1KDNA

Structure of nucleoside diphosphate kinase
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
150
structure length
150
Chain Sequence
VNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIHGSDSVESANREIALWFKPEELLTEVKPNPNLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title AlF3 mimics the transition state of protein phosphorylation in the crystal structure of nucleoside diphosphate kinase and MgADP.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Phosphotransferase
total genus 44
structure length 150
sequence length 150
chains with identical sequence B, C
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1996-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1kdnA00
1UCNA 3PRVA 4DUTA 1NLKL 4ANEA 1NCLA 4W98A 4O0NA 3FKBA 4KPCA 3DKDA 1EHWA 1NDCA 3Q8UA 2DY9A 3FBEA 5IOLA 2AZ3A 4CP5A 3FBBA 1BE4A 3GPAA 3VGTA 3ZTPA 4ENOA 1F3FA 4UOGA 3VGVA 4WBFA 3B54A 3Q8YA 3ZTSA 3PJ9A 3NGRA 3R9LA 3ZTOA 3FBCA 3VVUA 3EM1A 1NB2A 2ZUAA 1JXVA 1KDNA 1LWXA 3EICA 1PKUA 1W7WA 1S59A 3EVMA 4UOFA 1LEOA 4F4AA 3EMTA 1HLWA 3MPDA 3B6BA 3EVOA 4HR2A 4UOHA 5CAAA 3L7UA 4FKXA 1U8WA 3NGUA 5BXIA 3VGSA 3NGTA 1BUXA 2B8QA 2HVDA 3DDIA 1WKLA 4S0MA 1NHKL 4DI6A 2DXFA 1K44A 3JS9A 2NCKL 3WX8A 1NSPA 1NSKL 3ELHA 3BBBA 1S5ZA 3FCVA 2CWKA 1NDLA 3NGSA 1XIQA 3BH6B 4ANCA 4ANDA 3Q86A 1WKJA 2DXEA 1HHQA 1WKKA 3EVWA 1XQIA 1MN7A 5CABA 2DYAA 5C7PA 1NDPA 4FKYA 2DXDA 4EK2A 2B8PA 3BH7B 3Q83A 1NUEA 3FC9A 3VVTA 1NPKA 3ENAA 3GP9A 1NSQA 1MN9A 3EE3A 1HIYA 1ZS6A 4C6AA 3BBFA 1B4SA 2HURA 4F36A 1S57A 3Q89A 1B99A 3ZTRA 1BHNA 1PAEX 3Q8VA 4DZ6A 3ETMA 3VGUA 1VYAA 2BEFA 2VU5A 3BBCA 3EJMA 1F6TA 3FBFA 2AZ1A 3G2XA 2BX6A 1NDKA 2HVEA 3ZTQA 3FCWA
chains in the Genus database with same CATH superfamily
3L95X 3RRKA 2HNDA 1ZZFA 3CCRS 5IXUA 4ZP9A 4L75A 4TLQA 3KOAA 3DYAA 2H4YB 4Q43A 1SL0A 2ZH1A 4J9MA 4KFBA 1ZOTA 4RWWA 3F41A 1U2CA 1GXLA 5EWGA 2F9DA 4OJHA 2DNKA 5A6WA 2FVRA 4DFMA 1FKOB 1X60A 2HRTA 1YI2S 4WTYA 2DNLA 2MLZA 3I82A 1X9MA 2MZSA 1N36F 1OPZA 1Y11A 1LWEA 4RW8B 1HBNB 4CLTA 2WSCC 1RDRA 3M32A 4LF8F 3H98A 2ZOGA 1D09B 1RAAB 3ZFVA 2R3VA 3QT6A 2RDDA 5AXKA 1S97A 4WF9Q 4DS5A 3T1HJ 3M8SA 4I1TA 3UI3A 2RNEA 3DLKA 5D78A 4RZRA 4MIBA 4BDPA 2ZHOA 2UUAJ 1H7XA 2QV6A 2BANA 1N52B 2HZCA 1JLGA 5DM6Q 3MHYA 3OT9A 3KMSA 3DRPA 3GIMA 2RUGA 3FZBA 1RTIA 2VOPA 5IWAF 3TARA 3RBEA 2M70A 4WE1A 1DTQA 1MG7A 2AHOB 4CTAA 5KT7A 1VRTB 2G0IA 4FPRA 1G4CA 3OXFA 4RW6B 5HVGA 3HVTB 2CDRB 4C97A 2AYMA 2Z2MA 2ZBRA 3C19A 4DEZA 4LSNB 5B0GA 4CT9A 4MAKA 3Q2SC 4ZVFA 4WU3A 1C1CA 3W5XA 3IM9A 5E3CA 5IV3A 2GIRA 5KT2A 4QWBA 4O3OA 1T05A 5HP1A 2AKWB 3P5BP 1VQNS 1WORA 3VGUA 3NG8A 1VR6A 1RT3B 4NCBA 1QVGR 3ZZTA 2OEJA 1JJHA 4RWXA 2FIUA 2F5GA 3AA8A 4J9OA 4NZ0A 3ZTPA 3SSQA 4X65F 3PJWA 1NKEA 1MW7A 4EEYA 3UFCX 3CJRA 5EWFA 4LRBA 3DU5A 1U48A 3CCSS 1VS3A 3H25A 3M8PA 4UOHA 4JI8J 2BJDA 3LGMA 4PG7A 2UVUA 3PXGa 2EEYA 2WBRA 4NLSA 3CEDA 3A13A 3JQJA 1I5OB 4DQPA 2FJBB 3M9OB 2DR6A 4MYTA 1JKHB 1RTJB 3OTEA 2CG4A 1XTZA 4ZCLA 3H0PA 1NDPA 2GVZA 3NMAA 1RSCA 1H38A 4YS2A 1REVA 3NCQA 3HM9A 3KTQA 4DN9A 2GHVC 3VF0B 5JVHQ 2DO0A 3CMES 2H9ZA 2B6AB 1OQ3A 1U1PA 3MEDA 4ZVOB 1FRKA 2P9EA 1ZAXA 1FNOA 1I51B 4OLPA 3IG1A 3MUVP 2XI3A 1XERA 3ZTOA 2C3PA 3DRSB 1YLXA 1WELA 1RB0A 3OTDA 4NXMJ 5A6PA 2V2VA 5IZHA 2LEPA 4Y2MA 5DETA 3E3XA 4KTQA 3P3DA 3V4IB 1B64A 4TU7A 2K06A 1ZA1B 2QO3A 1N6QB 1S1WB 5CCLA 3OJSA 5A0YB 1UJ4A 3QO9B 3L09A 3KUEA 3OXGA 1SJRA 2WONB 1NK6A 5F9LA 4LF4F 1B0VA 1UETA 4ZHRA 4ED8A 2VPWB 3G96A 4F3QA 5J1EB 1TV6A 3T3FA 3PYEA 1SIZA 3HULA 3PRBA 2O01C 3A8KA 1N48A 1SH0A 4C11B 3LALA 1GMUA 2HFZA 4MK7A 2FZCB 1URRA 2M8HA 4G3IA 3I9V9 2C22A 1T9TA 3AJ1A 1ZM2A 4LIWA 3HO1A 1KC8T 5ETQA 1A7GE 3OPKA 3EYZA 3OFFA 3ENQA 2JEGA 3OBIA 1QE1A 4I6WA 3W9JA 4QIFA 1HW9A 3RGIA 4ETXA 1FA0A 3I0RB 2ROPA 2BRKA 5JVGQ 1R0AB 5L1JA 1CC7A 3W2WB 1ZM4A 2KN4A 4K2XA 3KFWX 2Q6BA 4HL9A 4RL1A 4RU2A 1XNQJ 1KLNA 1S48A 5F41A 1VBYA 2A2CA 2R42A 4F02A 4CLKA 2OLWA 5J2MA 1KFSA 4OMFG 4KHPJ 2KI2A 3B78A 2W25A 1D9AA 3FRYA 1ROFA 2HRYA 1DHMA 4OJGA 4RW7B 2IDLA 3NAIA 4ETZA 1FJEB 4O4GA 1S6OA 1HPZB 2NZ4A 2FQQB 3LF0A 1FT8A 2BJ3A 2JSXA 4ENOA 1NKBA 1P6TA 1YSJA 3M2VB 2LYVA 5IS2A 5D3GA 5L46A 3RUBL 1KKHA 4N47A 4WXOA 4YHHJ 1KVJA 5IQ6A 4XDDA 4J9KA 1DY3A 3IR6B 1X0FA 2VQFJ 1JLAB 5F0WA 4ZVTB 1GH8A 1J5OA 5HANA 3CB4A 2W24A 2YWKA 1YG0A 3HVRA 5HVFA 3THTA 1X9SA 2QIFA 2FC8A 5AE2A 2LCWA 4L72B 4YEAA 1RISA 2OPQA 3JSMA 3U1MA 2V4RA 3CCUS 1MMNA 4U7UD 2GMHA 2YWGA 1CVJA 1KONA 2XWXA 3JSRA 5KFQA 4FYXB 3UN2A 4N5SA 2B0GA 1EETB 2QA1A 3W9HA 4UQTA 2JFKA 5DDRC 5ETVA 3Q8RB 1SB6A 3QGIA 4C8MA 1YJTA 4L3NA 3M6WA 5IT4A 2IJRA 1WTBA 3DCAA 3MWBA 4JV5J 2N3LA 2CG8A 1B70B 4C3KA 2BUNA 2YPYA 3MM6A 5CYQA 3B54A 4X64F 4DR2J 1HBUA 1FHTA 3GJTB 2PI5A 4MFBB 4DLEA 3I6PA 1F3VA 2RH3A 1JLFA 3TUIC 3IS9B 4DJBA 2E7XA 3G6YA 2AJ2A 2CWXA 3QGPA 3FFIB 3OVBA 1BUXA 1C2PA 2QA2A 2PEHA 1RP5A 1S9GB 1RWKB 5E7OB 1JNZB 4UQGA 2DRDA 2XCAA 5LXRA 3EPGA 2KDOA 2BABA 1E6VA 3WQPA 2QL5B 2DH7A 3VAMA 2XMMA 1RU2A 4OYBA 3BPSP 4KV8A 4EZ6A 2NQPA 2O66A 3S1TA 1O8BA 4BS2A 4PXBA 2I2YA 3FMBA 5KG4A 2F1FA 1NCLA 1N88A 4NLYA 2B9WA 1FF2A 4CO3A 4PABA 3M30B 4R0EA 1KLMB 4PG6A 4JI4J 1VISA 2BM1A 2MKKA 3G8SA 3H59A 2N82B 2UXCJ 2GAHC 4JI5J 3DLHA 4QR0A 3DOKA 3IBWA 2DEJA 4O3RA 3G82A 1TL1A 1N4LA 5KT4A 1F1BB 2OEKA 2GMJA 8AT1B 1EARA 1JLCB 2ZH4A 3BKTA 4K4SA 5KFXA 3GFXA 4C3MA 4MYUA 3PJXA 1RT2B 4DV2F 4N41A 2LLZA 5H9EK 4CH7A 3ZZYA 3E51A 2OGUA 4HDGA 3TAPA 3POTA 3GWCA 2VIHA 3KKFA 3OTCA 1DQAA 2EPIA 4K4XA 1GAOA 2IC3B 3DOMA 1YJWS 1M5KC 2V2KA 2B51A 5DLFA 4DL7A 5D0EA 3NWRA 2XHWA 6FDRA 3GMGA 1P1LA 5H9FK 1BE4A 1Q86T 2QLJB 3DYAB 1V3ZA 2HRUA 4A8MP 2ZHAA 1APSA 4ZP8A 4CWBA 2E1MC 3OL9A 2DNMA 2DITA 2XS7A 3FK4A 4CYUA 1N5YA 3DDIA 2B5JA 1WHWA 2R8GA 3NNAA 1UVJA 3H20A 2I5JA 2W4PA 4WJBA 3D68A 3OTOJ 2NZCA 2V68A 1LWEB 4KH1B 3HJVA 2ALZA 3HI9A 4ZVUB 3M32B 2IM0A 1HIYA 4C6AA 2V8GA 1T9WA 1LFWA 5F8NA 3CDUA 4NOHA 2EBEA 4IQMA 1NDKA 3DLKB 3A1YG 1WC3A 4H4KC 4URGA 5AJ3F 1FXRA 4KPCA 1U24A 1JLGB 3AY0A 2XY6A 3DRPB 1RTHA 3K8VA 1RTIB 2BW7A 4WE1B 4TY9A 1DTQB 5E5NA 1FESA 3MGJA 4EBCA 4IR1A 3R6LB 3MPYA 3OL6A 4NPOA 4K4YA 4DPYA 4ICLB 3KLGA 1GQEA 4LBPA 3HSJA 5KFRA 1VI7A 3PFOA 3HKZD 4DR1J 4NMLA 2HBYB 1C1CB 4LR8A 2A18A 3N4WA 5FLXY 3MEGB 1TTHB 4DCOB 4LVNP 3Q23A 4KO0B 2C2NA 2NS1B 1TL3A 4A8QA 1T05B 5HP1B 2FHJD 5LSOA 1F6TA 4A8WA 4A8SA 3AB2B 1N5TA 1TUGB 2OHDA 2GCFA 1LW0B 1NZ8A 4JI7J 2EK6A 3CIMA 3TI0A 1VBZA 4LIRA 3WIUA 1M5OC 2VG5B 2ZH8A 4IQXA 3FJ2A 1CULA 2ZEJA 5D4PA 2W9BB 4IH7A 4X4TA 3O44A 5K5MA 2YNGA 2OFHX 3GJRB 1AYEA 4DN0A 2UXDJ 4ID8A 3I55S 3IM8A 2R8KA 4V19J 4CQ1A 3M8PB 4GKJF 2ZZTA 3H4DA 4E8UA 1QVFR 5ETKA 4WK3A 4NYOA 5I42A 1QTNB 2ZHBA 4CLSA 2BE2A 3JB9k 1OO0B 4DR5J 2BKPA 1HI1A 2E9RX 3TX8A 1Q8LA 3G6ES 4DL4A 2GVZB 4HTJA 2VASA 2GAGC 2JJ4D 1WG5A 1JMTA 4MK8A 1Q8KA 1S76D 1REVB 1S1XA 4P2FA 1B99A 2GMLA 4G1QA 5EX3A 4CO2A 4RNNA 4DR3F 5KFAA 1F0XA 2HHPA 2DO4A 3SBMA 3RW7A 3T5JA 3CMQA 4J5OA 3MEDB 3CDWA 1NXIA 4IOBA 1GX6A 2CIMA 1UFKA 3THPA 4BHQA 1FKPA 3IG1B 3MR5A 2AU0A 4K4UA 3NWGA 2C1EB 2V6AA 2V69A 2PFDA 1FE4A 2VDHA 2PT0A 1U1LA 2G0JA 4HI1A 1WJ9A 1NHVA 2GQ2A 2K3KA 2J76E 3M6VA 4A8OA 3FCHA 4Y2KA 4PQUB 2AJ1A 2JNJA 3BBBA 4DX6A 1MWZA 2PDAA 5DDQC 3CC2S 5HJXA 2Y8WA 2CKWA 2CPXA 3P96A 5DG8A 4LF9J 1T3OA 3BM7A 2JLEA 3V81A 2X1FA 4DPTA 3HT3A 4X84A 2I9SA 3BN7A 4ZHRB 2Y3YA 4AQYJ 5C2CA 1TV6B 2VU5A 3EZUA 3WHIA 2AEJA 2ZKTA 2XZDB 3UR0A 1UCNA 3CDAA 4LQ3A 3AOAA 3LOUA 4WFBQ 1HA1A 3HFZB 2MLYA 1HNVA 3FSXA 2YX4A 3FBCA 4QBUA 4LFCJ 2PI4A 2GVDB 1FFGB 2VFVA 3EVOA 2KFYA 4QIEA 2M7SA 3NGTA 4HLBA 4MMOA 3ZZUA 3EGVA 2MGZB 2ASYA 2JOQA 2P9GA 3SEOA 5KFGA 1OYEA 3BH6B 2L41A 3DGPA 2DYAA 1M1KT 2HHHJ 4DV5J 1T3NA 4BLGA 1VIOA 2D3UA 2E5JA 5LMUJ 5DDPC 2ZH3A 1GTHA 2RS8A 3G8QA 1XEZA 3TJ9A 4RBUA 2XMUA 4YUDA 5KG1A 3UO0A 2UU9F 2MYFA 2RIJA 1FWLA 4J9RA 3RRGA 1XMOJ 4DUZJ 4AD6A 1IWAA 4X4QA 1WHXA 4O4GB 1RADB 4CLFA 3I4HX 3CCQS 1SV5B 1S77D 1SQFA 3AAWB 1KFDA 4XIUA 1S1UB 3LP2A 3A4TA 2HHTA 3N6LA 4ER8A 3MCMA 2AJFE 2HVIA 1IM6A 5EHHA 2IM1A 1FKAF 4DV7F 2B7BB 7FD1A 3DHXA 5F0UA 4RW9A 3GCXP 2MKHA 5J2QA 2V2QA 2MEWA 2CWKA 1UPPA 3AH6A 1AZSB 3PHEA 1SJ1A 1RTZA 3IP0A 3UNGC 1WTFA 4RBTA 2W9AA 4PUOB 1C1BB 2HS3A 2QN6B 2FHKA 3TA0A 3JSMB 4OZJA 1M5VC 3DLJA 1LNQA 3Q8QB 1OY6A 4Y00A 2HS0A 1NSQA 2DNYA 1RLCL 2DNRA 2I8EA 2MJNA 3KHGA 2DVIA 3C14A 5CHCB 3BBCA 5KG2A 3FEZA 2BRLA 5DQGA 2AV5A 5ETPA 2CQ4A 1N36J 3OQ2A 3M2RA 5HMWA 5IQQA 3WBZA 3DRRA 2E5LJ 3M6UA 2OMOA 2QT7A 2M4MA 4CP5A 2KHCA 4M5JA 3MM6B 2CNOB 3ITHA 4LF2A 4J90A 3MM5A 1HBUB 1RT7A 4I64A 2XO6A 5C24A 4J37A 3K5PA 3PHTA 2VBWA 3MUTP 4H4MA 3BQ1A 3AOCA 2BJEA 4WTOB 1JJ2R 1NMEB 1JLFB 1AXQA 1Y3JA 2BBEA 1QUVA 4P73A 2MQLA 1C4AA 1G2EA 1NBEB 2XMVA 3OR1A 1AT1B 2KM8C 1N5VA 1U1NA 2WW8A 5DG9A 2GJFA 1TR0A 3NS7B 2M2BA 2P6TA 2IRYA 2EC2A 4HDHA 5GMKa 3HHNB 2DXDA 1DQ9A 1TKZA 4UW2A 1S0MA 3VAIA 3MM9A 1ZPWX 1X7VA 3R3TA 4PPDA 3BZQA 2ZH2A 3PG9A 3BB5A 5KFDA 3M05A 4ED1A 2RJZA 2AX1A 5EWEA 3JQKA 2VKZG 3GIJA 4JI0J 3IR5B 3HKWA 2R2RA 5ETOA 3FKBA 4ALZA 4LFAJ 3MAQA 3P5TL 2DHXA 2DNGA 4GVLA 3G6XA 2FHJA 4P6QA 1MWQA 2GX8A 3JAMY 1RUSA 4IO1A 2R2UA 3GTYX 4DZDA 4E2FB 2LEBA 2R8HA 3DOKB 2KVQE 4DSEA 3AD9C 3JSBA 1U02A 1V9OA 1BY9A 3KLHA 2CVIA 3HHLC 3JQMA 3G82B 4U8YA 1TL1B 4WK1A 2I6WA 4P2MA 3UD5A 5KFJA 2KXNB 2XYGB 3DMJA 1NSPA 4IOAQ 1MMLA 2MHEA 2RRNA 3ISND 4ZOSA 1CSJA 3R5AA 1X4GA 3RBDA 4BWMA 4ED7A 1ZA2B 3W3SA 3TA1A 2CPYA 4FF4A 2ZJRQ 3ZNJ1 4ZVGA 2DIUA 4TY8A 1SKRA 3THVA 3EE3A 2MB0B 5LOQA 1VIXA 1U1OA 2HGNA 3POTB 3ETMA 5DJBA 3I5AA 3HHEA 2DR7A 1BXNA 7AT1B 2F65A 1VQPS 3DDKA 3P6YC 3NGDA 1HHTP 4KGXB 3DOMB 2C2KB 2QMXA 1NDCA 4LSLB 2ACMA 1Z4UA 4HT5A 3BSNA 1HNWJ 3LPEA 3PR4A 1JJ4A 3RW6A 1NHUA 4CLPA 2M0GB 2O5DA 1VQ5S 5GADU 2XO7A 1CQNA 3D67A 2HK2A 2POKA 5BYRA 2R7TA 1J5EF 2JHEA 2AQ4A 2H5IB 1LWCB 1UEVA 3T5HA 4V1Ak 2L08A 4BWJA 4KE5A 4CYUB 5HROA 4M5MA 1N5YB 2PC6A 2B5JB 1QJHA 2XYPB 5KFTA 4JB8B 2D3OR 3Q86A 1SIWB 2I5JB 2G2ZA 1FDAA 1IBCB 4WYLA 3HX9A 2UVWA 2YQ1A 1CC8A 1P9QC 4FYDA 1L3UA 4NLGA 5KFYA 5HSPA 4MIAA 4CZCA 2ZDPA 2NREA 4U9RA 5ETSA 2HFVA 2RT3A 3TX0A 3TOQA 2ERRA 2C42A 4DF8A 3KLFB 3NXZA 3K7RA 2FGOA 1TL4A 3HVAA 2VG7B 2VV5A 1FTRA 3M9NB 1HWIA 5IOLA 5DRKA 3PYFA 1NRKA 4DV4F 2ILYA 1RTHB 1EP4B 5HQMA 2CXEA 4B3TF 4YQWA 3O3LA 5LJ3Y 1VK3A 2KT3A 2RF2B 3BSAA 4HHHA 3QRQA 4PR6A 3RR8A 2RS2A 1O5JA 1AA1B 4NASA 1N54B 3BSOA 3MXHP 2GHWA 4DQQA 4NXNJ 3HSZA 2DIVA 2Q1LA 3KLGB 3BYRA 1NK0A 2E7WA 4IFVA 2CJAA 4QR1A 1IBKF 3IAM9 3FDSA 1R8PA 1T11A 4B3RF 2D9PA 1TL3B 2V9KA 4ZVEA 1T03A 4ZCMA 4DPXA 3D6HB 1YBUA 1SUQA 4O0NA 3KHHA 2EFQA 2HWTA 4DSFA 5BR8J 4OLOA 2GGPB 2L3MA 2GJ2A 1EB0A 1YBAA 2OSQA 2XEXA 3NBPA 4ZPTR 1SJQA 2GJIA 2V8HA 2YNGB 4YB7A 4PAAA 3PCOB 1YJRA 4USTA 2UUBF 3NY0A 2ZD1A 5M2RA 2EC0A 2OPRB 5RUBA 3LAKA 2B4UA 4CIOA 1R7IA 1YZ6A 1PJ5A 4DPWA 2DGWA 4LF6F 4KR0B 3MCSA 2JWNA 1JQGA 5I42B 2C3UA 2N4CA 2JLFA 3UD3P 1EX8A 1RBOB 1NPKA 2AYGA 3DLEA 1ZS6A 1S7IA 5D0GA 2E44A 2Q6CA 1S1XB 1NH8A 4C8LA 5I4MA 1RHKB 4G1QB 5AXNA 4DSIA 3D1OA 1GEHA 4DL6A 2ZFHA 2V5HG 4DR7J 1AROP 1X4FA 3TZZA 1SKSA 1N33J 1M0SA 4FYVB 4J9VA 4PXCA 3UE2A 4ZPVR 1FKPB 2D74B 1HR0J 4OI2A 3VALA 5D4LA 4OYAA 4Q44A 2W7PA 1RAFB 2LQJA 4QYZJ 2BJ7A 1QY7A 2YNFB 3SQGA 3DC2A 2R4FA 3OFEA 1WKLA 4IUFA 1FNMA 1KEKA 1H0HB 4ILLA 1UP1A 4W92B 1XK8A 2VFSA 3MZIA 1Q81T 4X64J 5ETMA 4X62F 3JYTA 2R8IA 2DCUB 3C6TA 5HQLA 4USJC 1RAOA 3D6TB 1SC1B 2DH8A 4LT6A 1S4EA 3EJMA 2ZBPA 2VDIA 3WIVA 4J9UE 4Y0FA 4JUZA 4I6YA 4OI3A 3WZ0A 1X4DA 4NA2A 3FEXB 4QQBA 1DURA 3WX4A 2ZNYA 4WFXA 3DLLQ 5KFCA 1HNVB 2BDPA 4DL5A 4AE5A 1J2VA 5LJ5Y 3ZO7A 4RW4A 4Q0BB 4HYKA 4CLWA 2LDYA 2XNQA 3CW2C 5HK4A 1GMVA 1XJWB 3I56S 4ECYA 4DV0F 2XY7A 2FVSA 1VDHA 4FP9A 3OXLA 3OL7A 2CPDA 3DGPB 1I94F 2MHNA 2ZM6F 1HYSB 1WACA 4MJKA 2J7UA 3NCRA 3DI6A 2LP4A 4ZVSB 4OJ1A 3H4BA 2VG6A 2W2OP 1VBXA 2XS2A 2DTJA 4K4ZA 4C4WA 2QYGA 2XCPA 3ISZA 1UVIA 1FWPA 2HBZB 3EX7B 1HKAA 3BKUA 3K8WA 4EZ9A 2Z57B 5HAOA 4K5RA 2WVDA 2COLA 3W8GA 4F50A 3LP2B 2CA9A 4RNFA 1VQMS 2Y8YA 4CI0B 3O6QA 1TFYA 1DTTA 2HWIA 1U1RA 2V8PA 1H2UX 4USVA 5EUHA 2EI5A 2DGUA 2X7IA 4WYWA 3QAEA 2MKIA 1SCJB 1LQ9A 2DGXA 1OY9A 2GIFA 2XC9A 3T5KA 3IFEA 4QWAA 4F4YA 1VQ9S 2V4JA 1SXLA 3BGUA 4OZ2A 2HFNA 5IT9U 2RAQA 5GAHI 2HAIA 1XWLA 5E3PA 1Q7LB 1OSDA 3C14B 3CIZA 1O0PA 1N34F 2CZ9A 4DCPB 4ANEA 4F25A 3SDEA 2R9LA 3D5MA 1BMQB 4C98A 3M2RB 4RKUC 4ELVA 2NPFA 2FYXA 1CJUA 3BREA 3VGTA 2KFZA 3AOBA 2HHXA 5CD4H 3TVZA 5F8JA 1LKZA 2R2SA 3ITHB 1G1XA 2UUTA 3Q8PB 3MM5B 2Y0BB 1RT7B 2RU3A 5C24B 2PE8A 4JI1J 4H4MB 3AT1B 4FYYB 1JIHA 4KGVB 2MZ1A 2HLTA 1GMWA 2AJ0A 4LBHA 4KT0C 1U0HB 2NXNA 4C8OA 5AJ3J 2OTLS 2DR8A 3OR1B 1HBOA 1S0VA 2IAJA 1KS2A 1FRJA 1HI8A 2WSEC 5K9FA 2YX1A 1PILA 3UR3C 1WC6A 2QRRA 4PG4A 3MD1A 4M5NA 1TKZB 4ED0A 1UFLA 2V2ZA 3MM9B 4DV6J 3W62A 1X4BA 3KK3B 3M8WA 1C4CA 1QLNA 3Q8VA 3MMAA 4EI2A 3N5FA 2DR5A 3FBFA 1NJYA 2Y1IA 2BM0A 2ZE2A 2PFFB 1PJ6A 3BEGB 2CJQA 5CQGA 2PIIA 4IG0A 1K47A 3L4BC 1P1TA 3QIPA 1H2VZ 1PBAA 2ZH7A 1S7HA 1RTDA 5F3ZA 1EAYC 2OMLA 3TEGA 3E01B 4WBFA 1G7CB 1X4HA 2QL7B 3K5NA 1NB2A 3GYXB 4HT7A 2VKRA 5E0OA 1LWFA 4QWCA 3QPIA 4O3QA 1TKTA 1BQMA 4NYPA 2BMBA 5FIIA 3MPVA 4L76A 4J9QA 5F3TA 1PG5B 3SV3A 3KLHB 4M1KA 4ZCIA 4R0JA 1GTEA 2O67A 2CJYB 1QDUB 3DMJB 4GO7X 2PSZA 3IWLA 1S10A 2EFPA 5AE3A 2DRBA 4EUVA 4K59A 2XMJA 2XMWA 3QAUA 2HG4A 1CBKA 1UW4A 2X3DA 3CJ4A 1L3TA 2LQ5A 4KQZA 4DU7A 4ZK7M 3QRPA 2HIYA 2B9YA 2XMAA 3BBFA 2DGQA 2HVHA 5KFUA 1VK8A 4CLZA 1F5AA 9RUBA 3K5MA 4ZPBA 2B7CB 3EPIA 3EZ5A 1UWBB 1Q53A 2CPFA 4PG5A 2LXIA 1R6VA 1Y10A 5K8OA 3LQVA 1EKRA 2PMZD 1NK5A 3W63A 2Z56B 2NUUG 1AFJA 4C0BA 4XO0A 4RUAA 1PC4A 1PKUA 3U1LA 5D0HA 4PWUA 2UUCJ 3CSKA 1WOOA 1RA7A 2AX0A 2RSQA 2NLWA 4OI1A 3PACA 1GX5A 3KNGA 2H3EB 3R5DA 4F0MA 3MECA 1VJQA 3J7AN 3MMBA 2NCKL 2LDIA 3HP6A 1GK8A 5HROB 1FJGF 1H98A 1XIQA 1PBUA 2XSJA 3IBCB 4RUCA 2DGVA 4QR2A 2DJWA 5JXSA 1WHVA 2RQKA 4KGMA 5I3UA 2B9XA 4DPUA 4F8RA 4IG3A 4Y2CA 4K0KJ 5HVHA 2UUAF 4OX7A 5L9XA 2HURA 2HQCA 1FRLA 2EW9A 2R7OA 4QPTA 2W4DA 2ZNZA 2YKNA 1VQOS 1KSPA 5KFWA 3J81Y 2JEFA 4CRJA 3KJNB 3Q2TC 5ADZA 4F04B 4M5KA 1G3OA 1KDNA 2LKZA 1S99A 1KRPA 2HEKA 3MPDA 3CC7S 2K3IA 3C6UA 2KL8A 2WVEA 5BXIA 2A2DA 3Q22A 5CH7B 2N7CA 2MZJA 2CNNB 4JV1A 3LA0A 4W4MA 2E5HA 1GXUA 2E29A 2NYIA 3CT9A 3TRGA 1WWHA 1WKJA 3ILOA 4DQIA 5LM7E 2G13A 5D4NA 3M8RA 1Q5YA 3E8OA 1FD2A 3BV8A 3W5ZA 2RKIA 2AF6A 1UL3A 3UVJA 4IFVB 4K4VA 5HMZA 2Q66A 1PAEX 3O8WA 2XGPA 2JC0A 1T03B 4LF7J 3GIIA 4J7CA 3FSYA 1SUQB 4Z2XA 1S72S 1D8ZA 2HHWA 1UMJA 3A12A 4JI8F 3RBZA 5B0CA 4UF4A 3NBPB 2FGCA 5KFBA 2A6MA 5KFNA 3HXMA 4X4VA 4OYWA 1IKXA 4HR2A 2UU9J 4NLUA 5CAAA 4FNHA 4AYBD 4DLGA 1LOUA 4URQU 4RO0A 2WVCA 1N8RT 2CJBA 2MQOA 2QTWA 4L3KA 3VAKA 5L1KA 4LF5J 4ECRA 3FEYB 2J0SD 3NGSA 1RHQB 5JUMA 3IN5A 4ZPCA 1V6HA 2F4VF 4B9SA 2EG2A 2FJWA 2C3MA 1CJVA 2MMYA 3RU0A 2ZC4A 1NJWA 2OPPA 3QZ8A 3MR6A 4DV7J 1YK9A 5FD1A 2YX7A 5LT5A 1IJFB 3PRVA 2NPIA 1U45A 3R5BA 3MDFA 3US5A 1OIAA 5IM0A 5A2QU 4OYIA 5F8GA 1HL6A 3AQPA 3H2VE 4J9LA 1TK5A 3QWPA 4UOGA 4XTTA 2FLLA 1YVFA 1VRUA 5EGYA 1R43A 4KBIA 3M4XA 1RYRA 1RAGB 3UDLA 4XDCA 2MQNA 2J9DE 5A8WA 1PYTA 3EUNA 2AP6A 1YITS 2M88A 2IBOA 4ZLPA 3PIOQ 1HQUA 2QMWA 1DFDA 1FEEA 3ELHA 4TXSA 1NDLA 5J2NA 4DDFA 2ZBCA 3BS9A 1BD6A 2VC1A 3X1LB 1QM9A 4OV1A 1OWXA 4EO8A 4NCGB 4DXLA 2PO4A 3JYTB 4NI2A 3QNWB 1IWGA 4DL0C 3PDNA 4JI2F 2ASLA 1S0OA 3C6TB 3TQEA 1WI8A 3HLUA 5ETLA 1VHIA 2X3GA 2I0XA 3RAQA 4WP3A 2XMTA 1KP6A 2GQCA 2R7WA 1WC1A 3ZXWA 3R5GA 5H1SV 3T41A 1TMMA 1ZM9A 2YPZA 4KYZA 2E66A 4NLXA 5C2GA 2MTLA 2JDJA 2L9NA 3SZ2A 4OX9J 4B9MA 3EDRB 1XBWA 5KTQA 4QWEA 4LMZA 4P10A 5A8RA 1XNQF 1FD8A 3GB0A 3VGSA 4GVBA 4KRWA 4F2SA 1HNIA 1ZYQA 5G0RA 2BE7D 1X5TA 1HNXF 4ES1A 2AGQA 3PRDA 4GO5X 1HHQA 1WKKA 3VZIA 2J6SA 3CJSA 2VOOA 2ASJA 1Z2LA 2F40A 1ZETA 1IM4A 5D0RA 3CGIA 1PYOB 2HLUA 3DI6B 4DS4A 1FX2A 1ZBTA 1WUUA 4CDIA 2VG6B 3MURP 2PN6A 3SCLE 1YJNS 2H65B 2QSWA 4Y3CA 3IGVA 2G4BA 3LAMA 2AT1B 4YHHF 4ED6A 1UKUA 4NEZA 2VQFF 3PEHA 1U26A 3EM1A 2DPJA 1T9UA 4HI2A 2AYBA 2CQGA 1F60B 1UW9A 1NB7A 1MWYA 1Y5NB 1S1VB 2HQFA 1HLWA 2NXEA 2XQCA 2DNZA 2QC3A 3UDCA 3KJFB 2H5JB 1DTTB 3PEJA 1VLOA 5AXLA 2DK2A 1HNZJ 5BYSA 3QZ7A 1PJ7A 4NZ6A 3GV7B 3R7NB 1M90T 2BZ2A 3VTIA 1U1QA 3TUPA 3U02A 1UJ5A 2X1GA 3RR7A 2LVWA 1XQIA 3W60A 3PVXA 4IYQA 1F2HA 4OYMA 4Y2IA 4DV1J 3ULHA 3DLGB 2MDAA 1R31A 1KNZA 2V4JB 3GONA 1F9HA 1WSVA 3N5BA 3MR2A 2RB7A 1H72C 2KFNA 2HQ3A 3AJDA 2OP5A 4WP8A 2C2OB 4DR2F 3CC4S 3AJ2A 3B8HA 2KXFA 2JX2A 3QT7A 4LRCA 5GADI 4NLVA 1P8GA 2MKSA 2VFRA 4QU6A 1CJUB 3SMZA 2FDNA 3L7OA 3H42A 2XB2D 3R5JB 5HN0A 4WKRA 8ATCB 2CNKB 2GNKA 3NLCA 1S12A 4X4UA 2MKCA 3AD8C 1UPMB 1O6XA 2HBRB 4AT1B 2CQPA 1ZPVA 2WSFC 1ITPA 5J2PA 4MT1A 5FDLB 2MJUA 2IAJB 1VRTA 3BO3A 2KJVA 5HLFB 4ZS6A 4HTIA 4UUWA 2YBVA 4DV4J 4FDFA 1HMVA 3VQTA 1FRIA 3ET6A 4CT8A 4B3TJ 4ERDA 4KHMA 1OYDA 3F56A 2HVZA 1FCAA 1U25A 3IRXA 4CH0S 2BW2A 3D0IE 4WFZA 2F63A 1VFJA 1BHNA 3B4MA 4G1PA 2FTRA 3MMAB 1UA0A 4JI4F 2ZE2B 2RQ4A 4ECTA 2UXCF 4JI5F 4P71A 4IG0B 3H5UA 5KFEA 3QIPB 1X9WA 1FWKA 4D3HA 1RT6A 1RTDB 4ZLNA 4E98A 3VAJA 4Q2MA 2B4OA 5GMDA 2V63A 4U96A 3ADAC 3G9CA 1B7FA 2KH9A 5ETTA 1SC6A 4B3RJ 3R7BB 2IHR1 1TKTB 1GNKA 1BQMB 4ZVHA 1U8WA 3NGUA 4MK9A 1VQ4S 5C5JA 1YTYA 1CJTA 4YR0A 1NHKL 4M5DA 2KRBA 2G0CA 2D41A 3NOGA 1RZMA 1PCAA 3MCOA 5U47A 3CO0P 3MR7A 2L9DA 5LSRA 2HGMA 4BBYA 2B8PA 4X4PA 2HQGA 2IVFB 2QSFA 1IKYA 1U2RA 3KNAA 4FPIA 1NU4A 1JLBA 3DDNA 3GP9A 2XLIA 2FUG9 4FF3A 1ZAVA 1TK8A 2VBXA 2R8JA 4NLTA 4LF6J 4M5LA 1QAXA 4OJ3A 4QU7A 4NE9C 4PQAA 3GG1A 2WBMA 2W1BA 2E9ZA 4UZCA 1Q5VA 2YKAA 1XNRJ 3RAMA 2W2NP 3WC2A 1S59A 4B9UA 3K89A 3QRRA 4F4AA 3ZZ0A 5FJ4A 1NPPA 1T0TV 4LRFA 2HHQA 3OTOF 4JI6F 3DRSA 2FJAB 4AXIA 1RYSA 4S0MA 3PR5B 4IOCQ 4ZJLA 1SKUB 3M1VA 3MECB 5LMNJ 3MMBB 2RHQB 4C0HA 2ZBIA 1B7YB 1CPZA 3QSYB 1L5UA 2XSJB 4JV2A 4ECQA 3V4IA 3T1AA 2QX0A 3KLEA 4B3MJ 5I3UB 4C8KA 4OHYA 3NCPA 1S1WA 4OHZA 4IG3B 4JP8A 1FI4A 2GFFA 3GU0A 2WB1D 3TJ8A 5T14A 3HMJG 3N28A 5DQHA 1SC4B 3K17A 2WONA 4A8YA 3ZZOA 2MKJA 4WU2A 4Q2LA 1RAIB 1K9MT 3NS6A 2UP1A 1HWKA 5E3RA 2DY9A 1X5OA 2NXCA 1SJ4P 3AD7C 2YKNB 5B0BA 4X62J 3OJUA 4ECXA 2GV1A 1RACB 4LR9A 1RQ0A 3X3UA 4RNMA 4FS1A 1HD0A 2DNHA 4FZVA 4YMEA 3S8SA 4F4ZA 1IBMJ 3EVMA 4UOFA 5KT3A 2ZBQA 3CD0A 1CJKB 3TZWA 1H74A 1WG1A 4PG8A 1YX2A 1ELOA 4GC7A 3C6UB 4AUKA 4DR1F 4YB6A 4BCAA 5I3PA 4NLPA 1WC4A 5MAOA 1UA1A 4Y2AA 3GILA 3I9ZA 4YDDB 1ICEB 4EBDA 5J1NA 2EBGA 1U6BA 1NK8A 4RNHA 4WFAQ 4DR4F 1S4FA 3D3CJ 3AB4B 3B82A 4QW9A 4I7FA 5C7PA 1KR4A 4LR7A 3C16A 4OX8A 4WPAA 2VJUA 4DG1A 1X4CA 2J8AA 3HD1A 3UVJB 2JEIA 2IMWP 4IO9Q 2VODA 1REGX 3QJLA 4JI7F 2XTJP 4GKKJ 1R8BA 2VHGA 5DG7A 4Y34A 2AWZA 2LU1A 1VQ7S 3MM7A 1TL7B 5JJBA 1OS5A 2F4FA 4ZMMA 2Z30B 2J5AA 2UXBF 4GC6A 1I94J 3H8YA 2UXDF 2OKQA 2H54B 3DNCA 4R25A 4I2QB 4RW7A 3CNQP 2ZJPQ 3CD7A 3QLHA 4DHVA 2R7RA 4X66J 4OI4A 3QATA 3PYGA 1TP7A 2ZOFA 2E5IA 1IKXB 4DR5F 3BR8A 2VBYA 2K8GA 3GV5B 1Y5LB 3E2EA 2CJ9A 1KQKA 2VPZB 5F8MA 2KB2A 2VD3A 4QW8A 1RWMB 4I69A 3D28A 2CQIA 4ZJQA 1JLAA 2M3DA 4ZIVA 1RWXB 4AL5A 1TKXA 3HSGA 1YRXA 3I96A 2QL9B 1OPIA 2SXLA 2QE5A 5GAHU 1CJVB 3SFGA 3AODA 2HNDB 2PEBA 5KFFA 2HPUA 4XK8C 4FNIA 4H4OA 2OPPB 5DO2A 2V94A 1Y9OA 3ZTRA 2WVFA 3G4SS 4A8FA 2DNQA 2UV8A 4JYAJ 4QOTA 3K5OA 2RUSA 4KFBB 3GLJA 3SI8A 3GFZA 5IM0B 2RQCA 4WFYA 3H2LA 1TFWA 2XBPA 3PKMA 4TVAB 2BJ1A 3G87A 3IRWP 3ZTSA 4PXEA 1OJ4A 1WI6A 2MY8A 4DL2A 2ZWPA 4HACA 3BN4A 4ZIWA 3D4JA 5A8WB 1V3RA 4K7QA 5B0AA 4MFBA 4QZVB 3KMQA 1R8AA 4OZ5A 4FF2A 4LF9F 2V8VA 1HQUB 3KDNA 4ZP7A 5D6GA 3QQCD 3NAHA 4HHUA 5J2NB 1XMQJ 4AQYF 1X8DA 3FFIA 2ZVIA 3D66A 3KDOA 5LSLA 1WEXA 4CO5A 1YQHA 5I3QA 4ZVRB 1NKCA 4ZJOA 3PYDA 1IVZA 2BANB 3B4DA 1U6ZA 5DLGA 1VQ6S 5B7WA 1YGYA 4NI2B 1S6PA 3DLBA 3TYTA 3OL8A 1RBLA 1KQGB 1NAQA 2CUYA 4KIAA 1KOHA 4QIVA 4LFCF 4DFJA 1JK9B 3R6GB 4UOCA 5G4DA 4GMKA 4ILRA 4CTAB 3FBBA 2IA6A 3BYPA 4WP9A 3QIDA 3LGNA 3VGVA 1U0SA 3HDSA 4HEA9 1AUDA 4EYIB 5F8LA 1RAJA 3A8IA 4G6VB 2R7SA 1AFIA 2IIHA 2EFNA 5A8RB 4EU0A 2HHHF 4GVBB 4DV5F 4KKOA 3NKYA 5LMUF 1Y7PA 1HNIB 3N6NA 1JXLA 1U49A 4JV0A 2YWFA 2E1RA 2OI2A 2QLWA 5L39A 3SCJE 3BGOP 2FHOB 4QCLA 4JOUA 2DBBA 2YWWA 4NRUA 1XMOF 4DUZF 4R8UA 1SQGA 1P9YA 1ACMB 4B3SJ 3H7HB 1RT2A 1SL1A 3K0JA 3S6EA 1RBAA 1LK5A 4IFYA 2VFUA 2VFTA 3I87A 4WIQA 3DU6A 3CCWA 3N01A 2WB4A 2CQHA 3TANA 2ATLA 4Y28C 2VB6A 4G1IA 1U8SA 4U7UK 5CA5A 1Y5IB 1VLYA 3IGNA 2CZVC 1WSRA 1SBRA 2AGPA 3SCIE 3D7SB 3NS5A 3K58A 2ACYA 1IQTA 2QLBB 3AXMA 3VAHA 1VMBA 3UWTA 5T7LA 2IYGA 1RCOB 3CDEA 4WZQA 5LL6d 1RWWB 4BC7A 5IT0A 5D8HB 3HD2A 1VRQC 3I4PA 2ADBA 1IKWA 5IC6B 3J81j 1PGZA 3HZGA 1K73T 4ECUA 4DQRA 1E6YA 3PFEA 4O44A 1S79A 3PY8A 1TVRA 2E5LF 1RJJA 2IJFA 1EJ7L 2G1DA 1HHSA 1F2GA 4FYWB 3KUGA 4UY85 1SH3A 1FJGJ 4ID5A 3CWJA 4LQ9A 9ATCB 2EFGA 1TL5A 3CVKA 2FVPA 4PZVA 1I6JA 3QT5A 3ZZRA 3W2VA 1I3OB 3BSCA 3AA9A 2PD1A 2KYZA 1DJ0A 3CCJS 3BGFA 3TA2A 4LFBF 4DSLA 2OTJS 3DRXA 1K0VA 2RD5C 4NEYA 4P74A 2ZKUA 5J2PB 2ZDOA 1VBKA 3KJVA 1PC5A 4KC5A 2DXEA 3T1YF 1Q95G 3BO2A 1W25A 1HWJA 1MLAA 3U27A 2MKYA 1HMVB 3R2CJ 4ICLA 3ET6B 4Q7AA 4JI0F 3KJQB 2PMHA 2BA9A 3IRXB 2VQEJ 5E41A 4LFAF 2CNLB 1L3VA 3LGHA 2WK4A 3P49B 2KT5A 4P72A 4ZVPB 3MEGA 2DHAA 2C2MB 2BOAA 1U47A 1M5SA 2D69A 2ZZNA 4W98A 4KO0A 2YWHA 1QE1B 3OLBA 3CCLS 2OD4A 3N9UC 4XPEA 4DUYF 1WNEA 3GPAA 2P5VA 1HQEA 1UFWA 2H48B 2JL9A 1LW0A 1RT6B 1WC5A 2DH9A 3IA0A 3RTVA 3GG0A 2DPIA 3FNNA 2VG5A 3MD3A 1PIEA 5KOXA 1UAWA 4FXDA 2W9BA 2IJNA 3EDQB 1KVKA 1HWUA 1YBTA 1HBMA 1I1GA 1NK4A 5J2MB 1CJTB 4RUHA 3OHAA 4M5DB 2HS4A 5L8RC 1CS4A 3D6MB 1IXKA 2Y1LB 5KFHA 3RRHA 2CRLA 3M8ZA 4JI3J 2GHPA 4ZPDA 1V5VA 2J7WA 1FVSA 1K8AT 1FRHA 3UDVA 1IKYB 2KU7A 1JLBB 1HNWF 2YTCA 3FZ2A 3RYLA 1BWVA 4B17A 4B9TA 1NNDA 4I0WA 2VZ9A 4OL8A 4NLWA 2RDJA 5D3GB 1M5HA 1ZAWA 3DRYA 2UV8G 1SI9A 5KT6A 1UVKA 2HK3A 2NXUA 2F4VJ 4PPZA 5E2QA 4URSA 1J5OB 4ZITA 2GS8A 4F4KA 5L1IA 3Q0AA 3LP0A 1EQ0A 1N5SA 4M63A 3GR1A 5KT5A 4OZLA 1TUWA 3HF5A 3UNYA 2Y1RI 1UTAA 4DFPA 2IRUA 4DCJB 3R7SB 2OPQB 1CQMA 2J7KA 2FJDB 2PA8D 1U2FA 2M52A 3M1VB 2BKOA 4C2MA 4C8ZA 2W8KA 4H54A 4PQUA 2Z58B 4CNYA 3G86A 3KLEB 3GQCA 4PYDA 3QWUA 5IV4A 3MI7X 1FJCA 4LF8J 2RILA 4CH1A 5CYQB 2RHSB 3DGVA 3ILLA 4EWTA 2FD2A 1A6LA 2BR0A 1SQEA 3T9ZA 5HI7A 4HH0A 2GO9A 2HQDA 2KG0A 2CQ3A 2J9DA 2WTFA 2QFIA 2QYCA 2RMLA 4Z37A 3LO3A 2PMWA 3L3CA 1X0PA 2HBQB 5K8PA 4P9SA 3C46A 4N76A 4JI2J 1MU2A 2VPXB 1RU1A 2R7UA 4NXNF 5IWAJ 6FD1A 3W65A 3L7UA 2CPZA 5B0FA 1E6VB 2GVDA 3J7A1 3F0NA 4DR6F 5HJYA 3LW5C 3CDBA 1NPRA 2XLKA 3HPOA 1NK7A 1YHQS 3Q8SB 2RQMA 1S9EA 3CD6S 3UW1A 3GYNA 2VONA 4KV8B 3JTNA 3KLVA 3RBXA 3CMAS 5A76A 4DSKA 2DD8S 3MMJA 4I7FB 3QSIA 2MGZA 1RCXB 5GAEU 6AT1B 3C16B 3HK2A 4DG1B 1YJUA 2AD9A 4Q8FA 1NSAA 2CPEA 1B4SA 2KTQA 4IKAA 4OV6A 4O4RA 4A47A 4XPCA 2FC9A 5BR8F 3V6DA 1VQ8S 4TU9A 3A8EA 1HNXJ 1ZTWA 3W64A 2Z2LA 1QAJA 1WD6A 4W90B 3MM7B 4HH1A 2C28A 2LA4A 4WKYA 3PW4A 5LXYA 3VHQA 1QSLA 2A1BA 3QLHB 3MEKA 1WG4A 4KAIA 1TELA 3GIKA 3PX0A 1SV5A 4X65J 1JX4A 1KWMA 5AT1B 2EFVA 1C0UA 1S1UA 1T7PA 3MEEA 1VQSA 3IMQJ 2J8SA 2X1BA 3QBCA 3I5BA 1BQNA 2F9JA 1DARA 1HW8A 5KFPA 2A10A 2IDEA 4KGZB 5D77A 4CLYA 3WDOA 4C9DA 2W2QP 1HI0P 1TKXB 2I1RA 3PV8A 2W2PP 2W2MP 2DNPA 1MN9A 1TUVA 4OQJA 1V5IB 1AZSA 3BQ0A 4F36A 2BQUA 4OZ1A 3M7VA 3Q89A 4DR7F 4PUOA 4H4OB 4NLRA 1C1BA 3DXSX 3FGVA 1T9VA 4ZLJA 4G65A 3FMWA 1P27B 1N33F 1RA6A 4ED4A 1QAYA 4P75A 2A6OA 3RZAA 2F8MA 4M5HA 4USWA 5L9NA 4O3NA 1HR0F 2VA3A 4U6PA 2XS5A 4QPXA 4OHVA 2UVRA 3Q8YA 3OUYA 3BO4A 1Q8BA 3NEKA 5GVQA 3OFGA 2NYHA 1WOPA 4C8YA 3H2UB 2YKMA 2ZZMA 1YDLA 3KG4A 2HQIA 1BWEA 4CM0A 1JLQA 4HACB 4X4OA 1RKJA 3PZPA 3SXLA 3QFHA 3MF5A 2A0FB 3V6KA 2CDQA 1WEZA 5FLXU 3LWMA 1X5SA 3GFYA 1DAXA 2JVRA 2VPYB 4TN2A 4O0IA 2DNOA 3RB4A 3TAMA 3SYZA 3Q83A 1XR7A 4ECWA 4JBCA 1WDDA 2L48A 2ASDA 1GMWD 4LF4J 3J7YI 1S6PB 1NZAA 3TR5A 3CJQA 2Q79A 4V19X 4EGLA 1LFPA 3GSDA 2W4CA 3TQ1A 1VOMA 3LPYA 3CJKA 4PKDB 1N0VC 2FJVA 2E5GA 2CVEA 2HGLA 2BJ9A 4FF1A 1ULRA 4LRAA 2Z2ZA 4Z7YA 3MR3A 3C15A 3MTKA 4ZN3A 1FXDA 4KKOB 2LXFA 1CEZA 4YR2A 2H1YA 3AXKA 4CM2A 1K1QA 3UPFA 2OELA 1N32F 3LH2S 2ADCA 2G2YA 3PW5A 3ENAA 4ZLLA 4R8UB 1IKVA 2WHOA 2OH2A 4P52A 1SVDA 4PCQA 1QTMA 4QIGA 1VYAA 3CTRA 2VF3A 3CCMS 3PW7A 2IY5B 1CULB 2MQ8A 1Q78A 1KBRA 3IR7B 4IFYB 1FK9A 4OHXA 2ZITA 2CADA 1EHWA 5HQ8A 2WOMA 4PYAA 4Z7CA 1RXOB 4U8VA 1F3FA 1OSCA 5SUHA 3GV8B 2M8DB 4F3OA 4U7CA 2CZ4A 3CJ8A 5IFMA 4LSLA 2BACA 5H9EJ 2ZH6A 4Q45A 4PWDA 1KTVA 1IN0A 4X2BA 2AMCB 2KYXA 4K50A 1R8HA 2BE2B 1R27B 1SKWA 2Z0GA 3F73A 3OHBA 2DGTA 1QSSA 4UUXA 3TVYA 3U1NA 2J0XA 5T7LB 1XN9A 1HFEL 2HIQA 1LWCA 4Q8EA 3U7JA 4FKYA 1IKWB 5H9FJ 4ECVA 1WEYA 2Z2YB 3VAFA 4RX6A 2BYCA 5F8HA 4QYZK 3GCWP 2Z8QA 1MSWD 3ISNC 1Z1ZA 1E6YB 2F3JA 3D1HA 4JI6J 4O44B 2W7AA 2VA2A 2AEMA 1TVRB 2VUGA 4OX6A 4I67A 3KUHA 2C3OA 2K7JA 4UY8T 1L3SA 4ID5B 1VGYA 2XHCA 3QMQA 4JI1F 2J6TA 3KLFA 1YKWA 3LP1A 2ZH5A 2KG1A 2G2OA 1WC0A 1JXVA 3W2VB 2VG7A 4LJMA 1RHMB 2NXJA 2CQCA 2ILZA 3AQOA 5MLCV 1EP4A 4YDXA 2FZGB 3DOLA 3T5LA 1Q4RA 4CO0A 3V81B 3PNIA 4J91A 1PYSB 4J9SA 1L3KA 2RF2A 4OYPA 4CCHA 3KJVB 2IFXA 1IJEB 4DV6F 5CABA 2K2PA 2XZWA 3FVYA 4RUBA 3L7PA 3UCZP 1T9YA 1Y4ZB 3OR2A 3A3NB 1U09A 2OD6A 2WAQD 2ZJQQ 3MMCA 3TZYA 4DQSA 2BEFA 1R8CA 4IH6A 2FY1A 5EN1A 3VQSA 2RDIA 2R7VA 4IH5A 5DDOC 4YN3B 4F0KA 3PW2A 4DR4J 3D2WA 2P9CA 3S01A 2LFVA 3NGRA 3K5LA 4OZNA 1HQEB 2KT2A 4MKBA 1RHRB 2GC8A 2DHGA 3HFVA 3A3PB 3UQSA 3OSNA 4TYAA 3SCKE 1QUPA 1YJ9S 1A9NB 2GGPA 1T94A 5KFLA 1NJZA 2MSTA 4ATNA 2E1AA 2YH0A 4OYZA 2KKHA 4LSZB 2VICA 4DOZA 2EKYA 3I0SA 1S5ZA 4J9NA 1HBMB 1WF1A 2UXBJ 2YKQA 2KVIA 4I68A 2CPHA 1H7WA 3GR0A 2OPRA 1CS4B 2FLNA 3BGRA 2AIRB 2GZOA 4A4JA 4FS2A 2ATCB 1S6QA 3HHDA 4P2XA 1IBLF 2HKEA 2GIQA 4F4XA 1R89A 3MM8A 4DV2J 3LANA 1ZZNA 3TW0A 4TYBA 2NUHA 3KXDA 3MAAA 2DY1A 4H4KA 2ZOMA 5BYQA 3BDPA 3FBEA 1YZ7A 3ENWA 2UUCF 4AFFA 4ELTA 4NMXA 3BF4A 1LW2A 3QGHA 1IUJA 4RW9B 3R1LA 5J2QB 2I38A 3LP0B 4DMZA 3KHLA 4USMA 3FQKA 2EKNA 2XI2A 4C3LA 2HAFA 2C2DA 1JLEA 4I2PA 3RB6A 4B9NA 1S9FA 3T6BA 4YY3F 4K0KF 2YNFA 4TKTA 2OPSA 3GE9A 1H73A 3KLIA 1JNRB 3FRZA 4NA1A 3O5TB 4K5SA 2XZTB 4IDKA 3W9IA 3DRRB 2ALYB 3R8YA 3PM9A 5ITHA 1UVMA 2XNRA 2HMIA 3CULA 3M2UA 3JAMU 4IR9A 1KHVA 1Q1KA 4KSEB 5C25A 1RE1B 2M9KA 3IO1A 2EXUA 2HZVA 2UVVA 2F8EX 2ABYA 4U67Q 3H90A 1M1GA 3HHLD 1VQKS 4WFNQ 1FTCA 1IR1A 2ZH9A 1FFWB 1TKDA 2J9CA 4EO6A 1MU2B 2F8HA 2OSRA 5C42A 4HKQA 5K20B 1AB8A 1VHFA 2PGCA 1RAEB 1K44A 4Q0BA 1KHWA 1X4AA 3JXOA 3EXYA 4RBVA 1KN6A 4Q5VA 1UVLA 3MOZA 3EVWA 2HNZA 3GZ7A 3SSSA 1S9EB 1XR6A 4C8NA 1BGXT 2Y0SD 2U1AA 1DQ8A 2CQDA 3D1QA 4R5PA 5KFVA 1X4EA 3BH7B 1OY8A 3O1LA 5B0EA 3V4MA 4NA3A 1U6FA 4BC9A 2XMKA 2BV3A 4LF7F 4USUA 4LBIA 4DBQA 3V6HA 3AFGA 1HYSA 3EZOA 2DRAA 5KG6A 2JVOA 3OVSA 2DGSA 4ILMA 3CJ2A 1GXTA 3V6DB 1W26A 2K1RA 4OZ0A 1SPBP 1HWLA 4K8RA 1F5CA 5K8NA 4B9VA 1KVIA 4ES3A 2HSEB 3T9NA 1T8EA 3M9MB 2CJKA 1EZZB 4LF5F 3R97A 4DV3F 4FKXA 5GAGI 1W2IA 1JXEA 1FDNA 1U7LA 3TAQA 1C0UB 3RJMB 2J0WA 3DM2A 3MEEB 1FERA 3PKYA 4TY8B 1BQNB 3KK2A 1C0TA 3NRBA 4GKJJ 1UJ6A 1RLDA 4M5GA 1M1HA 3TJAA 5CYMA 4KJIA 2H4WB 4N8OA 4Y65A 3MFHA 4ZVQB 4EFAC 2G9OA 4OYXA 1UEUA 1U4BA 3TO8A 1KD1T 4ZA1A 1Y0HA 2APOA 4N7TA 3PW0A 3D6FB 3SFUA 1AW0A 2W8LA 1W2BR 4N77A 3IAS9 4DX8H 4L6V3 2HW3A 3Q8UA 2QG9B 5HBMA 4DR3J 3MCNA 4P7VA 2Z4PA 1FRXA 2DHSA 1RWUA 2OO4A 3OUYB 4ED3A 3MTJA 1IR0A 3EMTA 2LQBA 2YKMB 3B6BA 3T1HF 1YJVA 2DR9A 1JLQB 2W9CA 2EK1A 3NOCA 4A48A 1TU0B 2LXUA 2Y1JA 1SH2A 3TWZA 1LV5A 2IM2A 2A3JA 1U0HA 2V4QA 2XG8A 3ILIA 1OMSA 2JLGA 1NUEA 4EMDA 3VVTA 3TAMB 2BVZA 3NP5A 2XLJA 2IRXA 4LFBJ 2H51B 8RUCA 1H6KX 3UN5A 2JEJA 2HHVA 1S57A 2HNYA 2EWHA 1D0EA 2AGOA 2KZZA 1Y3KA 2HVEA 5IT9Y 2OEMA 4DUTA 1VQYA 4C7QA 4ITSA 2RVJA 3KK3A 3DKDA 1LXNA 4YR3A 1VC0A 4ES2A 3T1YJ 4OX9F 3HSDA 5KFZA 3NL0A 1KOOA 5KG7A 1NM2A 1FXLA 3CJKB 1R0CB 2R2TA 7FDRA 3KG0A 2BKNA 2YKOA 2XY5A 2DISA 3E01A 3G71S 4DF4A 1BQXA 1T95A 4DI6A 3C15B 3WX8A 1RT4A 2U2FA 4M95A 2FJXA 2GW8A 1B3TA 3CPWR 1A0OB 4DUYJ 4ANDA 3BPDA 1FNXH 2KJWA 2VBZA 1FDBA 2MZTA 5DQIA 2MQMA 1SC3B 3W1YC 3BJYA 1M5PC 1FEHA 2YNIA 2E9TA 3IWXA 5THWA 3TUJC 5HATA 3Q24A 5IC4B 2ZVSA 2FB0A 2FHMA 2EG1A 4B08A 4MKVA 3D9BA 1ZH5A 3BKFA 1J27A 1DLOA 1IKVB 4DZ6A 2XYHB 1S49A 1G6BA 4OFZA 2AZ1A 3S7RA 3PO4A 1N0UA 1MROA 2V50A 4D3GA 4RLEA 1KQSR 2C2ZB 1DBDA 2QLFB 1FK9B 2Q43A 5ETRA 2WOMB 3GYGA 2ZD1B 3PJ9A 3CCES 5CZVA 1UWBA 3D3BJ 4KPYA 2HFOA 4OHWA 1HNZF 4X4NA 2WCXA 2X1AA 3KK1A 3W66A 4PWDB 2CQ2A 5SZTA 2BJ8A 1T02A 4NRTA 2LQ8A 5DGAA 4OYOA 1D3WA 4K4TA 2LEAA 4DV1F 2L9WA 1VC5A 1NSKL 5CXTA 3DLEB 4TLRA 1B0TA 5DZ7A 3GSIA 4F26A 3J80U 4N56A 3C8YA 3LUYA 4F3MA 2HZAA 4PRFA 2DGOA 4TQSA 3P45B 1MMDA 1RWPB 5K14A 4NXMF 3CE8A 4PWWA 1SJ3P 3GIRA 3NNHA 3O2IA 4NYZA 4L74A 3V5RA 2CAJA 2J6UA 1RT1A 2IBKA 5AXMA 2P8IA 1S1TA 2YNHA 3MUMP 2M5YA 1XMBA 3J7Z5 2D3O1 1QSYA 2AYEA 4I4BA 4MTPA 3IC1A 4O23A 4O3PA 4ZP6A 3SQGB 1KQFB 5L38A 3LP1B 2DNNA 4IRKA 1RGVA 1JB0C 3ONQA 1Y00A 2CPIA 2V8DA 3G6VA 5A8KA 1RT5A 3QYYA 1U1KA 3HHLA 2EVZA 1VC6A 2HFUA 3GFHA 3DOLB 1NH7A 2YY3A 4FXVA 2AW0A 3H5SA 3M8YA 1GT8A 3GJSB 4PXDA 2C3YA 1LXJA 4WCEQ 1IQZA 2VL1A 5F8IA 5KG0A 1CLFA 2CFXA 2V34A 1TZ0A 2FJEB 3C66A 3OR2B 2IM3A 3MMCB 2QGFB 3TUZC 3DN9A 4DR6J 4NZ7A 1RHJB 1BLUA 5DGBA 5B08A 4MIWA 2V9WA 2XM3A 4ZPAA 5DS7A 2H5EA 3QJPA 1S0NA 1D1UA 3LWLA 4RW4B 3OFHA 1FX4A 2AZ3A 2CQ0A 2DT9A 4RNOA 5M2PA 1VCTA 3K2YA 1XC9A 4KHPF 4UTGA 4CLLA 1FE0A 3UDEA 4AL7A 2B43A 4ED5A 2WZ1A 3M8QA 2V67A 4ZCKA 4K2JA 5KOWA 2YWEA 4IRDA 2CQBA 1R3NA 1CG2A 2GO8A 2QFJA 2OFGX 4B3OA 4ZDNA 5GAEI 3I0SB 1MNEA 4AL6A 2VJVA 2JRSA 5B09A 1R6YA 3TEHB 2O1PA 3BGRB 2RRBA 3VWSA 4QIWD 1PSDA 4J9PA 1AUSL 1S6UA 1S6QB 2K7KA 1NK9A 4B02A 1VJWA 4KH0B 2MZRA 3MM8B 4USHA 4DX5A 4A8KA 1Q79A 4FXWA 1WHYA 4ECSA 4C0OC 5CD4A 1UZDA 1XNRF 5T41A 3MAAB 4UT4A 1N56A 4GRSA 2MLXA 1RK8A 1NJXA 4KB7A 1VQLS 3R9LA 2HHSA 3DXBA 3A3OB 2N4DA 2ZUAA 2WW4A 1B0PA 1LW2B 1NEEA 4YFUA 1WF0A 3FUYA 5LMNF 2JZ5A 4NLQA 3N79A 1NJIT 3MPWA 1FKOA 1FO1A 1UWAA 3OLAA 1EIYB 4AXJA 2B8QA 3W5YA 2PA3A 4F7VA 3K59A 2B3TB 4B3MF 1JLEB 4I2PB 3NMRA 1FRMA 1TMJA 3VZHA 4TNOA 3CCTA 4JV5F 4RW8A 1J5EJ 1HBNA 1QAIA 1XR5A 2W01A 2QLXA 3TP2A 4WIIA 1F5BA 2YXLA 1QD1A 2OPSB 3KLIB 3NNCA 3AHPA 4NLDA 1O51A 3SDEB 4IDKB 3J7YU 4EYHB 2OIHA 2DCLA 4NX9A 4NL5A 4UZBA 3HFKA 4NCGA 2R7XA 1YRUA 2HMIB 4QJVA 2MPUA 3M2UB 3CF5Q 2Y9HA 4EBEA 3J80Y 1IBMF 3L9ZA 5C25B 4N8NA 1ZM3A 3H5YA 4OIXA 3K57A 3CJTA 5A2QY 2JFDA 2CQ1A 1HBOB 1W7WA 2CPJA 3N0VA 1LEOA 4P2SA 2G1HA 2JH3A 4RW6A 1YRTA 4HHJA 2OAUA 2CYYA 5C42B 5EDWA 3HVTA 4Y6IA 2P6SA 5KFIA 2GA7A 4LSNA 4NCAA 1U1MA 3HVWA 4F0HA 1RWVB 4RU9A 4ANCA 1FFSB 2HNZB 1EQMA 4GKKF 1URNA 4ZN1A 4R5PB 4CO4A 2E1PA 2QZ8A 4RPFA 4KY3A 2QA4S 4U95A 4MKAA 4CO1A 2MQQA 2ZUGA 3P4UB 1RT3A 2LMIA 1IBKJ 3W7BA 3T19A 4A46A 5HO4A 4X66F 4I56A 1LWFB 2K1RB 3W8PA 2MQPA 3SV4A 2YVSA 1WF2A 1N32J 2GQQA 4L73A 1K0TA 1OQ6A 2MY7A 1N5QA 1PO6A 2XULA 3EICA 3PX4A 3QJJA 1F9FA 4DL3A 2FPHX 5KG3A 4MH8A 1JWWA 4DWIA 3UN3A 3R2DJ 4F2RA 3JTPA 5CCMA 1TK0A 1Z2ZA 2BQ3A 3A8JA 2ROEA 3PX6A 4ZPWR 1S1VA 3DM2B 2UUBJ 2VC0A 1JKHA 1RTJA 3EGZA 4TQRA 2QEXS 1MN7A 3KK2B 1Q82T 2YQ0A 5KG5A 3OV7A 1C0TB 2BOPA 3FC9A 5CYMB 4JYAF 2YKPA 4NLOA 3BGLA 3JTOA 3H5XA 3ETOA 3KWMA 5BJRA 2UZAA 1SJFA 3T6JA 2F7VA 2B6AA 3DLGA 1Q7YT 1DZ5A 3UCGA 3FCWA 3J81U 1WDTA 3QT8A 1KTQA 1EKSA 4E0DA 1R0BG 2LQ9A 4DSJA 3RB3A 2RU9A 5GMEA 3UCUP 4QWDA 1H3DA 5HBMB 1D9DA 3PO5A 1RWNB 1RAHB 2ZWOA 2D7SA 2Q3PA 1DRZA 3EXCX 1ZTTA 2DB1A 2MSSA 1TAUA 1UVNA 1Q16B 2BE9B 5M2UA 3F44A 4USIA 5HL7Q 3VR1A 5JMNA 3V6JA 2KXHA 1NO8A 3M6XA 5AE1A 3PTWA 1XMQF 5K8MA 1N6QA 3C3LA 2BXJA 3JS9A 2W9CB 2J0QD 3RB0A 2E7VA 5D4OA 4O3SA 4LREA 4DX7A 5A0YA 3QO9A 4USKA 2QMUB 1V3SA 1RWOB 2NSBA 2N3OA 2MZQA 5D15A 1TQLA 5F9NA 4RR5A 2B4VA 1X31C 4FN5A 3RG6A 5J1EA 5FDLA 3BDEA 3N6MA 5HLFA 2OJ3A 2HWHA 3D54A 2HNYB 4M94A 4M8LA 4C11A 4YP3A 4YOEA 2NR0A 4ECZA 2B4PA 5L1LA 2QA4G 2JC1A 5HMXA 1YJ7A 2AJ4A 3HZEA 3CCVS 2D1CA 1RI7A 5HMYA 3I32A 3W61A 3ILJA 5KFMA 4FVCA 1JJCB 3CJ0A 3VCDA 3OVAA 1HQ2A 2FLPA 2KHDA 1YWXA 3D0HE 3I0RA 3EWGA 2WRMA 3EGNA 1R0AA 4TU8A 3W2WA 3BQ2A 4XAKA 2R7QA 2X51A 1PAUB 1YIJS 3R5CA 4M5IA 3PIPQ 3IWNC 2RKIB 5E3AA 2KO1A 3CUNA 1RT4B 1RABB 3CD5A 3ZZZA 2UUWA 2LECA 3RAXA 2HHUA 4B3SF 4KHRA 1Q0NA 4F4WA 3ENVA 3FSIA 4X4SA 3CCZA 3HHKA 4DV0J 4ED2A 2YNIB 2NSCA 1UEKA 4I6AA 2FZKB 2ZM6J 2D3ZA 1DLOB 4OZ3A 3KG1A 3QGGA 1HARA 4F67A 1HPZA 3MPUB 2MXYA 4FBUA 1MROB 2D9OA 4LF1A 1Q8IA 4K4WA 3SSRA 3LTOA 4C48A 4CLUA 2B9EA 5EX0A 2XGQA 3BR9A 3M2VA 3VAGA 4IRCA 2LU2A 4DPOA 3QFWA 3D0GE 5KFOA 2E1CA 1IBLJ 2FLOA 1F9EB 3P8BB 3C2PA 1FDDA 2V0NA 2ROGA 3GJQB 2OUGA 3KK1B 4ZKAA 3JSYA 2XWYA 3R1HA 4WWSA 3TNVA 1RKIA 2HVDA 1GFWB 2RRAA 2AJQA 2DHHA 3CXCR 5E33A 2DXFA 3CO9A 3SQOP 2KM8B 3OW2R 2W7OA 3KHRA 4LVOP 1LK7A 3I31A 4WZMA 3HJFA 4LUBA 4EK2A 5CZXA 4YB1P 2YH1A 1EETA 4HVZA 2IA0A 5K14B 3ZNUA 3OSPA 2FVCA 2RE1A 1X5PA 2O3DA 3G2XA 2FY8A 3H40A 4FVMA 1VRUB 2KRRA 4MKYA 1UZHA 4YY3J 1D9FA 1RT1B 1BC6A 1S1TB 2YNHB 4QYRA 3TVKA 4YB5A 3I5CA 3J7ZT 2IMOA 1N34J 2J9EA 3VVUA 2BQRA 2IPOB 2IYIA 1LWXA 4OI0A 5CYJA 2LA6A 3ICLA 3CJ5A 3HT0A 3IS9A 3HCXA 1RHUB 3EGWB 3ZC4A 1FVQA 5B0DA 1S9GA 2QJ3A 5A8KB 5DZ6A 1RT5B 4B9LA 2KZMA 3HHLB 4PEOA 3ZZPA 3VV2B 1TAQA 1CJKA 3MOJB 4P7TA 3DHWC 2ZC3A 3R27A 2DKOB 2VQEF 5DM7Q 3SIPB 3TZXA 3G8TA 2P2CB 4CNZA 5J1PA 4WXWA 2EFOA 4X4RA 2C2RA 2HYIB 1IR2A 3KYLA 3MFIA 4KGKA 1HD1A 2VH7A 3UD4P 2BX6A 2AEFA 3ZTQA 1NLKL 2YQ3A 3OD2A 1SL2A 4ELUA 5E3QA 3M30A 3OTBA 1KLMA 4NWBA 3WC0A 1H2TZ 4DFKA 3IXQA 1TL7A 5G0RB 5KFSA 5GAGU 5ETNA 3CJ3A 2C2EA 4A8XA 1FJ7A 2IVMA 1T9XA 4I2QA 2XSFA 5KAKA 5KFKA 1D8YA 3NGKA 3M8QB 3MAHA 1JLCA 2DEIA 2CJXB 4JI3F 3FCVA 2WVBA 4B3OB 4FBTA 2FVQA 3FQLA 2N7YA 4RJVA 1K1SA 3DFEA 3IBFB 2HFSA 2B56A 1WOSA 4OI6A 4DU8A 4DV3J 3V2UC 2IC3A 4LRDA 2IVYA
chains in the Genus database with same CATH topology
1UCNA 3PRVA 4DUTA 1NLKL 4ANEA 1NCLA 4W98A 4O0NA 3FKBA 4KPCA 3DKDA 1EHWA 1NDCA 3Q8UA 2DY9A 3FBEA 5IOLA 2AZ3A 4CP5A 3FBBA 1BE4A 3GPAA 3VGTA 3ZTPA 4ENOA 1F3FA 4UOGA 3VGVA 4WBFA 3B54A 3Q8YA 3ZTSA 3PJ9A 3NGRA 3R9LA 3ZTOA 3FBCA 3VVUA 3EM1A 1NB2A 2ZUAA 1JXVA 1KDNA 1LWXA 3EICA 1PKUA 1W7WA 1S59A 3EVMA 4UOFA 1LEOA 4F4AA 3EMTA 1HLWA 3MPDA 3B6BA 3EVOA 4HR2A 4UOHA 5CAAA 3L7UA 4FKXA 1U8WA 3NGUA 5BXIA 3VGSA 3NGTA 1BUXA 2B8QA 2HVDA 3DDIA 1WKLA 4S0MA 1NHKL 4DI6A 2DXFA 1K44A 3JS9A 2NCKL 3WX8A 1NSPA 1NSKL 3ELHA 3BBBA 1S5ZA 3FCVA 2CWKA 1NDLA 3NGSA 1XIQA 3BH6B 4ANCA 4ANDA 3Q86A 1WKJA 2DXEA 1HHQA 1WKKA 3EVWA 1XQIA 1MN7A 5CABA 2DYAA 5C7PA 1NDPA 4FKYA 2DXDA 4EK2A 2B8PA 3BH7B 3Q83A 1NUEA 3FC9A 3VVTA 1NPKA 3ENAA 3GP9A 1NSQA 1MN9A 3EE3A 1HIYA 1ZS6A 4C6AA 3BBFA 1B4SA 2HURA 4F36A 1S57A 3Q89A 1B99A 3ZTRA 1BHNA 1PAEX 3Q8VA 4DZ6A 3ETMA 3VGUA 1VYAA 2BEFA 2VU5A 3BBCA 3EJMA 1F6TA 3FBFA 2AZ1A 3G2XA 2BX6A 1NDKA 2HVEA 3ZTQA 3FCWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UCN A;  3PRV A;  4DUT A;  1NLK L;  4ANE A;  1NCL A;  4W98 A;  4O0N A;  3FKB A;  4KPC A;  3DKD A;  1EHW A;  1NDC A;  3Q8U A;  2DY9 A;  3FBE A;  5IOL A;  2AZ3 A;  4CP5 A;  3FBB A;  1BE4 A;  3GPA A;  3VGT A;  3ZTP A;  4ENO A;  1F3F A;  4UOG A;  3VGV A;  4WBF A;  3B54 A;  3Q8Y A;  3ZTS A;  3PJ9 A;  3NGR A;  3R9L A;  3ZTO A;  3FBC A;  3VVU A;  3EM1 A;  1NB2 A;  2ZUA A;  1JXV A;  1KDN A;  1LWX A;  3EIC A;  1PKU A;  1W7W A;  1S59 A;  3EVM A;  4UOF A;  1LEO A;  4F4A A;  3EMT A;  1HLW A;  3MPD A;  3B6B A;  3EVO A;  4HR2 A;  4UOH A;  5CAA A;  3L7U A;  4FKX A;  1U8W A;  3NGU A;  5BXI A;  3VGS A;  3NGT A;  1BUX A;  2B8Q A;  2HVD A;  3DDI A;  1WKL A;  4S0M A;  1NHK L;  4DI6 A;  2DXF A;  1K44 A;  3JS9 A;  2NCK L;  3WX8 A;  1NSP A;  1NSK L;  3ELH A;  3BBB A;  1S5Z A;  3FCV A;  2CWK A;  1NDL A;  3NGS A;  1XIQ A;  3BH6 B;  4ANC A;  4AND A;  3Q86 A;  1WKJ A;  2DXE A;  1HHQ A;  1WKK A;  3EVW A;  1XQI A;  1MN7 A;  5CAB A;  2DYA A;  5C7P A;  1NDP A;  4FKY A;  2DXD A;  4EK2 A;  2B8P A;  3BH7 B;  3Q83 A;  1NUE A;  3FC9 A;  3VVT A;  1NPK A;  3ENA A;  3GP9 A;  1NSQ A;  1MN9 A;  3EE3 A;  1HIY A;  1ZS6 A;  4C6A A;  3BBF A;  1B4S A;  2HUR A;  4F36 A;  1S57 A;  3Q89 A;  1B99 A;  3ZTR A;  1BHN A;  1PAE X;  3Q8V A;  4DZ6 A;  3ETM A;  3VGU A;  1VYA A;  2BEF A;  2VU5 A;  3BBC A;  3EJM A;  1F6T A;  3FBF A;  2AZ1 A;  3G2X A;  2BX6 A;  1NDK A;  2HVE A;  3ZTQ A;  3FCW A; 
#chains in the Genus database with same CATH topology
 3L95 X;  3RRK A;  2HND A;  1ZZF A;  3CCR S;  5IXU A;  4ZP9 A;  4L75 A;  4TLQ A;  3KOA A;  3DYA A;  2H4Y B;  4Q43 A;  1SL0 A;  2ZH1 A;  4J9M A;  4KFB A;  1ZOT A;  4RWW A;  3F41 A;  1U2C A;  1GXL A;  5EWG A;  2F9D A;  4OJH A;  2DNK A;  5A6W A;  2FVR A;  4DFM A;  1FKO B;  1X60 A;  2HRT A;  1YI2 S;  4WTY A;  2DNL A;  2MLZ A;  3I82 A;  1X9M A;  2MZS A;  1N36 F;  1OPZ A;  1Y11 A;  1LWE A;  4RW8 B;  1HBN B;  4CLT A;  2WSC C;  1RDR A;  3M32 A;  4LF8 F;  3H98 A;  2ZOG A;  1D09 B;  1RAA B;  3ZFV A;  2R3V A;  3QT6 A;  2RDD A;  5AXK A;  1S97 A;  4WF9 Q;  4DS5 A;  3T1H J;  3M8S A;  4I1T A;  3UI3 A;  2RNE A;  3DLK A;  5D78 A;  4RZR A;  4MIB A;  4BDP A;  2ZHO A;  2UUA J;  1H7X A;  2QV6 A;  2BAN A;  1N52 B;  2HZC A;  1JLG A;  5DM6 Q;  3MHY A;  3OT9 A;  3KMS A;  3DRP A;  3GIM A;  2RUG A;  3FZB A;  1RTI A;  2VOP A;  5IWA F;  3TAR A;  3RBE A;  2M70 A;  4WE1 A;  1DTQ A;  1MG7 A;  2AHO B;  4CTA A;  5KT7 A;  1VRT B;  2G0I A;  4FPR A;  1G4C A;  3OXF A;  4RW6 B;  5HVG A;  3HVT B;  2CDR B;  4C97 A;  2AYM A;  2Z2M A;  2ZBR A;  3C19 A;  4DEZ A;  4LSN B;  5B0G A;  4CT9 A;  4MAK A;  3Q2S C;  4ZVF A;  4WU3 A;  1C1C A;  3W5X A;  3IM9 A;  5E3C A;  5IV3 A;  2GIR A;  5KT2 A;  4QWB A;  4O3O A;  1T05 A;  5HP1 A;  2AKW B;  3P5B P;  1VQN S;  1WOR A;  3VGU A;  3NG8 A;  1VR6 A;  1RT3 B;  4NCB A;  1QVG R;  3ZZT A;  2OEJ A;  1JJH A;  4RWX A;  2FIU A;  2F5G A;  3AA8 A;  4J9O A;  4NZ0 A;  3ZTP A;  3SSQ A;  4X65 F;  3PJW A;  1NKE A;  1MW7 A;  4EEY A;  3UFC X;  3CJR A;  5EWF A;  4LRB A;  3DU5 A;  1U48 A;  3CCS S;  1VS3 A;  3H25 A;  3M8P A;  4UOH A;  4JI8 J;  2BJD A;  3LGM A;  4PG7 A;  2UVU A;  3PXG a;  2EEY A;  2WBR A;  4NLS A;  3CED A;  3A13 A;  3JQJ A;  1I5O B;  4DQP A;  2FJB B;  3M9O B;  2DR6 A;  4MYT A;  1JKH B;  1RTJ B;  3OTE A;  2CG4 A;  1XTZ A;  4ZCL A;  3H0P A;  1NDP A;  2GVZ A;  3NMA A;  1RSC A;  1H38 A;  4YS2 A;  1REV A;  3NCQ A;  3HM9 A;  3KTQ A;  4DN9 A;  2GHV C;  3VF0 B;  5JVH Q;  2DO0 A;  3CME S;  2H9Z A;  2B6A B;  1OQ3 A;  1U1P A;  3MED A;  4ZVO B;  1FRK A;  2P9E A;  1ZAX A;  1FNO A;  1I51 B;  4OLP A;  3IG1 A;  3MUV P;  2XI3 A;  1XER A;  3ZTO A;  2C3P A;  3DRS B;  1YLX A;  1WEL A;  1RB0 A;  3OTD A;  4NXM J;  5A6P A;  2V2V A;  5IZH A;  2LEP A;  4Y2M A;  5DET A;  3E3X A;  4KTQ A;  3P3D A;  3V4I B;  1B64 A;  4TU7 A;  2K06 A;  1ZA1 B;  2QO3 A;  1N6Q B;  1S1W B;  5CCL A;  3OJS A;  5A0Y B;  1UJ4 A;  3QO9 B;  3L09 A;  3KUE A;  3OXG A;  1SJR A;  2WON B;  1NK6 A;  5F9L A;  4LF4 F;  1B0V A;  1UET A;  4ZHR A;  4ED8 A;  2VPW B;  3G96 A;  4F3Q A;  5J1E B;  1TV6 A;  3T3F A;  3PYE A;  1SIZ A;  3HUL A;  3PRB A;  2O01 C;  3A8K A;  1N48 A;  1SH0 A;  4C11 B;  3LAL A;  1GMU A;  2HFZ A;  4MK7 A;  2FZC B;  1URR A;  2M8H A;  4G3I A;  3I9V 9;  2C22 A;  1T9T A;  3AJ1 A;  1ZM2 A;  4LIW A;  3HO1 A;  1KC8 T;  5ETQ A;  1A7G E;  3OPK A;  3EYZ A;  3OFF A;  3ENQ A;  2JEG A;  3OBI A;  1QE1 A;  4I6W A;  3W9J A;  4QIF A;  1HW9 A;  3RGI A;  4ETX A;  1FA0 A;  3I0R B;  2ROP A;  2BRK A;  5JVG Q;  1R0A B;  5L1J A;  1CC7 A;  3W2W B;  1ZM4 A;  2KN4 A;  4K2X A;  3KFW X;  2Q6B A;  4HL9 A;  4RL1 A;  4RU2 A;  1XNQ J;  1KLN A;  1S48 A;  5F41 A;  1VBY A;  2A2C A;  2R42 A;  4F02 A;  4CLK A;  2OLW A;  5J2M A;  1KFS A;  4OMF G;  4KHP J;  2KI2 A;  3B78 A;  2W25 A;  1D9A A;  3FRY A;  1ROF A;  2HRY A;  1DHM A;  4OJG A;  4RW7 B;  2IDL A;  3NAI A;  4ETZ A;  1FJE B;  4O4G A;  1S6O A;  1HPZ B;  2NZ4 A;  2FQQ B;  3LF0 A;  1FT8 A;  2BJ3 A;  2JSX A;  4ENO A;  1NKB A;  1P6T A;  1YSJ A;  3M2V B;  2LYV A;  5IS2 A;  5D3G A;  5L46 A;  3RUB L;  1KKH A;  4N47 A;  4WXO A;  4YHH J;  1KVJ A;  5IQ6 A;  4XDD A;  4J9K A;  1DY3 A;  3IR6 B;  1X0F A;  2VQF J;  1JLA B;  5F0W A;  4ZVT B;  1GH8 A;  1J5O A;  5HAN A;  3CB4 A;  2W24 A;  2YWK A;  1YG0 A;  3HVR A;  5HVF A;  3THT A;  1X9S A;  2QIF A;  2FC8 A;  5AE2 A;  2LCW A;  4L72 B;  4YEA A;  1RIS A;  2OPQ A;  3JSM A;  3U1M A;  2V4R A;  3CCU S;  1MMN A;  4U7U D;  2GMH A;  2YWG A;  1CVJ A;  1KON A;  2XWX A;  3JSR A;  5KFQ A;  4FYX B;  3UN2 A;  4N5S A;  2B0G A;  1EET B;  2QA1 A;  3W9H A;  4UQT A;  2JFK A;  5DDR C;  5ETV A;  3Q8R B;  1SB6 A;  3QGI A;  4C8M A;  1YJT A;  4L3N A;  3M6W A;  5IT4 A;  2IJR A;  1WTB A;  3DCA A;  3MWB A;  4JV5 J;  2N3L A;  2CG8 A;  1B70 B;  4C3K A;  2BUN A;  2YPY A;  3MM6 A;  5CYQ A;  3B54 A;  4X64 F;  4DR2 J;  1HBU A;  1FHT A;  3GJT B;  2PI5 A;  4MFB B;  4DLE A;  3I6P A;  1F3V A;  2RH3 A;  1JLF A;  3TUI C;  3IS9 B;  4DJB A;  2E7X A;  3G6Y A;  2AJ2 A;  2CWX A;  3QGP A;  3FFI B;  3OVB A;  1BUX A;  1C2P A;  2QA2 A;  2PEH A;  1RP5 A;  1S9G B;  1RWK B;  5E7O B;  1JNZ B;  4UQG A;  2DRD A;  2XCA A;  5LXR A;  3EPG A;  2KDO A;  2BAB A;  1E6V A;  3WQP A;  2QL5 B;  2DH7 A;  3VAM A;  2XMM A;  1RU2 A;  4OYB A;  3BPS P;  4KV8 A;  4EZ6 A;  2NQP A;  2O66 A;  3S1T A;  1O8B A;  4BS2 A;  4PXB A;  2I2Y A;  3FMB A;  5KG4 A;  2F1F A;  1NCL A;  1N88 A;  4NLY A;  2B9W A;  1FF2 A;  4CO3 A;  4PAB A;  3M30 B;  4R0E A;  1KLM B;  4PG6 A;  4JI4 J;  1VIS A;  2BM1 A;  2MKK A;  3G8S A;  3H59 A;  2N82 B;  2UXC J;  2GAH C;  4JI5 J;  3DLH A;  4QR0 A;  3DOK A;  3IBW A;  2DEJ A;  4O3R A;  3G82 A;  1TL1 A;  1N4L A;  5KT4 A;  1F1B B;  2OEK A;  2GMJ A;  8AT1 B;  1EAR A;  1JLC B;  2ZH4 A;  3BKT A;  4K4S A;  5KFX A;  3GFX A;  4C3M A;  4MYU A;  3PJX A;  1RT2 B;  4DV2 F;  4N41 A;  2LLZ A;  5H9E K;  4CH7 A;  3ZZY A;  3E51 A;  2OGU A;  4HDG A;  3TAP A;  3POT A;  3GWC A;  2VIH A;  3KKF A;  3OTC A;  1DQA A;  2EPI A;  4K4X A;  1GAO A;  2IC3 B;  3DOM A;  1YJW S;  1M5K C;  2V2K A;  2B51 A;  5DLF A;  4DL7 A;  5D0E A;  3NWR A;  2XHW A;  6FDR A;  3GMG A;  1P1L A;  5H9F K;  1BE4 A;  1Q86 T;  2QLJ B;  3DYA B;  1V3Z A;  2HRU A;  4A8M P;  2ZHA A;  1APS A;  4ZP8 A;  4CWB A;  2E1M C;  3OL9 A;  2DNM A;  2DIT A;  2XS7 A;  3FK4 A;  4CYU A;  1N5Y A;  3DDI A;  2B5J A;  1WHW A;  2R8G A;  3NNA A;  1UVJ A;  3H20 A;  2I5J A;  2W4P A;  4WJB A;  3D68 A;  3OTO J;  2NZC A;  2V68 A;  1LWE B;  4KH1 B;  3HJV A;  2ALZ A;  3HI9 A;  4ZVU B;  3M32 B;  2IM0 A;  1HIY A;  4C6A A;  2V8G A;  1T9W A;  1LFW A;  5F8N A;  3CDU A;  4NOH A;  2EBE A;  4IQM A;  1NDK A;  3DLK B;  3A1Y G;  1WC3 A;  4H4K C;  4URG A;  5AJ3 F;  1FXR A;  4KPC A;  1U24 A;  1JLG B;  3AY0 A;  2XY6 A;  3DRP B;  1RTH A;  3K8V A;  1RTI B;  2BW7 A;  4WE1 B;  4TY9 A;  1DTQ B;  5E5N A;  1FES A;  3MGJ A;  4EBC A;  4IR1 A;  3R6L B;  3MPY A;  3OL6 A;  4NPO A;  4K4Y A;  4DPY A;  4ICL B;  3KLG A;  1GQE A;  4LBP A;  3HSJ A;  5KFR A;  1VI7 A;  3PFO A;  3HKZ D;  4DR1 J;  4NML A;  2HBY B;  1C1C B;  4LR8 A;  2A18 A;  3N4W A;  5FLX Y;  3MEG B;  1TTH B;  4DCO B;  4LVN P;  3Q23 A;  4KO0 B;  2C2N A;  2NS1 B;  1TL3 A;  4A8Q A;  1T05 B;  5HP1 B;  2FHJ D;  5LSO A;  1F6T A;  4A8W A;  4A8S A;  3AB2 B;  1N5T A;  1TUG B;  2OHD A;  2GCF A;  1LW0 B;  1NZ8 A;  4JI7 J;  2EK6 A;  3CIM A;  3TI0 A;  1VBZ A;  4LIR A;  3WIU A;  1M5O C;  2VG5 B;  2ZH8 A;  4IQX A;  3FJ2 A;  1CUL A;  2ZEJ A;  5D4P A;  2W9B B;  4IH7 A;  4X4T A;  3O44 A;  5K5M A;  2YNG A;  2OFH X;  3GJR B;  1AYE A;  4DN0 A;  2UXD J;  4ID8 A;  3I55 S;  3IM8 A;  2R8K A;  4V19 J;  4CQ1 A;  3M8P B;  4GKJ F;  2ZZT A;  3H4D A;  4E8U A;  1QVF R;  5ETK A;  4WK3 A;  4NYO A;  5I42 A;  1QTN B;  2ZHB A;  4CLS A;  2BE2 A;  3JB9 k;  1OO0 B;  4DR5 J;  2BKP A;  1HI1 A;  2E9R X;  3TX8 A;  1Q8L A;  3G6E S;  4DL4 A;  2GVZ B;  4HTJ A;  2VAS A;  2GAG C;  2JJ4 D;  1WG5 A;  1JMT A;  4MK8 A;  1Q8K A;  1S76 D;  1REV B;  1S1X A;  4P2F A;  1B99 A;  2GML A;  4G1Q A;  5EX3 A;  4CO2 A;  4RNN A;  4DR3 F;  5KFA A;  1F0X A;  2HHP A;  2DO4 A;  3SBM A;  3RW7 A;  3T5J A;  3CMQ A;  4J5O A;  3MED B;  3CDW A;  1NXI A;  4IOB A;  1GX6 A;  2CIM A;  1UFK A;  3THP A;  4BHQ A;  1FKP A;  3IG1 B;  3MR5 A;  2AU0 A;  4K4U A;  3NWG A;  2C1E B;  2V6A A;  2V69 A;  2PFD A;  1FE4 A;  2VDH A;  2PT0 A;  1U1L A;  2G0J A;  4HI1 A;  1WJ9 A;  1NHV A;  2GQ2 A;  2K3K A;  2J76 E;  3M6V A;  4A8O A;  3FCH A;  4Y2K A;  4PQU B;  2AJ1 A;  2JNJ A;  3BBB A;  4DX6 A;  1MWZ A;  2PDA A;  5DDQ C;  3CC2 S;  5HJX A;  2Y8W A;  2CKW A;  2CPX A;  3P96 A;  5DG8 A;  4LF9 J;  1T3O A;  3BM7 A;  2JLE A;  3V81 A;  2X1F A;  4DPT A;  3HT3 A;  4X84 A;  2I9S A;  3BN7 A;  4ZHR B;  2Y3Y A;  4AQY J;  5C2C A;  1TV6 B;  2VU5 A;  3EZU A;  3WHI A;  2AEJ A;  2ZKT A;  2XZD B;  3UR0 A;  1UCN A;  3CDA A;  4LQ3 A;  3AOA A;  3LOU A;  4WFB Q;  1HA1 A;  3HFZ B;  2MLY A;  1HNV A;  3FSX A;  2YX4 A;  3FBC A;  4QBU A;  4LFC J;  2PI4 A;  2GVD B;  1FFG B;  2VFV A;  3EVO A;  2KFY A;  4QIE A;  2M7S A;  3NGT A;  4HLB A;  4MMO A;  3ZZU A;  3EGV A;  2MGZ B;  2ASY A;  2JOQ A;  2P9G A;  3SEO A;  5KFG A;  1OYE A;  3BH6 B;  2L41 A;  3DGP A;  2DYA A;  1M1K T;  2HHH J;  4DV5 J;  1T3N A;  4BLG A;  1VIO A;  2D3U A;  2E5J A;  5LMU J;  5DDP C;  2ZH3 A;  1GTH A;  2RS8 A;  3G8Q A;  1XEZ A;  3TJ9 A;  4RBU A;  2XMU A;  4YUD A;  5KG1 A;  3UO0 A;  2UU9 F;  2MYF A;  2RIJ A;  1FWL A;  4J9R A;  3RRG A;  1XMO J;  4DUZ J;  4AD6 A;  1IWA A;  4X4Q A;  1WHX A;  4O4G B;  1RAD B;  4CLF A;  3I4H X;  3CCQ S;  1SV5 B;  1S77 D;  1SQF A;  3AAW B;  1KFD A;  4XIU A;  1S1U B;  3LP2 A;  3A4T A;  2HHT A;  3N6L A;  4ER8 A;  3MCM A;  2AJF E;  2HVI A;  1IM6 A;  5EHH A;  2IM1 A;  1FKA F;  4DV7 F;  2B7B B;  7FD1 A;  3DHX A;  5F0U A;  4RW9 A;  3GCX P;  2MKH A;  5J2Q A;  2V2Q A;  2MEW A;  2CWK A;  1UPP A;  3AH6 A;  1AZS B;  3PHE A;  1SJ1 A;  1RTZ A;  3IP0 A;  3UNG C;  1WTF A;  4RBT A;  2W9A A;  4PUO B;  1C1B B;  2HS3 A;  2QN6 B;  2FHK A;  3TA0 A;  3JSM B;  4OZJ A;  1M5V C;  3DLJ A;  1LNQ A;  3Q8Q B;  1OY6 A;  4Y00 A;  2HS0 A;  1NSQ A;  2DNY A;  1RLC L;  2DNR A;  2I8E A;  2MJN A;  3KHG A;  2DVI A;  3C14 A;  5CHC B;  3BBC A;  5KG2 A;  3FEZ A;  2BRL A;  5DQG A;  2AV5 A;  5ETP A;  2CQ4 A;  1N36 J;  3OQ2 A;  3M2R A;  5HMW A;  5IQQ A;  3WBZ A;  3DRR A;  2E5L J;  3M6U A;  2OMO A;  2QT7 A;  2M4M A;  4CP5 A;  2KHC A;  4M5J A;  3MM6 B;  2CNO B;  3ITH A;  4LF2 A;  4J90 A;  3MM5 A;  1HBU B;  1RT7 A;  4I64 A;  2XO6 A;  5C24 A;  4J37 A;  3K5P A;  3PHT A;  2VBW A;  3MUT P;  4H4M A;  3BQ1 A;  3AOC A;  2BJE A;  4WTO B;  1JJ2 R;  1NME B;  1JLF B;  1AXQ A;  1Y3J A;  2BBE A;  1QUV A;  4P73 A;  2MQL A;  1C4A A;  1G2E A;  1NBE B;  2XMV A;  3OR1 A;  1AT1 B;  2KM8 C;  1N5V A;  1U1N A;  2WW8 A;  5DG9 A;  2GJF A;  1TR0 A;  3NS7 B;  2M2B A;  2P6T A;  2IRY A;  2EC2 A;  4HDH A;  5GMK a;  3HHN B;  2DXD A;  1DQ9 A;  1TKZ A;  4UW2 A;  1S0M A;  3VAI A;  3MM9 A;  1ZPW X;  1X7V A;  3R3T A;  4PPD A;  3BZQ A;  2ZH2 A;  3PG9 A;  3BB5 A;  5KFD A;  3M05 A;  4ED1 A;  2RJZ A;  2AX1 A;  5EWE A;  3JQK A;  2VKZ G;  3GIJ A;  4JI0 J;  3IR5 B;  3HKW A;  2R2R A;  5ETO A;  3FKB A;  4ALZ A;  4LFA J;  3MAQ A;  3P5T L;  2DHX A;  2DNG A;  4GVL A;  3G6X A;  2FHJ A;  4P6Q A;  1MWQ A;  2GX8 A;  3JAM Y;  1RUS A;  4IO1 A;  2R2U A;  3GTY X;  4DZD A;  4E2F B;  2LEB A;  2R8H A;  3DOK B;  2KVQ E;  4DSE A;  3AD9 C;  3JSB A;  1U02 A;  1V9O A;  1BY9 A;  3KLH A;  2CVI A;  3HHL C;  3JQM A;  3G82 B;  4U8Y A;  1TL1 B;  4WK1 A;  2I6W A;  4P2M A;  3UD5 A;  5KFJ A;  2KXN B;  2XYG B;  3DMJ A;  1NSP A;  4IOA Q;  1MML A;  2MHE A;  2RRN A;  3ISN D;  4ZOS A;  1CSJ A;  3R5A A;  1X4G A;  3RBD A;  4BWM A;  4ED7 A;  1ZA2 B;  3W3S A;  3TA1 A;  2CPY A;  4FF4 A;  2ZJR Q;  3ZNJ 1;  4ZVG A;  2DIU A;  4TY8 A;  1SKR A;  3THV A;  3EE3 A;  2MB0 B;  5LOQ A;  1VIX A;  1U1O A;  2HGN A;  3POT B;  3ETM A;  5DJB A;  3I5A A;  3HHE A;  2DR7 A;  1BXN A;  7AT1 B;  2F65 A;  1VQP S;  3DDK A;  3P6Y C;  3NGD A;  1HHT P;  4KGX B;  3DOM B;  2C2K B;  2QMX A;  1NDC A;  4LSL B;  2ACM A;  1Z4U A;  4HT5 A;  3BSN A;  1HNW J;  3LPE A;  3PR4 A;  1JJ4 A;  3RW6 A;  1NHU A;  4CLP A;  2M0G B;  2O5D A;  1VQ5 S;  5GAD U;  2XO7 A;  1CQN A;  3D67 A;  2HK2 A;  2POK A;  5BYR A;  2R7T A;  1J5E F;  2JHE A;  2AQ4 A;  2H5I B;  1LWC B;  1UEV A;  3T5H A;  4V1A k;  2L08 A;  4BWJ A;  4KE5 A;  4CYU B;  5HRO A;  4M5M A;  1N5Y B;  2PC6 A;  2B5J B;  1QJH A;  2XYP B;  5KFT A;  4JB8 B;  2D3O R;  3Q86 A;  1SIW B;  2I5J B;  2G2Z A;  1FDA A;  1IBC B;  4WYL A;  3HX9 A;  2UVW A;  2YQ1 A;  1CC8 A;  1P9Q C;  4FYD A;  1L3U A;  4NLG A;  5KFY A;  5HSP A;  4MIA A;  4CZC A;  2ZDP A;  2NRE A;  4U9R A;  5ETS A;  2HFV A;  2RT3 A;  3TX0 A;  3TOQ A;  2ERR A;  2C42 A;  4DF8 A;  3KLF B;  3NXZ A;  3K7R A;  2FGO A;  1TL4 A;  3HVA A;  2VG7 B;  2VV5 A;  1FTR A;  3M9N B;  1HWI A;  5IOL A;  5DRK A;  3PYF A;  1NRK A;  4DV4 F;  2ILY A;  1RTH B;  1EP4 B;  5HQM A;  2CXE A;  4B3T F;  4YQW A;  3O3L A;  5LJ3 Y;  1VK3 A;  2KT3 A;  2RF2 B;  3BSA A;  4HHH A;  3QRQ A;  4PR6 A;  3RR8 A;  2RS2 A;  1O5J A;  1AA1 B;  4NAS A;  1N54 B;  3BSO A;  3MXH P;  2GHW A;  4DQQ A;  4NXN J;  3HSZ A;  2DIV A;  2Q1L A;  3KLG B;  3BYR A;  1NK0 A;  2E7W A;  4IFV A;  2CJA A;  4QR1 A;  1IBK F;  3IAM 9;  3FDS A;  1R8P A;  1T11 A;  4B3R F;  2D9P A;  1TL3 B;  2V9K A;  4ZVE A;  1T03 A;  4ZCM A;  4DPX A;  3D6H B;  1YBU A;  1SUQ A;  4O0N A;  3KHH A;  2EFQ A;  2HWT A;  4DSF A;  5BR8 J;  4OLO A;  2GGP B;  2L3M A;  2GJ2 A;  1EB0 A;  1YBA A;  2OSQ A;  2XEX A;  3NBP A;  4ZPT R;  1SJQ A;  2GJI A;  2V8H A;  2YNG B;  4YB7 A;  4PAA A;  3PCO B;  1YJR A;  4UST A;  2UUB F;  3NY0 A;  2ZD1 A;  5M2R A;  2EC0 A;  2OPR B;  5RUB A;  3LAK A;  2B4U A;  4CIO A;  1R7I A;  1YZ6 A;  1PJ5 A;  4DPW A;  2DGW A;  4LF6 F;  4KR0 B;  3MCS A;  2JWN A;  1JQG A;  5I42 B;  2C3U A;  2N4C A;  2JLF A;  3UD3 P;  1EX8 A;  1RBO B;  1NPK A;  2AYG A;  3DLE A;  1ZS6 A;  1S7I A;  5D0G A;  2E44 A;  2Q6C A;  1S1X B;  1NH8 A;  4C8L A;  5I4M A;  1RHK B;  4G1Q B;  5AXN A;  4DSI A;  3D1O A;  1GEH A;  4DL6 A;  2ZFH A;  2V5H G;  4DR7 J;  1ARO P;  1X4F A;  3TZZ A;  1SKS A;  1N33 J;  1M0S A;  4FYV B;  4J9V A;  4PXC A;  3UE2 A;  4ZPV R;  1FKP B;  2D74 B;  1HR0 J;  4OI2 A;  3VAL A;  5D4L A;  4OYA A;  4Q44 A;  2W7P A;  1RAF B;  2LQJ A;  4QYZ J;  2BJ7 A;  1QY7 A;  2YNF B;  3SQG A;  3DC2 A;  2R4F A;  3OFE A;  1WKL A;  4IUF A;  1FNM A;  1KEK A;  1H0H B;  4ILL A;  1UP1 A;  4W92 B;  1XK8 A;  2VFS A;  3MZI A;  1Q81 T;  4X64 J;  5ETM A;  4X62 F;  3JYT A;  2R8I A;  2DCU B;  3C6T A;  5HQL A;  4USJ C;  1RAO A;  3D6T B;  1SC1 B;  2DH8 A;  4LT6 A;  1S4E A;  3EJM A;  2ZBP A;  2VDI A;  3WIV A;  4J9U E;  4Y0F A;  4JUZ A;  4I6Y A;  4OI3 A;  3WZ0 A;  1X4D A;  4NA2 A;  3FEX B;  4QQB A;  1DUR A;  3WX4 A;  2ZNY A;  4WFX A;  3DLL Q;  5KFC A;  1HNV B;  2BDP A;  4DL5 A;  4AE5 A;  1J2V A;  5LJ5 Y;  3ZO7 A;  4RW4 A;  4Q0B B;  4HYK A;  4CLW A;  2LDY A;  2XNQ A;  3CW2 C;  5HK4 A;  1GMV A;  1XJW B;  3I56 S;  4ECY A;  4DV0 F;  2XY7 A;  2FVS A;  1VDH A;  4FP9 A;  3OXL A;  3OL7 A;  2CPD A;  3DGP B;  1I94 F;  2MHN A;  2ZM6 F;  1HYS B;  1WAC A;  4MJK A;  2J7U A;  3NCR A;  3DI6 A;  2LP4 A;  4ZVS B;  4OJ1 A;  3H4B A;  2VG6 A;  2W2O P;  1VBX A;  2XS2 A;  2DTJ A;  4K4Z A;  4C4W A;  2QYG A;  2XCP A;  3ISZ A;  1UVI A;  1FWP A;  2HBZ B;  3EX7 B;  1HKA A;  3BKU A;  3K8W A;  4EZ9 A;  2Z57 B;  5HAO A;  4K5R A;  2WVD A;  2COL A;  3W8G A;  4F50 A;  3LP2 B;  2CA9 A;  4RNF A;  1VQM S;  2Y8Y A;  4CI0 B;  3O6Q A;  1TFY A;  1DTT A;  2HWI A;  1U1R A;  2V8P A;  1H2U X;  4USV A;  5EUH A;  2EI5 A;  2DGU A;  2X7I A;  4WYW A;  3QAE A;  2MKI A;  1SCJ B;  1LQ9 A;  2DGX A;  1OY9 A;  2GIF A;  2XC9 A;  3T5K A;  3IFE A;  4QWA A;  4F4Y A;  1VQ9 S;  2V4J A;  1SXL A;  3BGU A;  4OZ2 A;  2HFN A;  5IT9 U;  2RAQ A;  5GAH I;  2HAI A;  1XWL A;  5E3P A;  1Q7L B;  1OSD A;  3C14 B;  3CIZ A;  1O0P A;  1N34 F;  2CZ9 A;  4DCP B;  4ANE A;  4F25 A;  3SDE A;  2R9L A;  3D5M A;  1BMQ B;  4C98 A;  3M2R B;  4RKU C;  4ELV A;  2NPF A;  2FYX A;  1CJU A;  3BRE A;  3VGT A;  2KFZ A;  3AOB A;  2HHX A;  5CD4 H;  3TVZ A;  5F8J A;  1LKZ A;  2R2S A;  3ITH B;  1G1X A;  2UUT A;  3Q8P B;  3MM5 B;  2Y0B B;  1RT7 B;  2RU3 A;  5C24 B;  2PE8 A;  4JI1 J;  4H4M B;  3AT1 B;  4FYY B;  1JIH A;  4KGV B;  2MZ1 A;  2HLT A;  1GMW A;  2AJ0 A;  4LBH A;  4KT0 C;  1U0H B;  2NXN A;  4C8O A;  5AJ3 J;  2OTL S;  2DR8 A;  3OR1 B;  1HBO A;  1S0V A;  2IAJ A;  1KS2 A;  1FRJ A;  1HI8 A;  2WSE C;  5K9F A;  2YX1 A;  1PIL A;  3UR3 C;  1WC6 A;  2QRR A;  4PG4 A;  3MD1 A;  4M5N A;  1TKZ B;  4ED0 A;  1UFL A;  2V2Z A;  3MM9 B;  4DV6 J;  3W62 A;  1X4B A;  3KK3 B;  3M8W A;  1C4C A;  1QLN A;  3Q8V A;  3MMA A;  4EI2 A;  3N5F A;  2DR5 A;  3FBF A;  1NJY A;  2Y1I A;  2BM0 A;  2ZE2 A;  2PFF B;  1PJ6 A;  3BEG B;  2CJQ A;  5CQG A;  2PII A;  4IG0 A;  1K47 A;  3L4B C;  1P1T A;  3QIP A;  1H2V Z;  1PBA A;  2ZH7 A;  1S7H A;  1RTD A;  5F3Z A;  1EAY C;  2OML A;  3TEG A;  3E01 B;  4WBF A;  1G7C B;  1X4H A;  2QL7 B;  3K5N A;  1NB2 A;  3GYX B;  4HT7 A;  2VKR A;  5E0O A;  1LWF A;  4QWC A;  3QPI A;  4O3Q A;  1TKT A;  1BQM A;  4NYP A;  2BMB A;  5FII A;  3MPV A;  4L76 A;  4J9Q A;  5F3T A;  1PG5 B;  3SV3 A;  3KLH B;  4M1K A;  4ZCI A;  4R0J A;  1GTE A;  2O67 A;  2CJY B;  1QDU B;  3DMJ B;  4GO7 X;  2PSZ A;  3IWL A;  1S10 A;  2EFP A;  5AE3 A;  2DRB A;  4EUV A;  4K59 A;  2XMJ A;  2XMW A;  3QAU A;  2HG4 A;  1CBK A;  1UW4 A;  2X3D A;  3CJ4 A;  1L3T A;  2LQ5 A;  4KQZ A;  4DU7 A;  4ZK7 M;  3QRP A;  2HIY A;  2B9Y A;  2XMA A;  3BBF A;  2DGQ A;  2HVH A;  5KFU A;  1VK8 A;  4CLZ A;  1F5A A;  9RUB A;  3K5M A;  4ZPB A;  2B7C B;  3EPI A;  3EZ5 A;  1UWB B;  1Q53 A;  2CPF A;  4PG5 A;  2LXI A;  1R6V A;  1Y10 A;  5K8O A;  3LQV A;  1EKR A;  2PMZ D;  1NK5 A;  3W63 A;  2Z56 B;  2NUU G;  1AFJ A;  4C0B A;  4XO0 A;  4RUA A;  1PC4 A;  1PKU A;  3U1L A;  5D0H A;  4PWU A;  2UUC J;  3CSK A;  1WOO A;  1RA7 A;  2AX0 A;  2RSQ A;  2NLW A;  4OI1 A;  3PAC A;  1GX5 A;  3KNG A;  2H3E B;  3R5D A;  4F0M A;  3MEC A;  1VJQ A;  3J7A N;  3MMB A;  2NCK L;  2LDI A;  3HP6 A;  1GK8 A;  5HRO B;  1FJG F;  1H98 A;  1XIQ A;  1PBU A;  2XSJ A;  3IBC B;  4RUC A;  2DGV A;  4QR2 A;  2DJW A;  5JXS A;  1WHV A;  2RQK A;  4KGM A;  5I3U A;  2B9X A;  4DPU A;  4F8R A;  4IG3 A;  4Y2C A;  4K0K J;  5HVH A;  2UUA F;  4OX7 A;  5L9X A;  2HUR A;  2HQC A;  1FRL A;  2EW9 A;  2R7O A;  4QPT A;  2W4D A;  2ZNZ A;  2YKN A;  1VQO S;  1KSP A;  5KFW A;  3J81 Y;  2JEF A;  4CRJ A;  3KJN B;  3Q2T C;  5ADZ A;  4F04 B;  4M5K A;  1G3O A;  1KDN A;  2LKZ A;  1S99 A;  1KRP A;  2HEK A;  3MPD A;  3CC7 S;  2K3I A;  3C6U A;  2KL8 A;  2WVE A;  5BXI A;  2A2D A;  3Q22 A;  5CH7 B;  2N7C A;  2MZJ A;  2CNN B;  4JV1 A;  3LA0 A;  4W4M A;  2E5H A;  1GXU A;  2E29 A;  2NYI A;  3CT9 A;  3TRG A;  1WWH A;  1WKJ A;  3ILO A;  4DQI A;  5LM7 E;  2G13 A;  5D4N A;  3M8R A;  1Q5Y A;  3E8O A;  1FD2 A;  3BV8 A;  3W5Z A;  2RKI A;  2AF6 A;  1UL3 A;  3UVJ A;  4IFV B;  4K4V A;  5HMZ A;  2Q66 A;  1PAE X;  3O8W A;  2XGP A;  2JC0 A;  1T03 B;  4LF7 J;  3GII A;  4J7C A;  3FSY A;  1SUQ B;  4Z2X A;  1S72 S;  1D8Z A;  2HHW A;  1UMJ A;  3A12 A;  4JI8 F;  3RBZ A;  5B0C A;  4UF4 A;  3NBP B;  2FGC A;  5KFB A;  2A6M A;  5KFN A;  3HXM A;  4X4V A;  4OYW A;  1IKX A;  4HR2 A;  2UU9 J;  4NLU A;  5CAA A;  4FNH A;  4AYB D;  4DLG A;  1LOU A;  4URQ U;  4RO0 A;  2WVC A;  1N8R T;  2CJB A;  2MQO A;  2QTW A;  4L3K A;  3VAK A;  5L1K A;  4LF5 J;  4ECR A;  3FEY B;  2J0S D;  3NGS A;  1RHQ B;  5JUM A;  3IN5 A;  4ZPC A;  1V6H A;  2F4V F;  4B9S A;  2EG2 A;  2FJW A;  2C3M A;  1CJV A;  2MMY A;  3RU0 A;  2ZC4 A;  1NJW A;  2OPP A;  3QZ8 A;  3MR6 A;  4DV7 J;  1YK9 A;  5FD1 A;  2YX7 A;  5LT5 A;  1IJF B;  3PRV A;  2NPI A;  1U45 A;  3R5B A;  3MDF A;  3US5 A;  1OIA A;  5IM0 A;  5A2Q U;  4OYI A;  5F8G A;  1HL6 A;  3AQP A;  3H2V E;  4J9L A;  1TK5 A;  3QWP A;  4UOG A;  4XTT A;  2FLL A;  1YVF A;  1VRU A;  5EGY A;  1R43 A;  4KBI A;  3M4X A;  1RYR A;  1RAG B;  3UDL A;  4XDC A;  2MQN A;  2J9D E;  5A8W A;  1PYT A;  3EUN A;  2AP6 A;  1YIT S;  2M88 A;  2IBO A;  4ZLP A;  3PIO Q;  1HQU A;  2QMW A;  1DFD A;  1FEE A;  3ELH A;  4TXS A;  1NDL A;  5J2N A;  4DDF A;  2ZBC A;  3BS9 A;  1BD6 A;  2VC1 A;  3X1L B;  1QM9 A;  4OV1 A;  1OWX A;  4EO8 A;  4NCG B;  4DXL A;  2PO4 A;  3JYT B;  4NI2 A;  3QNW B;  1IWG A;  4DL0 C;  3PDN A;  4JI2 F;  2ASL A;  1S0O A;  3C6T B;  3TQE A;  1WI8 A;  3HLU A;  5ETL A;  1VHI A;  2X3G A;  2I0X A;  3RAQ A;  4WP3 A;  2XMT A;  1KP6 A;  2GQC A;  2R7W A;  1WC1 A;  3ZXW A;  3R5G A;  5H1S V;  3T41 A;  1TMM A;  1ZM9 A;  2YPZ A;  4KYZ A;  2E66 A;  4NLX A;  5C2G A;  2MTL A;  2JDJ A;  2L9N A;  3SZ2 A;  4OX9 J;  4B9M A;  3EDR B;  1XBW A;  5KTQ A;  4QWE A;  4LMZ A;  4P10 A;  5A8R A;  1XNQ F;  1FD8 A;  3GB0 A;  3VGS A;  4GVB A;  4KRW A;  4F2S A;  1HNI A;  1ZYQ A;  5G0R A;  2BE7 D;  1X5T A;  1HNX F;  4ES1 A;  2AGQ A;  3PRD A;  4GO5 X;  1HHQ A;  1WKK A;  3VZI A;  2J6S A;  3CJS A;  2VOO A;  2ASJ A;  1Z2L A;  2F40 A;  1ZET A;  1IM4 A;  5D0R A;  3CGI A;  1PYO B;  2HLU A;  3DI6 B;  4DS4 A;  1FX2 A;  1ZBT A;  1WUU A;  4CDI A;  2VG6 B;  3MUR P;  2PN6 A;  3SCL E;  1YJN S;  2H65 B;  2QSW A;  4Y3C A;  3IGV A;  2G4B A;  3LAM A;  2AT1 B;  4YHH F;  4ED6 A;  1UKU A;  4NEZ A;  2VQF F;  3PEH A;  1U26 A;  3EM1 A;  2DPJ A;  1T9U A;  4HI2 A;  2AYB A;  2CQG A;  1F60 B;  1UW9 A;  1NB7 A;  1MWY A;  1Y5N B;  1S1V B;  2HQF A;  1HLW A;  2NXE A;  2XQC A;  2DNZ A;  2QC3 A;  3UDC A;  3KJF B;  2H5J B;  1DTT B;  3PEJ A;  1VLO A;  5AXL A;  2DK2 A;  1HNZ J;  5BYS A;  3QZ7 A;  1PJ7 A;  4NZ6 A;  3GV7 B;  3R7N B;  1M90 T;  2BZ2 A;  3VTI A;  1U1Q A;  3TUP A;  3U02 A;  1UJ5 A;  2X1G A;  3RR7 A;  2LVW A;  1XQI A;  3W60 A;  3PVX A;  4IYQ A;  1F2H A;  4OYM A;  4Y2I A;  4DV1 J;  3ULH A;  3DLG B;  2MDA A;  1R31 A;  1KNZ A;  2V4J B;  3GON A;  1F9H A;  1WSV A;  3N5B A;  3MR2 A;  2RB7 A;  1H72 C;  2KFN A;  2HQ3 A;  3AJD A;  2OP5 A;  4WP8 A;  2C2O B;  4DR2 F;  3CC4 S;  3AJ2 A;  3B8H A;  2KXF A;  2JX2 A;  3QT7 A;  4LRC A;  5GAD I;  4NLV A;  1P8G A;  2MKS A;  2VFR A;  4QU6 A;  1CJU B;  3SMZ A;  2FDN A;  3L7O A;  3H42 A;  2XB2 D;  3R5J B;  5HN0 A;  4WKR A;  8ATC B;  2CNK B;  2GNK A;  3NLC A;  1S12 A;  4X4U A;  2MKC A;  3AD8 C;  1UPM B;  1O6X A;  2HBR B;  4AT1 B;  2CQP A;  1ZPV A;  2WSF C;  1ITP A;  5J2P A;  4MT1 A;  5FDL B;  2MJU A;  2IAJ B;  1VRT A;  3BO3 A;  2KJV A;  5HLF B;  4ZS6 A;  4HTI A;  4UUW A;  2YBV A;  4DV4 J;  4FDF A;  1HMV A;  3VQT A;  1FRI A;  3ET6 A;  4CT8 A;  4B3T J;  4ERD A;  4KHM A;  1OYD A;  3F56 A;  2HVZ A;  1FCA A;  1U25 A;  3IRX A;  4CH0 S;  2BW2 A;  3D0I E;  4WFZ A;  2F63 A;  1VFJ A;  1BHN A;  3B4M A;  4G1P A;  2FTR A;  3MMA B;  1UA0 A;  4JI4 F;  2ZE2 B;  2RQ4 A;  4ECT A;  2UXC F;  4JI5 F;  4P71 A;  4IG0 B;  3H5U A;  5KFE A;  3QIP B;  1X9W A;  1FWK A;  4D3H A;  1RT6 A;  1RTD B;  4ZLN A;  4E98 A;  3VAJ A;  4Q2M A;  2B4O A;  5GMD A;  2V63 A;  4U96 A;  3ADA C;  3G9C A;  1B7F A;  2KH9 A;  5ETT A;  1SC6 A;  4B3R J;  3R7B B;  2IHR 1;  1TKT B;  1GNK A;  1BQM B;  4ZVH A;  1U8W A;  3NGU A;  4MK9 A;  1VQ4 S;  5C5J A;  1YTY A;  1CJT A;  4YR0 A;  1NHK L;  4M5D A;  2KRB A;  2G0C A;  2D41 A;  3NOG A;  1RZM A;  1PCA A;  3MCO A;  5U47 A;  3CO0 P;  3MR7 A;  2L9D A;  5LSR A;  2HGM A;  4BBY A;  2B8P A;  4X4P A;  2HQG A;  2IVF B;  2QSF A;  1IKY A;  1U2R A;  3KNA A;  4FPI A;  1NU4 A;  1JLB A;  3DDN A;  3GP9 A;  2XLI A;  2FUG 9;  4FF3 A;  1ZAV A;  1TK8 A;  2VBX A;  2R8J A;  4NLT A;  4LF6 J;  4M5L A;  1QAX A;  4OJ3 A;  4QU7 A;  4NE9 C;  4PQA A;  3GG1 A;  2WBM A;  2W1B A;  2E9Z A;  4UZC A;  1Q5V A;  2YKA A;  1XNR J;  3RAM A;  2W2N P;  3WC2 A;  1S59 A;  4B9U A;  3K89 A;  3QRR A;  4F4A A;  3ZZ0 A;  5FJ4 A;  1NPP A;  1T0T V;  4LRF A;  2HHQ A;  3OTO F;  4JI6 F;  3DRS A;  2FJA B;  4AXI A;  1RYS A;  4S0M A;  3PR5 B;  4IOC Q;  4ZJL A;  1SKU B;  3M1V A;  3MEC B;  5LMN J;  3MMB B;  2RHQ B;  4C0H A;  2ZBI A;  1B7Y B;  1CPZ A;  3QSY B;  1L5U A;  2XSJ B;  4JV2 A;  4ECQ A;  3V4I A;  3T1A A;  2QX0 A;  3KLE A;  4B3M J;  5I3U B;  4C8K A;  4OHY A;  3NCP A;  1S1W A;  4OHZ A;  4IG3 B;  4JP8 A;  1FI4 A;  2GFF A;  3GU0 A;  2WB1 D;  3TJ8 A;  5T14 A;  3HMJ G;  3N28 A;  5DQH A;  1SC4 B;  3K17 A;  2WON A;  4A8Y A;  3ZZO A;  2MKJ A;  4WU2 A;  4Q2L A;  1RAI B;  1K9M T;  3NS6 A;  2UP1 A;  1HWK A;  5E3R A;  2DY9 A;  1X5O A;  2NXC A;  1SJ4 P;  3AD7 C;  2YKN B;  5B0B A;  4X62 J;  3OJU A;  4ECX A;  2GV1 A;  1RAC B;  4LR9 A;  1RQ0 A;  3X3U A;  4RNM A;  4FS1 A;  1HD0 A;  2DNH A;  4FZV A;  4YME A;  3S8S A;  4F4Z A;  1IBM J;  3EVM A;  4UOF A;  5KT3 A;  2ZBQ A;  3CD0 A;  1CJK B;  3TZW A;  1H74 A;  1WG1 A;  4PG8 A;  1YX2 A;  1ELO A;  4GC7 A;  3C6U B;  4AUK A;  4DR1 F;  4YB6 A;  4BCA A;  5I3P A;  4NLP A;  1WC4 A;  5MAO A;  1UA1 A;  4Y2A A;  3GIL A;  3I9Z A;  4YDD B;  1ICE B;  4EBD A;  5J1N A;  2EBG A;  1U6B A;  1NK8 A;  4RNH A;  4WFA Q;  4DR4 F;  1S4F A;  3D3C J;  3AB4 B;  3B82 A;  4QW9 A;  4I7F A;  5C7P A;  1KR4 A;  4LR7 A;  3C16 A;  4OX8 A;  4WPA A;  2VJU A;  4DG1 A;  1X4C A;  2J8A A;  3HD1 A;  3UVJ B;  2JEI A;  2IMW P;  4IO9 Q;  2VOD A;  1REG X;  3QJL A;  4JI7 F;  2XTJ P;  4GKK J;  1R8B A;  2VHG A;  5DG7 A;  4Y34 A;  2AWZ A;  2LU1 A;  1VQ7 S;  3MM7 A;  1TL7 B;  5JJB A;  1OS5 A;  2F4F A;  4ZMM A;  2Z30 B;  2J5A A;  2UXB F;  4GC6 A;  1I94 J;  3H8Y A;  2UXD F;  2OKQ A;  2H54 B;  3DNC A;  4R25 A;  4I2Q B;  4RW7 A;  3CNQ P;  2ZJP Q;  3CD7 A;  3QLH A;  4DHV A;  2R7R A;  4X66 J;  4OI4 A;  3QAT A;  3PYG A;  1TP7 A;  2ZOF A;  2E5I A;  1IKX B;  4DR5 F;  3BR8 A;  2VBY A;  2K8G A;  3GV5 B;  1Y5L B;  3E2E A;  2CJ9 A;  1KQK A;  2VPZ B;  5F8M A;  2KB2 A;  2VD3 A;  4QW8 A;  1RWM B;  4I69 A;  3D28 A;  2CQI A;  4ZJQ A;  1JLA A;  2M3D A;  4ZIV A;  1RWX B;  4AL5 A;  1TKX A;  3HSG A;  1YRX A;  3I96 A;  2QL9 B;  1OPI A;  2SXL A;  2QE5 A;  5GAH U;  1CJV B;  3SFG A;  3AOD A;  2HND B;  2PEB A;  5KFF A;  2HPU A;  4XK8 C;  4FNI A;  4H4O A;  2OPP B;  5DO2 A;  2V94 A;  1Y9O A;  3ZTR A;  2WVF A;  3G4S S;  4A8F A;  2DNQ A;  2UV8 A;  4JYA J;  4QOT A;  3K5O A;  2RUS A;  4KFB B;  3GLJ A;  3SI8 A;  3GFZ A;  5IM0 B;  2RQC A;  4WFY A;  3H2L A;  1TFW A;  2XBP A;  3PKM A;  4TVA B;  2BJ1 A;  3G87 A;  3IRW P;  3ZTS A;  4PXE A;  1OJ4 A;  1WI6 A;  2MY8 A;  4DL2 A;  2ZWP A;  4HAC A;  3BN4 A;  4ZIW A;  3D4J A;  5A8W B;  1V3R A;  4K7Q A;  5B0A A;  4MFB A;  4QZV B;  3KMQ A;  1R8A A;  4OZ5 A;  4FF2 A;  4LF9 F;  2V8V A;  1HQU B;  3KDN A;  4ZP7 A;  5D6G A;  3QQC D;  3NAH A;  4HHU A;  5J2N B;  1XMQ J;  4AQY F;  1X8D A;  3FFI A;  2ZVI A;  3D66 A;  3KDO A;  5LSL A;  1WEX A;  4CO5 A;  1YQH A;  5I3Q A;  4ZVR B;  1NKC A;  4ZJO A;  3PYD A;  1IVZ A;  2BAN B;  3B4D A;  1U6Z A;  5DLG A;  1VQ6 S;  5B7W A;  1YGY A;  4NI2 B;  1S6P A;  3DLB A;  3TYT A;  3OL8 A;  1RBL A;  1KQG B;  1NAQ A;  2CUY A;  4KIA A;  1KOH A;  4QIV A;  4LFC F;  4DFJ A;  1JK9 B;  3R6G B;  4UOC A;  5G4D A;  4GMK A;  4ILR A;  4CTA B;  3FBB A;  2IA6 A;  3BYP A;  4WP9 A;  3QID A;  3LGN A;  3VGV A;  1U0S A;  3HDS A;  4HEA 9;  1AUD A;  4EYI B;  5F8L A;  1RAJ A;  3A8I A;  4G6V B;  2R7S A;  1AFI A;  2IIH A;  2EFN A;  5A8R B;  4EU0 A;  2HHH F;  4GVB B;  4DV5 F;  4KKO A;  3NKY A;  5LMU F;  1Y7P A;  1HNI B;  3N6N A;  1JXL A;  1U49 A;  4JV0 A;  2YWF A;  2E1R A;  2OI2 A;  2QLW A;  5L39 A;  3SCJ E;  3BGO P;  2FHO B;  4QCL A;  4JOU A;  2DBB A;  2YWW A;  4NRU A;  1XMO F;  4DUZ F;  4R8U A;  1SQG A;  1P9Y A;  1ACM B;  4B3S J;  3H7H B;  1RT2 A;  1SL1 A;  3K0J A;  3S6E A;  1RBA A;  1LK5 A;  4IFY A;  2VFU A;  2VFT A;  3I87 A;  4WIQ A;  3DU6 A;  3CCW A;  3N01 A;  2WB4 A;  2CQH A;  3TAN A;  2ATL A;  4Y28 C;  2VB6 A;  4G1I A;  1U8S A;  4U7U K;  5CA5 A;  1Y5I B;  1VLY A;  3IGN A;  2CZV C;  1WSR A;  1SBR A;  2AGP A;  3SCI E;  3D7S B;  3NS5 A;  3K58 A;  2ACY A;  1IQT A;  2QLB B;  3AXM A;  3VAH A;  1VMB A;  3UWT A;  5T7L A;  2IYG A;  1RCO B;  3CDE A;  4WZQ A;  5LL6 d;  1RWW B;  4BC7 A;  5IT0 A;  5D8H B;  3HD2 A;  1VRQ C;  3I4P A;  2ADB A;  1IKW A;  5IC6 B;  3J81 j;  1PGZ A;  3HZG A;  1K73 T;  4ECU A;  4DQR A;  1E6Y A;  3PFE A;  4O44 A;  1S79 A;  3PY8 A;  1TVR A;  2E5L F;  1RJJ A;  2IJF A;  1EJ7 L;  2G1D A;  1HHS A;  1F2G A;  4FYW B;  3KUG A;  4UY8 5;  1SH3 A;  1FJG J;  4ID5 A;  3CWJ A;  4LQ9 A;  9ATC B;  2EFG A;  1TL5 A;  3CVK A;  2FVP A;  4PZV A;  1I6J A;  3QT5 A;  3ZZR A;  3W2V A;  1I3O B;  3BSC A;  3AA9 A;  2PD1 A;  2KYZ A;  1DJ0 A;  3CCJ S;  3BGF A;  3TA2 A;  4LFB F;  4DSL A;  2OTJ S;  3DRX A;  1K0V A;  2RD5 C;  4NEY A;  4P74 A;  2ZKU A;  5J2P B;  2ZDO A;  1VBK A;  3KJV A;  1PC5 A;  4KC5 A;  2DXE A;  3T1Y F;  1Q95 G;  3BO2 A;  1W25 A;  1HWJ A;  1MLA A;  3U27 A;  2MKY A;  1HMV B;  3R2C J;  4ICL A;  3ET6 B;  4Q7A A;  4JI0 F;  3KJQ B;  2PMH A;  2BA9 A;  3IRX B;  2VQE J;  5E41 A;  4LFA F;  2CNL B;  1L3V A;  3LGH A;  2WK4 A;  3P49 B;  2KT5 A;  4P72 A;  4ZVP B;  3MEG A;  2DHA A;  2C2M B;  2BOA A;  1U47 A;  1M5S A;  2D69 A;  2ZZN A;  4W98 A;  4KO0 A;  2YWH A;  1QE1 B;  3OLB A;  3CCL S;  2OD4 A;  3N9U C;  4XPE A;  4DUY F;  1WNE A;  3GPA A;  2P5V A;  1HQE A;  1UFW A;  2H48 B;  2JL9 A;  1LW0 A;  1RT6 B;  1WC5 A;  2DH9 A;  3IA0 A;  3RTV A;  3GG0 A;  2DPI A;  3FNN A;  2VG5 A;  3MD3 A;  1PIE A;  5KOX A;  1UAW A;  4FXD A;  2W9B A;  2IJN A;  3EDQ B;  1KVK A;  1HWU A;  1YBT A;  1HBM A;  1I1G A;  1NK4 A;  5J2M B;  1CJT B;  4RUH A;  3OHA A;  4M5D B;  2HS4 A;  5L8R C;  1CS4 A;  3D6M B;  1IXK A;  2Y1L B;  5KFH A;  3RRH A;  2CRL A;  3M8Z A;  4JI3 J;  2GHP A;  4ZPD A;  1V5V A;  2J7W A;  1FVS A;  1K8A T;  1FRH A;  3UDV A;  1IKY B;  2KU7 A;  1JLB B;  1HNW F;  2YTC A;  3FZ2 A;  3RYL A;  1BWV A;  4B17 A;  4B9T A;  1NND A;  4I0W A;  2VZ9 A;  4OL8 A;  4NLW A;  2RDJ A;  5D3G B;  1M5H A;  1ZAW A;  3DRY A;  2UV8 G;  1SI9 A;  5KT6 A;  1UVK A;  2HK3 A;  2NXU A;  2F4V J;  4PPZ A;  5E2Q A;  4URS A;  1J5O B;  4ZIT A;  2GS8 A;  4F4K A;  5L1I A;  3Q0A A;  3LP0 A;  1EQ0 A;  1N5S A;  4M63 A;  3GR1 A;  5KT5 A;  4OZL A;  1TUW A;  3HF5 A;  3UNY A;  2Y1R I;  1UTA A;  4DFP A;  2IRU A;  4DCJ B;  3R7S B;  2OPQ B;  1CQM A;  2J7K A;  2FJD B;  2PA8 D;  1U2F A;  2M52 A;  3M1V B;  2BKO A;  4C2M A;  4C8Z A;  2W8K A;  4H54 A;  4PQU A;  2Z58 B;  4CNY A;  3G86 A;  3KLE B;  3GQC A;  4PYD A;  3QWU A;  5IV4 A;  3MI7 X;  1FJC A;  4LF8 J;  2RIL A;  4CH1 A;  5CYQ B;  2RHS B;  3DGV A;  3ILL A;  4EWT A;  2FD2 A;  1A6L A;  2BR0 A;  1SQE A;  3T9Z A;  5HI7 A;  4HH0 A;  2GO9 A;  2HQD A;  2KG0 A;  2CQ3 A;  2J9D A;  2WTF A;  2QFI A;  2QYC A;  2RML A;  4Z37 A;  3LO3 A;  2PMW A;  3L3C A;  1X0P A;  2HBQ B;  5K8P A;  4P9S A;  3C46 A;  4N76 A;  4JI2 J;  1MU2 A;  2VPX B;  1RU1 A;  2R7U A;  4NXN F;  5IWA J;  6FD1 A;  3W65 A;  3L7U A;  2CPZ A;  5B0F A;  1E6V B;  2GVD A;  3J7A 1;  3F0N A;  4DR6 F;  5HJY A;  3LW5 C;  3CDB A;  1NPR A;  2XLK A;  3HPO A;  1NK7 A;  1YHQ S;  3Q8S B;  2RQM A;  1S9E A;  3CD6 S;  3UW1 A;  3GYN A;  2VON A;  4KV8 B;  3JTN A;  3KLV A;  3RBX A;  3CMA S;  5A76 A;  4DSK A;  2DD8 S;  3MMJ A;  4I7F B;  3QSI A;  2MGZ A;  1RCX B;  5GAE U;  6AT1 B;  3C16 B;  3HK2 A;  4DG1 B;  1YJU A;  2AD9 A;  4Q8F A;  1NSA A;  2CPE A;  1B4S A;  2KTQ A;  4IKA A;  4OV6 A;  4O4R A;  4A47 A;  4XPC A;  2FC9 A;  5BR8 F;  3V6D A;  1VQ8 S;  4TU9 A;  3A8E A;  1HNX J;  1ZTW A;  3W64 A;  2Z2L A;  1QAJ A;  1WD6 A;  4W90 B;  3MM7 B;  4HH1 A;  2C28 A;  2LA4 A;  4WKY A;  3PW4 A;  5LXY A;  3VHQ A;  1QSL A;  2A1B A;  3QLH B;  3MEK A;  1WG4 A;  4KAI A;  1TEL A;  3GIK A;  3PX0 A;  1SV5 A;  4X65 J;  1JX4 A;  1KWM A;  5AT1 B;  2EFV A;  1C0U A;  1S1U A;  1T7P A;  3MEE A;  1VQS A;  3IMQ J;  2J8S A;  2X1B A;  3QBC A;  3I5B A;  1BQN A;  2F9J A;  1DAR A;  1HW8 A;  5KFP A;  2A10 A;  2IDE A;  4KGZ B;  5D77 A;  4CLY A;  3WDO A;  4C9D A;  2W2Q P;  1HI0 P;  1TKX B;  2I1R A;  3PV8 A;  2W2P P;  2W2M P;  2DNP A;  1MN9 A;  1TUV A;  4OQJ A;  1V5I B;  1AZS A;  3BQ0 A;  4F36 A;  2BQU A;  4OZ1 A;  3M7V A;  3Q89 A;  4DR7 F;  4PUO A;  4H4O B;  4NLR A;  1C1B A;  3DXS X;  3FGV A;  1T9V A;  4ZLJ A;  4G65 A;  3FMW A;  1P27 B;  1N33 F;  1RA6 A;  4ED4 A;  1QAY A;  4P75 A;  2A6O A;  3RZA A;  2F8M A;  4M5H A;  4USW A;  5L9N A;  4O3N A;  1HR0 F;  2VA3 A;  4U6P A;  2XS5 A;  4QPX A;  4OHV A;  2UVR A;  3Q8Y A;  3OUY A;  3BO4 A;  1Q8B A;  3NEK A;  5GVQ A;  3OFG A;  2NYH A;  1WOP A;  4C8Y A;  3H2U B;  2YKM A;  2ZZM A;  1YDL A;  3KG4 A;  2HQI A;  1BWE A;  4CM0 A;  1JLQ A;  4HAC B;  4X4O A;  1RKJ A;  3PZP A;  3SXL A;  3QFH A;  3MF5 A;  2A0F B;  3V6K A;  2CDQ A;  1WEZ A;  5FLX U;  3LWM A;  1X5S A;  3GFY A;  1DAX A;  2JVR A;  2VPY B;  4TN2 A;  4O0I A;  2DNO A;  3RB4 A;  3TAM A;  3SYZ A;  3Q83 A;  1XR7 A;  4ECW A;  4JBC A;  1WDD A;  2L48 A;  2ASD A;  1GMW D;  4LF4 J;  3J7Y I;  1S6P B;  1NZA A;  3TR5 A;  3CJQ A;  2Q79 A;  4V19 X;  4EGL A;  1LFP A;  3GSD A;  2W4C A;  3TQ1 A;  1VOM A;  3LPY A;  3CJK A;  4PKD B;  1N0V C;  2FJV A;  2E5G A;  2CVE A;  2HGL A;  2BJ9 A;  4FF1 A;  1ULR A;  4LRA A;  2Z2Z A;  4Z7Y A;  3MR3 A;  3C15 A;  3MTK A;  4ZN3 A;  1FXD A;  4KKO B;  2LXF A;  1CEZ A;  4YR2 A;  2H1Y A;  3AXK A;  4CM2 A;  1K1Q A;  3UPF A;  2OEL A;  1N32 F;  3LH2 S;  2ADC A;  2G2Y A;  3PW5 A;  3ENA A;  4ZLL A;  4R8U B;  1IKV A;  2WHO A;  2OH2 A;  4P52 A;  1SVD A;  4PCQ A;  1QTM A;  4QIG A;  1VYA A;  3CTR A;  2VF3 A;  3CCM S;  3PW7 A;  2IY5 B;  1CUL B;  2MQ8 A;  1Q78 A;  1KBR A;  3IR7 B;  4IFY B;  1FK9 A;  4OHX A;  2ZIT A;  2CAD A;  1EHW A;  5HQ8 A;  2WOM A;  4PYA A;  4Z7C A;  1RXO B;  4U8V A;  1F3F A;  1OSC A;  5SUH A;  3GV8 B;  2M8D B;  4F3O A;  4U7C A;  2CZ4 A;  3CJ8 A;  5IFM A;  4LSL A;  2BAC A;  5H9E J;  2ZH6 A;  4Q45 A;  4PWD A;  1KTV A;  1IN0 A;  4X2B A;  2AMC B;  2KYX A;  4K50 A;  1R8H A;  2BE2 B;  1R27 B;  1SKW A;  2Z0G A;  3F73 A;  3OHB A;  2DGT A;  1QSS A;  4UUX A;  3TVY A;  3U1N A;  2J0X A;  5T7L B;  1XN9 A;  1HFE L;  2HIQ A;  1LWC A;  4Q8E A;  3U7J A;  4FKY A;  1IKW B;  5H9F J;  4ECV A;  1WEY A;  2Z2Y B;  3VAF A;  4RX6 A;  2BYC A;  5F8H A;  4QYZ K;  3GCW P;  2Z8Q A;  1MSW D;  3ISN C;  1Z1Z A;  1E6Y B;  2F3J A;  3D1H A;  4JI6 J;  4O44 B;  2W7A A;  2VA2 A;  2AEM A;  1TVR B;  2VUG A;  4OX6 A;  4I67 A;  3KUH A;  2C3O A;  2K7J A;  4UY8 T;  1L3S A;  4ID5 B;  1VGY A;  2XHC A;  3QMQ A;  4JI1 F;  2J6T A;  3KLF A;  1YKW A;  3LP1 A;  2ZH5 A;  2KG1 A;  2G2O A;  1WC0 A;  1JXV A;  3W2V B;  2VG7 A;  4LJM A;  1RHM B;  2NXJ A;  2CQC A;  2ILZ A;  3AQO A;  5MLC V;  1EP4 A;  4YDX A;  2FZG B;  3DOL A;  3T5L A;  1Q4R A;  4CO0 A;  3V81 B;  3PNI A;  4J91 A;  1PYS B;  4J9S A;  1L3K A;  2RF2 A;  4OYP A;  4CCH A;  3KJV B;  2IFX A;  1IJE B;  4DV6 F;  5CAB A;  2K2P A;  2XZW A;  3FVY A;  4RUB A;  3L7P A;  3UCZ P;  1T9Y A;  1Y4Z B;  3OR2 A;  3A3N B;  1U09 A;  2OD6 A;  2WAQ D;  2ZJQ Q;  3MMC A;  3TZY A;  4DQS A;  2BEF A;  1R8C A;  4IH6 A;  2FY1 A;  5EN1 A;  3VQS A;  2RDI A;  2R7V A;  4IH5 A;  5DDO C;  4YN3 B;  4F0K A;  3PW2 A;  4DR4 J;  3D2W A;  2P9C A;  3S01 A;  2LFV A;  3NGR A;  3K5L A;  4OZN A;  1HQE B;  2KT2 A;  4MKB A;  1RHR B;  2GC8 A;  2DHG A;  3HFV A;  3A3P B;  3UQS A;  3OSN A;  4TYA A;  3SCK E;  1QUP A;  1YJ9 S;  1A9N B;  2GGP A;  1T94 A;  5KFL A;  1NJZ A;  2MST A;  4ATN A;  2E1A A;  2YH0 A;  4OYZ A;  2KKH A;  4LSZ B;  2VIC A;  4DOZ A;  2EKY A;  3I0S A;  1S5Z A;  4J9N A;  1HBM B;  1WF1 A;  2UXB J;  2YKQ A;  2KVI A;  4I68 A;  2CPH A;  1H7W A;  3GR0 A;  2OPR A;  1CS4 B;  2FLN A;  3BGR A;  2AIR B;  2GZO A;  4A4J A;  4FS2 A;  2ATC B;  1S6Q A;  3HHD A;  4P2X A;  1IBL F;  2HKE A;  2GIQ A;  4F4X A;  1R89 A;  3MM8 A;  4DV2 J;  3LAN A;  1ZZN A;  3TW0 A;  4TYB A;  2NUH A;  3KXD A;  3MAA A;  2DY1 A;  4H4K A;  2ZOM A;  5BYQ A;  3BDP A;  3FBE A;  1YZ7 A;  3ENW A;  2UUC F;  4AFF A;  4ELT A;  4NMX A;  3BF4 A;  1LW2 A;  3QGH A;  1IUJ A;  4RW9 B;  3R1L A;  5J2Q B;  2I38 A;  3LP0 B;  4DMZ A;  3KHL A;  4USM A;  3FQK A;  2EKN A;  2XI2 A;  4C3L A;  2HAF A;  2C2D A;  1JLE A;  4I2P A;  3RB6 A;  4B9N A;  1S9F A;  3T6B A;  4YY3 F;  4K0K F;  2YNF A;  4TKT A;  2OPS A;  3GE9 A;  1H73 A;  3KLI A;  1JNR B;  3FRZ A;  4NA1 A;  3O5T B;  4K5S A;  2XZT B;  4IDK A;  3W9I A;  3DRR B;  2ALY B;  3R8Y A;  3PM9 A;  5ITH A;  1UVM A;  2XNR A;  2HMI A;  3CUL A;  3M2U A;  3JAM U;  4IR9 A;  1KHV A;  1Q1K A;  4KSE B;  5C25 A;  1RE1 B;  2M9K A;  3IO1 A;  2EXU A;  2HZV A;  2UVV A;  2F8E X;  2ABY A;  4U67 Q;  3H90 A;  1M1G A;  3HHL D;  1VQK S;  4WFN Q;  1FTC A;  1IR1 A;  2ZH9 A;  1FFW B;  1TKD A;  2J9C A;  4EO6 A;  1MU2 B;  2F8H A;  2OSR A;  5C42 A;  4HKQ A;  5K20 B;  1AB8 A;  1VHF A;  2PGC A;  1RAE B;  1K44 A;  4Q0B A;  1KHW A;  1X4A A;  3JXO A;  3EXY A;  4RBV A;  1KN6 A;  4Q5V A;  1UVL A;  3MOZ A;  3EVW A;  2HNZ A;  3GZ7 A;  3SSS A;  1S9E B;  1XR6 A;  4C8N A;  1BGX T;  2Y0S D;  2U1A A;  1DQ8 A;  2CQD A;  3D1Q A;  4R5P A;  5KFV A;  1X4E A;  3BH7 B;  1OY8 A;  3O1L A;  5B0E A;  3V4M A;  4NA3 A;  1U6F A;  4BC9 A;  2XMK A;  2BV3 A;  4LF7 F;  4USU A;  4LBI A;  4DBQ A;  3V6H A;  3AFG A;  1HYS A;  3EZO A;  2DRA A;  5KG6 A;  2JVO A;  3OVS A;  2DGS A;  4ILM A;  3CJ2 A;  1GXT A;  3V6D B;  1W26 A;  2K1R A;  4OZ0 A;  1SPB P;  1HWL A;  4K8R A;  1F5C A;  5K8N A;  4B9V A;  1KVI A;  4ES3 A;  2HSE B;  3T9N A;  1T8E A;  3M9M B;  2CJK A;  1EZZ B;  4LF5 F;  3R97 A;  4DV3 F;  4FKX A;  5GAG I;  1W2I A;  1JXE A;  1FDN A;  1U7L A;  3TAQ A;  1C0U B;  3RJM B;  2J0W A;  3DM2 A;  3MEE B;  1FER A;  3PKY A;  4TY8 B;  1BQN B;  3KK2 A;  1C0T A;  3NRB A;  4GKJ J;  1UJ6 A;  1RLD A;  4M5G A;  1M1H A;  3TJA A;  5CYM A;  4KJI A;  2H4W B;  4N8O A;  4Y65 A;  3MFH A;  4ZVQ B;  4EFA C;  2G9O A;  4OYX A;  1UEU A;  1U4B A;  3TO8 A;  1KD1 T;  4ZA1 A;  1Y0H A;  2APO A;  4N7T A;  3PW0 A;  3D6F B;  3SFU A;  1AW0 A;  2W8L A;  1W2B R;  4N77 A;  3IAS 9;  4DX8 H;  4L6V 3;  2HW3 A;  3Q8U A;  2QG9 B;  5HBM A;  4DR3 J;  3MCN A;  4P7V A;  2Z4P A;  1FRX A;  2DHS A;  1RWU A;  2OO4 A;  3OUY B;  4ED3 A;  3MTJ A;  1IR0 A;  3EMT A;  2LQB A;  2YKM B;  3B6B A;  3T1H F;  1YJV A;  2DR9 A;  1JLQ B;  2W9C A;  2EK1 A;  3NOC A;  4A48 A;  1TU0 B;  2LXU A;  2Y1J A;  1SH2 A;  3TWZ A;  1LV5 A;  2IM2 A;  2A3J A;  1U0H A;  2V4Q A;  2XG8 A;  3ILI A;  1OMS A;  2JLG A;  1NUE A;  4EMD A;  3VVT A;  3TAM B;  2BVZ A;  3NP5 A;  2XLJ A;  2IRX A;  4LFB J;  2H51 B;  8RUC A;  1H6K X;  3UN5 A;  2JEJ A;  2HHV A;  1S57 A;  2HNY A;  2EWH A;  1D0E A;  2AGO A;  2KZZ A;  1Y3K A;  2HVE A;  5IT9 Y;  2OEM A;  4DUT A;  1VQY A;  4C7Q A;  4ITS A;  2RVJ A;  3KK3 A;  3DKD A;  1LXN A;  4YR3 A;  1VC0 A;  4ES2 A;  3T1Y J;  4OX9 F;  3HSD A;  5KFZ A;  3NL0 A;  1KOO A;  5KG7 A;  1NM2 A;  1FXL A;  3CJK B;  1R0C B;  2R2T A;  7FDR A;  3KG0 A;  2BKN A;  2YKO A;  2XY5 A;  2DIS A;  3E01 A;  3G71 S;  4DF4 A;  1BQX A;  1T95 A;  4DI6 A;  3C15 B;  3WX8 A;  1RT4 A;  2U2F A;  4M95 A;  2FJX A;  2GW8 A;  1B3T A;  3CPW R;  1A0O B;  4DUY J;  4AND A;  3BPD A;  1FNX H;  2KJW A;  2VBZ A;  1FDB A;  2MZT A;  5DQI A;  2MQM A;  1SC3 B;  3W1Y C;  3BJY A;  1M5P C;  1FEH A;  2YNI A;  2E9T A;  3IWX A;  5THW A;  3TUJ C;  5HAT A;  3Q24 A;  5IC4 B;  2ZVS A;  2FB0 A;  2FHM A;  2EG1 A;  4B08 A;  4MKV A;  3D9B A;  1ZH5 A;  3BKF A;  1J27 A;  1DLO A;  1IKV B;  4DZ6 A;  2XYH B;  1S49 A;  1G6B A;  4OFZ A;  2AZ1 A;  3S7R A;  3PO4 A;  1N0U A;  1MRO A;  2V50 A;  4D3G A;  4RLE A;  1KQS R;  2C2Z B;  1DBD A;  2QLF B;  1FK9 B;  2Q43 A;  5ETR A;  2WOM B;  3GYG A;  2ZD1 B;  3PJ9 A;  3CCE S;  5CZV A;  1UWB A;  3D3B J;  4KPY A;  2HFO A;  4OHW A;  1HNZ F;  4X4N A;  2WCX A;  2X1A A;  3KK1 A;  3W66 A;  4PWD B;  2CQ2 A;  5SZT A;  2BJ8 A;  1T02 A;  4NRT A;  2LQ8 A;  5DGA A;  4OYO A;  1D3W A;  4K4T A;  2LEA A;  4DV1 F;  2L9W A;  1VC5 A;  1NSK L;  5CXT A;  3DLE B;  4TLR A;  1B0T A;  5DZ7 A;  3GSI A;  4F26 A;  3J80 U;  4N56 A;  3C8Y A;  3LUY A;  4F3M A;  2HZA A;  4PRF A;  2DGO A;  4TQS A;  3P45 B;  1MMD A;  1RWP B;  5K14 A;  4NXM F;  3CE8 A;  4PWW A;  1SJ3 P;  3GIR A;  3NNH A;  3O2I A;  4NYZ A;  4L74 A;  3V5R A;  2CAJ A;  2J6U A;  1RT1 A;  2IBK A;  5AXM A;  2P8I A;  1S1T A;  2YNH A;  3MUM P;  2M5Y A;  1XMB A;  3J7Z 5;  2D3O 1;  1QSY A;  2AYE A;  4I4B A;  4MTP A;  3IC1 A;  4O23 A;  4O3P A;  4ZP6 A;  3SQG B;  1KQF B;  5L38 A;  3LP1 B;  2DNN A;  4IRK A;  1RGV A;  1JB0 C;  3ONQ A;  1Y00 A;  2CPI A;  2V8D A;  3G6V A;  5A8K A;  1RT5 A;  3QYY A;  1U1K A;  3HHL A;  2EVZ A;  1VC6 A;  2HFU A;  3GFH A;  3DOL B;  1NH7 A;  2YY3 A;  4FXV A;  2AW0 A;  3H5S A;  3M8Y A;  1GT8 A;  3GJS B;  4PXD A;  2C3Y A;  1LXJ A;  4WCE Q;  1IQZ A;  2VL1 A;  5F8I A;  5KG0 A;  1CLF A;  2CFX A;  2V34 A;  1TZ0 A;  2FJE B;  3C66 A;  3OR2 B;  2IM3 A;  3MMC B;  2QGF B;  3TUZ C;  3DN9 A;  4DR6 J;  4NZ7 A;  1RHJ B;  1BLU A;  5DGB A;  5B08 A;  4MIW A;  2V9W A;  2XM3 A;  4ZPA A;  5DS7 A;  2H5E A;  3QJP A;  1S0N A;  1D1U A;  3LWL A;  4RW4 B;  3OFH A;  1FX4 A;  2AZ3 A;  2CQ0 A;  2DT9 A;  4RNO A;  5M2P A;  1VCT A;  3K2Y A;  1XC9 A;  4KHP F;  4UTG A;  4CLL A;  1FE0 A;  3UDE A;  4AL7 A;  2B43 A;  4ED5 A;  2WZ1 A;  3M8Q A;  2V67 A;  4ZCK A;  4K2J A;  5KOW A;  2YWE A;  4IRD A;  2CQB A;  1R3N A;  1CG2 A;  2GO8 A;  2QFJ A;  2OFG X;  4B3O A;  4ZDN A;  5GAE I;  3I0S B;  1MNE A;  4AL6 A;  2VJV A;  2JRS A;  5B09 A;  1R6Y A;  3TEH B;  2O1P A;  3BGR B;  2RRB A;  3VWS A;  4QIW D;  1PSD A;  4J9P A;  1AUS L;  1S6U A;  1S6Q B;  2K7K A;  1NK9 A;  4B02 A;  1VJW A;  4KH0 B;  2MZR A;  3MM8 B;  4USH A;  4DX5 A;  4A8K A;  1Q79 A;  4FXW A;  1WHY A;  4ECS A;  4C0O C;  5CD4 A;  1UZD A;  1XNR F;  5T41 A;  3MAA B;  4UT4 A;  1N56 A;  4GRS A;  2MLX A;  1RK8 A;  1NJX A;  4KB7 A;  1VQL S;  3R9L A;  2HHS A;  3DXB A;  3A3O B;  2N4D A;  2ZUA A;  2WW4 A;  1B0P A;  1LW2 B;  1NEE A;  4YFU A;  1WF0 A;  3FUY A;  5LMN F;  2JZ5 A;  4NLQ A;  3N79 A;  1NJI T;  3MPW A;  1FKO A;  1FO1 A;  1UWA A;  3OLA A;  1EIY B;  4AXJ A;  2B8Q A;  3W5Y A;  2PA3 A;  4F7V A;  3K59 A;  2B3T B;  4B3M F;  1JLE B;  4I2P B;  3NMR A;  1FRM A;  1TMJ A;  3VZH A;  4TNO A;  3CCT A;  4JV5 F;  4RW8 A;  1J5E J;  1HBN A;  1QAI A;  1XR5 A;  2W01 A;  2QLX A;  3TP2 A;  4WII A;  1F5B A;  2YXL A;  1QD1 A;  2OPS B;  3KLI B;  3NNC A;  3AHP A;  4NLD A;  1O51 A;  3SDE B;  4IDK B;  3J7Y U;  4EYH B;  2OIH A;  2DCL A;  4NX9 A;  4NL5 A;  4UZB A;  3HFK A;  4NCG A;  2R7X A;  1YRU A;  2HMI B;  4QJV A;  2MPU A;  3M2U B;  3CF5 Q;  2Y9H A;  4EBE A;  3J80 Y;  1IBM F;  3L9Z A;  5C25 B;  4N8N A;  1ZM3 A;  3H5Y A;  4OIX A;  3K57 A;  3CJT A;  5A2Q Y;  2JFD A;  2CQ1 A;  1HBO B;  1W7W A;  2CPJ A;  3N0V A;  1LEO A;  4P2S A;  2G1H A;  2JH3 A;  4RW6 A;  1YRT A;  4HHJ A;  2OAU A;  2CYY A;  5C42 B;  5EDW A;  3HVT A;  4Y6I A;  2P6S A;  5KFI A;  2GA7 A;  4LSN A;  4NCA A;  1U1M A;  3HVW A;  4F0H A;  1RWV B;  4RU9 A;  4ANC A;  1FFS B;  2HNZ B;  1EQM A;  4GKK F;  1URN A;  4ZN1 A;  4R5P B;  4CO4 A;  2E1P A;  2QZ8 A;  4RPF A;  4KY3 A;  2QA4 S;  4U95 A;  4MKA A;  4CO1 A;  2MQQ A;  2ZUG A;  3P4U B;  1RT3 A;  2LMI A;  1IBK J;  3W7B A;  3T19 A;  4A46 A;  5HO4 A;  4X66 F;  4I56 A;  1LWF B;  2K1R B;  3W8P A;  2MQP A;  3SV4 A;  2YVS A;  1WF2 A;  1N32 J;  2GQQ A;  4L73 A;  1K0T A;  1OQ6 A;  2MY7 A;  1N5Q A;  1PO6 A;  2XUL A;  3EIC A;  3PX4 A;  3QJJ A;  1F9F A;  4DL3 A;  2FPH X;  5KG3 A;  4MH8 A;  1JWW A;  4DWI A;  3UN3 A;  3R2D J;  4F2R A;  3JTP A;  5CCM A;  1TK0 A;  1Z2Z A;  2BQ3 A;  3A8J A;  2ROE A;  3PX6 A;  4ZPW R;  1S1V A;  3DM2 B;  2UUB J;  2VC0 A;  1JKH A;  1RTJ A;  3EGZ A;  4TQR A;  2QEX S;  1MN7 A;  3KK2 B;  1Q82 T;  2YQ0 A;  5KG5 A;  3OV7 A;  1C0T B;  2BOP A;  3FC9 A;  5CYM B;  4JYA F;  2YKP A;  4NLO A;  3BGL A;  3JTO A;  3H5X A;  3ETO A;  3KWM A;  5BJR A;  2UZA A;  1SJF A;  3T6J A;  2F7V A;  2B6A A;  3DLG A;  1Q7Y T;  1DZ5 A;  3UCG A;  3FCW A;  3J81 U;  1WDT A;  3QT8 A;  1KTQ A;  1EKS A;  4E0D A;  1R0B G;  2LQ9 A;  4DSJ A;  3RB3 A;  2RU9 A;  5GME A;  3UCU P;  4QWD A;  1H3D A;  5HBM B;  1D9D A;  3PO5 A;  1RWN B;  1RAH B;  2ZWO A;  2D7S A;  2Q3P A;  1DRZ A;  3EXC X;  1ZTT A;  2DB1 A;  2MSS A;  1TAU A;  1UVN A;  1Q16 B;  2BE9 B;  5M2U A;  3F44 A;  4USI A;  5HL7 Q;  3VR1 A;  5JMN A;  3V6J A;  2KXH A;  1NO8 A;  3M6X A;  5AE1 A;  3PTW A;  1XMQ F;  5K8M A;  1N6Q A;  3C3L A;  2BXJ A;  3JS9 A;  2W9C B;  2J0Q D;  3RB0 A;  2E7V A;  5D4O A;  4O3S A;  4LRE A;  4DX7 A;  5A0Y A;  3QO9 A;  4USK A;  2QMU B;  1V3S A;  1RWO B;  2NSB A;  2N3O A;  2MZQ A;  5D15 A;  1TQL A;  5F9N A;  4RR5 A;  2B4V A;  1X31 C;  4FN5 A;  3RG6 A;  5J1E A;  5FDL A;  3BDE A;  3N6M A;  5HLF A;  2OJ3 A;  2HWH A;  3D54 A;  2HNY B;  4M94 A;  4M8L A;  4C11 A;  4YP3 A;  4YOE A;  2NR0 A;  4ECZ A;  2B4P A;  5L1L A;  2QA4 G;  2JC1 A;  5HMX A;  1YJ7 A;  2AJ4 A;  3HZE A;  3CCV S;  2D1C A;  1RI7 A;  5HMY A;  3I32 A;  3W61 A;  3ILJ A;  5KFM A;  4FVC A;  1JJC B;  3CJ0 A;  3VCD A;  3OVA A;  1HQ2 A;  2FLP A;  2KHD A;  1YWX A;  3D0H E;  3I0R A;  3EWG A;  2WRM A;  3EGN A;  1R0A A;  4TU8 A;  3W2W A;  3BQ2 A;  4XAK A;  2R7Q A;  2X51 A;  1PAU B;  1YIJ S;  3R5C A;  4M5I A;  3PIP Q;  3IWN C;  2RKI B;  5E3A A;  2KO1 A;  3CUN A;  1RT4 B;  1RAB B;  3CD5 A;  3ZZZ A;  2UUW A;  2LEC A;  3RAX A;  2HHU A;  4B3S F;  4KHR A;  1Q0N A;  4F4W A;  3ENV A;  3FSI A;  4X4S A;  3CCZ A;  3HHK A;  4DV0 J;  4ED2 A;  2YNI B;  2NSC A;  1UEK A;  4I6A A;  2FZK B;  2ZM6 J;  2D3Z A;  1DLO B;  4OZ3 A;  3KG1 A;  3QGG A;  1HAR A;  4F67 A;  1HPZ A;  3MPU B;  2MXY A;  4FBU A;  1MRO B;  2D9O A;  4LF1 A;  1Q8I A;  4K4W A;  3SSR A;  3LTO A;  4C48 A;  4CLU A;  2B9E A;  5EX0 A;  2XGQ A;  3BR9 A;  3M2V A;  3VAG A;  4IRC A;  2LU2 A;  4DPO A;  3QFW A;  3D0G E;  5KFO A;  2E1C A;  1IBL J;  2FLO A;  1F9E B;  3P8B B;  3C2P A;  1FDD A;  2V0N A;  2ROG A;  3GJQ B;  2OUG A;  3KK1 B;  4ZKA A;  3JSY A;  2XWY A;  3R1H A;  4WWS A;  3TNV A;  1RKI A;  2HVD A;  1GFW B;  2RRA A;  2AJQ A;  2DHH A;  3CXC R;  5E33 A;  2DXF A;  3CO9 A;  3SQO P;  2KM8 B;  3OW2 R;  2W7O A;  3KHR A;  4LVO P;  1LK7 A;  3I31 A;  4WZM A;  3HJF A;  4LUB A;  4EK2 A;  5CZX A;  4YB1 P;  2YH1 A;  1EET A;  4HVZ A;  2IA0 A;  5K14 B;  3ZNU A;  3OSP A;  2FVC A;  2RE1 A;  1X5P A;  2O3D A;  3G2X A;  2FY8 A;  3H40 A;  4FVM A;  1VRU B;  2KRR A;  4MKY A;  1UZH A;  4YY3 J;  1D9F A;  1RT1 B;  1BC6 A;  1S1T B;  2YNH B;  4QYR A;  3TVK A;  4YB5 A;  3I5C A;  3J7Z T;  2IMO A;  1N34 J;  2J9E A;  3VVU A;  2BQR A;  2IPO B;  2IYI A;  1LWX A;  4OI0 A;  5CYJ A;  2LA6 A;  3ICL A;  3CJ5 A;  3HT0 A;  3IS9 A;  3HCX A;  1RHU B;  3EGW B;  3ZC4 A;  1FVQ A;  5B0D A;  1S9G A;  2QJ3 A;  5A8K B;  5DZ6 A;  1RT5 B;  4B9L A;  2KZM A;  3HHL B;  4PEO A;  3ZZP A;  3VV2 B;  1TAQ A;  1CJK A;  3MOJ B;  4P7T A;  3DHW C;  2ZC3 A;  3R27 A;  2DKO B;  2VQE F;  5DM7 Q;  3SIP B;  3TZX A;  3G8T A;  2P2C B;  4CNZ A;  5J1P A;  4WXW A;  2EFO A;  4X4R A;  2C2R A;  2HYI B;  1IR2 A;  3KYL A;  3MFI A;  4KGK A;  1HD1 A;  2VH7 A;  3UD4 P;  2BX6 A;  2AEF A;  3ZTQ A;  1NLK L;  2YQ3 A;  3OD2 A;  1SL2 A;  4ELU A;  5E3Q A;  3M30 A;  3OTB A;  1KLM A;  4NWB A;  3WC0 A;  1H2T Z;  4DFK A;  3IXQ A;  1TL7 A;  5G0R B;  5KFS A;  5GAG U;  5ETN A;  3CJ3 A;  2C2E A;  4A8X A;  1FJ7 A;  2IVM A;  1T9X A;  4I2Q A;  2XSF A;  5KAK A;  5KFK A;  1D8Y A;  3NGK A;  3M8Q B;  3MAH A;  1JLC A;  2DEI A;  2CJX B;  4JI3 F;  3FCV A;  2WVB A;  4B3O B;  4FBT A;  2FVQ A;  3FQL A;  2N7Y A;  4RJV A;  1K1S A;  3DFE A;  3IBF B;  2HFS A;  2B56 A;  1WOS A;  4OI6 A;  4DU8 A;  4DV3 J;  3V2U C;  2IC3 A;  4LRD A;  2IVY A; 
#chains in the Genus database with same CATH homology
 1UCN A;  3PRV A;  4DUT A;  1NLK L;  4ANE A;  1NCL A;  4W98 A;  4O0N A;  3FKB A;  4KPC A;  3DKD A;  1EHW A;  1NDC A;  3Q8U A;  2DY9 A;  3FBE A;  5IOL A;  2AZ3 A;  4CP5 A;  3FBB A;  1BE4 A;  3GPA A;  3VGT A;  3ZTP A;  4ENO A;  1F3F A;  4UOG A;  3VGV A;  4WBF A;  3B54 A;  3Q8Y A;  3ZTS A;  3PJ9 A;  3NGR A;  3R9L A;  3ZTO A;  3FBC A;  3VVU A;  3EM1 A;  1NB2 A;  2ZUA A;  1JXV A;  1KDN A;  1LWX A;  3EIC A;  1PKU A;  1W7W A;  1S59 A;  3EVM A;  4UOF A;  1LEO A;  4F4A A;  3EMT A;  1HLW A;  3MPD A;  3B6B A;  3EVO A;  4HR2 A;  4UOH A;  5CAA A;  3L7U A;  4FKX A;  1U8W A;  3NGU A;  5BXI A;  3VGS A;  3NGT A;  1BUX A;  2B8Q A;  2HVD A;  3DDI A;  1WKL A;  4S0M A;  1NHK L;  4DI6 A;  2DXF A;  1K44 A;  3JS9 A;  2NCK L;  3WX8 A;  1NSP A;  1NSK L;  3ELH A;  3BBB A;  1S5Z A;  3FCV A;  2CWK A;  1NDL A;  3NGS A;  1XIQ A;  3BH6 B;  4ANC A;  4AND A;  3Q86 A;  1WKJ A;  2DXE A;  1HHQ A;  1WKK A;  3EVW A;  1XQI A;  1MN7 A;  5CAB A;  2DYA A;  5C7P A;  1NDP A;  4FKY A;  2DXD A;  4EK2 A;  2B8P A;  3BH7 B;  3Q83 A;  1NUE A;  3FC9 A;  3VVT A;  1NPK A;  3ENA A;  3GP9 A;  1NSQ A;  1MN9 A;  3EE3 A;  1HIY A;  1ZS6 A;  4C6A A;  3BBF A;  1B4S A;  2HUR A;  4F36 A;  1S57 A;  3Q89 A;  1B99 A;  3ZTR A;  1BHN A;  1PAE X;  3Q8V A;  4DZ6 A;  3ETM A;  3VGU A;  1VYA A;  2BEF A;  2VU5 A;  3BBC A;  3EJM A;  1F6T A;  3FBF A;  2AZ1 A;  3G2X A;  2BX6 A;  1NDK A;  2HVE A;  3ZTQ A;  3FCW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...