1JXVA

Crystal structure of human nucleoside diphosphate kinase a
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
149
structure length
149
Chain Sequence
CERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside Diphosphate Kinase A
publication title Crystal structure of human nucleoside diphosphate kinase A, a metastasis suppressor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 42
structure length 149
sequence length 149
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2001-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1jxvA00
1MN9A 1S59A 1S57A 1U8WA 3Q86A 1XIQA 2AZ1A 1EHWA 2DYAA 3BBBA 4ENOA 1NSQA 2AZ3A 4F36A 3NGRA 1HIYA 2HVEA 3ZTQA 4HR2A 4W98A 1LEOA 1BUXA 1B99A 4EK2A 3R9LA 3NGUA 4ANCA 5BXIA 5CAAA 1MN7A 1NPKA 3BH6B 3MPDA 3GP9A 3JS9A 3WX8A 3EVWA 3PJ9A 2VU5A 1NDKA 3L7UA 1NLKL 3FCVA 2CWKA 1S5ZA 4UOHA 1K44A 1JXVA 3EVOA 1B4SA 1HHQA 1NHKL 3B6BA 4UOGA 1HLWA 3DKDA 2DY9A 2B8QA 3FC9A 3Q8YA 2DXFA 2NCKL 2DXDA 4FKXA 3ETMA 3FCWA 3FKBA 1XQIA 1NB2A 1VYAA 3FBCA 3VGVA 3NGSA 3Q83A 3EMTA 5IOLA 4F4AA 4CP5A 3PRVA 3EICA 3BBCA 4C6AA 2HURA 4O0NA 3Q8UA 2HVDA 1NDCA 4DI6A 3B54A 3EVMA 3Q8VA 3ZTPA 3EM1A 2ZUAA 1BHNA 3ZTSA 3ENAA 3VVTA 1KDNA 4ANEA 1WKKA 3FBBA 3NGTA 3BH7B 1NDLA 3VVUA 1PKUA 3GPAA 3ZTRA 3FBFA 2B8PA 4UOFA 3FBEA 3DDIA 1W7WA 4FKYA 1NCLA 1NSPA 3BBFA 2BX6A 3VGTA 5C7PA 4DUTA 4DZ6A 1F3FA 3ELHA 3ZTOA 1NDPA 1NSKL 4S0MA 3VGUA 3G2XA 2BEFA 5CABA 3EE3A 1WKJA 3Q89A 1PAEX 1UCNA 4KPCA 1NUEA 1LWXA 1ZS6A 3EJMA 4WBFA 3VGSA 1BE4A 1WKLA 1F6TA 2DXEA 4ANDA
chains in the Genus database with same CATH superfamily
4Z7YA 2Q3PA 2MY8A 1KLMA 1Q4RA 1Z4UA 2QLFB 4YY3F 2YKQA 1PIEA 4N77A 1IKWB 4R25A 4QQBA 5HLFB 3OBIA 2VZ9A 1Q7LB 4H4OA 4YHHF 3P96A 1RTJB 4RNFA 2HZVA 4DR5F 1Z2LA 4LBIA 2H4WB 2W9BB 2BZ2A 3D0GE 1MROA 4WFYA 2E1AA 4B3OA 3K58A 5I3PA 2VH7A 5KG0A 2VFRA 4I7FA 4Y00A 2W2OP 5A6WA 1UJ4A 2HHPA 4YB1P 5E5NA 2CNOB 4ETZA 2AYGA 3FCHA 3DRPA 1Y11A 1LQ9A 2R42A 1VISA 2WOMB 1V6HA 4Y2AA 3W65A 5KG1A 1R0AA 1PYOB 3PZPA 1S1WA 4U7CA 3Q24A 2F8HA 2ZZNA 1NUEA 1QAIA 5EWEA 4DLGA 3BN4A 3AJ1A 3QJJA 3EXCX 2V2KA 2HHHF 4RKUC 4LSNA 2YTCA 3BKFA 4K4ZA 5KFHA 5KOWA 1SKRA 1CQNA 1VK8A 1WG4A 5HVGA 1XEZA 3MEDB 1Q5VA 1R8BA 3CGIA 2VQFF 3N5FA 1O6XA 4FBUA 4EO8A 3ZZUA 1IKYB 2HSEB 3NWGA 3PYGA 2W2MP 1UVNA 3CWJA 3QQCD 4ZCMA 3UCGA 3O44A 2C3MA 5SZTA 5G0RB 4O0NA 5D4OA 1DRZA 2B5JB 1TK5A 1VRUA 4XDDA 2JLFA 1XWLA 1B3TA 1NRKA 3MCMA 3C19A 4CM0A 1WI8A 2I38A 3KJQB 2IHR1 3BKTA 5F8GA 3V81A 3R1HA 2H65B 3QO9A 3RB6A 4LVNP 3D7SB 4HHHA 3ITHA 2CDQA 4NLXA 3MMAB 1U02A 3K7RA 4OL8A 3NGRA 4C9DA 3UR3C 1FRXA 3QFWA 2KZZA 4HHUA 2QT7A 1JJ4A 5DZ7A 3HM9A 3W63A 4DS4A 5ETLA 1YTYA 1B4SA 4FPIA 1FJGF 3KUEA 2ABYA 4PG4A 3OXGA 2VD3A 1NJIT 3CD6S 4CLTA 4ZP7A 4R8UB 4EU0A 4LF9J 4OYZA 3IM9A 3DLGB 2R2SA 3NNAA 1SBRA 1AZSA 3FSXA 1HBMB 1N6QB 2YKNB 3LO3A 5GAHU 1HWUA 1SH3A 1RT3A 4G1PA 3T1HF 4DEZA 3KHRA 1RWOB 3KK1B 1IN0A 3OTBA 4X4PA 2VQEF 2WHOA 1SC1B 4C8KA 1JLEB 1IBKF 2H4YB 2GIFA 3ZFVA 4JI8J 1C0TA 1A6LA 3OHAA 1E6YB 1HYSB 1JWWA 3ZTQA 3EYZA 1VC5A 4W98A 2KRRA 4EBEA 3DOLB 1FKOB 3BH6B 3C3LA 1QVFR 3J80U 3E01A 1TVRA 4CNYA 1G7CB 3DC2A 2I2YA 2H54B 1U1OA 4Q2LA 4F50A 2VG6B 4ZN1A 4I0WA 4NA3A 3MM9B 4DL4A 4KGMA 2HHXA 4EBDA 2U2FA 3GLJA 4NCAA 3G8QA 2RILA 2V94A 1E6VB 4NEZA 3TI0A 4M5DB 2B6AB 3KUGA 4CO3A 1P8GA 2RD5C 2VFVA 2YNIB 1T9YA 5IM0A 3ZTOA 4LFBF 3Q8PB 1S9EB 3EZUA 3CVKA 2BBEA 3EUNA 4P2SA 5KT2A 1JX4A 2YY3A 5E0OA 5KFLA 4NLYA 5KFUA 3UDCA 2JJ4D 2D9PA 3IWLA 3TZZA 4FPRA 2L9DA 5KFAA 4L6V3 3N5BA 3CD0A 5ETNA 2YWFA 3PDNA 1JIHA 4CNZA 2GX8A 1U0HB 3QT8A 4YR0A 1KOHA 1XMOJ 2R2RA 1RAOA 1TELA 4UOGA 4CYUB 4ZPTR 3GYNA 4DR6F 1OPIA 1VHFA 4NA1A 2AJ0A 1WHWA 4OYIA 3ILJA 3IM8A 4XIUA 5A8WB 2HBZB 4DXLA 4EEYA 1I3OB 4P71A 4Y65A 3KHHA 3D5MA 4WFZA 4CT9A 1WWHA 2VPXB 4J5OA 4ECZA 4P74A 2VG7B 3FDSA 4C8MA 3O6QA 3H42A 5D4NA 2U1AA 4YB7A 1T03B 4UUWA 2V9WA 4IR1A 4DV3J 5LJ3Y 1RAFB 3QFHA 1IR1A 2RU3A 2YBVA 4QU7A 3US5A 2H9ZA 4Q8EA 4B9SA 3NMRA 4JOUA 3QSYB 4LFCF 1Q8KA 2FGCA 1XR7A 4DSKA 3VQTA 1VQ5S 4WTOB 3R8YA 1TAUA 1M5SA 3VR1A 2VBXA 1IKXA 4YEAA 4ZCIA 2XLKA 1VQOS 3Q8YA 3D9BA 4KO0A 4CLFA 5B08A 2ZUGA 1CC7A 4X84A 4OJ3A 2VJVA 4MYUA 3T6BA 3POTB 5J1NA 1UEUA 4WXOA 3M05A 2HNYB 2EKYA 5AXMA 4F2SA 2FJEB 3DGPA 4JBCA 3WBZA 3KJVA 2EVZA 1WTBA 1FJ7A 1EP4A 3CJKB 3ENVA 2N3OA 3KOAA 2LECA 2X51A 1FWLA 1WACA 2QZ8A 3R5BA 4DUZJ 1SKUB 5DQIA 3L09A 4FF1A 2KM8B 2MMYA 1S9GB 1XIQA 2XI2A 1QSLA 2HLUA 3QIDA 2CVIA 4ZLLA 2YH1A 2XMUA 1UVJA 3JYTB 3IG1A 5T7LB 1PC5A 2ZITA 4OV1A 2PA8D 1EKSA 1HWKA 2V8VA 1GEHA 2CPXA 4M5LA 2HG4A 2ZD1B 3ZZTA 3JSMB 2JDJA 3LTOA 1P9YA 5KFIA 3DHWC 4DR4J 3RU0A 1X60A 1A7GE 4USIA 1H38A 2COLA 2LXUA 4DR3J 2JNJA 1JLGB 3UO0A 1QM9A 4MT1A 3MEEA 3WZ0A 1RA6A 1L3VA 1N5VA 5ETQA 2L9NA 2RIJA 5JMNA 1LWEA 3FBFA 1RUSA 1Q78A 3PO5A 1FNOA 4DSLA 4DQQA 2E5GA 3OSPA 2VPYB 2DEJA 2HQGA 4JI6J 4DL5A 2HW3A 3SQGA 1DQAA 1TR0A 4Q5VA 3ZZRA 1X7VA 3CC2S 5EWFA 5CZVA 4CQ1A 2IBOA 2DKOB 2HQIA 2N4DA 3UNYA 3T9ZA 2MYFA 2RJZA 1XBWA 5HP1B 1NDKA 1Q86T 3DDNA 3HVAA 4HI2A 2Y1LB 4ZP6A 3T5HA 2C2ZB 3M6UA 3R3TA 1U09A 1RBLA 2MTLA 1YJUA 3QIPB 1I5OB 3TA1A 2E1CA 4KQZA 4CLLA 4L72B 2HFUA 1RLCL 3BGRB 1PBAA 4ALZA 5HK4A 4DCPB 3IBWA 1WHVA 5F9NA 2Z56B 3HULA 4TN2A 4KBIA 2YWGA 3QZ7A 3Q22A 1RLDA 4Y28C 1NK7A 1VIXA 1H2UX 2BKOA 4RUAA 1U2FA 4IO1A 3TJ8A 4X2BA 5CA5A 2XHWA 3CXCR 5HAOA 5JUMA 5CABA 2I8EA 4ZLPA 1LWXA 4I1TA 3OLBA 2K1RB 3JQJA 2RQCA 1YRUA 2BM0A 2XYPB 3HHLD 2BRLA 4ENOA 4B3RJ 3PX0A 5IV4A 2DIUA 3ZZPA 1DHMA 2BJ8A 3PXGa 3FNNA 4A8KA 3TR5A 1HHQA 2XMWA 3M2UB 4JV5F 1UVMA 1EKRA 2W2NP 3FC9A 3RTVA 3SI8A 4RBUA 3RGIA 3TARA 3IMQJ 1R0BG 3OR1A 3L4BC 2WZ1A 5LOQA 3PKYA 5HJXA 4ED7A 5HMXA 3QJLA 4OFZA 4LJMA 3OHBA 3HDSA 5FDLB 4ECRA 3SSQA 1YITS 3BJYA 5C25A 3VVUA 2EKNA 4OV6A 1REVB 3BO3A 3CCSS 5J1EA 3RBEA 3G6YA 5T41A 1HNXJ 2QG9B 4UY8T 3X3UA 5J2PA 1X4EA 1C0UA 2DISA 3WIVA 2QJ3A 4NXNF 3OVSA 4ECVA 4NI2A 1NK0A 3M6XA 3C6TA 3UWTA 1TUGB 4KHMA 4P6QA 4ANDA 1S57A 4G1QA 2UUCJ 4M5KA 3V6DA 2RNEA 4DV0F 4CI0B 2AJ2A 4HKQA 1VBKA 4YDXA 3BR8A 3EVWA 5A6PA 2GJFA 1YVFA 2HRTA 4KTQA 2RKIA 1KS2A 1SH2A 3UI3A 2KM8C 3CDEA 1MG7A 4C0HA 4DCOB 4FKXA 5HSPA 4I6WA 4PQUB 3IP0A 4JI0F 2A6OA 3FQLA 1S1UA 1NJXA 4WE1B 4JI2J 3OFHA 2HVIA 1N32F 2CJBA 1WOPA 3LP1A 5GMDA 4J9MA 4W4MA 3N28A 3CCQS 4ZVRB 1RABB 5DM6Q 3K5OA 2HRUA 3MECB 2MQ8A 3I0RA 5ETKA 1Y5LB 4O3RA 2GAGC 5DG9A 4X4TA 4B3MJ 3KMQA 1OS5A 3M2RB 1VQYA 4JI5J 3GR1A 1WORA 1M5VC 1JLCB 2DXEA 1RADB 2XNRA 1UFWA 1X4BA 4F4WA 4DJBA 4RW7B 3LAMA 3CCLS 5KFQA 2KTQA 2VPZB 4M94A 1OY6A 2GVZB 3HI9A 3CCVS 4IR9A 4Q0BA 3T19A 1I1GA 5D3GA 1DURA 1YJ7A 2BABA 3H98A 3AB4B 1WEYA 2IDLA 1TKZB 3A3OB 5E2QA 3W7BA 1N5YA 4FNIA 4YY3J 1QSSA 5DGBA 4PWDB 2ZBPA 3SCIE 2OPSB 4WYWA 4LRDA 3MM8B 4YHHJ 5EX0A 3BS9A 1VDHA 3OVBA 4DR5J 4DV6F 3KHGA 3MF5A 4DF4A 3ZTRA 2W4CA 1FERA 2K3IA 4ZOSA 3K5MA 4FDFA 3GV7B 3BGLA 3R5DA 1RWXB 4LRFA 4DSFA 5A2QU 2Q6BA 2DNHA 1YQHA 1X5SA 3FEYB 4IG0B 3PNIA 2ATCB 4LSLA 2HNDB 3IGNA 4MAKA 1NAQA 3CJ0A 3ISNC 1ZM2A 2FVRA 3HSDA 4DCJB 4NYPA 1LNQA 2CZVC 4BWJA 2KH9A 3SV4A 1FX4A 1C1CB 2YKOA 2ZDPA 1U1LA 4I6AA 1YBAA 1GAOA 3A4TA 1Q82T 1WHXA 2HHHJ 2E29A 4CCHA 3KYLA 4KGKA 4CP5A 3Q8RB 3O8WA 3CCZA 3NBPB 3MD3A 2GQ2A 1N0VC 4TQSA 5E3QA 2VQFJ 1RXOB 2ILZA 1RT4B 2OFHX 2JEFA 3QWPA 4PPZA 3QGHA 4JUZA 2AW0A 3AJ2A 4OYAA 2XC9A 2E66A 1VQMS 1TFYA 1GMUA 3FGVA 1RDRA 1HW9A 2BJDA 1PILA 3P8BB 1NKEA 2V68A 5T14A 4USMA 2CVEA 2WW8A 3AHPA 2PFDA 3UW1A 3T6JA 2D3OR 2QFIA 6AT1B 3TWZA 3N0VA 3QT6A 1G1XA 1N8RT 4ECWA 1AYEA 4AFFA 2CPIA 1QVGR 4X64F 3UVJA 2XBPA 3EVOA 1MMNA 3ET6A 1GMVA 4U8VA 4O3NA 4I2QA 2VA2A 1VFJA 1SKSA 4V19J 3D0HE 3M6VA 4ZLJA 1ZM9A 4FN5A 4IFVB 5AJ3F 1ZTWA 3J7ZT 2DGTA 1FJGJ 3CMES 3OFGA 2DGSA 2J5AA 2C1EB 2F4VF 3NGTA 3MUVP 3MCNA 1H74A 3RBXA 4RWXA 1UL3A 4CLZA 4ER8A 1FWPA 2BANA 1KVIA 2WRMA 3I6PA 2RH3A 1S6UA 3GG0A 1S12A 3G9CA 5IT0A 2IRUA 3M9MB 3AAWB 1CJVB 1TFWA 4HLBA 2ZH6A 1SKWA 3W2WA 2LU2A 4NLQA 2VQEJ 3M1VA 4RW8A 2RUSA 5C42B 3H5UA 3JSYA 1IBKJ 3AOCA 3VAHA 5IC6B 1VRTA 1FXRA 2F4FA 3HO1A 2ROEA 2DY9A 2DB1A 5L38A 2BOPA 4DWIA 4GO5X 1HBUB 3MEKA 2Q66A 1NK6A 2PC6A 2C3YA 5IWAF 3HCXA 2Y3YA 5KFDA 3MMCB 3X1LB 3NOCA 2ZKUA 3AD9C 1D9DA 3HHEA 1WKKA 1RK8A 1VQ9S 1T9WA 3NKYA 3CIZA 4ZJOA 5KFBA 5IXUA 4DZ6A 1UJ6A 3DM2B 1IKWA 4DV7F 1W2IA 2O3DA 5HLFA 1N4LA 4MH8A 1RU1A 2JC1A 2HYIB 3U7JA 3FRZA 4YUDA 1T95A 4WBFA 2W9BA 4NE9C 2YKPA 1YWXA 1M5PC 2DHSA 2CG4A 4R0EA 1S1VB 4PCQA 1NSQA 2YX7A 2CJAA 3PEJA 1RACB 1C2PA 3W1YC 4LFBJ 3CO0P 4IDKB 1RT1A 2NQPA 1OQ3A 5KFCA 2QLBB 5LSOA 3AD8C 5A8KB 2IA6A 1V5IB 4UW2A 1PBUA 2H5IB 3Q2SC 4KGVB 4W90B 3NS6A 3M8QA 3TQEA 5DDOC 1T11A 3LH2S 1H3DA 1PCAA 4TVAB 4G1IA 3GILA 4U7UD 3H90A 2YQ1A 5RUBA 2FHJD 5J2NB 3D1QA 1YRXA 2AF6A 3TA0A 3I32A 1LWFB 5SUHA 5IQ6A 5J2QB 4DV4F 4P2FA 4DR6J 3F41A 1Q0NA 4IG3B 1FA0A 4QPXA 3TNVA 3DDIA 3HHNB 4WYLA 4N7TA 4J9QA 4HT5A 2DGXA 3JSBA 1KC8T 1XMQF 2UUBF 3MM6A 3MEGB 2OELA 3EE3A 2XG8A 4WTYA 3W8GA 3JAMU 4RL1A 2VICA 3M2VB 5G0RA 4FYXB 4USKA 2YWKA 3MPDA 1YSJA 1RWPB 5H9FJ 1B70B 5H1SV 3NNCA 3DLEB 4CLPA 4CRJA 1NHKL 2W8KA 4QR0A 1ZZNA 4LF8F 5MLCV 4FBTA 4EGLA 2XO6A 1HPZB 3Q8SB 2X1GA 4N5SA 2AP6A 5KAKA 1SPBP 1UVLA 1S77D 1ICEB 3GB0A 2R7RA 2EG1A 3CE8A 3ZTPA 3R5AA 2O66A 4YMEA 1FE4A 4DQPA 4X4SA 5AXKA 1J2VA 1B0PA 1R0CB 2RS2A 4DG1B 3U1LA 4IRDA 1R8CA 4F4ZA 3PM9A 1RTDB 4IOAQ 1CG2A 2AV5A 2Z2ZA 3HHLB 2QL9B 1WKJA 3SYZA 3OUYB 3M8PA 1IBLF 3TAMA 2IJNA 3DLJA 3DU6A 1K1SA 2OMOA 3AJDA 3DLGA 1B99A 3NGUA 4B02A 2YKNA 4TLQA 2CWXA 3UN2A 1DY3A 1NMEB 4KIAA 3ISZA 1RA7A 2QN6B 1AA1B 2MZRA 1UJ5A 4NYOA 2EW9A 4F8RA 5CD4A 1WF1A 4OHWA 5DJBA 1RI7A 3TUPA 3KK1A 1I6JA 7AT1B 3ZNUA 3GIRA 2JFKA 3NGSA 2FJBB 4E2FB 2XS5A 4PAAA 2NYHA 2VHGA 4CO1A 1NJZA 3W9IA 5KG7A 2HRYA 2V2VA 3D28A 4E98A 3DCAA 1JJ2R 1HYSA 4DI6A 4DR2F 2WSFC 4MIBA 4ZPAA 2EFVA 4F3QA 2B4PA 3FZ2A 3OD2A 3C6UB 3DOLA 1VOMA 4QWCA 2YNFB 4MYTA 1RYSA 3UCUP 4DR1F 2HIYA 2VBYA 3SXLA 5ETTA 3UN3A 5D0RA 3AQOA 1F1BB 3BYPA 1ZAXA 3Q2TC 2DGUA 4DS5A 1JLQB 1Q81T 3FMBA 5K14B 4RW9A 2X3GA 1VRQC 3FSYA 4WWSA 1HL6A 2KT2A 4A46A 4ECSA 4IOCQ 5B0DA 3GP9A 1E6VA 3ZZYA 2JH3A 4M5DA 2B6AA 1XMBA 3CCES 1FNXH 4RW6B 3GV5B 1N5SA 1JNRB 1ACMB 1MU2B 4C7QA 4QYRA 3EGVA 1FTCA 1YJRA 2DNOA 1R43A 1NB2A 1LW2A 2W7AA 1GQEA 2CJQA 3QRQA 3JB9k 4M95A 4PG7A 1RTHB 1D0EA 4ZCKA 4GRSA 4AQYF 3H25A 1R8AA 4URSA 2X1FA 3MZIA 1CSJA 4UQGA 2FLOA 5IC4B 1F2HA 1VI7A 1HMVB 1U0HA 2ILYA 2R8IA 5HBMB 2NYIA 2NXJA 2PFFB 3SFUA 2CUYA 2QFJA 3B8HA 3J81Y 3LGMA 2Y1RI 5A8WA 5FIIA 4MKAA 4JV1A 3FJ2A 4KH0B 1URRA 4DOZA 1PGZA 2MKYA 3HVRA 1QAYA 3HHKA 2KG1A 1KQKA 1VQNS 2XY7A 1C1BA 2V4JA 4C98A 3BO4A 1NZAA 3RR8A 2ZE2B 1RHQB 2NSCA 1T03A 2XGQA 3DXBA 2Y0BB 3PW7A 5E33A 2VG5B 1G4CA 1UWBB 1SJFA 4JV5J 3CTRA 4D3HA 1ULRA 3VCDA 3NGDA 3NY0A 1NU4A 4FS2A 1FKPB 4GVBB 1QD1A 4UOFA 5BJRA 2Y8YA 2FTRA 2N7YA 2R7WA 1FJEB 1F3FA 3AXMA 5GVQA 2EEYA 1RT7B 2HS4A 2DCUB 2HEKA 1EETB 2HHWA 4QYZJ 2YQ0A 2DTJA 3HKZD 4O3PA 2GVDA 3TANA 1F6TA 2OO4A 3SDEB 2HQCA 3POTA 2PE8A 4WU2A 2MPUA 3CEDA 2YKMB 4JI7F 2AJ1A 2HNYA 4NXNJ 4V1Ak 1SJ1A 1VC6A 2FJDB 2ZH8A 1RHMB 3OJSA 3N79A 1SI9A 3KLHA 4DV0J 5JXSA 5A2QY 2V2QA 4UTGA 1V5VA 3ENWA 3NCRA 2QA4S 3UQSA 4RU2A 2VFSA 2QC3A 1RKIA 3VGVA 5HMYA 2J6SA 1FWKA 3SSRA 3NCPA 4LBPA 3RRHA 2VUGA 3CIMA 3EVMA 2R8GA 3AFGA 5HROB 1Z1ZA 4AL7A 4MJKA 1F5BA 1RTIA 2AYMA 2DHAA 5T7LA 4JI0J 3I96A 1JLBA 5GAGU 2HK3A 4HACB 1N32J 4K8RA 1TV6B 2ASLA 1BQMA 4M8LA 3V4MA 1KKHA 4MKBA 1UPMB 3NP5A 2ZD1A 1G2EA 2AU0A 3VAMA 3V6HA 3DU5A 5KFEA 4ZPDA 3SFGA 4LF6F 1WSRA 3CD7A 3O1LA 1NPKA 2KT5A 3ZNJ1 1LXNA 4A8YA 1H7XA 2IC3A 3H7HB 1GH8A 1WUUA 4R5PB 1S1XB 5L1JA 4TLRA 2NUHA 2HMIA 1JXEA 2KFZA 3CB4A 4OZ2A 2G0IA 4H4KC 2PDAA 4TU8A 1JXLA 3KK2A 2FZCB 2IM3A 1QLNA 3QGGA 1R6VA 4GVLA 2YPZA 4QWAA 4X65F 2ZM6F 3MAQA 1FRMA 2WAQD 4IUFA 4C11B 5C24B 2HGNA 3OXLA 3D68A 2QTWA 2W9CA 4OI0A 3DDKA 4AXJA 4F3MA 2OPPB 3E2EA 5KT5A 3CPWR 4ECYA 3QIPA 4MKVA 5KG5A 4G3IA 3G2XA 2BEFA 3TQ1A 1PAEX 3MM5B 4DV6J 1FEEA 5DRKA 4F02A 3I5BA 3SMZA 1N34F 2QX0A 2ZH4A 3H59A 1NLKL 2W2PP 1REGX 1TKXB 2CKWA 5CD4H 5LSRA 1W26A 1TAQA 2C22A 5M2RA 3FMWA 2V63A 1S0OA 4K0KF 4CTAB 3U02A 3EXYA 5J1PA 3DMJB 2FDNA 3VAGA 5KT6A 5DLGA 2K1RA 1NKBA 4OX7A 1NDCA 1YBUA 1L3SA 3KHLA 4IH5A 2F8EX 4K4YA 1UA0A 3TZXA 1KDNA 4KKOB 1J27A 3T1AA 3JTOA 3W60A 1EB0A 1YLXA 4MMOA 5IT4A 3M2UA 4ZP9A 4FVCA 2MKKA 1D09B 3GYXB 3AODA 1KOOA 2OMLA 3H2VE 4J91A 1TL7B 2ZWPA 4C8ZA 4IYQA 2AZ1A 2VIHA 1SL0A 1RT6B 2CQBA 5CYJA 3CJSA 1OYDA 2RF2B 5C5JA 3A8KA 4A8FA 1VIOA 2OHDA 2MQMA 1TK8A 2OFGX 4PUOA 1HKAA 4J9RA 4XAKA 4WK3A 2XI3A 1YI2S 3DRYA 1UAWA 3DKDA 3OFFA 4BBYA 5DLFA 3KMSA 5KG4A 2M8DB 1FF2A 4X64J 2ROGA 3RBZA 5F8LA 3QGPA 2R8HA 1IUJA 1CJUB 2LQ5A 1LOUA 2M4MA 3I9V9 2UUAJ 3RW6A 2JLGA 2ZUAA 4ZLNA 4IOBA 2CZ4A 4LVOP 5D77A 4JV2A 1WD6A 2MGZB 2XTJP 3LA0A 4C97A 5DG8A 1T9UA 3OW2R 3ENQA 4CM2A 5AJ3J 2VBWA 4PXCA 3RYLA 3I0SA 3UNGC 4OHZA 3RZAA 2APOA 1UFKA 4C8NA 5CCLA 2HVZA 4C3LA 2RHSB 2F4VJ 3DOKB 1KN6A 5JVHQ 4PQUA 1MN9A 1HQUB 4B9NA 3SCLE 1S1TB 2ZH2A 2CADA 4WE1A 4J9UE 1NPPA 5IS2A 4ZCLA 2CQDA 5E3CA 2AX1A 2M5YA 5L39A 2GV1A 4OZLA 3DLHA 1TL1B 3P5TL 3PFEA 4O0IA 2OAUA 4JI6F 4QWEA 1VQ4S 2E9TA 4J9NA 4E0DA 2GCFA 1FVQA 1UEKA 3JAMY 1VQ6S 1LFWA 1K47A 4ZITA 4ZVUB 2J6UA 3M2RA 1V9OA 5DS7A 2EC0A 2YVSA 2OTLS 2H3EB 3MAAB 4RW7A 3BH7B 1XN9A 2GVZA 5IWAJ 2EG2A 1GFWB 1MLAA 2IBKA 4KHPF 2IAJB 2MHNA 5HQLA 4B3SF 3QNWB 4ILRA 2CQGA 1TL4A 1HR0J 1TKZA 4PPDA 2IY5B 1KHVA 2VB6A 4H4OB 1D9FA 2DGVA 3GJQB 4PWDA 2OPSA 1LEOA 4DV7J 2UZAA 2IRYA 1MROB 4F0HA 3MM8A 2DR7A 4Y2KA 4I7FB 1IR0A 2F9JA 2MSTA 4OQJA 1RT5B 1U6BA 1ROFA 5IFMA 4ZPCA 2VC1A 3UE2A 2GW8A 3BV8A 3OL9A 3M8YA 2ZZMA 3PYFA 2M52A 2DNKA 5JVGQ 3G87A 1FDNA 2IIHA 2VDHA 2QLWA 2JEIA 1R0AB 2LQBA 4IG0A 1OIAA 3S8SA 1S1WB 4KH1B 1BHNA 2HNDA 5ETVA 2EC2A 1D9AA 1NDLA 1RZMA 1PC4A 2NXEA 4K2XA 3V6KA 2OKQA 2ATLA 1ZA1B 1YJ9S 1C1CA 4FXVA 5AXLA 2CPYA 2LCWA 4DV4J 1HQEB 3BO2A 1VLOA 4WFBQ 3K5NA 3GFZA 2Q1LA 4QIGA 1KVKA 4MIWA 4C3KA 3OJUA 4WZMA 3QLHB 3THPA 3MDFA 1M1HA 2LMIA 3GYGA 2HVEA 2EI5A 4NLRA 3NBPA 1XMQJ 5CYMA 1F9HA 2MQQA 2NR0A 1RTZA 3CD5A 2UUBJ 1VBZA 3MUMP 2DD8S 3OTDA 4P9SA 4QZVB 2KXNB 1VRUB 4ID5A 1NKCA 1KWMA 2ASJA 4I2PA 4F4YA 1EQMA 3HF5A 5F8JA 4JV0A 2G4BA 2BKNA 2PN6A 3L9ZA 5LJ5Y 5H9EK 4ED6A 3I87A 3IS9A 5KG3A 3V81B 3DXSX 3PKMA 1CC8A 2C3PA 4ZIVA 3P45B 2HBQB 2FVSA 3GZ7A 3IRXA 2ADCA 1IR2A 3ITHB 4USHA 3AOBA 2JSXA 2KKHA 2BX6A 4K4TA 4QPTA 3KFWX 4DX8H 4HHJA 3CO9A 4URGA 2KI2A 3R6LB 4JI2F 3DNCA 1QE1B 2CPDA 2SXLA 2OI2A 1VQSA 4OYXA 3HVWA 2MZQA 3HT3A 2UU9J 4LQ9A 2B4OA 2GO9A 1N5TA 1BMQB 1IBLJ 2ZNZA 1X9MA 2ZHBA 1D8YA 3KWMA 5KFJA 1RWUA 4Y34A 4J9KA 4MTPA 4PWUA 1VJQA 2WVBA 2AEFA 1VYAA 2ZFHA 5F3TA 3BSNA 3IA0A 3HP6A 4X62J 1VC0A 2M9KA 3KK3B 4J90A 4OX8A 1XK8A 2ZHOA 3KLEB 2BDPA 1KNZA 3UDEA 3R6GB 4AD6A 1CJVA 2HQ3A 2K2PA 3D66A 2YPYA 1C0TB 1KR4A 3AY0A 2E1PA 2PMHA 4OYOA 2OLWA 2CQ2A 3P4UB 2IYIA 3IR7B 3ELHA 3W3SA 1H0HB 4DR2J 2B9YA 1TVRB 3LAKA 1FRLA 1HBUA 4YDDB 3PHTA 1BE4A 1M5HA 4I64A 5B0EA 2LA6A 3MMCA 4DR1J 3FK4A 1VHIA 2HFNA 1F9FA 2OD6A 1QAJA 3NLCA 3UD3P 4NRUA 3IWXA 5IT9U 3MCSA 1LW0B 2C2KB 3DOMB 4AE5A 4K50A 4ED8A 2ERRA 4F04B 2CPFA 2DXFA 3DM2A 2HHUA 3RBDA 3WC2A 4DSIA 4ZS6A 4HTIA 1M5KC 3C16A 2LDYA 2UVUA 1KVJA 2DNGA 2V8DA 5KFWA 4LR9A 2J76E 5IM0B 4EZ6A 1BY9A 2UV8G 2XY6A 1FRJA 1Q1KA 3TJAA 2UXBF 2FY8A 1ZAVA 4B9VA 3FFIB 1NK8A 2KG0A 2Y1IA 4PR6A 1UW9A 1Y9OA 4MFBB 4ZA1A 1HNIB 1VQ8S 2IVYA 2XWXA 2KZMA 4HEA9 4RZRA 1XR5A 1YZ6A 1T9XA 1RAEB 3VAJA 1APSA 3D0IE 2J9EA 3B78A 4AQYJ 5KTQA 4DFMA 2FJXA 4AXIA 4I68A 3I5AA 1NBEB 2AEMA 4LIRA 2G1HA 4QOTA 1S7HA 3W2VB 3TZYA 2FZKB 1LWFA 4LF5F 5KOXA 2YNGA 2I6WA 4RUBA 2EFPA 4GKKF 2UUWA 3HFKA 4C8LA 3HFVA 3G82A 3PV8A 1NK4A 4X66F 2XZTB 2CPHA 1HD0A 4YN3B 1W2BR 1XNQF 4LFAF 3MEGA 3KG0A 5AE1A 3NS7B 1YDLA 4QIVA 1FVSA 4P72A 2D1CA 3N6LA 4USTA 2JWNA 4USVA 5D15A 4O4RA 3M6WA 3TX8A 1UVKA 4RJVA 5C2GA 3PY8A 4DV5J 4NRTA 1HFEL 2B9EA 4A48A 2LDIA 2LXIA 9RUBA 2RDIA 3BYRA 4DPYA 1Q8BA 3HSZA 1SQGA 3DLEA 3TVZA 3P5BP 2ROPA 8AT1B 4F25A 5EN1A 4HL9A 5KFRA 4R0JA 3Q89A 3LP0B 2N7CA 4QR1A 1HPZA 1EARA 1BD6A 2B9XA 1SH0A 3DFEA 4NASA 1HIYA 2CPJA 2J9DA 4K5SA 4LRAA 1JKHB 2LQ9A 3RAQA 4FZVA 3LQVA 4K5RA 5CAAA 3QSIA 4O4GA 5B0AA 4ZN3A 3K8VA 1YBTA 1IBMF 1UW4A 2CQ4A 4Y0FA 3BPDA 4C0OC 4DG1A 4F3OA 4DUYF 1CJKB 3UDVA 3HLUA 1S48A 2ZVSA 2UVVA 4DV2F 4UQTA 4JI7J 3HHLA 5L1LA 1U1KA 3MI7X 4HYKA 2YWEA 2IM1A 2RDJA 1FFGB 1H98A 4FXWA 2GMHA 3MAHA 2CDRB 1S6PA 5CZXA 3VQSA 2EFQA 2QMXA 2H5JB 2VA3A 4DX5A 2YKAA 3T1YF 2W25A 4N8OA 2AYEA 1U1MA 1GXTA 1V3RA 3CDAA 3CJ5A 3VGUA 3IG1B 1TUWA 1VQKS 4O3QA 1U2CA 1Q7YT 2R3VA 4ED3A 1QSYA 1AW0A 4Y2IA 2EBEA 5LMUF 4YR2A 3NXZA 1S5ZA 4UOHA 2ZDOA 3IO1A 1M5OC 4BC9A 4D3GA 3PIOQ 3SV3A 2XMJA 2LYVA 2NPFA 3B4MA 3MEEB 1ZH5A 4HH0A 4F0KA 4PYAA 4LF6J 2XSJB 2QLJB 2A6MA 2RB7A 2WTFA 1JLFA 4RNHA 3GSIA 5HATA 3AT1B 4C6AA 2OSQA 2DNZA 3NAIA 1SVDA 5K14A 4OZNA 1FKAF 1DTTA 2BVZA 3SQGB 3D3CJ 5L1IA 1SC3B 4H4KA 3QRPA 1N54B 1W7WA 2EPIA 2R9LA 3MWBA 4ELVA 1VQPS 3OSNA 4X65J 2ZM6J 2J0SD 3DRRB 3OL8A 1NZ8A 2GHWA 4KPCA 1LWCA 3U1MA 2XQCA 1WKLA 3THVA 2E7WA 4A4JA 2GHVC 4HTJA 2D9OA 4J7CA 4DPTA 3OLAA 5J2MA 5CXTA 1CPZA 1RTHA 1XR6A 2EFOA 1U24A 3VAKA 3SQOP 2XY5A 1OSCA 3K5LA 4M5NA 2A2CA 1Y5NB 1RHJB 1Y10A 2JRSA 2O01C 3PCOB 4CLSA 1Q8LA 2LU1A 1WNEA 1H72C 3KG1A 2GGPB 4U67Q 3CCMS 1N34J 4TY8B 2YH0A 3NCQA 4CT8A 3PW5A 5D78A 1S49A 4M5IA 2HFOA 3RAMA 3BEGB 4LRBA 2IM2A 2M8HA 1SV5A 4NLVA 1QJHA 3ENAA 2J0QD 1FDDA 1MMLA 1S0MA 2OTJS 4K0KJ 4DQSA 2MKSA 3PW4A 4WF9Q 4K4SA 4KGXB 4ZDNA 3CJ2A 2B56A 5LMNF 5I3UB 4MKYA 3EGZA 3RB3A 2ACMA 2ZE2A 2WCXA 1YRTA 2AGPA 3HJVA 4JI1F 1Y7PA 2L3MA 1AXQA 2NUUG 4WZQA 3T41A 1WDTA 2VG5A 4HR2A 3R9LA 4FF3A 2OPQB 4LUBA 2DH8A 5I42B 3CC7S 3IWNC 1FKPA 4GVBA 3EZ5A 3ICLA 4NZ6A 4X4OA 1JQGA 1TKDA 4LF2A 3LUYA 5CYQB 2RQKA 3BZQA 2FD2A 2BM1A 1RT7A 2NREA 5C25B 1EETA 2Q6CA 3MR5A 1WJ9A 2AJFE 1RAJA 5J1EB 4OI4A 1G6BA 2EBGA 5J2PB 3LW5C 2EWHA 3SDEA 2UXCF 4RBTA 1FD2A 3EM1A 2GIQA 5F0UA 5AE2A 4P7TA 3C6TB 2ZJQQ 2YKMA 2MKCA 3LALA 4DHVA 2F63A 1OY9A 2KJWA 4KGZB 1F9EB 3V6DB 4ZIWA 4QW8A 1HHTP 2HGMA 1KRPA 4OJ1A 1NK9A 2X1AA 2H5EA 5AXNA 2OEKA 3D1HA 5F0WA 4OX9F 2Q79A 2PMZD 2JVOA 4ZJQA 1U0SA 1FRHA 2AIRB 3A13A 3SIPB 1Y0HA 4NYZA 1S9FA 1S6OA 1B64A 4UF4A 1QDUB 4DBQA 2E7XA 2BOAA 5HMWA 1KTVA 4RNNA 1UZDA 4C8YA 5HI7A 4GC6A 1AFIA 1FI4A 1SC4B 2XZDB 4F2RA 2BW2A 3LP1B 2IJRA 2ZJRQ 1SCJB 2MKJA 2MDAA 1FK9B 3M32A 2KN4A 4TQRA 4LSZB 1WHYA 2XYGB 3HZGA 4BDPA 3UD5A 2DPJA 2F1FA 2MJNA 1DLOB 4C0BA 4EYHB 3FSIA 2AGQA 1UVIA 1YHQS 3CJTA 1IM6A 2BA9A 1HQ2A 2CA9A 3F0NA 2RT3A 1FEHA 2K7KA 3R2DJ 2C42A 4HVZA 5C7PA 3HK2A 1KQGB 4R5PA 3A12A 1B0TA 4UUXA 1S1XA 4Q0BB 2DRAA 4F26A 4WFXA 1OPZA 2B43A 2ZWOA 1M90T 1KBRA 4KV8B 2R2UA 3EZOA 3HD2A 2FQQB 1BWVA 1FDBA 4NCGB 4B9UA 4KHPJ 4CZCA 1SXLA 2WBMA 4B3SJ 4HT7A 1N5YB 2DGWA 5M2PA 5C24A 2M7SA 3W64A 2RRNA 3QRRA 3KXDA 3DRSA 2LVWA 4ZPBA 2AEJA 2RVJA 3HMJG 1ZA2B 2YNHB 2UXDF 5K8OA 2VOOA 4GKJJ 1T3NA 3VWSA 1HBNA 2PEHA 4DV1F 4X4RA 3DYAB 4I56A 3V4IB 1XTZA 1U1QA 4DX6A 1EZZB 3EGWB 4UZBA 4RWWA 4LREA 1WI6A 4LSLB 1X9SA 4WKRA 1KFDA 1ZM3A 2QV6A 2ALZA 4EO6A 1X0FA 1WF2A 4OJGA 3R7BB 2G13A 3DI6B 4CTAA 5KFZA 1GNKA 5HO4A 2KHDA 2CNNB 5HQMA 1P9QC 1RWNB 1ITPA 1RHUB 3LPYA 1PJ6A 2GA7A 3T5LA 1KLNA 2W4PA 4TYBA 5I3QA 1PAUB 3QZ8A 2HS3A 1U47A 4Q45A 1HNWF 3I9ZA 3PJWA 2AQ4A 3N6MA 4ZVEA 2K06A 5AE3A 1YK9A 1K9MT 4OYWA 1CS4B 2I0XA 3H2UB 3NS5A 5ETPA 4BCAA 1IVZA 3PRVA 1NJYA 1DQ9A 3TEGA 4ED1A 1IXKA 4MK8A 1RT6A 3R5JB 5HN0A 4F0MA 4FYYB 2RF2A 8ATCB 3RR7A 2E44A 3D6HB 2DO4A 2V8GA 4WJBA 3MCOA 3C46A 4ZVSB 3NRBA 5D0HA 3LANA 3MTJA 4ZVGA 2VV5A 1QTNB 5KFFA 4RX6A 3UVJB 3KLIB 4JB8B 2HVHA 5B09A 5K5MA 3CCUS 1RWWB 5E7OB 2DNYA 2MQLA 4I2QB 1EHWA 2YXLA 2JEGA 2R7UA 2XCPA 1CJUA 3G6VA 1VMBA 3GFHA 2MJUA 2P9CA 2AKWB 3JS9A 4ED5A 1HNVA 2BJ3A 3P6YC 4DL3A 4U6PA 1FTRA 4USJC 4L3KA 1WELA 4RW4B 2BANB 2WB4A 1S10A 3BKUA 3MUTP 1RISA 1HQUA 3BQ1A 3DRXA 2QYGA 4M5GA 5F8HA 1U1PA 2AHOB 2VC0A 1TL1A 2ZH1A 4QIEA 1HI8A 3C8YA 3VHQA 2QMUB 4RW8B 2E5HA 5CCMA 3CJ3A 3M4XA 5CQGA 2XMKA 3A1YG 2Y8WA 1DTQB 2P5VA 2HK2A 4DQRA 4BWMA 1RE1B 4U95A 1Q95G 1TTHB 4OHYA 2J9CA 5DG7A 3TUJC 2WB1D 2WONB 2AJQA 3I31A 3DLLQ 3ISND 1ZTTA 2DK2A 3L7UA 3HX9A 1VLYA 1SJ3P 3HFZB 5KFTA 2UUTA 2GAHC 1VQLS 1WEZA 1GX6A 4NLGA 5IV3A 2W7OA 4M5MA 2VFUA 1P6TA 2IAJA 2PD1A 1TP7A 3TA2A 1D3WA 3UR0A 1U6FA 1ZETA 3BGOP 2I9SA 4NCBA 1RT2A 2JL9A 1TL5A 4OYMA 4F67A 1HWJA 3E51A 2XLIA 4ZJLA 3SSSA 4ZVQB 3I4PA 3M8WA 4A8MP 4C3MA 1SUQA 2LQJA 4FKYA 2FVQA 1GMWD 4H54A 1JLAA 3KG4A 1AUDA 2VOPA 1RT5A 4W92B 3DHXA 4OLPA 3TO8A 1RT1B 4L73A 1YZ7A 2UXBJ 2ZOMA 3EJMA 1SIWB 2DRBA 5K8PA 3L95X 3M8QB 2W01A 1IKVB 3SCJE 1HI1A 1RKJA 2JC0A 2V5HG 2JVRA 2VL1A 5A0YB 4M63A 3D6MB 3W5ZA 4M1KA 1LV5A 2JEJA 2DITA 2KFYA 5D4PA 3A8JA 3J80Y 1NHUA 1BQXA 5EUHA 1WG5A 2JZ5A 2C2EA 4LIWA 5BR8F 3I5CA 4LF5J 4O44B 2GFFA 4NMXA 5KFVA 1HQEA 1ZPVA 4K4VA 4GKKJ 5EHHA 3QLHA 3MM6B 2YX1A 3T5JA 1FFSB 1WEXA 4X66J 1FD8A 3IN5A 4Z7CA 1XNQJ 4LFAJ 4PXEA 2LQ8A 5BYRA 2RQ4A 1MNEA 3KJFB 1RAIB 3HVTA 3QAEA 3HKWA 2W2QP 2V9KA 3QMQA 3R1LA 4HDGA 3ZC4A 2CQHA 4P52A 2IMOA 4O3SA 3PJXA 4A8WA 3W9JA 4JI3J 5M2UA 3BBBA 3O3LA 2AYBA 2IDEA 3PRDA 1S0VA 3H20A 2UUAF 3BR9A 3LP2B 5L1KA 2J7KA 4J9PA 2CNKB 2CQ0A 4NA2A 3A8EA 2J0WA 4Q2MA 4ATNA 2MHEA 2RMLA 4IRKA 2FB0A 2M3DA 1XERA 5KG6A 1OJ4A 1WC4A 5EDWA 3JXOA 2GZOA 3MOZA 5B0GA 1X4AA 3IR6B 3GE9A 1IBMJ 5F9LA 3ZZZA 2BYCA 4A8SA 3E8OA 3IAS9 2F9DA 1QE1A 3CT9A 2HIQA 4DUYJ 4WIIA 4DV2J 3PEHA 2GHPA 2MB0B 3M8PB 2I1RA 4NLWA 3TAMB 3GPAA 2UVRA 4DN0A 1Y5IB 4UOCA 1T9TA 5B0FA 2XS7A 2V67A 3CJQA 1Y00A 5B0CA 4DLEA 1XNRF 3MR7A 4LF7F 4QR2A 1AT1B 3HZEA 3I4HX 4NL5A 2CJXB 2N4CA 3H40A 3VTIA 2FLNA 2DYAA 3T1YJ 1WF0A 3KK3A 5DDPC 1U6ZA 1RHKB 4ZVTB 1H7WA 2F5GA 3KLEA 1N36F 3ONQA 3AXKA 5GADI 4OYPA 4DN9A 2X7IA 3OQ2A 2A18A 4ZP8A 2PMWA 1NHVA 5LMUJ 5E3PA 1N88A 5HVFA 1HR0F 1P27B 4MK7A 1S7IA 5IOLA 2V69A 4NLSA 3A8IA 4OZJA 3BSCA 4AUKA 2RSQA 4P2MA 3PHEA 1TL3B 2HNZB 2J7WA 5FD1A 5E3AA 1RTJA 2WSEC 2R7VA 1SC6A 2MKIA 2YX4A 3R97A 1F2GA 3K89A 4RW9B 3UCZP 3GONA 2NXNA 4ES3A 4OZ1A 1LW0A 2V8PA 3DOMA 2HAFA 3CDBA 4DR7J 2WSCC 1TKTB 3MMJA 2IVMA 3CJRA 3WDOA 2AWZA 2I5JB 3Q0AA 2MZ1A 3TP2A 4B3TF 2XEXA 2CQIA 2MZSA 2WOMA 4A8QA 4Q7AA 3H4BA 2HAIA 1RQ0A 1LW2B 2QSWA 3FFIA 4BLGA 3KLFB 4MFBA 4ZPVR 3QGIA 2BJEA 1WOSA 1HNIA 4QBUA 5F8NA 1HWLA 1WC1A 1FT8A 6FDRA 2LEAA 3LOUA 1PYTA 4K59A 5G4DA 1X8DA 2W1BA 4NLPA 1F60B 4IQXA 2DBBA 4KB7A 3D1OA 3CW2C 3MEDA 1UMJA 2N3LA 3W2VA 5BYSA 1IKYA 3FBBA 4PQAA 4RUCA 2GNKA 4KHRA 2DT9A 1EAYC 2J0XA 3UPFA 5E41A 2WVDA 2ZNYA 1RYRA 2B5JA 4WPAA 4UZCA 2EK6A 4DL7A 1DQ8A 3CCRS 6FD1A 1ZYQA 3CCTA 1C1BB 2V4JB 1HWIA 1T05B 4DDFA 2KT3A 3MURP 2QSFA 5LMNJ 3D6FB 4RLEA 2MQOA 3FEXB 4EZ9A 3MMAA 3CUNA 2DNNA 2E5LF 4JI1J 4TY9A 1H73A 2PA3A 2FZGB 4DFKA 1X5TA 4MIAA 4RPFA 4FNHA 3LP0A 2OIHA 4EYIB 2HWTA 4OI3A 3H5YA 2Y0SD 2UU9F 3MR2A 1CULB 1JKHA 4G6VB 2C2NA 2PI4A 2J9DE 2GVDB 4OZ0A 1BQNB 3KLGB 2VONA 1OWXA 2KVQE 4R8UA 2CG8A 3VGTA 1J5OB 2M70A 2UXCJ 1CJKA 1HBMA 1N6QA 3GIMA 3MMBB 2B3TB 3GV8B 1FXDA 5D0GA 4PG6A 4X62F 4EI2A 2RRAA 4OI1A 1FJCA 2NZ4A 3BGFA 1H6KX 3KLHB 3ZXWA 2ZH5A 2V34A 1I94F 2KFNA 2HGLA 1O0PA 4WP3A 3I55S 3KNGA 5EGYA 2VPWB 4C2MA 1JLEA 3I56S 3G71S 2GMJA 4OX9J 4WCEQ 2MLYA 1E6YA 2G0JA 1LFPA 4ZVHA 2DXDA 2IJFA 2HHTA 3FCWA 3D54A 1LKZA 1FKOA 1RTIB 3CMAS 3DLKB 2GMLA 2MLXA 2ZJPQ 1RBOB 1JLBB 1VJWA 4E8UA 4YFUA 1BQMB 2DGQA 5GADU 4OMFG 4DL6A 3VVTA 3ETOA 2VG6A 2O1PA 2MSSA 1PKUA 1X4DA 4IFYB 2B8PA 3MM9A 1U26A 1R7IA 4AL5A 3FVYA 5EWGA 1TU0B 1B7YB 4PXDA 4B9MA 1GXLA 4ITSA 4ZVOB 4WKYA 2WK4A 1MWZA 1SJRA 2HPUA 2QIFA 2IC3B 2A1BA 3K0JA 1WC5A 2KHCA 3GFYA 2XSJA 3B4DA 3RB4A 4DPXA 4O3OA 2A10A 1K0TA 1RHRB 2AMCB 2YNIA 3EGNA 4NEYA 4X4QA 2HMIB 2D3O1 1WG1A 1X5PA 1S9EA 3PO4A 4GC7A 1OQ6A 3KK2B 2HBYB 1CQMA 2J8AA 2DHHA 5DGAA 1HHSA 3P49B 1HLWA 4KFBB 2CQPA 2D69A 1NK5A 1WDDA 4B9LA 3LWMA 3DRRA 2W9CB 2DNLA 4JYAJ 2VBZA 4P10A 1JB0C 2W4DA 3M8RA 2VFTA 1RP5A 3AA8A 1WOOA 2ZBCA 3C66A 3FRYA 1DJ0A 2V0NA 4NMLA 1U1NA 4P73A 4NLOA 5ITHA 4CYUA 3GIJA 3ZTSA 2OD4A 1AUSL 2ZBQA 5D6GA 1X5OA 2UXDJ 2DNRA 1NCLA 2F40A 3IRWP 3OXFA 4DUTA 3GJSB 4DV1J 3VAFA 2WVFA 1U45A 5L8RC 2GGPA 4RO0A 2Z30B 4TY8A 3OT9A 5HL7Q 4I69A 3U27A 3VZIA 2ZOGA 2VG7A 1S4FA 1GT8A 2L48A 3HD1A 2DH9A 2LKZA 2RAQA 3G8SA 1X4GA 2J7UA 2V2ZA 4NLTA 4DV5F 2X3DA 1XJWB 4ETXA 1Q53A 4OZ3A 4WU3A 3OTCA 2HKEA 4L74A 5KFMA 4ECQA 4NXMF 1C4CA 2F7VA 4WP8A 1UTAA 1YJWS 2DNMA 3THTA 2FC8A 4PG5A 5I3UA 2DR6A 2XCAA 1HNWJ 1GTHA 1O8BA 4CH1A 3G4SS 1SB6A 3NEKA 1UA1A 3TEHB 1Y3KA 4B17A 1U25A 4XK8C 1DAXA 1IWGA 3GIKA 4K4XA 2KO1A 2OPQA 3OPKA 2V8HA 4G65A 4CWBA 5I42A 4DU7A 3RW7A 3UDLA 1NM2A 3CCWA 1RWVB 2ZHAA 1ZM4A 5CYQA 4JI4J 5CHCB 1S4EA 1ZS6A 3H2LA 1J5EF 3HHLC 3CJKA 4PUOB 4NZ0A 1R27B 5A76A 4DL0C 4NLDA 2CQCA 3QJPA 2DHXA 2P6SA 3SBMA 2FGOA 5F8MA 5D0EA 5KFXA 3PTWA 2DO0A 4DSEA 9ATCB 2DHGA 4KRWA 2W7PA 1VBXA 3TJ9A 2HHQA 1DBDA 3S01A 4ILMA 1NO8A 1S9GA 3ILIA 1BWEA 4YR3A 1OMSA 3VV2B 5DDQC 1KQSR 5DQGA 2OP5A 3J81j 3QBCA 2B7BB 5DDRC 3JYTA 3O2IA 2L08A 3FZBA 4DPOA 3I0SB 3BBCA 2H48B 4RR5A 4ERDA 3RUBL 2XM3A 4OHVA 3JSMA 1TUVA 3M30B 3H5XA 4XTTA 3C14B 2B4UA 4K4UA 4IRCA 1D8ZA 3J81U 4IO9Q 3PRBA 1QUPA 1JLGA 3J7A1 2CNLB 4GMKA 2AGOA 2LXFA 2KXFA 1WSVA 3DLBA 1FK9A 4K2JA 3N01A 5F3ZA 2OH2A 2E9RX 3QYYA 2BR0A 1X4HA 2FJVA 2G2YA 2MZTA 4Y2CA 4KY3A 1DLOA 3OR2B 4CLKA 1FNMA 4FXDA 3FQKA 2BE9B 4ED4A 1GXUA 2FC9A 4CH0S 2YQ3A 2BE2B 2AX0A 1RAGB 1DZ5A 2R7XA 5DZ6A 5HP1A 4KV8A 2KXHA 2FIUA 5THWA 1RCXB 4OIXA 4NCGA 4H4MB 2JOQA 1S72S 1P1TA 3A3PB 5KFGA 3BGRA 2PT0A 2HHSA 5E3RA 3BBFA 4DX7A 1AFJA 1EX8A 1NNDA 2PEBA 1R6YA 2XNQA 3QATA 5HVHA 1RBAA 4PG8A 2GJIA 2YNHA 2B51A 2XMVA 2VKZG 3Q86A 1MMDA 2PSZA 1RSCA 3AA9A 4F4KA 2Z57B 2CJ9A 5LT5A 1UP1A 4HH1A 5BXIA 2PO4A 3LF0A 3DYAA 5KFSA 3V4IA 4ID8A 4KAIA 2Y1JA 4WXWA 2VU5A 1U48A 2DIVA 3HSGA 1A0OB 2IMWP 4KE5A 4F7VA 5HJYA 3MM7B 3WQPA 1FE0A 1KHWA 4PYDA 4ZHRB 1CVJA 1SL2A 2F8MA 5KG2A 2Q43A 3IAM9 3W66A 3A3NB 3EICA 2C3OA 1EIYB 1OYEA 2BV3A 3T5KA 3D2WA 1HA1A 2H1YA 3DI6A 4OI2A 4LF4F 5BR8J 4X4VA 2XMTA 4ICLB 3TUZC 3MPYA 4NLUA 1JK9B 5IZHA 2CQ3A 5CYMB 2JFDA 2FVCA 4ES2A 3R2CJ 2MLZA 3C15B 2CJKA 5MAOA 1CS4A 4X4NA 2CAJA 5FDLA 4U8YA 5ETMA 1S6QB 2NLWA 3IGVA 3N6NA 2CPZA 2E1RA 1F3VA 1REVA 4ID5B 3W5YA 2AZ3A 4I2PB 2FYXA 4C8OA 3HXMA 4ANCA 3BQ0A 1WC6A 3PX4A 2DPIA 3IS9B 2V6AA 3ZO7A 2BQRA 1W25A 1N5QA 2D41A 4ED2A 2KYZA 3IRXB 4KT0C 2H51B 2P8IA 5L9NA 1FFWB 3KLIA 2Z2YB 1T3OA 2E1MC 5LM7E 4J9VA 3PR5B 3Q8UA 1MWQA 1X4CA 4WIQA 2HZCA 1N33F 2G1DA 1RWMB 1IBCB 1HBOB 1SIZA 1T94A 4N47A 4DPUA 3WC0A 1PO6A 1YX2A 4RU9A 4KPYA 5EX3A 2ZEJA 2UV8A 2XGPA 4RW4A 4K4WA 2W8LA 3MECA 3RRGA 3NL0A 1T0TV 1NEEA 3ZZOA 3TOQA 4AL6A 1BLUA 1NH7A 4LMZA 3G86A 2EK1A 3WX8A 1XNRJ 4LF7J 4U7UK 1S0NA 1HD1A 1VBYA 1CJTB 4EWTA 2OPRB 4CLWA 1JLCA 4LRCA 3T1HJ 2BKPA 3ZZ0A 2NCKL 4N41A 4Q8FA 4QWDA 1N36J 2ASYA 5A8RB 2WVEA 1AB8A 2IVFB 3MFIA 2BE7D 2FHMA 3GQCA 1PSDA 3WX4A 2PGCA 4I6YA 1DTQA 2HURA 1KLMB 3Q8VA 3KNAA 1S79A 3PYEA 3Q8QB 2F3JA 2V50A 2K7JA 2WONA 2DR5A 3NG8A 2FPHX 2AD9A 3BSAA 4AT1B 2B7CB 2Z2MA 1NSKL 1UEVA 3R5CA 2A3JA 3V5RA 3BDPA 4B3OB 4PRFA 1WTFA 4GKJF 2POKA 1IWAA 5H9EJ 1U4BA 4B08A 3ILOA 1N56A 4TKTA 3TW0A 3HJFA 3EX7B 1TZ0A 4WK1A 4RNMA 5GAEI 2OEJA 3C16B 3QPIA 3DRPB 1U7LA 3FCVA 3OTOF 1FRIA 1KSPA 4UY85 4B3TJ 1KONA 5FLXU 4N76A 4GO7X 3AQPA 2C2DA 3SCKE 2QLXA 2VF3A 3JQKA 4U96A 7FD1A 2CPEA 2WBRA 2R7SA 2Y9HA 1R89A 4YS2A 3IFEA 2HVDA 3B54A 1IKVA 1K1QA 2M0GB 4LSNB 3JTPA 2UVWA 4ANEA 1HNZF 2BW7A 5A0YA 5K8NA 4YB6A 1VGYA 1TQLA 3KDOA 3L7OA 3N9UC 1FXLA 2CQ1A 2DNQA 2YNGB 1RT4A 3L7PA 2JLEA 3KLVA 4O44A 2DH7A 3G82B 2XMAA 1RCOB 4RBVA 4U9RA 4TYAA 4ELUA 4ED0A 2FJWA 3GJRB 2CFXA 3OFEA 1QAXA 3UFCX 2JX2A 3G6XA 3NOGA 3PJ9A 4ELTA 3TUIC 4KC5A 1X0PA 3QO9B 2OEMA 1UWAA 1RAHB 1AROP 1ELOA 2R7OA 5DO2A 2GS8A 4CO5A 4CO0A 2C3UA 2Z58B 3FBCA 1T7PA 3NGKA 3VAIA 1EJ7L 3WHIA 2DR9A 2DY1A 3PW0A 2G2OA 3GIIA 2E5LJ 5K8MA 2IM0A 1YJVA 2NSBA 3LP2A 1K8AT 3MR6A 4IFVA 4ZMMA 3OTEA 4LFCJ 2MZJA 4LF1A 1U8SA 1YGYA 1F5CA 2E9ZA 2KL8A 4O4GB 1L3KA 4KYZA 1U49A 2ZZTA 3W8PA 3CCJS 1AZSB 2CRLA 1JMTA 4F36A 2XWYA 3U1NA 4X4UA 1RT3B 2BXJA 2RDDA 2Z2LA 1K73T 4Z37A 3GCXP 1OSDA 2DJWA 2D3ZA 2HQDA 3GR0A 4XPCA 2KYXA 2OUGA 1F5AA 5GMKa 2XULA 4EUVA 5BYQA 2ADBA 4PEOA 1DARA 2HFSA 1S6PB 4EMDA 2WW4A 2R4FA 2B8QA 3ULHA 4FYWB 1I94J 3CSKA 2RRBA 3QAUA 3TVYA 1XC9A 3MOJB 1IJEB 2CZ9A 2KDOA 5C42A 3HPOA 3JTNA 3QT5A 4A8OA 4FVMA 3JQMA 3GCWP 5IQQA 5ETOA 3J7AN 2ZH9A 4Y2MA 1URNA 3MPUB 3E01B 3BN7A 4FF4A 2CXEA 5GAGI 1KTQA 5H9FK 5KFNA 1NSPA 3BF4A 1KP6A 3H0PA 2FLLA 1SJ4P 1C4AA 4CIOA 2HBRB 4URQU 2DGOA 5LSLA 1S97A 2GO8A 4TU7A 2DRDA 2G9OA 2ZH3A 4LQ3A 3PIPQ 1BC6A 3R5GA 4YQWA 4RNOA 1ZAWA 2HFZA 2P6TA 1TL3A 2HNZA 1JLFB 4Y3CA 3M9OB 1R8PA 1K44A 2FUG9 2LEPA 3K59A 4PABA 3K8WA 3G96A 2KVIA 1S1VA 1DTTB 3G8TA 2LEBA 2KU7A 4JP8A 2GIRA 1X9WA 4IDKA 1TKTA 3CJ4A 5LL6d 4V19X 2Z4PA 2I5JA 3KUHA 5A8KA 3IC1A 4FF2A 1OO0B 5GAEU 5DETA 2OJ3A 3CJ8A 1IQTA 2QGFB 3MTKA 1LWCB 3IBCB 3BQ2A 1T8EA 5J2NA 1DFDA 1FHTA 5J2MB 4QWBA 3KLFA 3R7SB 4NOHA 5J2QA 3FEZA 3KJNB 1HI0P 3K5PA 3RRKA 1F0XA 2EXUA 2D3UA 2ZOFA 3KDNA 1N48A 4IG3A 2HS0A 1H2TZ 1X31C 3J7Z5 1O51A 4WP9A 1WC3A 3TRGA 4NZ7A 3OVAA 3AD7C 2ALYB 3AB2B 4OHXA 4DMZA 3V2UC 1N52B 2CWKA 3MPVA 2DR8A 1VCTA 4EBCA 1SV5B 2CJYB 3M2VA 4IH6A 4CDIA 3EWGA 8RUCA 2HFVA 1RAAB 2A2DA 3P3DA 4JI3F 1R8HA 3GFXA 3IBFB 1NB7A 2O67A 4NXMJ 2MEWA 4IQMA 4Y6IA 2HZAA 3NNHA 2XZWA 3F73A 3M7VA 3F56A 3MXHP 1T05A 1FO1A 4CLUA 5LXRA 3D4JA 2GQQA 2IPOB 1IKXB 2V4QA 5ETSA 4KO0B 2PI5A 5ADZA 2BJ7A 4WFAQ 2DEIA 2DNPA 1PJ5A 1MSWD 4N8NA 4BS2A 4QCLA 2E5JA 3DGPB 1RTDA 5ETRA 3KJVB 1YJNS 2RE1A 2X1BA 2ZH7A 4C48A 4FYDA 1EP4B 2D7SA 3PW2A 1GK8A 1CULA 1LK7A 4LF9F 1J5EJ 2VKRA 2IA0A 4ES1A 2YWHA 3OUYA 3RJMB 1BQNA 2K8GA 2QA1A 3KLGA 4NPOA 3VF0B 4QIWD 1J5OA 5KT3A 3MGJA 4K7QA 3M8SA 2BQUA 4DZDA 3MMBA 1ZZFA 1V3SA 3G6ES 2QEXS 3J7YI 1FRKA 3PYDA 4TNOA 4Q43A 3I82A 4JI8F 5DQHA 1PG5B 4CO2A 3GMGA 1FX2A 5CH7B 3C2PA 1FESA 3KKFA 4DPWA 2NXCA 1HW8A 4OYBA 4L3NA 3C6UA 2MY7A 4TU9A 3PVXA 2YNFA 1U8WA 3DLKA 2DVIA 1TMJA 2QE5A 2LFVA 2IRXA 2B0GA 4OLOA 1SQFA 1D1UA 1PJ7A 1U1RA 2XHCA 3CF5Q 1LWEB 1RU2A 3M32B 4TXSA 2XLJA 4IFYA 1JLQA 1U2RA 4LBHA 3CNQP 4DR7F 1CLFA 1JJCB 4J9SA 3CDUA 1KD1T 3TYTA 2MKHA 3ETMA 1QUVA 4QYZK 1NH8A 4PWWA 3T9NA 1M1GA 2PIIA 4CO4A 3PR4A 3LPEA 3R7NB 1SL1A 4RW6A 5GMEA 1RGVA 4MK9A 1MU2A 3S7RA 1Y4ZB 2P9GA 4PKDB 2ASDA 4O23A 5B7WA 1TMMA 1QY7A 2OGUA 4A47A 4KJIA 3E3XA 2CYYA 4DFPA 3QT7A 1X4FA 3BREA 4DU8A 4OZ5A 2RU9A 2HQFA 2LA4A 1PYSB 4S0MA 4DF8A 4XPEA 2ZKTA 5F8IA 4ILLA 4KFBA 1B0VA 3TAPA 4J9LA 1GTEA 3VGSA 1S59A 1XMOF 3DRSB 1YG0A 3CC4S 2XO7A 1VK3A 3BM7A 1IQZA 2OSRA 2EFNA 1HMVA 4EK2A 5HBMA 5K20B 5KT4A 4M5JA 2IFXA 5KT7A 5DM7Q 3SEOA 1HBNB 2BMBA 3EPGA 4YP3A 2BRKA 3CULA 1UETA 2XS2A 1T02A 1V3ZA 4PXBA 2KRBA 3HHDA 3O5TB 2VASA 4L76A 4DSJA 2HLTA 2LP4A 4A8XA 4CH7A 1EQ0A 3DN9A 1I51B 1UFLA 5D4LA 3BPSP 2FHOB 3K2YA 1NXIA 4DV3F 1MW7A 2NS1B 3RB0A 4RUHA 2R8JA 4XDCA 3L3CA 1VQ7S 1UWBA 3MHYA 3MFHA 4LF4J 1VR6A 3OR1B 3BGUA 4YB5A 4ECXA 2XYHB 2P2CB 2C2MB 1Q5YA 2AJ4A 3DGVA 2R7QA 3PFOA 1BUXA 2BJ9A 2FY1A 5K9FA 1ZPWX 2XMMA 1GMWA 1SJQA 2FJAB 4QW9A 3CMQA 1T9VA 1BXNA 2C2OB 7FDRA 4DQIA 1C0UB 2C28A 1OY8A 3ADAC 2D74B 4NI2B 2O5DA 2GQCA 2RS8A 1B7FA 3H8YA 4IKAA 3FKBA 3EPIA 4G1QB 3EDQB 3PG9A 3TAQA 1UPPA 1LXJA 3N4WA 3GWCA 4XO0A 2XB2D 4DUZF 1VS3A 3GU0A 1N0UA 1RWKB 4OI6A 1BGXT 3W9HA 5FLXY 3B82A 2RKIB 3FBEA 1H2VZ 1NPRA 5I4MA 2MXYA 3MPWA 2M2BA 2WVCA 3UD4P 2IYGA 1K0VA 5HROA 2BACA 3J7YU 1HNVB 1O5JA 1S1UB 2G0CA 1N33J 1L3TA 3QWUA 3RG6A 2NZCA 4PZVA 4USUA 1QTMA 2DCLA 1HARA 1KEKA 2KJVA 4HACA 1FDAA 5D8HB 2ZBIA 1TV6A 1YIJS 4LT6A 2QRRA 4DR4F 2G2ZA 4P75A 3M30A 2QL5B 2R7TA 3I0RB 4M5HA 5AT1B 1LK5A 3D3BJ 4DR3F 3JSRA 3C14A 5HANA 3VALA 4B9TA 2C2RA 1XQIA 3D67A 2R8KA 3IXQA 4OJHA 2Z8QA 4LR8A 5HQ8A 4BC7A 1KFSA 5JJBA 3BSOA 5C2CA 3NAHA 4FS1A 5D3GB 3OR2A 4ZVPB 2BJ1A 2RHQB 3UN5A 4ZK7M 4ECUA 4P2XA 4BHQA 3GG1A 4JYAF 3F44A 1G3OA 3OL7A 2BE2A 4C11A 2QL7B 1ZBTA 3V6JA 2FVPA 2B9WA 2L41A 5F41A 2HWHA 1L3UA 2OPPA 2NXUA 4F4XA 3S1TA 2N82B 2RQMA 5KFOA 2QO3A 4H4MA 3MM5A 2ZVIA 1JXVA 4QIFA 1RT2B 2LLZA 3B6BA 2GJ2A 4Z2XA 4NX9A 4L75A 4DL2A 3BDEA 3NMAA 1ZOTA 2AT1B 3BB5A 3KTQA 2B4VA 3CDWA 1SUQB 3R27A 4P7VA 4N56A 1FCAA 3Q83A 1JLAB 1S76D 1RB0A 5KFYA 3OTOJ 4EFAC 1TKXA 2J6TA 1CBKA 2KB2A 3W61A 3TX0A 2BUNA 2V4RA 4LR7A 3HSJA 4ZVFA 2QA2A 3OL6A 2K3KA 1YJTA 1JJHA 4B3RF 3DMJA 1A9NB 4WFNQ 2VODA 1M0SA 1IJFB 3MM7A 2NPIA 1WC0A 1Q8IA 3ILLA 4ZHRA 1HNZJ 4KKOA 2YWWA 1S99A 1SQEA 5FJ4A 3FUYA 4KR0B 5U47A 1MN7A 2ZBRA 2FHKA 5KFKA 1TK0A 1TL7A 4ICLA 1YKWA 4OX6A 1L5UA 4YOEA 2QYCA 2QA4G 3GTYX 5IT9Y 5LXYA 2P9EA 4JI4F 3H4DA 2R2TA 3W62A 3K57A 3C15A 5L9XA 4J37A 3EMTA 4IH7A 5KFPA 4HDHA 1HNXF 1S6QA 3HVTB 2FLPA 3T3FA 1IM4A 4FP9A 1NSAA 4AYBD 4Q44A 2FHJA 2ZC4A 3GJTB 2MQPA 3SZ2A 4KSEB 1Q16B 1KQFB 3ET6B 2UUCF 1Q79A 1M1KT 3LWLA 3NWRA 1NDPA 3IR5B 2QMWA 4LF8J 3M8ZA 4DFJA 3GSDA 2MGZA 1CEZA 2W9AA 3HT0A 1P1LA 3AOAA 2VDIA 5L46A 1GX5A 2W24A 3S6EA 3W5XA 1MWYA 5B0BA 2GC8A 2JHEA 4USWA 2EFGA 2E7VA 2RUGA 2BQ3A 2CIMA 2A0FB 4UT4A 4QU6A 1JNZB 4ZPWR 5GAHI 2Z0GA 3LGNA 3WIUA 3DOKA 1UZHA 3M9NB 1HBOA 1R31A 2HHVA 4HI1A 3EDRB 3D6TB 1S1TA 2MQNA 1Z2ZA 2XSFA 2F65A 4ECTA 3RAXA 2E5IA 4F4AA 2ACYA 1NJWA 3TVKA 3VZHA 3MR3A 2L9WA 4I4BA 4QJVA 3K17A 3W2WB 2J8SA 2M88A 1R3NA 3MD1A 3M1VB 3TZWA 4B3MF 3LGHA 4J9OA 1UKUA 4JI5F 2VJUA 2UP1A 1VRTB 3AH6A 3Q23A 1CJTA 1RJJA 4C4WA 2OPRA 3OV7A 2ZC3A 4CLYA 2HWIA 5HMZA 4ZKAA 3MAAA 1UCNA 4FYVB 3PX6A 4I67A 1Y3JA 3PACA 3H5SA 5A8RA 4NWBA
chains in the Genus database with same CATH topology
1MN9A 1S59A 1S57A 1U8WA 3Q86A 1XIQA 2AZ1A 1EHWA 2DYAA 3BBBA 4ENOA 1NSQA 2AZ3A 4F36A 3NGRA 1HIYA 2HVEA 3ZTQA 4HR2A 4W98A 1LEOA 1BUXA 1B99A 4EK2A 3R9LA 3NGUA 4ANCA 5BXIA 5CAAA 1MN7A 1NPKA 3BH6B 3MPDA 3GP9A 3JS9A 3WX8A 3EVWA 3PJ9A 2VU5A 1NDKA 3L7UA 1NLKL 3FCVA 2CWKA 1S5ZA 4UOHA 1K44A 1JXVA 3EVOA 1B4SA 1HHQA 1NHKL 3B6BA 4UOGA 1HLWA 3DKDA 2DY9A 2B8QA 3FC9A 3Q8YA 2DXFA 2NCKL 2DXDA 4FKXA 3ETMA 3FCWA 3FKBA 1XQIA 1NB2A 1VYAA 3FBCA 3VGVA 3NGSA 3Q83A 3EMTA 5IOLA 4F4AA 4CP5A 3PRVA 3EICA 3BBCA 4C6AA 2HURA 4O0NA 3Q8UA 2HVDA 1NDCA 4DI6A 3B54A 3EVMA 3Q8VA 3ZTPA 3EM1A 2ZUAA 1BHNA 3ZTSA 3ENAA 3VVTA 1KDNA 4ANEA 1WKKA 3FBBA 3NGTA 3BH7B 1NDLA 3VVUA 1PKUA 3GPAA 3ZTRA 3FBFA 2B8PA 4UOFA 3FBEA 3DDIA 1W7WA 4FKYA 1NCLA 1NSPA 3BBFA 2BX6A 3VGTA 5C7PA 4DUTA 4DZ6A 1F3FA 3ELHA 3ZTOA 1NDPA 1NSKL 4S0MA 3VGUA 3G2XA 2BEFA 5CABA 3EE3A 1WKJA 3Q89A 1PAEX 1UCNA 4KPCA 1NUEA 1LWXA 1ZS6A 3EJMA 4WBFA 3VGSA 1BE4A 1WKLA 1F6TA 2DXEA 4ANDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MN9 A;  1S59 A;  1S57 A;  1U8W A;  3Q86 A;  1XIQ A;  2AZ1 A;  1EHW A;  2DYA A;  3BBB A;  4ENO A;  1NSQ A;  2AZ3 A;  4F36 A;  3NGR A;  1HIY A;  2HVE A;  3ZTQ A;  4HR2 A;  4W98 A;  1LEO A;  1BUX A;  1B99 A;  4EK2 A;  3R9L A;  3NGU A;  4ANC A;  5BXI A;  5CAA A;  1MN7 A;  1NPK A;  3BH6 B;  3MPD A;  3GP9 A;  3JS9 A;  3WX8 A;  3EVW A;  3PJ9 A;  2VU5 A;  1NDK A;  3L7U A;  1NLK L;  3FCV A;  2CWK A;  1S5Z A;  4UOH A;  1K44 A;  1JXV A;  3EVO A;  1B4S A;  1HHQ A;  1NHK L;  3B6B A;  4UOG A;  1HLW A;  3DKD A;  2DY9 A;  2B8Q A;  3FC9 A;  3Q8Y A;  2DXF A;  2NCK L;  2DXD A;  4FKX A;  3ETM A;  3FCW A;  3FKB A;  1XQI A;  1NB2 A;  1VYA A;  3FBC A;  3VGV A;  3NGS A;  3Q83 A;  3EMT A;  5IOL A;  4F4A A;  4CP5 A;  3PRV A;  3EIC A;  3BBC A;  4C6A A;  2HUR A;  4O0N A;  3Q8U A;  2HVD A;  1NDC A;  4DI6 A;  3B54 A;  3EVM A;  3Q8V A;  3ZTP A;  3EM1 A;  2ZUA A;  1BHN A;  3ZTS A;  3ENA A;  3VVT A;  1KDN A;  4ANE A;  1WKK A;  3FBB A;  3NGT A;  3BH7 B;  1NDL A;  3VVU A;  1PKU A;  3GPA A;  3ZTR A;  3FBF A;  2B8P A;  4UOF A;  3FBE A;  3DDI A;  1W7W A;  4FKY A;  1NCL A;  1NSP A;  3BBF A;  2BX6 A;  3VGT A;  5C7P A;  4DUT A;  4DZ6 A;  1F3F A;  3ELH A;  3ZTO A;  1NDP A;  1NSK L;  4S0M A;  3VGU A;  3G2X A;  2BEF A;  5CAB A;  3EE3 A;  1WKJ A;  3Q89 A;  1PAE X;  1UCN A;  4KPC A;  1NUE A;  1LWX A;  1ZS6 A;  3EJM A;  4WBF A;  3VGS A;  1BE4 A;  1WKL A;  1F6T A;  2DXE A;  4AND A; 
#chains in the Genus database with same CATH topology
 4Z7Y A;  2Q3P A;  2MY8 A;  1KLM A;  1Q4R A;  1Z4U A;  2QLF B;  4YY3 F;  2YKQ A;  1PIE A;  4N77 A;  1IKW B;  4R25 A;  4QQB A;  5HLF B;  3OBI A;  2VZ9 A;  1Q7L B;  4H4O A;  4YHH F;  3P96 A;  1RTJ B;  4RNF A;  2HZV A;  4DR5 F;  1Z2L A;  4LBI A;  2H4W B;  2W9B B;  2BZ2 A;  3D0G E;  1MRO A;  4WFY A;  2E1A A;  4B3O A;  3K58 A;  5I3P A;  2VH7 A;  5KG0 A;  2VFR A;  4I7F A;  4Y00 A;  2W2O P;  5A6W A;  1UJ4 A;  2HHP A;  4YB1 P;  5E5N A;  2CNO B;  4ETZ A;  2AYG A;  3FCH A;  3DRP A;  1Y11 A;  1LQ9 A;  2R42 A;  1VIS A;  2WOM B;  1V6H A;  4Y2A A;  3W65 A;  5KG1 A;  1R0A A;  1PYO B;  3PZP A;  1S1W A;  4U7C A;  3Q24 A;  2F8H A;  2ZZN A;  1NUE A;  1QAI A;  5EWE A;  4DLG A;  3BN4 A;  3AJ1 A;  3QJJ A;  3EXC X;  2V2K A;  2HHH F;  4RKU C;  4LSN A;  2YTC A;  3BKF A;  4K4Z A;  5KFH A;  5KOW A;  1SKR A;  1CQN A;  1VK8 A;  1WG4 A;  5HVG A;  1XEZ A;  3MED B;  1Q5V A;  1R8B A;  3CGI A;  2VQF F;  3N5F A;  1O6X A;  4FBU A;  4EO8 A;  3ZZU A;  1IKY B;  2HSE B;  3NWG A;  3PYG A;  2W2M P;  1UVN A;  3CWJ A;  3QQC D;  4ZCM A;  3UCG A;  3O44 A;  2C3M A;  5SZT A;  5G0R B;  4O0N A;  5D4O A;  1DRZ A;  2B5J B;  1TK5 A;  1VRU A;  4XDD A;  2JLF A;  1XWL A;  1B3T A;  1NRK A;  3MCM A;  3C19 A;  4CM0 A;  1WI8 A;  2I38 A;  3KJQ B;  2IHR 1;  3BKT A;  5F8G A;  3V81 A;  3R1H A;  2H65 B;  3QO9 A;  3RB6 A;  4LVN P;  3D7S B;  4HHH A;  3ITH A;  2CDQ A;  4NLX A;  3MMA B;  1U02 A;  3K7R A;  4OL8 A;  3NGR A;  4C9D A;  3UR3 C;  1FRX A;  3QFW A;  2KZZ A;  4HHU A;  2QT7 A;  1JJ4 A;  5DZ7 A;  3HM9 A;  3W63 A;  4DS4 A;  5ETL A;  1YTY A;  1B4S A;  4FPI A;  1FJG F;  3KUE A;  2ABY A;  4PG4 A;  3OXG A;  2VD3 A;  1NJI T;  3CD6 S;  4CLT A;  4ZP7 A;  4R8U B;  4EU0 A;  4LF9 J;  4OYZ A;  3IM9 A;  3DLG B;  2R2S A;  3NNA A;  1SBR A;  1AZS A;  3FSX A;  1HBM B;  1N6Q B;  2YKN B;  3LO3 A;  5GAH U;  1HWU A;  1SH3 A;  1RT3 A;  4G1P A;  3T1H F;  4DEZ A;  3KHR A;  1RWO B;  3KK1 B;  1IN0 A;  3OTB A;  4X4P A;  2VQE F;  2WHO A;  1SC1 B;  4C8K A;  1JLE B;  1IBK F;  2H4Y B;  2GIF A;  3ZFV A;  4JI8 J;  1C0T A;  1A6L A;  3OHA A;  1E6Y B;  1HYS B;  1JWW A;  3ZTQ A;  3EYZ A;  1VC5 A;  4W98 A;  2KRR A;  4EBE A;  3DOL B;  1FKO B;  3BH6 B;  3C3L A;  1QVF R;  3J80 U;  3E01 A;  1TVR A;  4CNY A;  1G7C B;  3DC2 A;  2I2Y A;  2H54 B;  1U1O A;  4Q2L A;  4F50 A;  2VG6 B;  4ZN1 A;  4I0W A;  4NA3 A;  3MM9 B;  4DL4 A;  4KGM A;  2HHX A;  4EBD A;  2U2F A;  3GLJ A;  4NCA A;  3G8Q A;  2RIL A;  2V94 A;  1E6V B;  4NEZ A;  3TI0 A;  4M5D B;  2B6A B;  3KUG A;  4CO3 A;  1P8G A;  2RD5 C;  2VFV A;  2YNI B;  1T9Y A;  5IM0 A;  3ZTO A;  4LFB F;  3Q8P B;  1S9E B;  3EZU A;  3CVK A;  2BBE A;  3EUN A;  4P2S A;  5KT2 A;  1JX4 A;  2YY3 A;  5E0O A;  5KFL A;  4NLY A;  5KFU A;  3UDC A;  2JJ4 D;  2D9P A;  3IWL A;  3TZZ A;  4FPR A;  2L9D A;  5KFA A;  4L6V 3;  3N5B A;  3CD0 A;  5ETN A;  2YWF A;  3PDN A;  1JIH A;  4CNZ A;  2GX8 A;  1U0H B;  3QT8 A;  4YR0 A;  1KOH A;  1XMO J;  2R2R A;  1RAO A;  1TEL A;  4UOG A;  4CYU B;  4ZPT R;  3GYN A;  4DR6 F;  1OPI A;  1VHF A;  4NA1 A;  2AJ0 A;  1WHW A;  4OYI A;  3ILJ A;  3IM8 A;  4XIU A;  5A8W B;  2HBZ B;  4DXL A;  4EEY A;  1I3O B;  4P71 A;  4Y65 A;  3KHH A;  3D5M A;  4WFZ A;  4CT9 A;  1WWH A;  2VPX B;  4J5O A;  4ECZ A;  4P74 A;  2VG7 B;  3FDS A;  4C8M A;  3O6Q A;  3H42 A;  5D4N A;  2U1A A;  4YB7 A;  1T03 B;  4UUW A;  2V9W A;  4IR1 A;  4DV3 J;  5LJ3 Y;  1RAF B;  3QFH A;  1IR1 A;  2RU3 A;  2YBV A;  4QU7 A;  3US5 A;  2H9Z A;  4Q8E A;  4B9S A;  3NMR A;  4JOU A;  3QSY B;  4LFC F;  1Q8K A;  2FGC A;  1XR7 A;  4DSK A;  3VQT A;  1VQ5 S;  4WTO B;  3R8Y A;  1TAU A;  1M5S A;  3VR1 A;  2VBX A;  1IKX A;  4YEA A;  4ZCI A;  2XLK A;  1VQO S;  3Q8Y A;  3D9B A;  4KO0 A;  4CLF A;  5B08 A;  2ZUG A;  1CC7 A;  4X84 A;  4OJ3 A;  2VJV A;  4MYU A;  3T6B A;  3POT B;  5J1N A;  1UEU A;  4WXO A;  3M05 A;  2HNY B;  2EKY A;  5AXM A;  4F2S A;  2FJE B;  3DGP A;  4JBC A;  3WBZ A;  3KJV A;  2EVZ A;  1WTB A;  1FJ7 A;  1EP4 A;  3CJK B;  3ENV A;  2N3O A;  3KOA A;  2LEC A;  2X51 A;  1FWL A;  1WAC A;  2QZ8 A;  3R5B A;  4DUZ J;  1SKU B;  5DQI A;  3L09 A;  4FF1 A;  2KM8 B;  2MMY A;  1S9G B;  1XIQ A;  2XI2 A;  1QSL A;  2HLU A;  3QID A;  2CVI A;  4ZLL A;  2YH1 A;  2XMU A;  1UVJ A;  3JYT B;  3IG1 A;  5T7L B;  1PC5 A;  2ZIT A;  4OV1 A;  2PA8 D;  1EKS A;  1HWK A;  2V8V A;  1GEH A;  2CPX A;  4M5L A;  2HG4 A;  2ZD1 B;  3ZZT A;  3JSM B;  2JDJ A;  3LTO A;  1P9Y A;  5KFI A;  3DHW C;  4DR4 J;  3RU0 A;  1X60 A;  1A7G E;  4USI A;  1H38 A;  2COL A;  2LXU A;  4DR3 J;  2JNJ A;  1JLG B;  3UO0 A;  1QM9 A;  4MT1 A;  3MEE A;  3WZ0 A;  1RA6 A;  1L3V A;  1N5V A;  5ETQ A;  2L9N A;  2RIJ A;  5JMN A;  1LWE A;  3FBF A;  1RUS A;  1Q78 A;  3PO5 A;  1FNO A;  4DSL A;  4DQQ A;  2E5G A;  3OSP A;  2VPY B;  2DEJ A;  2HQG A;  4JI6 J;  4DL5 A;  2HW3 A;  3SQG A;  1DQA A;  1TR0 A;  4Q5V A;  3ZZR A;  1X7V A;  3CC2 S;  5EWF A;  5CZV A;  4CQ1 A;  2IBO A;  2DKO B;  2HQI A;  2N4D A;  3UNY A;  3T9Z A;  2MYF A;  2RJZ A;  1XBW A;  5HP1 B;  1NDK A;  1Q86 T;  3DDN A;  3HVA A;  4HI2 A;  2Y1L B;  4ZP6 A;  3T5H A;  2C2Z B;  3M6U A;  3R3T A;  1U09 A;  1RBL A;  2MTL A;  1YJU A;  3QIP B;  1I5O B;  3TA1 A;  2E1C A;  4KQZ A;  4CLL A;  4L72 B;  2HFU A;  1RLC L;  3BGR B;  1PBA A;  4ALZ A;  5HK4 A;  4DCP B;  3IBW A;  1WHV A;  5F9N A;  2Z56 B;  3HUL A;  4TN2 A;  4KBI A;  2YWG A;  3QZ7 A;  3Q22 A;  1RLD A;  4Y28 C;  1NK7 A;  1VIX A;  1H2U X;  2BKO A;  4RUA A;  1U2F A;  4IO1 A;  3TJ8 A;  4X2B A;  5CA5 A;  2XHW A;  3CXC R;  5HAO A;  5JUM A;  5CAB A;  2I8E A;  4ZLP A;  1LWX A;  4I1T A;  3OLB A;  2K1R B;  3JQJ A;  2RQC A;  1YRU A;  2BM0 A;  2XYP B;  3HHL D;  2BRL A;  4ENO A;  4B3R J;  3PX0 A;  5IV4 A;  2DIU A;  3ZZP A;  1DHM A;  2BJ8 A;  3PXG a;  3FNN A;  4A8K A;  3TR5 A;  1HHQ A;  2XMW A;  3M2U B;  4JV5 F;  1UVM A;  1EKR A;  2W2N P;  3FC9 A;  3RTV A;  3SI8 A;  4RBU A;  3RGI A;  3TAR A;  3IMQ J;  1R0B G;  3OR1 A;  3L4B C;  2WZ1 A;  5LOQ A;  3PKY A;  5HJX A;  4ED7 A;  5HMX A;  3QJL A;  4OFZ A;  4LJM A;  3OHB A;  3HDS A;  5FDL B;  4ECR A;  3SSQ A;  1YIT S;  3BJY A;  5C25 A;  3VVU A;  2EKN A;  4OV6 A;  1REV B;  3BO3 A;  3CCS S;  5J1E A;  3RBE A;  3G6Y A;  5T41 A;  1HNX J;  2QG9 B;  4UY8 T;  3X3U A;  5J2P A;  1X4E A;  1C0U A;  2DIS A;  3WIV A;  2QJ3 A;  4NXN F;  3OVS A;  4ECV A;  4NI2 A;  1NK0 A;  3M6X A;  3C6T A;  3UWT A;  1TUG B;  4KHM A;  4P6Q A;  4AND A;  1S57 A;  4G1Q A;  2UUC J;  4M5K A;  3V6D A;  2RNE A;  4DV0 F;  4CI0 B;  2AJ2 A;  4HKQ A;  1VBK A;  4YDX A;  3BR8 A;  3EVW A;  5A6P A;  2GJF A;  1YVF A;  2HRT A;  4KTQ A;  2RKI A;  1KS2 A;  1SH2 A;  3UI3 A;  2KM8 C;  3CDE A;  1MG7 A;  4C0H A;  4DCO B;  4FKX A;  5HSP A;  4I6W A;  4PQU B;  3IP0 A;  4JI0 F;  2A6O A;  3FQL A;  1S1U A;  1NJX A;  4WE1 B;  4JI2 J;  3OFH A;  2HVI A;  1N32 F;  2CJB A;  1WOP A;  3LP1 A;  5GMD A;  4J9M A;  4W4M A;  3N28 A;  3CCQ S;  4ZVR B;  1RAB B;  5DM6 Q;  3K5O A;  2HRU A;  3MEC B;  2MQ8 A;  3I0R A;  5ETK A;  1Y5L B;  4O3R A;  2GAG C;  5DG9 A;  4X4T A;  4B3M J;  3KMQ A;  1OS5 A;  3M2R B;  1VQY A;  4JI5 J;  3GR1 A;  1WOR A;  1M5V C;  1JLC B;  2DXE A;  1RAD B;  2XNR A;  1UFW A;  1X4B A;  4F4W A;  4DJB A;  4RW7 B;  3LAM A;  3CCL S;  5KFQ A;  2KTQ A;  2VPZ B;  4M94 A;  1OY6 A;  2GVZ B;  3HI9 A;  3CCV S;  4IR9 A;  4Q0B A;  3T19 A;  1I1G A;  5D3G A;  1DUR A;  1YJ7 A;  2BAB A;  3H98 A;  3AB4 B;  1WEY A;  2IDL A;  1TKZ B;  3A3O B;  5E2Q A;  3W7B A;  1N5Y A;  4FNI A;  4YY3 J;  1QSS A;  5DGB A;  4PWD B;  2ZBP A;  3SCI E;  2OPS B;  4WYW A;  4LRD A;  3MM8 B;  4YHH J;  5EX0 A;  3BS9 A;  1VDH A;  3OVB A;  4DR5 J;  4DV6 F;  3KHG A;  3MF5 A;  4DF4 A;  3ZTR A;  2W4C A;  1FER A;  2K3I A;  4ZOS A;  3K5M A;  4FDF A;  3GV7 B;  3BGL A;  3R5D A;  1RWX B;  4LRF A;  4DSF A;  5A2Q U;  2Q6B A;  2DNH A;  1YQH A;  1X5S A;  3FEY B;  4IG0 B;  3PNI A;  2ATC B;  4LSL A;  2HND B;  3IGN A;  4MAK A;  1NAQ A;  3CJ0 A;  3ISN C;  1ZM2 A;  2FVR A;  3HSD A;  4DCJ B;  4NYP A;  1LNQ A;  2CZV C;  4BWJ A;  2KH9 A;  3SV4 A;  1FX4 A;  1C1C B;  2YKO A;  2ZDP A;  1U1L A;  4I6A A;  1YBA A;  1GAO A;  3A4T A;  1Q82 T;  1WHX A;  2HHH J;  2E29 A;  4CCH A;  3KYL A;  4KGK A;  4CP5 A;  3Q8R B;  3O8W A;  3CCZ A;  3NBP B;  3MD3 A;  2GQ2 A;  1N0V C;  4TQS A;  5E3Q A;  2VQF J;  1RXO B;  2ILZ A;  1RT4 B;  2OFH X;  2JEF A;  3QWP A;  4PPZ A;  3QGH A;  4JUZ A;  2AW0 A;  3AJ2 A;  4OYA A;  2XC9 A;  2E66 A;  1VQM S;  1TFY A;  1GMU A;  3FGV A;  1RDR A;  1HW9 A;  2BJD A;  1PIL A;  3P8B B;  1NKE A;  2V68 A;  5T14 A;  4USM A;  2CVE A;  2WW8 A;  3AHP A;  2PFD A;  3UW1 A;  3T6J A;  2D3O R;  2QFI A;  6AT1 B;  3TWZ A;  3N0V A;  3QT6 A;  1G1X A;  1N8R T;  4ECW A;  1AYE A;  4AFF A;  2CPI A;  1QVG R;  4X64 F;  3UVJ A;  2XBP A;  3EVO A;  1MMN A;  3ET6 A;  1GMV A;  4U8V A;  4O3N A;  4I2Q A;  2VA2 A;  1VFJ A;  1SKS A;  4V19 J;  3D0H E;  3M6V A;  4ZLJ A;  1ZM9 A;  4FN5 A;  4IFV B;  5AJ3 F;  1ZTW A;  3J7Z T;  2DGT A;  1FJG J;  3CME S;  3OFG A;  2DGS A;  2J5A A;  2C1E B;  2F4V F;  3NGT A;  3MUV P;  3MCN A;  1H74 A;  3RBX A;  4RWX A;  1UL3 A;  4CLZ A;  4ER8 A;  1FWP A;  2BAN A;  1KVI A;  2WRM A;  3I6P A;  2RH3 A;  1S6U A;  3GG0 A;  1S12 A;  3G9C A;  5IT0 A;  2IRU A;  3M9M B;  3AAW B;  1CJV B;  1TFW A;  4HLB A;  2ZH6 A;  1SKW A;  3W2W A;  2LU2 A;  4NLQ A;  2VQE J;  3M1V A;  4RW8 A;  2RUS A;  5C42 B;  3H5U A;  3JSY A;  1IBK J;  3AOC A;  3VAH A;  5IC6 B;  1VRT A;  1FXR A;  2F4F A;  3HO1 A;  2ROE A;  2DY9 A;  2DB1 A;  5L38 A;  2BOP A;  4DWI A;  4GO5 X;  1HBU B;  3MEK A;  2Q66 A;  1NK6 A;  2PC6 A;  2C3Y A;  5IWA F;  3HCX A;  2Y3Y A;  5KFD A;  3MMC B;  3X1L B;  3NOC A;  2ZKU A;  3AD9 C;  1D9D A;  3HHE A;  1WKK A;  1RK8 A;  1VQ9 S;  1T9W A;  3NKY A;  3CIZ A;  4ZJO A;  5KFB A;  5IXU A;  4DZ6 A;  1UJ6 A;  3DM2 B;  1IKW A;  4DV7 F;  1W2I A;  2O3D A;  5HLF A;  1N4L A;  4MH8 A;  1RU1 A;  2JC1 A;  2HYI B;  3U7J A;  3FRZ A;  4YUD A;  1T95 A;  4WBF A;  2W9B A;  4NE9 C;  2YKP A;  1YWX A;  1M5P C;  2DHS A;  2CG4 A;  4R0E A;  1S1V B;  4PCQ A;  1NSQ A;  2YX7 A;  2CJA A;  3PEJ A;  1RAC B;  1C2P A;  3W1Y C;  4LFB J;  3CO0 P;  4IDK B;  1RT1 A;  2NQP A;  1OQ3 A;  5KFC A;  2QLB B;  5LSO A;  3AD8 C;  5A8K B;  2IA6 A;  1V5I B;  4UW2 A;  1PBU A;  2H5I B;  3Q2S C;  4KGV B;  4W90 B;  3NS6 A;  3M8Q A;  3TQE A;  5DDO C;  1T11 A;  3LH2 S;  1H3D A;  1PCA A;  4TVA B;  4G1I A;  3GIL A;  4U7U D;  3H90 A;  2YQ1 A;  5RUB A;  2FHJ D;  5J2N B;  3D1Q A;  1YRX A;  2AF6 A;  3TA0 A;  3I32 A;  1LWF B;  5SUH A;  5IQ6 A;  5J2Q B;  4DV4 F;  4P2F A;  4DR6 J;  3F41 A;  1Q0N A;  4IG3 B;  1FA0 A;  4QPX A;  3TNV A;  3DDI A;  3HHN B;  4WYL A;  4N7T A;  4J9Q A;  4HT5 A;  2DGX A;  3JSB A;  1KC8 T;  1XMQ F;  2UUB F;  3MM6 A;  3MEG B;  2OEL A;  3EE3 A;  2XG8 A;  4WTY A;  3W8G A;  3JAM U;  4RL1 A;  2VIC A;  3M2V B;  5G0R A;  4FYX B;  4USK A;  2YWK A;  3MPD A;  1YSJ A;  1RWP B;  5H9F J;  1B70 B;  5H1S V;  3NNC A;  3DLE B;  4CLP A;  4CRJ A;  1NHK L;  2W8K A;  4QR0 A;  1ZZN A;  4LF8 F;  5MLC V;  4FBT A;  4EGL A;  2XO6 A;  1HPZ B;  3Q8S B;  2X1G A;  4N5S A;  2AP6 A;  5KAK A;  1SPB P;  1UVL A;  1S77 D;  1ICE B;  3GB0 A;  2R7R A;  2EG1 A;  3CE8 A;  3ZTP A;  3R5A A;  2O66 A;  4YME A;  1FE4 A;  4DQP A;  4X4S A;  5AXK A;  1J2V A;  1B0P A;  1R0C B;  2RS2 A;  4DG1 B;  3U1L A;  4IRD A;  1R8C A;  4F4Z A;  3PM9 A;  1RTD B;  4IOA Q;  1CG2 A;  2AV5 A;  2Z2Z A;  3HHL B;  2QL9 B;  1WKJ A;  3SYZ A;  3OUY B;  3M8P A;  1IBL F;  3TAM A;  2IJN A;  3DLJ A;  3DU6 A;  1K1S A;  2OMO A;  3AJD A;  3DLG A;  1B99 A;  3NGU A;  4B02 A;  2YKN A;  4TLQ A;  2CWX A;  3UN2 A;  1DY3 A;  1NME B;  4KIA A;  3ISZ A;  1RA7 A;  2QN6 B;  1AA1 B;  2MZR A;  1UJ5 A;  4NYO A;  2EW9 A;  4F8R A;  5CD4 A;  1WF1 A;  4OHW A;  5DJB A;  1RI7 A;  3TUP A;  3KK1 A;  1I6J A;  7AT1 B;  3ZNU A;  3GIR A;  2JFK A;  3NGS A;  2FJB B;  4E2F B;  2XS5 A;  4PAA A;  2NYH A;  2VHG A;  4CO1 A;  1NJZ A;  3W9I A;  5KG7 A;  2HRY A;  2V2V A;  3D28 A;  4E98 A;  3DCA A;  1JJ2 R;  1HYS A;  4DI6 A;  4DR2 F;  2WSF C;  4MIB A;  4ZPA A;  2EFV A;  4F3Q A;  2B4P A;  3FZ2 A;  3OD2 A;  3C6U B;  3DOL A;  1VOM A;  4QWC A;  2YNF B;  4MYT A;  1RYS A;  3UCU P;  4DR1 F;  2HIY A;  2VBY A;  3SXL A;  5ETT A;  3UN3 A;  5D0R A;  3AQO A;  1F1B B;  3BYP A;  1ZAX A;  3Q2T C;  2DGU A;  4DS5 A;  1JLQ B;  1Q81 T;  3FMB A;  5K14 B;  4RW9 A;  2X3G A;  1VRQ C;  3FSY A;  4WWS A;  1HL6 A;  2KT2 A;  4A46 A;  4ECS A;  4IOC Q;  5B0D A;  3GP9 A;  1E6V A;  3ZZY A;  2JH3 A;  4M5D A;  2B6A A;  1XMB A;  3CCE S;  1FNX H;  4RW6 B;  3GV5 B;  1N5S A;  1JNR B;  1ACM B;  1MU2 B;  4C7Q A;  4QYR A;  3EGV A;  1FTC A;  1YJR A;  2DNO A;  1R43 A;  1NB2 A;  1LW2 A;  2W7A A;  1GQE A;  2CJQ A;  3QRQ A;  3JB9 k;  4M95 A;  4PG7 A;  1RTH B;  1D0E A;  4ZCK A;  4GRS A;  4AQY F;  3H25 A;  1R8A A;  4URS A;  2X1F A;  3MZI A;  1CSJ A;  4UQG A;  2FLO A;  5IC4 B;  1F2H A;  1VI7 A;  1HMV B;  1U0H A;  2ILY A;  2R8I A;  5HBM B;  2NYI A;  2NXJ A;  2PFF B;  3SFU A;  2CUY A;  2QFJ A;  3B8H A;  3J81 Y;  3LGM A;  2Y1R I;  5A8W A;  5FII A;  4MKA A;  4JV1 A;  3FJ2 A;  4KH0 B;  1URR A;  4DOZ A;  1PGZ A;  2MKY A;  3HVR A;  1QAY A;  3HHK A;  2KG1 A;  1KQK A;  1VQN S;  2XY7 A;  1C1B A;  2V4J A;  4C98 A;  3BO4 A;  1NZA A;  3RR8 A;  2ZE2 B;  1RHQ B;  2NSC A;  1T03 A;  2XGQ A;  3DXB A;  2Y0B B;  3PW7 A;  5E33 A;  2VG5 B;  1G4C A;  1UWB B;  1SJF A;  4JV5 J;  3CTR A;  4D3H A;  1ULR A;  3VCD A;  3NGD A;  3NY0 A;  1NU4 A;  4FS2 A;  1FKP B;  4GVB B;  1QD1 A;  4UOF A;  5BJR A;  2Y8Y A;  2FTR A;  2N7Y A;  2R7W A;  1FJE B;  1F3F A;  3AXM A;  5GVQ A;  2EEY A;  1RT7 B;  2HS4 A;  2DCU B;  2HEK A;  1EET B;  2HHW A;  4QYZ J;  2YQ0 A;  2DTJ A;  3HKZ D;  4O3P A;  2GVD A;  3TAN A;  1F6T A;  2OO4 A;  3SDE B;  2HQC A;  3POT A;  2PE8 A;  4WU2 A;  2MPU A;  3CED A;  2YKM B;  4JI7 F;  2AJ1 A;  2HNY A;  4NXN J;  4V1A k;  1SJ1 A;  1VC6 A;  2FJD B;  2ZH8 A;  1RHM B;  3OJS A;  3N79 A;  1SI9 A;  3KLH A;  4DV0 J;  5JXS A;  5A2Q Y;  2V2Q A;  4UTG A;  1V5V A;  3ENW A;  3NCR A;  2QA4 S;  3UQS A;  4RU2 A;  2VFS A;  2QC3 A;  1RKI A;  3VGV A;  5HMY A;  2J6S A;  1FWK A;  3SSR A;  3NCP A;  4LBP A;  3RRH A;  2VUG A;  3CIM A;  3EVM A;  2R8G A;  3AFG A;  5HRO B;  1Z1Z A;  4AL7 A;  4MJK A;  1F5B A;  1RTI A;  2AYM A;  2DHA A;  5T7L A;  4JI0 J;  3I96 A;  1JLB A;  5GAG U;  2HK3 A;  4HAC B;  1N32 J;  4K8R A;  1TV6 B;  2ASL A;  1BQM A;  4M8L A;  3V4M A;  1KKH A;  4MKB A;  1UPM B;  3NP5 A;  2ZD1 A;  1G2E A;  2AU0 A;  3VAM A;  3V6H A;  3DU5 A;  5KFE A;  4ZPD A;  3SFG A;  4LF6 F;  1WSR A;  3CD7 A;  3O1L A;  1NPK A;  2KT5 A;  3ZNJ 1;  1LXN A;  4A8Y A;  1H7X A;  2IC3 A;  3H7H B;  1GH8 A;  1WUU A;  4R5P B;  1S1X B;  5L1J A;  4TLR A;  2NUH A;  2HMI A;  1JXE A;  2KFZ A;  3CB4 A;  4OZ2 A;  2G0I A;  4H4K C;  2PDA A;  4TU8 A;  1JXL A;  3KK2 A;  2FZC B;  2IM3 A;  1QLN A;  3QGG A;  1R6V A;  4GVL A;  2YPZ A;  4QWA A;  4X65 F;  2ZM6 F;  3MAQ A;  1FRM A;  2WAQ D;  4IUF A;  4C11 B;  5C24 B;  2HGN A;  3OXL A;  3D68 A;  2QTW A;  2W9C A;  4OI0 A;  3DDK A;  4AXJ A;  4F3M A;  2OPP B;  3E2E A;  5KT5 A;  3CPW R;  4ECY A;  3QIP A;  4MKV A;  5KG5 A;  4G3I A;  3G2X A;  2BEF A;  3TQ1 A;  1PAE X;  3MM5 B;  4DV6 J;  1FEE A;  5DRK A;  4F02 A;  3I5B A;  3SMZ A;  1N34 F;  2QX0 A;  2ZH4 A;  3H59 A;  1NLK L;  2W2P P;  1REG X;  1TKX B;  2CKW A;  5CD4 H;  5LSR A;  1W26 A;  1TAQ A;  2C22 A;  5M2R A;  3FMW A;  2V63 A;  1S0O A;  4K0K F;  4CTA B;  3U02 A;  3EXY A;  5J1P A;  3DMJ B;  2FDN A;  3VAG A;  5KT6 A;  5DLG A;  2K1R A;  1NKB A;  4OX7 A;  1NDC A;  1YBU A;  1L3S A;  3KHL A;  4IH5 A;  2F8E X;  4K4Y A;  1UA0 A;  3TZX A;  1KDN A;  4KKO B;  1J27 A;  3T1A A;  3JTO A;  3W60 A;  1EB0 A;  1YLX A;  4MMO A;  5IT4 A;  3M2U A;  4ZP9 A;  4FVC A;  2MKK A;  1D09 B;  3GYX B;  3AOD A;  1KOO A;  2OML A;  3H2V E;  4J91 A;  1TL7 B;  2ZWP A;  4C8Z A;  4IYQ A;  2AZ1 A;  2VIH A;  1SL0 A;  1RT6 B;  2CQB A;  5CYJ A;  3CJS A;  1OYD A;  2RF2 B;  5C5J A;  3A8K A;  4A8F A;  1VIO A;  2OHD A;  2MQM A;  1TK8 A;  2OFG X;  4PUO A;  1HKA A;  4J9R A;  4XAK A;  4WK3 A;  2XI3 A;  1YI2 S;  3DRY A;  1UAW A;  3DKD A;  3OFF A;  4BBY A;  5DLF A;  3KMS A;  5KG4 A;  2M8D B;  1FF2 A;  4X64 J;  2ROG A;  3RBZ A;  5F8L A;  3QGP A;  2R8H A;  1IUJ A;  1CJU B;  2LQ5 A;  1LOU A;  2M4M A;  3I9V 9;  2UUA J;  3RW6 A;  2JLG A;  2ZUA A;  4ZLN A;  4IOB A;  2CZ4 A;  4LVO P;  5D77 A;  4JV2 A;  1WD6 A;  2MGZ B;  2XTJ P;  3LA0 A;  4C97 A;  5DG8 A;  1T9U A;  3OW2 R;  3ENQ A;  4CM2 A;  5AJ3 J;  2VBW A;  4PXC A;  3RYL A;  3I0S A;  3UNG C;  4OHZ A;  3RZA A;  2APO A;  1UFK A;  4C8N A;  5CCL A;  2HVZ A;  4C3L A;  2RHS B;  2F4V J;  3DOK B;  1KN6 A;  5JVH Q;  4PQU A;  1MN9 A;  1HQU B;  4B9N A;  3SCL E;  1S1T B;  2ZH2 A;  2CAD A;  4WE1 A;  4J9U E;  1NPP A;  5IS2 A;  4ZCL A;  2CQD A;  5E3C A;  2AX1 A;  2M5Y A;  5L39 A;  2GV1 A;  4OZL A;  3DLH A;  1TL1 B;  3P5T L;  3PFE A;  4O0I A;  2OAU A;  4JI6 F;  4QWE A;  1VQ4 S;  2E9T A;  4J9N A;  4E0D A;  2GCF A;  1FVQ A;  1UEK A;  3JAM Y;  1VQ6 S;  1LFW A;  1K47 A;  4ZIT A;  4ZVU B;  2J6U A;  3M2R A;  1V9O A;  5DS7 A;  2EC0 A;  2YVS A;  2OTL S;  2H3E B;  3MAA B;  4RW7 A;  3BH7 B;  1XN9 A;  2GVZ A;  5IWA J;  2EG2 A;  1GFW B;  1MLA A;  2IBK A;  4KHP F;  2IAJ B;  2MHN A;  5HQL A;  4B3S F;  3QNW B;  4ILR A;  2CQG A;  1TL4 A;  1HR0 J;  1TKZ A;  4PPD A;  2IY5 B;  1KHV A;  2VB6 A;  4H4O B;  1D9F A;  2DGV A;  3GJQ B;  4PWD A;  2OPS A;  1LEO A;  4DV7 J;  2UZA A;  2IRY A;  1MRO B;  4F0H A;  3MM8 A;  2DR7 A;  4Y2K A;  4I7F B;  1IR0 A;  2F9J A;  2MST A;  4OQJ A;  1RT5 B;  1U6B A;  1ROF A;  5IFM A;  4ZPC A;  2VC1 A;  3UE2 A;  2GW8 A;  3BV8 A;  3OL9 A;  3M8Y A;  2ZZM A;  3PYF A;  2M52 A;  2DNK A;  5JVG Q;  3G87 A;  1FDN A;  2IIH A;  2VDH A;  2QLW A;  2JEI A;  1R0A B;  2LQB A;  4IG0 A;  1OIA A;  3S8S A;  1S1W B;  4KH1 B;  1BHN A;  2HND A;  5ETV A;  2EC2 A;  1D9A A;  1NDL A;  1RZM A;  1PC4 A;  2NXE A;  4K2X A;  3V6K A;  2OKQ A;  2ATL A;  1ZA1 B;  1YJ9 S;  1C1C A;  4FXV A;  5AXL A;  2CPY A;  2LCW A;  4DV4 J;  1HQE B;  3BO2 A;  1VLO A;  4WFB Q;  3K5N A;  3GFZ A;  2Q1L A;  4QIG A;  1KVK A;  4MIW A;  4C3K A;  3OJU A;  4WZM A;  3QLH B;  3THP A;  3MDF A;  1M1H A;  2LMI A;  3GYG A;  2HVE A;  2EI5 A;  4NLR A;  3NBP A;  1XMQ J;  5CYM A;  1F9H A;  2MQQ A;  2NR0 A;  1RTZ A;  3CD5 A;  2UUB J;  1VBZ A;  3MUM P;  2DD8 S;  3OTD A;  4P9S A;  4QZV B;  2KXN B;  1VRU B;  4ID5 A;  1NKC A;  1KWM A;  2ASJ A;  4I2P A;  4F4Y A;  1EQM A;  3HF5 A;  5F8J A;  4JV0 A;  2G4B A;  2BKN A;  2PN6 A;  3L9Z A;  5LJ5 Y;  5H9E K;  4ED6 A;  3I87 A;  3IS9 A;  5KG3 A;  3V81 B;  3DXS X;  3PKM A;  1CC8 A;  2C3P A;  4ZIV A;  3P45 B;  2HBQ B;  2FVS A;  3GZ7 A;  3IRX A;  2ADC A;  1IR2 A;  3ITH B;  4USH A;  3AOB A;  2JSX A;  2KKH A;  2BX6 A;  4K4T A;  4QPT A;  3KFW X;  4DX8 H;  4HHJ A;  3CO9 A;  4URG A;  2KI2 A;  3R6L B;  4JI2 F;  3DNC A;  1QE1 B;  2CPD A;  2SXL A;  2OI2 A;  1VQS A;  4OYX A;  3HVW A;  2MZQ A;  3HT3 A;  2UU9 J;  4LQ9 A;  2B4O A;  2GO9 A;  1N5T A;  1BMQ B;  1IBL J;  2ZNZ A;  1X9M A;  2ZHB A;  1D8Y A;  3KWM A;  5KFJ A;  1RWU A;  4Y34 A;  4J9K A;  4MTP A;  4PWU A;  1VJQ A;  2WVB A;  2AEF A;  1VYA A;  2ZFH A;  5F3T A;  3BSN A;  3IA0 A;  3HP6 A;  4X62 J;  1VC0 A;  2M9K A;  3KK3 B;  4J90 A;  4OX8 A;  1XK8 A;  2ZHO A;  3KLE B;  2BDP A;  1KNZ A;  3UDE A;  3R6G B;  4AD6 A;  1CJV A;  2HQ3 A;  2K2P A;  3D66 A;  2YPY A;  1C0T B;  1KR4 A;  3AY0 A;  2E1P A;  2PMH A;  4OYO A;  2OLW A;  2CQ2 A;  3P4U B;  2IYI A;  3IR7 B;  3ELH A;  3W3S A;  1H0H B;  4DR2 J;  2B9Y A;  1TVR B;  3LAK A;  1FRL A;  1HBU A;  4YDD B;  3PHT A;  1BE4 A;  1M5H A;  4I64 A;  5B0E A;  2LA6 A;  3MMC A;  4DR1 J;  3FK4 A;  1VHI A;  2HFN A;  1F9F A;  2OD6 A;  1QAJ A;  3NLC A;  3UD3 P;  4NRU A;  3IWX A;  5IT9 U;  3MCS A;  1LW0 B;  2C2K B;  3DOM B;  4AE5 A;  4K50 A;  4ED8 A;  2ERR A;  4F04 B;  2CPF A;  2DXF A;  3DM2 A;  2HHU A;  3RBD A;  3WC2 A;  4DSI A;  4ZS6 A;  4HTI A;  1M5K C;  3C16 A;  2LDY A;  2UVU A;  1KVJ A;  2DNG A;  2V8D A;  5KFW A;  4LR9 A;  2J76 E;  5IM0 B;  4EZ6 A;  1BY9 A;  2UV8 G;  2XY6 A;  1FRJ A;  1Q1K A;  3TJA A;  2UXB F;  2FY8 A;  1ZAV A;  4B9V A;  3FFI B;  1NK8 A;  2KG0 A;  2Y1I A;  4PR6 A;  1UW9 A;  1Y9O A;  4MFB B;  4ZA1 A;  1HNI B;  1VQ8 S;  2IVY A;  2XWX A;  2KZM A;  4HEA 9;  4RZR A;  1XR5 A;  1YZ6 A;  1T9X A;  1RAE B;  3VAJ A;  1APS A;  3D0I E;  2J9E A;  3B78 A;  4AQY J;  5KTQ A;  4DFM A;  2FJX A;  4AXI A;  4I68 A;  3I5A A;  1NBE B;  2AEM A;  4LIR A;  2G1H A;  4QOT A;  1S7H A;  3W2V B;  3TZY A;  2FZK B;  1LWF A;  4LF5 F;  5KOX A;  2YNG A;  2I6W A;  4RUB A;  2EFP A;  4GKK F;  2UUW A;  3HFK A;  4C8L A;  3HFV A;  3G82 A;  3PV8 A;  1NK4 A;  4X66 F;  2XZT B;  2CPH A;  1HD0 A;  4YN3 B;  1W2B R;  1XNQ F;  4LFA F;  3MEG A;  3KG0 A;  5AE1 A;  3NS7 B;  1YDL A;  4QIV A;  1FVS A;  4P72 A;  2D1C A;  3N6L A;  4UST A;  2JWN A;  4USV A;  5D15 A;  4O4R A;  3M6W A;  3TX8 A;  1UVK A;  4RJV A;  5C2G A;  3PY8 A;  4DV5 J;  4NRT A;  1HFE L;  2B9E A;  4A48 A;  2LDI A;  2LXI A;  9RUB A;  2RDI A;  3BYR A;  4DPY A;  1Q8B A;  3HSZ A;  1SQG A;  3DLE A;  3TVZ A;  3P5B P;  2ROP A;  8AT1 B;  4F25 A;  5EN1 A;  4HL9 A;  5KFR A;  4R0J A;  3Q89 A;  3LP0 B;  2N7C A;  4QR1 A;  1HPZ A;  1EAR A;  1BD6 A;  2B9X A;  1SH0 A;  3DFE A;  4NAS A;  1HIY A;  2CPJ A;  2J9D A;  4K5S A;  4LRA A;  1JKH B;  2LQ9 A;  3RAQ A;  4FZV A;  3LQV A;  4K5R A;  5CAA A;  3QSI A;  4O4G A;  5B0A A;  4ZN3 A;  3K8V A;  1YBT A;  1IBM F;  1UW4 A;  2CQ4 A;  4Y0F A;  3BPD A;  4C0O C;  4DG1 A;  4F3O A;  4DUY F;  1CJK B;  3UDV A;  3HLU A;  1S48 A;  2ZVS A;  2UVV A;  4DV2 F;  4UQT A;  4JI7 J;  3HHL A;  5L1L A;  1U1K A;  3MI7 X;  4HYK A;  2YWE A;  2IM1 A;  2RDJ A;  1FFG B;  1H98 A;  4FXW A;  2GMH A;  3MAH A;  2CDR B;  1S6P A;  5CZX A;  3VQS A;  2EFQ A;  2QMX A;  2H5J B;  2VA3 A;  4DX5 A;  2YKA A;  3T1Y F;  2W25 A;  4N8O A;  2AYE A;  1U1M A;  1GXT A;  1V3R A;  3CDA A;  3CJ5 A;  3VGU A;  3IG1 B;  1TUW A;  1VQK S;  4O3Q A;  1U2C A;  1Q7Y T;  2R3V A;  4ED3 A;  1QSY A;  1AW0 A;  4Y2I A;  2EBE A;  5LMU F;  4YR2 A;  3NXZ A;  1S5Z A;  4UOH A;  2ZDO A;  3IO1 A;  1M5O C;  4BC9 A;  4D3G A;  3PIO Q;  3SV3 A;  2XMJ A;  2LYV A;  2NPF A;  3B4M A;  3MEE B;  1ZH5 A;  4HH0 A;  4F0K A;  4PYA A;  4LF6 J;  2XSJ B;  2QLJ B;  2A6M A;  2RB7 A;  2WTF A;  1JLF A;  4RNH A;  3GSI A;  5HAT A;  3AT1 B;  4C6A A;  2OSQ A;  2DNZ A;  3NAI A;  1SVD A;  5K14 A;  4OZN A;  1FKA F;  1DTT A;  2BVZ A;  3SQG B;  3D3C J;  5L1I A;  1SC3 B;  4H4K A;  3QRP A;  1N54 B;  1W7W A;  2EPI A;  2R9L A;  3MWB A;  4ELV A;  1VQP S;  3OSN A;  4X65 J;  2ZM6 J;  2J0S D;  3DRR B;  3OL8 A;  1NZ8 A;  2GHW A;  4KPC A;  1LWC A;  3U1M A;  2XQC A;  1WKL A;  3THV A;  2E7W A;  4A4J A;  2GHV C;  4HTJ A;  2D9O A;  4J7C A;  4DPT A;  3OLA A;  5J2M A;  5CXT A;  1CPZ A;  1RTH A;  1XR6 A;  2EFO A;  1U24 A;  3VAK A;  3SQO P;  2XY5 A;  1OSC A;  3K5L A;  4M5N A;  2A2C A;  1Y5N B;  1RHJ B;  1Y10 A;  2JRS A;  2O01 C;  3PCO B;  4CLS A;  1Q8L A;  2LU1 A;  1WNE A;  1H72 C;  3KG1 A;  2GGP B;  4U67 Q;  3CCM S;  1N34 J;  4TY8 B;  2YH0 A;  3NCQ A;  4CT8 A;  3PW5 A;  5D78 A;  1S49 A;  4M5I A;  2HFO A;  3RAM A;  3BEG B;  4LRB A;  2IM2 A;  2M8H A;  1SV5 A;  4NLV A;  1QJH A;  3ENA A;  2J0Q D;  1FDD A;  1MML A;  1S0M A;  2OTJ S;  4K0K J;  4DQS A;  2MKS A;  3PW4 A;  4WF9 Q;  4K4S A;  4KGX B;  4ZDN A;  3CJ2 A;  2B56 A;  5LMN F;  5I3U B;  4MKY A;  3EGZ A;  3RB3 A;  2ACM A;  2ZE2 A;  2WCX A;  1YRT A;  2AGP A;  3HJV A;  4JI1 F;  1Y7P A;  2L3M A;  1AXQ A;  2NUU G;  4WZQ A;  3T41 A;  1WDT A;  2VG5 A;  4HR2 A;  3R9L A;  4FF3 A;  2OPQ B;  4LUB A;  2DH8 A;  5I42 B;  3CC7 S;  3IWN C;  1FKP A;  4GVB A;  3EZ5 A;  3ICL A;  4NZ6 A;  4X4O A;  1JQG A;  1TKD A;  4LF2 A;  3LUY A;  5CYQ B;  2RQK A;  3BZQ A;  2FD2 A;  2BM1 A;  1RT7 A;  2NRE A;  5C25 B;  1EET A;  2Q6C A;  3MR5 A;  1WJ9 A;  2AJF E;  1RAJ A;  5J1E B;  4OI4 A;  1G6B A;  2EBG A;  5J2P B;  3LW5 C;  2EWH A;  3SDE A;  2UXC F;  4RBT A;  1FD2 A;  3EM1 A;  2GIQ A;  5F0U A;  5AE2 A;  4P7T A;  3C6T B;  2ZJQ Q;  2YKM A;  2MKC A;  3LAL A;  4DHV A;  2F63 A;  1OY9 A;  2KJW A;  4KGZ B;  1F9E B;  3V6D B;  4ZIW A;  4QW8 A;  1HHT P;  2HGM A;  1KRP A;  4OJ1 A;  1NK9 A;  2X1A A;  2H5E A;  5AXN A;  2OEK A;  3D1H A;  5F0W A;  4OX9 F;  2Q79 A;  2PMZ D;  2JVO A;  4ZJQ A;  1U0S A;  1FRH A;  2AIR B;  3A13 A;  3SIP B;  1Y0H A;  4NYZ A;  1S9F A;  1S6O A;  1B64 A;  4UF4 A;  1QDU B;  4DBQ A;  2E7X A;  2BOA A;  5HMW A;  1KTV A;  4RNN A;  1UZD A;  4C8Y A;  5HI7 A;  4GC6 A;  1AFI A;  1FI4 A;  1SC4 B;  2XZD B;  4F2R A;  2BW2 A;  3LP1 B;  2IJR A;  2ZJR Q;  1SCJ B;  2MKJ A;  2MDA A;  1FK9 B;  3M32 A;  2KN4 A;  4TQR A;  4LSZ B;  1WHY A;  2XYG B;  3HZG A;  4BDP A;  3UD5 A;  2DPJ A;  2F1F A;  2MJN A;  1DLO B;  4C0B A;  4EYH B;  3FSI A;  2AGQ A;  1UVI A;  1YHQ S;  3CJT A;  1IM6 A;  2BA9 A;  1HQ2 A;  2CA9 A;  3F0N A;  2RT3 A;  1FEH A;  2K7K A;  3R2D J;  2C42 A;  4HVZ A;  5C7P A;  3HK2 A;  1KQG B;  4R5P A;  3A12 A;  1B0T A;  4UUX A;  1S1X A;  4Q0B B;  2DRA A;  4F26 A;  4WFX A;  1OPZ A;  2B43 A;  2ZWO A;  1M90 T;  1KBR A;  4KV8 B;  2R2U A;  3EZO A;  3HD2 A;  2FQQ B;  1BWV A;  1FDB A;  4NCG B;  4B9U A;  4KHP J;  4CZC A;  1SXL A;  2WBM A;  4B3S J;  4HT7 A;  1N5Y B;  2DGW A;  5M2P A;  5C24 A;  2M7S A;  3W64 A;  2RRN A;  3QRR A;  3KXD A;  3DRS A;  2LVW A;  4ZPB A;  2AEJ A;  2RVJ A;  3HMJ G;  1ZA2 B;  2YNH B;  2UXD F;  5K8O A;  2VOO A;  4GKJ J;  1T3N A;  3VWS A;  1HBN A;  2PEH A;  4DV1 F;  4X4R A;  3DYA B;  4I56 A;  3V4I B;  1XTZ A;  1U1Q A;  4DX6 A;  1EZZ B;  3EGW B;  4UZB A;  4RWW A;  4LRE A;  1WI6 A;  4LSL B;  1X9S A;  4WKR A;  1KFD A;  1ZM3 A;  2QV6 A;  2ALZ A;  4EO6 A;  1X0F A;  1WF2 A;  4OJG A;  3R7B B;  2G13 A;  3DI6 B;  4CTA A;  5KFZ A;  1GNK A;  5HO4 A;  2KHD A;  2CNN B;  5HQM A;  1P9Q C;  1RWN B;  1ITP A;  1RHU B;  3LPY A;  1PJ6 A;  2GA7 A;  3T5L A;  1KLN A;  2W4P A;  4TYB A;  5I3Q A;  1PAU B;  3QZ8 A;  2HS3 A;  1U47 A;  4Q45 A;  1HNW F;  3I9Z A;  3PJW A;  2AQ4 A;  3N6M A;  4ZVE A;  2K06 A;  5AE3 A;  1YK9 A;  1K9M T;  4OYW A;  1CS4 B;  2I0X A;  3H2U B;  3NS5 A;  5ETP A;  4BCA A;  1IVZ A;  3PRV A;  1NJY A;  1DQ9 A;  3TEG A;  4ED1 A;  1IXK A;  4MK8 A;  1RT6 A;  3R5J B;  5HN0 A;  4F0M A;  4FYY B;  2RF2 A;  8ATC B;  3RR7 A;  2E44 A;  3D6H B;  2DO4 A;  2V8G A;  4WJB A;  3MCO A;  3C46 A;  4ZVS B;  3NRB A;  5D0H A;  3LAN A;  3MTJ A;  4ZVG A;  2VV5 A;  1QTN B;  5KFF A;  4RX6 A;  3UVJ B;  3KLI B;  4JB8 B;  2HVH A;  5B09 A;  5K5M A;  3CCU S;  1RWW B;  5E7O B;  2DNY A;  2MQL A;  4I2Q B;  1EHW A;  2YXL A;  2JEG A;  2R7U A;  2XCP A;  1CJU A;  3G6V A;  1VMB A;  3GFH A;  2MJU A;  2P9C A;  2AKW B;  3JS9 A;  4ED5 A;  1HNV A;  2BJ3 A;  3P6Y C;  4DL3 A;  4U6P A;  1FTR A;  4USJ C;  4L3K A;  1WEL A;  4RW4 B;  2BAN B;  2WB4 A;  1S10 A;  3BKU A;  3MUT P;  1RIS A;  1HQU A;  3BQ1 A;  3DRX A;  2QYG A;  4M5G A;  5F8H A;  1U1P A;  2AHO B;  2VC0 A;  1TL1 A;  2ZH1 A;  4QIE A;  1HI8 A;  3C8Y A;  3VHQ A;  2QMU B;  4RW8 B;  2E5H A;  5CCM A;  3CJ3 A;  3M4X A;  5CQG A;  2XMK A;  3A1Y G;  2Y8W A;  1DTQ B;  2P5V A;  2HK2 A;  4DQR A;  4BWM A;  1RE1 B;  4U95 A;  1Q95 G;  1TTH B;  4OHY A;  2J9C A;  5DG7 A;  3TUJ C;  2WB1 D;  2WON B;  2AJQ A;  3I31 A;  3DLL Q;  3ISN D;  1ZTT A;  2DK2 A;  3L7U A;  3HX9 A;  1VLY A;  1SJ3 P;  3HFZ B;  5KFT A;  2UUT A;  2GAH C;  1VQL S;  1WEZ A;  1GX6 A;  4NLG A;  5IV3 A;  2W7O A;  4M5M A;  2VFU A;  1P6T A;  2IAJ A;  2PD1 A;  1TP7 A;  3TA2 A;  1D3W A;  3UR0 A;  1U6F A;  1ZET A;  3BGO P;  2I9S A;  4NCB A;  1RT2 A;  2JL9 A;  1TL5 A;  4OYM A;  4F67 A;  1HWJ A;  3E51 A;  2XLI A;  4ZJL A;  3SSS A;  4ZVQ B;  3I4P A;  3M8W A;  4A8M P;  4C3M A;  1SUQ A;  2LQJ A;  4FKY A;  2FVQ A;  1GMW D;  4H54 A;  1JLA A;  3KG4 A;  1AUD A;  2VOP A;  1RT5 A;  4W92 B;  3DHX A;  4OLP A;  3TO8 A;  1RT1 B;  4L73 A;  1YZ7 A;  2UXB J;  2ZOM A;  3EJM A;  1SIW B;  2DRB A;  5K8P A;  3L95 X;  3M8Q B;  2W01 A;  1IKV B;  3SCJ E;  1HI1 A;  1RKJ A;  2JC0 A;  2V5H G;  2JVR A;  2VL1 A;  5A0Y B;  4M63 A;  3D6M B;  3W5Z A;  4M1K A;  1LV5 A;  2JEJ A;  2DIT A;  2KFY A;  5D4P A;  3A8J A;  3J80 Y;  1NHU A;  1BQX A;  5EUH A;  1WG5 A;  2JZ5 A;  2C2E A;  4LIW A;  5BR8 F;  3I5C A;  4LF5 J;  4O44 B;  2GFF A;  4NMX A;  5KFV A;  1HQE A;  1ZPV A;  4K4V A;  4GKK J;  5EHH A;  3QLH A;  3MM6 B;  2YX1 A;  3T5J A;  1FFS B;  1WEX A;  4X66 J;  1FD8 A;  3IN5 A;  4Z7C A;  1XNQ J;  4LFA J;  4PXE A;  2LQ8 A;  5BYR A;  2RQ4 A;  1MNE A;  3KJF B;  1RAI B;  3HVT A;  3QAE A;  3HKW A;  2W2Q P;  2V9K A;  3QMQ A;  3R1L A;  4HDG A;  3ZC4 A;  2CQH A;  4P52 A;  2IMO A;  4O3S A;  3PJX A;  4A8W A;  3W9J A;  4JI3 J;  5M2U A;  3BBB A;  3O3L A;  2AYB A;  2IDE A;  3PRD A;  1S0V A;  3H20 A;  2UUA F;  3BR9 A;  3LP2 B;  5L1K A;  2J7K A;  4J9P A;  2CNK B;  2CQ0 A;  4NA2 A;  3A8E A;  2J0W A;  4Q2M A;  4ATN A;  2MHE A;  2RML A;  4IRK A;  2FB0 A;  2M3D A;  1XER A;  5KG6 A;  1OJ4 A;  1WC4 A;  5EDW A;  3JXO A;  2GZO A;  3MOZ A;  5B0G A;  1X4A A;  3IR6 B;  3GE9 A;  1IBM J;  5F9L A;  3ZZZ A;  2BYC A;  4A8S A;  3E8O A;  3IAS 9;  2F9D A;  1QE1 A;  3CT9 A;  2HIQ A;  4DUY J;  4WII A;  4DV2 J;  3PEH A;  2GHP A;  2MB0 B;  3M8P B;  2I1R A;  4NLW A;  3TAM B;  3GPA A;  2UVR A;  4DN0 A;  1Y5I B;  4UOC A;  1T9T A;  5B0F A;  2XS7 A;  2V67 A;  3CJQ A;  1Y00 A;  5B0C A;  4DLE A;  1XNR F;  3MR7 A;  4LF7 F;  4QR2 A;  1AT1 B;  3HZE A;  3I4H X;  4NL5 A;  2CJX B;  2N4C A;  3H40 A;  3VTI A;  2FLN A;  2DYA A;  3T1Y J;  1WF0 A;  3KK3 A;  5DDP C;  1U6Z A;  1RHK B;  4ZVT B;  1H7W A;  2F5G A;  3KLE A;  1N36 F;  3ONQ A;  3AXK A;  5GAD I;  4OYP A;  4DN9 A;  2X7I A;  3OQ2 A;  2A18 A;  4ZP8 A;  2PMW A;  1NHV A;  5LMU J;  5E3P A;  1N88 A;  5HVF A;  1HR0 F;  1P27 B;  4MK7 A;  1S7I A;  5IOL A;  2V69 A;  4NLS A;  3A8I A;  4OZJ A;  3BSC A;  4AUK A;  2RSQ A;  4P2M A;  3PHE A;  1TL3 B;  2HNZ B;  2J7W A;  5FD1 A;  5E3A A;  1RTJ A;  2WSE C;  2R7V A;  1SC6 A;  2MKI A;  2YX4 A;  3R97 A;  1F2G A;  3K89 A;  4RW9 B;  3UCZ P;  3GON A;  2NXN A;  4ES3 A;  4OZ1 A;  1LW0 A;  2V8P A;  3DOM A;  2HAF A;  3CDB A;  4DR7 J;  2WSC C;  1TKT B;  3MMJ A;  2IVM A;  3CJR A;  3WDO A;  2AWZ A;  2I5J B;  3Q0A A;  2MZ1 A;  3TP2 A;  4B3T F;  2XEX A;  2CQI A;  2MZS A;  2WOM A;  4A8Q A;  4Q7A A;  3H4B A;  2HAI A;  1RQ0 A;  1LW2 B;  2QSW A;  3FFI A;  4BLG A;  3KLF B;  4MFB A;  4ZPV R;  3QGI A;  2BJE A;  1WOS A;  1HNI A;  4QBU A;  5F8N A;  1HWL A;  1WC1 A;  1FT8 A;  6FDR A;  2LEA A;  3LOU A;  1PYT A;  4K59 A;  5G4D A;  1X8D A;  2W1B A;  4NLP A;  1F60 B;  4IQX A;  2DBB A;  4KB7 A;  3D1O A;  3CW2 C;  3MED A;  1UMJ A;  2N3L A;  3W2V A;  5BYS A;  1IKY A;  3FBB A;  4PQA A;  4RUC A;  2GNK A;  4KHR A;  2DT9 A;  1EAY C;  2J0X A;  3UPF A;  5E41 A;  2WVD A;  2ZNY A;  1RYR A;  2B5J A;  4WPA A;  4UZC A;  2EK6 A;  4DL7 A;  1DQ8 A;  3CCR S;  6FD1 A;  1ZYQ A;  3CCT A;  1C1B B;  2V4J B;  1HWI A;  1T05 B;  4DDF A;  2KT3 A;  3MUR P;  2QSF A;  5LMN J;  3D6F B;  4RLE A;  2MQO A;  3FEX B;  4EZ9 A;  3MMA A;  3CUN A;  2DNN A;  2E5L F;  4JI1 J;  4TY9 A;  1H73 A;  2PA3 A;  2FZG B;  4DFK A;  1X5T A;  4MIA A;  4RPF A;  4FNH A;  3LP0 A;  2OIH A;  4EYI B;  2HWT A;  4OI3 A;  3H5Y A;  2Y0S D;  2UU9 F;  3MR2 A;  1CUL B;  1JKH A;  4G6V B;  2C2N A;  2PI4 A;  2J9D E;  2GVD B;  4OZ0 A;  1BQN B;  3KLG B;  2VON A;  1OWX A;  2KVQ E;  4R8U A;  2CG8 A;  3VGT A;  1J5O B;  2M70 A;  2UXC J;  1CJK A;  1HBM A;  1N6Q A;  3GIM A;  3MMB B;  2B3T B;  3GV8 B;  1FXD A;  5D0G A;  4PG6 A;  4X62 F;  4EI2 A;  2RRA A;  4OI1 A;  1FJC A;  2NZ4 A;  3BGF A;  1H6K X;  3KLH B;  3ZXW A;  2ZH5 A;  2V34 A;  1I94 F;  2KFN A;  2HGL A;  1O0P A;  4WP3 A;  3I55 S;  3KNG A;  5EGY A;  2VPW B;  4C2M A;  1JLE A;  3I56 S;  3G71 S;  2GMJ A;  4OX9 J;  4WCE Q;  2MLY A;  1E6Y A;  2G0J A;  1LFP A;  4ZVH A;  2DXD A;  2IJF A;  2HHT A;  3FCW A;  3D54 A;  1LKZ A;  1FKO A;  1RTI B;  3CMA S;  3DLK B;  2GML A;  2MLX A;  2ZJP Q;  1RBO B;  1JLB B;  1VJW A;  4E8U A;  4YFU A;  1BQM B;  2DGQ A;  5GAD U;  4OMF G;  4DL6 A;  3VVT A;  3ETO A;  2VG6 A;  2O1P A;  2MSS A;  1PKU A;  1X4D A;  4IFY B;  2B8P A;  3MM9 A;  1U26 A;  1R7I A;  4AL5 A;  3FVY A;  5EWG A;  1TU0 B;  1B7Y B;  4PXD A;  4B9M A;  1GXL A;  4ITS A;  4ZVO B;  4WKY A;  2WK4 A;  1MWZ A;  1SJR A;  2HPU A;  2QIF A;  2IC3 B;  2A1B A;  3K0J A;  1WC5 A;  2KHC A;  3GFY A;  2XSJ A;  3B4D A;  3RB4 A;  4DPX A;  4O3O A;  2A10 A;  1K0T A;  1RHR B;  2AMC B;  2YNI A;  3EGN A;  4NEY A;  4X4Q A;  2HMI B;  2D3O 1;  1WG1 A;  1X5P A;  1S9E A;  3PO4 A;  4GC7 A;  1OQ6 A;  3KK2 B;  2HBY B;  1CQM A;  2J8A A;  2DHH A;  5DGA A;  1HHS A;  3P49 B;  1HLW A;  4KFB B;  2CQP A;  2D69 A;  1NK5 A;  1WDD A;  4B9L A;  3LWM A;  3DRR A;  2W9C B;  2DNL A;  4JYA J;  2VBZ A;  4P10 A;  1JB0 C;  2W4D A;  3M8R A;  2VFT A;  1RP5 A;  3AA8 A;  1WOO A;  2ZBC A;  3C66 A;  3FRY A;  1DJ0 A;  2V0N A;  4NML A;  1U1N A;  4P73 A;  4NLO A;  5ITH A;  4CYU A;  3GIJ A;  3ZTS A;  2OD4 A;  1AUS L;  2ZBQ A;  5D6G A;  1X5O A;  2UXD J;  2DNR A;  1NCL A;  2F40 A;  3IRW P;  3OXF A;  4DUT A;  3GJS B;  4DV1 J;  3VAF A;  2WVF A;  1U45 A;  5L8R C;  2GGP A;  4RO0 A;  2Z30 B;  4TY8 A;  3OT9 A;  5HL7 Q;  4I69 A;  3U27 A;  3VZI A;  2ZOG A;  2VG7 A;  1S4F A;  1GT8 A;  2L48 A;  3HD1 A;  2DH9 A;  2LKZ A;  2RAQ A;  3G8S A;  1X4G A;  2J7U A;  2V2Z A;  4NLT A;  4DV5 F;  2X3D A;  1XJW B;  4ETX A;  1Q53 A;  4OZ3 A;  4WU3 A;  3OTC A;  2HKE A;  4L74 A;  5KFM A;  4ECQ A;  4NXM F;  1C4C A;  2F7V A;  4WP8 A;  1UTA A;  1YJW S;  2DNM A;  3THT A;  2FC8 A;  4PG5 A;  5I3U A;  2DR6 A;  2XCA A;  1HNW J;  1GTH A;  1O8B A;  4CH1 A;  3G4S S;  1SB6 A;  3NEK A;  1UA1 A;  3TEH B;  1Y3K A;  4B17 A;  1U25 A;  4XK8 C;  1DAX A;  1IWG A;  3GIK A;  4K4X A;  2KO1 A;  2OPQ A;  3OPK A;  2V8H A;  4G65 A;  4CWB A;  5I42 A;  4DU7 A;  3RW7 A;  3UDL A;  1NM2 A;  3CCW A;  1RWV B;  2ZHA A;  1ZM4 A;  5CYQ A;  4JI4 J;  5CHC B;  1S4E A;  1ZS6 A;  3H2L A;  1J5E F;  3HHL C;  3CJK A;  4PUO B;  4NZ0 A;  1R27 B;  5A76 A;  4DL0 C;  4NLD A;  2CQC A;  3QJP A;  2DHX A;  2P6S A;  3SBM A;  2FGO A;  5F8M A;  5D0E A;  5KFX A;  3PTW A;  2DO0 A;  4DSE A;  9ATC B;  2DHG A;  4KRW A;  2W7P A;  1VBX A;  3TJ9 A;  2HHQ A;  1DBD A;  3S01 A;  4ILM A;  1NO8 A;  1S9G A;  3ILI A;  1BWE A;  4YR3 A;  1OMS A;  3VV2 B;  5DDQ C;  1KQS R;  5DQG A;  2OP5 A;  3J81 j;  3QBC A;  2B7B B;  5DDR C;  3JYT A;  3O2I A;  2L08 A;  3FZB A;  4DPO A;  3I0S B;  3BBC A;  2H48 B;  4RR5 A;  4ERD A;  3RUB L;  2XM3 A;  4OHV A;  3JSM A;  1TUV A;  3M30 B;  3H5X A;  4XTT A;  3C14 B;  2B4U A;  4K4U A;  4IRC A;  1D8Z A;  3J81 U;  4IO9 Q;  3PRB A;  1QUP A;  1JLG A;  3J7A 1;  2CNL B;  4GMK A;  2AGO A;  2LXF A;  2KXF A;  1WSV A;  3DLB A;  1FK9 A;  4K2J A;  3N01 A;  5F3Z A;  2OH2 A;  2E9R X;  3QYY A;  2BR0 A;  1X4H A;  2FJV A;  2G2Y A;  2MZT A;  4Y2C A;  4KY3 A;  1DLO A;  3OR2 B;  4CLK A;  1FNM A;  4FXD A;  3FQK A;  2BE9 B;  4ED4 A;  1GXU A;  2FC9 A;  4CH0 S;  2YQ3 A;  2BE2 B;  2AX0 A;  1RAG B;  1DZ5 A;  2R7X A;  5DZ6 A;  5HP1 A;  4KV8 A;  2KXH A;  2FIU A;  5THW A;  1RCX B;  4OIX A;  4NCG A;  4H4M B;  2JOQ A;  1S72 S;  1P1T A;  3A3P B;  5KFG A;  3BGR A;  2PT0 A;  2HHS A;  5E3R A;  3BBF A;  4DX7 A;  1AFJ A;  1EX8 A;  1NND A;  2PEB A;  1R6Y A;  2XNQ A;  3QAT A;  5HVH A;  1RBA A;  4PG8 A;  2GJI A;  2YNH A;  2B51 A;  2XMV A;  2VKZ G;  3Q86 A;  1MMD A;  2PSZ A;  1RSC A;  3AA9 A;  4F4K A;  2Z57 B;  2CJ9 A;  5LT5 A;  1UP1 A;  4HH1 A;  5BXI A;  2PO4 A;  3LF0 A;  3DYA A;  5KFS A;  3V4I A;  4ID8 A;  4KAI A;  2Y1J A;  4WXW A;  2VU5 A;  1U48 A;  2DIV A;  3HSG A;  1A0O B;  2IMW P;  4KE5 A;  4F7V A;  5HJY A;  3MM7 B;  3WQP A;  1FE0 A;  1KHW A;  4PYD A;  4ZHR B;  1CVJ A;  1SL2 A;  2F8M A;  5KG2 A;  2Q43 A;  3IAM 9;  3W66 A;  3A3N B;  3EIC A;  2C3O A;  1EIY B;  1OYE A;  2BV3 A;  3T5K A;  3D2W A;  1HA1 A;  2H1Y A;  3DI6 A;  4OI2 A;  4LF4 F;  5BR8 J;  4X4V A;  2XMT A;  4ICL B;  3TUZ C;  3MPY A;  4NLU A;  1JK9 B;  5IZH A;  2CQ3 A;  5CYM B;  2JFD A;  2FVC A;  4ES2 A;  3R2C J;  2MLZ A;  3C15 B;  2CJK A;  5MAO A;  1CS4 A;  4X4N A;  2CAJ A;  5FDL A;  4U8Y A;  5ETM A;  1S6Q B;  2NLW A;  3IGV A;  3N6N A;  2CPZ A;  2E1R A;  1F3V A;  1REV A;  4ID5 B;  3W5Y A;  2AZ3 A;  4I2P B;  2FYX A;  4C8O A;  3HXM A;  4ANC A;  3BQ0 A;  1WC6 A;  3PX4 A;  2DPI A;  3IS9 B;  2V6A A;  3ZO7 A;  2BQR A;  1W25 A;  1N5Q A;  2D41 A;  4ED2 A;  2KYZ A;  3IRX B;  4KT0 C;  2H51 B;  2P8I A;  5L9N A;  1FFW B;  3KLI A;  2Z2Y B;  1T3O A;  2E1M C;  5LM7 E;  4J9V A;  3PR5 B;  3Q8U A;  1MWQ A;  1X4C A;  4WIQ A;  2HZC A;  1N33 F;  2G1D A;  1RWM B;  1IBC B;  1HBO B;  1SIZ A;  1T94 A;  4N47 A;  4DPU A;  3WC0 A;  1PO6 A;  1YX2 A;  4RU9 A;  4KPY A;  5EX3 A;  2ZEJ A;  2UV8 A;  2XGP A;  4RW4 A;  4K4W A;  2W8L A;  3MEC A;  3RRG A;  3NL0 A;  1T0T V;  1NEE A;  3ZZO A;  3TOQ A;  4AL6 A;  1BLU A;  1NH7 A;  4LMZ A;  3G86 A;  2EK1 A;  3WX8 A;  1XNR J;  4LF7 J;  4U7U K;  1S0N A;  1HD1 A;  1VBY A;  1CJT B;  4EWT A;  2OPR B;  4CLW A;  1JLC A;  4LRC A;  3T1H J;  2BKP A;  3ZZ0 A;  2NCK L;  4N41 A;  4Q8F A;  4QWD A;  1N36 J;  2ASY A;  5A8R B;  2WVE A;  1AB8 A;  2IVF B;  3MFI A;  2BE7 D;  2FHM A;  3GQC A;  1PSD A;  3WX4 A;  2PGC A;  4I6Y A;  1DTQ A;  2HUR A;  1KLM B;  3Q8V A;  3KNA A;  1S79 A;  3PYE A;  3Q8Q B;  2F3J A;  2V50 A;  2K7J A;  2WON A;  2DR5 A;  3NG8 A;  2FPH X;  2AD9 A;  3BSA A;  4AT1 B;  2B7C B;  2Z2M A;  1NSK L;  1UEV A;  3R5C A;  2A3J A;  3V5R A;  3BDP A;  4B3O B;  4PRF A;  1WTF A;  4GKJ F;  2POK A;  1IWA A;  5H9E J;  1U4B A;  4B08 A;  3ILO A;  1N56 A;  4TKT A;  3TW0 A;  3HJF A;  3EX7 B;  1TZ0 A;  4WK1 A;  4RNM A;  5GAE I;  2OEJ A;  3C16 B;  3QPI A;  3DRP B;  1U7L A;  3FCV A;  3OTO F;  1FRI A;  1KSP A;  4UY8 5;  4B3T J;  1KON A;  5FLX U;  4N76 A;  4GO7 X;  3AQP A;  2C2D A;  3SCK E;  2QLX A;  2VF3 A;  3JQK A;  4U96 A;  7FD1 A;  2CPE A;  2WBR A;  2R7S A;  2Y9H A;  1R89 A;  4YS2 A;  3IFE A;  2HVD A;  3B54 A;  1IKV A;  1K1Q A;  2M0G B;  4LSN B;  3JTP A;  2UVW A;  4ANE A;  1HNZ F;  2BW7 A;  5A0Y A;  5K8N A;  4YB6 A;  1VGY A;  1TQL A;  3KDO A;  3L7O A;  3N9U C;  1FXL A;  2CQ1 A;  2DNQ A;  2YNG B;  1RT4 A;  3L7P A;  2JLE A;  3KLV A;  4O44 A;  2DH7 A;  3G82 B;  2XMA A;  1RCO B;  4RBV A;  4U9R A;  4TYA A;  4ELU A;  4ED0 A;  2FJW A;  3GJR B;  2CFX A;  3OFE A;  1QAX A;  3UFC X;  2JX2 A;  3G6X A;  3NOG A;  3PJ9 A;  4ELT A;  3TUI C;  4KC5 A;  1X0P A;  3QO9 B;  2OEM A;  1UWA A;  1RAH B;  1ARO P;  1ELO A;  2R7O A;  5DO2 A;  2GS8 A;  4CO5 A;  4CO0 A;  2C3U A;  2Z58 B;  3FBC A;  1T7P A;  3NGK A;  3VAI A;  1EJ7 L;  3WHI A;  2DR9 A;  2DY1 A;  3PW0 A;  2G2O A;  3GII A;  2E5L J;  5K8M A;  2IM0 A;  1YJV A;  2NSB A;  3LP2 A;  1K8A T;  3MR6 A;  4IFV A;  4ZMM A;  3OTE A;  4LFC J;  2MZJ A;  4LF1 A;  1U8S A;  1YGY A;  1F5C A;  2E9Z A;  2KL8 A;  4O4G B;  1L3K A;  4KYZ A;  1U49 A;  2ZZT A;  3W8P A;  3CCJ S;  1AZS B;  2CRL A;  1JMT A;  4F36 A;  2XWY A;  3U1N A;  4X4U A;  1RT3 B;  2BXJ A;  2RDD A;  2Z2L A;  1K73 T;  4Z37 A;  3GCX P;  1OSD A;  2DJW A;  2D3Z A;  2HQD A;  3GR0 A;  4XPC A;  2KYX A;  2OUG A;  1F5A A;  5GMK a;  2XUL A;  4EUV A;  5BYQ A;  2ADB A;  4PEO A;  1DAR A;  2HFS A;  1S6P B;  4EMD A;  2WW4 A;  2R4F A;  2B8Q A;  3ULH A;  4FYW B;  1I94 J;  3CSK A;  2RRB A;  3QAU A;  3TVY A;  1XC9 A;  3MOJ B;  1IJE B;  2CZ9 A;  2KDO A;  5C42 A;  3HPO A;  3JTN A;  3QT5 A;  4A8O A;  4FVM A;  3JQM A;  3GCW P;  5IQQ A;  5ETO A;  3J7A N;  2ZH9 A;  4Y2M A;  1URN A;  3MPU B;  3E01 B;  3BN7 A;  4FF4 A;  2CXE A;  5GAG I;  1KTQ A;  5H9F K;  5KFN A;  1NSP A;  3BF4 A;  1KP6 A;  3H0P A;  2FLL A;  1SJ4 P;  1C4A A;  4CIO A;  2HBR B;  4URQ U;  2DGO A;  5LSL A;  1S97 A;  2GO8 A;  4TU7 A;  2DRD A;  2G9O A;  2ZH3 A;  4LQ3 A;  3PIP Q;  1BC6 A;  3R5G A;  4YQW A;  4RNO A;  1ZAW A;  2HFZ A;  2P6T A;  1TL3 A;  2HNZ A;  1JLF B;  4Y3C A;  3M9O B;  1R8P A;  1K44 A;  2FUG 9;  2LEP A;  3K59 A;  4PAB A;  3K8W A;  3G96 A;  2KVI A;  1S1V A;  1DTT B;  3G8T A;  2LEB A;  2KU7 A;  4JP8 A;  2GIR A;  1X9W A;  4IDK A;  1TKT A;  3CJ4 A;  5LL6 d;  4V19 X;  2Z4P A;  2I5J A;  3KUH A;  5A8K A;  3IC1 A;  4FF2 A;  1OO0 B;  5GAE U;  5DET A;  2OJ3 A;  3CJ8 A;  1IQT A;  2QGF B;  3MTK A;  1LWC B;  3IBC B;  3BQ2 A;  1T8E A;  5J2N A;  1DFD A;  1FHT A;  5J2M B;  4QWB A;  3KLF A;  3R7S B;  4NOH A;  5J2Q A;  3FEZ A;  3KJN B;  1HI0 P;  3K5P A;  3RRK A;  1F0X A;  2EXU A;  2D3U A;  2ZOF A;  3KDN A;  1N48 A;  4IG3 A;  2HS0 A;  1H2T Z;  1X31 C;  3J7Z 5;  1O51 A;  4WP9 A;  1WC3 A;  3TRG A;  4NZ7 A;  3OVA A;  3AD7 C;  2ALY B;  3AB2 B;  4OHX A;  4DMZ A;  3V2U C;  1N52 B;  2CWK A;  3MPV A;  2DR8 A;  1VCT A;  4EBC A;  1SV5 B;  2CJY B;  3M2V A;  4IH6 A;  4CDI A;  3EWG A;  8RUC A;  2HFV A;  1RAA B;  2A2D A;  3P3D A;  4JI3 F;  1R8H A;  3GFX A;  3IBF B;  1NB7 A;  2O67 A;  4NXM J;  2MEW A;  4IQM A;  4Y6I A;  2HZA A;  3NNH A;  2XZW A;  3F73 A;  3M7V A;  3F56 A;  3MXH P;  1T05 A;  1FO1 A;  4CLU A;  5LXR A;  3D4J A;  2GQQ A;  2IPO B;  1IKX B;  2V4Q A;  5ETS A;  4KO0 B;  2PI5 A;  5ADZ A;  2BJ7 A;  4WFA Q;  2DEI A;  2DNP A;  1PJ5 A;  1MSW D;  4N8N A;  4BS2 A;  4QCL A;  2E5J A;  3DGP B;  1RTD A;  5ETR A;  3KJV B;  1YJN S;  2RE1 A;  2X1B A;  2ZH7 A;  4C48 A;  4FYD A;  1EP4 B;  2D7S A;  3PW2 A;  1GK8 A;  1CUL A;  1LK7 A;  4LF9 F;  1J5E J;  2VKR A;  2IA0 A;  4ES1 A;  2YWH A;  3OUY A;  3RJM B;  1BQN A;  2K8G A;  2QA1 A;  3KLG A;  4NPO A;  3VF0 B;  4QIW D;  1J5O A;  5KT3 A;  3MGJ A;  4K7Q A;  3M8S A;  2BQU A;  4DZD A;  3MMB A;  1ZZF A;  1V3S A;  3G6E S;  2QEX S;  3J7Y I;  1FRK A;  3PYD A;  4TNO A;  4Q43 A;  3I82 A;  4JI8 F;  5DQH A;  1PG5 B;  4CO2 A;  3GMG A;  1FX2 A;  5CH7 B;  3C2P A;  1FES A;  3KKF A;  4DPW A;  2NXC A;  1HW8 A;  4OYB A;  4L3N A;  3C6U A;  2MY7 A;  4TU9 A;  3PVX A;  2YNF A;  1U8W A;  3DLK A;  2DVI A;  1TMJ A;  2QE5 A;  2LFV A;  2IRX A;  2B0G A;  4OLO A;  1SQF A;  1D1U A;  1PJ7 A;  1U1R A;  2XHC A;  3CF5 Q;  1LWE B;  1RU2 A;  3M32 B;  4TXS A;  2XLJ A;  4IFY A;  1JLQ A;  1U2R A;  4LBH A;  3CNQ P;  4DR7 F;  1CLF A;  1JJC B;  4J9S A;  3CDU A;  1KD1 T;  3TYT A;  2MKH A;  3ETM A;  1QUV A;  4QYZ K;  1NH8 A;  4PWW A;  3T9N A;  1M1G A;  2PII A;  4CO4 A;  3PR4 A;  3LPE A;  3R7N B;  1SL1 A;  4RW6 A;  5GME A;  1RGV A;  4MK9 A;  1MU2 A;  3S7R A;  1Y4Z B;  2P9G A;  4PKD B;  2ASD A;  4O23 A;  5B7W A;  1TMM A;  1QY7 A;  2OGU A;  4A47 A;  4KJI A;  3E3X A;  2CYY A;  4DFP A;  3QT7 A;  1X4F A;  3BRE A;  4DU8 A;  4OZ5 A;  2RU9 A;  2HQF A;  2LA4 A;  1PYS B;  4S0M A;  4DF8 A;  4XPE A;  2ZKT A;  5F8I A;  4ILL A;  4KFB A;  1B0V A;  3TAP A;  4J9L A;  1GTE A;  3VGS A;  1S59 A;  1XMO F;  3DRS B;  1YG0 A;  3CC4 S;  2XO7 A;  1VK3 A;  3BM7 A;  1IQZ A;  2OSR A;  2EFN A;  1HMV A;  4EK2 A;  5HBM A;  5K20 B;  5KT4 A;  4M5J A;  2IFX A;  5KT7 A;  5DM7 Q;  3SEO A;  1HBN B;  2BMB A;  3EPG A;  4YP3 A;  2BRK A;  3CUL A;  1UET A;  2XS2 A;  1T02 A;  1V3Z A;  4PXB A;  2KRB A;  3HHD A;  3O5T B;  2VAS A;  4L76 A;  4DSJ A;  2HLT A;  2LP4 A;  4A8X A;  4CH7 A;  1EQ0 A;  3DN9 A;  1I51 B;  1UFL A;  5D4L A;  3BPS P;  2FHO B;  3K2Y A;  1NXI A;  4DV3 F;  1MW7 A;  2NS1 B;  3RB0 A;  4RUH A;  2R8J A;  4XDC A;  3L3C A;  1VQ7 S;  1UWB A;  3MHY A;  3MFH A;  4LF4 J;  1VR6 A;  3OR1 B;  3BGU A;  4YB5 A;  4ECX A;  2XYH B;  2P2C B;  2C2M B;  1Q5Y A;  2AJ4 A;  3DGV A;  2R7Q A;  3PFO A;  1BUX A;  2BJ9 A;  2FY1 A;  5K9F A;  1ZPW X;  2XMM A;  1GMW A;  1SJQ A;  2FJA B;  4QW9 A;  3CMQ A;  1T9V A;  1BXN A;  2C2O B;  7FDR A;  4DQI A;  1C0U B;  2C28 A;  1OY8 A;  3ADA C;  2D74 B;  4NI2 B;  2O5D A;  2GQC A;  2RS8 A;  1B7F A;  3H8Y A;  4IKA A;  3FKB A;  3EPI A;  4G1Q B;  3EDQ B;  3PG9 A;  3TAQ A;  1UPP A;  1LXJ A;  3N4W A;  3GWC A;  4XO0 A;  2XB2 D;  4DUZ F;  1VS3 A;  3GU0 A;  1N0U A;  1RWK B;  4OI6 A;  1BGX T;  3W9H A;  5FLX Y;  3B82 A;  2RKI B;  3FBE A;  1H2V Z;  1NPR A;  5I4M A;  2MXY A;  3MPW A;  2M2B A;  2WVC A;  3UD4 P;  2IYG A;  1K0V A;  5HRO A;  2BAC A;  3J7Y U;  1HNV B;  1O5J A;  1S1U B;  2G0C A;  1N33 J;  1L3T A;  3QWU A;  3RG6 A;  2NZC A;  4PZV A;  4USU A;  1QTM A;  2DCL A;  1HAR A;  1KEK A;  2KJV A;  4HAC A;  1FDA A;  5D8H B;  2ZBI A;  1TV6 A;  1YIJ S;  4LT6 A;  2QRR A;  4DR4 F;  2G2Z A;  4P75 A;  3M30 A;  2QL5 B;  2R7T A;  3I0R B;  4M5H A;  5AT1 B;  1LK5 A;  3D3B J;  4DR3 F;  3JSR A;  3C14 A;  5HAN A;  3VAL A;  4B9T A;  2C2R A;  1XQI A;  3D67 A;  2R8K A;  3IXQ A;  4OJH A;  2Z8Q A;  4LR8 A;  5HQ8 A;  4BC7 A;  1KFS A;  5JJB A;  3BSO A;  5C2C A;  3NAH A;  4FS1 A;  5D3G B;  3OR2 A;  4ZVP B;  2BJ1 A;  2RHQ B;  3UN5 A;  4ZK7 M;  4ECU A;  4P2X A;  4BHQ A;  3GG1 A;  4JYA F;  3F44 A;  1G3O A;  3OL7 A;  2BE2 A;  4C11 A;  2QL7 B;  1ZBT A;  3V6J A;  2FVP A;  2B9W A;  2L41 A;  5F41 A;  2HWH A;  1L3U A;  2OPP A;  2NXU A;  4F4X A;  3S1T A;  2N82 B;  2RQM A;  5KFO A;  2QO3 A;  4H4M A;  3MM5 A;  2ZVI A;  1JXV A;  4QIF A;  1RT2 B;  2LLZ A;  3B6B A;  2GJ2 A;  4Z2X A;  4NX9 A;  4L75 A;  4DL2 A;  3BDE A;  3NMA A;  1ZOT A;  2AT1 B;  3BB5 A;  3KTQ A;  2B4V A;  3CDW A;  1SUQ B;  3R27 A;  4P7V A;  4N56 A;  1FCA A;  3Q83 A;  1JLA B;  1S76 D;  1RB0 A;  5KFY A;  3OTO J;  4EFA C;  1TKX A;  2J6T A;  1CBK A;  2KB2 A;  3W61 A;  3TX0 A;  2BUN A;  2V4R A;  4LR7 A;  3HSJ A;  4ZVF A;  2QA2 A;  3OL6 A;  2K3K A;  1YJT A;  1JJH A;  4B3R F;  3DMJ A;  1A9N B;  4WFN Q;  2VOD A;  1M0S A;  1IJF B;  3MM7 A;  2NPI A;  1WC0 A;  1Q8I A;  3ILL A;  4ZHR A;  1HNZ J;  4KKO A;  2YWW A;  1S99 A;  1SQE A;  5FJ4 A;  3FUY A;  4KR0 B;  5U47 A;  1MN7 A;  2ZBR A;  2FHK A;  5KFK A;  1TK0 A;  1TL7 A;  4ICL A;  1YKW A;  4OX6 A;  1L5U A;  4YOE A;  2QYC A;  2QA4 G;  3GTY X;  5IT9 Y;  5LXY A;  2P9E A;  4JI4 F;  3H4D A;  2R2T A;  3W62 A;  3K57 A;  3C15 A;  5L9X A;  4J37 A;  3EMT A;  4IH7 A;  5KFP A;  4HDH A;  1HNX F;  1S6Q A;  3HVT B;  2FLP A;  3T3F A;  1IM4 A;  4FP9 A;  1NSA A;  4AYB D;  4Q44 A;  2FHJ A;  2ZC4 A;  3GJT B;  2MQP A;  3SZ2 A;  4KSE B;  1Q16 B;  1KQF B;  3ET6 B;  2UUC F;  1Q79 A;  1M1K T;  3LWL A;  3NWR A;  1NDP A;  3IR5 B;  2QMW A;  4LF8 J;  3M8Z A;  4DFJ A;  3GSD A;  2MGZ A;  1CEZ A;  2W9A A;  3HT0 A;  1P1L A;  3AOA A;  2VDI A;  5L46 A;  1GX5 A;  2W24 A;  3S6E A;  3W5X A;  1MWY A;  5B0B A;  2GC8 A;  2JHE A;  4USW A;  2EFG A;  2E7V A;  2RUG A;  2BQ3 A;  2CIM A;  2A0F B;  4UT4 A;  4QU6 A;  1JNZ B;  4ZPW R;  5GAH I;  2Z0G A;  3LGN A;  3WIU A;  3DOK A;  1UZH A;  3M9N B;  1HBO A;  1R31 A;  2HHV A;  4HI1 A;  3EDR B;  3D6T B;  1S1T A;  2MQN A;  1Z2Z A;  2XSF A;  2F65 A;  4ECT A;  3RAX A;  2E5I A;  4F4A A;  2ACY A;  1NJW A;  3TVK A;  3VZH A;  3MR3 A;  2L9W A;  4I4B A;  4QJV A;  3K17 A;  3W2W B;  2J8S A;  2M88 A;  1R3N A;  3MD1 A;  3M1V B;  3TZW A;  4B3M F;  3LGH A;  4J9O A;  1UKU A;  4JI5 F;  2VJU A;  2UP1 A;  1VRT B;  3AH6 A;  3Q23 A;  1CJT A;  1RJJ A;  4C4W A;  2OPR A;  3OV7 A;  2ZC3 A;  4CLY A;  2HWI A;  5HMZ A;  4ZKA A;  3MAA A;  1UCN A;  4FYV B;  3PX6 A;  4I67 A;  1Y3J A;  3PAC A;  3H5S A;  5A8R A;  4NWB A; 
#chains in the Genus database with same CATH homology
 1MN9 A;  1S59 A;  1S57 A;  1U8W A;  3Q86 A;  1XIQ A;  2AZ1 A;  1EHW A;  2DYA A;  3BBB A;  4ENO A;  1NSQ A;  2AZ3 A;  4F36 A;  3NGR A;  1HIY A;  2HVE A;  3ZTQ A;  4HR2 A;  4W98 A;  1LEO A;  1BUX A;  1B99 A;  4EK2 A;  3R9L A;  3NGU A;  4ANC A;  5BXI A;  5CAA A;  1MN7 A;  1NPK A;  3BH6 B;  3MPD A;  3GP9 A;  3JS9 A;  3WX8 A;  3EVW A;  3PJ9 A;  2VU5 A;  1NDK A;  3L7U A;  1NLK L;  3FCV A;  2CWK A;  1S5Z A;  4UOH A;  1K44 A;  1JXV A;  3EVO A;  1B4S A;  1HHQ A;  1NHK L;  3B6B A;  4UOG A;  1HLW A;  3DKD A;  2DY9 A;  2B8Q A;  3FC9 A;  3Q8Y A;  2DXF A;  2NCK L;  2DXD A;  4FKX A;  3ETM A;  3FCW A;  3FKB A;  1XQI A;  1NB2 A;  1VYA A;  3FBC A;  3VGV A;  3NGS A;  3Q83 A;  3EMT A;  5IOL A;  4F4A A;  4CP5 A;  3PRV A;  3EIC A;  3BBC A;  4C6A A;  2HUR A;  4O0N A;  3Q8U A;  2HVD A;  1NDC A;  4DI6 A;  3B54 A;  3EVM A;  3Q8V A;  3ZTP A;  3EM1 A;  2ZUA A;  1BHN A;  3ZTS A;  3ENA A;  3VVT A;  1KDN A;  4ANE A;  1WKK A;  3FBB A;  3NGT A;  3BH7 B;  1NDL A;  3VVU A;  1PKU A;  3GPA A;  3ZTR A;  3FBF A;  2B8P A;  4UOF A;  3FBE A;  3DDI A;  1W7W A;  4FKY A;  1NCL A;  1NSP A;  3BBF A;  2BX6 A;  3VGT A;  5C7P A;  4DUT A;  4DZ6 A;  1F3F A;  3ELH A;  3ZTO A;  1NDP A;  1NSK L;  4S0M A;  3VGU A;  3G2X A;  2BEF A;  5CAB A;  3EE3 A;  1WKJ A;  3Q89 A;  1PAE X;  1UCN A;  4KPC A;  1NUE A;  1LWX A;  1ZS6 A;  3EJM A;  4WBF A;  3VGS A;  1BE4 A;  1WKL A;  1F6T A;  2DXE A;  4AND A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...