1X4FA

Solution structure of the second rrm domain in matrin 3
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
112
structure length
112
Chain Sequence
b'GSSGSSGKKPEGKPDQKFDQKQELGRVIHLSNLPHSGYSDSAVLKLAEPYGKIKNYILMRMKSQAFIEMETREDAMAMVDHCLKKALWFQGRCVKVDLSEKYKKLVSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matrin 3
publication title Solution structure of the second RRM domain in Matrin 3
rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 11
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2005-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1x4fA00
2U1AA 1R8HA 2AYGA 2MKHA 2KRBA 1A9NB 5IM0B 2XS2A 2LMIA 5GADU 3LPYA 2ZJQQ 3MXHP 3BS9A 1U6FA 4ERDA 3UCUP 2I38A 1QVFR 2MZQA 3NS6A 2CPFA 5HL7Q 1WI6A 3UE2A 1WG4A 2JWNA 3MOJB 1O0PA 1QM9A 1X4BA 1KD1T 2DO0A 2E5GA 2MKSA 3MUTP 3MUVP 2MQPA 4IOAQ 3SXLA 2OTJS 1Q82T 4WKRA 4UY8T 3I55S 2M88A 5HO4A 2DHXA 5DM7Q 3K0JA 2HVZA 2KVIA 1VBZA 2MY7A 3DXBA 4TU9A 3J7ZT 1VQPS 2ADCA 3RW7A 3P5TL 2FY1A 3S8SA 2AYEA 2LQ5A 1YIJS 2CQBA 2MZSA 1R8PA 2MQQA 3G8TA 1FJ7A 1WHXA 2XNQA 1ZZFA 2VONA 2YWKA 2CQ0A 2LXUA 1F9FA 1VQ5S 1IQTA 1X4CA 2KXHA 4IO9Q 2KT5A 1JJ4A 2M9KA 4CH0S 2VOOA 2DB1A 4EGLA 3NNCA 1M5OC 5GMKa 3H2VE 3CCSS 2KXNB 3P49B 2MKJA 2D3OR 3S01A 2NLWA 4TU8A 2GO9A 2RUGA 2M4MA 5DDQC 3CPWR 3J7YU 1HL6A 5IFMA 2ZJPQ 3G96A 5LSOA 2RRBA 5JVGQ 2RS8A 5DDPC 3I56S 1XN9A 3V4MA 2DNMA 2MHNA 2MB0B 3JB9k 2RT3A 1RK8A 2HGLA 5FJ4A 2HGMA 2RU3A 2JRSA 3B4MA 2RNEA 3P3DA 3HHNB 1VBXA 1WTBA 2DNHA 1HD0A 4PR6A 1FHTA 3CTRA 1NO8A 2HGNA 3NNAA 5IM0A 2MZ1A 1WHWA 1PGZA 3G9CA 3U1MA 2ZJRQ 2CPEA 1K8AT 4FXWA 1YJ9S 3NS5A 5JVHQ 2J8AA 2CPZA 1P1TA 2L9WA 2DO4A 5D77A 2KM8B 2LKZA 1U1NA 1WEXA 1VQNS 2G0CA 5LJ5Y 1G2EA 4W90B 2FPHX 2DH8A 2DISA 3G4SS 2YTCA 2CQ1A 1DRZA 1DZ5A 2F9JA 4F25A 1FJCA 2RQCA 1X4AA 2AYBA 1SJ4P 2MKIA 1HA1A 4LMZA 4LJMA 2DGXA 4PKDB 2O3DA 3P6YC 3FEXB 2I2YA 3LQVA 3CCES 2XS7A 4IOCQ 1KQSR 2RRAA 1UW4A 1DHMA 1URNA 2E5HA 1OWXA 5LXYA 4C7QA 1UAWA 3CCRS 4ZKAA 2KHCA 3Q2TC 2OJ3A 3EGZA 4F26A 2CPIA 2DNRA 1KC8T 2F3JA 1X0FA 3CXCR 4WCEQ 1HD1A 2XNRA 4Z2XA 4QQBA 1H2UX 1M5VC 4WIIA 1SJQA 5DM6Q 2OSRA 1VQ8S 3NNHA 2FHOB 4Y0FA 5EN1A 2K8GA 2DIUA 2AYMA 2MKKA 1UP1A 1X5SA 4YUDA 2QA4S 1YI2S 3MUMP 2CQGA 3R1HA 3DLLQ 1PO6A 2E44A 4WFNQ 2DNZA 1NJIT 4C0OC 3MURP 2MZRA 2X1GA 3TYTA 1X5OA 1U1KA 2KYXA 2M52A 5MLCV 4PRFA 4TU7A 2CQPA 1Q86T 4OZ1A 2PEHA 4F02A 3CMES 2CQ4A 1JMTA 2KG0A 3VAGA 2MSSA 3L3CA 3CCVS 1WF0A 2MQLA 2ADBA 1YJNS 5BJRA 3PIOQ 2MZJA 2RS2A 3VAIA 3R1LA 4YOEA 2DGQA 2QFJA 2DK2A 3G6ES 1VQ7S 2RVJA 2FC9A 3MD3A 3TO8A 2DGOA 2KN4A 2LECA 2JX2A 2CQIA 3OW2R 4IUFA 1WHVA 2MSTA 3SMZA 1X4EA 2CPXA 2MPUA 1FNXH 1FT8A 3UCGA 1U1RA 3UWTA 1WEYA 3CMAS 3UCZP 2A3JA 3CC7S 3TP2A 2MZTA 1VQKS 1CVJA 2K3KA 3MI7X 1X4DA 2M70A 3HI9A 1SXLA 1P27B 3R27A 2G4BA 1OO0B 2UP1A 2CQDA 1Q81T 2XS5A 2KFYA 3VF0B 4Y00A 2N7CA 1WEZA 5GAEU 5DETA 1WELA 3CCMS 2DHGA 2F9DA 4V19X 2KU7A 1AUDA 1VQMS 1M5KC 4C4WA 1VC6A 1B7FA 2AD9A 1FJEB 1FO1A 1JJHA 2DNOA 2YKAA 1YWXA 3US5A 1N88A 1WI8A 2DHAA 2M8HA 2MGZB 2DH9A 2LCWA 5CYJA 1KOHA 2DGTA 1YTYA 1U2FA 1VQ6S 2DNLA 1DBDA 2SXLA 2M2BA 1WF2A 4UQTA 4P6QA 2CPYA 2MXYA 4YB1P 2BOPA 3BEGB 3G71S 2CPHA 2MJUA 1N52B 4J5OA 1H2TZ 5DDRC 1X5TA 5GVQA 1K73T 3MD1A 1SJ3P 1ZZNA 3G8SA 1U1MA 1FXLA 1VQLS 2CPJA 1X4FA 1VQ9S 1X5PA 2RQ4A 3CCLS 1UFWA 2J76E 1VC5A 4WFAQ 3H2UB 2NZ4A 2DNKA 5LSLA 2MMYA 1M1KT 3CF5Q 2DHSA 2M8DB 2MQOA 3IWNC 2DITA 4A8XA 3Q2SC 3BO3A 2LA6A 3CCQS 4U67Q 1M90T 4RU2A 3RW6A 1X4GA 3SDEB 2DNPA 2LEAA 1W2BR 1OIAA 2V94A 2KG1A 3VAJA 3ULHA 1YJWS 2CJKA 2FC8A 5ITHA 3CCJS 2YH1A 2YH0A 2MQNA 1WG5A 2MQMA 1X4HA 2LA4A 2E5IA 1VQ4S 5CXTA 2DNGA 1L3KA 1YITS 3ZZYA 1QVGR 4CQ1A 1D8ZA 3U1LA 1YHQS 3MDFA 1Q7YT 1U1PA 3NMRA 3CUNA 2MYFA 2KRRA 1U1QA 2MJNA 2LEBA 2LYVA 2HYIB 2OIHA 4ED5A 1U1LA 1RKJA 3VAFA 3UD4P 3VAHA 1WWHA 2CPDA 2X1FA 2L41A 1S72S 3EGNA 4OZ0A 5CA5A 3BO2A 3B4DA 2U2FA 2ERRA 2VODA 3CC4S 5D78A 5GAGU 5LJ3Y 2N3LA 2B0GA 1VBYA 2G1DA 2M7SA 3VAMA 5H1SV 2D9OA 3FEYB 1KOOA 3CC2S 1D9AA 1SJFA 3EX7B 3UD3P 1U6BA 1K9MT 3CULA 2KM8C 1WF1A 2DNQA 3VALA 2XB2D 2EK6A 4W92B 1OPIA 4TLQA 2BZ2A 1H6KX 2Q79A 2N82B 2MGZA 2OSQA 1SJRA 4BS2A 4CH1A 2XSFA 2M0GB 2JVOA 2CQ2A 2CQHA 1WHYA 1N8RT 2GHPA 2DGWA 2DGVA 2J0SD 1A7GE 3N9UC 2L08A 2PE8A 1BY9A 2N3OA 3CCUS 3BO4A 2X1BA 2DH7A 3D2WA 4M5DB 1JJ2R 2KI2A 4QPTA 2X1AA 2HZCA 3CD6S 2LXIA 4CIOA 2MKCA 3THPA 2DNYA 2MY8A 5LXRA 3VAKA 1H2VZ 2J0QD 2DGSA 1VC0A 2JVRA 1WG1A 1N54B 2DGUA 4LIRA 3THTA 2EVZA 4FXVA 3IRWP 1ZH5A 1M5PC 4WF9Q 5DDOC 4QU6A 2CQ3A 2VOPA 3ZZZA 5GAHU 2KXFA 2OTLS 2EK1A 2E5JA 3SDEA 2CQCA 3PIPQ 1NU4A 1VQOS 2WBRA 1U1OA 4WFBQ 2DIVA 2KH9A 3S7RA 3S6EA 2DNNA 2D9PA 2QEXS 1S79A 5IQQA 4QU7A
chains in the Genus database with same CATH superfamily
2Q43A 1RSCA 2VQEF 3QWUA 2F40A 1KQKA 1F2HA 3G8QA 3SCLE 1DQ9A 3PYEA 2D3UA 2FJEB 4Q44A 4URQU 3HK2A 1S7HA 3ELHA 4DPYA 2XWYA 1D9FA 4WKRA 2PC6A 3K0JA 1NKEA 3HXMA 3WC2A 2DHHA 3BDPA 2EC2A 1NRKA 3UW1A 4ENOA 2XMWA 1N5QA 3TJ9A 1XNQF 2VH7A 3OQ2A 2VU5A 3P49B 4HL9A 3ZXWA 2KZZA 1FVQA 2AT1B 3T1HJ 3DOLB 3O2IA 3IR5B 4X4OA 2JH3A 4LIWA 2XMTA 2BJ3A 2CRLA 4K8RA 2JNJA 3JB9k 1EP4A 4OHZA 3ZO7A 1FEEA 1NM2A 2IC3B 4RW8B 2JRSA 2EBGA 3PW5A 1FE4A 4JV0A 1ZM9A 3CTRA 3MM6A 4DR2J 4WIQA 2KB2A 1PYTA 1PGZA 3CJKA 1SPBP 4FBTA 1SH2A 4DR7J 5ETQA 1BQMA 2VFRA 1YVFA 3F0NA 1YK9A 3ZZUA 5GMEA 1RWKB 2CQ1A 4V1Ak 2V8HA 3BF4A 4LJMA 2O3DA 3BDEA 1GFWB 3LQVA 1RA7A 3QPIA 2FYXA 3OL8A 1FDAA 2ROEA 1OWXA 4ILLA 3M8PB 1B64A 1JIHA 1RACB 2J7UA 3MTJA 5C7PA 4FS2A 3NBPB 1LWXA 1Q7LB 1OQ3A 1TQLA 4NOHA 5I3PA 2B51A 2MKKA 4TN2A 3IWLA 1HHTP 1W2IA 3DLLQ 5JUMA 2GC8A 3IGNA 4KH1B 2KYXA 4KRWA 2AX0A 1Q86T 4JI0J 5LT5A 2V2VA 3CMES 3ISNC 3RRGA 2AZ1A 1T03B 3W1YC 1YJNS 5LL6d 3KLEA 4RU9A 4DFJA 1CPZA 3PX0A 1K47A 3TO8A 4F2RA 3TX8A 4J9QA 1YJ7A 3BN4A 1FJGJ 4PXDA 4Y2CA 4RUAA 2XO6A 2OMOA 3OL9A 1CVJA 2HFVA 3TNVA 1KDNA 3ZZRA 2ZH4A 1OO0B 1JLAB 3J81U 3M9MB 5GAEU 2FHMA 3CCMS 4V19X 1VQMS 1FJEB 1FO1A 3MEDB 4DXLA 5HLFB 2GQQA 3GV8B 3BYRA 4NRUA 2HFZA 3HPOA 4A8SA 3EPIA 1LFPA 4DS5A 1HARA 2H9ZA 2M2BA 4UQTA 2B4PA 2B9WA 4BC9A 2CPHA 2R42A 2K2PA 3DM2B 3LANA 2BKOA 1JKHA 2GFFA 3NMAA 4JI1F 4ZMMA 1F3VA 2OPRB 1T8EA 2H4YB 1YJWS 4URGA 3PFEA 4WU2A 1SV5A 2DNGA 4DCPB 4P74A 4DSFA 1K0VA 1U26A 3V2UC 5KT7A 2LYVA 3NGDA 2FJXA 1HPZA 2CPDA 2EFOA 2R8KA 2VODA 2Z8QA 2EFVA 4RZRA 1S6PA 3M6VA 2DTJA 3H0PA 1X9SA 3T9ZA 1K9MT 1AFJA 1GTHA 3VALA 1PJ7A 2JLEA 1RT3A 3H59A 3V6HA 4Y2AA 1J5OB 2M0GB 1VCTA 1A7GE 1FRIA 3EZUA 4TYAA 3KHGA 2VFTA 2E1RA 2LXIA 1R8AA 1L3UA 2ASJA 5C42A 2YKNB 4DBQA 2QL9B 1WC1A 4BBYA 2F4VF 3AHPA 1RQ0A 4L72B 3MFHA 4DV5F 2BQ3A 4P2XA 4C8MA 4PQAA 1FWLA 1VK8A 2WVDA 3NAIA 3C15A 3GFHA 4V19J 1N0UA 2AYGA 5LMUJ 2ZZTA 2DKOB 3I4PA 4O0NA 2I9SA 5HROB 4R0JA 1XK8A 4DR4J 2AWZA 1WG4A 1C1CB 3GWCA 1QM9A 3PDNA 3TVKA 3DOMA 3FSYA 3HDSA 4JI7J 1CC8A 1XEZA 5HO4A 3J80Y 1RWVB 3PKYA 2FZCB 4KO0B 1MWQA 4GKJF 2V50A 5CZVA 3UR0A 2XYHB 1JX4A 2AYEA 1RWUA 2G2OA 2MKYA 2VONA 3MF5A 1ULRA 4M94A 2H5EA 4J37A 5HMZA 3CCSS 2JEFA 2D3OR 1EKRA 4B9UA 2Y8WA 3FRZA 5GMDA 2WVCA 4LFAJ 2VPZB 1YRXA 5IFMA 4DSIA 2XSJA 1S0OA 1ZM3A 1YDLA 3V4MA 2YNFA 3HVAA 5GAEI 3W64A 3IMQJ 4X4QA 2RU3A 1OY8A 3LP0B 1G4CA 2IRYA 2YKQA 2P5VA 4PR6A 5KFVA 1NO8A 3KUEA 2MZ1A 1JWWA 1T05B 2ZJRQ 2CPEA 7AT1B 4TQRA 2KFNA 3PR5B 2CWXA 4NLGA 4EI2A 4MFBB 2LP4A 2XQCA 3KTQA 3DLHA 2BA9A 2LDYA 3ZTSA 2N7YA 1SJ4P 4O3OA 4H4KC 3I82A 2I1RA 5KFHA 4KAIA 2UVRA 4LF5J 4X4VA 1UAWA 3ZZOA 4NI2B 1S48A 3ILIA 2XNRA 3MM9B 4WIIA 5KFXA 2O66A 2B9YA 3DDIA 5AXMA 1YI2S 1HQEB 1UA1A 2Q6CA 2YBVA 3ETMA 4MTPA 1IM6A 3DOLA 3UDEA 3DRSB 2MZRA 4CLSA 3I96A 3TYTA 1X5OA 3GTYX 1LW2B 1WDTA 4ED6A 2X7IA 3KDNA 2D3ZA 4GC7A 4QCLA 1TK8A 1WOOA 2IC3A 4RW8A 2MLXA 3Q8YA 3G6ES 4ZJLA 1AYEA 1T0TV 2WCXA 3MTKA 5DZ7A 4CO2A 2XLIA 4HH0A 3OW2R 3BKFA 2MSTA 3QSIA 3V4IB 1IR0A 5KG2A 4GMKA 2MZTA 1LFWA 2O1PA 3U7JA 2M70A 3SYZA 3T5HA 4M5HA 3M2VB 1O51A 2HVHA 1KONA 5E3AA 2HRUA 1WEZA 5DETA 4D3GA 3TAQA 3QT6A 3F73A 1BE4A 3OXFA 3M8PA 4DR3J 3J81j 1MU2A 3EZ5A 2CJBA 2GNKA 2SXLA 3NBPA 3MFIA 1DLOB 2MXYA 4L3KA 3W66A 1H2TZ 5DDRC 3GSIA 3D54A 5KFMA 4JI3F 4IH6A 1Q79A 4N56A 2XCAA 2WHOA 2NZ4A 5EWFA 3NGUA 4ELTA 2LEPA 4K59A 2BVZA 4GVBB 2ZBCA 4MYTA 1T03A 2V4RA 4Y2KA 3QGGA 4MYUA 2WBMA 4DJBA 4IG3B 3DLKB 1QVGR 4CQ1A 5DGBA 5AXLA 2YKMB 3R7NB 2X3GA 2BRLA 2W2OP 1XMBA 3AFGA 4CT9A 2GO8A 5HN0A 1FFSB 4UOHA 4TXSA 5H1SV 1JLAA 3UN5A 3MMBB 2J7KA 1D9AA 4GKKF 1PBUA 2R8IA 3D6FB 4O3RA 3MEDA 5HLFA 2HMIB 2EK6A 4W92B 1NH7A 3MPWA 2UXBF 4NLVA 3O6QA 1Z2ZA 3MM7B 3C2PA 4J9OA 4ES1A 3H42A 2AIRB 3FCVA 1KEKA 2GJIA 1UJ4A 3QZ8A 3DM2A 3R6GB 4USVA 3CEDA 4CLLA 2D7SA 4C8LA 2HWHA 4QU6A 2MTLA 1FKPB 2OPRA 2D1CA 2E5JA 1LKZA 1IM4A 4WFBQ 4NE9C 3S7RA 3MEGB 5KAKA 4UTGA 1S79A 2XC9A 5DS7A 2G0JA 5F3TA 1RISA 2KRBA 1ELOA 2LQJA 4ETZA 1JXVA 3MHYA 4ZVGA 3FBBA 3CO0P 3I5AA 4XPEA 3MXHP 1U6FA 3UCUP 2FJBB 5D15A 4ZP9A 3CJ4A 3GMGA 3KLHB 4DV0F 2JWNA 4DV3J 2GS8A 4QWBA 2DO0A 3JQJA 3I55S 3H4BA 5DM7Q 1HWKA 4AXIA 2VA2A 2E7VA 1U49A 3KLIB 3GQCA 3RW7A 3FBFA 4G1IA 2OD6A 3AD9C 2QT7A 2NXJA 4QW8A 3FMBA 3VGUA 4PYDA 1J5OA 1UVKA 2CQ0A 3M1VB 5D4LA 1RCXB 4DL4A 2J6TA 2BKNA 3FGVA 4OYOA 4QYZK 4W98A 1VGYA 2P9EA 5L46A 2YKNA 1FNMA 1T9XA 5J2MB 4ZJQA 3PRDA 2FB0A 3FRYA 4DR1F 3PX6A 1VHIA 3PJXA 1D8YA 4DWIA 1NKBA 4RNNA 1M1GA 3RGIA 4M5JA 1P1LA 3SEOA 4OYAA 3C8YA 1V3ZA 2DNHA 4RUHA 4M63A 3KG1A 1U24A 4GO5X 5HROA 1OS5A 2KM8B 1N5TA 2NXNA 4B3MF 1C1CA 4IH7A 3A3OB 5EX3A 5C5JA 2H5IB 4QR2A 1KLNA 2AYBA 3FK4A 2Z2ZA 3GJSB 4B9SA 3OR1B 4KO0A 1R27B 3UR3C 4P73A 1H73A 3I0SB 2AGOA 5KFDA 3LF0A 4F26A 1SKUB 1YZ7A 1KC8T 1Y7PA 3OSNA 2QA2A 2K8GA 4ZCMA 5HI7A 1SH3A 1X5SA 1MROB 1PO6A 4WFNQ 1N36F 3B82A 2XGPA 2WTFA 3NS7B 1F6TA 1D3WA 1TP7A 4K0KJ 3MAQA 3G86A 4OI6A 3BQ1A 2R7SA 2KG0A 2XG8A 2E1AA 2YWEA 4USMA 4A8WA 2OFHX 3WX4A 2RILA 1Y5IB 3LP0A 5AJ3F 2RH3A 4ZS6A 3PCOB 2RVJA 1ZYQA 4I6WA 2DGOA 1T05A 4RNMA 1VLOA 2V8GA 3KDOA 5KFZA 4P75A 2MPUA 3QLHB 4MFBA 2DBBA 2R9LA 2G2YA 4F36A 1V3RA 2IDEA 4FVMA 4C98A 3NGSA 3HI9A 1S6UA 1SXLA 2XS5A 2YNHB 2OHDA 3MAAB 2F9DA 1N5VA 2IJNA 4TKTA 3AXMA 1UA0A 2QN6B 1FA0A 4NI2A 1KOHA 1VRQC 5IT0A 3MM9A 1WF2A 4O3PA 2BOPA 2ZC4A 3B78A 2HHTA 5IXUA 1HQEA 2ZH1A 3DRSA 4HKQA 1UFWA 3MR2A 1S4FA 3LP1B 2VJUA 3Q22A 3F44A 4WFZA 5JMNA 3GU0A 3CCQS 1LW2A 3MM5B 5B0EA 2C2DA 4FBUA 2HNZB 2CJYB 3GG0A 3K5NA 3LP2B 1EIYB 1JLQB 4KGVB 5EGYA 4CLKA 2MQNA 2C28A 2B6AB 1RDRA 1YHQS 1NDCA 5DLGA 3WIVA 4WK1A 5HQMA 2IMOA 3V4IA 1IR2A 3R7SB 2IPOB 2E7WA 5F41A 2GVDB 1S72S 2YKOA 4NCBA 3QJPA 5D78A 3W8GA 3M2VA 3FEYB 2COLA 4RW6B 1YBTA 1SJFA 1LWCB 3AQOA 3MCOA 4MIWA 5A8KB 2C2KB 4YP3A 5HMXA 1IKWB 2XSFA 5CCLA 4DR5F 1DLOA 2J0SD 1TKTB 3CCUS 4ZVRB 3D6MB 4EWTA 3THPA 2RHSB 3LA0A 3JQKA 2XBPA 3QGHA 4LIRA 4MKVA 4B3SF 4DFKA 3JSYA 2AKWB 1EHWA 2HBYB 5IWAF 4GVBA 3ZNJ1 2VG6B 3M9NB 1U7LA 2POKA 2W7OA 2CNNB 4IG3A 2V2KA 3VWSA 3DLKA 5DG8A 2R3VA 3HHLD 2QMUB 2XS2A 4A8MP 2YKMA 3BS9A 3VQSA 3K5LA 4PXCA 4OV1A 1WI6A 4I6YA 1SH0A 4OI4A 4DV1J 1OYEA 3SXLA 2EI5A 4W4MA 4J91A 4DOZA 4LF6F 3MMBA 2FVPA 3P45B 1VIXA 2HMIA 2W9BB 5F9NA 2QFIA 2MZSA 4J90A 2YWKA 3EM1A 4AT1B 4Y6IA 4ECTA 3MM7A 2KT5A 2WSCC 4PXBA 3IS9B 2V69A 1RADB 3H2VE 1RAIB 1Y4ZB 1MWYA 4C8YA 2OD4A 5DDQC 4X84A 1WOSA 1UKUA 1FKPA 5DDPC 1OSDA 1Q4RA 1Q0NA 1NH8A 2RT3A 3M8YA 4PZVA 4K4SA 2HGMA 3MEGA 4DPWA 4C9DA 3PO4A 4KYZA 2HFSA 4DV5J 4FXWA 2UXCF 2BUNA 2AGQA 3NCRA 1S0NA 1UFLA 3KLHA 4O44B 2YNIB 2FZKB 1TFWA 2LKZA 3NGKA 2ZBRA 4AD6A 1DZ5A 5KFKA 1W26A 2DGXA 2XMMA 4CLYA 8RUCA 1B0VA 3KLIA 4ZKAA 4U7UK 2OJ3A 2R7TA 6FD1A 4A46A 1GXLA 3M1VA 3NNHA 3CIMA 2ZVIA 4AQYF 3IP0A 2WK4A 3K5MA 1TV6B 3SSRA 4PCQA 3MURP 5B0AA 5J2MA 5KG6A 1U1KA 1EETB 1WC3A 1TKDA 5KG7A 2GIQA 4IR9A 2C3OA 3TEGA 1F9HA 4ED2A 5B09A 1TL3B 4JI4F 1HHQA 2H5JB 2GA7A 2RAQA 1LK5A 4O3QA 2FGOA 4DPTA 5E3PA 1FNXH 3PG9A 3IM8A 4EBDA 4N8OA 2K3KA 2OFGX 3QGIA 3D1OA 4L75A 3MWBA 3GB0A 2N7CA 3CJ3A 5E5NA 2QSFA 1BHNA 6AT1B 3OR1A 4ED1A 1E6YB 1GX5A 4F04B 3HHKA 1XNRF 2C2ZB 1IBLJ 3I0SA 3M9OB 2WOMB 1IKYA 3CJQA 3FCWA 5B0DA 1HNWF 3B54A 3HVTB 3GLJA 1MROA 1Q53A 2CPJA 1R0BG 1X4FA 4M8LA 4ZPAA 3CDUA 3SQGB 3OTBA 2L48A 2J9EA 4OLPA 4KGMA 2MQOA 1UETA 3KUHA 3ULHA 5D8HB 2FC8A 1QSYA 1FEHA 3CCJS 2Y3YA 1WG5A 4IFVB 3JAMU 1RCOB 1L3KA 1PC5A 1D8ZA 1ZS6A 3PR4A 1HNZF 4Z7YA 3QLHA 3UD4P 4ES3A 3DCAA 3PX4A 5BXIA 4YHHJ 3FMWA 2W2QP 2NYIA 1VBYA 2YNHA 4P7TA 3MAAA 1CC7A 5LOQA 2BV3A 1V9OA 1T11A 1YG0A 5A8WB 2XHCA 2DRAA 2PFDA 3N4WA 4FZVA 4IYQA 2VDHA 3P96A 1SC3B 2HWTA 4PG6A 3R9LA 1LQ9A 2HK3A 4ILRA 2BW2A 3MEKA 1DQAA 1R31A 1S97A 2R2SA 2VC0A 2XYPB 3ZZPA 3LP1A 1FXRA 3R2DJ 2KXFA 4OHXA 2ZHOA 3MM5A 1FX4A 1SJ1A 2HNZA 3NY0A 3VGSA 2P9GA 3LP2A 1JLQA 4KKOB 2KH9A 2DR5A 3BB5A 3PFOA 1MN9A 1NSPA 2B6AA 4RBUA 1QAJA 2QMWA 1X7VA 1OMSA 4JYAF 2IVFB 2LMIA 3P5BP 2K1RB 4ZA1A 3HF5A 4ZVSB 3TZYA 2GVDA 4F2SA 3VHQA 4BWJA 3IWXA 4IRKA 5IZHA 3AY0A 2W01A 4RW6A 1KVJA 1URRA 2KVIA 1A6LA 1LWCA 4CLPA 3OXGA 5C24B 3IR6B 3GE9A 1ZETA 3P5TL 2DPIA 3D66A 3V6JA 4ZVPB 5A8KA 4OI0A 1R8PA 5KG0A 1IKWA 3G8TA 1G1XA 2KXHA 1TKTA 1YKWA 5GMKa 1I1GA 5SUHA 5RUBA 2IIHA 2CJ9A 1VRUB 5KFTA 1AROP 3L7PA 4G1PA 2UXBJ 5A2QU 2RRBA 1HNXJ 3M8ZA 4F0MA 3DYAB 2VG6A 4OJGA 4ZPWR 2RE1A 4NA1A 4LF9J 1O8BA 2VBZA 2HHXA 5MAOA 1S99A 1PJ5A 3CDEA 5G0RB 2QC3A 5GAHI 1YJ9S 2VL1A 1N48A 3FEZA 4DV7J 1AXQA 2HURA 5HANA 1VQNS 3QFHA 4QYRA 2HSEB 1DAXA 4F0KA 4LBIA 3PY8A 3ZNUA 1HA1A 5E3CA 2G9OA 2MEWA 2HW3A 4IOCQ 5KFOA 2BE7D 2AHOB 4U8VA 4F4WA 4ANCA 4PABA 3CJ0A 2W9BA 5KFAA 2WONB 1VYAA 3GR1A 1HD1A 1X0FA 1SJQA 3SV3A 1UPPA 2V6AA 4Q43A 2AYMA 2FJDB 3IS9A 1UP1A 4YUDA 5HJXA 5KFRA 3UO0A 3D6HB 1TU0B 1CJVB 5FIIA 3JTNA 2M52A 1P6TA 5KG5A 4Q0BB 2P6SA 1GTEA 2MQLA 3DGPB 3VAIA 2DRDA 4BHQA 1SI9A 4P72A 1FVSA 4CO0A 4DL5A 5CD4A 1S0VA 4J9NA 2PIIA 3CJSA 2QA1A 2Z57B 3ILOA 2XM3A 3UCGA 2E5LJ 3QT7A 3W9HA 3SFUA 4O44A 2YNIA 3CB4A 1JXEA 3JYTB 4PG8A 2XGQA 2A3JA 2IRXA 1RLDA 5E41A 4A8YA 4HHHA 4QBUA 2QG9B 2GIRA 3R27A 4C0BA 5LMNF 2UP1A 1SC4B 3D68A 3K5OA 4KFBB 1QAYA 3GCWP 3T6BA 1SIZA 1RB0A 2MGZB 5I3UB 4DV4J 2DGTA 2DNLA 1DBDA 1JB0C 4USKA 1LXJA 4QIGA 5ETSA 2ZH8A 5FD1A 2C42A 1ITPA 2RQMA 1TV6A 1I5OB 1VQ9S 3T1AA 2V0NA 4WBFA 2O67A 4HHJA 2R2TA 3WZ0A 4DV2F 4LSNB 4USJC 4M5GA 4LFBF 1EETA 2J0WA 4Y65A 3WBZA 3DKDA 5L1KA 3RJMB 2C2RA 3GPAA 4RU2A 1TVRB 1CJTB 4WJBA 1TL4A 5CQGA 3NLCA 1TL3A 5HBMB 2IJFA 1HI0P 4UY85 4WZMA 1BGXT 1ROFA 4ED5A 3KNGA 2RB7A 2IBOA 3WQPA 2GMJA 3UVJB 3W5ZA 4XTTA 3KFWX 2E9ZA 3W62A 2CXEA 5I4MA 3H98A 1KQFB 1GEHA 3AQPA 2W4PA 2QX0A 3OXLA 1N6QB 3CC2S 2H65B 1U6BA 1N34J 1WF1A 2JDJA 1NK4A 1E6YA 2YPZA 1H74A 2DVIA 4I4BA 2FLNA 2WOMA 4KJIA 4C8OA 2UUWA 4P52A 2DGVA 4ZP6A 2PE8A 1BY9A 3HVTA 4F8RA 3WC0A 1CS4B 1JQGA 3AD7C 2VKRA 3V5RA 4C8KA 1ZPWX 1U09A 2JVRA 2I0XA 2W2NP 3SQGA 1WG1A 3THTA 5DDOC 1SL0A 2CQ3A 3GYNA 5KFNA 2J6SA 4NLPA 4M1KA 3HFZB 2HHHF 4J9LA 4GC6A 1F9EB 3UN3A 1HMVB 3DLGB 4IFVA 4JI8J 3EVOA 4CNZA 2UU9F 3AA8A 4LRDA 1UWBB 2ZM6F 4X65F 4M5LA 5GADU 2ZJQQ 3HFVA 4OZ5A 3RUBL 2MZQA 3PEJA 3NS6A 3R5GA 3PNIA 3L95X 1T9YA 1X4BA 1NK7A 4DF8A 2NSCA 1KP6A 2E5GA 4QWEA 2ALYB 4DZ6A 5L1IA 1R0CB 2JL9A 2HVZA 5U47A 2E29A 5J1NA 4RX6A 1U2CA 4F4ZA 3EGWB 2PGCA 5A8WA 3DLBA 2MQQA 4YR2A 4Z37A 3EMTA 1KFDA 4IO9Q 1JJ4A 3RB6A 1IKXB 3W61A 2F4FA 2MKJA 3Q8RB 4MK8A 4I56A 4QIVA 2BE9B 2BANB 4ZVTB 1FCAA 4ZCKA 3G96A 1NLKL 3J7AN 4HLBA 3RTVA 4QIFA 4AL6A 1OJ4A 2ZDOA 3H40A 2WRMA 1CQMA 4LFCJ 1C4CA 1BMQB 2E1PA 4B3SJ 3PYGA 1RAFB 2K1RA 1WC5A 4B3TF 5JVHQ 2F63A 1JNZB 5D0HA 3K89A 1TFYA 2DISA 3DDKA 2IA0A 1SQGA 2NQPA 4LMZA 4QIEA 1FRXA 2XS7A 3PEHA 5C24A 1UW4A 5CABA 2RUSA 3HHLC 3KK2B 1SC6A 5IV4A 2DNRA 4K7QA 3CXCR 4FYVB 2LLZA 1RWNB 3WDOA 3K8WA 2YWHA 4OHYA 2J9CA 4JBCA 3MGJA 2ZKTA 4F4YA 4DQQA 4G1QB 1TAQA 4FS1A 1VRUA 3A3PB 3MMAB 4CLUA 3ONQA 4A48A 4PRFA 3H20A 1IKVB 3DYAA 2YY3A 1JMTA 2V8VA 3CCVS 5ETRA 4ATNA 1M5HA 2QV6A 2MZJA 4DUZJ 2G0IA 3BSNA 4UF4A 2L9DA 5B0FA 3J7YI 3KK1B 3H7HB 3OTOF 2ZE2B 2QLBB 2OAUA 3LPEA 5G0RA 2ZH9A 5IT4A 2ZC3A 4JUZA 4HTJA 5T41A 3EVWA 4EBCA 1Q8IA 1UPMB 2CKWA 3BR8A 4WYLA 1K0TA 3HT3A 3C16B 4K4UA 5D4NA 4IRCA 4Y00A 3RBXA 2JSXA 1U0SA 2HFOA 2QO3A 2YKAA 1XERA 4CP5A 3GV7B 3PKMA 2WONA 2QYCA 3SFGA 1VQ6S 4KBIA 4ALZA 5E33A 2KFZA 5GADI 1NMEB 2YWGA 3A8JA 1Y11A 1C4AA 3CCLS 1CJVA 4WFAQ 3H2UB 2MMYA 4DL2A 1J5EF 4FP9A 2M8DB 3F56A 3Q2SC 4Q0BA 3OL6A 3DGPA 2CJKA 1WUUA 2YH1A 4OIXA 2FVQA 4G65A 3OFFA 4FNHA 2C2EA 3S1TA 4F4XA 2EFNA 3ETOA 5HQ8A 2HYIB 5J2QB 1VHFA 3BKTA 4MIAA 4P7VA 2ILYA 3PRBA 2YX1A 3JYTA 3QQCD 1RT4B 4OZ2A 4B3RF 3QRQA 1G3OA 4B9VA 3T1YJ 3RYLA 2HS0A 2IAJB 4KFBA 1LWEB 2V5HG 4NPOA 4KHPF 4RPFA 2YX4A 3CNQP 5BR8J 1NJXA 4OYBA 1U2RA 2MGZA 3HJVA 4URSA 5I3UA 2QTWA 2CQHA 1WHYA 4DLGA 3P4UB 3IRXB 1QAIA 5HP1B 3C6TB 5KTQA 2J0XA 2E1CA 2HZVA 1QSSA 3HLUA 2ZH2A 1XNRJ 4K50A 3N79A 1JNRB 2DGUA 2EVZA 4LSNA 2A10A 1ZTTA 1YJTA 2OGUA 1D9DA 4WWSA 2M5YA 1HIYA 4RWWA 2EK1A 3FZBA 5B0BA 3PIPQ 2CIMA 2DIVA 1S9FA 1N5SA 2FQQB 1TVRA 1CJTA 4EBEA 3TAMB 2ZBQA 5HBMA 3N6NA 2BQRA 1Y5NB 1EQ0A 1YQHA 3UVJA 3E2EA 2UXDJ 4H4KA 1XMQJ 3A13A 2ZH7A 2W8KA 1CSJA 1OQ6A 4CO1A 2XZWA 1WORA 1M5SA 1TTHB 3DLEB 4DV6J 2GVZB 2R8JA 4DQIA 2PEBA 1N6QA 3OLAA 4L73A 2VFSA 1IBMF 2NSBA 2DEIA 4KT0C 3QJJA 2ZH6A 2CQBA 4I69A 1FJ7A 1WHXA 4DPUA 1V5VA 4M5MA 3BR9A 1X4CA 4WXOA 2VOOA 5AE2A 2NXEA 4X66F 3RBZA 4K2XA 1CS4A 4ZK7M 2LQBA 4ICLB 4LQ9A 4OJHA 2GO9A 4F3OA 2C3PA 4ED8A 1H38A 2ZJPQ 2OPQB 3LO3A 2B43A 2EFGA 2CDRB 2H54B 4B17A 5FJ4A 1HMVA 3DLGA 3B4MA 3NCPA 4NLWA 2IM1A 5F0WA 1WTBA 2BXJA 4KSEB 4P9SA 1HD0A 4ED4A 1UWBA 1WHWA 2AJFE 5KT5A 3N6LA 4UUWA 4M95A 1P1TA 2DY9A 2R8HA 2BM1A 3T9NA 3A3NB 1GMVA 1H72C 5CH7B 4OZLA 4UOFA 5LSRA 5A76A 2C2MB 2JFKA 4JYAJ 2V8PA 4J9UE 2B8PA 4OX6A 2BX6A 5H9EK 3VV2B 4ANEA 4QQBA 2GW8A 2IYIA 4EEYA 4QW9A 2YPYA 3TZWA 1IKXA 1ZM4A 4YFUA 4IH5A 2HKEA 3QRPA 2E44A 1BWEA 4RWXA 4ZDNA 2GHVC 2BANA 3JTPA 3EYZA 1MLAA 2PMWA 4B9MA 4TY8B 4F02A 3A8EA 3K2YA 1Q8LA 2MSSA 2RS2A 4LBHA 1HQ2A 3ADAC 1XBWA 2LECA 3HT0A 3SMZA 3OVAA 3DRPB 2LQ8A 4IDKB 1A0OB 1TMJA 3AAWB 3KHHA 3A8KA 3GFZA 4C8NA 3CC7S 1Y9OA 4FKYA 1S1UB 1FD2A 5BYQA 1S10A 1DTTB 1GAOA 3ILJA 1GT8A 4RBVA 1X9WA 2W9AA 4P71A 2NZCA 1T7PA 5A0YB 1JJHA 4ZJOA 2WW8A 5HATA 1DQ8A 3KK2A 4O4GB 4R8UB 3I5BA 2OPPB 4P6QA 2CPYA 1N52B 4ECQA 2L9NA 4ZLNA 3VZHA 3JS9A 4G1QA 4PQUB 3MMAA 3BYPA 3JTOA 2DHSA 1FF2A 1GXUA 4ED7A 5L39A 3MCSA 1IKVA 4A8XA 4U67Q 3SDEB 4QR1A 2KKHA 2V94A 1FNOA 3I87A 2DCLA 3TAPA 1UFKA 2E5IA 1NK6A 4IOBA 1L3VA 4NXMJ 1FESA 3KK1A 3GONA 2ZE2A 4NRTA 1RKJA 1N32F 3HFKA 3VAFA 2RDIA 3W9IA 3RAXA 5ETLA 2VC1A 2Q6BA 4K4TA 3C16A 2VBXA 2V4QA 1AUSL 2XWXA 2BJ7A 5KFYA 3RZAA 4DPXA 4DX6A 4OLOA 1XR7A 1NPKA 1SJRA 2AP6A 2CUYA 4ZCIA 1U25A 1RTJB 5LMNJ 2MHEA 3IBWA 2X1BA 4HACB 3NP5A 3GJTB 4MKYA 4ZN3A 1UEKA 1YZ6A 4CIOA 3QIDA 5IV3A 3RRKA 2DNYA 5D0RA 3OFGA 1C0UB 1WDDA 1N54B 3TUIC 3IRWP 3IFEA 4DDFA 3ZZZA 2OI2A 1B99A 2YVSA 3GG1A 1MNEA 4KH0B 4RUCA 3EUNA 3I9V9 1RBAA 1REGX 5J2PB 3MOZA 3LAKA 1QAXA 2J9DA 4YN3B 3B8HA 2DYAA 5J2QA 1RTIB 2ABYA 3PO5A 1XR5A 1P9QC 1RJJA 3BPDA 1RT4A 1T3NA 5KFCA 2MKSA 3GJQB 1S9EA 4ZPBA 1Z2LA 1VS3A 2PO4A 2IAJA 2KJWA 1LWEA 4YDXA 3S8SA 3H2LA 1YIJS 4X64J 1TL7B 5K14B 2EWHA 2XNQA 2Z2YB 1KN6A 3A4TA 2HIYA 3PW4A 3IRXA 5HP1A 1ZPVA 3C6TA 2DB1A 5HVGA 5HMWA 3QFWA 2CADA 3T1HF 2FHJA 1FDBA 3T5JA 4A8KA 5C2CA 4Q5VA 1OPZA 2PA3A 2NCKL 4DQRA 4OMFG 4LR7A 2XTJP 3SCKE 1XN9A 2WB4A 3MAHA 2ZOMA 2JFDA 4CYUA 1S49A 5K9FA 4ZVQB 2BRKA 2PN6A 3TAMA 1HWJA 3Q8PB 4DR2F 3DN9A 1FHTA 3HHDA 3M8WA 4MJKA 2DD8S 1V3SA 4NLTA 1GK8A 3BQ2A 1N33F 2HHQA 2FGCA 2BR0A 2HHHJ 3AB2B 3KYLA 4IFYB 4JB8B 2X3DA 1X9MA 1DRZA 3DLEA 3G6YA 2QL7B 2GVZA 1U02A 3EDRB 2QE5A 2ZM6J 4N5SA 4PKDB 5ETVA 1K1SA 3CCRS 1VJWA 5C2GA 1BWVA 4YDDB 3O3LA 3DOKB 4Z2XA 3ZTOA 3RBDA 4ECYA 2DXEA 3BREA 1Y5LB 1ZAWA 3CSKA 3MUMP 4ICLA 2VHGA 4Q2MA 2LXFA 3ISND 2CFXA 2OPQA 1RTHB 4J7CA 5MLCV 4JI0F 4QOTA 1EJ7L 3KUGA 3M8RA 1EQMA 2JEJA 4EK2A 1TKXB 4JI5J 3R1LA 2DK2A 4KV8B 4Y28C 2PI5A 2KN4A 1NAQA 1VK3A 1TMMA 1FJGF 4C48A 1U1RA 2ZFHA 1NCLA 2HQIA 2UZAA 4KY3A 4OX9F 3OD2A 3GIMA 1X4DA 2LVWA 3QGPA 4H54A 2F7VA 5BYSA 2UVUA 2Z4PA 3RU0A 1WELA 4K5RA 4O4RA 4B3TJ 3FJ2A 3TRGA 1WI8A 3OSPA 2K7JA 5IT9Y 3O5TB 4UOCA 1RU1A 3LH2S 1M1HA 2MJUA 2GQCA 4R5PB 1FRKA 2PD1A 4XPCA 3TI0A 3CJRA 2OLWA 5AE3A 1SKWA 1NHUA 3AXKA 3LAMA 3FNNA 4YQWA 1CQNA 4LT6A 4TY8A 5FLXY 2DITA 4E0DA 1PAEX 3I32A 1HBMB 4RR5A 3VVTA 1W2BR 1OIAA 4LF4J 3D5MA 1UVIA 3PJ9A 2LA4A 2KDOA 4RL1A 4BDPA 1VR6A 4P2SA 2ALZA 4FN5A 3IO1A 1QLNA 1I51B 4FF3A 3DRPA 2IVYA 3J7Z5 4IDKA 3C66A 1WWHA 2UV8G 4UQGA 2VPWB 5DLFA 1S1UA 3W7BA 2Q3PA 1OYDA 1DTTA 1OSCA 1RYSA 1Z1ZA 3OTOJ 5A6WA 4RNHA 5A0YA 1YJVA 4OYWA 2RQKA 4AFFA 4O4GA 4BS2A 4R8UA 3GILA 4I2QB 2R8GA 2OPPA 2NYHA 4JI6J 1GNKA 5D3GB 4EO8A 4M5DB 2KI2A 2A2DA 4E98A 5B0GA 4DFMA 2IFXA 3T6JA 4XO0A 1LEOA 3ET6A 4PQUA 1H2VZ 4RJVA 5KT6A 1RWXB 2HQCA 1ZH5A 3H5XA 5CYQB 2J9DE 3SDEA 2WBRA 2Z2LA 1PC4A 1GMWA 4DI6A 2MQ8A 3KK3B 2OH2A 2R2UA 2WVFA 4MMOA 5LMUF 1UZHA 2R7XA 1G6BA 3L09A 4DR4F 5KOXA 2ACYA 4DR6J 3UE2A 1O0PA 2R7WA 3EE3A 2Z30B 4NXNF 4CO4A 1UVJA 1O5JA 3TJAA 1Q82T 4UY8T 3BPSP 1ZAVA 1HHSA 3O8WA 2MLZA 4QJVA 1JJCB 5H9FJ 5KG4A 5KFJA 1S57A 2JHEA 3O1LA 3PYDA 2W25A 4YR3A 2KT3A 2B4OA 3SSSA 4B9TA 3HZGA 3OPKA 1ZZFA 5KFUA 2QLXA 3GIRA 1F9FA 1RTJA 1LK7A 3GJRB 3CW2C 4NLUA 4LR8A 2QA4G 4HACA 4NYOA 2NLWA 4TU8A 2HBQB 2JEIA 1UW9A 2B56A 1C0UA 3AB4B 1VI7A 1RXOB 2VICA 2Z0GA 4USTA 2IVMA 3I56S 4QIWD 2MHNA 2XYGB 2HHSA 3IXQA 1FDDA 5ETMA 3MMCB 2AEJA 4O3NA 3RB4A 1NB7A 2GAHC 5J2PA 2B5JB 1QUVA 1WC6A 5AXNA 4ECZA 1RT2B 1W7WA 3FQKA 2Y8YA 2VG5B 2VQFJ 2VV5A 4IKAA 4HHUA 1UEVA 3PXGa 1FDNA 1RTIA 2J8AA 2CPZA 3CD5A 3BGUA 2QGFB 2QIFA 4CI0B 4K4VA 1G2EA 1S6OA 3G4SS 2AW0A 3OVSA 3HCXA 4RO0A 4E2FB 4CO3A 9RUBA 1PKUA 3CDWA 3Q8VA 4ZVUB 2I2YA 4U8YA 5K20B 3T5KA 3BSAA 4LF1A 4KHRA 4XAKA 3Q0AA 2CJAA 3QATA 3Q2TC 5L1LA 2CPIA 1TL7A 4KPCA 1PYOB 5K14A 2F3JA 4C11B 4FF1A 1M5VC 5EN1A 2WVEA 1MSWD 1VRTB 2AX1A 2AJ0A 3SSQA 2CQGA 2DR8A 4F0HA 4LF7J 4YY3F 4XDCA 5AXKA 4N76A 1KHWA 2ASYA 4X66J 2DXDA 1WF0A 2UVVA 1IBKJ 4I64A 1F3FA 5F0UA 2Q66A 4MK7A 4ECRA 2XY7A 3UD5A 2JX2A 4LVNP 4IUFA 3Q8UA 4ZHRB 2EW9A 2AU0A 4WPAA 4KGXB 2WAQD 4EZ6A 4IFYA 2DXFA 1WJ9A 3X3UA 3AT1B 4ZVEA 2FD2A 2LQ9A 3SQOP 2OEKA 4HT5A 1AUDA 2DNOA 1BQNB 5LM7E 2DH9A 2LCWA 3Q83A 1YTYA 3M6XA 3I0RB 1FRHA 3DOKA 4WE1B 2HHPA 2ZWPA 3BEGB 3G71S 1IUJA 2KO1A 4ZIWA 3G87A 4OZ3A 5G4DA 4RUBA 4BLGA 5CD4H 1FXLA 1QUPA 3IBCB 1FFWB 3J81Y 4H4OB 4QWCA 2JC0A 1RTHA 1HBUB 3M2RB 1X4GA 3NGTA 4IO1A 2KG1A 1SCJB 3DXSX 1TKXA 2MQMA 5AE1A 3W2VB 4JV2A 3LUYA 2FJWA 3ZZYA 4CLWA 4KV8A 2UUAF 3VGVA 3NMRA 3TZZA 1U1QA 4K4YA 2IM2A 2X1FA 2V9WA 1QJHA 1JLFB 3HHLB 4Q7AA 4O0IA 2Z56B 4PYAA 1MW7A 4F67A 2VKZG 5DG7A 1MG7A 3GFXA 3FSXA 3IG1B 3HSJA 3CDAA 2XB2D 1LWFB 3QNWB 2N82B 2OSQA 3MPVA 4F4AA 2I8EA 4WFXA 5DG9A 1B0TA 3N9UC 3DRYA 1RT6B 1AFIA 2EC0A 4C3MA 4R5PA 3KLFB 1DY3A 4PG4A 2GV1A 2I5JB 1YRTA 3D9BA 4HI1A 1M5PC 1TK0A 3VTIA 2XY6A 2B4VA 2ROPA 2NR0A 2QMXA 1HBMA 3CJTA 1NU4A 3J80U 1CULB 1RBOB 1WSVA 3R7BB 4OYPA 4RNOA 4HEA9 2HZAA 4QU7A 4PUOB 1R8BA 2VQEJ 5EWEA 3LPYA 1QVFR 3AODA 1YJRA 4M5KA 4ER8A 3OL7A 4QPXA 3PTWA 1VIOA 5KT3A 5JJBA 2C3MA 2HFUA 2E9TA 4NX9A 1T95A 4OI1A 2DHXA 2WZ1A 2BBEA 2AJ2A 2RMLA 3R8YA 1N32J 3JSMB 2Y1RI 2VUGA 2NUUG 1XNQJ 3I31A 4WTYA 2CA9A 4I2QA 2M9KA 3LOUA 2GHWA 2W2MP 1S1WB 4LR9A 5D3GA 4AXJA 4QWAA 4M5DA 3RR7A 2EKNA 2Y1IA 1XTZA 1KTQA 2RUGA 4CM0A 4ZPDA 3LGHA 1BUXA 4CO5A 1NK5A 5CYQA 3U27A 3T3FA 2F8EX 4MKBA 2EXUA 2HGLA 1B4SA 1YGYA 3KK3A 4AL5A 1WNEA 2KZMA 4GO7X 3SBMA 2J8SA 4HDGA 2HGNA 3NCQA 4ILMA 3LGMA 3NEKA 2PMZD 1WEXA 7FD1A 2DH8A 2YTCA 2QLFB 5DQIA 1D1UA 1FJCA 1D09B 3TVZA 3TZXA 1ZOTA 2BEFA 1CG2A 4YR0A 1PG5B 2JZ5A 1F5CA 1KVKA 2E5HA 3BGOP 1HWUA 3TA0A 4IRDA 4WCEQ 2ZWOA 1UVLA 4GRSA 4EYHB 1KR4A 1HNIB 4WP8A 3KHRA 1PSDA 2FHOB 3NG8A 2FLLA 4LVOP 2FLPA 2L3MA 1S6QB 4ID8A 3I9ZA 3RAQA 1NJIT 5L1JA 2HNYB 4WTOB 2FHJD 4O23A 4WZQA 2F1FA 4K0KF 2A2CA 3HP6A 1RWMB 3K17A 4JV1A 1JK9B 2LU1A 2VDIA 1GX6A 3ENWA 1WOPA 3MMCA 5CZXA 2B5JA 2QFJA 1RT2A 1OY9A 2VG5A 2GJFA 5DQGA 2K3IA 2QSWA 1IN0A 1MN7A 3BBCA 2KT2A 4RW9B 4K4ZA 3AJ1A 3SI8A 2FUG9 4X4PA 1JLCB 2ZH3A 4WP3A 5B08A 1DARA 2IYGA 1P27B 2QJ3A 4B08A 3QBCA 1N33J 1M5KC 5EX0A 3Q89A 1UL3A 2V67A 3PW0A 4FXDA 4CH7A 3DU6A 4C11A 4USUA 1VRTA 2J7WA 1T9UA 2CZ9A 3GYGA 3TEHB 2RQ4A 2HVDA 1YX2A 3EPGA 1MU2B 4I7FB 1M1KT 4JI1J 4I67A 1YSJA 4LRAA 3POTB 2VPYB 1IJEB 3K58A 2V8DA 4MIBA 3R2CJ 4Z7CA 1S4EA 2UUCF 4H4MB 2MYFA 1B0PA 4ZHRA 2B9XA 4ANDA 3D3BJ 3N6MA 2L41A 1JLGB 3EGNA 4OZ0A 5CA5A 3N01A 1BC6A 4PEOA 1KOOA 3HVWA 4QWDA 1S1XB 4DU8A 1BQNA 3UQSA 2BZ2A 1U8WA 3UDLA 4DEZA 4OX9J 3HX9A 3I0RA 1NSKL 4WE1A 2DGWA 1XJWB 1RUSA 2XY5A 3DRRB 2L08A 2N3OA 3OR2B 2C3UA 4RW7B 4ES2A 2MKCA 1YRUA 2P6TA 1PBAA 5LXRA 2ZNYA 4H4OA 3TQ1A 1WTFA 1HBUA 2ZD1B 2QZ8A 2F4VJ 3M2RA 3H5UA 4DX8H 3JSRA 3BGRB 4UZBA 1KS2A 3DLJA 4N47A 3FBCA 2D9PA 2GAGC 3DDNA 3W2VA 2IBKA 4LSLB 4NZ0A 4KTQA 4ZITA 1FKOB 3W65A 2F65A 3L7OA 1ZAXA 2C2NA 1TUWA 1JLFA 3HHLA 4DV1F 5T7LB 4IOAQ 2E7XA 2F8MA 2OTJS 2BQUA 4ELVA 2P9CA 2HHVA 2BYCA 3IG1A 2CAJA 5KG1A 4MKAA 1NDPA 1Q5VA 2ADCA 4GKJJ 1LWFA 3F41A 1UVNA 2LQ5A 2AV5A 2ZBPA 4PG7A 2XLKA 2VD3A 3HD1A 2NXUA 1NHKL 3ZTQA 2WB1D 4CH0S 2OP5A 1RT6A 2HQGA 5KFPA 1HKAA 2V2QA 3KLFA 2I5JA 5B7WA 1HL6A 3NOGA 4MAKA 4N41A 2CVIA 3M6WA 4K5SA 4NCAA 2AJQA 3E8OA 4D3HA 1P8GA 2XLJA 3KG4A 1CULA 4KGKA 5HVHA 2RNEA 4OYXA 1GMWD 3K7RA 2IRUA 4PUOA 2N4DA 4PWDB 4J9PA 1CJUB 3W5XA 1K8AT 3TW0A 1U8SA 2CJXB 3KXDA 1TUVA 4OV6A 2MKIA 1KQSR 3ISZA 1X31C 2HEKA 1URNA 3BQ0A 3JSMA 2KHCA 2EG1A 4NXNJ 4TYBA 1UWAA 2FVRA 4Y0FA 1MMLA 1S1WA 2DIUA 2CNLB 3AD8C 4OL8A 4OFZA 4NMLA 2VJVA 4NASA 2V2ZA 3M8QB 4C0OC 3SZ2A 2HQFA 3NGRA 3FQLA 5D0EA 3TUZC 2YQ1A 3R5CA 3EXCX 2CQ4A 3L3CA 4ZIVA 1W25A 2KVQE 3MEEB 2VZ9A 2J6UA 4Y3CA 3AH6A 3W5YA 3MD3A 1UTAA 4ITSA 2GJ2A 3BH6B 2CQIA 2EFQA 2FZGB 2HFNA 5A6PA 3C3LA 1AW0A 1RTZA 1RHRB 3GIKA 2G4BA 1FFGB 2CYYA 3VF0B 2HK2A 1B7FA 5KT4A 2AD9A 1FERA 5L38A 1IBLF 4USWA 3NXZA 3KJQB 1U6ZA 1UZDA 5F8JA 1HNIA 5HSPA 5A8RB 2XZTB 1U4BA 3D1HA 3KHLA 4KPYA 3KNAA 4NZ7A 1U1MA 3CWJA 4JI3J 1S6QA 3BH7B 2HNYA 2ZBIA 4ETXA 2CDQA 3C19A 2RF2B 1RTDB 3C6UB 2LA6A 1RYRA 5M2RA 2IA6A 2DNPA 4MH8A 4HTIA 2ZITA 1Y3KA 1U48A 3VAJA 2YNGB 3HM9A 4A4JA 3W3SA 1FI4A 1VQ4S 4ZPVR 3QMQA 3M32B 4YY3J 2JLGA 5K8OA 1R3NA 4KR0B 1U1PA 4OI2A 3CUNA 5FDLB 1KLMB 1HBNB 2XMVA 4RW9A 1JLCA 4ZVOB 3C46A 4YHHF 1HI1A 2V68A 3BM7A 4J9MA 3UD3P 3K57A 1NBEB 4GKKJ 4ZOSA 2W4CA 1KNZA 4HDHA 1H6KX 1PJ6A 2Q79A 4CH1A 2JVOA 4UOGA 4TNOA 2M3DA 3QAEA 2W2PP 2ZEJA 3OTEA 3V6KA 3MZIA 2X1AA 1HWIA 3H25A 2J0QD 1XMOF 2EEYA 5J1PA 1WACA 5EWGA 4I7FA 2EBEA 4FXVA 4DUYF 3RB0A 2VOPA 4NLRA 3POTA 1NSAA 1QDUB 2PSZA 1SIWB 2ZOFA 1X0PA 3CD7A 4CZCA 1VQOS 4QR0A 4HH1A 3S6EA 1Q5YA 3W63A 2U1AA 1RWPB 4H4MA 3GFYA 4NLXA 3QWPA 1NUEA 1YBAA 2ZUGA 2CPFA 4OHVA 4DV0J 2DRBA 1JLGA 3MUTP 2HLTA 4F7VA 1NB2A 1GQEA 1NDLA 2UUAJ 4TU9A 3J7ZT 1EARA 4NYPA 1S1XA 1VQPS 1BXNA 2RD5C 2YQ0A 3OLBA 3E01B 2O01C 4DN0A 1HW8A 4OZJA 2DR9A 3N5BA 4DMZA 3BSOA 4LQ3A 3PW2A 3ZTPA 1N56A 2B4UA 3DRRA 3D6TB 1S1TB 4NEYA 3CCTA 3OR2A 3PYFA 1HR0F 4RW7A 4WFYA 5D0GA 3TA1A 3V6DB 3UDCA 3M8SA 1EX8A 2ZZNA 2BJ8A 1IWAA 2PT0A 2I6WA 2BW7A 2WW4A 1HNXF 2ZD1A 2JC1A 1WSRA 3TWZA 4DR1J 3BGRA 3VGTA 2MB0B 1NXIA 3DFEA 4LF9F 2OMLA 3KJFB 4Y34A 1VBXA 3GZ7A 3EXYA 4X2BA 3NNAA 4LSLA 1FTRA 1FKOA 2VBYA 3KLGB 4DV7F 2B8QA 2L9WA 5D77A 3QYYA 3QIPB 2G0CA 4B3MJ 2AGPA 5T7LA 1SKRA 2HBRB 4F25A 3FVYA 3KLVA 4OX8A 2HQDA 2FVCA 4TQSA 4DX7A 4P10A 3OHAA 3JQMA 1K44A 4QYZJ 3KMSA 3CE8A 5K8PA 3HULA 4C97A 1N36J 2BDPA 2IM3A 1BD6A 2X1GA 3R5AA 4TU7A 4OZ1A 3OFHA 2F8HA 2BJDA 2GMHA 3VAGA 1N5YB 3FC9A 4UUXA 4ZP8A 3M6UA 5AJ3J 1GXTA 2AF6A 3A8IA 2FC9A 4PWDA 1CJUA 3M05A 2E5LF 3CMAS 3UCZP 2HWIA 2QRRA 4BCAA 3MR3A 3ITHB 3TP2A 3WHIA 1UVMA 2CQDA 1NK8A 2KFYA 3UFCX 2OKQA 2KU7A 3MPUB 1VC6A 1YWXA 3US5A 4WK3A 3SCJE 4DV4F 1NK9A 2RIJA 3CCWA 3A1YG 1U2FA 1L3TA 3NWRA 1ZM2A 3PJWA 2V9KA 4J5OA 5DO2A 3G8SA 2BE2B 1Q16B 3CMQA 3JXOA 3AA9A 3M8QA 3MR5A 2OUGA 3N28A 4LRBA 1IKYB 3M2UB 3CF5Q 4U6PA 2YWFA 4YB7A 2KL8A 2J5AA 2CZ4A 3MCNA 3QSYB 1REVB 3MEEA 2YH0A 2ZH5A 1H3DA 5CXTA 1UCNA 1Q7YT 5JXSA 2MJNA 2EPIA 3D1QA 2P2CB 3K5PA 4A8FA 1C0TB 4FYXB 3B4DA 3AJDA 3Q8QB 4G3IA 4F4KA 5GAGU 4FVCA 5LJ3Y 4ID5B 3BGFA 3HSGA 1N34F 5E3RA 1R43A 3JAMY 3I4HX 1FRJA 4QZVB 2ZHAA 3HKZD 2CZVC 2R7RA 2AJ1A 3MR7A 2CQ2A 4L3NA 2FJVA 4DR5J 1L5UA 3GIIA 5A8RA 4C3KA 1VLYA 5ETOA 1MMDA 3D2WA 4QPTA 2HZCA 2ATCB 4KKOA 3FDSA 2JLFA 2W7AA 2VIHA 3ENQA 5T14A 1S77D 3FCHA 2RF2A 1RTDA 3C6UA 2EFPA 1FRMA 5I42B 5IWAJ 4X62F 2YNGA 2A1BA 1SQFA 2ACMA 5IQQA 4JI8F 3G82B 1IWGA 1SB6A 1R8HA 3M32A 3HJFA 3KOAA 2FIUA 2AQ4A 4ERDA 1LOUA 5FDLA 1KLMA 1VFJA 4IQXA 2AMCB 2R7QA 2I38A 1HBNA 1TELA 4AYBD 1U0HB 3TANA 3MOJB 5M2PA 2UUCJ 5IQ6A 2H1YA 3GYXB 1H0HB 3HSZA 1AB8A 5IC4B 4LF6J 3DXBA 2BOAA 4DL7A 4WYWA 2OEMA 2PA8D 4IR1A 1H98A 1V5IB 3LW5C 5KFSA 4DL3A 1RLCL 1SL2A 1IJFB 5KT2A 4K4WA 4USHA 3HO1A 1HQUB 1TL1B 4DSKA 1B70B 4IG0B 3L9ZA 2G2ZA 2RS8A 3DRXA 3PZPA 4J9SA 2YX7A 1L3SA 4ECWA 1KWMA 1UJ5A 1NNDA 2NPIA 4LFCF 2ZHBA 1RU2A 3P3DA 1RAHB 1V6HA 4DQPA 1FWKA 4HT7A 3U1MA 2C3YA 1RAEB 3VQTA 3Q8SB 2B3TB 2UXCJ 4FPRA 3H5YA 2A18A 2DO4A 3GIJA 3CJ2A 1KTVA 3CCZA 4CRJA 3HKWA 5A2QY 3GSDA 2FPHX 4NA3A 4L76A 3GP9A 3VVUA 1IQZA 4JP8A 2GQ2A 1UEUA 4CTAB 4DPOA 5K8MA 3E01A 3WIUA 4CWBA 3EGZA 3QJLA 7FDRA 2VA3A 1NZ8A 1FX2A 4Y2IA 2YWWA 1S1TA 4AQYJ 3RG6A 3DC2A 3EJMA 3R1HA 4OYMA 3V6DA 4ECVA 4KGZB 2XULA 4C2MA 3NOCA 4XDDA 2EKYA 5GAGI 4RNFA 2GCFA 1NEEA 2W9CB 3V81B 2UUBF 2HHWA 3RRHA 3KKFA 4DUZF 5BJRA 2XZDB 4YOEA 1QTMA 2DGQA 5B0CA 3OTDA 2RSQA 3CVKA 4JI4J 2H51B 1LW0B 2CJQA 4NLQA 2BABA 1IVZA 3L4BC 2CPXA 3IGVA 4DU7A 2GZOA 3WX8A 1Q1KA 3KLGA 4B02A 2HRTA 3SIPB 4XK8C 3LGNA 3QIPA 4O3SA 1VQKS 4X4NA 1RE1B 5KG3A 5KFEA 2UVWA 5L9NA 3GV5B 4UT4A 4LF8F 2RKIB 3BBFA 2ROGA 2DHGA 1PILA 4G6VB 2HAFA 1N88A 2XHWA 1Q8BA 1Q8KA 4CM2A 2PMHA 1F5BA 1HLWA 3SV4A 4L6V3 2PDAA 1HNWJ 5F8GA 2ZKUA 1X5TA 4FYDA 5E2QA 1VOMA 4ZP7A 1ZZNA 3G6XA 3QAUA 1CBKA 2J76E 2DNKA 3PM9A 4DN9A 3BZQA 1HYSB 2Y0SD 1I94F 1K1QA 4USIA 5E0OA 3ZC4A 2LEAA 2E1MC 1AZSB 4U7UD 1WC0A 1NK0A 1N5YA 1Y0HA 5ITHA 2V4JB 4LF2A 3R3TA 1X4HA 1RI7A 1NJWA 2E66A 1AT1B 8ATCB 3U1LA 1JLEB 1DFDA 4NYZA 1GH8A 1ICEB 1HNZJ 3OFEA 3KJNB 1RZMA 4YB6A 3ICLA 3ITHA 2ILZA 3OHBA 1FTCA 3C14B 2B0GA 2M7SA 3T1YF 2D9OA 3T41A 4LRFA 3PVXA 4X4UA 4GVLA 5BR8F 1KSPA 2DNQA 1KKHA 3Q24A 1Q95G 1VQYA 4YEAA 4TLQA 4U7CA 3M4XA 3N0VA 2A6MA 4N7TA 4KHMA 3BO4A 4NWBA 2ZZMA 2LU2A 4OJ1A 2ATLA 4DCJB 2MY8A 2BE2A 3ENVA 3VAKA 2X51A 4U95A 3M30B 1NKCA 3M2UA 4WF9Q 2XMAA 5GAHU 1RABB 2OTLS 2BJ1A 8AT1B 2Y1JA 3FZ2A 5CHCB 3B6BA 2ZDPA 4JI2F 1REVA 3AOCA 3L7UA 4AE5A 2A0FB 1NHVA 5F8IA 1S5ZA 1VJQA 1A9NB 4OI3A 3RR8A 2C1EB 5HAOA 2UXDF 1IBCB 1XMQF 4EMDA 3O44A 3DI6B 1C0TA 5KOWA 2AEMA 5SZTA 4DQSA 2MDAA 3MUVP 4DV6F 4FF4A 1RWOB 4ID5A 1XQIA 4I1TA 2M88A 4ECUA 4CLFA 1H7XA 3IC1A 1VBZA 1LV5A 3KJVB 4E8UA 1MMNA 4LBPA 1ZA1B 4OQJA 1NPRA 1VQSA 5IOLA 2LXUA 3OJSA 4ZLLA 4I68A 1KHVA 2KXNB 2NPFA 3S01A 4TLRA 4EFAC 3T19A 2M4MA 3MPDA 3CPWR 4F3QA 3DMJB 2FHKA 2QYGA 1KFSA 4ZN1A 2FLOA 5I42A 1QE1B 5CCMA 3TUPA 2XI3A 4FNIA 1GMUA 4NLYA 1EB0A 3G82A 2VG7B 1XMOJ 3CDBA 5HMYA 3I5CA 3QZ7A 4DUYJ 2KYZA 4YS2A 4XIUA 4ED3A 4NLDA 2BM0A 4K4XA 2HG4A 2VPXB 3TX0A 1U0HA 5ETNA 5LJ5Y 3ENAA 1TL5A 3Q86A 1F2GA 4PG5A 3OUYB 2QL5B 4PPDA 1X4AA 1T9TA 4DS4A 3P6YC 3FEXB 1LXNA 4ZLPA 2UV8A 2HNDB 4TY9A 2WVBA 1TKZB 4C7QA 2ASDA 2PFFB 1ZBTA 1F60B 1TAUA 3TQEA 1H2UX 5DM6Q 2OSRA 4C0HA 4C6AA 2AEFA 4A8QA 1CLFA 5KFQA 2HQ3A 4HYKA 4CLTA 1UJ6A 5KFBA 2QA4S 2OO4A 3MCMA 1HQUA 4ZPCA 2G13A 1TL1A 4IG0A 4DLEA 3PACA 5DGAA 4P2MA 3FSIA 2CQPA 1H7WA 1G7CB 1S0MA 3FUYA 1QTNB 4DG1B 3MECB 3NAHA 2B9EA 3AOBA 2ADBA 3PIOQ 3R5DA 1HR0J 3GCXP 2BKPA 1X8DA 1VBKA 4I0WA 1F5AA 3M7VA 1RAAB 3FFIB 3UPFA 1R6YA 4L74A 4ZPTR 1RGVA 4PWWA 1HNVB 5DRKA 5F8LA 2HAIA 2XCPA 4J9KA 1F1BB 2D74B 3CJ8A 1T9WA 2MLYA 3R5JB 4P2FA 3HD2A 3N5FA 2NS1B 2E9RX 4KE5A 4OZNA 3UNGC 3PHEA 4LSZB 4CTAA 3RBEA 2W7PA 2DHAA 3J7A1 3QO9B 3MM8B 4NLSA 1T3OA 1S9GB 1CJKB 1CEZA 3D3CJ 2FTRA 3TA2A 3EVMA 4DL6A 1K73T 2R7UA 1PCAA 5D4PA 1T9VA 4JV5F 3W2WB 5CYMB 1X5PA 4DCOB 1VC5A 1EZZB 1EAYC 4DV2J 3DGVA 3P8BB 4LFBJ 2Y0BB 2W9CA 3V81A 4RW4B 3ILLA 1M90T 2EG2A 3RW6A 3RAMA 3BGLA 4DZDA 2VB6A 2GGPB 2OEJA 1J2VA 1RP5A 1IXKA 3AOAA 4NEZA 1JLBB 2ZVSA 5EDWA 4NXMF 1T02A 1NJYA 5EUHA 5C25B 1XR6A 3Q23A 1LW0A 5F3ZA 1E6VB 4X4RA 2DY1A 2KRRA 2HS3A 4YMEA 1YBUA 2ERRA 4CLZA 3VAMA 2G1HA 3TR5A 3BSCA 2RKIA 1UMJA 3EX7B 1RHMB 2NREA 3BBBA 4Q8FA 4NL5A 3HVRA 3HZEA 1SUQB 2GMLA 2DH7A 4ZVFA 1JJ2R 4U96A 3PHTA 3PV8A 4Q45A 3D67A 2VF3A 1NJZA 2GX8A 2IJRA 1HYSA 3H90A 1RAGB 3AJ2A 2FDNA 4DR7F 2CQCA 2K7KA 1AZSA 4N77A 1HBOB 2V4JA 2DNNA 2QEXS 4DSJA 3OTCA 5J1EB 1U45A 3G2XA 2UU9J 5KFLA 2MKHA 5ETTA 4EZ9A 2V63A 1JLEA 5IM0B 1F0XA 2H48B 1QSLA 4X65J 4N8NA 4J9VA 3KMQA 2OPSB 1S76D 3FBEA 2KTQA 5E7OB 3TUJC 2O5DA 4A8OA 5HL7Q 2HBZB 4U9RA 1KD1T 1ACMB 2D3O1 2RU9A 3C14A 2XEXA 2DPJA 5DZ6A 3LWMA 4ZVHA 4AUKA 4WXWA 5EHHA 4OYIA 2CG4A 2FY1A 1WKJA 4X64F 1BQXA 3HSDA 2JOQA 2DEJA 4KIAA 1VQ5S 3RB3A 1IQTA 1EKSA 4X4SA 2AJ4A 2OELA 1DTQB 1M5OC 4C8ZA 3CJ5A 4HR2A 3IBFB 2VBWA 4UW2A 5ADZA 2BJ9A 1FK9B 3EDQB 3J7YU 2CWKA 3M30A 3CGIA 2VFUA 4I2PB 3NKYA 2NXCA 2IM0A 1AA1B 2DNMA 1FD8A 5HJYA 2IDLA 1Y3JA 3D28A 2HRYA 4WP9A 4NLOA 1RHKB 3SCIE 3R6LB 4BWMA 2ZNZA 3CD0A 1T94A 2FVSA 2C2OB 2A6OA 3FKBA 1NPPA 4FYYB 1X60A 1RT1B 3G9CA 1TZ0A 3EWGA 1SL1A 3TJ8A 5HQLA 5L9XA 2IMWP 4X62J 3DI6A 3DNCA 1U47A 4B3OB 3NRBA 1VDHA 2RQCA 3DU5A 1KRPA 1R7IA 3CCES 3KJVA 3MPYA 4S0MA 1DHMA 3H5SA 5LXYA 3R97A 4OX7A 1R0AB 2W1BA 4KQZA 4HI2A 3BV8A 3E3XA 2DT9A 4IQMA 5K8NA 3VZIA 3LALA 5CAAA 4NZ6A 2RDJA 4K2JA 2QLJB 2DNZA 2Y1LB 2CG8A 1SC1B 1C2PA 4FYWB 2VASA 3DMJA 3QT8A 2AZ3A 2PEHA 1HW9A 1QE1A 4NCGB 5I3QA 4LRCA 4JI5F 3OBIA 3UDVA 2VG7A 5J2NB 1VQ7S 3CO9A 1C1BB 4RKUC 2IHR1 3D0GE 3DHXA 1S1VB 3THVA 4M5NA 1PIEA 3NL0A 4DUTA 3MI7X 1RT5B 1S12A 3R5BA 3OUYA 5HVFA 4FKXA 2Q1LA 4DF4A 3TVYA 1S7IA 1RBLA 1MWZA 2KHDA 4C4WA 2HNDA 3VR1A 3CIZA 1TKZA 1Y00A 2R4FA 1FXDA 2M8HA 5F8HA 3ZFVA 4M5IA 4Q2LA 3TARA 3PRVA 1VMBA 3K59A 5F8NA 5DQHA 4YB1P 3IAM9 2B7CB 1DURA 3I6PA 2V34A 3MD1A 5F8MA 1VQLS 1RHUB 2R2RA 2NUHA 2BACA 1RT7B 5LSLA 1FE0A 1PAUB 3X1LB 4Q8EA 3IWNC 3G6VA 1J5EJ 4CNYA 1LNQA 2K06A 2RRNA 4A47A 1PYSB 2HVEA 3NWGA 4LF4F 3K8VA 4HVZA 4DG1A 1HWLA 3MECA 4BC7A 2YKPA 3W9JA 1Q78A 4ZCLA 1M0SA 4EU0A 4JI7F 2VFVA 1WKKA 2APOA 5KFGA 1SQEA 5L8RC 3FFIA 2OIHA 4PPZA 2ASLA 1U1LA 2UUBJ 4CDIA 1HNVA 3VAHA 1QD1A 1N0VC 1R8CA 4DX5A 4OYZA 2N3LA 4B3RJ 3H4DA 2G1DA 4DL0C 4YB5A 2KM8C 1SKSA 4KHPJ 5ETKA 1B7YB 5H9FK 5D4OA 4LFAF 4RBTA 1OPIA 1BLUA 3QO9A 3MM8A 1NZAA 4B9LA 1S9GA 4JI6F 1N8RT 1CJKA 2CNKB 5HK4A 1O6XA 4LF8J 4KB7A 3CD6S 1J27A 1P9YA 2DR7A 1I6JA 1FKAF 3ZTRA 2DGSA 1VC0A 3W2WA 5CYMA 4Y2MA 2HHUA 2N4CA 4JOUA 5D6GA 4RW4A 2XI2A 4MT1A 1EP4B 4TVAB 2GGPA 1XIQA 3W60A 1YLXA 5F9LA 2R7VA 4EO6A 4PAAA 1JLBA 4PWUA 4R25A 1HFEL 3MM6B 5C25A 4LREA 3CJKB 1E6VA 4F50A 1I94J 1JXLA 4ZLJA 2BMBA 4LF5F 1BQMB 4DR6F 3VCDA 1TR0A 2CVEA 1RKIA 2R7OA 4C3LA 3EZOA 2MQPA 1WKLA 1Y10A 2FY8A 2P8IA 1XWLA 2MY7A 4LUBA 1IBMJ 2Z2MA 1TK5A 5DJBA 1APSA 2LFVA 3JSBA 2BJEA 1FRLA 3OT9A 1S9EB 3UI3A 3T5LA 1KVIA 4X4TA 4EGLA 3NNCA 3LTOA 1SUQA 2H3EB 2XMUA 5BYRA 1R89A 3IA0A 4PXEA 4WKYA 4ELUA 5LSOA 5JVGQ 4ECSA 4EYIB 5KFFA 3W8PA 1DJ0A 1RK8A 5ETPA 3IAS9 5AT1B 2UUTA 3KLEB 1HBOA 3OV7A 3EGVA 3HHNB 5J1EA 5IM0A 2Y9HA 2VQFF 2QLWA 1KBRA 2OPSA 2GIFA 2H4WB 3NS5A 4CYUB 4ECXA 4DHVA 4DR3F 1U1NA 3OVBA 3BKUA 4W90B 4JI2J 2D69A 2XMJA 3CT9A 2B7BB 4NA2A 5THWA 2FJAB 2F9JA 2RHQB 3UN2A 3MMJA 2WSFC 2W4DA 3D4JA 4FPIA 2RRAA 4F3MA 1D0EA 2W8LA 3EICA 4ED0A 3ZZTA 2DR6A 1RHJB 5M2UA 4AL7A 3LWLA 3GR0A 1VQ8S 3DHWC 1DTQA 1FWPA 3ZZ0A 2HVIA 1YJUA 3H8YA 4LF7F 2C22A 2Z58B 4DFPA 1JKHB 1FK9A 4I2PA 1SVDA 3OJUA 2F5GA 1NDKA 3HMJG 2HPUA 1IBKF 3HHEA 1N4LA 1IR1A 1SV5B 3BJYA 4NMXA 1RT1A 2HLUA 5IT9U 1WHVA 2PI4A 1X4EA 4J9RA 1FT8A 3UWTA 1ZTWA 1WEYA 1HPZB 4WU3A 2KJVA 2DCUB 2HS4A 4FDFA 4I6AA 2JJ4D 4B3OA 3U1NA 3D0IE 1Q81T 3KG0A 2CNOB 1S6PB 4FF2A 5H9EJ 5FLXU 1I3OB 3IR7B 1RT3B 2XMKA 2DJWA 5IS2A 1R0AA 5CYJA 2IY5B 2YQ3A 3QT5A 4R0EA 2JEGA 1TUGB 4UZCA 5GVQA 2YXLA 3D0HE 1SJ3P 5C42B 1R6VA 1WC4A 5KFIA 1NSQA 3BO3A 3BN7A 5IC6B 2XO7A 1WD6A 2RDDA 3KWMA 4NCGA 2RJZA 2LDIA 4DV3F 4CT8A 3C15B 1YITS 2HIQA 5J2NA 2W24A 3MDFA 1C1BA 9ATCB 4B9NA 1QY7A 4DSLA 2LEBA 1S1VA 1RAOA 3U02A 3D7SB 1RWWB 3BO2A 2U2FA 3CC4S 1RT5A 3DOMB 1KQGB 1S59A 3TOQA 2WSEC 2D41A 3A12A 3CULA 3IN5A 5KFWA 2ZUAA 2ZOGA 1ZA2B 3E51A 2GHPA 5K5MA 6FDRA 1B3TA 4OHWA 1OY6A 3UNYA 3PW7A 1HI8A 3QRRA 4RLEA 5E3QA 1RT7A 2XSJB 3MR6A 1RA6A 4MK9A 3IM9A 1Z4UA 4KC5A 4EUVA 1RAJA 2YNFB 1U1OA 4OJ3A 4DSEA 1XC9A 1VISA 1SBRA 4CCHA 1RHQB 3ET6B 4JV5J
chains in the Genus database with same CATH topology
2Q43A 1R8HA 3M32A 4RBUA 2VQEF 3QWUA 1QAJA 2QMWA 1X7VA 2F40A 3HJFA 2R7XA 3KOAA 2FIUA 4JYAF 1G6BA 2AQ4A 1KQKA 3L09A 2IVFB 2LMIA 2K1RB 4ERDA 1LOUA 4ZA1A 1KLMA 3G8QA 1VFJA 3HF5A 5FDLA 4IQXA 4DR4F 2R7QA 2I38A 3SCLE 1DQ9A 1HBNA 2D3UA 2FJEB 4Q44A 4URQU 4AYBD 3HK2A 5KOXA 2ACYA 1S7HA 3TANA 3UE2A 3MOJB 4F2SA 1O0PA 2R7WA 2XWYA 1D9FA 4BWJA 4NXNF 3IWXA 4CO4A 4IRKA 5M2PA 5IZHA 3AY0A 1UVJA 1O5JA 5IQ6A 1Q82T 4WKRA 3GYXB 4UY8T 1H0HB 1ZAVA 1HHSA 2PC6A 3O8WA 4QJVA 4RW6A 3K0JA 1KVJA 1URRA 1NKEA 2KVIA 5H9FJ 3HXMA 1A6LA 3WC2A 1LWCA 3DXBA 5KG4A 4DL7A 4WYWA 5KFJA 3OXGA 3BDPA 5C24B 2PA8D 4IR1A 3IR6B 3GE9A 1NRKA 2JHEA 3O1LA 3UW1A 2W25A 2XMWA 3P5TL 1ZETA 2DPIA 4YR3A 1N5QA 2KT3A 2B4OA 3SSSA 3V6JA 1H98A 1XNQF 5A8KA 4OI0A 4B9TA 1R8PA 5KG0A 1IKWA 3HZGA 3OPKA 3G8TA 1ZZFA 5KFUA 2QLXA 1G1XA 3LW5C 5KFSA 1F9FA 2KXHA 4DL3A 2VH7A 1RTJA 1TKTA 1LK7A 3OQ2A 1SL2A 1IJFB 5KT2A 4NLUA 2QA4G 5GMKa 3P49B 4K4WA 4USHA 4HL9A 1I1GA 5SUHA 4NYOA 3HO1A 2NLWA 4TU8A 2KZZA 2CJ9A 1FVQA 2JEIA 1HQUB 3DOLB 1TL1B 1VRUB 2B56A 4DSKA 3O2IA 5KFTA 1AROP 1C0UA 3IR5B 4IG0B 3AB4B 2JH3A 4X4OA 1VI7A 4LIWA 3L7PA 4G1PA 2XMTA 2RRBA 2Z0GA 2RS8A 2IVMA 3I56S 3DRXA 3PZPA 4QIWD 2MHNA 3DYAB 4J9SA 2HHSA 2YX7A 3IXQA 1L3SA 1FDDA 3MMCB 4ECWA 2CRLA 2VG6A 4O3NA 3JB9k 3RB4A 1EP4A 1NNDA 1UJ5A 4OHZA 1FEEA 4OJGA 4ZPWR 2RE1A 2IC3B 1NB7A 2NPIA 4LFCF 4NA1A 2ZHBA 4RW8B 5J2PA 1O8BA 2JRSA 2B5JB 1QUVA 2VBZA 2EBGA 3P3DA 1FE4A 5AXNA 1V6HA 3PW5A 4JV0A 4ECZA 4DQPA 2HHXA 1RT2B 3FQKA 1ZM9A 3CTRA 3MM6A 2KB2A 2VG5B 4HT7A 5MAOA 1S99A 1PGZA 3CJKA 3U1MA 2C3YA 4FBTA 3VQTA 1SH2A 3CDEA 5G0RB 3Q8SB 2VV5A 2B3TB 2VL1A 4IKAA 5GAHI 1YJ9S 1UEVA 3PXGa 1FDNA 1RTIA 2J8AA 2CPZA 3CD5A 3BGUA 4FPRA 3H5YA 1BQMA 1N48A 2A18A 2DO4A 3FEZA 1AXQA 3CJ2A 3GIJA 1KTVA 2QIFA 4CI0B 2VFRA 1YVFA 3CCZA 1VQNS 4K4VA 3HKWA 4QYRA 3GSDA 5A2QY 2FPHX 1G2EA 4NA3A 1DAXA 1S6OA 3ZZUA 3G4SS 2AW0A 2CQ1A 3OVSA 1IQZA 4CO3A 3PY8A 2V8HA 3BF4A 1HA1A 3CDWA 5E3CA 4LJMA 2G9OA 2O3DA 3BDEA 2HW3A 2I2YA 3LQVA 1RA7A 2GQ2A 4IOCQ 3QPIA 5KFOA 1UEUA 3T5KA 4CTAB 3BSAA 3OL8A 1FDAA 4KHRA 4XAKA 2ROEA 4DPOA 1OWXA 5K8MA 4ILLA 3E01A 3M8PB 3Q0AA 4F4WA 1B64A 2CJAA 1JIHA 3CJ0A 2W9BA 3Q2TC 5KFAA 2WONB 2CPIA 5L1LA 2J7UA 3MTJA 3EGZA 3QJLA 3GR1A 5K14A 7FDRA 2F3JA 1X0FA 4FS2A 3NBPB 2VA3A 1HD1A 4C11B 1Q7LB 4FF1A 1M5VC 1SJQA 3SV3A 1OQ3A 1TQLA 4NOHA 4Q43A 4Y2IA 5EN1A 5I3PA 2AYMA 2B51A 1S1TA 1MSWD 2FJDB 1VRTB 2AX1A 3IS9A 2MKKA 1UP1A 4YUDA 2AJ0A 3DC2A 4TN2A 3SSQA 2CQGA 3IWLA 5KFRA 3R1HA 2DR8A 1HHTP 1W2IA 3DLLQ 5JUMA 3V6DA 2GC8A 3IGNA 4ECVA 4YY3F 5FIIA 2XULA 3JTNA 2KYXA 2M52A 1P6TA 4XDDA 4C2MA 2EKYA 4KRWA 5GAGI 5KG5A 4XDCA 4RNFA 2AX0A 5AXKA 1Q86T 5LT5A 2GCFA 4Q0BB 1NEEA 2W9CB 3V81B 2P6SA 3CMES 4N76A 3ISNC 3RRGA 2UUBF 1GTEA 2HHWA 1T03B 1KHWA 2ASYA 2UVVA 1WF0A 3RRHA 2MQLA 3KKFA 1YJNS 4DUZF 5BJRA 5LL6d 4I64A 3KLEA 3VAIA 5F0UA 2Q66A 4BHQA 4YOEA 1QTMA 2DGQA 4RU9A 1SI9A 5B0CA 4DFJA 1FVSA 4CO0A 3OTDA 2RSQA 3CVKA 4DL5A 4J9NA 3PX0A 1S0VA 4MK7A 4ECRA 1LW0B 2XY7A 3TO8A 2PIIA 2CJQA 2QA1A 2JX2A 4F2RA 4LVNP 3TX8A 4NLQA 2BABA 4J9QA 4IUFA 1CPZA 2CPXA 3IGVA 3BN4A 4ZHRB 3UCGA 1Q1KA 2EW9A 3KLGA 2AU0A 3SFUA 4O44A 2YNIA 3CB4A 4B02A 4PXDA 1JXEA 3JYTB 2WAQD 4Y2CA 4XK8C 3LGNA 4PG8A 3QIPA 2A3JA 4RUAA 2XGQA 2IRXA 4EZ6A 2OMOA 4IFYA 3OL9A 4O3SA 1VQKS 1CVJA 4X4NA 5E41A 4A8YA 3TNVA 5KG3A 5KFEA 2UVWA 4QBUA 3X3UA 3ZZRA 5L9NA 3R27A 2GIRA 4ZVEA 4C0BA 2ZH4A 1OO0B 2FD2A 5LMNF 2UP1A 3GV5B 1JLAB 4LF8F 2RKIB 3M9MB 2LQ9A 3K5OA 4KFBB 5GAEU 2FHMA 1QAYA 2ROGA 3CCMS 2DHGA 4HT5A 4V19X 1PILA 1AUDA 1VQMS 1FJEB 1FO1A 3MEDB 2DNOA 5HLFB 2GQQA 3T6BA 1SIZA 4G6VB 3GV8B 1BQNB 1N88A 4NRUA 2XHWA 2HFZA 1Q8BA 3HPOA 4A8SA 3EPIA 2MGZB 2DH9A 2LCWA 5I3UB 1LFPA 2DGTA 1HARA 1F5BA 2PMHA 4DS5A 1YTYA 3M6XA 2DNLA 1DBDA 1FRHA 2H9ZA 2M2BA 3I0RB 3DOKA 4WE1B 4UQTA 3SV4A 1JB0C 2B4PA 2HHPA 1LXJA 2B9WA 4BC9A 3BEGB 4L6V3 3G71S 4QIGA 2CPHA 2PDAA 2ZH8A 1IUJA 2KO1A 5F8GA 2ZKUA 1X5TA 5FD1A 2C42A 4FYDA 5E2QA 1VOMA 4ZP7A 5G4DA 2K2PA 2RQMA 1ZZNA 1TV6A 3DM2B 3LANA 5CD4H 1FXLA 3G6XA 1QUPA 3QAUA 1VQ9S 3T1AA 2V0NA 2O67A 4HHJA 2R2TA 3J81Y 2J76E 1JKHA 2GFFA 3WZ0A 2DNKA 4H4OB 4LSNB 4QWCA 4DV2F 3PM9A 4USJC 2JC0A 4JI1F 3NMAA 1RTHA 4ZMMA 4DN9A 3BZQA 1HBUB 1HYSB 4LFBF 1EETA 2J0WA 2Y0SD 4Y65A 1I94F 3WBZA 1K1QA 2OPRB 3M2RB 1T8EA 4USIA 5L1KA 2C2RA 5E0OA 4RU2A 1X4GA 3ZC4A 2LEAA 2E1MC 4IO1A 2KG1A 1YJWS 1NK0A 1N5YA 1Y0HA 5ITHA 3DXSX 2V4JB 1TVRB 1TKXA 4WJBA 4URGA 1TL4A 2MQMA 3R3TA 5AE1A 1X4HA 3PFEA 4WU2A 1RI7A 5CQGA 1SV5A 3NLCA 3W2VB 4JV2A 2DNGA 1TL3A 3LUYA 1NJWA 2FJWA 3ZZYA 5HBMB 4KV8A 2IJFA 2E66A 4DSFA 1K0VA 3U1LA 1JLEB 1HI0P 1DFDA 4UY85 1U26A 4WZMA 2UUAF 3NMRA 4NYZA 1BGXT 1GH8A 1ROFA 3V2UC 5KT7A 1U1QA 4ED5A 2LYVA 3NGDA 3KNGA 2RB7A 4K4YA 2IBOA 3OFEA 2GMJA 2FJXA 1HPZA 2IM2A 2CPDA 4YB6A 3KFWX 2X1FA 2V9WA