1KDNA

Structure of nucleoside diphosphate kinase
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
150
structure length
150
Chain Sequence
b'VNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIHGSDSVESANREIALWFKPEELLTEVKPNPNLYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title AlF3 mimics the transition state of protein phosphorylation in the crystal structure of nucleoside diphosphate kinase and MgADP.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Phosphotransferase
total genus 44
structure length 150
sequence length 150
chains with identical sequence B, C
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1996-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1kdnA00
1W7WA 5CABA 4UOFA 3ZTRA 1XQIA 2DY9A 3Q89A 1B99A 1NB2A 1S59A 3BBBA 4ANEA 3FBBA 3JS9A 3GP9A 4KPCA 2BEFA 1S57A 1WKLA 1JXVA 1NDKA 3ENAA 3Q8VA 3NGTA 4O0NA 1NDPA 3FBEA 3VGTA 3EE3A 1LEOA 1PAEX 1NDLA 1NDCA 3FBFA 3FBCA 1B4SA 3ETMA 1NSQA 2DXEA 5IOLA 1MN9A 1NSPA 2BX6A 3NGSA 2B8PA 3FCWA 2HURA 3L7UA 4ANCA 1XIQA 3B6BA 3BBFA 3NGRA 3G2XA 1K44A 4DUTA 1F3FA 1KDNA 2NCKL 1LWXA 4EK2A 3Q83A 3VGSA 1HHQA 2HVEA 2ZUAA 3EM1A 1NCLA 3EVOA 3BH6B 5BXIA 1BUXA 1NUEA 4CP5A 3Q8UA 2HVDA 3VGUA 3PRVA 4F4AA 1WKJA 3FC9A 1NHKL 3EICA 1HIYA 1NLKL 3EMTA 3ZTPA 3ZTOA 5CAAA 4ENOA 3PJ9A 3WX8A 3EVWA 4WBFA 2B8QA 2DYAA 3NGUA 1PKUA 3VVUA 1MN7A 5C7PA 1S5ZA 1NSKL 2AZ1A 4FKXA 4C6AA 3BH7B 4ANDA 3EVMA 3FCVA 3ZTSA 1UCNA 4W98A 1BHNA 4S0MA 3BBCA 3DKDA 3VGVA 3ELHA 2CWKA 1BE4A 3GPAA 2DXFA 3EJMA 1VYAA 2VU5A 4DI6A 3Q86A 1ZS6A 1NPKA 2AZ3A 3DDIA 1HLWA 3MPDA 4FKYA 4UOGA 1WKKA 3R9LA 3B54A 3VVTA 3ZTQA 4HR2A 1EHWA 1F6TA 1U8WA 4F36A 2DXDA 4DZ6A 3FKBA 4UOHA 3Q8YA
chains in the Genus database with same CATH superfamily
4ECZA 4UZBA 5GAHU 2DHHA 4N8NA 4CLLA 2JLGA 4WP9A 4KO0A 3I6PA 1JLAB 2RS8A 4NYZA 2DHGA 1TL5A 2ZVIA 4CTAA 1FESA 5FJ4A 3LGNA 1HBMA 4M5GA 1H38A 3PO4A 1KDNA 1U2CA 3RTVA 1LWXA 3MEDB 4DMZA 4M8LA 2W9CB 4O3RA 2LQBA 2HVZA 2DRBA 4M5DA 4DPUA 4HHUA 4R5PB 4PUOB 3CCVS 3CTRA 3WC2A 2E5GA 2RH3A 2WSEC 3UDEA 8AT1B 2ZJRQ 2V5HG 3T6JA 1LWCA 4QPTA 2CPZA 1RAGB 2JC0A 4KPYA 2ZVSA 5F8LA 4ZLJA 4FPIA 4BWJA 5EDWA 2NUUG 1UFKA 1RWMB 1F6TA 3OR1B 5AE2A 4KSEB 2QO3A 2FHKA 3D0GE 1R8PA 1CJVA 4DPOA 4RUHA 2KL8A 5E3RA 2PD1A 3MOJB 4DQRA 3PDNA 1H72C 1F9EB 5J2MB 2MY8A 2YX7A 3GJQB 1NDCA 4F02A 4QU6A 5HLFA 1HD1A 3M9MB 5JJBA 3BO3A 2V69A 4NCBA 4FS1A 2AEFA 1S0MA 3ISND 1G6BA 1BXNA 4MFBB 1RA7A 3V81B 1F0XA 1FFWB 3CMAS 2HNZB 2K7JA 3BGOP 3D28A 2YKNA 3FEZA 1YZ6A 1O0PA 3MM8B 1S9EA 5KFGA 1JKHB 5D8HB 2V34A 4Y65A 5IT4A 2ABYA 1KOOA 1REVB 1RBAA 3HJFA 1DRZA 3OSNA 3AJDA 3AH6A 2BANA 3W9HA 4EBCA 4WJBA 1PC5A 4TY9A 2W2OP 1MU2A 5AT1B 1FX4A 1F60B 2FJWA 1RGVA 1C1BA 5LJ3Y 5B0FA 2KFZA 2GJ2A 4CLPA 2OEMA 5GMKa 2W7OA 1CG2A 1YTYA 2LQ8A 3HF5A 2JVOA 5G0RA 4OYIA 2V2KA 3PXGa 4DR4J 4L6V3 3BS9A 2OHDA 3EZ5A 3C66A 3KLHA 4NCGA 4B9NA 1RYRA 1NJWA 2HWHA 2MGZB 1I51B 2FGOA 3E01B 3OL8A 2CKWA 1HBNA 1LKZA 2C2DA 3KLIA 2ZHAA 1L3VA 2BKPA 1VQ8S 2AGPA 3H2LA 3K7RA 1S1UA 2LP4A 2IDEA 2V50A 3FCVA 2OPQA 4EYIB 1ZOTA 3OW2R 4RO0A 3ELHA 3CD7A 3PO5A 4USUA 1NK0A 1S6PB 3D54A 1P8GA 1OWXA 2VJUA 3NWGA 3LPYA 2XS2A 2DO0A 2JVRA 1Q95G 4UOFA 1SJ3P 4LFBF 3FCHA 4LF5F 1FKAF 3RUBL 4HI1A 5AJ3F 1D9FA 3M32B 3KMQA 4CH0S 3JYTA 5ETSA 2KH9A 1XC9A 2DR6A 2CQ1A 2W25A 2VG7A 3HFZB 5T7LB 4WIIA 3RW6A 1TELA 4CNZA 3V6HA 5B7WA 4CRJA 3FCWA 3DRRA 1UA0A 3W5YA 2NZCA 2V4RA 2NCKL 1VQ9S 3AB4B 1XJWB 3FEYB 3LANA 1NRKA 1VIXA 3VGUA 1HPZB 1U0SA 4Y00A 3OV7A 2G4BA 2NXEA 1UWAA 2AD9A 2P5VA 4DSLA 1VBYA 2HEKA 3TX0A 4CM2A 3TR5A 3THPA 3ZTSA 3LALA 1OQ6A 3BQ1A 2KJWA 3IRXB 2R8HA 2CZVC 2OPPB 1IBMJ 3I5CA 1O8BA 1ZTWA 5L1IA 4J9SA 2OD4A 4QWCA 5C42B 1AYEA 1OQ3A 3RRKA 2LCWA 6AT1B 1RHJB 1VJQA 4DEZA 5D0RA 1B0TA 1RADB 4IRKA 2IRXA 4ZCLA 3VTIA 3SV3A 3UDVA 2UU9F 1BMQB 1KQFB 2EG1A 2LYVA 4TN2A 1N5YB 2UXBJ 3P5TL 1VRTB 2W4CA 2OFGX 4H4MA 2N3LA 4OZLA 1FD2A 1WOOA 2AJ4A 4DSJA 1N54B 4NEYA 4NX9A 4P7VA 5B08A 4C97A 2YKMA 5L9XA 1FNXH 2D3UA 1FERA 4M5LA 4KR0B 2IIHA 2UXDJ 4CLWA 3K5OA 1R0AB 1D09B 1YJRA 3HHEA 1KFDA 3DLKA 4DR1F 1SV5A 2XCPA 2HIQA 4X64F 2J7KA 2XMUA 4WTOB 2A3JA 2EXUA 3C15B 1HNIA 3H2VE 3AFGA 1RTJB 2QG9B 4DSEA 4USMA 3I0RA 1VQPS 1H74A 5I3QA 3SSQA 1HWKA 4DV6J 4QCLA 1X0PA 4X2BA 1HBOB 2YNFA 3DI6A 3HVTB 2GIFA 4LF6J 1VQYA 3J81U 3W5ZA 2ZHBA 3BQ2A 4USTA 2AX1A 2RDJA 3A8JA 4NLSA 5KT7A 2Q1LA 2DD8S 2F3JA 1RWOB 4YHHJ 4G1IA 1XMQF 3DOMB 1EB0A 3RYLA 2IDLA 1IBKJ 2ZKTA 3SCIE 4XDDA 2YWWA 2DRDA 1DQ8A 2VF3A 4NASA 3VVUA 1QUPA 1T0TV 1LFWA 4NLRA 2PMWA 1K1QA 4PXDA 4PXEA 2X51A 5SZTA 1ZM4A 2KZZA 4HHHA 2MTLA 3H7HB 3GE9A 2RKIA 3QFWA 3GZ7A 4FNHA 5I3UB 2XLIA 1LW2A 3DMJB 2CWXA 1HNZJ 3TAMB 1VQ5S 1FRXA 3IWLA 2VICA 4PG6A 3TX8A 1FK9B 2N4DA 2NR0A 3QRQA 5ADZA 3HJVA 3JXOA 1UFWA 2ERRA 2RSQA 1FI4A 1QAYA 1XTZA 2FUG9 3IBCB 4F0MA 5LSLA 3KYLA 5B0CA 1FTRA 4ZPVR 1NU4A 2QZ8A 2AV5A 3M8QA 4Z37A 5GADU 1AA1B 3EVOA 2GNKA 4C8MA 3TVZA 3RU0A 1GX5A 3ZTOA 2IPOB 3DOKB 1RAFB 4K4UA 3PTWA 4F3OA 2PC6A 2GS8A 2VBXA 3CJ2A 3VGVA 1S48A 1DQ9A 3DOLB 3T3FA 1NAQA 2VH7A 3I0SB 4X4VA 4LSNA 2L48A 2LU1A 4C0BA 5DGBA 3L7OA 1BGXT 1ELOA 4OZJA 3G87A 3IBWA 2Q43A 3BR8A 4M5JA 2A6OA 1ZETA 3M8PB 3OFFA 3NXZA 3NOGA 2QFJA 4LFAF 2V6AA 2AGQA 3H8YA 3UPFA 4FF1A 2NREA 5HQMA 1FKOA 1MMNA 1QUVA 1X31C 3H5SA 4B3MF 4DFKA 4N7TA 1UPMB 5CD4H 2XO6A 3A3NB 1RTDB 3QIDA 3AOAA 4EZ9A 3Q8UA 2CPJA 4ZVRB 4OLPA 3D6TB 3MM6A 2DO4A 2QLJB 2XO7A 4ZHRB 1IBLJ 1T9VA 2B9WA 3VAFA 4OLOA 4ETZA 3GSIA 3P96A 4WXWA 1WNEA 2XWXA 3AXKA 4DR3F 2AT1B 3JQKA 4RWWA 2DXFA 1Q7LB 2FPHX 2MZJA 4D3HA 3S8SA 4IOCQ 4N76A 2W1BA 1U6ZA 2H65B 4PXCA 4ED0A 1PJ7A 1U0HB 1IKXA 3RB4A 4X62J 2PEBA 1EKRA 3FKBA 1RWWB 5L46A 3CDEA 3TJAA 1XERA 4WTYA 2X1GA 4CWBA 4B9VA 3BKFA 4IR1A 3KG4A 4B02A 3DNCA 4F2SA 2G2OA 2PMZD 1CJUB 4BDPA 1R8BA 5ETTA 2W8LA 4ECXA 2V8PA 5CZXA 3HM9A 4O3OA 4EU0A 5HL7Q 3UNYA 2AYMA 4WU3A 1M5HA 3HVWA 2CNNB 1CEZA 3AJ1A 1TK5A 3EXCX 4DWIA 2NS1B 1KONA 1GMVA 1U1KA 1H0HB 1PSDA 3N6LA 1G7CB 4Z7CA 3PR5B 1WG4A 3UI3A 1IKVA 2VQFF 2JHEA 1ZH5A 3N5BA 3ZZOA 4CLSA 5HMYA 4I56A 4QIFA 3IBFB 2HNDA 3QQCD 3D6MB 3FFIA 1NMEB 3R8YA 5J2PA 4OZ3A 1SKUB 4ILLA 2ACMA 1H98A 2QA1A 3NNCA 2FHOB 3AQPA 2CJQA 1H7XA 4MKBA 2P6TA 2BE2B 5J1EA 5KAKA 5KFZA 5HVFA 1X9MA 3HVAA 2I5JB 1LW0B 3H40A 3ILLA 4ALZA 3TVYA 1Y7PA 1FEHA 5F8IA 5DG7A 1HYSA 2B4VA 2MZQA 2IVYA 2V67A 1EAYC 4P2MA 2WONA 4YOEA 5H9FJ 2JLFA 1WJ9A 4ZVPB 4LMZA 2MLYA 3V4MA 3ISNC 1KRPA 3OJUA 4JI4F 1YITS 2PO4A 1AUDA 4C2MA 1R89A 4IG0A 2IFXA 4NLVA 3O8WA 3FVYA 3K89A 3EDRB 3R5AA 4OX7A 1DY3A 2UUAF 2VPWB 4FKYA 3UDLA 3HHLD 4YB6A 3N28A 4ZP6A 4DR2J 2QE5A 4NMLA 1WF2A 3ENWA 1RT3A 2CNOB 3IWXA 3PEJA 1NB2A 4ANEA 1RHMB 3CC2S 3IO1A 4G1QA 2UXCJ 1FA0A 4CLUA 2YWFA 3LAKA 1DBDA 2OJ3A 2GA7A 4OYOA 1AFJA 1M5VC 1IR0A 2NSCA 4GC6A 1MN9A 1FFGB 2X1AA 1VQOS 2C3MA 2YTCA 2GMLA 4OYZA 3MAAA 3GFYA 5K14A 1SKSA 1KNZA 4F4AA 2OPRB 2ZZNA 2GO9A 2FVSA 3CD5A 4RWXA 4CCHA 1SIWB 2DNZA 4KBIA 5LXYA 4USIA 3I4PA 5E0OA 1C1CA 3T6BA 2BR0A 3RZAA 3QGHA 5C25B 4H4OA 3MI7X 4K2XA 4QBUA 1T02A 4B9LA 2N7YA 4AQYF 3ZFVA 4JI2F 2X7IA 3HZEA 4GKKJ 1HQEB 2PE8A 4L72B 5KFKA 3OVBA 2OEJA 1MWYA 1CJTB 1RABB 3HHDA 3AXMA 3AY0A 2NXNA 3TANA 3DGPA 4DL5A 2L9WA 2JNJA 3V6JA 3C6TB 1N6QA 4TU7A 1EJ7L 2P2CB 2C2RA 2E9TA 1V3ZA 4MK9A 2VQEF 1Y3JA 8ATCB 3FMBA 1DTQA 1DFDA 1WTBA 2EWHA 3P6YC 3SDEB 1LV5A 4MIAA 2BQRA 2M3DA 3WX8A 3MPUB 4K8RA 1L5UA 2A2DA 2AEJA 2E9RX 1SJRA 4CQ1A 1NNDA 2E1PA 4MYUA 3FNNA 1TVRA 3NNHA 3M1VA 3HULA 4U8YA 1UVJA 1VYAA 2JEJA 3H20A 1JXEA 4RPFA 3NMAA 5CYQA 4X4PA 5K8MA 4ZPDA 3FDSA 1YBUA 1QD1A 1O51A 5D15A 2PMHA 2I8EA 1U1NA 5HAOA 1X4HA 3JTOA 2BACA 2E9ZA 2MSTA 2BEFA 2QX0A 4QPXA 2J7WA 1Q79A 3BGFA 4J5OA 2RT3A 5KTQA 2XYGB 2CDRB 5IWAF 2XMJA 4W92B 3BGUA 3KK2B 4WZQA 2J8SA 2OGUA 3K5LA 3B6BA 4TVAB 4NYOA 1RQ0A 2R7WA 1Q82T 4F4XA 1NUEA 3GIMA 1J5OB 1WC0A 2CFXA 3C16A 4RW4A 2HRTA 3BKTA 3G71S 1RT1A 4TLRA 3DC2A 4FYXB 4FF3A 1D8YA 5L9NA 1ZYQA 3G96A 2HHUA 1SQGA 1LWEA 2R7VA 4C0HA 1KQGB 3G6ES 1WELA 2H5IB 1RT2B 1U25A 2AQ4A 3T1YF 1BC6A 1KLMA 3DM2B 1FJ7A 3PY8A 4WK3A 5A0YA 4JI8F 1JLAA 3H42A 3AJ2A 1FNOA 4O44B 2YQ0A 2RVJA 4CIOA 2E5IA 3IG1B 3TVKA 1FHTA 3DRSB 2L08A 3CO0P 5JMNA 4QIWD 4CO2A 1OPIA 2EFOA 3MEDA 2KJVA 4X4QA 3G8QA 2VC0A 2Q3PA 5DS7A 2E1RA 2LEPA 3MDFA 3NWRA 2J9DA 2RS2A 1RT5B 2FZCB 1A9NB 4O3QA 4BCAA 3ZZUA 2W4PA 4ED7A 4ELUA 5E3AA 1QM9A 4IOBA 4UY85 5F8JA 2PT0A 4K7QA 2YNIB 3I9ZA 1VDHA 3OTEA 4QWBA 3QZ7A 3K0JA 1RLDA 2RD5C 3OR1A 4OYMA 5DQHA 5CCMA 4CH1A 4J9UE 5ETMA 3BREA 2HFVA 1OY8A 4I0WA 3K8VA 4CTAB 2PGCA 5GVQA 5J2MA 5BR8F 4E98A 3PYDA 3PX0A 3TUZC 1HBMB 4LFBJ 1F2HA 4LF5J 2GQQA 1RKJA 4DQPA 2BXJA 5AJ3J 2ASJA 2UZAA 4LSLB 1LWFA 2BOAA 2FZGB 4DPTA 4MFBA 4DV1F 3V81A 3G8TA 2HNZA 2HHWA 3IA0A 5B0EA 3PNIA 2FVQA 2HAIA 1X5TA 1LWCB 4J9NA 3CJSA 4ICLB 3QT7A 2VIHA 1S9GB 2DRAA 3HXMA 2XS5A 1H3DA 1Z2LA 3W62A 2DHSA 4P2FA 3K8WA 3C6UB 1XR7A 2CAJA 4JI6F 2HRYA 3I4HX 1JKHA 3R1LA 3TARA 1WC4A 3MR7A 3KFWX 1M5KC 1S0NA 2AF6A 5M2UA 1YX2A 1REVA 4OHWA 1BQXA 2ZBIA 1HWJA 2VUGA 1UZHA 2NLWA 2AMCB 5HROB 1S0VA 2BM0A 1FDBA 2F40A 1UW9A 3NS6A 4EMDA 1B99A 2Y1LB 2HFZA 1T9YA 1N5VA 2RMLA 1VGYA 3SCJE 3I5BA 2WOMB 1B4SA 1KHWA 4ANCA 2ZOGA 1WC3A 3DHXA 2UU9J 4BBYA 4DL0C 4MKAA 2MGZA 2YKNB 3E01A 2WSCC 3ZZRA 2DEIA 4RUCA 4USHA 4JUZA 3KLEB 4HYKA 3E2EA 3NEKA 2F9DA 3D3BJ 1QSYA 4O3NA 2MHNA 3MMAB 4KGKA 2YXLA 4GMKA 3IR6B 1S6PA 2CG8A 3RB3A 2IVMA 2KYXA 1MU2B 2BW7A 2GQCA 2KVIA 3EDQB 4NRTA 4DR1J 3OLBA 2DGWA 3TEHB 4X64J 2BBEA 4XPCA 2HAFA 4RJVA 5H9EK 1C1BB 3GV5B 1HARA 2CQIA 4DOZA 1JLGA 5H9EJ 3I96A 3O6QA 5E3PA 5A8RA 2J76E 3M32A 1S59A 1QAIA 4RL1A 4KH1B 3R1HA 1Q5YA 2N3OA 3JSRA 2IM0A 4R0EA 3HHLA 5T7LA 2H3EB 3C14B 4X66F 3GIJA 5GAGI 1OY6A 1FJCA 3KLGB 2QC3A 3PW2A 2GGPB 1JX4A 1NK4A 3IM8A 3H2UB 1R6YA 3DYAB 4A8QA 1UVKA 4IFYA 1HPZA 2EFGA 3KLIB 1RHQB 3IXQA 3PKMA 3H25A 3MR3A 2BKNA 1S1UB 4HL9A 4I2PA 1NLKL 5KFAA 3L09A 4OX6A 5D6GA 5L1KA 3T9NA 1XMQJ 3AD7C 3EUNA 3FRZA 1LK5A 4FKXA 1IKYB 1FRHA 1JLBA 3UD5A 1BHNA 2QTWA 5BJRA 3QLHB 3IRXA 1BE4A 4JI1F 3KDOA 4P75A 3KJNB 5AXKA 4K2JA 1ITPA 1WF1A 4B3RF 3DDIA 1XMBA 2DEJA 2OPPA 3MHYA 3R9LA 5KFIA 1QVFR 3UW1A 4B08A 1D3WA 2RQCA 2VG7B 2CA9A 3M8ZA 3U7JA 1ZM2A 4PYAA 4Q2MA 3WIVA 1KBRA 4O3PA 4GVLA 2GO8A 1M5PC 2DNQA 3DRRB 1PYTA 3M2RB 3U02A 3KUEA 2AYGA 4ZP9A 3FEXB 3R2CJ 2IMWP 3BYRA 3A1YG 1CJKB 3EGNA 1XIQA 5F0WA 2DY1A 1N5YA 1RI7A 2VFSA 1VRTA 2BZ2A 3VGSA 1GXTA 5ETPA 1S4EA 5K5MA 1CC8A 4RX6A 1NPRA 1VC0A 3CJ5A 2BVZA 4ENOA 3NY0A 2HVHA 3TP2A 4MH8A 2V8HA 1Q78A 1SBRA 3OBIA 1R0AA 2YWGA 1F1BB 4QWAA 4RBVA 3VAHA 3H4DA 1FO1A 2J6SA 3CUNA 4H4KC 3C15A 5JXSA 4ZOSA 3NG8A 3KNGA 5KFBA 1FD8A 1RZMA 1YKWA 1TK0A 2DGTA 1YRTA 2LQ9A 3Q8YA 1B7FA 5HMWA 4NLUA 4NCAA 1VHFA 1HBOA 3HVTA 1JLCA 3TJ8A 4LFAJ 3VGTA 1T7PA 4Y0FA 3G6YA 1SC4B 1YWXA 3MCMA 4ZPBA 1GTEA 5HK4A 2JFKA 1VMBA 4OJ1A 4DQIA 2IM1A 2H5EA 2OTJS 4B3MJ 1R0CB 2ZNZA 3ITHB 3DFEA 2HFNA 1VBXA 3SEOA 2EC0A 4LRDA 2ASYA 4YR0A 2PEHA 4RW7B 1NO8A 2GHPA 2G0IA 2G0CA 1KEKA 4FF2A 1NB7A 3M05A 5C5JA 2Z2MA 1X4CA 5F9LA 1HNIB 3SZ2A 3VAMA 3RRGA 4DR3J 4ZPCA 3TJ9A 3I0RB 3DMJA 2VODA 2CQ3A 2C42A 3TAMA 2RHSB 3MCNA 1N52B 2WZ1A 4G3IA 2HW3A 2LA4A 3HHNB 1FK9A 3R97A 4UQTA 3DI6B 4FNIA 1RHKB 2KG0A 3T19A 4PKDB 3LWMA 3R6LB 1T9UA 2H54B 2MZSA 4K4VA 5KFPA 2EI5A 2KTQA 2XNRA 1U8SA 5EX3A 3MR2A 1I3OB 2BJ8A 4ITSA 4LF8F 4EK2A 2ZM6F 4AL6A 3C2PA 1SH2A 4HH0A 4FYVB 3HZGA 3DOKA 5DGAA 1UP1A 1UPPA 3CCWA 5M2RA 1TUGB 3JSMB 2KHDA 3AT1B 1TFYA 4DV4F 2RKIB 4KC5A 1G1XA 3W2WB 3D4JA 3DOLA 2WTFA 3GSDA 2ZH7A 1LW2B 1X5PA 2VQFJ 5MLCV 1FXLA 4X65F 2Z2ZA 2DR8A 1WHVA 4BC7A 4LBHA 2WVCA 2Z30B 5DRKA 1Y5IB 1AW0A 4K4SA 5KFXA 3CCTA 3M8PA 3A3OB 4Q5VA 3MEKA 1T94A 3JSYA 4P10A 3JQMA 1NDKA 2AYEA 2QA2A 3M8QB 1S0OA 3HPOA 5D3GB 1HMVB 1S4FA 2RU9A 5J2NB 1FRJA 4F25A 5ETKA 2BJEA 3KHRA 2CQDA 1RAHB 4ZJLA 4P2SA 2OSQA 5RUBA 4ZHRA 2AJ0A 2A6MA 1X5OA 1T9XA 2MYFA 2JL9A 4TU9A 4DF4A 2PFDA 4J9QA 2POKA 1KHVA 5IFMA 4CYUB 2HHHF 3W64A 4K59A 3WHIA 3DXBA 1T05B 4JI4J 1XEZA 2VFVA 3A12A 1WI8A 3EWGA 2Y1JA 2AKWB 4RR5A 2QRRA 5U47A 4P72A 1UAWA 5FLXU 2UUAJ 2NUHA 4XTTA 5E3CA 3KLVA 2LMIA 1FKOB 3IGVA 2ZWOA 3EPIA 2WHOA 1GH8A 3GFZA 2OTLS 4F26A 4WKYA 1CJUA 2ZH8A 3I82A 4DUZF 1APSA 1AT1B 4DR6F 5LT5A 2WB1D 1KN6A 2Z4PA 3MM6B 2AJQA 1M90T 4WIQA 1QY7A 3ZC4A 1M1HA 1RWPB 2LLZA 2BQ3A 2BJ9A 4ZVFA 1S77D 1XR5A 1RP5A 5GAEI 2DGUA 4DPXA 1YJWS 2HPUA 2C3OA 1IKXB 4LF7F 4OYWA 3R7NB 5B0AA 3Q22A 5KOWA 1CQMA 2DB1A 2IJRA 4IYQA 4URQU 3UVJA 3MPDA 3IS9B 3HT3A 1HNVA 1X4DA 1U45A 1EHWA 2BE2A 4KHPF 3Q8QB 4AQYJ 2MKJA 4O4GB 2EKYA 4JI2J 1XQIA 2HSEB 3A8KA 2FJVA 2I5JA 3I9V9 5LJ5Y 3QFHA 3B78A 2G13A 2VPYB 2VONA 4NZ6A 2GJFA 4QZVB 3ETOA 3OTDA 3TZYA 2RAQA 1FCAA 2D74B 1EARA 3PW5A 2FZKB 2ROGA 5GMDA 4WKRA 1W2IA 2OPSA 1ACMB 2JSXA 3TA1A 4CLKA 2VQEJ 1IKVB 3KXDA 3SFUA 3R5GA 4JI7F 1T9TA 1TL3A 2I2YA 1TFWA 5GAHI 3HCXA 4WBFA 2HNDB 2J9DE 3ET6A 4OYAA 2Y3YA 1WEXA 3V5RA 3CXCR 2ZH6A 4Y6IA 1TP7A 3KUGA 3QGPA 3BDPA 3W3SA 4PR6A 2BJ1A 2P9EA 4DL7A 2CWKA 4HEA9 2H1YA 2ZC3A 2IBKA 3AAWB 5J1EB 2RQ4A 2V2QA 3D9BA 3UD3P 4FBUA 2YH0A 3ZTQA 4JYAF 1HNWF 3TW0A 1Q8LA 2DPIA 3PIOQ 4LJMA 2ZH9A 2D1CA 2DITA 1TQLA 2MKYA 5A2QY 2MPUA 3OQ2A 4ECQA 2BW2A 3FZ2A 1S6OA 4I4BA 1HYSB 2CQBA 4HACB 4LUBA 1J2VA 2M2BA 1PCAA 3BYPA 2A1BA 4DF8A 4WWSA 2HS4A 3MECB 2XGQA 1N4LA 4QWDA 2XMVA 1Q5VA 3UN5A 2DGSA 4XDCA 2UUTA 4B17A 5IWAJ 1M5OC 3NS5A 2OPRA 2K3IA 4J37A 4OI4A 5LMNF 2ZUGA 2C3YA 2EPIA 5D77A 3EICA 1V5VA 1B0VA 1HIYA 1FE4A 3CW2C 3FGVA 5D0HA 5KT4A 2G2ZA 1SB6A 2EC2A 1DJ0A 3DRXA 2HQFA 4C98A 1UJ6A 4PWWA 2O1PA 4DV0F 3TWZA 3MMJA 2CJ9A 3C8YA 2ZZTA 1RT3B 2Z0GA 1NPPA 1VR6A 1ZAVA 2WW8A 3FRYA 1HLWA 3VHQA 3OUYB 1HQEA 3TUPA 4DX6A 2CUYA 3KWMA 1S6QA 2RJZA 3UNGC 5HBMA 3OFEA 2B4UA 4ANDA 3W2VA 4K50A 3EZUA 4TKTA 3QATA 3CCMS 1U1QA 5IC6B 3T1YJ 3HDSA 1Z4UA 2Q66A 2A2CA 3TAQA 4JI8J 2VASA 3MMBB 4RNOA 3C6TA 4USWA 2W7PA 2I38A 1S76D 2CXEA 1N8RT 2AYBA 2OMOA 2BJ3A 3KKFA 5IOLA 3NGKA 2X3GA 1FWLA 3N01A 4YY3F 4ILRA 2PSZA 3CIMA 2MJNA 1UTAA 3ZNUA 2N7CA 3SDEA 2XB2D 5BYRA 1FWPA 1G3OA 1UVMA 1RCOB 1C1CB 4OX9F 2ZH2A 1Y00A 4H4OB 2VC1A 2DKOB 1IWAA 2JEFA 3C46A 4OHYA 1UCNA 1K9MT 2HGMA 4DQSA 1BQNB 5A6WA 2CVIA 4OI2A 1SL2A 4P9SA 1N5SA 3C19A 2RHQB 1RWXB 3DGPB 3L95X 1IJEB 5ETRA 3M8YA 1U26A 2YKPA 4HT7A 2DNMA 4F4YA 3D2WA 2KRBA 3J7ZT 5BR8J 1T03B 1MW7A 3KK2A 3T9ZA 4TLQA 4RKUC 1PGZA 2R8IA 3CT9A 2LDIA 2MZRA 3G8SA 1RA6A 1RT6B 1S79A 2Z56B 4TQRA 3BO4A 1J5OA 3K2YA 2Y0SD 4DV1J 4ED8A 3H5XA 2C2KB 4HT5A 4FXWA 1X60A 4C9DA 3S6EA 4DV5F 1TVRB 1TKXB 2KVQE 2K2PA 4ZMMA 3A4TA 2BM1A 4FZVA 2NYHA 1X4AA 8RUCA 1Q8IA 1PO6A 1S1VA 5KFUA 1XNRF 4OI3A 5CYQB 2VA2A 5KFNA 3BO2A 1IR2A 4JI6J 1WSVA 4IDKB 3K57A 4NLYA 1QLNA 2FLNA 2WCXA 5B0DA 1KWMA 4A47A 1CS4B 3JAMU 3N9UC 1VIOA 4JV5F 3DM2A 1RSCA 4CO5A 4ZS6A 3X3UA 4EGLA 2CJBA 1UJ4A 4O44A 1S7IA 4LF1A 3OXGA 1LXNA 3DRSA 1SKWA 4I6WA 3QRPA 2F7VA 5I4MA 4WZMA 3X1LB 1NJXA 4UY8T 2UV8A 1OYEA 3L9ZA 1PAUB 3C16B 1E6YA 5T14A 2ZH5A 1OYDA 5LMUF 1RT1B 3PW0A 1RT5A 5IT0A 5KFCA 4X4UA 5DZ6A 3DN9A 4L73A 1F5AA 2AJ1A 4QYZK 5L8RC 4EEYA 2D3O1 3T1HF 1Y0HA 3OTOF 3Q2SC 2FHJA 4Y2CA 1NSKL 3CCLS 1W2BR 1C2PA 1N0VC 2YNIA 4EZ6A 4DU8A 1NKEA 4OMFG 3EJMA 5F3ZA 2HGLA 4PWDA 1KLMB 1VBZA 5A0YB 1KTQA 1Q4RA 4IRCA 1SC3B 1X4FA 3EPGA 1URNA 2MKIA 2D69A 2QLWA 3M9NB 4CZCA 3RGIA 3DGVA 4V19X 2KI2A 4NLTA 4LSLA 3FBFA 1VS3A 4X66J 1NSPA 2WK4A 4DS5A 3CB4A 2R7UA 3BBFA 3CCUS 4C3KA 1IKWB 3ENVA 1HI8A 5LSOA 1JXLA 3PJWA 4ZVHA 5FD1A 1YK9A 4ICLA 2XULA 5EX0A 1S9GA 3ULHA 1BY9A 2R7RA 2R9LA 2IJNA 1ULRA 2HYIB 3HLUA 3C6UA 4DR7J 2E1AA 3PVXA 5J2QB 1WG1A 4DXLA 1S1TB 2MZTA 2Q79A 3SI8A 4S0MA 2NYIA 2RQKA 4I69A 5IM0B 2XCAA 1RLCL 3CE8A 4NI2B 2CQ2A 4JI1J 1U6BA 4FN5A 3GR0A 1RAAB 4DN9A 3OL6A 2L9NA 2E7XA 2E44A 4LF4F 4B3RJ 3MPYA 2N4CA 3EXYA 2W2QP 5HROA 2HG4A 4NOHA 2GIRA 1J5EF 1U02A 2CNKB 1NHVA 4M1KA 4NE9C 1LWFB 1RJJA 4UZCA 3ZZZA 2AX0A 4DFPA 2BYCA 3PW7A 2WOMA 1R8HA 2ZBCA 3Q8PB 3IFEA 3LAMA 3CCSS 1DAXA 2HVIA 2ZBQA 4IO9Q 3N6MA 4ZVSB 2DR9A 2WB4A 3KOAA 4FYDA 1U2FA 2CQCA 4KH0B 1XMOF 5KFJA 3HSGA 2MQ8A 3O44A 1I94F 2ADBA 1S6UA 3KLEA 3EMTA 1KLNA 3MMAA 3VCDA 2EG2A 2YKAA 4L3KA 3FSXA 4K4YA 4DL3A 2QLFB 1PJ6A 3BPSP 4O23A 5GADI 3MF5A 1YJNS 1HI1A 2CPFA 1IWGA 4U96A 4TXSA 3B4DA 1HBUB 2J0WA 2EW9A 2R2SA 1DHMA 5HMXA 1K73T 3THVA 5KFEA 2DPJA 5L38A 3C14A 5J1NA 3QPIA 1U1OA 2B6AA 3KLGA 2GGPA 2B51A 1FXRA 4OZ0A 3T5HA 4JB8B 1TL1B 3DYAA 4N56A 3QGGA 4C7QA 1WWHA 1OPZA 1SL0A 3SXLA 5IV4A 3PCOB 3VR1A 1KD1T 2ZZMA 3QGIA 2FC8A 2MDAA 2IAJB 3OL7A 2XSJB 1IKYA 1AROP 3DRYA 1PKUA 1N36F 2IRYA 3QLHA 3BH7B 1TZ0A 2ZDOA 2JEGA 1IBCB 5A8WA 3RR8A 1HQ2A 4YEAA 4P71A 1JLGB 4USKA 3T41A 4RW6A 5A8RB 3RG6A 4UOGA 4JI3F 3T5KA 1N5QA 2DXDA 5DDQC 3BSAA 2X3DA 3HHLB 1KC8T 4EO8A 4NLPA 2AW0A 1NZ8A 3M2RA 3J80U 2HHQA 3K5MA 2HK3A 4ZLPA 5H1SV 4IFYB 3FZBA 4ES2A 4G1PA 4FVMA 1CJKA 3FMWA 1HW8A 4LSZB 3WQPA 5KT5A 1VHIA 4FBTA 3NCQA 4I2PB 1VQKS 4NLQA 4PWUA 2R7XA 1JNZB 4DUTA 1VBKA 5DQIA 1FVQA 2MKKA 3QWPA 4URSA 4QIVA 4LF8J 2ZM6J 4K4ZA 4IQXA 1JLBB 4C8OA 3MM7B 2UVVA 4IO1A 2AEMA 2DYAA 2KFYA 1VK8A 1FRIA 3HFKA 4ECVA 3GV8B 3M30A 4EYHB 1RACB 3TO8A 1S9FA 4DV4J 4UF4A 3SQOP 4YR3A 2V2ZA 4OJ3A 3VAJA 3KUHA 4X65J 5A2QU 2GQ2A 2QFIA 3D1HA 3MXHP 4PQAA 4NYPA 1DURA 3MGJA 2R2UA 2ZH3A 5GAGU 1S1XA 3CDWA 2QL9B 3RBEA 4F67A 4PQUA 1NH8A 2PDAA 4OV6A 3FSIA 1CBKA 3W66A 3MM5A 4RLEA 2IVFB 2EVZA 3FBCA 4I2QA 3PX4A 1TL4A 4C0OC 4RUBA 3ITHA 3UCGA 4ED4A 4LQ9A 1FRLA 3KJQB 2HBRB 1ZA2B 4LR8A 2EKNA 3LWLA 4K4TA 4DV7F 4NZ0A 5EWEA 3BQ0A 4RW7A 1WEZA 2R7SA 3KK3B 2ZH4A 4OZ5A 1WDTA 1U47A 1S5ZA 2CPYA 2DNKA 2VV5A 1ZM3A 3IM9A 1DQAA 2HHHJ 5AE3A 4AL7A 4C8KA 3Q0AA 2JDJA 3M8SA 4F3MA 1U6FA 2AJFE 4YDDB 1VK3A 2WBMA 1JLFA 1F2GA 4C8NA 4RBTA 2DH8A 1JLCB 2XSFA 3ZZPA 2V4QA 4NEZA 3PKYA 1W7WA 5ETVA 5DJBA 3ZTRA 2ZJQQ 1Y9OA 3MTJA 5KG6A 4IFVA 1FNMA 3ENAA 1N5TA 1VC6A 4HDGA 2HWTA 2W2PP 1BWEA 3PM9A 3RAQA 4ZVUB 2DNPA 1JB0C 4DUZJ 4DR6J 1HHQA 2ZEJA 2QJ3A 1G4CA 4OV1A 4CP5A 2OEKA 4YB5A 4PRFA 2FLPA 3CJ3A 3H0PA 2QV6A 5LXRA 3JSMA 3PHEA 3GYNA 2LKZA 2Y8WA 2XMAA 4AE5A 3W2WA 7FDRA 4AL5A 2MQQA 3GJSB 4JI5F 4KRWA 3TAPA 1WDDA 4D3GA 2GCFA 1UJ5A 1WOPA 4KY3A 4CH7A 3I32A 3HP6A 3IC1A 1KVJA 4LF7J 1ZS6A 1SPBP 2VOOA 3SIPB 3R5JB 5ETOA 5D4NA 4A8KA 5D0GA 3R5DA 1S97A 4LR9A 2XBPA 1VQLS 4KHPJ 2R3VA 4WXOA 1UVIA 5D3GA 1HMVA 5J2NA 3GB0A 1Y5LB 3BN7A 2HZVA 3D6HB 4ZCMA 3AB2B 3V6DB 3MFHA 5IC4B 4TU8A 1NH7A 4YQWA 1PYSB 4ID8A 3BSOA 2Q6BA 2KB2A 1SH3A 2UVUA 2CADA 4Z2XA 1X4GA 3CULA 5M2PA 2I0XA 4MIBA 4JI7J 3OHBA 1M0SA 4CYUA 4GKJF 2E1CA 4U8VA 4MK7A 2V4JB 1T05A 2V2VA 5HJYA 2AWZA 2XEXA 2B43A 1GEHA 4DV2F 3CVKA 1K1SA 1YRUA 4WE1A 2MKSA 1YJUA 2CRLA 3WIUA 4EO6A 3GU0A 4MJKA 3O1LA 2XQCA 4UUXA 4JYAJ 1HNWJ 2FTRA 2HMIB 5DQGA 5T41A 5KFVA 2JWNA 3HD2A 3GYXB 2RIJA 1U49A 2HQCA 4TYBA 4E8UA 1AXQA 2LQ5A 1NSQA 2L3MA 3KHGA 1PJ5A 3AD9C 4BLGA 3L7UA 2IJFA 4PZVA 1FF2A 1TKTA 4ID5B 3PX6A 5BYQA 3D0HE 3TNVA 1URRA 4CO4A 2BA9A 3EGVA 3UO0A 4NWBA 3H59A 5LMNJ 1P9YA 1U4BA 2GIQA 3R5BA 4KV8B 3Q24A 4B3OB 2OKQA 3SQGB 4ZP7A 2UP1A 3PRDA 4NA3A 1HKAA 2VDIA 4OHZA 4CNYA 2CQ4A 4NLXA 3T5LA 4DV0J 2FB0A 3IS9A 1FFSB 1QSLA 1WC5A 1RTHB 3MURP 2QL5B 4MK8A 2NZ4A 3J7YU 1GX6A 2VG5A 4O4GA 1LOUA 3ZZYA 1RAOA 3CIZA 2YX1A 3DLGB 4QW8A 2OFHX 3D6FB 2DY9A 3FBBA 4ECUA 5L1LA 4A48A 4XAKA 5KFSA 3BF4A 2HFOA 1S49A 2MJUA 3ZZTA 4P52A 2IM3A 1FRKA 1KSPA 4Q7AA 5IS2A 3DDKA 3QT5A 1WSRA 4J9KA 1TKZA 3A8IA 1VRUB 3NBPA 2GAHC 3R3TA 3OL9A 4C3LA 5A76A 2IYIA 4YY3J 4MYTA 4ZVTB 3LGHA 1M1GA 3BH6B 2NQPA 1EP4A 3JQJA 2MLZA 2HHTA 3HFVA 2QMWA 1TK8A 2UUCF 4OL8A 2FGCA 4H54A 4OX9J 1VQNS 1EETB 2WVBA 3M7VA 3H5UA 3UVJB 3PV8A 4KJIA 1JIHA 1UETA 3BV8A 1HNVB 1D1UA 1MWZA 2HRUA 2XY6A 2HLTA 4AUKA 1YBAA 2FLOA 3W1YC 4PG5A 1WEYA 3QSYB 3HKWA 3GONA 2HBQB 2A0FB 1X9SA 5I42A 2VBZA 5K8OA 1T95A 5F8GA 1KFSA 2XMTA 1TKDA 3CDAA 1YQHA 1YRXA 4ATNA 4HACA 4Y28C 4Q8FA 4QQBA 3R6GB 4G6VB 4F3QA 2HHVA 3MECA 3NCRA 4IH6A 3SCKE 2OPSB 1PG5B 5GAEU 5HQLA 1R27B 2GJIA 2F8MA 2D3OR 1TL3B 2KZMA 1F3FA 4CT8A 3J81j 3K5NA 9ATCB 3Q83A 5C2CA 3CCJS 1RK8A 2WBRA 3ET6B 4V1Ak 3MTKA 2AGOA 2CPIA 1WKJA 1LQ9A 3MAQA 2VFTA 3N5FA 3GIIA 3PJ9A 2XC9A 3JTPA 4DV5J 2AZ1A 4ED1A 1WHWA 4P73A 1U24A 4I6YA 3DLJA 1RHUB 1YZ7A 3KJVB 1XNRJ 1BD6A 1V3RA 4ZJOA 3F73A 3OUYA 3V4IB 2VKRA 2HNYB 5C24B 1M5SA 4J9LA 1N34F 1HR0F 3U1LA 1S10A 3AOBA 4JV5J 4GVBA 2KM8B 4ED2A 2CPDA 4L76A 2M8DB 1Q7YT 3MMBA 4B3TF 3TZZA 2CPXA 3Q8VA 2PA3A 1LNQA 4X4TA 3VZHA 4CLYA 1P1TA 4RW9A 1KKHA 4Z7YA 4EUVA 2V9KA 1RT7A 3M2UB 4A4JA 1ZPWX 2W24A 1NHUA 4NXMF 4DX7A 2FIUA 2R4FA 3MPVA 3I56S 2B5JA 4WFBQ 2W7AA 4BC9A 5LMUJ 3UN2A 4IRDA 4WYWA 1U2RA 2B8QA 4ZDNA 4JI0F 4YP3A 2EFVA 2NXUA 1VOMA 4M95A 4NXNF 2C2ZB 1C0TA 3T1HJ 3OTOJ 1FDDA 1BQNA 2MQPA 3G6XA 3U27A 1S6QB 5HBMB 2VU5A 3W2VB 5KFMA 1VJWA 1YBTA 1RAEB 2YQ3A 2VPZB 4M5KA 1RISA 1OIAA 1QDUB 3CJTA 1N32F 4PG7A 1YHQS 1KP6A 2GAGC 1T3NA 3W5XA 3D68A 3P3DA 2BKOA 1T03A 2ADCA 4CDIA 4HKQA 4OJGA 2DJWA 5HSPA 3UR3C 3CCQS 1FKPB 3HT0A 2E5JA 1RT6A 4ZVQB 3KMSA 4RBUA 3Q8RB 1RKIA 4DPWA 5CYJA 4A8MP 3CJQA 6FD1A 3QWUA 5ETLA 2C2NA 3FC9A 1TKXA 1W25A 5DDOC 1FJGF 2ILZA 1HD0A 2GHVC 4KGVB 2ATLA 2QN6B 3HVRA 2FHMA 4R8UA 4DV3F 2F4FA 3H5YA 4IDKA 5DLFA 5LL6d 3GG0A 3SYZA 2XZDB 1BQMA 4DDFA 1CS4A 4WF9Q 1Q53A 4U95A 1Q0NA 2PN6A 5KFQA 2V94A 2BRKA 5KG7A 3D66A 2HK2A 3MWBA 4CM0A 1VQ6S 5IQ6A 1CC7A 2COLA 2OD6A 2LQJA 4MKVA 4GRSA 4LF4J 1AB8A 1S1WA 2O01C 1SJ4P 2YNHA 3I31A 1J5EJ 3NRBA 2C2OB 1UEUA 1AUSL 2WSFC 4EI2A 3KJFB 3BR9A 1K47A 3GWCA 2DH9A 2FC9A 2DNGA 4LREA 4ED6A 1HQUA 1QE1A 2ALZA 2MMYA 2YNGB 1R6VA 4A8FA 2IMOA 3R2DJ 4DCPB 3J7Z5 2KO1A 4I7FA 5E2QA 1QTNB 3THTA 2I6WA 2W9BB 4HI2A 5B0BA 3BSNA 2E5LF 3MEEA 1XMOJ 4DU7A 1Q81T 2OI2A 1S1VB 1I94J 3OR2A 1D9DA 4EFAC 2XGPA 2DIUA 4X84A 2VB6A 4L3NA 2XG8A 2O5DA 1TL7B 5C7PA 3QAUA 3VV2B 2GX8A 3KHLA 4BWMA 3BZQA 1KR4A 4TY8B 1HA1A 4URGA 1EIYB 3LA0A 4NA1A 5B0GA 1NEEA 1GFWB 3LP1B 1UA1A 4W90B 1FVSA 1TUVA 4LFCF 1YIJS 4KKOA 2QSFA 4Y2KA 4C3MA 5IQQA 4C11A 3F44A 2JJ4D 4KGXB 1RAIB 3SV4A 4JP8A 3OVSA 1U1PA 1OO0B 5DM7Q 3MFIA 1E6YB 5DG9A 3CCES 4O0NA 3MOZA 1I1GA 5FIIA 1B0PA 2AU0A 2BQUA 1RWKB 2EBEA 1IKWA 5HP1A 1IM4A 4QR1A 4Q43A 5EGYA 2R8GA 3TUIC 3TZXA 1D8ZA 5L39A 5KG1A 5C2GA 4FYWB 2WAQD 4PPDA 4DZDA 2VBYA 2V8VA 2PI5A 2CYYA 4RU2A 5J2QA 4I67A 4PWDB 1S1TA 3UN3A 2QYCA 3RAMA 4K0KF 2MQOA 3EX7B 1L3TA 3CMES 1MLAA 5IM0A 1M1KT 4NI2A 3RBZA 3CPWR 1SJFA 3D1OA 3MEGA 1TTHB 1N36J 4LQ3A 3R7SB 1Q86T 1EKSA 5CYMA 3H4BA 2KN4A 1GMWD 4I1TA 3VQSA 5BYSA 2PIIA 2BE7D 1SJQA 4IKAA 1FRMA 4JI3J 3LW5C 3QO9B 2F63A 3Q89A 2VHGA 4LF9F 4QR2A 5LOQA 4OYXA 4C48A 1XNQF 4DFMA 1SUQB 4LIWA 2V63A 4FXDA 3CJKB 4J9OA 3TEGA 2HS0A 3JSBA 2VFRA 2LXUA 3C3LA 3AODA 3DLHA 4QWEA 3ADAC 1YJVA 1NXIA 2JEIA 4L74A 1JJ4A 4ZLNA 2ACYA 1NHKL 3D67A 3AHPA 4QU7A 3IP0A 3BJYA 1DARA 2NSBA 1FT8A 2SXLA 2DGVA 2F8EX 1MMLA 1ZPVA 2Z2YB 2GVZA 4LRBA 4XO0A 2G9OA 3LF0A 3KK1A 1SQFA 2XLKA 4OX8A 1O5JA 3W9IA 2KXFA 2RB7A 3LPEA 4C8LA 2DNHA 1YI2S 5DDRC 3VVTA 2WVFA 1HBUA 4MT1A 3RB6A 4P7TA 2XWYA 4A8XA 2V68A 3E51A 2IRUA 2DIVA 1FEEA 1S57A 1MROB 4WP8A 2IY5B 1OS5A 2P9GA 2B7CB 3K58A 2APOA 1TL1A 2R2RA 2Z57B 4ZITA 4X4OA 2FLLA 2W2MP 2XNQA 3Q8SB 3MM9A 4J9VA 4ILMA 2HVEA 3D1QA 1KTVA 2VL1A 2IAJA 5CZVA 2ZBPA 3QJLA 3OTBA 1K0VA 1NJYA 3LOUA 1DTTB 4FYYB 4ZKAA 2XSJA 4DV7J 4RZRA 4H4KA 2QEXS 2R8KA 3OVAA 3W9JA 2LEBA 1U09A 3MCSA 5LM7E 4DCJB 4DI6A 4U9RA 1UWBA 3DLBA 1S7HA 3MPWA 3CNQP 4WFZA 4RNNA 2CVEA 2XZWA 4FF4A 1VI7A 1TV6B 3GQCA 1R7IA 1H2VZ 2DR5A 3LP0A 3HSZA 4A8SA 1N33F 2B6AB 3VAIA 5KFTA 1VQMS 1NK5A 4U7UK 1WKLA 1JXVA 2C1EB 2F9JA 1UKUA 3QZ8A 1TU0B 2J6TA 2H4YB 2RQMA 2Z2LA 1JLQA 2PI4A 4DR7F 2J0SD 3W60A 3NGSA 1RWVB 4M5IA 4K4XA 5L1JA 2R7TA 1XK8A 2FJDB 1J27A 3LGMA 2OP5A 3IN5A 2W4DA 3R27A 4KGZB 2FQQB 3MM7A 2VG6A 1LK7A 4ZP8A 1UW4A 3UR0A 1TAUA 1T9WA 1YDLA 3CF5Q 3OT9A 5DZ7A 5A8WB 4A8WA 2XLJA 3NAHA 5CH7B 2DTJA 1Y5NB 1F5BA 2M88A 4RW6B 2CQ0A 4IQMA 4JI5J 4LT6A 3N4WA 2J0QD 3DRPA 3PRBA 4Y2MA 1R31A 2K1RB 1SIZA 2YVSA 3MR6A 1ICEB 3ISZA 5AXNA 4YN3B 5F3TA 2VZ9A 3WBZA 4DN0A 2OUGA 1C0UA 2GMHA 1LFPA 2WW4A 4E0DA 2MY7A 3FQLA 3BEGB 1WOSA 1GTHA 3QBCA 1QTMA 4NL5A 4YB1P 4WP3A 3LUYA 2IC3B 4CLZA 2RF2A 4FPRA 5KFFA 3K17A 2ZE2B 3NMRA 3JB9k 1EZZB 3D5MA 4ES3A 1L3UA 3GJTB 3POTA 3KK3A 3M30B 2IBOA 1CULB 5KOXA 4ZCIA 3KG0A 5ITHA 2DCLA 4LF2A 2XYPB 4C6AA 3PW4A 4GKJJ 3EVMA 1Y11A 4ES1A 2Z58B 1NK6A 1UL3A 1JQGA 1S1XB 1WKKA 4DV2J 2V9WA 4PQUB 1IQTA 4KAIA 3W61A 2YKOA 4DL2A 2Y1IA 3MM5B 1ZAWA 3DXSX 2YWEA 2G0JA 4B3SF 4LRAA 4I2QB 3BGRB 3P4UB 1HHTP 1VQSA 3CSKA 3GP9A 5THWA 3PIPQ 5B09A 2MZ1A 1WC1A 2UV8G 3N0VA 2RNEA 2LFVA 2J5AA 1JJCB 2M52A 3ETMA 3TRGA 4F4ZA 1SH0A 4XK8C 1K44A 3GR1A 4YR2A 3EM1A 2YPYA 5FDLA 3L4BC 3G6VA 5SUHA 2LEAA 4FXVA 1H2TZ 2U2FA 4O0IA 2AIRB 1U48A 4CO3A 4LBIA 1T8EA 3DDNA 3GCXP 3SMZA 4LVNP 2FD2A 3OPKA 5KFDA 2E7VA 3CC4S 2EFPA 3CO9A 1L3KA 4CI0B 1X7VA 1JLFB 2M9KA 2YBVA 4W98A 4DX8H 1S99A 4WK1A 2CZ9A 2BRLA 2CJKA 4X4NA 4R25A 5D78A 3HSJA 3HSDA 3DLEB 4IFVB 2EK6A 4E2FB 4OZ2A 1R8CA 4HTJA 4KE5A 4ZVGA 2N82B 5IV3A 4DSIA 1IR1A 4DUYF 2GV1A 1VCTA 5E7OB 5HVGA 1SJ1A 2EK1A 3M6VA 3R7BB 1YJ7A 3F0NA 2OMLA 4QIEA 4NLWA 1Z1ZA 3V6DA 4CO1A 4PCQA 3AOCA 4LVOP 4DR5F 2I9SA 1EQMA 5KFYA 2Y1RI 2KXHA 1H2UX 1W26A 3PYFA 1N56A 3LO3A 1VC5A 3QMQA 1DLOB 2V4JA 2FVCA 2U1AA 1E6VA 2ZBRA 3W8GA 1RHRB 4LRFA 4V19J 3QIPB 2UUCJ 3HD1A 5H9FK 4KFBB 5AXLA 4DPYA 3PACA 5D4PA 2ZDPA 1X5SA 2GZOA 3LP2A 3LQVA 5ETQA 2LECA 4EBEA 1SXLA 4KGMA 2KKHA 2AZ3A 3BKUA 3ZZ0A 4AXJA 4KHRA 2RU3A 1CPZA 4I6AA 4HR2A 2HMIA 1NKCA 3MUTP 2H9ZA 5AE1A 4Q0BB 2BJDA 5DO2A 3HK2A 3SSSA 1GMWA 1WORA 2ZD1A 5GMEA 4KB7A 1TAQA 5KFOA 3UWTA 3OLAA 4DL4A 2B7BB 4DG1A 1SL1A 4ID5A 3NS7B 3H98A 3CGIA 2IA6A 3HI9A 3J7AN 1WHYA 2HIYA 1FDAA 3G2XA 1YJTA 1LXJA 5F0UA 2BV3A 1NCLA 2CQPA 4P6QA 4U7UD 2MHEA 4N47A 4KV8A 4OJHA 4B3OA 1IUJA 4ZIVA 1RTZA 3F41A 3SQGA 1K0TA 4CT9A 3MR5A 5A8KA 2Z8QA 2HHXA 4WE1B 4C8YA 2DCUB 4F7VA 2O3DA 3M8RA 4YMEA 5LSRA 1RTHA 3ILIA 4JV2A 1X4EA 4AXIA 4OI6A 3QYYA 1AZSA 2PA8D 2KFNA 3BDEA 2CQHA 4R0JA 1WD6A 4JV0A 3DLGA 1N34J 1HR0J 2ATCB 1HNXF 1NBEB 1V5IB 2FDNA 1TKTB 4B3TJ 1U1LA 1VRUA 5ETNA 3PYGA 5KG3A 2JX2A 1D0EA 2HGNA 3KTQA 2OO4A 2IHR1 1FDNA 1JLEB 1JJHA 2EBGA 3G82B 2HFUA 4IR9A 2YQ1A 3PRVA 3S1TA 1QAJA 4UQGA 4NXMJ 5J1PA 1B64A 3MCOA 1HW9A 2BJ7A 2D9OA 1EETA 3OTCA 3M2VB 4JI0J 1MWQA 3BBCA 2VG5B 3Q2TC 4NXNJ 4RNHA 4GO7X 4OYPA 4IG3A 2MKCA 4Y2AA 2KT3A 3OXFA 3EGZA 2R7QA 3TA0A 2CZ4A 2EEYA 3CJ8A 2DR7A 1O6XA 1TKZB 2VKZG 1N32J 4M5MA 3NBPB 2CQGA 2R7OA 2M7SA 1RTIA 3E3XA 3O5TB 3HHKA 2CPEA 1Z2ZA 3KLFA 4ZN3A 2DISA 3ILJA 4PG8A 1EP4B 2VBWA 1HWUA 2ROPA 3TOQA 2AHOB 2XHCA 4NLDA 2CG4A 2HWIA 3CMQA 3PZPA 2P9CA 3GLJA 2G1HA 3TA2A 4I68A 4L75A 3S01A 2DNNA 1P27B 3VAKA 1FTCA 2Y9HA 1F3VA 4X4SA 5CAAA 4HH1A 3TYTA 1F5CA 1FJGJ 3SBMA 4F4KA 5DDPC 1KS2A 2DVIA 2XI3A 4GO5X 3KJVA 5I42B 4DV3J 2NPFA 3OSPA 2ROEA 5E41A 3V4IA 3EYZA 2HNYA 5C24A 4MAKA 1I6JA 1RCXB 4HHJA 4Y2IA 2LU2A 5F8MA 2F4VF 4ERDA 1SVDA 4F8RA 4Y3CA 3G4SS 4BS2A 2DT9A 1B70B 1XR6A 4F0KA 3MAHA 1WHXA 3CD0A 2QYGA 2UUWA 3FSYA 1SC1B 1X8DA 3OFGA 2J7UA 1NDLA 3M2UA 3PJXA 4YFUA 2V0NA 1RU1A 2YY3A 3MUMP 7FD1A 5FLXY 3NCPA 1OY9A 2W9AA 3GG1A 4ED3A 4ZLLA 3J7A1 2GVDB 2XMKA 4USVA 1XBWA 2GFFA 1R0BG 1DZ5A 4W4MA 1QVGR 2E5LJ 1CQNA 4AFFA 1RT4B 3GCWP 2W9CA 1NJIT 2CJAA 5JVHQ 3T1AA 2VPXB 4R5PA 1QJHA 4PUOA 2D7SA 2KU7A 1F9FA 3RB0A 3MMCB 2X1BA 2DK2A 4RW8B 3ZO7A 1S72S 2DH7A 1MG7A 3FJ2A 4GVBB 2BE9B 2QA4S 3U1MA 7AT1B 1V3SA 2G2YA 2H51B 3QJPA 1SC6A 3GTYX 3CJ4A 4RW9B 1FX2A 1QSSA 3HO1A 3WDOA 4LFCJ 1RT7B 3M6XA 2CDQA 2EFQA 2FJAB 5CXTA 1NZAA 2QL7B 3OD2A 4LRCA 2QLXA 1RYSA 1FKPA 1HWLA 3FUYA 1JJ2R 3NAIA 1PAEX 4KO0B 4MMOA 1P9QC 3WX4A 4ZCKA 3I87A 4ETXA 3VZIA 2B5JB 1ZZFA 2EFNA 4HLBA 2QMXA 3CCZA 3V2UC 5EUHA 1A6LA 3M6WA 2BOPA 1U1MA 2HHSA 2HVDA 5KT6A 1C0TB 2JOQA 4M5DB 3ZNJ1 2MLXA 1V6HA 2W2NP 5F9NA 4K0KJ 3CC7S 3M8WA 1IQZA 5JUMA 4TYAA 4J9MA 2VFUA 4ECWA 2ZH1A 4N8OA 1RDRA 2RRAA 2UUBF 1QAXA 2ILYA 2DBBA 3B54A 3MM8A 2C2MB 4X4RA 4A8YA 4Q45A 2CIMA 4QYRA 2K3KA 2KDOA 1YVFA 4B9UA 1NK9A 2GC8A 4LIRA 3BBBA 1CJVB 1YSJA 2A10A 5K8PA 3PYEA 2BUNA 4KT0C 3DHWC 4LF9J 1XNQJ 4YS2A 2YH1A 1ZTTA 2YNGA 2KRRA 2ZNYA 1UVLA 1JMTA 1PILA 5I3PA 5HLFB 2XI2A 3NGRA 1WTFA 2W9BA 3UD4P 5E3QA 2LDYA 4K5SA 4FDFA 5KFHA 4R8UB 2YKQA 2Y0BB 2LXIA 4PABA 2C2EA 1ZAXA 1TL7A 4XPEA 4DFJA 2FJXA 1R43A 1BQMB 1Y10A 2QT7A 2HZAA 2F8HA 1X9WA 1RXOB 1RBOB 1VQ4S 2B9XA 4KTQA 4TY8A 2ZOMA 5HMZA 5EWGA 4OYBA 1U7LA 4NLGA 1S9EB 1OJ4A 1JWWA 1B3TA 1S1WB 3CJ0A 2C3UA 3WC0A 4XIUA 3LP1A 2ZFHA 2HQDA 2YNHB 2XS7A 1Y3KA 1HI0P 3KDNA 4F04B 2HZCA 2AP6A 5KG5A 2OH2A 1ZBTA 5KT2A 2DHXA 3RRHA 5CABA 3QNWB 1HQUB 4OI0A 2BANB 3U1NA 1VFJA 1QE1B 4KPCA 2R42A 3NGTA 3EE3A 1LEOA 4I7FB 1F9HA 4RNFA 2IYGA 2IA0A 1A7GE 2MQLA 3MEEB 2RILA 3OR2B 3QT8A 1YJ9S 3DLLQ 5G0RB 4Q44A 4QYZJ 2I1RA 2ZUAA 4Q2LA 2FVPA 2MXYA 3G86A 4NA2A 2A18A 3KLHB 3QRRA 1NK8A 2NXCA 4NCGB 3P49B 2CNLB 5MAOA 3KNAA 1NM2A 1VQ7S 1HBNB 2DNRA 1GNKA 3B82A 1OSDA 4AT1B 1RE1B 3DKDA 3HKZD 2OPQB 3MZIA 3HX9A 1TUWA 4KKOB 2MKHA 4C11B 4RNMA 1T11A 1GXUA 2OIHA 2FJBB 1PBUA 5IZHA 2HFSA 1CSJA 2O66A 2OAUA 3QO9A 1B7YB 1RU2A 4DZ6A 5D0EA 2RE1A 2WRMA 2M0GB 4NZ7A 3VWSA 3VF0B 4PPZA 1MMDA 1SUQA 5HP1B 1N33J 1XN9A 3CJKA 3JYTB 4IH5A 1RBLA 3NKYA 2VJVA 5C42A 2H48B 3GILA 5CCLA 3GIRA 4CLTA 3AA8A 4OQJA 2J6UA 3GMGA 3R5CA 3RJMB 4DLGA 4P74A 4DBQA 3TQ1A 3MEGB 4Q8EA 1GXLA 1ZM9A 2ZHOA 5IT9Y 5CYMB 3S7RA 5CHCB 5D4OA 2C3PA 3IAM9 4DSFA 2XMWA 3LH2S 1T3OA 1NJZA 3ENQA 3Q86A 1NPKA 4NRUA 4F50A 1KOHA 2RUSA 2KYZA 2G1DA 2J9CA 1BLUA 2HKEA 4J9RA 2QGFB 1FE0A 4HTIA 4N41A 2XTJP 1MROA 3W63A 2P8IA 2K06A 2YWHA 2HLUA 3ILOA 4M63A 2AJ2A 1C4AA 3CDUA 1RTJA 3M9OB 4ZK7M 1PYOB 1NDPA 4DHVA 2LA6A 3SFGA 4DR4F 1RUSA 4A46A 4DX5A 3JAMY 2XY5A 3VQTA 3EGWB 4TQSA 3IRWP 3NGDA 3HHLC 2J9EA 1BUXA 1DTTA 2GMJA 2GVZB 3KK1B 4WPAA 1FJEB 3TUJC 1CVJA 2NPIA 1OSCA 2D3ZA 2MEWA 3UCZP 2L41A 2DNLA 4H4MB 1N88A 3BPDA 2KT5A 3N6NA 3DOMA 2YKMB 4PYDA 3SSRA 2JLEA 2LXFA 1SCJB 1ZA1B 4AD6A 4HVZA 1WI6A 4CO0A 4WCEQ 4IOAQ 4OZ1A 1EQ0A 4DL6A 2B56A 3DLKB 1TV6A 2JZ5A 2J8AA 1SV5B 4WU2A 4FVCA 1U8WA 3F56A 2ZC4A 5F41A 2FVRA 4QOTA 3D0IE 1HL6A 5KG2A 1R8AA 5I3UA 4B3SJ 2QMUB 2WVDA 3MM9B 2DNYA 3MD3A 1KQSR 3RR7A 3FQKA 1Y4ZB 4OIXA 2YNFB 4ECTA 2F1FA 2CPHA 1YLXA 3I5AA 4BHQA 2E7WA 3PR4A 4DLEA 2K7KA 4UT4A 3QAEA 3ZTPA 5CQGA 5DETA 3EVWA 5KFWA 2LVWA 1RWUA 2D9PA 4QJVA 4O4RA 1UWBB 4WYLA 3BN4A 3PFEA 1NKBA 2K1RA 4I64A 3TZWA 2HQ3A 4ER8A 3LP0B 3RBDA 3L3CA 4JV1A 4UUWA 5HI7A 2RDDA 5D4LA 4M94A 1IBMF 3NOCA 5E33A 5A6PA 2K8GA 4ZPAA 2IM2A 1PBAA 3IGNA 3GJRB 1WF0A 3I0SA 2M4MA 3IMQJ 1JLQB 1VLYA 3OJSA 1RWNB 1KQKA 2IC3A 4DUYJ 5HJXA 4M5NA 1G2EA 2ZE2A 1Q1KA 2QA4G 2VG6B 4F4WA 4N77A 4C8ZA 2KHCA 2UXBF 2HS3A 5AXMA 4ZA1A 3TQEA 5KG4A 3J7YI 4DR5J 2HQGA 3CEDA 3M4XA 1CULA 1IJFB 1H73A 2FYXA 3WZ0A 3OFHA 1KVIA 3DRPB 1RTDA 5CD4A 4G65A 2UXDF 2FHJD 3OXLA 3NP5A 4YB7A 3LTOA 3E8OA 3K5PA 2FY8A 5K20B 2PFFB 1N48A 3W8PA 1C0UB 1TMJA 4PAAA 1WUUA 4PG4A 5KFRA 4JBCA 4LSNB 2B4OA 4Y34A 3US5A 4F36A 5KFLA 3BGRA 1X0FA 1H6KX 3ZXWA 5F8NA 2JH3A 4DV6F 2RF2B 2DHAA 4WFAQ 3B8HA 1U0HA 3JS9A 3K59A 1D9AA 3W7BA 2R8JA 3FBEA 4LF6F 2CJYB 3V6KA 3GYGA 1RAJA 4N5SA 2BMBA 2DXEA 3POTB 4QIGA 3PG9A 1GMUA 4RUAA 2B4PA 2VOPA 1EX8A 1KVKA 4YHHF 2V8GA 1MNEA 1SI9A 1GT8A 4ZVOB 2W01A 4ECYA 4QW9A 1IBKF 2Q6CA 4USJC 2E66A 1IXKA 3D7SB 1HFEL 4NMXA 2ZJPQ 3GFXA 2W8KA 2M5YA 3UCUP 4IUFA 2WVEA 2H4WB 3EZOA 3DLEA 1HNZF 4OFZA 4QR0A 2DGOA 4OHXA 4NLOA 3BGLA 3PHTA 4K4WA 3GIKA 1VISA 4DCOB 1Q8KA 3FK4A 2ASDA 2E5HA 3SCLE 3NLCA 3N79A 3CD6S 2OLWA 4DJBA 2ZOFA 4HDHA 3IAS9 1HNXJ 2RDIA 1PIEA 2HQIA 4U67Q 4PEOA 4M5HA 5FDLB 3UFCX 2DGQA 3DU6A 4UOCA 1LW0A 2JRSA 3UE2A 3VALA 3RW7A 4O3SA 3VAGA 4WFXA 3UDCA 3I55S 1DLOA 5DLGA 4ECSA 3J80Y 1GQEA 3QIPA 1FXDA 4KFBA 2M8HA 2J0XA 1MN7A 3T5JA 4ZPTR 1JNRB 5EN1A 1VRQC 3H90A 3GPAA 1HHSA 1Q8BA 3TI0A 3BSCA 2MQMA 3FFIB 4Q0BA 2VDHA 5J2PB 3O3LA 1NSAA 4MIWA 3PEHA 2O67A 3GFHA 4TNOA 1ZZNA 3CCRS 3IR7B 3L7PA 4K5RA 4KQZA 2B9YA 4GC7A 3CJRA 1CLFA 4U7CA 3UQSA 1NK7A 1WACA 2KXNB 2FY1A 4YUDA 5HO4A 5E5NA 4J91A 2JC1A 2B8PA 5EHHA 4ZPWR 2UVWA 1E6VB 2XYHB 2B0GA 2NXJA 1IBLF 3RAXA 5KT3A 1C4CA 4F0HA 1IVZA 3LP2B 2WONB 5CA5A 5HATA 2ZKUA 1FWKA 2VD3A 4FP9A 4DSKA 5DM6Q 3P8BB 4EBDA 4AYBD 4ELVA 4WFYA 1YGYA 4RU9A 3JTNA 4IG0B 3QT6A 2XM3A 4JOUA 1GAOA 2F65A 4X62F 2BDPA 5F8HA 2F4VJ 2ZD1B 1P1LA 1SQEA 5C25A 4DQQA 4ZJQA 2ASLA 3AD8C 2XZTB 1S12A 4CLFA 4DG1B 4P2XA 3A8EA 4ZIWA 2GW8A 1PC4A 2GHWA 1U1RA 4J7CA 4G1QB 3KHHA 1UEVA 2MQNA 2XHWA 2YX4A 1CJTA 2C22A 2BX6A 1JLEA 2RRNA 2HURA 3G82A 1UEKA 2QSWA 5A8KB 5BXIA 3IWNC 2H5JB 2DGXA 5K9FA 1VLOA 3J81Y 3MAAB 3P5BP 2OELA 5K14B 3M2VA 2P6SA 4PXBA 3HMJG 4F2RA 4C4WA 1H7WA 2M70A 3DCAA 1AZSB 4B9SA 2R2TA 5G4DA 3KG1A 2ZWPA 1RB0A 4UW2A 4KYZA 2XY7A 5KG0A 2OSRA 4ECRA 2BABA 2HBYB 4YDXA 4EWTA 1IM6A 2F5GA 1OMSA 3O2IA 4IH7A 1REGX 2FJEB 4FS2A 1WG5A 2VA3A 1P6TA 3CWJA 3QSIA 3A3PB 2ALYB 5HVHA 3OHAA 4ELTA 2RUGA 1K8AT 3P45B 3DU5A 2JFDA 2UVRA 3Q23A 1N6QB 3NL0A 3MUVP 3RBXA 4ZN1A 2E1MC 2YWKA 1BWVA 5JVGQ 1SKRA 3ICLA 4OZNA 2KM8C 3W65A 1R3NA 1JK9B 2L9DA 2X1FA 5IT9U 1X4BA 2MSSA 4ZVEA 2XMMA 1HWIA 1DTQB 5IXUA 2DNOA 3NNAA 1L3SA 1A0OB 3A13A 2Y8YA 4OI1A 4IG3B 5HANA 3BB5A 1UVNA 4KIAA 4DS4A 1TR0A 1AFIA 2QIFA 1Q16B 3G9CA 3M1VB 1V9OA 5K8NA 2D41A 6FDRA 1YG0A 1XWLA 3AQOA 1UZDA 4DR2F 1RTIB 2UUBJ 2QLBB 4WFNQ 2V8DA 3KLFB 1WC6A 2UXCF 3AA9A 1GK8A 3IR5B 5EWFA 4A8OA 2KT2A 1RT2A 1MSWD 4UTGA 2MB0B 4KHMA 5DG8A 3MD1A 1UFLA 2KG1A 4B9MA 4MKYA 2C28A 4OHVA 3QJJA 3IG1A 3GV7B 2B9EA 2RRBA 5HN0A 2YPZA 2GVDA 5HQ8A 4LBPA 1N0UA 4MTPA 1I5OB 1RT4A 2E29A 3B4MA 1ROFA 4LR7A 4J90A 4RW4B 2HBZB 3NGUA 2B3TB 2HHPA 3ONQA 2ZITA 1TMMA 3MMCA 3PFOA 4RW8A 3D3CJ 4NPOA 3BM7A 1LWEB 3M6UA 4J9PA 4GKKF 4U6PA 1IN0A 1UMJA 4ED5A 9RUBA 2CJXB 3CDBA 4UOHA 4B9TA
chains in the Genus database with same CATH topology
1W7WA 5CABA 4UOFA 3ZTRA 1XQIA 2DY9A 3Q89A 1B99A 1NB2A 1S59A 3BBBA 4ANEA 3FBBA 3JS9A 3GP9A 4KPCA 2BEFA 1S57A 1WKLA 1JXVA 1NDKA 3ENAA 3Q8VA 3NGTA 4O0NA 1NDPA 3FBEA 3VGTA 3EE3A 1LEOA 1PAEX 1NDLA 1NDCA 3FBFA 3FBCA 1B4SA 3ETMA 1NSQA 2DXEA 5IOLA 1MN9A 1NSPA 2BX6A 3NGSA 2B8PA 3FCWA 2HURA 3L7UA 4ANCA 1XIQA 3B6BA 3BBFA 3NGRA 3G2XA 1K44A 4DUTA 1F3FA 1KDNA 2NCKL 1LWXA 4EK2A 3Q83A 3VGSA 1HHQA 2HVEA 2ZUAA 3EM1A 1NCLA 3EVOA 3BH6B 5BXIA 1BUXA 1NUEA 4CP5A 3Q8UA 2HVDA 3VGUA 3PRVA 4F4AA 1WKJA 3FC9A 1NHKL 3EICA 1HIYA 1NLKL 3EMTA 3ZTPA 3ZTOA 5CAAA 4ENOA 3PJ9A 3WX8A 3EVWA 4WBFA 2B8QA 2DYAA 3NGUA 1PKUA 3VVUA 1MN7A 5C7PA 1S5ZA 1NSKL 2AZ1A 4FKXA 4C6AA 3BH7B 4ANDA 3EVMA 3FCVA 3ZTSA 1UCNA 4W98A 1BHNA 4S0MA 3BBCA 3DKDA 3VGVA 3ELHA 2CWKA 1BE4A 3GPAA 2DXFA 3EJMA 1VYAA 2VU5A 4DI6A 3Q86A 1ZS6A 1NPKA 2AZ3A 3DDIA 1HLWA 3MPDA 4FKYA 4UOGA 1WKKA 3R9LA 3B54A 3VVTA 3ZTQA 4HR2A 1EHWA 1F6TA 1U8WA 4F36A 2DXDA 4DZ6A 3FKBA 4UOHA 3Q8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W7W A;  5CAB A;  4UOF A;  3ZTR A;  1XQI A;  2DY9 A;  3Q89 A;  1B99 A;  1NB2 A;  1S59 A;  3BBB A;  4ANE A;  3FBB A;  3JS9 A;  3GP9 A;  4KPC A;  2BEF A;  1S57 A;  1WKL A;  1JXV A;  1NDK A;  3ENA A;  3Q8V A;  3NGT A;  4O0N A;  1NDP A;  3FBE A;  3VGT A;  3EE3 A;  1LEO A;  1PAE X;  1NDL A;  1NDC A;  3FBF A;  3FBC A;  1B4S A;  3ETM A;  1NSQ A;  2DXE A;  5IOL A;  1MN9 A;  1NSP A;  2BX6 A;  3NGS A;  2B8P A;  3FCW A;  2HUR A;  3L7U A;  4ANC A;  1XIQ A;  3B6B A;  3BBF A;  3NGR A;  3G2X A;  1K44 A;  4DUT A;  1F3F A;  1KDN A;  2NCK L;  1LWX A;  4EK2 A;  3Q83 A;  3VGS A;  1HHQ A;  2HVE A;  2ZUA A;  3EM1 A;  1NCL A;  3EVO A;  3BH6 B;  5BXI A;  1BUX A;  1NUE A;  4CP5 A;  3Q8U A;  2HVD A;  3VGU A;  3PRV A;  4F4A A;  1WKJ A;  3FC9 A;  1NHK L;  3EIC A;  1HIY A;  1NLK L;  3EMT A;  3ZTP A;  3ZTO A;  5CAA A;  4ENO A;  3PJ9 A;  3WX8 A;  3EVW A;  4WBF A;  2B8Q A;  2DYA A;  3NGU A;  1PKU A;  3VVU A;  1MN7 A;  5C7P A;  1S5Z A;  1NSK L;  2AZ1 A;  4FKX A;  4C6A A;  3BH7 B;  4AND A;  3EVM A;  3FCV A;  3ZTS A;  1UCN A;  4W98 A;  1BHN A;  4S0M A;  3BBC A;  3DKD A;  3VGV A;  3ELH A;  2CWK A;  1BE4 A;  3GPA A;  2DXF A;  3EJM A;  1VYA A;  2VU5 A;  4DI6 A;  3Q86 A;  1ZS6 A;  1NPK A;  2AZ3 A;  3DDI A;  1HLW A;  3MPD A;  4FKY A;  4UOG A;  1WKK A;  3R9L A;  3B54 A;  3VVT A;  3ZTQ A;  4HR2 A;  1EHW A;  1F6T A;  1U8W A;  4F36 A;  2DXD A;  4DZ6 A;  3FKB A;  4UOH A;  3Q8Y A; 
#chains in the Genus database with same CATH topology
 4ECZ A;  4UZB A;  5GAH U;  2DHH A;  4N8N A;  4CLL A;  2JLG A;  4WP9 A;  4KO0 A;  3I6P A;  1JLA B;  2RS8 A;  4NYZ A;  2DHG A;  1TL5 A;  2ZVI A;  4CTA A;  1FES A;  5FJ4 A;  3LGN A;  1HBM A;  4M5G A;  1H38 A;  3PO4 A;  1KDN A;  1U2C A;  3RTV A;  1LWX A;  3MED B;  4DMZ A;  4M8L A;  2W9C B;  4O3R A;  2LQB A;  2HVZ A;  2DRB A;  4M5D A;  4DPU A;  4HHU A;  4R5P B;  4PUO B;  3CCV S;  3CTR A;  3WC2 A;  2E5G A;  2RH3 A;  2WSE C;  3UDE A;  8AT1 B;  2ZJR Q;  2V5H G;  3T6J A;  1LWC A;  4QPT A;  2CPZ A;  1RAG B;  2JC0 A;  4KPY A;  2ZVS A;  5F8L A;  4ZLJ A;  4FPI A;  4BWJ A;  5EDW A;  2NUU G;  1UFK A;  1RWM B;  1F6T A;  3OR1 B;  5AE2 A;  4KSE B;  2QO3 A;  2FHK A;  3D0G E;  1R8P A;  1CJV A;  4DPO A;  4RUH A;  2KL8 A;  5E3R A;  2PD1 A;  3MOJ B;  4DQR A;  3PDN A;  1H72 C;  1F9E B;  5J2M B;  2MY8 A;  2YX7 A;  3GJQ B;  1NDC A;  4F02 A;  4QU6 A;  5HLF A;  1HD1 A;  3M9M B;  5JJB A;  3BO3 A;  2V69 A;  4NCB A;  4FS1 A;  2AEF A;  1S0M A;  3ISN D;  1G6B A;  1BXN A;  4MFB B;  1RA7 A;  3V81 B;  1F0X A;  1FFW B;  3CMA S;  2HNZ B;  2K7J A;  3BGO P;  3D28 A;  2YKN A;  3FEZ A;  1YZ6 A;  1O0P A;  3MM8 B;  1S9E A;  5KFG A;  1JKH B;  5D8H B;  2V34 A;  4Y65 A;  5IT4 A;  2ABY A;  1KOO A;  1REV B;  1RBA A;  3HJF A;  1DRZ A;  3OSN A;  3AJD A;  3AH6 A;  2BAN A;  3W9H A;  4EBC A;  4WJB A;  1PC5 A;  4TY9 A;  2W2O P;  1MU2 A;  5AT1 B;  1FX4 A;  1F60 B;  2FJW A;  1RGV A;  1C1B A;  5LJ3 Y;  5B0F A;  2KFZ A;  2GJ2 A;  4CLP A;  2OEM A;  5GMK a;  2W7O A;  1CG2 A;  1YTY A;  2LQ8 A;  3HF5 A;  2JVO A;  5G0R A;  4OYI A;  2V2K A;  3PXG a;  4DR4 J;  4L6V 3;  3BS9 A;  2OHD A;  3EZ5 A;  3C66 A;  3KLH A;  4NCG A;  4B9N A;  1RYR A;  1NJW A;  2HWH A;  2MGZ B;  1I51 B;  2FGO A;  3E01 B;  3OL8 A;  2CKW A;  1HBN A;  1LKZ A;  2C2D A;  3KLI A;  2ZHA A;  1L3V A;  2BKP A;  1VQ8 S;  2AGP A;  3H2L A;  3K7R A;  1S1U A;  2LP4 A;  2IDE A;  2V50 A;  3FCV A;  2OPQ A;  4EYI B;  1ZOT A;  3OW2 R;  4RO0 A;  3ELH A;  3CD7 A;  3PO5 A;  4USU A;  1NK0 A;  1S6P B;  3D54 A;  1P8G A;  1OWX A;  2VJU A;  3NWG A;  3LPY A;  2XS2 A;  2DO0 A;  2JVR A;  1Q95 G;  4UOF A;  1SJ3 P;  4LFB F;  3FCH A;  4LF5 F;  1FKA F;  3RUB L;  4HI1 A;  5AJ3 F;  1D9F A;  3M32 B;  3KMQ A;  4CH0 S;  3JYT A;  5ETS A;  2KH9 A;  1XC9 A;  2DR6 A;  2CQ1 A;  2W25 A;  2VG7 A;  3HFZ B;  5T7L B;  4WII A;  3RW6 A;  1TEL A;  4CNZ A;  3V6H A;  5B7W A;  4CRJ A;  3FCW A;  3DRR A;  1UA0 A;  3W5Y A;  2NZC A;  2V4R A;  2NCK L;  1VQ9 S;  3AB4 B;  1XJW B;  3FEY B;  3LAN A;  1NRK A;  1VIX A;  3VGU A;  1HPZ B;  1U0S A;  4Y00 A;  3OV7 A;  2G4B A;  2NXE A;  1UWA A;  2AD9 A;  2P5V A;  4DSL A;  1VBY A;  2HEK A;  3TX0 A;  4CM2 A;  3TR5 A;  3THP A;  3ZTS A;  3LAL A;  1OQ6 A;  3BQ1 A;  2KJW A;  3IRX B;  2R8H A;  2CZV C;  2OPP B;  1IBM J;  3I5C A;  1O8B A;  1ZTW A;  5L1I A;  4J9S A;  2OD4 A;  4QWC A;  5C42 B;  1AYE A;  1OQ3 A;  3RRK A;  2LCW A;  6AT1 B;  1RHJ B;  1VJQ A;  4DEZ A;  5D0R A;  1B0T A;  1RAD B;  4IRK A;  2IRX A;  4ZCL A;  3VTI A;  3SV3 A;  3UDV A;  2UU9 F;  1BMQ B;  1KQF B;  2EG1 A;  2LYV A;  4TN2 A;  1N5Y B;  2UXB J;  3P5T L;  1VRT B;  2W4C A;  2OFG X;  4H4M A;  2N3L A;  4OZL A;  1FD2 A;  1WOO A;  2AJ4 A;  4DSJ A;  1N54 B;  4NEY A;  4NX9 A;  4P7V A;  5B08 A;  4C97 A;  2YKM A;  5L9X A;  1FNX H;  2D3U A;  1FER A;  4M5L A;  4KR0 B;  2IIH A;  2UXD J;  4CLW A;  3K5O A;  1R0A B;  1D09 B;  1YJR A;  3HHE A;  1KFD A;  3DLK A;  4DR1 F;  1SV5 A;  2XCP A;  2HIQ A;  4X64 F;  2J7K A;  2XMU A;  4WTO B;  2A3J A;  2EXU A;  3C15 B;  1HNI A;  3H2V E;  3AFG A;  1RTJ B;  2QG9 B;  4DSE A;  4USM A;  3I0R A;  1VQP S;  1H74 A;  5I3Q A;  3SSQ A;  1HWK A;  4DV6 J;  4QCL A;  1X0P A;  4X2B A;  1HBO B;  2YNF A;  3DI6 A;  3HVT B;  2GIF A;  4LF6 J;  1VQY A;  3J81 U;  3W5Z A;  2ZHB A;  3BQ2 A;  4UST A;  2AX1 A;  2RDJ A;  3A8J A;  4NLS A;  5KT7 A;  2Q1L A;  2DD8 S;  2F3J A;  1RWO B;  4YHH J;  4G1I A;  1XMQ F;  3DOM B;  1EB0 A;  3RYL A;  2IDL A;  1IBK J;  2ZKT A;  3SCI E;  4XDD A;  2YWW A;  2DRD A;  1DQ8 A;  2VF3 A;  4NAS A;  3VVU A;  1QUP A;  1T0T V;  1LFW A;  4NLR A;  2PMW A;  1K1Q A;  4PXD A;  4PXE A;  2X51 A;  5SZT A;  1ZM4 A;  2KZZ A;  4HHH A;  2MTL A;  3H7H B;  3GE9 A;  2RKI A;  3QFW A;  3GZ7 A;  4FNH A;  5I3U B;  2XLI A;  1LW2 A;  3DMJ B;  2CWX A;  1HNZ J;  3TAM B;  1VQ5 S;  1FRX A;  3IWL A;  2VIC A;  4PG6 A;  3TX8 A;  1FK9 B;  2N4D A;  2NR0 A;  3QRQ A;  5ADZ A;  3HJV A;  3JXO A;  1UFW A;  2ERR A;  2RSQ A;  1FI4 A;  1QAY A;  1XTZ A;  2FUG 9;  3IBC B;  4F0M A;  5LSL A;  3KYL A;  5B0C A;  1FTR A;  4ZPV R;  1NU4 A;  2QZ8 A;  2AV5 A;  3M8Q A;  4Z37 A;  5GAD U;  1AA1 B;  3EVO A;  2GNK A;  4C8M A;  3TVZ A;  3RU0 A;  1GX5 A;  3ZTO A;  2IPO B;  3DOK B;  1RAF B;  4K4U A;  3PTW A;  4F3O A;  2PC6 A;  2GS8 A;  2VBX A;  3CJ2 A;  3VGV A;  1S48 A;  1DQ9 A;  3DOL B;  3T3F A;  1NAQ A;  2VH7 A;  3I0S B;  4X4V A;  4LSN A;  2L48 A;  2LU1 A;  4C0B A;  5DGB A;  3L7O A;  1BGX T;  1ELO A;  4OZJ A;  3G87 A;  3IBW A;  2Q43 A;  3BR8 A;  4M5J A;  2A6O A;  1ZET A;  3M8P B;  3OFF A;  3NXZ A;  3NOG A;  2QFJ A;  4LFA F;  2V6A A;  2AGQ A;  3H8Y A;  3UPF A;  4FF1 A;  2NRE A;  5HQM A;  1FKO A;  1MMN A;  1QUV A;  1X31 C;  3H5S A;  4B3M F;  4DFK A;  4N7T A;  1UPM B;  5CD4 H;  2XO6 A;  3A3N B;  1RTD B;  3QID A;  3AOA A;  4EZ9 A;  3Q8U A;  2CPJ A;  4ZVR B;  4OLP A;  3D6T B;  3MM6 A;  2DO4 A;  2QLJ B;  2XO7 A;  4ZHR B;  1IBL J;  1T9V A;  2B9W A;  3VAF A;  4OLO A;  4ETZ A;  3GSI A;  3P96 A;  4WXW A;  1WNE A;  2XWX A;  3AXK A;  4DR3 F;  2AT1 B;  3JQK A;  4RWW A;  2DXF A;  1Q7L B;  2FPH X;  2MZJ A;  4D3H A;  3S8S A;  4IOC Q;  4N76 A;  2W1B A;  1U6Z A;  2H65 B;  4PXC A;  4ED0 A;  1PJ7 A;  1U0H B;  1IKX A;  3RB4 A;  4X62 J;  2PEB A;  1EKR A;  3FKB A;  1RWW B;  5L46 A;  3CDE A;  3TJA A;  1XER A;  4WTY A;  2X1G A;  4CWB A;  4B9V A;  3BKF A;  4IR1 A;  3KG4 A;  4B02 A;  3DNC A;  4F2S A;  2G2O A;  2PMZ D;  1CJU B;  4BDP A;  1R8B A;  5ETT A;  2W8L A;  4ECX A;  2V8P A;  5CZX A;  3HM9 A;  4O3O A;  4EU0 A;  5HL7 Q;  3UNY A;  2AYM A;  4WU3 A;  1M5H A;  3HVW A;  2CNN B;  1CEZ A;  3AJ1 A;  1TK5 A;  3EXC X;  4DWI A;  2NS1 B;  1KON A;  1GMV A;  1U1K A;  1H0H B;  1PSD A;  3N6L A;  1G7C B;  4Z7C A;  3PR5 B;  1WG4 A;  3UI3 A;  1IKV A;  2VQF F;  2JHE A;  1ZH5 A;  3N5B A;  3ZZO A;  4CLS A;  5HMY A;  4I56 A;  4QIF A;  3IBF B;  2HND A;  3QQC D;  3D6M B;  3FFI A;  1NME B;  3R8Y A;  5J2P A;  4OZ3 A;  1SKU B;  4ILL A;  2ACM A;  1H98 A;  2QA1 A;  3NNC A;  2FHO B;  3AQP A;  2CJQ A;  1H7X A;  4MKB A;  2P6T A;  2BE2 B;  5J1E A;  5KAK A;  5KFZ A;  5HVF A;  1X9M A;  3HVA A;  2I5J B;  1LW0 B;  3H40 A;  3ILL A;  4ALZ A;  3TVY A;  1Y7P A;  1FEH A;  5F8I A;  5DG7 A;  1HYS A;  2B4V A;  2MZQ A;  2IVY A;  2V67 A;  1EAY C;  4P2M A;  2WON A;  4YOE A;  5H9F J;  2JLF A;  1WJ9 A;  4ZVP B;  4LMZ A;  2MLY A;  3V4M A;  3ISN C;  1KRP A;  3OJU A;  4JI4 F;  1YIT S;  2PO4 A;  1AUD A;  4C2M A;  1R89 A;  4IG0 A;  2IFX A;  4NLV A;  3O8W A;  3FVY A;  3K89 A;  3EDR B;  3R5A A;  4OX7 A;  1DY3 A;  2UUA F;  2VPW B;  4FKY A;  3UDL A;  3HHL D;  4YB6 A;  3N28 A;  4ZP6 A;  4DR2 J;  2QE5 A;  4NML A;  1WF2 A;  3ENW A;  1RT3 A;  2CNO B;  3IWX A;  3PEJ A;  1NB2 A;  4ANE A;  1RHM B;  3CC2 S;  3IO1 A;  4G1Q A;  2UXC J;  1FA0 A;  4CLU A;  2YWF A;  3LAK A;  1DBD A;  2OJ3 A;  2GA7 A;  4OYO A;  1AFJ A;  1M5V C;  1IR0 A;  2NSC A;  4GC6 A;  1MN9 A;  1FFG B;  2X1A A;  1VQO S;  2C3M A;  2YTC A;  2GML A;  4OYZ A;  3MAA A;  3GFY A;  5K14 A;  1SKS A;  1KNZ A;  4F4A A;  2OPR B;  2ZZN A;  2GO9 A;  2FVS A;  3CD5 A;  4RWX A;  4CCH A;  1SIW B;  2DNZ A;  4KBI A;  5LXY A;  4USI A;  3I4P A;  5E0O A;  1C1C A;  3T6B A;  2BR0 A;  3RZA A;  3QGH A;  5C25 B;  4H4O A;  3MI7 X;  4K2X A;  4QBU A;  1T02 A;  4B9L A;  2N7Y A;  4AQY F;  3ZFV A;  4JI2 F;  2X7I A;  3HZE A;  4GKK J;  1HQE B;  2PE8 A;  4L72 B;  5KFK A;  3OVB A;  2OEJ A;  1MWY A;  1CJT B;  1RAB B;  3HHD A;  3AXM A;  3AY0 A;  2NXN A;  3TAN A;  3DGP A;  4DL5 A;  2L9W A;  2JNJ A;  3V6J A;  3C6T B;  1N6Q A;  4TU7 A;  1EJ7 L;  2P2C B;  2C2R A;  2E9T A;  1V3Z A;  4MK9 A;  2VQE F;  1Y3J A;  8ATC B;  3FMB A;  1DTQ A;  1DFD A;  1WTB A;  2EWH A;  3P6Y C;  3SDE B;  1LV5 A;  4MIA A;  2BQR A;  2M3D A;  3WX8 A;  3MPU B;  4K8R A;  1L5U A;  2A2D A;  2AEJ A;  2E9R X;  1SJR A;  4CQ1 A;  1NND A;  2E1P A;  4MYU A;  3FNN A;  1TVR A;  3NNH A;  3M1V A;  3HUL A;  4U8Y A;  1UVJ A;  1VYA A;  2JEJ A;  3H20 A;  1JXE A;  4RPF A;  3NMA A;  5CYQ A;  4X4P A;  5K8M A;  4ZPD A;  3FDS A;  1YBU A;  1QD1 A;  1O51 A;  5D15 A;  2PMH A;  2I8E A;  1U1N A;  5HAO A;  1X4H A;  3JTO A;  2BAC A;  2E9Z A;  2MST A;  2BEF A;  2QX0 A;  4QPX A;  2J7W A;  1Q79 A;  3BGF A;  4J5O A;  2RT3 A;  5KTQ A;  2XYG B;  2CDR B;  5IWA F;  2XMJ A;  4W92 B;  3BGU A;  3KK2 B;  4WZQ A;  2J8S A;  2OGU A;  3K5L A;  3B6B A;  4TVA B;  4NYO A;  1RQ0 A;  2R7W A;  1Q82 T;  4F4X A;  1NUE A;  3GIM A;  1J5O B;  1WC0 A;  2CFX A;  3C16 A;  4RW4 A;  2HRT A;  3BKT A;  3G71 S;  1RT1 A;  4TLR A;  3DC2 A;  4FYX B;  4FF3 A;  1D8Y A;  5L9N A;  1ZYQ A;  3G96 A;  2HHU A;  1SQG A;  1LWE A;  2R7V A;  4C0H A;  1KQG B;  3G6E S;  1WEL A;  2H5I B;  1RT2 B;  1U25 A;  2AQ4 A;  3T1Y F;  1BC6 A;  1KLM A;  3DM2 B;  1FJ7 A;  3PY8 A;  4WK3 A;  5A0Y A;  4JI8 F;  1JLA A;  3H42 A;  3AJ2 A;  1FNO A;  4O44 B;  2YQ0 A;  2RVJ A;  4CIO A;  2E5I A;  3IG1 B;  3TVK A;  1FHT A;  3DRS B;  2L08 A;  3CO0 P;  5JMN A;  4QIW D;  4CO2 A;  1OPI A;  2EFO A;  3MED A;  2KJV A;  4X4Q A;  3G8Q A;  2VC0 A;  2Q3P A;  5DS7 A;  2E1R A;  2LEP A;  3MDF A;  3NWR A;  2J9D A;  2RS2 A;  1RT5 B;  2FZC B;  1A9N B;  4O3Q A;  4BCA A;  3ZZU A;  2W4P A;  4ED7 A;  4ELU A;  5E3A A;  1QM9 A;  4IOB A;  4UY8 5;  5F8J A;  2PT0 A;  4K7Q A;  2YNI B;  3I9Z A;  1VDH A;  3OTE A;  4QWB A;  3QZ7 A;  3K0J A;  1RLD A;  2RD5 C;  3OR1 A;  4OYM A;  5DQH A;  5CCM A;  4CH1 A;  4J9U E;  5ETM A;  3BRE A;  2HFV A;  1OY8 A;  4I0W A;  3K8V A;  4CTA B;  2PGC A;  5GVQ A;  5J2M A;  5BR8 F;  4E98 A;  3PYD A;  3PX0 A;  3TUZ C;  1HBM B;  4LFB J;  1F2H A;  4LF5 J;  2GQQ A;  1RKJ A;  4DQP A;  2BXJ A;  5AJ3 J;  2ASJ A;  2UZA A;  4LSL B;  1LWF A;  2BOA A;  2FZG B;  4DPT A;  4MFB A;  4DV1 F;  3V81 A;  3G8T A;  2HNZ A;  2HHW A;  3IA0 A;  5B0E A;  3PNI A;  2FVQ A;  2HAI A;  1X5T A;  1LWC B;  4J9N A;  3CJS A;  4ICL B;  3QT7 A;  2VIH A;  1S9G B;  2DRA A;  3HXM A;  2XS5 A;  1H3D A;  1Z2L A;  3W62 A;  2DHS A;  4P2F A;  3K8W A;  3C6U B;  1XR7 A;  2CAJ A;  4JI6 F;  2HRY A;  3I4H X;  1JKH A;  3R1L A;  3TAR A;  1WC4 A;  3MR7 A;  3KFW X;  1M5K C;  1S0N A;  2AF6 A;  5M2U A;  1YX2 A;  1REV A;  4OHW A;  1BQX A;  2ZBI A;  1HWJ A;  2VUG A;  1UZH A;  2NLW A;  2AMC B;  5HRO B;  1S0V A;  2BM0 A;  1FDB A;  2F40 A;  1UW9 A;  3NS6 A;  4EMD A;  1B99 A;  2Y1L B;  2HFZ A;  1T9Y A;  1N5V A;  2RML A;  1VGY A;  3SCJ E;  3I5B A;  2WOM B;  1B4S A;  1KHW A;  4ANC A;  2ZOG A;  1WC3 A;  3DHX A;  2UU9 J;  4BBY A;  4DL0 C;  4MKA A;  2MGZ A;  2YKN B;  3E01 A;  2WSC C;  3ZZR A;  2DEI A;  4RUC A;  4USH A;  4JUZ A;  3KLE B;  4HYK A;  3E2E A;  3NEK A;  2F9D A;  3D3B J;  1QSY A;  4O3N A;  2MHN A;  3MMA B;  4KGK A;  2YXL A;  4GMK A;  3IR6 B;  1S6P A;  2CG8 A;  3RB3 A;  2IVM A;  2KYX A;  1MU2 B;  2BW7 A;  2GQC A;  2KVI A;  3EDQ B;  4NRT A;  4DR1 J;  3OLB A;  2DGW A;  3TEH B;  4X64 J;  2BBE A;  4XPC A;  2HAF A;  4RJV A;  5H9E K;  1C1B B;  3GV5 B;  1HAR A;  2CQI A;  4DOZ A;  1JLG A;  5H9E J;  3I96 A;  3O6Q A;  5E3P A;  5A8R A;  2J76 E;  3M32 A;  1S59 A;  1QAI A;  4RL1 A;  4KH1 B;  3R1H A;  1Q5Y A;  2N3O A;  3JSR A;  2IM0 A;  4R0E A;  3HHL A;  5T7L A;  2H3E B;  3C14 B;  4X66 F;  3GIJ A;  5GAG I;  1OY6 A;  1FJC A;  3KLG B;  2QC3 A;  3PW2 A;  2GGP B;  1JX4 A;  1NK4 A;  3IM8 A;  3H2U B;  1R6Y A;  3DYA B;  4A8Q A;  1UVK A;  4IFY A;  1HPZ A;  2EFG A;  3KLI B;  1RHQ B;  3IXQ A;  3PKM A;  3H25 A;  3MR3 A;  2BKN A;  1S1U B;  4HL9 A;  4I2P A;  1NLK L;  5KFA A;  3L09 A;  4OX6 A;  5D6G A;  5L1K A;  3T9N A;  1XMQ J;  3AD7 C;  3EUN A;  3FRZ A;  1LK5 A;  4FKX A;  1IKY B;  1FRH A;  1JLB A;  3UD5 A;  1BHN A;  2QTW A;  5BJR A;  3QLH B;  3IRX A;  1BE4 A;  4JI1 F;  3KDO A;  4P75 A;  3KJN B;  5AXK A;  4K2J A;  1ITP A;  1WF1 A;  4B3R F;  3DDI A;  1XMB A;  2DEJ A;  2OPP A;  3MHY A;  3R9L A;  5KFI A;  1QVF R;  3UW1 A;  4B08 A;  1D3W A;  2RQC A;  2VG7 B;  2CA9 A;  3M8Z A;  3U7J A;  1ZM2 A;  4PYA A;  4Q2M A;  3WIV A;  1KBR A;  4O3P A;  4GVL A;  2GO8 A;  1M5P C;  2DNQ A;  3DRR B;  1PYT A;  3M2R B;  3U02 A;  3KUE A;  2AYG A;  4ZP9 A;  3FEX B;  3R2C J;  2IMW P;  3BYR A;  3A1Y G;  1CJK B;  3EGN A;  1XIQ A;  5F0W A;  2DY1 A;  1N5Y A;  1RI7 A;  2VFS A;  1VRT A;  2BZ2 A;  3VGS A;  1GXT A;  5ETP A;  1S4E A;  5K5M A;  1CC8 A;  4RX6 A;  1NPR A;  1VC0 A;  3CJ5 A;  2BVZ A;  4ENO A;  3NY0 A;  2HVH A;  3TP2 A;  4MH8 A;  2V8H A;  1Q78 A;  1SBR A;  3OBI A;  1R0A A;  2YWG A;  1F1B B;  4QWA A;  4RBV A;  3VAH A;  3H4D A;  1FO1 A;  2J6S A;  3CUN A;  4H4K C;  3C15 A;  5JXS A;  4ZOS A;  3NG8 A;  3KNG A;  5KFB A;  1FD8 A;  1RZM A;  1YKW A;  1TK0 A;  2DGT A;  1YRT A;  2LQ9 A;  3Q8Y A;  1B7F A;  5HMW A;  4NLU A;  4NCA A;  1VHF A;  1HBO A;  3HVT A;  1JLC A;  3TJ8 A;  4LFA J;  3VGT A;  1T7P A;  4Y0F A;  3G6Y A;  1SC4 B;  1YWX A;  3MCM A;  4ZPB A;  1GTE A;  5HK4 A;  2JFK A;  1VMB A;  4OJ1 A;  4DQI A;  2IM1 A;  2H5E A;  2OTJ S;  4B3M J;  1R0C B;  2ZNZ A;  3ITH B;  3DFE A;  2HFN A;  1VBX A;  3SEO A;  2EC0 A;  4LRD A;  2ASY A;  4YR0 A;  2PEH A;  4RW7 B;  1NO8 A;  2GHP A;  2G0I A;  2G0C A;  1KEK A;  4FF2 A;  1NB7 A;  3M05 A;  5C5J A;  2Z2M A;  1X4C A;  5F9L A;  1HNI B;  3SZ2 A;  3VAM A;  3RRG A;  4DR3 J;  4ZPC A;  3TJ9 A;  3I0R B;  3DMJ A;  2VOD A;  2CQ3 A;  2C42 A;  3TAM A;  2RHS B;  3MCN A;  1N52 B;  2WZ1 A;  4G3I A;  2HW3 A;  2LA4 A;  3HHN B;  1FK9 A;  3R97 A;  4UQT A;  3DI6 B;  4FNI A;  1RHK B;  2KG0 A;  3T19 A;  4PKD B;  3LWM A;  3R6L B;  1T9U A;  2H54 B;  2MZS A;  4K4V A;  5KFP A;  2EI5 A;  2KTQ A;  2XNR A;  1U8S A;  5EX3 A;  3MR2 A;  1I3O B;  2BJ8 A;  4ITS A;  4LF8 F;  4EK2 A;  2ZM6 F;  4AL6 A;  3C2P A;  1SH2 A;  4HH0 A;  4FYV B;  3HZG A;  3DOK A;  5DGA A;  1UP1 A;  1UPP A;  3CCW A;  5M2R A;  1TUG B;  3JSM B;  2KHD A;  3AT1 B;  1TFY A;  4DV4 F;  2RKI B;  4KC5 A;  1G1X A;  3W2W B;  3D4J A;  3DOL A;  2WTF A;  3GSD A;  2ZH7 A;  1LW2 B;  1X5P A;  2VQF J;  5MLC V;  1FXL A;  4X65 F;  2Z2Z A;  2DR8 A;  1WHV A;  4BC7 A;  4LBH A;  2WVC A;  2Z30 B;  5DRK A;  1Y5I B;  1AW0 A;  4K4S A;  5KFX A;  3CCT A;  3M8P A;  3A3O B;  4Q5V A;  3MEK A;  1T94 A;  3JSY A;  4P10 A;  3JQM A;  1NDK A;  2AYE A;  2QA2 A;  3M8Q B;  1S0O A;  3HPO A;  5D3G B;  1HMV B;  1S4F A;  2RU9 A;  5J2N B;  1FRJ A;  4F25 A;  5ETK A;  2BJE A;  3KHR A;  2CQD A;  1RAH B;  4ZJL A;  4P2S A;  2OSQ A;  5RUB A;  4ZHR A;  2AJ0 A;  2A6M A;  1X5O A;  1T9X A;  2MYF A;  2JL9 A;  4TU9 A;  4DF4 A;  2PFD A;  4J9Q A;  2POK A;  1KHV A;  5IFM A;  4CYU B;  2HHH F;  3W64 A;  4K59 A;  3WHI A;  3DXB A;  1T05 B;  4JI4 J;  1XEZ A;  2VFV A;  3A12 A;  1WI8 A;  3EWG A;  2Y1J A;  2AKW B;  4RR5 A;  2QRR A;  5U47 A;  4P72 A;  1UAW A;  5FLX U;  2UUA J;  2NUH A;  4XTT A;  5E3C A;  3KLV A;  2LMI A;  1FKO B;  3IGV A;  2ZWO A;  3EPI A;  2WHO A;  1GH8 A;  3GFZ A;  2OTL S;  4F26 A;  4WKY A;  1CJU A;  2ZH8 A;  3I82 A;  4DUZ F;  1APS A;  1AT1 B;  4DR6 F;  5LT5 A;  2WB1 D;  1KN6 A;  2Z4P A;  3MM6 B;  2AJQ A;  1M90 T;  4WIQ A;  1QY7 A;  3ZC4 A;  1M1H A;  1RWP B;  2LLZ A;  2BQ3 A;  2BJ9 A;  4ZVF A;  1S77 D;  1XR5 A;  1RP5 A;  5GAE I;  2DGU A;  4DPX A;  1YJW S;  2HPU A;  2C3O A;  1IKX B;  4LF7 F;  4OYW A;  3R7N B;  5B0A A;  3Q22 A;  5KOW A;  1CQM A;  2DB1 A;  2IJR A;  4IYQ A;  4URQ U;  3UVJ A;  3MPD A;  3IS9 B;  3HT3 A;  1HNV A;  1X4D A;  1U45 A;  1EHW A;  2BE2 A;  4KHP F;  3Q8Q B;  4AQY J;  2MKJ A;  4O4G B;  2EKY A;  4JI2 J;  1XQI A;  2HSE B;  3A8K A;  2FJV A;  2I5J A;  3I9V 9;  5LJ5 Y;  3QFH A;  3B78 A;  2G13 A;  2VPY B;  2VON A;  4NZ6 A;  2GJF A;  4QZV B;  3ETO A;  3OTD A;  3TZY A;  2RAQ A;  1FCA A;  2D74 B;  1EAR A;  3PW5 A;  2FZK B;  2ROG A;  5GMD A;  4WKR A;  1W2I A;  2OPS A;  1ACM B;  2JSX A;  3TA1 A;  4CLK A;  2VQE J;  1IKV B;  3KXD A;  3SFU A;  3R5G A;  4JI7 F;  1T9T A;  1TL3 A;  2I2Y A;  1TFW A;  5GAH I;  3HCX A;  4WBF A;  2HND B;  2J9D E;  3ET6 A;  4OYA A;  2Y3Y A;  1WEX A;  3V5R A;  3CXC R;  2ZH6 A;  4Y6I A;  1TP7 A;  3KUG A;  3QGP A;  3BDP A;  3W3S A;  4PR6 A;  2BJ1 A;  2P9E A;  4DL7 A;  2CWK A;  4HEA 9;  2H1Y A;  2ZC3 A;  2IBK A;  3AAW B;  5J1E B;  2RQ4 A;  2V2Q A;  3D9B A;  3UD3 P;  4FBU A;  2YH0 A;  3ZTQ A;  4JYA F;  1HNW F;  3TW0 A;  1Q8L A;  2DPI A;  3PIO Q;  4LJM A;  2ZH9 A;  2D1C A;  2DIT A;  1TQL A;  2MKY A;  5A2Q Y;  2MPU A;  3OQ2 A;  4ECQ A;  2BW2 A;  3FZ2 A;  1S6O A;  4I4B A;  1HYS B;  2CQB A;  4HAC B;  4LUB A;  1J2V A;  2M2B A;  1PCA A;  3BYP A;  2A1B A;  4DF8 A;  4WWS A;  2HS4 A;  3MEC B;  2XGQ A;  1N4L A;  4QWD A;  2XMV A;  1Q5V A;  3UN5 A;  2DGS A;  4XDC A;  2UUT A;  4B17 A;  5IWA J;  1M5O C;  3NS5 A;  2OPR A;  2K3I A;  4J37 A;  4OI4 A;  5LMN F;  2ZUG A;  2C3Y A;  2EPI A;  5D77 A;  3EIC A;  1V5V A;  1B0V A;  1HIY A;  1FE4 A;  3CW2 C;  3FGV A;  5D0H A;  5KT4 A;  2G2Z A;  1SB6 A;  2EC2 A;  1DJ0 A;  3DRX A;  2HQF A;  4C98 A;  1UJ6 A;  4PWW A;  2O1P A;  4DV0 F;  3TWZ A;  3MMJ A;  2CJ9 A;  3C8Y A;  2ZZT A;  1RT3 B;  2Z0G A;  1NPP A;  1VR6 A;  1ZAV A;  2WW8 A;  3FRY A;  1HLW A;  3VHQ A;  3OUY B;  1HQE A;  3TUP A;  4DX6 A;  2CUY A;  3KWM A;  1S6Q A;  2RJZ A;  3UNG C;  5HBM A;  3OFE A;  2B4U A;  4AND A;  3W2V A;  4K50 A;  3EZU A;  4TKT A;  3QAT A;  3CCM S;  1U1Q A;  5IC6 B;  3T1Y J;  3HDS A;  1Z4U A;  2Q66 A;  2A2C A;  3TAQ A;  4JI8 J;  2VAS A;  3MMB B;  4RNO A;  3C6T A;  4USW A;  2W7P A;  2I38 A;  1S76 D;  2CXE A;  1N8R T;  2AYB A;  2OMO A;  2BJ3 A;  3KKF A;  5IOL A;  3NGK A;  2X3G A;  1FWL A;  3N01 A;  4YY3 F;  4ILR A;  2PSZ A;  3CIM A;  2MJN A;  1UTA A;  3ZNU A;  2N7C A;  3SDE A;  2XB2 D;  5BYR A;  1FWP A;  1G3O A;  1UVM A;  1RCO B;  1C1C B;  4OX9 F;  2ZH2 A;  1Y00 A;  4H4O B;  2VC1 A;  2DKO B;  1IWA A;  2JEF A;  3C46 A;  4OHY A;  1UCN A;  1K9M T;  2HGM A;  4DQS A;  1BQN B;  5A6W A;  2CVI A;  4OI2 A;  1SL2 A;  4P9S A;  1N5S A;  3C19 A;  2RHQ B;  1RWX B;  3DGP B;  3L95 X;  1IJE B;  5ETR A;  3M8Y A;  1U26 A;  2YKP A;  4HT7 A;  2DNM A;  4F4Y A;  3D2W A;  2KRB A;  3J7Z T;  5BR8 J;  1T03 B;  1MW7 A;  3KK2 A;  3T9Z A;  4TLQ A;  4RKU C;  1PGZ A;  2R8I A;  3CT9 A;  2LDI A;  2MZR A;  3G8S A;  1RA6 A;  1RT6 B;  1S79 A;  2Z56 B;  4TQR A;  3BO4 A;  1J5O A;  3K2Y A;  2Y0S D;  4DV1 J;  4ED8 A;  3H5X A;  2C2K B;  4HT5 A;  4FXW A;  1X60 A;  4C9D A;  3S6E A;  4DV5 F;  1TVR B;  1TKX B;  2KVQ E;  2K2P A;  4ZMM A;  3A4T A;  2BM1 A;  4FZV A;  2NYH A;  1X4A A;  8RUC A;  1Q8I A;  1PO6 A;  1S1V A;  5KFU A;  1XNR F;  4OI3 A;  5CYQ B;  2VA2 A;  5KFN A;  3BO2 A;  1IR2 A;  4JI6 J;  1WSV A;  4IDK B;  3K57 A;  4NLY A;  1QLN A;  2FLN A;  2WCX A;  5B0D A;  1KWM A;  4A47 A;  1CS4 B;  3JAM U;  3N9U C;  1VIO A;  4JV5 F;  3DM2 A;  1RSC A;  4CO5 A;  4ZS6 A;  3X3U A;  4EGL A;  2CJB A;  1UJ4 A;  4O44 A;  1S7I A;  4LF1 A;  3OXG A;  1LXN A;  3DRS A;  1SKW A;  4I6W A;  3QRP A;  2F7V A;  5I4M A;  4WZM A;  3X1L B;  1NJX A;  4UY8 T;  2UV8 A;  1OYE A;  3L9Z A;  1PAU B;  3C16 B;  1E6Y A;  5T14 A;  2ZH5 A;  1OYD A;  5LMU F;  1RT1 B;  3PW0 A;  1RT5 A;  5IT0 A;  5KFC A;  4X4U A;  5DZ6 A;  3DN9 A;  4L73 A;  1F5A A;  2AJ1 A;  4QYZ K;  5L8R C;  4EEY A;  2D3O 1;  3T1H F;  1Y0H A;  3OTO F;  3Q2S C;  2FHJ A;  4Y2C A;  1NSK L;  3CCL S;  1W2B R;  1C2P A;  1N0V C;  2YNI A;  4EZ6 A;  4DU8 A;  1NKE A;  4OMF G;  3EJM A;  5F3Z A;  2HGL A;  4PWD A;  1KLM B;  1VBZ A;  5A0Y B;  1KTQ A;  1Q4R A;  4IRC A;  1SC3 B;  1X4F A;  3EPG A;  1URN A;  2MKI A;  2D69 A;  2QLW A;  3M9N B;  4CZC A;  3RGI A;  3DGV A;  4V19 X;  2KI2 A;  4NLT A;  4LSL A;  3FBF A;  1VS3 A;  4X66 J;  1NSP A;  2WK4 A;  4DS5 A;  3CB4 A;  2R7U A;  3BBF A;  3CCU S;  4C3K A;  1IKW B;  3ENV A;  1HI8 A;  5LSO A;  1JXL A;  3PJW A;  4ZVH A;  5FD1 A;  1YK9 A;  4ICL A;  2XUL A;  5EX0 A;  1S9G A;  3ULH A;  1BY9 A;  2R7R A;  2R9L A;  2IJN A;  1ULR A;  2HYI B;  3HLU A;  3C6U A;  4DR7 J;  2E1A A;  3PVX A;  5J2Q B;  1WG1 A;  4DXL A;  1S1T B;  2MZT A;  2Q79 A;  3SI8 A;  4S0M A;  2NYI A;  2RQK A;  4I69 A;  5IM0 B;  2XCA A;  1RLC L;  3CE8 A;  4NI2 B;  2CQ2 A;  4JI1 J;  1U6B A;  4FN5 A;  3GR0 A;  1RAA B;  4DN9 A;  3OL6 A;  2L9N A;  2E7X A;  2E44 A;  4LF4 F;  4B3R J;  3MPY A;  2N4C A;  3EXY A;  2W2Q P;  5HRO A;  2HG4 A;  4NOH A;  2GIR A;  1J5E F;  1U02 A;  2CNK B;  1NHV A;  4M1K A;  4NE9 C;  1LWF B;  1RJJ A;  4UZC A;  3ZZZ A;  2AX0 A;  4DFP A;  2BYC A;  3PW7 A;  2WOM A;  1R8H A;  2ZBC A;  3Q8P B;  3IFE A;  3LAM A;  3CCS S;  1DAX A;  2HVI A;  2ZBQ A;  4IO9 Q;  3N6M A;  4ZVS B;  2DR9 A;  2WB4 A;  3KOA A;  4FYD A;  1U2F A;  2CQC A;  4KH0 B;  1XMO F;  5KFJ A;  3HSG A;  2MQ8 A;  3O44 A;  1I94 F;  2ADB A;  1S6U A;  3KLE A;  3EMT A;  1KLN A;  3MMA A;  3VCD A;  2EG2 A;  2YKA A;  4L3K A;  3FSX A;  4K4Y A;  4DL3 A;  2QLF B;  1PJ6 A;  3BPS P;  4O23 A;  5GAD I;  3MF5 A;  1YJN S;  1HI1 A;  2CPF A;  1IWG A;  4U96 A;  4TXS A;  3B4D A;  1HBU B;  2J0W A;  2EW9 A;  2R2S A;  1DHM A;  5HMX A;  1K73 T;  3THV A;  5KFE A;  2DPJ A;  5L38 A;  3C14 A;  5J1N A;  3QPI A;  1U1O A;  2B6A A;  3KLG A;  2GGP A;  2B51 A;  1FXR A;  4OZ0 A;  3T5H A;  4JB8 B;  1TL1 B;  3DYA A;  4N56 A;  3QGG A;  4C7Q A;  1WWH A;  1OPZ A;  1SL0 A;  3SXL A;  5IV4 A;  3PCO B;  3VR1 A;  1KD1 T;  2ZZM A;  3QGI A;  2FC8 A;  2MDA A;  2IAJ B;  3OL7 A;  2XSJ B;  1IKY A;  1ARO P;  3DRY A;  1PKU A;  1N36 F;  2IRY A;  3QLH A;  3BH7 B;  1TZ0 A;  2ZDO A;  2JEG A;  1IBC B;  5A8W A;  3RR8 A;  1HQ2 A;  4YEA A;  4P71 A;  1JLG B;  4USK A;  3T41 A;  4RW6 A;  5A8R B;  3RG6 A;  4UOG A;  4JI3 F;  3T5K A;  1N5Q A;  2DXD A;  5DDQ C;  3BSA A;  2X3D A;  3HHL B;  1KC8 T;  4EO8 A;  4NLP A;  2AW0 A;  1NZ8 A;  3M2R A;  3J80 U;  2HHQ A;  3K5M A;  2HK3 A;  4ZLP A;  5H1S V;  4IFY B;  3FZB A;  4ES2 A;  4G1P A;  4FVM A;  1CJK A;  3FMW A;  1HW8 A;  4LSZ B;  3WQP A;  5KT5 A;  1VHI A;  4FBT A;  3NCQ A;  4I2P B;  1VQK S;  4NLQ A;  4PWU A;  2R7X A;  1JNZ B;  4DUT A;  1VBK A;  5DQI A;  1FVQ A;  2MKK A;  3QWP A;  4URS A;  4QIV A;  4LF8 J;  2ZM6 J;  4K4Z A;  4IQX A;  1JLB B;  4C8O A;  3MM7 B;  2UVV A;  4IO1 A;  2AEM A;  2DYA A;  2KFY A;  1VK8 A;  1FRI A;  3HFK A;  4ECV A;  3GV8 B;  3M30 A;  4EYH B;  1RAC B;  3TO8 A;  1S9F A;  4DV4 J;  4UF4 A;  3SQO P;  4YR3 A;  2V2Z A;  4OJ3 A;  3VAJ A;  3KUH A;  4X65 J;  5A2Q U;  2GQ2 A;  2QFI A;  3D1H A;  3MXH P;  4PQA A;  4NYP A;  1DUR A;  3MGJ A;  2R2U A;  2ZH3 A;  5GAG U;  1S1X A;  3CDW A;  2QL9 B;  3RBE A;  4F67 A;  4PQU A;  1NH8 A;  2PDA A;  4OV6 A;  3FSI A;  1CBK A;  3W66 A;  3MM5 A;  4RLE A;  2IVF B;  2EVZ A;  3FBC A;  4I2Q A;  3PX4 A;  1TL4 A;  4C0O C;  4RUB A;  3ITH A;  3UCG A;  4ED4 A;  4LQ9 A;  1FRL A;  3KJQ B;  2HBR B;  1ZA2 B;  4LR8 A;  2EKN A;  3LWL A;  4K4T A;  4DV7 F;  4NZ0 A;  5EWE A;  3BQ0 A;  4RW7 A;  1WEZ A;  2R7S A;  3KK3 B;  2ZH4 A;  4OZ5 A;  1WDT A;  1U47 A;  1S5Z A;  2CPY A;  2DNK A;  2VV5 A;  1ZM3 A;  3IM9 A;  1DQA A;  2HHH J;  5AE3 A;  4AL7 A;  4C8K A;  3Q0A A;  2JDJ A;  3M8S A;  4F3M A;  1U6F A;  2AJF E;  4YDD B;  1VK3 A;  2WBM A;  1JLF A;  1F2G A;  4C8N A;  4RBT A;  2DH8 A;  1JLC B;  2XSF A;  3ZZP A;  2V4Q A;  4NEZ A;  3PKY A;  1W7W A;  5ETV A;  5DJB A;  3ZTR A;  2ZJQ Q;  1Y9O A;  3MTJ A;  5KG6 A;  4IFV A;  1FNM A;  3ENA A;  1N5T A;  1VC6 A;  4HDG A;  2HWT A;  2W2P P;  1BWE A;  3PM9 A;  3RAQ A;  4ZVU B;  2DNP A;  1JB0 C;  4DUZ J;  4DR6 J;  1HHQ A;  2ZEJ A;  2QJ3 A;  1G4C A;  4OV1 A;  4CP5 A;  2OEK A;  4YB5 A;  4PRF A;  2FLP A;  3CJ3 A;  3H0P A;  2QV6 A;  5LXR A;  3JSM A;  3PHE A;  3GYN A;  2LKZ A;  2Y8W A;  2XMA A;  4AE5 A;  3W2W A;  7FDR A;  4AL5 A;  2MQQ A;  3GJS B;  4JI5 F;  4KRW A;  3TAP A;  1WDD A;  4D3G A;  2GCF A;  1UJ5 A;  1WOP A;  4KY3 A;  4CH7 A;  3I32 A;  3HP6 A;  3IC1 A;  1KVJ A;  4LF7 J;  1ZS6 A;  1SPB P;  2VOO A;  3SIP B;  3R5J B;  5ETO A;  5D4N A;  4A8K A;  5D0G A;  3R5D A;  1S97 A;  4LR9 A;  2XBP A;  1VQL S;  4KHP J;  2R3V A;  4WXO A;  1UVI A;  5D3G A;  1HMV A;  5J2N A;  3GB0 A;  1Y5L B;  3BN7 A;  2HZV A;  3D6H B;  4ZCM A;  3AB2 B;  3V6D B;  3MFH A;  5IC4 B;  4TU8 A;  1NH7 A;  4YQW A;  1PYS B;  4ID8 A;  3BSO A;  2Q6B A;  2KB2 A;  1SH3 A;  2UVU A;  2CAD A;  4Z2X A;  1X4G A;  3CUL A;  5M2P A;  2I0X A;  4MIB A;  4JI7 J;  3OHB A;  1M0S A;  4CYU A;  4GKJ F;  2E1C A;  4U8V A;  4MK7 A;  2V4J B;  1T05 A;  2V2V A;  5HJY A;  2AWZ A;  2XEX A;  2B43 A;  1GEH A;  4DV2 F;  3CVK A;  1K1S A;  1YRU A;  4WE1 A;  2MKS A;  1YJU A;  2CRL A;  3WIU A;  4EO6 A;  3GU0 A;  4MJK A;  3O1L A;  2XQC A;  4UUX A;  4JYA J;  1HNW J;  2FTR A;  2HMI B;  5DQG A;  5T41 A;  5KFV A;  2JWN A;  3HD2 A;  3GYX B;  2RIJ A;  1U49 A;  2HQC A;  4TYB A;  4E8U A;  1AXQ A;  2LQ5 A;  1NSQ A;  2L3M A;  3KHG A;  1PJ5 A;  3AD9 C;  4BLG A;  3L7U A;  2IJF A;  4PZV A;  1FF2 A;  1TKT A;  4ID5 B;  3PX6 A;  5BYQ A;  3D0H E;  3TNV A;  1URR A;  4CO4 A;  2BA9 A;  3EGV A;  3UO0 A;  4NWB A;  3H59 A;  5LMN J;  1P9Y A;  1U4B A;  2GIQ A;  3R5B A;  4KV8 B;  3Q24 A;  4B3O B;  2OKQ A;  3SQG B;  4ZP7 A;  2UP1 A;  3PRD A;  4NA3 A;  1HKA A;  2VDI A;  4OHZ A;  4CNY A;  2CQ4 A;  4NLX A;  3T5L A;  4DV0 J;  2FB0 A;  3IS9 A;  1FFS B;  1QSL A;  1WC5 A;  1RTH B;  3MUR P;  2QL5 B;  4MK8 A;  2NZ4 A;  3J7Y U;  1GX6 A;  2VG5 A;  4O4G A;  1LOU A;  3ZZY A;  1RAO A;  3CIZ A;  2YX1 A;  3DLG B;  4QW8 A;  2OFH X;  3D6F B;  2DY9 A;  3FBB A;  4ECU A;  5L1L A;  4A48 A;  4XAK A;  5KFS A;  3BF4 A;  2HFO A;  1S49 A;  2MJU A;  3ZZT A;  4P52 A;  2IM3 A;  1FRK A;  1KSP A;  4Q7A A;  5IS2 A;  3DDK A;  3QT5 A;  1WSR A;  4J9K A;  1TKZ A;  3A8I A;  1VRU B;  3NBP A;  2GAH C;  3R3T A;  3OL9 A;  4C3L A;  5A76 A;  2IYI A;  4YY3 J;  4MYT A;  4ZVT B;  3LGH A;  1M1G A;  3BH6 B;  2NQP A;  1EP4 A;  3JQJ A;  2MLZ A;  2HHT A;  3HFV A;  2QMW A;  1TK8 A;  2UUC F;  4OL8 A;  2FGC A;  4H54 A;  4OX9 J;  1VQN S;  1EET B;  2WVB A;  3M7V A;  3H5U A;  3UVJ B;  3PV8 A;  4KJI A;  1JIH A;  1UET A;  3BV8 A;  1HNV B;  1D1U A;  1MWZ A;  2HRU A;  2XY6 A;  2HLT A;  4AUK A;  1YBA A;  2FLO A;  3W1Y C;  4PG5 A;  1WEY A;  3QSY B;  3HKW A;  3GON A;  2HBQ B;  2A0F B;  1X9S A;  5I42 A;  2VBZ A;  5K8O A;  1T95 A;  5F8G A;  1KFS A;  2XMT A;  1TKD A;  3CDA A;  1YQH A;  1YRX A;  4ATN A;  4HAC A;  4Y28 C;  4Q8F A;  4QQB A;  3R6G B;  4G6V B;  4F3Q A;  2HHV A;  3MEC A;  3NCR A;  4IH6 A;  3SCK E;  2OPS B;  1PG5 B;  5GAE U;  5HQL A;  1R27 B;  2GJI A;  2F8M A;  2D3O R;  1TL3 B;  2KZM A;  1F3F A;  4CT8 A;  3J81 j;  3K5N A;  9ATC B;  3Q83 A;  5C2C A;  3CCJ S;  1RK8 A;  2WBR A;  3ET6 B;  4V1A k;  3MTK A;  2AGO A;  2CPI A;  1WKJ A;  1LQ9 A;  3MAQ A;  2VFT A;  3N5F A;  3GII A;  3PJ9 A;  2XC9 A;  3JTP A;  4DV5 J;  2AZ1 A;  4ED1 A;  1WHW A;  4P73 A;  1U24 A;  4I6Y A;  3DLJ A;  1RHU B;  1YZ7 A;  3KJV B;  1XNR J;  1BD6 A;  1V3R A;  4ZJO A;  3F73 A;  3OUY A;  3V4I B;  2VKR A;  2HNY B;  5C24 B;  1M5S A;  4J9L A;  1N34 F;  1HR0 F;  3U1L A;  1S10 A;  3AOB A;  4JV5 J;  4GVB A;  2KM8 B;  4ED2 A;  2CPD A;  4L76 A;  2M8D B;  1Q7Y T;  3MMB A;  4B3T F;  3TZZ A;  2CPX A;  3Q8V A;  2PA3 A;  1LNQ A;  4X4T A;  3VZH A;  4CLY A;  1P1T A;  4RW9 A;  1KKH A;  4Z7Y A;  4EUV A;  2V9K A;  1RT7 A;  3M2U B;  4A4J A;  1ZPW X;  2W24 A;  1NHU A;  4NXM F;  4DX7 A;  2FIU A;  2R4F A;  3MPV A;  3I56 S;  2B5J A;  4WFB Q;  2W7A A;  4BC9 A;  5LMU J;  3UN2 A;  4IRD A;  4WYW A;  1U2R A;  2B8Q A;  4ZDN A;  4JI0 F;  4YP3 A;  2EFV A;  2NXU A;  1VOM A;  4M95 A;  4NXN F;  2C2Z B;  1C0T A;  3T1H J;  3OTO J;  1FDD A;  1BQN A;  2MQP A;  3G6X A;  3U27 A;  1S6Q B;  5HBM B;  2VU5 A;  3W2V B;  5KFM A;  1VJW A;  1YBT A;  1RAE B;  2YQ3 A;  2VPZ B;  4M5K A;  1RIS A;  1OIA A;  1QDU B;  3CJT A;  1N32 F;  4PG7 A;  1YHQ S;  1KP6 A;  2GAG C;  1T3N A;  3W5X A;  3D68 A;  3P3D A;  2BKO A;  1T03 A;  2ADC A;  4CDI A;  4HKQ A;  4OJG A;  2DJW A;  5HSP A;  3UR3 C;  3CCQ S;  1FKP B;  3HT0 A;  2E5J A;  1RT6 A;  4ZVQ B;  3KMS A;  4RBU A;  3Q8R B;  1RKI A;  4DPW A;  5CYJ A;  4A8M P;  3CJQ A;  6FD1 A;  3QWU A;  5ETL A;  2C2N A;  3FC9 A;  1TKX A;  1W25 A;  5DDO C;  1FJG F;  2ILZ A;  1HD0 A;  2GHV C;  4KGV B;  2ATL A;  2QN6 B;  3HVR A;  2FHM A;  4R8U A;  4DV3 F;  2F4F A;  3H5Y A;  4IDK A;  5DLF A;  5LL6 d;  3GG0 A;  3SYZ A;  2XZD B;  1BQM A;  4DDF A;  1CS4 A;  4WF9 Q;  1Q53 A;  4U95 A;  1Q0N A;  2PN6 A;  5KFQ A;  2V94 A;  2BRK A;  5KG7 A;  3D66 A;  2HK2 A;  3MWB A;  4CM0 A;  1VQ6 S;  5IQ6 A;  1CC7 A;  2COL A;  2OD6 A;  2LQJ A;  4MKV A;  4GRS A;  4LF4 J;  1AB8 A;  1S1W A;  2O01 C;  1SJ4 P;  2YNH A;  3I31 A;  1J5E J;  3NRB A;  2C2O B;  1UEU A;  1AUS L;  2WSF C;  4EI2 A;  3KJF B;  3BR9 A;  1K47 A;  3GWC A;  2DH9 A;  2FC9 A;  2DNG A;  4LRE A;  4ED6 A;  1HQU A;  1QE1 A;  2ALZ A;  2MMY A;  2YNG B;  1R6V A;  4A8F A;  2IMO A;  3R2D J;  4DCP B;  3J7Z 5;  2KO1 A;  4I7F A;  5E2Q A;  1QTN B;  3THT A;  2I6W A;  2W9B B;  4HI2 A;  5B0B A;  3BSN A;  2E5L F;  3MEE A;  1XMO J;  4DU7 A;  1Q81 T;  2OI2 A;  1S1V B;  1I94 J;  3OR2 A;  1D9D A;  4EFA C;  2XGP A;  2DIU A;  4X84 A;  2VB6 A;  4L3N A;  2XG8 A;  2O5D A;  1TL7 B;  5C7P A;  3QAU A;  3VV2 B;  2GX8 A;  3KHL A;  4BWM A;  3BZQ A;  1KR4 A;  4TY8 B;  1HA1 A;  4URG A;  1EIY B;  3LA0 A;  4NA1 A;  5B0G A;  1NEE A;  1GFW B;  3LP1 B;  1UA1 A;  4W90 B;  1FVS A;  1TUV A;  4LFC F;  1YIJ S;  4KKO A;  2QSF A;  4Y2K A;  4C3M A;  5IQQ A;  4C11 A;  3F44 A;  2JJ4 D;  4KGX B;  1RAI B;  3SV4 A;  4JP8 A;  3OVS A;  1U1P A;  1OO0 B;  5DM7 Q;  3MFI A;  1E6Y B;  5DG9 A;  3CCE S;  4O0N A;  3MOZ A;  1I1G A;  5FII A;  1B0P A;  2AU0 A;  2BQU A;  1RWK B;  2EBE A;  1IKW A;  5HP1 A;  1IM4 A;  4QR1 A;  4Q43 A;  5EGY A;  2R8G A;  3TUI C;  3TZX A;  1D8Z A;  5L39 A;  5KG1 A;  5C2G A;  4FYW B;  2WAQ D;  4PPD A;  4DZD A;  2VBY A;  2V8V A;  2PI5 A;  2CYY A;  4RU2 A;  5J2Q A;  4I67 A;  4PWD B;  1S1T A;  3UN3 A;  2QYC A;  3RAM A;  4K0K F;  2MQO A;  3EX7 B;  1L3T A;  3CME S;  1MLA A;  5IM0 A;  1M1K T;  4NI2 A;  3RBZ A;  3CPW R;  1SJF A;  3D1O A;  3MEG A;  1TTH B;  1N36 J;  4LQ3 A;  3R7S B;  1Q86 T;  1EKS A;  5CYM A;  3H4B A;  2KN4 A;  1GMW D;  4I1T A;  3VQS A;  5BYS A;  2PII A;  2BE7 D;  1SJQ A;  4IKA A;  1FRM A;  4JI3 J;  3LW5 C;  3QO9 B;  2F63 A;  3Q89 A;  2VHG A;  4LF9 F;  4QR2 A;  5LOQ A;  4OYX A;  4C48 A;  1XNQ F;  4DFM A;  1SUQ B;  4LIW A;  2V63 A;  4FXD A;  3CJK B;  4J9O A;  3TEG A;  2HS0 A;  3JSB A;  2VFR A;  2LXU A;  3C3L A;  3AOD A;  3DLH A;  4QWE A;  3ADA C;  1YJV A;  1NXI A;  2JEI A;  4L74 A;  1JJ4 A;  4ZLN A;  2ACY A;  1NHK L;  3D67 A;  3AHP A;  4QU7 A;  3IP0 A;  3BJY A;  1DAR A;  2NSB A;  1FT8 A;  2SXL A;  2DGV A;  2F8E X;  1MML A;  1ZPV A;  2Z2Y B;  2GVZ A;  4LRB A;  4XO0 A;  2G9O A;  3LF0 A;  3KK1 A;  1SQF A;  2XLK A;  4OX8 A;  1O5J A;  3W9I A;  2KXF A;  2RB7 A;  3LPE A;  4C8L A;  2DNH A;  1YI2 S;  5DDR C;  3VVT A;  2WVF A;  1HBU A;  4MT1 A;  3RB6 A;  4P7T A;  2XWY A;  4A8X A;  2V68 A;  3E51 A;  2IRU A;  2DIV A;  1FEE A;  1S57 A;  1MRO B;  4WP8 A;  2IY5 B;  1OS5 A;  2P9G A;  2B7C B;  3K58 A;  2APO A;  1TL1 A;  2R2R A;  2Z57 B;  4ZIT A;  4X4O A;  2FLL A;  2W2M P;  2XNQ A;  3Q8S B;  3MM9 A;  4J9V A;  4ILM A;  2HVE A;  3D1Q A;  1KTV A;  2VL1 A;  2IAJ A;  5CZV A;  2ZBP A;  3QJL A;  3OTB A;  1K0V A;  1NJY A;  3LOU A;  1DTT B;  4FYY B;  4ZKA A;  2XSJ A;  4DV7 J;  4RZR A;  4H4K A;  2QEX S;  2R8K A;  3OVA A;  3W9J A;  2LEB A;  1U09 A;  3MCS A;  5LM7 E;  4DCJ B;  4DI6 A;  4U9R A;  1UWB A;  3DLB A;  1S7H A;  3MPW A;  3CNQ P;  4WFZ A;  4RNN A;  2CVE A;  2XZW A;  4FF4 A;  1VI7 A;  1TV6 B;  3GQC A;  1R7I A;  1H2V Z;  2DR5 A;  3LP0 A;  3HSZ A;  4A8S A;  1N33 F;  2B6A B;  3VAI A;  5KFT A;  1VQM S;  1NK5 A;  4U7U K;  1WKL A;  1JXV A;  2C1E B;  2F9J A;  1UKU A;  3QZ8 A;  1TU0 B;  2J6T A;  2H4Y B;  2RQM A;  2Z2L A;  1JLQ A;  2PI4 A;  4DR7 F;  2J0S D;  3W60 A;  3NGS A;  1RWV B;  4M5I A;  4K4X A;  5L1J A;  2R7T A;  1XK8 A;  2FJD B;  1J27 A;  3LGM A;  2OP5 A;  3IN5 A;  2W4D A;  3R27 A;  4KGZ B;  2FQQ B;  3MM7 A;  2VG6 A;  1LK7 A;  4ZP8 A;  1UW4 A;  3UR0 A;  1TAU A;  1T9W A;  1YDL A;  3CF5 Q;  3OT9 A;  5DZ7 A;  5A8W B;  4A8W A;  2XLJ A;  3NAH A;  5CH7 B;  2DTJ A;  1Y5N B;  1F5B A;  2M88 A;  4RW6 B;  2CQ0 A;  4IQM A;  4JI5 J;  4LT6 A;  3N4W A;  2J0Q D;  3DRP A;  3PRB A;  4Y2M A;  1R31 A;  2K1R B;  1SIZ A;  2YVS A;  3MR6 A;  1ICE B;  3ISZ A;  5AXN A;  4YN3 B;  5F3T A;  2VZ9 A;  3WBZ A;  4DN0 A;  2OUG A;  1C0U A;  2GMH A;  1LFP A;  2WW4 A;  4E0D A;  2MY7 A;  3FQL A;  3BEG B;  1WOS A;  1GTH A;  3QBC A;  1QTM A;  4NL5 A;  4YB1 P;  4WP3 A;  3LUY A;  2IC3 B;  4CLZ A;  2RF2 A;  4FPR A;  5KFF A;  3K17 A;  2ZE2 B;  3NMR A;  3JB9 k;  1EZZ B;  3D5M A;  4ES3 A;  1L3U A;  3GJT B;  3POT A;  3KK3 A;  3M30 B;  2IBO A;  1CUL B;  5KOX A;  4ZCI A;  3KG0 A;  5ITH A;  2DCL A;  4LF2 A;  2XYP B;  4C6A A;  3PW4 A;  4GKJ J;  3EVM A;  1Y11 A;  4ES1 A;  2Z58 B;  1NK6 A;  1UL3 A;  1JQG A;  1S1X B;  1WKK A;  4DV2 J;  2V9W A;  4PQU B;  1IQT A;  4KAI A;  3W61 A;  2YKO A;  4DL2 A;  2Y1I A;  3MM5 B;  1ZAW A;  3DXS X;  2YWE A;  2G0J A;  4B3S F;  4LRA A;  4I2Q B;  3BGR B;  3P4U B;  1HHT P;  1VQS A;  3CSK A;  3GP9 A;  5THW A;  3PIP Q;  5B09 A;  2MZ1 A;  1WC1 A;  2UV8 G;  3N0V A;  2RNE A;  2LFV A;  2J5A A;  1JJC B;  2M52 A;  3ETM A;  3TRG A;  4F4Z A;  1SH0 A;  4XK8 C;  1K44 A;  3GR1 A;  4YR2 A;  3EM1 A;  2YPY A;  5FDL A;  3L4B C;  3G6V A;  5SUH A;  2LEA A;  4FXV A;  1H2T Z;  2U2F A;  4O0I A;  2AIR B;  1U48 A;  4CO3 A;  4LBI A;  1T8E A;  3DDN A;  3GCX P;  3SMZ A;  4LVN P;  2FD2 A;  3OPK A;  5KFD A;  2E7V A;  3CC4 S;  2EFP A;  3CO9 A;  1L3K A;  4CI0 B;  1X7V A;  1JLF B;  2M9K A;  2YBV A;  4W98 A;  4DX8 H;  1S99 A;  4WK1 A;  2CZ9 A;  2BRL A;  2CJK A;  4X4N A;  4R25 A;  5D78 A;  3HSJ A;  3HSD A;  3DLE B;  4IFV B;  2EK6 A;  4E2F B;  4OZ2 A;  1R8C A;  4HTJ A;  4KE5 A;  4ZVG A;  2N82 B;  5IV3 A;  4DSI A;  1IR1 A;  4DUY F;  2GV1 A;  1VCT A;  5E7O B;  5HVG A;  1SJ1 A;  2EK1 A;  3M6V A;  3R7B B;  1YJ7 A;  3F0N A;  2OML A;  4QIE A;  4NLW A;  1Z1Z A;  3V6D A;  4CO1 A;  4PCQ A;  3AOC A;  4LVO P;  4DR5 F;  2I9S A;  1EQM A;  5KFY A;  2Y1R I;  2KXH A;  1H2U X;  1W26 A;  3PYF A;  1N56 A;  3LO3 A;  1VC5 A;  3QMQ A;  1DLO B;  2V4J A;  2FVC A;  2U1A A;  1E6V A;  2ZBR A;  3W8G A;  1RHR B;  4LRF A;  4V19 J;  3QIP B;  2UUC J;  3HD1 A;  5H9F K;  4KFB B;  5AXL A;  4DPY A;  3PAC A;  5D4P A;  2ZDP A;  1X5S A;  2GZO A;  3LP2 A;  3LQV A;  5ETQ A;  2LEC A;  4EBE A;  1SXL A;  4KGM A;  2KKH A;  2AZ3 A;  3BKU A;  3ZZ0 A;  4AXJ A;  4KHR A;  2RU3 A;  1CPZ A;  4I6A A;  4HR2 A;  2HMI A;  1NKC A;  3MUT P;  2H9Z A;  5AE1 A;  4Q0B B;  2BJD A;  5DO2 A;  3HK2 A;  3SSS A;  1GMW A;  1WOR A;  2ZD1 A;  5GME A;  4KB7 A;  1TAQ A;  5KFO A;  3UWT A;  3OLA A;  4DL4 A;  2B7B B;  4DG1 A;  1SL1 A;  4ID5 A;  3NS7 B;  3H98 A;  3CGI A;  2IA6 A;  3HI9 A;  3J7A N;  1WHY A;  2HIY A;  1FDA A;  3G2X A;  1YJT A;  1LXJ A;  5F0U A;  2BV3 A;  1NCL A;  2CQP A;  4P6Q A;  4U7U D;  2MHE A;  4N47 A;  4KV8 A;  4OJH A;  4B3O A;  1IUJ A;  4ZIV A;  1RTZ A;  3F41 A;  3SQG A;  1K0T A;  4CT9 A;  3MR5 A;  5A8K A;  2Z8Q A;  2HHX A;  4WE1 B;  4C8Y A;  2DCU B;  4F7V A;  2O3D A;  3M8R A;  4YME A;  5LSR A;  1RTH A;  3ILI A;  4JV2 A;  1X4E A;  4AXI A;  4OI6 A;  3QYY A;  1AZS A;  2PA8 D;  2KFN A;  3BDE A;  2CQH A;  4R0J A;  1WD6 A;  4JV0 A;  3DLG A;  1N34 J;  1HR0 J;  2ATC B;  1HNX F;  1NBE B;  1V5I B;  2FDN A;  1TKT B;  4B3T J;  1U1L A;  1VRU A;  5ETN A;  3PYG A;  5KG3 A;  2JX2 A;  1D0E A;  2HGN A;  3KTQ A;  2OO4 A;  2IHR 1;  1FDN A;  1JLE B;  1JJH A;  2EBG A;  3G82 B;  2HFU A;  4IR9 A;  2YQ1 A;  3PRV A;  3S1T A;  1QAJ A;  4UQG A;  4NXM J;  5J1P A;  1B64 A;  3MCO A;  1HW9 A;  2BJ7 A;  2D9O A;  1EET A;  3OTC A;  3M2V B;  4JI0 J;  1MWQ A;  3BBC A;  2VG5 B;  3Q2T C;  4NXN J;  4RNH A;  4GO7 X;  4OYP A;  4IG3 A;  2MKC A;  4Y2A A;  2KT3 A;  3OXF A;  3EGZ A;  2R7Q A;  3TA0 A;  2CZ4 A;  2EEY A;  3CJ8 A;  2DR7 A;  1O6X A;  1TKZ B;  2VKZ G;  1N32 J;  4M5M A;  3NBP B;  2CQG A;  2R7O A;  2M7S A;  1RTI A;  3E3X A;  3O5T B;  3HHK A;  2CPE A;  1Z2Z A;  3KLF A;  4ZN3 A;  2DIS A;  3ILJ A;  4PG8 A;  1EP4 B;  2VBW A;  1HWU A;  2ROP A;  3TOQ A;  2AHO B;  2XHC A;  4NLD A;  2CG4 A;  2HWI A;  3CMQ A;  3PZP A;  2P9C A;  3GLJ A;  2G1H A;  3TA2 A;  4I68 A;  4L75 A;  3S01 A;  2DNN A;  1P27 B;  3VAK A;  1FTC A;  2Y9H A;  1F3V A;  4X4S A;  5CAA A;  4HH1 A;  3TYT A;  1F5C A;  1FJG J;  3SBM A;  4F4K A;  5DDP C;  1KS2 A;  2DVI A;  2XI3 A;  4GO5 X;  3KJV A;  5I42 B;  4DV3 J;  2NPF A;  3OSP A;  2ROE A;  5E41 A;  3V4I A;  3EYZ A;  2HNY A;  5C24 A;  4MAK A;  1I6J A;  1RCX B;  4HHJ A;  4Y2I A;  2LU2 A;  5F8M A;  2F4V F;  4ERD A;  1SVD A;  4F8R A;  4Y3C A;  3G4S S;  4BS2 A;  2DT9 A;  1B70 B;  1XR6 A;  4F0K A;  3MAH A;  1WHX A;  3CD0 A;  2QYG A;  2UUW A;  3FSY A;  1SC1 B;  1X8D A;  3OFG A;  2J7U A;  1NDL A;  3M2U A;  3PJX A;  4YFU A;  2V0N A;  1RU1 A;  2YY3 A;  3MUM P;  7FD1 A;  5FLX Y;  3NCP A;  1OY9 A;  2W9A A;  3GG1 A;  4ED3 A;  4ZLL A;  3J7A 1;  2GVD B;  2XMK A;  4USV A;  1XBW A;  2GFF A;  1R0B G;  1DZ5 A;  4W4M A;  1QVG R;  2E5L J;  1CQN A;  4AFF A;  1RT4 B;  3GCW P;  2W9C A;  1NJI T;  2CJA A;  5JVH Q;  3T1A A;  2VPX B;  4R5P A;  1QJH A;  4PUO A;  2D7S A;  2KU7 A;  1F9F A;  3RB0 A;  3MMC B;  2X1B A;  2DK2 A;  4RW8 B;  3ZO7 A;  1S72 S;  2DH7 A;  1MG7 A;  3FJ2 A;  4GVB B;  2BE9 B;  2QA4 S;  3U1M A;  7AT1 B;  1V3S A;  2G2Y A;  2H51 B;  3QJP A;  1SC6 A;  3GTY X;  3CJ4 A;  4RW9 B;  1FX2 A;  1QSS A;  3HO1 A;  3WDO A;  4LFC J;  1RT7 B;  3M6X A;  2CDQ A;  2EFQ A;  2FJA B;  5CXT A;  1NZA A;  2QL7 B;  3OD2 A;  4LRC A;  2QLX A;  1RYS A;  1FKP A;  1HWL A;  3FUY A;  1JJ2 R;  3NAI A;  1PAE X;  4KO0 B;  4MMO A;  1P9Q C;  3WX4 A;  4ZCK A;  3I87 A;  4ETX A;  3VZI A;  2B5J B;  1ZZF A;  2EFN A;  4HLB A;  2QMX A;  3CCZ A;  3V2U C;  5EUH A;  1A6L A;  3M6W A;  2BOP A;  1U1M A;  2HHS A;  2HVD A;  5KT6 A;  1C0T B;  2JOQ A;  4M5D B;  3ZNJ 1;  2MLX A;  1V6H A;  2W2N P;  5F9N A;  4K0K J;  3CC7 S;  3M8W A;  1IQZ A;  5JUM A;  4TYA A;  4J9M A;  2VFU A;  4ECW A;  2ZH1 A;  4N8O A;  1RDR A;  2RRA A;  2UUB F;  1QAX A;  2ILY A;  2DBB A;  3B54 A;  3MM8 A;  2C2M B;  4X4R A;  4A8Y A;  4Q45 A;  2CIM A;  4QYR A;  2K3K A;  2KDO A;  1YVF A;  4B9U A;  1NK9 A;  2GC8 A;  4LIR A;  3BBB A;  1CJV B;  1YSJ A;  2A10 A;  5K8P A;  3PYE A;  2BUN A;  4KT0 C;  3DHW C;  4LF9 J;  1XNQ J;  4YS2 A;  2YH1 A;  1ZTT A;  2YNG A;  2KRR A;  2ZNY A;  1UVL A;  1JMT A;  1PIL A;  5I3P A;  5HLF B;  2XI2 A;  3NGR A;  1WTF A;  2W9B A;  3UD4 P;  5E3Q A;  2LDY A;  4K5S A;  4FDF A;  5KFH A;  4R8U B;  2YKQ A;  2Y0B B;  2LXI A;  4PAB A;  2C2E A;  1ZAX A;  1TL7 A;  4XPE A;  4DFJ A;  2FJX A;  1R43 A;  1BQM B;  1Y10 A;  2QT7 A;  2HZA A;  2F8H A;  1X9W A;  1RXO B;  1RBO B;  1VQ4 S;  2B9X A;  4KTQ A;  4TY8 A;  2ZOM A;  5HMZ A;  5EWG A;  4OYB A;  1U7L A;  4NLG A;  1S9E B;  1OJ4 A;  1JWW A;  1B3T A;  1S1W B;  3CJ0 A;  2C3U A;  3WC0 A;  4XIU A;  3LP1 A;  2ZFH A;  2HQD A;  2YNH B;  2XS7 A;  1Y3K A;  1HI0 P;  3KDN A;  4F04 B;  2HZC A;  2AP6 A;  5KG5 A;  2OH2 A;  1ZBT A;  5KT2 A;  2DHX A;  3RRH A;  5CAB A;  3QNW B;  1HQU B;  4OI0 A;  2BAN B;  3U1N A;  1VFJ A;  1QE1 B;  4KPC A;  2R42 A;  3NGT A;  3EE3 A;  1LEO A;  4I7F B;  1F9H A;  4RNF A;  2IYG A;  2IA0 A;  1A7G E;  2MQL A;  3MEE B;  2RIL A;  3OR2 B;  3QT8 A;  1YJ9 S;  3DLL Q;  5G0R B;  4Q44 A;  4QYZ J;  2I1R A;  2ZUA A;  4Q2L A;  2FVP A;  2MXY A;  3G86 A;  4NA2 A;  2A18 A;  3KLH B;  3QRR A;  1NK8 A;  2NXC A;  4NCG B;  3P49 B;  2CNL B;  5MAO A;  3KNA A;  1NM2 A;  1VQ7 S;  1HBN B;  2DNR A;  1GNK A;  3B82 A;  1OSD A;  4AT1 B;  1RE1 B;  3DKD A;  3HKZ D;  2OPQ B;  3MZI A;  3HX9 A;  1TUW A;  4KKO B;  2MKH A;  4C11 B;  4RNM A;  1T11 A;  1GXU A;  2OIH A;  2FJB B;  1PBU A;  5IZH A;  2HFS A;  1CSJ A;  2O66 A;  2OAU A;  3QO9 A;  1B7Y B;  1RU2 A;  4DZ6 A;  5D0E A;  2RE1 A;  2WRM A;  2M0G B;  4NZ7 A;  3VWS A;  3VF0 B;  4PPZ A;  1MMD A;  1SUQ A;  5HP1 B;  1N33 J;  1XN9 A;  3CJK A;  3JYT B;  4IH5 A;  1RBL A;  3NKY A;  2VJV A;  5C42 A;  2H48 B;  3GIL A;  5CCL A;  3GIR A;  4CLT A;  3AA8 A;  4OQJ A;  2J6U A;  3GMG A;  3R5C A;  3RJM B;  4DLG A;  4P74 A;  4DBQ A;  3TQ1 A;  3MEG B;  4Q8E A;  1GXL A;  1ZM9 A;  2ZHO A;  5IT9 Y;  5CYM B;  3S7R A;  5CHC B;  5D4O A;  2C3P A;  3IAM 9;  4DSF A;  2XMW A;  3LH2 S;  1T3O A;  1NJZ A;  3ENQ A;  3Q86 A;  1NPK A;  4NRU A;  4F50 A;  1KOH A;  2RUS A;  2KYZ A;  2G1D A;  2J9C A;  1BLU A;  2HKE A;  4J9R A;  2QGF B;  1FE0 A;  4HTI A;  4N41 A;  2XTJ P;  1MRO A;  3W63 A;  2P8I A;  2K06 A;  2YWH A;  2HLU A;  3ILO A;  4M63 A;  2AJ2 A;  1C4A A;  3CDU A;  1RTJ A;  3M9O B;  4ZK7 M;  1PYO B;  1NDP A;  4DHV A;  2LA6 A;  3SFG A;  4DR4 F;  1RUS A;  4A46 A;  4DX5 A;  3JAM Y;  2XY5 A;  3VQT A;  3EGW B;  4TQS A;  3IRW P;  3NGD A;  3HHL C;  2J9E A;  1BUX A;  1DTT A;  2GMJ A;  2GVZ B;  3KK1 B;  4WPA A;  1FJE B;  3TUJ C;  1CVJ A;  2NPI A;  1OSC A;  2D3Z A;  2MEW A;  3UCZ P;  2L41 A;  2DNL A;  4H4M B;  1N88 A;  3BPD A;  2KT5 A;  3N6N A;  3DOM A;  2YKM B;  4PYD A;  3SSR A;  2JLE A;  2LXF A;  1SCJ B;  1ZA1 B;  4AD6 A;  4HVZ A;  1WI6 A;  4CO0 A;  4WCE Q;  4IOA Q;  4OZ1 A;  1EQ0 A;  4DL6 A;  2B56 A;  3DLK B;  1TV6 A;  2JZ5 A;  2J8A A;  1SV5 B;  4WU2 A;  4FVC A;  1U8W A;  3F56 A;  2ZC4 A;  5F41 A;  2FVR A;  4QOT A;  3D0I E;  1HL6 A;  5KG2 A;  1R8A A;  5I3U A;  4B3S J;  2QMU B;  2WVD A;  3MM9 B;  2DNY A;  3MD3 A;  1KQS R;  3RR7 A;  3FQK A;  1Y4Z B;  4OIX A;  2YNF B;  4ECT A;  2F1F A;  2CPH A;  1YLX A;  3I5A A;  4BHQ A;  2E7W A;  3PR4 A;  4DLE A;  2K7K A;  4UT4 A;  3QAE A;  3ZTP A;  5CQG A;  5DET A;  3EVW A;  5KFW A;  2LVW A;  1RWU A;  2D9P A;  4QJV A;  4O4R A;  1UWB B;  4WYL A;  3BN4 A;  3PFE A;  1NKB A;  2K1R A;  4I64 A;  3TZW A;  2HQ3 A;  4ER8 A;  3LP0 B;  3RBD A;  3L3C A;  4JV1 A;  4UUW A;  5HI7 A;  2RDD A;  5D4L A;  4M94 A;  1IBM F;  3NOC A;  5E33 A;  5A6P A;  2K8G A;  4ZPA A;  2IM2 A;  1PBA A;  3IGN A;  3GJR B;  1WF0 A;  3I0S A;  2M4M A;  3IMQ J;  1JLQ B;  1VLY A;  3OJS A;  1RWN B;  1KQK A;  2IC3 A;  4DUY J;  5HJX A;  4M5N A;  1G2E A;  2ZE2 A;  1Q1K A;  2QA4 G;  2VG6 B;  4F4W A;  4N77 A;  4C8Z A;  2KHC A;  2UXB F;  2HS3 A;  5AXM A;  4ZA1 A;  3TQE A;  5KG4 A;  3J7Y I;  4DR5 J;  2HQG A;  3CED A;  3M4X A;  1CUL A;  1IJF B;  1H73 A;  2FYX A;  3WZ0 A;  3OFH A;  1KVI A;  3DRP B;  1RTD A;  5CD4 A;  4G65 A;  2UXD F;  2FHJ D;  3OXL A;  3NP5 A;  4YB7 A;  3LTO A;  3E8O A;  3K5P A;  2FY8 A;  5K20 B;  2PFF B;  1N48 A;  3W8P A;  1C0U B;  1TMJ A;  4PAA A;  1WUU A;  4PG4 A;  5KFR A;  4JBC A;  4LSN B;  2B4O A;  4Y34 A;  3US5 A;  4F36 A;  5KFL A;  3BGR A;  1X0F A;  1H6K X;  3ZXW A;  5F8N A;  2JH3 A;  4DV6 F;  2RF2 B;  2DHA A;  4WFA Q;  3B8H A;  1U0H A;  3JS9 A;  3K59 A;  1D9A A;  3W7B A;  2R8J A;  3FBE A;  4LF6 F;  2CJY B;  3V6K A;  3GYG A;  1RAJ A;  4N5S A;  2BMB A;  2DXE A;  3POT B;  4QIG A;  3PG9 A;  1GMU A;  4RUA A;  2B4P A;  2VOP A;  1EX8 A;  1KVK A;  4YHH F;  2V8G A;  1MNE A;  1SI9 A;  1GT8 A;  4ZVO B;  2W01 A;  4ECY A;  4QW9 A;  1IBK F;  2Q6C A;  4USJ C;  2E66 A;  1IXK A;  3D7S B;  1HFE L;  4NMX A;  2ZJP Q;  3GFX A;  2W8K A;  2M5Y A;  3UCU P;  4IUF A;  2WVE A;  2H4W B;  3EZO A;  3DLE A;  1HNZ F;  4OFZ A;  4QR0 A;  2DGO A;  4OHX A;  4NLO A;  3BGL A;  3PHT A;  4K4W A;  3GIK A;  1VIS A;  4DCO B;  1Q8K A;  3FK4 A;  2ASD A;  2E5H A;  3SCL E;  3NLC A;  3N79 A;  3CD6 S;  2OLW A;  4DJB A;  2ZOF A;  4HDH A;  3IAS 9;  1HNX J;  2RDI A;  1PIE A;  2HQI A;  4U67 Q;  4PEO A;  4M5H A;  5FDL B;  3UFC X;  2DGQ A;  3DU6 A;  4UOC A;  1LW0 A;  2JRS A;  3UE2 A;  3VAL A;  3RW7 A;  4O3S A;  3VAG A;  4WFX A;  3UDC A;  3I55 S;  1DLO A;  5DLG A;  4ECS A;  3J80 Y;  1GQE A;  3QIP A;  1FXD A;  4KFB A;  2M8H A;  2J0X A;  1MN7 A;  3T5J A;  4ZPT R;  1JNR B;  5EN1 A;  1VRQ C;  3H90 A;  3GPA A;  1HHS A;  1Q8B A;  3TI0 A;  3BSC A;  2MQM A;  3FFI B;  4Q0B A;  2VDH A;  5J2P B;  3O3L A;  1NSA A;  4MIW A;  3PEH A;  2O67 A;  3GFH A;  4TNO A;  1ZZN A;  3CCR S;  3IR7 B;  3L7P A;  4K5R A;  4KQZ A;  2B9Y A;  4GC7 A;  3CJR A;  1CLF A;  4U7C A;  3UQS A;  1NK7 A;  1WAC A;  2KXN B;  2FY1 A;  4YUD A;  5HO4 A;  5E5N A;  4J91 A;  2JC1 A;  2B8P A;  5EHH A;  4ZPW R;  2UVW A;  1E6V B;  2XYH B;  2B0G A;  2NXJ A;  1IBL F;  3RAX A;  5KT3 A;  1C4C A;  4F0H A;  1IVZ A;  3LP2 B;  2WON B;  5CA5 A;  5HAT A;  2ZKU A;  1FWK A;  2VD3 A;  4FP9 A;  4DSK A;  5DM6 Q;  3P8B B;  4EBD A;  4AYB D;  4ELV A;  4WFY A;  1YGY A;  4RU9 A;  3JTN A;  4IG0 B;  3QT6 A;  2XM3 A;  4JOU A;  1GAO A;  2F65 A;  4X62 F;  2BDP A;  5F8H A;  2F4V J;  2ZD1 B;  1P1L A;  1SQE A;  5C25 A;  4DQQ A;  4ZJQ A;  2ASL A;  3AD8 C;  2XZT B;  1S12 A;  4CLF A;  4DG1 B;  4P2X A;  3A8E A;  4ZIW A;  2GW8 A;  1PC4 A;  2GHW A;  1U1R A;  4J7C A;  4G1Q B;  3KHH A;  1UEV A;  2MQN A;  2XHW A;  2YX4 A;  1CJT A;  2C22 A;  2BX6 A;  1JLE A;  2RRN A;  2HUR A;  3G82 A;  1UEK A;  2QSW A;  5A8K B;  5BXI A;  3IWN C;  2H5J B;  2DGX A;  5K9F A;  1VLO A;  3J81 Y;  3MAA B;  3P5B P;  2OEL A;  5K14 B;  3M2V A;  2P6S A;  4PXB A;  3HMJ G;  4F2R A;  4C4W A;  1H7W A;  2M70 A;  3DCA A;  1AZS B;  4B9S A;  2R2T A;  5G4D A;  3KG1 A;  2ZWP A;  1RB0 A;  4UW2 A;  4KYZ A;  2XY7 A;  5KG0 A;  2OSR A;  4ECR A;  2BAB A;  2HBY B;  4YDX A;  4EWT A;  1IM6 A;  2F5G A;  1OMS A;  3O2I A;  4IH7 A;  1REG X;  2FJE B;  4FS2 A;  1WG5 A;  2VA3 A;  1P6T A;  3CWJ A;  3QSI A;  3A3P B;  2ALY B;  5HVH A;  3OHA A;  4ELT A;  2RUG A;  1K8A T;  3P45 B;  3DU5 A;  2JFD A;  2UVR A;  3Q23 A;  1N6Q B;  3NL0 A;  3MUV P;  3RBX A;  4ZN1 A;  2E1M C;  2YWK A;  1BWV A;  5JVG Q;  1SKR A;  3ICL A;  4OZN A;  2KM8 C;  3W65 A;  1R3N A;  1JK9 B;  2L9D A;  2X1F A;  5IT9 U;  1X4B A;  2MSS A;  4ZVE A;  2XMM A;  1HWI A;  1DTQ B;  5IXU A;  2DNO A;  3NNA A;  1L3S A;  1A0O B;  3A13 A;  2Y8Y A;  4OI1 A;  4IG3 B;  5HAN A;  3BB5 A;  1UVN A;  4KIA A;  4DS4 A;  1TR0 A;  1AFI A;  2QIF A;  1Q16 B;  3G9C A;  3M1V B;  1V9O A;  5K8N A;  2D41 A;  6FDR A;  1YG0 A;  1XWL A;  3AQO A;  1UZD A;  4DR2 F;  1RTI B;  2UUB J;  2QLB B;  4WFN Q;  2V8D A;  3KLF B;  1WC6 A;  2UXC F;  3AA9 A;  1GK8 A;  3IR5 B;  5EWF A;  4A8O A;  2KT2 A;  1RT2 A;  1MSW D;  4UTG A;  2MB0 B;  4KHM A;  5DG8 A;  3MD1 A;  1UFL A;  2KG1 A;  4B9M A;  4MKY A;  2C28 A;  4OHV A;  3QJJ A;  3IG1 A;  3GV7 B;  2B9E A;  2RRB A;  5HN0 A;  2YPZ A;  2GVD A;  5HQ8 A;  4LBP A;  1N0U A;  4MTP A;  1I5O B;  1RT4 A;  2E29 A;  3B4M A;  1ROF A;  4LR7 A;  4J90 A;  4RW4 B;  2HBZ B;  3NGU A;  2B3T B;  2HHP A;  3ONQ A;  2ZIT A;  1TMM A;  3MMC A;  3PFO A;  4RW8 A;  3D3C J;  4NPO A;  3BM7 A;  1LWE B;  3M6U A;  4J9P A;  4GKK F;  4U6P A;  1IN0 A;  1UMJ A;  4ED5 A;  9RUB A;  2CJX B;  3CDB A;  4UOH A;  4B9T A; 
#chains in the Genus database with same CATH homology
 1W7W A;  5CAB A;  4UOF A;  3ZTR A;  1XQI A;  2DY9 A;  3Q89 A;  1B99 A;  1NB2 A;  1S59 A;  3BBB A;  4ANE A;  3FBB A;  3JS9 A;  3GP9 A;  4KPC A;  2BEF A;  1S57 A;  1WKL A;  1JXV A;  1NDK A;  3ENA A;  3Q8V A;  3NGT A;  4O0N A;  1NDP A;  3FBE A;  3VGT A;  3EE3 A;  1LEO A;  1PAE X;  1NDL A;  1NDC A;  3FBF A;  3FBC A;  1B4S A;  3ETM A;  1NSQ A;  2DXE A;  5IOL A;  1MN9 A;  1NSP A;  2BX6 A;  3NGS A;  2B8P A;  3FCW A;  2HUR A;  3L7U A;  4ANC A;  1XIQ A;  3B6B A;  3BBF A;  3NGR A;  3G2X A;  1K44 A;  4DUT A;  1F3F A;  1KDN A;  2NCK L;  1LWX A;  4EK2 A;  3Q83 A;  3VGS A;  1HHQ A;  2HVE A;  2ZUA A;  3EM1 A;  1NCL A;  3EVO A;  3BH6 B;  5BXI A;  1BUX A;  1NUE A;  4CP5 A;  3Q8U A;  2HVD A;  3VGU A;  3PRV A;  4F4A A;  1WKJ A;  3FC9 A;  1NHK L;  3EIC A;  1HIY A;  1NLK L;  3EMT A;  3ZTP A;  3ZTO A;  5CAA A;  4ENO A;  3PJ9 A;  3WX8 A;  3EVW A;  4WBF A;  2B8Q A;  2DYA A;  3NGU A;  1PKU A;  3VVU A;  1MN7 A;  5C7P A;  1S5Z A;  1NSK L;  2AZ1 A;  4FKX A;  4C6A A;  3BH7 B;  4AND A;  3EVM A;  3FCV A;  3ZTS A;  1UCN A;  4W98 A;  1BHN A;  4S0M A;  3BBC A;  3DKD A;  3VGV A;  3ELH A;  2CWK A;  1BE4 A;  3GPA A;  2DXF A;  3EJM A;  1VYA A;  2VU5 A;  4DI6 A;  3Q86 A;  1ZS6 A;  1NPK A;  2AZ3 A;  3DDI A;  1HLW A;  3MPD A;  4FKY A;  4UOG A;  1WKK A;  3R9L A;  3B54 A;  3VVT A;  3ZTQ A;  4HR2 A;  1EHW A;  1F6T A;  1U8W A;  4F36 A;  2DXD A;  4DZ6 A;  3FKB A;  4UOH A;  3Q8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...