1JXVA

Crystal structure of human nucleoside diphosphate kinase a
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
149
structure length
149
Chain Sequence
b'CERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside Diphosphate Kinase A
molecule tags Transferase
source organism Homo sapiens
publication title Crystal structure of human nucleoside diphosphate kinase A, a metastasis suppressor.
pubmed doi rcsb
total genus 42
structure length 149
sequence length 149
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2001-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1jxvA00
1BHNA 3MPDA 3ZTPA 2NCKL 3VGSA 1NDCA 4FKXA 4F4AA 1EHWA 1XQIA 3ELHA 4DZ6A 1NDLA 3ZTRA 3EMTA 3FC9A 3PJ9A 3NGRA 3Q8UA 4DUTA 1PAEX 3DKDA 2HVEA 3EM1A 1W7WA 3NGTA 1B99A 1S57A 3WX8A 2HVDA 3EVWA 1F3FA 3ETMA 3EVMA 2HURA 3PRVA 1S5ZA 3FCVA 4W98A 4CP5A 4FKYA 3FBEA 3Q8YA 1NDPA 5IOLA 1NUEA 3EJMA 3FBCA 1WKLA 3B54A 1MN7A 1NB2A 3BH6B 1HIYA 4EK2A 4KPCA 4F36A 3Q86A 4S0MA 1WKKA 3BBCA 1LEOA 4UOHA 1HLWA 3FBBA 4WBFA 1MN9A 1KDNA 3BBBA 4UOGA 2B8QA 1UCNA 4O0NA 3ENAA 3R9LA 1S59A 2DXDA 3FCWA 2ZUAA 2BEFA 3EICA 3G2XA 1F6TA 3NGSA 2AZ3A 4UOFA 1BUXA 1NLKL 3FBFA 3VGTA 3VVTA 3VGUA 3VGVA 1K44A 4HR2A 1NCLA 5CABA 5CAAA 4ANCA 2CWKA 3Q83A 3BH7B 4DI6A 1U8WA 1NPKA 2DY9A 1VYAA 1JXVA 2BX6A 1ZS6A 1B4SA 2DXFA 3GP9A 1XIQA 5C7PA 3FKBA 2B8PA 3GPAA 1BE4A 1NDKA 3Q8VA 3ZTSA 4ANEA 3VVUA 3L7UA 2AZ1A 3DDIA 3B6BA 3ZTQA 1WKJA 3BBFA 3EE3A 1LWXA 3JS9A 1NSKL 1PKUA 3ZTOA 4ENOA 2DYAA 3EVOA 3Q89A 1NSQA 4ANDA 5BXIA 1NHKL 4C6AA 1HHQA 1NSPA 2VU5A 3NGUA 2DXEA
chains in the Genus database with same CATH superfamily
1BHNA 5ETRA 2QYGA 3EXCX 3PW4A 2IFXA 3CVKA 1Y10A 3OTDA 4QYRA 4ZCKA 1JJ4A 2QLBB 2H51B 3HFKA 4NLVA 3J7Z5 4C8KA 4B3OA 4LF1A 3QGIA 3J7YI 2VC1A 3I6PA 1YJ7A 1MMNA 2C2ZB 2J9EA 4LF2A 4DZ6A 5EGYA 1VIOA 3QMQA 4J5OA 3H5YA 2FLLA 1HBUB 1DTTA 1W26A 1SC6A 1Z2LA 3W2WB 4C3KA 2OD6A 4I68A 3GLJA 4O4RA 2OGUA 3FDSA 4F0MA 2CJKA 2DRAA 1FHTA 4USKA 5HL7Q 2OTJS 1K1QA 2HVEA 3MM8A 4TU8A 2N82B 1VFJA 2DNZA 1F5AA 2KKHA 1HARA 2VH7A 3IS9B 2CA9A 2F4FA 4OL8A 2F7VA 2B4OA 2HVDA 3EVWA 1N6QA 1UZHA 5H9FK 1X9WA 7FDRA 1RTHB 2HIQA 3W9JA 1XMBA 3LA0A 5D15A 3DLLQ 2MGZA 4B3SF 4FBTA 5KG2A 5IQ6A 2C2MB 4OX8A 3Q2TC 2K1RB 4ZVSB 3CJKA 4WKYA 4TQRA 1S12A 1APSA 5CH7B 1UEUA 4IH6A 1SPBP 2ROPA 3KK2B 3L3CA 4A8FA 1FNOA 2V4RA 2MTLA 2FVSA 3UN5A 2WSEC 4HI2A 2YKMA 2GJIA 2W1BA 5B0GA 3Q86A 4IFYB 3OJSA 4KV8B 1WKKA 2PO4A 4DPYA 4N7TA 4FP9A 3L7OA 4NOHA 4DL5A 1UTAA 4WBFA 4RW6B 3BGLA 4B3RJ 3MEEA 2YQ1A 2K8GA 2D74B 3HF5A 3IG1B 1REGX 2CJQA 1H2UX 2LDIA 2HG4A 3R3TA 4DV2F 2BANA 1SH2A 3K58A 2ZJRQ 1IVZA 4WKRA 4O3QA 2OFHX 3BO3A 3OFEA 1CJVA 1Y11A 2J7WA 3NOCA 3PJWA 2VQFJ 3T5KA 1FEHA 4X65F 1XR7A 1RYRA 4K4ZA 1Q8IA 3CD0A 1YKWA 5DETA 4OYWA 2B56A 2FC8A 2QJ3A 3PEHA 1WC3A 4MFBA 2L08A 3JQJA 3Q8QB 4OYIA 1OPZA 3GG1A 4OYZA 2VG6B 3UO0A 2D3O1 4V19J 3UR0A 2RSQA 2E1AA 3W5YA 5C42A 1TKTA 3AOAA 5IV4A 3RAMA 4BDPA 2MZTA 2B9YA 1QM9A 2VFVA 3N28A 3GQCA 1F60B 1LWFB 1DZ5A 4DQRA 3T5JA 4MKVA 4LF6J 1CJUB 2UXBF 3AXMA 4NLXA 2K7JA 5HATA 3MEGA 2FYXA 1HWUA 2JDJA 3R5CA 4FN5A 3TQEA 3WDOA 4A46A 1U6ZA 1VYAA 2D7SA 2V2VA 3CJ4A 2QZ8A 3AB4B 3TAMB 5J2PB 3MCNA 2YNIA 4NL5A 1T9WA 3GTYX 2Y0BB 2BJ3A 3MZIA 4K2XA 5GAEI 3CJ8A 4WFNQ 4JI7J 1FJGF 3QT6A 1EKRA 2OEJA 3FFIB 3KG1A 1JIHA 3D6HB 3SQGB 1OQ3A 5G0RA 2ASJA 4IDKA 4NLTA 1DQ9A 1VOMA 3OXGA 5KT5A 1LWXA 2IRUA 3QGGA 4M5NA 4WP8A 3CCES 3BKUA 2HQ3A 4ECUA 1RHUB 4GKKF 3QAUA 4N77A 5ITHA 1U2FA 3MAQA 2BANB 2ZH4A 4DFMA 2CPDA 2G9OA 1KOHA 2Z56B 1VBXA 4NZ7A 4NI2B 2HHPA 3KLEB 3LWLA 2XLKA 3CO9A 1C0TA 3GJTB 5IFMA 4C8YA 2Q79A 3QPIA 2E1PA 2NXCA 2B9WA 2IM3A 2XWXA 1HQEA 1PYOB 2H5EA 4HH1A 4CRJA 1N5YA 1C1CA 3DYAB 4RNHA 3LP0B 3CF5Q 5GAGI 2M52A 1BWEA 5LL6d 4O23A 4ICLA 2LYVA 2D9OA 3BO4A 2YWEA 3OW2R 2UUAF 1LK7A 1P8GA 4OYOA 2OUGA 2VG7B 2O1PA 3NAHA 2BQRA 1Y0HA 2MQOA 1SH0A 3EM1A 3FEZA 3NEKA 4TY8B 5FDLA 4JI8F 1U1RA 1HNZF 2QX0A 2Z2YB 3MEDB 4LQ9A 1H74A 4KQZA 5DQGA 1DARA 2NXEA 3F56A 1CG2A 2OO4A 3E8OA 1NKBA 5H9EJ 2FC9A 4DQSA 3AQOA 4J9VA 2VBWA 2EI5A 3THTA 4YQWA 2BV3A 3CCRS 5GVQA 4P71A 5LSRA 4Q8EA 4R0JA 4I6WA 1WKLA 4FXWA 5KFDA 1T8EA 1IBMF 1U1NA 5GADU 2DY1A 3DLHA 4F36A 2MB0B 1RAFB 2FJWA 3GB0A 3MCOA 3R6LB 2XS2A 4Z7CA 4U6PA 4WIQA 1TL7B 1KC8T 1H0HB 2HEKA 1G2EA 2MPUA 4DL2A 4MFBB 3PFOA 1J5OA 3C16A 4M5JA 1R27B 2A1BA 2ZWPA 2DGXA 2ZNZA 3NBPA 5BJRA 3VCDA 2DCUB 4CT8A 5J2NB 1Q86T 1UL3A 3B4MA 4DV6J 5LT5A 3BEGB 3DNCA 4MJKA 3TYTA 2CNOB 4K4VA 1IXKA 2W9BB 2DXDA 3SFGA 4CLKA 5DM7Q 1VHFA 3LP2A 1U1PA 2HHQA 3E2EA 4X4UA 4MK7A 1L3VA 1GK8A 3TJ9A 4DX5A 1FCAA 4HTJA 4DUYJ 2KO1A 1DTQB 4RW6A 5L38A 4ZVEA 1U48A 2HS4A 1RDRA 1RAAB 2XI2A 3GIMA 1Q53A 1JLQA 2O3DA 3C8YA 3F41A 1BQMA 1FDNA 1N56A 1RAIB 2J6SA 2IBOA 4LF4F 2B7CB 4O4GB 4K59A 1IKVA 3UCUP 2HGLA 1C0UA 3D1OA 2RQKA 5LJ3Y 3MM9A 4XPEA 1FRJA 4U7CA 2R7XA 3A3OB 3AB2B 5KFRA 3UVJB 5M2PA 2WVBA 1T9UA 1SJRA 1N5SA 2KJWA 2XHCA 1VLYA 1WI6A 2L9NA 1GX6A 1UPMB 2MLYA 3QQCD 4I7FA 4ZVQB 2DK2A 4C3LA 2FPHX 4F4ZA 4DF8A 1ULRA 3AJ2A 1HBOA 4M5GA 2GV1A 5KFHA 2EFQA 3NGKA 4HLBA 4B9VA 2JVRA 3H5UA 2HKEA 4LF9J 2ZDPA 2R3VA 3HSDA 2OAUA 4TLQA 1WJ9A 1WHXA 1KP6A 3M6UA 1FRKA 5D4LA 5ETVA 3M1VB 4OZ0A 5F8GA 4A8XA 3JYTB 2R2RA 3LP1B 3ZFVA 4ZPAA 4BLGA 2E9RX 3TZZA 3ZTQA 2B4PA 3BN7A 2DNMA 2HNZB 3FUYA 3DCAA 3MAAA 1NSKL 4L3NA 5I3UB 1QLNA 3FQLA 4Q43A 3TRGA 4J9PA 2YTCA 2XY7A 1S72S 4ANDA 3LQVA 4IRCA 2HRYA 2ZD1B 2JFKA 4ZJOA 3TW0A 4AT1B 5IC6B 4DCJB 5JMNA 2EK6A 5KFOA 2YX1A 2LQ5A 3TUPA 4IG0A 1FJCA 1FVQA 2ZBPA 1NJYA 2I5JA 4GKJF 4UOCA 1SQFA 3NWGA 2V5HG 4LRAA 2GMJA 2IDLA 1TL7A 3NNCA 4YUDA 1MWYA 2DEIA 3VGSA 6FDRA 2ZUGA 1D9FA 2K06A 1PIEA 1FE0A 2MSSA 4OI4A 3C16B 2HHUA 2EBEA 4PWDB 4M5IA 4R8UA 3BKFA 2CQHA 4Q5VA 2FTRA 2XBPA 4P74A 4QU6A 2OEMA 3NGRA 1SQEA 3R27A 5IC4B 2UXCF 3QBCA 2L9DA 3MTJA 4WPAA 1KQFB 4K4TA 4CO5A 2CVEA 3KUGA 2MZRA 3CGIA 1KLMA 1KBRA 5KFBA 1FESA 1TK5A 1S57A 1RA7A 4KSEB 1FDAA 1F3FA 1TL3A 2DIUA 3CC2S 3EVMA 2LVWA 4JI6J 1U25A 1SL0A 1F1BB 3ILJA 3MECB 3RG6A 3V6DB 1UA0A 1R8PA 4DR6J 2H3EB 3LAMA 3GIIA 4ERDA 2QA1A 2NYHA 3IWLA 2BUNA 5CCLA 1F9HA 2CQ0A 2H4YB 3OLBA 2FHJD 1TK8A 1HNXF 1S9EB 2Z4PA 5HLFA 1RSCA 1VJWA 4GVBA 4HACB 2V9KA 1TL4A 2J9DE 1HNVB 2NZCA 4TY8A 4HYKA 2VOPA 4DWIA 3QIPA 2RKIA 4LFCJ 2I5JB 2HHSA 1V5IB 1SUQA 1WF0A 2PMHA 1RBLA 3OR1A 4EEYA 3TQ1A 3BDEA 1RAHB 3KLHA 1FT8A 1ZPWX 2BACA 4IO9Q 2L48A 2A2DA 2VFTA 2D9PA 4ALZA 5D78A 4QR1A 1Q78A 3HULA 4UT4A 2F8EX 1RT2B 4ZLPA 5LJ5Y 5LMNF 3J7A1 3V4MA 3TEGA 2MDAA 3C14B 4DCPB 4BWMA 1UVNA 1HPZB 3CCVS 3SEOA 3T1HJ 1OS5A 2CUYA 2XMVA 3K7RA 3DI6B 3R9LA 3GFYA 4ECXA 1Y3JA 3KLIB 4L74A 1BXNA 2DISA 5IQQA 3KOAA 2QC3A 1F3VA 1DURA 1VRUA 3FSYA 1EARA 1M0SA 3JSYA 4G1QB 2ABYA 4ZVOB 3SV3A 4NA2A 1WDTA 5D0HA 1MLAA 2HK3A 4WCEQ 1IBKF 2J6TA 3MPYA 5HBMA 2E9TA 5KFJA 3Q22A 3C6UB 5C24B 1FRIA 2BBEA 1DQAA 4PG7A 1QE1B 2BKOA 3I4HX 4I2QB 2WONB 2XI3A 4C11B 2UZAA 1G1XA 4BS2A 1U4BA 4JI0F 2QRRA 4PRFA 1XNQF 3SQOP 2HQIA 5LOQA 2LXUA 3QIPB 4JI2J 4QU7A 2MZ1A 3CDBA 3JTPA 2R2SA 3D54A 3THVA 1JKHB 3IRXA 4DLGA 2HFOA 2MJNA 4PAAA 1K9MT 4JI1J 3KWMA 5CZXA 2V34A 5HJXA 2GHVC 3OD2A 1WG5A 4JI4F 4RUCA 1O0PA 3RB0A 2H48B 2VKRA 3OFHA 3IS9A 1I5OB 3MUTP 2DO0A 2GAHC 4OI2A 5L39A 4DV1J 3QGHA 3RJMB 2AJQA 3LALA 3CDWA 2AV5A 4EO8A 1NKEA 5F8NA 2N7CA 4OHYA 2XMJA 2Y1LB 3OR2A 2GIQA 1Y7PA 3Q89A 4WK1A 4ZP9A 1ZBTA 2HNDB 3GJRB 1RWPB 2FJBB 4IQMA 4OJ1A 4KKOB 1O6XA 5EX0A 2F4VJ 3U02A 2J0WA 4C8NA 1HHQA 2MEWA 2JEFA 2LQBA 3GYNA 2PD1A 4ELUA 1ZAWA 3R7SB 3DGVA 2YPYA 4ECYA 2YKPA 4C8MA 4OV6A 1W25A 1Y9OA 3U7JA 1NK4A 4URGA 4KH1B 3QO9B 2ZH3A 1UFKA 1NDCA 2VC0A 2Q3PA 3OTEA 4Y0FA 1XQIA 3AD8C 4EBEA 4J9UE 3HJFA 3KJNB 1UEVA 3ZZUA 2RQCA 2VKZG 2FY1A 4PR6A 3D4JA 3EMTA 3IRXB 3OR1B 1S1VB 4K4XA 1KR4A 3UCGA 1YITS 2ZOGA 3H40A 3KLHB 4O3SA 3M8RA 1X4AA 2W4CA 1X0PA 4GVBB 2FHJA 1L5UA 3FFIA 2GFFA 2LA6A 4I0WA 1AUDA 1XJWB 4Y2CA 4NLUA 1WUUA 3R1HA 1AW0A 4DR4F 2UU9F 5CYMB 1S97A 3EDQB 4C7QA 4LUBA 1TFYA 2ROEA 5KFZA 1LWEA 2B7BB 4M5HA 4KGMA 1QE1A 1I1GA 4JYAF 2GO8A 1N88A 5A76A 3TANA 2HHVA 4CP5A 2Y1IA 1QSLA 1AYEA 4U96A 1E6VB 2WZ1A 4RBTA 3ILOA 4CH1A 5IV3A 5F8IA 2E5IA 3HZGA 1L3UA 4Y6IA 4OX9F 3I9ZA 2Y3YA 3P8BB 2AF6A 4YHHF 1X0FA 4YY3J 1X8DA 2RDIA 4RWWA 4KPCA 3P4UB 2UUTA 5SUHA 2CYYA 5B08A 1R0CB 4ZP7A 1T03A 1C4CA 2QO3A 3TJAA 2E7XA 2XMMA 2B4UA 1I3OB 2F65A 5I42A 1NK0A 2UVUA 3PO5A 3ENQA 3QIDA 3DLKB 1XMQF 4CO2A 1UMJA 4XDDA 1LXNA 5FD1A 1IN0A 3M30A 5HK4A 4R5PA 2W25A 4N5SA 2OPRA 4MKAA 1GMVA 3IN5A 4CCHA 1S0VA 4ZPCA 3TNVA 1HI1A 4ED8A 3M9OB 1H2VZ 4WFYA 3ADAC 5IS2A 1K73T 4X64J 1N33F 3ITHB 2JEJA 1GXLA 2QEXS 1FX2A 2DR9A 2HAFA 3MM6B 1D9DA 1U0SA 3FBFA 1G7CB 4RBUA 3PKMA 2VL1A 2C2EA 3ENVA 2LP4A 2BDPA 2ACMA 2V4QA 1B64A 2GGPA 4MKBA 3GIRA 1XBWA 1XR6A 3VGVA 4YR0A 4X62F 4EO6A 5BR8J 3HVTA 4LRCA 2C3OA 2R42A 1ZETA 1U1LA 2CWXA 3KLIA 1A6LA 3ZNJ1 4GC6A 2BR0A 1D1UA 3NWRA 1SI9A 2PEHA 4PQUB 3CULA 2IJRA 2NPFA 3EWGA 3KK3A 4UY85 3H5XA 3GP9A 3N5FA 2WVDA 5C25A 2MZQA 1XIQA 4URQU 2DHXA 1IQTA 2WBRA 2F63A 3DLEA 3FGVA 4FXVA 3W7BA 1UAWA 4UUXA 4USTA 1ZZNA 1VQ7S 4LREA 3DGPA 4X4VA 4DPWA 1TV6B 2BJ7A 1UZDA 4F4YA 2XULA 4HDGA 1HBUA 4IOCQ 2AZ1A 4HH0A 1YBUA 4A47A 2E1MC 2LU1A 1HW8A 4TU9A 3VTIA 4NRTA 3QRQA 2FJXA 1U2RA 1OJ4A 2V8DA 3R7NB 1R8BA 1Y3KA 2A2CA 2Z57B 3JSRA 2EBGA 3RU0A 4EI2A 1UWBA 4DV3F 4DV5J 2CNKB 2LKZA 2IA6A 1NSPA 4Q2LA 4K8RA 4CQ1A 2AGPA 1S4EA 1PBAA 2HHHJ 2C42A 3PACA 5GAHU 3M1VA 3JYTA 1SKSA 4LQ3A 4HHJA 3OVBA 4DR7F 3D66A 4IG3A 1S1TA 1IKYA 3CCJS 4AD6A 5RUBA 1S6PA 2KT3A 5KTQA 3HHLB 4KRWA 3DRPA 4A48A 2GMLA 2WW8A 2DCLA 3L7PA 2E1CA 2A6MA 2RF2B 3SDEB 5LSLA 2UXDJ 1CEZA 3KJVB 2J6UA 1O51A 1YZ7A 3FC9A 3R5AA 2HGNA 3KHGA 2GQCA 3MMCB 4IH5A 1IJFB 4U9RA 4R5PB 1KN6A 3CJ3A 2F1FA 2Y8WA 3HP6A 1IR0A 3ET6B 1KTVA 1X7VA 2D3ZA 3FRZA 3MM9B 5KFLA 4KTQA 2HHXA 5F9NA 2AYEA 1TU0B 2H54B 2KB2A 5I42B 3HKZD 3W2WA 3VAJA 2DNOA 1B0PA 3BB5A 3H5SA 1KVIA 1SKUB 3UN3A 3H2VE 4DR6F 1S49A 2XMKA 4ZVFA 4CI0B 1ROFA 3AT1B 3HMJG 3G71S 4J9KA 3WIVA 3DRRA 3H25A 4ER8A 2LECA 3SSRA 4NX9A 2DVIA 1S4FA 2HNZA 3PX0A 3UNGC 2C1EB 5L9NA 2LA4A 1L3SA 1NDPA 3MI7X 4OJHA 2EW9A 3G8QA 4IDKB 1CQNA 1HNIB 1NUEA 3RRKA 3PIOQ 2RAQA 3GIJA 3EZ5A 1L3TA 4BC7A 2UXCJ 1WEYA 2JFDA 3NS5A 2JWNA 4Q7AA 1WG1A 4FS2A 2V0NA 4A8KA 3K0JA 4OI1A 1N5TA 4JBCA 4Q0BB 1N34F 3AHPA 3KLFB 2CQDA 3KKFA 4NLPA 5AJ3F 2UV8A 1PJ7A 2X1BA 5AE2A 4L3KA 4RU9A 2MQLA 4O3PA 3Q0AA 1HHTP 3D6TB 1N33J 3VAKA 3MM6A 3V6DA 1DRZA 3JQMA 5HI7A 3T3FA 2IVMA 5AXLA 4PEOA 1T11A 5E3CA 2AEJA 4UF4A 4K4WA 2R7UA 3TUIC 2MZSA 3RGIA 2ZHOA 5DDQC 4DSJA 2ZOMA 1F0XA 2FZCB 2FVCA 3I0RA 2IVYA 3MD1A 4B17A 3POTA 2I8EA 2PI4A 1VQOS 4YR3A 3D5MA 1RWXB 1Q16B 4WXOA 2XGPA 4C48A 1RWVB 4NA3A 3SDEA 1RK8A 1JLFA 2EFVA 2FB0A 3DRXA 1CULA 4F4XA 4DL6A 3J81j 1QSSA 4KO0B 5DO2A 1T3OA 5KOXA 2IYGA 2V69A 1YK9A 3GCXP 4N47A 4YY3F 5IT9Y 3HVAA 5SZTA 1DY3A 4ILMA 2G2YA 3C19A 1K44A 1R0BG 4ETZA 1TL1A 4LF9F 2AW0A 2FHOB 1JJ2R 2F3JA 2W4PA 3KK1A 1RACB 4BC9A 3D1HA 1HNVA 2D41A 4ZCIA 1K1SA 4MIBA 2RHQB 3QSYB 2MJUA 2MQMA 4F0KA 2FVRA 1HWLA 2BE2B 1JJCB 2BE9B 2YWHA 4ZPTR 2R7TA 1SB6A 4PXCA 1YDLA 1HQUA 3DRSA 2ZWOA 1R89A 3N0VA 2GQ2A 2UU9J 2Y8YA 1DQ8A 5H9EK 3OTBA 4IQXA 3BN4A 4QR2A 1T7PA 2Q66A 1CC7A 3FZ2A 4O3OA 3LPYA 3NMRA 1GTEA 4NLYA 2DNKA 4RZRA 3OL8A 4ELVA 2XYPB 4LT6A 3UDEA 2AJ1A 4P7VA 2OELA 5GMEA 4NXNF 2W2MP 2VZ9A 2IVFB 3CIMA 4EWTA 3BSNA 5JJBA 3M2RB 2CPYA 2CQGA 5ADZA 2CQ4A 2VG6A 2VG7A 5KG0A 2WONA 4C11A 2HVZA 4C8LA 1B70B 2OSQA 5C42B 2F9JA 3CJ5A 1VQPS 4PWUA 1FF2A 2V4JB 4LFAF 4LMZA 2G1HA 4PWWA 2R7WA 4WE1A 2HFUA 1NO8A 2V2KA 2PEBA 4NLGA 1VRTB 1FE4A 2CG8A 5EUHA 1YRUA 2F4VF 1CS4B 2OD4A 2BQ3A 5FDLB 1L3KA 1Q7LB 2DXEA 3C2PA 3O5TB 1MROB 5A6PA 4CYUA 5GAEU 1HPZA 3TA1A 4F8RA 3NNHA 5DRKA 3BGRB 2DPIA 3PDNA 3LW5C 2WBMA 4IRDA 3LWMA 3RRHA 3CD5A 4KBIA 2FIUA 3AJ1A 1VRUB 2RQ4A 2OH2A 4X64F 3AOCA 2G0CA 4OJ3A 1RUSA 2DH9A 2X3DA 4IRKA 1SV5A 1T9VA 2ZE2B 4X4NA 2ILZA 4DJBA 3BF4A 3QFWA 1FWLA 2I9SA 3AD7C 4HDHA 2XSJA 2M88A 4DSEA 4P75A 1D09B 1RTJB 4FVMA 4ELTA 4LF8F 3TZYA 4DN0A 4JI1F 3G82B 4USJC 3IR6B 2C3YA 2IC3A 5EHHA 5DGAA 2E5JA 3TZXA 4J91A 1N8RT 4CT9A 4QCLA 5E2QA 4QWBA 1WF1A 1FERA 4KO0A 3CSKA 4NZ6A 3W63A 2KG0A 3UD4P 5HROA 2BE7D 2DRDA 4RKUC 2BJEA 4QWCA 4BBYA 2DPJA 4PUOA 3IWNC 3TEHB 2QMXA 3G87A 5IWAJ 4ZIWA 4KHMA 4OZ5A 2LXFA 3RBEA 3LGNA 1REVB 2IY5B 2E66A 2DHHA 3HK2A 4MKYA 2OKQA 2KHDA 5D77A 2ALZA 4TN2A 4DX6A 2W9CB 5D0GA 2CQIA 1CPZA 5DDPC 1KFDA 1FRXA 4RW4B 1HIYA 2GA7A 2QL5B 1HW9A 5A6WA 1ZM4A 2E29A 3UN2A 1FI4A 3JSMB 1RHKB 1N32J 1NXIA 1IBKJ 2NSCA 3PY8A 1K47A 2GX8A 3T19A 3DLGA 2EFNA 2KFYA 1HD1A 2B3TB 3R5JB 2UV8G 2JEGA 1UKUA 2WCXA 2BE2A 1RTIA 2XYHB 3QATA 1S9FA 2BRKA 3A1YG 1N48A 5KG7A 3ILIA 3OLAA 5DG9A 1Q5YA 4PABA 2K7KA 4KB7A 4DZDA 2NXNA 4Y28C 4NMXA 1X4CA 2YNHB 3SSQA 4CLLA 4LFAJ 4W90B 3G2XA 2M4MA 2QTWA 3M2UA 1S1VA 1WC6A 2DGVA 3QGPA 3U27A 5HMWA 3KHHA 2ZH5A 1R0AA 1HBNB 2IHR1 4DQQA 3B78A 3D1QA 3VGTA 4BWJA 3K2YA 1X4DA 1HQEB 3O2IA 4DV0F 4X4SA 3I87A 5AXNA 3OSNA 5E3RA 4FS1A 5KG5A 4HR2A 4IFYA 3E01B 5CAAA 4HHUA 1N6QB 2DNNA 2CWKA 2HQCA 2GCFA 1Q8LA 3CPWR 4O0IA 3EGWB 4QYZJ 3CO0P 4ILLA 3VQTA 4KKOA 4DSIA 1VK3A 4EFAC 1U0HA 2YWKA 2BXJA 1Y4ZB 2V4JA 3A3PB 3PYGA 3VZIA 1JXEA 3DFEA 4F25A 1T03B 1PO6A 1NEEA 1M90T 4PG6A 3OL9A 2W24A 4LF8J 1A7GE 4DDFA 1VRTA 1C1BB 1KQGB 1W2IA 2B8PA 2JLFA 1B7YB 1H7WA 1SC3B 2P6SA 1QUVA 4PPDA 3GZ7A 5ETQA 4QQBA 3R8YA 3MD3A 3D0HE 3SCKE 5B09A 1EETB 4EUVA 4X62J 5L1LA 3BYPA 4PYDA 4ANEA 2XTJP 3VAMA 3SSSA 4O3RA 3TZWA 1SKRA 3TVZA 3VV2B 5KFSA 1WKJA 4UZBA 3BZQA 3L09A 5L1IA 1YSJA 3G9CA 1RYSA 3HT3A 1HQUB 2K1RA 3DRSB 3CJKB 1R43A 3JS9A 3H2UB 1NK7A 2GVDB 1OWXA 1WHVA 3QSIA 4ENOA 1REVA 3S7RA 3RW7A 5CYMA 3PO4A 4HEA9 3N79A 3AD9C 1UVLA 4NCBA 2HLUA 5HVHA 3CJSA 1S79A 2R8KA 2IAJA 3DLBA 5K14B 2KXFA 5AE3A 4UUWA 1JLBB 2VFSA 3JSBA 3W2VA 1HBNA 4F26A 5C25B 2IC3B 5KFVA 3VAFA 3MPDA 3ZTPA 1PJ5A 5DS7A 1FFGB 2YY3A 2NCKL 4DG1A 1H73A 2ZBCA 4PYAA 3KLGA 4F4AA 5CYQB 3C15A 2KTQA 2R8IA 5AJ3J 3K5LA 2QA4S 2UUCF 4Y3CA 3GR0A 1NDLA 2W7OA 4DS5A 3IBCB 4IYQA 4QIVA 3OVAA 1LOUA 3R7BB 2W8LA 3OSPA 3R97A 2V67A 2IM0A 4DU8A 1SC1B 1S1UB 3CJQA 3GSIA 4QIGA 3TWZA 4WU3A 1VQLS 3NGTA 1U0HB 5HQLA 2H4WB 3IG1A 1NB7A 3RR7A 2XB2D 4U7UD 1T9TA 3GILA 4ECTA 2P9GA 3HDSA 2AJ0A 4JOUA 4ZVTB 3V6JA 5B0EA 2DNGA 3BO2A 4W98A 4FYVB 1P27B 2GJ2A 5F3TA 4DR4J 3D67A 3CCTA 2YH0A 4FXDA 3E01A 2ROGA 3MDFA 4KFBB 2OMLA 3UNYA 1C2PA 4ZJQA 1KEKA 2HRTA 3HD1A 3IP0A 3MGJA 1M5SA 3V6HA 1LXJA 1QDUB 3KG0A 1KQSR 2CNNB 3O44A 3OFFA 2DNQA 4RLEA 4KHPJ 1FKPA 1O8BA 1RI7A 2GVDA 5KFCA 5DGBA 4DUYF 5HROB 3ISZA 2OPQB 1IUJA 1TUVA 1HLWA 4NPOA 1CQMA 1TL5A 2P9EA 4USUA 1AROP 5D4NA 5C2GA 2ZH6A 4J9LA 3BDPA 2PGCA 3D0GE 5KFAA 2QMUB 5FLXU 4NCAA 2EC2A 5HLFB 3EGZA 5ETMA 2KH9A 3R2CJ 1IR1A 1T9XA 4MK8A 4DHVA 1UVJA 1FJ7A 3P49B 3KHRA 1IKXA 2GNKA 4EZ9A 4NI2A 1NSAA 2AEFA 3M8SA 2C2DA 3CCLS 5H9FJ 4G1PA 4WFZA 1F6TA 3NGSA 4N8OA 4CO4A 4YS2A 1WSRA 2RRBA 4TY9A 1OY9A 2E44A 3F44A 5C2CA 2VIHA 1S48A 4ZVRB 2C2OB 3GU0A 1BUXA 4CWBA 2N3OA 5DLFA 1GXUA 1TKDA 3M8WA 3E51A 4D3HA 1N34J 1YLXA 2VBYA 2UVVA 4QYZK 1S1UA 2IPOB 1HFEL 9ATCB 2JOQA 4JI4J 5GMDA 2SXLA 5ETNA 1YJ9S 1X60A 4N41A 3RYLA 3KJVA 3VQSA 4ZHRB 2XG8A 3SCIE 5L1JA 1YG0A 2EEYA 2IDEA 2ERRA 3RTVA 5IWAF 1BLUA 4DG1B 3AAWB 4NWBA 1S6PB 1JLEB 3CMAS 4QBUA 5MAOA 2I1RA 4ZIVA 2E5HA 2J7UA 2YKNB 2QT7A 2IAJB 4NYOA 1TKXB 3W5XA 3TX0A 3POTB 4DQPA 1X9MA 1U26A 1JLBA 2FJDB 4F50A 2IM1A 4CTAB 3CMQA 2DKOB 1RGVA 2ZNYA 5C7PA 4DF4A 1WOOA 2RD5C 3IO1A 5AXMA 4OJGA 4JI0J 3GPAA 2W2NP 3WQPA 1BE4A 1WOPA 2KM8B 2M8DB 2W4DA 3IBFB 4OYMA 3N6NA 5LM7E 3P3DA 3TJ8A 3OUYB 2ASYA 1S9EA 2NXUA 1RAEB 4MYTA 4FYDA 1OYDA 1LQ9A 2ZDOA 3BJYA 1R6YA 3UI3A 2BOAA 1J5OB 4DBQA 1N0VC 3BBFA 1GAOA 2P2CB 3HSGA 1T9YA 4ZLJA 2NREA 5J2MB 1B7FA 2Q6CA 4XTTA 2W7AA 4ES1A 3MF5A 4CDIA 3KK1B 3EDRB 1VQYA 1C0UB 3MMAB 3UWTA 1GX5A 1GMWD 1OSCA 4DR2J 3AA8A 1BQMB 3W8PA 1NK5A 1RT7B 2J76E 3Q2SC 3QLHA 4RWXA 1IKVB 4XO0A 4DV3J 3D7SB 4DSLA 3DU6A 3QT7A 1NPRA 4MIWA 4GKKJ 1S9GA 2DR5A 1GT8A 3US5A 2DT9A 2PA3A 4ZS6A 4BHQA 4RNOA 3CCSS 3T1YJ 2ZH9A 3RRGA 1SL1A 2YKNA 1TMJA 2RS8A 1MMLA 1V3SA 3D3CJ 2HVIA 4KT0C 4KHPF 4YHHJ 1HMVB 3IAS9 3CIZA 3HHLC 4P2SA 1KQKA 3MR6A 1ZTWA 2L41A 3VAGA 2JC1A 1YZ6A 3NXZA 1BMQB 1FD8A 1PC5A 3UDCA 4YEAA 1RWOB 2KZZA 1JLAA 3EX7B 3CCUS 2AJ2A 3OBIA 3W8GA 2CRLA 1E6YA 3PHEA 3T5LA 5I3UA 4IOAQ 2L9WA 4JYAJ 3PR5B 3VWSA 5J2NA 3LANA 4KV8A 3QO9A 1NZAA 4WP9A 1VQSA 4V1Ak 4JV2A 1M5PC 1GXTA 1LW2B 3FCVA 5E7OB 3AH6A 1CS4A 3WBZA 3MM7A 1TKZA 2XY6A 1U47A 3FBEA 1RT5A 1MROA 2XMWA 3RB6A 3QJLA 3GFXA 4LSLB 3SBMA 2OPSA 3T1AA 4F7VA 5A0YB 3I0SB 1M1HA 2CQ2A 2HZAA 2R7VA 3BREA 5DDRC 1MU2B 4XK8C 3T9NA 2ZKUA 5KFEA 3BH6B 3MEKA 2X1FA 4NRUA 4Y2AA 3OTOF 1AFJA 4FDFA 1DTTB 5A8RB 1TVRB 4QPXA 2XM3A 2ASLA 4I7FB 3C3LA 1U8SA 4ID5B 5J2QA 3FBBA 4K7QA 1RT6B 3I82A 4UOGA 3CWJA 4LSNA 4RW8A 4DSFA 5C5JA 1U6FA 1RZMA 1LKZA 3PKYA 4K4SA 1UVKA 1EKSA 1NZ8A 2WHOA 5BYQA 4WTYA 3K5NA 3DHWC 3OFGA 1LNQA 3ENWA 3NOGA 1SKWA 2E5LF 4CTAA 2HPUA 1HHSA 2ZD1A 5K20B 4ED1A 1YJUA 2PC6A 1FKPB 3KG4A 4OZNA 3BQ0A 4LVNP 2HBYB 1AB8A 1YJRA 4I1TA 4P10A 3P96A 2FDNA 3G6XA 5B7WA 1NLKL 3OTOJ 1K8AT 3BGRA 2DIVA 3K89A 1BQNA 2AJ4A 4UW2A 1EP4A 2YKMB 2RUGA 3I56S 2UUAJ 2MZJA 2UXBJ 4ANCA 1KOOA 2J9CA 1RT4A 4TU7A 1RLCL 1R8HA 4J7CA 4L6V3 4K4UA 2MQQA 3Q23A 2P8IA 3DRRB 5KFYA 2YX4A 3PXGa 4OLPA 1RT1B 2PDAA 5LXRA 1FFWB 3BSOA 2OPRB 4C98A 3TVYA 2XO7A 4TLRA 2DXFA 5HQMA 3G6VA 3QAEA 3RBXA 1RWWB 2WB4A 2MY7A 2CVIA 1RAOA 1XNQJ 2IJNA 4LR9A 4YB5A 3H98A 2R7RA 4Q44A 4N8NA 5J2QB 1QAJA 3CNQP 1TVRA 1E6VA 2HWHA 3SXLA 3OV7A 4DV0J 2AIRB 4K50A 2CAJA 4NLQA 5KT4A 3F73A 4PQUA 2POKA 3SYZA 3EE3A 2KXHA 1SUQB 3KTQA 1VGYA 1T94A 5D3GA 2XWYA 1XMOJ 4M63A 1M5OC 2MHNA 2HS3A 5BXIA 4DL0C 1RE1B 2V8PA 1XTZA 3DLJA 3MEGB 4F02A 4F3QA 3BSCA 2XS7A 2VU5A 4GRSA 3W62A 4DV5F 4FNIA 2OIHA 5LMNJ 1LWFA 9RUBA 1QTNB 2BA9A 2Y1RI 3AQPA 3ETOA 3IC1A 5E5NA 3W9HA 2DGTA 3L4BC 3DM2B 4CLFA 2DH8A 1FNMA 1H7XA 5KFGA 2WOMA 3H2LA 4DCOB 5KFWA 1SC4B 2AQ4A 2HVHA 2DNLA 2VPYB 3GWCA 4QIEA 1NK6A 4DV1F 4GVLA 4LSNB 4G6VB 4RW8B 3ICLA 3PJ9A 1FRMA 3UD3P 4LFCF 4P6QA 4OV1A 5K5MA 1LFWA 3V6KA 2K2PA 2N3LA 2B51A 4ID5A 3DKDA 4DL7A 1U2CA 3FEYB 4ED6A 1CJVB 1X4HA 5DQIA 3ZZRA 2G1DA 1JXLA 2RDJA 4PPZA 1B99A 2QE5A 1LV5A 3NGDA 2W2QP 5ETOA 1IBLF 2Z0GA 3BGOP 1U1OA 3ZZPA 3O1LA 1RTZA 1FX4A 3BPSP 3PRVA 4OIXA 4RBVA 3HHLA 3TO8A 5IZHA 4JI3J 4NLDA 5KFTA 3SI8A 2PFDA 2QLXA 4FKYA 4UZCA 2XLIA 3AOBA 2EFPA 3OR2B 2HAIA 3I96A 4ED4A 2RH3A 1RHQB 1EQ0A 1BD6A 2J8AA 2FLPA 2DTJA 1U09A 5DLGA 1IBCB 1HBMA 1FXDA 2FGCA 1UFLA 2LLZA 4ZCMA 1Z2ZA 3A12A 8RUCA 2VB6A 3IM9A 3M8PB 4FYYB 2CQPA 4OHWA 4S0MA 2EK1A 3HHEA 2MLZA 3NRBA 4K5SA 2R8GA 3SCLE 3BSAA 1KS2A 4UOHA 3TAMA 3V4IA 3NY0A 4XIUA 1N5YB 1MN9A 4K2JA 1URNA 1DAXA 4JP8A 1RU2A 4YB1P 2VODA 4B9LA 5KFQA 2CFXA 4ED0A 4KFBA 1D3WA 2CJYB 1TL1B 1HNIA 3WX4A 2B4VA 2KYXA 1TAUA 5A8WA 4ED3A 4AL6A 2JEIA 4IOBA 3IRWP 1N54B 2CJBA 2E7VA 5MLCV 1XMQJ 3CXCR 1S10A 1U45A 3J7ZT 3WZ0A 4FF4A 1LWCA 1X4FA 2HWIA 3EPGA 1KFSA 1P6TA 3GV7B 3FVYA 1RT3B 3RB4A 3I5CA 3NCQA 3D68A 2OI2A 2CZVC 3VALA 4YOEA 2PN6A 1F2HA 1IKWB 3P5TL 2ZC4A 5HP1B 3K5OA 3HHKA 2XNQA 1NCLA 2RF2A 4USWA 5T7LB 3G86A 1OIAA 4HL9A 2ZHBA 4OYBA 1WHWA 5AT1B 5THWA 1FNXH 1LWEB 1VMBA 1TTHB 3H42A 4AE5A 1QTMA 2HMIB 4RNFA 1HBMB 3ILLA 2G0IA 4TKTA 3G96A 2QLJB 4ZLNA 4Y2KA 4JI6F 4FVCA 2YX7A 1JXVA 1RA6A 3F0NA 2KRRA 4ZA1A 3PV8A 4LF5F 3RW6A 2DHGA 1M5VC 2CDQA 1VQMS 1S76D 1PBUA 1NPPA 5KFXA 1JLCB 5IXUA 4YDXA 4URSA 4ZP8A 2BVZA 3TUZC 1VBKA 3T1YF 2RNEA 1IQZA 1SXLA 1X4BA 1YBAA 3IWXA 3M30B 2R7OA 2AU0A 1WWHA 2UUCJ 2RILA 5EN1A 1RHMB 1RTHA 5KG6A 5CA5A 2N4DA 4CO1A 3PR4A 3S6EA 3WIUA 3G8TA 2MKSA 2QLFB 1GMUA 1ZYQA 1BGXT 4ZKAA 3W3SA 4G1IA 5M2RA 1FVSA 3KNGA 1XEZA 4WTOB 1PILA 3EVOA 4L72B 2YKOA 1NHKL 2BM1A 3BKTA 4C6AA 1GMWA 2V2QA 2B9XA 3BGFA 3NG8A 4L75A 4R0EA 3M05A 5HVGA 5L1KA 1OO0B 5BYSA 2UVRA 2F8HA 4J37A 1BY9A 2VF3A 1RWNB 3I4PA 5HN0A 4WYLA 1WELA 1UJ6A 1M1KT 4ETXA 5L46A 1WG4A 3MURP 2VDHA 2AHOB 1NHUA 2V8VA 2V9WA 2VJVA 3OT9A 1OSDA 3BS9A 4RR5A 1WTBA 1RWKB 4DFPA 3K8WA 3BYRA 2W9BA 3M8QA 2E7WA 1GFWB 4OZJA 4EYIB 3CW2C 5K8PA 1PG5B 1TKXA 1VJQA 1VS3A 1ZM9A 3DLKA 2I6WA 3R2DJ 1KWMA 1YRTA 4ZHRA 2O01C 3PYFA 1DLOB 2AMCB 2HWTA 4NEYA 4ZMMA 1XR5A 5CHCB 4JV5F 1YWXA 3H90A 3GYGA 4UY8T 1VQ8S 1SIZA 1TV6A 4MAKA 3K8VA 4PZVA 1HYSA 4QW8A 1RTIB 2MQ8A 3TOQA 2HLTA 4RUBA 3OHBA 4LF4J 4IUFA 2A3JA 5G4DA 2J5AA 2K3KA 3DRYA 1CLFA 3K5MA 2PMZD 2WAQD 2CJ9A 5FLXY 3BGUA 3UFCX 2UXDF 4H4OB 3T5HA 1IKYB 2HGMA 5JVHQ 1ZA2B 3QZ7A 1YJWS 2NQPA 3U1LA 4OFZA 4DR7J 4I64A 1KDNA 3BBBA 3EXYA 5T41A 4I67A 2CPZA 4NZ0A 1KTQA 1H3DA 4QZVB 3M6WA 3T1HF 1S0NA 2GHWA 2OLWA 4CO0A 4K0KF 2LEBA 1TAQA 2GIFA 2JJ4D 3N6MA 2XZDB 4ED2A 3H7HB 5F8JA 1GH8A 3BM7A 5I3PA 2W2OP 2ZITA 3MCMA 2ZZTA 3UW1A 1GQEA 4MYUA 1UWAA 1EZZB 3TA0A 3J7AN 2D3UA 4C0BA 3V81B 3ZZ0A 1N32F 3ZO7A 4RNNA 1PCAA 2QSFA 4C3MA 4V19X 2DITA 2B0GA 2KT5A 4DPUA 3TARA 1RT6A 3LAKA 2NUHA 2HIYA 4L73A 3OQ2A 5CABA 1D9AA 1MWQA 2CPJA 4RUAA 4EBCA 3K59A 1SV5B 1FTRA 1P9YA 2N7YA 4XAKA 3C6TB 2J0SD 3CE8A 1JLGB 4OYXA 1ZA1B 3W61A 3QRRA 4HT5A 2ZBRA 4M8LA 3KJQB 4GMKA 4XPCA 1NPKA 1J5EJ 1VC0A 3GR1A 5KFUA 4KY3A 4PXBA 2GW8A 2Y1JA 4LR7A 1HWJA 2OPSB 1VQ5S 2JH3A 3DI6A 1QJHA 2EKNA 2MKYA 4OLOA 2IYIA 1NAQA 1PYSB 2ZKTA 4JI8J 4DXLA 3A8KA 3W66A 4OZ1A 1LW2A 4LBPA 5GAHI 3VAIA 2DJWA 5CYQA 4EU0A 1XERA 4DV7J 1CULB 4QIFA 4F3OA 1T05A 4TXSA 4C0HA 2AYMA 3R5DA 2EKYA 4OQJA 4O44B 2RE1A 4PG5A 5KT6A 3W2VB 3N5BA 2VG5B 2Z58B 1QVGR 2NPIA 4Y00A 1N52B 1VK8A 3BR9A 3GIKA 1XK8A 1G3OA 1S0MA 2R2TA 2RKIB 2C3MA 4ZVPB 3M32B 2CZ9A 4UTGA 4ZN3A 4J9RA 4F3MA 1V6HA 2DYAA 5FJ4A 2M9KA 5F0UA 1EQMA 2FUG9 1CJKB 2B6AB 1AT1B 2O67A 2YNGA 2YBVA 3MFIA 4HACA 4DV2J 4USVA 1JLQB 3AJDA 2HFNA 1RAGB 3M6VA 3PVXA 2HRUA 1U1QA 2AYGA 3RB3A 2PMWA 4DV4J 5KG4A 5CZVA 2L3MA 2U2FA 1R31A 3QWPA 5A8RA 1X5TA 1FWPA 3TA2A 1NM2A 1S6UA 4CLTA 3H4BA 2J0QD 3TAPA 3SCJE 3MTKA 1R7IA 2RB7A 4FKXA 3MOZA 2V50A 2C22A 1MU2A 2D3OR 1EETA 3HT0A 3ZZZA 3CCWA 4ILRA 5GAGU 4ZVHA 2CQ3A 2R2UA 4NXNJ 3M9MB 2XEXA 5CCMA 4L76A 1HBOB 1ZAXA 2EPIA 3NLCA 5KAKA 5CD4H 4B9TA 4I2QA 3LUYA 4WJBA 4U8YA 3D9BA 1EX8A 2KM8C 2XCAA 3HJVA 2DO4A 1HNWJ 1U02A 5CXTA 2FZKB 4PG4A 5HAOA 2GZOA 2XLJA 2XC9A 1M5HA 2HQGA 3JB9k 1HI0P 4FF2A 2AD9A 1X5OA 1S1XA 2QLWA 2HS0A 2VPXB 3KHLA 1RKJA 1HR0J 1BQNB 4HT7A 4A8OA 2MLXA 1FK9B 1N4LA 2YKAA 4P2MA 4DFJA 4C9DA 4A4JA 3M9NB 3CJRA 1SBRA 3FRYA 2DR6A 3EJMA 3LH2S 4OZ2A 3H20A 2G2ZA 1QAXA 1WC4A 4EBDA 1YQHA 3NMAA 2XGQA 4ECVA 3KXDA 3V5RA 1NB2A 1V3RA 1N0UA 1SJFA 3SIPB 4CYUB 2ASDA 3PTWA 1C4AA 2RRNA 2B6AA 1CJKA 1W2BR 2MGZB 1KVKA 1KD1T 4RW7B 2CPFA 4X65J 4F2SA 1FRLA 5HSPA 1YGYA 1AA1B 2FZGB 3PRBA 2ZM6F 2GQQA 4HHHA 1S9GB 5DM6Q 4J9NA 3A8JA 1UJ4A 5CYJA 1S59A 2XZTB 3KMSA 4EZ6A 1MG7A 3LF0A 2KFZA 2QGFB 4WFXA 3O6QA 3THPA 2FVPA 4AXJA 4YB7A 3M2VA 4R8UB 3IGNA 1IM6A 2AZ3A 3I5BA 3EUNA 5HMXA 2F40A 4UQTA 1Z4UA 2ZFHA 4X4RA 4ECRA 4AQYF 1FKAF 3HO1A 4RU2A 5EWGA 3ZZOA 1NK9A 1MWZA 2MQNA 3MAHA 5HO4A 4QWDA 2QFJA 2HNYB 2IRYA 2VASA 4WZQA 4E0DA 4KYZA 2PI5A 2V6AA 1KLNA 2OPQA 4FNHA 1A0OB 1DBDA 2X51A 3IFEA 2MYFA 5KFKA 4A8MP 4DR1J 1HI8A 1RBOB 2AX1A 3HZEA 4X84A 3OUYA 5U47A 4CLYA 3M2RA 1J2VA 4DOZA 1KRPA 3CC4S 2ZVIA 1JX4A 3RUBL 2DY9A 4G65A 1RT5B 4JB8B 3RBDA 3R5BA 4P7TA 4X66J 2PFFB 3WC2A 3M8ZA 3FJ2A 2DBBA 5HVFA 3OJUA 1IWAA 4LVOP 4B3TJ 1UWBB 3A3NB 3CC7S 3CUNA 1I51B 1Y5IB 4P52A 3C46A 4KR0B 3UR3C 2MXYA 2ALYB 1EB0A 3QLHB 2J9DA 5F0WA 4NCGA 1JJHA 1OQ6A 2P5VA 2FD2A 4PG8A 1CSJA 2R7SA 3ZNUA 4OX6A 3IXQA 2MHEA 3T41A 1JB0C 3ISND 4KHRA 2ILYA 1SH3A 1WI8A 2YKQA 3DOMA 4I2PA 5K8OA 1TZ0A 1RP5A 1U1MA 4ECZA 4H4MA 4B9UA 3M2VB 2ZHAA 2O5DA 2Z2ZA 4RW4A 3GFZA 4JI5F 1S6QB 4ECQA 4IKAA 1H38A 4OMFG 1VRQC 3GJSB 2BM0A 3MCSA 1OMSA 3GE9A 3N9UC 2C28A 1EHWA 1PAUB 1S1WB 3SQGA 1EIYB 1FKOA 1S7HA 2F9DA 3Q8UA 4C8OA 1XNRF 3DXSX 3T6BA 2C3UA 4ATNA 2VFUA 4DU7A 4DUTA 2I38A 4U7UK 4ZLLA 1KHVA 1PAEX 2DGOA 2V94A 1Q95G 1GNKA 3IR5B 3MHYA 4K5RA 4RJVA 2QIFA 5FIIA 3VR1A 1V5VA 3MR2A 3VZHA 4DL3A 1OY6A 1W7WA 3PRDA 1VQ6S 2EXUA 3KLFA 1S1TB 3WX8A 5LMUJ 4LFBF 1VCTA 2ZC3A 5EX3A 4JV0A 1RLDA 1FJEB 4QWAA 3JTNA 4CH0S 4F2RA 5KOWA 1AXQA 1AZSB 2VV5A 2E9ZA 4OHXA 4OZLA 1LW0A 1Y5LB 2OEKA 1HWKA 3MUVP 1TUWA 4FBUA 1TKTB 1ZM3A 5J1EB 2A6OA 1SJ3P 3IR7B 1RT3A 5E3AA 4ECWA 5BR8F 1VIXA 3FBCA 4G3IA 3PW2A 4W92B 2QFIA 3DRPB 3MPVA 4B9MA 3TAQA 1RCOB 1ACMB 2RT3A 2DNRA 3PCOB 5I3QA 1ZZFA 1RTDB 1JLFB 1CJTB 5IT4A 1HNWF 1HL6A 4WZMA 4FPIA 5ETSA 5EWFA 4WP3A 5KG1A 2WTFA 2CPXA 3AODA 3IMQJ 5KFMA 3DLEB 2UP1A 3O3LA 2JLGA 2C3PA 4CNYA 1B0VA 5KT3A 2M3DA 4P72A 1FD2A 2Q43A 5J2PA 4LSZB 1RWMB 1JMTA 4CLWA 2WSCC 4O3NA 2A10A 2VD3A 2W2PP 2ZUAA 2FHKA 3KDNA 1ZH5A 5EWEA 2YXLA 4WF9Q 4WYWA 3EGNA 5A2QY 3MR3A 2FQQB 2IRXA 2BOPA 3DDKA 3A8EA 2QSWA 3L9ZA 3P45B 3JTOA 4Y2IA 3VVTA 3JAMU 2W9AA 1SJ1A 3OXLA 3S1TA 3VGUA 1TQLA 1C1BA 3M6XA 4CH7A 1KSPA 1C0TB 3TR5A 4OX9J 3BQ1A 3KDOA 2R8JA 3CB4A 1R8AA 2WRMA 5E3QA 1X9SA 2HK2A 1YHQS 5EDWA 1WOSA 4DL4A 4IFVA 1XWLA 4M5DA 2QL9B 1U8WA 4B3SJ 1C1CB 3DYAA 3RZAA 4A8SA 2HQFA 2RRAA 1PJ6A 1NHVA 3HPOA 1CJTA 2XO6A 1A9NB 3NNAA 1Q8BA 1NKCA 3D0IE 3OVSA 1Q0NA 3MMCA 1YI2S 1FA0A 1RWUA 4DPOA 2Z30B 3GV5B 4JV5J 4ZPBA 1EP4B 2JVOA 1U7LA 4HKQA 3QJPA 3DXBA 1GTHA 5IT9U 4ZOSA 2IA0A 1NDKA 2YQ3A 4I56A 2BJ1A 3HHLD 5CD4A 1DTQA 4CZCA 4WFBQ 1VR6A 1SIWB 2CG4A 3UPFA 4DFKA 3NCPA 1Q4RA 3HHDA 1N5QA 2BZ2A 3MEEB 2EC0A 2EWHA 2U1AA 3M8QB 1CVJA 3O8WA 2ATLA 2UVWA 4LIWA 2H9ZA 1TFWA 3ZTOA 1RB0A 1NNDA 4DLEA 4UQGA 2KL8A 3KLVA 2CQBA 1DJ0A 4PKDB 2AGOA 3LGMA 1Q5VA 2HFSA 2XYGB 4IH7A 5ETKA 2KG1A 2KZMA 2KVIA 2V63A 2B5JB 4FYWB 3HD2A 3MMJA 2G13A 1WSVA 3NL0A 2LXIA 4P73A 2C2NA 3GSDA 1OY8A 4GO7X 3AFGA 5D0RA 2AX0A 2J7KA 1AUSL 1U24A 1RU1A 1WEXA 2BKPA 2BMBA 2R8HA 5DG7A 5HJYA 5HP1A 3UVJA 2CQ1A 4NA1A 3M32A 2WVCA 3DOMB 4I2PB 4ZN1A 3DC2A 4MIAA 4H4OA 4NE9C 4EYHB 1IBMJ 3CDUA 4J90A 3B82A 1Q7YT 2Y9HA 5DG8A 1TK0A 3QNWB 3FQKA 3IAM9 3GJQB 1K0TA 4B02A 2ZZNA 2VICA 2GC8A 1QY7A 2DEJA 1YJVA 4ES2A 1T05B 1Q8KA 4LIRA 4CLUA 3KK3B 2UUBF 2CZ4A 1YVFA 4KGXB 3MUMP 1Y5NB 3NS7B 2W01A 2HURA 3H0PA 2QA2A 1S5ZA 3DN9A 2DB1A 3X1LB 3PM9A 4NLWA 4JI2F 4EGLA 3LP2B 4F0HA 3PEJA 3GV8B 2VBXA 2Z2LA 5K8NA 1P9QC 1YTYA 1HNZJ 4RL1A 2QG9B 3TUJC 4ZCLA 3WHIA 7AT1B 2M2BA 3D28A 4DUZJ 3IM8A 5T14A 3MR7A 3W5ZA 1UJ5A 1MN7A 1S6OA 3TX8A 1NRKA 3RAQA 3G4SS 3TP2A 4EK2A 2FLNA 2HW3A 3FZBA 4NXMJ 3CDEA 2JC0A 1H98A 3LTOA 2XSJB 3ZC4A 4WWSA 1U1KA 2FGOA 4AFFA 4TQSA 4DR5F 2MKHA 4LRFA 4PXEA 4C97A 1HWIA 2DGWA 3MWBA 1RHJB 2WW4A 4CM0A 1R6VA 4DV4F 4MK9A 3KYLA 4ECSA 2X3GA 1VI7A 3MAAB 2HFZA 4N76A 4B3MF 2AJFE 4CM2A 4FYXB 4USIA 4W4MA 1YRXA 1VQ9S 1M1GA 1X4EA 2WVEA 4KH0B 2HBRB 1VISA 2MMYA 4WK3A 2GS8A 3S8SA 4RNMA 1VDHA 3BPDA 5D4OA 1S7IA 2ZH8A 1H6KX 2BW2A 3I0SA 1RBAA 4K4YA 3PIPQ 2YWWA 4WE1B 3RBZA 1T02A 3GFHA 2BJ8A 4DS4A 1VBZA 2KVQE 2QV6A 2WOMB 2XCPA 2XY5A 4C2MA 1VBYA 2QMWA 3IGVA 4I6AA 2JHEA 4TNOA 4ZVUB 1X5SA 1YBTA 2H65B 1ICEB 4JI7F 2CPHA 1HNXJ 3BH7B 1FJGJ 2JL9A 4DI6A 1H2TZ 3GYXB 4G1QA 1RTJA 5DQHA 2ZH7A 1TKZB 1JLAB 2RMLA 3W60A 2CPIA 3AXKA 1VQKS 2MKCA 1J5EF 2BX6A 4KE5A 1S99A 2DHAA 4P9SA 4LFBJ 1CBKA 2ZE2A 4CLPA 4RPFA 2DGQA 2V2ZA 3HM9A 3DOLB 1AFIA 2C2KB 4FPRA 2VA2A 2AKWB 4X4OA 3D6FB 2BW7A 3FMWA 3M2UB 1KKHA 2RIJA 3K5PA 4TYAA 5HANA 3Q8RB 3PX4A 2LQJA 1XNRJ 3SMZA 1NBEB 5GADI 3D6MB 2HSEB 1UW9A 3L7UA 1UVIA 4ED5A 2HNYA 2OTLS 3H59A 2FHMA 3CD7A 1VQNS 1YX2A 3GMGA 1FEEA 2YNFB 3MMBA 2D1CA 2LEPA 5ETPA 2FY8A 2VQFF 2ADCA 3W1YC 4GKJJ 5BYRA 4DX7A 3M4XA 2H5IB 2XNRA 2HZCA 2NS1B 5A2QU 3BQ2A 2VA3A 2XZWA 1F9EB 1V9OA 4DEZA 3NGUA 1LEOA 2XS5A 2AWZA 2H5JB 2YNIB 2LU2A 3FK4A 1MSWD 2HHHF 5A8WB 2ZZMA 1CC8A 1URRA 4MTPA 5A0YA 1QUPA 3GONA 4X2BA 4KGVB 2VPZB 3CDAA 4NYPA 2ZJQQ 3CCQS 3CJ0A 3ELHA 3T6JA 1QSYA 4IO1A 1P1TA 3RR8A 3ZTRA 2LDYA 1I94F 1KONA 2GJFA 4NCGB 1ZAVA 5JVGQ 4GO5X 1Z1ZA 2DNHA 2IMOA 4NLRA 3NP5A 5IM0B 4F4WA 2YVSA 2ADBA 2X7IA 1HKAA 4QPTA 2KHCA 2RHSB 3I9V9 1G6BA 4Q0BA 1JKHA 5DZ6A 2FJEB 5T7LA 4JI3F 1ZPVA 1CJUA 1NU4A 1HR0F 2QYCA 3CTRA 1OPIA 2DR7A 2OPPB 2UUBJ 3R5GA 3OPKA 3ZZTA 3B4DA 4TYBA 1RAJA 1FDDA 4O44A 2WB1D 2GIRA 6FD1A 4LJMA 2MKIA 5F8LA 3KK2A 4H4KA 2Y0SD 3QT8A 5HBMB 1D8YA 4LF7F 4OI0A 4FF1A 2B43A 4XDCA 2BABA 3C15B 3IA0A 2AGQA 3CT9A 2NZ4A 1TMMA 1SQGA 4M1KA 2XQCA 3G6ES 1QVFR 2G4BA 2OFGX 3I55S 2PE8A 3FNNA 1X4GA 2HNDA 2KT2A 4U8VA 3OHAA 2R9LA 1SL2A 1VLOA 2WVFA 5D4PA 1UETA 3DMJB 3CCMS 3QRPA 2ZH1A 2FLOA 2UUWA 3W9IA 1IWGA 1WNEA 1RT1A 5E33A 2B8QA 5IT0A 3OL7A 3PW0A 5F3ZA 4LBHA 3QJJA 4DV6F 4WFAQ 3DM2A 2KI2A 4DQIA 1RT4B 3MPWA 3UDLA 4DMZA 3QFHA 2HYIB 5AE1A 3PYEA 4EMDA 2ZM6J 2BEFA 4ZDNA 1QAYA 4PCQA 5K9FA 2FJAB 2KFNA 1S1WA 4KPYA 3N01A 5K14A 2RUSA 2A0FB 4I69A 2JLEA 3H8YA 2HBZB 4FF3A 1KVJA 3UDVA 4R25A 5LSOA 1MW7A 1SCJB 2DD8S 4ZPDA 1Q79A 2DH7A 2EFOA 5IM0A 1UW4A 2G0JA 2VJUA 2I2YA 5DDOC 2F5GA 1Q81T 2E5GA 4Q2MA 4YB6A 3M8PA 1D0EA 2VONA 4M5MA 1Y00A 2NLWA 4NMLA 4FZVA 3KUHA 4KGZB 1Q1KA 4ICLB 3ISNC 2CJXB 2LCWA 1S6QA 1TL3B 4AXIA 4CNZA 3I31A 1ZOTA 4YN3B 5L9XA 2ACYA 4E98A 3KLGB 3LOUA 4NLSA 3MECA 3E3XA 3R1LA 2DGUA 3LP1A 4PXDA 3FMBA 5F8HA 1T0TV 2OP5A 1WC1A 4JUZA 2ZH2A 3HSZA 1TR0A 3PJXA 1UFWA 1WF2A 5F41A 2Q1LA 5KG3A 3JQKA 4M5LA 5LXYA 1ZS6A 3MFHA 2DRBA 1KNZA 1BWVA 1RQ0A 3HFVA 4NEZA 1B0TA 1PC4A 5DJBA 3SV4A 2GVZA 5KT2A 1WD6A 3FKBA 2V8HA 1R8CA 1RCXB 3Q8VA 1ELOA 1HA1A 4LR8A 4J9OA 1O5JA 2OMOA 4RUHA 5KFNA 2BJ9A 4IR9A 4QW9A 1IJEB 2PT0A 4ES3A 1FXLA 4ED7A 1Q82T 3P6YC 2GMHA 2HBQB 3DHXA 5J1PA 2RS2A 3DDIA 2EG1A 2YNHA 3VHQA 5I4MA 4LBIA 4A8YA 1FDBA 1BC6A 2V68A 1F5CA 2VUGA 2NXJA 2VFRA 4M5KA 4RX6A 2MQPA 3PW5A 3G6YA 1RHRB 4RW9B 1X5PA 2K3IA 2QN6B 2XSFA 3DOKA 1FTCA 3CJ2A 5DZ7A 1XC9A 2D69A 2HMIA 3KMQA 4B3MJ 2CXEA 1RADB 5KT7A 2OPPA 1JQGA 1EAYC 1WDDA 4LRDA 4KAIA 2CDRB 4P2XA 2APOA 4QOTA 2NUUG 1UP1A 2YWFA 7FD1A 1MNEA 3JSMA 1NJIT 4Q45A 1IKWA 1T3NA 3OL6A 2W9CA 3R6GB 3ULHA 4C8ZA 2KJVA 3EPIA 2ZBIA 4DR3F 1LWCB 4Y65A 2R4FA 4ZP6A 5L8RC 4HTIA 5JXSA 1OYEA 2COLA 2VG5A 5HMZA 3HXMA 4KJIA 2DR8A 1FFSB 1S0OA 3HFZB 5B0BA 4J9SA 2YQ0A 6AT1B 4DV7F 4ZPWR 1IM4A 5HQ8A 2X1AA 1VQ4S 3QZ8A 2B5JA 4DPXA 3PHTA 5KFIA 4KIAA 4WIIA 3M7VA 2N4CA 2P9CA 2VDIA 4Z7YA 3MMAA 1SJQA 3ETMA 1QAIA 3K17A 1NMEB 2IM2A 1V3ZA 4MT1A 1VHIA 2GGPB 3OTCA 4RW7A 1IBLJ 4DSKA 4YFUA 4QWEA 2DGSA 3C66A 3ZXWA 2OJ3A 1RT2A 3I32A 3J81U 2HQDA 4LF6F 3J7YU 1NH8A 2WK4A 1XN9A 3CJTA 3DOKB 3A4TA 3ITHA 4AYBD 2M0GB 4DX8H 3Q8SB 1R0AB 3OXFA 2GO9A 2JZ5A 2P6TA 3DDNA 3LP0A 3B54A 1JLCA 3NCRA 2M5YA 1E6YB 1JLEA 4NLOA 2CQCA 4E2FB 3G82A 2HZVA 2R7QA 1HMVA 1RISA 2BYCA 2G2OA 4LRBA 2IIHA 1TP7A 4RW9A 4X4TA 1RKIA 3BBCA 4OZ3A 5G0RB 5B0AA 1S1XB 1JK9B 3J81Y 1WORA 2C2RA 1N5VA 3D3BJ 1FRHA 2FJVA 4ZVGA 3PX6A 3KLEA 3D2WA 1F5BA 5D6GA 1JNZB 4A8WA 2NSBA 2NYIA 4I4BA 4F67A 2BKNA 4O0NA 2CNLB 1P1LA 1WC0A 4CO3A 4H54A 4USHA 4U95A 5D8HB 3ENAA 4KGKA 5E41A 2HHWA 5JUMA 2JNJA 1XMOF 1FWKA 1FK9A 5M2UA 5ETLA 1D8ZA 1LFPA 3EICA 4B3RF 2RU9A 2M8HA 4Z37A 2EVZA 3LO3A 4ZJLA 4DR5J 3G8SA 4Q8FA 4LSLA 3DGPB 4DN9A 4J9MA 3DLGB 4IR1A 4UOFA 4OHVA 1ITPA 1GEHA 2MKKA 1U6BA 3I5AA 3AA9A 2YH1A 2VOOA 3H4DA 2LMIA 5ETTA 3X3UA 2BQUA 4DUZF 2IBKA 4LF7J 1BQXA 1VC5A 4USMA 1KHWA 4YDDB 1JNRB 4B3TF 5A8KA 4WU2A 4OYAA 1N36F 1QD1A 2KXNB 2F8MA 2OSRA 3BR8A 2KDOA 3N4WA 1YIJS 3KFWX 3MEDA 1F2GA 2PSZA 2XHWA 1SJ4P 4H4KC 1B4SA 2V8GA 4OHZA 1I6JA 4KC5A 4X4QA 1N36J 2IMWP 4B9NA 3MM5A 1G4CA 1PSDA 2O66A 4N56A 3HVRA 4DR1F 1UA1A 4B9SA 3NBPB 1RTDA 2ZJPQ 4H4MB 3VAHA 5F9LA 3IBWA 1VC6A 3ZTSA 3C6UA 5C24A 1I94J 3BV8A 1TUGB 1MMDA 3M8YA 3VVUA 1FO1A 3KNAA 4AUKA 2DHSA 2WSFC 3PG9A 4AQYJ 3CD6S 3B6BA 3ET6A 2LFVA 4AL5A 4U67Q 3MOJB 2OHDA 5B0FA 2RU3A 2PIIA 3MM7B 3P5BP 3NS6A 4CIOA 2RDDA 1PKUA 2M70A 3PZPA 4I6YA 3FCHA 1NSQA 2LEAA 2GVZB 1ZTTA 2E5LJ 1S77D 1IR2A 2CADA 2RJZA 3A8IA 1IKXB 3W64A 4F4KA 4ID8A 4QJVA 2VQEF 3CMES 3FSXA 2HFVA 1LW0B 4MMOA 4YMEA 1HYSB 2JSXA 2JRSA 3I0RB 4CLZA 4C4WA 2YPZA 2VBZA 1RXOB 1T95A 1WEZA 3PFEA 1JWWA 2ZEJA 1PYTA 3T9ZA 1DLOA 3DU5A 4PQAA 5CQGA 4ZPVR 4OX7A 5GMKa 1J27A 4AL7A 2BJDA 3C6TA 4E8UA 4CLSA 1DHMA 2MSTA 5A8KB 2YWGA 3MM5B 4ITSA 3SFUA 2VPWB 3DOLA 2AP6A 3HSJA 4D3GA 1K0VA 3N6LA 1RJJA 5KFFA 2RQMA 3A13A 3SZ2A 1HQ2A 5B0DA 3ZZYA 3PNIA 5E3PA 3EYZA 5D3GB 3W65A 4LF5J 4ZITA 2KYZA 2AT1B 2M7SA 3V81A 2Q6BA 4DPTA 2I0XA 2XMAA 4ZK7M 3GG0A 2IJFA 4X4PA 2MKJA 3MR5A 2B9EA 3EGVA 5LMUF 3KUEA 2HHTA 2JX2A 3ONQA 5E0OA 3NKYA 3Q8YA 5H1SV 3B8HA 5IOLA 1WACA 3TVKA 3J80Y 2CIMA 3CEDA 3HKWA 4P2FA 1UVMA 4B3OB 4F04B 4YP3A 2Z8QA 3HVWA 5AXKA 3UCZP 4YR2A 1UPPA 8AT1B 4DR3J 4C0OC 3QWUA 4B08A 1WC5A 2YNFA 2ZOFA 1FXRA 3MMBB 4HI1A 3MXHP 3Q8PB 2J8SA 4O4GA 5D0EA 2H1YA 2LQ8A 1AZSA 1UEKA 2QL7B 3QT5A 4RO0A 4QR0A 1JLGA 3KJFB 5F8MA 3J80U 4IFVB 4IG0B 2BRLA 3GCWP 4NASA 3HHNB 1RABB 3U1NA 4GC7A 3EZOA 3UE2A 1UCNA 5J1EA 3HCXA 4DR2F 2AYBA 3TI0A 2LQ9A 4IG3B 3HLUA 5K8MA 1NJXA 3JAMY 2X1GA 1LK5A 3FCWA 3LPEA 2YNGB 3S01A 2RVJA 4M95A 2MY8A 4M5DB 4Y2MA 1HD0A 3MPUB 1M5KC 3L95X 2NR0A 3V4IB 4NXMF 2XMTA 1YJNS 1TELA 1ZM2A 3K57A 5B0CA 2J0XA 2W8KA 1NJZA 1YJTA 3LGHA 3VF0B 2GHPA 2CKWA 4Y34A 4OI3A 4NYZA 4HVZA 1RT7A 1FKOB 2KN4A 5KFPA 4M94A 3FSIA 1H72C 2CJAA 3Q83A 3U1MA 3V2UC 3DMJA 1DFDA 3JXOA 3UD5A 4X66F 3PYDA 2KU7A 4BCAA 1R3NA 2CPEA 3MM8B 2A18A 3FEXB 3QYYA 3HX9A 3NAIA 2EFGA 2DNPA 1B3TA 2ATCB 5J1NA 5J2MA 1NK8A 2KRBA 1X31C 2QA4G 3Q24A 1WHYA 4A8QA 1SVDA 2XMUA 3CCZA 4TVAB 2ZBQA 2ZVSA 1KLMB 4Z2XA 4J9QA 2E1RA 2DNYA 8ATCB 2EG2A 3HI9A 2VHGA 4OI6A 2W7PA 1PGZA 4JV1A 2GAGC 3PW7A 4PUOB 3HVTB 3RAXA 3C14A 3WC0A 2FVQA 4QIWD 4PWDA 3UQSA 1WTFA 2PA8D 4WXWA 3AY0A 4JI5J 2AEMA 2VQEJ 4MH8A 5HMYA 1F9FA 1EJ7L 2Z2MA 4K0KJ 1U49A 1NJWA 3EZUA 1NH7A 4OYPA
chains in the Genus database with same CATH topology
1BHNA 3MPDA 3ZTPA 2NCKL 3VGSA 1NDCA 4FKXA 4F4AA 1EHWA 1XQIA 3ELHA 4DZ6A 1NDLA 3ZTRA 3EMTA 3FC9A 3PJ9A 3NGRA 3Q8UA 4DUTA 1PAEX 3DKDA 2HVEA 3EM1A 1W7WA 3NGTA 1B99A 1S57A 3WX8A 2HVDA 3EVWA 1F3FA 3ETMA 3EVMA 2HURA 3PRVA 1S5ZA 3FCVA 4W98A 4CP5A 4FKYA 3FBEA 3Q8YA 1NDPA 5IOLA 1NUEA 3EJMA 3FBCA 1WKLA 3B54A 1MN7A 1NB2A 3BH6B 1HIYA 4EK2A 4KPCA 4F36A 3Q86A 4S0MA 1WKKA 3BBCA 1LEOA 4UOHA 1HLWA 3FBBA 4WBFA 1MN9A 1KDNA 3BBBA 4UOGA 2B8QA 1UCNA 4O0NA 3ENAA 3R9LA 1S59A 2DXDA 3FCWA 2ZUAA 2BEFA 3EICA 3G2XA 1F6TA 3NGSA 2AZ3A 4UOFA 1BUXA 1NLKL 3FBFA 3VGTA 3VVTA 3VGUA 3VGVA 1K44A 4HR2A 1NCLA 5CABA 5CAAA 4ANCA 2CWKA 3Q83A 3BH7B 4DI6A 1U8WA 1NPKA 2DY9A 1VYAA 1JXVA 2BX6A 1ZS6A 1B4SA 2DXFA 3GP9A 1XIQA 5C7PA 3FKBA 2B8PA 3GPAA 1BE4A 1NDKA 3Q8VA 3ZTSA 4ANEA 3VVUA 3L7UA 2AZ1A 3DDIA 3B6BA 3ZTQA 1WKJA 3BBFA 3EE3A 1LWXA 3JS9A 1NSKL 1PKUA 3ZTOA 4ENOA 2DYAA 3EVOA 3Q89A 1NSQA 4ANDA 5BXIA 1NHKL 4C6AA 1HHQA 1NSPA 2VU5A 3NGUA 2DXEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BHN A;  3MPD A;  3ZTP A;  2NCK L;  3VGS A;  1NDC A;  4FKX A;  4F4A A;  1EHW A;  1XQI A;  3ELH A;  4DZ6 A;  1NDL A;  3ZTR A;  3EMT A;  3FC9 A;  3PJ9 A;  3NGR A;  3Q8U A;  4DUT A;  1PAE X;  3DKD A;  2HVE A;  3EM1 A;  1W7W A;  3NGT A;  1B99 A;  1S57 A;  3WX8 A;  2HVD A;  3EVW A;  1F3F A;  3ETM A;  3EVM A;  2HUR A;  3PRV A;  1S5Z A;  3FCV A;  4W98 A;  4CP5 A;  4FKY A;  3FBE A;  3Q8Y A;  1NDP A;  5IOL A;  1NUE A;  3EJM A;  3FBC A;  1WKL A;  3B54 A;  1MN7 A;  1NB2 A;  3BH6 B;  1HIY A;  4EK2 A;  4KPC A;  4F36 A;  3Q86 A;  4S0M A;  1WKK A;  3BBC A;  1LEO A;  4UOH A;  1HLW A;  3FBB A;  4WBF A;  1MN9 A;  1KDN A;  3BBB A;  4UOG A;  2B8Q A;  1UCN A;  4O0N A;  3ENA A;  3R9L A;  1S59 A;  2DXD A;  3FCW A;  2ZUA A;  2BEF A;  3EIC A;  3G2X A;  1F6T A;  3NGS A;  2AZ3 A;  4UOF A;  1BUX A;  1NLK L;  3FBF A;  3VGT A;  3VVT A;  3VGU A;  3VGV A;  1K44 A;  4HR2 A;  1NCL A;  5CAB A;  5CAA A;  4ANC A;  2CWK A;  3Q83 A;  3BH7 B;  4DI6 A;  1U8W A;  1NPK A;  2DY9 A;  1VYA A;  1JXV A;  2BX6 A;  1ZS6 A;  1B4S A;  2DXF A;  3GP9 A;  1XIQ A;  5C7P A;  3FKB A;  2B8P A;  3GPA A;  1BE4 A;  1NDK A;  3Q8V A;  3ZTS A;  4ANE A;  3VVU A;  3L7U A;  2AZ1 A;  3DDI A;  3B6B A;  3ZTQ A;  1WKJ A;  3BBF A;  3EE3 A;  1LWX A;  3JS9 A;  1NSK L;  1PKU A;  3ZTO A;  4ENO A;  2DYA A;  3EVO A;  3Q89 A;  1NSQ A;  4AND A;  5BXI A;  1NHK L;  4C6A A;  1HHQ A;  1NSP A;  2VU5 A;  3NGU A;  2DXE A; 
#chains in the Genus database with same CATH topology
 1BHN A;  5ETR A;  2QYG A;  3EXC X;  3PW4 A;  2IFX A;  3CVK A;  1Y10 A;  3OTD A;  4QYR A;  4ZCK A;  1JJ4 A;  2QLB B;  2H51 B;  3HFK A;  4NLV A;  3J7Z 5;  4C8K A;  4B3O A;  4LF1 A;  3QGI A;  3J7Y I;  2VC1 A;  3I6P A;  1YJ7 A;  1MMN A;  2C2Z B;  2J9E A;  4LF2 A;  4DZ6 A;  5EGY A;  1VIO A;  3QMQ A;  4J5O A;  3H5Y A;  2FLL A;  1HBU B;  1DTT A;  1W26 A;  1SC6 A;  1Z2L A;  3W2W B;  4C3K A;  2OD6 A;  4I68 A;  3GLJ A;  4O4R A;  2OGU A;  3FDS A;  4F0M A;  2CJK A;  2DRA A;  1FHT A;  4USK A;  5HL7 Q;  2OTJ S;  1K1Q A;  2HVE A;  3MM8 A;  4TU8 A;  2N82 B;  1VFJ A;  2DNZ A;  1F5A A;  2KKH A;  1HAR A;  2VH7 A;  3IS9 B;  2CA9 A;  2F4F A;  4OL8 A;  2F7V A;  2B4O A;  2HVD A;  3EVW A;  1N6Q A;  1UZH A;  5H9F K;  1X9W A;  7FDR A;  1RTH B;  2HIQ A;  3W9J A;  1XMB A;  3LA0 A;  5D15 A;  3DLL Q;  2MGZ A;  4B3S F;  4FBT A;  5KG2 A;  5IQ6 A;  2C2M B;  4OX8 A;  3Q2T C;  2K1R B;  4ZVS B;  3CJK A;  4WKY A;  4TQR A;  1S12 A;  1APS A;  5CH7 B;  1UEU A;  4IH6 A;  1SPB P;  2ROP A;  3KK2 B;  3L3C A;  4A8F A;  1FNO A;  2V4R A;  2MTL A;  2FVS A;  3UN5 A;  2WSE C;  4HI2 A;  2YKM A;  2GJI A;  2W1B A;  5B0G A;  3Q86 A;  4IFY B;  3OJS A;  4KV8 B;  1WKK A;  2PO4 A;  4DPY A;  4N7T A;  4FP9 A;  3L7O A;  4NOH A;  4DL5 A;  1UTA A;  4WBF A;  4RW6 B;  3BGL A;  4B3R J;  3MEE A;  2YQ1 A;  2K8G A;  2D74 B;  3HF5 A;  3IG1 B;  1REG X;  2CJQ A;  1H2U X;  2LDI A;  2HG4 A;  3R3T A;  4DV2 F;  2BAN A;  1SH2 A;  3K58 A;  2ZJR Q;  1IVZ A;  4WKR A;  4O3Q A;  2OFH X;  3BO3 A;  3OFE A;  1CJV A;  1Y11 A;  2J7W A;  3NOC A;  3PJW A;  2VQF J;  3T5K A;  1FEH A;  4X65 F;  1XR7 A;  1RYR A;  4K4Z A;  1Q8I A;  3CD0 A;  1YKW A;  5DET A;  4OYW A;  2B56 A;  2FC8 A;  2QJ3 A;  3PEH A;  1WC3 A;  4MFB A;  2L08 A;  3JQJ A;  3Q8Q B;  4OYI A;  1OPZ A;  3GG1 A;  4OYZ A;  2VG6 B;  3UO0 A;  2D3O 1;  4V19 J;  3UR0 A;  2RSQ A;  2E1A A;  3W5Y A;  5C42 A;  1TKT A;  3AOA A;  5IV4 A;  3RAM A;  4BDP A;  2MZT A;  2B9Y A;  1QM9 A;  2VFV A;  3N28 A;  3GQC A;  1F60 B;  1LWF B;  1DZ5 A;  4DQR A;  3T5J A;  4MKV A;  4LF6 J;  1CJU B;  2UXB F;  3AXM A;  4NLX A;  2K7J A;  5HAT A;  3MEG A;  2FYX A;  1HWU A;  2JDJ A;  3R5C A;  4FN5 A;  3TQE A;  3WDO A;  4A46 A;  1U6Z A;  1VYA A;  2D7S A;  2V2V A;  3CJ4 A;  2QZ8 A;  3AB4 B;  3TAM B;  5J2P B;  3MCN A;  2YNI A;  4NL5 A;  1T9W A;  3GTY X;  2Y0B B;  2BJ3 A;  3MZI A;  4K2X A;  5GAE I;  3CJ8 A;  4WFN Q;  4JI7 J;  1FJG F;  3QT6 A;  1EKR A;  2OEJ A;  3FFI B;  3KG1 A;  1JIH A;  3D6H B;  3SQG B;  1OQ3 A;  5G0R A;  2ASJ A;  4IDK A;  4NLT A;  1DQ9 A;  1VOM A;  3OXG A;  5KT5 A;  1LWX A;  2IRU A;  3QGG A;  4M5N A;  4WP8 A;  3CCE S;  3BKU A;  2HQ3 A;  4ECU A;  1RHU B;  4GKK F;  3QAU A;  4N77 A;  5ITH A;  1U2F A;  3MAQ A;  2BAN B;  2ZH4 A;  4DFM A;  2CPD A;  2G9O A;  1KOH A;  2Z56 B;  1VBX A;  4NZ7 A;  4NI2 B;  2HHP A;  3KLE B;  3LWL A;  2XLK A;  3CO9 A;  1C0T A;  3GJT B;  5IFM A;  4C8Y A;  2Q79 A;  3QPI A;  2E1P A;  2NXC A;  2B9W A;  2IM3 A;  2XWX A;  1HQE A;  1PYO B;  2H5E A;  4HH1 A;  4CRJ A;  1N5Y A;  1C1C A;  3DYA B;  4RNH A;  3LP0 B;  3CF5 Q;  5GAG I;  2M52 A;  1BWE A;  5LL6 d;  4O23 A;  4ICL A;  2LYV A;  2D9O A;  3BO4 A;  2YWE A;  3OW2 R;  2UUA F;  1LK7 A;  1P8G A;  4OYO A;  2OUG A;  2VG7 B;  2O1P A;  3NAH A;  2BQR A;  1Y0H A;  2MQO A;  1SH0 A;  3EM1 A;  3FEZ A;  3NEK A;  4TY8 B;  5FDL A;  4JI8 F;  1U1R A;  1HNZ F;  2QX0 A;  2Z2Y B;  3MED B;  4LQ9 A;  1H74 A;  4KQZ A;  5DQG A;  1DAR A;  2NXE A;  3F56 A;  1CG2 A;  2OO4 A;  3E8O A;  1NKB A;  5H9E J;  2FC9 A;  4DQS A;  3AQO A;  4J9V A;  2VBW A;  2EI5 A;  3THT A;  4YQW A;  2BV3 A;  3CCR S;  5GVQ A;  4P71 A;  5LSR A;  4Q8E A;  4R0J A;  4I6W A;  1WKL A;  4FXW A;  5KFD A;  1T8E A;  1IBM F;  1U1N A;  5GAD U;  2DY1 A;  3DLH A;  4F36 A;  2MB0 B;  1RAF B;  2FJW A;  3GB0 A;  3MCO A;  3R6L B;  2XS2 A;  4Z7C A;  4U6P A;  4WIQ A;  1TL7 B;  1KC8 T;  1H0H B;  2HEK A;  1G2E A;  2MPU A;  4DL2 A;  4MFB B;  3PFO A;  1J5O A;  3C16 A;  4M5J A;  1R27 B;  2A1B A;  2ZWP A;  2DGX A;  2ZNZ A;  3NBP A;  5BJR A;  3VCD A;  2DCU B;  4CT8 A;  5J2N B;  1Q86 T;  1UL3 A;  3B4M A;  4DV6 J;  5LT5 A;  3BEG B;  3DNC A;  4MJK A;  3TYT A;  2CNO B;  4K4V A;  1IXK A;  2W9B B;  2DXD A;  3SFG A;  4CLK A;  5DM7 Q;  1VHF A;  3LP2 A;  1U1P A;  2HHQ A;  3E2E A;  4X4U A;  4MK7 A;  1L3V A;  1GK8 A;  3TJ9 A;  4DX5 A;  1FCA A;  4HTJ A;  4DUY J;  2KO1 A;  1DTQ B;  4RW6 A;  5L38 A;  4ZVE A;  1U48 A;  2HS4 A;  1RDR A;  1RAA B;  2XI2 A;  3GIM A;  1Q53 A;  1JLQ A;  2O3D A;  3C8Y A;  3F41 A;  1BQM A;  1FDN A;  1N56 A;  1RAI B;  2J6S A;  2IBO A;  4LF4 F;  2B7C B;  4O4G B;  4K59 A;  1IKV A;  3UCU P;  2HGL A;  1C0U A;  3D1O A;  2RQK A;  5LJ3 Y;  3MM9 A;  4XPE A;  1FRJ A;  4U7C A;  2R7X A;  3A3O B;  3AB2 B;  5KFR A;  3UVJ B;  5M2P A;  2WVB A;  1T9U A;  1SJR A;  1N5S A;  2KJW A;  2XHC A;  1VLY A;  1WI6 A;  2L9N A;  1GX6 A;  1UPM B;  2MLY A;  3QQC D;  4I7F A;  4ZVQ B;  2DK2 A;  4C3L A;  2FPH X;  4F4Z A;  4DF8 A;  1ULR A;  3AJ2 A;  1HBO A;  4M5G A;  2GV1 A;  5KFH A;  2EFQ A;  3NGK A;  4HLB A;  4B9V A;  2JVR A;  3H5U A;  2HKE A;  4LF9 J;  2ZDP A;  2R3V A;  3HSD A;  2OAU A;  4TLQ A;  1WJ9 A;  1WHX A;  1KP6 A;  3M6U A;  1FRK A;  5D4L A;  5ETV A;  3M1V B;  4OZ0 A;  5F8G A;  4A8X A;  3JYT B;  2R2R A;  3LP1 B;  3ZFV A;  4ZPA A;  4BLG A;  2E9R X;  3TZZ A;  3ZTQ A;  2B4P A;  3BN7 A;  2DNM A;  2HNZ B;  3FUY A;  3DCA A;  3MAA A;  1NSK L;  4L3N A;  5I3U B;  1QLN A;  3FQL A;  4Q43 A;  3TRG A;  4J9P A;  2YTC A;  2XY7 A;  1S72 S;  4AND A;  3LQV A;  4IRC A;  2HRY A;  2ZD1 B;  2JFK A;  4ZJO A;  3TW0 A;  4AT1 B;  5IC6 B;  4DCJ B;  5JMN A;  2EK6 A;  5KFO A;  2YX1 A;  2LQ5 A;  3TUP A;  4IG0 A;  1FJC A;  1FVQ A;  2ZBP A;  1NJY A;  2I5J A;  4GKJ F;  4UOC A;  1SQF A;  3NWG A;  2V5H G;  4LRA A;  2GMJ A;  2IDL A;  1TL7 A;  3NNC A;  4YUD A;  1MWY A;  2DEI A;  3VGS A;  6FDR A;  2ZUG A;  1D9F A;  2K06 A;  1PIE A;  1FE0 A;  2MSS A;  4OI4 A;  3C16 B;  2HHU A;  2EBE A;  4PWD B;  4M5I A;  4R8U A;  3BKF A;  2CQH A;  4Q5V A;  2FTR A;  2XBP A;  4P74 A;  4QU6 A;  2OEM A;  3NGR A;  1SQE A;  3R27 A;  5IC4 B;  2UXC F;  3QBC A;  2L9D A;  3MTJ A;  4WPA A;  1KQF B;  4K4T A;  4CO5 A;  2CVE A;  3KUG A;  2MZR A;  3CGI A;  1KLM A;  1KBR A;  5KFB A;  1FES A;  1TK5 A;  1S57 A;  1RA7 A;  4KSE B;  1FDA A;  1F3F A;  1TL3 A;  2DIU A;  3CC2 S;  3EVM A;  2LVW A;  4JI6 J;  1U25 A;  1SL0 A;  1F1B B;  3ILJ A;  3MEC B;  3RG6 A;  3V6D B;  1UA0 A;  1R8P A;  4DR6 J;  2H3E B;  3LAM A;  3GII A;  4ERD A;  2QA1 A;  2NYH A;  3IWL A;  2BUN A;  5CCL A;  1F9H A;  2CQ0 A;  2H4Y B;  3OLB A;  2FHJ D;  1TK8 A;  1HNX F;  1S9E B;  2Z4P A;  5HLF A;  1RSC A;  1VJW A;  4GVB A;  4HAC B;  2V9K A;  1TL4 A;  2J9D E;  1HNV B;  2NZC A;  4TY8 A;  4HYK A;  2VOP A;  4DWI A;  3QIP A;  2RKI A;  4LFC J;  2I5J B;  2HHS A;  1V5I B;  1SUQ A;  1WF0 A;  2PMH A;  1RBL A;  3OR1 A;  4EEY A;  3TQ1 A;  3BDE A;  1RAH B;  3KLH A;  1FT8 A;  1ZPW X;  2BAC A;  4IO9 Q;  2L48 A;  2A2D A;  2VFT A;  2D9P A;  4ALZ A;  5D78 A;  4QR1 A;  1Q78 A;  3HUL A;  4UT4 A;  2F8E X;  1RT2 B;  4ZLP A;  5LJ5 Y;  5LMN F;  3J7A 1;  3V4M A;  3TEG A;  2MDA A;  3C14 B;  4DCP B;  4BWM A;  1UVN A;  1HPZ B;  3CCV S;  3SEO A;  3T1H J;  1OS5 A;  2CUY A;  2XMV A;  3K7R A;  3DI6 B;  3R9L A;  3GFY A;  4ECX A;  1Y3J A;  3KLI B;  4L74 A;  1BXN A;  2DIS A;  5IQQ A;  3KOA A;  2QC3 A;  1F3V A;  1DUR A;  1VRU A;  3FSY A;  1EAR A;  1M0S A;  3JSY A;  4G1Q B;  2ABY A;  4ZVO B;  3SV3 A;  4NA2 A;  1WDT A;  5D0H A;  1MLA A;  2HK3 A;  4WCE Q;  1IBK F;  2J6T A;  3MPY A;  5HBM A;  2E9T A;  5KFJ A;  3Q22 A;  3C6U B;  5C24 B;  1FRI A;  2BBE A;  1DQA A;  4PG7 A;  1QE1 B;  2BKO A;  3I4H X;  4I2Q B;  2WON B;  2XI3 A;  4C11 B;  2UZA A;  1G1X A;  4BS2 A;  1U4B A;  4JI0 F;  2QRR A;  4PRF A;  1XNQ F;  3SQO P;  2HQI A;  5LOQ A;  2LXU A;  3QIP B;  4JI2 J;  4QU7 A;  2MZ1 A;  3CDB A;  3JTP A;  2R2S A;  3D54 A;  3THV A;  1JKH B;  3IRX A;  4DLG A;  2HFO A;  2MJN A;  4PAA A;  1K9M T;  4JI1 J;  3KWM A;  5CZX A;  2V34 A;  5HJX A;  2GHV C;  3OD2 A;  1WG5 A;  4JI4 F;  4RUC A;  1O0P A;  3RB0 A;  2H48 B;  2VKR A;  3OFH A;  3IS9 A;  1I5O B;  3MUT P;  2DO0 A;  2GAH C;  4OI2 A;  5L39 A;  4DV1 J;  3QGH A;  3RJM B;  2AJQ A;  3LAL A;  3CDW A;  2AV5 A;  4EO8 A;  1NKE A;  5F8N A;  2N7C A;  4OHY A;  2XMJ A;  2Y1L B;  3OR2 A;  2GIQ A;  1Y7P A;  3Q89 A;  4WK1 A;  4ZP9 A;  1ZBT A;  2HND B;  3GJR B;  1RWP B;  2FJB B;  4IQM A;  4OJ1 A;  4KKO B;  1O6X A;  5EX0 A;  2F4V J;  3U02 A;  2J0W A;  4C8N A;  1HHQ A;  2MEW A;  2JEF A;  2LQB A;  3GYN A;  2PD1 A;  4ELU A;  1ZAW A;  3R7S B;  3DGV A;  2YPY A;  4ECY A;  2YKP A;  4C8M A;  4OV6 A;  1W25 A;  1Y9O A;  3U7J A;  1NK4 A;  4URG A;  4KH1 B;  3QO9 B;  2ZH3 A;  1UFK A;  1NDC A;  2VC0 A;  2Q3P A;  3OTE A;  4Y0F A;  1XQI A;  3AD8 C;  4EBE A;  4J9U E;  3HJF A;  3KJN B;  1UEV A;  3ZZU A;  2RQC A;  2VKZ G;  2FY1 A;  4PR6 A;  3D4J A;  3EMT A;  3IRX B;  3OR1 B;  1S1V B;  4K4X A;  1KR4 A;  3UCG A;  1YIT S;  2ZOG A;  3H40 A;  3KLH B;  4O3S A;  3M8R A;  1X4A A;  2W4C A;  1X0P A;  4GVB B;  2FHJ A;  1L5U A;  3FFI A;  2GFF A;  2LA6 A;  4I0W A;  1AUD A;  1XJW B;  4Y2C A;  4NLU A;  1WUU A;  3R1H A;  1AW0 A;  4DR4 F;  2UU9 F;  5CYM B;  1S97 A;  3EDQ B;  4C7Q A;  4LUB A;  1TFY A;  2ROE A;  5KFZ A;  1LWE A;  2B7B B;  4M5H A;  4KGM A;  1QE1 A;  1I1G A;  4JYA F;  2GO8 A;  1N88 A;  5A76 A;  3TAN A;  2HHV A;  4CP5 A;  2Y1I A;  1QSL A;  1AYE A;  4U96 A;  1E6V B;  2WZ1 A;  4RBT A;  3ILO A;  4CH1 A;  5IV3 A;  5F8I A;  2E5I A;  3HZG A;  1L3U A;  4Y6I A;  4OX9 F;  3I9Z A;  2Y3Y A;  3P8B B;  2AF6 A;  4YHH F;  1X0F A;  4YY3 J;  1X8D A;  2RDI A;  4RWW A;  4KPC A;  3P4U B;  2UUT A;  5SUH A;  2CYY A;  5B08 A;  1R0C B;  4ZP7 A;  1T03 A;  1C4C A;  2QO3 A;  3TJA A;  2E7X A;  2XMM A;  2B4U A;  1I3O B;  2F65 A;  5I42 A;  1NK0 A;  2UVU A;  3PO5 A;  3ENQ A;  3QID A;  3DLK B;  1XMQ F;  4CO2 A;  1UMJ A;  4XDD A;  1LXN A;  5FD1 A;  1IN0 A;  3M30 A;  5HK4 A;  4R5P A;  2W25 A;  4N5S A;  2OPR A;  4MKA A;  1GMV A;  3IN5 A;  4CCH A;  1S0V A;  4ZPC A;  3TNV A;  1HI1 A;  4ED8 A;  3M9O B;  1H2V Z;  4WFY A;  3ADA C;  5IS2 A;  1K73 T;  4X64 J;  1N33 F;  3ITH B;  2JEJ A;  1GXL A;  2QEX S;  1FX2 A;  2DR9 A;  2HAF A;  3MM6 B;  1D9D A;  1U0S A;  3FBF A;  1G7C B;  4RBU A;  3PKM A;  2VL1 A;  2C2E A;  3ENV A;  2LP4 A;  2BDP A;  2ACM A;  2V4Q A;  1B64 A;  2GGP A;  4MKB A;  3GIR A;  1XBW A;  1XR6 A;  3VGV A;  4YR0 A;  4X62 F;  4EO6 A;  5BR8 J;  3HVT A;  4LRC A;  2C3O A;  2R42 A;  1ZET A;  1U1L A;  2CWX A;  3KLI A;  1A6L A;  3ZNJ 1;  4GC6 A;  2BR0 A;  1D1U A;  3NWR A;  1SI9 A;  2PEH A;  4PQU B;  3CUL A;  2IJR A;  2NPF A;  3EWG A;  3KK3 A;  4UY8 5;  3H5X A;  3GP9 A;  3N5F A;  2WVD A;  5C25 A;  2MZQ A;  1XIQ A;  4URQ U;  2DHX A;  1IQT A;  2WBR A;  2F63 A;  3DLE A;  3FGV A;  4FXV A;  3W7B A;  1UAW A;  4UUX A;  4UST A;  1ZZN A;  1VQ7 S;  4LRE A;  3DGP A;  4X4V A;  4DPW A;  1TV6 B;  2BJ7 A;  1UZD A;  4F4Y A;  2XUL A;  4HDG A;  1HBU A;  4IOC Q;  2AZ1 A;  4HH0 A;  1YBU A;  4A47 A;  2E1M C;  2LU1 A;  1HW8 A;  4TU9 A;  3VTI A;  4NRT A;  3QRQ A;  2FJX A;  1U2R A;  1OJ4 A;  2V8D A;  3R7N B;  1R8B A;  1Y3K A;  2A2C A;  2Z57 B;  3JSR A;  2EBG A;  3RU0 A;  4EI2 A;  1UWB A;  4DV3 F;  4DV5 J;  2CNK B;  2LKZ A;  2IA6 A;  1NSP A;  4Q2L A;  4K8R A;  4CQ1 A;  2AGP A;  1S4E A;  1PBA A;  2HHH J;  2C42 A;  3PAC A;  5GAH U;  3M1V A;  3JYT A;  1SKS A;  4LQ3 A;  4HHJ A;  3OVB A;  4DR7 F;  3D66 A;  4IG3 A;  1S1T A;  1IKY A;  3CCJ S;  4AD6 A;  5RUB A;  1S6P A;  2KT3 A;  5KTQ A;  3HHL B;  4KRW A;  3DRP A;  4A48 A;  2GML A;  2WW8 A;  2DCL A;  3L7P A;  2E1C A;  2A6M A;  2RF2 B;  3SDE B;  5LSL A;  2UXD J;  1CEZ A;  3KJV B;  2J6U A;  1O51 A;  1YZ7 A;  3FC9 A;  3R5A A;  2HGN A;  3KHG A;  2GQC A;  3MMC B;  4IH5 A;  1IJF B;  4U9R A;  4R5P B;  1KN6 A;  3CJ3 A;  2F1F A;  2Y8W A;  3HP6 A;  1IR0 A;  3ET6 B;  1KTV A;  1X7V A;  2D3Z A;  3FRZ A;  3MM9 B;  5KFL A;  4KTQ A;  2HHX A;  5F9N A;  2AYE A;  1TU0 B;  2H54 B;  2KB2 A;  5I42 B;  3HKZ D;  3W2W A;  3VAJ A;  2DNO A;  1B0P A;  3BB5 A;  3H5S A;  1KVI A;  1SKU B;  3UN3 A;  3H2V E;  4DR6 F;  1S49 A;  2XMK A;  4ZVF A;  4CI0 B;  1ROF A;  3AT1 B;  3HMJ G;  3G71 S;  4J9K A;  3WIV A;  3DRR A;  3H25 A;  4ER8 A;  2LEC A;  3SSR A;  4NX9 A;  2DVI A;  1S4F A;  2HNZ A;  3PX0 A;  3UNG C;  2C1E B;  5L9N A;  2LA4 A;  1L3S A;  1NDP A;  3MI7 X;  4OJH A;  2EW9 A;  3G8Q A;  4IDK B;  1CQN A;  1HNI B;  1NUE A;  3RRK A;  3PIO Q;  2RAQ A;  3GIJ A;  3EZ5 A;  1L3T A;  4BC7 A;  2UXC J;  1WEY A;  2JFD A;  3NS5 A;  2JWN A;  4Q7A A;  1WG1 A;  4FS2 A;  2V0N A;  4A8K A;  3K0J A;  4OI1 A;  1N5T A;  4JBC A;  4Q0B B;  1N34 F;  3AHP A;  3KLF B;  2CQD A;  3KKF A;  4NLP A;  5AJ3 F;  2UV8 A;  1PJ7 A;  2X1B A;  5AE2 A;  4L3K A;  4RU9 A;  2MQL A;  4O3P A;  3Q0A A;  1HHT P;  3D6T B;  1N33 J;  3VAK A;  3MM6 A;  3V6D A;  1DRZ A;  3JQM A;  5HI7 A;  3T3F A;  2IVM A;  5AXL A;  4PEO A;  1T11 A;  5E3C A;  2AEJ A;  4UF4 A;  4K4W A;  2R7U A;  3TUI C;  2MZS A;  3RGI A;  2ZHO A;  5DDQ C;  4DSJ A;  2ZOM A;  1F0X A;  2FZC B;  2FVC A;  3I0R A;  2IVY A;  3MD1 A;  4B17 A;  3POT A;  2I8E A;  2PI4 A;  1VQO S;  4YR3 A;  3D5M A;  1RWX B;  1Q16 B;  4WXO A;  2XGP A;  4C48 A;  1RWV B;  4NA3 A;  3SDE A;  1RK8 A;  1JLF A;  2EFV A;  2FB0 A;  3DRX A;  1CUL A;  4F4X A;  4DL6 A;  3J81 j;  1QSS A;  4KO0 B;  5DO2 A;  1T3O A;  5KOX A;  2IYG A;  2V69 A;  1YK9 A;  3GCX P;  4N47 A;  4YY3 F;  5IT9 Y;  3HVA A;  5SZT A;  1DY3 A;  4ILM A;  2G2Y A;  3C19 A;  1K44 A;  1R0B G;  4ETZ A;  1TL1 A;  4LF9 F;  2AW0 A;  2FHO B;  1JJ2 R;  2F3J A;  2W4P A;  3KK1 A;  1RAC B;  4BC9 A;  3D1H A;  1HNV A;  2D41 A;  4ZCI A;  1K1S A;  4MIB A;  2RHQ B;  3QSY B;  2MJU A;  2MQM A;  4F0K A;  2FVR A;  1HWL A;  2BE2 B;  1JJC B;  2BE9 B;  2YWH A;  4ZPT R;  2R7T A;  1SB6 A;  4PXC A;  1YDL A;  1HQU A;  3DRS A;  2ZWO A;  1R89 A;  3N0V A;  2GQ2 A;  2UU9 J;  2Y8Y A;  1DQ8 A;  5H9E K;  3OTB A;  4IQX A;  3BN4 A;  4QR2 A;  1T7P A;  2Q66 A;  1CC7 A;  3FZ2 A;  4O3O A;  3LPY A;  3NMR A;  1GTE A;  4NLY A;  2DNK A;  4RZR A;  3OL8 A;  4ELV A;  2XYP B;  4LT6 A;  3UDE A;  2AJ1 A;  4P7V A;  2OEL A;  5GME A;  4NXN F;  2W2M P;  2VZ9 A;  2IVF B;  3CIM A;  4EWT A;  3BSN A;  5JJB A;  3M2R B;  2CPY A;  2CQG A;  5ADZ A;  2CQ4 A;  2VG6 A;  2VG7 A;  5KG0 A;  2WON A;  4C11 A;  2HVZ A;  4C8L A;  1B70 B;  2OSQ A;  5C42 B;  2F9J A;  3CJ5 A;  1VQP S;  4PWU A;  1FF2 A;  2V4J B;  4LFA F;  4LMZ A;  2G1H A;  4PWW A;  2R7W A;  4WE1 A;  2HFU A;  1NO8 A;  2V2K A;  2PEB A;  4NLG A;  1VRT B;  1FE4 A;  2CG8 A;  5EUH A;  1YRU A;  2F4V F;  1CS4 B;  2OD4 A;  2BQ3 A;  5FDL B;  1L3K A;  1Q7L B;  2DXE A;  3C2P A;  3O5T B;  1MRO B;  5A6P A;  4CYU A;  5GAE U;  1HPZ A;  3TA1 A;  4F8R A;  3NNH A;  5DRK A;  3BGR B;  2DPI A;  3PDN A;  3LW5 C;  2WBM A;  4IRD A;  3LWM A;  3RRH A;  3CD5 A;  4KBI A;  2FIU A;  3AJ1 A;  1VRU B;  2RQ4 A;  2OH2 A;  4X64 F;  3AOC A;  2G0C A;  4OJ3 A;  1RUS A;  2DH9 A;  2X3D A;  4IRK A;  1SV5 A;  1T9V A;  2ZE2 B;  4X4N A;  2ILZ A;  4DJB A;  3BF4 A;  3QFW A;  1FWL A;  2I9S A;  3AD7 C;  4HDH A;  2XSJ A;  2M88 A;  4DSE A;  4P75 A;  1D09 B;  1RTJ B;  4FVM A;  4ELT A;  4LF8 F;  3TZY A;  4DN0 A;  4JI1 F;  3G82 B;  4USJ C;  3IR6 B;  2C3Y A;  2IC3 A;  5EHH A;  5DGA A;  2E5J A;  3TZX A;  4J91 A;  1N8R T;  4CT9 A;  4QCL A;  5E2Q A;  4QWB A;  1WF1 A;  1FER A;  4KO0 A;  3CSK A;  4NZ6 A;  3W63 A;  2KG0 A;  3UD4 P;  5HRO A;  2BE7 D;  2DRD A;  4RKU C;  2BJE A;  4QWC A;  4BBY A;  2DPJ A;  4PUO A;  3IWN C;  3TEH B;  2QMX A;  3G87 A;  5IWA J;  4ZIW A;  4KHM A;  4OZ5 A;  2LXF A;  3RBE A;  3LGN A;  1REV B;  2IY5 B;  2E66 A;  2DHH A;  3HK2 A;  4MKY A;  2OKQ A;  2KHD A;  5D77 A;  2ALZ A;  4TN2 A;  4DX6 A;  2W9C B;  5D0G A;  2CQI A;  1CPZ A;  5DDP C;  1KFD A;  1FRX A;  4RW4 B;  1HIY A;  2GA7 A;  2QL5 B;  1HW9 A;  5A6W A;  1ZM4 A;  2E29 A;  3UN2 A;  1FI4 A;  3JSM B;  1RHK B;  1N32 J;  1NXI A;  1IBK J;  2NSC A;  3PY8 A;  1K47 A;  2GX8 A;  3T19 A;  3DLG A;  2EFN A;  2KFY A;  1HD1 A;  2B3T B;  3R5J B;  2UV8 G;  2JEG A;  1UKU A;  2WCX A;  2BE2 A;  1RTI A;  2XYH B;  3QAT A;  1S9F A;  2BRK A;  3A1Y G;  1N48 A;  5KG7 A;  3ILI A;  3OLA A;  5DG9 A;  1Q5Y A;  4PAB A;  2K7K A;  4KB7 A;  4DZD A;  2NXN A;  4Y28 C;  4NMX A;  1X4C A;  2YNH B;  3SSQ A;  4CLL A;  4LFA J;  4W90 B;  3G2X A;  2M4M A;  2QTW A;  3M2U A;  1S1V A;  1WC6 A;  2DGV A;  3QGP A;  3U27 A;  5HMW A;  3KHH A;  2ZH5 A;  1R0A A;  1HBN B;  2IHR 1;  4DQQ A;  3B78 A;  3D1Q A;  3VGT A;  4BWJ A;  3K2Y A;  1X4D A;  1HQE B;  3O2I A;  4DV0 F;  4X4S A;  3I87 A;  5AXN A;  3OSN A;  5E3R A;  4FS1 A;  5KG5 A;  4HR2 A;  4IFY A;  3E01 B;  5CAA A;  4HHU A;  1N6Q B;  2DNN A;  2CWK A;  2HQC A;  2GCF A;  1Q8L A;  3CPW R;  4O0I A;  3EGW B;  4QYZ J;  3CO0 P;  4ILL A;  3VQT A;  4KKO A;  4DSI A;  1VK3 A;  4EFA C;  1U0H A;  2YWK A;  2BXJ A;  1Y4Z B;  2V4J A;  3A3P B;  3PYG A;  3VZI A;  1JXE A;  3DFE A;  4F25 A;  1T03 B;  1PO6 A;  1NEE A;  1M90 T;  4PG6 A;  3OL9 A;  2W24 A;  4LF8 J;  1A7G E;  4DDF A;  1VRT A;  1C1B B;  1KQG B;  1W2I A;  2B8P A;  2JLF A;  1B7Y B;  1H7W A;  1SC3 B;  2P6S A;  1QUV A;  4PPD A;  3GZ7 A;  5ETQ A;  4QQB A;  3R8Y A;  3MD3 A;  3D0H E;  3SCK E;  5B09 A;  1EET B;  4EUV A;  4X62 J;  5L1L A;  3BYP A;  4PYD A;  4ANE A;  2XTJ P;  3VAM A;  3SSS A;  4O3R A;  3TZW A;  1SKR A;  3TVZ A;  3VV2 B;  5KFS A;  1WKJ A;  4UZB A;  3BZQ A;  3L09 A;  5L1I A;  1YSJ A;  3G9C A;  1RYS A;  3HT3 A;  1HQU B;  2K1R A;  3DRS B;  3CJK B;  1R43 A;  3JS9 A;  3H2U B;  1NK7 A;  2GVD B;  1OWX A;  1WHV A;  3QSI A;  4ENO A;  1REV A;  3S7R A;  3RW7 A;  5CYM A;  3PO4 A;  4HEA 9;  3N79 A;  3AD9 C;  1UVL A;  4NCB A;  2HLU A;  5HVH A;  3CJS A;  1S79 A;  2R8K A;  2IAJ A;  3DLB A;  5K14 B;  2KXF A;  5AE3 A;  4UUW A;  1JLB B;  2VFS A;  3JSB A;  3W2V A;  1HBN A;  4F26 A;  5C25 B;  2IC3 B;  5KFV A;  3VAF A;  3MPD A;  3ZTP A;  1PJ5 A;  5DS7 A;  1FFG B;  2YY3 A;  2NCK L;  4DG1 A;  1H73 A;  2ZBC A;  4PYA A;  3KLG A;  4F4A A;  5CYQ B;  3C15 A;  2KTQ A;  2R8I A;  5AJ3 J;  3K5L A;  2QA4 S;  2UUC F;  4Y3C A;  3GR0 A;  1NDL A;  2W7O A;  4DS5 A;  3IBC B;  4IYQ A;  4QIV A;  3OVA A;  1LOU A;  3R7B B;  2W8L A;  3OSP A;  3R97 A;  2V67 A;  2IM0 A;  4DU8 A;  1SC1 B;  1S1U B;  3CJQ A;  3GSI A;  4QIG A;  3TWZ A;  4WU3 A;  1VQL S;  3NGT A;  1U0H B;  5HQL A;  2H4W B;  3IG1 A;  1NB7 A;  3RR7 A;  2XB2 D;  4U7U D;  1T9T A;  3GIL A;  4ECT A;  2P9G A;  3HDS A;  2AJ0 A;  4JOU A;  4ZVT B;  3V6J A;  5B0E A;  2DNG A;  3BO2 A;  4W98 A;  4FYV B;  1P27 B;  2GJ2 A;  5F3T A;  4DR4 J;  3D67 A;  3CCT A;  2YH0 A;  4FXD A;  3E01 A;  2ROG A;  3MDF A;  4KFB B;  2OML A;  3UNY A;  1C2P A;  4ZJQ A;  1KEK A;  2HRT A;  3HD1 A;  3IP0 A;  3MGJ A;  1M5S A;  3V6H A;  1LXJ A;  1QDU B;  3KG0 A;  1KQS R;  2CNN B;  3O44 A;  3OFF A;  2DNQ A;  4RLE A;  4KHP J;  1FKP A;  1O8B A;  1RI7 A;  2GVD A;  5KFC A;  5DGB A;  4DUY F;  5HRO B;  3ISZ A;  2OPQ B;  1IUJ A;  1TUV A;  1HLW A;  4NPO A;  1CQM A;  1TL5 A;  2P9E A;  4USU A;  1ARO P;  5D4N A;  5C2G A;  2ZH6 A;  4J9L A;  3BDP A;  2PGC A;  3D0G E;  5KFA A;  2QMU B;  5FLX U;  4NCA A;  2EC2 A;  5HLF B;  3EGZ A;  5ETM A;  2KH9 A;  3R2C J;  1IR1 A;  1T9X A;  4MK8 A;  4DHV A;  1UVJ A;  1FJ7 A;  3P49 B;  3KHR A;  1IKX A;  2GNK A;  4EZ9 A;  4NI2 A;  1NSA A;  2AEF A;  3M8S A;  2C2D A;  3CCL S;  5H9F J;  4G1P A;  4WFZ A;  1F6T A;  3NGS A;  4N8O A;  4CO4 A;  4YS2 A;  1WSR A;  2RRB A;  4TY9 A;  1OY9 A;  2E44 A;  3F44 A;  5C2C A;  2VIH A;  1S48 A;  4ZVR B;  2C2O B;  3GU0 A;  1BUX A;  4CWB A;  2N3O A;  5DLF A;  1GXU A;  1TKD A;  3M8W A;  3E51 A;  4D3H A;  1N34 J;  1YLX A;  2VBY A;  2UVV A;  4QYZ K;  1S1U A;  2IPO B;  1HFE L;  9ATC B;  2JOQ A;  4JI4 J;  5GMD A;  2SXL A;  5ETN A;  1YJ9 S;  1X60 A;  4N41 A;  3RYL A;  3KJV A;  3VQS A;  4ZHR B;  2XG8 A;  3SCI E;  5L1J A;  1YG0 A;  2EEY A;  2IDE A;  2ERR A;  3RTV A;  5IWA F;  1BLU A;  4DG1 B;  3AAW B;  4NWB A;  1S6P B;  1JLE B;  3CMA S;  4QBU A;  5MAO A;  2I1R A;  4ZIV A;  2E5H A;  2J7U A;  2YKN B;  2QT7 A;  2IAJ B;  4NYO A;  1TKX B;  3W5X A;  3TX0 A;  3POT B;  4DQP A;  1X9M A;  1U26 A;  1JLB A;  2FJD B;  4F50 A;  2IM1 A;  4CTA B;  3CMQ A;  2DKO B;  1RGV A;  2ZNY A;  5C7P A;  4DF4 A;  1WOO A;  2RD5 C;  3IO1 A;  5AXM A;  4OJG A;  4JI0 J;  3GPA A;  2W2N P;  3WQP A;  1BE4 A;  1WOP A;  2KM8 B;  2M8D B;  2W4D A;  3IBF B;  4OYM A;  3N6N A;  5LM7 E;  3P3D A;  3TJ8 A;  3OUY B;  2ASY A;  1S9E A;  2NXU A;  1RAE B;  4MYT A;  4FYD A;  1OYD A;  1LQ9 A;  2ZDO A;  3BJY A;  1R6Y A;  3UI3 A;  2BOA A;  1J5O B;  4DBQ A;  1N0V C;  3BBF A;  1GAO A;  2P2C B;  3HSG A;  1T9Y A;  4ZLJ A;  2NRE A;  5J2M B;  1B7F A;  2Q6C A;  4XTT A;  2W7A A;  4ES1 A;  3MF5 A;  4CDI A;  3KK1 B;  3EDR B;  1VQY A;  1C0U B;  3MMA B;  3UWT A;  1GX5 A;  1GMW D;  1OSC A;  4DR2 J;  3AA8 A;  1BQM B;  3W8P A;  1NK5 A;  1RT7 B;  2J76 E;  3Q2S C;  3QLH A;  4RWX A;  1IKV B;  4XO0 A;  4DV3 J;  3D7S B;  4DSL A;  3DU6 A;  3QT7 A;  1NPR A;  4MIW A;  4GKK J;  1S9G A;  2DR5 A;  1GT8 A;  3US5 A;  2DT9 A;  2PA3 A;  4ZS6 A;  4BHQ A;  4RNO A;  3CCS S;  3T1Y J;  2ZH9 A;  3RRG A;  1SL1 A;  2YKN A;  1TMJ A;  2RS8 A;  1MML A;  1V3S A;  3D3C J;  2HVI A;  4KT0 C;  4KHP F;  4YHH J;  1HMV B;  3IAS 9;  3CIZ A;  3HHL C;  4P2S A;  1KQK A;  3MR6 A;  1ZTW A;  2L41 A;  3VAG A;  2JC1 A;  1YZ6 A;  3NXZ A;  1BMQ B;  1FD8 A;  1PC5 A;  3UDC A;  4YEA A;  1RWO B;  2KZZ A;  1JLA A;  3EX7 B;  3CCU S;  2AJ2 A;  3OBI A;  3W8G A;  2CRL A;  1E6Y A;  3PHE A;  3T5L A;  5I3U A;  4IOA Q;  2L9W A;  4JYA J;  3PR5 B;  3VWS A;  5J2N A;  3LAN A;  4KV8 A;  3QO9 A;  1NZA A;  4WP9 A;  1VQS A;  4V1A k;  4JV2 A;  1M5P C;  1GXT A;  1LW2 B;  3FCV A;  5E7O B;  3AH6 A;  1CS4 A;  3WBZ A;  3MM7 A;  1TKZ A;  2XY6 A;  1U47 A;  3FBE A;  1RT5 A;  1MRO A;  2XMW A;  3RB6 A;  3QJL A;  3GFX A;  4LSL B;  3SBM A;  2OPS A;  3T1A A;  4F7V A;  5A0Y B;  3I0S B;  1M1H A;  2CQ2 A;  2HZA A;  2R7V A;  3BRE A;  5DDR C;  1MU2 B;  4XK8 C;  3T9N A;  2ZKU A;  5KFE A;  3BH6 B;  3MEK A;  2X1F A;  4NRU A;  4Y2A A;  3OTO F;  1AFJ A;  4FDF A;  1DTT B;  5A8R B;  1TVR B;  4QPX A;  2XM3 A;  2ASL A;  4I7F B;  3C3L A;  1U8S A;  4ID5 B;  5J2Q A;  3FBB A;  4K7Q A;  1RT6 B;  3I82 A;  4UOG A;  3CWJ A;  4LSN A;  4RW8 A;  4DSF A;  5C5J A;  1U6F A;  1RZM A;  1LKZ A;  3PKY A;  4K4S A;  1UVK A;  1EKS A;  1NZ8 A;  2WHO A;  5BYQ A;  4WTY A;  3K5N A;  3DHW C;  3OFG A;  1LNQ A;  3ENW A;  3NOG A;  1SKW A;  2E5L F;  4CTA A;  2HPU A;  1HHS A;  2ZD1 A;  5K20 B;  4ED1 A;  1YJU A;  2PC6 A;  1FKP B;  3KG4 A;  4OZN A;  3BQ0 A;  4LVN P;  2HBY B;  1AB8 A;  1YJR A;  4I1T A;  4P10 A;  3P96 A;  2FDN A;  3G6X A;  5B7W A;  1NLK L;  3OTO J;  1K8A T;  3BGR A;  2DIV A;  3K89 A;  1BQN A;  2AJ4 A;  4UW2 A;  1EP4 A;  2YKM B;  2RUG A;  3I56 S;  2UUA J;  2MZJ A;  2UXB J;  4ANC A;  1KOO A;  2J9C A;  1RT4 A;  4TU7 A;  1RLC L;  1R8H A;  4J7C A;  4L6V 3;  4K4U A;  2MQQ A;  3Q23 A;  2P8I A;  3DRR B;  5KFY A;  2YX4 A;  3PXG a;  4OLP A;  1RT1 B;  2PDA A;  5LXR A;  1FFW B;  3BSO A;  2OPR B;  4C98 A;  3TVY A;  2XO7 A;  4TLR A;  2DXF A;  5HQM A;  3G6V A;  3QAE A;  3RBX A;  1RWW B;  2WB4 A;  2MY7 A;  2CVI A;  1RAO A;  1XNQ J;  2IJN A;  4LR9 A;  4YB5 A;  3H98 A;  2R7R A;  4Q44 A;  4N8N A;  5J2Q B;  1QAJ A;  3CNQ P;  1TVR A;  1E6V A;  2HWH A;  3SXL A;  3OV7 A;  4DV0 J;  2AIR B;  4K50 A;  2CAJ A;  4NLQ A;  5KT4 A;  3F73 A;  4PQU A;  2POK A;  3SYZ A;  3EE3 A;  2KXH A;  1SUQ B;  3KTQ A;  1VGY A;  1T94 A;  5D3G A;  2XWY A;  1XMO J;  4M63 A;  1M5O C;  2MHN A;  2HS3 A;  5BXI A;  4DL0 C;  1RE1 B;  2V8P A;  1XTZ A;  3DLJ A;  3MEG B;  4F02 A;  4F3Q A;  3BSC A;  2XS7 A;  2VU5 A;  4GRS A;  3W62 A;  4DV5 F;  4FNI A;  2OIH A;  5LMN J;  1LWF A;  9RUB A;  1QTN B;  2BA9 A;  2Y1R I;  3AQP A;  3ETO A;  3IC1 A;  5E5N A;  3W9H A;  2DGT A;  3L4B C;  3DM2 B;  4CLF A;  2DH8 A;  1FNM A;  1H7X A;  5KFG A;  2WOM A;  3H2L A;  4DCO B;  5KFW A;  1SC4 B;  2AQ4 A;  2HVH A;  2DNL A;  2VPY B;  3GWC A;  4QIE A;  1NK6 A;  4DV1 F;  4GVL A;  4LSN B;  4G6V B;  4RW8 B;  3ICL A;  3PJ9 A;  1FRM A;  3UD3 P;  4LFC F;  4P6Q A;  4OV1 A;  5K5M A;  1LFW A;  3V6K A;  2K2P A;  2N3L A;  2B51 A;  4ID5 A;  3DKD A;  4DL7 A;  1U2C A;  3FEY B;  4ED6 A;  1CJV B;  1X4H A;  5DQI A;  3ZZR A;  2G1D A;  1JXL A;  2RDJ A;  4PPZ A;  1B99 A;  2QE5 A;  1LV5 A;  3NGD A;  2W2Q P;  5ETO A;  1IBL F;  2Z0G A;  3BGO P;  1U1O A;  3ZZP A;  3O1L A;  1RTZ A;  1FX4 A;  3BPS P;  3PRV A;  4OIX A;  4RBV A;  3HHL A;  3TO8 A;  5IZH A;  4JI3 J;  4NLD A;  5KFT A;  3SI8 A;  2PFD A;  2QLX A;  4FKY A;  4UZC A;  2XLI A;  3AOB A;  2EFP A;  3OR2 B;  2HAI A;  3I96 A;  4ED4 A;  2RH3 A;  1RHQ B;  1EQ0 A;  1BD6 A;  2J8A A;  2FLP A;  2DTJ A;  1U09 A;  5DLG A;  1IBC B;  1HBM A;  1FXD A;  2FGC A;  1UFL A;  2LLZ A;  4ZCM A;  1Z2Z A;  3A12 A;  8RUC A;  2VB6 A;  3IM9 A;  3M8P B;  4FYY B;  2CQP A;  4OHW A;  4S0M A;  2EK1 A;  3HHE A;  2MLZ A;  3NRB A;  4K5S A;  2R8G A;  3SCL E;  3BSA A;  1KS2 A;  4UOH A;  3TAM A;  3V4I A;  3NY0 A;  4XIU A;  1N5Y B;  1MN9 A;  4K2J A;  1URN A;  1DAX A;  4JP8 A;  1RU2 A;  4YB1 P;  2VOD A;  4B9L A;  5KFQ A;  2CFX A;  4ED0 A;  4KFB A;  1D3W A;  2CJY B;  1TL1 B;  1HNI A;  3WX4 A;  2B4V A;  2KYX A;  1TAU A;  5A8W A;  4ED3 A;  4AL6 A;  2JEI A;  4IOB A;  3IRW P;  1N54 B;  2CJB A;  2E7V A;  5MLC V;  1XMQ J;  3CXC R;  1S10 A;  1U45 A;  3J7Z T;  3WZ0 A;  4FF4 A;  1LWC A;  1X4F A;  2HWI A;  3EPG A;  1KFS A;  1P6T A;  3GV7 B;  3FVY A;  1RT3 B;  3RB4 A;  3I5C A;  3NCQ A;  3D68 A;  2OI2 A;  2CZV C;  3VAL A;  4YOE A;  2PN6 A;  1F2H A;  1IKW B;  3P5T L;  2ZC4 A;  5HP1 B;  3K5O A;  3HHK A;  2XNQ A;  1NCL A;  2RF2 A;  4USW A;  5T7L B;  3G86 A;  1OIA A;  4HL9 A;  2ZHB A;  4OYB A;  1WHW A;  5AT1 B;  5THW A;  1FNX H;  1LWE B;  1VMB A;  1TTH B;  3H42 A;  4AE5 A;  1QTM A;  2HMI B;  4RNF A;  1HBM B;  3ILL A;  2G0I A;  4TKT A;  3G96 A;  2QLJ B;  4ZLN A;  4Y2K A;  4JI6 F;  4FVC A;  2YX7 A;  1JXV A;  1RA6 A;  3F0N A;  2KRR A;  4ZA1 A;  3PV8 A;  4LF5 F;  3RW6 A;  2DHG A;  1M5V C;  2CDQ A;  1VQM S;  1S76 D;  1PBU A;  1NPP A;  5KFX A;  1JLC B;  5IXU A;  4YDX A;  4URS A;  4ZP8 A;  2BVZ A;  3TUZ C;  1VBK A;  3T1Y F;  2RNE A;  1IQZ A;  1SXL A;  1X4B A;  1YBA A;  3IWX A;  3M30 B;  2R7O A;  2AU0 A;  1WWH A;  2UUC J;  2RIL A;  5EN1 A;  1RHM B;  1RTH A;  5KG6 A;  5CA5 A;  2N4D A;  4CO1 A;  3PR4 A;  3S6E A;  3WIU A;  3G8T A;  2MKS A;  2QLF B;  1GMU A;  1ZYQ A;  1BGX T;  4ZKA A;  3W3S A;  4G1I A;  5M2R A;  1FVS A;  3KNG A;  1XEZ A;  4WTO B;  1PIL A;  3EVO A;  4L72 B;  2YKO A;  1NHK L;  2BM1 A;  3BKT A;  4C6A A;  1GMW A;  2V2Q A;  2B9X A;  3BGF A;  3NG8 A;  4L75 A;  4R0E A;  3M05 A;  5HVG A;  5L1K A;  1OO0 B;  5BYS A;  2UVR A;  2F8H A;  4J37 A;  1BY9 A;  2VF3 A;  1RWN B;  3I4P A;  5HN0 A;  4WYL A;  1WEL A;  1UJ6 A;  1M1K T;  4ETX A;  5L46 A;  1WG4 A;  3MUR P;  2VDH A;  2AHO B;  1NHU A;  2V8V A;  2V9W A;  2VJV A;  3OT9 A;  1OSD A;  3BS9 A;  4RR5 A;  1WTB A;  1RWK B;  4DFP A;  3K8W A;  3BYR A;  2W9B A;  3M8Q A;  2E7W A;  1GFW B;  4OZJ A;  4EYI B;  3CW2 C;  5K8P A;  1PG5 B;  1TKX A;  1VJQ A;  1VS3 A;  1ZM9 A;  3DLK A;  2I6W A;  3R2D J;  1KWM A;  1YRT A;  4ZHR A;  2O01 C;  3PYF A;  1DLO B;  2AMC B;  2HWT A;  4NEY A;  4ZMM A;  1XR5 A;  5CHC B;  4JV5 F;  1YWX A;  3H90 A;  3GYG A;  4UY8 T;  1VQ8 S;  1SIZ A;  1TV6 A;  4MAK A;  3K8V A;  4PZV A;  1HYS A;  4QW8 A;  1RTI B;  2MQ8 A;  3TOQ A;  2HLT A;  4RUB A;  3OHB A;  4LF4 J;  4IUF A;  2A3J A;  5G4D A;  2J5A A;  2K3K A;  3DRY A;  1CLF A;  3K5M A;  2PMZ D;  2WAQ D;  2CJ9 A;  5FLX Y;  3BGU A;  3UFC X;  2UXD F;  4H4O B;  3T5H A;  1IKY B;  2HGM A;  5JVH Q;  1ZA2 B;  3QZ7 A;  1YJW S;  2NQP A;  3U1L A;  4OFZ A;  4DR7 J;  4I64 A;  1KDN A;  3BBB A;  3EXY A;  5T41 A;  4I67 A;  2CPZ A;  4NZ0 A;  1KTQ A;  1H3D A;  4QZV B;  3M6W A;  3T1H F;  1S0N A;  2GHW A;  2OLW A;  4CO0 A;  4K0K F;  2LEB A;  1TAQ A;  2GIF A;  2JJ4 D;  3N6M A;  2XZD B;  4ED2 A;  3H7H B;  5F8J A;  1GH8 A;  3BM7 A;  5I3P A;  2W2O P;  2ZIT A;  3MCM A;  2ZZT A;  3UW1 A;  1GQE A;  4MYU A;  1UWA A;  1EZZ B;  3TA0 A;  3J7A N;  2D3U A;  4C0B A;  3V81 B;  3ZZ0 A;  1N32 F;  3ZO7 A;  4RNN A;  1PCA A;  2QSF A;  4C3M A;  4V19 X;  2DIT A;  2B0G A;  2KT5 A;  4DPU A;  3TAR A;  1RT6 A;  3LAK A;  2NUH A;  2HIY A;  4L73 A;  3OQ2 A;  5CAB A;  1D9A A;  1MWQ A;  2CPJ A;  4RUA A;  4EBC A;  3K59 A;  1SV5 B;  1FTR A;  1P9Y A;  2N7Y A;  4XAK A;  3C6T B;  2J0S D;  3CE8 A;  1JLG B;  4OYX A;  1ZA1 B;  3W61 A;  3QRR A;  4HT5 A;  2ZBR A;  4M8L A;  3KJQ B;  4GMK A;  4XPC A;  1NPK A;  1J5E J;  1VC0 A;  3GR1 A;  5KFU A;  4KY3 A;  4PXB A;  2GW8 A;  2Y1J A;  4LR7 A;  1HWJ A;  2OPS B;  1VQ5 S;  2JH3 A;  3DI6 A;  1QJH A;  2EKN A;  2MKY A;  4OLO A;  2IYI A;  1NAQ A;  1PYS B;  2ZKT A;  4JI8 J;  4DXL A;  3A8K A;  3W66 A;  4OZ1 A;  1LW2 A;  4LBP A;  5GAH I;  3VAI A;  2DJW A;  5CYQ A;  4EU0 A;  1XER A;  4DV7 J;  1CUL B;  4QIF A;  4F3O A;  1T05 A;  4TXS A;  4C0H A;  2AYM A;  3R5D A;  2EKY A;  4OQJ A;  4O44 B;  2RE1 A;  4PG5 A;  5KT6 A;  3W2V B;  3N5B A;  2VG5 B;  2Z58 B;  1QVG R;  2NPI A;  4Y00 A;  1N52 B;  1VK8 A;  3BR9 A;  3GIK A;  1XK8 A;  1G3O A;  1S0M A;  2R2T A;  2RKI B;  2C3M A;  4ZVP B;  3M32 B;  2CZ9 A;  4UTG A;  4ZN3 A;  4J9R A;  4F3M A;  1V6H A;  2DYA A;  5FJ4 A;  2M9K A;  5F0U A;  1EQM A;  2FUG 9;  1CJK B;  2B6A B;  1AT1 B;  2O67 A;  2YNG A;  2YBV A;  3MFI A;  4HAC A;  4DV2 J;  4USV A;  1JLQ B;  3AJD A;  2HFN A;  1RAG B;  3M6V A;  3PVX A;  2HRU A;  1U1Q A;  2AYG A;  3RB3 A;  2PMW A;  4DV4 J;  5KG4 A;  5CZV A;  2L3M A;  2U2F A;  1R31 A;  3QWP A;  5A8R A;  1X5T A;  1FWP A;  3TA2 A;  1NM2 A;  1S6U A;  4CLT A;  3H4B A;  2J0Q D;  3TAP A;  3SCJ E;  3MTK A;  1R7I A;  2RB7 A;  4FKX A;  3MOZ A;  2V50 A;  2C22 A;  1MU2 A;  2D3O R;  1EET A;  3HT0 A;  3ZZZ A;  3CCW A;  4ILR A;  5GAG U;  4ZVH A;  2CQ3 A;  2R2U A;  4NXN J;  3M9M B;  2XEX A;  5CCM A;  4L76 A;  1HBO B;  1ZAX A;  2EPI A;  3NLC A;  5KAK A;  5CD4 H;  4B9T A;  4I2Q A;  3LUY A;  4WJB A;  4U8Y A;  3D9B A;  1EX8 A;  2KM8 C;  2XCA A;  3HJV A;  2DO4 A;  1HNW J;  1U02 A;  5CXT A;  2FZK B;  4PG4 A;  5HAO A;  2GZO A;  2XLJ A;  2XC9 A;  1M5H A;  2HQG A;  3JB9 k;  1HI0 P;  4FF2 A;  2AD9 A;  1X5O A;  1S1X A;  2QLW A;  2HS0 A;  2VPX B;  3KHL A;  1RKJ A;  1HR0 J;  1BQN B;  4HT7 A;  4A8O A;  2MLX A;  1FK9 B;  1N4L A;  2YKA A;  4P2M A;  4DFJ A;  4C9D A;  4A4J A;  3M9N B;  3CJR A;  1SBR A;  3FRY A;  2DR6 A;  3EJM A;  3LH2 S;  4OZ2 A;  3H20 A;  2G2Z A;  1QAX A;  1WC4 A;  4EBD A;  1YQH A;  3NMA A;  2XGQ A;  4ECV A;  3KXD A;  3V5R A;  1NB2 A;  1V3R A;  1N0U A;  1SJF A;  3SIP B;  4CYU B;  2ASD A;  3PTW A;  1C4A A;  2RRN A;  2B6A A;  1CJK A;  1W2B R;  2MGZ B;  1KVK A;  1KD1 T;  4RW7 B;  2CPF A;  4X65 J;  4F2S A;  1FRL A;  5HSP A;  1YGY A;  1AA1 B;  2FZG B;  3PRB A;  2ZM6 F;  2GQQ A;  4HHH A;  1S9G B;  5DM6 Q;  4J9N A;  3A8J A;  1UJ4 A;  5CYJ A;  1S59 A;  2XZT B;  3KMS A;  4EZ6 A;  1MG7 A;  3LF0 A;  2KFZ A;  2QGF B;  4WFX A;  3O6Q A;  3THP A;  2FVP A;  4AXJ A;  4YB7 A;  3M2V A;  4R8U B;  3IGN A;  1IM6 A;  2AZ3 A;  3I5B A;  3EUN A;  5HMX A;  2F40 A;  4UQT A;  1Z4U A;  2ZFH A;  4X4R A;  4ECR A;  4AQY F;  1FKA F;  3HO1 A;  4RU2 A;  5EWG A;  3ZZO A;  1NK9 A;  1MWZ A;  2MQN A;  3MAH A;  5HO4 A;  4QWD A;  2QFJ A;  2HNY B;  2IRY A;  2VAS A;  4WZQ A;  4E0D A;  4KYZ A;  2PI5 A;  2V6A A;  1KLN A;  2OPQ A;  4FNH A;  1A0O B;  1DBD A;  2X51 A;  3IFE A;  2MYF A;  5KFK A;  4A8M P;  4DR1 J;  1HI8 A;  1RBO B;  2AX1 A;  3HZE A;  4X84 A;  3OUY A;  5U47 A;  4CLY A;  3M2R A;  1J2V A;  4DOZ A;  1KRP A;  3CC4 S;  2ZVI A;  1JX4 A;  3RUB L;  2DY9 A;  4G65 A;  1RT5 B;  4JB8 B;  3RBD A;  3R5B A;  4P7T A;  4X66 J;  2PFF B;  3WC2 A;  3M8Z A;  3FJ2 A;  2DBB A;  5HVF A;  3OJU A;  1IWA A;  4LVO P;  4B3T J;  1UWB B;  3A3N B;  3CC7 S;  3CUN A;  1I51 B;  1Y5I B;  4P52 A;  3C46 A;  4KR0 B;  3UR3 C;  2MXY A;  2ALY B;  1EB0 A;  3QLH B;  2J9D A;  5F0W A;  4NCG A;  1JJH A;  1OQ6 A;  2P5V A;  2FD2 A;  4PG8 A;  1CSJ A;  2R7S A;  3ZNU A;  4OX6 A;  3IXQ A;  2MHE A;  3T41 A;  1JB0 C;  3ISN D;  4KHR A;  2ILY A;  1SH3 A;  1WI8 A;  2YKQ A;  3DOM A;  4I2P A;  5K8O A;  1TZ0 A;  1RP5 A;  1U1M A;  4ECZ A;  4H4M A;  4B9U A;  3M2V B;  2ZHA A;  2O5D A;  2Z2Z A;  4RW4 A;  3GFZ A;  4JI5 F;  1S6Q B;  4ECQ A;  4IKA A;  1H38 A;  4OMF G;  1VRQ C;  3GJS B;  2BM0 A;  3MCS A;  1OMS A;  3GE9 A;  3N9U C;  2C28 A;  1EHW A;  1PAU B;  1S1W B;  3SQG A;  1EIY B;  1FKO A;  1S7H A;  2F9D A;  3Q8U A;  4C8O A;  1XNR F;  3DXS X;  3T6B A;  2C3U A;  4ATN A;  2VFU A;  4DU7 A;  4DUT A;  2I38 A;  4U7U K;  4ZLL A;  1KHV A;  1PAE X;  2DGO A;  2V94 A;  1Q95 G;  1GNK A;  3IR5 B;  3MHY A;  4K5R A;  4RJV A;  2QIF A;  5FII A;  3VR1 A;  1V5V A;  3MR2 A;  3VZH A;  4DL3 A;  1OY6 A;  1W7W A;  3PRD A;  1VQ6 S;  2EXU A;  3KLF A;  1S1T B;  3WX8 A;  5LMU J;  4LFB F;  1VCT A;  2ZC3 A;  5EX3 A;  4JV0 A;  1RLD A;  1FJE B;  4QWA A;  3JTN A;  4CH0 S;  4F2R A;  5KOW A;  1AXQ A;  1AZS B;  2VV5 A;  2E9Z A;  4OHX A;  4OZL A;  1LW0 A;  1Y5L B;  2OEK A;  1HWK A;  3MUV P;  1TUW A;  4FBU A;  1TKT B;  1ZM3 A;  5J1E B;  2A6O A;  1SJ3 P;  3IR7 B;  1RT3 A;  5E3A A;  4ECW A;  5BR8 F;  1VIX A;  3FBC A;  4G3I A;  3PW2 A;  4W92 B;  2QFI A;  3DRP B;  3MPV A;  4B9M A;  3TAQ A;  1RCO B;  1ACM B;  2RT3 A;  2DNR A;  3PCO B;  5I3Q A;  1ZZF A;  1RTD B;  1JLF B;  1CJT B;  5IT4 A;  1HNW F;  1HL6 A;  4WZM A;  4FPI A;  5ETS A;  5EWF A;  4WP3 A;  5KG1 A;  2WTF A;  2CPX A;  3AOD A;  3IMQ J;  5KFM A;  3DLE B;  2UP1 A;  3O3L A;  2JLG A;  2C3P A;  4CNY A;  1B0V A;  5KT3 A;  2M3D A;  4P72 A;  1FD2 A;  2Q43 A;  5J2P A;  4LSZ B;  1RWM B;  1JMT A;  4CLW A;  2WSC C;  4O3N A;  2A10 A;  2VD3 A;  2W2P P;  2ZUA A;  2FHK A;  3KDN A;  1ZH5 A;  5EWE A;  2YXL A;  4WF9 Q;  4WYW A;  3EGN A;  5A2Q Y;  3MR3 A;  2FQQ B;  2IRX A;  2BOP A;  3DDK A;  3A8E A;  2QSW A;  3L9Z A;  3P45 B;  3JTO A;  4Y2I A;  3VVT A;  3JAM U;  2W9A A;  1SJ1 A;  3OXL A;  3S1T A;  3VGU A;  1TQL A;  1C1B A;  3M6X A;  4CH7 A;  1KSP A;  1C0T B;  3TR5 A;  4OX9 J;  3BQ1 A;  3KDO A;  2R8J A;  3CB4 A;  1R8A A;  2WRM A;  5E3Q A;  1X9S A;  2HK2 A;  1YHQ S;  5EDW A;  1WOS A;  4DL4 A;  4IFV A;  1XWL A;  4M5D A;  2QL9 B;  1U8W A;  4B3S J;  1C1C B;  3DYA A;  3RZA A;  4A8S A;  2HQF A;  2RRA A;  1PJ6 A;  1NHV A;  3HPO A;  1CJT A;  2XO6 A;  1A9N B;  3NNA A;  1Q8B A;  1NKC A;  3D0I E;  3OVS A;  1Q0N A;  3MMC A;  1YI2 S;  1FA0 A;  1RWU A;  4DPO A;  2Z30 B;  3GV5 B;  4JV5 J;  4ZPB A;  1EP4 B;  2JVO A;  1U7L A;  4HKQ A;  3QJP A;  3DXB A;  1GTH A;  5IT9 U;  4ZOS A;  2IA0 A;  1NDK A;  2YQ3 A;  4I56 A;  2BJ1 A;  3HHL D;  5CD4 A;  1DTQ A;  4CZC A;  4WFB Q;  1VR6 A;  1SIW B;  2CG4 A;  3UPF A;  4DFK A;  3NCP A;  1Q4R A;  3HHD A;  1N5Q A;  2BZ2 A;  3MEE B;  2EC0 A;  2EWH A;  2U1A A;  3M8Q B;  1CVJ A;  3O8W A;  2ATL A;  2UVW A;  4LIW A;  2H9Z A;  1TFW A;  3ZTO A;  1RB0 A;  1NND A;  4DLE A;  4UQG A;  2KL8 A;  3KLV A;  2CQB A;  1DJ0 A;  4PKD B;  2AGO A;  3LGM A;  1Q5V A;  2HFS A;  2XYG B;  4IH7 A;  5ETK A;  2KG1 A;  2KZM A;  2KVI A;  2V63 A;  2B5J B;  4FYW B;  3HD2 A;  3MMJ A;  2G13 A;  1WSV A;  3NL0 A;  2LXI A;  4P73 A;  2C2N A;  3GSD A;  1OY8 A;  4GO7 X;  3AFG A;  5D0R A;  2AX0 A;  2J7K A;  1AUS L;  1U24 A;  1RU1 A;  1WEX A;  2BKP A;  2BMB A;  2R8H A;  5DG7 A;  5HJY A;  5HP1 A;  3UVJ A;  2CQ1 A;  4NA1 A;  3M32 A;  2WVC A;  3DOM B;  4I2P B;  4ZN1 A;  3DC2 A;  4MIA A;  4H4O A;  4NE9 C;  4EYH B;  1IBM J;  3CDU A;  4J90 A;  3B82 A;  1Q7Y T;  2Y9H A;  5DG8 A;  1TK0 A;  3QNW B;  3FQK A;  3IAM 9;  3GJQ B;  1K0T A;  4B02 A;  2ZZN A;  2VIC A;  2GC8 A;  1QY7 A;  2DEJ A;  1YJV A;  4ES2 A;  1T05 B;  1Q8K A;  4LIR A;  4CLU A;  3KK3 B;  2UUB F;  2CZ4 A;  1YVF A;  4KGX B;  3MUM P;  1Y5N B;  3NS7 B;  2W01 A;  2HUR A;  3H0P A;  2QA2 A;  1S5Z A;  3DN9 A;  2DB1 A;  3X1L B;  3PM9 A;  4NLW A;  4JI2 F;  4EGL A;  3LP2 B;  4F0H A;  3PEJ A;  3GV8 B;  2VBX A;  2Z2L A;  5K8N A;  1P9Q C;  1YTY A;  1HNZ J;  4RL1 A;  2QG9 B;  3TUJ C;  4ZCL A;  3WHI A;  7AT1 B;  2M2B A;  3D28 A;  4DUZ J;  3IM8 A;  5T14 A;  3MR7 A;  3W5Z A;  1UJ5 A;  1MN7 A;  1S6O A;  3TX8 A;  1NRK A;  3RAQ A;  3G4S S;  3TP2 A;  4EK2 A;  2FLN A;  2HW3 A;  3FZB A;  4NXM J;  3CDE A;  2JC0 A;  1H98 A;  3LTO A;  2XSJ B;  3ZC4 A;  4WWS A;  1U1K A;  2FGO A;  4AFF A;  4TQS A;  4DR5 F;  2MKH A;  4LRF A;  4PXE A;  4C97 A;  1HWI A;  2DGW A;  3MWB A;  1RHJ B;  2WW4 A;  4CM0 A;  1R6V A;  4DV4 F;  4MK9 A;  3KYL A;  4ECS A;  2X3G A;  1VI7 A;  3MAA B;  2HFZ A;  4N76 A;  4B3M F;  2AJF E;  4CM2 A;  4FYX B;  4USI A;  4W4M A;  1YRX A;  1VQ9 S;  1M1G A;  1X4E A;  2WVE A;  4KH0 B;  2HBR B;  1VIS A;  2MMY A;  4WK3 A;  2GS8 A;  3S8S A;  4RNM A;  1VDH A;  3BPD A;  5D4O A;  1S7I A;  2ZH8 A;  1H6K X;  2BW2 A;  3I0S A;  1RBA A;  4K4Y A;  3PIP Q;  2YWW A;  4WE1 B;  3RBZ A;  1T02 A;  3GFH A;  2BJ8 A;  4DS4 A;  1VBZ A;  2KVQ E;  2QV6 A;  2WOM B;  2XCP A;  2XY5 A;  4C2M A;  1VBY A;  2QMW A;  3IGV A;  4I6A A;  2JHE A;  4TNO A;  4ZVU B;  1X5S A;  1YBT A;  2H65 B;  1ICE B;  4JI7 F;  2CPH A;  1HNX J;  3BH7 B;  1FJG J;  2JL9 A;  4DI6 A;  1H2T Z;  3GYX B;  4G1Q A;  1RTJ A;  5DQH A;  2ZH7 A;  1TKZ B;  1JLA B;  2RML A;  3W60 A;  2CPI A;  3AXK A;  1VQK S;  2MKC A;  1J5E F;  2BX6 A;  4KE5 A;  1S99 A;  2DHA A;  4P9S A;  4LFB J;  1CBK A;  2ZE2 A;  4CLP A;  4RPF A;  2DGQ A;  2V2Z A;  3HM9 A;  3DOL B;  1AFI A;  2C2K B;  4FPR A;  2VA2 A;  2AKW B;  4X4O A;  3D6F B;  2BW7 A;  3FMW A;  3M2U B;  1KKH A;  2RIJ A;  3K5P A;  4TYA A;  5HAN A;  3Q8R B;  3PX4 A;  2LQJ A;  1XNR J;  3SMZ A;  1NBE B;  5GAD I;  3D6M B;  2HSE B;  1UW9 A;  3L7U A;  1UVI A;  4ED5 A;  2HNY A;  2OTL S;  3H59 A;  2FHM A;  3CD7 A;  1VQN S;  1YX2 A;  3GMG A;  1FEE A;  2YNF B;  3MMB A;  2D1C A;  2LEP A;  5ETP A;  2FY8 A;  2VQF F;  2ADC A;  3W1Y C;  4GKJ J;  5BYR A;  4DX7 A;  3M4X A;  2H5I B;  2XNR A;  2HZC A;  2NS1 B;  5A2Q U;  3BQ2 A;  2VA3 A;  2XZW A;  1F9E B;  1V9O A;  4DEZ A;  3NGU A;  1LEO A;  2XS5 A;  2AWZ A;  2H5J B;  2YNI B;  2LU2 A;  3FK4 A;  1MSW D;  2HHH F;  5A8W B;  2ZZM A;  1CC8 A;  1URR A;  4MTP A;  5A0Y A;  1QUP A;  3GON A;  4X2B A;  4KGV B;  2VPZ B;  3CDA A;  4NYP A;  2ZJQ Q;  3CCQ S;  3CJ0 A;  3ELH A;  3T6J A;  1QSY A;  4IO1 A;  1P1T A;  3RR8 A;  3ZTR A;  2LDY A;  1I94 F;  1KON A;  2GJF A;  4NCG B;  1ZAV A;  5JVG Q;  4GO5 X;  1Z1Z A;  2DNH A;  2IMO A;  4NLR A;  3NP5 A;  5IM0 B;  4F4W A;  2YVS A;  2ADB A;  2X7I A;  1HKA A;  4QPT A;  2KHC A;  2RHS B;  3I9V 9;  1G6B A;  4Q0B A;  1JKH A;  5DZ6 A;  2FJE B;  5T7L A;  4JI3 F;  1ZPV A;  1CJU A;  1NU4 A;  1HR0 F;  2QYC A;  3CTR A;  1OPI A;  2DR7 A;  2OPP B;  2UUB J;  3R5G A;  3OPK A;  3ZZT A;  3B4D A;  4TYB A;  1RAJ A;  1FDD A;  4O44 A;  2WB1 D;  2GIR A;  6FD1 A;  4LJM A;  2MKI A;  5F8L A;  3KK2 A;  4H4K A;  2Y0S D;  3QT8 A;  5HBM B;  1D8Y A;  4LF7 F;  4OI0 A;  4FF1 A;  2B43 A;  4XDC A;  2BAB A;  3C15 B;  3IA0 A;  2AGQ A;  3CT9 A;  2NZ4 A;  1TMM A;  1SQG A;  4M1K A;  2XQC A;  3G6E S;  1QVF R;  2G4B A;  2OFG X;  3I55 S;  2PE8 A;  3FNN A;  1X4G A;  2HND A;  2KT2 A;  4U8V A;  3OHA A;  2R9L A;  1SL2 A;  1VLO A;  2WVF A;  5D4P A;  1UET A;  3DMJ B;  3CCM S;  3QRP A;  2ZH1 A;  2FLO A;  2UUW A;  3W9I A;  1IWG A;  1WNE A;  1RT1 A;  5E33 A;  2B8Q A;  5IT0 A;  3OL7 A;  3PW0 A;  5F3Z A;  4LBH A;  3QJJ A;  4DV6 F;  4WFA Q;  3DM2 A;  2KI2 A;  4DQI A;  1RT4 B;  3MPW A;  3UDL A;  4DMZ A;  3QFH A;  2HYI B;  5AE1 A;  3PYE A;  4EMD A;  2ZM6 J;  2BEF A;  4ZDN A;  1QAY A;  4PCQ A;  5K9F A;  2FJA B;  2KFN A;  1S1W A;  4KPY A;  3N01 A;  5K14 A;  2RUS A;  2A0F B;  4I69 A;  2JLE A;  3H8Y A;  2HBZ B;  4FF3 A;  1KVJ A;  3UDV A;  4R25 A;  5LSO A;  1MW7 A;  1SCJ B;  2DD8 S;  4ZPD A;  1Q79 A;  2DH7 A;  2EFO A;  5IM0 A;  1UW4 A;  2G0J A;  2VJU A;  2I2Y A;  5DDO C;  2F5G A;  1Q81 T;  2E5G A;  4Q2M A;  4YB6 A;  3M8P A;  1D0E A;  2VON A;  4M5M A;  1Y00 A;  2NLW A;  4NML A;  4FZV A;  3KUH A;  4KGZ B;  1Q1K A;  4ICL B;  3ISN C;  2CJX B;  2LCW A;  1S6Q A;  1TL3 B;  4AXI A;  4CNZ A;  3I31 A;  1ZOT A;  4YN3 B;  5L9X A;  2ACY A;  4E98 A;  3KLG B;  3LOU A;  4NLS A;  3MEC A;  3E3X A;  3R1L A;  2DGU A;  3LP1 A;  4PXD A;  3FMB A;  5F8H A;  1T0T V;  2OP5 A;  1WC1 A;  4JUZ A;  2ZH2 A;  3HSZ A;  1TR0 A;  3PJX A;  1UFW A;  1WF2 A;  5F41 A;  2Q1L A;  5KG3 A;  3JQK A;  4M5L A;  5LXY A;  1ZS6 A;  3MFH A;  2DRB A;  1KNZ A;  1BWV A;  1RQ0 A;  3HFV A;  4NEZ A;  1B0T A;  1PC4 A;  5DJB A;  3SV4 A;  2GVZ A;  5KT2 A;  1WD6 A;  3FKB A;  2V8H A;  1R8C A;  1RCX B;  3Q8V A;  1ELO A;  1HA1 A;  4LR8 A;  4J9O A;  1O5J A;  2OMO A;  4RUH A;  5KFN A;  2BJ9 A;  4IR9 A;  4QW9 A;  1IJE B;  2PT0 A;  4ES3 A;  1FXL A;  4ED7 A;  1Q82 T;  3P6Y C;  2GMH A;  2HBQ B;  3DHX A;  5J1P A;  2RS2 A;  3DDI A;  2EG1 A;  2YNH A;  3VHQ A;  5I4M A;  4LBI A;  4A8Y A;  1FDB A;  1BC6 A;  2V68 A;  1F5C A;  2VUG A;  2NXJ A;  2VFR A;  4M5K A;  4RX6 A;  2MQP A;  3PW5 A;  3G6Y A;  1RHR B;  4RW9 B;  1X5P A;  2K3I A;  2QN6 B;  2XSF A;  3DOK A;  1FTC A;  3CJ2 A;  5DZ7 A;  1XC9 A;  2D69 A;  2HMI A;  3KMQ A;  4B3M J;  2CXE A;  1RAD B;  5KT7 A;  2OPP A;  1JQG A;  1EAY C;  1WDD A;  4LRD A;  4KAI A;  2CDR B;  4P2X A;  2APO A;  4QOT A;  2NUU G;  1UP1 A;  2YWF A;  7FD1 A;  1MNE A;  3JSM A;  1NJI T;  4Q45 A;  1IKW A;  1T3N A;  3OL6 A;  2W9C A;  3R6G B;  3ULH A;  4C8Z A;  2KJV A;  3EPI A;  2ZBI A;  4DR3 F;  1LWC B;  4Y65 A;  2R4F A;  4ZP6 A;  5L8R C;  4HTI A;  5JXS A;  1OYE A;  2COL A;  2VG5 A;  5HMZ A;  3HXM A;  4KJI A;  2DR8 A;  1FFS B;  1S0O A;  3HFZ B;  5B0B A;  4J9S A;  2YQ0 A;  6AT1 B;  4DV7 F;  4ZPW R;  1IM4 A;  5HQ8 A;  2X1A A;  1VQ4 S;  3QZ8 A;  2B5J A;  4DPX A;  3PHT A;  5KFI A;  4KIA A;  4WII A;  3M7V A;  2N4C A;  2P9C A;  2VDI A;  4Z7Y A;  3MMA A;  1SJQ A;  3ETM A;  1QAI A;  3K17 A;  1NME B;  2IM2 A;  1V3Z A;  4MT1 A;  1VHI A;  2GGP B;  3OTC A;  4RW7 A;  1IBL J;  4DSK A;  4YFU A;  4QWE A;  2DGS A;  3C66 A;  3ZXW A;  2OJ3 A;  1RT2 A;  3I32 A;  3J81 U;  2HQD A;  4LF6 F;  3J7Y U;  1NH8 A;  2WK4 A;  1XN9 A;  3CJT A;  3DOK B;  3A4T A;  3ITH A;  4AYB D;  2M0G B;  4DX8 H;  3Q8S B;  1R0A B;  3OXF A;  2GO9 A;  2JZ5 A;  2P6T A;  3DDN A;  3LP0 A;  3B54 A;  1JLC A;  3NCR A;  2M5Y A;  1E6Y B;  1JLE A;  4NLO A;  2CQC A;  4E2F B;  3G82 A;  2HZV A;  2R7Q A;  1HMV A;  1RIS A;  2BYC A;  2G2O A;  4LRB A;  2IIH A;  1TP7 A;  4RW9 A;  4X4T A;  1RKI A;  3BBC A;  4OZ3 A;  5G0R B;  5B0A A;  1S1X B;  1JK9 B;  3J81 Y;  1WOR A;  2C2R A;  1N5V A;  3D3B J;  1FRH A;  2FJV A;  4ZVG A;  3PX6 A;  3KLE A;  3D2W A;  1F5B A;  5D6G A;  1JNZ B;  4A8W A;  2NSB A;  2NYI A;  4I4B A;  4F67 A;  2BKN A;  4O0N A;  2CNL B;  1P1L A;  1WC0 A;  4CO3 A;  4H54 A;  4USH A;  4U95 A;  5D8H B;  3ENA A;  4KGK A;  5E41 A;  2HHW A;  5JUM A;  2JNJ A;  1XMO F;  1FWK A;  1FK9 A;  5M2U A;  5ETL A;  1D8Z A;  1LFP A;  3EIC A;  4B3R F;  2RU9 A;  2M8H A;  4Z37 A;  2EVZ A;  3LO3 A;  4ZJL A;  4DR5 J;  3G8S A;  4Q8F A;  4LSL A;  3DGP B;  4DN9 A;  4J9M A;  3DLG B;  4IR1 A;  4UOF A;  4OHV A;  1ITP A;  1GEH A;  2MKK A;  1U6B A;  3I5A A;  3AA9 A;  2YH1 A;  2VOO A;  3H4D A;  2LMI A;  5ETT A;  3X3U A;  2BQU A;  4DUZ F;  2IBK A;  4LF7 J;  1BQX A;  1VC5 A;  4USM A;  1KHW A;  4YDD B;  1JNR B;  4B3T F;  5A8K A;  4WU2 A;  4OYA A;  1N36 F;  1QD1 A;  2KXN B;  2F8M A;  2OSR A;  3BR8 A;  2KDO A;  3N4W A;  1YIJ S;  3KFW X;  3MED A;  1F2G A;  2PSZ A;  2XHW A;  1SJ4 P;  4H4K C;  1B4S A;  2V8G A;  4OHZ A;  1I6J A;  4KC5 A;  4X4Q A;  1N36 J;  2IMW P;  4B9N A;  3MM5 A;  1G4C A;  1PSD A;  2O66 A;  4N56 A;  3HVR A;  4DR1 F;  1UA1 A;  4B9S A;  3NBP B;  1RTD A;  2ZJP Q;  4H4M B;  3VAH A;  5F9L A;  3IBW A;  1VC6 A;  3ZTS A;  3C6U A;  5C24 A;  1I94 J;  3BV8 A;  1TUG B;  1MMD A;  3M8Y A;  3VVU A;  1FO1 A;  3KNA A;  4AUK A;  2DHS A;  2WSF C;  3PG9 A;  4AQY J;  3CD6 S;  3B6B A;  3ET6 A;  2LFV A;  4AL5 A;  4U67 Q;  3MOJ B;  2OHD A;  5B0F A;  2RU3 A;  2PII A;  3MM7 B;  3P5B P;  3NS6 A;  4CIO A;  2RDD A;  1PKU A;  2M70 A;  3PZP A;  4I6Y A;  3FCH A;  1NSQ A;  2LEA A;  2GVZ B;  1ZTT A;  2E5L J;  1S77 D;  1IR2 A;  2CAD A;  2RJZ A;  3A8I A;  1IKX B;  3W64 A;  4F4K A;  4ID8 A;  4QJV A;  2VQE F;  3CME S;  3FSX A;  2HFV A;  1LW0 B;  4MMO A;  4YME A;  1HYS B;  2JSX A;  2JRS A;  3I0R B;  4CLZ A;  4C4W A;  2YPZ A;  2VBZ A;  1RXO B;  1T95 A;  1WEZ A;  3PFE A;  1JWW A;  2ZEJ A;  1PYT A;  3T9Z A;  1DLO A;  3DU5 A;  4PQA A;  5CQG A;  4ZPV R;  4OX7 A;  5GMK a;  1J27 A;  4AL7 A;  2BJD A;  3C6T A;  4E8U A;  4CLS A;  1DHM A;  2MST A;  5A8K B;  2YWG A;  3MM5 B;  4ITS A;  3SFU A;  2VPW B;  3DOL A;  2AP6 A;  3HSJ A;  4D3G A;  1K0V A;  3N6L A;  1RJJ A;  5KFF A;  2RQM A;  3A13 A;  3SZ2 A;  1HQ2 A;  5B0D A;  3ZZY A;  3PNI A;  5E3P A;  3EYZ A;  5D3G B;  3W65 A;  4LF5 J;  4ZIT A;  2KYZ A;  2AT1 B;  2M7S A;  3V81 A;  2Q6B A;  4DPT A;  2I0X A;  2XMA A;  4ZK7 M;  3GG0 A;  2IJF A;  4X4P A;  2MKJ A;  3MR5 A;  2B9E A;  3EGV A;  5LMU F;  3KUE A;  2HHT A;  2JX2 A;  3ONQ A;  5E0O A;  3NKY A;  3Q8Y A;  5H1S V;  3B8H A;  5IOL A;  1WAC A;  3TVK A;  3J80 Y;  2CIM A;  3CED A;  3HKW A;  4P2F A;  1UVM A;  4B3O B;  4F04 B;  4YP3 A;  2Z8Q A;  3HVW A;  5AXK A;  3UCZ P;  4YR2 A;  1UPP A;  8AT1 B;  4DR3 J;  4C0O C;  3QWU A;  4B08 A;  1WC5 A;  2YNF A;  2ZOF A;  1FXR A;  3MMB B;  4HI1 A;  3MXH P;  3Q8P B;  2J8S A;  4O4G A;  5D0E A;  2H1Y A;  2LQ8 A;  1AZS A;  1UEK A;  2QL7 B;  3QT5 A;  4RO0 A;  4QR0 A;  1JLG A;  3KJF B;  5F8M A;  3J80 U;  4IFV B;  4IG0 B;  2BRL A;  3GCW P;  4NAS A;  3HHN B;  1RAB B;  3U1N A;  4GC7 A;  3EZO A;  3UE2 A;  1UCN A;  5J1E A;  3HCX A;  4DR2 F;  2AYB A;  3TI0 A;  2LQ9 A;  4IG3 B;  3HLU A;  5K8M A;  1NJX A;  3JAM Y;  2X1G A;  1LK5 A;  3FCW A;  3LPE A;  2YNG B;  3S01 A;  2RVJ A;  4M95 A;  2MY8 A;  4M5D B;  4Y2M A;  1HD0 A;  3MPU B;  1M5K C;  3L95 X;  2NR0 A;  3V4I B;  4NXM F;  2XMT A;  1YJN S;  1TEL A;  1ZM2 A;  3K57 A;  5B0C A;  2J0X A;  2W8K A;  1NJZ A;  1YJT A;  3LGH A;  3VF0 B;  2GHP A;  2CKW A;  4Y34 A;  4OI3 A;  4NYZ A;  4HVZ A;  1RT7 A;  1FKO B;  2KN4 A;  5KFP A;  4M94 A;  3FSI A;  1H72 C;  2CJA A;  3Q83 A;  3U1M A;  3V2U C;  3DMJ A;  1DFD A;  3JXO A;  3UD5 A;  4X66 F;  3PYD A;  2KU7 A;  4BCA A;  1R3N A;  2CPE A;  3MM8 B;  2A18 A;  3FEX B;  3QYY A;  3HX9 A;  3NAI A;  2EFG A;  2DNP A;  1B3T A;  2ATC B;  5J1N A;  5J2M A;  1NK8 A;  2KRB A;  1X31 C;  2QA4 G;  3Q24 A;  1WHY A;  4A8Q A;  1SVD A;  2XMU A;  3CCZ A;  4TVA B;  2ZBQ A;  2ZVS A;  1KLM B;  4Z2X A;  4J9Q A;  2E1R A;  2DNY A;  8ATC B;  2EG2 A;  3HI9 A;  2VHG A;  4OI6 A;  2W7P A;  1PGZ A;  4JV1 A;  2GAG C;  3PW7 A;  4PUO B;  3HVT B;  3RAX A;  3C14 A;  3WC0 A;  2FVQ A;  4QIW D;  4PWD A;  3UQS A;  1WTF A;  2PA8 D;  4WXW A;  3AY0 A;  4JI5 J;  2AEM A;  2VQE J;  4MH8 A;  5HMY A;  1F9F A;  1EJ7 L;  2Z2M A;  4K0K J;  1U49 A;  1NJW A;  3EZU A;  1NH7 A;  4OYP A; 
#chains in the Genus database with same CATH homology
 1BHN A;  3MPD A;  3ZTP A;  2NCK L;  3VGS A;  1NDC A;  4FKX A;  4F4A A;  1EHW A;  1XQI A;  3ELH A;  4DZ6 A;  1NDL A;  3ZTR A;  3EMT A;  3FC9 A;  3PJ9 A;  3NGR A;  3Q8U A;  4DUT A;  1PAE X;  3DKD A;  2HVE A;  3EM1 A;  1W7W A;  3NGT A;  1B99 A;  1S57 A;  3WX8 A;  2HVD A;  3EVW A;  1F3F A;  3ETM A;  3EVM A;  2HUR A;  3PRV A;  1S5Z A;  3FCV A;  4W98 A;  4CP5 A;  4FKY A;  3FBE A;  3Q8Y A;  1NDP A;  5IOL A;  1NUE A;  3EJM A;  3FBC A;  1WKL A;  3B54 A;  1MN7 A;  1NB2 A;  3BH6 B;  1HIY A;  4EK2 A;  4KPC A;  4F36 A;  3Q86 A;  4S0M A;  1WKK A;  3BBC A;  1LEO A;  4UOH A;  1HLW A;  3FBB A;  4WBF A;  1MN9 A;  1KDN A;  3BBB A;  4UOG A;  2B8Q A;  1UCN A;  4O0N A;  3ENA A;  3R9L A;  1S59 A;  2DXD A;  3FCW A;  2ZUA A;  2BEF A;  3EIC A;  3G2X A;  1F6T A;  3NGS A;  2AZ3 A;  4UOF A;  1BUX A;  1NLK L;  3FBF A;  3VGT A;  3VVT A;  3VGU A;  3VGV A;  1K44 A;  4HR2 A;  1NCL A;  5CAB A;  5CAA A;  4ANC A;  2CWK A;  3Q83 A;  3BH7 B;  4DI6 A;  1U8W A;  1NPK A;  2DY9 A;  1VYA A;  1JXV A;  2BX6 A;  1ZS6 A;  1B4S A;  2DXF A;  3GP9 A;  1XIQ A;  5C7P A;  3FKB A;  2B8P A;  3GPA A;  1BE4 A;  1NDK A;  3Q8V A;  3ZTS A;  4ANE A;  3VVU A;  3L7U A;  2AZ1 A;  3DDI A;  3B6B A;  3ZTQ A;  1WKJ A;  3BBF A;  3EE3 A;  1LWX A;  3JS9 A;  1NSK L;  1PKU A;  3ZTO A;  4ENO A;  2DYA A;  3EVO A;  3Q89 A;  1NSQ A;  4AND A;  5BXI A;  1NHK L;  4C6A A;  1HHQ A;  1NSP A;  2VU5 A;  3NGU A;  2DXE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...