1A9NB

Crystal structure of the spliceosomal u2b''-u2a' protein complex bound to a fragment of u2 small nuclear rna
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
94
structure length
94
Chain Sequence
IRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the spliceosomal U2B"-U2A' protein complex bound to a fragment of U2 small nuclear RNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
molecule keywords RNA (5'-R(*CP*CP*UP*GP*GP*UP*AP*UP*UP*GP*CP*AP*GP*UP*AP*CP*C
total genus 25
structure length 94
sequence length 94
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1a9nB00
2DNYA 4QQBA 3NNHA 4Y00A 3CD6S 2CQ4A 2LCWA 2XS7A 1U1KA 2CQDA 2LA4A 2OSQA 3MURP 4LMZA 4IOCQ 5H1SV 5BJRA 3R1LA 1X5PA 2KXFA 4TU9A 3ULHA 2MKCA 3CCVS 5LSLA 2F3JA 5IM0B 1FT8A 5LXYA 3R27A 2B0GA 2NLWA 2KXNB 1KC8T 1BY9A 2RQ4A 3L3CA 2MQLA 2LKZA 2KXHA 4LJMA 2DGWA 2YKAA 3CPWR 5DDOC 1VQ9S 3CC7S 1ZH5A 1K9MT 1UAWA 5DM7Q 1S79A 2MSTA 1OO0B 4IUFA 1JMTA 3S8SA 3BEGB 4YOEA 2O3DA 1OPIA 2ADCA 2M2BA 4C7QA 2BOPA 1NO8A 5D77A 2RQCA 2AYMA 2EK1A 1VQ5S 1L3KA 2J0SD 1NJIT 3US5A 3Q2TC 3EX7B 4IO9Q 2M0GB 2DHXA 1R8PA 2JX2A 1YITS 5CYJA 2DNZA 1O0PA 2FPHX 1R8HA 2KN4A 2U2FA 3CCSS 2DH9A 3G4SS 5HL7Q 3HI9A 2MKHA 2RT3A 2RS8A 1H2TZ 3G8SA 1M5PC 1M5KC 2YH0A 3J7ZT 1VQMS 2MKKA 3CMAS 2MJUA 2KG0A 3VAIA 4C4WA 3CC4S 3U1LA 1YTYA 1WTBA 1S72S 2CPEA 1X5TA 2JRSA 5JVHQ 1RK8A 1WI8A 1URNA 1A9NB 2E5HA 1OWXA 2E5IA 2E5JA 4QU7A 1SJRA 2MB0B 2VONA 1KD1T 2KM8C 1X4CA 4FXWA 3TYTA 1U1LA 1W2BR 1M1KT 2CPIA 4J5OA 3B4DA 2LEAA 2PE8A 3U1MA 1X4AA 4UQTA 2GO9A 2KM8B 3MUTP 2N3OA 1Q82T 2CQIA 4OZ1A 2KFYA 5IM0A 1QVFR 1WF1A 1D8ZA 2M7SA 1JJ2R 2ZJRQ 2DHAA 2CQBA 1WF2A 1DBDA 2LMIA 3THPA 1VC6A 5GMKa 2ERRA 3G96A 3G8TA 3G71S 3UD3P 4BS2A 4EGLA 5DDPC 3IWNC 1U1QA 1VC5A 2DGTA 1VQOS 2M52A 2MMYA 5DDQC 2MQQA 2NZ4A 1WHXA 2DNRA 1FNXH 1VQ8S 1X4HA 3CCLS 3NS5A 2FC8A 4WF9Q 1WEXA 2YWKA 1AUDA 2CPZA 2DNPA 2AYGA 2MSSA 2FC9A 5MLCV 4WCEQ 5IQQA 1IQTA 2DH7A 2K8GA 4FXVA 1N52B 2KRRA 2DISA 2JVOA 2KT5A 3Q2SC 1VQKS 3ZZYA 2RU3A 1VQ7S 4W92B 3I56S 2LECA 1U1MA 4F26A 1NU4A 2WBRA 4WFBQ 2DB1A 2V94A 3P5TL 2DO0A 2LYVA 2DNNA 4Y0FA 1X5OA 2CQ0A 3VALA 3EGNA 2EK6A 2HGLA 2LA6A 3SDEB 5IFMA 2YH1A 1YWXA 2LXIA 2HGMA 2VOPA 1Q7YT 5DDRC 3CCJS 1X4GA 4LIRA 1SJFA 4IOAQ 2DGUA 3VAHA 5LSOA 2MKJA 3B4MA 1N88A 1FJ7A 2CQ3A 2DNHA 2M8HA 2KI2A 4ED5A 2QEXS 2MZQA 1CVJA 2MQPA 2MQOA 5GVQA 1Q81T 1UFWA 4WFNQ 1U1OA 1Q86T 3DXBA 2MGZB 3J7YU 2QFJA 2YTCA 3VAKA 2G0CA 1VC0A 3CULA 1X0FA 3EGZA 2I38A 4CH0S 3OW2R 1JJHA 1HD0A 2LXUA 2ZJPQ 3VAMA 4C0OC 1HA1A 1WG5A 3TP2A 5D78A 3CCES 1RKJA 2M8DB 3UWTA 4Z2XA 1PO6A 4YUDA 3HHNB 3G9CA 3I55S 2RNEA 2DO4A 3CMES 1U1RA 2HZCA 2DNGA 1M5OC 2A3JA 3CF5Q 2L41A 2KH9A 2N3LA 4A8XA 5GAHU 2DIUA 2CQPA 2L08A 2DH8A 5GADU 2XNRA 2OTLS 4ZKAA 3N9UC 1WG1A 1SXLA 1K73T 2F9JA 2E44A 3H2UB 3CCRS 3CCMS 1FHTA 2CPJA 4F02A 3P3DA 4TLQA 2M70A 3UE2A 2KRBA 3P49B 3MUMP 3VAJA 2U1AA 1OIAA 1SJ3P 2DIVA 4W90B 2MZJA 2Q79A 2MZ1A 4PRFA 3H2VE 2MYFA 2KYXA 3LQVA 4M5DB 2DNOA 2PEHA 2MGZA 3VF0B 1UP1A 1VQ6S 1FJEB 2E5GA 2HYIB 1SJ4P 2DGOA 4CH1A 3MD3A 1YI2S 1X4EA 3SMZA 1X4FA 2RVJA 2VOOA 3TO8A 2ADBA 4WIIA 2MY8A 2K3KA 1FO1A 2MQMA 2MKSA 2J8AA 3SDEA 1A7GE 1H2VZ 2XB2D 1X4DA 2CQCA 2RRAA 1WI6A 3S7RA 2LEBA 3NMRA 2D9OA 2DGQA 4WFAQ 1KOHA 2VODA 1YIJS 1P1TA 2OJ3A 1H6KX 2KG1A 3NS6A 2RS2A 5LJ3Y 1VQPS 1N54B 2DHGA 2M9KA 2N82B 4PKDB 2D9PA 2KHCA 3RW6A 5LXRA 1VBZA 2MHNA 1WHYA 2UP1A 4CIOA 5GAGU 1XN9A 2DNQA 2DGSA 2CJKA 3BO4A 2JWNA 1JJ4A 1K8AT 1VQLS 2MXYA 1U1NA 4RU2A 2XNQA 1WF0A 3MXHP 2DNLA 2CQ1A 2M88A 1FJCA 2CQ2A 2FY1A 1B7FA 5LJ5Y 4QU6A 1ZZFA 3UCUP 2I2YA 1UW4A 1YJNS 1D9AA 4TU8A 1FXLA 2CQGA 3R1HA 2SXLA 2X1FA 1VQNS 2OSRA 2MJNA 3MOJB 2HGNA 2CPFA 1WHVA 1N8RT 2XS5A 2L9WA 2MKIA 3NNCA 2JVRA 1HD1A 4CQ1A 3MUVP 1G2EA 1DHMA 3THTA 2X1AA 3FEXB 3CXCR 2XSFA 2DHSA 1X5SA 2QA4S 2G4BA 3SXLA 1ZZNA 2MZTA 2M4MA 2ZJQQ 4U67Q 2MQNA 3CCQS 1H2UX 2MY7A 5DM6Q 5EN1A 2CPHA 2CQHA 2N7CA 3CCUS 4F25A 1F9FA 3VAFA 3UCZP 2GHPA 2D3OR 5ITHA 3CUNA 3K0JA 2J76E 3PIPQ 2KU7A 2AD9A 2BZ2A 4QPTA 2OTJS 3FEYB 3IRWP 2AYEA 2EVZA 1YJ9S 4ERDA 3BS9A 5GAEU 3BO2A 1U1PA 5CA5A 3RW7A 2DGXA 1U2FA 2DITA 2RUGA 5CXTA 1YHQS 5HO4A 1VBYA 5JVGQ 1WG4A 5DETA 4TU7A 1X4BA 1KQSR 1HL6A 2MZSA 3UCGA 1DZ5A 3LPYA 1WWHA 2DK2A 3UD4P 1QVGR 2J0QD 3CC2S 4OZ0A 3NNAA 2DNMA 2XS2A 1VQ4S 2KVIA 1U6FA 3P6YC 3BO3A 2OIHA 1PGZA 2LQ5A 3PIOQ 1P27B 1WEYA 1WEZA 2MZRA 4PR6A 1QM9A 3VAGA 2CPDA 1U6BA 4YB1P 4WKRA 2CPYA 2X1GA 1WELA 3ZZZA 2G1DA 3MI7X 1DRZA 2MPUA 1YJWS 3D2WA 4V19X 2AYBA 1WHWA 1VBXA 2CPXA 2DNKA 2HVZA 1M5VC 2X1BA 1M90T 3DLLQ 3JB9k 2DGVA 3S6EA 1SJQA 3G6ES 4UY8T 2FHOB 3MD1A 1KOOA 4P6QA 3V4MA 2F9DA 3MDFA 5FJ4A 3CTRA 3S01A 2RRBA
chains in the Genus database with same CATH superfamily
2W2NP 3M9MB 3BGLA 2AJ1A 7FDRA 3TZWA 4DFKA 2CQ4A 1W25A 4OHXA 2XS7A 1S1VB 4P71A 2VFRA 3N0VA 5F41A 2ZKTA 4CLUA 3MURP 1T05A 1RTHB 1UWBA 4YP3A 2UXBJ 2IYGA 2E7XA 2V4RA 4KTQA 2VG7B 2UV8A 3PKMA 2HAFA 4RW7B 4CCHA 4GVBA 1IBKF 2C2MB 4X4NA 2QMWA 3I31A 4FNIA 5CYQB 5KT7A 4C3LA 5F9LA 1PIEA 3NP5A 4BDPA 1X5PA 3FJ2A 1SL2A 3KK2B 5K9FA 3CCVS 4DR6F 2CJAA 4IKAA 1J5EF 3POTB 4HKQA 2H3EB 2F3JA 2BA9A 5A8WA 1FT8A 1U0HB 2GGPA 1RT6A 2XWYA 2UXCF 2ZBRA 4NPOA 4DQIA 4KE5A 3AD7C 3KNGA 2JH3A 1TUWA 2O67A 1BY9A 1YBAA 2RQ4A 1RWVB 2OELA 2IVMA 1T9YA 1S97A 4LJMA 1Q8IA 1FJGF 2UXBF 3M2UB 2YKAA 3W5XA 2GJFA 2LP4A 4CYUA 5C5JA 2R2UA 2DPIA 2IJFA 3CC7S 1K9MT 2E9TA 5HMZA 4MK7A 1YVFA 1S1TA 4LSNB 2HLTA 5IS2A 1ZM4A 3MCNA 5KFSA 3BEGB 2OEJA 3BKFA 2V2VA 4H4KA 1KWMA 1RT1A 3BH7B 1FE0A 3FCWA 3RR8A 3MECA 4OYWA 1V9OA 1I5OB 2HIQA 4HI1A 2ZH6A 1YJVA 2JZ5A 1GNKA 1V5IB 2I0XA 5ETRA 1RXOB 5IQ6A 1FWLA 1BWVA 5E3PA 2IDEA 1XMBA 3FGVA 2HFUA 1FDAA 3SQGB 4BCAA 4DV1F 1S6QB 3CO9A 1XNRJ 3MM7B 1NSPA 3QIPA 1OPZA 3ADAC 3BJYA 4QWEA 4IO9Q 2DHXA 4B3MJ 5AXMA 4DR3F 3QO9A 2ZE2B 1R8HA 3EDRB 3PJXA 1F5CA 4ECSA 1Z2ZA 2DH9A 3L7UA 1FKAF 1LXJA 2D7SA 3LGNA 5ETKA 1FESA 3HI9A 5J2PA 4M5NA 3ETMA 4OYZA 4P74A 3VV2B 1XMOJ 4B3RJ 5B7WA 1M5KC 3QGHA 1VQMS 1RTIA 2MJUA 3VAIA 4C4WA 1SC4B 2ZDOA 4IR9A 3QGIA 4DV3J 1WTBA 2CJ9A 1MROB 2YBVA 3BGFA 4AQYF 1Y5LB 1X5TA 3DDNA 4KRWA 4DSIA 2HVEA 2JRSA 2LEPA 3GFZA 4DDFA 1I94F 2IMOA 4JOUA 3KLGA 2JDJA 4CM2A 1RK8A 2KKHA 4B3TF 3R3TA 2NUHA 4KFBB 3D0IE 1MN9A 2IC3B 3BKTA 3G87A 5J2NB 5K8MA 5DG9A 4B3OB 4OYBA 4QWDA 2FLLA 2NSBA 2E5JA 2RF2B 2BANB 4QOTA 3VHQA 3D9BA 2B4UA 2VONA 3UNGC 3DLJA 1JWWA 1NSQA 1X4CA 2VG6B 2KM8C 2VICA 1ZBTA 2QL5B 4RW8A 2YNIB 1W7WA 5LMNF 4M95A 4J5OA 1WC1A 4IFVB 4ED1A 5KFKA 3B4DA 2E29A 4PZVA 4OI1A 2ZWOA 2LEAA 3KOAA 2PE8A 3KG0A 3T1AA 1IQZA 3I9ZA 2BKPA 3GSDA 3B78A 3MM5A 1B3TA 3RB3A 4WE1A 2GO9A 2HBQB 2JFDA 3CJSA 3IA0A 4K59A 2N3OA 3AA9A 3EZ5A 1LQ9A 4NYOA 4TYAA 3MM8B 4X4QA 4X64J 4H4KC 3G82B 4PYDA 1QVFR 1IM4A 2IM0A 5IV4A 4C8KA 3BF4A 4KT0C 2JOQA 3BQ2A 2ZOFA 1UVJA 1BLUA 2DHHA 1WF2A 2HFOA 4ES3A 1DBDA 1QDUB 3KFWX 3NCQA 4R0EA 4HTIA 2VASA 1KVKA 3NCRA 3GB0A 1RHMB 3G8TA 2AZ3A 3GYNA 3G71S 2GIFA 4KH1B 2C2KB 2EEYA 4O3RA 2JNJA 1CEZA 3CGIA 4ZPAA 1VQOS 2M52A 5DDQC 1B0VA 2NZ4A 2YQ0A 2VPYB 1KLMA 2WHOA 2YKMA 4NX9A 5HAOA 1FTRA 3JQKA 4RUAA 3JSMB 4QIWD 3QSYB 1WEXA 3C16B 1MW7A 1BQMA 3DRSB 2AYGA 4RLEA 1TL3A 3OVAA 3T9ZA 5IQQA 3PO4A 1D09B 4I2QB 3KXDA 2EBEA 3GIIA 1C1CA 1RU2A 1UFLA 3D7SB 3OT9A 4NA1A 2LU1A 4PXEA 1CS4A 3K8VA 3W64A 3W62A 3KHLA 3RRGA 4F2RA 4X4UA 4DV6F 3GTYX 3O2IA 4MAKA 1R89A 1FK9B 4O3QA 4CWBA 2AEJA 2YNHB 3MPUB 1YBUA 3AH6A 1N5TA 2RU3A 1RHJB 4RX6A 1JLEB 4YQWA 1RB0A 1RISA 1K0TA 5THWA 3E3XA 1RCXB 2UUWA 1O8BA 3UR3C 1NU4A 3OUYA 1RHQB 2GA7A 2QSFA 4OV6A 5L1IA 1OYEA 1N5SA 5LMUJ 3A3PB 1HBMA 2FZKB 2LYVA 3NGUA 4R8UA 1JLQB 5CCLA 4Y0FA 4E8UA 3C3LA 4O3SA 2QIFA 1X5OA 4OL8A 4UOGA 2GVZA 4MYUA 3L95X 2VUGA 2OLWA 5ETSA 2FGCA 2AP6A 3VALA 3EGNA 3QT6A 3OXFA 3KJQB 3CJTA 4OX6A 4RBUA 3SDEB 4CT9A 1HBUB 3HFKA 2YH1A 4X65F 1CSJA 2GX8A 2HGMA 2VBZA 2VOPA 1T3NA 4LIRA 1L5UA 1U49A 4IOAQ 2OPRA 5LSOA 4N56A 3KK1A 4DCOB 1T0TV 1TTHB 1U26A 2FLNA 1NHUA 4K4SA 2RMLA 4I1TA 2P9GA 4DF4A 1CVJA 3LF0A 2AZ1A 2B5JA 2MQPA 2MQOA 4JI6F 1Y10A 2IAJA 3MMCA 2J8SA 5KG6A 3PYDA 1U1OA 2UUBF 5HATA 2B9WA 4C9DA 1HI8A 2AEMA 2GFFA 4DUTA 4UOCA 1UVKA 3I87A 3PCOB 4M5DA 5CYMA 2W2MP 3VAKA 3RAXA 4FF4A 3BBBA 4JI1J 1X0FA 3AA8A 3KMQA 2HHQA 3EGZA 3GWCA 2YQ1A 2HS4A 4DUZF 5HQMA 4CH0S 2R8KA 1TL5A 1IWAA 2XULA 1JJHA 4HI2A 3LAMA 1KR4A 3J81j 5AT1B 4QPXA 1WOPA 3Q8QB 1PC4A 1T94A 3FQLA 4LF2A 4Z7YA 4USUA 3WC2A 4WPAA 3CCES 1V3SA 1S99A 2OPQA 4PABA 3QLHB 3O3LA 3I32A 2HLUA 3NGKA 3TA1A 4Z2XA 4WP8A 2FVRA 2M8DB 1U09A 2QRRA 4EEYA 3VTIA 4MT1A 1G6BA 1GTEA 2CIMA 3ZZPA 5C7PA 3PW0A 3C6TA 1VC0A 3X1LB 2HHTA 2HQDA 1NSKL 1JNRB 3LP2A 4KC5A 1PYOB 2Q3PA 3PY8A 1WC6A 4R0JA 3J80U 3ONQA 4DV2J 3CMES 2HZCA 3RBEA 4EBEA 3A4TA 1HPZB 3IRXA 3MTKA 1N6QA 3DLGB 1K44A 2ROPA 4ICLA 3U1NA 1AW0A 2W2PP 4NLOA 1S6PB 2YNGB 1IVZA 2V5HG 2EKNA 8RUCA 3BSOA 4IFYB 4RW9A 2N3LA 1CJUB 4ES2A 3DMJA 5GAHU 4DV4F 4MH8A 2G1HA 4DSJA 4NMLA 1NKEA 4DV0J 2XNRA 2OTLS 4AL6A 3PTWA 2RQMA 1WG1A 4J37A 4GO7X 1AROP 2NXNA 4KGKA 2XMMA 2PMHA 4OZ5A 1BQXA 2F9JA 3EPGA 2R2SA 3BQ0A 3PVXA 3RR7A 2E44A 4FDFA 1FHTA 1H7WA 5BYQA 2UXDJ 1YBTA 1P9QC 3P3DA 3MR7A 4ZPCA 2WAQD 2FZGB 1ELOA 1TV6B 2HMIB 2V4JA 3UE2A 1C4CA 3S1TA 4DLGA 3V6JA 1VK3A 1QAIA 2HWHA 3A12A 1NUEA 1MSWD 1B7YB 3GLJA 2K3IA 1HLWA 4YR2A 1SKSA 3IS9A 1S1WB 2VQEJ 2Y8WA 4RUBA 3H42A 3BPDA 1R8CA 1WTFA 3FQKA 1CQNA 3BGOP 2F8MA 1L3VA 1N0VC 1JXEA 5HROB 1IR1A 4DR4J 4UY85 1F9EB 4I4BA 3CSKA 4NLYA 2MGZA 2J7KA 2PEHA 3EXCX 3DRPB 4I56A 1I51B 4KV8B 2IVYA 1PAEX 3UO0A 5AE3A 2ZUAA 1KBRA 4RW4B 5KT3A 2W2QP 1SC6A 5GAGI 1U24A 2XBPA 5HANA 2EC2A 4CH1A 4DR1J 2MLXA 1TKTA 4ETXA 2R9LA 1V5VA 4OI6A 2VOOA 2VPXB 2DR5A 4B9LA 4JV5J 4BBYA 1KP6A 4GKKF 2XO7A 3AD9C 3CCZA 2AJ2A 2BR0A 2MKSA 2W01A 3N4WA 4L74A 2V8PA 3OPKA 4NI2A 1L3SA 1HW9A 2O01C 3KMSA 1C4AA 3L7PA 2QA2A 2JFKA 2CQCA 1XERA 4LR9A 5BR8J 2V67A 2GNKA 4LRFA 5DJBA 1WI6A 3Q8YA 4M63A 4ZHRA 2IPOB 2E1RA 4FF1A 2P8IA 3PR5B 4DL7A 4PG5A 3BDPA 2JC0A 1RTJB 4P52A 4CLZA 4XO0A 1R0AB 3EWGA 1IWGA 3O8WA 5IV3A 2OJ3A 2X3GA 3I0RA 3FEZA 3ITHA 3UD5A 2DHGA 3J7Z5 3Q8RB 2M9KA 2XZTB 1SC3B 4U7UD 5HP1A 2VFTA 2KHCA 1RHKB 1WC5A 1ZAWA 4XDCA 3FFIA 3FRYA 2KB2A 4KKOB 3CDWA 2C3OA 1IKVA 3CDEA 3I0RB 4USHA 2R7VA 2F5GA 2BBEA 2F4VJ 1SC1B 1VRUA 4URSA 1D0EA 1S6OA 1T9UA 2K06A 1F3FA 4LR8A 4JI2F 5AE1A 4RWXA 2JWNA 3D3BJ 1JJ4A 5F9NA 2CXEA 4X4SA 3KHRA 1FKOA 1S9GB 4OLOA 4F0MA 4K4ZA 5D15A 2QJ3A 1Q0NA 1WF0A 2V2ZA 2CQ1A 2M88A 3GONA 3M2RA 4FF3A 3DYAB 2VB6A 2IRYA 5L1KA 5HMWA 2CJQA 1GH8A 3M8ZA 3VQTA 1ZZFA 3M8QB 1DTTB 3O1LA 1UW4A 3L9ZA 4P2MA 5KOXA 2HNDB 3W9HA 2W7PA 1YJNS 1HNVA 1EB0A 1D9AA 4USJC 2AWZA 2WONA 4WFXA 4TU8A 2SXLA 4JI6J 1C2PA 2EXUA 4LBIA 5IT9Y 1P1LA 2OMLA 4GKJF 1TKZA 2HGNA 1K1SA 1UEKA 4X66J 4DOZA 4IRCA 3AOCA 4I0WA 1J2VA 4UZCA 2VKRA 3LPEA 5HJXA 1X0PA 4TY9A 4N76A 4ZDNA 2W9CB 3IM9A 1RYRA 3F0NA 3CD7A 4OQJA 2IRXA 3I0SA 4CQ1A 3OL6A 3MUVP 2YVSA 2ZFHA 2HURA 4TKTA 1JXVA 1OSCA 3FEXB 3GCWP 4HACA 3ZTPA 2BJ1A 2V4JB 4E0DA 2C3YA 4H4OB 2QA4S 2F65A 5L9XA 4ZPWR 2G4BA 1GMVA 1HHSA 4KPYA 4OHYA 4UQGA 3QZ8A 2ZHOA 3LTOA 4C8OA 2MZTA 1F6TA 2M4MA 2YXLA 4TY8B 4J9KA 2LDYA 3OVSA 1NCLA 2MY7A 4PG7A 4JI0F 4ED0A 3CJRA 5I42B 2N7CA 4LF8F 2GZOA 1PSDA 2KJWA 3DKDA 1V3ZA 1RWUA 4WFZA 4FP9A 4F25A 4I68A 2W7OA 1KQKA 1EHWA 4B02A 1FVQA 1NK5A 2QA4G 4PG6A 2J9DA 3DMJB 4WK3A 3TANA 4C8ZA 3FUYA 1T8EA 3ENQA 3BN7A 2CDQA 3LOUA 3Q8SB 1VMBA 3M30A 4ICLB 3R8YA 5KG0A 1EX8A 1FVSA 1FWPA 4QIFA 4CNZA 1NK6A 1VYAA 2AF6A 2WSEC 5ETLA 4DR5J 3U27A 1UA1A 2V4QA 2EFGA 1F5BA 1ITPA 3CDBA 4DF8A 4LF6J 4ECRA 3C6TB 4OIXA 5D4NA 2HHVA 5C24A 5KOWA 3BS9A 3MM6B 3EZOA 4CNYA 3C66A 3MM6A 2DKOB 4S0MA 1YK9A 5FLXU 2R2TA 4B3SJ 4DL0C 3C15B 2FQQB 5HMYA 1N5YB 5KG5A 2J9CA 2CWXA 1Q1KA 5KFUA 2HWIA 2D3ZA 2UUCJ 1VBYA 5B0GA 1Q78A 3MEEA 1PJ5A 3HHLC 4ZP9A 2FJDB 3K7RA 3ISNC 5CAAA 5JVGQ 2Y1JA 1I1GA 2XYGB 3DOLA 4TU7A 1GMUA 1SIWB 4TQSA 1SBRA 1KQSR 5CYMB 3K57A 1N32F 1QVGR 4ECQA 3CC2S 4OZ0A 3OTEA 3MMCB 1HNIB 5K20B 3D28A 1XIQA 1CULA 2DTJA 2B5JB 2GQQA 4K2XA 3BO3A 3MMBA 3QGGA 3TJ9A 4LBPA 4WFYA 1WEYA 4C0BA 1RU1A 4ENOA 5KAKA 1FRIA 4HDGA 1NKBA 3I0SB 1T7PA 1E6VB 2AMCB 4G1QB 1C0TB 4J9OA 1B70B 1WSVA 3VZHA 4F36A 3R7NB 4OHWA 1T9WA 4ILMA 1QJHA 1HQEA 4EYHB 2XS5A 1ACMB 3NGTA 1FI4A 1X60A 2ZBCA 2HK2A 4YB5A 3R9LA 6AT1B 5L39A 3KDNA 4DR2F 5I3UA 1DRZA 4I7FA 4F4YA 2PI5A 4DR4F 3V4IA 3IMQJ 3NXZA 1FEHA 4B3TJ 1FKPB 2BJEA 4MFBB 1UKUA 2DNKA 4DXLA 1SQGA 1URRA 2BV3A 1M5VC 2D41A 1RT4B 2FIUA 4M5GA 3ETOA 3T19A 1M90T 2DGVA 1JXLA 1SJQA 4Q8EA 4HEA9 1Q7LB 1HIYA 3OR2A 1FK9A 4RKUC 5I42A 2ZH7A 4W98A 1KONA 3V4IB 4LF5J 3W3SA 2R4FA 1N33F 2HK3A 1EARA 3PX6A 3E01A 5FJ4A 5I3UB 1PKUA 3CTRA 2N4DA 2KN4A 3CW2C 2VQFJ 2DNYA 3PW5A 3NOGA 4NZ0A 1RWPB 1TL3B 1KN6A 3D0GE 5L38A 4GO5X 4NLPA 2O5DA 3CD6S 4UF4A 1AA1B 2R2RA 1NBEB 1VRUB 2LA4A 2OSQA 3CT9A 5J2MA 2XZDB 2MLYA 4OZJA 1WUUA 4IOCQ 4BWJA 4B9SA 2KYZA 1EKSA 3Q8PB 3MOZA 1TK0A 2G13A 1YJ7A 3DLKA 1UFKA 2KO1A 3R1LA 3P5BP 4FVCA 2HRTA 2UUCF 3DHXA 5T14A 5A8RB 1DQ9A 5H9FK 3DLEB 3K5NA 4GKJJ 1PC5A 1RAAB 2VQEF 1B4SA 1F2HA 3HLUA 5LXYA 2C28A 4JUZA 2KXNB 1RWOB 1TVRA 4ER8A 1ZA2B 3C6UA 1FRJA 3M6VA 4NLWA 2BKNA 1RAHB 2ZZNA 3N28A 1HYSB 3JTOA 5HI7A 3L3CA 5EWFA 4LFBF 1MWZA 4ZPVR 2R7QA 2EFPA 3C15A 4UT4A 1VQ9S 1J5OB 2RILA 2OI2A 4U8VA 2FHJA 3OSPA 4WWSA 2BJDA 2MSTA 1KVJA 4PWDB 4IUFA 1N32J 3GFHA 4YOEA 2Q43A 5T7LB 2ADCA 3DRYA 4NRUA 4C7QA 5F8HA 4A8FA 2FYXA 1IBLJ 3I5AA 2V9KA 2H5IB 1NO8A 2C2OB 2WSFC 3MHYA 1S59A 3W9IA 5D77A 4DEZA 2IY5B 2MLZA 3C8YA 5EDWA 2ZVIA 3H5YA 1S77D 3OXGA 1WORA 3NBPB 3IR5B 1EQ0A 3H25A 4LQ9A 1KLNA 2YPZA 3US5A 1T11A 2OD6A 4U6PA 5E3QA 2E1PA 2XI2A 5E3CA 4OYPA 3HCXA 4R5PA 1CJKB 1S1WA 2FPHX 2L9DA 1IKWB 1HWJA 2BJ8A 2U2FA 3IP0A 3GMGA 4O23A 3CCSS 3C14B 3TVKA 2PSZA 1OQ3A 1PBUA 2GJ2A 1HQ2A 2C2ZB 4OX7A 4V19J 1J27A 5HL7Q 1U25A 4DHVA 1JLFB 2RS8A 3HHEA 2K7KA 4ZPTR 2YH0A 4HACB 5CCMA 1S9EB 3IGNA 2MKKA 2A2CA 3CMAS 3T1YF 1UVLA 3TR5A 2WCXA 2XLJA 2KG0A 2C2RA 2FGOA 3CC4S 5FIIA 2W9CA 4CLYA 3J81Y 5ETPA 4R5PB 5IC4B 1S1UA 4X62F 3GILA 1N33J 4G6VB 3BBCA 5CD4H 2D74B 4DQSA 4JV1A 4NXMJ 4IFYA 4RW9B 4YY3F 1TQLA 5JVHQ 4ZP6A 4KQZA 3RRKA 1Q8KA 1M1GA 5D4LA 3U7JA 1FRHA 1N6QB 4YHHJ 3IRXB 5FDLB 2OUGA 3SQGA 5L46A 2HNDA 5B09A 5A0YA 2E5IA 4USVA 4A46A 2EFNA 2HRUA 2XEXA 1WD6A 2FJVA 2MB0B 3MECB 3DN9A 4P7VA 1KD1T 3Q83A 2PT0A 3TYTA 1TL7B 1U1LA 4CH7A 1M1KT 4IDKA 4EBDA 1Q16B 2MHEA 3HHLB 1S76D 5LT5A 4ANEA 4F4ZA 2VDHA 3FK4A 3W60A 4LSNA 1DAXA 3NMAA 1X4AA 3KLEA 3LP0B 1FRXA 2G0JA 4CYUB 1IJFB 2MKYA 3DU6A 3MUTP 3MR5A 1WJ9A 5EX0A 3NRBA 1TVRB 2J0WA 5JXSA 2XM3A 1R43A 1XBWA 5F0WA 1KTQA 4WZMA 5KFJA 1IKVB 2EC0A 1GXUA 1JJ2R 2L9NA 4DL5A 5L9NA 4EO8A 2ZJRQ 2DHAA 5A8WB 4A8SA 5D3GB 2LMIA 4ZVFA 1U2RA 3BR8A 2WBMA 4LUBA 4QWCA 1FXDA 3QWPA 5ETQA 4K4VA 2J7UA 5J2MB 3KK1B 1Y0HA 4ZMMA 2OPRB 4Y2CA 5DDPC 1FDBA 2CNNB 2DT9A 4O0NA 3OL9A 3CJ3A 2MQQA 5KFPA 1FNXH 3W66A 3W2VA 1RBOB 2FHJD 4ZHRB 4DCJB 1DY3A 3CCLS 4CT8A 3I82A 2FC8A 4GC6A 4EBCA 1NB7A 1AUDA 4WF9Q 4X2BA 1KS2A 2CPZA 4DG1B 3T5KA 3B8HA 2FC9A 3P45B 2XMVA 3AOAA 1GX5A 5GAHI 3QRQA 3OFGA 5KG3A 3KNAA 1QUVA 4B17A 1N4LA 1QY7A 2QLJB 1N52B 4O4GA 1S0MA 1JB0C 3KDOA 2Y1RI 4FNHA 5HN0A 5M2RA 4N5SA 1TKXB 4ED3A 4EZ9A 2KT5A 2YKNB 4RW4A 1JLEA 2ZZTA 3ZZYA 4W92B 1R8AA 1S12A 1FJGJ 2HHHJ 3A3OB 1ZS6A 1T03A 3K8WA 1HNXJ 1UTAA 3HSDA 3ISND 3M6XA 1FDNA 2QMUB 4F26A 4YY3J 1U1MA 2QG9B 1HARA 3TEGA 4OJ3A 5SZTA 2V94A 3OJSA 2HNYB 4DL2A 4NLVA 3GSIA 1RBAA 2UXDF 2DY9A 2VBYA 3IS9B 4OYAA 3HT0A 1SL1A 2C2DA 2A2DA 1E6VA 4G1QA 1HMVB 3C16A 3H8YA 3T1YJ 2HGLA 3N5BA 2LA6A 3CJ2A 3DI6B 1T9VA 1PBAA 1TV6A 2XHCA 2HHWA 4LBHA 2CRLA 1R6VA 5KFBA 5DDRC 3CCJS 5DGAA 1SJFA 4B9VA 1VRTA 2BM1A 1S49A 3THVA 3MAAA 4MMOA 3VAHA 5ADZA 3B4MA 3PNIA 1FJ7A 2BJ3A 3EXYA 4N8NA 2XMAA 4K4UA 3K89A 4C98A 1X8DA 4ED7A 2UV8G 1KVIA 5GVQA 1MMDA 1Q81T 1R0BG 3NLCA 3DOLB 3DXBA 4IH6A 4C8NA 2HFZA 2E5LJ 2QGFB 3ISZA 1S6PA 2YNGA 3SEOA 7AT1B 2Y1IA 3PEHA 4OYXA 5DG8A 3FSYA 4PG4A 2HIYA 4H54A 5A6PA 4P75A 4ZITA 2I38A 3MMJA 2G0IA 1E6YB 1YZ7A 3BZQA 1KDNA 4HT7A 5DS7A 4AXIA 5KFOA 3OW2R 3VAMA 2B8QA 2JEIA 3BB5A 1HNWF 1WG5A 4M8LA 1AT1B 1R7IA 3D6HB 2EBGA 2LQBA 5D78A 1ZOTA 3GIMA 2ZBPA 2CDRB 3IG1A 1RKJA 2OPQB 1O51A 1R27B 2VC0A 1TL1A 2AW0A 1PO6A 4PPZA 4RNNA 2ZH1A 1GFWB 5DZ7A 9ATCB 2CJYB 3R6LB 1MMLA 4OX9F 2ZH5A 2AU0A 3ET6B 4QIGA 3ENVA 2DO4A 2ASLA 2HNZB 4R25A 1RLDA 1S1XA 2VD3A 4FPIA 4I6YA 2F8HA 2H4YB 3W63A 3I9V9 1DQAA 2V6AA 2I8EA 3RUBL 4Y2AA 2IC3A 3CULA 4NLTA 4ECZA 1KHWA 2PC6A 1FWKA 2QO3A 5M2UA 4B3SF 3PRBA 1RACB 5EWEA 1SKRA 2A3JA 1RCOB 1YQHA 3TX0A 3GFYA 4RBVA 4WP9A 3G6XA 1MU2B 3V2UC 3ILOA 3ZC4A 1MU2A 2CQPA 3HVAA 2W25A 4ZCKA 1SH0A 4Y2IA 2L08A 4G65A 1YG0A 4Y65A 1FA0A 2Z57B 4DLEA 4ZKAA 3HZGA 4Q5VA 1NK8A 3BPSP 1XR5A 1YSJA 1SXLA 4FS1A 2GIRA 3R2CJ 4DSEA 1WC0A 1K73T 4ZIVA 3KLHA 4ZCLA 1NRKA 1RA7A 1S1XB 3H2UB 3EVOA 3HDSA 3MCOA 3QMQA 3GV7B 4QW8A 2RDJA 4K4XA 1NEEA 3B54A 4KH0B 5G0RB 3OBIA 2VF3A 3TW0A 1VBKA 3IBWA 4QWBA 4TLQA 4KR0B 1HBUA 2VKZG 4LIWA 2KRBA 3PIOQ 1NH8A 1NK7A 1NXIA 1TU0B 3CB4A 3VVTA 1WKKA 2LQ8A 1KNZA 1OIAA 1VDHA 2W1BA 4RZRA 4LF8J 4W90B 3MEDB 1B0PA 3A8JA 1TP7A 2CNKB 3MEGB 3H2VE 2WVEA 2MYFA 3CJ5A 2KYXA 2ZM6F 1Y9OA 1HI1A 2JLFA 4NLRA 4U7CA 9RUBA 3LQVA 2Y8YA 1SPBP 2YKQA 2P2CB 1N34J 2QL7B 2NQPA 1RZMA 2DNOA 4OI4A 4B3MF 1UP1A 3K5PA 1VQ6S 3Q8UA 1SJ4P 2A18A 2DGOA 2ZOMA 5KFWA 2AV5A 3MD3A 3BQ1A 1XC9A 2J6UA 4JI7F 1X4EA 1PYTA 1RT1B 4O4RA 1NDCA 2CZVC 3W5YA 5L1LA 2RVJA 4LF9J 1RT3A 4F3OA 1RAIB 1CC8A 4DV5F 4LT6A 2BDPA 4KJIA 1YJTA 4EWTA 4JYAJ 3FKBA 3MAAB 4H4MB 3TAPA 5M2PA 3CWJA 2P6SA 1LWXA 4OZ3A 1U45A 4DPUA 1ROFA 2EW9A 3JSMA 1O5JA 3S7RA 2FLPA 1KLMB 2YKMB 1NJYA 2D9OA 3OFFA 5J2QB 1HMVA 4CLTA 5BYSA 2VODA 2F1FA 1GXTA 2ZEJA 3HVTB 1ZM2A 1P1TA 1PCAA 1XR6A 1YIJS 4X64F 3K5OA 1HBOB 4DZDA 1FE4A 4RPFA 2VBWA 2E7VA 1VFJA 4EK2A 1LW2A 1FX2A 1QE1B 1VK8A 3NKYA 1RTZA 5I4MA 3HSGA 1F3VA 4RNOA 1SQEA 3RW6A 4RW7A 3PXGa 5KFQA 2PDAA 2OAUA 1VBZA 3BSNA 3MEKA 2XGPA 2RQKA 2B51A 3T5LA 3RBZA 3HFZB 1AYEA 1JQGA 3IM8A 4A8QA 1UPMB 2GVDB 4OX9J 5JJBA 3LP1B 4YB7A 1UJ4A 4IG3A 2NREA 1XN9A 3JSYA 3R5AA 1HR0J 1U8WA 1IKXA 2UZAA 2PFDA 4NEYA 1HFEL 2B4OA 3X3UA 2QA1A 5A8KB 1SQFA 1UWAA 2ZHAA 3TUPA 3LALA 2HBZB 5L8RC 3LW5C 1AFJA 4OX8A 3CJQA 1F0XA 2B8PA 1ZPVA 4O3OA 2AHOB 4CZCA 2MXYA 3DLBA 1CG2A 3TZYA 2DNLA 1GAOA 1L3UA 3LP1A 2ZH9A 2VA2A 2B9YA 2H4WB 1KQFB 2CVIA 2KT2A 1QD1A 3FC9A 4ZPBA 5KTQA 4LF7J 4A47A 4CO1A 3M4XA 2GS8A 3HKZD 4WYWA 1QE1A 1LW2B 2PN6A 5BR8F 5J2NA 4DV5J 2CQGA 2H48B 4CDIA 2ZH3A 5HROA 3SSRA 1HR0F 4KGXB 1FXLA 2XSJB 2RAQA 2AGPA 2C2EA 1QTNB 3MOJB 4FZVA 3HHLD 1G3OA 4WYLA 1BUXA 1REGX 3DGPA 3MPWA 1N8RT 2BE9B 2V2KA 2WVFA 2Z4PA 3AFGA 3AJ2A 1TMMA 2YX4A 3M1VB 4HLBA 4NZ7A 5D0HA 2FTRA 3B6BA 4U9RA 3PR4A 3DFEA 2YY3A 3LUYA 3CJKA 4ATNA 5K8NA 3P96A 5RUBA 3JAMU 5KFZA 2NS1B 2WOMA 1SB6A 3DRXA 4OZLA 2O1PA 3LP0A 2KTQA 5KG2A 2R7RA 1G2EA 1NPPA 5KFAA 1U02A 4CO4A 4HH1A 2X1AA 5F8LA 4LFCJ 1S10A 1GXLA 3R7SB 2K2PA 3FZBA 1N36F 3D6MB 2LQ9A 5AJ3J 1HWUA 3RB0A 4DUYF 1A6LA 2GAGC 4FBUA 2PGCA 1LWEA 4IDKB 4USWA 2MQNA 4F4KA 3MF5A 3SSQA 1H2UX 4ZN1A 1M1HA 5DM6Q 2CQHA 2FJEB 4QZVB 4U96A 4F50A 4ED4A 1HNXF 5EN1A 5CZVA 3D1HA 3NWRA 3HMJG 3JQJA 3IR7B 3MM7A 5ITHA 3CUNA 1R31A 3GJSB 2IBOA 2DRDA 3R5BA 2EFVA 1JKHB 2W9BB 4HH0A 3NGDA 3TJAA 3MEGA 2VJUA 2KU7A 3HSZA 5AJ3F 2V8VA 2MTLA 3FSIA 4JI7J 2JLEA 5E41A 3PYEA 3IRWP 3QJPA 1LWEB 1IJEB 1H0HB 1RWXB 1S1UB 1BXNA 2AYEA 4U8YA 2CG4A 5K14A 3RU0A 3DRRB 3UN5A 1YJ9S 3IO1A 2BQRA 1RABB 5GAEU 2FDNA 4MKBA 5KFMA 2ZKUA 1U1PA 5G0RA 4DX8H 1NZ8A 2DGXA 1U2FA 2DITA 1LNQA 3GP9A 1XK8A 2QLXA 1S9FA 3CIMA 1JJCB 1VGYA 2BE2B 1IBLF 1YHQS 2PO4A 2ZOGA 4TVAB 3EVMA 4HT5A 1LFPA 4CI0B 5EX3A 3C14A 2HHUA 3K59A 1UPPA 1JLCA 2BACA 3MMAB 4NCGA 1CJKA 4OFZA 1WG4A 4Y28C 4ALZA 4URGA 1KFSA 3GPAA 3RG6A 4A48A 3QT7A 4QIVA 4CTAA 3GG1A 3W8GA 3FNNA 1WWHA 1DZ5A 2DR8A 4NCAA 3NBPA 1WC4A 2RE1A 1LWCA 4ZVEA 4LFBJ 3MTJA 2YWFA 3N79A 4QCLA 4ZPDA 1U6FA 4DPTA 3HVWA 3ENAA 2OIHA 3AODA 4C3MA 3H90A 3MFIA 4DUZJ 1PGZA 4DL4A 4U7UK 1NHKL 2H65B 1Z1ZA 1S4FA 2LQ5A 2RJZA 1WEZA 2V34A 1Q95G 3CD0A 3IG1B 3L7OA 4NEZA 3VAGA 2HKEA 1R8BA 4MIAA 5KG1A 4FBTA 4PWDA 2QLBB 4WXOA 4DUYJ 3SQOP 3F56A 4RL1A 4WTOB 2LLZA 4KAIA 5C2GA 4DR6J 2H51B 5DRKA 2FD2A 1J5OA 4LFCF 1HBMB 3MCSA 4R8UB 3DXSX 2NCKL 4D3GA 1E6YA 2GVDA 3D6FB 3D2WA 2EWHA 4DL3A 4V19X 1M5SA 1N0UA 4DSLA 1VBXA 2Z2ZA 1Y5NB 3C6UB 3RBDA 3BDEA 2CPXA 1RAGB 1L3TA 4C0HA 4ZLLA 2YWEA 2X1BA 1AZSA 3CCWA 3S6EA 3GCXP 3Q86A 4IR1A 5A8RA 1JLAA 2FHOB 2Y0SD 3ENWA 3LGHA 2AIRB 4IQXA 4ZS6A 4WU3A 3MM9A 4K5RA 3V4MA 4Q45A 4JI5F 2VZ9A 4I2QA 1HHQA 4ZJOA 2F9DA 3W9JA 1HQUA 1TUGB 2OPSA 2OMOA 3S01A 2HHHF 3PW2A 4PPDA 3SCJE 3Q23A 1BE4A 3OTDA 1R0CB 4L73A 3NNHA 1QAYA 4LRBA 1RUSA 2ASYA 3A8KA 4GMKA 4I6WA 1OS5A 4A8MP 1A0OB 3I5CA 2CAJA 2LCWA 4MIWA 3TOQA 1XWLA 4H4MA 4MKAA 5HQ8A 3NGSA 1XMOF 5G4DA 4LR7A 1XEZA 1UVNA 1VHIA 2ZNZA 1RT3B 6FDRA 1JLAB 3DLHA 2LFVA 4PYAA 5BJRA 3CDUA 1AZSB 1FX4A 1W2IA 1D9FA 2E9RX 1S4EA 3SFGA 3WDOA 5F0UA 2KFNA 2MKCA 3OD2A 2J0XA 4F2SA 4NXMF 5LSLA 1B64A 3TJ8A 2AJQA 1YJUA 4FYYB 4KGZB 1RTDB 4C8YA 1KQGB 4O44B 3HT3A 5I3PA 2XO6A 1KC8T 2CJBA 1VQSA 3R5CA 3A8EA 1YDLA 1GX6A 2OHDA 4I7FB 4JBCA 4WE1B 4DS5A 2MQLA 2XY5A 3QRPA 1R3NA 2BW7A 3L4BC 3RJMB 3HO1A 2DGWA 3GJQB 3CPWR 3AT1B 5DDOC 1SKWA 1ZH5A 1EETB 1U48A 3BH6B 4W4MA 2FHMA 1S79A 4UW2A 1RWMB 1SCJB 1JMTA 3S8SA 2YQ3A 2ZHBA 1XNQJ 2O3DA 1OPIA 1FFSB 4QR2A 4USTA 2ILYA 2V63A 2ACYA 4OJ1A 2BOPA 1LWCB 5C42B 3PYGA 3TZXA 3D6TB 2PEBA 1X9WA 3PV8A 1CULB 2RQCA 3H0PA 4NXNF 4KGVB 4KO0A 3WBZA 4CLLA 3H5UA 2EK1A 4RWWA 3MFHA 1Q5VA 1S7HA 4PUOA 1LV5A 1NJIT 4NCGB 1QSLA 3ZXWA 1JLCB 3MMAA 5E2QA 1RWNB 3WZ0A 4A8KA 2M0GB 4K2JA 2JX2A 2HFNA 5CYJA 1MROA 1UEUA 4CLKA 1LFWA 1CJTA 1O0PA 3J7AN 4ETZA 3ZZ0A 2ASJA 3OL8A 4N77A 2HNZA 3ILJA 3VGVA 2DEIA 3JXOA 2QLWA 5IWAF 1LK7A 2MKHA 3CMQA 2RT3A 4NRTA 3VGUA 2A6MA 1TL1B 3BV8A 5AXLA 3G8SA 1M5PC 4OMFG 3UVJB 3HHLA 2R7SA 4FKXA 5K14B 3TRGA 4C48A 1RLCL 1X31C 2OFGX 1TL7A 2ZBIA 2DVIA 5C24B 3MPDA 4JI0J 4WP3A 1YTYA 4GKKJ 1BWEA 3GR0A 5C2CA 1XMQJ 2CPEA 3J7A1 1RWWB 4O3PA 1PYSB 2YX1A 3DC2A 5A0YB 4J9VA 5KFVA 1NDLA 2F8EX 1FD2A 2WB4A 2W9BA 1S6QA 2QFIA 3G6VA 4K50A 4IRDA 1WI8A 5C25A 3KLFB 3KKFA 1K1QA 3C19A 1URNA 2M3DA 5K8PA 4M1KA 5CD4A 1A9NB 3RAMA 4ZCIA 1X9MA 3V6DB 2HBYB 3EICA 1OWXA 3QFWA 4YR3A 1KHVA 3TEHB 5D0GA 3Q89A 4UOFA 4QU7A 3O5TB 1WC3A 2HS0A 3F41A 2W8LA 4FXWA 4X66F 1W2BR 3IWXA 1LXNA 1VRTB 2HHSA 1S9EA 2D1CA 2CPIA 3PX0A 2IBKA 1Y3KA 3T41A 4H4OA 1REVB 2WVCA 3U1MA 1KEKA 3ZZTA 4WXWA 4C97A 3LANA 2YX7A 2RIJA 3A3NB 4G1PA 4UQTA 8AT1B 3RGIA 3OHAA 3FBCA 3D1OA 3KJNB 4J91A 4LF1A 5K5MA 2F63A 2ILZA 1IKWA 3FCVA 3M1VA 4EO6A 4WU2A 1U6ZA 1OJ4A 4I69A 4AT1B 2CQIA 4DR7J 1U0HA 2A10A 4O0IA 4LRCA 2KDOA 3F73A 1N48A 3AJ1A 1OY9A 1WF1A 1D8ZA 2GC8A 2HBRB 2HNYA 2M7SA 3AAWB 3ILIA 3K17A 3ZO7A 3VZIA 1RAOA 2CQBA 3JS9A 3T1HF 3I5BA 3O44A 4FF2A 3THPA 1VC6A 5GMKa 4ID8A 4ED8A 4XK8C 4TN2A 1ZM9A 3JSRA 1X7VA 4URQU 3AJDA 3UD3P 1U47A 4BS2A 3BR9A 1TKXA 1YRUA 4OV1A 5CHCB 2BW2A 4EGLA 3T5JA 1DTTA 3CIZA 4N41A 1U1QA 3IWNC 5T7LA 3ZTOA 2HW3A 3GG0A 4LRAA 2OEKA 1OY6A 3G8QA 4QBUA 1WHXA 2DNRA 3W8PA 5DGBA 4RUCA 1VQ8S 4K8RA 4HYKA 1P9YA 5A8KA 1J5EJ 1DARA 3NS5A 4DG1A 2YWKA 3GJTB 1S9GA 2DNPA 5LMNJ 3SBMA 2MSSA 2GAHC 3TQ1A 1JX4A 4WCEQ 1TL4A 3HKWA 1YZ6A 3W2VB 5KFNA 2FVQA 3DM2B 1IQTA 1WOSA 3BGUA 5GMDA 2DH7A 5B0FA 4YHHF 4FXVA 4M5MA 2KRRA 3V81B 3SI8A 4EFAC 2IRUA 3FBFA 5F3ZA 2R7TA 5DG7A 2DISA 2G9OA 3DHWC 1MWQA 5KFXA 2RKIB 3KLIA 5D6GA 5F8MA 1VQKS 3DLEA 3KJFB 3QGPA 3GV5B 2VQFF 4K7QA 5IT9U 2LECA 4USKA 2NSCA 4M94A 4NA2A 1V6HA 4QW9A 5HLFB 3DLKB 2WBRA 3D66A 4M5HA 2UUBJ 3QAEA 2A6OA 3LH2S 1CQMA 3AXKA 2DB1A 3JTNA 1YKWA 2VFVA 4ANDA 4WFBQ 3P5TL 2PA3A 4Q2LA 2W2OP 4F67A 2R8GA 5IC6B 3OL7A 1NSAA 1RI7A 3FBEA 3DDKA 1ICEB 3QNWB 4TNOA 5E7OB 1ZAVA 1H7XA 3KJVA 4LF9F 2FJWA 2EK6A 1EP4A 5E5NA 3NOCA 4K0KF 2LXIA 4X4OA 3Q22A 2HQGA 1JLBB 1X4GA 3D5MA 3AD8C 2MQ8A 2C1EB 4J9NA 1UJ5A 2MKJA 2ZD1B 4TXSA 1ZTWA 5F3TA 4AL5A 4ED5A 3TA0A 2QEXS 2MZQA 4DR3J 1S0NA 1KKHA 1TKTB 2VHGA 2GIQA 3UN2A 2DRBA 1FRKA 2ATCB 2JL9A 4ILLA 3EJMA 4WFNQ 1Y00A 1CLFA 2AQ4A 3GYXB 5FDLA 4B9MA 4PQAA 2YNFA 2CWKA 4C3KA 1CBKA 1FKPA 3EZUA 4MFBA 2MGZB 3J7YU 2YTCA 1SIZA 2FLOA 2G0CA 4DX5A 4BC9A 1H3DA 1IR0A 5KFFA 4HHUA 2ZNYA 2DXDA 2EFQA 4NA3A 1NK4A 1LOUA 4FS2A 3GFXA 4NZ6A 2HQFA 3W5ZA 4DX6A 2JSXA 2ZH4A 2B3TB 4DQQA 3KG1A 1QLNA 1HD0A 2B7BB 2LXUA 5B0DA 5KT6A 1TKDA 2AX0A 1HA1A 2D69A 3M2VB 1H72C 1C0TA 1DQ8A 1NM2A 2I5JB 1N5QA 2V2QA 2FZCB 2XYHB 4JI8F 3R2DJ 3UWTA 2ZH8A 2UUAJ 3ZNUA 1VHFA 3SSSA 3TUIC 4CLPA 4DPWA 1AFIA 4YUDA 2B6AB 3HHNB 1Q8LA 4DN0A 3G9CA 3NAIA 3I55S 2RSQA 3QIDA 2FJBB 4PEOA 3EDQB 3PRVA 3UN3A 5KFRA 1HNIA 1T02A 1YRXA 5LOQA 5KFLA 1U1RA 4Z37A 4GC7A 1VOMA 2UUAF 2YWGA 2OD4A 4NLGA 3W61A 1ZM3A 2Q6CA 3R5DA 2Y1LB 1U7LA 3ZTQA 3AQOA 3ZZUA 2R3VA 1CJUA 4WJBA 3CJ0A 4ZN3A 4ECVA 4WZQA 4KBIA 2AX1A 4ZLJA 2A0FB 4DPYA 2BABA 2GHVC 4WBFA 5A76A 2DR6A 4ZVUB 4IO1A 4PG8A 4OHZA 4ECUA 1RYSA 1WKLA 2C22A 5SUHA 2LQJA 3CCRS 3KK3B 4F02A 1HW8A 1VISA 4X62J 3CNQP 5DQGA 1G1XA 1FXRA 4ZVTB 3D0HE 1VI7A 3P8BB 3OTOJ 2M70A 1D1UA 1N5VA 3GYGA 2K1RB 3EUNA 1ZYQA 3R5GA 3ELHA 2U1AA 2P6TA 4AL7A 3KUHA 2VH7A 3GU0A 2DIVA 4L3NA 4DPOA 2F7VA 3UFCX 1B0TA 3D3CJ 4WKYA 4F4XA 1HNZF 2Z2YB 1HYSA 1SV5B 4PRFA 2GQCA 1TMJA 3M30B 1VQYA 2OEMA 1PAUB 5E0OA 5EHHA 5DQIA 2P9CA 1F2GA 1IUJA 2Z0GA 4LF6F 4MK8A 4QWAA 4M5DB 4FYDA 1NLKL 1Z2LA 1RT7A 2E5GA 3IAS9 3WIVA 1FJEB 2HYIB 1HNZJ 1NAQA 2C3MA 3QT8A 3M6UA 4LRDA 1YI2S 4A8OA 2IAJB 1WOOA 4LSLA 2XC9A 3SMZA 3M32B 3GIJA 1X4FA 3VR1A 2ZM6J 4A8YA 1SVDA 3GR1A 3PW4A 1IBMF 2E1CA 4ELUA 3N5FA 4Q0BB 3CCTA 3IC1A 4JP8A 4KHMA 3IXQA 2J9EA 2ZH2A 4DV3F 4IQMA 2WRMA 2K3KA 1FO1A 4I2PB 2G2OA 3DI6A 4FYWB 2J8AA 2W4DA 3KTQA 3O6QA 2WW8A 4M5JA 3NL0A 2XB2D 5HVFA 3PYFA 5KG4A 2NXEA 4NOHA 5A6WA 2RRAA 2HVDA 2IIHA 2LDIA 4Y34A 3OVBA 4LF5F 2N4CA 1F60B 3M6WA 2DGQA 3OJUA 1BHNA 2V68A 3BREA 5H9EK 2HQ3A 5F8NA 2RD5C 1T95A 2KHDA 1FCAA 2KG1A 1C0UB 3NS6A 2D3UA 2QC3A 2WZ1A 3OR1B 1N54B 5AE2A 5HVHA 4DV4J 2ZVSA 2HG4A 2W24A 3CDAA 3OR2B 2XY7A 2N82B 4F0KA 4X4VA 2IM1A 1MN7A 2D9PA 3BGRB 3L09A 3LO3A 4N7TA 2YKNA 1HNVB 4PKDB 4ECYA 2DXEA 4IRKA 3BGRA 4FXDA 2NXUA 3R97A 2HWTA 4USIA 1GQEA 3M8PA 2O66A 5KG7A 3RB4A 2MHNA 4O4GB 5L1JA 3VCDA 1C0UA 3PJ9A 2UP1A 4CIOA 4LFAF 3TUJC 5ETMA 5GAGU 4B08A 3UW1A 4YB6A 2XMTA 1HQEB 2CJKA 4ECTA 3PZPA 2I9SA 5DO2A 2ACMA 4LVNP 5EUHA 1K8AT 2W8KA 1PJ7A 2GO8A 4KYZA 1RHRB 5CQGA 2OGUA 4RU2A 4QIEA 4Q8FA 3G2XA 3MXHP 3H5XA 4DV7J 3HF5A 3R5JB 4I2PA 1TZ0A 1U2CA 1EJ7L 3H4BA 3HM9A 1FJCA 2CQ2A 3MMBB 2FY1A 1DTQB 1B7FA 5BYRA 1RT2A 3UDCA 4KKOA 2CA9A 2DCLA 2F4FA 1WNEA 2XI3A 3TQEA 1GEHA 5D3GA 2HZVA 4FKYA 2XMUA 3W2WB 2XMWA 4NMXA 2B4PA 4DU7A 3R1HA 2X1FA 1ZETA 4AUKA 2MJNA 1FRMA 3NCPA 2CPFA 4NLUA 2H1YA 2UVRA 3QWUA 4GRSA 4DFPA 2IM2A 2GMJA 4K4TA 3QT5A 3G82A 1P8GA 2MKIA 3NNCA 4B9UA 3KLEB 4IG0A 5ETNA 2JVRA 1OY8A 3AB4B 3AXMA 1IN0A 4NLDA 4ZVSB 2BQ3A 2ABYA 3H20A 1HD1A 4QYRA 3THTA 1VLYA 4JI2J 2XSFA 4NI2B 1QTMA 1H73A 3ZNJ1 4IFVA 4HR2A 4NWBA 5H9EJ 1Y3JA 2XG8A 4UTGA 2ZJQQ 2ZC3A 2A1BA 2NXJA 3CE8A 4NE9C 4F0HA 4U67Q 3CCQS 4HHJA 2CPHA 4OHVA 3PHTA 5J1EB 3MR2A 4I64A 3MR6A 1XJWB 4DCPB 4ID5A 1IM6A 1V3RA 2XMKA 2X7IA 2D3OR 3QJJA 4N8OA 2ALYB 3JSBA 2XLIA 3KYLA 1RQ0A 2ZZMA 4XIUA 2HEKA 5IT0A 3UDEA 3K0JA 1EZZB 2J76E 2RU9A 3KG4A 4DSFA 4DSKA 1C1BA 1G4CA 2GCFA 2KL8A 3PIPQ 1W26A 2KT3A 3BBFA 2R8HA 4P2FA 3KLGB 1BMQB 1YRTA 4C11B 2AD9A 2BZ2A 3A1YG 3UI3A 2J6TA 2OTJS 1EQMA 2V50A 3FEYB 3M05A 1VS3A 3PFEA 4OI3A 4TY8A 3TX8A 5EWGA 4DFMA 1UW9A 3BSCA 4ES1A 1BGXT 2CNLB 4WIQA 3C2PA 2EKYA 3QYYA 1XNRF 4NYPA 1S0VA 5CH7B 1VLOA 4L76A 4KB7A 3TUZC 2B4VA 1JLFA 2H9ZA 4DV2F 3SV3A 4NXNJ 1F1BB 3RW7A 5CXTA 4RJVA 2I5JA 5E3AA 3R6GB 1NPKA 1NHVA 1YGYA 4NASA 4JI3J 2IYIA 4CO5A 1DLOB 3QAUA 2CNOB 5HK4A 1C1BB 4YMEA 3M8RA 1QSSA 2GV1A 3TI0A 2DR9A 3ZTRA 3WX4A 2GQ2A 1TKZB 2NYIA 1X4BA 5IOLA 4LF4J 1SI9A 3SCIE 2GW8A 2MDAA 2EG1A 1HL6A 2OPPB 3PX4A 4ID5B 4ZP7A 3UCGA 4G1IA 3LPYA 2WONB 1HPZA 4ILRA 4YS2A 3UD4P 1WSRA 4DR7F 1UEVA 3NNAA 3FVYA 3IBCB 2DNMA 3PACA 3H4DA 2XS2A 2IM3A 3VVUA 2IJRA 3M8QA 3W65A 2PI4A 2KVIA 2R7UA 1UCNA 3K5LA 1XTZA 4K4YA 4J9RA 3P6YC 4IYQA 4CLWA 3IN5A 1AXQA 1FERA 1OMSA 2Q1LA 3DYAA 3M2RB 1RGVA 2FUG9 4AFFA 4ZIWA 3JYTB 2MZRA 1K47A 3FMBA 4F3MA 1Y11A 1QM9A 1AUSL 2CPDA 4PR6A 4BLGA 4YB1P 4CP5A 1FKOB 3GZ7A 2E9ZA 2JLGA 4NLXA 4UOHA 1S1TB 1FF2A 2WVBA 4IG0B 1BD6A 1VJWA 2APOA 2GJIA 3D4JA 4P7TA 3ZZZA 3MR3A 1TAQA 2G1DA 2KZZA 1RT5A 5HQLA 3MI7X 1TUVA 4X65J 1YJWS 2HQCA 2AYBA 3QQCD 1WHWA 4KHRA 4YDXA 3SV4A 3AQPA 2CVEA 1HWIA 2PIIA 7FD1A 3FFIB 2GGPB 1FFGB 2HVZA 4P10A 5CZXA 2UU9F 4KHPF 1IXKA 2R7XA 4B9NA 2CKWA 3DLLQ 3JB9k 2BJ9A 5HP1B 3KK2A 1HBNB 4UY8T 5J1PA 3MD1A 3NEKA 3KLIB 3J81U 2RKIA 5CYQA 4UUWA 2WSCC 1NJXA 1JLGA 1LW0B 4C8MA 4DZ6A 2QTWA 1RTJA 3OTOF 1H38A 3QBCA 4PAAA 5LSRA 3V81A 3TAQA 4RO0A 1UWBB 3T6BA 4QQBA 1Q4RA 1TELA 1IR2A 1S5ZA 3FBBA 4LSZB 1NJZA 2B9EA 4Y00A 1T05B 4DMZA 3OLAA 2HQIA 5IWAJ 2VU5A 2KVQE 1O6XA 3FSXA 4FYXB 3UR0A 4L72B 2ROGA 2VIHA 2GVZB 4MYTA 3SFUA 3E01B 2N7YA 3JYTA 2CQDA 4ZLPA 1U1KA 2UU9J 2WVDA 1JLQA 4LMZA 2M5YA 2VV5A 2HSEB 4RW6A 1CC7A 3DDIA 2CUYA 2ZUGA 5KFIA 1UVIA 5H1SV 2WTFA 3M8PB 4K0KJ 5B0CA 2BYCA 3G86A 3OUYB 3HD1A 1S0OA 2BQUA 3UDLA 1RT4A 2K7JA 4JI3F 2X51A 2F4VF 3ZTSA 2NPFA 2KXFA 3TWZA 3ULHA 4TU9A 3D67A 3DRPA 2C42A 1T9TA 2E1MC 3OQ2A 4KV8A 3T9NA 3HHDA 2QMXA 3LGMA 3U02A 5B08A 1VJQA 5IM0B 3OSNA 1JIHA 2B0GA 2NLWA 3R27A 4YEAA 3IWLA 5AXKA 4ZLNA 1EAYC 1JNZB 4ZCMA 3H5SA 5E33A 1FEEA 2QZ8A 5ETTA 2LKZA 2KXHA 2UVVA 3DRSA 2VBXA 1T9XA 3PG9A 1Y4ZB 4DI6A 2IFXA 2LU2A 3T3FA 1X9SA 1VQNS 4OYOA 1UAWA 2JJ4D 5DM7Q 4IH5A 3IGVA 1M0SA 2EG2A 1DURA 3KWMA 2V8DA 2HMIA 5T41A 3EGVA 1OO0B 1FTCA 4E2FB 1D8YA 1Q8BA 2DRAA 1VRQC 1RHUB 2VFSA 1HNWJ 2OKQA 4OJHA 4Q0BA 2VPWB 4XPCA 5DLFA 3M32A 2M2BA 2BJ7A 5U47A 3EVWA 4ZP8A 1VIXA 3OFHA 4C11A 1G7CB 2XQCA 1RT7B 1YLXA 3EE3A 4F3QA 3QFHA 3V6DA 2AYMA 1RSCA 2J0SD 1VQ5S 1L3KA 4DR1F 2H54B 1FD8A 2DJWA 3Q2TC 2W7AA 3EX7B 5C25B 1S6UA 3MEEB 3KLFA 4LQ3A 2HHXA 2HRYA 4JV0A 1SV5A 3DLGA 1R8PA 1YITS 2QLFB 4L75A 4IOBA 2DNZA 3PEJA 4UUXA 4EMDA 1N5YA 4PQUB 2I1RA 3N6LA 4PXCA 5KFHA 3LP2B 2G2ZA 4Q2MA 3G4SS 4DX7A 4QJVA 3FCHA 4EUVA 3D68A 2IHR1 2HZAA 2VDIA 1H2TZ 1MMNA 3F44A 2D3O1 1ZTTA 4ZJLA 3UVJA 4P2XA 3J7ZT 2RRNA 3QATA 3OXLA 3LAKA 3JQMA 3N6NA 4YR0A 4I67A 4DWIA 3A13A 2NYHA 3U1LA 5KT4A 3GQCA 1S72S 3FZ2A 4AD6A 2RUSA 2W9AA 1ZPWX 2ZITA 1KFDA 4HVZA 8ATCB 3TZZA 4EZ6A 2Z8QA 2OP5A 1FRLA 4JB8B 3M8SA 2FVSA 1TK8A 2YKPA 4Y2KA 3DOMA 3N01A 4OLPA 2E5HA 2NZCA 5CABA 2AJ4A 2V69A 3AHPA 4KO0B 4B9TA 4KHPJ 2KZMA 2XWXA 1APSA 4JI4J 1IBMJ 2PMWA 3M8WA 4N47A 1SJRA 1GK8A 2EFOA 1RT2B 5C42A 2DY1A 3QRRA 3OFEA 1DTQA 4DN9A 2B6AA 1CPZA 1LEOA 1OYDA 1UETA 4DR2J 2PA8D 1MWYA 3H40A 3MZIA 2Z2LA 3MPVA 2RHQB 3MWBA 5B0EA 1Y5IB 3A8IA 4ZVHA 2UVUA 4AQYJ 3CJ4A 3N6MA 1QSYA 3RBXA 2DD8S 4JI8J 2KM8B 1KSPA 2RDIA 5KFEA 3BYPA 4K4WA 5I3QA 1Q82T 2XLKA 2Y9HA 3NS7B 4OZ1A 1NPRA 5IM0A 1UZDA 3TVYA 2KFYA 2FB0A 4X4PA 2XMJA 2COLA 4CLSA 3EYZA 2XTJP 2E66A 4NLSA 2R8JA 2W4PA 1MNEA 2I6WA 3ZFVA 4RU9A 4DV7F 3OV7A 1SH3A 2ERRA 3G96A 3CO0P 3HHKA 4LVOP 4DS4A 4J9MA 5HJYA 3KUGA 2FVPA 3OR1A 4HHHA 5H9FJ 5IXUA 3EPIA 2ZD1A 2WB1D 1VC5A 1CS4B 2DGTA 1TFYA 3PHEA 2MMYA 1YX2A 4P73A 3Q24A 1X4HA 2AJFE 2HHPA 2BEFA 1EKRA 2JHEA 3D1QA 2C3PA 4QR1A 1BQMB 4RBTA 3GE9A 3MCMA 5ETVA 4ED6A 3V6KA 3KJVB 2NPIA 3UNYA 5DQHA 3HFVA 3KUEA 3M2UA 3TVZA 3MPYA 5MLCV 2BXJA 2P5VA 3CD5A 4MTPA 1JLGB 1LW0A 1GTHA 4MJKA 2PFFB 2K8GA 3K5MA 4FN5A 1D9DA 4AE5A 2BUNA 4Y3CA 2HVIA 3VGSA 1HBNA 1NZAA 4JI4F 4LSLB 3POTA 2JVOA 3Q2SC 1LKZA 3GIRA 2Y3YA 2R42A 4KSEB 1VQ7S 4DU8A 2QX0A 1B99A 1RKIA 3BYRA 4ZVOB 3I56S 3ITHB 1XMQF 3DCAA 2QSWA 4IH7A 1FFWB 3LWLA 2IVFB 2QV6A 2YPYA 1R0AA 3UPFA 3PFOA 2DO0A 1RT5B 2DNNA 1BQNA 2Y0BB 4TQRA 1RTHA 3DM2A 3EMTA 3FMWA 5EGYA 4Z7CA 3KLVA 4B3RF 3ZZRA 4DPXA 2VFUA 2CQ0A 4L6V3 4OI2A 2J6SA 4RR5A 2F40A 2K1RA 2KFZA 5IFMA 4ITSA 4DL6A 1IBKJ 1YWXA 2HAIA 1I6JA 3BN4A 5DZ6A 2BVZA 1Q7YT 4DQRA 1NK0A 2YNIA 2DGUA 2QYCA 1HKAA 2RHSB 3P4UB 1N88A 2ALZA 2CQ3A 2DNHA 2HFVA 2KI2A 2M8HA 3HX9A 1LK5A 4DV1J 4NYZA 4XDDA 2BANA 5F8IA 3SCLE 2RF2A 2V8HA 2OPPA 3ILLA 1UFWA 4AXJA 1RAFB 5AXNA 2XGQA 1ULRA 4ED2A 2Z56B 3IR6B 5HMXA 3OHBA 1S7IA 3GV8B 2AKWB 4KFBA 1Q86T 4C8LA 4QYZK 1M5HA 2L3MA 4CTAB 3PDNA 5A2QU 2QFJA 2Q66A 5F8JA 1DLOA 2FVCA 4ZK7M 1H74A 1UJ6A 3IFEA 2YWWA 5KT5A 3GIKA 3RRHA 1CJVB 4Y6IA 1VIOA 1UA0A 1UZHA 3H59A 2ZJPQ 2KJVA 1GT8A 4C0OC 1HI0P 2RS2A 4WK1A 4V1Ak 3TP2A 4YFUA 2LVWA 3VGTA 3DOKB 2R7WA 3CJ8A 3Q8VA 4OJGA 3VQSA 1RTIB 4FYVB 1RAEB 3HZEA 5HVGA 4LF4F 5GMEA 5J2PB 5KT2A 4P72A 3DRRA 2RNEA 2V0NA 3M2VA 2XYPB 1QAJA 2BOAA 3B82A 3J80Y 2DNGA 4OZNA 4OYIA 3QO9B 2UVWA 5HBMA 1HWKA 1P6TA 4OZ2A 2J9DE 4Q7AA 4EYIB 1NDPA 2L48A 5KFYA 1M5OC 3DU5A 2WK4A 1JKHA 2CJXB 4BHQA 3CF5Q 3BSAA 1WDTA 2L41A 4I6AA 2P9EA 2KH9A 4A8XA 5IT4A 2DIUA 2V8GA 3PJWA 3WC0A 4U95A 5J1EA 2JEFA 3H7HB 2DH8A 1Q53A 1RADB 4P9SA 2C2NA 3WQPA 3N9UC 5HBMB 5GADU 3SZ2A 5HLFA 3C46A 1DFDA 4F4AA 3HPOA 4KIAA 3WIUA 2C3UA 4DR5F 1PILA 3CCMS 2BRLA 2CPJA 1TAUA 4XAKA 3QLHA 1JLBA 2E5LF 4KPCA 4ZVGA 2BRKA 3NGRA 3QPIA 4JYAF 4ZOSA 4PCQA 4Q44A 3PO5A 4PWWA 4ZA1A 5FLXY 3MUMP 3P49B 2CFXA 3VAJA 3DOKA 5B0AA 3AOBA 1OSDA 2BKOA 3JTPA 2AGOA 2WOMB 4M5IA 4NL5A 1SJ3P 3HJFA 1CJTB 1SUQB 1VCTA 2MZJA 3E2EA 2Q79A 2MZ1A 6FD1A 1GMWD 3M9NB 3RTVA 3DGPB 4OYMA 1RT6B 4YN3B 3W2WA 2QT7A 4ECXA 1N36J 2WW4A 1RWKB 5K8OA 2MEWA 2XSJA 3D54A 4A4JA 1NJWA 3VF0B 2IMWP 2JEGA 4J9PA 4C2MA 1WKJA 2Z58B 4ZVPB 1HWLA 1SKUB 4GVBB 4PXDA 2EI5A 2VG7A 3GJRB 3OTCA 3TO8A 2ADBA 1KRPA 4WIIA 3BKUA 3K58A 2DR7A 2MY8A 5HSPA 4NLQA 2XCPA 2MQMA 3AB2B 3LA0A 1S1VA 3SDEA 1A7GE 1H2VZ 3EGWB 4FPRA 1EETA 5F8GA 2B9XA 1X4DA 4HL9A 1XNQF 1RDRA 4JI5J 4Q43A 2XZWA 2B56A 1QAXA 2VJVA 3BM7A 2LEBA 3IBFB 3I4PA 4J7CA 4L3KA 3NMRA 1U4BA 1TK5A 4WFAQ 1IKXB 1D3WA 3H98A 1KOHA 2FY8A 4FVMA 4IG3B 2R8IA 2IA6A 1RE1B 2ROEA 1RTDA 1H6KX 5D0EA 1BQNB 5LJ3Y 3ZZOA 2HFSA 3SIPB 1NNDA 4TLRA 1VQPS 4DJBA 4B3OA 4TYBA 2FJAB 4ZVRB 1XQIA 2AT1B 4DV0F 2VL1A 4YDDB 2VG5B 4JI1F 2GHWA 3QJLA 1NH7A 2YNHA 4LREA 5LM7E 3G6YA 3KHHA 2ZBQA 3AY0A 1VR6A 5KFGA 3QSIA 4O3NA 2HVHA 3TNVA 5LXRA 2V9WA 2VC1A 2B7CB 2RDDA 1HBOA 3SYZA 1C1CB 1WHYA 2FHKA 2IDLA 2QYGA 5FD1A 4AYBD 3TAMB 5B0BA 3HVTA 5JUMA 4ECWA 2DNQA 3RAQA 4F8RA 3HULA 2DGSA 2H5JB 3LWMA 5J2QA 3BO4A 3RZAA 1NK9A 1FNMA 4NCBA 4C6AA 3CEDA 4PXBA 1REVA 4J9UE 1TFWA 3NY0A 3VWSA 2EPIA 1RBLA 1VQLS 4MKVA 1U1NA 4CO0A 2XNQA 3V6HA 1TR0A 1NMEB 1HQUB 2CZ4A 2Z30B 3TAMA 2ZDPA 3E51A 4CLFA 3OLBA 2ZWPA 4GVLA 3KHGA 2JEJA 2XHWA 4F04B 5LJ5Y 1N56A 4QU6A 1UVMA 4M5KA 3IAM9 3R7BB 1EIYB 3HVRA 1HHTP 3UCUP 2ASDA 2I2YA 2FJXA 2BMBA 4BWMA 4F7VA 2HS3A 1SJ1A 1UL3A 1ZA1B 3MAQA 4QYZJ 2GMLA 3OTBA 3HSJA 3MAHA 3Q0AA 1PG5B 1Q79A 4EI2A 4CO3A 4HTJA 1RAJA 2OSRA 1SH2A 3EM1A 2BE7D 3HJVA 2G2YA 3H2LA 5JMNA 3TARA 2VA3A 1WHVA 1F9HA 3MM8A 2L9WA 3PM9A 2DXFA 1QUPA 2CYYA 3QZ7A 4DV6J 2AGQA 4RNMA 4JV5F 3MEDA 3MM5B 3W7BA 2PMZD 4DQPA 1AB8A 5GADI 4LF7F 4ZVQB 1XR7A 2JC1A 1DHMA 2R7OA 1U8SA 3CXCR 2DHSA 1X5SA 4RW8B 1R6YA 2IJNA 2OFHX 2OO4A 3KK3A 5IZHA 3PRDA 2VG6A 4Y2MA 3SXLA 4PWUA 1LWFA 3FDSA 1ZZNA 2DYAA 3T6JA 2BM0A 3KLHB 2NXCA 2GMHA 5MAOA 3RYLA 3FRZA 4XTTA 3CCUS 4RUHA 1IKYB 5D8HB 5J1NA 1F9FA 4X4RA 3VAFA 3T5HA 2HPUA 2GHPA 3UCZP 4LFAJ 4CO2A 5GAEI 4P2SA 3DOMB 2QN6B 1Y7PA 5A2QY 4PUOB 2RH3A 3T1HJ 3NWGA 1RJJA 2QE5A 1PJ6A 1IKYA 1UMJA 2E7WA 4J9LA 1SUQA 1T3OA 2B43A 4RNFA 4QPTA 2BE2A 4QR0A 1I3OB 2AEFA 4USMA 4X4TA 1KTVA 3J7YI 1LWFB 2X3DA 4K5SA 2EVZA 3ET6A 1N34F 2Z2MA 2OH2A 4MKYA 1Z4UA 4ERDA 4J90A 3BO2A 5KFDA 2H5EA 1ZAXA 5CA5A 5D4OA 4J9SA 1SL0A 2CADA 2W4CA 3PW7A 2J5AA 2RUGA 3UQSA 1MG7A 1BC6A 4OI0A 3HK2A 4PQUA 1NB2A 4CRJA 4CM0A 5ETOA 2ZE2A 5HO4A 1S48A 3V5RA 3I6PA 3PKYA 4JV2A 1Q5YA 3E8OA 4HDHA 3QIPB 3NG8A 2CG8A 2BX6A 4O44A 3UDVA 5DETA 2XY6A 2YNFB 4KY3A 1YJRA 4X84A 3CVKA 4E98A 2MZSA 1H98A 1WDDA 4D3HA 5DLGA 2DK2A 4M5LA 2J0QD 1U0SA 1NKCA 1S57A 3MGJA 3HP6A 1K0VA 5KFCA 3WX8A 2ZC4A 1VQ4S 1FNOA 4ELVA 3RB6A 1JK9B 1IBCB 3DGVA 3I96A 4A8WA 4EU0A 2DBBA 1FDDA 5BXIA 2UUTA 1RA6A 5D4PA 1P27B 2NR0A 3M7VA 2DEJA 2PD1A 1U6BA 1EP4B 2AJ0A 3I4HX 4MK9A 2UXCJ 4WKRA 2CPYA 2YKOA 3WHIA 3M9OB 2X1GA 4WTYA 5KFTA 3HXMA 2POKA 1WELA 3DNCA 3K2YA 5E3RA 4BC7A 3CJKB 4XPEA 1MLAA 1WACA 1OQ6A 2OPSB 1CJVA 2Q6BA 4F4WA 2MPUA 1DJ0A 2IA0A 2NUUG 4ELTA 3MM9B 2J7WA 2DCUB 2RB7A 4J9QA 3JAMY 3HD2A 1F5AA 2VPZB 4RNHA 2ATLA 1T03B 2CZ9A 5D0RA 2VG5A 4ZJQA 3G6ES 2E1AA 1KOOA 2XCAA 1RP5A 3M8YA 4MIBA 4P6QA 3TA2A 3W1YC 1NDKA 2DPJA 4KGMA 4DFJA 3ICLA 1I94J 1GMWA 2QL9B 3MDFA 4ANCA 3NAHA 2YWHA 3SCKE 5LMUF 4DBQA 4RW6B 2RRBA 5LL6d 4UZBA 4G3IA 2LXFA
chains in the Genus database with same CATH topology
3M9MB 3BGLA 2AJ1A 7FDRA 4DFKA 2CQ4A 1W25A 4OHXA 2XS7A 1S1VB 2VFRA 3N0VA 5F41A 2ZKTA 1T05A 3MURP 1RTHB 1UWBA 4YP3A 2IYGA 2E7XA 2V4RA 4KTQA 2VG7B 2UV8A 3PKMA 4CCHA 4RW7B 1IBKF 4X4NA 2QMWA 3I31A 4FNIA 5CYQB 5KT7A 4C3LA 5F9LA 3NP5A 4BDPA 1X5PA 3FJ2A 1SL2A 3KK2B 5K9FA 3CCVS 4DR6F 2CJAA 4IKAA 1J5EF 3POTB 4HKQA 5A8WA 2F3JA 2BA9A 1FT8A 2GGPA 1RT6A 2XWYA 2UXCF 4NPOA 4KE5A 3KNGA 2JH3A 2O67A 1BY9A 1YBAA 2RQ4A 2IVMA 1S97A 4LJMA 1Q8IA 1FJGF 2UXBF 3M2UB 2YKAA 5C5JA 2R2UA 2DPIA 2IJFA 3CC7S 1K9MT 2E9TA 5HMZA 4MK7A 1YVFA 1S1TA 4LSNB 2HLTA 5IS2A 1ZM4A 5KFSA 3BEGB 4H4KA 1RT1A 1FE0A 3RR8A 3MECA 1V9OA 2HIQA 4HI1A 2ZH6A 1YJVA 2JZ5A 1GNKA 5IQ6A 2I0XA 5E3PA 3FGVA 1XMBA 3SQGB 1FDAA 4BCAA 4DV1F 1S6QB 3CO9A 3MM7B 3QIPA 1OPZA 4IO9Q 3BJYA 2DHXA 5AXMA 4DR3F 3QO9A 2ZE2B 1R8HA 3PJXA 4ECSA 1F5CA 1Z2ZA 2DH9A 1FKAF 1LXJA 2D7SA 3LGNA 1FESA 3HI9A 5J2PA 5B7WA 1M5KC 3QGHA 1VQMS 1RTIA 2MJUA 3VAIA 4C4WA 2ZDOA 4IR9A 3QGIA 1WTBA 2CJ9A 1MROB 3BGFA 4AQYF 1Y5LB 1X5TA 3DDNA 4KRWA 4DSIA 2JRSA 2LEPA 3GFZA 4DDFA 1I94F 2IMOA 4JOUA 3KLGA 2JDJA 1RK8A 2KKHA 4B3TF 3R3TA 2NUHA 4KFBB 3D0IE 5DG9A 2IC3B 5J2NB 5K8MA 2FLLA 4QWDA 2NSBA 2E5JA 2RF2B 2BANB 4QOTA 2B4UA 2VONA 3UNGC 3DLJA 1JWWA 2KM8C 1X4CA 2VG6B 1ZBTA 4RW8A 2YNIB 5LMNF 4M95A 4J5OA 4IFVB 4ED1A 5KFKA 3B4DA 2E29A 4OI1A 2LEAA 3KOAA 2PE8A 3KG0A 3T1AA 1IQZA 3I9ZA 3GSDA 3MM5A 3B78A 3RB3A 4WE1A 2GO9A 2JFDA 4K59A 3IA0A 3EZ5A 2N3OA 3AA9A 1LQ9A 4NYOA 4TYAA 3MM8B 4X4QA 4H4KC 1QVFR 1IM4A 2IM0A 4C8KA 3BF4A 4KT0C 2JOQA 3BQ2A 2ZOFA 1UVJA 1BLUA 2HFOA 1WF2A 4ES3A 1DBDA 4R0EA 3KFWX 3NCQA 4HTIA 2VASA 3NCRA 3GB0A 3G8TA 3GYNA 3G71S 4O3RA 1CEZA 3CGIA 4ZPAA 1VQOS 2M52A 5DDQC 1B0VA 2NZ4A 2VPYB 1KLMA 2WHOA 2YKMA 4NX9A 4RUAA 1FTRA 3JSMB 4QIWD 1WEXA 1MW7A 1BQMA 3DRSB 2AYGA 4RLEA 1TL3A 3OVAA 3T9ZA 5IQQA 3PO4A 4I2QB 2EBEA 3GIIA 1C1CA 1NKBA 1UFLA 4NA1A 2LU1A 4PXEA 3KHLA 3K8VA 3RRGA 4X4UA 4DV6F 3O2IA 4MAKA 1R89A 1FK9B 4O3QA 2YNHB 3AH6A 1N5TA 2RU3A 4RX6A 1JLEB 4YQWA 1RISA 1K0TA 5THWA 3E3XA 2UUWA 1O8BA 3UR3C 1NU4A 3OUYA 2GA7A 2QSFA 5L1IA 1N5SA 1HBMA 2LYVA 4R8UA 4Y0FA 3C3LA 1JLQB 5CCLA 4O3SA 4E8UA 2QIFA 1X5OA 4OL8A 4MYUA 3L95X 2VUGA 2OLWA 2FGCA 2AP6A 3VALA 3EGNA 3OXFA 4OX6A 3SDEB 4RBUA 4CT9A 1HBUB 3HFKA 2YH1A 4X65F 1CSJA 2GX8A 2HGMA 2VBZA 2VOPA 1T3NA 4LIRA 1L5UA 1U49A 4IOAQ 2OPRA 5LSOA 4N56A 3KK1A 4K4SA 1U26A 2FLNA 1NHUA 2RMLA 4I1TA 2P9GA 4DF4A 1CVJA 3LF0A 2B5JA 2MQPA 2MQOA 4JI6F 2IAJA 3MMCA 5KG6A 1U1OA 2UUBF 2B9WA 4C9DA 1HI8A 2AQ4A 2GFFA 4UOCA 1UVKA 3I87A 4M5DA 5CYMA 3VAKA 3RAXA 3E2EA 4FF4A 1X0FA 3AA8A 3KMQA 2HHQA 3EGZA 3GWCA 2HS4A 4DUZF 4CH0S 2R8KA 1TL5A 2XULA 1JJHA 4HI2A 3LAMA 1KR4A 4QPXA 3Q8QB 1PC4A 1T94A 3FQLA 3WC2A 3CCES 1V3SA 1S99A 2OPQA 3QLHB 3O3LA 3I32A 2HLUA 3NGKA 3TA1A 4Z2XA 2FVRA 2M8DB 1U09A 2QRRA 4EEYA 3VTIA 1G6BA 1GTEA 2CIMA 3ZZPA 3PW0A 3X1LB 3C6TA 2HHTA 4KC5A 1JNRB 3LP2A 2Q3PA 3PY8A 4R0JA 3ONQA 3CMES 2HZCA 3RBEA 4EBEA 3IRXA 1HPZB 3MTKA 1N6QA 3DLGB 2ROPA 1AW0A 4ICLA 3U1NA 4NLOA 1S6PB 2YNGB 2V5HG 3BSOA 4IFYB 4RW9A 2N3LA 4ES2A 5GAHU 3DMJA 4DV4F 4MH8A 4DSJA 4NMLA 1NKEA 2XNRA 2OTLS 4AL6A 2RQMA 1WG1A 4J37A 4GO7X 1AROP 4KGKA 4OZ5A 2XMMA 2PMHA 4QWEA 1BQXA 2F9JA 3EPGA 2R2SA 3BQ0A 3PVXA 3RR7A 2E44A 1FHTA 1H7WA 5BYQA 1P9QC 3P3DA 4ZPCA 2WAQD 1ELOA 1TV6B 2HMIB 2V4JA 3UE2A 1C4CA 3S1TA 4DLGA 3V6JA 1VK3A 1QAIA 2HWHA 1MSWD 2K3IA 4YR2A 1SKSA 3IS9A 1S1WB 1R8CA 1WTFA 3FQKA 1CQNA 2F8MA 1L3VA 1N0VC 1JXEA 5HROB 4UY85 4I4BA 3CSKA 4NLYA 2MGZA 2J7KA 2PEHA 3EXCX 3DRPB 4I56A 4KV8B 5AE3A 2IVYA 5GAGI 4RW4B 5KT3A 4CH1A 1SC6A 1U24A 2XBPA 1TKTA 4ETXA 2R9LA 4OI6A 2VOOA 2VPXB 2DR5A 4B9LA 4BBYA 4GKKF 2XO7A 3CCZA 2BR0A 2MKSA 3N4WA 3OPKA 1L3SA 1HW9A 2O01C 3KMSA 1C4AA 3L7PA 2QA2A 2JFKA 2CQCA 1XERA 2GNKA 5DJBA 1WI6A 4M63A 4ZHRA 2E1RA 4FF1A 3PR5B 4DL7A 4PG5A 2JC0A 1RTJB 4XO0A 1R0AB 3O8WA 2OJ3A 2X3GA 3I0RA 3FEZA 3ITHA 2DHGA 3J7Z5 3Q8RB 2M9KA 5HP1A 2VFTA 2KHCA 1ZAWA 4XDCA 3FFIA 3FRYA 2KB2A 4KKOB 3CDWA 2C3OA 1IKVA 3CDEA 3I0RB 4USHA 2R7VA 2BBEA 1VRUA 4URSA 1D0EA 1S6OA 4JI2F 5AE1A 4RWXA 2JWNA 1JJ4A 5F9NA 4X4SA 3KHRA 1FKOA 1S9GB 4OLOA 4K4ZA 1WF0A 2CQ1A 2M88A 4FF3A 3M2RA 3DYAB 2VB6A 2IRYA 5L1KA 5HMWA 2CJQA 1GH8A 3VQTA 1ZZFA 3M8QB 1DTTB 3O1LA 1UW4A 5KOXA 1YJNS 2HNDB 2W7PA 1HNVA 1D9AA 4USJC 2AWZA 2WONA 4WFXA 4TU8A 2SXLA 1C2PA 5IT9Y 1P1LA 2OMLA 1TKZA 1K1SA 2HGNA 4DOZA 4IRCA 4I0WA 1J2VA 2VKRA 1X0PA 4TY9A 4N76A 4ZDNA 2W9CB 1RYRA 3CD7A 4OQJA 2IRXA 3I0SA 4CQ1A 3OL6A 3MUVP 2YVSA 2ZFHA 4TKTA 1OSCA 3FEXB 2V4JB 4E0DA 2C3YA 4H4OB 2QA4S 5L9XA 2G4BA 4ZPWR 1HHSA 4KPYA 4OHYA 4UQGA 3QZ8A 2ZHOA 4C8OA 2MZTA 2M4MA 4TY8B 4J9KA 2LDYA 3OVSA 2MY7A 4PG7A 4JI0F 4ED0A 5I42B 2N7CA 4LF8F 2KJWA 1PSDA 1V3ZA 1RWUA 4WFZA 4FP9A 4F25A 4I68A 2W7OA 1KQKA