBP 3HP6A 1TKTA 2WW4A 3VCDA 3G8TA 2RH3A 5ETVA 3Q8UA 2XS2A 2E9RX 2XY7A 1RWKB 3GMGA 2PN6A 3JQMA 4JI4F 2Y1JA 4CLSA 1G2EA 1K8AT 3LGHA 2R4FA 2VG7A 3OFGA 2VU5A 4QQBA 1KDNA 4CLUA 3I6PA 5M2PA 2MKIA 2HNZA 1UPMB 1FO1A 3PW5A 3MAAB 1V6HA 5DGAA 5DQGA 4DI6A 3EUNA 5CD4H 3CJ8A 5H9EJ 2UVUA 2DXDA 4NA2A 1MMNA 4FNHA 3GYGA 2XYPB 3BSNA 1PG5B 4NCBA 1SC6A 1VBYA 4ED8A 4J9LA 3S1TA 1HR0F 3VVTA 3M05A 4CQ1A 4DCJB 1RTHA 2VOPA 2CQGA 4N76A 2KZZA 3O1LA 3CCJS 1RAIB 4O23A 4NLOA 2KL8A 3QGPA 4TXSA 2AX0A 1T05B 3GG1A 1HW8A 3M2VA 1DTQB 4EZ6A 3GWCA 2MQOA 3O5TB 3TZZA 3L09A 2BBEA 1KR4A 4X64F 2ZDPA 1FJGJ 1OQ3A 1OWXA 3FBBA 3R27A 2MZSA 3NGSA 1URRA 2EW9A 3LP2B 2E1PA 4A8YA 3GONA 3MAHA 4KV8B 3CMES 5J1NA 1MW7A 3JSMB 1NHVA 4D3GA 1WELA 4NA3A 2AJ1A 3K59A 4CT8A 2L41A 3DLEB 2QA2A 4WCEQ 4QYRA 4NXMF 2G0IA 3Q23A 1VLYA 2Y1IA 4EO8A 2DEJA 1SUQB 1B64A 2DO0A 1VQ9S 1RT7A 4W92B 2AWZA 3HD2A 1N8RT 2F9DA 2KN4A 3N5FA 2XO6A 2ZUAA 4UT4A 4CT9A 1YJUA 5K9FA 2HVIA 2BRLA 4O44A 4KKOA 2CQ3A 4FYVB 3DRSB 3VWSA 1ULRA 3HJVA 4ZVOB 2HZVA 4DOZA 2MZRA 1JJ4A 5D6GA 4F4WA 3OLBA 4DFMA 4DMZA 5KG7A 1Q95G 1U0HB 1XERA 1GX6A 4J9PA 1QSSA 5IM0B 3WC2A 1IKYA 2FVCA 3CIMA 2BJ7A 1ZAXA 3RBXA 2I5JA 4Q8EA 4YB6A 9RUBA 2KU7A 3KLHB 3DU5A 3QSYB 3GIKA 1JLFB 4C3MA 1H98A 2H5EA 3L7PA 1U45A 2CG4A 3C6TB 1JLBA 2FDNA 1L3VA 2BKOA 1F5CA 1VJQA 2NLWA 2BM0A 4DL7A 4M5MA 1WEZA 1S1XA 2F65A 5RUBA 2WSFC 5B0FA 3MEDA 4IQMA 2PO4A 3PM9A 1SL1A 3QO9B 1RKJA 2V8GA 3CO9A 2JL9A 3UCZP 2F3JA 3DCAA 4CI0B 3HHDA 3NMAA 4E8UA 3KG0A 4GRSA 3SQGB 1M5SA 4RUHA 3KWMA 4DPWA 2GZOA 2OEJA 5LMUJ 2NREA 3UDLA 4P2MA 5L1LA 1M1GA 3GTYX 1HNWF 1WACA 3KLIB 2D3ZA 2VOOA 1BMQB 2C3YA 2MKCA 2CQBA 2KB2A 1FA0A 3M4XA 5F0UA 1D8YA 1ZM3A 1TFYA 1LFPA 2UVRA 2ZJQQ 4UQGA 1NXIA 2DISA 2OSQA 2FUG9 3C6UB 5F8LA 5J2MA 1BE4A 1XNRJ 2LA4A 4I69A 2OMOA 2YH0A 2ZWOA 4RW8B 2BJEA 2E66A 4L6V3 2XMJA 4P72A 4DV4F 2B51A 2FVQA 4DDFA 1FD2A 2HBZB 2ZOGA 3AH6A 3MF5A 1LW2B 3ELHA 2OFHX 4B9NA 2R8IA 4O3PA 1REVB 1Y00A 1TL7A 3ZZOA 4WZQA 4DV5F 5GAGU 3QFWA 1TK8A 4L3NA 2D1CA 3PRVA 1FKOA 2J0WA 2A10A 2DGTA 2C2DA 1MN7A 2BW2A 1UZHA 1RAGB 3IR7B 1TMMA 3LUYA 5E7OB 1FTRA 3P4UB 3IG1B 4DQSA 1QAIA 2Z57B 3AJ2A 2V4QA 3UQSA 3L9ZA 3ISND 2BQRA 2HZAA 2U1AA 1C0TB 1CJVA 2WZ1A 3CJ0A 4OHVA 2DY9A 2E7WA 3R8YA 3R5BA 2L3MA 5T7LB 3MAAA 2CDQA 2HK3A 3LQVA 3HHKA 4FXWA 4LF6J 3BF4A 2W7AA 4TU9A 1F9FA 3BKFA 4ZPAA 2E5LF 1UFKA 2XWYA 3M6XA 1D09B 2VPXB 3AHPA 1GXUA 3MI7X 1XR6A 3M8WA 4JI2J 1HNVB 4KPCA 3RR8A 2UUWA 3AA8A 5CCLA 3BYRA 2EG1A 2C3UA 4HDHA 2JC1A 1UVLA 3VAHA 4UW2A 4NLUA 2OTJS 4DV6J 3FVYA 3W2VB 4KH1B 3GIJA 3MFHA 4PR6A 3GYNA 4KQZA 2DPIA 4Y2KA 1T05A 4WFYA 2DRDA 1FJEB 2HQCA 3QBCA 3TZWA 4QU7A 3BGFA 4X84A 3HMJG 3X1LB 4MKYA 5HJYA 3NWRA 1K73T 2VFRA 4OLPA 1NJYA 1N32F 1NHUA 4X62J 1SIZA 4UZCA 1FERA 5KFVA 1IKVB 3MUMP 1VC5A 3CC2S 3AA9A 2OTLS 1NJIT 4NL5A 4J9KA 2LECA 4XIUA 3PRDA 2A6OA 5F8NA 5JXSA 1UFLA 2QA4G 4DX5A 4DL0C 1YSJA 4OYOA 2DIVA 4KV8A 5IXUA 3JSMA 4RWWA 3D1QA 5KFTA 3OV7A 3CJSA 1B4SA 1RACB 3CJ3A 3DLEA 3GPAA 4DR5F 1AZSB 1IQZA 2I9SA 2B43A 4XTTA 2NZ4A 1SUQA 1FHTA 2GO8A 1IR1A 2QFIA 1VQ6S 4UOGA 1WF2A 1BQNA 3SFGA 1N34F 2JH3A 2QSWA 1X4EA 4QYZK 3KK3A 2V2KA 2BQ3A 3DRRB 4RLEA 1NDKA 2LFVA 2UUCF 1HBMB 1S1WA 2ZHBA 1AB8A 2CQIA 4RZRA 5L9XA 3BO2A 3OSNA 2CPEA 1NK4A 1YIJS 3JSBA 2RHSB 3BGOP 1AUDA 4MAKA 2WBMA 1WI6A 4N77A 1S59A 3P45B 3QQCD 1NK7A 4ZJLA 1AYEA 2DNKA 4JI3F 4M5KA 4UUWA 4DX6A 1C0UB 2RUSA 1OJ4A 3NLCA 5LM7E 4QBUA 2XMUA 1UA0A 2YQ3A 2CQ4A 1UVNA 4CLFA 3D66A 4Y0FA 4N8OA 2HHHJ 4HL9A 5K14A 1R8HA 1N0VC 2Y9HA 3GYXB 2C28A 3P49B 1JLGA 3M6UA 1VR6A 2ZVSA 4ED2A 1IR0A 4FYWB 1WTFA 3BQ0A 2A0FB 4B02A 2EEYA 2VC1A 4K4UA 1MNEA 1S1VB 4ZP7A 4NEYA 2UXDJ 4G1IA 2FJXA 3JQJA 3KLIA 3MEGA 3M6WA 2J9DE 1ROFA 5LMNJ 1HL6A 5KFQA 4F67A 1B3TA 2QYGA 5IT4A 1M1KT 1N5VA 4ETZA 2LKZA 5J2PB 5HO4A 3NOGA 4ATNA 4C8KA 3TUZC 5A2QU 4RBUA 3WDOA 2EFOA 3P5TL 4RW8A 1Q8KA 2AZ3A 4B3RJ 4EUVA 1SQEA 4V1Ak 4RU9A 3V4MA 3DLKA 1HBUB 5AXNA 2IM0A 3N4WA 1LW2A 2RB7A 3HKWA 1Q5VA 3ITHB 4KSEB 4JI0F 3QLHB 4J37A 3OHBA 1REVA 1KP6A 4DUZF 1MWYA 3HD1A 5BR8F 5DRKA 1YJ9S 2DNRA 3DOLA 1Y11A 3CSKA 4Q2MA 2JNJA 4B9VA 1H2TZ 1P1TA 5HANA 3NGKA 4P7TA 3KDNA 2HQIA 2ILZA 3LP1B 2D7SA 4X4RA 2Z58B 5GMKa 2W4CA 3H98A 3M32B 1E6VA 2DR9A 2AKWB 2FYXA 4NWBA 1NDLA 4MKBA 1TMJA 1J5EJ 1U8SA 3PG9A 2B6AB 1IBKF 5C24B 1NAQA 4AL6A 2CJBA 2UV8G 3UR3C 2VICA 2LXFA 2XZWA 2BRKA 3BPSP 1EIYB 3HHEA 1HNVA 2RUGA 4RWXA 1WOPA 3HM9A 2G9OA 4YB5A 1EETA 1QSYA 2NR0A 1DURA 4V19J 2HS0A 5E3CA 3ZO7A 5JJBA 1X5PA 1Y5NB 1RTIA 4ZVQB 2W8LA 1SKRA 4E2FB 5A8KB 4PXEA 2XMAA 4OYXA 2UVWA 3U02A 4ZDNA 3CJTA 5F8HA 2MLZA 3TVZA 3BGUA 4FDFA 2AJFE 3I5AA 3UCGA 1HQUA 3KOAA 1HIYA 2Z2MA 1GK8A 1P27B 4LSNA 1HQ2A 4HTIA 3D0HE 4TLRA 1XMBA 2UVVA 5KTQA 2L9WA 2HFNA 3DHXA 1GQEA 1WC0A 4NXNJ 1RAEB 3RZAA 1T03B 2R2RA 4QJVA 2JRSA 2KRRA 4TU8A 1D3WA 3ZFVA 3FRZA 1JJHA 2QL5B 4OZ2A 2VFUA 2ZNZA 1T9TA 3EGZA 1S10A 1AZSA 1W25A 3LPYA 3MXHP 2UUAJ 1B7FA 3D9BA 5AE2A 4ECYA 5GAEI 4ITSA 4K4WA 2VODA 3IRWP 2CQPA 5HVGA 1XK8A 3TP2A 1XNQJ 1U0SA 2IC3B 2CA9A 4JI2F 4JYAF 4V19X 4U6PA 2O3DA 3FEYB 1KKHA 2I8EA 1HFEL 3IGNA 3PR5B 2K1RB 2FY8A 1HQEA 1HBMA 1Y3JA 1LWEB 5L39A 2CIMA 2EK6A 1NM2A 2MZ1A 3W2WB 1UWBA 4Q0BB 3VAIA 1X60A 1NKCA 2JLEA 1FK9B 1H0HB 2AGQA 3G9CA 3RB6A 3R5DA 1C0UA 1DZ5A 5DDPC 1JX4A 3T1HJ 4P10A 1HYSA 4IH6A 3TA2A 3O8WA 1D9FA 4USKA 3OTCA 2AW0A 4N8NA 3A3PB 5L1JA 1XMOJ 4LF5J 3UD4P 5D78A 4O0NA 3CCLS 2HW3A 1FXLA 4KFBA 1QE1B 4N47A 2VQFJ 4Y28C 1GAOA 3TEGA 1VBKA 2CQCA 1U26A 4P2SA 2ZM6F 3H8YA 3BSAA 1OY9A 4U8YA 2MGZB 2EVZA 4HDGA 2ZKUA 3T9ZA 4MFBA 2IMOA 2KO1A 5J1EB 4I6WA 1LXNA 1WORA 5AXMA 2ATLA 5LXRA 3M8RA 2JEFA 1X5OA 3V81A 4KGVB 5ETNA 1VK8A 3V2UC 4OX9J 1KFSA 1S0VA 2HHXA 3PXGa 2H65B 2XLJA 3MM8A 5BYRA 2NSCA 2DGOA 4CLZA 3W9JA 1GMWA 4C4WA 2Z56B 3LANA 1UWAA 1PC4A 2UP1A 4PQUA 5M2UA 3A3OB 2MQQA 3KK2A 3R6GB 1WG5A 1WDTA 1VQOS 2E29A 3QGHA 4PABA 2V6AA 1HBUA 3L4BC 4O3RA 4DQQA 1CJUB 1HPZB 3CC4S 2BYCA 3ITHA 1HBOA 2ZBRA 3QLHA 4K5SA 3J81U 2DNYA 2OH2A 1MWZA 1L3SA 4NZ0A 2FZGB 4DR2F 3UWTA 2Q1LA 2GIRA 3A4TA 2DYAA 3HLUA 2QMXA 3I82A 3QPIA 2VKZG 3DKDA 3GJRB 4MYTA 3QRRA 2IJNA 3M32A 3V6KA 4W4MA 2O5DA 5I42A 4C48A 2N3OA 1OY6A 3J80U 1N36J 3A13A 2WVCA 2OMLA 2HGMA 1SJ4P 2QIFA 2V50A 3BH6B 3CEDA 3J7A1 5D0RA 1RHJB 3P8BB 4ZPCA 4DFJA 2RRBA 4KH0B 2BE2B 1MMLA 3K58A 2HS4A 2HFOA 3F56A 4OYAA 1JK9B 2ZZNA 2ZHAA 4J90A 5KFXA 4EBEA 4YHHJ 5C42A 2C2MB 2GQ2A 2O66A 3LGMA 3W1YC 1JXEA 2FJWA 5DZ6A 1QVFR 5KFSA 2HVEA 3M6VA 1Q82T 2YX1A 3MHYA 3T1YJ 4EBDA 4A48A 3KLFB 1SCJB 3I5BA 4ENOA 2VV5A 3DGPB 2WB1D 3EVOA 1RISA 2VL1A 3M9NB 2V63A 1N6QA 2MQMA 2B9EA 1HI0P 5SUHA 1VGYA 2DGXA 1AXQA 1FRHA 1KHVA 1WOSA 2XTJP 3K17A 1IVZA 2A18A 4L76A 2B8QA 3HK2A 2J76E 2CAJA 2VFTA 2VG6B 4FKYA 4Z7YA 2HHSA 5CXTA 1UVKA 2JHEA 2MQLA 1YJ7A 1S97A 4DR3F 1AA1B 1VBXA 2XHCA 1HBNB 2E1RA 1QDUB 3UFCX 5D77A 1KSPA 3PNIA 4RNMA 1Q8IA 1RT1B 4OJ3A 2ASJA 2O1PA 5IZHA 3LOUA 1IN0A 1TTHB 2MJNA 2CDRB 4LRFA 3CDEA 4IFYA 4QZVB 1KQFB 1LWCB 2BA9A 1SI9A 2XGPA 3AXKA 1U2CA 3PHEA 2O67A 1N88A 4RW6B 3CTRA 1QJHA 4NCGB 1LWXA 1S6UA 1X4CA 1YWXA 5DGBA 2W9CB 3PFEA 1TUWA 1NUEA 4DR6J 4DL6A 2YNFB 3RW6A 4MH8A 4WFAQ 2XLIA 1U1OA 5CABA 3KHRA 1H3DA 4EWTA 2YNIB 1RAFB 2V5HG 3MM9B 4QIWD 3BV8A 2RU9A 1LWEA 4PUOB 3JTOA 3HHLB 5KFAA 4JI7J 2UUTA 1Y10A 4WU2A 1HNZJ 3C14A 3CDBA 1V9OA 3IBWA 3NY0A 2FVRA 1FFGB 2VPWB 3HVWA 1KQKA 5KG3A 5HMZA 3UDCA 2XM3A 1XC9A 2HG4A 2QFJA 5IT9Y 1APSA 5DS7A 2Y1LB 1KN6A 2R7RA 5AT1B 4X4OA 2ZH5A 4RUAA 1RLDA 2OPPA 1RT6B 1ZZNA 3IO1A 1F3VA 4FBUA 1XEZA 4LF7J 4C7QA 3G8QA 7AT1B 3EE3A 2MLXA 1HNIB 4Z7CA 1VK3A 3ENWA 3MEEB 2GCFA 2PC6A 4ZLPA 2KG0A 3IAS9 5J1EA 1GMUA 3D6HB 4WE1B 2YNHB 3MR5A 3H5YA 2QA4S 1FRLA 1SH2A 3M1VB 4USMA 5B0AA 2BJDA 1FKPA 1PC5A 1WC6A 2AV5A 2UUBF 3H2LA 3M2RB 4RBTA 1GXTA 1HWUA 4PXBA 4QWDA 4BC9A 3BO3A 1JNZB 1GTEA 4M5DB 3EGWB 3H2UB 2J9CA 2RQ4A 4X4VA 1CJUA 1T9YA 4OJ1A 1K44A 3OLAA 4CO5A 4B9LA 1JKHA 1MROA 1U1QA 1FNOA 4ZPDA 2YX4A 4O4RA 2EC0A 5BYSA 3QIDA 2F1FA 3Q8SB 2GAGC 1YHQS 3HVAA 2JC0A 3BZQA 2DGSA 3GSIA 1V3RA 2RDIA 2F4VJ 4PEOA 1QD1A 2DPJA 1KVJA 2ZBCA 1KQSR 3DC2A 3ISZA 2KYZA 4LBPA 2WBRA 2HLUA 3CCQS 4ZVRB 3DM2B 3CJKB 1EKRA 4F02A 4I2QB 1Q79A 1S0MA 4X4NA 3CCES 4ZCKA 4P74A 2YKOA 3KKFA 1RABB 3BPDA 1T9UA 2F5GA 8ATCB 4KHPF 3LAKA 4JI8F 2DD8S 3DXBA 2QRRA 2BE2A 2BEFA 2RRAA 4OI4A 1X4BA 4TN2A 1P9QC 4NRUA 5KG2A 3W9IA 4ZOSA 4ECTA 1K1QA 5CYMB 1VQ8S 3NBPB 3D5MA 4QIGA 2YWHA 1JXLA 3BBBA 4ZMMA 4P52A 4DUYF 2J9DA 4LRBA 1BQXA 3ZTPA 4NLTA 4EFAC 2HKEA 2C42A 3FQKA 5KFNA 1LFWA 4LIWA 4KO0A 3HKZD 1U7LA 3M2UB 2Y0BB 4JI5J 4L3KA 4DX8H 3C66A 2VBWA 3G82A 2X1BA 5I3UB 5J2NB 1TKZB 3NNCA 3QIPA 3VV2B 2EC2A 2X1GA 2FB0A 3W3SA 2WVBA 4M5HA 1LK7A 1I94J 2VG5B 3GP9A 5EN1A 2KFZA 1LOUA 3CJ5A 1JMTA 1MLAA 3NXZA 3N6NA 2DCUB 4PAAA 1HHQA 2BOPA 3FQLA 4H4KC 2W9BA 1HBNA 4IG3A 4F4KA 3IC1A 3BO4A 4L74A 1HMVB 5H9FJ 4QCLA 4NOHA 3HHLD 3IRXA 4HH1A 1VC6A 1AROP 1WC5A 1J27A 2GQQA 3KG1A 4F8RA 1QAYA 3W65A 2K8GA 3FFIB 3CF5Q 4UQTA 1FESA 3MMAB 3KK1B 1LWCA 2C1EB 2RU3A 2HSEB 4KRWA 2VD3A 3PIPQ 3GIRA 3TW0A 1VI7A 4ED1A 1SKUB 2H9ZA 1JLQB 2XSFA 5CA5A 3H42A 3I56S 3K2YA 1EKSA 4PYAA 3DHWC 3KUGA 2ZH7A 4HACB 1SKSA 3FEZA 1NB7A 2OJ3A 1GTHA 3DDIA 4KHRA 3T1YF 2EK1A 5A6WA 5HN0A 3FNNA 1HI1A 2XZDB 2FLNA 1NH8A 4B3TJ 1VQMS 3EGVA 2Y3YA 2B0GA 2KXHA 1DLOB 1SJQA 3IBFB 4LFAJ 2E1MC 4PG8A 1S4EA 2F63A 4WF9Q 1S48A 3ZTRA 2FGCA 2W25A 4A8KA 2BACA 2UXCJ 3AY0A 3DXSX 5K20B 5KFLA 1H74A 2W9AA 3HVTA 4K0KJ 3J7YI 1UJ6A 2M52A 9ATCB 4ZITA 3H2VE 4LT6A 3QT8A 2DT9A 3A8EA 2DO4A 3CJ4A 3CCTA 5LSLA 4TY8A 3E01A 3TI0A 1ZH5A 1VLOA 3MEEA 2QL7B 4PWUA 3FBCA 5IWAJ 5G0RA 4CLPA 2EFQA 3C3LA 2KZMA 4OZ1A 5A6PA 3PW7A 3SV4A 3O44A 5ETMA 4WE1A 5GAHI 3ZZTA 4UF4A 5B09A 3ZZRA 4ICLB 3JB9k 4QR1A 2XULA 1N0UA 2G2OA 3H90A 3M1VA 1VRUB 3KUHA 2AU0A 3UO0A 4DHVA 4USWA 2BOAA 3CDUA 3FUYA 3MCSA 2PA3A 2VDIA 4B9SA 2MQ8A 1KRPA 5D8HB 2YWGA 5HVHA 2DNQA 2YPZA 4TKTA 4XPCA 5GMDA 3DLGB 3SDEA 4X66F 2XCPA 1R0AB 4PWDA 2CWKA 1P8GA 3F73A 1ZAVA 3MEKA 1H2VZ 4JI7F 4M5DA 4F36A 4O4GB 3VZIA 1YDLA 1QY7A 3H5SA 2ZH1A 1HNZF 1KVIA 3VAMA 2V4JB 5EX3A 3DGVA 1PSDA 2W2OP 1QVGR 3FCVA 1IBMF 3SCJE 2J5AA 3FEXB 1GXLA 3ZTSA 3H0PA 5KFOA 5JMNA 4ELUA 4O0IA 3PKYA 4DPXA 4IG0B 2OPRB 4ER8A 3ENVA 3DNCA 4OFZA 4ZP9A 2BJ9A 2WVEA 3CJKA 5T41A 3AJDA 5GADI 2UXBF 4USTA 2PSZA 4TLQA 3K5LA 2U2FA 1RKIA 4B3MF 1IJFB 1S7HA 1OIAA 4Q2LA 2IAJB 1UKUA 2CADA 1IBLJ 3CJQA 1RT5B 4WIQA 2XMWA 4K4TA 3FCWA 3GZ7A 4M8LA 3GCXP 2C2OB 1BUXA 4JI1F 2QTWA 1CVJA 1WC1A 1NK0A 4QW9A 4C3LA 4Z2XA 5D4LA 2K2PA 3MPYA 4PCQA 1W2BR 4DWIA 3D68A 3HF5A 2P6SA 2HMIB 3AB2B 3D6FB 2OFGX 1F9EB 4G1QA 2UU9J 4PG5A 3MZIA 3M2UA 1VHIA 2GMHA 1FF2A 6FDRA 5J2NA 3Q2TC 2WOMB 1TKZA 3W60A 2XI2A 3TYTA 5DLFA 3H59A 3OR1B 4RW9B 3MMBB 1VQSA 3NS5A 2WONA 3T9NA 1SJ3P 5B0DA 1Q86T 1RLCL 5EX0A 1C1BB 3CPWR 4OHXA 3ZC4A 2BVZA 4UOFA 3OFHA 1WF1A 1QAXA 4XDDA 2QT7A 2DRBA 5AE1A 4Y2AA 5DO2A 4DPYA 2KG1A 2G13A 1TVRB 1RT2B 2QLXA 1O6XA 1Y5IB 3ZTQA 2GMLA 1FDBA 3R7SB 2AYMA 1F3FA 2ZJRQ 1UEKA 2DIUA 1FXRA 4IQXA 3MMAA 5KT7A 2XQCA 3TJ9A 1FI4A 2BZ2A 4EYIB 2LP4A 4K4YA 3TX0A 4A47A 4H4MA 1JLQA 2LEAA 1U2RA 2C22A 3CD7A 3KLGB 2AD9A 1U25A 2QE5A 3TUIC 4W98A 2GO9A 1FVQA 1QM9A 1ITPA 2CVEA 2J7WA 3QMQA 3D0GE 4DV3F 2I38A 1ZA2B 1HWIA 1CS4B 4P71A 3RAMA 1RWPB 1H6KX 4IOAQ 1E6YB 4P9SA 2HYIB 1RJJA 1FE0A 4AQYF 4ZVSB 2OGUA 3HVRA 2HFUA 3C46A 2Y0SD 3TZYA 3ZZUA 4YY3J 2P5VA 4PKDB 2G0CA 5D0EA 1RBOB 4YDXA 4I7FA 3I55S 4FYDA 2RVJA 1XMQF 1OPIA 4P7VA 3K57A 2W8KA 2KM8C 1PYSB 3K5PA 1U6BA 2EKNA 1Q16B 5CZXA 1TK5A 3HFKA 1RU1A 3QJJA 1YVFA 3G6XA 3NAHA 2X7IA 3F44A 4N5SA 1O5JA 1CLFA 4WIIA 3CE8A 1FE4A 1XTZA 2KT3A 3ENAA 4ED4A 1WHWA 4I68A 1OO0B 1KOOA 2IRXA 2HNDB 2YWKA 3P6YC 4H4OB 1YLXA 3NNHA 2B4UA 2D9PA 4K2JA 1S9GB 3CT9A 2W4DA 3MUVP 2NUHA 4JV2A 2XB2D 3AQPA 4XK8C 4ICLA 1T9WA 1NB2A 1VRUA 4F4ZA 3PDNA 1SVDA 1TKTB 2JJ4D 2GX8A 3M8YA 1YRTA 1RK8A 4WFXA 2AJ0A 4UTGA 4DR4F 4K4ZA 5HMXA 3UN5A 1N54B 4MIBA 3OTEA 4C98A 2LU2A 4LVNP 4LF2A 3POTB 1W7WA 3DLGA 4GVBB 4K59A 3CUNA 2X3DA 4B9MA 1OSCA 2V9KA 1YI2S 4ECUA 1BXNA 2CPIA 4NYOA 4TYAA 4B3TF 3TVKA 2MSSA 1FRMA 2E44A 2V4JA 1RHUB 1CQNA 3BDEA 3RB3A 5EWFA 1HD0A 4LBIA 2E9TA 2F9JA 3QFHA 2YKMA 4DN0A 3PJWA 1J2VA 3HT0A 1UEUA 4A8XA 2XHWA 5LXYA 1LWFA 2LXUA 3EPIA 4X2BA 1B7YB 1X5TA 2OPRA 3HO1A 3TA1A 2ALYB 5KFCA 4C9DA 4LRCA 1VQYA 4LFBF 2IIHA 5THWA 3WHIA 1RTHB 4ES1A 1T94A 2FC9A 2QLJB 2PMZD 3MPVA 1RT5A 2KJWA 2N82B 3D4JA 3VZHA 4DV0J 2PD1A 3RAXA 1Q78A 2B7BB 1R0CB 3MM5B 3JS9A 4IOBA 1QAJA 3MR2A 4I2PA 4DBQA 4AL5A 2AYBA 4GKJJ 4TY9A 3UD3P 4IFVA 1SL2A 1S9EA 2RQMA 3FGVA 1M5VC 1WDDA 1REGX 1KLNA 2YQ1A 1UVMA 4DSKA 3CCVS 2MKKA 3EICA 4NA1A 3PX0A 3FKBA 1U49A 4IOCQ 3BYPA 2ZKTA 3Q86A 5GMEA 1O8BA 2XMKA 5E3RA 1SC3B 2V34A 5ETSA 1YBAA 4WYLA 1HNXF 2FIUA 5AJ3F 1DTTB 1RT7B 4AE5A 2BDPA 3ADAC 1QUVA 2D3UA 3ILIA 3VTIA 5KT5A 3BBFA 3DDKA 2ILYA 4MYUA 4MT1A 3US5A 3TAQA 4FF3A 4BCAA 2LQJA 3DLJA 1WKLA 1IWAA 3CC7S 3OTOF 2ZH3A 3DI6A 3H5XA 4O44B 1RT2A 2HQFA 2HHWA 1WOOA 4IO9Q 5DDQC 2VQEF 4YUDA 3H4DA 3SV3A 4ZS6A 1UVJA 1RHRB 4RU2A 1X31C 2XWXA 4BDPA 3O3LA 2H5JB 4RPFA 2FJBB 4LBHA 4LFCF 3OFFA 4F50A 3R7BB 5I4MA 2ZD1A 3TJ8A 4DLGA 1JLBB 4ZPBA 1RTDA 1IUJA 3THTA 3C15A 1X9WA 1Q4RA 2RHQB 2ZC4A 5C25B 2KFNA 3HHLC 2PT0A 3OJSA 1H7XA 1E6YA 3MEDB 4OYZA 5HQ8A 3RB0A 3DN9A 1X5SA 4IR1A 2X3GA 2J8AA 3VHQA 1WF0A 2PE8A 4C8YA 2XI3A 3R97A 4ECQA 5D4PA 2XO7A 3HXMA 1S9FA 1YGYA 4ZPWR 4MIWA 1ZS6A 5KG6A 1N5YA 3IWLA 4OYBA 4PPZA 1U4BA 3PY8A 5GAGI 4WK3A 4F3OA 2HNYB 4Z37A 2WHOA 2NPFA 3NCRA 1NRKA 5K8MA 2BJ8A 3TARA 4I0WA 2HNDA 2COLA 1DFDA 2ZZTA 1WEXA 2HRYA 4C11A 4H4OA 2DH7A 4RJVA 2B3TB 3LPEA 3T6BA 1JIHA 4KBIA 2PMHA 1CJKA 1MU2B 1PYTA 1Q7YT 1TELA 1D0EA 3Q8RB 2YH1A 4LVOP 1X4FA 1NDPA 4URSA 3VAFA 3LP0B 1FKOB 4AD6A 2V0NA 2K7KA 4C0BA 3CWJA 2EFVA 4ZLJA 3A8KA 2HHQA 5K8NA 2KT2A 4CTAB 1TV6B 4ANCA 3POTA 4RNNA 2XMVA 1VS3A 4GVBA 5HAOA 4YEAA 3MAQA 4QIEA 1CJVB 3D6TB 1JQGA 1S1TB 4B3SJ 1P1LA 3UN3A 4DFPA 4K8RA 3I0SB 3B8HA 2QGFB 2R9LA 4Q45A 1MN9A 1ACMB 3HSJA 4GKKJ 1SIWB 3S7RA 2MHNA 3OD2A 1MWQA 4NLPA 1F9HA 2C2RA 3BKUA 3EZ5A 1ZTTA 2MKJA 5EUHA 3C16A 3OHAA 1CC7A 3O2IA 2JEIA 2XY6A 5HJXA 1K1SA 4YR2A 4ZVPB 1R3NA 2FVSA 2KYXA 2M88A 3MFIA 1M1HA 3CD5A 4ILMA 2GJFA 2J0SD 2GGPA 4IDKA 4C0HA 3TNVA 3PVXA 4N7TA 3H25A 4HHUA 4F0MA 4OZ3A 5B7WA 4DV7F 1ZBTA 1NSKL 4XO0A 1FWKA 1RE1B 1S77D 2VBXA 4X4TA 5H9EK 4W90B 3MM5A 3DOKA 3UDVA 2CYYA 2HRTA 3JAMU 4OZ5A 5A8RB 5G4DA 1Z2LA 4JV5F 2CPXA 2ERRA 1NK8A 2HZCA 3WZ0A 2N4DA 3O6QA 2C2ZB 2QJ3A 3MPUB 3NS7B 7FD1A 3R5CA 3DU6A 1J5OA 4ZCIA 3DRPB 1HI8A 1SBRA 2BR0A 4NI2B 1S76D 2W1BA 2EFNA 5CH7B 2R7XA 4G6VB 2CG8A 1A9NB 2EI5A 2YWEA 4NEZA 3UR0A 2RKIA 2ROEA 1DTTA 1EQ0A 2RS2A 4X65J 1BQNB 1F5AA 4F4YA 2JWNA 3UNYA 4DR7F 1ZM9A 4RNOA 5CQGA 2R8KA 1YJRA 3KK3B 3UI3A 4CLKA 2JSXA 5IV3A 5CYQB 2W7OA 2E5HA 1S1WB 2I1RA 3DOMB 4F0HA 1T9VA 4LF4J 4ZLLA 2IYGA 2Z30B 1UP1A 2OAUA 3IAM9 2HHUA 1YTYA 4K2XA 3T41A 2XNRA 1JWWA 3Q8PB 5E33A 3M9OB 4X4UA 1RDRA 5F8IA 4OI2A 4EYHB 1I51B 3DMJA 5ETOA 1RA7A 5A0YB 1AW0A 4DPTA 3GG0A 1JLAA 3JAMY 5ETQA 5K14B 5C25A 2L9DA 1ZPWX 4ZVUB 3CDWA 2R8HA 1JLGB 1RHQB 1M0SA 1GFWB 4OLOA 2AJ4A 1I3OB 1WHXA 3FK4A 4NLYA 3QZ8A 4U67Q 2LA6A 4OHWA 3TUJC 5HROB 3CCWA 4CO1A 4DR1J 5B0CA 3NCPA 4J9QA 4WKYA 3MEGB 2CQDA 2ZNYA 3AB4B 5J2QB 1UEVA 3NG8A 4J9VA 2IHR1 4HTJA 4RKUC 3BQ1A 2XNQA 1SB6A 3GJSB 4J7CA 5LT5A 3IP0A 1ZYQA 1M5PC 4F25A 4ZN1A 4DV1J 2B4OA 2HNYA 4ALZA 1D8ZA 1WJ9A 1LNQA 2QLFB 1WHVA 3NGRA 3FC9A 3WBZA 1WSVA 3GU0A 4KE5A 5K8PA 5B0GA 1K9MT 2BANA 2P8IA 1U1LA 3BJYA 1KEKA 3WX8A 3W9HA 3IGVA 3DLKB 4C0OC 4DSFA 4LQ3A 3NEKA 3Q2SC 1MU2A 1LW0B 2MZQA 2DHAA 5FIIA 3QGIA 2HGNA 3LP0A 3DOLB 1N33F 4LSZB 2IM2A 4LF8F 2IDEA 4RUCA 3I87A 3SSSA 1S57A 1UW9A 3AQOA 4CTAA 2DJWA 2M8DB 1TV6A 4DSLA 4DZ6A 5HATA 1TAQA 1HD1A 2E9ZA 3LWLA 4LF9F 1E6VB 5DDOC 1FXDA 3PHTA 3VGVA 2DXEA 1S1TA 2JVOA 1S0OA 2OD4A 3EDRB 3I0SA 1FT8A 2YNGB 4F2RA 3AODA 4O3SA 3SSQA 3GJQB 1EB0A 3CXCR 1YRXA 2D41A 2ZBPA 4Y00A 1S99A 4ZK7M 3KJFB 1WC4A 1S6QB 4M5IA 4G1PA 4USUA 2DK2A 1XR7A 3RAQA 1HA1A 1N52B 5JVHQ 3EDQB 3M8QA 4R0EA 4DV2F 3ETOA 3UVJA 2MKHA 4J9OA 2F40A 2FTRA 1CULB 2ZITA 1Q7LB 4FF4A 1EETB 5HBMB 2Y8YA 2YX7A 5ETTA 5A8WA 1Y9OA 2NXCA 1R0BG 3OL8A 4QPXA 1RTIB 1U09A 4ELVA 3ZNUA 1YJTA 1MSWD 2YTCA 4HEA9 4OHZA 3IS9A 3MUTP 1RXOB 1RCOB 1X0FA 2EXUA 4J9SA 2RJZA 1P6TA 1HWJA 1HQUB 3UDEA 2QC3A 2VC0A 4KGZB 4LSNB 5A8RA 4BBYA 2V2QA 4RW7B 2FZKB 3HFZB 1F2GA 4Q44A 3RRHA 2W2QP 2W01A 4JI4J 4WTOB 5KOXA 4DL4A 3ICLA 4HHHA 1RU2A 4GMKA 2YWWA 4Q7AA 1F0XA 1EHWA 1VQKS 2NS1B 1DQ8A 3DRPA 4IYQA 4R8UA 2CJKA 2HLTA 4NI2A 2HHPA 4U7CA 3J81j 2CWXA 1GX5A 4J9UE 3VQTA 2LQ9A 3T6JA 3QSIA 3FSXA 2V8DA 2DNPA 5HP1A 2JDJA 4WXOA 1RBLA 3T5JA 3IA0A 1CC8A 3S01A 4Y65A 3FJ2A 4ILLA 1CPZA 2EFGA 4KJIA 3NRBA 5CYQA 2CUYA 1HR0J 4ECSA 1HQEB 3TX8A 1FDDA 3DOMA 4BWMA 4YOEA 2M70A 3GV8B 1G7CB 1XBWA 3SMZA 1FWPA 1PAEX 4OQJA 1UWBB 2IBOA 2IFXA 5KFHA 2GA7A 2NZCA 2DTJA 3GFHA 6AT1B 2VA3A 3PJXA 1RAJA 2CNKB 4DG1A 4OJGA 2KVIA 5KFYA 1HYSB 4IH7A 3RUBL 1KOHA 1LXJA 3PV8A 2DITA 2BUNA 2DNMA 2F8HA 4R5PB 1V5VA 3CMQA 1FJGF 5A0YA 2Q3PA 4AYBD 2KHCA 4X64J 3N28A 3MECA 2HHVA 4ANDA 4PWWA 3I5CA 2RSQA 2KHDA 4FKXA 4CM2A 2CPHA 4Y2CA 2ZBQA 4OYIA 3A3NB 2CKWA 4KFBB 4DQPA 3IMQJ 1O51A 4EGLA 3MPWA 4K4XA 1SC1B 4K4VA 4U95A 4HI1A 3R7NB 2DEIA 4JB8B 4MFBB 3EZOA 5GAHU 2HWHA 2J0QD 4WYWA 4DL2A 1VQ4S 5HQMA 5HROA 2HURA 3ZZ0A 3V81B 5KT3A 2ADCA 3KUEA 3OFEA 2JVRA 1X4GA 5J2QA 2GVDB 4YDDB 1U6ZA 3MM8B 2ASLA 1Y7PA 3I31A 2QEXS 1RTJA 2P6TA 3QATA 1JLCA 1R43A 3MR6A 3QJPA 2I0XA 4JBCA 2IJFA 4PQUB 2OEMA 3KK2B 2E1AA 4ZVGA 2H51B 4CWBA 3FCHA 4LQ9A 2BW7A 3KJVA 2FLPA 2D9OA 1CJTA 4USJC 1LW0A 1HBOB 1DAXA 2VBZA 4P75A 1KLMA 1GEHA 5ITHA 3NGTA 3N5BA 1TL5A 1VRTA 4I6YA 2I2YA 4KT0C 5F3ZA 4ZPVR 3TAMA 3T3FA 1U6FA 2WSCC 4QIVA 1N5SA 1Z4UA 4WP3A 3TUPA 2IM1A 3PTWA 4FPIA 1BWVA 3PO5A 3D28A 1G3OA 3R6LB 5KG1A 2Z8QA 2DH8A 5I42B 3NKYA 4NLXA 3BS9A 4KGKA 2NCKL 2YNGA 2FHOB 1O0PA 3PZPA 1IM6A 4CH7A 1RWNB 4RW4A 1X9MA 2I6WA 5LMUF 2W2PP 4UUXA 2YPYA 1S6QA 1HNWJ 1SXLA 2JZ5A 2VPZB 1NJZA 5B0BA 3AD7C 4KC5A 4DS4A 2E7VA 4XDCA 4RBVA 1QUPA 5C42B 4DLEA 1ZZFA 3MGJA 3AT1B 4M63A 1AFJA 5ETLA 1CULA 5KFRA 5HBMA 4FN5A 3NOCA 2BM1A 1DHMA 1XNRF 2LQ5A 1NH7A 4ZCLA 4M95A 2LDYA 1IKWB 4EI2A 1N6QB 1TKXB 3IXQA 3DLBA 1UPPA 4DU7A 2QV6A 4DV4J 4FS2A 4C8OA 3GILA 4MTPA 4E0DA 2YKQA 2LQ8A 3VQSA 2NXEA 3BEGB 3G86A 4DV5J 4WFNQ 4JI6J 3D2WA 3UE2A 5KAKA 1WKKA 3R2CJ 4RW7A 1UJ4A 1NK5A 2XEXA 1BHNA 2CZ4A 4IO1A 2QLBB 1F5BA 5IQQA 3VAGA 1PJ6A 2D69A 2JOQA 2CNNB 4LRAA 1S49A 4IFYB 2JFDA 3AXMA 2AT1B 1Z2ZA 3M8PB 5D3GB 4WWSA 1Q5YA 1VBZA 1HWLA 5DM7Q 4LF6F 1PKUA 1ZPVA 3I4HX 2EBGA 4NLVA 2MEWA 3FZBA 5CHCB 2OPSB 3TQEA 2CPDA 2E5LJ 2VPYB 2W7PA 4MMOA 3W8PA 2DKOB 5IFMA 2UV8A 2OSRA 3D3BJ 2ZE2A 2BQUA 3W5YA 5C7PA 2WAQD 2P2CB 3HI9A 2XC9A 4CIOA 3E2EA 2JLFA 5D4NA 1PILA 4O3QA 3KHGA 2DNGA 3BQ2A 4I4BA 2NXUA 1N5QA 3PACA 3BM7A 3JSRA 1RHMB 2K7JA 1R27B 2FD2A 4DV6F 3BR8A 3C14B 3D1OA 1NNDA 3ET6A 1AFIA 3JSYA 1Q8LA 2ZH2A 2ZH4A 1BQMA 3LH2S 4DZDA 2NQPA 4X62F 1GMWD 1N32J 3M8ZA 3R2DJ 5ETPA 1OY8A 4R5PA 4DF8A 2LMIA 3FMWA 2R2UA 1NLKL 4YP3A 2DH9A 1IKXA 2FJEB 2OPPB 2DR5A 2IYIA 2NXJA 3MD1A 1U1KA 1DY3A 1C2PA 2KTQA 1UMJA 2GMJA 2OKQA 2A6MA 5KFBA 1CSJA 3MM7A 2AYEA 4ZPTR 2P9EA 3ZZZA 4HI2A 4BLGA 3PO4A 1ZM2A 3K5MA 4DEZA 2WVFA 2QL9B 3OR2A 4DR5J 1FDAA 4OMFG 4ZVHA 2Z4PA 3IM8A 3D0IE 3VGUA 1FD8A 2GVDA 4FBTA 4ID5A 3NWGA 1S4FA 1N34J 3F41A 2AEFA 1FKPB 3J7Z5 3KJQB 2V68A 4ECXA 4GC6A 3I0RA 1CG2A 4WJBA 4DSEA 3QT6A 4YN3B 1F2HA 3QRQA 2DVIA 3PW2A 2UUCJ 1T7PA 4TVAB 3NCQA 4P6QA 5A76A 2NYIA 1SV5A 2UZAA 2FHKA 1ELOA 3QWPA 3QT5A 2CFXA 3CB4A 4Y2IA 1JKHB 2HAIA 4CH0S 3NP5A 1MROB 1S72S 3MTKA 2AF6A 1HLWA 2G1HA 1QSLA 4OZJA 4JI3J 2NPIA 4XPEA 1DARA 1UAWA 1YQHA 4NLWA 2DB1A 2GVZA 2RDDA 1T9XA 2Z2ZA 2QMUB 2YKPA 4YQWA 3LGNA 4FVMA 1FEEA 2J7UA 2HHHF 5DG9A 1RP5A 3H20A 4ZIWA 1H73A 4DXLA 3G6YA 2YKNA 4QWCA 4M5NA 2ZBIA 3CJRA 2OUGA 3W64A 1TQLA 4WBFA 3TWZA 2FHJD 4NPOA 1H38A 4ED0A 2UXDF 1VRQC 2Q6CA 2M0GB 2N7CA 2IDLA 3KG4A 4DX7A 2MQPA 4HVZA 4KPYA 3TJAA 1SJ1A 4UY85 2QYCA 2MKSA 5LMNF 3PFOA 1W26A 4K7QA 4CO4A 2DNNA 4M94A 5CZVA 4KO0B 2V8PA 1L3TA 4WKRA 3CO0P 3AD8C 1IKWA 1TKXA 1OYDA 2FJVA 3G82B 4TYBA 4B3RF 4ES3A 1I1GA 1F60B 2AEJA 3HX9A 2KI2A 4RO0A 3QIPB 2L08A 2M8HA 1KVKA 5C5JA 4JI0J 1G4CA 2WK4A 4J9RA 5IT9U 4DUZJ 5KFWA 3AOAA 1OMSA 1SC4B 5BR8J 3ZXWA 2MLYA 1NBEB 3JTNA 2RDJA 4NMXA 1R8CA 5IC4B 2W9BB 3CNQP 4IG3B 3MD3A 2IVFB 2P9CA 2VASA 3IRXB 1U8WA 3CDAA 1RT3B 4IRCA 2QX0A 4JP8A 1WEYA 2DBBA 3UW1A 2HBQB 3FBEA 1FKAF 3G6ES 4CNYA 3M8PA 1J5EF 5D3GA 2NXNA 3QT7A 3MR3A 2H54B 2WVDA 2YXLA 3MCNA 2LDIA 4ZVFA 1JNRB 3R1LA 1Y4ZB 1GMVA 2J6SA 4EEYA 1FWLA 2XSJB 2CRLA 4NZ7A 5KT2A 2AYGA 2OPSA 1IBKJ 4NZ6A 2FHMA 2Z0GA 2WRMA 4DSIA 1QTNB 3TAPA 3V6DA 2XYGB 1IJEB 1RT4B 2EWHA 4MJKA 2APOA 2RT3A 1JLEB 1X4AA 2OPQA 2AGOA 3S8SA 1CQMA 1R8PA 4CZCA 2HBRB 3GFZA 2MKYA 3CGIA 4PQAA 4B17A 2QZ8A 3LALA 2B9YA 1NU4A 4GO5X 1RCXB 1UZDA 4ANEA 2R7TA 5B0EA 3IR6B 3TO8A 4A8SA 4ED5A 2HVZA 1CEZA 1FDNA 4FP9A 3H7HB 4JI6F 1NEEA 2R8GA 3HVTB 2RIJA 2F8MA 2V94A 1S12A 4DS5A 3MPDA 1TU0B 3D1HA 1PCAA 2BJ1A 1WD6A 4TY8B 3E01B 5HMWA 4NXNF 2B7CB 1N56A 2KRBA 4F26A 5G0RB 1OS5A 2B56A 3ZZYA 2V8HA 3AFGA 5E3AA 3N0VA 2UUAF 3SSRA 2MYFA 2R7VA 1GH8A 3BB5A 4OI6A 1EJ7L 1XNQF 3EM1A 4JYAJ 2JEGA 1YRUA 3SDEB 4NASA 3PYFA 3EPGA 1S0NA 4PWDB 3W8GA 3T5KA 3CIZA 3JXOA 1NZ8A 3B4MA 2GJ2A 2C3OA 1KFDA 2KXFA 2X51A 5BJRA 5KFJA 1C4CA 2A1BA 2L9NA 4KIAA 2MDAA 4K50A 3OJUA 2FQQB 1VOMA 4OV6A 1VC0A 4ILRA 3OXFA 1RWVB 1BWEA 3EX7B 1Q1KA 2RMLA 1DTQA 4HYKA 3T1HF 1YJWS 4CM0A 3IBCB 3NGDA 3HFVA 5KT6A 3V6HA 2YY3A 3OT9A 1XMOF 4LF5F 2IJRA 1KQGB 3BDPA 4QYZJ 4AXIA 4KY3A 2F4FA 3LP2A 5JUMA 2AJQA 4IR9A 2M5YA 3WIVA 2VQFF 3IWNC 1WG1A 4RNFA 2IVYA 2X1FA 4ZLNA 5HLFB 8AT1B 4U7UK 4J91A 5HQLA 4LR9A 4M5LA 2ZM6J 2VONA 4I6AA 3TEHB 1PO6A 5KFKA 4IH5A 3UN2A 4DJBA 3GFYA 5KFUA 3G71S 5D0HA 3QJLA 1WKJA 3DRYA 3PW0A 3W61A 1NZAA 4MK8A 4CYUB 4OX9F 4NRTA 2RQKA 2VB6A 2VBYA 2G0JA 1RGVA 1KS2A 2CQ1A 2RQCA 2HRUA 3PKMA 3BN7A 2CPYA 4G1QB 4LR8A 4O3OA 4U7UD 1NSPA 2LVWA 2XS5A 4DL3A 5IC6B 3HZEA 4OI3A 2CNOB 3C19A 2DGUA 3DRSA 4AL7A 5DG8A 5LOQA 3D54A 4HKQA 2F7VA 5C2GA 3Q83A 1VDHA 4YMEA 1U0HA 4EBCA 3RB4A 5IM0A 1B0VA 1VCTA 4ELTA 4NCAA 3KJNB 2EG2A 2WONB 2R7UA 2QA1A 4NMLA 3UPFA 1IQTA 1R6YA 3G87A 2KKHA 1S5ZA 3KLHA 1D9AA 3M8SA 3PR4A 1SL0A 4DR2J 2DGVA 1JLFA 5EDWA 2EFPA 3C6TA 2MZTA 4KTQA 2DNLA 5CCMA 4KAIA 1RT3A 1TZ0A 2GQCA 4DF4A 1TFWA 2PFFB 1H2UX 1S79A 1N36F 1FRKA 2KXNB 3QO9A 3PYDA 2HVDA 4FF1A 4KGMA 4H4MB 2C3PA 4MKAA 3SQGA 2XSJA 5FJ4A 1X7VA 1KNZA 2OI2A 3OL6A 4YHHF 1VIOA 3MOZA 3DFEA 3ILOA 5H9FK 5DG7A 1RT4A 2CJQA 4QOTA 4OI0A 1JLEA 2XMMA 5FD1A 1OQ6A 5DETA 1SKWA 2ZVIA 1Y0HA 4NYPA 3C6UA 1T95A 2HBYB 3V5RA 2BKPA 4F4XA 3WQPA 4F04B 1GNKA 4RNHA 3MOJB 3U1LA 1VQ5S 1IBCB 3IWXA 3SCLE 4I7FB 2DR6A 3BGLA 3ILLA 2Z2LA 3E8OA 4Q5VA 4DR3J 5DZ7A 1X0PA 4QPTA 2XG8A 2R2SA 3ZZPA 4AFFA 1YG0A 4HH0A 1URNA 1K47A 3UNGC 5KFGA 3IG1A 2GHVC 2R3VA 3EVMA 5F8GA 5KG0A 3RTVA 1SH0A 4EO6A 2M2BA 3HSZA 5AXLA 2PEBA 4A8OA 5DJBA 1PYOB 4QR0A 2Q6BA 1C0TA 3FRYA 1N48A 1FFSB 2K3KA 2WB4A 4NX9A 1FRXA 3P3DA 5T7LA 5L8RC 2QG9B 1ZOTA 1N4LA 2CXEA 4OL8A 3PEJA 1YX2A 3Q0AA 5D15A 4O3NA 3R5GA 1X8DA 1Q0NA 3OL7A 4DR6F 4EZ9A 1S1UB 5IT0A 1WI8A 5K8OA 3B82A 4PG7A 1FVSA 4MIAA 1XWLA 5ETKA 4HT5A 5BYQA 2XBPA 1F1BB 2V69A 1YK9A 2HQ3A 4OX6A 3WIUA 2MY8A 2FY1A 3Q8VA 2ROGA 1G1XA 3OVAA 2SXLA 1PJ7A 3W2VA 5A2QY 3C2PA 2AGPA 2B4PA 4ZP8A 1KTQA 3HCXA 1S7IA 1D1UA 2YKMB 1P9YA 2OEKA 3DLHA 3GCWP 1LWFB 5KFMA 4F3MA 1IKVA 4H4KA 1NKBA 2PGCA 5HI7A 3MMJA 4AT1B 4LF7F 3T5HA 3OTBA 1UW4A 2GAHC 2MMYA 1B0PA 2GIQA 1RYRA 2DY1A 2J6TA 2B8PA 3NL0A 3OBIA 4OI1A 5HLFA 2GNKA 1UTAA 4E98A 3A8JA 5D0GA 3U7JA 1NPPA 3IFEA 4YS2A 3NNAA 2A2CA 2MTLA 2YVSA 3EXCX 1IR2A 3R5AA 4CYUA 4I2PB 1H72C 1YBTA 4KR0B 4ERDA 5IV4A 3RYLA 4IFVB 1S9EB 1A0OB 3QAEA 3D3CJ 2ZH6A 2FGOA 4U96A 2MY7A 3CD0A 2ZHOA 3DRRA 4L75A 2UUBJ 1KHWA 5K5MA 1VQLS 1FNMA 3KDOA 1NSQA 3K7RA 4S0MA 3BGRB 3CCUS 1SQGA 2RILA 3SEOA 2B4VA 1T8EA 4CO2A 3H4BA 1NPRA 5JVGQ 2ZJPQ 1U1NA 4PYDA 2BABA 4C8ZA 1LV5A 4X4SA 4QWBA 5EWGA 3LAMA 4ZJQA 3GIIA 3QAUA 4A8FA 2F4VF 2MB0B 1FCAA 4QU6A 3THVA 2KM8B 1RSCA 3DI6B 3U1MA 3DLLQ 1WHYA 2POKA 5E41A 2Q79A 2NSBA 1T02A 3OTDA 3TOQA 2ASDA 4OZNA 5KFIA 4LRDA 4KHPJ 3I96A 1Y5LB 4JI8J 1XIQA 2FVPA 1YITS 4J9MA 2LCWA 1VQNS 4J9NA 1S1VA 2ADBA 4WP8A 2ABYA 4DU8A 4I67A 3HDSA 4YB1P 2ZD1B 3KLEB 3MR7A 1RTDB 7FDRA 1WTBA 4DUYJ 3C15B 2Q43A 4PPDA 1DQ9A 5J2PA 3VGTA 1VFJA 3EWGA 3V6JA 4AXJA 1EQMA 2PI4A 1EP4B 3RW7A 2FJDB 4JI5F 4DL5A 3UD5A 3P96A 3K5OA 2BMBA 2LEPA 4MK7A 2VHGA 2GW8A 5T14A 5LJ3Y 1FX4A 5HL7Q 1I94F 1G6BA 5GVQA 3E51A 2DHGA 2IRYA 1N5YB 4OIXA 3TR5A 3Q8QB 2IRUA 1YZ7A 1HWKA 2WW8A 3SIPB 4DN9A 1VQ7S 2J9EA 4CLWA 5HMYA 2R7WA 5EHHA 1ZETA 3LP1A 4MK9A 2D3O1 2HVHA 3CJ2A 4C11B 4HR2A 2E5JA 3IN5A 2DRAA 2CZVC 4USIA 1CJKB 4WFBQ 2XYHB 5KFPA 2W4PA 3HSGA 4H54A 3GV5B 1EARA 2B6AA 4L72B 4ECZA 3KYLA 4URGA 5BXIA 5C24A 3M7VA 5ETRA 3BREA 3N01A 1S1UA 3AJ1A 1NJXA 3CD6S 2M3DA 1Y3KA 4C6AA 4KB7A 4KGXB 4OYMA 2R42A 3N9UC 3GR0A 2IA6A 2OD6A 1VQPS 1RB0A 3Q24A 1RWXB 2QN6B 3PX4A 3ISNC 2KFYA 1KTVA 4OYWA 1ZM4A 4LFAF 2ZUGA 3RU0A 3W62A 5A8KA 4CDIA 2CQ2A 1U02A 3G6VA 4ZHRB 5L1KA 4XAKA 5ADZA 3C16B 1DJ0A 2UXCF 3CCMS 2FHJA 2RF2B 1R8BA 3J81Y 4BHQA 4K0KF 2ZOFA 4ZP6A 3G2XA 4USHA 4OHYA 2OIHA 3LO3A 3OXLA 4FPRA 3A12A 2GGPB 1IWGA 1FJCA 4IDKB 1ZAWA 1C4AA 2MHEA 5IWAF 4LMZA 1T03A 4BS2A 1TKDA 1SQFA 4TQRA 1DBDA 3MURP 2CJAA 2Q66A 3RBEA 4JV1A 4D3HA 1YBUA 3DOKB 3J80Y 4M1KA 4YFUA 1VIXA 1XR5A 4WFZA 3MM6B 2IC3A 4Y2MA 2GC8A 2PMWA 1X4HA 2XCAA 3I4PA 4X66J 2XGQA 2K1RA 4DQIA 2VUGA 4QIFA 4OX7A 3DRXA 3BGRA 1J5OB 4P2FA 3PJ9A 2HK2A 3W2WA 1RZMA 4L73A 4Q0BA 5GAEU 2OLWA 2E5GA 1TUVA 2ROPA 4UOHA 3TA0A 1FK9A 2RKIB 2IPOB 1DRZA 3DDNA 2ZFHA 5HK4A 4DPUA 1IBMJ 1RAOA 4PG4A 2ZC3A 3FBFA 2N4CA 3BSOA 1RWMB 3OUYB 2KVQE 3NAIA 3J7AN 2KH9A 1XQIA 1I6JA 1T3OA 1A6LA 4F7VA 2AEMA 2N7YA 2UXBJ 1QE1A 2JX2A 4WU3A 2D3OR 1OSDA 2H5IB 2ZDOA 3WC0A 4B3MJ 1IBLF 2IM3A 2MGZA 4QWAA 1KD1T 4PRFA 2ASYA 2FZCB 2C2EA 1W2IA 3K89A 3BBCA 4JI1J 2VF3A 2L48A 2HS3A 2D74B 3GE9A 3T1AA 4R0JA 4ZN3A 2RRNA 1R8AA 3G4SS 3KLEA 2OO4A 3DMJB 3N6LA 3A8IA 1YKWA 5IS2A 4B3OB 1DQAA 1JLAB 3SCKE 1GT8A 1OYEA 2UU9F 1ZTWA 2W2MP 2CJYB 3G8SA 1EP4A 2AIRB 3VALA 5M2RA 5KOWA 5DQHA 4DUTA 3FDSA 1K0TA 2HAFA 2CJXB 5L38A 5KG5A 5C2CA 3W63A 3PYEA 1HPZA 4CO0A 2DNOA 5I3PA 4DQRA 3D6MB 2FLLA 5E3QA 3N79A 3N6MA 4PZVA 3S6EA 4WZMA 1S6OA 3BN4A 1BY9A 3L95X 3R1HA 1ICEB 2R8JA 2H4YB 2J7KA 4N56A 1HHTP 1PBAA 3OXGA 2VJUA 2CZ9A 3IM9A 3L3CA 4CNZA 2BANB 5IQ6A 3E3XA 5F8JA 4OV1A 5DQIA 4ED6A 2ZEJA 4F2SA 2HPUA 2PFDA 4LIRA 3K8WA 2J6UA 2IMWP 2ZWPA 4N41A 1FFWB 1U24A 3EYZA 1V3ZA 5J1PA 2XLKA 3CMAS 1D9DA 4I64A 2BXJA 4TQSA 3VAJA 1RI7A 2GHWA 2LEBA 1WC3A 2H48B 3W5XA 2GS8A 4DV3J 4GC7A 2QSFA 2QO3A 3SBMA 1YJNS 3KHLA 5D4OA 3KLFA 3R9LA
chains in the Genus database with same CATH topology
2QLJB 3D6HB 1IBCB 3R6LB 5IC4B 4ZVQB 1PAUB 3R5JB 1RWOB 1RHMB 4ZVRB 1ICEB 4DCJB 4ZVSB 1RE1B 1RHKB 2H5IB 2H4YB 1RWXB 4DCPB 3GJRB 2XZDB 3KJQB 3EDRB 3P4UB 1RWNB 2QLBB 3IBFB 3GJQB 3SIPB 2HBQB 2C2OB 3GJSB 2H65B 1RWKB 3R7SB 1QDUB 2H4WB 2CNKB 2QLFB 2CNNB 1RHJB 3KJFB 2C2ZB 2H54B 4ZVOB 5K20B 1BMQB 2H51B 1RHRB 2FQQB 5IC6B 2H5JB 2CDRB 1RWVB 2CNOB 1RHUB 3NS7B 3GJTB 1PYOB 3R6GB 2C1EB 3D6FB 3EDQB 3P45B 1F9EB 2XYHB 3IBCB 3R7BB 2CJYB 1I51B 2C2KB 2C2MB 2Y1LB 3QNWB 4ZVPB 2QL5B 1QTNB 2XZTB 2DKOB 3RJMB 1NMEB 1SC1B 2XYGB 2QL7B 2CJXB 2Y0BB 3KJNB 2XYPB 4ZVUB 2HBYB 2HBZB 1SC3B 2QL9B 3R7NB 2H48B 2P2CB 4LSZB 1RWMB 4JB8B 4DCOB 1RWWB 1RHQB 2HBRB 1GFWB 4ZVTB 3D6MB 1I3OB 2CNLB 1SC4B 1RWPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QLJ B;  3D6H B;  1IBC B;  3R6L B;  5IC4 B;  4ZVQ B;  1PAU B;  3R5J B;  1RWO B;  1RHM B;  4ZVR B;  1ICE B;  4DCJ B;  4ZVS B;  1RE1 B;  1RHK B;  2H5I B;  2H4Y B;  1RWX B;  4DCP B;  3GJR B;  2XZD B;  3KJQ B;  3EDR B;  3P4U B;  1RWN B;  2QLB B;  3IBF B;  3GJQ B;  3SIP B;  2HBQ B;  2C2O B;  3GJS B;  2H65 B;  1RWK B;  3R7S B;  1QDU B;  2H4W B;  2CNK B;  2QLF B;  2CNN B;  1RHJ B;  3KJF B;  2C2Z B;  2H54 B;  4ZVO B;  5K20 B;  1BMQ B;  2H51 B;  1RHR B;  2FQQ B;  5IC6 B;  2H5J B;  2CDR B;  1RWV B;  2CNO B;  1RHU B;  3NS7 B;  3GJT B;  1PYO B;  3R6G B;  2C1E B;  3D6F B;  3EDQ B;  3P45 B;  1F9E B;  2XYH B;  3IBC B;  3R7B B;  2CJY B;  1I51 B;  2C2K B;  2C2M B;  2Y1L B;  3QNW B;  4ZVP B;  2QL5 B;  1QTN B;  2XZT B;  2DKO B;  3RJM B;  1NME B;  1SC1 B;  2XYG B;  2QL7 B;  2CJX B;  2Y0B B;  3KJN B;  2XYP B;  4ZVU B;  2HBY B;  2HBZ B;  1SC3 B;  2QL9 B;  3R7N B;  2H48 B;  2P2C B;  4LSZ B;  1RWM B;  4JB8 B;  4DCO B;  1RWW B;  1RHQ B;  2HBR B;  1GFW B;  4ZVT B;  3D6M B;  1I3O B;  2CNL B;  1SC4 B;  1RWP B; 
#chains in the Genus database with same CATH topology
 3LWM A;  3DGP A;  4PG6 A;  3WX4 A;  1PAU B;  4A8M P;  4QW8 A;  4AQY J;  4YY3 F;  4IUF A;  4EU0 A;  1SJF A;  1Z1Z A;  2ATC B;  2GFF A;  1RTZ A;  4LSL B;  4ZJO A;  3SI8 A;  1FRI A;  4ZHR A;  2IVM A;  2MJU A;  2VG6 A;  5F41 A;  2M4M A;  1XMQ J;  2E5I A;  3I32 A;  5AE3 A;  2RF2 A;  3W7B A;  3M8Q B;  3UVJ B;  1U1P A;  4CLL A;  4DFK A;  5KFZ A;  1RT1 A;  2RS8 A;  5A8W B;  1Q8B A;  4YR3 A;  1RWU A;  2VA2 A;  1N5T A;  2HFV A;  3G96 A;  3JYT B;  1C1C B;  4BC7 A;  3W5Z A;  3FZ2 A;  4NLS A;  3AAW B;  3GLJ A;  8RUC A;  5HSP A;  1JXV A;  1LK5 A;  3IS9 B;  4B08 A;  1B70 B;  1R31 A;  2DXF A;  5I3Q A;  4PXD A;  3T5L A;  2DR8 A;  4CLY A;  4RW6 A;  1VJW A;  2HFZ A;  4NCG A;  3GFX A;  5F9N A;  1QTM A;  4WK1 A;  2C3M A;  2VKR A;  4EK2 A;  3GV7 B;  2W9C A;  2G4B A;  5H1S V;  4HHJ A;  3MM6 A;  4DR4 J;  2YNF A;  3K5N A;  3UCU P;  1UVI A;  2EKY A;  4ZA1 A;  4LRE A;  5DM6 Q;  4C8N A;  2CPJ A;  3THP A;  2GIF A;  2AP6 A;  3TQ1 A;  1VIS A;  1NO8 A;  2YNI A;  2OEL A;  3MM9 A;  1MG7 A;  4PUO A;  5CYJ A;  3HHL A;  4B9T A;  4R8U B;  2RNE A;  5LSR A;  1UFW A;  1LQ9 A;  5LSO A;  1FX2 A;  2CJ9 A;  3P5B P;  2G2Z A;  2G1D A;  1VHF A;  3RBZ A;  5HP1 B;  4M5J A;  1BLU A;  1KBR A;  1OPZ A;  3CVK A;  4U8V A;  2HGL A;  3HSD A;  2N3L A;  3MCM A;  1S6P B;  2MQN A;  3FMB A;  5EWE A;  3B4D A;  4IRK A;  1U1M A;  3OUY A;  3TVY A;  4UZB A;  4I56 A;  2RAQ A;  1M90 T;  4M5G A;  1RT6 A;  2V67 A;  4X4P A;  4LFB J;  2MZJ A;  2V2Z A;  2WSE C;  1HNI A;  2BX6 A;  4ECV A;  2G2Y A;  3RGI A;  1JJ2 R;  4RL1 A;  3PEH A;  4DV0 F;  1QLN A;  3SXL A;  1YJV A;  2VJV A;  2KT5 A;  4FYX B;  3DYA B;  1M5O C;  2PI5 A;  2GJI A;  4DG1 B;  2OP5 A;  2YNH A;  2RE1 A;  1FNX H;  4CH1 A;  1H7W A;  1TP7 A;  3OPK A;  2LLZ A;  2H3E B;  4GKJ F;  1RUS A;  4LJM A;  3J7Z T;  2V9W A;  4Y3C A;  4B3O A;  3MEC B;  4ECW A;  3NGU A;  3SZ2 A;  3PX6 A;  2P9G A;  3AOB A;  2DCL A;  3M2R A;  2HQD A;  1TUG B;  1TL3 B;  1BD6 A;  1SJR A;  2AX1 A;  1XJW B;  4JV0 A;  1L3K A;  1NME B;  2F8E X;  3VGS A;  5KFF A;  4C3K A;  4NYZ A;  4WPA A;  3F0N A;  3V4I B;  4CCH A;  2ZOM A;  4DSJ A;  3MMC B;  4A8Q A;  1HNX J;  2CNL B;  5AJ3 J;  4OX8 A;  3VAK A;  3PYG A;  6FD1 A;  2W2N P;  1NK6 A;  1RTJ B;  1JLC B;  3RG6 A;  4ETX A;  1WUU A;  4U9R A;  4FF2 A;  3OTO J;  4FS1 A;  2K3I A;  4P73 A;  1AT1 B;  1WG4 A;  4OZ0 A;  2B5J B;  1LEO A;  3RR7 A;  1PJ5 A;  3DM2 A;  4C97 A;  2XS7 A;  3SCI E;  4I2Q A;  2LYV A;  1NDC A;  3KJV B;  2VQE J;  2H4W B;  1V3S A;  1CJT B;  5DDR C;  4HT7 A;  5F3T A;  5MAO A;  1KLM B;  3A1Y G;  2WTF A;  3CCZ A;  1EX8 A;  1VRT B;  4UY8 T;  3Q89 A;  2E7X A;  3TAM B;  4LFC J;  3MTJ A;  5F8M A;  4B9U A;  2DR7 A;  1UJ5 A;  5CYM A;  1UL3 A;  3FSY A;  2R2T A;  3JQK A;  3NBP A;  3I9Z A;  2CPF A;  4TNO A;  2ZH8 A;  5FDL B;  2BKN A;  3B54 A;  4NLQ A;  3EXY A;  3BH7 B;  2Y1R I;  4X4Q A;  2ZH9 A;  3ZNJ 1;  5EGY A;  3HZG A;  3LW5 C;  3HUL A;  5IOL A;  4RR5 A;  5I3U A;  1Q81 T;  4RW4 B;  2NYH A;  3OW2 R;  4NLR A;  5E5N A;  4LSL A;  5CD4 A;  3KXD A;  3AD9 C;  3B6B A;  4AUK A;  2CQ0 A;  3M30 B;  2VG5 A;  3M9M B;  1YZ6 A;  2E1C A;  1LKZ A;  2HFS A;  3Q22 A;  2YBV A;  5KFE A;  1NK9 A;  2PII A;  4Y34 A;  2PEH A;  1HMV A;  4BWJ A;  4YB7 A;  2HQG A;  4OZL A;  3JYT A;  1C1C A;  2VFV A;  1NPK A;  2KJV A;  4WTY A;  2VIH A;  3FFI A;  5L46 A;  2HHT A;  1FRJ A;  3KK1 A;  1A7G E;  2XZT B;  2R7Q A;  4C8M A;  3L7O A;  3OSP A;  4UOC A;  3HT3 A;  1AUS L;  2Y8W A;  4DCO B;  1RWW B;  1KWM A;  3B78 A;  1RAA B;  3AOC A;  3ONQ A;  4NLD A;  5F9L A;  2HEK A;  4LUB A;  2M9K A;  3EGN A;  4YR0 A;  1TR0 A;  1JB0 C;  1UCN A;  1RYS A;  4C8L A;  4HAC A;  2AMC B;  5F0W A;  3BKT A;  1RA6 A;  3VR1 A;  2IY5 B;  3T19 A;  3IR5 B;  4ED7 A;  1X9S A;  3K8V A;  1M5K C;  4OJH A;  1HAR A;  2DGQ A;  3KHH A;  4B3S F;  3CW2 C;  3L7U A;  5MLC V;  4GVL A;  2DHS A;  1WSR A;  2K06 A;  3EZU A;  5KFD A;  4A8W A;  2FC8 A;  4GKK F;  1DLO A;  4FYY B;  1T11 A;  2IBK A;  2AZ1 A;  2ACY A;  2HWT A;  2O01 C;  5AXK A;  3U1N A;  2M7S A;  2ZE2 B;  3LF0 A;  1S6P A;  4A4J A;  1TL1 B;  2MST A;  1VYA A;  4PXC A;  4ECR A;  3MWB A;  1NKE A;  2EBE A;  2V8V A;  3KMS A;  4ZVT B;  2ACM A;  3EVW A;  5DLG A;  1I5O B;  1PGZ A;  3FSI A;  4DV7 J;  1L5U A;  2CVI A;  1V5I B;  3ET6 B;  3GQC A;  3DYA A;  3KFW X;  1RHK B;  2YWF A;  1BQM B;  4K5R A;  2IA0 A;  4J5O A;  1VMB A;  3U27 A;  2PDA A;  3CCS S;  4WP9 A;  3J7Y U;  4NE9 C;  1WWH A;  4QR2 A;  4TU7 A;  1UET A;  2JEJ A;  1KC8 T;  3NMR A;  1IKX B;  4ZVE A;  2J8S A;  1BGX T;  4JV5 J;  2R7O A;  3CCR S;  3PRB A;  2MXY A;  3PCO B;  3TRG A;  3MM7 B;  2VZ9 A;  4ED3 A;  1R0A A;  4CO3 A;  2VG7 B;  1TL3 A;  3MCO A;  1Q53 A;  2RD5 C;  3PIO Q;  4O4G A;  2HIY A;  4ID8 A;  3OR2 B;  2C2N A;  2HNZ B;  2LXI A;  2FPH X;  3QZ7 A;  3KNG A;  1RQ0 A;  4NXM J;  3V4I A;  1NHK L;  5E2Q A;  2DHX A;  1MMD A;  1NCL A;  4I1T A;  3MMC A;  2LU1 A;  4X65 F;  1SH3 A;  4FXD A;  4ID5 B;  3KTQ A;  4DR7 J;  3OVB A;  2Z2Y B;  1CBK A;  4IG0 A;  1IXK A;  2GV1 A;  3I0R B;  3QGG A;  2JLG A;  3I9V 9;  4USV A;  3VF0 B;  2B5J A;  3X3U A;  2CQH A;  4DCP B;  2KDO A;  4FZV A;  5KG4 A;  3BR9 A;  3R3T A;  2BE7 D;  2BV3 A;  4LF4 F;  2HIQ A;  4F0K A;  1T0T V;  2FLO A;  1SV5 B;  2W24 A;  4Y6I A;  4CP5 A;  5KT4 A;  4C2M A;  2IAJ A;  1HHS A;  1U47 A;  2B9W A;  4ZCM A;  1X4D A;  1PBU A;  5LJ5 Y;  1HW9 A;  3M2V B;  4KYZ A;  2GVZ B;  3JTP A;  3ILJ A;  1B99 A;  4CLT A;  1NSA A;  1WNE A;  3HHN B;  4DPO A;  2B9X A;  3RRK A;  1B0T A;  2NUU G;  4URQ U;  5GAD U;  5FDL A;  4IRD A;  1K0V A;  1PIE A;  2HMI A;  4R25 A;  2PA8 D;  2DGW A;  2YKN B;  2AQ4 A;  3HPO A;  2J0X A;  4RUB A;  2VDH A;  3KNA A;  3CUL A;  5FLX U;  4EMD A;  1UA1 A;  2WOM A;  2DNH A;  4KHM A;  3D67 A;  2AHO B;  3SFU A;  3LTO A;  2MPU A;  2V4R A;  1U48 A;  5B08 A;  4DR1 F;  3OQ2 A;  3OR1 A;  4RW9 A;  3MMB A;  4LR7 A;  3TZX A;  3M30 A;  4FXV A;  2QLW A;  3KLV A;  3Q8Y A;  1U2F A;  1XN9 A;  3QYY A;  4NLG A;  2A2D A;  1C1B A;  5L9N A;  3HJF A;  4K4S A;  4DV1 F;  4Q8F A;  3H40 A;  1BC6 A;  4OYP A;  1TVR A;  4KKO B;  4G3I A;  3C8Y A;  3QWU A;  4QWE A;  2GHP A;  2AJ2 A;  4F4A A;  2DNZ A;  2VFS A;  2C2K B;  5U47 A;  2ZZM A;  3QNW B;  4FNI A;  4A46 A;  1M5H A;  1IKY B;  1IM4 A;  2I5J B;  1TL4 A;  3GR1 A;  1T3N A;  2WCX A;  1F6T A;  1EAY C;  1L3U A;  1N33 J;  3EJM A;  3KLG A;  3ZTO A;  2VH7 A;  4LF8 J;  4IKA A;  1RAD B;  3ULH A;  5E0O A;  3PW4 A;  5HVF A;  2BJ3 A;  2FJA B;  2LQB A;  3K0J A;  3NS6 A;  3OVS A;  1R89 A;  4MKV A;  2XY5 A;  1CS4 A;  3LA0 A;  2EPI A;  5SZT A;  1EZZ B;  4LF9 J;  4JOU A;  2BE9 B;  4CRJ A;  3GIM A;  1S1X B;  4ZIV A;  5E3P A;  1HKA A;  4Q43 A;  1R6V A;  1FJ7 A;  2YKA A;  1KON A;  1RBA A;  4LF1 A;  2H1Y A;  3W66 A;  3H5U A;  2A3J A;  3EMT A;  2X1A A;  2DHH A;  2JFK A;  2ALZ A;  2QMW A;  5FLX Y;  5L1I A;  4HLB A;  3RBD A;  1TK0 A;  3QRP A;  3D7S B;  1JJC B;  3GJT B;  1TL1 A;  3V6D B;  4JUZ A;  4DV2 J;  2OPQ B;  2V2V A;  2OHD A;  3GSD A;  4ZKA A;  3OL9 A;  4ES2 A;  5J2M B;  3RJM B;  3SQO P;  4P2X A;  2XMT A;  5LL6 d;  2CPZ A;  4G65 A;  4F3Q A;  5CAA A;  4GO7 X;  1RAH B;  3ENQ A;  3ETM A;  1NJW A;  1S9G A;  3RRG A;  2YQ0 A;  1R7I A;  3GB0 A;  1U1R A;  3R5J B;  1RWO B;  2R7S A;  1FTC A;  1TL7 B;  1ZA1 B;  3BSC A;  3TAN A;  1FEH A;  3SYZ A;  4RX6 A;  3VVU A;  2HWI A;  3KMQ A;  4WXW A;  3MDF A;  1TAU A;  4FVC A;  1SPB P;  3HP6 A;  1TKT A;  2WW4 A;  3VCD A;  3G8T A;  2RH3 A;  5ETV A;  3Q8U A;  2XS2 A;  2E9R X;  2XY7 A;  1RWK B;  3GMG A;  2PN6 A;  3JQM A;  4JI4 F;  2Y1J A;  4CLS A;  1G2E A;  1K8A T;  3LGH A;  2R4F A;  2VG7 A;  3OFG A;  2VU5 A;  4QQB A;  1KDN A;  4CLU A;  3I6P A;  5M2P A;  2MKI A;  2HNZ A;  1UPM B;  1FO1 A;  3PW5 A;  3MAA B;  1V6H A;  5DGA A;  5DQG A;  4DI6 A;  3EUN A;  5CD4 H;  3CJ8 A;  5H9E J;  2UVU A;  2DXD A;  4NA2 A;  1MMN A;  4FNH A;  3GYG A;  2XYP B;  3BSN A;  1PG5 B;  4NCB A;  1SC6 A;  1VBY A;  4ED8 A;  4J9L A;  3S1T A;  1HR0 F;  3VVT A;  3M05 A;  4CQ1 A;  4DCJ B;  1RTH A;  2VOP A;  2CQG A;  4N76 A;  2KZZ A;  3O1L A;  3CCJ S;  1RAI B;  4O23 A;  4NLO A;  2KL8 A;  3QGP A;  4TXS A;  2AX0 A;  1T05 B;  3GG1 A;  1HW8 A;  3M2V A;  1DTQ B;  4EZ6 A;  3GWC A;  2MQO A;  3O5T B;  3TZZ A;  3L09 A;  2BBE A;  1KR4 A;  4X64 F;  2ZDP A;  1FJG J;  1OQ3 A;  1OWX A;  3FBB A;  3R27 A;  2MZS A;  3NGS A;  1URR A;  2EW9 A;  3LP2 B;  2E1P A;  4A8Y A;  3GON A;  3MAH A;  4KV8 B;  3CME S;  5J1N A;  1MW7 A;  3JSM B;  1NHV A;  4D3G A;  1WEL A;  4NA3 A;  2AJ1 A;  3K59 A;  4CT8 A;  2L41 A;  3DLE B;  2QA2 A;  4WCE Q;  4QYR A;  4NXM F;  2G0I A;  3Q23 A;  1VLY A;  2Y1I A;  4EO8 A;  2DEJ A;  1SUQ B;  1B64 A;  2DO0 A;  1VQ9 S;  1RT7 A;  4W92 B;  2AWZ A;  3HD2 A;  1N8R T;  2F9D A;  2KN4 A;  3N5F A;  2XO6 A;  2ZUA A;  4UT4 A;  4CT9 A;  1YJU A;  5K9F A;  2HVI A;  2BRL A;  4O44 A;  4KKO A;  2CQ3 A;  4FYV B;  3DRS B;  3VWS A;  1ULR A;  3HJV A;  4ZVO B;  2HZV A;  4DOZ A;  2MZR A;  1JJ4 A;  5D6G A;  4F4W A;  3OLB A;  4DFM A;  4DMZ A;  5KG7 A;  1Q95 G;  1U0H B;  1XER A;  1GX6 A;  4J9P A;  1QSS A;  5IM0 B;  3WC2 A;  1IKY A;  2FVC A;  3CIM A;  2BJ7 A;  1ZAX A;  3RBX A;  2I5J A;  4Q8E A;  4YB6 A;  9RUB A;  2KU7 A;  3KLH B;  3DU5 A;  3QSY B;  3GIK A;  1JLF B;  4C3M A;  1H98 A;  2H5E A;  3L7P A;  1U45 A;  2CG4 A;  3C6T B;  1JLB A;  2FDN A;  1L3V A;  2BKO A;  1F5C A;  1VJQ A;  2NLW A;  2BM0 A;  4DL7 A;  4M5M A;  1WEZ A;  1S1X A;  2F65 A;  5RUB A;  2WSF C;  5B0F A;  3MED A;  4IQM A;  2PO4 A;  3PM9 A;  1SL1 A;  3QO9 B;  1RKJ A;  2V8G A;  3CO9 A;  2JL9 A;  3UCZ P;  2F3J A;  3DCA A;  4CI0 B;  3HHD A;  3NMA A;  4E8U A;  3KG0 A;  4GRS A;  3SQG B;  1M5S A;  4RUH A;  3KWM A;  4DPW A;  2GZO A;  2OEJ A;  5LMU J;  2NRE A;  3UDL A;  4P2M A;  5L1L A;  1M1G A;  3GTY X;  1HNW F;  1WAC A;  3KLI B;  2D3Z A;  2VOO A;  1BMQ B;  2C3Y A;  2MKC A;  2CQB A;  2KB2 A;  1FA0 A;  3M4X A;  5F0U A;  1D8Y A;  1ZM3 A;  1TFY A;  1LFP A;  2UVR A;  2ZJQ Q;  4UQG A;  1NXI A;  2DIS A;  2OSQ A;  2FUG 9;  3C6U B;  5F8L A;  5J2M A;  1BE4 A;  1XNR J;  2LA4 A;  4I69 A;  2OMO A;  2YH0 A;  2ZWO A;  4RW8 B;  2BJE A;  2E66 A;  4L6V 3;  2XMJ A;  4P72 A;  4DV4 F;  2B51 A;  2FVQ A;  4DDF A;  1FD2 A;  2HBZ B;  2ZOG A;  3AH6 A;  3MF5 A;  1LW2 B;  3ELH A;  2OFH X;  4B9N A;  2R8I A;  4O3P A;  1REV B;  1Y00 A;  1TL7 A;  3ZZO A;  4WZQ A;  4DV5 F;  5GAG U;  3QFW A;  1TK8 A;  4L3N A;  2D1C A;  3PRV A;  1FKO A;  2J0W A;  2A10 A;  2DGT A;  2C2D A;  1MN7 A;  2BW2 A;  1UZH A;  1RAG B;  3IR7 B;  1TMM A;  3LUY A;  5E7O B;  1FTR A;  3P4U B;  3IG1 B;  4DQS A;  1QAI A;  2Z57 B;  3AJ2 A;  2V4Q A;  3UQS A;  3L9Z A;  3ISN D;  2BQR A;  2HZA A;  2U1A A;  1C0T B;  1CJV A;  2WZ1 A;  3CJ0 A;  4OHV A;  2DY9 A;  2E7W A;  3R8Y A;  3R5B A;  2L3M A;  5T7L B;  3MAA A;  2CDQ A;  2HK3 A;  3LQV A;  3HHK A;  4FXW A;  4LF6 J;  3BF4 A;  2W7A A;  4TU9 A;  1F9F A;  3BKF A;  4ZPA A;  2E5L F;  1UFK A;  2XWY A;  3M6X A;  1D09 B;  2VPX B;  3AHP A;  1GXU A;  3MI7 X;  1XR6 A;  3M8W A;  4JI2 J;  1HNV B;  4KPC A;  3RR8 A;  2UUW A;  3AA8 A;  5CCL A;  3BYR A;  2EG1 A;  2C3U A;  4HDH A;  2JC1 A;  1UVL A;  3VAH A;  4UW2 A;  4NLU A;  2OTJ S;  4DV6 J;  3FVY A;  3W2V B;  4KH1 B;  3GIJ A;  3MFH A;  4PR6 A;  3GYN A;  4KQZ A;  2DPI A;  4Y2K A;  1T05 A;  4WFY A;  2DRD A;  1FJE B;  2HQC A;  3QBC A;  3TZW A;  4QU7 A;  3BGF A;  4X84 A;  3HMJ G;  3X1L B;  4MKY A;  5HJY A;  3NWR A;  1K73 T;  2VFR A;  4OLP A;  1NJY A;  1N32 F;  1NHU A;  4X62 J;  1SIZ A;  4UZC A;  1FER A;  5KFV A;  1IKV B;  3MUM P;  1VC5 A;  3CC2 S;  3AA9 A;  2OTL S;  1NJI T;  4NL5 A;  4J9K A;  2LEC A;  4XIU A;  3PRD A;  2A6O A;  5F8N A;  5JXS A;  1UFL A;  2QA4 G;  4DX5 A;  4DL0 C;  1YSJ A;  4OYO A;  2DIV A;  4KV8 A;  5IXU A;  3JSM A;  4RWW A;  3D1Q A;  5KFT A;  3OV7 A;  3CJS A;  1B4S A;  1RAC B;  3CJ3 A;  3DLE A;  3GPA A;  4DR5 F;  1AZS B;  1IQZ A;  2I9S A;  2B43 A;  4XTT A;  2NZ4 A;  1SUQ A;  1FHT A;  2GO8 A;  1IR1 A;  2QFI A;  1VQ6 S;  4UOG A;  1WF2 A;  1BQN A;  3SFG A;  1N34 F;  2JH3 A;  2QSW A;  1X4E A;  4QYZ K;  3KK3 A;  2V2K A;  2BQ3 A;  3DRR B;  4RLE A;  1NDK A;  2LFV A;  2UUC F;  1HBM B;  1S1W A;  2ZHB A;  1AB8 A;  2CQI A;  4RZR A;  5L9X A;  3BO2 A;  3OSN A;  2CPE A;  1NK4 A;  1YIJ S;  3JSB A;  2RHS B;  3BGO P;  1AUD A;  4MAK A;  2WBM A;  1WI6 A;  4N77 A;  1S59 A;  3P45 B;  3QQC D;  1NK7 A;  4ZJL A;  1AYE A;  2DNK A;  4JI3 F;  4M5K A;  4UUW A;  4DX6 A;  1C0U B;  2RUS A;  1OJ4 A;  3NLC A;  5LM7 E;  4QBU A;  2XMU A;  1UA0 A;  2YQ3 A;  2CQ4 A;  1UVN A;  4CLF A;  3D66 A;  4Y0F A;  4N8O A;  2HHH J;  4HL9 A;  5K14 A;  1R8H A;  1N0V C;  2Y9H A;  3GYX B;  2C28 A;  3P49 B;  1JLG A;  3M6U A;  1VR6 A;  2ZVS A;  4ED2 A;  1IR0 A;  4FYW B;  1WTF A;  3BQ0 A;  2A0F B;  4B02 A;  2EEY A;  2VC1 A;  4K4U A;  1MNE A;  1S1V B;  4ZP7 A;  4NEY A;  2UXD J;  4G1I A;  2FJX A;  3JQJ A;  3KLI A;  3MEG A;  3M6W A;  2J9D E;  1ROF A;  5LMN J;  1HL6 A;  5KFQ A;  4F67 A;  1B3T A;  2QYG A;  5IT4 A;  1M1K T;  1N5V A;  4ETZ A;  2LKZ A;  5J2P B;  5HO4 A;  3NOG A;  4ATN A;  4C8K A;  3TUZ C;  5A2Q U;  4RBU A;  3WDO A;  2EFO A;  3P5T L;  4RW8 A;  1Q8K A;  2AZ3 A;  4B3R J;  4EUV A;  1SQE A;  4V1A k;  4RU9 A;  3V4M A;  3DLK A;  1HBU B;  5AXN A;  2IM0 A;  3N4W A;  1LW2 A;  2RB7 A;  3HKW A;  1Q5V A;  3ITH B;  4KSE B;  4JI0 F;  3QLH B;  4J37 A;  3OHB A;  1REV A;  1KP6 A;  4DUZ F;  1MWY A;  3HD1 A;  5BR8 F;  5DRK A;  1YJ9 S;  2DNR A;  3DOL A;  1Y11 A;  3CSK A;  4Q2M A;  2JNJ A;  4B9V A;  1H2T Z;  1P1T A;  5HAN A;  3NGK A;  4P7T A;  3KDN A;  2HQI A;  2ILZ A;  3LP1 B;  2D7S A;  4X4R A;  2Z58 B;  5GMK a;  2W4C A;  3H98 A;  3M32 B;  1E6V A;  2DR9 A;  2AKW B;  2FYX A;  4NWB A;  1NDL A;  4MKB A;  1TMJ A;  1J5E J;  1U8S A;  3PG9 A;  2B6A B;  1IBK F;  5C24 B;  1NAQ A;  4AL6 A;  2CJB A;  2UV8 G;  3UR3 C;  2VIC A;  2LXF A;  2XZW A;  2BRK A;  3BPS P;  1EIY B;  3HHE A;  1HNV A;  2RUG A;  4RWX A;  1WOP A;  3HM9 A;  2G9O A;  4YB5 A;  1EET A;  1QSY A;  2NR0 A;  1DUR A;  4V19 J;  2HS0 A;  5E3C A;  3ZO7 A;  5JJB A;  1X5P A;  1Y5N B;  1RTI A;  4ZVQ B;  2W8L A;  1SKR A;  4E2F B;  5A8K B;  4PXE A;  2XMA A;  4OYX A;  2UVW A;  3U02 A;  4ZDN A;  3CJT A;  5F8H A;  2MLZ A;  3TVZ A;  3BGU A;  4FDF A;  2AJF E;  3I5A A;  3UCG A;  1HQU A;  3KOA A;  1HIY A;  2Z2M A;  1GK8 A;  1P27 B;  4LSN A;  1HQ2 A;  4HTI A;  3D0H E;  4TLR A;  1XMB A;  2UVV A;  5KTQ A;  2L9W A;  2HFN A;  3DHX A;  1GQE A;  1WC0 A;  4NXN J;  1RAE B;  3RZA A;  1T03 B;  2R2R A;  4QJV A;  2JRS A;  2KRR A;  4TU8 A;  1D3W A;  3ZFV A;  3FRZ A;  1JJH A;  2QL5 B;  4OZ2 A;  2VFU A;  2ZNZ A;  1T9T A;  3EGZ A;  1S10 A;  1AZS A;  1W25 A;  3LPY A;  3MXH P;  2UUA J;  1B7F A;  3D9B A;  5AE2 A;  4ECY A;  5GAE I;  4ITS A;  4K4W A;  2VOD A;  3IRW P;  2CQP A;  5HVG A;  1XK8 A;  3TP2 A;  1XNQ J;  1U0S A;  2IC3 B;  2CA9 A;  4JI2 F;  4JYA F;  4V19 X;  4U6P A;  2O3D A;  3FEY B;  1KKH A;  2I8E A;  1HFE L;  3IGN A;  3PR5 B;  2K1R B;  2FY8 A;  1HQE A;  1HBM A;  1Y3J A;  1LWE B;  5L39 A;  2CIM A;  2EK6 A;  1NM2 A;  2MZ1 A;  3W2W B;  1UWB A;  4Q0B B;  3VAI A;  1X60 A;  1NKC A;  2JLE A;  1FK9 B;  1H0H B;  2AGQ A;  3G9C A;  3RB6 A;  3R5D A;  1C0U A;  1DZ5 A;  5DDP C;  1JX4 A;  3T1H J;  4P10 A;  1HYS A;  4IH6 A;  3TA2 A;  3O8W A;  1D9F A;  4USK A;  3OTC A;  2AW0 A;  4N8N A;  3A3P B;  5L1J A;  1XMO J;  4LF5 J;  3UD4 P;  5D78 A;  4O0N A;  3CCL S;  2HW3 A;  1FXL A;  4KFB A;  1QE1 B;  4N47 A;  2VQF J;  4Y28 C;  1GAO A;  3TEG A;  1VBK A;  2CQC A;  1U26 A;  4P2S A;  2ZM6 F;  3H8Y A;  3BSA A;  1OY9 A;  4U8Y A;  2MGZ B;  2EVZ A;  4HDG A;  2ZKU A;  3T9Z A;  4MFB A;  2IMO A;  2KO1 A;  5J1E B;  4I6W A;  1LXN A;  1WOR A;  5AXM A;  2ATL A;  5LXR A;  3M8R A;  2JEF A;  1X5O A;  3V81 A;  4KGV B;  5ETN A;  1VK8 A;  3V2U C;  4OX9 J;  1KFS A;  1S0V A;  2HHX A;  3PXG a;  2H65 B;  2XLJ A;  3MM8 A;  5BYR A;  2NSC A;  2DGO A;  4CLZ A;  3W9J A;  1GMW A;  4C4W A;  2Z56 B;  3LAN A;  1UWA A;  1PC4 A;  2UP1 A;  4PQU A;  5M2U A;  3A3O B;  2MQQ A;  3KK2 A;  3R6G B;  1WG5 A;  1WDT A;  1VQO S;  2E29 A;  3QGH A;  4PAB A;  2V6A A;  1HBU A;  3L4B C;  4O3R A;  4DQQ A;  1CJU B;  1HPZ B;  3CC4 S;  2BYC A;  3ITH A;  1HBO A;  2ZBR A;  3QLH A;  4K5S A;  3J81 U;  2DNY A;  2OH2 A;  1MWZ A;  1L3S A;  4NZ0 A;  2FZG B;  4DR2 F;  3UWT A;  2Q1L A;  2GIR A;  3A4T A;  2DYA A;  3HLU A;  2QMX A;  3I82 A;  3QPI A;  2VKZ G;  3DKD A;  3GJR B;  4MYT A;  3QRR A;  2IJN A;  3M32 A;  3V6K A;  4W4M A;  2O5D A;  5I42 A;  4C48 A;  2N3O A;  1OY6 A;  3J80 U;  1N36 J;  3A13 A;  2WVC A;  2OML A;  2HGM A;  1SJ4 P;  2QIF A;  2V50 A;  3BH6 B;  3CED A;  3J7A 1;  5D0R A;  1RHJ B;  3P8B B;  4ZPC A;  4DFJ A;  2RRB A;  4KH0 B;  2BE2 B;  1MML A;  3K58 A;  2HS4 A;  2HFO A;  3F56 A;  4OYA A;  1JK9 B;  2ZZN A;  2ZHA A;  4J90 A;  5KFX A;  4EBE A;  4YHH J;  5C42 A;  2C2M B;  2GQ2 A;  2O66 A;  3LGM A;  3W1Y C;  1JXE A;  2FJW A;  5DZ6 A;  1QVF R;  5KFS A;  2HVE A;  3M6V A;  1Q82 T;  2YX1 A;  3MHY A;  3T1Y J;  4EBD A;  4A48 A;  3KLF B;  1SCJ B;  3I5B A;  4ENO A;  2VV5 A;  3DGP B;  2WB1 D;  3EVO A;  1RIS A;  2VL1 A;  3M9N B;  2V63 A;  1N6Q A;  2MQM A;  2B9E A;  1HI0 P;  5SUH A;  1VGY A;  2DGX A;  1AXQ A;  1FRH A;  1KHV A;  1WOS A;  2XTJ P;  3K17 A;  1IVZ A;  2A18 A;  4L76 A;  2B8Q A;  3HK2 A;  2J76 E;  2CAJ A;  2VFT A;  2VG6 B;  4FKY A;  4Z7Y A;  2HHS A;  5CXT A;  1UVK A;  2JHE A;  2MQL A;  1YJ7 A;  1S97 A;  4DR3 F;  1AA1 B;  1VBX A;  2XHC A;  1HBN B;  2E1R A;  1QDU B;  3UFC X;  5D77 A;  1KSP A;  3PNI A;  4RNM A;  1Q8I A;  1RT1 B;  4OJ3 A;  2ASJ A;  2O1P A;  5IZH A;  3LOU A;  1IN0 A;  1TTH B;  2MJN A;  2CDR B;  4LRF A;  3CDE A;  4IFY A;  4QZV B;  1KQF B;  1LWC B;  2BA9 A;  1SI9 A;  2XGP A;  3AXK A;  1U2C A;  3PHE A;  2O67 A;  1N88 A;  4RW6 B;  3CTR A;  1QJH A;  4NCG B;  1LWX A;  1S6U A;  1X4C A;  1YWX A;  5DGB A;  2W9C B;  3PFE A;  1TUW A;  1NUE A;  4DR6 J;  4DL6 A;  2YNF B;  3RW6 A;  4MH8 A;  4WFA Q;  2XLI A;  1U1O A;  5CAB A;  3KHR A;  1H3D A;  4EWT A;  2YNI B;  1RAF B;  2V5H G;  3MM9 B;  4QIW D;  3BV8 A;  2RU9 A;  1LWE A;  4PUO B;  3JTO A;  3HHL B;  5KFA A;  4JI7 J;  2UUT A;  1Y10 A;  4WU2 A;  1HNZ J;  3C14 A;  3CDB A;  1V9O A;  3IBW A;  3NY0 A;  2FVR A;  1FFG B;  2VPW B;  3HVW A;  1KQK A;  5KG3 A;  5HMZ A;  3UDC A;  2XM3 A;  1XC9 A;  2HG4 A;  2QFJ A;  5IT9 Y;  1APS A;  5DS7 A;  2Y1L B;  1KN6 A;  2R7R A;  5AT1 B;  4X4O A;  2ZH5 A;  4RUA A;  1RLD A;  2OPP A;  1RT6 B;  1ZZN A;  3IO1 A;  1F3V A;  4FBU A;  1XEZ A;  4LF7 J;  4C7Q A;  3G8Q A;  7AT1 B;  3EE3 A;  2MLX A;  1HNI B;  4Z7C A;  1VK3 A;  3ENW A;  3MEE B;  2GCF A;  2PC6 A;  4ZLP A;  2KG0 A;  3IAS 9;  5J1E A;  1GMU A;  3D6H B;  4WE1 B;  2YNH B;  3MR5 A;  3H5Y A;  2QA4 S;  1FRL A;  1SH2 A;  3M1V B;  4USM A;  5B0A A;  2BJD A;  1FKP A;  1PC5 A;  1WC6 A;  2AV5 A;  2UUB F;  3H2L A;  3M2R B;  4RBT A;  1GXT A;  1HWU A;  4PXB A;  4QWD A;  4BC9 A;  3BO3 A;  1JNZ B;  1GTE A;  4M5D B;  3EGW B;  3H2U B;  2J9C A;  2RQ4 A;  4X4V A;  1CJU A;  1T9Y A;  4OJ1 A;  1K44 A;  3OLA A;  4CO5 A;  4B9L A;  1JKH A;  1MRO A;  1U1Q A;  1FNO A;  4ZPD A;  2YX4 A;  4O4R A;  2EC0 A;  5BYS A;  3QID A;  2F1F A;  3Q8S B;  2GAG C;  1YHQ S;  3HVA A;  2JC0 A;  3BZQ A;  2DGS A;  3GSI A;  1V3R A;  2RDI A;  2F4V J;  4PEO A;  1QD1 A;  2DPJ A;  1KVJ A;  2ZBC A;  1KQS R;  3DC2 A;  3ISZ A;  2KYZ A;  4LBP A;  2WBR A;  2HLU A;  3CCQ S;  4ZVR B;  3DM2 B;  3CJK B;  1EKR A;  4F02 A;  4I2Q B;  1Q79 A;  1S0M A;  4X4N A;  3CCE S;  4ZCK A;  4P74 A;  2YKO A;  3KKF A;  1RAB B;  3BPD A;  1T9U A;  2F5G A;  8ATC B;  4KHP F;  3LAK A;  4JI8 F;  2DD8 S;  3DXB A;  2QRR A;  2BE2 A;  2BEF A;  2RRA A;  4OI4 A;  1X4B A;  4TN2 A;  1P9Q C;  4NRU A;  5KG2 A;  3W9I A;  4ZOS A;  4ECT A;  1K1Q A;  5CYM B;  1VQ8 S;  3NBP B;  3D5M A;  4QIG A;  2YWH A;  1JXL A;  3BBB A;  4ZMM A;  4P52 A;  4DUY F;  2J9D A;  4LRB A;  1BQX A;  3ZTP A;  4NLT A;  4EFA C;  2HKE A;  2C42 A;  3FQK A;  5KFN A;  1LFW A;  4LIW A;  4KO0 A;  3HKZ D;  1U7L A;  3M2U B;  2Y0B B;  4JI5 J;  4L3K A;  4DX8 H;  3C66 A;  2VBW A;  3G82 A;  2X1B A;  5I3U B;  5J2N B;  1TKZ B;  3NNC A;  3QIP A;  3VV2 B;  2EC2 A;  2X1G A;  2FB0 A;  3W3S A;  2WVB A;  4M5H A;  1LK7 A;  1I94 J;  2VG5 B;  3GP9 A;  5EN1 A;  2KFZ A;  1LOU A;  3CJ5 A;  1JMT A;  1MLA A;  3NXZ A;  3N6N A;  2DCU B;  4PAA A;  1HHQ A;  2BOP A;  3FQL A;  4H4K C;  2W9B A;  1HBN A;  4IG3 A;  4F4K A;  3IC1 A;  3BO4 A;  4L74 A;  1HMV B;  5H9F J;  4QCL A;  4NOH A;  3HHL D;  3IRX A;  4HH1 A;  1VC6 A;  1ARO P;  1WC5 A;  1J27 A;  2GQQ A;  3KG1 A;  4F8R A;  1QAY A;  3W65 A;  2K8G A;  3FFI B;  3CF5 Q;  4UQT A;  1FES A;  3MMA B;  3KK1 B;  1LWC A;  2C1E B;  2RU3 A;  2HSE B;  4KRW A;  2VD3 A;  3PIP Q;  3GIR A;  3TW0 A;  1VI7 A;  4ED1 A;  1SKU B;  2H9Z A;  1JLQ B;  2XSF A;  5CA5 A;  3H42 A;  3I56 S;  3K2Y A;  1EKS A;  4PYA A;  3DHW C;  3KUG A;  2ZH7 A;  4HAC B;  1SKS A;  3FEZ A;  1NB7 A;  2OJ3 A;  1GTH A;  3DDI A;  4KHR A;  3T1Y F;  2EK1 A;  5A6W A;  5HN0 A;  3FNN A;  1HI1 A;  2XZD B;  2FLN A;  1NH8 A;  4B3T J;  1VQM S;  3EGV A;  2Y3Y A;  2B0G A;  2KXH A;  1DLO B;  1SJQ A;  3IBF B;  4LFA J;  2E1M C;  4PG8 A;  1S4E A;  2F63 A;  4WF9 Q;  1S48 A;  3ZTR A;  2FGC A;  2W25 A;  4A8K A;  2BAC A;  2UXC J;  3AY0 A;  3DXS X;  5K20 B;  5KFL A;  1H74 A;  2W9A A;  3HVT A;  4K0K J;  3J7Y I;  1UJ6 A;  2M52 A;  9ATC B;  4ZIT A;  3H2V E;  4LT6 A;  3QT8 A;  2DT9 A;  3A8E A;  2DO4 A;  3CJ4 A;  3CCT A;  5LSL A;  4TY8 A;  3E01 A;  3TI0 A;  1ZH5 A;  1VLO A;  3MEE A;  2QL7 B;  4PWU A;  3FBC A;  5IWA J;  5G0R A;  4CLP A;  2EFQ A;  3C3L A;  2KZM A;  4OZ1 A;  5A6P A;  3PW7 A;  3SV4 A;  3O44 A;  5ETM A;  4WE1 A;  5GAH I;  3ZZT A;  4UF4 A;  5B09 A;  3ZZR A;  4ICL B;  3JB9 k;  4QR1 A;  2XUL A;  1N0U A;  2G2O A;  3H90 A;  3M1V A;  1VRU B;  3KUH A;  2AU0 A;  3UO0 A;  4DHV A;  4USW A;  2BOA A;  3CDU A;  3FUY A;  3MCS A;  2PA3 A;  2VDI A;  4B9S A;  2MQ8 A;  1KRP A;  5D8H B;  2YWG A;  5HVH A;  2DNQ A;  2YPZ A;  4TKT A;  4XPC A;  5GMD A;  3DLG B;  3SDE A;  4X66 F;  2XCP A;  1R0A B;  4PWD A;  2CWK A;  1P8G A;  3F73 A;  1ZAV A;  3MEK A;  1H2V Z;  4JI7 F;  4M5D A;  4F36 A;  4O4G B;  3VZI A;  1YDL A;  1QY7 A;  3H5S A;  2ZH1 A;  1HNZ F;  1KVI A;  3VAM A;  2V4J B;  5EX3 A;  3DGV A;  1PSD A;  2W2O P;  1QVG R;  3FCV A;  1IBM F;  3SCJ E;  2J5A A;  3FEX B;  1GXL A;  3ZTS A;  3H0P A;  5KFO A;  5JMN A;  4ELU A;  4O0I A;  3PKY A;  4DPX A;  4IG0 B;  2OPR B;  4ER8 A;  3ENV A;  3DNC A;  4OFZ A;  4ZP9 A;  2BJ9 A;  2WVE A;  3CJK A;  5T41 A;  3AJD A;  5GAD I;  2UXB F;  4UST A;  2PSZ A;  4TLQ A;  3K5L A;  2U2F A;  1RKI A;  4B3M F;  1IJF B;  1S7H A;  1OIA A;  4Q2L A;  2IAJ B;  1UKU A;  2CAD A;  1IBL J;  3CJQ A;  1RT5 B;  4WIQ A;  2XMW A;  4K4T A;  3FCW A;  3GZ7 A;  4M8L A;  3GCX P;  2C2O B;  1BUX A;  4JI1 F;  2QTW A;  1CVJ A;  1WC1 A;  1NK0 A;  4QW9 A;  4C3L A;  4Z2X A;  5D4L A;  2K2P A;  3MPY A;  4PCQ A;  1W2B R;  4DWI A;  3D68 A;  3HF5 A;  2P6S A;  2HMI B;  3AB2 B;  3D6F B;  2OFG X;  1F9E B;  4G1Q A;  2UU9 J;  4PG5 A;  3MZI A;  3M2U A;  1VHI A;  2GMH A;  1FF2 A;  6FDR A;  5J2N A;  3Q2T C;  2WOM B;  1TKZ A;  3W60 A;  2XI2 A;  3TYT A;  5DLF A;  3H59 A;  3OR1 B;  4RW9 B;  3MMB B;  1VQS A;  3NS5 A;  2WON A;  3T9N A;  1SJ3 P;  5B0D A;  1Q86 T;  1RLC L;  5EX0 A;  1C1B B;  3CPW R;  4OHX A;  3ZC4 A;  2BVZ A;  4UOF A;  3OFH A;  1WF1 A;  1QAX A;  4XDD A;  2QT7 A;  2DRB A;  5AE1 A;  4Y2A A;  5DO2 A;  4DPY A;  2KG1 A;  2G13 A;  1TVR B;  1RT2 B;  2QLX A;  1O6X A;  1Y5I B;  3ZTQ A;  2GML A;  1FDB A;  3R7S B;  2AYM A;  1F3F A;  2ZJR Q;  1UEK A;  2DIU A;  1FXR A;  4IQX A;  3MMA A;  5KT7 A;  2XQC A;  3TJ9 A;  1FI4 A;  2BZ2 A;  4EYI B;  2LP4 A;  4K4Y A;  3TX0 A;  4A47 A;  4H4M A;  1JLQ A;  2LEA A;  1U2R A;  2C22 A;  3CD7 A;  3KLG B;  2AD9 A;  1U25 A;  2QE5 A;  3TUI C;  4W98 A;  2GO9 A;  1FVQ A;  1QM9 A;  1ITP A;  2CVE A;  2J7W A;  3QMQ A;  3D0G E;  4DV3 F;  2I38 A;  1ZA2 B;  1HWI A;  1CS4 B;  4P71 A;  3RAM A;  1RWP B;  1H6K X;  4IOA Q;  1E6Y B;  4P9S A;  2HYI B;  1RJJ A;  1FE0 A;  4AQY F;  4ZVS B;  2OGU A;  3HVR A;  2HFU A;  3C46 A;  2Y0S D;  3TZY A;  3ZZU A;  4YY3 J;  2P5V A;  4PKD B;  2G0C A;  5D0E A;  1RBO B;  4YDX A;  4I7F A;  3I55 S;  4FYD A;  2RVJ A;  1XMQ F;  1OPI A;  4P7V A;  3K57 A;  2W8K A;  2KM8 C;  1PYS B;  3K5P A;  1U6B A;  2EKN A;  1Q16 B;  5CZX A;  1TK5 A;  3HFK A;  1RU1 A;  3QJJ A;  1YVF A;  3G6X A;  3NAH A;  2X7I A;  3F44 A;  4N5S A;  1O5J A;  1CLF A;  4WII A;  3CE8 A;  1FE4 A;  1XTZ A;  2KT3 A;  3ENA A;  4ED4 A;  1WHW A;  4I68 A;  1OO0 B;  1KOO A;  2IRX A;  2HND B;  2YWK A;  3P6Y C;  4H4O B;  1YLX A;  3NNH A;  2B4U A;  2D9P A;  4K2J A;  1S9G B;  3CT9 A;  2W4D A;  3MUV P;  2NUH A;  4JV2 A;  2XB2 D;  3AQP A;  4XK8 C;  4ICL A;  1T9W A;  1NB2 A;  1VRU A;  4F4Z A;  3PDN A;  1SVD A;  1TKT B;  2JJ4 D;  2GX8 A;  3M8Y A;  1YRT A;  1RK8 A;  4WFX A;  2AJ0 A;  4UTG A;  4DR4 F;  4K4Z A;  5HMX A;  3UN5 A;  1N54 B;  4MIB A;  3OTE A;  4C98 A;  2LU2 A;  4LVN P;  4LF2 A;  3POT B;  1W7W A;  3DLG A;  4GVB B;  4K59 A;  3CUN A;  2X3D A;  4B9M A;  1OSC A;  2V9K A;  1YI2 S;  4ECU A;  1BXN A;  2CPI A;  4NYO A;  4TYA A;  4B3T F;  3TVK A;  2MSS A;  1FRM A;  2E44 A;  2V4J A;  1RHU B;  1CQN A;  3BDE A;  3RB3 A;  5EWF A;  1HD0 A;  4LBI A;  2E9T A;  2F9J A;  3QFH A;  2YKM A;  4DN0 A;  3PJW A;  1J2V A;  3HT0 A;  1UEU A;  4A8X A;  2XHW A;  5LXY A;  1LWF A;  2LXU A;  3EPI A;  4X2B A;  1B7Y B;  1X5T A;  2OPR A;  3HO1 A;  3TA1 A;  2ALY B;  5KFC A;  4C9D A;  4LRC A;  1VQY A;  4LFB F;  2IIH A;  5THW A;  3WHI A;  1RTH B;  4ES1 A;  1T94 A;  2FC9 A;  2QLJ B;  2PMZ D;  3MPV A;  1RT5 A;  2KJW A;  2N82 B;  3D4J A;  3VZH A;  4DV0 J;  2PD1 A;  3RAX A;  1Q78 A;  2B7B B;  1R0C B;  3MM5 B;  3JS9 A;  4IOB A;  1QAJ A;  3MR2 A;  4I2P A;  4DBQ A;  4AL5 A;  2AYB A;  4GKJ J;  4TY9 A;  3UD3 P;  4IFV A;  1SL2 A;  1S9E A;  2RQM A;  3FGV A;  1M5V C;  1WDD A;  1REG X;  1KLN A;  2YQ1 A;  1UVM A;  4DSK A;  3CCV S;  2MKK A;  3EIC A;  4NA1 A;  3PX0 A;  3FKB A;  1U49 A;  4IOC Q;  3BYP A;  2ZKT A;  3Q86 A;  5GME A;  1O8B A;  2XMK A;  5E3R A;  1SC3 B;  2V34 A;  5ETS A;  1YBA A;  4WYL A;  1HNX F;  2FIU A;  5AJ3 F;  1DTT B;  1RT7 B;  4AE5 A;  2BDP A;  3ADA C;  1QUV A;  2D3U A;  3ILI A;  3VTI A;  5KT5 A;  3BBF A;  3DDK A;  2ILY A;  4MYU A;  4MT1 A;  3US5 A;  3TAQ A;  4FF3 A;  4BCA A;  2LQJ A;  3DLJ A;  1WKL A;  1IWA A;  3CC7 S;  3OTO F;  2ZH3 A;  3DI6 A;  3H5X A;  4O44 B;  1RT2 A;  2HQF A;  2HHW A;  1WOO A;  4IO9 Q;  5DDQ C;  2VQE F;  4YUD A;  3H4D A;  3SV3 A;  4ZS6 A;  1UVJ A;  1RHR B;  4RU2 A;  1X31 C;  2XWX A;  4BDP A;  3O3L A;  2H5J B;  4RPF A;  2FJB B;  4LBH A;  4LFC F;  3OFF A;  4F50 A;  3R7B B;  5I4M A;  2ZD1 A;  3TJ8 A;  4DLG A;  1JLB B;  4ZPB A;  1RTD A;  1IUJ A;  3THT A;  3C15 A;  1X9W A;  1Q4R A;  2RHQ B;  2ZC4 A;  5C25 B;  2KFN A;  3HHL C;  2PT0 A;  3OJS A;  1H7X A;  1E6Y A;  3MED B;  4OYZ A;  5HQ8 A;  3RB0 A;  3DN9 A;  1X5S A;  4IR1 A;  2X3G A;  2J8A A;  3VHQ A;  1WF0 A;  2PE8 A;  4C8Y A;  2XI3 A;  3R97 A;  4ECQ A;  5D4P A;  2XO7 A;  3HXM A;  1S9F A;  1YGY A;  4ZPW R;  4MIW A;  1ZS6 A;  5KG6 A;  1N5Y A;  3IWL A;  4OYB A;  4PPZ A;  1U4B A;  3PY8 A;  5GAG I;  4WK3 A;  4F3O A;  2HNY B;  4Z37 A;  2WHO A;  2NPF A;  3NCR A;  1NRK A;  5K8M A;  2BJ8 A;  3TAR A;  4I0W A;  2HND A;  2COL A;  1DFD A;  2ZZT A;  1WEX A;  2HRY A;  4C11 A;  4H4O A;  2DH7 A;  4RJV A;  2B3T B;  3LPE A;  3T6B A;  1JIH A;  4KBI A;  2PMH A;  1CJK A;  1MU2 B;  1PYT A;  1Q7Y T;  1TEL A;  1D0E A;  3Q8R B;  2YH1 A;  4LVO P;  1X4F A;  1NDP A;  4URS A;  3VAF A;  3LP0 B;  1FKO B;  4AD6 A;  2V0N A;  2K7K A;  4C0B A;  3CWJ A;  2EFV A;  4ZLJ A;  3A8K A;  2HHQ A;  5K8N A;  2KT2 A;  4CTA B;  1TV6 B;  4ANC A;  3POT A;  4RNN A;  2XMV A;  1VS3 A;  4GVB A;  5HAO A;  4YEA A;  3MAQ A;  4QIE A;  1CJV B;  3D6T B;  1JQG A;  1S1T B;  4B3S J;  1P1L A;  3UN3 A;  4DFP A;  4K8R A;  3I0S B;  3B8H A;  2QGF B;  2R9L A;  4Q45 A;  1MN9 A;  1ACM B;  3HSJ A;  4GKK J;  1SIW B;  3S7R A;  2MHN A;  3OD2 A;  1MWQ A;  4NLP A;  1F9H A;  2C2R A;  3BKU A;  3EZ5 A;  1ZTT A;  2MKJ A;  5EUH A;  3C16 A;  3OHA A;  1CC7 A;  3O2I A;  2JEI A;  2XY6 A;  5HJX A;  1K1S A;  4YR2 A;  4ZVP B;  1R3N A;  2FVS A;  2KYX A;  2M88 A;  3MFI A;  1M1H A;  3CD5 A;  4ILM A;  2GJF A;  2J0S D;  2GGP A;  4IDK A;  4C0H A;  3TNV A;  3PVX A;  4N7T A;  3H25 A;  4HHU A;  4F0M A;  4OZ3 A;  5B7W A;  4DV7 F;  1ZBT A;  1NSK L;  4XO0 A;  1FWK A;  1RE1 B;  1S77 D;  2VBX A;  4X4T A;  5H9E K;  4W90 B;  3MM5 A;  3DOK A;  3UDV A;  2CYY A;  2HRT A;  3JAM U;  4OZ5 A;  5A8R B;  5G4D A;  1Z2L A;  4JV5 F;  2CPX A;  2ERR A;  1NK8 A;  2HZC A;  3WZ0 A;  2N4D A;  3O6Q A;  2C2Z B;  2QJ3 A;  3MPU B;  3NS7 B;  7FD1 A;  3R5C A;  3DU6 A;  1J5O A;  4ZCI A;  3DRP B;  1HI8 A;  1SBR A;  2BR0 A;  4NI2 B;  1S76 D;  2W1B A;  2EFN A;  5CH7 B;  2R7X A;  4G6V B;  2CG8 A;  1A9N B;  2EI5 A;  2YWE A;  4NEZ A;  3UR0 A;  2RKI A;  2ROE A;  1DTT A;  1EQ0 A;  2RS2 A;  4X65 J;  1BQN B;  1F5A A;  4F4Y A;  2JWN A;  3UNY A;  4DR7 F;  1ZM9 A;  4RNO A;  5CQG A;  2R8K A;  1YJR A;  3KK3 B;  3UI3 A;  4CLK A;  2JSX A;  5IV3 A;  5CYQ B;  2W7O A;  2E5H A;  1S1W B;  2I1R A;  3DOM B;  4F0H A;  1T9V A;  4LF4 J;  4ZLL A;  2IYG A;  2Z30 B;  1UP1 A;  2OAU A;  3IAM 9;  2HHU A;  1YTY A;  4K2X A;  3T41 A;  2XNR A;  1JWW A;  3Q8P B;  5E33 A;  3M9O B;  4X4U A;  1RDR A;  5F8I A;  4OI2 A;  4EYH B;  1I51 B;  3DMJ A;  5ETO A;  1RA7 A;  5A0Y B;  1AW0 A;  4DPT A;  3GG0 A;  1JLA A;  3JAM Y;  5ETQ A;  5K14 B;  5C25 A;  2L9D A;  1ZPW X;  4ZVU B;  3CDW A;  2R8H A;  1JLG B;  1RHQ B;  1M0S A;  1GFW B;  4OLO A;  2AJ4 A;  1I3O B;  1WHX A;  3FK4 A;  4NLY A;  3QZ8 A;  4U67 Q;  2LA6 A;  4OHW A;  3TUJ C;  5HRO B;  3CCW A;  4CO1 A;  4DR1 J;  5B0C A;  3NCP A;  4J9Q A;  4WKY A;  3MEG B;  2CQD A;  2ZNY A;  3AB4 B;  5J2Q B;  1UEV A;  3NG8 A;  4J9V A;  2IHR 1;  4HTJ A;  4RKU C;  3BQ1 A;  2XNQ A;  1SB6 A;  3GJS B;  4J7C A;  5LT5 A;  3IP0 A;  1ZYQ A;  1M5P C;  4F25 A;  4ZN1 A;  4DV1 J;  2B4O A;  2HNY A;  4ALZ A;  1D8Z A;  1WJ9 A;  1LNQ A;  2QLF B;  1WHV A;  3NGR A;  3FC9 A;  3WBZ A;  1WSV A;  3GU0 A;  4KE5 A;  5K8P A;  5B0G A;  1K9M T;  2BAN A;  2P8I A;  1U1L A;  3BJY A;  1KEK A;  3WX8 A;  3W9H A;  3IGV A;  3DLK B;  4C0O C;  4DSF A;  4LQ3 A;  3NEK A;  3Q2S C;  1MU2 A;  1LW0 B;  2MZQ A;  2DHA A;  5FII A;  3QGI A;  2HGN A;  3LP0 A;  3DOL B;  1N33 F;  4LSZ B;  2IM2 A;  4LF8 F;  2IDE A;  4RUC A;  3I87 A;  3SSS A;  1S57 A;  1UW9 A;  3AQO A;  4CTA A;  2DJW A;  2M8D B;  1TV6 A;  4DSL A;  4DZ6 A;  5HAT A;  1TAQ A;  1HD1 A;  2E9Z A;  3LWL A;  4LF9 F;  1E6V B;  5DDO C;  1FXD A;  3PHT A;  3VGV A;  2DXE A;  1S1T A;  2JVO A;  1S0O A;  2OD4 A;  3EDR B;  3I0S A;  1FT8 A;  2YNG B;  4F2R A;  3AOD A;  4O3S A;  3SSQ A;  3GJQ B;  1EB0 A;  3CXC R;  1YRX A;  2D41 A;  2ZBP A;  4Y00 A;  1S99 A;  4ZK7 M;  3KJF B;  1WC4 A;  1S6Q B;  4M5I A;  4G1P A;  4USU A;  2DK2 A;  1XR7 A;  3RAQ A;  1HA1 A;  1N52 B;  5JVH Q;  3EDQ B;  3M8Q A;  4R0E A;  4DV2 F;  3ETO A;  3UVJ A;  2MKH A;  4J9O A;  2F40 A;  2FTR A;  1CUL B;  2ZIT A;  1Q7L B;  4FF4 A;  1EET B;  5HBM B;  2Y8Y A;  2YX7 A;  5ETT A;  5A8W A;  1Y9O A;  2NXC A;  1R0B G;  3OL8 A;  4QPX A;  1RTI B;  1U09 A;  4ELV A;  3ZNU A;  1YJT A;  1MSW D;  2YTC A;  4HEA 9;  4OHZ A;  3IS9 A;  3MUT P;  1RXO B;  1RCO B;  1X0F A;  2EXU A;  4J9S A;  2RJZ A;  1P6T A;  1HWJ A;  1HQU B;  3UDE A;  2QC3 A;  2VC0 A;  4KGZ B;  4LSN B;  5A8R A;  4BBY A;  2V2Q A;  4RW7 B;  2FZK B;  3HFZ B;  1F2G A;  4Q44 A;  3RRH A;  2W2Q P;  2W01 A;  4JI4 J;  4WTO B;  5KOX A;  4DL4 A;  3ICL A;  4HHH A;  1RU2 A;  4GMK A;  2YWW A;  4Q7A A;  1F0X A;  1EHW A;  1VQK S;  2NS1 B;  1DQ8 A;  3DRP A;  4IYQ A;  4R8U A;  2CJK A;  2HLT A;  4NI2 A;  2HHP A;  4U7C A;  3J81 j;  2CWX A;  1GX5 A;  4J9U E;  3VQT A;  2LQ9 A;  3T6J A;  3QSI A;  3FSX A;  2V8D A;  2DNP A;  5HP1 A;  2JDJ A;  4WXO A;  1RBL A;  3T5J A;  3IA0 A;  1CC8 A;  3S01 A;  4Y65 A;  3FJ2 A;  4ILL A;  1CPZ A;  2EFG A;  4KJI A;  3NRB A;  5CYQ A;  2CUY A;  1HR0 J;  4ECS A;  1HQE B;  3TX8 A;  1FDD A;  3DOM A;  4BWM A;  4YOE A;  2M70 A;  3GV8 B;  1G7C B;  1XBW A;  3SMZ A;  1FWP A;  1PAE X;  4OQJ A;  1UWB B;  2IBO A;  2IFX A;  5KFH A;  2GA7 A;  2NZC A;  2DTJ A;  3GFH A;  6AT1 B;  2VA3 A;  3PJX A;  1RAJ A;  2CNK B;  4DG1 A;  4OJG A;  2KVI A;  5KFY A;  1HYS B;  4IH7 A;  3RUB L;  1KOH A;  1LXJ A;  3PV8 A;  2DIT A;  2BUN A;  2DNM A;  2F8H A;  4R5P B;  1V5V A;  3CMQ A;  1FJG F;  5A0Y A;  2Q3P A;  4AYB D;  2KHC A;  4X64 J;  3N28 A;  3MEC A;  2HHV A;  4AND A;  4PWW A;  3I5C A;  2RSQ A;  2KHD A;  4FKX A;  4CM2 A;  2CPH A;  4Y2C A;  2ZBQ A;  4OYI A;  3A3N B;  2CKW A;  4KFB B;  4DQP A;  3IMQ J;  1O51 A;  4EGL A;  3MPW A;  4K4X A;  1SC1 B;  4K4V A;  4U95 A;  4HI1 A;  3R7N B;  2DEI A;  4JB8 B;  4MFB B;  3EZO A;  5GAH U;  2HWH A;  2J0Q D;  4WYW A;  4DL2 A;  1VQ4 S;  5HQM A;  5HRO A;  2HUR A;  3ZZ0 A;  3V81 B;  5KT3 A;  2ADC A;  3KUE A;  3OFE A;  2JVR A;  1X4G A;  5J2Q A;  2GVD B;  4YDD B;  1U6Z A;  3MM8 B;  2ASL A;  1Y7P A;  3I31 A;  2QEX S;  1RTJ A;  2P6T A;  3QAT A;  1JLC A;  1R43 A;  3MR6 A;  3QJP A;  2I0X A;  4JBC A;  2IJF A;  4PQU B;  2OEM A;  3KK2 B;  2E1A A;  4ZVG A;  2H51 B;  4CWB A;  3FCH A;  4LQ9 A;  2BW7 A;  3KJV A;  2FLP A;  2D9O A;  1CJT A;  4USJ C;  1LW0 A;  1HBO B;  1DAX A;  2VBZ A;  4P75 A;  1KLM A;  1GEH A;  5ITH A;  3NGT A;  3N5B A;  1TL5 A;  1VRT A;  4I6Y A;  2I2Y A;  4KT0 C;  5F3Z A;  4ZPV R;  3TAM A;  3T3F A;  1U6F A;  2WSC C;  4QIV A;  1N5S A;  1Z4U A;  4WP3 A;  3TUP A;  2IM1 A;  3PTW A;  4FPI A;  1BWV A;  3PO5 A;  3D28 A;  1G3O A;  3R6L B;  5KG1 A;  2Z8Q A;  2DH8 A;  5I42 B;  3NKY A;  4NLX A;  3BS9 A;  4KGK A;  2NCK L;  2YNG A;  2FHO B;  1O0P A;  3PZP A;  1IM6 A;  4CH7 A;  1RWN B;  4RW4 A;  1X9M A;  2I6W A;  5LMU F;  2W2P P;  4UUX A;  2YPY A;  1S6Q A;  1HNW J;  1SXL A;  2JZ5 A;  2VPZ B;  1NJZ A;  5B0B A;  3AD7 C;  4KC5 A;  4DS4 A;  2E7V A;  4XDC A;  4RBV A;  1QUP A;  5C42 B;  4DLE A;  1ZZF A;  3MGJ A;  3AT1 B;  4M63 A;  1AFJ A;  5ETL A;  1CUL A;  5KFR A;  5HBM A;  4FN5 A;  3NOC A;  2BM1 A;  1DHM A;  1XNR F;  2LQ5 A;  1NH7 A;  4ZCL A;  4M95 A;  2LDY A;  1IKW B;  4EI2 A;  1N6Q B;  1TKX B;  3IXQ A;  3DLB A;  1UPP A;  4DU7 A;  2QV6 A;  4DV4 J;  4FS2 A;  4C8O A;  3GIL A;  4MTP A;  4E0D A;  2YKQ A;  2LQ8 A;  3VQS A;  2NXE A;  3BEG B;  3G86 A;  4DV5 J;  4WFN Q;  4JI6 J;  3D2W A;  3UE2 A;  5KAK A;  1WKK A;  3R2C J;  4RW7 A;  1UJ4 A;  1NK5 A;  2XEX A;  1BHN A;  2CZ4 A;  4IO1 A;  2QLB B;  1F5B A;  5IQQ A;  3VAG A;  1PJ6 A;  2D69 A;  2JOQ A;  2CNN B;  4LRA A;  1S49 A;  4IFY B;  2JFD A;  3AXM A;  2AT1 B;  1Z2Z A;  3M8P B;  5D3G B;  4WWS A;  1Q5Y A;  1VBZ A;  1HWL A;  5DM7 Q;  4LF6 F;  1PKU A;  1ZPV A;  3I4H X;  2EBG A;  4NLV A;  2MEW A;  3FZB A;  5CHC B;  2OPS B;  3TQE A;  2CPD A;  2E5L J;  2VPY B;  2W7P A;  4MMO A;  3W8P A;  2DKO B;  5IFM A;  2UV8 A;  2OSR A;  3D3B J;  2ZE2 A;  2BQU A;  3W5Y A;  5C7P A;  2WAQ D;  2P2C B;  3HI9 A;  2XC9 A;  4CIO A;  3E2E A;  2JLF A;  5D4N A;  1PIL A;  4O3Q A;  3KHG A;  2DNG A;  3BQ2 A;  4I4B A;  2NXU A;  1N5Q A;  3PAC A;  3BM7 A;  3JSR A;  1RHM B;  2K7J A;  1R27 B;  2FD2 A;  4DV6 F;  3BR8 A;  3C14 B;  3D1O A;  1NND A;  3ET6 A;  1AFI A;  3JSY A;  1Q8L A;  2ZH2 A;  2ZH4 A;  1BQM A;  3LH2 S;  4DZD A;  2NQP A;  4X62 F;  1GMW D;  1N32 J;  3M8Z A;  3R2D J;  5ETP A;  1OY8 A;  4R5P A;  4DF8 A;  2LMI A;  3FMW A;  2R2U A;  1NLK L;  4YP3 A;  2DH9 A;  1IKX A;  2FJE B;  2OPP B;  2DR5 A;  2IYI A;  2NXJ A;  3MD1 A;  1U1K A;  1DY3 A;  1C2P A;  2KTQ A;  1UMJ A;  2GMJ A;  2OKQ A;  2A6M A;  5KFB A;  1CSJ A;  3MM7 A;  2AYE A;  4ZPT R;  2P9E A;  3ZZZ A;  4HI2 A;  4BLG A;  3PO4 A;  1ZM2 A;  3K5M A;  4DEZ A;  2WVF A;  2QL9 B;  3OR2 A;  4DR5 J;  1FDA A;  4OMF G;  4ZVH A;  2Z4P A;  3IM8 A;  3D0I E;  3VGU A;  1FD8 A;  2GVD A;  4FBT A;  4ID5 A;  3NWG A;  1S4F A;  1N34 J;  3F41 A;  2AEF A;  1FKP B;  3J7Z 5;  3KJQ B;  2V68 A;  4ECX A;  4GC6 A;  3I0R A;  1CG2 A;  4WJB A;  4DSE A;  3QT6 A;  4YN3 B;  1F2H A;  3QRQ A;  2DVI A;  3PW2 A;  2UUC J;  1T7P A;  4TVA B;  3NCQ A;  4P6Q A;  5A76 A;  2NYI A;  1SV5 A;  2UZA A;  2FHK A;  1ELO A;  3QWP A;  3QT5 A;  2CFX A;  3CB4 A;  4Y2I A;  1JKH B;  2HAI A;  4CH0 S;  3NP5 A;  1MRO B;  1S72 S;  3MTK A;  2AF6 A;  1HLW A;  2G1H A;  1QSL A;  4OZJ A;  4JI3 J;  2NPI A;  4XPE A;  1DAR A;  1UAW A;  1YQH A;  4NLW A;  2DB1 A;  2GVZ A;  2RDD A;  1T9X A;  2Z2Z A;  2QMU B;  2YKP A;  4YQW A;  3LGN A;  4FVM A;  1FEE A;  2J7U A;  2HHH F;  5DG9 A;  1RP5 A;  3H20 A;  4ZIW A;  1H73 A;  4DXL A;  3G6Y A;  2YKN A;  4QWC A;  4M5N A;  2ZBI A;  3CJR A;  2OUG A;  3W64 A;  1TQL A;  4WBF A;  3TWZ A;  2FHJ D;  4NPO A;  1H38 A;  4ED0 A;  2UXD F;  1VRQ C;  2Q6C A;  2M0G B;  2N7C A;  2IDL A;  3KG4 A;  4DX7 A;  2MQP A;  4HVZ A;  4KPY A;  3TJA A;  1SJ1 A;  4UY8 5;  2QYC A;  2MKS A;  5LMN F;  3PFO A;  1W26 A;  4K7Q A;  4CO4 A;  2DNN A;  4M94 A;  5CZV A;  4KO0 B;  2V8P A;  1L3T A;  4WKR A;  3CO0 P;  3AD8 C;  1IKW A;  1TKX A;  1OYD A;  2FJV A;  3G82 B;  4TYB A;  4B3R F;  4ES3 A;  1I1G A;  1F60 B;  2AEJ A;  3HX9 A;  2KI2 A;  4RO0 A;  3QIP B;  2L08 A;  2M8H A;  1KVK A;  5C5J A;  4JI0 J;  1G4C A;  2WK4 A;  4J9R A;  5IT9 U;  4DUZ J;  5KFW A;  3AOA A;  1OMS A;  1SC4 B;  5BR8 J;  3ZXW A;  2MLY A;  1NBE B;  3JTN A;  2RDJ A;  4NMX A;  1R8C A;  5IC4 B;  2W9B B;  3CNQ P;  4IG3 B;  3MD3 A;  2IVF B;  2P9C A;  2VAS A;  3IRX B;  1U8W A;  3CDA A;  1RT3 B;  4IRC A;  2QX0 A;  4JP8 A;  1WEY A;  2DBB A;  3UW1 A;  2HBQ B;  3FBE A;  1FKA F;  3G6E S;  4CNY A;  3M8P A;  1J5E F;  5D3G A;  2NXN A;  3QT7 A;  3MR3 A;  2H54 B;  2WVD A;  2YXL A;  3MCN A;  2LDI A;  4ZVF A;  1JNR B;  3R1L A;  1Y4Z B;  1GMV A;  2J6S A;  4EEY A;  1FWL A;  2XSJ B;  2CRL A;  4NZ7 A;  5KT2 A;  2AYG A;  2OPS A;  1IBK J;  4NZ6 A;  2FHM A;  2Z0G A;  2WRM A;  4DSI A;  1QTN B;  3TAP A;  3V6D A;  2XYG B;  1IJE B;  1RT4 B;  2EWH A;  4MJK A;  2APO A;  2RT3 A;  1JLE B;  1X4A A;  2OPQ A;  2AGO A;  3S8S A;  1CQM A;  1R8P A;  4CZC A;  2HBR B;  3GFZ A;  2MKY A;  3CGI A;  4PQA A;  4B17 A;  2QZ8 A;  3LAL A;  2B9Y A;  1NU4 A;  4GO5 X;  1RCX B;  1UZD A;  4ANE A;  2R7T A;  5B0E A;  3IR6 B;  3TO8 A;  4A8S A;  4ED5 A;  2HVZ A;  1CEZ A;  1FDN A;  4FP9 A;  3H7H B;  4JI6 F;  1NEE A;  2R8G A;  3HVT B;  2RIJ A;  2F8M A;  2V94 A;  1S12 A;  4DS5 A;  3MPD A;  1TU0 B;  3D1H A;  1PCA A;  2BJ1 A;  1WD6 A;  4TY8 B;  3E01 B;  5HMW A;  4NXN F;  2B7C B;  1N56 A;  2KRB A;  4F26 A;  5G0R B;  1OS5 A;  2B56 A;  3ZZY A;  2V8H A;  3AFG A;  5E3A A;  3N0V A;  2UUA F;  3SSR A;  2MYF A;  2R7V A;  1GH8 A;  3BB5 A;  4OI6 A;  1EJ7 L;  1XNQ F;  3EM1 A;  4JYA J;  2JEG A;  1YRU A;  3SDE B;  4NAS A;  3PYF A;  3EPG A;  1S0N A;  4PWD B;  3W8G A;  3T5K A;  3CIZ A;  3JXO A;  1NZ8 A;  3B4M A;  2GJ2 A;  2C3O A;  1KFD A;  2KXF A;  2X51 A;  5BJR A;  5KFJ A;  1C4C A;  2A1B A;  2L9N A;  4KIA A;  2MDA A;  4K50 A;  3OJU A;  2FQQ B;  1VOM A;  4OV6 A;  1VC0 A;  4ILR A;  3OXF A;  1RWV B;  1BWE A;  3EX7 B;  1Q1K A;  2RML A;  1DTQ A;  4HYK A;  3T1H F;  1YJW S;  4CM0 A;  3IBC B;  3NGD A;  3HFV A;  5KT6 A;  3V6H A;  2YY3 A;  3OT9 A;  1XMO F;  4LF5 F;  2IJR A;  1KQG B;  3BDP A;  4QYZ J;  4AXI A;  4KY3 A;  2F4F A;  3LP2 A;  5JUM A;  2AJQ A;  4IR9 A;  2M5Y A;  3WIV A;  2VQF F;  3IWN C;  1WG1 A;  4RNF A;  2IVY A;  2X1F A;  4ZLN A;  5HLF B;  8AT1 B;  4U7U K;  4J91 A;  5HQL A;  4LR9 A;  4M5L A;  2ZM6 J;  2VON A;  4I6A A;  3TEH B;  1PO6 A;  5KFK A;  4IH5 A;  3UN2 A;  4DJB A;  3GFY A;  5KFU A;  3G71 S;  5D0H A;  3QJL A;  1WKJ A;  3DRY A;  3PW0 A;  3W61 A;  1NZA A;  4MK8 A;  4CYU B;  4OX9 F;  4NRT A;  2RQK A;  2VB6 A;  2VBY A;  2G0J A;  1RGV A;  1KS2 A;  2CQ1 A;  2RQC A;  2HRU A;  3PKM A;  3BN7 A;  2CPY A;  4G1Q B;  4LR8 A;  4O3O A;  4U7U D;  1NSP A;  2LVW A;  2XS5 A;  4DL3 A;  5IC6 B;  3HZE A;  4OI3 A;  2CNO B;  3C19 A;  2DGU A;  3DRS A;  4AL7 A;  5DG8 A;  5LOQ A;  3D54 A;  4HKQ A;  2F7V A;  5C2G A;  3Q83 A;  1VDH A;  4YME A;  1U0H A;  4EBC A;  3RB4 A;  5IM0 A;  1B0V A;  1VCT A;  4ELT A;  4NCA A;  3KJN B;  2EG2 A;  2WON B;  2R7U A;  2QA1 A;  4NML A;  3UPF A;  1IQT A;  1R6Y A;  3G87 A;  2KKH A;  1S5Z A;  3KLH A;  1D9A A;  3M8S A;  3PR4 A;  1SL0 A;  4DR2 J;  2DGV A;  1JLF A;  5EDW A;  2EFP A;  3C6T A;  2MZT A;  4KTQ A;  2DNL A;  5CCM A;  4KAI A;  1RT3 A;  1TZ0 A;  2GQC A;  4DF4 A;  1TFW A;  2PFF B;  1H2U X;  1S79 A;  1N36 F;  1FRK A;  2KXN B;  3QO9 A;  3PYD A;  2HVD A;  4FF1 A;  4KGM A;  4H4M B;  2C3P A;  4MKA A;  3SQG A;  2XSJ A;  5FJ4 A;  1X7V A;  1KNZ A;  2OI2 A;  3OL6 A;  4YHH F;  1VIO A;  3MOZ A;  3DFE A;  3ILO A;  5H9F K;  5DG7 A;  1RT4 A;  2CJQ A;  4QOT A;  4OI0 A;  1JLE A;  2XMM A;  5FD1 A;  1OQ6 A;  5DET A;  1SKW A;  2ZVI A;  1Y0H A;  4NYP A;  3C6U A;  1T95 A;  2HBY B;  3V5R A;  2BKP A;  4F4X A;  3WQP A;  4F04 B;  1GNK A;  4RNH A;  3MOJ B;  3U1L A;  1VQ5 S;  1IBC B;  3IWX A;  3SCL E;  4I7F B;  2DR6 A;  3BGL A;  3ILL A;  2Z2L A;  3E8O A;  4Q5V A;  4DR3 J;  5DZ7 A;  1X0P A;  4QPT A;  2XG8 A;  2R2S A;  3ZZP A;  4AFF A;  1YG0 A;  4HH0 A;  1URN A;  1K47 A;  3UNG C;  5KFG A;  3IG1 A;  2GHV C;  2R3V A;  3EVM A;  5F8G A;  5KG0 A;  3RTV A;  1SH0 A;  4EO6 A;  2M2B A;  3HSZ A;  5AXL A;  2PEB A;  4A8O A;  5DJB A;  1PYO B;  4QR0 A;  2Q6B A;  1C0T A;  3FRY A;  1N48 A;  1FFS B;  2K3K A;  2WB4 A;  4NX9 A;  1FRX A;  3P3D A;  5T7L A;  5L8R C;  2QG9 B;  1ZOT A;  1N4L A;  2CXE A;  4OL8 A;  3PEJ A;  1YX2 A;  3Q0A A;  5D15 A;  4O3N A;  3R5G A;  1X8D A;  1Q0N A;  3OL7 A;  4DR6 F;  4EZ9 A;  1S1U B;  5IT0 A;  1WI8 A;  5K8O A;  3B82 A;  4PG7 A;  1FVS A;  4MIA A;  1XWL A;  5ETK A;  4HT5 A;  5BYQ A;  2XBP A;  1F1B B;  2V69 A;  1YK9 A;  2HQ3 A;  4OX6 A;  3WIU A;  2MY8 A;  2FY1 A;  3Q8V A;  2ROG A;  1G1X A;  3OVA A;  2SXL A;  1PJ7 A;  3W2V A;  5A2Q Y;  3C2P A;  2AGP A;  2B4P A;  4ZP8 A;  1KTQ A;  3HCX A;  1S7I A;  1D1U A;  2YKM B;  1P9Y A;  2OEK A;  3DLH A;  3GCW P;  1LWF B;  5KFM A;  4F3M A;  1IKV A;  4H4K A;  1NKB A;  2PGC A;  5HI7 A;  3MMJ A;  4AT1 B;  4LF7 F;  3T5H A;  3OTB A;  1UW4 A;  2GAH C;  2MMY A;  1B0P A;  2GIQ A;  1RYR A;  2DY1 A;  2J6T A;  2B8P A;  3NL0 A;  3OBI A;  4OI1 A;  5HLF A;  2GNK A;  1UTA A;  4E98 A;  3A8J A;  5D0G A;  3U7J A;  1NPP A;  3IFE A;  4YS2 A;  3NNA A;  2A2C A;  2MTL A;  2YVS A;  3EXC X;  1IR2 A;  3R5A A;  4CYU A;  4I2P B;  1H72 C;  1YBT A;  4KR0 B;  4ERD A;  5IV4 A;  3RYL A;  4IFV B;  1S9E B;  1A0O B;  3QAE A;  3D3C J;  2ZH6 A;  2FGO A;  4U96 A;  2MY7 A;  3CD0 A;  2ZHO A;  3DRR A;  4L75 A;  2UUB J;  1KHW A;  5K5M A;  1VQL S;  1FNM A;  3KDO A;  1NSQ A;  3K7R A;  4S0M A;  3BGR B;  3CCU S;  1SQG A;  2RIL A;  3SEO A;  2B4V A;  1T8E A;  4CO2 A;  3H4B A;  1NPR A;  5JVG Q;  2ZJP Q;  1U1N A;  4PYD A;  2BAB A;  4C8Z A;  1LV5 A;  4X4S A;  4QWB A;  5EWG A;  3LAM A;  4ZJQ A;  3GII A;  3QAU A;  4A8F A;  2F4V F;  2MB0 B;  1FCA A;  4QU6 A;  3THV A;  2KM8 B;  1RSC A;  3DI6 B;  3U1M A;  3DLL Q;  1WHY A;  2POK A;  5E41 A;  2Q79 A;  2NSB A;  1T02 A;  3OTD A;  3TOQ A;  2ASD A;  4OZN A;  5KFI A;  4LRD A;  4KHP J;  3I96 A;  1Y5L B;  4JI8 J;  1XIQ A;  2FVP A;  1YIT S;  4J9M A;  2LCW A;  1VQN S;  4J9N A;  1S1V A;  2ADB A;  4WP8 A;  2ABY A;  4DU8 A;  4I67 A;  3HDS A;  4YB1 P;  2ZD1 B;  3KLE B;  3MR7 A;  1RTD B;  7FDR A;  1WTB A;  4DUY J;  3C15 B;  2Q43 A;  4PPD A;  1DQ9 A;  5J2P A;  3VGT A;  1VFJ A;  3EWG A;  3V6J A;  4AXJ A;  1EQM A;  2PI4 A;  1EP4 B;  3RW7 A;  2FJD B;  4JI5 F;  4DL5 A;  3UD5 A;  3P96 A;  3K5O A;  2BMB A;  2LEP A;  4MK7 A;  2VHG A;  2GW8 A;  5T14 A;  5LJ3 Y;  1FX4 A;  5HL7 Q;  1I94 F;  1G6B A;  5GVQ A;  3E51 A;  2DHG A;  2IRY A;  1N5Y B;  4OIX A;  3TR5 A;  3Q8Q B;  2IRU A;  1YZ7 A;  1HWK A;  2WW8 A;  3SIP B;  4DN9 A;  1VQ7 S;  2J9E A;  4CLW A;  5HMY A;  2R7W A;  5EHH A;  1ZET A;  3LP1 A;  4MK9 A;  2D3O 1;  2HVH A;  3CJ2 A;  4C11 B;  4HR2 A;  2E5J A;  3IN5 A;  2DRA A;  2CZV C;  4USI A;  1CJK B;  4WFB Q;  2XYH B;  5KFP A;  2W4P A;  3HSG A;  4H54 A;  3GV5 B;  1EAR A;  2B6A A;  4L72 B;  4ECZ A;  3KYL A;  4URG A;  5BXI A;  5C24 A;  3M7V A;  5ETR A;  3BRE A;  3N01 A;  1S1U A;  3AJ1 A;  1NJX A;  3CD6 S;  2M3D A;  1Y3K A;  4C6A A;  4KB7 A;  4KGX B;  4OYM A;  2R42 A;  3N9U C;  3GR0 A;  2IA6 A;  2OD6 A;  1VQP S;  1RB0 A;  3Q24 A;  1RWX B;  2QN6 B;  3PX4 A;  3ISN C;  2KFY A;  1KTV A;  4OYW A;  1ZM4 A;  4LFA F;  2ZUG A;  3RU0 A;  3W62 A;  5A8K A;  4CDI A;  2CQ2 A;  1U02 A;  3G6V A;  4ZHR B;  5L1K A;  4XAK A;  5ADZ A;  3C16 B;  1DJ0 A;  2UXC F;  3CCM S;  2FHJ A;  2RF2 B;  1R8B A;  3J81 Y;  4BHQ A;  4K0K F;  2ZOF A;  4ZP6 A;  3G2X A;  4USH A;  4OHY A;  2OIH A;  3LO3 A;  3OXL A;  4FPR A;  3A12 A;  2GGP B;  1IWG A;  1FJC A;  4IDK B;  1ZAW A;  1C4A A;  2MHE A;  5IWA F;  4LMZ A;  1T03 A;  4BS2 A;  1TKD A;  1SQF A;  4TQR A;  1DBD A;  3MUR P;  2CJA A;  2Q66 A;  3RBE A;  4JV1 A;  4D3H A;  1YBU A;  3DOK B;  3J80 Y;  4M1K A;  4YFU A;  1VIX A;  1XR5 A;  4WFZ A;  3MM6 B;  2IC3 A;  4Y2M A;  2GC8 A;  2PMW A;  1X4H A;  2XCA A;  3I4P A;  4X66 J;  2XGQ A;  2K1R A;  4DQI A;  2VUG A;  4QIF A;  4OX7 A;  3DRX A;  3BGR A;  1J5O B;  4P2F A;  3PJ9 A;  2HK2 A;  3W2W A;  1RZM A;  4L73 A;  4Q0B A;  5GAE U;  2OLW A;  2E5G A;  1TUV A;  2ROP A;  4UOH A;  3TA0 A;  1FK9 A;  2RKI B;  2IPO B;  1DRZ A;  3DDN A;  2ZFH A;  5HK4 A;  4DPU A;  1IBM J;  1RAO A;  4PG4 A;  2ZC3 A;  3FBF A;  2N4C A;  3BSO A;  1RWM B;  3OUY B;  2KVQ E;  3NAI A;  3J7A N;  2KH9 A;  1XQI A;  1I6J A;  1T3O A;  1A6L A;  4F7V A;  2AEM A;  2N7Y A;  2UXB J;  1QE1 A;  2JX2 A;  4WU3 A;  2D3O R;  1OSD A;  2H5I B;  2ZDO A;  3WC0 A;  4B3M J;  1IBL F;  2IM3 A;  2MGZ A;  4QWA A;  1KD1 T;  4PRF A;  2ASY A;  2FZC B;  2C2E A;  1W2I A;  3K89 A;  3BBC A;  4JI1 J;  2VF3 A;  2L48 A;  2HS3 A;  2D74 B;  3GE9 A;  3T1A A;  4R0J A;  4ZN3 A;  2RRN A;  1R8A A;  3G4S S;  3KLE A;  2OO4 A;  3DMJ B;  3N6L A;  3A8I A;  1YKW A;  5IS2 A;  4B3O B;  1DQA A;  1JLA B;  3SCK E;  1GT8 A;  1OYE A;  2UU9 F;  1ZTW A;  2W2M P;  2CJY B;  3G8S A;  1EP4 A;  2AIR B;  3VAL A;  5M2R A;  5KOW A;  5DQH A;  4DUT A;  3FDS A;  1K0T A;  2HAF A;  2CJX B;  5L38 A;  5KG5 A;  5C2C A;  3W63 A;  3PYE A;  1HPZ A;  4CO0 A;  2DNO A;  5I3P A;  4DQR A;  3D6M B;  2FLL A;  5E3Q A;  3N79 A;  3N6M A;  4PZV A;  3S6E A;  4WZM A;  1S6O A;  3BN4 A;  1BY9 A;  3L95 X;  3R1H A;  1ICE B;  2R8J A;  2H4Y B;  2J7K A;  4N56 A;  1HHT P;  1PBA A;  3OXG A;  2VJU A;  2CZ9 A;  3IM9 A;  3L3C A;  4CNZ A;  2BAN B;  5IQ6 A;  3E3X A;  5F8J A;  4OV1 A;  5DQI A;  4ED6 A;  2ZEJ A;  4F2S A;  2HPU A;  2PFD A;  4LIR A;  3K8W A;  2J6U A;  2IMW P;  2ZWP A;  4N41 A;  1FFW B;  1U24 A;  3EYZ A;  1V3Z A;  5J1P A;  2XLK A;  3CMA S;  1D9D A;  4I64 A;  2BXJ A;  4TQS A;  3VAJ A;  1RI7 A;  2GHW A;  2LEB A;  1WC3 A;  2H48 B;  3W5X A;  2GS8 A;  4DV3 J;  4GC7 A;  2QSF A;  2QO3 A;  3SBM A;  1YJN S;  3KHL A;  5D4O A;  3KLF A;  3R9L A; 
#chains in the Genus database with same CATH homology
 2QLJ B;  3D6H B;  1IBC B;  3R6L B;  5IC4 B;  4ZVQ B;  1PAU B;  3R5J B;  1RWO B;  1RHM B;  4ZVR B;  1ICE B;  4DCJ B;  4ZVS B;  1RE1 B;  1RHK B;  2H5I B;  2H4Y B;  1RWX B;  4DCP B;  3GJR B;  2XZD B;  3KJQ B;  3EDR B;  3P4U B;  1RWN B;  2QLB B;  3IBF B;  3GJQ B;  3SIP B;  2HBQ B;  2C2O B;  3GJS B;  2H65 B;  1RWK B;  3R7S B;  1QDU B;  2H4W B;  2CNK B;  2QLF B;  2CNN B;  1RHJ B;  3KJF B;  2C2Z B;  2H54 B;  4ZVO B;  5K20 B;  1BMQ B;  2H51 B;  1RHR B;  2FQQ B;  5IC6 B;  2H5J B;  2CDR B;  1RWV B;  2CNO B;  1RHU B;  3NS7 B;  3GJT B;  1PYO B;  3R6G B;  2C1E B;  3D6F B;  3EDQ B;  3P45 B;  1F9E B;  2XYH B;  3IBC B;  3R7B B;  2CJY B;  1I51 B;  2C2K B;  2C2M B;  2Y1L B;  3QNW B;  4ZVP B;  2QL5 B;  1QTN B;  2XZT B;  2DKO B;  3RJM B;  1NME B;  1SC1 B;  2XYG B;  2QL7 B;  2CJX B;  2Y0B B;  3KJN B;  2XYP B;  4ZVU B;  2HBY B;  2HBZ B;  1SC3 B;  2QL9 B;  3R7N B;  2H48 B;  2P2C B;  4LSZ B;  1RWM B;  4JB8 B;  4DCO B;  1RWW B;  1RHQ B;  2HBR B;  1GFW B;  4ZVT B;  3D6M B;  1I3O B;  2CNL B;  1SC4 B;  1RWP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...