3FFIB

Hiv-1 rt with pyridone non-nucleoside inhibitor
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
424
structure length
403
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYATNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pyridone Diaryl Ether Non-Nucleoside Inhibitors of HIV-1 Reverse Transcriptase
rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 116
structure length 403
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3ffiB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ffiB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ffiB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ffiB04
3PHEA 1DTQB 1RT6A 3T1AA 4DL5A 4EO6A 3RBDA 1C0TA 3BSOA 3KLEB 4ZHRB 3MF5A 2XGQA 3M9NB 4J9NA 3T5JA 1RTIB 3RB4A 1S1VA 1RTHA 3HKWA 5EWEA 1HNVB 3QO9A 3DOLB 1U09A 3H5SA 4WE1B 4Y2AA 3KJVB 2V0NA 5KFSA 3VQSA 1S0MA 3G6XA 1HQEB 3KMQA 1C0UB 1TV6A 2O5DA 1BQMA 3DRPB 3V4IA 3KNAA 3T19A 3IGVA 3FFIA 1T03B 2UVWA 2IJFA 5KG0A 4O3QA 2JEFA 3NAIA 1TKTB 3UQSA 2BE2A 1TVRB 4O44B 3MEGB 5KFBA 1QE1A 1LWFB 1S1UB 1IKXA 1S9GA 4MFBB 3D28A 1IKYB 1DTTA 2WONB 4WFXA 5KFRA 3PW4A 1REVA 3H5UA 1C1BA 2VG6A 3DLGB 3BR9A 2BANB 4TYBA 5EUHA 2W8LA 4OL8A 4EBEA 4NZ0A 2HNYA 4ZHRA 5L9XA 2ASLA 4Q8EA 3T5KA 1I6JA 4WYWA 1SV5B 2R8JA 2D3UA 4RW4B 5F9NA 2J6UA 3M8QA 3SFUA 4IR1A 1MU2A 3DOKB 4K50A 5T14A 4TYAA 5KT5A 4DL3A 1S10A 2OPPB 5J2NA 2FLNA 3QGHA 1JLEA 4QWDA 2IJNA 1LW0B 3G6VA 2YNFB 4ED8A 1BQNA 2F8EX 4MKAA 1TL1B 2R8HA 4RW8A 5J1EB 3Q8PB 1C1CA 3V6HA 4X2BA 4ECTA 1JKHB 3QIPB 4DL4A 3I0RA 4TN2A 1J5OB 4ECVA 1HMVA 2OH2A 1TKZA 4IFYA 3KK2A 2YNIA 4KBIA 4NRTA 4Y2CA 3N6MA 4QWCA 4HKQA 3RAQA 2BQ3A 3QGIA 2EC0A 2OPRA 2IC3A 1HNVA 3EZUA 3KLFB 1R0AB 1IKYA 2HMIB 1DTTB 2WONA 4KV8A 2BR0A 4ECXA 4YR3A 4FS2A 3T5LA 5J2NB 4YR2A 1FK9A 4WZQA 4ZVGA 2V4QA 4Q8FA 1N4LA 3Q8SB 1TL3A 4ZVHA 3MR5A 5CYMA 5FDLB 3V6DB 3EPGA 4RW8B 1YVFA 3CDUA 3SI8A 1OS5A 2WRMA 3KOAA 4I2QB 3UDLA 3DLKB 4J9LA 2GIRA 5HLFA 2ATLA 4URQU 4KO0B 3CDEA 4U6PA 3LAKA 4RW7B 4EYHB 2ASDA 4KE5A 2AGPA 1HPZA 5KG7A 4U7CA 2W9BA 3BSNA 3MECB 4PQUB 1RT7B 1JLCB 1RA7A 5DG8A 3MR6A 1JLQA 4IRDA 1TL1A 5J1EA 1HQUA 4DL7A 3NAHA 2XC9A 3NKYA 4IOBA 4RUCA 2R2UA 1FK9B 4IR9A 4J9PA 3M8PA 4H4OB 2B43A 3TAMB 1MMLA 5KG2A 1EP4B 1WNEA 2V9WA 4ZP8A 2IM0A 2OPRB 5KFVA 1LWEB 3DYAA 4DG1B 2C2EA 4IH7A 3KLGB 2C2RA 4RNNA 3LP2B 5J2PB 4MK7A 3H5YA 4WFYA 3ITHB 2XGPA 4IFYB 3PW7A 4KO0A 2QV6A 2ILYA 2YKMA 3M9MB 1DTQA 1RT6B 3RB0A 2DPIA 2R8KA 1JLFA 5JXSA 1S1WA 4O4GB 3BQ1A 3C6TB 1RT7A 2D41A 5HROB 2ZE2B 3DM2B 1RDRA 4R0EA 4TY8A 5KFGA 1N56A 4WXWA 4XPEA 2WTFA 2I1RA 1JXLA 5K14B 2JC0A 1RAJA 4K4ZA 2RF2B 3IG1B 3MR3A 4DL6A 2D7SA 4RNMA 4IDKA 5KFXA 2WK4A 3FFIB 2E9RX 3D5MA 4F4XA 4FS1A 3E01A 1LWEA 3DYAB 4DG1A 3QO9B 4WZMA 3OHAA 1IKXB 5C24B 1S1TB 1K1SA 1UWBA 4NLYA 1LW2B 1SUQA 3DLEB 4RW9B 4NLDA 3MEEA 4JV0A 2YKMB 3G86A 3MFIA 3DLGA 5DLGA 2BANA 5KFLA 3CJ3A 3H40A 1K1QA 2RKIB 5J2MB 1JLBB 1FKOA 5HROA 2JEJA 3CVKA 1S0OA 1S9GB 4MFBA 3BJYA 4IH6A 4KHRA 3GILA 5L1IA 1RTHB 4PUOB 4IFVB 4H54A 4RNOA 3OSNA 5KFUA 2YKNB 3QIDA 5KFNA 3KK3B 1HYSB 3ITHA 4IH5A 2JEIA 1KHVA 3MFHA 3M9OB 2DPJA 5KFEA 4NLSA 4TY9A 5KFQA 2J6SA 2AX1A 1DLOA 3RB3A 4Y34A 3BQ0A 5DLFA 2OPQA 5C25A 2FJXA 4NCGB 4ECYA 3BGRA 3DRRA 5KFYA 4NLPA 4KAIA 2OPPA 1IM4A 3OL7A 4J9QA 3KLVA 2ALZA 1D1UA 4NLGA 1ZTWA 3RBEA 1FKPB 4ZP7A 2JLEA 2WOMB 3MEDB 1N6QB 4ZP6A 1RT5A 3KK1B 3DM2A 3RB6A 3H59A 4F4ZA 2C28A 2UVVA 4LSLA 2OPSB 4LQ9A 4I2PA 5KFOA 4RNHA 1N5YA 3LANA 3ICLA 2B6AB 4KFBB 3LAMA 5CYQB 4IDKB 2QE5A 4O3OA 4QWAA 2YNIB 3Q8RB 3KHGA 3CDWA 4K4XA 4NLUA 5KFTA 4IG0B 3GV7B 2I5JA 3HVTB 2VG7A 1T05A 4F50A 3V6KA 4ID5A 5C42B 2IC3B 2E9TA 3KMSA 3BREA 3DRSA 2FVQA 4KHMA 4K4VA 2ZD1B 1BQNB 3IRXB 3FQLA 4RUAA 1RTJA 2BQRA 3KLHA 5DQIA 2R2TA 3DLKA 3OSPA 4ECZA 3CIZA 1TKZB 2BRKA 4RW6B 2XI2A 3HVAA 2IAJA 2RKIA 5J2MA 1RT5B 3KK1A 5CYMB 3V6DA 1IKVA 4TQRA 4URSA 3PW0A 5EDWA 2HNDB 4R8UA 1EETB 4ECQA 1S48A 5DGAA 2IM1A 3TVKA 2HWIA 1XR5A 3KK3A 3BGRB 1HYSA 3CJ4A 5HBMB 5I3UB 5D3GB 3CO9A 1NNDA 2W7OA 3N6NA 4R5PB 4Q45A 5C42A 1QE1B 5EWFA 4K4WA 3MECA 4PQUA 1RTIA 2HWHA 5FDLA 2V4RA 4EBCA 4EEYA 4IQXA 4LQ3A 3LP0A 1TKXA 2FVRA 5JUMA 2OPSA 4O3NA 3PVXA 4NLXA 5J2PA 4JV2A 1HQEA 4LSNB 2AGOA 4GC7A 4B3OB 5L1JA 1JLGA 1IKVB 4URGA 4K4SA 5F8LA 4EYIB 3HVTA 3FSIA 1T05B 1TQLA 3ISND 4G1QA 3N6LA 1VRTB 1LWFA 1S6QB 4H4MB 1S97A 1T94A 4O3SA 1N5YB 2FVPA 1RA6A 2B6AA 4KFBA 5CYQA 3LALA 1Z4UA 4MIAA 4MK8A 4J9MA 3KHLA 3DDKA 2VA2A 3C6UA 2FJWA 4ICLB 3ISNC 2IM3A 2ASJA 3JYTB 5KFZA 2B5JB 2VG7B 4ZPBA 3CJ2A 2YNFA 3C6TA 4WXOA 3TAMA 1S1UA 2J6TA 1RT3B 5J2QA 3PJXA 3V81A 3PJWA 4IG3A 5KFCA 4ED1A 3TQ1A 1RT2B 3G6YA 2BRLA 5KT3A 1UWBB 3BSAA 1SUQB 1C1BB 2VG6B 3KK2B 3LP2A 4YMEA 3IN5A 3H5XA 2C22A 4RU9A 1C0UA 4ZPAA 5KFJA 1NHVA 3E01B 4TLRA 4MK9A 5KG3A 4WYLA 1S1WB 4O4GA 1XR7A 1SV5A 1LW0A 1TKTA 3NBPA 1C2PA 3KLIB 4IKAA 4ECUA 4ZPCA 1S1XA 4DEZA 4NLVA 3DLEA 4J9RA 3LP0B 4M94A 4RZRA 3MEEB 2GIQA 3HHKA 1IKWA 2YKNA 3QIPA 3CWJA 2FJVA 3DMJA 2UUTA 4NLTA 4XO0A 3JYTA 4Q44A 4I7FA 4R5PA 3GIKA 1S0NA 1FKOB 1JLBA 4K4UA 5F8JA 4ECRA 1CSJA 4K4TA 3GV5B 5DQHA 1S9EA 1TKXB 2JEGA 5KFWA 3I5CA 4HYKA 1HARA 4ZMMA 3NGDA 1J5OA 2HMIA 5HLFB 1LW2A 1RT4B 4RW9A 4NLWA 3T5HA 1ZTTA 1S4FA 2BQUA 2FLLA 1RT1A 2CKWA 4XPCA 3IGNA 3NMAA 5C5JA 1HPZB 2R8IA 2W9BB 2WOMA 2W8KA 4EBDA 3MTKA 1TL3B 3E51A 1S1XB 1QAJA 5KG6A 1SH3A 1VRUA 4NCGA 3JSMA 4IG3B 1QAIA 3DRRB 4I2PB 3FDSA 2R8GA 1C1CB 3OLAA 5KT6A 2AU0A 4F4WA 4I7FB 3I0RB 1SH2A 2B5JA 3MEDA 1QUVA 4KB7A 1N6QA 3I5BA 1S1VB 2YNGB 2AQ4A 2C2DA 2ILZA 3H4DA 3LP1B 4GC6A 4ED3A 3NBPB 2ZD1A 3I0SB 3IRXA 3H2LA 5DGBA 4O3RA 3OHBA 1TV6B 3DRPA 4ED0A 1N48A 3SFGA 4QW9A 3QGGA 2VA3A 1S9FA 4YR0A 2IBKA 4O44A 2VG5A 5I42A 1VRUB 2FVCA 2W9CA 2AX0A 2XI3A 3I5AA 3KHHA 5K14A 3KLHB 4DL2A 2XWYA 3KLGA 3HVWA 3KJVA 4MH8A 1LWCA 2E9ZA 5HP1A 3CJ0A 2IAJB 4MIBA 5L1LA 1EP4A 3KLEA 3BQ2A 4FBUA 5KFPA 4RW7A 4RNFA 2BE2B 1S9EB 3BSCA 3I0SA 1T3NA 2HNZB 2WHOA 3FQKA 4O4RA 1JX4A 4TY8B 1MU2B 3DOKA 4O3PA 4IRKA 4K4YA 1HNIB 2D3ZA 1BQMB 1REVB 3V4IB 4ED2A 5KFFA 4QWEA 2YNHA 1RT1B 4MKBA 4IRCA 1S49A 1TVRA 2W9AA 2W9CB 3MEGA 1KHWA 5KG5A 5F8IA 3QZ8A 3GV8B 2AGQA 2XCPA 4PUOA 3JSMB 4ECSA 5DG7A 2HNDA 4R8UB 4H4MA 3PR5B 5C24A 3GIJA 2RF2A 1S1TA 3IG1A 4RW4A 1HMVB 2JC1A 2WCXA 3MR2A 3QLHB 1KLMA 2RDJA 3IS9A 2GC8A 5L1KA 1JLGB 1GX5A 1TP7A 4PWDB 1JLFB 3QZ7A 2VG5B 2HNZA 5I42B 1S6QA 1RT3A 1JLAB 5J2QB 2UVRA 2R2SA 2IM2A 4IFVA 5F8GA 4NLRA 4J9SA 3PZPA 2YNHB 2IMWP 4KKOA 4ICLA 1LWCB 4ZVFA 2AWZA 5EWGA 4LSNA 2W7PA 4JV1A 1JLEB 4QW8A 3DI6B 3OL8A 5KFMA 3KHRA 4LSLB 5KFDA 1RT2A 4FBTA 4G1QB 5F8HA 4ZP9A 4KSEB 1JKHA 3KLFA 1KLMB 1R0AA 2FVSA 5KG1A 5HP1B 1HNIA 4ECWA 4TXSA 4NLOA 2I5JB 3RAXA 3NL0A 2XCAA 1JLAA 5KT4A 3KLIA 5KFAA 2OPQB 1RTJB 3GYNA 4F4YA 2R2RA 1HQUB 4NRUA 3V81B 4Y3CA 4EO8A 1RTDB 4Q0BA 5KFKA 5KT7A 1ZETA 4KV8B 4YQWA 3PR4A 4J9KA 1S6PB 4QWBA 3UPFA 4ED6A 3QLHA 1RYRA 3M8PB 4H4OA 4ZPDA 1FKPA 1NHUA 1C0TB 5KG4A 3OL9A 5KT2A 2WB4A 1GX6A 3CJ5A 5F8NA 4JUZA 4TQSA 3DRSB 1DLOB 2CJQA 3GIMA 4ED7A 1JLCA 4Q43A 4I2QA 2RDIA 5C25B 1W25A 5DQGA 5DG9A 4YP3A 3IS9B 3Q8QB 3EPIA 1IKWB 3FRZA 4IG0A 3DMJB 2HAIA 3GIIA 4PWDA 1D0EA 4ZVEA 4J9OA 2UVUA 2YNGA 3GQCA 2UUWA 1JLQB 5KFHA 1XR6A 3H98A 3UR0A 3OL6A 4G3IA 1S6PA 2FLPA 4NLQA 3DOLA 4NYZA 1RYSA 4WE1A 3OLBA 3PW2A 4KKOB 4B3OA 1RT4A 3V6JA 1JIHA 4RW6A 5HBMA 5I3UA 2HNYB 3PW5A 1T03A 3DI6A 1VRTA 3LP1A 1SH0A 1EETA 4ID5B 3QYYA 2ZE2A 2ZKUA 2IA6A 3M8QB 5F9LA 3H4BA 1RTDA 4Q0BB 3C6UB 4M95A 5KFIA 4QPXA 5D3GA 5F8MA 4WFZA
chains in the Genus database with same CATH superfamily
4ZVOB 4A8WA 3T1AA 5ADZA 1SQGA 4EO6A 5E3AA 1C0TA 2BA9A 2VFRA 1YQHA 3R7SB 1EKRA 1NXIA 2NYHA 4PZVA 2XGQA 1OPZA 1RTIB 1WOPA 2JVRA 3T5JA 1XNQJ 1R6VA 1S7HA 2VBZA 1XIQA 3P45B 3DGPB 1U2CA 1YBUA 2KJWA 2C2KB 3KJVB 2V0NA 3D7SB 3WC0A 1S0MA 4B3MF 1HQEB 3KNAA 1Q5VA 2JNJA 4QJVA 3QRPA 2EEYA 3IGVA 4CO1A 3UNYA 1T03B 1VI7A 5ETTA 4O3QA 3UQSA 2AZ1A 2RUGA 3CJSA 3G6ES 4JP8A 2P6SA 3OVSA 1S1UB 2NREA 1IKXA 1V5VA 4FXWA 2MQMA 4LSZB 4WFXA 4XDCA 4AQYJ 1L5UA 2LA4A 2VFVA 3H2VE 1TK8A 1X4HA 5EUHA 2R42A 3SMZA 4OL8A 5B7WA 4NZ0A 2ASLA 2CDRB 4DBQA 3T5KA 3EICA 1SKUB 3PHTA 2B4VA 4I56A 1Y10A 1B64A 2D3UA 4RW4B 1JJCB 3CCVS 4AXIA 3MTJA 1DQ8A 2M8HA 5F0WA 1JMTA 5BR8J 3SCKE 4K50A 5KT5A 1R8BA 4DL3A 1Y9OA 2OPPB 1R31A 1K73T 1HBNB 3P4UB 4ALZA 2VICA 2XMKA 3QGHA 1XNRF 1LW0B 1DRZA 2F8EX 4MKAA 4EZ9A 2ZKTA 4DV1F 2XZDB 3Q8PB 2G2OA 4N5SA 4YDDB 4AUKA 2GMJA 3L3CA 2XMUA 4ECVA 1H0HB 4IFYA 3Q8UA 5IT0A 4KBIA 3GONA 4Y2CA 2CQGA 2NXCA 2VL1A 3I87A 1FTCA 2PFDA 3J7YU 3SSQA 4HKQA 3VAGA 4DV6F 3RAQA 3E2EA 1QD1A 4AFFA 2OPRA 3TAQA 2JOQA 1YX2A 2AEMA 1ZM4A 3OUYB 1PJ7A 2HSEB 4RR5A 4W90B 4L6V3 2BR0A 5E3CA 5LMUF 5J2NB 1NZAA 4YS2A 2OLWA 3P5BP 2CUYA 4ZLLA 1H73A 3GR0A 2XNQA 4P72A 1RTZA 5RUBA 4ZVGA 4DCJB 1T9WA 3HF5A 4Q8FA 5GVQA 1N4LA 3IA0A 3Q8SB 2ADBA 2GHVC 2DNZA 2CQIA 2XNRA 3MCOA 2F3JA 1D9AA 3O2IA 3CDUA 4J91A 1REGX 2ZDPA 2KYXA 3N9UC 5LXYA 2XLJA 5CABA 3MD1A 2HVDA 1NAQA 3BKUA 2KT5A 3PNIA 1FXLA 2GVDA 2VBYA 4X62F 4URQU 4DQPA 2DO4A 3LAKA 5HL7Q 2HHHF 1TELA 1HPZA 2AGPA 2GW8A 3BSNA 3DHXA 1UWAA 1NZ8A 2FDNA 2MLYA 2IPOB 3DFEA 1JLCB 3MCNA 1IM6A 5L8RC 3MR6A 4IRDA 1TL1A 4J9VA 3AODA 3DNCA 3PW5A 3NKYA 4L3KA 3GYXB 2R2UA 4IR9A 4IOAQ 1QVGR 3M8PA 3P8BB 1WC0A 3BBFA 4YB7A 1QDUB 5KG2A 3UVJB 2E5LJ 2UUBJ 4OZ0A 3RR7A 1WNEA 3GSIA 1J2VA 4LF2A 4NMLA 2HVIA 2IM0A 2OPRB 2ZOMA 1RBAA 2VKZG 2C2EA 3OFEA 4IH7A 2HBZB 3WX8A 1AUSL 4X64J 3LP2B 4DR7F 1HNXJ 2RT3A 4IFYB 4RJVA 4KO0A 1NSAA 1VK8A 4RWWA 2QV6A 5B0FA 3PW7A 3RB0A 1YJUA 1Z2LA 1X7VA 1TR0A 2OI2A 3QMQA 1JLFA 4DFPA 1CQNA 4OYWA 4DFJA 3BQ1A 1Y5LB 2CIMA 1RT7A 1X5TA 1EJ7L 3LQVA 3V2UC 4DN9A 3DM2B 2LECA 2AD9A 3R2CJ 1RSCA 3C19A 1RQ0A 4GRSA 1RAFB 2WSFC 1VR6A 1KKHA 3EUNA 2ZH8A 3EGNA 1WHVA 2GZOA 4OYBA 5KFXA 1BLUA 2FZCB 4P2XA 3FFIB 3LGNA 2UXDJ 3D5MA 3E01A 2H4YB 3AFGA 2KHDA 3KJFB 1F0XA 2PEBA 2E5IA 2F8HA 3LOUA 2X7IA 3DYAB 1NJYA 4JI0J 4B3RF 4WFNQ 1FX4A 3EXCX 4HACA 4X4NA 1DFDA 2VUGA 1AFIA 1UWBA 1KD1T 4RW9B 2F9JA 3BDEA 2B9EA 2BMBA 4CLKA 3J7Z5 4C8YA 2R4FA 1WORA 4LRBA 4RBUA 5K9FA 3MFIA 3D54A 4JI6F 3PIOQ 4DV7J 4LUBA 1EHWA 3CJ3A 4X4QA 2HAFA 2E1CA 2IA0A 1UKUA 1K1QA 2HVHA 4MYUA 4HTJA 1WD6A 1FKOA 4YDXA 2JEJA 1RAEB 1RLDA 3UCZP 3KG4A 4UY8T 3MGJA 4IH6A 4KHRA 3GILA 1UFKA 1RTHB 1LKZA 4H54A 2HFOA 3VGUA 4ATNA 3OSNA 2QEXS 5A0YB 3F73A 1RWXB 3I4HX 3L7UA 4DFKA 4IH5A 1F2GA 3E8OA 3POTB 5HMXA 4FVMA 1HNZJ 1HFEL 1N5VA 3UN3A 5KFEA 5ETVA 4FNIA 2XO6A 5LM7E 4DV0J 1CC7A 5KFQA 1D9FA 2J6SA 2CPDA 1XMOF 2A6OA 1TL5A 3B78A 3M1VA 4ZPVR 1FF2A 4DCPB 5IM0A 4QPTA 1T3OA 1EQ0A 2FJXA 4F8RA 4NCGB 2DNLA 2K2PA 2ZUGA 1U1RA 3BGRA 5KFYA 3I32A 1Q7LB 3OL7A 2BKOA 1I94F 1CBKA 4DLGA 4P7TA 1FKPB 4ZP7A 1N6QB 1TMMA 2W25A 4AE5A 5DO2A 1D3WA 4F4ZA 2C28A 4LSLA 4JI6J 2ZOGA 4RNHA 4Q2MA 3DRYA 5LL6d 3ICLA 3OTBA 2LXUA 2VA3A 4IDKB 6FD1A 3KHGA 1HWKA 3NNAA 3TYTA 4K4XA 4WK1A 3SXLA 4TU8A 2MZ1A 3GV7B 1EAYC 2DD8S 3OV7A 1WACA 4C8OA 1HI1A 1R6YA 2FQQB 4ID5A 5C42B 2IC3B 3O6QA 3VGTA 3RBZA 1MNEA 1WG4A 1O51A 1S77D 4K4VA 2ZD1B 3IRXB 1R8AA 4J37A 3BO4A 1R8HA 3KLHA 3GB0A 4DV6J 5T7LA 3PCOB 2YY3A 1TL7B 4ECZA 1EB0A 2FJEB 2O3DA 3PJ9A 5A8WB 1TKZB 4KGZB 3UW1A 4RW6B 1X5PA 5DDOC 3HVAA 5K20B 3PRBA 4PAAA 2UU9F 4WTOB 4TQRA 1W7WA 3I6PA 1YJVA 1OYDA 2OGUA 4ZJQA 5H9EJ 3FKBA 1IBLF 1N5QA 4DR3J 1HWUA 2IM1A 2OUGA 4JV5F 2WSEC 3Q2SC 1HYSA 3BGRB 1T9XA 4DZ6A 3FMBA 1IXKA 2VKRA 3CJ4A 5I3UB 5D3GB 3DLJA 2R7SA 1VHIA 3CO9A 3EJMA 3M2UA 2F5GA 2XZTB 4N77A 5IZHA 1U4BA 4QYZJ 1H2UX 1F3VA 4Q45A 4ER8A 2HLUA 1SJQA 1AT1B 4K4WA 2V8VA 2HLTA 2DR6A 1RTIA 1FNOA 1WEZA 1M5SA 5LJ3Y 4EBCA 2MXYA 2DH8A 2ZJQQ 3GCWP 2BKPA 4LQ3A 3CJ8A 4ANDA 1VC0A 4OYPA 3UE2A 1X31C 5J2PA 2CQ2A 2GMLA 2PGCA 4LRCA 1HQEA 1NPPA 2RHQB 4NZ6A 4QYRA 4JV2A 4LSNB 4OJGA 8ATCB 2DEIA 2WVDA 3KFWX 1JLGA 5IC4B 3LWMA 2HQ3A 5D6GA 2B8PA 1RHJB 2M3DA 2GAGC 3P5TL 3FSIA 2LXIA 1NLKL 4C97A 1VRTB 4ZS6A 3D2WA 1S6QB 1S97A 4TKTA 1T9TA 1KVKA 2JJ4D 3FVYA 1N5YB 2E5HA 1S59A 1HW8A 4MK8A 2G13A 4ED4A 3KHLA 2HYIB 2FJWA 3CSKA 1SBRA 2APOA 2H5EA 2B5JB 4ZLPA 2MKCA 3O3LA 1XC9A 1N33F 2MKSA 3C6TA 4RPFA 2G4BA 2A10A 2EK6A 1S1UA 4GO7X 3SDEB 4DR2J 3JQMA 2DNMA 4L3NA 4G1IA 1IUJA 2BW7A 4YN3B 3G6YA 2BRLA 3H20A 3ZZ0A 1F6TA 3EVMA 3RRHA 4LFBF 1NDPA 3BBCA 4RBTA 3IN5A 4KHPJ 3N01A 2PSZA 3K5OA 2K7JA 4RU9A 4QU6A 2DXFA 3MM7A 5KFJA 4TLRA 4N47A 2KT2A 1S1WB 4O4GA 2YWWA 1XR7A 3WIVA 3KKFA 3KLIB 4HHJA 3MAHA 1S1XA 2VF3A 2UV8G 4NLVA 1HA1A 2X1BA 4QU7A 3MEEB 3HHKA 2DYAA 5HVHA 4ENOA 4AL6A 3BKTA 3CWJA 2UUTA 3ILIA 3JYTA 3AD7C 5EGYA 1X4GA 2QMXA 2GJFA 4R5PA 1JLBA 1M90T 1VQ6S 4YB1P 1FRJA 4GMKA 4A8QA 2UU9J 4A4JA 4NXMJ 2GFFA 3R5CA 3SQGA 1URRA 2OFGX 7FDRA 3I5CA 1U48A 2KG1A 2YWEA 2AP6A 1VQ8S 3TP2A 5D77A 4ZMMA 3NGDA 1LW2A 3T5HA 4ZOSA 5KTQA 3QSYB 2QLFB 1S4FA 2YQ0A 2FLLA 3BS9A 5C5JA 1HPZB 1TMJA 2QIFA 3LO3A 2WOMA 3EE3A 2VB6A 3TI0A 3HULA 1XEZA 4Y2IA 2MZJA 2X3DA 1QAJA 2FUG9 1H2VZ 1N0VC 3B6BA 5KG6A 3MM8A 2P6TA 4UQGA 3DRRB 1C1CB 2RRBA 5KT6A 2AU0A 2N7YA 3HFVA 1Y3JA 3VVUA 3CF5Q 3K5MA 3AOBA 1MN7A 4H4KC 4XIUA 4KB7A 1SC1B 2DXDA 1H6KX 4DF4A 1S1VB 2YNGB 1FFGB 3CCES 3ZTRA 4U95A 1VQ7S 1PKUA 4PG4A 4W4MA 3OHBA 1YJ7A 3G4SS 3DRPA 1N48A 4QW9A 4K7QA 3OXGA 5B0AA 5HATA 2F65A 3K59A 1FA0A 2PI5A 4YR0A 5A2QY 4O44A 1HBUB 3K5LA 2RS8A 2XI3A 1FDBA 3SSSA 3Q24A 5K14A 1QVFR 1RK8A 5CQGA 1P9YA 4BC9A 1FRMA 4MKYA 4YOEA 2GHWA 2XWYA 3GJTB 3HVWA 4TVAB 3KJVA 2M8DB 1VC5A 1LWCA 2VPZB 2CRLA 5HP1A 4USVA 4B3SF 1T11A 2V9KA 3CJ0A 3I4PA 4ITSA 4MIBA 1X0PA 5DRKA 2F4VJ 1AW0A 1SL0A 2CQ1A 5EHHA 4OYXA 4YEAA 1JK9B 3NCPA 4RW7A 2GMHA 4D3GA 2MJUA 4X4RA 2GQCA 3BSCA 3I0SA 5A8KB 2OEMA 3C14B 1I5OB 3FQKA 2GS8A 4TY8B 1JX4A 2QT7A 3DOKA 1U25A 1VQYA 3I31A 1UFLA 4PWUA 5AXKA 3DC2A 2D3ZA 5HQ8A 4ED2A 2CQBA 2ZC4A 3NS5A 2G0IA 2YNHA 1RWUA 3K0JA 4MKBA 4NYOA 2EFNA 3MURP 2O67A 2W2PP 4USIA 5U47A 2W9AA 3C15A 2W9CB 5KG5A 2BM0A 4ZVQB 3CW2C 3HCXA 2XCPA 1U2FA 1BGXT 1R43A 4UZCA 4F36A 4R8UB 4H4MA 4Y2MA 1TK0A 2JWNA 1HHSA 1S1TA 2E9ZA 1A9NB 1HMVB 2IFXA 1ELOA 3QLHB 3BKFA 5HAOA 3S01A 8AT1B 3WQPA 1T9VA 2RDJA 2RRAA 3HD1A 1UVLA 3W9HA 1B3TA 2DR9A 2OKQA 4OI0A 1HBNA 1TP7A 4CLWA 1U2RA 3D1HA 2AYEA 4OX6A 4KT0C 4GKJF 1BE4A 4N7TA 1ZH5A 1XMBA 4CO5A 2IMWP 3HSDA 2HURA 4KKOA 4ZVRB 4ICLA 2FHOB 3VR1A 1LWCB 3A8EA 1F9EB 2C42A 2IDLA 3GTYX 1XNQF 1RWWB 4EZ6A 1FEHA 2OSRA 4PXDA 1JLEB 1VFJA 4BHQA 1TKDA 4K4SA 3EVWA 4YY3J 1GXTA 5K8PA 5KFMA 4LSLB 2CNLB 3TA2A 3SEOA 4G1QB 2GJIA 2ZZTA 4OYIA 2YWHA 4P9SA 4D3HA 4PPZA 4ZP9A 3KLFA 1FFWB 2FD2A 4C0HA 3QPIA 5KG1A 3W5ZA 1OO0B 2DH9A 4ECWA 2KB2A 2MQNA 4WIIA 1LK5A 2B9YA 1MG7A 4CLZA 3RAXA 1BMQB 1E6YB 5HVGA 3N5BA 1UA1A 2V2QA 4ZCKA 2ZZNA 1RWKB 3TVYA 4AT1B 3GYNA 1FCAA 5KT7A 4Y3CA 4NRUA 3V81B 2VONA 3MUTP 3TRGA 3PR4A 4KJIA 4HTIA 1VS3A 2W4DA 2MJNA 2MMYA 3BGFA 3QLHA 3OXFA 4ED6A 1RYRA 2DT9A 1Q7YT 3PIPQ 2CZVC 4PQAA 1FKPA 1SQFA 5B0BA 5IQ6A 3FEZA 1GX6A 4A46A 4J90A 1U8SA 1CULA 1NH8A 1RAGB 4JUZA 4JI0F 1WG1A 2Y1RI 2VC0A 5F3TA 2IRXA 3W9JA 1K44A 1JLCA 3GIMA 4I2QA 4WK3A 3C2PA 3G9CA 1TUWA 5CA5A 4WKYA 3D0IE 5DG9A 1UVKA 3CTRA 2ZZMA 2U2FA 1RXOB 3FRZA 3TEGA 2EWHA 3DMJB 2JX2A 2HAIA 3ETMA 5A6WA 3MAAA 2R7RA 2QL9B 4PWDA 2KKHA 1OYEA 4CIOA 4CTAB 4WBFA 2OEKA 3HHLB 1V6HA 2CQCA 2VH7A 2RVJA 4ZVPB 4NYZA 4WE1A 3PW2A 1XTZA 4B3OA 1RT4A 2C2ZB 1ZBTA 2QA1A 5SUHA 3CCRS 1IR0A 2HNYB 2BABA 2MQPA 5CD4A 3FZ2A 3GCXP 2AT1B 1JJHA 2OAUA 3NCRA 4DR6J 3LP1A 4YUDA 2YXLA 3HJVA 1K8AT 1EETA 1IBKF 3TX8A 4AXJA 2ZE2A 2ZKUA 2IA6A 2O1PA 3H4BA 2VASA 3TJ9A 2F63A 1RI7A 1HI0P 5GMDA 3K8WA 1PAUB 4ED5A 4DFMA 2H1YA 2AYBA 4WFZA 3PHEA 2V6AA 4O23A 3ZNJ1 4DV3J 1XBWA 2EK1A 3GJSB 3HDSA 3KLEB 3MF5A 2YX7A 4J9NA 3RB4A 2EBGA 2W2MP 2WB1D 5GMKa 5H9EK 2AIRB 1S0VA 4ILMA 5EWEA 4B3SJ 2JEGA 3DOLB 1U09A 3H5SA 4HACB 5IT4A 3VQSA 3DXSX 1Q79A 4DPXA 4LFAF 1C0UB 1TV6A 1BQMA 3V4IA 3VAFA 4HHUA 3SIPB 5IXUA 3FFIA 3NGKA 3W62A 4UF4A 3G82A 3U1MA 2IJFA 2NPFA 4DPOA 3T1HF 1M5HA 2BOAA 3HT0A 2BE2A 3N28A 2XB2D 1JNZB 1E6VB 4OHXA 1H3DA 3PX4A 2WONB 1YDLA 1AFJA 3O44A 3JSYA 1RWOB 1U0SA 2I9SA 4OYZA 2A2DA 4JI5F 2VQFJ 1VQ9S 4QQBA 3TNVA 2VQEJ 1X4DA 1NBEB 2AW0A 1WOOA 1AA1B 1BXNA 1ACMB 1ZA1B 2HNYA 1CQMA 3ONQA 3CCJS 4Q8EA 3SDEA 4F25A 2FJDB 3TUJC 4YHHJ 3V5RA 5IM0B 3UCUP 4OZ1A 2UV8A 3O1LA 2E5JA 2V2ZA 1R8CA 4QIWD 1KEKA 1TZ0A 1MU2A 2C3MA 3BGOP 4RLEA 2DHGA 5T14A 2Y8YA 4C8KA 2IRYA 1S10A 3M8SA 3M8YA 1HNXF 2LU1A 2NXUA 1WHYA 4LRFA 1LFWA 1N34J 2DTJA 4L74A 3BGLA 3R5BA 5BJRA 4QWDA 3G6VA 2B4PA 1BQNA 1U02A 3AXMA 2MKJA 4FKYA 3CJRA 4LRAA 2HQFA 2XS5A 1VBXA 3EDRB 2B7CB 3MMCA 1SB6A 4ZN1A 3VAHA 3QIPB 1HWJA 3I0RA 4TN2A 4DL4A 4F2RA 2EFVA 4ETZA 4UT4A 1YIJS 2OH2A 4L73A 4DWIA 4HEA9 3KK2A 3I9ZA 1IJEB 2YNIA 1HWIA 1MWZA 1NH7A 1NMEB 4NRTA 3T9ZA 3N6MA 5A76A 5DDPC 3G82B 2UZAA 4QWCA 2YH0A 3J7AN 3MM6B 3FJ2A 3QGIA 2DGVA 2QLBB 4KGKA 2IC3A 3KUHA 3DGPA 4DR1F 1NRKA 4P2SA 4C8ZA 1JB0C 2W7AA 2IVFB 3PXGa 2WONA 4FN5A 1RUSA 4KV8A 2B3TB 4E2FB 2OP5A 4XAKA 4YR3A 4FS2A 2MKIA 4X62J 3V4MA 1FK9A 4C11A 1SJ4P 1HBUA 3J81U 4WZQA 4DR1J 1NKBA 4ZVSB 4HT7A 3S6EA 2FHKA 1WKJA 4NA2A 3Q8RB 3US5A 4I67A 3T41A 2RS2A 2LQ9A 3UDLA 4UY85 1UP1A 2AJFE 4ETXA 2QRRA 2POKA 2GIRA 5HLFA 3G87A 1WC3A 2ATLA 1B4SA 4C2MA 3CDEA 1W2BR 4U6PA 1PAEX 3AB2B 5D4OA 4RW7B 1YI2S 2UUAF 2EXUA 4X4PA 3HO1A 4A8KA 2OD6A 2OMOA 1J5EJ 2G0JA 3ENWA 4OI1A 1XMOJ 1S72S 3H42A 2ZBCA 2ZH5A 4WWSA 1KOOA 3NAHA 1SC6A 1XERA 2JH3A 3SCJE 4RUCA 2XC9A 2ZH6A 3GZ7A 1OY6A 4J9UE 3FEXB 1FI4A 5H1SV 5EN1A 2IMOA 4H4OB 1MMLA 4LFAJ 4CZCA 2BYCA 2F40A 2XYHB 2V9WA 4AYBD 3CO0P 2V67A 3IBWA 5KFVA 3ZC4A 2AZ3A 1LWEB 4DG1B 1UZDA 1X4AA 1SL1A 4N41A 1N32F 3C14A 2VZ9A 3KLGB 4DV4J 1SCJB 5J2PB 2MZRA 6FDRA 3ITHB 2IVMA 2HHUA 1KC8T 2CJ9A 2YKMA 1DTQA 1RT6B 1DQAA 3AQPA 3J81j 3MPWA 1WKLA 3UDCA 3N5FA 3H2UB 2QJ3A 2XYGB 5HROB 3A12A 1FE4A 4W98A 1HBMA 4R0EA 1ZZNA 2VPXB 4A8FA 4TY8A 2C2MB 3MD3A 5KFGA 4XPEA 2KRBA 5IWAF 2WTFA 1TK5A 2C3OA 1RAJA 2D1CA 2NLWA 3IG1B 2Q6BA 3PEJA 5BYSA 4AL7A 1O5JA 1RADB 4QOTA 2D7SA 2KT3A 1N5TA 2J9DA 4X66J 2DHHA 2ZH4A 4HVZA 1FRLA 3JXOA 2WK4A 2VQFF 3KG1A 4IUFA 1CJKB 4F4XA 4WU3A 3AT1B 3Q2TC 1T95A 5ITHA 1B7YB 4WCEQ 1CJUB 2BOPA 2RQ4A 4WZMA 1U7LA 1MWYA 1GQEA 1S1TB 4NLDA 3T1YJ 1SUQA 3OPKA 2GAHC 4JV0A 3IXQA 3DLGA 3L9ZA 3H40A 4U8VA 4F02A 2X1AA 1FVQA 2RKIB 2QN6B 1JLBB 1BWVA 2A18A 4X64F 1N36J 4OMFG 1S9GB 2QMWA 1KTQA 1RU1A 5HMZA 4IYQA 2B9WA 1U1PA 4RNOA 4QIEA 2GIFA 2RU3A 3QIDA 1UVMA 2UXDF 2HHQA 5T41A 1K0TA 1KHVA 3M9OB 2UUBF 2YX1A 3TJAA 3UDEA 1FDAA 5CCMA 2DPJA 1UCNA 4TY9A 4ELTA 4CLSA 2LYVA 2MQQA 3P96A 2PE8A 1M1KT 4MJKA 1GH8A 1VQ4S 3TANA 5C25A 4X4TA 1FE0A 1VQ5S 2XSFA 1KFDA 1K9MT 4JYAF 5AJ3J 2H9ZA 4BBYA 3DRRA 1SJ1A 4RUBA 4WP9A 4NLPA 4LMZA 4J9QA 2LVWA 4C0BA 2MZSA 4R25A 1FEEA 2DBBA 1IBCB 2AJ1A 2JLEA 3RBEA 2WOMB 2GQQA 4FP9A 1A6LA 1LNQA 2VHGA 3KK1B 2XYPB 3DM2A 1KQKA 4CLFA 3RB6A 1AUDA 1Y5IB 3DU6A 1U47A 3U27A 1DY3A 4O3OA 2W4CA 2EG2A 1R3NA 2W2OP 2FTRA 4NLUA 2YKQA 2HIQA 1L3VA 3TZYA 2I5JA 3HVTB 2VG7A 1NUEA 1RLCL 2V63A 4ILRA 4A8OA 3V6KA 4L75A 2E9TA 2VPWB 1Q5YA 2RMLA 4HI2A 4KHMA 1NB2A 3AAWB 2PC6A 3MM5B 2BQRA 4USMA 2R2TA 3DLKA 3OSPA 2CJKA 2VIHA 1QSYA 4Y6IA 2W2QP 2RKIA 1RT5B 2DNGA 3V6DA 1IKVA 4LIWA 4URSA 3PW0A 2WW4A 2FLOA 4M5MA 2HNDB 1OPIA 1EX8A 1EETB 2CJAA 4FPRA 4XK8C 2HWIA 3DKDA 3ISZA 2BEFA 2RILA 3JTOA 5GAGU 1Y5NB 4FF3A 1PSDA 4NCBA 1WHWA 4QR2A 4FPIA 2HFNA 2YVSA 2CZ9A 3N6NA 5THWA 3TAPA 2L9DA 1FWPA 2HKEA 2YPYA 3HFZB 4OJ3A 1VYAA 4CLPA 5DM7Q 1YJ9S 1OQ6A 4PQUA 2BJ8A 2ZVIA 2FGOA 3T6JA 2ZWPA 5FLXU 5A8KA 2E29A 5A8RA 4IQXA 1YRTA 1X5OA 3D3BJ 3EX7B 4DV2J 4O3NA 4UTGA 4JI4F 1OMSA 3S1TA 4ELUA 2CVIA 2IYIA 3VF0B 2YPZA 2HFZA 3OTDA 4M5GA 2DR8A 2DNYA 4URGA 5HANA 1WHXA 2DRDA 3BO2A 2G2YA 4DV7F 3J7YI 2HS4A 5C2CA 5CCLA 3CJTA 1IR2A 1E6VA 1I51B 3H90A 1TUVA 2GVZA 3KDOA 5CHCB 4ES2A 4ILLA 4Z2XA 4IO9Q 3MM5A 1Q8KA 4WP3A 2HK2A 4J9MA 1BWEA 2L08A 2VA2A 4OJHA 2PIIA 1QAYA 3B54A 3ISNC 4B3RJ 3TZZA 2HK3A 2DY1A 1C4CA 1FDDA 3CJ2A 2QL7B 3JSBA 5D78A 2UXBF 3TAMA 1RAIB 2DIVA 4PXEA 2HHHJ 1B7FA 4QR1A 4WIQA 3UN2A 1DQ9A 3PJWA 1PILA 3EWGA 3PJXA 3GR1A 4ZK7M 4E8UA 3D3CJ 1QTMA 1U1MA 2GO9A 3DRXA 3BSAA 1PJ5A 2H54B 1KBRA 2VG6B 5J1PA 1WC5A 2C22A 1VOMA 2KH9A 4OIXA 3VALA 1PBUA 5KG3A 4X4SA 4CT8A 4WYLA 2ZDOA 3T9NA 3QFHA 3AB4B 3RU0A 1TKTA 3VGVA 1HD1A 1C2PA 3RRGA 4IKAA 1S6UA 5HSPA 4DEZA 1L3TA 3DLEA 3OTOF 4J9RA 2LXFA 4JI2F 4RZRA 3BGUA 1HW9A 1IKWA 2YKNA 1A7GE 3QIPA 1UMJA 2M4MA 3FZBA 4C8NA 2ZH2A 4NLTA 3GE9A 4XO0A 2BXJA 1U49A 1S0NA 3MOJB 2DXEA 1VK3A 1UW9A 1KONA 1WTBA 5DQHA 1S9EA 4UOFA 5IV4A 2Z4PA 4QBUA 2CG8A 3PYGA 3CJKA 4RW9A 4NLWA 5K8OA 4DSKA 1H74A 2EFQA 2JL9A 2BZ2A 3Q0AA 1RT1A 2BQUA 3NMAA 1FXRA 3MHYA 4Y65A 3JSRA 3MTKA 4DUZJ 1TL3B 4CWBA 1S1XB 4CTAA 3ZZRA 3W61A 2FC8A 3IR7B 5L39A 3ZZOA 3BH7B 2H3EB 5HN0A 3OLAA 4I7FB 1SH2A 3CCMS 2ZM6J 3KDNA 3TVZA 2B5JA 1DAXA 1QUVA 5D15A 3I82A 2XY5A 1HBOA 5AXNA 4DR5F 4ED3A 2VDIA 2HRUA 1XMQJ 2YKAA 2WVFA 4I4BA 2BE7D 2HPUA 2YKPA 4ZIVA 5AE2A 2M88A 4LFCF 4O3RA 3VAJA 2PEHA 5ETNA 3RYLA 3QGGA 3QJPA 2J7UA 2LQJA 1S9FA 4U7UK 4O0NA 3AA9A 3HVRA 4LBHA 2IRUA 4DV0F 5I42A 4LVNP 2ZHAA 2FVCA 2DGWA 4NI2A 1VQMS 2ACMA 4K59A 1RCOB 2HQGA 5D0EA 4RUHA 3J7A1 4M63A 3MAQA 3KLGA 3W60A 2PA3A 2HBQB 5JJBA 5I4MA 2XTJP 3PKYA 4B3MJ 2CJYB 4OYMA 1S5ZA 2IAJB 3MEKA 4WU2A 1FT8A 3K5PA 5KAKA 2L41A 3X1LB 3KLEA 2ZBRA 4FBUA 1PBAA 4NCAA 3QJLA 3AD9C 3ZTQA 2BE2B 1S9EB 1JQGA 2QLXA 1T3NA 5IFMA 2AJ4A 1Y3KA 3KNGA 5D4NA 4DSJA 2CPHA 3D6HB 4K8RA 4O3PA 3VGSA 1BQMB 3V4IB 5D0RA 3A3NB 2JDJA 2XBPA 4KTQA 5EX0A 1VQNS 4CO3A 4B9UA 3OBIA 5GAGI 2MQ8A 1N52B 5DM6Q 1N8RT 5F8IA 3GV8B 1VBYA 2JFDA 3PX6A 3M05A 2XY7A 5DG7A 3PR5B 3IG1A 1X5SA 2WCXA 4RW4A 1NDCA 5HMWA 1D9DA 2R7VA 1CJVA 4WPAA 3IS9A 2E1PA 1UJ5A 2K8GA 2E7WA 2I0XA 4PXBA 5E0OA 5G0RB 2GC8A 5CAAA 3PYFA 2DGTA 2FZKB 3CD6S 5BYRA 4KGMA 1FJGJ 5CZVA 3R97A 2Q79A 2VDHA 3PFEA 2ACYA 1U1LA 1VRQC 1RT3A 2CYYA 5GMEA 1Q82T 4OLOA 2IJRA 2UVRA 3JTNA 2R2SA 1A0OB 3TJ8A 2IM2A 2DNHA 1LWXA 4KH0B 5SZTA 2ZJRQ 2CPZA 1WELA 2YNHB 2NZCA 5MAOA 5I3PA 3PO5A 5BYQA 5HQLA 4LBIA 2AKWB 2BBEA 5C2GA 4DPWA 3FSXA 4F2SA 3KWMA 2I6WA 2XSJB 2Z30B 3HI9A 3OL8A 1MWQA 1WG5A 2VV5A 5KFDA 3I55S 2VFUA 3SSRA 4B08A 4KSEB 3M6XA 1KLMB 2LQBA 2ZHBA 3W5YA 5HP1B 4H4KA 2I5JB 1Q78A 5F41A 3MM9B 3NL0A 4WFAQ 1JLAA 1TAUA 1QJHA 2RHSB 1XMQF 2HHXA 5KFAA 2OPQB 2R2RA 1HQUB 4LRDA 2KXHA 3HD2A 4G1PA 3VAIA 3JTPA 4J9KA 3CB4A 2BW2A 2Z2LA 2WW8A 4NASA 1VBKA 2MKKA 3NNCA 3A13A 3Q8VA 4O0IA 4J5OA 5KG4A 4ZVTB 4FDFA 3JB9k 1KVIA 1UEKA 2CADA 2DNRA 4C0OC 3ET6A 3DRSB 1DLOB 1GTEA 2CJQA 5L46A 4Q43A 5LMUJ 2NSBA 2E7VA 3C66A 2EKYA 3FCHA 4UZBA 3IS9B 3EMTA 2FPHX 2K1RA 4U9RA 4EUVA 3Q8QB 3EPIA 1NDLA 3D1OA 2I2YA 3BDPA 2XWXA 1CVJA 1NM2A 1CS4A 1D0EA 1VQLS 1OY8A 3B4MA 3D4JA 1KN6A 4OX9J 2UVUA 2DNOA 2B8QA 2Z57B 1B99A 2EBEA 2C2NA 1XR6A 3M8ZA 1NK5A 2DCUB 4G3IA 2DITA 2KI2A 3CE8A 3CXCR 1RYSA 3QBCA 4KKOB 3F0NA 4KPCA 1RISA 1WF2A 4F0KA 4DV1J 2QA2A 2RD5C 5HBMA 1T7PA 2Q1LA 3TW0A 3D6MB 4WP8A 1T03A 2J0QD 2F1FA 2DNPA 2E44A 1PC5A 1E6YA 1VRTA 1FFSB 1TU0B 5B0GA 3UD3P 1RWNB 2ZC3A 2ERRA 2MB0B 3QYYA 3NY0A 1WI6A 1HBMB 4RX6A 5FIIA 1FRHA 1ICEB 2MHEA 3OFGA 3THVA 2Z2ZA 4I1TA 2AMCB 4M95A 5DETA 4ECSA 2R8GA 1KNZA 5F8MA 1YRXA 1DTQB 1RT6A 2KXFA 3AJDA 2KFNA 4DL5A 5IQQA 3RBDA 3C16A 4ZHRB 4JB8B 3M9NB 4PCQA 4DR7J 4FYVB 4FYYB 5AXMA 3OVAA 3M8RA 3VQTA 1ZZFA 2LFVA 3HKWA 2KHCA 1HNVB 2V69A 4P7VA 4DR2F 2VPYB 4DX6A 4WE1B 5KFSA 4Z7CA 3G6XA 1QLNA 4CH1A 2BM1A 3S7RA 2O5DA 3K58A 1MLAA 3K89A 5DZ7A 2DGOA 3B4DA 3AA8A 3T19A 2KL8A 1GMWD 1RKIA 2JRSA 4FYWB 2BKNA 1S79A 2GGPA 3ZZTA 3T1YF 3NAIA 1TKTB 2J0WA 3MEGB 3GP9A 4BWMA 1QE1A 1LWFB 1RWPB 3UDVA 4CH7A 1S9GA 3D28A 1IKYB 1FRXA 1F2HA 2Z58B 5KFRA 2WZ1A 2RAQA 3PW4A 1HR0J 3H5UA 3DCAA 2X3GA 3SZ2A 2UP1A 3QT8A 2VG6A 4TYBA 3L09A 4NL5A 4CI0B 4DUTA 4NA1A 2W8LA 4EBEA 1VIOA 2DISA 3POTA 2HZVA 1G3OA 5L9XA 2J5AA 5K8NA 4OZ5A 4K4ZA 4ZCLA 1YJNS 2KZMA 4Y2KA 3VZHA 1HI8A 4WYWA 5ETKA 1UJ4A 3FEYB 2KJVA 2KFZA 5F9NA 3MPDA 2J6UA 3SFUA 5HVFA 1UA0A 4IR1A 3DOKB 4X4VA 1F1BB 1KR4A 4USUA 2FJAB 2J9DE 3PV8A 4CT9A 3DLBA 5J2NA 2XEXA 2FLNA 4DUZF 1UPMB 3FSYA 1K0VA 4HH0A 5AJ3F 2IJNA 2YNFB 1QY7A 3RJMB 4ED8A 2F4VF 1SKSA 4RW8A 5J1EB 3NXZA 4KIAA 1WI8A 1OSDA 3HSJA 1C1CA 2K3IA 4PR6A 3V6HA 5HJXA 3G8SA 4ECTA 2MLZA 2K06A 3G8QA 3MCMA 1HMVA 1S57A 5HJYA 1TKZA 2R7QA 3EYZA 4L76A 5GAEI 1X4FA 3O8WA 1G6BA 3GSDA 4M5IA 4V19X 3J7ZT 2P2CB 4JI1J 2EC0A 3CCZA 3C3LA 1VISA 1SVDA 5GADI 1X9WA 1J5EF 5M2PA 1HIYA 3EZUA 2AEJA 1R0AB 2MEWA 4OI6A 1WF1A 4EMDA 2HMIB 3PEHA 4ECXA 1ZA2B 2V8GA 3GIRA 3T5LA 3A3PB 1TL7A 1TFYA 3OR2A 4YR2A 3OW2R 1GXUA 1HLWA 2RIJA 2GGPB 2FB0A 2V4QA 3QGPA 1UTAA 1TL3A 2V50A 3MR5A 3V6DB 5FDLB 3OFHA 2DNKA 3GG1A 1YVFA 2EI5A 1S76D 4K2JA 3SI8A 1F5CA 1WJ9A 1WC1A 2WRMA 1UL3A 3LUYA 5L38A 4KHPF 4F67A 3KOAA 4LF6F 1WTFA 3DLKB 1CC8A 1OIAA 3K17A 4N8NA 3M30A 4CLUA 4A8MP 2Q43A 3QRRA 3RW7A 4KO0B 2B4UA 1PYTA 4DPTA 4OHZA 4KE5A 4AQYF 3M7VA 5KG7A 2W9BA 4IQMA 3OUYA 2H65B 4PQUB 3CPWR 1RT7B 1RA7A 1H38A 1JLQA 1FVSA 2MZQA 2XHCA 4DL7A 5LJ5Y 5DDQC 3ILOA 2AHOB 4IOBA 3CJQA 4A48A 4FF1A 2VBWA 3D67A 4HLBA 1FK9B 4ZKAA 4PYAA 2B43A 3W65A 2CJBA 2QLWA 5DZ6A 1WDTA 4NE9C 1YJWS 1ROFA 1P9QC 4C6AA 3TR5A 4OX7A 2WVEA 4USKA 3DYAA 3TA0A 1B0VA 4HHHA 4ANCA 5IC6B 3UCGA 2R7XA 3H5YA 4LVOP 5ETRA 2DKOB 2LP4A 5FLXY 3M9MB 3G96A 1S1WA 4O4GB 1F3FA 1Q53A 2JSXA 2V8PA 1KWMA 1RHKB 4HDHA 3ZZPA 1IQTA 3C6TB 1D8YA 2D41A 4B9MA 1W2IA 5LSRA 3VAKA 1Q16B 2C3UA 1TFWA 2IHR1 4MAKA 2DCLA 4Z7YA 1JXLA 4RU2A 1NKCA 2KRRA 3LF0A 5E7OB 3MR3A 4DL6A 2J0SD 2C3YA 3K2YA 4NA3A 3DLLQ 3OR2B 2ZH7A 2E9RX 4I6WA 4DJBA 2RUSA 3GLJA 4FS1A 1N33J 2D69A 4LF1A 1UAWA 1R7IA 1LV5A 2CWXA 3QO9B 2LA6A 4K2XA 4OI2A 3Q22A 5C24B 1KOHA 1K1SA 2J7KA 2RU9A 4NLYA 4BWJA 2QYCA 2EKNA 2Z0GA 4NX9A 3MEEA 1N88A 3R3TA 4KY3A 3EZ5A 1JWWA 1HNWJ 5DLGA 2BANA 3BN7A 5KFLA 3DXBA 2O01C 2P8IA 3DHWC 2H48B 1DJ0A 4QR0A 1YITS 2VOOA 2VBXA 2DNQA 3BZQA 2KZZA 5J2MB 2DHXA 3I9V9 5HROA 3IO1A 3ENQA 4NPOA 4DV4F 1S0OA 3KUGA 2XS7A 4MFBA 4C8LA 5L1IA 3CD7A 4LF8J 4PUOB 4DL0C 3HXMA 2HVEA 3N4WA 5KFNA 2BJ9A 1HHTP 1HQ2A 2CQ0A 3MZIA 3KK3B 4GVBB 3ITHA 3R6GB 1FRKA 3MFHA 4X4UA 2R9LA 2KM8B 1GEHA 3L95X 3PM9A 3M6WA 2V2VA 3RUBL 2OHDA 1WEXA 1WWHA 3IFEA 1YHQS 3RRKA 2AX1A 3RB3A 4Y34A 3BQ0A 2GX8A 3PACA 5DLFA 2OPQA 1RHUB 2ROGA 4ECYA 2ZBQA 1AZSA 1GMWA 5KOWA 4WJBA 3R2DJ 2OPPA 1IM4A 2QO3A 3MAAB 5MLCV 3KLVA 4DR5J 3OVBA 4NLGA 1FRIA 1ZTWA 4JI8J 3AH6A 4F26A 4USHA 4YB5A 2D74B 3SYZA 2BJEA 1GNKA 3MMBA 1VQOS 1LFPA 1YZ6A 2EW9A 2OJ3A 5M2RA 2CQDA 3H59A 2C2OB 4KC5A 3GYGA 3Q89A 5KFOA 2DR7A 3LANA 1ZAXA 4KFBB 4M5HA 3RAMA 4CM0A 1SQEA 4MYTA 3HZGA 5H9FK 4XTTA 2MYFA 1VQPS 5JVHQ 2MDAA 2VFTA 3LPYA 3KMSA 3BREA 3DRSA 3FQLA 1OWXA 1FDNA 1QUPA 3BYPA 4RUAA 1NK7A 4LJMA 3ZFVA 2BJDA 4HDGA 1IWAA 3GPAA 3BPDA 1ZS6A 3CIZA 1SIZA 2V4JA 4TU7A 1YJTA 5J2MA 5CYMB 2BJ7A 2WSCC 4UUXA 4DXLA 1CEZA 4FYXB 5EDWA 1GMUA 2B9XA 2PT0A 4R8UA 3RR8A 2HHTA 2Y0BB 5ETPA 4ECQA 4ID8A 4DQQA 1KS2A 1FWKA 3PG9A 3DOMB 2ZEJA 4CLLA 2PDAA 4FF4A 4GVBA 3SBMA 3CCSS 1NJZA 2AYGA 3DDNA 1KSPA 4DV3F 5HBMB 2VFSA 1NNDA 4U7UD 3W3SA 3UD5A 3VVTA 1TUGB 5C42A 2OEJA 3PO4A 1QE1B 2E1AA 5EWFA 1HNZF 2UUCJ 3MECA 4ES3A 4I6YA 5D4LA 4UOGA 2MGZA 2HWHA 3BH6B 2V4RA 4EEYA 4DN0A 3LP0A 1TKXA 3A8IA 5BXIA 1AZSB 2N4DA 5JUMA 2XMAA 4NLXA 4LF8F 2VD3A 5LOQA 2YWGA 1L3KA 2AGOA 3H7HB 1NSPA 1V3RA 3N0VA 2UXBJ 1LXNA 1D8ZA 3HVTA 3D68A 3MMBB 2GJ2A 2QA4S 1EZZB 2J0XA 3FBBA 4G1QA 1NO8A 3N6LA 1LWFA 2JHEA 4HT5A 5HQMA 1WEYA 4H4MB 1VCTA 1HKAA 1NEEA 2V5HG 4EWTA 4ZLJA 2XLIA 1IBMJ 2FVPA 1RA6A 4KFBA 1Z4UA 2Y1IA 3LALA 1Q1KA 3W7BA 4CP5A 4FXVA 3Q86A 3DDKA 3C6UA 4C8MA 2XY6A 3CD5A 4ICLB 2IM3A 2FC9A 1WUUA 5AT1B 3JYTB 2VG7B 4ZPBA 1KFSA 1PJ6A 1Y7PA 2DNNA 2JZ5A 2HRTA 4PPDA 4WXOA 3FCVA 1V3ZA 3UD4P 1RT3B 2WBRA 3V81A 2Y1LB 4IG3A 2K7KA 4OZ3A 3R8YA 4PG8A 3TQ1A 3BR8A 4F0HA 1F60B 1UPPA 1Q8LA 1CJTB 2HS3A 2MTLA 2O66A 2CQPA 2F9DA 1C1BB 2I8EA 3KK2B 3LP2A 2CPIA 2XMVA 3PTWA 3H5XA 4PRFA 4YB6A 3K7RA 3B8HA 1VLYA 3GWCA 2CXEA 2ZBIA 3QAUA 4M5DB 3TUIC 3W8GA 1FJEB 4J7CA 4WFBQ 2HWTA 1CULB 3QNWB 3BPSP 4Y28C 1SV5A 5DS7A 2JLFA 4K0KJ 2KTQA 4FF2A 4ZPCA 3O5TB 3JAMU 1O8BA 3LP0B 4BCAA 4M94A 2DGXA 3TUZC 2GIQA 3VWSA 2HFUA 4LT6A 2QTWA 3ENVA 2FJVA 4I64A 2LEPA 1UEVA 4DSIA 4Q44A 3R1LA 2R7TA 5F8JA 1BY9A 3QSIA 1FXDA 2ZHOA 1CSJA 3LH2S 1X4BA 3GV5B 1TKXB 2G2ZA 3NOCA 5KFWA 4HYKA 2KVQE 3R9LA 1HARA 1J5OA 2HMIA 5HLFB 2QMUB 1RT4B 1KTVA 2RQMA 4ZA1A 1XQIA 5AXLA 3IP0A 2D3O1 2WVCA 1YBTA 1ZTTA 4RKUC 4BDPA 2CKWA 4XPCA 1NHKL 3IGNA 2W9BB 2W8KA 2M52A 2MY7A 4EBDA 4B9TA 1WF0A 4DLEA 3KYLA 3ET6B 1SH3A 1VRUA 5B09A 2HIYA 3JSMA 4Q5VA 4IG3B 2MQLA 3D1QA 1QAIA 4I2PB 2DIUA 3X3UA 4EU0A 4ZCMA 3GMGA 5CD4H 1IJFB 4UW2A 1VIXA 4YHHF 2D9PA 4M5DA 3MEDA 2HZCA 1N6QA 3I5BA 3AD8C 4USWA 4V19J 3NMRA 3DLHA 1SPBP 2C2DA 2K3KA 2ILZA 1UFWA 1W26A 3VHQA 3LP1B 2DGSA 5HO4A 5GAHU 4LF7J 2IBOA 2ZD1A 3I0SB 3IRXA 5DGBA 2OTJS 2RB7A 4ED0A 2NUHA 2EVZA 1B70B 3DN9A 1YK9A 1TTHB 1BD6A 4ANEA 4C7QA 1UVIA 2VG5A 1OQ3A 4NXNJ 2P9EA 1EKSA 3MM8B 3C15B 2AX0A 3EM1A 3I5AA 2W9CA 1IBMF 1F5AA 1QTNB 2N7CA 2QSFA 3WIUA 4DL2A 1T9UA 1ZAVA 1NK8A 4ZITA 4DSEA 2PO4A 1XWLA 2HRYA 4MH8A 2KVIA 1V5IB 2J8SA 1CJKA 3FBEA 3ZO7A 2QG9B 3GU0A 1V9OA 3M2UB 1EP4A 3KJQB 4ZN3A 5L1LA 3C16B 1Y0HA 4ZIWA 4RNFA 5LSLA 1M1GA 3CDBA 1VMBA 1YKWA 4HH1A 4P71A 4USJC 2HNZB 2WHOA 4UUWA 4M5JA 1UEUA 4OI4A 2RQCA 4K4YA 1YJRA 2HEKA 2E1MC 5KFFA 5JVGQ 1RT1B 3ADAC 4PG5A 3RBXA 1RJJA 2SXLA 3W8PA 3LGMA 5F3ZA 1VQKS 4CCHA 3LA0A 3K8VA 1KHWA 4CH0S 2AGQA 3HLUA 1YSJA 5DJBA 4PUOA 3JSMB 5ETQA 3W1YC 5E41A 5AE3A 4LF7F 3NRBA 4QCLA 3GIJA 3CD0A 5C24A 2XS2A 2DEJA 2JC1A 2ZJPQ 1P27B 4DX8H 3THPA 4LREA 2A0FB 1NK6A 4BC7A 1JLGB 2LCWA 2JLGA 3K5NA 2D3OR 4KH1B 2BV3A 2H51B 3ULHA 1SKRA 3NS6A 2MSTA 1JLFB 1GTHA 2B7BB 2NYIA 2Z2YB 4P6QA 3U02A 5I42B 4CO0A 5HMYA 3QZ7A 5J2QB 1GK8A 5ETLA 3GFHA 2VC1A 1APSA 3MMJA 3EGZA 1Z2ZA 1RWVB 2P9GA 2EG1A 3A1YG 4IFVA 1M1HA 4KPYA 3W64A 4KQZA 3A8KA 3F41A 5F0UA 4ZVFA 4DS5A 2W7PA 4LSNA 4OJ1A 3KTQA 4JV1A 5I3QA 3BBBA 3BV8A 4WF9Q 3NCQA 4QW8A 3TEHB 2YTCA 3DI6B 2QFIA 3JQKA 4NEYA 1RT2A 1P1LA 1K47A 3TZWA 5FJ4A 4TNOA 4A8XA 4HL9A 4G65A 2FVSA 2MKHA 2B4OA 4JI3F 3OR1B 4DV5F 2J76E 3UFCX 4MTPA 1FX2A 3CMQA 5CZXA 4B17A 2ZOFA 3BN4A 4B9LA 3RGIA 5EX3A 5K8MA 1AXQA 4C11B 1Q0NA 4OZ2A 3I56S 4FYDA 3Q83A 2BACA 5KT4A 2HHVA 1QSLA 4F4YA 4F4KA 4P2MA 4Q0BA 1Z1ZA 3ZZZA 1FO1A 2HW3A 4KV8B 2B56A 3L7PA 1S6PB 3JQJA 3J80Y 3CUNA 3AJ1A 4QWBA 3IAS9 1PYOB 3UPFA 1N54B 4DSLA 2ZUAA 3M8PB 1LXJA 2MHNA 3J81Y 1H72C 2HVZA 1F9FA 3OXLA 1C0TB 2BJ3A 4EK2A 2GCFA 5KT2A 2MKYA 3CIMA 2ZWOA 3CJ5A 2M70A 3PRVA 4MKVA 2QSWA 5F8NA 4E0DA 2DRAA 4GKKF 3M1VB 3GJQB 2VQEF 2RDIA 4MIWA 1NDKA 4OYAA 1WC6A 3QWUA 4F7VA 3KUEA 1CJVB 5DQGA 2YQ3A 2Y0SD 3FRYA 2WBMA 2YBVA 2CZ4A 4YP3A 1IKWB 4QIFA 5KOXA 2KO1A 5ETSA 4JI3J 3P3DA 3BB5A 2ADCA 3FGVA 3RG6A 3GIIA 4B9VA 5AE1A 3RTVA 4CYUA 2F7VA 3CCQS 4LFBJ 9ATCB 2GNKA 4J9OA 2UXCJ 3T1HJ 2YNGA 2NR0A 2LEAA 2CPYA 1CG2A 2M0GB 1RB0A 1JLQB 3ZTSA 1Y00A 5KFHA 2XMWA 1N0UA 3HZEA 2CPFA 4Q2LA 2FLPA 3DOLA 2A2CA 2OSQA 4RWXA 2PI4A 3V6JA 1CPZA 1JIHA 4OFZA 4K0KF 1PYSB 2DH7A 4DF8A 4U96A 4JYAJ 5IT9Y 2Z2MA 3AOAA 2XSJA 4CO2A 1JJ4A 4B9NA 3MM9A 2ZH1A 2LLZA 3ELHA 1SH0A 1YLXA 2IYGA 1NSQA 3PRDA 4DQRA 2Y1JA 3QRQA 5BR8F 3M8QB 3WX4A 5F9LA 2OIHA 4Q0BB 2K1RB 3JAMY 4FZVA 1X8DA 5GAHI 1R89A 3OTCA 5KFIA 1VQSA 1VGYA 1P6TA 1LOUA 2JFKA 2ZFHA 1M5VC 4EFAC 2CJXB 1DBDA 2C1EB 2RSQA 3BSOA 4DR6F 4PWWA 2GHPA 2DY9A 3UN5A 2MGZB 1WSVA 2DK2A 4F0MA 4DR3F 1S1VA 2CNOB 2XMJA 1RTHA 2N3LA 2QLJB 2IIHA 2CDQA 3QO9A 4Y2AA 2RRNA 3QT7A 2YWKA 1U0HA 3MDFA 3MMAB 3NG8A 2HHWA 3LPEA 2R7UA 3ZXWA 3AOCA 1LEOA 4DDFA 5D0HA 3DRPB 2E5LF 3KMQA 1YRUA 2YQ1A 2EFGA 3M2RA 5B0CA 5KG0A 1SJ3P 2JEFA 2UVWA 1FJGF 1PC4A 1CS4B 1TVRB 4O44B 1O0PA 5KFBA 4QIGA 1JXVA 3CULA 2Q6CA 2IY5B 5A2QU 4MFBB 5ETMA 3VAMA 1DTTA 4P10A 3M4XA 2R7OA 2B51A 1X60A 1REVA 3MMCB 2P9CA 4LFCJ 2FYXA 1G2EA 1C1BA 3DLGB 3BR9A 2BANB 4I69A 2HFVA 2NPIA 4B3TJ 2V8HA 4OZLA 4NOHA 2PMHA 3BF4A 4CYUB 4ZHRA 4F4AA 5LT5A 3FBCA 3QQCD 2NUUG 2AJQA 2Q66A 4X84A 1B0PA 3UO0A 1I6JA 3R7NB 1SV5B 3CCLS 2R8JA 4QYZK 5HK4A 4DI6A 2HGMA 3FMWA 3M8QA 2NXEA 1OY9A 4TYAA 3ZTOA 1FERA 2PFFB 2KYZA 2KN4A 2V68A 3U1LA 1JLEA 3MWBA 1MMDA 4Z37A 4DSFA 1IBLJ 4PABA 4ZPTR 1TL1B 2R8HA 5HI7A 3GFZA 1F5BA 4X2BA 2HQCA 4MMOA 1JKHB 3IR5B 2CPXA 1J5OB 3MOZA 1UZHA 1NU4A 1RGVA 2OD4A 4V1Ak 3SCLE 3MPVA 3TWZA 4EGLA 2UXCF 3M2RB 1NKEA 2DJWA 1ZPVA 2N3OA 1XJWB 3HHDA 2BQ3A 1M5OC 1HNVA 2AV5A 4NWBA 2XULA 3KLFB 1RBLA 1U0HB 1IKYA 1KQGB 3R7BB 1DTTB 4PG6A 3LGHA 3NP5A 3BEGB 4F04B 1RHRB 2VJUA 3AHPA 3BO3A 1FD8A 1FNXH 2MY8A 4FXDA 2GQ2A 3WHIA 3TZXA 1ITPA 1XN9A 3VTIA 1NK9A 3M6VA 4LF6J 1HL6A 2G0CA 2BE9B 4ZVHA 1WDDA 3F56A 5CYMA 3EPGA 2P5VA 4RW8B 3SV4A 2DRBA 1LQ9A 1OS5A 1DURA 1F9HA 4I2QB 2FY1A 4J9LA 3KJNB 1GMVA 4ZJLA 2BVZA 2AEFA 2CVEA 4M1KA 3S8SA 2PMWA 5ETOA 4TLQA 4X66F 2ASDA 4EYHB 1ZM2A 2CQHA 4U7CA 3Q23A 1D09B 1Y11A 3MECB 4CDIA 4LF4F 2F4FA 5DG8A 1ZM9A 3M6UA 1M5KC 1KQFB 2VOPA 5J1EA 4M5NA 1HQUA 3PKMA 3KXDA 4JI7F 4RBVA 3CCUS 1RHQB 1RAAB 1IR1A 3BM7A 4LIRA 3M2VA 1KRPA 4J9PA 2CNNB 4YY3F 1I1GA 3TAMB 3G2XA 4ZCIA 1EP4B 2ZBPA 4LR7A 1ZPWX 2FY8A 4NEZA 5JMNA 4ZP8A 2D9OA 1SXLA 3LWLA 4DZDA 2NZ4A 3GFXA 4ES1A 1PGZA 2CQ3A 2C2RA 1SKWA 4DCOB 4RNNA 4MK7A 1N34F 4GKJJ 4WFYA 1WC4A 2HBYB 4X4OA 2XGPA 3CDAA 1BQXA 3TX0A 2ILYA 1XK8A 1H7WA 4L72B 2DPIA 3UI3A 2R8KA 3F44A 5JXSA 1RU2A 3W9IA 4NXNF 1RABB 1PCAA 3H0PA 1YWXA 2L3MA 4KR0B 4ERDA 2ZE2B 1AYEA 1RDRA 4MT1A 3R5JB 3R6LB 4IOCQ 1U1QA 4WXWA 1N56A 2I1RA 2DGQA 5K14B 2JC0A 3HHLA 2RF2B 3BYRA 1RAHB 4FVCA 4ZJOA 2KXNB 3RZAA 1FKAF 4RNMA 4AL5A 4GO5X 3PFOA 4IDKA 4OHVA 2G9OA 3J80U 2DB1A 3SQOP 1H98A 4JI5J 3G8TA 2AF6A 2COLA 1U26A 3HHNB 4EI2A 4C4WA 4CRJA 1LWEA 4DG1A 1MMNA 3R5AA 5CH7B 3W5XA 3CC7S 2V2KA 3OHAA 1IKXB 4NZ7A 2QL5B 1LW2B 3W66A 3DLEB 3W2VA 4UOHA 4TU9A 2WAQD 2YKMB 3G86A 2A6MA 3IM9A 5L9NA 3M2VB 2W01A 3MPYA 1WOSA 1YTYA 2M5YA 3OJSA 1YG0A 3WZ0A 2L48A 2L9WA 2QC3A 3CVKA 3D6TB 3U1NA 3NGUA 1N32J 3C46A 4DR4F 1G7CB 1Q4RA 2CQ4A 3BJYA 4G6VB 4IFVB 2HQIA 1OJ4A 4CNYA 5KFUA 2YKNB 3CJKB 2BJ1A 1HYSB 1R0CB 3KG0A 1U1NA 2JEIA 2NXNA 1UJ6A 3EDQB 4CQ1A 3TOQA 4NLSA 1AROP 2CWKA 2Y9HA 1RKJA 1DLOA 1VC6A 4LF4J 2YX4A 3D0HE 4WTYA 3IBFB 1Q86T 2V94A 3FBFA 1XNRJ 1U24A 2NS1B 3IMQJ 4A47A 3SCIE 3ZNUA 4KAIA 5T7LB 2B0GA 1MSWD 2ALZA 1D1UA 2XZWA 1NPKA 5J1NA 4DUYJ 3HJFA 1UVJA 3MEDB 4M5KA 2XMTA 1SC3B 3JS9A 4ZP6A 1RT5A 3MM6A 1MROB 2MSSA 1GT8A 1H2TZ 2AJ0A 4OX9F 2UVVA 4LQ9A 2OPSB 5IS2A 4I2PA 2MZTA 4M5LA 2JVOA 1N5YA 1FTRA 3C8YA 2B6AB 5CYQB 3LAMA 3OD2A 4Y00A 2L9NA 2QE5A 4I0WA 2YNIB 3W2VB 4KGVB 3CDWA 4QWAA 5KFTA 4IG0B 1PIEA 1RACB 5E5NA 2IVYA 3HK2A 1HD0A 2DHSA 2A3JA 3PYEA 4BLGA 1T05A 1N36F 4F50A 2EPIA 2OTLS 1JNRB 2FVQA 1VJQA 2X51A 3TQEA 1BQNB 4NI2B 4YFUA 1RTJA 3MXHP 4P75A 4S0MA 1AB8A 5DQIA 3MUVP 1WKKA 2M9KA 1NJXA 1P8GA 5LMNJ 4OHYA 2BRKA 1RZMA 1X4EA 2XI2A 2KM8C 2OMLA 2IAJA 2IDEA 2KDOA 2PA8D 3KK1A 2QYGA 4RL1A 3HT3A 3HM9A 2R7WA 2KG0A 1S7IA 3R1HA 2Q3PA 1HHQA 4JOUA 3PX0A 1S48A 2W4PA 3TVKA 3AJ2A 5DGAA 2NQPA 2G1DA 1S6OA 1XR5A 3KK3A 4DV2F 2GVDB 2Y8WA 3DDIA 3FNNA 2RE1A 2E1RA 5D0GA 4Y0FA 1X9SA 1X0FA 2HGLA 4ZDNA 3ZZYA 4CLTA 5DDRC 7AT1B 2W7OA 2ABYA 4R5PB 2RQKA 3AY0A 4E98A 1U45A 2CA9A 2H5IB 4HR2A 2WVBA 2QZ8A 3R5GA 5FDLA 2W24A 4I68A 4KYZA 1RE1B 1U6ZA 3WBZA 4B3TF 1IBKJ 3HHEA 3ZZUA 2FVRA 4C9DA 2N4CA 1T8EA 2OPSA 3PVXA 4LF5F 2DR5A 1FWLA 1NB7A 1Y4ZB 5E2QA 3D66A 1WSRA 3M30B 3N79A 4Q7AA 3VV2B 4B3OB 2LMIA 4GC7A 5L1JA 3HX9A 4OZJA 1R0BG 1ZM3A 1IKVB 5G0RA 3VCDA 1SIWB 8RUCA 5LXRA 5F8LA 2HZAA 4X65F 3OTEA 1Q8BA 1T05B 4EYIB 1TQLA 3ISND 1KVJA 4F3QA 2J9CA 4K5RA 1T94A 2OO4A 4C3KA 4O3SA 3IWLA 4MIAA 4OI3A 2B6AA 5CYQA 1NK0A 3GG0A 1FJ7A 3W63A 4B02A 2Z56B 3EXYA 4KRWA 2ASJA 5E3RA 2CPJA 4DQIA 2MPUA 5KFZA 1VBZA 4OQJA 2PN6A 1DZ5A 2YNFA 1IQZA 2UUAJ 4K5SA 2Y3YA 1DHMA 1QAXA 5J2QA 1V3SA 3QT6A 4DPYA 5CXTA 2J6TA 3NWGA 3W2WA 5LSOA 3IM8A 5KFCA 2N82B 3MR7A 1RT2B 4ED1A 4LF9F 1IVZA 5KT3A 3HP6A 1UWBB 4A8YA 1SUQB 3CT9A 3DOMA 3EZOA 2HG4A 4OX8A 4YMEA 3VZIA 1H7XA 3TA1A 1C0UA 4ZPAA 1U6BA 4FNHA 1NHVA 2X1FA 2EFPA 3E01B 2E66A 4MK9A 1NJIT 2W1BA 1R27B 2G1HA 2J9EA 1FHTA 1LW0A 1S4EA 3NBPA 1TL4A 2ATCB 3QFWA 3QATA 1T9YA 4JI8F 4U67Q 4DUYF 2LDIA 5CYJA 4ECUA 4I6AA 2M7SA 4JV5J 1BHNA 4F3MA 4DQSA 5D4PA 3UNGC 3QAEA 5A0YA 4P74A 4DPUA 2V8DA 4ZPWR 3DMJA 4I7FA 4C3LA 4OZNA 3GIKA 4JI1F 1FKOB 2CAJA 1QSSA 4K4UA 3RW6A 4ECRA 3ILLA 1BUXA 4K4TA 3GJRB 3NGSA 3HSZA 2F8MA 4N8OA 2CG4A 1CJTA 4NXMF 1YBAA 3IWXA 3IWNC 3NGTA 1HWLA 2LQ8A 3MUMP 1PO6A 1CLFA 2FHMA 1LK7A 2HHPA 2NXJA 2ASYA 5A6PA 4B9SA 1SJRA 2I38A 4W92B 1NPRA 4GKKJ 2ROPA 4LR9A 3FCWA 2R8IA 1KDNA 2HS0A 1UETA 2PD1A 3E51A 3QT5A 2X1GA 3NS7B 4DU7A 1RAOA 4NCGA 2DO0A 4USTA 4M8LA 4OHWA 3W2WB 4BS2A 1HNWF 2V34A 3IAM9 1FESA 3FDSA 3FUYA 3M8WA 3ENAA 2ROEA 3NWRA 3QWPA 4F4WA 1MW7A 4KGXB 4LBPA 3I0RB 5C7PA 1Q95G 5IV3A 4DX7A 2ZM6F 1M5PC 4WKRA 1S99A 4C98A 4OV6A 3R27A 2LKZA 2ZITA 4UOCA 3GFYA 4DHVA 2AQ4A 1O6XA 1GAOA 1EQMA 1I94J 3QJJA 3HPOA 1IN0A 3H4DA 2RNEA 3OQ2A 3NBPB 4GC6A 3H2LA 2EC2A 2GV1A 1HR0F 1TV6B 3LW5C 4PG7A 3TUPA 3MI7X 2R3VA 3SFGA 2Z8QA 4N56A 1B0TA 1VDHA 2ZVSA 4JI7J 3NOGA 4DV5J 2YWFA 1SL2A 5E3QA 2IBKA 1FJCA 3CNQP 1VRUB 2DHAA 4DMZA 3KHHA 3CCWA 1ZAWA 1FNMA 2FIUA 4PYDA 1RBOB 2HGNA 3KLHB 2HHSA 3CEDA 1JXEA 3IC1A 3H25A 2H5JB 3MMAA 5IT9U 3PDNA 4ZVUB 3TARA 3CMES 2HBRB 1YGYA 2VODA 3DGVA 5B0EA 2E7XA 2QX0A 3UVJA 4CNZA 2U1AA 4P52A 4JI4J 3NNHA 3BQ2A 4JI2J 2LEBA 5KFPA 2OFHX 2GO8A 3WC2A 7FD1A 4DOZA 4CM2A 4FKXA 5A8RB 4O4RA 5FD1A 2UUCF 1MU2B 4IRKA 1EARA 3NEKA 5B0DA 1HNIB 2QGFB 5IOLA 1REVB 1ZOTA 3L4BC 4QWEA 2XO7A 4ELVA 3I96A 1N5SA 3MCSA 2W2NP 1U6FA 2AYMA 2H4WB 2HFSA 4R0JA 3IRWP 4IRCA 1IWGA 1S49A 1TVRA 3UR3C 2VU5A 3MEGA 1NCLA 4AD6A 2ALYB 4IO1A 5K5MA 4CLYA 3QZ8A 2MLXA 3M32A 1RHMB 1TAQA 1NSKL 1NJWA 4LF9J 3MPUB 6AT1B 3DU5A 2HNDA 2GVZB 2RF2A 3D6FB 4ZLNA 3MR2A 1ULRA 5IWAJ 1KLMA 1T0TV 3EGWB 4JBCA 2FZGB 2PMZD 2XQCA 3CC2S 1G1XA 1J27A 5L1KA 3HMJG 2LU2A 1GX5A 2XM3A 3THTA 4PWDB 1FD2A 3P49B 2VG5B 2CFXA 2HNZA 1S6QA 1GXLA 1JLAB 1G4CA 3ETOA 4NMXA 1MN9A 3CGIA 3FK4A 4PXCA 5GAEU 2A1BA 4QIVA 2CPEA 1RWMB 2KU7A 4NLRA 5F8GA 3EGVA 3IR6B 4X65J 4J9SA 3WDOA 3PZPA 1JJ2R 1KP6A 1KLNA 5M2UA 4RO0A 1R8PA 2AWZA 5EWGA 2DVIA 5GADU 5E33A 3IBCB 1UVNA 3E3XA 2XHWA 3T6BA 3CCTA 4P2FA 3KHRA 1Q8IA 1EIYB 2J7WA 3HHLC 4FBTA 5F8HA 1CJUA 1BC6A 4UQTA 1JKHA 1R0AA 1M0SA 1SI9A 2NSCA 3AQOA 3H8YA 4OV1A 1DARA 2YH1A 1HNIA 3A3OB 3D0GE 3MM7B 4OLPA 4TXSA 4NLOA 2J8AA 3Q8YA 4OYOA 4XDDA 5G4DA 3PY8A 2QA4G 3HKZD 4DX5A 2HQDA 2AJ2A 4HI1A 2NCKL 2XCAA 3KLIA 2EFOA 3D9BA 1VJWA 3OTOJ 2ZNZA 1Q81T 1RTJB 1S12A 1MROA 1UW4A 3U7JA 4EO8A 5KFKA 1RTDB 1C4AA 3PYDA 1ZETA 1URNA 1I3OB 4YQWA 2XLKA 4N76A 3A8JA 3HFKA 2DGUA 3SV3A 4LR8A 2MQOA 2ZH9A 3NGRA 2V4JB 4QZVB 3K57A 3OFFA 4H4OA 4ZPDA 4C3MA 5LMNF 1L3SA 2CNKB 1NHUA 2QFJA 3OL9A 1SJFA 2FGCA 2WB4A 3L7OA 2LDYA 1P1TA 4GVLA 3M32B 2C3PA 2RDDA 3EVOA 3SQGB 4NYPA 4TQSA 4P73A 3HSGA 4ED7A 3P6YC 2BX6A 4C48A 2FHJA 3LTOA 3R5DA 9RUBA 3NLCA 5C25B 1SC4B 1W25A 3OR1A 4DR4J 1U8WA 3CMAS 1KQSR 5D8HB 2LQ5A 1QM9A 4IG0A 4DS4A 2GA7A 4DU8A 2ZH3A 1U1KA 3OT9A 3G71S 4U8YA 3A4TA 4ZVEA 3TO8A 1HBOB 1X9MA 1YZ7A 3GQCA 1L3UA 3HHLD 2UUWA 4A8SA 1RCXB 3H98A 2VJVA 2BDPA 3UR0A 3OL6A 3T3FA 1S6PA 2XG8A 4NLQA 4PEOA 1ZYQA 3B82A 3OLBA 2ZNYA 5A8WA 4PKDB 5H9FJ 2YKOA 4RW6A 5I3UA 1T02A 1VLOA 3UWTA 1PG5B 2BUNA 3ZTPA 4CO4A 3ILJA 2FJBB 2RJZA 5E3PA 3DI6A 4LF5J 1RP5A 2E5GA 1VHFA 2XMMA 4F3OA 4ID5B 1NK4A 1OSCA 2M2BA 3CC4S 3AXKA 1GFWB 5B08A 1RTDA 3OJUA 3C6UB 2OELA 3FC9A 1X4CA 2RH3A 4QPXA 2KFYA 5D3GA 1U1OA 2FHJD
chains in the Genus database with same CATH topology
4A8WA 3T1AA 5ADZA 4EO6A 5E3AA 1C0TA 2BA9A 2VFRA 1YQHA 2XGQA 1NKCA 1S76D 1OPZA 1RTIB 3T5JA 2JVRA 1S7HA 2VBZA 4B3MF 2KJWA 3KJVB 2V0NA 3WC0A 1S0MA 1HQEB 3KNAA 4QJVA 3IGVA 4CO1A 1T03B 1VI7A 4O3QA 3UQSA 2RUGA 3G6ES 2P6SA 3OVSA 1S1UB 2NREA 1IKXA 4FXWA 2MQMA 4WFXA 4XDCA 1L5UA 2LA4A 2VFVA 3H2VE 1TK8A 1X4HA 5EUHA 5B7WA 3SMZA 4OL8A 4NZ0A 2ASLA 4DBQA 3T5KA 2B4VA 4I56A 1B64A 2D3UA 4RW4B 3CCVS 4AXIA 3MTJA 1DQ8A 2M8HA 5F0WA 1JMTA 3SCKE 4K50A 5KT5A 1R8BA 4DL3A 1Y9OA 2OPPB 1R31A 1K73T 1HBNB 4ALZA 2XMKA 3QGHA 1XNRF 1LW0B 1DRZA 2F8EX 4MKAA 4EZ9A 2ZKTA 4DV1F 3Q8PB 4N5SA 4YDDB 4AUKA 2GMJA 3L3CA 2XMUA 4ECVA 1H0HB 4IFYA 5IT0A 4KBIA 4Y2CA 2CQGA 2VL1A 3I87A 1FTCA 3J7YU 4DV6F 3SSQA 4HKQA 3VAGA 3RAQA 3E2EA 4AFFA 2OPRA 3TAQA 2JOQA 1ZM4A 3OUYB 4W90B 4L6V3 2BR0A 5E3CA 5LMUF 5J2NB 1NZAA 2OLWA 3GR0A 2XNQA 4ZVGA 3HF5A 4Q8FA 5GVQA 1N4LA 3IA0A 3Q8SB 2ADBA 2GHVC 2DNZA 2CQIA 2XNRA 2F3JA 1D9AA 3O2IA 3CDUA 2ZDPA 2KYXA 3N9UC 5LXYA 2XLJA 3MD1A 3PNIA 1NAQA 1FXLA 2KT5A 2VBYA 4X62F 4URQU 4DQPA 2DO4A 3LAKA 5HL7Q 2HHHF 2AGPA 1HPZA 2GW8A 3BSNA 3DHXA 5L8RC 2FDNA 4GKKF 4IRDA 3DFEA 1JLCB 3MR6A 1TL1A 3DNCA 3NKYA 3GYXB 2R2UA 4IR9A 4IOAQ 1QVGR 3M8PA 4YB7A 5KG2A 3RR7A 1WNEA 4OZ0A 1J2VA 4NMLA 2HVIA 2IM0A 2OPRB 2ZOMA 2VKZG 2C2EA 3OFEA 4IH7A 4DR7F 3LP2B 2RT3A 4IFYB 5B0FA 4KO0A 1VK8A 4RWWA 3PW7A 2QV6A 3RB0A 1YJUA 1Z2LA 1X7VA 1TR0A 3QMQA 2DR9A 1JLFA 1CQNA 3BQ1A 1Y5LB 2CIMA 1RT7A 1X5TA 3LQVA 3V2UC 4DN9A 2LECA 3DM2B 2AD9A 4FF3A 1RQ0A 2WSFC 2ZH8A 3EUNA 3EGNA 1WHVA 5KFXA 1BLUA 3FFIB 3LGNA 3D5MA 3E01A 2KHDA 1NJYA 1F0XA 4B3RF 2E5IA 2F8HA 3LOUA 3DYAB 4WFNQ 3EXCX 1DFDA 4X4NA 2VUGA 1AFIA 1UWBA 1KD1T 4RW9B 2F9JA 3BDEA 3J7Z5 4C8YA 2R4FA 4RBUA 5K9FA 3MFIA 3D54A 4JI6F 3PIOQ 2E1CA 4LUBA 4X4QA 3CJ3A 2HVHA 2IA0A 1UKUA 1K1QA 4MYUA 4HTJA 1WD6A 1FKOA 4YDXA 2JEJA 3UCZP 3KG4A 4UY8T 3MGJA 4IH6A 4KHRA 3GILA 1RTHB 1LKZA 4H54A 2HFOA 4ATNA 3OSNA