1X4FA

Solution structure of the second rrm domain in matrin 3
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
112
structure length
112
Chain Sequence
GSSGSSGKKPEGKPDQKFDQKQELGRVIHLSNLPHSGYSDSAVLKLAEPYGKIKNYILMRMKSQAFIEMETREDAMAMVDHCLKKALWFQGRCVKVDLSEKYKKLVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matrin 3
publication title Solution structure of the second RRM domain in Matrin 3
rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 11
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2005-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1x4fA00
5D78A 3NMRA 4LIRA 1VQ8S 3CCVS 2A3JA 2DGOA 1WG5A 1WF0A 1QVFR 2EVZA 3H2UB 3MUTP 1FJEB 4PKDB 3UD3P 2RS8A 4TU8A 5DM7Q 2LKZA 2KFYA 2CPZA 1M5KC 3MD1A 1X4FA 2D3OR 5LJ3Y 2KU7A 2AYBA 1M5VC 2MQPA 2MKHA 4RU2A 1WEXA 2JX2A 1QM9A 2CQCA 2E5IA 2KRBA 1JMTA 2HGNA 2MGZB 1HA1A 5EN1A 2DGVA 2JVRA 1BY9A 1U1LA 4Y00A 2MQOA 2PEHA 4QU6A 3IWNC 3CXCR 3NNHA 1X4BA 5DDRC 3J7ZT 5GAHU 3ULHA 1FT8A 3R27A 1WWHA 1WELA 5D77A 2RQ4A 4YB1P 2CPDA 1VC0A 2M88A 2X1FA 2ADBA 1U1NA 2OJ3A 1VQKS 2DGXA 3PIPQ 3CCJS 4F26A 4QU7A 1WEZA 2YWKA 2N3OA 2RRAA 1U6BA 2AYGA 2ADCA 1YHQS 1FJCA 2G0CA 2EK1A 2L9WA 1X4CA 3G9CA 4V19X 2DO4A 1X4DA 3EGZA 1ZZNA 2GO9A 2O3DA 2DGUA 4TU7A 2DNRA 3THTA 4Y0FA 2BOPA 1FXLA 2MZQA 2LCWA 3UCGA 1YITS 3CUNA 1DRZA 1W2BR 3S8SA 4ERDA 2DH7A 3TYTA 2LEBA 5DDPC 2LEAA 3Q2TC 2J0QD 1Q82T 3SXLA 2VOOA 3UE2A 1VQMS 1S72S 1VBXA 2DK2A 2MSSA 2CPJA 1O0PA 5LSLA 3OW2R 3MI7X 1Q81T 1OWXA 2K3KA 5H1SV 1H2VZ 2GHPA 2MJNA 2N82B 1URNA 1UFWA 2UP1A 2F9DA 1YI2S 2RNEA 2MQLA 3TO8A 4IUFA 3UCUP 3VAMA 2AYEA 1NU4A 5JVHQ 1RKJA 3RW7A 2CQIA 2M7SA 3CD6S 2MB0B 2DISA 4QPTA 1K73T 2HGLA 2RS2A 1SJ4P 2K8GA 5IM0B 1KC8T 2MQNA 1R8PA 1UW4A 3THPA 4C0OC 4BS2A 1YTYA 3B4DA 5IFMA 1UP1A 2RVJA 2QEXS 2DITA 4CIOA 1VC5A 4YUDA 2KI2A 3G96A 2CPXA 3CMES 2X1GA 2JVOA 3R1LA 2KHCA 3BEGB 2AD9A 2YTCA 5GVQA 5DDOC 1OPIA 4J5OA 3EGNA 1D8ZA 1VQPS 5IQQA 3RW6A 2G1DA 3CCRS 2LECA 2DNNA 2LYVA 3DLLQ 3I56S 1VQ5S 2J76E 2OIHA 1AUDA 2DIVA 1PO6A 2MGZA 1VBZA 1RK8A 2OSRA 2MZ1A 1X0FA 1X4HA 2M0GB 2B0GA 4PRFA 2CJKA 1UAWA 2CQBA 2DGQA 2RRBA 1Q7YT 1G2EA 2CPEA 1P1TA 2LQ5A 2N3LA 5DDQC 2DNYA 2CQ1A 2CQ4A 3US5A 5GADU 3ZZYA 1U1QA 1WEYA 1IQTA 2DH9A 4IOCQ 3HI9A 2KVIA 3IRWP 4M5DB 1KOOA 2MYFA 2KN4A 1VQNS 5FJ4A 2M4MA 2X1AA 3CCLS 1WHWA 2YH0A 3J7YU 4CH1A 4F02A 3LPYA 1H2UX 5GMKa 3SDEB 3CCUS 2DNHA 1VQLS 4FXVA 1DZ5A 4W90B 4FXWA 2KXFA 1N88A 3Q2SC 5CXTA 2OTJS 2E44A 3N9UC 3CPWR 3NNAA 4C4WA 4TLQA 2SXLA 2N7CA 3EX7B 5HL7Q 1WI6A 2DHGA 1X4AA 4UQTA 1X5SA 1R8HA 2FC8A 2MY8A 2ZJQQ 3TP2A 2DNLA 1HD1A 3JB9k 3NS5A 5DM6Q 4WFBQ 4IOAQ 1X4EA 1YWXA 3VAKA 2HYIB 5GAGU 2NLWA 1F9FA 2CPYA 1WTBA 3BO4A 2YH1A 1CVJA 2XS7A 2KXHA 2MKIA 2F9JA 1WF1A 2MHNA 2MZRA 2ZJRQ 3VAHA 4ED5A 1D9AA 3VAFA 1KD1T 2L08A 3ZZZA 5LSOA 5LXRA 2ERRA 3FEXB 2DNKA 2DNPA 2DHXA 4WFNQ 1YJWS 1ZH5A 1A9NB 3K0JA 1M5OC 2DNOA 2DGWA 1HD0A 3UWTA 3G8SA 3VAGA 1YJ9S 3CULA 3VAJA 2DNZA 2HVZA 2LMIA 1DBDA 2QFJA 1SJFA 2MZJA 1H2TZ 1N54B 2DNQA 2XSFA 1WHVA 3H2VE 1SJQA 2CPHA 2HZCA 3D2WA 1VQ9S 1VQ6S 4TU9A 2M8DB 1VBYA 2FHOB 3CC7S 2CQPA 3G8TA 1KOHA 5CYJA 3UCZP 5IM0A 3U1MA 1SXLA 3S6EA 5BJRA 1VC6A 3CCES 1M90T 1VQ7S 1JJ4A 3G71S 1WHXA 1P27B 2U1AA 1PGZA 2MKSA 3I55S 3CCMS 2M52A 4LMZA 3PIOQ 1A7GE 3P3DA 2MKJA 4WF9Q 3P49B 3P5TL 2JWNA 4WFAQ 1QVGR 1FNXH 1XN9A 2XS5A 2I38A 1B7FA 2MJUA 1Q86T 1U2FA 1WF2A 2DGTA 1VQ4S 2CPIA 2MZSA 1SJRA 1X5TA 1S79A 3G4SS 4A8XA 2MQQA 3MUVP 2RT3A 5ITHA 2CQDA 4Z2XA 1U6FA 1M1KT 2MQMA 4PR6A 2XB2D 2RU3A 2KG0A 5HO4A 2DIUA 3MURP 2XNRA 2YKAA 1U1RA 2D9PA 2E5JA 2LA6A 1M5PC 4F25A 1U1KA 1K9MT 2V94A 3U1LA 2D9OA 1U1PA 2E5HA 3CTRA 3SMZA 2CQ2A 3BO3A 4U67Q 2BZ2A 1WG4A 2DO0A 2OTLS 4WKRA 4YOEA 2DH8A 2DNMA 2NZ4A 2DHSA 1OO0B 2Q79A 2CQ3A 3S7RA 2JRSA 3MUMP 3CCQS 3VALA 2EK6A 1NJIT 2MZTA 3SDEA 2KYXA 2L41A 2FC9A 1JJHA 4EGLA 1L3KA 2MXYA 2PE8A 2HGMA 1VQOS 2MKCA 1HL6A 1FHTA 2KXNB 2KH9A 3FEYB 5LJ5Y 3VAIA 5DETA 2F3JA 3S01A 2VOPA 4WCEQ 2M2BA 1FJ7A 1SJ3P 2XS2A 2G4BA 2VONA 2LA4A 1U1MA 2FY1A 2E5GA 5MLCV 2WBRA 1H6KX 2KRRA 2AYMA 4OZ0A 2KT5A 5GAEU 4C7QA 5CA5A 4P6QA 2CQ0A 2OSQA 2MSTA 2MKKA 1YJNS 1X5PA 2DGSA 2J8AA 1FO1A 4CQ1A 2RUGA 3CF5Q 2KM8C 4IO9Q 3NS6A 2KM8B 2QA4S 2M70A 1X5OA 1NO8A 2CQHA 3BO2A 4UY8T 3P6YC 1WI8A 3CMAS 2DNGA 5LXYA 3CC2S 3V4MA 5JVGQ 3DXBA 2DHAA 2X1BA 3R1HA 3LQVA 4WIIA 1ZZFA 3G6ES 2I2YA 3NNCA 1K8AT 1N52B 2J0SD 1WG1A 3MD3A 4QQBA 3VF0B 3BS9A 3CC4S 1N8RT 1KQSR 1U1OA 4CH0S 3L3CA 2M9KA 2VODA 2U2FA 3UD4P 2ZJPQ 2MPUA 1DHMA 2XNQA 1X4GA 3MOJB 1OIAA 2LXUA 2KG1A 2CQGA 4LJMA 3MDFA 1YIJS 1JJ2R 3B4MA 2RQCA 1WHYA 3HHNB 2MMYA 4OZ1A 2M8HA 2DB1A 2CPFA 2FPHX 2LXIA 3CCSS 4W92B 2MY7A 4ZKAA 3MXHP
chains in the Genus database with same CATH superfamily
5KFPA 1WF0A 1QVFR 2C3UA 1VK8A 4MFBA 1M1HA 3UR3C 3GCXP 3W2VA 2AHOB 2DR9A 2CPZA 5ETMA 3NGDA 3TAQA 1IJEB 5DRKA 2AYBA 1Z2ZA 2GVDA 3TUZC 3OBIA 2BE7D 4LQ3A 3H8YA 1QLNA 2WW4A 3ET6A 1VLYA 4OX6A 2ASDA 5EN1A 2DGVA 3D1HA 4FPRA 1BY9A 5A8WB 1U0HA 4DF8A 1UA1A 5DG7A 2CRLA 4ED4A 1PBUA 4JI2J 1CEZA 2DR8A 3PR4A 4KRWA 2ABYA 1QTNB 1EAYC 4NYZA 3HKWA 4AD6A 2ZZMA 1LWEB 3G82B 3QGIA 4O3SA 2OJ3A 1UEVA 4O4GB 1F6TA 3MMBA 1S1UA 4C8KA 2V8VA 1ELOA 2Z2YB 2BMBA 1QAJA 2QLBB 3MCMA 1CULA 5AXKA 1SJ1A 3J80U 1WORA 4B3MJ 2FZKB 2DGUA 1NAQA 5LMUJ 3OR2B 2BOPA 3IO1A 2RQKA 4QR0A 2EWHA 5IS2A 2GCFA 4K4UA 1SVDA 9ATCB 2I5JB 5J2PA 4RW8A 1JB0C 2VKZG 3I4PA 4L73A 2W4CA 4IG3A 3TQEA 3MPYA 1QD1A 1O0PA 1WKLA 1H98A 2RDDA 3V4IA 1FDAA 3E01A 4CLPA 4YP3A 1VS3A 1V3SA 2AEMA 1JXEA 1H74A 4M63A 3W2WA 3A1YG 2EXUA 3ZTSA 3RG6A 5C7PA 4NL5A 2G1DA 2UU9F 4NXNF 4ECRA 2KYZA 3UDVA 3I4HX 5B0EA 3D3CJ 2BQUA 1NHVA 1AZSB 4TY8A 4UT4A 4HKQA 1PAUB 3U1NA 4K8RA 3UDCA 4USKA 4P71A 4JI4J 4BBYA 4H54A 1J5EJ 1NK8A 3LH2S 4MK7A 4CH1A 1UWBA 3GFZA 2HQCA 4FXWA 3JYTB 1FNMA 2KXFA 3R6GB 1SL1A 4J9SA 1WTFA 4EFAC 4OI6A 2ZJQQ 1TUWA 3EDQB 3L7OA 3DOKB 4WFBQ 4WYLA 2OH2A 2CPYA 1N34J 3M4XA 2KXHA 1VOMA 4M1KA 2A0FB 3PEHA 4DPTA 2VFUA 5L38A 4L75A 1PC4A 2B56A 4WKYA 1UEUA 4JBCA 1GQEA 2DNZA 1N5YB 2LMIA 3DKDA 4Y2IA 4RNOA 1UJ6A 2VC0A 3DM2A 1VRTB 3DU6A 1Y5IB 3B6BA 2HQGA 2M8DB 1WOPA 2VPWB 3O5TB 5CYJA 2C42A 2YX4A 2F8EX 4CM0A 3R6LB 2HNZA 1PGZA 1WC4A 3EVMA 3I32A 2A6MA 4PWDB 3QO9B 1XN9A 3B78A 1U2FA 4IO1A 4OYOA 5G0RB 1VQ4S 1RT2B 2HIQA 3EM1A 1G3OA 3NAHA 2DIUA 2QL9B 4XO0A 4LF4J 3K59A 4RO0A 3GWCA 1PJ5A 2ILZA 2V94A 1SL0A 5ETPA 3IS9B 3N6NA 4I69A 2DO0A 4YOEA 4OZ5A 2Q43A 4ZMMA 2J8SA 4DV7F 3LAMA 4X4QA 1VQOS 1O5JA 3OSPA 3KHRA 1TL1A 5IOLA 1BC6A 4Q43A 3G8QA 4F0HA 5D0GA 1QJHA 3IWLA 2XWXA 5L1KA 3M9NB 5E5NA 2K1RB 2ZBIA 3THVA 2CWKA 3QGGA 4ZVHA 2V4RA 3FEZA 2PDAA 4DN9A 4DX5A 1LK7A 4LVOP 3BQ0A 4ED6A 4FYDA 3QT5A 2CZ4A 2J9DE 4CH7A 2YX7A 4J9QA 1K0VA 3V81B 5CZXA 1MWZA 1FDNA 2C2KB 2M9KA 2U2FA 2ROEA 4CP5A 4J91A 2KHDA 1OPZA 1GH8A 3DHWC 2ATLA 1LWFA 1DTQA 4V1Ak 1TZ0A 1YK9A 1CBKA 3VWSA 5GMDA 4NX9A 4RW7B 3R7NB 2Z58B 2W24A 2DRDA 1GMWD 1RTHA 1FK9B 3MEGB 3EGWB 2IRYA 2QG9B 3PYGA 5D78A 5J1EA 4KKOB 5C25B 4ZOSA 2LKZA 4RW6B 4UUWA 4RNNA 1JKHB 4L3KA 4HH1A 2CVIA 2VG6B 4G1IA 1JLQA 5KFUA 4EO6A 1VIOA 3OXGA 1WKKA 3H5SA 3FFIA 1RBOB 3CXCR 4UOGA 4DPOA 4OYIA 2IVFB 4MAKA 1F3FA 1OSDA 4ZP8A 2FHJA 3KJVA 1DURA 5D8HB 4KY3A 3QAUA 1KQFB 4LF6F 3MPUB 5HJXA 3H2LA 2ADCA 4ANEA 1PBAA 1SIZA 2ZHAA 4FF2A 4USUA 3QLHA 4Y0FA 2PSZA 2Y9HA 4KR0B 4F7VA 2DH7A 4IQMA 3NBPA 3PRDA 4JV5F 4B3RF 3TZYA 2ZUGA 3GLJA 4DV5J 3MI7X 1OWXA 2K3KA 4DL6A 2EBEA 5DQGA 2ACMA 2B9EA 3RW7A 2HNDB 3PZPA 3MTJA 2N4CA 4O3NA 1KC8T 4O44B 3MPDA 4NPOA 5HN0A 1NXIA 5IFMA 4DQSA 1IBKF 4HI2A 3T1HJ 1S77D 1MN9A 2KHCA 3DU5A 2XGQA 2YTCA 3VR1A 2W2PP 4OIXA 5C24A 5H9FK 3DDKA 2LECA 2YKPA 5M2PA 8RUCA 1Y5LB 1YJ7A 4WP9A 2UXBJ 1D3WA 4PRFA 1FWKA 2FVCA 4NYOA 4DX7A 4K4TA 2J6SA 1BE4A 2RHQB 1U1QA 4ZLNA 4RWWA 2W8KA 2X1AA 1UVNA 5CYMB 4UF4A 1H2UX 4LSZB 2JL9A 1SKUB 2A18A 4PWWA 1FRMA 2NZCA 3EX7B 1HW9A 5M2UA 2AF6A 1HD1A 2IM1A 3EPGA 1UW9A 5I3UA 2XS7A 3WC2A 3MR7A 2UUCJ 5LMNJ 3VAHA 3Q0AA 3IA0A 2B6AB 2GHVC 4EU0A 1Z2LA 3N4WA 2PC6A 1VK3A 2F1FA 4M95A 4DSLA 1N54B 4A8QA 4ZVSB 2JJ4D 1UCNA 4ID5A 1VQ6S 1OYDA 1ZM3A 3FSYA 1SC3B 1RTZA 3BBCA 5KG0A 2FVQA 5HAOA 4U8VA 1QTMA 1PC5A 3OXFA 2XZWA 4DN0A 1XEZA 2ZKTA 2M52A 3ILLA 1Q0NA 2VFSA 2RILA 1KVKA 3W65A 1UA0A 4IFYB 4GKJJ 5EHHA 2O5DA 3HLUA 5IQ6A 5JMNA 1Q16B 1B7FA 1ZS6A 1HHQA 5KFKA 4K4SA 1LKZA 3GSDA 1QUPA 2CPIA 2RKIA 4LQ9A 3HM9A 3QRQA 4X4TA 4IH5A 2BACA 2GVZB 2VF3A 3F44A 1VRUA 4OX8A 2ROGA 4DCJB 2XMMA 4CLKA 1XK8A 4DPUA 4FN5A 4G1PA 1NDCA 4HTJA 4OV1A 2F63A 2NZ4A 5I3PA 4X62J 3GV5B 4EGLA 2MXYA 4FKYA 4WU2A 3IN5A 1N4LA 2HQFA 3IM9A 3LA0A 4M5HA 3QRPA 2OMLA 3VAIA 3ZZTA 4USVA 3HZEA 2FY1A 1H6KX 1C2PA 3H25A 4USTA 4DG1A 4ZVUB 4Q2LA 1UJ5A 3N28A 2J8AA 1FKOB 4GKKJ 1UFKA 3CC2S 1D9FA 2MLYA 1J27A 2LVWA 2V5HG 3LWMA 1Q8BA 1RTDB 5HQLA 4JI6J 2VFVA 1OIAA 2KG1A 1R0AB 4RNMA 4F04B 5HP1B 3BYPA 9RUBA 2P9CA 2DB1A 2ZM6F 3UPFA 3RR8A 3NMRA 3M7VA 3CJ8A 3GFHA 3CCVS 3DOMB 1RWKB 2XO6A 1FX4A 3LW5C 3AA9A 3BREA 4AQYF 4TQRA 1F5AA 4PQAA 4RX6A 3ILIA 1QM9A 2VBWA 4UQGA 4NCAA 2D74B 1U0SA 1F1BB 3A3OB 1X4BA 2UVRA 1ZA2B 1WWHA 4H4KA 5KOWA 2V34A 2L9NA 2OPQB 1IKXB 1SQGA 1TL3A 4K2JA 4ZP7A 5HBMB 1NKCA 4J7CA 4EBEA 3V6JA 2NXUA 2XHWA 2EG1A 1RXOB 1VDHA 3W3SA 4V19X 3DLGB 1IWGA 1RABB 2RJZA 4Y3CA 4YFUA 3S8SA 3NWGA 1F60B 5DGAA 1REVA 3GONA 3M9OB 4I67A 2QMWA 2GIFA 3MAQA 1HWUA 3NCQA 1HR0F 3PX6A 4ZP9A 1A0OB 5J2MA 4WP3A 2ZNYA 1K73T 1DTTB 3ISND 5ETQA 1VFJA 3MM7A 1Y7PA 1I1GA 3FUYA 3TUJC 3N6MA 4C3LA 4OJHA 1OQ6A 4FYXB 3BN7A 4CLFA 4EMDA 4DU8A 4RW4B 1SKSA 3QIPA 3UI3A 3CT9A 3GG1A 3DI6A 4Y34A 2B5JB 4A8KA 2E66A 1TKXB 3ZTPA 1E6VA 2CJKA 1N5QA 2W9BB 3TVZA 2XI2A 5DDQC 4DV3F 3CJ3A 1C1BB 4UTGA 4DR4F 3R2CJ 2KN4A 4JB8B 1WJ9A 4ED2A 3KLGB 3D6FB 5E33A 4W90B 1K44A 2FLOA 2VDHA 5GAGI 2OTJS 1RGVA 3LGNA 2N7CA 1LW2A 4GO7X 1NPPA 4F3MA 2DNLA 1PAEX 2EEYA 1FERA 5F0UA 4EO8A 4LSLA 3GP9A 2YH1A 4QW8A 1XIQA 2Q6CA 1S76D 5EX3A 5J2QA 4IR1A 2HS4A 3BJYA 1FCAA 1G6BA 3ADAC 2FDNA 3K5LA 4K2XA 1LW0A 2HS0A 4IOBA 3VAGA 1FFSB 1YBTA 2UUWA 1UVIA 5IZHA 2RDJA 3PACA 2CQPA 4N76A 1RTIB 3NCPA 2IC3B 4LFBJ 1LXJA 1C4AA 4L72B 3I9V9 2CNNB 2GX8A 5F8NA 2ZBRA 4LMZA 4PG5A 1TK5A 2BXJA 4BCAA 4JYAF 2H5IB 1XNQJ 1EZZB 2JWNA 3ETOA 1FKPB 1RAJA 4CI0B 4RBVA 3UVJA 2YWHA 5A8RA 5K14B 2HVEA 2MZSA 2K7KA 3D67A 1J5OA 2RT3A 1AB8A 2RH3A 3SV3A 3JSYA 1Z4UA 3B8HA 2KDOA 2D9PA 4DQQA 4M5GA 1NCLA 3U1LA 1TK8A 2IJNA 2K7JA 2ZKUA 3HHLB 1L3VA 3KXDA 5L1JA 4GMKA 1JLAA 2EK6A 4DI6A 3KUEA 2R7WA 4H4KC 1ZETA 2H51B 2NREA 2VZ9A 2PE8A 4B9UA 4QIEA 1QSSA 4AXIA 2QL5B 2G9OA 3T9ZA 2LA4A 4NRTA 4C9DA 5BR8F 1H0HB 3CMQA 2QA2A 4IRCA 3DLEB 3PKYA 1FESA 3HXMA 4F4YA 1WC6A 3EZOA 2KM8C 5KFAA 2QA4S 4A8WA 2W9CA 1RACB 2IHR1 4K7QA 2B4PA 2IM0A 2NYIA 1QSYA 4XPCA 1B64A 3LQVA 1RT7B 4DR6J 1U49A 2R8HA 1SB6A 4C97A 3L3CA 2FJBB 3FDSA 3L4BC 2CQGA 4LJMA 1CJKB 3QIDA 4LRDA 4F0KA 2EC2A 4WTOB 2V4JA 1ZM9A 1PCAA 2JEJA 4OX9J 3EZ5A 4Y2CA 1W26A 2C3PA 3ZTRA 4DLEA 3GJSB 3BGLA 1P6TA 4C48A 3Q8YA 3J81U 5MAOA 2HHTA 3H2UB 3Q89A 5AXNA 2RHSB 1Y00A 4TU8A 2QC3A 5CD4A 3M8QA 3TW0A 3F41A 1R8CA 1S9EB 3A3PB 2HAIA 3EXCX 2DY9A 2E5IA 1HA1A 4XAKA 2IAJB 2L48A 2ZD1B 2MQOA 4EZ9A 4QU6A 2LEPA 4R5PA 4DL5A 3LPEA 3ZC4A 2Q66A 1WACA 2C28A 3RBDA 4YB1P 3A13A 2AEFA 2X1FA 1RCOB 3OFFA 3BV8A 2IMWP 5CABA 1U8SA 3ITHB 1IM6A 2GMLA 4ZPWR 4NZ0A 2J7WA 5AXMA 4LF7F 3ENQA 4DV1F 1YZ7A 2OD4A 4JI1J 1QSLA 2OHDA 3FMBA 4F3OA 5IV4A 2R4FA 3P4UB 1DRZA 2R7SA 4YHHF 3CJ5A 1Q78A 2J0QD 3FVYA 2VFTA 2BABA 2PMHA 2W25A 3PV8A 4I6WA 1TVRB 1LWXA 1U2CA 1PILA 1N33J 2CG4A 1XQIA 4QYZJ 5DQIA 3PHTA 1S1VB 2V8GA 3MPWA 2K8GA 2CNKB 2MQNA 1AXQA 1IKYA 3DXSX 3NAIA 1HMVB 3JS9A 4YUDA 4WXOA 3CMES 1OPIA 2R3VA 4NMLA 3A8JA 3BKFA 2KTQA 3FZBA 3FQKA 1L3SA 1K47A 2MHEA 1HNWF 2DIVA 2UXDF 3W2VB 5F8MA 5A8WA 2XMJA 2WB4A 5B0GA 3GE9A 3MR3A 1JQGA 2AT1B 4DUZF 3Q8RB 4ANCA 3AQOA 4ZHRB 1LWEA 3G82A 3VGTA 4O4GA 3MAHA 2WVFA 2DEJA 3QT7A 3CGIA 1XJWB 3QFWA 3LO3A 1X4AA 4KO0B 2YNGB 4LIWA 3OL6A 1R31A 1TR0A 1RJJA 3OR2A 2MKIA 4ED5A 2ZJRQ 2I5JA 1RT3A 3S1TA 1TL5A 2DHXA 1MU2B 5ADZA 4BC7A 4XK8C 1YJ9S 5J2PB 1NZ8A 5DGBA 5B09A 3MEEB 3DGPA 3KLHB 2CPHA 4NXMJ 3ZTQA 5F3ZA 2HQ3A 1GT8A 1JXVA 3V4IB 1Y5NB 5LM7E 3G71S 3MR5A 1KEKA 2U1AA 3I55S 4LR8A 4B9SA 5A76A 3R5AA 2O01C 4C2MA 5KFLA 5G4DA 1VYAA 3AD7C 1PYOB 1FA0A 2MJUA 4CO1A 2R7VA 4KHRA 2GQQA 3R5BA 2CQDA 4I7FA 1AZSA 4PR6A 2KG0A 1T9XA 1RT5B 1NRKA 4I56A 2E1PA 2J6UA 4UOHA 3C46A 4DSKA 3DRPB 4U67Q 1WUUA 2OTLS 4WKRA 4OFZA 4X4VA 2ZH5A 2YWEA 3NOGA 2L41A 2H3EB 3JYTA 1I6JA 3HJVA 4DXLA 4NEZA 1HNZF 5BYRA 2PEBA 3DOKA 4FKXA 2XS2A 1U1MA 1HWJA 4X4SA 3VV2B 2H5JB 2CQ0A 2WONB 2ZH7A 4X65F 1YJNS 2RIJA 1N36F 1FO1A 2H9ZA 3IGVA 2V2KA 1S59A 2ZH8A 2ZBCA 5JVGQ 3NLCA 5KTQA 1N5YA 2IJRA 3UN5A 4P72A 4MTPA 4DR5F 2A10A 1MLAA 1VRTA 1N8RT 4OI2A 2IM2A 1FNOA 4JV0A 4LBIA 5KT2A 1GK8A 4H4MA 2NSBA 1NSQA 3MDFA 1WOSA 4HT7A 3HHNB 2X7IA 3DM2B 4KBIA 5E3CA 4F4KA 3FSXA 2CPFA 1RAIB 2LXIA 4ZN1A 3I5CA 3IWXA 2UUAF 1VQ8S 2HS3A 1KHWA 2UU9J 4NXNJ 5G0RA 1RT2A 2CVEA 5IWAF 1T11A 3HX9A 3AOAA 4KHPF 1BXNA 1NMEB 3KJNB 3C3LA 3KLEB 3IS9A 3NGUA 1LXNA 2NPFA 2QJ3A 3NNHA 2B8QA 4OX7A 3PW4A 3AOCA 4JV2A 3QZ8A 4DV4J 1VRQC 4DFPA 4WXWA 2BQRA 2EFPA 4USHA 3CD0A 3RRKA 1FJCA 3QWPA 1HQ2A 3TNVA 4NZ6A 4NMXA 4V19J 3RRHA 1S49A 1Q95G 1X4DA 4Y2AA 4DL2A 4DWIA 1YITS 4KQZA 2BE2A 2VBYA 4DV0J 4DR3F 1YX2A 1T03B 2H5EA 1FRXA 2YWGA 7FDRA 1UTAA 5KAKA 3QJJA 4IRKA 2AYEA 3NY0A 3TZWA 1HWIA 4RW7A 4DPWA 2DISA 2WVDA 5EGYA 1FK9A 2VPXB 4MIAA 3SQGB 3MEGA 1EARA 4PXBA 1NBEB 2H48B 4KKOA 3W62A 3EDRB 2CPXA 1RWPB 4NOHA 2QE5A 4DL7A 4PAAA 3EICA 4RUHA 1OQ3A 1EX8A 2JH3A 4O23A 4DHVA 3K8WA 1KNZA 3DOLB 1JKHA 1QAIA 5E2QA 5FIIA 4YDDB 1S4EA 4OZNA 2B7CB 3OTEA 2HQDA 4Q2MA 2XMWA 1R27B 2JLEA 2YKQA 2GJIA 1EP4B 2RRBA 3ZZOA 3UN3A 3DLBA 4FVCA 1JLQB 4OZ2A 4DV7J 2BJEA 1KFSA 3PO4A 1HBOB 2BW2A 1JLBB 3LUYA 1Q5YA 2BYCA 2HVDA 3SCKE 5DM6Q 5KFBA 3GIKA 5GAGU 2W9AA 1CPZA 2UV8A 1N32F 2PFFB 1WF1A 3IFEA 5KFCA 4X84A 1PJ7A 2HKEA 1A9NB 2ZOGA 1NHKL 4PXDA 4OV6A 3UQSA 2GA7A 3SSRA 4UY85 3KTQA 5J2NB 3GYGA 3NBPB 2MZJA 2B9WA 3CEDA 1NZAA 1TQLA 2HNDA 1RHRB 4OLOA 4P2FA 3H5XA 1U24A 2OGUA 1KOHA 1FE0A 1GXTA 4O44A 4O3QA 4I0WA 1RHUB 4I6YA 2F8MA 2VJUA 4CRJA 3P3DA 4WZQA 3GG0A 3WIUA 3P5TL 4B9NA 1YBUA 2XS5A 3M8SA 3W5ZA 1BQMA 4XIUA 3GJQB 4J9NA 4K50A 1S9FA 2WVCA 4ZJLA 2RU3A 3HSJA 4OJGA 3C6UB 4DV2F 2XYHB 4RUBA 1HYSA 3W66A 1JWWA 1U1PA 3SZ2A 1M0SA 2L9DA 3OFGA 4B9TA 1S6QB 1M1GA 2KYXA 3CCWA 1L3KA 4LF6J 1F2GA 1JLFB 1HL6A 2R42A 3M2UB 3BSNA 3FEYB 1NKEA 1D09B 3DYAB 1UPMB 3P5BP 3KG1A 2F65A 4QZVB 2XSJB 4E8UA 2G2YA 1SBRA 2B6AA 3MGJA 3JQKA 2FHMA 4CQ1A 7AT1B 4DR1F 4MKAA 3R5CA 3MWBA 2M70A 3FRYA 4JI5J 5I3UB 2OLWA 4CO5A 5DS7A 3BO2A 3CJTA 3CJKB 4KV8A 4JV5J 5LXYA 4B3RJ 3Q8PB 2DHAA 5ETKA 3WX4A 3QSIA 4TQSA 1N52B 3QT8A 4DCOB 3VF0B 1AFIA 2I9SA 2OFHX 3FCHA 3UD4P 2FGCA 2FJEB 3ENWA 3QRRA 4ANDA 4ID5B 2FD2A 4EBCA 5CD4H 1NDLA 4F50A 3K5NA 2GIRA 4IFYA 4AXJA 3PR5B 3CJ0A 4ELUA 4OHVA 4G6VB 1RWXB 1X4FA 3EYZA 2GVZA 1C4CA 5GAHI 4K0KF 2CQCA 5HJYA 3LOUA 1HNIB 3T1YJ 4HDHA 2W7OA 1Q5VA 1D1UA 4A48A 2N7YA 3KHHA 8AT1B 4HVZA 5T7LB 2CWXA 5L46A 1O6XA 1B0VA 1FDDA 1U2RA 1T8EA 3PJ9A 1H73A 1SC4B 1WELA 2CPDA 1IKWB 3PRBA 3PIPQ 3JSRA 4F26A 2E1RA 3HD1A 2MKYA 3RB6A 1I51B 3D9BA 3H0PA 2EK1A 1IVZA 2RF2B 2QLXA 5K5MA 3WX8A 1ZZNA 4TU7A 1FKOA 1FXLA 1ZOTA 3UCGA 4F4ZA 3HKZD 1GTHA 3CUNA 2PIIA 3Q23A 2J9CA 2LFVA 4NRUA 4B17A 3Q2TC 3HFZB 4B3TF 4OI0A 2CZVC 3FBBA 2CJ9A 1RTDA 1H2VZ 2GHPA 2N82B 1LOUA 4Q45A 1ZAXA 4PXEA 1JLGB 2MQLA 3HT3A 2OUGA 1R0AA 5JVHQ 5HP1A 3TJ9A 4P52A 4N47A 2A2CA 1PKUA 2HGLA 2RS2A 2WSCC 4QYZK 1UW4A 3CDUA 2XI3A 2W01A 2ZZTA 1ZAVA 1WD6A 2LQ9A 1X31C 3DOMA 1TKTB 1RKIA 1Q4RA 5GVQA 1MROB 1VQPS 3DHXA 4DR7J 2QYGA 3BYRA 4U7CA 3M8YA 2DGQA 4A8FA 1U47A 1G2EA 1BWEA 3UDLA 4LF9F 2HMIB 3EPIA 3HI9A 1VQNS 2APOA 2OPQA 1IKXA 1WHWA 4M5JA 3JAMY 4X4NA 4OYWA 2AQ4A 5B0DA 5HBMA 3G6XA 5HL7Q 1R8HA 4LUBA 3H90A 5E41A 2VA3A 4IDKB 1EIYB 2FJVA 4ZP6A 3SFUA 2WVEA 3N5BA 4DQIA 8ATCB 1S97A 2YQ1A 2ZBQA 1YJWS 5LT5A 3H20A 4ZCKA 2CIMA 3CJ2A 3I5AA 2C3YA 4DMZA 2HVZA 2V8HA 2HZCA 3TVYA 3N01A 4OYBA 2P6SA 2CJQA 2Q3PA 1DTTA 4ZVPB 2YWFA 2R7XA 1SXLA 2ZM6J 2VQFF 4P73A 5T41A 4DV6J 1B3TA 1P27B 1BLUA 4TNOA 2YVSA 3Q83A 5KG5A 4L76A 4RW4A 2AEJA 4OZLA 4AQYJ 3DDNA 3R7SB 2EC0A 1NSKL 2POKA 2B5JA 1Y4ZB 1X5TA 4P2MA 1CC8A 1TKXA 5BYQA 3G4SS 3HZGA 4LRBA 3SI8A 2MQMA 1M1KT 2E29A 2EG2A 1C0TB 3NRBA 3QIPB 2XEXA 1C1BA 2J0XA 1YRTA 3DI6B 5EDWA 4HI1A 2B8PA 3CJSA 2JZ5A 1X60A 3SMZA 3TARA 3KLGA 4NI2B 1K0TA 5HATA 3S7RA 1E6YB 2CQ3A 3TX8A 3GYNA 3T5JA 2MKCA 2KXNB 4PYAA 4OZ3A 4XDDA 5GMEA 3AODA 5MLCV 2PMWA 1FF2A 2KT5A 3RYLA 1T05A 2ACYA 4OQJA 1N6QB 1R89A 5LMUF 4J90A 1NJXA 3GFXA 3TWZA 5IC6B 3NS6A 1ZPWX 2ZHBA 1RB0A 2DXFA 3J81j 2AP6A 2IFXA 2EPIA 2R7TA 2PMZD 4IYQA 3V5RA 2I2YA 1HR0J 4DDFA 4P9SA 1U1OA 2DRAA 2NQPA 3BQ1A 3K7RA 3KLIA 2XNQA 3JTOA 3MOJB 1ZM2A 2AZ1A 2GS8A 3B4MA 1WHYA 3PJXA 1EJ7L 2FVSA 3KLFB 3WC0A 4EBDA 2BUNA 1FKPA 2A3JA 3E3XA 3MUTP 4UUXA 2IBOA 1WDDA 4LBHA 5K14A 4O4RA 2BE9B 2BRLA 3MD1A 2EFOA 2H65B 1XBWA 1T3OA 4F2SA 1WEXA 4DV3J 3T3FA 2A6OA 1JMTA 5B0BA 2MGZB 5AT1B 4CWBA 4X64F 4HYKA 3HHLA 2Y1RI 1U1LA 2O66A 4LRFA 1TKDA 1FEHA 3AOBA 2FZGB 1HW8A 2HQIA 4NLUA 2HRTA 3ULHA 2QLFB 3O44A 4BLGA 1TL7B 1NK5A 1H7WA 3H42A 2V2QA 2GFFA 3UN2A 2G0CA 3T1AA 1K1SA 1RE1B 3DLEA 2KJVA 4NLOA 2BOAA 3HVAA 4DQRA 1B99A 2R2RA 3GIJA 3C15A 4BHQA 4KPYA 4YQWA 1YSJA 2OEJA 3MECB 3MM9A 1W2BR 3P45B 5HQMA 4X66F 2XWYA 1RT7A 4F3QA 1VQMS 3OW2R 4FBUA 4FDFA 4ZN3A 3IR6B 2R2TA 2DJWA 1F5CA 2ALZA 3MR2A 4PG6A 3VAMA 3M2RB 2V8DA 3EGVA 3QWUA 1FWLA 3EZUA 3TI0A 5HROB 1DY3A 1XMQJ 5KFXA 3OLAA 4JYAJ 4Q0BB 4HH0A 2YNFB 4ZVOB 3GILA 4FNHA 4K4XA 2AGPA 3TZXA 4JI7F 2HWTA 3W60A 4DFMA 3BGFA 1FTRA 4M5LA 2YNHB 5HMWA 4DX6A 3M8QB 3DMJA 2IAJA 3IM8A 2ZD1A 3GMGA 3M05A 1X9MA 4ES3A 1Q8KA 3US5A 2Z2ZA 3D0GE 1R3NA 5CQGA 2QSWA 4M5DB 5HANA 5FJ4A 3T6BA 3L7PA 5KFIA 2FJDB 1LFPA 3IBFB 3ITHA 3VGSA 1YRXA 4FXVA 4WIQA 5D0EA 3OVBA 4C4WA 2SXLA 1EQ0A 5BR8J 2DHGA 4RJVA 3GQCA 4UQTA 5ETNA 4IOAQ 1JNZB 4CTAB 3BO4A 1Z1ZA 1ROFA 2V69A 4FYVB 3DLJA 5LXRA 3OVAA 2R2UA 2HHHF 2XZTB 3HF5A 1HD0A 3J7AN 2LDYA 1TVRA 1S0NA 4K4WA 1SC1B 1S1VA 1T0TV 2HK2A 4ED0A 1RHJB 1VC6A 1T94A 1WC0A 1HMVA 4LT6A 3PG9A 1HLWA 1U09A 3D66A 4B9VA 1W7WA 3HVRA 1QVGR 2YX1A 3LAKA 2P5VA 4EUVA 1YVFA 2DD8S 2YQ3A 1F9HA 2DKOB 3BPSP 4CLLA 2AWZA 4KT0C 4Z2XA 5HO4A 2LQJA 3MPVA 2YKAA 5HK4A 4TYAA 1CS4B 1JNRB 4C0BA 4QIFA 1M5PC 4NLXA 3HHLC 3PW2A 2CFXA 2QL7B 2HHVA 2CJAA 4ZHRA 4KB7A 3MUMP 1EHWA 2JRSA 2MZTA 2VPZB 2FQQB 4NLQA 4WWSA 1SQFA 2GO8A 1RADB 4LVNP 3RAQA 4LF7J 2D1CA 4KO0A 5LJ5Y 2YNGA 4ICLB 4E2FB 4DV1J 2VOPA 1FJ7A 1H72C 3HFKA 2PO4A 3RZAA 2WBRA 3HCXA 2AX1A 2P2CB 1LWCB 5L39A 2N4DA 3DDIA 4AL7A 1G7CB 2DGSA 4IH7A 1TV6B 2RUGA 1MU2A 2XLIA 3FCWA 4ALZA 3P6YC 3PFEA 3CMAS 2NCKL 1LFWA 1RT3B 3V4MA 5ETTA 3R1HA 2PN6A 4KFBB 3GV7B 1C0UB 2J0SD 2KT3A 3MEEA 3KLHA 5K9FA 1RWWB 3CC4S 2K2PA 3T5HA 3OFEA 3NGTA 5KFNA 1V5IB 3DGPB 3OT9A 4OZ1A 1RWUA 1PSDA 4NA2A 2MY7A 3MXHP 2FYXA 4OHWA 3BH6B 2EVZA 2RS8A 4G1QA 1HNWJ 2BDPA 2UXDJ 4PG4A 3VCDA 1RT5A 2UXBF 1RU1A 3TA0A 1WOOA 1GXLA 3DRPA 4I7FB 2VFRA 1ZBTA 4DUZJ 4C3MA 2VA2A 5DDRC 5GAHU 1OY9A 3SIPB 3T5KA 3NKYA 4ZJOA 1U1NA 5KFDA 2ZHOA 2HIYA 2FGOA 3GPAA 3MFIA 1RAEB 3DRSB 5K20B 5E3QA 3HSDA 3IR5B 2WONA 2QMXA 6FDRA 5KG7A 2UUCF 2VG7B 5KG4A 3CB4A 4LR9A 1MNEA 1IQZA 3DRRA 3M6WA 4N56A 1AA1B 3AD9C 1D0EA 1S48A 5K8PA 1GMVA 2EI5A 2GNKA 2WRMA 3M2VB 3R5GA 1XNRF 4CLSA 3SXLA 4QJVA 1HWKA 5CYQB 1RWOB 4YB7A 1IBMJ 5L8RC 5H1SV 2Z0GA 4HT5A 3QJLA 2F9DA 1YI2S 3CDBA 2DXEA 1Q79A 2WCXA 2G2ZA 5IM0B 3W61A 4H4MB 4FF4A 3CO9A 2JHEA 5AJ3F 2KI2A 4ECUA 1CJVA 4FZVA 1HBMB 2HVIA 1HFEL 3DLLQ 1TTHB 3MAAB 2OELA 2OEKA 3KLEA 5I4MA 5DG8A 4ZVFA 3J7YI 2CPEA 2VBZA 3A3NB 1NSAA 2DYAA 3BGOP 3C8YA 4NEYA 2AJ2A 4RKUC 3NGKA 2Z30B 3A12A 4UW2A 4LF8F 4R8UB 3SDEB 1FRIA 1FX2A 1JLEB 1DZ5A 5E3AA 1HNZJ 4O3RA 3GFYA 4AYBD 1KDNA 1RHMB 1R0BG 5BXIA 3AXMA 4PWUA 2QIFA 2E7WA 1U4BA 4F8RA 1X4EA 4MKBA 4X65J 1YWXA 4KJIA 2GAGC 1N36J 1V5VA 4X2BA 2VKRA 1O8BA 2J5AA 3ZZZA 2C3MA 1FJGJ 4PPDA 2IA0A 1T03A 4I2QB 2G13A 3D4JA 5EWEA 1MWYA 2BM1A 2DGWA 5FLXY 3CDWA 3RR7A 3MMAB 3IXQA 1IR0A 4DR5J 2IA6A 4KH1B 2BE2B 2FHJD 1HQEA 3NOCA 3QYYA 1P9QC 1BQXA 3AB4B 1WHVA 1QAXA 1W25A 4JI6F 1FVSA 4USJC 1VBYA 4WE1B 2ZC4A 2WW8A 3KMSA 1N0VC 3UCZP 4M8LA 4BWMA 3SQGA 1RQ0A 3PDNA 4C8LA 5AE3A 1P9YA 1FTCA 2UUAJ 3AJ2A 5DQHA 3HT0A 1RISA 3ENVA 1DLOB 2OPRA 5IWAJ 2IMOA 3DOLA 1Q86T 2DGTA 4AL6A 2XLJA 2ZWOA 4KHPJ 4ELTA 4L3NA 2FTRA 1EP4A 3KG4A 4DJBA 2Q1LA 1U1KA 1U25A 1DARA 5CZVA 1HQUA 3IAS9 4DPYA 2D9OA 2E5HA 4EEYA 5KT6A 4HR2A 2DNMA 2Q79A 2W2NP 1HBOA 3CCQS 2ASYA 1JLBA 1KR4A 2HGMA 4USWA 3D68A 4Q8FA 5DETA 2GQ2A 4F4WA 5B0FA 2HHWA 3E8OA 5B0CA 2V8PA 2XMKA 1MW7A 2IYIA 3L09A 1NUEA 3H5UA 2OSQA 2ZUAA 3AHPA 4DS5A 1S99A 1CJUA 2FY8A 4A46A 2R7UA 4ECTA 4WTYA 1WI8A 3KUGA 2UXCF 2KL8A 1YQHA 3ENAA 4JOUA 5J2NA 3RAMA 2E5LF 4K4YA 3L7UA 4FF1A 4ED8A 1KLMB 3IRXB 5KG2A 2RQCA 3O2IA 4ZITA 3D6HB 5KFZA 3KYLA 2R8IA 4USMA 1FKAF 4LIRA 4PEOA 5HMXA 1CSJA 1YZ6A 4RW9B 3OLBA 2QLJB 3KFWX 5K8NA 1UZDA 3ILJA 5KFVA 1DAXA 3C6UA 5KFYA 1BQMB 3MM8B 4TN2A 3I5BA 4Y00A 3BSOA 4YS2A 3AH6A 4RR5A 1B0PA 1S6QA 1HYSB 3M8PB 1RTJB 1YG0A 1S0OA 2B4OA 4G3IA 3KUHA 4HLBA 3KDOA 1JLFA 4J9VA 1KHVA 2ZH1A 2IDLA 3M2UA 1SQEA 5ETOA 3DYAA 2AYGA 2HBRB 3T41A 1RA7A 2L9WA 3GCWP 2XSJA 1N32J 2DO4A 1U26A 3PEJA 1XWLA 5FDLB 3OQ2A 4RBTA 5B0AA 3SEOA 4A8OA 3CJKA 5KT7A 1NK0A 3TYTA 1S1TB 4R25A 4OI4A 5DDPC 4KGVB 5F9LA 2LEAA 1WC1A 1N5TA 3KHGA 3WDOA 3GJRB 2XULA 4YY3F 4KV8B 4KH0B 3SCIE 2ZZNA 1UFWA 3FBEA 4IUFA 1NU4A 2WB1D 4LFAF 4JI3F 1U8WA 3LP1B 2OP5A 3CIMA 4BC9A 5C42B 2A2DA 2RVJA 5A2QY 1VC5A 2YKMB 2HURA 2Y8WA 2BJ8A 3ZTOA 3N0VA 5ETLA 2WBMA 3HSZA 4PG7A 2LYVA 2Y0BB 1VQ5S 2J76E 3MM5B 2E9TA 4DV2J 1BUXA 1HNIA 4LSNA 4ETZA 2OAUA 1OSCA 2N3LA 5T7LA 2V4QA 2X3DA 4YMEA 4XTTA 1IUJA 1HI8A 2P8IA 4C11B 1VQYA 1IKWA 5KFEA 3BB5A 3CD7A 3MEDB 1HI0P 1S7IA 1IBLJ 4YR0A 2ZVSA 4J9OA 2E44A 3N9UC 5E3PA 2RF2A 3UFCX 3W5YA 2OMOA 3TP2A 3RB3A 1FVQA 4P7TA 3CW2C 4CLYA 3PW0A 2XMUA 2NLWA 3C6TB 4B3OA 1YBAA 2JDJA 1A6LA 3VAFA 1KD1T 2ERRA 2XLKA 2V50A 2V0NA 4NLRA 2HHQA 4W4MA 3W9IA 1UZHA 1JLGA 4Q8EA 1FI4A 1H2TZ 2GHWA 1T3NA 2BJ7A 2R8KA 2FJWA 2BBEA 3JQJA 2LU2A 3W64A 3ZXWA 3ONQA 3FBFA 5BJRA 4OX9F 1MG7A 1M90T 2XG8A 2FLPA 5H9FJ 1TKTA 4DEZA 2NSCA 4NLVA 5F41A 1SL2A 1MROA 2MKJA 2D3O1 3GJTB 2ZC3A 3P49B 2OPSB 2DPJA 3ILOA 2ILYA 2AJ4A 4JI8F 4K0KJ 5J1PA 1KN6A 2MQQA 4Y2KA 1ZAWA 1ACMB 2XB2D 3ZNJ1 1SIWB 3MURP 3TRGA 2HMIA 1U1RA 1X0PA 2C2OB 1HNXJ 4A8SA 5HLFB 3I96A 3AXKA 3VVTA 3KK3A 2CYYA 2O67A 3U02A 1EQMA 2FC9A 1JJHA 2QFIA 1S1XB 4PABA 5JXSA 1FHTA 5F8LA 2UUTA 4J9PA 2H54B 4C8MA 4IDKA 1NNDA 4I1TA 1NB2A 1GMUA 4P6QA 1TMMA 1AW0A 3V6HA 4IO9Q 4CO2A 5F8HA 4CT8A 1T9UA 4UOFA 1H38A 4Q44A 2B51A 3POTA 4B3TJ 5I42A 4U95A 4JP8A 3D6MB 3ZZUA 4IG0A 3NNCA 4EYIB 3R7BB 3C2PA 3MD3A 1KQSR 2RDIA 4KIAA 4QIVA 4Z7YA 1N33F 4WJBA 5ETSA 3TEHB 3HO1A 3RBZA 2HZAA 3TANA 2I6WA 2JSXA 2JFKA 1X7VA 3LWLA 4P2XA 2Y1JA 3NEKA 1PIEA 2Y0SD 3HVTB 1FFWB 4ZPAA 2Z2LA 5DZ6A 3KK1B 4KAIA 1LNQA 2HHSA 1BQNA 4PZVA 2BANB 2DGOA 3RU0A 4LF5J 3X1LB 1WG5A 1FJEB 5IV3A 1JIHA 4ILMA 5DM7Q 2LLZA 4PQUB 4UZBA 2BJ1A 2KU7A 1C0TA 3PX0A 2QTWA 4ID8A 2HSEB 2KRBA 4LF9J 4NLPA 1D9DA 1S5ZA 3ISZA 4QWDA 4NI2A 4M5NA 1E6YA 3K5MA 3C16B 4DU7A 3FGVA 1RT1B 4ZPVR 1VC0A 2M88A 3SQOP 3R9LA 2N3OA 1HNVB 4NLGA 2IPOB 1U6ZA 3J7A1 3IR7B 3R5JB 1REGX 4LBPA 3TVKA 3CJQA 3GTYX 1N6QA 2W4PA 2R7RA 2ZH3A 4O0IA 4WPAA 2AX0A 2OPPB 4QWAA 2JC0A 3Q22A 4NCBA 2GGPB 2QO3A 4J9KA 2KT2A 5F3TA 1B70B 2W4DA 4A8MP 1MWQA 3WQPA 1T05B 2DCUB 4ZLJA 4DSFA 3CCTA 2W8LA 2BW7A 3SCJE 1V9OA 3AA8A 4J9RA 3T5LA 4NCGB 3I31A 5LSLA 4QYRA 1S1WB 4FS1A 1I94F 2XY6A 2RNEA 2B9XA 3TO8A 4CYUB 4HEA9 4CNZA 3PRVA 4K59A 4LFCJ 3KLIB 3KLFA 4BS2A 4I2PB 4NLTA 3ETMA 1RWMB 2GW8A 1S6UA 2PGCA 4C98A 4B3SF 5IQQA 3BKUA 1F3VA 1XR5A 2DR5A 3CCRS 3Q8VA 3PXGa 2H4WB 2MGZA 2G1HA 3MMJA 1KBRA 4FVMA 4N8OA 2LQ5A 4X4RA 2EKYA 1IXKA 4ECWA 4ECSA 3WHIA 1NJZA 2WVBA 1CLFA 3HMJG 4ED7A 1TL7A 2QYCA 2HFVA 3J7YU 4P74A 2CG8A 3M6UA 4O3PA 1N88A 3MMCB 4KGXB 4OLPA 4TLQA 1CJTB 3W9JA 1WI6A 4OL8A 4OHXA 4ZIVA 1ZYQA 3BGUA 5F8JA 4N5SA 2G2OA 3MECA 4GVBB 4RWXA 3MR6A 4YB6A 2DNPA 1RT4B 1TUGB 1RHQB 1M5OC 3C15B 3DC2A 1Q8IA 3V2UC 3MM9B 2AIRB 2ZH4A 4I64A 2M3DA 3M2RA 2P6TA 1SUQA 3ZZ0A 4LRCA 5HROA 2ZE2A 3I0RB 5KFOA 4Q5VA 2QA1A 4Q0BA 2YNFA 5D4NA 1RI7A 2JC1A 4CT9A 3PO5A 4FNIA 2YNHA 2M5YA 4H4OA 4X64J 2KO1A 5IC4B 3K5OA 2UVVA 5KFSA 2BKNA 4M5DA 3AQPA 1YJUA 2CQ2A 3NGRA 3DMJB 2BZ2A 3PKMA 2V67A 4DV4F 4TYBA 1NJYA 1WC3A 1QDUB 3HULA 2E9RX 1PYTA 4I68A 2DRBA 1IR2A 2M2BA 4CTAA 1P1LA 5KFJA 2G0JA 2AYMA 2JEFA 4DX8H 1T9TA 4U7UK 4C7QA 3FJ2A 4CO4A 3L9ZA 2R8JA 4HTIA 4X66J 3W1YC 4DV0F 3SV4A 5KFGA 1NKBA 2D41A 3UDEA 2F4VF 1TK0A 3OL8A 1S6PB 3TZZA 2V9KA 4IKAA 2ZDPA 3R5DA 2CA9A 3LP0B 5C2GA 1WSVA 2FPHX 1B7YB 2BJ3A 4JI7J 2HFNA 2ASLA 1LQ9A 2LDIA 4OMFG 1VMBA 1NSPA 2B4VA 3M30B 2KZMA 2I8EA 3RBXA 4KGMA 4OYPA 4FBTA 4C8NA 3QT6A 2C3OA 1CS4A 2WOMB 1XMOF 4KSEB 4WU3A 4OYAA 4J9MA 5F0WA 3J7ZT 2YKNB 3U27A 2ZBPA 3KHLA 2UVWA 4CO0A 5DO2A 1QE1B 2ADBA 2OFGX 3DRYA 1VQKS 4Y2MA 4ICLA 2HK3A 4BDPA 1SV5B 4HACB 1KVJA 2WHOA 2HWHA 2BKOA 1LWCA 1XR6A 3RJMB 1M5SA 2OI2A 4WFYA 2HEKA 3OFHA 4ZPDA 1TV6A 4RBUA 5HMYA 2DCLA 5A6PA 1SC6A 1U48A 3OTCA 4MJKA 2HHHJ 2FZCB 4OI1A 3KNGA 2EKNA 3MM6B 5THWA 1Q82T 4KFBA 1C0UA 2CPJA 3IC1A 1Q81T 3TA1A 2W2OP 4DQPA 2UP1A 4ZCMA 4I4BA 2C2EA 2BA9A 2XO7A 1AFJA 2E1MC 1RKJA 3TEGA 3JAMU 1I5OB 4IRDA 1T95A 4MIWA 5C5JA 4MIBA 2RUSA 3B4DA 1GX6A 3CJ4A 4N41A 4TKTA 2JVOA 4F67A 2QMUB 1D8YA 1VI7A 3M9MB 3GIIA 1PG5B 2DNNA 3WIVA 1XMBA 3A8EA 4G1QB 5L1IA 1VBZA 1YJTA 1CC7A 1X4HA 3W8PA 1UAWA 2CQBA 2FHKA 3IP0A 1Q7YT 4U6PA 5CAAA 1S9GB 1EETB 3ZZYA 3HP6A 1Y11A 2GV1A 4QWBA 4IOCQ 2GC8A 3ZZRA 1C1CB 1RAHB 3IRWP 1YJRA 3U7JA 3PYEA 3B82A 1UWAA 2B9YA 1P8GA 4P2SA 2KFNA 5IT0A 3CCUS 3FZ2A 4MYTA 5CXTA 2VIHA 3DRSA 2HZVA 3PTWA 1OJ4A 2FC8A 4CM2A 2MY8A 3JTNA 1GMWA 2E7XA 3TJ8A 2VG7A 1SH0A 1RWVB 2CNOB 3CVKA 4OYXA 1S0MA 3NS7B 1NDKA 1IR1A 4JI5F 1DQ8A 3M2VA 3QMQA 3PFOA 2DEIA 5CYQA 3G8SA 3DRRB 3D3BJ 3NL0A 5B7WA 2QFJA 5A8KB 2VJVA 3BM7A 3KK2B 1RHKB 2ZOMA 5HVGA 3RUBL 4F36A 3MHYA 1X9WA 3GSIA 4CDIA 4A47A 1UPPA 1UVKA 5IM0A 2C2NA 4L74A 3TAMA 3EXYA 3PIOQ 1A7GE 2AJ1A 2HLUA 3SSQA 1RAAB 2IRXA 4B9LA 3KJFB 2DR6A 4WF9Q 3N6LA 1HBMA 3O1LA 3VQTA 3OJUA 1ULRA 5T14A 4NLYA 3MFHA 1WF2A 3MAAA 2A1BA 1BHNA 1CJVB 3MOZA 5IT9Y 2EFVA 3T1YF 4P10A 3Q8SB 2LA6A 4F25A 1FRKA 2F8HA 3TAPA 4MMOA 2C2ZB 2EFGA 1WG4A 2BEFA 4KHMA 2DH8A 5HSPA 2DHSA 3VALA 2AU0A 4R8UA 3SDEA 5SZTA 1NH8A 1JLEA 3QAEA 3CE8A 1OS5A 5F8IA 2UVUA 2HLTA 3OUYB 2J9EA 3ZO7A 3P8BB 4WCEQ 4LF1A 5RUBA 4ETXA 1GNKA 1NH7A 4I6AA 3VHQA 3UNGC 2BRKA 3DLKB 2QLWA 1X5PA 1V6HA 4I2QA 1QAYA 3D0IE 1LV5A 4ECVA 1RBAA 1XNRJ 3MMAA 1UEKA 2HRUA 4FYYB 5D4LA 2X1BA 3IGNA 1ZZFA 1IM4A 2ZWPA 1T9YA 4WE1A 3SFGA 2P9GA 1HQEB 1TKZB 1JJ2R 3X3UA 3Q8UA 2WAQD 2XMAA 3P96A 4EYHB 5AJ3J 5F8GA 4ITSA 4ZKAA 1RT6B 1DLOA 5CH7B 2FLNA 3IG1B 4PKDB 3FCVA 4PYDA 4OJ1A 4ZJQA 3K58A 4URSA 2Z4PA 4DR7F 1R8AA 2OPRB 4FF3A 2MKHA 4OJ3A 2JX2A 2Q6BA 2F7VA 3BSAA 3EUNA 4JI0F 3BR8A 2PEHA 2XMVA 4ED3A 3SBMA 4WFZA 3R27A 1N5SA 4LF8J 1LK5A 1T9WA 1HQUB 2QX0A 2GJ2A 2PI4A 1RZMA 3BGRB 4MKYA 3CCJS 2YWKA 1IKVB 2PD1A 1H7XA 4ZPTR 2AJFE 1YHQS 1X4CA 1UMJA 1NPRA 4RUCA 3HPOA 2QV6A 2GMJA 2V68A 2K3IA 3UNYA 2YNIA 2CKWA 4L6V3 3PW7A 5KFFA 4NLWA 3FKBA 4DUYF 4HL9A 3R3TA 3K57A 3PJWA 1W2IA 2LEBA 2YBVA 4ZVQB 3IAM9 2MEWA 4DSJA 3FMWA 4LR7A 1CJUB 1S72S 1VBXA 2XC9A 2CZ9A 1T7PA 4W98A 2AMCB 3M6XA 2HHPA 2XY7A 3AT1B 2FIUA 4B02A 5BYSA 1KLMA 1YJVA 3IRXA 3UCUP 2RAQA 3CDAA 2XGPA 3CD6S 4QPTA 3R8YA 4DV6F 1FD2A 1NHUA 3E2EA 4XPEA 5L1LA 3G96A 4RW9A 2X1GA 2E7VA 3R1LA 3BEGB 3J80Y 5B08A 2CUYA 2D3ZA 4WP8A 2VHGA 1Q1KA 2CADA 4ZDNA 1JXLA 1L3TA 1AUDA 3H4DA 4NE9C 4A4JA 3MM8A 2M0GB 4MYUA 3JQMA 3V6DB 1DFDA 4BWJA 2CQ4A 4DZ6A 1WEYA 3M8PA 1RTJA 1M5HA 1TFYA 2M4MA 4KC5A 2LQ8A 4EWTA 3Q8QB 1VQLS 4DSIA 1S57A 3Q2SC 4NLSA 4IFVB 3RB4A 2R2SA 2E1AA 1X5SA 1GX5A 3QFHA 3PYDA 5FDLA 1WTBA 2X51A 1KLNA 4WK3A 3CIZA 2F9JA 2MZRA 3A4TA 1D9AA 2L08A 5LSOA 1S1TA 1IN0A 1JX4A 2UXCJ 3SCLE 3K0JA 2E5LJ 2VG5B 3N79A 2VICA 3I0SB 2Z2MA 4X4UA 1SJFA 4KGZB 1KQKA 2RB7A 2MDAA 4ZVEA 4MK9A 5ETRA 1VQ9S 4S0MA 4DCPB 2IDEA 3LP1A 2GMHA 2LU1A 3PM9A 3S6EA 3CCES 5C42A 1KSPA 1VQ7S 3M32B 5E7OB 4F4AA 2HBZB 1EB0A 2YKMA 2CAJA 2G0IA 1IBKJ 3M8RA 4YDXA 3M1VB 3GIRA 3MM5A 2B3TB 1SJRA 1S79A 1ZTTA 4A8XA 2V6AA 5CCMA 2GZOA 3CSKA 5KT3A 4M5IA 1K9MT 2Z8QA 3AD8C 4LSNB 4ILRA 3MZIA 4C11A 1T9VA 2KZZA 3PYFA 3I6PA 3MEDA 3UW1A 1XERA 4F2RA 2BJDA 1BWVA 5U47A 4TY9A 2VQEF 2HAFA 2YY3A 3FBCA 3HHKA 2R9LA 2QN6B 2HHUA 1KVIA 3K17A 1JLCB 4ZPCA 4UZCA 2KRRA 3C6TA 3FK4A 4TXSA 2MSTA 2ZNZA 1TAUA 1VBKA 1RLDA 3PHEA 2PT0A 2CQHA 4B3OB 2XBPA 4NLDA 4R0EA 1GAOA 4YY3J 2HG4A 3IBCB 5D3GB 2CJXB 1OY8A 4CH0S 4LFAJ 2PA8D 3E51A 4JI3J 3LTOA 3FSIA 3AAWB 1DHMA 1X4GA 5KFWA 2UUBF 3GU0A 2ATCB 4YR2A 2HBYB 3TQ1A 3WZ0A 1XMQF 5DZ7A 3CCSS 4W92B 4RLEA 2OPSA 4UOCA 3KWMA 1RU2A 2Y1LB 2YWWA 1GXUA 5H9EJ 4DL3A 4QW9A 3KDNA 3OTOF 1M5VC 2NXEA 5HVFA 2HPUA 2BR0A 2HNYB 1HPZB 1RUSA 2RRNA 3PNIA 2C1EB 5HLFA 1XC9A 2JLGA 3C14B 5KG1A 2QSFA 2AGQA 3H59A 3ZFVA 1RBLA 4Y28C 5F9NA 4FPIA 2OKQA 3FQLA 5DLFA 1S1XA 3H5YA 5K8MA 3KK3B 2HFZA 2I0XA 3RAXA 5DJBA 3BPDA 1FD8A 2NPIA 2MLZA 2IM3A 2NYHA 1X8DA 1FRJA 2LQBA 3K8VA 3HHDA 4HDGA 1ZM4A 5KG3A 1RSCA 2O3DA 3JSMB 1DQ9A 3TUPA 2DR7A 4DUTA 2DPIA 4K4VA 3LALA 5FD1A 2BQ3A 1KP6A 5E0OA 1KFDA 3K5PA 5A0YA 3POTB 5I42B 2MJNA 1N0UA 5D6GA 4IG0B 4PUOB 2VPYB 5DLGA 1RYRA 4NASA 3LP2B 1SJ4P 4CNYA 3HVTA 4OYMA 1NDPA 2FJXA 4DR2F 1N5VA 5AXLA 3KK1A 3OR1B 3BN4A 4OYZA 2ZITA 3L95X 2BANA 2QEXS 2DITA 4QIWD 1L3UA 1H3DA 2J0WA 1HHSA 2XYGB 1MN7A 4PQUA 4JI8J 4OI3A 2JLFA 3D1QA 5GADI 5D0HA 1BQNB 1HBUB 2OIHA 1G1XA 4DBQA 3EJMA 1NEEA 1RK8A 2OSRA 3QPIA 4DS4A 1R6YA 2NXJA 1KRPA 2H1YA 3F0NA 2DNYA 4RL1A 1HWLA 5FLXU 2CQ1A 1FXRA 3TOQA 6FD1A 1NPKA 3C16A 2DH9A 2KVIA 1HBNB 1RT1A 5JUMA 1KOOA 1VHFA 4JI2F 3CCLS 4N77A 3ICLA 1HNVA 5HVHA 4NZ7A 2F4FA 2E1CA 2CDQA 3OHAA 2VD3A 5KT4A 2OPPA 4IR9A 3ISNC 5J1NA 1F9FA 1FE4A 2GGPA 3JXOA 3DCAA 3I9ZA 2MHNA 3I82A 4B3MF 1N48A 1RP5A 3HHLD 4MT1A 4URQU 4NCGA 4Y65A 2R8GA 3D54A 3CJRA 3CULA 4CLUA 1S1WA 2VB6A 1DBDA 4CYUA 4LF2A 2W2MP 3DRXA 1Y9OA 3BF4A 1JJCB 3Q86A 4AT1B 3VZIA 4ECZA 4I2PA 2EFNA 3KNAA 4C8ZA 1L5UA 2WTFA 1DJ0A 3QSYB 2EBGA 1TL4A 1NM2A 4C6AA 4WFAQ 1VISA 2I38A 4MFBB 1HKAA 2I1RA 5D0RA 1BGXT 2GVDB 4KTQA 1UJ4A 3KLVA 3ET6B 4D3GA 3W9HA 1NJWA 1U0HB 3GIMA 4DR4J 4JI4F 1NJIT 1J5EF 2HRYA 5LSRA 5D4OA 2QA4G 1VR6A 2XYPB 3MMCA 1CJTA 5GAEI 1R6VA 2KH9A 3C66A 1R8BA 4LREA 3MMBB 1S1UB 4P75A 5IT4A 1VHIA 1CULB 4GVBA 1MMLA 2ALYB 1UKUA 1RT4A 1N34F 1NLKL 4D3HA 2B4UA 3D28A 1FFGB 2MLXA 3MTKA 4FXDA 4RW8B 4ES2A 1Y0HA 2XM3A 1IBMF 4IG3B 3LANA 1I94J 2HVHA 1RAFB 1NB7A 3OL9A 2VL1A 4ZPBA 3I0RA 3E01B 3BKTA 3NG8A 1HARA 3SYZA 1VJQA 2XTJP 1SUQB 3KG0A 3DNCA 2ZE2B 3W2WB 5D15A 4B3SJ 3VVUA 2DBBA 4ES1A 2XQCA 2D3UA 4QOTA 4NA3A 3H4BA 4CLWA 1KONA 4ELVA 4EK2A 2D3OR 1V3ZA 4X4PA 5CCLA 1VCTA 3O8WA 4PXCA 4XDCA 2LP4A 2W1BA 4H4OB 1Y10A 4TY8B 3W63A 4LF4F 3JTPA 2EFQA 4X4OA 1VIXA 4WZMA 3HVWA 2BKPA 3H98A 2W7PA 4K4ZA 2CNLB 4EZ6A 1UVLA 3T19A 2R7OA 2YPYA 3TJAA 2XCAA 4MK8A 3T6JA 2DGXA 2COLA 5HI7A 1UWBB 2W2QP 3EVWA 1URRA 3TX0A 3IBWA 1BMQB 3G9CA 5A2QU 3OPKA 4CLZA 5LL6d 3PVXA 5C2CA 1LEOA 4O3OA 4ZVRB 2DNRA 4ZIWA 1UVMA 1FJGF 3LGMA 1WKJA 2RQMA 4OHZA 4ERDA 4Z7CA 3QBCA 3UE2A 1Q53A 6AT1B 2MSSA 4E98A 1S6PA 4ENOA 1TFWA 3BQ2A 3I87A 2NUHA 1NK7A 5KFTA 3LP0A 2UV8G 1KTQA 3VZHA 3EE3A 5KFMA 5AE2A 1FRHA 3FC9A 2MB0B 1YKWA 4DFJA 4PWDA 2AJQA 3W7BA 4C0OC 3QO9A 1UP1A 2HNZB 2ZOFA 3M30A 5IXUA 3R97A 1GEHA 3QZ7A 4LRAA 1HI1A 1IJFB 4JUZA 1N56A 3G6YA 1RAOA 2WOMA 2C22A 3A8KA 1TAQA 1K1QA 2B0GA 2CJYB 1RA6A 1S6OA 3G6VA 3RTVA 3UD5A 4P7VA 2RMLA 4U9RA 3PX4A 1CQNA 2YKNA 1F0XA 3PW5A 2MYFA 2MQ8A 1QE1A 4MKVA 1IBCB 5GMKa 2ZH2A 1SV5A 4HACA 2B7BB 3CPWR 1ITPA 1VQSA 2K1RA 4GO5X 1TL1B 3K2YA 1B4SA 3JB9k 2Y1IA 4PCQA 2IYGA 3VAKA 2HYIB 3H40A 4ZLLA 3NCRA 2DHHA 3OHBA 2HWIA 1RYSA 3T9NA 2DNKA 3MM6A 4YHHJ 2GQCA 3V81A 1FRLA 1SH2A 2RU9A 2F4VJ 2QGFB 3AFGA 3BDEA 3FNNA 3W8GA 4DV5F 4C8OA 4G65A 3G87A 2NXNA 4TU9A 1I3OB 2VASA 3CC7S 3QATA 3G8TA 4CLTA 2HFSA 1G4CA 3CWJA 1LWFB 1DTQB 3U1MA 1NK6A 1JJ4A 5C25A 2FVPA 4RW6A 3BSCA 1RTHB 3TR5A 1R43A 3G86A 4ATNA 5J1EB 3T1HF 1FNXH 3GR0A 1GTEA 2D7SA 2VG6A 2V2ZA 5ITHA 1RLCL 1XMOJ 1S9GA 4ZCIA 3AJDA 1EETA 2VU5A 3F73A 2X3GA 1F9EB 1C1CA 2C2RA 1MMNA 3CTRA 1WNEA 3FFIB 3BO3A 3M6VA 1OO0B 1SH3A 3EMTA 1AYEA 1Q7LB 5L9NA 2KFZA 4AFFA 3KJVB 1HHTP 4R0JA 1Y3KA 4O0NA 4CCHA 2VONA 2J7UA 2DTJA 2VBXA 2VC1A 1F5BA 1DQAA 1HIYA 1SKRA 2MKKA 2IVMA 3QLHB 1SKWA 5LMNF 3R2DJ 3NMAA 1NK4A 2V63A 5A8KA 4ZS6A 2VUGA 3KK2A 4QQBA 1YLXA 3MEKA 2WSEC 3OTBA 1MSWD 2MPUA 1XR7A 1APSA 1YIJS 3N5FA 3VTIA 4C8YA 4DLGA 1V3RA 4M5MA 2M8HA 1KS2A 2MTLA 3KJQB 1VJWA 3NXZA 2H4YB 2HFOA 4IQXA 3ZNUA 2JFDA 2C2DA 3TAMB 2ZH9A 1F2HA 4DL0C 4FYWB 4Z37A 4GKJF 3GR1A 2NS1B 4B9MA 5C24B 2MQPA 5H9EK 4NWBA 4J37A 3BH7B 4RUAA 1J2VA 3CCZA 4A8YA 4J9LA 1RAGB 5CYMA 3IWNC 1FT8A 2IIHA 4QBUA 4Y6IA 2RQ4A 1IBLF 3M8WA 4X62F 3EWGA 3RRGA 3OUYA 2RRAA 1U6BA 2Y8YA 3CD5A 4Q7AA 4F0MA 2ZH6A 1TU0B 3J81Y 2CDRB 1JK9B 2R7QA 3DLKA 2B43A 4F4XA 4GC7A 3EGZA 2GO9A 1AUSL 2YXLA 2YPZA 2LCWA 3CDEA 3HK2A 4ZVGA 1TP7A 4DOZA 3D1OA 1S4FA 2ZVIA 4ZCLA 3QGHA 4U96A 4K5RA 4WYWA 5I3QA 4GKKF 1CQMA 2Z56B 3BDPA 3CNQP 4DF4A 2ASJA 3SSSA 1YDLA 4GVLA 1TKZA 2CQIA 2WSFC 2M7SA 2HHXA 4M94A 4OZJA 4QR1A 1R8PA 1RT6A 3THPA 4CIOA 3QJPA 3IG1A 1UETA 1ZTWA 2AD9A 5DDOC 4J5OA 4WBFA 3W5XA 3KKFA 1FXDA 4ZK7M 3JSBA 2RE1A 4U7UD 3I56S 2RKIB 2IRUA 5A6WA 2MZ1A 1FWPA 1HNXF 1VRUB 3RBEA 2XCPA 5GADU 1IQTA 3ELHA 4C0HA 3MCNA 4N7TA 2HW3A 3BGRA 5EUHA 4F02A 3TUIC 3LPYA 1IKVA 2C2MB 2OD6A 1UL3A 4TVAB 2Z57B 5EWFA 4HHHA 2AJ0A 1R7IA 4QPXA 4AE5A 5KT5A 4DG1B 3F56A 3BBFA 2DT9A 4WK1A 3OJSA 2XHCA 4WFNQ 2YNIB 3O3LA 2DNOA 3IMQJ 4DR3J 2GJFA 1S0VA 3VGVA 5HQ8A 2F5GA 2K06A 2VH7A 5KG6A 2JNJA 2DNQA 2XSFA 3H2VE 3D2WA 4QR2A 2FHOB 1S7HA 3OVSA 3EVOA 1R0CB 1WC5A 3UR0A 2BX6A 2KKHA 1TELA 2PFDA 2MKSA 3NP5A 2JOQA 4RU9A 4LF5F 2HBQB 2ROPA 2LXFA 5EWGA 1U45A 1KTVA 3OL7A 4U8YA 4MH8A 4RPFA 3V6DA 1U7LA 4JI0J 2E5JA 3HFVA 3HJFA 3PCOB 2WK4A 3Q24A 4ZVTB 2QZ8A 5KFQA 3GV8B 3DLHA 3J7Z5 2ZEJA 5LOQA 4IFVA 1QUVA 2DXDA 1TL3B 3DLGA 2F3JA 2F40A 3S01A 1IWAA 2G4BA 3D6TB 1RDRA 4ZLPA 1UFLA 1FEEA 3WBZA 4OZ0A 5GAEU 5CA5A 3MF5A 5D4PA 4AL5A 4DUYJ 4HHUA 3CF5Q 2Y3YA 2KM8B 5CHCB 2V2VA 1PJ6A 1X5OA 1NO8A 3VQSA 5KOXA 2FJAB 2VG5A 3MCOA 2EW9A 4KYZA 2IY5B 3I0SA 4NA1A 2V9WA 3G6ES 1B0TA 2DY1A 1REVB 1AROP 1WG1A 2O1PA 3BS9A 2JEIA 4KGKA 5KFRA 1OMSA 1TUVA 3D0HE 3FRZA 5J2MB 2FLLA 2IJFA 3M32A 3LGHA 3C19A 2ZDOA 4LFCF 2MMYA 4LFBF 4WFXA 2E9ZA 3MM7B 1KKHA 4YB5A 1GFWB 3BBBA 3M1VA 3UD3P 4B08A 3VGUA 1XNQF 2VDIA 2KFYA 1M5KC 1QY7A 4FP9A 2ZFHA 2W9BA 5LJ3Y 4RNFA 3A8IA 3H7HB 4RU2A 4KPCA 2HGNA 1KWMA 4N8NA 2BV3A 2UZAA 3TA2A 1E6VB 2JVRA 4URGA 4KE5A 1WDTA 1Y3JA 5D77A 1FDBA 3HDSA 1T02A 1SPBP 2JEGA 4QU7A 1WEZA 2L3MA 4M5KA 2D69A 3KMQA 1JLCA 1LW2B 2W7AA 5KFHA 2YQ0A 4IH6A 1CG2A 2YKOA 3THTA 4LSLB 2MZQA 2PA3A 3D7SB 4DR1J 5J2QB 4DL4A 3QNWB 2KVQE 2VOOA 5D3GA 2KB2A 3RGIA 2DK2A 2OO4A 2WZ1A 1LW0B 4RNHA 2RD5C 1RTIA 2IC3A 1URNA 4DR6F 3QQCD 4PG8A 1UVJA 4QWCA 3OSNA 1PYSB 2DVIA 3AY0A 3O6QA 4NYPA 4QIGA 2AV5A 4YR3A 2QT7A 1RCXB 4OHYA 1U02A 2GIQA 3K89A 1YTYA 4GRSA 3MCSA 2BM0A 1ZA1B 3EGNA 1D8ZA 3RW6A 2AGOA 3UVJB 3DFEA 1TMJA 5A8RB 2HNYA 1HPZA 5HMZA 2PI5A 3G2XA 1PO6A 1J5OB 1KQGB 1X0FA 4EI2A 3C14A 3GB0A 4AUKA 1P1TA 1OY6A 4QCLA 1OYEA 3LF0A 3KOAA 3AJ1A 5M2RA 4CO3A 4ECXA 2YH0A 1SCJB 5JJBA 2VQEJ 1JLAB 1YRUA 2DNHA 4ER8A 3HHEA 3NNAA 3M8ZA 4USIA 3NS5A 1X9SA 4FS2A 3JSMA 2KJWA 4RZRA 3HSGA 4JI1F 5ETVA 2HFUA 4YN3B 1CVJA 1Q8LA 1XTZA 2GAHC 1AT1B 2AZ3A 3FEXB 4PPZA 4GC6A 2NR0A 1ZH5A 2BJ9A 2W9CB 3UWTA 2J6TA 5IT9U 3VAJA 3PY8A 4TLRA 5EX0A 1CJKA 4PUOA 2UUBJ 1SJQA 5A0YB 2FB0A 3NGSA 3ZZPA 3OTDA 3LP2A 3OR1A 4J9UE 5L9XA 1WHXA 1S12A 4YEAA 2V4JB 4DPXA 3DGVA 3CCMS 5SUHA 1ZPVA 1YGYA 2CXEA 1S9EA 2AKWB 3OTOJ 4HHJA 3QGPA 3OV7A 1HBUA 3BZQA 4C3KA 3UO0A 2VV5A 3MUVP 1MMDA 5E3RA 1U6FA 4K5SA 2NUUG 1VLOA 2XNRA 1ICEB 4JV1A 1S10A 5K8OA 1HBNA 2OEMA 3BR9A 4ZA1A 2FUG9 4R5PB 3NWRA 2QRRA 1VGYA 3RB0A 4ED1A 2RSQA 2NXCA 3OXLA 4DZDA 2J7KA 4QWEA 2FVRA 1EKSA 1SJ3P 3GZ7A 2E5GA 3V6KA 1SI9A 2BVZA 2XZDB 3GYXB 2IVYA 1RWNB 2AW0A 2J9DA 4UY8T 3D5MA 2XY5A 2DNGA 4ECYA 1EKRA 3DXBA 4ECQA 4DFKA 4WIIA 4E0DA 3OD2A 1BD6A 1K8AT 5AE1A 2IBKA 3AB2B 4CZCA 2VODA 2CJBA 4DSEA 2ZJPQ 4ILLA 2XMTA 5DG9A 2P9EA 3HD2A 1WSRA 2LXUA 3CO0P 4NXMF 3B54A 1O51A 1NK9A 4DR2J 2VQFJ 7FD1A 3DN9A 1IKYB
chains in the Genus database with same CATH topology
2OPSA 4UOCA 3IWXA 2UUAF 4LIRA 1VQ8S 5HMXA 5KFPA 1CSJA 3KWMA 2HS3A 1KHWA 1WF0A 1QVFR 2C3UA 1VK8A 4MFBA 4RW9B 3OLBA 3UR3C 5G0RA 1GXUA 1RT2A 5H9EJ 2CVEA 3W2VA 3KFWX 2DR9A 5K8NA 2CPZA 5IWAF 3NGDA 4DL3A 4QW9A 3TAQA 1IJEB 3OTOF 5DRKA 2AYBA 1Z2ZA 5KFVA 3TUZC 1M5VC 1DAXA 3OBIA 3C6UA 4LQ3A 3HX9A 5KFYA 3H8YA 1BQMB 4KHPF 2HPUA 2BR0A 2HNYB 1QLNA 1HPZB 2RRNA 1VLYA 4OX6A 2ASDA 3C3LA 3MM8B 2DGVA 3D1HA 3PNIA 5EN1A 3KLEB 5HLFA 4FPRA 1BY9A 4TN2A 5A8WB 4DF8A 1XC9A 5DG7A 1UA1A 2JLGA 3I5BA 3IS9A 1LXNA 2NPFA 5KG1A 4Y00A 3BSOA 2QSFA 3AH6A 2CRLA 3NNHA 4OX7A 2AGQA 3PW4A 1CEZA 1B0PA 1S6QA 3H59A 3M8PB 3ZFVA 1RTJB 4Y28C 1YG0A 5F9NA 1S0OA 3QZ8A 4JV2A 2OKQA 2B4OA 2DR8A 3PR4A 3FQLA 4G3IA 5DLFA 1S1XA 4KRWA 2ABYA 4HLBA 3H5YA 1JLFA 4DFPA 4NYZA 1KHVA 3HKWA 4WXWA 5K8MA 2ZZMA 3KK3B 2ZH1A 1LWEB 3QGIA 4O3SA 2BQRA 2OJ3A 2HFZA 2I0XA 3M2UA 1SQEA 1UEVA 2EFPA 4O4GB 3RAXA 5DJBA 3DYAA 4USHA 3MMBA 2AYGA 3CD0A 1FD8A 1S1UA 4C8KA 2V8VA 1RA7A 3RRKA 2NPIA 1ELOA 1FJCA 2IM3A 2L9WA 3QWPA 1X8DA 2XSJA 1QAJA 1FRJA 2LQBA 3K8VA 3TNVA 4NZ6A 3HHDA 4V19J 2DO4A 1U26A 4HDGA 3PEJA 1S49A 1ZM4A 5AXKA 3RRHA 5KG3A 1SJ1A 1XWLA 1X4DA 5FDLB 2O3DA 3OQ2A 3JSMB 2DGUA 4RBTA 1NAQA 1DQ9A 2BOPA 3OR2B 4Y2AA 3IO1A 2RQKA 4QR0A 2EWHA 5B0AA 5IS2A 2DR7A 4DL2A 4DWIA 2GCFA 3SEOA 4K4UA 2DPIA 4A8OA 1YITS 3CJKA 3LALA 2I5JB 4KQZA 5FD1A 5KT7A 4K4VA 1NK0A 5J2PA 3TYTA 2BE2A 1S1TB 2VBYA 2BQ3A 4R25A 4OI4A 4DR3F 4RW8A 5E0OA 1JB0C 1KFDA 2VKZG 5DDPC 5F9LA 2LEAA 1T03B 2H5EA 1FRXA 3K5PA 1N5TA 2YWGA 3I4PA 3KHGA 3WDOA 2W4CA 4IG3A 3MPYA 5A0YA 7FDRA 2XULA 4YY3F 1O0PA 3POTB 5KAKA 4KV8B 5I42B 1H98A 2MJNA 3QJJA 3SCIE 2ZZNA 1UFWA 1N0UA 5D6GA 3V4IA 4IRKA 4IUFA 4IG0B 4PUOB 1FDAA 2AYEA 1NU4A 3E01A 4YP3A 1HWIA 2WB1D 1VS3A 4LFAF 2VPYB 4RW7A 5DLGA 4JI3F 1RYRA 1V3SA 2DISA 3LP1B 2OP5A 3LP2B 3CIMA 5EGYA 1SJ4P 4CNYA 1JXEA 3HVTA 1FK9A 2VPXB 4MIAA 2FJXA 3SQGB 4DR2F 3MEGA 4M63A 1N5VA 5AXLA 4BC9A 3W2WA 3OR1B 3KK1A 3BN4A 5C42B 2A2DA 2ZITA 4PXBA 2RVJA 3L95X 2BANA 4KKOA 5A2QY 2DITA 2QEXS 1VC5A 4QIWD 2YKMB 2CPXA 3A1YG 1L3UA 1H3DA 2J0WA 1HHSA 4NOHA 2QE5A 4DL7A 3N0VA 4PQUA 4RUHA 1OQ3A 4OI3A 2JH3A 2WBMA 4NL5A 2G1DA 2JLFA 4O23A 4DHVA 3D1QA 3K8WA 2UU9F 5GADI 1KNZA 4NXNF 4PG7A 1BQNB 3DOLB 2LYVA 1JKHA 4ECRA 1QAIA 2KYZA 5E2QA 3I4HX 1VQ5S 1HBUB 2J76E 3MM5B 5FIIA 5B0EA 4YDDB 2OIHA 2E9TA 4OZNA 1G1XA 2B7CB 4DBQA 1HNIA 4LSNA 1NEEA 3OTEA 1RK8A 2BQUA 2OSRA 4Q2MA 4ETZA 2XMWA 2YKQA 1NHVA 1R27B 2GJIA 2JLEA 3QPIA 2OAUA 4DS4A 1EP4B 1R6YA 2RRBA 4TY8A 1OSCA 4HKQA 3U1NA 2N3LA 1KRPA 2DNYA 5T7LA 1HWLA 3UDCA 3ZZOA 2CQ1A 1FXRA 3TOQA 2V4QA 4YMEA 6FD1A 3DLBA 2DH9A 4BBYA 4FVCA 4H54A 1IUJA 1JLQB 1HI8A 2KVIA 4C11B 1HBNB 1RT1A 5JUMA 1VQYA 1NK8A 1KOOA 3LH2S 1VHFA 4MK7A 4JI2F 1IKWA 5KFEA 3CCLS 3BB5A 2BJEA 3CD7A 1KFSA 3PO4A 4N77A 1HBOB 4CH1A 3MEDB 2BW2A 1HI0P 3ICLA 1UWBA 1HNVA 3GFZA 4YR0A 1JLBB 3LUYA 4FXWA 2ZVSA 4NZ7A 1FNMA 3JYTB 2KXFA 4J9OA 1SL1A 4J9SA 2E44A 3N9UC 1WTFA 2BYCA 4EFAC 5E3PA 2RF2A 4OI6A 3UFCX 2E1CA 2OMOA 2CDQA 2ZJQQ 3TP2A 3RB3A 3OHAA 3L7OA 2VD3A 3DOKB 1FVQA 4P7TA 3SCKE 5DM6Q 4WFBQ 5KFBA 4WYLA 5KT4A 3PW0A 2XMUA 3GIKA 2OH2A 2OPPA 4IR9A 3ISNC 5GAGU 5J1NA 2NLWA 1F9FA 2CPYA 1FE4A 2GGPA 3C6TB 2UV8A 2W9AA 4B3OA 3M4XA 1N32F 1YBAA 3DCAA 3I9ZA 2PFFB 2KXHA 1WF1A 3IFEA 2MHNA 5KFCA 4X84A 3I82A 2JDJA 1A6LA 1VOMA 3VAFA 1KD1T 4B3MF 4M1KA 2ERRA 1N48A 1RP5A 3HHLD 2XLKA 4URQU 3PEHA 1A9NB 2V0NA 4NLRA 2ZOGA 2VFUA 2HHQA 5L38A 4NCGA 4Y65A 2R8GA 4PXDA 3D54A 1PC4A 2B56A 4WKYA 1UEUA 3UQSA 4JBCA 2GA7A 3SSRA 1GQEA 4UY85 3KTQA 3CULA 2DNZA 1S1WA 2VB6A 1JLGA 1N5YB 4Q8EA 2LMIA 5J2NB 1DBDA 3NBPB 2MZJA 1H2TZ 2B9WA 2GHWA 1T3NA 3CEDA 1NZAA 4Y2IA 4RNOA 1UJ6A 2VC0A 2FJWA 2R8KA 1TQLA 1VRTB 2HNDA 3DM2A 3DU6A 2BBEA 1Y5IB 4OLOA 2M8DB 3H5XA 1U24A 3DRXA 2LU2A 2VPWB 1KOHA 3O5TB 5CYJA 1FE0A 1Y9OA 1GXTA 2C42A 2YX4A 3ONQA 3BF4A 2F8EX 4O44A 3VZIA 4ECZA 5BJRA 4O3QA 4OX9F 4I2PA 1M90T 2EFNA 2XG8A 3KNAA 2FLPA 4I0WA 4C8ZA 5H9FJ 1L5UA 4I6YA 1TKTA 2F8MA 2HNZA 4DEZA 1DJ0A 2WTFA 5F8HA 1PGZA 2NSCA 4NLVA 5F41A 3P3DA 2EBGA 4WZQA 1SL2A 1MROA 1TL4A 2MKJA 3I32A 3GG0A 4PWDB 2ZC3A 3P5TL 4WFAQ 3P49B 2OPSB 4B9NA 3QO9B 1XN9A 1BWEA 2DPJA 2XS5A 3M8SA 2I38A 1BQMA 3B78A 1U2FA 2ILYA 4IO1A 4MFBB 2AJ4A 4XIUA 5G0RB 1VQ4S 1RT2B 2HIQA 4JI8F 4J9NA 2I1RA 5J1PA 4K50A 1S9FA 1KN6A 2MQQA 4Y2KA 1ZAWA 1BGXT 1G3OA 2XB2D 3NAHA 2RU3A 1SIWB 2DIUA 4OJGA 3C6UB 3MURP 4XO0A 3TRGA 4DV2F 2HMIA 4KTQA 1U1RA 1UJ4A 1X0PA 3KLVA 3K59A 1HYSA 3GWCA 4D3GA 1HYSB 1JWWA 4A8SA 2ILZA 2V94A 5HLFB 1NJWA 1SL0A 3I96A 3GIMA 1U1PA 3IS9B 3KK3A 3SZ2A 3N6NA 4I69A 2CYYA 2DO0A 2O67A 4YOEA 4JI4F 1M0SA 4OZ5A 2Q43A 2L9DA 3OFGA 1NJIT 1J5EF 4B9TA 2HRYA 1S6QB 3U02A 5LSRA 5D4OA 4ZMMA 2QA4G 2KYXA 4DV7F 3LAMA 2FC9A 1JJHA 3CCWA 1L3KA 1S1XB 3MMCA 4X4QA 1F2GA 1JLFB 1VQOS 5GAEI 1O5JA 3OSPA 5JXSA