1KDNA

Structure of nucleoside diphosphate kinase
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
150
structure length
150
Chain Sequence
VNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIHGSDSVESANREIALWFKPEELLTEVKPNPNLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title AlF3 mimics the transition state of protein phosphorylation in the crystal structure of nucleoside diphosphate kinase and MgADP.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Phosphotransferase
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
total genus 44
structure length 150
sequence length 150
chains with identical sequence B, C
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1996-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1kdnA00
1F6TA 3ZTOA 4ANDA 4EK2A 3Q89A 1NSQA 2B8QA 4ANCA 1BUXA 3VGSA 4ANEA 4C6AA 1NUEA 5BXIA 2DXDA 3DDIA 1NHKL 1NDKA 2VU5A 3EE3A 1HIYA 2DXFA 4UOFA 3ZTQA 3EVMA 3Q8UA 1S59A 3ELHA 5IOLA 1HHQA 3VGUA 1LEOA 4DUTA 2DY9A 3EICA 4W98A 1NDCA 5CABA 1LWXA 3DKDA 3JS9A 3FKBA 3MPDA 4UOGA 3WX8A 2BX6A 3FCVA 3NGTA 3ZTSA 3EMTA 4WBFA 1ZS6A 1B99A 2BEFA 1NB2A 1NDPA 1WKKA 3EVOA 1NSKL 1NSPA 1K44A 3BBFA 3L7UA 5C7PA 2HURA 5CAAA 3FBCA 3BBCA 4O0NA 3ENAA 1MN9A 1UCNA 2CWKA 4ENOA 1WKLA 1HLWA 1BHNA 1XIQA 4KPCA 4UOHA 1NPKA 3G2XA 3ZTRA 2HVEA 3Q8YA 4FKXA 1XQIA 1JXVA 3FBBA 1NDLA 1F3FA 1WKJA 4HR2A 1U8WA 2HVDA 3EVWA 1VYAA 4F36A 2AZ1A 1BE4A 2DYAA 3VGTA 2AZ3A 4FKYA 1NLKL 3FC9A 3BH7B 1S5ZA 3FBFA 4DI6A 3NGSA 3GPAA 3Q86A 3VVTA 4S0MA 2DXEA 3BBBA 1W7WA 1NCLA 3PRVA 1B4SA 1EHWA 3VGVA 1PAEX 1S57A 4DZ6A 3EM1A 3PJ9A 4F4AA 3B54A 1MN7A 3R9LA 3FBEA 3BH6B 3ZTPA 2NCKL 4CP5A 3Q83A 3FCWA 3Q8VA 3NGUA 3VVUA 2ZUAA 3NGRA 2B8PA 1PKUA 3ETMA 3EJMA 1KDNA 3B6BA 3GP9A
chains in the Genus database with same CATH superfamily
1T11A 3EGVA 3RBXA 4Z7CA 2QIFA 3H8YA 4DUYF 2QSFA 1B0TA 1EKRA 4IO9Q 4ED0A 5CHCB 4GKJF 2CPIA 1SKSA 1WHWA 5IT9Y 3IS9B 5EWFA 3HDSA 1RT7B 2BV3A 3W7BA 3POTB 4ANEA 4EUVA 3CXCR 1IR2A 4WK3A 5FDLB 4K4ZA 2JLEA 3CIMA 4QIVA 2PA8D 3OR2B 3NAHA 3VAGA 1RTIB 3MMJA 3W5ZA 1IKYB 1DTQB 5A8WB 2QGFB 1G6BA 1RT2B 2ILYA 1FXRA 2LQJA 3D54A 5A0YA 1TELA 2AJ0A 1REVB 2CJQA 1ZOTA 3SQGB 1KFDA 2Z30B 5A8KA 1RI7A 1D1UA 2HNZA 2HHXA 4W4MA 2GAHC 3SBMA 3BYPA 4K2JA 5HP1B 3NMAA 3CCLS 3M2VA 1IWAA 1ZTTA 4NZ6A 4QZVB 3Q8RB 1GFWB 1Q0NA 2DY9A 4ZVEA 2XGPA 1FA0A 1Y9OA 1S12A 2V34A 3L9ZA 4DLGA 4F0KA 1WDTA 3MUMP 1P9YA 2VBYA 3C19A 5U47A 2HPUA 1CG2A 3M9OB 4MMOA 2BE9B 2JVOA 5L46A 4MH8A 2XS5A 1ICEB 4J9VA 3ISNC 2CPFA 2QX0A 4QU7A 1Q16B 4FS2A 3RW7A 4A8XA 3K7RA 2IRXA 2XULA 3MAAA 1U2FA 1VS3A 2CXEA 4QR2A 4BC9A 3D6TB 1JLBA 3P5TL 5CYJA 2HURA 3QGPA 4TQSA 3KG4A 4I2QB 1QAIA 2OH2A 4QIFA 5LL6d 1IR1A 1WHVA 5I3UA 3C3LA 4O4GA 2LEBA 2CWKA 3PW5A 2UUBF 2L41A 3LH2S 3SCLE 4RZRA 4WE1A 1ZAWA 4ALZA 2VHGA 4ZVFA 1X5SA 5T7LB 2VD3A 3LAKA 1HNIA 2N7YA 3JSRA 3G2XA 3HT3A 2RRNA 1DARA 1HBUB 1WUUA 3RGIA 5J2NB 2CPEA 5DGAA 3J80U 3Q8YA 4I69A 3HKWA 1RLDA 1GXTA 1FRMA 3M6VA 3DHXA 3MM5B 4LF8J 1TV6A 1YSJA 4NCGA 1NM2A 1T9WA 1Q82T 2FDNA 4MJKA 1UW4A 2ZBIA 4DV6F 1S1XA 2BW2A 3HHKA 4JBCA 1FRHA 4MKVA 3VALA 5KFFA 3ICLA 3A8JA 4GVBA 2Z4PA 2E5JA 3DCAA 2AZ3A 1APSA 2BE2A 4C3KA 1YI2S 4YB5A 3W61A 5KFWA 1CULA 1YJRA 3BDPA 4FF2A 2CQ4A 4NXNF 2CVEA 3Q8QB 4LSLA 2FLOA 2QV6A 2RUSA 3ZNJ1 4OHVA 3M2RB 4Q8EA 3SCJE 4C4WA 1OWXA 1U2RA 1JXEA 3LQVA 3NRBA 3BBBA 4M5LA 3RR7A 1ZZNA 1IWGA 3FVYA 3GIJA 4I6WA 4EZ9A 2FJDB 1O0PA 4OQJA 2QJ3A 4B9TA 5HJXA 2RS2A 3PX0A 5HLFB 3IG1B 3PFEA 3EM1A 4P71A 2VQFF 2O5DA 3HSGA 4DPYA 2R7XA 4K8RA 1FEEA 1P9QC 1RAIB 2HLUA 2M52A 2UP1A 1S9EA 2JEGA 5RUBA 3G4SS 1CJKB 3Q83A 1WELA 3KDNA 3TVYA 4MK9A 4ZVPB 3TOQA 3DI6A 2GJIA 4CQ1A 2CZ4A 1RWUA 3JTNA 4ECVA 3R7NB 2DHHA 1S6PB 2W4CA 1SV5B 3PG9A 3PYGA 8ATCB 5GAEU 1GXUA 5KFSA 1FRJA 2JFKA 3AJ1A 1ZA1B 2QLXA 4CM2A 5B7WA 3MM6A 4KY3A 3KTQA 3NBPA 5F8IA 5LSOA 3M1VA 1A6LA 3CD5A 2IC3A 3ENQA 1U6BA 5KFNA 2E9ZA 2OIHA 3RW6A 4JV1A 4LQ3A 1R8AA 3QJPA 2DO4A 1U1KA 2E5HA 4P73A 3NY0A 4NA2A 1RTDA 1X0FA 3P96A 3UR3C 2DR8A 2Q66A 2ABYA 2K1RA 5E3RA 1RU2A 4ZVOB 3N5BA 3W64A 4ZHRB 4X65J 3J81Y 1HBNB 1XTZA 4BWMA 3NNHA 2ZFHA 4ZLLA 1BXNA 1X4FA 2GC8A 3ZNUA 4ES3A 3G6ES 4NXNJ 1RK8A 1J5EJ 2VFTA 4WF9Q 1LWCB 1A9NB 3TZWA 1U6ZA 5CZVA 3AQOA 4ZJLA 1Q7YT 1S6UA 2N82B 2UUAJ 3D0HE 4CO2A 2VBZA 1NJYA 1ZTWA 3AJ2A 5I4MA 3QJLA 3NWGA 1S59A 4NI2A 4ZOSA 1CC7A 1XR7A 1T03A 3GSDA 2MZTA 2CJ9A 3MMCB 3CD0A 1OQ3A 2ZJRQ 2JNJA 5GVQA 2IVFB 1JJHA 3OUYB 2ZC4A 3A13A 2YKOA 4C0HA 3PR5B 4J9NA 5A76A 2IBKA 5HVHA 3FCVA 3QJJA 2HIQA 2PEHA 1UWBB 1TL1A 1V3RA 4TVAB 1ROFA 2HFUA 4LR8A 5AT1B 2N4CA 5DGBA 1J5OA 3AOCA 4OYOA 2XNQA 2SXLA 1OYDA 4C0BA 4DV0F 3MXHP 2WCXA 4NYZA 1QE1B 3D3BJ 3BJYA 3UN3A 1U48A 4FYYB 4DDFA 2W7PA 4OV6A 2R8JA 4RUBA 2C2MB 3VAJA 3QWUA 4OYZA 3TUJC 1VIXA 1C1BA 1CQMA 2HK3A 1YWXA 3QATA 4PPZA 4WIIA 1JLCB 3FMWA 6FDRA 4M63A 1KR4A 3QYYA 4ELVA 2EI5A 4ZPVR 4R5PB 1FVQA 2WBRA 3KG0A 2ASJA 4J9RA 4MKYA 3U27A 1SCJB 2GGPB 4OYMA 1KQSR 2X1BA 1EQ0A 1WC4A 2MQ8A 1RZMA 4NCAA 3H59A 4X4SA 3CCZA 1QD1A 4FPRA 4RUHA 4FNHA 5KFLA 4IO1A 4I2PA 4C3LA 3CJKA 5KFVA 1HARA 2R4FA 3I56S 3Q24A 3HSDA 2IIHA 2R7WA 2OELA 1TL7B 3LW5C 4UOCA 1JXVA 1N4LA 3FBBA 3FQKA 5HMWA 2R2UA 3IAS9 1CJVB 2FHKA 2XYPB 2APOA 2W2NP 4FPIA 2RKIA 3MF5A 4WWSA 5F8JA 2W2QP 1HYSA 3D66A 3PX6A 1Q7LB 4YP3A 3THVA 2MPUA 3K57A 3OXFA 2MGZA 3CT9A 4KPYA 3CO9A 2J76E 4J5OA 3GFXA 2ZH5A 2P9EA 3OPKA 2ALZA 1S1UB 2IFXA 1OQ6A 1X0PA 4F3QA 2NR0A 2GIRA 4AL5A 1PJ5A 4F3OA 1WEZA 2GHVC 2MTLA 2Z8QA 5KFOA 2J9EA 3AB4B 4Q5VA 2MQLA 4FN5A 1GEHA 3F0NA 1A0OB 1X4BA 1MN7A 5H1SV 3GV5B 1YBUA 4A8KA 3R9LA 3G8QA 3KG1A 3DLJA 4TXSA 1IN0A 1YRTA 2JHEA 1CSJA 2XMAA 2WVFA 4RLEA 4OHZA 3K5LA 2WB1D 2WSFC 3KK2A 3RB4A 2MSTA 1MU2B 2D3O1 1N34J 2A10A 2F9DA 4CDIA 4OX9J 1OPIA 1R3NA 4DV5J 2C2DA 2ZJPQ 5CCMA 1M5HA 3AXMA 4ZPTR 3PKYA 3MPVA 2Z2YB 2XM3A 2BABA 3CJRA 1L5UA 4EK2A 3Q89A 4HT7A 3P8BB 4BS2A 1U2CA 1Z2ZA 4B9VA 4LF6F 3W8GA 3CULA 3RBZA 4ES2A 1WD6A 3GONA 2LXIA 4DR7J 1UVNA 1MROA 2R2SA 1VC6A 2VICA 2CQ3A 1RXOB 3SFUA 1FDAA 4DL7A 4KH0B 5G0RB 2DNGA 4PG6A 3DRRB 4C3MA 1CBKA 2HRUA 3W8PA 4CYUB 1UVJA 1JJ2R 1T0TV 4KFBB 3DXBA 3HVAA 2PI5A 1NHVA 2E1RA 2HGNA 1KQGB 1SH2A 1U0SA 3QPIA 5K14B 3IWXA 5KG4A 3M8RA 2C3YA 2OEJA 2CA9A 1MW7A 3R5CA 1X5TA 1RT5B 4PYDA 2AYEA 3UDLA 2AWZA 4OZNA 4TU8A 3GZ7A 1VQYA 4QIWD 4QWDA 3BN4A 1RQ0A 2DGQA 1KKHA 2B6AB 2N3LA 4USIA 3M30B 3V81A 1U1MA 3C46A 3KHHA 4QWAA 2C2EA 2RHQB 3M8PA 3KLGA 1KLMA 4BDPA 1KBRA 3FK4A 4RW9A 5CABA 2B7BB 1YBAA 3DOKB 2O66A 3CCES 4GKJJ 1OYEA 1QUPA 1Y11A 2KHDA 5KOWA 1FJGF 4USHA 4EGLA 2R7UA 2KRRA 4KGVB 5KG3A 2CYYA 4N8NA 3ZTSA 4DBQA 5AE2A 2JEJA 1FE4A 2DGSA 4DR4F 2VFSA 3RBDA 3W62A 4OI2A 2W8LA 1SC6A 3GIIA 2KTQA 2FUG9 2U2FA 2HRYA 3BM7A 1QVGR 2HQDA 1W2BR 4IOBA 4OI1A 4BHQA 2VJVA 1YK9A 2DNPA 3QFHA 3B82A 4TYBA 4RNMA 9ATCB 3Q0AA 2HIYA 4CLFA 1UETA 1EQMA 1S4EA 4KV8B 4PKDB 4D3HA 1PBUA 1Q8BA 2WRMA 3OTOJ 2W7AA 2W2PP 4Y28C 1VQNS 5CYMB 1G4CA 5J1EA 3HMJG 2DIUA 1XMQF 4IR1A 1GH8A 2DR5A 4DV7F 5HROB 1L3VA 3ET6B 3PM9A 2RAQA 3CJ5A 1XIQA 3SCKE 5KFBA 2F40A 1U25A 2FHOB 2QRRA 5ETVA 3PZPA 1FRIA 1NPKA 3D6MB 2Y1JA 1S76D 3M9NB 2OFHX 3KUEA 1XR6A 2B56A 4WFBQ 1AFJA 5C25A 2E7WA 2DNMA 2RS8A 1SL2A 3NWRA 4RW6A 1NDLA 2FJXA 4CO1A 4WFZA 1WG5A 1YG0A 2UV8G 4TQRA 1RHRB 2V9KA 1IQZA 1S0VA 1TKXB 3NP5A 3R5GA 1VOMA 4YMEA 1S9FA 1ZM4A 2B4UA 3CCVS 4B17A 4ECSA 3L09A 1E6YA 2C42A 2YKMB 3OFHA 3JTPA 4QR0A 5F41A 5EHHA 5K20B 2QSWA 2AJ4A 3M8YA 4DPXA 4F4ZA 2QZ8A 3DXSX 1QM9A 3D5MA 3AAWB 1RHUB 2DB1A 4O44B 2ZH4A 2XI3A 1S97A 3PEJA 4ICLB 4OX6A 2OPPB 4KGKA 2FJBB 3AA8A 4G1QB 4O3PA 5M2UA 3RR8A 1WJ9A 3AH6A 2MKHA 4N77A 4OLPA 1R0CB 4ZKAA 4R8UB 2V2VA 5HK4A 5HVFA 3TZXA 3G71S 3MTKA 4LUBA 4Q43A 2PGCA 4NEZA 4DLEA 4RUCA 2DKOB 4DV2F 4BWJA 1OY6A 3OXGA 5IT4A 1WORA 3IRXA 4F25A 4YR2A 3D2WA 1HHSA 6AT1B 4DSLA 4ED7A 3I0SA 5DLFA 3TUZC 3M8QB 4A8FA 1UEVA 1LQ9A 4ZCLA 2DBBA 4Z7YA 3KJVB 2WSEC 4B3SJ 3O1LA 4JP8A 3KK1A 4F04B 2B8PA 1S10A 1T05B 4WTYA 1NU4A 2VPWB 3HCXA 3JQKA 2AIRB 4JV2A 2J7WA 3QRRA 1HNVB 3M9MB 3JSMA 5KFIA 3KUGA 3KHLA 4J9KA 4DUZF 4RW7A 4DSEA 2XG8A 4F02A 1FJGJ 4DV1F 4PXCA 1NJWA 4ZPAA 3RRGA 3VQSA 2XCAA 1TL3B 1UVMA 3J7Z5 1TVRB 2LDYA 3M2UB 4U9RA 1RWXB 1SB6A 2X1FA 4JI0F 2U1AA 3DGPA 3KLHA 4HVZA 1KQKA 1NJZA 4Q0BB 2GQQA 3DMJB 2CQ1A 4X65F 2XC9A 2OJ3A 4B3TF 2ZDOA 2HWTA 3BDEA 5B0DA 5F3TA 1Q86T 2JC0A 3OL6A 2ZWOA 1RTHA 2CQ0A 5CH7B 2E1CA 2ZHAA 1Q5YA 1R31A 3QT5A 5D15A 1W25A 3ITHB 7FD1A 3AA9A 5EGYA 4WIQA 2YWFA 1SC3B 2OD4A 4ECQA 2HVHA 2W9CA 2J9CA 1VGYA 2ZBRA 2VL1A 3DRPA 3VGUA 3TAQA 3PKMA 4RR5A 2IDEA 3LAMA 4HACB 2HBZB 1YJ9S 3HKZD 1DRZA 2L48A 2CQGA 3UD3P 2YNHA 3TAMB 4YY3F 4EI2A 3TZYA 2IRYA 3SEOA 2BYCA 2F3JA 1R6VA 3BPDA 2H5JB 3M8WA 3DLGA 1VLYA 2RSQA 2BX6A 3BN7A 3D68A 3IXQA 1YZ6A 4NYPA 5F9NA 1SJ4P 4ECWA 2J8SA 3LP2A 4OJGA 3GFZA 1HPZB 2AF6A 5EUHA 1RAHB 3GV8B 1G7CB 4KBIA 2BKPA 3HI9A 3C6UA 3TUIC 2FJEB 1KRPA 1NDPA 4LVNP 3OHBA 1HKAA 2M3DA 2MZQA 1K0VA 3K58A 3J7AN 1NSPA 1AYEA 1K44A 1T8EA 3I0RA 3L7UA 3VQTA 3ZZUA 3H5SA 5C7PA 2LLZA 4WKYA 3CTRA 2F9JA 1Q8KA 1WF1A 3VAMA 2GNKA 4ZVQB 3JB9k 1R0AA 4X4UA 2CPZA 2QLJB 5KT2A 3LALA 4IRCA 1RAEB 2QL7B 1C4CA 3DC2A 3PRBA 1SXLA 5LMUJ 1RAGB 5KG5A 4QCLA 1IM4A 3A3NB 3L4BC 2EK1A 2F1FA 1X9MA 3IRWP 1DLOB 1JB0C 1R8BA 4LIWA 1M90T 2QFJA 1TTHB 3TQ1A 1S72S 2GMLA 5E3CA 2R2TA 2KYZA 2R7OA 3CCQS 4DR2J 3SSRA 1S1WB 1IKWB 2BM0A 4PPDA 2H54B 1JKHA 3ILLA 1JXLA 4K4VA 5DETA 1RE1B 4XO0A 3IR7B 2VKRA 3BSAA 2AZ1A 4KSEB 2G0CA 3UDEA 1RUSA 2X1AA 2FVPA 4CNYA 4ED2A 1TP7A 5BYRA 2QYGA 1FK9B 7AT1B 4YOEA 2WK4A 3HVTA 2B9WA 4X66J 3P6YC 2HQGA 2VG5B 5B08A 5F8HA 5GAHI 4C97A 2AX0A 2MXYA 4S0MA 1KVIA 2ATCB 3KLVA 2IDLA 2VOPA 1PC5A 3W2VA 2I2YA 2COLA 3IM9A 3WC0A 3K5PA 3MEEA 5FD1A 4QQBA 8RUCA 2D7SA 2AGOA 2MB0B 4DSKA 4ZPCA 2R7RA 1QAJA 1RTZA 4GKKJ 1FJCA 2KM8B 1NZ8A 3KLEA 2MJNA 3OTBA 3H2LA 4IG0A 5L1IA 4ELTA 4X4NA 2KN4A 3MUVP 2UUCJ 2DHSA 2BA9A 3ZTPA 4ATNA 3FCHA 3MM7A 5KFCA 1Q8LA 3HPOA 3MCMA 2BW7A 2IPOB 2ZVSA 1FKPA 2GX8A 2YWHA 1FT8A 3WX4A 4WTOB 5DDRC 4OI6A 3GMGA 3R5BA 2PSZA 2DR9A 2AJQA 4QR1A 1RT6A 4KR0B 1HQUA 2JX2A 3I4HX 1CQNA 4CO0A 4WK1A 4OZ1A 4M5IA 4NPOA 4DL6A 4JB8B 5GMKa 4F4WA 2P9CA 2UUCF 3BKFA 3A1YG 3I5AA 5K8OA 2BJ1A 2DEIA 4TY8A 4N41A 1XEZA 4ANCA 3FGVA 3EGZA 4I7FA 5KFXA 2NYHA 3CJ2A 3THPA 3NMRA 3ZZZA 1IKXB 4PQUB 1VR6A 4X64J 5KT6A 2LQ8A 3U1MA 1U1QA 3H20A 3CW2C 3CJSA 3PX4A 1X4AA 4NRTA 3JQMA 3OXLA 5MAOA 1FX2A 1TKTB 3BR9A 3U1NA 2HZAA 1RBLA 2DXFA 3O3LA 3R5AA 1ITPA 3ZTQA 4TKTA 4HDHA 4QIGA 3OV7A 3J7YU 4C98A 2CUYA 4K4WA 2KFNA 5B0AA 2B3TB 2QE5A 2W24A 1EP4B 4C9DA 2B9XA 2ATLA 2FC8A 1NMEB 1JNRB 5KFPA 2BJ3A 1TAUA 1O6XA 1FFWB 1RHMB 5H9EJ 2FVQA 3QAUA 3ZZ0A 3DKDA 3JS9A 4YDDB 1RYSA 1AW0A 3FKBA 2F4VF 1IKVA 5KG2A 2R42A 1WC5A 4HHUA 2VA3A 2GO8A 3MOZA 4OI3A 2H9ZA 1I1GA 1IKYA 1ZS6A 4LQ9A 3CGIA 4WBFA 4M5MA 3TVZA 4JYAF 4LFBF 4M94A 4QYZK 4I68A 2LXUA 2OGUA 4KGMA 3HXMA 2RJZA 1QTMA 3DRYA 1RKJA 1S1VA 5A8KB 1D9AA 4FS1A 2ZNZA 1TKZB 3PYDA 1NXIA 2B5JB 3N9UC 3OVSA 2XO7A 4DFKA 5HP1A 4JI8J 2W1BA 4USWA 1KD1T 4DCJB 1HNXF 3FBCA 4XK8C 1YIJS 3M4XA 4BBYA 5F8NA 1D09B 4NWBA 3GLJA 3GE9A 4J9OA 2QYCA 1T9XA 3GSIA 1HR0F 3MMAB 1OPZA 1FKOA 3UFCX 3B8HA 4K2XA 1BHNA 3VV2B 2C3PA 2UVVA 2VOOA 2HS0A 4UUXA 3IN5A 1PYOB 2HHHF 4P2SA 3FJ2A 7FDRA 5CA5A 2A6OA 1EAYC 1O5JA 1SKWA 2W4DA 2DPIA 1LXNA 5EN1A 3KOAA 1SUQA 2Y1RI 1GMWD 2UUTA 4LT6A 2LU1A 3HHLB 2DH7A 4HI2A 1NK6A 1TUVA 1U8WA 5KFRA 1RTJB 1VBKA 4O3QA 3EZ5A 3TX8A 2NXCA 1N5YB 5CCLA 2V4JA 4ZP6A 4IFVA 1VRTA 1NLKL 1FD8A 1YGYA 2BJEA 4DR5J 2QA4G 5THWA 2ZH3A 1KWMA 2HAFA 4DI6A 4LF1A 1N8RT 1CJUB 1S48A 1Y5LB 1QSLA 4HT5A 1R8PA 5J1NA 1B4SA 2V5HG 4JI6J 2EC0A 1WSRA 3GR0A 4HH0A 1E6VA 2IMOA 5KTQA 4I67A 1FVSA 4DU7A 3PJ9A 2NZ4A 1S1XB 2V8HA 4F2RA 4CH7A 4ZN1A 1HA1A 1LWEB 1S6OA 3D28A 4DQQA 3B4DA 4ETZA 4B3RF 2XLIA 3GTYX 1EETA 1N5SA 2GVDA 2ZHOA 4N5SA 3H5YA 4WYLA 1U47A 4MFBA 1H2VZ 1TK0A 5L39A 5AXNA 3D9BA 1NEEA 1UFKA 2FPHX 3B78A 2PMHA 3GR1A 2QMUB 3NGRA 3OFFA 3QNWB 4QOTA 1OO0B 4QYRA 3VR1A 2DGVA 2D3OR 3G86A 3L95X 1FRXA 3M2RA 1ZH5A 4IFYB 1XN9A 3TWZA 5EDWA 2M5YA 4PQUA 3CMQA 4M5DB 5KFGA 4DX5A 1J5EF 3UQSA 3HHEA 3AXKA 1WI8A 4OJ1A 1GQEA 4LF9J 4K0KF 2KL8A 2XMTA 1B64A 4OJ3A 4IRDA 1D9FA 1X4GA 2XYGB 3VF0B 3BSOA 1DQAA 4LBPA 1UA1A 2NYIA 1FDNA 4Q2MA 2KFZA 2MLYA 4CNZA 4ZN3A 2H5EA 2CQPA 5BYSA 2EFOA 1D0EA 3DLHA 4Y00A 2DO0A 4JI7F 1HNZJ 2VU5A 2LDIA 2VPYB 2YKNA 2UV8A 3EE3A 3NLCA 2RRAA 4DG1B 1HIYA 3CC2S 3UVJA 1FNMA 1GMUA 1N5QA 3LP1A 3QT6A 2ASLA 2AYBA 2YY3A 2CNNB 3UDCA 4ER8A 3R2DJ 2C22A 2IC3B 1VRUB 1KN6A 4ZA1A 1U1OA 4J90A 4M5JA 2MHEA 4GRSA 4CZCA 4DN0A 2DD8S 4RJVA 3NOCA 3H4BA 2MQQA 2PE8A 1X60A 5A6WA 1A7GE 4LRBA 3LPEA 3OL7A 1QY7A 4B9MA 2E44A 3I5CA 3W66A 1X7VA 1LWFB 1HBNA 2FJWA 2E9RX 2YWEA 3W9JA 1XMBA 3TYTA 2W9AA 1RT1B 1RBOB 5E2QA 3TP2A 3G87A 3IM8A 3CCUS 2PT0A 2CG8A 1GX5A 4DX6A 1QUVA 5B0GA 4X62F 1XMQJ 3N6LA 4LRAA 2AEJA 3FMBA 1IBCB 3GCWP 5C42A 2H3EB 4O3OA 1JLAB 3JQJA 1I94F 3KXDA 2VUGA 3JAMU 4MKBA 2PDAA 4YQWA 4DS5A 2F63A 4DQIA 1IM6A 2WHOA 3OHAA 4PUOB 5D0EA 2HS4A 3KLIB 4ID8A 1WEYA 3R2CJ 1S9GA 4EBCA 1R8HA 2KG1A 3DN9A 1N52B 3I6PA 3CPWR 4KO0B 5F9LA 1JLGB 3V4IB 2OMLA 4OHWA 5G4DA 2GQCA 3GG0A 4I1TA 1WC0A 5E41A 4UQGA 3TAPA 1L3UA 3FRZA 1X8DA 4JI6F 2XLKA 2HHUA 2YX7A 1Y7PA 3E01B 4NXMJ 4HDGA 1NK4A 1RWNB 4NLOA 1C1BB 2UXCF 2VV5A 1VYAA 3EYZA 1WACA 1C1CA 3DRXA 2EEYA 3M32B 4AQYJ 2QFIA 4OZ0A 4J37A 3MD1A 4NMXA 5DQGA 2GFFA 2RB7A 5K8MA 4U6PA 4MIWA 3F41A 3EDQB 5IM0A 3MURP 3G6XA 4OX8A 1NBEB 2AEMA 3ILIA 3NGSA 1VQ9S 3DM2A 2Q6CA 3EGWB 2LKZA 4AUKA 1VCTA 3PIOQ 2N3OA 3PRVA 3PO5A 2LQ9A 4DQRA 4DV4J 1RHKB 1SIWB 1NH8A 1VHIA 3ETOA 3MHYA 2HFOA 3PNIA 2AD9A 1RWVB 5KG1A 5LXYA 4IUFA 2V2KA 1CJVA 3NAIA 3J80Y 3WC2A 1LXJA 2NXNA 3W5YA 2V69A 3FBEA 4U67Q 2HMIB 4OYWA 5D0GA 5JXSA 4DL2A 5D77A 1HYSB 1T02A 4RNHA 2DNKA 3CJ4A 1GMWA 2YNFA 4CP5A 1WC6A 2XLJA 1WTBA 4D3GA 1RT4B 2R9LA 4V19X 2K7JA 2LQ5A 4C8ZA 1S1UA 2OPSA 1NPPA 1KHWA 3C16A 4W90B 3WDOA 2B51A 4IYQA 4GMKA 1F1BB 5HMYA 2MQOA 2KG0A 3KK3B 5L1LA 2EKNA 2HHTA 2B4PA 2YH0A 3WQPA 5HN0A 2DY1A 5HAOA 5I42B 2K3IA 4DSIA 3TANA 2J8AA 3JXOA 3F73A 2VZ9A 5E33A 6FD1A 3MCSA 4H54A 3PRDA 1VBXA 4ITSA 3LGNA 2C3UA 4CH0S 5A8RB 3FZBA 4YR0A 4H4MB 2RVJA 4TU7A 2V8DA 4F4KA 2ROEA 3VAIA 3PW0A 1S0NA 3KK2B 2DXDA 2JZ5A 4DQSA 4G1PA 2CJBA 2MY7A 4KRWA 3H2UB 1UFWA 2H4WB 1VQ5S 1F2HA 2YNIB 5J2QA 4LR9A 4ZVRB 1IBKJ 1O8BA 1KS2A 3CNQP 3UO0A 5ETOA 2CQDA 1AXQA 1PCAA 3RRKA 5EWEA 4DS4A 1KFSA 5KG6A 2HHVA 3BREA 5BYQA 2XGQA 2I5JB 2Z2LA 1MROB 1C0UB 3EUNA 1HMVA 1Q5VA 2YH1A 1XNRF 2IM0A 3MZIA 8AT1B 4M5GA 2DVIA 1TL4A 3WBZA 2FIUA 4QWCA 2K06A 2VQEF 2DNNA 3DLBA 2QLFB 3ISND 2CDQA 3E3XA 2LYVA 2ZBCA 2Q3PA 3BS9A 1RGVA 3IR6B 4IKAA 2ASYA 2KVQE 4DV2J 4YB7A 1AZSA 3LPYA 5K14A 4IDKA 4DV4F 3ZZOA 2O3DA 1K1SA 4DV5F 4QWBA 4ED8A 4JI3J 2J9DA 2XHWA 3IP0A 2DGXA 4ID5B 1N34F 4P2XA 1DHMA 5SUHA 1HQEB 1NSKL 1VHFA 2OPRB 2UXBF 3M30A 3LGMA 1HNXJ 3HSZA 4CLLA 2WOMB 3KDOA 3AD8C 3C15A 4NA1A 3W1YC 4L76A 2J6UA 4DR3F 1H73A 3DYAB 3GU0A 3T1YJ 3GWCA 2QLWA 2V4QA 2CZVC 4DPOA 5IV3A 1C0TA 2E1PA 4MIAA 1XMOF 3AB2B 1N32F 1UAWA 1U8SA 1MMNA 4C11B 5HL7Q 1SKRA 2YBVA 1QSYA 3VAKA 4V19J 4ETXA 3C14A 3VCDA 4LF7F 4MT1A 1U1RA 2ILZA 5E5NA 3JYTA 4DR2F 3V6DA 2OTLS 3FSIA 2B4OA 3MEDB 1CS4B 2XEXA 2FZCB 3QZ8A 4O4RA 2IRUA 2J7KA 4F2SA 4F4YA 1F3FA 1EJ7L 1XERA 5DO2A 3SDEA 5HMZA 2HG4A 1JK9B 3H90A 2QL9B 2XZTB 4K4XA 1PYTA 5B0EA 2XMUA 3U1LA 3J81j 3KYLA 3RAQA 1BE4A 2VFVA 3ZZTA 1M1HA 4XIUA 1XWLA 3O6QA 5KT3A 2WW8A 2JEIA 4RX6A 4FVCA 1RSCA 5K9FA 5IWAF 5LMUF 2R7VA 3BZQA 4DMZA 3NNCA 1KOHA 2XTJP 2NREA 5ETLA 1WOSA 5L8RC 1M1KT 2FHMA 4PQAA 3KLFA 2DXEA 1N6QA 4TYAA 1GTEA 5C25B 3IC1A 2HVIA 3P45B 2NXJA 3HZEA 5ETRA 2P9GA 2GHWA 4ECZA 3QRQA 4IG3B 4C8LA 4DZ6A 1RDRA 2CQIA 2XSJB 3N6MA 5C24A 4WYWA 1VQKS 2JRSA 4JI2J 3IA0A 1W26A 3CE8A 3GYXB 5IC6B 3D3CJ 4R0EA 5J2PA 2J6SA 3I9ZA 3OQ2A 4HKQA 4M5KA 2KXFA 2F5GA 1T9TA 2JC1A 3GYGA 4M8LA 2LU2A 5CYQA 4ICLA 3RBEA 3EJMA 1KDNA 2HZVA 5HO4A 3B6BA 3DOMB 3S8SA 4ECUA 2MKYA 1YBTA 3EXCX 3K8WA 3V6DB 4PWDA 2XMVA 3BKUA 4ECXA 1GTHA 5KFDA 3V6JA 4KC5A 1RHQB 1HW9A 2YQ1A 1LOUA 1U09A 3MMBB 3MPUB 1UTAA 4IH6A 3VHQA 4J9QA 4J9LA 2OPQB 2UVWA 4Y6IA 1K47A 1UPMB 3UN5A 4C2MA 5GADU 1YHQS 4L3NA 3RTVA 2D9OA 5K5MA 2QA1A 4WP8A 4X4PA 1YQHA 3MEGA 4CI0B 4PABA 3DDIA 5LMNJ 4CLKA 2Y8YA 3W2WB 1HBOA 4XPEA 2DRBA 4PR6A 1Q8IA 5GAEI 3T5HA 1MSWD 1WG4A 2MKCA 3H2VE 4JOUA 2JEFA 2QO3A 2VBWA 3JSMB 2X3GA 2CQHA 3GCXP 4OLOA 4RW7B 4YB6A 1RKIA 2EPIA 4RW4B 2W8KA 4DUYJ 1S6QA 4B3MF 1X4CA 3BF4A 4C8MA 1TL3A 1VDHA 2DHXA 3ELHA 4WPAA 2FD2A 3FRYA 1H74A 4ED6A 4ZVSB 1YJWS 1TL5A 2HK2A 4B3TJ 3DLKA 3QIPB 3POTA 5D0HA 5F0UA 3QO9B 1HFEL 2O1PA 3LGHA 3R7BB 4RW8A 2BANB 5FDLA 2W9BA 3EPIA 3RRHA 2AJFE 3F44A 3BO2A 1CLFA 3OR2A 4OZJA 1WWHA 2XY6A 5ETSA 3OFEA 3W60A 3IGVA 4AL7A 1JLQA 1HD1A 1WNEA 1ACMB 2C2ZB 1LFWA 3R6GB 2ZJQQ 2RNEA 3LUYA 3W9HA 1KOOA 1VC0A 2HNZB 3BGRB 1NKBA 4FYXB 4DUZJ 1B7FA 3CDAA 1KP6A 2W9CB 2UVUA 2HFZA 2E9TA 2VBXA 4U8YA 3M2VB 5D4LA 1VI7A 2VJUA 5CD4A 2W2MP 2YNHB 2CPHA 4CTAB 1VISA 3BEGB 3HVWA 1FWPA 4X84A 3QGHA 4K5RA 2VPXB 3AD9C 1V3SA 2GVZA 1VRQC 5D6GA 2WONA 5SZTA 3I55S 1VMBA 5JJBA 5M2PA 1FTCA 1JJ4A 3HJFA 2J5AA 3ZTRA 3C6UB 4CLYA 3M6UA 3ZZPA 4QJVA 4Y2CA 1T3NA 1NAQA 5B0CA 3MAAB 3CB4A 3LTOA 4G6VB 2HHQA 4LSNA 1JLBB 2OI2A 2I6WA 3JAMY 4A8WA 4I2QA 3MI7X 3C66A 5D4OA 4ED3A 1KC8T 3H0PA 4Q7AA 4F36A 3MWBA 2R3VA 1LW0A 2BZ2A 5E7OB 5IQ6A 2MZSA 5I3UB 3R7SB 1O51A 1IJFB 1FWKA 1QAXA 3NOGA 3SYZA 3N79A 2AGPA 3KNGA 1SBRA 2MEWA 2Y8WA 2OP5A 3FC9A 3TQEA 4KHPF 4WE1B 1RWWB 2ZEJA 2ZD1A 2V68A 1FNOA 2IBOA 5T7LA 5CD4H 4DV0J 1NK8A 3Q86A 2BJ8A 1R8CA 1ZAXA 2W2OP 4QPTA 3NEKA 2PD1A 4EFAC 1C4AA 1HI1A 4YY3J 5BR8J 4PWDB 1LK7A 3U7JA 2F4FA 3OTEA 1IKWA 2DNHA 4P52A 4P72A 3G96A 2YNGA 1BWVA 1WF0A 4JI1F 3OJUA 2IY5B 2EC2A 5HQMA 5HMXA 2HHWA 1M5OC 1UFLA 3KNAA 5L9NA 3MTJA 1ZPVA 2HWIA 2HHSA 2DT9A 2BJ7A 2Y3YA 3C6TB 1S1TA 2RRBA 3PW4A 1U45A 3UE2A 4DV3F 1LV5A 2KJVA 3M6XA 3VTIA 3JSYA 5HBMA 2DRAA 1RAJA 1AUSL 3PW7A 1VQOS 4NLGA 2D3ZA 4WP9A 4A8SA 3T6JA 4K5SA 2HQIA 1G3OA 3MR7A 4IG0B 3SFGA 5IT0A 4DV1J 4A8MP 2ZOFA 4LMZA 2IYGA 2HBRB 2K3KA 3WIVA 2C28A 1AFIA 1IQTA 3GFHA 4U7UD 4YDXA 2GAGC 3DRSA 4ZVUB 1F9FA 2R8KA 1MMLA 2FZKB 2PC6A 2VB6A 3FFIB 2PI4A 2BR0A 5KG0A 3DI6B 3QAEA 4B9LA 1EX8A 3T9ZA 4DCPB 3BPSP 3MM9A 3OW2R 3ISZA 3EVMA 1H7XA 3PJWA 5B0FA 3MM6B 2C1EB 1UZDA 2HVZA 3MECA 2BQ3A 1SJFA 3CWJA 3M1VB 4MYUA 1K0TA 3K17A 2EW9A 3TJ8A 3CEDA 3QWPA 1FX4A 3K8VA 3MCOA 1WHXA 3A3PB 5ETNA 1CJTB 4I7FB 2XMMA 3VZIA 1VBZA 3Q23A 4EYIB 1WOPA 2ZUGA 3LP0B 5B0BA 1GK8A 4XPCA 2MKJA 1Z1ZA 2F8MA 3MPWA 2K1RB 4EO8A 5KFJA 4CCHA 4ZHRA 4RU2A 2PN6A 5L1KA 2G13A 1X31C 1ELOA 2MJUA 3IWNC 4RNNA 3CMAS 4WZQA 2DNYA 4MK7A 2F8HA 4CLTA 1FD2A 4ZLPA 3H40A 2G2YA 4OI4A 3DDNA 3QT8A 2QL5B 4USKA 4UY85 1DJ0A 4H4OB 2FLNA 1JLEB 2LA4A 2NSBA 1KTVA 2ZNYA 1EP4A 5DZ7A 1B0VA 1S99A 1NH7A 1V5VA 4NI2B 3PY8A 2IAJA 2VG7B 3MGJA 1TK5A 3DU5A 3MMCA 4H4KC 1BGXT 5ETQA 2FJAB 3OUYA 3FSYA 2RF2B 2KXHA 3O5TB 1FCAA 1IKVB 4XDDA 2M4MA 1MN9A 4ILRA 4YS2A 1WKLA 3PHTA 2BE7D 4G65A 4LF8F 4B3OA 2RDIA 1F5CA 1TL1B 2RILA 2KU7A 2OHDA 1P6TA 4ILLA 1FTRA 1QAYA 4KKOA 3SSQA 3MM8A 4UOHA 3H4DA 3QSYB 4EEYA 1J5OB 3A8KA 4U7UK 5L1JA 1P8GA 1JMTA 3D6FB 1SC4B 3Q8PB 2A2CA 2MKIA 4AYBD 2G1DA 2E5IA 2C2OB 4DX8H 3GV7B 1FJEB 4E0DA 3KMQA 2R8GA 4DR5F 1JWWA 2UUBJ 3K2YA 4MTPA 2JSXA 2AT1B 5MLCV 2EFQA 1XNQJ 2ZH9A 1FKOB 5C2GA 1REGX 1DTTB 1RB0A 4NLYA 2G4BA 1NJIT 2V8GA 1UP1A 2EG1A 5EWGA 4OZ3A 3UCGA 2CG4A 2DNZA 2MQMA 4I2PB 5DJBA 3TJ9A 1MWZA 2UXDJ 3T1HF 2MZRA 4ZVTB 2XSFA 1TL7A 1SUQB 3MR2A 3D1QA 3J7YI 2CZ9A 3AOBA 4ZPWR 3C8YA 5DG7A 2IA6A 4ILMA 3IS9A 2JWNA 1XNRJ 3FZ2A 1N5YA 2BOPA 2RKIB 5A6PA 4USMA 1VQ8S 4IFVB 1EIYB 2KT5A 1VJQA 1VRTB 1AROP 1RT7A 3BKTA 3CJ3A 3H25A 2IM1A 1QSSA 1B0PA 3A12A 5L9XA 3SZ2A 1WDDA 1IR0A 4CIOA 1RTIA 1RISA 2DTJA 4DR1J 1TKDA 5D8HB 1DTQA 1CJUA 2Z2MA 3IBCB 4P2FA 5A8WA 2Z2ZA 2KYXA 3DLEA 3KJFB 1L3SA 2RQ4A 2CQ2A 3PFOA 3SQGA 2EFGA 1REVA 4RWWA 5D0RA 3ZO7A 3CCSS 3R1LA 1VBYA 5H9FK 1F2GA 3H42A 4TY9A 2NZCA 3GJQB 5DLGA 4HTJA 2K7KA 2FC9A 4ERDA 3T19A 3I32A 1AB8A 1LWEA 1QJHA 3P3DA 5LM7E 2DNOA 1EETB 2XMKA 1SI9A 2JL9A 2ADBA 4MFBB 4RKUC 4X64F 3QGGA 2J0WA 4Y2MA 1ZYQA 5ETPA 2V0NA 2AKWB 1TZ0A 1U0HB 1SVDA 3HFVA 3NL0A 2WVCA 4CT9A 3I9V9 4Y34A 1VJWA 2W25A 3BQ1A 4IFYA 3PW2A 3AHPA 2G0IA 3DOLB 1X9SA 2FLLA 4B3SF 4A48A 2CNLB 4FYVB 4Z2XA 3R5DA 1X4HA 4KE5A 2IMWP 2V50A 4YB1P 4DSFA 4LFAF 4OZ2A 3MAQA 4JUZA 3LOUA 1F0XA 1NDCA 4U7CA 1K8AT 1LWXA 3CCMS 3HSJA 2VIHA 2XY7A 3DRRA 1LW2A 3MPDA 3TR5A 4I4BA 1XR5A 3PVXA 3RB0A 1IBMF 1CEZA 4NLSA 1QVFR 3TX0A 3CD6S 3BR8A 2J0QD 3HHNB 3C2PA 2L9DA 4E2FB 4YHHF 4EBEA 2M7SA 4EBDA 2FY8A 3LP1B 2VQFJ 3ONQA 2VG6A 3QLHB 5J2NA 2R8HA 2IVMA 1HL6A 5LT5A 2KFYA 4USTA 1YRUA 1FHTA 2BDPA 1RA6A 1TV6B 2NS1B 1GNKA 5GAHU 2BACA 1G2EA 5DS7A 2RMLA 1BC6A 4Q8FA 3M8PB 1UVIA 4L3KA 1V9OA 2YKQA 4AXJA 1S4FA 3GILA 2X1GA 1RT3B 3DOKA 5HJYA 4DHVA 2R8IA 4QW8A 1EB0A 3D0IE 4OZ5A 2BE2B 2HQ3A 1HLWA 3CIZA 2K8GA 2QA2A 3MCNA 3L3CA 3BGFA 1U1LA 3E2EA 1TMMA 1B70B 2P8IA 3MFHA 4X4TA 1MWQA 3R3TA 4UZCA 4M95A 1N5TA 3W3SA 4I64A 4DN9A 5GAGU 1SQEA 5T41A 4ZDNA 3IFEA 4CH1A 2WVEA 4AQYF 4AD6A 3K89A 1N48A 3MOJB 3RG6A 3GJTB 4DXLA 3RAXA 2F65A 5KFMA 3IG1A 2OAUA 5H9EK 2BQRA 2DNQA 2YX4A 2WVDA 2HVDA 3OTOF 1PJ6A 3OR1B 5CYMA 5HATA 4AXIA 5J1EB 4Q45A 2VKZG 1PJ7A 3EZOA 3VGTA 3Q22A 2CQBA 3ET6A 1S9EB 1F3VA 2FVCA 3IBWA 4G3IA 1Y5IB 3X3UA 2ZITA 4FP9A 4I56A 3H98A 4EZ6A 4FF1A 2XB2D 2YKPA 5LXRA 2HNYA 4KO0A 2FGOA 2OD6A 2CNOB 5DDPC 1S6PA 4DL3A 1SV5A 3OTCA 5IV4A 1KLNA 2Q1LA 3QFWA 2JOQA 2RQCA 1W7WA 4FF3A 2KO1A 1OMSA 2HAIA 3NBPB 5IFMA 2OO4A 4QWEA 2D69A 1HWJA 2YWWA 4RW6B 1R0BG 4K59A 2CQCA 3GB0A 5AJ3J 4O0IA 4MKAA 2D41A 1TKXA 2KVIA 5EX3A 3KWMA 1MMDA 1WSVA 1RTDB 2VFUA 1BQNB 1E6YB 1OJ4A 3N28A 2B0GA 1IVZA 4X62J 2HKEA 1JLFA 5KFUA 4O44A 4PAAA 1UJ4A 4OHXA 3N0VA 2DH8A 4DOZA 2OPPA 4X4RA 3PJXA 4G1QA 4KAIA 3PCOB 2D1CA 2C2KB 2Q43A 3EWGA 2HGMA 2ACMA 1XK8A 4A46A 4E98A 4ZIWA 2N7CA 1TUWA 3BYRA 3CD7A 3T5KA 2RQMA 1W2IA 4OYPA 4DR1F 3UI3A 2D9PA 1T03B 4BLGA 4YHHJ 2AJ2A 1R89A 1T9UA 2NSCA 3I0SB 2DHAA 3QZ7A 3N6NA 4LF6J 1YJNS 3RU0A 3QSIA 1U1NA 2AP6A 2XNRA 3MPYA 4KYZA 4WZMA 1DQ8A 3FDSA 5AXKA 1Z4UA 3NGDA 2V8VA 1N33F 1WC1A 1RCOB 1C2PA 2CPJA 4UOFA 2EBEA 1HNVA 2KB2A 4A8OA 5D3GA 4YEAA 1S79A 4QYZJ 2IM2A 1TFYA 2H5IB 4F3MA 1VLOA 1U6FA 4TLRA 4WU2A 5I3PA 5F0WA 5IOLA 1FKAF 1NJXA 4XDCA 4N8OA 5FJ4A 5KFYA 3M2UA 4IRKA 3PACA 4NE9C 4KQZA 5A8RA 5D4PA 4X4QA 2UU9J 4B9NA 1JLCA 4F0HA 1URRA 2O01C 5KFAA 5KAKA 1HQ2A 3GJSB 2X3DA 4OYIA 3WX8A 1RP5A 1DBDA 2E5LJ 2MYFA 4FBUA 2GGPA 4TNOA 1JIHA 4ZS6A 5KFHA 4YFUA 4X66F 2VONA 3D67A 1SQFA 4F0MA 1B99A 2EXUA 1RTHB 2ZE2B 4Z37A 1DFDA 4EMDA 4UUWA 4PRFA 4ED1A 2LQBA 1KSPA 1WKKA 2RU9A 2X51A 1VQSA 1R6YA 2P6TA 5KFTA 2FHJD 1N5VA 4DL5A 1Y10A 3DRPB 1SJRA 4HACA 2ACYA 3D1HA 2HLTA 1ZM9A 4L74A 2ADCA 3BBCA 2K2PA 4JI1J 1UL3A 2CRLA 4A4JA 1T3OA 1U26A 2GS8A 2YWKA 4OV1A 2YTCA 2ZKTA 2Y0BB 3D7SB 3OVAA 3MR3A 4I6YA 5GMEA 3PXGa 1F9EB 2MGZB 1S0OA 3LP2B 2H1YA 1UVKA 4K4YA 2QLBB 3SV3A 3SMZA 2DHGA 2I0XA 2LEPA 1X4DA 2OFGX 3FNNA 3HM9A 1TK8A 2MZJA 3NKYA 4EO6A 2W4PA 5E3PA 5EX0A 1Y00A 3QIDA 3A3OB 5IC4B 3A4TA 3S1TA 4AFFA 3K59A 3C15B 1BQMB 1Y3KA 4NASA 1H38A 2A1BA 4RO0A 5ADZA 1N88A 3QMQA 2ZBPA 4EWTA 3QT7A 4WJBA 1IBLF 1KHVA 2VDHA 3DNCA 2AJ1A 4J91A 4ZVGA 4C11A 1RWMB 3ZZRA 5J1PA 1S5ZA 3LWMA 1MU2A 4WXOA 2G0JA 5E0OA 2R2RA 1D8YA 1F9HA 2FTRA 3RB3A 3ENVA 3VVTA 3MR6A 2QTWA 4GC6A 3V6HA 3NNAA 2V2ZA 1U24A 5DM6Q 4FXVA 1U1PA 1DZ5A 4ELUA 2A3JA 3RUBL 3PHEA 1Q1KA 2AV5A 3UDVA 4L6V3 1HBMB 3G9CA 4YR3A 1JKHB 4A47A 3N5FA 2E66A 1NK5A 3UWTA 4JI7J 1PO6A 4UZBA 1NHUA 2HS3A 1IBKF 1YX2A 2MLXA 1B7YB 5AE3A 4WFNQ 1X5PA 4WU3A 1YITS 1NB7A 4HH1A 2ZUAA 4KFBA 5FLXY 2EK6A 2LMIA 4DU8A 1K9MT 1SIZA 4OYXA 1RADB 4P6QA 1I3OB 1URNA 4K4UA 3US5A 3IBFB 4LFCJ 2RDDA 3FEYB 2JLGA 4DZDA 1N6QB 4LFAJ 3P49B 4PXBA 3MEEB 4WXWA 1RT5A 1N0VC 1R43A 3GG1A 2PO4A 3M8SA 3GIRA 4C8KA 4U8VA 4IG3A 2ZOGA 2EWHA 1UZHA 3V81B 2IVYA 3OSPA 2M2BA 2ZZNA 2DIVA 2HBQB 1P1LA 1P1TA 4DJBA 3CDBA 2XSJA 5C24B 3MD3A 4ES1A 3KLGB 3N4WA 2XS2A 1VIOA 4L72B 3MM7B 4PZVA 2XO6A 5J2PB 4IR9A 2OSQA 1D8ZA 2DGTA 2IHR1 4USUA 5KT7A 4FYWB 5CYQB 2HNDA 3BSCA 1NNDA 2BUNA 5J2MA 1XJWB 2RUGA 5KT5A 3OTDA 2RU3A 1N54B 1Q78A 2WBMA 2GHPA 2HHPA 5HVGA 1VQ4S 3CJ8A 1VFJA 2RQKA 5KOXA 2BKNA 4DV3J 1FO1A 4TY8B 1R7IA 2OPQA 1HHQA 2M0GB 4KV8A 1IJEB 2OLWA 2B4VA 4LBHA 2KT2A 4P7VA 2LXFA 2NPFA 4DUTA 2WZ1A 3T5LA 1H6KX 2MY8A 3BGUA 2CJKA 1KTQA 4OYAA 1YRXA 4N47A 3SXLA 2M9KA 2ZKUA 4C8NA 1UVLA 1KVJA 2GQ2A 2A6MA 3I96A 2PFFB 1PC4A 1UMJA 3S01A 5DG9A 2BVZA 1TKTA 2VPZB 3CJ0A 4U96A 1MNEA 3KKFA 5A2QY 1SC1B 4O23A 2LFVA 3CC4S 5BR8F 4L75A 4I6AA 3HJVA 4PYAA 1TMJA 2CPXA 2EKYA 4LF9F 2H51B 4K0KJ 5D4NA 3TA0A 1HWIA 3AJDA 3IWLA 2RDJA 1S6QB 1I5OB 1HI8A 3TZZA 4RBVA 2VC0A 3V4MA 4ED4A 3G6YA 4QU6A 1IXKA 1YJTA 3HP6A 1M5PC 1TAQA 3VZHA 1BQXA 2NPIA 3RZAA 1IBLJ 2DGUA 4KT0C 2C2NA 3PEHA 4O0NA 4DFPA 2M70A 4RW8B 2W9BB 2HFVA 2HGLA 1UEKA 2YKMA 2FYXA 3OFGA 1GXLA 3PV8A 1FRLA 1SL0A 4H4KA 3UNYA 4FXDA 4B9SA 2FVSA 4NEYA 4ECRA 4HI1A 1IBMJ 4V1Ak 4N56A 4FXWA 3GIMA 3BGRA 1SH3A 2JJ4D 3QQCD 1FE0A 5D78A 2B5JA 3T5JA 4HL9A 2PA3A 4JYAJ 1EZZB 4KGXB 4BC7A 4LFBJ 3G82B 4HR2A 1YLXA 3SIPB 2XS7A 4GVLA 2DITA 1LKZA 1BD6A 1OSCA 3L7PA 4CTAA 1J2VA 3TEHB 2O67A 3AT1B 3ULHA 2C2RA 3MMAA 1U4BA 2KH9A 3OD2A 3AD7C 1GT8A 2WONB 3HFKA 3M8QA 4OMFG 1OY9A 2QG9B 3AOAA 2HSEB 2IA0A 3KJVA 1K73T 1RWPB 1SH0A 1OSDA 2EFPA 3KJQB 4RWXA 3KK1B 3HO1A 3OLBA 2NXEA 1MG7A 1T05A 2ASDA 1HD0A 2G1HA 4CM0A 1RJJA 3PTWA 2Y9HA 4DQPA 3HZGA 3I31A 3CCJS 1SPBP 2WW4A 3HHLC 1PAUB 2J0XA 4BCAA 4LSNB 4NLDA 4URSA 3W9IA 3HHLA 2ZOMA 4U95A 4ZMMA 4Y65A 4CLWA 1H2TZ 1RACB 1VK3A 1NPRA 1TVRA 2CADA 1Y5NB 4WFYA 3UCZP 1RABB 2VFRA 1HWUA 1T9YA 1HHTP 2IJRA 2MKKA 4JI4J 3NG8A 4UQTA 5JVGQ 3CDUA 2JDJA 2A18A 1AA1B 3CJQA 3Q8VA 4J9PA 1RWKB 2ZD1B 2XYHB 3RB6A 5B09A 4PWWA 3FSXA 4B3MJ 2OUGA 2ZM6F 2KI2A 2GW8A 1PYSB 2DEJA 1RT2A 2KDOA 2IJNA 1NSAA 4NLTA 3S7RA 5A0YB 5LJ3Y 1VC5A 2AQ4A 4PEOA 4CLZA 3NCQA 2BBEA 2B8QA 1YZ7A 4NL5A 4URGA 3EPGA 2GZOA 2UUAF 4ZITA 2L3MA 1NKCA 3UN2A 3K5OA 2QMXA 1JX4A 2DCUB 3ADAC 3T1HJ 5ETTA 2DRDA 3ZZYA 1UKUA 2Q6BA 5KT4A 3G6VA 4CO3A 2FLPA 3OLAA 1HPZA 5HBMB 1ZZFA 4B3RJ 4NZ0A 5DRKA 2E7XA 2PMZD 3T3FA 1GAOA 4M5DA 3PIPQ 3H7HB 2ZHBA 4KJIA 4J9SA 4B08A 3Q8UA 4ZP9A 1HNWJ 3UPFA 4P74A 1WC3A 4Y3CA 1NK9A 4ZPDA 4RBUA 3EZUA 5IZHA 2P2CB 2WTFA 3QBCA 4PG4A 2C3MA 1R0AB 4JI2F 2VA2A 2FB0A 1XBWA 1ZBTA 2XHCA 3MDFA 2DH9A 1YKWA 2VF3A 4O4GB 4UOGA 2V4RA 2KZZA 1F5BA 1NRKA 3ZXWA 4Y2AA 4KB7A 5JVHQ 3DDKA 2D74B 3HD1A 5HI7A 3MM9B 2ZM6J 1HNIB 1J27A 4OZLA 2LVWA 1HBUA 3Q8SB 3MECB 1TR0A 1L3TA 3J7ZT 1OY8A 4FVMA 2W01A 3SV4A 3MM5A 3GJRB 1V5IB 2XI2A 4NCGB 5DDOC 2F8EX 1S1WA 1CJTA 2LCWA 1HWLA 1UJ6A 1X5OA 1I51B 4K7QA 4MK8A 5E3AA 2PMWA 2XZDB 4PG7A 5GMDA 4ZK7M 2R7SA 3TUPA 1CPZA 4GVBB 4AL6A 1WI6A 1BMQB 1LWFA 1RHJB 2EG2A 2ZH7A 3D6HB 4ENOA 5LSLA 4QIEA 3R1HA 1FK9A 2FHJA 3LA0A 3BO4A 4KHPJ 4F8RA 1CULB 1WTFA 2MQNA 4KPCA 3W63A 2DK2A 2KRBA 2YKAA 2VG5A 2YQ3A 3CVKA 2YWGA 4I0WA 2KKHA 4LSLB 3BQ2A 4UF4A 2IM3A 3T6BA 4DV6J 1FXLA 1RAAB 1X9WA 3GQCA 3HF5A 4GKKF 1JLEA 4LF7J 2MDAA 3FEZA 1NK0A 2FJVA 1I6JA 1CVJA 4NCBA 3MUTP 1Q81T 4PG5A 1QDUB 3CDEA 5C42B 2E1AA 1F60B 1ZM3A 3R6LB 1JLAA 4LF5J 3A8EA 2VODA 2IAJB 3PYEA 1WKJA 2OKQA 3KLEB 5HLFA 4KTQA 3E51A 4LJMA 4O3NA 5IS2A 1KNZA 2J0SD 5HQ8A 4DR6J 1Q95G 4IH5A 4LRCA 4ZIVA 2ZWPA 4CLPA 5IWAJ 2HFSA 2ZBQA 3KLIA 1RLCL 4OYBA 1S9GB 1CJKA 2LP4A 1SJ3P 2OSRA 5BJRA 4KKOB 2BRKA 3TEGA 1AUDA 1JLGA 3V4IA 1Y4ZB 2XWXA 4OX7A 3J81U 2F4VJ 3R97A 2HW3A 1DAXA 1HQUB 2WSCC 3W5XA 1RCXB 5T14A 1ZAVA 2CFXA 2H4YB 5GAGI 1RWOB 3E01A 2ROPA 3VGVA 1G1XA 5AXLA 2I38A 2MLZA 1PAEX 3KJNB 1RA7A 1YJ7A 2CJYB 4USVA 3OBIA 1FEHA 4ED5A 2CAJA 4P75A 3OT9A 3J7A1 4LR7A 1TQLA 1P27B 4ZPBA 3FQLA 4ECTA 4NLXA 3MR5A 1IKXA 1RAFB 3M32A 4IH7A 2E5LF 2V67A 4RNOA 3O2IA 4J7CA 1WG1A 1UEUA 3NGUA 1HNWF 2AMCB 3Q2TC 2JVRA 3D1OA 3BQ0A 2M8HA 1LWCA 4JI5F 2WB4A 2KM8C 3TW0A 3VAFA 1FJ7A 2JH3A 3ZTOA 4DPTA 4LF4F 1FFGB 2HEKA 3P5BP 2RE1A 1SL1A 1SJ1A 2X7IA 3HD2A 3S6EA 1KVKA 3VGSA 4ZLJA 2NQPA 1BWEA 4LREA 4OJHA 1GMVA 2OEKA 3R5JB 3KMSA 4C6AA 5FLXU 5LMNF 3F56A 4OHYA 1NDKA 1RT4A 2HZCA 2PEBA 4RNFA 2RH3A 1UWBA 5DM7Q 2H65B 2AEFA 4GC7A 3OVBA 3V2UC 1L3KA 2OPSB 3C16B 3UCUP 4ZCMA 1VQMS 1N36F 3DLEB 3T41A 3PDNA 1S7IA 1DQ9A 1S1VB 2AW0A 3E8OA 9RUBA 5KG7A 2ZH1A 1QE1A 2KJWA 5M2RA 1QTNB 3TVKA 4MIBA 3LF0A 3I87A 1TKZA 3ILJA 4M5NA 1WEXA 2J6TA 2NUHA 2QMWA 1T94A 2XMWA 3I4PA 3SCIE 1MLAA 2RHSB 4DR7F 2QT7A 4Q2LA 4W98A 1PG5B 1RAOA 3NCRA 2GJFA 2V2QA 1HW8A 4R5PA 2RIJA 1PBAA 2AHOB 1U02A 4NLRA 1SKUB 1RYRA 2HHHJ 3BGLA 2ROGA 1U0HA 2PFDA 3TJAA 5F8LA 2BQUA 4PWUA 2KZMA 3GIKA 2BEFA 3DOLA 4NOHA 1NB2A 3NS5A 4TLQA 5AJ3F 4CLUA 3BSNA 4WP3A 1LFPA 3CJKB 3RJMB 2RD5C 2AGQA 3HK2A 4C0OC 2MKSA 3ZC4A 1TFWA 4OI0A 2CWXA 4JI8F 2HRTA 1XNQF 3UR0A 1RTJA 4ZP7A 1QLNA 2V8PA 3T9NA 2V4JB 1DURA 1LW2B 2JFDA 3TA1A 4CT8A 3EXYA 5CXTA 3AQPA 1S7HA 4EU0A 4IDKB 3L7OA 2EVZA 2FVRA 2I9SA 4URQU 2CPYA 1SJQA 3QGIA 3TA2A 2A2DA 2N4DA 4JV0A 2VG6B 3QLHA 2A0FB 1R27B 4DPUA 4X4OA 1Q4RA 1HQEA 2NXUA 4F26A 3D0GE 4HTIA 2J7UA 2WOMA 2Z57B 4DL4A 2E7VA 1E6VB 2ZDPA 3DGVA 1HR0J 2L08A 2BJDA 3ILOA 4LF4J 4UTGA 1RT3A 1YJVA 3FUYA 4FBTA 3DYAA 3BV8A 4R25A 5HQLA 5KFEA 4B9UA 2I8EA 2CKWA 4FKYA 1BLUA 4W92B 1UPPA 2GVDB 1S0MA 1XMOJ 2ZH2A 3FBFA 4XTTA 2DGWA 3GPAA 4OFZA 4WFXA 5DQHA 5K8PA 1S77D 2E29A 1PGZA 1M5SA 5ETMA 2UU9F 1H98A 4CO4A 4CLSA 1CS4A 4QW9A 4CRJA 4K50A 4RPFA 1S57A 4IOAQ 4LRFA 2WVBA 3BGOP 2G2OA 4PG8A 4F4AA 3NCPA 5I3QA 1FXDA 1JQGA 3OR1A 4NYOA 4LF2A 2ZC3A 3EGNA 3BH6B 2FZGB 3LO3A 4Q44A 1NKEA 1T9VA 3D4JA 5G0RA 1Z2LA 1HI0P 1ULRA 1N36J 4CYUA 1FNXH 1NO8A 3IO1A 1FF2A 2HNYB 2YKNB 4F67A 5DG8A 4DG1A 3ETMA 4C7QA 1I94J 3KLFB 3UVJB 2DCLA 3BO3A 1KQFB 3JSBA 1IUJA 1VK8A 2YX1A 1UW9A 5LSRA 5KFKA 2HYIB 1B3TA 4MYTA 1V6HA 3X1LB 1NSQA 2I1RA 2BXJA 1M1GA 1VRUA 2GJ2A 2B6AA 3HLUA 4NRUA 3RAMA 2AU0A 1UA0A 3H5XA 2P6SA 1BUXA 2HQCA 3CSKA 4P10A 2IJFA 3M7VA 1KLMB 2Y1LB 2QN6B 2ALYB 2V6AA 4RW9B 1U49A 1FWLA 1BQNA 4JI5J 1FDDA 4X2BA 3HHLD 1NUEA 5BXIA 1ZA2B 1JLFB 4XAKA 1NHKL 1PILA 2DPJA 4O3RA 4DFJA 5JUMA 3W65A 1TUGB 1AT1B 1RT1A 3TI0A 1LNQA 3IR5B 3DOMA 2L9WA 4TU9A 5ETKA 2BKOA 5CQGA 5JMNA 4QBUA 2B43A 4L73A 1ZPWX 3HFZB 2CVIA 5L38A 2Z58B 3HHDA 2HFNA 2YVSA 4PCQA 5LJ5Y 2AYGA 3V5RA 3HX9A 3K5MA 2XY5A 5ITHA 4ZCKA 4Y2IA 3UNGC 1LEOA 3B4MA 3Q2SC 2CDRB 4NLPA 3KHRA 4LF5F 3EICA 4OL8A 3DU6A 2ZZMA 1JNZB 1X4EA 5DDQC 4CO5A 4HEA9 3EDRB 3JTOA 3G8TA 4ECYA 3AY0A 5HROA 2GIQA 2LA6A 4LRDA 4PUOA 2Z56B 3WIUA 4C8YA 3EMTA 2R7QA 1HBOB 2FY1A 4TN2A 2DNLA 1GX6A 1DY3A 1N32J 1H3DA 5D3GB 4Y2KA 3RYLA 4E8UA 5E3QA 3T1YF 5AXMA 1PIEA 4RW4A 4DR6F 4WKRA 3GFYA 4HYKA 2XZWA 2UXDF 4KGZB 1WOOA 2RT3A 4KHRA 4K4TA 2ZH6A 2XBPA 4CWBA 1RU1A 3IMQJ 2Z0GA 3DLKB 2OMOA 3HULA 1Y0HA 3QIPA 3QO9A 3U02A 3OL8A 3LANA 3NXZA 2MMYA 2BANA 4M5HA 1UCNA 1N56A 1C1CB 4IQMA 4UW2A 4ZCIA 2XCPA 4JI4F 4HLBA 5IM0B 1JLQB 2DJWA 5C5JA 2ZE2A 4DL0C 3NGKA 2BRLA 2YPYA 4P7TA 3DM2B 5LOQA 3IAM9 2HBYB 2BJ9A 2B9EA 3KUHA 2VDIA 3CDWA 4R8UA 3R8YA 4FKXA 4DEZA 1XQIA 3DFEA 2LEAA 3R27A 2BOAA 4USJC 2CIMA 3EVWA 3IGNA 3IRXB 4FNIA 3DHWC 4NLVA 2HMIA 2G9OA 3CO0P 5AE1A 3CCWA 2Y1IA 3DLLQ 2GVZB 2W7OA 1Y3JA 4KIAA 2YNFB 3BH7B 5A2QU 1F5AA 4FYDA 2DR6A 4Y0FA 1EKSA 4P2MA 4NZ7A 5C2CA 2IYIA 2DR7A 3PO4A 2P5VA 1YJUA 2YQ0A 1FFSB 3H5UA 5FIIA 2AX1A 1EHWA 5IQQA 2MZ1A 2OEMA 3KK3A 5I42A 5IT9U 4DCOB 2QA4S 3N01A 4FF4A 1YVFA 2GA7A 4YN3B 4DX7A 4ZLNA 3CCRS 4DSJA 1BQMA 1MWYA 3CUNA 3SI8A 1D9DA 1LW0B 2ZH8A 3UD4P 1RBAA 2ZVIA 4DR4J 2DISA 4H4MA 4OIXA 1FERA 3DGPB 3KLHB 4F50A 2UVRA 1N33J 4Q0BA 2ZZTA 3DMJA 1EARA 3FCWA 3VVUA 4HHHA 4J9MA 4R0JA 4F7VA 3VWSA 1PKUA 2KT3A 1FI4A 5K8NA 1TU0B 3A8IA 2YNIA 5J2QB 3CJTA 2FGCA 4JV5J 3PYFA 1U7LA 1ZETA 1H0HB 1F6TA 4NLWA 3HT0A 4ANDA 3AODA 3ITHA 3SQOP 4B02A 1M5KC 3QRPA 1HBMA 2BM1A 4AE5A 5DZ6A 1PSDA 2PIIA 3TO8A 2YNGB 3CC7S 3UW1A 4YUDA 2I5JA 1C0UA 1HMVB 2OTJS 2KXNB 1BY9A 1FRKA 4GO7X 3TAMA 4JV5F 1H2UX 2XMJA 3O8WA 1HNZF 2EBGA 3DLGB 4LVOP 3C6TA 4C48A 1S1TB 1OIAA 4ZJOA 2GIFA 1AZSB 5KFZA 3G8SA 2GMJA 2B7CB 4IQXA 3MFIA 2G2ZA 4K4SA 2VC1A 1Q79A 3M6WA 4ID5A 2CJXB 2NLWA 1OS5A 2MHNA 3HVRA 2L9NA 2OPRA 5HSPA 4WCEQ 1K1QA 1S49A 3I0RB 4RUAA 4G1IA 4GO5X 2GMHA 4JI0J 4EYHB 2E5GA 2E1MC 2GCFA 4NXMF 5H9FJ 3MEKA 3VAHA 3DRSB 4PXDA 3I5BA 4A8YA 2VASA 2JLFA 2UUWA 1FDBA 3FFIA 3M8ZA 3WZ0A 4LBIA 3MAHA 1C0TB 3NGTA 2DNRA 2AYMA 1NZAA 2HQFA 2Y0SD 4NA3A 5F8GA 1T95A 2HNDB 4A8QA 5J2MB 5GADI 3CF5Q 1T7PA 1H7WA 2CNKB 3OSNA 4MAKA 4KHMA 3C14B 5F8MA 4RU9A 4P9SA 1DLOA 1HWKA 4NLUA 4QPXA 1WHYA 3KHGA 1LK5A 3WHIA 3TARA 3OL9A 2EFVA 4KH1B 3JYTB 1UJ5A 1WF2A 3EVOA 2MSSA 3MEDA 3BBFA 2H48B 2DGOA 2XQCA 4LFCF 4IOCQ 1V3ZA 1D3WA 2EFNA 3SDEB 3LP0A 5CAAA 2M8DB 3ENWA 2VH7A 4ZP8A 4PXEA 3OJSA 2NUUG 3ENAA 2CJAA 2GV1A 2V94A 4AT1B 1ZM2A 4DR3J 4N76A 2WAQD 4X4VA 1M0SA 3HVTB 1VQ7S 4NMLA 4NLQA 4O3SA 2YXLA 1VQ6S 3FEXB 3I82A 2UXBJ 2BMBA 2KHCA 2J9DE 4J9UE 5IXUA 3TNVA 2QC3A 2HWHA 4H4OA 2HVEA 4DF8A 3W2VB 1KONA 3EX7B 1CC8A 2YPZA 3K0JA 3O44A 4LIRA 2D3UA 3M05A 2M88A 5F3ZA 4DV7J 3KFWX 2VG7A 4RL1A 3PR4A 1UWAA 4DPWA 2UXCJ 2RF2A 2V63A 2F7VA 2DYAA 2VQEJ 2CPDA 2POKA 2B9YA 3T1AA 2R7TA 1SQGA 4N7TA 3THTA 2QEXS 4B3OB 3K5NA 4DF4A 1FKPB 3UD5A 2C3OA 1YDLA 3GYNA 4RBTA 3SSSA 3MM8B 2ERRA 2FQQB 1NK7A 4WFAQ 1VQLS 4ZJQA 4HHJA 1RT6B 4C8OA 4M1KA 4JI3F 5DQIA 2UZAA 2XWYA 1NCLA 1VQPS 3TRGA 3NS6A 1N0UA 4DFMA 4UY8T 1M5VC 2Q79A 3G82A 3MMBA 3NS7B 4UT4A 5CZXA 1Q53A 3B54A 4FZVA 1XC9A 4ZVHA 2GO9A 2MQPA 2LECA 4F4XA 5HANA 1H72C 3CCTA 1YTYA 3ZFVA 2V9WA 2NCKL 1DTTA 3BB5A 3AFGA 3MEGB 1FESA 4LSZB 4OX9F 5KFQA 1KEKA 3LWLA 1JJCB 3W2WA 4NX9A 4DWIA 3P4UB 4FDFA 3V6KA 3CMES 3GP9A
chains in the Genus database with same CATH topology
1F6TA 3ZTOA 4ANDA 4EK2A 3Q89A 1NSQA 2B8QA 4ANCA 1BUXA 3VGSA 4ANEA 4C6AA 1NUEA 5BXIA 2DXDA 3DDIA 1NHKL 1NDKA 2VU5A 3EE3A 1HIYA 2DXFA 4UOFA 3ZTQA 3EVMA 3Q8UA 1S59A 3ELHA 5IOLA 1HHQA 3VGUA 1LEOA 4DUTA 2DY9A 3EICA 4W98A 1NDCA 5CABA 1LWXA 3DKDA 3JS9A 3FKBA 3MPDA 4UOGA 3WX8A 2BX6A 3FCVA 3NGTA 3ZTSA 3EMTA 4WBFA 1ZS6A 1B99A 2BEFA 1NB2A 1NDPA 1WKKA 3EVOA 1NSKL 1NSPA 1K44A 3BBFA 3L7UA 5C7PA 2HURA 5CAAA 3FBCA 3BBCA 4O0NA 3ENAA 1MN9A 1UCNA 2CWKA 4ENOA 1WKLA 1HLWA 1BHNA 1XIQA 4KPCA 4UOHA 1NPKA 3G2XA 3ZTRA 2HVEA 3Q8YA 4FKXA 1XQIA 1JXVA 3FBBA 1NDLA 1F3FA 1WKJA 4HR2A 1U8WA 2HVDA 3EVWA 1VYAA 4F36A 2AZ1A 1BE4A 2DYAA 3VGTA 2AZ3A 4FKYA 1NLKL 3FC9A 3BH7B 1S5ZA 3FBFA 4DI6A 3NGSA 3GPAA 3Q86A 3VVTA 4S0MA 2DXEA 3BBBA 1W7WA 1NCLA 3PRVA 1B4SA 1EHWA 3VGVA 1PAEX 1S57A 4DZ6A 3EM1A 3PJ9A 4F4AA 3B54A 1MN7A 3R9LA 3FBEA 3BH6B 3ZTPA 2NCKL 4CP5A 3Q83A 3FCWA 3Q8VA 3NGUA 3VVUA 2ZUAA 3NGRA 2B8PA 1PKUA 3ETMA 3EJMA 1KDNA 3B6BA 3GP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F6T A;  3ZTO A;  4AND A;  4EK2 A;  3Q89 A;  1NSQ A;  2B8Q A;  4ANC A;  1BUX A;  3VGS A;  4ANE A;  4C6A A;  1NUE A;  5BXI A;  2DXD A;  3DDI A;  1NHK L;  1NDK A;  2VU5 A;  3EE3 A;  1HIY A;  2DXF A;  4UOF A;  3ZTQ A;  3EVM A;  3Q8U A;  1S59 A;  3ELH A;  5IOL A;  1HHQ A;  3VGU A;  1LEO A;  4DUT A;  2DY9 A;  3EIC A;  4W98 A;  1NDC A;  5CAB A;  1LWX A;  3DKD A;  3JS9 A;  3FKB A;  3MPD A;  4UOG A;  3WX8 A;  2BX6 A;  3FCV A;  3NGT A;  3ZTS A;  3EMT A;  4WBF A;  1ZS6 A;  1B99 A;  2BEF A;  1NB2 A;  1NDP A;  1WKK A;  3EVO A;  1NSK L;  1NSP A;  1K44 A;  3BBF A;  3L7U A;  5C7P A;  2HUR A;  5CAA A;  3FBC A;  3BBC A;  4O0N A;  3ENA A;  1MN9 A;  1UCN A;  2CWK A;  4ENO A;  1WKL A;  1HLW A;  1BHN A;  1XIQ A;  4KPC A;  4UOH A;  1NPK A;  3G2X A;  3ZTR A;  2HVE A;  3Q8Y A;  4FKX A;  1XQI A;  1JXV A;  3FBB A;  1NDL A;  1F3F A;  1WKJ A;  4HR2 A;  1U8W A;  2HVD A;  3EVW A;  1VYA A;  4F36 A;  2AZ1 A;  1BE4 A;  2DYA A;  3VGT A;  2AZ3 A;  4FKY A;  1NLK L;  3FC9 A;  3BH7 B;  1S5Z A;  3FBF A;  4DI6 A;  3NGS A;  3GPA A;  3Q86 A;  3VVT A;  4S0M A;  2DXE A;  3BBB A;  1W7W A;  1NCL A;  3PRV A;  1B4S A;  1EHW A;  3VGV A;  1PAE X;  1S57 A;  4DZ6 A;  3EM1 A;  3PJ9 A;  4F4A A;  3B54 A;  1MN7 A;  3R9L A;  3FBE A;  3BH6 B;  3ZTP A;  2NCK L;  4CP5 A;  3Q83 A;  3FCW A;  3Q8V A;  3NGU A;  3VVU A;  2ZUA A;  3NGR A;  2B8P A;  1PKU A;  3ETM A;  3EJM A;  1KDN A;  3B6B A;  3GP9 A; 
#chains in the Genus database with same CATH topology
 1T11 A;  3EGV A;  3RBX A;  4Z7C A;  2QIF A;  3H8Y A;  4DUY F;  2QSF A;  1B0T A;  1EKR A;  4IO9 Q;  4ED0 A;  5CHC B;  4GKJ F;  2CPI A;  1SKS A;  1WHW A;  5IT9 Y;  3IS9 B;  5EWF A;  3HDS A;  1RT7 B;  2BV3 A;  3W7B A;  3POT B;  4ANE A;  4EUV A;  3CXC R;  1IR2 A;  4WK3 A;  5FDL B;  4K4Z A;  2JLE A;  3CIM A;  4QIV A;  2PA8 D;  3OR2 B;  3NAH A;  3VAG A;  1RTI B;  3MMJ A;  3W5Z A;  1IKY B;  1DTQ B;  5A8W B;  2QGF B;  1G6B A;  1RT2 B;  2ILY A;  1FXR A;  2LQJ A;  3D54 A;  5A0Y A;  1TEL A;  2AJ0 A;  1REV B;  2CJQ A;  1ZOT A;  3SQG B;  1KFD A;  2Z30 B;  5A8K A;  1RI7 A;  1D1U A;  2HNZ A;  2HHX A;  4W4M A;  2GAH C;  3SBM A;  3BYP A;  4K2J A;  5HP1 B;  3NMA A;  3CCL S;  3M2V A;  1IWA A;  1ZTT A;  4NZ6 A;  4QZV B;  3Q8R B;  1GFW B;  1Q0N A;  2DY9 A;  4ZVE A;  2XGP A;  1FA0 A;  1Y9O A;  1S12 A;  2V34 A;  3L9Z A;  4DLG A;  4F0K A;  1WDT A;  3MUM P;  1P9Y A;  2VBY A;  3C19 A;  5U47 A;  2HPU A;  1CG2 A;  3M9O B;  4MMO A;  2BE9 B;  2JVO A;  5L46 A;  4MH8 A;  2XS5 A;  1ICE B;  4J9V A;  3ISN C;  2CPF A;  2QX0 A;  4QU7 A;  1Q16 B;  4FS2 A;  3RW7 A;  4A8X A;  3K7R A;  2IRX A;  2XUL A;  3MAA A;  1U2F A;  1VS3 A;  2CXE A;  4QR2 A;  4BC9 A;  3D6T B;  1JLB A;  3P5T L;  5CYJ A;  2HUR A;  3QGP A;  4TQS A;  3KG4 A;  4I2Q B;  1QAI A;  2OH2 A;  4QIF A;  5LL6 d;  1IR1 A;  1WHV A;  5I3U A;  3C3L A;  4O4G A;  2LEB A;  2CWK A;  3PW5 A;  2UUB F;  2L41 A;  3LH2 S;  3SCL E;  4RZR A;  4WE1 A;  1ZAW A;  4ALZ A;  2VHG A;  4ZVF A;  1X5S A;  5T7L B;  2VD3 A;  3LAK A;  1HNI A;  2N7Y A;  3JSR A;  3G2X A;  3HT3 A;  2RRN A;  1DAR A;  1HBU B;  1WUU A;  3RGI A;  5J2N B;  2CPE A;  5DGA A;  3J80 U;  3Q8Y A;  4I69 A;  3HKW A;  1RLD A;  1GXT A;  1FRM A;  3M6V A;  3DHX A;  3MM5 B;  4LF8 J;  1TV6 A;  1YSJ A;  4NCG A;  1NM2 A;  1T9W A;  1Q82 T;  2FDN A;  4MJK A;  1UW4 A;  2ZBI A;  4DV6 F;  1S1X A;  2BW2 A;  3HHK A;  4JBC A;  1FRH A;  4MKV A;  3VAL A;  5KFF A;  3ICL A;  3A8J A;  4GVB A;  2Z4P A;  2E5J A;  3DCA A;  2AZ3 A;  1APS A;  2BE2 A;  4C3K A;  1YI2 S;  4YB5 A;  3W61 A;  5KFW A;  1CUL A;  1YJR A;  3BDP A;  4FF2 A;  2CQ4 A;  4NXN F;  2CVE A;  3Q8Q B;  4LSL A;  2FLO A;  2QV6 A;  2RUS A;  3ZNJ 1;  4OHV A;  3M2R B;  4Q8E A;  3SCJ E;  4C4W A;  1OWX A;  1U2R A;  1JXE A;  3LQV A;  3NRB A;  3BBB A;  4M5L A;  3RR7 A;  1ZZN A;  1IWG A;  3FVY A;  3GIJ A;  4I6W A;  4EZ9 A;  2FJD B;  1O0P A;  4OQJ A;  2QJ3 A;  4B9T A;  5HJX A;  2RS2 A;  3PX0 A;  5HLF B;  3IG1 B;  3PFE A;  3EM1 A;  4P71 A;  2VQF F;  2O5D A;  3HSG A;  4DPY A;  2R7X A;  4K8R A;  1FEE A;  1P9Q C;  1RAI B;  2HLU A;  2M52 A;  2UP1 A;  1S9E A;  2JEG A;  5RUB A;  3G4S S;  1CJK B;  3Q83 A;  1WEL A;  3KDN A;  3TVY A;  4MK9 A;  4ZVP B;  3TOQ A;  3DI6 A;  2GJI A;  4CQ1 A;  2CZ4 A;  1RWU A;  3JTN A;  4ECV A;  3R7N B;  2DHH A;  1S6P B;  2W4C A;  1SV5 B;  3PG9 A;  3PYG A;  8ATC B;  5GAE U;  1GXU A;  5KFS A;  1FRJ A;  2JFK A;  3AJ1 A;  1ZA1 B;  2QLX A;  4CM2 A;  5B7W A;  3MM6 A;  4KY3 A;  3KTQ A;  3NBP A;  5F8I A;  5LSO A;  3M1V A;  1A6L A;  3CD5 A;  2IC3 A;  3ENQ A;  1U6B A;  5KFN A;  2E9Z A;  2OIH A;  3RW6 A;  4JV1 A;  4LQ3 A;  1R8A A;  3QJP A;  2DO4 A;  1U1K A;  2E5H A;  4P73 A;  3NY0 A;  4NA2 A;  1RTD A;  1X0F A;  3P96 A;  3UR3 C;  2DR8 A;  2Q66 A;  2ABY A;  2K1R A;  5E3R A;  1RU2 A;  4ZVO B;  3N5B A;  3W64 A;  4ZHR B;  4X65 J;  3J81 Y;  1HBN B;  1XTZ A;  4BWM A;  3NNH A;  2ZFH A;  4ZLL A;  1BXN A;  1X4F A;  2GC8 A;  3ZNU A;  4ES3 A;  3G6E S;  4NXN J;  1RK8 A;  1J5E J;  2VFT A;  4WF9 Q;  1LWC B;  1A9N B;  3TZW A;  1U6Z A;  5CZV A;  3AQO A;  4ZJL A;  1Q7Y T;  1S6U A;  2N82 B;  2UUA J;  3D0H E;  4CO2 A;  2VBZ A;  1NJY A;  1ZTW A;  3AJ2 A;  5I4M A;  3QJL A;  3NWG A;  1S59 A;  4NI2 A;  4ZOS A;  1CC7 A;  1XR7 A;  1T03 A;  3GSD A;  2MZT A;  2CJ9 A;  3MMC B;  3CD0 A;  1OQ3 A;  2ZJR Q;  2JNJ A;  5GVQ A;  2IVF B;  1JJH A;  3OUY B;  2ZC4 A;  3A13 A;  2YKO A;  4C0H A;  3PR5 B;  4J9N A;  5A76 A;  2IBK A;  5HVH A;  3FCV A;  3QJJ A;  2HIQ A;  2PEH A;  1UWB B;  1TL1 A;  1V3R A;  4TVA B;  1ROF A;  2HFU A;  4LR8 A;  5AT1 B;  2N4C A;  5DGB A;  1J5O A;  3AOC A;  4OYO A;  2XNQ A;  2SXL A;  1OYD A;  4C0B A;  4DV0 F;  3MXH P;  2WCX A;  4NYZ A;  1QE1 B;  3D3B J;  3BJY A;  3UN3 A;  1U48 A;  4FYY B;  4DDF A;  2W7P A;  4OV6 A;  2R8J A;  4RUB A;  2C2M B;  3VAJ A;  3QWU A;  4OYZ A;  3TUJ C;  1VIX A;  1C1B A;  1CQM A;  2HK3 A;  1YWX A;  3QAT A;  4PPZ A;  4WII A;  1JLC B;  3FMW A;  6FDR A;  4M63 A;  1KR4 A;  3QYY A;  4ELV A;  2EI5 A;  4ZPV R;  4R5P B;  1FVQ A;  2WBR A;  3KG0 A;  2ASJ A;  4J9R A;  4MKY A;  3U27 A;  1SCJ B;  2GGP B;  4OYM A;  1KQS R;  2X1B A;  1EQ0 A;  1WC4 A;  2MQ8 A;  1RZM A;  4NCA A;  3H59 A;  4X4S A;  3CCZ A;  1QD1 A;  4FPR A;  4RUH A;  4FNH A;  5KFL A;  4IO1 A;  4I2P A;  4C3L A;  3CJK A;  5KFV A;  1HAR A;  2R4F A;  3I56 S;  3Q24 A;  3HSD A;  2IIH A;  2R7W A;  2OEL A;  1TL7 B;  3LW5 C;  4UOC A;  1JXV A;  1N4L A;  3FBB A;  3FQK A;  5HMW A;  2R2U A;  3IAS 9;  1CJV B;  2FHK A;  2XYP B;  2APO A;  2W2N P;  4FPI A;  2RKI A;  3MF5 A;  4WWS A;  5F8J A;  2W2Q P;  1HYS A;  3D66 A;  3PX6 A;  1Q7L B;  4YP3 A;  3THV A;  2MPU A;  3K57 A;  3OXF A;  2MGZ A;  3CT9 A;  4KPY A;  3CO9 A;  2J76 E;  4J5O A;  3GFX A;  2ZH5 A;  2P9E A;  3OPK A;  2ALZ A;  1S1U B;  2IFX A;  1OQ6 A;  1X0P A;  4F3Q A;  2NR0 A;  2GIR A;  4AL5 A;  1PJ5 A;  4F3O A;  1WEZ A;  2GHV C;  2MTL A;  2Z8Q A;  5KFO A;  2J9E A;  3AB4 B;  4Q5V A;  2MQL A;  4FN5 A;  1GEH A;  3F0N A;  1A0O B;  1X4B A;  1MN7 A;  5H1S V;  3GV5 B;  1YBU A;  4A8K A;  3R9L A;  3G8Q A;  3KG1 A;  3DLJ A;  4TXS A;  1IN0 A;  1YRT A;  2JHE A;  1CSJ A;  2XMA A;  2WVF A;  4RLE A;  4OHZ A;  3K5L A;  2WB1 D;  2WSF C;  3KK2 A;  3RB4 A;  2MST A;  1MU2 B;  2D3O 1;  1N34 J;  2A10 A;  2F9D A;  4CDI A;  4OX9 J;  1OPI A;  1R3N A;  4DV5 J;  2C2D A;  2ZJP Q;  5CCM A;  1M5H A;  3AXM A;  4ZPT R;  3PKY A;  3MPV A;  2Z2Y B;  2XM3 A;  2BAB A;  3CJR A;  1L5U A;  4EK2 A;  3Q89 A;  4HT7 A;  3P8B B;  4BS2 A;  1U2C A;  1Z2Z A;  4B9V A;  4LF6 F;  3W8G A;  3CUL A;  3RBZ A;  4ES2 A;  1WD6 A;  3GON A;  2LXI A;  4DR7 J;  1UVN A;  1MRO A;  2R2S A;  1VC6 A;  2VIC A;  2CQ3 A;  1RXO B;  3SFU A;  1FDA A;  4DL7 A;  4KH0 B;  5G0R B;  2DNG A;  4PG6 A;  3DRR B;  4C3M A;  1CBK A;  2HRU A;  3W8P A;  4CYU B;  1UVJ A;  1JJ2 R;  1T0T V;  4KFB B;  3DXB A;  3HVA A;  2PI5 A;  1NHV A;  2E1R A;  2HGN A;  1KQG B;  1SH2 A;  1U0S A;  3QPI A;  5K14 B;  3IWX A;  5KG4 A;  3M8R A;  2C3Y A;  2OEJ A;  2CA9 A;  1MW7 A;  3R5C A;  1X5T A;  1RT5 B;  4PYD A;  2AYE A;  3UDL A;  2AWZ A;  4OZN A;  4TU8 A;  3GZ7 A;  1VQY A;  4QIW D;  4QWD A;  3BN4 A;  1RQ0 A;  2DGQ A;  1KKH A;  2B6A B;  2N3L A;  4USI A;  3M30 B;  3V81 A;  1U1M A;  3C46 A;  3KHH A;  4QWA A;  2C2E A;  2RHQ B;  3M8P A;  3KLG A;  1KLM A;  4BDP A;  1KBR A;  3FK4 A;  4RW9 A;  5CAB A;  2B7B B;  1YBA A;  3DOK B;  2O66 A;  3CCE S;  4GKJ J;  1OYE A;  1QUP A;  1Y11 A;  2KHD A;  5KOW A;  1FJG F;  4USH A;  4EGL A;  2R7U A;  2KRR A;  4KGV B;  5KG3 A;  2CYY A;  4N8N A;  3ZTS A;  4DBQ A;  5AE2 A;  2JEJ A;  1FE4 A;  2DGS A;  4DR4 F;  2VFS A;  3RBD A;  3W62 A;  4OI2 A;  2W8L A;  1SC6 A;  3GII A;  2KTQ A;  2FUG 9;  2U2F A;  2HRY A;  3BM7 A;  1QVG R;  2HQD A;  1W2B R;  4IOB A;  4OI1 A;  4BHQ A;  2VJV A;  1YK9 A;  2DNP A;  3QFH A;  3B82 A;  4TYB A;  4RNM A;  9ATC B;  3Q0A A;  2HIY A;  4CLF A;  1UET A;  1EQM A;  1S4E A;  4KV8 B;  4PKD B;  4D3H A;  1PBU A;  1Q8B A;  2WRM A;  3OTO J;  2W7A A;  2W2P P;  4Y28 C;  1VQN S;  5CYM B;  1G4C A;  5J1E A;  3HMJ G;  2DIU A;  1XMQ F;  4IR1 A;  1GH8 A;  2DR5 A;  4DV7 F;  5HRO B;  1L3V A;  3ET6 B;  3PM9 A;  2RAQ A;  3CJ5 A;  1XIQ A;  3SCK E;  5KFB A;  2F40 A;  1U25 A;  2FHO B;  2QRR A;  5ETV A;  3PZP A;  1FRI A;  1NPK A;  3D6M B;  2Y1J A;  1S76 D;  3M9N B;  2OFH X;  3KUE A;  1XR6 A;  2B56 A;  4WFB Q;  1AFJ A;  5C25 A;  2E7W A;  2DNM A;  2RS8 A;  1SL2 A;  3NWR A;  4RW6 A;  1NDL A;  2FJX A;  4CO1 A;  4WFZ A;  1WG5 A;  1YG0 A;  2UV8 G;  4TQR A;  1RHR B;  2V9K A;  1IQZ A;  1S0V A;  1TKX B;  3NP5 A;  3R5G A;  1VOM A;  4YME A;  1S9F A;  1ZM4 A;  2B4U A;  3CCV S;  4B17 A;  4ECS A;  3L09 A;  1E6Y A;  2C42 A;  2YKM B;  3OFH A;  3JTP A;  4QR0 A;  5F41 A;  5EHH A;  5K20 B;  2QSW A;  2AJ4 A;  3M8Y A;  4DPX A;  4F4Z A;  2QZ8 A;  3DXS X;  1QM9 A;  3D5M A;  3AAW B;  1RHU B;  2DB1 A;  4O44 B;  2ZH4 A;  2XI3 A;  1S97 A;  3PEJ A;  4ICL B;  4OX6 A;  2OPP B;  4KGK A;  2FJB B;  3AA8 A;  4G1Q B;  4O3P A;  5M2U A;  3RR8 A;  1WJ9 A;  3AH6 A;  2MKH A;  4N77 A;  4OLP A;  1R0C B;  4ZKA A;  4R8U B;  2V2V A;  5HK4 A;  5HVF A;  3TZX A;  3G71 S;  3MTK A;  4LUB A;  4Q43 A;  2PGC A;  4NEZ A;  4DLE A;  4RUC A;  2DKO B;  4DV2 F;  4BWJ A;  1OY6 A;  3OXG A;  5IT4 A;  1WOR A;  3IRX A;  4F25 A;  4YR2 A;  3D2W A;  1HHS A;  6AT1 B;  4DSL A;  4ED7 A;  3I0S A;  5DLF A;  3TUZ C;  3M8Q B;  4A8F A;  1UEV A;  1LQ9 A;  4ZCL A;  2DBB A;  4Z7Y A;  3KJV B;  2WSE C;  4B3S J;  3O1L A;  4JP8 A;  3KK1 A;  4F04 B;  2B8P A;  1S10 A;  1T05 B;  4WTY A;  1NU4 A;  2VPW B;  3HCX A;  3JQK A;  2AIR B;  4JV2 A;  2J7W A;  3QRR A;  1HNV B;  3M9M B;  3JSM A;  5KFI A;  3KUG A;  3KHL A;  4J9K A;  4DUZ F;  4RW7 A;  4DSE A;  2XG8 A;  4F02 A;  1FJG J;  4DV1 F;  4PXC A;  1NJW A;  4ZPA A;  3RRG A;  3VQS A;  2XCA A;  1TL3 B;  1UVM A;  3J7Z 5;  1TVR B;  2LDY A;  3M2U B;  4U9R A;  1RWX B;  1SB6 A;  2X1F A;  4JI0 F;  2U1A A;  3DGP A;  3KLH A;  4HVZ A;  1KQK A;  1NJZ A;  4Q0B B;  2GQQ A;  3DMJ B;  2CQ1 A;  4X65 F;  2XC9 A;  2OJ3 A;  4B3T F;  2ZDO A;  2HWT A;  3BDE A;  5B0D A;  5F3T A;  1Q86 T;  2JC0 A;  3OL6 A;  2ZWO A;  1RTH A;  2CQ0 A;  5CH7 B;  2E1C A;  2ZHA A;  1Q5Y A;  1R31 A;  3QT5 A;  5D15 A;  1W25 A;  3ITH B;  7FD1 A;  3AA9 A;  5EGY A;  4WIQ A;  2YWF A;  1SC3 B;  2OD4 A;  4ECQ A;  2HVH A;  2W9C A;  2J9C A;  1VGY A;  2ZBR A;  2VL1 A;  3DRP A;  3VGU A;  3TAQ A;  3PKM A;  4RR5 A;  2IDE A;  3LAM A;  4HAC B;  2HBZ B;  1YJ9 S;  3HKZ D;  1DRZ A;  2L48 A;  2CQG A;  3UD3 P;  2YNH A;  3TAM B;  4YY3 F;  4EI2 A;  3TZY A;  2IRY A;  3SEO A;  2BYC A;  2F3J A;  1R6V A;  3BPD A;  2H5J B;  3M8W A;  3DLG A;  1VLY A;  2RSQ A;  2BX6 A;  3BN7 A;  3D68 A;  3IXQ A;  1YZ6 A;  4NYP A;  5F9N A;  1SJ4 P;  4ECW A;  2J8S A;  3LP2 A;  4OJG A;  3GFZ A;  1HPZ B;  2AF6 A;  5EUH A;  1RAH B;  3GV8 B;  1G7C B;  4KBI A;  2BKP A;  3HI9 A;  3C6U A;  3TUI C;  2FJE B;  1KRP A;  1NDP A;  4LVN P;  3OHB A;  1HKA A;  2M3D A;  2MZQ A;  1K0V A;  3K58 A;  3J7A N;  1NSP A;  1AYE A;  1K44 A;  1T8E A;  3I0R A;  3L7U A;  3VQT A;  3ZZU A;  3H5S A;  5C7P A;  2LLZ A;  4WKY A;  3CTR A;  2F9J A;  1Q8K A;  1WF1 A;  3VAM A;  2GNK A;  4ZVQ B;  3JB9 k;  1R0A A;  4X4U A;  2CPZ A;  2QLJ B;  5KT2 A;  3LAL A;  4IRC A;  1RAE B;  2QL7 B;  1C4C A;  3DC2 A;  3PRB A;  1SXL A;  5LMU J;  1RAG B;  5KG5 A;  4QCL A;  1IM4 A;  3A3N B;  3L4B C;  2EK1 A;  2F1F A;  1X9M A;  3IRW P;  1DLO B;  1JB0 C;  1R8B A;  4LIW A;  1M90 T;  2QFJ A;  1TTH B;  3TQ1 A;  1S72 S;  2GML A;  5E3C A;  2R2T A;  2KYZ A;  2R7O A;  3CCQ S;  4DR2 J;  3SSR A;  1S1W B;  1IKW B;  2BM0 A;  4PPD A;  2H54 B;  1JKH A;  3ILL A;  1JXL A;  4K4V A;  5DET A;  1RE1 B;  4XO0 A;  3IR7 B;  2VKR A;  3BSA A;  2AZ1 A;  4KSE B;  2G0C A;  3UDE A;  1RUS A;  2X1A A;  2FVP A;  4CNY A;  4ED2 A;  1TP7 A;  5BYR A;  2QYG A;  1FK9 B;  7AT1 B;  4YOE A;  2WK4 A;  3HVT A;  2B9W A;  4X66 J;  3P6Y C;  2HQG A;  2VG5 B;  5B08 A;  5F8H A;  5GAH I;  4C97 A;  2AX0 A;  2MXY A;  4S0M A;  1KVI A;  2ATC B;  3KLV A;  2IDL A;  2VOP A;  1PC5 A;  3W2V A;  2I2Y A;  2COL A;  3IM9 A;  3WC0 A;  3K5P A;  3MEE A;  5FD1 A;  4QQB A;  8RUC A;  2D7S A;  2AGO A;  2MB0 B;  4DSK A;  4ZPC A;  2R7R A;  1QAJ A;  1RTZ A;  4GKK J;  1FJC A;  2KM8 B;  1NZ8 A;  3KLE A;  2MJN A;  3OTB A;  3H2L A;  4IG0 A;  5L1I A;  4ELT A;  4X4N A;  2KN4 A;  3MUV P;  2UUC J;  2DHS A;  2BA9 A;  3ZTP A;  4ATN A;  3FCH A;  3MM7 A;  5KFC A;  1Q8L A;  3HPO A;  3MCM A;  2BW7 A;  2IPO B;  2ZVS A;  1FKP A;  2GX8 A;  2YWH A;  1FT8 A;  3WX4 A;  4WTO B;  5DDR C;  4OI6 A;  3GMG A;  3R5B A;  2PSZ A;  2DR9 A;  2AJQ A;  4QR1 A;  1RT6 A;  4KR0 B;  1HQU A;  2JX2 A;  3I4H X;  1CQN A;  4CO0 A;  4WK1 A;  4OZ1 A;  4M5I A;  4NPO A;  4DL6 A;  4JB8 B;  5GMK a;  4F4W A;  2P9C A;  2UUC F;  3BKF A;  3A1Y G;  3I5A A;  5K8O A;  2BJ1 A;  2DEI A;  4TY8 A;  4N41 A;  1XEZ A;  4ANC A;  3FGV A;  3EGZ A;  4I7F A;  5KFX A;  2NYH A;  3CJ2 A;  3THP A;  3NMR A;  3ZZZ A;  1IKX B;  4PQU B;  1VR6 A;  4X64 J;  5KT6 A;  2LQ8 A;  3U1M A;  1U1Q A;  3H20 A;  3CW2 C;  3CJS A;  3PX4 A;  1X4A A;  4NRT A;  3JQM A;  3OXL A;  5MAO A;  1FX2 A;  1TKT B;  3BR9 A;  3U1N A;  2HZA A;  1RBL A;  2DXF A;  3O3L A;  3R5A A;  1ITP A;  3ZTQ A;  4TKT A;  4HDH A;  4QIG A;  3OV7 A;  3J7Y U;  4C98 A;  2CUY A;  4K4W A;  2KFN A;  5B0A A;  2B3T B;  2QE5 A;  2W24 A;  1EP4 B;  4C9D A;  2B9X A;  2ATL A;  2FC8 A;  1NME B;  1JNR B;  5KFP A;  2BJ3 A;  1TAU A;  1O6X A;  1FFW B;  1RHM B;  5H9E J;  2FVQ A;  3QAU A;  3ZZ0 A;  3DKD A;  3JS9 A;  4YDD B;  1RYS A;  1AW0 A;  3FKB A;  2F4V F;  1IKV A;  5KG2 A;  2R42 A;  1WC5 A;  4HHU A;  2VA3 A;  2GO8 A;  3MOZ A;  4OI3 A;  2H9Z A;  1I1G A;  1IKY A;  1ZS6 A;  4LQ9 A;  3CGI A;  4WBF A;  4M5M A;  3TVZ A;  4JYA F;  4LFB F;  4M94 A;  4QYZ K;  4I68 A;  2LXU A;  2OGU A;  4KGM A;  3HXM A;  2RJZ A;  1QTM A;  3DRY A;  1RKJ A;  1S1V A;  5A8K B;  1D9A A;  4FS1 A;  2ZNZ A;  1TKZ B;  3PYD A;  1NXI A;  2B5J B;  3N9U C;  3OVS A;  2XO7 A;  4DFK A;  5HP1 A;  4JI8 J;  2W1B A;  4USW A;  1KD1 T;  4DCJ B;  1HNX F;  3FBC A;  4XK8 C;  1YIJ S;  3M4X A;  4BBY A;  5F8N A;  1D09 B;  4NWB A;  3GLJ A;  3GE9 A;  4J9O A;  2QYC A;  1T9X A;  3GSI A;  1HR0 F;  3MMA B;  1OPZ A;  1FKO A;  3UFC X;  3B8H A;  4K2X A;  1BHN A;  3VV2 B;  2C3P A;  2UVV A;  2VOO A;  2HS0 A;  4UUX A;  3IN5 A;  1PYO B;  2HHH F;  4P2S A;  3FJ2 A;  7FDR A;  5CA5 A;  2A6O A;  1EAY C;  1O5J A;  1SKW A;  2W4D A;  2DPI A;  1LXN A;  5EN1 A;  3KOA A;  1SUQ A;  2Y1R I;  1GMW D;  2UUT A;  4LT6 A;  2LU1 A;  3HHL B;  2DH7 A;  4HI2 A;  1NK6 A;  1TUV A;  1U8W A;  5KFR A;  1RTJ B;  1VBK A;  4O3Q A;  3EZ5 A;  3TX8 A;  2NXC A;  1N5Y B;  5CCL A;  2V4J A;  4ZP6 A;  4IFV A;  1VRT A;  1NLK L;  1FD8 A;  1YGY A;  2BJE A;  4DR5 J;  2QA4 G;  5THW A;  2ZH3 A;  1KWM A;  2HAF A;  4DI6 A;  4LF1 A;  1N8R T;  1CJU B;  1S48 A;  1Y5L B;  1QSL A;  4HT5 A;  1R8P A;  5J1N A;  1B4S A;  2V5H G;  4JI6 J;  2EC0 A;  1WSR A;  3GR0 A;  4HH0 A;  1E6V A;  2IMO A;  5KTQ A;  4I67 A;  1FVS A;  4DU7 A;  3PJ9 A;  2NZ4 A;  1S1X B;  2V8H A;  4F2R A;  4CH7 A;  4ZN1 A;  1HA1 A;  1LWE B;  1S6O A;  3D28 A;  4DQQ A;  3B4D A;  4ETZ A;  4B3R F;  2XLI A;  3GTY X;  1EET A;  1N5S A;  2GVD A;  2ZHO A;  4N5S A;  3H5Y A;  4WYL A;  1U47 A;  4MFB A;  1H2V Z;  1TK0 A;  5L39 A;  5AXN A;  3D9B A;  1NEE A;  1UFK A;  2FPH X;  3B78 A;  2PMH A;  3GR1 A;  2QMU B;  3NGR A;  3OFF A;  3QNW B;  4QOT A;  1OO0 B;  4QYR A;  3VR1 A;  2DGV A;  2D3O R;  3G86 A;  3L95 X;  1FRX A;  3M2R A;  1ZH5 A;  4IFY B;  1XN9 A;  3TWZ A;  5EDW A;  2M5Y A;  4PQU A;  3CMQ A;  4M5D B;  5KFG A;  4DX5 A;  1J5E F;  3UQS A;  3HHE A;  3AXK A;  1WI8 A;  4OJ1 A;  1GQE A;  4LF9 J;  4K0K F;  2KL8 A;  2XMT A;  1B64 A;  4OJ3 A;  4IRD A;  1D9F A;  1X4G A;  2XYG B;  3VF0 B;  3BSO A;  1DQA A;  4LBP A;  1UA1 A;  2NYI A;  1FDN A;  4Q2M A;  2KFZ A;  2MLY A;  4CNZ A;  4ZN3 A;  2H5E A;  2CQP A;  5BYS A;  2EFO A;  1D0E A;  3DLH A;  4Y00 A;  2DO0 A;  4JI7 F;  1HNZ J;  2VU5 A;  2LDI A;  2VPY B;  2YKN A;  2UV8 A;  3EE3 A;  3NLC A;  2RRA A;  4DG1 B;  1HIY A;  3CC2 S;  3UVJ A;  1FNM A;  1GMU A;  1N5Q A;  3LP1 A;  3QT6 A;  2ASL A;  2AYB A;  2YY3 A;  2CNN B;  3UDC A;  4ER8 A;  3R2D J;  2C22 A;  2IC3 B;  1VRU B;  1KN6 A;  4ZA1 A;  1U1O A;  4J90 A;  4M5J A;  2MHE A;  4GRS A;  4CZC A;  4DN0 A;  2DD8 S;  4RJV A;  3NOC A;  3H4B A;  2MQQ A;  2PE8 A;  1X60 A;  5A6W A;  1A7G E;  4LRB A;  3LPE A;  3OL7 A;  1QY7 A;  4B9M A;  2E44 A;  3I5C A;  3W66 A;  1X7V A;  1LWF B;  1HBN A;  2FJW A;  2E9R X;  2YWE A;  3W9J A;  1XMB A;  3TYT A;  2W9A A;  1RT1 B;  1RBO B;  5E2Q A;  3TP2 A;  3G87 A;  3IM8 A;  3CCU S;  2PT0 A;  2CG8 A;  1GX5 A;  4DX6 A;  1QUV A;  5B0G A;  4X62 F;  1XMQ J;  3N6L A;  4LRA A;  2AEJ A;  3FMB A;  1IBC B;  3GCW P;  5C42 A;  2H3E B;  4O3O A;  1JLA B;  3JQJ A;  1I94 F;  3KXD A;  2VUG A;  3JAM U;  4MKB A;  2PDA A;  4YQW A;  4DS5 A;  2F63 A;  4DQI A;  1IM6 A;  2WHO A;  3OHA A;  4PUO B;  5D0E A;  2HS4 A;  3KLI B;  4ID8 A;  1WEY A;  3R2C J;  1S9G A;  4EBC A;  1R8H A;  2KG1 A;  3DN9 A;  1N52 B;  3I6P A;  3CPW R;  4KO0 B;  5F9L A;  1JLG B;  3V4I B;  2OML A;  4OHW A;  5G4D A;  2GQC A;  3GG0 A;  4I1T A;  1WC0 A;  5E41 A;  4UQG A;  3TAP A;  1L3U A;  3FRZ A;  1X8D A;  4JI6 F;  2XLK A;  2HHU A;  2YX7 A;  1Y7P A;  3E01 B;  4NXM J;  4HDG A;  1NK4 A;  1RWN B;  4NLO A;  1C1B B;  2UXC F;  2VV5 A;  1VYA A;  3EYZ A;  1WAC A;  1C1C A;  3DRX A;  2EEY A;  3M32 B;  4AQY J;  2QFI A;  4OZ0 A;  4J37 A;  3MD1 A;  4NMX A;  5DQG A;  2GFF A;  2RB7 A;  5K8M A;  4U6P A;  4MIW A;  3F41 A;  3EDQ B;  5IM0 A;  3MUR P;  3G6X A;  4OX8 A;  1NBE B;  2AEM A;  3ILI A;  3NGS A;  1VQ9 S;  3DM2 A;  2Q6C A;  3EGW B;  2LKZ A;  4AUK A;  1VCT A;  3PIO Q;  2N3O A;  3PRV A;  3PO5 A;  2LQ9 A;  4DQR A;  4DV4 J;  1RHK B;  1SIW B;  1NH8 A;  1VHI A;  3ETO A;  3MHY A;  2HFO A;  3PNI A;  2AD9 A;  1RWV B;  5KG1 A;  5LXY A;  4IUF A;  2V2K A;  1CJV A;  3NAI A;  3J80 Y;  3WC2 A;  1LXJ A;  2NXN A;  3W5Y A;  2V69 A;  3FBE A;  4U67 Q;  2HMI B;  4OYW A;  5D0G A;  5JXS A;  4DL2 A;  5D77 A;  1HYS B;  1T02 A;  4RNH A;  2DNK A;  3CJ4 A;  1GMW A;  2YNF A;  4CP5 A;  1WC6 A;  2XLJ A;  1WTB A;  4D3G A;  1RT4 B;  2R9L A;  4V19 X;  2K7J A;  2LQ5 A;  4C8Z A;  1S1U A;  2OPS A;  1NPP A;  1KHW A;  3C16 A;  4W90 B;  3WDO A;  2B51 A;  4IYQ A;  4GMK A;  1F1B B;  5HMY A;  2MQO A;  2KG0 A;  3KK3 B;  5L1L A;  2EKN A;  2HHT A;  2B4P A;  2YH0 A;  3WQP A;  5HN0 A;  2DY1 A;  5HAO A;  5I42 B;  2K3I A;  4DSI A;  3TAN A;  2J8A A;  3JXO A;  3F73 A;  2VZ9 A;  5E33 A;  6FD1 A;  3MCS A;  4H54 A;  3PRD A;  1VBX A;  4ITS A;  3LGN A;  2C3U A;  4CH0 S;  5A8R B;  3FZB A;  4YR0 A;  4H4M B;  2RVJ A;  4TU7 A;  2V8D A;  4F4K A;  2ROE A;  3VAI A;  3PW0 A;  1S0N A;  3KK2 B;  2DXD A;  2JZ5 A;  4DQS A;  4G1P A;  2CJB A;  2MY7 A;  4KRW A;  3H2U B;  1UFW A;  2H4W B;  1VQ5 S;  1F2H A;  2YNI B;  5J2Q A;  4LR9 A;  4ZVR B;  1IBK J;  1O8B A;  1KS2 A;  3CNQ P;  3UO0 A;  5ETO A;  2CQD A;  1AXQ A;  1PCA A;  3RRK A;  5EWE A;  4DS4 A;  1KFS A;  5KG6 A;  2HHV A;  3BRE A;  5BYQ A;  2XGQ A;  2I5J B;  2Z2L A;  1MRO B;  1C0U B;  3EUN A;  1HMV A;  1Q5V A;  2YH1 A;  1XNR F;  2IM0 A;  3MZI A;  8AT1 B;  4M5G A;  2DVI A;  1TL4 A;  3WBZ A;  2FIU A;  4QWC A;  2K06 A;  2VQE F;  2DNN A;  3DLB A;  2QLF B;  3ISN D;  2CDQ A;  3E3X A;  2LYV A;  2ZBC A;  2Q3P A;  3BS9 A;  1RGV A;  3IR6 B;  4IKA A;  2ASY A;  2KVQ E;  4DV2 J;  4YB7 A;  1AZS A;  3LPY A;  5K14 A;  4IDK A;  4DV4 F;  3ZZO A;  2O3D A;  1K1S A;  4DV5 F;  4QWB A;  4ED8 A;  4JI3 J;  2J9D A;  2XHW A;  3IP0 A;  2DGX A;  4ID5 B;  1N34 F;  4P2X A;  1DHM A;  5SUH A;  1HQE B;  1NSK L;  1VHF A;  2OPR B;  2UXB F;  3M30 A;  3LGM A;  1HNX J;  3HSZ A;  4CLL A;  2WOM B;  3KDO A;  3AD8 C;  3C15 A;  4NA1 A;  3W1Y C;  4L76 A;  2J6U A;  4DR3 F;  1H73 A;  3DYA B;  3GU0 A;  3T1Y J;  3GWC A;  2QLW A;  2V4Q A;  2CZV C;  4DPO A;  5IV3 A;  1C0T A;  2E1P A;  4MIA A;  1XMO F;  3AB2 B;  1N32 F;  1UAW A;  1U8S A;  1MMN A;  4C11 B;  5HL7 Q;  1SKR A;  2YBV A;  1QSY A;  3VAK A;  4V19 J;  4ETX A;  3C14 A;  3VCD A;  4LF7 F;  4MT1 A;  1U1R A;  2ILZ A;  5E5N A;  3JYT A;  4DR2 F;  3V6D A;  2OTL S;  3FSI A;  2B4O A;  3MED B;  1CS4 B;  2XEX A;  2FZC B;  3QZ8 A;  4O4R A;  2IRU A;  2J7K A;  4F2S A;  4F4Y A;  1F3F A;  1EJ7 L;  1XER A;  5DO2 A;  3SDE A;  5HMZ A;  2HG4 A;  1JK9 B;  3H90 A;  2QL9 B;  2XZT B;  4K4X A;  1PYT A;  5B0E A;  2XMU A;  3U1L A;  3J81 j;  3KYL A;  3RAQ A;  1BE4 A;  2VFV A;  3ZZT A;  1M1H A;  4XIU A;  1XWL A;  3O6Q A;  5KT3 A;  2WW8 A;  2JEI A;  4RX6 A;  4FVC A;  1RSC A;  5K9F A;  5IWA F;  5LMU F;  2R7V A;  3BZQ A;  4DMZ A;  3NNC A;  1KOH A;  2XTJ P;  2NRE A;  5ETL A;  1WOS A;  5L8R C;  1M1K T;  2FHM A;  4PQA A;  3KLF A;  2DXE A;  1N6Q A;  4TYA A;  1GTE A;  5C25 B;  3IC1 A;  2HVI A;  3P45 B;  2NXJ A;  3HZE A;  5ETR A;  2P9G A;  2GHW A;  4ECZ A;  3QRQ A;  4IG3 B;  4C8L A;  4DZ6 A;  1RDR A;  2CQI A;  2XSJ B;  3N6M A;  5C24 A;  4WYW A;  1VQK S;  2JRS A;  4JI2 J;  3IA0 A;  1W26 A;  3CE8 A;  3GYX B;  5IC6 B;  3D3C J;  4R0E A;  5J2P A;  2J6S A;  3I9Z A;  3OQ2 A;  4HKQ A;  4M5K A;  2KXF A;  2F5G A;  1T9T A;  2JC1 A;  3GYG A;  4M8L A;  2LU2 A;  5CYQ A;  4ICL A;  3RBE A;  3EJM A;  1KDN A;  2HZV A;  5HO4 A;  3B6B A;  3DOM B;  3S8S A;  4ECU A;  2MKY A;  1YBT A;  3EXC X;  3K8W A;  3V6D B;  4PWD A;  2XMV A;  3BKU A;  4ECX A;  1GTH A;  5KFD A;  3V6J A;  4KC5 A;  1RHQ B;  1HW9 A;  2YQ1 A;  1LOU A;  1U09 A;  3MMB B;  3MPU B;  1UTA A;  4IH6 A;  3VHQ A;  4J9Q A;  4J9L A;  2OPQ B;  2UVW A;  4Y6I A;  1K47 A;  1UPM B;  3UN5 A;  4C2M A;  5GAD U;  1YHQ S;  4L3N A;  3RTV A;  2D9O A;  5K5M A;  2QA1 A;  4WP8 A;  4X4P A;  1YQH A;  3MEG A;  4CI0 B;  4PAB A;  3DDI A;  5LMN J;  4CLK A;  2Y8Y A;  3W2W B;  1HBO A;  4XPE A;  2DRB A;  4PR6 A;  1Q8I A;  5GAE I;  3T5H A;  1MSW D;  1WG4 A;  2MKC A;  3H2V E;  4JOU A;  2JEF A;  2QO3 A;  2VBW A;  3JSM B;  2X3G A;  2CQH A;  3GCX P;  4OLO A;  4RW7 B;  4YB6 A;  1RKI A;  2EPI A;  4RW4 B;  2W8K A;  4DUY J;  1S6Q A;  4B3M F;  1X4C A;  3BF4 A;  4C8M A;  1TL3 A;  1VDH A;  2DHX A;  3ELH A;  4WPA A;  2FD2 A;  3FRY A;  1H74 A;  4ED6 A;  4ZVS B;  1YJW S;  1TL5 A;  2HK2 A;  4B3T J;  3DLK A;  3QIP B;  3POT A;  5D0H A;  5F0U A;  3QO9 B;  1HFE L;  2O1P A;  3LGH A;  3R7B B;  4RW8 A;  2BAN B;  5FDL A;  2W9B A;  3EPI A;  3RRH A;  2AJF E;  3F44 A;  3BO2 A;  1CLF A;  3OR2 A;  4OZJ A;  1WWH A;  2XY6 A;  5ETS A;  3OFE A;  3W60 A;  3IGV A;  4AL7 A;  1JLQ A;  1HD1 A;  1WNE A;  1ACM B;  2C2Z B;  1LFW A;  3R6G B;  2ZJQ Q;  2RNE A;  3LUY A;  3W9H A;  1KOO A;  1VC0 A;  2HNZ B;  3BGR B;  1NKB A;  4FYX B;  4DUZ J;  1B7F A;  3CDA A;  1KP6 A;  2W9C B;  2UVU A;  2HFZ A;  2E9T A;  2VBX A;  4U8Y A;  3M2V B;  5D4L A;  1VI7 A;  2VJU A;  5CD4 A;  2W2M P;  2YNH B;  2CPH A;  4CTA B;  1VIS A;  3BEG B;  3HVW A;  1FWP A;  4X84 A;  3QGH A;  4K5R A;  2VPX B;  3AD9 C;  1V3S A;  2GVZ A;  1VRQ C;  5D6G A;  2WON A;  5SZT A;  3I55 S;  1VMB A;  5JJB A;  5M2P A;  1FTC A;  1JJ4 A;  3HJF A;  2J5A A;  3ZTR A;  3C6U B;  4CLY A;  3M6U A;  3ZZP A;  4QJV A;  4Y2C A;  1T3N A;  1NAQ A;  5B0C A;  3MAA B;  3CB4 A;  3LTO A;  4G6V B;  2HHQ A;  4LSN A;  1JLB B;  2OI2 A;  2I6W A;  3JAM Y;  4A8W A;  4I2Q A;  3MI7 X;  3C66 A;  5D4O A;  4ED3 A;  1KC8 T;  3H0P A;  4Q7A A;  4F36 A;  3MWB A;  2R3V A;  1LW0 A;  2BZ2 A;  5E7O B;  5IQ6 A;  2MZS A;  5I3U B;  3R7S B;  1O51 A;  1IJF B;  1FWK A;  1QAX A;  3NOG A;  3SYZ A;  3N79 A;  2AGP A;  3KNG A;  1SBR A;  2MEW A;  2Y8W A;  2OP5 A;  3FC9 A;  3TQE A;  4KHP F;  4WE1 B;  1RWW B;  2ZEJ A;  2ZD1 A;  2V68 A;  1FNO A;  2IBO A;  5T7L A;  5CD4 H;  4DV0 J;  1NK8 A;  3Q86 A;  2BJ8 A;  1R8C A;  1ZAX A;  2W2O P;  4QPT A;  3NEK A;  2PD1 A;  4EFA C;  1C4A A;  1HI1 A;  4YY3 J;  5BR8 J;  4PWD B;  1LK7 A;  3U7J A;  2F4F A;  3OTE A;  1IKW A;  2DNH A;  4P52 A;  4P72 A;  3G96 A;  2YNG A;  1BWV A;  1WF0 A;  4JI1 F;  3OJU A;  2IY5 B;  2EC2 A;  5HQM A;  5HMX A;  2HHW A;  1M5O C;  1UFL A;  3KNA A;  5L9N A;  3MTJ A;  1ZPV A;  2HWI A;  2HHS A;  2DT9 A;  2BJ7 A;  2Y3Y A;  3C6T B;  1S1T A;  2RRB A;  3PW4 A;  1U45 A;  3UE2 A;  4DV3 F;  1LV5 A;  2KJV A;  3M6X A;  3VTI A;  3JSY A;  5HBM A;  2DRA A;  1RAJ A;  1AUS L;  3PW7 A;  1VQO S;  4NLG A;  2D3Z A;  4WP9 A;  4A8S A;  3T6J A;  4K5S A;  2HQI A;  1G3O A;  3MR7 A;  4IG0 B;  3SFG A;  5IT0 A;  4DV1 J;  4A8M P;  2ZOF A;  4LMZ A;  2IYG A;  2HBR B;  2K3K A;  3WIV A;  2C28 A;  1AFI A;  1IQT A;  3GFH A;  4U7U D;  4YDX A;  2GAG C;  3DRS A;  4ZVU B;  1F9F A;  2R8K A;  1MML A;  2FZK B;  2PC6 A;  2VB6 A;  3FFI B;  2PI4 A;  2BR0 A;  5KG0 A;  3DI6 B;  3QAE A;  4B9L A;  1EX8 A;  3T9Z A;  4DCP B;  3BPS P;  3MM9 A;  3OW2 R;  3ISZ A;  3EVM A;  1H7X A;  3PJW A;  5B0F A;  3MM6 B;  2C1E B;  1UZD A;  2HVZ A;  3MEC A;  2BQ3 A;  1SJF A;  3CWJ A;  3M1V B;  4MYU A;  1K0T A;  3K17 A;  2EW9 A;  3TJ8 A;  3CED A;  3QWP A;  1FX4 A;  3K8V A;  3MCO A;  1WHX A;  3A3P B;  5ETN A;  1CJT B;  4I7F B;  2XMM A;  3VZI A;  1VBZ A;  3Q23 A;  4EYI B;  1WOP A;  2ZUG A;  3LP0 B;  5B0B A;  1GK8 A;  4XPC A;  2MKJ A;  1Z1Z A;  2F8M A;  3MPW A;  2K1R B;  4EO8 A;  5KFJ A;  4CCH A;  4ZHR A;  4RU2 A;  2PN6 A;  5L1K A;  2G13 A;  1X31 C;  1ELO A;  2MJU A;  3IWN C;  4RNN A;  3CMA S;  4WZQ A;  2DNY A;  4MK7 A;  2F8H A;  4CLT A;  1FD2 A;  4ZLP A;  3H40 A;  2G2Y A;  4OI4 A;  3DDN A;  3QT8 A;  2QL5 B;  4USK A;  4UY8 5;  1DJ0 A;  4H4O B;  2FLN A;  1JLE B;  2LA4 A;  2NSB A;  1KTV A;  2ZNY A;  1EP4 A;  5DZ7 A;  1B0V A;  1S99 A;  1NH7 A;  1V5V A;  4NI2 B;  3PY8 A;  2IAJ A;  2VG7 B;  3MGJ A;  1TK5 A;  3DU5 A;  3MMC A;  4H4K C;  1BGX T;  5ETQ A;  2FJA B;  3OUY A;  3FSY A;  2RF2 B;  2KXH A;  3O5T B;  1FCA A;  1IKV B;  4XDD A;  2M4M A;  1MN9 A;  4ILR A;  4YS2 A;  1WKL A;  3PHT A;  2BE7 D;  4G65 A;  4LF8 F;  4B3O A;  2RDI A;  1F5C A;  1TL1 B;  2RIL A;  2KU7 A;  2OHD A;  1P6T A;  4ILL A;  1FTR A;  1QAY A;  4KKO A;  3SSQ A;  3MM8 A;  4UOH A;  3H4D A;  3QSY B;  4EEY A;  1J5O B;  3A8K A;  4U7U K;  5L1J A;  1P8G A;  1JMT A;  3D6F B;  1SC4 B;  3Q8P B;  2A2C A;  2MKI A;  4AYB D;  2G1D A;  2E5I A;  2C2O B;  4DX8 H;  3GV7 B;  1FJE B;  4E0D A;  3KMQ A;  2R8G A;  4DR5 F;  1JWW A;  2UUB J;  3K2Y A;  4MTP A;  2JSX A;  2AT1 B;  5MLC V;  2EFQ A;  1XNQ J;  2ZH9 A;  1FKO B;  5C2G A;  1REG X;  1DTT B;  1RB0 A;  4NLY A;  2G4B A;  1NJI T;  2V8G A;  1UP1 A;  2EG1 A;  5EWG A;  4OZ3 A;  3UCG A;  2CG4 A;  2DNZ A;  2MQM A;  4I2P B;  5DJB A;  3TJ9 A;  1MWZ A;  2UXD J;  3T1H F;  2MZR A;  4ZVT B;  2XSF A;  1TL7 A;  1SUQ B;  3MR2 A;  3D1Q A;  3J7Y I;  2CZ9 A;  3AOB A;  4ZPW R;  3C8Y A;  5DG7 A;  2IA6 A;  4ILM A;  3IS9 A;  2JWN A;  1XNR J;  3FZ2 A;  1N5Y A;  2BOP A;  2RKI B;  5A6P A;  4USM A;  1VQ8 S;  4IFV B;  1EIY B;  2KT5 A;  1VJQ A;  1VRT B;  1ARO P;  1RT7 A;  3BKT A;  3CJ3 A;  3H25 A;  2IM1 A;  1QSS A;  1B0P A;  3A12 A;  5L9X A;  3SZ2 A;  1WDD A;  1IR0 A;  4CIO A;  1RTI A;  1RIS A;  2DTJ A;  4DR1 J;  1TKD A;  5D8H B;  1DTQ A;  1CJU A;  2Z2M A;  3IBC B;  4P2F A;  5A8W A;  2Z2Z A;  2KYX A;  3DLE A;  3KJF B;  1L3S A;  2RQ4 A;  2CQ2 A;  3PFO A;  3SQG A;  2EFG A;  1REV A;  4RWW A;  5D0R A;  3ZO7 A;  3CCS S;  3R1L A;  1VBY A;  5H9F K;  1F2G A;  3H42 A;  4TY9 A;  2NZC A;  3GJQ B;  5DLG A;  4HTJ A;  2K7K A;  2FC9 A;  4ERD A;  3T19 A;  3I32 A;  1AB8 A;  1LWE A;  1QJH A;  3P3D A;  5LM7 E;  2DNO A;  1EET B;  2XMK A;  1SI9 A;  2JL9 A;  2ADB A;  4MFB B;  4RKU C;  4X64 F;  3QGG A;  2J0W A;  4Y2M A;  1ZYQ A;  5ETP A;  2V0N A;  2AKW B;  1TZ0 A;  1U0H B;  1SVD A;  3HFV A;  3NL0 A;  2WVC A;  4CT9 A;  3I9V 9;  4Y34 A;  1VJW A;  2W25 A;  3BQ1 A;  4IFY A;  3PW2 A;  3AHP A;  2G0I A;  3DOL B;  1X9S A;  2FLL A;  4B3S F;  4A48 A;  2CNL B;  4FYV B;  4Z2X A;  3R5D A;  1X4H A;  4KE5 A;  2IMW P;  2V50 A;  4YB1 P;  4DSF A;  4LFA F;  4OZ2 A;  3MAQ A;  4JUZ A;  3LOU A;  1F0X A;  1NDC A;  4U7C A;  1K8A T;  1LWX A;  3CCM S;  3HSJ A;  2VIH A;  2XY7 A;  3DRR A;  1LW2 A;  3MPD A;  3TR5 A;  4I4B A;  1XR5 A;  3PVX A;  3RB0 A;  1IBM F;  1CEZ A;  4NLS A;  1QVF R;  3TX0 A;  3CD6 S;  3BR8 A;  2J0Q D;  3HHN B;  3C2P A;  2L9D A;  4E2F B;  4YHH F;  4EBE A;  2M7S A;  4EBD A;  2FY8 A;  3LP1 B;  2VQF J;  3ONQ A;  2VG6 A;  3QLH B;  5J2N A;  2R8H A;  2IVM A;  1HL6 A;  5LT5 A;  2KFY A;  4UST A;  1YRU A;  1FHT A;  2BDP A;  1RA6 A;  1TV6 B;  2NS1 B;  1GNK A;  5GAH U;  2BAC A;  1G2E A;  5DS7 A;  2RML A;  1BC6 A;  4Q8F A;  3M8P B;  1UVI A;  4L3K A;  1V9O A;  2YKQ A;  4AXJ A;  1S4F A;  3GIL A;  2X1G A;  1RT3 B;  3DOK A;  5HJY A;  4DHV A;  2R8I A;  4QW8 A;  1EB0 A;  3D0I E;  4OZ5 A;  2BE2 B;  2HQ3 A;  1HLW A;  3CIZ A;  2K8G A;  2QA2 A;  3MCN A;  3L3C A;  3BGF A;  1U1L A;  3E2E A;  1TMM A;  1B70 B;  2P8I A;  3MFH A;  4X4T A;  1MWQ A;  3R3T A;  4UZC A;  4M95 A;  1N5T A;  3W3S A;  4I64 A;  4DN9 A;  5GAG U;  1SQE A;  5T41 A;  4ZDN A;  3IFE A;  4CH1 A;  2WVE A;  4AQY F;  4AD6 A;  3K89 A;  1N48 A;  3MOJ B;  3RG6 A;  3GJT B;  4DXL A;  3RAX A;  2F65 A;  5KFM A;  3IG1 A;  2OAU A;  5H9E K;  2BQR A;  2DNQ A;  2YX4 A;  2WVD A;  2HVD A;  3OTO F;  1PJ6 A;  3OR1 B;  5CYM A;  5HAT A;  4AXI A;  5J1E B;  4Q45 A;  2VKZ G;  1PJ7 A;  3EZO A;  3VGT A;  3Q22 A;  2CQB A;  3ET6 A;  1S9E B;  1F3V A;  2FVC A;  3IBW A;  4G3I A;  1Y5I B;  3X3U A;  2ZIT A;  4FP9 A;  4I56 A;  3H98 A;  4EZ6 A;  4FF1 A;  2XB2 D;  2YKP A;  5LXR A;  2HNY A;  4KO0 A;  2FGO A;  2OD6 A;  2CNO B;  5DDP C;  1S6P A;  4DL3 A;  1SV5 A;  3OTC A;  5IV4 A;  1KLN A;  2Q1L A;  3QFW A;  2JOQ A;  2RQC A;  1W7W A;  4FF3 A;  2KO1 A;  1OMS A;  2HAI A;  3NBP B;  5IFM A;  2OO4 A;  4QWE A;  2D69 A;  1HWJ A;  2YWW A;  4RW6 B;  1R0B G;  4K59 A;  2CQC A;  3GB0 A;  5AJ3 J;  4O0I A;  4MKA A;  2D41 A;  1TKX A;  2KVI A;  5EX3 A;  3KWM A;  1MMD A;  1WSV A;  1RTD B;  2VFU A;  1BQN B;  1E6Y B;  1OJ4 A;  3N28 A;  2B0G A;  1IVZ A;  4X62 J;  2HKE A;  1JLF A;  5KFU A;  4O44 A;  4PAA A;  1UJ4 A;  4OHX A;  3N0V A;  2DH8 A;  4DOZ A;  2OPP A;  4X4R A;  3PJX A;  4G1Q A;  4KAI A;  3PCO B;  2D1C A;  2C2K B;  2Q43 A;  3EWG A;  2HGM A;  2ACM A;  1XK8 A;  4A46 A;  4E98 A;  4ZIW A;  2N7C A;  1TUW A;  3BYR A;  3CD7 A;  3T5K A;  2RQM A;  1W2I A;  4OYP A;  4DR1 F;  3UI3 A;  2D9P A;  1T03 B;  4BLG A;  4YHH J;  2AJ2 A;  1R89 A;  1T9U A;  2NSC A;  3I0S B;  2DHA A;  3QZ7 A;  3N6N A;  4LF6 J;  1YJN S;  3RU0 A;  3QSI A;  1U1N A;  2AP6 A;  2XNR A;  3MPY A;  4KYZ A;  4WZM A;  1DQ8 A;  3FDS A;  5AXK A;  1Z4U A;  3NGD A;  2V8V A;  1N33 F;  1WC1 A;  1RCO B;  1C2P A;  2CPJ A;  4UOF A;  2EBE A;  1HNV A;  2KB2 A;  4A8O A;  5D3G A;  4YEA A;  1S79 A;  4QYZ J;  2IM2 A;  1TFY A;  2H5I B;  4F3M A;  1VLO A;  1U6F A;  4TLR A;  4WU2 A;  5I3P A;  5F0W A;  5IOL A;  1FKA F;  1NJX A;  4XDC A;  4N8O A;  5FJ4 A;  5KFY A;  3M2U A;  4IRK A;  3PAC A;  4NE9 C;  4KQZ A;  5A8R A;  5D4P A;  4X4Q A;  2UU9 J;  4B9N A;  1JLC A;  4F0H A;  1URR A;  2O01 C;  5KFA A;  5KAK A;  1HQ2 A;  3GJS B;  2X3D A;  4OYI A;  3WX8 A;  1RP5 A;  1DBD A;  2E5L J;  2MYF A;  4FBU A;  2GGP A;  4TNO A;  1JIH A;  4ZS6 A;  5KFH A;  4YFU A;  4X66 F;  2VON A;  3D67 A;  1SQF A;  4F0M A;  1B99 A;  2EXU A;  1RTH B;  2ZE2 B;  4Z37 A;  1DFD A;  4EMD A;  4UUW A;  4PRF A;  4ED1 A;  2LQB A;  1KSP A;  1WKK A;  2RU9 A;  2X51 A;  1VQS A;  1R6Y A;  2P6T A;  5KFT A;  2FHJ D;  1N5V A;  4DL5 A;  1Y10 A;  3DRP B;  1SJR A;  4HAC A;  2ACY A;  3D1H A;  2HLT A;  1ZM9 A;  4L74 A;  2ADC A;  3BBC A;  2K2P A;  4JI1 J;  1UL3 A;  2CRL A;  4A4J A;  1T3O A;  1U26 A;  2GS8 A;  2YWK A;  4OV1 A;  2YTC A;  2ZKT A;  2Y0B B;  3D7S B;  3OVA A;  3MR3 A;  4I6Y A;  5GME A;  3PXG a;  1F9E B;  2MGZ B;  1S0O A;  3LP2 B;  2H1Y A;  1UVK A;  4K4Y A;  2QLB B;  3SV3 A;  3SMZ A;  2DHG A;  2I0X A;  2LEP A;  1X4D A;  2OFG X;  3FNN A;  3HM9 A;  1TK8 A;  2MZJ A;  3NKY A;  4EO6 A;  2W4P A;  5E3P A;  5EX0 A;  1Y00 A;  3QID A;  3A3O B;  5IC4 B;  3A4T A;  3S1T A;  4AFF A;  3K59 A;  3C15 B;  1BQM B;  1Y3K A;  4NAS A;  1H38 A;  2A1B A;  4RO0 A;  5ADZ A;  1N88 A;  3QMQ A;  2ZBP A;  4EWT A;  3QT7 A;  4WJB A;  1IBL F;  1KHV A;  2VDH A;  3DNC A;  2AJ1 A;  4J91 A;  4ZVG A;  4C11 A;  1RWM B;  3ZZR A;  5J1P A;  1S5Z A;  3LWM A;  1MU2 A;  4WXO A;  2G0J A;  5E0O A;  2R2R A;  1D8Y A;  1F9H A;  2FTR A;  3RB3 A;  3ENV A;  3VVT A;  3MR6 A;  2QTW A;  4GC6 A;  3V6H A;  3NNA A;  2V2Z A;  1U24 A;  5DM6 Q;  4FXV A;  1U1P A;  1DZ5 A;  4ELU A;  2A3J A;  3RUB L;  3PHE A;  1Q1K A;  2AV5 A;  3UDV A;  4L6V 3;  1HBM B;  3G9C A;  4YR3 A;  1JKH B;  4A47 A;  3N5F A;  2E66 A;  1NK5 A;  3UWT A;  4JI7 J;  1PO6 A;  4UZB A;  1NHU A;  2HS3 A;  1IBK F;  1YX2 A;  2MLX A;  1B7Y B;  5AE3 A;  4WFN Q;  1X5P A;  4WU3 A;  1YIT S;  1NB7 A;  4HH1 A;  2ZUA A;  4KFB A;  5FLX Y;  2EK6 A;  2LMI A;  4DU8 A;  1K9M T;  1SIZ A;  4OYX A;  1RAD B;  4P6Q A;  1I3O B;  1URN A;  4K4U A;  3US5 A;  3IBF B;  4LFC J;  2RDD A;  3FEY B;  2JLG A;  4DZD A;  1N6Q B;  4LFA J;  3P49 B;  4PXB A;  3MEE B;  4WXW A;  1RT5 A;  1N0V C;  1R43 A;  3GG1 A;  2PO4 A;  3M8S A;  3GIR A;  4C8K A;  4U8V A;  4IG3 A;  2ZOG A;  2EWH A;  1UZH A;  3V81 B;  2IVY A;  3OSP A;  2M2B A;  2ZZN A;  2DIV A;  2HBQ B;  1P1L A;  1P1T A;  4DJB A;  3CDB A;  2XSJ A;  5C24 B;  3MD3 A;  4ES1 A;  3KLG B;  3N4W A;  2XS2 A;  1VIO A;  4L72 B;  3MM7 B;  4PZV A;  2XO6 A;  5J2P B;  4IR9 A;  2OSQ A;  1D8Z A;  2DGT A;  2IHR 1;  4USU A;  5KT7 A;  4FYW B;  5CYQ B;  2HND A;  3BSC A;  1NND A;  2BUN A;  5J2M A;  1XJW B;  2RUG A;  5KT5 A;  3OTD A;  2RU3 A;  1N54 B;  1Q78 A;  2WBM A;  2GHP A;  2HHP A;  5HVG A;  1VQ4 S;  3CJ8 A;  1VFJ A;  2RQK A;  5KOX A;  2BKN A;  4DV3 J;  1FO1 A;  4TY8 B;  1R7I A;  2OPQ A;  1HHQ A;  2M0G B;  4KV8 A;  1IJE B;  2OLW A;  2B4V A;  4LBH A;  2KT2 A;  4P7V A;  2LXF A;  2NPF A;  4DUT A;  2WZ1 A;  3T5L A;  1H6K X;  2MY8 A;  3BGU A;  2CJK A;  1KTQ A;  4OYA A;  1YRX A;  4N47 A;  3SXL A;  2M9K A;  2ZKU A;  4C8N A;  1UVL A;  1KVJ A;  2GQ2 A;  2A6M A;  3I96 A;  2PFF B;  1PC4 A;  1UMJ A;  3S01 A;  5DG9 A;  2BVZ A;  1TKT A;  2VPZ B;  3CJ0 A;  4U96 A;  1MNE A;  3KKF A;  5A2Q Y;  1SC1 B;  4O23 A;  2LFV A;  3CC4 S;  5BR8 F;  4L75 A;  4I6A A;  3HJV A;  4PYA A;  1TMJ A;  2CPX A;  2EKY A;  4LF9 F;  2H51 B;  4K0K J;  5D4N A;  3TA0 A;  1HWI A;  3AJD A;  3IWL A;  2RDJ A;  1S6Q B;  1I5O B;  1HI8 A;  3TZZ A;  4RBV A;  2VC0 A;  3V4M A;  4ED4 A;  3G6Y A;  4QU6 A;  1IXK A;  1YJT A;  3HP6 A;  1M5P C;  1TAQ A;  3VZH A;  1BQX A;  2NPI A;  3RZA A;  1IBL J;  2DGU A;  4KT0 C;  2C2N A;  3PEH A;  4O0N A;  4DFP A;  2M70 A;  4RW8 B;  2W9B B;  2HFV A;  2HGL A;  1UEK A;  2YKM A;  2FYX A;  3OFG A;  1GXL A;  3PV8 A;  1FRL A;  1SL0 A;  4H4K A;  3UNY A;  4FXD A;  4B9S A;  2FVS A;  4NEY A;  4ECR A;  4HI1 A;  1IBM J;  4V1A k;  4N56 A;  4FXW A;  3GIM A;  3BGR A;  1SH3 A;  2JJ4 D;  3QQC D;  1FE0 A;  5D78 A;  2B5J A;  3T5J A;  4HL9 A;  2PA3 A;  4JYA J;  1EZZ B;  4KGX B;  4BC7 A;  4LFB J;  3G82 B;  4HR2 A;  1YLX A;  3SIP B;  2XS7 A;  4GVL A;  2DIT A;  1LKZ A;  1BD6 A;  1OSC A;  3L7P A;  4CTA A;  1J2V A;  3TEH B;  2O67 A;  3AT1 B;  3ULH A;  2C2R A;  3MMA A;  1U4B A;  2KH9 A;  3OD2 A;  3AD7 C;  1GT8 A;  2WON B;  3HFK A;  3M8Q A;  4OMF G;  1OY9 A;  2QG9 B;  3AOA A;  2HSE B;  2IA0 A;  3KJV A;  1K73 T;  1RWP B;  1SH0 A;  1OSD A;  2EFP A;  3KJQ B;  4RWX A;  3KK1 B;  3HO1 A;  3OLB A;  2NXE A;  1MG7 A;  1T05 A;  2ASD A;  1HD0 A;  2G1H A;  4CM0 A;  1RJJ A;  3PTW A;  2Y9H A;  4DQP A;  3HZG A;  3I31 A;  3CCJ S;  1SPB P;  2WW4 A;  3HHL C;  1PAU B;  2J0X A;  4BCA A;  4LSN B;  4NLD A;  4URS A;  3W9I A;  3HHL A;  2ZOM A;  4U95 A;  4ZMM A;  4Y65 A;  4CLW A;  1H2T Z;  1RAC B;  1VK3 A;  1NPR A;  1TVR A;  2CAD A;  1Y5N B;  4WFY A;  3UCZ P;  1RAB B;  2VFR A;  1HWU A;  1T9Y A;  1HHT P;  2IJR A;  2MKK A;  4JI4 J;  3NG8 A;  4UQT A;  5JVG Q;  3CDU A;  2JDJ A;  2A18 A;  1AA1 B;  3CJQ A;  3Q8V A;  4J9P A;  1RWK B;  2ZD1 B;  2XYH B;  3RB6 A;  5B09 A;  4PWW A;  3FSX A;  4B3M J;  2OUG A;  2ZM6 F;  2KI2 A;  2GW8 A;  1PYS B;  2DEJ A;  1RT2 A;  2KDO A;  2IJN A;  1NSA A;  4NLT A;  3S7R A;  5A0Y B;  5LJ3 Y;  1VC5 A;  2AQ4 A;  4PEO A;  4CLZ A;  3NCQ A;  2BBE A;  2B8Q A;  1YZ7 A;  4NL5 A;  4URG A;  3EPG A;  2GZO A;  2UUA F;  4ZIT A;  2L3M A;  1NKC A;  3UN2 A;  3K5O A;  2QMX A;  1JX4 A;  2DCU B;  3ADA C;  3T1H J;  5ETT A;  2DRD A;  3ZZY A;  1UKU A;  2Q6B A;  5KT4 A;  3G6V A;  4CO3 A;  2FLP A;  3OLA A;  1HPZ A;  5HBM B;  1ZZF A;  4B3R J;  4NZ0 A;  5DRK A;  2E7X A;  2PMZ D;  3T3F A;  1GAO A;  4M5D A;  3PIP Q;  3H7H B;  2ZHB A;  4KJI A;  4J9S A;  4B08 A;  3Q8U A;  4ZP9 A;  1HNW J;  3UPF A;  4P74 A;  1WC3 A;  4Y3C A;  1NK9 A;  4ZPD A;  4RBU A;  3EZU A;  5IZH A;  2P2C B;  2WTF A;  3QBC A;  4PG4 A;  2C3M A;  1R0A B;  4JI2 F;  2VA2 A;  2FB0 A;  1XBW A;  1ZBT A;  2XHC A;  3MDF A;  2DH9 A;  1YKW A;  2VF3 A;  4O4G B;  4UOG A;  2V4R A;  2KZZ A;  1F5B A;  1NRK A;  3ZXW A;  4Y2A A;  4KB7 A;  5JVH Q;  3DDK A;  2D74 B;  3HD1 A;  5HI7 A;  3MM9 B;  2ZM6 J;  1HNI B;  1J27 A;  4OZL A;  2LVW A;  1HBU A;  3Q8S B;  3MEC B;  1TR0 A;  1L3T A;  3J7Z T;  1OY8 A;  4FVM A;  2W01 A;  3SV4 A;  3MM5 A;  3GJR B;  1V5I B;  2XI2 A;  4NCG B;  5DDO C;  2F8E X;  1S1W A;  1CJT A;  2LCW A;  1HWL A;  1UJ6 A;  1X5O A;  1I51 B;  4K7Q A;  4MK8 A;  5E3A A;  2PMW A;  2XZD B;  4PG7 A;  5GMD A;  4ZK7 M;  2R7S A;  3TUP A;  1CPZ A;  4GVB B;  4AL6 A;  1WI6 A;  1BMQ B;  1LWF A;  1RHJ B;  2EG2 A;  2ZH7 A;  3D6H B;  4ENO A;  5LSL A;  4QIE A;  3R1H A;  1FK9 A;  2FHJ A;  3LA0 A;  3BO4 A;  4KHP J;  4F8R A;  1CUL B;  1WTF A;  2MQN A;  4KPC A;  3W63 A;  2DK2 A;  2KRB A;  2YKA A;  2VG5 A;  2YQ3 A;  3CVK A;  2YWG A;  4I0W A;  2KKH A;  4LSL B;  3BQ2 A;  4UF4 A;  2IM3 A;  3T6B A;  4DV6 J;  1FXL A;  1RAA B;  1X9W A;  3GQC A;  3HF5 A;  4GKK F;  1JLE A;  4LF7 J;  2MDA A;  3FEZ A;  1NK0 A;  2FJV A;  1I6J A;  1CVJ A;  4NCB A;  3MUT P;  1Q81 T;  4PG5 A;  1QDU B;  3CDE A;  5C42 B;  2E1A A;  1F60 B;  1ZM3 A;  3R6L B;  1JLA A;  4LF5 J;  3A8E A;  2VOD A;  2IAJ B;  3PYE A;  1WKJ A;  2OKQ A;  3KLE B;  5HLF A;  4KTQ A;  3E51 A;  4LJM A;  4O3N A;  5IS2 A;  1KNZ A;  2J0S D;  5HQ8 A;  4DR6 J;  1Q95 G;  4IH5 A;  4LRC A;  4ZIV A;  2ZWP A;  4CLP A;  5IWA J;  2HFS A;  2ZBQ A;  3KLI A;  1RLC L;  4OYB A;  1S9G B;  1CJK A;  2LP4 A;  1SJ3 P;  2OSR A;  5BJR A;  4KKO B;  2BRK A;  3TEG A;  1AUD A;  1JLG A;  3V4I A;  1Y4Z B;  2XWX A;  4OX7 A;  3J81 U;  2F4V J;  3R97 A;  2HW3 A;  1DAX A;  1HQU B;  2WSC C;  3W5X A;  1RCX B;  5T14 A;  1ZAV A;  2CFX A;  2H4Y B;  5GAG I;  1RWO B;  3E01 A;  2ROP A;  3VGV A;  1G1X A;  5AXL A;  2I38 A;  2MLZ A;  1PAE X;  3KJN B;  1RA7 A;  1YJ7 A;  2CJY B;  4USV A;  3OBI A;  1FEH A;  4ED5 A;  2CAJ A;  4P75 A;  3OT9 A;  3J7A 1;  4LR7 A;  1TQL A;  1P27 B;  4ZPB A;  3FQL A;  4ECT A;  4NLX A;  3MR5 A;  1IKX A;  1RAF B;  3M32 A;  4IH7 A;  2E5L F;  2V67 A;  4RNO A;  3O2I A;  4J7C A;  1WG1 A;  1UEU A;  3NGU A;  1HNW F;  2AMC B;  3Q2T C;  2JVR A;  3D1O A;  3BQ0 A;  2M8H A;  1LWC A;  4JI5 F;  2WB4 A;  2KM8 C;  3TW0 A;  3VAF A;  1FJ7 A;  2JH3 A;  3ZTO A;  4DPT A;  4LF4 F;  1FFG B;  2HEK A;  3P5B P;  2RE1 A;  1SL1 A;  1SJ1 A;  2X7I A;  3HD2 A;  3S6E A;  1KVK A;  3VGS A;  4ZLJ A;  2NQP A;  1BWE A;  4LRE A;  4OJH A;  1GMV A;  2OEK A;  3R5J B;  3KMS A;  4C6A A;  5FLX U;  5LMN F;  3F56 A;  4OHY A;  1NDK A;  1RT4 A;  2HZC A;  2PEB A;  4RNF A;  2RH3 A;  1UWB A;  5DM7 Q;  2H65 B;  2AEF A;  4GC7 A;  3OVB A;  3V2U C;  1L3K A;  2OPS B;  3C16 B;  3UCU P;  4ZCM A;  1VQM S;  1N36 F;  3DLE B;  3T41 A;  3PDN A;  1S7I A;  1DQ9 A;  1S1V B;  2AW0 A;  3E8O A;  9RUB A;  5KG7 A;  2ZH1 A;  1QE1 A;  2KJW A;  5M2R A;  1QTN B;  3TVK A;  4MIB A;  3LF0 A;  3I87 A;  1TKZ A;  3ILJ A;  4M5N A;  1WEX A;  2J6T A;  2NUH A;  2QMW A;  1T94 A;  2XMW A;  3I4P A;  3SCI E;  1MLA A;  2RHS B;  4DR7 F;  2QT7 A;  4Q2L A;  4W98 A;  1PG5 B;  1RAO A;  3NCR A;  2GJF A;  2V2Q A;  1HW8 A;  4R5P A;  2RIJ A;  1PBA A;  2AHO B;  1U02 A;  4NLR A;  1SKU B;  1RYR A;  2HHH J;  3BGL A;  2ROG A;  1U0H A;  2PFD A;  3TJA A;  5F8L A;  2BQU A;  4PWU A;  2KZM A;  3GIK A;  2BEF A;  3DOL A;  4NOH A;  1NB2 A;  3NS5 A;  4TLQ A;  5AJ3 F;  4CLU A;  3BSN A;  4WP3 A;  1LFP A;  3CJK B;  3RJM B;  2RD5 C;  2AGQ A;  3HK2 A;  4C0O C;  2MKS A;  3ZC4 A;  1TFW A;  4OI0 A;  2CWX A;  4JI8 F;  2HRT A;  1XNQ F;  3UR0 A;  1RTJ A;  4ZP7 A;  1QLN A;  2V8P A;  3T9N A;  2V4J B;  1DUR A;  1LW2 B;  2JFD A;  3TA1 A;  4CT8 A;  3EXY A;  5CXT A;  3AQP A;  1S7H A;  4EU0 A;  4IDK B;  3L7O A;  2EVZ A;  2FVR A;  2I9S A;  4URQ U;  2CPY A;  1SJQ A;  3QGI A;  3TA2 A;  2A2D A;  2N4D A;  4JV0 A;  2VG6 B;  3QLH A;  2A0F B;  1R27 B;  4DPU A;  4X4O A;  1Q4R A;  1HQE A;  2NXU A;  4F26 A;  3D0G E;  4HTI A;  2J7U A;  2WOM A;  2Z57 B;  4DL4 A;  2E7V A;  1E6V B;  2ZDP A;  3DGV A;  1HR0 J;  2L08 A;  2BJD A;  3ILO A;  4LF4 J;  4UTG A;  1RT3 A;  1YJV A;  3FUY A;  4FBT A;  3DYA A;  3BV8 A;  4R25 A;  5HQL A;  5KFE A;  4B9U A;  2I8E A;  2CKW A;  4FKY A;  1BLU A;  4W92 B;  1UPP A;  2GVD B;  1S0M A;  1XMO J;  2ZH2 A;  3FBF A;  4XTT A;  2DGW A;  3GPA A;  4OFZ A;  4WFX A;  5DQH A;  5K8P A;  1S77 D;  2E29 A;  1PGZ A;  1M5S A;  5ETM A;  2UU9 F;  1H98 A;  4CO4 A;  4CLS A;  1CS4 A;  4QW9 A;  4CRJ A;  4K50 A;  4RPF A;  1S57 A;  4IOA Q;  4LRF A;  2WVB A;  3BGO P;  2G2O A;  4PG8 A;  4F4A A;  3NCP A;  5I3Q A;  1FXD A;  1JQG A;  3OR1 A;  4NYO A;  4LF2 A;  2ZC3 A;  3EGN A;  3BH6 B;  2FZG B;  3LO3 A;  4Q44 A;  1NKE A;  1T9V A;  3D4J A;  5G0R A;  1Z2L A;  1HI0 P;  1ULR A;  1N36 J;  4CYU A;  1FNX H;  1NO8 A;  3IO1 A;  1FF2 A;  2HNY B;  2YKN B;  4F67 A;  5DG8 A;  4DG1 A;  3ETM A;  4C7Q A;  1I94 J;  3KLF B;  3UVJ B;  2DCL A;  3BO3 A;  1KQF B;  3JSB A;  1IUJ A;  1VK8 A;  2YX1 A;  1UW9 A;  5LSR A;  5KFK A;  2HYI B;  1B3T A;  4MYT A;  1V6H A;  3X1L B;  1NSQ A;  2I1R A;  2BXJ A;  1M1G A;  1VRU A;  2GJ2 A;  2B6A A;  3HLU A;  4NRU A;  3RAM A;  2AU0 A;  1UA0 A;  3H5X A;  2P6S A;  1BUX A;  2HQC A;  3CSK A;  4P10 A;  2IJF A;  3M7V A;  1KLM B;  2Y1L B;  2QN6 B;  2ALY B;  2V6A A;  4RW9 B;  1U49 A;  1FWL A;  1BQN A;  4JI5 J;  1FDD A;  4X2B A;  3HHL D;  1NUE A;  5BXI A;  1ZA2 B;  1JLF B;  4XAK A;  1NHK L;  1PIL A;  2DPJ A;  4O3R A;  4DFJ A;  5JUM A;  3W65 A;  1TUG B;  1AT1 B;  1RT1 A;  3TI0 A;  1LNQ A;  3IR5 B;  3DOM A;  2L9W A;  4TU9 A;  5ETK A;  2BKO A;  5CQG A;  5JMN A;  4QBU A;  2B43 A;  4L73 A;  1ZPW X;  3HFZ B;  2CVI A;  5L38 A;  2Z58 B;  3HHD A;  2HFN A;  2YVS A;  4PCQ A;  5LJ5 Y;  2AYG A;  3V5R A;  3HX9 A;  3K5M A;  2XY5 A;  5ITH A;  4ZCK A;  4Y2I A;  3UNG C;  1LEO A;  3B4M A;  3Q2S C;  2CDR B;  4NLP A;  3KHR A;  4LF5 F;  3EIC A;  4OL8 A;  3DU6 A;  2ZZM A;  1JNZ B;  1X4E A;  5DDQ C;  4CO5 A;  4HEA 9;  3EDR B;  3JTO A;  3G8T A;  4ECY A;  3AY0 A;  5HRO A;  2GIQ A;  2LA6 A;  4LRD A;  4PUO A;  2Z56 B;  3WIU A;  4C8Y A;  3EMT A;  2R7Q A;  1HBO B;  2FY1 A;  4TN2 A;  2DNL A;  1GX6 A;  1DY3 A;  1N32 J;  1H3D A;  5D3G B;  4Y2K A;  3RYL A;  4E8U A;  5E3Q A;  3T1Y F;  5AXM A;  1PIE A;  4RW4 A;  4DR6 F;  4WKR A;  3GFY A;  4HYK A;  2XZW A;  2UXD F;  4KGZ B;  1WOO A;  2RT3 A;  4KHR A;  4K4T A;  2ZH6 A;  2XBP A;  4CWB A;  1RU1 A;  3IMQ J;  2Z0G A;  3DLK B;  2OMO A;  3HUL A;  1Y0H A;  3QIP A;  3QO9 A;  3U02 A;  3OL8 A;  3LAN A;  3NXZ A;  2MMY A;  2BAN A;  4M5H A;  1UCN A;  1N56 A;  1C1C B;  4IQM A;  4UW2 A;  4ZCI A;  2XCP A;  4JI4 F;  4HLB A;  5IM0 B;  1JLQ B;  2DJW A;  5C5J A;  2ZE2 A;  4DL0 C;  3NGK A;  2BRL A;  2YPY A;  4P7T A;  3DM2 B;  5LOQ A;  3IAM 9;  2HBY B;  2BJ9 A;  2B9E A;  3KUH A;  2VDI A;  3CDW A;  4R8U A;  3R8Y A;  4FKX A;  4DEZ A;  1XQI A;  3DFE A;  2LEA A;  3R27 A;  2BOA A;  4USJ C;  2CIM A;  3EVW A;  3IGN A;  3IRX B;  4FNI A;  3DHW C;  4NLV A;  2HMI A;  2G9O A;  3CO0 P;  5AE1 A;  3CCW A;  2Y1I A;  3DLL Q;  2GVZ B;  2W7O A;  1Y3J A;  4KIA A;  2YNF B;  3BH7 B;  5A2Q U;  1F5A A;  4FYD A;  2DR6 A;  4Y0F A;  1EKS A;  4P2M A;  4NZ7 A;  5C2C A;  2IYI A;  2DR7 A;  3PO4 A;  2P5V A;  1YJU A;  2YQ0 A;  1FFS B;  3H5U A;  5FII A;  2AX1 A;  1EHW A;  5IQQ A;  2MZ1 A;  2OEM A;  3KK3 A;  5I42 A;  5IT9 U;  4DCO B;  2QA4 S;  3N01 A;  4FF4 A;  1YVF A;  2GA7 A;  4YN3 B;  4DX7 A;  4ZLN A;  3CCR S;  4DSJ A;  1BQM A;  1MWY A;  3CUN A;  3SI8 A;  1D9D A;  1LW0 B;  2ZH8 A;  3UD4 P;  1RBA A;  2ZVI A;  4DR4 J;  2DIS A;  4H4M A;  4OIX A;  1FER A;  3DGP B;  3KLH B;  4F50 A;  2UVR A;  1N33 J;  4Q0B A;  2ZZT A;  3DMJ A;  1EAR A;  3FCW A;  3VVU A;  4HHH A;  4J9M A;  4R0J A;  4F7V A;  3VWS A;  1PKU A;  2KT3 A;  1FI4 A;  5K8N A;  1TU0 B;  3A8I A;  2YNI A;  5J2Q B;  3CJT A;  2FGC A;  4JV5 J;  3PYF A;  1U7L A;  1ZET A;  1H0H B;  1F6T A;  4NLW A;  3HT0 A;  4AND A;  3AOD A;  3ITH A;  3SQO P;  4B02 A;  1M5K C;  3QRP A;  1HBM A;  2BM1 A;  4AE5 A;  5DZ6 A;  1PSD A;  2PII A;  3TO8 A;  2YNG B;  3CC7 S;  3UW1 A;  4YUD A;  2I5J A;  1C0U A;  1HMV B;  2OTJ S;  2KXN B;  1BY9 A;  1FRK A;  4GO7 X;  3TAM A;  4JV5 F;  1H2U X;  2XMJ A;  3O8W A;  1HNZ F;  2EBG A;  3DLG B;  4LVO P;  3C6T A;  4C48 A;  1S1T B;  1OIA A;  4ZJO A;  2GIF A;  1AZS B;  5KFZ A;  3G8S A;  2GMJ A;  2B7C B;  4IQX A;  3MFI A;  2G2Z A;  4K4S A;  2VC1 A;  1Q79 A;  3M6W A;  4ID5 A;  2CJX B;  2NLW A;  1OS5 A;  2MHN A;  3HVR A;  2L9N A;  2OPR A;  5HSP A;  4WCE Q;  1K1Q A;  1S49 A;  3I0R B;  4RUA A;  4G1I A;  4GO5 X;  2GMH A;  4JI0 J;  4EYH B;  2E5G A;  2E1M C;  2GCF A;  4NXM F;  5H9F J;  3MEK A;  3VAH A;  3DRS B;  4PXD A;  3I5B A;  4A8Y A;  2VAS A;  2JLF A;  2UUW A;  1FDB A;  3FFI A;  3M8Z A;  3WZ0 A;  4LBI A;  3MAH A;  1C0T B;  3NGT A;  2DNR A;  2AYM A;  1NZA A;  2HQF A;  2Y0S D;  4NA3 A;  5F8G A;  1T95 A;  2HND B;  4A8Q A;  5J2M B;  5GAD I;  3CF5 Q;  1T7P A;  1H7W A;  2CNK B;  3OSN A;  4MAK A;  4KHM A;  3C14 B;  5F8M A;  4RU9 A;  4P9S A;  1DLO A;  1HWK A;  4NLU A;  4QPX A;  1WHY A;  3KHG A;  1LK5 A;  3WHI A;  3TAR A;  3OL9 A;  2EFV A;  4KH1 B;  3JYT B;  1UJ5 A;  1WF2 A;  3EVO A;  2MSS A;  3MED A;  3BBF A;  2H48 B;  2DGO A;  2XQC A;  4LFC F;  4IOC Q;  1V3Z A;  1D3W A;  2EFN A;  3SDE B;  3LP0 A;  5CAA A;  2M8D B;  3ENW A;  2VH7 A;  4ZP8 A;  4PXE A;  3OJS A;  2NUU G;  3ENA A;  2CJA A;  2GV1 A;  2V94 A;  4AT1 B;  1ZM2 A;  4DR3 J;  4N76 A;  2WAQ D;  4X4V A;  1M0S A;  3HVT B;  1VQ7 S;  4NML A;  4NLQ A;  4O3S A;  2YXL A;  1VQ6 S;  3FEX B;  3I82 A;  2UXB J;  2BMB A;  2KHC A;  2J9D E;  4J9U E;  5IXU A;  3TNV A;  2QC3 A;  2HWH A;  4H4O A;  2HVE A;  4DF8 A;  3W2V B;  1KON A;  3EX7 B;  1CC8 A;  2YPZ A;  3K0J A;  3O44 A;  4LIR A;  2D3U A;  3M05 A;  2M88 A;  5F3Z A;  4DV7 J;  3KFW X;  2VG7 A;  4RL1 A;  3PR4 A;  1UWA A;  4DPW A;  2UXC J;  2RF2 A;  2V63 A;  2F7V A;  2DYA A;  2VQE J;  2CPD A;  2POK A;  2B9Y A;  3T1A A;  2R7T A;  1SQG A;  4N7T A;  3THT A;  2QEX S;  4B3O B;  3K5N A;  4DF4 A;  1FKP B;  3UD5 A;  2C3O A;  1YDL A;  3GYN A;  4RBT A;  3SSS A;  3MM8 B;  2ERR A;  2FQQ B;  1NK7 A;  4WFA Q;  1VQL S;  4ZJQ A;  4HHJ A;  1RT6 B;  4C8O A;  4M1K A;  4JI3 F;  5DQI A;  2UZA A;  2XWY A;  1NCL A;  1VQP S;  3TRG A;  3NS6 A;  1N0U A;  4DFM A;  4UY8 T;  1M5V C;  2Q79 A;  3G82 A;  3MMB A;  3NS7 B;  4UT4 A;  5CZX A;  1Q53 A;  3B54 A;  4FZV A;  1XC9 A;  4ZVH A;  2GO9 A;  2MQP A;  2LEC A;  4F4X A;  5HAN A;  1H72 C;  3CCT A;  1YTY A;  3ZFV A;  2V9W A;  2NCK L;  1DTT A;  3BB5 A;  3AFG A;  3MEG B;  1FES A;  4LSZ B;  4OX9 F;  5KFQ A;  1KEK A;  3LWL A;  1JJC B;  3W2W A;  4NX9 A;  4DWI A;  3P4U B;  4FDF A;  3V6K A;  3CME S;  3GP9 A; 
#chains in the Genus database with same CATH homology
 1F6T A;  3ZTO A;  4AND A;  4EK2 A;  3Q89 A;  1NSQ A;  2B8Q A;  4ANC A;  1BUX A;  3VGS A;  4ANE A;  4C6A A;  1NUE A;  5BXI A;  2DXD A;  3DDI A;  1NHK L;  1NDK A;  2VU5 A;  3EE3 A;  1HIY A;  2DXF A;  4UOF A;  3ZTQ A;  3EVM A;  3Q8U A;  1S59 A;  3ELH A;  5IOL A;  1HHQ A;  3VGU A;  1LEO A;  4DUT A;  2DY9 A;  3EIC A;  4W98 A;  1NDC A;  5CAB A;  1LWX A;  3DKD A;  3JS9 A;  3FKB A;  3MPD A;  4UOG A;  3WX8 A;  2BX6 A;  3FCV A;  3NGT A;  3ZTS A;  3EMT A;  4WBF A;  1ZS6 A;  1B99 A;  2BEF A;  1NB2 A;  1NDP A;  1WKK A;  3EVO A;  1NSK L;  1NSP A;  1K44 A;  3BBF A;  3L7U A;  5C7P A;  2HUR A;  5CAA A;  3FBC A;  3BBC A;  4O0N A;  3ENA A;  1MN9 A;  1UCN A;  2CWK A;  4ENO A;  1WKL A;  1HLW A;  1BHN A;  1XIQ A;  4KPC A;  4UOH A;  1NPK A;  3G2X A;  3ZTR A;  2HVE A;  3Q8Y A;  4FKX A;  1XQI A;  1JXV A;  3FBB A;  1NDL A;  1F3F A;  1WKJ A;  4HR2 A;  1U8W A;  2HVD A;  3EVW A;  1VYA A;  4F36 A;  2AZ1 A;  1BE4 A;  2DYA A;  3VGT A;  2AZ3 A;  4FKY A;  1NLK L;  3FC9 A;  3BH7 B;  1S5Z A;  3FBF A;  4DI6 A;  3NGS A;  3GPA A;  3Q86 A;  3VVT A;  4S0M A;  2DXE A;  3BBB A;  1W7W A;  1NCL A;  3PRV A;  1B4S A;  1EHW A;  3VGV A;  1PAE X;  1S57 A;  4DZ6 A;  3EM1 A;  3PJ9 A;  4F4A A;  3B54 A;  1MN7 A;  3R9L A;  3FBE A;  3BH6 B;  3ZTP A;  2NCK L;  4CP5 A;  3Q83 A;  3FCW A;  3Q8V A;  3NGU A;  3VVU A;  2ZUA A;  3NGR A;  2B8P A;  1PKU A;  3ETM A;  3EJM A;  1KDN A;  3B6B A;  3GP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...