3FFIB

Hiv-1 rt with pyridone non-nucleoside inhibitor
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
424
structure length
403
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYATNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pyridone Diaryl Ether Non-Nucleoside Inhibitors of HIV-1 Reverse Transcriptase
rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 116
structure length 403
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3ffiB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ffiB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ffiB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ffiB04
5I3UA 1JLGA 4Q44A 4TXSA 4IG0A 1NHUA 5C5JA 1RTDB 3MR5A 1S9EA 4WYLA 1TKZB 3DI6B 4NLQA 3I0SB 4NLVA 3RBDA 3D5MA 3PW5A 3I5AA 4RUCA 4NLYA 1HNVA 1TL3A 4RU9A 3DM2A 4RNHA 5C42B 4K4XA 2D3UA 4RW6A 1N56A 3CDUA 1DTTB 1JLAB 3OHBA 1S6QA 4DG1B 3DLGB 1RT3A 3ISNC 1I6JA 5F9NA 1ZTTA 3KLIB 5DG8A 1N5YA 4NLWA 4H4MB 3V81A 4WZMA 3VQSA 3FFIB 3KLGB 1JLEA 3SI8A 1BQMA 4ICLB 4WE1A 1HQUB 1RT6B 1RTIB 1EP4B 2YKNB 5CYQA 1FKPB 2HAIA 1IKYA 5KFCA 5DGBA 3JSMA 1HARA 4O3PA 3RB4A 3KK1B 4H4OB 4QW8A 1QAJA 2GIRA 2I5JA 2BRKA 2ZD1B 2JLEA 5L1JA 3GIIA 2FJVA 3JYTA 1UWBA 3OLAA 4Q0BB 1LWEB 1S1VB 2OPRB 4IFYA 4WFZA 3MR3A 1HMVA 4LSLB 2JEFA 4O3SA 1JLAA 4IG3A 4O4GA 3LP0A 3GILA 4KBIA 2VG7B 4PWDA 3V6DA 2FVCA 1RT3B 4XPEA 1RAJA 5KFQA 4Y2CA 2R2RA 2V4RA 2RDJA 1FK9A 2BE2B 3KJVA 3BGRB 1S48A 1N4LA 3HHKA 3V81B 4EO6A 5KG7A 1VRTB 3RB6A 3I0SA 1JLEB 4K50A 1LW0B 3NKYA 2E9ZA 1TKTB 3OL8A 4O3RA 5EWGA 5KFEA 3JSMB 3GIJA 2C2RA 2IM2A 3QIPA 3M8PA 4J9SA 2I5JB 3I5BA 3QGGA 4F4ZA 1RT5A 3IS9A 4TYAA 4Y2AA 2HWIA 4NLGA 1JLGB 3KMSA 1RTJA 1JLFB 4OL8A 3NBPB 4MIAA 1DTQA 3CJ3A 3Q8RB 3BREA 5KFXA 5L1KA 5HP1A 2AQ4A 4PQUB 5J2PB 1KLMA 4Q8EA 5DG7A 1C1BA 3PW0A 3NGDA 2AX1A 4TQRA 3PW4A 2ASDA 3FQLA 1XR7A 1S1TA 4DL7A 1HNVB 1TL3B 1JLCB 2ZE2A 3QGIA 1C1CB 4JV0A 5KFWA 3ISND 1UWBB 4MFBA 3GYNA 4WFYA 3G6XA 2UVUA 1S9EB 5J2QB 1K1QA 4J9KA 3T19A 2VG6B 3V6DB 1ZETA 4TN2A 4M94A 1VRUA 5KT2A 1DLOA 1IKYB 4J9OA 1FKOB 4YQWA 3DMJA 1T03B 1T05B 5F9LA 1JX4A 4IQXA 4ECUA 2R2TA 1JLCA 5EUHA 5JXSA 3UQSA 4QW9A 3NMAA 4LSLA 1GX5A 1S49A 4YMEA 3BJYA 4PWDB 1YVFA 1TVRB 1BQMB 1K1SA 3PJXA 1HQUA 1RTIA 4IH6A 2IBKA 4I2PB 1RT4B 2I1RA 1JXLA 3OSPA 1IKWA 2UUTA 2JEIA 3HVAA 2J6TA 4FBUA 3LP2B 4ZP7A 3PR5B 1HPZA 2OPPA 3PR4A 2ZE2B 4IRDA 1HQEB 4JV1A 4ZP6A 3H59A 2ASJA 3PW7A 2B6AA 4MFBB 3OL9A 4O3QA 2B43A 1SH3A 2RKIA 2WCXA 4NLSA 2AGQA 3H40A 5KG1A 4I7FB 2BQRA 1TV6B 2BE2A 4RNMA 3DLEA 4FBTA 1MMLA 5KT6A 4ED3A 4X2BA 3IRXB 1T94A 3Q8PB 1C1BB 1S4FA 1RTDA 3C6TB 4KHMA 5F8MA 4NRTA 4ID5B 2FJWA 3QIPB 4G1QA 3UPFA 1XR5A 2CKWA 4KV8A 2D41A 2IJFA 4TY8A 4K4TA 3ITHA 2OPPB 3GIKA 4DL6A 1S1WB 1SUQA 3BR9A 4RW7B 4NLOA 5CYMA 3QO9B 1S0NA 1D1UA 3C6UA 3MEGA 4PUOA 2AWZA 2OPSA 5DQGA 2OPQB 5KFJA 3V6JA 2VA3A 4NZ0A 1LWCB 4NLTA 1C0TA 4WYWA 4Y34A 3DOLA 2WOMA 4DL3A 1DLOB 1QAIA 3I5CA 4WXWA 3OLBA 3M9MB 4ECZA 3IG1A 4RW8A 1KHVA 5KFSA 4IR9A 2UVRA 1T03A 2FVQA 4O44A 5J1EB 3DRPA 1EP4A 4ZVEA 5KFRA 1FKPA 3MR6A 4QWEA 3KK1A 2V4QA 5KFYA 5D3GB 3CJ2A 2WK4A 4KV8B 2ASLA 5KFUA 3DLKA 2WB4A 1S9GA 3SFUA 2VG5B 4R5PB 2F8EX 4QWBA 4JUZA 4RNFA 5KFKA 2XI2A 3C6UB 3MEGB 5K14A 3TAMB 4XPCA 1N48A 3PJWA 1KHWA 4ZP8A 2QV6A 5HROA 3NAHA 3C6TA 4IFVB 2WONB 4NLPA 3MFHA 2C28A 1RT7B 4G1QB 2CJQA 1JKHA 5F8GA 2UVWA 4NRUA 4EBEA 4LQ3A 4Q45A 1CSJA 4RNNA 4J9QA 4TY8B 4M95A 4MKAA 1TKTA 5L1IA 3SFGA 1TP7A 3H4BA 4IG0B 3H98A 2RF2B 2AGPA 3OL7A 5C24A 3DLEB 2QE5A 1LW2B 3BSCA 4ZVGA 3QZ7A 2R2UA 5I3UB 5KFPA 1S10A 3KK2A 5KG6A 4H54A 5JUMA 3HVTB 5KFOA 5KFHA 3GV7B 4ECQA 3DOLB 4JV2A 3FRZA 5I42A 1JLQB 2RDIA 2FJXA 2WONA 1S1XA 2YNIB 5D3GA 2W8KA 1R0AA 1N6QA 4DL2A 1S9FA 1TKXB 3V6KA 1S9GB 1C2PA 2HNYB 1RT2B 1LWCA 5KG4A 3FQKA 1EETB 1JLBA 4IDKB 4MIBA 2XCPA 2GIQA 2WOMB 3TVKA 1LWFB 3PZPA 3KNAA 4QWDA 3T5LA 1T3NA 3KK2B 4FS1A 4ICLA 1QUVA 3QGHA 2YKMA 2W9CB 2UUWA 4ECYA 4DEZA 4ED6A 4J9MA 4IR1A 1S1WA 1SUQB 2W9BA 4RW7A 3M9OB 3EPGA 4RUAA 2BQ3A 5I42B 1Z4UA 2BQUA 3I0RB 2OPQA 3KLEA 3IS9B 3IGVA 3KLHA 3LAMA 1JLFA 2B5JB 4FS2A 1REVA 3T5HA 5C25B 1LW2A 4ZVHA 2ATLA 2IM1A 4RW9A 5J2PA 1IM4A 1KLMB 4RNOA 4ED7A 1BQNB 4EYIB 1JIHA 1QE1A 3DOKB 2R8IA 4ZMMA 5T14A 1S6PA 3NAIA 2DPJA 5DQIA 4KB7A 3DLKB 1OS5A 2C2DA 5J2MB 5KFLA 3UR0A 4NLXA 2C22A 2C2EA 4EO8A 3E01B 2WHOA 1D0EA 4I2QA 1SH2A 3CJ5A 3CDWA 5C24B 4ECSA 5DGAA 4KFBB 3CIZA 1NNDA 3ICLA 4YR0A 4EEYA 1GX6A 3V6HA 4KKOB 1RA7A 2JEJA 1JLBB 4IDKA 3GQCA 3LANA 2HNZB 5KFDA 3MFIA 5DQHA 4K4ZA 1FKOA 2HNDB 5KFVA 4IKAA 4R8UB 1HNIA 3LP1B 5KT7A 4ZP9A 2W9CA 2YNGA 4NLRA 3DRSB 5DLFA 4ZPBA 4URQU 3PW2A 2BANB 1SV5B 5J2QA 1TKXA 1J5OA 3CJ4A 2R8GA 3M8QB 4LQ9A 3FDSA 2ILYA 3QLHB 3E01A 5KFBA 4B3OB 3QO9A 4YR2A 4O3OA 2OPSB 1RTHB 3MEEA 2R8JA 5L1LA 2W9AA 1T05A 3BSAA 2FLNA 1JLQA 2IC3A 3MECA 3KK3B 2HMIB 4NLUA 2HNZA 4Y3CA 4URGA 3KLVA 3GV5B 4EBDA 1S1UA 3G86A 4J9NA 3MTKA 2IJNA 1IKXA 1DTTA 4ZHRA 4QPXA 3OHAA 2V9WA 1RDRA 3DRSA 2FVSA 4DG1A 3LALA 1RA6A 3KLHB 4F4YA 4I2QB 4KAIA 1IKVA 4F4WA 5C25A 4H4MA 4NCGA 4ZPAA 3PHEA 5KFTA 4G3IA 4QWAA 4J9RA 2BRLA 1BQNA 1TVRA 2JC0A 5F8HA 4KO0B 5KFFA 1QE1B 1RT4A 3DOKA 1TKZA 4IH7A 2W9BB 2E9RX 4YR3A 3OSNA 4IFVA 3I0RA 3KLEB 5J2MA 1HPZB 3CWJA 1S1UB 3DM2B 4Q0BA 1JKHB 1TV6A 4R0EA 2B6AB 4ECXA 5L9XA 5FDLB 3M8QA 5HBMA 2RKIB 4IRCA 4GC6A 4F50A 4HKQA 2AU0A 3KJVB 1C0UA 2OH2A 3BGRA 3MEDB 4ZVFA 2O5DA 5KG2A 4RW8B 3N6NA 2V0NA 5DLGA 4J9PA 1LW0A 2AGOA 2IC3B 3DRPB 3MECB 3KK3A 3KLFA 2HMIA 3KHLA 3BQ2A 3Q8QB 1WNEA 4ID5A 2FLLA 4QWCA 1W25A 1RYRA 3V4IB 4TLRA 2R2SA 3RAQA 2BANA 3TQ1A 4ZPDA 3HVWA 1S1XB 5KT3A 1S97A 3QLHA 2XGPA 1R0AB 3HKWA 2VA2A 4PUOB 5FDLA 4IG3B 4O4GB 4PQUA 3NL0A 3DI6A 4K4YA 4K4UA 4WXOA 4KO0A 4RW4B 2JC1A 2YNGB 2IAJB 2W7PA 2ALZA 5HP1B 3DYAA 2XI3A 1RT7A 5C42A 4K4VA 4ECVA 4O3NA 3IN5A 4Q8FA 4EYHB 1S1TB 3EZUA 2FLPA 4K4WA 3H5UA 3M8PB 5KFNA 2RF2A 2WTFA 3EPIA 1RT1B 5KG3A 1C1CA 5F8NA 3MEEB 4MH8A 4R5PA 1RTJB 4IOBA 3NBPA 2B5JA 2IA6A 1REVB 3PVXA 5K14B 3TAMA 4O4RA 4RW9B 3BSNA 3KHRA 4IH5A 5HROB 1XR6A 4ECWA 2UVVA 4DL4A 1IKXB 4ZHRB 3DDKA 3JYTB 4WFXA 5KT4A 4KSEB 3GIMA 3V4IA 3MF5A 1LWEA 1S1VA 2OPRA 4IFYB 1MU2B 3RB0A 1TL1A 2YNHA 2W8LA 4NCGB 2R8HA 3QYYA 3LP0B 3BQ0A 2VG7A 2YNFB 5HLFB 4URSA 3H5YA 4ED1A 2IMWP 3KHGA 1EETA 3QZ8A 4LSNA 3T1AA 2XGQA 1C0UB 4I2PA 1LWFA 2VG6A 1VRTA 2DPIA 2HWHA 2IM0A 5F8LA 2D7SA 5KG5A 3HVTA 1ZTWA 5KFZA 4YP3A 5F8JA 1VRUB 4XO0A 2YKMB 3N6LA 2IM3A 4J9LA 3KLFB 3D28A 2YNIA 5DG9A 2W7OA 2HNDA 2J6UA 1N6QB 1SH0A 3Q8SB 1HYSB 3RAXA 5HBMB 3KMQA 3BSOA 2GC8A 4ED0A 1RT2A 3G6VA 3FSIA 1MU2A 1DTQB 2ILZA 1TQLA 3MR2A 3KHHA 3RBEA 2D3ZA 4TY9A 2HNYA 5KFMA 3DRRA 4TQSA 3KLIA 5F8IA 3CO9A 4NLDA 3OL6A 4DL5A 3RB3A 4LSNB 2AX0A 4ECRA 2EC0A 4ECTA 4HYKA 3FFIA 3KLGA 1IKWB 3IRXA 1S6PB 4Q43A 4WE1B 5KFIA 3LP2A 1NHVA 2R8KA 5KG0A 4IRKA 5J2NB 4KHRA 1U09A 5KT5A 5EWEA 1HQEA 4ED8A 3UDLA 1RT1A 5EDWA 1HYSA 4KE5A 1S6QB 3H2LA 2E9TA 4MK8A 2XC9A 1IKVB 4I7FA 4RW4A 1HMVB 5KFAA 2IAJA 2XCAA 3T5KA 4NYZA 3CJ0A 4WZQA 1RYSA 3DYAB 3DRRB 3DMJB 4RZRA 4ZPCA 1FK9B 3E51A 3CDEA 2JEGA 3CVKA 3LAKA 3QIDA 3IGNA 2ZD1A 4O44B 5J1EA 1TL1B 2FVRA 3BQ1A 4GC7A 5KFGA 3ITHB 2YNFA 5HLFA 5CYMB 3H5XA 4B3OA 3KOAA 4U6PA 3G6YA 1N5YB 3H4DA 4KFBA 2XWYA 4TYBA 1S0MA 1RTHA 2VG5A 4MK7A 4MK9A 4KKOA 4U7CA 4R8UA 4F4XA 1C0TB 2ZKUA 1RT6A 3M9NB 2YKNA 5CYQB 2FVPA 5EWFA 3MEDA 3GV8B 3IG1B 4H4OA 2WRMA 1HNIB 3LP1A 4RW6B 1SV5A 1J5OB 3T5JA 2BR0A 2YNHB 2J6SA 5J2NA 3N6MA 3DLGA 4MKBA 3H5SA 4ED2A 4K4SA 1S0OA 4EBCA 1RT5B
chains in the Genus database with same CATH superfamily
1IBCB 2XS7A 4F25A 4B9NA 4OZ3A 2DNMA 3RG6A 4Q44A 1JLGA 4TXSA 5C5JA 3IBCB 1RTDB 2V8GA 1S9EA 3I32A 1CG2A 5A8KB 5L46A 3CUNA 3K17A 4NZ6A 4CNYA 3C2PA 3HHLC 3H2UB 3M30A 3TVZA 3DI6B 3I0SB 3RBDA 2RMLA 3EZ5A 3K59A 1I51B 2AJ4A 3PW5A 3I5AA 2CQ2A 4NLYA 1LNQA 4QBUA 1TL3A 4ZCLA 1IBLJ 3CC7S 1ZM3A 4RW6A 1N56A 3CDUA 1DTTB 3GU0A 4O0IA 1UJ6A 3ISNC 1N88A 4B3RF 2HVHA 2FZKB 1ZTTA 1AROP 2DB1A 4LRCA 1FD8A 5DG8A 3U7JA 1VBYA 1RU2A 3BBFA 3RR8A 3K8VA 2ACYA 4RX6A 4JI0F 1VISA 1N32J 4WZMA 3W2VB 3SI8A 1Q78A 2KH9A 1KFSA 5C7PA 2VQEJ 2QTWA 3BQ1A 2UXDJ 4MKYA 4DWIA 3T1HF 1FKPB 2G2YA 4PPDA 4ZDNA 1WEYA 3M2UB 2HLUA 1SC4B 3KK1B 1FFWB 2Y8YA 1QAJA 3EGWB 2JLEA 1VQ5S 4EI2A 2R7RA 3Q2SC 3B6BA 4ATNA 1FX2A 4Q0BB 1M0SA 1NDCA 2NXJA 1LWEB 1S1VB 1R7IA 3MR3A 2XB2D 3P6YC 1HMVA 1DY3A 1PSDA 4EZ6A 1NEEA 5IFMA 3EWGA 4HEA9 4KBIA 2VG7B 4PWDA 3V6DA 2VL1A 4XPEA 3HFVA 3W9HA 5KFQA 1CQNA 1TELA 1FK9A 2MKYA 3GCXP 1QVGR 3BGRB 3HHKA 1VK8A 5CCMA 2RSQA 3CCUS 5KG7A 1SB6A 2WW4A 2ZHOA 2LXIA 2PI5A 3I0SA 2BEFA 2DH8A 2YWGA 1BUXA 1LW0B 2CJXB 4C97A 3BO4A 4K50A 3DFEA 4U7UK 2ZH5A 2GVDA 3DRYA 1MROB 4PXBA 2MZSA 3MAAA 3JAMY 5E41A 5EWGA 4RBUA 3OL8A 2OMLA 2IM2A 4LRAA 2MKKA 1EAYC 3NGTA 2HS4A 4OLOA 5AE3A 1HBNA 2ROGA 3MPYA 4DL0C 4DZ6A 3I31A 2KJWA 3UFCX 4F4ZA 1WEZA 2IRUA 3PACA 1FTRA 1M1GA 2G1HA 4TYAA 5HAOA 4ED4A 3HJVA 1WHWA 3P96A 3IMQJ 2OMOA 3NBPB 4F4XA 3CJ3A 5D4OA 3RRKA 2LDIA 1HW9A 3R2DJ 3GG1A 4Q8EA 1TU0B 1C1BA 2R4FA 4DFKA 3PW0A 3C66A 2ASDA 3Q23A 3C16B 1H98A 4JI1F 1XR7A 4C8YA 1S1TA 4DL7A 1HNVB 2UUCJ 3HM9A 2YY3A 5IV4A 1WOOA 4CYUA 2H9ZA 4OYIA 2YPZA 3GYNA 1UWBB 1Y3KA 5KFWA 3JXOA 2DR6A 3EGNA 3EDQB 2CPXA 1Q7LB 1EIYB 4JV5J 2DGWA 3WZ0A 5KTQA 1K1QA 1LEOA 1FWKA 2DR9A 1HWIA 3V6DB 4WIQA 5LMUJ 1VQSA 3W8GA 4M94A 4MKVA 4ILRA 4DUZJ 1NKEA 1NBEB 3ZFVA 2GNKA 1FKOB 3BBBA 4I6AA 3DMJA 3BYRA 3MEKA 4F7VA 5HMXA 1T05B 4K59A 4U8VA 2OD6A 5E3RA 2D1CA 3NNAA 3SSQA 1AB8A 4JI5F 4NYPA 4AUKA 3B82A 4Z7YA 4QW9A 4WFNQ 1GAOA 4UTGA 2HHVA 1UP1A 4ILLA 2AT1B 3T9ZA 2A3JA 4E8UA 4O3RA 2VPZB 3PJXA 4ZKAA 1HQUA 1RTIA 1RBOB 2MZRA 2DIVA 2XYGB 4IH6A 4LF7F 4D3GA 2DHXA 3DDIA 3IAS9 2NXCA 5K8MA 1IKWA 2HHXA 3HVAA 1ZYQA 2IRYA 4FBUA 1XNRJ 4QIFA 3PR5B 4DR4F 2RQKA 1HPZA 3SQGA 1Z1ZA 4UT4A 1YI2S 4IRDA 1KVIA 1G4CA 4ZP6A 3H59A 3NEKA 3C14A 1QDUB 1SL1A 1U0SA 5KG1A 3DLEA 2FIUA 2YKPA 3P45B 3DU5A 5KT6A 2GMHA 2HFSA 4X2BA 1KOOA 1YZ6A 2P5VA 5FIIA 1SJ1A 3Q8PB 1S4FA 1RTDA 2K3KA 4NI2B 4ZLPA 5JVHQ 2V8VA 4KHMA 5F8MA 3ETOA 4NRTA 2PFFB 3BYPA 2V5HG 2HRUA 2GVZB 4UZCA 1LFWA 3J7Z5 4QYZK 3HSDA 5ETVA 3ITHA 4JB8B 2AV5A 2OPPB 3AODA 5ETMA 2MMYA 3BR9A 3MPUB 3PFOA 4QR1A 3M8SA 2DNQA 1U24A 3QQCD 2F65A 4PUOA 1SQGA 2AWZA 2P2CB 3UO0A 5DQGA 3V6JA 1KQSR 1LWCB 1C0TA 4QPTA 3EYZA 1H7WA 1U1KA 3QJJA 4WXWA 3M9MB 9RUBA 4G1IA 4DV7F 1VHFA 2N4CA 4I0WA 3DRPA 1EP4A 1VYAA 5KFRA 4EZ9A 2CZ9A 4ITSA 4JI3F 5E5NA 4M8LA 4I68A 1JJ2R 4CZCA 2O01C 2KT5A 2ASLA 1UZHA 3DLKA 1VBKA 4CO4A 1S9GA 1W2BR 1PO6A 2VOPA 2VG5B 5DRKA 3GIJA 2F8EX 2J0QD 1FE4A 4DUYJ 1K0VA 3F73A 2RS8A 1N48A 1AUDA 1NK8A 1KHWA 2LP4A 4EGLA 1NZ8A 1RADB 4USKA 2W2PP 4NI2A 4KR0B 1UJ5A 4MJKA 9ATCB 2FJBB 1S59A 1WC6A 1NMEB 4RUBA 1RT7B 4RPFA 1JKHA 3EM1A 5F8GA 4NRUA 4EBEA 4OJ1A 4TY8B 2VPXB 2UUBF 1F5AA 4BDPA 4NXMF 3SFGA 1CS4B 5T7LB 3G82B 4USTA 4DHVA 4IG0B 4WKYA 2AGPA 4B3RJ 4JYAF 1O6XA 4USJC 3DLEB 3BSCA 2R2UA 5I3UB 4L75A 1RCOB 5KFPA 1S10A 3RR7A 1R27B 2OEKA 3HVTB 2PFDA 2XMMA 5JUMA 1SCJB 3L4BC 3DOLB 2F4FA 1NRKA 1QM9A 4JV2A 4Y0FA 1OIAA 3QGPA 4OZJA 3MURP 2KDOA 3UVJA 1FJ7A 1NDKA 5AE1A 4ZVUB 1EKRA 2YNIB 1X4BA 2V34A 2W8KA 2RS2A 3MMBB 4OI4A 3RGIA 1S9FA 1TKXB 1CJVA 2I38A 1U0HA 1WC5A 4G65A 4JI6F 3V6KA 2QSWA 3D3CJ 3HK2A 4PYAA 2B8PA 2XNRA 3DKDA 3TW0A 4JI5J 4CLTA 4QWDA 3D6MB 4ZJLA 1T3NA 3FSYA 2V2ZA 1QUVA 2FJDB 2W9CB 1Q16B 2UUWA 4ECYA 4DEZA 4F0HA 1B99A 3HLUA 4IR1A 1S1WA 1SUQB 3H8YA 3T9NA 1Q53A 3HCXA 1DHMA 5HMZA 3TZYA 4FDFA 2HHSA 1UETA 5HSPA 3AA8A 3I0RB 2Q79A 1VCTA 3KLEA 3IS9B 4DV0J 2DBBA 3KLHA 2CNLB 3OR1B 3SCKE 1H38A 4LBHA 2KFYA 1Y3JA 3MD3A 1Q7YT 5AT1B 3V2UC 1YSJA 5AJ3F 4A8WA 3GJQB 2Y1JA 2DVIA 1NO8A 1UTAA 1YTYA 2YWEA 1SPBP 4X66J 4Y6IA 3I4HX 1VQ4S 3ILIA 1ZAVA 2GHWA 2R8IA 2G13A 4DR2J 1S6PA 4J37A 1H0HB 2ZH8A 3GYXB 3GONA 3H7HB 1BHNA 5J2MB 1HKAA 2XMUA 3N5FA 4NLXA 1U26A 3B8HA 4DJBA 4EO8A 3E01B 2V4JB 4WP9A 1D0EA 1SH2A 2J7KA 3CJ5A 1HBNB 4OHWA 1EHWA 4U96A 2DR8A 2ZC4A 3IRWP 3QT7A 1L5UA 3A3PB 2E1AA 1NNDA 3CIZA 4ZJQA 4OHZA 2HZVA 1N5SA 2FZGB 3PYEA 1KFDA 4DX7A 5AJ3J 1HR0J 4JI3J 1PBAA 2KTQA 1LXJA 1NH8A 2YKAA 2EFVA 3A1YG 1HBOA 1TTHB 2GAHC 4K4ZA 4N8OA 4Z37A 4DDFA 3UN2A 1QSSA 3LP1B 2GJIA 2PA8D 3DGVA 5A6WA 3OJUA 1NU4A 1HNWF 4NLRA 5HATA 2CNNB 2MSTA 2HWTA 2DHAA 3PO5A 2BANB 4LF2A 1F5CA 4LVOP 4NYOA 3Q83A 1U0HB 4CLPA 2DY1A 2R8GA 2XY5A 2BKNA 5DZ6A 5LXRA 3QLHB 1WC0A 3D3BJ 4QQBA 2ADCA 2RUGA 3AHPA 2RJZA 3CJKA 1IM6A 5L1LA 1FDNA 3TUZC 4L3NA 1UEUA 1WG4A 3M2VB 3UVJB 2IC3A 3MECA 3KK3B 2HMIB 4HH0A 4Y3CA 3G71S 5EGYA 4EBDA 1E6YB 1U1PA 3OBIA 3G86A 1T9WA 2JZ5A 4M5IA 4IO9Q 1CULA 1DTTA 4B3MF 2Z8QA 1WTBA 2FZCB 2FVSA 1R8PA 3VAKA 2HBYB 4DPYA 3LALA 1RA6A 3JQKA 1T0TV 4KPYA 4F4WA 2IVMA 3DDNA 1T9TA 2G0IA 3CCTA 5KFTA 3G87A 1BQNA 2JC0A 4HL9A 5KFFA 2HFVA 1NK6A 2M7SA 1RT4A 2BOPA 3SQGB 1CC8A 2H51B 2RDDA 4KPCA 1KVKA 2W9BB 5KOXA 3MUVP 3SCLE 5DDPC 1B7YB 2NUHA 1DURA 2NREA 1TL4A 5FLXU 5J2MA 4MYUA 1X9SA 4ZPWR 4LF9J 1JKHB 2DY9A 1TV6A 2B6AB 2W7AA 3IM8A 1GQEA 8RUCA 3M8QA 2IYIA 2CPYA 2RKIB 2C1EB 1IN0A 2AJQA 2MQMA 3NCPA 2GA7A 1S4EA 1O5JA 3BGRA 5BXIA 3PX0A 2CPDA 5M2PA 4DR7F 2V0NA 1B0VA 4KIAA 4LT6A 3VV2B 1KQFB 5A8WB 1BE4A 5IM0B 2AGOA 3DHWC 4ZS6A 1H7XA 3R9LA 2B7BB 4LF4J 2WSEC 1MWYA 2R2SA 1VLOA 2J8AA 4TLRA 1G7CB 2ZJQQ 4DV2J 1L3SA 4B9SA 3K5PA 1S1XB 3D6HB 1EZZB 2QYGA 1S97A 1TK8A 3GFZA 2CQCA 3CD7A 3MMBA 3W61A 2J7WA 6FD1A 3MI7X 3POTA 5IOLA 4A46A 4K4UA 4WXOA 5LMNJ 2AIRB 4LRBA 4KO0A 2JC1A 2W7PA 2YNGB 1PJ7A 4PQAA 2DK2A 2DYAA 1FE0A 2DISA 2MKSA 5C42A 2ADBA 1UFKA 1QLNA 3F0NA 2M70A 3KDNA 4N76A 2ZJRQ 3MAAB 2BV3A 1L3VA 1Q4RA 1R8HA 2JL9A 3SQOP 4K4WA 2BW7A 5KFNA 1NDLA 4DBQA 4ELTA 3TUPA 4JYAJ 1PGZA 2BMBA 3F44A 4OI0A 2WVEA 4ZPVR 5F8NA 4MH8A 5DDQC 5IT4A 1AW0A 5LMNF 3AOCA 4RO0A 2V94A 1R31A 5K14B 3EX7B 4I69A 2HVEA 4O4RA 4ILMA 4RW9B 4WFAQ 1ZAWA 1M5HA 2UVVA 2D3O1 3FBBA 1CULB 4PG5A 5K20B 4OLPA 4DL4A 1M5OC 2LFVA 2QGFB 2CPZA 3HDSA 3OUYB 3VAGA 3GIMA 1JWWA 3V4IA 2F9DA 2OPRA 4C0BA 2FC8A 3TVYA 3VR1A 1R3NA 3GIRA 3HP6A 2W8LA 4GKJF 2Z2MA 4MAKA 4FF4A 2EKYA 4CNZA 1TZ0A 2CNKB 4OYBA 1DJ0A 1KLNA 3T1AA 4WTOB 3O6QA 3OV7A 4DPTA 3EXCX 4OFZA 2IM0A 2D7SA 2VC1A 3HVTA 4YP3A 1FWLA 4U7UD 1VRUB 2AF6A 3G2XA 3MPVA 3KLFB 4W98A 2GZOA 2K06A 2KU7A 2XTJP 5DG9A 2W7OA 2LQ8A 4JI0J 2FC9A 2HHTA 3ET6A 5HBMB 2E5IA 3BGUA 1VMBA 3THVA 3AB2B 3VTIA 1RT2A 2KZMA 3G6VA 2FHJA 3Q8UA 3FSIA 2ILZA 1DTQB 2Y0SD 3T1HJ 3W66A 1Z2ZA 1YJWS 1WG5A 4TY9A 3GV7B 2HNYA 5KFMA 2L9NA 1D9DA 1DQ9A 2VBYA 2QFIA 1LV5A 4ECRA 1YJRA 2IMOA 4AFFA 2CJKA 2UXCJ 2U1AA 4DR2F 1S6PB 2LEBA 4WE1B 3B78A 1ZS6A 3LP2A 3MMCA 1RUSA 4DSKA 2R9LA 2BJ8A 1U09A 4ZN1A 5KT5A 1HQEA 1VGYA 3PHTA 4GO7X 2Z4PA 4OMFG 2DGSA 1GNKA 3UDLA 3TZZA 3ZNJ1 3MM5A 3IR5B 3EVOA 3H2LA 2XMAA 1S6OA 4I64A 2XC9A 1NJYA 4I7FA 4RWWA 1L3UA 2XCAA 5KFAA 3OTDA 4PCQA 2X1GA 3DRXA 4PWWA 3L9ZA 2LQJA 3MCSA 4WWSA 4A48A 2A2CA 1WI6A 2UXCF 1KKHA 1QTMA 2R7XA 5IT9U 3E51A 5A8RA 1RHUB 2JEGA 2C3YA 4PWUA 3LAKA 2W25A 3TARA 2ZD1A 4V1Ak 4IO1A 1TL1B 4QIWD 5KFGA 3ITHB 2CG8A 4U9RA 1X9MA 2MJUA 4OYMA 3G6YA 1N5YB 1ZPVA 2DIUA 1YJUA 4KFBA 1ZM2A 1S0MA 1RTHA 3TANA 3MUMP 3P8BB 1V9OA 4FXVA 3M2VA 1B4SA 2B7CB 2UZAA 4DL6A 3PDNA 4ES3A 4CI0B 5DM7Q 2DH9A 2Y1RI 3H42A 1P6TA 3LP1A 2WB1D 1J5OB 2UUBJ 3ZZUA 2RQ4A 3MMJA 1YIJS 3NNHA 5J2NA 2VB6A 3DLGA 4DS4A 4MKBA 1KDNA 4ED2A 1H3DA 1P8GA 1FNOA 1RAGB 2OGUA 1PAEX 3OXGA 1RT5B 1GMUA 3BPDA 3HSGA 3MAQA 4E0DA 4M5KA 5I3UA 1QY7A 4OYWA 4YN3B 1ZH5A 4IG0A 3MR5A 2NPFA 1QJHA 2XMVA 4WYLA 2UUAF 4J9VA 5A2QY 4JI2F 3MUTP 3PNIA 1PKUA 4NLVA 5T41A 4GKJJ 5GAGI 3HHLB 2CVEA 2Q43A 2BJ1A 1CLFA 2ERRA 3DM2A 1FERA 1FRLA 3NGSA 4RNHA 4K4XA 4CYUB 1HNXF 1R0BG 2QMWA 4DQSA 1JLAB 1U2CA 4O23A 4DG1B 3DLGB 1RT3A 1F60B 3IWLA 4PEOA 4AE5A 3I87A 2DCUB 4OI6A 3F56A 4HHUA 2OJ3A 3FFIB 1JLEA 8AT1B 1BQMA 4ICLB 4WE1A 4Y2CA 2PGCA 2YKNB 2QL9B 2ZKTA 3M2RA 5KFCA 5DGBA 2VOOA 1IVZA 1DQAA 1FJGJ 2HURA 2GIRA 3OTEA 2D9PA 4J90A 2E66A 2DXFA 3LGNA 2ZD1B 4CLSA 5GAEU 5L1JA 3GIIA 1HNXJ 3G96A 2NZCA 2FJVA 3K8WA 3JYTA 4KGZB 1UWBA 1WORA 4KGXB 4QIVA 3OLAA 2R7OA 4X4NA 2KZZA 1VK3A 3WHIA 4LSLB 1HW8A 3DGPB 4O3SA 4W4MA 2D69A 2FVCA 2P9GA 3MTJA 4M5LA 2IYGA 2R2RA 4FN5A 2V4RA 2DRBA 3LPYA 2BE2B 4QIEA 3HMJG 4L76A 2ZJPQ 1S48A 2LA4A 4OI3A 3MPDA 4UOFA 3J81U 3KG1A 1HD0A 1VRTB 2HIQA 3RB6A 4B3SJ 4I4BA 2QJ3A 1F3FA 1FRXA 1WHYA 2MLXA 3MOZA 4OZ2A 4DX8H 4PR6A 5A8WA 3A3NB 2V8HA 1TKTB 4P72A 2AYBA 1KRPA 2DGUA 4C8OA 5KFEA 5BYQA 2KN4A 3CIMA 2MKIA 3M8PA 2VKRA 2X3DA 4K5SA 1FVSA 5CCLA 3I5BA 3GZ7A 4DPUA 4LF8J 4Y2AA 5DZ7A 4OYAA 1FFGB 1N36F 1JLFB 3Q8RB 3FEYB 4UQGA 5KFXA 3L09A 3GJSB 1Q5VA 1ZAXA 1WJ9A 2AQ4A 1LQ9A 3AXKA 3DLHA 1F2GA 4NZ7A 3U1MA 2FGCA 2YX7A 3NGDA 3K7RA 4KHPF 1M1KT 5IWAJ 1IBMF 3CTRA 1HBUB 2N7YA 1FRKA 4P2FA 2ZE2A 2P8IA 1OYDA 1WSRA 2MQPA 1YWXA 3QGIA 4WF9Q 1C1CB 1UVIA 4JV0A 5LSRA 1UWAA 3DLLQ 2UVUA 4U8YA 1RKJA 3I4PA 3UCZP 4WFYA 1HHQA 1NM2A 2KT3A 3IFEA 3D9BA 1VQ7S 5CHCB 3KJQB 2FD2A 2N82B 5J2QB 2BJ7A 3M6WA 2DHHA 3SEOA 3T19A 1YGYA 2IDLA 2EFPA 2LXUA 5CH7B 5HANA 3R2CJ 2KXHA 1RWXB 2JWNA 1ZETA 4PYDA 1SC1B 3FZ2A 3VZIA 4PRFA 2ZOGA 1VRUA 2QZ8A 2ZOFA 1Q1KA 2ZNYA 1DLOA 1IKYB 3FNNA 1U4BA 4P2XA 3EGZA 1T9YA 1B70B 2OSQA 1OQ6A 2GMJA 2XHCA 2OUGA 4BC9A 4DFJA 1JX4A 1YRXA 2JRSA 2GQ2A 5H9EJ 1APSA 4ECUA 3TP2A 3OXLA 1JLCA 1R8CA 1RAIB 1RTZA 4OZLA 5E3AA 5JXSA 4ELUA 2HGMA 2RILA 3HFZB 4OZNA 4HDHA 4JI2J 3ZO7A 2ZH4A 3BJYA 1KNZA 4CWBA 3J80U 4X4TA 2XS5A 1QVFR 3CE8A 1JNZB 3LPEA 2L9WA 2QIFA 4PG7A 2E5LJ 2IBKA 4V19J 1JXLA 1AFIA 2CJBA 3ZZTA 4RBTA 4ZVOB 1OQ3A 3LUYA 4N47A 4ZP7A 2GW8A 3WBZA 2DXEA 3TZXA 2EXUA 5K9FA 7FDRA 3PR4A 5D4NA 2E29A 2IVYA 4XDCA 2MZ1A 2UV8G 1U7LA 1JB0C 2RKIA 1C4AA 1X5SA 5D77A 2VUGA 3H40A 2E1PA 4I7FB 5GAEI 1TV6B 3CCJS 2BQRA 4USUA 3G8TA 1V5VA 3MXHP 2ZBIA 2HQCA 4ED3A 1T94A 2I0XA 3UR3C 1C1BB 2HGNA 1PAUB 2D74B 2N7CA 3OJSA 4JV5F 4F0MA 1MROA 3AXMA 1XNQJ 1PILA 1Q8KA 4ZVPB 1UJ4A 2BW2A 2HRTA 2RH3A 4XIUA 2CKWA 5LT5A 1XMOJ 4PZVA 1H6KX 2QLWA 2R3VA 3BBCA 3R6LB 5AXKA 3GIKA 1S6UA 2FQQB 1S1WB 1SUQA 2EK6A 3CMQA 3VHQA 5CYMA 3QO9B 4NPOA 3QSYB 1KD1T 3D6TB 1D1UA 3MEGA 3VAHA 1RAOA 2OPSA 2KYXA 1UAWA 2DGVA 2MYFA 2VA3A 4NZ0A 1DAXA 4NLTA 4Y34A 1GXUA 1S99A 2IVFB 4ZN3A 2BBEA 1RE1B 3OLBA 3NGUA 1E6YA 3AQOA 4WIIA 4RW8A 2I8EA 5KFSA 3OFFA 4ZVEA 4J9QA 2RRBA 1KC8T 1FKPA 3BN7A 1CC7A 1O8BA 3KK1A 5KFYA 1HD1A 1YLXA 5D3GB 2ZBQA 3JAMU 3W5ZA 2AEJA 1SL0A 2GVZA 1HIYA 2JFDA 5KFUA 4ELVA 1WDDA 1WC3A 2FHJD 3HHNB 5BYSA 4DU8A 4GRSA 4OIXA 4ZITA 1ZBTA 2W24A 4RNFA 1H2UX 1Q95G 3TJ8A 3WX8A 5KFKA 5BYRA 3C6UB 1N34J 3TAMB 1WF0A 1RHJB 2GQQA 3LGMA 3PJWA 4Q2LA 4F4KA 4OV1A 1G1XA 1MN9A 2UXBJ 4ZP8A 1P1TA 3C6TA 1MMNA 3HHLA 4A8MP 4DV1F 1ULRA 3PXGa 4Y28C 1HBOB 4DR5J 1VQNS 2CJQA 2YQ3A 2CPFA 2UVWA 2PO4A 1VQYA 2CPJA 4PG4A 3IO1A 3TRGA 2DTJA 1BD6A 2BXJA 2CA9A 1TP7A 2HHHJ 4OX9J 4XTTA 4P2SA 1KQGB 3R7NB 3UN3A 4JI6J 2O1PA 2QE5A 1LW2B 2C2OB 4ZVGA 4OX6A 2HS3A 2QLBB 1UVNA 5KG6A 4H54A 5KFHA 3PX6A 1Z2LA 3GJRB 4Q2MA 3M30B 3MM9B 3SCJE 3TWZA 1TL5A 3A8EA 5I42A 1OMSA 2MY7A 4OYXA 2DHGA 7AT1B 4WU3A 2OEMA 2RDIA 4I6YA 3K5LA 2WONA 1S1XA 4OHXA 4TU7A 4C8NA 3TAPA 2YWWA 1R0AA 2F63A 4KGMA 1N6QA 2Y3YA 3R3TA 2BYCA 4K2XA 4JOUA 4DXLA 5J1PA 1Y9OA 2KKHA 1VS3A 4DV0F 1S9GB 4F2RA 1N5QA 2HNYB 4Y2KA 2ZDPA 3H90A 1KTVA 3Q89A 2XCPA 1T9VA 2HBZB 2C3PA 2RRAA 2WOMB 1XMQF 2PMHA 1SJQA 2MSSA 1X4CA 3KNAA 2I9SA 3Q8YA 3ISZA 3T5LA 3KK2B 4FS1A 2C2NA 5IQ6A 3DHXA 4ED6A 3FCHA 4ZLLA 4F3OA 1NPRA 3O1LA 4RW7A 4KT0C 5E3CA 4RUAA 3KJNB 2IBOA 5I42B 1Z4UA 4F0KA 4ZVRB 2VFTA 4HT5A 2OELA 2PEBA 3D1OA 4PXCA 1K0TA 1W7WA 3HZEA 3IGVA 2E1CA 4F8RA 4M5DA 1PCAA 2B5JB 4WP3A 1REVA 5C25B 4DQRA 2IJRA 2NXUA 4K8RA 5D78A 1IM4A 5M2RA 4YY3F 3K5OA 1K9MT 1U8SA 2GAGC 1ICEB 1H72C 3E3XA 3DOKB 1PBUA 5BR8F 1ROFA 2E7VA 3ENAA 2DEJA 2RVJA 2SXLA 1N33J 2MZJA 2DO0A 4B17A 3NAIA 2DPJA 3AD8C 2KYZA 5E33A 4KB7A 5CAAA 3UD4P 2JEFA 1OY6A 3UR0A 4EK2A 1F9FA 2Y0BB 4LF6F 3CDWA 3S01A 1X60A 4YR0A 4RWXA 2KO1A 4KKOB 2FJAB 4OZ5A 3D2WA 2JEJA 3R1LA 1X8DA 2GV1A 3M6XA 1SC3B 5EHHA 2HNZB 5KFDA 2CQBA 3QJPA 2CYYA 1Y11A 2NXNA 4WFBQ 5KFVA 1B0PA 4IKAA 3DN9A 4ZP9A 4DSIA 3HT0A 4LF7J 4AL5A 3O5TB 1RAFB 2B9YA 2P9EA 4LREA 2MQOA 2V2QA 1Q81T 3VVUA 4ZPBA 4OI2A 4HACA 4C11A 2XM3A 1O0PA 4URQU 1P9YA 3KDOA 4X4UA 5ETSA 1J5OA 5J2QA 1TKXA 3TJ9A 2Y8WA 2X7IA 3CJ4A 4RU2A 3FMBA 3FDSA 4LQ9A 2MXYA 2HFZA 3GB0A 3RJMB 5KFBA 4B3OB 1FTCA 1LFPA 2B9XA 1RTHB 3CGIA 1WACA 3KUEA 2A2DA 3J7A1 1T05A 2V9KA 3BSAA 2LMIA 4X84A 3G9CA 2M8DB 3BGLA 4OX9F 2HHHF 3KLVA 1XNRF 5ETOA 4URGA 2BE9B 3HVRA 2KHDA 1S1UA 5AXMA 1OJ4A 3O44A 3HULA 4N5SA 4J9NA 1DZ5A 3MTKA 4ETXA 5J1NA 2IJNA 1IKXA 4ZHRA 2FYXA 4QPXA 1FNXH 2V9WA 2HHQA 3DRSA 1EQ0A 1F1BB 4B3TJ 5EX3A 5GADU 4DFMA 4DUTA 3C19A 4F4YA 3FGVA 2ZVSA 2GHVC 2MKJA 5C25A 3OR2A 4G3IA 2L41A 1BWVA 4GKKF 2BRLA 4WK3A 3DOMA 1TVRA 2UUCF 2QMXA 5F8HA 4KO0B 2AJ0A 3O3LA 1FF2A 2L48A 2MHEA 3DXSX 5CD4H 4C3KA 1YQHA 1CJTA 3B4DA 4YR3A 4IFVA 3K0JA 1FO1A 3KLEB 3FBEA 3N28A 3DM2B 4PG8A 2ASYA 4DCOB 5HVGA 4X62F 3FBFA 1UVMA 2AZ3A 2J5AA 4I67A 4DV5J 3AT1B 5A6PA 3VAJA 4OI1A 2W4DA 2E7WA 2HQIA 2KB2A 1LWXA 3NCRA 4ZVFA 2EKNA 2RE1A 3G4SS 4J9PA 1RBAA 1GT8A 3CDBA 1LW0A 2ZEJA 5GMDA 4DLEA 3AD9C 1YITS 2Q3PA 2QLFB 3BQ2A 2LLZA 4I1TA 1WNEA 3W5YA 2JJ4D 2E44A 4OX7A 3M8RA 3DLJA 3L7OA 3RAQA 2P6TA 4O0NA 1NK7A 2DR7A 3TQ1A 1FXDA 3QAEA 4ZPDA 3PYGA 4OZ1A 2YQ1A 2DNKA 5CQGA 2C2MB 4ER8A 1FESA 3M32B 4ANDA 2M4MA 2EFQA 5FDLA 2GX8A 4B9TA 1X31C 4A4JA 2VQFF 2V2KA 3ZZRA 3NL0A 2VDIA 4TNOA 4K4YA 2ZH7A 1YJVA 3R6GB 4RW4B 2IAJB 4ES1A 2ALZA 5HP1B 2F3JA 1YDLA 1WF1A 5L8RC 5B09A 3DYAA 1R8BA 2XI3A 3MMAA 1HWLA 3NRBA 4P10A 4K4VA 2OIHA 1F5BA 4YB1P 4NCAA 4RUHA 1HBUA 3H5UA 1X4GA 2VC0A 3NS7B 2RF2A 1IWAA 1C1CA 1RQ0A 5I4MA 4CRJA 1WF2A 4LMZA 4IQMA 2D3OR 4WTYA 3TEGA 1PYSB 1X0PA 4UQTA 3MM8B 1RTJB 4IOBA 2AHOB 4NA3A 4ZVQB 4BCAA 5KOWA 2IA6A 4HT7A 4ZLNA 1NZAA 2ZOMA 4YHHF 3BSNA 2GCFA 2MLZA 4IH5A 3M6UA 4KH1B 4ECWA 4A8FA 1P9QC 3IA0A 2A10A 4XAKA 3WDOA 3DDKA 3JB9k 2BKOA 2LU2A 2N4DA 1YJ9S 2CVIA 2DT9A 4IFYB 1SI9A 4H4KC 1MU2B 4HTIA 4JP8A 1FDAA 2I2YA 4NCGB 3CJRA 2RHSB 3R97A 5GMEA 3MM7A 4ED1A 3UNGC 2IMWP 3KHGA 3GLJA 3ZC4A 3QZ8A 3TO8A 4I2PA 4X65J 4ZCMA 1LWFA 1C4CA 2BJ9A 5B0EA 1VRTA 2HZCA 2CJYB 2NLWA 3AH6A 5F8LA 3I55S 3GE9A 4DV6F 1Y7PA 1ZTWA 5F8JA 2IIHA 4XO0A 2C42A 4HVZA 2HK3A 5HI7A 1TR0A 4BWJA 1Y10A 4FYWB 3A13A 3TEHB 2JDJA 1U1QA 1CJUB 3OTCA 3QT6A 2DNHA 1HNZF 3W64A 4FPRA 2GC8A 3ELHA 3PCOB 2FHKA 3RBEA 3KHHA 3RBZA 4B9MA 1TL7A 3AJ1A 3DRRA 3A8IA 3KLIA 1F9HA 3OL6A 3OUYA 4DL5A 1N36J 3C16A 1Y5LB 3GMGA 4Y2IA 2RRNA 2EC0A 3HJFA 4HYKA 2A18A 1A6LA 5E3PA 3FFIA 5U47A 3J80Y 1M90T 1RWNB 4S0MA 4NXMJ 5KFIA 2ZH6A 1VBZA 1NHVA 2HAFA 1YHQS 3D1QA 2IFXA 1T8EA 2B9WA 4JI4F 2IHR1 2W4CA 4FYXB 3JTOA 4IYQA 4LBIA 1CVJA 1RT1A 1A0OB 1VHIA 2C2ZB 4B3SF 1HNWJ 2CQPA 2GGPB 1UEKA 3JS9A 2M88A 4ETZA 5JVGQ 1T9UA 3L3CA 1RWPB 4FNIA 1NJWA 2E9TA 2HVDA 2JVRA 1HHSA 3QT8A 2J9DE 3BKTA 3KNGA 3LGHA 3RZAA 3T5KA 1KSPA 1RYSA 3DYAB 3MMAB 4EMDA 3DU6A 4N7TA 5BJRA 3J81j 2KM8C 2X1FA 2XMWA 4C7QA 2COLA 4ZPCA 4X4SA 3PFEA 1FK9B 5HMYA 1N8RT 4N41A 3EE3A 4C0OC 2EG2A 5D4PA 4HH1A 3IGNA 4X64F 1L3TA 2VQFJ 4ZPTR 5HO4A 2QEXS 4O44B 5J1EA 4GC7A 5K5MA 2NPIA 3UWTA 4DR3F 1JXVA 2V8PA 1RB0A 1GTEA 3KG0A 1QAYA 3VGVA 2ACMA 1XNQF 2G4BA 3H5XA 2J76E 4FNHA 3KOAA 1WKKA 2ZITA 4Y00A 1BWEA 2RT3A 3CJKB 2VG5A 3A12A 3BH6B 4KKOA 3CJQA 3QFHA 4G6VB 4MK7A 4NEZA 4R8UA 4Q5VA 2FPHX 4DV1J 2ZKUA 3M9NB 5CYQB 1KR4A 2HLTA 3MEDA 2AJFE 4F2SA 3OD2A 4H4OA 4YB7A 1ZM9A 5M2UA 3TAQA 4RW6B 4L6V3 2DGTA 3T5JA 1RZMA 2OAUA 2MB0B 2XHWA 3HFKA 4ZK7M 2F40A 4TVAB 5B0GA 3N6MA 5F3ZA 1U48A 3C3LA 1NPKA 3ZTSA 1S0OA 2HQ3A 1MW7A 3NMRA 3R5BA 3HPOA 4CO3A 2CQDA 2MDAA 3IP0A 1FEHA 3E2EA 2XSJA 4YFUA 5E7OB 3CD6S 3G82A 3CJTA 3NLCA 3VAMA 4QZVB 1EX8A 1Q82T 4AYBD 2XLKA 1TKZB 1CJTB 1HQ2A 4NLQA 1S7HA 1KEKA 4DU7A 1HNVA 1XMBA 2E5HA 1F6TA 2WW8A 3KUGA 1VJQA 1U6BA 2I6WA 1GEHA 2BJ3A 3VWSA 4JI4J 2F1FA 1TL7B 1S6QA 3ILOA 4UOCA 1S79A 1I6JA 1NAQA 2EBGA 3KLIB 1IWGA 1R43A 2HKEA 2POKA 1N5YA 2Z2ZA 1UFLA 3EJMA 3W5XA 4H4MB 2R7QA 1GFWB 3FMWA 2JX2A 1T9XA 2ZNZA 3PRDA 3VQSA 4DS5A 5I3QA 4FF1A 3M8ZA 1XK8A 1EP4B 3QMQA 1UEVA 3RB4A 1KONA 4O3PA 1HARA 2VBWA 3T1YJ 1MN7A 4H4OB 1UW9A 3GWCA 2I5JA 5ETTA 4BS2A 1A7GE 2RHQB 4CLFA 4P6QA 3NG8A 2HFNA 4IFYA 4ZCIA 5B0BA 1OY9A 5ETPA 4UY85 2XY6A 1FDDA 3BDPA 4IG3A 4O4GA 3LP0A 2B0GA 2BKPA 2RU9A 3I9ZA 4HDGA 3ZZPA 1RT3B 3IBFB 1RAJA 1X5TA 1HFEL 2VFVA 3ZZZA 4AD6A 1QSYA 4PABA 4MT1A 2Q6BA 4M5JA 1HI0P 4EO6A 1WOSA 3D68A 4CO1A 3DC2A 1ZOTA 1JLEB 3CMES 1I1GA 3LA0A 4RBVA 3NKYA 2VICA 1TUVA 2E9ZA 5HQLA 1RGVA 4QCLA 3M2UA 2VFSA 2K2PA 3QIPA 4DR5F 4J9SA 1T02A 2JFKA 2NSBA 3IS9A 2HWIA 5B7WA 4Y2MA 1RTJA 4OL8A 4MIAA 2DNRA 1DTQA 1VQMS 3QJLA 2WVBA 4CLWA 5HP1A 5L1KA 4PQUB 2ZFHA 1EARA 3FSXA 1KVJA 5J2PB 2J7UA 4B9LA 1KLMA 2VASA 3CNQP 3MGJA 1YRTA 1AT1B 3U1NA 4V19X 1SQEA 2EC2A 4HI2A 3FQLA 3AJ2A 3AY0A 4OJ3A 1TL3B 1JLCB 3TX8A 1X5OA 3QT5A 5HQ8A 3CCMS 4DFPA 3SV3A 2V68A 2VIHA 2BJDA 2UU9F 4MFBA 2F5GA 1AUSL 2ZUAA 3G6XA 3CO0P 4CO0A 3BO3A 3CSKA 4HACB 4C11B 4AXJA 5GVQA 2BM1A 1S9EB 2RB7A 5A8KA 2OFHX 5L38A 2EEYA 1NKCA 1TMMA 3DLBA 4DR7J 3U02A 2VG6B 2M0GB 5IC6B 2YWHA 1TK0A 1VC5A 3ENVA 5KT2A 4LF4F 3PO4A 4J9OA 3HZGA 2HFUA 1RAEB 5LM7E 4USHA 2XLIA 3KTQA 4YHHJ 1MNEA 1Y5NB 1VFJA 2CADA 4DI6A 2FHOB 4UOGA 1MWZA 1Y00A 4PPZA 1HWUA 2B56A 1FXLA 3THPA 2ZBPA 4WKRA 5IT0A 5D4LA 3M1VA 3EMTA 3IR6B 3NMAA 2AYMA 4RR5A 4LSLA 4GKKJ 2GS8A 4DV7J 2CJAA 4YMEA 3CCQS 3JTNA 4PWDB 1YVFA 2HBRB 2M5YA 4KTQA 4LF9F 1K1SA 2MKHA 1WD6A 1NSQA 3OTOJ 4I56A 3HKZD 2PN6A 3OSPA 2UUTA 1NSPA 3M05A 2GJ2A 2JLFA 4CLLA 3MCNA 2J6TA 4QU6A 3LP2B 3LF0A 4FYVB 1GK8A 1SJ3P 2RIJA 2OPPA 4DR6J 2VZ9A 2DNNA 1VJWA 4OZ0A 4JV1A 1GMWD 2B6AA 3S1TA 2VBXA 3T6JA 2B43A 1V6HA 5H9EK 3OL9A 2J0WA 2WCXA 4J9UE 4NLSA 4C0HA 1X4HA 2KG1A 3VAIA 2AGQA 3QSIA 2BE2A 4LF6J 4FPIA 1MMLA 3OR2B 2F4VF 4DV3J 3OVSA 4CT8A 4X4RA 2ZM6J 3BEGB 2EPIA 1K73T 3M7VA 3HX9A 2GIFA 4XDDA 4FYYB 3P4UB 1J2VA 2VHGA 5B0FA 3QIPB 4G1QA 2CPHA 3UPFA 3SIPB 3EZOA 4KV8A 3FRYA 4X64J 5CZXA 4TY8A 3BH7B 3HO1A 4DQIA 3PKYA 2KI2A 4NLOA 3R7BB 4F4AA 1CJVB 1TUGB 2HW3A 1M5SA 1ZM4A 2OPQB 1XN9A 5EN1A 2FY8A 2OKQA 1KQKA 5FD1A 2JSXA 1HBMA 5JJBA 1UVKA 1S0VA 2M3DA 4DL3A 2P9CA 3B54A 3I5CA 3BS9A 3A8JA 1T03A 2FVQA 3WIVA 4O44A 5J1EB 4ZIWA 3MR6A 4DOZA 1V3RA 2CDQA 4QR2A 6AT1B 1U1NA 1SKSA 1UPMB 2WK4A 3CJ2A 4C3LA 3CEDA 5CABA 1XWLA 2WB4A 2QT7A 3ADAC 5I3PA 3SFUA 3QRRA 2V6AA 2ZH2A 1WC4A 4ANCA 3P5TL 2U2FA 4QWBA 3UDVA 4USVA 3CCLS 3V5RA 1WDTA 4IUFA 4XPCA 2GMLA 5A0YB 2R7SA 2DNZA 5DJBA 2BX6A 2H4WB 1Q0NA 2H5JB 5HROA 2QV6A 3CD0A 3V4MA 2K8GA 4DV4F 4IFVB 1UVLA 3IWXA 2L9DA 2LEPA 2XO6A 3GCWP 3MD1A 2C28A 4G1QB 4LQ3A 2JHEA 3OPKA 2QLXA 1CSJA 4RNNA 2PC6A 4M95A 1PC4A 1TKTA 2WBMA 4MKAA 1TK5A 4C8LA 2EW9A 3H4BA 1WWHA 2J9CA 4FF2A 5C24A 1QAXA 3I96A 1FRHA 2DNYA 4L73A 3T6BA 1JXEA 2QA2A 3KK2A 1R0CB 3QPIA 5KFOA 3WC0A 3ZZYA 3QBCA 4L72B 2BVZA 2RQCA 5A0YA 3S7RA 4DSLA 3VCDA 3FRZA 3HHLD 1RWVB 5IS2A 2ROEA 1PIEA 2DITA 2QG9B 4OJHA 3TJAA 2KXNB 1JLQB 3R5JB 4H4KA 1GMVA 2LECA 2MQLA 1GMWA 2VD3A 1DRZA 5GADI 3Q22A 3TA1A 3HD2A 1CJUA 2NXEA 3H0PA 4DL2A 1HI1A 3I82A 2PA3A 1RT2B 4LR7A 5KG4A 1S72S 3FQKA 1NUEA 3GP9A 4NMLA 1EETB 1JLBA 3PM9A 4NX9A 2QFJA 1LWFB 4FXDA 2AP6A 5A76A 1UCNA 2XO7A 3ENWA 1GXTA 3J7YI 2IY5B 4ICLA 1SIZA 3QGHA 3VF0B 3EXYA 3M2RB 1IJEB 2ZBCA 4Q7AA 2HYIB 1IR0A 2CFXA 2W2NP 2W9BA 2B51A 3M9OB 3EPGA 1RXOB 1NXIA 4KQZA 1BGXT 2DKOB 2F8MA 3NCQA 3OVAA 2DPIA 4CM0A 2HQDA 3LAMA 3ZTQA 3SDEB 1OO0B 1SC6A 2UUAJ 5HVHA 1XQIA 3T5HA 1LW2A 2ATLA 5CXTA 4F67A 4RW9A 5IXUA 1KLMB 2G2OA 4QJVA 2P6SA 4RNOA 3W2WA 2CQ1A 1EQMA 2HGLA 1WUUA 1S5ZA 3M4XA 3KUHA 1UZDA 1G6BA 3EICA 3I6PA 5DQIA 3OW2R 1RISA 1D3WA 1RWKB 1U6ZA 2AEMA 4RLEA 5KFLA 4DN9A 2C22A 1CS4A 5T7LA 4I2QA 5G4DA 2FY1A 5IQQA 4ZJOA 4ECSA 5DGAA 2WVFA 2GGPA 1AFJA 2UXDF 1U8WA 3UD5A 3ZTPA 2OSRA 1GX6A 1JQGA 1PJ6A 3UDEA 1RA7A 1RWOB 4IDKA 3GQCA 3M32A 4YS2A 1GTHA 3OFGA 5DQHA 3POTB 1FKOA 3NNCA 1FA0A 4HHHA 4L74A 1HNIA 4R8UB 5KT7A 2M8HA 1H2TZ 1H74A 2CAJA 2YNGA 2ZVIA 2X51A 3NGRA 3RYLA 5DS7A 1MLAA 2VQEF 5H1SV 3AAWB 2Z57B 5GMKa 3VAFA 3PW2A 1UL3A 2XZWA 2NR0A 4D3HA 3R8YA 1FJGF 2CPEA 2VDHA 4X4VA 3ILJA 1VQKS 2OTLS 2XWXA 2OPSB 4O3OA 3EGVA 1I5OB 3RW7A 3WX4A 3GPAA 3CCSS 2R8JA 1LXNA 2HHUA 2R7TA 1U2RA 3TNVA 2FLNA 1JLQA 4K7QA 1HLWA 5IM0A 1FVQA 3JQJA 3CF5Q 3UE2A 3GV5B 4A8KA 2HHPA 2ZM6F 2DO4A 5LSOA 4ANEA 2KVQE 3OHAA 3PG9A 1RDRA 2A0FB 3VGSA 4DG1A 1PJ5A 1RLDA 2NSCA 2V4JA 4LF1A 4I2QB 1IQZA 1IKVA 3TA2A 3WIUA 3FBCA 4X4PA 4X62J 4H4MA 4P74A 4NCGA 2OHDA 3AB4B 3PHEA 1U49A 2DR5A 2CZ4A 4QWAA 3R7SB 4J9RA 2KT2A 2G2ZA 2C3UA 5HJXA 2VJVA 1RHKB 3ZZ0A 4DZDA 2VF3A 3Q24A 1TKZA 4YDXA 3AOAA 4DR1J 1NB7A 1NH7A 4G1PA 3RAMA 4NCBA 3OFHA 1KBRA 4AT1B 2IRXA 1RHRB 3BKUA 2JLGA 1IBLF 1HPZB 1OWXA 3GFHA 1S1UB 4FZVA 4KGKA 3SDEA 2W01A 1NJXA 3IXQA 4RJVA 4ECXA 3W63A 4YOEA 3H2VE 1HHTP 1R6YA 1H73A 4IRCA 3MCMA 3TYTA 4GC6A 1TMJA 4C4WA 5LSLA 2AU0A 2OFGX 2L3MA 4ZVSB 3KJVB 1W26A 2EWHA 3CCWA 4BLGA 3S6EA 3MEDB 2UV8A 3FC9A 2NS1B 5L39A 2O5DA 1N32F 5DLGA 3N6NA 4BHQA 2IC3B 3MECB 3KK3A 2HMIA 3KLFA 4P2MA 3TA0A 3TUIC 3Q8QB 2X1AA 3KHLA 1SJFA 1Q5YA 2HIYA 4QWCA 1W25A 2V63A 3V4IB 1ZA2B 3OQ2A 4CO5A 1RYRA 5AE2A 1Y5IB 2BANA 1IXKA 2LEAA 2N3LA 5KAKA 4P52A 3CC2S 1RBLA 1OYEA 2EFOA 3VZHA 3KG4A 5KT3A 2ZZTA 3QLHA 3SZ2A 2YKOA 1CBKA 2WSCC 3MM8A 2RUSA 1J5EF 4HR2A 2KG0A 1B64A 4IG3B 4O4GB 4PQUA 5DM6Q 2MPUA 1NB2A 3R5CA 1PC5A 1UW4A 4R25A 4WBFA 1SQFA 1SKUB 1PG5B 5GAGU 2Q1LA 1P27B 3ZNUA 2Z0GA 1N0UA 1AA1B 4KC5A 4UF4A 1RT7A 4F26A 5C2GA 1FD2A 4O3NA 3IN5A 1X4DA 1V5IB 3D0HE 2DNPA 1Y4ZB 2QA1A 1N52B 2W2QP 3SYZA 3FJ2A 3M8PB 1IR2A 3CW2C 3PRBA 4LRDA 1RT1B 4DCJB 4KJIA 3LO3A 2PD1A 2V69A 3CJSA 4ZLJA 4B02A 2KL8A 2K7JA 1H2VZ 3PYFA 3NBPA 1WG1A 1REVB 4HHJA 4X65F 2Z56B 1XMOF 3TAMA 3CCZA 4TU8A 2YPYA 4K0KF 2J0SD 2W2MP 5HJYA 5HROB 1XR6A 2EG1A 2NYHA 3Q86A 4A8OA 4AL6A 1U1RA 1RAAB 3BN4A 3CT9A 5KT4A 2X3GA 4LUBA 4CT9A 4KSEB 3TX0A 4CDIA 2BDPA 3MF5A 3R5AA 3KYLA 4CLKA 2PI4A 4C9DA 1TL1A 2YNHA 4C8ZA 3EVMA 2R8HA 2AD9A 3QYYA 3LP0B 2QL7B 1ZZNA 5HVFA 3CMAS 2YNFB 4JI7F 4OHYA 3US5A 1SJRA 1U25A 1EETA 4ZOSA 3D0GE 3HSZA 4LSNA 4DPXA 4A47A 3ILLA 4KRWA 4ID8A 4ZIVA 1VQ9S 1OY8A 2HVZA 2WAQD 4K2JA 2HWHA 2OI2A 1L3KA 1WTFA 2MEWA 2QC3A 3AD7C 3I9V9 4J5OA 4NA1A 3W1YC 4BBYA 3N6LA 5KG5A 4J9LA 1QUPA 1BMQB 4CLUA 1WKJA 5D0HA 5F0WA 4DX5A 2J6UA 5DETA 2HNDA 2ZHBA 1D09B 1N6QB 1G2EA 1NK9A 3QFWA 3RTVA 3RAXA 3PY8A 2Q6CA 2VH7A 2V67A 3ZXWA 1S77D 3KMQA 1SL2A 5ETNA 5SUHA 1MU2A 2CQGA 5K8OA 1TQLA 3MR2A 3B4MA 2UXBF 3DNCA 4LBPA 2D3ZA 4NEYA 1UA0A 3MM7B 4TQSA 1HWJA 2CRLA 5F8IA 3CO9A 2AEFA 4NLDA 4DX6A 5F0UA 1RWWB 1TKDA 4ECTA 5BR8J 4DUYF 3UD3P 1FEEA 2PMZD 4QU7A 4LF5F 1S7IA 2CUYA 2NQPA 1FDBA 2JH3A 3LWLA 3KKFA 5KG0A 4CLYA 2CDRB 4KHRA 4IRKA 1P1LA 1F3VA 2AJ2A 4A8XA 2DGQA 2LQBA 3M8YA 2MQ8A 4UW2A 3UDCA 1SBRA 5EDWA 2KXFA 2M2BA 1VIOA 3C15B 4OQJA 4OV6A 2HHWA 6FDRA 1IQTA 4LFAF 1FRJA 2CNOB 3CCES 1IKVB 2L08A 1VQPS 1WHVA 1HMVB 2BM0A 2IAJA 1Y0HA 3GJTB 4NYZA 3PV8A 2XEXA 4DR4J 2BOAA 3FK4A 3D4JA 5HMWA 3PEJA 3W2WB 1U6FA 2E5JA 2XMJA 1MG7A 2NUUG 1FRIA 3CDEA 1CEZA 3CVKA 2MLYA 5ADZA 2XG8A 1T7PA 5FLXY 4DV6J 4LFBJ 1WELA 3CXCR 1ELOA 2DHSA 4RKUC 1VR6A 3AJDA 3MM6B 5HLFA 2WZ1A 1XJWB 1D8YA 5CYMB 1RP5A 1U02A 2CPIA 2YQ0A 2MZTA 4FYDA 3DGPA 4ZA1A 2OP5A 3F41A 4TYBA 4B3TF 5DDOC 2R7WA 2JVOA 3LQVA 4MK9A 2YBVA 4U7CA 2DJWA 1Q8BA 4CO2A 1NJZA 1WC1A 1SXLA 1RT6A 3SXLA 5ETQA 2FVPA 4LFCJ 2XULA 3GV8B 2WRMA 2K3IA 1WEXA 2HFOA 1HNIB 1TFWA 1SV5A 2B4PA 2CWXA 2HQFA 2YNHB 2OLWA 1RKIA 3AOBA 1R8AA 3H5SA 4GVBA 3DXBA 4BC7A 1SJ4P 1URNA 4DR6F 4K4SA 4EBCA 4CTAA 1FJCA 2C3MA 3W8PA 1BXNA 2ZZMA 1U45A 4K0KJ 2BACA 2H5EA 3C46A 1SVDA 1NHUA 1TFYA 2VBZA 4MIWA 5HK4A 3AQPA 3X1LB 1TAQA 3K2YA 1K47A 3BGFA 4YEAA 2YWFA 4NE9C 4X4OA 2BZ2A 1UA1A 3Q0AA 1K44A 4B9VA 4C3MA 1B7FA 2G9OA 3CC4S 1YJNS 2XNQA 3D5MA 4LF8F 3SSSA 4RUCA 2R42A 2YXLA 4HLBA 2V8DA 4RU9A 5C42B 2D3UA 1N33F 1FX4A 3OHBA 1V3ZA 4LRFA 1D8ZA 3C15A 3FCVA 3DOMB 3TQEA 2QA4S 2HS0A 4NLWA 3TOQA 2MGZA 4DPWA 1FHTA 3V81A 1AZSB 1NSKL 2DCLA 3KLGB 3A3OB 3BKFA 2DRAA 2RAQA 4I6WA 3JQMA 2LXFA 3QWPA 4GMKA 2CQ3A 1HQUB 1RT6B 1RTIB 1JK9B 5CYQA 1MWQA 1URRA 2HAIA 1IKYA 4P7TA 4DCPB 3JSMA 1RSCA 3J81Y 2FUG9 2VONA 2FB0A 4QW8A 4DSJA 3R27A 3PIPQ 2BRKA 2F4VJ 1T95A 2ABYA 4CM2A 1KP6A 1F0XA 3BZQA 3O2IA 1VC0A 3MM6A 4W90B 2OPRB 4E98A 4WFZA 1J5EJ 1RACB 2G1DA 3HT3A 1X7VA 1JLAA 4LF5J 5CYJA 3BR8A 3GILA 4IQXA 1FNMA 2RDJA 1M5KC 3HI9A 3W62A 1FI4A 3KJVA 2H5IB 3NXZA 2UP1A 1S12A 1N4LA 1N34F 3V81B 1AZSA 2J9DA 3E8OA 3HF5A 3NS5A 5DDRC 5IV3A 3AFGA 4DV4J 3PX4A 2CIMA 2GO9A 1IR1A 2WSFC 2XYHB 3G8QA 3VVTA 3JSMB 2VFRA 1R6VA 4DF4A 2C2RA 4DQQA 2XLJA 2I5JB 2CQIA 1F2HA 2ZHAA 3QGGA 2BA9A 1RT5A 2GQCA 4C8MA 3SCIE 3PEHA 4NLGA 3MDFA 1JLGB 3SSRA 2B4OA 3KMSA 2LVWA 2YVSA 2E1MC 3BREA 4P9SA 1F9EB 2Z58B 4ENOA 5CA5A 1X9WA 3RBXA 1KTQA 1IBKJ 3BO2A 5DG7A 3P49B 1RLCL 2AX1A 3AA9A 4TQRA 1S57A 5LXYA 3PW4A 3T41A 2YWKA 3MPWA 3QAUA 2IA0A 4EWTA 1RJJA 3GR1A 2WVDA 2GHPA 3ISND 3K89A 3A4TA 2K7KA 1YBAA 1QTNB 3ONQA 1PYOB 1N54B 2LYVA 3N9UC 5HN0A 2PIIA 3SBMA 4B9UA 1FFSB 2B4UA 2V2VA 4LFCF 4FKYA 4J9KA 3P3DA 1U47A 2CQ4A 4TN2A 1M5PC 1RAHB 4EUVA 4DV5F 2CG4A 1NPPA 2O67A 4DV2F 2CJ9A 2HZAA 4YQWA 3UCGA 1T03B 3MR7A 4M5GA 4CP5A 1ZZFA 5F9LA 1U1LA 1U2FA 1HNZJ 1VRQC 2H3EB 2XY7A 2R2TA 3LTOA 5EUHA 1SKRA 3UQSA 5GAHI 2ZWOA 2XBPA 3W9JA 1GX5A 1S49A 3IM9A 1LK7A 2N3OA 2RNEA 4YB5A 5LJ3Y 4DQPA 1FT8A 1TVRB 1BQMB 4OYZA 2Z2YB 2J8SA 3N0VA 1YBUA 4I2PB 1RT4B 2H65B 2I1RA 5D0EA 3W65A 4DV3F 2B8QA 2JEIA 3KXDA 1REGX 1FJEB 1X5PA 4QYZJ 3HHEA 2KFZA 2QX0A 4OX8A 2KRBA 3K5MA 2ZE2B 1HQEB 2LCWA 2ZBRA 2ASJA 3PW7A 2V50A 1NK0A 2K1RA 4MFBB 2YX4A 4O3QA 4KHPJ 3VQTA 1SH3A 4EU0A 4C2MA 5IWAF 1NCLA 2FGOA 2FHMA 2VFUA 4DPOA 2ZWPA 4LIRA 1IBMJ 2MTLA 4RNMA 1JJ4A 4FBTA 3N4WA 2OD4A 2XSJB 3GSIA 3IRXB 2E1RA 5FJ4A 1AYEA 1IUJA 3C6TB 3RRHA 2YH0A 4F02A 2FLOA 3D67A 3MWBA 3HD1A 4ID5B 2FJWA 5AXLA 5ETRA 1ACMB 1XR5A 3QRQA 4LFBF 2D41A 2IJFA 4UUWA 4K4TA 2PEHA 2AZ1A 3HHDA 2OTJS 4MYTA 4AQYF 2MZQA 4RW7B 4YDDB 1S0NA 1XIQA 3OT9A 5IT9Y 3C6UA 3BF4A 5KFJA 4FXWA 1D9FA 3D54A 4M5DB 4WYWA 4LFAJ 3DOLA 2WOMA 2G0JA 4DN0A 1DLOB 1QAIA 3C8YA 2DNGA 4ECZA 3IG1A 1KHVA 4FVCA 3NOCA 2UVRA 1N5VA 4IR9A 3RUBL 2KHCA 2E5LF 2Z30B 4LIWA 4QWEA 3GYGA 3FCWA 2V4QA 2HG4A 2KJVA 2E5GA 2ZDOA 1A9NB 5CD4A 2A6OA 5B0AA 4KV8B 4TU9A 2HRYA 4USIA 3FEZA 1XERA 2YKQA 3RW6A 3FKBA 1NDPA 4R5PB 2DD8S 2CQHA 1D9AA 2LKZA 4JI1J 4NXNJ 2DGXA 4JUZA 4RL1A 5MLCV 2XMKA 3MEGB 2XI2A 5K14A 2R7VA 3R1HA 1VIXA 2VV5A 4F04B 2RQMA 3X3UA 1GH8A 1YJ7A 2YTCA 3NAHA 4LR8A 4WK1A 2F7VA 5IC4B 5H9FJ 3K57A 4AL7A 1WKLA 3JSRA 2WONB 4M5MA 4M63A 4NLPA 2QO3A 4CIOA 3MFHA 3CULA 5HL7Q 4UOHA 4C98A 4NL5A 1NK5A 1E6VA 2JOQA 1V3SA 2VU5A 3EUNA 3M8WA 3W60A 4PKDB 2GVDB 4CTAB 4YY3J 3K5NA 5L1IA 1ZPWX 1ITPA 4ZVTB 2AYEA 1I3OB 3FUYA 3KFWX 3H98A 2RF2B 4OYPA 5G0RA 3OL7A 1IJFB 4P71A 3EDRB 2XYPB 1N5TA 3QZ7A 3GSDA 1X0FA 1QSLA 2IDEA 2A6MA 3CCRS 1EKSA 2KVIA 4ECQA 4DSEA 1WI8A 2QN6B 5IZHA 4QYRA 3MHYA 3PIOQ 3T1YF 3QRPA 4R0JA 1VQLS 2KRRA 3WQPA 2K1RB 5LJ5Y 2FJXA 1DFDA 1HR0F 3ZTOA 3JTPA 2OO4A 2NZ4A 5D3GA 2OEJA 3GFXA 5AXNA 2YH1A 2WBRA 3OVBA 1EJ7L 4DR1F 4WPAA 1YJTA 2MQQA 2ROPA 1C2PA 3A8KA 2VPWB 2W1BA 1LWCA 4IDKB 2EK1A 4MIBA 4Q45A 3D7SB 2GIQA 3TVKA 5D0GA 3PZPA 5E3QA 1ZA1B 4QOTA 3SV4A 2HEKA 1LOUA 4A8YA 5F41A 4M5NA 2ZH3A 2YKMA 1YKWA 3OTBA 4GVLA 4L3KA 2QLJB 4J9MA 1RK8A 2Z2LA 1IBKF 3TZWA 4JI8F 2BQ3A 2BQUA 1U1OA 1X4FA 4DMZA 3HSJA 4AXIA 2OPQA 4CH0S 4FF3A 3BM7A 5MAOA 1MMDA 4B08A 1S76D 1Q8IA 1JLFA 4FS2A 4NWBA 5THWA 2UU9J 4UZBA 4ZVHA 2IM1A 1VC6A 5J2PA 3M6VA 4ED7A 1BQNB 4EYIB 2DH7A 1VQ8S 1JIHA 3CB4A 3CDAA 1QE1A 1XC9A 5A8RB 2Y9HA 2B4VA 4ZMMA 2ZH9A 2FTRA 2X1BA 3PYDA 5T14A 1E6VB 1N0VC 2XZTB 3GR0A 2VKZG 3DLKB 1OS5A 4N56A 3UCUP 2C2DA 4F3QA 3NGKA 3FVYA 2WHOA 3QATA 2BABA 5C24B 4WJBA 1WSVA 4KFBB 3ICLA 4J91A 4EEYA 1TAUA 3CPWR 1FWPA 2MY8A 3V6HA 5LL6d 1JLBB 3LANA 4Z7CA 2GFFA 1DBDA 2DXDA 3MFIA 4FKXA 4NA2A 2NYIA 1T11A 2HNDB 1OSCA 2ZUGA 2D9OA 1KN6A 2H1YA 4X4QA 4PXDA 3OTOF 2W9CA 2CWKA 5D8HB 3DRSB 2ALYB 3PTWA 5DLFA 4CH7A 2VODA 3JSYA 4FVMA 2PDAA 1SV5B 3L95X 4P7VA 1TUWA 2ZZNA 3M8QB 2EFGA 2ILYA 5A2QU 1QD1A 3E01A 1HA1A 1XBWA 3VGTA 4WU2A 3QO9A 4DF8A 3W9IA 1BC6A 4YR2A 3D6FB 5F3TA 2HBQB 2YX1A 3MEEA 1W2IA 3THTA 4ED5A 5ETKA 2W9AA 2FJEB 2QA4G 4NLUA 2HNZA 2MKCA 4DUZF 3C14B 3FZBA 3MM5B 4N8NA 1WOPA 4NMXA 1OSDA 3KLHB 2EVZA 2PT0A 3N01A 3OR1A 4KAIA 2ZH1A 4ZPAA 7FD1A 1NKBA 3ETMA 2A1BA 4LSZB 4TLQA 4USWA 2QSFA 2AKWB 2MGZB 2AYGA 1QE1B 3DOKA 1JJHA 1UKUA 1JNRB 2FDNA 3IBWA 3MZIA 4IH7A 1YRUA 1Q86T 1HI8A 2E9RX 4P73A 3OSNA 1I94F 2R7UA 1RWUA 3UW1A 1VDHA 4N77A 3I0RA 2W2OP 4B3MJ 5L9NA 4C8KA 3CWJA 3EVWA 4Q0BA 5EX0A 5B0DA 3K58A 3T3FA 1M5VC 4ERDA 4R0EA 5K8PA 2LU1A 5L9XA 5FDLB 5HBMA 3WC2A 3IWNC 1CQMA 4GO5X 3NOGA 4OHVA 5RUBA 4F50A 4HKQA 1HBMB 4OYOA 3R5GA 4PG6A 3UNYA 1C0UA 5B0CA 4DLGA 1VBXA 1NLKL 3D1HA 1DQ8A 2OH2A 1UMJA 1VQOS 3W2VA 5KG2A 4RW8B 1BLUA 2QRRA 4J7CA 2C2EA 4NXNF 5D6GA 1I94J 4U67Q 3DRPB 3ENQA 1FCAA 4CQ1A 3LW5C 4ID5A 2FLLA 2HQGA 4GVBB 4M1KA 2O3DA 4EFAC 4M5HA 3PRVA 2MJNA 2QMUB 1RCXB 2B9EA 4E2FB 3JSBA 4F36A 3HVWA 2XMTA 2BE7D 5D0RA 2XQCA 1FKAF 1CPZA 3NWGA 1J27A 4P75A 1R0AB 1Q8LA 3HKWA 2XGPA 2VA2A 1XMQJ 3ULHA 4PUOB 3NP5A 5H9FK 1RWMB 1T3OA 1YX2A 2Y1IA 3DI6A 2HK2A 1OPZA 3OFEA 2RD5C 4KYZA 3G8SA 5ITHA 1FXRA 2LA6A 1KWMA 2J9EA 2EI5A 1BY9A 4ES2A 4ECVA 1R89A 1RU1A 2LQ5A 4Q8FA 2DRDA 3VGUA 3BDEA 4EYHB 2XS2A 1S1TB 3EZUA 4LVNP 2FLPA 1YK9A 2CXEA 2LQ9A 4A8SA 1VI7A 2M9KA 5G0RB 1M1HA 3SMZA 3ZZOA 2WTFA 3EPIA 5KG3A 2PMWA 4JBCA 3QNWB 3PKMA 1NSAA 4UUXA 3MEEB 4XK8C 4R5PA 4ZCKA 1NJIT 4C6AA 2B5JA 2W4PA 1VOMA 2DGOA 1HL6A 5D15A 3PVXA 1G3OA 1KOHA 4MMOA 2G0CA 3D0IE 3QWUA 2F9JA 5ETLA 4USMA 3KHRA 4IOCQ 2APOA 3LOUA 3Q8VA 1IKXB 4ZHRB 1KS2A 1RI7A 3MMCB 5F9NA 1SKWA 3JYTB 3BV8A 4WFXA 3HXMA 3J7AN 4KH0B 1LWEA 1S1VA 4QIGA 3Q2TC 4MTPA 3RB0A 3CCVS 1UFWA 3BQ0A 2VG7A 1PYTA 5HLFB 2QL5B 4URSA 5B08A 3J7YU 3G6ES 3H5YA 1BQXA 4JI8J 2LDYA 3O8WA 3D66A 2XGQA 1C0UB 1LKZA 2HSEB 2EBEA 3MM9A 4WP8A 2VG6A 3FEXB 3PJ9A 2DEIA 2H54B 5HQMA 4CH1A 5LMUF 4U95A 5KFZA 1HWKA 3ZTRA 4F3MA 2YKMB 2IM3A 4DR3J 3IC1A 2BUNA 2B3TB 3D28A 2YNIA 1SIWB 4LJMA 4WCEQ 4UY8T 1EB0A 2GO8A 1RHQB 1SH0A 1XTZA 2M52A 3Q8SB 1HYSB 2C2KB 1RABB 2DNOA 5JMNA 3S8SA 1Q79A 1YBTA 2MQNA 4K5RA 4PAAA 8ATCB 3BSOA 4ED0A 1VLYA 4C48A 3TR5A 3TI0A 1UPPA 2ZC3A 4KGVB 3OXFA 2JNJA 3MOJB 1YG0A 3IR7B 1JJCB 3UI3A 3BGOP 1UVJA 1DARA 2H48B 4KY3A 4DSFA 3RB3A 3CD5A 2DNLA 3BB5A 4LSNB 2AX0A 1FRMA 3RU0A 2XSFA 1X4EA 3DCAA 3KLGA 1IKWB 3IRXA 3NWRA 2IPOB 4Q43A 3GTYX 2KM8B 5C2CA 1B0TA 3LWMA 2Q66A 3NS6A 2CZVC 3P5BP 1LK5A 5J2NB 4Y65A 4AQYJ 4HTJA 2R8KA 5EWEA 2F8HA 3KJFB 4ED8A 3H25A 1X4AA 4W92B 2HVIA 1MSWD 1HYSA 3MCOA 4KE5A 3KWMA 3VALA 4CCHA 1AXQA 2AMCB 4FP9A 1S6QB 2PSZA 3U27A 2VJUA 3I56S 1NK4A 4MK8A 4LR9A 3L7PA 3N5BA 4RW4A 2KFNA 3CJ0A 4WZQA 3MAHA 1OPIA 5CZVA 3DRRB 3DMJB 4QR0A 4RZRA 1B3TA 2XZDB 4JI7J 1CJKA 2ATCB 1YZ7A 2AW0A 2O66A 4OJGA 4PXEA 4TKTA 5E0OA 5K8NA 2MHNA 4X66F 1VQ6S 4YUDA 2WVCA 4Z2XA 5SZTA 3QIDA 5E2QA 3UN5A 2RU3A 3J7ZT 1XEZA 3M1VB 2CQ0A 2HPUA 2FVRA 3ET6B 3IAM9 1GXLA 3BPSP 4YB6A 3W7BA 5LOQA 2YNFA 4ALZA 1WHXA 1O51A 1NHKL 5GAHU 1K8AT 4B3OA 3H20A 2GJFA 4NASA 4NOHA 4U6PA 3H4DA 4IOAQ 2XWYA 3GG0A 1JMTA 2BJEA 5DO2A 3N79A 3GFYA 1C0TB 2C3OA 2Y1LB 2YKNA 2H4YB 3LH2S 1RHMB 2PE8A 2EFNA 5EWFA 4CLZA 3IG1B 4HI1A 3RRGA 2J0XA 2VPYB 2NCKL 3L7UA 3R5DA 1CJKB 2BR0A 2AJ1A 2J6SA 3CJ8A 4BWMA 3U1LA 3TUJC 4A8QA 3NY0A 1U1MA 3W3SA 2E7XA 2QYCA
chains in the Genus database with same CATH topology
2XS7A 4F25A 4B9NA 2DNMA 4Q44A 1JLGA 4TXSA 5C5JA 1RTDB 2V8GA 1S9EA 3I32A 1CG2A 5A8KB 3CUNA 4NZ6A 4CNYA 3C2PA 3HHLC 3H2UB 3M30A 3TVZA 3DI6B 3I0SB 3RBDA 2RMLA 3EZ5A 3K59A 2AJ4A 3PW5A 3I5AA 2CQ2A 4NLYA 4QBUA 1TL3A 4ZCLA 3CC7S 1ZM3A 4RW6A 1N56A 3CDUA 1DTTB 4O0IA 1UJ6A 3ISNC 1N88A 4B3RF 1ZTTA 1AROP 2DB1A 1VBYA 1FD8A 5DG8A 3U7JA 3RR8A 3K8VA 2ACYA 4RX6A 4JI0F 4WZMA 3W2VB 3SI8A 1Q78A 2KH9A 1KFSA 3BQ1A 4MKYA 4DWIA 3T1HF 1FKPB 4PPDA 4ZDNA 1WEYA 3M2UB 2HLUA 3KK1B 1QAJA 3EGWB 2JLEA 1VQ5S 2R7RA 3Q2SC 4ATNA 4Q0BB 1M0SA 3P6YC 1LWEB 1S1VB 1R7IA 3MR3A 2XB2D 1HMVA 1PSDA 4EZ6A 1NEEA 5IFMA 4HEA9 4KBIA 2VG7B 4PWDA 3V6DA 2VL1A 4XPEA 5KFQA 1CQNA 1FK9A 1QVGR 3BGRB 3HHKA 1VK8A 5CCMA 2RSQA 3CCUS 5KG7A 1SB6A 2ZHOA 2LXIA 2PI5A 3I0SA 4C97A 2DH8A 2YWGA 4K50A 1LW0B 3BO4A 3DFEA 4U7UK 2ZH5A 3DRYA 3OL8A 1MROB 4PXBA 2MZSA 3JAMY 5E41A 5EWGA 3G8SA 4RBUA 3GIJA 2OMLA 2IM2A 2MKKA 5AE3A 2HS4A 4OLOA 1HBNA 2ROGA 3MPYA 4DL0C 3I31A 2KJWA 3UFCX 4F4ZA 1WEZA 2IRUA 3PACA 1FTRA 4TYAA 1WHWA 3P96A 2OMOA 3NBPB 4F4XA 3CJ3A 5D4OA 3RRKA 2LDIA 1HW9A 3GG1A 4Q8EA 1C1BA 2R4FA 4DFKA 3PW0A 3C66A 2ASDA 3Q23A 1H98A 4JI1F 1XR7A 4C8YA 1S1TA 4DL7A 1HNVB 3HM9A 2YY3A 2H9ZA 5KFWA 3GYNA 1UWBB 1Y3KA 3EGNA 2CPXA 1Q7LB 2DGWA 3WZ0A 5KTQA 1K1QA 2DR9A 1HWIA 3V6DB 1VQSA 4M94A 4ILRA 1NKEA 3ZFVA 2GNKA 1FKOB 4I6AA 3DMJA 3MEKA 5HMXA 1T05B 4K59A 5E3RA 2OD6A 2D1CA 3NNAA 3SSQA 4JI5F 4NYPA 4AUKA 3B82A 2HHVA 4QW9A 4WFNQ 1GAOA 1UP1A 4ILLA 3T9ZA 2A3JA 4E8UA 4O3RA 2VPZB 3PJXA 4ZKAA 1HQUA 1RTIA 2MZRA 4IH6A 2DIVA 4LF7F 2DHXA 3IAS9 5K8MA 1IKWA 2HHXA 3HVAA 1ZYQA 2IRYA 4FBUA 4QIFA 3PR5B 4DR4F 2RQKA 1HPZA 3SQGA 1Z1ZA 1YI2S 4IRDA 1KVIA 4ZP6A 3H59A 1SL1A 5KG1A 3DLEA 2FIUA 2YKPA 3DU5A 5KT6A 2GMHA 4X2BA 1KOOA 5FIIA 2P5VA 3Q8PB 1SJ1A 5JVHQ 1S4FA 1RTDA 2K3KA 4ZLPA 2V8VA 4KHMA 5F8MA 3ETOA 4NRTA 2PFFB 2V5HG 2HRUA 1LFWA 3J7Z5 3ITHA 2AV5A 2OPPB 2MMYA 3BR9A 4QR1A 3PFOA