1JXVA

Crystal structure of human nucleoside diphosphate kinase a
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
149
structure length
149
Chain Sequence
b'CERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside Diphosphate Kinase A
publication title Crystal structure of human nucleoside diphosphate kinase A, a metastasis suppressor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 42
structure length 149
sequence length 149
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2001-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1jxvA00
3EJMA 1HIYA 1U8WA 1XIQA 2B8PA 3FBEA 1MN7A 4UOHA 1PKUA 2DXEA 3FCVA 3NGRA 3ZTQA 1XQIA 1LEOA 1NDPA 2AZ3A 2HURA 4UOFA 2DYAA 4CP5A 2AZ1A 4F4AA 3BH6B 3Q86A 1UCNA 3NGTA 2DY9A 4ENOA 1NLKL 2BX6A 3VVUA 1NDKA 3Q83A 3GPAA 1NHKL 2NCKL 1F6TA 1NUEA 1NPKA 3JS9A 1NSKL 1S57A 1WKJA 1NDLA 2DXFA 3GP9A 5IOLA 3FC9A 1NB2A 1BUXA 3BBCA 4F36A 3DKDA 3Q89A 1B99A 3NGSA 3EE3A 1HHQA 3NGUA 3ZTSA 3FBCA 3FCWA 1WKLA 3VGSA 1BHNA 4ANDA 3ELHA 2VU5A 3VGUA 3PJ9A 1S5ZA 3WX8A 1S59A 1NSPA 2HVDA 3EVWA 1MN9A 4FKYA 4DI6A 3ZTOA 1HLWA 4KPCA 3Q8YA 3EVOA 1ZS6A 3ETMA 1W7WA 4ANEA 1K44A 2HVEA 5CAAA 3B54A 3VGVA 4FKXA 3EICA 1WKKA 2B8QA 3Q8VA 3B6BA 3BBFA 1BE4A 4UOGA 2DXDA 3EVMA 3ENAA 3R9LA 3MPDA 3EMTA 1NCLA 3ZTPA 2BEFA 2CWKA 3L7UA 4S0MA 3BBBA 4W98A 1B4SA 3Q8UA 3ZTRA 3VGTA 3VVTA 3BH7B 1NSQA 3PRVA 3EM1A 1VYAA 3FBBA 1NDCA 4DZ6A 4DUTA 4WBFA 1F3FA 1PAEX 5CABA 4HR2A 5BXIA 3DDIA 1LWXA 1KDNA 4O0NA 4C6AA 3G2XA 2ZUAA 1EHWA 3FKBA 4ANCA 4EK2A 5C7PA 1JXVA 3FBFA
chains in the Genus database with same CATH superfamily
3PRBA 5LMNJ 3MD3A 4NI2B 4FF2A 2KZZA 2F7VA 1LNQA 4ERDA 2CJQA 1UEUA 2P5VA 1HHTP 4DCJB 3PIOQ 5HVFA 3A8JA 1NK7A 2IRYA 2MZJA 3AD8C 4F3QA 3PDNA 3MPVA 3PW7A 2IFXA 3OT9A 1XNQJ 1WI8A 1UWAA 1FRKA 4NA3A 2UP1A 2XYGB 1NKBA 2FHJA 4V19X 4NLSA 2AD9A 5A2QU 3DLLQ 1C0TB 3EVWA 4ED6A 1FCAA 2R7XA 2AKWB 2JEJA 4P71A 3T1AA 3RRKA 1YDLA 2L9NA 3UDCA 1FTCA 3T19A 7FDRA 3DLGB 1RE1B 4DQSA 4OZNA 2QLFB 2G0JA 5F8LA 2WRMA 2B6AB 3SCLE 5AXKA 4O3SA 2WW8A 3PRVA 3EM1A 4RJVA 3FBBA 4NLRA 4C3KA 3QAEA 3D5MA 5B0DA 1V5IB 3FBFA 3AODA 4USVA 1RDRA 4NPOA 4I6WA 3FRZA 1SL0A 3BGUA 3CULA 2XSJA 2Y0BB 1FX4A 1FI4A 2PMZD 2QIFA 4C0OC 3DGPA 2BQUA 1RAAB 1U4BA 2ASDA 1H3DA 4I67A 5KFPA 4KKOA 1RACB 2YKMB 1JQGA 1MW7A 2HW3A 2VBZA 3QWPA 4QR0A 4DF4A 3CC7S 4ILRA 4WJBA 4LFAF 3BSOA 1X4DA 1FRXA 4NZ6A 1X0FA 2HFOA 1RAIB 3K8WA 4Y2IA 1RWMB 2B4UA 4WIQA 3D6MB 4PABA 2V8VA 1MMDA 3U1NA 3M6UA 5HMXA 3ILOA 4LT6A 4ED5A 3MEEA 3K58A 4JI3J 1CVJA 4JYAJ 3MM6A 3GV8B 1FVSA 4LSLB 5HP1A 4LQ9A 4NLWA 4L76A 2H5EA 3J81Y 1P9YA 4J9LA 4ZLNA 2F9JA 4C8LA 4DR5J 4CH7A 2RHQB 1NZAA 1UZDA 1N5SA 4RW6A 3MTJA 3D7SB 1VR6A 4MJKA 5HLFB 1U1NA 3BGLA 1Y00A 4F4AA 4NCBA 4WFZA 1V9OA 1NKCA 2NXUA 2ALYB 3PG9A 4HH0A 1KNZA 4KQZA 3C19A 4HHUA 3GV5B 2OSQA 3CVKA 4TY8B 3MM9B 5ETTA 5B0FA 4URGA 2CAJA 3GFHA 3SZ2A 3MM5A 4A48A 1N36F 1WHWA 3MM8B 2IRUA 4DR7F 1JNRB 3L7PA 5BYQA 5CYMB 3TNVA 2VPXB 2MKKA 5L1IA 4HACA 2V2VA 2DKOB 4MIBA 1X9MA 5C25B 3TX8A 1N48A 3A3NB 3PRDA 1RWPB 1DLOB 1WJ9A 2FJXA 1E6VA 2OH2A 1SQFA 3DDNA 4LFBJ 2YNFA 1KD1T 1K0VA 4OJHA 1VQNS 4IFVA 2CNNB 5K8OA 2IBKA 5HBMB 2ROGA 4JV1A 5A8WA 2V63A 5CD4A 3OHBA 1KKHA 3HVTA 3W2VB 2E7XA 2IM0A 1ZPVA 3THPA 2IJNA 3PZPA 2B43A 4O44A 3OXLA 1VQ7S 1W2IA 4X4RA 4DN0A 4KGVB 4Q8FA 1BQXA 4RW7A 1T9UA 4DV6F 1CS4B 1U1KA 1JJCB 2E1PA 3ZZOA 4JBCA 1HW9A 2CPZA 4C11A 1NK5A 2IAJA 2YH1A 4KT0C 3HHLD 1YJNS 2C22A 1HNVB 3SEOA 2RDIA 3FZ2A 2RDDA 1CC7A 5JVHQ 4NOHA 4GRSA 4OFZA 5T14A 3AY0A 3I5AA 4J37A 2VG5B 1LXNA 3Q2SC 3L7UA 3G6ES 2F63A 5L1JA 4M5JA 4MYTA 2VG7B 3M8WA 2BJDA 2CQHA 1S6UA 2BABA 1WEZA 5D0EA 3MCOA 3J7Z5 4QW9A 2B4OA 3I5CA 2VONA 1IKXA 2R42A 3NGKA 3OLBA 3THVA 2C2DA 4C8OA 3KJFB 2ZBQA 1FT8A 2HFSA 4PXDA 2E1AA 4NX9A 1FDAA 4M5MA 1PC5A 3HVRA 4X66F 4QIFA 2NYIA 2R2UA 8ATCB 1D0EA 2D69A 5KT4A 1RT5A 2KDOA 4XDCA 2RD5C 2PO4A 3THTA 5KT3A 2BM0A 1UJ5A 3I0RB 5IT0A 1NHVA 1K73T 2HHQA 2XG8A 2CJ9A 2PGCA 3D67A 1PJ5A 3RTVA 5DZ7A 3SCIE 3WX8A 2HS4A 3H2VE 2MQOA 1HNZJ 4KO0B 4R5PA 1VRQC 1JLGB 1KVJA 3ZZZA 4DL7A 4BC7A 1CG2A 5J2QB 1ZM2A 4HH1A 1DBDA 4NLXA 1VC5A 1Q78A 1FRJA 2O1PA 3G71S 2FJBB 2AGPA 2X1AA 2UUAF 5F8NA 2WVFA 2KHDA 4QW8A 2W2QP 1L5UA 2YQ3A 5K8NA 4CYUB 2MDAA 4NYPA 4J9VA 2NQPA 3AHPA 3MPWA 4FZVA 4A47A 3QFWA 3Q83A 1FJ7A 5D6GA 1HMVB 1WKJA 3BDEA 2OPSA 4DR7J 2HYIB 4LF4F 2FYXA 3OL6A 3T41A 4CLTA 4H4OB 4FF1A 1GMWA 4DPYA 2FZCB 1W7WA 2FJDB 2W4DA 2XYPB 3M8QA 5EWEA 1QAIA 1A9NB 3QWUA 3I31A 1JLBB 4C7QA 4NZ0A 1YQHA 3QBCA 2CNKB 4DQRA 2RF2B 2MPUA 4K8RA 3HSZA 2OD4A 2GIFA 1FXDA 3AFGA 1YJ9S 1HL6A 3IBWA 2KTQA 3BGRA 1ULRA 5B08A 1FE4A 5KFYA 1KHWA 2JNJA 2OPPB 2KU7A 1GAOA 1VLOA 1MN7A 1GFWB 2VG6B 1XR6A 3BKFA 2NZCA 1GMUA 3PHTA 2M70A 4ZCLA 3J80U 1JLCB 2DGSA 2CNOB 2GIQA 2BJ9A 2YX7A 3SDEA 5HI7A 5D4NA 3BEGB 5F8JA 4DPUA 5DRKA 1HYSA 4BWJA 1S6PA 2JEFA 3LUYA 2VIHA 3GCXP 2DGUA 2DCUB 2C28A 3DKDA 2XHCA 1SH2A 2GW8A 2E5GA 2YNHB 4L3KA 4DL3A 3DLKB 3H42A 3K5PA 3GG1A 1NSPA 2BANB 1I6JA 4I1TA 1RAGB 4FPIA 1BD6A 1VCTA 3R6GB 4LRFA 2DRBA 4OX6A 3H7HB 2MY7A 1NHUA 2NREA 3KG1A 2J7KA 4K5SA 2CNLB 1FK9B 1AT1B 1M1GA 5D0GA 1HW8A 2DIUA 3MCNA 1S6QB 2BR0A 2MZRA 1QUPA 3IGVA 3M2UA 4XDDA 1S12A 2H3EB 4J5OA 2XCPA 1WEXA 1NXIA 3B8HA 3DGVA 3KLVA 3QT5A 2QN6B 3DMJB 3FFIA 2Y8WA 1DTQA 3H4BA 4OZLA 4ENOA 4DV5F 3F41A 2B9XA 3JB9k 1D9FA 4K4ZA 4GVBB 4CLFA 2D1CA 1FJCA 1KVIA 2RDJA 1I5OB 1JLQA 2HSEB 4LVOP 1WG5A 4DQQA 3EGZA 2QZ8A 1W25A 1VQ9S 1ZETA 1VJQA 1X4CA 3HKZD 5KFKA 2HHXA 1X9WA 3X3UA 4A4JA 1ICEB 3JYTA 1U47A 3MFHA 5JMNA 4I0WA 3IR6B 1U24A 1D3WA 5BR8F 1RHMB 4ZDNA 4ZK7M 3BKUA 2UUAJ 4K2JA 2ZHAA 5E41A 4U67Q 4LUBA 1RGVA 3MPUB 1X8DA 3HT3A 3ISNC 7AT1B 1S72S 2ZBCA 1DQ9A 4LF8F 2K7JA 1OQ3A 3J7A1 1I51B 1RCXB 1SUQA 2WK4A 2YNIB 5E3CA 4QWEA 4MKYA 5B09A 4RNMA 2OP5A 5HO4A 3AA8A 1YG0A 2R7RA 5ETMA 2CG4A 2CDQA 1MROB 2X1BA 4USTA 4YB5A 2R9LA 4EZ6A 4A8KA 1P8GA 2JDJA 4HTJA 1VK8A 2I2YA 2HQ3A 4I2QB 1BQMA 3HX9A 4WP9A 3FEZA 2DO0A 3HSDA 2NSCA 2B5JB 3MOJB 4M5NA 1HQEB 5KFBA 4ED2A 3D54A 3QMQA 3CD5A 3RGIA 5KFDA 3NS7B 1RZMA 2EBEA 3R27A 4CO3A 4LFCF 1KLNA 4ZHRA 1RHQB 1Y5LB 2CQDA 3LP0A 1M5PC 2OUGA 1JMTA 2J6SA 4FKXA 4MYUA 2W9CA 2C42A 4IR9A 1T03A 4DUZF 4DSKA 1IJEB 3UDVA 1T05B 2HFVA 5K5MA 2XULA 4B3RF 1RWKB 5A2QY 4PQAA 4DR4F 3GJSB 3N01A 1PYTA 2E44A 4ECVA 1U26A 3B4DA 2DGWA 3HHKA 3T5KA 3HKWA 4JP8A 5A6WA 3V81A 3BQ1A 1NM2A 5AXMA 2OEMA 3RUBL 4LBPA 2QLXA 2V8DA 2Z0GA 2W9BB 1LK7A 1IBLJ 3Q89A 4F0HA 1VRUA 2FPHX 3SQGB 1WKLA 3GJRB 2VFUA 4CLWA 1EP4B 2DNOA 4Y34A 4ZMMA 3KLHA 4LR9A 5KFLA 1S7IA 1MMNA 2FHJD 2YY3A 4CO5A 5GAHI 5U47A 2G9OA 2DNYA 3DRSB 3PO4A 2OHDA 3DM2B 1H74A 4AL7A 2AT1B 5F8IA 3RB6A 2W2OP 1MSWD 4ALZA 4CLPA 1FXLA 1CJUB 2ZUAA 3CDAA 4X4NA 4DX8H 1VGYA 1BMQB 4OYMA 1TK0A 2W9AA 3NCPA 2OI2A 1WORA 2C2KB 3CMAS 4QQBA 3SMZA 3C3LA 2GHVC 3A8IA 1S0MA 4DL0C 1IBMF 2HHSA 2YWWA 4M5IA 1XWLA 3C16A 3G96A 1S9FA 3LP1A 2IIHA 3C14B 3JAMU 2IC3B 5FIIA 4UOCA 2HMIA 1JJ4A 3A1YG 2ZE2B 5BR8J 1KSPA 2ZH3A 3KLFB 2IVFB 3ADAC 4FYVB 3FZBA 2M7SA 1HI0P 2AYBA 4ETZA 5GMKa 1ZZNA 3ENQA 4BDPA 1HD0A 2MLXA 5A8KB 3BZQA 1JLFA 2CVEA 1XR7A 4LF8J 5IWAF 1HNWF 3L4BC 2XMMA 2VICA 5ETKA 4QR1A 2MY8A 4URQU 3G82B 1TL7B 2UVUA 4ER8A 4ED8A 4OYXA 2W8LA 1V3SA 1BGXT 4KY3A 1JKHA 2K1RB 4PG7A 3GFZA 2CJAA 3GR1A 2X1GA 3R5AA 4UTGA 3ZXWA 3E3XA 1CC8A 1VIOA 5IT4A 3KOAA 2P8IA 1QLNA 1N4LA 2V2QA 3GR0A 2B8PA 4F4WA 1YLXA 2DNLA 2DR9A 4PKDB 1NJIT 3PYGA 5KG5A 2AZ3A 2JX2A 3OTDA 3T9NA 3VVUA 1VDHA 4DL6A 3P6YC 4X65J 3AD9C 4LFCJ 2LP4A 5KFWA 3HFKA 4FDFA 2X7IA 2YKPA 2FUG9 2OAUA 1YTYA 2VPWB 1U1RA 4N56A 4RLEA 2WOMA 4EYHB 1YJ7A 5KT6A 3LGNA 2ZZMA 3HHLC 2E5IA 4KGKA 2PD1A 1RTZA 2V34A 2RJZA 2IA6A 2LQJA 4DFKA 2GFFA 3QGIA 4B3RJ 3QGGA 1WTBA 4DR4J 3TJ8A 4WP8A 2MZTA 4KGZB 3GQCA 1R0AB 3TAQA 2IYGA 1JLAB 2XMUA 2LMIA 2Y8YA 4FS1A 3WQPA 1WD6A 1X4HA 4Q44A 3D6FB 1CJVB 4UQGA 1FJGJ 4YB7A 1VRTA 5KFVA 3CD7A 1LEOA 4DFJA 4AQYF 1B0VA 1Y10A 5KFAA 1VOMA 4C48A 2HVIA 4WE1B 4KIAA 4OZ0A 3TRGA 2KHCA 3GE9A 1BQNB 4MH8A 4DFPA 3NGUA 1P6TA 4TY9A 2C2RA 2AX0A 2HWHA 2DGXA 3B82A 4RWWA 1S59A 3MCSA 3OUYA 4DF8A 5ETQA 2KKHA 5THWA 1W2BR 2G0IA 5RUBA 4TU7A 4LF9F 2I38A 3KK1A 1SJ4P 3M30B 1TV6B 3EMTA 3N5BA 1Q53A 1I3OB 4NASA 2QMWA 3FSXA 4KH1B 4Q0BA 1M5SA 2X1FA 3I0SB 1SH0A 4WTOB 1UW9A 4DSJA 3MUVP 3MPYA 1VFJA 1IKWB 4NI2A 3LWLA 3PIPQ 1RLDA 3MMBB 2CQ3A 2GAGC 1KOOA 3F56A 2CQ4A 1YITS 3Q0AA 4ZCKA 3I9ZA 3KHRA 3DLEB 4ZITA 2CQGA 4OYOA 1DFDA 3KMSA 1E6YA 1HNWJ 4YUDA 1EKSA 3CWJA 4ZPDA 3D68A 1C0TA 4Z7YA 4MKAA 3A4TA 4ZVGA 3K5MA 4WPAA 3Q8VA 2CG8A 2AJQA 5M2UA 2FY1A 2DNKA 3VAMA 1T9YA 1B4SA 3ZTRA 4OI2A 1NSQA 2B6AA 1T8EA 3NOGA 3BSAA 3MDFA 2WW4A 2D9PA 4IOBA 2VZ9A 1U1LA 5L46A 4RZRA 2RQ4A 2HG4A 1DHMA 3DHXA 5HVGA 2ZH5A 3FDSA 2G1HA 2MMYA 3L9ZA 3RAMA 2DY9A 1CJTB 1B0TA 3PEHA 4DX5A 3LO3A 3CDEA 4I7FB 4QOTA 2A18A 1NB2A 1R3NA 4CNZA 2YKMA 2KXHA 3UR0A 3TUJC 1PJ6A 4Q8EA 5A8RA 4KAIA 3ISZA 5K8MA 3O8WA 1TFWA 3QZ8A 2NR0A 6FD1A 4A46A 1F60B 2AJ0A 2XHWA 3HMJG 2Y1JA 1NJYA 4PG8A 4P73A 2ZEJA 3J80Y 4B9TA 3WBZA 3M9NB 2F4FA 2C3YA 5JXSA 2KFYA 3W5YA 4J7CA 4ZA1A 2QEXS 2YX4A 1GMWD 3TJ9A 3KG4A 2GGPA 4CIOA 1YVFA 5CYQA 4UY8T 4DV0F 4OLPA 5AE2A 5LJ3Y 1OQ6A 2KVIA 1JXEA 4I2PB 2EG1A 4O23A 4KV8B 2P9CA 2JLEA 3GZ7A 4QYZJ 3LPEA 3E01A 1U0HB 4B9VA 2DTJA 2HNZB 4UZBA 1O5JA 2VUGA 1NK6A 4FPRA 3M2VA 5E3PA 1S10A 3BO3A 2W2MP 4JI2F 1RKIA 2XTJP 2MKSA 2WVDA 3JQMA 4ZKAA 1FJEB 4A8SA 1IWGA 1S4FA 1FKOB 4DL4A 2DCLA 4ZJLA 4DOZA 3KLIA 4K4VA 4WYWA 4LF9J 2XYHB 1UAWA 4ANDA 3TVKA 3VAJA 1OSCA 4F4XA 1ZA2B 3MM8A 1S1XB 4B3TF 4OI3A 3DOLB 1NB7A 2W7AA 5CYMA 3W63A 1CLFA 3MD1A 1LW2B 4C4WA 3EGWB 2GHWA 4ZP8A 2ZH9A 2N3OA 5C25A 1GXLA 3JSRA 1YK9A 1DLOA 2JL9A 4WF9Q 1FDNA 2CA9A 5I42B 1B7FA 4Y28C 2XGPA 3V6DB 4JI7F 4CM0A 3T5JA 1YJWS 4DCPB 5F8GA 4O3OA 4EO8A 3PYDA 3UDLA 1C1CA 2J9CA 2DNHA 2HVHA 1PILA 3W2VA 1UJ6A 2L9WA 2QSWA 3JTOA 5HL7Q 3DN9A 6AT1B 2ZC4A 3NBPB 2G0CA 3FQLA 3SCKE 1RADB 5C24B 3UCUP 1CS4A 2VU5A 3MI7X 4J9KA 2CZVC 1X60A 2AEMA 1RTDB 4W90B 1QAYA 2DITA 1AROP 5LSLA 1OYDA 3GFXA 4I6YA 2IM2A 1HNVA 3CCJS 4Y65A 2UXDF 4N47A 4EU0A 3AOCA 1UWBB 1U0SA 3LA0A 1C4CA 3SSSA 4E2FB 3KLGB 1N34J 3HHDA 2XNQA 2IPOB 4K2XA 4G1QB 2OEKA 3EJMA 3H25A 1HKAA 2EI5A 2MKIA 4DQPA 1FFGB 1QD1A 3A3OB 2RU3A 1HPZB 3QT8A 4YFUA 3DFEA 4RW9A 3N4WA 4OX7A 1YWXA 2DNQA 5DJBA 4YDDB 4OZ2A 2ATCB 4X2BA 5DLGA 2LQ9A 1IM6A 4CO2A 2MHNA 1S99A 4M5DB 1HWIA 1XERA 1OSDA 1L3UA 2KFZA 5C42B 4OHZA 2HQIA 3V6JA 4USHA 3BYPA 3TEGA 3EVOA 2ZKUA 3CJKB 1U7LA 3LANA 4DV0J 1KRPA 4NA2A 1RWOB 1ZH5A 3MMAA 4IH6A 1JLGA 2Z4PA 1BE4A 2J5AA 3QLHB 1NCLA 5HAOA 3O6QA 4RBTA 4OX9F 4WK3A 1GT8A 2ZBIA 2H1YA 5L39A 3HP6A 4B3OA 2KG0A 1N5YA 4JI2J 5KFRA 3CGIA 5CQGA 2LU1A 1YKWA 2KM8C 1WUUA 4C8KA 4ID8A 4X64J 2KJVA 5T7LB 2R8HA 1PBUA 4C0BA 8AT1B 1RISA 1WC6A 5A0YB 1L3KA 2DHGA 1U49A 4ZIVA 2G13A 3US5A 3FEYB 5KOWA 3PR4A 4FYDA 4CTAB 1HMVA 2V4JB 1RAFB 1ZZFA 4F2RA 2W25A 5KG7A 5LOQA 2XY5A 1Q8LA 4HTIA 4MT1A 2ZKTA 3W9IA 4CLUA 4K4TA 4H4OA 3I5BA 3A3PB 3VR1A 2V8HA 3WZ0A 1ZS6A 5FD1A 1SL1A 3B54A 2RRBA 1SVDA 1RT3B 4DMZA 2D9OA 2N4CA 2B7CB 5HQ8A 3JAMY 4C3MA 1D1UA 4JI7J 1JLBA 4K4XA 1G3OA 4F3OA 4AFFA 2IDLA 3I56S 1V3RA 2DHHA 2VJUA 4MK8A 3ITHB 1G7CB 2EFQA 3ONQA 3UD5A 2R7UA 5HQLA 1RHUB 2SXLA 1MMLA 2DGVA 2DNGA 3BR8A 1T9WA 4RUAA 3DRRB 3C6UA 4YB6A 1JLCA 2OFHX 4ZPVR 1UETA 3W66A 3NXZA 3SV4A 2D3ZA 2HIYA 3CJ3A 2MKYA 1TKTA 2DXFA 4X4SA 1H2TZ 2CQCA 3PR5B 1AW0A 3NL0A 1DQAA 2XZTB 5KT5A 2ZOMA 1M5OC 1PYOB 5I4MA 3PYFA 3P4UB 3DLKA 1QE1A 5AE1A 5K14B 3NS5A 2BANA 2IDEA 5KT2A 1XEZA 5KFGA 4MK7A 1FKPA 4RO0A 5FDLB 1EAYC 1FFSB 2HAFA 2Z57B 4QIVA 2FLNA 1N32J 1MWQA 1FK9A 3G87A 3IS9A 1WF0A 2Z58B 2LQ8A 3KLEB 1FNXH 4OI6A 3FKBA 3LP2B 3UN2A 1SPBP 1V5VA 1S1VB 2B56A 4M95A 3DOKB 2VJVA 3QO9B 2Y9HA 1DY3A 3BSCA 3MCMA 3R8YA 2BMBA 1ZYQA 3BGOP 4XO0A 2EXUA 5BYSA 1HBNA 2ZH2A 1XMQF 1QM9A 4Y2MA 1S49A 2VF3A 4O3RA 2KRRA 2XMJA 3G8SA 3D4JA 4DV3F 4K4WA 2BRKA 2HNYB 1T11A 5DG9A 1SB6A 1HNIB 1RK8A 3PY8A 2HVDA 1K1QA 2OO4A 1TFYA 1M5HA 3ULHA 1RT4B 4ZN1A 1WKKA 4DL2A 3CPWR 4Q7AA 3KNAA 2E5JA 1N33F 2X3DA 4G65A 2K8GA 4JI5F 2LCWA 1TUGB 5J2MB 4JUZA 3NY0A 1U8WA 2LA6A 4LQ3A 1M5KC 4OQJA 3BDPA 5D4PA 2DT9A 1YZ7A 3NGRA 3ZTQA 4EI2A 2JZ5A 2QL5B 3TZXA 2DR5A 1KQSR 1AUSL 1MROA 4DLEA 1TL5A 4PWDB 1N5QA 2OMOA 5D4OA 2CPEA 2J0QD 4WXOA 2DHAA 3M1VB 1CULB 1REVB 1GMVA 1H7WA 2E9ZA 2F1FA 3CSKA 4NXNF 4Q2LA 2O67A 4IR1A 4BS2A 2I5JB 3CC2S 4JI0F 2ZC3A 4C0HA 2APOA 4ITSA 2K3IA 2ZNYA 4PWUA 2DGTA 3RB0A 2XZDB 2NXNA 3CF5Q 2WVEA 3T3FA 2PA3A 1WDTA 2YQ1A 1S1TA 3POTA 4KB7A 2AW0A 3M6WA 2MKCA 5IV3A 5CZVA 1W26A 2EPIA 5KFZA 1RSCA 2N82B 1SC6A 5HMYA 2HQCA 3MHYA 2KB2A 4KTQA 3T1YF 3QNWB 2MQ8A 4GVLA 3VAGA 1LFPA 3KJNB 1FD8A 2BW2A 2HK2A 4IFYA 1OYEA 3H40A 2KFNA 1RBLA 4WKYA 3KMQA 5IXUA 5IOLA 3UN5A 3UWTA 3CTRA 2HWIA 1PAUB 5DO2A 4R8UB 4DSEA 3VWSA 3IN5A 5SZTA 2C3UA 4WWSA 3WIUA 3E51A 1P1LA 2CQBA 4JV0A 2EVZA 3NCRA 3MFIA 1TK5A 2E9TA 1H2VZ 2GQQA 1WOOA 2HBZB 4K0KF 3OR1A 5L1KA 1TKZB 3VGVA 1V6HA 2M2BA 4AE5A 3BPDA 5DM6Q 2V9WA 2WB1D 1IM4A 1J5OB 3RBXA 1GH8A 5KG6A 2VB6A 1IKVB 4HL9A 3VGTA 2VODA 1Q8IA 1U45A 4ZP7A 1HR0F 1IBKF 2WONA 4DV2F 2VOPA 5L1LA 1FEHA 2MYFA 2O01C 2R8IA 4IUFA 2F3JA 1T3NA 4DV3J 3QFHA 1XC9A 3ZZUA 3FVYA 2IJRA 5D3GB 1APSA 4G1PA 3Q86A 2XMVA 4F02A 4PAAA 2F4VF 1RHJB 3KKFA 3RYLA 3OL7A 1S6OA 3TA0A 1FHTA 2YKAA 3QRQA 3HZEA 2IC3A 2H5IB 4OZ1A 3CJRA 1YBUA 2XLIA 4QZVB 2ZJPQ 3HJFA 2YXLA 3FCWA 3KLFA 2R7SA 3NAIA 3PJ9A 5G0RB 1KTVA 4KRWA 1N33J 2MLYA 4HEA9 4JI5J 3MR3A 2PC6A 2IVMA 4NLVA 1N0VC 4L73A 3G6XA 4HI2A 3G82A 2AJ4A 3Q8UA 2HZVA 3UVJA 4RNNA 2Y1IA 5L9XA 4IH5A 2K1RA 3GLJA 3C46A 2EK1A 3FEXB 4CO1A 4TYBA 4A8XA 2ASYA 1FWKA 3HJVA 4NLPA 2CQ2A 4OYIA 1NDPA 1RT7A 4TU8A 2V68A 4NXNJ 4FYYB 3U7JA 2DPIA 3KG0A 1S79A 1NLKL 1XK8A 2A6MA 2HK3A 5KG2A 2U1AA 4AD6A 3D3BJ 3G86A 3OBIA 3GIRA 1U02A 3GU0A 4USJC 1URNA 1VK3A 4N8OA 2E5LF 2DRDA 3MEGA 3AA9A 3MWBA 3W8GA 3MR6A 3NAHA 1TL1B 5HANA 4ZJOA 2CJYB 2RE1A 2JFKA 2NLWA 2VA3A 5ETNA 1CQMA 2QFJA 1EETB 4J9UE 3UNGC 2HZAA 3LTOA 2K3KA 4ECSA 3C15B 2ACYA 5ETVA 3MMCB 1R0AA 1RYRA 1Z2LA 1JLAA 2AEFA 1DTTA 4JV5F 2HBRB 2ABYA 3CD6S 4NMXA 1EZZB 4P2XA 4ZVEA 4TU9A 3P96A 1CJVA 3H0PA 4X4UA 3NNHA 2I0XA 4K4UA 2JSXA 4M63A 2XI2A 2QA1A 4HDGA 4H54A 3DLBA 1JLEA 4CWBA 1U1OA 3W9HA 1OJ4A 4LIWA 2CPJA 2BA9A 4JI6J 2JFDA 1PIEA 1WOSA 1M90T 1BQNA 4ICLA 1N88A 4DXLA 1GEHA 4WTYA 2XSJB 2FZKB 2WBRA 3R5GA 3TAMA 1WSVA 2VD3A 3DGPB 2UVWA 1RT6B 2KYZA 2V67A 2HAIA 2AIRB 1MN9A 2ZH1A 4PG5A 4K59A 3CCVS 2QMXA 1HR0J 1IBKJ 3EDQB 4DV2J 3QZ7A 2AF6A 4I64A 5HN0A 2VKZG 1TV6A 4YDXA 3EXYA 5DS7A 2L3MA 1LWFB 5KFJA 5EUHA 2YKNB 2WZ1A 1U1MA 5GAEI 5CZXA 5C7PA 2F4VJ 1LFWA 2ZJRQ 3MEEB 1IKWA 2Z2ZA 4WIIA 2YWHA 3FJ2A 1VJWA 1UVNA 4M5LA 5HP1B 3QYYA 1R0CB 4ECZA 2YPZA 1Q16B 2AZ1A 4BWMA 2FJVA 2PMHA 3M4XA 5T41A 1WTFA 2VDHA 2VFVA 2AJ2A 2C2NA 2WHOA 2CPIA 1QDUB 4RW6B 4EBCA 1J27A 3ZTSA 2LYVA 4ZLPA 4M5GA 1HBMA 5KAKA 1RBAA 3D1QA 3U1MA 1KQGB 4DR1F 1KQFB 4PUOA 4RL1A 3QGPA 4AXJA 3GTYX 3R9LA 2B9WA 3GIIA 1T7PA 1LQ9A 4DUYF 3VV2B 2RUSA 4KYZA 1TVRB 5C2CA 2VL1A 1HWJA 4LR8A 4F26A 2GIRA 4HACB 4NLTA 2PA8D 2HRTA 1KLMA 1M1HA 2LU2A 1E6VB 2C2ZB 2KN4A 2UVRA 2E5LJ 2D41A 1NK0A 1Y11A 5DDOC 2BJEA 1F9EB 2ZH6A 1CJTA 4IFVB 4GKJJ 4DV4F 2O66A 2YQ0A 1NK4A 2HS3A 4I7FA 3M32A 4L72B 3HVTB 3ELHA 3W3SA 4PG4A 3VHQA 4O44B 2OPRB 3BR9A 4F0MA 4KFBB 1RHKB 1X5TA 1RHRB 3KK3B 2LEPA 3QSYB 4WKRA 3S8SA 2DR8A 4YY3F 3MPDA 4JV5J 2M0GB 3NOCA 3D0HE 2CRLA 3BBBA 3KYLA 3P8BB 1SBRA 4ILMA 3ILIA 2MQNA 3N9UC 3PJXA 2NXEA 5DLFA 3M6VA 3UN3A 3RRGA 2VPYB 1AUDA 4ZN3A 4UUXA 5D8HB 4EO6A 2AWZA 3ZZRA 3GMGA 1NU4A 4I2PA 5IFMA 1OY6A 1N54B 3HHEA 4CT8A 1F9FA 3AXMA 3EUNA 4NMLA 1U0HA 4C9DA 2BYCA 2HNZA 2XI3A 2MB0B 4I6AA 5GAHU 3IM8A 4U8YA 1CPZA 3I6PA 2HHHF 1IKXB 1R8PA 2Q79A 1FRMA 1HQUB 2ZD1B 5IZHA 1LV5A 1IWAA 2HRYA 2GAHC 2UXBF 4LF1A 3NGSA 3F0NA 3CJ4A 3FNNA 4MFBB 2R7WA 1RT5B 4B02A 5B0CA 3CCQS 4DG1A 3SXLA 1Z4UA 4FKYA 2BACA 4OHWA 2H4YB 3K7RA 4DU7A 1RJJA 4ED4A 1KONA 3DOLA 2HIQA 2P6SA 1SQGA 1KWMA 3PW4A 3OV7A 1VQ5S 2V6AA 4L6V3 3LAMA 4MIAA 3UQSA 1Q95G 2LKZA 2D3OR 4R5PB 4DZ6A 1AZSB 2R2TA 3AAWB 4BCAA 1LWXA 2DBBA 1KDNA 4B08A 4RX6A 5KFSA 4R25A 1JB0C 5I42A 1Q7LB 2DNNA 4F4YA 4Q45A 1YRXA 2WB4A 1VQ8S 3W5XA 3R2DJ 1XIQA 3UCZP 3FBEA 5C5JA 3V6DA 4H4KA 2QL7B 2RAQA 2HURA 2V2KA 4F25A 3GJTB 3H5YA 3H5SA 1UZHA 2BE2B 1BXNA 4R0JA 1F6TA 3Q23A 4MKBA 3R7SB 5LT5A 1FF2A 2HLUA 2PT0A 5LXRA 3NBPA 1B99A 1S0NA 2QLWA 2BE7D 1KN6A 1OPZA 3NG8A 1VQPS 3CO0P 4RNOA 4DUYJ 2DH8A 1SC3B 2OPSB 4KPCA 3IC1A 1S76D 4ECYA 4A8WA 1S97A 3RB3A 3C66A 3CJ2A 4ES1A 4KC5A 4NCAA 1YGYA 1UWBA 3D0GE 3PO5A 3DYAA 3VVTA 1Y3JA 4RPFA 4NZ7A 1Y3KA 3MECA 1NDCA 1X31C 3KLGA 4WXWA 1NJZA 2DPJA 4PPZA 3KNGA 4OYWA 2E1RA 2AJFE 1QTMA 1R89A 3TQEA 4DV4J 5DGBA 1JXLA 3UFCX 4I56A 3X1LB 2PFDA 2VV5A 3UD4P 3BGRB 3LOUA 3SFUA 4PG6A 4PZVA 4ES3A 2BQ3A 1TK8A 4NL5A 3TJAA 2Z2MA 3PCOB 3H2UB 1C1BB 3LF0A 4YY3J 4CDIA 4M5DA 2OTJS 4ZVQB 3UR3C 1RCOB 3ZZYA 4OYZA 2NZ4A 1HYSB 3GYGA 2W4CA 3IO1A 4H4MA 2GS8A 5EX3A 2RKIA 2LFVA 3Q8RB 4UOGA 4IO9Q 2GMJA 2L9DA 2P6TA 1RABB 1XBWA 4QWAA 1RA7A 2LEAA 4RNHA 2FLLA 3OFEA 4LSZB 1GXTA 1OY8A 1UKUA 1YI2S 2ZWPA 1P1TA 1DJ0A 3EWGA 3DDIA 2MZSA 2YWGA 4O4RA 2M52A 2HHHJ 1BY9A 4LFAJ 1DURA 4DX6A 1TTHB 3OQ2A 3MM7B 4EYIB 2CXEA 1NSAA 4JI1F 3HLUA 1RTJA 1T95A 4RR5A 1GX5A 4GKKF 4K4YA 5GADI 3BQ0A 3SBMA 2ZZTA 1RWVB 4L3NA 2LDIA 4CTAA 4WFAQ 4IRKA 2V4JA 1ZA1B 2OMLA 1WF2A 5A76A 4P2FA 1XTZA 3J7YI 3FFIB 4K5RA 3EE3A 2MQMA 2D7SA 4RW4B 3D9BA 1S9EA 2J9DE 4CO0A 1LXJA 4Z37A 4JI4F 3TUIC 3K0JA 3HVWA 2BJ1A 1RT2A 3G8QA 1RT3A 2G1DA 4USUA 3MR7A 3M05A 4M5KA 3NMRA 2FJEB 4USKA 1LWEA 2E29A 3KK2B 4IQMA 5ETLA 3P49B 4ZPTR 5M2RA 2GMLA 4AXIA 3I32A 2KI2A 3CJ8A 5ETRA 3L7OA 2ZOFA 4RBVA 1HNXF 1N36J 2H48B 4CT9A 5CA5A 3HD2A 3KUHA 1F2GA 2M5YA 1RTHB 2FB0A 4PXBA 3OTOF 4ED3A 5DG8A 2WAQD 3MAAA 4EFAC 4J9SA 4WFYA 5J2NB 1H7XA 1VI7A 1SC4B 1XJWB 3G9CA 5FLXU 4QCLA 4GC7A 2UUBF 3NKYA 2XBPA 3C6TB 3TYTA 1NRKA 4ILLA 5D78A 3ZO7A 4V1Ak 2XO7A 1QAJA 4ZVTB 3PJWA 4K7QA 5K14A 1X4FA 3CUNA 2HVEA 1IQZA 4QBUA 1TP7A 1U6BA 3PX0A 2AU0A 3R5DA 1OPIA 5FDLA 5EHHA 2EK6A 1IR1A 1UP1A 2ZBRA 2L41A 3RRHA 4LBIA 5GAGI 5F0UA 2ZDPA 2ZVIA 3LP0B 3EZUA 4DR2F 5F9LA 3KJVA 2LXUA 4U9RA 5BXIA 2W9CB 3L09A 4DV6J 2AV5A 1YSJA 1TKXA 1T03B 1T3OA 4HT5A 3KTQA 3B78A 3LP2A 2ZDOA 2MSTA 4TKTA 2CYYA 2R2RA 2F9DA 1GXUA 3FUYA 4DJBA 3M2RA 2YPYA 1SV5A 1SJFA 4NLOA 3DCAA 5CHCB 1T9VA 4ATNA 2FDNA 2QA2A 3M8PA 4E0DA 3AT1B 5G4DA 2UV8A 4IG3A 3CMES 1IBCB 1REGX 4N7TA 1SC1B 3VGSA 3V4IB 2HNYA 3RAQA 4G1IA 2L48A 2EC0A 1SJ3P 1PJ7A 4OJ3A 4KBIA 1YJVA 2V2ZA 1H6KX 2XWXA 3R7BB 4X66J 2E9RX 1VRUB 2YX1A 2KXFA 1AYEA 3LW5C 3MZIA 5FJ4A 1IKYA 3G6VA 3GONA 1QY7A 4GMKA 2R2SA 2IBOA 2GO9A 2HHWA 3SSRA 2UUCF 4CLSA 3J81j 4JI1J 1H72C 4B17A 2LLZA 1RI7A 1AFJA 1WHYA 5L9NA 4YR2A 3HVAA 2V5HG 3W65A 1SKUB 3IRXA 4OHVA 1TZ0A 5GVQA 4RUHA 3TAPA 1RAEB 2VH7A 4Y3CA 5F8HA 1FO1A 4PWDA 1GNKA 3T5HA 2B9EA 1IXKA 2OPQB 3TARA 2P9EA 3M1VA 1FXRA 5HMWA 2IMWP 2ZOGA 4JI8F 2MKJA 4JI4J 1MNEA 5KG3A 1PGZA 3OR2B 5BYRA 4CH0S 5J1EB 1RTIB 2AX1A 1VHFA 1EQMA 1U1PA 1YBTA 1GQEA 3MUTP 4ECWA 1X4AA 5KFIA 2B0GA 1UW4A 1SKWA 2DEIA 3M8ZA 1U6ZA 2XY7A 3PW2A 4NEZA 2K7KA 2O3DA 3BQ2A 1B64A 5KFHA 3Q8QB 2ZFHA 4LBHA 3MOZA 1A6LA 3HK2A 2V9KA 2Y0SD 4LF4J 1JLFB 2FHMA 1YIJS 5HROA 3SFGA 3QRPA 2OIHA 4N8NA 5KFOA 2ATLA 3OL8A 2R7TA 1T94A 6FDRA 5J1NA 3M8YA 4J9RA 3DNCA 1D9DA 5IT9Y 5SUHA 3DI6B 4U8VA 3H4DA 2MEWA 1YZ6A 1NNDA 2RRNA 5F8MA 2EFNA 1Q5VA 2DGQA 1BUXA 3M6XA 4I68A 4R8UA 4OHXA 3AOAA 4ZPAA 4B9NA 1UVJA 3VGUA 1U09A 1ZM9A 1YRTA 2QYCA 4NLQA 1BC6A 4UT4A 3ET6A 1WC1A 3RBZA 3TA2A 2GZOA 2WOMB 3EVMA 3ENAA 4URSA 3T6BA 4ZIWA 3EYZA 1J5OA 1JX4A 4ID5A 2J7WA 5CH7B 1XR5A 3TVYA 1SKRA 4O0NA 4WCEQ 2WTFA 2AHOB 1X4EA 2XLJA 3WC2A 1TELA 1JXVA 1VQMS 4U7UD 2JC1A 5J2PB 2G4BA 4FXWA 4YN3B 5I3UA 3OVSA 1IJFB 3A13A 4CZCA 1TUWA 4ZJQA 3QJPA 4X62F 4F3MA 3BN4A 4WP3A 4B9MA 3G8TA 1VRTB 4ZLLA 3BV8A 4JYAF 2HZCA 1A7GE 5D4LA 2DJWA 4LJMA 4QIWD 2V4RA 2JH3A 4L75A 1YRUA 2AGQA 2FLOA 4V19J 2DH9A 2PEHA 3ZTOA 1A0OB 1SKSA 3ETMA 3H8YA 1IUJA 4DR3F 2UUCJ 2MSSA 1RT1A 1S48A 2FVPA 3W7BA 4DV5J 3A8KA 5KOXA 4DV7F 2A10A 1C0UB 3K59A 2VQFF 2E66A 1TL3A 3W60A 2HRUA 1UPMB 2W24A 3KK1B 1C2PA 4NWBA 3KDNA 1VBYA 1S1WB 4UOHA 1S1UB 4ZVRB 3MURP 4Q0BB 1R8CA 4JI8J 3W2WA 3JSBA 3ISND 1QVGR 1TU0B 2CPXA 2XSFA 1RWNB 2E5HA 4OJ1A 1CBKA 4C2MA 1KHVA 4OIXA 5ETOA 1TKDA 2JWNA 4NCGA 5KFTA 4W92B 1YX2A 2CFXA 4LFBF 4Q5VA 2KRBA 1K0TA 2VQEF 4EZ9A 4KPYA 4TYAA 4DFMA 4NRTA 3TR5A 1I1GA 3O3LA 4QYRA 2A1BA 2QRRA 1TL1A 1ZTWA 2XO6A 1RWXB 3V5RA 2CADA 3JSMB 4P72A 2P2CB 4FNHA 1E6YB 5MLCV 1ZTTA 2J9EA 4LSNA 2GJ2A 4YR0A 1EETA 1U1QA 3K57A 4KR0B 3IAM9 4YHHF 4RW8A 3C15A 3BS9A 3UO0A 3LWMA 5I3PA 3MMCA 4PQUB 1TMMA 1ELOA 3KFWX 2Z8QA 1VQKS 4JB8B 3U02A 2EFVA 3VAIA 3RG6A 3NCQA 4RU9A 3PX6A 3R5BA 3EZ5A 1EIYB 2GNKA 2R7VA 2WCXA 5KFNA 1CJKA 4ZVFA 5EWGA 1UA1A 4M5HA 3GPAA 3KXDA 3HHNB 3IBCB 4DUZJ 4O4GB 1FDDA 4LVNP 3C8YA 2CPDA 3BSNA 4F36A 1K8AT 2N7CA 2XNRA 1SQEA 1NJWA 3AB4B 4M94A 2GV1A 1Y5IB 4RBUA 2GC8A 4DSIA 2BJ3A 4WZQA 2Z30B 2XGQA 1RT6A 1MWYA 4E8UA 1HWUA 4OZ5A 5A8RB 4J91A 2V69A 1J2VA 1S0OA 5L8RC 3AJ2A 3DOMB 4P2SA 4M1KA 3N79A 4QPXA 1D8YA 4DUTA 3HSJA 5CABA 5IC4B 1LWFA 3J7ZT 1AA1B 1FERA 2IYIA 1F0XA 2RMLA 2YKNA 4P7VA 2HQFA 1L3SA 4X62J 3QIPA 2N4DA 3PX4A 2MJUA 3HXMA 2I9SA 3IMQJ 2GGPB 1CQNA 1X5SA 2F8MA 4J9OA 5CYQB 1B70B 1HNZF 2FVQA 1B0PA 2KL8A 4DSLA 3NGTA 3GIMA 3E01B 1JNZB 2GVDA 2OD6A 4ZP6A 1WG4A 4J9QA 2A6OA 4IH7A 5I3QA 2DHSA 5JVGQ 3M2VB 1X4BA 5LJ5Y 4DR3J 2Q6CA 4HKQA 2F8EX 4M8LA 4G3IA 4DV7J 1ACMB 5HK4A 1MWZA 3FRYA 1YBAA 1TR0A 3NWRA 2OFGX 3KLIB 3OSPA 4B9UA 5GMEA 2VQFJ 5EWFA 3T1HF 4ECXA 3K8VA 5L38A 1N6QB 1SXLA 4LF2A 3IP0A 3HZGA 4CM2A 4FXVA 1IBMJ 2IMOA 2WSCC 5CD4H 4ZP9A 3T6JA 2J9DA 3VZHA 1WNEA 1TVRA 3TOQA 3QJLA 2IM1A 1UFWA 1S77D 3SQOP 4G6VB 3CCWA 4AUKA 1PKUA 3GYXB 1FFWB 3UCGA 4OMFG 2QT7A 3GIJA 2G2OA 5IWAJ 4NRUA 4YMEA 2VQEJ 3CB4A 3PV8A 2ZHOA 4ZVPB 3WC0A 1Y7PA 2XZWA 3RW6A 2VBXA 2RIJA 4CRJA 1FESA 4B9LA 2HQDA 3HF5A 1NDLA 4QU7A 1AB8A 3RR8A 2HNDB 3PM9A 2XS7A 4KHMA 1GX6A 1WC5A 5HQMA 1C1CB 3FBCA 1HBUB 3DLGA 3CJ5A 1Q82T 1FRLA 2UZAA 3CJTA 1Y0HA 2OPRA 1D8ZA 4YHHJ 1RAJA 3IFEA 2QYGA 1Q0NA 4KFBA 3KK3A 3U1LA 2V8PA 5AE3A 5B0GA 4IQXA 2RB7A 1TQLA 5FLXY 1G6BA 3OJUA 1J5EF 3CO9A 2AMCB 2XS5A 2UU9F 4DHVA 4FS2A 2FVRA 2MTLA 1UEKA 2HFZA 4ECTA 1WC3A 2LXFA 3PKMA 2R7QA 1WC0A 2ZM6F 1U2RA 3JSYA 3RU0A 4UW2A 3OVAA 5AXLA 1WOPA 1X7VA 1FX2A 3Q2TC 1KBRA 3Q8PB 3MUMP 1HQUA 1VHIA 2ZD1A 3V6HA 4RW9B 2W8KA 4PXCA 1QSLA 4AYBD 4RWXA 4Y0FA 1QUVA 4MFBA 4FP9A 3CJSA 3IWNC 3OTEA 3Q8SB 3BREA 1WHVA 3L95X 3PYEA 1UVLA 4AQYJ 4LSLA 2WSEC 4TVAB 4MTPA 2FJWA 1YHQS 2N3LA 2JLFA 1Q86T 3MMAB 2GVZB 1AZSA 5HLFA 1BLUA 3G2XA 3PHEA 3IR7B 2NXCA 2CJXB 1VC0A 2MQQA 4OZJA 2RS8A 2ILYA 4QWBA 4K50A 4B3OB 4OL8A 1N5YB 1KP6A 4IRCA 3O1LA 3QRRA 2AEJA 4QWDA 2DYAA 4TY8A 3HFZB 4DQIA 3MM9A 4DPTA 1VQOS 3ZZTA 2XMTA 3EXCX 2AGOA 2BE2A 1CEZA 1NUEA 1R8BA 2HGNA 2C3MA 4BBYA 3T1HJ 5IM0B 2E1MC 1D9AA 4GO5X 3IG1B 3T9ZA 1QTNB 4DI6A 1NZ8A 2XY6A 4LRAA 3CCSS 1JIHA 3PACA 4F67A 3H90A 1Q7YT 3GWCA 3DRPB 2VASA 1YJRA 2DXDA 1SJQA 1WI6A 3W62A 4XTTA 2CQ0A 2JHEA 1C4AA 3RAXA 1VYAA 2WVCA 5MAOA 2KJWA 5HBMA 2M4MA 4KHRA 3FSIA 3M9MB 2IY5B 1VQSA 4N76A 5IV4A 2DNZA 1XNRF 1G4CA 2ILZA 2AJ1A 4CLYA 2HPUA 2MZ1A 1SCJB 2JJ4D 1H73A 3GSIA 4ZCIA 2YTCA 1TL4A 2RH3A 5F0WA 2LECA 2OGUA 2YKOA 2OTLS 2OELA 4ZVOB 2QTWA 2B4PA 1NSKL 1PC4A 4IOAQ 4YQWA 3C6UB 4TN2A 3M7VA 4NEYA 1C1BA 2CPHA 1V3ZA 4RNFA 2VG5A 1UA0A 2KG1A 3UNYA 1TKTB 2W2PP 3V2UC 4HDHA 5KFQA 2VG7A 1J5EJ 4IDKB 4LRCA 1EX8A 1VISA 2UU9J 3BKTA 2QJ3A 3OTBA 5E33A 1QE1B 3CCZA 4E98A 3EDRB 1G2EA 2ZM6J 4OV1A 2HFUA 3AQPA 1IBLF 4UY85 1FKPB 1XN9A 2UVVA 4N5SA 1QVFR 1R7IA 4MKVA 2R8JA 3PFOA 1FVQA 4USMA 2H4WB 2OLWA 4IKAA 1ZBTA 1YJTA 3IS9B 1IR2A 3QATA 3I0RA 3BPSP 5E3RA 3MM7A 1DRZA 1BWVA 2HKEA 5E5NA 3BO4A 2E1CA 4WU2A 3AQOA 5GAEU 3RB4A 1ZM4A 2LEBA 4KO0A 1HBNB 4ELTA 2DY1A 4RW4A 1MU2B 5J2QA 4O3NA 4LR7A 1KTQA 4IG0B 2W1BA 1QAXA 4ECQA 3NEKA 1ZAWA 3BBFA 3NNCA 5HJXA 3D1HA 5IS2A 2Q43A 3GJQB 4WFXA 1T02A 2Y1LB 4CYUA 3OSNA 1S4EA 3KK2A 3HULA 3OJSA 3GIKA 2MKHA 4R0EA 4IOCQ 1SIWB 2YNGB 4CH1A 1NO8A 3BN7A 1OS5A 4QJVA 1EJ7L 4EGLA 4LMZA 4B3TJ 2KXNB 1RTHA 1WG1A 3FQKA 5KT7A 5J2NA 3HHLB 3FMBA 5D15A 1N8RT 1PBAA 3U27A 3C6TA 3R1HA 3MTKA 1L3TA 4PR6A 4PPDA 3CDUA 2ZBPA 1N0UA 4ZVUB 2QMUB 3HI9A 5C2GA 2RF2A 3MGJA 3K17A 3NWGA 2CZ4A 3OHAA 4C8YA 1XNRJ 2YWFA 4X65F 2AP6A 3I4PA 4ZCMA 2OPPA 4C8MA 2VG6A 4WBFA 1S1TB 3POTB 4A8QA 4TQRA 3UDEA 2ZH7A 1KVKA 1U48A 5ETSA 4F4ZA 5E2QA 1TAQA 1VQLS 2UXDJ 3OFFA 4C8NA 1RAHB 2HVZA 3IM9A 2YNHA 3UPFA 3H2LA 1Y4ZB 4H4KC 5DM7Q 4KGMA 1LWCB 3QQCD 1QSSA 4L74A 4N41A 2W4PA 2DRAA 2M3DA 3R5JB 1OIAA 5AJ3F 4IFYB 3V4IA 1VC6A 4OYPA 2QV6A 4Z2XA 3IGNA 2RQMA 2F40A 3ENWA 4J9PA 1FJGF 3JXOA 4NYZA 5CXTA 4PXEA 2FIUA 1F5CA 3GSDA 1S9GB 2GO8A 1S6QA 1NPPA 2RSQA 4B3SF 3AH6A 3D6HB 1XMBA 3OR1B 4Y00A 2BJ7A 2DNRA 2GCFA 5H9EK 2FHOB 3DMJA 2HGMA 2CPFA 1X5OA 4GVBA 2J8AA 2DK2A 3NMAA 1X0PA 3UE2A 1HFEL 3N28A 2WONB 2RRAA 2JRSA 3MEDB 1IVZA 1F5BA 4OX9J 2OEJA 3CJQA 2KT2A 4X84A 4QYZK 3D28A 2OPQA 1HWLA 1Q81T 3JTNA 4OI4A 5DQIA 2GHPA 4DN9A 4U95A 2ZNZA 4UZCA 3OR2A 2UXCF 5J1EA 1RTIA 4LF5F 4HVZA 1VBXA 1UMJA 5DQHA 1T0TV 4CQ1A 3CEDA 5HVHA 1FWPA 2VHGA 2OSRA 1FKAF 3CIZA 2JEGA 1Q4RA 3IBFB 2CVIA 3JQKA 1DAXA 3CE8A 2XM3A 2ZH8A 2YNIA 2J0XA 4Q2MA 5KFFA 4EWTA 3DXSX 3N6MA 3L3CA 4K4SA 3VCDA 1KQKA 1NKEA 3AOBA 1FWLA 5K9FA 2XCAA 2DR6A 2C1EB 1GTHA 2F8HA 1Q5YA 3H20A 3DDKA 4XPCA 4I2QA 3UVJB 1ROFA 4P9SA 1F3VA 2C2EA 1PO6A 2B5JA 2A0FB 1HI1A 1UJ4A 1FTRA 1M1KT 1HQEA 1Q1KA 3OFHA 2BX6A 2V94A 2HHTA 5ITHA 3DI6A 1FDBA 2BVZA 4XK8C 3GFYA 3KDOA 2J8SA 5F41A 5D0RA 1RT7B 4YB1P 3HO1A 2FVCA 4UF4A 1FE0A 5KG1A 1FNMA 4C97A 3P5BP 4ZVHA 5EGYA 2RT3A 3O5TB 4MK9A 3MEGB 1T05A 2W2NP 4EBDA 5LSRA 3KHGA 4CLLA 2CWKA 3TUPA 4W98A 2CQIA 3MF5A 3TANA 2Q1LA 1K9MT 4Y2CA 1R6YA 2GQ2A 1VBKA 1HBOB 2VBYA 4A8OA 4LF6F 2E7WA 1UFLA 4YS2A 3VAKA 2AQ4A 1FEEA 1WEYA 4TQSA 2P9GA 1H0HB 2EFGA 3SSQA 5J2PA 3VTIA 2W9BA 4RUBA 3A8EA 4CCHA 5AJ3J 1DTTB 3SQGA 1XMOF 1K1SA 3UW1A 5E3AA 3VAFA 1EP4A 2MGZB 2BKNA 4USIA 2O5DA 4Y2KA 4JV2A 1LW0B 4MIWA 9ATCB 2XS2A 2QE5A 1AFIA 1R27B 1JLEB 2KT3A 5CCMA 4B3SJ 1WHXA 1BWEA 1RYSA 3DRSA 2J6TA 3DM2A 4HHJA 2EKNA 2R8KA 4ICLB 3TO8A 5GADU 1FD2A 1HD1A 2QO3A 3TAMB 4WU3A 2Y3YA 3DU5A 5F3ZA 1XMQJ 1CJUA 3TQ1A 3LGHA 3J7YU 4S0MA 2XC9A 2OJ3A 4KHPF 4RUCA 1C0UA 3I9V9 2EBGA 4ECUA 3HD1A 2KYXA 3FGVA 2OKQA 3ENVA 4C6AA 3UI3A 1EHWA 2EG2A 1HIYA 4DPXA 1S1WA 2J76E 4DX7A 3TWZA 1ZPWX 1S1UA 3C14A 4DPWA 2GX8A 4F50A 5B0AA 2ZE2A 1RP5A 2AYMA 4CLKA 4QU6A 2UXCJ 4CLZA 3GG0A 4LF5J 3AJ1A 3LGMA 3OPKA 2V8GA 2V0NA 1L3VA 2W7PA 4A8FA 2RILA 2QA4S 5A8KA 2MZQA 1HARA 5KG4A 2YWKA 2PDAA 2AYEA 5LM7E 3CNQP 1KR4A 3KHHA 2DHXA 2PMWA 1TL7A 3IXQA 3VQTA 3TI0A 1SL2A 2HFNA 2QL9B 2R7OA 3EICA 4NLUA 3JSMA 4IRDA 1RQ0A 3D1OA 4YR3A 1HBMB 3I96A 3BB5A 3WDOA 2QX0A 1KEKA 3OL9A 3R5CA 4PUOB 2W7OA 4HLBA 1WF1A 3DC2A 4PQUA 3VZIA 2CUYA 1ZM3A 5J1PA 2QGFB 4JI0J 2ZHBA 3Q8YA 4Z7CA 4F4KA 4FNIA 4NLYA 3N6NA 3M9OB 1LOUA 3OTCA 3S01A 3IRWP 2RQKA 5GAGU 1NK8A 2JC0A 2RNEA 1KLMB 4P52A 3FMWA 4X4VA 4PCQA 2DO4A 4O4GA 2GMHA 3BBCA 3H98A 1N34F 2NYHA 3ZC4A 3PXGa 2VPZB 5ADZA 4DEZA 1VQ6S 5IQ6A 2UUWA 1BHNA 1R8HA 3F73A 2MQLA 3T1YJ 5KFCA 1U8SA 1DQ8A 3M32B 4FF4A 1VS3A 9RUBA 5KG0A 1GTEA 1LKZA 2I8EA 3GCWP 2EWHA 2CDRB 3VF0B 4LF6J 2KM8B 4DS5A 1IQTA 4LIRA 4ZOSA 2C3PA 4FYWB 3DOMA 2FJAB 2UV8G 3OVBA 5H9EJ 5M2PA 2QLBB 3BYRA 3I4HX 2GA7A 3RW7A 2YKQA 4OZ3A 3WX4A 1O6XA 1PSDA 1RB0A 4LREA 1XMOJ 4EK2A 4WE1A 5E0OA 1IR0A 2FC9A 3NLCA 2WVBA 4XPEA 2GJIA 4K0KJ 4NLDA 4NXMF 1EQ0A 1XQIA 3AD7C 3RBEA 4TLQA 2B4VA 2ADBA 3EZOA 3R2CJ 1G1XA 2HEKA 1NDKA 3C2PA 3DRXA 4KKOB 5EN1A 2V50A 2ZITA 2EW9A 3VALA 4QWCA 3CD0A 4F8RA 3CDWA 5BJRA 1R0BG 3M30A 4QIEA 2WSFC 4X64F 2BW7A 2CPYA 4KHPJ 1JJ2R 3QT7A 2NUUG 3TVZA 3M8RA 2BRLA 1EB0A 1K44A 3RR7A 7FD1A 3OD2A 1OY9A 3I0SA 2PEBA 1N6QA 2I6WA 2JVOA 5KFMA 2V4QA 2HLTA 4IO1A 1SIZA 1UFKA 4DG1B 3MR5A 1U2CA 3K5OA 2BUNA 4XIUA 3MM6B 1O51A 1UL3A 5DQGA 4RU2A 5D77A 2AYGA 2B51A 2IM3A 2VDIA 4DSFA 3ILJA 4HR2A 1KS2A 3OXFA 3MMBA 3K5NA 2VFTA 4P74A 5LSOA 2EKYA 2MQPA 3MAQA 3IWXA 4OLOA 3DLEA 4CI0B 4UOFA 2ZJQQ 4USWA 4OI1A 1HQ2A 3FCHA 5H9FK 2FVSA 2XLKA 4FVMA 2EFOA 3PVXA 1H38A 3RZAA 4ZVSB 3MXHP 2HNDA 2K2PA 3D2WA 2LVWA 5IT9U 2HWTA 5AT1B 3MM5B 1HBUA 3DLJA 2X3GA 3CCES 2A3JA 1HA1A 1B7YB 1WELA 3R1LA 3IR5B 1RA6A 1FRIA 1N56A 2B8QA 3PEJA 1PCAA 4P75A 3P5TL 2DR7A 4P10A 1FA0A 4KJIA 2FTRA 2EEYA 3MR2A 3I87A 2CJKA 1CSJA 2F65A 2H5JB 2YNFB 4RKUC 3R6LB 1HWKA 2KO1A 3DU6A 5LMUF 3TZYA 3J7AN 3W5ZA 2NSBA 4UUWA 3DYAB 2PIIA 3MECB 2FGOA 5A8WB 2DNMA 1JK9B 4F7VA 4F04B 2KT5A 4Q43A 1VQ4S 1NH7A 2J6UA 2NCKL 4X4PA 1N32F 1M5VC 2BXJA 3FC9A 4PYDA 3DHWC 4RW7B 2RS2A 4EBEA 4ZPWR 1URRA 3QT6A 2F5GA 2QG9B 3R7NB 1MG7A 3B4MA 4C11B 8RUCA 2IAJB 3PKYA 5D0HA 3K5LA 2C2OB 3DRYA 4DDFA 2GQCA 3CCUS 4U96A 1NMEB 3D0IE 4B3MF 4KV8A 3LH2S 3QSIA 2I1RA 2CQ1A 3FSYA 3A12A 4EEYA 3P3DA 4OHYA 2UUTA 2ZZNA 1LK5A 3AB2B 4H4MB 4NXMJ 4OI0A 1HI8A 2RKIB 4N77A 4WK1A 3CXCR 2GVZA 1I94F 5HMZA 2KZMA 4DPOA 3HFVA 1RAOA 4ANCA 1T9TA 1FKOA 1RBOB 3HT0A 3W9JA 3K2YA 5ETPA 3BGFA 1RLCL 1NBEB 2G2ZA 1Y9OA 1UVKA 2IVYA 3V6KA 4LRDA 5K8PA 1NEEA 2PE8A 4O3PA 2BBEA 4J9NA 5DDQC 3BJYA 3GP9A 1IN0A 3PFEA 2NUHA 1S1XA 4XAKA 1FNOA 1TUVA 5IM0A 3NP5A 4YOEA 3EPGA 1RTJB 3W1YC 3Q22A 2HHPA 3IG1A 5K20B 5KFUA 2NXJA 1LW2A 4DCOB 5EDWA 5CAAA 5CCLA 2HHUA 3DRPA 1S9EB 2IJFA 3ZTPA 4CO4A 4X4OA 3PTWA 4X4TA 3HSGA 4AT1B 1F3FA 1RT2B 4F2SA 2JLGA 5B0EA 3CMQA 1LWEB 2K06A 3ICLA 4DR1J 2RHSB 2R8GA 2ERRA 5KTQA 3CJ0A 2ASJA 3KHLA 4U6PA 4ELVA 2DXEA 2LA4A 4BC9A 5DGAA 1JJHA 5HSPA 2LDYA 3BH6B 3S1TA 1EARA 5C24A 4WZMA 2COLA 1ZAVA 1RUSA 1RTDA 1VQYA 2Z2YB 2XMKA 3MAAB 3QJJA 3RJMB 3EGNA 5DETA 3S6EA 4ED7A 3F44A 2CJBA 1AXQA 2DISA 2J0SD 3I55S 2B3TB 1HLWA 3OW2R 3HPOA 3W8PA 3M8QB 2BJ8A 4KSEB 2WBMA 1ITPA 4DU8A 1WACA 3D6TB 5HJYA 1M0SA 4IDKA 5LMUJ 2D3O1 1T9XA 2BOAA 1VLYA 4G1QA 3NRBA 2BQRA 3LAKA 5F3TA 1H2UX 3TX0A 4B9SA 2VC1A 1DARA 2H9ZA 1HPZA 4KGXB 2BE9B 4FXDA 3CC4S 2ALZA 4A8YA 3WIVA 1SI9A 1B3TA 4AL6A 4TLRA 3KUGA 2B7BB 3KJVB 2J0WA 2RQCA 3N6LA 2FGCA 4HT7A 2PN6A 1O0PA 1TKXB 1N5TA 3SV3A 1NAQA 2LQBA 1NH8A 3W64A 3SDEB 3O44A 1JWWA 5C42A 1S6PB 3M2RB 3CJKA 1SV5B 1DZ5A 2DEJA 3QPIA 4B3MJ 2BM1A 3OXGA 3M8PB 3J81U 3QLHA 2GJFA 1S5ZA 1MU2A 4IG3B 2FC8A 2HBYB 3CCMS 4ANEA 2NS1B 4IG0A 4GO7X 1R43A 3B6BA 3JQJA 1I94J 1U6FA 4HHHA 3SI8A 2Z56B 4IYQA 3IA0A 1UTAA 3LQVA 2NPFA 2FLPA 3PW5A 5T7LA 2POKA 4DWIA 2X51A 4ES2A 4YEAA 2UXBJ 2M8HA 5A0YA 4HYKA 4DR6F 2YWEA 3M2UB 1O8BA 2MHEA 3VAHA 1IKYB 2L08A 2YNGA 4HI1A 3NS6A 3ZZPA 5F9NA 3E8OA 4Y2AA 2MXYA 1DTQB 4PYAA 3ETOA 1ZAXA 3V4MA 1QJHA 2ROPA 5H9FJ 2N7YA 5IC6B 2VOOA 3IRXB 3HHLA 1JLQB 1RU1A 3Q24A 1R6VA 2JEIA 1OWXA 4X4QA 2W01A 1Y5NB 2BKPA 2Q6BA 4P7TA 5DDPC 3JYTB 1R8AA 2A2CA 2HS0A 5EX0A 3I82A 3ITHA 3KWMA 1X4GA 2MJNA 2XQCA 5A6PA 3FK4A 3HDSA 3CIMA 4PWWA 2ROEA 4ZPBA 3D3CJ 2U2FA 2QSFA 3PNIA 1Q8KA 2C2MB 1SUQB 3DRRA 2D74B 4C3LA 3VQSA 4DBQA 1F5AA 2H65B 1S7HA 3NGDA 4ZS6A 5JJBA 5HROB 3DLHA 2CZ9A 2Z2LA 4Y6IA 3TA1A 3MEKA 4FBUA 2Q3PA 1SJRA 1BQMB 3PW0A 2M9KA 4JOUA 3ZZ0A 4TXSA 4U7CA 3SIPB 1LWCA 5H1SV 1WSRA 2VA2A 3HM9A 4PRFA 2VKRA 1HHQA 1F9HA 1ZOTA 3GB0A 2PI4A 2PSZA 2LQ5A 3N5FA 4ZHRB 2D3UA 3RBDA 4NLGA 2QLJB 4LF7F 4TNOA 4OYBA 4UQTA 3W61A 5DDRC 1KC8T 1PYSB 1SJ1A 4OV6A 2VBWA 1Q8BA 3KLEA 4LRBA 3GV7B 2XB2D 2VFRA 3ILLA 3WHIA 1Z2ZA 1S9GA 2JOQA 1S1VA 2HQGA 4ECRA 4MAKA 3DOKA 1TMJA 4JI6F 3QO9A 3ET6B 2DVIA 4QPTA 2LXIA 4O3QA 2YH0A 1PG5B 2CQPA 2H51B 2Y1RI 2C3OA 5HATA 1VBZA 4ID5B 4YP3A 3ZNJ1 1P9QC 1U25A 2YVSA 3V81B 1NJXA 4CP5A 3BO2A 2QFIA 4F0KA 2FHKA 3MEDA 1NPRA 2RVJA 4GC6A 2FY8A 3GYNA 1HNIA 4CNYA 1R31A 2DIVA 4WFNQ 4KH0B 1WDDA 3QAUA 5I3UB 1RU2A 2XWYA 1RT4A 4DV1F 2M88A 4D3HA 1UEVA 3OLAA 4OJGA 3KLHB 2QC3A 2NPIA 3LPYA 2H54B 2FQQB 4GKKJ 5J2MA 4DR6J 3O2IA 2ACMA 3CCTA 1GK8A 3TW0A 2EFPA 2G2YA 1VMBA 3KJQB 4FVCA 4I69A 2BZ2A 1RT1B 4MMOA 2J7UA 3QIDA 1OO0B 2IRXA 3BF4A 1YJUA 2JVRA 4I4BA 2DD8S 4NE9C 4J9MA 2HHVA 2DNPA 1CULA 1REVA 2R3VA 1TL3B 4ED1A 4KE5A 2IA0A 3LALA 2BOPA 1P27B 4J90A 2XMWA 3P45B 2I5JA 3C16B 5DG7A 2ZVSA 5E3QA 3LP1B 2ZWOA 3JS9A 3QGHA 1S57A 2HMIB 5LMNF 1U2FA 3W2WB 4BLGA 3HCXA 3GILA 3TZWA 5B7WA 4QIGA 4FN5A 3CDBA 4FYXB 3MMJA 1HNXJ 3D66A 1UVIA 4BHQA 1K47A 1UVMA 3TZZA 2PFFB 2BV3A 4WYLA 1XNQF 3OTOJ 1UPPA 4NCGB 4FF3A 2DB1A 1F2HA 2BDPA 2A2DA 1X5PA 2BEFA 1KFDA 2CKWA 4GKJF 1JKHB 5E7OB 4DZDA 2IHR1 2UUBJ 1KOHA 2VFSA 1S0VA 3NNAA 3G6YA 1MLAA 2HGLA 1HBOA 3TEHB 1HHSA 4LSNB 5LXYA 1QSYA 5LL6d 2FZGB 2MLZA 3E2EA 4RW8B 2FD2A 1SH3A 2KVQE 3G4SS 1RKJA 3CCLS 3SYZA 4ELUA 1F1BB 4W4MA 3EPIA 1NHKL 1KFSA 4WFBQ 1NPKA 4LF7J 4DR2J 3IWLA 2MGZA 4DLGA 4O0IA 1VIXA 3H59A 1TKZA 1LW0A 3N0VA 4C8ZA 4U7UK 1CJKB 4D3GA 3ZNUA 2HBQB 4ED0A 2Q66A 1FRHA 2XMAA 3BM7A 1IKVA 2DH7A 3UD3P 3EGVA 2EC2A 4AL5A 3OFGA 1X9SA 4OYAA 4P2MA 4QR2A 5GMDA 3K89A 2PI5A 3AJDA 4A8MP 4OX8A 3S7RA 1WC4A 2ZUGA 3H5XA 2YBVA 1N52B 2BKOA 1PAEX 2R4FA 1RWUA 3R97A 2ASLA 5D3GA 4ETXA 3KUEA 2QA4G 3CT9A 3H5UA 4FBTA 3IAS9 5DZ6A 3TUZC 1EKRA 4JI3F 3FCVA 4NA1A 1OMSA 1Q79A 4NYOA 5CYJA 1N5VA 3CCRS 4EMDA 4DV1J 2ADCA 1UCNA 5IQQA 3QIPB 5JUMA 4DS4A 3AXKA 2VC0A 2KH9A 2M8DB 4DR5F 5G0RA 3DXBA 4C98A 2RU9A 2E7VA 5KFEA 1H98A 3SCJE 1NK9A 2GVDB 3OUYB 2CWXA 4P6QA 2RUGA 2CIMA 1TAUA 2B9YA 1Z1ZA 3R3TA 4PEOA 4ZLJA 3T5LA 2XEXA 2ZH4A 5AXNA 4EUVA 3JTPA 4DL5A 5B0BA 1RWWB 3CW2C 1RXOB 3MAHA 2DGOA 4ZPCA 3ZFVA 3BH7B 3M8SA 1WWHA 1D09B 3EX7B 3TP2A 5KFXA
chains in the Genus database with same CATH topology
3EJMA 1HIYA 1U8WA 1XIQA 2B8PA 3FBEA 1MN7A 4UOHA 1PKUA 2DXEA 3FCVA 3NGRA 3ZTQA 1XQIA 1LEOA 1NDPA 2AZ3A 2HURA 4UOFA 2DYAA 4CP5A 2AZ1A 4F4AA 3BH6B 3Q86A 1UCNA 3NGTA 2DY9A 4ENOA 1NLKL 2BX6A 3VVUA 1NDKA 3Q83A 3GPAA 1NHKL 2NCKL 1F6TA 1NUEA 1NPKA 3JS9A 1NSKL 1S57A 1WKJA 1NDLA 2DXFA 3GP9A 5IOLA 3FC9A 1NB2A 1BUXA 3BBCA 4F36A 3DKDA 3Q89A 1B99A 3NGSA 3EE3A 1HHQA 3NGUA 3ZTSA 3FBCA 3FCWA 1WKLA 3VGSA 1BHNA 4ANDA 3ELHA 2VU5A 3VGUA 3PJ9A 1S5ZA 3WX8A 1S59A 1NSPA 2HVDA 3EVWA 1MN9A 4FKYA 4DI6A 3ZTOA 1HLWA 4KPCA 3Q8YA 3EVOA 1ZS6A 3ETMA 1W7WA 4ANEA 1K44A 2HVEA 5CAAA 3B54A 3VGVA 4FKXA 3EICA 1WKKA 2B8QA 3Q8VA 3B6BA 3BBFA 1BE4A 4UOGA 2DXDA 3EVMA 3ENAA 3R9LA 3MPDA 3EMTA 1NCLA 3ZTPA 2BEFA 2CWKA 3L7UA 4S0MA 3BBBA 4W98A 1B4SA 3Q8UA 3ZTRA 3VGTA 3VVTA 3BH7B 1NSQA 3PRVA 3EM1A 1VYAA 3FBBA 1NDCA 4DZ6A 4DUTA 4WBFA 1F3FA 1PAEX 5CABA 4HR2A 5BXIA 3DDIA 1LWXA 1KDNA 4O0NA 4C6AA 3G2XA 2ZUAA 1EHWA 3FKBA 4ANCA 4EK2A 5C7PA 1JXVA 3FBFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EJM A;  1HIY A;  1U8W A;  1XIQ A;  2B8P A;  3FBE A;  1MN7 A;  4UOH A;  1PKU A;  2DXE A;  3FCV A;  3NGR A;  3ZTQ A;  1XQI A;  1LEO A;  1NDP A;  2AZ3 A;  2HUR A;  4UOF A;  2DYA A;  4CP5 A;  2AZ1 A;  4F4A A;  3BH6 B;  3Q86 A;  1UCN A;  3NGT A;  2DY9 A;  4ENO A;  1NLK L;  2BX6 A;  3VVU A;  1NDK A;  3Q83 A;  3GPA A;  1NHK L;  2NCK L;  1F6T A;  1NUE A;  1NPK A;  3JS9 A;  1NSK L;  1S57 A;  1WKJ A;  1NDL A;  2DXF A;  3GP9 A;  5IOL A;  3FC9 A;  1NB2 A;  1BUX A;  3BBC A;  4F36 A;  3DKD A;  3Q89 A;  1B99 A;  3NGS A;  3EE3 A;  1HHQ A;  3NGU A;  3ZTS A;  3FBC A;  3FCW A;  1WKL A;  3VGS A;  1BHN A;  4AND A;  3ELH A;  2VU5 A;  3VGU A;  3PJ9 A;  1S5Z A;  3WX8 A;  1S59 A;  1NSP A;  2HVD A;  3EVW A;  1MN9 A;  4FKY A;  4DI6 A;  3ZTO A;  1HLW A;  4KPC A;  3Q8Y A;  3EVO A;  1ZS6 A;  3ETM A;  1W7W A;  4ANE A;  1K44 A;  2HVE A;  5CAA A;  3B54 A;  3VGV A;  4FKX A;  3EIC A;  1WKK A;  2B8Q A;  3Q8V A;  3B6B A;  3BBF A;  1BE4 A;  4UOG A;  2DXD A;  3EVM A;  3ENA A;  3R9L A;  3MPD A;  3EMT A;  1NCL A;  3ZTP A;  2BEF A;  2CWK A;  3L7U A;  4S0M A;  3BBB A;  4W98 A;  1B4S A;  3Q8U A;  3ZTR A;  3VGT A;  3VVT A;  3BH7 B;  1NSQ A;  3PRV A;  3EM1 A;  1VYA A;  3FBB A;  1NDC A;  4DZ6 A;  4DUT A;  4WBF A;  1F3F A;  1PAE X;  5CAB A;  4HR2 A;  5BXI A;  3DDI A;  1LWX A;  1KDN A;  4O0N A;  4C6A A;  3G2X A;  2ZUA A;  1EHW A;  3FKB A;  4ANC A;  4EK2 A;  5C7P A;  1JXV A;  3FBF A; 
#chains in the Genus database with same CATH topology
 3PRB A;  5LMN J;  3MD3 A;  4NI2 B;  4FF2 A;  2KZZ A;  2F7V A;  1LNQ A;  4ERD A;  2CJQ A;  1UEU A;  2P5V A;  1HHT P;  4DCJ B;  3PIO Q;  5HVF A;  3A8J A;  1NK7 A;  2IRY A;  2MZJ A;  3AD8 C;  4F3Q A;  3PDN A;  3MPV A;  3PW7 A;  2IFX A;  3OT9 A;  1XNQ J;  1WI8 A;  1UWA A;  1FRK A;  4NA3 A;  2UP1 A;  2XYG B;  1NKB A;  2FHJ A;  4V19 X;  4NLS A;  2AD9 A;  5A2Q U;  3DLL Q;  1C0T B;  3EVW A;  4ED6 A;  1FCA A;  2R7X A;  2AKW B;  2JEJ A;  4P71 A;  3T1A A;  3RRK A;  1YDL A;  2L9N A;  3UDC A;  1FTC A;  3T19 A;  7FDR A;  3DLG B;  1RE1 B;  4DQS A;  4OZN A;  2QLF B;  2G0J A;  5F8L A;  2WRM A;  2B6A B;  3SCL E;  5AXK A;  4O3S A;  2WW8 A;  3PRV A;  3EM1 A;  4RJV A;  3FBB A;  4NLR A;  4C3K A;  3QAE A;  3D5M A;  5B0D A;  1V5I B;  3FBF A;  3AOD A;  4USV A;  1RDR A;  4NPO A;  4I6W A;  3FRZ A;  1SL0 A;  3BGU A;  3CUL A;  2XSJ A;  2Y0B B;  1FX4 A;  1FI4 A;  2PMZ D;  2QIF A;  4C0O C;  3DGP A;  2BQU A;  1RAA B;  1U4B A;  2ASD A;  1H3D A;  4I67 A;  5KFP A;  4KKO A;  1RAC B;  2YKM B;  1JQG A;  1MW7 A;  2HW3 A;  2VBZ A;  3QWP A;  4QR0 A;  4DF4 A;  3CC7 S;  4ILR A;  4WJB A;  4LFA F;  3BSO A;  1X4D A;  1FRX A;  4NZ6 A;  1X0F A;  2HFO A;  1RAI B;  3K8W A;  4Y2I A;  1RWM B;  2B4U A;  4WIQ A;  3D6M B;  4PAB A;  2V8V A;  1MMD A;  3U1N A;  3M6U A;  5HMX A;  3ILO A;  4LT6 A;  4ED5 A;  3MEE A;  3K58 A;  4JI3 J;  1CVJ A;  4JYA J;  3MM6 A;  3GV8 B;  1FVS A;  4LSL B;  5HP1 A;  4LQ9 A;  4NLW A;  4L76 A;  2H5E A;  3J81 Y;  1P9Y A;  4J9L A;  4ZLN A;  2F9J A;  4C8L A;  4DR5 J;  4CH7 A;  2RHQ B;  1NZA A;  1UZD A;  1N5S A;  4RW6 A;  3MTJ A;  3D7S B;  1VR6 A;  4MJK A;  5HLF B;  1U1N A;  3BGL A;  1Y00 A;  4F4A A;  4NCB A;  4WFZ A;  1V9O A;  1NKC A;  2NXU A;  2ALY B;  3PG9 A;  4HH0 A;  1KNZ A;  4KQZ A;  3C19 A;  4HHU A;  3GV5 B;  2OSQ A;  3CVK A;  4TY8 B;  3MM9 B;  5ETT A;  5B0F A;  4URG A;  2CAJ A;  3GFH A;  3SZ2 A;  3MM5 A;  4A48 A;  1N36 F;  1WHW A;  3MM8 B;  2IRU A;  4DR7 F;  1JNR B;  3L7P A;  5BYQ A;  5CYM B;  3TNV A;  2VPX B;  2MKK A;  5L1I A;  4HAC A;  2V2V A;  2DKO B;  4MIB A;  1X9M A;  5C25 B;  3TX8 A;  1N48 A;  3A3N B;  3PRD A;  1RWP B;  1DLO B;  1WJ9 A;  2FJX A;  1E6V A;  2OH2 A;  1SQF A;  3DDN A;  4LFB J;  2YNF A;  1KD1 T;  1K0V A;  4OJH A;  1VQN S;  4IFV A;  2CNN B;  5K8O A;  2IBK A;  5HBM B;  2ROG A;  4JV1 A;  5A8W A;  2V63 A;  5CD4 A;  3OHB A;  1KKH A;  3HVT A;  3W2V B;  2E7X A;  2IM0 A;  1ZPV A;  3THP A;  2IJN A;  3PZP A;  2B43 A;  4O44 A;  3OXL A;  1VQ7 S;  1W2I A;  4X4R A;  4DN0 A;  4KGV B;  4Q8F A;  1BQX A;  4RW7 A;  1T9U A;  4DV6 F;  1CS4 B;  1U1K A;  1JJC B;  2E1P A;  3ZZO A;  4JBC A;  1HW9 A;  2CPZ A;  4C11 A;  1NK5 A;  2IAJ A;  2YH1 A;  4KT0 C;  3HHL D;  1YJN S;  2C22 A;  1HNV B;  3SEO A;  2RDI A;  3FZ2 A;  2RDD A;  1CC7 A;  5JVH Q;  4NOH A;  4GRS A;  4OFZ A;  5T14 A;  3AY0 A;  3I5A A;  4J37 A;  2VG5 B;  1LXN A;  3Q2S C;  3L7U A;  3G6E S;  2F63 A;  5L1J A;  4M5J A;  4MYT A;  2VG7 B;  3M8W A;  2BJD A;  2CQH A;  1S6U A;  2BAB A;  1WEZ A;  5D0E A;  3MCO A;  3J7Z 5;  4QW9 A;  2B4O A;  3I5C A;  2VON A;  1IKX A;  2R42 A;  3NGK A;  3OLB A;  3THV A;  2C2D A;  4C8O A;  3KJF B;  2ZBQ A;  1FT8 A;  2HFS A;  4PXD A;  2E1A A;  4NX9 A;  1FDA A;  4M5M A;  1PC5 A;  3HVR A;  4X66 F;  4QIF A;  2NYI A;  2R2U A;  8ATC B;  1D0E A;  2D69 A;  5KT4 A;  1RT5 A;  2KDO A;  4XDC A;  2RD5 C;  2PO4 A;  3THT A;  5KT3 A;  2BM0 A;  1UJ5 A;  3I0R B;  5IT0 A;  1NHV A;  1K73 T;  2HHQ A;  2XG8 A;  2CJ9 A;  2PGC A;  3D67 A;  1PJ5 A;  3RTV A;  5DZ7 A;  3SCI E;  3WX8 A;  2HS4 A;  3H2V E;  2MQO A;  1HNZ J;  4KO0 B;  4R5P A;  1VRQ C;  1JLG B;  1KVJ A;  3ZZZ A;  4DL7 A;  4BC7 A;  1CG2 A;  5J2Q B;  1ZM2 A;  4HH1 A;  1DBD A;  4NLX A;  1VC5 A;  1Q78 A;  1FRJ A;  2O1P A;  3G71 S;  2FJB B;  2AGP A;  2X1A A;  2UUA F;  5F8N A;  2WVF A;  2KHD A;  4QW8 A;  2W2Q P;  1L5U A;  2YQ3 A;  5K8N A;  4CYU B;  2MDA A;  4NYP A;  4J9V A;  2NQP A;  3AHP A;  3MPW A;  4FZV A;  4A47 A;  3QFW A;  3Q83 A;  1FJ7 A;  5D6G A;  1HMV B;  1WKJ A;  3BDE A;  2OPS A;  4DR7 J;  2HYI B;  4LF4 F;  2FYX A;  3OL6 A;  3T41 A;  4CLT A;  4H4O B;  4FF1 A;  1GMW A;  4DPY A;  2FZC B;  1W7W A;  2FJD B;  2W4D A;  2XYP B;  3M8Q A;  5EWE A;  1QAI A;  1A9N B;  3QWU A;  3I31 A;  1JLB B;  4C7Q A;  4NZ0 A;  1YQH A;  3QBC A;  2CNK B;  4DQR A;  2RF2 B;  2MPU A;  4K8R A;  3HSZ A;  2OD4 A;  2GIF A;  1FXD A;  3AFG A;  1YJ9 S;  1HL6 A;  3IBW A;  2KTQ A;  3BGR A;  1ULR A;  5B08 A;  1FE4 A;  5KFY A;  1KHW A;  2JNJ A;  2OPP B;  2KU7 A;  1GAO A;  1VLO A;  1MN7 A;  1GFW B;  2VG6 B;  1XR6 A;  3BKF A;  2NZC A;  1GMU A;  3PHT A;  2M70 A;  4ZCL A;  3J80 U;  1JLC B;  2DGS A;  2CNO B;  2GIQ A;  2BJ9 A;  2YX7 A;  3SDE A;  5HI7 A;  5D4N A;  3BEG B;  5F8J A;  4DPU A;  5DRK A;  1HYS A;  4BWJ A;  1S6P A;  2JEF A;  3LUY A;  2VIH A;  3GCX P;  2DGU A;  2DCU B;  2C28 A;  3DKD A;  2XHC A;  1SH2 A;  2GW8 A;  2E5G A;  2YNH B;  4L3K A;  4DL3 A;  3DLK B;  3H42 A;  3K5P A;  3GG1 A;  1NSP A;  2BAN B;  1I6J A;  4I1T A;  1RAG B;  4FPI A;  1BD6 A;  1VCT A;  3R6G B;  4LRF A;  2DRB A;  4OX6 A;  3H7H B;  2MY7 A;  1NHU A;  2NRE A;  3KG1 A;  2J7K A;  4K5S A;  2CNL B;  1FK9 B;  1AT1 B;  1M1G A;  5D0G A;  1HW8 A;  2DIU A;  3MCN A;  1S6Q B;  2BR0 A;  2MZR A;  1QUP A;  3IGV A;  3M2U A;  4XDD A;  1S12 A;  2H3E B;  4J5O A;  2XCP A;  1WEX A;  1NXI A;  3B8H A;  3DGV A;  3KLV A;  3QT5 A;  2QN6 B;  3DMJ B;  3FFI A;  2Y8W A;  1DTQ A;  3H4B A;  4OZL A;  4ENO A;  4DV5 F;  3F41 A;  2B9X A;  3JB9 k;  1D9F A;  4K4Z A;  4GVB B;  4CLF A;  2D1C A;  1FJC A;  1KVI A;  2RDJ A;  1I5O B;  1JLQ A;  2HSE B;  4LVO P;  1WG5 A;  4DQQ A;  3EGZ A;  2QZ8 A;  1W25 A;  1VQ9 S;  1ZET A;  1VJQ A;  1X4C A;  3HKZ D;  5KFK A;  2HHX A;  1X9W A;  3X3U A;  4A4J A;  1ICE B;  3JYT A;  1U47 A;  3MFH A;  5JMN A;  4I0W A;  3IR6 B;  1U24 A;  1D3W A;  5BR8 F;  1RHM B;  4ZDN A;  4ZK7 M;  3BKU A;  2UUA J;  4K2J A;  2ZHA A;  5E41 A;  4U67 Q;  4LUB A;  1RGV A;  3MPU B;  1X8D A;  3HT3 A;  3ISN C;  7AT1 B;  1S72 S;  2ZBC A;  1DQ9 A;  4LF8 F;  2K7J A;  1OQ3 A;  3J7A 1;  1I51 B;  1RCX B;  1SUQ A;  2WK4 A;  2YNI B;  5E3C A;  4QWE A;  4MKY A;  5B09 A;  4RNM A;  2OP5 A;  5HO4 A;  3AA8 A;  1YG0 A;  2R7R A;  5ETM A;  2CG4 A;  2CDQ A;  1MRO B;  2X1B A;  4UST A;  4YB5 A;  2R9L A;  4EZ6 A;  4A8K A;  1P8G A;  2JDJ A;  4HTJ A;  1VK8 A;  2I2Y A;  2HQ3 A;  4I2Q B;  1BQM A;  3HX9 A;  4WP9 A;  3FEZ A;  2DO0 A;  3HSD A;  2NSC A;  2B5J B;  3MOJ B;  4M5N A;  1HQE B;  5KFB A;  4ED2 A;  3D54 A;  3QMQ A;  3CD5 A;  3RGI A;  5KFD A;  3NS7 B;  1RZM A;  2EBE A;  3R27 A;  4CO3 A;  4LFC F;  1KLN A;  4ZHR A;  1RHQ B;  1Y5L B;  2CQD A;  3LP0 A;  1M5P C;  2OUG A;  1JMT A;  2J6S A;  4FKX A;  4MYU A;  2W9C A;  2C42 A;  4IR9 A;  1T03 A;  4DUZ F;  4DSK A;  1IJE B;  3UDV A;  1T05 B;  2HFV A;  5K5M A;  2XUL A;  4B3R F;  1RWK B;  5A2Q Y;  4PQA A;  4DR4 F;  3GJS B;  3N01 A;  1PYT A;  2E44 A;  4ECV A;  1U26 A;  3B4D A;  2DGW A;  3HHK A;  3T5K A;  3HKW A;  4JP8 A;  5A6W A;  3V81 A;  3BQ1 A;  1NM2 A;  5AXM A;  2OEM A;  3RUB L;  4LBP A;  2QLX A;  2V8D A;  2Z0G A;  2W9B B;  1LK7 A;  1IBL J;  3Q89 A;  4F0H A;  1VRU A;  2FPH X;  3SQG B;  1WKL A;  3GJR B;  2VFU A;  4CLW A;  1EP4 B;  2DNO A;  4Y34 A;  4ZMM A;  3KLH A;  4LR9 A;  5KFL A;  1S7I A;  1MMN A;  2FHJ D;  2YY3 A;  4CO5 A;  5GAH I;  5U47 A;  2G9O A;  2DNY A;  3DRS B;  3PO4 A;  2OHD A;  3DM2 B;  1H74 A;  4AL7 A;  2AT1 B;  5F8I A;  3RB6 A;  2W2O P;  1MSW D;  4ALZ A;  4CLP A;  1FXL A;  1CJU B;  2ZUA A;  3CDA A;  4X4N A;  4DX8 H;  1VGY A;  1BMQ B;  4OYM A;  1TK0 A;  2W9A A;  3NCP A;  2OI2 A;  1WOR A;  2C2K B;  3CMA S;  4QQB A;  3SMZ A;  3C3L A;  2GHV C;  3A8I A;  1S0M A;  4DL0 C;  1IBM F;  2HHS A;  2YWW A;  4M5I A;  1XWL A;  3C16 A;  3G96 A;  1S9F A;  3LP1 A;  2IIH A;  3C14 B;  3JAM U;  2IC3 B;  5FII A;  4UOC A;  2HMI A;  1JJ4 A;  3A1Y G;  2ZE2 B;  5BR8 J;  1KSP A;  2ZH3 A;  3KLF B;  2IVF B;  3ADA C;  4FYV B;  3FZB A;  2M7S A;  1HI0 P;  2AYB A;  4ETZ A;  5GMK a;  1ZZN A;  3ENQ A;  4BDP A;  1HD0 A;  2MLX A;  5A8K B;  3BZQ A;  1JLF A;  2CVE A;  1XR7 A;  4LF8 J;  5IWA F;  1HNW F;  3L4B C;  2XMM A;  2VIC A;  5ETK A;  4QR1 A;  2MY8 A;  4URQ U;  3G82 B;  1TL7 B;  2UVU A;  4ER8 A;  4ED8 A;  4OYX A;  2W8L A;  1V3S A;  1BGX T;  4KY3 A;  1JKH A;  2K1R B;  4PG7 A;  3GFZ A;  2CJA A;  3GR1 A;  2X1G A;  3R5A A;  4UTG A;  3ZXW A;  3E3X A;  1CC8 A;  1VIO A;  5IT4 A;  3KOA A;  2P8I A;  1QLN A;  1N4L A;  2V2Q A;  3GR0 A;  2B8P A;  4F4W A;  1YLX A;  2DNL A;  2DR9 A;  4PKD B;  1NJI T;  3PYG A;  5KG5 A;  2AZ3 A;  2JX2 A;  3OTD A;  3T9N A;  3VVU A;  1VDH A;  4DL6 A;  3P6Y C;  4X65 J;  3AD9 C;  4LFC J;  2LP4 A;  5KFW A;  3HFK A;  4FDF A;  2X7I A;  2YKP A;  2FUG 9;  2OAU A;  1YTY A;  2VPW B;  1U1R A;  4N56 A;  4RLE A;  2WOM A;  4EYH B;  1YJ7 A;  5KT6 A;  3LGN A;  2ZZM A;  3HHL C;  2E5I A;  4KGK A;  2PD1 A;  1RTZ A;  2V34 A;  2RJZ A;  2IA6 A;  2LQJ A;  4DFK A;  2GFF A;  3QGI A;  4B3R J;  3QGG A;  1WTB A;  4DR4 J;  3TJ8 A;  4WP8 A;  2MZT A;  4KGZ B;  3GQC A;  1R0A B;  3TAQ A;  2IYG A;  1JLA B;  2XMU A;  2LMI A;  2Y8Y A;  4FS1 A;  3WQP A;  1WD6 A;  1X4H A;  4Q44 A;  3D6F B;  1CJV B;  4UQG A;  1FJG J;  4YB7 A;  1VRT A;  5KFV A;  3CD7 A;  1LEO A;  4DFJ A;  4AQY F;  1B0V A;  1Y10 A;  5KFA A;  1VOM A;  4C48 A;  2HVI A;  4WE1 B;  4KIA A;  4OZ0 A;  3TRG A;  2KHC A;  3GE9 A;  1BQN B;  4MH8 A;  4DFP A;  3NGU A;  1P6T A;  4TY9 A;  2C2R A;  2AX0 A;  2HWH A;  2DGX A;  3B82 A;  4RWW A;  1S59 A;  3MCS A;  3OUY A;  4DF8 A;  5ETQ A;  2KKH A;  5THW A;  1W2B R;  2G0I A;  5RUB A;  4TU7 A;  4LF9 F;  2I38 A;  3KK1 A;  1SJ4 P;  3M30 B;  1TV6 B;  3EMT A;  3N5B A;  1Q53 A;  1I3O B;  4NAS A;  2QMW A;  3FSX A;  4KH1 B;  4Q0B A;  1M5S A;  2X1F A;  3I0S B;  1SH0 A;  4WTO B;  1UW9 A;  4DSJ A;  3MUV P;  3MPY A;  1VFJ A;  1IKW B;  4NI2 A;  3LWL A;  3PIP Q;  1RLD A;  3MMB B;  2CQ3 A;  2GAG C;  1KOO A;  3F56 A;  2CQ4 A;  1YIT S;  3Q0A A;  4ZCK A;  3I9Z A;  3KHR A;  3DLE B;  4ZIT A;  2CQG A;  4OYO A;  1DFD A;  3KMS A;  1E6Y A;  1HNW J;  4YUD A;  1EKS A;  3CWJ A;  4ZPD A;  3D68 A;  1C0T A;  4Z7Y A;  4MKA A;  3A4T A;  4ZVG A;  3K5M A;  4WPA A;  3Q8V A;  2CG8 A;  2AJQ A;  5M2U A;  2FY1 A;  2DNK A;  3VAM A;  1T9Y A;  1B4S A;  3ZTR A;  4OI2 A;  1NSQ A;  2B6A A;  1T8E A;  3NOG A;  3BSA A;  3MDF A;  2WW4 A;  2D9P A;  4IOB A;  2VZ9 A;  1U1L A;  5L46 A;  4RZR A;  2RQ4 A;  2HG4 A;  1DHM A;  3DHX A;  5HVG A;  2ZH5 A;  3FDS A;  2G1H A;  2MMY A;  3L9Z A;  3RAM A;  2DY9 A;  1CJT B;  1B0T A;  3PEH A;  4DX5 A;  3LO3 A;  3CDE A;  4I7F B;  4QOT A;  2A18 A;  1NB2 A;  1R3N A;  4CNZ A;  2YKM A;  2KXH A;  3UR0 A;  3TUJ C;  1PJ6 A;  4Q8E A;  5A8R A;  4KAI A;  3ISZ A;  5K8M A;  3O8W A;  1TFW A;  3QZ8 A;  2NR0 A;  6FD1 A;  4A46 A;  1F60 B;  2AJ0 A;  2XHW A;  3HMJ G;  2Y1J A;  1NJY A;  4PG8 A;  4P73 A;  2ZEJ A;  3J80 Y;  4B9T A;  3WBZ A;  3M9N B;  2F4F A;  2C3Y A;  5JXS A;  2KFY A;  3W5Y A;  4J7C A;  4ZA1 A;  2QEX S;  2YX4 A;  1GMW D;  3TJ9 A;  3KG4 A;  2GGP A;  4CIO A;  1YVF A;  5CYQ A;  4UY8 T;  4DV0 F;  4OLP A;  5AE2 A;  5LJ3 Y;  1OQ6 A;  2KVI A;  1JXE A;  4I2P B;  2EG1 A;  4O23 A;  4KV8 B;  2P9C A;  2JLE A;  3GZ7 A;  4QYZ J;  3LPE A;  3E01 A;  1U0H B;  4B9V A;  2DTJ A;  2HNZ B;  4UZB A;  1O5J A;  2VUG A;  1NK6 A;  4FPR A;  3M2V A;  5E3P A;  1S10 A;  3BO3 A;  2W2M P;  4JI2 F;  1RKI A;  2XTJ P;  2MKS A;  2WVD A;  3JQM A;  4ZKA A;  1FJE B;  4A8S A;  1IWG A;  1S4F A;  1FKO B;  4DL4 A;  2DCL A;  4ZJL A;  4DOZ A;  3KLI A;  4K4V A;  4WYW A;  4LF9 J;  2XYH B;  1UAW A;  4AND A;  3TVK A;  3VAJ A;  1OSC A;  4F4X A;  1ZA2 B;  3MM8 A;  1S1X B;  4B3T F;  4OI3 A;  3DOL B;  1NB7 A;  2W7A A;  5CYM A;  3W63 A;  1CLF A;  3MD1 A;  1LW2 B;  4C4W A;  3EGW B;  2GHW A;  4ZP8 A;  2ZH9 A;  2N3O A;  5C25 A;  1GXL A;  3JSR A;  1YK9 A;  1DLO A;  2JL9 A;  4WF9 Q;  1FDN A;  2CA9 A;  5I42 B;  1B7F A;  4Y28 C;  2XGP A;  3V6D B;  4JI7 F;  4CM0 A;  3T5J A;  1YJW S;  4DCP B;  5F8G A;  4O3O A;  4EO8 A;  3PYD A;  3UDL A;  1C1C A;  2J9C A;  2DNH A;  2HVH A;  1PIL A;  3W2V A;  1UJ6 A;  2L9W A;  2QSW A;  3JTO A;  5HL7 Q;  3DN9 A;  6AT1 B;  2ZC4 A;  3NBP B;  2G0C A;  3FQL A;  3SCK E;  1RAD B;  5C24 B;  3UCU P;  1CS4 A;  2VU5 A;  3MI7 X;  4J9K A;  2CZV C;  1X60 A;  2AEM A;  1RTD B;  4W90 B;  1QAY A;  2DIT A;  1ARO P;  5LSL A;  1OYD A;  3GFX A;  4I6Y A;  2IM2 A;  1HNV A;  3CCJ S;  4Y65 A;  2UXD F;  4N47 A;  4EU0 A;  3AOC A;  1UWB B;  1U0S A;  3LA0 A;  1C4C A;  3SSS A;  4E2F B;  3KLG B;  1N34 J;  3HHD A;  2XNQ A;  2IPO B;  4K2X A;  4G1Q B;  2OEK A;  3EJM A;  3H25 A;  1HKA A;  2EI5 A;  2MKI A;  4DQP A;  1FFG B;  1QD1 A;  3A3O B;  2RU3 A;  1HPZ B;  3QT8 A;  4YFU A;  3DFE A;  4RW9 A;  3N4W A;  4OX7 A;  1YWX A;  2DNQ A;  5DJB A;  4YDD B;  4OZ2 A;  2ATC B;  4X2B A;  5DLG A;  2LQ9 A;  1IM6 A;  4CO2 A;  2MHN A;  1S99 A;  4M5D B;  1HWI A;  1XER A;  1OSD A;  1L3U A;  2KFZ A;  5C42 B;  4OHZ A;  2HQI A;  3V6J A;  4USH A;  3BYP A;  3TEG A;  3EVO A;  2ZKU A;  3CJK B;  1U7L A;  3LAN A;  4DV0 J;  1KRP A;  4NA2 A;  1RWO B;  1ZH5 A;  3MMA A;  4IH6 A;  1JLG A;  2Z4P A;  1BE4 A;  2J5A A;  3QLH B;  1NCL A;  5HAO A;  3O6Q A;  4RBT A;  4OX9 F;  4WK3 A;  1GT8 A;  2ZBI A;  2H1Y A;  5L39 A;  3HP6 A;  4B3O A;  2KG0 A;  1N5Y A;  4JI2 J;  5KFR A;  3CGI A;  5CQG A;  2LU1 A;  1YKW A;  2KM8 C;  1WUU A;  4C8K A;  4ID8 A;  4X64 J;  2KJV A;  5T7L B;  2R8H A;  1PBU A;  4C0B A;  8AT1 B;  1RIS A;  1WC6 A;  5A0Y B;  1L3K A;  2DHG A;  1U49 A;  4ZIV A;  2G13 A;  3US5 A;  3FEY B;  5KOW A;  3PR4 A;  4FYD A;  4CTA B;  1HMV A;  2V4J B;  1RAF B;  1ZZF A;  4F2R A;  2W25 A;  5KG7 A;  5LOQ A;  2XY5 A;  1Q8L A;  4HTI A;  4MT1 A;  2ZKT A;  3W9I A;  4CLU A;  4K4T A;  4H4O A;  3I5B A;  3A3P B;  3VR1 A;  2V8H A;  3WZ0 A;  1ZS6 A;  5FD1 A;  1SL1 A;  3B54 A;  2RRB A;  1SVD A;  1RT3 B;  4DMZ A;  2D9O A;  2N4C A;  2B7C B;  5HQ8 A;  3JAM Y;  4C3M A;  1D1U A;  4JI7 J;  1JLB A;  4K4X A;  1G3O A;  4F3O A;  4AFF A;  2IDL A;  3I56 S;  1V3R A;  2DHH A;  2VJU A;  4MK8 A;  3ITH B;  1G7C B;  2EFQ A;  3ONQ A;  3UD5 A;  2R7U A;  5HQL A;  1RHU B;  2SXL A;  1MML A;  2DGV A;  2DNG A;  3BR8 A;  1T9W A;  4RUA A;  3DRR B;  3C6U A;  4YB6 A;  1JLC A;  2OFH X;  4ZPV R;  1UET A;  3W66 A;  3NXZ A;  3SV4 A;  2D3Z A;  2HIY A;  3CJ3 A;  2MKY A;  1TKT A;  2DXF A;  4X4S A;  1H2T Z;  2CQC A;  3PR5 B;  1AW0 A;  3NL0 A;  1DQA A;  2XZT B;  5KT5 A;  2ZOM A;  1M5O C;  1PYO B;  5I4M A;  3PYF A;  3P4U B;  3DLK A;  1QE1 A;  5AE1 A;  5K14 B;  3NS5 A;  2BAN A;  2IDE A;  5KT2 A;  1XEZ A;  5KFG A;  4MK7 A;  1FKP A;  4RO0 A;  5FDL B;  1EAY C;  1FFS B;  2HAF A;  2Z57 B;  4QIV A;  2FLN A;  1N32 J;  1MWQ A;  1FK9 A;  3G87 A;  3IS9 A;  1WF0 A;  2Z58 B;  2LQ8 A;  3KLE B;  1FNX H;  4OI6 A;  3FKB A;  3LP2 B;  3UN2 A;  1SPB P;  1V5V A;  1S1V B;  2B56 A;  4M95 A;  3DOK B;  2VJV A;  3QO9 B;  2Y9H A;  1DY3 A;  3BSC A;  3MCM A;  3R8Y A;  2BMB A;  1ZYQ A;  3BGO P;  4XO0 A;  2EXU A;  5BYS A;  1HBN A;  2ZH2 A;  1XMQ F;  1QM9 A;  4Y2M A;  1S49 A;  2VF3 A;  4O3R A;  2KRR A;  2XMJ A;  3G8S A;  3D4J A;  4DV3 F;  4K4W A;  2BRK A;  2HNY B;  1T11 A;  5DG9 A;  1SB6 A;  1HNI B;  1RK8 A;  3PY8 A;  2HVD A;  1K1Q A;  2OO4 A;  1TFY A;  1M5H A;  3ULH A;  1RT4 B;  4ZN1 A;  1WKK A;  4DL2 A;  3CPW R;  4Q7A A;  3KNA A;  2E5J A;  1N33 F;  2X3D A;  4G65 A;  2K8G A;  4JI5 F;  2LCW A;  1TUG B;  5J2M B;  4JUZ A;  3NY0 A;  1U8W A;  2LA6 A;  4LQ3 A;  1M5K C;  4OQJ A;  3BDP A;  5D4P A;  2DT9 A;  1YZ7 A;  3NGR A;  3ZTQ A;  4EI2 A;  2JZ5 A;  2QL5 B;  3TZX A;  2DR5 A;  1KQS R;  1AUS L;  1MRO A;  4DLE A;  1TL5 A;  4PWD B;  1N5Q A;  2OMO A;  5D4O A;  2CPE A;  2J0Q D;  4WXO A;  2DHA A;  3M1V B;  1CUL B;  1REV B;  1GMV A;  1H7W A;  2E9Z A;  2F1F A;  3CSK A;  4NXN F;  4Q2L A;  2O67 A;  4IR1 A;  4BS2 A;  2I5J B;  3CC2 S;  4JI0 F;  2ZC3 A;  4C0H A;  2APO A;  4ITS A;  2K3I A;  2ZNY A;  4PWU A;  2DGT A;  3RB0 A;  2XZD B;  2NXN A;  3CF5 Q;  2WVE A;  3T3F A;  2PA3 A;  1WDT A;  2YQ1 A;  1S1T A;  3POT A;  4KB7 A;  2AW0 A;  3M6W A;  2MKC A;  5IV3 A;  5CZV A;  1W26 A;  2EPI A;  5KFZ A;  1RSC A;  2N82 B;  1SC6 A;  5HMY A;  2HQC A;  3MHY A;  2KB2 A;  4KTQ A;  3T1Y F;  3QNW B;  2MQ8 A;  4GVL A;  3VAG A;  1LFP A;  3KJN B;  1FD8 A;  2BW2 A;  2HK2 A;  4IFY A;  1OYE A;  3H40 A;  2KFN A;  1RBL A;  4WKY A;  3KMQ A;  5IXU A;  5IOL A;  3UN5 A;  3UWT A;  3CTR A;  2HWI A;  1PAU B;  5DO2 A;  4R8U B;  4DSE A;  3VWS A;  3IN5 A;  5SZT A;  2C3U A;  4WWS A;  3WIU A;  3E51 A;  1P1L A;  2CQB A;  4JV0 A;  2EVZ A;  3NCR A;  3MFI A;  1TK5 A;  2E9T A;  1H2V Z;  2GQQ A;  1WOO A;  2HBZ B;  4K0K F;  3OR1 A;  5L1K A;  1TKZ B;  3VGV A;  1V6H A;  2M2B A;  4AE5 A;  3BPD A;  5DM6 Q;  2V9W A;  2WB1 D;  1IM4 A;  1J5O B;  3RBX A;  1GH8 A;  5KG6 A;  2VB6 A;  1IKV B;  4HL9 A;  3VGT A;  2VOD A;  1Q8I A;  1U45 A;  4ZP7 A;  1HR0 F;  1IBK F;  2WON A;  4DV2 F;  2VOP A;  5L1L A;  1FEH A;  2MYF A;  2O01 C;  2R8I A;  4IUF A;  2F3J A;  1T3N A;  4DV3 J;  3QFH A;  1XC9 A;  3ZZU A;  3FVY A;  2IJR A;  5D3G B;  1APS A;  4G1P A;  3Q86 A;  2XMV A;  4F02 A;  4PAA A;  2F4V F;  1RHJ B;  3KKF A;  3RYL A;  3OL7 A;  1S6O A;  3TA0 A;  1FHT A;  2YKA A;  3QRQ A;  3HZE A;  2IC3 A;  2H5I B;  4OZ1 A;  3CJR A;  1YBU A;  2XLI A;  4QZV B;  2ZJP Q;  3HJF A;  2YXL A;  3FCW A;  3KLF A;  2R7S A;  3NAI A;  3PJ9 A;  5G0R B;  1KTV A;  4KRW A;  1N33 J;  2MLY A;  4HEA 9;  4JI5 J;  3MR3 A;  2PC6 A;  2IVM A;  4NLV A;  1N0V C;  4L73 A;  3G6X A;  4HI2 A;  3G82 A;  2AJ4 A;  3Q8U A;  2HZV A;  3UVJ A;  4RNN A;  2Y1I A;  5L9X A;  4IH5 A;  2K1R A;  3GLJ A;  3C46 A;  2EK1 A;  3FEX B;  4CO1 A;  4TYB A;  4A8X A;  2ASY A;  1FWK A;  3HJV A;  4NLP A;  2CQ2 A;  4OYI A;  1NDP A;  1RT7 A;  4TU8 A;  2V68 A;  4NXN J;  4FYY B;  3U7J A;  2DPI A;  3KG0 A;  1S79 A;  1NLK L;  1XK8 A;  2A6M A;  2HK3 A;  5KG2 A;  2U1A A;  4AD6 A;  3D3B J;  3G86 A;  3OBI A;  3GIR A;  1U02 A;  3GU0 A;  4USJ C;  1URN A;  1VK3 A;  4N8O A;  2E5L F;  2DRD A;  3MEG A;  3AA9 A;  3MWB A;  3W8G A;  3MR6 A;  3NAH A;  1TL1 B;  5HAN A;  4ZJO A;  2CJY B;  2RE1 A;  2JFK A;  2NLW A;  2VA3 A;  5ETN A;  1CQM A;  2QFJ A;  1EET B;  4J9U E;  3UNG C;  2HZA A;  3LTO A;  2K3K A;  4ECS A;  3C15 B;  2ACY A;  5ETV A;  3MMC B;  1R0A A;  1RYR A;  1Z2L A;  1JLA A;  2AEF A;  1DTT A;  4JV5 F;  2HBR B;  2ABY A;  3CD6 S;  4NMX A;  1EZZ B;  4P2X A;  4ZVE A;  4TU9 A;  3P96 A;  1CJV A;  3H0P A;  4X4U A;  3NNH A;  2I0X A;  4K4U A;  2JSX A;  4M63 A;  2XI2 A;  2QA1 A;  4HDG A;  4H54 A;  3DLB A;  1JLE A;  4CWB A;  1U1O A;  3W9H A;  1OJ4 A;  4LIW A;  2CPJ A;  2BA9 A;  4JI6 J;  2JFD A;  1PIE A;  1WOS A;  1M90 T;  1BQN A;  4ICL A;  1N88 A;  4DXL A;  1GEH A;  4WTY A;  2XSJ B;  2FZK B;  2WBR A;  3R5G A;  3TAM A;  1WSV A;  2VD3 A;  3DGP B;  2UVW A;  1RT6 B;  2KYZ A;  2V67 A;  2HAI A;  2AIR B;  1MN9 A;  2ZH1 A;  4PG5 A;  4K59 A;  3CCV S;  2QMX A;  1HR0 J;  1IBK J;  3EDQ B;  4DV2 J;  3QZ7 A;  2AF6 A;  4I64 A;  5HN0 A;  2VKZ G;  1TV6 A;  4YDX A;  3EXY A;  5DS7 A;  2L3M A;  1LWF B;  5KFJ A;  5EUH A;  2YKN B;  2WZ1 A;  1U1M A;  5GAE I;  5CZX A;  5C7P A;  2F4V J;  1LFW A;  2ZJR Q;  3MEE B;  1IKW A;  2Z2Z A;  4WII A;  2YWH A;  3FJ2 A;  1VJW A;  1UVN A;  4M5L A;  5HP1 B;  3QYY A;  1R0C B;  4ECZ A;  2YPZ A;  1Q16 B;  2AZ1 A;  4BWM A;  2FJV A;  2PMH A;  3M4X A;  5T41 A;  1WTF A;  2VDH A;  2VFV A;  2AJ2 A;  2C2N A;  2WHO A;  2CPI A;  1QDU B;  4RW6 B;  4EBC A;  1J27 A;  3ZTS A;  2LYV A;  4ZLP A;  4M5G A;  1HBM A;  5KAK A;  1RBA A;  3D1Q A;  3U1M A;  1KQG B;  4DR1 F;  1KQF B;  4PUO A;  4RL1 A;  3QGP A;  4AXJ A;  3GTY X;  3R9L A;  2B9W A;  3GII A;  1T7P A;  1LQ9 A;  4DUY F;  3VV2 B;  2RUS A;  4KYZ A;  1TVR B;  5C2C A;  2VL1 A;  1HWJ A;  4LR8 A;  4F26 A;  2GIR A;  4HAC B;  4NLT A;  2PA8 D;  2HRT A;  1KLM A;  1M1H A;  2LU2 A;  1E6V B;  2C2Z B;  2KN4 A;  2UVR A;  2E5L J;  2D41 A;  1NK0 A;  1Y11 A;  5DDO C;  2BJE A;  1F9E B;  2ZH6 A;  1CJT A;  4IFV B;  4GKJ J;  4DV4 F;  2O66 A;  2YQ0 A;  1NK4 A;  2HS3 A;  4I7F A;  3M32 A;  4L72 B;  3HVT B;  3ELH A;  3W3S A;  4PG4 A;  3VHQ A;  4O44 B;  2OPR B;  3BR9 A;  4F0M A;  4KFB B;  1RHK B;  1X5T A;  1RHR B;  3KK3 B;  2LEP A;  3QSY B;  4WKR A;  3S8S A;  2DR8 A;  4YY3 F;  3MPD A;  4JV5 J;  2M0G B;  3NOC A;  3D0H E;  2CRL A;  3BBB A;  3KYL A;  3P8B B;  1SBR A;  4ILM A;  3ILI A;  2MQN A;  3N9U C;  3PJX A;  2NXE A;  5DLF A;  3M6V A;  3UN3 A;  3RRG A;  2VPY B;  1AUD A;  4ZN3 A;  4UUX A;  5D8H B;  4EO6 A;  2AWZ A;  3ZZR A;  3GMG A;  1NU4 A;  4I2P A;  5IFM A;  1OY6 A;  1N54 B;  3HHE A;  4CT8 A;  1F9F A;  3AXM A;  3EUN A;  4NML A;  1U0H A;  4C9D A;  2BYC A;  2HNZ A;  2XI3 A;  2MB0 B;  4I6A A;  5GAH U;  3IM8 A;  4U8Y A;  1CPZ A;  3I6P A;  2HHH F;  1IKX B;  1R8P A;  2Q79 A;  1FRM A;  1HQU B;  2ZD1 B;  5IZH A;  1LV5 A;  1IWA A;  2HRY A;  2GAH C;  2UXB F;  4LF1 A;  3NGS A;  3F0N A;  3CJ4 A;  3FNN A;  4MFB B;  2R7W A;  1RT5 B;  4B02 A;  5B0C A;  3CCQ S;  4DG1 A;  3SXL A;  1Z4U A;  4FKY A;  2BAC A;  4OHW A;  2H4Y B;  3K7R A;  4DU7 A;  1RJJ A;  4ED4 A;  1KON A;  3DOL A;  2HIQ A;  2P6S A;  1SQG A;  1KWM A;  3PW4 A;  3OV7 A;  1VQ5 S;  2V6A A;  4L6V 3;  3LAM A;  4MIA A;  3UQS A;  1Q95 G;  2LKZ A;  2D3O R;  4R5P B;  4DZ6 A;  1AZS B;  2R2T A;  3AAW B;  4BCA A;  1LWX A;  2DBB A;  1KDN A;  4B08 A;  4RX6 A;  5KFS A;  4R25 A;  1JB0 C;  5I42 A;  1Q7L B;  2DNN A;  4F4Y A;  4Q45 A;  1YRX A;  2WB4 A;  1VQ8 S;  3W5X A;  3R2D J;  1XIQ A;  3UCZ P;  3FBE A;  5C5J A;  3V6D A;  4H4K A;  2QL7 B;  2RAQ A;  2HUR A;  2V2K A;  4F25 A;  3GJT B;  3H5Y A;  3H5S A;  1UZH A;  2BE2 B;  1BXN A;  4R0J A;  1F6T A;  3Q23 A;  4MKB A;  3R7S B;  5LT5 A;  1FF2 A;  2HLU A;  2PT0 A;  5LXR A;  3NBP A;  1B99 A;  1S0N A;  2QLW A;  2BE7 D;  1KN6 A;  1OPZ A;  3NG8 A;  1VQP S;  3CO0 P;  4RNO A;  4DUY J;  2DH8 A;  1SC3 B;  2OPS B;  4KPC A;  3IC1 A;  1S76 D;  4ECY A;  4A8W A;  1S97 A;  3RB3 A;  3C66 A;  3CJ2 A;  4ES1 A;  4KC5 A;  4NCA A;  1YGY A;  1UWB A;  3D0G E;  3PO5 A;  3DYA A;  3VVT A;  1Y3J A;  4RPF A;  4NZ7 A;  1Y3K A;  3MEC A;  1NDC A;  1X31 C;  3KLG A;  4WXW A;  1NJZ A;  2DPJ A;  4PPZ A;  3KNG A;  4OYW A;  2E1R A;  2AJF E;  1QTM A;  1R89 A;  3TQE A;  4DV4 J;  5DGB A;  1JXL A;  3UFC X;  4I56 A;  3X1L B;  2PFD A;  2VV5 A;  3UD4 P;  3BGR B;  3LOU A;  3SFU A;  4PG6 A;  4PZV A;  4ES3 A;  2BQ3 A;  1TK8 A;  4NL5 A;  3TJA A;  2Z2M A;  3PCO B;  3H2U B;  1C1B B;  3LF0 A;  4YY3 J;  4CDI A;  4M5D A;  2OTJ S;  4ZVQ B;  3UR3 C;  1RCO B;  3ZZY A;  4OYZ A;  2NZ4 A;  1HYS B;  3GYG A;  2W4C A;  3IO1 A;  4H4M A;  2GS8 A;  5EX3 A;  2RKI A;  2LFV A;  3Q8R B;  4UOG A;  4IO9 Q;  2GMJ A;  2L9D A;  2P6T A;  1RAB B;  1XBW A;  4QWA A;  1RA7 A;  2LEA A;  4RNH A;  2FLL A;  3OFE A;  4LSZ B;  1GXT A;  1OY8 A;  1UKU A;  1YI2 S;  2ZWP A;  1P1T A;  1DJ0 A;  3EWG A;  3DDI A;  2MZS A;  2YWG A;  4O4R A;  2M52 A;  2HHH J;  1BY9 A;  4LFA J;  1DUR A;  4DX6 A;  1TTH B;  3OQ2 A;  3MM7 B;  4EYI B;  2CXE A;  1NSA A;  4JI1 F;  3HLU A;  1RTJ A;  1T95 A;  4RR5 A;  1GX5 A;  4GKK F;  4K4Y A;  5GAD I;  3BQ0 A;  3SBM A;  2ZZT A;  1RWV B;  4L3N A;  2LDI A;  4CTA A;  4WFA Q;  4IRK A;  2V4J A;  1ZA1 B;  2OML A;  1WF2 A;  5A76 A;  4P2F A;  1XTZ A;  3J7Y I;  3FFI B;  4K5R A;  3EE3 A;  2MQM A;  2D7S A;  4RW4 B;  3D9B A;  1S9E A;  2J9D E;  4CO0 A;  1LXJ A;  4Z37 A;  4JI4 F;  3TUI C;  3K0J A;  3HVW A;  2BJ1 A;  1RT2 A;  3G8Q A;  1RT3 A;  2G1D A;  4USU A;  3MR7 A;  3M05 A;  4M5K A;  3NMR A;  2FJE B;  4USK A;  1LWE A;  2E29 A;  3KK2 B;  4IQM A;  5ETL A;  3P49 B;  4ZPT R;  5M2R A;  2GML A;  4AXI A;  3I32 A;  2KI2 A;  3CJ8 A;  5ETR A;  3L7O A;  2ZOF A;  4RBV A;  1HNX F;  1N36 J;  2H48 B;  4CT9 A;  5CA5 A;  3HD2 A;  3KUH A;  1F2G A;  2M5Y A;  1RTH B;  2FB0 A;  4PXB A;  3OTO F;  4ED3 A;  5DG8 A;  2WAQ D;  3MAA A;  4EFA C;  4J9S A;  4WFY A;  5J2N B;  1H7X A;  1VI7 A;  1SC4 B;  1XJW B;  3G9C A;  5FLX U;  4QCL A;  4GC7 A;  2UUB F;  3NKY A;  2XBP A;  3C6T B;  3TYT A;  1NRK A;  4ILL A;  5D78 A;  3ZO7 A;  4V1A k;  2XO7 A;  1QAJ A;  4ZVT B;  3PJW A;  4K7Q A;  5K14 A;  1X4F A;  3CUN A;  2HVE A;  1IQZ A;  4QBU A;  1TP7 A;  1U6B A;  3PX0 A;  2AU0 A;  3R5D A;  1OPI A;  5FDL A;  5EHH A;  2EK6 A;  1IR1 A;  1UP1 A;  2ZBR A;  2L41 A;  3RRH A;  4LBI A;  5GAG I;  5F0U A;  2ZDP A;  2ZVI A;  3LP0 B;  3EZU A;  4DR2 F;  5F9L A;  3KJV A;  2LXU A;  4U9R A;  5BXI A;  2W9C B;  3L09 A;  4DV6 J;  2AV5 A;  1YSJ A;  1TKX A;  1T03 B;  1T3O A;  4HT5 A;  3KTQ A;  3B78 A;  3LP2 A;  2ZDO A;  2MST A;  4TKT A;  2CYY A;  2R2R A;  2F9D A;  1GXU A;  3FUY A;  4DJB A;  3M2R A;  2YPY A;  1SV5 A;  1SJF A;  4NLO A;  3DCA A;  5CHC B;  1T9V A;  4ATN A;  2FDN A;  2QA2 A;  3M8P A;  4E0D A;  3AT1 B;  5G4D A;  2UV8 A;  4IG3 A;  3CME S;  1IBC B;  1REG X;  4N7T A;  1SC1 B;  3VGS A;  3V4I B;  2HNY A;  3RAQ A;  4G1I A;  2L48 A;  2EC0 A;  1SJ3 P;  1PJ7 A;  4OJ3 A;  4KBI A;  1YJV A;  2V2Z A;  1H6K X;  2XWX A;  3R7B B;  4X66 J;  2E9R X;  1VRU B;  2YX1 A;  2KXF A;  1AYE A;  3LW5 C;  3MZI A;  5FJ4 A;  1IKY A;  3G6V A;  3GON A;  1QY7 A;  4GMK A;  2R2S A;  2IBO A;  2GO9 A;  2HHW A;  3SSR A;  2UUC F;  4CLS A;  3J81 j;  4JI1 J;  1H72 C;  4B17 A;  2LLZ A;  1RI7 A;  1AFJ A;  1WHY A;  5L9N A;  4YR2 A;  3HVA A;  2V5H G;  3W65 A;  1SKU B;  3IRX A;  4OHV A;  1TZ0 A;  5GVQ A;  4RUH A;  3TAP A;  1RAE B;  2VH7 A;  4Y3C A;  5F8H A;  1FO1 A;  4PWD A;  1GNK A;  3T5H A;  2B9E A;  1IXK A;  2OPQ B;  3TAR A;  2P9E A;  3M1V A;  1FXR A;  5HMW A;  2IMW P;  2ZOG A;  4JI8 F;  2MKJ A;  4JI4 J;  1MNE A;  5KG3 A;  1PGZ A;  3OR2 B;  5BYR A;  4CH0 S;  5J1E B;  1RTI B;  2AX1 A;  1VHF A;  1EQM A;  1U1P A;  1YBT A;  1GQE A;  3MUT P;  4ECW A;  1X4A A;  5KFI A;  2B0G A;  1UW4 A;  1SKW A;  2DEI A;  3M8Z A;  1U6Z A;  2XY7 A;  3PW2 A;  4NEZ A;  2K7K A;  2O3D A;  3BQ2 A;  1B64 A;  5KFH A;  3Q8Q B;  2ZFH A;  4LBH A;  3MOZ A;  1A6L A;  3HK2 A;  2V9K A;  2Y0S D;  4LF4 J;  1JLF B;  2FHM A;  1YIJ S;  5HRO A;  3SFG A;  3QRP A;  2OIH A;  4N8N A;  5KFO A;  2ATL A;  3OL8 A;  2R7T A;  1T94 A;  6FDR A;  5J1N A;  3M8Y A;  4J9R A;  3DNC A;  1D9D A;  5IT9 Y;  5SUH A;  3DI6 B;  4U8V A;  3H4D A;  2MEW A;  1YZ6 A;  1NND A;  2RRN A;  5F8M A;  2EFN A;  1Q5V A;  2DGQ A;  1BUX A;  3M6X A;  4I68 A;  4R8U A;  4OHX A;  3AOA A;  4ZPA A;  4B9N A;  1UVJ A;  3VGU A;  1U09 A;  1ZM9 A;  1YRT A;  2QYC A;  4NLQ A;  1BC6 A;  4UT4 A;  3ET6 A;  1WC1 A;  3RBZ A;  3TA2 A;  2GZO A;  2WOM B;  3EVM A;  3ENA A;  4URS A;  3T6B A;  4ZIW A;  3EYZ A;  1J5O A;  1JX4 A;  4ID5 A;  2J7W A;  5CH7 B;  1XR5 A;  3TVY A;  1SKR A;  4O0N A;  4WCE Q;  2WTF A;  2AHO B;  1X4E A;  2XLJ A;  3WC2 A;  1TEL A;  1JXV A;  1VQM S;  4U7U D;  2JC1 A;  5J2P B;  2G4B A;  4FXW A;  4YN3 B;  5I3U A;  3OVS A;  1IJF B;  3A13 A;  4CZC A;  1TUW A;  4ZJQ A;  3QJP A;  4X62 F;  4F3M A;  3BN4 A;  4WP3 A;  4B9M A;  3G8T A;  1VRT B;  4ZLL A;  3BV8 A;  4JYA F;  2HZC A;  1A7G E;  5D4L A;  2DJW A;  4LJM A;  4QIW D;  2V4R A;  2JH3 A;  4L75 A;  1YRU A;  2AGQ A;  2FLO A;  4V19 J;  2DH9 A;  2PEH A;  3ZTO A;  1A0O B;  1SKS A;  3ETM A;  3H8Y A;  1IUJ A;  4DR3 F;  2UUC J;  2MSS A;  1RT1 A;  1S48 A;  2FVP A;  3W7B A;  4DV5 J;  3A8K A;  5KOX A;  4DV7 F;  2A10 A;  1C0U B;  3K59 A;  2VQF F;  2E66 A;  1TL3 A;  3W60 A;  2HRU A;  1UPM B;  2W24 A;  3KK1 B;  1C2P A;  4NWB A;  3KDN A;  1VBY A;  1S1W B;  4UOH A;  1S1U B;  4ZVR B;  3MUR P;  4Q0B B;  1R8C A;  4JI8 J;  3W2W A;  3JSB A;  3ISN D;  1QVG R;  1TU0 B;  2CPX A;  2XSF A;  1RWN B;  2E5H A;  4OJ1 A;  1CBK A;  4C2M A;  1KHV A;  4OIX A;  5ETO A;  1TKD A;  2JWN A;  4NCG A;  5KFT A;  4W92 B;  1YX2 A;  2CFX A;  4LFB F;  4Q5V A;  2KRB A;  1K0T A;  2VQE F;  4EZ9 A;  4KPY A;  4TYA A;  4DFM A;  4NRT A;  3TR5 A;  1I1G A;  3O3L A;  4QYR A;  2A1B A;  2QRR A;  1TL1 A;  1ZTW A;  2XO6 A;  1RWX B;  3V5R A;  2CAD A;  3JSM B;  4P72 A;  2P2C B;  4FNH A;  1E6Y B;  5MLC V;  1ZTT A;  2J9E A;  4LSN A;  2GJ2 A;  4YR0 A;  1EET A;  1U1Q A;  3K57 A;  4KR0 B;  3IAM 9;  4YHH F;  4RW8 A;  3C15 A;  3BS9 A;  3UO0 A;  3LWM A;  5I3P A;  3MMC A;  4PQU B;  1TMM A;  1ELO A;  3KFW X;  2Z8Q A;  1VQK S;  4JB8 B;  3U02 A;  2EFV A;  3VAI A;  3RG6 A;  3NCQ A;  4RU9 A;  3PX6 A;  3R5B A;  3EZ5 A;  1EIY B;  2GNK A;  2R7V A;  2WCX A;  5KFN A;  1CJK A;  4ZVF A;  5EWG A;  1UA1 A;  4M5H A;  3GPA A;  3KXD A;  3HHN B;  3IBC B;  4DUZ J;  4O4G B;  1FDD A;  4LVN P;  3C8Y A;  2CPD A;  3BSN A;  4F36 A;  1K8A T;  2N7C A;  2XNR A;  1SQE A;  1NJW A;  3AB4 B;  4M94 A;  2GV1 A;  1Y5I B;  4RBU A;  2GC8 A;  4DSI A;  2BJ3 A;  4WZQ A;  2Z30 B;  2XGQ A;  1RT6 A;  1MWY A;  4E8U A;  1HWU A;  4OZ5 A;  5A8R B;  4J91 A;  2V69 A;  1J2V A;  1S0O A;  5L8R C;  3AJ2 A;  3DOM B;  4P2S A;  4M1K A;  3N79 A;  4QPX A;  1D8Y A;  4DUT A;  3HSJ A;  5CAB A;  5IC4 B;  1LWF A;  3J7Z T;  1AA1 B;  1FER A;  2IYI A;  1F0X A;  2RML A;  2YKN A;  4P7V A;  2HQF A;  1L3S A;  4X62 J;  3QIP A;  2N4D A;  3PX4 A;  2MJU A;  3HXM A;  2I9S A;  3IMQ J;  2GGP B;  1CQN A;  1X5S A;  2F8M A;  4J9O A;  5CYQ B;  1B70 B;  1HNZ F;  2FVQ A;  1B0P A;  2KL8 A;  4DSL A;  3NGT A;  3GIM A;  3E01 B;  1JNZ B;  2GVD A;  2OD6 A;  4ZP6 A;  1WG4 A;  4J9Q A;  2A6O A;  4IH7 A;  5I3Q A;  2DHS A;  5JVG Q;  3M2V B;  1X4B A;  5LJ5 Y;  4DR3 J;  2Q6C A;  4HKQ A;  2F8E X;  4M8L A;  4G3I A;  4DV7 J;  1ACM B;  5HK4 A;  1MWZ A;  3FRY A;  1YBA A;  1TR0 A;  3NWR A;  2OFG X;  3KLI B;  3OSP A;  4B9U A;  5GME A;  2VQF J;  5EWF A;  3T1H F;  4ECX A;  3K8V A;  5L38 A;  1N6Q B;  1SXL A;  4LF2 A;  3IP0 A;  3HZG A;  4CM2 A;  4FXV A;  1IBM J;  2IMO A;  2WSC C;  5CD4 H;  4ZP9 A;  3T6J A;  2J9D A;  3VZH A;  1WNE A;  1TVR A;  3TOQ A;  3QJL A;  2IM1 A;  1UFW A;  1S77 D;  3SQO P;  4G6V B;  3CCW A;  4AUK A;  1PKU A;  3GYX B;  1FFW B;  3UCG A;  4OMF G;  2QT7 A;  3GIJ A;  2G2O A;  5IWA J;  4NRU A;  4YME A;  2VQE J;  3CB4 A;  3PV8 A;  2ZHO A;  4ZVP B;  3WC0 A;  1Y7P A;  2XZW A;  3RW6 A;  2VBX A;  2RIJ A;  4CRJ A;  1FES A;  4B9L A;  2HQD A;  3HF5 A;  1NDL A;  4QU7 A;  1AB8 A;  3RR8 A;  2HND B;  3PM9 A;  2XS7 A;  4KHM A;  1GX6 A;  1WC5 A;  5HQM A;  1C1C B;  3FBC A;  1HBU B;  3DLG A;  3CJ5 A;  1Q82 T;  1FRL A;  2UZA A;  3CJT A;  1Y0H A;  2OPR A;  1D8Z A;  4YHH J;  1RAJ A;  3IFE A;  2QYG A;  1Q0N A;  4KFB A;  3KK3 A;  3U1L A;  2V8P A;  5AE3 A;  5B0G A;  4IQX A;  2RB7 A;  1TQL A;  5FLX Y;  1G6B A;  3OJU A;  1J5E F;  3CO9 A;  2AMC B;  2XS5 A;  2UU9 F;  4DHV A;  4FS2 A;  2FVR A;  2MTL A;  1UEK A;  2HFZ A;  4ECT A;  1WC3 A;  2LXF A;  3PKM A;  2R7Q A;  1WC0 A;  2ZM6 F;  1U2R A;  3JSY A;  3RU0 A;  4UW2 A;  3OVA A;  5AXL A;  1WOP A;  1X7V A;  1FX2 A;  3Q2T C;  1KBR A;  3Q8P B;  3MUM P;  1HQU A;  1VHI A;  2ZD1 A;  3V6H A;  4RW9 B;  2W8K A;  4PXC A;  1QSL A;  4AYB D;  4RWX A;  4Y0F A;  1QUV A;  4MFB A;  4FP9 A;  3CJS A;  3IWN C;  3OTE A;  3Q8S B;  3BRE A;  1WHV A;  3L95 X;  3PYE A;  1UVL A;  4AQY J;  4LSL A;  2WSE C;  4TVA B;  4MTP A;  2FJW A;  1YHQ S;  2N3L A;  2JLF A;  1Q86 T;  3MMA B;  2GVZ B;  1AZS A;  5HLF A;  1BLU A;  3G2X A;  3PHE A;  3IR7 B;  2NXC A;  2CJX B;  1VC0 A;  2MQQ A;  4OZJ A;  2RS8 A;  2ILY A;  4QWB A;  4K50 A;  4B3O B;  4OL8 A;  1N5Y B;  1KP6 A;  4IRC A;  3O1L A;  3QRR A;  2AEJ A;  4QWD A;  2DYA A;  4TY8 A;  3HFZ B;  4DQI A;  3MM9 A;  4DPT A;  1VQO S;  3ZZT A;  2XMT A;  3EXC X;  2AGO A;  2BE2 A;  1CEZ A;  1NUE A;  1R8B A;  2HGN A;  2C3M A;  4BBY A;  3T1H J;  5IM0 B;  2E1M C;  1D9A A;  4GO5 X;  3IG1 B;  3T9Z A;  1QTN B;  4DI6 A;  1NZ8 A;  2XY6 A;  4LRA A;  3CCS S;  1JIH A;  3PAC A;  4F67 A;  3H90 A;  1Q7Y T;  3GWC A;  3DRP B;  2VAS A;  1YJR A;  2DXD A;  1SJQ A;  1WI6 A;  3W62 A;  4XTT A;  2CQ0 A;  2JHE A;  1C4A A;  3RAX A;  1VYA A;  2WVC A;  5MAO A;  2KJW A;  5HBM A;  2M4M A;  4KHR A;  3FSI A;  3M9M B;  2IY5 B;  1VQS A;  4N76 A;  5IV4 A;  2DNZ A;  1XNR F;  1G4C A;  2ILZ A;  2AJ1 A;  4CLY A;  2HPU A;  2MZ1 A;  1SCJ B;  2JJ4 D;  1H73 A;  3GSI A;  4ZCI A;  2YTC A;  1TL4 A;  2RH3 A;  5F0W A;  2LEC A;  2OGU A;  2YKO A;  2OTL S;  2OEL A;  4ZVO B;  2QTW A;  2B4P A;  1NSK L;  1PC4 A;  4IOA Q;  4YQW A;  3C6U B;  4TN2 A;  3M7V A;  4NEY A;  1C1B A;  2CPH A;  1V3Z A;  4RNF A;  2VG5 A;  1UA0 A;  2KG1 A;  3UNY A;  1TKT B;  2W2P P;  3V2U C;  4HDH A;  5KFQ A;  2VG7 A;  1J5E J;  4IDK B;  4LRC A;  1EX8 A;  1VIS A;  2UU9 J;  3BKT A;  2QJ3 A;  3OTB A;  5E33 A;  1QE1 B;  3CCZ A;  4E98 A;  3EDR B;  1G2E A;  2ZM6 J;  4OV1 A;  2HFU A;  3AQP A;  1IBL F;  4UY8 5;  1FKP B;  1XN9 A;  2UVV A;  4N5S A;  1QVF R;  1R7I A;  4MKV A;  2R8J A;  3PFO A;  1FVQ A;  4USM A;  2H4W B;  2OLW A;  4IKA A;  1ZBT A;  1YJT A;  3IS9 B;  1IR2 A;  3QAT A;  3I0R A;  3BPS P;  5E3R A;  3MM7 A;  1DRZ A;  1BWV A;  2HKE A;  5E5N A;  3BO4 A;  2E1C A;  4WU2 A;  3AQO A;  5GAE U;  3RB4 A;  1ZM4 A;  2LEB A;  4KO0 A;  1HBN B;  4ELT A;  2DY1 A;  4RW4 A;  1MU2 B;  5J2Q A;  4O3N A;  4LR7 A;  1KTQ A;  4IG0 B;  2W1B A;  1QAX A;  4ECQ A;  3NEK A;  1ZAW A;  3BBF A;  3NNC A;  5HJX A;  3D1H A;  5IS2 A;  2Q43 A;  3GJQ B;  4WFX A;  1T02 A;  2Y1L B;  4CYU A;  3OSN A;  1S4E A;  3KK2 A;  3HUL A;  3OJS A;  3GIK A;  2MKH A;  4R0E A;  4IOC Q;  1SIW B;  2YNG B;  4CH1 A;  1NO8 A;  3BN7 A;  1OS5 A;  4QJV A;  1EJ7 L;  4EGL A;  4LMZ A;  4B3T J;  2KXN B;  1RTH A;  1WG1 A;  3FQK A;  5KT7 A;  5J2N A;  3HHL B;  3FMB A;  5D15 A;  1N8R T;  1PBA A;  3U27 A;  3C6T A;  3R1H A;  3MTK A;  1L3T A;  4PR6 A;  4PPD A;  3CDU A;  2ZBP A;  1N0U A;  4ZVU B;  2QMU B;  3HI9 A;  5C2G A;  2RF2 A;  3MGJ A;  3K17 A;  3NWG A;  2CZ4 A;  3OHA A;  4C8Y A;  1XNR J;  2YWF A;  4X65 F;  2AP6 A;  3I4P A;  4ZCM A;  2OPP A;  4C8M A;  2VG6 A;  4WBF A;  1S1T B;  3POT B;  4A8Q A;  4TQR A;  3UDE A;  2ZH7 A;  1KVK A;  1U48 A;  5ETS A;  4F4Z A;  5E2Q A;  1TAQ A;  1VQL S;  2UXD J;  3OFF A;  4C8N A;  1RAH B;  2HVZ A;  3IM9 A;  2YNH A;  3UPF A;  3H2L A;  1Y4Z B;  4H4K C;  5DM7 Q;  4KGM A;  1LWC B;  3QQC D;  1QSS A;  4L74 A;  4N41 A;  2W4P A;  2DRA A;  2M3D A;  3R5J B;  1OIA A;  5AJ3 F;  4IFY B;  3V4I A;  1VC6 A;  4OYP A;  2QV6 A;  4Z2X A;  3IGN A;  2RQM A;  2F40 A;  3ENW A;  4J9P A;  1FJG F;  3JXO A;  4NYZ A;  5CXT A;  4PXE A;  2FIU A;  1F5C A;  3GSD A;  1S9G B;  2GO8 A;  1S6Q A;  1NPP A;  2RSQ A;  4B3S F;  3AH6 A;  3D6H B;  1XMB A;  3OR1 B;  4Y00 A;  2BJ7 A;  2DNR A;  2GCF A;  5H9E K;  2FHO B;  3DMJ A;  2HGM A;  2CPF A;  1X5O A;  4GVB A;  2J8A A;  2DK2 A;  3NMA A;  1X0P A;  3UE2 A;  1HFE L;  3N28 A;  2WON B;  2RRA A;  2JRS A;  3MED B;  1IVZ A;  1F5B A;  4OX9 J;  2OEJ A;  3CJQ A;  2KT2 A;  4X84 A;  4QYZ K;  3D28 A;  2OPQ A;  1HWL A;  1Q81 T;  3JTN A;  4OI4 A;  5DQI A;  2GHP A;  4DN9 A;  4U95 A;  2ZNZ A;  4UZC A;  3OR2 A;  2UXC F;  5J1E A;  1RTI A;  4LF5 F;  4HVZ A;  1VBX A;  1UMJ A;  5DQH A;  1T0T V;  4CQ1 A;  3CED A;  5HVH A;  1FWP A;  2VHG A;  2OSR A;  1FKA F;  3CIZ A;  2JEG A;  1Q4R A;  3IBF B;  2CVI A;  3JQK A;  1DAX A;  3CE8 A;  2XM3 A;  2ZH8 A;  2YNI A;  2J0X A;  4Q2M A;  5KFF A;  4EWT A;  3DXS X;  3N6M A;  3L3C A;  4K4S A;  3VCD A;  1KQK A;  1NKE A;  3AOB A;  1FWL A;  5K9F A;  2XCA A;  2DR6 A;  2C1E B;  1GTH A;  2F8H A;  1Q5Y A;  3H20 A;  3DDK A;  4XPC A;  4I2Q A;  3UVJ B;  1ROF A;  4P9S A;  1F3V A;  2C2E A;  1PO6 A;  2B5J A;  2A0F B;  1HI1 A;  1UJ4 A;  1FTR A;  1M1K T;  1HQE A;  1Q1K A;  3OFH A;  2BX6 A;  2V94 A;  2HHT A;  5ITH A;  3DI6 A;  1FDB A;  2BVZ A;  4XK8 C;  3GFY A;  3KDO A;  2J8S A;  5F41 A;  5D0R A;  1RT7 B;  4YB1 P;  3HO1 A;  2FVC A;  4UF4 A;  1FE0 A;  5KG1 A;  1FNM A;  4C97 A;  3P5B P;  4ZVH A;  5EGY A;  2RT3 A;  3O5T B;  4MK9 A;  3MEG B;  1T05 A;  2W2N P;  4EBD A;  5LSR A;  3KHG A;  4CLL A;  2CWK A;  3TUP A;  4W98 A;  2CQI A;  3MF5 A;  3TAN A;  2Q1L A;  1K9M T;  4Y2C A;  1R6Y A;  2GQ2 A;  1VBK A;  1HBO B;  2VBY A;  4A8O A;  4LF6 F;  2E7W A;  1UFL A;  4YS2 A;  3VAK A;  2AQ4 A;  1FEE A;  1WEY A;  4TQS A;  2P9G A;  1H0H B;  2EFG A;  3SSQ A;  5J2P A;  3VTI A;  2W9B A;  4RUB A;  3A8E A;  4CCH A;  5AJ3 J;  1DTT B;  3SQG A;  1XMO F;  1K1S A;  3UW1 A;  5E3A A;  3VAF A;  1EP4 A;  2MGZ B;  2BKN A;  4USI A;  2O5D A;  4Y2K A;  4JV2 A;  1LW0 B;  4MIW A;  9ATC B;  2XS2 A;  2QE5 A;  1AFI A;  1R27 B;  1JLE B;  2KT3 A;  5CCM A;  4B3S J;  1WHX A;  1BWE A;  1RYS A;  3DRS A;  2J6T A;  3DM2 A;  4HHJ A;  2EKN A;  2R8K A;  4ICL B;  3TO8 A;  5GAD U;  1FD2 A;  1HD1 A;  2QO3 A;  3TAM B;  4WU3 A;  2Y3Y A;  3DU5 A;  5F3Z A;  1XMQ J;  1CJU A;  3TQ1 A;  3LGH A;  3J7Y U;  4S0M A;  2XC9 A;  2OJ3 A;  4KHP F;  4RUC A;  1C0U A;  3I9V 9;  2EBG A;  4ECU A;  3HD1 A;  2KYX A;  3FGV A;  2OKQ A;  3ENV A;  4C6A A;  3UI3 A;  1EHW A;  2EG2 A;  1HIY A;  4DPX A;  1S1W A;  2J76 E;  4DX7 A;  3TWZ A;  1ZPW X;  1S1U A;  3C14 A;  4DPW A;  2GX8 A;  4F50 A;  5B0A A;  2ZE2 A;  1RP5 A;  2AYM A;  4CLK A;  4QU6 A;  2UXC J;  4CLZ A;  3GG0 A;  4LF5 J;  3AJ1 A;  3LGM A;  3OPK A;  2V8G A;  2V0N A;  1L3V A;  2W7P A;  4A8F A;  2RIL A;  2QA4 S;  5A8K A;  2MZQ A;  1HAR A;  5KG4 A;  2YWK A;  2PDA A;  2AYE A;  5LM7 E;  3CNQ P;  1KR4 A;  3KHH A;  2DHX A;  2PMW A;  1TL7 A;  3IXQ A;  3VQT A;  3TI0 A;  1SL2 A;  2HFN A;  2QL9 B;  2R7O A;  3EIC A;  4NLU A;  3JSM A;  4IRD A;  1RQ0 A;  3D1O A;  4YR3 A;  1HBM B;  3I96 A;  3BB5 A;  3WDO A;  2QX0 A;  1KEK A;  3OL9 A;  3R5C A;  4PUO B;  2W7O A;  4HLB A;  1WF1 A;  3DC2 A;  4PQU A;  3VZI A;  2CUY A;  1ZM3 A;  5J1P A;  2QGF B;  4JI0 J;  2ZHB A;  3Q8Y A;  4Z7C A;  4F4K A;  4FNI A;  4NLY A;  3N6N A;  3M9O B;  1LOU A;  3OTC A;  3S01 A;  3IRW P;  2RQK A;  5GAG U;  1NK8 A;  2JC0 A;  2RNE A;  1KLM B;  4P52 A;  3FMW A;  4X4V A;  4PCQ A;  2DO4 A;  4O4G A;  2GMH A;  3BBC A;  3H98 A;  1N34 F;  2NYH A;  3ZC4 A;  3PXG a;  2VPZ B;  5ADZ A;  4DEZ A;  1VQ6 S;  5IQ6 A;  2UUW A;  1BHN A;  1R8H A;  3F73 A;  2MQL A;  3T1Y J;  5KFC A;  1U8S A;  1DQ8 A;  3M32 B;  4FF4 A;  1VS3 A;  9RUB A;  5KG0 A;  1GTE A;  1LKZ A;  2I8E A;  3GCW P;  2EWH A;  2CDR B;  3VF0 B;  4LF6 J;  2KM8 B;  4DS5 A;  1IQT A;  4LIR A;  4ZOS A;  2C3P A;  4FYW B;  3DOM A;  2FJA B;  2UV8 G;  3OVB A;  5H9E J;  5M2P A;  2QLB B;  3BYR A;  3I4H X;  2GA7 A;  3RW7 A;  2YKQ A;  4OZ3 A;  3WX4 A;  1O6X A;  1PSD A;  1RB0 A;  4LRE A;  1XMO J;  4EK2 A;  4WE1 A;  5E0O A;  1IR0 A;  2FC9 A;  3NLC A;  2WVB A;  4XPE A;  2GJI A;  4K0K J;  4NLD A;  4NXM F;  1EQ0 A;  1XQI A;  3AD7 C;  3RBE A;  4TLQ A;  2B4V A;  2ADB A;  3EZO A;  3R2C J;  1G1X A;  2HEK A;  1NDK A;  3C2P A;  3DRX A;  4KKO B;  5EN1 A;  2V50 A;  2ZIT A;  2EW9 A;  3VAL A;  4QWC A;  3CD0 A;  4F8R A;  3CDW A;  5BJR A;  1R0B G;  3M30 A;  4QIE A;  2WSF C;  4X64 F;  2BW7 A;  2CPY A;  4KHP J;  1JJ2 R;  3QT7 A;  2NUU G;  3TVZ A;  3M8R A;  2BRL A;  1EB0 A;  1K44 A;  3RR7 A;  7FD1 A;  3OD2 A;  1OY9 A;  3I0S A;  2PEB A;  1N6Q A;  2I6W A;  2JVO A;  5KFM A;  2V4Q A;  2HLT A;  4IO1 A;  1SIZ A;  1UFK A;  4DG1 B;  3MR5 A;  1U2C A;  3K5O A;  2BUN A;  4XIU A;  3MM6 B;  1O51 A;  1UL3 A;  5DQG A;  4RU2 A;  5D77 A;  2AYG A;  2B51 A;  2IM3 A;  2VDI A;  4DSF A;  3ILJ A;  4HR2 A;  1KS2 A;  3OXF A;  3MMB A;  3K5N A;  2VFT A;  4P74 A;  5LSO A;  2EKY A;  2MQP A;  3MAQ A;  3IWX A;  4OLO A;  3DLE A;  4CI0 B;  4UOF A;  2ZJQ Q;  4USW A;  4OI1 A;  1HQ2 A;  3FCH A;  5H9F K;  2FVS A;  2XLK A;  4FVM A;  2EFO A;  3PVX A;  1H38 A;  3RZA A;  4ZVS B;  3MXH P;  2HND A;  2K2P A;  3D2W A;  2LVW A;  5IT9 U;  2HWT A;  5AT1 B;  3MM5 B;  1HBU A;  3DLJ A;  2X3G A;  3CCE S;  2A3J A;  1HA1 A;  1B7Y B;  1WEL A;  3R1L A;  3IR5 B;  1RA6 A;  1FRI A;  1N56 A;  2B8Q A;  3PEJ A;  1PCA A;  4P75 A;  3P5T L;  2DR7 A;  4P10 A;  1FA0 A;  4KJI A;  2FTR A;  2EEY A;  3MR2 A;  3I87 A;  2CJK A;  1CSJ A;  2F65 A;  2H5J B;  2YNF B;  4RKU C;  3R6L B;  1HWK A;  2KO1 A;  3DU6 A;  5LMU F;  3TZY A;  3J7A N;  3W5Z A;  2NSB A;  4UUW A;  3DYA B;  2PII A;  3MEC B;  2FGO A;  5A8W B;  2DNM A;  1JK9 B;  4F7V A;  4F04 B;  2KT5 A;  4Q43 A;  1VQ4 S;  1NH7 A;  2J6U A;  2NCK L;  4X4P A;  1N32 F;  1M5V C;  2BXJ A;  3FC9 A;  4PYD A;  3DHW C;  4RW7 B;  2RS2 A;  4EBE A;  4ZPW R;  1URR A;  3QT6 A;  2F5G A;  2QG9 B;  3R7N B;  1MG7 A;  3B4M A;  4C11 B;  8RUC A;  2IAJ B;  3PKY A;  5D0H A;  3K5L A;  2C2O B;  3DRY A;  4DDF A;  2GQC A;  3CCU S;  4U96 A;  1NME B;  3D0I E;  4B3M F;  4KV8 A;  3LH2 S;  3QSI A;  2I1R A;  2CQ1 A;  3FSY A;  3A12 A;  4EEY A;  3P3D A;  4OHY A;  2UUT A;  2ZZN A;  1LK5 A;  3AB2 B;  4H4M B;  4NXM J;  4OI0 A;  1HI8 A;  2RKI B;  4N77 A;  4WK1 A;  3CXC R;  2GVZ A;  1I94 F;  5HMZ A;  2KZM A;  4DPO A;  3HFV A;  1RAO A;  4ANC A;  1T9T A;  1FKO A;  1RBO B;  3HT0 A;  3W9J A;  3K2Y A;  5ETP A;  3BGF A;  1RLC L;  1NBE B;  2G2Z A;  1Y9O A;  1UVK A;  2IVY A;  3V6K A;  4LRD A;  5K8P A;  1NEE A;  2PE8 A;  4O3P A;  2BBE A;  4J9N A;  5DDQ C;  3BJY A;  3GP9 A;  1IN0 A;  3PFE A;  2NUH A;  1S1X A;  4XAK A;  1FNO A;  1TUV A;  5IM0 A;  3NP5 A;  4YOE A;  3EPG A;  1RTJ B;  3W1Y C;  3Q22 A;  2HHP A;  3IG1 A;  5K20 B;  5KFU A;  2NXJ A;  1LW2 A;  4DCO B;  5EDW A;  5CAA A;  5CCL A;  2HHU A;  3DRP A;  1S9E B;  2IJF A;  3ZTP A;  4CO4 A;  4X4O A;  3PTW A;  4X4T A;  3HSG A;  4AT1 B;  1F3F A;  1RT2 B;  4F2S A;  2JLG A;  5B0E A;  3CMQ A;  1LWE B;  2K06 A;  3ICL A;  4DR1 J;  2RHS B;  2R8G A;  2ERR A;  5KTQ A;  3CJ0 A;  2ASJ A;  3KHL A;  4U6P A;  4ELV A;  2DXE A;  2LA4 A;  4BC9 A;  5DGA A;  1JJH A;  5HSP A;  2LDY A;  3BH6 B;  3S1T A;  1EAR A;  5C24 A;  4WZM A;  2COL A;  1ZAV A;  1RUS A;  1RTD A;  1VQY A;  2Z2Y B;  2XMK A;  3MAA B;  3QJJ A;  3RJM B;  3EGN A;  5DET A;  3S6E A;  4ED7 A;  3F44 A;  2CJB A;  1AXQ A;  2DIS A;  2J0S D;  3I55 S;  2B3T B;  1HLW A;  3OW2 R;  3HPO A;  3W8P A;  3M8Q B;  2BJ8 A;  4KSE B;  2WBM A;  1ITP A;  4DU8 A;  1WAC A;  3D6T B;  5HJY A;  1M0S A;  4IDK A;  5LMU J;  2D3O 1;  1T9X A;  2BOA A;  1VLY A;  4G1Q A;  3NRB A;  2BQR A;  3LAK A;  5F3T A;  1H2U X;  3TX0 A;  4B9S A;  2VC1 A;  1DAR A;  2H9Z A;  1HPZ A;  4KGX B;  2BE9 B;  4FXD A;  3CC4 S;  2ALZ A;  4A8Y A;  3WIV A;  1SI9 A;  1B3T A;  4AL6 A;  4TLR A;  3KUG A;  2B7B B;  3KJV B;  2J0W A;  2RQC A;  3N6L A;  2FGC A;  4HT7 A;  2PN6 A;  1O0P A;  1TKX B;  1N5T A;  3SV3 A;  1NAQ A;  2LQB A;  1NH8 A;  3W64 A;  3SDE B;  3O44 A;  1JWW A;  5C42 A;  1S6P B;  3M2R B;  3CJK A;  1SV5 B;  1DZ5 A;  2DEJ A;  3QPI A;  4B3M J;  2BM1 A;  3OXG A;  3M8P B;  3J81 U;  3QLH A;  2GJF A;  1S5Z A;  1MU2 A;  4IG3 B;  2FC8 A;  2HBY B;  3CCM S;  4ANE A;  2NS1 B;  4IG0 A;  4GO7 X;  1R43 A;  3B6B A;  3JQJ A;  1I94 J;  1U6F A;  4HHH A;  3SI8 A;  2Z56 B;  4IYQ A;  3IA0 A;  1UTA A;  3LQV A;  2NPF A;  2FLP A;  3PW5 A;  5T7L A;  2POK A;  4DWI A;  2X51 A;  4ES2 A;  4YEA A;  2UXB J;  2M8H A;  5A0Y A;  4HYK A;  4DR6 F;  2YWE A;  3M2U B;  1O8B A;  2MHE A;  3VAH A;  1IKY B;  2L08 A;  2YNG A;  4HI1 A;  3NS6 A;  3ZZP A;  5F9N A;  3E8O A;  4Y2A A;  2MXY A;  1DTQ B;  4PYA A;  3ETO A;  1ZAX A;  3V4M A;  1QJH A;  2ROP A;  5H9F J;  2N7Y A;  5IC6 B;  2VOO A;  3IRX B;  3HHL A;  1JLQ B;  1RU1 A;  3Q24 A;  1R6V A;  2JEI A;  1OWX A;  4X4Q A;  2W01 A;  1Y5N B;  2BKP A;  2Q6B A;  4P7T A;  5DDP C;  3JYT B;  1R8A A;  2A2C A;  2HS0 A;  5EX0 A;  3I82 A;  3ITH A;  3KWM A;  1X4G A;  2MJN A;  2XQC A;  5A6P A;  3FK4 A;  3HDS A;  3CIM A;  4PWW A;  2ROE A;  4ZPB A;  3D3C J;  2U2F A;  2QSF A;  3PNI A;  1Q8K A;  2C2M B;  1SUQ B;  3DRR A;  2D74 B;  4C3L A;  3VQS A;  4DBQ A;  1F5A A;  2H65 B;  1S7H A;  3NGD A;  4ZS6 A;  5JJB A;  5HRO B;  3DLH A;  2CZ9 A;  2Z2L A;  4Y6I A;  3TA1 A;  3MEK A;  4FBU A;  2Q3P A;  1SJR A;  1BQM B;  3PW0 A;  2M9K A;  4JOU A;  3ZZ0 A;  4TXS A;  4U7C A;  3SIP B;  1LWC A;  5H1S V;  1WSR A;  2VA2 A;  3HM9 A;  4PRF A;  2VKR A;  1HHQ A;  1F9H A;  1ZOT A;  3GB0 A;  2PI4 A;  2PSZ A;  2LQ5 A;  3N5F A;  4ZHR B;  2D3U A;  3RBD A;  4NLG A;  2QLJ B;  4LF7 F;  4TNO A;  4OYB A;  4UQT A;  3W61 A;  5DDR C;  1KC8 T;  1PYS B;  1SJ1 A;  4OV6 A;  2VBW A;  1Q8B A;  3KLE A;  4LRB A;  3GV7 B;  2XB2 D;  2VFR A;  3ILL A;  3WHI A;  1Z2Z A;  1S9G A;  2JOQ A;  1S1V A;  2HQG A;  4ECR A;  4MAK A;  3DOK A;  1TMJ A;  4JI6 F;  3QO9 A;  3ET6 B;  2DVI A;  4QPT A;  2LXI A;  4O3Q A;  2YH0 A;  1PG5 B;  2CQP A;  2H51 B;  2Y1R I;  2C3O A;  5HAT A;  1VBZ A;  4ID5 B;  4YP3 A;  3ZNJ 1;  1P9Q C;  1U25 A;  2YVS A;  3V81 B;  1NJX A;  4CP5 A;  3BO2 A;  2QFI A;  4F0K A;  2FHK A;  3MED A;  1NPR A;  2RVJ A;  4GC6 A;  2FY8 A;  3GYN A;  1HNI A;  4CNY A;  1R31 A;  2DIV A;  4WFN Q;  4KH0 B;  1WDD A;  3QAU A;  5I3U B;  1RU2 A;  2XWY A;  1RT4 A;  4DV1 F;  2M88 A;  4D3H A;  1UEV A;  3OLA A;  4OJG A;  3KLH B;  2QC3 A;  2NPI A;  3LPY A;  2H54 B;  2FQQ B;  4GKK J;  5J2M A;  4DR6 J;  3O2I A;  2ACM A;  3CCT A;  1GK8 A;  3TW0 A;  2EFP A;  2G2Y A;  1VMB A;  3KJQ B;  4FVC A;  4I69 A;  2BZ2 A;  1RT1 B;  4MMO A;  2J7U A;  3QID A;  1OO0 B;  2IRX A;  3BF4 A;  1YJU A;  2JVR A;  4I4B A;  2DD8 S;  4NE9 C;  4J9M A;  2HHV A;  2DNP A;  1CUL A;  1REV A;  2R3V A;  1TL3 B;  4ED1 A;  4KE5 A;  2IA0 A;  3LAL A;  2BOP A;  1P27 B;  4J90 A;  2XMW A;  3P45 B;  2I5J A;  3C16 B;  5DG7 A;  2ZVS A;  5E3Q A;  3LP1 B;  2ZWO A;  3JS9 A;  3QGH A;  1S57 A;  2HMI B;  5LMN F;  1U2F A;  3W2W B;  4BLG A;  3HCX A;  3GIL A;  3TZW A;  5B7W A;  4QIG A;  4FN5 A;  3CDB A;  4FYX B;  3MMJ A;  1HNX J;  3D66 A;  1UVI A;  4BHQ A;  1K47 A;  1UVM A;  3TZZ A;  2PFF B;  2BV3 A;  4WYL A;  1XNQ F;  3OTO J;  1UPP A;  4NCG B;  4FF3 A;  2DB1 A;  1F2H A;  2BDP A;  2A2D A;  1X5P A;  2BEF A;  1KFD A;  2CKW A;  4GKJ F;  1JKH B;  5E7O B;  4DZD A;  2IHR 1;  2UUB J;  1KOH A;  2VFS A;  1S0V A;  3NNA A;  3G6Y A;  1MLA A;  2HGL A;  1HBO A;  3TEH B;  1HHS A;  4LSN B;  5LXY A;  1QSY A;  5LL6 d;  2FZG B;  2MLZ A;  3E2E A;  4RW8 B;  2FD2 A;  1SH3 A;  2KVQ E;  3G4S S;  1RKJ A;  3CCL S;  3SYZ A;  4ELU A;  1F1B B;  4W4M A;  3EPI A;  1NHK L;  1KFS A;  4WFB Q;  1NPK A;  4LF7 J;  4DR2 J;  3IWL A;  2MGZ A;  4DLG A;  4O0I A;  1VIX A;  3H59 A;  1TKZ A;  1LW0 A;  3N0V A;  4C8Z A;  4U7U K;  1CJK B;  4D3G A;  3ZNU A;  2HBQ B;  4ED0 A;  2Q66 A;  1FRH A;  2XMA A;  3BM7 A;  1IKV A;  2DH7 A;  3UD3 P;  3EGV A;  2EC2 A;  4AL5 A;  3OFG A;  1X9S A;  4OYA A;  4P2M A;  4QR2 A;  5GMD A;  3K89 A;  2PI5 A;  3AJD A;  4A8M P;  4OX8 A;  3S7R A;  1WC4 A;  2ZUG A;  3H5X A;  2YBV A;  1N52 B;  2BKO A;  1PAE X;  2R4F A;  1RWU A;  3R97 A;  2ASL A;  5D3G A;  4ETX A;  3KUE A;  2QA4 G;  3CT9 A;  3H5U A;  4FBT A;  3IAS 9;  5DZ6 A;  3TUZ C;  1EKR A;  4JI3 F;  3FCV A;  4NA1 A;  1OMS A;  1Q79 A;  4NYO A;  5CYJ A;  1N5V A;  3CCR S;  4EMD A;  4DV1 J;  2ADC A;  1UCN A;  5IQQ A;  3QIP B;  5JUM A;  4DS4 A;  3AXK A;  2VC0 A;  2KH9 A;  2M8D B;  4DR5 F;  5G0R A;  3DXB A;  4C98 A;  2RU9 A;  2E7V A;  5KFE A;  1H98 A;  3SCJ E;  1NK9 A;  2GVD B;  3OUY B;  2CWX A;  4P6Q A;  2RUG A;  2CIM A;  1TAU A;  2B9Y A;  1Z1Z A;  3R3T A;  4PEO A;  4ZLJ A;  3T5L A;  2XEX A;  2ZH4 A;  5AXN A;  4EUV A;  3JTP A;  4DL5 A;  5B0B A;  1RWW B;  3CW2 C;  1RXO B;  3MAH A;  2DGO A;  4ZPC A;  3ZFV A;  3BH7 B;  3M8S A;  1WWH A;  1D09 B;  3EX7 B;  3TP2 A;  5KFX A; 
#chains in the Genus database with same CATH homology
 3EJM A;  1HIY A;  1U8W A;  1XIQ A;  2B8P A;  3FBE A;  1MN7 A;  4UOH A;  1PKU A;  2DXE A;  3FCV A;  3NGR A;  3ZTQ A;  1XQI A;  1LEO A;  1NDP A;  2AZ3 A;  2HUR A;  4UOF A;  2DYA A;  4CP5 A;  2AZ1 A;  4F4A A;  3BH6 B;  3Q86 A;  1UCN A;  3NGT A;  2DY9 A;  4ENO A;  1NLK L;  2BX6 A;  3VVU A;  1NDK A;  3Q83 A;  3GPA A;  1NHK L;  2NCK L;  1F6T A;  1NUE A;  1NPK A;  3JS9 A;  1NSK L;  1S57 A;  1WKJ A;  1NDL A;  2DXF A;  3GP9 A;  5IOL A;  3FC9 A;  1NB2 A;  1BUX A;  3BBC A;  4F36 A;  3DKD A;  3Q89 A;  1B99 A;  3NGS A;  3EE3 A;  1HHQ A;  3NGU A;  3ZTS A;  3FBC A;  3FCW A;  1WKL A;  3VGS A;  1BHN A;  4AND A;  3ELH A;  2VU5 A;  3VGU A;  3PJ9 A;  1S5Z A;  3WX8 A;  1S59 A;  1NSP A;  2HVD A;  3EVW A;  1MN9 A;  4FKY A;  4DI6 A;  3ZTO A;  1HLW A;  4KPC A;  3Q8Y A;  3EVO A;  1ZS6 A;  3ETM A;  1W7W A;  4ANE A;  1K44 A;  2HVE A;  5CAA A;  3B54 A;  3VGV A;  4FKX A;  3EIC A;  1WKK A;  2B8Q A;  3Q8V A;  3B6B A;  3BBF A;  1BE4 A;  4UOG A;  2DXD A;  3EVM A;  3ENA A;  3R9L A;  3MPD A;  3EMT A;  1NCL A;  3ZTP A;  2BEF A;  2CWK A;  3L7U A;  4S0M A;  3BBB A;  4W98 A;  1B4S A;  3Q8U A;  3ZTR A;  3VGT A;  3VVT A;  3BH7 B;  1NSQ A;  3PRV A;  3EM1 A;  1VYA A;  3FBB A;  1NDC A;  4DZ6 A;  4DUT A;  4WBF A;  1F3F A;  1PAE X;  5CAB A;  4HR2 A;  5BXI A;  3DDI A;  1LWX A;  1KDN A;  4O0N A;  4C6A A;  3G2X A;  2ZUA A;  1EHW A;  3FKB A;  4ANC A;  4EK2 A;  5C7P A;  1JXV A;  3FBF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...