1X4FA

Solution structure of the second rrm domain in matrin 3
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
112
structure length
112
Chain Sequence
GSSGSSGKKPEGKPDQKFDQKQELGRVIHLSNLPHSGYSDSAVLKLAEPYGKIKNYILMRMKSQAFIEMETREDAMAMVDHCLKKALWFQGRCVKVDLSEKYKKLVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matrin 3
publication title Solution structure of the second RRM domain in Matrin 3
rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 11
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2005-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1x4fA00
3PIOQ 1AUDA 3I55S 1OWXA 2DNOA 1X4AA 4IOAQ 2GHPA 1HA1A 3BEGB 3NS5A 2HGMA 2LA6A 1VQKS 1H2UX 1YHQS 1HD1A 2LEBA 3UCGA 1DHMA 5GMKa 2YWKA 1SJFA 2KRRA 5LSOA 4WKRA 1XN9A 1H2TZ 3CCQS 1UFWA 2LA4A 2MJUA 4QU7A 4WCEQ 2ZJRQ 2AYEA 1X4CA 2DIUA 1Q86T 3U1LA 4CH1A 1VQNS 5LXRA 2E5HA 2DNPA 2HGLA 5GADU 1WEYA 2LMIA 2DH8A 2DNQA 2OSRA 3DLLQ 2LQ5A 3EGZA 3VAJA 2CQCA 1FJCA 2CQ3A 2KVIA 2J0SD 3J7ZT 1WWHA 3UD3P 2EK6A 3J7YU 1U6BA 1U1QA 1VC5A 2HGNA 2KG0A 2PE8A 1CVJA 3N9UC 5IFMA 2RQCA 1U1MA 5LSLA 3NNCA 2M9KA 4CQ1A 2MKJA 5HL7Q 1NJIT 3P49B 1P27B 2MZ1A 2X1BA 1FNXH 4F25A 4TLQA 1R8PA 2XNQA 3G8TA 1KC8T 1H6KX 2K3KA 5D78A 3CCMS 1QVFR 3THTA 5IM0B 3I56S 1FJ7A 2MQNA 5LJ5Y 1YJNS 1N54B 2YKAA 1N8RT 2M4MA 2CQ1A 5DDPC 1ZH5A 3CPWR 1OO0B 2KXHA 1WG1A 1QM9A 1RK8A 1X5SA 5DM7Q 2CPHA 1URNA 4TU9A 2N7CA 1VQ4S 1FO1A 2AYBA 5GAEU 2CPEA 1W2BR 3MXHP 2B0GA 1O0PA 2CPDA 3TYTA 1WHWA 1Q81T 2DH7A 2X1GA 3CCJS 3VAGA 3CC2S 2DHAA 4UQTA 1U1PA 3FEXB 1VBXA 2VOOA 1SJRA 3UCZP 2DGQA 2M8HA 4TU8A 2VONA 2MQMA 3MUMP 3S7RA 2DHXA 2MZQA 1VC6A 1WF0A 4WIIA 1ZZNA 2U2FA 2DNMA 1X4HA 3R1HA 3CD6S 1WELA 2RUGA 1B7FA 4ERDA 5H1SV 1NO8A 1FXLA 2QEXS 3G96A 3CCLS 1SJ4P 1YITS 1M5VC 1S79A 1X4GA 2KM8C 1U1LA 1HD0A 2N82B 2XS7A 2X1FA 2FC9A 2DNGA 3VAHA 2CPIA 3CC7S 1N88A 2KT5A 2NZ4A 1L3KA 2M2BA 1F9FA 2I38A 1KD1T 4W90B 4C0OC 2QA4S 3UWTA 4LJMA 4U67Q 3EX7B 2DGUA 2EK1A 3BO3A 4PR6A 4C7QA 5HO4A 2MJNA 3R27A 2MGZA 2K8GA 4YB1P 4ED5A 1YI2S 1K8AT 1UAWA 2YH0A 1YJ9S 4YUDA 2XS2A 2VODA 4P6QA 4W92B 2EVZA 3EGNA 2DNKA 4BS2A 2JWNA 4Y00A 3CMES 2XSFA 2RS2A 5GAHU 2FPHX 3LPYA 1R8HA 2J76E 1Q82T 2QFJA 4WFAQ 2OSQA 2AYGA 1M5PC 3MD1A 1X5TA 2D9PA 2KRBA 2LCWA 2MGZB 2Q79A 1BY9A 2CQBA 2MZRA 3THPA 2LKZA 5D77A 1A7GE 1M5OC 2KXFA 3UD4P 3P3DA 1M90T 1RKJA 3CXCR 3CCSS 2JRSA 2MSTA 2MB0B 3R1LA 1N52B 4OZ1A 3Q2TC 2GO9A 2HZCA 2DB1A 3UE2A 1VQPS 2YTCA 3IWNC 1VQLS 2JVOA 2PEHA 3CTRA 1VC0A 1WG4A 2LXUA 2MHNA 2ADCA 1U1NA 1VQ6S 2XNRA 2DGOA 1D9AA 2DISA 2DGWA 2DK2A 1M1KT 1WI6A 2XB2D 1WHXA 3NMRA 4WFBQ 1K73T 2LEAA 2G4BA 1WHVA 4QQBA 1JMTA 3SDEA 3CCRS 2KYXA 2DO0A 2KM8B 4IO9Q 2MKKA 3G71S 2DNRA 1S72S 1OPIA 5DM6Q 2MPUA 2CQ0A 2MQLA 1PO6A 4FXWA 1SJQA 2MZSA 2SXLA 4A8XA 3HI9A 3JB9k 2LXIA 2MY8A 3H2UB 1WHYA 2J8AA 2LYVA 1PGZA 5GVQA 2DGTA 2CQIA 2E44A 5DDOC 2MXYA 1QVGR 1FJEB 3VAKA 3B4MA 3P5TL 5EN1A 2L9WA 2NLWA 3CF5Q 3Q2SC 1UP1A 1VQ9S 2N3OA 2M8DB 2HYIB 3IRWP 2MSSA 1X4EA 1U2FA 2BOPA 5CA5A 2YH1A 1KOHA 2RS8A 1M5KC 5LXYA 4QU6A 3FEYB 3V4MA 3OW2R 2CQ4A 5FJ4A 2ERRA 2DNNA 2L41A 4QPTA 5BJRA 3CCUS 5DDQC 1X4DA 4PKDB 2CJKA 4FXVA 2RNEA 1WF1A 3SMZA 3D2WA 5CXTA 3MOJB 2F9JA 4CH0S 1Q7YT 2N3LA 2MZJA 2DO4A 4ZKAA 3CULA 4F26A 2MQQA 4WFNQ 2I2YA 1U6FA 3TO8A 1WG5A 2DNZA 2E5JA 2UP1A 1NU4A 2M7SA 1SXLA 3G4SS 2CPZA 2MYFA 1DZ5A 1X0FA 2J0QD 5JVHQ 2RRAA 1JJHA 4F02A 1G2EA 3K0JA 3VAIA 1VBZA 1WEZA 3TP2A 2MY7A 4IUFA 1VQ7S 2VOPA 2U1AA 2MKCA 3PIPQ 2DHSA 2CPJA 3G8SA 5JVGQ 3NNHA 4C4WA 3CUNA 2OTLS 2DGXA 4TU7A 1FT8A 2KN4A 2M52A 1VQ8S 3VALA 4Z2XA 2MKSA 3ULHA 1JJ2R 2G1DA 2FC8A 4M5DB 1JJ4A 1X4FA 1VQOS 2KHCA 3UCUP 2CPFA 2KI2A 3U1MA 5IM0A 3MD3A 2M88A 3H2VE 2F9DA 2CQGA 3MI7X 4UY8T 3B4DA 3BO2A 2L08A 2O3DA 2X1AA 2DNYA 1KQSR 3RW6A 1WI8A 1D8ZA 4IOCQ 1WEXA 3CCES 1YJWS 2M70A 2E5GA 2KU7A 2DH9A 3G6ES 4YOEA 1K9MT 2KFYA 2ZJPQ 3RW7A 2KG1A 2RVJA 1WF2A 1H2VZ 1WTBA 2OIHA 1IQTA 2DGSA 3LQVA 1X5PA 4WF9Q 2CQDA 3S8SA 1U1OA 2LECA 2MKIA 2MZTA 2D9OA 3DXBA 3P6YC 2MQPA 2XS5A 2KXNB 2CPXA 3BO4A 2HVZA 3VF0B 5GAGU 1FHTA 1X4BA 2M0GB 3MUTP 1VQ5S 1HL6A 2ADBA 3US5A 3VAMA 5DETA 2CPYA 1P1TA 2DITA 3ZZZA 1OIAA 1KOOA 2OTJS 1YTYA 2RU3A 2D3OR 3NS6A 1YIJS 2RRBA 2AYMA 3VAFA 1X5OA 4LIRA 2MMYA 1VQMS 2DNLA 4J5OA 2FHOB 1U1RA 3CMAS 4LMZA 3CCVS 2DGVA 2CQ2A 2WBRA 3SDEB 2FY1A 3ZZYA 2ZJQQ 5MLCV 1VBYA 5IQQA 3L3CA 1ZZFA 4CIOA 2DIVA 1A9NB 2G0CA 4EGLA 2DHGA 4OZ0A 3NNAA 3MURP 4Y0FA 2MKHA 1UW4A 2KH9A 1DBDA 3SXLA 2MQOA 3MUVP 4V19X 1SJ3P 1U1KA 2OJ3A 3S01A 3CC4S 2RQ4A 2JVRA 3MDFA 5LJ3Y 2CQHA 2RT3A 2E5IA 5CYJA 2A3JA 1DRZA 3G9CA 2JX2A 2CQPA 3S6EA 2F3JA 4RU2A 2AD9A 3HHNB 2DNHA 4PRFA 2BZ2A 1YWXA 5DDRC 3BS9A 5ITHA 2V94A
chains in the Genus database with same CATH superfamily
1P8GA 2CJYB 4KKOB 1KQFB 4R8UA 1HD1A 5K5MA 3UCGA 5AT1B 2KVQE 5I3QA 2RRNA 4PWDA 4A46A 3CJKA 1HNIB 4TVAB 5GAHI 1SIZA 1LXNA 3RR7A 1IKXA 1HBMB 2DNQA 5AE2A 3PW4A 3M8QA 4ES1A 3NGKA 5K8NA 4C3KA 2RHSB 2I1RA 4OLOA 3D0GE 2QLFB 3HKWA 4KH0B 5F8IA 3MAAA 2ZHBA 2V4JB 5L1LA 5T14A 3MEDA 1P1LA 3FCWA 1OO0B 2W24A 3H98A 4DPYA 4TYBA 5DM7Q 5J1EA 4U7CA 2UUCJ 5GAEU 3GMGA 3TYTA 1JLQA 4KFBB 4QYZJ 1NJWA 2H5EA 3TUJC 4GVBA 1S9EA 2V6AA 4M5HA 2MZQA 5ETOA 5KG4A 3MMBA 4Y2IA 3IR6B 5ETLA 4ID8A 3GV5B 4N56A 3CCLS 1T94A 4Y65A 2QA1A 1U0HA 3M2VA 4K7QA 2G13A 3OUYA 3N5BA 5HBMB 2B7CB 4NWBA 4ECZA 3V6DB 4X66F 4CLPA 1F9FA 3CDBA 4Q44A 1KD1T 5T41A 3DOMB 2HBQB 1QAJA 4C8OA 5E33A 4ZN3A 1DTTB 2NPIA 4R5PB 4BS2A 4GKKJ 3K5OA 4ZJQA 1LQ9A 4KHPJ 4XDDA 1ITPA 2QFJA 4U7UD 2XLIA 3MD1A 1IKWA 2N4DA 5KFQA 4USJC 4NA1A 1HNZJ 2IM0A 4DR2F 2XMMA 1U8SA 1KHWA 1Y10A 1WG4A 5A8KB 2LXUA 2NQPA 3BGFA 2BOAA 2DGOA 2HHSA 2ZKTA 3DLGB 5HMYA 1PAUB 3H4BA 2G4BA 1JMTA 2DO0A 1CJKB 5H9FK 4AXIA 4DV0F 1KQGB 1IWAA 4B9SA 4GRSA 4OYPA 1WKLA 4AXJA 2OEMA 1TFWA 2YBVA 1X4EA 3RRKA 1FTRA 1NJXA 4OJGA 3WZ0A 3MM8B 5BJRA 1Z4UA 4PQAA 2K1RB 5HSPA 4RW6A 4WP9A 3HT3A 4JUZA 1IJFB 4OI1A 2FGOA 4F26A 1QE1A 2GMLA 5CZVA 1XMQJ 4DMZA 3X1LB 2Q1LA 4RL1A 5JVHQ 2UUAJ 1P9QC 2POKA 3KJVA 1RAEB 1JKHA 5J2QB 2HVEA 3OV7A 3KLGA 2GV1A 4C4WA 3M6WA 2DGXA 4MYTA 1M5HA 4IG0B 1GEHA 2WOMA 4WK1A 3GSDA 3J81j 2C2MB 4ZLLA 2G1DA 2XYPB 3PR4A 1VQOS 2CPFA 2MHEA 2WVDA 3U1MA 5IM0A 4KPYA 3KNGA 3J7YI 2WVEA 3H8YA 2FVPA 2X1AA 1WI8A 3G6ES 2KG1A 2XGQA 1H2VZ 2OIHA 1IQTA 4KGVB 3KLIB 3DXBA 4OYIA 4F4KA 4ZVEA 4DPTA 1GXLA 5CZXA 2B7BB 1HHTP 1RTHB 3FZBA 3ZNUA 1Q8LA 4F4AA 5L39A 4YR2A 3IS9A 1MNEA 3RAMA 2HHXA 2XGPA 4TKTA 4LIRA 2MMYA 2DNLA 1G1XA 1DARA 3DRRB 2DGVA 4DU7A 3GTYX 1FRHA 4NASA 3K17A 1HMVA 3T5JA 4IQMA 3H7HB 2ZD1A 3Q86A 2OGUA 2PI5A 4EGLA 3ELHA 2QJ3A 3GIIA 4OZ0A 4LF9J 1SUQB 3IBFB 2MQOA 1YG0A 3WC0A 2VFSA 2XSJB 3LALA 1U48A 2XHWA 4Q7AA 4FVMA 3N0VA 2UU9J 4DJBA 3BS9A 1YHQS 2X3GA 3UVJB 1TQLA 2QG9B 3M32B 2O5DA 2XZDB 2LA6A 1DHMA 2V2ZA 2O66A 4WKRA 3CCQS 2UXDJ 2DIUA 3AHPA 5GADU 2NSCA 4FKXA 3VCDA 1FJCA 3M8PB 2CNNB 5LMNF 4LFBF 1D3WA 2ROEA 2BJ7A 4L76A 1FEEA 3JYTA 4NLUA 2ZBCA 3CDUA 1T9TA 1R8AA 3UN3A 4F8RA 4TLQA 2XNQA 1H6KX 1FWLA 1T05A 2E29A 1Q7LB 3JQMA 3SQOP 3Q89A 3EYZA 1YJNS 2HHUA 3TARA 2DR8A 2KXHA 5JXSA 1X5SA 4LBPA 4DFJA 2ASLA 2J7WA 4K5SA 3KLEA 3DRYA 1RTZA 1RHKB 3C14A 3FEXB 5EWGA 2DD8S 2VU5A 4TU8A 5KFAA 3K5PA 2RAQA 2MQMA 2FVRA 1SH3A 3MUMP 1R31A 5FIIA 2YKPA 3CD6S 1X4HA 2XY5A 5IT9U 3DRPB 3G96A 4JI4F 3CE8A 4EMDA 3D6HB 4WE1A 4AL7A 4NLRA 1BWEA 1NPRA 4LJMA 3EX7B 4ECQA 5MAOA 3CWJA 1XMOF 3PKMA 1RTDA 3K8WA 2R8JA 2CUYA 3GZ7A 3QIPB 1KRPA 1HI0P 4MIBA 3JTNA 4CYUA 3WC2A 2YQ3A 4I64A 3TJAA 4CLSA 3JSMB 1X9MA 2FPHX 3M8ZA 2J76E 3CJTA 2HK3A 3MAQA 2LKZA 5A6WA 2C2RA 4ED7A 2R4FA 1TKDA 1UPPA 1RU2A 3MM9A 2OP5A 3R1LA 3D54A 4L6V3 3A8JA 3B78A 3M6VA 3I32A 2GX8A 5KFHA 2HFVA 3NY0A 1RADB 1VQ6S 5M2RA 5IS2A 3UO0A 1K0TA 1J5EF 1NDLA 5C24B 5IT9Y 2QC3A 1VOMA 1MN9A 1F60B 2AEJA 3R7BB 4H4OB 2HWIA 2EG1A 3NLCA 2RB7A 1ZAWA 2MQLA 2V9KA 2I9SA 3J7A1 1TKTB 5EN1A 5KFGA 2HNYA 1MMLA 2C22A 4QW8A 3EPIA 1MROB 4NCGB 2ERRA 2LU1A 2BXJA 2VJVA 1JLCA 3TX0A 3IR5B 3CJ0A 3C46A 1UTAA 2VC0A 2FHMA 1YVFA 2GVZB 3BDEA 2HQCA 1EJ7L 4C9DA 2LXFA 2J7KA 1RP5A 4CLTA 1NDKA 4LFAF 2DHHA 4LSLB 2ZBRA 4FF4A 4C3MA 4KE5A 4HL9A 4NI2A 2WBMA 1SV5A 5F3ZA 4CLWA 1HBUA 1FD2A 4CI0B 1AROP 3IC1A 3K5LA 2H9ZA 3Q8UA 3IRXA 4F0MA 3W9IA 1N36F 3G2XA 3PHTA 4JI1F 4HTJA 2LFVA 1ICEB 4PCQA 1BXNA 1YBAA 1B4SA 2NS1B 3FZ2A 5C5JA 4OHXA 1Z2LA 2VQFF 3W9HA 2AW0A 2M70A 1IJEB 1K9MT 3HHLA 4I6AA 4OX6A 4DG1A 3TUIC 2H54B 2WAQD 4QR1A 4I6YA 2ZH2A 1N32F 3FK4A 3HJFA 2GGPA 2W2OP 2XYGB 3RUBL 3DLEB 2CPYA 3JQJA 4AQYJ 4U96A 3UW1A 2Z2LA 2CFXA 1QSLA 1JNRB 4OIXA 5E3RA 4TNOA 1JLAA 3ZZYA 1Y5NB 2B4UA 3W9JA 1AZSA 4CIOA 5DLGA 4QWCA 3X3UA 3NCPA 4PG6A 4ZVRB 2QO3A 3F41A 1RAAB 2V9WA 5HK4A 4V19X 3CVKA 1SQGA 1RHRB 2VBWA 2IYIA 3PJWA 2RT3A 2V8PA 1YX2A 2ZOGA 4C6AA 4DS4A 3O3LA 2XC9A 1HNWF 1RT4B 2NZCA 4DQIA 5F0UA 1F6TA 4OL8A 4ILMA 1REGX 2QLJB 2B5JA 3I55S 1SQFA 4LF6F 3NS5A 4LF2A 4RW7A 3KXDA 3CIMA 2R7UA 4CH1A 1MMDA 1HYSB 3ET6A 4LF1A 4GO5X 3VV2B 2KVIA 3NRBA 1RB0A 4LF5F 2B4OA 2J9CA 8RUCA 2AJ0A 3LP2A 3BM7A 4ITSA 3R6LB 3ZC4A 3PJ9A 5L9XA 2MZ1A 1N5TA 3KLFA 2XCAA 2X3DA 1FX2A 3PXGa 5C25A 4WFZA 3GV8B 3C15A 3AXMA 4Q45A 1QAYA 2M4MA 4HH0A 2CQ1A 5J2NB 3CPWR 4F4WA 4RUHA 1QM9A 4J9NA 3D9BA 1NPPA 3IG1B 4JI6J 4XO0A 1HBOA 1VQ4S 1RGVA 4JYAF 2YX7A 3JSBA 4N5SA 3V6JA 1N56A 1AXQA 3FRYA 4FPRA 4CNZA 1WF0A 2XLKA 1WELA 2RUGA 4M5KA 5J1NA 3KNAA 2NXUA 4FF1A 2MEWA 2OAUA 4V19J 1RWWB 3NS7B 2G0IA 1PSDA 2FJXA 1RT2B 3PV8A 3VAHA 1HQUB 2BUNA 4RX6A 2W8KA 4KGMA 1S6QB 3BR8A 4ELVA 3UWTA 2ZWOA 4PR6A 2ZOFA 2MJNA 3KDNA 1K8AT 3B8HA 2YNIA 4DDFA 4LREA 4DR3F 4A8SA 5IWAJ 4F7VA 1KFDA 3I4HX 3RGIA 1S1VA 2IPOB 1VK3A 3D6MB 4TY9A 1S0NA 3OL7A 1X5TA 4K8RA 1EKRA 3THPA 2BKOA 2C2KB 4DUZJ 4ED0A 3MPYA 3KLVA 3L4BC 2OPQB 1FE0A 4XAKA 2HFZA 4MK8A 3UPFA 2YWHA 1Y4ZB 1NZAA 5B7WA 3MMAA 4Y2KA 2W9CB 2E7XA 4HT5A 1RAOA 2HW3A 1MG7A 3FFIA 2RQKA 4DZDA 1WHVA 2OUGA 4QQBA 5D0EA 2IIHA 4LIWA 4C97A 2CQ0A 1RWNB 5BR8J 1TKXB 1CJUA 2WB4A 3I0SA 2CNKB 1EHWA 1S0MA 1WHYA 3U7JA 2P6SA 3B4MA 1Q95G 5G0RB 1C0UA 4G1PA 3IM8A 1UP1A 4IG3A 1VQ9S 4UUWA 2HYIB 4J91A 2R8GA 4O4RA 3AOBA 1X9WA 3PG9A 1IXKA 1PJ7A 3DKDA 3OXLA 3CCUS 2Z30B 1OY8A 3MOJB 1RA7A 3QO9B 4L73A 2E5JA 4QIVA 4KAIA 1TKZA 3G4SS 4F02A 3QJPA 4NMLA 3DN9A 5HMWA 1HPZA 4DUYF 4X65F 2F4VF 2BYCA 4ANDA 2W01A 1FDAA 2IAJB 3DFEA 3D1HA 5DZ7A 1JLBA 3AXKA 5AXLA 1N6QB 2D74B 1S10A 3ZZOA 3HHKA 1R43A 3VQTA 2J9DE 1OSDA 1IM6A 4IFVB 4J9UE 4FYWB 1FFGB 4OI0A 2XBPA 4A8FA 3KK2A 2E7VA 1X8DA 1WF2A 1WNEA 3H5YA 3ZNJ1 1B99A 1FKOA 1U1OA 4LF4F 3QBCA 1PIEA 3W2VA 2MQPA 3OR1A 1PYSB 4YFUA 2M0GB 2I0XA 3W66A 5B0BA 4URGA 1KOOA 2D3OR 1VRUB 3V5RA 2FHOB 2OPSA 1N34F 3L09A 4PQUB 2B9EA 1N33F 3NXZA 3DMJB 2HZVA 2AGQA 3W5YA 3MURP 3GG0A 4ZP7A 1UW4A 3MUVP 1R6YA 4J9OA 1RKIA 1ELOA 2H4YB 3LP0A 5L38A 1D8YA 2G1HA 4MKBA 2A3JA 2E5LF 3R7NB 2QSWA 2JX2A 3QSYB 1CQNA 3OTEA 4EK2A 3FCVA 4J7CA 4ZPWR 5DDRC 4TN2A 5ITHA 3EXYA 1T9UA 1UFLA 4NEZA 4RU9A 2HGMA 1H2UX 2LEBA 2YWKA 2EFQA 2MJUA 2WONB 4QW9A 4NXNJ 2XG8A 4UT4A 2D3UA 4AL6A 2VFVA 1RAHB 1XMBA 3JSRA 1CULB 1PKUA 1VHIA 1SIWB 2QRRA 3PO5A 2HG4A 2PI4A 1ZM4A 2V63A 3VZIA 4A8OA 2MKJA 4Q0BA 1RLDA 1P27B 4YR0A 4F25A 3QNWB 5D78A 4YY3J 2BJ8A 3THTA 2K06A 4QR0A 4OZ2A 3PYDA 3T1AA 1LOUA 1HHSA 4XIUA 1I3OB 4YP3A 3O8WA 1R27B 4B3MF 1XK8A 3KK3A 1O0PA 4IOBA 1LWXA 2BJ3A 4JB8B 3CC2S 5T7LA 2QL7B 2HZAA 1HQ2A 3G6YA 3A4TA 3DOKB 2BJ1A 1XWLA 1VS3A 2ZNYA 2DNMA 3CJ4A 4ERDA 5IZHA 3V2UC 3A3NB 1UVNA 2HBRB 4GC7A 4X4NA 4USVA 4I4BA 4CLZA 3CC7S 4UZBA 4DV6F 2CDQA 4W90B 1PYTA 1PC4A 5B0FA 2I5JB 4PEOA 4RW8A 1VHFA 3RAQA 4DCOB 1SC6A 3GJRB 4X62J 1SQEA 1VMBA 5K20B 1RJJA 3D6TB 2C2NA 5E3AA 4V1Ak 3P4UB 3RTVA 3TOQA 3DM2A 5HAOA 5CYMB 4KHMA 3W65A 4K2XA 2HLUA 3QLHA 1XNQF 3CJ8A 1YJRA 5EUHA 1HW9A 4BWJA 5HN0A 2HRTA 3HP6A 1FRIA 4XPEA 1U47A 1UJ6A 1AYEA 1VQPS 3H4DA 3IWNC 1GMUA 1WC5A 1FWPA 2XMTA 2ZWPA 3IN5A 2AEFA 2WRMA 1ZM2A 3BQ2A 2IM3A 5CYQA 4I2QB 2QYGA 2H51B 2JC0A 3HSZA 1K73T 5C42A 1C0TB 1OSCA 4ANCA 2ROPA 1RU1A 3NL0A 1FKPB 4B17A 4TQSA 3OPKA 2FJAB 2NSBA 2K7JA 3GLJA 5F8MA 1TUGB 4RBVA 2N3OA 4KRWA 3IRWP 3DI6B 2Y0SD 3BN7A 1UWAA 3FMBA 4QU6A 3OHAA 2XM3A 3EXCX 1LWEB 2RNEA 2C3OA 1CSJA 1JXLA 2MZJA 2DO4A 3K5MA 1XEZA 3TO8A 4RWXA 4TYAA 5JJBA 4UZCA 3PW5A 2AMCB 1RBAA 1QTMA 4YHHJ 4Y2AA 2XMUA 3C8YA 1NK8A 4DV3F 2HLTA 3TP2A 2BR0A 5DQHA 5BYRA 3NWGA 4QCLA 1NKCA 1FESA 4R25A 2W7AA 4Y3CA 4USMA 4URQU 1Q8BA 1S97A 1IVZA 4C8KA 4DWIA 1XR7A 4BBYA 1TL7B 5F41A 1YJTA 3SCLE 1FVQA 1R0AA 2FQQB 1REVA 2C1EB 4I56A 1LW0A 2UXBJ 2R3VA 3A8KA 3CCES 1YJWS 3KJNB 3BYRA 4JI0J 2BRLA 5ADZA 2HFUA 1WC3A 3H2LA 1FK9A 3A13A 4GVLA 4O44A 2GS8A 4K4VA 2HVZA 1EP4B 3UR0A 3OTOJ 1XC9A 3WX4A 3VAMA 4NXNF 4JV5J 5B0AA 3CIZA 2JZ5A 1WC4A 3CCVS 4DQRA 2AV5A 3MZIA 2B6AA 1ZZFA 2G0CA 2GVDB 4RNNA 3W8GA 2E66A 3M2UB 4DSFA 3V81B 2WTFA 2BACA 3PNIA 2AP6A 3HX9A 4FDFA 3T1HF 3PACA 2OJ3A 3W63A 1DQ8A 3PRVA 1UJ4A 3PVXA 2MDAA 1QJHA 5K14A 2CAJA 3HSJA 1NJZA 4DPUA 3BBBA 5EHHA 3OTBA 1UA0A 4ECSA 2KRRA 3UFCX 1ZAVA 3DLKB 9RUBA 2DNPA 4X64J 2J7UA 2VC1A 2VJUA 1N4LA 3H5XA 2LQ5A 3EZUA 3FKBA 1R0BG 4W98A 2AGOA 3OR2A 1RABB 3J7AN 3M2RA 4IH7A 2IVFB 4DV1J 1FNXH 1RAJA 1HW8A 1M5SA 4X4RA 1NM2A 3PYGA 5EX0A 3I31A 4DR7F 4WXWA 4Y6IA 1GXTA 1R0CB 2IJNA 1LV5A 1UVJA 1RK8A 4KY3A 3K57A 1AFIA 3HM9A 4RW4A 4C48A 4FF2A 4MIAA 3HPOA 4K4UA 2FLNA 1TVRB 4JI2F 3LGMA 2XCPA 2BANA 1RT3A 1GMWD 2J9DA 5B08A 3S7RA 2UUTA 1R89A 2VG5A 2CJAA 3HD2A 3R1HA 4JI5J 2D7SA 1RTJB 4IO1A 4ECVA 4I6WA 3RZAA 1KKHA 1FRLA 4K4SA 1HNVB 2YPZA 3TR5A 4OYWA 3M8RA 4DV5F 2KZZA 1U2CA 4PXDA 3M9MB 2QV6A 1S1TB 1J5OB 4C0OC 5I3PA 4N77A 2WVBA 2COLA 3UDEA 1Y7PA 2MGZA 3V6KA 3EMTA 2YH0A 1BQMA 4OI4A 4P6QA 2YNHA 4CDIA 3FUYA 2JLFA 4RNMA 4Y00A 1ZYQA 4PUOB 1RT6B 1S77D 1PILA 3PDNA 4X4VA 3BZQA 3CMQA 2LCWA 1T7PA 4ZVPB 3TUPA 1T9WA 4R8UB 2QLXA 4NYOA 4PWDB 3CJKB 1IBLF 3IA0A 2DB1A 3UE2A 5D4LA 1H72C 4GO7X 2X7IA 3R5DA 3M8QB 3UI3A 4DCPB 1RT5B 4C8LA 2IDEA 4RLEA 1CBKA 1QSYA 2OELA 2KO1A 3HK2A 3MAAB 4WWSA 5GAGI 2BQUA 2DNRA 1S1WA 1PO6A 4WBFA 1NKEA 1FRKA 5A6PA 3WIVA 1Q79A 1S6UA 1NHKL 3HVWA 3HJVA 4DV4J 2IMWP 3HVAA 4ZPBA 2DXDA 3MMCA 4I68A 3QAEA 3KHGA 4X84A 1NSQA 5KFSA 3MPUB 1VI7A 3MECA 2DNNA 4GVBB 2L41A 1S9EB 4K2JA 5IXUA 1NHUA 3MMBB 3ZTSA 2N3LA 2UZAA 1C4AA 2DNZA 3UDCA 3CT9A 1U0HB 2M7SA 3MCOA 9ATCB 3OUYB 3BPDA 3PIPQ 1JB0C 4EZ9A 2Y8YA 4K4XA 4NZ6A 2AKWB 2HFOA 2FC8A 1X4FA 3GIMA 2KHCA 4AD6A 3TW0A 5D4OA 4PZVA 4LFCF 1IKWB 3RW6A 5KFFA 1KVIA 3N5FA 2DH9A 3AB2B 2YKOA 2ZJPQ 2WVCA 1HWUA 1I94F 4ZCLA 5KFMA 3IP0A 2BMBA 2B9YA 4DR5J 1Y0HA 4ZPCA 2IC3A 3Q8VA 1HL6A 1NUEA 2B43A 3ZZZA 5KG5A 2RU3A 2AYMA 1H7XA 3AD7C 3VAFA 3I9ZA 3TA2A 2W1BA 2HHQA 2C3PA 4P2XA 4B02A 2AJ4A 5IQQA 3O5TB 5I42B 2VPZB 1FDBA 1QTNB 5HLFA 2XI2A 3C6TA 4H54A 4Y0FA 3E3XA 2KH9A 4KKOA 2W2PP 2UXCJ 3ILJA 3NCQA 2R2RA 1NH8A 4AYBD 1T8EA 4DL0C 1CG2A 2F3JA 3HHNB 1SL2A 1HBMA 3GU0A 3T5LA 4NCAA 4ZPDA 1OWXA 2B51A 2PA3A 5CCMA 4CO5A 1QE1B 1NAQA 1WSVA 4DSKA 4IFYB 3L7OA 3KJVB 2VIHA 2AGPA 1JKHB 3RBDA 2CQ3A 3ZTOA 4FVCA 3KLGB 1R3NA 4C8ZA 3KLHB 2P9GA 3E51A 1B70B 5LSLA 4KTQA 3UQSA 1RBOB 1B7YB 3RJMB 3E01A 1TFYA 2J6SA 3CCMS 5IM0B 1JIHA 2A6OA 1FI4A 4ECUA 4KFBA 2E9ZA 5DDPC 3GYGA 2E9TA 1T9YA 5KFVA 2PMWA 1P6TA 3DU5A 2D3O1 2BW7A 2Y1RI 5HBMA 2HIQA 3JS9A 3V6DA 2OFHX 2FJEB 1U7LA 4PYDA 2HHTA 3DOMA 2XMAA 2KM8C 1DTTA 7FD1A 2OHDA 4R5PA 1HMVB 4WFYA 1YZ7A 4B9NA 2DNGA 1L3KA 1VRTA 4J9QA 3CDEA 1KVJA 2IVYA 1R7IA 4M95A 3R27A 1HNXF 2AHOB 2VODA 4USTA 3PTWA 4RW9B 2FLLA 2FLOA 3BBFA 3MF5A 2CJBA 3PEHA 4E2FB 4C8NA 3D1OA 4PWUA 1QD1A 3K58A 3K2YA 2GO8A 3TVKA 4QOTA 4ZHRA 5G4DA 3KWMA 1APSA 3GFZA 4GKJJ 3P3DA 1RCOB 3DLGA 4ZCKA 2XQCA 3NCRA 3QZ7A 2FVQA 2OI2A 2MB0B 3D28A 1YJVA 3HCXA 1CJKA 4NLPA 1I51B 4DR6J 3I9V9 3B54A 2BV3A 4WU2A 4ZCIA 3KG4A 2E7WA 3FEZA 1SC1B 4U95A 4TLRA 3GJTB 1E6YB 4NL5A 1KBRA 3MAHA 3CCRS 2VBYA 3BGRB 3GJQB 4QIEA 1T05B 3O2IA 4NEYA 2ZBPA 5L1IA 1BGXT 1WJ9A 3MM8A 1GX6A 2R7SA 4RUCA 3MFHA 3P5TL 2K1RA 3LP1B 2NLWA 3CF5Q 5FDLA 1IKVA 3MR6A 1HR0J 2R2UA 3KLEB 2IA6A 2YH1A 1E6VB 4OHYA 4O0IA 3C14B 1YZ6A 4WZQA 3KG1A 1XTZA 2ZITA 1TUWA 5DDQC 2G2YA 4CT9A 2LQ8A 1YK9A 2UP1A 1NU4A 4X4UA 1RWUA 4IG0A 3BKFA 4MH8A 4WE1B 4DQSA 1S5ZA 3SYZA 1EETB 1X0FA 2HQFA 1RXOB 3TQEA 1W7WA 2P2CB 2VOPA 3T1YF 1VFJA 3JTPA 3TEHB 1T02A 4NLOA 4Z7YA 4WTYA 2OTLS 2JC1A 1RTDB 4CTAB 3N6NA 1UJ5A 1DLOA 3TEGA 1JJ4A 4P7TA 2OPPA 3KLIA 1IBMJ 1RTHA 4BWMA 2O3DA 3DDIA 3QMQA 3ZZ0A 2OMOA 1FD8A 2NXEA 1UEVA 3MM9B 1W26A 4P72A 3GG1A 2W9AA 4G65A 3D67A 2UUBJ 2F63A 2YKMA 1LWFA 3C16A 5KFLA 5L46A 4ZJOA 1C4CA 2DITA 2CNLB 3IO1A 4KB7A 2WB1D 3TVYA 2OTJS 4EUVA 2O67A 1KVKA 1LKZA 3OFFA 4LMZA 5E41A 1V6HA 4CT8A 2DHGA 3VTIA 4U6PA 4LRFA 4ZIVA 3OL9A 4F4XA 2PC6A 3SSQA 1S76D 3UVJA 2LQ9A 2JVRA 3W3SA 3CD5A 1V5VA 1GXUA 3MHYA 1FJGF 3D6FB 2JFDA 3DGPB 1S1UB 2Z58B 3HSDA 2QZ8A 3BH7B 2VBXA 2NPFA 2GFFA 2V69A 4ZVUB 2Y1IA 3EVOA 3H5SA 3B82A 4NLYA 4J9VA 5A2QU 2CIMA 2NYIA 4RKUC 5DLFA 3AJDA 4YB5A 4OQJA 3DLLQ 2BM0A 1MWZA 3A12A 3W5XA 2CWKA 5LOQA 2VQEJ 3UD3P 2FIUA 4ZN1A 1EQ0A 1HBUB 1SKRA 3N9UC 4URSA 5D6GA 1GQEA 4LF8F 3IRXB 3QFWA 1ZA1B 1FJ7A 2QMWA 2CJXB 4NLVA 4F04B 2B9WA 4M5IA 1T3OA 4DL2A 4OV1A 3TX8A 5B0DA 2GA7A 3ADAC 4DLGA 3DGVA 4DG1B 2CKWA 1CJTB 4YQWA 4K4YA 2GGPB 4WXOA 2CZ4A 4C3LA 3NP5A 3FMWA 3IBCB 2QYCA 4DR4J 4DV7J 2IRUA 3HVTB 2BE7D 3BN4A 1ZS6A 1VBKA 5A2QY 1CJVA 4KPCA 4D3GA 1Y11A 1FCAA 4HR2A 2KT5A 3G82A 1IKYB 4NMXA 4QPXA 3JSMA 2I38A 4BCAA 1UPMB 2KT3A 2DGUA 2HNZB 2EI5A 3HXMA 3SSRA 1UAWA 1YJ9S 3FQLA 4M5JA 4MTPA 3CNQP 1S59A 3MEGA 2LQJA 2HHPA 3WQPA 4A8YA 4ANEA 5GAHU 3AOCA 2OLWA 3LPYA 3FBFA 4FYXB 4B3TF 2B5JB 4M5GA 5D4NA 2YX1A 4ED1A 1DJ0A 2VPXB 3OD2A 2VKRA 2I6WA 2QLBB 1D1UA 2A18A 2FJDB 2LU2A 3GFYA 1H38A 4RW7B 4ZP8A 3ZTRA 1PBAA 3K8VA 4H4OA 1LW2B 2BE9B 4P73A 1N5YA 2XY6A 3T5KA 1UW9A 1D9AA 5LL6d 3LP2B 1KDNA 3MMJA 3NMRA 2HQGA 4OJ1A 1SH2A 4ECRA 3KLFB 3TANA 3M1VB 5C25B 5E2QA 2XWXA 2IJFA 1PGZA 4LSNA 2DGTA 2E44A 2BJDA 1Q0NA 3U02A 4DX7A 4YR3A 2GVZA 5B0GA 2Z2MA 4ZPTR 3CDWA 4JP8A 1PJ5A 2R8KA 1KOHA 3AFGA 5LXYA 3OW2R 2CQ4A 4LSLA 2HQIA 2AZ3A 3Q22A 1HBNB 1RHUB 4C11B 2P9CA 4OZ3A 3LANA 1X0PA 1NNDA 3OLAA 1MW7A 3I82A 1IBKF 3DYAA 5KFOA 1CS4B 4LF7J 2Z57B 4G6VB 4B3OB 3RG6A 3KUEA 1U2RA 3K0JA 3OXFA 3L95X 1G3OA 2JLGA 2Y8WA 2LQBA 2C42A 1YRUA 4N41A 1FEHA 5KAKA 2RDIA 2HPUA 1JLEA 2BDPA 2YNIB 4ZPAA 2OPRB 5KFBA 1S1VB 2VG7B 2N7YA 4B3SJ 5D3GB 2RMLA 3SCJE 5E7OB 4UY8T 3HDSA 1UA1A 5A0YB 1S1XA 3DLEA 1SPBP 3SQGA 3AQOA 3PYEA 3CJ5A 3SV3A 5IT0A 3PW7A 4K0KF 3GV7B 4ES2A 4N7TA 3V4IB 3AA8A 3MM6A 4B9VA 3QRPA 4QWDA 4I7FB 3CW2C 4MJKA 4OJHA 3MMAB 1RWVB 2PIIA 2JH3A 3M4XA 1F3VA 1VJQA 1EKSA 2FUG9 2ZJQQ 7FDRA 3FC9A 3GR1A 4X4SA 1A9NB 3MPWA 4J9MA 1CJUB 4OX8A 1ZTTA 4DI6A 1RTIB 2PFDA 1S0OA 5D0HA 1NEEA 2MKHA 2A0FB 1C0UB 4BC9A 4AT1B 2BJEA 4I1TA 4FZVA 4IG3B 1YRXA 5LJ3Y 3NAIA 3I0RA 4M5MA 3FBCA 5C7PA 3DOLB 3ISND 1EARA 3GPAA 4YDXA 5U47A 3OSNA 5IV4A 1UVMA 4G3IA 2FHKA 4O3PA 4OX9F 5LSOA 1UFWA 3GWCA 3IAM9 1TKZB 1BQXA 2ZJRQ 4DSLA 5THWA 2FZGB 4NZ0A 3KKFA 3NGTA 1HPZB 1BE4A 2XEXA 3J7YU 2ZH9A 4WYLA 2GJ2A 2DR5A 2BW2A 1YQHA 1H73A 2W7OA 3HF5A 3P49B 2X1BA 4XDCA 1S6PB 3GJSB 1F3FA 2B8QA 2VPYB 1VIXA 2QLWA 3AQPA 3VHQA 5CABA 3MEEB 2AYBA 2DY9A 1U26A 1Q81T 3OR1B 1VBXA 2VOOA 4RBUA 1RUSA 1VQYA 2YKQA 2ZUGA 1S6QA 1UEUA 1ZZNA 1UEKA 1MU2A 3ZXWA 1FXLA 1Q5VA 4OLPA 2QEXS 2OPSB 1X4GA 2ZE2B 4CM2A 2AT1B 2HFSA 2ZKUA 4DR1J 1V3SA 3Q83A 1N88A 3NEKA 4O3SA 2ZH8A 1RQ0A 2B4PA 2J6TA 4X4QA 2NCKL 4EI2A 1RAGB 4OYZA 2HAFA 3LP0B 3NGUA 1GAOA 1K1QA 3RB0A 3KMQA 2P5VA 4RWWA 1JLFB 1F2HA 5DO2A 1XJWB 1JX4A 2AYGA 4RUAA 5CCLA 3M6UA 3TA0A 1QUPA 4LRCA 2KRBA 3GB0A 2HMIA 1XNRJ 5D77A 2W9CA 1A7GE 1O5JA 2J5AA 4Q2LA 1TAQA 4F67A 2EXUA 5KFXA 2YNFB 2MSTA 3ZTPA 4G1QB 1B0PA 4LRDA 2H4WB 2ZH1A 4ICLB 2GHWA 2VZ9A 1U1NA 4NLQA 1R8CA 2NREA 3ILLA 1D9FA 5DG9A 5G0RA 1M1KT 1WI6A 4DEZA 2E1CA 2ALYB 2Y9HA 4Q0BB 4X2BA 4TY8A 2KYXA 2AU0A 1N5SA 1X60A 2L48A 3RBXA 5ETKA 4JI3J 2VA2A 1MSWD 4DFKA 4ZLNA 1Y9OA 4TQRA 5DDOC 4DSEA 4DSJA 5JUMA 1AT1B 2L9WA 3Q24A 4EYIB 3WIUA 3KK3B 4B3RJ 3FJ2A 2GW8A 4ED6A 2RS8A 5T7LB 2QSFA 5DGBA 1WF1A 1U6FA 4OI2A 1RHJB 2CPZA 1S12A 3ENAA 5ETMA 3HLUA 5LSRA 1WUUA 5J2PB 1WD6A 3FNNA 2UUCF 4NXMJ 2U1AA 3R5GA 4IFVA 2V2KA 3OL8A 1NZ8A 2DY1A 3CCTA 4CO4A 3CSKA 1MWYA 1FA0A 1JJ2R 4NYZA 5AJ3J 2GMJA 2IFXA 1O6XA 4O0NA 4C8YA 4M5DB 4OYOA 5KFYA 2QL9B 2CQGA 3DM2B 3GQCA 2XULA 3LW5C 4L3KA 1YDLA 1RWXB 5I3UB 4IDKA 2PN6A 2EW9A 2FHJA 1LWCA 1X5PA 2D9OA 2KXNB 4A47A 2CPXA 5HROA 2ZH3A 1CPZA 1TL1B 1MN7A 3DMJA 4P2FA 4WK3A 3LWLA 4GKKF 5CYQB 1OIAA 1O51A 1TTHB 1YTYA 2HSEB 2GQ2A 4PG7A 1VQMS 4RNHA 4KHPF 1KHVA 1K47A 5DG8A 2KL8A 3MEKA 4ZA1A 2R7XA 1Y3JA 5MLCV 4K59A 4DFMA 5KT5A 4M8LA 1F0XA 2E1AA 2QX0A 3T9ZA 1HNZF 3NNAA 4KQZA 3OVBA 3SXLA 4CO0A 1U1KA 4ZJLA 3MDFA 4JOUA 3IMQJ 4J9SA 3ILIA 2FJVA 1DRZA 2RE1A 2WONA 3P45B 5ETPA 1M1GA 2DYAA 4PRFA 3MTJA 2BZ2A 2L3MA 1TR0A 3K5NA 1CULA 4J9LA 2EFNA 3MM5A 2V67A 2ZM6J 2ZZTA 1X4CA 1Q86T 1U6ZA 3BSOA 2E5HA 1F1BB 1HKAA 3EGZA 3VAJA 5KT2A 3KOAA 2EK6A 4EO6A 3J81U 2PE8A 3AH6A 5LMUJ 1ZAXA 1A0OB 2OKQA 2Y0BB 4RR5A 3ITHB 4UUXA 4FKYA 1R8PA 4Y34A 2HEKA 2K3KA 2YKAA 2P8IA 1V3ZA 1XMQF 3AAWB 2RKIA 5KG2A 2BJ9A 1EAYC 2EC2A 4IR1A 4OHZA 4AFFA 3PR5B 2UUAF 2V2QA 1TK5A 4A8WA 4MKAA 1W2BR 1C1BB 2IBKA 1FK9B 1WHWA 3CD0A 4NOHA 1VISA 1TL3B 2DHAA 4HT7A 3HHDA 4HDHA 2W9BA 4OZLA 4UOCA 4USUA 4KC5A 3PYFA 4JI8J 5KT4A 2EC0A 1JK9B 1NKBA 3FGVA 4CLLA 5H1SV 3HD1A 2V8HA 2W2QP 4HI1A 4CLKA 1U1LA 2HHHJ 2NYHA 4E0DA 1SVDA 1SKUB 2CPIA 4PG8A 4O23A 3PX6A 4KIAA 3J81Y 5ETQA 5KFRA 4YB7A 3C3LA 4C7QA 4CLFA 4R0EA 2MTLA 4ED5A 3IGNA 1UWBA 5I4MA 2ALZA 1I5OB 3IXQA 3HO1A 4HTIA 2XSFA 4OYMA 4WFAQ 3OSPA 1RT7A 3OJSA 2V4QA 1L3VA 2E1PA 3M30B 4MIWA 1M90T 3A1YG 4LF9F 3VGVA 2K7KA 2ASYA 3QT5A 2AJ1A 1MLAA 4JI7J 1VC0A 4EBDA 3WX8A 4EWTA 1Q1KA 3PZPA 3OR2B 3G6VA 2XB2D 2ZH4A 2UU9F 4IO9Q 4HVZA 3G71S 2YPYA 2FVCA 3MR5A 1I1GA 2BRKA 3FSXA 2XO7A 2UXDF 3VAKA 3H0PA 2JEIA 1WOPA 4F4YA 1RT1B 5KFEA 2BE2B 2DR6A 5HP1A 3DDNA 3Q2SC 3R6GB 4ELUA 1IUJA 4RW4B 4DS5A 2VASA 3DRXA 3PM9A 3MR3A 5E3CA 4LSZB 1KEKA 2D41A 1K0VA 4EFAC 3C2PA 4DXLA 2VG5B 5CXTA 2F9JA 2ZH7A 3F73A 1EB0A 4R0JA 1RYRA 3T6BA 5CD4H 1RAIB 2HVIA 3TQ1A 1TL7A 4U9RA 4D3HA 3VGTA 2RRAA 4M63A 5DZ6A 1XIQA 2RDDA 4IUFA 1AA1B 3BSNA 4EYHB 1KFSA 1LNQA 1AFJA 3OFEA 2M52A 1U45A 2MKSA 2YNHB 3JTOA 3BPSP 4PXBA 2GIFA 2J9EA 3AJ1A 4IQXA 4OHVA 1Q8KA 3MI7X 4OHWA 1EP4A 3GIKA 2FDNA 1BLUA 2KU7A 1S99A 4UW2A 3W5ZA 4X66J 5D8HB 3CO9A 2DGSA 2RUSA 3QT6A 3ENQA 3TZZA 1AW0A 3MUTP 2DPIA 2Q66A 4Q5VA 5HQLA 3M2UA 5E3PA 2WK4A 4J5OA 4PYAA 2J0XA 4MK7A 3TVZA 1S1WB 1T95A 4ZVQB 1T11A 3TNVA 3DHWC 4HKQA 1U4BA 1RHQB 2VFTA 1HARA 2HAIA 2YWWA 4DR2J 4MFBA 1RYSA 2UVVA 2DCUB 4F3QA 3PO4A 5M2PA 4WJBA 3RRGA 4HHJA 3R2CJ 2LLZA 2HRUA 2CG4A 1JLGB 2E5IA 3DLKA 2KFZA 1RCXB 1SKSA 5IT4A 3MECB 1FVSA 5LM7E 3CDAA 4ZOSA 2HRYA 2B4VA 1FF2A 4DV0J 4UQGA 2YWGA 4JV2A 1FNMA 3MM7B 4F36A 1H2TZ 1FRMA 4FP9A 3O1LA 1L3UA 2HGLA 4PPZA 3QGPA 2XZWA 3L7PA 4CP5A 1KLMA 4FNIA 5AE3A 1U1QA 3BJYA 1QAXA 2YQ1A 4NLDA 3QYYA 3CEDA 2RQCA 2EBEA 2VDHA 4E8UA 4KV8B 4I0WA 4NPOA 1FRXA 2V8DA 1TVRA 6AT1B 1YRTA 1N8RT 4OX7A 2G2ZA 3MCNA 3OLBA 3KYLA 4QIWD 2DJWA 2CPHA 4NA2A 3CO0P 2N7CA 3T9NA 1RTJA 1OPZA 7AT1B 4NLSA 2CPDA 2X1GA 3OVAA 1HNVA 1KTVA 3ISNC 2RSQA 2IC3B 2GIRA 2VONA 5ETRA 3OL6A 1VCTA 1S1TA 4KT0C 4WIIA 1J5OA 1Y5LB 4NRUA 5KOXA 2FVSA 3GFHA 4B9UA 2D69A 2ZC4A 3M8SA 2XS7A 2VUGA 4I2PB 2FC9A 4ILRA 2NZ4A 5KG3A 1ZBTA 3C66A 4ID5A 4H4KC 4PUOA 5HLFB 4WKYA 4QBUA 3BO3A 5HO4A 2AWZA 3NBPA 3OTCA 5ETSA 1SI9A 3W2WB 1YI2S 3RRHA 3R97A 2N4CA 4AQYF 4P10A 4ZPVR 3CMES 2EPIA 4YB6A 3MCMA 5KFUA 4WYWA 3HKZD 4P2SA 2HS4A 2ATLA 4DLEA 2IHR1 2ILYA 4O3NA 1RT5A 1WACA 1RKJA 3TWZA 4NZ7A 1QSSA 4A8KA 1SB6A 1D9DA 3OT9A 3RBEA 1LEOA 5J2MB 1NXIA 2NUHA 4KO0A 3RYLA 3MPDA 3ISZA 4EU0A 3NKYA 2F1FA 3HSGA 1TK0A 5E0OA 3FRZA 3Q8PB 3NAHA 3HVRA 3E01B 1S72S 1LFPA 3JSYA 2JLEA 1D09B 2FTRA 4OZNA 4LVNP 1HWLA 5ETTA 4C98A 1I6JA 1OQ6A 3R8YA 4ATNA 4CZCA 5LMNJ 4LFBJ 4EO8A 1LXJA 3FEYB 3V4MA 5FJ4A 4QPTA 2QGFB 2CJKA 1F5CA 1FTCA 4FXVA 3M9OB 3LAMA 4ZKAA 3WDOA 5D15A 1TELA 5HJYA 2UVRA 2FLPA 4HYKA 4L3NA 1G2EA 1JJHA 3PW2A 4JI6F 3CCWA 4LVOP 2ZZNA 4QWEA 3R5AA 2MKCA 1VRTB 1QDUB 3G8SA 3D1QA 3ZZPA 3NNHA 2W4DA 4TU7A 3HHLD 1XBWA 1S7IA 5HATA 5DS7A 1S0VA 2BQ3A 4B9LA 2XMVA 4HACB 4JI4J 4ZP9A 2L08A 1K1SA 4ZHRB 2JEJA 2JNJA 1WEXA 4JV1A 3M7VA 3WHIA 2R7QA 3G87A 4YOEA 2KFYA 2CZVC 2RVJA 1GFWB 2XO6A 1GTEA 4CWBA 2C28A 6FDRA 3G8QA 1X4BA 3QT7A 1XMOJ 3FDSA 5I42A 5IWAF 2PO4A 3OFHA 3C6UA 3HT0A 1GX5A 2C3UA 2Y1JA 3A3OB 5GAEI 2WBRA 5F8HA 3GR0A 5CHCB 1V9OA 4DUZF 3PRDA 4B9MA 4AL5A 2HVHA 2NR0A 2GCFA 2YKNA 5A8RA 3OJUA 1OMSA 1WC1A 2QTWA 5FDLB 1KONA 1IKVB 4F2RA 4ECXA 1J5EJ 4BDPA 2DTJA 1WOSA 1JWWA 1DTQB 2HVDA 2FGCA 4IFYA 1G6BA 5KG0A 3M9NB 2J6UA 1X4AA 5BR8F 4CO3A 1VLOA 3KLHA 2VL1A 3L7UA 3MR7A 3Q0AA 4ZMMA 3DDKA 2FJBB 4WCEQ 1RWMB 3PKYA 5LXRA 3QIDA 3O6QA 1Z1ZA 2QA2A 1KTQA 2HS0A 2HGNA 3T3FA 2PDAA 2Y1LB 3BB5A 2MQ8A 1NJIT 3QPIA 2CWXA 1DLOB 3G8TA 1KC8T 2DRBA 2OPPB 3QGIA 1QVFR 3I56S 2DRDA 4Q8EA 1GTHA 1P9YA 1ZH5A 3TJ9A 2WSFC 1T9VA 4LFAJ 1VQSA 2ZHOA 3UNGC 2DKOB 3CD7A 2ZH5A 4TU9A 3RBZA 5DJBA 2CPEA 5F9NA 2F65A 3FBEA 2RU9A 5IC4B 2CDRB 3UCZP 2YKMB 2H48B 5KFWA 3VVTA 1LWFB 1T9XA 3C16B 2E1MC 3TZXA 2FZCB 2V4RA 1RSCA 1B7FA 3L9ZA 1N36J 2JEFA 1SJ4P 4USWA 1YITS 4JI1J 3VZHA 2GHVC 1JXVA 1NDPA 5A8WA 2RQMA 3Q8SB 3BGOP 1W25A 2VQFJ 2BKPA 4RW9A 5HMZA 3M8WA 3ZFVA 4I69A 3KK1A 3TAMA 2WZ1A 1N32J 4H4MA 2ZBIA 4CNYA 3MCSA 3EM1A 1YSJA 3EGNA 4ED3A 4IR9A 4P71A 3RB4A 1OY6A 2DR7A 1U02A 3ETMA 4Y2CA 2JOQA 1VLYA 2Q6CA 4K4ZA 4YN3B 2MZRA 2KXFA 4OI3A 2O01C 1E6YA 2FYXA 3DHXA 3AD8C 2Q3PA 1S6OA 1VGYA 1T03A 1N52B 1BD6A 2LVWA 2HZCA 2R7OA 2G9OA 2M3DA 3BGRA 3TZYA 2P9EA 2YTCA 2W2MP 1PAEX 3A8IA 2BX6A 3A8EA 2H3EB 2DISA 2HNDB 3VGUA 1HNWJ 3RR8A 3SCIE 3LP1A 1WHXA 4DOZA 2LEAA 3SDEA 1QLNA 1OPIA 4DZ6A 1HQEB 4LF6J 1E6VA 2BM1A 3HI9A 2WSEC 3T41A 2PSZA 2CZ9A 2MXYA 3KG0A 3V6HA 3S1TA 4Z37A 3DLHA 1UVIA 2C2EA 1SJ1A 4LF5J 3D0IE 1EETA 3SIPB 3LWMA 5E3QA 2J8SA 2YQ0A 3MFIA 4NCBA 2YNGA 2VG6A 4YY3F 4ES3A 3P5BP 1M0SA 3SFUA 1CJVB 2Z0GA 1CQMA 2IBOA 3QWUA 2RF2A 4CTAA 5SUHA 3JAMU 4DX6A 1UMJA 3TJ8A 1N0UA 2A2CA 1BQNB 3G82B 2MY7A 1VQ7S 1RZMA 2DHSA 4JYAJ 4ZK7M 3WBZA 5GADI 1XERA 2R7VA 3I96A 1NB2A 3MEGB 4QWBA 5CH7B 3R3TA 4NYPA 2YVSA 2F9DA 3OFGA 2DNYA 4C2MA 1KQSR 3T19A 4IOCQ 3CJ2A 3ICLA 2JL9A 2HFNA 1J27A 2XMWA 5KG6A 3S8SA 2CADA 2GAHC 1RHMB 2MZTA 2KHDA 4L72B 1TZ0A 3POTA 3VF0B 5GAGU 4X62F 1N5YB 4DFPA 2XMKA 4DR3J 5DETA 2DCLA 3VGSA 3DRSA 4M5LA 2RRBA 4EEYA 1X5OA 3QQCD 4TXSA 2AJQA 3JAMY 5F3TA 4LBHA 1EZZB 3L3CA 4O4GB 5KT7A 3EGVA 3DGPA 1S1UA 4LSNB 2VPWB 3BQ0A 2RQ4A 2HS3A 1TV6A 1WC0A 3UDLA 5CYJA 3EZ5A 3N6LA 1B0TA 1TL5A 1VRQC 4RJVA 3M6XA 5HJXA 4DUTA 5ETVA 3OQ2A 2R9LA 1IR2A 2GHPA 3RAXA 1NK0A 3LGHA 4WU3A 2ZVIA 2V34A 3DYAB 4M1KA 3UNYA 1C2PA 4QU7A 4UOHA 4P2MA 3OXGA 3GP9A 3H5UA 3HULA 2QIFA 1S9GB 1V5IB 2OSRA 1VDHA 4MKYA 2ZDOA 1WWHA 2HWTA 2UVUA 2ZZMA 1JLEB 5D4PA 2KG0A 1C1CA 3JXOA 2KZMA 1UETA 3IFEA 1IKXB 3TA1A 1CJTA 2W7PA 1N54B 3IAS9 4YHHF 1S1XB 4DHVA 1B0VA 3SQGB 1CC8A 3HVTA 4FYDA 4DL5A 2V50A 3GIRA 2ASJA 4RPFA 3MXHP 2B0GA 4DUYJ 4X65J 2VH7A 2F4VJ 3NG8A 3VAGA 4UQTA 1U1PA 1GMVA 1YBTA 3MM6B 3MEDB 2EG2A 3K59A 2NXNA 4ED8A 4LR9A 1IKYA 2IM2A 1UVKA 5J1EB 3R5JB 1ULRA 1OY9A 3EVMA 2HNZA 2IDLA 3NGDA 2UXBF 4S0MA 3RB3A 1PCAA 4EBEA 1JLQB 2YY3A 2G2OA 4DL4A 1FDNA 4QIFA 5EWFA 4JI0F 1ZPWX 2GNKA 4LF4J 3QJLA 3D68A 2HHWA 2J0WA 1H3DA 4QWAA 3OTOF 3M2VB 2ABYA 2JDJA 3QFHA 3I0RB 2JWNA 1IWGA 4WP3A 1LW2A 4JV5F 2RS2A 1TMMA 2VD3A 1R8HA 4F2SA 2EWHA 2QE5A 1N34J 2Q79A 1NBEB 1BY9A 1N33J 3TAPA 3I6PA 1M5OC 3AODA 5DQGA 3ENVA 1TP7A 2GQQA 5SZTA 2JRSA 1MMNA 3BDPA 4ED2A 2GO9A 3QAUA 5CAAA 3M1VA 3EE3A 2MHNA 2ADCA 2Z2YB 3CB4A 2E5LJ 4IH5A 3F44A 1SBRA 3AD9C 3UD5A 2O1PA 1RLCL 4WFBQ 3GYNA 4NLGA 3SSSA 4ER8A 4KYZA 3IBWA 2Q43A 1RWKB 2MZSA 1R6VA 3PFOA 1PG5B 2LXIA 2MY8A 1HBNA 4X64F 4CO1A 4C11A 1BUXA 4F0KA 2CJQA 3BKUA 5C2GA 1DQ9A 1CS4A 2EKYA 3D4JA 5KFJA 4B3OA 3NOCA 2W4PA 2IY5B 2KYZA 2OEJA 4DV1F 4X4OA 1MU2B 4CH0S 2I2YA 5H9FJ 2AF6A 4USKA 2YX4A 2RH3A 2CNOB 2R2TA 2ZH6A 4DN9A 2F7VA 1HNIA 2OPRA 2A2DA 3BREA 1RWOB 3RB6A 2VG7A 1YJ7A 4ED4A 4B3MJ 3MR2A 5D3GA 4WPAA 4RW6B 3NGRA 4RO0A 1ZM9A 5A0YA 1KN6A 2ZFHA 1VQ8S 3MOZA 5FLXU 2XHCA 3THVA 1F9EB 4JI5F 2F8HA 3V4IA 3PRBA 4PAAA 2V4JA 3B4DA 2B8PA 4YDDB 3R7SB 4I7FA 3MPVA 3PW0A 2HMIB 2VFUA 2WOMB 4IRKA 4AE5A 5KT6A 5AXMA 4DV6J 3P6YC 2XS5A 5KOWA 3BO4A 1SC4B 2AIRB 1VQ5S 2JJ4D 4KHRA 3US5A 3VQSA 4NLXA 4PABA 1IR1A 4LUBA 1RTIA 2LEPA 1VK8A 3D66A 1HWJA 2OD4A 4DL3A 3AA9A 2FZKB 5L1KA 1IM4A 1WC6A 4EZ6A 4TY8B 1OJ4A 1VBYA 3KHRA 1XNQJ 3ETOA 3IS9B 3DOLA 1WDTA 4L74A 5HQ8A 2AZ1A 4Y2MA 1HI8A 1KS2A 3HHLC 1DBDA 2WW4A 2I8EA 2DEJA 3CC4S 5FLXY 4ELTA 2CQHA 2ZD1B 1OS5A 4J9PA 2R2SA 5DG7A 2AD9A 4PWWA 2GZOA 5EX3A 2XZTB 3PIOQ 4QYRA 4B9TA 1S4EA 3K89A 4IOAQ 2RD5C 4HH1A 3SFGA 3AT1B 1U24A 3I87A 2EEYA 2A1BA 1H7WA 3LF0A 2VKZG 4IYQA 3I5CA 4DPXA 2DH8A 4DV4F 2BA9A 1S6PA 4DF4A 2VV5A 5A8KA 4DF8A 4MT1A 4XPCA 2RJZA 1JNZB 1VC5A 1TAUA 4MYUA 2BBEA 4DL6A 2UV8G 4P74A 1IBCB 4FXDA 1K44A 3VR1A 3EUNA 3G86A 5HL7Q 4NRTA 2JSXA 3MEEA 1FNOA 3DXSX 2GQCA 3IR7B 2MQNA 2IRYA 3EDRB 4NLTA 3N79A 3JYTB 2G0JA 3GIJA 4IDKB 1H74A 1URNA 3H59A 4DV3J 1FFWB 2ROGA 1LWCB 4HDGA 4UTGA 1YBUA 2ZE2A 2DH7A 5HROB 4LR8A 4MAKA 4KR0B 3DNCA 5L9NA 3IWXA 4LBIA 1Q4RA 4AUKA 3TI0A 1RAFB 1NO8A 2EFVA 4ETXA 3Q23A 4U8YA 1O8BA 3TAQA 2KJWA 2XLJA 4QJVA 3UR3C 3W60A 1JLFA 1GMWA 5J2QA 2HURA 2C2OB 2QA4S 4YS2A 4DR5F 1U0SA 3QSIA 2EVZA 2QL5B 3MTKA 2YNFA 4A8QA 4G1QA 2DPJA 1Q82T 4ICLA 2OSQA 4J37A 4NX9A 3MM5B 2ACMA 4BHQA 2MLYA 4ZDNA 3UN5A 3CXCR 4CYUB 2RILA 4J9RA 4C0BA 3T1HJ 2UXCF 3CTRA 4DPWA 3FCHA 2C2DA 4F50A 4ZITA 1Y3KA 3KMSA 2DK2A 2HKEA 1NK7A 1S9FA 3DRRA 4LRAA 4NE9C 3CJRA 2AJFE 2MPUA 1DFDA 1SJQA 2SXLA 3GSIA 4A8XA 4GC6A 1EQMA 1YJUA 2C2ZB 4RBTA 2RKIB 1SUQA 4MK9A 3DLJA 4FBTA 4FPIA 1H0HB 2XSJA 2XYHB 5A76A 1SKWA 3M05A 4PG4A 2Z8QA 3D7SB 5AXNA 5K9FA 1HFEL 2H65B 2F8EX 4YEAA 2W9BB 1OYEA 5J2PA 4PKDB 4ZVTB 1NSAA 3SMZA 3M32A 1Q7YT 2HNYB 3FBBA 4IKAA 1WG5A 5IOLA 4BC7A 3Q8RB 3ZZRA 4FF3A 5KFCA 4DR7J 4G1IA 2R7RA 1NK5A 4C0HA 5KG1A 2MYFA 2VF3A 4M5DA 1OYDA 1VBZA 2V2VA 3T6JA 3M8PA 2CPJA 4OMFG 1JLCB 3KHLA 2HK2A 5K8PA 2DRAA 5KG7A 1NSPA 3SV4A 2F8MA 2YXLA 5I3UA 4JI2J 2KN4A 1NLKL 3ULHA 3LPEA 1UWBB 4QR2A 2DR9A 4ZVHA 3UCUP 5KFIA 3I4PA 2CVEA 4NI2B 4DX8H 1UKUA 4OYXA 1SV5B 1TL1A 3GILA 1RT7B 5HMXA 4HHUA 2KTQA 4HEA9 3UN2A 1RISA 4DV5J 3RW7A 1N48A 4OV6A 1WTBA 4UF4A 2MKIA 1F5AA 4ZVGA 3O44A 1PYOB 3N4WA 1YKWA 2ADBA 1FWKA 1F9HA 3GFXA 1L3TA 3U27A 4A48A 4IRDA 4LR7A 3HHLB 3DRPA 2ILZA 4ZIWA 1J2VA 3W8PA 4FYYB 1NRKA 4GKJF 1HLWA 3MWBA 4OYAA 4K50A 2YWFA 1ZM3A 4FS2A 3PX4A 1IBLJ 2GIQA 4DR6F 2R42A 5HP1B 1ACMB 1JLAB 4UY85 3A3PB 8ATCB 5K8MA 4P75A 1AZSB 3QIPA 3N6MA 3QJJA 3G9CA 3S6EA 5AXKA 2VA3A 2FD2A 4DV2J 1TMJA 1YWXA 2EFGA 4ETZA 3SBMA 4MMOA 1MWQA 3BSAA 2DNOA 1WSRA 3W7BA 3BBCA 2OMLA 1TK8A 1VQKS 4W4MA 2HIYA 2M5YA 3D5MA 1XN9A 1GNKA 3ZTQA 1VQNS 3ITHA 1QY7A 1WEYA 2DEIA 1HR0F 2J0SD 2VBZA 2WSCC 3R5BA 5C24A 1U6BA 3NOGA 4UOGA 2YWEA 2EKNA 3ET6B 1C1BA 5LJ5Y 1SCJB 4CO2A 1TL3A 1FRJA 1U49A 2MKYA 3FQKA 1U09A 2A10A 1TKTA 3E2EA 5ETNA 5K8OA 2C3MA 1FO1A 1NDCA 1URRA 2DBBA 1ZOTA 5J1PA 2A6MA 1MROA 1BHNA 3CCJS 1LK7A 3C15B 4NCGA 3DCAA 2DGQA 1S57A 4PXCA 2FY8A 2DHXA 1VC6A 1X7VA 4ILLA 1HBOB 2Z2ZA 1IBMF 3H42A 4Y28C 2JHEA 1UZDA 1HD0A 2R8HA 2N82B 2UV8A 4LFCJ 3Q8QB 4ALZA 3PHEA 3W64A 3TZWA 1WKJA 2ZDPA 2WCXA 4DPOA 1I94J 3LOUA 2W25A 3M8YA 2NUUG 4MFBB 5KFPA 2RDJA 2UUBF 4HI2A 2EK1A 5DGAA 4FS1A 2OO4A 3M30A 4JV0A 3DU6A 1T3NA 3EZOA 1RE1B 1WDDA 1B3TA 1UL3A 1T0TV 2KJVA 5BYQA 4USHA 1NPKA 3OHBA 4E98A 1M5PC 2Q6BA 2CQBA 1NSKL 5AE1A 3CGIA 3UD4P 3BGLA 5IV3A 2DXFA 5FD1A 4K5RA 2UVWA 4OZ1A 2BABA 4XK8C 2H5IB 4KGZB 1S48A 2BEFA 2JVOA 1VQLS 3I5BA 1KLMB 2XNRA 2LDIA 1FXDA 1BC6A 2PD1A 1RT1A 4YMEA 2BVZA 2BE2A 1U25A 1QAIA 1IQZA 2V0NA 1KQKA 3LGNA 5EWEA 4PPDA 2MKKA 5RUBA 4RNFA 4FXWA 3LAKA 2ACYA 2QMXA 1CEZA 4N8NA 4Z7CA 3H40A 1NCLA 2CQIA 2B3TB 4O3RA 8AT1B 3AOAA 3FFIB 3PEJA 2VQEF 2MSSA 2F40A 2BOPA 1GK8A 3IGVA 1M5KC 3I0SB 3N28A 1RT4A 3QRQA 3HZEA 3OBIA 2ASDA 1X4DA 1N0VC 5H9EK 2QN6B 3D2WA 4HHHA 1RA6A 3ENWA 2MQQA 1NK6A 3D0HE 2CJ9A 4JBCA 4F4ZA 1X31C 1SC3B 1HYSA 4KH1B 3CCZA 3N01A 2PEBA 4ID5B 4P9SA 1G4CA 2CG8A 3ILOA 4F3OA 1VJWA 3NBPB 2V68A 3FSYA 5CQGA 3GCWP 2QT7A 2HHVA 3VALA 3QATA 4DR4F 1KNZA 1KP6A 4DV7F 5EDWA 3EVWA 2M88A 3EWGA 1CC7A 1KR4A 1RI7A 5J2NA 4O3OA 5HI7A 1Z2ZA 1S4FA 1JLBB 1Q5YA 3IG1A 4N47A 4DV2F 2DVIA 3LQVA 3ZO7A 2CQDA 4F0HA 1XR6A 2LECA 1AB8A 2ZUAA 4OJ3A 4BLGA 2WVFA 1FHTA 4KO0B 5DRKA 1HNXJ 3BQ1A 4FN5A 4IRCA 3KK2B 2AQ4A 3CJSA 3EICA 1S7HA 3QRRA 1F2GA 3KUHA 5KTQA 5HVGA 3CMAS 1FKOB 2VFRA 3W2VB 2AJ2A 2FY1A 2OH2A 1RT2A 1JLGA 2DIVA 1HQUA 3VVUA 5HQMA 3FSIA 1SJ3P 1X9SA 1RDRA 4KSEB 3MM7A 5JMNA 4FYVB 4OFZA 2DNHA 5BYSA 2EBGA 1RWPB 2RHQB 3IWLA 2V94A 4B08A 3SI8A 4LT6A 1F5BA 2LDYA 5GMKa 1SJFA 1UZHA 5C2CA 2OPQA 4CLYA 4KV8A 2LMIA 4M5NA 1DY3A 2CQCA 1N5QA 2GJIA 4RUBA 2D1CA 1XQIA 2F5GA 1VR6A 4F3MA 3CJQA 5IFMA 1A6LA 1PJ6A 2D3ZA 1W2IA 5HANA 4DL7A 5E5NA 1TKXA 1NJYA 4LF7F 4XTTA 1FKAF 1TL4A 4DN0A 4OZJA 1PC5A 3BV8A 3G6XA 4ECYA 5BXIA 5HVHA 3T1YJ 2PMZD 3T5HA 3H20A 4I2PA 2KFNA 2M8HA 1NK4A 3QWPA 4RZRA 2U2FA 2UUWA 4B3SF 3C6UB 3QO9A 3HFKA 2KDOA 4DX5A 2P6TA 2PGCA 5KFZA 1M5VC 3W2WA 3KFWX 2M2BA 3ZZUA 2YKNB 5A8RB 4U67Q 4ZLJA 2IAJA 2K8GA 4YB1P 1HHQA 4USIA 2W2NP 4YUDA 1N6QA 2R8IA 1UCNA 2DNKA 1SH0A 2IYGA 3PCOB 2OFGX 3AY0A 4KJIA 2ZC3A 5J2MA 5F8NA 3NWRA 2Y3YA 3KUGA 4L75A 4RW8B 5KFDA 4DSIA 4QYZK 3LO3A 5HVFA 2ZOMA 4CH7A 2V5HG 3CCSS 3AJ2A 3D3CJ 3Q2TC 2Z56B 2XWYA 1ZPVA 2JFKA 2CVIA 5CD4A 3EPGA 4NLWA 5B09A 4ZVOB 4Q43A 1Q16B 3ONQA 3J80U 3B6BA 3QLHB 1FJGJ 2DGWA 1VRUA 2E1RA 3QT8A 1Y00A 4J9KA 4PQUA 3KJFB 5DM6Q 3HFZB 4FNHA 1TUVA 1DAXA 3H2UB 2LYVA 2FB0A 5GMDA 4IH6A 4ZLPA 5C42B 1FDDA 3R5CA 4FBUA 5DQIA 3J7Z5 5CA5A 3W61A 2HQDA 5F8JA 3GYXB 4LF8J 2JEGA 4X4TA 3NGSA 6FD1A 4P7VA 4KGXB 5A8WB 2C3YA 4DQQA 2V8GA 1EIYB 2KT2A 3VAIA 4CRJA 4LQ9A 3HHEA 2VB6A 4HACA 3PX0A 3J80Y 3KK1B 3TAMB 4ZVFA 4H4MB 3PFEA 3CUNA 3PJXA 2Z4PA 1FT8A 2XI3A 2HBZB 4GMKA 3CJ3A 4Q8FA 2XMJA 5L1JA 4WFXA 2PFFB 2RIJA 3BR9A 1KLNA 2W8LA 2XY7A 2IVMA 3MD3A 4WP8A 1FXRA 3H2VE 2VICA 4MKVA 3QGGA 3BO2A 1L3SA 1D8ZA 3EJMA 4DR1F 4ZCMA 4WTOB 2E5GA 4LQ3A 4UOFA 4A8MP 1NHVA 4WF9Q 1T03B 4RNOA 3BYPA 1R0AB 1G7CB 1REVB 4ZS6A 3H90A 1LW0B 4QZVB 3DOKA 4HLBA 1Q8IA 1YIJS 3QZ8A 1HIYA 2ZEJA 1DQAA 1BMQB 2EFOA 2IA0A 3GONA 1U1RA 3SDEB 2DXEA 4O44B 4N76A 4B3TJ 2ZBQA 4LRBA 3DLBA 1XNRF 2BQRA 1L5UA 1DTQA 1DURA 2I5JA 1LFWA 3F56A 2IMOA 4U8VA 3NMAA 4P52A 4O3QA 3S01A 2HBYB 2QMUB 3K7RA 1YLXA 2B6AB 3Q8YA 2V8VA 4X4PA 3PY8A 4RU2A 3HZGA 1VYAA 2BKNA 3VWSA 1QUVA 1AUDA 3SEOA 2YNGB 5CYMA 2VG6B 1HA1A 3BEGB 1ZETA 4JI3F 2AX1A 2CYYA 2LA4A 3BF4A 2AYEA 2RF2B 3U1LA 3OTDA 5D0RA 5K14B 2NXCA 3J7ZT 1Y5IB 1FX4A 2WHOA 4B3RF 4I2QA 1FERA 3DC2A 3KHHA 1CVJA 2B56A 2HWHA 1U1MA 3NNCA 2M9KA 4CQ1A 1NH7A 2OEKA 4OZ5A 1C0TA 3BSCA 3W1YC 1PBUA 3EDQB 1JQGA 2GC8A 3I5AA 4PG5A 4K4TA 1FKPA 2VDIA 1IBKJ 3C19A 1KSPA 3QGHA 2KB2A 4H4KA 1WG1A 2DT9A 3TRGA 2K2PA 4CLUA 1WORA 3M2RB 4NXMF 1BWVA 3OVSA 2OD6A 4C8MA 1SL0A 3JQKA 4ECWA 3DI6A 1HWKA 1TU0B 4PXEA 3POTB 3BGUA 1SJRA 3HFVA 5GMEA 5L8RC 2MLXA 2VHGA 2PT0A 5AJ3F 4CM0A 1LWEA 3DRSB 4ECTA 4ENOA 2APOA 1RBLA 1S79A 5KT3A 1V3RA 5D0GA 2K3IA 4QIGA 2X1FA 2BANB 1RT3B 2CA9A 4K0KJ 2L9NA 2NXJA 4OI6A 3ZZTA 2PMHA 4NA3A 4DQPA 2XS2A 4W92B 4DCJB 1SL1A 1TV6B 3KTQA 3KJQB 5F9LA 4J90A 2D9PA 3UDVA 4EBCA 2MGZB 1BQMB 2HNDA 5M2UA 1LK5A 3F0NA 2ZHAA 3P8BB 1CLFA 1IN0A 4DU8A 3W62A 5H9EJ 4M94A 3D3BJ 5LT5A 2PEHA 3P96A 1HQEA 2ZVSA 4K4WA 3H25A 5KFNA 1RACB 1ROFA 1C1CB 2ATCB 2KM8B 1NK9A 1VIOA 2QFIA 2KKHA 1KWMA 3RU0A 4WZMA 3JB9k 4OX9J 2GVDA 1ZTWA 2AX0A 2J8AA 2ZM6F 5GVQA 3V81A 1QVGR 1FJEB 2IM1A 3U1NA 3GE9A 4A4JA 2R7WA 4ZVSB 2M8DB 1U2FA 2E9RX 2F4FA 1NMEB 5LMUF 2B9XA 2MLZA 2GJFA 1BQNA 2HQ3A 2GAGC 5EGYA 1WOOA 2WW8A 3CULA 1WTFA 2GMHA 3MMCB 5F8LA 4WFNQ 1SXLA 3E8OA 2QA4G 1DZ5A 2J0QD 2IRXA 3FVYA 2W4CA 4U7UK 2R7TA 1WEZA 1D0EA 4Q2MA 1Q53A 1B64A 3IM9A 1HWIA 1IR0A 1JJCB 2ZNZA 5KFTA 3SCKE 5JVGQ 2H1YA 5IC6B 1GT8A 4WIQA 1GH8A 2FHJD 4Z2XA 3LA0A 1ZA2B 5KFKA 4JI8F 1NB7A 1M1HA 4KBIA 2EFPA 2IJRA 3LUYA 2KI2A 1FFSB 2HHHF 2CXEA 3SZ2A 5F0WA 1XR5A 1FE4A 4N8OA 3TUZC 5F8GA 4KGKA 3LH2S 1HI1A 1UFKA 2H5JB 1EX8A 1H98A 1WKKA 3BH6B 5B0CA 4O4GA 2LP4A 3KDOA 2FJWA 1AUSL 1P1TA 3AB4B 3NS6A 4DBQA 5B0EA 1OQ3A 2CQ2A 2AEMA 4OYBA 1UVLA 3LTOA 3EGWB 2L9DA 4ZP6A 3HMJG 1U8WA 1R8BA 4CCHA 2PA8D 5IQ6A 3R9LA 1YGYA 3GCXP 2X51A 4JI7F 4I67A 3BKTA 1JXEA 2XTJP 2CRLA 1Q78A 1S49A 2CQPA 3MGJA 1S9GA 3R2DJ 1RT6A 3C6TB 1N5VA
chains in the Genus database with same CATH topology
3PIOQ 4QYRA 1P8GA 4KKOB 1NJZA 4B9TA 1KQFB 4IOAQ 2RD5C 5EHHA 4HH1A 4R8UA 4J9LA 2EFNA 3MM5A 3SFGA 1HD1A 5K5MA 3OTBA 1U24A 3UCGA 1UA0A 4ECSA 2KRRA 3I87A 3UFCX 1ZAVA 3DLKB 5I3QA 2A1BA 2RRNA 4PWDA 4A46A 3CJKA 1X4CA 1Q86T 1H7WA 1HNIB 1U6ZA 3BSOA 2E5HA 2DNPA 3LF0A 2J7UA 2VKZG 2VC1A 4IYQA 5GAHI 1SIZA 3I5CA 1N4LA 1LXNA 2DH8A 1IKXA 1HBMB 2DNQA 4DV4F 3RR7A 2BA9A 1S6PA 4DF4A 3H5XA 2LQ5A 2VV5A 3EGZA 3EZUA 3VAJA 5A8KA 5KT2A 5AE2A 4DF8A 3M8QA 3PW4A 3KOAA 2EK6A 4ES1A 3NGKA 4EO6A 4XPCA 2RJZA 5K8NA 1JNZB 1VC5A 1TAUA 4MYUA 4C3KA 2AGOA 2PE8A 2BBEA 3AH6A 4DL6A 2UV8G 3OR2A 2I1RA 4OLOA 3M2RA 4FXDA 1ZAXA 3D0GE 3VR1A 3EUNA 2OKQA 4IH7A 3G86A 5HL7Q 3HKWA 4NRTA 2JSXA 3ITHB 2IVFB 4UUXA 3MEEA 5F8IA 1FNXH 1FNOA 3DXSX 1RAJA 1R8PA 1HW8A 2GQCA 4Y34A 1M5SA 2K3KA 4X4RA 3IR7B 2MQNA 5EX0A 3I31A 2ZHBA 2IRYA 2YKAA 2V4JB 5L1LA 4WXWA 4DR7F 5T14A 1V3ZA 3MEDA 4NLTA 1GXTA 4Y6IA 1XMQF 3AAWB 1P1LA 2RKIA 3N79A 5KG2A 1OO0B 2W24A 3H98A 3JYTB 2IJNA 4IR1A 1LV5A 1UVJA 4OHZA 1RK8A 4TYBA 4AFFA 3PR5B 3GIJA 3K57A 4IDKB 5DM7Q 2UUAF 5J1EA 1AFIA 1URNA 3H59A 4U7CA 1TK5A 4A8WA 4MKAA 2ROGA 1LWCB 4HDGA 5GAEU 3HM9A 1W2BR 1C1BB 3GMGA 4RW4A 2IBKA 4FF2A 4MIAA 3HPOA 1FK9B 1WHWA 3CD0A 2ZE2A 3TYTA 4NOHA 2DH7A 4K4UA 1JLQA 5HROB 2FLNA 1TL3B 2DHAA 1TVRB 4HT7A 4KFBB 4JI2F 3HHDA 1NJWA 4QYZJ 3LGMA 4MAKA 2H5EA 2XCPA 2BANA 4KR0B 3TUJC 1RT3A 4HDHA 1S9EA 2W9BA 4OZLA 2J9DA 3DNCA 4UOCA 5B08A 5L9NA 3IWXA 3S7RA 1Q4RA 4KC5A 4AUKA 3TI0A 2MZQA 2UUTA 5KT4A 5KG4A 1R89A 2EC0A 3MMBA 1JK9B 2VG5A 2CJAA 3R1HA 4Y2IA 1NKBA 3IR6B 3FGVA 1NO8A 1RTJB 2D7SA 4ID8A 4IO1A 5H1SV 3GV5B 4N56A 2V8HA 3CCLS 4ECVA 4I6WA 2EFVA 1T94A 4ETXA 3Q23A 4HI1A 3RZAA 1O8BA 4Y65A 1U1LA 1FRLA 2QA1A 3TAQA 3M2VA 4K4SA 1HNVB 2KJWA 4E0DA 2G13A 3OUYA 3N5BA 2XLJA 5HBMB 2B7CB 3TR5A 4NWBA 4QJVA 3M8RA 4DV5F 2KZZA 4ECZA 2CPIA 4PG8A 3V6DB 4X66F 3UR3C 1JLFA 4PXDA 4O23A 2QV6A 3M9MB 1S1TB 5J2QA 1F9FA 4KIAA 3J81Y 3PX6A 3CDBA 1J5OB 4Q44A 1KD1T 4C0OC 5T41A 5KFRA 2QA4S 5I3PA 4N77A 4YB7A 3C3LA 4DR5F 2COLA 1Y7PA 4C7QA 1QAJA 4C8OA 4R0EA 2MGZA 4ED5A 3IGNA 5E33A 3V6KA 2YH0A 1DTTB 1BQMA 2NPIA 4OI4A 4P6QA 2YNHA 2EVZA 3MTKA 4R5PB 1UWBA 4BS2A 5I4MA 2ALZA 2JLFA 4RNMA 2YNFA 3IXQA 3K5OA 4Y00A 4A8QA 1LQ9A 1ZYQA 3HO1A 4HTIA 2XSFA 4G1QA 2DPJA 4PUOB 1Q82T 4XDDA 1RT6B 4ICLA 1S77D 2QFJA 4WFAQ 3OSPA 1PILA 2OSQA 3PDNA 4X4VA 3BZQA 2XLIA 4J37A 4NX9A 3MD1A 1IKWA 1RT7A 2LCWA 2N4DA 3OJSA 2V4QA 1T7PA 4R8UB 5KFQA 4USJC 3MM5B 1L3VA 3M30B 4MIWA 4BHQA 2QLXA 4NA1A 4ZDNA 1M90T 3A1YG 4LF9F 4NYOA 2IM0A 4DR2F 2XMMA 4PWDB 3CXCR 2K7KA 3CJKB 2RILA 1U8SA 2ASYA 4J9RA 1IBLF 1KHWA 2AJ1A 4C0BA 3IA0A 2DB1A 3UE2A 5D4LA 2UXCF 3CTRA 1VC0A 1WG4A 4GO7X 2LXUA 5A8KB 3FCHA 2NQPA 4EBDA 3BGFA 3R5DA 3M8QB 4EWTA 3UI3A 1Q1KA 1RT5B 4C8LA 2C2DA 2DGOA 2HHSA 4RLEA 4F50A 3PZPA 2ZKTA 3DLGB 1Y3KA 3KMSA 5HMYA 2DK2A 3OR2B 3G6VA 1QSYA 2XB2D 2KO1A 1NK7A 1S9FA 2ZH4A 2UU9F 3DRRA 3HK2A 3H4BA 2G4BA 1JMTA 2DO0A 4IO9Q 4HVZA 2AJFE 5GAGI 3G71S 2BQUA 2DNRA 2FVCA 1S1WA 3MR5A 2MPUA 4AXIA 1DFDA 4DV0F 1I1GA 1PO6A 1SJQA 2SXLA 4A8XA 2BRKA 4GC6A 1NKEA 3FSXA 1FRKA 1KQGB 1YJUA 4RBTA 2XO7A 2RKIB 5A6PA 2UXDF 4B9SA 3VAKA 1Q79A 1S6UA 1SUQA 2JEIA 3HVWA 4MK9A 1RT1B 4F4YA 3DLJA 5KFEA 4FBTA 2BE2B 4AXJA 3HVAA 2IMWP 4ZPBA 5HP1A 3DDNA 3Q2SC 3MMCA 4I68A 4ELUA 1H0HB 2XSJA 1IUJA 4RW4B 1TFWA 4DS5A 1X4EA 3QAEA 1SKWA 2VASA 3RRKA 3DRXA 1FTRA 1NJXA 3PM9A 3KHGA 3M05A 4PG4A 4X84A 3MR3A 5E3CA 2Z8QA 5KFSA 1KEKA 4OJGA 5AXNA 5K9FA 1VI7A 1HFEL 3MECA 2F8EX 2DNNA 3WZ0A 2D41A 2L41A 1S9EB 3MM8B 4YEAA 2W9BB 1K0VA 5BJRA 1Z4UA 5J2PA 4PKDB 4EFAC 3C2PA 4PQAA 5IXUA 1NHUA 2K1RB 3MMBB 4RW6A 2VG5B 3HT3A 3SMZA 4JUZA 5CXTA 1IJFB 3M32A 4OI1A 2F9JA 2HNYB 2ZH7A 3F73A 2N3LA 1Q7YT 4IKAA 2FGOA 4F26A 1QE1A 2UZAA 2GMLA 5CZVA 1C4AA 1WG5A 4BC7A 3Q8RB 2DNZA 3ZZRA 4FF3A 4R0JA 5KFCA 3UDCA 3CT9A 4G1IA 2R7RA 1NK5A 1RYRA 2M7SA 3T6BA 4C0HA 4DMZA 5CD4H 5KG1A 3X1LB 3OUYB 2MYFA 3TQ1A 2HVIA 4U9RA 2Q1LA 4D3HA 5JVHQ 2RRAA 4M63A 4M5DA 1P9QC 1VBZA 2POKA 3KJVA 4IUFA 1JKHA 3T6JA 5J2QB 3PIPQ 3M8PA 2CPJA 3OV7A 3KLGA 3BSNA 4OMFG 1JLCB 3KHLA 4EYHB 1KFSA 2GV1A 1JB0C 5K8PA 4EZ9A 2DRAA 5KG7A 4C4WA 3M6WA 2DGXA 3SV4A 2F8MA 4MYTA 4K4XA 5I3UA 1AFJA 1M5HA 2KN4A 2WOMA 3OFEA 2M52A 4IG0B 4NZ6A 4WK1A 1U45A 2MKSA 2YNHB 3GSDA 3JTOA 3ULHA 4PXBA 1UWBB 4QR2A 2J9EA 2G1DA 2HFOA 3AJ1A 2FC8A 1X4FA 3PR4A 1VQOS 4IQXA 3GIMA 2KHCA 4OHVA 2DR9A 4ZVHA 2CPFA 2MHEA 3UCUP 5KFIA 3U1MA 5IM0A 4KPYA 3I4PA 2CVEA 3KNGA 4DX8H 3J7YI 1UKUA 3MI7X 3H8YA 4OHWA 2FVPA 1EP4A 1SV5B 1TL1A 3GILA 3TW0A 3GIKA 5D4OA 2X1AA 4LFCF 1IKWB 1RT7B 3RW6A 1WI8A 5KFFA 5HMXA 1KVIA 2FDNA 2KTQA 4HEA9 3N5FA 1RISA 1BLUA 2KU7A 2DH9A 3AB2B 2YKOA 3G6ES 2ZJPQ 3RW7A 2KG1A 1N48A 1HWUA 1S99A 4UW2A 2XGQA 1I94F 5D8HB 1H2VZ 1WTBA 2OIHA 4ZCLA 5KFMA 3CO9A 2DGSA 1IQTA 2MKIA 1F5AA 3KLIB 3DXBA