1JXVA

Crystal structure of human nucleoside diphosphate kinase a
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
149
structure length
149
Chain Sequence
CERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nucleoside Diphosphate Kinase A
publication title Crystal structure of human nucleoside diphosphate kinase A, a metastasis suppressor.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 149
sequence length 149
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2001-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1jxvA00
5CABA 3GP9A 2AZ3A 4HR2A 3FBBA 4UOHA 3FCVA 1EHWA 1LEOA 4FKYA 4ANCA 1NCLA 1HHQA 4WBFA 4F4AA 3ZTRA 1PAEX 2B8QA 3EE3A 1HLWA 3B54A 3EMTA 3FBEA 2HVEA 3MPDA 4DZ6A 1NLKL 1MN9A 3EVOA 1VYAA 5CAAA 3BBCA 2BX6A 3NGUA 3Q83A 2DYAA 3ZTOA 4F36A 3ZTQA 3ZTPA 2HVDA 4DI6A 3ENAA 5IOLA 3Q8YA 4EK2A 4DUTA 1S59A 2AZ1A 2DY9A 3ETMA 4C6AA 1S5ZA 1JXVA 1W7WA 3ZTSA 4KPCA 3NGRA 1K44A 1LWXA 1MN7A 1PKUA 3FCWA 3VGTA 3BH6B 3BBBA 2VU5A 2ZUAA 3B6BA 4CP5A 4ENOA 1XIQA 1NUEA 3L7UA 3EM1A 3WX8A 3EVMA 3FBCA 1WKKA 3BH7B 2HURA 3NGTA 1NSQA 4O0NA 1NDKA 3BBFA 1BHNA 1NHKL 1BE4A 1NDCA 3ELHA 3Q86A 4S0MA 1WKLA 3PRVA 1UCNA 1NSPA 2DXEA 2DXDA 1S57A 1F6TA 1HIYA 4W98A 3Q8VA 3Q89A 3DDIA 3JS9A 3VVUA 2DXFA 3G2XA 4UOGA 3PJ9A 3VGUA 1NB2A 4ANEA 1WKJA 2BEFA 4ANDA 5C7PA 3EVWA 1NDLA 3FBFA 1XQIA 3DKDA 3NGSA 3FKBA 3EJMA 3EICA 3VGSA 2NCKL 1B4SA 3VVTA 5BXIA 1B99A 1F3FA 4FKXA 3Q8UA 3FC9A 1NPKA 1BUXA 2B8PA 1NSKL 1U8WA 1ZS6A 1KDNA 4UOFA 3VGVA 1NDPA 3R9LA 3GPAA 2CWKA
chains in the Genus database with same CATH superfamily
4IG0A 3LF0A 2OSRA 4HR2A 4NI2A 2W2PP 4BS2A 3TI0A 2EFPA 1Q16B 2KH9A 2FHJD 1PCAA 2KKHA 4J91A 2M5YA 4NCBA 1UVNA 5JVHQ 3KLEB 1W7WA 4ZA1A 3R97A 1AT1B 5KG6A 2B7BB 3CT9A 1U6BA 4MAKA 3G6YA 4GRSA 5CYJA 3A1YG 4QOTA 4KYZA 2MQLA 4WU3A 2QEXS 3JTNA 1JLGA 2VDHA 2IM0A 4MT1A 2FHOB 3AD7C 4RBVA 2H51B 2W4CA 4M5DA 5D3GA 3IR6B 1NDLA 2W2OP 3PX6A 1S6OA 2VG5A 1EP4B 3FEXB 3OV7A 5DDOC 3TAMB 5K8OA 4KY3A 1FVSA 1T02A 1FRJA 3W3SA 2G13A 4MYUA 2FVCA 3W65A 3N79A 4DG1A 1R0BG 4KGXB 3Q83A 3SBMA 3A4TA 1ULRA 2DNZA 1RLCL 4NLSA 1Z2LA 4DV1F 2Y1RI 3CO9A 2FIUA 2J0SD 1Q8LA 2GAGC 2OTJS 1N32F 3GIMA 1LQ9A 1GEHA 1FXDA 3AB4B 1BQMB 1L5UA 1HARA 4OYXA 4DPTA 1SV5A 3M1VA 3MEKA 3VAIA 1GXLA 1XN9A 5A6WA 2CXEA 3KLFA 1HBMA 3U1NA 2GIFA 4JI7F 3GJQB 4ZVQB 1JJ4A 1XNRF 1M1HA 4EZ6A 3RTVA 4ZVTB 4ZPAA 4USJC 2XZTB 4WCEQ 1D9AA 1TTHB 2HHQA 1KP6A 4DX8H 1S0OA 3HKWA 1TKZB 3AFGA 4FPIA 2DR7A 5CXTA 2VH7A 1RAIB 4WBFA 3O1LA 2HAFA 1S0VA 1YI2S 4UTGA 5KFWA 2G0JA 4XK8C 3L7OA 3FSXA 5HSPA 2ROPA 1KFDA 4K8RA 1VK8A 5CQGA 4IH5A 4PZVA 4DX7A 3BQ0A 5D0HA 2EEYA 2LDYA 2GQ2A 2OKQA 1UFWA 1LXJA 2E5LJ 2MY7A 2OMOA 3H5XA 1VK3A 1C1CB 1BQXA 1ZAVA 1NUEA 3EGWB 2QFJA 8AT1B 4V19X 4LRDA 2XGPA 4KV8A 1NSPA 5KG0A 3US5A 3DU6A 4DSLA 2AD9A 2UUCF 5EDWA 1OY8A 5ETOA 4DPWA 3PX4A 1RTHA 5GMKa 1RACB 4UF4A 3GPAA 1TL1B 4F50A 2U1AA 1CULB 2UUAF 2DGXA 4ZIVA 2B56A 1KC8T 3AHPA 3C19A 3EE3A 1FX4A 2FB0A 2AX0A 3AJDA 3M2UB 1KR4A 2RS8A 3KJQB 5FD1A 2A6MA 1FKOB 3RAQA 3Q8YA 4MKYA 2EKYA 4EGLA 1FTRA 4OZ0A 3BGFA 1FE4A 1BD6A 3OR1A 3RYLA 2HGNA 2MKIA 1JLAA 4ENOA 4RLEA 1IKWB 3EVMA 4B3OB 1MNEA 2MQQA 4ES1A 3IBWA 3I4HX 4K5RA 4J7CA 3DLHA 3M2RB 5M2RA 2DHHA 4K4SA 1UWAA 3SCJE 4ECUA 3IS9B 1UPPA 4X66J 2MMYA 3KMSA 3MEDB 2XS5A 1IR2A 4C8ZA 2N82B 3I5CA 3MTKA 4DR5J 1MSWD 3KNGA 3DMJA 1Q4RA 2XSFA 2VONA 4I1TA 2YWEA 1U25A 4F0HA 1RAOA 4ZVPB 4K59A 3KHLA 3CCLS 5IWAJ 2DYAA 1DQ9A 4RUHA 3C16B 5K9FA 1U1LA 4XIUA 1TAQA 3ENAA 1SC6A 2FZGB 2CQ4A 1OJ4A 4ZP6A 1URNA 5CYMB 1T94A 1XMQF 3KLHB 2HHHJ 3UWTA 2VPZB 4M5GA 2VU5A 4ZP9A 1IM4A 3EM1A 1IBKJ 3GYXB 1XNQJ 1NKBA 3PYFA 1VQ5S 2B7CB 3QGIA 5GAEI 1X4EA 3BO4A 1FDDA 3WX4A 4L3KA 2R7QA 4TY8A 4DV7F 3SI8A 1W26A 1U1OA 4J9RA 2R9LA 1M5VC 3K58A 3FDSA 4WFAQ 2YKNB 3SDEB 2V2QA 4EBEA 3QO9A 1EAYC 2DRBA 2NXCA 2WSEC 2GJFA 1BLUA 2GO9A 5L1KA 2PGCA 3NGUA 3OHAA 1Q5YA 1IKYB 4NMXA 4X4NA 3T9ZA 4EK2A 2DY9A 4OHVA 5EUHA 3KOAA 3R2DJ 2I2YA 3A8EA 4LR8A 3IXQA 2UVWA 3D1HA 1VC6A 5HQLA 2W25A 4J90A 5IC6B 2WW4A 4DV2F 3N6LA 3PFOA 1M5HA 4LF7F 3TW0A 2RF2B 3KG0A 1M1GA 2J6TA 3TANA 3D9BA 3KMQA 1P27B 1IKXB 1FA0A 1WOPA 3LP0A 5HN0A 4U7UD 2DD8S 2XO7A 2BMBA 3T5HA 2Y1LB 3WIUA 2KXHA 3MOJB 5KFLA 4K50A 1V5IB 2OD4A 4DHVA 4QWEA 2RQCA 2YWFA 4NCAA 4DMZA 1WF1A 1NK6A 2GMHA 1UETA 1FKPA 1PIEA 3Q0AA 1VQSA 4OZNA 3PCOB 4CLUA 4ECSA 3I0SB 1O5JA 4JV1A 1N34F 1JKHA 5CAAA 4ZK7M 5J1NA 4PWDA 2AT1B 3ET6B 4B3TF 4LF5J 3UN5A 1X60A 2ATCB 1F1BB 4A8MP 2ZD1B 2Q43A 5D4LA 5BJRA 2VBXA 3LOUA 2QJ3A 3T19A 5CYQB 1WDDA 4CO2A 4WE1B 2EBEA 1X4AA 4J9LA 3GYNA 3BQ2A 3BBFA 5E3RA 1GTEA 1NKEA 5D8HB 3MI7X 4QYRA 1DLOA 1S9EA 4C0BA 2NYHA 4N47A 4B9MA 3BR8A 4NXNJ 5H9EJ 2VQEF 1SPBP 2KRBA 3TAPA 3OD2A 2B6AB 2X3DA 4QU7A 4F0MA 3DLKB 5F8HA 4NLYA 3EMTA 1Y5IB 4CLLA 1UFKA 5GADU 1M5SA 1NMEB 4D3GA 4EBDA 3TUPA 1QSLA 3C14A 3PV8A 2D1CA 4JI1F 1N4LA 2BYCA 4TLRA 2DNHA 4WP8A 3F41A 2HQCA 4JV5F 2HFNA 2H5JB 2QA4S 2HBRB 3CIZA 3GJTB 3JAMU 2ROEA 3NLCA 3KNAA 2W8KA 3CC7S 2J8AA 3FJ2A 1H7XA 4NMLA 1H6KX 1Q8BA 2N4CA 1RADB 4MH8A 3POTB 2MZTA 1XR7A 1XEZA 2QA4G 4YR0A 2ZBIA 2WVDA 2CQ0A 2R7VA 2W9AA 1UPMB 1U47A 1UEKA 3R5DA 2JEFA 1P1TA 5E3PA 1U8SA 4KH0B 1RHMB 1X7VA 2DNOA 4ZLJA 3CO0P 1EQMA 4YHHF 1Q0NA 5B7WA 3RAMA 1TFWA 2UZAA 1RA7A 1HW9A 1HLWA 2IVYA 3OFGA 2FVPA 3KDOA 4ZKAA 2BUNA 3MECB 1HI1A 3SSQA 4EO6A 2UXCF 2BJ3A 3QLHB 4KHPF 1KVIA 3T3FA 2KXFA 5L39A 4KO0B 3T6JA 1ICEB 3DRXA 5GMEA 2C28A 3QSYB 5DM7Q 5IM0B 5KFKA 2CJAA 2QMUB 1EARA 4KTQA 1DAXA 4DR3F 5ETLA 3P4UB 2DO4A 3Q8SB 2L3MA 1U24A 2Y9HA 1F0XA 4O3NA 2XYPB 4M1KA 1VR6A 3OL9A 1SJ4P 5E2QA 4NOHA 3VAJA 4IR1A 4I4BA 3I5BA 2VFRA 4C8LA 1TL3A 4OYOA 2Y1JA 4NXMF 1QUVA 2W9BB 3Q23A 2WBRA 1QTNB 4FKYA 2PFDA 4DL5A 3LP2B 1MMDA 5FIIA 3HSGA 2XWYA 2O01C 3C15A 2LP4A 4IO9Q 1U26A 4NASA 2P6SA 2PI5A 2KT3A 7FD1A 3GCXP 4ECRA 1TKZA 5K5MA 2E1RA 2ZNYA 1XR5A 1RJJA 2Z2ZA 2DCLA 1HPZA 1TKDA 1T95A 3VAFA 3J7YU 3MCMA 5E41A 2COLA 1S12A 2WW8A 1TL4A 2BABA 4RW8B 2H1YA 1B0PA 3T5KA 2HAIA 3K59A 5HJYA 4DV6J 3W5YA 2YKMB 1HR0F 1IKVB 3GG1A 3V81B 1N36F 3RW6A 3DLGB 2R8GA 2XY6A 1SUQB 3NGKA 1CSJA 1F3FA 2POKA 5C25B 4UW2A 1RWWB 2QLXA 3GE9A 1M90T 1TKXB 4M5NA 2WVBA 3ZNJ1 1N48A 3NWGA 1FWLA 1YRUA 2DNNA 4Z7YA 4XDCA 1P8GA 3ULHA 3PW0A 1WG4A 2WRMA 4ILLA 4YS2A 4O3SA 4JI8F 4WKRA 2BA9A 2AEJA 3QBCA 4A8YA 4LFAJ 1U1QA 1OWXA 3HULA 2V9WA 3PYDA 4NRTA 4JV2A 4FF4A 2V50A 2F4FA 2K7KA 5B08A 2V9KA 1MMNA 2EG1A 5KFTA 1VQ4S 5L9XA 2MDAA 3T1YF 4UUWA 1T03A 1YJ7A 2VFVA 1SKRA 1TK5A 3K8WA 3M2UA 2EFGA 4YP3A 2FC9A 1K1QA 2XNRA 1FKOA 5DRKA 2NLWA 2YWHA 2QIFA 3OTCA 4RW6B 4WIQA 2ZC4A 3HDSA 1HNXJ 3EUNA 3AH6A 2UU9F 2FUG9 2MKHA 3MM7A 3IRXA 4C8NA 2MZRA 2ZBPA 4ED8A 1VOMA 5CA5A 4RNOA 2P9GA 4LMZA 5LSLA 1VISA 1QVGR 2KVQE 1VMBA 2XO6A 2VBYA 2HVEA 2KM8B 1RT5A 3IC1A 1RT2A 1Y0HA 2J0WA 2JDJA 3GIRA 2Y8WA 3HK2A 1IR1A 2CJBA 2BANB 4L73A 2O66A 5JVGQ 2OD6A 2RDIA 2VA3A 2YTCA 1E6VA 2KJVA 2ALZA 1JXVA 1SH2A 4ECTA 3LO3A 5HK4A 2F4VF 2JLFA 1S1WB 1UVIA 4UZBA 1OPZA 4OX9F 1R27B 2J8SA 2JEGA 1NDKA 1SB6A 1S49A 1SBRA 3Q86A 3DGVA 1GAOA 2P2CB 3WIVA 2HHTA 4C8MA 1SXLA 2GGPA 1KQKA 2EC2A 2JVOA 2VG6A 2FJVA 2YH0A 2O3DA 1C0TA 5D0EA 4B02A 1YVFA 1NJIT 4MIBA 5KT6A 2BV3A 1N33J 2GVZA 1HWJA 4J9VA 1FCAA 4C4WA 4YB7A 1T9XA 2QLJB 4LFBJ 2BJEA 4I69A 3D6HB 2KHDA 4IDKA 1SL1A 2E1CA 2HHUA 3PW2A 4IOBA 4P72A 1YBUA 5JMNA 1I3OB 3WC0A 2JHEA 3FEZA 2DNPA 4XDDA 2DPJA 2V68A 1B70B 3KK2B 1NPRA 1RKIA 2CQ3A 1NDCA 2OPSB 1RWPB 2CJYB 4JOUA 2J5AA 3PHEA 4USUA 2CDQA 4RW4B 4DL7A 4OI6A 4MFBA 1KVJA 3SFGA 4B3SJ 3D3BJ 4PQUB 2R7XA 4KC5A 1YRTA 3MMJA 2EFNA 5C7PA 1YBAA 4URQU 2XWXA 5A8KB 4GVBA 2CIMA 3OXLA 2NZ4A 4FF1A 2EBGA 3TJ9A 1OO0B 2VL1A 1WSVA 2DPIA 2RF2A 1J5EF 2NSBA 2FVQA 4PAAA 4H4MB 2JFKA 4ICLB 5KT2A 2LQ8A 2JEIA 4C9DA 5GAHI 3GMGA 2CQPA 3C8YA 1VQYA 1S9GA 3BSNA 2IM2A 3OR2A 1SI9A 5HANA 3EXYA 1WI6A 4P7TA 4P75A 2HMIB 1HNVA 2LA6A 2W2QP 2CA9A 2V4JB 1G7CB 5F41A 2XQCA 1RKJA 4DUZF 1WG1A 4NLUA 4ZPVR 1M5OC 5KAKA 3CDBA 3AAWB 4LBPA 2H65B 4XO0A 3D6MB 2BR0A 2R2SA 3I0RB 1VLYA 2K8GA 2PC6A 3DYAB 2DGOA 4Q45A 3T9NA 3KUEA 2A2CA 1QVFR 4WE1A 5LXRA 3GV8B 1S1XA 2JZ5A 2BW2A 2F1FA 3AXMA 3V4IA 4DV1J 4LT6A 2NZCA 2WB1D 1NJWA 4ZVHA 4I2PA 1LW2B 4IUFA 2Z0GA 4Q0BB 4FXDA 1KWMA 1LFPA 4CH1A 2C1EB 4KH1B 4O3PA 4YR2A 3ILOA 4K0KJ 4DEZA 5FLXU 3PIPQ 3N01A 4PYAA 2RRBA 5C5JA 4ZVFA 1IQZA 3CWJA 3QWPA 1M1KT 1WC0A 2YKQA 4YR3A 2W7PA 3B4DA 2YVSA 4JI7J 2B6AA 2IVMA 1I94F 1XNRJ 2H48B 1K0VA 3DHXA 2JX2A 2KZZA 2QRRA 4NLGA 3HHLD 5EX3A 4DQSA 3T1HJ 2HWHA 1T9UA 2MQNA 1QAIA 1KONA 2OI2A 1HL6A 3D0GE 2KO1A 2H3EB 1W2IA 1DURA 3D5MA 4H4KC 4DL6A 1HMVA 5KFZA 4DXLA 2NXJA 4RW9B 1GMWD 3VGVA 3D1QA 1AB8A 3B82A 2B0GA 1HBOB 1OPIA 5D0GA 1QE1A 4X64J 2F7VA 3UD5A 4ED3A 1RUSA 3MGJA 1XMOJ 2DNKA 1LWCA 3DXSX 4QIWD 4ZHRB 4CIOA 1JJCB 5THWA 5KFBA 3C6TB 2KXNB 2HNZB 1T8EA 3TJAA 4URGA 3E01A 4ZCLA 3DGPB 3N4WA 1REVB 5KFGA 5J2NA 2WVCA 1TV6B 3LH2S 3ZTSA 4BWJA 2XSJA 2GCFA 1RB0A 1FX2A 1TK0A 9ATCB 2DHXA 4LF6F 4Z2XA 2KJWA 2UUCJ 2EC0A 1JXLA 3M8QB 4JI2J 1VHFA 2WSCC 4LBIA 3QJJA 2LCWA 3GIIA 1W25A 3T41A 1X5SA 3TZYA 4WWSA 4NCGB 5E3AA 1B3TA 2UUAJ 2K06A 2IDEA 5HATA 4P7VA 4RNMA 3Q22A 2F8MA 2ASDA 4CNZA 4J9SA 2J0QD 2RJZA 4HT5A 4AFFA 3M9NB 2GS8A 4ZS6A 2V94A 4A48A 3WZ0A 1R8AA 3H25A 1ZH5A 2OPPB 3GJRB 3QNWB 3BSCA 2VJVA 3MM5B 3I96A 1NK0A 2XG8A 4IFVB 4DL0C 1B0TA 2YNFB 1RAFB 5LSRA 4DR4J 2GHVC 3AD8C 2JL9A 2CPDA 3DRYA 3LANA 3N6NA 2QV6A 4KQZA 2V4QA 2W9BA 1FRMA 1KKHA 3IAS9 3ILIA 1YITS 4TNOA 5GVQA 1I5OB 1MW7A 3W66A 1JNZB 1NSQA 3H7HB 1GMUA 5KFOA 3HO1A 2HHWA 4J9UE 3G8SA 4I7FB 2ZOMA 4I6WA 2OHDA 5C2GA 1VQ7S 4H4OB 5LSOA 4B9VA 3I9V9 3HD2A 4X4VA 4I6AA 4JI0F 3C3LA 5L8RC 1K8AT 3HFZB 5MAOA 2I1RA 3A12A 2ZE2A 3ILLA 4RW8A 3D66A 4BC9A 3FCVA 2VUGA 4ZLLA 5EN1A 3AA9A 2GVDB 1U1PA 1IKVA 2B4VA 2NXEA 1KBRA 3RBDA 4P52A 3DLGA 4PXBA 2Q6BA 2IJNA 2QT7A 2KM8C 5C25A 4MKBA 1ELOA 4X2BA 2B43A 3MD3A 3KJVB 1SCJB 4O44B 3BPSP 2FJWA 2YNHA 4ZIWA 3PVXA 4OHZA 3FSYA 2BJ9A 4A8QA 1RT1B 4P71A 2F8HA 4DV7J 4B9SA 3R5JB 3QQCD 5L9NA 2R2UA 1LWFA 2FJBB 2Z56B 5DQGA 2DXDA 3ILJA 5JUMA 2KG0A 1YK9A 1RBLA 3DDNA 2CKWA 4HH0A 4TVAB 2UXDF 1NPPA 3PHTA 5B0FA 3FKBA 2JRSA 5ETTA 5H9FK 2NCKL 4WFNQ 3M6XA 4Q5VA 2CJ9A 2GC8A 3QT7A 5I42A 2M88A 3M8PA 4TYBA 2VQFF 5I3UA 3R1HA 3VHQA 2XYGB 2HQGA 1URRA 5IS2A 4DX5A 2ZH6A 1RSCA 3TVZA 2XTJP 5A6PA 5DDPC 4RW6A 3W62A 2AU0A 1V3ZA 1WC1A 2BQ3A 4DV2J 1MROB 5KFCA 2WBMA 4HDGA 5H9FJ 4LF7J 3HI9A 1FNOA 4R5PB 2VKRA 4O4RA 3CD0A 4DPYA 1K1SA 2RU3A 3I55S 2ZWPA 5RUBA 4OMFG 3A3NB 1WORA 1S79A 3ZZYA 3BGRA 4O23A 4WJBA 1WG5A 1RP5A 2MSSA 2WOMB 1UVMA 2E1AA 1IN0A 2B9EA 3HXMA 1PO6A 4BDPA 1R6VA 4TU7A 4F8RA 3LAKA 4OX6A 3NS5A 2D41A 3E3XA 3ZC4A 2LVWA 1R89A 2KN4A 4LF8F 1CJTB 1Y11A 1SJ1A 1NB2A 4ANEA 2HIQA 2PMWA 2GX8A 3MR5A 3LUYA 1N34J 3NKYA 3ISZA 4DR2J 5GAEU 5I3PA 4UQTA 2V8DA 1RHQB 4B3TJ 4CI0B 3TWZA 1CS4B 4WK3A 1G3OA 1X5TA 3HF5A 4RW7A 1HNIB 2QG9B 3W9JA 4KT0C 1NCLA 4A8SA 1S7HA 4FN5A 4NLWA 2FPHX 4WK1A 1Y5NB 2O1PA 1RXOB 2RKIB 3CMAS 3DM2B 2B9WA 4B3RJ 4P2FA 1TMMA 1JLEB 3GIJA 2GV1A 4FXVA 2FLLA 3P8BB 1H7WA 5L1JA 1M0SA 1S6PA 4ETXA 1RAEB 3FCWA 2BRLA 1WC6A 1AW0A 1TVRB 1YHQS 3LPEA 2N7CA 4FBUA 2IIHA 2ZDPA 3A8KA 2VQEJ 2R7RA 1VRTB 2G0CA 5GAGI 4QR1A 4QPTA 1S57A 4I0WA 3CPWR 4RU9A 4O3OA 1WDTA 5IZHA 3UDVA 3Q8PB 1SQFA 3NS6A 3NGSA 5K14B 4C0OC 3HPOA 5J2PA 4OI4A 1RYRA 4JI1J 2Q79A 5KG7A 2OPSA 4JV5J 2GAHC 2R4FA 3UD3P 3OTOF 5G4DA 5B0GA 1FJGF 3ZTRA 2B8QA 3K8VA 3OVSA 4N56A 4K7QA 3JYTA 2AV5A 1RWVB 1NJYA 4UOCA 5A8KA 1I6JA 3VV2B 1T05A 2HPUA 2V4RA 1H3DA 4E8UA 3HSDA 2V34A 2VIHA 4P74A 2J9DE 3H98A 5D15A 4H4MA 4ICLA 4IFYB 3JSMB 3SV4A 3J7A1 3CCRS 4YB6A 4DR1F 1HNZJ 2RU9A 1YZ7A 4IR9A 1F2HA 2X51A 3EYZA 3EZOA 4YHHJ 2CJXB 2V4JA 1HQUB 2AW0A 2BJ7A 4B3MJ 3MFIA 2PN6A 4N76A 2QSWA 4AQYJ 3QYYA 2UXCJ 4U9RA 4L72B 1RTIB 1SL0A 4LQ3A 1NDPA 3OXGA 1VQLS 3HSJA 1DTTA 3CB4A 2JFDA 4J9MA 3G6XA 2HG4A 2KYXA 2ZHBA 2BKNA 4RL1A 4PXDA 3FBEA 3RJMB 2FLOA 2G1DA 3IM9A 3MMBB 1RWOB 1JJHA 4HI2A 2RNEA 5HJXA 3C6UB 5C24B 2M2BA 3DLEB 2OFGX 2B51A 2ASYA 3KK1B 1F60B 1AA1B 3BYRA 1JLCA 1NZ8A 4KPCA 3HT0A 1LW0B 5B09A 2R8IA 3IWNC 4X4PA 3D6FB 1K44A 2DGQA 1JJ2R 4Q0BA 4CP5A 4KKOA 4QQBA 1RT7B 2HURA 2CPJA 2KT2A 3CXCR 1NHKL 2VPXB 2V2VA 1RT3B 1WKLA 1CVJA 4L75A 7AT1B 2ZHAA 4NXMJ 3QAEA 2JC0A 3PYEA 2IA6A 1S77D 2I0XA 3G2XA 2G9OA 4U6PA 1S99A 1SC4B 3FFIB 1H73A 4TXSA 1S1UB 2WONB 3FBFA 1WHXA 2QLFB 2E7WA 4AD6A 1F2GA 3Q8UA 1NU4A 3DRPB 3L7PA 2E44A 2AKWB 2GA7A 3U7JA 3QIDA 4NA1A 1EHWA 5CD4A 4DN0A 3G87A 1PAEX 1J5OB 2P9CA 1O6XA 4RX6A 3SFUA 3RZAA 4OL8A 4USVA 1RT6B 5DLFA 2BACA 4ID8A 3SEOA 5IOLA 3SQGA 3FQLA 5IT9Y 3CJRA 4NLVA 3BB5A 3HHDA 1HBOA 1QY7A 1ZM2A 1XK8A 1ZM4A 3OSNA 1RT4A 1HR0J 1N36J 4WYLA 3D4JA 5E5NA 3TQ1A 2FQQB 3C6TA 5HBMA 1HNWF 5DO2A 3M7VA 4ERDA 2BXJA 3NS7B 1J2VA 4TQSA 2DXEA 4LRFA 2ASJA 2DITA 3MPVA 5B0CA 2U2FA 2G2YA 1IBLJ 3OL8A 1S6UA 5LT5A 2R7SA 2MXYA 3EVWA 2HHXA 2Q66A 1P6TA 2JEJA 5BXIA 4PUOA 1Z2ZA 4DS4A 4TYAA 2B8PA 2YNIA 3M8QA 4CTAA 3ONQA 5BYRA 3Q24A 1Q7YT 5AJ3J 3HHLB 4ANCA 3MUVP 3KHRA 1FDAA 3T1YJ 4HEA9 4DSIA 3K89A 3NY0A 4F7VA 1RI7A 4C8YA 1EJ7L 5KFAA 2E7VA 3MAQA 2LEBA 3M32A 3K5LA 2KFYA 5L1IA 5HVHA 4LSLB 1RWXB 2MZJA 2XMTA 2ILYA 4KSEB 2HS3A 2OPRA 2AIRB 4YN3B 4UY8T 2KVIA 4K4YA 2ZUGA 3V6DA 4IFVA 5J2QA 2F8EX 2E5JA 2YNFA 1RQ0A 2YWGA 1UWBB 1AZSB 3GIKA 4TQRA 4Q44A 1R6YA 1DZ5A 1S6QB 4KGMA 2UUBJ 4DQRA 2L08A 2IFXA 5J2MB 3TZXA 4RR5A 2GIQA 3FCHA 2VHGA 1KLMB 4C48A 2L9NA 3L3CA 5CCLA 2OP5A 4F3QA 2OEMA 4ZMMA 3UVJB 1NEEA 4EBCA 1NO8A 2CWKA 1HIYA 3F73A 3WC2A 1A7GE 4F4WA 3EDQB 3T1AA 3THTA 1PBUA 4ZN1A 2LQ5A 1CJVA 3QFWA 1RWMB 1KRPA 3ZZRA 2CQ2A 2IAJB 1CLFA 2FC8A 3CC4S 2ZKUA 5D78A 3KTQA 4OX9J 4EZ9A 5M2PA 2CWXA 5DDQC 4GC7A 4FYWB 5HQ8A 1U48A 2ZH2A 3W2WA 4DSEA 2HK3A 5CZXA 1WEXA 1F9EB 5KOWA 1R0CB 2RVJA 1PJ6A 2HK2A 2HSEB 4RO0A 5A8WB 3UN3A 3VGTA 3MAHA 2J9EA 4DX6A 4WTYA 3BDEA 3MURP 3BKTA 1VBXA 4EO8A 2OLWA 1FERA 2RE1A 1C4AA 3LALA 5SUHA 5LJ5Y 2UVRA 3ADAC 3VGUA 4FYYB 4OHWA 1Y7PA 2XY5A 4H54A 3EPIA 3TP2A 3GSIA 1RT1A 1Q8IA 3CUNA 2DB1A 1WI8A 4CLTA 2ZM6J 2HFVA 4ID5B 2H4WB 2J9CA 3BPDA 4DR7J 3GLJA 4CH0S 3VALA 4Q2LA 3BJYA 1A6LA 3GV7B 1FDNA 2EVZA 4DF8A 1TQLA 2XM3A 8RUCA 4Q2MA 4ECVA 3DNCA 4JI3F 4G6VB 1IUJA 3VCDA 4OJHA 2W24A 1FRKA 2LU2A 2OH2A 3KKFA 3K7RA 2LDIA 3UNYA 3MMCB 4C98A 5IQ6A 1N5SA 1ZTTA 4OZ3A 3HVTB 2HS0A 3KDNA 3MPYA 2PIIA 1NH7A 2I38A 4GC6A 4JP8A 4FXWA 3BGLA 2OO4A 2K3IA 4DPXA 2IJRA 1G2EA 1C0UB 2UXBJ 1G4CA 2OMLA 2BKPA 2OGUA 4WIIA 4QR0A 3BREA 3UDLA 1SQGA 4XPEA 4F4KA 1OY6A 5E3CA 4IG3A 2MJUA 2YKPA 2X3GA 1T9WA 1WTFA 4OJ1A 4OZLA 5KFRA 1FWPA 4YDDB 1RA6A 3DRRB 2BKOA 4DCJB 3BKUA 2A6OA 1CJTA 4OYBA 4DUZJ 2IJFA 1PG5B 4K4WA 3MUMP 3DOKB 1PGZA 1YKWA 1LWEA 4DUYJ 2XEXA 1VS3A 2DGWA 2E9TA 3QZ7A 3TA2A 1SIZA 2MKKA 1B64A 1NK9A 1X31C 1R31A 2MJNA 5CH7B 2CFXA 3SIPB 2PA3A 2BE2B 4TLQA 4U7CA 1BQNA 3WX8A 4R8UB 2W01A 5L46A 4ZPDA 3LTOA 2D3O1 2HZVA 1FD8A 1CPZA 1JLEA 3SXLA 3MAAB 4XPCA 3R5AA 1FXRA 1PYTA 2UVUA 5KFSA 3D0HE 2MZQA 5KOXA 1N6QB 1EZZB 2AJQA 4ANDA 2DR8A 5DQIA 4R0JA 3VVTA 1JQGA 2XLIA 2V2KA 3NCQA 3QZ8A 3ITHB 4F3MA 4CO3A 2E5LF 4MTPA 2WB4A 3PJWA 4RNNA 3TX8A 1R8PA 3O3LA 3H0PA 3KG4A 3SMZA 2CVIA 2HIYA 2PSZA 3A3PB 3J80Y 2AJ0A 3MMAB 2ZFHA 2LMIA 1SL2A 3GWCA 1TELA 2B9YA 1S1VA 3KWMA 1QLNA 1DQ8A 5U47A 4L6V3 4P6QA 3BKFA 3CIMA 5GAHU 2DRDA 5IQQA 3KYLA 2XHWA 2VPYB 4ZVUB 3MM9A 3M4XA 4EI2A 3HZEA 2QA1A 4QYZK 1XWLA 2BW7A 1JLFB 1F5BA 3IR5B 2VICA 4FVCA 3EX7B 3MEEB 2CPHA 3J81Y 2BEFA 2DISA 1VHIA 1ITPA 3ENWA 4P9SA 2AX1A 4IFYA 2ZH8A 4F04B 3JSMA 1SJ3P 4O4GA 2EG2A 2LEPA 2FY8A 4YB1P 5CABA 3HJVA 3AODA 4QYZJ 1TUGB 3BYPA 3NCRA 4F4AA 2AGOA 2HVHA 1NLKL 4JBCA 4K4UA 5KG2A 3UNGC 3BGUA 4ED5A 3MUTP 1KOOA 3W7BA 4DS5A 5ETQA 3OT9A 3BQ1A 1RTIA 2FHKA 2MYFA 1HHSA 3BN4A 4ZP8A 5ETVA 5IC4B 4OLOA 4X66F 2XMVA 2DR5A 3UW1A 4MJKA 3K5OA 4JUZA 4CH7A 3CCMS 2CZ4A 4HACB 2MZSA 2VG7A 3G82B 4DR5F 3JTPA 2G2ZA 2B4UA 2W9CB 2CQ1A 2BOAA 2DIUA 3FEYB 1NB7A 3LP1B 2A3JA 2VV5A 5KFYA 1TL7B 4ZDNA 2QN6B 1WWHA 3VQTA 2XCAA 4X84A 5IWAF 2ZNZA 3OTBA 2WK4A 2Q6CA 3RG6A 3N0VA 3L9ZA 4RKUC 2XS7A 2RQKA 1DTQA 5AXKA 2Y0SD 1HD0A 3MDFA 5LMUJ 2CDRB 2APOA 4OZ5A 3KK3A 3VAHA 1RWUA 1IBKF 3M2VB 1XNQF 1VIOA 3HHLC 5C42A 1U2RA 4Q43A 3M8SA 2B5JA 3DI6A 3P49B 4NLRA 2P6TA 3OLAA 4DV0F 1GX5A 5HL7Q 3NMAA 3VR1A 4MIAA 2DH9A 2IM3A 3CD7A 2NUHA 5HO4A 1P9YA 3IBFB 3MFHA 2OPQB 1YJ9S 2ZUAA 2SXLA 1DRZA 4JI0J 1BHNA 1K9MT 4PG7A 2XMKA 1FK9B 4LFCJ 1PBAA 4M5IA 1SH3A 1NK7A 4U95A 4DN9A 3H40A 3TUIC 4J9PA 2M9KA 3CCQS 2J0XA 1D09B 4IG0B 4LSNB 3F56A 3J7ZT 1RHUB 1RTDA 2LXIA 4NI2B 2Q3PA 3MR6A 1NXIA 1LOUA 3CVKA 4KGZB 1N0UA 1T3OA 2O67A 5HMWA 3TZZA 3B54A 1TUWA 4GO5X 3X1LB 1E6YA 1AFIA 5K8MA 3KHHA 1UEUA 2ZDOA 3NG8A 3H42A 4ECYA 3H2VE 1TFYA 2J7WA 1T9TA 3IWLA 1NHUA 1AXQA 1PSDA 2E1MC 5ETPA 5KFPA 1S1TB 2ZJQQ 3BH6B 4DLEA 2W1BA 2ZOFA 3JQJA 3SCKE 1JLGB 3SZ2A 5EHHA 4XAKA 1R0AA 4KJIA 4Y3CA 1UCNA 2GIRA 2QGFB 4M5DB 3K5NA 5D3GB 4F2SA 2MSTA 2HVIA 3DDKA 3CJTA 3VVUA 3P45B 1HFEL 1VC0A 2MGZA 4LSLA 4HT7A 2RS2A 3CNQP 3U1MA 4OV6A 1C1BA 3K0JA 5EWGA 4FP9A 1XTZA 1L3SA 5F8NA 1FRLA 4M5HA 2NYIA 3FBBA 1UWBA 4IOAQ 3QAUA 4WKYA 4O3QA 1GFWB 1QM9A 2A2DA 3H5YA 4RUBA 3RBZA 2XLKA 3EVOA 4CWBA 1FFWB 1RTJA 1UFLA 4ED1A 1RAHB 2MQOA 2LA4A 3HVWA 5K8PA 1MLAA 3NGDA 3TEGA 2C2KB 4OV1A 1TKTA 4Y6IA 1SJQA 3M1VB 3BSAA 2PFFB 1JLBA 3H59A 2DBBA 4NXNF 4J37A 3KLFB 1HBMB 1X9WA 1YLXA 3HMJG 4KFBB 3ZXWA 1HW8A 5HLFA 1MG7A 4QWBA 5KT4A 1GK8A 2MKYA 3A3OB 3PIOQ 1XQIA 4CLFA 3ZZ0A 1Q81T 2AGPA 1PC4A 1PJ5A 3TRGA 2R2TA 4FF2A 1CJKA 1AFJA 4ED7A 4GMKA 4OJGA 5E7OB 1T9YA 3FUYA 3MM6A 1V9OA 3SCIE 4WFBQ 3ZNUA 2ILZA 1Z4UA 3K2YA 4ZLPA 2HVDA 2BM1A 3HFKA 4NYPA 3W8GA 1RBOB 4NZ0A 4N8NA 1IJFB 1HI0P 1YTYA 1QAXA 3KLGA 4DFKA 3NBPB 4N77A 3T5LA 4HI1A 2K1RA 3AY0A 2YWKA 5I4MA 4PEOA 4TN2A 2Q1LA 3Q8VA 3EZ5A 3FSIA 2DTJA 3M30A 1FJGJ 1EIYB 2Y0BB 2HRUA 4L74A 1RTHB 4CYUA 1D8YA 3FRYA 4EUVA 1D9DA 3HLUA 2BJ1A 3G8TA 5T7LB 1NJZA 3GFXA 3ISND 2H4YB 3W64A 4CO0A 1YJNS 2C2OB 1LEOA 1X4BA 5FDLA 1TK8A 4C3KA 1MN9A 4QCLA 4X4UA 2BX6A 2AYBA 5LMNJ 1FEEA 4ED2A 1Y4ZB 1GX6A 1RZMA 4DR1J 4OI1A 4QW9A 3IR7B 4KBIA 3IP0A 2LXFA 1JLAB 4ILMA 4JI6J 3CEDA 3DFEA 3DRRA 1YBTA 1Y9OA 4YEAA 2V8VA 3B4MA 3IAM9 1FWKA 3N5BA 3U02A 1FTCA 2FD2A 3MEGB 1X9MA 4NLPA 2AJ1A 1AYEA 5HMYA 2C22A 4ECXA 2QMWA 2C2EA 2PMHA 2VDIA 3RBXA 2HZAA 4NLXA 2C2ZB 3L09A 5B0BA 1HBNA 2GZOA 3QIPA 2CNOB 2XB2D 3PR4A 2YH1A 4DR6J 3DMJB 3K5PA 2YQ3A 3CCUS 5GAGU 2VOPA 3TX0A 3NXZA 1RISA 3VQSA 2MB0B 4ELVA 3CMQA 4B9LA 2LEAA 3TA0A 2EFVA 3G86A 1X8DA 4F36A 1FVQA 1P1LA 2HNYB 2YKOA 1GT8A 2HRTA 4PR6A 3T5JA 2CQDA 4DCOB 1WC3A 3LGHA 4KE5A 2EI5A 2AEFA 4C3MA 1TAUA 3KLEA 4OYAA 3E2EA 4HDHA 2GQQA 2QA2A 2V5HG 3CJ8A 3Q8QB 3IGVA 2ADCA 3O2IA 3BH7B 1KLNA 2PT0A 1CG2A 3W63A 1S9FA 4IOCQ 1XERA 2ZWOA 3D2WA 2JOQA 3V5RA 1DFDA 4DPUA 1T3NA 4LFAF 1PAUB 1OIAA 1N56A 3MR7A 1UZHA 2MKSA 3OXFA 3W1YC 3QJLA 1EP4A 3QO9B 4BCAA 4MK9A 3EZUA 4X4OA 3TAMA 4DZDA 1X4FA 1L3UA 3GR0A 4USWA 1F5CA 2FGCA 2GQCA 3GILA 2YNGB 3DN9A 1VQ8S 1ROFA 3DC2A 4PG8A 4UT4A 3ZO7A 4M63A 3IBCB 4AYBD 4KRWA 2N3OA 4DL4A 2AZ1A 1O8BA 3LPYA 4NPOA 3PO4A 1HNXF 2R8JA 4F25A 2R7TA 2V6AA 3PDNA 4FS2A 2PO4A 3R3TA 2MZ1A 2QSFA 3LP0B 3UD4P 3GJSB 1BQMA 1RGVA 1WOOA 3OFEA 2I9SA 4JYAF 3G4SS 2EFOA 5DG9A 3F44A 2A10A 1V3RA 4G1PA 4D3HA 2XMUA 1S10A 4ZVEA 4JI5J 4Y2IA 4DSKA 4OQJA 3IA0A 3HSZA 4Q7AA 1VQPS 2WCXA 4HACA 3G82A 2ATLA 2CPZA 4BC7A 2FJXA 2W9CA 3A8JA 1WF2A 1S7IA 3ZFVA 4RWXA 2I6WA 1JKHB 3W5XA 4DOZA 1PYSB 3KXDA 4RBUA 3ENVA 1XR6A 3TZWA 2HBYB 1UKUA 4Q8FA 3CC2S 3RB4A 4LBHA 4USHA 3G9CA 5HAOA 2BDPA 4C6AA 4LF4F 4QJVA 3HM9A 1GH8A 2CNNB 1U0SA 2HHVA 2Z4PA 1TMJA 2XS2A 1B7FA 3GYGA 2G2OA 4X65F 3GTYX 4OYMA 1C1CA 2XGQA 5DG7A 5F8IA 4QBUA 1F3VA 1N33F 1ZZFA 1EB0A 4F26A 3TUZC 1DLOB 3I56S 4WF9Q 1FRIA 3EGNA 3U1LA 1QAYA 1S9EB 1Q95G 1FRXA 5AXMA 4CLPA 4GKKF 4AXJA 2VF3A 2CAJA 3BZQA 1TR0A 2QL9B 4MMOA 3GB0A 4RJVA 3MTJA 1NZAA 1VGYA 4NYZA 3PTWA 2CPXA 5DM6Q 5A76A 4X4RA 2M70A 2KRRA 1FF2A 1TL1A 1KOHA 2CNKB 4QIGA 1CULA 2C3UA 1Q5VA 4OFZA 1H0HB 3GQCA 2F5GA 4NL5A 2XYHB 2HVZA 4LSNA 1R8HA 3PO5A 2B9XA 1YX2A 4CDIA 2DJWA 2V2ZA 4CM2A 4B3SF 4J5OA 2FLPA 3VWSA 2ZJRQ 4DU7A 2ZBRA 4U8VA 4YFUA 3PEHA 1RWNB 1DBDA 1NRKA 2IC3B 1D9FA 4FYDA 4ZITA 1DARA 1QUPA 2CPIA 2CQIA 4FYXB 2GHWA 1IKWA 2KYZA 4PQAA 3D67A 4LF1A 4B3OA 3Q89A 2W7AA 4UOGA 4FNIA 5HROB 1H2TZ 3M2RA 1YG0A 2WVFA 4X62J 3H8YA 2XMMA 1S1TA 3IS9A 5ETMA 1D1UA 3R9LA 4DZ6A 1NM2A 3MEDA 4KAIA 4NA2A 4JI3J 3L4BC 3R8YA 2X1FA 2PEBA 1HQEB 3H90A 1QSYA 2JLEA 3KLVA 2JNJA 3AA8A 1VBZA 1SH0A 1VQ9S 4CZCA 3TQEA 4GKJJ 2H5IB 1YDLA 4OI2A 5KT5A 4DUTA 5M2UA 3C16A 1X4CA 4WXOA 3DXBA 5KFDA 2YWWA 3UR3C 1BWVA 1R43A 2AJ2A 1W2BR 2BJ8A 2FDNA 4Y34A 1PKUA 4MK8A 4E98A 2V69A 1BC6A 3HVAA 5CYMA 4FBTA 3L7UA 1BXNA 4YUDA 2W8LA 1S48A 3KLHA 1OSDA 2E1PA 1BWEA 5KFMA 5KT3A 2YQ0A 1UVJA 2EPIA 4LUBA 4FS1A 2ZHOA 3DU5A 4ZJOA 2H54B 4X4QA 4JV0A 4K0KF 4FYVB 2DCUB 1TL3B 4WTOB 1EETB 4PG4A 3T6BA 2RUSA 2Y3YA 4FPRA 4QIVA 2HBZB 1FD2A 1MU2B 1T0TV 2HQIA 3KG1A 3P5TL 4KFBA 3C15B 1U1NA 2ACMA 2RSQA 1X4DA 4GVLA 1YJRA 1S4FA 4M94A 4AL5A 1CC8A 3HP6A 2CADA 2HNDB 3CCTA 2YKNA 3SDEA 5F8JA 4TY9A 4IQMA 1Q78A 2C2NA 3T1HF 2HGLA 1HPZB 1HHTP 1IKYA 4U8YA 5ETRA 4ZCIA 3OFHA 4HTIA 4UUXA 3ZZZA 3PEJA 1HWKA 3LAMA 3GSDA 1RCOB 4N7TA 1VRQC 4X64F 4PG6A 3RGIA 4LREA 1KN6A 1K47A 1ZM3A 1RK8A 2VD3A 3WBZA 1XMOF 4IH6A 2WAQD 1IKXA 3PR5B 3H4DA 6FD1A 3DLJA 2HHPA 3P6YC 5F0WA 3EJMA 3UQSA 3NBPA 2OAUA 1ZTWA 2X1GA 4CT9A 4A4JA 1C2PA 3H2LA 2FVRA 5T41A 3RAXA 1VQKS 2P5VA 2A0FB 2F40A 5J1EB 1L3TA 2M0GB 2OSQA 2XZDB 4TU8A 3M6WA 4E0DA 3RU0A 4TU9A 4JI2F 3D7SB 3VTIA 2QO3A 1KTVA 1QAJA 4A8XA 4NLTA 3ZTOA 3I0SA 2KDOA 4K4TA 1N54B 2QYGA 1RCXB 1GNKA 1RAAB 5T7LA 5IT4A 1T03B 2M4MA 3ET6A 1RHRB 3HKZD 4DSJA 2ZD1A 5ETKA 1S0NA 2KB2A 4F2RA 1ZA2B 1YJWS 2L41A 3IMQJ 5IT0A 2M8HA 2VC1A 3R27A 5CYQA 3CD5A 2KL8A 2CYYA 3QGHA 2XMAA 4WZQA 1D3WA 2MQPA 3HCXA 3MM7B 2DT9A 3IRXB 2UV8A 1AUSL 1HA1A 3AJ1A 2QLBB 3I9ZA 2W4DA 4DR4F 1FE0A 1N32J 3RRHA 1HKAA 1RU2A 3MEGA 1N5YB 4DV4F 4PABA 3FNNA 3UCZP 4NEZA 3IWXA 1RT5B 4UOHA 1RT2B 3HZGA 1SKSA 2PI4A 2PEHA 1EQ0A 1OS5A 3CF5Q 5D6GA 4CLWA 4QW8A 3DLKA 3M8ZA 4I2QB 1E6VB 3W5ZA 1UW4A 2RHQB 2MEWA 2EWHA 4C8KA 1V3SA 2WVEA 4JI4F 4CM0A 3V4MA 3R5CA 4A8WA 1JB0C 2O5DA 3PW7A 4OZ2A 1KEKA 1H74A 5KFVA 3BO2A 1MWZA 3F0NA 5AE3A 4EMDA 2HNYA 2GGPB 5DJBA 1C4CA 1MMLA 3D0IE 2CPYA 2VG6B 4DFJA 2K2PA 2HS4A 3S01A 3POTA 1XBWA 3J7AN 1C0TB 4BLGA 4ECWA 2A18A 2IRYA 1WSRA 2GVZB 4O3RA 5DQHA 1UJ6A 5J1PA 3CMES 3VAMA 2ZH1A 2MLXA 3JAMY 4B9UA 1HWIA 3B78A 5SZTA 4DV0J 1J27A 4J9NA 3GV5B 2UVVA 1Y10A 1H2UX 4IDKB 2N3LA 1NKCA 1VBYA 5B0AA 3I4PA 1VQNS 3MECA 1UA1A 3IM8A 2DGVA 3QLHA 1U0HB 3PG9A 3Q2TC 4YY3F 4KO0A 1U1KA 4KHRA 1UMJA 2VPWB 3BS9A 1TZ0A 2ZJPQ 2YNGA 5IM0A 3VAKA 4MFBB 2CJQA 3ELHA 3AQOA 5BYQA 2CQGA 2GJ2A 4P2SA 2W2MP 2HYIB 2FHJA 3FRZA 4ED4A 3PJ9A 4GVBB 1FEHA 1S4EA 3R6GB 5GMDA 4C8OA 1WEZA 1WHVA 3HJFA 4H4KA 5C2CA 2E5GA 2DO0A 3TAQA 2WTFA 5KG5A 3QRPA 5ITHA 4GO7X 4M5LA 2RDJA 2EW9A 5D4PA 2OUGA 1S9GB 2LQ9A 2NS1B 3OR2B 3LP2A 4CLKA 1HNVB 1WEYA 1UJ4A 4K4XA 4QWCA 2HBQB 1VC5A 1IJEB 1LK7A 2R7OA 3TOQA 2QMXA 4NX9A 4WP9A 3UE2A 2ZH5A 1KTQA 2IM1A 3TVKA 3EGZA 1VQMS 1DQAA 2HQDA 2VFSA 4DR2F 3X3UA 4HHJA 4OHXA 4PG5A 3RB0A 2LFVA 3BR9A 3ENQA 1PILA 2HLUA 2EXUA 1TP7A 2ZITA 3DDIA 5D0RA 2BQUA 5LOQA 4E2FB 2MY8A 4LQ9A 1S1XB 5H9EK 1UVLA 4HTJA 4B3RF 3V4IB 2YKMA 1XMQJ 3VZIA 2Z2LA 4ZCMA 3V81A 3LQVA 2GMJA 1U8WA 1H2VZ 2N4DA 2HLTA 4I2PB 1DHMA 1SUQA 2JVRA 3PM9A 2ROGA 1N52B 1NK8A 4Y28C 5LJ3Y 5B0EA 4LJMA 3QT6A 2DEIA 3HT3A 4LIRA 3KUHA 3QPIA 2V63A 1TKXA 1FRHA 2Y8YA 2XI2A 4B17A 3D68A 4RZRA 2BZ2A 1FO1A 2NR0A 1LKZA 5AXLA 2RQ4A 1IQTA 5G0RB 3R5GA 5F0UA 2CZVC 3QWUA 2G4BA 2OEKA 3HHEA 2IVFB 4CLSA 3Q8RB 2I5JB 1UP1A 3THPA 4B08A 3G71S 3NNHA 2KFNA 5E0OA 2HEKA 2ZKTA 2GO8A 4W4MA 3CJ5A 2E9RX 1Q79A 1WKKA 2ZBCA 3MOZA 4DFPA 5F8MA 1D8ZA 2H9ZA 4RBTA 3H4BA 5DZ7A 2HKEA 5E3QA 1HMVB 3AOAA 1ACMB 4ATNA 3CSKA 3SCLE 1QE1B 2IC3A 3Q2SC 2AQ4A 3KJNB 4DL3A 2NXNA 1FNMA 3UCGA 2IRXA 3SQOP 2WZ1A 1Q82T 4WFXA 3JQMA 3TUJC 2AJFE 1LWCB 5DGBA 1RWKB 3N28A 1FDBA 2IA0A 2D9PA 3OTEA 3PXGa 5HROA 3E01B 3DRSB 3G6ES 2DH8A 1HNZF 1Y3JA 4PXEA 4NYOA 1NK4A 1HYSB 5J2NB 1I51B 4HVZA 3W9HA 3FMWA 2HHSA 1RYSA 1X4GA 2XSJB 3PACA 4B3MF 4LR9A 2BANA 1FI4A 4AQYF 3NGRA 4V19J 1WC5A 1APSA 2C3PA 1HBUB 2IMOA 2GHPA 1HQEA 1SKUB 1Z1ZA 4WPAA 1EKSA 1S1WA 4PXCA 5KFEA 3ZZOA 3GR1A 2N7YA 3M8YA 3HVRA 2MQ8A 1TL5A 1UAWA 4M5MA 2DGSA 2ASLA 3CW2C 1Q8KA 4USTA 3W2VB 3RR7A 2C2MB 4J9OA 5KTQA 4URSA 3LWMA 4NRUA 3MXHP 2X1BA 4CO5A 5EGYA 4C0HA 4LRCA 4ECZA 4M5KA 2DNMA 2C2RA 5KT7A 3PKMA 1P9QC 2D3OR 4DQIA 3S6EA 4ETZA 4OYPA 1H38A 3LW5C 1EETA 1ZBTA 1NH8A 2OFHX 1QTMA 2IHR1 2XHCA 3MPWA 5F3TA 4M95A 2FLNA 1MU2A 4RUAA 1X0FA 2DGTA 2JC1A 2YBVA 4I67A 3QT8A 4IYQA 4KR0B 4IRDA 1KHWA 1U6ZA 1KQFB 5KG3A 5IFMA 3GFHA 2HNDA 5BR8F 4OI3A 2G1HA 4FDFA 3SYZA 2AHOB 3KK2A 4RWWA 3GCWP 1R7IA 3OHBA 4DV5F 2I8EA 3MCNA 4C11B 2HGMA 2X7IA 1JLQB 4RW4A 5A2QU 3CCVS 4F3OA 1M5PC 2ZE2B 4PQUA 1B99A 4ZVGA 2RT3A 3RW7A 4BBYA 3M9OB 3I87A 3CULA 3D3CJ 4YDXA 1K73T 1H72C 4C3LA 1KFSA 2OEJA 1HHQA 4OI0A 1N8RT 2HWIA 1FJ7A 2YPZA 3CJ2A 4OIXA 1YJVA 4HHHA 1WF0A 2EKNA 3UN2A 3TO8A 4ES3A 1VQ6S 1VDHA 1KS2A 2YNHB 3D1OA 4HH1A 5A0YB 3UDCA 1JWWA 3U27A 1IBLF 2HMIA 3MCSA 5J1EA 2ZVIA 3R5BA 3UR0A 1LWFB 1MN7A 3ISNC 4ZJQA 3NGTA 5B0DA 1CEZA 4NA3A 2AGQA 1Q1KA 4Y2KA 5AJ3F 4KHPJ 2RHSB 2E66A 2QE5A 3KHGA 4ZCKA 4PKDB 3I0RA 4MKVA 4QZVB 4WP3A 3OW2R 5AE2A 3DYAA 2VB6A 1F9HA 1WJ9A 3OFFA 5I42B 3M8PB 5I3UB 3QGPA 5LM7E 4DR3J 2K7JA 4V1Ak 4AXIA 4A47A 1FJEB 1VIXA 1SC3B 2NUUG 1OQ3A 4K4ZA 1OYEA 1IM6A 5DG8A 1LW2A 1Y5LB 2E9ZA 2XMJA 2RH3A 2Y1IA 1FNXH 5DETA 3OJSA 3BGRB 1RTZA 2UUBF 1N5YA 4JYAJ 4RUCA 2FZCB 3IG1B 2QFIA 3CJQA 4YMEA 4USKA 1GMVA 4ZPWR 1SIWB 4Y2AA 4I2QA 2R7UA 3OLBA 2C2DA 4DDFA 4QIEA 3AD9C 1Y00A 3DOLB 1UW9A 4OYZA 5FLXY 4ZOSA 5F3ZA 2OTLS 4WFZA 4QWAA 2AYEA 1KD1T 5KFNA 4Y0FA 1UJ5A 3CGIA 2RRAA 2RMLA 3LWLA 4RW7B 1XJWB 1G6BA 4A8FA 2KI2A 3S7RA 5LXYA 2MKCA 2AZ3A 1G1XA 2JLGA 2BM0A 4RW9A 2CPEA 1X5OA 4LF4J 4LR7A 5HQMA 5KFXA 1VQOS 1MWQA 2P9EA 4RNFA 4JB8B 1VLOA 1AUDA 3FK4A 5F8LA 2DK2A 3SSRA 2CRLA 4X65J 4W90B 3ZTQA 3OBIA 4ZHRA 2AP6A 4QPXA 3JTOA 2XY7A 5DZ6A 2HNZA 1S6PB 1IBMF 4NZ6A 2KU7A 2V67A 3M8WA 3DGPA 3H5UA 2FJAB 4GKKJ 1REVA 4WFYA 2RIJA 2R8KA 3I5AA 1WUUA 1TV6A 4DV3F 1JIHA 2ZM6F 3CCZA 6FDRA 1CQNA 4JI8J 4ECQA 4X4SA 1OYDA 1OSCA 3VF0B 2LKZA 4DR7F 5CCMA 5KFHA 2QX0A 1WHYA 3NNAA 1U0HA 2Z8QA 1FHTA 1U2FA 1PYOB 1HQ2A 3GU0A 3PRBA 2ZZNA 2QL5B 5J2PB 3KUGA 4NCGA 2FJEB 3OL6A 1B4SA 1LNQA 2UUTA 3CCES 3AOCA 2NXUA 3AOBA 2BBEA 1BY9A 3E51A 5KG1A 5IV3A 4IH7A 3JYTB 4RU2A 1U1MA 2GW8A 3OQ2A 4NE9C 3MPDA 2OPPA 2H5EA 3M8RA 1RHJB 1T05B 3KLIB 4AUKA 5D4OA 1S0MA 2UU9J 1B0VA 3MM5A 4OYIA 2MQMA 2UXBF 1REGX 4EFAC 3CCJS 1MWYA 2KG1A 2RD5C 2KT5A 1PC5A 3JSBA 2UUWA 2WHOA 1S76D 3BBBA 3KFWX 3M6VA 2YX1A 4ZP7A 3V2UC 4OJ3A 4IQXA 3SSSA 1ZETA 4DCPB 1YWXA 1RE1B 2QTWA 3UPFA 2C3MA 1JNRB 1EX8A 1U49A 5D77A 2FHMA 2DXFA 4BHQA 3MHYA 2CG8A 4N41A 2DNQA 4I7FA 4MKAA 2W2NP 1WOSA 1NSAA 4OZ1A 5KFUA 3RUBL 1DTTB 2F4VJ 4F02A 4DUYF 2ZC3A 1NNDA 1ZOTA 4H4OA 2WSFC 4LVNP 1RAGB 1YJTA 4LF9F 1IWGA 4A8OA 2W4PA 4Z37A 1UZDA 1FT8A 4UQGA 4C7QA 5A8RB 4L76A 3VZHA 3O6QA 2C3OA 1ZYQA 2FGOA 2GVDA 3QSIA 3IGNA 2ZBQA 2IPOB 3EXCX 1JLCB 3V6JA 3K17A 2MKJA 2Z2MA 2YY3A 4ED6A 2RB7A 2VBZA 4Y2MA 3D54A 2F65A 4KIAA 2VZ9A 4KKOB 1R8CA 3KJVA 3QRRA 4O44A 4B9TA 2ADBA 4YB5A 4R25A 2CPFA 2CQCA 3FBCA 1UA0A 3RRGA 3TEHB 4Q8EA 4A8KA 1KQGB 3CJKB 3MM8B 5G0RA 2IMWP 4CLYA 3NEKA 2Z58B 1ZZNA 3JS9A 5AXNA 2V8GA 5HI7A 3ZZTA 2YPYA 1UL3A 2I5JA 5IT9U 1V6HA 3DKDA 2V8HA 1L3KA 2LXUA 1RDRA 1BUXA 2DNRA 2ACYA 1WHWA 1N5TA 4ELUA 2BE9B 3NRBA 1ZPVA 1X5PA 2CNLB 4N5SA 2ZH3A 2HRYA 5KFIA 2OIHA 2M52A 2MTLA 1JX4A 1VYAA 1Y3KA 4ZPCA 3SQGB 3TA1A 1QSSA 4LVOP 5ETSA 2BVZA 4NLOA 3R7NB 1RT4B 2LECA 2DGUA 1I1GA 3TARA 1MROA 3PY8A 3FQKA 4M8LA 1U2CA 4UZCA 2VFTA 4R5PA 1A0OB 4YQWA 1J5EJ 3L95X 1CJUB 5HBMB 4KGKA 1RU1A 3DRSA 2VFUA 1U7LA 3BO3A 1N88A 1PJ7A 1HYSA 2WOMA 5KG4A 4UY85 1RABB 2CJKA 2FVSA 2R8HA 1FXLA 2LLZA 4PUOB 4C2MA 1U1RA 4Z7CA 2YNIB 4CTAB 2BE7D 4ILRA 2QZ8A 1HBUA 3NOGA 2VASA 4FZVA 4PWWA 3R1LA 2GNKA 3CDAA 1CS4A 1N5VA 2ZH7A 1HNIA 3HD1A 3W2VA 3BV8A 4IRCA 3S1TA 3OPKA 3M9MB 3M32B 1UVKA 1HI8A 5E33A 3OVBA 2DH7A 2RKIA 3DM2A 2ZZMA 3TNVA 3B8HA 2VBWA 3PFEA 2DR9A 4DBQA 2OPRB 2ZOGA 4DQQA 3V6DB 5J2QB 5AT1B 5F9LA 1GXTA 5LMUF 4HYKA 1BE4A 3A8IA 2GJIA 1TVRA 4DV4J 2RDDA 1FESA 1DJ0A 2ZVSA 3CJ4A 4W98A 1WELA 2YXLA 2YX4A 4B9NA 3UO0A 1VRTA 2IRUA 1KHVA 3PW5A 2R7WA 1JK9B 3OTDA 3JB9k 1I94J 4DU8A 2XCPA 4CLZA 3H5SA 3IRWP 1NPKA 1S97A 2A1BA 1GXUA 1CJVB 2HQFA 4EU0A 3LGNA 2EK6A 5K14A 2CVEA 4JI4J 1H98A 3GFYA 2JSXA 4KB7A 5HP1B 1HWUA 3GONA 4OYWA 4QIFA 2F9JA 7FDRA 4DF4A 4C11A 5T14A 5DGAA 1JLQA 3BM7A 1YZ6A 3W60A 2X1AA 3W2WB 3K57A 4LFCF 3RB6A 2M8DB 3SV3A 2OJ3A 4Y00A 1QJHA 1CC7A 1YRXA 5BYSA 3GG0A 1SVDA 2L9WA 3E8OA 4FF3A 5A2QY 3CJ0A 3VAGA 4BWMA 4I6YA 5L1LA 5A0YA 2C42A 4PYDA 2D7SA 3UCUP 2IBKA 3ICLA 5CD4H 3QMQA 3BSOA 3CDEA 1HQUA 3EICA 4LF6J 2D3UA 1Q53A 2XMWA 4ES2A 2MLYA 5D4NA 4OX8A 3W61A 2IBOA 3PRDA 4ED0A 3OUYB 4A46A 5K20B 4NLQA 4YY3J 1NAQA 4F4YA 3DCAA 3I31A 4M5JA 2HZCA 2ABYA 3MMBA 4G1QB 1KVKA 1XMBA 2PA8D 1YJUA 3C6UA 4FVMA 5C24A 2FTRA 3R7SB 2PD1A 3DLEA 4LRBA 1VFJA 3EDRB 3KK1A 4HLBA 5H1SV 1BMQB 4ZLNA 1CQMA 1LW0A 1V5VA 3D28A 1ZM9A 4K2JA 5HVGA 2BQRA 3UFCX 4W92B 3O5TB 2MLZA 1RT7A 2CG4A 1WD6A 1RT3A 4PPZA 1T11A 1QD1A 4IG3B 4HHUA 1VI7A 3IG1A 2VA2A 3MD1A 3S8SA 2HHHF 2HW3A 4MYTA 3PX0A 3HHKA 2J6UA 3HX9A 4IKAA 5ETNA 3TVYA 3FFIA 4CO4A 3J81j 1S1UA 1VRUB 2WONA 4PPDA 3RB3A 1XC9A 5HVFA 3TR5A 4ZVOB 2VJUA 2KZMA 3DOLA 3BGOP 3DRPA 3G8QA 4K4VA 3I32A 2BRKA 4G65A 3PJXA 3NAHA 4Y2CA 3ZZPA 1LWEB 4LRAA 4J9KA 1FFSB 4P10A 5EX0A 2EFQA 2E7XA 1J5OA 1VJWA 2XLJA 1VCTA 5L38A 3QT5A 2FJDB 3V6KA 1RT6A 3ETMA 1QDUB 2ALYB 5EWFA 4K2XA 2ZH9A 1BQNB 1LWXA 2DHAA 3DOMB 2DIVA 3M05A 4EYHB 1F9FA 2DHGA 1LK5A 3OSPA 2FYXA 2VKZG 4Y65A 3NWRA 3J80U 1IVZA 1F6TA 2YQ1A 3FZBA 1ZAWA 4HKQA 2AWZA 3DLLQ 4U7UK 4IO1A 3FGVA 3O44A 4OX7A 1ZS6A 4XTTA 1ZPWX 5K8NA 5GADI 4ITSA 2B4PA 3W9IA 4U96A 1VJQA 3QGGA 4MIWA 1X4HA 4DPOA 3CD6S 3AXKA 1YGYA 2NQPA 4IRKA 4RNHA 4R0EA 3HHLA 2E5IA 3N6MA 1S1VB 2UXDJ 1SC1B 4P73A 1WNEA 3CE8A 3J81U 1VBKA 4J9QA 3OVAA 4ER8A 4NZ7A 5KFFA 2F63A 1K0TA 2VQFJ 2DVIA 2EK1A 2QC3A 5AE1A 1B7YB 1GMWA 4CCHA 3MM9B 2VG5B 1R3NA 1Q7LB 4LF5F 3KLIA 1SQEA 4LIWA 3JXOA 8ATCB 3DLBA 6AT1B 2ZEJA 3AT1B 4EEYA 3MZIA 4O4GB 2GMLA 4DG1B 1AZSA 2IYGA 5LMNF 1WKJA 2CZ9A 2L48A 4O0IA 2R3VA 1S6QA 4DSFA 3VGSA 2QL7B 4ZPBA 5J2MA 1NSKL 4UOFA 3CDUA 1KLMA 3FZ2A 4JI6F 3GP9A 2DRAA 5IV4A 3UVJA 2F3JA 2HWTA 5DDRC 1RAJA 2CQBA 2LQJA 4LF8J 2XULA 2NSCA 3WDOA 1SV5B 1WTBA 3ZZUA 2IAJA 1T7PA 2J7UA 3H2UB 1OMSA 2HFUA 1CBKA 1S59A 1FFGB 2HFSA 3LGMA 1U4BA 2VG7B 4X4TA 3NCPA 4DR6F 2LYVA 5A8RA 1L3VA 4QU6A 1U02A 2DKOB 3BDPA 3QRQA 5A8WA 1KNZA 3GZ7A 4USMA 4OHYA 1O51A 4HL9A 2D74B 3R2CJ 2Z30B 1FJCA 5CHCB 2B3TB 3MR2A 1DTQB 5EWEA 3MWBA 4EYIB 4I68A 3UDEA 3PNIA 4ELTA 4CRJA 3I82A 1D0EA 3J7Z5 1SKWA 3KK3B 3CJKA 3MM8A 5C42B 1HD1A 2B5JB 2RUGA 3DI6B 4ID5A 1OY9A 2R42A 2FY1A 1YSJA 1ZA1B 2XC9A 4KPYA 4MK7A 4OLPA 4TKTA 4YOEA 3FVYA 5BR8J 3NP5A 4KV8B 4DI6A 4CNYA 3G6VA 3J7YI 4P2MA 1F5AA 3KJFB 3PZPA 3ETOA 4DV5J 4ZVSB 2AMCB 2K3KA 5ADZA 2RAQA 5KFJA 3OTOJ 5LL6d 3EGVA 1OQ6A 1UEVA 2AYMA 1UTAA 1NJXA 4LF2A 3N5FA 4O0NA 1O0PA 3C66A 3MMCA 3HVTA 2KFZA 4DQPA 3O8WA 3NL0A 3BF4A 4K5SA 1RTDB 2UV8G 3QATA 1GTHA 3LA0A 1C0UA 4F0KA 4U67Q 4ALZA 1CJUA 3AB2B 2W7OA 2XZWA 3GFZA 3H20A 4OZJA 3PKYA 5F8GA 1ZAXA 2BOPA 5HMXA 3OR1B 4G3IA 4G1IA 1A9NB 4F4ZA 1E6YB 3MPUB 1R8BA 2ERRA 2AF6A 1U45A 3QJPA 2MHNA 3NAIA 3D6TB 1LV5A 1IBCB 3CCSS 3DOKA 2PMZD 1SJRA 4JI5F 1S5ZA 3A13A 1WC4A 1X0PA 4ZPTR 2PDAA 5DS7A 1R0AB 3B6BA 2J7KA 3P5BP 2YKAA 3PYGA 1KQSR 2BE2A 2MGZB 1RHKB 4R8UA 1U6FA 2R2RA 4AE5A 2CQHA 3I6PA 1NK5A 1C1BB 4AL7A 3C2PA 1FKAF 2DEJA 1GQEA 3NNCA 2XBPA 1JMTA 3AJ2A 3K5MA 3MAAA 3THVA 4I56A 9RUBA 2IDLA 1N6QA 4WZMA 2Z2YB 3EWGA 1TUVA 1IR0A 3N9UC 4DV6F 3IFEA 3NMRA 4DLGA 2KTQA 3ITHA 3QFHA 2DR6A 3IN5A 1RTJB 3TYTA 3RRKA 2YX7A 1TU0B 4NEYA 3EPGA 4KGVB 5JJBA 3AQPA 1TKTB 3P3DA 2LQBA 2JH3A 1LFWA 2XI3A 3MMAA 4ZN3A 2HFZA 1NBEB 4EWTA 1JLBB 3WHIA 4TY8B 4ZJLA 4DJBA 4F67A 5HP1A 2RQMA 3CJSA 5KFQA 1YQHA 3CDWA 3FMBA 1XIQA 3MF5A 5HLFB 2DNLA 2ZH4A 2JWNA 4S0MA 5HMZA 3HFVA 3PRVA 4N8OA 2DY1A 2VODA 4DFMA 2E5HA 2NPFA 5IXUA 1JLFA 4RPFA 2BJDA 1CJKB 3MEEA 4WYWA 4FNHA 2J6SA 1SJFA 1LXNA 2RRNA 3R7BB 5I3QA 4CT8A 1T9VA 3MM6B 3C46A 1HNWJ 3CCWA 3RBEA 1IBMJ 2QLWA 4DL2A 2J9DA 2CUYA 4DV3J 3RR8A 2HFOA 2AEMA 1NHVA 3ZTPA 1KSPA 3JSRA 2KHCA 3KLGB 2QYCA 3BEGB 3M6UA 3OUYA 1N5QA 3G96A 2D9OA 4X62F 2K1RB 2NPIA 2G0IA 3HHNB 2F9DA 2PE8A 2VOOA 1YIJS 3MCOA 4L3NA 2RILA 3UI3A 1Q86T 1AROP 1FKPB 4NWBA 5FJ4A 4I64A 2LU1A 3M30B 4P2XA 4G1QA 2XNQA 3MR3A 4PWUA 3CTRA 3JSYA 4DWIA 4CYUB 2J76E 3LP1A 4WXWA 4C97A 5JXSA 1TL7A 1JXEA 4PWDB 4CQ1A 4GKJF 2DNGA 3IO1A 1X9SA 2B4OA 2P8IA 3BN7A 1RLDA 1RBAA 3OL7A 5FDLB 2V8PA 1WACA 2Z57B 3TJ8A 5F9NA 2VC0A 1U09A 3PW4A 1BGXT 2D3ZA 2OELA 2C3YA 3BBCA 4NLDA 2M7SA 2D69A 4CO1A 3M2VA 1VRUA 2ZZTA 2IY5B 2NREA 1EKRA 5CZVA 4KHMA 3R6LB 2HQ3A 2DHSA 3CJ3A 1S72S 4F4XA 3P96A 4LFBF 1DY3A 1M5KC 3V6HA 4PCQA 3NOCA 2E29A 4AT1B 4WU2A 3W8PA 2MHEA 4QR2A 3OJUA 1N0VC 1IWAA 2AYGA 2MPUA 4ZVRB 3JQKA 2IYIA 2M3DA 2OPQA 2AJ4A 2L9DA 1IXKA 3DHWC 1HBNB 4LF9J 5DLGA 1HWLA 4PRFA 3QIPB 2JJ4D 2FZKB 1FK9A 3WQPA 2UP1A 4LSZB 4USIA 2V0NA 2DNYA 4QWDA 3C14B 4FKXA 4AL6A 3DOMA 3FC9A 5MLCV 1KDNA 2GFFA
chains in the Genus database with same CATH topology
5CABA 3GP9A 2AZ3A 4HR2A 3FBBA 4UOHA 3FCVA 1EHWA 1LEOA 4FKYA 4ANCA 1NCLA 1HHQA 4WBFA 4F4AA 3ZTRA 1PAEX 2B8QA 3EE3A 1HLWA 3B54A 3EMTA 3FBEA 2HVEA 3MPDA 4DZ6A 1NLKL 1MN9A 3EVOA 1VYAA 5CAAA 3BBCA 2BX6A 3NGUA 3Q83A 2DYAA 3ZTOA 4F36A 3ZTQA 3ZTPA 2HVDA 4DI6A 3ENAA 5IOLA 3Q8YA 4EK2A 4DUTA 1S59A 2AZ1A 2DY9A 3ETMA 4C6AA 1S5ZA 1JXVA 1W7WA 3ZTSA 4KPCA 3NGRA 1K44A 1LWXA 1MN7A 1PKUA 3FCWA 3VGTA 3BH6B 3BBBA 2VU5A 2ZUAA 3B6BA 4CP5A 4ENOA 1XIQA 1NUEA 3L7UA 3EM1A 3WX8A 3EVMA 3FBCA 1WKKA 3BH7B 2HURA 3NGTA 1NSQA 4O0NA 1NDKA 3BBFA 1BHNA 1NHKL 1BE4A 1NDCA 3ELHA 3Q86A 4S0MA 1WKLA 3PRVA 1UCNA 1NSPA 2DXEA 2DXDA 1S57A 1F6TA 1HIYA 4W98A 3Q8VA 3Q89A 3DDIA 3JS9A 3VVUA 2DXFA 3G2XA 4UOGA 3PJ9A 3VGUA 1NB2A 4ANEA 1WKJA 2BEFA 4ANDA 5C7PA 3EVWA 1NDLA 3FBFA 1XQIA 3DKDA 3NGSA 3FKBA 3EJMA 3EICA 3VGSA 2NCKL 1B4SA 3VVTA 5BXIA 1B99A 1F3FA 4FKXA 3Q8UA 3FC9A 1NPKA 1BUXA 2B8PA 1NSKL 1U8WA 1ZS6A 1KDNA 4UOFA 3VGVA 1NDPA 3R9LA 3GPAA 2CWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CAB A;  3GP9 A;  2AZ3 A;  4HR2 A;  3FBB A;  4UOH A;  3FCV A;  1EHW A;  1LEO A;  4FKY A;  4ANC A;  1NCL A;  1HHQ A;  4WBF A;  4F4A A;  3ZTR A;  1PAE X;  2B8Q A;  3EE3 A;  1HLW A;  3B54 A;  3EMT A;  3FBE A;  2HVE A;  3MPD A;  4DZ6 A;  1NLK L;  1MN9 A;  3EVO A;  1VYA A;  5CAA A;  3BBC A;  2BX6 A;  3NGU A;  3Q83 A;  2DYA A;  3ZTO A;  4F36 A;  3ZTQ A;  3ZTP A;  2HVD A;  4DI6 A;  3ENA A;  5IOL A;  3Q8Y A;  4EK2 A;  4DUT A;  1S59 A;  2AZ1 A;  2DY9 A;  3ETM A;  4C6A A;  1S5Z A;  1JXV A;  1W7W A;  3ZTS A;  4KPC A;  3NGR A;  1K44 A;  1LWX A;  1MN7 A;  1PKU A;  3FCW A;  3VGT A;  3BH6 B;  3BBB A;  2VU5 A;  2ZUA A;  3B6B A;  4CP5 A;  4ENO A;  1XIQ A;  1NUE A;  3L7U A;  3EM1 A;  3WX8 A;  3EVM A;  3FBC A;  1WKK A;  3BH7 B;  2HUR A;  3NGT A;  1NSQ A;  4O0N A;  1NDK A;  3BBF A;  1BHN A;  1NHK L;  1BE4 A;  1NDC A;  3ELH A;  3Q86 A;  4S0M A;  1WKL A;  3PRV A;  1UCN A;  1NSP A;  2DXE A;  2DXD A;  1S57 A;  1F6T A;  1HIY A;  4W98 A;  3Q8V A;  3Q89 A;  3DDI A;  3JS9 A;  3VVU A;  2DXF A;  3G2X A;  4UOG A;  3PJ9 A;  3VGU A;  1NB2 A;  4ANE A;  1WKJ A;  2BEF A;  4AND A;  5C7P A;  3EVW A;  1NDL A;  3FBF A;  1XQI A;  3DKD A;  3NGS A;  3FKB A;  3EJM A;  3EIC A;  3VGS A;  2NCK L;  1B4S A;  3VVT A;  5BXI A;  1B99 A;  1F3F A;  4FKX A;  3Q8U A;  3FC9 A;  1NPK A;  1BUX A;  2B8P A;  1NSK L;  1U8W A;  1ZS6 A;  1KDN A;  4UOF A;  3VGV A;  1NDP A;  3R9L A;  3GPA A;  2CWK A; 
#chains in the Genus database with same CATH topology
 4IG0 A;  3LF0 A;  2OSR A;  4HR2 A;  4NI2 A;  2W2P P;  4BS2 A;  3TI0 A;  2EFP A;  1Q16 B;  2KH9 A;  2FHJ D;  1PCA A;  2KKH A;  4J91 A;  2M5Y A;  4NCB A;  1UVN A;  5JVH Q;  3KLE B;  1W7W A;  4ZA1 A;  3R97 A;  1AT1 B;  5KG6 A;  2B7B B;  3CT9 A;  1U6B A;  4MAK A;  3G6Y A;  4GRS A;  5CYJ A;  3A1Y G;  4QOT A;  4KYZ A;  2MQL A;  4WU3 A;  2QEX S;  3JTN A;  1JLG A;  2VDH A;  2IM0 A;  4MT1 A;  2FHO B;  3AD7 C;  4RBV A;  2H51 B;  2W4C A;  4M5D A;  5D3G A;  3IR6 B;  1NDL A;  2W2O P;  3PX6 A;  1S6O A;  2VG5 A;  1EP4 B;  3FEX B;  3OV7 A;  5DDO C;  3TAM B;  5K8O A;  4KY3 A;  1FVS A;  1T02 A;  1FRJ A;  3W3S A;  2G13 A;  4MYU A;  2FVC A;  3W65 A;  3N79 A;  4DG1 A;  1R0B G;  4KGX B;  3Q83 A;  3SBM A;  3A4T A;  1ULR A;  2DNZ A;  1RLC L;  4NLS A;  1Z2L A;  4DV1 F;  2Y1R I;  3CO9 A;  2FIU A;  2J0S D;  1Q8L A;  2GAG C;  2OTJ S;  1N32 F;  3GIM A;  1LQ9 A;  1GEH A;  1FXD A;  3AB4 B;  1BQM B;  1L5U A;  1HAR A;  4OYX A;  4DPT A;  1SV5 A;  3M1V A;  3MEK A;  3VAI A;  1GXL A;  1XN9 A;  5A6W A;  2CXE A;  3KLF A;  1HBM A;  3U1N A;  2GIF A;  4JI7 F;  3GJQ B;  4ZVQ B;  1JJ4 A;  1XNR F;  1M1H A;  4EZ6 A;  3RTV A;  4ZVT B;  4ZPA A;  4USJ C;  2XZT B;  4WCE Q;  1D9A A;  1TTH B;  2HHQ A;  1KP6 A;  4DX8 H;  1S0O A;  3HKW A;  1TKZ B;  3AFG A;  4FPI A;  2DR7 A;  5CXT A;  2VH7 A;  1RAI B;  4WBF A;  3O1L A;  2HAF A;  1S0V A;  1YI2 S;  4UTG A;  5KFW A;  2G0J A;  4XK8 C;  3L7O A;  3FSX A;  5HSP A;  2ROP A;  1KFD A;  4K8R A;  1VK8 A;  5CQG A;  4IH5 A;  4PZV A;  4DX7 A;  3BQ0 A;  5D0H A;  2EEY A;  2LDY A;  2GQ2 A;  2OKQ A;  1UFW A;  1LXJ A;  2E5L J;  2MY7 A;  2OMO A;  3H5X A;  1VK3 A;  1C1C B;  1BQX A;  1ZAV A;  1NUE A;  3EGW B;  2QFJ A;  8AT1 B;  4V19 X;  4LRD A;  2XGP A;  4KV8 A;  1NSP A;  5KG0 A;  3US5 A;  3DU6 A;  4DSL A;  2AD9 A;  2UUC F;  5EDW A;  1OY8 A;  5ETO A;  4DPW A;  3PX4 A;  1RTH A;  5GMK a;  1RAC B;  4UF4 A;  3GPA A;  1TL1 B;  4F50 A;  2U1A A;  1CUL B;  2UUA F;  2DGX A;  4ZIV A;  2B56 A;  1KC8 T;  3AHP A;  3C19 A;  3EE3 A;  1FX4 A;  2FB0 A;  2AX0 A;  3AJD A;  3M2U B;  1KR4 A;  2RS8 A;  3KJQ B;  5FD1 A;  2A6M A;  1FKO B;  3RAQ A;  3Q8Y A;  4MKY A;  2EKY A;  4EGL A;  1FTR A;  4OZ0 A;  3BGF A;  1FE4 A;  1BD6 A;  3OR1 A;  3RYL A;  2HGN A;  2MKI A;  1JLA A;  4ENO A;  4RLE A;  1IKW B;  3EVM A;  4B3O B;  1MNE A;  2MQQ A;  4ES1 A;  3IBW A;  3I4H X;  4K5R A;  4J7C A;  3DLH A;  3M2R B;  5M2R A;  2DHH A;  4K4S A;  1UWA A;  3SCJ E;  4ECU A;  3IS9 B;  1UPP A;  4X66 J;  2MMY A;  3KMS A;  3MED B;  2XS5 A;  1IR2 A;  4C8Z A;  2N82 B;  3I5C A;  3MTK A;  4DR5 J;  1MSW D;  3KNG A;  3DMJ A;  1Q4R A;  2XSF A;  2VON A;  4I1T A;  2YWE A;  1U25 A;  4F0H A;  1RAO A;  4ZVP B;  4K59 A;  3KHL A;  3CCL S;  5IWA J;  2DYA A;  1DQ9 A;  4RUH A;  3C16 B;  5K9F A;  1U1L A;  4XIU A;  1TAQ A;  3ENA A;  1SC6 A;  2FZG B;  2CQ4 A;  1OJ4 A;  4ZP6 A;  1URN A;  5CYM B;  1T94 A;  1XMQ F;  3KLH B;  2HHH J;  3UWT A;  2VPZ B;  4M5G A;  2VU5 A;  4ZP9 A;  1IM4 A;  3EM1 A;  1IBK J;  3GYX B;  1XNQ J;  1NKB A;  3PYF A;  1VQ5 S;  2B7C B;  3QGI A;  5GAE I;  1X4E A;  3BO4 A;  1FDD A;  3WX4 A;  4L3K A;  2R7Q A;  4TY8 A;  4DV7 F;  3SI8 A;  1W26 A;  1U1O A;  4J9R A;  2R9L A;  1M5V C;  3K58 A;  3FDS A;  4WFA Q;  2YKN B;  3SDE B;  2V2Q A;  4EBE A;  3QO9 A;  1EAY C;  2DRB A;  2NXC A;  2WSE C;  2GJF A;  1BLU A;  2GO9 A;  5L1K A;  2PGC A;  3NGU A;  3OHA A;  1Q5Y A;  1IKY B;  4NMX A;  4X4N A;  3T9Z A;  4EK2 A;  2DY9 A;  4OHV A;  5EUH A;  3KOA A;  3R2D J;  2I2Y A;  3A8E A;  4LR8 A;  3IXQ A;  2UVW A;  3D1H A;  1VC6 A;  5HQL A;  2W25 A;  4J90 A;  5IC6 B;  2WW4 A;  4DV2 F;  3N6L A;  3PFO A;  1M5H A;  4LF7 F;  3TW0 A;  2RF2 B;  3KG0 A;  1M1G A;  2J6T A;  3TAN A;  3D9B A;  3KMQ A;  1P27 B;  1IKX B;  1FA0 A;  1WOP A;  3LP0 A;  5HN0 A;  4U7U D;  2DD8 S;  2XO7 A;  2BMB A;  3T5H A;  2Y1L B;  3WIU A;  2KXH A;  3MOJ B;  5KFL A;  4K50 A;  1V5I B;  2OD4 A;  4DHV A;  4QWE A;  2RQC A;  2YWF A;  4NCA A;  4DMZ A;  1WF1 A;  1NK6 A;  2GMH A;  1UET A;  1FKP A;  1PIE A;  3Q0A A;  1VQS A;  4OZN A;  3PCO B;  4CLU A;  4ECS A;  3I0S B;  1O5J A;  4JV1 A;  1N34 F;  1JKH A;  5CAA A;  4ZK7 M;  5J1N A;  4PWD A;  2AT1 B;  3ET6 B;  4B3T F;  4LF5 J;  3UN5 A;  1X60 A;  2ATC B;  1F1B B;  4A8M P;  2ZD1 B;  2Q43 A;  5D4L A;  5BJR A;  2VBX A;  3LOU A;  2QJ3 A;  3T19 A;  5CYQ B;  1WDD A;  4CO2 A;  4WE1 B;  2EBE A;  1X4A A;  4J9L A;  3GYN A;  3BQ2 A;  3BBF A;  5E3R A;  1GTE A;  1NKE A;  5D8H B;  3MI7 X;  4QYR A;  1DLO A;  1S9E A;  4C0B A;  2NYH A;  4N47 A;  4B9M A;  3BR8 A;  4NXN J;  5H9E J;  2VQE F;  1SPB P;  2KRB A;  3TAP A;  3OD2 A;  2B6A B;  2X3D A;  4QU7 A;  4F0M A;  3DLK B;  5F8H A;  4NLY A;  3EMT A;  1Y5I B;  4CLL A;  1UFK A;  5GAD U;  1M5S A;  1NME B;  4D3G A;  4EBD A;  3TUP A;  1QSL A;  3C14 A;  3PV8 A;  2D1C A;  4JI1 F;  1N4L A;  2BYC A;  4TLR A;  2DNH A;  4WP8 A;  3F41 A;  2HQC A;  4JV5 F;  2HFN A;  2H5J B;  2QA4 S;  2HBR B;  3CIZ A;  3GJT B;  3JAM U;  2ROE A;  3NLC A;  3KNA A;  2W8K A;  3CC7 S;  2J8A A;  3FJ2 A;  1H7X A;  4NML A;  1H6K X;  1Q8B A;  2N4C A;  1RAD B;  4MH8 A;  3POT B;  2MZT A;  1XR7 A;  1XEZ A;  2QA4 G;  4YR0 A;  2ZBI A;  2WVD A;  2CQ0 A;  2R7V A;  2W9A A;  1UPM B;  1U47 A;  1UEK A;  3R5D A;  2JEF A;  1P1T A;  5E3P A;  1U8S A;  4KH0 B;  1RHM B;  1X7V A;  2DNO A;  4ZLJ A;  3CO0 P;  1EQM A;  4YHH F;  1Q0N A;  5B7W A;  3RAM A;  1TFW A;  2UZA A;  1RA7 A;  1HW9 A;  1HLW A;  2IVY A;  3OFG A;  2FVP A;  3KDO A;  4ZKA A;  2BUN A;  3MEC B;  1HI1 A;  3SSQ A;  4EO6 A;  2UXC F;  2BJ3 A;  3QLH B;  4KHP F;  1KVI A;  3T3F A;  2KXF A;  5L39 A;  4KO0 B;  3T6J A;  1ICE B;  3DRX A;  5GME A;  2C28 A;  3QSY B;  5DM7 Q;  5IM0 B;  5KFK A;  2CJA A;  2QMU B;  1EAR A;  4KTQ A;  1DAX A;  4DR3 F;  5ETL A;  3P4U B;  2DO4 A;  3Q8S B;  2L3M A;  1U24 A;  2Y9H A;  1F0X A;  4O3N A;  2XYP B;  4M1K A;  1VR6 A;  3OL9 A;  1SJ4 P;  5E2Q A;  4NOH A;  3VAJ A;  4IR1 A;  4I4B A;  3I5B A;  2VFR A;  4C8L A;  1TL3 A;  4OYO A;  2Y1J A;  4NXM F;  1QUV A;  2W9B B;  3Q23 A;  2WBR A;  1QTN B;  4FKY A;  2PFD A;  4DL5 A;  3LP2 B;  1MMD A;  5FII A;  3HSG A;  2XWY A;  2O01 C;  3C15 A;  2LP4 A;  4IO9 Q;  1U26 A;  4NAS A;  2P6S A;  2PI5 A;  2KT3 A;  7FD1 A;  3GCX P;  4ECR A;  1TKZ A;  5K5M A;  2E1R A;  2ZNY A;  1XR5 A;  1RJJ A;  2Z2Z A;  2DCL A;  1HPZ A;  1TKD A;  1T95 A;  3VAF A;  3J7Y U;  3MCM A;  5E41 A;  2COL A;  1S12 A;  2WW8 A;  1TL4 A;  2BAB A;  4RW8 B;  2H1Y A;  1B0P A;  3T5K A;  2HAI A;  3K59 A;  5HJY A;  4DV6 J;  3W5Y A;  2YKM B;  1HR0 F;  1IKV B;  3GG1 A;  3V81 B;  1N36 F;  3RW6 A;  3DLG B;  2R8G A;  2XY6 A;  1SUQ B;  3NGK A;  1CSJ A;  1F3F A;  2POK A;  5C25 B;  4UW2 A;  1RWW B;  2QLX A;  3GE9 A;  1M90 T;  1TKX B;  4M5N A;  2WVB A;  3ZNJ 1;  1N48 A;  3NWG A;  1FWL A;  1YRU A;  2DNN A;  4Z7Y A;  4XDC A;  1P8G A;  3ULH A;  3PW0 A;  1WG4 A;  2WRM A;  4ILL A;  4YS2 A;  4O3S A;  4JI8 F;  4WKR A;  2BA9 A;  2AEJ A;  3QBC A;  4A8Y A;  4LFA J;  1U1Q A;  1OWX A;  3HUL A;  2V9W A;  3PYD A;  4NRT A;  4JV2 A;  4FF4 A;  2V50 A;  2F4F A;  2K7K A;  5B08 A;  2V9K A;  1MMN A;  2EG1 A;  5KFT A;  1VQ4 S;  5L9X A;  2MDA A;  3T1Y F;  4UUW A;  1T03 A;  1YJ7 A;  2VFV A;  1SKR A;  1TK5 A;  3K8W A;  3M2U A;  2EFG A;  4YP3 A;  2FC9 A;  1K1Q A;  2XNR A;  1FKO A;  5DRK A;  2NLW A;  2YWH A;  2QIF A;  3OTC A;  4RW6 B;  4WIQ A;  2ZC4 A;  3HDS A;  1HNX J;  3EUN A;  3AH6 A;  2UU9 F;  2FUG 9;  2MKH A;  3MM7 A;  3IRX A;  4C8N A;  2MZR A;  2ZBP A;  4ED8 A;  1VOM A;  5CA5 A;  4RNO A;  2P9G A;  4LMZ A;  5LSL A;  1VIS A;  1QVG R;  2KVQ E;  1VMB A;  2XO6 A;  2VBY A;  2HVE A;  2KM8 B;  1RT5 A;  3IC1 A;  1RT2 A;  1Y0H A;  2J0W A;  2JDJ A;  3GIR A;  2Y8W A;  3HK2 A;  1IR1 A;  2CJB A;  2BAN B;  4L73 A;  2O66 A;  5JVG Q;  2OD6 A;  2RDI A;  2VA3 A;  2YTC A;  1E6V A;  2KJV A;  2ALZ A;  1JXV A;  1SH2 A;  4ECT A;  3LO3 A;  5HK4 A;  2F4V F;  2JLF A;  1S1W B;  1UVI A;  4UZB A;  1OPZ A;  4OX9 F;  1R27 B;  2J8S A;  2JEG A;  1NDK A;  1SB6 A;  1S49 A;  1SBR A;  3Q86 A;  3DGV A;  1GAO A;  2P2C B;  3WIV A;  2HHT A;  4C8M A;  1SXL A;  2GGP A;  1KQK A;  2EC2 A;  2JVO A;  2VG6 A;  2FJV A;  2YH0 A;  2O3D A;  1C0T A;  5D0E A;  4B02 A;  1YVF A;  1NJI T;  4MIB A;  5KT6 A;  2BV3 A;  1N33 J;  2GVZ A;  1HWJ A;  4J9V A;  1FCA A;  4C4W A;  4YB7 A;  1T9X A;  2QLJ B;  4LFB J;  2BJE A;  4I69 A;  3D6H B;  2KHD A;  4IDK A;  1SL1 A;  2E1C A;  2HHU A;  3PW2 A;  4IOB A;  4P72 A;  1YBU A;  5JMN A;  1I3O B;  3WC0 A;  2JHE A;  3FEZ A;  2DNP A;  4XDD A;  2DPJ A;  2V68 A;  1B70 B;  3KK2 B;  1NPR A;  1RKI A;  2CQ3 A;  1NDC A;  2OPS B;  1RWP B;  2CJY B;  4JOU A;  2J5A A;  3PHE A;  4USU A;  2CDQ A;  4RW4 B;  4DL7 A;  4OI6 A;  4MFB A;  1KVJ A;  3SFG A;  4B3S J;  3D3B J;  4PQU B;  2R7X A;  4KC5 A;  1YRT A;  3MMJ A;  2EFN A;  5C7P A;  1YBA A;  4URQ U;  2XWX A;  5A8K B;  4GVB A;  2CIM A;  3OXL A;  2NZ4 A;  4FF1 A;  2EBG A;  3TJ9 A;  1OO0 B;  2VL1 A;  1WSV A;  2DPI A;  2RF2 A;  1J5E F;  2NSB A;  2FVQ A;  4PAA A;  4H4M B;  2JFK A;  4ICL B;  5KT2 A;  2LQ8 A;  2JEI A;  4C9D A;  5GAH I;  3GMG A;  2CQP A;  3C8Y A;  1VQY A;  1S9G A;  3BSN A;  2IM2 A;  3OR2 A;  1SI9 A;  5HAN A;  3EXY A;  1WI6 A;  4P7T A;  4P75 A;  2HMI B;  1HNV A;  2LA6 A;  2W2Q P;  2CA9 A;  2V4J B;  1G7C B;  5F41 A;  2XQC A;  1RKJ A;  4DUZ F;  1WG1 A;  4NLU A;  4ZPV R;  1M5O C;  5KAK A;  3CDB A;  3AAW B;  4LBP A;  2H65 B;  4XO0 A;  3D6M B;  2BR0 A;  2R2S A;  3I0R B;  1VLY A;  2K8G A;  2PC6 A;  3DYA B;  2DGO A;  4Q45 A;  3T9N A;  3KUE A;  2A2C A;  1QVF R;  4WE1 A;  5LXR A;  3GV8 B;  1S1X A;  2JZ5 A;  2BW2 A;  2F1F A;  3AXM A;  3V4I A;  4DV1 J;  4LT6 A;  2NZC A;  2WB1 D;  1NJW A;  4ZVH A;  4I2P A;  1LW2 B;  4IUF A;  2Z0G A;  4Q0B B;  4FXD A;  1KWM A;  1LFP A;  4CH1 A;  2C1E B;  4KH1 B;  4O3P A;  4YR2 A;  3ILO A;  4K0K J;  4DEZ A;  5FLX U;  3PIP Q;  3N01 A;  4PYA A;  2RRB A;  5C5J A;  4ZVF A;  1IQZ A;  3CWJ A;  3QWP A;  1M1K T;  1WC0 A;  2YKQ A;  4YR3 A;  2W7P A;  3B4D A;  2YVS A;  4JI7 J;  2B6A A;  2IVM A;  1I94 F;  1XNR J;  2H48 B;  1K0V A;  3DHX A;  2JX2 A;  2KZZ A;  2QRR A;  4NLG A;  3HHL D;  5EX3 A;  4DQS A;  3T1H J;  2HWH A;  1T9U A;  2MQN A;  1QAI A;  1KON A;  2OI2 A;  1HL6 A;  3D0G E;  2KO1 A;  2H3E B;  1W2I A;  1DUR A;  3D5M A;  4H4K C;  4DL6 A;  1HMV A;  5KFZ A;  4DXL A;  2NXJ A;  4RW9 B;  1GMW D;  3VGV A;  3D1Q A;  1AB8 A;  3B82 A;  2B0G A;  1HBO B;  1OPI A;  5D0G A;  1QE1 A;  4X64 J;  2F7V A;  3UD5 A;  4ED3 A;  1RUS A;  3MGJ A;  1XMO J;  2DNK A;  1LWC A;  3DXS X;  4QIW D;  4ZHR B;  4CIO A;  1JJC B;  5THW A;  5KFB A;  3C6T B;  2KXN B;  2HNZ B;  1T8E A;  3TJA A;  4URG A;  3E01 A;  4ZCL A;  3DGP B;  3N4W A;  1REV B;  5KFG A;  5J2N A;  2WVC A;  1TV6 B;  3LH2 S;  3ZTS A;  4BWJ A;  2XSJ A;  2GCF A;  1RB0 A;  1FX2 A;  1TK0 A;  9ATC B;  2DHX A;  4LF6 F;  4Z2X A;  2KJW A;  2UUC J;  2EC0 A;  1JXL A;  3M8Q B;  4JI2 J;  1VHF A;  2WSC C;  4LBI A;  3QJJ A;  2LCW A;  3GII A;  1W25 A;  3T41 A;  1X5S A;  3TZY A;  4WWS A;  4NCG B;  5E3A A;  1B3T A;  2UUA J;  2K06 A;  2IDE A;  5HAT A;  4P7V A;  4RNM A;  3Q22 A;  2F8M A;  2ASD A;  4CNZ A;  4J9S A;  2J0Q D;  2RJZ A;  4HT5 A;  4AFF A;  3M9N B;  2GS8 A;  4ZS6 A;  2V94 A;  4A48 A;  3WZ0 A;  1R8A A;  3H25 A;  1ZH5 A;  2OPP B;  3GJR B;  3QNW B;  3BSC A;  2VJV A;  3MM5 B;  3I96 A;  1NK0 A;  2XG8 A;  4IFV B;  4DL0 C;  1B0T A;  2YNF B;  1RAF B;  5LSR A;  4DR4 J;  2GHV C;  3AD8 C;  2JL9 A;  2CPD A;  3DRY A;  3LAN A;  3N6N A;  2QV6 A;  4KQZ A;  2V4Q A;  2W9B A;  1FRM A;  1KKH A;  3IAS 9;  3ILI A;  1YIT S;  4TNO A;  5GVQ A;  1I5O B;  1MW7 A;  3W66 A;  1JNZ B;  1NSQ A;  3H7H B;  1GMU A;  5KFO A;  3HO1 A;  2HHW A;  4J9U E;  3G8S A;  4I7F B;  2ZOM A;  4I6W A;  2OHD A;  5C2G A;  1VQ7 S;  4H4O B;  5LSO A;  4B9V A;  3I9V 9;  3HD2 A;  4X4V A;  4I6A A;  4JI0 F;  3C3L A;  5L8R C;  1K8A T;  3HFZ B;  5MAO A;  2I1R A;  3A12 A;  2ZE2 A;  3ILL A;  4RW8 A;  3D66 A;  4BC9 A;  3FCV A;  2VUG A;  4ZLL A;  5EN1 A;  3AA9 A;  2GVD B;  1U1P A;  1IKV A;  2B4V A;  2NXE A;  1KBR A;  3RBD A;  4P52 A;  3DLG A;  4PXB A;  2Q6B A;  2IJN A;  2QT7 A;  2KM8 C;  5C25 A;  4MKB A;  1ELO A;  4X2B A;  2B43 A;  3MD3 A;  3KJV B;  1SCJ B;  4O44 B;  3BPS P;  2FJW A;  2YNH A;  4ZIW A;  3PVX A;  4OHZ A;  3FSY A;  2BJ9 A;  4A8Q A;  1RT1 B;  4P71 A;  2F8H A;  4DV7 J;  4B9S A;  3R5J B;  3QQC D;  5L9N A;  2R2U A;  1LWF A;  2FJB B;  2Z56 B;  5DQG A;  2DXD A;  3ILJ A;  5JUM A;  2KG0 A;  1YK9 A;  1RBL A;  3DDN A;  2CKW A;  4HH0 A;  4TVA B;  2UXD F;  1NPP A;  3PHT A;  5B0F A;  3FKB A;  2JRS A;  5ETT A;  5H9F K;  2NCK L;  4WFN Q;  3M6X A;  4Q5V A;  2CJ9 A;  2GC8 A;  3QT7 A;  5I42 A;  2M88 A;  3M8P A;  4TYB A;  2VQF F;  5I3U A;  3R1H A;  3VHQ A;  2XYG B;  2HQG A;  1URR A;  5IS2 A;  4DX5 A;  2ZH6 A;  1RSC A;  3TVZ A;  2XTJ P;  5A6P A;  5DDP C;  4RW6 A;  3W62 A;  2AU0 A;  1V3Z A;  1WC1 A;  2BQ3 A;  4DV2 J;  1MRO B;  5KFC A;  2WBM A;  4HDG A;  5H9F J;  4LF7 J;  3HI9 A;  1FNO A;  4R5P B;  2VKR A;  4O4R A;  3CD0 A;  4DPY A;  1K1S A;  2RU3 A;  3I55 S;  2ZWP A;  5RUB A;  4OMF G;  3A3N B;  1WOR A;  1S79 A;  3ZZY A;  3BGR A;  4O23 A;  4WJB A;  1WG5 A;  1RP5 A;  2MSS A;  2WOM B;  1UVM A;  2E1A A;  1IN0 A;  2B9E A;  3HXM A;  1PO6 A;  4BDP A;  1R6V A;  4TU7 A;  4F8R A;  3LAK A;  4OX6 A;  3NS5 A;  2D41 A;  3E3X A;  3ZC4 A;  2LVW A;  1R89 A;  2KN4 A;  4LF8 F;  1CJT B;  1Y11 A;  1SJ1 A;  1NB2 A;  4ANE A;  2HIQ A;  2PMW A;  2GX8 A;  3MR5 A;  3LUY A;  1N34 J;  3NKY A;  3ISZ A;  4DR2 J;  5GAE U;  5I3P A;  4UQT A;  2V8D A;  1RHQ B;  4B3T J;  4CI0 B;  3TWZ A;  1CS4 B;  4WK3 A;  1G3O A;  1X5T A;  3HF5 A;  4RW7 A;  1HNI B;  2QG9 B;  3W9J A;  4KT0 C;  1NCL A;  4A8S A;  1S7H A;  4FN5 A;  4NLW A;  2FPH X;  4WK1 A;  1Y5N B;  2O1P A;  1RXO B;  2RKI B;  3CMA S;  3DM2 B;  2B9W A;  4B3R J;  4P2F A;  1TMM A;  1JLE B;  3GIJ A;  2GV1 A;  4FXV A;  2FLL A;  3P8B B;  1H7W A;  5L1J A;  1M0S A;  1S6P A;  4ETX A;  1RAE B;  3FCW A;  2BRL A;  1WC6 A;  1AW0 A;  1TVR B;  1YHQ S;  3LPE A;  2N7C A;  4FBU A;  2IIH A;  2ZDP A;  3A8K A;  2VQE J;  2R7R A;  1VRT B;  2G0C A;  5GAG I;  4QR1 A;  4QPT A;  1S57 A;  4I0W A;  3CPW R;  4RU9 A;  4O3O A;  1WDT A;  5IZH A;  3UDV A;  3Q8P B;  1SQF A;  3NS6 A;  3NGS A;  5K14 B;  4C0O C;  3HPO A;  5J2P A;  4OI4 A;  1RYR A;  4JI1 J;  2Q79 A;  5KG7 A;  2OPS A;  4JV5 J;  2GAH C;  2R4F A;  3UD3 P;  3OTO F;  5G4D A;  5B0G A;  1FJG F;  3ZTR A;  2B8Q A;  3K8V A;  3OVS A;  4N56 A;  4K7Q A;  3JYT A;  2AV5 A;  1RWV B;  1NJY A;  4UOC A;  5A8K A;  1I6J A;  3VV2 B;  1T05 A;  2HPU A;  2V4R A;  1H3D A;  4E8U A;  3HSD A;  2V34 A;  2VIH A;  4P74 A;  2J9D E;  3H98 A;  5D15 A;  4H4M A;  4ICL A;  4IFY B;  3JSM B;  3SV4 A;  3J7A 1;  3CCR S;  4YB6 A;  4DR1 F;  1HNZ J;  2RU9 A;  1YZ7 A;  4IR9 A;  1F2H A;  2X51 A;  3EYZ A;  3EZO A;  4YHH J;  2CJX B;  2V4J A;  1HQU B;  2AW0 A;  2BJ7 A;  4B3M J;  3MFI A;  2PN6 A;  4N76 A;  2QSW A;  4AQY J;  3QYY A;  2UXC J;  4U9R A;  4L72 B;  1RTI B;  1SL0 A;  4LQ3 A;  1NDP A;  3OXG A;  1VQL S;  3HSJ A;  1DTT A;  3CB4 A;  2JFD A;  4J9M A;  3G6X A;  2HG4 A;  2KYX A;  2ZHB A;  2BKN A;  4RL1 A;  4PXD A;  3FBE A;  3RJM B;  2FLO A;  2G1D A;  3IM9 A;  3MMB B;  1RWO B;  1JJH A;  4HI2 A;  2RNE A;  5HJX A;  3C6U B;  5C24 B;  2M2B A;  3DLE B;  2OFG X;  2B51 A;  2ASY A;  3KK1 B;  1F60 B;  1AA1 B;  3BYR A;  1JLC A;  1NZ8 A;  4KPC A;  3HT0 A;  1LW0 B;  5B09 A;  2R8I A;  3IWN C;  4X4P A;  3D6F B;  1K44 A;  2DGQ A;  1JJ2 R;  4Q0B A;  4CP5 A;  4KKO A;  4QQB A;  1RT7 B;  2HUR A;  2CPJ A;  2KT2 A;  3CXC R;  1NHK L;  2VPX B;  2V2V A;  1RT3 B;  1WKL A;  1CVJ A;  4L75 A;  7AT1 B;  2ZHA A;  4NXM J;  3QAE A;  2JC0 A;  3PYE A;  2IA6 A;  1S77 D;  2I0X A;  3G2X A;  2G9O A;  4U6P A;  1S99 A;  1SC4 B;  3FFI B;  1H73 A;  4TXS A;  1S1U B;  2WON B;  3FBF A;  1WHX A;  2QLF B;  2E7W A;  4AD6 A;  1F2G A;  3Q8U A;  1NU4 A;  3DRP B;  3L7P A;  2E44 A;  2AKW B;  2GA7 A;  3U7J A;  3QID A;  4NA1 A;  1EHW A;  5CD4 A;  4DN0 A;  3G87 A;  1PAE X;  1J5O B;  2P9C A;  1O6X A;  4RX6 A;  3SFU A;  3RZA A;  4OL8 A;  4USV A;  1RT6 B;  5DLF A;  2BAC A;  4ID8 A;  3SEO A;  5IOL A;  3SQG A;  3FQL A;  5IT9 Y;  3CJR A;  4NLV A;  3BB5 A;  3HHD A;  1HBO A;  1QY7 A;  1ZM2 A;  1XK8 A;  1ZM4 A;  3OSN A;  1RT4 A;  1HR0 J;  1N36 J;  4WYL A;  3D4J A;  5E5N A;  3TQ1 A;  2FQQ B;  3C6T A;  5HBM A;  1HNW F;  5DO2 A;  3M7V A;  4ERD A;  2BXJ A;  3NS7 B;  1J2V A;  4TQS A;  2DXE A;  4LRF A;  2ASJ A;  2DIT A;  3MPV A;  5B0C A;  2U2F A;  2G2Y A;  1IBL J;  3OL8 A;  1S6U A;  5LT5 A;  2R7S A;  2MXY A;  3EVW A;  2HHX A;  2Q66 A;  1P6T A;  2JEJ A;  5BXI A;  4PUO A;  1Z2Z A;  4DS4 A;  4TYA A;  2B8P A;  2YNI A;  3M8Q A;  4CTA A;  3ONQ A;  5BYR A;  3Q24 A;  1Q7Y T;  5AJ3 J;  3HHL B;  4ANC A;  3MUV P;  3KHR A;  1FDA A;  3T1Y J;  4HEA 9;  4DSI A;  3K89 A;  3NY0 A;  4F7V A;  1RI7 A;  4C8Y A;  1EJ7 L;  5KFA A;  2E7V A;  3MAQ A;  2LEB A;  3M32 A;  3K5L A;  2KFY A;  5L1I A;  5HVH A;  4LSL B;  1RWX B;  2MZJ A;  2XMT A;  2ILY A;  4KSE B;  2HS3 A;  2OPR A;  2AIR B;  4YN3 B;  4UY8 T;  2KVI A;  4K4Y A;  2ZUG A;  3V6D A;  4IFV A;  5J2Q A;  2F8E X;  2E5J A;  2YNF A;  1RQ0 A;  2YWG A;  1UWB B;  1AZS B;  3GIK A;  4TQR A;  4Q44 A;  1R6Y A;  1DZ5 A;  1S6Q B;  4KGM A;  2UUB J;  4DQR A;  2L08 A;  2IFX A;  5J2M B;  3TZX A;  4RR5 A;  2GIQ A;  3FCH A;  2VHG A;  1KLM B;  4C48 A;  2L9N A;  3L3C A;  5CCL A;  2OP5 A;  4F3Q A;  2OEM A;  4ZMM A;  3UVJ B;  1NEE A;  4EBC A;  1NO8 A;  2CWK A;  1HIY A;  3F73 A;  3WC2 A;  1A7G E;  4F4W A;  3EDQ B;  3T1A A;  3THT A;  1PBU A;  4ZN1 A;  2LQ5 A;  1CJV A;  3QFW A;  1RWM B;  1KRP A;  3ZZR A;  2CQ2 A;  2IAJ B;  1CLF A;  2FC8 A;  3CC4 S;  2ZKU A;  5D78 A;  3KTQ A;  4OX9 J;  4EZ9 A;  5M2P A;  2CWX A;  5DDQ C;  4GC7 A;  4FYW B;  5HQ8 A;  1U48 A;  2ZH2 A;  3W2W A;  4DSE A;  2HK3 A;  5CZX A;  1WEX A;  1F9E B;  5KOW A;  1R0C B;  2RVJ A;  1PJ6 A;  2HK2 A;  2HSE B;  4RO0 A;  5A8W B;  3UN3 A;  3VGT A;  3MAH A;  2J9E A;  4DX6 A;  4WTY A;  3BDE A;  3MUR P;  3BKT A;  1VBX A;  4EO8 A;  2OLW A;  1FER A;  2RE1 A;  1C4A A;  3LAL A;  5SUH A;  5LJ5 Y;  2UVR A;  3ADA C;  3VGU A;  4FYY B;  4OHW A;  1Y7P A;  2XY5 A;  4H54 A;  3EPI A;  3TP2 A;  3GSI A;  1RT1 A;  1Q8I A;  3CUN A;  2DB1 A;  1WI8 A;  4CLT A;  2ZM6 J;  2HFV A;  4ID5 B;  2H4W B;  2J9C A;  3BPD A;  4DR7 J;  3GLJ A;  4CH0 S;  3VAL A;  4Q2L A;  3BJY A;  1A6L A;  3GV7 B;  1FDN A;  2EVZ A;  4DF8 A;  1TQL A;  2XM3 A;  8RUC A;  4Q2M A;  4ECV A;  3DNC A;  4JI3 F;  4G6V B;  1IUJ A;  3VCD A;  4OJH A;  2W24 A;  1FRK A;  2LU2 A;  2OH2 A;  3KKF A;  3K7R A;  2LDI A;  3UNY A;  3MMC B;  4C98 A;  5IQ6 A;  1N5S A;  1ZTT A;  4OZ3 A;  3HVT B;  2HS0 A;  3KDN A;  3MPY A;  2PII A;  1NH7 A;  2I38 A;  4GC6 A;  4JP8 A;  4FXW A;  3BGL A;  2OO4 A;  2K3I A;  4DPX A;  2IJR A;  1G2E A;  1C0U B;  2UXB J;  1G4C A;  2OML A;  2BKP A;  2OGU A;  4WII A;  4QR0 A;  3BRE A;  3UDL A;  1SQG A;  4XPE A;  4F4K A;  1OY6 A;  5E3C A;  4IG3 A;  2MJU A;  2YKP A;  2X3G A;  1T9W A;  1WTF A;  4OJ1 A;  4OZL A;  5KFR A;  1FWP A;  4YDD B;  1RA6 A;  3DRR B;  2BKO A;  4DCJ B;  3BKU A;  2A6O A;  1CJT A;  4OYB A;  4DUZ J;  2IJF A;  1PG5 B;  4K4W A;  3MUM P;  3DOK B;  1PGZ A;  1YKW A;  1LWE A;  4DUY J;  2XEX A;  1VS3 A;  2DGW A;  2E9T A;  3QZ7 A;  3TA2 A;  1SIZ A;  2MKK A;  1B64 A;  1NK9 A;  1X31 C;  1R31 A;  2MJN A;  5CH7 B;  2CFX A;  3SIP B;  2PA3 A;  2BE2 B;  4TLQ A;  4U7C A;  1BQN A;  3WX8 A;  4R8U B;  2W01 A;  5L46 A;  4ZPD A;  3LTO A;  2D3O 1;  2HZV A;  1FD8 A;  1CPZ A;  1JLE A;  3SXL A;  3MAA B;  4XPC A;  3R5A A;  1FXR A;  1PYT A;  2UVU A;  5KFS A;  3D0H E;  2MZQ A;  5KOX A;  1N6Q B;  1EZZ B;  2AJQ A;  4AND A;  2DR8 A;  5DQI A;  4R0J A;  3VVT A;  1JQG A;  2XLI A;  2V2K A;  3NCQ A;  3QZ8 A;  3ITH B;  4F3M A;  4CO3 A;  2E5L F;  4MTP A;  2WB4 A;  3PJW A;  4RNN A;  3TX8 A;  1R8P A;  3O3L A;  3H0P A;  3KG4 A;  3SMZ A;  2CVI A;  2HIY A;  2PSZ A;  3A3P B;  3J80 Y;  2AJ0 A;  3MMA B;  2ZFH A;  2LMI A;  1SL2 A;  3GWC A;  1TEL A;  2B9Y A;  1S1V A;  3KWM A;  1QLN A;  1DQ8 A;  5U47 A;  4L6V 3;  4P6Q A;  3BKF A;  3CIM A;  5GAH U;  2DRD A;  5IQQ A;  3KYL A;  2XHW A;  2VPY B;  4ZVU B;  3MM9 A;  3M4X A;  4EI2 A;  3HZE A;  2QA1 A;  4QYZ K;  1XWL A;  2BW7 A;  1JLF B;  1F5B A;  3IR5 B;  2VIC A;  4FVC A;  3EX7 B;  3MEE B;  2CPH A;  3J81 Y;  2BEF A;  2DIS A;  1VHI A;  1ITP A;  3ENW A;  4P9S A;  2AX1 A;  4IFY A;  2ZH8 A;  4F04 B;  3JSM A;  1SJ3 P;  4O4G A;  2EG2 A;  2LEP A;  2FY8 A;  4YB1 P;  5CAB A;  3HJV A;  3AOD A;  4QYZ J;  1TUG B;  3BYP A;  3NCR A;  4F4A A;  2AGO A;  2HVH A;  1NLK L;  4JBC A;  4K4U A;  5KG2 A;  3UNG C;  3BGU A;  4ED5 A;  3MUT P;  1KOO A;  3W7B A;  4DS5 A;  5ETQ A;  3OT9 A;  3BQ1 A;  1RTI A;  2FHK A;  2MYF A;  1HHS A;  3BN4 A;  4ZP8 A;  5ETV A;  5IC4 B;  4OLO A;  4X66 F;  2XMV A;  2DR5 A;  3UW1 A;  4MJK A;  3K5O A;  4JUZ A;  4CH7 A;  3CCM S;  2CZ4 A;  4HAC B;  2MZS A;  2VG7 A;  3G82 B;  4DR5 F;  3JTP A;  2G2Z A;  2B4U A;  2W9C B;  2CQ1 A;  2BOA A;  2DIU A;  3FEY B;  1NB7 A;  3LP1 B;  2A3J A;  2VV5 A;  5KFY A;  1TL7 B;  4ZDN A;  2QN6 B;  1WWH A;  3VQT A;  2XCA A;  4X84 A;  5IWA F;  2ZNZ A;  3OTB A;  2WK4 A;  2Q6C A;  3RG6 A;  3N0V A;  3L9Z A;  4RKU C;  2XS7 A;  2RQK A;  1DTQ A;  5AXK A;  2Y0S D;  1HD0 A;  3MDF A;  5LMU J;  2CDR B;  2APO A;  4OZ5 A;  3KK3 A;  3VAH A;  1RWU A;  1IBK F;  3M2V B;  1XNQ F;  1VIO A;  3HHL C;  5C42 A;  1U2R A;  4Q43 A;  3M8S A;  2B5J A;  3DI6 A;  3P49 B;  4NLR A;  2P6T A;  3OLA A;  4DV0 F;  1GX5 A;  5HL7 Q;  3NMA A;  3VR1 A;  4MIA A;  2DH9 A;  2IM3 A;  3CD7 A;  2NUH A;  5HO4 A;  1P9Y A;  3IBF B;  3MFH A;  2OPQ B;  1YJ9 S;  2ZUA A;  2SXL A;  1DRZ A;  4JI0 J;  1BHN A;  1K9M T;  4PG7 A;  2XMK A;  1FK9 B;  4LFC J;  1PBA A;  4M5I A;  1SH3 A;  1NK7 A;  4U95 A;  4DN9 A;  3H40 A;  3TUI C;  4J9P A;  2M9K A;  3CCQ S;  2J0X A;  1D09 B;  4IG0 B;  4LSN B;  3F56 A;  3J7Z T;  1RHU B;  1RTD A;  2LXI A;  4NI2 B;  2Q3P A;  3MR6 A;  1NXI A;  1LOU A;  3CVK A;  4KGZ B;  1N0U A;  1T3O A;  2O67 A;  5HMW A;  3TZZ A;  3B54 A;  1TUW A;  4GO5 X;  3X1L B;  1E6Y A;  1AFI A;  5K8M A;  3KHH A;  1UEU A;  2ZDO A;  3NG8 A;  3H42 A;  4ECY A;  3H2V E;  1TFY A;  2J7W A;  1T9T A;  3IWL A;  1NHU A;  1AXQ A;  1PSD A;  2E1M C;  5ETP A;  5KFP A;  1S1T B;  2ZJQ Q;  3BH6 B;  4DLE A;  2W1B A;  2ZOF A;  3JQJ A;  3SCK E;  1JLG B;  3SZ2 A;  5EHH A;  4XAK A;  1R0A A;  4KJI A;  4Y3C A;  1UCN A;  2GIR A;  2QGF B;  4M5D B;  3K5N A;  5D3G B;  4F2S A;  2MST A;  2HVI A;  3DDK A;  3CJT A;  3VVU A;  3P45 B;  1HFE L;  1VC0 A;  2MGZ A;  4LSL A;  4HT7 A;  2RS2 A;  3CNQ P;  3U1M A;  4OV6 A;  1C1B A;  3K0J A;  5EWG A;  4FP9 A;  1XTZ A;  1L3S A;  5F8N A;  1FRL A;  4M5H A;  2NYI A;  3FBB A;  1UWB A;  4IOA Q;  3QAU A;  4WKY A;  4O3Q A;  1GFW B;  1QM9 A;  2A2D A;  3H5Y A;  4RUB A;  3RBZ A;  2XLK A;  3EVO A;  4CWB A;  1FFW B;  1RTJ A;  1UFL A;  4ED1 A;  1RAH B;  2MQO A;  2LA4 A;  3HVW A;  5K8P A;  1MLA A;  3NGD A;  3TEG A;  2C2K B;  4OV1 A;  1TKT A;  4Y6I A;  1SJQ A;  3M1V B;  3BSA A;  2PFF B;  1JLB A;  3H59 A;  2DBB A;  4NXN F;  4J37 A;  3KLF B;  1HBM B;  1X9W A;  1YLX A;  3HMJ G;  4KFB B;  3ZXW A;  1HW8 A;  5HLF A;  1MG7 A;  4QWB A;  5KT4 A;  1GK8 A;  2MKY A;  3A3O B;  3PIO Q;  1XQI A;  4CLF A;  3ZZ0 A;  1Q81 T;  2AGP A;  1PC4 A;  1PJ5 A;  3TRG A;  2R2T A;  4FF2 A;  1CJK A;  1AFJ A;  4ED7 A;  4GMK A;  4OJG A;  5E7O B;  1T9Y A;  3FUY A;  3MM6 A;  1V9O A;  3SCI E;  4WFB Q;  3ZNU A;  2ILZ A;  1Z4U A;  3K2Y A;  4ZLP A;  2HVD A;  2BM1 A;  3HFK A;  4NYP A;  3W8G A;  1RBO B;  4NZ0 A;  4N8N A;  1IJF B;  1HI0 P;  1YTY A;  1QAX A;  3KLG A;  4DFK A;  3NBP B;  4N77 A;  3T5L A;  4HI1 A;  2K1R A;  3AY0 A;  2YWK A;  5I4M A;  4PEO A;  4TN2 A;  2Q1L A;  3Q8V A;  3EZ5 A;  3FSI A;  2DTJ A;  3M30 A;  1FJG J;  1EIY B;  2Y0B B;  2HRU A;  4L74 A;  1RTH B;  4CYU A;  1D8Y A;  3FRY A;  4EUV A;  1D9D A;  3HLU A;  2BJ1 A;  3G8T A;  5T7L B;  1NJZ A;  3GFX A;  3ISN D;  2H4Y B;  3W64 A;  4CO0 A;  1YJN S;  2C2O B;  1LEO A;  1X4B A;  5FDL A;  1TK8 A;  4C3K A;  1MN9 A;  4QCL A;  4X4U A;  2BX6 A;  2AYB A;  5LMN J;  1FEE A;  4ED2 A;  1Y4Z B;  1GX6 A;  1RZM A;  4DR1 J;  4OI1 A;  4QW9 A;  3IR7 B;  4KBI A;  3IP0 A;  2LXF A;  1JLA B;  4ILM A;  4JI6 J;  3CED A;  3DFE A;  3DRR A;  1YBT A;  1Y9O A;  4YEA A;  2V8V A;  3B4M A;  3IAM 9;  1FWK A;  3N5B A;  3U02 A;  1FTC A;  2FD2 A;  3MEG B;  1X9M A;  4NLP A;  2AJ1 A;  1AYE A;  5HMY A;  2C22 A;  4ECX A;  2QMW A;  2C2E A;  2PMH A;  2VDI A;  3RBX A;  2HZA A;  4NLX A;  2C2Z B;  3L09 A;  5B0B A;  1HBN A;  2GZO A;  3QIP A;  2CNO B;  2XB2 D;  3PR4 A;  2YH1 A;  4DR6 J;  3DMJ B;  3K5P A;  2YQ3 A;  3CCU S;  5GAG U;  2VOP A;  3TX0 A;  3NXZ A;  1RIS A;  3VQS A;  2MB0 B;  4ELV A;  3CMQ A;  4B9L A;  2LEA A;  3TA0 A;  2EFV A;  3G86 A;  1X8D A;  4F36 A;  1FVQ A;  1P1L A;  2HNY B;  2YKO A;  1GT8 A;  2HRT A;  4PR6 A;  3T5J A;  2CQD A;  4DCO B;  1WC3 A;  3LGH A;  4KE5 A;  2EI5 A;  2AEF A;  4C3M A;  1TAU A;  3KLE A;  4OYA A;  3E2E A;  4HDH A;  2GQQ A;  2QA2 A;  2V5H G;  3CJ8 A;  3Q8Q B;  3IGV A;  2ADC A;  3O2I A;  3BH7 B;  1KLN A;  2PT0 A;  1CG2 A;  3W63 A;  1S9F A;  4IOC Q;  1XER A;  2ZWO A;  3D2W A;  2JOQ A;  3V5R A;  1DFD A;  4DPU A;  1T3N A;  4LFA F;  1PAU B;  1OIA A;  1N56 A;  3MR7 A;  1UZH A;  2MKS A;  3OXF A;  3W1Y C;  3QJL A;  1EP4 A;  3QO9 B;  4BCA A;  4MK9 A;  3EZU A;  4X4O A;  3TAM A;  4DZD A;  1X4F A;  1L3U A;  3GR0 A;  4USW A;  1F5C A;  2FGC A;  2GQC A;  3GIL A;  2YNG B;  3DN9 A;  1VQ8 S;  1ROF A;  3DC2 A;  4PG8 A;  4UT4 A;  3ZO7 A;  4M63 A;  3IBC B;  4AYB D;  4KRW A;  2N3O A;  4DL4 A;  2AZ1 A;  1O8B A;  3LPY A;  4NPO A;  3PO4 A;  1HNX F;  2R8J A;  4F25 A;  2R7T A;  2V6A A;  3PDN A;  4FS2 A;  2PO4 A;  3R3T A;  2MZ1 A;  2QSF A;  3LP0 B;  3UD4 P;  3GJS B;  1BQM A;  1RGV A;  1WOO A;  3OFE A;  2I9S A;  4JYA F;  3G4S S;  2EFO A;  5DG9 A;  3F44 A;  2A10 A;  1V3R A;  4G1P A;  4D3H A;  2XMU A;  1S10 A;  4ZVE A;  4JI5 J;  4Y2I A;  4DSK A;  4OQJ A;  3IA0 A;  3HSZ A;  4Q7A A;  1VQP S;  2WCX A;  4HAC A;  3G82 A;  2ATL A;  2CPZ A;  4BC7 A;  2FJX A;  2W9C A;  3A8J A;  1WF2 A;  1S7I A;  3ZFV A;  4RWX A;  2I6W A;  1JKH B;  3W5X A;  4DOZ A;  1PYS B;  3KXD A;  4RBU A;  3ENV A;  1XR6 A;  3TZW A;  2HBY B;  1UKU A;  4Q8F A;  3CC2 S;  3RB4 A;  4LBH A;  4USH A;  3G9C A;  5HAO A;  2BDP A;  4C6A A;  4LF4 F;  4QJV A;  3HM9 A;  1GH8 A;  2CNN B;  1U0S A;  2HHV A;  2Z4P A;  1TMJ A;  2XS2 A;  1B7F A;  3GYG A;  2G2O A;  4X65 F;  3GTY X;  4OYM A;  1C1C A;  2XGQ A;  5DG7 A;  5F8I A;  4QBU A;  1F3V A;  1N33 F;  1ZZF A;  1EB0 A;  4F26 A;  3TUZ C;  1DLO B;  3I56 S;  4WF9 Q;  1FRI A;  3EGN A;  3U1L A;  1QAY A;  1S9E B;  1Q95 G;  1FRX A;  5AXM A;  4CLP A;  4GKK F;  4AXJ A;  2VF3 A;  2CAJ A;  3BZQ A;  1TR0 A;  2QL9 B;  4MMO A;  3GB0 A;  4RJV A;  3MTJ A;  1NZA A;  1VGY A;  4NYZ A;  3PTW A;  2CPX A;  5DM6 Q;  5A76 A;  4X4R A;  2M70 A;  2KRR A;  1FF2 A;  1TL1 A;  1KOH A;  2CNK B;  4QIG A;  1CUL A;  2C3U A;  1Q5V A;  4OFZ A;  1H0H B;  3GQC A;  2F5G A;  4NL5 A;  2XYH B;  2HVZ A;  4LSN A;  1R8H A;  3PO5 A;  2B9X A;  1YX2 A;  4CDI A;  2DJW A;  2V2Z A;  4CM2 A;  4B3S F;  4J5O A;  2FLP A;  3VWS A;  2ZJR Q;  4DU7 A;  2ZBR A;  4U8V A;  4YFU A;  3PEH A;  1RWN B;  1DBD A;  1NRK A;  2IC3 B;  1D9F A;  4FYD A;  4ZIT A;  1DAR A;  1QUP A;  2CPI A;  2CQI A;  4FYX B;  2GHW A;  1IKW A;  2KYZ A;  4PQA A;  3D67 A;  4LF1 A;  4B3O A;  3Q89 A;  2W7A A;  4UOG A;  4FNI A;  5HRO B;  1H2T Z;  3M2R A;  1YG0 A;  2WVF A;  4X62 J;  3H8Y A;  2XMM A;  1S1T A;  3IS9 A;  5ETM A;  1D1U A;  3R9L A;  4DZ6 A;  1NM2 A;  3MED A;  4KAI A;  4NA2 A;  4JI3 J;  3L4B C;  3R8Y A;  2X1F A;  2PEB A;  1HQE B;  3H90 A;  1QSY A;  2JLE A;  3KLV A;  2JNJ A;  3AA8 A;  1VBZ A;  1SH0 A;  1VQ9 S;  4CZC A;  3TQE A;  4GKJ J;  2H5I B;  1YDL A;  4OI2 A;  5KT5 A;  4DUT A;  5M2U A;  3C16 A;  1X4C A;  4WXO A;  3DXB A;  5KFD A;  2YWW A;  3UR3 C;  1BWV A;  1R43 A;  2AJ2 A;  1W2B R;  2BJ8 A;  2FDN A;  4Y34 A;  1PKU A;  4MK8 A;  4E98 A;  2V69 A;  1BC6 A;  3HVA A;  5CYM A;  4FBT A;  3L7U A;  1BXN A;  4YUD A;  2W8L A;  1S48 A;  3KLH A;  1OSD A;  2E1P A;  1BWE A;  5KFM A;  5KT3 A;  2YQ0 A;  1UVJ A;  2EPI A;  4LUB A;  4FS1 A;  2ZHO A;  3DU5 A;  4ZJO A;  2H54 B;  4X4Q A;  4JV0 A;  4K0K F;  4FYV B;  2DCU B;  1TL3 B;  4WTO B;  1EET B;  4PG4 A;  3T6B A;  2RUS A;  2Y3Y A;  4FPR A;  4QIV A;  2HBZ B;  1FD2 A;  1MU2 B;  1T0T V;  2HQI A;  3KG1 A;  3P5T L;  4KFB A;  3C15 B;  1U1N A;  2ACM A;  2RSQ A;  1X4D A;  4GVL A;  1YJR A;  1S4F A;  4M94 A;  4AL5 A;  1CC8 A;  3HP6 A;  2CAD A;  2HND B;  3CCT A;  2YKN A;  3SDE A;  5F8J A;  4TY9 A;  4IQM A;  1Q78 A;  2C2N A;  3T1H F;  2HGL A;  1HPZ B;  1HHT P;  1IKY A;  4U8Y A;  5ETR A;  4ZCI A;  3OFH A;  4HTI A;  4UUX A;  3ZZZ A;  3PEJ A;  1HWK A;  3LAM A;  3GSD A;  1RCO B;  4N7T A;  1VRQ C;  4X64 F;  4PG6 A;  3RGI A;  4LRE A;  1KN6 A;  1K47 A;  1ZM3 A;  1RK8 A;  2VD3 A;  3WBZ A;  1XMO F;  4IH6 A;  2WAQ D;  1IKX A;  3PR5 B;  3H4D A;  6FD1 A;  3DLJ A;  2HHP A;  3P6Y C;  5F0W A;  3EJM A;  3UQS A;  3NBP A;  2OAU A;  1ZTW A;  2X1G A;  4CT9 A;  4A4J A;  1C2P A;  3H2L A;  2FVR A;  5T41 A;  3RAX A;  1VQK S;  2P5V A;  2A0F B;  2F40 A;  5J1E B;  1L3T A;  2M0G B;  2OSQ A;  2XZD B;  4TU8 A;  3M6W A;  4E0D A;  3RU0 A;  4TU9 A;  4JI2 F;  3D7S B;  3VTI A;  2QO3 A;  1KTV A;  1QAJ A;  4A8X A;  4NLT A;  3ZTO A;  3I0S A;  2KDO A;  4K4T A;  1N54 B;  2QYG A;  1RCX B;  1GNK A;  1RAA B;  5T7L A;  5IT4 A;  1T03 B;  2M4M A;  3ET6 A;  1RHR B;  3HKZ D;  4DSJ A;  2ZD1 A;  5ETK A;  1S0N A;  2KB2 A;  4F2R A;  1ZA2 B;  1YJW S;  2L41 A;  3IMQ J;  5IT0 A;  2M8H A;  2VC1 A;  3R27 A;  5CYQ A;  3CD5 A;  2KL8 A;  2CYY A;  3QGH A;  2XMA A;  4WZQ A;  1D3W A;  2MQP A;  3HCX A;  3MM7 B;  2DT9 A;  3IRX B;  2UV8 A;  1AUS L;  1HA1 A;  3AJ1 A;  2QLB B;  3I9Z A;  2W4D A;  4DR4 F;  1FE0 A;  1N32 J;  3RRH A;  1HKA A;  1RU2 A;  3MEG A;  1N5Y B;  4DV4 F;  4PAB A;  3FNN A;  3UCZ P;  4NEZ A;  3IWX A;  1RT5 B;  4UOH A;  1RT2 B;  3HZG A;  1SKS A;  2PI4 A;  2PEH A;  1EQ0 A;  1OS5 A;  3CF5 Q;  5D6G A;  4CLW A;  4QW8 A;  3DLK A;  3M8Z A;  4I2Q B;  1E6V B;  3W5Z A;  1UW4 A;  2RHQ B;  2MEW A;  2EWH A;  4C8K A;  1V3S A;  2WVE A;  4JI4 F;  4CM0 A;  3V4M A;  3R5C A;  4A8W A;  1JB0 C;  2O5D A;  3PW7 A;  4OZ2 A;  1KEK A;  1H74 A;  5KFV A;  3BO2 A;  1MWZ A;  3F0N A;  5AE3 A;  4EMD A;  2HNY A;  2GGP B;  5DJB A;  1C4C A;  1MML A;  3D0I E;  2CPY A;  2VG6 B;  4DFJ A;  2K2P A;  2HS4 A;  3S01 A;  3POT A;  1XBW A;  3J7A N;  1C0T B;  4BLG A;  4ECW A;  2A18 A;  2IRY A;  1WSR A;  2GVZ B;  4O3R A;  5DQH A;  1UJ6 A;  5J1P A;  3CME S;  3VAM A;  2ZH1 A;  2MLX A;  3JAM Y;  4B9U A;  1HWI A;  3B78 A;  5SZT A;  4DV0 J;  1J27 A;  4J9N A;  3GV5 B;  2UVV A;  1Y10 A;  1H2U X;  4IDK B;  2N3L A;  1NKC A;  1VBY A;  5B0A A;  3I4P A;  1VQN S;  3MEC A;  1UA1 A;  3IM8 A;  2DGV A;  3QLH A;  1U0H B;  3PG9 A;  3Q2T C;  4YY3 F;  4KO0 A;  1U1K A;  4KHR A;  1UMJ A;  2VPW B;  3BS9 A;  1TZ0 A;  2ZJP Q;  2YNG A;  5IM0 A;  3VAK A;  4MFB B;  2CJQ A;  3ELH A;  3AQO A;  5BYQ A;  2CQG A;  2GJ2 A;  4P2S A;  2W2M P;  2HYI B;  2FHJ A;  3FRZ A;  4ED4 A;  3PJ9 A;  4GVB B;  1FEH A;  1S4E A;  3R6G B;  5GMD A;  4C8O A;  1WEZ A;  1WHV A;  3HJF A;  4H4K A;  5C2C A;  2E5G A;  2DO0 A;  3TAQ A;  2WTF A;  5KG5 A;  3QRP A;  5ITH A;  4GO7 X;  4M5L A;  2RDJ A;  2EW9 A;  5D4P A;  2OUG A;  1S9G B;  2LQ9 A;  2NS1 B;  3OR2 B;  3LP2 A;  4CLK A;  1HNV B;  1WEY A;  1UJ4 A;  4K4X A;  4QWC A;  2HBQ B;  1VC5 A;  1IJE B;  1LK7 A;  2R7O A;  3TOQ A;  2QMX A;  4NX9 A;  4WP9 A;  3UE2 A;  2ZH5 A;  1KTQ A;  2IM1 A;  3TVK A;  3EGZ A;  1VQM S;  1DQA A;  2HQD A;  2VFS A;  4DR2 F;  3X3U A;  4HHJ A;  4OHX A;  4PG5 A;  3RB0 A;  2LFV A;  3BR9 A;  3ENQ A;  1PIL A;  2HLU A;  2EXU A;  1TP7 A;  2ZIT A;  3DDI A;  5D0R A;  2BQU A;  5LOQ A;  4E2F B;  2MY8 A;  4LQ9 A;  1S1X B;  5H9E K;  1UVL A;  4HTJ A;  4B3R F;  3V4I B;  2YKM A;  1XMQ J;  3VZI A;  2Z2L A;  4ZCM A;  3V81 A;  3LQV A;  2GMJ A;  1U8W A;  1H2V Z;  2N4D A;  2HLT A;  4I2P B;  1DHM A;  1SUQ A;  2JVR A;  3PM9 A;  2ROG A;  1N52 B;  1NK8 A;  4Y28 C;  5LJ3 Y;  5B0E A;  4LJM A;  3QT6 A;  2DEI A;  3HT3 A;  4LIR A;  3KUH A;  3QPI A;  2V63 A;  1TKX A;  1FRH A;  2Y8Y A;  2XI2 A;  4B17 A;  3D68 A;  4RZR A;  2BZ2 A;  1FO1 A;  2NR0 A;  1LKZ A;  5AXL A;  2RQ4 A;  1IQT A;  5G0R B;  3R5G A;  5F0U A;  2CZV C;  3QWU A;  2G4B A;  2OEK A;  3HHE A;  2IVF B;  4CLS A;  3Q8R B;  2I5J B;  1UP1 A;  3THP A;  4B08 A;  3G71 S;  3NNH A;  2KFN A;  5E0O A;  2HEK A;  2ZKT A;  2GO8 A;  4W4M A;  3CJ5 A;  2E9R X;  1Q79 A;  1WKK A;  2ZBC A;  3MOZ A;  4DFP A;  5F8M A;  1D8Z A;  2H9Z A;  4RBT A;  3H4B A;  5DZ7 A;  2HKE A;  5E3Q A;  1HMV B;  3AOA A;  1ACM B;  4ATN A;  3CSK A;  3SCL E;  1QE1 B;  2IC3 A;  3Q2S C;  2AQ4 A;  3KJN B;  4DL3 A;  2NXN A;  1FNM A;  3UCG A;  2IRX A;  3SQO P;  2WZ1 A;  1Q82 T;  4WFX A;  3JQM A;  3TUJ C;  2AJF E;  1LWC B;  5DGB A;  1RWK B;  3N28 A;  1FDB A;  2IA0 A;  2D9P A;  3OTE A;  3PXG a;  5HRO A;  3E01 B;  3DRS B;  3G6E S;  2DH8 A;  1HNZ F;  1Y3J A;  4PXE A;  4NYO A;  1NK4 A;  1HYS B;  5J2N B;  1I51 B;  4HVZ A;  3W9H A;  3FMW A;  2HHS A;  1RYS A;  1X4G A;  2XSJ B;  3PAC A;  4B3M F;  4LR9 A;  2BAN A;  1FI4 A;  4AQY F;  3NGR A;  4V19 J;  1WC5 A;  1APS A;  2C3P A;  1HBU B;  2IMO A;  2GHP A;  1HQE A;  1SKU B;  1Z1Z A;  4WPA A;  1EKS A;  1S1W A;  4PXC A;  5KFE A;  3ZZO A;  3GR1 A;  2N7Y A;  3M8Y A;  3HVR A;  2MQ8 A;  1TL5 A;  1UAW A;  4M5M A;  2DGS A;  2ASL A;  3CW2 C;  1Q8K A;  4UST A;  3W2V B;  3RR7 A;  2C2M B;  4J9O A;  5KTQ A;  4URS A;  3LWM A;  4NRU A;  3MXH P;  2X1B A;  4CO5 A;  5EGY A;  4C0H A;  4LRC A;  4ECZ A;  4M5K A;  2DNM A;  2C2R A;  5KT7 A;  3PKM A;  1P9Q C;  2D3O R;  4DQI A;  3S6E A;  4ETZ A;  4OYP A;  1H38 A;  3LW5 C;  1EET A;  1ZBT A;  1NH8 A;  2OFH X;  1QTM A;  2IHR 1;  2XHC A;  3MPW A;  5F3T A;  4M95 A;  2FLN A;  1MU2 A;  4RUA A;  1X0F A;  2DGT A;  2JC1 A;  2YBV A;  4I67 A;  3QT8 A;  4IYQ A;  4KR0 B;  4IRD A;  1KHW A;  1U6Z A;  1KQF B;  5KG3 A;  5IFM A;  3GFH A;  2HND A;  5BR8 F;  4OI3 A;  2G1H A;  4FDF A;  3SYZ A;  2AHO B;  3KK2 A;  4RWW A;  3GCW P;  1R7I A;  3OHB A;  4DV5 F;  2I8E A;  3MCN A;  4C11 B;  2HGM A;  2X7I A;  1JLQ B;  4RW4 A;  5A2Q U;  3CCV S;  4F3O A;  1M5P C;  2ZE2 B;  4PQU A;  1B99 A;  4ZVG A;  2RT3 A;  3RW7 A;  4BBY A;  3M9O B;  3I87 A;  3CUL A;  3D3C J;  4YDX A;  1K73 T;  1H72 C;  4C3L A;  1KFS A;  2OEJ A;  1HHQ A;  4OI0 A;  1N8R T;  2HWI A;  1FJ7 A;  2YPZ A;  3CJ2 A;  4OIX A;  1YJV A;  4HHH A;  1WF0 A;  2EKN A;  3UN2 A;  3TO8 A;  4ES3 A;  1VQ6 S;  1VDH A;  1KS2 A;  2YNH B;  3D1O A;  4HH1 A;  5A0Y B;  3UDC A;  1JWW A;  3U27 A;  1IBL F;  2HMI A;  3MCS A;  5J1E A;  2ZVI A;  3R5B A;  3UR0 A;  1LWF B;  1MN7 A;  3ISN C;  4ZJQ A;  3NGT A;  5B0D A;  1CEZ A;  4NA3 A;  2AGQ A;  1Q1K A;  4Y2K A;  5AJ3 F;  4KHP J;  2RHS B;  2E66 A;  2QE5 A;  3KHG A;  4ZCK A;  4PKD B;  3I0R A;  4MKV A;  4QZV B;  4WP3 A;  3OW2 R;  5AE2 A;  3DYA A;  2VB6 A;  1F9H A;  1WJ9 A;  3OFF A;  5I42 B;  3M8P B;  5I3U B;  3QGP A;  5LM7 E;  4DR3 J;  2K7J A;  4V1A k;  4AXI A;  4A47 A;  1FJE B;  1VIX A;  1SC3 B;  2NUU G;  1OQ3 A;  4K4Z A;  1OYE A;  1IM6 A;  5DG8 A;  1LW2 A;  1Y5L B;  2E9Z A;  2XMJ A;  2RH3 A;  2Y1I A;  1FNX H;  5DET A;  3OJS A;  3BGR B;  1RTZ A;  2UUB F;  1N5Y A;  4JYA J;  4RUC A;  2FZC B;  3IG1 B;  2QFI A;  3CJQ A;  4YME A;  4USK A;  1GMV A;  4ZPW R;  1SIW B;  4Y2A A;  4I2Q A;  2R7U A;  3OLB A;  2C2D A;  4DDF A;  4QIE A;  3AD9 C;  1Y00 A;  3DOL B;  1UW9 A;  4OYZ A;  5FLX Y;  4ZOS A;  5F3Z A;  2OTL S;  4WFZ A;  4QWA A;  2AYE A;  1KD1 T;  5KFN A;  4Y0F A;  1UJ5 A;  3CGI A;  2RRA A;  2RML A;  3LWL A;  4RW7 B;  1XJW B;  1G6B A;  4A8F A;  2KI2 A;  3S7R A;  5LXY A;  2MKC A;  2AZ3 A;  1G1X A;  2JLG A;  2BM0 A;  4RW9 A;  2CPE A;  1X5O A;  4LF4 J;  4LR7 A;  5HQM A;  5KFX A;  1VQO S;  1MWQ A;  2P9E A;  4RNF A;  4JB8 B;  1VLO A;  1AUD A;  3FK4 A;  5F8L A;  2DK2 A;  3SSR A;  2CRL A;  4X65 J;  4W90 B;  3ZTQ A;  3OBI A;  4ZHR A;  2AP6 A;  4QPX A;  3JTO A;  2XY7 A;  5DZ6 A;  2HNZ A;  1S6P B;  1IBM F;  4NZ6 A;  2KU7 A;  2V67 A;  3M8W A;  3DGP A;  3H5U A;  2FJA B;  4GKK J;  1REV A;  4WFY A;  2RIJ A;  2R8K A;  3I5A A;  1WUU A;  1TV6 A;  4DV3 F;  1JIH A;  2ZM6 F;  3CCZ A;  6FDR A;  1CQN A;  4JI8 J;  4ECQ A;  4X4S A;  1OYD A;  1OSC A;  3VF0 B;  2LKZ A;  4DR7 F;  5CCM A;  5KFH A;  2QX0 A;  1WHY A;  3NNA A;  1U0H A;  2Z8Q A;  1FHT A;  1U2F A;  1PYO B;  1HQ2 A;  3GU0 A;  3PRB A;  2ZZN A;  2QL5 B;  5J2P B;  3KUG A;  4NCG A;  2FJE B;  3OL6 A;  1B4S A;  1LNQ A;  2UUT A;  3CCE S;  3AOC A;  2NXU A;  3AOB A;  2BBE A;  1BY9 A;  3E51 A;  5KG1 A;  5IV3 A;  4IH7 A;  3JYT B;  4RU2 A;  1U1M A;  2GW8 A;  3OQ2 A;  4NE9 C;  3MPD A;  2OPP A;  2H5E A;  3M8R A;  1RHJ B;  1T05 B;  3KLI B;  4AUK A;  5D4O A;  1S0M A;  2UU9 J;  1B0V A;  3MM5 A;  4OYI A;  2MQM A;  2UXB F;  1REG X;  4EFA C;  3CCJ S;  1MWY A;  2KG1 A;  2RD5 C;  2KT5 A;  1PC5 A;  3JSB A;  2UUW A;  2WHO A;  1S76 D;  3BBB A;  3KFW X;  3M6V A;  2YX1 A;  4ZP7 A;  3V2U C;  4OJ3 A;  4IQX A;  3SSS A;  1ZET A;  4DCP B;  1YWX A;  1RE1 B;  2QTW A;  3UPF A;  2C3M A;  1JNR B;  1EX8 A;  1U49 A;  5D77 A;  2FHM A;  2DXF A;  4BHQ A;  3MHY A;  2CG8 A;  4N41 A;  2DNQ A;  4I7F A;  4MKA A;  2W2N P;  1WOS A;  1NSA A;  4OZ1 A;  5KFU A;  3RUB L;  1DTT B;  2F4V J;  4F02 A;  4DUY F;  2ZC3 A;  1NND A;  1ZOT A;  4H4O A;  2WSF C;  4LVN P;  1RAG B;  1YJT A;  4LF9 F;  1IWG A;  4A8O A;  2W4P A;  4Z37 A;  1UZD A;  1FT8 A;  4UQG A;  4C7Q A;  5A8R B;  4L76 A;  3VZH A;  3O6Q A;  2C3O A;  1ZYQ A;  2FGO A;  2GVD A;  3QSI A;  3IGN A;  2ZBQ A;  2IPO B;  3EXC X;  1JLC B;  3V6J A;  3K17 A;  2MKJ A;  2Z2M A;  2YY3 A;  4ED6 A;  2RB7 A;  2VBZ A;  4Y2M A;  3D54 A;  2F65 A;  4KIA A;  2VZ9 A;  4KKO B;  1R8C A;  3KJV A;  3QRR A;  4O44 A;  4B9T A;  2ADB A;  4YB5 A;  4R25 A;  2CPF A;  2CQC A;  3FBC A;  1UA0 A;  3RRG A;  3TEH B;  4Q8E A;  4A8K A;  1KQG B;  3CJK B;  3MM8 B;  5G0R A;  2IMW P;  4CLY A;  3NEK A;  2Z58 B;  1ZZN A;  3JS9 A;  5AXN A;  2V8G A;  5HI7 A;  3ZZT A;  2YPY A;  1UL3 A;  2I5J A;  5IT9 U;  1V6H A;  3DKD A;  2V8H A;  1L3K A;  2LXU A;  1RDR A;  1BUX A;  2DNR A;  2ACY A;  1WHW A;  1N5T A;  4ELU A;  2BE9 B;  3NRB A;  1ZPV A;  1X5P A;  2CNL B;  4N5S A;  2ZH3 A;  2HRY A;  5KFI A;  2OIH A;  2M52 A;  2MTL A;  1JX4 A;  1VYA A;  1Y3K A;  4ZPC A;  3SQG B;  3TA1 A;  1QSS A;  4LVO P;  5ETS A;  2BVZ A;  4NLO A;  3R7N B;  1RT4 B;  2LEC A;  2DGU A;  1I1G A;  3TAR A;  1MRO A;  3PY8 A;  3FQK A;  4M8L A;  1U2C A;  4UZC A;  2VFT A;  4R5P A;  1A0O B;  4YQW A;  1J5E J;  3L95 X;  1CJU B;  5HBM B;  4KGK A;  1RU1 A;  3DRS A;  2VFU A;  1U7L A;  3BO3 A;  1N88 A;  1PJ7 A;  1HYS A;  2WOM A;  5KG4 A;  4UY8 5;  1RAB B;  2CJK A;  2FVS A;  2R8H A;  1FXL A;  2LLZ A;  4PUO B;  4C2M A;  1U1R A;  4Z7C A;  2YNI B;  4CTA B;  2BE7 D;  4ILR A;  2QZ8 A;  1HBU A;  3NOG A;  2VAS A;  4FZV A;  4PWW A;  3R1L A;  2GNK A;  3CDA A;  1CS4 A;  1N5V A;  2ZH7 A;  1HNI A;  3HD1 A;  3W2V A;  3BV8 A;  4IRC A;  3S1T A;  3OPK A;  3M9M B;  3M32 B;  1UVK A;  1HI8 A;  5E33 A;  3OVB A;  2DH7 A;  2RKI A;  3DM2 A;  2ZZM A;  3TNV A;  3B8H A;  2VBW A;  3PFE A;  2DR9 A;  4DBQ A;  2OPR B;  2ZOG A;  4DQQ A;  3V6D B;  5J2Q B;  5AT1 B;  5F9L A;  1GXT A;  5LMU F;  4HYK A;  1BE4 A;  3A8I A;  2GJI A;  1TVR A;  4DV4 J;  2RDD A;  1FES A;  1DJ0 A;  2ZVS A;  3CJ4 A;  4W98 A;  1WEL A;  2YXL A;  2YX4 A;  4B9N A;  3UO0 A;  1VRT A;  2IRU A;  1KHV A;  3PW5 A;  2R7W A;  1JK9 B;  3OTD A;  3JB9 k;  1I94 J;  4DU8 A;  2XCP A;  4CLZ A;  3H5S A;  3IRW P;  1NPK A;  1S97 A;  2A1B A;  1GXU A;  1CJV B;  2HQF A;  4EU0 A;  3LGN A;  2EK6 A;  5K14 A;  2CVE A;  4JI4 J;  1H98 A;  3GFY A;  2JSX A;  4KB7 A;  5HP1 B;  1HWU A;  3GON A;  4OYW A;  4QIF A;  2F9J A;  7FDR A;  4DF4 A;  4C11 A;  5T14 A;  5DGA A;  1JLQ A;  3BM7 A;  1YZ6 A;  3W60 A;  2X1A A;  3W2W B;  3K57 A;  4LFC F;  3RB6 A;  2M8D B;  3SV3 A;  2OJ3 A;  4Y00 A;  1QJH A;  1CC7 A;  1YRX A;  5BYS A;  3GG0 A;  1SVD A;  2L9W A;  3E8O A;  4FF3 A;  5A2Q Y;  3CJ0 A;  3VAG A;  4BWM A;  4I6Y A;  5L1L A;  5A0Y A;  2C42 A;  4PYD A;  2D7S A;  3UCU P;  2IBK A;  3ICL A;  5CD4 H;  3QMQ A;  3BSO A;  3CDE A;  1HQU A;  3EIC A;  4LF6 J;  2D3U A;  1Q53 A;  2XMW A;  4ES2 A;  2MLY A;  5D4N A;  4OX8 A;  3W61 A;  2IBO A;  3PRD A;  4ED0 A;  3OUY B;  4A46 A;  5K20 B;  4NLQ A;  4YY3 J;  1NAQ A;  4F4Y A;  3DCA A;  3I31 A;  4M5J A;  2HZC A;  2ABY A;  3MMB A;  4G1Q B;  1KVK A;  1XMB A;  2PA8 D;  1YJU A;  3C6U A;  4FVM A;  5C24 A;  2FTR A;  3R7S B;  2PD1 A;  3DLE A;  4LRB A;  1VFJ A;  3EDR B;  3KK1 A;  4HLB A;  5H1S V;  1BMQ B;  4ZLN A;  1CQM A;  1LW0 A;  1V5V A;  3D28 A;  1ZM9 A;  4K2J A;  5HVG A;  2BQR A;  3UFC X;  4W92 B;  3O5T B;  2MLZ A;  1RT7 A;  2CG4 A;  1WD6 A;  1RT3 A;  4PPZ A;  1T11 A;  1QD1 A;  4IG3 B;  4HHU A;  1VI7 A;  3IG1 A;  2VA2 A;  3MD1 A;  3S8S A;  2HHH F;  2HW3 A;  4MYT A;  3PX0 A;  3HHK A;  2J6U A;  3HX9 A;  4IKA A;  5ETN A;  3TVY A;  3FFI A;  4CO4 A;  3J81 j;  1S1U A;  1VRU B;  2WON A;  4PPD A;  3RB3 A;  1XC9 A;  5HVF A;  3TR5 A;  4ZVO B;  2VJU A;  2KZM A;  3DOL A;  3BGO P;  3DRP A;  3G8Q A;  4K4V A;  3I32 A;  2BRK A;  4G65 A;  3PJX A;  3NAH A;  4Y2C A;  3ZZP A;  1LWE B;  4LRA A;  4J9K A;  1FFS B;  4P10 A;  5EX0 A;  2EFQ A;  2E7X A;  1J5O A;  1VJW A;  2XLJ A;  1VCT A;  5L38 A;  3QT5 A;  2FJD B;  3V6K A;  1RT6 A;  3ETM A;  1QDU B;  2ALY B;  5EWF A;  4K2X A;  2ZH9 A;  1BQN B;  1LWX A;  2DHA A;  3DOM B;  2DIV A;  3M05 A;  4EYH B;  1F9F A;  2DHG A;  1LK5 A;  3OSP A;  2FYX A;  2VKZ G;  4Y65 A;  3NWR A;  3J80 U;  1IVZ A;  1F6T A;  2YQ1 A;  3FZB A;  1ZAW A;  4HKQ A;  2AWZ A;  3DLL Q;  4U7U K;  4IO1 A;  3FGV A;  3O44 A;  4OX7 A;  1ZS6 A;  4XTT A;  1ZPW X;  5K8N A;  5GAD I;  4ITS A;  2B4P A;  3W9I A;  4U96 A;  1VJQ A;  3QGG A;  4MIW A;  1X4H A;  4DPO A;  3CD6 S;  3AXK A;  1YGY A;  2NQP A;  4IRK A;  4RNH A;  4R0E A;  3HHL A;  2E5I A;  3N6M A;  1S1V B;  2UXD J;  1SC1 B;  4P73 A;  1WNE A;  3CE8 A;  3J81 U;  1VBK A;  4J9Q A;  3OVA A;  4ER8 A;  4NZ7 A;  5KFF A;  2F63 A;  1K0T A;  2VQF J;  2DVI A;  2EK1 A;  2QC3 A;  5AE1 A;  1B7Y B;  1GMW A;  4CCH A;  3MM9 B;  2VG5 B;  1R3N A;  1Q7L B;  4LF5 F;  3KLI A;  1SQE A;  4LIW A;  3JXO A;  8ATC B;  3DLB A;  6AT1 B;  2ZEJ A;  3AT1 B;  4EEY A;  3MZI A;  4O4G B;  2GML A;  4DG1 B;  1AZS A;  2IYG A;  5LMN F;  1WKJ A;  2CZ9 A;  2L48 A;  4O0I A;  2R3V A;  1S6Q A;  4DSF A;  3VGS A;  2QL7 B;  4ZPB A;  5J2M A;  1NSK L;  4UOF A;  3CDU A;  1KLM A;  3FZ2 A;  4JI6 F;  3GP9 A;  2DRA A;  5IV4 A;  3UVJ A;  2F3J A;  2HWT A;  5DDR C;  1RAJ A;  2CQB A;  2LQJ A;  4LF8 J;  2XUL A;  2NSC A;  3WDO A;  1SV5 B;  1WTB A;  3ZZU A;  2IAJ A;  1T7P A;  2J7U A;  3H2U B;  1OMS A;  2HFU A;  1CBK A;  1S59 A;  1FFG B;  2HFS A;  3LGM A;  1U4B A;  2VG7 B;  4X4T A;  3NCP A;  4DR6 F;  2LYV A;  5A8R A;  1L3V A;  4QU6 A;  1U02 A;  2DKO B;  3BDP A;  3QRQ A;  5A8W A;  1KNZ A;  3GZ7 A;  4USM A;  4OHY A;  1O51 A;  4HL9 A;  2D74 B;  3R2C J;  2Z30 B;  1FJC A;  5CHC B;  2B3T B;  3MR2 A;  1DTQ B;  5EWE A;  3MWB A;  4EYI B;  4I68 A;  3UDE A;  3PNI A;  4ELT A;  4CRJ A;  3I82 A;  1D0E A;  3J7Z 5;  1SKW A;  3KK3 B;  3CJK A;  3MM8 A;  5C42 B;  1HD1 A;  2B5J B;  2RUG A;  3DI6 B;  4ID5 A;  1OY9 A;  2R42 A;  2FY1 A;  1YSJ A;  1ZA1 B;  2XC9 A;  4KPY A;  4MK7 A;  4OLP A;  4TKT A;  4YOE A;  3FVY A;  5BR8 J;  3NP5 A;  4KV8 B;  4DI6 A;  4CNY A;  3G6V A;  3J7Y I;  4P2M A;  1F5A A;  3KJF B;  3PZP A;  3ETO A;  4DV5 J;  4ZVS B;  2AMC B;  2K3K A;  5ADZ A;  2RAQ A;  5KFJ A;  3OTO J;  5LL6 d;  3EGV A;  1OQ6 A;  1UEV A;  2AYM A;  1UTA A;  1NJX A;  4LF2 A;  3N5F A;  4O0N A;  1O0P A;  3C66 A;  3MMC A;  3HVT A;  2KFZ A;  4DQP A;  3O8W A;  3NL0 A;  3BF4 A;  4K5S A;  1RTD B;  2UV8 G;  3QAT A;  1GTH A;  3LA0 A;  1C0U A;  4F0K A;  4U67 Q;  4ALZ A;  1CJU A;  3AB2 B;  2W7O A;  2XZW A;  3GFZ A;  3H20 A;  4OZJ A;  3PKY A;  5F8G A;  1ZAX A;  2BOP A;  5HMX A;  3OR1 B;  4G3I A;  4G1I A;  1A9N B;  4F4Z A;  1E6Y B;  3MPU B;  1R8B A;  2ERR A;  2AF6 A;  1U45 A;  3QJP A;  2MHN A;  3NAI A;  3D6T B;  1LV5 A;  1IBC B;  3CCS S;  3DOK A;  2PMZ D;  1SJR A;  4JI5 F;  1S5Z A;  3A13 A;  1WC4 A;  1X0P A;  4ZPT R;  2PDA A;  5DS7 A;  1R0A B;  3B6B A;  2J7K A;  3P5B P;  2YKA A;  3PYG A;  1KQS R;  2BE2 A;  2MGZ B;  1RHK B;  4R8U A;  1U6F A;  2R2R A;  4AE5 A;  2CQH A;  3I6P A;  1NK5 A;  1C1B B;  4AL7 A;  3C2P A;  1FKA F;  2DEJ A;  1GQE A;  3NNC A;  2XBP A;  1JMT A;  3AJ2 A;  3K5M A;  3MAA A;  3THV A;  4I56 A;  9RUB A;  2IDL A;  1N6Q A;  4WZM A;  2Z2Y B;  3EWG A;  1TUV A;  1IR0 A;  3N9U C;  4DV6 F;  3IFE A;  3NMR A;  4DLG A;  2KTQ A;  3ITH A;  3QFH A;  2DR6 A;  3IN5 A;  1RTJ B;  3TYT A;  3RRK A;  2YX7 A;  1TU0 B;  4NEY A;  3EPG A;  4KGV B;  5JJB A;  3AQP A;  1TKT B;  3P3D A;  2LQB A;  2JH3 A;  1LFW A;  2XI3 A;  3MMA A;  4ZN3 A;  2HFZ A;  1NBE B;  4EWT A;  1JLB B;  3WHI A;  4TY8 B;  4ZJL A;  4DJB A;  4F67 A;  5HP1 A;  2RQM A;  3CJS A;  5KFQ A;  1YQH A;  3CDW A;  3FMB A;  1XIQ A;  3MF5 A;  5HLF B;  2DNL A;  2ZH4 A;  2JWN A;  4S0M A;  5HMZ A;  3HFV A;  3PRV A;  4N8O A;  2DY1 A;  2VOD A;  4DFM A;  2E5H A;  2NPF A;  5IXU A;  1JLF A;  4RPF A;  2BJD A;  1CJK B;  3MEE A;  4WYW A;  4FNH A;  2J6S A;  1SJF A;  1LXN A;  2RRN A;  3R7B B;  5I3Q A;  4CT8 A;  1T9V A;  3MM6 B;  3C46 A;  1HNW J;  3CCW A;  3RBE A;  1IBM J;  2QLW A;  4DL2 A;  2J9D A;  2CUY A;  4DV3 J;  3RR8 A;  2HFO A;  2AEM A;  1NHV A;  3ZTP A;  1KSP A;  3JSR A;  2KHC A;  3KLG B;  2QYC A;  3BEG B;  3M6U A;  3OUY A;  1N5Q A;  3G96 A;  2D9O A;  4X62 F;  2K1R B;  2NPI A;  2G0I A;  3HHN B;  2F9D A;  2PE8 A;  2VOO A;  1YIJ S;  3MCO A;  4L3N A;  2RIL A;  3UI3 A;  1Q86 T;  1ARO P;  1FKP B;  4NWB A;  5FJ4 A;  4I64 A;  2LU1 A;  3M30 B;  4P2X A;  4G1Q A;  2XNQ A;  3MR3 A;  4PWU A;  3CTR A;  3JSY A;  4DWI A;  4CYU B;  2J76 E;  3LP1 A;  4WXW A;  4C97 A;  5JXS A;  1TL7 A;  1JXE A;  4PWD B;  4CQ1 A;  4GKJ F;  2DNG A;  3IO1 A;  1X9S A;  2B4O A;  2P8I A;  3BN7 A;  1RLD A;  1RBA A;  3OL7 A;  5FDL B;  2V8P A;  1WAC A;  2Z57 B;  3TJ8 A;  5F9N A;  2VC0 A;  1U09 A;  3PW4 A;  1BGX T;  2D3Z A;  2OEL A;  2C3Y A;  3BBC A;  4NLD A;  2M7S A;  2D69 A;  4CO1 A;  3M2V A;  1VRU A;  2ZZT A;  2IY5 B;  2NRE A;  1EKR A;  5CZV A;  4KHM A;  3R6L B;  2HQ3 A;  2DHS A;  3CJ3 A;  1S72 S;  4F4X A;  3P96 A;  4LFB F;  1DY3 A;  1M5K C;  3V6H A;  4PCQ A;  3NOC A;  2E29 A;  4AT1 B;  4WU2 A;  3W8P A;  2MHE A;  4QR2 A;  3OJU A;  1N0V C;  1IWA A;  2AYG A;  2MPU A;  4ZVR B;  3JQK A;  2IYI A;  2M3D A;  2OPQ A;  2AJ4 A;  2L9D A;  1IXK A;  3DHW C;  1HBN B;  4LF9 J;  5DLG A;  1HWL A;  4PRF A;  3QIP B;  2JJ4 D;  2FZK B;  1FK9 A;  3WQP A;  2UP1 A;  4LSZ B;  4USI A;  2V0N A;  2DNY A;  4QWD A;  3C14 B;  4FKX A;  4AL6 A;  3DOM A;  3FC9 A;  5MLC V;  1KDN A;  2GFF A; 
#chains in the Genus database with same CATH homology
 5CAB A;  3GP9 A;  2AZ3 A;  4HR2 A;  3FBB A;  4UOH A;  3FCV A;  1EHW A;  1LEO A;  4FKY A;  4ANC A;  1NCL A;  1HHQ A;  4WBF A;  4F4A A;  3ZTR A;  1PAE X;  2B8Q A;  3EE3 A;  1HLW A;  3B54 A;  3EMT A;  3FBE A;  2HVE A;  3MPD A;  4DZ6 A;  1NLK L;  1MN9 A;  3EVO A;  1VYA A;  5CAA A;  3BBC A;  2BX6 A;  3NGU A;  3Q83 A;  2DYA A;  3ZTO A;  4F36 A;  3ZTQ A;  3ZTP A;  2HVD A;  4DI6 A;  3ENA A;  5IOL A;  3Q8Y A;  4EK2 A;  4DUT A;  1S59 A;  2AZ1 A;  2DY9 A;  3ETM A;  4C6A A;  1S5Z A;  1JXV A;  1W7W A;  3ZTS A;  4KPC A;  3NGR A;  1K44 A;  1LWX A;  1MN7 A;  1PKU A;  3FCW A;  3VGT A;  3BH6 B;  3BBB A;  2VU5 A;  2ZUA A;  3B6B A;  4CP5 A;  4ENO A;  1XIQ A;  1NUE A;  3L7U A;  3EM1 A;  3WX8 A;  3EVM A;  3FBC A;  1WKK A;  3BH7 B;  2HUR A;  3NGT A;  1NSQ A;  4O0N A;  1NDK A;  3BBF A;  1BHN A;  1NHK L;  1BE4 A;  1NDC A;  3ELH A;  3Q86 A;  4S0M A;  1WKL A;  3PRV A;  1UCN A;  1NSP A;  2DXE A;  2DXD A;  1S57 A;  1F6T A;  1HIY A;  4W98 A;  3Q8V A;  3Q89 A;  3DDI A;  3JS9 A;  3VVU A;  2DXF A;  3G2X A;  4UOG A;  3PJ9 A;  3VGU A;  1NB2 A;  4ANE A;  1WKJ A;  2BEF A;  4AND A;  5C7P A;  3EVW A;  1NDL A;  3FBF A;  1XQI A;  3DKD A;  3NGS A;  3FKB A;  3EJM A;  3EIC A;  3VGS A;  2NCK L;  1B4S A;  3VVT A;  5BXI A;  1B99 A;  1F3F A;  4FKX A;  3Q8U A;  3FC9 A;  1NPK A;  1BUX A;  2B8P A;  1NSK L;  1U8W A;  1ZS6 A;  1KDN A;  4UOF A;  3VGV A;  1NDP A;  3R9L A;  3GPA A;  2CWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...