3FFIB

Hiv-1 rt with pyridone non-nucleoside inhibitor
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
424
structure length
403
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYATNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Pyridone Diaryl Ether Non-Nucleoside Inhibitors of HIV-1 Reverse Transcriptase
rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 116
structure length 403
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3ffiB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ffiB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ffiB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ffiB04
1LWEB 3TQ1A 2WHOA 4XO0A 2FLLA 3NBPA 3TVKA 3KLIB 3BQ0A 1JLEB 4MFBA 3DYAB 4Y34A 3QYYA 3GIJA 2FVQA 2AGQA 3JYTB 3BGRB 5HLFB 2RDJA 2YNHA 3V4IB 3I5CA 4ED2A 4PQUA 4LQ3A 2YKNB 3IN5A 1RTJB 4EO8A 1JLAA 4FBTA 3KMSA 3I5BA 3LP2B 4ZPAA 5C42A 3KK1A 4ICLA 4LQ9A 5L1KA 5F8HA 3H4DA 5KFGA 1JLFA 3E01B 3BQ2A 1TV6B 2HNZA 4IH6A 2FLNA 4HKQA 3JSMB 1DLOA 4Y2CA 5KFFA 4K4YA 5FDLB 3KJVA 5EWEA 4ID5A 2V4RA 2ZD1B 3HVWA 3EZUA 2FJWA 1HQUB 1TQLA 1S1UA 3V6DA 3E51A 4TY8B 4YR0A 3H5YA 3MECB 1RA7A 4I2QB 4M94A 3ICLA 3DMJA 5KFIA 1RTHA 3RBEA 2J6UA 2RDIA 1RTIB 2ALZA 4K4VA 3IS9A 2VG5B 1RTDB 2BRKA 2HWHA 2D41A 4KFBB 1RA6A 3UPFA 3DLEB 1N6QB 4URQU 4WFZA 1VRUA 1TKXB 2QE5A 5KFXA 3EPGA 4ZPCA 3PVXA 5J2QB 1S9GA 2I5JB 2WB4A 5F8MA 3DRPA 4WE1B 5J2NB 4TQSA 4K4WA 1TL3A 1DTQA 4NLDA 4XPCA 2CKWA 2ASJA 5KFOA 4ED6A 3Q8PB 4ZHRA 2E9ZA 1RT6A 5KG3A 2WTFA 1JLBB 4ZP8A 3MR5A 5KG4A 2ASLA 1JLQB 3NAHA 5KFMA 3KHHA 4IG3A 4O4GB 2D3ZA 3KLGA 3D28A 3H59A 2IAJB 2JEJA 1EETB 1VRTA 3C6TA 3IG1A 1JIHA 2HNDA 4U6PA 3GQCA 1C1BB 4PUOB 4G1QB 3DM2B 2IM3A 2GC8A 3QZ8A 3ISNC 1IKWA 3M8PB 5EUHA 3FSIA 1HNVA 1N5YB 1HNIA 1HMVB 4U7CA 2XGQA 3MF5A 4JV0A 4IRCA 2RF2A 4R5PA 4Y2AA 1LWCA 3Q8SB 1T03A 1EP4B 1S1VA 3BQ1A 3C6UB 4QW9A 3OL9A 3QIDA 3PW7A 4DL7A 1IKYA 2HNYA 3H5SA 3GV5B 4ECWA 5HP1A 3HVTB 1LW2B 4KE5A 4ECVA 5F8JA 2W9BB 3I0SA 5KG1A 3DRSA 2GIRA 3LAKA 3OL7A 4IDKA 1SH2A 4ED3A 3OHBA 1HARA 1UWBA 2BR0A 1HYSA 3VQSA 1W25A 4KKOB 3HVAA 4ZVHA 1S6QA 2W7OA 1RT5A 4RNOA 3DLGA 1FKOB 4RW6A 5CYMA 4B3OB 2FVPA 3OSPA 1RAJA 1JXLA 4ZVGA 1I6JA 2WK4A 5KFEA 3MTKA 2IBKA 2WRMA 5KT2A 3N6LA 4K4ZA 4TYBA 2W8LA 4R0EA 1TKZA 1LWEA 4Y3CA 3OL6A 2B5JB 4H4MA 3KLIA 4J9LA 4DG1B 1JLEA 4NLPA 3DYAA 1RT2B 1N48A 3JYTA 3BGRA 5HLFA 3Q8RB 3MEEB 5I3UB 5C24A 3CJ5A 3FQKA 5KFLA 3V4IA 4RW7B 4PWDB 1GX5A 1JLGB 2YNFA 2D7SA 3NAIA 3V6JA 2DPIA 1QE1B 2YKNA 4IQXA 3KLHB 3BSCA 4H4OB 1RTJA 4I7FB 3MFHA 5EWGA 3LP2A 1YVFA 2B43A 3RB0A 1S97A 1S1WA 4FBUA 2EC0A 4WZQA 3E01A 4WYLA 5KT5A 2YKMB 2UVUA 5KFHA 4IR1A 1MMLA 1RT4B 1TKTB 2YNIA 3JSMA 1RT7B 4KO0B 5FDLA 3PW4A 3TAMB 4YR3A 1HQUA 4H54A 4QW8A 1S1XB 2XCAA 5D3GB 4ECSA 2IA6A 2VG7B 3M9MB 3KLFA 1S9EB 2VG6A 4MKAA 3QLHB 3KK2B 4QWCA 2WOMA 4I2QA 3SFGA 3LP0B 3QZ7A 4J9MA 1ZTTA 2AGPA 2IJNA 3CVKA 4RU9A 2BQRA 3QIPB 4EO6A 2JC0A 1FKPB 1RTIA 4O44B 1KHWA 3FRZA 3KLEB 3H5XA 1RTDA 5F8NA 4IFVB 4MIAA 2XCPA 3T5KA 2B6AB 4KFBA 1JKHA 3MEDA 5KFNA 1C0UB 2BANB 3DLEA 1N6QA 4KV8B 1FK9B 5KT7A 4ED8A 3RAQA 2I5JA 2OPSB 4WE1A 5J2NA 5C25B 4TYAA 1S0MA 4ECXA 2IMWP 3T19A 4MIBA 5KT3A 1S0NA 3PZPA 4RNMA 2W9CB 3KK3B 4WYWA 5DG8A 1JLBA 2OPPB 4XPEA 4O4GA 3M8QB 3I0RB 2HWIA 1OS5A 1SV5B 2FVRA 1RT3B 2C28A 2R8GA 1EETA 2IC3A 4EYIB 3OHAA 3V6KA 4ECYA 1BQNB 4RW4B 3H98A 4TXSA 4WFXA 2C2DA 3SI8A 3T5HA 2QV6A 1C1BA 3HHKA 4KAIA 4PUOA 1REVB 4G1QA 4EYHB 3T5LA 1JLCB 1S10A 2UVVA 3DM2A 4QWAA 1T05B 2XI3A 3H4BA 5J2PB 5CYQA 1HQEB 3M8PA 3KNAA 1IKXB 5F8IA 2D3UA 4DL6A 1HMVA 3BSNA 4LSNB 4NLXA 5L1JA 1EP4A 3C6UA 1QAIA 3RB6A 1KHVA 5I42B 4F4WA 3CJ4A 4EBCA 4DL3A 4RZRA 2E9RX 1R0AB 5K14B 4F4ZA 1TVRB 3QO9A 4KHMA 5L1IA 3BR9A 5F8LA 3NL0A 3PJWA 3OL8A 1LWFB 1LW2A 3HVTA 5KG5A 2ATLA 1SUQA 5KFWA 1MU2A 4NCGB 5C42B 2ZKUA 4J9PA 4RW9A 5T14A 2R8HA 2R2RA 2HNZB 1DLOB 5J2MB 3FQLA 3UR0A 4LSLA 3PHEA 4JV2A 4KKOA 4O3RA 3T1AA 1ZETA 4JV1A 1TL1B 4NYZA 2AU0A 1C1CB 3ITHA 1U09A 4G3IA 1FKOA 4ZVFA 1DTTB 3KMQA 4KHRA 1SH3A 4FS1A 4KBIA 4GC6A 4Q0BA 2JEGA 4WXWA 2WONB 2ZE2A 1XR5A 1RTHB 4TQRA 4IRDA 3GIIA 5KFQA 4K4UA 2B5JA 3IGVA 1K1QA 4O3OA 3BSAA 4ZP9A 1RT2A 2OPRA 5J1EA 1J5OA 4URGA 3MEEA 1VRUB 5I3UA 4K4XA 2R8JA 2HAIA 5KFPA 4J9KA 4FS2A 5DQHA 1JLGA 5KFJA 3DRPB 1QE1A 4ZVEA 1TL3B 4J9RA 3CJ0A 1DTQB 3DI6A 4H4OA 4I7FA 3DOKB 5KFKA 5DGAA 4F4XA 2JC1A 2W8KA 1RT6B 3H40A 2R8KA 1GX6A 4NLVA 3DOLB 2AQ4A 5KFSA 4ZP7A 3MEGB 1RT4A 4MKBA 2R8IA 2FVCA 2FJVA 1SH0A 1IKVB 2IM2A 3H5UA 4NRTA 1RT7A 4KO0A 1S49A 3D5MA 3PR4A 3PW2A 3IG1B 3DLKB 3QGHA 1Z4UA 2ASDA 4K4TA 4O3NA 5D3GA 2VG7A 3N6MA 4IH5A 5JXSA 1S9EA 1QUVA 5KG7A 3QLHA 3NMAA 4ECRA 1NHVA 1HPZB 3RBDA 3QIPA 5C5JA 1S1TB 4R5PB 4I2PB 1FKPA 4TN2A 3V6HA 4EEYA 1T03B 5DLGA 3CDUA 4EBDA 4ZPBA 2B6AA 5KFZA 4J9QA 2FLPA 2BANA 3V81B 5EDWA 4KV8A 3FFIB 3IGNA 1FK9A 1IKYB 1TV6A 2HNYB 2OPQB 2AX1A 4RNFA 2W9AA 4JUZA 4MK7A 3G6XA 2OPSA 3DRRB 3RB4A 4QPXA 3I0SB 2BRLA 4GC7A 2ZD1A 3GILA 4R8UB 4TY8A 2W9CA 3KK3A 5KFUA 1RT1B 3MR2A 5DGBA 5F9LA 3FDSA 3MECA 2OPPA 1CSJA 1LW0B 3QGGA 4NLSA 2RKIB 3M8QA 4IG0B 4IFYB 3I0RA 1S4FA 1D1UA 1SV5A 1RT3A 2BE2B 2HMIB 1WNEA 4RUCA 4RW4A 2VG5A 4NLTA 5DG9A 1XR6A 1REVA 4DEZA 4IOBA 4YP3A 3LP1B 2V4QA 4ECZA 3PW0A 1T05A 3UDLA 4J9OA 1TKXA 4HYKA 1HQEA 5HBMB 4NZ0A 5J2QA 1KLMB 1TKZB 1K1SA 4IH7A 2YNGB 2R2SA 3PW5A 4LSNA 4H4MB 4RW8B 2XGPA 2V0NA 1C0TB 3UQSA 5KFDA 5HROB 5I42A 4NLWA 3EPIA 2VA2A 5C24B 1JLQA 5L1LA 1R0AA 5K14A 3CO9A 4URSA 2R2UA 4ECQA 2YNFB 3BJYA 1S6PB 4J9NA 1BQMB 1TVRA 2IAJA 3OSNA 1T3NA 2UVRA 3KOAA 2R2TA 1LWFA 1RYRA 4NLOA 1C2PA 4ED0A 3IRXB 4NCGA 1S1WB 2VA3A 5KFRA 3CDWA 4O3QA 3T5JA 1S48A 4M95A 2YNIB 5J2MA 4YMEA 5KFTA 4Q43A 4EBEA 4ED7A 4F4YA 1N5YA 1TL1A 3G6YA 1C1CA 4QWBA 5KFCA 3NBPB 4K4SA 4MFBB 4TY9A 2J6SA 1DTTA 3KLFB 2VG6B 2UUWA 3BREA 2YNHB 2WOMB 4WZMA 1NNDA 5KG2A 2WONA 3HKWA 2IM0A 4PQUB 2WCXA 5L9XA 2ILZA 3CJ2A 4YQWA 3KHGA 3N6NA 1JLAB 2W9BA 5EWFA 1ZTWA 4WXOA 2DPJA 3KK1B 1JKHB 3MEDB 4ICLB 3M9NB 2BQ3A 1JLFB 3KHLA 3G6VA 2O5DA 3GIKA 2JEFA 2V9WA 3G86A 5KG0A 5KFAA 4Q8EA 2AGOA 3KJVB 3LALA 4NRUA 5KFBA 4ID5B 4IR9A 3DOKA 3OLBA 2F8EX 5F8GA 1S1UB 3V6DB 2XWYA 3H2LA 3PR5B 1N56A 4B3OA 2IM1A 3DOLA 3CJ3A 2CJQA 3MEGA 4QWDA 5DQGA 4RNNA 1S0OA 1IKVA 2IC3B 3DMJB 1D0EA 4ZP6A 1IM4A 4IRKA 3IS9B 3DLKA 3ISND 4DG1A 4NLYA 3GV7B 5KFYA 5DG7A 3GYNA 3I5AA 5CYQB 1HPZA 1TP7A 4K50A 4J9SA 4WFYA 4RW7A 4PWDA 1S9GB 5DQIA 1S1TA 4NLUA 1RYSA 3MR3A 4I2PA 2I1RA 3QGIA 3KLHA 3BSOA 2E9TA 5JUMA 4Q44A 2JLEA 3KLVA 4ZHRB 4OL8A 3GV8B 2JEIA 3V81A 2AX0A 2YKMA 4IG3B 3FFIA 3KLGB 2OPQA 2IJFA 1TKTA 3QO9B 3GIMA 4RNHA 1VRTB 3LAMA 3DRRA 2UVWA 1SUQB 3C6TB 5KT4A 3TAMA 1MU2B 2HNDB 2OH2A 4R8UA 4RW9B 5DLFA 2GIQA 3NGDA 1S1XA 1RT1A 4MH8A 1XR7A 1JX4A 4X2BA 2XC9A 1QAJA 4MK9A 1LW0A 4NLRA 2RKIA 3KK2A 4IFYA 4IG0A 4LSLB 1IKWB 3LP0A 2C22A 3M9OB 2BQUA 3CIZA 1HNVB 1HNIB 2BE2A 2HMIA 4KB7A 4ECTA 4O3SA 3ITHB 2RF2B 3CWJA 4QWEA 4KSEB 4O44A 1LWCB 2ILYA 4O3PA 4ECUA 3KLEA 3OLAA 1S1VB 4IFVA 3SFUA 5KT6A 4F50A 4DL2A 3LP1A 4Q45A 3MFIA 2J6TA 1C0UA 4TLRA 4Q0BB 1NHUA 4NLQA 4ZPDA 2ZE2B 3RAXA 5HBMA 4RUAA 2W7PA 2FVSA 2XI2A 4O4RA 4ED1A 1KLMA 4ZMMA 3Q8QB 2YNGA 5HP1B 3CDEA 5C25A 4DL4A 4RW8A 3RB3A 3MR6A 3DRSB 1C0TA 4Q8FA 3DDKA 2OPRB 5J1EB 4IDKB 5HROA 1J5OB 1N4LA 5KFVA 5KG6A 2C2EA 1RDRA 1UWBB 3NKYA 1HYSB 4YR2A 1S6PA 1BQMA 4DL5A 3DI6B 4MK8A 1S6QB 3PJXA 3LANA 1RT5B 1BQNA 2UUTA 3DLGB 4IKAA 3IRXA 4RW6B 5CYMB 2AWZA 2C2RA 4NLGA 1S9FA 1JLCA 2FJXA 5F9NA 1T94A 5J2PA 3KHRA 1IKXA
chains in the Genus database with same CATH superfamily
2R7RA 3ZC4A 3TZXA 3TQ1A 2EFQA 3CJKB 1VIXA 5D78A 3V4IB 4ED2A 3R1HA 4TU7A 4N76A 3IN5A 2IA0A 3H4DA 1JLFA 1RHRB 4RO0A 3FGVA 2BJ8A 5IQQA 3HLUA 4KGMA 4DUZF 5GAHU 1JB0C 4I4BA 5IV4A 3FCVA 3IBCB 2AJ1A 4DPTA 1XNQJ 5F8MA 4TQSA 3DU5A 4JI6J 3EVMA 4YY3J 4B3SJ 2JX2A 4AE5A 1RAEB 4OJGA 2Y1IA 3AJ2A 1X9MA 4KR0B 3IC1A 3CD7A 4G1QB 1IBKJ 3ISNC 1PGZA 3N79A 1WWHA 3FSIA 1HMVB 1Y7PA 4ZCKA 1TUVA 3Q8SB 3PV8A 3BQ1A 3BGFA 4QW9A 4N41A 3FUYA 3OL9A 3UCUP 2KL8A 2XMUA 3OL7A 1KBRA 4K59A 4QR0A 4CO3A 3RW7A 2EEYA 4CLWA 1FKOB 1LXNA 5KFEA 3CCMS 2LECA 1KQSR 5DDOC 3CTRA 2BX6A 2H54B 1X4BA 5HAOA 1VIOA 5EWGA 4OI0A 1WOSA 2O1PA 3K17A 1DRZA 4B3RF 4LFAF 1RT7B 1LWXA 3M9MB 3TVZA 2ZITA 3NLCA 2XSJB 1DQAA 3GSIA 3D68A 2V5HG 5KOWA 4ECXA 2FZKB 5IZHA 2KHCA 5GMEA 4ZPWR 2EC2A 1BY9A 5AE3A 4ECYA 4LF8J 4TXSA 3T5HA 3R6GB 5BXIA 5HVGA 4NLXA 5GMDA 2FD2A 4OHVA 2P6SA 5L1IA 3NL0A 1LWFB 1LW2A 5KG5A 4X4SA 1S79A 4DV5J 4J9PA 2MTLA 3IAS9 1RWWB 1JQGA 3AH6A 3DXBA 1UVIA 4JV5J 2Y3YA 1RTHB 2LYVA 3NOGA 2BJ7A 3BSAA 5DJBA 2DGQA 2N4DA 2OPRA 2RHQB 1NK8A 1DTQB 2K8GA 3K57A 4M5KA 1PSDA 2W4DA 1U1QA 1HWJA 4CNYA 3PW2A 4QQBA 1NJIT 4O3NA 5D3GA 2PDAA 1LNQA 1T9YA 4QZVB 4ANEA 3QT5A 2ZEJA 3KG0A 3MMAB 4P7VA 6AT1B 4UQTA 4HEA9 2D74B 5A2QY 4OQJA 3MR2A 4UZCA 1WNEA 1G2EA 2DHXA 3X1LB 1XR6A 3IBWA 4QYZJ 1H98A 3S8SA 1S6OA 2RU9A 1TKZB 1YJNS 4DSLA 2R2SA 3NP5A 4MAKA 1KKHA 1SJ1A 2YWEA 2R2UA 2YNFB 3BJYA 3IWLA 4O0IA 2VOPA 4NCGA 4JI1J 2W4PA 3LTOA 4A8WA 2EKNA 2C3PA 4K4SA 4LFCF 4EUVA 2WOMB 5KG2A 4RJVA 3TJ8A 4CH1A 2K7JA 5JMNA 2DPJA 2JFKA 1VRQC 3FCWA 4DPXA 2JEFA 4Q8EA 2HQDA 1QVGR 3PR5B 3FJ2A 2AYGA 4Y0FA 3RW6A 3DOLA 5A0YB 2G0CA 1P9QC 3K58A 1Y4ZB 1HNZF 5DG7A 1RK8A 2X1GA 5SZTA 1RE1B 3TUJC 2CUYA 3NNHA 2MLXA 4J9SA 4RW7A 4UOHA 2YVSA 3MMCA 1FDNA 2M7SA 2MZSA 2GMJA 1X4HA 5J1NA 2C2MB 2Y8YA 3DDIA 2HNDB 3AOBA 5L39A 3DKDA 1B7YB 3HT3A 3H8YA 2X7IA 3HKZD 2CZVC 3CWJA 4O44A 2ILYA 2VBZA 1AZSA 4F50A 1X4GA 2J6TA 3PJ9A 4NLQA 2OTJS 4ED1A 2XI2A 4ZMMA 2KJWA 2CIMA 4RW8A 2IJRA 3FZBA 5J1EB 1X31C 3TA2A 2W1BA 3MURP 3E2EA 2NQPA 1PBUA 4C8LA 1HHSA 3FBEA 2DVIA 5F9NA 4DR6F 3PYFA 4HT7A 2HYIB 2WHOA 1JLEB 2QJ3A 3JYTB 1RHKB 1CLFA 3HULA 5D0RA 5EGYA 3MM6A 1WTFA 1RTJB 4ICLA 1T7PA 4FKXA 3V4MA 4OX7A 3CUNA 3P5BP 4DQIA 4DCJB 4DX5A 4LIRA 1RP5A 2V8HA 5HQMA 4DPYA 5E41A 2ALZA 3GCXP 3ILIA 2WB4A 3CDAA 2K1RA 2DYAA 5HVHA 4ED6A 3M1VA 1RT6A 1JLQB 2B9WA 4C48A 1NLKL 1XNRF 2CXEA 5K5MA 2COLA 4PUOB 3OQ2A 3GJRB 3CCQS 3NNAA 2CQ2A 3L95X 5EUHA 3OR2A 4M5DB 4AYBD 1X9WA 4RPFA 4Q2LA 3QIDA 3SBMA 2HNYA 3KUGA 5F8JA 2MSTA 4HACB 2OMLA 4X65F 3LAKA 3MD1A 1O6XA 4ED3A 2AYBA 3PHTA 3VQSA 2XNQA 3MHYA 4ELTA 2MZTA 4JBCA 4HHHA 3Q23A 4MYUA 4TYBA 4A8SA 3NWRA 4DR4F 1KD1T 3DYAA 4QYZK 2Y0BB 4LF4F 3FQKA 2BE9B 2NYHA 3HPOA 1ZA1B 2OKQA 4P6QA 3HX9A 2DGOA 4WZQA 3UW1A 3C16A 3MUMP 3VGUA 1LEOA 4OI2A 3NCQA 2YNIA 2X3DA 2QN6B 4ECQA 1U48A 2B56A 1NDLA 2ZC4A 3ELHA 3LGNA 3UVJB 4OHWA 3SXLA 1Q81T 3AODA 5KFNA 4CLKA 4M5HA 1FK9B 2PA8D 1IBLJ 8ATCB 2CQ3A 2OIHA 3KK3B 4DV0F 4IUFA 4WFAQ 3FRYA 2VJUA 3Q86A 4WFXA 2A10A 1L3VA 4EYHB 3OJUA 1IBCB 3FMBA 4HLBA 2F9JA 4U67Q 2ZH6A 3GCWP 2MXYA 1M5KC 2FC8A 1H73A 3SDEA 1NJXA 2E7WA 3FQLA 3T1AA 1U0SA 1ZETA 4JV1A 4NYZA 1E6VA 4PXBA 2WBMA 2V94A 3KDNA 5CHCB 3KUHA 2H51B 2E1CA 4A8FA 4URGA 4EFAC 5KFJA 1GMWD 2B9XA 3DI6A 2BJ9A 4N5SA 1IUJA 1SH0A 3K2YA 1FRIA 3SCLE 3PACA 2J7KA 3I82A 2BMBA 1HLWA 3I32A 4CLSA 1S1TB 4EBDA 3LF0A 1N5VA 1VQ6S 5LOQA 2YH0A 3IGNA 3ONQA 2VFVA 4C2MA 1Q8BA 4DL0C 2OPPA 3L7OA 2M0GB 1S4FA 4TNOA 4RUCA 4DMZA 3LWMA 2VG5A 4PKDB 3SCIE 3ZNJ1 3IR7B 2XGPA 5GAHI 1M5PC 1R0AA 3MAAB 1T3NA 4IO1A 1S7IA 1AUSL 1T11A 2YWKA 3D0HE 1TR0A 2CZ9A 3H90A 5KFTA 3M4XA 3G6YA 4TY9A 4A46A 5FLXU 3HFKA 4OHZA 1WC5A 1NEEA 2CNLB 2KRBA 1WOPA 3IAM9 1CJKB 2AGOA 3EXCX 2CAJA 2F8EX 4B3OA 3ETMA 4CM2A 1GXUA 3UNYA 4CLZA 4ATNA 4YOEA 5DQGA 2BYCA 3RR8A 3ET6A 2E9TA 3BM7A 3EYZA 5AJ3J 2DR7A 4ITSA 2DIUA 3UCZP 2XSFA 2HMIA 4BWMA 2DCLA 1CVJA 5GAEU 4ZPDA 3RAXA 4ZK7M 1C4CA 3D1HA 3J7Z5 1KLMA 3SQGB 1OPIA 2OPRB 2J0WA 3JQKA 1KONA 1DARA 3DLGB 3CCRS 3Q2SC 2XZTB 4QU7A 2HQCA 4RUHA 3KHRA 2QEXS 2OFHX 1DAXA 1NB2A 2J0QD 5DS7A 1SPBP 1HBNA 5HJYA 1I94F 4Y2CA 5KFFA 3FC9A 4FYWB 3HVWA 3BV8A 1U1LA 9RUBA 4I2QB 4A8KA 3GFHA 2NXJA 4EGLA 3VAFA 2P6TA 3IS9A 3FVYA 5D0EA 8RUCA 1FJCA 3CNQP 2AD9A 1QM9A 4P2MA 4C8MA 4CH7A 3JTPA 4WE1B 1I5OB 5E5NA 4XPCA 5KFOA 3Q8PB 5KG3A 1JLBB 2OTLS 3H59A 4YHHJ 3BH6B 4L72B 4OZ3A 2FHOB 2CQIA 2VODA 3IXQA 1WEYA 1C4AA 3CF5Q 4PAAA 1RLCL 4DQQA 4BC7A 5IT9Y 5KG1A 4B3RJ 3DRSA 4IDKA 3AHPA 4ZVHA 1CQNA 2J9EA 2DEJA 1Y10A 4DSFA 3BO4A 4X4OA 2B4VA 2RRBA 5AE2A 3W5ZA 2YX1A 2W25A 2DR8A 5C24A 2MMYA 4RW7B 1JLGB 1BWEA 2R7TA 1F9EB 1NO8A 3MFHA 1S97A 1I51B 1JNRB 2UV8A 2WVEA 2ADBA 2AMCB 1SIZA 4RBTA 2D69A 4ECSA 2CPDA 1Q7LB 3EVOA 3QZ7A 1EKSA 3TJAA 1H72C 4EO6A 4I56A 1RTIA 4O44B 4LSZB 3H2UB 1JKHA 1N5SA 1HBOA 3F73A 2VONA 2F1FA 4N77A 1KS2A 3Q83A 2FVRA 1O51A 3M2UB 5HVFA 2UXDJ 1XBWA 3W3SA 3H20A 2SXLA 5I42B 2FY8A 5ADZA 1Q86T 2V8VA 3I9ZA 1SL1A 1FEHA 4C6AA 1AT1B 1C1CB 5T41A 4ZN1A 4FS1A 2V67A 1R8HA 4GC6A 3I87A 2ZE2A 1XR5A 3FK4A 4JI8J 1KVKA 2B5JA 2B9EA 4ZP9A 4QIVA 3MEEA 1FD2A 5I3UA 2Q3PA 3FEZA 5DQHA 1DFDA 2PC6A 2K1RB 2ZJQQ 3CJ0A 1WSVA 3J81j 2W8KA 1RT6B 2LEBA 4F3MA 2FZGB 3CW2C 2W2MP 1RT4A 2IM2A 2KI2A 3QRQA 3A3PB 1MMNA 1T9XA 3F41A 5C5JA 4CYUA 1WOOA 1BD6A 1RHUB 3IR6B 1M1GA 2HNYB 1E6YB 3ISZA 4P72A 2OPSA 4V19J 1T02A 4GC7A 3NXZA 3MECA 1CSJA 4IFYB 2IMOA 3C3LA 2EW9A 1FHTA 1X4AA 4RW4A 4PG4A 2DGWA 1HQEA 5HBMB 2CQ1A 3GWCA 4DV2F 3M05A 5K14A 2EFPA 1TMJA 3R7BB 5FIIA 3HHLC 1UFLA 1C2PA 3DNCA 3C16B 5DETA 2A0FB 4H4KC 1KFSA 2YNIB 3PEHA 4I69A 1TL1A 4AT1B 1G3OA 4DR5F 3F44A 2YNHB 2RNEA 3AT1B 2IM0A 4PQUB 4FVCA 1NJZA 3N6NA 4PXEA 4C0OC 2QLWA 1B64A 1NZ8A 4ID5B 1U6FA 4UUXA 4IR9A 4OMFG 4LF5J 4CTAA 1PYOB 1IR2A 5KTQA 1J2VA 2R7SA 1CQMA 5KFYA 3GYNA 3I9V9 4ELVA 2RSQA 2E5HA 3JS9A 1WHVA 3CJQA 3P49B 2APOA 4Y00A 3KLVA 2BVZA 3GYXB 2OEMA 2M52A 2U2FA 2OJ3A 4L3KA 2IJFA 2F9DA 2H5IB 2OEKA 2NR0A 2BKPA 3W63A 2DY9A 2KYXA 3LP0A 2M88A 3L4BC 1PYTA 1E6VB 2RT3A 4XTTA 3BYRA 1S76D 1K8AT 3T1HF 2FJDB 2C3OA 4ED4A 4Y2IA 5HP1B 1U02A 2QSFA 2RUGA 1HNWF 3DI6B 4MK8A 1VQ8S 3G6ES 2IYGA 4DLEA 4WWSA 1VLYA 3AXKA 2CQPA 2GNKA 1XC9A 3KLIB 1U1MA 2BABA 2ZJPQ 4DR7F 4LF1A 3U1NA 4C3KA 4C7QA 1LK5A 3VTIA 2L9DA 1QAYA 3SCKE 4LRCA 4K4YA 3TW0A 4U9RA 3OPKA 1TQLA 3E51A 1WHXA 4V19X 5A8RA 4OLPA 5KFIA 4J5OA 3RBEA 2VG5B 1DZ5A 4OYZA 2QE5A 3EPGA 4K4WA 3FZ2A 1PG5B 4ZHRA 1IXKA 2B7BB 4ZP8A 5KG4A 4O4GB 1VRTA 5GVQA 5DO2A 1U2FA 1M5OC 1RACB 4JI7J 1EP4B 1S1VA 2E1RA 1UJ6A 3TRGA 3TQEA 5B0EA 3TR5A 4LIWA 1UVNA 3JTOA 3KFWX 2BR0A 1CPZA 3AY0A 1Z2ZA 1RT5A 3VF0B 9ATCB 1N52B 4B3OB 1RADB 1YDLA 1RAJA 1JXEA 1YHQS 4LJMA 1PILA 4DPWA 3OL6A 4HH1A 3DRXA 2OD6A 3ET6B 4BCAA 3ENVA 2YKNA 2EC0A 3CCES 2J9DE 3JSMA 2B8QA 2GAGC 4KO0B 5FDLA 3PW4A 2UZAA 1UETA 1TELA 5HMXA 3KNGA 1YRXA 4DV7F 4TKTA 3SFGA 5H9FJ 4I64A 4ZLJA 2BQRA 1FKPB 4LBIA 4AQYF 2FHJA 3JXOA 2GCFA 3BN7A 2LXUA 3UD3P 1T9UA 4O0NA 3PX6A 1YSJA 2IMWP 4NI2A 1SXLA 4DUYJ 3OTOF 2UV8G 3PO4A 1LXJA 4XPEA 3BKFA 1UMJA 4ANCA 1WDDA 2LCWA 3I31A 2XHWA 5F8IA 5BYQA 3O6QA 3D6FB 4DL3A 3M2VB 3UN3A 2ACMA 3D6TB 2HFNA 2GMHA 2V4JA 2CQ4A 4ZLNA 4FNHA 3BS9A 2DR9A 1VQLS 1SJFA 1NBEB 3M30A 4GKJF 2QIFA 3WC0A 3GG0A 3C46A 2NXCA 4NL5A 2WVDA 1MWYA 3UFCX 4GO5X 2F8MA 1IJFB 5KFPA 5E3PA 5GAEI 1EHWA 2ZZMA 4TLQA 4F4XA 3OUYA 3JQMA 3LGHA 3DLHA 1GXTA 4NRTA 4LVOP 3IBFB 1VBKA 2B8PA 2DRDA 1RBOB 1R89A 4F04B 2RQKA 3G96A 3QIPA 3B4MA 3V6HA 1RWOB 3CJ8A 3O5TB 3FFIB 2QA1A 4WF9Q 2ZD1A 4R8UB 2FHKA 2LQJA 2MHEA 1FI4A 4J37A 5DG9A 2PD1A 3PW0A 2ZH7A 2FQQB 2FZCB 2X51A 3WIUA 4U7UD 1JJCB 2QL7B 5C24B 3CO9A 3MCNA 1URRA 2G1DA 2VKRA 1SQFA 4OX9J 1IBMF 5K20B 4EBEA 4RX6A 1SKUB 1VISA 1JJ2R 2NUHA 1F6TA 2I0XA 2QL9B 1JKHB 1YX2A 4OLOA 2FUG9 2O5DA 3HSGA 2C2KB 2V9WA 1WC0A 3P6YC 1N56A 2IM1A 1V9OA 4LMZA 3MEGA 4LF9F 2A1BA 2MKHA 1QSSA 1YWXA 4IRKA 3DLKA 5CZVA 1M1KT 3G71S 2RAQA 4OL8A 2OSQA 2OPQA 2XMJA 2HBZB 3LAMA 3KWMA 4A8YA 5KT4A 3UD4P 1S1XA 2MQMA 2RKIA 2XZWA 2OHDA 1HNVB 4P71A 4NEZA 2HBRB 1LWCB 2E5JA 3LP1A 3CCUS 5H9FK 3TOQA 2ZE2B 1IQZA 2CJKA 3CDEA 2DGVA 4DL4A 2YKQA 1HYSB 1YRTA 4KC5A 3PJXA 3L9ZA 2RVJA 1FRJA 2Z56B 3K7RA 1FF2A 5ETRA 2GVDA 1VR6A 4HTJA 4MFBA 4JI4F 4CYUB 2HHUA 1SJ4P 2VUGA 3I96A 5F8HA 4JI5J 5D6GA 2Q6CA 2UUAF 2AZ3A 1URNA 3H5YA 3MECB 1FJGJ 2JHEA 3T9NA 3ZNUA 4FF3A 3CCTA 2E5GA 2BRKA 2HWHA 1FE4A 4CCHA 4AL7A 1S9GA 3HSDA 4OYAA 2B7CB 1RCXB 3MR5A 3NAHA 2FJEB 4KYZA 2RQCA 2IVMA 1SC3B 3FCHA 1WDTA 1PJ6A 3CJSA 1HHQA 3T3FA 4C3LA 1V5IB 2C3MA 2DNLA 1LK7A 1XMOJ 2BM0A 1YJRA 4ECWA 3R6LB 2ZBPA 1EARA 2W2NP 1HARA 2YQ1A 2CVEA 2RHSB 3OFHA 3AJ1A 1JXLA 4CTAB 3H42A 3N6LA 2BM1A 5C2CA 1UEVA 4H4KA 4NLPA 1N48A 5T7LA 2PFFB 2R7WA 5A2QU 4TU8A 1GX5A 2XMAA 3CJRA 3JTNA 1QE1B 1HR0J 4I7FB 3SSRA 4FBUA 3RAMA 2E5LF 1FRXA 4GKKF 1HQUA 2QT7A 1S9EB 2UUCF 3LP0B 1ZAWA 2J7UA 2BANB 1TK5A 2ACYA 3OFFA 3KJQB 3NCRA 1K73T 4M5MA 5DG8A 4DV4F 1YRUA 1LFPA 4ENOA 4FF2A 2QV6A 3T5LA 3UNGC 2UVVA 4Z7YA 3A3OB 2JH3A 5L1JA 2L9NA 3M8RA 3VZHA 4FXDA 4S0MA 2GQQA 3M7VA 3U02A 2ROGA 3PJWA 2HRTA 3J7AN 2ATLA 4K0KJ 4B9SA 4LSLA 4LREA 4C8NA 4X62F 3NGKA 5A8RB 4K5RA 2VICA 2VC0A 1K1QA 3K5MA 2DXFA 1AXQA 1UEKA 5DDQC 5LMUJ 4DR3J 4XDCA 2ZVSA 3RG6A 2R7OA 5KFSA 2BOAA 2OD4A 2YKAA 2CPYA 1YZ6A 3DU6A 1FESA 5KG7A 1HPZB 2DTJA 3CDUA 5CYJA 4FXVA 1T9VA 3MPVA 1VMBA 2OUGA 2W9CA 4LF6F 1VK8A 3F56A 4AXJA 5J1PA 4GVBA 4LSNA 5KFDA 5A76A 2VBYA 2HKEA 4ZVPB 2XULA 1Y5NB 5B0DA 3HDSA 2GVZA 2GW8A 3FSXA 4O3QA 1S48A 4M95A 3LO3A 4Q43A 4USKA 1YK9A 1DTTA 4HI2A 1VLOA 4ZJOA 4QBUA 3EGVA 2W9BA 3KK1B 2MQ8A 2BQ3A 2B9YA 1P27B 2HIYA 3PKMA 2W01A 3MM7A 1WKLA 1SVDA 3OTDA 2J0SD 3ZTSA 1IKVA 3WBZA 3L7UA 1IM4A 1U0HA 5A8KB 2NS1B 2HQ3A 2CJXB 2Z30B 4OYIA 5IXUA 1R0BG 5JUMA 1OY8A 3O8WA 2A2CA 1VC5A 3QAEA 4C8YA 1XNQF 4JI6F 1BE4A 4NLRA 2BQUA 1KVIA 4YY3F 4KB7A 4B3SF 4DR7J 4O3PA 2RRAA 1J27A 4USUA 4ED5A 2OLWA 2B3TB 1IBKF 3MR6A 1C0TA 4F4KA 2LDYA 2RS2A 2E1PA 3MM5A 1H2UX 3OUYB 2RIJA 4NLGA 2F4VF 4ES3A 3QJJA 3EICA 1U24A 1K0TA 4QR2A 4NWBA 1RHQB 3P5TL 2QA4S 2E1MC 2IVYA 1RI7A 4PR6A 4WP9A 3GR0A 2ZD1B 4HDHA 4YR0A 2NPFA 1X0PA 4OZJA 4M94A 3W2VA 4WTOB 1H7WA 1KRPA 5E3RA 1VQKS 4WFZA 3GFZA 3FMWA 1D9FA 2M8HA 1TL3A 1XK8A 2WTFA 2W2QP 4W4MA 1AW0A 3KLGA 5ETQA 1D9AA 1YG0A 5THWA 5EX0A 3C6TA 3GQCA 4AFFA 2VFRA 5HQ8A 3CULA 4PG6A 2MJNA 4DR1J 1U25A 3OFGA 4WFNQ 4LF8F 4KPCA 2B51A 3BBFA 2F40A 1FFSB 4P52A 2C3YA 4DX6A 2N7YA 1UWBA 1NDKA 3QJLA 2MKIA 1K44A 2ZWPA 4EZ9A 1IM6A 3W65A 2WK4A 4DV5F 1H74A 4CLLA 4KQZA 1F9HA 3CJKA 4F67A 1NCLA 4F0KA 3V4IA 4JV5F 3OTOJ 1DY3A 3US5A 4HH0A 1JJ4A 2R7XA 4GMKA 5H1SV 1X5OA 2QRRA 1S1XB 2RS8A 2VG7B 1SC6A 4PYDA 2Z8QA 5B0GA 3LWLA 2XO6A 3I56S 2F7VA 1B0VA 4ED8A 2ZUGA 1S0MA 4WYWA 3R8YA 2ALYB 5K8NA 3WZ0A 1FVQA 5CD4H 2F5GA 1VGYA 4G1QA 4NZ6A 3QBCA 4DS4A 2D3UA 1HMVA 1UP1A 3TANA 2YKPA 5B0AA 1U1OA 4HTIA 5E3CA 1MROA 1TL5A 4YS2A 3R5JB 1KOHA 3ITHA 1FKOA 4ZVTB 4JI1F 3KJNB 4TQRA 1Y11A 3MZIA 1BWVA 5KFQA 1W7WA 3BKTA 2OGUA 2Q66A 3DOKB 1OWXA 3TX8A 2B4PA 1NMEB 1RAGB 1RT7A 2HGNA 2ASDA 3N6MA 2GAHC 1QUVA 3R5BA 3NMAA 2Y1JA 1RWUA 1FNXH 2KFNA 4EEYA 1ZPWX 4LR8A 2FLPA 1XMBA 1P1TA 2V2QA 1VJWA 4USIA 1RT1B 3GLJA 4PPZA 1SJQA 3K59A 3RGIA 1YBTA 4IOBA 2RUSA 1NDPA 1GK8A 3BH7B 4IH7A 3QAUA 2YY3A 3OVAA 5T7LB 1TK0A 3VQTA 2KG0A 1QTNB 1MWQA 4NZ7A 2IAJA 1LWFA 4LF9J 4DJBA 4E0DA 2P9CA 3PG9A 1WEXA 3NGUA 1GFWB 4WZMA 4RR5A 2MKCA 4ELUA 3KJFB 2V2KA 3RZAA 4FYVB 4A4JA 5KG0A 3WHIA 4X4QA 3OLBA 1S1UB 2XWYA 4ID8A 2G13A 1FNOA 2I38A 4KGKA 2MQPA 2XLIA 3DMJB 1W2IA 2QLBB 2ZH9A 4DX7A 5BYRA 1LOUA 2BEFA 3I5AA 2VFUA 3BYPA 4FVMA 3MR3A 4Q44A 2D3O1 4OX8A 2AX0A 4OV6A 3VAIA 3MMAA 3JQJA 5E3QA 1IWGA 3P96A 4DV6J 1X4FA 4LSLB 2Q43A 1FJEB 4KSEB 4OFZA 1EIYB 1ZOTA 4IFVA 5LSRA 4E2FB 2W7PA 2FPHX 2UUAJ 2K06A 5KFVA 1O8BA 3DFEA 6FDRA 3OXGA 3D54A 4L3NA 1IR0A 1S6UA 2MYFA 4YEAA 3CGIA 2MKKA 2GO9A 1ZYQA 2K7KA 3GIJA 2KKHA 4AUKA 1OYDA 2PEHA 2B0GA 4ZPAA 2DNRA 1WC3A 3E01B 5F0UA 4IH6A 3TAQA 2XY5A 3LW5C 5A0YA 4EK2A 3D7SB 2DNKA 2XG8A 4TVAB 1HWKA 4CWBA 4CDIA 3UPFA 5SUHA 1VJQA 1B3TA 4DCPB 4LFBJ 2CKWA 3K5NA 1K9MT 4R0JA 2XZDB 3ENAA 1UVMA 4ZOSA 4F36A 2ZH4A 1HD1A 2DGUA 1N33J 2FJBB 2HNDA 1IBLF 2IM3A 1YJTA 3WQPA 1M5SA 3MF5A 4CT9A 1RHJB 3MR7A 3PW7A 4DL7A 3T41A 3GMGA 3HVTB 2W9BB 4GKKJ 3FSYA 5E0OA 1VQMS 4N7TA 2UXCJ 1WI6A 3GONA 2EFOA 5DRKA 4JI2J 2VF3A 2MQNA 5AXNA 3CCJS 4ZVGA 3LGMA 3BPDA 4FNIA 1F5AA 2V2VA 4K4ZA 4C0HA 1JLEA 4Y2MA 3KG4A 3J7YU 3JYTA 2XQCA 3BO3A 3V6JA 4DV4J 1RTJA 4ER8A 1PKUA 2HHTA 1WACA 2JOQA 2RH3A 2H1YA 3HHEA 1KTQA 4QW8A 1H38A 2ZOFA 1G4CA 3CVKA 2A18A 3CD6S 4MIAA 2LEAA 2AEMA 1FNMA 3W2WB 3MUVP 1N32J 1U4BA 1CULB 3EX7B 3I0RB 1Q7YT 2V34A 2HQGA 3AAWB 1RT3B 3MM5B 5EX3A 3OT9A 4DLGA 4USHA 4PUOA 1REVB 2DNQA 4QWAA 2MZJA 2AT1B 2XI3A 3H4BA 3OTEA 3R3TA 3VWSA 1U1PA 2EBEA 5L9NA 4HHUA 1TVRB 5F3ZA 2WSCC 4HACA 3VALA 5J2MB 2MKJA 2BKNA 5MLCV 1R7IA 3NY0A 2QLFB 2ZNYA 2GQ2A 4PG7A 4DU8A 2HRYA 3W2VB 3QNWB 5HSPA 4B3TJ 4B9LA 4O3OA 2A2DA 1JMTA 1TL3B 5B08A 3A8IA 2C2NA 4NLVA 5IM0A 4WFBQ 3TX0A 3C19A 2FJAB 2MB0B 4A8OA 2H3EB 2YTCA 1FXLA 4DI6A 4ECRA 3UVJA 4WP3A 1FJ7A 4I2PB 4HI1A 2G4BA 3V81B 1FK9A 4CT8A 3RUBL 3B4DA 2BRLA 1KR4A 3M8ZA 3KK3A 1T3OA 3FDSA 1T9WA 3HM9A 1VOMA 2W2PP 5AJ3F 4DEZA 2CQBA 4OYOA 1NPKA 4JYAJ 4P75A 3A3NB 5IT4A 2O3DA 4DSEA 4B9MA 5I3PA 2V50A 1S6PB 4J9NA 3Q8YA 2R2TA 4ED0A 1HI8A 3AD7C 3S6EA 5M2PA 1SJ3P 1B0PA 4ED7A 4UOFA 2CJBA 2J6SA 2R3VA 2AV5A 3HKWA 4A8XA 3ZZRA 1FWLA 1F0XA 5D0GA 3VGVA 4ETXA 4KJIA 2R7VA 5HQLA 3GIKA 4NRUA 2G1HA 2AJ0A 3CC2S 2H4YB 4QWDA 2DO0A 2ADCA 2PT0A 1S0OA 3QQCD 1FRLA 3VGTA 4HVZA 1OJ4A 4YB1P 4WFYA 1S1TA 3BSOA 4QOTA 2LXFA 3D0GE 3GIMA 2MKSA 1MROB 2F4VJ 2CYYA 1YJUA 2ZZTA 2YX7A 1HNIB 3ITHB 2RF2B 2P2CB 3OLAA 4YHHF 2LDIA 2MKYA 2P9EA 2PGCA 2VKZG 2POKA 4Q8FA 3EXYA 3GJQB 3T6BA 3W64A 4UUWA 2IHR1 1UVJA 3MAAA 5I3QA 4ZN3A 4RW6B 3ZTQA 4CO0A 3U1LA 2H9ZA 4X4PA 3QT7A 3EZ5A 3BGRB 2YQ3A 2GZOA 1A6LA 4LQ3A 2DD8S 4HKQA 1QLNA 1CJKA 7FD1A 1KC8T 2DB1A 3ICLA 4W90B 4KFBB 1HIYA 1N6QB 1RCOB 1VRUA 3S7RA 3PVXA 1GMUA 5J2NB 2HFVA 3HO1A 4KT0C 3GIRA 5KFMA 2D3ZA 2IAJB 3IG1A 3M32A 4PYAA 2KB2A 3MUTP 2HVDA 4YB7A 2RDDA 1VBYA 4ZIVA 4U95A 4J7CA 3C6UB 3EWGA 5L38A 2H48B 3ZZYA 2IDLA 1M90T 3IFEA 2UXDF 3I0SA 4UQGA 1P6TA 2CQ0A 3SQGA 1SH2A 4PWUA 2GJIA 4MYTA 4KKOB 4RNOA 3DLGA 2YWWA 3PYEA 2O01C 4H4MA 3HJFA 2UUBJ 1TK8A 2EXUA 4K5SA 2QFIA 2KVQE 3TA1A 2B43A 4JI8F 4DV3J 4WYLA 4X4VA 2QSWA 2B4OA 5GAGU 3HCXA 2LU1A 1FFGB 4YR3A 4H54A 2XCAA 2N3OA 4I2QA 4WBFA 3N5BA 1HI1A 4CLTA 3H5XA 4IFVB 4U96A 1YGYA 2DHHA 1XJWB 4KV8B 3J7ZT 2LA4A 2KN4A 2NXEA 1QJHA 4WE1A 3ULHA 5I4MA 2C1EB 1WI8A 2RB7A 4WKRA 1JLBA 3M8QB 2ZM6J 8AT1B 4USMA 2JJ4D 1H2VZ 3HHKA 1OSCA 1S10A 1XWLA 5CZXA 2CDRB 2CQCA 3D67A 1AYEA 1DHMA 5FLXY 1P9YA 1X7VA 3QRRA 2J9CA 2PMZD 2Y0SD 4RZRA 1LQ9A 3NGTA 4CNZA 3PHEA 4FF1A 1R27B 3BDPA 3KMQA 4KBIA 1SC4B 1CJVB 3ADAC 4RL1A 2FY1A 1MG7A 1WG1A 1BGXT 2FDNA 1D3WA 3R7NB 3JAMY 1JLGA 1RAFB 2UU9J 3OXLA 4FYDA 1ZPVA 2V8DA 4ZP7A 4W98A 3BO2A 4ZCLA 3R5DA 2ZOMA 3QGHA 3QWUA 4U8YA 3LQVA 2G2OA 2NLWA 3ZTOA 2ZUAA 4LF5F 1HNXF 4XK8C 1WEZA 4G65A 3RB4A 4QPXA 3D9BA 2QO3A 1SB6A 4M5JA 2A3JA 1LW0B 4IG0B 1MN9A 3KKFA 2WAQD 1PYSB 2BE2B 3M2UA 3MPWA 5E3AA 2H65B 4QIEA 2JSXA 5JJBA 5J2QA 2FGOA 2YNGB 5ETPA 2V0NA 5I42A 3D4JA 5D0HA 2IRUA 3HVRA 3P45B 1FVSA 3CDWA 4OJ1A 3AFGA 3TARA 1N5YA 4KH1B 1C1CA 4QWBA 1H2TZ 3BREA 5JVHQ 2MDAA 2Y9HA 1NNDA 3KHGA 4OZ5A 4L74A 3KHLA 4M5GA 1GXLA 3KJVB 1I1GA 3QSIA 3UCGA 2DHSA 1V6HA 2ZZNA 2CJQA 1X0FA 7FDRA 1HW8A 1D0EA 2EKYA 2X1AA 3K5OA 1TP7A 3G8TA 4OYXA 3KLHA 3VVTA 3GV8B 5E33A 2YKMA 4IG3B 1E6YA 2V2ZA 3PYDA 3J7YI 2OH2A 3DN9A 1QAJA 1HWIA 4IFYA 1T95A 1TZ0A 3ZTRA 3MFIA 3CCWA 3H0PA 1UJ4A 5DZ6A 5HBMA 1ZS6A 4O4RA 4FXWA 5IWAJ 4IOAQ 4OZLA 4JI7F 1N4LA 1RDRA 3RTVA 1OY9A 4P7TA 1S6QB 3LANA 2DY1A 1BQNA 1AA1B 1RXOB 2AWZA 5IM0B 2N3LA 1T94A 1Q82T 3AOCA 3B8HA 3BQ0A 2FC9A 4CI0B 1UZDA 2YNHA 2MZQA 4PQUA 4OZ1A 3LP2B 3SV3A 5C42A 5IC4B 1ROFA 1RU1A 2DXEA 2RILA 4ID5A 1YJ7A 3Q8VA 5D15A 5B7WA 3E3XA 1REGX 2RDIA 3D66A 3DLEB 4IO9Q 2VOOA 4LBPA 2HFZA 3HT0A 4LR9A 2I5JB 1YITS 1DQ8A 3C2PA 4NMLA 4PQAA 2QL5B 1NK6A 1WD6A 1U26A 1JXVA 3I55S 3OTCA 4L75A 4WU2A 4YDDB 3GTYX 3TUZC 1EETB 2JEJA 4DN9A 5AXMA 1S0VA 2HFOA 3QZ8A 2H5JB 3VAJA 2VFTA 4DUYF 3MPUB 3M8PB 3O1LA 2XGQA 3RYLA 1T03A 3H5SA 5HP1A 1FDAA 3VZIA 2RQ4A 4ZCIA 3A8JA 2EK6A 2ZOGA 2Y1RI 2GGPA 5LXRA 5ETMA 3WIVA 4Y6IA 1FDBA 3POTA 3KLIA 3LA0A 1F3VA 3QPIA 2PI5A 2P8IA 4P73A 1FWPA 2KU7A 2D7SA 4IQXA 3W9HA 2HFUA 3RB0A 3C15B 2GJFA 2Z58B 3PRDA 3QLHB 4WTYA 1KQGB 3U1MA 3MI7X 4QWCA 2I2YA 5D4OA 1VHFA 1R6VA 3M6VA 3MM8A 2XCPA 4QPTA 1CC7A 3RAQA 3C14B 1WKJA 2KM8B 3MWBA 2ZJRQ 3UN5A 4CO1A 4O4GA 2AEJA 2HWIA 2C28A 3IWXA 3OHAA 3VR1A 4KAIA 4USTA 1T05B 2PMWA 4OHXA 5K9FA 4DL6A 1UCNA 2HVZA 1MNEA 2KT2A 3PX0A 1EP4A 2E9RX 4X4NA 3CIMA 2HG4A 5LMNJ 1SUQA 2IIHA 1HBUB 2PI4A 4ZLLA 2DRBA 1FT8A 4EZ6A 5M2RA 4AL5A 3B6BA 2HLUA 3MCMA 1PJ5A 1QDUB 5G4DA 2VQFJ 4OX9F 4IRDA 4CM0A 4LRDA 3HI9A 2WVCA 2YX4A 1J5OA 1VRUB 3SYZA 3GR1A 2QA2A 4XAKA 3W7BA 4KIAA 2V9KA 5F41A 5EHHA 4KO0A 3PR4A 4NXMJ 3IG1B 5A8WA 3M32B 1VQSA 3HD1A 2CVIA 3SEOA 2MLZA 1NHKL 4L6V3 1Q5VA 1FKPA 4TN2A 1NKBA 4K8RA 4RNFA 1TV6A 3J80Y 2CRLA 4FP9A 4MIWA 4UY85 3I0SB 1SL2A 1OO0B 5HMWA 5IQ6A 3QGGA 3THPA 4C98A 4B9TA 3OTBA 4KPYA 4Y2KA 3K5LA 4H4MB 1UA0A 1SKRA 2H4WB 3M2VA 1UL3A 3UN2A 2CDQA 4Q5VA 4NA2A 5H9EK 3IRXB 1NZAA 3R1LA 2CJ9A 1YIJS 3SSQA 1N36J 2M2BA 5BJRA 1PBAA 1HW9A 5HL7Q 3DLLQ 1GNKA 1QD1A 1JLAB 1ZTWA 2HHQA 1KFDA 4QIGA 3JSYA 1N34J 2XYGB 2XMWA 3V6DB 1F9FA 2MPUA 4JI5F 1YJWS 5GMKa 4OV1A 3ISND 4G1IA 3W8GA 3GV7B 2VBXA 1OPZA 4UF4A 5IS2A 3CD0A 4OI1A 1FJGF 2VDHA 2JLEA 3MMBA 4WIQA 3FFIA 1NM2A 3VAMA 4X66F 3BN4A 4R8UA 2DR5A 2XS2A 2QMXA 3KK2A 3CIZA 2RD5C 5GAGI 4ERDA 1L3UA 4RUAA 3PRVA 2ZFHA 5CCLA 1WG4A 5HN0A 4N8OA 1XMOF 2MLYA 2ZH1A 4BDPA 2PIIA 4K7QA 3NS5A 1J5EF 5FJ4A 1LWEB 3LUYA 2J8AA 1B0TA 5HLFB 1X4CA 1YQHA 2WSEC 1AFJA 4EO8A 2M4MA 3I5BA 5L1KA 1XQIA 3BQ2A 4IOCQ 2BW7A 5EWEA 2YH1A 2AZ1A 2FJWA 4PABA 1MWZA 1M5HA 1RA7A 1RBAA 1HR0F 4DQPA 2VIHA 2ZBCA 3A8KA 5KOXA 2J6UA 4K4VA 4XIUA 1RTDB 2C2OB 2DR6A 3RBZA 4B3MJ 4ILLA 5J2QB 4JP8A 3EE3A 2YPZA 1KQKA 2CPEA 1RGVA 1ZZNA 2F65A 1O0PA 2ZBQA 3DM2B 1FXDA 2GC8A 2OI2A 1U2CA 1HNVA 1N5YB 5F3TA 1LWCA 4J90A 2P9GA 2VU5A 1S59A 4ECVA 2X1BA 2KH9A 4ZITA 1N5TA 3UI3A 1ZAVA 1HYSA 1W25A 4DF8A 1UZHA 2GJ2A 3QSYB 2AEFA 4K0KF 5KT2A 2BDPA 1D09B 1VFJA 4Y3CA 2DH9A 1RT2B 4C11B 2OELA 4GRSA 3NAIA 3CEDA 4JI0J 1T0TV 3KLHB 4H4OB 5ETKA 3V2UC 1KTVA 3OVBA 2YKMB 4BHQA 4DZ6A 4YDXA 2E66A 4Y65A 5LMUF 4Z37A 2BZ2A 4DR3F 4UT4A 4B9NA 2Q1LA 3T1YJ 6FD1A 4NMXA 1Q8IA 4UZBA 1NKCA 3ZFVA 2B6AB 2ATCB 3HF5A 1TKDA 4TYAA 2CQHA 4B08A 1PC5A 4EYIB 1BQNB 4M5IA 1RQ0A 5HANA 2DH8A 1KHVA 5IT0A 1F60B 3QO9A 3JB9k 1NH7A 3PRBA 5C42B 2R8HA 1RISA 2F8HA 1FE0A 3CMQA 4O3RA 2KT3A 3BPSP 4G3IA 4ZVFA 4KHRA 4OIXA 4I6YA 4WXWA 2WONB 5D4NA 1HNXJ 4K4UA 3B82A 3GYGA 1Q78A 4J9KA 4LBHA 4FS2A 2J5AA 3CMAS 1QE1A 4ZVEA 4I7FA 1DBDA 2JC1A 3BGUA 4JOUA 3H5UA 2ABYA 4NCAA 4K4TA 2M9KA 2XTJP 1S9EA 4DDFA 3AQOA 3RBDA 1T03B 5DLGA 4NXNJ 5CH7B 2BANA 1NU4A 1GEHA 2AX1A 3DRRB 2XS5A 4CH0S 1EQ0A 2XBPA 3HSJA 5DGBA 4X84A 1Q5YA 1UWAA 1WC6A 1S12A 3TP2A 4JI3J 4J9OA 2GGPB 1HBMA 3W9IA 2M5YA 3POTB 3SZ2A 1NSQA 3UQSA 5HROB 1Q1KA 4BLGA 4P2XA 3L7PA 1BQMB 3MXHP 5D8HB 2QLXA 2VA3A 5KFRA 1L3TA 3T5JA 3A4TA 4F4YA 1NUEA 3NBPB 1AFIA 1RWXB 5K8MA 1N88A 3MM8B 2DEIA 2JNJA 1Y00A 4F3QA 1Q53A 4ZVOB 2R7QA 1VI7A 4L76A 4NA1A 2BUNA 3ILJA 4M5NA 3H2LA 2MQLA 2HIQA 2A6OA 5HI7A 1SBRA 4XDDA 3TYTA 2QMUB 3ZZTA 4OZ0A 4DG1A 4NLYA 2D1CA 5E2QA 1RLDA 1HPZA 1RYSA 3Q22A 2F4FA 5DZ7A 2KJVA 3TWZA 4RNHA 1NJYA 2UVWA 1SUQB 1WF1A 4MH8A 2HHXA 1SCJB 3TUPA 1U6BA 1IKWB 2CZ4A 4O3SA 2ZVIA 4QJVA 3RR7A 3KLEA 5KT6A 4TLRA 1RWNB 2ZHOA 1J5OB 3O44A 4DR1F 3TEHB 1XMQJ 3IM9A 5CYMB 1PJ7A 3IP0A 1PAEX 3PYGA 2ERRA 2M8DB 5A8WB 4XO0A 3D1OA 4Y34A 1R8BA 2RDJA 1S4EA 2DRAA 2FB0A 2CFXA 1S57A 4FBTA 3KK1A 2LEPA 3IMQJ 1SC1B 4MT1A 1TV6B 2HNZA 2FLNA 2J76E 1DLOA 2HSEB 1QVFR 3MAHA 1HI0P 1P8GA 3GJSB 2CQGA 1F3FA 2LP4A 5A8KA 1L3SA 3IO1A 1TL7B 4P9SA 2E1AA 3EGNA 1V3RA 2JL9A 1G1XA 3QATA 4CZCA 4A8QA 1C1BB 3ZO7A 3VVUA 2DO4A 5IV3A 5ETOA 1UVLA 3HHNB 4HR2A 4NPOA 4R5PA 4LF2A 2PE8A 3DLBA 2O66A 2ZH3A 3GV5B 2GX8A 1XERA 3K89A 2CJYB 2E7VA 4LRBA 1AROP 4QYRA 5AT1B 2HEKA 2W7OA 4I68A 4ETZA 2IBKA 2WRMA 1D8ZA 1DQ9A 4NEYA 2EPIA 4F2RA 3MMBB 2LKZA 3EZOA 4IR1A 4USVA 1CEZA 2NZ4A 3EM1A 2ZBRA 4C97A 2FLOA 2IY5B 3KLFA 3KK2B 1G7CB 2Q6BA 3K8VA 4KHPJ 1YJ9S 3MPYA 2DNPA 5KT7A 1TL4A 1UFKA 5DM6Q 1V5VA 3SMZA 5KT3A 3GB0A 2KRRA 2MHNA 2HK2A 3IWNC 1SV5B 1GMWA 4DV1J 3DOMB 1SQEA 3BGLA 4OJHA 1EAYC 4ZPTR 2AW0A 5U47A 3U7JA 3N28A 3OFEA 1ELOA 4KHMA 1ICEB 2CQDA 2HK3A 3TZWA 4M1KA 2V69A 1DURA 4KGVB 2AU0A 4C8OA 2BBEA 1N5QA 2FHJD 1SH3A 4Q0BA 3R2CJ 2QLJB 3BBBA 2EWHA 2F3JA 3OW2R 4X64J 1BLUA 5KFKA 1R6YA 1TAUA 4RKUC 2DBBA 2FVCA 5A6WA 3MDFA 3D5MA 1Z1ZA 1Z4UA 2VG7A 5JXSA 3GFYA 1G6BA 3DHWC 4I1TA 1FFWB 1BXNA 2CPIA 1X60A 3GFXA 4Y28C 2J9DA 2CPXA 4JB8B 4Z7CA 3Q0AA 3HJVA 1OY6A 4DS5A 2G9OA 4YP3A 3T6JA 3UDLA 2NSCA 4DV6F 4HYKA 4A8MP 1NDCA 3VAHA 3EPIA 4NOHA 3CCSS 2MQOA 4ILRA 1AB8A 3CO0P 1VK3A 1RYRA 4F02A 2Z4PA 1N0VC 3T9ZA 5DDPC 1WORA 3CC7S 4YMEA 4CLPA 3GG1A 5L8RC 1U6ZA 3S01A 1YBAA 2Z2ZA 3AOAA 4HT5A 5EWFA 1FX4A 2VD3A 3M9NB 5HJXA 1VQOS 1JLFB 4X66J 3H7HB 2HHWA 4DXLA 3P8BB 1NSPA 1X5PA 3DOKA 3CCLS 3J81Y 2IYIA 2Y1LB 2X1FA 2I8EA 3KDOA 3OVSA 2GS8A 1R0CB 4DR2J 1BHNA 3QGIA 3D6MB 3IRWP 3MAQA 4RU2A 1X9SA 3QO9B 2VPWB 1UW4A 1NK5A 2MZRA 1SL0A 5HATA 2NSBA 3UR3C 1J5EJ 4C8ZA 5DLFA 1RT1A 1JX4A 4LFBF 4MK9A 4ZVSB 1QAXA 4FPIA 4RBVA 2VL1A 3B54A 4QWEA 4ES1A 3PFOA 2IRYA 1N33F 3I6PA 1FD8A 1UTAA 5HO4A 1IN0A 2JVOA 2OAUA 1S77D 2KO1A 2FJXA 2LXIA 2HVHA 3H2VE 2UXCF 2AGQA 3CD5A 1EX8A 4JI2F 4WCEQ 1S5ZA 1RWMB 1HHTP 4MKVA 1M1HA 1X5SA 1NH8A 3N9UC 3QFWA 3EZUA 1S1UA 2GV1A 2VJVA 4M8LA 1NB7A 3DMJA 1CS4A 3MCSA 1K47A 2ROEA 1HBMB 1PC4A 2ASJA 2UXBJ 5BR8F 1UJ5A 2WW8A 4PZVA 1V3SA 2B4UA 3EGWB 1U47A 4F0MA 4LF7J 3VGSA 1N32F 3G87A 1XIQA 1IWAA 4JV0A 4Y2AA 3JAMU 3UDVA 1IKYA 4OYPA 4DZDA 1R8CA 1LW2B 2GIRA 3OHBA 4AL6A 2G0IA 3PIOQ 1RUSA 2FVPA 3EDQB 1I6JA 4BS2A 2MY7A 1HD0A 3QRPA 2CNNB 3QGPA 5B09A 4LRAA 4DG1B 1QSLA 3PKYA 4C3MA 2G2YA 3HSZA 4DUZJ 2DGTA 1RKJA 3BEGB 2ASYA 1YVFA 2HS3A 1S1WA 1FA0A 2WZ1A 5IC6B 3E01A 4B3TF 2EK1A 5KT5A 3M6XA 4DN0A 2IFXA 4ZKAA 2DHAA 2IA6A 4YB6A 2C42A 5D3GB 2BA9A 1UFWA 2CADA 4J9MA 2AGPA 1KVJA 4CO5A 2XM3A 3KLEB 3QT6A 4I6AA 3T5KA 2QYCA 3MEDA 1YLXA 2E5IA 3W8PA 3CB4A 2XMVA 2EFVA 4MIBA 4RNMA 1TMMA 3HHLD 4U7UK 2R8GA 3VCDA 2C2DA 5MAOA 1RBLA 2RQMA 1YBUA 2XS7A 5ETNA 4EBCA 4F4WA 3QFHA 3HVTA 4JYAF 5KFWA 2ZKUA 4NCGB 4RW9A 2HNZB 1DLOB 4NA3A 4F7VA 1U09A 2XMKA 4N47A 2L48A 2I6WA 4DF4A 2GMLA 1U8WA 1OQ3A 3Q8UA 1MLAA 1P1LA 2JFDA 4LFAJ 2WVFA 2HAIA 5LT5A 3W5YA 3DXSX 2RE1A 1YTYA 2VH7A 2R8KA 1VC0A 3DOLB 3G82A 1BQXA 2R8IA 3ZZ0A 2DKOB 3UO0A 1XTZA 1LV5A 2LQBA 5CAAA 3RJMB 3NWGA 2NPIA 4R5PB 2WW4A 4ILMA 3MMCB 5KFZA 3FNNA 3W2WA 4BWJA 1B7FA 3G8QA 1CULA 2HW3A 1RAOA 2LU2A 3I0RA 1RT3A 4LUBA 4HHJA 1WG5A 4J9VA 2YXLA 2ZDOA 1AZSB 2DXDA 1REVA 2V4QA 4ECZA 2XO7A 1F1BB 3PY8A 1TKXA 2MJUA 2BJEA 4RW8B 4WIIA 2V8PA 1M5VC 2A6MA 3DLJA 3VV2B 1TFYA 1TVRA 3KOAA 4NCBA 1CBKA 2VPXB 4ZLPA 1S7HA 2NREA 4B9VA 2IBOA 5J2MA 4G1PA 3KLFB 2CPJA 1FTRA 2WCXA 2ILZA 3MM6B 3CJ2A 1F2HA 4ZCMA 4PXDA 4ICLB 2R4FA 4OYWA 3G6VA 3AD9C 5KFBA 2M3DA 2LLZA 1TAQA 1NJWA 1WTBA 3NOCA 4RNNA 3V5RA 2KHDA 2AJ2A 3TA0A 2CNKB 4I2PA 4F2SA 2L3MA 3M1VB 2AYEA 3THTA 3DGPA 3V81A 1XN9A 1ZA2B 3O2IA 2XC9A 4I67A 4WKYA 2ZKTA 3OR2B 3SIPB 4Q0BB 5AXLA 1Y3KA 2GO8A 2XMMA 1ZZFA 5FD1A 3GZ7A 2QMWA 4DOZA 1N54B 1M0SA 2XLJA 2G2ZA 1S6PA 3SQOP 4LFCJ 1VQPS 2UUTA 4ZJLA 1JLCA 3HK2A 1UW9A 3W5XA 2R9LA 1ZM2A 3M6UA 2FLLA 5KAKA 3DYAB 3QYYA 2AJFE 3RRGA 2YPYA 4LQ9A 4OI3A 5CA5A 3AXMA 1X4EA 1HNZJ 2DGSA 1Y9OA 2UUBF 1CG2A 4KY3A 1AUDA 4P2FA 4FDFA 3CT9A 3N0VA 4DV3F 3AB2B 2KM8C 1RA6A 2UP1A 1X5TA 4K2XA 1TUGB 5L46A 2XLKA 2KFZA 3RRKA 4PG8A 4NLDA 1LKZA 2VFSA 2ASLA 3D28A 1R8AA 4CP5A 3OBIA 2MQQA 2QC3A 1PO6A 5K8PA 2VHGA 1HNIA 1VC6A 4M63A 2CNOB 2RF2A 5E7OB 1VS3A 2ZM6F 4DFPA 4DPOA 2HQIA 3A13A 4QCLA 3AA9A 1R31A 4DR6J 1QTMA 3PO5A 3SDEB 4ZJQA 3PTWA 4Q7AA 4WK3A 5ETTA 2X3GA 4RW6A 2NZCA 2W8LA 2VPZB 1GTEA 3ILOA 1FX2A 2IVFB 3IA0A 3J80U 2HRUA 3RBXA 3BGRA 3BF4A 1FKAF 3N01A 2CA9A 3SV4A 2V63A 3RU0A 1T9TA 5F0WA 4FN5A 1FTCA 1VCTA 4FYXB 1LFWA 3EJMA 4FYYB 2EG1A 4MKAA 1NK4A 2UU9F 3PNIA 4RU9A 3MOZA 4QU6A 2G0JA 2JC0A 4ALZA 2Z2MA 4KFBA 2XYHB 4DU7A 1N6QA 3KTQA 7AT1B 1XNRJ 1QUPA 3GE9A 5J2NA 1S0NA 2HVEA 4E8UA 2OPPB 5CXTA 5D4LA 3QWPA 1ACMB 1JWWA 3UDCA 4WK1A 2GFFA 4X65J 1KLNA 2XWXA 1TU0B 5D77A 3C6UA 3RB6A 1R0AB 3NEKA 4F4ZA 1YZ7A 3BB5A 3BR9A 1VBZA 2L9WA 1U7LA 1MU2A 2AJQA 5T14A 1RU2A 3BDEA 4DR4J 1WSRA 4KKOA 4BC9A 4DFMA 4LF4J 3VAGA 2D9PA 2JVRA 3D3BJ 4CLYA 1CS4B 2BACA 3IGVA 1TTHB 3PM9A 4I6WA 5IT9U 5LSOA 1IQTA 2QZ8A 4MKBA 4PRFA 4WP8A 1U49A 1RAIB 2ZH5A 3CC4S 1ZBTA 3BZQA 2MGZA 2AKWB 2HHHF 4DV0J 1HL6A 2EFGA 3W60A 3NG8A 4J9QA 4KV8A 2VDIA 4ZPVR 1IKYB 3G6XA 2CJAA 1U1KA 4TY8A 2DT9A 4UOGA 1ULRA 3M8QA 4UTGA 2HMIB 3AD8C 1U45A 5B0FA 1KLMB 3PW5A 1UEUA 5HK4A 4ZS6A 5GADU 4NASA 2Z2YB 3GJTB 5B0BA 1S1WB 2J0XA 1OQ6A 2PFDA 5IWAF 4DFJA 1U8SA 3LH2S 4DSIA 2XMTA 3PXGa 1NKEA 1OMSA 3G9CA 5CCMA 4YB5A 1VYAA 1CJVA 3A12A 3MEDB 4YFUA 1HBNB 2MSSA 1WF0A 3HFVA 2ZH8A 3CJ3A 3IS9B 1HQ2A 4E98A 3KXDA 4PWDA 1NSAA 4NLUA 4EWTA 2I1RA 2HHSA 2MZ1A 4NE9C 4WU3A 4RW9B 1LW0A 2C22A 4IG0A 1WC1A 2BE2A 1JNZB 1HKAA 3AJDA 1RWPB 2RU3A 4DL2A 4Q45A 4P74A 2AP6A 2GQCA 1Q0NA 2YNGA 3RB3A 1WC4A 2WB1D 3DRSB 3DDKA 4IDKB 4HL9A 2HQFA 3NKYA 4YR2A 2LFVA 3G82B 4DQSA 3NGRA 4CLFA 1IKXA 4C0BA 2HHVA 3MOJB 3P4UB 3I5CA 5BR8J 4QR1A 3SSSA 5KFGA 2KG1A 2QGFB 2PEBA 2OFGX 3KJVA 2CPHA 1FDDA 5C7PA 4QIFA 1YI2S 4ZDNA 5CD4A 1RTIB 2FTRA 3AB4B 2BV3A 1TKXB 1CJUA 4W92B 1HBOB 2I9SA 2GIFA 2DIVA 4ES2A 4IG3A 1JIHA 4V1Ak 1FERA 3IM8A 1GQEA 3TUIC 1WKKA 3IR5B 3K5PA 2LA6A 3TJ9A 1KP6A 3BR8A 3M8YA 1EKRA 2BXJA 4X4RA 3WX8A 1ZM9A 1CJTA 2HZAA 2ZC3A 3HVAA 1S6QA 2FGCA 2CPZA 4WPAA 3OSPA 5LMNF 2GHWA 3BKUA 3HMJG 1FRHA 2LQ5A 2B5JB 3Q24A 1I94J 2HFSA 3MEEB 5I3UB 4C4WA 4D3HA 1KEKA 2YQ0A 3BSCA 1RABB 3LPEA 3LP2A 3MM9A 2VQFF 3DGPB 1RT4B 4QIWD 5HMZA 2DHGA 3ZZOA 2K2PA 2OO4A 1IVZA 1D9DA 2U1AA 1KHWA 1Y5IB 4PXCA 2DNOA 4NXMF 2D3OR 3DLEA 2YKOA 1NAQA 4NYPA 3B78A 3PFEA 2ZHAA 2I5JA 2OPSB 2P5VA 1NSKL 4CLUA 3R97A 3Q2TC 4OX6A 3G8SA 1PCAA 1IR1A 3L3CA 1OS5A 1EETA 2IC3A 3DDNA 4RW4B 1HWLA 2IRXA 3H98A 2KT5A 1JLCB 3R9LA 5BYSA 2AHOB 1NK9A 1HQEB 3M8PA 3EUNA 1QAIA 3A1YG 3CJ4A 3HD2A 5K14B 4X4TA 3JSBA 5F8LA 3OL8A 2EVZA 3M2RA 3K0JA 3NGSA 3MTJA 2BJDA 3CMES 3VAKA 3N5FA 3BGOP 1TL1B 4F26A 1VQ4S 4DCOB 2DNGA 3SCJE 2N7CA 3O3LA 3GIIA 3PEJA 3CJTA 2WSFC 2BJ3A 1VQYA 2C3UA 4UW2A 4K4XA 3RRHA 2R8JA 3R5CA 1N36F 4CQ1A 1ZAXA 1Q8KA 2YBVA 3UE2A 2HS0A 3HHLA 3C15A 4Q2MA 2V6AA 3ZXWA 4KGXB 4MTPA 1N34F 1MN7A 4IH5A 3QLHA 2DGXA 3ETOA 2HPUA 1FWKA 4USWA 3EMTA 3EVWA 5EDWA 1VQ7S 2W9AA 4JUZA 3C14A 2XY6A 3GILA 1Z2LA 5KFUA 5F9LA 2HGLA 4NLSA 2XEXA 3TO8A 4CIOA 1S72S 4RWWA 1RWKB 2JWNA 5G0RA 1T05A 1EZZB 2NXUA 4NZ0A 1O5JA 3GU0A 4URSA 3OSNA 3TAPA 2J7WA 3LOUA 1NXIA 1HBUA 4PG5A 2QG9B 1T8EA 2JZ5A 1YKWA 4ZVRB 2UUWA 3DHXA 4PEOA 4RWXA 4YQWA 3ILLA 4FF4A 2IPOB 1MW7A 3G86A 3S1TA 3UD5A 5CABA 3M8WA 3KG1A 1D8YA 4YUDA 4DUTA 1SJRA 4ZHRB 2KDOA 1HWUA 2VASA 1TKTA 2NCKL 1VRTB 2DNMA 4F25A 4B3MF 2DJWA 1KQFB 3TAMA 1MU2B 1XR7A 4X2BA 4N8NA 4MMOA 4DV2J 4YN3B 1S1VB 3SFUA 3M6WA 2EG2A 1C0UA 3F0NA 3HZGA 3OR1A 2YWFA 5C25A 2CPFA 1RAAB 1XEZA 5KG6A 2C2EA 4I0WA 4LT6A 4DR5J 2XHCA 1RT5B 1VQ9S 4IKAA 5K8OA 3IRXA 2HVIA 1S9FA 3PX4A 3TEGA 5J2PA 4CO4A 2L41A 3DRYA 3TVKA 2H5EA 2K3IA 2MGZB 2ZHBA 1WF2A 3QJPA 2YKNB 2HURA 1X4DA 2OMOA 1JLAA 3KMSA 3PDNA 2Z0GA 3JSMB 1WUUA 4UY8T 5FDLB 2V4RA 4TY8B 3V6DA 1K0VA 3AA8A 3FEYB 2KYZA 2VQEF 4JI0F 3CCVS 1BUXA 1KWMA 4URQU 2PN6A 4ZPCA 1R43A 3DRPA 4NX9A 2LQ9A 3HP6A 3T1YF 1U2RA 4EMDA 4NI2B 2VV5A 3KHHA 3R7SB 2BOPA 4KRWA 2L08A 1Y0HA 4OYBA 2DH7A 3GP9A 2E7XA 4ZVUB 2AJ4A 4U6PA 3T1HJ 2PO4A 1H0HB 1RAHB 3C8YA 2V68A 5AE1A 1CC8A 5LJ3Y 1HNWJ 2AYMA 2XYPB 3G2XA 1EQMA 3I4PA 4KE5A 2PA3A 5LXYA 2WBRA 3ZZPA 2CG8A 2V4JB 4P10A 2O67A 1FEEA 3PIPQ 1I3OB 1SKSA 4F8RA 3M30B 1ZH5A 1APSA 1L3KA 3MTKA 1TUWA 3WX4A 4G6VB 1VDHA 4J91A 1LWEA 2KXHA 2VZ9A 3NCPA 4BBYA 5HLFA 3MD3A 4R25A 3Q8RB 3U27A 5KFLA 2E44A 1Q79A 4PWDB 4GVLA 2DNYA 3ZZUA 3OJSA 4OHYA 4LVNP 3BBCA 4O23A 5KFHA 3FBFA 1MMLA 1N0UA 3LPYA 3MGJA 2W24A 2N82B 5GADI 1B99A 2VG6A 1B70B 2E9ZA 1ZTTA 2IJNA 2R42A 3QIPB 5ETVA 3KUEA 3FRZA 1RTDA 4X4UA 2NXNA 5AXKA 5IOLA 1WJ9A 3CE8A 4B9UA 4OZNA 2VB6A 3T19A 3A8EA 1RB0A 2QX0A 1SIWB 4NXNF 2C2ZB 3TNVA 3V6KA 4UOCA 4DSJA 1ZM3A 3DM2A 4FPRA 2ROPA 5CYQA 1H6KX 1W26A 1IKXB 3BSNA 4F0HA 3FKBA 1NPPA 4USJC 2KFYA 3J81U 4JI3F 4RUBA 2HHPA 2Y8WA 2J8SA 2QTWA 3CSKA 3AQPA 3TVYA 3TI0A 2MY8A 2HBYB 5LSLA 2HHHJ 2JEGA 1VQ5S 2NUUG 3WC2A 4DBQA 1RT2A 3DGVA 4OYMA 4U8VA 2CWKA 1CJUB 4C11A 4NYOA 4J9RA 4DV7J 4H4OA 3OD2A 5DGAA 2BE7D 1GX6A 5ITHA 2AQ4A 3MEGB 1ZM4A 2FJVA 2YWHA 4AQYJ 3TZYA 1S49A 3DLKB 2LVWA 3HXMA 2FYXA 2AF6A 4F3OA 4DFKA 1NHVA 5A6PA 5EN1A 3NS6A 4IYQA 4ZPBA 2B6AA 3D0IE 2OPQB 5C2GA 3NMRA 3L09A 4OI4A 3NNCA 4CRJA 1KOOA 1CJTB 2RKIB 4OJ3A 4WJBA 1KN6A 3P3DA 4KH0B 2RRNA 2XY7A 3LP1B 3EDRB 4LRFA 1K1SA 1WELA 2KTQA 5L1LA 4D3GA 4GKJJ 3W66A 2UVRA 4NLOA 1KDNA 3MM9B 2PSZA 2GVDB 1XMQF 4MFBB 2F63A 2WONA 4L73A 5L9XA 1H3DA 2RMLA 5RUBA 5DDRC 4DSKA 1GT8A 2BKOA 1UAWA 3GPAA 5F8GA 5H9EJ 2LQ8A 2HWTA 3CPWR 2IDEA 2R7UA 2IC3B 4ZP6A 1Y3JA 2N4CA 1NK7A 4DQRA 2D9OA 1A9NB 1GMVA 2VPYB 4LR7A 1HA1A 1S9GB 1QY7A 2M70A 2JDJA 1Q4RA 1SI9A 4K2JA 3D6HB 3G4SS 1GAOA 3DRRA 4B17A 3M2RB 1A7GE 4PPDA 3NGDA 3OXFA 3D1QA 3R2DJ 5IFMA 3TZZA 4MKYA 1MSWD 1TFWA 2XSJA 3ZTPA 5LL6d 2VBWA 2FVSA 4OZ2A 2DITA 1S99A 1IBMJ 5HROA 1BMQB 1H7XA 1BQMA 4M5LA 1F2GA 1B4SA 3HHLB 3QT8A 2DNNA 3NBPA 3W9JA 2FVQA 4RBUA 2W4CA 3D3CJ 1DJ0A 1UKUA 4FKYA 4GO7X 4ZVQB 2Z2LA 1HQUB 4F4AA 3DCAA 1JJHA 1RTHA 2Z57B 1HFEL 3M8SA 3DC2A 2D41A 5G0RB 3R5GA 3W1YC 2K3KA 5KFXA 2GHPA 2HAFA 2QFJA 1DTQA 3NS7B 1UPMB 4C8KA 4KHPF 5CQGA 4Z2XA 3OV7A 4A48A 1FRKA 1IKWA 1FO1A 4U7CA 4IRCA 1PAUB 2ZDPA 3MEKA 1WHWA 3ENQA 1FCAA 4DHVA 4DV1F 2EFNA 3MPDA 3ZZZA 3HHDA 2DNZA 3Q89A 2ZWOA 5JVGQ 4J9UE 1OIAA 1V3ZA 1RSCA 1UA1A 1OSDA 2JRSA 4DWIA 5CYMA 4JI4J 2ZBIA 2V8GA 4ZIWA 4R0EA 1TKZA 3MCOA 2WVBA 4J9LA 1QSYA 4KGZB 1RKIA 3CJ5A 3W62A 2YNFA 2DPIA 1W2BR 1OYEA 1VHIA 1UVKA 2UVUA 3KYLA 1TKTB 1RWVB 2XB2D 2KXFA 3JSRA 3TAMB 2ZH2A 1NPRA 4X64F 2WOMA 3K8WA 2CG4A 5F8NA 1RZMA 4EI2A 3FBBA 2CWXA 1C0UB 4N56A 2BW2A 1TL7A 3CDBA 3OR1B 4A47A 5C25B 3QMQA 2HLTA 2Q79A 3PZPA 2W9CB 5LM7E 2EI5A 2DK2A 3UWTA 4AD6A 3J7A1 3SI8A 1FRMA 1C1BA 4GVBB 3C66A 2EBGA 3NRBA 1N8RT 5J2PB 2NYIA 3KNAA 4AXIA 4LSNB 3D2WA 3PCOB 2KVIA 4ANDA 1VQNS 2GVZB 2R2RA 3UR0A 4JV2A 1NK0A 3CCZA 2E29A 5HMYA 1DTTB 1PIEA 4HDGA 2KZMA 2KZZA 2KXNB 2E5LJ 3R27A 5J1EA 2FHMA 3DRPB 3MM7B 1RTZA 5ETSA 2JLFA 2UUCJ 1A0OB 3H40A 4DPUA 5LJ5Y 2XNRA 1FXRA 1EB0A 1IKVB 4RLEA 1RHMB 1U0HB 1UPPA 1X8DA 3FEXB 5M2UA 3EGZA 2ZNZA 3HZEA 4P2SA 1Q8LA 1MMDA 3N4WA 4MK7A 1EJ7L 1R3NA 5B0CA 2OEJA 1GTHA 2OSRA 2VC1A 4DR2F 1NRKA 5DM7Q 2W2OP 4IQMA 1R8PA 4TU9A 4B02A 1D1UA 1U1RA 1SV5A 3THVA 2HGMA 4ZA1A 4NLTA 3DOMA 2W7AA 4KTQA 3I4HX 2GA7A 2QA4G 1YJVA 4OI6A 1SQGA 3UDEA 1Q16B 3FBCA 4PWWA 1Q95G 1C0TB 3W61A 1IJEB 4NLWA 4EU0A 2VA2A 1JLQA 3HFZB 1U1NA 4X62J 2LMIA 2JLGA 2AIRB 1WHYA 4MJKA 2YWGA 2RJZA 4FZVA 4C9DA 2HBQB 2HZCA 5KFCA 3X3UA 4M5DA 2VG6B 3MMJA 1L5UA 2HZVA 4WXOA 2PMHA 5KFAA 1KSPA 3LALA 3ENWA 5D4PA 1KNZA 3H25A 3E8OA 2DNHA 3R5AA 5ETLA 1ITPA 5CYQB 4K50A 1JK9B 5DQIA 4LF6J 4CO2A 2DISA 1GH8A 2JEIA 1F5BA 4DX8H 3KLGB 2GHVC 2MEWA 3C6TB 1Y5LB 3VHQA 2GIQA 2UXBF 3M9OB 2OP5A 4ECTA 3GSDA 4ECUA 2HS4A 1BC6A 2FIUA 1VBXA 1NHUA 4LF7F 2DCUB 3Q8QB 1SKWA 1UWBB 2VQEJ 3WDOA 4DL5A 3CXCR 2C2RA 1RJJA 2BJ1A 2QYGA 4PCQA 1F5CA
chains in the Genus database with same CATH topology
1Q82T 2R7RA 3ZC4A 3TQ1A 1FF2A 3B8HA 2FLLA 5KAKA 2EFQA 2FC9A 3BQ0A 4HTJA 4MFBA 3DYAB 3CJKB 3QYYA 4CI0B 2AJFE 1VIXA 5D78A 3RRGA 2YNHA 2MZQA 3V4IB 4ED2A 3R1HA 4JI4F 4PQUA 4TU7A 4N76A 3IN5A 4OZ1A 2IA0A 2HHUA 1SJ4P 2VUGA 3LP2B 3SV3A 5C42A 4LQ9A 4OI3A 3I96A 5F8HA 1ROFA 3H4DA 1JLFA 5CA5A 1X4EA 5D6GA 3FGVA 2DGSA 2Q6CA 2UUAF 1Y9OA 2UUBF 2RILA 4ID5A 5IQQA 1CG2A 3HLUA 4KGMA 1URNA 1AUDA 3H5YA 3MECB 4DUZF 5GAHU 2JHEA 1JB0C 3CT9A 4I4BA 3T9NA 3N0VA 4DV3F 5B7WA 3E3XA 4FF3A 3CCTA 2RDIA 2E5GA 2BRKA 2HWHA 3AB2B 2KM8C 1RA6A 2UP1A 1X5TA 3DLEB 4K2XA 2XLKA 2KFZA 3RRKA 2AJ1A 1FE4A 4IO9Q 2VOOA 2HFZA 4CCHA 4AL7A 1S9GA 2I5JB 4PG8A 5F8MA 4TQSA 1YITS 3DU5A 1DQ8A 3C2PA 4NMLA 4NLDA 4PQAA 1NK6A 1WD6A 2B7CB 1U26A 1LKZA 2VFSA 3MR5A 2ASLA 3NAHA 3I55S 2JX2A 2FJEB 3OTCA 3D28A 2IVMA 2RQCA 4WU2A 1R8AA 4YDDB 3TUZC 1EETB 4AE5A 2JEJA 4OJGA 4DN9A 2Y1IA 3FCHA 3AJ2A 5AXMA 1X9MA 4KR0B 3IC1A 3CD7A 3OBIA 1S0VA 4G1QB 2MQQA 2HFOA 3T3FA 3QZ8A 4C3LA 1PO6A 3VAJA 3ISNC 2VFTA 5K8PA 3N79A 4DUYF 1PGZA 2C3MA 3M8PB 1WWHA 3FSIA 2DNLA 1HNIA 1HMVB 3O1LA 1Y7PA 4M63A 3RYLA 2XGQA 1VC6A 2RF2A 4ZCKA 1LK7A 1TUVA 3Q8SB 1T03A 3PV8A 5E7OB 3BQ1A 2BM0A 1VS3A 3BGFA 1YJRA 4QW9A 2ZM6F 4N41A 3OL9A 4DFPA 4DPOA 2HQIA 3H5SA 4ECWA 3UCUP 5HP1A 4QCLA 1FDAA 3AA9A 3VZIA 1R31A 2RQ4A 1QTMA 2XMUA 3OL7A 4K59A 4QR0A 3PO5A 1HARA 3SDEB 4ZCIA 4Q7AA 2EK6A 4WK3A 4CO3A 2CVEA 3RW7A 2X3GA 2ZOGA 3OFHA 1FKOB 4RW6A 3AJ1A 1JXLA 1LXNA 2Y1RI 4CTAB 5KFEA 3CCMS 2GGPA 5LXRA 3N6LA 2BM1A 2LECA 2W8LA 4Y6IA 1KQSR 2VPZB 1UEVA 1GTEA 5DDOC 1FDBA 2IVFB 3IA0A 3POTA 4H4KA 3KLIA 2HRUA 4NLPA 3CTRA 3QPIA 2PI5A 1N48A 3BGRA 5T7LA 2R7WA 2PFFB 2KU7A 4TU8A 1GX5A 3BF4A 3JTNA 2D7SA 1FKAF 3N01A 4IQXA 1QE1B 1X4BA 1VIOA 4I7FB 5EWGA 4OI0A 3SSRA 4FBUA 3RB0A 3SV4A 3RU0A 2O1PA 3RAMA 2E5LF 1DRZA 1FRXA 4B3RF 5F0WA 4LFAF 4GKKF 1RT7B 4FN5A 1FTCA 1HQUA 1LFWA 3PRDA 3M9MB 2QT7A 1S9EB 4MKAA 2EG1A 3QLHB