1A9NB

Crystal structure of the spliceosomal u2b''-u2a' protein complex bound to a fragment of u2 small nuclear rna
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
94
structure length
94
Chain Sequence
b'IRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA (5'-R(*CP*CP*UP*GP*GP*UP*AP*UP*UP*GP*CP*AP*GP*UP*AP*CP*C
publication title Crystal structure of the spliceosomal U2B"-U2A' protein complex bound to a fragment of U2 small nuclear RNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 25
structure length 94
sequence length 94
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1a9nB00
1DRZA 5LJ5Y 2DNGA 1SJRA 3TO8A 2GO9A 4M5DB 4TU8A 1VBYA 3CCUS 1HA1A 1D9AA 1WELA 1HD1A 2OTJS 2AYMA 2VODA 1YJNS 3FEXB 1QVGR 2I2YA 1NO8A 2E44A 2MKJA 2JVRA 5LXYA 2DISA 2LA6A 3CD6S 1YITS 3MD3A 1VC0A 3MD1A 4A8XA 1SXLA 1K9MT 4QU7A 4ED5A 2XS7A 2DHGA 2MJNA 1X4EA 2RS8A 3P5TL 4YB1P 3H2VE 2XS5A 3G4SS 5IQQA 1H2VZ 2CPXA 1U1NA 5ITHA 3CCVS 1S72S 3S01A 3HHNB 1F9FA 2LEBA 2LA4A 1YJ9S 5DM7Q 2CPYA 4LJMA 2J0QD 1M5KC 1U1QA 1URNA 3IWNC 2MY7A 3CULA 1X5OA 1WEYA 5D78A 2DK2A 3OW2R 2RQCA 1P1TA 4Y0FA 4IUFA 2MSTA 2MZTA 3LPYA 1RK8A 1M5VC 2CQHA 2FC9A 2JWNA 2RRAA 1H6KX 4W92B 4ERDA 1JMTA 1YJWS 2XS2A 2DIVA 3FEYB 5GAEU 2G4BA 2MKKA 2DGXA 4YOEA 4LMZA 2DH7A 2N82B 2CQGA 4PKDB 2QEXS 1CVJA 4WFBQ 2HGMA 2CPEA 4ZKAA 4CH0S 2MQNA 2ZJPQ 3CC2S 3NNCA 2D3OR 3VAHA 2MB0B 3EGNA 1VQ6S 1WF1A 2DGSA 1FHTA 2MGZB 2KYXA 4W90B 2L41A 1M5OC 2EVZA 3ULHA 1YI2S 2L08A 2N3LA 2DITA 2AYBA 2DHSA 3J7ZT 2YH1A 2DNKA 5LJ3Y 1VQ8S 1ZH5A 2RUGA 3NS6A 2RT3A 3MDFA 1DZ5A 4WFAQ 3MI7X 3NNAA 4PR6A 4UQTA 5CA5A 1KQSR 2DNYA 2MQQA 3CXCR 2OTLS 4V19X 4C7QA 3R1HA 1VQKS 2M8HA 3CCMS 2K8GA 2RVJA 2MGZA 1IQTA 4F02A 4YUDA 2KFYA 3S6EA 2KH9A 1M5PC 1X4AA 3MUMP 2LMIA 2PEHA 5IM0A 2ADCA 1U6FA 3ZZZA 3Q2SC 2DH9A 1Q7YT 2FY1A 5IFMA 3JB9k 1U2FA 2G1DA 2EK6A 2NLWA 3MOJB 2DNHA 1VQNS 4P6QA 2RS2A 2VONA 2WBRA 1WHWA 1ZZFA 2YKAA 1B7FA 1JJ4A 1WHXA 3L3CA 3B4DA 1ZZNA 2LXUA 3CCJS 1UP1A 1FJ7A 1OPIA 2LKZA 1U1MA 2DIUA 2ZJRQ 1N88A 2FC8A 3VAKA 2KRBA 2E5GA 1QM9A 4TU7A 2D9OA 3N9UC 2KT5A 2CPZA 2HZCA 2DNQA 2CPHA 2M52A 5DDOC 5EN1A 2XB2D 2DGVA 1U1KA 2M70A 2E5HA 2XNQA 2FHOB 4CH1A 2RRBA 2J0SD 5DETA 2VOOA 5GVQA 1UFWA 1FXLA 4UY8T 2N7CA 1YTYA 1R8PA 3PIPQ 2DNOA 1FT8A 2M7SA 3G71S 1VC6A 3CF5Q 3CCSS 2CQ4A 1X4FA 1Q81T 1HD0A 1NJIT 2CPJA 1KD1T 3G8SA 2MZ1A 2MZJA 2AYEA 2ADBA 1RKJA 2I38A 1FO1A 2DHAA 2JRSA 2A3JA 1YIJS 3CCRS 2HGLA 3BO4A 1KC8T 2M4MA 1VQ5S 2LQ5A 2GHPA 2MQMA 4TU9A 2RQ4A 1U6BA 2X1FA 2QA4S 1VBZA 4PRFA 5LSLA 2FPHX 2KU7A 1UAWA 4IOCQ 4WIIA 3V4MA 3MUTP 2DNNA 1N54B 2MQPA 1X5PA 5CXTA 3BO3A 1KOOA 2F9JA 1YWXA 2KG0A 2DNRA 3CCLS 1M90T 2X1BA 2KXNB 4U67Q 3SXLA 1NU4A 2VOPA 2RNEA 3US5A 2M9KA 2OIHA 4EGLA 1YHQS 5H1SV 5DM6Q 1PGZA 1WTBA 1O0PA 2J76E 5LXRA 3UD4P 2CQ0A 2JX2A 1K73T 5GADU 5GAGU 3G8TA 1JJHA 2CQDA 3VAFA 2XSFA 1W2BR 1WG1A 1A9NB 3UCUP 3EGZA 3R1LA 4QPTA 4Y00A 2MYFA 3SMZA 2DB1A 2KG1A 2CQBA 1SJ3P 1VQOS 4WKRA 4Z2XA 2HVZA 2MKCA 4F25A 1PO6A 1WEZA 3PIOQ 2MMYA 2YWKA 1A7GE 1H2UX 2NZ4A 3P3DA 1D8ZA 3EX7B 3CC7S 3S8SA 2AYGA 4CQ1A 2CQPA 4OZ0A 1VQLS 2MKIA 1VQPS 2LECA 3VAJA 1FJCA 2MSSA 3RW6A 3NMRA 2DO0A 1L3KA 1P27B 2RU3A 3H2UB 2DGOA 2KN4A 2MZQA 4LIRA 2SXLA 5D77A 1Q86T 1VQ7S 2F9DA 2LCWA 5DDRC 4C4WA 2MKSA 3CCES 4IO9Q 2D9PA 2DHXA 2MHNA 1OO0B 2MKHA 4FXVA 1OIAA 5JVGQ 3MXHP 4WCEQ 1G2EA 5DDPC 5GMKa 3G96A 2X1AA 2OJ3A 2MPUA 1U1LA 1X4HA 2DGQA 5GAHU 3ZZYA 2DNZA 5DDQC 1WF2A 2MQOA 1SJ4P 1JJ2R 3HI9A 1WWHA 3CC4S 1DBDA 1K8AT 2DGWA 2U1AA 2KI2A 2CPFA 2DH8A 3TYTA 1DHMA 1FJEB 1XN9A 3VAGA 2EK1A 2LYVA 2MZSA 1FNXH 1WG5A 4BS2A 2KXHA 1HL6A 2KXFA 5HL7Q 3IRWP 1X0FA 1U1OA 1VC5A 2E5IA 1KOHA 1SJQA 2CQ1A 3SDEB 2BOPA 3UE2A 1S79A 2HGNA 3BO2A 2XNRA 3VF0B 3D2WA 2M88A 2MQLA 1VQ9S 2KRRA 1X5SA 4FXWA 3BS9A 2M8DB 3G9CA 2CQ2A 3MURP 2ERRA 4C0OC 5CYJA 2DNMA 2YTCA 4TLQA 2L9WA 2K3KA 5FJ4A 3CPWR 1VQ4S 3CMAS 2JVOA 1WI8A 1VQMS 1R8HA 2M2BA 5LSOA 3I55S 4OZ1A 1X4BA 3LQVA 1N8RT 1WHVA 2V94A 2O3DA 3THTA 3VAIA 2QFJA 3SDEA 1UW4A 1H2TZ 1X4DA 4J5OA 1SJFA 4RU2A 4QU6A 1X5TA 2AD9A 2PE8A 1QVFR 2DO4A 3TP2A 2LEAA 1OWXA 2G0CA 3UD3P 2Q79A 3CUNA 2DNPA 2CJKA 2KVIA 2F3JA 1U1PA 2CQIA 2B0GA 5HO4A 1Q82T 2KHCA 3CCQS 4IOAQ 1M1KT 2BZ2A 3K0JA 4QQBA 3NNHA 4WF9Q 2ZJQQ 5IM0B 5MLCV 2CPDA 2MJUA 2DGTA 2OSRA 2HYIB 3VAMA 3S7RA 3UWTA 3U1LA 3I56S 1WHYA 4F26A 1WI6A 3R27A 3DXBA 2X1GA 3MUVP 2M0GB 2UP1A 2E5JA 2OSQA 1AUDA 3CTRA 3U1MA 1X4GA 1N52B 3B4MA 3NS5A 2MY8A 3J7YU 2DGUA 1X4CA 4WFNQ 3G6ES 1U1RA 3CMES 2CQCA 2U2FA 4CIOA 3UCGA 2KM8C 3UCZP 2MZRA 3P49B 1WG4A 2LXIA 3RW7A 3DLLQ 3Q2TC 2DNLA 2CPIA 3P6YC 2MXYA 1BY9A 3VALA 2KM8B 2J8AA 2YH0A 5BJRA 1WF0A 2CQ3A 3THPA 1VBXA 2N3OA 1WEXA 3BEGB 5JVHQ
chains in the Genus database with same CATH superfamily
4TU8A 5E3CA 3OR1A 1D9AA 4OYZA 4ZVQB 1K0TA 2XSJB 4A8KA 3BQ1A 4OHYA 3BKFA 4O4RA 1S12A 1T03A 2IAJB 2RD5C 3WQPA 3RB4A 4JI3J 2P9GA 3A8IA 3K5MA 3P5TL 3FDSA 2X3GA 4C0HA 2MLYA 2BABA 4DFPA 1RTDB 1FRXA 1U6ZA 2R8GA 1RHJB 5IV3A 3A1YG 1BUXA 2MZTA 4OJGA 5CCMA 2FC9A 1Y7PA 2XLKA 2FHJA 2IVMA 2AHOB 4NPOA 1KQKA 4YOEA 4EEYA 2N82B 1I6JA 3OBIA 4JI1F 3ZTOA 1AB8A 4P10A 2JFDA 1TK8A 3G6YA 3J7Z5 3PJ9A 3Q8PB 4R0EA 4PABA 3HD2A 1DTQA 2BBEA 2M8HA 1H38A 3CDAA 1HBNB 4CLKA 3TA2A 3NMAA 3KLHB 4YMEA 1KQFB 1NK4A 2CZVC 3DYAB 4MKBA 3MMBA 4B3TJ 5IFMA 3J81j 1FWKA 2EK6A 2J0XA 1QLNA 2RS2A 1Q95G 1XQIA 3B4DA 5EX3A 2LXUA 3KK3B 2QA2A 1HFEL 2NYIA 5A8KB 3PYGA 5IZHA 4C8KA 3FFIB 1IBLJ 1P8GA 1TL3B 2ASYA 5GVQA 4LRDA 1FXLA 4HI2A 3C6TB 4URQU 4DR5F 1S4EA 5HLFA 2W8LA 1SIZA 1NJIT 2BJ9A 3KLGA 5MAOA 2CWKA 2VG7B 3G8SA 1LFPA 2RHQB 3DRPB 1B0VA 2HLUA 3IBFB 3GP9A 2NXNA 3CJ2A 1RTIB 2ZZMA 1VQ5S 4RW8B 3M7VA 3I6PA 4ZJOA 2BQ3A 1X8DA 3V4MA 3TJ9A 5AE1A 3VZHA 1PCAA 1RB0A 1R6YA 1J5OA 4ELTA 1S1XB 4ECZA 1NU4A 4UOHA 1T9XA 3US5A 2VL1A 3ZZOA 1JJCB 1N5QA 3LP2A 1FXRA 1RE1B 4C0BA 1PC5A 4JOUA 1WOOA 1NDLA 2NS1B 1SJ3P 2MMYA 4MYUA 1TKXA 4OIXA 4OYWA 4CQ1A 2YKMA 3FJ2A 4OI0A 1QD1A 1HWLA 4Q43A 3MPVA 1LKZA 1O51A 2FVRA 1CG2A 1OYEA 4EBCA 4YR2A 2F4VJ 2OFGX 1R7IA 4Y28C 4F8RA 5IS2A 3G96A 3UNGC 1OY6A 1QJHA 1WKKA 3W64A 3FK4A 1EETB 3IS9A 1DHMA 2WZ1A 4K0KJ 3OXFA 4C6AA 2OEJA 5EUHA 4DV0J 1FWPA 5KFJA 2WW8A 5L1LA 4JV5J 3DLKB 3E01B 3VF0B 5KG4A 4NZ0A 1VK8A 1TKTA 4Y2IA 2DNMA 3RAXA 1N56A 2K7KA 3M8QA 1R8HA 2DCLA 3BDEA 3LQVA 2UUTA 4B9NA 1H2TZ 3LGHA 1SPBP 4LVNP 1FK9A 2ZH5A 2F3JA 3QZ7A 2CAJA 1GFWB 3ITHA 2YNFA 1LK5A 5MLCV 3NL0A 3VAMA 1YJRA 1KHWA 2XZWA 4U95A 2PT0A 4OJ1A 3R7SB 1FVSA 3CTRA 4OX7A 1YG0A 4ZVHA 1YZ7A 3T9ZA 4HT7A 2KHDA 2MHEA 2BJ3A 1MROA 2OUGA 2B7CB 3M2UB 3MZIA 2VQEJ 5T7LB 2AX0A 2V4JA 4DL0C 5BJRA 1RT7A 3TZYA 4HKQA 4EBEA 1J5EF 1SJRA 4QYZK 4RW4A 4ES2A 3OHAA 1OQ3A 3KMQA 3D0IE 2E29A 4M5IA 2AYMA 2JOQA 3NAHA 3CJ4A 3FEXB 3UPFA 4ZPCA 1NCLA 1WSVA 2HS0A 3FKBA 1RAHB 3QO9A 3FBEA 3M1VB 2PI5A 4K4WA 4ED5A 1P6TA 2HQGA 1RT5B 2FLOA 1JXLA 2XS5A 2ZITA 1LWCB 1YJ9S 4A46A 4O3PA 1U1QA 2CVIA 4V1Ak 2XLJA 4CO0A 1YJVA 4NCBA 4IDKB 2DXDA 1CJVA 3KXDA 1JKHB 4MK9A 2G4BA 3PW5A 4LMZA 4OJ3A 3O6QA 2HFNA 4NI2B 1WF1A 2BA9A 2G13A 2GMHA 2AJ2A 4W90B 1M5OC 5L1JA 1EQ0A 4HYKA 2QFIA 4CO4A 4JI3F 2IA0A 2YH1A 2DNKA 2HSEB 3IRXA 1T3NA 3KKFA 4A8QA 4NCGB 2VBYA 1XNQJ 2K8GA 4CZCA 4F02A 3AXMA 1S4FA 3K5NA 2LU2A 3D1QA 2LMIA 4UUXA 3GONA 1SIWB 1YBTA 1KVKA 2UVRA 4PPDA 2RHSB 1XWLA 4KGXB 3UNYA 2YKAA 2BQUA 2AKWB 2ROGA 1QSLA 2Q66A 1UWBA 4LFAJ 3DM2B 2ZBQA 3QAEA 5D4NA 5K20B 3TA1A 1F5AA 4URGA 5FLXY 2NXCA 3K89A 3CVKA 4Q2MA 2FQQB 3PDNA 2ZNZA 4RO0A 2DEIA 2H5EA 3SI8A 3UFCX 5EWFA 2C2DA 5KFFA 4K8RA 2QJ3A 3UR0A 1C1BA 5F8IA 3SCJE 1DY3A 2MZJA 2ADBA 2UXBJ 4A4JA 2IJFA 4DHVA 2HGLA 4WZQA 2NREA 5KFLA 3J80Y 3OVBA 4Y34A 4PRFA 1U0HA 1NJYA 3RBZA 4IOCQ 3A8EA 2B9WA 1Q79A 2QL9B 1S1UB 4MKYA 1XR6A 2XZTB 1KOOA 4DMZA 4ZHRA 1KONA 2VF3A 4ZN1A 1V5IB 4C98A 1S59A 2OFHX 1UVIA 3VVTA 5BYSA 3EVWA 3AB2B 4LF1A 4LRBA 4P2MA 4JI7J 4YEAA 4Y00A 2OKQA 3PW7A 3MFIA 4IRKA 2IRXA 1VRTA 3MECA 2DRDA 4MKVA 2RE1A 4FS1A 4Q7AA 2KN4A 3BM7A 2DPJA 2SXLA 3KMSA 2D9PA 4NLGA 1F0XA 3M8RA 2HHVA 2KJVA 4JV0A 1F1BB 4ZPAA 1YBAA 3DGPA 4LF6J 1H3DA 3FZ2A 5I3UA 3RAMA 2CPFA 4PQAA 1E6YA 4B9SA 1H73A 2AEFA 1T9WA 3MPDA 4TYBA 4DQQA 4OYMA 1LWFA 4KO0A 1HPZB 4CWBA 2UVUA 4B9LA 2ABYA 2M88A 4RNMA 4FXWA 2P9EA 2CNKB 2M8DB 4OQJA 2YTCA 2FB0A 2A18A 3MOZA 2JVOA 3K5PA 1KP6A 3TQEA 4B17A 2F4VF 3H40A 3CJTA 1NH7A 1CQMA 1MG7A 3M32A 3CUNA 4CLWA 3RB6A 3LTOA 3GV8B 2J5AA 4K0KF 4ZLPA 2WRMA 4KKOB 3CCQS 4EI2A 3H59A 1VHIA 2HG4A 1HNIA 3D1HA 3RG6A 3NGUA 4DSIA 4DV1J 2D41A 1Y9OA 2FVCA 4C3MA 1S7IA 1X4GA 2AJ0A 3NS5A 1SUQA 2VJVA 4EMDA 4O44A 5IT4A 5FIIA 2WB1D 3CO0P 3UCGA 3SIPB 1TKZA 1NKEA 2YNHB 3Q8UA 1LXNA 1HQ2A 4QR2A 5LJ5Y 2DNGA 3G8QA 2IM2A 3UW1A 1NSPA 1RWKB 4OZ2A 1HIYA 4YHHJ 3GG1A 1HWUA 4F3OA 3MD3A 1MU2A 1SXLA 4PZVA 5AXKA 3HJFA 1PSDA 3QATA 4ES1A 4CTAB 2CPXA 1TAQA 4OX8A 2Z4PA 4NYZA 1BQNB 1HLWA 1PYTA 3H0PA 4ZCMA 2YKNB 2XI2A 4DG1A 5D6GA 3UVJB 3GPAA 3U02A 2CQHA 3BQ0A 1HNWF 4OHVA 1RGVA 3R3TA 1DTTA 3KHLA 1SBRA 3L09A 3AQPA 4KGVB 1DLOB 2KFZA 4F4YA 4N5SA 2DGSA 3SFUA 2EG1A 1D8YA 4GC6A 4RUHA 1GXUA 1ZH5A 2A6OA 3NS6A 3MDFA 4EK2A 1JLFA 2NXJA 4QCLA 3O8WA 1DAXA 3NOCA 4F0KA 3BZQA 4I1TA 4H4OB 3C14A 3C46A 1CJKB 4M5GA 4F50A 1WC5A 3QIPA 3FMWA 5ETPA 2VG6B 1GX6A 2LKZA 2JLEA 2ZKTA 1Y5LB 1S57A 2ZEJA 4BCAA 4TU7A 3SQGB 2XNQA 3EZUA 1S1TA 3CMQA 4DDFA 3I0RA 5KFEA 2VG5B 1YTYA 2DD8S 4A8WA 2DNOA 4I6WA 4NLSA 3G71S 4TVAB 3BR9A 4QWAA 1RAGB 1IR2A 1TKDA 1TUVA 1UEUA 2C1EB 3T5LA 4OHWA 1B70B 2GJFA 2ZKUA 2DHAA 1YIJS 1JLGB 1N6QB 3FBFA 2OMLA 2LQ5A 1RHKB 2GHPA 4WTYA 1VJQA 5A2QY 1HW8A 5LOQA 3KWMA 4LFAF 4WIIA 4ZITA 3GIJA 1BHNA 4J9SA 5G0RB 1X5PA 5CXTA 4ZVUB 4KRWA 1HARA 4A8MP 1CJTB 4DLGA 3GJTB 1M90T 3BGFA 3MEEB 2X1BA 5DJBA 4DSFA 3ELHA 3PFOA 2IC3B 2YX4A 1ZAVA 3W9JA 1K73T 4ZVFA 4LF4F 3L4BC 4XAKA 2UXBF 2CJYB 4KR0B 2BYCA 3KDOA 2PD1A 4WK1A 1YJUA 4L6V3 3DOMB 5L39A 4IG0A 3GJQB 1RHRB 4Y3CA 2AIRB 2PI4A 5LM7E 4OHXA 1D9FA 1P27B 5HVFA 2DGOA 3J7YI 4PXCA 2BVZA 3TJAA 1Q86T 3WDOA 1KTQA 4M5HA 3CCES 4ECQA 2FZCB 1OIAA 3BN4A 4FYVB 5KG2A 1U1LA 1PBAA 2R7RA 2GC8A 3CJ8A 2XY5A 4I64A 4ZJQA 3KYLA 2J9EA 2DH8A 3TUPA 3JAMU 1IJEB 5FDLA 3RUBL 4J9VA 1S0OA 1NXIA 3NGRA 3L7PA 4F2SA 1Y3KA 2H65B 2B8PA 4NE9C 2EKYA 1XERA 2DVIA 3SDEB 2QMWA 5IWAJ 3ENWA 3D2WA 2QV6A 4TLRA 3M6XA 3O2IA 5M2RA 3MM9B 2ERRA 4C0OC 3A3PB 5DQHA 1MNEA 1ROFA 2BOAA 1Q78A 3I55S 1VGYA 4KSEB 4A8OA 2E7WA 3PYEA 3FEZA 2QFJA 4O0IA 5L9NA 1SJFA 1NK5A 2K06A 4RU2A 4LF6F 2QX0A 3UD5A 1DTQB 1JX4A 3TP2A 5ETSA 2J6TA 3BF4A 4DR7J 1CC7A 1Q8BA 2Q79A 4ZLLA 1TTHB 3FCVA 4PQUB 1S9GA 4C8MA 4IOAQ 4ZPTR 4QQBA 2RH3A 4NLQA 3SZ2A 3V4IA 5D4PA 2HS4A 3KK2A 4FDFA 2GW8A 5L9XA 2UP1A 2XMUA 1X4CA 4BHQA 1WG4A 3FMBA 2ZH6A 4DR3J 3P6YC 1XK8A 3OUYA 5F8NA 1V6HA 1VBXA 2N3OA 5B0FA 2WOMA 2GNKA 2ZHBA 3H5UA 2BXJA 1VBYA 1T9VA 5KFRA 2ATCB 3KLGB 5HN0A 2MKJA 5LXYA 2Q43A 4ZK7M 2EW9A 5D15A 4DV1F 3R5DA 2D7SA 1GTHA 2C3PA 1S10A 3OTDA 2MJNA 2RS8A 3HSGA 4RX6A 4ZS6A 3N28A 3BPSP 5ETQA 2XO6A 4KH1B 3NP5A 2DK2A 4N41A 2K1RB 4R5PA 4A8YA 1X31C 2DIVA 2MKKA 2DGXA 2V2KA 1Q5YA 1T3OA 2V8HA 4PWWA 4WFBQ 3KG4A 3LP2B 5J1PA 3NNCA 1S7HA 2MB0B 3QLHA 2R2RA 4I6YA 2EVZA 5KFOA 1VHFA 2GIFA 4E2FB 2DITA 3O5TB 3DLBA 3VCDA 1NZAA 1TKXB 3HF5A 1Q16B 2YKMB 5KFUA 4ZOSA 1X4AA 3V81A 2KT3A 2PEHA 5IM0A 4DFJA 2A0FB 2ADCA 1KN6A 2AJ4A 5LMUJ 3Q2SC 2DH9A 3P4UB 5IT9U 1EQMA 2OPQA 4P74A 3W65A 4NA3A 4FYYB 1S48A 2V2VA 5HROA 2J8SA 3IS9B 2NQPA 2ZJRQ 2VICA 3JQKA 3BGUA 3DRYA 3N4WA 2M52A 4LF8F 1U1KA 1IQZA 4ZIWA 1UFWA 3OLBA 1HD0A 4RZRA 1I3OB 1FNOA 1UMJA 3M6VA 3T5KA 4UZBA 4UTGA 5G4DA 3M8QB 4L74A 3AXKA 2A3JA 4QJVA 4O0NA 4ZVSB 1KBRA 4OI3A 1U6BA 1FK9B 2FPHX 4WFXA 4X62J 1LWXA 1UCNA 1S1VA 3M2RB 3ITHB 3ZNUA 1YWXA 4OYIA 1MWZA 2MKYA 1TQLA 3UN3A 2OPSA 1K44A 1REVA 2BDPA 3AHPA 5A6PA 5D4OA 3GFXA 4PYAA 3RB0A 3Q83A 3Q8RB 4KIAA 3J80U 2IHR1 1MROB 2HKEA 1QAXA 2V4JB 2VPYB 4OZ5A 4QW9A 1RT7B 4USHA 4OFZA 1YJTA 2AZ3A 2AZ1A 2BR0A 4RW4B 2EKNA 1VQLS 1FKPA 4WTOB 3NCQA 3SEOA 1LFWA 2QG9B 1G6BA 3RW6A 4RW9A 3QO9B 3ZTRA 4IO9Q 2MHNA 2V5HG 2APOA 1ELOA 4IKAA 4C48A 4ES3A 4H4MB 3Q8VA 1MMDA 2KI2A 4N7TA 1FJEB 4B9TA 4NWBA 2VV5A 3OT9A 2N4CA 4DV2J 2DHHA 4UF4A 1CJVB 1F6TA 4F3MA 2K2PA 4OX9J 1T11A 2BV3A 1FRMA 2ACMA 4IR9A 4GKJJ 3JQJA 3MURP 4WIQA 4DV4J 3TW0A 5A0YA 2M2BA 2O66A 3IRXB 2BE2B 3VAIA 3LANA 4Q44A 2NR0A 3EM1A 2AD9A 1VLYA 1QVFR 1SL1A 3D1OA 1M5HA 3GFZA 1UA0A 2CQIA 3OQ2A 1N5SA 4ZVRB 4CYUB 3AODA 1TL5A 3K17A 1NSQA 1RAJA 3LH2S 1HBMA 4R8UA 2BACA 4ED6A 3ENAA 3J7YU 4ICLA 2C3MA 1R31A 3CMES 4CIOA 1JLEA 2MZRA 2GZOA 2G1HA 4P7TA 4FVCA 4C8ZA 5KG5A 1WF0A 1TK0A 1S49A 2WSEC 1DRZA 3QT5A 5HVGA 3ZZ0A 1AW0A 3DLEB 2WONA 4DR7F 3MEGB 1RT3A 1C1BB 5DGBA 1RWVB 3JYTA 2JVRA 5EWEA 2I9SA 1YITS 1VC0A 1TL7A 3J81Y 4DS4A 1L3SA 2N7YA 3IXQA 3ZZUA 3V6DB 3OHBA 4TY8B 1Y5NB 3MMAB 3IGVA 1U0HB 5ITHA 1UFLA 4WFYA 3TZXA 5AXNA 2XSJA 2NSCA 3BSNA 1W7WA 4BC7A 1WEYA 4NLYA 2B6AA 4Y0FA 4IUFA 1SC1B 2QLBB 4ZHRB 4DR3F 5DG9A 5H9FK 2VC1A 2XS2A 4LFBJ 1RAFB 3G87A 3LUYA 1RTDA 2W2MP 3M05A 4IQMA 2CPEA 2K7JA 4CH0S 4X4PA 4L75A 4DS5A 2UUCJ 3VAHA 5D0HA 1RP5A 3HM9A 1WTFA 2ZOGA 4J37A 1YGYA 3LPEA 2VPXB 5B09A 3P5BP 1CS4A 1VRTB 2RT3A 1DZ5A 2DRAA 4UQTA 4N56A 4V19X 3TUJC 5KOXA 2HFZA 1CLFA 1DQ9A 4OV1A 2FDNA 1Y5IB 1UZDA 2FTRA 4NL5A 2GVDA 1FTRA 1U2FA 2NLWA 1G1XA 3N79A 3DGPB 1UPMB 4WP3A 2DRBA 5I3UB 2UXCJ 1HBNA 3CJSA 2KO1A 4RNOA 4JI2F 4DL2A 1RHUB 1YRUA 5F0WA 1KS2A 2IJRA 1UJ5A 4ZLJA 1PYSB 4KO0B 4LF5F 2ZBRA 2Z30B 2QO3A 2W25A 3D9BA 1FNMA 3HSZA 1N0UA 4Q0BA 3W9HA 1ZA2B 2HWIA 2XYGB 2CPJA 2DTJA 2ILZA 3FBCA 3FZBA 5A8KA 4H4KC 5LMUF 3KUEA 1TL3A 4EFAC 4CM2A 1Q1KA 5KFVA 3CCRS 1P1LA 4WU3A 1TELA 3C6TA 4RJVA 4ZVOB 2RQ4A 4TU9A 3M32B 2QA4S 1F9HA 3RRHA 3DHXA 4WXWA 4XPCA 1FRIA 3LF0A 1TV6A 1WNEA 3MR2A 1RQ0A 1N5VA 1HNIB 3H7HB 1N32J 1BGXT 3DRPA 1FX2A 4NLTA 4P7VA 5LT5A 1PIEA 4HR2A 5IOLA 4EGLA 1J2VA 1CBKA 1WTBA 2UVVA 1O0PA 1SUQB 4LF9F 3AJ2A 4O44B 1JXEA 3GYGA 3FNNA 1FDNA 2XSFA 3QNWB 3MR7A 2R7SA 1NUEA 1VQOS 3PW0A 1FRHA 1YRTA 3R7BB 4QIEA 4LF7J 5A8WA 4Y2AA 3M8WA 3HO1A 2XCPA 2Z2MA 5ETRA 5D0GA 3IO1A 2LCWA 1MU2B 4U96A 3MR3A 3W5YA 4F4AA 1W2IA 4RW7A 3E2EA 4YS2A 4DSLA 3OTOF 1DFDA 2GQCA 5K8MA 5J2PA 2B43A 1FNXH 2UUAF 2ZM6J 2ZH8A 1WG5A 4BS2A 1C2PA 2CNLB 4P2FA 2DKOB 2VBXA 3PKMA 1X0FA 5CYQB 1DTTB 4J9PA 5EX0A 1VC5A 2H48B 1T9UA 1KOHA 3N6MA 1EETA 2L48A 5HJYA 4DL3A 5F8JA 1BQMA 4ZJLA 3R5AA 3PX0A 4USVA 2L9WA 4DZ6A 3I5CA 3GR1A 1VQMS 5KT5A 1S97A 3WIUA 4USMA 4GKKF 1JLFB 2F5GA 1WDTA 5GAEI 3CCTA 3IG1B 1L3UA 2DBBA 3K8VA 3QPIA 3UDVA 5KT6A 3C14B 1O6XA 1UPPA 5IC6B 4ZDNA 1BE4A 1WI6A 2RUSA 3D67A 2EXUA 4OX9F 3J7AN 4USUA 1HBOB 3LO3A 3HFVA 2D69A 3PO5A 1XEZA 2Y8WA 4GKJF 5BR8F 4FYDA 2ZOMA 1UL3A 3R9LA 3GWCA 4CDIA 1WORA 2KM8C 4DQPA 3IA0A 4ELVA 4Y65A 1DQAA 4N8OA 2J8AA 3OVAA 3BEGB 1IR0A 1RWPB 3MPUB 1NDKA 4DQSA 3MTJA 2VODA 2BJDA 1MN7A 3M2UA 5CABA 5KFDA 2R7TA 3E51A 4LBPA 1XNRF 3BPDA 2V69A 2XS7A 1EJ7L 5AJ3F 2VH7A 1TU0B 3D6HB 1H2VZ 4ECSA 4I68A 1S72S 3V5RA 4NZ6A 2CPYA 2OLWA 3CULA 2ZDOA 2Q1LA 2GX8A 3ETMA 1HHSA 1QTMA 4RNHA 5J2MA 4O3OA 1S1WA 4ERDA 2CJXB 1XMQJ 2ZBIA 2CQGA 2IFXA 2GJ2A 2RJZA 4DF8A 4X64J 4ZCIA 3MPYA 1FHTA 3EGNA 3UI3A 3HHDA 5HK4A 3TJ8A 3W5XA 2V68A 2L41A 3GIIA 3ZC4A 2OAUA 4IDKA 1RAEB 1D09B 5EHHA 2J0WA 1F60B 2Z2LA 4IG0B 1YK9A 1FDDA 4ZLNA 3NKYA 3CXCR 3A8KA 3EPGA 4TNOA 1FF2A 2FUG9 4QOTA 1M5PC 1IKVA 3PG9A 4I7FA 4DQRA 5AXLA 2FY1A 4LFBF 1GK8A 3CCWA 2HVHA 1WHWA 3OFEA 2WVFA 1VFJA 2F40A 1BWVA 1UP1A 1HI8A 3GZ7A 2GQQA 4UOGA 4WJBA 4HTIA 3QFHA 4ZVPB 3OL6A 3M8SA 2J0SD 4USTA 3KNAA 1RAAB 2XMWA 2HFVA 1ZTTA 3CCSS 3NBPA 5F41A 3KUGA 2H54B 3GFHA 2WSFC 3R97A 2MZ1A 1RKJA 2JEIA 3I9ZA 1FO1A 2VFSA 2J9DA 3SCLE 4ZCLA 4BWMA 1RAIB 3TVYA 1Y10A 3HVTA 2UXCF 4PXBA 1WC0A 5LSLA 4IFYA 1S9GB 2ZD1A 3GJSB 2CJ9A 3FSYA 1WC6A 2WCXA 4KV8A 2IMOA 1HBUB 5E3RA 1H7WA 5K8PA 1YHQS 2EFPA 1R8BA 5F3ZA 1S1UA 1FRLA 1FEHA 2QE5A 2MYFA 2E9RX 2C2RA 4ALZA 3OUYB 2V9KA 2XM3A 5I4MA 2IYGA 2NZ4A 1NB7A 3PVXA 2VDIA 4CNYA 1X7VA 3W62A 1RU2A 1PAEX 3H2UB 4J9NA 5JJBA 2PN6A 5D77A 2HBZB 5DDRC 3GV5B 4C4WA 2MKSA 3KJVB 5M2UA 5DDPC 3BQ2A 2BQRA 3ZZYA 5DDQC 3K59A 1WF2A 2EBGA 2VBWA 2KDOA 1G7CB 4K59A 4L3NA 5L1KA 3E3XA 5IXUA 4R5PB 3GMGA 5HL7Q 1U1OA 4LF7F 2P6TA 2XYPB 3EZOA 2HIYA 3MAAB 3A4TA 3MM7A 5T41A 2DR6A 5KFWA 1JLBB 1VR6A 1YKWA 1T02A 3QLHB 1VIXA 3QGHA 2UU9J 1UEVA 2K3KA 3EXCX 4NX9A 3DN9A 4I6AA 3CEDA 4Z7CA 1HPZA 1RT1B 5BXIA 1S6OA 1NPPA 3JSMB 2C3YA 4DV6J 3DRXA 4TY9A 5K8NA 1GEHA 3I0SB 5CZVA 3HJVA 2BZ2A 1RZMA 3V81B 2E7XA 3NNHA 2AJQA 5IM0B 2MJUA 5GMEA 4PG5A 4I69A 5HROB 2OSQA 3BJYA 4LQ3A 3U1NA 3G6ES 1SKSA 2CQCA 2U2FA 2JFKA 3ENQA 3EJMA 5JMNA 3J7A1 4M95A 4KHRA 1C1CA 3NS7B 6FDRA 1KSPA 4NXNJ 3H25A 4OYBA 1PYOB 4U7UK 1AYEA 1SB6A 3R5CA 1WSRA 3M30A 1S0VA 2YNHA 4K2JA 3W8GA 3A12A 3RRGA 1HR0J 4HH1A 3OLAA 4DL5A 3NLCA 2KZZA 1FI4A 4X2BA 4ZMMA 3IAM9 3C6UA 3CCVS 1HNXJ 4KH0B 1S1VB 2CJQA 1FRKA 1VOMA 2XMVA 3KG1A 1T9YA 2EFGA 4OHZA 5ETLA 2UXDJ 1U2CA 2AP6A 1SC6A 1H6KX 2QT7A 4F36A 5GAEU 1PJ7A 2UV8A 4CTAA 4X4OA 1REVB 4PG8A 1CVJA 4J9RA 1BQNA 1ZPWX 2BKPA 2XMMA 2D3OR 1Q8LA 3LWMA 1NMEB 5KFQA 1VCTA 3ULHA 2XTJP 2AX1A 4CI0B 1YSJA 3D0GE 3I5AA 4JI4J 3RB3A 3D54A 1EKSA 1Y4ZB 2L9DA 3ZTPA 2YWHA 3NNAA 2ZNYA 2B4VA 2OD4A 2XMKA 3CCMS 4RW9B 1IQTA 2I5JA 5B0GA 3S6EA 2B5JA 3H42A 2Y0SD 3RBXA 4HI1A 2W2QP 3R6GB 1B99A 2JC0A 1VQNS 2WVBA 3BB5A 4MMOA 4M94A 3D6MB 2KZMA 3ENVA 4KYZA 3H8YA 3U7JA 2WBMA 5HBMB 4I2QB 2HPUA 1AZSA 1SCJB 3G6XA 1ACMB 4OLPA 3D7SB 3WBZA 3B6BA 1XMBA 1NK9A 3T9NA 3ICLA 2FHOB 1MMNA 5KG3A 2VG6A 4LREA 4ED7A 4JI5J 4QYRA 4CP5A 2V6AA 1T8EA 1VRUA 4ZVTB 5A0YB 5F0UA 4K4ZA 2ROEA 2JLGA 3G82B 3DDNA 4RBUA 4ZCKA 1TZ0A 1APSA 4AFFA 4DPYA 1NK0A 2VG5A 3KLIB 5ETMA 1FEEA 5FD1A 1UW9A 4XO0A 1RWWB 1HKAA 1Z2ZA 4LFCJ 3Q89A 2HFSA 1U26A 3EVOA 3IWLA 4TQSA 1DURA 1N6QA 4JBCA 2R9LA 4KT0C 1HBMB 3CJQA 4R8UB 4D3GA 1KR4A 3TAPA 1P9YA 2IJNA 4MK7A 4NXMJ 3W5ZA 1VISA 5ETVA 4QPTA 1CJTA 2GHVC 2V34A 2EG2A 2HVZA 3IR7B 2YWKA 3C66A 1F9EB 3BH7B 5HJXA 4ED8A 3CC7S 2IC3A 4IO1A 2LECA 1RT3B 2HAFA 3CD0A 3JYTB 5HQMA 5K5MA 1HI1A 2F9DA 3CIMA 4I2PB 1TL7B 1UZHA 1ZOTA 1FFWB 2DHXA 1R8AA 2HHQA 1NJXA 2Y1JA 2X1AA 2BKOA 5C24B 4QWEA 1LV5A 1HHTP 2GAGC 2D3O1 4ZPBA 4J91A 1DBDA 3SSSA 2QMUB 3G6VA 5HMWA 2B6AB 1RAOA 1REGX 1HL6A 2KXFA 3W60A 1SJQA 3EDRB 1C0UA 4J9OA 2G2YA 2QYGA 4FF1A 5KOWA 3KLFA 2GCFA 2HRUA 1SKWA 4RW6A 3DRRA 3BREA 5LSOA 3CWJA 2VDHA 1CS4B 1GAOA 2RILA 3SDEA 4OZJA 1N5YB 4HHUA 5KG7A 4NOHA 1KVJA 2DPIA 3UD3P 2DNPA 3MM9A 5HO4A 3KLEA 4O3RA 2ZJQQ 3CW2C 3PACA 3CO9A 1U02A 1UWAA 2GVDB 4NEYA 5KFHA 3PV8A 3DXBA 4PXDA 3L7OA 2FVQA 4RPFA 1NM2A 3LGNA 3B4MA 4PQUA 3MHYA 5B0DA 4NLXA 1ZAXA 2CWXA 2UU9F 1GQEA 1N33J 3DLHA 1U0SA 1TR0A 3CIZA 1WEXA 2IYIA 4EWTA 4C11A 4EO6A 4FF2A 3NRBA 3CJKB 3IR5B 4Q0BB 1HW9A 1YJNS 2VQFJ 2KL8A 1H74A 3M8ZA 2I2YA 2DISA 4HT5A 1UJ4A 2F8MA 3T6BA 1U2RA 4C2MA 4QR0A 1VK3A 3BBCA 1X4EA 5IQQA 2V67A 2V8DA 4DL4A 3HHNB 1NDPA 1NKCA 2YX1A 3IWNC 1TV6B 4Q8EA 4A48A 5KFIA 2B4UA 2V2QA 4B3SJ 1RK8A 3M2VA 1EKRA 1R0AB 3H20A 2ZBCA 2DH7A 4DN0A 2HHHF 2XC9A 2MQNA 2FJBB 2KYXA 3X3UA 2YVSA 2X51A 2K1RA 4ZP9A 1SL0A 5DQGA 5CD4A 3R5BA 2OD6A 3ILIA 5LJ3Y 2HQDA 3AD8C 2PFFB 1C0TB 5A8WB 4FP9A 1HNXF 2YQ1A 1OY9A 3E8OA 1S0MA 4X65F 1PKUA 1WDDA 1D0EA 1PILA 1D9DA 4EZ9A 2NXEA 4I56A 2UXDF 1U6FA 4PG4A 4HHJA 4QWBA 1VYAA 3D5MA 4B3OA 4OYXA 2Y1IA 4RW7B 3A3OB 1FDBA 3JAMY 1ZZFA 1B7FA 4U9RA 1ZZNA 1QUVA 4YB5A 3HMJG 5J2PB 3OR2A 2A2DA 3G2XA 1RTJA 1C4CA 3AT1B 1IBKJ 5J1EA 1JLAA 2Z8QA 1NRKA 2VUGA 3OD2A 4JI4F 3GLJA 3K8WA 4ZPWR 1RT4B 4FZVA 4B9MA 4U7UD 5H9EJ 4B3RJ 3DDIA 4MIWA 4AUKA 1OMSA 2OI2A 3CF5Q 4BWJA 3GQCA 2J9CA 5GAHI 4KHPJ 4H54A 1BQMB 3TR5A 2VU5A 5E3QA 3IC1A 3FRZA 5DO2A 2JRSA 1R8CA 4HDHA 4DV3J 4WP8A 2IBKA 2DR7A 5CCLA 1U25A 2KU7A 3MUTP 5E41A 3SSRA 2VASA 2MQPA 1AT1B 1WC1A 1PJ5A 3PW4A 4BLGA 3NGTA 3PY8A 3CCLS 4C8OA 2C3OA 2RAQA 2XLIA 2OIHA 4JI5F 3JQMA 2O1PA 2L3MA 2VFRA 4KGZB 3M2RA 1SJ1A 1HMVB 1W25A 1JJHA 3T6JA 1RWOB 3R1LA 4RUBA 4X4TA 1F5CA 2HVEA 3TA0A 2HHXA 4DV5J 2IDEA 4ZVGA 3W3SA 1H2UX 4FNHA 1TUWA 2AQ4A 5CQGA 4OZLA 4DUZF 1S6QA 4FF4A 1FA0A 2KYZA 1N5TA 1CC8A 1T0TV 1Q5VA 1YRXA 3KJQB 1B0PA 3HHLC 4LIRA 4UOCA 4DUTA 4LFCF 5GMDA 2HRTA 1N36J 2RMLA 4DSKA 4FXVA 5DG7A 5L1IA 2DGQA 2DNZA 1N34F 4ID5B 2H1YA 2AGOA 1K8AT 3M9NB 1DARA 2EK1A 1NNDA 4AT1B 2LP4A 5J2MB 3GIKA 2KXHA 1S1WB 5KTQA 3QWUA 2E5IA 2JDJA 3HD1A 2LEPA 4AL7A 3RBEA 4H4MA 3FC9A 3BGRA 1LWEB 1R6VA 3N5BA 4NA1A 4NLUA 2JH3A 5CYJA 5FJ4A 1D3WA 1X4BA 5RUBA 2ILYA 4QIWD 4UQGA 3GSDA 3LOUA 2V50A 1X0PA 3B54A 5IT9Y 1WOPA 3FUYA 4CLSA 2KHCA 1UFKA 1IKVB 4I7FB 2HYIB 1FE4A 4M1KA 2BE2A 3U1LA 3I56S 4DPWA 1VDHA 2M0GB 3VQSA 3OTCA 3TQ1A 2DCUB 2OHDA 1VI7A 4CYUA 1UVNA 1SKUB 2ASLA 4MAKA 1FD8A 1YQHA 3TWZA 3LA0A 4DBQA 5F8LA 2B51A 3H4BA 2JSXA 4FPIA 3TO8A 1KRPA 2F7VA 3VZIA 1JQGA 4KHMA 1FRJA 3NBPB 2V4QA 4GVBA 1B0TA 3QT7A 4JV2A 3EGVA 3DRSA 2P2CB 2QA1A 2RKIA 5L46A 3DFEA 4WBFA 2ZH1A 3A8JA 3HVTB 3DLEA 4X66J 2FJVA 3H2VE 5E3PA 1F2HA 3MEGA 4K2XA 4OZ3A 4QPXA 4IFYB 3QGIA 4YY3J 3PFEA 3FSIA 4C9DA 3T1HJ 1N33F 3WC2A 4ZPDA 5D78A 3ISZA 2ZD1B 4B3TF 3K57A 3KHHA 4DF4A 3PTWA 1ICEB 3QRQA 4FXDA 1RLCL 3JSYA 3V6JA 4KV8B 3V6DA 4TY8A 3MMJA 3P45B 3MMAA 2IVYA 4PKDB 2Z57B 2HGMA 3NAIA 2P9CA 2VA3A 1VQ6S 4RBVA 5A8RB 4K4SA 1IBLF 1YI2S 3ADAC 1BLUA 1BWEA 1OPZA 1RSCA 3WX4A 1UTAA 1URRA 4MYTA 3KHGA 1XIQA 1ZBTA 3D66A 2YNGA 4P72A 2OTLS 5KT4A 3OSNA 2R7XA 4YUDA 3FQKA 4B3SF 1QAIA 2RQMA 1UVKA 3AOCA 3VVUA 4TYAA 4HTJA 1RABB 5L8RC 1RWNB 4WK3A 3W8PA 2QA4G 3ETOA 3C2PA 4LBHA 5THWA 2KRBA 2VKRA 1WKLA 2HZCA 4S0MA 1I5OB 3O1LA 5I42A 1UVLA 5K8OA 4K4VA 2KVQE 4UOFA 1CSJA 1SH0A 1FT8A 3MM7B 3D6TB 2CQ4A 2CUYA 1CJUA 3ZZRA 1VLOA 4TKTA 2AYEA 5B0EA 4N76A 1RWXB 1TMJA 3FGVA 1IM4A 4RLEA 4A47A 2GJIA 1AA1B 2YQ3A 4FN5A 2MQMA 2NYHA 4DV7J 2C42A 2DNNA 2RDDA 1IBKF 3PEHA 3M6WA 2DNRA 3V6KA 1ZM4A 2HHTA 1HYSA 2GVZA 3O44A 5KFTA 4B3RF 2VOPA 4P2XA 4WE1A 2BW2A 4NYOA 3AJ1A 4KHPF 2Z58B 2W1BA 3VAFA 4UUWA 3EGZA 1B64A 4DV0F 4DU8A 1C1CB 3VGTA 1NBEB 4JV5F 4DV3F 1H0HB 1IM6A 2YKPA 2ZDPA 1A0OB 1QY7A 2HZAA 3QT8A 4O4GA 4DR6J 4IH5A 4DX8H 2JEGA 2YWFA 3TAQA 3M30B 2RF2A 4DQIA 1JWWA 1X9MA 4M63A 3RR8A 1M1HA 2LDYA 1CQNA 5C5JA 1DJ0A 3VWSA 3D3CJ 3AB4B 1G2EA 2LFVA 5GAHU 3C6UB 1HQEA 3IWXA 4AL5A 1SJ4P 3HI9A 4Y2KA 4RL1A 2FJWA 2DXFA 2OELA 2CG4A 1XN9A 2YY3A 1R3NA 4KPYA 4XIUA 1SVDA 3VV2B 2G0IA 3BKUA 1UETA 3WX8A 4J9UE 2CQ1A 1S5ZA 2FY8A 3FCHA 2VZ9A 4USJC 1OYDA 3N6NA 2XNRA 4LRFA 4QWDA 1RBLA 3G9CA 4MTPA 4K4YA 2VQEF 1FJGJ 3UDEA 4TLQA 1N36F 4ZP7A 3B8HA 1U8WA 2I1RA 4ANEA 5CYQA 4YR0A 4LQ9A 3H5XA 3MR5A 3EWGA 3HLUA 3PO4A 2I5JB 2B5JB 1QSYA 4KQZA 2OSRA 5C42A 4J90A 2QN6B 1EZZB 2FJDB 2W7OA 3MM5B 4J9QA 3IG1A 4LRAA 2EEYA 1UEKA 1AZSB 5AT1B 3IN5A 3ILLA 1GH8A 4Y6IA 9RUBA 4P2SA 4OYAA 4OMFG 4P9SA 1HBOA 2ZZNA 2YWEA 1SH3A 4M8LA 4NYPA 1VRUB 5ETNA 4X4RA 3FCWA 4W98A 2NPIA 2CDQA 1NO8A 3A13A 3MD1A 4BBYA 2N4DA 5D4LA 2DHGA 7FD1A 3AFGA 2EBEA 1XNQF 3OPKA 5B0AA 1F3FA 1F9FA 1VJWA 3SV3A 5DM7Q 3IMQJ 3HFKA 4ZN3A 4NRTA 2YXLA 4WWSA 3LAKA 4KJIA 2OGUA 5KT3A 1L5UA 3TVKA 2RRAA 3CJ0A 4CLZA 5EWGA 5HVHA 3I96A 5E2QA 1Q4RA 2FHJD 2YPYA 1QUPA 5E7OB 5JUMA 4F04B 1RJJA 2MGZB 2XYHB 1KWMA 2R2TA 4F4ZA 2NUUG 4X66F 2R3VA 4WFAQ 1IWGA 4PUOA 2F8EX 1KQSR 3HKZD 2MQQA 1ZM3A 2V63A 3W61A 3WC0A 5DZ6A 3OVSA 3T1HF 3W66A 3AOBA 2QSWA 2V2ZA 2VC0A 3BBFA 4OZNA 1C4AA 3C16B 3AD9C 4M5JA 2I8EA 3JB9k 3GCXP 3TX8A 1S9EB 2I6WA 3L3CA 1FJ7A 4ECVA 1XC9A 2J7WA 1EP4A 2UZAA 4ANDA 4K4XA 3N9UC 2CPZA 2DNQA 3QYYA 2G2ZA 2GQ2A 4CH1A 3Q23A 1C0UB 3AA8A 4UY8T 1GMUA 1VC6A 2FJXA 2HEKA 4JI7F 4MIBA 1RISA 3KLFB 4PAAA 4RW6B 3DRRB 4QBUA 2HMIA 4JI8J 1T95A 3BBBA 1ZYQA 2E1RA 4IYQA 3VHQA 3BO4A 4TXSA 3KTQA 2CXEA 2W4PA 5KG1A 2ZVIA 1GT8A 4EBDA 2AJ1A 4ZIVA 1NHKL 3KLEB 3PEJA 2PC6A 1S0NA 4E8UA 1T05B 3W7BA 1FKAF 3L7UA 1U8SA 4AYBD 5D0EA 3NCRA 2DJWA 5K9FA 4CCHA 1N48A 2RRNA 2FLPA 2VBZA 3KNGA 1A9NB 3KUHA 3QWPA 2R7QA 4F2RA 3BSAA 2MKCA 4F25A 3TRGA 3CGIA 4C11B 1HBUA 2B4PA 2XEXA 1HNVA 2P6SA 3P3DA 3QGGA 5KFMA 2KB2A 4AD6A 4DV7F 4DJBA 3VAJA 2W4DA 3GJRB 3HK2A 2DO0A 2RU3A 4M5KA 4DCPB 4USIA 5CH7B 1NSAA 1UJ6A 4MFBA 1OO0B 3Q8QB 1KLMA 4K5SA 1CEZA 2FLLA 1X4HA 3SYZA 3NOGA 3W1YC 4J9MA 2W4CA 1YDLA 2C22A 4MH8A 2YBVA 2XGQA 3UR3C 3KJVA 4G6VB 3M2VB 2W9BB 4FKYA 3HULA 3BGOP 4N77A 3UE2A 4RKUC 2OEMA 3HHLD 2HGNA 1QE1B 2W24A 5IV4A 4DR6F 3Q0AA 1BD6A 2V4RA 4ED1A 2CQ2A 3HSJA 2UV8G 5D3GA 1NSKL 1WI8A 1IKXA 4WP9A 3HFZB 2XHCA 1LXJA 1V9OA 1BMQB 3MAAA 2YX7A 1QDUB 4C8LA 1OWXA 3PYFA 4P75A 4DFMA 1JLBA 2FJEB 3IM8A 2CJKA 4DR2J 4L73A 4YHHF 1X9WA 2V8PA 2LQ8A 3DOLA 3K0JA 4AXJA 3R5JB 1WHYA 4B3OB 1RT1A 3R27A 2E5JA 2WVDA 3JSMA 3HZEA 4GRSA 5B0BA 3U1MA 4ANCA 1N52B 2MY8A 2CJAA 2GFFA 1UVMA 1V5VA 3OR2B 4NASA 3I0SA 1FJGF 1RTJB 3UCZP 2LQ9A 3P49B 2Z56B 5J1EB 1JLAB 4LR9A 4YB7A 2KM8B 1TFWA 2YH0A 3CNQP 1FERA 3K2YA 4IH6A 1WELA 4G3IA 1QVGR 1KNZA 1TMMA 3H90A 1IBMJ 2PFDA 4A8XA 3HHLA 2YKQA 2O01C 2HQCA 1VRQC 1O5JA 3G4SS 2CZ9A 1HHQA 2CG8A 2MY7A 4KAIA 2RQCA 4XDCA 4AQYJ 1D1UA 3NEKA 4N47A 1VS3A 4QWCA 4KC5A 3PR4A 2OO4A 3PX4A 2BM0A 2VIHA 1OQ6A 1AFIA 4B02A 2JNJA 3QRRA 2YPZA 2O67A 1U4BA 4C97A 5E3AA 2ZJPQ 2IBOA 4IRCA 2HW3A 1SQEA 1E6VA 1RWUA 3Q8YA 3LWLA 2YKOA 2N3LA 2OPRA 2CVEA 4IFVB 4QZVB 2XI3A 5I3PA 1Y0HA 3PRDA 3MAHA 3MAQA 2PDAA 3MI7X 3LP1B 3BGLA 1S6QB 2BRLA 2OP5A 3JTPA 4C7QA 3R1HA 3MR6A 2W2OP 3CDBA 3D68A 2KH9A 4F0MA 3ZZZA 1BQXA 2KTQA 2WHOA 2R8KA 2G1DA 4B9UA 3P96A 2X3DA 3PX6A 1HNWJ 5SZTA 3DC2A 2VONA 4CLYA 1IKWA 3CCJS 4URSA 4DOZA 3ZXWA 3SBMA 2HRYA 4ILMA 2VHGA 1XJWB 4G1QA 2C2ZB 2G2OA 1ZPVA 2Y0BB 5DETA 4CT9A 3QJPA 1KEKA 5IT0A 1R8PA 4M5DA 5E0OA 3BGRB 3EICA 5LMNJ 3ET6A 3C3LA 1Q81T 5HBMA 2RB7A 4I2QA 3MFHA 2ZOFA 5IQ6A 2LQJA 1X60A 3BV8A 3CD7A 1B3TA 2X1FA 2DYAA 1UAWA 3GILA 2VKZG 1GXTA 1N54B 1S6PB 5C7PA 3BO3A 3G82A 1T7PA 3D3BJ 2ZZTA 1NKBA 3MCNA 2KXNB 3HVRA 3KLIA 2PIIA 1RYRA 3EZ5A 3CB4A 2Y1RI 1PGZA 5KT7A 3TARA 1RBOB 1RT2A 1W2BR 1WG1A 3SQOP 2JEFA 4JI8F 2CQBA 1RACB 5IWAF 2QRRA 4XTTA 3NGKA 5BYQA 2CQPA 4PPZA 2MSSA 4GVBB 2ZUGA 2AGQA 2HNZB 3DRSB 4DPTA 4EYIB 2RKIB 3EPIA 1RYSA 2H5IB 4WCEQ 4A8FA 4FBUA 2MLZA 4YDXA 1JLQA 4IOBA 3K58A 5J2QA 2C2OB 5C25A 4LF4J 4I2PA 2AV5A 3GCWP 2NCKL 2ZH2A 4ZPVR 2UUBJ 5C24A 2V8VA 1S79A 3BO2A 4R0JA 2HHSA 3KJNB 3M8PA 3H5SA 2KRRA 3AA9A 3BS9A 3DGVA 3ZTQA 4CO1A 5HI7A 4JI0J 3RU0A 5C2CA 3T41A 1WC3A 2CIMA 2FVSA 2FIUA 4OZ1A 1N8RT 3L9ZA 1S76D 3THTA 3MEKA 3DMJA 4HHHA 4JUZA 4QU6A 2E1AA 2PMHA 1HQUA 3QJJA 1RA7A 2IM1A 2LEAA 2YNGB 4OLOA 1I1GA 4GO7X 2B0GA 1PBUA 1AROP 3UWTA 4LVOP 1N5YA 3GIRA 2EWHA 2PEBA 3MM8B 1Z2LA 4RNNA 4ECWA 3IGNA 4FBTA 3PCOB 2VFTA 9ATCB 1SQFA 3GV7B 1B7YB 2LXIA 3Q2TC 1Q7LB 3HDSA 2CPIA 2MXYA 3VALA 3VGUA 1T94A 4RUCA 5I42B 1I94J 4NZ7A 2FGOA 4JB8B 1VQSA 4GVLA 4DR2F 2L9NA 4RWXA 1KDNA 2O5DA 1NLKL 1CJUB 1ZS6A 2E44A 3PKYA 4F7VA 3O3LA 2XGPA 2J9DE 1TVRB 1RCXB 2KT2A 1N0VC 2H3EB 3TZWA 4QU7A 2LDIA 2QL7B 4P71A 4YB1P 3CJKA 4MKAA 1Z4UA 2JL9A 3V2UC 4BC9A 4QYZJ 3NCPA 2JWNA 1HYSB 2GVZB 2XMJA 3DKDA 3HVAA 4Z37A 2Y1LB 4WE1B 5DRKA 2QLJB 2E5LJ 1VBKA 2J6SA 3OFGA 4LUBA 2BX6A 1IBMF 5CYMA 3POTA 4NLPA 2AYBA 1R0AA 3I82A 1L3VA 4ER8A 4O3QA 5KFYA 3VQTA 4IG3A 4K4TA 4L3KA 3MWBA 4O4GB 1JLCB 2KFYA 4AQYF 1K1SA 2RF2B 2QLWA 1SQGA 2MEWA 5JXSA 2IIHA 3GIMA 2C2NA 4DZDA 4U8VA 4XPEA 4FYWB 3QQCD 1C0TA 4HDGA 5KFCA 5HMZA 5U47A 4JYAJ 1HQEB 4X62F 2HVIA 1NZ8A 1OPIA 1KHVA 1R89A 2FC8A 4CH7A 3D4JA 3MM6A 3KK1A 4C3LA 2PA3A 2GA7A 5DDOC 2VOOA 2R8HA 2H51B 1XBWA 1A6LA 2QLXA 4HEA9 2UUWA 2W2NP 4EU0A 4ATNA 1RADB 2E9TA 1UKUA 1RT4A 1IKYB 1MW7A 2M4MA 2GIRA 4G1PA 4Y2CA 1DQ8A 2ASDA 2EPIA 4P73A 1UA1A 4TN2A 4C8YA 5CHCB 5C42B 2FHKA 4MIAA 5DLGA 3VGVA 4YDDB 4DUYJ 3EMTA 2DR5A 3Q24A 4LF8J 2RNEA 2RSQA 3LP0B 3IR6B 5DM6Q 5LMNF 1TL1A 2J76E 3GYNA 4ED2A 1RHQB 2COLA 2CQDA 4DV2F 1F3VA 3EXYA 2ZWOA 4IQXA 1WOSA 1PO6A 3GG0A 1A7GE 2D3UA 4EO8A 3CJ3A 3OTBA 3EX7B 4OX6A 4OZ0A 2QL5B 3DXSX 4CNZA 1HMVA 1HWJA 1FFGB 2C2EA 4DV4F 4ZP6A 1KFDA 3NWGA 1HI0P 1WD6A 2CADA 2ACYA 4EYHB 3JTNA 2BE9B 2EI5A 3RYLA 1F2GA 1IJFB 1SL2A 2XWYA 1LOUA 1RHMB 3W63A 3DI6A 3SV4A 1CULB 5K14A 2DGWA 5ADZA 4QIVA 4IRDA 2ZWPA 3F56A 4OYOA 1EIYB 3DHWC 3VAGA 2HFUA 3LGMA 2GIQA 1Z1ZA 3W2VA 3B78A 2ZH7A 1RWMB 3IRWP 4WFZA 3LW5C 4ID5A 2MQ8A 2NSBA 2MQLA 5J2NB 7FDRA 2ZHOA 5HSPA 1FWLA 1VQ4S 3CMAS 1MMLA 2QTWA 2VB6A 3OFHA 1S99A 3G86A 1NPRA 1UW4A 4J5OA 2VD3A 1LWEA 4PUOB 2FD2A 2G0CA 1RUSA 1U49A 4FYXB 2QIFA 2CPDA 2D3ZA 2DGTA 4IR1A 3JSBA 3MEDA 3M6UA 2UUBF 4PG7A 3OL9A 1AUDA 3W2WA 1QAYA 4V19J 3TOQA 2DGUA 3OR1B 4YQWA 4WFNQ 2ZH4A 1EP4B 5EDWA 5KFAA 4JI0F 3JS9A 2XHWA 1T03B 4J9KA 4IH7A 4U6PA 2CDRB 4KTQA 1ITPA 2EFQA 1AXQA 1W26A 2UUCF 3GE9A 3F41A 3BSOA 1EHWA 1RKIA 4ECTA 1VMBA 1RA6A 2GMJA 3JTOA 2HMIB 4J9LA 3VGSA 2FJAB 3K5OA 2G9OA 3IP0A 4HACA 3CCZA 4B9VA 2ALYB 2H4YB 4CLUA 3KLVA 2JHEA 4LJMA 5DS7A 1FCAA 1M5KC 2JC1A 3ZFVA 3P8BB 1RU1A 5ETKA 1NAQA 4UZCA 1JMTA 2Y3YA 3FSXA 1I94F 4NRUA 2HBQB 1LW0A 3RR7A 3QGPA 4LR8A 1NH8A 5E5NA 5KG0A 3MMCA 4LSNA 1SI9A 2PMWA 1R0BG 3I87A 2Z2ZA 3HVWA 3K5LA 4HH0A 4HLBA 3MMBB 1BC6A 1RLDA 2HWTA 1HNVB 4B08A 1FFSB 2W7AA 1NHVA 2RVJA 5A8RA 2ATLA 2AF6A 1RTHA 2VFUA 1NJZA 2B4OA 2E66A 2GGPA 2ZH3A 3JSRA 4MFBB 4CLFA 4DWIA 1KLMB 5AE3A 2VPWB 2DT9A 2E1MC 1V3SA 5AE2A 2E5LF 4LRCA 1U1MA 2H4WB 5HLFB 1N32F 3AD7C 3OL8A 1JNZB 5KFXA 3MCSA 1QM9A 2D9OA 4OJHA 4K50A 3ZZTA 1NPKA 5KT2A 3NXZA 2N7CA 1SV5A 4UY85 4CT8A 2ZC4A 5EGYA 2IY5B 1LQ9A 5L38A 3Q22A 4PWDA 3DDKA 5D3GB 1IKXB 1GMVA 4JV1A 1J5OB 1KC8T 4JYAF 4M5NA 4PEOA 1XR7A 3HCXA 4DX6A 4ELUA 4DSEA 2AEJA 2BJ8A 3DOLB 5A76A 2HNDA 1EB0A 4JI2J 3HHKA 1JIHA 2RIJA 2XQCA 4LF5J 2C28A 4DCJB 5F8GA 4NCAA 2R4FA 2ZM6F 2VPZB 4LSLA 3UCUP 1F5BA 2HNYA 3SMZA 2PO4A 3OSPA 3UDLA 2Z2YB 4WKRA 4X4UA 4KFBA 4WYLA 2HK2A 2AYGA 3DCAA 1FESA 5HP1A 1FJCA 4YB6A 1L3KA 4ETXA 4DPXA 2RDIA 1LEOA 2MZQA 2WVEA 1VQ7S 2W9CA 1LK7A 2XMAA 1UVJA 4DUYF 4K7QA 3HHLB 1H7XA 2MKHA 3DLGA 3KHRA 3CJRA 4OL8A 1H72C 4MJKA 4WKYA 1KQGB 4LF9J 1GTEA 2AW0A 3T5HA 3VR1A 1TKTB 3H2LA 2XMTA 2MZSA 3TX0A 2K3IA 1MSWD 1MN9A 2AT1B 1WKJA 4UT4A 3HP6A 3N0VA 2XCAA 2KFNA 1T9TA 2CRLA 1RT6A 4ED3A 3THVA 5FLXU 1E6VB 1FTCA 1XR5A 4ILRA 3H98A 3EUNA 2OPRB 2YNFB 4NLDA 5KFZA 2BANA 1WUUA 4TQRA 4X4VA 2WAQD 5KFSA 3N5FA 5AXMA 2F63A 2I0XA 5DGAA 2YNIA 4Q2LA 3PNIA 2PGCA 3ZTSA 3OTOJ 3DOKA 3B82A 3DU5A 3BDPA 4DFKA 3HSDA 1VIOA 2UUAJ 3AOAA 3BH6B 8RUCA 3DLJA 1RDRA 3D0HE 1MLAA 3UO0A 3QBCA 4DPUA 3EYZA 2IRUA 1IKWB 1R43A 2HHUA 5J1NA 3HHEA 4ITSA 1X9SA 2F8HA 4QR1A 3RW7A 1IBCB 4G1QB 3DLLQ 2ZC3A 2B9EA 4QW8A 1XMQF 3L95X 2ZE2A 2FZGB 2D1CA 3MM5A 2Z0GA 4X64F 3EGWB 2GO9A 4M5DB 4GKKJ 2F65A 3PM9A 3ET6B 4CLTA 3NGSA 3S1TA 5KG6A 1IUJA 2HFOA 3OXGA 5DG8A 4LSZB 2QLFB 4J7CA 4G1IA 1FKOA 3MCMA 2XY6A 4NMXA 4WU2A 5DZ7A 4K4UA 2MDAA 4DX5A 5F9LA 1U1NA 4DX7A 5BYRA 4C3KA 3WHIA 2LA4A 1M0SA 1URNA 2R7OA 1X5OA 5BR8J 4EZ6A 1NJWA 3TEHB 2LXFA 2ZVSA 5CZXA 1TK5A 4LIWA 4NA2A 4OI1A 1YJWS 2Y8YA 1JXVA 1NK7A 4DR1J 2QEXS 1IR1A 4K5RA 3C15A 2YWWA 2W01A 1RT2B 4KBIA 3MTKA 3M9OB 2L08A 2DHSA 1LW2A 3J7ZT 2CZ4A 1ZM9A 3TANA 5A6WA 2J6UA 3TAMA 1XNRJ 3ZO7A 1WC4A 2HQIA 4PR6A 3RAQA 5AJ3J 3R2DJ 3RJMB 2MGZA 5H9EK 1UWBB 2E1CA 5GADI 5GAGI 3F0NA 4HVZA 2ALZA 4GC7A 1N4LA 1HWKA 2DNHA 3MOJB 3MCOA 3K7RA 3QAUA 3WIVA 3ILOA 1JLQB 5D0RA 3OFFA 5J2QB 2DIUA 4ECYA 1N88A 5C25B 3C16A 4CO5A 2OPPA 4CO2A 2CPHA 2XB2D 4DSJA 1S9EA 4Q45A 2WK4A 2GS8A 4E98A 4L72B 1U47A 3CDEA 2ZBPA 3M8PB 5M2PA 3PYDA 1Q0NA 3C19A 2A6MA 2LVWA 3PRBA 4DR4J 2ZHAA 4LBIA 1KD1T 2W9AA 1Q53A 3AY0A 2IAJA 3DMJB 1HQUB 5F3TA 2BJ7A 1PC4A 4YP3A 1VBZA 3OV7A 3CD5A 2IA6A 1FXDA 4DPOA 2WW4A 2WVCA 2AGPA 2BE7D 3AAWB 1ZTWA 4PYDA 2HK3A 1YJ7A 4LF2A 4H4KA 3ISNC 3H4DA 1KLNA 1K1QA 3MECB 4CLLA 2EFVA 2CYYA 3QT6A 1FDAA 3ZZPA 3G8TA 3KG0A 3C8YA 3SFGA 1YZ6A 1GX5A 3QSYB 2EC2A 1T05A 1KVIA 2R7VA 3OL7A 2IMWP 3NY0A 4Z2XA 4F3QA 4C8NA 2B7BB 3I31A 3S8SA 3D28A 1HNZJ 3PHTA 4M5LA 2LQBA 2GMLA 2Q6CA 3X1LB 2HLTA 2DY9A 3KLHA 4LT6A 1E6YB 1PJ6A 3DYAA 1SC3B 5JVGQ 1LWFB 5HAOA 2B9XA 4DV6F 2EC0A 3I4PA 3FRYA 4O3SA 2MQOA 1WWHA 3CC4S 3KK3A 3TYTA 2PSZA 4JI6J 2QC3A 1TAUA 4KY3A 2NPFA 2W7PA 4Q5VA 3JXOA 3IFEA 3FFIA 3NGDA 5LL6d 3UN5A 3N01A 4NEZA 2PMZD 4R25A 5DLFA 4ED4A 3QZ8A 5T14A 2V0NA 3TNVA 4DL7A 5B7WA 1X5SA 2RDJA 3PW2A 3M9MB 4ETZA 2HQFA 1NB2A 2EFNA 5CYMB 2VG7A 1U45A 3POTB 1R27B 4NXNF 4F4XA 2W9BA 1WHVA 2V94A 2HBYB 2W2PP 3EDQB 2O3DA 2YQ0A 3W9IA 1IVZA 4IG3B 1X5TA 1RTIA 3IAS9 4RW8A 1QE1A 1JNRB 1FD2A 1U48A 1BXNA 3RGIA 1WJ9A 1K47A 5A2QU 4WF9Q 2KJWA 1HR0F 1TKZB 2B56A 1S1XA 3MUVP 4WYWA 1PG5B 2QSFA 3QIDA 4ENOA 4DCOB 1NEEA 4CO3A 3SCIE 2G0JA 3T1YJ 1YLXA 4F67A 2ZUAA 3MM6B 2DNLA 3KK1B 2P8IA 2FHMA 2IDLA 2BRKA 3H5YA 2CQ3A 2D74B 1MWQA 4F4WA 2ZFHA 2IM3A 2HZVA 1Y3JA 3CCUS 2R8IA 4PCQA 4USWA 1HA1A 4FVMA 1HD1A 2YWGA 4F4KA 6FD1A 1Q8KA 3SCKE 4DXLA 5DQIA 2VJUA 4YFUA 2WSCC 1YBUA 2LA6A 2KKHA 1JB0C 4DG1B 1K9MT 2WB4A 2BW7A 2XBPA 3RRKA 2NUHA 5HQLA 4ECRA 4PWUA 4X4QA 3R6LB 4GMKA 3S01A 2CNNB 2AJFE 2HS3A 2LEBA 2BM1A 3ONQA 2HHPA 4I67A 1U7LA 1P1TA 2M5YA 1FVQA 2EFOA 4DEZA 3LPYA 1M5VC 4W92B 2H5JB 4P52A 3DLKA 3E01A 1TL1B 4ZKAA 2M3DA 2R42A 3KJFB 3CC2S 4DU7A 5IC4B 1FX4A 1SH2A 2CJBA 4GO5X 2GAHC 3GSIA 2IRYA 3FBBA 2RUGA 3HPOA 1H98A 3QIPB 2AMCB 1IXKA 5HQ8A 4E0DA 4FF3A 1CPZA 2DNYA 1NHUA 4X4NA 4NLOA 3DU6A 5H9FJ 4OYPA 3MUMP 4IFVA 4I4BA 1EX8A 4RNFA 1IWAA 3BKTA 4P6QA 3LP1A 1O8BA 2B8QA 4DR1F 1S1TB 3DI6B 3I0RB 2XY7A 3A3NB 4B3MJ 5K14B 3TUIC 1ZAWA 3LAMA 3VAKA 2FYXA 4O3NA 2E5GA 2DEJA 2KT5A 5T7LA 3W2VB 5HMXA 5ETTA 4NMLA 2E5HA 2NZCA 2XO7A 7AT1B 2LU1A 4NXMF 3PIPQ 2M7SA 5SUHA 2MLXA 4RR5A 4OI4A 4G65A 1G4CA 2HHWA 2R2SA 5LSRA 5KFPA 4KGKA 2I38A 2OEKA 4FNIA 4WXOA 3FQLA 1S6UA 3M1VA 3HZGA 5F9NA 3FVYA 3QSIA 4XK8C 2E7VA 1MWYA 1RT5A 1Y00A 2IM0A 3OJSA 3CJ5A 4KE5A 2HAIA 2HWHA 1LWCA 4LR7A 3BYRA 4ED0A 2FGCA 1U09A 4KPCA 3MEDB 1OSCA 4JP8A 1JKHA 4KGMA 4U7CA 1S9FA 4WPAA 3PRVA 3W2WB 4NI2A 4WZMA 5LXRA 2CQ0A 2JX2A 2FLNA 5GADU 5GAGU 3M8YA 1S6PA 4DR4F 2A10A 2JLFA 1ZA1B 4CLPA 2DB1A 3F44A 4ZA1A 5HATA 3PIOQ 3QJLA 3T5JA 2HBRB 2J7UA 3ZNJ1 4DI6A 1R0CB 2MKIA 1VQPS 4NCGA 3NMRA 2GV1A 1RBAA 3SSQA 5I3QA 5FDLB 3R7NB 3RZAA 1EAYC 3R5GA 4HACB 2V9WA 2MPUA 2AWZA 1OS5A 3HXMA 4Q8FA 1I51B 2U1AA 3DM2A 3RBDA 2HNZA 3D6FB 2POKA 1NK8A 4N8NA 3TZZA 4A8SA 1QSSA 1LW0B 4YR3A 2W8KA 1XMOJ 1HNZF 2PA8D 5ETOA 2V8GA 1KTVA 2JEJA 3MMCB 4LSNB 1ZETA 2Q6BA 3CPWR 1AFJA 4HL9A 3Q8SB 3V4IB 2DR9A 5KAKA 1X4DA 3KK2B 1SKRA 2DO4A 2VFVA 1G3OA 3BR8A 2VQFF 4JI6F 3IBCB 1RTHB 3GR0A 2AEMA 2P5VA 2GGPB 5CAAA 2WTFA 3S7RA 3I5BA 4F26A 3CDUA 4QIFA 4D3HA 3N6LA 2X1GA 6AT1B 2WOMB 3KOAA 5B0CA 3AJDA 2E9ZA 5KFBA 5HMYA 1Y11A 4OI2A 4ID8A 2OH2A 3GB0A 2C2KB 4M5MA 1RI7A 4X4SA 2J7KA 3MM8A 3MPWA 2LLZA 4F0HA 5JVHQ 1M5SA 2CA9A 1SV5B 3DNCA 2IPOB 2C2MB 1OSDA 4PWDB 2OTJS 4JI1J 3NWRA 4FKXA 3AQOA 2QMXA 4KB7A 2F1FA 4ECUA 2BUNA 3CD6S 1TP7A 3F73A 3CSKA 1V3RA 2CKWA 1B4SA 4ILLA 3I32A 1WACA 2RU9A 3CE8A 3BYPA 3QFWA 2J0QD 1RCOB 3OJUA 3T1YF 1J27A 3OW2R 8AT1B 1TVRA 2HNDB 5B08A 2MSTA 4W4MA 3KFWX 2HURA 1YVFA 1QAJA 2JJ4D 3TI0A 3FEYB 3GFYA 3R8YA 3AH6A 2DR8A 1OY8A 2H9ZA 4RWWA 2HIQA 2BJ1A 4MK8A 1OJ4A 3OXLA 4LSLB 1VQYA 2HNYB 3LALA 4RU9A 3VTIA 1VQ8S 2OPQB 3PJXA 4KFBB 3GU0A 2FZKB 3M4XA 2HVDA 5CA5A 4BDPA 5HP1B 4DR5J 1VQKS 3T19A 1TL4A 3V6HA 2ROPA 3R2CJ 1ULRA 3HT0A 2Y9HA 4KKOA 2NXUA 2W9CB 2CNOB 2IVFB 4FS2A 1Q7YT 3DLGB 3EVMA 2DXEA 2WBRA 4MT1A 1JJ4A 1WHXA 1JLCA 3OTEA 2R8JA 1KKHA 2HHHJ 4FPRA 3MGJA 3TEGA 2C3UA 1GNKA 4PXEA 5F8HA 2B3TB 2QGFB 5EN1A 2DGVA 1RTZA 2M70A 1RT6B 2RRBA 2FVPA 2ZH9A 3UQSA 1AUSL 1K0VA 1X4FA 1JK9B 4CM0A 2UVWA 5HANA 4X65J 3TVZA 4DV5F 3UDCA 2F4FA 3GTYX 4I0WA 3T1AA 4AXIA 3T3FA 2BANB 3ILJA 3BSCA 2OPSB 3PR5B 4B3MF 4ZP8A 3J81U 3NG8A 1YX2A 2YNIB 4RUAA 2QYCA 3DOKB 4CRJA 2YKNA 2F9JA 3HX9A 2X7IA 4OI6A 3UVJA 4O23A 2KG0A 2GO8A 1L3TA 1IKYA 4DLEA 3PHEA 4U67Q 3SXLA 4NLWA 2M9KA 1SC4B 5H1SV 2A2CA 3UD4P 1DLOA 1FKPB 4AE5A 4UW2A 2BJEA 4NLRA 2HQ3A 3Q86A 4ZVEA 1GXLA 2Q3PA 1GMWD 2KG1A 3PZPA 3HKWA 4U8YA 3UN2A 2ZE2B 1WEZA 4Z7YA 2BMBA 3CDWA 3LP0A 1D8ZA 2CFXA 2XZDB 5CD4H 1FE0A 3I4HX 2A1BA 2RQKA 3GYXB 4X84A 4L76A 2ASJA 1RXOB 4ECXA 1NDCA 3ISND 2MTLA 2BKNA 4H4OA 1CJKA 3KDNA 2XWXA 3QRPA 1FKOB 1ZM2A 3MXHP 5D8HB 1QTNB 1IN0A 5GMKa 5F8MA 2OJ3A 3I9V9 2DY1A 2R2UA 1U24A 1JJ2R 4Y2MA 2E1PA 1P9QC 2LYVA 5KFKA 1KFSA 2OMOA 3SQGA 2BOPA 3PJWA 3IBWA 1CULA 5KFNA 2BEFA 3C15B 1VQ9S 1NK6A 4DUZJ 3IM9A 2JZ5A 4AL6A 8ATCB 1XTZA 3CT9A 4NLVA 1LW2B 4XDDA 1JLGA 3TAMB 2R7UA 2QZ8A 1LNQA 1M1GA 3PXGa 2PE8A 1J5EJ 5C2GA 4PG6A 5J2NA 5KFGA 1Q8IA 1N34J 1V3ZA 2KVIA 3WZ0A 1U1PA 1GMWA 4ICLB 2XULA 1Q82T 4DN9A 5G0RA 1M1KT 1JLEB 2B9YA 1PAUB 2AU0A 2GHWA 1EARA 5E33A 3TUZC 3MEEA 3BN7A 2XG8A 1HWIA 1XMOF 4RBTA 3MF5A 2R7WA 4DL6A 2VA2A 1S77D 4YY3F 3QMQA 4YN3B 2WONB 3U27A 4USKA 3EE3A 1U1RA 1TFYA 3HT3A 4EUVA 4OV6A 2OPPB 1TUGB 1BY9A 3DOMA 3THPA 4QIGA 3RTVA
chains in the Genus database with same CATH topology
1DRZA 4U6PA 3ZZ0A 1AW0A 3DLEB 3TO8A 2WONA 1KRPA 4KTQA 4TU8A 4DR7F 2EFQA 1AXQA 2F7VA 5E3CA 2UUCF 3OR1A 3VZIA 3GE9A 3F41A 3BSOA 3MEGB 1D9AA 1FRJA 1RT3A 3NBPB 4KHMA 2V4QA 1C1BB 1K0TA 5DGBA 1RKIA 4ECTA 2XSJB 1B0TA 4A8KA 1VMBA 3JYTA 3BQ1A 4OHYA 1RA6A 2GMJA 4JV2A 3JTOA 2JVRA 5EWEA 2I9SA 3DRSA 2QA1A 1YITS 4O4RA 1VC0A 2RKIA 2HMIB 4J9LA 1T03A 2IAJB 3J81Y 2RD5C 3DFEA 4DS4A 1L3SA 2FJAB 2N7YA 3RB4A 2P9GA 3K5OA 2G9OA 3K5MA 3IXQA 3CCZA 3ZZUA 2ZH1A 4B9VA 3HVTB 3DLEA 3P5TL 3V6DB 2FJVA 3FDSA 3OHBA 3H2VE 4TY8B 2X3GA 4C0HA 3KLVA 1Y5NB 2BABA 3MMAB 5E3PA 3IGVA 4DFPA 3MEGA 1RTDB 4K2XA 5ITHA 1UFLA 4QPXA 4IFYB 4WFYA 1FRXA 2JHEA 3QGIA 5AXNA 2XSJA 1U6ZA 4LJMA 2NSCA 3PFEA 3FSIA 5DS7A 1FCAA 3BSNA 2R8GA 1M5KC 3WC2A 2JC1A 4C9DA 1N33F 4BC7A 3ZFVA 3A1YG 4ZPDA 1WEYA 4NLYA 5D78A 2B6AA 4Y0FA 4IUFA 3ISZA 2ZD1B 4ZHRB 4B3TF 4DR3F 3K57A 4OJGA 2MZTA 5CCMA 3KHHA 4DF4A 2FC9A 5DG9A 1Y7PA 2XLKA 1NAQA 2FHJA 2VC1A 4FXDA 1JMTA 2XS2A 1I94F 3FSXA 2IVMA 3JSYA 4NRUA 3V6JA 1LW0A 4KV8B 3V6DA 3LUYA 4NPOA 4TY8A 1KQKA 4YOEA 3MMJA 4EEYA 3MMAA 2IVYA 2N82B 3RR7A 4PKDB 1RTDA 3QGPA 2HGMA 1NH8A 3NAIA 5E5NA 2P9CA 3M05A 4IQMA 2CPEA 1I6JA 3OBIA 2K7JA 5KG0A 4CH0S 4X4PA 3MMCA 2VA3A 4DS5A 4JI1F 4LSNA 3VAHA 1VQ6S 4RBVA 5A8RB 4K4SA 1SI9A 1IBLF 1RP5A 3HM9A 3I87A 1YI2S 1WTFA 3HVWA 3K5LA 2ZOGA 4HH0A 4J37A 1BLUA 1YGYA 1BWEA 2JFDA 1TK8A 1OPZA 4HLBA 3WX4A 2VPXB 3G6YA 5B09A 3J7Z5 3MMBB 1VRTB 1BC6A 1URRA 2HWTA 2RT3A 4MYTA 3KHGA 1HNVB 1DZ5A 2DRAA 1ZBTA 3Q8PB 4B08A 4R0EA 4UQTA 2W7AA 1DTQA 2BBEA 2YNGA 2OTLS 4N56A 4V19X 5KT4A 1NHVA 2M8HA 3OSNA 3TUJC 1H38A 2RVJA 5A8RA 3CDAA 2R7XA 2ATLA 5KOXA 1HBNB 2HFZA 4YUDA 3TA2A 3NMAA 3KLHB 1DQ9A 2AF6A 1RTHA 3FQKA 1KQFB 2VFUA 4YMEA 1NJZA 4B3SF 4OV1A 1NK4A 1QAIA 2B4OA 2CZVC 2E66A 2GGPA 2ZH3A 3DYAB 2RQMA 4MKBA 2FDNA 1UVKA 1Y5IB 3JSRA 2FTRA 4MFBB 4NL5A 3MMBA 5IFMA 1FTRA 1U2FA 4TYAA 4DWIA 1KLMB 2EK6A 2NLWA 2J0XA 1QLNA 1G1XA 2RS2A 3N79A 5AE3A 2VPWB 2DT9A 4HTJA 5L8RC 2E1MC 1V3SA 5AE2A 3B4DA 2DRBA 2E5LF 5EX3A 5I3UB 4WK3A 2LXUA 2QA4G 3ETOA 1HBNA 3C2PA 1U1MA 3KK3B 5HLFB 2QA2A 1HFEL 1N32F 2KO1A 5THWA 4RNOA 2NYIA 4JI2F 4DL2A 3OL8A 1JNZB 1YRUA 5F0WA 2KRBA 5KFXA 1KS2A 3MCSA 1QM9A 5A8KB 5IZHA 2VKRA 2D9OA 4C8KA 4OJHA 3FFIB 4K50A 1UJ5A 2HZCA 1P8GA 3ZZTA 1TL3B 2ASYA 4KO0B 3O1LA 5KT2A 5I42A 4LF5F 1UVLA 5K8OA 4K4VA 2QO3A 5GVQA 2W25A 1FXLA 1FNMA 2N7CA 1CSJA 4HI2A 1SV5A 1SH0A 3C6TB 4UY85 1FT8A 4CT8A 2ZC4A 4URQU 1N0UA 4DR5F 3MM7B 2CQ4A 5EGYA 5HLFA 1LQ9A 5L38A 2W8LA 4Q0BA 3Q22A 4PWDA 1SIZA 2HWIA 1NJIT 2CPJA 3KLGA 2DTJA 2ILZA 3FZBA 5MAOA 5A8KA 3ZZRA 3G8SA 2VG7B 1LFPA 3DDKA 2AYEA 4TKTA 4H4KC 5B0EA 5D3GB 4N76A 1IKXB 5LMUF 3FGVA 1IM4A 1TL3A 4RLEA 4EFAC 3DRPB 1B0VA 2HLUA 1Q1KA 4A47A 4JV1A 1J5OB 5KFVA 2GJIA 3CCRS 1P1LA 1KC8T 3CJ2A 2YQ3A 4WU3A 4FN5A 4JYAF 1RTIB 2ZZMA 3C6TA 1VQ5S 4RW8B 2MQMA 4TU9A 2RQ4A 3M32B 3I6PA 2QA4S 3RRHA 2BQ3A 1XR7A 3DHXA 4ELUA 2C42A 4WXWA 4XPCA 1X8DA 4DSEA 3V4MA 1FRIA 3LF0A 1TV6A 2DNNA 1WNEA 5AE1A 3MR2A 3DOLB 1RQ0A 1IBKF 3VZHA 1N5VA 1HNIB 1BGXT 2HNDA 3PEHA 1R6YA 3DRPA 3HHKA 3M6WA 1JIHA 2DNRA 1J5OA 3V6KA 1ZM4A 2RIJA 2HHTA 1HYSA 4ELTA 1S1XB 3O44A 4NLTA 4P7VA 5KFTA 4ECZA 4B3RF 1NU4A 2VOPA 3US5A 5LT5A 2C28A 2VL1A 3ZZOA 4EGLA 5F8GA 4WE1A 4NCAA 1J2VA 1N5QA 2BW2A 4NYOA 3AJ1A 1WTBA 2UVVA 1O0PA 1SUQB 4LF9F 4KHPF 3AJ2A 4O44B 3LP2A 1JXEA 2R4FA 3FNNA 1FDNA 2ZM6F 3VAFA 2XSFA 1FXRA 2VPZB 4UUWA 4LSLA 3UCUP 4C0BA 3EGZA 1B64A 4DV0F 1F5BA 1PC5A 2HNYA 3SMZA 2PO4A 4JOUA 3OSPA 3UDLA 2R7SA 1C1CB 2NS1B 1SJ3P 1VQOS 4JV5F 3PW0A 4WKRA 4X4UA 1FRHA 1YRTA 2MMYA 4QIEA 4KFBA 1H0HB 4DV3F 4MYUA 4WYLA 2YKPA 1TKXA 4OIXA 2ZDPA 5A8WA 4Y2AA 2AYGA 3HO1A 4CQ1A 2YKMA 3FJ2A 3DCAA 4OI0A 1QY7A 1FESA 5HP1A 1HWLA 4Q43A 3MPVA 1FJCA 4YB6A 4O4GA 1LKZA 1L3KA 4IH5A 4ETXA 1O51A 2XCPA 4DX8H 2FVRA 2JEGA 2Z2MA 1CG2A 2RDIA 4EBCA 2YWFA 3TAQA 2MZQA 3M30B 2RF2A 4DQIA 3IO1A 2W9CA 1LK7A 1VQ7S 2LCWA 1JWWA 1MU2B 4YR2A 1UVJA 1X9MA 4M63A 4DUYF 3RR8A 3MR3A 3HHLB 1H7XA 2LDYA 1CQNA 2MKHA 1DJ0A 2OFGX 3DLGA 1R7IA 4Y28C 3VWSA 5C5JA 3KHRA 1W2IA 4F8RA 3AB4B 5IS2A 1G2EA 3G96A 4RW7A 3UNGC 5GAHU 4OL8A 3C6UB 3E2EA 1HQEA 1QJHA 3IWXA 4MJKA 4WKYA 4DSLA 4AL5A 1SJ4P 1KQGB 3HI9A 4Y2KA 1EETB 3OTOF 2FJWA 1DFDA 2CG4A 2GQCA 3IS9A 1GTEA 2AW0A 5K8MA 3T5HA 3VR1A 5J2PA 1DHMA 1TKTB 1XN9A 2YY3A 3H2LA 2B43A 2XMTA 3OXFA 2MZSA 1FNXH 2UUAF 1R3NA 4KPYA 4XIUA 5EUHA 2K3IA 2ZH8A 1MSWD 1WG5A 4BS2A 1C2PA 5KFJA 3HP6A 2VBXA 3N0VA 1UETA 3PKMA 2XCAA 2KFNA 1X0FA 2WW8A 5CYQB 1DTTB 4J9PA 5L1LA 2CRLA 5EX0A 1VC5A 1RT6A 3DLKB 4ED3A 1KOHA 3THVA 2CQ1A 3FCHA 2VZ9A 4USJC 3E01B 3N6MA 3N6NA 2XNRA 3VF0B 4QWDA 1EETA 5KG4A 2L48A 4NZ0A 4DL3A 5F8JA 1BQMA 1VK8A 1TKTA 3G9CA 3R5AA 1E6VB 4Y2IA 4MTPA 1FTCA 1XR5A 2VQEF 4ILRA 4K4YA