1A9NB

Crystal structure of the spliceosomal u2b''-u2a' protein complex bound to a fragment of u2 small nuclear rna
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
94
structure length
94
Chain Sequence
IRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords RNA (5'-R(*CP*CP*UP*GP*GP*UP*AP*UP*UP*GP*CP*AP*GP*UP*AP*CP*C
publication title Crystal structure of the spliceosomal U2B"-U2A' protein complex bound to a fragment of U2 small nuclear RNA.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 94
sequence length 94
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1a9nB00
2MMYA 4CH1A 1VQPS 4ZKAA 5HO4A 3G8TA 2M2BA 3UE2A 2DHSA 1JJ2R 1IQTA 3EGNA 2MXYA 2MSSA 3U1MA 3UCGA 2G4BA 5IFMA 2AD9A 4OZ0A 2DK2A 2L9WA 2KG1A 2CPDA 1H6KX 2CQCA 3P5TL 2KXFA 3J7ZT 2E5HA 1OIAA 3MURP 2BOPA 2SXLA 3S7RA 2FHOB 4LJMA 1PGZA 2DIVA 2XSFA 4RU2A 4WF9Q 2CPIA 1QVFR 5MLCV 2VONA 2LA6A 2MQLA 5DM7Q 1NJIT 2CQPA 2AYGA 3VAFA 4PRFA 4Z2XA 2ERRA 2RQ4A 2XNQA 2M8HA 3G8SA 2KU7A 3CCSS 1XN9A 3NNHA 2MQNA 1VQ8S 1YI2S 1WTBA 2E44A 2MQQA 2LKZA 1X5TA 3G96A 2MZRA 3CPWR 2L08A 4F02A 1QM9A 1FJEB 2X1GA 3MUTP 2KXHA 5GVQA 2J8AA 3CMES 1WHVA 2CPHA 1N52B 2DGOA 2MYFA 5IM0A 1VQ7S 3IWNC 4CQ1A 2DISA 4LIRA 1U6FA 3ULHA 1VQ4S 2CQGA 5LXYA 2E5JA 2DH8A 1Q81T 2MZQA 3G6ES 3VAIA 3LQVA 1X4GA 2MJNA 3MUVP 1YIJS 2MHNA 3I56S 2DNPA 2PE8A 2KM8C 1VC0A 2VODA 5ITHA 1FNXH 4C7QA 1VC5A 2G1DA 2RNEA 5IQQA 3TP2A 2DNZA 5GADU 1X4BA 2DNGA 2YH1A 2XB2D 1W2BR 3NS6A 1L3KA 5JVHQ 5CXTA 2F9DA 2CQ0A 5D78A 2K3KA 4YOEA 1WG4A 2D3OR 2I2YA 2FC8A 3EGZA 2CQDA 2EK6A 2CPJA 2KXNB 4ERDA 4Y00A 4QU7A 2DO0A 2KG0A 3CCQS 3VAMA 3NNAA 1M5KC 2KRBA 2F3JA 4FXVA 1M90T 2DH7A 1VQ6S 1P1TA 2U1AA 1WF1A 1M5VC 1UFWA 2HGNA 2CQIA 5GMKa 3EX7B 3CF5Q 3DLLQ 1VBYA 1Q86T 3HI9A 2RRAA 2DNKA 3UD4P 2KFYA 5DDRC 1HL6A 2RUGA 2MJUA 2YKAA 3BEGB 1WG1A 2RT3A 3VALA 3BS9A 2MGZA 1VQOS 2I38A 3CC2S 1X5OA 5LJ5Y 1WF0A 2ZJPQ 4UQTA 3OW2R 1YHQS 1U1MA 2CPZA 2LXIA 2LEAA 1DBDA 4IOCQ 3ZZZA 1U1LA 1FT8A 1X4AA 4OZ1A 2BZ2A 1VQMS 3CUNA 1X4EA 1DRZA 2QA4S 5GAGU 1KOHA 1ZZFA 2DHXA 5IM0B 4QU6A 4QQBA 2DHGA 2DGWA 2MKKA 1OWXA 2JWNA 1X4HA 2U2FA 1WHYA 2EVZA 2DHAA 3SXLA 2XS2A 1H2UX 1D9AA 3JB9k 4J5OA 1M1KT 2MZSA 1F9FA 1OPIA 3K0JA 3VF0B 1VBZA 2J76E 1WHXA 2MKIA 4WFAQ 3UCZP 2MY7A 4TU9A 1KD1T 1U1KA 2FY1A 1UW4A 4V19X 2LA4A 3V4MA 1DZ5A 3CC7S 1X5PA 2DNNA 3NS5A 1OO0B 3VAHA 2DITA 5DM6Q 2NZ4A 1VBXA 3H2UB 4FXWA 2WBRA 1U2FA 1G2EA 1KOOA 1YTYA 2GO9A 3Q2SC 3LPYA 2G0CA 3IRWP 1Q82T 5HL7Q 2DGXA 2MQOA 3MD1A 4IUFA 1U1NA 1M5OC 5CA5A 2DGSA 1WHWA 1VQLS 2HZCA 2FPHX 1WEZA 2M52A 1VQKS 1UP1A 1U1QA 2X1FA 2M0GB 2HGLA 3N9UC 5LXRA 4WFNQ 3R27A 1YITS 3FEYB 5LSLA 3UD3P 1N88A 4CH0S 1FHTA 3MI7X 1D8ZA 2JX2A 3TO8A 4U67Q 2UP1A 2DGQA 2XNRA 2LECA 5DDPC 1H2VZ 2KYXA 5D77A 1SJ4P 3MXHP 2MKHA 3CULA 1YWXA 2MKSA 1X4FA 3MDFA 2MGZB 2M8DB 3CXCR 1YJWS 2KT5A 1UAWA 4TU8A 2EK1A 2AYMA 3S01A 1A9NB 1WEYA 5BJRA 1X4CA 3CCUS 2DH9A 2M9KA 1M5PC 2CQ2A 1ZH5A 2RS8A 1O0PA 2YTCA 3BO2A 1CVJA 2MZTA 3US5A 2CPYA 2HGMA 2CQBA 2YWKA 1HD1A 4WKRA 2DO4A 5DDQC 2CJKA 2RS2A 2CQ4A 1YJ9S 2HYIB 5LJ3Y 4UY8T 2RRBA 2OIHA 3VAGA 2RVJA 1A7GE 2KI2A 3D2WA 2DGTA 1KQSR 2CPXA 5CYJA 2OSRA 2CQ3A 1S72S 1FO1A 2VOPA 2M88A 1BY9A 3NNCA 1RK8A 3U1LA 3P49B 2KHCA 2RU3A 1X5SA 3MD3A 2DGUA 2ADCA 4C4WA 2PEHA 3H2VE 2FC9A 1SJFA 2O3DA 5GAEU 2MKJA 2X1BA 3SDEB 2D9OA 1WI8A 1PO6A 1JJ4A 4F25A 3FEXB 2CQHA 3G9CA 4WCEQ 2MZJA 2KM8B 3HHNB 2CQ1A 4TLQA 2MPUA 3CCLS 2MQMA 3MOJB 2LEBA 5FJ4A 1WELA 3NMRA 2DNRA 2HVZA 2K8GA 2NLWA 2N3LA 3CCES 4PKDB 3S6EA 2QEXS 2DNMA 1P27B 2LYVA 1VQ5S 1X0FA 2ADBA 1U1RA 2MB0B 2J0SD 1B7FA 2LCWA 1VQNS 4A8XA 3G4SS 1FJ7A 1R8HA 4TU7A 3PIPQ 2JRSA 1N54B 2LQ5A 2AYBA 3CMAS 4QPTA 1VQ9S 1WEXA 3CCVS 5DDOC 4BS2A 1K9MT 3SDEA 3TYTA 2MZ1A 2LMIA 2N82B 5LSOA 1R8PA 2DNYA 5GAHU 2ZJRQ 1YJNS 2RQCA 4P6QA 2MQPA 3J7YU 2N7CA 2KN4A 3R1HA 2CPFA 4F26A 3I55S 3VAKA 3UCUP 3VAJA 2AYEA 4IOAQ 4Y0FA 2XS5A 2KRRA 2DNLA 5EN1A 2J0QD 2Q79A 1SJ3P 2QFJA 2XS7A 2VOOA 2MKCA 4YB1P 2YH0A 3R1LA 3S8SA 1HA1A 2M70A 1K73T 3Q2TC 1VC6A 3CCRS 3BO4A 4C0OC 3G71S 1U6BA 1U1OA 1WI6A 2OTLS 1FXLA 3MUMP 4LMZA 3UWTA 1K8AT 4M5DB 1JJHA 3L3CA 2B0GA 3DXBA 1FJCA 5JVGQ 1WG5A 2JVOA 3B4MA 4ED5A 1S79A 2F9JA 3CCJS 1WF2A 2DGVA 2A3JA 2M4MA 2OSQA 3RW7A 2KH9A 1SJRA 1WWHA 3RW6A 2ZJQQ 1DHMA 1JMTA 1AUDA 3BO3A 2DB1A 5H1SV 2E5IA 3CCMS 1QVGR 3THTA 3CD6S 4YUDA 1ZZNA 1X4DA 2JVRA 2MSTA 2E5GA 4CIOA 1Q7YT 1SJQA 3SMZA 3THPA 2DNQA 4PR6A 3P6YC 2DNHA 4W92B 2N3OA 2M7SA 4W90B 2V94A 1SXLA 2DNOA 2LXUA 1URNA 3P3DA 1RKJA 1KC8T 3CC4S 2CPEA 2L41A 1NU4A 2GHPA 2X1AA 1H2TZ 1U1PA 4WFBQ 2OJ3A 2D9PA 4EGLA 3PIOQ 5DETA 1HD0A 1NO8A 1N8RT 2DIUA 4WIIA 3CTRA 3ZZYA 2OTJS 4IO9Q 3B4DA 2KVIA 2MY8A
chains in the Genus database with same CATH superfamily
2JJ4D 4KT0C 3G8TA 2YX1A 5ETOA 1Q8IA 1QDUB 3MMCB 1VRQC 2R7SA 2IMWP 3SV3A 4DN0A 2P6TA 2YWGA 1UA1A 4DU8A 1RWOB 2XSFA 4WF9Q 4GC7A 3I4PA 3ISZA 2QTWA 2HLUA 3BN4A 5HATA 3JS9A 1SL2A 3JSMA 3V5RA 4QWEA 2CYYA 2KU7A 2JC0A 3PRDA 3NBPB 2BE2A 4OYAA 5F0WA 2Y9HA 5HI7A 2F5GA 3MUTP 2CFXA 3MM9A 4YHHF 1ZAVA 2PA8D 4LIRA 1TZ0A 4QWAA 3ISND 5CAAA 4HR2A 3KJNB 4CLZA 3MCSA 3EVWA 3KLGB 4C8MA 4M1KA 3VWSA 3RG6A 2MDAA 1VC0A 1QAXA 2FVRA 4ZVUB 3H42A 2UVVA 2BYCA 2HFVA 1T11A 4DR3J 3I0RA 2GS8A 5L1LA 4IG3B 3DMJA 3ZTPA 3MEDB 2RQMA 5EWFA 3VAMA 4GKJF 2BJEA 1WKLA 4IG0B 4OI2A 1NDLA 1UFKA 1M90T 2GIQA 3C16A 2OEJA 4HHUA 2Z8QA 1Q86T 3OTBA 4CTAB 5DDRC 2XWXA 3PXGa 2ZVIA 1Z2ZA 3QGPA 2GC8A 1H0HB 4Q7AA 4U95A 4AL6A 1TK5A 1S12A 3OJUA 3LW5C 3F44A 3M2VB 1XR6A 1DRZA 5J2NB 4FKXA 3V6HA 3UN3A 3J7A1 3IBWA 1FRXA 5ETLA 2W2OP 3T1HF 2B8QA 2R2TA 2YPZA 3C15B 3KK2A 3M8YA 2VF3A 2HVDA 3U1NA 1FKOB 3C6TA 4JI2F 3TQ1A 4ELTA 2R7UA 2NR0A 2OPRB 1HI1A 1X7VA 2XMAA 1KOOA 5F8LA 1CC8A 1LW0B 1CPZA 3QT5A 3QQCD 2AZ1A 4L73A 1M5OC 1C4CA 2P6SA 1SL0A 1VQKS 4J9OA 1N36J 4AYBD 3CDAA 2ASDA 2PFFB 3MMAB 2HRTA 1Q79A 2VV5A 1N88A 2K7JA 4Q8EA 2DGQA 1J27A 1RAAB 3AH6A 3AAWB 3TR5A 2HHHJ 2MKSA 1HPZA 2JLGA 4AQYJ 3CJQA 2WCXA 2EK1A 2RB7A 2W1BA 3HKZD 2DH9A 1FJGJ 1ZH5A 2CWXA 4YY3F 3US5A 2VC0A 4WKRA 5DDQC 3BSOA 3AQOA 4HH0A 5ETPA 4DQPA 2ZDPA 2DR6A 3MFIA 3J7AN 1ZTTA 1CJUA 4DSJA 2R7TA 1BY9A 1RK8A 1RTDA 5G4DA 3GJSB 3AJ1A 5T7LA 2ADCA 4DX5A 3J81Y 3H0PA 2XMKA 2O3DA 5KG4A 5MAOA 1TKTB 3D54A 3TVYA 2HQGA 4TY8A 2CQ1A 5KG7A 2VFUA 2MPUA 2GZOA 2ZD1B 1HWIA 2IM2A 3W2WA 3ZZUA 4ES3A 4KHMA 2ASLA 4TU7A 4QPTA 2ZKUA 8ATCB 2YX4A 1P1LA 4DV2J 1ZBTA 2DNYA 3KLFB 1WC4A 1HYSA 1N5TA 4Y0FA 2XS7A 4PEOA 3DLEA 2YH0A 3TRGA 1VC6A 1LNQA 1P8GA 3POTA 3FVYA 4KGMA 4OI4A 2UVUA 4RNNA 3PX0A 1MSWD 1RAOA 2OPPA 4J9PA 3B4MA 2GO8A 3WQPA 1XR7A 2R7QA 1TKZA 5GAHI 4B3TJ 3M9OB 4N76A 4J9NA 1QVGR 1UEVA 2M3DA 1C1BB 2BX6A 2DKOB 3V6JA 4M95A 1HWUA 2DNQA 3BH7B 2JEFA 4NLTA 2V94A 1CBKA 3KNAA 2N7YA 2GHPA 1NDKA 2D3O1 3MR7A 4NLXA 1N56A 5B0GA 4BHQA 3CTRA 1FD2A 2BVZA 2WOMA 5KFQA 2I5JA 4M8LA 4MK7A 3SCLE 2V8HA 1HBOB 3DU5A 2VBYA 2DY9A 1FWPA 2Z30B 1HHSA 4O23A 1TQLA 2VD3A 3BBBA 2QYCA 3CCZA 3DLKB 3NY0A 2UUCF 2XMMA 4FYXB 2LQJA 1X5TA 1WUUA 4P71A 3W62A 2MZRA 2BOAA 1W7WA 4DQIA 2MYFA 4CDIA 2W9CB 3VVUA 1SC1B 3VAIA 3R2DJ 1DY3A 3PEJA 3FBFA 5K14B 2XG8A 3IMQJ 3MZIA 4C7QA 4ZPVR 4ZPDA 1FK9A 2Y3YA 2DNZA 1X4BA 1L3KA 1Y9OA 2DTJA 4NA1A 2CWKA 3MECB 2HHVA 4ERDA 4ZVQB 3GYGA 2GW8A 4HACB 4Y2CA 2FIUA 2R7WA 1CULA 3BQ0A 2NPIA 1M5VC 4F4AA 3CJSA 3HI9A 5AXKA 4H4MB 4ZVRB 4A8KA 3W5YA 4DR1F 4YN3B 4LUBA 4JI1J 4MYTA 4GVBA 1S6UA 4C3MA 3ZTQA 5A2QU 1YRXA 1XJWB 3DHXA 5DQGA 1SUQB 2V8PA 2W8LA 4LSLA 2BANA 3H5UA 5HQMA 2DXEA 3AHPA 3PW7A 2DHGA 5L46A 2AHOB 5DRKA 2YKQA 3CCTA 5KFTA 4WYLA 2J76E 4OX6A 2PFDA 2AMCB 2EC0A 4TU9A 3ZTRA 3BM7A 3ISNC 1WSVA 5KFUA 5L1KA 1FRLA 2WK4A 4PG7A 5LOQA 4I0WA 1K47A 1U7LA 2BDPA 3Q2SC 4WIQA 3QJJA 1Z4UA 2MQOA 4A8OA 1IBLF 2Z57B 4ZPAA 3WX8A 3GR0A 3J80Y 2CVIA 2C1EB 3M6WA 3MPVA 4WFNQ 2BR0A 5DLFA 1C1CB 1Q78A 2LECA 1FEEA 1H2VZ 4ZITA 5EWGA 5C42B 2WONA 1N5YB 1X4FA 4FP9A 2MGZB 2C42A 4KFBB 4RW6B 1X4CA 2M9KA 2V5HG 3MM6A 1IBMF 2GX8A 4M5JA 2YTCA 3GIMA 3FSXA 3H5XA 2CPYA 4ZVSB 1YJUA 4JV1A 3Q86A 1U0SA 2LU2A 4F4WA 4URGA 2OP5A 4EK2A 3DCAA 4OJ1A 2OD4A 4NYZA 2FVSA 1OYEA 3CJ2A 3NNCA 3U1LA 2WTFA 4C11A 3P49B 4RR5A 4DSIA 1EP4B 2UUBF 4C4WA 2JH3A 1WI8A 4DR5F 4NLDA 2QLWA 2B5JB 1N32F 2G2OA 4KGZB 1XIQA 3NWGA 2LEBA 5FJ4A 4RL1A 5I3PA 3PNIA 3SBMA 3E8OA 1JKHA 2VA3A 3O5TB 1B7FA 3CDWA 2AQ4A 1CLFA 4JI7J 2E5LJ 1N54B 1IUJA 1U48A 1D1UA 3W1YC 4RW8A 2B6AB 2HAIA 2OKQA 1S77D 4UY85 2NZCA 1FNMA 2FLLA 4Q5VA 1HMVA 3TZXA 2CPFA 3R5CA 4O3QA 4E98A 2YKNA 3DN9A 4RUAA 2GGPA 2DCUB 2GMJA 2HBQB 4X4PA 3SCJE 1QAJA 2IJNA 4A8MP 5U47A 4I68A 5IWAF 1U6BA 4F04B 1JJHA 1I5OB 4RX6A 4ZIVA 4ED5A 1FDNA 2DGVA 1XMOJ 4LF4F 2ZE2A 2HHUA 1TL1A 3FMWA 3RW7A 2LEPA 2UXDJ 3LALA 2BJ9A 1FRHA 2AJQA 4DPWA 1ZZNA 4OL8A 2BW2A 1O6XA 3SMZA 4AXJA 2DNHA 1N5SA 4O44B 5AXLA 2HQIA 3CO0P 5K8MA 2FJWA 4I2QA 2Z4PA 3M2UB 2L41A 2X1AA 2V50A 3V4IB 2F4VF 1REGX 3PIOQ 1JLGA 2DIUA 3TX0A 1GEHA 3B4DA 3VGVA 3GP9A 2ZDOA 5H9FJ 1IQTA 2DK2A 1QUPA 3EZUA 4LF9J 3GV7B 4LFAF 4DV0F 1CJVB 1RHJB 3OFGA 4NI2A 1QLNA 2ZH2A 5G0RB 2XM3A 3LOUA 3H25A 1RT1B 4ICLA 1RT3B 1ZM4A 1XN9A 5KT7A 2HK3A 3HVRA 4ZCKA 4DV6J 2PI4A 1XNRJ 2ZFHA 4O3OA 3IFEA 1TL3A 3LP0B 4ZPWR 2WAQD 2J8AA 3ENQA 5IM0A 2PO4A 3GYNA 1VJWA 4PG8A 2VKRA 1RT6A 2E5JA 4Y2IA 2DVIA 1R8BA 3HHEA 3CJ0A 3I56S 3NGKA 2DNPA 2PE8A 4KHRA 4JV5F 2QYGA 4IRCA 3TEHB 3D9BA 2XSJB 1B0PA 4CLTA 3NMAA 3Q8QB 2V2QA 1CQMA 4HI1A 2CQDA 3NKYA 3OXFA 2KXNB 5J2MA 3DM2A 5A8RA 3IM8A 4R5PB 2GIFA 5L9NA 4X4UA 1XQIA 1CG2A 4CT8A 4ILLA 2YKAA 5EX0A 1YBTA 1RTJB 1YVFA 3VALA 4AL7A 1SIZA 1AFIA 3BZQA 4K4UA 4UQTA 1AFJA 2MQ8A 1DAXA 2ZWPA 2WRMA 2BZ2A 1B70B 4FPRA 1NHVA 2R9LA 2JWNA 2OPQA 3C14A 1RABB 3SXLA 3BN7A 5F3ZA 5ETMA 4O3SA 2KZZA 1D9AA 5HK4A 3JB9k 1RT4B 1HARA 4F7VA 3GG0A 4QIVA 3VF0B 1WACA 1VFJA 5JXSA 2D41A 2IM3A 1X31C 5HJXA 5CYQB 4BDPA 2EKYA 1DARA 4HHHA 2DNNA 5CD4H 1U2FA 1JLCB 3W61A 3SEOA 2IMOA 2XMTA 1UKUA 1CS4A 3NCQA 1IKWA 5J2QB 3QO9A 4F4YA 4DR3F 3BGUA 3W64A 3PR4A 3MAHA 5D77A 2HQDA 3HXMA 4CLWA 2M8DB 3DRSB 1YJWS 2YX7A 5T41A 1RAIB 4YR0A 3EGVA 2E1MC 2XMJA 4P52A 5D0GA 2BABA 1RU2A 3ICLA 3E01B 4DSLA 3VGUA 3T5KA 4Q0BB 1R0AB 5KFZA 2OMLA 3ILIA 3C46A 2BKPA 4KBIA 1UVNA 2DGTA 1FERA 2C3OA 5GADI 3SQGB 3GFZA 2RIJA 1NHUA 4Y6IA 1SJFA 3T6BA 4NLSA 2YNIB 3W9IA 3OTOJ 4O3PA 4X4SA 3DDNA 2A2DA 4IFYA 5B0CA 3V6KA 5EUHA 2VFSA 3V81B 3NCRA 4BCAA 1IM6A 2LYVA 1KWMA 2ZOMA 2FTRA 4UOHA 3DC2A 1R8HA 5E41A 3PIPQ 3HMJG 5KFFA 1HNZJ 1S0VA 1NK8A 3SDEA 1ZAWA 1N36F 2FY8A 5GAGI 2R8JA 2OHDA 2V67A 2RQCA 2UUTA 1P6TA 2N7CA 3LWMA 1YSJA 3I55S 3SCKE 3MMCA 2HHHF 4URSA 4FF3A 1Q7LB 2YPYA 4AQYF 1NH7A 3J81U 1RHRB 1SJ3P 2AEFA 2RD5C 4YB1P 3S8SA 1L3SA 4K4XA 1FJGF 4DV1J 1YGYA 4Y2AA 5KFAA 1NK4A 4OHVA 3OL7A 4WYWA 2J5AA 4LFBJ 5SZTA 4HLBA 1WG5A 3H4DA 2NSBA 3NBPA 3LP1B 2D69A 1SJRA 3RW6A 4LF6J 3WX4A 3NAIA 3BH6B 1EB0A 4OI6A 3SIPB 3FQKA 3KK3B 2UVRA 9ATCB 3TAPA 2UXBJ 1UTAA 1FFGB 3TARA 2ZBCA 1Q5VA 3MAAB 3KLGA 1KC8T 2CPEA 3PJ9A 3CJ8A 2FYXA 1U1PA 3ZZ0A 2OAUA 5H9EK 1BWEA 3FZBA 1N8RT 1BXNA 2BEFA 4OV1A 3AB2B 4M5IA 3MEDA 2DHSA 4J9KA 3UCGA 2AD9A 4IG0A 2XBPA 1HBNB 3D68A 3W65A 3MURP 1IWGA 3S7RA 1PGZA 4DV2F 4B9SA 3I6PA 3R6LB 4CTAA 3OSNA 4AUKA 3AA9A 3NNHA 1NDCA 4FPIA 1ZPVA 2HVEA 3M2VA 3Q8SB 3QBCA 1FRJA 5J2NA 2FLNA 1U09A 3TUZC 2B9EA 5HP1A 3TUPA 4P2SA 3C15A 4KV8B 2A6OA 4B3TF 1FKOA 2EI5A 1XMQJ 1T3NA 3EMTA 4OYPA 4LR9A 2DXDA 2RNEA 4X64J 2X3DA 3AOBA 2OPRA 3EUNA 5CYMB 5E33A 5CXTA 3GIIA 3HX9A 2C2EA 2FHMA 4FVCA 3UDCA 1VBKA 4ED2A 4H4OB 1LW0A 1T94A 2KG0A 2Y8YA 4F67A 3M30B 2WVBA 3K59A 1SKUB 3IBFB 2HS4A 3EXYA 3MMAA 4CZCA 5ETVA 2Y1RI 4B3OB 3PV8A 3MM5B 4PUOB 3IO1A 3A4TA 3R5JB 4A48A 4YQWA 1HNWJ 3GZ7A 2E1PA 4A8FA 3H40A 2BJDA 1VYAA 4ALZA 5B0EA 4DL3A 1S9FA 4QCLA 3BJYA 1DURA 4NWBA 1PAEX 1WHYA 1UWAA 5KOXA 1FDAA 2IAJB 5GMEA 3HPOA 1CJTB 3KLVA 3T19A 2AX0A 1KD1T 1DLOB 5BXIA 5AXNA 3T5HA 3FBBA 1JLAB 4DPOA 3GYXB 5F9NA 4C0BA 2GCFA 1U26A 3KG0A 3IRWP 3TAMA 1TKTA 3RB0A 4I2PB 1WHWA 2KTQA 1DTQB 5KG2A 2W4PA 2ZD1A 2ZH7A 2HGLA 4PYDA 1TAUA 4ZS6A 3C8YA 3B6BA 4QWBA 1SC4B 5HAOA 1NMEB 2IRXA 2EG1A 3DDIA 4ANEA 1RQ0A 3HFZB 1AROP 2VICA 3D7SB 3A12A 2WW8A 3LA0A 4B3MF 2GHWA 1RAJA 2RS8A 3KLFA 1LXNA 2CJKA 3W60A 1X60A 4P73A 5THWA 2HEKA 1Q8BA 5LJ3Y 2P8IA 4A8YA 3WIUA 2XI3A 3T9ZA 3TW0A 2BJ7A 4FVMA 2OSRA 1Y3KA 1KHVA 2GAGC 4TY9A 3HFVA 4N8OA 3J80U 1K0VA 4OYBA 1K44A 1RTZA 4RNMA 4N5SA 1KEKA 5GAEU 2MKJA 3AJ2A 3BBCA 2QN6B 1ZTWA 4QOTA 3FMBA 4ZLLA 4B9TA 4UUXA 2CQHA 2XHWA 4NOHA 4RBTA 5FIIA 1C1BA 2KFZA 4RKUC 3MOJB 3X1LB 5B0BA 3NS7B 1T9XA 2B4PA 3CCES 2YNGB 3DLGB 3S6EA 4F8RA 5AE2A 4DBQA 1Y3JA 1FJ7A 5IQ6A 1RT5B 4OX8A 5E3PA 4ES2A 2G1HA 3UFCX 2JEIA 2MZ1A 5CCMA 3BF4A 1E6YB 2EFOA 2WVDA 4F26A 3UCUP 3DOKA 3M1VB 4WTYA 5BYSA 1HBOA 4RW9B 2QFJA 3PJWA 1Y4ZB 5E7OB 2FJVA 2GQ2A 4C0OC 1JLEB 2GJFA 3PCOB 2Q1LA 1XERA 1RTHB 3DLKA 2JVOA 2FGCA 4FNIA 1X8DA 2VG5A 3E3XA 4ED8A 2BW7A 4DHVA 2W9CA 4W90B 1DFDA 2V2VA 3CD5A 1R27B 3VGTA 5K14A 3DOMB 3CCWA 3H2LA 3BDEA 1OSCA 1RDRA 2VBXA 3PY8A 5M2PA 2ASYA 2CAJA 3JSMB 4I67A 4WIIA 4O3RA 4DS5A 3N6LA 4QIWD 7AT1B 3MECA 2UXCJ 4OFZA 2D3ZA 4JI7F 3CJ3A 1FVQA 1FF2A 3L95X 4NZ6A 4UOFA 3A13A 3DRPB 3KG4A 1IJEB 4DUZJ 4R0JA 2VONA 2LA6A 4H4MA 2AP6A 2EXUA 2CQPA 2FHJA 3D3BJ 4L6V3 2K2PA 3ZZPA 1FRMA 4NCBA 4WU3A 3I0RB 1BQMB 5F8JA 5HN0A 5GMDA 1SUQA 3OVAA 1U24A 4F3QA 3M8ZA 4F02A 3OLBA 5FLXU 2CJBA 1FRKA 2FZGB 2PMWA 3IP0A 4DFJA 2DISA 3R2CJ 2QA2A 1UJ6A 4GO7X 4I6AA 1OY8A 5F0UA 3G8QA 2C3YA 8AT1B 2VG6B 1OJ4A 2QLFB 1X4GA 3R7NB 2APOA 2MHNA 2UXDF 3Q8RB 5FDLB 4B17A 3TP2A 1EETB 3K5LA 2OMOA 2EKNA 4N47A 2ZBQA 2CPJA 1UJ4A 3Q8YA 2B4UA 1NB2A 2BV3A 4LFCJ 1VBYA 3IC1A 2R7VA 3NEKA 1C1CA 4B3RJ 4ZA1A 4B9NA 5C42A 2MHEA 2MGZA 2I38A 1TP7A 4LF9F 1XBWA 2PN6A 3PDNA 4KFBA 4RW6A 1RLDA 1SH2A 2IRYA 1QJHA 2EVZA 2XS2A 4JB8B 4J5OA 4PWDB 2HG4A 1F9FA 1OPIA 3A1YG 3GJRB 1XNRF 4PWUA 3UVJB 2JL9A 2FY1A 2OD6A 2HFZA 4USWA 2DR5A 1EP4A 1B7YB 3D1HA 4FYYB 1HNXJ 3UR3C 5LMNJ 4X4NA 1BQXA 4P2MA 3SZ2A 3W7BA 1PSDA 1SB6A 3M8WA 2ZH3A 2E9RX 1XTZA 3MPUB 1YBAA 2B5JA 1JXVA 4OZ5A 1RSCA 1UP1A 3EXCX 5LXRA 1LOUA 2LU1A 3OTDA 1MMLA 3M4XA 5D4LA 1SJ4P 3FCHA 1MN7A 2BQUA 1UAWA 2E1AA 1RAGB 3TAQA 2V9KA 3D1QA 1A9NB 1KLMB 2B6AA 2V9WA 3BQ2A 3TQEA 4CO2A 2VJVA 2CDRB 2VDIA 4IH7A 4S0MA 3FC9A 1T8EA 3KLHB 3UR0A 1HBUB 3OXLA 2CPXA 1PCAA 2CQ3A 3W2WB 1PBUA 4ZJOA 4TXSA 2OPSB 2CNLB 3G86A 4NRTA 2RDJA 2PEHA 3H2VE 2KJVA 2Z2MA 1FFWB 1H3DA 2Z56B 4QBUA 1V3SA 4UQGA 1E6VB 3CWJA 4A8QA 1URRA 4NXNJ 2HVZA 4O44A 1SPBP 3CO9A 5AE1A 6FDRA 4XDCA 1BE4A 3C66A 3V4IA 1AZSB 3QYYA 2LVWA 4MKVA 2EFGA 1W25A 3JQJA 1G6BA 2KN4A 3R1HA 2HNZB 1GMWD 1F3FA 5JJBA 2HIYA 1F2GA 4OLPA 2MKCA 3Q2TC 3BPSP 3QWUA 4MFBB 1CJVA 2B9WA 5DLGA 3G71S 2HAFA 5G0RA 3AY0A 4IRKA 2P9GA 3OT9A 1RT1A 3IS9B 5JVGQ 2F9JA 1KVKA 1WWHA 2BJ3A 2JLFA 5C7PA 1F9EB 4DV4J 1KFSA 3LP0A 2H9ZA 4DR7J 2R8IA 4OZ2A 2GMHA 4F50A 1ZA1B 4KPCA 4M5GA 3OJSA 1NPRA 1URNA 1RP5A 3L7UA 2EBEA 3D67A 1L3TA 1H2TZ 2XSJA 2FJXA 5DETA 1G3OA 1FE4A 4TQRA 5B7WA 3KUGA 4ED0A 3GFYA 5KFSA 4L3KA 4R5PA 3QLHB 4OZ0A 4I6YA 2R2UA 4G3IA 1HNZF 4KIAA 1RWXB 4R0EA 4MYUA 3DYAB 3LAKA 4ED1A 1RTJA 4PRFA 4USHA 1AT1B 2YNFB 1U45A 1I6JA 3H90A 1YI2S 4OYXA 5CZVA 3RB4A 4PQUB 4Q8FA 1Q5YA 3QGIA 1N0VC 1QM9A 2WB4A 5GVQA 1BC6A 4CQ1A 4J9QA 4AXIA 1KBRA 4LFBF 5LXYA 1WC3A 3D0HE 4ZJLA 1RT4A 3MUVP 3PFEA 1GTHA 2ZM6J 4LF6F 5ITHA 5CYQA 3ZNUA 1M0SA 3KMSA 4EBDA 3EWGA 2UXBF 7FD1A 1JLCA 4GVLA 2BE7D 4UT4A 4FZVA 1OS5A 3MMBB 4WP8A 4PPZA 4URQU 5E0OA 4OZ3A 2POKA 3T1YJ 2ACMA 1SL1A 1FI4A 4QWCA 5J2QA 3R5AA 5HLFB 2HGNA 1NBEB 1CQNA 2KFYA 1NKEA 1NJYA 3UDLA 3DRSA 5K8OA 3H7HB 2MTLA 1DBDA 3BYPA 2XLJA 4IKAA 2XWYA 3E01A 4QQBA 4K4YA 4Q0BA 1R0AA 4EU0A 1NK5A 3M2RB 4RJVA 1R6VA 1R8CA 2L48A 2K3IA 2OI2A 4LSNA 1PC5A 5KT3A 3RJMB 4V19X 3SQGA 4NLPA 3F56A 4MJKA 3BSCA 4XIUA 1IM4A 4R25A 1RWNB 5HQ8A 3GJTB 2YNIA 2ALYB 1XMQF 2H4YB 4X64F 3PTWA 4ZN3A 2ZUGA 4UZBA 3V81A 3UD3P 4D3HA 3MI7X 1D8ZA 3DKDA 3LP2A 5E3RA 4ZVOB 1CEZA 1C0TB 3KUHA 3N0VA 3GJQB 1L3UA 1NSKL 1FWKA 5A8KB 1RYRA 3PYDA 4QWDA 2IYGA 2EG2A 3QWPA 2ATLA 4ZPBA 2CQ4A 2G2YA 2RSQA 1ULRA 2VQEJ 2IDEA 1KDNA 2EPIA 1QSSA 3D2WA 1NEEA 3CJRA 3PACA 4ELVA 4KH1B 4QYRA 2PA3A 3HHKA 1ZOTA 2O1PA 3QSIA 3LP1A 3HM9A 4CO1A 4OV6A 1GFWB 1PO6A 2B3TB 1SVDA 1NUEA 1HIYA 4FS2A 5E3CA 5IT4A 4C9DA 3I32A 3VV2B 1WJ9A 2RJZA 4XDDA 1MMNA 2VQFJ 1N6QB 4H4KC 1ZS6A 1PJ6A 3MAAA 1FE0A 1JB0C 2J0WA 3CNQP 4ED7A 3H59A 5D0HA 1Y7PA 2RDIA 2NXEA 4ER8A 1H7WA 5HROA 2CADA 1R8PA 2AEMA 3MCNA 4B9LA 4LBPA 4QYZJ 1NZ8A 1HBNA 4MIAA 3AD9C 3TOQA 4ECZA 1VJQA 2E7VA 3BREA 1CJKB 4N56A 4OJ3A 1HA1A 2CKWA 1UVLA 1B0VA 4P75A 2ZUAA 4M5DB 1FRIA 3CSKA 2V2ZA 1HFEL 4LF7J 3IWXA 2I1RA 4FXDA 1YZ6A 1VS3A 3QT7A 3PW0A 4KAIA 2DB1A 2VUGA 4DV3F 3CIMA 2JVRA 5KFIA 1O51A 2HQCA 3QAEA 1RKJA 4NLGA 4KV8A 3HT0A 3CC4S 2RHSB 1KR4A 4MMOA 4EYIB 1BMQB 2OJ3A 1RLCL 3SSSA 4Q44A 2MLZA 5CYMA 1KNZA 1S57A 3ZZYA 4NLUA 4X2BA 4H4OA 2HWIA 2AEJA 1JJ2R 1T7PA 1GXUA 2CPDA 1NSQA 1GH8A 1HWJA 1D8YA 4WZQA 2YY3A 3M30A 4JYAJ 2IVFB 5HMZA 1RB0A 4DI6A 4B3OA 1K1SA 3MM5A 4PUOA 4KE5A 3TJ8A 2XNQA 3P5BP 4N8NA 3DU6A 5IC4B 4DQQA 1VQ8S 1T0TV 5HMWA 2VFVA 3HCXA 4E0DA 3DRRB 3GONA 3G6XA 3IWNC 1ZM3A 4USVA 4MT1A 2YWEA 2DH8A 2IAJA 5J1PA 3LQVA 6FD1A 3I9V9 3Q8VA 2W7PA 1FNXH 3Q8PB 1DLOA 3KWMA 1JLAA 4U8YA 1N34J 2CJ9A 2JFDA 2FC8A 3KTQA 2XMVA 3MAQA 3DRXA 4I2PA 2H4WB 2W9AA 3QJPA 3ZO7A 1UFWA 1C4AA 3AD8C 3HZEA 4O4GB 2UXCF 1NNDA 2AGPA 4ZK7M 5M2RA 2Z58B 1U49A 1ZETA 4ECUA 1PBAA 3JQKA 3LTOA 2V63A 2R7XA 1TUGB 4DUZF 4JI6J 3QIDA 1U2CA 3ENWA 4TVAB 1QAIA 3PRVA 5IOLA 4IQXA 1H2UX 1RCXB 5K8NA 3K0JA 2KDOA 1RA7A 1GTEA 4QIFA 4WFAQ 2ZOFA 3LGMA 3W2VA 4FDFA 2FVPA 3FSIA 2LA4A 3SSQA 3NS5A 5DM6Q 2RE1A 3GPAA 4OIXA 3ZXWA 2NPFA 2FVCA 1EAYC 4DF8A 3LPYA 1RBOB 5I3QA 3NAHA 2DEIA 1WEZA 2W9BB 2ROEA 3I31A 1U1QA 1BHNA 4FF1A 5B0FA 2YNGA 3DLGA 4PYAA 3LANA 1SBRA 1YWXA 4O0IA 1RT5A 4KSEB 2HRUA 4LFCF 1LQ9A 4IFVB 1TKXB 2EEYA 1WEYA 3E51A 2P9CA 5E3AA 3CCUS 1B99A 5HVHA 4B9VA 3G2XA 4ILRA 3I87A 1RE1B 4WU2A 4B3RF 1F9HA 2XC9A 2W7AA 3O6QA 4K4ZA 4C3LA 3OD2A 3M1VA 4YR2A 4RW9A 4CO3A 1TR0A 1VRTB 5J1EB 3O1LA 1FEHA 4NCGB 5BYQA 1U0HB 5LMUF 1ELOA 1JLEA 5I4MA 2RU3A 4JBCA 1RAHB 3QAUA 1RTHA 2ZH5A 4DV5J 3JQMA 4MIBA 3SDEB 2GVDA 4KQZA 3FJ2A 4LQ3A 4KY3A 2HNYB 1HNXF 5LMNF 1U1RA 2NYIA 3DOMA 1Y10A 2JRSA 2VHGA 2HW3A 3N6NA 5D4PA 3ZFVA 5DDOC 1LWXA 2CZVC 4HT7A 1FTCA 1TELA 4P6QA 2ZC3A 1MMDA 3VAJA 3CJTA 2ZNZA 4CH7A 3BGLA 3NOGA 2R42A 3DRPA 2YBVA 2WSFC 2CXEA 1EZZB 1UL3A 4IH6A 4NLYA 4IYQA 5IT0A 4A47A 3GSIA 5ETKA 4QR1A 2ILZA 1V3ZA 3DXBA 3CCJS 2OUGA 1BQMA 3OL8A 4ES1A 1Q4RA 1S6OA 2WSEC 4J7CA 2M5YA 1PC4A 4LF1A 3OHAA 2VG6A 2LXUA 1S0OA 2E66A 4BBYA 2F65A 3HDSA 2HHTA 1KP6A 4DWIA 5FDLA 4Y3CA 4EGLA 3R7BB 1HD0A 5CCLA 1EETA 4NXNF 2HHXA 1DQ9A 1SCJB 4RPFA 1S0NA 4K0KJ 1JLFB 2FJDB 4ZKAA 2H5EA 5IFMA 4F2SA 1IXKA 1H6KX 2BOPA 5LT5A 2CPIA 3FRZA 5MLCV 5DG8A 5HP1B 5E2QA 1D09B 2HNDB 5DM7Q 1CC7A 2UUAJ 2AX1A 2WVCA 4NXMJ 2MQQA 2RHQB 4DZ6A 2LXFA 1T9TA 3PHEA 2FUG9 3D6MB 2HWTA 2IFXA 2QL9B 4WJBA 2KZMA 1N52B 4HL9A 2GJ2A 2NXUA 1ROFA 3AA8A 1VQ4S 2CQGA 3Q23A 3W66A 4K2XA 3M8QA 4PWDA 1UMJA 1R0CB 4Q2LA 3PHTA 3UVJA 4C2MA 4DV4F 3RU0A 5LM7E 4DR7F 5GADU 3NS6A 5I42B 2B56A 1JWWA 4X4VA 3IXQA 4DQRA 4TKTA 2F7VA 5AT1B 2XZWA 2KRBA 2Q3PA 2ACYA 1D0EA 5CQGA 4C97A 4USJC 4OHWA 2F4FA 3UD4P 2RUGA 3HT3A 2PC6A 4MTPA 4ECQA 1AW0A 2NS1B 4DR6J 4FNHA 2R8GA 2CPZA 2W4DA 4ZVEA 1KLMA 3PVXA 4GRSA 1DTTB 4UF4A 5GAGU 2DHXA 4QU6A 3TJAA 2CNNB 1T3OA 3TAMB 2U2FA 1A6LA 2B51A 3KLHA 1WHXA 1HBUA 5DJBA 5KFJA 3DOLB 1MU2B 4CWBA 4X4OA 1FCAA 1N0UA 2OPSA 3D6HB 4IR1A 2KT2A 2RMLA 1YTYA 5DQIA 4L74A 3HHLD 1M5SA 2G0CA 1Q82T 3M6VA 2QLXA 1E6VA 2XY5A 4NYOA 5F9LA 2NXNA 4ETZA 3A8KA 4DU7A 2M0GB 3B8HA 2DPIA 5D15A 1ZA2B 4WK1A 3GSDA 2Y0SD 1U6ZA 3N5BA 3T1YF 1AZSA 1QE1B 3QIPB 3O8WA 4LRDA 3FQLA 2CQ2A 4I64A 2PDAA 3BO2A 1V5IB 4JI5J 3M8PB 2HNZA 2IJFA 4I1TA 1X9MA 2D74B 4KKOB 4NPOA 1IKVB 4OLOA 4TN2A 4MFBA 3THVA 3FBCA 5D4NA 3UQSA 2C3PA 4ECWA 3ELHA 3CDEA 4K8RA 3IS9A 1HWKA 5B0AA 3HSJA 4P72A 1JJ4A 3R6GB 4I69A 3V6DB 3RRKA 4C98A 1OY6A 3HVAA 4ENOA 4B3SJ 1RISA 3CCLS 4DL7A 3ILJA 3DOKB 4DJBA 2XY6A 1FTRA 1LFWA 3CB4A 3IGVA 3RGIA 2DRAA 4FYDA 2XLKA 2C2OB 4NASA 4DG1B 2J9DE 3HJVA 1U4BA 3PKMA 2FDNA 1MWZA 1S10A 4NZ7A 1Q1KA 3UNGC 3R8YA 1WDTA 3QJLA 2GNKA 5C25B 5KFMA 1SH3A 2VG5B 1UPPA 2C2NA 5EGYA 3QLHA 2V2KA 3AODA 2DNLA 3I5BA 5HMXA 3DYAA 1WI6A 3UWTA 1K8AT 2YNFA 1RAFB 4O4RA 4PQUA 2KH9A 2OSQA 4DSKA 4QJVA 4KGVB 2EW9A 1Y5LB 4JOUA 1SJQA 2A6MA 3QRPA 4DDFA 2EFQA 2N3OA 1R6YA 1SXLA 3P3DA 1D9DA 2XCPA 5K20B 2I0XA 3IBCB 1MWQA 4X65J 4F4XA 3VQSA 5KFDA 3KJQB 3U02A 3PZPA 2VQFF 2K7KA 3D28A 4P2FA 3K5NA 1GNKA 3MMBA 3B82A 4RUCA 3TVZA 4LRAA 4CO4A 2G4BA 2LP4A 4JUZA 3P5TL 2P5VA 5HLFA 1PILA 4JI0J 1QTMA 5H9EJ 3TANA 2YNHB 1ZAXA 4EZ9A 3QNWB 3FKBA 3VAFA 3NGTA 2K06A 2ERRA 2M8HA 3KHLA 3JAMY 2LQ9A 1P9YA 1XWLA 3G96A 3W9JA 1RT2B 3CPWR 1RTIB 3GV5B 1FJEB 1FXDA 1VQ7S 2NYHA 4K4VA 3ULHA 1RWVB 5C2CA 1H7XA 2UUWA 3M2RA 1N48A 4LF7F 4CT9A 4I56A 2KM8C 4QIEA 5C2GA 2V68A 4PXEA 1KVIA 4DPXA 4U7CA 2BBEA 5IQQA 3K5MA 2AJFE 2XB2D 5CD4A 3A3NB 2F9DA 1Q8KA 3M05A 3A8JA 4Y00A 4LF8J 3OFHA 4FKYA 3HSDA 2Y1JA 3HF5A 3QZ7A 5KG5A 1HL6A 3F0NA 3F73A 1C0TA 1M5HA 2X3GA 2F8HA 4KH0B 4K4TA 3IG1A 2WB1D 3M9NB 5A8KA 5ETQA 3N5FA 4JYAF 1YHQS 2UVWA 5IV3A 3CUNA 3CJ4A 1X4HA 4DV7J 4JV2A 1YG0A 2ZBRA 4RU9A 3A8EA 1VMBA 1JIHA 1VBZA 2MKIA 1HLWA 3UCZP 2A2CA 5HJYA 3V2UC 4RNHA 2E1RA 3CC7S 5BR8J 4Z7YA 4LR7A 1V9OA 1NKBA 4WK3A 4G65A 4XO0A 2BE9B 5EWEA 2ZEJA 2AT1B 4UZCA 2LQ8A 5L1IA 1VDHA 3HSGA 3HD1A 1KVJA 3FSYA 1N6QA 4CNYA 1N34F 3FZ2A 1TMMA 1T03B 4G1IA 3UN2A 3Q0AA 2G0IA 3TO8A 4U67Q 3FUYA 3ONQA 1Q8LA 3MFHA 3GMGA 3P4UB 1S59A 4FYVB 3UN5A 4HT5A 4ZOSA 3PYGA 1O0PA 1CVJA 2YWKA 3U27A 2HRYA 3ZC4A 2AKWB 3CJKA 2RRBA 3N6MA 3VAGA 1MG7A 1CJKA 1VI7A 1YX2A 2KI2A 4JI6F 1R43A 2IA0A 4PPDA 2ASJA 2M88A 2HQ3A 3RUBL 1SKRA 3ZZOA 3ZZRA 2V69A 4M5DA 4LRBA 5FLXY 3FBEA 4HTIA 1R3NA 1KTVA 4DR4F 1ZPWX 1XK8A 4WCEQ 3C19A 4CO0A 3G82B 3QSYB 2R3VA 7FDRA 4M94A 3NMRA 2H3EB 3OHBA 2NXCA 3MCMA 1F1BB 3HHLC 4EWTA 1YBUA 2LFVA 1VQ5S 1NSPA 5M2UA 2MB0B 4A8XA 2VC1A 1VK8A 3G4SS 4NZ0A 2BRLA 2WZ1A 5KFXA 2J8SA 2LMIA 2RILA 4KGXB 1OY9A 4NLQA 1MNEA 3IRXB 4FF4A 3D1OA 2HPUA 2N4DA 2CJQA 4Q43A 3KHRA 4DL4A 1M1GA 3NL0A 1KTQA 2B4VA 3I5AA 3R5GA 2FJBB 2F1FA 2OGUA 4OYMA 3CIZA 2ZKTA 4OI0A 1KFDA 5CABA 4ANDA 3WIVA 3QRRA 5KFBA 1YDLA 1RYSA 2A3JA 2ZJQQ 3DRRA 5H1SV 3CD6S 4YUDA 1Q53A 1X4DA 3EVMA 1SV5B 1UETA 2AJ2A 1U8SA 2DRBA 4NCAA 2ATCB 4NA3A 4DV5F 4N41A 4OMFG 2EFNA 1MWYA 1GT8A 2GV1A 2QO3A 3WHIA 2R8KA 2BUNA 1FDDA 1YJVA 5HQLA 3BSAA 3JYTB 1HQUB 2B7BB 2F4VJ 3Q22A 3TWZA 2QMXA 4HH1A 1REVB 1WDDA 1EJ7L 1RWMB 2P2CB 4ECYA 2KG1A 2R7OA 5C24B 2OFHX 3BPDA 4QPXA 1OIAA 2BRKA 4OHYA 4M5MA 1PYOB 1PKUA 3ZTSA 4BLGA 4NX9A 4M5HA 4O4GA 1NHKL 4LFAJ 3RB3A 3G8SA 4IRDA 3NGSA 1WTBA 3HVWA 3TZZA 2VB6A 2L08A 4OJHA 1T05B 1NCLA 2NREA 1U6FA 2R7RA 4J9RA 4KHPJ 5IS2A 5ETSA 2A1BA 2WVFA 2RH3A 2PEBA 3MF5A 1LWEB 3SI8A 3K89A 3AJDA 3T6JA 1T9WA 2DNGA 1U47A 2VFTA 3QRQA 1GMUA 5JVHQ 4RW4B 2WHOA 4YOEA 1WG4A 4OHZA 1WOSA 2J9DA 3EPIA 2E9TA 1LEOA 4MAKA 1KQGB 1UEUA 2NCKL 2CVEA 1TV6B 2W9BA 4Z7CA 4YEAA 2IM1A 3CF5Q 2Y1IA 3DLLQ 2V4JB 2ZH6A 1EKRA 4J37A 4ZVHA 3GV8B 4BWMA 2B8PA 4LSNB 2RT3A 5DZ7A 3BS9A 3HZGA 3CC2S 1HNIB 2FVQA 4IFVA 1TKXA 3CEDA 3MTJA 4K2JA 1UJ5A 1TL4A 1V5VA 2QA4S 2UUAF 2V8DA 5KG3A 1B3TA 1RACB 1RI7A 1WSRA 2CJAA 4NXMF 4CRJA 1VRTA 5J1EA 4KR0B 4LT6A 3ITHB 5IC6B 4NCGA 5DS7A 4DOZA 3DRYA 3EDRB 1U0HA 3ILOA 3LP2B 1UW4A 4ID5B 3PO5A 1S6PB 4RBVA 1OMSA 4RO0A 3TVKA 2WBRA 1VGYA 1QTNB 2RRNA 2WVEA 3JSBA 3T41A 4MKYA 4LIWA 4YDDB 4X84A 4JI4J 4IUFA 5IT9Y 2YKMB 2M52A 2HNYA 4NE9C 4ZP9A 1K0TA 1TK8A 4UOGA 5LSLA 1FHTA 2ILYA 4OI3A 2IY5B 1RCOB 2XNRA 3KFWX 2KYXA 1NPKA 1HBMB 5JMNA 5HVFA 4OYZA 1KSPA 2DR7A 2X51A 1NKCA 1B0TA 2MZTA 3LGHA 1N5VA 2JSXA 4LRFA 3ETMA 1LXJA 1RHKB 4ZP7A 2BM1A 4DR6F 2RVJA 4HDHA 3AOCA 1WC6A 1NZAA 3SCIE 2B9XA 2VASA 1H72C 1ACMB 2NQPA 3QATA 3MD3A 1RT7A 1S1UB 4Y34A 2IYIA 3TA2A 5HROB 2VDHA 2CA9A 2BQ3A 3N79A 3LH2S 2QA1A 2MZJA 2PSZA 2HHWA 1TU0B 3CDBA 5KFRA 2QJ3A 4G1PA 2FJEB 2DNMA 1P27B 2RKIB 3Q24A 5KT6A 4P9SA 3OQ2A 2J0SD 3T5JA 1S4EA 2GFFA 3K5OA 3CCVS 2N82B 4L3NA 4KC5A 1WD6A 2KFNA 1EARA 1JLFA 3ETOA 1AYEA 2HKEA 4GC6A 3KJVB 1GMVA 3H98A 2CNKB 1S1VB 3R1LA 4CLKA 1KHWA 5A8WB 3PRBA 3DGPB 3D6FB 1TVRB 1VIXA 2HWHA 2BQRA 1TK0A 1UZDA 2HNDA 4JI5F 1JQGA 4CI0B 3HVTB 4PQAA 2FZCB 5E5NA 2L3MA 4CM2A 1RHMB 3GILA 2XHCA 2E5IA 3RBDA 4WTOB 1IN0A 5KFWA 4CIOA 1MROB 1TL7B 2P9EA 2HIQA 4NRUA 3FCWA 2BJ1A 4WXOA 4DFPA 4LF2A 3R9LA 3JTPA 4YB5A 2Q6CA 4B3SF 5I42A 5K8PA 2D1CA 3KK1B 2GHVC 2J7KA 3QMQA 3EGWB 2YWHA 2Q66A 3LPEA 2W2QP 2L9WA 4GKKJ 4NLVA 2LDIA 3EICA 3GE9A 4QR2A 4QYZK 4G6VB 4YB7A 2V6AA 3PG9A 2DIVA 5KFNA 3M9MB 3A8IA 2ZZMA 3AXKA 2Z2LA 2RQ4A 4RW7B 1KONA 4EMDA 3K2YA 5D0EA 1PYTA 2A10A 3OFEA 3PKYA 3MMJA 3NLCA 2JDJA 1DTTA 2KXHA 3W5XA 4NYPA 3R97A 2VH7A 3KLEA 1KN6A 5ETRA 2MZQA 1LWFB 2PGCA 3W63A 4X4QA 1JJCB 3DOLA 3TJ9A 2G1DA 1MU2A 2LDYA 1GXTA 2C3UA 4X62J 2JNJA 5D78A 3SFUA 2JEJA 2VZ9A 1Y5IB 4Q2MA 2DO0A 2R2SA 2F3JA 4X65F 3JAMU 1U2RA 4JI1F 1S1WB 4TYAA 1WF1A 1NAQA 1HNVB 4O3NA 4B08A 1LFPA 2DNKA 1S9GB 3MR2A 4AE5A 3W2VB 1X5OA 1QE1A 3QIPA 3OW2R 1ZM9A 1U1MA 5KT4A 1FWLA 1U1LA 4OZ1A 3I0SB 4JI0F 4KJIA 3BB5A 3D66A 4F0MA 3FK4A 2QE5A 2PT0A 2D7SA 3M8PA 4MH8A 1HHQA 4KKOA 1YRTA 3MHYA 2R4FA 3MEGA 1IKVA 2DJWA 3L7PA 2JEGA 1XR5A 3H5SA 2IC3A 2DT9A 2QG9B 2ROGA 3QGHA 3KJFB 2LLZA 5I3UB 1OSDA 4OI1A 4HEA9 3UDVA 3V6DA 4NA2A 2FPHX 3ET6B 3I96A 2XMWA 4J9SA 3PM9A 5C5JA 4J90A 2VA2A 1N5QA 4F4ZA 1IBKJ 4LF8F 3MDFA 4ECTA 5AJ3J 2AW0A 3J7Z5 3NGDA 3NRBA 4DG1A 4RZRA 1HHTP 3HULA 2ZITA 2GVDB 5C25A 3QFHA 1F5CA 1RADB 1HQEB 4B3MJ 2HHSA 4IH5A 2XLIA 1A0OB 3KLIA 4KRWA 1AB8A 4F0HA 4RNOA 2AGQA 2VOPA 1L3VA 4CLLA 1WORA 1IVZA 4DV7F 1KRPA 2G9OA 1SQGA 1S48A 2GA7A 2IRUA 3EJMA 4XTTA 2WSCC 3N28A 2DYAA 4LVOP 3FEXB 4OX7A 3UW1A 3HHNB 4OX9J 4N7TA 2MQMA 2RF2B 4EYHB 5BR8F 3K8VA 1XNQJ 2UU9J 4IR9A 2E5LF 2QEXS 4BC7A 4I6WA 3OBIA 1X0FA 1Q0NA 2GMLA 4C8LA 5KFGA 4ID8A 5KFLA 4AT1B 3HO1A 2FGOA 1FXRA 1K9MT 4R8UB 4EZ6A 1TUVA 2YWWA 4WXWA 2ZH1A 2GAHC 4Y28C 2ZJRQ 4MKAA 4ATNA 1UW9A 2DEJA 2H1YA 3A3PB 2AYEA 4CLFA 4MK9A 2M70A 4Z37A 5J2PB 2YNHA 1XMOF 1U1OA 1EIYB 1FXLA 2PI5A 2O67A 4YS2A 4UTGA 1WF2A 1RBAA 1RT2A 1Y00A 2ZHOA 4TLRA 2F8EX 3BO3A 3NGUA 1RTIA 3RRHA 3SFGA 1PYSB 3EVOA 1Q7YT 3OR2B 4W92B 4OZJA 2IA6A 2G0JA 3ENAA 1PJ7A 4UOCA 4RUBA 4NMXA 1S97A 2C2ZB 4WE1B 2IPOB 5DGBA 4ED3A 2W01A 1NK0A 1VRUB 1UFLA 4HDGA 1NO8A 2PD1A 1G1XA 1I3OB 1UVJA 2XMUA 1NM2A 2MY8A 3HK2A 3OVSA 3EGNA 1UWBB 2DXFA 1HI8A 1S9EA 2E5HA 4ZCLA 5ETTA 4BC9A 3M8QB 1PAUB 2HK2A 2A0FB 4JI3J 4ED6A 4DV6F 1NJIT 2VU5A 2V4RA 1T9VA 3FEZA 2MQNA 1GXLA 1BUXA 2BKOA 3EDQB 2FD2A 2DRDA 3W8GA 3DHWC 3K17A 3W3SA 2X1GA 4HI2A 3CMES 4J9MA 3C6UA 4JV0A 4QIGA 1TTHB 4ZJQA 2C28A 5D0RA 4B02A 1S6QB 3MM7B 4C8NA 2QT7A 4JP8A 5A76A 6AT1B 3FDSA 4ZIWA 2YKPA 2KB2A 5F8GA 1W2BR 2E29A 3J7YI 2W2MP 4DL2A 3WC2A 2FZKB 2ZWOA 3IR7B 1JNZB 1JX4A 4FXVA 1W2IA 2DH7A 5HANA 1T03A 1KS2A 2XYPB 1F6TA 4A8WA 5K9FA 1UPMB 2OELA 3BEGB 1LW2B 2H65B 1MW7A 3IM9A 5IV4A 4K5SA 1Y0HA 2LEAA 4IOCQ 1VQMS 3R5BA 1X4EA 1RUSA 1GX6A 1N33J 5F41A 3TX8A 2MZSA 1H38A 3EM1A 2W7OA 1HKAA 5FD1A 4ECXA 2HZVA 4FXWA 4KHPF 3IAM9 1FA0A 3OV7A 1S76D 3C2PA 1VISA 1YK9A 4B9UA 4KTQA 2D3UA 4C0HA 3QGGA 3DI6B 3QFWA 2G13A 2VBZA 1BQNB 3G82A 2VPYB 3FFIA 4ZCIA 1F2HA 3N9UC 2CIMA 2XYHB 4GMKA 2JLEA 4ZDNA 2C2DA 5DDPC 2H51B 4FBTA 3ZZTA 3VCDA 3G6YA 4KPYA 1HR0J 2DR9A 3MR3A 1DJ0A 1LWCB 1M5PC 1VCTA 1F5AA 1S1XB 3IRXA 3EE3A 1LK7A 4D3GA 2KVQE 2JFKA 2XCAA 3CVKA 2YQ1A 4HTJA 5HMYA 1UCNA 2XY7A 2J7UA 1UVKA 5IT9U 1NJWA 1JLQB 3GIKA 3OTOF 1Z1ZA 1WTFA 2OFGX 5CHCB 2FC9A 3RZAA 2C2KB 3IGNA 4UW2A 1GQEA 1IKXB 3RAMA 2KM8B 3AOAA 3PYEA 3OTCA 2W25A 4DZDA 1S1TB 4PXDA 4EI2A 1SV5A 2K8GA 3BGRB 4EO6A 3OR1B 2XO7A 2ADBA 2VIHA 1J5EJ 2HS0A 4JI4F 2LQ5A 2AYBA 4LRCA 1SJ1A 2EC2A 3FRYA 1R8AA 1HQ2A 1EKSA 2VJUA 1RZMA 2QSFA 2IIHA 1HQUA 3DGVA 3JTNA 3JYTA 2J6SA 2ZHBA 2O5DA 1YJNS 4EO8A 4YMEA 2HMIB 3NG8A 4P7TA 1REVA 3VAKA 2HHPA 4DV1F 4IOAQ 5C24A 1X9WA 2VOOA 1UEKA 2CRLA 5ETNA 4LMZA 3K5PA 3M6XA 3OUYB 1JNRB 2B0GA 1RU1A 2GQQA 4CYUB 5CZXA 3PO4A 1RWUA 1JLBA 1S7HA 4PAAA 3OVBA 1WC1A 1SQEA 1SI9A 4ECVA 1JMTA 1AUDA 2QIFA 1I94J 4X66J 1FDBA 1T05A 1NLKL 5F8MA 3M32B 4M63A 4QW8A 4PR6A 1S7IA 4G1QB 2HHQA 2HFNA 1O8BA 4MKBA 1LWEA 3MEKA 4U6PA 1BD6A 4MK8A 5AXMA 2H54B 1W26A 1TFWA 4DN9A 1J5OB 3Q83A 2ZNYA 3SSRA 4I7FB 3L9ZA 4XAKA 4JI8J 4RW4A 3TEGA 4USMA 4CH1A 3RRGA 4UUWA 4H4KA 3UE2A 2VG7B 2MKYA 2ALZA 3U1MA 1M1HA 2O66A 3J7ZT 1IKYB 1TV6A 2SXLA 4DUYJ 2V4JA 3D6TB 1SH0A 2MQLA 1VOMA 3QT6A 5KAKA 2E44A 5D3GB 4OYWA 3W9HA 2MLXA 2RUSA 1HNIA 3LAMA 3Q89A 4OYIA 2KO1A 1KKHA 3T5LA 2HVIA 1T02A 1ICEB 2CPHA 2DGOA 2F63A 1DQAA 1Q95G 1Q81T 1Q16B 3ITHA 3KKFA 5KT5A 5KFKA 2HSEB 4ID5A 3M6UA 2YH1A 1S6PA 3IG1B 2K1RB 2K3KA 5L8RC 4RWWA 2YVSA 5F3TA 4DEZA 2EK6A 3HHLB 3NNAA 1FKPB 2PMZD 2YKMA 5L1JA 4USUA 4ZVFA 1HNWF 2CQIA 3EX7B 1LKZA 2RRAA 1NXIA 4DS4A 4ZLNA 2RU9A 4IG3A 1VQOS 4GKKF 1U25A 1HBMA 3HFKA 2UV8A 3OSPA 4DR2J 5LJ5Y 1YJRA 2QA4G 3BBFA 1H73A 5A0YB 3VZIA 2Q6BA 1L5UA 4A8SA 1GMWA 2VPZB 4M5KA 4DL0C 1ZYQA 3H5YA 1S5ZA 1T95A 1VK3A 2GIRA 2OEMA 1U1KA 3DLBA 3VAHA 1OO0B 1GX5A 2DITA 3GFHA 1RKIA 1S1UA 2DR8A 3WDOA 3GU0A 4WP9A 5F8HA 3DLHA 2RDDA 4E2FB 1WOPA 4ZHRB 5EDWA 2HZCA 4P2XA 1RJJA 5F8IA 4C48A 3AD7C 4X62F 3CJKB 1YITS 2FHJD 2JX2A 2UP1A 2RKIA 4DX7A 3M7VA 4NMLA 2FLOA 4MIWA 2Z2ZA 4PXBA 5L39A 1AUSL 2AYMA 3S01A 3T9NA 4C3KA 3WZ0A 5KFCA 3VQTA 5KFHA 2C22A 2JOQA 3PR5B 3KJVA 2QGFB 2YXLA 2W4CA 1KQKA 4UY8T 3BQ1A 1S1VA 2CDQA 3IWLA 2W2PP 3H8YA 2J0XA 5A8WA 3DGPA 1S72S 1TVRA 2GVZB 1AA1B 1X5SA 3OTEA 3HVTA 1S49A 2XULA 3VTIA 2Y0BB 2XGPA 5D8HB 3HHDA 2D9OA 3MEEB 2FB0A 5DG9A 4DL6A 4P7VA 4TLQA 2I8EA 4U7UK 1MROA 3GCXP 3GIJA 5HSPA 2N3LA 1TL7A 1R0BG 2H5IB 2KHDA 4NEZA 4ZP8A 1VQNS 2ZOGA 1RWWB 2EFVA 2DD8S 3TYTA 5LSOA 1IBKF 3KK1A 4NLRA 2ROPA 1TMJA 2KT3A 2QLBB 2OO4A 5AJ3F 4FF2A 4W4MA 5IZHA 3PX4A 4WP3A 4IDKB 2AJ4A 2HBRB 2OTLS 3MM8B 1XEZA 4F3OA 3H20A 2QSWA 4RW7A 1FESA 4KO0B 3TUIC 3HKWA 4DCPB 1NK9A 4USIA 5DO2A 3CCMS 2BXJA 3THTA 5JUMA 1KLNA 3O3LA 3AQPA 2MSTA 2E5GA 4OZLA 1R31A 3O2IA 1EHWA 2KL8A 2DPJA 5H9FK 4DV3J 2FJAB 1LWFA 5SUHA 5EHHA 1JXLA 2IHR1 1NU4A 1TAQA 5E3QA 1NK6A 4WFBQ 4HKQA 3GFXA 2QRRA 2D9PA 4OX9F 3NGRA 1XNQF 3G6VA 2UU9F 2AV5A 8RUCA 3M8RA 2YQ3A 3UDEA 4NLWA 2VFRA 2CQCA 1S1WA 4LJMA 2CG8A 1HNVA 1S9GA 4LBHA 1C0UB 3GCWP 4ZLPA 3RAXA 4Z2XA 2E9ZA 1F3VA 2PMHA 1G4CA 5HBMB 1TUWA 3BYRA 3I0SA 3RR8A 4U96A 2ZHAA 2AJ1A 4L72B 1WHVA 4WBFA 3OFFA 2IBOA 4WKYA 1QY7A 2QX0A 5DZ6A 3KHGA 2VODA 4LR8A 1VC5A 3RBXA 2EFPA 1SKWA 1PIEA 1SIWB 5I3UA 2D3OR 3EGZA 4TYBA 3N01A 4QU7A 2ZZNA 1M5KC 5J1NA 1OYDA 3MOZA 3ET6A 3K58A 2ZZTA 1P1TA 1RWPB 4CM0A 5GMKa 4V1Ak 3FCVA 2RAQA 2MJUA 4EUVA 3GR1A 2B9YA 3NP5A 4TQSA 1LV5A 2BE2B 1WF0A 2IVMA 3HSZA 2ZJPQ 2QMWA 2LXIA 3CDUA 3R3TA 3VVTA 4JI3F 4HACA 1WC5A 1ZZFA 3MM9B 2NSCA 4ILMA 1VQYA 2EWHA 4WFZA 4FYWB 1HWLA 3RAQA 1HQEA 1M1KT 2VPWB 4C8YA 1I51B 3PW4A 3CMQA 3B78A 2AZ3A 2VPXB 1S99A 1YJTA 1NRKA 1DZ5A 3ENVA 1WOOA 4ITSA 3DMJB 2AF6A 1ZM2A 3BSNA 4ZPTR 1HW8A 3KOAA 2XTJP 3IN5A 2DHHA 2KKHA 5DG7A 2HFOA 1U1NA 2IVYA 3W5ZA 1I1GA 4NLOA 3TZYA 3C16B 3NOCA 2RF2A 4DPUA 2X1FA 4DF4A 2WBMA 5A6WA 1U02A 3FEYB 4CH0S 3IR6B 1ITPA 2NXJA 4YR3A 1FNOA 3MXHP 4DX6A 3CXCR 1APSA 4QZVB 2I6WA 3J81j 3BR9A 4ECSA 3L09A 4R8UA 1RT7B 4NEYA 5L9XA 4C6AA 3D0IE 2HGMA 3EZ5A 3BDPA 2OEKA 2DO4A 1IWAA 3MTKA 4IQMA 4L76A 5IXUA 4ZVGA 3FNNA 3MWBA 2EBGA 3BGFA 3KK2B 3C6TB 4DLGA 3KMQA 1UZHA 1N5YA 1U8WA 3BKFA 5J2PA 4X4TA 1N33F 2HZAA 3KG1A 4NL5A 5KFYA 5LMUJ 4F25A 1Z2LA 2ZBPA 4LF5J 3JSRA 2KJWA 1WELA 2DNRA 2XO6A 3OR2A 4PKDB 4YDXA 3RB6A 5KFVA 1YJ7A 1QSLA 3MR6A 4ZMMA 3JSYA 1S4FA 4K4WA 1NPPA 1J2VA 1BGXT 4WE1A 3EYZA 1HPZB 1B64A 4F36A 3P45B 1WEXA 4XPCA 1VLYA 4H54A 1VRUA 3FGVA 1AXQA 3Q8UA 4X4RA 2C2MB 2XYGB 3T3FA 3VR1A 4M5LA 2J9CA 2MQPA 3SQOP 2XQCA 1UWBA 4C8KA 2XS5A 4ZLJA 2Q79A 1HR0F 4C8ZA 1CJUB 3ZNJ1 4EBEA 2Z0GA 4J9LA 3PX6A 2QL5B 3C3LA 1LK5A 4YHHJ 1RTDB 2XZTB 1P9QC 2VBWA 5T7LB 1FX4A 3D3CJ 1EQMA 3D5MA 2W8KA 4J9VA 4C8OA 1WKJA 1RA6A 2QV6A 4LQ9A 2IM0A 3WBZA 3CT9A 2AGOA 4TY8B 3HJFA 1PG5B 3B54A 3PYFA 1NB7A 4PWWA 1JK9B 2M7SA 1VHFA 5A6PA 1YLXA 4N77A 1S6QA 2NUHA 3MM7A 4GKJJ 3KXDA 3SV4A 2DY1A 4DPYA 4DLEA 3CD7A 1T9UA 3CGIA 4K4SA 1OQ3A 3R7SB 5LL6d 2KVIA 4I4BA 2MMYA 1VQPS 3HLUA 1HYSB 2M2BA 4DFMA 1J5EF 2MXYA 2MSSA 3AB4B 5KG6A 4DFKA 2KXFA 1QD1A 3KLEB 3DLEB 2FHOB 3M2UA 2J6TA 4RU2A 1WNEA 2N4CA 4DCJB 3POTB 3TI0A 1FVSA 1IR2A 4W98A 4U8VA 1LW2A 2QZ8A 2OPPB 3T1HJ 4CCHA 1BWVA 3CCSS 2DCLA 1TL5A 1TKZB 5KG0A 4OJGA 3OLAA 4JI2J 2VL1A 1F60B 2ZC4A 4IO1A 3UI3A 3W8PA 4XK8C 3MPDA 2ZH4A 2H5JB 3RTVA 2ZM6F 4WFYA 4A4JA 3BV8A 3GTYX 3BR8A 4YFUA 1GAOA 4OHXA 3G6ES 1UVIA 1YIJS 4CLYA 2E1CA 1NJZA 5K5MA 1RT3A 4X66F 5T14A 1I94F 1BLUA 5BYRA 1F0XA 2NUUG 2C3MA 3K57A 2I2YA 1HI0P 3RBZA 2JC1A 2BA9A 2WOMB 5HVGA 5DGAA 2I5JB 5KFEA 3DI6A 2HURA 4QW9A 3MGJA 1BQNA 4ZCMA 1VQ6S 1R89A 3E2EA 2U1AA 2HLTA 3QZ8A 3R5DA 4JI8F 4YY3J 3MEGB 2F40A 4CLSA 5B09A 2FHKA 1WG1A 4DPTA 3I82A 2FLPA 4FS1A 3KHHA 3HP6A 2V0NA 2IC3B 2AU0A 1RBLA 2COLA 3ZZZA 1FT8A 1X4AA 4DUYF 3T1AA 1LWCA 3U7JA 1N4LA 1GK8A 4ZVTB 1S1XA 2MKKA 2DGWA 1OWXA 4YB6A 4CLPA 4K7QA 3GWCA 2DHAA 2Z2YB 2WW4A 1DQ8A 3HD2A 3JTOA 2AJ0A 1KQFB 1NK7A 3GG1A 1FK9B 4F0KA 3ZTOA 2AIRB 1SQFA 1JLQA 1X5PA 1UVMA 2NZ4A 3H2UB 3OXGA 2GO9A 5CH7B 4RBUA 3LWLA 1FFSB 1O5JA 4U9RA 2MEWA 5KTQA 4F4KA 5CA5A 1IKXA 4OYOA 1S1TA 1CULB 2BJ8A 3A3OB 2J9EA 3R27A 3BGRA 2CZ4A 2YKOA 1X0PA 4DX8H 2QC3A 1OQ6A 3OR1A 1G7CB 3KLIB 3O44A 4ZN1A 3UO0A 4BWJA 4GVBB 3CULA 5AE3A 4LVNP 4TU8A 4A46A 5KOWA 3I5CA 4OQJA 3I9ZA 4LSLB 2BANB 2VQEF 4WZMA 2FQQB 2JZ5A 2V8GA 1QSYA 2HMIA 3PFOA 2RS2A 2HVHA 2HYIB 4QR0A 2HFUA 3CJ5A 1S0MA 1MLAA 4DR2F 2OIHA 4WPAA 4DL5A 1RAEB 2ZVSA 4O0NA 5CYJA 1PJ5A 3K7RA 4USKA 3DLJA 2G2ZA 4ELUA 3OUYA 3G87A 3NXZA 2V34A 4DSEA 1V3RA 4CYUA 5F8NA 2X1BA 1YRUA 2B4OA 5D6GA 1TKDA 2CUYA 3G9CA 1VLOA 5DQHA 4CO5A 3M32A 2UZAA 2NLWA 1YZ7A 4PG6A 4ZPCA 1IR0A 4LSZB 4G1QA 3PW5A 1C2PA 2AWZA 2R8HA 2LCWA 2J6UA 3BGOP 2WONB 3BKUA 3H4BA 1H74A 1VQ9S 5KFPA 3OL6A 4BS2A 1J5OA 4I7FA 3MR5A 3MM6B 5GAHU 2QL7B 1WKKA 1JXEA 4K5RA 2RQKA 2VG7A 4RNFA 1SC3B 4RLEA 2UUCJ 4CNZA 2J0QD 1IKYA 3I4HX 3QPIA 4CP5A 1K73T 3NWRA 2A18A 3BO4A 4PXCA 4C11B 3MUMP 1IR1A 3UNYA 2E7XA 1FJCA 4GO5X 3CE8A 2UV8G 1EQ0A 2V4QA 1OPZA 5D3GA 2M4MA 1NSAA 1DHMA 1RWKB 4ECRA 3DFEA 4AL5A 1WC0A 4M5NA 3NCPA 3VGSA 4Y65A 3DDKA 4RUHA 3THPA 4Q45A 3P6YC 2R2RA 3P96A 1NJXA 3GQCA 4CLUA 1S9EB 2BACA 1JKHB 3LF0A 1X9SA 1NDPA 1MN9A 1T9YA 4RW8B 2ZH9A 3D4JA 4PCQA 2K1RA 5D4OA 4V19J 1HMVB 4DR1J 5HO4A 3HHLA 2HFSA 3KK3A 1FKPA 2YKNB 4RWXA 2B43A 4FBUA 3C6UB 2GGPB 3KNGA 1XMBA 1D9FA 1QVFR 4K59A 2BMBA 2AYGA 1QAYA 2LQBA 3MPWA 5GAEI 1FD8A 4B9MA 3IAS9 2YQ0A 2HBYB 2ZE2B 1FX2A 2LKZA 2L9NA 1XC9A 1TL1B 1RHQB 2IBKA 4F2RA 5A0YA 3K8WA 1RHUB 1VIOA 3PW2A 4ETXA 2H48B 4DMZA 3GLJA 4KGKA 4ANCA 5A2QY 4TNOA 2MJNA 1SC6A 4I2QB 1QUVA 3IR5B 3CD0A 1IBLJ 3L7OA 3MPYA 4P10A 1JLGB 2I9SA 3PJXA 4PZVA 4LBIA 2CG4A 3X3UA 2CQ0A 2CNOB 4L75A 1V6HA 3RYLA 1VHIA 3QT8A 5RUBA 2JHEA 3UPFA 3CCQS 2C2RA 4DXLA 4F3MA 3L4BC 2W2NP 4ZHRA 2E7WA 5KG1A 1HW9A 3N4WA 2QLJB 1IBMJ 4NI2B 1IBCB 1NH8A 4WFXA 4ICLB 5B08A 4IOBA 4HYKA 1VQSA 1CSJA 2CZ9A 1TL3B 1R7IA 4EBCA 2GJIA 2O01C 2W24A 1KOHA 1B4SA 5IM0B 5LSRA 4PG5A 2UUBJ 1RT6B 2Y1LB 4KB7A 3IA0A 4ZP6A 3FFIB 2J7WA 4DR5J 2MY7A 4EFAC 2Q43A 1N32J 4Y2MA 2GVZA 1TFYA 3V4MA 2Y8WA 3LUYA 3KUEA 4K50A 1VBXA 1G2EA 4YP3A 2X7IA 4USTA 3LGNA 4OZNA 3P8BB 5J2MB 3MEEA 5HL7Q 2DGXA 3D0GE 3DM2B 5A8RB 3MD1A 2KYZA 2DGSA 3KDNA 1Y5NB 5ADZA 1VQLS 3RR7A 3TA1A 3OPKA 1Y11A 1CJTA 3RBEA 4FN5A 1YKWA 4EEYA 3TNVA 4XPEA 1RXOB 2MKHA 2KT5A 3VHQA 1H98A 5BJRA 2HS3A 3ILLA 5IWAJ 3DNCA 2CQBA 1HD1A 2MLYA 2OPQB 3C14B 1YJ9S 1VR6A 3TZWA 1DTQA 4LREA 2ZH8A 3AT1B 3S1TA 4LF4J 1A7GE 2BM0A 3PEHA 1IJFB 2YWFA 1KQSR 3ADAC 1EX8A 4IDKA 1UA0A 1FO1A 4PG4A 3WC0A 3MM8A 9RUBA 2KHCA 3KDOA 2BKNA 3VZHA 2DGUA 4PABA 1FKAF 2PIIA 2OH2A 4HVZA 4ED4A 4HHJA 4KO0A 3DXSX 4E8UA 2QFIA 1K1QA 3KYLA 1CS4B 3GIRA 1F5BA 1IKWB 4DQSA 2GQCA 4AD6A 4WWSA 5B0DA 4KYZA 3QO9B 1D3WA 2OLWA 4DR4J 4J91A 3LO3A 3TA0A 4DSFA 2XEXA 2XGQA 3EZOA 3TUJC 4AFFA 2XZDB 1SKSA 2HBZB 2V8VA 4Y2KA 3CMAS 5EX3A 2XI2A 4DV0J 4P74A 5KT2A 3UD5A 1JLBB 3JXOA 2IDLA 2B7CB 2CJYB 3J7YU 3OL9A 2KRRA 5EN1A 1YQHA 3BKTA 3M8SA 2QMUB 4ZVPB 3CCRS 2IJRA 2HQFA 4DUTA 1C0UA 3F41A 2DBBA 3L3CA 4U7UD 1IQZA 2F8MA 1S79A 1E6YA 3AFGA 3EPGA 5HBMA 2CJXB 4JV5J 2VKZG 4DCOB 4IFYB 3MCOA 1RGVA 2ABYA 2DNOA 2ZBIA 3CW2C 5KFOA 4K0KF 4LF5F 3SYZA 3AXMA 2L9DA 4J9UE 3GB0A 5L38A 2OTJS 4IO9Q
chains in the Genus database with same CATH topology
4CH1A 3RRGA 4UUWA 1GNKA 3MECA 3MMBA 2JJ4D 4KT0C 3G8TA 3B82A 4RUCA 4H4KA 2YX1A 2VG7B 3UE2A 1Q8IA 4OFZA 3TVZA 3MMCB 2ALZA 4CO4A 3U1MA 2D3ZA 2G4BA 2R7SA 4JI7F 2IMWP 3SV3A 4DN0A 2O66A 3CJ3A 1FVQA 4JUZA 3P5TL 1FF2A 3J7ZT 2P6TA 1IKYB 2YWGA 3L95X 1TV6A 2SXLA 4NZ6A 2P5VA 3DRPB 5HLFA 3KG4A 1UA1A 1IJEB 2XSFA 4WF9Q 1PILA 2V4JA 5H9EJ 1QTMA 4R0JA 3TANA 2YNHB 1ZAXA 2VONA 4EZ9A 2LA6A 4GC7A 3I4PA 1SH0A 3ISZA 4H4MA 2AP6A 2HLUA 2MQLA 3BN4A 2CQPA 2FHJA 1VOMA 4L6V3 2K2PA 3ZZPA 1FRMA 3VAFA 1SL2A 2ERRA 3JSMA 3V5RA 5KAKA 2M8HA 3KHLA 4QWEA 2CYYA 2KU7A 4NCBA 3JAMY 2JC0A 3PRDA 2E44A 4WU3A 2LQ9A 3I0RB 1BQMB 3NBPB 2BE2A 5D3GB 5F8JA 1XWLA 3G96A 5HN0A 1HNIA 3LAMA 1RT2B 3CPWR 1SUQA 2KO1A 3OVAA 1U24A 5F0WA 1RTIB 4F3QA 3GV5B 4F02A 3OLBA 5HI7A 3T5LA 1FJEB 1T02A 2HVIA 1FXDA 3MUTP 2CJBA 1FRKA 1VQ7S 2CFXA 2CPHA 2DGOA 3MM9A 4YHHF 4DFJA 1ZAVA 2PA8D 2DISA 4LIRA 4K4VA 1TZ0A 2QA2A 4QWAA 1UJ6A 3ISND 3ULHA 4GO7X 1DQAA 1H7XA 4I6AA 5F0UA 2UUWA 2C3YA 3G8QA 3M2RA 3MCSA 1N48A 2VG6B 1Q81T 4LF7F 1X4GA 3KLGB 4C8MA 2APOA 4CT9A 4M1KA 2MHNA 2UXDF 3VWSA 1Q16B 1VC0A 2MDAA 4I56A 2KM8C 3ITHA 3Q8RB 1QAXA 3KKFA 4QIEA 2FVRA 5KT5A 1KVIA 4PXEA 5KFKA 5FDLB 2UVVA 4U7CA 2BYCA 4B17A 2BBEA 5IQQA 4ID5A 3I0RA 3TP2A 3K5MA 3M6UA 2YH1A 1EETB 1S6PA 2AJFE 2XB2D 3K5LA 5L1LA 4IG3B 3IG1B 2F9DA 2K1RB 2K3KA 2OMOA 5L8RC 4RWWA 2YVSA 3DMJA 4N47A 3M05A 5F3TA 3MEDB 4DEZA 2EK6A 2CPJA 3HHLB 2RQMA 4Y00A 1UJ4A 5EWFA 3VAMA 3NNAA 2B4UA 1FKPB 2BJEA 4GKJF 4IG0B 2PMZD 4OI2A 2YKMA 3OFHA 2BV3A 1M90T 2GIQA 5L1JA 4ZVFA 1HNWF 2CQIA 3EX7B 2Z8QA 1LKZA 1VBYA 1Q86T 3IC1A 2Y1JA 2RRAA 3OTBA 4CTAB 4DS4A 3HF5A 2R7VA 3QZ7A 5KG5A 1C1CA 5DDRC 1HL6A 2XWXA 3PXGa 1Z2ZA 3F73A 4ZA1A 1C0TA 1M5HA 3QGPA 2GC8A 1H0HB 4B9NA 4Q7AA 5C42A 2X3GA 2MHEA 2F8HA 2RU9A 4K4TA 4IG3A 4AL6A 3IG1A 2MGZA 1VQOS 4GKKF 1U25A 1HBMA 2I38A 1TP7A 2WB1D 2UV8A 3HFKA 3M9NB 5A8KA 3OSPA 4LF9F 5LJ5Y 1XBWA 2PN6A 3N5FA 1YJRA 3PDNA 4JYAF 4KFBA 3OJUA 1YHQS 4RW6A 2UVWA 3LW5C 2QA4G 3F44A 3M2VB 1XR6A 5A0YB 3CUNA 1DRZA 3CJ4A 5J2NB 3VZIA 2Q6BA 1SH2A 3V6HA 2IRYA 3J7A1 1L5UA 1X4HA 3IBWA 4A8SA 1FRXA 1QJHA 4JV2A 2EVZA 2XS2A 1YG0A 3T1HF 4J5OA 2R2TA 2VPZB 4PWDB 2HG4A 1F9FA 1OPIA 3A1YG 4RU9A 3A8EA 4DL0C 1VMBA 1JIHA 3KK2A 1VBZA 1ZYQA 3U1NA 1XNRF 2MKIA 1FKOB 4PWUA 3C6TA 3H5YA 4JI2F 3TQ1A 3UCZP 1VK3A 1T95A 4ELTA 2GIRA 2R7UA 2A2CA 2JL9A 1U1KA 2FY1A 2OD6A 3V2UC 3DLBA 4RNHA 2E1RA 2NR0A 2OPRB 2HFZA 3CC7S 3VAHA 1OO0B 2DR5A 1GX5A 2DITA 3GFHA 1EP4A 3D1HA 1RKIA 1HI1A 1V9OA 1X7VA 1S1UA 2DR8A 1NKBA 1KOOA 3WDOA 3UR3C 5F8LA 4WK3A 1CC8A 1BQXA 5F8HA 4X4NA 3SZ2A 1LW0B 1CPZA 3DLHA 3W7BA 1PSDA 1SB6A 4XO0A 2ZH3A 2E9RX 5EWEA 1M5OC 1XTZA 1YBAA 2B5JA 4ZHRB 5EDWA 2HZCA 1C4CA 5L1IA 2P6SA 4OZ5A 1SL0A 1RJJA 4J9OA 1VQKS 5F8IA 1UP1A 3EXCX 1KVJA 4AYBD 4X62F 3CDAA 2ASDA 2PFFB 3MMAB 3CJKB 3FSYA 5LXRA 4CNYA 1N34F 3FZ2A 1YITS 1LOUA 1N6QA 1T03B 4G1IA 1Q79A 2VV5A 3Q0AA 1N88A 2LU1A 2FHJD 3OTDA 2JX2A 2K7JA 2RKIA 3TO8A 4U67Q 2DGQA 1MMLA 2UP1A 4Q8EA 3M4XA 3ONQA 3AH6A 3AAWB 4NMLA 5D4LA 1SJ4P 3TR5A 2FLOA 3FCHA 2MKSA 4MIWA 1Q8LA 3MFHA 4PXBA 2BQUA 3GMGA 5L39A 1UAWA 1HPZA 2JLGA 2E1AA 2WCXA 3TAQA 2V9KA 3D1QA 2EK1A 2AYMA 4HT5A 3S01A 2RB7A 3T9NA 4C3KA 1A9NB 3HKZD 1KLMB 3WZ0A 2B6AA 2V9WA 4ZOSA 2DH9A 1ZH5A 3BQ2A 4CO2A 4YY3F 1O0PA 5KFCA 1CVJA 3US5A 3VQTA 5KFHA 2YWKA 2JOQA 2C22A 2VC0A 4WKRA 5DDQC 3U27A 3PR5B 2HRYA 3ZC4A 3KJVA 3BSOA 4IH7A 3AQOA 2W4CA 4HH0A 1KQKA 3CJKA 4UY8T 2RRBA 4DQPA 3N6MA 3VAGA 2ZDPA 3BQ1A 3MFIA 1VI7A 1ZTTA 3KLHB 1T8EA 4KTQA 2KI2A 1S1VA 3UR0A 1HBUB 2CDQA 3IWLA 3OXLA 1R43A 2IA0A 4JI6F 2CPXA 4DSJA 2R7TA 3H8YA 2J0XA 4PPDA 5A8WA 2CQ3A 3DGPA 1S72S 3W2WB 1TVRA 2ASJA 2M88A 1BY9A 2HQ3A 1RK8A 1SKRA 4TXSA 3ZZOA 3ZZRA 1RTDA 1X5SA 3OTEA 5G4DA 3HVTA 2OPSB 4M5DA 3AJ1A 3G86A 5T7LA 4NRTA 5FLXY 2ADCA 1S49A 2RDJA 2PEHA 4HTIA 3H2VE 3J81Y 1R3NA 2XMKA 2XULA 2KJVA 2O3DA 5KG4A 2Z2MA 3VTIA 5MAOA 2XGPA 5D8HB 3HHDA 1KTVA 2D9OA 4DR4F 3MEEB 2FB0A 1H3DA 1TKTB 3D54A 1ZPWX 4QBUA 1V3SA 1XK8A 3TVYA 4TY8A 4UQGA 4WCEQ 1E6VB 4CO0A 5DG9A 3CWJA 4A8QA 4DL6A 2CQ1A 4P7VA 4TLQA 5KG7A 2I8EA 2MPUA 2VFUA 4U7UK 7FDRA 1MROA 4M94A 1URRA 3GIJA 3NMRA 2ZD1B 3OHBA 2HVZA 2N3LA 4O44A 3HHLC 1HWIA 2IM2A 3W2WA 3CO9A 4EWTA 3ZZUA 1VQ5S 2KHDA 4ZP8A 4ES3A 5AE1A 6FDRA 5M2UA 2MB0B 1VQNS 4KHMA 4A8XA 2VC1A 1VK8A 3G4SS 2ASLA 4XDCA 3C66A 4NZ0A 2BRLA 2ZOGA 4TU7A 3V4IA 4QPTA 2EFVA 2ZKUA 3QYYA 2LVWA 5KFXA 2DD8S 2EFGA 3TYTA 2LMIA 1W25A 2YX4A 5LSOA 1P1LA 2RILA 1ZBTA 2DNYA 1G6BA 3KLFB 4NLQA 3KK1A 1IBKF 1MNEA 3IRXB 2KN4A 3R1HA 4FF4A 1HYSA 3D1OA 4NLRA 2HNZB 2ROPA 1N5TA 2HPUA 2N4DA 2KT3A 2CJQA 4Q43A 4Y0FA 3KHRA 4DL4A 3NL0A 2OO4A 5AJ3F 1KTQA 2B4VA 5JJBA 1F2GA 3I5AA 4FF2A 2XS7A 4OLPA 3DLEA 2MKCA 2YH0A 2FJBB 3Q2TC 3QWUA 4MFBB