1KDNA

Structure of nucleoside diphosphate kinase
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
150
structure length
150
Chain Sequence
VNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIHGSDSVESANREIALWFKPEELLTEVKPNPNLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Phosphotransferase
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title AlF3 mimics the transition state of protein phosphorylation in the crystal structure of nucleoside diphosphate kinase and MgADP.
pubmed doi rcsb
source organism Dictyostelium discoideum
total genus 44
structure length 150
sequence length 150
chains with identical sequence B, C
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1996-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1kdnA00
3NGRA 1EHWA 2B8QA 5CAAA 1S59A 2NCKL 4FKXA 3ZTRA 1LWXA 1NSQA 1WKJA 3Q8VA 4KPCA 3VVUA 3EE3A 3NGUA 1LEOA 5IOLA 5C7PA 1S57A 3Q8UA 4C6AA 1KDNA 3EJMA 4HR2A 1NDLA 4DZ6A 2HVEA 5BXIA 3FBFA 3DDIA 2DY9A 3EVWA 4W98A 3EICA 1XIQA 1WKKA 2HVDA 2VU5A 4ANEA 4DI6A 2CWKA 3VGUA 3ELHA 4S0MA 3FBCA 1HHQA 1BHNA 1NDPA 3GP9A 3FCWA 1NUEA 1U8WA 2B8PA 2ZUAA 1F3FA 4ANCA 4F4AA 1B4SA 4UOHA 1VYAA 3R9LA 3BBBA 4DUTA 1PKUA 3EMTA 3EM1A 1BE4A 1K44A 3BBCA 3ENAA 1NB2A 4EK2A 4FKYA 4O0NA 1F6TA 1S5ZA 1BUXA 3MPDA 1NPKA 4UOGA 1NSKL 3FKBA 3JS9A 2HURA 2DYAA 3ZTQA 1W7WA 3B54A 2DXDA 3PRVA 1NSPA 1JXVA 1MN7A 3B6BA 3FBEA 4ANDA 5CABA 3ETMA 4ENOA 1WKLA 1B99A 1NCLA 3VGTA 3BH7B 3BBFA 2BX6A 4WBFA 3L7UA 3GPAA 3NGTA 3ZTOA 3ZTPA 1NDKA 3ZTSA 3Q89A 2DXFA 3Q83A 2AZ3A 3VGSA 3Q8YA 2BEFA 1PAEX 1MN9A 4F36A 1HIYA 1NHKL 1ZS6A 3Q86A 4CP5A 3G2XA 3FBBA 1UCNA 2AZ1A 3DKDA 1NLKL 3EVMA 3VGVA 1NDCA 3EVOA 1HLWA 3WX8A 2DXEA 1XQIA 3BH6B 3NGSA 3FCVA 3PJ9A 3FC9A 3VVTA 4UOFA
chains in the Genus database with same CATH superfamily
2IBKA 2Y1RI 3RAXA 2YQ3A 4ILRA 2PA3A 2ZC4A 2RHSB 2RILA 2DGQA 4MMOA 4ED4A 1H0HB 4DPXA 2KG0A 5GADU 4Q5VA 2QZ8A 1QAXA 2GVZB 2P5VA 1WSVA 4O3QA 4B3OA 2DY9A 4W92B 2PO4A 1ZM2A 1YJUA 3W3SA 1VBKA 3N79A 4LQ3A 2ZBIA 1SI9A 2W4PA 4KBIA 4ECYA 1SKRA 1BMQB 4X62J 4CNZA 2C3YA 3KHLA 1GMWD 3EM1A 2MLYA 1AZSA 4IOBA 3CJ2A 4DR7J 3TZWA 2W2QP 5LXYA 5GAEI 1URNA 4ZVGA 2C22A 2YH0A 2MMYA 1K9MT 3Q24A 2CJKA 4Q8FA 1C0UB 2RF2A 5C42A 4GC7A 3I82A 1FF2A 2XCAA 3K0JA 3KHRA 3CEDA 3QFHA 2FLLA 4PYDA 1K0TA 3H98A 2CA9A 3NCPA 3RBDA 1R8AA 3FRZA 1L3UA 1X60A 1FX4A 3MR6A 3LW5C 3W62A 4WFBQ 2D3ZA 3DXSX 2VG6A 5KT4A 4RW9B 1RTJA 3VAMA 5GAGU 4F4WA 5A8KA 5GADI 3CO0P 3UW1A 4J9SA 2ERRA 4DS4A 2XYPB 4ZPWR 3EDQB 1J5EJ 2GS8A 1TMMA 4PCQA 1FRLA 4WP3A 3RZAA 3OR2B 4K50A 3BM7A 2MY7A 4IQMA 1BE4A 2CZ4A 2RU9A 3MPUB 4A46A 3M8SA 2XHWA 4DV7J 3IO1A 1U1MA 3WIVA 2QT7A 3D1HA 2V6AA 2HKEA 3RAMA 3SMZA 1BY9A 1I1GA 4X66F 3MF5A 1JJ4A 1XMOJ 1JLAB 4LRDA 2GQQA 2XHCA 2D1CA 2BACA 3JTPA 3FBBA 4FF4A 3KTQA 4WIQA 5HLFA 5RUBA 3NOCA 2R2TA 4DS5A 1V5VA 2AF6A 3HSGA 3Q2TC 5DO2A 1EQ0A 5F0UA 1YQHA 5GAGI 3MM5B 1NHVA 3MPVA 3P4UB 4KGKA 4Q7AA 1VBYA 2ZFHA 2CFXA 3C8YA 1KOOA 4I0WA 1OY8A 2V63A 1RJJA 3MEGA 2VA2A 4O4GA 4E2FB 2OFGX 4IRCA 4URGA 1P9YA 5C2GA 4KV8B 3TVKA 2XGPA 1S6QB 2QL5B 5IS2A 2QYCA 3IS9A 1VOMA 4Z37A 3DOKA 4FKYA 3DU5A 4NCGB 2W25A 2KH9A 3IC1A 2Z2YB 3UD5A 3BN7A 4OYOA 3ZZZA 3R7NB 1IM4A 1VISA 2Z56B 2YNIB 4OLPA 2IM2A 3PW0A 2HFUA 1FHTA 1ACMB 2KI2A 1HNVB 3DN9A 3Q8YA 4WYWA 1TKXB 3GYXB 3UR0A 2XNRA 4QIFA 3TVZA 1AUDA 4QQBA 4LF5F 1K47A 3W66A 3WX8A 1RZMA 4WFAQ 5D3GB 4JI1J 2VB6A 1W25A 1VQ8S 1NM2A 1WDTA 1DHMA 4NLWA 2XWYA 3CMES 2C2KB 2VBWA 5A8WA 2QGFB 2FGOA 3GV5B 3CJ8A 3PYDA 2OPRB 4Q8EA 4EBCA 3LTOA 3ZZ0A 1WD6A 1YVFA 4YR2A 1FVQA 3K8VA 3MMAB 2V8DA 3CW2C 4CRJA 1FDAA 2RQKA 1SIWB 2MJUA 3MTJA 2PE8A 2J0WA 5KFCA 4F04B 2DNRA 1U1KA 2VFTA 1JXVA 4CLFA 3B6BA 1Y4ZB 4R25A 2KTQA 3AD9C 2QMXA 1T95A 2AKWB 2XEXA 1WEXA 3CJQA 3D5MA 3IWLA 5E3CA 1OY9A 2DIVA 4USVA 2Y1JA 2KO1A 4CWBA 3D2WA 4LBPA 4ICLB 2ZH4A 3HJFA 3R6LB 1EP4B 1VC5A 3LH2S 3HVTA 1G7CB 5DZ6A 4OYMA 4UT4A 3H0PA 3WC0A 5KFKA 1I5OB 3IRWP 4QIGA 4I68A 2K3KA 2V8HA 1XJWB 2BR0A 4C6AA 3ET6B 1UVLA 4TQRA 5IQQA 4DSKA 1YZ6A 1RISA 2RIJA 2MSTA 2NUUG 1KNZA 2EEYA 3U1LA 5HP1B 2DGUA 3SIPB 3MCMA 2DBBA 4ZLPA 5A0YB 4YHHJ 1JK9B 3KDOA 3HHLA 2PD1A 5BR8J 2J0XA 3ZC4A 4CQ1A 3BGUA 1H2VZ 1W7WA 4P71A 4X84A 5E41A 1FFGB 4QWBA 4KHPJ 2FB0A 3MEDA 1KTVA 1C4CA 2W2NP 3FBEA 4FYYB 4RNFA 4NCBA 2K06A 1S0NA 1WC5A 4IFVB 2NUHA 1WTBA 3HMJG 4IDKA 4A8SA 1PC5A 3ISZA 2Y3YA 4P2SA 2W7PA 4TVAB 3S01A 1S1XA 2GHWA 2V2ZA 3TQ1A 4H4OB 1KQKA 4KGXB 2Y8YA 4Q0BA 5F3TA 2XY5A 2R7WA 3UNGC 2VFUA 2XLJA 1NK5A 1U0SA 2YBVA 3L9ZA 1KKHA 2FUG9 4X4VA 2MZSA 2AYBA 2W01A 1N48A 2JWNA 2W1BA 3KG4A 3DDIA 3K5OA 2W9BA 3FJ2A 4QPTA 1NH8A 1WELA 4PUOA 4HTJA 3HFVA 1RU1A 1YBUA 4LF9F 5J1EA 5FDLB 5LJ5Y 1KP6A 4DFKA 1JLCA 2BQRA 1MWQA 3P3DA 1HQ2A 3MPDA 4CNYA 1KN6A 4X4NA 3CPWR 1KTQA 3IGNA 3PY8A 3TO8A 5IQ6A 2FD2A 1SPBP 3VCDA 2V4JA 3BKTA 4LSNB 2FVCA 3B4MA 4NLVA 3QBCA 3PEHA 2RUGA 1ZA1B 4AL5A 2YX1A 4OV6A 4LREA 1TKZA 1NMEB 5FIIA 1S1UA 2W8KA 2K1RA 4DU7A 1U1PA 1M1HA 2LQ9A 3SSQA 3OBIA 5F8HA 4DUZJ 3OT9A 1FEEA 2AYMA 1IKYB 4UTGA 2EG2A 4HKQA 1I51B 3PEJA 1QM9A 1R8CA 2VBYA 4PG6A 2W4DA 2HHHF 2CWKA 1H3DA 4IG3B 4ED0A 1YJVA 3L3CA 2AYGA 3VAJA 1U8SA 3G71S 3EMTA 2UUBF 5ETQA 3FKBA 4J9PA 4H4MA 5L1LA 2LA6A 1UEVA 2PIIA 1ZETA 2WVCA 4HLBA 5K14B 1JLGA 3QJPA 5BYRA 5J1PA 2R7UA 3MAQA 1S0OA 2YKQA 3LP1B 4DR4J 3HO1A 1C4AA 1NKBA 1HIYA 1MU2A 2UUTA 3MAAB 1IR0A 1VQ7S 2VPWB 3R97A 1FRHA 3CD7A 5HVHA 4USUA 1N5QA 3DRPA 5D0HA 1GX5A 3OVAA 2BKNA 1KVJA 5J2MA 4OZ0A 1T03B 2G1DA 3CSKA 3QO9A 2LQBA 1C2PA 4ZPDA 1VBXA 4KAIA 3MFHA 3IRXB 1U45A 1VGYA 5IM0A 4NLSA 1SKWA 2D3UA 3M2UB 5LSLA 5F3ZA 2V2KA 4X62F 5L39A 4FF3A 4A8OA 3HFKA 4EBDA 1T9TA 2DNZA 3BGFA 4M5LA 1RTDA 1DY3A 1VK3A 3VGTA 4N41A 2BJ9A 2FVPA 2V8PA 3BV8A 3OQ2A 4ZP8A 2XMKA 1FFWB 3D68A 4F0KA 1IBLJ 2I5JB 1ZS6A 3GLJA 5AT1B 4RW7A 4PRFA 3DYAB 2HQDA 2WSEC 1S1VB 1I94J 4F4ZA 3N6MA 2CQGA 3QGGA 4FBTA 2RUSA 3EGVA 2RKIA 2ZBQA 3DU6A 4IH5A 1PSDA 3BSNA 3E01B 1W2BR 1S9EA 3TNVA 5LMUJ 3V2UC 4DCOB 1WORA 2K7KA 3D0IE 2FLOA 1UWAA 4KH0B 2HZAA 3OTOJ 2V2QA 3H42A 4PXBA 3T3FA 1R0AA 3MR7A 2HNZB 4C97A 3QRPA 2PEBA 3EXCX 1F1BB 5DS7A 4DV6J 4E98A 1J5EF 1VRUA 4URSA 1NSKL 3PX0A 3JAMY 2HURA 1VQMS 2XC9A 2NYHA 4M1KA 1HBOB 1SIZA 5DLFA 3BQ0A 4K4UA 3FMBA 2IVFB 3E8OA 3MXHP 1FK9A 1WJ9A 4JV2A 4FYDA 4DV7F 1RYRA 3VQSA 2JLEA 2E1RA 5B0AA 3JYTB 2R7OA 5I4MA 1X4EA 5IV3A 3P5BP 3CJSA 1Z4UA 3THPA 3F56A 2RQ4A 2M52A 4K0KF 3P5TL 1IKVA 4ZIVA 1RLCL 5C7PA 4U8YA 4YDDB 3T6JA 4O44B 3VZHA 5J2PB 2IRUA 1B70B 3I55S 4U67Q 1FD8A 4KB7A 1HBUB 2QG9B 2Z2LA 2ATLA 2D69A 2FVSA 1TK0A 4K4YA 2VFSA 3MR3A 4M5DB 2LCWA 1KHVA 1MN7A 2ZH1A 1HD0A 4Q45A 1TU0B 2DHXA 2CPXA 3PG9A 1QTNB 3IFEA 2B7BB 5EWEA 4KKOB 4DZDA 4P52A 2GCFA 4HEA9 4R5PA 3PX6A 1FNOA 3J81Y 4RNOA 2KYXA 4RX6A 4ID5A 1PBUA 2DEIA 2XB2D 4FYXB 1ULRA 3HHDA 4OV1A 1X8DA 4ZVEA 4DR2J 4DI6A 1PJ5A 2NYIA 3H5UA 2VG7A 4EU0A 2BJ7A 4PG7A 4JI1F 3D54A 1KDNA 1RWMB 1ZM9A 3QJJA 3NBPB 5G4DA 4GKKJ 4LT6A 4ZLJA 3K5PA 3DMJB 1KVKA 3TUIC 1FRXA 3B4DA 2C2RA 3VF0B 4U9RA 3M8YA 4WU2A 3LWMA 2NSCA 3CDAA 4J5OA 2E66A 2OKQA 4WFXA 2H65B 2ZZTA 4DXLA 3DOLA 3GZ7A 3BYRA 2ALZA 2EW9A 3T1YJ 1TL5A 2DCUB 3CDBA 4RW8B 1YJNS 4Y2IA 2L9NA 1T8EA 4FS1A 1LNQA 2GV1A 1Q78A 4IKAA 1XEZA 3JXOA 1AT1B 2LVWA 2DR5A 4FYVB 1KFSA 3K7RA 2ZBCA 2XMTA 3HK2A 5B0BA 4DV1J 1VHFA 3M8QB 4BS2A 1KRPA 2FLPA 4URQU 1RTIA 3LP0B 3FCVA 3B78A 4EI2A 1MMNA 4W4MA 4YP3A 3D0HE 3K5MA 2BRKA 3HI9A 1CSJA 4I67A 3I0SB 3NY0A 5M2UA 3H25A 3G86A 1LWCB 2F8HA 1XR5A 1T3NA 2DNPA 3PXGa 1PILA 1EB0A 2DHGA 1FKOB 4LIRA 2MGZB 1W2IA 2C42A 3MUVP 4G1PA 5ITHA 2I2YA 2O3DA 1PKUA 2J6TA 4HH0A 1PC4A 5MAOA 4YHHF 4WTOB 1HI0P 3W2VA 3HX9A 4LSLA 4NXMJ 2YKMA 2ASDA 2V8GA 2PMWA 3UCUP 1WACA 2IRXA 5BR8F 2CJ9A 3GPAA 1VJWA 1VQKS 4KHPF 5HQMA 2VC0A 2BUNA 1P1LA 3OTCA 4MFBB 2WB4A 3O1LA 4F36A 1OJ4A 2Q43A 2WZ1A 3PO4A 2ZZNA 1HWLA 2J8AA 4OFZA 2QL7B 2EFVA 4RW4B 4BCAA 1CJKB 1RTZA 2JZ5A 4RL1A 2HIQA 2OEJA 2GAHC 2JOQA 2B6AA 2Q6CA 3UD4P 4QWAA 3DCAA 4DL3A 2ZD1A 3VR1A 1QSLA 1TV6A 3D0GE 4KGVB 4NA3A 1DAXA 3R7BB 3IAS9 1XTZA 5ETOA 1CVJA 4HL9A 1IKXA 5DG7A 3OD2A 1JLEA 3AT1B 4C8ZA 4ZCMA 2Y1LB 3EZ5A 1NJWA 1LQ9A 2D41A 1X4CA 1OO0B 4QR1A 1BD6A 1L3SA 3CJ5A 4J9OA 1YRXA 4F26A 3CB4A 3NEKA 4CM2A 4NZ7A 3M9NB 5J2QA 4AL6A 3KK3A 1UWBB 3WZ0A 2R8JA 2DITA 3DGPA 3MM6A 2DH7A 4ES3A 3HM9A 4MJKA 2HS3A 1G2EA 3J7Z5 3GIJA 4CP5A 2CPHA 4B3SJ 4OJ1A 3KHGA 2ZHBA 2X3GA 4BBYA 3PYFA 1R27B 3PJWA 5E3AA 4YR3A 3AFGA 3OHAA 2M3DA 3NL0A 4UY85 2R7RA 3ULHA 3MMBB 3MUTP 4OYWA 1E6VA 4PQAA 1UZDA 4DZ6A 3TJ8A 3RGIA 4G65A 1G1XA 3KJQB 2X1BA 3D3CJ 2E9RX 3AXKA 1T05B 4PWDA 1DURA 1V9OA 2ZUAA 4WZQA 1Y5IB 2N7CA 4M94A 3QLHB 5K8OA 1K44A 2WCXA 4FPIA 1BQNB 2UZAA 3CIMA 1ZH5A 3GV8B 4FF1A 3SV3A 4M63A 1WUUA 5G0RA 3W61A 1MW7A 1R89A 4XAKA 1LFWA 1NEEA 3HD2A 2KL8A 3ZTOA 3K2YA 3TEGA 5KG4A 4RKUC 1NHUA 1VQNS 1K0VA 3TJAA 2YH1A 1EIYB 2UUAJ 4DR4F 4L72B 4OX8A 1J27A 5IWAJ 4F67A 2LQ5A 4KQZA 4DOZA 2E7WA 3PRDA 4OHWA 4WP9A 2XLKA 1IKWB 1LEOA 1U1QA 4WE1B 3CDUA 3KUGA 2MKKA 3CCVS 2F4VJ 4MYTA 2ZITA 3CO9A 1E6YA 2Q79A 5A8RA 2AJFE 4P2MA 2J9CA 2VPZB 2F8EX 2E7XA 3R9LA 2QO3A 1VRTB 2IYGA 4LQ9A 1RWKB 4RW9A 2EKYA 1S4EA 1S6OA 3C19A 5KG7A 2HHVA 3UDLA 5CYQA 5IC4B 3MMJA 4PWUA 2HNDA 4A48A 1P27B 5L1JA 1NK7A 3FDSA 6FD1A 1AW0A 4RUHA 2CNNB 1IQTA 2WW4A 4NLPA 1LXNA 1VQ5S 3P49B 3TAMB 5KFRA 2AIRB 2HGLA 4EMDA 5DG9A 2HVZA 4KGZB 2E44A 1RTHB 1EX8A 1IBLF 3I32A 3G4SS 4R0EA 4K4WA 2CPZA 5KFMA 1LXJA 3IGVA 5HJXA 3M32A 1FNXH 3QJLA 1HWIA 1I94F 2B4OA 1BQXA 4F2SA 2F9DA 2KFYA 1S1TB 2DKOB 5CCMA 2XS7A 1WG5A 2GX8A 4M5NA 2C2OB 2AJ0A 4DG1A 4F4KA 3AA9A 2IMOA 3CCES 5LMUF 3OTOF 1NU4A 3MECB 1IJEB 3FQLA 3PDNA 1RHQB 4ZDNA 4ZITA 3QATA 3MM5A 1YJ7A 2CJXB 2E29A 3PM9A 3VAFA 2JEGA 1Q8LA 3G82A 1SJRA 4LFBJ 4DV6F 3HLUA 3IA0A 3GWCA 5KFSA 4C9DA 2CVIA 1HI8A 5K8NA 1VLOA 3V6KA 2BE2B 5A76A 2XSFA 3BSAA 5KT2A 1U1OA 2VFVA 5JUMA 4KV8A 2EFOA 1YGYA 1JX4A 4Y6IA 2RQMA 2PFDA 2WSFC 1XBWA 4PG4A 3KLHA 2QA4G 3TOQA 2BANB 4NCGA 1NPRA 2N4CA 1R43A 2JC0A 2Z57B 1B7FA 2ZM6J 2QA2A 2QLXA 3QT6A 1HL6A 2YVSA 2FHOB 5LSRA 1RT7A 1OIAA 3BGOP 1WOSA 3MM8B 4DCJB 3HKZD 2FHJD 5KFVA 3ZFVA 2XY7A 1DLOB 2KKHA 3ISNC 3WHIA 2ACYA 1S6PB 2HFOA 3D28A 3UNYA 4NEYA 2DVIA 2QN6B 1VQOS 1MWYA 4CO2A 3RG6A 5L46A 4OYXA 2ZH2A 2NXJA 4OI3A 1QUVA 4NASA 4LVOP 3BBFA 3QQCD 1TL3B 2BQ3A 4R0JA 1RACB 2YKOA 1PAEX 3ILJA 1XMQF 1UCNA 2W4CA 3SV4A 2UXCJ 2KT3A 4JI3J 1JKHA 4P73A 4DU8A 1WF1A 3KJVA 1WSRA 4YMEA 3DGVA 4DL2A 3DLHA 5B0DA 3CVKA 3PW7A 2RS8A 2XI3A 4YB1P 3M9MB 3KLFB 4DR2F 3HHLD 4ZLNA 2KU7A 1EARA 4HR2A 2A1BA 1ZAXA 1ZTTA 1TKTA 3FBFA 1D8ZA 1ZOTA 2XMMA 3J81U 3V4IB 1VQ6S 1SJ3P 2MHEA 2AV5A 3KKFA 1F5AA 4GKKF 1J5OB 1HWKA 1VYAA 1H72C 1HR0J 4RUCA 1VQ4S 2VBXA 4V19J 4J7CA 1RYSA 2MZQA 2F40A 1KQGB 1MSWD 2DYAA 1D9FA 2H5IB 1KR4A 2EVZA 2XMUA 1WDDA 4F4XA 3T1YF 2PN6A 1NJZA 3OVBA 1UP1A 1S99A 3G8QA 2DEJA 3HF5A 3OVSA 3KMQA 4NLUA 5E0OA 1ZZFA 3L09A 4DN0A 2HVHA 2WVFA 2UUCJ 3SXLA 3PKMA 4DN9A 1XNRF 2DHAA 1RWXB 3AOCA 3A13A 1D9DA 2HHXA 4E8UA 4J9NA 4DV1F 3FFIA 1U4BA 4ZCKA 3IWXA 1IBMJ 2L41A 4JI5J 2K3IA 3VVUA 2OGUA 1SV5B 3Q8UA 1DTTA 1VC0A 3NNAA 4MKVA 4IO1A 3TP2A 2C3UA 4KGMA 4ITSA 1FKPA 3JTNA 3I0RA 3OXGA 2VOPA 2KHDA 2J8SA 5KFLA 4LIWA 1CJVB 5HJYA 2MJNA 4OI2A 5L9NA 1RBOB 1H2UX 3NS6A 1IR1A 3ETOA 1FRIA 1UFLA 4RWWA 1M0SA 2MKIA 4K4XA 2CNOB 4GMKA 5DDQC 2R9LA 2A3JA 2OPPA 4NXMF 2H54B 3OUYB 4PABA 1N4LA 4L76A 1UPPA 2DD8S 5JXSA 5C5JA 3VALA 2XMVA 5B0GA 4MIWA 3PZPA 2JDJA 4PWWA 3DLEB 3BQ2A 5KFDA 1DQ8A 4ECRA 2XS5A 4NX9A 1VLYA 3CWJA 3QGHA 4CLTA 3TW0A 4CO1A 1TAUA 1TZ0A 4J37A 3RW7A 4LJMA 4YUDA 1JLQB 2QEXS 2JX2A 3BGRB 3IBFB 3D1OA 1S9GB 3Q8PB 3ITHA 3CCZA 2E5IA 2G13A 5I3QA 4CLKA 1UFWA 3RB4A 1IQZA 1KLMB 4ELUA 4BC9A 5AJ3J 3S7RA 4DL0C 2G2YA 4KO0B 5DJBA 3L95X 1BGXT 2EI5A 4I69A 5C24A 4IG0A 3Q22A 3KLGB 4F7VA 2VL1A 2ZHOA 2D3O1 1WKLA 1XK8A 3GJTB 2H48B 4X4SA 1D8YA 2J7WA 1HNIB 1N34J 2M2BA 2BDPA 4IG3A 3I5CA 5ETTA 5DQGA 1MN9A 3ZNUA 3PO5A 1HMVA 2HHTA 1WEYA 3KLIA 2M8HA 1NO8A 1KOHA 3R5CA 3D6HB 2ZOMA 3FC9A 2B8QA 4B3SF 5H1SV 3F41A 2E1CA 1FRJA 4WU3A 5KFPA 4WFNQ 3DHXA 2CPDA 1X4DA 3M2RA 1CBKA 3LP2A 4AD6A 4C4WA 1VQYA 3QWUA 3M8PB 3PR5B 4WF9Q 3F73A 3QYYA 1M5HA 4MTPA 1TVRB 3DDNA 4DR5F 2WVBA 2P2CB 5ETSA 2ASLA 3HKWA 4ENOA 3C16A 2B9EA 3KLEB 3AJDA 2CAJA 1T03A 3H2LA 4Y2KA 3R5GA 4KJIA 3OPKA 4ZJOA 1LW0B 1H98A 2GW8A 1HQUB 2DXFA 4JI2J 3QIPA 1OY6A 1REVA 3G2XA 1P9QC 1JLFB 4TLQA 5EN1A 1N52B 1UJ6A 2LEAA 1Q1KA 2IDEA 5IV4A 3LOUA 3ZZYA 3KK2A 1D3WA 3KWMA 4UUXA 4ELTA 2NS1B 2UUAF 2EC0A 2FHKA 1CJUA 1RCXB 5IWAF 2DRDA 2XM3A 3NCRA 4FP9A 1B7YB 3GFZA 2NLWA 4DMZA 3UN2A 7AT1B 3EICA 2LKZA 4C11B 2B4PA 3TYTA 2I5JA 3H5SA 1DTQA 4DDFA 4V19X 1APSA 1DRZA 2F4VF 1SVDA 4ECWA 1S1WA 4Y34A 2V2VA 5KFNA 3CCRS 1M5PC 4ZHRA 1VR6A 2HHSA 1PG5B 2MQPA 4PPZA 2I8EA 3B54A 4M5GA 4IO9Q 1NPPA 5CA5A 5D4NA 3BH7B 4OIXA 3J81j 1RWWB 3CD0A 4CCHA 1EETA 2O5DA 2ZVSA 1RAOA 1O0PA 4AL7A 5GVQA 2AEJA 2MZ1A 1F3VA 2R7VA 2HNZA 1DQAA 1OQ3A 2UXBJ 2OO4A 2BRLA 2OFHX 2OPQA 4NRTA 2LMIA 4YDXA 2HLUA 2RDIA 3MHYA 2N7YA 2M0GB 4XTTA 5HMXA 3OL9A 4OI1A 4G1QA 3TWZA 2Y0BB 3PR4A 2HMIB 3EPGA 2BYCA 3M9OB 2JC1A 1WNEA 2CJBA 1RDRA 4A4JA 3RR8A 2OD6A 4RNMA 3G6YA 1U8WA 4I6AA 2DR8A 2QE5A 1FJCA 1RT3B 2NSBA 3UN5A 3MM9B 2HQIA 5GMKa 2JL9A 1TELA 3CCUS 1MMDA 3AD7C 2OPSA 1QAIA 1XN9A 5CABA 2Y9HA 2JJ4D 2HS0A 3UDCA 5J2PA 1HBNB 2VQFJ 2ZH8A 4LFBF 3CMAS 4P75A 3TA1A 1KBRA 3N9UC 1FRKA 1IUJA 2IMWP 2FQQB 2OD4A 1HBUA 4DSLA 2IDLA 1YBAA 2N4DA 2VPXB 2G2ZA 4OQJA 2KHCA 4OLOA 3DI6B 1YRTA 3KOAA 3I87A 3IAM9 1Y9OA 4HDGA 4HHUA 4CLPA 2KFNA 4ZVFA 1FTCA 2ZM6F 1SKSA 2RQCA 2HNYA 5EX0A 2AD9A 1NRKA 1LKZA 4KKOA 5KFWA 3GR1A 4ZVUB 1YIJS 3GE9A 1CJTB 3W1YC 1RT2A 3MMCB 5LT5A 2J6SA 1RT1B 1KHWA 4TU9A 1Q81T 3M6VA 2IRYA 2WBRA 3SDEB 3NMRA 5B7WA 3DLJA 4WXWA 2AJ1A 4ALZA 1UETA 4TU7A 4ZN1A 4LBIA 1YI2S 1F60B 3NBPA 1WC1A 3HPOA 3OHBA 4QW8A 5ETPA 3IR6B 3PJXA 3H59A 3D3BJ 2W24A 4KRWA 4LFCJ 3VAGA 3OSPA 2P9GA 1SKUB 4M5JA 4B3OB 2UXCF 5JJBA 5FLXY 3W9HA 3W5ZA 3HDSA 4ZVTB 5KG3A 3NGUA 1F5BA 2NPIA 2RRNA 4ID8A 3EJMA 2MKCA 4DR1J 1SCJB 4YR0A 4ZK7M 4ILLA 4DQPA 5HSPA 5FD1A 4A8KA 4TLRA 4USHA 3NMAA 3M8QA 4PKDB 3OL8A 5DQHA 1UA1A 3BDEA 4HT5A 3PIPQ 3BBBA 4CI0B 3DC2A 4IUFA 2WOMA 1BQMA 2KRBA 3U02A 3D6TB 4FVMA 3HULA 2RF2B 5C42B 2XSJA 1AFJA 2MZRA 4MAKA 4ANDA 2MLZA 4QYZJ 4QOTA 1O5JA 5LJ3Y 3AQPA 1FKOA 1IBCB 2IA0A 2HGNA 3JSBA 4TY8A 2AZ3A 2RU3A 4CLLA 3EZUA 1TK5A 3G6XA 1RTJB 3MEEB 9RUBA 3I5BA 3A8IA 4TXSA 1SC1B 1PIEA 2VDIA 3T5KA 4LF9J 3LGNA 2NXCA 2DGTA 4P2FA 4YB7A 3FNNA 1C1BA 1FWKA 2YWKA 3AA8A 2UUCF 3HHKA 2AJ4A 4R8UA 2ZDOA 5E5NA 4OJGA 2OAUA 3I9V9 4CH7A 1N33J 1IBMF 2QMUB 4TYBA 4JI5F 4FPRA 4ANEA 1FNMA 4DL5A 5T7LA 2BJEA 3DRRB 2WONA 4RW4A 4KFBB 4Y2CA 4K8RA 2DNLA 2JFDA 4H54A 4HH1A 1Z2LA 5DGBA 4WFZA 2DNHA 2XGQA 1KS2A 1X4GA 2XQCA 2NXUA 1M1GA 1GXTA 2FY8A 3PTWA 4MKBA 1WHXA 2H4WB 4EZ9A 4J9MA 2GQCA 3GJQB 4HDHA 4U8VA 4AFFA 2HHHJ 3NCQA 5IFMA 4M5HA 1BLUA 4IFYA 5FJ4A 5KFFA 3W63A 2ZH3A 2HHUA 3MEGB 3G9CA 2DNQA 1XMBA 6AT1B 4FKXA 1UWBA 4WWSA 3ENQA 2FDNA 1UEUA 4F0MA 4X4PA 3AB4B 4L3NA 2VG5A 2EFGA 5CYMA 4ZS6A 3KK1B 4DJBA 3DOKB 4JI4J 4NLDA 1Y0HA 1T94A 2PDAA 1PCAA 4F8RA 3UVJA 1O51A 3O44A 2CPJA 5HANA 1UVKA 4EK2A 2YWGA 4UW2A 1HNZF 5DQIA 1KVIA 2OMLA 5AJ3F 4GVLA 4CH0S 5KFQA 1RP5A 3G8SA 4RU2A 1Q16B 1Y7PA 5A2QU 1C0TA 2WVEA 2C3MA 1T05A 3OFHA 4TKTA 4EUVA 2K8GA 4JB8B 3I4HX 4C48A 2DIUA 4CLYA 4U7UD 1N34F 4RLEA 1RT4A 5LMNJ 2DCLA 3SZ2A 3IR5B 5KT5A 2DO4A 4BC7A 5A8WB 4N56A 1UA0A 4DLEA 3EX7B 4OHXA 2N82B 1YTYA 4C2MA 5B0FA 3AODA 4LRBA 1QTMA 3QAUA 3EYZA 2GJ2A 2V9KA 3ISND 1FWPA 3MFIA 4PQUA 1QE1A 3FBCA 2IYIA 3A3NB 3GP9A 3W2WA 5CZVA 1S97A 2EPIA 1P8GA 4I6WA 2YNGA 1UL3A 2CQ0A 2DO0A 3EDRB 2D9OA 1WOOA 1GT8A 4HVZA 2OHDA 4LF4J 3V5RA 2NXEA 1QAJA 2OP5A 3GSIA 3O3LA 3CC2S 1HI1A 1WEZA 4DBQA 2IFXA 3HVTB 1QUPA 2CNLB 4U7UK 1HFEL 4DFJA 3BSCA 4KSEB 3CCMS 2LXUA 2HFZA 4JI2F 3QSIA 2MY8A 1T9YA 1XQIA 3A8KA 1I6JA 1ROFA 4RW6A 3IG1B 2YY3A 4K5SA 1NSQA 3DM2A 3M6WA 3KNAA 1Q95G 2CXEA 1VQ9S 1RSCA 5HN0A 3NS5A 1RT6B 4P6QA 3TAMA 3CE8A 1FT8A 5IT4A 2ZOFA 3GB0A 2MZTA 3TAQA 3HHLB 4ECQA 5CH7B 1PO6A 3FCWA 4C3KA 1ZBTA 4DCPB 4IQXA 4F4AA 4I6YA 4LF7J 3MEDB 3M6UA 4B02A 5HROB 8RUCA 5KG1A 2B9XA 2NPFA 3DRYA 3SFGA 3D4JA 2CQ4A 4JUZA 4IDKB 3TANA 5KFUA 5HBMA 3V4MA 4K0KJ 4DL6A 2EK1A 2YNFB 2CZVC 2JLFA 4NRUA 1MROA 3HZEA 4JI8F 2O1PA 3Q2SC 4Q0BB 3DNCA 4WXOA 3EZOA 2VBZA 1VDHA 2A10A 1N5YA 1EAYC 3WX4A 2ROPA 4ED2A 1FJEB 2FJXA 2BJ3A 4CZCA 3LGMA 2UXBF 1JMTA 2IY5B 2W9BB 1HWJA 5E33A 4PUOB 5IT9U 2YWEA 2R8KA 2X51A 1DJ0A 4G3IA 5J1EB 3JB9k 1JXEA 1RCOB 2VFRA 4NWBA 1JLCB 4I2QA 1S7IA 1WF2A 3J80Y 2HSEB 1FDBA 3LO3A 1N54B 2IAJB 1MMLA 7FD1A 1QD1A 4IH6A 2G2OA 3MCOA 2V4JB 2B9WA 4B3TJ 4DQIA 4N8NA 1RBAA 1T02A 2BW2A 1FEHA 1S1UB 2R3VA 3DOMA 3ZXWA 5DG8A 4PAAA 4RWXA 3UR3C 1WC0A 5JVGQ 2VQFF 4O3RA 2GO9A 1FFSB 2AW0A 5H9FK 4CLSA 4FXDA 2EK6A 4F3OA 3OJUA 2DXEA 3VTIA 3R5JB 5E7OB 2OIHA 2ILYA 4J9RA 2MPUA 4CO4A 1XNQJ 3TUZC 1ZTWA 2VDHA 2MKJA 3ZO7A 2GGPA 4J9UE 3U27A 2DPJA 5K5MA 2DB1A 4H4MB 2LQJA 2CUYA 1SL2A 5ETMA 1FE4A 3N01A 5CZXA 3M2VB 5EUHA 3AY0A 3K5LA 1U25A 2XI2A 3H4DA 1NSPA 3H8YA 4OYPA 1B99A 2WBMA 5KFAA 3FUYA 1MU2B 3V4IA 4UQTA 2MXYA 1WHVA 4DPWA 1TFYA 1EKRA 2CJQA 4ZIWA 2XULA 3CTRA 1RI7A 1J5OA 5AE1A 2QL9B 4FDFA 3I6PA 1A9NB 1JNZB 3O6QA 5HMZA 4OX9J 5L1IA 2OSQA 1C1CA 3DRPB 1U6FA 2WK4A 5KT3A 3W60A 3L4BC 5J2MB 3ENVA 1WC6A 3LF0A 3ZTRA 4LFCF 2VA3A 3QO9B 1HHSA 1X9MA 2ASYA 1D9AA 2DRAA 5HMYA 1NDLA 1ZPVA 1RKJA 3DLLQ 5IM0B 4DQQA 3DDKA 2QV6A 3RBEA 1R6VA 1T9VA 3IM8A 2V34A 2HWHA 4P72A 1N5TA 3GJSB 2Y0SD 4I1TA 4DR1F 2BABA 4ANCA 3HSJA 4FVCA 3C14A 1AFIA 1CPZA 3JS9A 5ETRA 1SV5A 2MSSA 3J7AN 3OXFA 1JWWA 4B3MJ 2MKSA 1REGX 2DY1A 2E5LJ 4RW7B 2YX4A 4USKA 4WFYA 3B8HA 3GIIA 1TR0A 2XMAA 4B9LA 3ZTSA 1WHWA 4MKYA 4RO0A 4NI2B 1MLAA 2A2CA 4J9LA 5DLGA 2RKIB 1CG2A 2VICA 1S9EB 2VH7A 4U7CA 5B0EA 1T0TV 2VHGA 4USIA 3R27A 5HAOA 4F3QA 3N5BA 2PMHA 3DRSB 4CT8A 2BKPA 2JRSA 3ZZTA 2HQ3A 4JI7F 3CJ0A 3CCWA 4ECSA 1NB7A 1R0AB 3DLKB 3MWBA 2DPIA 3OUYA 2B9YA 3MPWA 1ELOA 4WIIA 1N33F 2DH8A 3HZGA 2BA9A 3LA0A 2ABYA 1U49A 3ENAA 5F41A 1FK9B 1NKEA 2J7UA 1JLQA 4MK8A 4B9TA 3ZZPA 4NLTA 4AQYF 1M1KT 4K4SA 2PFFB 3F0NA 3Q23A 3OR1B 2V0NA 1OYDA 4ZP6A 3T9ZA 4H4KA 3G6VA 3PCOB 4DV5F 3EVMA 1IKVB 4UQGA 3QZ8A 3WQPA 3C15B 1YHQS 3HHLC 1F9FA 4DV3J 2Z4PA 4P74A 2JEFA 1V3SA 5IT0A 2VPYB 5C25A 2BJDA 2W7OA 3KNGA 1WI6A 2QLWA 4B9UA 4MK7A 1TAQA 5B08A 4J90A 2OMOA 1FA0A 4E0DA 4X65J 4ED6A 2PGCA 2B8PA 5CHCB 1ZPWX 4OI0A 2RDDA 2HHWA 4LF2A 3W8PA 3GG1A 4F3MA 4PXCA 2AHOB 4JI4F 3U1MA 1JJHA 4IR1A 3RB3A 4A8YA 1NK8A 1X4HA 3TX0A 5I3UA 2YKNB 5L9XA 3T5HA 3CD5A 3TUJC 3TZXA 4DSIA 3MAHA 3PNIA 4IR9A 4O0IA 3EGWB 4L3KA 1S76D 3OFFA 4LRFA 1Z2ZA 3EUNA 2WB1D 2R2UA 4ZVQB 3HT3A 1F2HA 3IP0A 2UVVA 1Q86T 2RMLA 1X5SA 3IR7B 3LGHA 3HHEA 4FBUA 5LMNF 2VQEF 1LWXA 3KLEA 4DUYJ 5IOLA 3V6JA 1FXLA 2MQLA 4TNOA 1OSDA 3JQKA 4OZ3A 1S72S 5KFXA 3DOLB 4F2RA 4GKJJ 1SH2A 2HFVA 1LK7A 1IWAA 2B43A 3QFWA 5IXUA 5ETVA 3M8WA 2DHSA 2V50A 1Y11A 3A3PB 5ADZA 2XO6A 2CDRB 2PEHA 2J76E 5KT6A 3ETMA 5CXTA 1NCLA 1FKAF 4Y2MA 4ZP9A 2BOAA 4ED7A 2MTLA 4LF4F 2Q1LA 1RTIB 4Z7CA 3JTOA 1G3OA 5KAKA 2ZHAA 4QU7A 4AXJA 4QZVB 3AD8C 2YNHA 2C3OA 2DGVA 4UOFA 1AXQA 4Q2LA 2HVIA 3E2EA 2AGQA 1S57A 3QT7A 1VK8A 4CLWA 4IYQA 3OW2R 3C46A 2LXFA 4OJHA 2CJAA 2GIFA 2OH2A 2P9EA 2MKYA 3MDFA 1NJXA 2XZWA 2X7IA 3W2VB 1MWZA 2BE9B 4ZVHA 2YKMB 3C6TA 4Q43A 4HT7A 2XMWA 2OUGA 2G4BA 3G96A 2W9AA 4LF7F 2B4VA 3NGKA 3J7A1 5E3QA 4XK8C 1RT5A 3MM7B 2WTFA 2HPUA 1AA1B 2HQFA 4OHZA 2B4UA 4UUWA 2P8IA 5KFEA 3MCNA 1QAYA 1RT3A 2ZD1B 2L48A 3MM9A 1TV6B 3PACA 4L73A 5KOWA 4DX8H 2EWHA 2COLA 4B9NA 4KPCA 3GQCA 1HBNA 3MOJB 1JLEB 1UVIA 5AE2A 5D0EA 5HI7A 2C2MB 4UF4A 4OYIA 4A8XA 5HVGA 1X31C 4O3PA 2RE1A 2SXLA 1U47A 2YPYA 1SQEA 4PPDA 1Z1ZA 3A8EA 3FEYB 1TL1A 2UXDF 1JLBA 5J2QB 1XMQJ 3KK3B 1UW9A 3OFEA 3KUEA 1IXKA 2GHVC 2Z2MA 1SJQA 3C6UA 3DGPB 3MM6B 3WDOA 4QYRA 2LYVA 5F9NA 2I38A 3IBWA 4L75A 2AJ2A 5JMNA 1B3TA 4B3TF 3J7ZT 3TAPA 1QSSA 5CQGA 5EWGA 4O3SA 1RB0A 2X1AA 3TR5A 4CDIA 2A6MA 2GMLA 3GONA 2ZZMA 4FNIA 2HHPA 3R3TA 3VAIA 2MZJA 4KHMA 4BDPA 3RR7A 1URRA 1F2GA 4UY8T 5T41A 5CYJA 3QAEA 3A8JA 2R7SA 4U6PA 1YBTA 2ILZA 1A0OB 2FC9A 3CUNA 4MYUA 4JI0J 1NJIT 2Z0GA 4PWDB 3M30B 2G0JA 1HYSB 1RADB 1PJ6A 5KG0A 4UOCA 3KJNB 2LLZA 2VU5A 1ZM4A 3P96A 3IN5A 3OSNA 3MGJA 3OLBA 2IPOB 1XNQF 3BO2A 1NK4A 4ES2A 1FJGJ 2WHOA 2ZWPA 2ZNZA 3BYPA 2PI4A 2I6WA 5L1KA 3N28A 3KDNA 5G0RB 1HBMA 2FJEB 2JH3A 1BWVA 1WC3A 3T19A 2EFPA 1XNRJ 3MOZA 1JQGA 3MI7X 2RD5C 1N6QA 3H5YA 3V6DA 3FZ2A 4DR6J 4JI6F 1N32J 3CJKA 2CKWA 3CT9A 4ED5A 2OJ3A 2BX6A 2P6TA 1NZAA 1PYTA 4X4OA 3QRRA 1S49A 3FRYA 1RA6A 4I2PA 3CD6S 2J9EA 5AXNA 1OPZA 3QNWB 3GIMA 1AYEA 5GAHU 1EJ7L 2XWXA 2H5EA 3M7VA 1EQMA 5BYSA 1RK8A 3ONQA 4OX9F 1E6YB 4HACA 5A8RB 1S10A 3Q8RB 3DLGA 2ADCA 1VS3A 2P6SA 2BVZA 3TA0A 3PV8A 3GV7B 2HWIA 2KJWA 4X4UA 2RHQB 3W5XA 3ZZUA 2GFFA 2NZCA 1HHQA 4WP8A 3MEEA 4ZPTR 4FF2A 1IWGA 4ECUA 1Y5LB 5CYQB 1LWFA 1U0HA 5KOXA 2HNDB 2VF3A 1U24A 1OWXA 2Z30B 4YY3J 3VV2B 1F6TA 2HK2A 1XERA 2W2MP 2BMBA 3SQGA 4ELVA 3WC2A 1X0FA 1SJ1A 1NSAA 1KC8T 4CTAA 4DPUA 5E3PA 4ERDA 4WTYA 3DRXA 1HPZA 1NDKA 3DRRA 2MKHA 3OLAA 4C8KA 5KG6A 4B3MF 2R2RA 2CQ1A 2E5LF 4MK9A 2I1RA 4KFBA 1Q4RA 4OHVA 1WOPA 3OFGA 1ITPA 1X5OA 3M32B 5KT7A 1V3RA 3E51A 5GAHI 5EWFA 2EBGA 4X4RA 1DBDA 2DK2A 4LRCA 4DG1B 3H20A 4ED3A 1VC6A 3QPIA 5BXIA 2LU1A 1KWMA 2Z8QA 5GMDA 5HQ8A 2RAQA 2FJDB 3D9BA 1HD1A 4C8OA 2DGOA 2H3EB 2HBQB 2C2NA 3LWLA 3G82B 2M9KA 1WG1A 3LALA 4X4TA 8ATCB 4C0BA 3M1VA 4ZJLA 2E5HA 4Q44A 5J2NA 1WG4A 3ZTQA 4ED8A 3H90A 2FJWA 3UWTA 2C2EA 1HNWJ 1M5KC 2QSFA 3PHEA 2PA8D 1XC9A 1YKWA 1CULA 1HQEA 3SQOP 3KLHB 4QWDA 3LANA 3KK1A 3V81A 3FEZA 1UVJA 1Q5VA 1RKIA 2BEFA 3FSXA 4ZVPB 3UCGA 3NXZA 4C98A 3H4BA 1SUQA 1ZZNA 2YQ0A 1ZA2B 4F0HA 4FS2A 1NXIA 3OXLA 1RT7B 3H2UB 4MIAA 2MLXA 1TL7A 2JEJA 3HVRA 4DR5J 1Q7YT 3CC7S 2L9DA 4DV3F 1B0PA 3R5AA 4IRDA 1QDUB 3DHWC 3GCXP 4QWCA 1GTEA 2DNGA 4NE9C 1VIOA 1RAFB 1FO1A 1NBEB 1GK8A 3MURP 4OZJA 4ETXA 2GVZA 1RUSA 4DQSA 3GCWP 5HMWA 4XO0A 4I7FB 4ECVA 5D8HB 2HQCA 1H7WA 2W9CB 1RWNB 4X65F 1KQSR 2YWWA 2MB0B 1FI4A 2GVDB 1JIHA 3CJ4A 5EDWA 5HQLA 3BR8A 1JKHB 3Q83A 3KJVB 1EZZB 3BN4A 3IWNC 3AB2B 3LAMA 2FHJA 1C0UA 3KXDA 4PXEA 2UP1A 1FJ7A 1QLNA 5LM7E 5KFBA 1N88A 3W64A 1ZM3A 1TKTB 4NLGA 4NCAA 1LK5A 1WKJA 4NYPA 3I9ZA 1S6UA 4A8FA 2HFNA 3MCSA 3ZZRA 2MQ8A 1A6LA 4DFPA 3TJ9A 1U6ZA 3OL6A 2KXNB 4DUYF 4NEZA 4N77A 2QFIA 3HSZA 1N56A 2FTRA 4HTIA 2KXHA 3SSRA 4N7TA 3OTEA 2GIQA 3RUBL 1GAOA 2BV3A 3BQ1A 1Q82T 2CYYA 4TY9A 2LDIA 4GKJF 3IG1A 3CDWA 3CXCR 4O23A 3H7HB 1SJ4P 3OR2A 2KRRA 1DARA 1UJ5A 4ZPAA 2VKRA 2F8MA 2IVMA 4OYZA 1Y3JA 3H40A 4A47A 1RT6A 4JBCA 4C3LA 3M05A 2CPEA 2HRTA 5BJRA 1X0PA 1YG0A 2EFNA 1H6KX 4LMZA 4WZMA 5F0WA 4IOCQ 3CIZA 2KM8C 1X5TA 3FFIB 5HROA 2VJVA 1FCAA 2BZ2A 5I3PA 4ZCIA 2GZOA 3EVOA 3BEGB 1DTTB 1JLAA 2LEPA 1RAGB 5L8RC 3PVXA 4Z7YA 3Q8VA 2L08A 4NZ0A 1FKPB 3Q0AA 4KE5A 2YNFA 3I0RB 3POTB 4QPXA 4Y3CA 2R4FA 1HA1A 3NAIA 2NXNA 2KXFA 3KUHA 5MLCV 3NP5A 4JYAJ 1N5VA 1NDPA 5EHHA 4RU9A 3RB6A 2IM1A 1T9UA 1KSPA 4EYHB 4I64A 3KFWX 4QBUA 2YWHA 1UMJA 2F65A 4IOAQ 2ADBA 1VBZA 4UOGA 1S6QA 2OPPB 1Q8BA 2CQBA 4A8MP 3JAMU 2ZKTA 2ZDPA 1R8PA 2AMCB 3GYGA 2H4YB 4AT1B 2GIRA 4JV1A 3J7YU 4LF6J 2IAJA 3PHTA 4YQWA 2YNIA 2DR7A 2ZBPA 5F8IA 3GU0A 1HNVA 1S7HA 3WBZA 2AJQA 3PW5A 1TKXA 4HHHA 4M5IA 4DSEA 5D6GA 3ITHB 3QT8A 2HAIA 2UV8A 4OZNA 4LR9A 2JHEA 5D3GA 1VFJA 4PG8A 1CS4B 2QC3A 2AWZA 2E9ZA 4F25A 2QA1A 2V4RA 1Y5NB 4X4QA 5F8JA 5C24B 4IG0B 4K59A 3GFHA 4WYLA 1U6BA 1TUVA 4OMFG 3HJVA 5DM6Q 2OPRA 1LWEB 4DWIA 3TEHB 3MMAA 3QZ7A 3ILOA 2R8GA 4BWJA 4B08A 3S1TA 1N36J 4GVBB 2RT3A 2ROEA 2BXJA 3G8TA 3J7YI 1HMVB 1D1UA 3KLIB 2DGWA 4P10A 3ZTPA 1IJFB 1SH3A 4WKRA 2VASA 1FD2A 2ZUGA 1M5OC 5EX3A 1MNEA 2J5AA 3BPDA 3UDEA 2BOPA 3M2VA 2HK3A 2LDYA 2HZVA 2V5HG 5A6WA 3NOGA 4HI2A 4ICLA 1X9SA 2YKAA 5KFZA 3JSMB 5K20B 3CGIA 1EP4A 3M2RB 4CYUB 4XIUA 3BO3A 3LP2B 2NREA 1H38A 1N0UA 4ES1A 2VJUA 2C1EB 3BB5A 2J6UA 4JI0F 3TUPA 1S12A 2UUWA 3ET6A 5DZ7A 2DISA 4YS2A 4P2XA 1JB0C 2FJBB 2XTJP 4LBHA 1VQSA 3JQMA 1LW2B 1Y00A 3C16B 2PI5A 1FJGF 2EXUA 5HP1A 2FJAB 2XZTB 1YWXA 5A0YA 3QIPB 1REVB 4G6VB 1YJTA 4QU6A 2QTWA 4UZCA 4DR6F 1G6BA 2D9PA 1N32F 2KB2A 4RPFA 4L6V3 2XNQA 1X4FA 1VI7A 2ZJQQ 3KK2B 3V6HA 1V5IB 4IFVA 4DR7F 5I42B 1CJUB 2GQ2A 2KYZA 1U26A 1M90T 4J9QA 3UCZP 1OS5A 2BKOA 1RXOB 3TI0A 5DRKA 1R3NA 1DTQB 1NH7A 4H4OA 5ETLA 5DETA 3BZQA 4QIWD 4RR5A 3RJMB 1UFKA 3CCJS 1S1WB 4W98A 4NI2A 5HO4A 4XPEA 2HVDA 4KPYA 4M8LA 1CQNA 5J1NA 1NAQA 4S0MA 4ZHRB 1TUGB 2ZH6A 1TQLA 3RTVA 4ECZA 2AU0A 3UPFA 3MZIA 4PG5A 3RBZA 2FYXA 1V6HA 3U1NA 3HVAA 1RWPB 1BUXA 3DRSA 3E3XA 1EETB 3O8WA 1U1RA 5FDLA 2J7KA 1HWUA 3BS9A 3DLKA 4DX7A 4ZN3A 4YY3F 3PW2A 2ACMA 3GTYX 4OZ5A 4TN2A 2OPQB 4C0HA 1WC4A 1NHKL 2DJWA 2KVQE 4EO6A 2J9DE 4LSNA 4G1QB 4NYZA 2JVRA 4JOUA 3IXQA 1Y3KA 4PYAA 2CDQA 5DDPC 4I4BA 3AHPA 3UQSA 3NGDA 5ETKA 1ZYQA 3BPSP 2UVRA 3GIRA 2LP4A 4PEOA 1HNZJ 4WPAA 3OR1A 4NYOA 1U48A 5B09A 3G6ES 5F8GA 2VD3A 2EG1A 1XMOF 4HHJA 2F3JA 1F9HA 4CT9A 2IA6A 3HSDA 3KMSA 2ZJPQ 2OSRA 1IKYA 1U2RA 2OPSB 2LFVA 3D66A 3C15A 1RLDA 3RBXA 1T11A 3VQTA 5ETNA 2H5JB 1NB2A 5LXRA 2ZWOA 2HS4A 1P1TA 2OEMA 2FHMA 2GC8A 1U2FA 4O3OA 2M5YA 5L38A 2HZCA 4IRKA 4QWEA 1SC3B 2QLFB 3CDEA 3S8SA 1SQGA 2HEKA 1S4FA 1T3OA 1V3ZA 5D4LA 3FEXB 4B9VA 1HNWF 3KYLA 3KJFB 2IJNA 4JV5J 2VOOA 4USMA 4P7VA 3DKDA 4RNHA 2CADA 5K14A 1SB6A 4P7TA 3LP1A 5DM7Q 2V94A 1NJYA 2HBZB 4Y0FA 2HNYB 2IM0A 1S59A 3RAQA 3R1LA 3MAAA 2YKNA 4KIAA 3RRKA 2AGOA 3PW4A 2B5JB 3NG8A 1RT2B 3M8ZA 2VONA 2UVUA 1OPIA 2LU2A 4HYKA 4K5RA 2F1FA 4DPYA 2HQGA 3AAWB 3R5BA 3QGIA 1U7LA 1OYEA 3N6NA 2I0XA 3O2IA 2LA4A 4MT1A 3GYNA 1K1QA 4B3RJ 3FSIA 5IZHA 1DQ9A 3PRBA 2HGMA 4YN3B 3MD1A 1NK9A 3FCHA 3IRXA 2RS2A 5EGYA 1R6YA 2JLGA 3CCQS 1RHUB 3M2UA 2GMJA 4RBUA 1CEZA 1HKAA 4ZMMA 1KLNA 3BGLA 5THWA 1GMVA 3OJSA 3GR0A 3AQOA 3OV7A 1QVFR 3C2PA 4I56A 2D3OR 2C2ZB 1SC4B 1CC7A 3KG1A 2Z2ZA 2DH9A 1W26A 1D0EA 1RQ0A 5LL6d 2GJIA 1FXDA 1QVGR 3DYAA 1S1VA 1R8HA 1X9WA 2YX7A 1X7VA 4GO5X 4RJVA 2M88A 5K8PA 2CG8A 4V1Ak 2LECA 3MPYA 4DSJA 2CWXA 5CD4H 4F02A 3E01A 4Y2AA 2WOMB 2BE7D 1BQMB 4LF8J 1SH0A 1VMBA 3D7SB 4ZA1A 4DV0J 4JI8J 4WCEQ 2XSJB 2QJ3A 4K4ZA 1G4CA 2WRMA 2A0FB 1N8RT 2YKPA 3T5LA 3AOAA 4TY8B 4DFMA 2GO8A 4XDDA 3QGPA 1HARA 3D1QA 2F5GA 2AX0A 5D77A 1UZHA 3P8BB 1KFDA 1HBOA 3SCIE 1HNXJ 3I5AA 2VUGA 2AZ1A 3T1HJ 2XO7A 2BM0A 1C1BB 1U09A 2RRAA 4DV2J 2R42A 4R8UB 3THTA 2OLWA 1NNDA 3JYTA 5T7LB 1UVNA 3MR5A 3MM7A 3CJTA 2WONB 2B7CB 3NKYA 3FMWA 4W90B 4WK1A 1BXNA 3X1LB 2IC3B 1GTHA 1HHTP 4O44A 2LEBA 1MG7A 2VODA 2JVOA 3K58A 4J9VA 2R8HA 4JYAF 3UI3A 1D09B 1S79A 2KVIA 2RH3A 2GHPA 3CJ3A 4AYBD 1VJQA 1R7IA 2OI2A 1LOUA 5LSOA 4M5DA 2CIMA 4IFYB 1ZAVA 4ZPBA 1F9EB 3N4WA 5KFHA 4YFUA 2R7TA 5K9FA 3H5XA 2FLNA 1NLKL 4LF6F 2XZDB 3BKUA 2ASJA 2HRUA 2HHQA 5DDRC 7FDRA 1B64A 5K8MA 3ZNJ1 4M95A 1EKSA 2F9JA 2E1AA 2VG5B 1YZ7A 5CYMB 1GQEA 2ZE2B 2QIFA 1GNKA 4OYAA 1VQPS 4FXWA 2KZMA 4NA2A 1XIQA 4K2XA 3TQEA 5C2CA 4USWA 3UVJB 1UEKA 5T14A 3AOBA 3PYGA 5M2PA 1YDLA 3GIKA 2RSQA 2DNKA 2DR9A 4DLGA 1NK6A 3DMJA 3MR2A 1XR7A 5AE3A 2D74B 2H1YA 3GJRB 1C0TB 4DUZF 2FZCB 3H2VE 3WIUA 4DEZA 3M30A 1VQLS 3W5YA 1XWLA 1HYSA 3HT0A 3L7UA 4NXNJ 1RT4B 2J9DA 3IM9A 4RW8A 2KT2A 4XPCA 2QFJA 1N36F 1RAJA 2AEMA 2IM3A 2Z58B 3VGSA 1VIXA 1PYOB 4LSZB 4TU8A 2CRLA 1L5UA 3PYEA 3LPEA 5KFYA 2H51B 1OSCA 2APOA 2BJ8A 4DX6A 3LAKA 1AZSB 3KG0A 4CO3A 3FGVA 1BWEA 3CC4S 4PQUB 1QE1B 3LP0A 4IH7A 4YB5A 4ATNA 1PGZA 3W2WB 2M8DB 2CQ2A 1H74A 3I0SA 2IBOA 1SC6A 3ELHA 1LWCA 1DZ5A 2YNGB 2VV5A 1S0VA 5AXMA 5F8NA 2YQ1A 1FWLA 5E2QA 2MGZA 5IC6B 2ZH9A 1VCTA 2VG6B 2UU9J 1M5VC 1TUWA 4Y65A 3KLVA 2IJFA 2GJFA 3SEOA 1UKUA 1GH8A 2BJ1A 5A8KB 4JI7J 2HBYB 2B3TB 1QJHA 1X5PA 1GMWA 2B51A 2OTJS 2YWFA 4RW6B 3MD3A 4ZJQA 2VIHA 2ZBRA 5D15A 2E1PA 3DM2B 4OYBA 3BH6B 4MFBA 4X64J 2FVRA 2CQIA 3EGNA 2XY6A 4D3GA 1RAEB 4DL7A 3FK4A 1CJKA 5HATA 5HL7Q 1CQMA 3QRQA 2CVEA 3JSRA 2GMHA 4ILMA 1GXUA 4EYIB 4AQYJ 3HFZB 2XYGB 2F63A 3NNCA 4NLOA 3NAHA 4MKAA 2BM1A 5M2RA 4LFAJ 1Q0NA 1NUEA 4DV4J 2AYEA 4ECTA 3GG0A 4AUKA 5HLFB 5HBMB 5A6PA 4DV5J 5D4OA 3MTKA 1TL4A 5B0CA 2B0GA 4MH8A 4QIVA 3BO4A 1MROB 2QYGA 2HYIB 1GXLA 4LR8A 3VWSA 4RUAA 2IHR1 3W8GA 3NS7B 2G1HA 2IVYA 4WBFA 1N5YB 1SXLA 3GFXA 4O4GB 3VHQA 3Q8SB 2U2FA 5DGAA 2PC6A 2DGXA 4B9MA 3FZBA 3NLCA 1L3VA 2DTJA 3W9IA 4GO7X 3IS9B 4RNNA 1UJ4A 2PMZD 2A2DA 3T41A 3DXBA 1DFDA 2Q3PA 2J0SD 4I2QB 1P6TA 4F4YA 3SSSA 2NZ4A 3EVWA 3UFCX 1FTRA 2V4QA 2G0CA 3MMBA 3T5JA 1FX2A 1VRQC 3VGUA 2XG8A 5F8LA 1K1SA 2FGCA 3R6GB 1Q79A 4UZBA 2GNKA 2BW7A 2O66A 5SUHA 1I3OB 2C28A 3OTDA 4CO0A 1UW4A 4KHRA 3DOMB 3PRVA 1PYSB 2HRYA 3P6YC 3QLHA 2CQDA 4FNHA 2VQEJ 1BQNA 2XYHB 3NNHA 2ZH5A 2IJRA 4USTA 4QR0A 2GA7A 3CCSS 2W7AA 4B17A 4EZ6A 4A8WA 4I7FA 2B56A 3DFEA 2W9CA 1KEKA 1NDCA 4CO5A 1RGVA 4JV5F 3HD1A 2VKZG 4B9SA 2DNNA 3THVA 2MDAA 2RB7A 2GVDA 2CQHA 2F4FA 2GGPB 4Z2XA 2V67A 3IMQJ 3CULA 3MEKA 2HVEA 3IBCB 3K17A 4ZKAA 3AXMA 3RW6A 2WW8A 3R1HA 2WSCC 1GFWB 1IKWA 3CCTA 1N5SA 1TK8A 2QX0A 3R7SB 2V9WA 1BHNA 4WE1A 3TZZA 4F50A 1B0TA 4EGLA 3ILLA 1JJ2R 1K73T 5GMEA 1FE0A 3TARA 2BBEA 1S5ZA 3QSYB 1FXRA 2CNKB 3A3OB 2YXLA 4OI4A 1O8BA 3A1YG 1VRTA 4DQRA 4B3RF 3GSDA 2FJVA 4HI1A 2MQQA 1SJFA 4K7QA 1C1CB 1H73A 2QLJB 2AT1B 4ZCLA 5HVFA 3RRGA 1LFPA 2W2PP 4J91A 3RYLA 2ZKUA 3UD3P 2HLTA 2FC8A 3X3UA 4TQSA 1O6XA 3W7BA 1NKCA 2JSXA 3PX4A 4NMLA 1RBLA 3TRGA 4YB6A 4TYAA 6FDRA 3C66A 1RTHA 5KG5A 2ALYB 2KDOA 3AH6A 3FQKA 5H9EJ 1WKKA 4KT0C 1S1TA 3C14B 4N47A 3D6MB 1RWOB 4LF8F 1S1XB 2AQ4A 1Q53A 3EGZA 9ATCB 2O01C 1IBKJ 3QWPA 4KY3A 4DV0F 1YLXA 2HAFA 3MECA 3POTA 2OEKA 4G1IA 1CLFA 3JQJA 4NZ6A 1SL0A 4NOHA 3AJ1A 3EPIA 3UDVA 3Q89A 1Q5YA 1A7GE 2UV8G 3UN3A 3R2DJ 3L7PA 2BE2A 2L9WA 3CF5Q 4WKYA 2BQUA 1YITS 2V68A 1HNXF 2NQPA 2UXDJ 2C3PA 3T1HF 3GMGA 1FVSA 4DSFA 5LOQA 2E1MC 3D67A 2NCKL 3F44A 2K2PA 4QYZK 2BANA 4DV2F 2GAGC 3EE3A 1WF0A 3MUMP 5AXLA 1SBRA 1RA7A 3PIOQ 4C8YA 3LQVA 1JNRB 4GC6A 2U1AA 5KFGA 4ZVSB 3PKYA 4RBTA 1YX2A 1S0MA 4D3HA 1T9WA 3P45B 4NLQA 3Q8QB 4LR7A 3MM8A 1TKZB 2JNJA 3CJRA 2DNMA 2HW3A 3ENWA 2OTLS 1WI8A 3TZYA 2K1RB 4Q2MA 2E5GA 4JV0A 2KFZA 1DLOA 2G9OA 4DR3J 4K4TA 1NZ8A 1S6PA 3M8RA 4NMXA 5A2QY 4ECXA 1CS4A 3OTBA 2KN4A 3OL7A 4PXDA 2ZH7A 2RDJA 2V8VA 4CLUA 1UPMB 3Q86A 2F7VA 4K4VA 5AXKA 1TL3A 3CCLS 5C25B 1YRUA 1LWEA 1Q8IA 3SCJE 4DPOA 4ETZA 3U7JA 1U1NA 2ZJRQ 2ZNYA 3K59A 4GVBA 4O4RA 2M4MA 3R2CJ 8AT1B 3D6FB 4JI6J 2ATCB 4ZLLA 4OL8A 1H7XA 2QLBB 1RAHB 1PBAA 5DDOC 1JLGB 3KLFA 1GX6A 2WVDA 2EC2A 5F9LA 2D7SA 1UTAA 2YPZA 1YSJA 4PR6A 1Q7LB 2RNEA 1U2CA 5I3UB 4NL5A 4OZ2A 3JSMA 2ZEJA 2QSWA 1FRMA 2Y1IA 1TKDA 4CYUA 3LUYA 3QIDA 1AUSL 2DXDA 3TA2A 3W9JA 4ZVRB 1S77D 3QMQA 1RE1B 4N76A 2HWTA 4FN5A 2EKNA 2N3LA 2QMWA 1AROP 1RHRB 4OI6A 2PSZA 1LW2A 4NXNF 4CM0A 4KH1B 1TMJA 2W2OP 4XDCA 3NGRA 3BDPA 5CAAA 3R8YA 3N6LA 2DHHA 3HCXA 3SBMA 5FLXU 3K5NA 5D0GA 1RTDB 1RABB 1Y10A 4CH1A 2JFKA 3KHHA 3NWRA 2Y8WA 1R31A 5D4PA 2AGPA 4N8OA 1FDDA 5KFIA 2KG1A 2M70A 5I42A 5CD4A 3BREA 2XCPA 3K57A 2Q6BA 2FPHX 5HK4A 4DF8A 3CNQP 2VC1A 1NPKA 1CJVA 2R7QA 4X66J 4J9KA 4RZRA 3SI8A 1WTFA 1S48A 2UU9F 2X1FA 1SL1A 2CPIA 2YNHB 3BJYA 4AXIA 3G87A 2CG4A 1FERA 2CZ9A 3AJ2A 1S9FA 1M5SA 1KQFB 1RAAB 1FDNA 5CCLA 2FZKB 4QR2A 5IT9Y 3VAKA 2EFQA 2MEWA 4ER8A 4BWMA 3GFYA 1VRUB 3W65A 3ADAC 1OMSA 1H2TZ 4X64F 3DLEA 2POKA 2X3DA 1FESA 1RHJB 2FZGB 2HFSA 2ZVIA 1RWUA 3C6TB 4O3NA 3BGRA 1F3FA 4Y28C 3N5FA 1S9GA 4WJBA 4QCLA 1R8BA 1GEHA 1LV5A 4LFAF 1RT5B 4DV4F 4C7QA 5SZTA 1KLMA 3I4PA 4K2JA 4OJ3A 1TTHB 4KO0A 4AE5A 2R2SA 3VZIA 3KLGA 1KONA 3NGTA 3CMQA 2KZZA 4LF5J 4CLZA 2L3MA 2N3OA 2O67A 1TP7A 1HNIA 4NLRA 5H9EK 1HLWA 5BYQA 2E9TA 3T9NA 3NWGA 3PJ9A 2YTCA 3BSOA 1X4BA 4KYZA 2XBPA 1QSYA 3HHNB 1YJ9S 1HW9A 4LF1A 2QA4S 1RAIB 4Y00A 1TL1B 2PT0A 4EEYA 1JLBB 4DF4A 5D0RA 5KFTA 3TVYA 2CPFA 4QW9A 3C6UB 2MQNA 4R5PB 2HG4A 4DHVA 2DNOA 4DUTA 1R0BG 1RWVB 2R7XA 4ID5B 3L7OA 2HIYA 2XLIA 4ZVOB 3A4TA 1KD1T 3EXYA 4NA1A 3M8PA 2B5JA 4ZPCA 1IR2A 2VG7B 4NPOA 3K89A 4LVNP 4LUBA 1NK0A 2FIUA 1AB8A 1TVRA 2ZOGA 2M7SA 2DR6A 4KTQA 2MQOA 2ROGA 1Q8KA 3VAHA 3I96A 2XS2A 2K7JA 2V69A 3ICLA 1ICEB 1PJ7A 4L74A 5D78A 4JP8A 2MHNA 4FZVA 1LW0A 3HVWA 1HQUA 2Q66A 2X1GA 3NGSA 1F5CA 2CQPA 4YEAA 1JLFA 2MQMA 2HBRB 4PZVA 3T1AA 1YJRA 1L3TA 3SCLE 1JXLA 3SFUA 4C8NA 2ZC3A 3ILIA 3K8WA 1GMUA 3TX8A 1HBMB 4OZ1A 1U1LA 1YJWS 4H4KC 4JI3F 2H9ZA 1PAUB 1B4SA 1N6QB 4C11A 3V6DB 4QIEA 4KC5A 3CJKB 2RJZA 2IIHA 4O0NA 2G0IA 4EO8A 3GILA 1UAWA 1UVMA 3US5A 4I2PB 1HW8A 5U47A 2E5JA 4MIBA 2I9SA 2MYFA 2CQ3A 4U95A 3QT5A 1XR6A 2A18A 4DPTA 1HR0F 1SQFA 4C8LA 1TFWA 3SYZA 4RBVA 1RHMB 1T9XA 4HACB 4LRAA 3DLGB 3FSYA 1EHWA 4M5MA 4X2BA 4OX7A 1ZAWA 1JJCB 2A6OA 2W8LA 4OHYA 2VZ9A 3PFOA 4M5KA 4C8MA 2QRRA 4FYWB 4LSLB 4EWTA 4ZP7A 3UE2A 3I31A 5KTQA 3BKFA 1RU2A 1LWFB 1U0HB 1F0XA 1RHKB 2DGSA 2HMIA 1X4AA 4DX5A 3ZZOA 3SQGB 2FY1A 1VHIA 4UOHA 4C3MA 1OQ6A 4BLGA 4A8QA 5H9FJ 3N0VA 4OX6A 3DLBA 1J2VA 2OELA 4CTAB 4GRSA 1CC8A 4QJVA 3M6XA 4KR0B 2B6AB 1HPZB 4EFAC 3A12A 1B0VA 1IBKF 1IN0A 2LQ8A 4ED1A 2CQCA 2R8IA 5KFJA 4ZPVR 5JVHQ 3JSYA 3RU0A 1QY7A 1WWHA 2IC3A 5KFOA 1IM6A 2DRBA 3NRBA 4NLYA 2RRBA 2WAQD 3FVYA 4CIOA 1IKXB 2J0QD 4C0OC 2EBEA 3C3LA 3BR9A 4N5SA 1T7PA 2XMJA 5KG2A 1U02A 5F8MA 3UO0A 3HXMA 4FXVA 4U96A 4EBEA 2AP6A 2AEFA 3DI6A 4YOEA 1BC6A 3LPYA 3M4XA 3EWGA 2UUBJ 3M1VB 2KJVA 3BF4A 5J2NB 2JEIA 4BHQA 3I56S 3O5TB 3PFEA 3J80U 2RVJA 1YK9A 3T6BA 1CJTA 3BBCA 3MMCA 1CULB 1HQEB 2LXIA 3RB0A 2E7VA 1RT1A 1L3KA 1K8AT 4P9SA 2ZE2A 5GAEU 2FVQA 3V81B 3SDEA 2CJYB 4RUBA 1IVZA 4NLXA 4OZLA 1E6VB 4DR3F 2DT9A 4DL4A 2DNYA 4WK3A 1SUQB 2CPYA 3S6EA 1N0VC 2KT5A 5E3RA 1TL7B 2P9CA 2C2DA 3RRHA 2NR0A 3VGVA 2KM8B 2UVWA 4ZOSA 1R0CB 3SCKE 3R5DA 3B82A 1WHYA 3HP6A 4USJC 2AX1A 3VVTA
chains in the Genus database with same CATH topology
3NGRA 1EHWA 2B8QA 5CAAA 1S59A 2NCKL 4FKXA 3ZTRA 1LWXA 1NSQA 1WKJA 3Q8VA 4KPCA 3VVUA 3EE3A 3NGUA 1LEOA 5IOLA 5C7PA 1S57A 3Q8UA 4C6AA 1KDNA 3EJMA 4HR2A 1NDLA 4DZ6A 2HVEA 5BXIA 3FBFA 3DDIA 2DY9A 3EVWA 4W98A 3EICA 1XIQA 1WKKA 2HVDA 2VU5A 4ANEA 4DI6A 2CWKA 3VGUA 3ELHA 4S0MA 3FBCA 1HHQA 1BHNA 1NDPA 3GP9A 3FCWA 1NUEA 1U8WA 2B8PA 2ZUAA 1F3FA 4ANCA 4F4AA 1B4SA 4UOHA 1VYAA 3R9LA 3BBBA 4DUTA 1PKUA 3EMTA 3EM1A 1BE4A 1K44A 3BBCA 3ENAA 1NB2A 4EK2A 4FKYA 4O0NA 1F6TA 1S5ZA 1BUXA 3MPDA 1NPKA 4UOGA 1NSKL 3FKBA 3JS9A 2HURA 2DYAA 3ZTQA 1W7WA 3B54A 2DXDA 3PRVA 1NSPA 1JXVA 1MN7A 3B6BA 3FBEA 4ANDA 5CABA 3ETMA 4ENOA 1WKLA 1B99A 1NCLA 3VGTA 3BH7B 3BBFA 2BX6A 4WBFA 3L7UA 3GPAA 3NGTA 3ZTOA 3ZTPA 1NDKA 3ZTSA 3Q89A 2DXFA 3Q83A 2AZ3A 3VGSA 3Q8YA 2BEFA 1PAEX 1MN9A 4F36A 1HIYA 1NHKL 1ZS6A 3Q86A 4CP5A 3G2XA 3FBBA 1UCNA 2AZ1A 3DKDA 1NLKL 3EVMA 3VGVA 1NDCA 3EVOA 1HLWA 3WX8A 2DXEA 1XQIA 3BH6B 3NGSA 3FCVA 3PJ9A 3FC9A 3VVTA 4UOFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NGR A;  1EHW A;  2B8Q A;  5CAA A;  1S59 A;  2NCK L;  4FKX A;  3ZTR A;  1LWX A;  1NSQ A;  1WKJ A;  3Q8V A;  4KPC A;  3VVU A;  3EE3 A;  3NGU A;  1LEO A;  5IOL A;  5C7P A;  1S57 A;  3Q8U A;  4C6A A;  1KDN A;  3EJM A;  4HR2 A;  1NDL A;  4DZ6 A;  2HVE A;  5BXI A;  3FBF A;  3DDI A;  2DY9 A;  3EVW A;  4W98 A;  3EIC A;  1XIQ A;  1WKK A;  2HVD A;  2VU5 A;  4ANE A;  4DI6 A;  2CWK A;  3VGU A;  3ELH A;  4S0M A;  3FBC A;  1HHQ A;  1BHN A;  1NDP A;  3GP9 A;  3FCW A;  1NUE A;  1U8W A;  2B8P A;  2ZUA A;  1F3F A;  4ANC A;  4F4A A;  1B4S A;  4UOH A;  1VYA A;  3R9L A;  3BBB A;  4DUT A;  1PKU A;  3EMT A;  3EM1 A;  1BE4 A;  1K44 A;  3BBC A;  3ENA A;  1NB2 A;  4EK2 A;  4FKY A;  4O0N A;  1F6T A;  1S5Z A;  1BUX A;  3MPD A;  1NPK A;  4UOG A;  1NSK L;  3FKB A;  3JS9 A;  2HUR A;  2DYA A;  3ZTQ A;  1W7W A;  3B54 A;  2DXD A;  3PRV A;  1NSP A;  1JXV A;  1MN7 A;  3B6B A;  3FBE A;  4AND A;  5CAB A;  3ETM A;  4ENO A;  1WKL A;  1B99 A;  1NCL A;  3VGT A;  3BH7 B;  3BBF A;  2BX6 A;  4WBF A;  3L7U A;  3GPA A;  3NGT A;  3ZTO A;  3ZTP A;  1NDK A;  3ZTS A;  3Q89 A;  2DXF A;  3Q83 A;  2AZ3 A;  3VGS A;  3Q8Y A;  2BEF A;  1PAE X;  1MN9 A;  4F36 A;  1HIY A;  1NHK L;  1ZS6 A;  3Q86 A;  4CP5 A;  3G2X A;  3FBB A;  1UCN A;  2AZ1 A;  3DKD A;  1NLK L;  3EVM A;  3VGV A;  1NDC A;  3EVO A;  1HLW A;  3WX8 A;  2DXE A;  1XQI A;  3BH6 B;  3NGS A;  3FCV A;  3PJ9 A;  3FC9 A;  3VVT A;  4UOF A; 
#chains in the Genus database with same CATH topology
 2IBK A;  2Y1R I;  3RAX A;  2YQ3 A;  4ILR A;  2PA3 A;  2ZC4 A;  2RHS B;  2RIL A;  2DGQ A;  4MMO A;  4ED4 A;  1H0H B;  4DPX A;  2KG0 A;  5GAD U;  4Q5V A;  2QZ8 A;  1QAX A;  2GVZ B;  2P5V A;  1WSV A;  4O3Q A;  4B3O A;  2DY9 A;  4W92 B;  2PO4 A;  1ZM2 A;  1YJU A;  3W3S A;  1VBK A;  3N79 A;  4LQ3 A;  2ZBI A;  1SI9 A;  2W4P A;  4KBI A;  4ECY A;  1SKR A;  1BMQ B;  4X62 J;  4CNZ A;  2C3Y A;  3KHL A;  1GMW D;  3EM1 A;  2MLY A;  1AZS A;  4IOB A;  3CJ2 A;  4DR7 J;  3TZW A;  2W2Q P;  5LXY A;  5GAE I;  1URN A;  4ZVG A;  2C22 A;  2YH0 A;  2MMY A;  1K9M T;  3Q24 A;  2CJK A;  4Q8F A;  1C0U B;  2RF2 A;  5C42 A;  4GC7 A;  3I82 A;  1FF2 A;  2XCA A;  3K0J A;  3KHR A;  3CED A;  3QFH A;  2FLL A;  4PYD A;  1K0T A;  3H98 A;  2CA9 A;  3NCP A;  3RBD A;  1R8A A;  3FRZ A;  1L3U A;  1X60 A;  1FX4 A;  3MR6 A;  3LW5 C;  3W62 A;  4WFB Q;  2D3Z A;  3DXS X;  2VG6 A;  5KT4 A;  4RW9 B;  1RTJ A;  3VAM A;  5GAG U;  4F4W A;  5A8K A;  5GAD I;  3CO0 P;  3UW1 A;  4J9S A;  2ERR A;  4DS4 A;  2XYP B;  4ZPW R;  3EDQ B;  1J5E J;  2GS8 A;  1TMM A;  4PCQ A;  1FRL A;  4WP3 A;  3RZA A;  3OR2 B;  4K50 A;  3BM7 A;  2MY7 A;  4IQM A;  1BE4 A;  2CZ4 A;  2RU9 A;  3MPU B;  4A46 A;  3M8S A;  2XHW A;  4DV7 J;  3IO1 A;  1U1M A;  3WIV A;  2QT7 A;  3D1H A;  2V6A A;  2HKE A;  3RAM A;  3SMZ A;  1BY9 A;  1I1G A;  4X66 F;  3MF5 A;  1JJ4 A;  1XMO J;  1JLA B;  4LRD A;  2GQQ A;  2XHC A;  2D1C A;  2BAC A;  3JTP A;  3FBB A;  4FF4 A;  3KTQ A;  4WIQ A;  5HLF A;  5RUB A;  3NOC A;  2R2T A;  4DS5 A;  1V5V A;  2AF6 A;  3HSG A;  3Q2T C;  5DO2 A;  1EQ0 A;  5F0U A;  1YQH A;  5GAG I;  3MM5 B;  1NHV A;  3MPV A;  3P4U B;  4KGK A;  4Q7A A;  1VBY A;  2ZFH A;  2CFX A;  3C8Y A;  1KOO A;  4I0W A;  1OY8 A;  2V63 A;  1RJJ A;  3MEG A;  2VA2 A;  4O4G A;  4E2F B;  2OFG X;  4IRC A;  4URG A;  1P9Y A;  5C2G A;  4KV8 B;  3TVK A;  2XGP A;  1S6Q B;  2QL5 B;  5IS2 A;  2QYC A;  3IS9 A;  1VOM A;  4Z37 A;  3DOK A;  4FKY A;  3DU5 A;  4NCG B;  2W25 A;  2KH9 A;  3IC1 A;  2Z2Y B;  3UD5 A;  3BN7 A;  4OYO A;  3ZZZ A;  3R7N B;  1IM4 A;  1VIS A;  2Z56 B;  2YNI B;  4OLP A;  2IM2 A;  3PW0 A;  2HFU A;  1FHT A;  1ACM B;  2KI2 A;  1HNV B;  3DN9 A;  3Q8Y A;  4WYW A;  1TKX B;  3GYX B;  3UR0 A;  2XNR A;  4QIF A;  3TVZ A;  1AUD A;  4QQB A;  4LF5 F;  1K47 A;  3W66 A;  3WX8 A;  1RZM A;  4WFA Q;  5D3G B;  4JI1 J;  2VB6 A;  1W25 A;  1VQ8 S;  1NM2 A;  1WDT A;  1DHM A;  4NLW A;  2XWY A;  3CME S;  2C2K B;  2VBW A;  5A8W A;  2QGF B;  2FGO A;  3GV5 B;  3CJ8 A;  3PYD A;  2OPR B;  4Q8E A;  4EBC A;  3LTO A;  3ZZ0 A;  1WD6 A;  1YVF A;  4YR2 A;  1FVQ A;  3K8V A;  3MMA B;  2V8D A;  3CW2 C;  4CRJ A;  1FDA A;  2RQK A;  1SIW B;  2MJU A;  3MTJ A;  2PE8 A;  2J0W A;  5KFC A;  4F04 B;  2DNR A;  1U1K A;  2VFT A;  1JXV A;  4CLF A;  3B6B A;  1Y4Z B;  4R25 A;  2KTQ A;  3AD9 C;  2QMX A;  1T95 A;  2AKW B;  2XEX A;  1WEX A;  3CJQ A;  3D5M A;  3IWL A;  5E3C A;  1OY9 A;  2DIV A;  4USV A;  2Y1J A;  2KO1 A;  4CWB A;  3D2W A;  4LBP A;  4ICL B;  2ZH4 A;  3HJF A;  3R6L B;  1EP4 B;  1VC5 A;  3LH2 S;  3HVT A;  1G7C B;  5DZ6 A;  4OYM A;  4UT4 A;  3H0P A;  3WC0 A;  5KFK A;  1I5O B;  3IRW P;  4QIG A;  4I68 A;  2K3K A;  2V8H A;  1XJW B;  2BR0 A;  4C6A A;  3ET6 B;  1UVL A;  4TQR A;  5IQQ A;  4DSK A;  1YZ6 A;  1RIS A;  2RIJ A;  2MST A;  2NUU G;  1KNZ A;  2EEY A;  3U1L A;  5HP1 B;  2DGU A;  3SIP B;  3MCM A;  2DBB A;  4ZLP A;  5A0Y B;  4YHH J;  1JK9 B;  3KDO A;  3HHL A;  2PD1 A;  5BR8 J;  2J0X A;  3ZC4 A;  4CQ1 A;  3BGU A;  1H2V Z;  1W7W A;  4P71 A;  4X84 A;  5E41 A;  1FFG B;  4QWB A;  4KHP J;  2FB0 A;  3MED A;  1KTV A;  1C4C A;  2W2N P;  3FBE A;  4FYY B;  4RNF A;  4NCB A;  2K06 A;  1S0N A;  1WC5 A;  4IFV B;  2NUH A;  1WTB A;  3HMJ G;  4IDK A;  4A8S A;  1PC5 A;  3ISZ A;  2Y3Y A;  4P2S A;  2W7P A;  4TVA B;  3S01 A;  1S1X A;  2GHW A;  2V2Z A;  3TQ1 A;  4H4O B;  1KQK A;  4KGX B;  2Y8Y A;  4Q0B A;  5F3T A;  2XY5 A;  2R7W A;  3UNG C;  2VFU A;  2XLJ A;  1NK5 A;  1U0S A;  2YBV A;  3L9Z A;  1KKH A;  2FUG 9;  4X4V A;  2MZS A;  2AYB A;  2W01 A;  1N48 A;  2JWN A;  2W1B A;  3KG4 A;  3DDI A;  3K5O A;  2W9B A;  3FJ2 A;  4QPT A;  1NH8 A;  1WEL A;  4PUO A;  4HTJ A;  3HFV A;  1RU1 A;  1YBU A;  4LF9 F;  5J1E A;  5FDL B;  5LJ5 Y;  1KP6 A;  4DFK A;  1JLC A;  2BQR A;  1MWQ A;  3P3D A;  1HQ2 A;  3MPD A;  4CNY A;  1KN6 A;  4X4N A;  3CPW R;  1KTQ A;  3IGN A;  3PY8 A;  3TO8 A;  5IQ6 A;  2FD2 A;  1SPB P;  3VCD A;  2V4J A;  3BKT A;  4LSN B;  2FVC A;  3B4M A;  4NLV A;  3QBC A;  3PEH A;  2RUG A;  1ZA1 B;  4AL5 A;  2YX1 A;  4OV6 A;  4LRE A;  1TKZ A;  1NME B;  5FII A;  1S1U A;  2W8K A;  2K1R A;  4DU7 A;  1U1P A;  1M1H A;  2LQ9 A;  3SSQ A;  3OBI A;  5F8H A;  4DUZ J;  3OT9 A;  1FEE A;  2AYM A;  1IKY B;  4UTG A;  2EG2 A;  4HKQ A;  1I51 B;  3PEJ A;  1QM9 A;  1R8C A;  2VBY A;  4PG6 A;  2W4D A;  2HHH F;  2CWK A;  1H3D A;  4IG3 B;  4ED0 A;  1YJV A;  3L3C A;  2AYG A;  3VAJ A;  1U8S A;  3G71 S;  3EMT A;  2UUB F;  5ETQ A;  3FKB A;  4J9P A;  4H4M A;  5L1L A;  2LA6 A;  1UEV A;  2PII A;  1ZET A;  2WVC A;  4HLB A;  5K14 B;  1JLG A;  3QJP A;  5BYR A;  5J1P A;  2R7U A;  3MAQ A;  1S0O A;  2YKQ A;  3LP1 B;  4DR4 J;  3HO1 A;  1C4A A;  1NKB A;  1HIY A;  1MU2 A;  2UUT A;  3MAA B;  1IR0 A;  1VQ7 S;  2VPW B;  3R97 A;  1FRH A;  3CD7 A;  5HVH A;  4USU A;  1N5Q A;  3DRP A;  5D0H A;  1GX5 A;  3OVA A;  2BKN A;  1KVJ A;  5J2M A;  4OZ0 A;  1T03 B;  2G1D A;  3CSK A;  3QO9 A;  2LQB A;  1C2P A;  4ZPD A;  1VBX A;  4KAI A;  3MFH A;  3IRX B;  1U45 A;  1VGY A;  5IM0 A;  4NLS A;  1SKW A;  2D3U A;  3M2U B;  5LSL A;  5F3Z A;  2V2K A;  4X62 F;  5L39 A;  4FF3 A;  4A8O A;  3HFK A;  4EBD A;  1T9T A;  2DNZ A;  3BGF A;  4M5L A;  1RTD A;  1DY3 A;  1VK3 A;  3VGT A;  4N41 A;  2BJ9 A;  2FVP A;  2V8P A;  3BV8 A;  3OQ2 A;  4ZP8 A;  2XMK A;  1FFW B;  3D68 A;  4F0K A;  1IBL J;  2I5J B;  1ZS6 A;  3GLJ A;  5AT1 B;  4RW7 A;  4PRF A;  3DYA B;  2HQD A;  2WSE C;  1S1V B;  1I94 J;  4F4Z A;  3N6M A;  2CQG A;  3QGG A;  4FBT A;  2RUS A;  3EGV A;  2RKI A;  2ZBQ A;  3DU6 A;  4IH5 A;  1PSD A;  3BSN A;  3E01 B;  1W2B R;  1S9E A;  3TNV A;  5LMU J;  3V2U C;  4DCO B;  1WOR A;  2K7K A;  3D0I E;  2FLO A;  1UWA A;  4KH0 B;  2HZA A;  3OTO J;  2V2Q A;  3H42 A;  4PXB A;  3T3F A;  1R0A A;  3MR7 A;  2HNZ B;  4C97 A;  3QRP A;  2PEB A;  3EXC X;  1F1B B;  5DS7 A;  4DV6 J;  4E98 A;  1J5E F;  1VRU A;  4URS A;  1NSK L;  3PX0 A;  3JAM Y;  2HUR A;  1VQM S;  2XC9 A;  2NYH A;  4M1K A;  1HBO B;  1SIZ A;  5DLF A;  3BQ0 A;  4K4U A;  3FMB A;  2IVF B;  3E8O A;  3MXH P;  1FK9 A;  1WJ9 A;  4JV2 A;  4FYD A;  4DV7 F;  1RYR A;  3VQS A;  2JLE A;  2E1R A;  5B0A A;  3JYT B;  2R7O A;  5I4M A;  1X4E A;  5IV3 A;  3P5B P;  3CJS A;  1Z4U A;  3THP A;  3F56 A;  2RQ4 A;  2M52 A;  4K0K F;  3P5T L;  1IKV A;  4ZIV A;  1RLC L;  5C7P A;  4U8Y A;  4YDD B;  3T6J A;  4O44 B;  3VZH A;  5J2P B;  2IRU A;  1B70 B;  3I55 S;  4U67 Q;  1FD8 A;  4KB7 A;  1HBU B;  2QG9 B;  2Z2L A;  2ATL A;  2D69 A;  2FVS A;  1TK0 A;  4K4Y A;  2VFS A;  3MR3 A;  4M5D B;  2LCW A;  1KHV A;  1MN7 A;  2ZH1 A;  1HD0 A;  4Q45 A;  1TU0 B;  2DHX A;  2CPX A;  3PG9 A;  1QTN B;  3IFE A;  2B7B B;  5EWE A;  4KKO B;  4DZD A;  4P52 A;  2GCF A;  4HEA 9;  4R5P A;  3PX6 A;  1FNO A;  3J81 Y;  4RNO A;  2KYX A;  4RX6 A;  4ID5 A;  1PBU A;  2DEI A;  2XB2 D;  4FYX B;  1ULR A;  3HHD A;  4OV1 A;  1X8D A;  4ZVE A;  4DR2 J;  4DI6 A;  1PJ5 A;  2NYI A;  3H5U A;  2VG7 A;  4EU0 A;  2BJ7 A;  4PG7 A;  4JI1 F;  3D54 A;  1KDN A;  1RWM B;  1ZM9 A;  3QJJ A;  3NBP B;  5G4D A;  4GKK J;  4LT6 A;  4ZLJ A;  3K5P A;  3DMJ B;  1KVK A;  3TUI C;  1FRX A;  3B4D A;  2C2R A;  3VF0 B;  4U9R A;  3M8Y A;  4WU2 A;  3LWM A;  2NSC A;  3CDA A;  4J5O A;  2E66 A;  2OKQ A;  4WFX A;  2H65 B;  2ZZT A;  4DXL A;  3DOL A;  3GZ7 A;  3BYR A;  2ALZ A;  2EW9 A;  3T1Y J;  1TL5 A;  2DCU B;  3CDB A;  4RW8 B;  1YJN S;  4Y2I A;  2L9N A;  1T8E A;  4FS1 A;  1LNQ A;  2GV1 A;  1Q78 A;  4IKA A;  1XEZ A;  3JXO A;  1AT1 B;  2LVW A;  2DR5 A;  4FYV B;  1KFS A;  3K7R A;  2ZBC A;  2XMT A;  3HK2 A;  5B0B A;  4DV1 J;  1VHF A;  3M8Q B;  4BS2 A;  1KRP A;  2FLP A;  4URQ U;  1RTI A;  3LP0 B;  3FCV A;  3B78 A;  4EI2 A;  1MMN A;  4W4M A;  4YP3 A;  3D0H E;  3K5M A;  2BRK A;  3HI9 A;  1CSJ A;  4I67 A;  3I0S B;  3NY0 A;  5M2U A;  3H25 A;  3G86 A;  1LWC B;  2F8H A;  1XR5 A;  1T3N A;  2DNP A;  3PXG a;  1PIL A;  1EB0 A;  2DHG A;  1FKO B;  4LIR A;  2MGZ B;  1W2I A;  2C42 A;  3MUV P;  4G1P A;  5ITH A;  2I2Y A;  2O3D A;  1PKU A;  2J6T A;  4HH0 A;  1PC4 A;  5MAO A;  4YHH F;  4WTO B;  1HI0 P;  3W2V A;  3HX9 A;  4LSL A;  4NXM J;  2YKM A;  2ASD A;  2V8G A;  2PMW A;  3UCU P;  1WAC A;  2IRX A;  5BR8 F;  2CJ9 A;  3GPA A;  1VJW A;  1VQK S;  4KHP F;  5HQM A;  2VC0 A;  2BUN A;  1P1L A;  3OTC A;  4MFB B;  2WB4 A;  3O1L A;  4F36 A;  1OJ4 A;  2Q43 A;  2WZ1 A;  3PO4 A;  2ZZN A;  1HWL A;  2J8A A;  4OFZ A;  2QL7 B;  2EFV A;  4RW4 B;  4BCA A;  1CJK B;  1RTZ A;  2JZ5 A;  4RL1 A;  2HIQ A;  2OEJ A;  2GAH C;  2JOQ A;  2B6A A;  2Q6C A;  3UD4 P;  4QWA A;  3DCA A;  4DL3 A;  2ZD1 A;  3VR1 A;  1QSL A;  1TV6 A;  3D0G E;  4KGV B;  4NA3 A;  1DAX A;  3R7B B;  3IAS 9;  1XTZ A;  5ETO A;  1CVJ A;  4HL9 A;  1IKX A;  5DG7 A;  3OD2 A;  1JLE A;  3AT1 B;  4C8Z A;  4ZCM A;  2Y1L B;  3EZ5 A;  1NJW A;  1LQ9 A;  2D41 A;  1X4C A;  1OO0 B;  4QR1 A;  1BD6 A;  1L3S A;  3CJ5 A;  4J9O A;  1YRX A;  4F26 A;  3CB4 A;  3NEK A;  4CM2 A;  4NZ7 A;  3M9N B;  5J2Q A;  4AL6 A;  3KK3 A;  1UWB B;  3WZ0 A;  2R8J A;  2DIT A;  3DGP A;  3MM6 A;  2DH7 A;  4ES3 A;  3HM9 A;  4MJK A;  2HS3 A;  1G2E A;  3J7Z 5;  3GIJ A;  4CP5 A;  2CPH A;  4B3S J;  4OJ1 A;  3KHG A;  2ZHB A;  2X3G A;  4BBY A;  3PYF A;  1R27 B;  3PJW A;  5E3A A;  4YR3 A;  3AFG A;  3OHA A;  2M3D A;  3NL0 A;  4UY8 5;  2R7R A;  3ULH A;  3MMB B;  3MUT P;  4OYW A;  1E6V A;  4PQA A;  1UZD A;  4DZ6 A;  3TJ8 A;  3RGI A;  4G65 A;  1G1X A;  3KJQ B;  2X1B A;  3D3C J;  2E9R X;  3AXK A;  1T05 B;  4PWD A;  1DUR A;  1V9O A;  2ZUA A;  4WZQ A;  1Y5I B;  2N7C A;  4M94 A;  3QLH B;  5K8O A;  1K44 A;  2WCX A;  4FPI A;  1BQN B;  2UZA A;  3CIM A;  1ZH5 A;  3GV8 B;  4FF1 A;  3SV3 A;  4M63 A;  1WUU A;  5G0R A;  3W61 A;  1MW7 A;  1R89 A;  4XAK A;  1LFW A;  1NEE A;  3HD2 A;  2KL8 A;  3ZTO A;  3K2Y A;  3TEG A;  5KG4 A;  4RKU C;  1NHU A;  1VQN S;  1K0V A;  3TJA A;  2YH1 A;  1EIY B;  2UUA J;  4DR4 F;  4L72 B;  4OX8 A;  1J27 A;  5IWA J;  4F67 A;  2LQ5 A;  4KQZ A;  4DOZ A;  2E7W A;  3PRD A;  4OHW A;  4WP9 A;  2XLK A;  1IKW B;  1LEO A;  1U1Q A;  4WE1 B;  3CDU A;  3KUG A;  2MKK A;  3CCV S;  2F4V J;  4MYT A;  2ZIT A;  3CO9 A;  1E6Y A;  2Q79 A;  5A8R A;  2AJF E;  4P2M A;  2J9C A;  2VPZ B;  2F8E X;  2E7X A;  3R9L A;  2QO3 A;  1VRT B;  2IYG A;  4LQ9 A;  1RWK B;  4RW9 A;  2EKY A;  1S4E A;  1S6O A;  3C19 A;  5KG7 A;  2HHV A;  3UDL A;  5CYQ A;  5IC4 B;  3MMJ A;  4PWU A;  2HND A;  4A48 A;  1P27 B;  5L1J A;  1NK7 A;  3FDS A;  6FD1 A;  1AW0 A;  4RUH A;  2CNN B;  1IQT A;  2WW4 A;  4NLP A;  1LXN A;  1VQ5 S;  3P49 B;  3TAM B;  5KFR A;  2AIR B;  2HGL A;  4EMD A;  5DG9 A;  2HVZ A;  4KGZ B;  2E44 A;  1RTH B;  1EX8 A;  1IBL F;  3I32 A;  3G4S S;  4R0E A;  4K4W A;  2CPZ A;  5KFM A;  1LXJ A;  3IGV A;  5HJX A;  3M32 A;  1FNX H;  3QJL A;  1HWI A;  1I94 F;  2B4O A;  1BQX A;  4F2S A;  2F9D A;  2KFY A;  1S1T B;  2DKO B;  5CCM A;  2XS7 A;  1WG5 A;  2GX8 A;  4M5N A;  2C2O B;  2AJ0 A;  4DG1 A;  4F4K A;  3AA9 A;  2IMO A;  3CCE S;  5LMU F;  3OTO F;  1NU4 A;  3MEC B;  1IJE B;  3FQL A;  3PDN A;  1RHQ B;  4ZDN A;  4ZIT A;  3QAT A;  3MM5 A;  1YJ7 A;  2CJX B;  2E29 A;  3PM9 A;  3VAF A;  2JEG A;  1Q8L A;  3G82 A;  1SJR A;  4LFB J;  4DV6 F;  3HLU A;  3IA0 A;  3GWC A;  5KFS A;  4C9D A;  2CVI A;  1HI8 A;  5K8N A;  1VLO A;  3V6K A;  2BE2 B;  5A76 A;  2XSF A;  3BSA A;  5KT2 A;  1U1O A;  2VFV A;  5JUM A;  4KV8 A;  2EFO A;  1YGY A;  1JX4 A;  4Y6I A;  2RQM A;  2PFD A;  2WSF C;  1XBW A;  4PG4 A;  3KLH A;  2QA4 G;  3TOQ A;  2BAN B;  4NCG A;  1NPR A;  2N4C A;  1R43 A;  2JC0 A;  2Z57 B;  1B7F A;  2ZM6 J;  2QA2 A;  2QLX A;  3QT6 A;  1HL6 A;  2YVS A;  2FHO B;  5LSR A;  1RT7 A;  1OIA A;  3BGO P;  1WOS A;  3MM8 B;  4DCJ B;  3HKZ D;  2FHJ D;  5KFV A;  3ZFV A;  2XY7 A;  1DLO B;  2KKH A;  3ISN C;  3WHI A;  2ACY A;  1S6P B;  2HFO A;  3D28 A;  3UNY A;  4NEY A;  2DVI A;  2QN6 B;  1VQO S;  1MWY A;  4CO2 A;  3RG6 A;  5L46 A;  4OYX A;  2ZH2 A;  2NXJ A;  4OI3 A;  1QUV A;  4NAS A;  4LVO P;  3BBF A;  3QQC D;  1TL3 B;  2BQ3 A;  4R0J A;  1RAC B;  2YKO A;  1PAE X;  3ILJ A;  1XMQ F;  1UCN A;  2W4C A;  3SV4 A;  2UXC J;  2KT3 A;  4JI3 J;  1JKH A;  4P73 A;  4DU8 A;  1WF1 A;  3KJV A;  1WSR A;  4YME A;  3DGV A;  4DL2 A;  3DLH A;  5B0D A;  3CVK A;  3PW7 A;  2RS8 A;  2XI3 A;  4YB1 P;  3M9M B;  3KLF B;  4DR2 F;  3HHL D;  4ZLN A;  2KU7 A;  1EAR A;  4HR2 A;  2A1B A;  1ZAX A;  1ZTT A;  1TKT A;  3FBF A;  1D8Z A;  1ZOT A;  2XMM A;  3J81 U;  3V4I B;  1VQ6 S;  1SJ3 P;  2MHE A;  2AV5 A;  3KKF A;  1F5A A;  4GKK F;  1J5O B;  1HWK A;  1VYA A;  1H72 C;  1HR0 J;  4RUC A;  1VQ4 S;  2VBX A;  4V19 J;  4J7C A;  1RYS A;  2MZQ A;  2F40 A;  1KQG B;  1MSW D;  2DYA A;  1D9F A;  2H5I B;  1KR4 A;  2EVZ A;  2XMU A;  1WDD A;  4F4X A;  3T1Y F;  2PN6 A;  1NJZ A;  3OVB A;  1UP1 A;  1S99 A;  3G8Q A;  2DEJ A;  3HF5 A;  3OVS A;  3KMQ A;  4NLU A;  5E0O A;  1ZZF A;  3L09 A;  4DN0 A;  2HVH A;  2WVF A;  2UUC J;  3SXL A;  3PKM A;  4DN9 A;  1XNR F;  2DHA A;  1RWX B;  3AOC A;  3A13 A;  1D9D A;  2HHX A;  4E8U A;  4J9N A;  4DV1 F;  3FFI A;  1U4B A;  4ZCK A;  3IWX A;  1IBM J;  2L41 A;  4JI5 J;  2K3I A;  3VVU A;  2OGU A;  1SV5 B;  3Q8U A;  1DTT A;  1VC0 A;  3NNA A;  4MKV A;  4IO1 A;  3TP2 A;  2C3U A;  4KGM A;  4ITS A;  1FKP A;  3JTN A;  3I0R A;  3OXG A;  2VOP A;  2KHD A;  2J8S A;  5KFL A;  4LIW A;  1CJV B;  5HJY A;  2MJN A;  4OI2 A;  5L9N A;  1RBO B;  1H2U X;  3NS6 A;  1IR1 A;  3ETO A;  1FRI A;  1UFL A;  4RWW A;  1M0S A;  2MKI A;  4K4X A;  2CNO B;  4GMK A;  5DDQ C;  2R9L A;  2A3J A;  2OPP A;  4NXM F;  2H54 B;  3OUY B;  4PAB A;  1N4L A;  4L76 A;  1UPP A;  2DD8 S;  5JXS A;  5C5J A;  3VAL A;  2XMV A;  5B0G A;  4MIW A;  3PZP A;  2JDJ A;  4PWW A;  3DLE B;  3BQ2 A;  5KFD A;  1DQ8 A;  4ECR A;  2XS5 A;  4NX9 A;  1VLY A;  3CWJ A;  3QGH A;  4CLT A;  3TW0 A;  4CO1 A;  1TAU A;  1TZ0 A;  4J37 A;  3RW7 A;  4LJM A;  4YUD A;  1JLQ B;  2QEX S;  2JX2 A;  3BGR B;  3IBF B;  3D1O A;  1S9G B;  3Q8P B;  3ITH A;  3CCZ A;  2E5I A;  2G13 A;  5I3Q A;  4CLK A;  1UFW A;  3RB4 A;  1IQZ A;  1KLM B;  4ELU A;  4BC9 A;  5AJ3 J;  3S7R A;  4DL0 C;  2G2Y A;  4KO0 B;  5DJB A;  3L95 X;  1BGX T;  2EI5 A;  4I69 A;  5C24 A;  4IG0 A;  3Q22 A;  3KLG B;  4F7V A;  2VL1 A;  2ZHO A;  2D3O 1;  1WKL A;  1XK8 A;  3GJT B;  2H48 B;  4X4S A;  1D8Y A;  2J7W A;  1HNI B;  1N34 J;  2M2B A;  2BDP A;  4IG3 A;  3I5C A;  5ETT A;  5DQG A;  1MN9 A;  3ZNU A;  3PO5 A;  1HMV A;  2HHT A;  1WEY A;  3KLI A;  2M8H A;  1NO8 A;  1KOH A;  3R5C A;  3D6H B;  2ZOM A;  3FC9 A;  2B8Q A;  4B3S F;  5H1S V;  3F41 A;  2E1C A;  1FRJ A;  4WU3 A;  5KFP A;  4WFN Q;  3DHX A;  2CPD A;  1X4D A;  3M2R A;  1CBK A;  3LP2 A;  4AD6 A;  4C4W A;  1VQY A;  3QWU A;  3M8P B;  3PR5 B;  4WF9 Q;  3F73 A;  3QYY A;  1M5H A;  4MTP A;  1TVR B;  3DDN A;  4DR5 F;  2WVB A;  2P2C B;  5ETS A;  2ASL A;  3HKW A;  4ENO A;  3C16 A;  2B9E A;  3KLE B;  3AJD A;  2CAJ A;  1T03 A;  3H2L A;  4Y2K A;  3R5G A;  4KJI A;  3OPK A;  4ZJO A;  1LW0 B;  1H98 A;  2GW8 A;  1HQU B;  2DXF A;  4JI2 J;  3QIP A;  1OY6 A;  1REV A;  3G2X A;  1P9Q C;  1JLF B;  4TLQ A;  5EN1 A;  1N52 B;  1UJ6 A;  2LEA A;  1Q1K A;  2IDE A;  5IV4 A;  3LOU A;  3ZZY A;  3KK2 A;  1D3W A;  3KWM A;  4UUX A;  4ELT A;  2NS1 B;  2UUA F;  2EC0 A;  2FHK A;  1CJU A;  1RCX B;  5IWA F;  2DRD A;  2XM3 A;  3NCR A;  4FP9 A;  1B7Y B;  3GFZ A;  2NLW A;  4DMZ A;  3UN2 A;  7AT1 B;  3EIC A;  2LKZ A;  4C11 B;  2B4P A;  3TYT A;  2I5J A;  3H5S A;  1DTQ A;  4DDF A;  4V19 X;  1APS A;  1DRZ A;  2F4V F;  1SVD A;  4ECW A;  1S1W A;  4Y34 A;  2V2V A;  5KFN A;  3CCR S;  1M5P C;  4ZHR A;  1VR6 A;  2HHS A;  1PG5 B;  2MQP A;  4PPZ A;  2I8E A;  3B54 A;  4M5G A;  4IO9 Q;  1NPP A;  5CA5 A;  5D4N A;  3BH7 B;  4OIX A;  3J81 j;  1RWW B;  3CD0 A;  4CCH A;  1EET A;  2O5D A;  2ZVS A;  1RAO A;  1O0P A;  4AL7 A;  5GVQ A;  2AEJ A;  2MZ1 A;  1F3V A;  2R7V A;  2HNZ A;  1DQA A;  1OQ3 A;  2UXB J;  2OO4 A;  2BRL A;  2OFH X;  2OPQ A;  4NRT A;  2LMI A;  4YDX A;  2HLU A;  2RDI A;  3MHY A;  2N7Y A;  2M0G B;  4XTT A;  5HMX A;  3OL9 A;  4OI1 A;  4G1Q A;  3TWZ A;  2Y0B B;  3PR4 A;  2HMI B;  3EPG A;  2BYC A;  3M9O B;  2JC1 A;  1WNE A;  2CJB A;  1RDR A;  4A4J A;  3RR8 A;  2OD6 A;  4RNM A;  3G6Y A;  1U8W A;  4I6A A;  2DR8 A;  2QE5 A;  1FJC A;  1RT3 B;  2NSB A;  3UN5 A;  3MM9 B;  2HQI A;  5GMK a;  2JL9 A;  1TEL A;  3CCU S;  1MMD A;  3AD7 C;  2OPS A;  1QAI A;  1XN9 A;  5CAB A;  2Y9H A;  2JJ4 D;  2HS0 A;  3UDC A;  5J2P A;  1HBN B;  2VQF J;  2ZH8 A;  4LFB F;  3CMA S;  4P75 A;  3TA1 A;  1KBR A;  3N9U C;  1FRK A;  1IUJ A;  2IMW P;  2FQQ B;  2OD4 A;  1HBU A;  4DSL A;  2IDL A;  1YBA A;  2N4D A;  2VPX B;  2G2Z A;  4OQJ A;  2KHC A;  4OLO A;  3DI6 B;  1YRT A;  3KOA A;  3I87 A;  3IAM 9;  1Y9O A;  4HDG A;  4HHU A;  4CLP A;  2KFN A;  4ZVF A;  1FTC A;  2ZM6 F;  1SKS A;  2RQC A;  2HNY A;  5EX0 A;  2AD9 A;  1NRK A;  1LKZ A;  4KKO A;  5KFW A;  3GR1 A;  4ZVU B;  1YIJ S;  3GE9 A;  1CJT B;  3W1Y C;  1RT2 A;  3MMC B;  5LT5 A;  2J6S A;  1RT1 B;  1KHW A;  4TU9 A;  1Q81 T;  3M6V A;  2IRY A;  2WBR A;  3SDE B;  3NMR A;  5B7W A;  3DLJ A;  4WXW A;  2AJ1 A;  4ALZ A;  1UET A;  4TU7 A;  4ZN1 A;  4LBI A;  1YI2 S;  1F60 B;  3NBP A;  1WC1 A;  3HPO A;  3OHB A;  4QW8 A;  5ETP A;  3IR6 B;  3PJX A;  3H59 A;  3D3B J;  2W24 A;  4KRW A;  4LFC J;  3VAG A;  3OSP A;  2P9G A;  1SKU B;  4M5J A;  4B3O B;  2UXC F;  5JJB A;  5FLX Y;  3W9H A;  3W5Z A;  3HDS A;  4ZVT B;  5KG3 A;  3NGU A;  1F5B A;  2NPI A;  2RRN A;  4ID8 A;  3EJM A;  2MKC A;  4DR1 J;  1SCJ B;  4YR0 A;  4ZK7 M;  4ILL A;  4DQP A;  5HSP A;  5FD1 A;  4A8K A;  4TLR A;  4USH A;  3NMA A;  3M8Q A;  4PKD B;  3OL8 A;  5DQH A;  1UA1 A;  3BDE A;  4HT5 A;  3PIP Q;  3BBB A;  4CI0 B;  3DC2 A;  4IUF A;  2WOM A;  1BQM A;  2KRB A;  3U02 A;  3D6T B;  4FVM A;  3HUL A;  2RF2 B;  5C42 B;  2XSJ A;  1AFJ A;  2MZR A;  4MAK A;  4AND A;  2MLZ A;  4QYZ J;  4QOT A;  1O5J A;  5LJ3 Y;  3AQP A;  1FKO A;  1IBC B;  2IA0 A;  2HGN A;  3JSB A;  4TY8 A;  2AZ3 A;  2RU3 A;  4CLL A;  3EZU A;  1TK5 A;  3G6X A;  1RTJ B;  3MEE B;  9RUB A;  3I5B A;  3A8I A;  4TXS A;  1SC1 B;  1PIE A;  2VDI A;  3T5K A;  4LF9 J;  3LGN A;  2NXC A;  2DGT A;  4P2F A;  4YB7 A;  3FNN A;  1C1B A;  1FWK A;  2YWK A;  3AA8 A;  2UUC F;  3HHK A;  2AJ4 A;  4R8U A;  2ZDO A;  5E5N A;  4OJG A;  2OAU A;  3I9V 9;  4CH7 A;  1N33 J;  1IBM F;  2QMU B;  4TYB A;  4JI5 F;  4FPR A;  4ANE A;  1FNM A;  4DL5 A;  5T7L A;  2BJE A;  3DRR B;  2WON A;  4RW4 A;  4KFB B;  4Y2C A;  4K8R A;  2DNL A;  2JFD A;  4H54 A;  4HH1 A;  1Z2L A;  5DGB A;  4WFZ A;  2DNH A;  2XGQ A;  1KS2 A;  1X4G A;  2XQC A;  2NXU A;  1M1G A;  1GXT A;  2FY8 A;  3PTW A;  4MKB A;  1WHX A;  2H4W B;  4EZ9 A;  4J9M A;  2GQC A;  3GJQ B;  4HDH A;  4U8V A;  4AFF A;  2HHH J;  3NCQ A;  5IFM A;  4M5H A;  1BLU A;  4IFY A;  5FJ4 A;  5KFF A;  3W63 A;  2ZH3 A;  2HHU A;  3MEG B;  3G9C A;  2DNQ A;  1XMB A;  6AT1 B;  4FKX A;  1UWB A;  4WWS A;  3ENQ A;  2FDN A;  1UEU A;  4F0M A;  4X4P A;  3AB4 B;  4L3N A;  2VG5 A;  2EFG A;  5CYM A;  4ZS6 A;  3KK1 B;  4DJB A;  3DOK B;  4JI4 J;  4NLD A;  1Y0H A;  1T94 A;  2PDA A;  1PCA A;  4F8R A;  3UVJ A;  1O51 A;  3O44 A;  2CPJ A;  5HAN A;  1UVK A;  4EK2 A;  2YWG A;  4UW2 A;  1HNZ F;  5DQI A;  1KVI A;  2OML A;  5AJ3 F;  4GVL A;  4CH0 S;  5KFQ A;  1RP5 A;  3G8S A;  4RU2 A;  1Q16 B;  1Y7P A;  5A2Q U;  1C0T A;  2WVE A;  2C3M A;  1T05 A;  3OFH A;  4TKT A;  4EUV A;  2K8G A;  4JB8 B;  3I4H X;  4C48 A;  2DIU A;  4CLY A;  4U7U D;  1N34 F;  4RLE A;  1RT4 A;  5LMN J;  2DCL A;  3SZ2 A;  3IR5 B;  5KT5 A;  2DO4 A;  4BC7 A;  5A8W B;  4N56 A;  1UA0 A;  4DLE A;  3EX7 B;  4OHX A;  2N82 B;  1YTY A;  4C2M A;  5B0F A;  3AOD A;  4LRB A;  1QTM A;  3QAU A;  3EYZ A;  2GJ2 A;  2V9K A;  3ISN D;  1FWP A;  3MFI A;  4PQU A;  1QE1 A;  3FBC A;  2IYI A;  3A3N B;  3GP9 A;  3W2W A;  5CZV A;  1S97 A;  2EPI A;  1P8G A;  4I6W A;  2YNG A;  1UL3 A;  2CQ0 A;  2DO0 A;  3EDR B;  2D9O A;  1WOO A;  1GT8 A;  4HVZ A;  2OHD A;  4LF4 J;  3V5R A;  2NXE A;  1QAJ A;  2OP5 A;  3GSI A;  3O3L A;  3CC2 S;  1HI1 A;  1WEZ A;  4DBQ A;  2IFX A;  3HVT B;  1QUP A;  2CNL B;  4U7U K;  1HFE L;  4DFJ A;  3BSC A;  4KSE B;  3CCM S;  2LXU A;  2HFZ A;  4JI2 F;  3QSI A;  2MY8 A;  1T9Y A;  1XQI A;  3A8K A;  1I6J A;  1ROF A;  4RW6 A;  3IG1 B;  2YY3 A;  4K5S A;  1NSQ A;  3DM2 A;  3M6W A;  3KNA A;  1Q95 G;  2CXE A;  1VQ9 S;  1RSC A;  5HN0 A;  3NS5 A;  1RT6 B;  4P6Q A;  3TAM A;  3CE8 A;  1FT8 A;  5IT4 A;  2ZOF A;  3GB0 A;  2MZT A;  3TAQ A;  3HHL B;  4ECQ A;  5CH7 B;  1PO6 A;  3FCW A;  4C3K A;  1ZBT A;  4DCP B;  4IQX A;  4F4A A;  4I6Y A;  4LF7 J;  3MED B;  3M6U A;  4B02 A;  5HRO B;  8RUC A;  5KG1 A;  2B9X A;  2NPF A;  3DRY A;  3SFG A;  3D4J A;  2CQ4 A;  4JUZ A;  4IDK B;  3TAN A;  5KFU A;  5HBM A;  3V4M A;  4K0K J;  4DL6 A;  2EK1 A;  2YNF B;  2CZV C;  2JLF A;  4NRU A;  1MRO A;  3HZE A;  4JI8 F;  2O1P A;  3Q2S C;  4Q0B B;  3DNC A;  4WXO A;  3EZO A;  2VBZ A;  1VDH A;  2A10 A;  1N5Y A;  1EAY C;  3WX4 A;  2ROP A;  4ED2 A;  1FJE B;  2FJX A;  2BJ3 A;  4CZC A;  3LGM A;  2UXB F;  1JMT A;  2IY5 B;  2W9B B;  1HWJ A;  5E33 A;  4PUO B;  5IT9 U;  2YWE A;  2R8K A;  2X51 A;  1DJ0 A;  4G3I A;  5J1E B;  3JB9 k;  1JXE A;  1RCO B;  2VFR A;  4NWB A;  1JLC B;  4I2Q A;  1S7I A;  1WF2 A;  3J80 Y;  2HSE B;  1FDB A;  3LO3 A;  1N54 B;  2IAJ B;  1MML A;  7FD1 A;  1QD1 A;  4IH6 A;  2G2O A;  3MCO A;  2V4J B;  2B9W A;  4B3T J;  4DQI A;  4N8N A;  1RBA A;  1T02 A;  2BW2 A;  1FEH A;  1S1U B;  2R3V A;  3DOM A;  3ZXW A;  5DG8 A;  4PAA A;  4RWX A;  3UR3 C;  1WC0 A;  5JVG Q;  2VQF F;  4O3R A;  2GO9 A;  1FFS B;  2AW0 A;  5H9F K;  4CLS A;  4FXD A;  2EK6 A;  4F3O A;  3OJU A;  2DXE A;  3VTI A;  3R5J B;  5E7O B;  2OIH A;  2ILY A;  4J9R A;  2MPU A;  4CO4 A;  1XNQ J;  3TUZ C;  1ZTW A;  2VDH A;  2MKJ A;  3ZO7 A;  2GGP A;  4J9U E;  3U27 A;  2DPJ A;  5K5M A;  2DB1 A;  4H4M B;  2LQJ A;  2CUY A;  1SL2 A;  5ETM A;  1FE4 A;  3N01 A;  5CZX A;  3M2V B;  5EUH A;  3AY0 A;  3K5L A;  1U25 A;  2XI2 A;  3H4D A;  1NSP A;  3H8Y A;  4OYP A;  1B99 A;  2WBM A;  5KFA A;  3FUY A;  1MU2 B;  3V4I A;  4UQT A;  2MXY A;  1WHV A;  4DPW A;  1TFY A;  1EKR A;  2CJQ A;  4ZIW A;  2XUL A;  3CTR A;  1RI7 A;  1J5O A;  5AE1 A;  2QL9 B;  4FDF A;  3I6P A;  1A9N B;  1JNZ B;  3O6Q A;  5HMZ A;  4OX9 J;  5L1I A;  2OSQ A;  1C1C A;  3DRP B;  1U6F A;  2WK4 A;  5KT3 A;  3W60 A;  3L4B C;  5J2M B;  3ENV A;  1WC6 A;  3LF0 A;  3ZTR A;  4LFC F;  2VA3 A;  3QO9 B;  1HHS A;  1X9M A;  2ASY A;  1D9A A;  2DRA A;  5HMY A;  1NDL A;  1ZPV A;  1RKJ A;  3DLL Q;  5IM0 B;  4DQQ A;  3DDK A;  2QV6 A;  3RBE A;  1R6V A;  1T9V A;  3IM8 A;  2V34 A;  2HWH A;  4P72 A;  1N5T A;  3GJS B;  2Y0S D;  4I1T A;  4DR1 F;  2BAB A;  4ANC A;  3HSJ A;  4FVC A;  3C14 A;  1AFI A;  1CPZ A;  3JS9 A;  5ETR A;  1SV5 A;  2MSS A;  3J7A N;  3OXF A;  1JWW A;  4B3M J;  2MKS A;  1REG X;  2DY1 A;  2E5L J;  4RW7 B;  2YX4 A;  4USK A;  4WFY A;  3B8H A;  3GII A;  1TR0 A;  2XMA A;  4B9L A;  3ZTS A;  1WHW A;  4MKY A;  4RO0 A;  4NI2 B;  1MLA A;  2A2C A;  4J9L A;  5DLG A;  2RKI B;  1CG2 A;  2VIC A;  1S9E B;  2VH7 A;  4U7C A;  5B0E A;  1T0T V;  2VHG A;  4USI A;  3R27 A;  5HAO A;  4F3Q A;  3N5B A;  2PMH A;  3DRS B;  4CT8 A;  2BKP A;  2JRS A;  3ZZT A;  2HQ3 A;  4JI7 F;  3CJ0 A;  3CCW A;  4ECS A;  1NB7 A;  1R0A B;  3DLK B;  3MWB A;  2DPI A;  3OUY A;  2B9Y A;  3MPW A;  1ELO A;  4WII A;  1N33 F;  2DH8 A;  3HZG A;  2BA9 A;  3LA0 A;  2ABY A;  1U49 A;  3ENA A;  5F41 A;  1FK9 B;  1NKE A;  2J7U A;  1JLQ A;  4MK8 A;  4B9T A;  3ZZP A;  4NLT A;  4AQY F;  1M1K T;  4K4S A;  2PFF B;  3F0N A;  3Q23 A;  3OR1 B;  2V0N A;  1OYD A;  4ZP6 A;  3T9Z A;  4H4K A;  3G6V A;  3PCO B;  4DV5 F;  3EVM A;  1IKV B;  4UQG A;  3QZ8 A;  3WQP A;  3C15 B;  1YHQ S;  3HHL C;  1F9F A;  4DV3 J;  2Z4P A;  4P74 A;  2JEF A;  1V3S A;  5IT0 A;  2VPY B;  5C25 A;  2BJD A;  2W7O A;  3KNG A;  1WI6 A;  2QLW A;  4B9U A;  4MK7 A;  1TAQ A;  5B08 A;  4J90 A;  2OMO A;  1FA0 A;  4E0D A;  4X65 J;  4ED6 A;  2PGC A;  2B8P A;  5CHC B;  1ZPW X;  4OI0 A;  2RDD A;  2HHW A;  4LF2 A;  3W8P A;  3GG1 A;  4F3M A;  4PXC A;  2AHO B;  4JI4 F;  3U1M A;  1JJH A;  4IR1 A;  3RB3 A;  4A8Y A;  1NK8 A;  1X4H A;  3TX0 A;  5I3U A;  2YKN B;  5L9X A;  3T5H A;  3CD5 A;  3TUJ C;  3TZX A;  4DSI A;  3MAH A;  3PNI A;  4IR9 A;  4O0I A;  3EGW B;  4L3K A;  1S76 D;  3OFF A;  4LRF A;  1Z2Z A;  3EUN A;  2WB1 D;  2R2U A;  4ZVQ B;  3HT3 A;  1F2H A;  3IP0 A;  2UVV A;  1Q86 T;  2RML A;  1X5S A;  3IR7 B;  3LGH A;  3HHE A;  4FBU A;  5LMN F;  2VQE F;  1LWX A;  3KLE A;  4DUY J;  5IOL A;  3V6J A;  1FXL A;  2MQL A;  4TNO A;  1OSD A;  3JQK A;  4OZ3 A;  1S72 S;  5KFX A;  3DOL B;  4F2R A;  4GKJ J;  1SH2 A;  2HFV A;  1LK7 A;  1IWA A;  2B43 A;  3QFW A;  5IXU A;  5ETV A;  3M8W A;  2DHS A;  2V50 A;  1Y11 A;  3A3P B;  5ADZ A;  2XO6 A;  2CDR B;  2PEH A;  2J76 E;  5KT6 A;  3ETM A;  5CXT A;  1NCL A;  1FKA F;  4Y2M A;  4ZP9 A;  2BOA A;  4ED7 A;  2MTL A;  4LF4 F;  2Q1L A;  1RTI B;  4Z7C A;  3JTO A;  1G3O A;  5KAK A;  2ZHA A;  4QU7 A;  4AXJ A;  4QZV B;  3AD8 C;  2YNH A;  2C3O A;  2DGV A;  4UOF A;  1AXQ A;  4Q2L A;  2HVI A;  3E2E A;  2AGQ A;  1S57 A;  3QT7 A;  1VK8 A;  4CLW A;  4IYQ A;  3OW2 R;  3C46 A;  2LXF A;  4OJH A;  2CJA A;  2GIF A;  2OH2 A;  2P9E A;  2MKY A;  3MDF A;  1NJX A;  2XZW A;  2X7I A;  3W2V B;  1MWZ A;  2BE9 B;  4ZVH A;  2YKM B;  3C6T A;  4Q43 A;  4HT7 A;  2XMW A;  2OUG A;  2G4B A;  3G96 A;  2W9A A;  4LF7 F;  2B4V A;  3NGK A;  3J7A 1;  5E3Q A;  4XK8 C;  1RT5 A;  3MM7 B;  2WTF A;  2HPU A;  1AA1 B;  2HQF A;  4OHZ A;  2B4U A;  4UUW A;  2P8I A;  5KFE A;  3MCN A;  1QAY A;  1RT3 A;  2ZD1 B;  2L48 A;  3MM9 A;  1TV6 B;  3PAC A;  4L73 A;  5KOW A;  4DX8 H;  2EWH A;  2COL A;  4B9N A;  4KPC A;  3GQC A;  1HBN A;  3MOJ B;  1JLE B;  1UVI A;  5AE2 A;  5D0E A;  5HI7 A;  2C2M B;  4UF4 A;  4OYI A;  4A8X A;  5HVG A;  1X31 C;  4O3P A;  2RE1 A;  2SXL A;  1U47 A;  2YPY A;  1SQE A;  4PPD A;  1Z1Z A;  3A8E A;  3FEY B;  1TL1 A;  2UXD F;  1JLB A;  5J2Q B;  1XMQ J;  3KK3 B;  1UW9 A;  3OFE A;  3KUE A;  1IXK A;  2GHV C;  2Z2M A;  1SJQ A;  3C6U A;  3DGP B;  3MM6 B;  3WDO A;  4QYR A;  2LYV A;  5F9N A;  2I38 A;  3IBW A;  4L75 A;  2AJ2 A;  5JMN A;  1B3T A;  4B3T F;  3J7Z T;  3TAP A;  1QSS A;  5CQG A;  5EWG A;  4O3S A;  1RB0 A;  2X1A A;  3TR5 A;  4CDI A;  2A6M A;  2GML A;  3GON A;  2ZZM A;  4FNI A;  2HHP A;  3R3T A;  3VAI A;  2MZJ A;  4KHM A;  4BDP A;  3RR7 A;  1URR A;  1F2G A;  4UY8 T;  5T41 A;  5CYJ A;  3QAE A;  3A8J A;  2R7S A;  4U6P A;  1YBT A;  2ILZ A;  1A0O B;  2FC9 A;  3CUN A;  4MYU A;  4JI0 J;  1NJI T;  2Z0G A;  4PWD B;  3M30 B;  2G0J A;  1HYS B;  1RAD B;  1PJ6 A;  5KG0 A;  4UOC A;  3KJN B;  2LLZ A;  2VU5 A;  1ZM4 A;  3P96 A;  3IN5 A;  3OSN A;  3MGJ A;  3OLB A;  2IPO B;  1XNQ F;  3BO2 A;  1NK4 A;  4ES2 A;  1FJG J;  2WHO A;  2ZWP A;  2ZNZ A;  3BYP A;  2PI4 A;  2I6W A;  5L1K A;  3N28 A;  3KDN A;  5G0R B;  1HBM A;  2FJE B;  2JH3 A;  1BWV A;  1WC3 A;  3T19 A;  2EFP A;  1XNR J;  3MOZ A;  1JQG A;  3MI7 X;  2RD5 C;  1N6Q A;  3H5Y A;  3V6D A;  3FZ2 A;  4DR6 J;  4JI6 F;  1N32 J;  3CJK A;  2CKW A;  3CT9 A;  4ED5 A;  2OJ3 A;  2BX6 A;  2P6T A;  1NZA A;  1PYT A;  4X4O A;  3QRR A;  1S49 A;  3FRY A;  1RA6 A;  4I2P A;  3CD6 S;  2J9E A;  5AXN A;  1OPZ A;  3QNW B;  3GIM A;  1AYE A;  5GAH U;  1EJ7 L;  2XWX A;  2H5E A;  3M7V A;  1EQM A;  5BYS A;  1RK8 A;  3ONQ A;  4OX9 F;  1E6Y B;  4HAC A;  5A8R B;  1S10 A;  3Q8R B;  3DLG A;  2ADC A;  1VS3 A;  2P6S A;  2BVZ A;  3TA0 A;  3PV8 A;  3GV7 B;  2HWI A;  2KJW A;  4X4U A;  2RHQ B;  3W5X A;  3ZZU A;  2GFF A;  2NZC A;  1HHQ A;  4WP8 A;  3MEE A;  4ZPT R;  4FF2 A;  1IWG A;  4ECU A;  1Y5L B;  5CYQ B;  1LWF A;  1U0H A;  5KOX A;  2HND B;  2VF3 A;  1U24 A;  1OWX A;  2Z30 B;  4YY3 J;  3VV2 B;  1F6T A;  2HK2 A;  1XER A;  2W2M P;  2BMB A;  3SQG A;  4ELV A;  3WC2 A;  1X0F A;  1SJ1 A;  1NSA A;  1KC8 T;  4CTA A;  4DPU A;  5E3P A;  4ERD A;  4WTY A;  3DRX A;  1HPZ A;  1NDK A;  3DRR A;  2MKH A;  3OLA A;  4C8K A;  5KG6 A;  4B3M F;  2R2R A;  2CQ1 A;  2E5L F;  4MK9 A;  2I1R A;  4KFB A;  1Q4R A;  4OHV A;  1WOP A;  3OFG A;  1ITP A;  1X5O A;  3M32 B;  5KT7 A;  1V3R A;  3E51 A;  5GAH I;  5EWF A;  2EBG A;  4X4R A;  1DBD A;  2DK2 A;  4LRC A;  4DG1 B;  3H20 A;  4ED3 A;  1VC6 A;  3QPI A;  5BXI A;  2LU1 A;  1KWM A;  2Z8Q A;  5GMD A;  5HQ8 A;  2RAQ A;  2FJD B;  3D9B A;  1HD1 A;  4C8O A;  2DGO A;  2H3E B;  2HBQ B;  2C2N A;  3LWL A;  3G82 B;  2M9K A;  1WG1 A;  3LAL A;  4X4T A;  8ATC B;  4C0B A;  3M1V A;  4ZJL A;  2E5H A;  4Q44 A;  5J2N A;  1WG4 A;  3ZTQ A;  4ED8 A;  3H90 A;  2FJW A;  3UWT A;  2C2E A;  1HNW J;  1M5K C;  2QSF A;  3PHE A;  2PA8 D;  1XC9 A;  1YKW A;  1CUL A;  1HQE A;  3SQO P;  3KLH B;  4QWD A;  3LAN A;  3KK1 A;  3V81 A;  3FEZ A;  1UVJ A;  1Q5V A;  1RKI A;  2BEF A;  3FSX A;  4ZVP B;  3UCG A;  3NXZ A;  4C98 A;  3H4B A;  1SUQ A;  1ZZN A;  2YQ0 A;  1ZA2 B;  4F0H A;  4FS2 A;  1NXI A;  3OXL A;  1RT7 B;  3H2U B;  4MIA A;  2MLX A;  1TL7 A;  2JEJ A;  3HVR A;  4DR5 J;  1Q7Y T;  3CC7 S;  2L9D A;  4DV3 F;  1B0P A;  3R5A A;  4IRD A;  1QDU B;  3DHW C;  3GCX P;  4QWC A;  1GTE A;  2DNG A;  4NE9 C;  1VIO A;  1RAF B;  1FO1 A;  1NBE B;  1GK8 A;  3MUR P;  4OZJ A;  4ETX A;  2GVZ A;  1RUS A;  4DQS A;  3GCW P;  5HMW A;  4XO0 A;  4I7F B;  4ECV A;  5D8H B;  2HQC A;  1H7W A;  2W9C B;  1RWN B;  4X65 F;  1KQS R;  2YWW A;  2MB0 B;  1FI4 A;  2GVD B;  1JIH A;  3CJ4 A;  5EDW A;  5HQL A;  3BR8 A;  1JKH B;  3Q83 A;  3KJV B;  1EZZ B;  3BN4 A;  3IWN C;  3AB2 B;  3LAM A;  2FHJ A;  1C0U A;  3KXD A;  4PXE A;  2UP1 A;  1FJ7 A;  1QLN A;  5LM7 E;  5KFB A;  1N88 A;  3W64 A;  1ZM3 A;  1TKT B;  4NLG A;  4NCA A;  1LK5 A;  1WKJ A;  4NYP A;  3I9Z A;  1S6U A;  4A8F A;  2HFN A;  3MCS A;  3ZZR A;  2MQ8 A;  1A6L A;  4DFP A;  3TJ9 A;  1U6Z A;  3OL6 A;  2KXN B;  4DUY F;  4NEZ A;  4N77 A;  2QFI A;  3HSZ A;  1N56 A;  2FTR A;  4HTI A;  2KXH A;  3SSR A;  4N7T A;  3OTE A;  2GIQ A;  3RUB L;  1GAO A;  2BV3 A;  3BQ1 A;  1Q82 T;  2CYY A;  4TY9 A;  2LDI A;  4GKJ F;  3IG1 A;  3CDW A;  3CXC R;  4O23 A;  3H7H B;  1SJ4 P;  3OR2 A;  2KRR A;  1DAR A;  1UJ5 A;  4ZPA A;  2VKR A;  2F8M A;  2IVM A;  4OYZ A;  1Y3J A;  3H40 A;  4A47 A;  1RT6 A;  4JBC A;  4C3L A;  3M05 A;  2CPE A;  2HRT A;  5BJR A;  1X0P A;  1YG0 A;  2EFN A;  1H6K X;  4LMZ A;  4WZM A;  5F0W A;  4IOC Q;  3CIZ A;  2KM8 C;  1X5T A;  3FFI B;  5HRO A;  2VJV A;  1FCA A;  2BZ2 A;  5I3P A;  4ZCI A;  2GZO A;  3EVO A;  3BEG B;  1DTT B;  1JLA A;  2LEP A;  1RAG B;  5L8R C;  3PVX A;  4Z7Y A;  3Q8V A;  2L08 A;  4NZ0 A;  1FKP B;  3Q0A A;  4KE5 A;  2YNF A;  3I0R B;  3POT B;  4QPX A;  4Y3C A;  2R4F A;  1HA1 A;  3NAI A;  2NXN A;  2KXF A;  3KUH A;  5MLC V;  3NP5 A;  4JYA J;  1N5V A;  1NDP A;  5EHH A;  4RU9 A;  3RB6 A;  2IM1 A;  1T9U A;  1KSP A;  4EYH B;  4I64 A;  3KFW X;  4QBU A;  2YWH A;  1UMJ A;  2F65 A;  4IOA Q;  2ADB A;  1VBZ A;  4UOG A;  1S6Q A;  2OPP B;  1Q8B A;  2CQB A;  4A8M P;  3JAM U;  2ZKT A;  2ZDP A;  1R8P A;  2AMC B;  3GYG A;  2H4Y B;  4AT1 B;  2GIR A;  4JV1 A;  3J7Y U;  4LF6 J;  2IAJ A;  3PHT A;  4YQW A;  2YNI A;  2DR7 A;  2ZBP A;  5F8I A;  3GU0 A;  1HNV A;  1S7H A;  3WBZ A;  2AJQ A;  3PW5 A;  1TKX A;  4HHH A;  4M5I A;  4DSE A;  5D6G A;  3ITH B;  3QT8 A;  2HAI A;  2UV8 A;  4OZN A;  4LR9 A;  2JHE A;  5D3G A;  1VFJ A;  4PG8 A;  1CS4 B;  2QC3 A;  2AWZ A;  2E9Z A;  4F25 A;  2QA1 A;  2V4R A;  1Y5N B;  4X4Q A;  5F8J A;  5C24 B;  4IG0 B;  4K59 A;  3GFH A;  4WYL A;  1U6B A;  1TUV A;  4OMF G;  3HJV A;  5DM6 Q;  2OPR A;  1LWE B;  4DWI A;  3TEH B;  3MMA A;  3QZ7 A;  3ILO A;  2R8G A;  4BWJ A;  4B08 A;  3S1T A;  1N36 J;  4GVB B;  2RT3 A;  2ROE A;  2BXJ A;  3G8T A;  3J7Y I;  1HMV B;  1D1U A;  3KLI B;  2DGW A;  4P10 A;  3ZTP A;  1IJF B;  1SH3 A;  4WKR A;  2VAS A;  1FD2 A;  2ZUG A;  1M5O C;  5EX3 A;  1MNE A;  2J5A A;  3BPD A;  3UDE A;  2BOP A;  3M2V A;  2HK3 A;  2LDY A;  2HZV A;  2V5H G;  5A6W A;  3NOG A;  4HI2 A;  4ICL A;  1X9S A;  2YKA A;  5KFZ A;  3JSM B;  5K20 B;  3CGI A;  1EP4 A;  3M2R B;  4CYU B;  4XIU A;  3BO3 A;  3LP2 B;  2NRE A;  1H38 A;  1N0U A;  4ES1 A;  2VJU A;  2C1E B;  3BB5 A;  2J6U A;  4JI0 F;  3TUP A;  1S12 A;  2UUW A;  3ET6 A;  5DZ7 A;  2DIS A;  4YS2 A;  4P2X A;  1JB0 C;  2FJB B;  2XTJ P;  4LBH A;  1VQS A;  3JQM A;  1LW2 B;  1Y00 A;  3C16 B;  2PI5 A;  1FJG F;  2EXU A;  5HP1 A;  2FJA B;  2XZT B;  1YWX A;  5A0Y A;  3QIP B;  1REV B;  4G6V B;  1YJT A;  4QU6 A;  2QTW A;  4UZC A;  4DR6 F;  1G6B A;  2D9P A;  1N32 F;  2KB2 A;  4RPF A;  4L6V 3;  2XNQ A;  1X4F A;  1VI7 A;  2ZJQ Q;  3KK2 B;  3V6H A;  1V5I B;  4IFV A;  4DR7 F;  5I42 B;  1CJU B;  2GQ2 A;  2KYZ A;  1U26 A;  1M90 T;  4J9Q A;  3UCZ P;  1OS5 A;  2BKO A;  1RXO B;  3TI0 A;  5DRK A;  1R3N A;  1DTQ B;  1NH7 A;  4H4O A;  5ETL A;  5DET A;  3BZQ A;  4QIW D;  4RR5 A;  3RJM B;  1UFK A;  3CCJ S;  1S1W B;  4W98 A;  4NI2 A;  5HO4 A;  4XPE A;  2HVD A;  4KPY A;  4M8L A;  1CQN A;  5J1N A;  1NAQ A;  4S0M A;  4ZHR B;  1TUG B;  2ZH6 A;  1TQL A;  3RTV A;  4ECZ A;  2AU0 A;  3UPF A;  3MZI A;  4PG5 A;  3RBZ A;  2FYX A;  1V6H A;  3U1N A;  3HVA A;  1RWP B;  1BUX A;  3DRS A;  3E3X A;  1EET B;  3O8W A;  1U1R A;  5FDL A;  2J7K A;  1HWU A;  3BS9 A;  3DLK A;  4DX7 A;  4ZN3 A;  4YY3 F;  3PW2 A;  2ACM A;  3GTY X;  4OZ5 A;  4TN2 A;  2OPQ B;  4C0H A;  1WC4 A;  1NHK L;  2DJW A;  2KVQ E;  4EO6 A;  2J9D E;  4LSN A;  4G1Q B;  4NYZ A;  2JVR A;  4JOU A;  3IXQ A;  1Y3K A;  4PYA A;  2CDQ A;  5DDP C;  4I4B A;  3AHP A;  3UQS A;  3NGD A;  5ETK A;  1ZYQ A;  3BPS P;  2UVR A;  3GIR A;  2LP4 A;  4PEO A;  1HNZ J;  4WPA A;  3OR1 A;  4NYO A;  1U48 A;  5B09 A;  3G6E S;  5F8G A;  2VD3 A;  2EG1 A;  1XMO F;  4HHJ A;  2F3J A;  1F9H A;  4CT9 A;  2IA6 A;  3HSD A;  3KMS A;  2ZJP Q;  2OSR A;  1IKY A;  1U2R A;  2OPS B;  2LFV A;  3D66 A;  3C15 A;  1RLD A;  3RBX A;  1T11 A;  3VQT A;  5ETN A;  2H5J B;  1NB2 A;  5LXR A;  2ZWO A;  2HS4 A;  1P1T A;  2OEM A;  2FHM A;  2GC8 A;  1U2F A;  4O3O A;  2M5Y A;  5L38 A;  2HZC A;  4IRK A;  4QWE A;  1SC3 B;  2QLF B;  3CDE A;  3S8S A;  1SQG A;  2HEK A;  1S4F A;  1T3O A;  1V3Z A;  5D4L A;  3FEX B;  4B9V A;  1HNW F;  3KYL A;  3KJF B;  2IJN A;  4JV5 J;  2VOO A;  4USM A;  4P7V A;  3DKD A;  4RNH A;  2CAD A;  5K14 A;  1SB6 A;  4P7T A;  3LP1 A;  5DM7 Q;  2V94 A;  1NJY A;  2HBZ B;  4Y0F A;  2HNY B;  2IM0 A;  1S59 A;  3RAQ A;  3R1L A;  3MAA A;  2YKN A;  4KIA A;  3RRK A;  2AGO A;  3PW4 A;  2B5J B;  3NG8 A;  1RT2 B;  3M8Z A;  2VON A;  2UVU A;  1OPI A;  2LU2 A;  4HYK A;  4K5R A;  2F1F A;  4DPY A;  2HQG A;  3AAW B;  3R5B A;  3QGI A;  1U7L A;  1OYE A;  3N6N A;  2I0X A;  3O2I A;  2LA4 A;  4MT1 A;  3GYN A;  1K1Q A;  4B3R J;  3FSI A;  5IZH A;  1DQ9 A;  3PRB A;  2HGM A;  4YN3 B;  3MD1 A;  1NK9 A;  3FCH A;  3IRX A;  2RS2 A;  5EGY A;  1R6Y A;  2JLG A;  3CCQ S;  1RHU B;  3M2U A;  2GMJ A;  4RBU A;  1CEZ A;  1HKA A;  4ZMM A;  1KLN A;  3BGL A;  5THW A;  1GMV A;  3OJS A;  3GR0 A;  3AQO A;  3OV7 A;  1QVF R;  3C2P A;  4I56 A;  2D3O R;  2C2Z B;  1SC4 B;  1CC7 A;  3KG1 A;  2Z2Z A;  2DH9 A;  1W26 A;  1D0E A;  1RQ0 A;  5LL6 d;  2GJI A;  1FXD A;  1QVG R;  3DYA A;  1S1V A;  1R8H A;  1X9W A;  2YX7 A;  1X7V A;  4GO5 X;  4RJV A;  2M88 A;  5K8P A;  2CG8 A;  4V1A k;  2LEC A;  3MPY A;  4DSJ A;  2CWX A;  5CD4 H;  4F02 A;  3E01 A;  4Y2A A;  2WOM B;  2BE7 D;  1BQM B;  4LF8 J;  1SH0 A;  1VMB A;  3D7S B;  4ZA1 A;  4DV0 J;  4JI8 J;  4WCE Q;  2XSJ B;  2QJ3 A;  4K4Z A;  1G4C A;  2WRM A;  2A0F B;  1N8R T;  2YKP A;  3T5L A;  3AOA A;  4TY8 B;  4DFM A;  2GO8 A;  4XDD A;  3QGP A;  1HAR A;  3D1Q A;  2F5G A;  2AX0 A;  5D77 A;  1UZH A;  3P8B B;  1KFD A;  1HBO A;  3SCI E;  1HNX J;  3I5A A;  2VUG A;  2AZ1 A;  3T1H J;  2XO7 A;  2BM0 A;  1C1B B;  1U09 A;  2RRA A;  4DV2 J;  2R42 A;  4R8U B;  3THT A;  2OLW A;  1NND A;  3JYT A;  5T7L B;  1UVN A;  3MR5 A;  3MM7 A;  3CJT A;  2WON B;  2B7C B;  3NKY A;  3FMW A;  4W90 B;  4WK1 A;  1BXN A;  3X1L B;  2IC3 B;  1GTH A;  1HHT P;  4O44 A;  2LEB A;  1MG7 A;  2VOD A;  2JVO A;  3K58 A;  4J9V A;  2R8H A;  4JYA F;  3UI3 A;  1D09 B;  1S79 A;  2KVI A;  2RH3 A;  2GHP A;  3CJ3 A;  4AYB D;  1VJQ A;  1R7I A;  2OI2 A;  1LOU A;  5LSO A;  4M5D A;  2CIM A;  4IFY B;  1ZAV A;  4ZPB A;  1F9E B;  3N4W A;  5KFH A;  4YFU A;  2R7T A;  5K9F A;  3H5X A;  2FLN A;  1NLK L;  4LF6 F;  2XZD B;  3BKU A;  2ASJ A;  2HRU A;  2HHQ A;  5DDR C;  7FDR A;  1B64 A;  5K8M A;  3ZNJ 1;  4M95 A;  1EKS A;  2F9J A;  2E1A A;  2VG5 B;  1YZ7 A;  5CYM B;  1GQE A;  2ZE2 B;  2QIF A;  1GNK A;  4OYA A;  1VQP S;  4FXW A;  2KZM A;  4NA2 A;  1XIQ A;  4K2X A;  3TQE A;  5C2C A;  4USW A;  3UVJ B;  1UEK A;  5T14 A;  3AOB A;  3PYG A;  5M2P A;  1YDL A;  3GIK A;  2RSQ A;  2DNK A;  2DR9 A;  4DLG A;  1NK6 A;  3DMJ A;  3MR2 A;  1XR7 A;  5AE3 A;  2D74 B;  2H1Y A;  3GJR B;  1C0T B;  4DUZ F;  2FZC B;  3H2V E;  3WIU A;  4DEZ A;  3M30 A;  1VQL S;  3W5Y A;  1XWL A;  1HYS A;  3HT0 A;  3L7U A;  4NXN J;  1RT4 B;  2J9D A;  3IM9 A;  4RW8 A;  2KT2 A;  4XPC A;  2QFJ A;  1N36 F;  1RAJ A;  2AEM A;  2IM3 A;  2Z58 B;  3VGS A;  1VIX A;  1PYO B;  4LSZ B;  4TU8 A;  2CRL A;  1L5U A;  3PYE A;  3LPE A;  5KFY A;  2H51 B;  1OSC A;  2APO A;  2BJ8 A;  4DX6 A;  3LAK A;  1AZS B;  3KG0 A;  4CO3 A;  3FGV A;  1BWE A;  3CC4 S;  4PQU B;  1QE1 B;  3LP0 A;  4IH7 A;  4YB5 A;  4ATN A;  1PGZ A;  3W2W B;  2M8D B;  2CQ2 A;  1H74 A;  3I0S A;  2IBO A;  1SC6 A;  3ELH A;  1LWC A;  1DZ5 A;  2YNG B;  2VV5 A;  1S0V A;  5AXM A;  5F8N A;  2YQ1 A;  1FWL A;  5E2Q A;  2MGZ A;  5IC6 B;  2ZH9 A;  1VCT A;  2VG6 B;  2UU9 J;  1M5V C;  1TUW A;  4Y65 A;  3KLV A;  2IJF A;  2GJF A;  3SEO A;  1UKU A;  1GH8 A;  2BJ1 A;  5A8K B;  4JI7 J;  2HBY B;  2B3T B;  1QJH A;  1X5P A;  1GMW A;  2B51 A;  2OTJ S;  2YWF A;  4RW6 B;  3MD3 A;  4ZJQ A;  2VIH A;  2ZBR A;  5D15 A;  2E1P A;  3DM2 B;  4OYB A;  3BH6 B;  4MFB A;  4X64 J;  2FVR A;  2CQI A;  3EGN A;  2XY6 A;  4D3G A;  1RAE B;  4DL7 A;  3FK4 A;  1CJK A;  5HAT A;  5HL7 Q;  1CQM A;  3QRQ A;  2CVE A;  3JSR A;  2GMH A;  4ILM A;  1GXU A;  4EYI B;  4AQY J;  3HFZ B;  2XYG B;  2F63 A;  3NNC A;  4NLO A;  3NAH A;  4MKA A;  2BM1 A;  5M2R A;  4LFA J;  1Q0N A;  1NUE A;  4DV4 J;  2AYE A;  4ECT A;  3GG0 A;  4AUK A;  5HLF B;  5HBM B;  5A6P A;  4DV5 J;  5D4O A;  3MTK A;  1TL4 A;  5B0C A;  2B0G A;  4MH8 A;  4QIV A;  3BO4 A;  1MRO B;  2QYG A;  2HYI B;  1GXL A;  4LR8 A;  3VWS A;  4RUA A;  2IHR 1;  3W8G A;  3NS7 B;  2G1H A;  2IVY A;  4WBF A;  1N5Y B;  1SXL A;  3GFX A;  4O4G B;  3VHQ A;  3Q8S B;  2U2F A;  5DGA A;  2PC6 A;  2DGX A;  4B9M A;  3FZB A;  3NLC A;  1L3V A;  2DTJ A;  3W9I A;  4GO7 X;  3IS9 B;  4RNN A;  1UJ4 A;  2PMZ D;  2A2D A;  3T41 A;  3DXB A;  1DFD A;  2Q3P A;  2J0S D;  4I2Q B;  1P6T A;  4F4Y A;  3SSS A;  2NZ4 A;  3EVW A;  3UFC X;  1FTR A;  2V4Q A;  2G0C A;  3MMB A;  3T5J A;  1FX2 A;  1VRQ C;  3VGU A;  2XG8 A;  5F8L A;  1K1S A;  2FGC A;  3R6G B;  1Q79 A;  4UZB A;  2GNK A;  2BW7 A;  2O66 A;  5SUH A;  1I3O B;  2C28 A;  3OTD A;  4CO0 A;  1UW4 A;  4KHR A;  3DOM B;  3PRV A;  1PYS B;  2HRY A;  3P6Y C;  3QLH A;  2CQD A;  4FNH A;  2VQE J;  1BQN A;  2XYH B;  3NNH A;  2ZH5 A;  2IJR A;  4UST A;  4QR0 A;  2GA7 A;  3CCS S;  2W7A A;  4B17 A;  4EZ6 A;  4A8W A;  4I7F A;  2B56 A;  3DFE A;  2W9C A;  1KEK A;  1NDC A;  4CO5 A;  1RGV A;  4JV5 F;  3HD1 A;  2VKZ G;  4B9S A;  2DNN A;  3THV A;  2MDA A;  2RB7 A;  2GVD A;  2CQH A;  2F4F A;  2GGP B;  4Z2X A;  2V67 A;  3IMQ J;  3CUL A;  3MEK A;  2HVE A;  3IBC B;  3K17 A;  4ZKA A;  3AXM A;  3RW6 A;  2WW8 A;  3R1H A;  2WSC C;  1GFW B;  1IKW A;  3CCT A;  1N5S A;  1TK8 A;  2QX0 A;  3R7S B;  2V9W A;  1BHN A;  4WE1 A;  3TZZ A;  4F50 A;  1B0T A;  4EGL A;  3ILL A;  1JJ2 R;  1K73 T;  5GME A;  1FE0 A;  3TAR A;  2BBE A;  1S5Z A;  3QSY B;  1FXR A;  2CNK B;  3A3O B;  2YXL A;  4OI4 A;  1O8B A;  3A1Y G;  1VRT A;  4DQR A;  4B3R F;  3GSD A;  2FJV A;  4HI1 A;  2MQQ A;  1SJF A;  4K7Q A;  1C1C B;  1H73 A;  2QLJ B;  2AT1 B;  4ZCL A;  5HVF A;  3RRG A;  1LFP A;  2W2P P;  4J91 A;  3RYL A;  2ZKU A;  3UD3 P;  2HLT A;  2FC8 A;  3X3U A;  4TQS A;  1O6X A;  3W7B A;  1NKC A;  2JSX A;  3PX4 A;  4NML A;  1RBL A;  3TRG A;  4YB6 A;  4TYA A;  6FDR A;  3C66 A;  1RTH A;  5KG5 A;  2ALY B;  2KDO A;  3AH6 A;  3FQK A;  5H9E J;  1WKK A;  4KT0 C;  1S1T A;  3C14 B;  4N47 A;  3D6M B;  1RWO B;  4LF8 F;  1S1X B;  2AQ4 A;  1Q53 A;  3EGZ A;  9ATC B;  2O01 C;  1IBK J;  3QWP A;  4KY3 A;  4DV0 F;  1YLX A;  2HAF A;  3MEC A;  3POT A;  2OEK A;  4G1I A;  1CLF A;  3JQJ A;  4NZ6 A;  1SL0 A;  4NOH A;  3AJ1 A;  3EPI A;  3UDV A;  3Q89 A;  1Q5Y A;  1A7G E;  2UV8 G;  3UN3 A;  3R2D J;  3L7P A;  2BE2 A;  2L9W A;  3CF5 Q;  4WKY A;  2BQU A;  1YIT S;  2V68 A;  1HNX F;  2NQP A;  2UXD J;  2C3P A;  3T1H F;  3GMG A;  1FVS A;  4DSF A;  5LOQ A;  2E1M C;  3D67 A;  2NCK L;  3F44 A;  2K2P A;  4QYZ K;  2BAN A;  4DV2 F;  2GAG C;  3EE3 A;  1WF0 A;  3MUM P;  5AXL A;  1SBR A;  1RA7 A;  3PIO Q;  4C8Y A;  3LQV A;  1JNR B;  4GC6 A;  2U1A A;  5KFG A;  4ZVS B;  3PKY A;  4RBT A;  1YX2 A;  1S0M A;  4D3H A;  1T9W A;  3P45 B;  4NLQ A;  3Q8Q B;  4LR7 A;  3MM8 A;  1TKZ B;  2JNJ A;  3CJR A;  2DNM A;  2HW3 A;  3ENW A;  2OTL S;  1WI8 A;  3TZY A;  2K1R B;  4Q2M A;  2E5G A;  4JV0 A;  2KFZ A;  1DLO A;  2G9O A;  4DR3 J;  4K4T A;  1NZ8 A;  1S6P A;  3M8R A;  4NMX A;  5A2Q Y;  4ECX A;  1CS4 A;  3OTB A;  2KN4 A;  3OL7 A;  4PXD A;  2ZH7 A;  2RDJ A;  2V8V A;  4CLU A;  1UPM B;  3Q86 A;  2F7V A;  4K4V A;  5AXK A;  1TL3 A;  3CCL S;  5C25 B;  1YRU A;  1LWE A;  1Q8I A;  3SCJ E;  4DPO A;  4ETZ A;  3U7J A;  1U1N A;  2ZJR Q;  2ZNY A;  3K59 A;  4GVB A;  4O4R A;  2M4M A;  3R2C J;  8AT1 B;  3D6F B;  4JI6 J;  2ATC B;  4ZLL A;  4OL8 A;  1H7X A;  2QLB B;  1RAH B;  1PBA A;  5DDO C;  1JLG B;  3KLF A;  1GX6 A;  2WVD A;  2EC2 A;  5F9L A;  2D7S A;  1UTA A;  2YPZ A;  1YSJ A;  4PR6 A;  1Q7L B;  2RNE A;  1U2C A;  5I3U B;  4NL5 A;  4OZ2 A;  3JSM A;  2ZEJ A;  2QSW A;  1FRM A;  2Y1I A;  1TKD A;  4CYU A;  3LUY A;  3QID A;  1AUS L;  2DXD A;  3TA2 A;  3W9J A;  4ZVR B;  1S77 D;  3QMQ A;  1RE1 B;  4N76 A;  2HWT A;  4FN5 A;  2EKN A;  2N3L A;  2QMW A;  1ARO P;  1RHR B;  4OI6 A;  2PSZ A;  1LW2 A;  4NXN F;  4CM0 A;  4KH1 B;  1TMJ A;  2W2O P;  4XDC A;  3NGR A;  3BDP A;  5CAA A;  3R8Y A;  3N6L A;  2DHH A;  3HCX A;  3SBM A;  5FLX U;  3K5N A;  5D0G A;  1RTD B;  1RAB B;  1Y10 A;  4CH1 A;  2JFK A;  3KHH A;  3NWR A;  2Y8W A;  1R31 A;  5D4P A;  2AGP A;  4N8O A;  1FDD A;  5KFI A;  2KG1 A;  2M70 A;  5I42 A;  5CD4 A;  3BRE A;  2XCP A;  3K57 A;  2Q6B A;  2FPH X;  5HK4 A;  4DF8 A;  3CNQ P;  2VC1 A;  1NPK A;  1CJV A;  2R7Q A;  4X66 J;  4J9K A;  4RZR A;  3SI8 A;  1WTF A;  1S48 A;  2UU9 F;  2X1F A;  1SL1 A;  2CPI A;  2YNH B;  3BJY A;  4AXI A;  3G87 A;  2CG4 A;  1FER A;  2CZ9 A;  3AJ2 A;  1S9F A;  1M5S A;  1KQF B;  1RAA B;  1FDN A;  5CCL A;  2FZK B;  4QR2 A;  5IT9 Y;  3VAK A;  2EFQ A;  2MEW A;  4ER8 A;  4BWM A;  3GFY A;  1VRU B;  3W65 A;  3ADA C;  1OMS A;  1H2T Z;  4X64 F;  3DLE A;  2POK A;  2X3D A;  1FES A;  1RHJ B;  2FZG B;  2HFS A;  2ZVI A;  1RWU A;  3C6T B;  4O3N A;  3BGR A;  1F3F A;  4Y28 C;  3N5F A;  1S9G A;  4WJB A;  4QCL A;  1R8B A;  1GEH A;  1LV5 A;  4LFA F;  1RT5 B;  4DV4 F;  4C7Q A;  5SZT A;  1KLM A;  3I4P A;  4K2J A;  4OJ3 A;  1TTH B;  4KO0 A;  4AE5 A;  2R2S A;  3VZI A;  3KLG A;  1KON A;  3NGT A;  3CMQ A;  2KZZ A;  4LF5 J;  4CLZ A;  2L3M A;  2N3O A;  2O67 A;  1TP7 A;  1HNI A;  4NLR A;  5H9E K;  1HLW A;  5BYQ A;  2E9T A;  3T9N A;  3NWG A;  3PJ9 A;  2YTC A;  3BSO A;  1X4B A;  4KYZ A;  2XBP A;  1QSY A;  3HHN B;  1YJ9 S;  1HW9 A;  4LF1 A;  2QA4 S;  1RAI B;  4Y00 A;  1TL1 B;  2PT0 A;  4EEY A;  1JLB B;  4DF4 A;  5D0R A;  5KFT A;  3TVY A;  2CPF A;  4QW9 A;  3C6U B;  2MQN A;  4R5P B;  2HG4 A;  4DHV A;  2DNO A;  4DUT A;  1R0B G;  1RWV B;  2R7X A;  4ID5 B;  3L7O A;  2HIY A;  2XLI A;  4ZVO B;  3A4T A;  1KD1 T;  3EXY A;  4NA1 A;  3M8P A;  2B5J A;  4ZPC A;  1IR2 A;  2VG7 B;  4NPO A;  3K89 A;  4LVN P;  4LUB A;  1NK0 A;  2FIU A;  1AB8 A;  1TVR A;  2ZOG A;  2M7S A;  2DR6 A;  4KTQ A;  2MQO A;  2ROG A;  1Q8K A;  3VAH A;  3I96 A;  2XS2 A;  2K7J A;  2V69 A;  3ICL A;  1ICE B;  1PJ7 A;  4L74 A;  5D78 A;  4JP8 A;  2MHN A;  4FZV A;  1LW0 A;  3HVW A;  1HQU A;  2Q66 A;  2X1G A;  3NGS A;  1F5C A;  2CQP A;  4YEA A;  1JLF A;  2MQM A;  2HBR B;  4PZV A;  3T1A A;  1YJR A;  1L3T A;  3SCL E;  1JXL A;  3SFU A;  4C8N A;  2ZC3 A;  3ILI A;  3K8W A;  1GMU A;  3TX8 A;  1HBM B;  4OZ1 A;  1U1L A;  1YJW S;  4H4K C;  4JI3 F;  2H9Z A;  1PAU B;  1B4S A;  1N6Q B;  4C11 A;  3V6D B;  4QIE A;  4KC5 A;  3CJK B;  2RJZ A;  2IIH A;  4O0N A;  2G0I A;  4EO8 A;  3GIL A;  1UAW A;  1UVM A;  3US5 A;  4I2P B;  1HW8 A;  5U47 A;  2E5J A;  4MIB A;  2I9S A;  2MYF A;  2CQ3 A;  4U95 A;  3QT5 A;  1XR6 A;  2A18 A;  4DPT A;  1HR0 F;  1SQF A;  4C8L A;  1TFW A;  3SYZ A;  4RBV A;  1RHM B;  1T9X A;  4HAC B;  4LRA A;  3DLG B;  3FSY A;  1EHW A;  4M5M A;  4X2B A;  4OX7 A;  1ZAW A;  1JJC B;  2A6O A;  2W8L A;  4OHY A;  2VZ9 A;  3PFO A;  4M5K A;  4C8M A;  2QRR A;  4FYW B;  4LSL B;  4EWT A;  4ZP7 A;  3UE2 A;  3I31 A;  5KTQ A;  3BKF A;  1RU2 A;  1LWF B;  1U0H B;  1F0X A;  1RHK B;  2DGS A;  2HMI A;  1X4A A;  4DX5 A;  3ZZO A;  3SQG B;  2FY1 A;  1VHI A;  4UOH A;  4C3M A;  1OQ6 A;  4BLG A;  4A8Q A;  5H9F J;  3N0V A;  4OX6 A;  3DLB A;  1J2V A;  2OEL A;  4CTA B;  4GRS A;  1CC8 A;  4QJV A;  3M6X A;  4KR0 B;  2B6A B;  1HPZ B;  4EFA C;  3A12 A;  1B0V A;  1IBK F;  1IN0 A;  2LQ8 A;  4ED1 A;  2CQC A;  2R8I A;  5KFJ A;  4ZPV R;  5JVH Q;  3JSY A;  3RU0 A;  1QY7 A;  1WWH A;  2IC3 A;  5KFO A;  1IM6 A;  2DRB A;  3NRB A;  4NLY A;  2RRB A;  2WAQ D;  3FVY A;  4CIO A;  1IKX B;  2J0Q D;  4C0O C;  2EBE A;  3C3L A;  3BR9 A;  4N5S A;  1T7P A;  2XMJ A;  5KG2 A;  1U02 A;  5F8M A;  3UO0 A;  3HXM A;  4FXV A;  4U96 A;  4EBE A;  2AP6 A;  2AEF A;  3DI6 A;  4YOE A;  1BC6 A;  3LPY A;  3M4X A;  3EWG A;  2UUB J;  3M1V B;  2KJV A;  3BF4 A;  5J2N B;  2JEI A;  4BHQ A;  3I56 S;  3O5T B;  3PFE A;  3J80 U;  2RVJ A;  1YK9 A;  3T6B A;  1CJT A;  3BBC A;  3MMC A;  1CUL B;  1HQE B;  2LXI A;  3RB0 A;  2E7V A;  1RT1 A;  1L3K A;  1K8A T;  4P9S A;  2ZE2 A;  5GAE U;  2FVQ A;  3V81 B;  3SDE A;  2CJY B;  4RUB A;  1IVZ A;  4NLX A;  4OZL A;  1E6V B;  4DR3 F;  2DT9 A;  4DL4 A;  2DNY A;  4WK3 A;  1SUQ B;  2CPY A;  3S6E A;  1N0V C;  2KT5 A;  5E3R A;  1TL7 B;  2P9C A;  2C2D A;  3RRH A;  2NR0 A;  3VGV A;  2KM8 B;  2UVW A;  4ZOS A;  1R0C B;  3SCK E;  3R5D A;  3B82 A;  1WHY A;  3HP6 A;  4USJ C;  2AX1 A;  3VVT A; 
#chains in the Genus database with same CATH homology
 3NGR A;  1EHW A;  2B8Q A;  5CAA A;  1S59 A;  2NCK L;  4FKX A;  3ZTR A;  1LWX A;  1NSQ A;  1WKJ A;  3Q8V A;  4KPC A;  3VVU A;  3EE3 A;  3NGU A;  1LEO A;  5IOL A;  5C7P A;  1S57 A;  3Q8U A;  4C6A A;  1KDN A;  3EJM A;  4HR2 A;  1NDL A;  4DZ6 A;  2HVE A;  5BXI A;  3FBF A;  3DDI A;  2DY9 A;  3EVW A;  4W98 A;  3EIC A;  1XIQ A;  1WKK A;  2HVD A;  2VU5 A;  4ANE A;  4DI6 A;  2CWK A;  3VGU A;  3ELH A;  4S0M A;  3FBC A;  1HHQ A;  1BHN A;  1NDP A;  3GP9 A;  3FCW A;  1NUE A;  1U8W A;  2B8P A;  2ZUA A;  1F3F A;  4ANC A;  4F4A A;  1B4S A;  4UOH A;  1VYA A;  3R9L A;  3BBB A;  4DUT A;  1PKU A;  3EMT A;  3EM1 A;  1BE4 A;  1K44 A;  3BBC A;  3ENA A;  1NB2 A;  4EK2 A;  4FKY A;  4O0N A;  1F6T A;  1S5Z A;  1BUX A;  3MPD A;  1NPK A;  4UOG A;  1NSK L;  3FKB A;  3JS9 A;  2HUR A;  2DYA A;  3ZTQ A;  1W7W A;  3B54 A;  2DXD A;  3PRV A;  1NSP A;  1JXV A;  1MN7 A;  3B6B A;  3FBE A;  4AND A;  5CAB A;  3ETM A;  4ENO A;  1WKL A;  1B99 A;  1NCL A;  3VGT A;  3BH7 B;  3BBF A;  2BX6 A;  4WBF A;  3L7U A;  3GPA A;  3NGT A;  3ZTO A;  3ZTP A;  1NDK A;  3ZTS A;  3Q89 A;  2DXF A;  3Q83 A;  2AZ3 A;  3VGS A;  3Q8Y A;  2BEF A;  1PAE X;  1MN9 A;  4F36 A;  1HIY A;  1NHK L;  1ZS6 A;  3Q86 A;  4CP5 A;  3G2X A;  3FBB A;  1UCN A;  2AZ1 A;  3DKD A;  1NLK L;  3EVM A;  3VGV A;  1NDC A;  3EVO A;  1HLW A;  3WX8 A;  2DXE A;  1XQI A;  3BH6 B;  3NGS A;  3FCV A;  3PJ9 A;  3FC9 A;  3VVT A;  4UOF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...