1A9NB

Crystal structure of the spliceosomal u2b''-u2a' protein complex bound to a fragment of u2 small nuclear rna
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
94
structure length
94
Chain Sequence
IRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the spliceosomal U2B"-U2A' protein complex bound to a fragment of U2 small nuclear RNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
molecule keywords RNA (5'-R(*CP*CP*UP*GP*GP*UP*AP*UP*UP*GP*CP*AP*GP*UP*AP*CP*C
total genus 25
structure length 94
sequence length 94
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1a9nB00
3THTA 2LA4A 3U1MA 2CPFA 3S7RA 1YTYA 1M5KC 3NS6A 2MZSA 2M7SA 2QFJA 1U1RA 3BS9A 1FO1A 3HI9A 4QU7A 1L3KA 2M4MA 5DM7Q 2KRBA 2MY7A 3MD3A 2QA4S 1HD1A 2LXUA 5IFMA 5DETA 3MD1A 3Q2TC 2QEXS 3VAMA 3CMES 2DNZA 1M1KT 4YOEA 3UWTA 2NZ4A 2KVIA 2KG1A 2EK6A 1WEYA 5GAHU 1HA1A 1VQ9S 1WHVA 3I55S 1ZH5A 1VBXA 1W2BR 4A8XA 3PIPQ 5GADU 3VAIA 2FC9A 4IOCQ 3UCUP 1WG5A 5HL7Q 2KXHA 4BS2A 2MZ1A 4CIOA 1F9FA 2DGXA 2O3DA 4WIIA 3TP2A 2LEBA 1M5OC 4FXWA 3R1HA 2F3JA 4W90B 3SMZA 1PGZA 1VC5A 2HVZA 3MI7X 2D9OA 3P49B 1Q86T 1SJFA 1OO0B 3DXBA 3CCMS 1WHWA 1VQOS 1JJHA 1X4HA 3EGZA 2DH8A 2DNGA 2CQDA 4OZ0A 1X5SA 2DB1A 2DITA 2KN4A 1WWHA 2MJUA 1WELA 2KRRA 2AYMA 2DO4A 2K3KA 1WEXA 2CQ1A 3FEYB 1JMTA 1VQNS 3CCUS 1N8RT 4TLQA 5DDRC 1BY9A 1WF1A 2KXFA 2MSSA 1VBZA 3PIOQ 2ERRA 1S72S 2RU3A 1M5PC 2OTJS 1VQKS 1NU4A 1U1OA 4UY8T 2AD9A 3G4SS 2HGLA 5LXRA 1OPIA 2LQ5A 5JVGQ 2DNPA 2RRAA 3CUNA 2XB2D 3S01A 2VODA 1X4EA 2K8GA 4CQ1A 2DNOA 2MZQA 3MUMP 4P6QA 1UAWA 2CPYA 2OSRA 2JVRA 3MUVP 2LCWA 1KD1T 3SDEB 4TU9A 2MHNA 1N54B 2XS7A 5HO4A 1ZZNA 3P3DA 2RS8A 1VQ4S 1X0FA 2G4BA 5LXYA 2CQIA 2AYBA 2E5GA 5BJRA 1Q81T 2WBRA 2FHOB 4M5DB 5CYJA 2MYFA 2CPJA 3BO3A 1X4BA 2MZTA 2CQGA 1YITS 3CC7S 1YJWS 2BZ2A 1UP1A 2CPHA 3S6EA 3ZZZA 1SJRA 2EK1A 4EGLA 3UE2A 1FXLA 3S8SA 1FJCA 2KFYA 3VAFA 1X4AA 2U2FA 3ZZYA 2L41A 3R27A 2E44A 1X5OA 2DK2A 2M0GB 3CF5Q 1B7FA 2KHCA 2RNEA 3VAKA 1YIJS 2RQ4A 2EVZA 2OSQA 1D8ZA 2MQMA 2MGZB 1X4GA 1X5PA 2MZRA 1VQLS 2N3OA 3IRWP 3P5TL 3BO4A 5EN1A 2MPUA 1H2UX 2DGQA 2CQ0A 2CJKA 3D2WA 2KYXA 5DM6Q 3R1LA 2DGUA 2I38A 1UW4A 2DNRA 2MMYA 1U1MA 2E5IA 1JJ2R 1U6BA 4Z2XA 2M52A 2LA6A 2PE8A 2HZCA 3K0JA 3VALA 1QVGR 4WFNQ 1WG1A 5DDPC 2CPIA 4FXVA 3CCRS 1U1QA 2DH9A 2MQPA 1Q82T 4Y00A 3CCJS 2I2YA 2OJ3A 1DBDA 3NNHA 1P27B 2JRSA 2DNNA 4WFBQ 1AUDA 2MQOA 3L3CA 3P6YC 4LMZA 3TYTA 2M70A 2F9JA 1SJ4P 3CC4S 4TU7A 4TU8A 2MKIA 1DHMA 1U2FA 2MKHA 2KI2A 3CCLS 1U1NA 2MKKA 5GMKa 1H6KX 2VONA 1WEZA 3LQVA 2CPXA 3MXHP 2RT3A 1M5VC 4WKRA 4WF9Q 4QU6A 3IWNC 5DDQC 2MJNA 3CULA 1A7GE 2LECA 2CPEA 2M88A 2CQHA 2MKJA 3G9CA 3NMRA 2MXYA 5IQQA 3N9UC 2ZJPQ 3RW6A 1YJNS 2RQCA 1O0PA 2M2BA 2DIVA 1X4CA 2JX2A 4V19X 2L08A 2LMIA 1YJ9S 1OWXA 2MGZA 2JWNA 2N7CA 1K9MT 2RUGA 4U67Q 5D78A 1QM9A 2DNHA 3VAGA 3OW2R 2M9KA 2RS2A 5DDOC 2FPHX 1YI2S 5JVHQ 2N82B 4ED5A 2YH1A 2YH0A 4PR6A 4LIRA 2MY8A 3J7ZT 2FY1A 2YWKA 4IUFA 1DRZA 2L9WA 3RW7A 3G8SA 2MQLA 1D9AA 1R8HA 2N3LA 2DO0A 2RRBA 5CA5A 1A9NB 5LJ5Y 2YTCA 1G2EA 1VQMS 5FJ4A 2DIUA 3U1LA 2DGSA 2XNRA 2AYGA 2KH9A 3THPA 4PRFA 2MSTA 3I56S 3MDFA 2VOOA 1N52B 4W92B 2DHAA 2DNKA 3UD4P 2UP1A 3CD6S 3H2UB 3SDEA 4WCEQ 4ZKAA 1VQ7S 2XS5A 4LJMA 3CCQS 1VQ8S 3B4MA 2ZJQQ 1YWXA 2LXIA 1FHTA 1RKJA 2CQCA 3TO8A 2E5JA 5MLCV 5LSOA 1VQPS 5D77A 4F02A 2KU7A 2DNYA 2KT5A 2CPDA 3UCZP 2A3JA 1U1PA 1XN9A 2X1GA 3VAHA 3SXLA 3MURP 1K8AT 3DLLQ 2LEAA 4WFAQ 3G96A 2E5HA 2G1DA 3NNAA 3CPWR 1PO6A 2U1AA 4PKDB 1SXLA 1WF2A 3CTRA 2AYEA 2DNLA 3MOJB 2KM8C 2DHXA 4J5OA 4F26A 1U1KA 3G71S 2GHPA 2V94A 4UQTA 1WI8A 1JJ4A 3EX7B 1QVFR 1WG4A 2LYVA 2YKAA 1RK8A 1KOHA 3CC2S 2CQPA 1HL6A 1SJ3P 1WF0A 2OTLS 3ULHA 2FC8A 4QPTA 1DZ5A 2XS2A 3BEGB 2ZJRQ 2DNQA 5GAEU 2MQNA 4CH0S 2MQQA 2MKSA 3G8TA 3MUTP 3CCSS 1WTBA 2X1BA 2GO9A 1VBYA 4YB1P 4C4WA 2HGNA 5GVQA 5IM0A 1WHXA 1U1LA 1YHQS 5LSLA 1P1TA 2DGWA 5IM0B 3NNCA 3Q2SC 1H2VZ 1Q7YT 1WHYA 5ITHA 3BO2A 5H1SV 2DH7A 2DGTA 1FNXH 1FT8A 2NLWA 1S79A 2B0GA 3CCES 2D9PA 3NS5A 2RVJA 1U6FA 2J76E 1X5TA 5LJ3Y 3H2VE 2HYIB 2VOPA 1URNA 1KQSR 2ADCA 1CVJA 2F9DA 3B4DA 4C0OC 4RU2A 4OZ1A 1ZZFA 2DHSA 2J0QD 3CMAS 3UD3P 1VQ6S 3G6ES 1X4FA 2CPZA 4IO9Q 2KM8B 3EGNA 3LPYA 3UCGA 2X1AA 2MKCA 3VAJA 1FJEB 1FJ7A 2DHGA 2KXNB 1M90T 2DISA 1N88A 2CQ4A 2DNMA 1VC6A 2DGOA 3VF0B 2BOPA 2MB0B 1SJQA 2DGVA 2CQBA 4F25A 1WI6A 2G0CA 3HHNB 2LKZA 3US5A 2J0SD 2KG0A 4ERDA 1K73T 4C7QA 3CXCR 1KC8T 2X1FA 2SXLA 2CQ3A 4IOAQ 1IQTA 1UFWA 2MZJA 4CH1A 2XNQA 1X4DA 1OIAA 3V4MA 1NJIT 2D3OR 5GAGU 3J7YU 4YUDA 2PEHA 1KOOA 3CCVS 4QQBA 1R8PA 1VQ5S 4Y0FA 2OIHA 2J8AA 2ADBA 2M8DB 2M8HA 5CXTA 2HGMA 2JVOA 1HD0A 2CQ2A 1NO8A 3FEXB 3JB9k 1VC0A 2XSFA 2Q79A 1H2TZ
chains in the Genus database with same CATH superfamily
4G1PA 3THTA 2CVIA 1AZSB 2VBYA 2LA4A 2WK4A 3K7RA 2O5DA 2CPFA 1R43A 1XR5A 3DM2A 5LSRA 3OJUA 4LFBF 2HHWA 1JXVA 1UPMB 4C11A 1YTYA 2RJZA 1RT2A 3C15B 4KYZA 2J9EA 2C22A 2I5JB 2NPIA 1RZMA 2MZSA 1C4CA 2ATLA 1S99A 1UL3A 4LR7A 1KQFB 4UY85 3CNQP 3NGRA 2UXCF 4IOBA 2JFDA 1Z2LA 2LVWA 5T7LB 3M6UA 1OY8A 2VUGA 1HMVA 3T1HJ 1L3KA 1VOMA 2IAJB 2OPPB 2F8HA 4EBEA 2KHDA 4B3SJ 1E6VA 3OT9A 3J7A1 2PI5A 3WC2A 3DLGA 3MGJA 4ED2A 2RMLA 4G6VB 2XM3A 4I7FA 3KK3A 1T02A 2D3UA 3NS7B 2EWHA 1CPZA 3MD1A 3R6LB 5E7OB 1S1WA 2QA1A 3VAMA 3Q2TC 4NLQA 2CADA 1RWOB 5FIIA 3VCDA 4FYDA 1HNVA 3GCXP 3Q8YA 4A8OA 2HNDA 2V2ZA 3ADAC 1M1KT 4MH8A 2G2ZA 4C3MA 1NBEB 2BQUA 1T9YA 5HI7A 4K59A 3PHEA 3VZHA 4FDFA 3GYNA 4HVZA 2ZM6J 3W5ZA 1HA1A 3I0RA 2UXBJ 4KGVB 4ENOA 1WHVA 2ZZTA 5KFKA 4YR2A 3AQOA 3BGRA 5C24B 1ZH5A 2HAIA 3AD7C 1C1CA 3KG1A 4BC7A 3W8PA 2C2OB 1YJUA 4URQU 1ZAXA 3WIVA 4KR0B 2VC1A 1FE4A 3VAIA 3TX8A 3UCUP 1WG5A 4OI3A 5KG6A 3DRXA 2NUHA 2LEBA 4WIIA 4LF2A 1RA6A 2FVQA 4N8OA 1SKRA 2HMIB 3ILIA 1N33J 3R1HA 2F3JA 4CLFA 2BE2A 2RF2A 4LRCA 4LF1A 3TVKA 3SMZA 1EIYB 2BRKA 4FF4A 4K4VA 1OYDA 1SJFA 1OO0B 4WZMA 2FVPA 3DXBA 1B99A 1OMSA 1S1TA 2D41A 3ISNC 5AT1B 3J7Z5 3CCMS 1FF2A 4CLWA 4ECSA 4DR2J 1KFSA 1CSJA 4WJBA 4ANCA 4LF6J 2BJ3A 4PG5A 2DNGA 4OZ0A 3DNCA 2XYGB 3KJQB 1S1VB 1ZETA 2WOMA 3DLJA 2DITA 2IRXA 3RBXA 1R6VA 1JLAA 1RTZA 2XWXA 3GR0A 4M94A 1UTAA 3AFGA 3CCTA 2J0WA 4EO8A 1S12A 8RUCA 2CJ9A 2V4JB 4ZVRB 3T1AA 3WIUA 5IS2A 3PW5A 2PI4A 5KFIA 5DDRC 5ETKA 2IRYA 5KT4A 4K7QA 1VBZA 3GV7B 2C3MA 2VPWB 1X60A 1FJ7A 2AF6A 4OYWA 1RWKB 2Y0BB 3GIRA 3H2LA 4QWBA 4G3IA 5A6PA 1Q95G 2IPOB 4CZCA 3N6NA 4X65J 1S72S 1CJKB 2MEWA 1VQKS 1MMNA 3K8VA 5LXRA 4MIAA 3D68A 5FLXY 5C5JA 2JC1A 5GAHI 4DG1B 3OR1A 5E41A 3DRSA 3V4IA 1MU2B 1H0HB 2XB2D 4LBHA 4LF5J 2E7VA 2XYHB 3AT1B 1X4EA 2IJNA 4RR5A 2VODA 3MUMP 2FYXA 2MZQA 4P6QA 2WVEA 4TY8A 2IM2A 2JVRA 2V68A 3M2UB 4NA2A 7FDRA 4DQSA 3SV3A 4Q8FA 2LCWA 3W5XA 1W26A 1H98A 3TQEA 1SJ1A 2BANA 2YX7A 4TU9A 5A8WB 5D3GA 4C0BA 2A0FB 2ZBQA 3BN7A 3DLKA 2LQJA 1WSRA 3P3DA 3QAUA 4NCAA 2COLA 1KHWA 4FF2A 4GKJJ 4DL6A 3UR3C 3I96A 3CJ3A 4ZCMA 1P9YA 1QUPA 3EGWB 1IKVA 2WBRA 5AXLA 4ZVUB 2FHOB 2FJAB 3IGVA 4F3OA 2BABA 2BJ7A 3MM7A 1HI8A 4KGKA 4B3TF 1RBLA 1YQHA 4XO0A 3C8YA 3MR5A 3A3OB 5CYJA 2AU0A 2MYFA 1MG7A 2KVQE 3WZ0A 2DYAA 5EWEA 1NDLA 5K8MA 1VYAA 1VK8A 2MZTA 4OQJA 4X4UA 4YY3J 5E3CA 4DUZJ 4EBDA 5KFLA 3PY8A 4UUWA 4A8WA 2WW8A 4OZLA 1HQ2A 2IAJA 1UW9A 2ILZA 2W01A 3GB0A 1S6OA 2VJUA 1HNWJ 4CNZA 2B4UA 1HHSA 3CO0P 1YKWA 4EI2A 3GJTB 2E44A 1X5OA 3S1TA 1B64A 1RWXB 2D7SA 1AUSL 3MCSA 1HYSB 3A3NB 2ZHBA 4NLSA 2R7XA 4P73A 1TK8A 4QIGA 1SKSA 2RNEA 5IC4B 5FD1A 1KVKA 1YIJS 2HQCA 1HYSA 4MFBB 2RILA 1J5OB 2UV8G 4RBUA 2MGZB 1ZM3A 1ZTWA 2MZRA 3CD0A 2OEJA 2V0NA 3DI6B 3JYTA 1G1XA 1KLMA 4U8VA 5I3PA 4CO3A 3H0PA 2RHSB 4JBCA 1GXTA 2MPUA 1H2UX 1ZAWA 2OPSB 2DGQA 3M6VA 4PXEA 4WIQA 4A46A 4Q8EA 3FFIA 3OTEA 5DM6Q 1IR0A 1JLFA 3PEJA 4LSZB 4ED6A 4A8MP 1S57A 1VRTB 2GAGC 5M2UA 3TAMA 5J2PB 2HHHJ 3PX6A 4Z2XA 2LA6A 4OI6A 4BDPA 4N76A 3IWLA 4TLRA 2HZCA 2ROPA 3BGUA 3DHWC 4WFNQ 2RKIB 3OSPA 2GQCA 3OL6A 1WC0A 1TKZA 1U1QA 4RW4B 1TKDA 1TL7A 3QIPA 4DR1J 5ETSA 4EK2A 1Q82T 4R5PB 1J5EF 1YGYA 4DEZA 3HMJG 2OJ3A 4DSIA 2HQGA 1K0TA 4ZIVA 4Y28C 3KLGB 3T1HF 3HT0A 3GYGA 2B9WA 4WFBQ 3L3CA 4LMZA 4DV5F 1TAUA 1YK9A 5IZHA 4RJVA 5EHHA 1SJ4P 3MOZA 4H4KC 3OL8A 1YZ7A 4J37A 1NAQA 3OFFA 1VR6A 4IH5A 4OYZA 3NGDA 1DHMA 5KFXA 2QIFA 2QT7A 2OP5A 4EYIB 2KI2A 2CWXA 4OHXA 4CLSA 3CCLS 5KFGA 1U1NA 1VCTA 3C14A 4Q5VA 1IKXB 3QFWA 4DL2A 4NMXA 2HHVA 4I6YA 3C6UB 3MCOA 2UUCJ 3LQVA 2POKA 1HIYA 1S1UB 3RB3A 3MXHP 1SL0A 4JYAF 1S6PA 2AEJA 2ZKUA 4ECUA 1JLBA 1ZAVA 5CD4H 4AT1B 4ZVGA 1RU2A 3NEKA 2BANB 2C28A 3FBEA 3UN3A 4MKYA 4DHVA 1A7GE 2CPEA 4QYRA 4DN0A 4HI1A 4IG0B 3M8ZA 2CJQA 3DM2B 1EP4B 1A0OB 3N6MA 4NYZA 5HATA 5EUHA 1TUGB 5IT9Y 2KL8A 5DG7A 3RBZA 1P1LA 1RT3A 3T9NA 4ED1A 1H7XA 1HW8A 1Y5NB 1UEUA 1SC1B 3PFEA 3HULA 1RTIB 1S9GB 3DLGB 1BQMA 2DIVA 1I51B 4WE1B 1F6TA 1R6YA 2VFVA 1UVMA 2UV8A 4TYBA 2G1HA 2YPZA 1N6QB 4LFCF 4YR0A 4J9RA 2I9SA 2DR9A 1FWPA 3OTCA 3SCKE 4ES1A 2JWNA 5HBMB 2D3O1 5E3PA 1R3NA 5IWAF 2XY5A 2RUGA 1K9MT 2QL7B 3D6TB 1FDNA 3VAGA 5JMNA 3G82B 1RAHB 2M9KA 1F1BB 3O8WA 3SCJE 4CH7A 4B3RF 3NXZA 3H59A 2ATCB 4QIEA 4UUXA 5DDOC 1YI2S 1LNQA 3HCXA 3TZYA 4YQWA 2YH1A 3NG8A 4J9KA 3PHTA 3KFWX 2OMLA 4H4OA 3OVAA 5T7LA 2YWKA 2ZH3A 4IUFA 1PSDA 3MEDB 2OMOA 1RT1B 3RW7A 1KTQA 1QE1A 2MQLA 5A8RB 1UZHA 2ALYB 2N3LA 3M9MB 1H7WA 2HNYA 2WW4A 3QZ7A 4U95A 5CA5A 1YSJA 4JI2F 1VQMS 2FZGB 2XNRA 2VV5A 2AYGA 4PYDA 3PJ9A 4HH0A 2HMIA 3IR6B 2GA7A 3GTYX 2RQKA 1RTHB 3RR8A 1YLXA 3J81Y 4C8KA 1DQAA 3A8JA 5ETOA 3C2PA 3M1VB 1L3UA 2FHJA 3D3CJ 4MIBA 2Q66A 3QO9B 3UN5A 1VQ7S 4KE5A 4MK7A 4YEAA 4LSLB 2YWHA 4DFKA 2QLWA 3CCQS 1L3TA 1KS2A 1HQEA 1P8GA 1SH2A 2YKQA 3BZQA 4QR2A 3B4MA 4DSEA 1SUQB 2B5JB 1FHTA 4Q2MA 2BQ3A 1VQPS 1PBUA 4RO0A 2RSQA 2PO4A 4Q7AA 5D77A 4ECTA 1HFEL 1FRXA 2KU7A 4OX6A 1V6HA 3LP0B 4WK1A 1NH7A 4KY3A 5K9FA 4UT4A 1REVA 1FRMA 1MWYA 2B8PA 2B9EA 2OAUA 3IAS9 4ANDA 3FGVA 1XN9A 4C6AA 5CYQA 3TZXA 5J2QA 3DLEB 3H4BA 1TKTB 2LEAA 3RBDA 1JKHA 1FVQA 5D4NA 1O5JA 3GPAA 3QT7A 1FJGJ 1QDUB 5HMWA 1HPZB 3M8YA 4HACA 1Z2ZA 2GC8A 1RACB 3O5TB 4P72A 1I94J 5E3AA 2HHPA 3ET6B 4NE9C 3ZTPA 2RE1A 2EFPA 3LUYA 1JLQB 4CTAA 3C16A 3CTRA 1RE1B 3PJXA 4HDGA 4E98A 2D74B 1TL4A 1NKBA 1S4EA 3IG1A 2NUUG 4ITSA 2GQ2A 4ALZA 5HP1B 3VGVA 2DHXA 2NYHA 4F26A 4HEA9 2XO6A 3G71S 3HHLB 1U1KA 2V94A 1WI8A 2V63A 2Z58B 3FMBA 3W66A 3ZC4A 1AZSA 3MEEB 3M2UA 4C0HA 4RNFA 4O3RA 3T1YF 4ZPAA 2GHWA 2PA8D 4B9LA 3FBFA 2HNZB 4RW8A 2QV6A 2CNLB 4CO2A 1S1XA 4CYUA 3C15A 2YKAA 3HSJA 1RK8A 1KOHA 2X51A 4Q0BB 1O51A 3I4HX 2FDNA 5F9NA 1SJ3P 4M95A 4C8ZA 4DZDA 4JYAJ 5AXKA 1CG2A 4QPTA 1DZ5A 3QNWB 2HNDB 2FGOA 3NCPA 5JUMA 1CLFA 2XS2A 5H9FK 1GQEA 2LXFA 1BQNB 2HNYB 2MDAA 4KIAA 4NA3A 3PW0A 4J9LA 4KH1B 5CYMA 5KFDA 4PQUA 2MQNA 2QLXA 4YN3B 2EW9A 4CH0S 3G8TA 4J9OA 4OZ3A 4WBFA 2X1BA 1RHUB 3BGLA 4FS1A 4NRTA 3SBMA 1MNEA 2A18A 2HGNA 3Q8UA 5KT3A 1ICEB 1HWKA 3OVSA 2IA0A 3DU5A 3OUYB 4OMFG 4FF3A 2B4OA 1YJ7A 2E1PA 1YHQS 1I6JA 3RGIA 5K20B 2KO1A 1U49A 1WOPA 3IO1A 2CZVC 3BGOP 1IBLJ 2VG6B 1S77D 5HBMA 4DR4F 2V34A 3SSRA 2GGPA 2WSEC 4KSEB 2ZD1B 4YMEA 1WHYA 5A0YB 3IAM9 3H40A 1Q7YT 5F3ZA 3RB0A 3MMCA 1L3SA 4PUOA 3MPUB 3KLIA 3AB2B 3IP0A 1Y9OA 4HTIA 3H25A 3BO2A 5H1SV 2DH7A 1FNXH 1TAQA 3AD8C 3HK2A 2RDJA 1Q78A 5KFPA 5KG7A 5KFJA 2PMHA 3DMJA 1RTIA 3CCES 3L7UA 3BGFA 4OHWA 2IVFB 3SSQA 1U6FA 4H4MA 2FVSA 4OYIA 3PVXA 2O1PA 5LJ3Y 3H2VE 2HYIB 2IA6A 1NZAA 1RT4B 3D0IE 3E2EA 2HHQA 2VKRA 2A10A 4ILRA 3HP6A 1JXLA 4J91A 3MMBA 2J7WA 4WP9A 3R97A 1RWWB 1SQFA 4OLPA 2IYIA 3TJAA 3DGVA 3B4DA 3TUIC 2YNIA 2ADCA 3HLUA 2BR0A 1S59A 4P2XA 3W2VA 5HLFA 1U24A 2WVBA 2ZVIA 3BR9A 1LKZA 4R0EA 4AQYF 1PYTA 4ILMA 1EQ0A 4NLTA 4IO9Q 3IRXB 1XNQF 4ZITA 2QFIA 2ZBCA 3LPYA 3PNIA 3UCGA 5GMEA 2GVDA 5HN0A 3D28A 3HZGA 2IC3A 1U02A 3FQKA 2VBWA 1FCAA 4N56A 2XULA 1V9OA 1YRTA 4M8LA 4J9NA 1SL1A 2CQ4A 3RRHA 4C9DA 1MWQA 2J9CA 4TQSA 1VC6A 5BYSA 1D9DA 3VQTA 2MB0B 1GMWD 2BACA 2F40A 4XPCA 1SJQA 3POTA 2CQBA 2J9DA 3M8QB 4XAKA 1Q8LA 3DRPA 4P9SA 5BYRA 4F25A 2G0CA 1TL3B 2LKZA 4QIFA 3V4IB 1RWPB 2V8VA 1X8DA 4EYHB 2DPJA 2HBYB 2Z0GA 4V19J 5IXUA 3ET6A 2HRTA 1CJVA 2KFNA 3E8OA 4UF4A 2Z2YB 4JV5F 3WQPA 2K06A 2HVIA 1FFGB 4RKUC 2X1FA 3QGIA 3K8WA 5LMUJ 2V9WA 4B08A 1LFPA 1IQTA 4FP9A 3AXKA 3R5JB 2HBQB 2QLBB 1REVB 4PAAA 3U02A 4OI1A 3ZO7A 3TZZA 4O44A 4R5PA 2GIRA 2HQDA 1S6QA 1KVIA 3C3LA 2FVRA 3D54A 1P6TA 5J1EB 2EC0A 1KOOA 3CCVS 3TANA 3DLBA 4Y3CA 2V5HG 4DX6A 3EZ5A 1VQ5S 4WXOA 1RT5B 4Y0FA 3RTVA 1TL1A 2VB6A 3G82A 5T41A 4J9SA 2Z2ZA 1T3OA 3E3XA 2J8AA 2JDJA 3MR7A 4CLZA 4TY8B 5AJ3J 2ADBA 2R8JA 2JZ5A 3K89A 1UFKA 4I2QA 3TWZA 3BSOA 1FI4A 2Y1JA 4OI0A 4CM0A 3QJLA 2RDIA 3QWPA 5CXTA 2OFGX 1M5HA 4OIXA 4W4MA 3JB9k 4LF5F 1R8AA 1BQNA 3IR7B 4FVCA 2VG5A 5ETRA 1HKAA 5CZVA 3M8RA 1NSKL 2PDAA 3IA0A 1PCAA 2IBOA 3C6UA 2R3VA 3HF5A 4ZPBA 3ONQA 3PW7A 2XLJA 2IHR1 4RU9A 2I8EA 5F8LA 5DRKA 2FGCA 1CJTB 1JIHA 5DZ6A 1K1QA 1GTEA 4RW9A 3N79A 5F8JA 4MKAA 1M5KC 1Y3JA 3NS6A 3UDEA 1UKUA 2W7OA 3GV5B 4RNNA 3OXLA 4NWBA 3EM1A 3KHGA 3V6DA 1V5IB 1A6LA 3AAWB 3DYAB 1U1RA 4C97A 2DKOB 1LWFB 2HLUA 3MEDA 3CO9A 1FFWB 2VJVA 2AJ1A 5EWFA 3JXOA 4NCGA 1ZPVA 1H74A 1FNOA 2CZ4A 1S1UA 3DLEA 3LANA 2MY7A 3ICLA 4RWXA 3MD3A 2QA4S 1HD1A 1OSCA 4K4TA 2R7VA 4WYWA 3VGUA 2LXUA 2NXJA 4RW7B 4DZ6A 1IKWB 3DHXA 4KGMA 3T9ZA 2K1RB 1MN9A 2CVEA 2YWFA 4J9QA 1XC9A 2QEXS 4FXDA 1BLUA 3NL0A 2XGPA 5HMZA 1R0BG 2OELA 3SI8A 1XMBA 4YOEA 3W64A 3EPIA 2YNGA 1O6XA 1PILA 1E6YA 2ACYA 2DEJA 3DLKB 4YB6A 1Y7PA 3SEOA 1FD2A 2KG1A 4X66F 4DV0J 3A3PB 1H73A 3GIJA 2MLXA 3HM9A 1LOUA 1TVRA 1WEYA 3I9ZA 1HBMB 3HHDA 5DZ7A 5DJBA 2CZ9A 3VWSA 4AXIA 4PWDB 4BWJA 1AFIA 2WVCA 1Z1ZA 4USMA 4B3MF 3D6MB 2AJ4A 2KT3A 4F0MA 4QWCA 4A8XA 3PIPQ 4F3MA 5GADU 3D6HB 3AB4B 3KUHA 2IMWP 1OYEA 3BGRB 5C24A 1K0VA 4Y2CA 2KXHA 4IO1A 5AE1A 1GX6A 2OPQB 4GRSA 1F9FA 1CBKA 2DGXA 2O3DA 3R5DA 1XEZA 2KKHA 4NEYA 3TP2A 4CTAB 5DLFA 4FXWA 1M5OC 4UY8T 1NSAA 1EKRA 2APOA 1NXIA 1ZPWX 3PRBA 3G86A 4W90B 1S48A 3EYZA 4A8QA 3K5NA 4X4VA 4TNOA 2RIJA 1PGZA 1ZS6A 2YNHB 4B3OA 2D9OA 2EFNA 2V69A 3AJ2A 4L6V3 2HRUA 3KLIB 4NCBA 2YWEA 2XCPA 1VS3A 1TKXB 2ZUGA 3NRBA 4I2PA 4N7TA 3Q8VA 5GAEI 2ZH2A 1WHWA 4I2QB 3L7PA 2C3OA 3EXYA 3I31A 1XQIA 4PXDA 1FRIA 1WC4A 1X4HA 4URSA 1VQOS 2DR6A 2R7OA 4IRCA 2PGCA 4C98A 4KPYA 1YJVA 2AHOB 3AA8A 5A8KB 1X5SA 1ZYQA 2FJEB 3OUYA 3J7AN 4L75A 2KN4A 3MM6A 1NSQA 1MSWD 3TNVA 5J1EA 4DV4F 2R7UA 1M0SA 5ETPA 1VRQC 4AFFA 3GSDA 3TW0A 3W1YC 2CQ1A 5F8IA 3C46A 4YDDB 3OLAA 3IBWA 2GHVC 3QT6A 1IWGA 1BY9A 1WF1A 1RT2B 2AEMA 2YKNB 3M2VA 4FF1A 1NPKA 2K3IA 2B4VA 5EGYA 2EBEA 1D3WA 4GC7A 3PDNA 3IBFB 2YNFA 1YZ6A 3RAMA 4A8YA 1S76D 1DJ0A 2BKNA 1TMMA 1RA7A 4K5SA 2RF2B 2LU1A 2YVSA 1U1OA 2FUG9 2OI2A 1GTHA 2ZUAA 3HT3A 2HGLA 3D1QA 3LP2A 4JI3F 2ZWOA 2JH3A 3LGMA 1N36F 1FEHA 2LQ5A 3Q89A 4KV8A 4DV6J 2QG9B 3OR2A 1TL1B 1ZM4A 1LW0B 4USJC 4CQ1A 2DNOA 2LLZA 3GZ7A 1WC3A 1Y3KA 2CPYA 3PKYA 4DLGA 3MAQA 2JL9A 3MUVP 5GADI 1KD1T 2V9KA 3DU6A 3HHEA 4U7CA 3N5BA 1N48A 4ZPVR 4A8FA 3LALA 4UOCA 1FDBA 3D0HE 1Q16B 4DX7A 4JI7J 2UXDJ 2GJ2A 2YBVA 3W2WA 4C3LA 2XS7A 5HO4A 3F73A 1NKEA 4G1IA 1X0FA 2XSJA 3ZZOA 4NPOA 1AB8A 5AE3A 4PWDA 3MM5B 2P9CA 5KFZA 4KTQA 1JLGB 4M5DB 4ZCLA 2XMWA 4OHZA 4ZN1A 2BJ9A 2HAFA 1RYRA 3HJVA 4H4KA 2BEFA 3I32A 1PYSB 2HWHA 3IR5B 3T19A 1B70B 3AY0A 1NH8A 2CPJA 3T3FA 2OD6A 3THVA 1X4BA 3A8KA 1YITS 2R8GA 2QGFB 5CAAA 1YJWS 2BZ2A 4WTOB 4EGLA 2EK1A 2IRUA 4NI2B 4JUZA 3UE2A 4FZVA 4AD6A 3S8SA 2FJVA 1LK7A 2KFYA 4UTGA 1UETA 4LVOP 4ZPDA 4ZPWR 2L41A 2AJ2A 2W4PA 4PYAA 2IDLA 2XZWA 2CYYA 1CQMA 5A6WA 2DK2A 1OPZA 1EZZB 1U4BA 4C48A 4JV2A 4O3SA 5IV3A 2BDPA 4NLOA 1B7FA 4DS4A 3MFHA 4ED4A 2AJQA 4ZJQA 2EVZA 3BB5A 2ZNYA 3MMBB 4OX7A 4DF8A 2H1YA 4ELTA 1KDNA 3Q23A 3C66A 3X3UA 3GFYA 5J2MB 4JI6F 1X4GA 3MR3A 4K0KJ 4C8LA 2D3ZA 5J2PA 3DRSB 4ELUA 1RAOA 3TAQA 3DOKA 4JI7F 2G0JA 4DCPB 4ED0A 1HWLA 3N6LA 2PFFB 5EN1A 2GMLA 4ZVTB 3TA0A 4YHHF 2B7BB 3JYTB 1IBMJ 2E7WA 1DTQA 3N4WA 1RHQB 1Q5YA 2KYXA 5ETVA 1HNZF 2R7TA 2C2ZB 3CJRA 4FKYA 1UW4A 2DNRA 2GFFA 1U1MA 2OPQA 2E5IA 2NXUA 4DV6F 2FLLA 1U6BA 3QLHA 2CNNB 1RBAA 4DUYF 2VG6A 2HEKA 2AWZA 4WZQA 1MROA 4JI8J 4ZK7M 4N5SA 3MF5A 3NWRA 4ICLA 3VR1A 3TEHB 2YX4A 1EARA 2DH9A 1UJ5A 2GIQA 1TVRB 3I9V9 4JV1A 3CCJS 3GV8B 4K0KF 4J9MA 2KT2A 4HHUA 2QSFA 2Y1LB 3DXSX 4M5HA 4ED7A 4LUBA 3IM9A 1QAXA 2DNNA 2J9DE 4CM2A 3P6YC 2V2QA 3EUNA 1S7IA 3TYTA 1Q5VA 3BF4A 5SZTA 4MYUA 4X4QA 4AQYJ 4LFCJ 4TU7A 4Q44A 2E1MC 1AXQA 4TU8A 1RKIA 2MKIA 3H5XA 1U2FA 3I5BA 1RI7A 5CH7B 4FYVB 3T6BA 4GKKJ 1KRPA 3NY0A 2EI5A 3VHQA 2GW8A 4ATNA 1YVFA 4BC9A 2MKKA 3SV4A 1RT6A 2QC3A 3OVBA 1RT7A 1WC5A 1WEZA 1UWBA 3D66A 4F0HA 5KFNA 4NL5A 4USVA 4Y6IA 3QRPA 5C2GA 1OY9A 6AT1B 3T41A 1NK4A 2RT3A 4DF4A 4PQAA 1F5AA 3PRDA 2LQ9A 2OUGA 3TEGA 1IXKA 3CJ4A 2VASA 1M1GA 2C2KB 2IYGA 2VFRA 2MJNA 3IWNC 4UOGA 4LFBJ 2J7UA 3OD2A 3CULA 5HVHA 2AGPA 2M88A 1VIOA 5D3GB 3CB4A 5KT5A 2CQHA 1F60B 3G9CA 2WONA 2HPUA 3NMRA 2VICA 2UUAF 1NK7A 4JI3J 1GT8A 1WKKA 2W1BA 1NUEA 2BKOA 2G13A 3G2XA 3OR2B 4LIWA 4IG3B 4F0KA 4DV7F 3CJKA 1YJNS 2MHEA 1U48A 2AX1A 2ZZNA 4ZLNA 2LP4A 2RQCA 3UI3A 3MM9B 4J9UE 2VBXA 1O0PA 3VV2B 2M2BA 1JLQA 3EZOA 4Z7CA 2JX2A 3BREA 3Q8PB 5B0DA 3NGSA 3UD5A 2B9XA 2YNFB 2L08A 1C4AA 1IKXA 1YJ9S 1OWXA 4DV7J 3IC1A 4DCJB 5DQIA 2CAJA 2DNHA 4L3KA 4EZ6A 3WDOA 4HDHA 4I7FB 1N56A 1UVLA 3FRYA 4ZJLA 3NWGA 2FPHX 1U25A 2N82B 3OL9A 1HR0F 5F0WA 1SKWA 4PG6A 2W9BB 1L3VA 3RG6A 1FESA 3E01A 4P52A 2GO8A 1U8WA 3JSRA 4EMDA 4QWDA 1VHIA 1UVJA 1BC6A 1BWVA 4HT7A 1XMOJ 3W9HA 2QJ3A 4IFVA 1C0TB 1EETB 3CJTA 5DS7A 2HRYA 3D9BA 4ES3A 4X62F 4Y2KA 3UDCA 1SC6A 1T05A 3DGPB 4RUAA 2V50A 3TA2A 5LJ5Y 3RB4A 5L9XA 2YTCA 1A9NB 1WDDA 3OR1B 3PCOB 1U0HA 2HFOA 2D69A 1WORA 2DIUA 3U1LA 3VVUA 4X4TA 2HW3A 3SZ2A 4NASA 1JLFB 3TAMB 4CO5A 2VHGA 4KH0B 1GX5A 2E9TA 3KNAA 3LP1B 2IC3B 2VOOA 4TY9A 1N52B 1RABB 3P96A 3B78A 1S0NA 2L48A 1NM2A 1IBLF 2M3DA 1PIEA 2DNKA 4DSKA 2VH7A 3CD6S 4B3OB 3ILLA 3TX0A 2B43A 1S6QB 1FTCA 3I87A 1KEKA 4WCEQ 3PXGa 4ZKAA 1JK9B 2XMUA 1RCXB 2CUYA 4JI1F 3MMAA 4O0NA 2R8IA 3ZTQA 4I67A 2HFVA 2CJYB 4GVBB 4O3PA 4F4KA 1RAIB 4U7UD 1Q8KA 2VA2A 5I42B 3LAMA 3HHKA 2LXIA 4EFAC 4ZLPA 5HQLA 5DG8A 5HJXA 1RKJA 5G0RA 1NJYA 5LSOA 2WOMB 3LF0A 3LA0A 2QX0A 1U45A 2UVVA 2DNYA 1L5UA 2HG4A 1FXRA 3JQMA 1HI0P 1FTRA 1VHFA 2DBBA 4HR2A 4RBVA 4DQPA 4LF7F 5HVFA 5C25B 2B9YA 2V8DA 2ZH7A 2YQ1A 3GFXA 3VAHA 4MK9A 3MURP 1K8AT 4LQ9A 3DLLQ 2W9CA 3IXQA 3V6HA 3RB6A 3AOAA 3NGKA 3G96A 3RJMB 1S10A 1FRHA 4G65A 4OJHA 5D4OA 1F9HA 1XNQJ 3SIPB 3HFKA 4J7CA 5KG4A 3IRXA 5KFQA 4DPOA 4M5DA 1IM6A 2KJWA 2XWYA 5H9EK 1PO6A 5L39A 5CQGA 4PKDB 1FKOA 1V5VA 1WF2A 3SFGA 3G6VA 2NXEA 1D0EA 4PXCA 3CJSA 2AYEA 3BDEA 3V6DB 2JEFA 3KUEA 1XIQA 1VLOA 3L09A 2AQ4A 4NXMF 4I64A 4NZ6A 1V3RA 1VBKA 1IJEB 3K57A 1GAOA 4U7UK 3SYZA 1BE4A 4I6AA 1D8YA 4QCLA 2HURA 5B0AA 2DJWA 1REGX 2XMJA 1FKPA 2DVIA 3EX7B 2AMCB 1U26A 1HNIB 1DTQB 1GMWA 4X84A 2MKYA 3HZEA 2LYVA 1RTHA 4FBTA 1TZ0A 4NLPA 2CQPA 3PRVA 4R25A 4ZHRA 2XLKA 2FZKB 3HVTA 1WF0A 2R7RA 4B9TA 3PM9A 2FC8A 1OSDA 3J80Y 3QATA 3KK1B 2A2CA 4P75A 3T5JA 1SH3A 1PKUA 2DNQA 4PABA 3BBCA 4K8RA 3JSMA 3MEKA 3C14B 4K4SA 1E6VB 2ZKTA 3R7NB 3M32A 2BKPA 4M5MA 2Y0SD 4DPWA 4ZVSB 3MMCB 4RPFA 1SB6A 4ZJOA 3CCSS 4QWAA 3OL7A 3D3BJ 2E7XA 4X4RA 2W9BA 2CJBA 4YB1P 5B0FA 2HBZB 4H4OB 3C19A 3OFEA 2JLFA 3H42A 4L72B 1VLYA 3M8SA 1RTDA 1P1TA 2DGWA 1WSVA 3QQCD 2ZH5A 4F3QA 2J6UA 3NLCA 1HNZJ 1WNEA 4ZIWA 4LT6A 4AXJA 5ADZA 4DR6J 3T5KA 4O3NA 3IS9A 1RP5A 5ITHA 2Y1IA 2JC0A 2QL9B 2BUNA 3FZBA 4GVLA 4ZVEA 2WRMA 4Y65A 3KHLA 1TKXA 3RRGA 2IY5B 5HANA 1F3FA 1U2RA 3CCWA 6FDRA 4GKJF 2D9PA 3CW2C 3PTWA 1UCNA 2VPYB 2UUCF 3EICA 2UVUA 3CD7A 3SQGB 3TJ9A 3KLFA 1ZA1B 4ECVA 4ZDNA 5D0GA 2E5LF 2C3YA 2BE9B 3H5YA 2DD8S 4LF9J 4Y2MA 1VK3A 3R5AA 1HI1A 2J6TA 4C0OC 1C0UB 3UW1A 5CCMA 3QT5A 2XMAA 2J0QD 2HHSA 3I0RB 3GFZA 4CNYA 4DPTA 1OQ6A 3G6ES 1CS4A 3EVOA 1VQYA 3D1HA 4OFZA 2ZC3A 5KT7A 3MR6A 2QRRA 2R8KA 3E51A 5KFSA 2KM8B 2CDQA 2ZDPA 4K5RA 2ZH1A 1FKOB 4ZCIA 2MLYA 2KXNB 3L9ZA 2DISA 3MCMA 2AIRB 3DFEA 2A2DA 2UU9F 4MAKA 2XMKA 1RB0A 2DNMA 4RZRA 1X7VA 4LBIA 2DGOA 1H38A 2E1AA 1T9UA 4JI5F 3NAHA 2FZCB 1MLAA 2V6AA 3EVMA 2EBGA 3R7BB 4BHQA 4I4BA 4Y2AA 4BBYA 8AT1B 4NLUA 1JQGA 4CO1A 1X0PA 4O0IA 1T9WA 2W2NP 3RAXA 2J6SA 4QJVA 3H8YA 2C2NA 4H4MB 4ER8A 2C1EB 2Z2MA 2B5JA 2DY9A 2HWTA 4EUVA 3TUZC 4DR5J 4DL7A 2HQIA 1RAFB 2AX0A 1B4SA 4O4GA 2UXCJ 2BMBA 1JNZB 3MM9A 1EJ7L 2EG2A 4QBUA 4IOAQ 1HBOA 3W8GA 4CH1A 2XNQA 5C25A 5F41A 1RBOB 4RUCA 1OIAA 3F56A 1QAYA 1HNXJ 2W4CA 3QIDA 1KQGB 1B0PA 1IBCB 2CDRB 5DGBA 3M32B 1VJWA 2PEHA 3CWJA 3P4UB 4YUDA 2WZ1A 2J5AA 4LBPA 2HVEA 2F4VF 4I56A 5HQ8A 4QQBA 5LOQA 1NCLA 2DTJA 2W2OP 4M5NA 4X64F 1SL2A 2VBZA 4ZVPB 3FCVA 2ACMA 3L95X 2ASJA 1WKJA 2M8HA 2JLGA 1IUJA 5E0OA 3KHHA 1HNWF 2ZFHA 5IOLA 4XPEA 3H5UA 2ZBPA 2JVOA 5E3RA 3K17A 4KGXB 3LWLA 3CEDA 3NCRA 3HVAA 4U8YA 3TRGA 2DCLA 2F7VA 3AA9A 4Z7YA 1VC0A 5J2NA 1W25A 1UWBB 3KXDA 3N01A 4LSNB 2XSFA 3FJ2A 4OHVA 4X4SA 3BQ0A 1SV5A 4DR2F 2JEIA 2LU2A 5D8HB 1S49A 1RHRB 2KJVA 3I5AA 1KVJA 1RTJA 4OYOA 3U1MA 4QW9A 4NRUA 3VGSA 2RHQB 2VQEJ 1F0XA 3F41A 2HS0A 4JI1J 2E66A 2QMUB 2NPFA 5L1JA 1X9WA 2ZC4A 4B9VA 1RAJA 1T3NA 1QTMA 2K2PA 3FVYA 5KFFA 2M7SA 3D7SB 3GE9A 2HZVA 2FB0A 2HBRB 4KPCA 3BS9A 1C0TA 1EETA 1FO1A 1SH0A 4ANEA 2B3TB 2EKNA 3HI9A 3Q8RB 1U8SA 2M4MA 3VTIA 5DM7Q 2WAQD 2H9ZA 1GMUA 4K2XA 1NB7A 5I4MA 3M6XA 1YRXA 2B51A 2RUSA 1EHWA 2GVZB 1W7WA 2P9GA 1K1SA 2JNJA 2X3DA 3FSYA 5IFMA 3PYEA 1X9MA 4YS2A 1S4FA 2CJAA 3GCWP 3OTDA 5DETA 1FERA 2K7JA 5KFEA 3CMES 2DNZA 2LQ8A 5DG9A 2IM0A 1WJ9A 4IRDA 3OLBA 3BYRA 4DSFA 1SIWB 1N4LA 2ZVSA 3BKUA 2OPPA 4WU2A 2GJIA 2F5GA 4UZCA 3RBEA 2HQ3A 4QYZJ 1SQGA 1RHKB 3DOKB 4OZJA 1Q7LB 1NHVA 9ATCB 2WSCC 5GAHU 1VQ9S 3OSNA 3I55S 1G7CB 3HJFA 2FJDB 2J8SA 1W2BR 2WBMA 5F9LA 3D4JA 3QJPA 4AL6A 4IOCQ 1R27B 1T95A 2MZ1A 4UQGA 4CIOA 1FWKA 5D6GA 5DGAA 1TR0A 4P7VA 4IFYA 2PT0A 3MTJA 1WC6A 1ELOA 1RT4A 2N4DA 1CJUB 4LSLA 4NLRA 4DN9A 3KLHA 2XY6A 5I3UA 3R2CJ 4E0DA 2ZOMA 1LWCB 4HHJA 3A13A 2KTQA 1FRKA 1WD6A 2H5EA 3MI7X 3R7SB 3IGNA 5FDLB 1Q86T 4MKBA 2VKZG 2W9CB 4DUTA 3FSIA 2W8LA 4X66J 2K1RA 3UPFA 2E1CA 4QWEA 2XO7A 1FXDA 5KT6A 1JJHA 1T94A 4X64J 2AGOA 2DRBA 4DL3A 3EGZA 3HD2A 5GAGI 1CEZA 2F1FA 2CQDA 5SUHA 5L1LA 5J2QB 1J5EJ 3KOAA 2DB1A 3ENWA 2ZHOA 3BSNA 1Q8IA 1HWUA 1WWHA 1GK8A 4DFMA 1KLNA 2MJUA 4TKTA 4DV3J 1XMQF 4MJKA 3BSCA 3F0NA 1LEOA 3GIIA 3KHRA 1S0OA 2DO4A 2K3KA 3SFUA 1BUXA 1WEXA 2DHHA 1JLAB 3FEYB 3UFCX 3KLGA 4USIA 3HKZD 3ZNJ1 3CCUS 2ZWPA 2KXFA 2MSSA 3F44A 2NR0A 1LWEB 4OX9J 2LDYA 3PIOQ 1S1VA 3U7JA 4JI0J 3GP9A 1NDKA 2Q6BA 4RNHA 5F3TA 2ERRA 4AL5A 1QLNA 2YXLA 4ZP9A 2RH3A 3JAMY 4MMOA 4NMLA 1M5PC 1XWLA 4ZHRB 1MROB 5B0BA 3R5BA 5AJ3F 2AD9A 1TK0A 2G2YA 1I94F 4CCHA 1RISA 4J9PA 4BWMA 4EO6A 2BM1A 5JVGQ 3A8IA 2RRAA 3CUNA 1XMOF 3OFHA 3GJSB 4N8NA 4RW8B 3PG9A 4ZVFA 4ECWA 1QSSA 1RWNB 2OPSA 3KNGA 2EFOA 4OI2A 3M8WA 2OH2A 3OXFA 2RDDA 4ED3A 1BQMB 4OZNA 3WBZA 3SQOP 1JLEB 1N0UA 5IQ6A 5THWA 2GVDB 1LXJA 1WC1A 3JQKA 3SDEB 1Y4ZB 1N54B 2F8MA 2MHNA 3A4TA 3CIZA 4HTJA 2FJXA 3GFHA 4O3OA 1EP4A 5F8GA 5LXYA 4YY3F 1NPRA 2AKWB 2CQIA 1RT7B 5BJRA 2KDOA 5E3QA 2G0IA 4C8OA 1D09B 1IKYB 1M5SA 2DR8A 1UFLA 3HSGA 3BN4A 1VDHA 4C2MA 1IKWA 1OQ3A 2L9DA 2W9AA 3W65A 1CJKA 4N77A 4P7TA 2CFXA 1S1WB 3CJ2A 3BO3A 2NREA 1VRUB 2ZD1A 2I1RA 4PCQA 3CC7S 2AZ1A 5C42A 4DPYA 1NRKA 1SJRA 3GJQB 4DUZF 2BE7D 5D0RA 1FXLA 2YNHA 3J81U 3PX0A 1UA0A 2V4JA 2R2TA 2HKEA 3MM7B 4C3KA 1FE0A 4PPZA 1X4AA 2QO3A 1LV5A 5KAKA 1HNXF 2U2FA 1QAJA 3B6BA 3ZZYA 2D1CA 3R27A 4LF7J 3ISND 3JSYA 4ILLA 4PXBA 4MIWA 1CC8A 2VG7B 3PZPA 3M7VA 1DAXA 4ZPTR 5G0RB 4KHMA 3CF5Q 4P74A 4OZ2A 3VAKA 2WVDA 2CXEA 2OEMA 4XDDA 5A8WA 2WSFC 1F2GA 3M2RB 3MAAB 2OSQA 1D8ZA 1SQEA 2YNIB 2QL5B 3MZIA 2DXDA 3P5BP 4DX8H 2F4FA 2YWWA 3ILJA 2VG5B 3UO0A 3IRWP 3P5TL 3PYFA 5J1NA 3AHPA 5U47A 2QYGA 4I1TA 1G3OA 2GAHC 1NSPA 4FYXB 2I6WA 4DL5A 5KG1A 3R6GB 4NZ0A 2CQ0A 4PWWA 3D2WA 1X9SA 4IR9A 2MQ8A 1WUUA 2DGUA 4PZVA 2BJ8A 2PC6A 5L8RC 2DRAA 3KK2A 2HHUA 3JQJA 3M30B 2L9NA 3O44A 2O01C 3MPWA 4IFVB 2GQQA 5DO2A 3Q22A 2UXDF 1S9EB 2WVFA 5H9EJ 4R8UB 1QE1B 1RXOB 4M1KA 5A8RA 3OHBA 4NXMJ 4DPXA 3VALA 1QVGR 3K0JA 2VU5A 5HJYA 5KFBA 5DDPC 2CPIA 3MPYA 4Q45A 1T05B 3DOMB 2MQPA 1HBUB 4RNMA 4KAIA 3K59A 4KHRA 5ETMA 5F8HA 5KFCA 3NAIA 4HH1A 5HMXA 2FQQB 3SCLE 1UMJA 2YKNA 3M2VB 2DXEA 1P27B 2HS4A 2N4CA 3FCWA 1UVKA 4PPDA 5I3QA 3L4BC 2MQOA 4X2BA 3HVWA 1S1TB 3FBBA 5KG2A 5DLGA 1WOSA 2Q3PA 4JI4F 4O44B 2YKMB 2FLOA 3W7BA 5HROB 3B8HA 4B3TJ 1HWJA 3QSIA 4OYMA 4RUBA 2V8HA 3OHAA 2CWKA 4ETZA 3UVJB 4J90A 4ZOSA 4LRDA 3AOCA 4P71A 4ZLLA 3MFIA 1CJUA 1RJJA 5GMKa 5I3UB 3MPDA 1HWIA 2VONA 4OZ5A 1IKVB 1PC4A 3W3SA 4LQ3A 4FYWB 4XDCA 5FDLA 1FKPB 2IM3A 2PIIA 4CYUB 3KJFB 1RT3B 4WKRA 3HD1A 5CD4A 3PO5A 3AODA 5AXNA 1SC4B 2NQPA 3G6XA 4DV5J 3W2WB 2LECA 4A8KA 1XR7A 3M1VA 5L9NA 2MKJA 4KKOA 5IC6B 4ECRA 3PV8A 5IQQA 3N9UC 2FHMA 3UN2A 1PJ7A 1LFWA 3EGVA 2XMTA 3EWGA 4A4JA 2HQFA 2GCFA 4BCAA 3Q8QB 2ZJPQ 1S6PB 1ZTTA 1N5TA 4LVNP 3RW6A 2R7QA 1Y11A 1ZM9A 1RHMB 3KWMA 3RYLA 2AW0A 1SBRA 1V3ZA 3KDOA 2GVZA 4HL9A 1FKAF 4BLGA 4WKYA 4PG8A 3SQGA 3KLFB 2UUBF 4OHYA 3BJYA 1FDAA 1NB2A 1I1GA 2BXJA 2QSWA 2QTWA 4RUHA 2LMIA 5JJBA 2H51B 3MM8B 5A0YA 2N7CA 4PUOB 3BV8A 3CJ5A 3EZUA 4ID8A 4DQRA 1TU0B 5D78A 4I6WA 3NGTA 1QM9A 5F8NA 2FHJD 2RAQA 3KDNA 3BQ1A 4RW7A 4HKQA 2BX6A 4DV1J 3PR4A 4EU0A 4XK8C 5HQMA 4OLOA 3M4XA 5JVHQ 1HR0J 1NZ8A 3HO1A 3ZZPA 2C42A 4PR6A 1RT1A 1SUQA 4LIRA 4IQXA 1LWEA 1PG5B 5D15A 3K5OA 3J7ZT 2HHXA 2EXUA 3QGPA 1NNDA 1DTTA 2VF3A 2L9WA 1IBKJ 1DRZA 4DL4A 3G8SA 2Z57B 2Y9HA 1N34J 2IDEA 4ICLB 2W8KA 4CLYA 1R8HA 4K4WA 3PW2A 2JEGA 3GR1A 4MK8A 3JSMB 1SVDA 2DO0A 3CT9A 4YR3A 1QSLA 4DQIA 2RRBA 2CG4A 2GMHA 4RWWA 2M5YA 3PX4A 2E29A 1G4CA 1PAUB 3FFIB 4X4OA 1AW0A 2XHWA 4PEOA 3W5YA 2KH9A 1ZM2A 1N6QA 2P6SA 2HNZA 3H90A 1TQLA 2XZTB 2HFSA 2RRNA 2YQ3A 3MDFA 4ES2A 1ITPA 5CCLA 1RWMB 2RQMA 4IG0A 2UUAJ 1SC3B 3MCNA 1FX2A 4M5LA 1KONA 3UD4P 2UP1A 4NLXA 2IBKA 3H2UB 1G6BA 1BD6A 3B54A 4JI2J 2N7YA 4JV0A 5HP1A 3M8PB 2XS5A 1DLOA 2K7KA 2CNOB 2WB4A 4RW6A 5KFUA 2P6TA 3T1YJ 1S97A 2ASLA 4CP5A 1VQ8S 1R8BA 1BMQB 1YWXA 2W2MP 2V2VA 2ZEJA 3BPSP 4OJGA 5D0EA 1TV6B 4O4RA 3ZTOA 1U09A 3OJSA 3PO4A 3TO8A 2Z4PA 3LH2S 4F02A 2GNKA 3PFOA 2BOAA 3U1NA 2R42A 2OHDA 2H54B 3IN5A 1ZA2B 1RAGB 2CPDA 2H5JB 2KT5A 3GG0A 1HBOB 3W63A 3H7HB 3V2UC 3C16B 1JKHB 1VRUA 3FQLA 3OTOJ 4CDIA 3PW4A 1XNRF 1FA0A 1RT6B 1XNRJ 3SXLA 1YJRA 5KFYA 1WKLA 1RWVB 3GLJA 4KQZA 4WWSA 4NI2A 4DR5F 4Z37A 3NBPA 4KGZB 1RUSA 3IMQJ 2E5HA 4F8RA 2G1DA 3NNAA 2E9ZA 4CT8A 3FUYA 2FJBB 3DDNA 2KB2A 1GMVA 1RHJB 2BW7A 3A1YG 3ZZUA 1TUVA 4QZVB 3T5LA 1BXNA 5H9FJ 4DPUA 2U1AA 3FZ2A 4LR9A 3CSKA 2LEPA 4TXSA 5CABA 4FVMA 2DNLA 3KLHB 1NJWA 3MAHA 1LW2A 4KJIA 4PG7A 4AL7A 2Y8YA 2AJFE 3HX9A 5DQHA 1Q0NA 1SPBP 1UPPA 4J5OA 3MMAB 4NYOA 1JLCB 5E33A 2GHPA 1CJTA 4UQTA 2H48B 3RAQA 1DARA 3QJJA 4FPIA 2Z30B 3PEHA 2XEXA 4LFAJ 1NKCA 1T7PA 4LF8J 4TQRA 4PQUB 1QVFR 1UVNA 2KZZA 2I5JA 1WG4A 3LP1A 2CRLA 2X3GA 2W25A 4Q2LA 2VFUA 3DMJB 4FYYB 2OTLS 2JJ4D 1RSCA 3ITHA 4M63A 3ULHA 4TVAB 4A8SA 3T5HA 3QRQA 2X7IA 3GIKA 4ZA1A 1IN0A 4OYXA 2LFVA 2VPXB 2ZBIA 3UVJA 2ZJRQ 2R9LA 4ECQA 2JFKA 3I0SA 4DFPA 2GGPB 5MAOA 5KFOA 1NPPA 3GSIA 3KG4A 5IT0A 3MUTP 1TP7A 1WTBA 1QAIA 3ZTSA 1VBYA 4C4WA 4L76A 3R2DJ 2UVRA 2F63A 3EDQB 1RU1A 3L7OA 2DEIA 2XBPA 2NXCA 3FSXA 1JJCB 3KKFA 1WHXA 5CHCB 5IM0A 1U7LA 3HPOA 1RQ0A 1U0SA 1KWMA 1JXEA 5LSLA 1ACMB 3NNCA 4XTTA 3Q2SC 4JOUA 5IT9U 2XC9A 2KYZA 1KFDA 3LTOA 2MLZA 5M2RA 2KZMA 3J81j 2IM1A 3DRPB 3HXMA 2RD5C 1Y0HA 4DXLA 4MKVA 4URGA 1F2HA 4B3RJ 4X65F 4OV6A 1RAAB 2L3MA 1VGYA 4ECYA 1Y00A 3NS5A 5BR8J 3FBCA 2J76E 1X5TA 3VGTA 4DR4J 3O3LA 3DDIA 1N5SA 1WOOA 3BBBA 4CO0A 4CRJA 1KNZA 1QD1A 1IR1A 4AE5A 2OLWA 5J1PA 1URNA 4YB5A 2P2CB 1DY3A 1KQSR 4F4WA 1CVJA 2F9DA 1IKYA 4RU2A 2YPYA 1NLKL 2YWGA 4OZ1A 4B3SF 1ZZFA 4K2JA 2WONB 4GO5X 4DCOB 3QMQA 1RCOB 3CMAS 1V3SA 1RLCL 4JI8F 3OV7A 3ZTRA 4N47A 1VQ6S 2VDHA 3CDWA 4Q43A 2UUTA 3RUBL 1C1CB 4B9UA 2CPZA 3ZFVA 3B82A 4RLEA 2W4DA 3MHYA 3A12A 2BV3A 1T8EA 3VAJA 2XQCA 4F50A 1FJEB 2CG8A 4LF9F 3DOLB 3BR8A 1GEHA 2EC2A 2LDIA 2NS1B 3IBCB 3V81A 3DC2A 1KSPA 2UZAA 3IG1B 3HDSA 1HNVB 5D4PA 3G87A 3RU0A 4LRBA 2VQFF 2DGVA 3NOGA 3NBPB 1CJVB 1MU2A 4OYPA 4C8NA 2YY3A 4KRWA 4LF4J 2P8IA 1C1BA 1JX4A 1ROFA 3MWBA 2VQEF 2J0SD 4DFJA 1IBMF 2KG0A 4NOHA 1IR2A 2PD1A 4C7QA 1PAEX 3WX4A 2BVZA 1T9TA 3LAKA 4H54A 1RTDB 2CQ3A 2DXFA 2O67A 1VMBA 1R0AA 4O23A 3MR2A 2XHCA 1UFWA 1YRUA 1EX8A 1FJCA 1DTTB 3DOMA 1T9XA 2FHKA 2ILYA 1HBUA 1P9QC 2NZ4A 1UWAA 5HK4A 1TFWA 3KTQA 2D3OR 2DY1A 3CVKA 3J7YU 2Y3YA 4EEYA 2A6OA 1RYSA 2GZOA 3JTNA 4F7VA 2XZDB 3JSBA 3LWMA 3H20A 2EEYA 2EFVA 1FJGF 3M30A 1F9EB 1RTJB 3IFEA 1PJ5A 4L74A 3ZZRA 5M2PA 2M8DB 3MEGB 2JSXA 1CC7A 4B17A 5B09A 2QA4G 5F0UA 5HAOA 2ZH9A 1HHTP 4ELVA 3HVTB 1LK5A 2ZE2B 2FJWA 4DX5A 1NO8A 3FEXB 2ABYA 4DV1F 3Q83A 3DI6A 2PEBA 4CT9A 1KLMB 2EPIA 4B02A 4IG3A 5BYQA 2H5IB 4NLWA 5KTQA 1H2TZ 2KM8C 2RU9A 1B0TA 5D4LA 2A6MA 1WDTA 2J7KA 3TVZA 4USUA 2RB7A 4YP3A 4TN2A 1RADB 2AZ3A 3RZAA 3S7RA 3Q8SB 3OTOF 5ETTA 3AOBA 2YKMA 3MMJA 3PYGA 1N5YB 3KYLA 4MYTA 5K14B 4F4YA 1TMJA 3JS9A 4IKAA 4JI5J 1X31C 1KTVA 3M2RA 1EKSA 1NJXA 2QFJA 2E5LJ 2LQBA 1F5CA 3QBCA 1T11A 3LOUA 2JEJA 1S0VA 4TYAA 3FC9A 5HVGA 3KJVA 1FRJA 5KG0A 2VD3A 4QU7A 1E6YB 1DURA 1FVSA 2FY8A 3JTPA 1S0MA 2JHEA 2B8QA 2EG1A 2KRBA 2QE5A 2QYCA 4NLDA 4P2SA 5CYMB 3ZZTA 3K5MA 3UR0A 4WYLA 4K4UA 1Q53A 5LMUF 2B4PA 3N0VA 4IYQA 2UVWA 3BKFA 3AQPA 3DN9A 5JXSA 2XMVA 4ED8A 2XMMA 3KK2B 1KHVA 4KHPF 4F2SA 3TI0A 4DDFA 1R7IA 1YJTA 1FRLA 1HMVB 3N5FA 4FNIA 5E5NA 2R2RA 3RR7A 3KK1A 2H3EB 3UWTA 4NEZA 2KVIA 1Y5LB 5L1KA 3M8QA 4EZ9A 2EK6A 5FLXU 4YHHJ 3K5PA 1BGXT 3MM5A 5KFHA 4NZ7A 3KLEB 3FMWA 4WTYA 1K47A 3U27A 3R5CA 2F8EX 3BH6B 2VZ9A 2NSBA 2VPZB 2VFTA 1VBXA 4USTA 3V6JA 3TAPA 3KUGA 2HZAA 2OEKA 4DS5A 4JI6J 1N32J 3GG1A 3AJDA 2R2UA 3PKMA 1OS5A 2FC9A 4ZMMA 1NHKL 5HL7Q 1XTZA 3QLHB 4Y34A 5IT4A 4BS2A 3ENAA 4EBCA 4K50A 1QTNB 1WACA 5BR8F 1S9EA 2EKYA 3P45B 1Q81T 1HBMA 1YDLA 1R0AB 5B0GA 2ZDOA 4A47A 2BM0A 1XMQJ 1KR4A 2HVZA 1VC5A 4DLEA 2IVYA 3P49B 1S5ZA 2AEFA 1FNMA 2HVDA 2VFSA 2XGQA 3TUPA 2PMWA 4KFBB 7AT1B 3WX8A 3Q86A 4DR7J 2XTJP 1VJQA 1AA1B 4M5KA 3J7YI 2DH8A 4USKA 4GKKF 4B3MJ 3ELHA 1LWFA 3MAAA 3EXCX 1RWUA 3EVWA 1TFYA 1GNKA 3M05A 3ETOA 3UDLA 3NGUA 4DV3F 1YG0A 3CDEA 3QYYA 5ETLA 1WELA 1S6UA 2KRRA 1SI9A 2AYMA 2CIMA 4FNHA 3D67A 3EJMA 1R8CA 4S0MA 4WP3A 5IV4A 2VA3A 2BJ1A 4QR0A 1YBTA 4ZLJA 1Y5IB 3H5SA 3NOCA 1JMTA 3I0SB 1K44A 3R3TA 4ZVHA 3WC0A 2YQ0A 4TLQA 4U96A 3KMSA 4CLLA 3UNYA 1N8RT 4UZBA 4W98A 2FLPA 3M6WA 3NP5A 4LF4F 1N32F 2XCAA 4JV5J 4F4AA 2V8GA 4QR1A 2HWIA 2UUWA 4G1QA 2Z8QA 2RU3A 2B6AB 2ZITA 3W62A 2IFXA 2OTJS 1AT1B 1LWCA 1NU4A 1YX2A 4LSNA 2XY7A 1LQ9A 2G2OA 2I0XA 4JP8A 4O3QA 3CDAA 3G4SS 1DQ9A 4DR3J 4IDKB 4LF6F 1OPIA 1GXUA 2Z2LA 2FTRA 2DNPA 5LM7E 4NLGA 3LW5C 3S01A 2XSJB 1M1HA 2K8GA 4USHA 1UAWA 2OSRA 3BH7B 4LRAA 4I69A 3ZZ0A 3GMGA 1I5OB 2R2SA 4WPAA 1LW2B 2PFDA 3J80U 2DR7A 2BBEA 5EX0A 5KFVA 1N33F 1QY7A 1AFJA 4WFYA 8ATCB 1UEVA 3BM7A 3FK4A 5IWAJ 3QO9A 2Y1RI 2Q1LA 3AXMA 4LRFA 2QMXA 1DFDA 3H98A 1XR6A 2IMOA 1ZZNA 2G4BA 2RS8A 1VQ4S 3KLEA 2IIHA 2V4QA 2AJ0A 2OGUA 4DMZA 2Q6CA 2AYBA 2E5GA 2JOQA 4LR8A 4U6PA 2ZH6A 4DR7F 1HBNA 3JAMU 3MECB 1Q4RA 4QIWD 2UXBF 1C1BB 2Z56B 4K4ZA 3UDVA 2ZOGA 1NMEB 1C2PA 2HFUA 3A8EA 4ZP7A 1RAEB 1Q8BA 4L73A 4UW2A 2P5VA 5CZXA 4DI6A 2E9RX 4X62J 2HIQA 3ILOA 6FD1A 2CQGA 1KN6A 2BRLA 4DOZA 1HW9A 3I82A 3LPEA 3P8BB 1UP1A 2CPHA 3S6EA 2XI2A 3ZZZA 4K4YA 1TKTA 4ZVOB 2ZBRA 3K2YA 4I68A 3CCZA 3V6KA 3JTOA 1UA1A 2QMWA 5KOXA 4NA1A 1HQEB 1OJ4A 3VAFA 4FPRA 2W7AA 4F2RA 4OJ1A 1TL7B 3QIPB 3R9LA 4C8YA 3LGNA 1R89A 3CJKB 1APSA 1TUWA 2WCXA 4DV0F 3QT8A 2M0GB 1UZDA 1TV6A 3OQ2A 3AD9C 3QPIA 3GONA 4RL1A 4WXWA 2KHCA 4FN5A 1FWLA 5K14A 3OXGA 1N5YA 2Y8WA 2RQ4A 1MMDA 1OY6A 2P9EA 2BQRA 1FD8A 1JLBB 4M5JA 3FEZA 2JLEA 1C0UA 2MQMA 3O2IA 2W2PP 3MM8A 4KHPJ 4L3NA 1X5PA 3TA1A 4R8UA 1VQLS 4IH6A 3TVYA 3WHIA 3ZXWA 2N3OA 5J2NB 3BO4A 4K4XA 1DQ8A 2IJFA 2HSEB 4ZCKA 1LXNA 1LW0A 2G9OA 1F3VA 5KG3A 3TJ8A 4I0WA 1VRTA 4RX6A 1KP6A 5C2CA 2CJKA 2V4RA 5KFTA 3VZIA 3BQ2A 3R1LA 4Q0BA 2I38A 5E2QA 2MMYA 3FRZA 1NHUA 2BW2A 2B6AA 5J2MA 4UOFA 5L46A 1JJ2R 2M52A 4ZN3A 3MEGA 4FBUA 2B56A 2BJDA 2PE8A 4OV1A 4UOHA 5D0HA 1NDCA 3DRRB 3TUJC 1WG1A 1VFJA 3BPDA 2AP6A 4P2FA 4ZP8A 3SSSA 5DQGA 4FXVA 3CCRS 2W7PA 3DCAA 2WTFA 4Y00A 4QIVA 4AUKA 2XLIA 3HSDA 4CLPA 5A76A 2I2YA 3DKDA 4MT1A 1DBDA 2GV1A 2HHHF 2E1RA 1ZBTA 2JRSA 4O4GB 2DPIA 4X4NA 1AUDA 2A1BA 3TZWA 5LMNF 1KKHA 3GIMA 1R31A 1VQNS 2M70A 2F9JA 3CC4S 4OX8A 1MMLA 3C6TA 5A2QU 2R8HA 1UEKA 2QA2A 4B9NA 4WE1A 5A8KA 4DR1F 9RUBA 2H4YB 2MKHA 1BWEA 4IQMA 2WHOA 3ENVA 5ETQA 3O1LA 1TK5A 1H6KX 3PJWA 5CYQB 5KFMA 1VISA 2FD2A 3V5RA 2CKWA 2ZH8A 2BA9A 4OJ3A 3AH6A 4ETXA 4DWIA 2CPXA 3Q0AA 1Q79A 4KBIA 3T6JA 1FK9B 1RGVA 4DL0C 1M5VC 1JB0C 1URRA 4GMKA 1H3DA 1N0VC 4WF9Q 4QU6A 2XYPB 5KOWA 1PJ6A 1JLEA 2HS3A 3CJQA 5DDQC 2PSZA 5KG5A 4JI0F 3X1LB 3FKBA 1TTHB 4IFYB 3GWCA 2H4WB 3OTBA 2KFZA 4AYBD 4WU3A 2MXYA 1EAYC 2OD4A 1J27A 2AGQA 2VC0A 1VI7A 2ROGA 3D5MA 1T0TV 1N5QA 2VDIA 2C2RA 1N36J 2ZZMA 1WTFA 2MTLA 3CJ8A 3OPKA 4HACB 4U9RA 4CO4A 1JWWA 1CULA 4KO0B 1HQUB 4M5IA 3LO3A 4WFZA 4NXNJ 1FFSB 2ZE2A 1IM4A 1X4CA 5C7PA 2R4FA 1B0VA 3EPGA 4G1QB 2GIFA 1HLWA 4IRKA 4JB8B 4V19X 3HHLD 3M9NB 4DJBA 3I6PA 1MN7A 5G4DA 2MGZA 1S9FA 5EX3A 4F4ZA 3VVTA 2OPRA 3HHLC 1Q1KA 4IDKA 4WK3A 2ALZA 1IWAA 4ZVQB 3NNHA 4U67Q 3KLVA 3DRYA 2Q43A 4OYBA 4DU8A 1SKUB 3OW2R 2RS2A 4D3HA 5K8OA 3DGPA 2NYIA 5K8NA 4XIUA 4CLUA 2QZ8A 4NCGB 1BHNA 3Q24A 2VG7A 1JLGA 4DV4J 4ZP6A 2ASDA 4ED5A 3LGHA 3N28A 3M9OB 3OBIA 2YH0A 5EDWA 2HIYA 3EDRB 3OFGA 1VIXA 2MY8A 3D0GE 3GJRB 4F36A 3G6YA 1T03B 3IWXA 2FY1A 1TL5A 5BXIA 1N34F 4NLYA 2PA3A 3UNGC 4RBTA 1NK8A 2FLNA 5C42B 1D9AA 2RKIA 2HK3A 2DRDA 1TKZB 3D1OA 3DLHA 3KG0A 7FD1A 2CNKB 3MTKA 2BE2B 4C11B 4NLVA 1G2EA 1NK6A 3K5LA 3KMQA 5FJ4A 1U47A 2ZH4A 2DGSA 1Z4UA 2ASYA 4PRFA 3THPA 2C2DA 1U0HB 1HNIA 2MSTA 3I4PA 4ID5B 4YFUA 2NXNA 1S1XB 4V1Ak 1VQSA 2GJFA 3I56S 4FS2A 4W92B 1B3TA 1U6ZA 2DHAA 2EFGA 1TELA 3ISZA 4GO7X 3HSZA 3SDEA 3QAEA 3CIMA 4KC5A 3K58A 3CGIA 4HI2A 3GYXB 3CMQA 4LJMA 5F8MA 3QZ8A 1RT5A 1RDRA 2C3UA 3HHLA 1CS4B 3W9JA 4QPXA 4PG4A 2VL1A 4PWUA 3SCIE 4CWBA 1FK9A 3AJ1A 3E01B 2ZJQQ 2ROEA 2CQCA 4CLKA 2E5JA 5MLCV 3DDKA 3HFVA 5HSPA 2ZHAA 1HHQA 1I3OB 3GU0A 3GQCA 3ETMA 3CDUA 5T14A 3QFHA 3CDBA 3UCZP 2A3JA 1U1PA 3VQSA 1IJFB 3EE3A 3POTB 2X1GA 3NMAA 2V8PA 1BQXA 1HPZA 4E8UA 1D9FA 4M5GA 4NYPA 1QUVA 3PYDA 4WFAQ 1PBAA 3UQSA 4RNOA 2C3PA 1IVZA 4USWA 4D3GA 3KK3B 4DR3F 3IS9B 5HMYA 3TARA 1QSYA 3NCQA 2HFNA 5KFRA 2AT1B 4DBQA 3CPWR 2V67A 2F4VJ 3MECA 1QJHA 4QYZK 3LP0A 2C2MB 4MTPA 1HARA 4IH7A 5K8PA 3W9IA 1SXLA 3C6TB 3R5GA 2ZOFA 3DYAA 3ZNUA 3W60A 3V81B 3RRKA 3MOJB 3BDPA 3DRRA 5B0CA 1SCJB 4N41A 4RW4A 4QOTA 3KJVB 1J2VA 2XG8A 3FNNA 2V2KA 3HKWA 5I42A 4RW9B 5L38A 4KB7A 5HLFB 1JJ4A 4OL8A 1MWZA 4Y2IA 3H4DA 2BYCA 4KV8B 1D1UA 4A48A 5KFWA 4NX9A 1XERA 3CC2S 3KJNB 3EMTA 1Y10A 1HL6A 2YNGB 4KT0C 4DQQA 4OX9F 4DG1A 2W24A 3BEGB 4X4PA 2HLTA 1H72C 3I5CA 3NKYA 3MEEA 3QWUA 4J9VA 2OFHX 5AXMA 2UUBJ 2GMJA 5GAEU 2CA9A 4B9MA 1GFWB 2F65A 2MKSA 2MQQA 2EFQA 4LREA 1UJ4A 2AV5A 2GO9A 1FDDA 1EB0A 4OI4A 2DCUB 1KQKA 2DT9A 2HK2A 1B7YB 2FIUA 1SIZA 1UJ6A 1FEEA 2FVCA 4HLBA 2IVMA 1YBUA 5GVQA 5KFAA 3TQ1A 3CJ0A 2UU9J 2NZCA 3R8YA 1U1LA 4R0JA 5IM0B 5K5MA 1XBWA 4QW8A 1IQZA 3FCHA 5GMDA 1H2VZ 2XI3A 2OPRB 1XJWB 1LWXA 2YX1A 2B7CB 3QGGA 1EQMA 4P10A 2H65B 4HT5A 4ZPCA 5A2QY 1ULRA 3BBFA 3BYPA 1PC5A 2J0XA 1MW7A 1TL3A 2DGTA 1GXLA 1FT8A 3CD5A 3PACA 2NLWA 1R0CB 1NK9A 1CULB 1S79A 2B0GA 3FDSA 4KO0A 5AE2A 4LF8F 3PR5B 4ID5A 3QRRA 2RVJA 1O8BA 2HFZA 1UVIA 2VIHA 4DSJA 3DOLA 2PN6A 2VOPA 3GILA 1JLCA 3ENQA 1IBKF 4MFBA 1J5OA 4CLTA 1PYOB 1HBNB 4E2FB 4NXNF 4WFXA 4RW6B 1XK8A 2DHSA 2OKQA 3M8PA 4KKOB 3BKTA 5EWGA 2VQFJ 3UD3P 2DR5A 1U2CA 3G8QA 5ETNA 4GVBA 5B08A 1X4FA 4HHHA 2O66A 1NJZA 2YKOA 4CI0B 3EGNA 2X1AA 4GC6A 1NDPA 2MKCA 4DV2J 1T03A 2DHGA 2GS8A 5B0EA 5LT5A 4ECXA 1M90T 1N88A 4WP8A 2HHTA 4F67A 4YDXA 2GX8A 3VF0B 3W2VB 2BOPA 5B7WA 3TOQA 2ZM6F 2QN6B 4DU7A 1WI6A 3HHNB 2QLFB 4F04B 3US5A 3HVRA 2PMZD 2R7SA 3D6FB 4DV2F 2WB1D 1T9VA 3MPVA 1RLDA 4EWTA 4ERDA 5HROA 2R7WA 1K73T 4IR1A 2NSCA 2IJRA 4ZS6A 3CXCR 1KC8T 4C8MA 2SXLA 4HYKA 2HVHA 3BSAA 1HQUA 3IM8A 4FKXA 2MZJA 3HFZB 1X4DA 3V4MA 1NK0A 2QLJB 1NJIT 3MM6B 3TR5A 5L1IA 1ZOTA 3QSYB 5GAGU 1S7HA 1AROP 2NCKL 5LMNJ 4P2MA 4DUYJ 4DSLA 5KT2A 1YBAA 3CE8A 1DLOB 1R8PA 3W61A 1NK5A 1SV5B 1AYEA 1CQNA 3QGHA 4ECZA 4KFBA 2OIHA 4F4XA 4I2PB 1W2IA 4B9SA 1NEEA 4OYAA 2W2QP 3ITHB 3O6QA 2HGMA 1KBRA 1HD0A 1N5VA 1S9GA 2CQ2A 1FX4A 2OO4A 5LL6d 2BJEA 5RUBA 2C2EA 2YKPA 4LFAF 4DR6F 3LP2B 1F5BA 2CJXB 4JI4J 4YB7A 1JNRB 2ZNZA 1GH8A 2Q79A
chains in the Genus database with same CATH topology
4G1PA 3THTA 2CVIA 2VBYA 2LA4A 2WK4A 3K7RA 2O5DA 2CPFA 1R43A 1XR5A 3DM2A 5LSRA 3OJUA 4LFBF 2HHWA 4C11A 1YTYA 2RJZA 1RT2A 2J9EA 2C22A 2I5JB 2NPIA 2MZSA 2ATLA 1C4CA 1S99A 1UL3A 1KQFB 4UY85 2UXCF 4IOBA 2JFDA 1Z2LA 2LVWA 5T7LB 3M6UA 2VUGA 1HMVA 1L3KA 1VOMA 2OPPB 2IAJB 2F8HA 4EBEA 2KHDA 1E6VA 3J7A1 2PI5A 3DLGA 3MGJA 4ED2A 2RMLA 4G6VB 4I7FA 3KK3A 1T02A 2D3UA 2EWHA 1CPZA 3MD1A 5E7OB 3Q2TC 1S1WA 2QA1A 3VAMA 4NLQA 4FYDA 5FIIA 3VCDA 1HNVA 4A8OA 1M1KT 2HNDA 4MH8A 4C3MA 2BQUA 5HI7A 4K59A 3PHEA 3VZHA 3GYNA 4HVZA 1HA1A 3I0RA 1WHVA 5KFKA 4YR2A 3BGRA 3AQOA 5C24B 1ZH5A 2HAIA 1C1CA 3KG1A 4BC7A 4URQU 1YJUA 1ZAXA 4KR0B 2VC1A 1FE4A 3VAIA 3TX8A 3UCUP 1WG5A 4OI3A 5KG6A 3DRXA 2NUHA 2LEBA 4WIIA 1RA6A 2FVQA 4N8OA 1SKRA 2HMIB 3R1HA 2F3JA 2BE2A 2RF2A 3TVKA 3SMZA 2BRKA 4FF4A 4K4VA 1SJFA 1OO0B 4WZMA 2FVPA 3DXBA 2D41A 1S1TA 3ISNC 3CCMS 1KFSA 3J7Z5 1FF2A 4ECSA 1CSJA 4WJBA 4PG5A 2DNGA 4OZ0A 3DNCA 1S1VB 1ZETA 2WOMA 3DLJA 2DITA 2IRXA 2XWXA 1JLAA 4M94A 3GR0A 3CCTA 2J0WA 4EO8A 2CJ9A 2V4JB 3T1AA 3PW5A 5IS2A 2PI4A 5KFIA 5DDRC 2IRYA 5KT4A 1VBZA 3GV7B 2C3MA 2VPWB 2AF6A 4QWBA 3H2LA 4G3IA 5A6PA 4CZCA 3N6NA 1S72S 1VQKS 1MMNA 3K8VA 5LXRA 4MIAA 5FLXY 5C5JA 2JC1A 5GAHI 4DG1B 3OR1A 5E41A 3DRSA 3V4IA 1MU2B 1H0HB 2XB2D 2VODA 1X4EA 2IJNA 3MUMP 2MZQA 4P6QA 4TY8A 2IM2A 2JVRA 4NA2A 3M2UB 7FDRA 4DQSA 3SV3A 4Q8FA 2LCWA 1H98A 1SJ1A 2BANA 2YX7A 4TU9A 5A8WB 5D3GA 4C0BA 3BN7A 3DLKA 2LQJA 4FF2A 3P3DA 3QAUA 4NCAA 2COLA 1KHWA 4DL6A 3UR3C 3I96A 3CJ3A 4ZCMA 1Q81T 1QUPA 3EGWB 1IKVA 2WBRA 5AXLA 2FHOB 2FJAB 3IGVA 4F3OA 2BABA 3MM7A 1HI8A 4KGKA 4B3TF 1YQHA 4XO0A 3C8YA 3MR5A 2AU0A 5CYJA 2MYFA 3WZ0A 5EWEA 5K8MA 1VK8A 2MZTA 4OQJA 4X4UA 5E3CA 4EBDA 5KFLA 3PY8A 4UUWA 4A8WA 2WW8A 4OZLA 2IAJA 2ILZA 3GB0A 1S6OA 4CNZA 2B4UA 1HHSA 2E44A 1X5OA 3S1TA 1B64A 2D7SA 3MCSA 2R7XA 1HYSB 2ZHBA 4NLSA 1TK8A 4QIGA 1SKSA 2RNEA 5FD1A 1YIJS 4MFBB 2RILA 1J5OB 2UV8G 4RBUA 2MGZB 1ZM3A 1ZTWA 2MZRA 3CD0A 2V0NA 3DI6B 3JYTA 1G1XA 1KLMA 5I3PA 4CO3A 4JBCA 1GXTA 2OPSB 1H2UX 1ZAWA 2MPUA 2DGQA 3M6VA 4PXEA 4A46A 4Q8EA 3FFIA 3OTEA 5DM6Q 1IR0A 1JLFA 3PEJA 4ED6A 4A8MP 1VRTB 5M2UA 5J2PB 3TAMA 3PX6A 4Z2XA 2LA6A 4OI6A 4BDPA 4N76A 3IWLA 4TLRA 2HZCA 2ROPA 3BGUA 3DHWC 4WFNQ 2RKIB 3OSPA 2GQCA 3OL6A 1TKZA 1U1QA 4RW4B 1TKDA 3QIPA 1Q82T 4R5PB 1J5EF 1YGYA 4DEZA 3HMJG 2OJ3A 4DSIA 1K0TA 4Y28C 3KLGB 3T1HF 2B9WA 4WFBQ 3L3CA 4LMZA 4DV5F 5IZHA 5EHHA 1SJ4P 3MOZA 4H4KC 3OL8A 4J37A 1NAQA 3OFFA 4IH5A 3NGDA 1DHMA 5KFXA 2QIFA 2QT7A 2OP5A 4EYIB 2KI2A 4OHXA 3CCLS 1U1NA 5KFGA 4Q5VA 1IKXB 4DL2A 2HHVA 4I6YA 3C6UB 3LQVA 2POKA 1S1UB 3RB3A 3MXHP 1SL0A 4JYAF 1S6PA 2ZKUA 4ECUA 1JLBA 1ZAVA 5CD4H 4ZVGA 2C28A 2BANB 4MKYA 4DHVA 1A7GE 2CPEA 4QYRA 4DN0A 4HI1A 4IG0B 2CJQA 3DM2B 1EP4B 3N6MA 4NYZA 5EUHA 5IT9Y 5DG7A 1P1LA 1RT3A 3T9NA 4ED1A 1H7XA 1HW8A 1Y5NB 1UEUA 3PFEA 1RTIB 1S9GB 3DLGB 1BQMA 2DIVA 4WE1B 1R6YA 2VFVA 1UVMA 2UV8A 4TYBA 1N6QB 4LFCF 4YR0A 4J9RA 2I9SA 2DR9A 3SCKE 3OTCA 4ES1A 2JWNA 5HBMB 1K9MT 5E3PA 1R3NA 5IWAF 2XY5A 2RUGA 1FDNA 3VAGA 4B3RF 2M9KA 3O8WA 4CH7A 3SCJE 4UUXA 3H59A 4QIEA 5DDOC 1YI2S 4YQWA 2YH1A 3NG8A 4J9KA 3KFWX 2OMLA 4H4OA 3OVAA 5T7LA 2YWKA 2ZH3A 4IUFA 1PSDA 3MEDB 2OMOA 1RT1B 3RW7A 1KTQA 1QE1A 2MQLA 5A8RB 2N3LA 3M9MB 1H7WA 2HNYA 3QZ7A 5CA5A 1YSJA 4JI2F 1VQMS 2XNRA 2VV5A 2AYGA 4HH0A 2HMIA 3IR6B 2GA7A 3RR8A 2RQKA 1RTHB 4C8KA 3J81Y 3C2PA 1DQAA 3M1VB 1L3UA 2FHJA 4MIBA 2Q66A 3QO9B 1VQ7S 4KE5A 4MK7A 4YEAA 4LSLB 2YWHA 4DFKA 2QLWA 3CCQS 1L3TA 1KS2A 1HQEA 1P8GA 1SH2A 2YKQA 3BZQA 4QR2A 3B4MA 4DSEA 1SUQB 2B5JB 1FHTA 4Q2MA 2BQ3A 1VQPS 2RSQA 2PO4A 4Q7AA 5D77A 4ECTA 1HFEL 1FRXA 2KU7A 4OX6A 1V6HA 3LP0B 4WK1A 1NH7A 5K9FA 1REVA 1FRMA 1MWYA 2OAUA 3IAS9 2R7TA 3FGVA 1XN9A 5J2QA 5CYQA 3DLEB 3H4BA 1TKTB 2LEAA 3RBDA 1JKHA 1FVQA 5D4NA 1O5JA 5HMWA 1HPZB 1Z2ZA 2GC8A 3O5TB 5E3AA 2HHPA 2RE1A 2EFPA 3LUYA 1JLQB 4CTAA 3CTRA 4HDGA 3PJXA 4E98A 2D74B 1TL4A 1NKBA 3IG1A 2NUUG 4ITSA 2GQ2A 4ALZA 5HP1B 2DHXA 4F26A 1U1KA 4HEA9 3G71S 3HHLB 2V94A 1WI8A 3FMBA 3ZC4A 3MEEB 3M2UA 4C0HA 4RNFA 4O3RA 3T1YF 4ZPAA 2GHWA 2PA8D 4B9LA 2HNZB 4RW8A 2QV6A 4CO2A 1S1XA 2YKAA 2X51A 1RK8A 1KOHA 4Q0BB 1O51A 3I4HX 2FDNA 5F9NA 1SJ3P 4M95A 4C8ZA 5AXKA 1CG2A 4QPTA 1DZ5A 2HNDB 2FGOA 3NCPA 5JUMA 1CLFA 2XS2A 1GQEA 2LXFA 1BQNB 2HNYB 2MDAA 4KIAA 4NA3A 3PW0A 4J9LA 5KFDA 5CYMA 4PQUA 2MQNA 2QLXA 4CH0S 2EW9A 3G8TA 4J9OA 2X1BA 4FS1A 3BGLA 4NRTA 1MNEA 2A18A 2HGNA 1HWKA 3OVSA 2IA0A 3DU5A 3OUYB 4OMFG 4FF3A 2B4OA 1I6JA 1YHQS 1U49A 2KO1A 3IO1A 2CZVC 1S77D 2VG6B 5HBMA 4DR4F 3SSRA 2GGPA 2WSEC 4KSEB 2ZD1B 4YMEA 1WHYA 5A0YB 3IAM9 3H40A 1Q7YT 5F3ZA 3RB0A 3MMCA 1L3SA 4PUOA 3KLIA 3AB2B 1Y9OA 4HTIA 3H25A 3BO2A 5H1SV 2DH7A 1FNXH 1TAQA 3HK2A 2RDJA 1Q78A 5KFPA 5KG7A 5KFJA