2KH9A

Solution structure of yeast prp24-rrm2 bound to a fragment of u6 rna
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
86
structure length
86
Chain Sequence
MTECTLWMTNFPPSYTQRNIRDLLQDINVVALSIRLPSLRFNTSRRFAYIDVTSKEDARYCVEKLNGLKIEGYTLVTKVSNPLELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Splicing/rna
molecule keywords U4/U6 snRNA-associated-splicing factor PRP24
publication title Structure and functional implications of a complex containing a segment of U6 RNA bound by a domain of Prp24.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 15
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kh9A00
2MSTA 3G4SS 3CCJS 1U6FA 4TU8A 3EGNA 2E5JA 4PR6A 1WWHA 2D3OR 2FHOB 2LYVA 5DM6Q 4YUDA 3SXLA 2RRAA 1U1QA 4WKRA 2KXFA 1N52B 1R8PA 1UFWA 2HVZA 2EK1A 1JJHA 2ADBA 3EX7B 3IWNC 2CQ3A 2MZTA 3Q2TC 2HGNA 4CH1A 2K3KA 4YB1P 1G2EA 4M5DB 5HL7Q 2X1FA 1X4FA 2DH9A 4P6QA 2MKKA 2AYGA 4ED5A 2RVJA 5DDQC 2AYMA 4C4WA 4F25A 3UD3P 2ERRA 2MQQA 1SJQA 2DK2A 2DO0A 1M5VC 1QVFR 2KU7A 4CQ1A 1YIJS 1FO1A 5GAHU 1VQKS 2MXYA 2N3LA 1IQTA 5LJ5Y 2HGLA 1HL6A 2MJNA 2PE8A 1SJRA 3S7RA 5IM0B 3R1LA 2A3JA 5LXRA 1VQMS 1U1NA 1VQ4S 2MSSA 3BO2A 2E5HA 5DDPC 1CVJA 2DGQA 2F9DA 2RS8A 5JVHQ 3CCES 2ZJPQ 1U2FA 2LA4A 1FHTA 2NZ4A 2GHPA 2M9KA 3UCGA 5BJRA 2M70A 1KD1T 3SDEA 2M7SA 3CCLS 3CD6S 3G8SA 1VBYA 2RQ4A 1FXLA 2MYFA 2QFJA 3NS5A 2FC8A 2CQGA 1A7GE 1WEZA 2JRSA 2KI2A 3THPA 2DH7A 1UAWA 1M1KT 1SJ4P 2KG1A 1P27B 3FEYB 1VQLS 2MGZA 1UW4A 3IRWP 2DGVA 2DHAA 2DGUA 4BS2A 1BY9A 3MUTP 3EGZA 3BEGB 1Q82T 5IFMA 1QM9A 1N54B 2AD9A 4EGLA 4TU9A 2MKHA 3P5TL 2MKJA 2E5IA 2XNRA 3SMZA 3BO4A 3G8TA 2CPJA 3U1LA 1WG4A 3MURP 1X0FA 3S01A 4TU7A 3HHNB 2BOPA 2DH8A 4OZ1A 2MHNA 2RQCA 2DO4A 2V94A 2CPXA 2MQOA 2LQ5A 1M5KC 5FJ4A 1U1PA 3D2WA 1WEYA 2F3JA 1S72S 4UY8T 1ZZFA 1WI8A 1P1TA 4WIIA 4V19X 1X5SA 3P6YC 2MY8A 3G96A 1FNXH 2KM8C 1KOOA 3MUVP 3THTA 2MMYA 1X4DA 2LXIA 4PKDB 2E5GA 2MZJA 5D77A 3VAFA 1QVGR 1DRZA 3R1HA 2MKIA 1X5TA 2ADCA 2FC9A 2E44A 1Q7YT 1VQOS 2GO9A 3MD1A 2XS7A 3R27A 4Y0FA 2VOOA 4WFAQ 2CQCA 2MPUA 1U1MA 4PRFA 3RW7A 5DDRC 2MJUA 1WTBA 1Q86T 2JWNA 1X4EA 2LA6A 5CYJA 2RRBA 2L9WA 3B4DA 5D78A 4IOCQ 3UD4P 1U1OA 2LKZA 3G71S 2DNKA 1VQ9S 1ZH5A 2MZSA 2CQHA 5MLCV 4QQBA 2DNNA 2J0QD 2DHXA 2MY7A 3P49B 2N3OA 2DIVA 2MKCA 2UP1A 1VC0A 2OTLS 2DHSA 4LJMA 3VAIA 2RUGA 4F02A 1FJ7A 3PIPQ 1VBXA 3FEXB 1X4AA 1DBDA 1YJ9S 2AYEA 5DDOC 2X1AA 5ITHA 1YJNS 5LSLA 2DNPA 1D8ZA 2I2YA 2YH1A 2M2BA 1X4HA 1VQ7S 4QU6A 3J7ZT 2VODA 2DGXA 3VAKA 5IM0A 5HO4A 2KM8B 2CQBA 2EK6A 2HYIB 1L3KA 1X5PA 2L08A 2KRRA 5DM7Q 2XS2A 1DZ5A 2RS2A 1U1RA 5GAEU 2JVRA 3MI7X 2MZRA 2RT3A 5JVGQ 4ERDA 4CIOA 2WBRA 2XS5A 3NS6A 3I56S 3CCSS 1VQPS 2D9OA 1X5OA 2DIUA 2L41A 3BS9A 3H2VE 2CPFA 4W92B 3G9CA 1HA1A 1H2TZ 2MZQA 2MQNA 5GMKa 1M5OC 2BZ2A 2DITA 4Y00A 1RK8A 1VC5A 2CPDA 1Q81T 5H1SV 4UQTA 3MXHP 3NNAA 4WCEQ 1K8AT 3UCUP 1U6BA 4TLQA 2DGOA 2VONA 2X1GA 1WEXA 2CQDA 1FJCA 2XB2D 1WF0A 2M4MA 1K9MT 1KQSR 3ZZYA 2OJ3A 2MZ1A 2DHGA 1WHYA 2DNZA 3CMES 3PIOQ 3NNHA 2DNHA 3NMRA 4U67Q 2M0GB 1S79A 2MKSA 2G1DA 1NU4A 2DB1A 3P3DA 2LXUA 2ZJRQ 3J7YU 1FJEB 1K73T 2J76E 3MOJB 3MDFA 1KC8T 4CH0S 3VALA 2KN4A 1X4BA 2HGMA 4QU7A 3UCZP 2G4BA 1OIAA 1VQ8S 3S8SA 5LXYA 3CCUS 2VOPA 2KRBA 2OTJS 4WF9Q 1UP1A 2DISA 2DNQA 2CPYA 2CPZA 2KFYA 1HD1A 2NLWA 4IUFA 2KH9A 1H2VZ 1URNA 5EN1A 1W2BR 2KVIA 2MQLA 2U2FA 5LJ3Y 5GAGU 2MQPA 1N8RT 4LIRA 3NNCA 2CPIA 2DNMA 2G0CA 3VAHA 3CCVS 3VAMA 2YWKA 1WHWA 2HZCA 1WF1A 3JB9k 3TP2A 2J8AA 2LEAA 1ZZNA 2N82B 3DXBA 2EVZA 1HD0A 2XNQA 3CXCR 3CMAS 2LEBA 2CQ0A 1H6KX 2F9JA 2CQIA 1YWXA 1VQ5S 2U1AA 5LSOA 1YJWS 4LMZA 1M5PC 4YOEA 2XSFA 1XN9A 3I55S 3CCRS 2FPHX 2O3DA 1VQ6S 2J0SD 2DNLA 2KYXA 1WF2A 2KHCA 4J5OA 1VBZA 3V4MA 2D9PA 2YH0A 2DGSA 2RU3A 3CC2S 2CPEA 4W90B 2AYBA 3US5A 1PGZA 2DNRA 2MB0B 2CQ1A 2KT5A 1NO8A 3N9UC 4C7QA 3CCMS 1YITS 2OIHA 3CULA 4IOAQ 1WHXA 3L3CA 3U1MA 2M88A 2QA4S 3H2UB 4FXVA 5GVQA 3SDEB 1FT8A 1O0PA 4OZ0A 1F9FA 1B7FA 3CC7S 3HI9A 1U1KA 4IO9Q 1JJ2R 2CJKA 2M52A 1WHVA 3OW2R 1SJ3P 1JMTA 2KXNB 3ULHA 3MD3A 3RW6A 3CF5Q 2LCWA 5IQQA 2Q79A 2B0GA 4A8XA 3LPYA 2DNOA 2DNGA 1PO6A 3LQVA 3G6ES 4QPTA 1DHMA 2MGZB 3CC4S 1WI6A 2DGTA 2LMIA 2LECA 5DETA 1VQNS 3VAJA 5CXTA 3BO3A 1WELA 3CUNA 2YKAA 2KG0A 3ZZZA 4WFNQ 1D9AA 1SXLA 2FY1A 1OPIA 2DGWA 3S6EA 2X1BA 2CQPA 3TO8A 1WG5A 1YTYA 3VF0B 1VC6A 4RU2A 1N88A 3UE2A 4WFBQ 2JVOA 5CA5A 1M90T 1OO0B 2YTCA 2ZJQQ 3K0JA 2N7CA 4F26A 1SJFA 1OWXA 2I38A 2OSQA 1X4GA 2KXHA 2M8DB 1JJ4A 1WG1A 2K8GA 3TYTA 2CPHA 1YI2S 3Q2SC 4ZKAA 3VAGA 1NJIT 2CQ4A 2JX2A 5GADU 2RNEA 3MUMP 4C0OC 1X4CA 3CPWR 2CQ2A 3B4MA 1RKJA 1R8HA 1H2UX 1KOHA 2M8HA 2PEHA 2QEXS 4Z2XA 3CCQS 1U1LA 1A9NB 1YHQS 3CTRA 1AUDA 2DNYA 3UWTA 2MQMA 2OSRA 3DLLQ 4FXWA 2SXLA
chains in the Genus database with same CATH superfamily
1R6YA 3IC1A 2B8PA 4QWCA 2FHOB 5LMUJ 4AFFA 5DM6Q 3RTVA 5A76A 1U1QA 2A10A 2WVDA 4CLKA 2HVZA 1B0VA 2ZHBA 3DLEB 2EFQA 2ZBPA 4OI3A 2P6TA 1EETA 3Q2TC 4CH1A 1H0HB 1RU1A 4MFBB 3SV4A 1LKZA 4DR6J 5CYQB 4DU8A 4Y34A 2F5GA 2VJUA 3DYAB 3HHDA 1UWBA 3E51A 4OYAA 1RAAB 3H5SA 3IBFB 1F0XA 5IT4A 5A8KB 4USMA 3FCVA 1TTHB 1VHFA 2F9DA 2YKPA 3DOLB 2LA4A 2Z30B 1DY3A 4C97A 3MMAA 1UKUA 3GG0A 2HNDB 2UU9F 4CM0A 2MYFA 2ZVSA 1IJEB 4PWUA 2AWZA 2HQFA 3QRQA 1LEOA 3DI6A 3TX0A 4ZP7A 4IQXA 3MUTP 3ILOA 3KDNA 3MWBA 4RWWA 4PWDA 4KHPJ 4MK7A 1B99A 2E5IA 2XNRA 3IG1A 4TU7A 2BKPA 1FKOA 5BR8J 3A8EA 2EKYA 4NLDA 3PX6A 2EEYA 1IN0A 1ZM4A 1X5SA 3L7UA 2KM8C 1KOOA 3MEEA 4ZLNA 1N48A 1MN7A 4GKKJ 5H9EJ 4MIAA 2W8LA 3A3OB 3W8GA 2L3MA 2PEBA 3F56A 1TL3A 1MMDA 2D7SA 1YBTA 4RPFA 2VZ9A 3QIPA 4M63A 3VR1A 1HI1A 2C3YA 2XI3A 2HHHF 4X4PA 3DGVA 4BC9A 2COLA 2BJ8A 4OHWA 3UD4P 1U1OA 1NBEB 1VQ9S 2ALZA 1U45A 1VI7A 1NPKA 1FK9B 2CQHA 2BKNA 2FLNA 1C0UB 3EVOA 4KH1B 2HWIA 1RYRA 1LXNA 3RBEA 4LRBA 4DQIA 3K5OA 3MFIA 3HKWA 1ROFA 4DV4J 1S4FA 1HQEB 2BV3A 4ECWA 1RJJA 4OV1A 1S97A 5LMUF 5IM0A 5T7LB 2KM8B 1WC4A 4HVZA 4USJC 1PYTA 3FUYA 3MEGA 1T9VA 2RT3A 3DRYA 3BREA 3OFFA 3FBFA 2G1HA 2A2CA 4Y2AA 4NLSA 1F5BA 4I69A 5CH7B 3DDNA 4NRUA 1CJUA 2DIUA 3HSJA 1U09A 5KT2A 3MMBB 3I0RB 4DR6F 4G65A 5H1SV 1RAIB 1VRQC 1WORA 1U6BA 6FD1A 1RADB 3UVJB 1P9QC 1S6OA 1PJ7A 1EKSA 1HBUB 1SIWB 4J9RA 3R7BB 1APSA 1SKSA 2QMXA 1B7YB 2W8KA 4ZJQA 3ELHA 1VQYA 2JEGA 4CH0S 5FDLB 3C19A 3J7AN 1JK9B 1RCOB 1SCJB 2Y1LB 3ENAA 2Z8QA 2KVIA 1TVRA 4C3KA 3VAHA 2KB2A 1WACA 1R6VA 3TZWA 2MEWA 5K8MA 2LEBA 3W5ZA 4KHPF 2JEIA 4DS5A 3MEDB 2L48A 4OI1A 1RXOB 3JTOA 2DNLA 4QYZK 4Q0BB 1S9FA 5BR8F 3V4MA 2HHVA 2C3UA 3CDBA 3CC2S 2H51B 3CVKA 2HNYB 3HZGA 3MF5A 2MB0B 5KG1A 1UVKA 3L4BC 4F4XA 1RKIA 2KT5A 4EYIB 1YITS 3QO9A 4KE5A 3H2UB 1FKPB 4DX5A 2YBVA 3MPYA 1GEHA 4EZ9A 3K5LA 4H4MA 4GKKF 4IFVA 2FVCA 3PO4A 1GK8A 5IQQA 2Q79A 4PG8A 2FHMA 3T9NA 3TUPA 4RUHA 1DHMA 3NLCA 1SL1A 5CXTA 2LVWA 1IKYB 1HMVA 2CKWA 3TNVA 1BQNB 1FTCA 3S6EA 4ZOSA 3GU0A 2W2OP 4DR1J 1T9TA 1L3VA 2WVFA 1S6UA 1BWVA 3HFVA 5HI7A 3K89A 2XZTB 2YX1A 2RF2A 4DV5F 4DV4F 3GJRB 3BSNA 2CQ2A 4J91A 4CLSA 5C25A 2AKWB 2YPZA 3DLLQ 3MAHA 5EGYA 1WWHA 3M4XA 2CJXB 1RT4B 5KFMA 2AZ3A 4HYKA 3EX7B 2X3GA 3GYGA 2FJEB 3PRDA 2V68A 4OHZA 1UWAA 3CJKA 3CJ0A 2FJBB 4WFXA 2UXBJ 4FN5A 3MAAA 1UVLA 3ILIA 4B9UA 2KJWA 2ZZMA 4N76A 1HL6A 2VG7A 2K7KA 4CLPA 4N41A 4DPXA 1CJTA 3ETOA 1G7CB 2GHPA 4V1Ak 2BANA 4Q45A 4LFCJ 1RHQB 3EGVA 3U02A 3A13A 3GLJA 2QFJA 4NLXA 5C42A 1NDCA 3THPA 3N0VA 4E0DA 3MEKA 2MGZA 4B9MA 4NLUA 1TUGB 4R0EA 1R0BG 1QM9A 1J5EJ 3TVKA 2GVDA 3E01B 5ETLA 2P9CA 1Q79A 3KJQB 2K2PA 3HKZD 4QIGA 1PC5A 2GW8A 1K47A 2JJ4D 2R8HA 1M5KC 1U1PA 1HW8A 3UDLA 1P1TA 1XR7A 3CGIA 4NRTA 4ER8A 3TA0A 4EBEA 2HVDA 2ADCA 2FC9A 3OUYB 1M5SA 1Q1KA 2B51A 1H38A 4QBUA 1ZAWA 3BSCA 1T02A 1S1VB 4U9RA 4DR1F 2ZZNA 1Q4RA 2CA9A 4ECSA 2A0FB 2LLZA 4AUKA 4KKOA 3H20A 2QLBB 2DRBA 2VPWB 3OLBA 2D41A 2DPJA 4AYBD 2EG1A 3TX8A 2CQBA 1FVSA 1U25A 4EYHB 1U1RA 1Y10A 4NLGA 1PAUB 3FRYA 4LREA 3NY0A 3T1YJ 4JI4J 1G4CA 3H2VE 3HHLC 2UXBF 2IRUA 4FKXA 3RAMA 2R7XA 1L3UA 2YNFA 4TLQA 4JV5J 4HDGA 1CJKA 2RKIA 2EFVA 2V67A 3NMRA 2ZH7A 1RWVB 2QSWA 1QTNB 3LAKA 2GJIA 3UN5A 5KFTA 4LFCF 5DG7A 2G4BA 2XY6A 3HVTB 3KK3A 1HARA 2KH9A 4RR5A 4IRKA 1CULA 3KJNB 4M5MA 2OD4A 4A8KA 4C6AA 2OEJA 2XULA 3HHLB 2H1YA 2W9CA 1PBAA 4PYDA 1J5EF 1UTAA 4EEYA 2HHXA 3EZOA 1FFGB 3IO1A 1HHSA 2FPHX 4UOGA 3WBZA 1VQ6S 2R7QA 3H5UA 2CZ9A 2NR0A 3D6TB 3PRVA 4N56A 4HKQA 2OPPB 2IVYA 4CLLA 1NKBA 2GIQA 2R4FA 2MLXA 4F2SA 1O0PA 3RU0A 3PEJA 5L46A 3OW2R 2IYIA 4DR7J 1KQGB 2YY3A 1TKXA 4A8QA 1N56A 1BQMA 3VZHA 3IR5B 2OPSB 3BH7B 2UUTA 1X60A 3O6QA 2I1RA 1Z2ZA 4A4JA 1XMOJ 1OPIA 2DGWA 1XEZA 1JKHA 4K4WA 1YTYA 1U47A 1KN6A 1OO0B 3DHXA 1HHQA 3QWUA 5A6PA 3G6VA 3GZ7A 4Q8EA 2GAGC 1R43A 1WG1A 2JX2A 3ZTPA 2W1BA 1HI0P 2QEXS 5DQIA 5GMDA 4KHRA 1N6QB 3CDUA 2R2SA 3G4SS 5CZVA 5M2RA 5D0HA 2C3MA 2XCPA 3U1NA 3QRRA 2X7IA 3T1YF 4JI4F 4DUZJ 5A8RA 2UUAJ 3PM9A 1JJHA 3PW2A 2ZH1A 2LDYA 3DOKB 4DEZA 3R6LB 3IS9A 4H4KA 3ZTOA 2HGNA 2BBEA 2UV8G 3HSZA 5C2CA 2X1FA 3R2CJ 2YKNB 4JV5F 4ED5A 4HHJA 4WBFA 2HVHA 1LWFB 1E6YA 3ZZOA 2R8KA 4CQ1A 4PQUA 4DQQA 2HS3A 5D0RA 5GAHU 3K7RA 1WC1A 2VC0A 3M1VB 2PFDA 5DDPC 3MPDA 3ZZPA 3CCES 3K17A 4ZVSB 5IZHA 4QIFA 3VGSA 3J81j 4LSZB 1JLFB 1D1UA 3IRWP 2DHAA 1OJ4A 3OVAA 2FZGB 1YKWA 2V2VA 3H90A 4TU9A 2E9RX 4WKYA 1WKLA 1AZSB 4HACA 1C4CA 2BVZA 4P2SA 3MMCA 4LF9J 2W7PA 2O66A 2MHNA 4O3QA 3MPVA 3HM9A 1Y11A 4HEA9 3UR3C 1FDBA 3FCWA 2KJVA 1WEYA 2JLFA 4DR7F 1OMSA 1S48A 3C14A 3TUIC 3QGGA 2P9EA 3G96A 3OV7A 4L74A 3THTA 4WYWA 1AB8A 5EUHA 3R7SB 1IBMJ 1NDPA 3PVXA 4QW8A 3CWJA 2QG9B 2LA6A 2H5EA 4IG3A 3TOQA 4I6YA 4Y2CA 4NI2A 1S4EA 4AXIA 4BC7A 2HLUA 2W4DA 4I2QA 5HMXA 2DHXA 4TY9A 4K59A 2VA2A 1GTHA 4OJGA 3MECA 1C0TA 1UETA 1VDHA 3C2PA 5I3UA 3M05A 4JI8J 1CEZA 3L7PA 4ZLPA 5K14A 2YQ0A 4TY8B 4DUZF 2UUAF 3H8YA 2RS2A 4K4VA 5GAEU 1TAQA 2XLIA 3MFHA 4UF4A 2VG6A 1RT1B 1U0HA 4WZMA 3DMJA 5KFVA 1RBLA 3JSMB 4Y3CA 5K9FA 2Q66A 1UFKA 3KHLA 2X1GA 2OPQB 4UUWA 1NCLA 4M5JA 4IRDA 3N79A 3RGIA 4C8NA 3D28A 4PZVA 3OHAA 3WX8A 4LF2A 1DTQB 1LWEB 5IV3A 1X4BA 5HLFB 2VOPA 3CCUS 2KRBA 5HROB 1HBNB 4UZCA 2G2ZA 2CPZA 3CJRA 5KG5A 5F9NA 5L1LA 4B3OA 2QSFA 3FZ2A 2Z2ZA 5LJ3Y 3D6MB 1FD8A 4NXMJ 4KY3A 1R8AA 4ECYA 1NHKL 2XMAA 2HQIA 4PPZA 3POTA 3DOMA 2EVZA 1F5AA 3CE8A 3CNQP 2FJAB 1X8DA 3G82B 1KFSA 1UCNA 3I55S 2JOQA 5L1IA 3EMTA 1EZZB 4NXNJ 2HMIA 4YDXA 2B8QA 4O3SA 4FXDA 4DG1A 2OEKA 3FVYA 3HHEA 1XR6A 5C2GA 2AEJA 4X4QA 5G0RB 2YNGA 4WFZA 4DN9A 1IBMF 4ILMA 4X84A 3NWGA 3GTYX 4A8XA 2CVIA 1UJ5A 3CC4S 2DGTA 3FCHA 4TVAB 3VAJA 3BO3A 1WSRA 2W24A 1RT3B 5J1EB 1JX4A 4YDDB 1DFDA 1LNQA 3V81B 1NJYA 2DBBA 3BBCA 4WFBQ 3HSDA 1HNVA 3PHEA 1K44A 2ZJQQ 1S76D 3W3SA 4DHVA 2H54B 2P2CB 3H7HB 1S1TA 4ZKAA 4PXDA 4K8RA 1KR4A 2EPIA 1HQUB 3PKMA 2DY1A 3M8SA 4JI8F 5HMYA 1H2UX 4OV6A 2B6AA 4G1IA 2KFZA 2V6AA 1EJ7L 2ZHAA 2SXLA 2MSTA 1WOOA 1GNKA 4IH7A 8RUCA 2GIRA 3MM5B 3C8YA 4KPYA 3AXKA 1VRTA 4IR9A 5L39A 2APOA 3OL8A 2GX8A 3EJMA 5HN0A 1WC0A 4M5DB 4OHVA 4XO0A 3CW2C 3VTIA 2DH9A 2MKKA 4Q7AA 5EDWA 1EARA 2VBWA 2ZD1B 3WC0A 1M1GA 2ASLA 1UL3A 2B56A 3A1YG 4F04B 3S7RA 1BXNA 2KVQE 1U1NA 4DSKA 2QYCA 4FYWB 2ZC4A 3FSIA 4LBIA 1E6VA 4IQMA 3WHIA 3KLEA 4NLWA 4F0KA 3OXLA 3Q8VA 3GWCA 1R0CB 1S7HA 4NXMF 3W8PA 1A7GE 5B09A 5F8IA 4C0HA 2IM2A 3H4BA 2V9KA 3BV8A 1UAWA 3JSBA 3WZ0A 5I42B 4X66J 1UEUA 4B9VA 3MCSA 2PDAA 3SV3A 2UVVA 2BX6A 4NXNF 4ECUA 5E0OA 3I9ZA 2LQ9A 1R0AB 2BE2B 4QJVA 3IA0A 2K7JA 5KT6A 1JLBA 2RQCA 4KGXB 3W1YC 1ZZFA 4X4UA 4EK2A 4K2JA 2Y0SD 4FPIA 3VAFA 1IKWB 1X5TA 1OY6A 2RDJA 3AFGA 3QRPA 1D09B 2CQCA 1ZA2B 3QNWB 1JLEA 3TVZA 2GVZA 3M9MB 4U7UK 1F1BB 2XO7A 4JYAJ 4PUOA 1ZTTA 2CXEA 3M2UA 2ABYA 2ZKTA 5MLCV 5HATA 4J9QA 2ALYB 3C6UB 3ENQA 3MPWA 4F8RA 4UY85 4AT1B 4PEOA 1KSPA 2IJNA 3QJJA 1FJ7A 6FDRA 4BCAA 1B4SA 1RTDB 2NPFA 1VR6A 4TQRA 2Z56B 3LP2B 4X2BA 2CG4A 4DF4A 2ZNYA 3TRGA 2NQPA 3UDVA 3AD8C 2V2ZA 4C8OA 3L09A 4NA1A 2NS1B 3PCOB 4GVLA 4RW4A 1AYEA 3OR2A 4DUYJ 2IAJA 5FLXU 1VQPS 3RB3A 1ACMB 2C22A 2WVBA 2H4WB 3V6DB 4Y00A 4Q44A 4DX8H 5U47A 5DQHA 2M4MA 1K9MT 2R2TA 2C3PA 1NNDA 1DQ8A 3KKFA 4DR2F 4DI6A 2MZ1A 3B6BA 1QTMA 4RX6A 5D3GA 4CO5A 2HZVA 2VB6A 2HRUA 4OI6A 4CT8A 2HGMA 4QU7A 2BJ3A 4NMXA 1RSCA 3MCNA 3FFIA 3AD9C 1H2VZ 5EWGA 3PZPA 3MCOA 3BJYA 2UZAA 4F4AA 4X66F 4HHUA 4L73A 4DCPB 5D0GA 3A8KA 2LEAA 3DXBA 1OQ3A 2CQ0A 1H6KX 2PI4A 2FY8A 3KTQA 1YJWS 1QE1A 2R7UA 1NSPA 3EXYA 4DV2J 3QZ7A 3A3NB 3DCAA 4GKJJ 3KNAA 1RHJB 1HHTP 4NZ7A 3J7A1 2XBPA 4ZP8A 4IO9Q 1HR0J 1JQGA 4LVOP 5B7WA 4DZ6A 2KXNB 3MD3A 3A3PB 3GR0A 3IXQA 4DV0J 5CQGA 1TFYA 2C2OB 2QN6B 3D1HA 4ZVQB 4QPTA 4F0HA 4FBTA 2LECA 2GAHC 4NL5A 2W9AA 4OYXA 3HHLD 2C2EA 4JYAF 3ET6B 3G2XA 4FF1A 4OYMA 3D0HE 5G4DA 2FLPA 1V5IB 2F65A 1IM6A 2RQMA 3DRRA 1VBKA 2JEFA 1QUPA 3EVMA 2A6MA 1B0PA 2ZOGA 1LXJA 4KPCA 3KDOA 1VMBA 1RAEB 3E2EA 1N32J 4MKAA 3CCQS 3PACA 1AUDA 3RRKA 5L9NA 2QGFB 4RNNA 1QAYA 1KQKA 3K5PA 4FXWA 2Q1LA 1BD6A 1TL1B 4RBUA 4ZVFA 3D7SB 2NXNA 2LYVA 1TP7A 1KWMA 3JTNA 4DUYF 3PXGa 1KRPA 3IP0A 2V5HG 2XGPA 2GV1A 3M2VB 2V4JA 4HHHA 5DG9A 4DSJA 4QYRA 5J2QA 1J5OB 1XERA 3IWLA 4ECQA 1M1HA 4PG4A 5A8WB 3M9OB 3TA1A 2QMWA 2HFUA 3UD3P 2GO8A 1RTJA 1SH2A 1SJQA 4JI2J 3QLHA 1Y3JA 4DV3J 3H40A 2N3LA 2CNNB 4OI2A 1Q0NA 2ILZA 2E1CA 2OP5A 5B0BA 2R2UA 4ZVUB 3SQGB 1REVB 3IRXA 3MM8B 2VFUA 3ADAC 3M8WA 2EC2A 1HNWJ 1SBRA 1ZM3A 1YZ7A 2VC1A 3TAMA 5BJRA 1KNZA 2Z2LA 4ZJLA 1VBYA 3IWXA 5IT0A 5AXNA 2UV8A 4J9LA 3GFYA 1U8WA 1TKZB 4P71A 5FIIA 2DD8S 2J7UA 1SJ4P 3BH6B 1MWZA 4HH1A 3UNYA 3DGPB 4DV2F 2NPIA 1N54B 3B78A 4GKJF 2FLLA 2B5JA 1NUEA 2BOPA 3FZBA 3GV7B 1RGVA 5KFZA 3QSIA 3TJ9A 4DPWA 1FEEA 1LW2A 3T5LA 5FJ4A 1IBKJ 1M0SA 1WI8A 3TI0A 1JXLA 2IRYA 3ZTSA 1FNXH 4DV0F 4WJBA 4F3OA 2JEJA 1AFJA 1I1GA 2L9DA 2E44A 3MD1A 1BUXA 2VOOA 3HSGA 1TZ0A 1Q5VA 4OYOA 2WW8A 2IPOB 4ZITA 3GJTB 1TR0A 2E7VA 2RDDA 4E98A 1JXVA 4ZIVA 4EBCA 1U4BA 4Q2LA 2AX0A 2I5JA 4NCGB 1N32F 1RT2B 4F02A 3MM6A 4KH0B 1S6PA 1HIYA 1WKJA 3W9IA 3SSSA 1OSCA 4CYUB 3W2VA 4C8YA 2C2NA 5DM7Q 3AAWB 2FGCA 1L3SA 2V8HA 2PA8D 3MTJA 4RBVA 1XJWB 1JLCB 2D69A 5DQGA 2XS5A 3Q8SB 4DL6A 3NBPB 4M5IA 3CCWA 4EU0A 2D3ZA 1SH3A 2ACMA 2CPFA 5DLFA 3G9CA 3QYYA 2MZQA 1SQEA 5DZ7A 2BQ3A 1RK8A 3HT0A 4GRSA 5D8HB 3VVTA 3NNAA 1FFWB 2IVMA 5DZ6A 4CP5A 5C7PA 2CQDA 2G9OA 4DV3F 2YKMB 1V3SA 1KQSR 1SUQA 2J0WA 3KJVA 1ZS6A 4CO2A 3OVSA 1F2GA 4A8SA 3SZ2A 2W9BB 4XPEA 3OHBA 1HNWF 5B0AA 2J76E 1EB0A 4NCBA 3UCZP 1ELOA 4AE5A 3BPSP 4USTA 1QLNA 1RWOB 1EETB 1BQXA 4F3QA 4WU2A 2VUGA 2HAIA 2DR7A 5KFBA 2NUHA 5IS2A 3TZYA 1UWBB 1RWKB 2O67A 2D9PA 2RU3A 4W90B 3RJMB 1PGZA 3PW7A 1IBKF 1UPMB 1N4LA 2DT9A 3N9UC 3AA9A 2PC6A 5C24B 4P10A 4I2PA 3MMAB 2CZ4A 2QJ3A 4JB8B 4ECTA 3CCTA 4OJHA 2BXJA 1KQFB 3DOLA 2IDLA 1UEKA 2DNOA 3H98A 2DNGA 3G6ES 1NK4A 3DI6B 2LMIA 4H4OA 1QAIA 5DETA 3NG8A 3CUNA 3HJFA 4LR7A 4DV7J 2XZDB 2FY1A 2AU0A 3TO8A 4PWDB 4NLRA 4RU2A 2DHHA 2QO3A 3BGOP 1M90T 2YTCA 4OX8A 4RNHA 5DRKA 2JSXA 3TYTA 1YSJA 4C48A 2WK4A 5AE3A 3H0PA 2Y8WA 2YWFA 4DF8A 1T9UA 3M8QA 3MEEB 4Z2XA 2LU1A 3QGIA 2HG4A 1QAJA 4TKTA 3EGNA 3AA8A 1TL3B 2CAJA 2RJZA 1YJVA 3QIPB 4CLFA 4FNIA 4DUTA 1HI8A 4B02A 1UFLA 2RDIA 1NXIA 2CNKB 1MWQA 1GMWD 4ZN1A 2B9WA 4RW8A 8ATCB 3K5MA 3I5CA 1UMJA 1TL5A 1ZOTA 1C0UA 1N5TA 5H9EK 3F41A 2WZ1A 4J37A 2CJYB 5IM0B 2P8IA 2IMOA 3QPIA 2Y1IA 2C28A 1NK5A 2RS8A 3D0GE 1H74A 1SL0A 2FVSA 2RILA 5LMNJ 3MEGB 1J2VA 3RYLA 1U49A 3TA2A 3H25A 5T7LA 5HBMA 1CJUB 2VASA 3DRSA 2CJAA 4XK8C 1EQMA 1U2RA 4WTOB 3BQ2A 3QJLA 1FE4A 2KL8A 4HL9A 2PGCA 3WQPA 4ZP9A 4EGLA 4LF8J 2C2RA 3G8TA 3UVJA 3HHNB 3PW5A 1WD6A 3SCKE 1FWPA 1Y5IB 2JH3A 1CBKA 4WIIA 1V5VA 5DO2A 4MK8A 1Q16B 2HQDA 4OHYA 1TVRB 1TKTA 2LXIA 2E5GA 1TL7A 3SYZA 4Y0FA 3ONQA 1X4EA 4DFPA 3CMQA 3PV8A 4A8WA 1LFWA 3I32A 3H4DA 3NWRA 2Q6CA 3G71S 1HPZB 2WVCA 3OFGA 1JXEA 1NKCA 2JL9A 3MEDA 2RB7A 2DIVA 3QO9B 5DG8A 2DHSA 5HQ8A 4Q0BA 4MYUA 2HIQA 1DBDA 2AQ4A 4H4MB 4IFVB 5ITHA 1YJNS 3L95X 5A2QU 2M3DA 1IR1A 1XK8A 1OYDA 4CO4A 2HBZB 2XY7A 4B17A 3GJSB 4UOFA 5F8MA 2RHSB 3OSNA 1XMBA 4NLYA 4NPOA 5DJBA 5BYSA 1S1XA 1HMVB 5L9XA 2WBRA 3R5AA 3Q23A 2DY9A 3OSPA 5FLXY 5DLGA 2MQNA 1BQNA 1RUSA 1M5OC 2CPDA 3C3LA 1NKEA 3KLIA 2NYHA 1FJCA 2RF2B 2VG5A 1NJZA 1ZM9A 3PY8A 5C25B 1T94A 5K8NA 3N28A 2M0GB 2K1RB 4BWJA 1KS2A 3ZZTA 1R8BA 5LMNF 1VK8A 2DB1A 4DPTA 3TAPA 3MDFA 3NCRA 1OY8A 5ETRA 4J90A 1UP1A 1S0MA 2GJ2A 3WIUA 5ETOA 1S6QB 1YDLA 3OQ2A 3BGRA 4OZ2A 3D54A 4KBIA 3CJKB 2G0CA 3RAXA 2V8PA 4NMLA 4FYXB 1X7VA 3C15A 4USWA 3THVA 3MAAB 2WAQD 3CXCR 4UT4A 4LF8F 4Z37A 1U2CA 4YOEA 3LA0A 2J0SD 2VG7B 1WF2A 1JJCB 2IJRA 3IM9A 3PHTA 1KLMA 3KLGB 4QR1A 1N34J 2IMWP 1CJTB 5CAAA 5HJXA 2XMWA 4JP8A 2DEJA 2BANB 4CO3A 5GVQA 2ZH6A 3R2DJ 5B0CA 1B7FA 4KGZB 3EVWA 1WHVA 3I82A 4IO1A 5C42B 1VISA 2BJEA 2WONB 1O6XA 3D1QA 1YVFA 3DLGA 2MGZB 1PIEA 1SKRA 4RJVA 2KG0A 4C11B 1A0OB 5KT4A 2JFDA 2GVDB 1D8YA 4ANEA 4Y2KA 4C3LA 4OYWA 1FX4A 1OWXA 1KDNA 4M1KA 1JJ4A 4TNOA 1S9GA 1KHVA 1Y4ZB 1KLNA 3E01A 2F4FA 2PEHA 1A9NB 3LO3A 3CJ5A 1T9WA 4RW7A 3CCJS 4OLOA 1WOSA 2VHGA 4B3SJ 5KFNA 4ZVOB 2Z2MA 2KXFA 2DXDA 3PO5A 1S12A 4RW6A 3VQTA 4F7VA 4ZDNA 4OX7A 1Q8BA 2J0XA 4Y2MA 4YB1P 4KKOB 3AJ1A 3T1AA 4I6WA 2AJ2A 4CDIA 1CG2A 4EO8A 4N5SA 3IFEA 3SSQA 2WCXA 3FSXA 2BW2A 3E3XA 2DO0A 3NGDA 5IOLA 1JNZB 4XAKA 4A46A 2AZ1A 3GSDA 4NLVA 1YBAA 1CLFA 2J7KA 3FSYA 3R1LA 2A3JA 3BGLA 1VQ4S 2E5HA 4QWEA 3LF0A 1U2FA 4ZA1A 4Y28C 3CD6S 2CDRB 3U7JA 4EUVA 4IH5A 1RHMB 2HS4A 5IC4B 1ZPVA 3L9ZA 5J2PA 2XCAA 3KUEA 1SL2A 2RUSA 2BJ1A 3DRXA 2DR5A 3A4TA 2DGVA 5E33A 4J9MA 5B0DA 4CLTA 4U96A 1N34F 2W2QP 3KWMA 1GQEA 2HNZA 1GAOA 2F40A 4TXSA 1C1CA 2WHOA 1TAUA 2JLEA 2YWEA 1QSYA 3DM2A 4IG0B 2OHDA 4P2FA 3KK3B 3ENVA 2ASYA 4B3MJ 4URQU 2HHSA 3F0NA 1CULB 2ROEA 1WKKA 4K4TA 3HD1A 3ZZ0A 1VQOS 5AJ3F 3OTOJ 1YRXA 1S9EB 5EX0A 4WK1A 3CCZA 2W9CB 2CUYA 3EDQB 3D67A 2QL9B 3KUGA 1GMVA 4X4NA 2FYXA 2XTJP 3AY0A 4MIBA 1R89A 1PCAA 4EI2A 2R9LA 2GMJA 3P49B 1R7IA 4U8VA 4LF7J 2MLZA 3FGVA 4J9SA 2ZEJA 2OPPA 1TKXB 1BQMB 3GIMA 2RMLA 1AXQA 2QE5A 3PR5B 4B3SF 5KFHA 2VPZB 2EK6A 1IKVB 4M5NA 3DDIA 1L3KA 2BRKA 1N5VA 1DZ5A 2JVRA 4LBPA 1PKUA 3I4HX 2HURA 4OHXA 4O3PA 1JKHB 4CIOA 2H5JB 1H98A 1RWNB 4DL4A 4BHQA 4EMDA 1RWWB 5CD4H 1VC5A 3FC9A 2PIIA 2ZVIA 2VJVA 2HHHJ 2R7SA 2RAQA 3NGSA 4QWAA 2XGQA 3RB6A 1D0EA 4DXLA 3ZZYA 1FDAA 4ZPAA 2AJFE 2FHKA 2YXLA 4WP9A 2FJVA 2DNHA 1SV5A 3M8ZA 2JC1A 3KYLA 1OSDA 2KHDA 2LXUA 5D4LA 2ZJRQ 1GXUA 2MQ8A 1FNOA 3N6LA 3Q8PB 1KC8T 2CZVC 5A8RB 4MYTA 2E5LJ 4B9TA 3K2YA 3I5BA 1HQ2A 1VLOA 5F8HA 1LWCB 3IS9B 1CQMA 5JUMA 3CCVS 3K8VA 3VAMA 2HLTA 2ATCB 3TP2A 1E6YB 2AW0A 3GE9A 4PQUB 3R5DA 4KR0B 2JDJA 5KFDA 2XSJB 2VDHA 5CCMA 2O3DA 4NLQA 3MMJA 4URSA 3AOAA 3NRBA 1O51A 4ZVHA 4DR3J 3BDPA 4L76A 1FXDA 4B3MF 4ZPTR 5KFRA 2B43A 4FXVA 2QX0A 3GONA 5HVGA 2YNHA 1RT5A 2CJBA 3PR4A 1JJ2R 2LQ8A 1XNRF 2GS8A 3OTOF 2B0GA 2EXUA 3I5AA 3V6JA 1WC5A 4O44A 1WI6A 1RTHA 4MKBA 1DTTA 2UUCJ 1S1UB 4DFKA 1EIYB 3LW5C 1JLFA 4CNZA 1F6TA 4M94A 2EBEA 4ILLA 2WSFC 3IAS9 3EM1A 3LWMA 1FTRA 1VC6A 4NASA 4USVA 3AHPA 2BQUA 2NSBA 5ETSA 4AQYJ 3AT1B 4LF7F 1V9OA 3GCXP 3ITHA 1QD1A 3EZ5A 3W2WA 3TEGA 3C6TB 2ZKUA 4MH8A 4HLBA 1RTIB 3R5CA 3C14B 1RKJA 1D9FA 4BWMA 4LFAJ 4Y6IA 4RWXA 2MQMA 5GAGI 4WIQA 4DX7A 1T9XA 2ZBQA 2FLOA 1FJGJ 4YUDA 4OMFG 4HTIA 3HLUA 2OUGA 4IG3B 2XYPB 3M32B 2EK1A 3QFHA 3HVWA 4NI2B 4DV6J 3ISNC 1ZPWX 2CQ3A 2V8GA 2ZDPA 2MZTA 2EFPA 3BR9A 4I2QB 2ZWOA 3CO9A 5AXMA 4DJBA 3M6XA 3H5XA 2AYGA 2RVJA 1R31A 3MR5A 3QZ8A 4CTAB 2MQQA 1C0TB 4DL2A 1QVFR 4FYDA 1NEEA 2OKQA 1MNEA 5CZXA 4ES3A 2E9ZA 3Q8QB 5I3UB 5GAEI 1QSLA 4U8YA 5K14B 2IDEA 3Q89A 9RUBA 1R8CA 4RZRA 2E5LF 3M6WA 4ZCIA 2ZE2A 4DV5J 3QIDA 4I56A 1CS4B 1HLWA 4YR2A 2Y1RI 5CABA 2M70A 5E2QA 2VG6B 2BM0A 4TY8A 5DGBA 1WNEA 2O5DA 2FC8A 4USIA 1SC6A 2JRSA 1H72C 4OFZA 4QWBA 3GV8B 1F3FA 4MKYA 1P27B 1UVNA 2B4VA 5KG0A 1RT1A 1RTZA 3MGJA 4TQSA 3RRGA 1XMQJ 4PG6A 4ZHRB 1OYEA 3GV5B 2AD9A 4DR3F 2JHEA 2CWXA 4ZVTB 3QT5A 2BM1A 3GIRA 1EP4A 4YP3A 1GX6A 2V94A 5HVHA 1UPPA 5D15A 4V19X 1DTQA 4Z7CA 4ICLA 3VCDA 4B3OB 3ZTQA 4KSEB 1N36J 5HLFA 1X4DA 1PILA 1AA1B 1Q7YT 2UUCF 2P6SA 3DOMB 2VF3A 5E3PA 4F3MA 4WK3A 2RRBA 4JI7F 4L75A 1SVDA 5K8PA 4W98A 4AQYF 2RSQA 1IWAA 2HMIB 2DNKA 2BJDA 4F4YA 4DG1B 4CLUA 5RUBA 1LW0A 2M5YA 2UP1A 2OTLS 4PCQA 1FRLA 3DLKB 4LFAF 3FEXB 2YNGB 2Y0BB 5DDOC 1WDDA 5A2QY 1X4HA 2DR6A 1VQ7S 4FP9A 3W9JA 1FJGF 5G0RA 5HO4A 3Q24A 2HYIB 1V3ZA 3T1HJ 4DV6F 1FA0A 4OLPA 3BSAA 2QLWA 3BDEA 4Q2MA 4ERDA 4N8OA 4HT5A 5J1EA 4URGA 4W92B 3BYRA 4CO0A 2BA9A 3V81A 2D3UA 1NZAA 1GMWA 2I6WA 1VYAA 2B6AB 4ED8A 3G8QA 3PIOQ 2CYYA 2DRAA 4U67Q 1T8EA 4XDDA 1N33J 1HQUA 2G1DA 3O1LA 2OPRA 2PD1A 2R7WA 3J7YU 4K5RA 2V4RA 5KTQA 4WF9Q 3V6HA 1IVZA 3PYEA 4DOZA 1VRTB 3LGMA 1U24A 1W2BR 2OGUA 2U2FA 2CPIA 4I64A 2VU5A 2DEIA 4KT0C 1RWPB 4CRJA 1XMQF 4G1QA 2XNQA 3CMAS 2PT0A 1TELA 2IM3A 3R97A 1Z2LA 4M5DA 5LSOA 3SI8A 1M5PC 2XSFA 3WC2A 4P73A 2XEXA 3WX4A 2C2KB 3NP5A 1CC7A 2ZD1A 1JLGA 3OJUA 1E6VB 1IBCB 1NO8A 2EI5A 4DCJB 4ENOA 4IOAQ 3KLEB 2QMUB 3LPEA 3I31A 1FT8A 1N36F 3DFEA 3HI9A 3VGVA 5KAKA 2WOMB 1LK5A 1RAOA 5IT9U 1DJ0A 2FHJA 3TARA 1ZBTA 1D9AA 3O2IA 4K4UA 1NHUA 4A47A 2E7WA 1K1QA 2HQGA 1X0PA 3T6JA 1IUJA 3NOGA 3NXZA 1JLBB 4YFUA 2J5AA 2V8VA 2FB0A 5F3TA 1R0AA 1B0TA 2BE2A 4A8MP 2CPHA 4ZMMA 5EX3A 2CQ4A 1KVIA 1BHNA 2NXCA 3MUMP 3HD2A 3B4MA 2V63A 4LRFA 2AP6A 5HMWA 1VLYA 2V8DA 2ZOFA 3T1HF 2ZUAA 4CZCA 1BGXT 5F41A 2K3IA 1NAQA 2GVZB 4WKRA 3PG9A 1UZDA 3TW0A 3SFGA 4K5SA 2DTJA 2AF6A 4PUOB 3M2UB 3OD2A 5KFSA 2AYMA 4O23A 3R5BA 3NS7B 3UI3A 2IC3A 3R5GA 1YIJS 1N33F 1VQKS 3GYNA 5ADZA 1IQTA 2F8HA 4DQPA 3KK2B 2LXFA 4G3IA 3KK1A 3KLHB 4K50A 2XYGB 3BO2A 1RLCL 5IWAJ 2W7OA 2ZJPQ 2NZ4A 3LP2A 1IR0A 3UCGA 3OR2B 4EWTA 4GC7A 4DLGA 4HTJA 1X9MA 1FXLA 4FVCA 3QFWA 3GFHA 2KI2A 2DH7A 5F8GA 3ICLA 2YKOA 4YR3A 2DGUA 4MKVA 3V6DA 1FE0A 3BEGB 4KO0A 5LL6d 2V4QA 2J9DE 4CO1A 3T9ZA 5J1NA 1RWUA 1S59A 1WG4A 1MW7A 2DH8A 4YR0A 4O4GA 2G0JA 2ZOMA 4N77A 3CD0A 4QR2A 3D2WA 4ZK7M 3HZEA 3GFZA 4C8ZA 3FFIB 1HNIA 3P6YC 2GMHA 4OQJA 3MCMA 4R0JA 1HYSA 3MUVP 3H42A 2MMYA 4PKDB 2MZJA 4UOCA 2VFSA 1QVGR 1T3NA 3LAMA 3BPDA 4WFAQ 2MPUA 2W25A 2V2KA 2MJUA 1W7WA 2R2RA 1NM2A 2JWNA 2BR0A 5KG2A 3KLFA 1KBRA 2RE1A 4LSNA 1TK0A 3D3CJ 3M8PA 3S1TA 5HP1B 1BE4A 4X4VA 4QQBA 3BSOA 2WRMA 4CH7A 1IM4A 1N0UA 4FPRA 2G2YA 2EG2A 3ZZUA 5LSLA 1RAGB 1D8ZA 4OYBA 5AXKA 2BKOA 3CDAA 1JLQA 2EFGA 2R7TA 3M6UA 4MTPA 3DC2A 3JYTB 4WXWA 3CCSS 4U6PA 2D9OA 3DRRB 1WUUA 3BS9A 3ZXWA 2BZ2A 4UQTA 1LWXA 2ZH8A 4F4ZA 2NXJA 1HWLA 4YS2A 1DURA 4KIAA 2CNLB 2OJ3A 2A18A 3J7Z5 2K06A 5IWAF 4NE9C 1S79A 2RD5C 3D6HB 4U95A 4O3NA 3I4PA 1HD1A 2V4JB 2UVWA 2HBQB 5ETNA 4DPYA 1URNA 1DLOA 5KFJA 3TEHB 2MKYA 5H9FJ 2YWKA 3OPKA 2N82B 1VIXA 1FRJA 3QLHB 3MAQA 3R8YA 3B8HA 4L72B 1HNZJ 4ALZA 3EICA 4M95A 4LF4J 4ILRA 4OZ5A 3N5BA 3GR1A 3ZO7A 3FRZA 1HWKA 2WB4A 3IRXB 3UPFA 2PSZA 3IR6B 4OX9J 1ZA1B 3TAMB 3U1MA 3NEKA 4ZLLA 5D0EA 1GTEA 4ED6A 1QJHA 4O0NA 5KFYA 3PFEA 1PO6A 4KFBB 2WB1D 2NXUA 4EFAC 4XTTA 1TKZA 1F9EB 3NAIA 4RW9A 4GMKA 3BN7A 2B5JB 2IA0A 3TJAA 3DGPA 1F3VA 1LW2B 2KXHA 3QT8A 1GT8A 1EKRA 4PG7A 2D74B 1TUVA 2FIUA 3GSIA 1X4CA 3V5RA 5KFFA 5L1KA 4RU9A 4FZVA 1YHQS 4UQGA 1T05A 4OIXA 4TU8A 4K4YA 1KTQA 2D3OR 3TAQA 4P2MA 4IFYA 3UDCA 4YQWA 4NZ0A 4DV1J 4DFJA 1U6ZA 2L9NA 1IXKA 3LANA 3TVYA 4U7CA 4FF3A 2OMOA 2J9DA 4JOUA 4WE1B 3OR1B 1T7PA 2K3KA 2DXEA 2GMLA 2ZWPA 2XMKA 3MPUB 4DCOB 3JAMU 2W01A 5CYMB 4DLEA 1IWGA 3M2RA 2VQEJ 4IOBA 5FD1A 1BWEA 2HGLA 1T9YA 2FTRA 5E3RA 3ZNJ1 1H7WA 1DAXA 3EZUA 3W2VB 4LSLB 1S10A 5JVHQ 2IRXA 3KNGA 1CJVB 3HJVA 1KD1T 1YZ6A 4CYUA 2ZH4A 2XY5A 2E9TA 1NRKA 5D6GA 5L1JA 2YPYA 2J6UA 3ENWA 1SQFA 3JQJA 4IRCA 3CD7A 5GADI 4BS2A 1BY9A 3KJVB 4CLWA 1HNZF 2OAUA 4LF4F 2B4PA 3B54A 5J2MB 2MHEA 4YB6A 1Q8IA 1P9YA 1X0FA 4OX9F 1VRUB 4M5KA 4WWSA 3AXMA 3D5MA 1TQLA 2QLJB 1G1XA 1D9DA 3JQKA 3W66A 2ASDA 2VPYB 2MKIA 4C98A 3V4IB 3ISND 1U1MA 2F1FA 1Q86T 3CSKA 2ZH3A 5KFEA 1LOUA 5D78A 4DL3A 2Z0GA 2HFNA 4DL5A 2V9WA 2E1PA 1NH8A 2V34A 1AROP 3M9NB 1O8BA 2MZSA 4DL7A 4B9SA 4GO5X 2MY7A 3OXFA 2GHWA 4FYYB 4I2PB 4ANDA 2F4VJ 1X4AA 4BDPA 3MHYA 5KFUA 4RLEA 1TMJA 1T0TV 3T19A 2AGPA 5C24A 2HEKA 1C1BA 1XWLA 2JZ5A 1T11A 2KO1A 4H4OB 3LWLA 4DV1F 1F5CA 1EX8A 5F9LA 2HHUA 1P8GA 2OI2A 1Y7PA 1X5OA 2B9YA 2L41A 2VV5A 2PMZD 3D68A 5AXLA 3RR8A 2B9XA 1RHKB 3MR6A 3IBCB 1FX2A 3AOCA 3KHGA 1XTZA 3FMWA 3P8BB 2VQEF 5KFKA 3MM9A 4J9OA 1VK3A 4ELUA 3M8QB 5F8NA 1WHYA 2D3O1 3CMES 4Y2IA 2UVUA 1CC8A 4QZVB 3IR7B 2XMTA 1RT6A 4DX6A 3MOJB 2ZH5A 3S8SA 2FVQA 4CLYA 2KFYA 1IBLJ 3W7BA 2G0IA 4IUFA 4OZNA 2MQPA 4A8YA 4QPXA 1RWMB 4RW8B 4JI3J 1RE1B 1IKXB 3C46A 4OI4A 2PO4A 2ZBIA 2GC8A 4HR2A 4P2XA 1YWXA 2BRLA 4AL5A 1YK9A 2Q6BA 2XMVA 2KYXA 2KHCA 1YJUA 4NCAA 1VBZA 3C16A 2AYBA 2ILYA 2GQ2A 3NL0A 1S0VA 1ULRA 3OLAA 3NKYA 2QA4S 4TLRA 2YKQA 5LT5A 4DR2J 4OZ0A 5HBMB 4WYLA 8AT1B 3VV2B 2M52A 1HKAA 1HBMB 4ECXA 3DRSB 2FDNA 2V2QA 5IT9Y 2ROPA 4PYAA 3BGUA 1RAFB 1WELA 4QR0A 2W4CA 2BEFA 1LV5A 4BLGA 4WFNQ 5A6WA 3FBBA 3W65A 1M5HA 2FZKB 1WG5A 2EC0A 4MMOA 5DS7A 2J8SA 3UE2A 3T3FA 3K5NA 5CA5A 2GGPA 1Y5LB 2E1AA 2F4VF 3RAQA 4HH0A 2FD2A 3OVBA 1NH7A 1FRXA 4ZCKA 2AJ0A 4R8UA 2GHVC 3I6PA 2ZHOA 3TZZA 1R8HA 2N4CA 1S0OA 4HI2A 3QAUA 1KVKA 1TKTB 2DNYA 4JI6J 1TL7B 3EE3A 3QT6A 4E2FB 3H2LA 5AE2A 1KONA 3TUZC 5GMEA 2XWXA 3KXDA 4TN2A 4ETZA 2RRAA 1R8PA 4IYQA 4OJ3A 2ASJA 2G13A 4KV8A 4K7QA 4DSLA 4HT7A 4CT9A 3VQSA 5J2NA 1KP6A 2VFVA 2MTLA 4P6QA 2EW9A 2IIHA 2FJXA 4JV1A 2IA6A 4G6VB 1HPZA 2DCLA 4R5PB 3MR2A 5LJ5Y 3AB4B 1JIHA 4OZJA 2QA1A 4ZP6A 5L8RC 3L7OA 3DU6A 1S1XB 1TV6A 2BW7A 4A48A 2UVRA 1IBLF 1ZETA 2Z57B 2BJ7A 2P9GA 1RB0A 3G8SA 4IH6A 1UA0A 4P52A 4JI3F 3BF4A 3OT9A 1VQLS 3KLIB 4NLPA 4LF6J 1P1LA 3N6NA 2C1EB 3KMQA 2VG5B 3EGZA 4KGMA 5BXIA 3Q83A 5IFMA 2J7WA 3HVRA 5K20B 1VJWA 3BGFA 5HMZA 5SZTA 3I87A 2DO4A 2HW3A 3KUHA 1N5YA 2K1RA 3RR7A 2YNIA 4UY8T 2BMBA 1UVIA 5HANA 3BGRB 5D4NA 4ZLJA 3BQ1A 1RP5A 3R1HA 1ZYQA 3LP0A 1S6QA 3C15B 2DPIA 3NGTA 2HK3A 5CYJA 3B4DA 2WVEA 2H65B 3DRPA 2H3EB 2RIJA 4CWBA 4C8KA 2GIFA 1NB7A 1UJ4A 4P72A 1KLMB 2Y3YA 3G87A 2HFOA 2QTWA 2BYCA 1VC0A 3Q8YA 4J9NA 3VAIA 2E1MC 4EO6A 1ZM2A 3PIPQ 4KYZA 2NYIA 3KLGA 1YJ9S 5KFAA 4JI6F 3IN5A 2YH1A 1FEHA 3KOAA 2VODA 4GVBB 3VAKA 1SC1B 3DLGB 2LDIA 1QDUB 4YMEA 3MI7X 1R3NA 1S57A 1VHIA 2WONA 5BYQA 4E8UA 3MZIA 3NAHA 3M8YA 2XZWA 5A0YB 3A8JA 3GMGA 3EUNA 4C11A 2R7OA 1NSKL 2HS0A 4AL7A 5F8JA 2YQ3A 1S9GB 3NGUA 4DR5J 1K0TA 2QA4G 2QV6A 4ID5A 4IR1A 3OTBA 2BACA 4ZPWR 3TZXA 4RW7B 3N01A 4UTGA 4CNYA 1RU2A 2W2NP 4KHMA 3O8WA 3X3UA 5B08A 2RHQB 4K2XA 1VQ8S 1GMUA 4M5GA 4RW6B 5KG3A 4DU7A 1MSWD 4KGKA 3P5BP 5EN1A 2GA7A 1UVJA 4LF6F 4LIRA 4DWIA 3WDOA 2POKA 1U0SA 4ES1A 4NYPA 4DPOA 1RABB 3TWZA 1B64A 4LR8A 3FQKA 1XN9A 1SKUB 1U48A 3UQSA 4RL1A 4B08A 4X65J 1RISA 2KKHA 4WFYA 3GP9A 2CQ1A 2C42A 3K59A 4RNMA 3N5FA 2N4DA 2AHOB 5M2PA 4X4SA 1NK0A 3MM7A 5MAOA 2LP4A 2CJKA 5I4MA 3OTDA 2C2MB 3ULHA 3J80U 5J2PB 1KFDA 1JLAA 3V2UC 1NK7A 1X9SA 4IDKA 1VQSA 4M5HA 4O3OA 4PQAA 1Z1ZA 4TYBA 2GQQA 4NZ6A 1RDRA 4KRWA 2VD3A 3QQCD 1DARA 2KZMA 3WIVA 4QWDA 5ETQA 3VF0B 3HFKA 1W26A 3N4WA 2HNZB 2BJ9A 3OL6A 2A6OA 2HHQA 1FFSB 2YX4A 1C1CB 2I38A 1NMEB 3IMQJ 2CJ9A 3AH6A 3DM2B 2ZBCA 3IAM9 3I0SB 4NLTA 3BQ0A 5KT7A 1VJQA 3EWGA 1KOHA 2M8HA 1FDNA 1W2IA 1S99A 5CHCB 2ZM6J 3UWTA 3VWSA 4KJIA 4IG0A 1MROA 3LP1A 2LQBA 2E5JA 3CJQA 3HXMA 1S77D 4I7FB 4K4ZA 4QCLA 2W7AA 4I6AA 1Q5YA 1I3OB 4IKAA 4ZIWA 1S9EA 3HFZB 2YVSA 2IJFA 2YWHA 3M30A 2CJQA 3SSRA 4DR5F 1X4FA 3TUJC 3Q0AA 2X51A 3JAMY 3CJ4A 3UNGC 1FESA 1FRKA 2RU9A 1FO1A 2JFKA 2WSCC 5HK4A 1ICEB 4N7TA 2MXYA 1I94J 1FVQA 5F8LA 2HKEA 2E7XA 1SJRA 1XR5A 3D4JA 1VQMS 1RT7A 4K4XA 3HCXA 1CVJA 1AT1B 5ETVA 2ZH2A 1UA1A 1R27B 1FHTA 1NJXA 5KOXA 3SDEA 1SC3B 3MOZA 2EFNA 1YJTA 1S1WA 1IKVA 2RQ4A 1YX2A 2CQGA 1T3OA 3P4UB 1G6BA 2R8GA 2I8EA 2J6SA 2GNKA 4K4SA 3PTWA 4FF2A 1C4AA 1TK5A 4FKYA 2HWTA 1MU2B 2XLJA 1HBOA 4OX6A 4J9VA 4X65F 4PAAA 1Y3KA 1SV5B 2AEFA 1YGYA 1KKHA 3FKBA 2IY5B 4XPCA 1MG7A 2MQOA 5T41A 1XQIA 3FJ2A 7FD1A 1SH0A 1T03B 2N7YA 4L6V3 1DQAA 3LGHA 3ZFVA 1LK7A 3AJDA 5D77A 5KFPA 1DRZA 1YJ7A 2XS7A 2LQJA 1LWCA 3RW7A 4OYIA 1WTBA 4LQ3A 2BE9B 2L9WA 3DLEA 4IOCQ 1J27A 1RACB 3I9V9 5DGAA 5E3AA 1TL4A 3UN3A 3J81U 3TR5A 1NK9A 5F3ZA 2DNNA 2J0QD 2R7RA 4MFBA 2XSJA 2MKCA 4I68A 9ATCB 5ETKA 3GG1A 2YNHB 2ZM6F 5CYQA 1RT5B 2DNPA 3ETMA 2H9ZA 3DYAA 1PJ5A 4DR4J 2NZCA 4NWBA 3U27A 3QJPA 4ZVEA 2DGXA 5B0EA 4O44B 5A8KA 1RTHB 1DTTB 2I9SA 2XMMA 3AB2B 3RG6A 2HNDA 4ZS6A 1S1UA 3ITHB 2D1CA 2DITA 2F8EX 3W2WB 4P7VA 2VH7A 3IG1B 5E3CA 1I94F 3OJSA 1FKOB 4OJ1A 4RKUC 4O0IA 3BKUA 2DNZA 4Z7YA 3C6TA 1RTIA 2FQQB 3GYXB 3R9LA 2MKSA 2FVRA 4B3RJ 1YBUA 1IQZA 4GC6A 4RUCA 5LXYA 4QIWD 5LOQA 4WZQA 5KFCA 1JB0C 1XMOF 1WJ9A 3HULA 3IM8A 3ILLA 5GAGU 4DSEA 3M32A 2NSCA 2HZCA 1WF1A 2ROGA 3JB9k 3ZNUA 2J8AA 1HD0A 3W61A 2VIHA 4ECRA 2CADA 5HAOA 5EHHA 4LMZA 5LM7E 3EPIA 1Z4UA 4CTAA 3CT9A 1FK9A 4KB7A 4L3KA 2ZE2B 1SC4B 3K57A 1FRMA 1RZMA 3L3CA 2CFXA 3Q8UA 1GXTA 1KVJA 2R7VA 2ZBRA 1CS4A 2XO6A 3FQLA 1HQEA 3SCIE 4FVMA 3BN4A 3CJ8A 3W60A 2ZC3A 2W2MP 1L3TA 4NEZA 3O5TB 1LQ9A 2PMWA 5B0FA 1RQ0A 1FD2A 1SXLA 3T5KA 4KGVB 4BBYA 3RBZA 2KZZA 2JVOA 1EP4B 4EBDA 4NEYA 2HRTA 2N7CA 4ZHRA 4F26A 3MMBA 3I0RA 1SJFA 2HBRB 7FDRA 2K8GA 1TUWA 4ZVGA 3FEZA 2RNEA 4C0OC 3JS9A 4DR4F 4ICLB 1HBUA 2A2DA 4J9UE 3K58A 3OBIA 4QYZJ 1KEKA 1C2PA 3UFCX 1U6FA 2CWKA 1X31C 1FI4A 1B70B 1XNQJ 1N52B 5KG6A 5FDLA 1S0NA 4P74A 3MR7A 4LVNP 4X4RA 2HZAA 2QIFA 2NXEA 2QLXA 4UUXA 1G2EA 4JV2A 1LW0B 4ED3A 4P9SA 4R25A 4LF9F 4F25A 1AW0A 1V3RA 5CD4A 2CDQA 4YN3B 1FWKA 3LALA 2HQCA 2DRDA 2PE8A 3DLKA 4B3RF 2XMUA 4MIWA 5L38A 4NX9A 2HNYA 2OD6A 3QATA 2M7SA 1FKPA 4RBTA 5KG4A 2OLWA 3RUBL 1HWJA 1IKYA 4W4MA 3J7YI 1RHUB 5I3QA 6AT1B 1Q8KA 4DSFA 3P5TL 4ZN3A 3SMZA 3BO4A 3U1LA 4G1PA 2OPRB 4USKA 4OZ1A 2QL7B 4OYPA 2VBXA 2AIRB 3QWPA 3EYZA 1YG0A 4YB5A 1UEVA 4C8MA 3HX9A 2MY8A 4QOTA 4I4BA 2B9EA 2XWYA 3GIKA 4NYOA 2E66A 1JWWA 3VVUA 1ITPA 4G1QB 2HBYB 2ZH9A 1QY7A 4ELTA 1RT4A 1MWYA 3KG0A 4U7UD 3UD5A 2HHWA 3HPOA 1JLGB 2F7VA 3CEDA 3D9BA 4QIVA 2QA2A 4ITSA 1FERA 2RUGA 5T14A 1SIZA 4N47A 4D3HA 2AYEA 2C2ZB 2I2YA 5B0GA 3KLVA 2X3DA 2XQCA 1XNQF 2NUUG 2L08A 2WOMA 5F0WA 5KFOA 2MZRA 1OPZA 1FF2A 3SBMA 2GJFA 2RH3A 3NS6A 4DSIA 4YEAA 5AJ3J 5GMKa 1Y00A 1Q81T 4AD6A 3MXHP 3GQCA 1K8AT 1WEXA 2XB2D 1WF0A 2RRNA 4DBQA 1H73A 1HWIA 3RZAA 3W62A 3NNHA 3PYFA 3GIIA 3OTCA 1NU4A 2FUG9 1RCXB 2G2OA 1QSSA 2W4PA 4JI1J 2DNQA 1K0VA 3OTEA 3W5XA 2DNMA 3CJ3A 1Y9OA 3JSYA 2EFOA 3OUYA 1WHWA 2ACYA 1PG5B 2QFIA 3PW4A 1S1VA 3MTKA 2CQIA 2IC3B 2GFFA 3D6FB 5CCLA 3CCRS 5D4OA 3CB4A 3KK1B 2DGSA 3QMQA 2KDOA 1T95A 3GJQB 1I6JA 4C7QA 3CULA 1WHXA 3PDNA 5EWEA 4O3RA 4V19J 3KK2A 3HMJG 3KLHA 2VKZG 1REGX 3DHWC 3CC7S 1SJ3P 2MLYA 4D3GA 4P7TA 2HHTA 1VOMA 5M2UA 2O01C 1U8SA 3J80Y 5J1PA 2LEPA 4LIWA 3FMBA 3CJTA 4OZLA 1NPRA 2VDIA 4KO0B 3ZZZA 3BB5A 2X1BA 1B3TA 1PYSB 1WC6A 4KC5A 1WOPA 2YNFB 4FYVB 3T6BA 1NK8A 1CJKB 4O4GB 5KFLA 1CQNA 2RKIB 4B9NA 1Y0HA 2B4OA 2HFVA 3AJ2A 4F0MA 5KT3A 3CPWR 1HNIB 3ZZRA 5THWA 1HYSB 3HDSA 3GPAA 2C3OA 1BLUA 4PR6A 3NMAA 2HFZA 3KLFB 1UFWA 1TKDA 4WPAA 4AL6A 4LSNB 3HVTA 3M8PB 5I3PA 1XNRJ 4RUBA 2AX1A 1HNXJ 1PC4A 4LRDA 2OH2A 2UXCJ 5HL7Q 5E5NA 4ZCMA 4ELVA 5E3QA 5HP1A 3HHLA 3TQ1A 4C2MA 1M5VC 1TMMA 2Z58B 3FK4A 1JLQB 1PYOB 2GQCA 1YLXA 2DGQA 4L3NA 4USHA 1LFPA 4A8OA 4JI1F 4ECZA 3IGNA 3RBDA 1SKWA 2ZNZA 3AODA 1WEZA 4F50A 4S0MA 3DN9A 3JYTA 4H4KC 2DKOB 4CCHA 2BDPA 1SQGA 2J9EA 4KAIA 1D3WA 2Q3PA 2OPSA 1S5ZA 3KMSA 3BKFA 3D0IE 1Q82T 1U7LA 3DNCA 4TYAA 1NHVA 2MKHA 1NDLA 3QGHA 3S01A 2A1BA 3KG4A 1O5JA 4ZPCA 3QGPA 2LQ5A 1WC3A 4WP8A 4F2RA 1MMNA 1NLKL 2HRYA 2HIYA 3MR3A 1DLOB 4DQRA 1N6QA 3PKYA 1IR2A 4Q43A 3R27A 5HVFA 2E1RA 1RYSA 1V6HA 2J9CA 2P5VA 3R5JB 3PX4A 2H4YB 4I0WA 5GAHI 4I1TA 3DOKA 4DL0C 5K8OA 1ZH5A 3J81Y 4DDFA 1FCAA 2YKNA 4YB7A 2ZITA 2CNOB 3PRBA 1LWFA 1VBXA 3W63A 4DQSA 2HQ3A 2HVIA 3T5JA 2KT2A 4QU6A 5H9FK 1WDTA 2BQRA 2DR8A 4LR9A 3M1VA 1NJWA 4KTQA 3W5YA 3CO0P 2XS2A 2NREA 1OQ6A 1XIQA 4DS4A 3N6MA 2IVFB 4DZDA 2XLKA 2ZFHA 4F67A 1HNXF 4KFBA 4RW9B 2UXCF 2JC0A 1F9HA 2IM1A 1HA1A 2BABA 2XM3A 2ZDOA 3VGTA 3EXCX 2QRRA 2B7BB 4JI7J 4HACB 1HFEL 3KHRA 3KHHA 3MMCB 1Q78A 5LSRA 4F4KA 2IBKA 5F0UA 4YY3J 4ZVRB 3EDRB 1T05B 1AZSA 4X62J 1HR0F 2AV5A 3CJ2A 5HQMA 3AOBA 4QIEA 3P3DA 1F60B 4N8NA 1FJEB 3R7NB 4IFYB 4PABA 5ETTA 2CPYA 1IJFB 1L5UA 2NLWA 3LOUA 2Z2YB 1XBWA 1P6TA 1RWXB 2UXDJ 3BZQA 2VICA 4ZCLA 2VA3A 4FDFA 2C2DA 2FVPA 4USUA 5HQLA 2QLFB 4WE1A 2F9JA 3OR1A 2U1AA 3M2RB 3UDEA 1CSJA 4ZPVR 3NOCA 1NDKA 5CYMA 3C66A 3MECB 2FZCB 3BYPA 3CCMS 4X4TA 1NPPA 4NA2A 1Q95G 4MAKA 5ETMA 4LSLA 1F9FA 5HJYA 1U1KA 3PYDA 2HSEB 1CJVA 3RW6A 3RBXA 3DLHA 3LQVA 1SI9A 1UZHA 2VL1A 1QUVA 3HP6A 4K0KJ 1SPBP 1U0HB 2JNJA 3DMJB 2LFVA 4PXEA 3SIPB 2ZUGA 3OFEA 4JI2F 3T41A 1N88A 2VBYA 4NOHA 1RAHB 5J2MA 3JSMA 2OSQA 1MMLA 4PXBA 3Q2SC 2OPQA 3VAGA 1NJIT 2HVEA 5GADU 1TK8A 4O4RA 1VRUA 4I67A 1NB2A 4DFMA 1RHRB 2Q43A 5KG7A 4ED1A 4M8LA 2FJDB 3G6YA 4H54A 5KFGA 1LWEA 1TU0B 3P96A 3SXLA 2HK2A 2XI2A 3QSYB 3ZTRA 2EWHA 5HROA 3V4IA 2ADBA 1HBNA 3IWNC 3POTB 4PXCA 4ED2A 1JNRB 3RB0A 2ATLA 1HWUA 4XIUA 2UUBJ 2OO4A 2VPXB 3V6KA 2ERRA 4JI5J 2DK2A 4YY3F 4GO7X 1YQHA 3VHQA 3G82A 4J9KA 4X62F 1FNMA 1H7XA 2MJNA 1AFIA 1C1BB 3BBFA 2AJQA 4JUZA 2MSSA 5D4PA 5JXSA 3GFXA 2OFGX 4Q8FA 1K1SA 2XMJA 2M9KA 2HHPA 3CCLS 3E8OA 3NS5A 1UVMA 2XHWA 2UXDF 4OL8A 1A6LA 3DLJA 3VGUA 2KG1A 3FBEA 3DU5A 5KFQA 4Y65A 2OFHX 4X4OA 1RT3A 1OY9A 3MM9B 1HNVB 1S1TB 3JQMA 3NGRA 3PEHA 3GILA 2H5IB 2CPJA 4OZ3A 1RT6B 1ZAXA 1MN9A 2CPXA 2OEMA 2XYHB 3ZC4A 4XDCA 3OFHA 3EGWB 3OL7A 4K0KF 4JI0J 1FRHA 1S49A 3A12A 4DN0A 1SB6A 3RB4A 2GO9A 4LRCA 1EHWA 4PRFA 4LT6A 1NK6A 4WXOA 2BUNA 3EPGA 3W64A 5KFIA 1Y5NB 2O1PA 1W25A 3SCJE 3MM5A 3PYGA 1IKXA 5K5MA 4ED7A 3AD7C 2VFTA 3H5YA 2AT1B 3C16B 1GH8A 2XC9A 4JV0A 1ZAVA 3GB0A 2JLGA 4PWWA 4ES2A 1UJ6A 1S7IA 2KYZA 4DPUA 2X1AA 2AEMA 5KFWA 2WSEC 2DYAA 3PJ9A 3ISZA 5EWFA 5SUHA 1X5PA 3JXOA 2FJWA 2HWHA 2KRRA 4CM2A 1HBMA 5JVGQ 1U26A 4FBUA 4HI1A 4C8LA 3BBBA 3ILJA 3I56S 1WSVA 1PSDA 2UUBF 1H2TZ 2GGPB 2J6TA 4WCEQ 4JI5F 4ZVPB 4RNFA 5IXUA 3KG1A 3UCUP 2DGOA 5I42A 3R6GB 3B82A 2YWWA 4R8UB 1G3OA 2DHGA 1NSAA 4ID8A 3VZIA 2OELA 3Q8RB 1VCTA 2AMCB 5AT1B 2FHJD 2QZ8A 3FNNA 4WU3A 1FKAF 4DV7F 2HFSA 1PJ6A 4KV8B 1JLEB 3LH2S 3UN2A 1FDDA 1I5OB 5J2NB 1IKWA 3HF5A 4ED4A 1RI7A 2IFXA 2R3VA 4RUAA 3Q86A 4KQZA 1ZZNA 2B3TB 1EAYC 3GCWP 1FXRA 4B9LA 2HPUA 3RRHA 1VQ5S 4MT1A 4C9DA 1DQ9A 2YQ1A 2V0NA 4J5OA 2ZZTA 4MK9A 4R5PA 3C6UA 3CDWA 1TV6B 2OIHA 3JSRA 1KHWA 2CRLA 3M8RA 1YRTA 1N0VC 2VQFJ 2H48B 3AQOA 3D66A 2Y9HA 4JI0F 5IQ6A 2AJ1A 1RTDA 4A8FA 1JMTA 2LCWA 1GFWB 4DMZA 3NCQA 3CIMA 4RW4B 4PG5A 2IAJB 3O3LA 3G6XA 1OS5A 1VQNS 5KFXA 2QC3A 2YKAA 2EKNA 4LRAA 4ZPDA 1H3DA 2QL5B 1Q8LA 2CQPA 1YJRA 3D1OA 2KTQA 1Q7LB 3OXGA 4LUBA 1SJ1A 2NCKL 1F2HA 5BYRA 3OL9A 2Z4PA 2M8DB 3DXSX 1YI2S 4HDHA 5D3GB 1N5YB 2YNIB 2MDAA 4YHHJ 2PN6A 3NCPA 4F36A 3CD5A 5JMNA 4CI0B 3D3BJ 1HW9A 7AT1B 3LP0B 3PFOA 2CIMA 3W9HA 1URRA 3LUYA 4OI0A 4FF4A 3DRPB 4ZJOA 3BR8A 1TFWA 4JBCA 3X1LB 2YWGA 3UW1A 4LF1A 2GZOA 1QE1B 2DR9A 4Q5VA 5DDQC 4C4WA 4PPDA 4ZPBA 2DJWA 2KU7A 1KTVA 3PJXA 2DXFA 4LF5J 2HAFA 5HSPA 4CLZA 4LQ9A 5LXRA 3DDKA 1GXLA 4FNHA 3AQPA 3LTOA 3QBCA 4GVBA 2KT3A 1I51B 4B3TJ 3CDEA 5JJBA 5IV4A 4UW2A 3Q22A 3P45B 1M1KT 3FDSA 3FEYB 1UW4A 3QAEA 4ID5B 5A0YA 2LU2A 4M5LA 3G86A 3ET6A 1AUSL 3HO1A 3O44A 2MKJA 2W2PP 1VFJA 3MURP 4J9PA 4MJKA 1FRIA 2DVIA 4F4WA 3KFWX 2B4UA 3HHKA 2VQFF 2V69A 1S72S 2F3JA 4QW9A 4WTYA 3IGVA 4RNOA 4FS2A 2R8JA 1FWLA 3SFUA 2BOAA 5AE1A 2XG8A 1X9WA 1TL1A 5ETPA 4LBHA 5DDRC 2F8MA 2PFFB 4RO0A 3DKDA 5J2QB 2BE7D 2IHR1 3M6VA 1RA6A 1EQ0A 3SQOP 2LKZA 3M7VA 1RBAA 3M2VA 1UW9A 1XC9A 3UO0A 1RTJB 5KOWA 5E41A 2EBGA 4FS1A 3HT3A 1J5OA 2N3OA 4LFBJ 4YHHF 2GCFA 2V50A 4LJMA 1RBOB 5A8WA 1VS3A 2IBOA 3MM7B 4AXJA 3DLBA 2M2BA 1JLAB 3LGNA 3J7ZT 3KJFB 4IDKB 4X64J 3SQGA 2PI5A 1VGYA 1REVA 3MM8A 4NYZA 3GIJA 4J7CA 3TJ8A 3CJSA 3NGKA 4WP3A 1PBUA 3SEOA 2VBZA 3HVAA 2YX7A 3IBWA 2VONA 2QYGA 2CG8A 4LF5F 3PJWA 1BC6A 3A8IA 4C3MA 1U02A 1BMQB 1N5QA 2I0XA 1MROB 5KT5A 1ZTWA 3K8WA 3I0SA 3LP1B 4ATNA 3SCLE 1WTFA 1CPZA 1K73T 3VALA 2KN4A 4ED0A 1MLAA 4ETXA 2F63A 1OIAA 2OTJS 4B3TF 2DISA 2AGQA 4I7FA 3M30B 3F44A 2UU9J 2MQLA 1N8RT 3NNCA 5IC6B 2WBMA 3TQEA 2IYGA 2Y8YA 2FGOA 2PA3A 3HK2A 3PW0A 4C0BA 2WW4A 3TANA 3BKTA 2I5JB 3PX0A 4UZBA 3MM6B 2YH0A 3F73A 1RT7B 2CPEA 1NSQA 3CIZA 1S6PB 2R42A 3US5A 1YRUA 2DNRA 2WTFA 2VFRA 2R8IA 2B7CB 2IM0A 3PNIA 2M88A 4NCGA 3SDEB 1RT2A 1S1WB 2E29A 2QT7A 3BM7A 5C5JA 3R3TA 1RA7A 2VKRA 3CF5Q 1RLDA 3LPYA 2PMHA 3T5HA 3H59A 5E7OB 4ECVA 4P75A 1HBOB 1RAJA 2OMLA 3FBCA 2AJ4A 1JLCA 4NLOA 1N5SA 4ANCA 1VIOA 3NBPA 4NA3A 2XHCA 1MU2A 4LFBF 1SUQB 1NZ8A 2CVEA 3K0JA 2AGOA 1X4GA 1GX5A 4OYZA 1PAEX 3I96A 2RQKA 3UR0A 4UOHA 2YKMA 2UUWA 2DCUB 2KFNA 1Q53A 1QAXA 1U1LA 3CTRA 4EZ6A 4X64F 3QT7A 2Y1JA 3JTPA 2OSRA 1T03A 2W9BA
chains in the Genus database with same CATH topology
1BD6A 1R6YA 1TL1B 3UFCX 1U6FA 3T1HF 4RBUA 3IC1A 2MB0B 4CZCA 1BGXT 4ZVFA 5F41A 4QWCA 2FHOB 4AFFA 2LYVA 5DM6Q 3RTVA 2K3IA 1TP7A 1NAQA 3JTNA 1U1QA 4WKRA 2A10A 1N52B 4DUYF 3PXGa 5KG6A 3TW0A 3SFGA 2HVZA 1B0VA 5FDLA 1KRPA 2ZHBA 4K5SA 3DLEB 1S0NA 2EFQA 2DTJA 2V5HG 2XGPA 4OI3A 2P6TA 2AF6A 4PUOB 1EETA 2GV1A 3M2VB 3M2UB 2V4JA 5DG9A 4LVNP 4X4RA 4DSJA 3Q2TC 2QIFA 2QLXA 4QYRA 5J2QA 4CH1A 4UUXA 1H0HB 1G2EA 4MFBB 1J5OB 4JV2A 1LW0B 1XERA 4ED3A 4R25A 3IWLA 3SV4A 4ECQA 4LF9F 4PG4A 5KFSA 5A8WB 2AYMA 4O23A 3TA1A 2QMWA 3R5BA 3M9OB 4F25A 1LKZA 3UD3P 2GO8A 1AW0A 1RTJA 1SH2A 1SJQA 3QLHA 5CYQB 1V3RA 3UI3A 1Y3JA 2IC3A 2CDQA 1YIJS 4Y34A 1N33F 1VQKS 3LALA 3GYNA 3H40A 2N3LA 5ADZA 1IQTA 4OI2A 3DYAB 2ILZA 3HHDA 2E1CA 1UWBA 2OP5A 5B0BA 2PE8A 3E51A 3DLKA 2F8HA 4DQPA 4B3RF 2R2UA 3KK2B 3H5SA 2LXFA 4G3IA 1F0XA 2XMUA 5IT4A 3KK1A 3KLHB 4K50A 5A8KB 3SQGB 3BO2A 4MIWA 5L38A 1VHFA 2W7OA 2F9DA 1REVB 4NX9A 2HNYA 3IRXA 2YKPA 3MM8B 2VFUA 2ZJPQ 2OD6A 3DOLB 1SBRA 2LA4A 1ZM3A 2VC1A 2NZ4A 3LP2A 1IR0A 3TAMA 3UCGA 5BJRA 1KNZA 2M7SA 2Z2LA 3OR2B 1FKPA 3MMAA 4C97A 4EWTA 4GC7A 4DLGA 1UKUA 3GG0A 4HTJA 1VBYA 2HNDB 3IWXA 1X9MA 2UU9F 1FXLA 2MYFA 5IT0A 5AXNA 4FVCA 3GFHA 2UV8A 4J9LA 3GFYA 2KI2A 2ZVSA 1TKZB 1IJEB 4RBTA 2DD8S 2DH7A 5FIIA 4PWUA 2J7UA 2AWZA 1SJ4P 5F8GA 3ICLA 2YKOA 3DI6A 5KG4A 1MWZA 4HH1A 4YR3A 4ZP7A 4IQXA 2DGUA 3MUTP 2OLWA 1HWJA 1FE0A 3BEGB 3V6DA 1IKYA 4KO0A 5LL6d 3J7YI 2V4QA 2J9DE 4DV2F 2NPIA 1N54B 3MWBA 4CO1A 5I3QA 3T9ZA 4RWWA 4PWDA 4DSFA 5J1NA 3P5TL 4MK7A 3B78A 4GKJF 2FLLA 2E5IA 1RWUA 3SMZA 2XNRA 3BO4A 2B5JA 3U1LA 1WG4A 4G1PA 3IG1A 2OPRB 4TU7A 1MW7A 2DH8A 2BOPA 1FKOA 3FZBA 4YR0A 4OZ1A 4O4GA 3GV7B 3A8EA 1RGVA 5KFZA 2EKYA 1FEEA 1LW2A 2VBXA 2ZOMA 3T5LA 5FJ4A 3QWPA 4N77A 3EYZA 3CD0A 4QR2A 4NLDA 1YG0A 3D2WA 3PX6A 4YB5A 4ZK7M 1M0SA 1UEVA 3HZEA 1WI8A 3GFZA 3TI0A 1IN0A 4C8ZA 1JXLA 2IRYA 1ZM4A 1X5SA 3FFIB 4C8MA 1HNIA 3P6YC 2GMHA 3HX9A 2MY8A 4OQJA 1FNXH 4R0JA 4QOTA 4I4BA 2KM8C 4DV0F 1KOOA 3MEEA 4WJBA 3MUVP 1HYSA 1N48A 4F3OA 2MMYA 2XWYA 2JEJA 3GIKA 4PKDB 2MZJA 4UOCA 2VFSA 1I1GA 4NYOA 1T3NA 1QVGR 1AFJA 5H9EJ 4MIAA 2W8LA 2L9DA 2E44A 2E66A 3MD1A 2L3MA 3LAMA 3F56A 1TL3A 2VOOA 1JWWA 4WFAQ 2MPUA 1TZ0A 1MMDA 2D7SA 2W25A 2V2KA 2MJUA 4G1QB 2ZH9A 1QY7A 2VZ9A 2R2RA 3QIPA 4M63A 2JWNA 2WW8A 2BR0A 5KG2A 3VR1A 3KLFA 1HI1A 2C3YA 2XI3A 2HHHF 4X4PA 4ELTA 1RT4A 1MWYA 3KG0A 4BC9A 2COLA 1TR0A 2RE1A 4LSNA 4E98A 1TK0A 4OHWA 3M8PA 3UD4P 3S1TA 1U1OA 5HP1B 1VQ9S 2ALZA 1U45A 1VI7A 4EBCA 2HHWA 1FK9B 3HPOA 2CQHA 1U4BA 4IRCA 4Q2LA 4QQBA 4X4VA 2AX0A 3BSOA 2FLNA 1C0UB 1JLGB 2F7VA 2WRMA 4CH7A 3CEDA 1IM4A 1N0UA 2HWIA 2I5JA 4QIVA 2QA2A 1RYRA 4ITSA 1FERA 1LXNA 4NCGB 1N32F 2RUGA 1RT2B 3RBEA 4F02A 5T14A 4DQIA 3MM6A 4FPRA 1SIZA 3K5OA 2EG2A 4N47A 1S6PA 4D3HA 2AYEA 3ZZUA 3MFIA 3HKWA 1ROFA 5LSLA 1D8ZA 1S4FA 2I2YA 5B0GA 3KLVA 1HQEB 5AXKA 2BV3A 4ECWA 1RJJA 4OV1A 3SSSA 1S97A 1OSCA 3CDAA 5LMUF 1JLQA 2EFGA 2R7TA 5IM0A 3M6UA 3W2VA 1XNQF 5T7LB 2KM8B 4MTPA 4HVZA 4USJC 4C8YA 2NUUG 2L08A 2WOMA 5DM7Q 3AAWB 3DC2A 5F0WA 5KFOA 3MEGA 2FGCA 2MZRA 2RT3A 1OPZA 3DRYA 3JYTB 3BREA 1L3SA 3OFFA 1FF2A 2A2CA 2V8HA 4Y2AA 2PA8D 4WXWA 3MTJA 4NLSA 4RBVA 1JLCB 1F5BA 2RH3A 5DQGA 2XS5A 3NS6A 4I69A 4DSIA 3Q8SB 3CCSS 4DL6A 5CH7B 3DDNA 4NRUA 2D9OA 3DRRB 3NBPB 4U6PA 2DIUA 3CCWA 4EU0A 2D3ZA 3BS9A 1SH3A 2CPFA 4YEAA 5DLFA 1U09A 3G9CA 3QYYA 2MZQA 5KT2A 3MMBB 5GMKa 3I0RB 1SQEA 2BZ2A 2BQ3A 1RK8A 4DR6F 1Y00A 1Q81T 5H1SV 4UQTA 5D8HB 3MXHP 3NNAA 2ZH8A 2IVMA 4F4ZA 3GQCA 1K8AT 1U6BA 6FD1A 1HWLA 1WEXA 2CQDA 2G9OA 2XB2D 1WF0A 1DURA 4DV3F 2YKMB 4KIAA 1V3SA 2RRNA 1KQSR 1SUQA 1P9QC 2J0WA 4DBQA 3KJVA 1S6OA 4CO2A 1HBUB 1SIWB 2OJ3A 4J9RA 1HWIA 3RZAA 3OVSA 1F2GA 2A18A 3J7Z5 1APSA 4A8SA 3NNHA 3SZ2A 1SKSA 5IWAF 2QMXA 2W9BB 3GIIA 1S79A 2W8KA 4XPEA 3OTCA 3OHBA 1NU4A 1HNWF 1VQYA 2FUG9 2JEGA 5B0AA 1QSSA 2RD5C 2J76E 2W4PA 4CH0S 4NCBA 5FDLB 3UCZP 1ELOA 4AE5A 1JK9B 4O3NA 3I4PA 2DNQA 1K0VA 1QLNA 1EETB 1HD1A 2Z8QA 1BQXA 2V4JB 2UVWA 1YI2S 1URNA 4F3QA 3OTEA 1DLOA 2KVIA 5KFJA 1TVRA 4C3KA 2DNMA 3VAHA 3CJ3A 5H9FJ 1Y9OA 3JSYA 2EFOA 4WU2A 2KB2A 2YWKA 1WACA 3OPKA 3OUYA 1WHWA 2VUGA 2ACYA 2HAIA 2DR7A 2N82B 1VIXA 1FRJA 3PW4A 5K8MA 3QLHB 2LEBA 1S1VA 3MTKA 5KFBA 2CQIA 2IC3B 2GFFA 3MAQA 4KHPF 2JEIA 2NUHA 5IS2A 4DS5A 5CCLA 3CCRS 3MEDB 5D4OA 2L48A 4OI1A 3B8HA 3JTOA 4L72B 4ALZA 4M95A 1UWBB 4ILRA 2DNLA 4OZ5A 4Q0BB 3N5BA 3CB4A 3GR1A 1S9FA 5BR8F 2O67A 3V4MA 2D9PA 3KK1B 2HHVA 2C3UA 2DGSA 3CDBA 3FRZA 2RU3A 3CC2S 1HWKA 3CVKA 3QMQA 4W90B 2WB4A 1PGZA 2KDOA 2HNYB 3IRXB 3HZGA 3MF5A 5KG1A 3UPFA 3PW7A 1UVKA 2PSZA 3IR6B 1N4LA 1IBKF 2DT9A 4F4XA 1T95A 1RKIA 2KT5A 4EYIB 3N9UC 3QO9A 4C7QA 1YITS 1I6JA 3AA9A 3CULA 1WHXA 3PDNA 3TAMB 3U1MA 5EWEA 2PC6A 3H2UB 4KE5A 5C24B 3KK2A 3HMJG 4V19J 1FKPB 3MMAB 4I2PA 2CZ4A 4ECTA 3CCTA 3MPYA 3KLHA 4EZ9A 2VKZG 3K5L