1A9NB

Crystal structure of the spliceosomal u2b''-u2a' protein complex bound to a fragment of u2 small nuclear rna
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
94
structure length
94
Chain Sequence
IRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA (5'-R(*CP*CP*UP*GP*GP*UP*AP*UP*UP*GP*CP*AP*GP*UP*AP*CP*C
publication title Crystal structure of the spliceosomal U2B"-U2A' protein complex bound to a fragment of U2 small nuclear RNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 25
structure length 94
sequence length 94
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1a9nB00
1Q81T 1HL6A 2CPDA 2KXHA 1OIAA 3MD3A 4TU9A 2OTLS 2LXUA 2RQ4A 4WIIA 5D78A 1ZH5A 4IOAQ 4IUFA 2D3OR 4WKRA 3OW2R 3TO8A 2CQGA 2DGQA 2DH8A 3H2VE 1WHWA 2ZJPQ 2XS2A 2M8HA 1M5KC 2JWNA 4WFAQ 3J7YU 5GMKa 3IRWP 1WI8A 3CCJS 3MDFA 4OZ0A 1H2UX 2NZ4A 2DIUA 2X1GA 2DNRA 2JVRA 1SJ4P 2FC8A 3CCRS 3G71S 3L3CA 3ZZYA 1UFWA 1FJEB 4PR6A 1QVFR 3TYTA 2MKKA 5GAHU 2LEAA 3P5TL 4F25A 1IQTA 5JVGQ 5LSOA 2D9OA 1SXLA 2X1FA 2CPXA 2YH0A 2U2FA 1U1KA 1SJRA 4CIOA 2GO9A 2KI2A 3CC4S 1F9FA 5GAEU 4RU2A 2MB0B 4ERDA 2X1AA 2I38A 2OJ3A 2PEHA 3I56S 3V4MA 2AYGA 3CCLS 3JB9k 1VQKS 3VAMA 1BY9A 1DHMA 1N54B 3MD1A 3LPYA 1G2EA 2RS8A 1JJHA 2VOOA 5IM0B 3SMZA 2M2BA 3BS9A 2F9DA 2AD9A 5D77A 2QEXS 5DDRC 3FEYB 3CC2S 1X4GA 1S79A 3UWTA 3VAHA 2DO4A 2B0GA 4Z2XA 1JMTA 1H6KX 2KXFA 1QVGR 2XNRA 3DLLQ 1VQ5S 3K0JA 2MKCA 4WCEQ 2QA4S 1VBYA 2HYIB 2HGNA 4TU8A 1U1LA 2PE8A 3CMES 4WFBQ 3UE2A 3CCMS 1VC5A 1WEXA 5FJ4A 2DISA 2CPEA 3SDEA 3NNAA 4ED5A 2MY8A 1N52B 2LECA 2CQ2A 3BO3A 2FPHX 4WFNQ 2MZ1A 5LSLA 1X4CA 1NJIT 1WG4A 1N88A 4CQ1A 2MZJA 2G4BA 2MZRA 5CXTA 2E5IA 1DBDA 2HVZA 1X5TA 1VQLS 2DGUA 2MJNA 3MI7X 2ZJRQ 3PIPQ 3MUVP 1HA1A 1JJ2R 1VQOS 2MGZB 1SJFA 1YJWS 1OO0B 4UY8T 1UW4A 3R27A 2CQDA 1OWXA 3Q2SC 1VQMS 2DNMA 1YI2S 3CCSS 3VAIA 3FEXB 2L41A 3CXCR 1Q86T 1VQPS 1M1KT 1JJ4A 1FJ7A 1KC8T 2KM8C 2RQCA 1A7GE 2M9KA 4IO9Q 3R1LA 1X4AA 2N3OA 1M90T 1YIJS 2OTJS 3MUMP 1YWXA 2MQNA 1B7FA 2M0GB 1W2BR 1K8AT 5CYJA 3BO2A 3G8SA 1SJQA 3SXLA 2ERRA 2BOPA 1WI6A 2DNYA 2MZTA 1VQ6S 3LQVA 4C4WA 1HD0A 2J8AA 1AUDA 1Q7YT 2CQ4A 2CPZA 2DGWA 1WG1A 2AYMA 2AYBA 4QU7A 1VC0A 2KT5A 2OIHA 3THTA 3EX7B 1URNA 3P3DA 3G96A 2MKHA 2MQOA 1WELA 3VAGA 3ZZZA 2F9JA 2N7CA 2Q79A 2CPHA 1FJCA 2J76E 3EGNA 3R1HA 2DGSA 2DIVA 2KFYA 3MOJB 5GAGU 5GVQA 5LXYA 4LMZA 2MJUA 2G1DA 4F02A 5IFMA 2NLWA 5DDPC 2HGLA 3VAKA 3CULA 2E5JA 2U1AA 1U6BA 5ITHA 2L08A 2L9WA 2CPIA 2MQLA 4ZKAA 2MZQA 1H2TZ 2HZCA 3I55S 5MLCV 1VQ9S 3RW6A 1U1PA 2DNNA 2M8DB 5IM0A 1VQ4S 2DNZA 2VOPA 1FHTA 2K8GA 2RS2A 3ULHA 2ADBA 2CQHA 1M5VC 2RT3A 1RK8A 2DH9A 2MY7A 2CQIA 2LA6A 2RRBA 5HO4A 3CMAS 1X4BA 2J0QD 3IWNC 1VQ8S 2MQQA 1N8RT 1M5OC 4YOEA 1RKJA 2DHXA 3BEGB 2XB2D 3HHNB 4P6QA 1ZZNA 1WEYA 2MQPA 1A9NB 4F26A 2DITA 2EVZA 3MUTP 3D2WA 2WBRA 2YWKA 2DHSA 2LXIA 2I2YA 1VC6A 2E5GA 3VAJA 2QFJA 4FXWA 1YTYA 2CQ1A 1KOHA 1KQSR 2CPFA 2DK2A 5H1SV 1U1RA 1X4HA 1PGZA 2KG0A 4C7QA 4YB1P 2DGXA 4QPTA 1U2FA 2RNEA 5DDOC 1VQNS 2DNOA 5LXRA 2M7SA 2JRSA 2MGZA 1S72S 1WHXA 3MXHP 1WG5A 3UCGA 4W90B 2MYFA 3CD6S 1VBXA 4C0OC 3G9CA 1P27B 2OSQA 1VBZA 1FXLA 3CF5Q 4FXVA 3CTRA 4PKDB 2XS7A 2N3LA 3CC7S 2LA4A 1WEZA 5DETA 1WHVA 2EK6A 5JVHQ 5LJ5Y 3H2UB 2FC9A 3NS6A 3VF0B 1ZZFA 2X1BA 3B4MA 4J5OA 1DZ5A 1X5PA 2LQ5A 4IOCQ 3UD4P 2N82B 4TU7A 1D9AA 2MZSA 2MKIA 2DNHA 4BS2A 2AYEA 2LKZA 2BZ2A 2LMIA 2XS5A 2K3KA 2KM8B 3DXBA 1CVJA 4LIRA 1YITS 3P49B 1K9MT 1PO6A 2M88A 2HGMA 3MURP 5LJ3Y 1XN9A 1NO8A 4WF9Q 2RU3A 1FNXH 1O0PA 2DGOA 4OZ1A 3S7RA 2E5HA 2YTCA 5DM6Q 5IQQA 3VAFA 1L3KA 1YJ9S 1K73T 2DNQA 1YJNS 5EN1A 1WHYA 1WF1A 2KYXA 4QQBA 1X4DA 2A3JA 2KH9A 3G8TA 1U6FA 2UP1A 2DHGA 1FO1A 2DNPA 4U67Q 3EGZA 2KVIA 1OPIA 2EK1A 2O3DA 3VALA 5DM7Q 4V19X 3US5A 4EGLA 2CJKA 2MPUA 3B4DA 2VONA 4YUDA 3BO4A 3U1LA 3Q2TC 2CPYA 3NNCA 2XSFA 2LEBA 2D9PA 2YH1A 2M4MA 2KU7A 3THPA 2KXNB 3CCUS 2CQ0A 2MHNA 2DH7A 2MSTA 2MKSA 3P6YC 2MKJA 3UD3P 4CH1A 3HI9A 2M52A 3G6ES 5HL7Q 5GADU 1R8HA 1WF0A 2KN4A 2MQMA 4A8XA 1KD1T 3CCES 1R8PA 2LYVA 1KOOA 3RW7A 3CCQS 3J7ZT 2F3JA 2RUGA 3G4SS 4Y00A 2G0CA 4QU6A 1X4EA 2DGTA 1U1MA 3N9UC 3S01A 4UQTA 3TP2A 1FT8A 1WTBA 3U1MA 2CPJA 4M5DB 2MSSA 1M5PC 2LCWA 3S8SA 2DGVA 3NS5A 4TLQA 2CQ3A 3CUNA 3NNHA 2CQBA 2V94A 1QM9A 1SJ3P 1U1OA 4CH0S 2M70A 2DO0A 2DNGA 1WWHA 2KHCA 3UCUP 3SDEB 1D8ZA 1NU4A 1X0FA 5CA5A 1X4FA 4Y0FA 5DDQC 3CCVS 2JVOA 2YKAA 5BJRA 3UCZP 3S6EA 2ADCA 4W92B 1Q82T 2SXLA 2DNLA 1WF2A 2J0SD 2GHPA 4LJMA 1VQ7S 2DNKA 1UAWA 2MXYA 2KG1A 3NMRA 2KRBA 1P1TA 2XNQA 1X5OA 2OSRA 4PRFA 1U1QA 1HD1A 3CPWR 3PIOQ 2VODA 1X5SA 2ZJQQ 1U1NA 1H2VZ 2KRRA 2FY1A 2FHOB 2JX2A 2CQCA 2RRAA 2RVJA 1YHQS 2MMYA 2DB1A 2DHAA 2E44A 2CQPA 1DRZA 1UP1A
chains in the Genus database with same CATH superfamily
1S48A 2CZ4A 2WZ1A 3KJNB 2ZH8A 3LALA 4LFBJ 1ZH5A 2UUBF 4IUFA 1E6YA 3GSDA 2K1RA 3OW2R 4YHHF 3BGUA 1FKPB 3H98A 4OI2A 4WYLA 2W2QP 4OYOA 2BW2A 2CWXA 1DARA 3GLJA 2D3ZA 3GIRA 2HMIA 1GX6A 2GIFA 3B6BA 4OHVA 3L3CA 4GVBA 3DRRA 2W8LA 4HL9A 4B3SF 3AB2B 4JI0F 4UW2A 2MKKA 1VFJA 2X1FA 3W3SA 3MM6A 2GMLA 1S6QA 2F40A 2W9BB 2L48A 3N5FA 5CQGA 3D6MB 3ELHA 4PG5A 2R4FA 4LRCA 2KTQA 2YWHA 1YVFA 5D3GB 3MCSA 2KFZA 3LP0A 3MM9B 1TKTA 4NXMJ 4K2XA 2FZCB 1QY7A 1J2VA 2V6AA 4WP8A 5KFFA 4DR5J 1S9FA 1H6KX 3IGNA 3KLHB 4EI2A 5IC6B 2XMMA 2NR0A 2AEJA 3CMES 4KRWA 3TNVA 3W5YA 4KTQA 2X7IA 4OFZA 3KMQA 1EARA 2G4BA 5CXTA 4AUKA 1CJUA 3MUVP 2UV8G 1Y5IB 5T7LA 5F8NA 4PXDA 1KQGB 2HQDA 3M6XA 1B3TA 3C14A 4P2SA 2QMUB 4KHRA 1OYDA 2NXNA 1JJ4A 5IT4A 1NHVA 4NLDA 4RLEA 5E3AA 2B51A 4PXEA 3BO2A 3NOGA 1WTFA 4LQ9A 3BKTA 3R5AA 1HD0A 3I0RA 1HWKA 1SPBP 4DDFA 2DGWA 1S9EA 1Q95G 2E7WA 3BSAA 2BOAA 5KFOA 4ZP8A 1RAIB 1HI0P 2GVDA 5F8IA 2V50A 2RF2A 2YPZA 2J76E 4G1QB 3SYZA 2GQ2A 3EDRB 4DL0C 2MJUA 3UR0A 3TAMA 5DDPC 2GGPA 3G8QA 1DTQA 2MQLA 3CD7A 1XR7A 2HZCA 3M2UB 5MLCV 3T3FA 3BN4A 1KVIA 4ZPWR 1FHTA 2ADBA 3DRSB 2LA6A 3AJ1A 3FVYA 1S0VA 2HS3A 3W7BA 2DTJA 4QBUA 3NGDA 2GVZB 4B3TF 3R7BB 1HW9A 4DR3J 2K3IA 3M6WA 3J7YI 2K7KA 2YKNA 1IKWA 3CT9A 3HVRA 4DSKA 5JXSA 3D2WA 1Y4ZB 2HK2A 4NLRA 1RGVA 1X4HA 3I9V9 4QJVA 2HQ3A 4R5PB 2CIMA 2XTJP 5LXRA 1OQ3A 2JRSA 2BABA 4KH0B 3UCGA 3ZO7A 2OLWA 4W90B 4NA2A 1HHTP 2QLWA 2XMWA 2CG8A 2Y0SD 4LF4J 3NOCA 2YQ1A 2LA4A 1GFWB 1WHVA 4DUYJ 2OD6A 4RW7B 3D28A 4OV1A 5CH7B 4QPXA 3JSMB 4KGZB 2QA2A 4LF2A 3NP5A 2M3DA 1YJNS 2NPFA 3R5DA 1KNZA 1APSA 4LT6A 1X4DA 3O3LA 3G8TA 5J2MA 2DHGA 2O3DA 3VWSA 2V5HG 1UEUA 4KKOB 1FDAA 1QAJA 4ZVSB 2AP6A 2ZE2B 1Y9OA 4H4MA 2W24A 1XBWA 4C3KA 4DR4J 4MYTA 4PCQA 4CLKA 1SKWA 3RW7A 4ETZA 1ZAWA 3EYZA 4B9MA 1AZSB 4TKTA 1Y00A 4XDCA 1RCXB 4UZCA 4ZVUB 1K44A 3ENQA 3DLGB 3KWMA 3ET6B 4X64J 3CUNA 2HFNA 3MZIA 4ECXA 2M70A 1NKEA 1RHRB 3HLUA 4XO0A 5DQGA 3GILA 2HFUA 3V81A 2OPPA 2EFVA 2KJWA 2NXJA 1F5AA 2Z56B 1XMQJ 4C0BA 2UXDF 2PGCA 3NMRA 5IOLA 1MNEA 2BM0A 3CO9A 2HZAA 1XERA 1KVKA 2HNDA 3W2WB 4WK3A 4DG1A 1F2GA 3V5RA 2QSFA 4RNFA 4TU9A 3HVWA 2RQ4A 4WIIA 4YY3J 3T9NA 5D78A 5KFAA 4CTAB 4J90A 4YR2A 1F9EB 5L1KA 3EPGA 1HBUB 4L6V3 1M5KC 4N8OA 2QTWA 1LFWA 3R9LA 3QRQA 1C1CA 4ZLPA 1REVA 4PYAA 2X1GA 4WWSA 1N32F 3MEGB 1WACA 3MAAA 1IQTA 1MROA 2AU0A 1T03A 1Z4UA 3CC4S 1OSDA 2GS8A 2H54B 4CLFA 1ZTTA 3CMQA 2E7XA 3GQCA 3QRRA 3KLGB 1BY9A 4CLYA 1GXLA 3LP1A 3PEHA 1JJHA 3FRYA 3SMZA 3IS9B 5ETMA 2V8GA 3FGVA 2IVMA 1U49A 2R7TA 2KXFA 1NK0A 5M2PA 3PJ9A 1EIYB 3HHLB 4TYBA 3K58A 1X60A 2A2DA 3CJ2A 1S0MA 1TL7A 1B7YB 3OFEA 3RAMA 2C2OB 2JFDA 3PJWA 4C11B 4CQ1A 4DHVA 3NCRA 4O4GA 5ETQA 2MJNA 1PBUA 1K1QA 4DV2F 3N5BA 2K7JA 4H4OB 2RDDA 4K4UA 2BVZA 1VQMS 2AHOB 1NMEB 4Q0BB 3VAIA 3M2RB 2OI2A 4I69A 4DFPA 1A7GE 3TARA 5T14A 2XQCA 1YWXA 2MQNA 5DGBA 3WQPA 2WCXA 2R8GA 2VQFJ 1M5SA 1JLCB 4H4KA 2MZTA 1XR6A 3BBBA 3ILJA 5A8RA 5HP1B 4QU7A 4R8UB 4DCJB 2N4CA 4TQSA 2LLZA 4KBIA 4YN3B 3CJTA 4CLSA 3R1HA 1T9YA 4ZJQA 3W1YC 2YNIA 1XR5A 1V6HA 3NG8A 2HHQA 1FD8A 2I0XA 4F4KA 3NY0A 1OJ4A 3CO0P 4QWAA 5AXNA 4DUTA 3CCZA 1M5VC 4RR5A 3QMQA 3OVBA 3RB4A 3CJQA 3O2IA 2FTRA 1KWMA 3PXGa 2KJVA 2B9YA 1U48A 2GJFA 2HZVA 1HLWA 2V9KA 1U26A 4OI3A 4AE5A 3AH6A 3I4PA 3VAJA 2CJBA 3EXCX 2P9GA 2IM0A 4YB1P 2IJNA 4QPTA 3K5OA 3HHDA 3D1QA 2C3MA 1RWPB 1HBOB 4F0MA 2UUAF 1HHSA 2MYFA 4OX9J 4C0OC 1Q7LB 1FXLA 4FS2A 2DXDA 3HSJA 3DOMB 1N34F 2RH3A 1DZ5A 3OL7A 3T1YF 4QR1A 1IVZA 4BS2A 1SC4B 2K3KA 3KLEA 1S1XA 2ZH4A 3MURP 1XN9A 1NPRA 4OHZA 4WIQA 5D4OA 3GZ7A 5KT5A 1CJVB 3VAFA 1UVJA 3KHRA 3EMTA 4O44A 4Y2MA 4J9OA 3PHTA 1WF1A 2KYXA 2IJRA 3Q8YA 3FCVA 3NLCA 1T0TV 4DQPA 4X4UA 2QL9B 3CDBA 2KU7A 2MHNA 2VFRA 3M8QB 3PVXA 2CNKB 2MKJA 1R8HA 4QYZJ 1WF0A 2HEKA 4C8ZA 4HLBA 4TY8B 1TL4A 4CLWA 5B0EA 3SQGA 1V9OA 4PG6A 1C2PA 2FVQA 2VF3A 1UFLA 3KDOA 2L3MA 2Y8WA 1CC8A 3OTOF 5BYSA 2QGFB 5AXMA 2CQBA 3T6BA 5ETRA 3O44A 1U1OA 4B02A 2IM1A 1RTIB 4K4SA 5MAOA 3ZTSA 1X4FA 1NK5A 2VG5A 2D3O1 3RRKA 1NUEA 3EZ5A 4UOHA 1JLAA 4KC5A 2QJ3A 4AL6A 2DNLA 1KR4A 1NCLA 2ZVSA 4WZQA 1QE1B 1TMMA 4OLPA 3Q23A 2XLIA 4K2JA 1A6LA 4CDIA 2EG1A 4DR6F 3FDSA 3RBZA 3EVMA 3ITHA 1TMJA 4DX7A 1UA0A 4WJBA 2ZJPQ 1PILA 2R42A 2B9EA 1WI8A 1ROFA 4CLLA 4I6AA 1B0VA 3DRYA 2HNZB 1GNKA 2VASA 1QUVA 1FJEB 4FF3A 4PR6A 2DPIA 4ZN1A 5CD4H 1MN9A 5GAHU 1U45A 3DMJB 1Y5NB 4YS2A 1DAXA 3G6XA 3E8OA 1I3OB 2BV3A 1S57A 1N48A 3MOZA 2YBVA 2MB0B 4PG8A 4C8LA 3HZEA 2I38A 4IRCA 4DV5F 3M1VA 4RWWA 1RT5A 2IMOA 3MFIA 2XI3A 1RAEB 5DDRC 3OXFA 1S79A 4LRFA 4HT7A 4NPOA 1VHIA 3QFHA 3OPKA 3CD0A 1WEXA 3KTQA 2ZH1A 4F8RA 1GXUA 2ZNYA 4GO7X 1DY3A 1FWPA 1PYSB 4UF4A 1DBDA 5I42A 1IM4A 1JLBB 1RZMA 2ZBIA 3KJVB 1HKAA 2H1YA 4TNOA 1QJHA 1B0PA 5K8PA 3NBPA 1QSYA 1Q86T 2VA3A 4Y2CA 1KC8T 3NGRA 4B9UA 4MKVA 4K50A 4OZ5A 2N3OA 5G4DA 1VJQA 3BPDA 4B08A 3M2VA 1G6BA 2L9DA 1CJTA 1C1BA 1CS4B 2YKPA 4HTIA 3TQEA 3SXLA 3GWCA 1PKUA 1TKXA 2B4PA 3QZ8A 7FDRA 4Q7AA 3QGPA 2XSJA 1TL1A 1BXNA 2ROPA 2N7CA 4DV7F 2VDIA 4QWDA 3UO0A 2JLFA 1EP4A 1RDRA 1T9UA 5LSRA 2C3OA 4DSJA 3F44A 1U6BA 4Q43A 3M9OB 4ZKAA 2HQFA 1JJCB 1KDNA 4ZPBA 4BC7A 3HK2A 1HNIB 2B4OA 1RK8A 1NJXA 1S1TA 3TJAA 2CQIA 2AGPA 5HO4A 3CMAS 2UU9J 1NNDA 2XWXA 4ZVPB 4U8YA 2VBYA 4ZCKA 2E1AA 3IMQJ 5EX0A 1ZZNA 4GVLA 3CD5A 3HT0A 3KDNA 2NXEA 4NYZA 2HBZB 4RJVA 2AGQA 1RT6A 3DRXA 1KOHA 4AT1B 4DZ6A 2VH7A 2RNEA 3FKBA 2XY6A 1BE4A 2PT0A 4ECVA 2MGZA 2V34A 5C25B 4LF6F 2YWFA 3K17A 3BSCA 1P27B 1KN6A 1VOMA 4OJ3A 5FDLB 3G6YA 2R7UA 1UJ6A 2HQCA 3WC0A 2CG4A 1QSSA 3O1LA 3H2UB 1J5OA 4B9LA 2LQ5A 2OPRB 1BQNB 2W7OA 1VJWA 3UQSA 2XYPB 3TAQA 2HGMA 1UJ4A 3BJYA 2N7YA 3OR2B 1NEEA 2CRLA 4I67A 4CLUA 2RMLA 4F3MA 4QQBA 5AJ3F 2BE9B 4EO6A 2OD4A 2DNPA 4KFBB 2UVUA 3CVKA 2CJKA 2QC3A 4LR7A 4HKQA 4Z37A 1H74A 2R8HA 2EFQA 3VVUA 3EICA 3H40A 4CH1A 2ZOMA 3NL0A 1YDLA 3EJMA 2AJQA 2F65A 1X4EA 2CNNB 1HNXF 1XQIA 4I2QB 1RB0A 1R0AB 2C22A 1B64A 3BSNA 2ACMA 1FFSB 2YKMB 4FKXA 4ES2A 4LSNB 5E3RA 4ZCMA 2XMVA 1LWEB 5DO2A 1TTHB 2Z2LA 3HFZB 2J8SA 5KFEA 1EHWA 3BDEA 1QDUB 1IKXB 1WF2A 5J1PA 1TKZB 1HQ2A 3SCJE 3B78A 5J2NA 5A8WA 3U02A 3ICLA 2Z2YB 2CA9A 1LWFB 3DOLB 3W66A 1F9HA 3MD3A 1J5EF 5B0GA 5KFQA 3MM5B 2XBPA 4I0WA 4KGKA 3OUYA 3TO8A 2DH8A 2RHSB 4HVZA 2F8HA 4MKYA 4WU3A 1Z2LA 2NSBA 4ED4A 3FQLA 2CJ9A 3Q83A 1IBMF 1Y11A 4FN5A 3J81U 2DIUA 3LPEA 2DNRA 5E3PA 3GG0A 3G71S 2LU2A 1S0NA 2AV5A 3AT1B 2ASLA 4OL8A 1FD2A 5JVGQ 3KNAA 4F04B 3NAIA 1N0UA 3ENAA 5GAEU 2P8IA 1I94J 4OX6A 5B08A 1SL0A 4NI2B 1FNOA 1XNRJ 1N6QB 2W9CA 2M2BA 4PAAA 4JBCA 2PC6A 1YQHA 1CPZA 4BHQA 2V8VA 3DI6A 2MKCA 4QWBA 2GW8A 4TU8A 1Y7PA 1DJ0A 4LF7J 1DLOA 3UE2A 5FJ4A 2DISA 2R8JA 4ED5A 1IQZA 1KP6A 2AF6A 1OY8A 3QSYB 2FGCA 2JEFA 3AOCA 1S7HA 3AQPA 3UN2A 3QRPA 4PWDB 3H4DA 3MMAA 4OYIA 1RUSA 2WW4A 2NQPA 2KFNA 4JP8A 1RAAB 1RTJA 1BWVA 5IZHA 1GTHA 2ZOFA 3BGLA 1FKPA 2AZ1A 4KB7A 4PQUB 1U8SA 4UOGA 4JV1A 2BANB 1CJKB 1VC0A 1SQGA 2DR6A 2FQQB 3JYTB 3DCAA 3AJ2A 1S1WB 4G6VB 5GVQA 3K2YA 1HI8A 2BYCA 4LFCJ 1GT8A 2L9WA 4TYAA 5D3GA 1TK8A 3KOAA 4LREA 4F4ZA 3MM9A 1TK0A 1PJ5A 2VOPA 3R7SB 2J7UA 2RUSA 1CEZA 3HM9A 2CWKA 1EAYC 3KLHA 2HFZA 1GH8A 5GMEA 4X2BA 4PXCA 2EVZA 2YWKA 3MF5A 4DR2F 3W2VB 4Q8EA 2CQ1A 3OQ2A 3AODA 4MYUA 3W61A 4ELVA 4JI5F 2M7SA 1WHXA 3VGTA 3MXHP 1WSVA 3H20A 2Z2ZA 2W7PA 1FX2A 4PKDB 5T7LB 1NRKA 4I56A 1NM2A 4ER8A 4DV6F 2VDHA 1GMWA 2YX1A 1YJVA 4LIRA 1QSLA 1MLAA 3ISNC 4M95A 2CNLB 1YSJA 1RHUB 2GZOA 4KGXB 4Q2LA 1SQFA 2IPOB 4G1QA 4OI1A 1U6FA 1IR2A 1IKVB 2DRDA 2RRNA 3MR5A 1LXJA 4WKYA 2BRLA 2HIYA 2O1PA 4DPTA 2YH1A 1RSCA 3DYAB 1XMOJ 2CQ0A 5K14B 3M2UA 2ZBCA 2MKSA 4IH5A 7AT1B 1I5OB 4UQGA 4X65F 4A8XA 2OFHX 3CCES 2ZC3A 3DRSA 1ZM4A 3QLHB 2GVZA 5AE1A 3AXKA 3U1MA 4M5DB 1G4CA 3OTBA 4Y2KA 4FPIA 1WC4A 2ASDA 1RLCL 2W7AA 3UDLA 2G1HA 3D1HA 4P52A 3DM2B 3FNNA 2BQRA 4R5PA 3PRVA 3MAQA 4ZVQB 1RAJA 3T1HF 3ILOA 3UN3A 1UPMB 1GMWD 3FEZA 1VQ7S 4MK7A 3KHHA 2DNKA 4O0IA 2UUTA 1VRQC 3CPWR 1X5SA 4PG4A 1UCNA 2CQCA 3DU6A 2DYAA 1HYSB 5D15A 3K5LA 5LMUJ 2JEIA 3PDNA 4N41A 3CJ3A 2WBMA 4RW7A 4F0KA 2HLTA 3JSMA 5A76A 5D4NA 1X9SA 5GMKa 2R7XA 2MLZA 2FHJA 2ACYA 4LF9J 3RAXA 2FC8A 3R2DJ 3NRBA 3R5GA 2VG6B 3QPIA 4RL1A 1RXOB 1YX2A 4KKOA 2G13A 1O6XA 1FRLA 2FHMA 5J2MB 3ZZOA 2LVWA 4IR9A 3FBBA 4P72A 3CIZA 1PBAA 2ZE2A 3WX4A 1FRJA 1Y3JA 5M2UA 2Y1RI 3V4MA 4ZOSA 2ZH6A 3J80Y 2RS8A 5IV3A 4N56A 1Z2ZA 5F3TA 3BPSP 1KLMB 1AZSA 2F9DA 4AQYF 4URGA 2QLBB 5SZTA 4ZS6A 3HMJG 4Z2XA 3DLGA 3ET6A 2QA4S 2Z58B 1YJRA 1VC5A 4B3RF 2Q66A 1QLNA 3NNAA 2Y3YA 2ZKUA 1N52B 2E9ZA 1URRA 1FKOB 2ZHOA 4CLPA 1KFDA 3QJPA 1X5TA 4RNMA 4EU0A 2VQEJ 2VFVA 3KUHA 2OPPB 2WW8A 3BR8A 5KFBA 2BKNA 3EE3A 3BM7A 3H8YA 3W2WA 4OYPA 3CXCR 4JI2F 1M1KT 4USHA 4PG7A 3PNIA 2M9KA 1IN0A 1TK5A 2JC0A 4A46A 4GO5X 4CTAA 1HBUA 2H5IB 1Q8KA 4DPOA 1SIZA 1KVJA 1WG1A 1WSRA 1IBKJ 5IT9Y 2XGPA 4DN0A 2QT7A 4CO5A 1KEKA 4ES1A 2QO3A 2HHPA 3MEGA 2A1BA 2FJVA 4USMA 5GAGU 1SV5B 2ZKTA 3R8YA 2ZWPA 1GXTA 4BDPA 2CPIA 1SKSA 2CFXA 3BKFA 1H2TZ 2F4VF 3KLGA 1PCAA 1WNEA 4BBYA 2FVPA 1VQ4S 3IS9A 2B56A 3KLIB 3B8HA 3KHGA 3AD8C 3IWNC 4DBQA 5HROB 2GNKA 3HHLA 3HHEA 4C3MA 3NAHA 1AROP 4IQMA 5HJXA 4OHWA 2Q43A 2J6UA 2C28A 5ETPA 2Z57B 3GIKA 1WUUA 4J9LA 1RWNB 5H1SV 2FVSA 4C11A 2WSCC 1NZ8A 2DNOA 3Q8UA 1L5UA 4Q5VA 1R0BG 4H4OA 4ZPCA 3OT9A 4O4GB 1VBZA 2YNFA 4Q0BA 1RTZA 2X3GA 3M2RA 1LK7A 2V2ZA 2BW7A 3LWLA 2D3UA 4K59A 5DETA 3HSZA 3OTCA 1EZZB 1PAUB 2MKIA 4JI1J 2DNHA 3D54A 2HRUA 3C6UB 2IFXA 1PO6A 1SC3B 2HWHA 1YKWA 5T41A 5HP1A 3FQKA 1Q5YA 4R8UA 2E5HA 5BXIA 4JYAF 1L3KA 3U7JA 1LXNA 1RT3B 3BYRA 4I4BA 3HKWA 3LANA 3C66A 4JI4F 4U67Q 3QT5A 5DM7Q 1WC3A 3I6PA 1TUVA 3J7AN 3NNCA 1HWLA 5JJBA 1RAGB 1AFJA 5L1LA 3D67A 3PYGA 5KFZA 5EWGA 4ICLB 4B3OB 2HFOA 2FJXA 1HWUA 1IBLF 1R3NA 4QIVA 1T3NA 5HSPA 5C5JA 6AT1B 3M8RA 3GIJA 2B7CB 2J6TA 3S01A 4CZCA 4ELTA 4ZA1A 4LFAF 1VIOA 4J9KA 4X84A 2O01C 2VL1A 2DO0A 3QFWA 2DD8S 3N6LA 2ZNZA 3UNYA 5EHHA 5DG9A 1P9QC 4DSLA 3CCVS 4GKKF 1HBOA 4FYVB 3OFGA 1FJGJ 1Q82T 5HJYA 2D7SA 4DSEA 4DWIA 2FUG9 2UXCJ 3TUIC 3DOMA 1GK8A 2KRRA 3C8YA 2FHOB 5L39A 3K89A 1CC7A 2IAJB 4J37A 5CABA 1K47A 2YQ3A 1IJEB 3Q8QB 3J81j 1MMNA 4LF5J 3IN5A 4KPYA 1HQEB 5L9XA 3RU0A 3NCPA 4M5MA 3RBEA 1CJVA 1WOOA 2OGUA 3MDFA 3A4TA 1QD1A 3GIIA 4OLOA 4F7VA 2JDJA 1N33J 3TYTA 3PM9A 3M8QA 3MGJA 4F4XA 5KG1A 4CIOA 2GO9A 3MTJA 4GRSA 2YQ0A 4P10A 1JX4A 3GFHA 1DHMA 4DV0F 3ENWA 4NYOA 4RU9A 1D9FA 4E8UA 3DOKB 2AD9A 4RBUA 1I6JA 4X66J 1ICEB 5EGYA 4UUWA 4KV8B 1VQ5S 5B0DA 3P8BB 2W8KA 4A8QA 5IC4B 1LOUA 4FBTA 4TXSA 1RTIA 1GMVA 4C8MA 4DV3F 1YJUA 2LECA 4KGVB 2VPZB 5DG8A 1N0VC 4ZVOB 3RR8A 3M8WA 2ZUGA 4AL5A 2R7OA 4J9VA 4RBTA 2RSQA 2W01A 1QE1A 2NREA 1RAHB 3R27A 2E5LJ 2Y1LB 1RWKB 4WXWA 4ECSA 1VQPS 5HAOA 5ETKA 2KL8A 4LFBF 3OL9A 1VISA 2GHWA 1B7FA 1JLQB 1MMLA 3KYLA 5ETTA 5H9FJ 1XJWB 2KZZA 1FDDA 1WDDA 4DLGA 5DRKA 1HARA 4C4WA 1Q8IA 3ZTPA 3BBFA 4Y34A 3EX7B 2AJ0A 4P71A 3M8PB 3DMJA 3UN5A 4K4ZA 3P4UB 4WFXA 1OYEA 5KG4A 1VQSA 4URSA 2CDQA 3TJ8A 4I6WA 4NXMF 4USWA 3KNGA 1FA0A 3NWGA 3RGIA 1R0CB 2DNZA 3T6JA 5EWFA 1L3VA 3VVTA 1HWIA 5EWEA 1NH7A 1NZAA 1WOSA 4L72B 2DHXA 3HHNB 3IAM9 4ZLNA 2G2YA 4KGMA 2DPJA 1HNZJ 4NZ7A 3OFHA 4ILRA 3BGRB 3NXZA 1YTYA 1KQKA 4CM2A 2ALZA 1U1RA 4WE1A 5KFGA 1JLBA 3KJVA 4L75A 1UW9A 2R7QA 2YXLA 2UUAJ 1VBXA 2GQCA 3RBXA 1ZETA 5LMNJ 2A18A 3CF5Q 3ETMA 1V3SA 2EC0A 4ZIWA 1QAYA 3THVA 3JSRA 3LO3A 1KKHA 2H3EB 4J5OA 3VQSA 1X5PA 3SI8A 1D9AA 1M1GA 1CS4A 2MZSA 1RP5A 2BJEA 3R5JB 3I5BA 3CJ4A 2IRYA 2C2MB 3DXBA 2C2DA 5DZ6A 4X4QA 1EQMA 1NO8A 2GJIA 2HLUA 3D6HB 3R5BA 4UT4A 2B7BB 1FRMA 2JZ5A 1WHYA 3PACA 2KH9A 4OMFG 1FO1A 4K0KJ 4OZ2A 2R9LA 3O8WA 2MPUA 1BLUA 4LIWA 3LGHA 5BYQA 1HMVB 1VLYA 3P6YC 4IFVB 1X0PA 4JI3J 1RAOA 1R43A 3MM8B 4ECZA 2F3JA 2H4WB 2OELA 4DR3F 3BH6B 5A8KB 5DG7A 4L3KA 1D1UA 4L3NA 3BREA 1YRXA 3ZTRA 4CT8A 5LT5A 2MEWA 4TLQA 3H25A 3Q86A 4JI8J 2NZCA 3FK4A 2DNGA 3BDPA 5HMZA 3IFEA 2XY7A 3K8WA 2XMUA 5HATA 5HQ8A 1FRXA 2OEMA 2RDIA 3UCZP 3AFGA 1GX5A 3OXGA 5C25A 2PSZA 3C6TB 4DL7A 3G6VA 4LF4F 1NSPA 3PW7A 1UAWA 2KRBA 1NKBA 1ZA1B 2EFGA 1U1QA 2OFGX 1Y0HA 4ZVEA 1DTTB 2RKIB 2RVJA 2LEPA 2R8KA 2MMYA 2ILZA 3TI0A 1Q53A 2MKYA 4DUYF 4J9SA 4DR6J 1MU2B 5E5NA 2OPRA 1UZHA 1BQNA 5EUHA 1EKSA 3AHPA 3CJSA 2YNGB 3GV7B 3NCQA 2AJ2A 3W5XA 4LVNP 1RHMB 1W2IA 2JWNA 2VPYB 3KUEA 1RI7A 3H59A 3OR2A 2FLNA 1M5HA 4OZ0A 1Q0NA 3PKMA 2HHSA 2UZAA 3AAWB 4JI6J 3QNWB 4KFBA 1U6ZA 1UVNA 1QVFR 3TEGA 5K20B 2D9OA 2CPXA 3PHEA 3GMGA 3L95X 3RRHA 1SJRA 4DR4F 2QMWA 2UUCF 1UPPA 2D69A 2PEHA 2HQGA 3IP0A 2PO4A 5IV4A 4J9MA 4RUAA 5IT0A 3MR6A 2XI2A 3MFHA 4I2QA 1NHUA 5ETLA 2DEJA 4X64F 4FXDA 3CCMS 4LSNA 4ECUA 3QBCA 3BO3A 1LWEA 2K2PA 1NJIT 1HBMB 1XMQF 5ETVA 2FZGB 1IKXA 2FHKA 3E51A 3DLHA 1LK5A 2GJ2A 1TKZA 3POTB 2AGOA 1UW4A 2V2QA 4X62J 1H98A 2FVRA 3FEXB 2GMJA 1LWFA 4P9SA 4FP9A 3DOLA 2KM8C 4YY3F 4J9PA 5A8WB 3MM5A 5J2PB 1AXQA 1DQ9A 3GONA 3OUYB 2HFSA 1MWQA 1HR0J 3OR1A 2KT5A 5SUHA 1O5JA 4U95A 4F4WA 1X31C 2XZDB 4EO8A 3JS9A 2RQKA 4EEYA 2NYIA 2PN6A 4KQZA 1NKCA 4W4MA 3V6DB 3HVAA 4CM0A 2MLXA 2E5JA 2WVBA 2QA1A 4LR9A 3UFCX 2W2OP 2YKOA 4NI2A 4DF4A 1F3VA 1B4SA 2JC1A 1N6QA 4DL3A 2H65B 2V2VA 4X4VA 3QJJA 4EFAC 3EZOA 4KHMA 2A2CA 4RX6A 4RKUC 5JMNA 5KFIA 3TX8A 3MMCB 4HHJA 1A9NB 2EPIA 2WVFA 4Q8FA 2QFJA 2RU9A 2EWHA 1L3UA 3R7NB 1U2FA 1HFEL 5A6WA 4PWDA 3PRBA 2BJDA 3D6TB 1SKUB 1FRKA 2FLLA 1RYRA 1JNRB 1M0SA 3IC1A 2EFNA 4KR0B 4OYZA 4I64A 3MMAB 4MKBA 2E1CA 5JVHQ 3GB0A 4H54A 1L3TA 2VQFF 1R6YA 2B9WA 2BZ2A 4PQUA 2W2MP 1MW7A 2BANA 5D0GA 1FNXH 1CJKA 4LBPA 4E0DA 3TA2A 2LFVA 1S99A 3PW4A 4ECTA 5EN1A 3JYTA 3TOQA 3W5ZA 1S1WA 2V4JB 4UZBA 4NMLA 3WIVA 4CH7A 4PQAA 4LVOP 2AQ4A 3U1LA 2GCFA 3PRDA 5M2RA 2LEBA 2KB2A 2VUGA 5HLFB 2ALYB 3FRZA 3AQOA 2M52A 2DY1A 1JQGA 2H4YB 2VKRA 1I51B 2HBRB 4ED8A 2YX7A 1JLGB 1R6VA 4Y00A 1JK9B 3DHWC 4ZJLA 2ZUAA 2F63A 3GR1A 2HNYA 5CZVA 1FK9A 1FEEA 1L3SA 1VRTB 1UJ5A 3S8SA 2CQ3A 9ATCB 1SJ3P 1ULRA 2BBEA 5CHCB 4HACB 3W2VA 4R25A 4Y28C 1VYAA 4NLOA 3SFUA 4XPEA 1T05B 1X0FA 4I68A 1YK9A 5CA5A 4Y0FA 4USVA 5DDQC 1BQXA 2YKAA 4C8KA 5FIIA 5HQMA 5GAGI 1C0UB 2GA7A 3MM7B 4OX9F 4YMEA 4C3LA 2MXYA 4DR1J 5D6GA 3SCIE 1CULB 2XNQA 1X5OA 4PRFA 1HD1A 1XEZA 1KONA 4OJ1A 2ATCB 3PW2A 4XK8C 1LW0B 1IJFB 3MPUB 2VG7B 2E44A 1BQMB 4GKJJ 3CDWA 4P2MA 2KXHA 2NPIA 2LXUA 5KG0A 3OVAA 4ED3A 2IIHA 4WPAA 3UD5A 3ISZA 3X3UA 4ANDA 3PYFA 2AEFA 3CCJS 1NB7A 1IBMJ 2XMTA 4NLWA 3QWPA 1IKVA 3ZZYA 4EMDA 2FZKB 1O51A 4QWEA 1FEHA 3FBCA 1R8CA 3DYAA 2HS0A 5F41A 5K14A 1VGYA 3CDEA 2NS1B 1U1KA 2KI2A 2CJAA 2X1AA 4DV1J 4B9TA 4QR2A 2AYGA 4ZDNA 3DGPB 4FF1A 5KG2A 1SBRA 2WVDA 3R6LB 1XK8A 3QLHA 1PYTA 3LF0A 5D77A 1U0SA 4OIXA 4M5DA 3DLLQ 1F3FA 1RT7B 1V5IB 2ZDOA 3V2UC 5CZXA 5KTQA 5I4MA 3FFIA 1HBNB 3DM2A 8RUCA 3E3XA 4ZK7M 3BQ2A 5LSLA 1NSAA 2RB7A 4EYIB 2O5DA 2PMZD 3MI7X 4NLQA 1WORA 3MCMA 1W7WA 4C98A 3KK2B 1OWXA 3ADAC 1RU2A 1RCOB 2ZZTA 4C97A 5L9NA 1HYSA 1D09B 2RQCA 1LFPA 1SKRA 4ED2A 1K8AT 3AY0A 1SJQA 3PTWA 4DR7J 4N7TA 2GAGC 3OTDA 2J8AA 3PG9A 1TAUA 1D0EA 2WVEA 3C3LA 2JNJA 4F3QA 2DRAA 3EWGA 2VG6A 2F9JA 2CPHA 1FJCA 1AT1B 2ZZMA 4MIBA 2KFYA 5IXUA 2PA8D 1TUGB 1RAFB 3VAKA 2XC9A 1PIEA 4DQRA 3EGVA 3BF4A 3IO1A 2QFIA 2EXUA 1PSDA 3DLJA 3PR4A 1RADB 1KLMA 1RABB 4DEZA 2RT3A 4CRJA 2RRBA 1WKKA 3OLBA 4OZJA 4ZHRB 2CJYB 5F3ZA 4YOEA 3JQMA 4P6QA 1LW2B 1WEYA 2WB4A 2BX6A 3JAMY 1VIXA 1Y3KA 4I7FB 1ZYQA 1S6PB 3NEKA 2DK2A 1PGZA 1FKOA 3MPDA 2KG0A 2J9EA 1S1UB 2HPUA 1JLEB 2UXBJ 4FXVA 3QQCD 3P5BP 4ELUA 3SBMA 5F8JA 2HHHJ 4RUCA 1SI9A 2VC0A 4IKAA 4LRBA 2BUNA 2NUUG 4OYAA 2BJ9A 4DSFA 2LKZA 3SQOP 3TR5A 2VICA 3HFKA 3GJQB 3P49B 1K9MT 1VI7A 4S0MA 2GC8A 4HEA9 3QJLA 4MH8A 2R2UA 3LH2S 2OPQB 3S7RA 5CYQB 2QX0A 3IBFB 3SZ2A 3PO4A 1RJJA 4NCGB 5CYMB 3HJVA 2QL5B 3OHBA 3OL8A 3OHAA 1SV5A 4FKYA 3US5A 4EGLA 1CG2A 4IOBA 1FDBA 4MFBB 3RZAA 3BO4A 1F1BB 4EZ9A 3DGVA 3RB6A 3MTKA 3DHXA 6FD1A 5GMDA 3CJ5A 2PEBA 3CCUS 3VQTA 1AW0A 2MSTA 4DX8H 3KLIA 2UU9F 3IR7B 1J27A 2RUGA 3EXYA 2A0FB 1FXDA 1NDCA 3TP2A 1SCJB 5HROA 5IWAJ 1O8BA 5HI7A 3IM9A 2HHUA 1M5PC 4ILMA 3M6UA 2XLJA 2V94A 4RW9B 2D41A 3NMAA 2I6WA 1XTZA 3NGSA 3KG0A 4LUBA 1YRTA 2Z30B 1X8DA 1TP7A 4ZCIA 1NJZA 4QWCA 5H9FK 2XWYA 3GV5B 4ATNA 2FJBB 2J0SD 3GCWP 2J9DE 1ZA2B 2CDRB 2V8PA 1P1TA 5DLFA 2ZITA 3LP2B 1UZDA 2YNFB 4WFZA 2DHAA 2JEJA 4ALZA 2W4DA 1UTAA 3C6UA 3T5KA 1DQ8A 4WFAQ 2GX8A 3D7SB 2FYXA 3K5PA 4Z7CA 2W1BA 2A10A 2DY9A 3N01A 4DLEA 2EBEA 3CCRS 1RT3A 3ZNJ1 4J7CA 2Y1JA 3QT6A 5J1EB 3FSXA 5H9EJ 4ZVFA 1R89A 4YDDB 5E7OB 2R2TA 4RUHA 2ROEA 4ICLA 4B3OA 4P2XA 3JB9k 4C8NA 1VQKS 3LPYA 3TVKA 3HVTB 3BN7A 4A48A 3Q24A 4BWJA 5B0FA 1QUPA 4WCEQ 1F6TA 3L4BC 4ANCA 1SB6A 1KQFB 4YB6A 2ZH7A 3H42A 3RR7A 5ADZA 1Q1KA 4WFBQ 4ZVTB 5K8OA 1Q8BA 4RZRA 2MY8A 4HHUA 1YRUA 5F9LA 4PZVA 1UEKA 2AMCB 2HHXA 1NAQA 4F36A 4M94A 4AL7A 2V69A 1ZM2A 2MHEA 2MZRA 1VQLS 4O0NA 2YPYA 1VHFA 3JTOA 2H51B 4EZ6A 1FE4A 2CQDA 3ZZ0A 4WZMA 4NZ6A 1NB2A 2IAJA 5B7WA 1FJ7A 2GIRA 1FESA 1S7IA 1M90T 1NK6A 2OTJS 1S10A 4X4SA 5D0RA 3TAPA 2O66A 1VDHA 2YVSA 1HQEA 1N5VA 3I4HX 1D9DA 1I1GA 4EBDA 4DV4J 1WJ9A 3QAUA 1AUDA 2KVQE 3VCDA 1LKZA 3DLKB 2AYBA 2V0NA 3RBDA 2RILA 1HNWJ 2IVFB 2QL7B 2MLYA 2ZH5A 3KK3B 2HRTA 1FERA 5LXYA 4FNIA 1RWWB 2W2PP 2Q6CA 2PI4A 1I94F 2L08A 1RT4B 3MPVA 2F4VJ 5C24B 3JQKA 2VV5A 2V2KA 2ZHAA 2YY3A 3DOKA 4K5RA 2MY7A 4A8SA 2IDEA 2EFPA 4KV8A 3Q8PB 2MQQA 1N8RT 3ILIA 2G9OA 2XYHB 4ENOA 3F0NA 4U7CA 4N47A 2HHTA 2FDNA 2KO1A 3O5TB 2WTFA 4NA1A 1V3ZA 3TVZA 3TVYA 3PFOA 5GADI 2XS7A 1SUQB 2JSXA 1WEZA 3SCKE 1GMUA 5F0UA 1TVRB 2EK6A 3A8IA 3NS6A 2IM2A 1JLQA 3I96A 4IG0B 2N82B 3K59A 4L74A 2DCLA 2KM8B 2J9CA 3T5HA 2BJ3A 3ETOA 2M88A 2E29A 3WBZA 1R31A 2FLOA 2YTCA 5IQQA 4JYAJ 4DL6A 3M8PA 4NWBA 3BQ1A 2A3JA 1FRIA 3TW0A 2EK1A 3VALA 4N76A 2ZDPA 4LFCF 3B4DA 4J9UE 2M4MA 1XNQJ 2KXNB 3I31A 4IO1A 1X7VA 5J2QB 4NE9C 5LOQA 3KG1A 1RBAA 3IG1B 2LYVA 3R2CJ 3N6MA 2MTLA 3R5CA 2FVCA 1FFWB 4N77A 1U2RA 1HNVB 3PW0A 1WTBA 4LBHA 4B3MJ 1B99A 4DX6A 1T7PA 2IMWP 4KO0B 2W25A 4OV6A 4FNHA 1S1VB 2G2OA 2HVDA 3BGRA 4OZLA 5BR8J 2B5JB 2KHCA 3SDEB 1RT2B 4LF8J 3WC2A 1JKHB 4EBCA 3TANA 2JVOA 4EK2A 1VR6A 1F0XA 3HJFA 3PJXA 4WTOB 4WE1B 3KMSA 5KG5A 4WTYA 3RUBL 3OSPA 2ZJQQ 2IYIA 1U1NA 5U47A 4XAKA 3FC9A 2QYGA 4J91A 3PX4A 4TVAB 1HL6A 2CPDA 4F67A 3M30A 1FWLA 2ZH9A 4LSLB 3QT7A 4CO2A 3ZNUA 5K9FA 3OFFA 4OQJA 2KHDA 3DLBA 3W62A 1X9MA 4NXNJ 4HTJA 1XMOF 1HMVA 4PWWA 5KG6A 1HHQA 2GFFA 1U47A 4IFVA 2EI5A 4D3HA 2Y8YA 2BE2B 1OMSA 2OJ3A 3TX0A 4X4NA 2V9WA 3VAMA 2V63A 3MD1A 3MM8A 2IY5B 3D0GE 3TUZC 5A8KA 3GFYA 2QEXS 1JXLA 3UWTA 2B0GA 4Q2MA 1YBAA 2IDLA 4A8OA 3CNQP 1M1HA 3ZZRA 2CVIA 4XIUA 4MKAA 2AJFE 1WG4A 3IRXB 3DDIA 1U2CA 1OPZA 2HG4A 3C6TA 1LWXA 3AA9A 1FX4A 4JV2A 2XYGB 5D0HA 1VQOS 1P9YA 4OYWA 1SJFA 1OO0B 2Q3PA 1DTTA 1KS2A 4A47A 1CLFA 2PIIA 1YZ7A 3CCSS 2RKIA 5LMUF 3E2EA 2BR0A 4JB8B 2B8QA 4I1TA 1FI4A 4ECYA 5CAAA 2MQ8A 3GP9A 3P45B 1H72C 4KSEB 4G1IA 1MU2A 3M9MB 4USIA 3HPOA 4OHYA 1YIJS 3MUMP 4RW6B 3FSIA 1TL3B 4K4XA 2B4VA 2YNGA 3BB5A 5KOWA 4QCLA 2P9EA 4X4RA 2XG8A 4LF9F 1KSPA 2CQ4A 2V8DA 1FWKA 3HD2A 5FLXY 2LP4A 4IH7A 2HFVA 2DGSA 2KT2A 4F02A 2NLWA 3TWZA 3WZ0A 2WONB 4WU2A 3SSRA 2B3TB 3KK1B 3GU0A 4ZLJA 2OPSB 3V6JA 1TFYA 4NMXA 4TN2A 2BEFA 2XB2D 5DLGA 1EETB 1U25A 2CZVC 4NLTA 3A1YG 2XHCA 3I5CA 4B17A 4FDFA 3GE9A 4FXWA 1HBMA 4PABA 2VQEF 4C7QA 2AW0A 3B82A 4DUZJ 3MECB 3HCXA 2IC3B 3POTA 1F2HA 2ZOGA 4DL2A 4MT1A 2N3LA 2K06A 1BWEA 2Z0GA 2QV6A 2HK3A 1T8EA 3ISND 4Q45A 2WAQD 5J2PA 2QMXA 3UI3A 1IBCB 3B4MA 3C15B 4RO0A 3EVWA 1IR1A 2B9XA 1IBKF 1NJWA 4XPCA 2CVEA 3DFEA 3KLFB 5KT7A 5KAKA 1YJ9S 4NLSA 3D4JA 3QGHA 4USKA 3OR1B 5JUMA 3ZFVA 2CJXB 4LBIA 2UP1A 2VFUA 1OPIA 3BGOP 3V6DA 3Q2TC 1FTRA 1TELA 3Q8SB 2DH7A 3BV8A 2FD2A 4NLXA 3G6ES 1IUJA 1ACMB 2A6OA 5ETNA 3X1LB 3LTOA 4WK1A 3G4SS 1LQ9A 2UUWA 3I0SB 1QTMA 3VZIA 5KFKA 1DQAA 2GQQA 3MMCA 1RWOB 2LCWA 3MPYA 1RWUA 1S5ZA 1QM9A 5C2GA 3KJFB 4I2PB 5A2QU 4NEZA 2ADCA 4URQU 4RNOA 2D74B 3ZC4A 3G82A 2RE1A 2ZC4A 5KFVA 2BACA 3TUPA 3VGUA 2CQPA 4JI1F 3HKZD 2E1MC 1Q81T 1OIAA 4ED6A 1HPZB 3WHIA 1IKYB 2H5EA 2DGQA 1FE0A 2QLFB 3RB0A 3GJTB 3NGTA 4NLGA 2FJDB 4O3NA 5E3CA 1Y5LB 1SJ4P 3ZTOA 2V4JA 3RRGA 3I9ZA 2O67A 1UFWA 2I1RA 2KDOA 1UWBB 1Q79A 5D0EA 3R97A 1C4AA 3DDNA 3P5TL 3ENVA 4F4AA 3CB4A 2YH0A 4K4WA 5HLFA 4CO3A 2ASJA 1F9FA 3L9ZA 4RU2A 1DURA 1SC6A 3A3PB 4ERDA 2UUCJ 3PZPA 4NCAA 2OO4A 2NXCA 5KFRA 5IM0B 1JLGA 3N0VA 2P9CA 4DF8A 5A0YB 4IG3B 4OI0A 2GAHC 1VRTA 3IA0A 1VBYA 3TA1A 2PE8A 2HNYB 4HACA 1FK9B 2Y0BB 2HAFA 4PPDA 1T05A 2FPHX 1FJGF 1CQMA 1RKIA 3Q89A 3CCWA 5L8RC 1C0UA 2NSCA 3MM7A 3KFWX 2W2NP 3PIPQ 2UXCF 4FF2A 1CULA 5B0CA 1UVLA 1RA7A 2LDIA 4JV0A 1YZ6A 4ECWA 5KFUA 1LW0A 2PMHA 3ZZPA 3BKUA 4CYUB 3DC2A 2VG7A 5KOXA 1BQMA 4ID5B 3CIMA 2H5JB 1AUSL 3R1LA 2UVWA 5K5MA 4IR1A 3QGGA 2VU5A 4NYPA 4C2MA 2M0GB 1W2BR 3GCXP 4LF5F 3PW5A 4UOFA 3HSGA 2ERRA 1KHWA 2IBKA 3GYGA 1JXVA 3TUJC 4KIAA 2HRYA 4DFJA 2MKHA 3VAGA 1BC6A 9RUBA 1N33F 2Q79A 4ZIVA 1RBLA 4G1PA 3A12A 1UFKA 1FFGB 2G1DA 4DPXA 3MR2A 5F0WA 4PXBA 3WIUA 3CULA 1ZPVA 2AZ3A 4ED1A 3I55S 3MPWA 2G2ZA 8AT1B 4CWBA 3DGPA 3VTIA 2F8MA 5B0AA 2M8DB 5HANA 5LL6d 1T9TA 4X66F 5DGAA 1R8AA 3F73A 1HQUB 4KHPJ 2YX4A 1A0OB 2V8HA 1RT7A 4CP5A 3AD9C 3D3CJ 1HBNA 4JI7J 3MUTP 3RTVA 4OX8A 1HI1A 4OJGA 3OD2A 2EEYA 3H5UA 4YDXA 5F8HA 2D1CA 3FFIB 2DGXA 2ZM6F 1WC5A 1N36J 3HULA 1VK8A 3KK2A 3T41A 2E5LF 3V6KA 5L38A 4ZPDA 2LQ9A 5HMWA 4BWMA 3CC7S 4KYZA 3PR5B 4ECQA 1VLOA 1TV6B 2ROGA 1NHKL 2UVVA 5H9EK 4ZP9A 3J80U 1CVJA 4HR2A 2UUBJ 4DS5A 2RU3A 4YHHJ 1O0PA 4OZ1A 3M8SA 4X4PA 1RTHB 4JV5F 2VC1A 5ETOA 2BJ7A 4AYBD 1DFDA 2JJ4D 3IR5B 3OTEA 4YUDA 3VHQA 4P7VA 4B3SJ 3MEDB 4JI0J 2HKEA 4CCHA 3M32B 2RD5C 2I5JB 4OYMA 1KHVA 3M9NB 3UD3P 1U0HB 2WSEC 2VFSA 3MWBA 4O23A 2DRBA 2BDPA 1FVQA 2IA0A 1U4BA 2DGTA 3H5YA 3PKYA 3C16B 3OL6A 4ZHRA 4EBEA 1LW2A 4KY3A 1RWVB 3I5AA 2CKWA 2V4RA 1HNZF 3MHYA 3K8VA 3T5LA 4I7FA 4L73A 3V6HA 1OSCA 4DU8A 1NK9A 1S6PA 4UY85 1G1XA 5C42B 3AD7C 5E33A 4IYQA 2ZH2A 1MWZA 5KT3A 3BBCA 5IT9U 1S1UA 3S6EA 1LNQA 1JLEA 5LMNF 1REGX 2L9NA 6FDRA 2KG1A 5HMYA 4DPWA 4K8RA 2OSRA 4M5GA 1H2VZ 3BSOA 2FHJD 4LRDA 1YLXA 3HP6A 2OTLS 1LWCB 4USUA 3HSDA 4P73A 5CD4A 3LAMA 3CJKB 2M8HA 2OPQA 3TZXA 5CYQA 2AJ4A 4XDDA 2RJZA 3Q8RB 3OJSA 2ZBQA 1H2UX 2CADA 4NCGA 5HBMB 5CYMA 3NGUA 4QYZK 2ZFHA 4K0KF 1ITPA 2QN6B 4NOHA 4CLTA 4DXLA 2BXJA 4NA3A 4MFBA 1BUXA 1B0TA 2VB6A 3L7UA 4JI3F 5KFCA 2Z4PA 3MR7A 2OH2A 5E3QA 2YWGA 1NDLA 1GTEA 3N28A 4C8YA 4FYWB 2OEJA 1UA1A 3VAHA 3GFXA 4PYDA 3W9HA 1NK4A 3C19A 2ZD1B 2HGNA 4JI8F 4B3TJ 4RW9A 3PYEA 2CPEA 1EB0A 5THWA 2MZ1A 4GC6A 1T3OA 3DN9A 2QIFA 3QO9B 2OP5A 4F0HA 3V4IB 4A4JA 3IAS9 3MEEB 3IM8A 3A3OB 3DLEB 3R6GB 2HW3A 2DNMA 4OX7A 3LP2A 3CJ0A 4YR0A 5D4LA 2P2CB 1X4AA 1F5BA 1VBKA 2DNYA 1VQ6S 3LQVA 4CI0B 2B6AB 2XZTB 2CPZA 2V68A 4DFMA 4JI6F 3THTA 1URNA 5IS2A 2LQJA 3G96A 4FF4A 1WELA 3OJUA 3ZZZA 5J1EA 1SC1B 2J9DA 4WP3A 4USTA 3WDOA 2PMWA 1E6VB 4F2SA 4CO1A 2CYYA 2FJEB 2DXFA 3HHLD 3HVTA 1VS3A 2R2RA 5L46A 2CAJA 1HWJA 3ULHA 2CQHA 4NEYA 4M1KA 2DH9A 4QR0A 3W60A 1VQ8S 4PPZA 5KG3A 3L7PA 3KXDA 1RKJA 2E1PA 4CO0A 3WX8A 3U27A 4AD6A 2DITA 4HH0A 1VC6A 1NDPA 3M8YA 2XCAA 1KQSR 2CPFA 4CT9A 1VQNS 2ZHBA 1QAXA 3QIPB 5AXLA 3QT8A 5F8LA 4X62F 1VRUB 2YWEA 3G9CA 2NUHA 4IFYB 2UXDJ 1S59A 5KFPA 4P2FA 2X1BA 4PUOB 2WB1D 4H4KC 3PCOB 2XS5A 3M7VA 2COLA 2A6MA 4WFYA 4MIAA 1HR0F 3DLKA 4WF9Q 2ZBRA 2DGOA 4E98A 1EQ0A 1RWMB 4A8FA 4J9RA 2X3DA 3K7RA 3KK3A 4NLVA 3MMBB 4EYHB 1N32J 3HX9A 2VONA 1ZM3A 4U9RA 2CPYA 2XSFA 1Q8LA 1RT4A 3THPA 2R7SA 4LSZB 4L76A 2CNOB 5C24A 1H7WA 5HL7Q 3AOAA 4KAIA 2IRUA 2KN4A 4P74A 1KD1T 2DJWA 4C6AA 1PJ7A 1RBOB 4QU6A 2N4DA 4LR8A 1U1MA 3IBCB 3A3NB 3I32A 4UTGA 1FT8A 5C7PA 5AE2A 1BD6A 4FZVA 2ZZNA 3RB3A 4ZITA 2FIUA 4LQ3A 3GR0A 3D0HE 1WC1A 1VQYA 2PA3A 3H0PA 3K5NA 1RT1B 3JSYA 4IH6A 4IDKB 2Q6BA 4W92B 4J9QA 3UVJB 2SXLA 3TEHB 3PFEA 2R7WA 4OZNA 3D66A 1SUQA 2EKYA 1HIYA 4DV2J 1Z1ZA 2VODA 1IWGA 2FY1A 4P7TA 3E01B 1TVRA 3DNCA 5F8GA 4J9NA 2QLXA 3U1NA 4M63A 3PY8A 1DRZA 2HVEA 4IG0A 1UP1A 4RW8B 4QOTA 1BMQB 4LF1A 4ZPVR 2PD1A 1WHWA 1FTCA 1TUWA 1RACB 1C0TA 4WBFA 1SL1A 1N5YB 4F3OA 1T02A 3BZQA 2CXEA 2GMHA 4EUVA 5G0RB 1WKJA 3LAKA 4DQIA 3QATA 3GJSB 2GV1A 1H73A 2KKHA 4RW4B 1H0HB 5J2QA 3O6QA 2AT1B 3CEDA 2WHOA 3I56S 3IG1A 3CCLS 1KTVA 1WC6A 3R3TA 3W8GA 2XMAA 2JLEA 1IWAA 4UOCA 1HNVA 3BR9A 2DBBA 4ECRA 1U24A 3NS7B 4DR5F 2F5GA 1U7LA 3BH7B 2ZBPA 4KO0A 2DR8A 2BKOA 1S1VA 4DOZA 1XWLA 3GIMA 2B5JA 3RAQA 3SDEA 1RT2A 2BM1A 2BA9A 1JKHA 1HW8A 1R27B 4DX5A 3PO5A 2E5IA 4DR1F 2ZJRQ 1SH3A 1NBEB 4UY8T 3OVSA 3Q2SC 2C2ZB 1R8BA 2AJ1A 3H90A 4DCPB 2L41A 4GKJF 1H38A 4Y2AA 4MIWA 5KFLA 4IO9Q 5K8NA 4ES3A 1N34J 3W65A 1NJYA 1RTDB 4IRDA 1T11A 1FNMA 3LUYA 4LSLA 1JLFB 1AFIA 1F60B 3DRPB 2IJFA 3T1YJ 1H7XA 1OQ6A 4TLRA 2LU1A 3M30B 2VKZG 4XTTA 4CNZA 5KG7A 2WOMB 3P3DA 3AB4B 1GQEA 4O4RA 4FS1A 5K8MA 5I3UA 4ZVHA 1ELOA 1IM6A 3CSKA 1K0TA 2DHHA 1RU1A 3FMBA 2DIVA 4LRAA 1Q16B 3A8EA 2DEIA 2R8IA 4U96A 2AX1A 2U1AA 4DV1F 2BE2A 2MZQA 3CW2C 1S9GB 3T5JA 2VBZA 1VQ9S 2DNNA 5BYRA 1K0VA 2AX0A 3D68A 1NLKL 4MK8A 1P1LA 3J81Y 2YNHB 3TZZA 3GV8B 4ZLLA 2LXIA 3OTOJ 3QGIA 4OYBA 4M8LA 3IRXA 5LM7E 8ATCB 3TZWA 4YB5A 2IRXA 3EGWB 1S72S 1MSWD 1WG5A 3GPAA 3CD6S 2OSQA 1FDNA 4QYRA 1NK8A 2ZH3A 2XEXA 3QAEA 1U09A 5LJ5Y 4RW6A 1GAOA 2VIHA 1TL3A 2E9RX 4TU7A 4DR7F 4EWTA 1SH0A 3IWLA 1WOPA 1R7IA 2LMIA 5KFJA 1E6YB 5A2QY 2K1RB 4DCOB 2QE5A 2DR7A 2WRMA 1AA1B 4DSIA 4GC7A 5DM6Q 2J0XA 2HMIB 2DNQA 3NKYA 4C9DA 1MWYA 4GVBB 2C42A 2KVIA 2W9BA 3DRRB 2X51A 2C3YA 1ZTWA 2WONA 2D9PA 3AA8A 1RYSA 3MM6B 3KK1A 4DU7A 3H7HB 1S6QB 3EZUA 2F8EX 2VPXB 4K7QA 1Q4RA 5RUBA 4AXJA 2OPSA 5GADU 4JUZA 2C1EB 4FYXB 4DV5J 3LP0B 1TKTB 4E2FB 3CCQS 2J5AA 4R0JA 2IYGA 4N5SA 3OSNA 4USJC 2CPJA 1EETA 3SV3A 1RHQB 2E1RA 4F2RA 3PX0A 3UR3C 4O3PA 1KBRA 2I9SA 1UVMA 1JXEA 3MECA 4Q44A 5BJRA 5IQ6A 2IC3A 1XC9A 2UXBF 1CJUB 1TL5A 2QLJB 4HDGA 3UDVA 2HHHF 2EFOA 1RLDA 3C14B 3Q22A 1H3DA 2JOQA 2POKA 3FBFA 2XLKA 5ETSA 1SIWB 4FBUA 3C15A 3G86A 2MDAA 2VPWB 4K5SA 4IOAQ 4WYWA 4QW9A 1S4EA 2GHVC 2CQGA 2QYCA 4HT5A 1SQEA 4ITSA 2WSFC 3IRWP 2VJUA 3KG4A 3SSSA 3KLFA 3I0RB 3SIPB 3P96A 2P6TA 4M5LA 1S9EB 1NDKA 3IWXA 1NSQA 2GVDB 2RF2B 4DV7J 1IR0A 2RIJA 3KJQB 5LSOA 2M5YA 1V3RA 3KHLA 3TAMB 1FVSA 2GGPB 1DTQB 5L1IA 4PWUA 3D9BA 3MMJA 2R3VA 7FD1A 1N54B 5CCMA 2HS4A 2VOOA 2OAUA 3A13A 3I0SA 3NGKA 3BS9A 3FMWA 4GMKA 5IWAF 5DQHA 4NRUA 1X4GA 2NXUA 1JMTA 3FBEA 2XNRA 3K0JA 1EJ7L 5CCLA 3LA0A 1U1LA 3IGVA 3Q0AA 2UV8A 2YKNB 1N4LA 1IKWB 3IBWA 4Z7YA 2FB0A 4YP3A 4I2PA 2CQ2A 4WFNQ 5FD1A 3CDAA 1X4CA 3HO1A 3J7A1 3D5MA 1EX8A 3A8KA 1YBTA 2HVZA 2HBQB 2E9TA 1ZOTA 1JJ2R 4DPYA 4LF6J 2LQBA 2B4UA 5KFDA 1RA6A 1F5CA 3G82B 3F56A 1UVIA 5AXKA 1XMBA 1JWWA 4R0EA 2PDAA 1HPZA 2HBYB 1IKYA 5E41A 3G8SA 2PI5A 1U02A 4F50A 4C0HA 4B9NA 3KUGA 4X4OA 1Q7YT 3ONQA 4D3GA 1KFSA 2OIHA 5J1NA 2MQOA 1S97A 4ZVGA 3JTPA 1PG5B 1UWBA 3MOJB 3LW5C 5AJ3J 3SCLE 2C2EA 2IBOA 3AJDA 3I82A 5ITHA 3VV2B 2E66A 2C3PA 2WVCA 5DS7A 2W4PA 4H4MB 5IM0A 4U8VA 3LGNA 5A0YA 3UW1A 4IG3A 3GSIA 3IXQA 1X4BA 2J0QD 1QAIA 3HHKA 1HNXJ 3OBIA 4F26A 3LWMA 2BRKA 4ZVRB 2E5GA 4DJBA 3TJ9A 2B8PA 4V1Ak 1MN7A 1S4FA 2HHWA 5DDOC 3V81B 1Q5VA 2JL9A 3W8PA 3MCNA 4X4TA 1WD6A 3HF5A 3UNGC 4CYUA 4G65A 2JEGA 1CBKA 1EKRA 4ID5A 5B0BA 2HNDB 1PC5A 4DG1B 2EG2A 1LEOA 3UD4P 4IOCQ 4NL5A 1YGYA 2FJWA 1PJ6A 2JFKA 1J5EJ 4DV4F 3DKDA 1YITS 1N56A 1UEVA 3GFZA 2HQIA 1HNWF 2VBWA 3LGMA 3T19A 1C1CB 1REVB 4MMOA 4ZPAA 1YG0A 1UETA 2OUGA 2JHEA 3MAAB 1MROB 4QZVB 2B43A 3MCOA 1S49A 4V19J 1T03B 2EC2A 1SJ1A 2NYHA 4KT0C 4QIFA 4DZDA 3LP1B 1YJTA 3VZHA 1HQUA 4IRKA 2C2RA 3N9UC 4CNYA 2XO7A 4UQTA 4HYKA 1ZBTA 1W25A 3HXMA 2E7VA 2RDJA 3CE8A 1FF2A 1VMBA 4FVMA 5EX3A 1WDTA 1MMDA 1TR0A 5I3PA 4FVCA 2DGVA 3EUNA 5KFXA 2HAIA 4CH0S 1TL7B 3HZGA 3UCUP 3DDKA 2G0IA 2LDYA 4Y2IA 2CUYA 2BE7D 5GAHI 4HH1A 1TU0B 3A8JA 2GHPA 2DR5A 4LJMA 1AB8A 3CDUA 1B70B 4Y6IA 1K1SA 2Q1LA 3TRGA 4AXIA 1UL3A 1TV6A 5KT4A 2RRAA 1YHQS 5D4PA 2DB1A 4BLGA 4ZN3A 1JLCA 3PV8A 2J7KA 4WKRA 4ANEA 2DVIA 1G7CB 3J7YU 2HSEB 4K4VA 4ZJOA 1RTHA 5A8RB 2NZ4A 2V67A 3KLVA 4RNNA 2JVRA 3IR6B 3W9IA 4B9VA 2XO6A 5KFSA 2IVYA 4A8YA 3JAMU 2ATLA 4Y3CA 3QWUA 4CLZA 1XNQF 2LEAA 3MEDA 2YNIB 1SXLA 3M32A 4NX9A 4YQWA 2I5JA 3EPIA 1U0HA 1SH2A 4HHHA 3W64A 3LOUA 2IA6A 1FRHA 1W26A 1G2EA 1C4CA 5A6PA 2BMBA 4DFKA 5E2QA 1Y10A 4B3MF 5F8MA 2WK4A 3C16A 2KYZA 3M8ZA 2OMOA 2DKOB 2DR9A 3BGFA 2HYIB 3H5SA 5BR8F 3TA0A 4LF8F 4RBVA 5C42A 3M4XA 1T9WA 5HVFA 3K57A 4RWXA 4OZ3A 4K4YA 3HT3A 4DR2J 1N88A 3HDSA 1T9VA 3FZBA 4NASA 1HA1A 4TY9A 1BGXT 3N79A 2W9AA 4JI5J 4M5IA 4P75A 2F7VA 2V4QA 1VK3A 2VBXA 2XHWA 1LWCA 4AFFA 2QG9B 1CSJA 1PYOB 3CJKA 4DV6J 2ABYA 5CYJA 2EKNA 2XMJA 4W98A 2GIQA 3MR3A 5HN0A 4NCBA 3KLEB 1S1XB 1WI6A 1RQ0A 4YR3A 5HBMA 2Y9HA 4I6YA 4C8OA 5EDWA 4O44B 3RG6A 4NXNF 3FCWA 3I87A 1UVKA 3QYYA 3CWJA 2BJ8A 1XIQA 4LMZA 3J7Z5 5IFMA 1P6TA 2HGLA 4DQSA 4U7UD 3UPFA 3CJ8A 2JH3A 4M5HA 4TY8A 3RW6A 1U1PA 4RPFA 1JNZB 2BJ1A 2BQUA 2HWIA 3GTYX 2K8GA 2RS2A 2ZEJA 2IM3A 4X65J 1Q78A 3SQGB 1ZS6A 5DQIA 3MAHA 2ZD1A 1M5OC 4HI2A 3BEGB 3H5XA 4WP9A 3DU5A 2G0JA 2MQPA 4A8WA 2P5VA 1TZ0A 2C2KB 3CGIA 3T1AA 5KFNA 2Y1IA 2F1FA 3QO9A 4OI4A 1QTNB 2ZM6J 2VG5B 3V4IA 2CJQA 2CZ9A 3QSIA 3MEEA 4NZ0A 1FKAF 1JLAB 3H4BA 3DLEA 3T1HJ 3CJRA 3D1OA 4DS4A 2H48B 4MTPA 3TQ1A 1MG7A 1T9XA 5DZ7A 3CTRA 4CO4A 2ZWOA 3VF0B 1ZZFA 1IXKA 3ITHB 2XGQA 1RHJB 2B6AA 2HNZA 3H2LA 5LJ3Y 1D8YA 1UWAA 3JQJA 4KE5A 4M5JA 3HFVA 2XY5A 3N6NA 3HD1A 2OMLA 4JV5J 1TFWA 4M5KA 4IQXA 1P8GA 1LV5A 3W9JA 1GEHA 4NLPA 3EGZA 1E6VA 3JTNA 3SV4A 4JOUA 2DT9A 1V5VA 2EBGA 3HI9A 1WKLA 3L09A 1KRPA 4UUXA 3EDQB 1R8PA 3VGSA 3M1VB 1RT5B 2G0CA 3VGVA 5F9NA 3HHLC 2IHR1 2ZVIA 1N5TA 1OS5A 4AQYJ 3N4WA 3ZTQA 5KFMA 1G3OA 1OY9A 1S77D 3EM1A 3NS5A 4ED0A 4DL5A 3ZZUA 5C2CA 1WWHA 5KT2A 4B3RJ 4KJIA 1D8ZA 2RQMA 4DUZF 4B9SA 4DQQA 3QIPA 4ED7A 4C48A 5B09A 2RAQA 5I42B 3EVOA 1VRUA 1SVDA 4YEAA 5GAEI 2C3UA 4IFYA 2HIQA 5HVGA 3FCHA 3NBPB 3G2XA 5I3QA 5AE3A 4PUOA 3OLAA 4JI2J 2VFTA 3AOBA 4KH1B 4YFUA 3M2VB 2HWTA 2F4FA 2DXEA 1CJTB 1C1BB 2D3OR 4OJHA 4QIWD 3H2VE 4BCAA 2XS2A 3FSYA 1RWXB 2EW9A 1KLNA 1TKXB 4O3OA 1S76D 1CQNA 4OHXA 4MJKA 2XSJB 4O3SA 3MMBA 1TL1B 5KT6A 4ZMMA 1S12A 3GYXB 2XCPA 4F25A 1NK7A 2U2FA 1EP4B 4OYXA 3SFGA 3GG1A 3SEOA 1HNIA 1YBUA 2VD3A 1RHKB 4U7UK 1XNRF 5KFWA 4K4TA 1D3WA 2HURA 3C2PA 5HQLA 1S1TB 3T9ZA 1UKUA 3M05A 3FEYB 3CC2S 1NH8A 1NPPA 2DO4A 1QVGR 3DXSX 2VJVA 1UMJA 5KFHA 4LF7F 3VR1A 2HVIA 2RHQB 1RT1A 4N8NA 3M6VA 1RT6B 4IDKA 1ZAVA 1ZM9A 3ZXWA 2MZJA 3UVJA 4WXOA 2DGUA 4RUBA 4ZP7A 5FDLA 1AYEA 2MGZB 4F4YA 1YJWS 3MEKA 1YI2S 3E01A 1NPKA 5HVHA 4A8KA 3QZ7A 2J6SA 4RW8A 1OY6A 3ZZTA 5HMXA 2ASYA 1J5OB 1KTQA 3OV7A 3L7OA 3NWRA 3CCTA 2FY8A 2BOPA 2XZWA 3W63A 1N5YA 5KFYA 2C2NA 1BHNA 2AYMA 4DN9A 2LQ8A 2ILYA 2QZ8A 2P6SA 1C0TB 2AKWB 1U8WA 2R7VA 4ETXA 5G0RA 4ZCLA 2LXFA 3EGNA 4QIEA 3PX6A 5AT1B 4JI4J 1TKDA 3RJMB 4RW4A 2DCUB 3FJ2A 2VA2A 2Z2MA 1N5SA 2PFFB 4NRTA 2I8EA 3BQ0A 4DI6A 1S0OA 1NSKL 4PEOA 1TQLA 1R0AA 2H9ZA 1IBLJ 3KKFA 3JSBA 2KT3A 2NCKL 3AXMA 2UVRA 4NLUA 2YKMA 4ID8A 4DPUA 3K5MA 2XMKA 2VZ9A 2WBRA 2DHSA 2I2YA 4LFAJ 4OI6A 2PFDA 2BKPA 2QSWA 3PEJA 1X9WA 2AIRB 3Q8VA 4HDHA 4FYDA 4GKKJ 4NLYA 2OHDA 1SL2A 3FUYA 4KPCA 3TZYA 2FGOA 2Z8QA 3UDCA 3BYPA 4O3QA 5J2NB 4DMZA 4M5NA 1JIHA 2J7WA 2FC9A 2HVHA 1RTDA 3GJRB 4FYYB 1JLFA 2AYEA 3DRPA 1YJ7A 2FJAB 4DL4A 1JB0C 4BC9A 2OKQA 2QRRA 2WOMA 1PAEX 2QA4G 4HI1A 1PC4A 1K73T 2W4CA 3B54A 2XM3A 1VCTA 4FPRA 3D3BJ 4G3IA 2R2SA 1NXIA 3UDEA 1RISA 4V19X 5I3UB 1T94A 2J0WA 5DJBA 4QIGA 1TAQA 2HHVA 1S9GA 3C46A 3G87A 5L1JA 4ILLA 4RNHA 2MQMA 3F41A 2BQ3A 2JLGA 3RYLA 2OEKA 2R7RA 1T95A 1KOOA 4KHPF 3J7ZT 1S6UA 4DV0J 2W9CB 4ZP6A 2YNHA 2XULA 2KZMA 1S6OA 1ZAXA 3QIDA 4JI7F 5E0OA 3DI6B 2MSSA 5D8HB 1RE1B 5KFTA 3NNHA 4MK9A 1FCAA 4Y65A 3GYNA 1DLOB 4ZPTR 4A8MP 1NU4A 2AEMA 1N36F 3ILLA 4DV3J 3D6FB 2VHGA 2FLPA 1WC0A 1FXRA 5FLXU 2YKQA 3D0IE 4O3RA 4YB7A 4QW8A 3PYDA 3PIOQ 3SSQA 2YWWA 3JXOA 4MAKA 2APOA 3FZ2A 4U6PA 2JX2A 1N5QA 2AWZA 1RTJB 2GO8A 3S1TA 4TQRA 1ZPWX 3OXLA 5HK4A
chains in the Genus database with same CATH topology
3PDNA 1S48A 4ALZA 4RW8B 4N41A 4QOTA 3CJ3A 2CZ4A 2W4DA 2WBMA 4RW7A 2ZH8A 3LALA 1ZH5A 2UUBF 4IUFA 3C6UA 4ZPVR 1E6YA 3GSDA 3T5KA 2HLTA 2K1RA 3JSMA 3OW2R 2PD1A 4YHHF 1WHWA 3BGUA 1FKPB 3H98A 1FTCA 4OI2A 4WYLA 2BW2A 1DQ8A 1DARA 5D4NA 2D3ZA 4WFAQ 2GX8A 5GMKa 1C0TA 1X9SA 2R7XA 1SL1A 1N5YB 3K5PA 4F3OA 2HMIA 1GX6A 2FHJA 2ACYA 3RAXA 2A10A 1T02A 4OHVA 2FC8A 3N01A 4DLEA 2EBEA 3NRBA 3CCRS 2VG6B 1RT3A 3QPIA 3BZQA 3L3CA 2GMHA 4EUVA 2Y1JA 5G0RB 5J1EB 3DRRA 2W8LA 4HL9A 4B3SF 4KKOA 3LAKA 2G13A 3FSXA 4DQIA 3AB2B 4JI0F 4UW2A 4ZVFA 2MKKA 5H9EJ 1FRLA 1R89A 1VFJA 2FHMA 2GV1A 2X1FA 5J2MB 3ZZOA 2LVWA 4IR9A 3W3SA 3MM6A 4YDDB 2GMLA 1S6QA 2F40A 2W9BB 2KKHA 2L48A 3CIZA 5E7OB 2ZE2A 3N5FA 4RW4B 5CQGA 3WX4A 2R2TA 1FRJA 4RUHA 1H0HB 2ROEA 4ICLA 4PG5A 5J2QA 4B3OA 3O6QA 2R4FA 2KTQA 1Y3JA 2YWHA 1YVFA 5D3GB 3MCSA 3CEDA 5M2UA 2WHOA 2KFZA 2Y1RI 3I56S 3IG1A 3V4MA 3CCLS 1KTVA 4ZOSA 4C8NA 3R3TA 3JB9k 1VQKS 2ZH6A 3LP0A 3LPYA 2JLEA 1TKTA 2RS8A 3HVTB 3MM9B 3TVKA 3J80Y 4N56A 3BN7A 4K2XA 1QY7A 1Z2ZA 4A48A 5F3TA 1J2VA 4UOCA 1KLMB 3Q24A 2F9DA 1HNVA 3BR9A 4BWJA 4AQYF 2DBBA 5KFFA 4URGA 1U24A 5B0FA 4ECRA 5SZTA 4DR5F 1U7LA 4ZS6A 3HMJG 1S9FA 4Z2XA 1QUPA 4KO0A 1H6KX 3IGNA 3KLHB 3DLGA 4WCEQ 2QA4S 2DR8A 2XMMA 1SB6A 1KQFB 1YJRA 4YB6A 2ZH7A 2NR0A 3RR7A 1S1VA 4DOZA 1Q1KA 4KRWA 5ADZA 4WFBQ 3CMES 1XWLA 5K8OA 1VC5A 4B3RF 3GIMA 2Q66A 3TNVA 2B5JA 1QLNA 3RAQA 3SDEA 1RT2A 3NNAA 1Q8BA 4RZRA 2MY8A 2ZKUA 4KTQA 1N52B 2BM1A 1YRUA 5F9LA 2BA9A 1JKHA 4OFZA 2HHXA 3KMQA 1NAQA 4M94A 4AL7A 2E9ZA 1ZM2A 2MHEA 1URRA 1HW8A 1FKOB 2G4BA 1R27B 2MZRA 2ZHOA 5CXTA 3PO5A 2E5IA 1KFDA 4AUKA 1VQLS 1X5TA 4RNMA 3QJPA 4EU0A 4DR1F 2ZJRQ 2VFVA 3MUVP 2UV8G 1Y5IB 5T7LA 5F8NA 1SH3A 1VHFA 2OPPB 2WW8A 3BR8A 4PXDA 1KQGB 3JTOA 5KFBA 3M6XA 4EZ6A 3OVSA 1FE4A 4UY8T 2CQDA 3Q2SC 3ZZ0A 4P2SA 4WZMA 3BM7A 4NZ6A 1R8BA 2AJ1A 3H8YA 4KHRA 2IAJA 2L41A 3W2WA 3CXCR 4JI2F 5B7WA 1M1KT 1H38A 4USHA 4GKJF 4Y2AA 1JJ4A 5IT4A 1FJ7A 2GIRA 1FESA 4PG7A 1NHVA 4MIWA 5KFLA 4NLDA 3PNIA 2M9KA 1IN0A 4IO9Q 1TK5A 5K8NA 2JC0A 1M90T 4A46A 4ES3A 1NK6A 2OTJS 1S10A 4GO5X 4RLEA 5E3AA 4CTAA 4X4SA 3TAPA 2B51A 1NJYA 1RTDB 4PXEA 2O66A 4IRDA 3BO2A 1FNMA 3LUYA 4LSLA 1JLFB 1HBUA 1AFIA 1F60B 1WTFA 3DRPB 2IJFA 4LQ9A 1H7XA 2YVSA 1HQEA 4DPOA 1OQ6A 4TLRA 1N5VA 3I4HX 1D9DA 3R5AA 1HD0A 1I1GA 4EBDA 3I0RA 2LU1A 3QAUA 1SIZA 1AUDA 1HWKA 3M30B 2VKZG 4DDFA 3VCDA 1LKZA 3DLKB 4CNZA 2DGWA 1WG1A 2AYBA 1KVJA 5IT9Y 2XGPA 1S9EA 5KG7A 2WOMB 4DN0A 2QT7A 2V0NA 4CO5A 2E7WA 1KEKA 3RBDA 3P3DA 2RILA 3AB4B 3BSAA 2IVFB 1GQEA 4ES1A 5KFOA 2QO3A 4ZP8A 4O4RA 2HHPA 4FS1A 5K8MA 2ZH5A 5I3UA 4ZVHA 1ELOA 3KK3B 3CSKA 1HI0P 1K0TA 3MEGA 5F8IA 2A1BA 2FJVA 2RF2A 3FMBA 2J76E 4G1QB 3SYZA 2GQ2A 2DIVA 1Q16B 1FERA 5GAGU 5LXYA 4DL0C 3A8EA 1SV5B 2MJUA 4FNIA 2ZKTA 3UR0A 3TAMA 5DDPC 2R8IA 2AX1A 2Q6CA 2U1AA 2PI4A 2GGPA 3G8QA 1I94F 1DTQA 1GXTA 2L08A 1RT4B 4DV1F 2BE2A 4BDPA 2CPIA 2MQLA 2MZQA 1S9GB 2CFXA 2VBZA 3CD7A 3MPVA 3T5JA 1H2TZ 1XR7A 2HZCA 3M2UB 1VQ9S 5MLCV 2F4VF 3KLGA 3T3FA 1WNEA 2DNNA 3BN4A 4BBYA 5C24B 1KVIA 2FVPA 5BYRA 1K0VA 2VV5A 2AX0A 2V2KA 2ZHAA 1VQ4S 2YY3A 3IS9A 4ZPWR 3DOKA 1FHTA 2ADBA 2B56A 4K5RA 3KLIB 2MY7A 4MK8A 3DRSB 2LA6A 3B8HA 3AJ1A 4A8SA 3KHGA 2EFPA 3FVYA 1S0VA 1P1LA 2HS3A 4KV8A 3W7BA 2DTJA 4QBUA 3IWNC 3NGDA 3Q8PB 3J81Y 2YNHB 4DBQA 2MQQA 4B3TF 5HROB 1HW9A 1N8RT 2GNKA 3GV8B 2K3IA 3HHLA 3HHEA 3M6WA 2G9OA 3J7YI 4C3MA 2K7KA 2YKNA 3NAHA 1IKWA 3CT9A 3HVRA 4DSKA 5JXSA 1AROP 4IQMA 3D2WA 1Y4ZB 2LXIA 4OHWA 2Q43A 2J6UA 4U7CA 2C28A 4NLRA 4N47A 3GIKA 3QGIA 4M8LA 4J9LA 2HHTA 2FDNA 1RGVA 2KO1A 5H1SV 2FVSA 4C11A 1X4HA 3IRXA 2WSCC 3I9V9 4QJVA 2HQ3A 4R5PB 2CIMA 3O5TB 2DNOA 2IRXA 4YB5A 3EGWB 5LXRA 1OQ3A 1L5UA 2JRSA 4Q5VA 1S72S 2WTFA 1MSWD 2BABA 1WG5A 4NA1A 3UCGA 1V3ZA 4H4OA 3TVZA 2OLWA 4ZPCA 4W90B 4O4GB 4NA2A 3CD6S 1HHTP 2OSQA 1VBZA 2YNFA 2QLWA 3TVYA 2XMWA 3PFOA 4Q0BA 2Y0SD 1FDNA 5GADI 2XS7A 2X3GA 3M2RA 1SUQB 2JSXA 1LK7A 4QYRA 3LWLA 2LA4A 1NK8A 2D3UA 4K59A 2ZH3A 1WEZA 3SCKE 2XEXA 5DETA 1WHVA 5F0UA 1TVRB 2EK6A 3QAEA 1U09A 3NS6A 2IM2A 4RW6A 5LJ5Y 1GAOA 1JLQA 3OTCA 1TL3A 3I96A 2E9RX 4IG0B 2N82B 4TU7A 4DR7F 3K59A 4EWTA 1SH0A 3IWLA 2MKIA 2DNHA 2OD6A 1R7IA 3D54A 4RW7B 2HRUA 2LMIA 3D28A 2DCLA 2KM8B 5KFJA 2J9CA 3C6UB 1E6YB 2IFXA 3T5HA 1PO6A 3ETOA 5A2QY 2K1RB 2M88A 4OV1A 5CH7B 4QPXA 3JSMB 2QE5A 2DR7A 2HWHA 2E29A 5T41A 5HP1A 2WRMA 2QA2A 3FQKA 3WBZA 1R31A 4R8UA 4DSIA 4GC7A 2E5HA 3NP5A 2FLOA 2YTCA 5DM6Q 5IQQA 4JYAF 1L3KA 3U7JA 4DL6A 2J0XA 3M8PA 2HMIB 2DNQA 2M3DA 1YJNS 3NKYA 2NPFA 4C9DA 3R5DA 1KNZA 1APSA 4LT6A 4NWBA 1X4DA 3BQ1A 2A3JA 1MWYA 1FRIA 1LXNA 3O3LA 3G8TA 5J2MA 1RT3B 4I4BA 2DHGA 3HKWA 3LANA 3C66A 4JI4F 3TW0A 4U67Q 2C42A 2EK1A 2KVIA 2O3DA 3VWSA 2W9BA 3VALA 3DRRB <