3FFIB

Hiv-1 rt with pyridone non-nucleoside inhibitor
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
424
structure length
403
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYATNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pyridone Diaryl Ether Non-Nucleoside Inhibitors of HIV-1 Reverse Transcriptase
rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 116
structure length 403
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3ffiB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ffiB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ffiB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ffiB04
4Q8FA 4TLRA 1J5OB 1C1BA 1RT3A 5I42B 4WE1B 3ISND 3M9NB 1SV5A 1S6PB 4DL2A 1HQEB 3DDKA 1HARA 1Z4UA 4ZHRB 2UVVA 3QGHA 3DYAB 1JLAB 1QE1B 1S6QA 2HWHA 4ED0A 1RT6B 2D3ZA 3GIMA 4NLDA 3DLGB 3LP1B 4HKQA 4Q43A 2YNFB 3KLHB 2XWYA 5KT7A 2VA2A 1GX6A 3BSOA 4F4XA 3MFHA 5D3GA 2W8LA 3CDUA 4EEYA 1S0OA 1RTIA 5CYMB 3JYTB 2V4QA 3GQCA 3MECB 4NCGB 3BSCA 4QWBA 4WFZA 4K4UA 4YP3A 4MKBA 4EYHB 4RW6B 3H5YA 1N5YA 4RW8B 4WFXA 4ECQA 1JLQB 4ZP8A 1HQUB 2WOMA 4NLXA 5JXSA 3H40A 3JSMB 4LSNB 5J2QB 3QLHA 3G86A 4TQRA 4ED1A 2FLLA 2R8IA 3CJ4A 3IN5A 1NNDA 2YNGB 2FLNA 4EBEA 3Q8SB 2GIQA 5J1EA 1S9EB 3DI6B 5CYMA 1N6QA 3ICLA 3KHHA 2IBKA 5DLGA 5I3UB 4KO0A 2BANA 1SH0A 4QW9A 2HAIA 3LP0B 4TXSA 4HYKA 3FFIA 3QYYA 2YKMA 1J5OA 2IMWP 2ALZA 2HNDB 4I2QB 2ILYA 4ZVEA 4JUZA 4F4ZA 1S6PA 3T5LA 4KFBB 4J9RA 4ZP7A 3ITHB 5KFEA 5KFMA 1SH3A 4H54A 3LANA 2IAJA 1IM4A 1S1TB 2WB4A 4IH6A 3LP2A 2FLPA 5J2MB 4K4ZA 4JV1A 4NRUA 5KT2A 2AWZA 4TN2A 3OL9A 1S9GB 3DLKA 3V4IA 1D0EA 3C6UA 3T19A 1S49A 2D41A 3CJ2A 5D3GB 3CJ5A 4DG1B 1T94A 5KG5A 3M9OB 4IQXA 3HHKA 3KLFA 3GV8B 3DOLA 4O44B 3M8QB 2OPQB 3KJVB 2XI3A 3CJ0A 1RTHB 3DMJB 2FJXA 1S48A 5KFNA 2E9TA 3PW2A 1JLBB 4KBIA 5KFBA 3JSMA 4O3RA 5C25A 4ZPAA 3KK2B 1JLQA 4O3OA 4NYZA 2GC8A 3LAMA 4IG3B 3QGIA 1S1UA 4H4MB 2FJWA 4KHMA 3MEEA 2HMIA 1VRUA 1S4FA 3I0SB 2JEGA 5I3UA 4TQSA 1HNIB 4F50A 4NLQA 5F8IA 4U7CA 5J2NA 4DL4A 4OL8A 2V4RA 2B5JA 5FDLB 3FFIB 3SFGA 1S10A 1RA7A 4R8UA 4ED7A 1JKHA 1IKWB 1R0AB 2BRKA 4URQU 1RT4B 4DL5A 1N5YB 1C0UA 3QZ8A 3OSNA 1RT2A 1TVRA 3QZ7A 2XGQA 2BQUA 2C2RA 4KAIA 4Q0BA 4IFVB 1UWBA 3KLIB 2C2DA 2FVPA 4IRCA 2AX1A 1T03B 2QV6A 2WONB 2OPPA 1I6JA 1JLFB 3DRPB 3IS9A 4WZMA 3PW7A 4I2PA 5HBMB 4NLUA 3MR6A 2RDIA 5C25B 3IGNA 3UQSA 4Q45A 5HP1A 2JEJA 2VG6A 3DRSB 1TL1B 2HNZA 4O3PA 1S1XB 1XR5A 4ED8A 5KFQA 1DTTA 3BJYA 1S1VA 3KLEA 1RA6A 1T05B 2YNHB 2ZE2A 4Y34A 5DQIA 1S1UB 2EC0A 1DLOA 4QW8A 5L1LA 1GX5A 3FRZA 1VRUB 4URSA 1S9FA 2WTFA 4IRDA 3GIKA 2WCXA 5KG1A 2HNYA 1ZTWA 3MR3A 4ZPDA 3KK1A 1U09A 3H98A 2R8GA 4WE1A 3BQ0A 4FS1A 1NHUA 2BRLA 2DPIA 3T5JA 4RW9B 3DMJA 4NZ0A 2ZD1B 2W9CB 1RTJB 3D5MA 3I5CA 4WFYA 1JLAA 1S6QB 3C6TA 1HYSB 4KSEB 1TKTB 2RDJA 4K4SA 4QWCA 3DLEB 4KB7A 2UVWA 1IKVA 1FK9B 2IJNA 5KFXA 4ID5B 3MEEB 2HMIB 1SH2A 3KLGA 1IKYB 5L1IA 4EYIB 2AGPA 2V0NA 4YMEA 2V9WA 3KOAA 1HQUA 3I5AA 4J9SA 3BREA 4R0EA 1SV5B 5KG7A 3KHGA 5K14B 3NBPA 4WYLA 3H5XA 1LWEA 4LSNA 4ZP6A 1RYRA 4YQWA 1DTTB 2E9ZA 2YNIB 1QAJA 5L9XA 5DQHA 5F8NA 1JLGB 1RT5A 2D3UA 2HWIA 4NLPA 4QWEA 4K4XA 4U6PA 3LAKA 1FKOA 3OHBA 3PW4A 2JEFA 4Q44A 1UWBB 3KLIA 5KT6A 3FDSA 5KFSA 4IRKA 2OPPB 3MFIA 3PZPA 2JC0A 2FVQA 3KK1B 5HROA 3GIJA 4ECZA 2I5JA 1TL3B 4H4OB 2GIRA 4ICLB 4NLVA 5EUHA 4KKOA 4URGA 4K4WA 1TV6B 2YKNA 1HYSA 2VG6B 3DRSA 5KFUA 5KG2A 2XC9A 4RNFA 3G6XA 1TKXB 2W8KA 1RTJA 2AX0A 1S0MA 4NLGA 2WRMA 3QLHB 1K1SA 4ZMMA 3V4IB 4NLOA 1TKTA 1JIHA 2XGPA 4MIAA 4XPCA 1S1WB 3H5UA 1KLMB 2UUWA 3GV5B 2J6UA 1S0NA 1MU2A 2W9BA 3T1AA 3CO9A 2IC3A 3CIZA 1IKYA 4QPXA 5F8LA 2UVUA 2BANB 3DOKA 4EO8A 1TQLA 4ECWA 3V6DA 4ZVFA 3DM2A 5C42B 3LALA 3OL6A 3BGRB 3M8PA 3GIIA 4ED6A 5KG3A 1HPZA 4KFBA 3NBPB 3I5BA 1LW0B 2RKIB 5CYQB 5KFJA 5L1KA 4FS2A 4MIBA 5HLFB 3BR9A 4IR1A 4J9NA 3TQ1A 1S1TA 1JX4A 4K4VA 3C6TB 4GC6A 3TAMA 4JV0A 3RAXA 1KHWA 1IKVB 1XR6A 3E01B 1CSJA 3CWJA 5KFCA 4ID5A 1OS5A 4J9KA 3MF5A 4LQ9A 4X2BA 4ZHRA 5KFZA 2B5JB 4ICLA 5FDLA 1HMVA 4O44A 3PJWA 3GILA 5J2PB 5KFLA 1C0UB 2VG5B 5EWFA 3NL0A 5HROB 4IH7A 3PHEA 1FKPB 4F4YA 4R8UB 4RNMA 1S97A 3KLVA 1TP7A 1RT6A 1RTDB 1HNVA 4MH8A 4O4GB 4RW7B 4J9OA 1KLMA 1C1CA 2VG7A 4PQUB 4IG0B 4PWDB 3RB0A 2R2SA 3E51A 1MU2B 4MFBA 3OHAA 3V81A 2ASJA 2UVRA 4TYBA 2QE5A 4WXOA 3MECA 4IR9A 2C2EA 4YR2A 4IDKA 4FBUA 3PVXA 2ASDA 2OH2A 3M8PB 2JC1A 4O3QA 2ASLA 5HP1B 4IH5A 1S1VB 4TYAA 4TY9A 2IJFA 5KFTA 1T05A 3T5KA 1C1BB 1RT3B 3DM2B 5C42A 5I42A 4RUCA 1TL3A 1JKHB 4H4OA 4IOBA 4Y2AA 3H4DA 1N6QB 4QWDA 1RT4A 4K4TA 1N48A 1VRTA 3HVTA 4G1QA 4ZPBA 2YNGA 3T5HA 2JEIA 1SUQB 3E01A 4EBDA 3CVKA 1ZETA 3OL7A 3TVKA 5F8JA 1KHVA 3FQKA 4ZVGA 3NMAA 3DRRA 2B6AA 5DLFA 3KLHA 2IM1A 3H2LA 1REVB 5KFGA 3I0RB 2R8JA 5DGAA 4K50A 2IAJB 4ECTA 1RT7B 3N6MA 5J2PA 2ILZA 2VA3A 3DOKB 2HNZB 3KMQA 4IG0A 2OPRA 2AU0A 1HPZB 1WNEA 1HNVB 4O4GA 4RW7A 4J9QA 5HLFA 1DTQB 3OLAA 1QAIA 4DL7A 4JV2A 3UPFA 2OPQA 5F8MA 5DG8A 3MR5A 1LW2A 4KV8B 1JLBA 4KO0B 4KHRA 3RAQA 5DQGA 2FJVA 2AQ4A 1MMLA 3N6LA 3FQLA 3BSAA 4O3NA 2R2TA 1HMVB 5K14A 4MKAA 4RW9A 3ITHA 5KFWA 3BQ1A 3DI6A 4I7FA 3QO9B 1FKPA 4B3OB 4YR0A 1LWEB 5T14A 2W9AA 2C22A 3UDLA 1LWFB 2C28A 3LP2B 1VRTB 5KT4A 3MEGA 1RTDA 3OLBA 3HVWA 2D7SA 3DRRB 5KFFA 2R2RA 1JLCA 2I1RA 4NLSA 5DG9A 2R8HA 4O4RA 3C6UB 5L1JA 5J2NB 2UUTA 4MFBB 4DG1A 2OPSB 4RW4A 3RB4A 4TY8A 1TKZA 5KG6A 4G3IA 1RYSA 5C24A 3I0RA 3NAHA 1N56A 4O3SA 2I5JB 3NKYA 5DGBA 3RBDA 3M8QA 3KJVA 2R2UA 3IRXA 3V6JA 3LP1A 3PW5A 2BE2B 4R5PB 3KK3B 1JLEA 2BQRA 4NLRA 2IC3B 5F8GA 1RTIB 5HBMA 4H4MA 3VQSA 1HNIA 1LW2B 2J6TA 3QIDA 4ECUA 4ECXA 3BQ2A 1N4LA 4RW8A 4NLWA 3V6HA 1TL1A 2W7OA 3HVAA 2J6SA 2AGOA 1D1UA 1S1XA 1QUVA 4KKOB 1QE1A 3KLEB 1RT2B 3QGGA 4LSLB 1BQMB 4ECYA 5KG0A 4ECVA 4Y2CA 1IKWA 1R0AA 1EETB 1W25A 3H59A 4LQ3A 2HNYB 5DG7A 3RBEA 4NLTA 5EWGA 4DL3A 4Q0BB 3DLGA 5F9LA 3JYTA 4IFYB 2W7PA 4J9PA 3KNAA 1JXLA 5C24B 3MEDB 2FVSA 3QIPA 1C2PA 4MK8A 1T03A 4ED3A 4NLYA 3EPIA 2XCAA 2ZD1A 2W9CA 3EPGA 4I2PB 2IM2A 5J2QA 4M94A 2F8EX 1FK9A 4YR3A 3GYNA 4PUOB 4F4WA 3IRXB 3DLEA 3Q8PB 2YNHA 5KFVA 1C0TB 5J1EB 4PWDA 4EBCA 2DPJA 3KK3A 3UR0A 3MEGB 3KLGB 3Q8RB 2ZE2B 1LWCB 4FBTA 4ZP9A 3DOLB 4KE5A 3LP0A 4XO0A 1RT1A 1BQNA 3PR4A 3ISNC 4WYWA 5KFRA 3IG1B 2HNDA 4J9LA 3PW0A 3KK2A 3MR2A 2YKMB 3CDWA 4ECRA 1RT5B 4I2QA 3H4BA 1EETA 3PR5B 1NHVA 3KHRA 5KFOA 3CDEA 5KFHA 4LSLA 2XI2A 3CJ3A 4DL6A 5C5JA 3Q8QB 1EP4A 5JUMA 1C1CB 2VG7B 1SUQA 2O5DA 4Y3CA 2FVRA 4R5PA 1RDRA 5F9NA 4RUAA 3M9MB 2E9RX 2ATLA 3G6VA 3QIPB 3SFUA 1IKXA 3KLFB 2FVCA 2B43A 4K4YA 3V81B 3MTKA 4IFYA 4RNNA 3KMSA 3RB6A 2XCPA 4J9MA 4IDKB 1TKXA 4ED2A 1RT7A 3DYAA 1YVFA 4RNOA 1TV6A 2YKNB 1RTHA 2BR0A 2R8KA 3NAIA 3G6YA 3RB3A 2WHOA 1DTQA 1S1WA 5KFYA 4ZPCA 2RF2B 1C0TA 4RZRA 3FSIA 3HVTB 4G1QB 1BQMA 4IG3A 1JLGA 5KFKA 1LWCA 4RNHA 4EO6A 2YNIA 4NRTA 1RAJA 1K1QA 1BQNB 3GV7B 3I0SA 2CKWA 3V6DB 5F8HA 3IG1A 3BGRA 2B6AB 5KG4A 1ZTTA 3BSNA 1FKOB 1REVA 4MK9A 3MEDA 2BQ3A 2AGQA 1T3NA 5KFDA 2JLEA 4M95A 3HKWA 2IM0A 4XPEA 3OL8A 5EWEA 5KFPA 1HQEA 3KHLA 2IM3A 4Q8EA 5KFAA 1EP4B 2IA6A 2OPRB 5KFIA 4PUOA 1TVRB 4DEZA 4MK7A 4ZVHA 1IKXB 3N6NA 5KT3A 2CJQA 2YNFA 2WONA 1JLCB 4TY8B 4ECSA 4NCGA 2VG5A 4IFVA 3H5SA 4QWAA 2OPSA 4RW4B 2W9BB 4KV8A 4WXWA 3OSPA 3SI8A 1TKZB 5EDWA 2ZKUA 1RT1B 1JLFA 3DRPA 3IS9B 1XR7A 3NGDA 3D28A 2RF2A 4PQUA 4IKAA 4RW6A 3EZUA 1LW0A 5CYQA 1JLEB 5J2MA 3QO9A 2WOMB 4I7FB 4B3OA 3V6KA 4RU9A 2BE2A 3IGVA 4WZQA 3DLKB 1LWFA 1S9GA 1DLOB 2RKIA 3PJXA 3TAMB 2WK4A 1S9EA 4GC7A 5KT5A
chains in the Genus database with same CATH superfamily
3SYZA 2IYIA 4B17A 2KKHA 5I42B 1LQ9A 1RU1A 3GMGA 2N82B 3M8SA 4CRJA 1YJWS 4AL5A 2NUHA 1S6PB 4M5IA 1AFIA 1N36J 4X65J 2KU7A 4ZHRB 3KYLA 1KS2A 1TL7A 2CJBA 4LF1A 4OJ1A 2RB7A 2UVVA 1S6QA 1QE1B 3H2UB 1VDHA 4O0NA 1QTNB 5IFMA 3GIMA 1GTEA 2VUGA 2PI5A 4BS2A 1EJ7L 3KLHB 2KYXA 2V8VA 2W4CA 2W8LA 3LPYA 3MAAB 5HO4A 1UA0A 1JNRB 1S0OA 5H9FK 1G6BA 1VLOA 2IJRA 5DDPC 3BSCA 3GQCA 3JQKA 1KWMA 1YSJA 3CMES 3OBIA 4NA1A 4MKBA 1KQFB 4YP3A 3H5YA 4WFXA 4RW8B 1P9QC 3MGJA 1U6FA 4OJHA 4OZLA 1U26A 1QVGR 2WOMA 4NLXA 3FGVA 3L09A 3JSMB 2CVIA 2C3MA 2X3GA 3TOQA 3VGTA 4ED1A 2FLLA 3TR5A 3HMJG 2R8IA 4EZ9A 3UW1A 2GVZB 2FLNA 5I4MA 1MMDA 3Q8SB 3D3BJ 3RW7A 2GIQA 3CULA 3SCIE 5CYMA 2G2OA 2IBKA 1Q5VA 3ICLA 1ICEB 2AEFA 3GG0A 1N33F 2Y1LB 3D4JA 3EDRB 2QZ8A 2BANA 1SH0A 2YX1A 5LJ5Y 3LP0B 4QW9A 3PFOA 4HYKA 5ETTA 1IBMF 4ZJQA 2NZ4A 1YX2A 4PCQA 5IXUA 4KJIA 1U2FA 2HNDB 4JUZA 2GA7A 4EI2A 4AL7A 3I87A 2HVDA 4H54A 1L3VA 3D1OA 3W66A 2UUBJ 1IM4A 2DITA 4OYOA 2M70A 2HFVA 5LJ3Y 3SSRA 4K4ZA 2V2QA 2ZJRQ 2HS3A 2M4MA 3SSQA 5KT2A 2AWZA 3V4IA 4L3NA 1S49A 3CJ2A 5K9FA 5KG5A 3CJ5A 3VV2B 3HHKA 2JVOA 2ROEA 3EE3A 3MPDA 4M1KA 2V8DA 4LF5J 1MW7A 1HNXF 2PMHA 4LR7A 3UO0A 1F2HA 2FJXA 2B9YA 4N8OA 2FTRA 2DHHA 1A7GE 2U1AA 2VPWB 4AXIA 5KFBA 2GS8A 1S59A 4TLQA 2NQPA 4KGKA 2N7CA 4O3OA 1RTZA 4B9TA 3CF5Q 3QRPA 1XJWB 1N34J 1S1UA 4DR4J 4KHMA 5C7PA 3MEEA 2HMIA 2H5IB 3B4MA 4O23A 4DFPA 2MDAA 1WG1A 5I3UA 2HGNA 1UVKA 2V5HG 1PAEX 2VF3A 3WIUA 1HNIB 3M6XA 4U95A 4F50A 4X4SA 1U1RA 1NJZA 2KHCA 4DR6F 4F4AA 2YXLA 3J81U 2V63A 4DL4A 3PY8A 4AFFA 2B5JA 3JB9k 3M2RB 3W2WA 3FFIB 1HKAA 3BGFA 5D15A 4R8UA 4N41A 1IKWB 1VMBA 1FJ7A 2E5IA 1RT4B 3OSNA 1TVRA 1G1XA 2FHMA 2H48B 4DS5A 3PRDA 3QZ7A 2XGQA 1FDNA 2FY8A 4Q7AA 2CDRB 3J81j 2C2RA 1VOMA 2XSJB 4IFVB 1UWBA 1WD6A 3ISZA 4KAIA 3RU0A 5CABA 3PX4A 2C2DA 1F6TA 2WONB 2Y0SD 4LRCA 2OPPA 2K3KA 1JLFB 5JMNA 4QIWD 2MZ1A 2CQ4A 4V1Ak 3M05A 4Z7YA 5HBMB 1OQ3A 4A8MP 2RDIA 2W7AA 1S76D 3UVJB 2ADBA 3FNNA 2VG6A 2IRYA 4DSLA 2HNZA 4F04B 1SC1B 3IR7B 2DXEA 5ETQA 3DDIA 1SXLA 1GQEA 5DDOC 3R1HA 2YNHB 1EHWA 4N7TA 3FCWA 4CLKA 2XULA 1OWXA 3UDCA 5L1LA 1GX5A 5HMYA 1VRUB 5CD4A 2DY1A 1HWIA 2DNYA 3ENWA 4F7VA 1S9FA 4IRDA 2F4VJ 2KVIA 2QA2A 2UP1A 5CH7B 4JI8F 1HIYA 3PIOQ 2PFDA 3KK1A 1U09A 5D77A 3VGUA 3GP9A 3BQ0A 2R7WA 1KTQA 1ZM2A 1GMVA 2BRLA 2VQEJ 2KHDA 2J9DA 4HLBA 5E0OA 1UPMB 1RTJB 4FYYB 2W24A 3T41A 2AEJA 1S6QB 4WFYA 4X4RA 4C3MA 2RDJA 1J5EJ 2MKSA 4USWA 4QWCA 2XY5A 1IKVA 2VFSA 2HHSA 2V69A 2WVCA 1AT1B 4PG7A 2RUGA 3W8PA 2HHHF 4PYDA 4B3MJ 2AGPA 2OEKA 1NSAA 3D68A 1JXVA 3H0PA 4IOCQ 3I5AA 2DNGA 3KHGA 3OTBA 5K14B 4OYIA 4JI4J 2E5JA 3H5XA 4DV5J 2V6AA 3BPDA 3N0VA 3EMTA 4ITSA 2Q3PA 4JP8A 2EG2A 3OR2B 4GVBB 3D2WA 1RYRA 5CA5A 2DR6A 4LF2A 3K0JA 1YJ9S 3US5A 3QAEA 2WSEC 1NDLA 4NLPA 2HS4A 1M5VC 2J7UA 5GAEU 2Z2LA 3LAKA 3KDNA 1UWBB 1EAYC 1Q4RA 3FDSA 5KFSA 3TP2A 2VHGA 4IRKA 3LWMA 3EYZA 4DV6J 2JC0A 3KK1B 5HROA 5GAHU 4J7CA 4OV6A 1TL3B 2GIRA 5HATA 4URGA 1H0HB 1SQGA 3BGUA 4A8QA 1HYSA 3H90A 2VG6B 5KFUA 1V5IB 3I55S 1S77D 2W8KA 1YG0A 1TKXB 2BJ1A 3ONQA 1MSWD 4ZA1A 2GJ2A 4F3QA 1Q53A 2V8PA 3T6JA 4ZMMA 5KOXA 2R7XA 4FPRA 3J80U 3HVRA 1B70B 3GJRB 4B3RF 4XPCA 3H5UA 4R0JA 3G71S 2UUWA 4DJBA 1BGXT 1FNOA 4P52A 1S0NA 4NCBA 5GADI 3UN2A 2YKQA 1IKYA 4M5DA 5F8LA 3DXBA 2WVFA 3R2DJ 4KGVB 2RU9A 3DOKA 3MPYA 5ETMA 2FGOA 3LGMA 1TQLA 4ECWA 3D54A 2UXCF 3DM2A 5C42B 3OL6A 2HQGA 3BGRB 4LF6F 3RAMA 5BR8J 2DJWA 4U7UD 2DY9A 1XIQA 1FRXA 3GR1A 5DM6Q 3M8YA 3MTJA 3IO1A 3IM8A 2XYHB 3NXZA 4Y2MA 4Y0FA 2ZEJA 4J9NA 1NSPA 2GVDB 3TQ1A 2HBRB 3C6TB 4GRSA 1IXKA 3TI0A 1FDDA 4JV0A 2V2KA 3HT3A 4JYAJ 1KHWA 4X64F 2CNNB 1QSLA 2G13A 1CSJA 1RKIA 1YBAA 4ZJLA 4DSEA 1CQNA 3MF5A 4PXBA 1XNQF 1NPRA 1FFWB 3CJQA 1WC3A 1KKHA 1PBUA 3ZZYA 2HPUA 2B5JB 1MLAA 2BW7A 4PWUA 4O44A 4KQZA 5B7WA 5KFLA 1SJ4P 3FZ2A 1UFWA 2E29A 3BGOP 4F4YA 2GCFA 5B0CA 2YWWA 3CMAS 2CJKA 1VHFA 3EGVA 3MMCB 4ZK7M 2GFFA 4F4KA 1ULRA 3WX4A 4MH8A 5IV4A 2CQBA 2AD9A 4FVMA 1C1CA 4PQUB 3RB0A 1T9UA 2G1DA 5H1SV 2ZKTA 3DXSX 2RMLA 4CTAB 1UA1A 3OHAA 3W63A 4MYTA 2ASJA 2CQCA 1JJ4A 3MECA 4USUA 5AE2A 1NDPA 4YR2A 1QY7A 2LU2A 3PVXA 4O3QA 2JC1A 5E3AA 4OYZA 2ASLA 5HP1B 4TYAA 2IDLA 2NYIA 1T05A 3T9ZA 1RU2A 4ILMA 1T11A 3QRRA 2FHOB 1N6QB 3R1LA 1VRTA 4G1QA 5FIIA 1JJ2R 2RU3A 1SBRA 5H9EK 2CVEA 1CJKA 1EB0A 2JEIA 1SUQB 2ZBQA 3E01A 3AD7C 4CYUA 1X7VA 1VQKS 4FF1A 1ZETA 2JFKA 1RABB 3FQKA 1IBKJ 5HJXA 3DRRA 3MWBA 4DZDA 2A1BA 3KLHA 2PMZD 1IUJA 5DLFA 2UUAF 1REVB 4OZ3A 4JI0J 1T9YA 5IWAJ 3VTIA 3LOUA 4DSIA 2FB0A 1RT7B 3ET6A 2MQNA 3FJ2A 2H1YA 5F0UA 3G87A 3QFHA 2Z58B 4KY3A 3UNGC 5I3QA 4N56A 1FX4A 2KYZA 2XNRA 2AJ1A 4C9DA 2K1RA 1FT8A 3DN9A 3CDBA 3TZYA 1IBLJ 1N88A 1YRXA 3MR7A 3T1HJ 1VBZA 4ZVTB 1L5UA 4RW7A 2F1FA 2D3OR 5HLFA 2QO3A 5MLCV 1QAIA 3OLAA 2QLJB 3O5TB 5DG8A 3P4UB 5F8MA 1YJNS 2IYGA 2ZH8A 3D3CJ 2R4FA 4ALZA 1RCOB 3AH6A 3AOAA 4Z37A 3CCLS 2JNJA 3N6LA 1K8AT 1DJ0A 3GZ7A 2ZFHA 3KUHA 1VBKA 1B4SA 4PG4A 1K0VA 1YIJS 1Q7LB 1R43A 4HH0A 1NKBA 4MKAA 2ZJQQ 3WQPA 1WTFA 2V2VA 1NRKA 4B3OB 2OGUA 2YPZA 3A13A 2COLA 5ETOA 4DU8A 1YRTA 2CNLB 4JI1J 1EQ0A 4B08A 1LWFB 1NCLA 1YJRA 3POTB 8AT1B 3EXYA 1SL2A 2MY7A 3HFVA 2D7SA 4FKYA 2DO4A 2DT9A 1WSVA 5CCLA 2KRBA 2UXDF 3G8TA 1N0VC 2R7TA 3LGHA 4MFBB 4C8KA 2DNHA 1TK8A 4W90B 1OO0B 2FGCA 2CWKA 2ZNZA 4F26A 4TY8A 1TKZA 5KG6A 1CBKA 4G3IA 3CCRS 4OYXA 2ZM6J 3WX8A 2V8GA 1YLXA 3NKYA 5ETKA 5LOQA 3AD9C 1NSQA 4NXMJ 3JSRA 3M8QA 3KJVA 1WDDA 2CZ4A 2R2UA 2RHSB 4OJ3A 3L9ZA 3IRXA 3V6JA 2JOQA 4K0KF 4QR0A 4DX5A 9ATCB 3HF5A 3W3SA 4AQYJ 3KK3B 3VALA 4USIA 2MQOA 1M1KT 4DPYA 5IV3A 1Q8BA 5F8GA 1KD1T 1FJCA 3Q24A 3UN5A 2EFOA 3I9ZA 1WSRA 4L74A 4LSZB 3BYRA 4RLEA 2J6TA 3R2CJ 1HL6A 3R9LA 4E98A 4ECUA 1LV5A 4FVCA 1N4LA 1T9XA 2DNLA 4NLWA 2EFQA 3U1NA 4C3LA 1S1XA 3OTDA 1VS3A 1S99A 3PYEA 4KKOB 4LR8A 1M5OC 2HBZB 2VONA 3W7BA 1YITS 2AT1B 3QGGA 1U1NA 4LSLB 2DEJA 1SKUB 3ILLA 4ELUA 1HBOA 2EI5A 3IFEA 4ECVA 4KHPJ 3THTA 3H59A 1W25A 2X3DA 3SCLE 2HNYB 3RBEA 4NLTA 4DV6F 3A1YG 2DNRA 5HQLA 1KVKA 3AJDA 5F9LA 1ZA1B 2YH1A 4MIWA 3TQEA 3WC2A 4ETXA 3JYTA 4IFYB 1HBUB 3VAKA 3KNAA 1B7FA 4WP9A 4UY85 2J0XA 1TTHB 4DUTA 4WTOB 4ED3A 4K2JA 3UR3C 4NLYA 3OJSA 4YB5A 1FRMA 3KDOA 4JB8B 3EPIA 3C2PA 2W9CA 3MOJB 2FJEB 4I2PB 4N47A 3RG6A 4ZS6A 2DD8S 2PDAA 4F4WA 4PPZA 3CTRA 2GNKA 3IBFB 1SC6A 1S6OA 2HG4A 2LFVA 4QBUA 1I94F 1C0TB 1ZS6A 3PFEA 4MT1A 4ZIVA 4DPXA 1L3TA 1M5PC 2DPJA 1KRPA 3PKMA 2MZSA 3UR0A 1EIYB 1S0VA 2EKNA 2NSBA 4OHYA 4JI2F 3N28A 3DOLB 1TUVA 4OHXA 4ZOSA 4ZP9A 1RT1A 3BBFA 1FEEA 1HWJA 1X4GA 3HHLB 4L76A 4WP3A 2X1AA 1N32J 1RSCA 3IG1B 2HNDA 1YZ7A 4P7VA 2JLGA 3NNAA 1UEKA 3VVUA 2I38A 2XMAA 4ECRA 1FCAA 1RT5B 4I2QA 2BW2A 3ZZZA 3H4BA 1EETA 4LF4F 1NHVA 3CO0P 4P6QA 5KFOA 1D8YA 1RWOB 1UPPA 5C5JA 4CO5A 6FD1A 5JUMA 2W2MP 4GKKJ 1B0PA 3Q8YA 4F67A 2GHPA 2E9RX 1RDRA 4B3RJ 1GMWD 3A8KA 2MKJA 2ATLA 4A8KA 2DHSA 3QIPB 1IKXA 2JX2A 2KJVA 2B43A 2E5GA 3V81B 1ZAWA 2RRBA 3AQOA 5AXMA 4GKJF 2XCPA 1URRA 3ZZ0A 4J9MA 3TUZC 2DVIA 2DH9A 4ZITA 1VGYA 3U7JA 1SJQA 4RNOA 3NS5A 1TV6A 1RTHA 2BR0A 2R8KA 2D69A 3C15B 4JI8J 2PC6A 1ZA2B 2OP5A 3O6QA 2Q66A 3D6MB 4ZPTR 4ZVQB 4S0MA 4G1QB 2HGMA 3N5FA 4I6YA 5K5MA 4IG3A 3MMAB 3CIMA 1LWCA 5L8RC 1KONA 3Q89A 3PTWA 3GPAA 4OI1A 1W2BR 2OAUA 3UD3P 2CKWA 4CH7A 4RUHA 4DN9A 5HJYA 2QL9B 3S6EA 2B6AB 1VQ6S 1ZTTA 3BSNA 3TA1A 1REVA 1N5QA 4M5KA 4DUZF 2UZAA 3AA9A 1TMJA 4PXDA 4CNZA 5FJ4A 3LWLA 5EWEA 4HR2A 1UVMA 4TNOA 2VC1A 4P10A 2Q6BA 1HNZF 4Q8EA 3IR6B 1EP4B 3RUBL 4PXEA 3QBCA 2IA6A 2M3DA 2XO6A 1NHKL 4JI6J 3R5DA 3DGVA 3FSYA 1F5CA 2CJQA 1GEHA 2P9CA 1S5ZA 4QU7A 2OELA 4ECSA 1IR1A 5ETLA 5BXIA 2CPJA 5LMNJ 1U48A 2IFXA 2W9BB 1RACB 2OPSA 4RW4B 3V2UC 2CQIA 3R27A 1FWPA 2XLIA 4DR1F 1TKZB 2V50A 2VASA 2WAQD 2ZM6F 4K8RA 3GCWP 3JTOA 1NK7A 4B9VA 4Z2XA 3AY0A 1WTBA 4P2XA 2NCKL 3KFWX 4RW6A 1YRUA 2AZ3A 2WSCC 4PQAA 2OLWA 2ZJPQ 4AL6A 2ZOGA 1JLEB 3QO9A 2WOMB 4I7FB 1EARA 1MWQA 2QLFB 5D78A 3VCDA 4RU9A 3IGVA 4UOHA 3V6KA 1LWFA 1R8CA 3WBZA 2CZ9A 2OTJS 2RVJA 2QMWA 3HULA 3MM5B 2WK4A 3DI6A 2CPIA 4WU2A 1SKSA 5KT5A 4Q8FA 1ELOA 3BN7A 1FE4A 1J5OB 4FXWA 2Y8YA 2DHGA 3TWZA 4WE1B 3ISND 1SV5A 2IMOA 4C98A 3BO2A 3W64A 5D0GA 4OYPA 3BBBA 1HQEB 1V5VA 1PC4A 2CPEA 3KJNB 2H3EB 5E3RA 4JV5J 3EVMA 4WWSA 2AJ0A 4KPYA 3DYAB 4ZCKA 1JLAB 2HWHA 2CQ1A 2LDYA 2QTWA 2W2NP 1RT6B 1H6KX 1I51B 2DB1A 2D3ZA 2DIUA 4TKTA 2CG8A 3AAWB 5HK4A 3H7HB 4UW2A 4Q43A 2GIFA 4OZ0A 3UCUP 3BSOA 1R8BA 2V68A 5A8WA 3HD1A 2NS1B 1M1HA 3CC4S 1SJ1A 4CLWA 3JYTB 1HBUA 2MSTA 4I56A 1BXNA 2J0WA 4K4UA 4A8WA 4NOHA 4EYHB 2BZ2A 1RAGB 1FWLA 1N5YA 4PWWA 2GJFA 4R25A 4YY3F 3M32B 2F40A 1BD6A 2A18A 2L9DA 4DL0C 5CD4H 3H40A 2FYXA 5K8MA 4LSNB 2MXYA 4TQRA 4W92B 2LMIA 3CJ4A 1JJCB 1FTCA 1FRIA 1FA0A 1VJQA 3ZNJ1 3DI6B 3D0HE 1N6QA 3OD2A 4DR5J 3A8JA 3SDEB 2HSEB 2C3YA 2AYBA 1A9NB 4KO0A 2L48A 2DTJA 3C16B 2HBYB 5D0HA 4ILLA 4TXSA 2VODA 1Y00A 5M2UA 4B9UA 2JJ4D 3TW0A 1CEZA 3G8QA 3P5BP 4ZVEA 1S6PA 5ETRA 3POTA 4J9RA 2FJBB 4Y65A 2PIIA 3ZZPA 5KFEA 3IRWP 5KFMA 1KDNA 1SH3A 3LANA 2CNKB 2IAJA 1XK8A 1Z1ZA 4NASA 1I94J 1S1TB 2X51A 2JL9A 3LP2A 4EWTA 2YWEA 4MJKA 4UQTA 2A10A 5J2MB 1XNRJ 3J7YU 4NRUA 4Y2KA 3RYLA 3VAFA 5AE3A 1N54B 2D41A 2GQQA 3C6UA 3T19A 4IQXA 2QEXS 5D3GB 1HHQA 3M9OB 4ERDA 1PC5A 2BBEA 3DOLA 2XNQA 4JV5F 1F9EB 4O44B 3M8QB 3KJVB 3CJ0A 3GWCA 1RTHB 4JI3F 1S48A 1BMQB 2CZVC 2V34A 2YVSA 2H4WB 5KFNA 4CQ1A 3HXMA 2RUSA 2DCLA 3PW2A 3HJFA 5C25A 2HFZA 4QU6A 2HW3A 2BE9B 2HVIA 1CULB 2MJNA 3D1HA 4NYZA 4J9UE 4XAKA 3LAMA 2AJ2A 4USVA 3EZOA 2VJVA 2LQJA 2MQMA 3QGIA 3R5CA 2CUYA 1NO8A 2YX7A 3GFHA 2M52A 3HLUA 1DRZA 1KR4A 2VPXB 1JB0C 3TZWA 1YJTA 3BDEA 2MMYA 4NCAA 3L95X 4I6AA 2CYYA 2V4RA 5FDLB 1RBLA 1IWGA 4OX6A 1S10A 4ANDA 1RA7A 3AOCA 1KSPA 3M6UA 4ED7A 2HLUA 2DR7A 1SB6A 2RH3A 1N5YB 1TU0B 3M1VA 3QZ8A 1VHIA 4NI2A 1S7IA 3D1QA 2B7CB 3D66A 3SZ2A 2FZGB 1E6VB 1GXLA 4G6VB 4UOFA 3T1YJ 2IDEA 5HAOA 2LECA 2AX1A 2HIYA 4BC9A 3AFGA 1X4EA 4BCAA 1Q86T 4X62F 1I6JA 1JWWA 2HQCA 3AB2B 1GH8A 4LRDA 1HBMB 2UV8A 4EGLA 4WZMA 5AXLA 3K59A 5BJRA 1UW4A 4I2PA 4NLUA 1TK5A 4HEA9 3BEGB 2OMOA 1UAWA 3UQSA 4AXJA 3SQGA 4Q45A 5HVGA 3DRSB 3BO4A 1U2RA 1NKCA 2JEJA 5KFFA 2DR5A 1DTTA 1UZHA 2ROGA 1S1VA 3KLEA 2N7YA 4FF4A 1T05B 2Z2MA 4DDFA 2BKOA 1S1UB 1FDAA 2FUG9 3GSIA 5B0FA 1FRHA 5DQIA 2EC0A 4QW8A 4OI6A 3PYFA 1OJ4A 5B0BA 2WTFA 3GIKA 1BY9A 1ZTWA 5L9NA 3LQVA 5E2QA 1RWMB 4ZCIA 2PGCA 4CLLA 2DGUA 3VAIA 2EBEA 5IOLA 1Q8KA 4WE1A 2BJ7A 2AF6A 2R8GA 1TK0A 3U1MA 1U0SA 4FS1A 1JQGA 2QMXA 3QT8A 4RW9B 1FD2A 3DMJA 2MQ8A 1SC3B 4Q2MA 3TZXA 1AXQA 2W9CB 1U1QA 3THVA 3HDSA 1XEZA 3I32A 4KGZB 4P7TA 3AXKA 2A6OA 3K17A 2XWXA 2C2MB 2HLTA 4QIEA 2UVWA 4B9SA 2XS5A 3UN3A 2MPUA 2FIUA 4FZVA 2IJNA 4LVNP 4ID5B 4TVAB 4WP8A 3W8GA 3VAMA 1DFDA 3KLGA 2BJ8A 1IKYB 4M5DB 1KEKA 4ELVA 2QLXA 1W2IA 2AP6A 2V4JA 3KOAA 2C1EB 1UJ6A 1WWHA 1H2UX 3N4WA 4L72B 2HWTA 1HQUA 2HZVA 4XIUA 1OSDA 4USJC 4DX7A 2XYPB 3T9NA 4N5SA 3SMZA 3FUYA 4DUZJ 1E6YA 2P9EA 3FSXA 3MM7B 4P2FA 2K2PA 1LWEA 3CDAA 2LCWA 4DX6A 4DF8A 1U8WA 1DTTB 3CD7A 2XSFA 3THPA 1QAJA 3M7VA 4DN0A 5DQHA 2ZHAA 1UVLA 2XZWA 1F5BA 4PEOA 2Z56B 3KUEA 1RT5A 2VBZA 2PT0A 4OLOA 4P74A 5SUHA 1NH7A 5C2GA 1EX8A 2GVDA 5AXNA 4K4XA 1FKOA 3PW4A 4ELTA 3M8ZA 4Q44A 5AJ3J 3KLIA 1X9MA 4YOEA 4J5OA 2E1AA 1L3SA 2NXJA 3CCVS 4OYMA 1CC7A 4ECZA 3MOZA 1HWKA 1JK9B 3DNCA 1WG4A 3GE9A 3BS9A 2OKQA 4RWXA 4X65F 1TV6B 3K5MA 1VC5A 1D9DA 3FEXB 2MKCA 1OY6A 4QZVB 3VGSA 4RNFA 4DS4A 2IBOA 3QLHB 1K1SA 1ZZNA 3P8BB 4CWBA 4DPOA 1TKTA 4DQSA 3ADAC 1AW0A 4MIAA 3HHDA 3NWGA 1DAXA 1UL3A 2EW9A 3IC1A 3MPUB 2ZH7A 1MU2A 1Y4ZB 1AA1B 2IC3A 2P6TA 1NJIT 3UI3A 3FZBA 2ABYA 5EGYA 1N34F 2XHWA 4QR2A 3J7AN 4QJVA 4EO8A 3D6FB 1TL4A 3CMQA 1N5TA 3LALA 3GU0A 1PILA 1XMQF 5HMWA 2RDDA 1U47A 2MB0B 4C8LA 3NBPB 1KBRA 1LW0B 5CYQB 3SCJE 5KFJA 5L1KA 4FS2A 3KJQB 2FHJA 4YS2A 4IR1A 3U27A 4WKRA 1JX4A 1YHQS 2ZBRA 3PHTA 1SQFA 1HR0J 1RHJB 1GXTA 2V67A 2LEAA 1HWLA 1CJKB 1FO1A 1XR6A 2CXEA 1R7IA 1CS4B 1T0TV 5KFCA 3Q23A 4K0KJ 4HDHA 3PEJA 4LQ9A 5DZ7A 5KFZA 3CUNA 4LF7J 2N3LA 3H20A 3PJWA 1U6BA 3NL0A 2HVHA 1C0UB 2VG5B 3ZTRA 1NBEB 5HROB 5EWFA 3PHEA 1FKPB 2DGOA 2CQGA 3V5RA 1CJTA 3QT6A 3K7RA 1TP7A 3BF4A 3M1VB 2RJZA 2Y0BB 3GSDA 5ETNA 2DISA 2QX0A 3IAS9 3B4DA 2WW8A 4J9OA 4F2SA 3HHNB 2KFNA 2A6MA 4WFAQ 4PWDB 3JAMU 3ZXWA 2R2SA 4C0BA 1SIWB 5E3QA 1D9AA 1XERA 3W60A 5ADZA 2LDIA 3UCZP 1H74A 2QA1A 3G8SA 4FBUA 4USHA 2KTQA 4PXCA 1P27B 4OHVA 3OT9A 3G4SS 1VIXA 3CGIA 3T1YF 5KFTA 2UUCJ 4RUCA 3CJTA 1LKZA 4DFMA 4H4OA 3H4DA 2Z57B 4QWDA 2VBWA 1RT4A 4KGXB 2BM0A 3CD0A 5HMXA 2MGZB 2KG0A 1KN6A 1CS4A 3EM1A 5DZ6A 1U1PA 1XNRF 3ZZTA 3TVKA 2ZBIA 4OHZA 3NMAA 1BE4A 2OJ3A 4B02A 5BYQA 1APSA 3KNGA 4BWJA 1P1LA 5KFGA 1H72C 2P9GA 3I0RB 2C3UA 3K89A 3RBXA 1YJ7A 1U1MA 3GFZA 4DCPB 4DR1J 3NNCA 3N01A 3PKYA 3HM9A 1SC4B 2L08A 2RQ4A 5J2PA 2G0IA 3A3PB 3H42A 3DOKB 4H4KA 4KIAA 3W62A 2DEIA 2HQDA 3MURP 1VQYA 3QWPA 4Y2IA 2OPRA 1R31A 4FN5A 2AYMA 1BWEA 2Y1IA 4RPFA 4W4MA 1DTQB 2CIMA 1X5OA 5CHCB 4DL7A 1Y3JA 2MZJA 5M2PA 3TAQA 1F60B 1LW2A 1SJFA 4KV8B 1JLBA 2GMHA 4KO0B 4YFUA 1NK6A 2UUAJ 4C8ZA 3FCVA 1MMLA 3A3OB 3HSDA 2YTCA 1IQZA 3FQLA 4AD6A 3JQJA 1RAOA 4YEAA 2HS0A 1YKWA 4G1IA 2HRTA 2B56A 4KT0C 3M8RA 1HMVB 4NXMF 3JS9A 1VQNS 2C22A 4I7FA 3QO9B 1FKPA 1A0OB 3NGRA 5T14A 4CO3A 3UDLA 2FDNA 1VRTB 2BJDA 4CLPA 3OLBA 2YH0A 3NGKA 3DRRB 3NGUA 2HRUA 1JLCA 1LNQA 4NLSA 2BUNA 4C8YA 2UUTA 1Q0NA 5D4NA 3GJTB 2OPSB 4RW4A 2KDOA 4GO5X 5ETVA 3NGSA 4P9SA 3CJKA 3RB4A 3QT5A 4LF5F 4Q2LA 1R8AA 3I0RA 4PKDB 4DLEA 4O3SA 2I5JB 3AB4B 1W26A 3EGNA 3I96A 2LQ5A 4UOGA 2E9TA 3RBDA 5KAKA 5GMKa 5LMUJ 2B4VA 3NP5A 1PGZA 1U0HB 1RHKB 3LPEA 2BE2B 1N33J 1RWVB 5CQGA 2IC3B 4OV1A 5LMUF 2VU5A 3ZTOA 5HBMA 4X62J 5K8PA 1WHYA 3K5LA 3CCES 1ZZFA 1X4FA 4RO0A 4A8FA 3VAJA 2BOAA 1NJXA 4NXNF 3WZ0A 1M5KC 4WF9Q 4DMZA 3HHEA 4NEZA 5GVQA 2OSRA 3PXGa 4JYAF 2O67A 5HVFA 2J6SA 2AGOA 1DQ9A 3TNVA 3UNYA 2MLZA 3W5XA 2D9OA 1NJYA 1QE1A 2G4BA 1FESA 1AZSB 3EXCX 4RUBA 3ZTPA 2EC2A 4ECYA 2DGSA 3B78A 5KG0A 2YQ3A 4UQGA 1IKWA 3IWXA 1V6HA 2WVDA 1DBDA 2KXHA 3PYGA 4LQ3A 2B7BB 2XSJA 4DL3A 4DR6J 4DV0F 1HHSA 2M7SA 5IC6B 2HKEA 1RLDA 2FC9A 3IP0A 2KRRA 3NOCA 4HI1A 4OLPA 5C24B 2MEWA 3MEDB 5E7OB 4YN3B 3QIPA 1C2PA 1Y3KA 4MK8A 1U1OA 2XS7A 2CNOB 3I4HX 1G4CA 4L3KA 2E7WA 1RQ0A 2ACMA 2OUGA 4HTJA 1T3OA 5GADU 3AODA 2CQ2A 1O5JA 2IM2A 4YHHF 5J2QA 4M94A 2LEPA 2JDJA 3GYNA 4I0WA 1HFEL 3HD2A 2FHKA 1FJGF 5KFVA 3U1LA 1RB0A 4PWDA 4NPOA 2V4JB 4EBCA 1WHVA 1H3DA 2GVZA 1B0VA 3WIVA 3KLGB 3E3XA 2HVZA 2ZE2B 3UWTA 4FBTA 1ZM4A 2RT3A 2D9PA 4PABA 3LP0A 4XO0A 3OXGA 1OY8A 1JMTA 3ISNC 5HSPA 1HQ2A 4KYZA 1GMUA 5KFRA 4LFBF 2GAHC 1Z2LA 2OEJA 3MR2A 4NE9C 4X4UA 3CDWA 3IMQJ 2MLYA 2WBRA 1Q7YT 2WZ1A 2ACYA 4F2RA 1HBNB 2OI2A 3PR5B 3QFWA 4DV2F 4DL6A 1AUSL 2GO9A 2BJ9A 4DR4F 1RAFB 3Q8PB 4OZJA 4V19X 4IUFA 3AXMA 5FD1A 2B4PA 3QQCD 4JBCA 4N76A 4DR2F 4UT4A 1PYTA 2QLBB 4IFYA 3EDQB 3KMSA 2ZC3A 2OMLA 2DH8A 4FYDA 1RISA 1TKXA 1X4AA 3ILJA 4XDDA 3S01A 3OV7A 1U1KA 4C11A 4CP5A 4DHVA 1NPPA 1YVFA 3CW2C 2QRRA 3NAIA 1WEYA 3G6YA 1Y5NB 5KFYA 2O01C 4ZPCA 2RF2B 1E6VA 1F5AA 5GAHI 1F3FA 1CVJA 1IJEB 1BQMA 1GK8A 1JLGA 3R7NB 4JI3J 2BEFA 2YNIA 1FRKA 3A3NB 1K1QA 4NZ7A 3GV7B 2EPIA 5CZXA 5HQ8A 4LVOP 3CCJS 2DR9A 1P6TA 1GMWA 2BQ3A 1T3NA 3M2VB 2DGTA 2JLEA 5DETA 3EVWA 3QATA 4CLUA 3OL8A 1U8SA 5EHHA 1WKKA 5KFPA 3KHLA 2L9WA 2H54B 4ZPWR 2CQPA 1WC5A 1NLKL 3HZGA 4ZJOA 3IXQA 2Q43A 2XMTA 1UTAA 2O66A 5KFIA 4PUOA 1TVRB 1RUSA 3BN4A 3MM6A 4DEZA 1RWNB 2LEBA 4MK7A 2LA6A 2GAGC 4ZVHA 1DQ8A 3SSSA 2IVFB 1I1GA 1FF2A 1PJ5A 3G82A 2FZCB 4TY8B 3MXHP 4NCGA 2XMJA 1X0FA 1FJEB 3H5SA 1BQXA 2OO4A 4KV8A 3Q0AA 3OSPA 2E1RA 2B9XA 2ZKUA 1JLFA 1KQKA 1RCXB 5HI7A 3Q8UA 2CJYB 2JVRA 3H2VE 3Q83A 1T8EA 1LW0A 5CYQA 2BACA 5J2MA 2WSFC 4B3OA 2CQ3A 3Q2TC 5A0YA 7AT1B 1HR0F 5H9FJ 1JJHA 3W2VA 3DLKB 1S9GA 2H65B 1DLOB 2NPFA 1QJHA 2RKIA 4C8NA 3Q8VA 4CLFA 3T3FA 1NK8A 2ALYB 1ITPA 5CYMB 4GC7A 1BHNA 2MZQA 4DPTA 2JLFA 2R7SA 1NK4A 4TLRA 3S7RA 2QMUB 3M9NB 3MM9A 1RAIB 1B7YB 3MCOA 1LFPA 5JJBA 1K73T 4DL2A 2CPDA 1EQMA 4HVZA 3DDKA 5MAOA 4CM2A 4DSFA 1YK9A 1VR6A 4C11B 4ED0A 4OX9F 3PO5A 2QC3A 1AYEA 3PIPQ 4U8YA 4U7UK 3LP1B 2EG1A 2OTLS 2VA2A 4M5JA 4P2SA 2HZCA 1RK8A 4F4XA 5D3GA 1LWXA 1TELA 1IVZA 3CDUA 3O8WA 1FXDA 1IN0A 2DK2A 2QYCA 1RTIA 5C2CA 4OX9J 2HHVA 2DYAA 3HFZB 2ADCA 3IBWA 4QWBA 4OQJA 4WFZA 3WHIA 1QVFR 3CCUS 4Y00A 1X5TA 4RW6B 1NJWA 2RILA 3NRBA 4ZP8A 2X1FA 1RWUA 1M0SA 4HACA 1QAYA 2NREA 3G86A 3VHQA 1FD8A 3BYPA 4C2MA 4A8YA 3MM7A 1NNDA 1IR0A 1NXIA 2YNGB 3MPVA 4EBEA 3HI9A 4YDXA 4LRFA 3T6BA 4NEYA 1S9EB 3CCTA 3KHHA 2JFDA 2QA4G 1CJUA 4CH1A 1FFGB 1WKJA 4I68A 5HMZA 5I3UB 1YBTA 2HAIA 2YY3A 1RBOB 5GAGU 1TAUA 4QOTA 3FFIA 3GIRA 2YKMA 5BYSA 2G2YA 1J5OA 5I3PA 2ALZA 2IMWP 3CEDA 3FEYB 2ILYA 5A2QY 4QPTA 3JTNA 3UE2A 5LXYA 4KFBB 1T9VA 3TVYA 1WC4A 3ITHB 1MWYA 3BH6B 2F4FA 3FMBA 1Q95G 2MQQA 2VV5A 1XTZA 3MCSA 2R7VA 2FLPA 1T7PA 1RADB 4JV1A 3SV4A 2XHCA 4UTGA 3OL9A 3O1LA 1D0EA 1YBUA 5A8WB 1HBMA 1T94A 2KL8A 2AMCB 4DLGA 3KLFA 1SI9A 2EFGA 4QR1A 2Z30B 3PM9A 1Q5YA 2KT3A 2XMUA 2OPQB 2XI3A 3P5TL 5IQ6A 3W65A 2YKPA 3DMJB 2F8MA 4EZ6A 2ZH2A 2G0JA 1JLBB 1ZM3A 4KBIA 4TU7A 3JSMA 2NR0A 8ATCB 2KO1A 1XNQJ 1WF1A 2ZUGA 3MUTP 1SVDA 5K8OA 4E0DA 2DCUB 4IG3B 3NNHA 3RR7A 5B08A 1HNXJ 1HD1A 4OI0A 1Y7PA 2FJWA 1BUXA 1VI7A 2XZDB 3NOGA 1V3RA 3KUGA 1S4FA 4BHQA 1K47A 3A8EA 2MQLA 2N3OA 2KT5A 4X66F 1U4BA 4B9NA 1RKJA 4OI4A 1X5PA 3HCXA 4TQSA 4DR2J 3PX6A 4Y28C 1YI2S 2ASYA 1G7CB 4NLQA 3DCAA 1FDBA 3QT7A 5J2NA 1X4HA 1U25A 5J1NA 4CCHA 5HVHA 1T9TA 2M9KA 1J27A 2F65A 2VPZB 3TYTA 3GYXB 3I31A 1TMMA 2ZH9A 4RKUC 4JI5F 1CLFA 2BVZA 1CJTB 1JKHA 1R0AB 2YWKA 2XZTB 5D4LA 4QQBA 4DR7J 4DL5A 2QN6B 4GO7X 1C0UA 1ZPWX 4DV5F 1HW8A 1KC8T 4PPDA 2HQ3A 1XMBA 4GKKF 1Q8LA 2BQUA 2HK2A 1ZYQA 1ZH5A 4FYXB 2CG4A 4LT6A 4OZ1A 5T41A 4IRCA 1CJVB 1T03B 2YBVA 3FBFA 2GW8A 2QGFB 4UOCA 2MKYA 3OUYB 3DRPB 5DRKA 2CPXA 1ZOTA 2ZWPA 3PW7A 4A4JA 2OD4A 3MR6A 1WHWA 3K58A 3IGNA 3W1YC 1MNEA 2PD1A 5HP1A 2E7VA 4ETZA 4LFBJ 3CD5A 1TL1B 2BA9A 1FXLA 2J76E 5A6WA 4O3PA 3J80Y 1S1XB 1N5SA 1VFJA 2QLWA 4YHHJ 5KFQA 3ZZOA 5SZTA 1X0PA 1RA6A 2BKNA 3R3TA 2AYGA 4QCLA 2B8QA 4Y34A 3ZNUA 3X1LB 1S12A 3C14A 5FLXU 1DLOA 3K8VA 3OFGA 3FRZA 5E3PA 3B8HA 4URSA 2ZDPA 1PJ7A 2PN6A 3F44A 1KTVA 2WCXA 6AT1B 4ER8A 2HNYA 2W2PP 1VQ4S 3H98A 2CDQA 2R3VA 2XMKA 3BBCA 3DC2A 2BDPA 4WKYA 2C42A 3EICA 2ERRA 2WB1D 4U9RA 5KOWA 3T5JA 1G3OA 4NZ0A 3EUNA 4DQPA 2KXFA 1LOUA 1Q78A 2U2FA 5CCMA 4JOUA 1HYSB 2DPIA 2G9OA 3T1HF 4K4SA 3UD4P 4KB7A 3CD6S 4W98A 1WEZA 2GQCA 4WFBQ 5IZHA 2KXNB 2LQ8A 2RRNA 3DKDA 1SH2A 2RS2A 3QSIA 5L1IA 2ZHOA 5CZVA 1VYAA 3F56A 3QWUA 4A47A 4YMEA 3K8WA 2V9WA 1HI8A 4XDCA 3NCRA 4ZCMA 2HFNA 3GONA 4J9SA 3BREA 4R0EA 1SV5B 1VBYA 4ZCLA 4USTA 1U49A 4QYZJ 2QL5B 3L4BC 4WYLA 2PFFB 2CQDA 4IOAQ 4LSNA 1Q16B 2BABA 3FCHA 1SKRA 4A8SA 2YNIB 4XTTA 1RXOB 2KG1A 5L9XA 4B3SF 3SDEA 2HHTA 4PAAA 2L3MA 4WTYA 1JLGB 1OPIA 4M8LA 4ZLPA 1PIEA 2HWIA 4AQYF 4F0KA 2VC0A 5D0EA 2DO0A 1EKSA 3OHBA 3HZEA 3MMJA 2NSCA 3FVYA 2IPOB 2ZZNA 2OPPB 5LSRA 3MFIA 2I9SA 4OYAA 4FF2A 1QAXA 4NA2A 3GIJA 4YB6A 2QFJA 4O0IA 4H4OB 2ZH3A 4KKOA 3TZZA 2YKNA 2XM3A 4P75A 2BJ3A 2GJIA 1RTJA 1Z2ZA 1S0MA 3BKUA 2F4VF 3TA0A 3V4IB 2ZNYA 4M63A 1JIHA 3TJ8A 5B0GA 1XC9A 2XGPA 1HD0A 4OX8A 3CC7S 2I6WA 1KLMB 4A46A 1B3TA 4I6WA 1T9WA 2QT7A 2J6UA 2APOA 3ZTSA 3OFHA 3T1AA 4QPXA 2W9BA 2UVUA 2VFUA 3I82A 4PZVA 2VFTA 4F8RA 3Q22A 4LBHA 5IWAF 1BC6A 2BM1A 2OHDA 4ZVFA 2HHPA 3GIIA 2DNZA 3M8PA 4BC7A 4ED6A 4X64J 1YTYA 1HPZA 4C7QA 4DV7J 3I5BA 5U47A 1VLYA 5HLFB 3LW5C 4MIBA 2K7KA 3CT9A 1B99A 1V3ZA 1RP5A 1UWAA 2VD3A 1WACA 1TUGB 3M2UA 4ZVOB 4BWMA 4ANCA 2NZCA 4BLGA 1SJRA 4K4VA 3G2XA 2O3DA 3MM6B 3RAXA 3O2IA 1IKVB 2HRYA 2AJFE 3E01B 3CWJA 1FERA 5DO2A 4J9KA 4WU3A 2R42A 2V94A 2D74B 4EK2A 3F0NA 1J5EF 4X2BA 1F0XA 3J7A1 2P8IA 4ICLA 3GILA 2IHR1 4IH7A 4X66J 1XWLA 2ZH6A 2BOPA 4HDGA 4FKXA 3GYGA 2UUCF 3IWNC 4M5GA 1RT6A 5DJBA 2DRBA 1YWXA 4RW7B 8RUCA 1P1TA 3MAAA 5LM7E 5HL7Q 2BE7D 1KLMA 2KI2A 4B9LA 4X4QA 2KFZA 3JXOA 3FK4A 3E51A 1MU2B 4MFBA 1DARA 2PMWA 2JHEA 1GTHA 2DR8A 2ZOMA 3OTCA 2JWNA 3V81A 4UUXA 2DRDA 3M6WA 2GGPA 2RQKA 4CIOA 2C2EA 1HNWF 4IDKA 3MMBA 1O6XA 3UDVA 3OJUA 3VAGA 1R89A 4RBVA 4DXLA 2VIHA 3TRGA 2ASDA 1TFWA 4GKJJ 4K7QA 1LXNA 3KXDA 4F36A 3UVJA 2XMMA 5E41A 2UXBJ 3E2EA 3HHLA 5I42A 3CJ8A 3DM2B 5C42A 3K5NA 2RRAA 1DQAA 1JKHB 2C2ZB 4IOBA 4Y2AA 3AT1B 1F3VA 4L6V3 3MDFA 5IT4A 3L7PA 3TEGA 3HVTA 2ZWOA 4QIGA 4QYRA 5G0RA 1S79A 2VKRA 1NK5A 4LF7F 1KOOA 2NUUG 2VDHA 4GMKA 1G2EA 2V8HA 3CVKA 3OL7A 5HN0A 3NS7B 5F8JA 4ZVGA 1CJVA 5IQQA 2BKPA 1OMSA 3AA8A 2I0XA 2IM1A 1RHRB 3OVBA 2IRXA 3R5GA 2C3PA 3ELHA 4CM0A 3TX8A 4DV2J 2R8JA 4RWWA 2IAJB 3PDNA 2AJQA 4LJMA 1U6ZA 3QMQA 2QJ3A 4ZVSB 5T7LA 4X84A 1RWWB 2O1PA 3PV8A 2AU0A 1TL5A 1HPZB 1Y9OA 2E1CA 1WNEA 2W9AA 5F0WA 2DGXA 2D3O1 5IM0B 1NK0A 2QA4S 4JV2A 4JI6F 1Y5LB 4ZVPB 1X4DA 1OY9A 3MZIA 4HHJA 1R0BG 2HHHJ 3MR5A 3PO4A 4CTAA 5H9EJ 4USKA 3QJPA 1MROB 4G1PA 3W9HA 5DQGA 3J81Y 2KH9A 1C4AA 3BSAA 4NA3A 4O3NA 3CCZA 2R2TA 3SEOA 5K14A 1KOHA 1R8HA 4JI2J 4RW9A 3ITHA 4L75A 1WOSA 5KFWA 3TEHB 4LFCF 1NB7A 4N8NA 1AROP 3LP2B 1R27B 3MI7X 2HZAA 3R7BB 1RTDA 5KT4A 1VQ9S 3HVWA 4CO2A 4CT8A 4LR9A 2MGZA 3ILOA 3D0GE 3L7OA 3LA0A 4WK3A 1DURA 1S4EA 2LP4A 3MHYA 3NY0A 3PJ9A 4O4RA 4C0HA 5J2NB 1RAAB 3BKFA 3R6LB 4DG1A 1HHTP 1WOPA 1HNWJ 3EGZA 2XY6A 4CNYA 1IM6A 3S8SA 1H98A 2BX6A 2Z0GA 3NAHA 4C97A 3F73A 1N56A 1RYSA 4DCJB 4NMLA 1Q81T 1BLUA 4OZNA 5DGBA 4CLZA 1ZAXA 2ZVSA 3MD1A 2WVBA 2M8DB 2KZZA 4HL9A 1LK5A 3M8WA 3DLLQ 4OMFG 3FKBA 1UFLA 2JH3A 3GCXP 3P3DA 3LP1A 2F5GA 2VBYA 4CI0B 1SCJB 3W2VB 3PW5A 1UVJA 1WJ9A 2J9DE 4DR3F 3IA0A 2BQRA 1VQ8S 2CFXA 5A76A 3QJLA 3MM5A 1RTIB 3VQSA 4H4MA 3HKZD 4CLSA 2UU9J 3QAUA 2FJDB 2C2OB 1CG2A 3R6GB 4F02A 1VQPS 4K2XA 4CH0S 1LW2B 4DWIA 3QIDA 4OZ5A 2W1BA 3MM9B 2B9EA 2XQCA 1RBAA 2PI4A 4RW8A 2K3IA 3V6HA 2W7OA 4DFJA 1QD1A 4HACB 3UDEA 1FRLA 3GG1A 5EX3A 1QSYA 3MPWA 1RT2B 1PBAA 1RI7A 1VIOA 3RGIA 3HHLD 5EWGA 1SQEA 2PEBA 4Q0BB 2V9KA 1UFKA 4J9PA 2ZH1A 1JXLA 3TA2A 1QM9A 3HPOA 3R8YA 2HHUA 3SIPB 5A8RA 3EX7B 1SL1A 4DSJA 1IBCB 1T03A 2HBQB 2OSQA 3OUYA 2VQEF 4P2MA 4DV4F 4HT7A 4CO4A 3G9CA 2J7KA 2WVEA 2XCAA 2ZD1A 4M5LA 1PYOB 5E33A 1UP1A 3HX9A 2UXDJ 1MMNA 2F9JA 1RAEB 1OPZA 1QDUB 1U45A 4UZBA 1M90T 4PUOB 4LFAF 2L41A 2YNHA 3DOMB 2ZOFA 2W25A 3A8IA 3W5ZA 2RQCA 5J1EB 2XB2D 3CJSA 3KK3A 1RJJA 1UZDA 2LLZA 3NGTA 5A6PA 5CAAA 1DHMA 3Q8RB 3O3LA 1LWCB 2AV5A 3PNIA 2A3JA 4KE5A 1LFWA 5A8KA 2I8EA 3MUVP 1BQNA 1WKLA 1Q82T 2NXCA 2VKZG 4MAKA 3TUIC 2HFSA 1U1LA 4J9LA 2CQHA 3OR2A 2N4CA 4GVBA 4C48A 2YKMB 1PKUA 2G1HA 2EK6A 2UV8G 5L39A 1DY3A 1HBOB 3DHWC 4DQRA 3TVZA 1FEHA 3TJAA 3CDEA 3P45B 4KH0B 2Q6CA 1UJ4A 2V2ZA 1EP4A 1MN7A 1RHUB 2QIFA 4AUKA 4NWBA 1C1CB 4Y3CA 2O5DA 2FVRA 4R5PA 5F9NA 4RUAA 1XMQJ 3HSGA 3G6VA 3G6ES 2XG8A 3R5BA 3RRGA 3KLFB 1TAQA 3MTKA 3CCMS 3M2RA 4HH1A 3W2WB 3RB6A 4IDKB 4DR3J 3I4PA 1O51A 3CSKA 4DV3F 1RT7A 3ET6B 3W5YA 3DYAA 4ED2A 3TANA 4N77A 3QRQA 1OYDA 2XTJP 2UXCJ 3A12A 4KH1B 3SQOP 2WHOA 4DUYJ 5IM0A 1S1WA 2ZC4A 4QIVA 3RB3A 3BDPA 4QYZK 2KFYA 4RZRA 4UZCA 3FSIA 2NXUA 2HHXA 1IQTA 3HVTB 3I6PA 4LBIA 2E1MC 4RJVA 1HI0P 5DM7Q 4NX9A 3MAQA 3MM8A 4OHWA 4DV4J 7FDRA 3PRBA 3M30A 4FXDA 3ETMA 3I0SA 1FNXH 4OYWA 3V6DB 4OX7A 1FI4A 5F8HA 1PJ6A 2DKOB 3BGRA 4Y6IA 4OFZA 4F0HA 4JI7F 1WF2A 3EWGA 1FKOB 1NDCA 4EUVA 4MK9A 1NU4A 2EFPA 1WHXA 3MEDA 2DNOA 2DNMA 2AGQA 2XLJA 5KFDA 1D9FA 4OJGA 4F3OA 2ZVIA 3HKWA 1YJUA 5J1PA 4XPEA 2AKWB 3EZ5A 2VOPA 1HQEA 3FRYA 1GFWB 5K20B 3C66A 1PCAA 2KVQE 1WELA 4WK1A 3UCGA 2RIJA 2P6SA 1H2TZ 2OPRB 1Y5IB 2DRAA 5DS7A 1QTMA 3DHXA 4YDDB 1YGYA 1TFYA 1FWKA 2CPFA 5F3ZA 2YNFA 2WONA 1JLCB 2LXFA 3LH2S 2EEYA 4IFVA 3OFEA 2OIHA 1X31C 2ZUAA 3NEKA 1Y0HA 2GV1A 4WXWA 3OTOJ 2Y9HA 3LGNA 1RT1B 3IS9B 1XR7A 2KJWA 4FPIA 3SQGB 1VQMS 2NXEA 1W7WA 2G0CA 3D28A 4JI4F 5LMNF 2RF2A 4IKAA 1X9WA 3QGPA 3EZUA 4HHUA 3DLHA 3VR1A 5IC4B 2MJUA 3IAM9 1FX2A 3MD3A 5B0EA 4EU0A 2BE2A 4J37A 4KRWA 4KC5A 2M8HA 2K8GA 1NDKA 1VK3A 2CPYA 3C19A 3VWSA 4Z7CA 4B3TJ 3C3LA 2YX4A 3GFXA 2X1GA 4FF3A 1KQSR 5LXRA 4YB7A 2KM8C 4ED5A 5RUBA 1C1BA 1RT3A 4RX6A 1HI1A 2L9NA 2PEHA 3BPSP 4E2FB 3CXCR 4DV1F 2FLOA 1EZZB 3B6BA 1RWXB 3DGPA 3NLCA 1D09B 1AZSA 3ZO7A 3EGWB 1HARA 1A6LA 1UMJA 1Z4UA 1IBKF 3QGHA 3NCPA 1VQLS 3VAHA 4LF8J 3AD8C 3N9UC 2JZ5A 5GMDA 4CLTA 4NLDA 3DLGB 4X4NA 3CE8A 4HKQA 3D0IE 4TU9A 2YNFB 4JI7J 2XWYA 3GTYX 1D3WA 3Q86A 5F41A 1GX6A 5KT7A 4YB1P 4DSKA 3MFHA 4EEYA 2QYGA 1PO6A 2H51B 2HFOA 1U02A 2V4QA 3MECB 4NCGB 2CRLA 4U67Q 1CQMA 1SKWA 3P6YC 5AE1A 1N0UA 2C3OA 4DU7A 1QLNA 4KHPF 3RW6A 1VBXA 4ECQA 2PE8A 3VVTA 1JLQB 4ZVUB 5AJ3F 1HQUB 2J8AA 3B82A 7FD1A 5JXSA 5BR8F 1TKDA 5J2QB 3QLHA 4CO1A 1RLCL 1LK7A 4OI2A 4ZN3A 4ID8A 4ZLJA 5L46A 3IN5A 1UJ5A 4PG8A 2AIRB 4KR0B 4MKVA 3SCKE 3JAMY 2XLKA 5J1EA 2DGVA 2CJAA 5DLGA 2ZH4A 4LIWA 3NS6A 2PA3A 5L38A 3ETOA 3KG4A 1SJ3P 2OFHX 3GLJA 4DQIA 4MKYA 3G82B 1QUPA 3QYYA 1WOOA 1N32F 2RQMA 3AHPA 4I2QB 4F4ZA 3T5LA 3PZPA 4ES3A 1TZ0A 2MQPA 2AW0A 2RD5C 3D6HB 3GFYA 3HT0A 4ZP7A 1UVNA 3UFCX 2BJEA 1HA1A 2WB4A 4IH6A 1H38A 2H9ZA 3ENVA 5JVGQ 5IT9U 1RHQB 2J5AA 1ZPVA 2AHOB 2UXBF 5D0RA 5ETSA 4P71A 4TN2A 1S9GB 3DLKA 1WUUA 2DNKA 4ANEA 2OH2A 1VK8A 3HO1A 1KVIA 1WF0A 4DG1B 1I5OB 2IIHA 3K5OA 3GV8B 1UEUA 3UD5A 2CWXA 2VBXA 3QNWB 1F2GA 2CA9A 4BBYA 4O3RA 2F8HA 4ZPAA 2DGWA 2JSXA 3KK2B 2P2CB 1JLQA 3FBCA 1KP6A 1U0HA 2GC8A 4DV0J 4U96A 4ES1A 1VISA 3MEKA 1UVIA 4AYBD 3TARA 4H4MB 3CCSS 2KZMA 3HP6A 4MYUA 2PO4A 2MKHA 5LSLA 1VRUA 5IS2A 3I0SB 2JEGA 1CPZA 3BB5A 1L3KA 2HQIA 3RRKA 1NAQA 1NZ8A 1UEVA 3MM8B 3L3CA 3H25A 2UU9F 3ENAA 5F8IA 4U7CA 2GMLA 1MWZA 1PG5B 4OL8A 4EFAC 3RTVA 4C8OA 4DZ6A 1HWUA 3EJMA 2SXLA 2HHQA 2AJ4A 1FXRA 2E44A 5D4OA 3SFGA 2VQFF 1XMOF 1GNKA 1NSKL 1VRQC 4UY8T 4DBQA 2BRKA 3R7SB 1FTRA 4URQU 2RAQA 3BO3A 4G65A 1RT2A 1HNZJ 1X5SA 4CZCA 2VL1A 5D8HB 3KTQA 2EKYA 4C8MA 1D8ZA 4Q0BA 5G4DA 3KLIB 2FVPA 1H73A 4YY3J 4OI3A 2QV6A 2E66A 4IYQA 2W2OP 1FRJA 3IS9A 1KQGB 1R6YA 2HGLA 4M5NA 3EVOA 2XO7A 4ILRA 2AEMA 5C25B 2DXDA 1OYEA 3PEHA 5M2RA 2WBMA 2Z2YB 1IR2A 1XR5A 4LUBA 4ED8A 1R6VA 3BJYA 2A0FB 4LRAA 3GJSB 5HQMA 4FYWB 2ZE2A 3ZFVA 4ATNA 1N36F 1U2CA 3LO3A 1S57A 3V4MA 1WC1A 1NEEA 1PYSB 2MHNA 3FC9A 5KG1A 3AJ2A 4CYUB 4PG5A 3DGPB 4V19J 3OVAA 4ZPDA 1VJWA 4P73A 4ZPVR 3MR3A 1ACMB 3HSZA 1VQSA 1U24A 3FEZA 1NHUA 3KKFA 4MMOA 4DPUA 3P96A 4U8VA 1XBWA 2MSSA 2ZD1B 1RWPB 3D5MA 3I5CA 2M5YA 1JLAA 2KB2A 3KG1A 3C6TA 5F3TA 4DUYF 4KSEB 1TKTB 1SL0A 2K7JA 3DLEB 4NI2B 3J7ZT 3QPIA 1N5VA 4DOZA 1FK9B 2F9DA 4B3TF 5KFXA 1N52B 3MEEB 2HMIB 1WEXA 3DRYA 4OZ2A 1X4CA 3OXFA 1ZBTA 4HI2A 2HURA 3CJKB 4EYIB 2ZZMA 1MROA 2M88A 2V0NA 2RS8A 3J7Z5 2FZKB 2MHEA 2CAJA 2NYHA 2BMBA 2EXUA 3OFFA 5A8KB 2FJAB 1NKEA 1H2VZ 5KG7A 3NBPA 2BV3A 2J7WA 1NM2A 1RWKB 4ZP6A 3H8YA 4C3KA 4YQWA 3MCMA 2W7PA 2VH7A 2DNNA 3IWLA 4NZ6A 2E9ZA 4ZKAA 1KNZA 2H4YB 3PYDA 3MMAA 1XMOJ 5F8NA 4K5RA 2D3UA 2ZITA 5IT9Y 4QWEA 4OIXA 2B8PA 4U6PA 3M30B 4PR6A 3B54A 3DFEA 3MCNA 1XQIA 2JEFA 3MMBB 5ETPA 4LFAJ 5KT6A 2XYGB 2E1PA 2IY5B 4KPCA 4NLGA 3VF0B 5A2QU 2FVQA 3TUPA 5CXTA 1V9OA 2I5JA 4NLVA 4ICLB 4K4WA 5EUHA 4J91A 2DHAA 3R5JB 3C46A 5G0RB 3DRSA 2XC9A 4ZLLA 5KG2A 4X4TA 3G6XA 4DF4A 1GT8A 3JSYA 2AX0A 4J9VA 2I2YA 1WI6A 2WRMA 4LFCJ 4WIQA 4LMZA 4NLOA 2OD6A 2Q79A 4NMXA 1B0TA 3W9IA 1K44A 1S1WB 2YWGA 3JSBA 2LU1A 1AUDA 3GV5B 3CNQP 1I3OB 3ENQA 4ZN1A 4LF9J 3OVSA 1REGX 3ULHA 3CO9A 3CIZA 4ES2A 4DR7F 2DH7A 2B9WA 2BANB 1R0CB 1NUEA 4AE5A 1NPKA 3OTOF 2QG9B 3PX0A 4JI5J 5LT5A 3I56S 3KWMA 5K8NA 3V6DA 2M0GB 2W01A 4ZIWA 4RU2A 2VICA 2YKOA 2POKA 5KG3A 4KFBA 2QSWA 1E6YB 2VFRA 2RKIB 2B0GA 4ENOA 3BR9A 2CJ9A 1S1TA 3PACA 4USMA 2MLXA 3BM7A 2AYEA 3CPWR 2ZZTA 4GC6A 1VCTA 3TAMA 2EK1A 2C2KB 1WC0A 4LBPA 2JRSA 2Y1RI 4K5SA 3SBMA 1FNMA 4ID5A 1OS5A 2DHXA 3FBEA 4HTIA 4CO0A 3D7SB 2FC8A 4FP9A 1UETA 4ZHRA 2W4DA 2OFGX 3EPGA 5FDLA 3AQPA 1HMVA 1O8BA 4H4KC 3OQ2A 5J2PB 1FVSA 2GO8A 2B3TB 4R8UB 4RNMA 1RAHB 2CPHA 5LL6d 4DV7F 1S97A 1J2VA 3S1TA 3RR8A 3KLVA 2F63A 4UF4A 5LSOA 2E5LJ 1RTDB 1HNVA 4O4GB 1LXJA 2BXJA 2XMWA 5THWA 3DOMA 5A0YB 3K57A 2VG7A 1F1BB 1IWAA 4IG0B 1RZMA 1YJVA 2Z2ZA 3AOBA 2MKKA 4F3MA 4DFKA 4FNIA 3KG0A 3C8YA 3QJJA 2LVWA 3IBCB 5KTQA 2DBBA 2EFVA 1PAUB 1GXUA 3BKTA 2UVRA 4TYBA 2FD2A 2QE5A 3DRXA 2MY8A 4WXOA 4IR9A 3CB4A 3GR0A 3RJMB 1Q79A 4ED4A 3IR5B 4I69A 3RZAA 4I67A 1FVQA 4WIIA 3M8PB 3HHLC 3FMWA 2Z8QA 4IH5A 1S1VB 4KTQA 4TY9A 2IJFA 4RBUA 3T5KA 3TO8A 1C1BB 1RT3B 3Q2SC 2ATCB 3G96A 1PSDA 1TL3A 2VA3A 4C4WA 4X4VA 4XK8C 4K4TA 1N48A 4I64A 2HQFA 4ZPBA 3BR8A 1C4CA 2EFNA 2YNGA 4IQMA 2LA4A 3T5HA 1KFDA 1WI8A 3C16A 1HBNA 4A8OA 4EBDA 2RHQB 3BZQA 2VB6A 2VOOA 1M5SA 2CJXB 1KHVA 2DNQA 2MZTA 5AXKA 1AFJA 4B9MA 2B6AA 2ROPA 3H2LA 3P49B 5DGAA 4K50A 4B3SJ 4ECTA 1X9SA 3N6MA 4LRBA 2VJUA 2ILZA 4FXVA 1KFSA 2IVMA 3M32A 3MAHA 5GAGI 1Y10A 4LF9F 2J8SA 2HNZB 2GMJA 4DX8H 3D67A 2LQBA 3KMQA 4PRFA 3SV3A 4IG0A 3E8OA 6FDRA 3K5PA 1HNVB 4O4GA 2B4UA 2X7IA 4J9QA 3C14B 3UPFA 2PSZA 4FDFA 2OPQA 4LF4J 1LEOA 5EX0A 1L3UA 4LF8F 1S7HA 3BGLA 3I9V9 3CCQS 4KHRA 3RAQA 1Q8IA 1K0TA 1R8PA 2FJVA 4FNHA 3R97A 3VZHA 2AQ4A 2K06A 3SXLA 3OR1A 1VC0A 1FFSB 4NL5A 2A2CA 3GJQB 4LREA 1WDTA 5GAEI 1SPBP 5B0AA 1VQOS 1EKRA 1F9HA 1CULA 1Q1KA 3LUYA 3J7YI 3BQ1A 4DQQA 4YR0A 4HHHA 3M2VA 1LWEB 4M5HA 3ZZRA 2UUBF 2C28A 2R7QA 4LIRA 4ZLNA 3MEGA 3AJ1A 3PRVA 2VDIA 3DLJA 2LXUA 2QSFA 4F25A 2J0QD 2GX8A 2R7UA 2R2RA 2I1RA 4RR5A 2H5JB 3L7UA 2D1CA 5DG9A 3C6UB 2R8HA 5L1JA 2F3JA 1B64A 3PG9A 4GVLA 1IBMJ 2E5LF 4BDPA 4E8UA 4DI6A 1WC6A 2R7OA 3R5AA 4OYBA 4CLYA 2GHWA 2GGPB 5C24A 2GZOA 2M2BA 1OSCA 2DIVA 5IT0A 5T7LB 2HHWA 2RNEA 4QIFA 1O0PA 4I4BA 2F7VA 1X8DA 3ZTQA 1QSSA 5JVHQ 3OTEA 5AT1B 1P9YA 1SIZA 2DGQA 2NPIA 4NXNJ 1URNA 4ZDNA 4R5PB 2LXIA 2W2QP 4IO1A 1JLEA 3U02A 4NLRA 3TJ9A 4DR5F 2FHJD 2HEKA 4NYPA 3D9BA 3TX0A 1NZAA 1HNIA 1UKUA 2LYVA 3WC0A 4F0MA 4DCOB 3VZIA 3QSYB 2HYIB 4RL1A 1V3SA 4ECXA 3BQ2A 1JNZB 2FPHX 1HLWA 3A4TA 1GAOA 1S72S 2ZBCA 1TL1A 2NXNA 3C15A 3HVAA 3OR1B 1D1UA 4AT1B 4YUDA 1M5HA 1N8RT 1QUVA 1VQ7S 2YQ1A 1BWVA 3KLEB 2GQ2A 3CC2S 4B3MF 2G2ZA 4X4OA 1BQMB 3M2UB 3OPKA 4PYAA 1R0AA 1AB8A 1EETB 4WPAA 2IA0A 4Y2CA 3VGVA 5DG7A 5E5NA 5EN1A 2B51A 3DLGA 2IRUA 1RHMB 1H7XA 2MZRA 4X4PA 4RBTA 2W4PA 2X1BA 2FVSA 5GMEA 2MKIA 3ZC4A 5D6GA 1H7WA 4L73A 3TAPA 4EMDA 2B4OA 2LQ9A 3M6VA 1FJGJ 3OW2R 2VZ9A 2WW4A 2VPYB 1RGVA 4TU8A 3PCOB 2F8EX 4YR3A 3DLBA 1FK9A 1ROFA 1X4BA 3IRXB 3W9JA 3DLEA 1TUWA 2EVZA 4A48A 2ZH5A 4CDIA 2HVEA 2YKAA 5BYRA 1U7LA 3MEGB 3DDNA 2XEXA 3O44A 5CYJA 2Q1LA 1FKAF 2DXFA 2HAFA 1KVJA 3VQTA 3X3UA 2A2DA 3HJVA 4C6AA 1RE1B 2P5VA 3PR4A 2FQQB 1IBLF 4WYWA 3MUMP 3ZZUA 5B0DA 3PW0A 2XMVA 4DV3J 3KK2A 1OQ6A 2EWHA 2NLWA 3LTOA 5HANA 4KGMA 5B09A 1VQ5S 1HW9A 2J0SD 4PG6A 3MMCA 3KHRA 4JI0F 4A8XA 5KFHA 2HFUA 2J9CA 4LSLA 2XI2A 3CJ3A 3F41A 3IM9A 3M4XA 5DDQC 3Q8QB 4HT5A 2VG7B 1SUQA 4D3HA 3M9MB 1T95A 3LF0A 3RBZA 1MG7A 2DNPA 3TUJC 2QFIA 4LF6J 5A8RB 2BYCA 3SFUA 2FVCA 1NH8A 4M5MA 1F9FA 2CADA 4RNNA 4K4YA 9RUBA 3RRHA 4K59A 4C0OC 1Y11A 5FLXY 2MTLA 3OXLA 3HK2A 1S6UA 2GHVC 4FYVB 3CCWA 2EBGA 2N4DA 4UUWA 2YKNB 2LKZA 2XBPA 1JXEA 4ZVRB 1TR0A 1YZ6A 2MYFA 2KT2A 2QL7B 1DTQA 2YWHA 1WORA 3NCQA 2K1RB 1C0TA 1IJFB 1OIAA 4WJBA 5DDRC 2YQ0A 4P72A 1VC6A 3NG8A 5KFKA 2Y1JA 1M1GA 5ITHA 4RNHA 3NMRA 4EO6A 3HSJA 4NRTA 4CT9A 1RAJA 1BQNB 4JI1F 2HIQA 3JTPA 3HFKA 1WG5A 3BV8A 3IG1A 3GB0A 5KG4A 1X60A 2ZBPA 1UW9A 4D3GA 2XY7A 3N5BA 2IVYA 3BH7B 1NB2A 2Y3YA 4M95A 1TL7B 2Y8WA 2ZDOA 1YDLA 1UCNA 2IM0A 2PA8D 5D4PA 4I1TA 1CC8A 2C2NA 1YQHA 2IM3A 5KFAA 1MN9A 1P8GA 2CPZA 4MTPA 1K9MT 3DU6A 1ZAVA 2HK3A 3K2YA 4NYOA 4DV1J 2VFVA 1FE0A 3N79A 3D6TB 2VQFJ 2E5HA 3CJRA 1IKXB 3N6NA 5KT3A 2E7XA 3KJFB 4Q5VA 2VG5A 2R9LA 2CQ0A 4QWAA 1NK9A 1NMEB 1FHTA 2AZ1A 3WDOA 3SI8A 5EDWA 3DRPA 3DU5A 4IO9Q 1KLNA 1XN9A 3NGDA 2RSQA 3JQMA 4PQUA 2R7RA 3ILIA 4WFNQ 3FBBA 2KN4A 2XS2A 2YPYA 2RE1A 4WCEQ 1T02A 2OEMA 1R3NA 2KM8B 5E3CA 4DPWA 4WZQA 1DZ5A 1ZM9A 4WBFA 2J9EA 2Z4PA 3TAMB 3PJXA 1CJUB 2ZHBA 2H5EA 3W61A 2FY1A 4J90A 3NWRA 1S9EA 2YWFA
chains in the Genus database with same CATH topology
3SYZA 2IYIA 4B17A 2KKHA 5I42B 1LQ9A 3GMGA 3M8SA 2N82B 1YJWS 4AL5A 2NUHA 1S6PB 1AFIA 2KU7A 4ZHRB 2CJBA 1KS2A 3KYLA 4OJ1A 2UVVA 2RB7A 1S6QA 1QE1B 3H2UB 5IFMA 3GIMA 1GTEA 2VUGA 2PI5A 4BS2A 2KYXA 3KLHB 2V8VA 2W4CA 2W8LA 3LPYA 5HO4A 1UA0A 1S0OA 1JNRB 1G6BA 5DDPC 3GQCA 3BSCA 3CMES 1YSJA 3OBIA 4NA1A 4MKBA 1KQFB 4YP3A 3H5YA 4WFXA 4RW8B 1P9QC 3MGJA 1U6FA 4OJHA 4OZLA 1U26A 1QVGR 2WOMA 4NLXA 3FGVA 3L09A 3JSMB 2CVIA 2C3MA 2X3GA 3TOQA 4ED1A 2FLLA 3TR5A 3HMJG 2R8IA 4EZ9A 3UW1A 2FLNA 5I4MA 1MMDA 3Q8SB 3CULA 3RW7A 2GIQA 3SCIE 5CYMA 2IBKA 3ICLA 1N33F 3GG0A 2QZ8A 2BANA 1SH0A 2YX1A 5LJ5Y 3LP0B 4QW9A 3PFOA 4HYKA 1IBMF 2NZ4A 4PCQA 5IXUA 4KJIA 1U2FA 2HNDB 4JUZA 2GA7A 4AL7A 3I87A 4H54A 1L3VA 3D1OA 1IM4A 2DITA 2M70A 4K4ZA 5LJ3Y 3SSRA 2ZJRQ 2HS3A 2M4MA 3SSQA 5KT2A 2AWZA 3V4IA 4L3NA 1S49A 3CJ2A 5K9FA 5KG5A 3CJ5A 3HHKA 2JVOA 2ROEA 4M1KA 2V8DA 1MW7A 1HNXF 2PMHA 2FJXA 2B9YA 4N8OA 2FTRA 2U1AA 1A7GE 2VPWB 4AXIA 5KFBA 4TLQA 2NQPA 4KGKA 2N7CA 4O3OA 4B9TA 3CF5Q 1S1UA 4KHMA 3MEEA 2HMIA 3B4MA 4O23A 4DFPA 2MDAA 1WG1A 5I3UA 2HGNA 1UVKA 2V5HG 1NJZA 1HNIB 3M6XA 4F50A 1U1RA 4X4SA 2KHCA 4DR6F 4DL4A 3PY8A 4AFFA 2B5JA 3JB9k 3M2RB 3W2WA 3FFIB 3BGFA 4R8UA 1FJ7A 4N41A 1IKWB 1VMBA 2E5IA 1RT4B 3OSNA 1TVRA 1G1XA 2FHMA 4DS5A 3PRDA 3QZ7A 2XGQA 1FDNA 4Q7AA 2C2RA 1VOMA 2XSJB 4IFVB 1UWBA 1WD6A 3ISZA 4KAIA 3RU0A 3PX4A 2C2DA 2WONB 2Y0SD 2OPPA 2K3KA 1JLFB 4QIWD 2MZ1A 2CQ4A 3M05A 5HBMB 1OQ3A 4A8MP 2RDIA 2W7AA 1S76D 2ADBA 3FNNA 2VG6A 2IRYA 4DSLA 2HNZA 3IR7B 1SXLA 1GQEA 5DDOC 3R1HA 2YNHB 2XULA 1OWXA 3UDCA 5L1LA 1GX5A 5HMYA 1VRUB 1HWIA 2DNYA 3ENWA 1S9FA 4IRDA 2KVIA 2QA2A 2UP1A 5CH7B 4JI8F 3PIOQ 3KK1A 1U09A 5D77A 3BQ0A 2R7WA 1KTQA 1ZM2A 2BRLA 2KHDA 2J9DA 4HLBA 5E0OA 1RTJB 2W24A 4WFYA 1S6QB 4X4RA 4C3MA 2RDJA 2MKSA 4QWCA 2XY5A 1IKVA 2VFSA 2HHSA 4PG7A 2RUGA 2HHHF 2AGPA 4IOCQ 3I5AA 2DNGA 3KHGA 3OTBA 5K14B 2E5JA 3H5XA 3N0VA 4ITSA