1X4FA

Solution structure of the second rrm domain in matrin 3
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
112
structure length
112
Chain Sequence
GSSGSSGKKPEGKPDQKFDQKQELGRVIHLSNLPHSGYSDSAVLKLAEPYGKIKNYILMRMKSQAFIEMETREDAMAMVDHCLKKALWFQGRCVKVDLSEKYKKLVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Matrin 3
publication title Solution structure of the second RRM domain in Matrin 3
rcsb
source organism Mus musculus
total genus 11
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2005-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1x4fA00
1FNXH 3ULHA 2KRBA 1HD1A 2YTCA 1H6KX 3CD6S 3NNHA 3EGNA 1JJ2R 4P6QA 2Q79A 1Q82T 3CC2S 2MYFA 3B4DA 2DNYA 3I55S 1WI8A 3MD1A 3UCGA 1X5SA 3UE2A 1D8ZA 2MSSA 3UD4P 2MKIA 1X4HA 1SXLA 1N52B 3BEGB 2KXHA 2MKKA 2DHSA 2HZCA 1ZZFA 1VQMS 2HYIB 2RT3A 5GMKa 4CIOA 1WWHA 3D2WA 2MZSA 2XS2A 2MZRA 5CYJA 2OIHA 2XSFA 3SMZA 3OW2R 3VAHA 1H2TZ 3CUNA 2KM8B 1X5OA 2DNQA 1VQPS 5IFMA 3CTRA 2CQIA 1U1KA 1CVJA 2OTLS 2DISA 1VBYA 3MUMP 2RS8A 1VQ4S 2L9WA 3CCLS 5LSLA 1JJ4A 5DDOC 1U2FA 2DNMA 1X4EA 2NLWA 3EGZA 4IO9Q 3CPWR 1R8HA 2RVJA 2CQDA 1YHQS 3CCJS 3G8TA 3P49B 2FHOB 2U2FA 1IQTA 3LQVA 2KG1A 3H2VE 2K3KA 1H2UX 1YWXA 3FEXB 4W92B 2CPJA 1D9AA 3TP2A 4F02A 2MGZB 2YH0A 3VAFA 4Y00A 1YJWS 2VONA 2LA6A 2DNHA 2LQ5A 2G1DA 2KHCA 2CPZA 1X4FA 2CPFA 4QU6A 2CQ3A 2CQ4A 2MKJA 2G4BA 2LEBA 2MMYA 1NO8A 3S7RA 1DHMA 2M7SA 1YI2S 2MQOA 2L08A 1QVGR 1BY9A 2EK6A 2M2BA 5LSOA 1U1PA 4C4WA 3R1HA 2A3JA 2MKSA 1G2EA 2CQPA 1P1TA 1YJ9S 3G4SS 2DGTA 5GAGU 2XB2D 3N9UC 2N7CA 2KRRA 1HL6A 2E5GA 5IM0A 2DO0A 2HGLA 5HO4A 1X4AA 1OIAA 2DNRA 5EN1A 3G8SA 1WTBA 2RU3A 2LXUA 5DDRC 1U1OA 2MY7A 3MXHP 3TO8A 2EVZA 2MJNA 3CCQS 3VAJA 3SXLA 2KG0A 1K9MT 4RU2A 2FY1A 2OJ3A 2L41A 1M5VC 1YJNS 4LJMA 2DH8A 1S72S 4BS2A 2XS7A 3R27A 1PGZA 2M9KA 1FJEB 2DITA 2DIUA 2QFJA 1L3KA 2UP1A 1OWXA 2CJKA 2AYEA 4V19X 3ZZZA 5GADU 2DNKA 1SJ4P 4CQ1A 1NJIT 2J8AA 4YOEA 1UP1A 2DHXA 3V4MA 2F9JA 3UWTA 3VAIA 3CXCR 2CQGA 2DH7A 2DNPA 2AD9A 5D78A 1OPIA 2E5JA 2XNQA 2MQPA 2AYMA 1SJFA 3S8SA 1A7GE 2NZ4A 1AUDA 3SDEA 1X4DA 2PE8A 3CCVS 2CQCA 1VC6A 5H1SV 1FO1A 3P6YC 3S6EA 1YITS 2MB0B 4A8XA 2CQ2A 5IQQA 1WEZA 2CPHA 2EK1A 2LCWA 3PIPQ 4WFNQ 2MZJA 2VOPA 1VC5A 3L3CA 2CQBA 1X5TA 1HD0A 2M8HA 1YIJS 1M1KT 2CPXA 4UQTA 3MURP 1XN9A 3CCUS 2MQMA 2DGVA 2M0GB 2O3DA 4F26A 4YUDA 2MZQA 4FXVA 2HGMA 3BO4A 2DHGA 1UFWA 2DNLA 2MHNA 4QQBA 3G96A 2MQNA 2ZJPQ 3UD3P 2ADBA 4U67Q 1DBDA 2QA4S 2M4MA 1N88A 2F9DA 2MQLA 2X1FA 2BOPA 1JJHA 1WHXA 2DNZA 1X5PA 2YH1A 3U1MA 3MUTP 1WHYA 2JWNA 3I56S 3NS6A 4LIRA 2LECA 3DXBA 3CC7S 4PKDB 3RW6A 3BO2A 1F9FA 3VAGA 3CC4S 2VODA 2JRSA 4YB1P 3VAMA 1U1MA 2F3JA 2DNOA 2KXNB 2CPIA 1VQOS 4WIIA 3TYTA 2DGUA 1DRZA 1KOHA 2DH9A 2XS5A 1YTYA 2YWKA 1S79A 3EX7B 2LA4A 3MOJB 2CPDA 3MI7X 5BJRA 4TU8A 1U1QA 2KI2A 2RS2A 2ERRA 3G71S 1QM9A 2KFYA 1WHWA 4F25A 4TU7A 2JVOA 1JMTA 1U6FA 2OTJS 1FT8A 2OSRA 2LKZA 2FPHX 2QEXS 4IUFA 3NMRA 1FHTA 1X4CA 2DGQA 5LJ5Y 3IRWP 1VQ7S 3MD3A 2MZ1A 2BZ2A 4OZ1A 1ZZNA 1U6BA 2LXIA 1WELA 2X1GA 2MJUA 3DLLQ 1M5PC 1WG5A 5DDPC 3UCUP 2N3LA 2KYXA 4C7QA 4IOCQ 1UAWA 2HGNA 1P27B 5LJ3Y 2MXYA 2D9OA 4CH1A 2DO4A 5HL7Q 2AYBA 4C0OC 3MDFA 4WKRA 1RKJA 2LYVA 2MGZA 2MZTA 2D3OR 5GAHU 2KN4A 4ERDA 2JVRA 5GVQA 2M52A 4J5OA 2AYGA 1B7FA 2RNEA 4PRFA 1SJ3P 1HA1A 1WF1A 5CA5A 2DGWA 5CXTA 2DNGA 4CH0S 2E44A 2DGXA 1WHVA 3US5A 1N8RT 4IOAQ 4ZKAA 1K73T 1O0PA 1N54B 1H2VZ 4FXWA 1FJ7A 4M5DB 2GHPA 3UCZP 1A9NB 2DB1A 3HI9A 2N82B 3P3DA 1QVFR 1U1NA 4WFBQ 1SJQA 2FC8A 1FJCA 1FXLA 2DNNA 2I2YA 2JX2A 2RUGA 2ZJQQ 5MLCV 2E5HA 1VQ5S 2U1AA 5GAEU 1WI6A 4QU7A 3CMAS 1WG1A 2CPEA 1WEXA 4W90B 2FC9A 5DDQC 4OZ0A 4WCEQ 3ZZYA 3G6ES 3R1LA 1ZH5A 2SXLA 2CQHA 3NNAA 3B4MA 2MKHA 3H2UB 1VQLS 2MY8A 2KT5A 1X0FA 3CCRS 3FEYB 3THPA 1PO6A 1RK8A 1VQKS 2KH9A 3HHNB 4Y0FA 1W2BR 3CMES 3VALA 3Q2SC 5IM0B 3VAKA 4ED5A 5LXRA 2RQ4A 1VBXA 3RW7A 2E5IA 2ADCA 1K8AT 2KVIA 5JVHQ 2KM8C 2K8GA 1UW4A 4WFAQ 1VQ8S 1VC0A 2CPYA 2DK2A 4LMZA 1KD1T 2MSTA 2N3OA 5D77A 1KOOA 2YKAA 2WBRA 3K0JA 3NNCA 5FJ4A 2OSQA 2PEHA 3P5TL 1X4BA 1Q81T 1URNA 2M8DB 1VQNS 2VOOA 1U1LA 5DM6Q 2X1AA 3U1LA 2CQ0A 1Q7YT 3CULA 3J7ZT 2B0GA 1M5OC 4Z2XA 3CCES 2D9PA 2XNRA 2LEAA 1WF2A 3NS5A 1VBZA 4PR6A 1NU4A 3LPYA 1M90T 3IWNC 2CQ1A 2ZJRQ 1KQSR 3CCSS 2J76E 3BS9A 4WF9Q 3CCMS 3VF0B 2M88A 2LMIA 2MPUA 3SDEB 1DZ5A 1WG4A 2DIVA 2V94A 4TLQA 4TU9A 2RQCA 5LXYA 2DGSA 1VQ9S 2DGOA 2M70A 5ITHA 3MUVP 3Q2TC 2KXFA 2X1BA 1KC8T 1R8PA 3PIOQ 2RRAA 1Q86T 5DETA 3G9CA 2G0CA 2HVZA 2J0SD 1X4GA 1U1RA 3J7YU 2MKCA 2GO9A 3S01A 4QPTA 1WF0A 4UY8T 2J0QD 1WEYA 5DM7Q 3BO3A 1M5KC 1VQ6S 2DHAA 2I38A 3THTA 4EGLA 2MQQA 3CF5Q 3JB9k 2RRBA 5JVGQ 1SJRA 1OO0B 2KU7A
chains in the Genus database with same CATH superfamily
4LSNB 2PGCA 5J2QA 1TR0A 2AJFE 1H6KX 3RAQA 1UPPA 3RR7A 4YHHF 1SV5B 3UCGA 5IWAJ 2WOMB 4EBEA 5KFUA 4ANEA 4NLSA 2KXHA 2DHSA 4C48A 2FVCA 5CYJA 2GMLA 3OTOJ 1F5AA 2RHQB 4TLRA 2EKNA 1U1KA 4QWEA 1SC4B 2B9XA 3EGZA 2UXDJ 3DLGB 1IQTA 3OLAA 3KLIA 2HQDA 1JLFB 3J81U 3TUIC 3VGUA 6FD1A 1T7PA 2ZH9A 4EZ9A 3DLJA 2NS1B 2DNHA 5C5JA 2DR6A 3T1YJ 1OJ4A 3S7RA 2EFNA 2IMOA 1DHMA 2MQOA 3RJMB 4ZPCA 1C1BB 1GXUA 4LRFA 1PBAA 4URQU 4WFYA 1ITPA 3QIDA 3SCJE 1T8EA 3LAMA 4F50A 4UT4A 2UUCF 2ZUAA 4LF5J 5K20B 1TP7A 4O3NA 2HHHJ 3VAJA 3BM7A 4WK3A 3TJAA 4NI2B 3KK2A 2HWIA 4R5PA 3R27A 1F5CA 4NCGB 4O4GB 1OWXA 1CULB 1DLOB 2FZGB 2VG7A 2V6AA 4OYMA 1EETB 1UP1A 1X31C 4RW7B 1I51B 1IQZA 2UU9F 1UVMA 4G1QB 3CXCR 3LWMA 4JYAF 4DX5A 4DPTA 3KDNA 4LF7F 2I5JA 3OFHA 5HLFA 1NZ8A 2YKNB 2QSWA 3MR6A 3MAQA 2CNNB 1RT7A 1HLWA 1WEZA 5A8WA 4ZIWA 2BQRA 1SKWA 4IG3B 2Z2ZA 1M1KT 3WQPA 2C3YA 3KK3A 4J9LA 1YRXA 1S49A 4F26A 2FVSA 4FBTA 3I82A 3K59A 5J2MA 3N28A 4KHMA 1PYSB 2D3ZA 3EICA 4CLFA 2QA4S 2M4MA 4LSNA 3RRGA 3G6YA 1X5PA 2YH1A 2HFSA 1SV5A 4DX6A 1BHNA 3K89A 2WOMA 3SV4A 4N56A 1EQMA 4L74A 2KI2A 3NS7B 3SBMA 2Q43A 3D68A 1U6FA 4DV1F 2HBZB 3M8RA 2YBVA 1I94F 1TUWA 4KHRA 4ECWA 1XEZA 4YR3A 1WELA 4ED4A 3DLGA 1M5PC 2RUSA 2J7WA 4C7QA 3NWRA 1JLFA 3NWGA 2Q6CA 4C0BA 3FQKA 2QA2A 2BJ3A 1R0AB 4A8WA 1MMNA 2H5JB 1GT8A 1R3NA 1C1BA 1LQ9A 5E7OB 1K44A 1S10A 2XYGB 3KK1B 4YHHJ 2FZCB 1WI6A 3C8YA 3W7BA 5EUHA 1FDBA 3R5CA 5GMDA 1N34F 4NI2A 4NCGA 4O4GA 1CULA 1W2BR 2P9GA 1PC5A 1EETA 4DCPB 4RW7A 2J9DE 4F3MA 1S57A 5J2PB 2AX0A 2HW3A 3IR5B 4USMA 4ZLNA 4N5SA 2BDPA 1LW0B 2WBRA 3Q8YA 2GQCA 2C22A 1VI7A 2YKNA 1X4BA 2YNFB 5KFMA 2F8MA 2OD4A 2FJEB 1EKSA 4JI8F 4IG3A 1IXKA 4NXMF 2ZJRQ 3IGNA 2G2ZA 2MPUA 4PWDB 2V63A 1X60A 1WG4A 2COLA 1VRUB 1HBUB 1FERA 1SC6A 3IN5A 2K1RB 2FHKA 3MUVP 1YJRA 2OLWA 1TL5A 3KJFB 4UZBA 2DJWA 5A0YB 2UUCJ 3NOGA 1R31A 5ETLA 4KV8B 1Y3KA 2J0QD 4DFMA 4UZCA 1R8AA 4RL1A 3L4BC 5KFQA 1YG0A 1VRQC 4B08A 1NK0A 5K8NA 3AODA 4LRAA 3UDVA 1FVSA 1SIZA 2WZ1A 3QPIA 2H1YA 2DYAA 2GAHC 3KUHA 2UU9J 3RB6A 4CLSA 1HKAA 4JYAJ 2CJ9A 2BW2A 5GAGI 1KVJA 3B4DA 2AW0A 4FVMA 1N5QA 4AXIA 2Y1LB 2ZBPA 5KG1A 4LF7J 2CIMA 1ZTTA 5B09A 1S6PB 3PACA 4DR6F 4JB8B 1Y9OA 1CJUB 3W9HA 2XS2A 2XSFA 1RWVB 3D3BJ 5F8JA 2ZKUA 4ZVFA 2OFGX 3M8ZA 3B54A 1JLEB 1EJ7L 4DUZF 3MUMP 3CCLS 1R0AA 4MK8A 1R8HA 1UWBB 1FFSB 2F1FA 2MLXA 1D9AA 4FYVB 1UFKA 2UUTA 4B3RF 3I0SB 2HIYA 3K8VA 4PWUA 1LWXA 5LMNF 2GHVC 1S76D 4HEA9 1FRMA 2MTLA 1IJFB 2EK6A 3IGVA 2BXJA 2A3JA 3ELHA 5CQGA 1G2EA 6FDRA 2N7CA 3CJRA 4DV1J 2DRAA 1S4FA 4U8VA 5J2PA 1I94J 5AT1B 2E7XA 3D4JA 1ZA1B 1LW0A 1S72S 2E9ZA 3M4XA 2YNFA 1Q5YA 3OL7A 4X64F 1WKKA 2DHXA 4NCAA 4MKBA 1NK7A 2HVIA 5DGAA 4O3SA 1OPIA 1CPZA 4RO0A 3DHWC 4PWDA 1KQFB 2P6SA 5AXKA 1VRUA 3S6EA 1YITS 4A8XA 1QSSA 1HBUA 2RDJA 2G0JA 2VG6B 2VICA 2K1RA 4HHJA 5ADZA 3KDOA 2CQBA 2Y0SD 3GJQB 1YIJS 4RBTA 3MURP 5GAHI 3QAEA 5EWFA 1UEKA 4FXVA 3ILJA 3I32A 3D54A 5C25B 1N34J 4KV8A 4QQBA 1H7XA 3UD3P 3BDPA 4OLPA 1GTHA 4OX6A 2B9EA 3W66A 3BR9A 2F9DA 3ZZ0A 4ELVA 1MSWD 2ZHOA 2XCPA 3LGNA 3NS6A 2E5LF 3G8QA 2AU0A 4MTPA 4DQRA 3JSBA 3H4DA 3TYTA 4TN2A 5HSPA 2XLIA 3EX7B 4CM2A 1T05A 2LVWA 1S6PA 1SL0A 5F3ZA 1CJUA 3R7SB 3HXMA 2C3PA 1NHUA 4BBYA 4CCHA 5CD4A 4JI8J 4NYOA 3H7HB 1WTFA 4RNOA 1UA0A 1JLEA 3EZUA 1KFSA 2HBRB 1IR1A 3FNNA 3BB5A 4DJBA 4TQSA 1UWBA 1XNRF 1QUVA 2J6SA 2IRYA 2VH7A 4JI5F 1YGYA 1DQAA 4F36A 2VPXB 4DHVA 4IDKB 3RRKA 3TQ1A 3I0SA 4OZNA 1U09A 4P10A 2Z2YB 3GQCA 4KJIA 2HPUA 1UPMB 1SI9A 3O2IA 1S48A 2A2DA 4FXWA 5BYQA 2VA3A 3W5YA 4WP3A 4MT1A 4PXEA 1PSDA 1IBKF 2QYGA 4WK1A 1DFDA 1F9HA 1B0PA 4TYBA 2XQCA 4LF6F 2LXFA 4DV0F 1W26A 3HHNB 1RAEB 2V0NA 4B9VA 5F8MA 3P96A 4YN3B 4OI0A 3DOMB 1Y4ZB 2KVIA 1R8BA 1Y5LB 3PO5A 2D3O1 5CABA 2W4CA 2YKAA 3JTOA 4JOUA 3U1NA 1NK5A 4LF8F 3PRDA 3LA0A 1UVIA 4FVCA 3MM5B 2OEKA 2VG6A 2VUGA 2VASA 3SQGB 5KFNA 3TEHB 1RHJB 4B3RJ 4UW2A 4X2BA 1BUXA 4ZPTR 2YPZA 5LMNJ 3GIIA 5C25A 1UTAA 3QATA 4LRDA 3ZZUA 2P6TA 4CLTA 2DIVA 3N5BA 4USWA 2DGSA 2A6MA 4XPEA 5IC6B 2UXCF 1HQ2A 3VCDA 2G9OA 2E9RX 1OQ6A 4RWWA 2POKA 2J0SD 2B56A 1X9SA 5KFLA 1U4BA 1M5KC 1SKUB 3C2PA 4URGA 3GJTB 4X64J 3AJDA 4YDDB 2D7SA 4CO5A 3DMJA 4ZLPA 4N8NA 3PX6A 4NLPA 4DPYA 1QDUB 2RQMA 4AD6A 4DCJB 1DARA 5DQGA 8ATCB 4I4BA 5E3AA 1VQMS 2I9SA 2W1BA 2JFKA 2VDHA 2V2QA 2VBZA 4IDKA 1F2GA 3QJPA 2FJAB 2R2SA 1VQPS 4KH1B 2ZOFA 3DNCA 5CCLA 3KFWX 2HQGA 4WZQA 3CPWR 1LK7A 2P5VA 3NCRA 3DOLA 5L39A 1ZBTA 4F02A 1U02A 3HHDA 2AJQA 2YH0A 4DL2A 3IFEA 3RAMA 2VONA 2E5LJ 4LRBA 2V2ZA 1ZYQA 1L3SA 4X62F 3FK4A 3GCXP 1WUUA 4A8QA 4KYZA 2HMIB 4NE9C 2QA1A 4P74A 4ELUA 2W2QP 3SFGA 5GAGU 2AT1B 5DS7A 3DOMA 2ROGA 4L73A 1X4AA 4OL8A 2PN6A 2X51A 3TO8A 1K9MT 2C2EA 2L41A 4C8KA 1WC1A 1HWKA 4EEYA 1XNRJ 4JI5J 2M9KA 3HVWA 1MG7A 3MM5A 2VG5B 4FXDA 5I3UB 3HSZA 3SQGA 3J7Z5 3VHQA 2WVBA 3NGTA 5CAAA 2MQPA 2OEMA 1NUEA 4QW9A 1FX2A 3ENWA 1J5EJ 1VC6A 2L3MA 2RU9A 2EK1A 1KN6A 3PRBA 1W2IA 3O44A 3QBCA 2FTRA 3M6WA 3J7AN 2IDLA 2KFZA 1HR0F 1T9XA 1IBKJ 3HHLC 1NAQA 1S0NA 1KBRA 4LF6J 3M1VB 4DV0J 3FRZA 4U67Q 5EWGA 4KGZB 4OIXA 1KONA 2GIFA 1WHXA 1NDKA 3GPAA 4CTAB 3FBCA 1SUQB 2Z2MA 2ZDPA 3K5PA 3BR8A 3A3OB 2ROPA 4LF8J 4QW8A 1RT6A 4A8SA 4M63A 2YWHA 5MAOA 4FYDA 4G1PA 2A1BA 3MPUB 4LT6A 4U7UD 2HHVA 2V9WA 3VVTA 3ILLA 4G65A 1RP5A 2FVQA 1PJ6A 3VZIA 1UZDA 2UXCJ 4WE1B 1K1QA 3EVMA 1UWAA 4OJ3A 5GAHU 2ROEA 3HFZB 1DQ9A 1KRPA 1IWAA 2NR0A 4CM0A 4NASA 3IS9B 3QSYB 4K4UA 3EDRB 4M5MA 2LDIA 3QQCD 3W62A 4DFJA 2HMIA 4P7TA 4QYZJ 2EFGA 4I64A 3UQSA 2CZ9A 3HFVA 3BZQA 4ZVSB 2FB0A 2IAJB 2I2YA 2ZJQQ 3QWPA 4FYWB 3CJ0A 1S1XB 2YXLA 2QZ8A 1JX4A 1CBKA 2CPEA 2GZOA 3EGVA 2HBYB 1X9WA 3HHLB 1MU2B 3GLJA 5CHCB 4IYQA 5LOQA 4J9RA 2A10A 2GCFA 1TUVA 3C66A 2VG5A 5KFSA 5I3UA 3Q2SC 2FJBB 1K47A 4USJC 1VBXA 4NCBA 1GMWA 2ZE2B 1Y10A 3HHEA 4WFAQ 2H9ZA 3ISNC 3H5XA 2MSTA 2N3OA 1TQLA 1YRTA 1GH8A 2YX1A 4LQ9A 3CCTA 4E0DA 3DCAA 1URNA 3T41A 3IP0A 2VFVA 3VQSA 2AEJA 3KLFB 4O44A 4KAIA 1PAUB 2OUGA 2QIFA 3PXGa 4PR6A 1NU4A 3LGHA 3HFKA 1SKRA 2CQ1A 2NREA 4X62J 4RX6A 3UNYA 1OY9A 4DV6F 4B9UA 3OXGA 2YPYA 2QFIA 3M1VA 1M1HA 4GC6A 2FGCA 3HSDA 3R7BB 4HYKA 2KB2A 2XYPB 1GNKA 3WX4A 4DR3F 4YMEA 4CTAA 1SUQA 1U8SA 1QE1B 2RKIB 3K58A 3BBFA 5DM7Q 4I67A 3CF5Q 2MQQA 4RUAA 3Q83A 2IM2A 2D41A 3GIKA 3CD6S 4PPDA 2B51A 3I4HX 3LWLA 5IT9Y 3BDEA 3A4TA 1UA1A 1FKAF 3ILOA 3JS9A 3BQ2A 1YZ6A 1VGYA 3VAHA 4WE1A 3EYZA 1HR0J 1KTVA 5C2CA 2ZBIA 2GQQA 3T6BA 3KHGA 4WYLA 3CIMA 1P1LA 4NA1A 3L95X 2HHTA 2CZ4A 2KJVA 3OJUA 1QAIA 4IH6A 5JJBA 3UN3A 1SC3B 1XTZA 1Q4RA 2BA9A 1S1XA 1NJXA 3DDKA 4ED0A 2WSFC 2CPZA 3HHLA 1FDDA 1MU2A 2W01A 4AT1B 4RNHA 1IM6A 4R0JA 4B9MA 2H3EB 5CZXA 3P45B 3N9UC 2G13A 1WSRA 5HO4A 2ZE2A 3TA0A 3I5BA 1AROP 2MY7A 2AJ1A 1CJKA 2FY1A 1YJNS 1A6LA 3ENAA 1REVB 3ZTQA 1KQKA 2HHUA 2Z30B 2CJKA 4V19X 5D15A 2RE1A 2XMJA 2J8AA 5HVHA 3KLFA 3PX4A 2ZD1B 3NGUA 3Q8PB 5CH7B 4WIQA 2F65A 2NZ4A 1X4DA 4EZ6A 3QT5A 2V2KA 1OSDA 3PX0A 1Q1KA 3PRVA 5KT7A 4DX7A 2XZTB 5LT5A 3X1LB 3U27A 1AFJA 4CH7A 4EUVA 5CD4H 2CPXA 2QLFB 4UQTA 2HK3A 2OHDA 4XO0A 1B3TA 1M5SA 1QE1A 2DNLA 2MHNA 2RKIA 2QLXA 2Z56B 2BJ7A 1T9TA 2QT7A 3U1MA 4QYZK 1BQXA 1F9FA 1UCNA 2V2VA 1U1MA 2LLZA 3LF0A 3DRYA 2B43A 4PXBA 3DDIA 3W2VB 1YLXA 2ZDOA 1FEEA 1PCAA 1ZA2B 3Q89A 2ZWPA 2WVEA 3ITHB 1XC9A 3B82A 2V4QA 1ELOA 4X4SA 2JVOA 2QEXS 3MMJA 1X4CA 5H9FJ 4CWBA 3CDBA 3ADAC 2R8IA 3QRPA 2BZ2A 3O1LA 4OZ1A 4DV6J 8AT1B 2X1GA 4KE5A 4AL6A 1T94A 3SQOP 3QGGA 5LJ3Y 2MXYA 1EZZB 3M30B 3PKYA 1P6TA 1TTHB 2B9WA 3PDNA 4USIA 4DR3J 3FJ2A 2IY5B 1XR6A 4QWDA 4JI3F 2C2MB 3PY8A 3US5A 4IOAQ 4RUBA 2N4DA 2JEGA 2VQEF 5J2NB 4JI4F 3A13A 1H3DA 3P3DA 1AUSL 1C1CB 2DNNA 1S59A 2CUYA 5D6GA 1PC4A 2C1EB 4ZLLA 2C2KB 4Q7AA 1PO6A 1REVA 2RB7A 3TVKA 2XO6A 1RDRA 4C11B 4ED5A 3IG1B 2BUNA 2FUG9 3EZ5A 3D3CJ 2ZD1A 1N36F 3LP0B 1VFJA 3SYZA 2XHCA 4UUXA 4Y2AA 2AHOB 5DJBA 1YBAA 1XMBA 2BX6A 2M8DB 2RSQA 4OYXA 2J9DA 1RLCL 4YQWA 3EZOA 4Z2XA 1UZHA 5KFIA 3QT7A 2WAQD 1SQEA 2O5DA 4PYAA 2FD2A 3LPYA 4NZ7A 1KQSR 3A1YG 2HHXA 4PG8A 1Y00A 3IBWA 1BQMB 2LU2A 3CE8A 4FYYB 4OX9F 3QFHA 4Z37A 3THVA 4ZS6A 2M70A 3TJ9A 5A6WA 3J81j 2KXFA 1TKTB 2RRAA 2YQ1A 2B8PA 3AY0A 2HKEA 3QRQA 3MCNA 4P75A 4IFYB 1RABB 4F0KA 4QPTA 1UEUA 3W2VA 2IFXA 3PYDA 2LQ8A 4I7FB 1SQFA 2KZZA 1SJRA 3ITHA 2CG8A 5T7LB 4U96A 2MYFA 3ONQA 3MM6B 1X5SA 4EK2A 4HHUA 3H5YA 5IOLA 2RT3A 2BJ9A 3GIMA 3OTDA 4NA3A 3HM9A 2OPSB 4LVOP 3JYTB 2EC0A 3SFUA 1F0XA 3UR3C 3M30A 3W8PA 1FNOA 1F3FA 1KLNA 5LSLA 1NH7A 4IO9Q 1YBTA 1QSLA 2FHMA 2RVJA 1JLGB 3RB4A 3UDLA 2RH3A 3MMCB 5J2NA 1IN0A 3JSMB 1TAUA 1C1CA 2EFQA 4Y00A 3T1AA 1JIHA 2QL9B 1ZOTA 4QU6A 2FJWA 4UTGA 3O6QA 3TJ8A 2M3DA 1RA7A 2ZC3A 4K8RA 4QZVB 4PG7A 3BSOA 3HDSA 1P1TA 3HT0A 4IOBA 2BJEA 2XB2D 4C11A 1F1BB 1WTBA 2J9EA 3MEEB 1MWZA 3LP0A 3PYFA 2KG0A 2HS3A 1TFYA 1TELA 3A8IA 4WU3A 1T9WA 3CDAA 3AHPA 3BH7B 2CQGA 3LGMA 4URSA 3FKBA 1Y7PA 2V9KA 2ZNYA 2DVIA 1A7GE 1F60B 4JI3J 4MIWA 4W4MA 4Q8EA 1BQMA 3RBDA 3SSQA 5H9FK 2W8LA 3CJKB 1KS2A 2AEMA 2RDIA 2W2NP 3I5CA 5HANA 1RHUB 5KFJA 1TKTA 3L3CA 1TU0B 2KYZA 3H5UA 3HPOA 2JOQA 1S1WB 3R9LA 4IFYA 1BWVA 1KDNA 1O5JA 3EJMA 2ZJPQ 4UY85 3FSYA 2C3OA 4I7FA 1NJYA 3QGIA 4XDDA 5T7LA 2VV5A 3GFYA 3ZZPA 4EI2A 3MUTP 3I56S 4B3SF 4Y6IA 2LECA 2ZBCA 3MM6A 2Y0BB 3OFGA 4PWWA 1UJ4A 2FDNA 4JI6F 3NGRA 3RAXA 1D0EA 3FFIB 2NPIA 2V68A 2R7SA 1U24A 2ERRA 4FYXB 2OPSA 3D0IE 3JYTA 3UDCA 2ZWOA 2HEKA 4RBVA 3D0GE 5DO2A 2OAUA 5L8RC 1HBNB 1RTHB 2IC3B 2LXIA 5DLFA 1TKZB 3DU5A 1GX5A 4OX9J 1JLGA 5M2RA 3MMCA 4CNZA 2VZ9A 4JI0F 5HL7Q 3UDEA 1T3OA 3JSMA 3PNIA 4F3OA 3MR7A 1C4AA 2JZ5A 3WBZA 4GVBB 2YVSA 4DPXA 1NSPA 1ZS6A 1QVFR 5DG9A 4CI0B 3V6KA 3LH2S 4QU7A 3MEEA 3JAMU 1HBOB 3R97A 1TVRB 4TNOA 2MY8A 3THPA 1YK9A 5A2QU 2YWWA 1F3VA 4U7UK 1RBOB 2HBQB 1KOOA 4NMLA 4OX7A 1G7CB 3HLUA 3VR1A 2VFTA 2B7BB 4R8UB 3CJKA 3GMGA 1VQNS 4QIWD 3GCWP 1VOMA 4FKYA 5C7PA 1RSCA 2NQPA 3KLEB 4FF1A 3OL8A 1M90T 2E66A 2DCUB 3CCMS 3OUYB 5E33A 1DTQB 3M6XA 1S1WA 2LMIA 3SDEB 3M32B 2QMXA 4TLQA 1ZAWA 2IYGA 1VQ9S 2ZH4A 1SH0A 2DR7A 3PIOQ 2YX7A 2M5YA 3CEDA 3AQPA 3RG6A 2JC1A 3M8QB 2W2OP 3E01B 3M9NB 3OVSA 4KHPF 2CADA 3R3TA 3H0PA 3N79A 3BO3A 5JUMA 1A0OB 1LFWA 2LEPA 3THTA 4ZP9A 1NK8A 2YNHB 2ZZNA 3DI6B 3KLVA 4FPRA 1YKWA 2RAQA 5A6PA 4X4NA 2HLUA 1HBNA 1RTHA 2B4VA 3PVXA 2IC3A 3KG4A 4OYZA 1TKZA 2VA2A 4CO1A 1ZZFA 3V6DB 4XAKA 2QMWA 3SCLE 2GV1A 1HI0P 5ETPA 1FD8A 2MZRA 2R7UA 1Q7LB 5D8HB 1U2FA 1YHQS 3E3XA 3MZIA 2U2FA 4GVBA 3MWBA 3GWCA 3H2VE 1NHKL 1PYOB 1S1TB 6AT1B 4M95A 4ZVOB 1IKVA 1T0TV 3IR7B 2PO4A 4UUWA 1TL7A 4KGXB 2DPIA 3TZYA 4B3SJ 5KFEA 2LQ5A 3NP5A 4C8ZA 4USUA 1VQSA 2CQ3A 4J9OA 1HBOA 2MMYA 1HI1A 4JI6J 1TVRA 4LF9F 3PZPA 2JH3A 4Y34A 2CQPA 2UVWA 4J9KA 5DDRC 2B5JA 4ENOA 1EQ0A 4F0HA 1RHMB 1FRLA 3AJ2A 2HNYB 3SXLA 3NG8A 4YS2A 2GFFA 1Z2ZA 3KG0A 8RUCA 2DH8A 1FEHA 2NXUA 4BS2A 3B78A 4O3QA 1AA1B 4LF1A 2OPPB 2ACMA 1BC6A 4F4AA 4JI0J 3A8JA 5EDWA 1SQGA 2ZVIA 1LWFA 3KLEA 3ILIA 4K7QA 1J5OB 1RAAB 2DEIA 4YR2A 2UXBJ 4QR0A 3OUYA 3H90A 4PG4A 1DTQA 4ES2A 3SDEA 4Y28C 3M32A 3P6YC 3DLEB 4ZDNA 3T9NA 2RJZA 3Q8SB 1H74A 3K57A 4P73A 4LVNP 1RAIB 4EBDA 2V69A 3CCUS 3M8QA 3MMBB 1U49A 4DWIA 3CO9A 3D1OA 4O23A 2MQNA 4RWXA 2AQ4A 2ABYA 3HF5A 3N4WA 2XYHB 1S6OA 5E3QA 1TAQA 2E1MC 1WOOA 3TX0A 3DI6A 4DU7A 4OV1A 2XSJB 1VQOS 3TW0A 1DRZA 3TUZC 1P8GA 1YTYA 3I4PA 1CJVB 3BN7A 3V6DA 4WFXA 2CJQA 3ISZA 2RS2A 2OGUA 2RRNA 2VB6A 5DGBA 2LKZA 4ED6A 5HAOA 3MAHA 4FF2A 4O3OA 3TZXA 1TMMA 1DY3A 1HNXF 5I3PA 1HNIB 2H5EA 3G86A 5EGYA 3GZ7A 2JEFA 4MYUA 1S1TA 3GYGA 4ZHRB 2LYVA 1H38A 4TXSA 4B17A 1S6UA 4ED7A 3W64A 1TKXB 1HWUA 1CJTB 4PRFA 3JXOA 1K1SA 2HRTA 5EX0A 3GV8B 4KHPJ 2HG4A 5THWA 2CVIA 2ATCB 2DGXA 2O67A 2XMKA 5A76A 4TY8B 2DHHA 4DSFA 4ZVEA 1U1NA 2W2PP 2WRMA 1FXLA 3CIZA 1NEEA 4JV2A 3D6MB 1JXLA 3RTVA 2HNYA 5KT2A 5L1LA 1RWKB 2J6TA 1KTQA 1W25A 3GR1A 4DV2F 1T02A 3NMAA 2OPPA 2AGPA 5HROB 3MFIA 5D3GB 1FRHA 3ZZRA 2RQ4A 2QL5B 4XPCA 4W98A 1VC0A 3TAPA 2NXEA 4A8FA 1FD2A 2KO1A 4QR2A 1J5OA 3QT6A 2CDRB 2ZH7A 1GMVA 2KT3A 5CYQA 2F4VF 1C0TA 4I0WA 3DLEA 1G6BA 2OPRB 2LEAA 4J9UE 1B70B 1ROFA 3MMBA 4HI2A 3VF0B 3VVUA 1LV5A 1D9FA 4LF9J 2O01C 4TU9A 4Q44A 2BJ1A 4ZP8A 5GMEA 2AKWB 4M1KA 1XERA 2C3MA 3JTNA 2CNLB 5DETA 3HULA 2LP4A 3OL9A 2ZNZA 5HMXA 3E8OA 4I69A 1QY7A 2XSJA 5IT0A 2J7KA 1LK5A 5HBMB 1EX8A 1CJVA 2I38A 5JVGQ 1OPZA 1GMUA 1RT2B 1JJ2R 4FPIA 1VHFA 1H98A 3EUNA 2LFVA 2NSBA 4EMDA 4IR1A 2PI5A 4AYBD 1NB7A 1HNIA 2XMAA 1U0SA 2PEBA 3I6PA 3OTBA 2IHR1 1MN9A 4ZHRA 1CSJA 5BR8J 3M2RB 3U02A 1TKXA 2DISA 2IM0A 1GK8A 1PKUA 2IVFB 5ETSA 1IR2A 1PJ5A 3SSSA 4MJKA 3CCJS 5F0WA 1RAGB 3I5AA 3FEXB 4DPUA 3OT9A 1V5VA 2GJIA 1JWWA 3GFZA 1VDHA 2CRLA 1M0SA 2MGZB 1O8BA 4Q0BB 3C3LA 2BVZA 2NXCA 1KWMA 3PV8A 4P9SA 1UVKA 3TRGA 1NKCA 2R8JA 2MKJA 3DRSB 1KHVA 4IO1A 3FQLA 3KYLA 5LSOA 3FSXA 4OYAA 3OXFA 2R2UA 1S1UB 2HVEA 5D3GA 3OTCA 3K5NA 1N5VA 1VHIA 4RU2A 5DQIA 2NYHA 1VCTA 3LP1B 3ZO7A 4ECYA 1HNXJ 1PGZA 1FJEB 3PM9A 4K4ZA 1SJ4P 4CQ1A 1I5OB 1S0MA 2ZH1A 2OPRA 1R6VA 1WC5A 3JQKA 2RMLA 3A3PB 4O0IA 4ZIVA 1ZM9A 3CCVS 1PILA 2EFOA 2MB0B 4KR0B 4HR2A 2KVQE 3PIPQ 4OYIA 3QMQA 4CLKA 2GJ2A 3RYLA 3ET6B 4X4VA 4B9TA 3NXZA 5HBMA 4DV2J 4DSJA 4C6AA 2JSXA 4ZJLA 2G1HA 1N88A 3PJWA 1RT2A 4E98A 2MEWA 1WHYA 1CEZA 4EO6A 2KDOA 3BSCA 2B7CB 3BO2A 2JRSA 2F3JA 2H51B 2DNOA 2CPIA 4QWCA 1AZSB 1JLAB 2RHSB 1KOHA 3MOJB 4YY3F 3RBEA 1RAJA 5KG0A 1IM4A 1NBEB 1WHWA 1JMTA 2OTJS 2ZBRA 2VC1A 1BQNB 2CA9A 3M2RA 4LR8A 1NK9A 1L5UA 5H9EJ 1HYSB 2D1CA 4NLDA 4I2QB 4ZCKA 3TVZA 3Q0AA 2CAJA 2HFVA 3PKMA 1KLMB 2A6OA 4OI2A 2MGZA 1OY6A 4Q0BA 2VDIA 1V6HA 2XMUA 3UN2A 3DRSA 2FJDB 4RNMA 2WW8A 3LP2A 1XR7A 3PYEA 1K73T 4M5DB 1X7VA 4M5KA 4IFVB 2HSEB 2N82B 4ECUA 3NGKA 2YNIB 4USHA 4RW8B 4CZCA 3QIPB 3DGVA 3OD2A 2VKRA 4DZDA 2H4YB 2E9TA 4CLZA 4KIAA 3HMJG 3LP1A 5KFKA 4DFPA 5L1IA 3VALA 2FGOA 5I3QA 3RW7A 3AQOA 2BR0A 1PIEA 1Y11A 2DXFA 1L3VA 2CJAA 3NNCA 4HHHA 5L9NA 3TOQA 4NEYA 4IH7A 3W61A 4OHXA 5C24B 2XCAA 1ZPVA 2H5IB 1DQ8A 4I56A 3IWNC 2J76E 3ET6A 2WONB 1GX6A 3CJ2A 2AGQA 5A8KB 1OYDA 1ICEB 2JJ4D 4V19J 1BMQB 4BLGA 4C3MA 3BSNA 1Q86T 2HVDA 3G9CA 3PW4A 4EWTA 2LU1A 1NK4A 4JV0A 4I68A 3DHXA 1AZSA 4LFAF 1JLAA 2GO9A 4TQRA 4FKXA 3V5RA 4EGLA 2RRBA 1VIXA 1OO0B 3BREA 4EO8A 3FUYA 4ILLA 3AD8C 4U8YA 1BQNA 1EB0A 1SJ1A 5C42B 4UQGA 1D8ZA 1HYSA 3QO9B 4ZCIA 1N52B 1SPBP 4I2QA 2PIIA 3K17A 3T5KA 4JI1F 2WVDA 4WKYA 4KBIA 4K0KF 4HH0A 3AB2B 4DV3F 1KLMA 2HHPA 2DTJA 5IQ6A 2FZKB 1MROB 3CTRA 3O8WA 2OTLS 4MFBB 4OYPA 1VBYA 2AF6A 2W8KA 2DNMA 2WVCA 1F9EB 5K8PA 4G6VB 3PFEA 4ZPAA 3HK2A 4QCLA 1U2CA 2KHDA 4M5HA 4DR4J 2VIHA 3D66A 2R7TA 4IFVA 4KPCA 4USVA 2W9AA 5HJYA 2YNIA 2BKPA 4RW8A 1X4FA 3QIPA 2R7VA 2OELA 2CWXA 2G2OA 2DY1A 2GS8A 4Z7YA 1T11A 2YX4A 3AA9A 3D28A 1KHWA 2C2OB 1RQ0A 3HVAA 3KJQB 2BQ3A 4WPAA 4K2JA 2LXUA 3LAKA 3ETOA 2BE9B 4K4VA 1M5VC 3DFEA 2VF3A 5FIIA 2XLKA 4IQXA 4J9NA 5G0RB 2FJVA 2DITA 3FBFA 1UFLA 4DR1F 1V9OA 4ZOSA 1MNEA 2XNQA 2YKPA 2AYMA 2KKHA 2WONA 1WKJA 2LQ9A 4U6PA 1NDCA 1VRTB 3DRPB 4ED8A 2PFFB 5H9EK 3RBZA 4WFNQ 5A8KA 5EHHA 4EU0A 3H2LA 1H72C 4NLUA 1RJJA 4QWAA 2HGMA 3KUGA 4OHYA 3ENQA 2AMCB 2BJDA 1RWNB 3AAWB 5M2PA 3JSRA 1DLOA 5CZVA 5F8NA 4G1QA 4F7VA 2FIUA 2KFNA 5C42A 3CGIA 3QO9A 5F0UA 4OI6A 2CNKB 2QSFA 4AE5A 4B3OB 1RHRB 4TYAA 4DZ6A 1BLUA 1OMSA 1NHVA 3HO1A 3HCXA 4MFBA 4ZK7M 3Q8RB 2XWYA 1EIYB 4GO7X 1IWGA 2QX0A 4F4XA 3NEKA 1V3SA 4O0NA 1SC1B 2NSCA 2J0XA 3G2XA 3RR8A 2ZEJA 2M52A 2VQFF 1SJ3P 2VPZB 4LFAJ 3OVBA 4UOCA 2E44A 4ALZA 5KFZA 2E29A 2XY6A 3MR3A 1IBCB 1H2VZ 3C14B 4I1TA 1TL3B 2AV5A 3V6JA 4NYZA 1XMOF 5GAEU 1G3OA 4ATNA 5B0FA 1ZH5A 1NKBA 2YKOA 4DXLA 3EVWA 4MIBA 4K0KJ 5G0RA 1YSJA 4DV3J 1KEKA 2V4JB 4IG0B 3HP6A 2XMMA 3CCWA 3CD0A 2AIRB 1VJQA 5D77A 2PMZD 7FDRA 2UV8G 1N33F 3PW5A 2Y1RI 1G1XA 1VK3A 2OP5A 1VRTA 3DRPA 3QNWB 2ZH3A 4USKA 5F8IA 1EP4B 3KK1A 4PG6A 4HTJA 2IDEA 3NCPA 4RW4B 2K06A 1DZ5A 4IKAA 4C8NA 2ZZMA 4J9PA 1NK6A 2YNGB 3TQEA 1RYSA 1Q53A 4QPXA 2H4WB 2W9BB 1KC8T 4EFAC 4RNFA 1NPPA 3A12A 5L9XA 2HVZA 2N4CA 2XWXA 3SEOA 5CYMB 1QAYA 4PAAA 4F4KA 2EC2A 2HRYA 2O66A 4KFBB 3CJ8A 2K2PA 1IVZA 1NLKL 5AXMA 4B9NA 4GMKA 4B3OA 2Y8YA 3QRRA 4DR1J 4B3TF 2Q79A 4FF4A 2E7VA 3HZEA 4QR1A 1Q82T 3D7SB 4C3LA 2MKIA 4H4OB 4CNYA 1GQEA 3CJ4A 3FEZA 2L48A 4NX9A 3K5MA 5GMKa 4ZVPB 3D2WA 3TUPA 2HHWA 3K7RA 2XLJA 5A0YA 3W65A 5IFMA 1LWEB 2V67A 1WC3A 2Y1JA 3ZTOA 3UN5A 3H98A 3R6LB 2XI2A 2VC0A 5DG7A 2OD6A 3T9ZA 4QIFA 1S9FA 3GYXB 3C14A 2Z0GA 2J7UA 5I42B 5KG6A 1TL3A 4B3MF 4L75A 1XJWB 1RTDB 1YJWS 4ZPDA 4ZITA 1NSQA 3TA2A 1NM2A 1QJHA 5E2QA 3DLHA 1N6QB 2FVRA 1RI7A 1PYTA 3C15B 1HI8A 2DO0A 2V4JA 4DOZA 5EN1A 4NXMJ 4IG0A 3MCMA 4F2SA 3CCQS 5KG2A 2BKOA 3MEDB 3M2UB 2C2NA 1RGVA 3RUBL 2J6UA 4YDXA 3UNGC 1FRKA 5BYRA 4C8MA 4NXNF 3VAIA 3FVYA 2ZUGA 1EP4A 1JLBB 4CLPA 1S12A 2C2DA 3RBXA 2VQFJ 3IBCB 5KT4A 2AZ1A 4RW4A 1CQMA 3D5MA 4M5LA 2IIHA 2YNGA 2W9BA 2VOPA 1X5TA 1XMOJ 5KFCA 2R7QA 3FCVA 5CYMA 1TKDA 3LTOA 4KFBA 4DR6J 4KPYA 1N32F 3R5GA 3L9ZA 1BWEA 5HATA 3WHIA 2EG2A 4KY3A 2OO4A 4DUZJ 2JWNA 3D1HA 3CC7S 2IVMA 1CC7A 1B0VA 3VAGA 3K5LA 3CC4S 3VAMA 3AB4B 2VFSA 3L7OA 4DG1B 1N33J 2JEIA 4DN0A 2CPDA 3CO0P 4CLUA 1S4EA 3G71S 1WJ9A 3J80Y 1E6VB 1FT8A 2OSRA 1BD6A 1KFDA 2HWTA 3QYYA 1CC8A 1LWEA 1VQ7S 2AEFA 4WXWA 3ZZTA 2MZ1A 2QLJB 3HD2A 4DSKA 2FLNA 3C46A 2G0IA 3DLLQ 3L09A 1RB0A 1FI4A 3LOUA 1WG5A 1RWUA 3DN9A 3UCUP 2KYXA 3IMQJ 2NUHA 5T41A 4C0OC 3N0VA 4C8YA 2BRKA 4UOGA 4ERDA 2JVRA 2HZAA 1RTDA 1GAOA 2QO3A 1B7FA 2ZH8A 1EAYC 3TZZA 5CA5A 1PAEX 4ZMMA 3R5BA 1AB8A 1N6QA 3MPYA 3QZ8A 3C15A 2AX1A 3CJTA 4B3TJ 2OKQA 4LF4F 4AL7A 5K5MA 1WORA 1CLFA 4OZ0A 3ZZYA 3MEDA 3M2UA 2CQHA 2WHOA 3MCSA 2V5HG 3FZ2A 3IA0A 4ECQA 3KUEA 1C2PA 4ITSA 4E2FB 1LWCB 5U47A 2KM8C 1S6QB 2K8GA 1VQ8S 1JLBA 4LMZA 4PXCA 1FFWB 1KR4A 3KMSA 3FBBA 3P5TL 3HD1A 4ED2A 3CSKA 4HTIA 3U1LA 3CULA 4D3HA 5J2QB 2ZVSA 4H54A 2B0GA 4B3MJ 5KFGA 2QJ3A 2R42A 2XNRA 1WF2A 4BC7A 4Q2MA 3NGSA 2R7WA 1NJWA 2GJFA 2M88A 1WC0A 3FRYA 5ETOA 1QUPA 4ZVUB 1LXNA 3ENVA 3PG9A 2ZM6F 2MLYA 1AYEA 1S0OA 3Q2TC 2BOAA 4NRUA 3EWGA 4OX8A 1QD1A 4OHWA 1U1RA 4DG1A 1WF0A 1N4LA 4M8LA 1ZPWX 3JB9k 2CJBA 2RQKA 2B4UA 2KRBA 3KLIB 2OFHX 4AXJA 4NXNJ 1SVDA 1E6VA 4LF2A 1FDNA 3OBIA 3IM8A 4X84A 2MSSA 4NLRA 1J27A 2GA7A 5HVFA 2OEJA 3ZNUA 3M8PB 2FHJD 3EPIA 1RADB 7FD1A 2QYCA 2MZSA 3SMZA 4ES3A 3C16B 4DL3A 2KM8B 1Z1ZA 2NXNA 1FTCA 4JP8A 2BJ8A 1YJTA 1FDAA 2MLZA 4JBCA 3T1HF 1N32J 2KG1A 2K3KA 1YWXA 2PMWA 3UR0A 3SCKE 3P4UB 5KFOA 2LA6A 3GG1A 2G4BA 1R8CA 1HFEL 1U7LA 3W5ZA 3W9JA 3R1HA 3OJSA 2ILZA 1LWCA 2E5GA 4KGMA 2Q3PA 1S6QA 3G8SA 2XMVA 2EVZA 3EMTA 1Q5VA 1WKLA 4ANCA 3KJVB 2CWKA 3QJLA 4ID5B 2DNKA 5DLGA 1UETA 1IBMF 4UF4A 1WD6A 3DGPB 3V81B 2HURA 1FE0A 3S8SA 4WP8A 4DPWA 4WTOB 2W2MP 4YB6A 2GMJA 3MR2A 1JLQB 3I96A 4ZCMA 1JQGA 4NLGA 5IT9U 4J9MA 2M8HA 4LF4J 3NCQA 2CXEA 2ZHBA 3MCOA 2NPFA 2MZQA 4X4PA 4TY9A 3WX8A 2R9LA 2F7VA 3VGSA 1DBDA 4ED3A 4HLBA 4FS1A 1HW8A 1NDPA 1GTEA 1Q8KA 4ED1A 4FDFA 3CWJA 2KTQA 1U0HB 4ETZA 1FRXA 4ZVQB 2EW9A 3MR5A 3M8PA 3PFOA 4O3PA 3F0NA 1FWPA 5E41A 3OHBA 3UI3A 1U8WA 3C16A 4FZVA 1DTTB 3MM7B 2DGQA 4A47A 3T5JA 2UVUA 4ILRA 3GYNA 3KTQA 3IWLA 4DLEA 4L3KA 4MKVA 2ZM6J 2N3LA 2F63A 3IXQA 1VBKA 2YWGA 4M5JA 1HWLA 1BXNA 2MZTA 4DL7A 1SL1A 4YEAA 3RGIA 1EARA 2KN4A 3BKFA 3M9OB 3GONA 1SCJB 3J7A1 1Y5NB 2HWHA 4AL5A 2GAGC 4IH5A 1I3OB 5SZTA 3AOCA 3BSAA 3FCHA 2DB1A 1JK9B 2EBGA 1FJCA 2E1RA 4DL5A 1M5HA 1VQ5S 2U1AA 1HHTP 3CMAS 3BGOP 1N5SA 1L3TA 3EE3A 1VQLS 3L7UA 1T95A 3KJVA 3TANA 4FP9A 3CMES 2VBYA 4ID5A 2MKYA 5JVHQ 1UW4A 2NZCA 1TMJA 5LMUF 3TNVA 2XTJP 5IV4A 3DGPA 2JHEA 3IS9A 3J81Y 3V81A 3K0JA 1LW2B 2GQ2A 3T1HJ 2I0XA 2B8QA 1JLQA 2VOOA 2IAJA 1NPKA 3CCES 1N48A 3D67A 2D9PA 3NS5A 5FLXU 2DY9A 2B9YA 5LXYA 1RT4B 3BV8A 1RZMA 2EWHA 4DBQA 4RW9B 2ACYA 3BYPA 3CMQA 5LL6d 4KKOB 3JTPA 1Q0NA 3KHHA 2HQFA 2OMLA 2PDAA 4B02A 3A8KA 1U0HA 2IJFA 4OI3A 3W5XA 2W4PA 2CZVC 2XO7A 4LBPA 2JFDA 2WSCC 4CYUB 1H73A 1YDLA 4Y2KA 3M8YA 1RAFB 4MK7A 1KNZA 5KFVA 2J5AA 1DTTA 3MM7A 1IBMJ 3PCOB 2DNYA 3UE2A 5B7WA 3AH6A 1QAXA 4J91A 2JLEA 1SXLA 1NSKL 3RB3A 2GIRA 2N7YA 4CIOA 4PQUB 2BQUA 2CVEA 5GADI 2ALZA 1BGXT 3B6BA 3GFHA 3HX9A 2XBPA 1JJ4A 1X4EA 4LQ3A 3GILA 1T3NA 2Z8QA 3P49B 2DXDA 2FHOB 1RE1B 3FZBA 1CG2A 4P2MA 2EPIA 1WDTA 1L3UA 4G1IA 5KOWA 2CNOB 3VAFA 5EX3A 3C19A 1HWJA 5ETMA 2DR8A 3OSNA 5BYSA 1NO8A 1YQHA 4RW6B 2KJWA 2R7XA 3MAAB 4DFKA 5E5NA 2QMUB 3DKDA 3G4SS 4RNNA 1HL6A 1EKRA 2FLPA 2HGLA 1AW0A 3ZZOA 1HNVB 3AOBA 4ECVA 5C2GA 3ICLA 5KG7A 4LJMA 4M5IA 2V34A 1LW2A 3CJQA 3H59A 2QGFB 4GKJF 2DIUA 4QIVA 1L3KA 2QFJA 3NY0A 3GP9A 1S99A 2DEJA 2DNPA 3CW2C 2AD9A 5I4MA 2LDYA 1RLDA 3KHLA 1D1UA 4NL5A 4F2RA 4WXOA 2W7AA 3IO1A 1FO1A 1APSA 1T05B 4DX8H 1RT4A 4C98A 2DD8S 5F8GA 4GVLA 2GW8A 1TFWA 4RW9A 2YY3A 1GXLA 4KKOA 2PD1A 2R4FA 3GB0A 3OR1B 1P9QC 2DGVA 4ICLB 2O3DA 2HHSA 3BO4A 1UFWA 1UVLA 1R89A 3QGHA 5M2UA 4CRJA 5HK4A 4CYUA 4RLEA 2MQLA 3KLGB 3HJVA 4ZN3A 3R2CJ 4C3KA 3OFFA 3AFGA 3GIRA 5LMUJ 4DSIA 3RW6A 4OHZA 4P2XA 4YB1P 4DSEA 2JL9A 4WIIA 3OQ2A 3T5LA 3S1TA 4HI1A 1MW7A 4H4MB 5F9LA 1MN7A 3GSIA 1R43A 2C2RA 3IC1A 3MM9B 4TU7A 4PQUA 5HMYA 4F8RA 3G6VA 3NMRA 3EXCX 1TL4A 3KHRA 3VV2B 5KFAA 3MD3A 3FMWA 2BV3A 1U6BA 2QN6B 4JV5F 4GKKF 2MQ8A 2NUUG 3AT1B 4IRKA 1B0TA 1YJ7A 4CH1A 3HVRA 3GG0A 2BYCA 1NXIA 2EBEA 2XGPA 5KFWA 1MLAA 2UUWA 3D9BA 5HP1B 4OMFG 3Q8QB 5CXTA 3BQ1A 4U95A 4RW6A 3MAAA 2VBWA 4ZKAA 1O0PA 5HVGA 2ASDA 4DL6A 2RF2B 2X3GA 4WFBQ 4CLWA 2YQ3A 4ES1A 2WW4A 1HNVA 2FC9A 1RTIB 1VK8A 1IKXB 3CCRS 1U6ZA 2EKYA 3DLBA 4Y0FA 4IRCA 2CYYA 3AD9C 2QE5A 2RILA 2NXJA 4DMZA 4KO0B 5KT5A 4PQAA 2OSQA 3NRBA 4CO3A 5KT6A 1VQYA 2JNJA 4WWSA 4KSEB 1P9YA 1HWIA 4HT7A 3J7ZT 4OYOA 1M5OC 3DMJB 2XI3A 1VBZA 3W9IA 3OR1A 2Z2LA 4ICLA 3QLHB 3K2YA 1FFGB 4ZLJA 2BRLA 4PUOB 3PR4A 1HARA 1RU1A 2HAFA 2ALYB 1N5TA 3IG1A 3KLGA 3OPKA 3Q23A 4LBIA 1LKZA 3QGPA 4K4YA 1XIQA 3SI8A 2XEXA 2HAIA 2CG4A 4NLVA 1J5EF 4H4MA 3DOLB 4GKJJ 4I6WA 2KU7A 1B7YB 2CJXB 1RACB 3MM9A 3LPEA 3CJ5A 4DL4A 1NMEB 4CLLA 3I55S 4ELTA 3MM8B 1Q79A 2VBXA 2VKZG 2HZCA 5D0HA 2VQEJ 2PFDA 1PJ7A 4JI4J 4MKAA 3OVAA 1VIOA 2GHWA 3OXLA 1VISA 3MFHA 3CUNA 4A48A 4Y2CA 2JLGA 2DNQA 3PHTA 2ASYA 5K8MA 4N47A 2CQIA 5HP1A 1VQ4S 3AD7C 1F5BA 3R5AA 3G8TA 2DR5A 1GFWB 5L46A 4W92B 2RF2A 4LRCA 4L6V3 4HKQA 1NPRA 1N36J 2IPOB 4RU9A 2R8KA 1D9DA 4P71A 1RTIA 2KL8A 5ETQA 3BKUA 2A0FB 1O6XA 3DC2A 1YRUA 3CD5A 1IKXA 2AWZA 1Q16B 1NSAA 5B0EA 1ZM3A 3KNGA 4BCAA 3KKFA 2DGTA 4KC5A 1VS3A 4LFCF 2ZITA 1JLCB 3CDUA 5KG5A 4R25A 2OJ3A 4KO0A 2E7WA 4JV5J 5KOXA 4GKKJ 3MPVA 1N0VC 3CT9A 5IS2A 5GADU 3PTWA 1NJIT 4PXDA 4OI1A 3V4MA 4I6YA 2ZBQA 2ZC4A 3QLHA 1HNZF 4MAKA 2PE8A 4PUOA 1RT6B 2CQ2A 5IQQA 3ZFVA 3IAM9 1FCAA 3AXMA 4QOTA 3MPWA 2GIQA 4AUKA 4FNIA 1VLOA 5K14B 1RBAA 3RB0A 1U26A 4N76A 4ANDA 4LR9A 4DF4A 2K7JA 1JNRB 3ZTPA 2PMHA 2DXEA 1FJGF 3GJRB 4DS5A 3KOAA 1RYRA 2OMOA 5L1JA 4RZRA 2BW7A 1YVFA 2NCKL 2DNZA 1SBRA 1X0PA 3O5TB 4OYWA 4PKDB 2OPQB 3MM8A 3MMAB 2IA6A 2HIQA 3POTB 2LA4A 1JKHB 2R2TA 2E1CA 4X65F 2PA3A 4V1Ak 3G82B 3T5HA 3KNAA 2Q1LA 3PW2A 3QFWA 4DLGA 5K8OA 4CO0A 2IRXA 5G4DA 1RU2A 5BXIA 3ZTRA 1S0VA 1J2VA 4PPZA 3KJNB 2JC0A 3LUYA 3A3NB 1WC4A 2MJUA 2V8HA 2RDDA 2VFUA 3NBPB 4MH8A 4N8OA 1UAWA 1MWQA 3DDNA 4DDFA 5D4OA 5L1KA 5IV3A 2D3OR 1LEOA 4K4SA 4J5OA 2HNDB 4OJGA 3FCWA 1WF1A 3EGWB 2AGOA 3D6TB 1S97A 1NKEA 3FFIA 3CJ3A 3PYGA 3V4IB 1UKUA 2FYXA 4Q5VA 4TKTA 2D74B 1FNMA 2FC8A 2YKMB 2L9DA 4O44B 5MLCV 3DRXA 1IR0A 1WG1A 3W63A 1FXRA 5KFBA 1JLCA 4P2SA 4MK9A 4A8OA 3GFXA 3B4MA 2MKHA 5B0AA 3AJ1A 3FC9A 2H65B 1RISA 1QAJA 1S9GB 2QC3A 2WBMA 3M05A 1Y3JA 1KD1T 4X4RA 4ZJOA 2L9NA 2Y9HA 3A8EA 3SCIE 2CFXA 4CO4A 5FJ4A 4F4WA 2YQ0A 2PEHA 2HHQA 3MPDA 1D3WA 1U1LA 4NYPA 1KVKA 2WB4A 1GXTA 3VQTA 2ASJA 2C3UA 3Q86A 5K14A 4YP3A 4DV7F 1U48A 3BJYA 4NLTA 3F73A 4Y65A 3WIUA 3IAS9 3D6FB 4X4UA 2Y1IA 2ZFHA 2RQCA 3NOCA 4NA2A 5J1PA 1UVJA 4A8MP 2Z4PA 4NLWA 5AE1A 4YR0A 4DF8A 4NPOA 4LFCJ 3PW7A 3MF5A 3N6MA 4WU2A 2OPQA 4X4QA 3BKTA 3MMAA 2MKCA 4L72B 3H5SA 3TR5A 3EXYA 2XM3A 4R8UA 3POTA 1OQ3A 3RZAA 1JKHA 2GVDB 5IZHA 1HD1A 3G82A 2X7IA 3NNHA 2VL1A 4EBCA 2LQBA 4BWMA 5JMNA 3DLKB 1NDLA 1WI8A 2GO8A 4DQSA 1PG5B 4NZ0A 1HNZJ 1X4HA 5LM7E 5KTQA 3FMBA 3FGVA 2R8GA 2FLLA 3NBPA 4CT9A 1ZETA 5F8LA 4JI7F 3HT3A 1FF2A 3OW2R 1X5OA 1UJ6A 1AT1B 3E01A 2HNDA 2RS8A 2L9WA 4QJVA 5DDOC 4KTQA 2QLWA 1CJKB 1VJWA 2NLWA 1FJGJ 2BE2B 3V4IA 1QLNA 1C0UB 1YBUA 4K5RA 4LREA 2YNHA 1UJ5A 2IBOA 3TEGA 2YKMA 2VJVA 1U2RA 1QTNB 4YB5A 4PZVA 4DPOA 1RHQB 3PO4A 2CQ4A 2DT9A 3CD7A 3DRRB 1E6YB 2YWFA 3NLCA 4ECTA 2NYIA 2WTFA 3QSIA 1YI2S 1X8DA 2G2YA 5KFXA 4C4WA 3EVOA 2GNKA 2JLFA 4X65J 4ER8A 1WNEA 4ILMA 3PR5B 1S9GA 1OIAA 3R7NB 2VPYB 3Q8UA 3KMQA 2RU3A 2V4RA 1U1OA 2MJNA 2XC9A 4OV6A 2AJ0A 3GV7B 1B64A 1W7WA 2XS7A 1RWMB 4Q45A 3PEJA 1RAOA 1Y0HA 2AYEA 3ZZZA 3ZC4A 4WTYA 3NGDA 4OLOA 1Q8LA 3DM2B 1OSCA 2IM3A 4DU8A 2W7OA 5D78A 1VR6A 1SJFA 2W4DA 4BC9A 1AUDA 2IJNA 1K0TA 4K4XA 1I6JA 2HRUA 2APOA 2UUAF 2QTWA 1H7WA 2MQMA 3IWXA 2K3IA 2DHGA 4IR9A 3V6HA 4E8UA 1TZ0A 2VFRA 2R7RA 2ADBA 5A8RB 2C2ZB 2HZVA 2BABA 2GVDA 1NRKA 1T9YA 5HJXA 1RWOB 3H42A 2GGPB 4LIRA 3DXBA 3DLKA 1N5YB 2QA4G 3FDSA 1RWXB 2KXNB 2VJUA 2EG1A 4P52A 5D4NA 1OYEA 4RUHA 1YZ7A 1RUSA 2Z58B 5BJRA 2IBKA 1U1QA 3MTKA 5D0EA 1QM9A 4YFUA 3PJ9A 2FPHX 4DV7J 1JJCB 2HS4A 1LNQA 2Q6BA 1V3RA 3QWUA 2EFVA 5DDPC 3H20A 2BE2A 4QIGA 1C0UA 2QV6A 5HQMA 4Y2IA 4MKYA 1OS5A 1RKJA 2BM0A 3GV5B 4LUBA 5GVQA 4JI2F 5AE2A 3UVJB 3JQMA 4KGKA 2RNEA 3IRXB 3DRRA 1E6YA 1XK8A 4IRDA 3D6HB 3UCZP 5J1EB 2HFUA 3HKWA 2BACA 2JX2A 2WB1D 3C6TB 2E5HA 3I9V9 3ZTSA 4C9DA 1ACMB 2PC6A 1WOSA 1FE4A 4ZCLA 1UW9A 5DDQC 3E51A 4O3RA 3J7YI 3BGUA 4I6AA 3FEYB 3OV7A 3B8HA 1HMVB 1Z2LA 2KH9A 4ID8A 3SV3A 3LANA 4JI7J 5ETRA 1T9UA 2MHEA 3VAKA 4FS2A 3DM2A 5E0OA 4Q2LA 4RR5A 4DUTA 1CJTA 3M6VA 3KLHB 3TAMB 4NLQA 3AA8A 2AJ2A 1FRIA 2V8PA 4HDHA 2CJYB 5ETTA 4TY8A 3G6XA 5FLXY 5DM6Q 5AJ3F 2J8SA 2X1AA 1X9MA 4LIWA 1JXEA 2PA8D 4BDPA 2W24A 4OZ5A 1XMQF 2XG8A 5AE3A 3P5BP 4YB7A 4XK8C 1I1GA 4K4TA 2FY8A 5A8RA 1SB6A 5HROA 2B6AB 1B4SA 2PI4A 4GRSA 3HHKA 2QLBB 4OI4A 4DSLA 2GGPA 4NEZA 1N5YA 3VGTA 4PCQA 4PABA 1T03B 2BKNA 1T9VA 4UY8T 1R0BG 4OFZA 4O4RA 3T19A 1FNXH 5DG8A 4K5SA 2ASLA 1RBLA 4F67A 2UUBF 3TWZA 3N6LA 2DPJA 3CC2S 3UPFA 1HQEB 3OR2B 3UD4P 1TL1B 3R5JB 3I9ZA 3NAIA 1WWHA 2V50A 4DR5F 3BN4A 1RCXB 4XDCA 2UUAJ 1B99A 4L3NA 5KFDA 3Q22A 1CQNA 3UVJA 4UOFA 3IRXA 2DCLA 3NAHA 5KFFA 3I0RB 1IKWB 2DBBA 5AXLA 1S7IA 1H2UX 1OY8A 1QTMA 5D0RA 1U25A 5J1EA 5E3RA 2Z57B 4ZPVR 1XR5A 4M5NA 3ZNJ1 3C6TA 2VD3A 2CPFA 1HHQA 1IUJA 5F41A 2LEBA 1FX4A 2F4VJ 2AZ3A 2M7SA 2L08A 1U1PA 4F0MA 2MKSA 5T14A 1HMVA 3HKZD 1YJ9S 3PJXA 5SUHA 3BGRB 4K50A 2KRRA 4JV1A 1WOPA 1FWKA 3VGVA 3HSJA 4GC7A 1NB2A 4ZVHA 3NL0A 3MXHP 1REGX 3KLHA 4TVAB 3TAMA 2WCXA 4PYDA 4ZVTB 2UP1A 4EYHB 5ETKA 4B9LA 4HDGA 4YOEA 4U7CA 3R2DJ 2JDJA 4ZPBA 2F9JA 5HQ8A 5KG4A 4P2FA 1TV6B 4JI2J 4H4KC 1MWYA 2FQQB 2D3UA 2XULA 2CQCA 4DV5F 2FVPA 9ATCB 4C97A 4F04B 4X4OA 3GSDA 2LCWA 1S1UA 1AXQA 2B6AA 4DV4F 2MZJA 3T3FA 3U7JA 4B9SA 1VC5A 2KZMA 5LSRA 5HMWA 4FN5A 2M0GB 3H4BA 3MTJA 4S0MA 3MECB 1T03A 4A46A 3MEKA 4DN9A 3NKYA 4L76A 2BANB 4Q43A 1SL2A 4DL0C 2F5GA 4ZVGA 3BGLA 4XTTA 2IMWP 1HQEA 3OR2A 2DGUA 5FD1A 2DH9A 1TL1A 1JXVA 2Y8WA 3ZXWA 3MI7X 4TU8A 3TARA 4F3QA 5AJ3J 4ZN1A 4F25A 3DU6A 4WFZA 1LOUA 3QT8A 3N6NA 3BQ0A 3IRWP 2UVVA 1XMQJ 1K0VA 4OZ3A 5CCMA 3I0RA 1ZM4A 1IKWA 3BH6B 1Q8BA 1XNQF 3BBCA 2AYBA 4LFBF 2FLOA 3RU0A 2W25A 4WJBA 3X3UA 1V5IB 1WDDA 1R27B 2V8DA 4DS4A 2ATLA 3SIPB 4NMXA 2FHJA 3WIVA 1RT5B 3O3LA 2R2RA 3BGRA 2UUBJ 1SJQA 1XWLA 5KFRA 2ZKTA 5KFHA 1WEXA 4OZJA 4W90B 2UZAA 1YJVA 5EWEA 3G6ES 4P72A 4J90A 1MMDA 2LQJA 2R8HA 4I2PB 1H0HB 4DCOB 5AXNA 1HNWF 2P2CB 2KT5A 4AFFA 1LXJA 3M8WA 3EM1A 4DEZA 4ECSA 4DR5J 1FXDA 5IM0B 5LXRA 1S77D 1TV6A 2JEJA 4RJVA 1NCLA 4CT8A 2KT2A 3OHAA 4OJ1A 4KRWA 2EI5A 4U9RA 3VTIA 1UL3A 1Q81T 1S9EB 4M5DA 1VYAA 2B4PA 1Q95G 3TVYA 3OL6A 1N56A 3PEHA 1U47A 4QYRA 3IM9A 3UD5A 4YY3J 3MECA 1YX2A 1FKPB 5B0GA 2V94A 5B08A 4F4YA 4ETXA 2YWEA 2XMWA 2BANA 2X3DA 2ZH2A 2X1BA 1R8PA 3ETMA 4PG5A 4ZPWR 1WC6A 1IBLF 2BM1A 2K7KA 3H8YA 4X4TA 1F6TA 3J7YU 2UXBF 2F40A 1WEYA 1FKOB 4ZA1A 2HVHA 1VQ6S 1RKIA 3AOAA 3ULHA 2PSZA 2YTCA 5C24A 1IKVB 1SH2A 3SZ2A 1TL7B 3KG1A 4A8KA 2XY7A 3JSYA 2MKKA 3BEGB 3V2UC 1SH3A 1ULRA 4DV5J 1RTZA 2UV8A 2HYIB 3IR6B 5DQHA 2I1RA 1HBMB 4FBUA 4A8YA 4LSLB 1RTJB 2OIHA 1XQIA 4DV4J 2ZHAA 5IT4A 4XIUA 4ECRA 1FK9B 2B5JB 2CDQA 4H4KA 3Q24A 5ETVA 5RUBA 2GMHA 2CQDA 1CS4B 4FF3A 1JB0C 3LQVA 1G4CA 1GMWD 3H40A 2C42A 3R5DA 3TP2A 2B4OA 1RT5A 2HFNA 2BEFA 1NZAA 1S5ZA 1LWFB 2G1DA 3GTYX 1QSYA 4I2PA 2XY5A 4R0EA 1BY9A 2M2BA 3W8GA 3T6JA 2PT0A 5KFYA 1SIWB 4HH1A 2W9CB 5IM0A 3DOKB 4OZ2A 4ECZA 1MROA 3GIJA 1MMLA 3JQJA 3K5OA 3M2VB 4K59A 4NRTA 4N7TA 5DZ7A 1FTRA 4QIEA 1XBWA 1BE4A 3GR0A 1S9EA 1XNQJ 1RT1B 4LFBJ 1R7IA 1C4CA 2D69A 2HS0A 3TAQA 4HVZA 4QWBA 1FKPA 2QL7B 1WACA 4G3IA 3JAMY 2RIJA 2VHGA 2O1PA 3EPGA 3EDQB 4DQPA 2BMBA 1HD0A 4MYTA 5A2QY 5HMZA 5F8HA 1GEHA 4MMOA 3HZGA 4CDIA 2A2CA 4JI1J 3G96A 1HNWJ 1FKOA 4KQZA 2I6WA 3DYAB 3WC0A 1RT3B 2QG9B 3CDWA 2X1FA 4WP9A 2BOPA 5D4LA 1JJHA 1TUGB 2QRRA 2DR9A 1URRA 2VODA 3G87A 1WSVA 3Q8VA 4NLYA 2XS5A 2VU5A 2YWKA 1S79A 4BWJA 2BE7D 4NWBA 1HBMA 3CJSA 2KFYA 4LSLA 1RTJA 4OQJA 1LFPA 3H25A 4IUFA 4LSZB 1NNDA 2EXUA 3GU0A 3HHLD 4KT0C 1FK9A 5LJ5Y 1RWPB 1KKHA 2HQCA 4ZVRB 2IRUA 1CS4A 2ZZTA 3C6UB 5DZ6A 3TUJC 2BBEA 2HGNA 4CLYA 2D9OA 2XGQA 2YKQA 3UW1A 4Z7CA 1FA0A 1IBLJ 3PW0A 4DUYF 2DGWA 2DNGA 2A18A 1N0UA 5B0BA 2P9EA 5CYQB 1C0TB 2H48B 5HI7A 1A9NB 4LBHA 1ZAVA 3LO3A 5D4PA 2W9CA 2RD5C 3DOKA 3F44A 1S1VB 5BR8F 4WCEQ 2ZH6A 2FJXA 3M2VA 5HQLA 2SXLA 3NNAA 3H2UB 3I31A 1TK5A 1X0FA 2OI2A 3MGJA 1RXOB 2IYIA 5JXSA 1RT1A 4OYBA 2DRDA 2ADCA 2E5IA 2HQIA 1K8AT 2DK2A 2HFOA 1HQUB 5E3CA 4UOHA 1NJZA 3M8SA 1HPZB 4Y2MA 3LW5C 2DRBA 5J1NA 1KVIA 2IVYA 2IM1A 4FNHA 1D8YA 2ILYA 1Q7YT 2GX8A 4N41A 4PEOA 4GO5X 2I8EA 2XZDB 3CCSS 2VPWB 9RUBA 4ZJQA 4N77A 1Z4UA 3J80U 1ZAXA 3DYAA 2XZWA 1HIYA 2DGOA 1S7HA 3M6UA 1RT3A 3ISND 2Y3YA 4C8LA 4DR2F 4USTA 1SKSA 1X4GA 3KXDA 3SSRA 3WC2A 3S01A 3KWMA 5F3TA 1HHSA 2DHAA 4KGVB 3CNQP 3VWSA 1RAHB 1RHKB 3OFEA 2AJ4A 2MDAA 2E1PA 2WSEC 3EGNA 2GVZB 1F2HA 4P6QA 2F8EX 2V8VA 3BPSP 3MD1A 5KFTA 2W7PA 5DRKA 3RRHA 3CDEA 4KB7A 1KP6A 4AQYF 2CKWA 1FVQA 3R8YA 2V8GA 3C6UA 3MOZA 1IKYB 5E3PA 4DQQA 2DKOB 1HW9A 3E2EA 3GJSB 4ZP7A 4OJHA 1H2TZ 4DR7F 1CVJA 3BYRA 4MIAA 2HQ3A 2F8HA 4OHVA 4JUZA 7AT1B 2WK4A 3HVTB 3N5FA 2CPJA 1M1GA 4CP5A 1NH8A 4RKUC 4NLXA 2KHCA 1S1VA 1R6YA 1FESA 4H4OA 3PHEA 1YJUA 4M94A 3W60A 2HK2A 1QVGR 2WVFA 2Q66A 5KG3A 3QZ7A 1DURA 3FSIA 2B3TB 2DNRA 4WZMA 2HNZB 1HQUA 3W2WB 1Q8IA 4RPFA 2IA0A 4X66F 4BHQA 3HSGA 3OSPA 1HPZA 5KT3A 1IJEB 3D1QA 1KSPA 4C2MA 5I42A 2H54B 2OH2A 4J9SA 3UWTA 2R3VA 4ECXA 2DH7A 2E5JA 4HACB 5IWAF 4DUYJ 4RBUA 1DAXA 4J37A 4IQMA 4M5GA 5H1SV 3MEGB 2CPHA 2HLTA 1D09B 3HJFA 3OTOF 5B0DA 1ZM2A 3L7PA 1XN9A 3UFCX 2XHWA 4YUDA 4Y3CA 2UXDF 2EEYA 3M7VA 3F56A 4NZ6A 2C28A 4HL9A 5K9FA 5FDLB 3TI0A 2P9CA 3OLBA 3BGFA 2GVZA 2J0WA 5D0GA 3CCZA 3TA1A 1Y5IB 1FRJA 3T1YF 4C8OA 2HFZA 3LP2B 4CO2A 3CB4A 2R7OA 1IKYA 1U45A 3W3SA 5F9NA 1FHTA 4LF5F 2HHHF 1AFIA 1RA6A 4Q8FA 1FWLA 1ZZNA 1TK0A 2E1AA 2ZOMA 2ZOGA 1UMJA 3D0HE 3HVTA 5HN0A 1KQGB 4IOCQ 1P27B 4J7CA 2DO4A 3MDFA 4WKRA 3W1YC 4DR2J 3CVKA 5IC4B 2AYGA 3TX8A 1HA1A 2F4FA 3I87A 2J9CA 4RUCA 3LALA 1RWWB 3N01A 4CH0S 4P7VA 3BF4A 1WHVA 1N8RT 3BPDA 2P8IA 1N54B 3AXKA 1FJ7A 3WZ0A 2GHPA 3HI9A 3GE9A 4WYWA 2GC8A 4J9VA 1PBUA 2RUGA 2XMTA 4J9QA 1JNZB 2HNZA 1RCOB 4D3GA 4K2XA 3W2WA 3DXSX 1O51A 4NOHA 3R1LA 4ZP6A 4F4ZA 4AQYJ 4DI6A 1R0CB 3QAUA 3OTEA 1RK8A 1VQKS 4DR4F 3WDOA 1EHWA 3K8WA 3P8BB 1VLYA 4KH0B 4DR7J 2CPYA 1ZTWA 5KFPA 4HACA 3F41A 3UO0A 5IXUA 1DJ0A 3BBBA 2UVRA 5GAEI 3KK2B 3IBFB 4C0HA 5B0CA 4R5PB 4WBFA 3MEGA 2IJRA 2AP6A 2VG7B 5KAKA 2CQ0A 3M9MB 4NLOA 1V3ZA 1VMBA 4WF9Q 2I5JB 3BS9A 5HLFB 3R6GB 3MHYA 4EYIB 3QJJA 4OZLA 1RT7B 5A8WB 1TK8A 5ITHA 5ETNA 4DQIA 5FDLA 4A4JA 4HT5A 4LR7A 2G0CA 3KK3B 1Q78A 1UEVA 5L38A 4QBUA 3VZHA 1UVNA 4X66J 4K4WA 2ZH5A 5J2MB 3TZWA 3FBEA 2EFPA
chains in the Genus database with same CATH topology
4LSNB 5IZHA 2PGCA 3ITHA 1HD1A 5J2QA 1TR0A 2AJFE 1H6KX 3RAQA 3NNHA 2VL1A 5T7LB 4B3TF 2Q79A 2LQBA 4EBCA 4FF4A 3HZEA 4QR1A 3RR7A 4BWMA 3DLKB 1Q82T 4YHHF 1SV5B 2MYFA 3ONQA 1WI8A 3MM6B 2GO8A 3UCGA 1X5SA 4DQSA 2WOMB 4EBEA 5KFUA 4NZ0A 4C3LA 2MKIA 4H4OB 1X4HA 4NLSA 5KTQA 3FMBA 2KXHA 4CNYA 2DHSA 1GQEA 3H5YA 3CJ4A 3FEZA 2L48A 4NX9A 2RT3A 3K5MA 3FGVA 5GMKa 2R8GA 2FLLA 3NBPA 3GIMA 4CT9A 3D2WA 1ZETA 3OTDA 4NA3A 3HM9A 2OPSB 5F8LA 2FVCA 5CYJA 4LVOP 4JI7F 3JYTB 3HT3A 2HHWA 1FF2A 3OW2R 2EC0A 3K7RA 3SFUA 2GMLA 2XLJA 1F5AA 5A0YA 1F0XA 1X5OA 3UR3C 1UJ6A 3M30A 4TLRA 1FNOA 5IFMA 1LWEB 1U1KA 1KLNA 2Y1JA 3E01A 2HNDA 2RS8A 2L9WA 4QJVA 5LSLA 4QWEA 5DDOC 4KTQA 1NH7A 2QLWA 2B9XA 1VJWA 2NLWA 3H98A 4IO9Q 3EGZA 1QSLA 2FHMA 2RVJA 3DLGB 2XI2A 1JLGB 3RB4A 3UDLA 2RH3A 2VC0A 1IQTA 2BE2B 5DG7A 3V4IA 2OD6A 3MMCB 3T9ZA 3OLAA 4QIFA 1S9FA 1C0UB 1QLNA 5J2NA 3GYXB 3KLIA 4K5RA 2Z0GA 2YNHA 2J7UA 5I42B 5KG6A 1UJ5A 1IN0A 2IBOA 1JLFB 3JSMB 1TL3A 3TUIC 6FD1A 4B3MF 1TAUA 1T7PA 2ZH9A 1C1CA 2EFQA 2YKMA 4EZ9A 3DLJA 4Y00A 3T1AA 1U2RA 4ZPDA 2NS1B 4YB5A 1JIHA 1YJWS 1RTDB 2DNHA 4DPOA 5C5JA 1ZOTA 4QU6A 3PO4A 2FJWA 2CQ4A 3O6QA 2M3DA 2DT9A 1RA7A 3CD7A 2ZC3A 1E6YB 2YWFA 3DRRB 3TA2A 3NLCA 4ECTA 4QZVB 4PG7A 1QJHA 2NYIA 3S7RA 2EFNA 2IMOA 5E2QA 2WTFA 3BSOA 1DHMA 3DLHA 1YI2S 1N6QB 2MQOA 1RI7A 2FVRA 1X8DA 5KFXA 4C4WA 2GNKA 2JLFA 4ZPCA 1WNEA 4ILMA 3PR5B 3HDSA 1C1BB 1HI8A 1GXUA 1P1TA 4IOBA 2BJEA 2XB2D 4URQU 4WFYA 1S9GA 3QIDA 4C11A 3SCJE 1T8EA 2DO0A 3LAMA 1OIAA 2V4JA 4F50A 2VPYB 4DOZA 2UUCF 3KMQA 1WTBA 4IG0A 2RU3A 2J9EA 5EN1A 2V4RA 1U1OA 3MEEB 1TP7A 4O3NA 1MWZA 3LP0A 2MJNA 4F2SA 3CCQS 3VAJA 2KG0A 3BM7A 5KG2A 2XC9A 4WK3A 3MEDB 3M2UB 2AJ0A 2HS3A 1TFYA 3GV7B 1B64A 3KK2A 2XS7A 2HWIA 1RGVA 4R5PA 3R27A 2J6UA 4YDXA 1F5CA 3UNGC 4NCGB 1FRKA 5BYRA 4WU3A 4O4GB 4Q45A 3PEJA 1OWXA 1Y0HA 2AYEA 1DLOB 3CDAA 3ZZZA 2VG7A 3AHPA 3ZC4A 4WTYA 1EETB 4C8MA 3NGDA 4OLOA 1UP1A 1Q8LA 4RW7B 4NXNF 3DM2B 3VAIA 1IQZA 1OSCA 3FVYA 2ZUGA 1EP4A 4G1QB 3LWMA 3CXCR 2UU9F 1UVMA 4JYAF 2CQGA 1JLBB 3LGMA 4URSA 2IM3A 2W7OA 1Y7PA 2V9KA 5D78A 2C2DA 2ZNYA 2DVIA 1SJFA 4LF7F 2W4DA 1A7GE 5KT4A 1F60B 2I5JA 3OFHA 4MIWA 4BC9A 5HLFA 2YKNB 1AUDA 4RW4A 1CQMA 4Q8EA 2QSWA 1BQMA 2IJNA 3D5MA 3RBDA 1K0TA 3SSQA 3MR6A 3MAQA 4K4XA 2W8LA 3CJKB 1KS2A 1RT7A 2YNGA 1I6JA 1WEZA 5A8WA 2RDIA 2HRUA 2APOA 3I5CA 2W9BA 2BQRA 2VOPA 1SKWA 5KFJA 2UUAF 4IG3B 1TKTA 3L3CA 1X5TA 2KYZA 1M1KT 1H7WA 2C3YA 3H5UA 2MQMA 3HPOA 5KFCA 3KK3A 2R7QA 2JOQA 4J9LA 1YRXA 1S49A 4F26A 2FVSA 4FBTA 3IWXA 2K3IA 5CYMA 1S1WB 1TKDA 4IFYA 3I82A 2DHGA 4IR9A 3V6HA 1O5JA 4KFBA 2ZJPQ 3K59A 4KPYA 4UY85 5J2MA 3N28A 1N32F 4KHMA 2D3ZA 3FSYA 2C3OA 4E8UA 1TZ0A 2VFRA 2R7RA 2ADBA 5A8RB 4I7FA 1NJYA 3QGIA 4XDDA 2QA4S 1BWEA 2BABA 2M4MA 4LSNA 1NRKA 3RRGA 2EG2A 3G6YA 5T7LA 2VV5A 3GFYA 1X5PA 2OO4A 3ZZPA 2GGPB 3MUTP 2JWNA 3I56S 2YH1A 4B3SF 4Y6IA 4LIRA 2LECA 3DXBA 3D1HA 3CC7S 2IVMA 1CC7A 2ZBCA 1B0VA 3DLKA 1N5YB 1SV5A 2QA4G 3VAGA 3K5LA 3CC4S 3FDSA 3MM6A 3VAMA 3AB4B 2KXNB 3OFGA 2EG1A 2VFSA 2WOMA 3L7OA 5D4NA 4DG1B 3SV4A 4RUHA 4N56A 1UJ4A 2FDNA 2JEIA 4JI6F 4DN0A 3RAXA 1D0EA 3FFIB 2CPDA 2NPIA 5BJRA 2IBKA 1U1QA 3MTKA 2R7SA 1U24A 2KI2A 2ERRA 3G71S 1QM9A 2OPSA 3D0IE 4YFUA 2Q43A 3J80Y 3JYTA 1E6VB 1U6FA 1FT8A 2OSRA 4DV1F 2FPHX 3UDCA 3M8RA 1BD6A 1KFDA 2HWTA 2HS4A 3QYYA 1CC8A 2Q6BA 4RBVA 1I94F 1LWEA 1VQ7S 1V3RA 3D0GE 5DO2A 2OAUA 4WXWA 3ZZTA 4KHRA 5L8RC 2MZ1A 4ECWA 1HBNB 1RTHB 1XEZA 4YR3A 2IC3B 2LXIA 5DLFA 4DSKA 1TKZB 1WELA 3DU5A 2FLNA 3C46A 3DLLQ 1GX5A 3L09A 3LOUA 3QWUA 3DLGA 1M5PC 1WG5A 2EFVA 1RWUA 3DN9A 1JLGA 5DDPC 5M2RA 3UCUP 2J7WA 3H20A 2BE2A 2KYXA 4C7QA 4QIGA 3MMCA 4CNZA 2NUHA 1C0UA 2QV6A 2VZ9A 4JI0F 4Y2IA 5T41A 5HL7Q 4C0OC 4MKYA 1T3OA 3N0VA 1OS5A 3JSMA 1JLFA 3NWGA 2BM0A 3GV5B 1RKJA 4C8YA 4LUBA 2BRKA 3PNIA 4ERDA 2JVRA 5GVQA 1RTDA 2Q6CA 4JI2F 4C0BA 5AE2A 4F3OA 1GAOA 2QO3A 3FQKA 1B7FA 2QA2A 4KGKA 2RNEA 2ZH8A 1R0AB 3IRXB 1C4AA 5CA5A 3DRRA 1E6YA 4A8WA 2JZ5A 4ZMMA 1MMNA 3WBZA 1XK8A 4IRDA 3R5BA 1N6QA 2YVSA 3MPYA 1GT8A 1R3NA 3QZ8A 1C1BA 2AX1A 3UCZP 1LQ9A 5J1EB 1QVFR 5DG9A 3HKWA 5E7OB 2BACA 2OKQA 2JX2A 1S10A 4CI0B 2WB1D 3C6TB 2E5HA 3I9V9 3V6KA 4LF4F 3KK1B 3LH2S 4AL7A 4C9DA 1WI6A 5K5MA 4QU7A 2PC6A 1FE4A 4ZCLA 3C8YA 3MEEA 5DDQC 3W7BA 5EUHA 1CLFA 3E51A 4OZ0A 1FDBA 1HBOB 3R5CA 3ZZYA 1N34F 3MEDA 3M2UA 4O3RA 2CQHA 2WHOA 1TVRB 3MCSA 2V5HG 3J7YI 3BGUA 3FZ2A 4TNOA 2MY8A 3IA0A 4ECQA 4I6AA 3FEYB 3THPA 4NCGA 3OV7A 3B8HA 1HMVB 1Z2LA 4O4GA 2KH9A 1C2PA 4ID8A 3SV3A 1W2BR 3LANA 4ITSA 2P9GA 1PC5A 1LWCB 4U7UK 2MHEA 1EETA 5U47A 3VAKA 4FS2A 4RW7A 3DM2A 2J9DE 5E0OA 2KM8C 1S6QB 2K8GA 4F3MA 4Q2LA 1VQ8S 5J2PB 2AX0A 1JLBA 4LMZA 2HW3A 4PXCA 1KOOA 1KR4A 3IR5B 3M6VA 3KLHB 4N5SA 2BDPA 1LW0B 2WBRA 2C22A 2GQCA 4NMLA 1VI7A 2YKNA 4OX7A 3TAMB 1G7CB 3HLUA 4NLQA