3FFIB

Hiv-1 rt with pyridone non-nucleoside inhibitor
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
424
structure length
403
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYATNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
publication title Pyridone Diaryl Ether Non-Nucleoside Inhibitors of HIV-1 Reverse Transcriptase
rcsb
source organism Hiv-1 m:b_hxb2r
total genus 116
structure length 403
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3ffiB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ffiB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ffiB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ffiB04
3IS9A 1N48A 5KFUA 2RDJA 2VG7B 4DL2A 1WNEA 2W7PA 4IG0B 3NL0A 3MTKA 1RTJB 2HMIA 2R2SA 2FLLA 1NHUA 3ICLA 1UWBA 3PZPA 4TN2A 3H98A 4U6PA 3BGRB 5I42A 3HVWA 5HP1A 4I2PB 3LALA 3DOKB 4KFBA 5C25A 1SH2A 5JUMA 2OPQA 2C28A 1C1BB 4NRTA 1S9EA 1VRTB 4H4OA 4NCGA 2D41A 3IGNA 4RNMA 4WXOA 3DLKA 1LWEA 4NLRA 4WZMA 4I7FB 5C24B 5KFGA 5FDLA 5F8MA 1HPZB 4ZHRB 1RT5A 3DM2A 3T5KA 2R8IA 3KLHA 3MEEA 2CJQA 3NAHA 2YNHB 1SUQA 3I5CA 3UPFA 1TQLA 1HMVB 5J2PA 1DLOB 3QGGA 2RF2B 1JLBA 2ASLA 3Q8RB 3PW5A 5JXSA 3I0RB 2R8JA 3M9OB 1EP4B 1N5YB 4QWBA 3V4IA 2E9ZA 3BREA 4MIAA 4ED1A 3N6MA 2W9CB 4DL4A 5DG7A 2J6UA 4M95A 1JLQA 2GIQA 4ZVEA 4F4WA 2HNZB 3IGVA 4JUZA 1VRUA 1NHVA 5L1IA 1QE1A 5F9LA 5KFOA 2RDIA 3DRSB 3RB3A 2AGQA 4K4ZA 3NKYA 5DQIA 4QWEA 3PJWA 4ECYA 1K1QA 4IH5A 5J2NB 1J5OA 3MFIA 3RBEA 3C6UB 1RT7B 4NLWA 4TLRA 1MMLA 5J1EB 3T1AA 4NRUA 5F9NA 1MU2B 3FQLA 3V6DA 1SH3A 3KHHA 3PW0A 3KHRA 1LW0B 4R8UA 4XPEA 2YKMA 3M8PB 4TYAA 1XR7A 3H5YA 1HNIB 1R0AB 2W8KA 1JKHB 4ZPCA 3MFHA 2YNGB 4QW9A 1RTHB 5KG0A 3DRRB 1T3NA 3E01A 5KG2A 4EYIB 3KLEB 2VG5B 4WXWA 1S0NA 3RB4A 3H4BA 2JC0A 2FVPA 4PWDB 2OPRA 1S1UB 1S1VA 1TKTA 1RT4B 3KLGB 4Q8EA 1SV5B 5DLGA 1S6QB 4LSNA 4IR9A 3KK2A 2OPSA 4ICLA 4KO0B 1T05B 3DYAB 5KFNA 2WONB 2YNIA 5L1LA 4ED3A 2AGPA 2ASDA 1RT6A 4R0EA 1OS5A 5EWFA 2DPIA 2B43A 2OPPA 3GV7B 4IG0A 4ECSA 1C0TA 3KJVA 3C6TB 1REVB 4O44B 4ED6A 2HNYB 4J9OA 2IM1A 1C0UB 4H4MB 2JC1A 2WB4A 3BGRA 2OH2A 4KB7A 4IR1A 2HWIA 4TQRA 1FK9A 1S4FA 4K50A 4ZP9A 4PUOA 3VQSA 3DOKA 1HQEB 1S9FA 3BSAA 4TY9A 3N6NA 1VRTA 5KFKA 1DTQB 3RBDA 1JLEB 2BR0A 4IRDA 1RAJA 3DI6B 3QO9B 5CYQB 2WOMB 4Q44A 4IRKA 4K4TA 1RT2B 3V81B 1HPZA 4ZHRA 5D3GB 4Q0BB 4O3OA 5KFIA 4KKOB 4O3NA 1JLGB 1IKWB 1TKZB 1D1UA 4Y3CA 2AX1A 2YNHA 3CWJA 3HVTB 1HMVA 1LWCB 1DLOA 3M9NB 4IRCA 3KNAA 4JV0A 4G3IA 5KG6A 4RW4B 3KHLA 3CJ2A 4URGA 5KG7A 1S1WA 3I0RA 1JLFA 1EP4A 2FVSA 4WYLA 1C1CA 1N5YA 5KFRA 3KLFB 3HVAA 2XCPA 4KE5A 2W9CA 2VG6B 5DQGA 1RYRA 2DPJA 3KHGA 1JLAB 1RTIB 2HNZA 3IG1B 2GC8A 5KT4A 5KFLA 2JEIA 4KHMA 2R2TA 1DTTB 4IFYA 2FLNA 4QWAA 1S1XA 1XR6A 4K4UA 3C6UA 1RT7A 3CVKA 2FJVA 2R2UA 1JIHA 5K14B 4NLOA 4EYHB 1LW0A 2IA6A 4K4VA 1EETA 3M8PA 5L1JA 3KLIB 2ZE2B 3MEDB 1HNIA 1R0AA 4RW8B 1KHWA 4NLUA 4TXSA 4DG1B 1RTHA 3LP0A 3NMAA 3CJ0A 5CYMB 3JYTB 4IH7A 4MK8A 3D5MA 1S48A 3DRRA 1RT3A 2V4QA 2HAIA 4F4YA 3KLEA 2VG5A 4ZPBA 5F8IA 2IMWP 2BRKA 4ZVGA 4PWDA 3M9MB 1D0EA 3RB0A 1S1UA 3M8QB 2AWZA 1RT4A 3FRZA 3KLGA 4YR2A 1SV5A 4MKAA 1S6QA 2V4RA 3FFIB 4MKBA 2RKIB 3QLHB 2WHOA 4ECWA 2VA2A 4FBTA 4KO0A 1T05A 1JLCB 3DYAA 3I0SB 2WONA 1TV6B 5KFHA 3BQ2A 4FS1A 5DGBA 3HHKA 1RTDB 4Q45A 4O4GA 4RW9A 4ID5B 4R5PB 5C42A 2AX0A 3UR0A 4ECRA 2ASJA 5KFPA 3C6TA 1REVA 2BANB 4O44A 2XGPA 1BQMB 5C5JA 3QZ8A 1N6QB 1C0UA 4H4MA 3FQKA 1QAIA 3ITHB 2FJXA 3DLGB 2D3UA 3GV8B 4ED2A 4ZP6A 2UUWA 3GYNA 4URSA 4KAIA 3OL7A 1HQEA 5KFZA 1RA6A 1HQUB 2ILYA 4IQXA 1DTQA 4KHRA 1JLEA 5KFBA 3QYYA 3DI6A 3QO9A 5CYQA 3BQ0A 1TL1B 4WZQA 4K4XA 3CDEA 1RT2A 3V81A 5KFYA 5D3GA 2YKNB 4Q0BA 5L1KA 1JLGA 1IKWA 1TKZA 3LP2B 1IKXB 3GIMA 4ZP7A 4EBDA 4NLTA 2YNFA 4TYBA 2W9AA 3T5LA 3H5XA 4K4SA 4RW4A 2XWYA 2JEJA 2UUTA 4NLSA 1IKVB 4QPXA 4H54A 5KT7A 2UVRA 1T03B 4NLGA 1IKYA 5KFDA 3KLFA 4DL7A 2W7OA 4ED7A 1LW2B 2GIRA 5KFFA 5KG3A 1HNVB 3EPGA 2VG6A 3PJXA 2I5JB 3BJYA 4RNNA 3G6XA 5HLFB 5KT5A 5KFJA 2IBKA 1JLAA 5KT3A 4ECXA 3IG1A 2J6SA 5KT2A 3LP1B 4LSLB 4DEZA 4NLYA 4ECUA 2VG7A 2XI2A 4RNHA 4O3PA 4HYKA 1RTJA 4URQU 2ALZA 1DTTA 3QGHA 4LQ9A 4PQUB 5KFMA 5FDLB 4NLQA 5F8GA 3G86A 1RT5B 5K14A 3KLHB 3MEEB 3GIIA 3KLIA 2ZE2A 3MEDA 3KLVA 4I2PA 4RW8A 1QAJA 3MF5A 1TKXB 5KFSA 4MH8A 2BRLA 5KFVA 1C1BA 5F8JA 5HBMB 5CYMA 3JYTA 1JLBB 4IKAA 4ZPAA 4F4XA 2R8HA 1RT1B 3GQCA 3LAMA 1BQNB 1HYSB 3BSOA 2IJNA 4ECVA 4I7FA 1K1SA 5C24A 3V4IB 2FJWA 5DQHA 4NLPA 5KG1A 3OLAA 2XC9A 2BQRA 1S9GB 3DOLB 4XO0A 1W25A 2WRMA 3FFIA 3QIDA 4NLVA 2RKIA 4J9LA 3QLHA 5EWEA 4IFVB 3OLBA 2VA3A 4DL6A 1JLCA 3I5BA 2RF2A 3I0SA 1TV6A 4DL3A 3PR4A 1S1TB 4KV8B 1RTDA 4ID5A 4OL8A 3ISND 3LANA 2O5DA 3RB6A 3KOAA 3OHBA 5DGAA 3MR2A 5J2QB 4WFZA 4ECTA 4EO6A 1BQMA 2YKMB 1ZTWA 2UVUA 2HWHA 1N6QA 5KFXA 3PVXA 2B6AB 1TL3B 2JEFA 3ITHA 3DRSA 3IRXB 2IAJB 4ZMMA 3MR6A 3DMJB 1S10A 5F8NA 3DRPB 4RNOA 3CIZA 4G1QB 3T5HA 4JV1A 5J2NA 1HQUA 3N6LA 3G6YA 4WE1B 4XPCA 4B3OB 2WK4A 5J1EA 3TQ1A 1MU2A 1CSJA 3T19A 3BSNA 2OPRB 1TVRB 3SFGA 4NLDA 1TKTB 1NNDA 1TL1A 5DG9A 3KK2B 4ICLB 4WYWA 1JKHA 3SFUA 3UQSA 2XGQA 3EPIA 2IC3B 2YNGA 3BR9A 3H4DA 4NZ0A 4J9MA 4EBEA 3LP2A 2ZD1B 3PHEA 4Y34A 4TQSA 4YR0A 3RAQA 4MK9A 1C2PA 5F8HA 2IM0A 4MK7A 3KK3B 2ILZA 3HKWA 4ED8A 2OPPB 3CO9A 3GIKA 3MECB 5DLFA 4QWDA 4X2BA 1IKVA 2QV6A 4ZVFA 1C0TB 1QUVA 1T03A 3KJVB 3OSNA 3CDUA 4ECZA 2R8GA 4NYZA 1JX4A 3V6JA 4FBUA 4IOBA 2AU0A 1LW2A 2BQ3A 1HNVA 1FKPB 2I5JA 5KFCA 5HLFA 1FK9B 4RNFA 4RW6B 2R2RA 4PUOB 2FVCA 2V9WA 5I3UB 1S6PB 4RW7B 3MEGB 3LAKA 4I2QB 5EWGA 3H59A 3LP1A 4LSLA 3FSIA 1N56A 3DLEB 4U7CA 1LWFB 3QIPB 5HROB 2HNDB 2XI3A 2UVVA 5T14A 3I5AA 4MFBB 3BSCA 3QZ7A 4KBIA 2HNYA 3NBPB 4PQUA 3G6VA 1FKOB 4JV2A 3GILA 3OHAA 2FVRA 4ED0A 2C2EA 4EBCA 2F8EX 3E51A 4RUCA 3TAMB 1TKXA 2AGOA 3D28A 2IM3A 5HBMA 4F4ZA 4O3RA 1GX6A 2D3ZA 5F8LA 2B5JB 1RT1A 2BE2B 2W9BB 1BQNA 1HYSA 3Q8QB 3V6KA 1S1WB 3H5SA 2JEGA 2WOMA 1JLFB 4J9RA 1C1CB 4IDKB 3JSMB 4TY8B 1RA7A 2XCAA 1I6JA 2ATLA 1TP7A 1S49A 4GC6A 5KFTA 4KKOA 1ZETA 1S9GA 3DOLA 3OL8A 3ISNC 3KK1B 4Y2CA 2E9TA 2IM2A 2FLPA 3HVTA 4IFVA 1LWCA 3KMSA 4IG3B 4YP3A 4O4RA 5J2MB 3H5UA 1KLMB 4MIBA 3IS9B 4J9KA 3FDSA 4DL5A 2V0NA 4HKQA 1S0MA 1S1TA 4KV8A 3GV5B 2HMIB 4IFYB 3KMQA 1S1XB 2WTFA 5KG5A 3CJ3A 1UWBB 2C2DA 4WFYA 3SI8A 1YVFA 4RUAA 2C2RA 5J2QA 4EO8A 2QE5A 5I42B 4IH6A 1EETB 3OSPA 1RTIA 5HP1B 4YR3A 5KFEA 4KFBB 2B6AA 1TL3A 5C25B 5KFWA 2OPQB 2I1RA 3IRXA 2IAJA 1S97A 3LP0B 2E9RX 1S9EB 3DMJA 4H4OB 4NCGB 4ZPDA 3DRPA 3CDWA 4K4YA 4Q8FA 4G1QA 3Q8PB 1RT3B 3DLKB 1LWEB 4LQ3A 4WE1A 2FVQA 2D7SA 4YQWA 4B3OA 2CKWA 3V6HA 1SH0A 3DM2B 1TVRA 1Z4UA 2C22A 1JXLA 1HARA 3PW4A 4QWCA 4O3QA 1SUQB 2BQUA 5DG8A 5J2PB 3MR5A 4F50A 2IC3A 1U09A 3CJ5A 4DG1A 3GIJA 2ZD1A 1GX5A 4J9PA 3KK3A 4O4GB 3DDKA 4J9NA 4RW9B 3QGIA 5EUHA 3BQ1A 4FS2A 3MECA 3EZUA 5KFAA 5C42B 2IJFA 4NLXA 4QW8A 3M8QA 3UDLA 4Y2AA 3MR3A 3T5JA 2AQ4A 5KFQA 4ZVHA 1JLQB 1ZTTA 3H2LA 1FKPA 2J6TA 1VRUB 2JLEA 1QE1B 2WCXA 4GC7A 2UVWA 3TVKA 2EC0A 4RW6A 5I3UA 1S6PA 4Q43A 4RW7A 3MEGA 4I2QA 1KHVA 3PW7A 4RZRA 1J5OB 4O3SA 3DLEA 1IM4A 1LWFA 3QIPA 4R5PA 5HROA 2HNDA 5EDWA 1RYSA 4RU9A 4MFBA 3V6DB 1S0OA 2BANA 3NBPA 4R8UB 1FKOA 4M94A 4WFXA 3H40A 4KSEB 3Q8SB 3PW2A 2ZKUA 4K4WA 3OL9A 5KT6A 2R8KA 3DLGA 4ECQA 1XR5A 2YNFB 3TAMA 4EEYA 5KG4A 3E01B 3IN5A 4ZP8A 5L9XA 3RAXA 2W8LA 2B5JA 2BE2A 2W9BA 1RDRA 3OL6A 1S1VB 4J9SA 1IKYB 4LSNB 4IDKA 3JSMA 4TY8A 4J9QA 1N4LA 2YKNA 3CJ4A 2OPSB 3PR5B 1IKXA 3KK1A 2YNIB 1T94A 4YMEA 1RT6B 3NGDA 4IG3A 5J2MA 3NAIA 1KLMA
chains in the Genus database with same CATH superfamily
2HKEA 3R2CJ 3UDCA 2ZBCA 3PZPA 2KZZA 3QRRA 4RBUA 2N82B 4CO3A 3P6YC 3QSYB 1S9EA 5BJRA 5CA5A 2H4YB 1S76D 1TU0B 2PC6A 3BS9A 3Q0AA 4J91A 1WI6A 1JJHA 3ULHA 5DQIA 4CP5A 4ECYA 4OI1A 4WKRA 1AZSA 2YKMA 1JKHB 4DX7A 1J5EF 5KG0A 2I6WA 4EYIB 3SQGB 3KJNB 5DDRC 3PEJA 2AJ2A 1HR0J 2AEJA 1FT8A 5KFNA 2WONB 1UFWA 4KGZB 2FHOB 2MZQA 4R0EA 3CDBA 2DGOA 2HFUA 4LIWA 5FD1A 1QD1A 2XBPA 1U2FA 1WI8A 1H6KX 2HHHF 3VQSA 1URRA 1E6YA 4LBIA 3QO9B 1YJ9S 2Q6BA 3WC0A 1TKZB 1X8DA 4LFCF 1KONA 1HMVA 3M9NB 3GJRB 2CNOB 3I0RA 2QFIA 1JLFA 2OEKA 1RYRA 5KOXA 1U0SA 3MMAA 1XR6A 1OWXA 5K14B 4EYHB 2DHSA 5IZHA 4DG1B 1HWJA 1RT3A 1ROFA 1CJVB 1UVJA 4C7QA 2BRKA 3US5A 3JAMU 1FF2A 1MROA 4HT7A 3NXZA 4X4VA 3HKZD 2XS7A 1R6YA 2B4UA 4O4GA 4HVZA 2VQEJ 3R1HA 1N0UA 2BANB 4DFJA 1R43A 4CT9A 2YQ0A 1ITPA 3VAFA 2RAQA 2N7YA 3CDAA 1KFDA 2ZUGA 4Q0BA 4NASA 2QLWA 3A3OB 5L1KA 1IM6A 1PKUA 2YNFA 1HLWA 2UZAA 4OYPA 1IKYA 4CDIA 3PJXA 2NZ4A 1KOOA 3JQMA 2XI2A 4O3PA 4KJIA 3RZAA 1FKAF 5FDLB 3KYLA 4ID8A 4J90A 4I2PA 3OUYA 4MH8A 3QJLA 5EX0A 3ZZOA 3Q22A 1U24A 1RTDA 1FDAA 1FI4A 2IDLA 3RB6A 3KOAA 5DGAA 3VVTA 3QPIA 2DNGA 2HWHA 4N8OA 2IAJB 4PXCA 4DQSA 4B9MA 3DOMB 2DRBA 4M5MA 4IOCQ 5LXRA 2BM1A 3K89A 4CLWA 4Y2KA 1VBZA 4OZJA 3TX0A 4B3RJ 3DRXA 3BSCA 1RBOB 2DXEA 2YX7A 2BJ3A 4PXBA 6FDRA 4C11B 2IM3A 3JQKA 1XMOF 4J9RA 3L09A 1UEKA 4DV3J 1S49A 5KFTA 4NXMF 1S9GA 3DOLA 2PI5A 2RB7A 3FDSA 3M6WA 2YBVA 2XM3A 4JBCA 3ZZ0A 1UA0A 1S1XB 5F41A 2BW7A 2DNPA 4KHPF 1FNOA 3K5LA 1LXNA 1UZDA 2RSQA 4Z2XA 1KC8T 4JYAF 1RWMB 4NCGB 4K4YA 1LWEB 2OELA 1CBKA 1JXLA 2E5LJ 1R7IA 1PGZA 4ZN3A 1FFSB 1P27B 4DL0C 4ZVQB 2X1GA 3H90A 2B4OA 3PYDA 5KFAA 3UDLA 2IJFA 4QW8A 4YB1P 2CG8A 3M2UA 4HH1A 3W9IA 2MB0B 2QEXS 4DBQA 5GMEA 2L08A 2BJEA 3JB9k 4TY8A 4CO2A 3PR5B 2LYVA 1F60B 1HBOB 2ZBQA 2RS8A 1KLNA 1WNEA 3UD3P 1XK8A 1HBMA 2JH3A 5HAOA 3K8WA 2ZH5A 2R7RA 2K1RB 4U8VA 2KN4A 4G1PA 2QL5B 4IYQA 4ZHRB 2CA9A 3EZ5A 2XY5A 3HF5A 1HWKA 1HNXF 3PYEA 5J2PA 1D8ZA 4RL1A 1AUDA 1H38A 2DBBA 1EP4B 1SC4B 4QWBA 1N5QA 1MLAA 3QT6A 2BE9B 3W8PA 3R27A 1VBXA 3WHIA 2F4VF 3RB3A 1U1KA 4PG7A 1Q8IA 4QWEA 3MM7A 4NLWA 1MMLA 4LMZA 1RAAB 4R8UA 3H5YA 3NNHA 2Z58B 4PABA 1N34F 3M8WA 4KTQA 3CCTA 2XS2A 3SV3A 2OPPA 1T9TA 4IG0A 2KXNB 3CT9A 1UL3A 1JNRB 1NZ8A 1ZAXA 4X4TA 1EZZB 2OH2A 1S4FA 2E1PA 4NEYA 3MUMP 2EG1A 3N6NA 2BR0A 4PG6A 3Q2TC 4O3OA 3KNAA 2GMHA 1PYTA 2DGWA 2EXUA 4KE5A 1RZMA 1VBYA 1O6XA 1FNXH 2VIHA 2C1EB 5KFLA 2HQ3A 2CQ2A 2WW4A 2HHXA 4WCEQ 3LOUA 2RH3A 2ZE2B 1XTZA 3G8TA 1ZM2A 5CYMB 3PKMA 4AL7A 1T02A 1F5CA 3KLEA 2W2MP 5F8IA 5IT9U 4W4MA 3M8QB 3CPWR 3J7YI 2RHSB 4RX6A 5CAAA 4KO0A 1VQNS 2PMHA 1IVZA 1X4CA 4LFAF 4ECRA 3C6TA 2XGPA 3BKTA 4EK2A 2D3UA 2BKPA 5M2PA 4ZP6A 1CC7A 3TVZA 2DH7A 3FEYB 4KHRA 1RKJA 5BXIA 5CYQA 1V3ZA 4P72A 4K4XA 3HT0A 2ZHOA 1HHSA 4FKYA 2MGZA 5FLXU 4YEAA 3VAMA 2YKQA 2K7KA 1IKVB 1S12A 2RRBA 2GIRA 3UN5A 2KKHA 4FYXB 2CFXA 4NLQA 1TK0A 4DU7A 4B9UA 1LKZA 2HQFA 3ENWA 5DQHA 3Q86A 1UP1A 4FYYB 4K5RA 2EBEA 2AHOB 2RRAA 4HDGA 5D4LA 4A47A 1TELA 3IRXB 1C4CA 1Q82T 2EEYA 1TL1A 2GVDA 3D2WA 1X4HA 4Y34A 1C4AA 1GMVA 1B7FA 3HKWA 4QWDA 3JTPA 2MHNA 3OSNA 3CDUA 3OW2R 4DUYF 3LPYA 3PIOQ 1ZM3A 1FKOB 1NLKL 2CJBA 1NAQA 1F3FA 1BQNA 4NMXA 2MY8A 2GNKA 1TP7A 1OY6A 4KKOA 3BYRA 3U1MA 1BHNA 3QATA 1Q8LA 4O4RA 4ZITA 2GGPB 1NEEA 1S1TA 5KG5A 4K0KF 2M7SA 3JSYA 1S59A 3MDFA 5I42B 4YS2A 2VFUA 1EJ7L 1TL3A 3LF0A 3BBBA 1Q7LB 2ZC3A 2KXHA 1Z4UA 3PO4A 4KC5A 4O3QA 4ELUA 2KG0A 4F50A 3CJ5A 3CMAS 1WWHA 4RUHA 1XMOJ 1QAYA 3GIRA 2HQCA 4FXVA 1NK9A 4J9NA 4RW9B 2VBWA 4UZCA 1U1NA 4UY8T 4QU6A 1E6VB 1X9WA 3PW7A 4O3SA 3D9BA 3M05A 4MFBA 4OYMA 3V6DB 4KHPJ 3NBPA 3Q8SB 5EGYA 1R8HA 4JYAJ 2F8HA 3G4SS 1UPMB 4K7QA 4L74A 2HZCA 3WIUA 3OBIA 1BUXA 4K5SA 2DIVA 3OL6A 4G1IA 3CJQA 4A8QA 7AT1B 4FNHA 1XJWB 3H42A 4P2SA 2R2SA 1RWNB 2ZC4A 3QNWB 3JSRA 3OTOF 1JJCB 3BGRB 1VFJA 3HVWA 2NQPA 5GADI 1C1BB 2AJFE 3MD3A 1VQ7S 1XNQF 5F8MA 4FNIA 1WF0A 2F8MA 1RT5A 2MSTA 2YNHB 1P9QC 2KB2A 2MZSA 2B4VA 3G8SA 1WJ9A 2W9CB 3R1LA 3NOGA 5F3TA 1VQ9S 3T1YF 4ER8A 1WHXA 3JXOA 2LXUA 5F0WA 3RBEA 1SH3A 3KHRA 3CC4S 4TYAA 3MPWA 3O44A 2YNGB 4X66J 1LXJA 3DRRB 3MPVA 1RU2A 3D3CJ 3K5PA 3X3UA 3HK2A 2FLOA 1K47A 1L3VA 4WXWA 2BE7D 4L73A 2FVPA 3LA0A 1S6QB 1HNXJ 1VRQC 1NH7A 4ED3A 1URNA 3UCGA 2DGTA 5BYRA 1HWLA 3J7AN 3VGVA 3RRKA 4X65J 1OY8A 2V69A 3EYZA 2F4VJ 1Q0NA 3EUNA 4PUOA 1I5OB 1LFWA 1JQGA 1SQEA 1JLEB 2Z4PA 1Y10A 5LJ3Y 2AJ1A 1N34J 1DLOA 4M5JA 3CJ2A 1T0TV 3Q8VA 2FVSA 1NJYA 4C98A 4BHQA 4YUDA 4C3KA 2Z2YB 4DR7F 3A8JA 3D0HE 2H54B 1RT7A 4U9RA 3W5XA 4RW8B 1M1KT 4EGLA 5HATA 5J1NA 5LM7E 4DCPB 2HFZA 2XHCA 5ETLA 1KVKA 2Q79A 2X3GA 2ZZNA 1T9XA 1YRUA 4RPFA 3SCLE 4L6V3 1T95A 5THWA 2AZ3A 1CPZA 4DR4F 1ZH5A 4URSA 2NUUG 3K0JA 1CVJA 1G7CB 2FPHX 2VZ9A 3IBWA 1IUJA 2K8GA 2D3O1 1JLGA 4OJ1A 3OR2A 2V9KA 3IWLA 2JEJA 2Y1IA 4GO5X 2AD9A 3GFHA 2QFJA 1R3NA 5E0OA 2W7OA 2DB1A 1VQ8S 3BJYA 5KT5A 3LP1B 1AFJA 4LFAJ 1UJ4A 1TKDA 3JAMY 4PQUB 3MEEB 3H25A 3MF5A 2BRLA 2DYAA 2R7WA 2FJWA 3VZIA 4J7CA 1YI2S 2WSEC 2B9YA 1NDPA 1PILA 4IUFA 1SC6A 2F40A 1R8AA 6AT1B 4OL8A 3MR2A 4DSJA 5LSRA 1IJEB 1BGXT 3R6GB 4C0HA 2HGLA 4JV1A 4G1QB 5J2NA 3A3PB 3NP5A 1NNDA 4N8NA 2YQ1A 1FDDA 3KJFB 1C2PA 5F8HA 5G4DA 1C0TB 1KTVA 3DU5A 2QMXA 5KFCA 4U67Q 1YGYA 4I2QB 3MM5A 3DLEB 2JRSA 2C3YA 1CULB 2G4BA 3E51A 3TUZC 2IPOB 3CCES 1ULRA 3TZWA 1W2IA 2AEFA 4NYOA 1V3RA 4F4ZA 1VS3A 2CRLA 1U2RA 3D6MB 3JSMB 2PD1A 3D1OA 4FXDA 1ZAWA 3OL8A 4Y2CA 1VJWA 3SDEA 3M30B 5DDQC 4DUYJ 1DQ9A 1FD2A 3TAQA 4HACA 4IO1A 3DHWC 1YJVA 1HNZF 3CE8A 3POTB 3W2WB 4WE1A 2CKWA 2CWXA 3MEKA 2JOQA 2DY9A 2KU7A 3MMBB 3WX8A 4W92B 5ETKA 1KOHA 1Q4RA 3J7ZT 5T7LB 3MR3A 2AQ4A 1AW0A 3KUEA 3CW2C 1JLQB 2M4MA 2J6TA 2WZ1A 3THTA 1KR4A 4QZVB 1RYSA 4K0KJ 1F2HA 2LQJA 4DSKA 1YX2A 3H40A 3MMCB 1B0PA 5CCLA 1K0VA 4EEYA 1ZA2B 4WF9Q 2BE2A 2W9BA 1L3TA 4J9SA 4LFBF 3IR7B 2DXFA 3CJ4A 1NPPA 4EUVA 1HHTP 1T94A 1YJRA 4OI3A 5J2MA 2VOOA 3NAIA 1UVMA 3NL0A 4YFUA 3I31A 2HRYA 1RWKB 5GAHI 1RHUB 4B3SF 1Y5LB 2DNZA 2GA7A 2GJIA 4KFBA 2GO9A 1Q79A 4WXOA 4F2SA 1FXDA 5KFGA 3UE2A 3T5KA 3QGGA 3OXLA 3LWMA 5F3ZA 2QSFA 4DLGA 4DCOB 4O23A 3N6MA 1M1GA 2E5IA 4F2RA 3T1HF 4F02A 4J9UE 2YY3A 1J5OA 5J1EB 3T1AA 1NU4A 1YLXA 3OTOJ 1NCLA 3CD5A 4QBUA 2QLJB 3KG0A 2Z2LA 1GFWB 2H48B 4NA3A 4PWDB 1S1VA 1VJQA 1T05B 2XTJP 5L1LA 2AGPA 3AH6A 1WHVA 3TA1A 2I9SA 4ANEA 2JC1A 4H4MB 1FK9A 1R0CB 3T1YJ 3ONQA 1HQEB 4D3GA 4TY9A 1VRTA 2DHGA 1MN7A 4IRDA 2FJBB 4HDHA 3V81B 4XDCA 5KFIA 2DIUA 5LXYA 1MWZA 3CWJA 3J80U 5EX3A 3CCZA 5KG7A 4HR2A 2F3JA 1M5SA 2VG6B 3VAIA 3BZQA 2QGFB 5E3AA 2XYHB 2G1HA 2E1AA 4C4WA 2HFSA 5KT4A 2DNYA 2JEIA 5RUBA 1SJRA 1EIYB 3C6UA 2FJVA 2VUGA 5HJYA 2HK3A 2Z0GA 1LW0A 2IA6A 3KLIB 1HNIA 2V4JA 4DR5F 1UWAA 2CPDA 4OLPA 3NMAA 4MK8A 4LRFA 1U1QA 3I82A 4PXDA 3FFIB 2VA2A 4EZ9A 4YB6A 3J7YU 2P6SA 2ASJA 1REVA 2X3DA 3QZ8A 4DR7J 2IJRA 4LSZB 2MKCA 1RA6A 1HQUB 4J5OA 5ETSA 3FCHA 2YKNB 1YZ7A 3GIMA 4EBDA 4TYBA 3T5LA 1T9WA 2HQDA 2DGXA 2R42A 3FSYA 3EWGA 3TANA 2VKRA 1UEVA 2B8QA 4ECXA 3TUIC 5IT9Y 1RTJA 3VALA 3QGHA 3G86A 4USHA 4DR4J 1CJTA 1X4EA 3MEDA 1Q7YT 1WORA 2XSJB 2YWWA 2DNLA 3M32A 4WTOB 1SJ1A 5C24A 4PQAA 4XO0A 2RKIA 1NH8A 1K8AT 2XO6A 3ZZYA 4P2XA 2M8HA 1BQMA 5CZXA 4OX9F 1NSKL 3RBZA 4JI4F 4JOUA 3SFGA 2MKYA 4C3MA 4ICLB 4X4SA 4B9VA 4ANCA 4ZK7M 2QX0A 3KK3B 3CMES 4ZJLA 2DEJA 3NWGA 1T03A 4NYZA 4XDDA 3V6JA 2AU0A 1HNVA 1FKPB 3W1YC 4JI7F 2I5JA 4FPIA 1S6PB 5EWGA 3FSIA 1Q5VA 4Q7AA 4E8UA 1UW9A 4PCQA 5IM0B 2GW8A 2CUYA 5DM7Q 4CH7A 2HQGA 3AJDA 3HFVA 4MYTA 1I94F 4YB5A 2B5JB 1RT1A 4DQQA 1X4BA 2CVEA 3FNNA 5M2UA 4QPTA 5K8MA 5HVFA 3UO0A 2MZRA 3BBCA 4N77A 4LREA 2NXNA 1EETB 2PA3A 3RRHA 1S9EB 3C19A 2G0CA 5KTQA 2C22A 2IRYA 2BQUA 1V5IB 5E3CA 5LSOA 2NS1B 5EUHA 4CI0B 1SQFA 3GP9A 1ZTTA 2LXIA 2EC0A 4JI3F 3TR5A 2HZVA 4R0JA 3QIPA 2XMWA 1NKBA 1S99A 1AZSB 4JP8A 4WIQA 5U47A 2ZKUA 2ATCB 2R8KA 4ZVRB 2K3KA 1RCXB 2GS8A 3IN5A 4MKYA 2BJ8A 4IDKA 4ZLNA 3BPDA 4KR0B 1SL0A 3TA2A 1D9AA 2KFYA 3A3NB 2Y3YA 2MKJA 3EXYA 2VG7B 3MTKA 3R9LA 1NO8A 3BDPA 5AT1B 4X4UA 1TL7A 2XYPB 3A8KA 4XTTA 1E6YB 1TMMA 4NRTA 3OFHA 4NMLA 2DK2A 3D66A 4X64F 3M7VA 2R8IA 1MWYA 1VI7A 3AHPA 3I5CA 3RW7A 3UPFA 4FPRA 1HMVB 3BN4A 3FGVA 3K8VA 3I0RB 4LFBJ 3FEXB 2GIQA 4ZVEA 1VRUA 1FX4A 3CJTA 1IWGA 2ZZTA 3MMAB 3AOCA 3AXMA 3KHHA 4Q2MA 4B3SJ 3PY8A 1JJ4A 4DPTA 3IO1A 3NMRA 1IR0A 2OKQA 1ZYQA 1V6HA 3HM9A 2Q66A 3KG4A 3H4BA 4QJVA 3JQJA 3W64A 2CZVC 2F7VA 2ASDA 1BLUA 3CD6S 4LF6F 5A8WA 3VAJA 2L3MA 4OV1A 4C8KA 1FDNA 2X1AA 1RBAA 4K50A 1SBRA 3ZC4A 2BJ7A 2NPIA 3B78A 3JS9A 2DNMA 4Q0BB 1D1UA 1UPPA 4C8MA 2E7WA 4NZ7A 4DN9A 1GXLA 5C7PA 2RE1A 4CO0A 2JSXA 5C2GA 1FNMA 2OD6A 1QSYA 2DPJA 3AXKA 2HHUA 2HNZA 2LKZA 3OJUA 1FWKA 1AB8A 2VJUA 2H5JB 2HWTA 2E5GA 4TXSA 4NLUA 4LBPA 3OUYB 4DR3F 4PPZA 1CC8A 4IH7A 3DLHA 2HAIA 5SZTA 2G0IA 5C2CA 2IMWP 4ZJQA 3LO3A 2AWZA 1S5ZA 1SV5A 4KT0C 3AB4B 3FZBA 2I8EA 3BQ2A 2I0XA 1RTDB 3M4XA 3UR0A 1F5BA 2IYGA 1WEYA 1OYEA 4P9SA 2RQKA 3CCUS 2FJXA 3DLGB 1RAOA 2B56A 1WTBA 3FRYA 3BV8A 3NY0A 2LA4A 3QAEA 4DR5J 1IKWA 4OV6A 5HANA 3NRBA 1FCAA 1FJ7A 4RW4A 3HX9A 4OIXA 4NLGA 4I4BA 1QAXA 4BS2A 5KG3A 3ENQA 4OYXA 3R5CA 5KFJA 1JLAA 3HT3A 3BN7A 2PT0A 3FBFA 4NLYA 1X60A 5CH7B 1H2TZ 1F9FA 2W1BA 1FJCA 3C46A 2OAUA 2DH8A 2VKZG 1YKWA 3GSIA 3I87A 3G71S 2HIQA 1S9GB 3DOLB 1W25A 1FO1A 5LT5A 2RF2A 2A10A 2U2FA 4GO7X 2KT2A 5DM6Q 4KH0B 2HRUA 4EO6A 5KFXA 2JEFA 1HBNA 1FE4A 3UW1A 5AXKA 4XPCA 3TQ1A 2CJ9A 1CSJA 3Q83A 3UQSA 2KHDA 3H4DA 2ZJPQ 4B3TF 5B7WA 3NS5A 1EARA 4DQPA 2QV6A 1CQNA 1FJGF 3M2UB 4TU8A 1KBRA 1GQEA 5HLFA 3AA8A 2LDYA 4YHHF 4LSLA 2J9CA 3K58A 4OX9J 1YG0A 4Q2LA 4DR2F 1ZS6A 1ZA1B 4JI4J 3P49B 5F8LA 2OLWA 4DR6F 4TY8B 2ATLA 1U48A 1SIWB 3KMSA 3H8YA 4J9KA 2JLGA 1HBMB 3HVRA 2AW0A 2MPUA 1YVFA 4LF7F 5MAOA 3TRGA 4LIRA 2HSEB 5GMKa 2FVQA 1AYEA 4QWCA 5J2PB 2KVIA 2A2CA 1I94J 2QA4S 2QYCA 2F1FA 4F04B 1AA1B 1GX5A 4OHXA 5DZ6A 4J9PA 2V5HG 2ZZMA 3CTRA 4CLLA 2IDEA 4LJMA 2HHQA 2DNHA 1LWXA 2J7UA 2CJYB 3BKUA 3MM7B 4DQIA 1IM4A 2HNDA 1FEHA 4WTYA 4ZS6A 4R8UB 4WFXA 1XNRF 2V8PA 2HFVA 3PXGa 3U1LA 3TAMA 2C3OA 3IM8A 2MZTA 1TMJA 1J2VA 2OP5A 3MAHA 3ILIA 1UTAA 4KPYA 2ABYA 1CG2A 4IG0B 3RTVA 2FLLA 4AFFA 4WU2A 3ICLA 2KRBA 3CB4A 3H98A 4JI3J 1NJZA 4H4OA 2WVFA 4BLGA 4PWWA 1ZPVA 2HAFA 3KLHA 1XEZA 1U1LA 1CJKA 2ASLA 2DJWA 4WFAQ 3CJKB 3M9OB 8AT1B 2DO0A 2XLIA 1OIAA 3BREA 4ED1A 3OFGA 4V19J 3CC2S 1XC9A 1QLNA 2RQMA 5F9LA 5KFOA 1XN9A 1PYSB 3DCAA 4ETXA 3GCXP 1MU2B 1XMQF 4DFMA 5A76A 3KLEB 4X64J 2C2NA 1TKTA 4LSNA 4KO0B 1GEHA 2KHCA 3CJ8A 2WBRA 5EWFA 4BDPA 3TNVA 3HHEA 3T41A 4FVCA 4PR6A 2ZVSA 3C6TB 2D3OR 4ED6A 1H0HB 2WSFC 3ZXWA 3QQCD 4P52A 3OTBA 5CD4A 3RBDA 2W2NP 4F3MA 5CYQB 2BBEA 4OX7A 4QR0A 1NPKA 3QFHA 1F9EB 4WP9A 5DRKA 5A6WA 2M70A 4LF6J 3MURP 2FLNA 1NM2A 1HQ2A 3VAGA 2GIFA 2R2UA 3EVMA 4QIGA 1MWQA 5A6PA 4X4RA 2YX4A 5ADZA 4FP9A 2FC9A 4GKKF 2PEBA 2KVQE 4O0NA 1FXRA 1OSCA 4YB7A 1SKSA 2C3PA 4ZOSA 4M5HA 2WBMA 2O1PA 1M5VC 1CJUB 2DO4A 1TL5A 3J80Y 4BWMA 1HBUA 4ZDNA 2CPIA 3OL7A 2FJDB 5KFBA 1TL1B 1MN9A 3GPAA 3N4WA 4QIEA 1NK6A 4A8XA 2GVDB 4MKVA 2Q3PA 2AP6A 4ZP7A 1YK9A 1GTHA 3BDEA 4DI6A 2DCUB 1QUPA 3SIPB 1X5PA 1UJ5A 5KFFA 4M8LA 2KJWA 2RD5C 2Y0SD 2BDPA 1TFWA 4CNZA 3OV7A 2BXJA 4IKAA 3GQCA 1BQNB 3GMGA 4FN5A 3KUGA 1K1SA 3V4IB 5KG1A 4AYBD 2AJ4A 3QLHA 2C2MB 1PAUB 2ACYA 1S1TB 2CJXB 2G0JA 2DISA 3LANA 3OHBA 4KGXB 3OJSA 3D6HB 3PVXA 1TL3B 2B7BB 2IVFB 2AEMA 4RNOA 2JVOA 4UOFA 3TEGA 4ZVTB 2EPIA 4BWJA 2XG8A 2WK4A 1S0VA 2N7CA 1JKHA 4OQJA 1UEUA 3UN2A 1FRXA 2ILZA 1EQ0A 2J7WA 2JFDA 2UUAF 4RNFA 4AXIA 3H2VE 3TEHB 5T41A 3I5AA 4MFBB 2XSFA 4KBIA 3NBPB 3TW0A 4JV2A 3PO5A 2RHQB 3AD8C 2F8EX 3PM9A 2AGOA 1W2BR 4WK1A 1K9MT 2OMOA 2DR5A 1DHMA 2OUGA 4B3TJ 4YP3A 5CQGA 5I4MA 4KV8A 1FJGJ 3AD7C 4KQZA 4DZ6A 2AJQA 3UR3C 4YHHJ 3M2VA 2XNQA 4F67A 3Q8PB 4LQ3A 4BC7A 4AD6A 1SH0A 4DR2J 5D0GA 1VISA 4DG1A 4LF4F 4M5IA 3P5BP 3KFWX 4DR6J 1TUVA 1WKKA 3T5JA 5LOQA 3N79A 2BUNA 1UFLA 4N56A 4CWBA 1Q5YA 2GQ2A 3TVKA 4ES3A 4RW7A 1JNZB 3PV8A 3BB5A 5B0CA 2B9WA 4RU9A 4LF7J 2BANA 3FVYA 1OSDA 5BR8F 2LECA 2E1RA 4L76A 3K57A 3NS7B 2HBQB 4ZP8A 3U27A 1WUUA 3GLJA 3HHDA 1B7YB 3HZGA 1H98A 1KLMA 4XIUA 5AE2A 1Y4ZB 4Z7YA 2HLUA 3AD9C 2LMIA 2AKWB 3DLKA 2LEAA 5FDLA 1XNRJ 5HK4A 2LCWA 3FC9A 3KXDA 1DLOB 1QTMA 4B9SA 2BZ2A 1Y5IB 4EMDA 2EK1A 3UWTA 2Z57B 2KO1A 2GVZA 3SV4A 3GTYX 2AYEA 5L1IA 1RKIA 1HIYA 1SCJB 3T9NA 1RT7B 4TLRA 4B17A 5D4OA 4NEZA 4UW2A 1EQMA 1T7PA 5I3QA 1SJFA 3DOMA 3PTWA 3CCRS 1OQ6A 4ANDA 5I3PA 4ITSA 3WX4A 2NCKL 2GQCA 2BA9A 1RTZA 2Z2MA 4OYAA 1IQTA 1RBLA 4TQRA 2IRXA 3MM6A 3O5TB 4PXEA 1VR6A 4BBYA 2F4FA 4ATNA 2WOMB 4IRKA 4OI4A 4RR5A 2VV5A 3B82A 1XMQJ 1IBLF 1JLGB 3OR2B 4C11A 3HVTB 1TZ0A 5KG6A 5G0RA 4G3IA 4OHWA 4URGA 2V67A 2ZWPA 2MQPA 1WD6A 1RXOB 3QT5A 2HS3A 1LOUA 5CABA 3FCVA 1S1XA 2HHTA 2M3DA 3O3LA 1R0AA 2VQFF 5D0RA 3CCJS 1T9UA 3DXBA 3BGOP 4U7UK 1QSLA 4ZPBA 1Y11A 2D74B 3KLGA 1KWMA 4MKBA 2MLYA 5A8RA 2HW3A 1RWOB 1UVIA 5HL7Q 1JWWA 3FBEA 3X1LB 2EFGA 2EKNA 4O44A 4QQBA 1A0OB 3Q23A 3S1TA 3SCIE 2PA8D 4OMFG 3ILLA 5K20B 2DR8A 4IQXA 2PFFB 1VIXA 4F8RA 2PIIA 2CAJA 5D15A 2XYGB 4ZPVR 4GKKJ 3TUPA 2EKYA 3A13A 2IBKA 5KT3A 1DBDA 2H4WB 3MM5B 4ES2A 1V9OA 2ALZA 1U8SA 5CXTA 4ED4A 2VICA 3PRBA 1H72C 3W62A 3P3DA 1JLBB 4F4XA 2R8HA 4DXLA 2FUG9 3K5MA 4U96A 2BQRA 4J9LA 5EWEA 2XZTB 3SDEB 5FJ4A 1OJ4A 1N8RT 4D3HA 2G2YA 2JNJA 3DDIA 4P7VA 4HACB 4ZMMA 2FZCB 3MR6A 5B0BA 2IYIA 2HS0A 4WE1B 1T8EA 3ILJA 2O3DA 2J0SD 2YWGA 1NJXA 1SKWA 5K8OA 4CH0S 2EFVA 2DCLA 1KVJA 1QUVA 3KJVB 4OZ1A 1BC6A 4L75A 1KD1T 2R7OA 3LAKA 1N0VC 3N01A 3FK4A 4OYZA 3VCDA 5K8NA 2EW9A 5GMDA 2KFNA 4AQYF 4RUCA 2XY6A 4DCJB 3MHYA 2BE2B 2W9BB 2JEGA 1HYSA 1C1CB 3HFZB 7FDRA 2G2ZA 2NREA 5J2MB 2L41A 1VC6A 1UETA 3BKFA 2LEPA 4ETZA 3KMQA 1Y3KA 3CJ3A 2UUAJ 1UVKA 2ZUAA 4IH6A 4KFBB 2B6AA 3LP0B 2HS4A 3HHLB 1XBWA 4B3OA 1X5TA 2B51A 3UN3A 1P9YA 2HHVA 3M8QA 1I51B 1S7IA 3AJ2A 3H2LA 5HO4A 1OY9A 3UVJA 3TARA 1YJNS 3HHNB 1RU1A 1J5OB 2OEJA 1LWFA 1H2VZ 4ZCIA 4J9VA 4QR1A 4ECQA 1VQPS 3T6JA 3RAXA 2V8VA 1RWUA 1S1VB 3QJJA 4LF4J 1ZZFA 3Q24A 5KOWA 3Q89A 3IMQJ 2V2QA 1YJUA 3AY0A 5D0HA 2FJEB 5ETTA 1SKUB 1VC5A 2QLFB 5B0EA 4PG8A 3QAUA 3LALA 4QU7A 2OPQA 3HLUA 1VRTB 1KP6A 3IGNA 2XZWA 4EFAC 2K3IA 3GJSB 5BR8J 1PCAA 4QIFA 5ETNA 2DD8S 2XMMA 4C0OC 2MJNA 3QMQA 1KKHA 5ETQA 3DRSB 3AOAA 1YDLA 2VPZB 4QCLA 1ICEB 4GVLA 3C6UB 2YWHA 4NRUA 2ZH8A 1LW0B 1HNIB 1EB0A 2EFOA 4YN3B 3ZTPA 5DDOC 1T3NA 2HBZB 5DLGA 4DUZF 1FRLA 1HWUA 2FJAB 2YNIA 1RT6A 1LQ9A 2F9JA 1OS5A 4KYZA 4K2JA 4ECSA 1REVB 3W9HA 2OMLA 2IM1A 4OI2A 3TX8A 2F5GA 5A0YB 1OYDA 1VQ5S 2FYXA 4O3NA 4Y3CA 3FMBA 3SEOA 2HFNA 2CG4A 4KGKA 4PG5A 2GJ2A 2CJKA 2IVYA 5D77A 2CDRB 1RAFB 2ZVIA 3MWBA 1SC3B 4X4NA 5CD4H 4NLOA 3MPUB 1NZAA 1CJTB 3UCUP 3M8PA 2HK2A 4OZ3A 3MEDB 4F4YA 3M32B 1BWVA 1IBLJ 4QIWD 1D0EA 2ZJRQ 5IFMA 2RKIB 2WHOA 3EGWB 3FKBA 1PC5A 3DYAA 4FS1A 1G3OA 2KT3A 4UUXA 2M5YA 2VDIA 4DUTA 1EAYC 2HBRB 4RW9A 1HI1A 2E29A 1B99A 4C8OA 1BQMB 3MI7X 2YVSA 3MTJA 1AUSL 3EGVA 2E5JA 2LLZA 4RKUC 2RDDA 3EICA 2IRUA 2EBGA 3QYYA 2GHVC 2VQFJ 4LF8F 2G1DA 3M1VA 2B3TB 4FYDA 3A8IA 4C97A 2UVRA 4QPXA 1T03B 1LFPA 3C66A 1VMBA 3GCWP 5EN1A 1HNVB 2I5JB 3NCPA 2E1CA 5KT2A 2AV5A 2CPZA 3ZZZA 3ZO7A 1P1TA 2YH0A 3KLVA 4BCAA 1ZOTA 2CZ9A 1WF1A 1C1BA 2ZNZA 1RT1B 3QWUA 4DFKA 4P6QA 3LPEA 3D0GE 3AJ1A 1U25A 4NLVA 3G6ES 4Z37A 2J8SA 2L48A 1RWWB 3C3LA 3VAKA 1JB0C 3ITHA 1RHJB 2BW2A 1YTYA 2X51A 1PJ5A 1N5TA 4FYVB 1IXKA 4U7UD 3BEGB 2AT1B 3EPIA 5H9EJ 2YNGA 3BR9A 3A1YG 4YR0A 2QTWA 4F4AA 4UZBA 1DY3A 2CNNB 4ZJOA 4ZVFA 4IOBA 1LW2A 3SXLA 3IA0A 1U49A 3SSRA 3NCRA 3QIPB 4X66F 1X0FA 2BYCA 3ENAA 4J37A 3CCVS 2PO4A 2KT5A 4ZLJA 1TKXA 1PIEA 4IDKB 2L9WA 3C15A 4X65F 4IFVA 3GV5B 2C2ZB 1VYAA 2R9LA 4ELVA 2AF6A 2Y8WA 1TL7B 3D7SB 5AXMA 2V8HA 1GXTA 3DMJA 3BGUA 1N36F 2D7SA 1YWXA 1TVRA 4AQYJ 1GAOA 3L7UA 5IWAF 2XMVA 2ZD1A 1WHWA 1Y00A 4N76A 1U6FA 4UTGA 1FVSA 3HD2A 1FE0A 3MECA 4Y2AA 2IHR1 4LF9F 3UDEA 4U95A 1VRUB 5IV4A 2JJ4D 4CT8A 5I3UA 1KHVA 3MEGA 5BYQA 2RILA 3R7NB 4F0HA 1FWPA 2G13A 2W8LA 3QRQA 4QYZJ 3MZIA 5L46A 3L3CA 3CUNA 4IG3A 2V8DA 1KN6A 4WIIA 5A8WB 1YBTA 3D0IE 1VDHA 4YDDB 1AFIA 2KTQA 2H5IB 4PPDA 4A8YA 2V34A 2ZKTA 1WOSA 4NLRA 4WZMA 4ZCMA 3MEEA 2CJQA 2UXCF 4EI2A 3DLLQ 3R7SB 2J8AA 4CNYA 2AYMA 2HNZB 2Z30B 3MPDA 4IO9Q 3MFIA 2OJ3A 2FTRA 2B0GA 4W98A 2BKNA 1RSCA 2VFTA 5HJXA 3FCWA 3ILOA 3CXCR 2E5HA 4DQRA 1T9VA 1VQLS 1SV5B 1LNQA 4MIWA 2OPSA 5D6GA 2OGUA 3HHLD 2CPXA 3NCQA 2B43A 1C0TA 2WB4A 2KYXA 3G87A 3HSDA 4Y2IA 5GAEI 1X31C 1IKWB 4C8LA 1LWCB 5DETA 5B08A 1Q95G 4RW4B 2PEHA 4DUZJ 2XCPA 4M5DA 4DX8H 1JLAB 1U1RA 1CLFA 2N4DA 1G1XA 2FZGB 2ZH4A 3VGUA 1SB6A 3D6TB 2FB0A 2ZFHA 2MJUA 3W2WA 3RB0A 1S1UA 3FRZA 3KWMA 3J81U 3KDOA 3MMBA 4M1KA 2VC0A 3GJQB 3I4HX 4R5PB 5D8HB 2ZITA 3GV8B 3AFGA 3AQPA 1HBNB 5K9FA 2P8IA 4EWTA 1FFGB 1DTQA 4CLSA 3RR7A 5D3GA 2SXLA 1NUEA 4FF4A 2E44A 1RHRB 4A8SA 2XULA 1YIJS 4P10A 3W63A 5HLFB 4GRSA 2NUHA 4RLEA 3D54A 3IG1A 3I56S 4USMA 4LSLB 3ET6A 2LXFA 1YRTA 2EI5A 4AE5A 3VQTA 3CCLS 4R25A 2CJAA 4LF5J 3J81j 3QT8A 3GFXA 1JMTA 4OJGA 1MG7A 2M8DB 3LAMA 9RUBA 3N5FA 4LF8J 2XC9A 3H20A 5JVHQ 1HW9A 1VQ4S 3I96A 1JLCA 4GVBA 3I0SA 4AL5A 3AT1B 3GYXB 2M88A 2DRDA 1V3SA 3W66A 1ZTWA 4RBVA 1X7VA 2XO7A 2CPEA 4USTA 3CIZA 3EGNA 5J1EA 4F25A 3T19A 1IN0A 4P74A 5DG9A 3KK2B 2DNNA 1NDLA 1PO6A 4JV5F 1GMWA 3C16A 4HL9A 3C14A 4CLFA 1FDBA 2DH9A 3F41A 1KQKA 2GZOA 2HNDB 3PYFA 3QZ7A 3LH2S 4MT1A 2CQDA 3PX4A 4UOCA 3OHAA 2C2EA 5L9NA 1HD0A 5H9EK 1U1PA 3TAMB 3B4MA 2QJ3A 2RUSA 4O3RA 2WVCA 1HI8A 1U4BA 2RQ4A 1RA7A 2RJZA 3DGPA 3L4BC 4ED5A 4ES1A 1FWLA 5B0FA 7FD1A 2WTFA 4WFYA 5E5NA 3LTOA 1JJ2R 4YR3A 5KFEA 4H4OB 3DRPA 4GKJJ 2D9OA 5FIIA 2RMLA 3KDNA 2VFVA 1NDKA 1U09A 2QC3A 2JFKA 1CJKB 2C3UA 4I68A 2BEFA 3DDKA 4FS2A 3MCMA 1BQXA 2DHAA 2RS2A 5C42B 5KFQA 2FHJA 2L9DA 2EFNA 4HT5A 4GC7A 3I6PA 3MM9B 5IQ6A 5IT4A 1APSA 2QLBB 1B64A 5ETOA 1PSDA 1RWVB 3FUYA 1Q53A 3K17A 3MCOA 3GR1A 1RAGB 1N36J 2XY7A 3KNGA 4X62J 2UV8G 4LSNB 1F1BB 2YKNA 5IWAJ 3B6BA 3CEDA 1QM9A 1BMQB 1YQHA 2O66A 1NBEB 4MMOA 4LF9J 2OSRA 4UT4A 1RK8A 4F36A 1VOMA 4RNMA 1UFKA 4QYZK 4I7FB 3ISZA 1LV5A 1RHQB 3DC2A 3DM2A 3F56A 3BO4A 3NAHA 1SUQA 1N88A 1VIOA 4F3OA 3Q8RB 4OFZA 1X5OA 4ILRA 4XAKA 3NKYA 1S72S 1WC4A 4LUBA 1KRPA 5IC6B 4LRDA 4Y0FA 1BE4A 2R7XA 1U1OA 3E01A 5KG2A 3LGHA 3A4TA 2CQ1A 1VK8A 1YSJA 4ICLA 5MLCV 2UXCJ 4CYUB 4ZLLA 1RQ0A 2A2DA 1Q16B 2FY8A 3RU0A 4FF3A 4ZPWR 3S7RA 3ZZPA 4ENOA 2V63A 2BKOA 2WVDA 2HWIA 1HBUB 1S9FA 1FJEB 5KFKA 4A48A 2OI2A 1RAJA 4M5LA 3NLCA 4C0BA 3R6LB 2V2VA 3TZZA 4FF1A 1B0TA 3R2DJ 1FERA 1PJ7A 2DNRA 2LEBA 1RTIB 1WEXA 3W65A 2J0XA 5AJ3F 5J1PA 1TL4A 1YRXA 1EETA 1KHWA 3OT9A 3CJ0A 3EGZA 2KXFA 3D5MA 4X4OA 1RAIB 2UXBF 3HZEA 2AYGA 3CCWA 2DNQA 5CYJA 1RT4A 1SQGA 3CNQP 3QLHB 2VFRA 1S77D 1NJWA 3CSKA 1O8BA 3HHKA 2AX0A 2DITA 3O8WA 1ACMB 4B08A 1RACB 3G2XA 1BY9A 5KFZA 3TI0A 4ERDA 4F3QA 5HQMA 2M2BA 4K4SA 1RHKB 2MZ1A 4UOGA 3M2RB 5KFDA 1VQOS 1K44A 3UDVA 4RNNA 3MM8A 3OR1A 4WKYA 4DEZA 2RRNA 2VG7A 1HI0P 4RUBA 2LFVA 3ZTRA 4DSIA 2V94A 5B09A 3K5NA 1NKCA 2UUBF 1I3OB 3OD2A 5HVGA 1V5VA 5AXLA 3OLBA 4KRWA 2VA3A 1TV6A 2CWKA 4KV8B 1VCTA 1H7WA 4JI0F 1FRKA 3E8OA 4WFZA 1PBAA 2UVUA 2GV1A 3HO1A 3M2VB 1UKUA 5F8NA 3NNCA 1N54B 4X4QA 3P4UB 3W2VA 2OPRB 3PACA 3SFUA 1UMJA 4EBEA 3JSBA 2R7UA 4ED8A 3CO9A 2FHMA 2NXJA 3T6BA 2R2RA 4UQGA 3AODA 2OTLS 4RW7B 2A18A 4QIVA 1R31A 1ZAVA 3GILA 3SSQA 1FESA 3IM9A 3KUHA 4B9LA 2C42A 1WC5A 5HBMA 1GX6A 4X84A 3M8ZA 1U8WA 1S1WB 5ETPA 3R5BA 2BJ9A 2E9TA 2QO3A 5HQ8A 4JV5J 1KLMB 3TP2A 2JHEA 4PEOA 2V0NA 4IFYB 3WIVA 3DLBA 1D9DA 5J2QA 3U7JA 5KFWA 2IY5B 1S97A 4ZPDA 1WG5A 1WHYA 3DLKB 3MXHP 3IBCB 2K2PA 3R5JB 2LQ9A 3CJRA 3ZZUA 4B3MF 2YX1A 3N9UC 2RIJA 2ACMA 1VLOA 2GVZB 4DV5F 2HHPA 2UVWA 4RW6A 3EE3A 4Q43A 5E33A 1L5UA 1M5PC 3SSSA 1XIQA 2UXDF 3E2EA 3VF0B 2KM8C 3GR0A 4KSEB 4FZVA 4K4WA 3DLGA 3WDOA 1U6BA 5LJ5Y 3OXGA 3HULA 4LR9A 4EZ6A 1X4AA 4DPXA 1N4LA 3CULA 1NB2A 1U0HA 2JDJA 2Y1JA 5SUHA 5CCMA 2W4PA 5KFUA 3IRWP 4A8OA 3DDNA 3I4PA 1UWBA 3PX6A 4TN2A 2EG2A 2JVRA 3MM6B 2VH7A 3BYPA 4HI2A 4DPWA 1OMSA 4I56A 3CMQA 2MQQA 3L95X 2KJVA 5G0RB 2RNEA 5JXSA 2R8JA 4JI6F 2E9ZA 3EVOA 4DL4A 3WC2A 4ZVSB 3QT7A 2H65B 4PYDA 1NHVA 4K4ZA 2AGQA 1K1QA 2XWXA 3J7A1 3TJAA 1R0AB 3MFHA 2J9DE 4LT6A 2KYZA 2KL8A 4V1Ak 3K2YA 1S0NA 4WFBQ 2V8GA 3KLGB 4Q8EA 2FZKB 5A8RB 4USKA 1DFDA 2MY7A 1B0VA 4WP3A 1MMNA 3HJVA 2AYBA 2V2ZA 1WOPA 4O44B 2HNYB 2CIMA 4Y00A 1ZBTA 1PC4A 3CCSS 2D9PA 1T3OA 1BD6A 2QT7A 4K4TA 1F9HA 1FTRA 1DQAA 2Y8YA 2LU1A 5GAEU 2ZNYA 1Q78A 2MXYA 3IXQA 1QVFR 1N5YA 4AUKA 2X1BA 1RABB 5JVGQ 4LRAA 3HCXA 3RR8A 2E7XA 2QL9B 3CVKA 5ETMA 3WBZA 1TTHB 1U1MA 3O6QA 1RTHA 5HQLA 4P73A 4LRBA 2HHSA 4CQ1A 1NRKA 2V4RA 4ECWA 3PX0A 3M6VA 1ZM4A 5KFHA 1X4FA 2NYHA 2BABA 1VQYA 2DGVA 2WVBA 1HWIA 4CLPA 5C5JA 3VAHA 3FQKA 5AJ3J 2Y9HA 4NZ6A 3V4MA 4PKDB 1RT2A 4CM2A 3TZXA 3H7HB 1IKXB 2GJFA 2UXBJ 4N47A 3KLFA 4ED7A 1WEZA 1Q8BA 3EPGA 2XZDB 2J6SA 1TFYA 1A6LA 1DTTA 3J81Y 4NX9A 2D1CA 3EXCX 5AE1A 1VQKS 1FEEA 1NK7A 3UD5A 1HYSB 3EDRB 2YQ3A 2GO8A 2ZM6F 2QA4G 2DGSA 5A8KA 2IFXA 3C8YA 1J5EJ 4LRCA 5E7OB 2VDHA 3TUJC 3VHQA 2BACA 4DL3A 3CJKA 3S8SA 5A2QU 1CQMA 3H2UB 3BR8A 1DARA 1UJ6A 2YKMB 3QSIA 5HVHA 1N6QA 2B6AB 3VR1A 5KAKA 4DV6F 4B3OB 1MU2A 5EHHA 2LA6A 2HHHJ 4J9MA 2R7SA 4NZ0A 3LP2A 2UUBJ 4LFCJ 1PJ6A 2DHHA 3UVJB 1M5OC 1WC0A 3KJQB 4X4PA 4JI0J 1LWFB 2VF3A 2Q1LA 4ED0A 4EBCA 1ELOA 4KY3A 3WZ0A 1KDNA 1VQ6S 2Y1LB 3PHTA 3AA9A 2AZ1A 1JLFB 1I6JA 3TVYA 2B9EA 1TK5A 3ISNC 5E3PA 4A8WA 3W60A 2CZ4A 3D1QA 2J0QD 4CTAA 1GNKA 4KPCA 2CDQA 2BX6A 3D67A 3R8YA 2MKSA 1R8CA 1UAWA 1SKRA 4H4KA 4LR7A 2XMAA 2OPQB 1DRZA 3CDWA 4Q8FA 1RT3B 3GU0A 3MPYA 4M5GA 2QRRA 1HARA 3MCNA 1MROB 2DXDA 1D09B 2IC3A 3CGIA 3GIJA 2L9NA 2OSQA 4O4GB 2QIFA 5CZVA 1ZM9A 4ZLPA 3F73A 2GHWA 1HHQA 4C9DA 4ELTA 1QVGR 1AT1B 4USIA 1S79A 4N7TA 2AIRB 1GTEA 1CJUA 3NGUA 2LP4A 1S6OA 5KT6A 4F4KA 4LF2A 2YNFB 5KG4A 1SJQA 1VGYA 5L9XA 4LR8A 1WELA 1RDRA 1IKYB 4DX5A 3KK1A 2YNIB 1N5SA 1RT6B 4B3MJ 3IS9A 1F6TA 2RDJA 1RCOB 4WJBA 1NHUA 4DV5J 3TYTA 5HP1A 4I2PB 4NCAA 2PMWA 3PYGA 2UXDJ 2R4FA 4DV0F 2XMTA 4OX8A 4TU9A 4OZLA 1YITS 4I0WA 2MHEA 4RJVA 2POKA 3V4IA 2W25A 2C2KB 4MIAA 1RHMB 1DZ5A 2W4DA 4DJBA 4RU2A 3PJWA 1KNZA 4IH5A 1N33F 1WDTA 5F9NA 2RVJA 3FQLA 3M8PB 4GMKA 4F26A 2Q43A 4H4KC 4F0MA 3DN9A 4NWBA 1W26A 4IR9A 3BM7A 3DYAB 1FTCA 2ZH9A 1XWLA 1FVQA 5ETRA 4JI6J 1F2GA 5E2QA 2RU9A 3JTOA 2LDIA 2ADCA 4NXMJ 3FBBA 3RBXA 2MSSA 2QL7B 4IR1A 2D69A 3DOKA 4DHVA 2DR6A 4CH1A 2ZEJA 1YBAA 3W7BA 1HPZA 3M1VB 1X9SA 2R7TA 3DNCA 4C2MA 3E3XA 2A3JA 3KHGA 2DHXA 3HSZA 4HH0A 1RUSA 5L1JA 3PCOB 4CLUA 3SZ2A 1NMEB 4USJC 2NPFA 3L9ZA 2E7VA 4ZPTR 2VG5A 3M9MB 1IR1A 4B02A 3O2IA 2A6MA 1PG5B 3OVBA 4O0IA 5DJBA 2ZOGA 1C0UA 4ED2A 3ITHB 1FXLA 3G96A 3VGSA 3VZHA 2GFFA 4CLZA 2HLTA 3DI6A 4B9NA 3CDEA 2BJ1A 3ETMA 4FXWA 2VASA 2B8PA 1VQMS 4NLTA 2XMUA 2QN6B 4NLSA 4ZVPB 1LW2B 2C3MA 1S4EA 1NSQA 3OPKA 2ZDPA 3GG0A 4RNHA 3LGNA 4LQ9A 1OQ3A 1O5JA 2FGCA 1TKXB 5KFVA 3JYTA 2YWFA 1Y7PA 3BSOA 1U02A 5D78A 4NLPA 3C15B 3QIDA 4IFVB 1M90T 4DL6A 3I5BA 2V2KA 4M63A 4MYUA 1L3KA 4ID5A 4Z7CA 1X4GA 3KG1A 3DMJB 2B9XA 2QSWA 1TVRB 3G82A 2XGQA 3U1NA 4DV2F 1SL2A 2ZD1B 3ENVA 4MK9A 2OPPB 2CPJA 3OXFA 3GIKA 3MECB 3FEZA 2ZM6J 1W7WA 1U2CA 2OO4A 2FDNA 4DWIA 4PYAA 3TJ9A 5I3UB 5B0GA 3MEGB 4P2MA 1N56A 4U7CA 1XQIA 2NXCA 2ROPA 3OQ2A 1T9YA 4JI2F 2YKAA 1U7LA 3BGLA 1M1HA 1FHTA 5H9FJ 4DV6J 1KQFB 3Q8QB 2WOMA 1JXVA 1SVDA 1IQZA 2FHKA 3RW6A 3HVTA 2YH1A 4IG3B 3NG8A 3LGMA 1QTNB 2HRTA 3GSDA 4HTJA 3HSGA 3WQPA 4ZCLA 3PRDA 3G8QA 3HXMA 4NL5A 1U26A 3MR5A 1G2EA 4ZVOB 3DGVA 3OFEA 2P9CA 4L72B 3PFEA 1MNEA 3HI9A 3EZUA 2XNRA 3OTDA 4JI1F 2NR0A 3HP6A 2KRRA 3OVAA 5H1SV 2PN6A 2J5AA 1HA1A 3BO3A 1IWAA 4RZRA 3C2PA 5HROA 4HHJA 5EDWA 2NZCA 4A8KA 4A46A 3OL9A 1IBCB 3LW5C 2FD2A 3PW2A 2OEMA 3MAAA 5B0DA 2MGZB 3VTIA 1Z2LA 2ZBPA 3LWLA 4OZ5A 4J9QA 2OPSB 2XEXA 5DO2A 2VODA 2MQ8A 4C3LA 1N48A 1F5AA 2HMIA 2MMYA 2LU2A 3TO8A 4DMZA 1CS4A 2BJDA 3S6EA 1H3DA 5C25A 3L7OA 2C28A 2D41A 4OHVA 3FZ2A 3PKYA 2A0FB 2LQ5A 4USWA 2PMZD 3ZTOA 2P2CB 1JLBA 2JWNA 3P8BB 2VONA 1PYOB 4M5DB 4NI2A 3DFEA 1SJ3P 4DSEA 2MKHA 4F4WA 1NK5A 1QE1A 4UF4A 4ZVUB 2EK6A 4XPEA 1GH8A 1XR7A 2W8KA 2YWEA 3B54A 3K7RA 4DV0J 1S1UB 2NXEA 5IT0A 2M0GB 1TR0A 2DGUA 2Z56B 2X7IA 2DPIA 1S57A 3GV7B 1HKAA 3KJVA 5K8PA 1EKSA 4ZP9A 4L3KA 3BSAA 4CO1A 1DTQB 1N33J 2A1BA 2J9EA 4OX6A 4DZDA 5D3GB 1TUWA 1CEZA 4KKOB 2C2OB 2VBYA 2UUCF 4IRCA 4LBHA 1S7HA 4WK3A 4TKTA 4I6YA 3KHLA 2DVIA 4WYLA 5KFRA 1C1CA 1K73T 5LSLA 2P9EA 3IG1B 2HPUA 2GC8A 3NGRA 3ET6B 2V50A 1Q81T 4KHMA 4QWAA 4K4UA 4PRFA 3G9CA 1JIHA 2QA2A 2KH9A 3HJFA 1G6BA 3LP0A 3N5BA 3O1LA 2PGCA 1S48A 1H7XA 3HHLA 2ASYA 1D8YA 3SQGA 4ZVGA 1M5KC 3R3TA 2HYIB 2HURA 3TWZA 2EFPA 4FBTA 3RG6A 1JLCB 4GVBB 3I0SB 2WONA 4Q45A 1WSVA 2DTJA 1VLYA 1U45A 2EFQA 2ILYA 2XLJA 1VQSA 2YKOA 4N41A 3T9ZA 3QO9A 2DNOA 3Q2SC 1XERA 4DSLA 1TKZA 3FSXA 1XNQJ 3H5XA 2R3VA 3C16B 2XWYA 2ADBA 5GVQA 4C48A 3C14B 2RT3A 1R8PA 1TUGB 2VD3A 1WDDA 3RGIA 3F0NA 4Y28C 4ECUA 4WP8A 4G65A 2QA1A 1J27A 2CQ3A 3I9V9 5KFMA 4KGMA 1RT5B 5K14A 3ETOA 4CM0A 3MOZA 4PAAA 1NK0A 1F0XA 2IJNA 3NGSA 1CJVA 1TAQA 4UQTA 1NPRA 4Q5VA 1RISA 1WG1A 2V6AA 2G2OA 2WRMA 3DGPB 4ZIWA 2CQHA 8RUCA 2HVEA 4RWWA 3QRPA 4F7VA 2O5DA 4DPYA 4DF4A 4QR2A 5ITHA 3DRSA 1X5SA 3DRPB 3N6LA 4PG4A 2RU3A 3W5ZA 2EWHA 4FDFA 4TU7A 4OLOA 1NHKL 2K06A 5IXUA 3M6XA 4OI6A 3PHEA 2QZ8A 1VBKA 2IM0A 1B70B 3HHLC 2W24A 3M8SA 5DLFA 3B8HA 1UVLA 2R8GA 4L3NA 1SC1B 5D0EA 2V9WA 4PUOB 2FVCA 3BF4A 3BGFA 4ZKAA 3H59A 4JI5F 2N4CA 3PDNA 4NXNF 2FVRA 2K7JA 4NA2A 2KZMA 1X4DA 2HFOA 2MQMA 5A0YA 5A2QY 3HFKA 1YJWS 3H5SA 1Z1ZA 2XCAA 1NJIT 1ZETA 4DV2J 4I6WA 2FLPA 3HSJA 1IBKF 3QGPA 4HKQA 3SI8A 4G6VB 3LQVA 3Q8YA 3VVUA 4OYBA 3TA0A 4EO8A 1LK7A 1DQ8A 3RAMA 4UY85 3OSPA 2IAJA 3BPSP 2CQIA 4DPOA 2CQ4A 5H9FK 3D4JA 1WF2A 2BOAA 3TOQA 4CO5A 3DM2B 4JI2J 3PW4A 1B4SA 2KDOA 1SUQB 3MGJA 3HDSA 2OFHX 3ZNUA 1L3SA 2N3OA 5ETVA 2E66A 2QG9B 2PE8A 2QMWA 1R89A 2FC8A 2JLEA 2NSCA 1M5HA 3L7PA 2JX2A 4IQMA 3MAQA 4FVMA 1P8GA 3KKFA 5FLXY 1WSRA 2W7AA 4WWSA 1KFSA 3E01B 4RBTA 4YDXA 4ZCKA 3THVA 1UA1A 3W8GA 4YMEA 2HZAA 2W7PA 5D4NA 4JI1J 3D6FB 3MR7A 1WTFA 2CVIA 2JZ5A 1FFWB 4OZ2A 3NOCA 4NCGA 1LWEA 2IBOA 2ZHAA 1IJFB 1EKRA 2FQQB 2AJ0A 2NLWA 1TQLA 3RRGA 3A8EA 3OTCA 1YBUA 4DLEA 4K8RA 3FBCA 2J6UA 2NSBA 1U47A 4JUZA 3ZFVA 2GMLA 2VC1A 4P75A 5J2NB 2Z2ZA 3PW0A 1WG4A 1KQGB 1EX8A 2YPYA 4QW9A 2RUGA 3GZ7A 2ZJQQ 4DV7F 2JC0A 1RT4B 3RYLA 1MSWD 2YWKA 1U6ZA 2JL9A 1HBOA 2OD4A 4M5NA 2Y1RI 1JK9B 3QJPA 2K1RA 5D4PA 5LL6d 5IOLA 4DU8A 3AOBA 4ZHRA 1HNZJ 5GAGI 4MAKA 2Z8QA 4F0KA 4RO0A 1EP4A 2MKIA 2MEWA 5DQGA 3MM8B 3OR1B 1B3TA 3R97A 2CNKB 2CQGA 2R2TA 3ZTSA 4CLYA 1LEOA 4DV4F 3D68A 5GADU 4YR2A 4QOTA 1DURA 2FY1A 2GMJA 2I2YA 2UUCJ 3D1HA 1TV6B 3UI3A 2GHPA 2BV3A 4RWXA 1NDCA 2KM8B 1RI7A 3CCQS 2UUWA 1ZPWX 1Y9OA 4OI0A 2XMKA 3W2VB 3BQ0A 1D9FA 3CIMA 4NYPA 3MOJB 3I32A 4ILMA 8ATCB 4BC9A 4DV1F 4CZCA 4NOHA 3PEHA 3D3BJ 2UUTA 2CYYA 3NEKA 2HBYB 4C8ZA 3CJSA 3GE9A 1Q1KA 4K2XA 2ZDOA 3Q8UA 4HYKA 4URQU 4Y65A 3IFEA 2DEIA 2A6OA 3T1HJ 2ZE2A 1QAJA 2FIUA 5KFSA 5HMZA 4OYWA 5HBMB 5CYMA 4OYIA 3F44A 2CXEA 1RWXB 3OLAA 2MKKA 1A9NB 3EVWA 4MTPA 3IWNC 3IC1A 1NXIA 2CQPA 2BM0A 5J2QB 1KTQA 1FA0A 3IAS9 1Y5NB 1S10A 1WKLA 2NYIA 3G6YA 4C8NA 4NLDA 4DS4A 4I6AA 1RAHB 5JJBA 2QLXA 2XS5A 3RAQA 4MK7A 2FGOA 1UZHA 2P6TA 1IKVA 3HMJG 2BQ3A 4B9TA 1FK9B 4RW6B 2LQBA 4AT1B 4A4JA 2W2QP 2XI3A 4DSFA 1H74A 3MD1A 3D28A 3M8YA 4WFNQ 3EDQB 2B7CB 1PAEX 2JLFA 3V6KA 4A8FA 1R27B 1WC1A 4LF1A 2J9DA 1Q8KA 2IM2A 1Q86T 1U0HB 1LWCA 4MIBA 4DL5A 2CQBA 1S0MA 2WB1D 4P2FA 1UWBB 2GQQA 3J7Z5 2C2DA 1X0PA 2C2RA 2QE5A 1IR2A 1GMWD 2V4JB 4JI5J 3IRXA 2BVZA 3IBFB 2VPWB 1SXLA 2EVZA 3V6HA 2WAQD 2DR9A 4NXNJ 1FRIA 5DG8A 1R8BA 1NK8A 3BQ1A 3QGIA 1UCNA 4ALZA 2WCXA 1I1GA 3M6UA 1IBKJ 2PDAA 3ZZTA 4R5PA 1FKOA 3K5OA 2ZWOA 2IA0A 2ZH1A 2ROEA 1UW4A 3GG1A 3R5GA 1O0PA 3P96A 1NSPA 3NGDA 1GMUA 2ZH6A 2MQOA 2W4CA 2GGPA 1RTJB 1K0TA 2UU9F 5I42A 2VBXA 4DS5A 4ZA1A 3HD1A 3GWCA 2FHJD 2F63A 5C24B 3T3FA 4HTIA 5LMUF 2WVEA 3SBMA 3UCZP 5L8RC 3PW5A 9ATCB 2HEKA 3CC7S 1N5YB 1N5VA 3R7BB 1E6VA 3RJMB 3IGVA 3PJ9A 4ILLA 4LF5F 4NA1A 1P1LA 3ZNJ1 3W61A 4JI7J 3V6DA 1WKJA 2KG1A 1IBMF 2ZBRA 1RTHB 1KSPA 4U8YA 3EM1A 5F0UA 1RLCL 2HIYA 3KK2A 2XQCA 3IR6B 2VJVA 4YY3F 4DR1F 1TAUA 2VPXB 3ELHA 4PZVA 4OJ3A 2X1FA 1NSAA 1R6VA 3BGRA 5JMNA 4KB7A 3S01A 2N3LA 3QBCA 1WC6A 3I9ZA 4DPUA 1HNWF 4OHZA 1RT2B 2IVMA 1T11A 4KIAA 2G9OA 2AX1A 2YNHA 2V68A 1YJTA 1QJHA 2WW8A 5HMXA 4DV7J 4W90B 4M5KA 4I67A 3KLFB 2CPHA 2Y0BB 3HVAA 3NS6A 2W9CA 2OFGX 5HI7A 4S0MA 4HI1A 5L38A 1LK5A 4JI8F 4I64A 1DTTB 3R5AA 4C8YA 2XB2D 2MZJA 2KI2A 3DKDA 2VU5A 4FF2A 3FJ2A 3ZTQA 3NNAA 5GAHU 3DRRA 1GK8A 2V4QA 5CHCB 5A8KB 4MKAA 1S6QA 4OZNA 1FD8A 1TK8A 5DGBA 5C42A 4GKJF 1KS2A 3W5YA 1YZ6A 3UNYA 1N6QB 3DXSX 2HVHA 3MM9A 4I1TA 2PSZA 2NXUA 4FKXA 1N32F 1RGVA 1REGX 1JLEA 2CADA 4DV4J 3LP2B 5K5MA 3DU6A 1OO0B 4UUWA 3M8RA 5KT7A 4H54A 3PNIA 4QYRA 3BH6B 3G6XA 4CLTA 2GX8A 3SCJE 3CCMS 1QDUB 4DOZA 2VOPA 4X62F 5F8GA 1RWPB 2O01C 3GIIA 4IOAQ 4RW8A 1L3UA 4NPOA 4CCHA 4ECVA 4I7FA 1QSSA 4K59A 4OJHA 5E41A 3BH7B 4E0DA 1FRHA 2ZHBA 4DV1J 3PFOA 5LMNF 3PR4A 4CTAB 2BMBA 4OYOA 4NCBA 2J7KA 4ECTA 1SPBP 4E98A 3UFCX 3MUVP 6FD1A 2UP1A 3KTQA 3IWXA 2COLA 4WYWA 4DFPA 2IC3B 1GT8A 3FMWA 3CD7A 2GAHC 4TQSA 2DKOB 5IC4B 5B0AA 1HFEL 2MYFA 4X2BA 3DHXA 5DDPC 4ECZA 2F65A 2RQCA 2H9ZA 4CYUA 1MW7A 2YXLA 3LP1A 2YTCA 1VK3A 5T14A 2DRAA 4PQUA 1HL6A 3GJTB 4DN0A 3QFWA 3NGTA 3AQOA 2HGMA 2PI4A 3ADAC 4ZN1A 2D3ZA 5BYSA 5E3RA 1BXNA 4V19X 5DS7A 1Y3JA 2QYGA 1SIZA 2GAGC 2VFSA 2YKPA 4DR3J 3UD4P 3KK1B 3IS9B 1KQSR 5HMWA 5E3QA 1BWEA 4TNOA 5AE3A 1RTIA 5HP1B 2E9RX 2I1RA 4LVOP 4TVAB 4G1QA 3THPA 4LVNP 2DT9A 2DR7A 2OHDA 1VHIA 3P5TL 4KGVB 2ZOMA 4ZVHA 4HLBA 3PRVA 4DDFA 2MQLA 4CIOA 4I2QA 1RLDA 3DLEA 1EHWA 1F3VA 3W9JA 1AROP 5L39A 1CULA 4M94A 2AMCB 1H2UX 4USVA 2HQIA 2IIHA 3BBFA 3EJMA 4NE9C 3JTNA 2DGQA 1VHFA 3JSMA 4Y2MA 2MTLA 2VB6A 2IMOA 4DL2A 3QWPA 3M30A 2UV8A 3M2RA 3UNGC 1RAEB 1JXEA 2H1YA 4U6PA 3SMZA 2M9KA 2BOPA 3DOKB 1SH2A 2W01A 5JUMA 2ALYB 3POTA 3MCSA 2U1AA 4HHHA 1AXQA 1HPZB 3CO0P 5HSPA 1R0BG 1PBUA 1ZZNA 1KEKA 1HR0F 4E2FB 2RF2B 3GONA 3IAM9 5T7LA 5DG7A 4M95A 3CF5Q 3MMJA 1JLQA 4ZIVA 2W2OP 2ZOFA 2HVIA 4DF8A 2RDIA 2EC2A 2HHWA 3OFFA 2OIHA 1D3WA 3OTEA 2UU9J 4Y6IA 3IP0A 1Y0HA 5M2RA 1YHQS 3MMCA 3ZZRA 3BO2A 1YJ7A 4ZPCA 3EMTA 5IQQA 5DZ7A 2LVWA 2VG5B 2ERRA 3RB4A 5IS2A 2OPRA 4TLQA 5LMUJ 3K59A 2VPYB 2CPYA 2VHGA 5HN0A 2MLXA 2XHWA 1OPIA 2Q6CA 3SYZA 2O67A 1SI9A 4J9OA 1C0UB 2H5EA 2VBZA 4OZ0A 3W3SA 2CQ0A 3NGKA 3DI6B 2APOA 4Q44A 3TQEA 3N0VA 3SQOP 1IBMJ 2LQ8A 3VV2B 4JV0A 2B4PA 1S1WA 5GAGU 2VQEF 1NKEA 1RADB 2GCFA 3V2UC 4YY3J 4DR1J 4A8MP 4IFYA 4K4VA 3SCKE 3I55S 3JYTB 4UOHA 3NWRA 2CQCA 1HNWJ 1RJJA 3RUBL 4PWDA 4JB8B 2YPZA 2HG4A 1T05A 4P71A 1M0SA 2DNKA 3P45B 3IR5B 3R5DA 4ID5B 5KFPA 4PWUA 2XMJA 4H4MA 4XK8C 1QAIA 4JI8J 3GYNA 4KAIA 1HQEA 3HPOA 3H0PA 2WSCC 3LUYA 1N52B 3G82B 3V81A 5KFYA 1MMDA 2MLZA 1H73A 4CLKA 1A7GE 2XLKA 2F9DA 2W9AA 2W2PP 4HHUA 1NK4A 1HW8A 2R7VA 4CRJA 4DL7A 2VG6A 3VGTA 4OHYA 4DX6A 2QMUB 4YOEA 4CO4A 2MQNA 2ZH3A 3KLHB 4USUA 3TJ8A 3KLIA 5HMYA 4C6AA 1GXUA 2J76E 1N32J 5F8JA 4ZPAA 2HGNA 4EU0A 1X9MA 1UVNA 3FFIA 2KFZA 1DJ0A 3EZOA 4B3RF 2H51B 2P9GA 3ISND 4FYWB 3TAPA 4WU3A 1WOOA 2ZBIA 3GB0A 4HEA9 3OVSA 5IV3A 1SL1A 2ZH7A 3T5HA 1HQUA 2ROGA 3AAWB 3BSNA 1TKTB 3N28A 3DRYA 4DV3F 2DY1A 1WACA 1FX2A 1JX4A 4FBUA 3GFZA 2HVDA 5LMNJ 2E1MC 5HROB 2UVVA 1S6UA 2M52A 2HNYA 3G6VA 1SJ4P 1DAXA 2E5LF 1VC0A 1RE1B 3MAAB 4AL6A 2XSJA 4WPAA 3AB2B 1HD1A 3GFYA 4GC6A 1RP5A 3H5UA 4N5SA 3PIPQ 2HMIB 3MUTP 3TZYA 5AXNA 4RUAA 1CS4B 3CD0A 1NB7A 5C25B 2CPFA 2MDAA 3A12A 3DLJA 1QY7A 1RB0A 2R7QA 4YQWA 3PG9A 2ZH2A 2HVZA 3EX7B 1O51A 2PFDA 1WC3A 3KK3A 2P5VA 4WBFA 4WZQA 4NLXA 2OTJS 4NI2B 3VWSA 1XMBA 2J0WA 1FKPA 1QE1B 1P6TA 1S6PA 4AXJA 1FRMA 1KVIA 1S0OA 1FRJA 5IM0A 4I69A 4MJKA 2VL1A 3U02A 1XR5A 4P7TA 3V5RA 2I38A 4KH1B 2B5JA 2H3EB 2CNLB 1Z2ZA 1G4CA 1IKXA 3B4DA 3GYGA 1OPZA
chains in the Genus database with same CATH topology
4WIIA 2MKJA 4C3LA 1N48A 5A8WB 1F5AA 3EXYA 2VG7B 3D0IE 3MTKA 1NO8A 2HMIA 3UDCA 2ZBCA 2MMYA 2LU2A 3TO8A 4YDDB 3BDPA 4X4UA 1AFIA 3PZPA 2KZZA 4DMZA 2BJDA 2KTQA 3S6EA 4PPDA 1H3DA 4RBUA 2N82B 5C25A 3L7OA 4CO3A 4A8YA 2C28A 3P6YC 1E6YB 2ZKTA 4NRTA 1S9EA 2D41A 4OHVA 3OFHA 4NMLA 5BJRA 2DK2A 5CA5A 3FZ2A 4NLRA 4WZMA 3PKYA 4X64F 4ZCMA 2R8IA 3MEEA 1MWYA 2CJQA 2LQ5A 1VI7A 3AHPA 3I5CA 3RW7A 3UPFA 4FPRA 1HMVB 2PMZD 1S76D 3BN4A 2PC6A 2UXCF 1JLBA 2JWNA 3FGVA 3K8VA 2VONA 3BS9A 3I0RB 3DLLQ 3Q0AA 1WI6A 4M5DB 2J8AA 3FEXB 1JJHA 4CNYA 3DFEA 1SJ3P 2AYMA 3ULHA 4DSEA 2MKHA 2GIQA 4ZVEA 4F4WA 2HNZB 1VRUA 1NK5A 1QE1A 3MMAB 5DQIA 4IO9Q 4ECYA 3MFIA 4OI1A 2OJ3A 2FTRA 2B0GA 2EK6A 4WKRA 3KHHA 4Q2MA 3PY8A 4XPEA 2YKMA 1GH8A 1JJ4A 1XR7A 2W8KA 2YWEA 1JKHB 3IO1A 3NMRA 1IR0A 3K7RA 5KG0A 2OKQA 1J5EF 1ZYQA 2VFTA 3CXCR 4EYIB 1V6HA 2E5HA 3HM9A 2Q66A 3SQGB 3KG4A 3H4BA 4DQRA 5DDRC 4QJVA 3PEJA 1S1UB 5IT0A 1VQLS 1SV5B 4MIWA 2OPSA 2M0GB 2CZVC 2F7VA 1FT8A 1TR0A 5KFNA 2WONB 2DGUA 1UFWA 3HHLD 1BLUA 5D6GA 2ASDA 3CD6S 2FHOB 2MZQA 4R0EA 3CDBA 2DGOA 2CPXA 3NCQA 2B43A 5A8WA 2DPIA 4LF6F 3GV7B 3VAJA 2L3MA 4LIWA 1C0TA 5FD1A 3KJVA 4OV1A 5K8PA 4C8KA 1FDNA 2XBPA 1U2FA 1WI8A 2WB4A 1H6KX 2X1AA 2HHHF 4K50A 1SBRA 4ZP9A 2KYXA 3ZC4A 3VQSA 1URRA 3BSAA 1E6YA 4CO1A 1DTQB 2NPIA 3B78A 2A1BA 2J9EA 3QO9B 2DNMA 1YJ9S 4OX6A 2Q6BA 4Y2IA 5D3GB 5GAEI 3WC0A 4Q0BB 1CEZA 4KKOB 1IKWB 4C8LA 1TKZB 1X8DA 1D1UA 1KONA 4LFCF 2VBYA 1HMVA 1LWCB 4C8MA 3M9NB 2UUCF 4IRCA 5DETA 2E7WA 1S7HA 4WK3A 4TKTA 5B08A 4I6YA 4RW4B 4NZ7A 4DN9A 1GXLA 3KHLA 2PEHA 2DVIA 3I0RA 1JLFA 4WYLA 5KFRA 1C1CA 1K73T 2RE1A 4CO0A 2XCPA 2JSXA 4M5DA 4DX8H 1FNMA 2OD6A 1RYRA 5LSLA 1QSYA 2DPJA 1JLAB 5KOXA 2P9EA 1U1RA 2HHUA 2HNZA 1CLFA 3IG1B 2HPUA 2LKZA 2GC8A 2N4DA 3MMAA 1Q81T 1G1XA 2ZH4A 4KHMA 4QWAA 3OJUA 1SB6A 1XR6A 2FB0A 4K4UA 4PRFA 1OWXA 1JIHA 5K14B 4EYHB 3G9CA 2ZFHA 2MJUA 2HWTA 2E5GA 2DHSA