2KH9A

Solution structure of yeast prp24-rrm2 bound to a fragment of u6 rna
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
86
structure length
86
Chain Sequence
b'MTECTLWMTNFPPSYTQRNIRDLLQDINVVALSIRLPSLRFNTSRRFAYIDVTSKEDARYCVEKLNGLKIEGYTLVTKVSNPLELE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords U4/U6 snRNA-associated-splicing factor PRP24
publication title Structure and functional implications of a complex containing a segment of U6 RNA bound by a domain of Prp24.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Splicing/rna
total genus 15
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kh9A00
2LEBA 1JJ4A 2MQNA 5HL7Q 1IQTA 2RNEA 2BZ2A 1WF1A 3JB9k 1M90T 3OW2R 3Q2SC 5ITHA 2CJKA 2E5JA 3CC7S 1WG4A 3VAMA 2DB1A 2AYEA 3TO8A 1M5OC 2DNLA 5DETA 5GMKa 3CCRS 1SJ4P 1N54B 2XS7A 3P49B 3CCJS 5GAGU 2MZJA 1VBXA 4LJMA 1DRZA 2M8DB 1VBYA 3EX7B 2KYXA 1K73T 1KD1T 2J8AA 2CQHA 4CH0S 4RU2A 1FHTA 1U6BA 3G8SA 5IM0B 4Y00A 5GADU 2XSFA 2OSQA 2WBRA 5DDQC 3R1HA 1U2FA 3UCGA 2OIHA 3THTA 3TYTA 2XNRA 2E5IA 2CQDA 5CYJA 1VQ9S 5HO4A 2E5HA 2X1BA 1D9AA 2AD9A 2JVOA 5IQQA 5H1SV 1B7FA 1YJNS 3CCES 2KM8C 1F9FA 2LECA 1JMTA 1SJ3P 3R27A 2UP1A 2DNZA 2LEAA 2X1AA 3VAFA 4IOAQ 1X4HA 5LJ3Y 2DNQA 3SXLA 1FJCA 2PE8A 2JRSA 1ZZFA 2AYBA 2KU7A 2LXUA 1U1KA 5LXRA 3VAJA 3UD4P 2DGWA 2LYVA 3S8SA 1WHXA 4WCEQ 2CPYA 2CPDA 2F3JA 3J7ZT 2XB2D 2HGMA 2ZJPQ 2CQCA 2EK6A 2J0QD 2YH1A 2DGSA 2JWNA 4C4WA 3BEGB 1U6FA 2LCWA 1HD1A 2D3OR 1L3KA 3H2UB 3HI9A 2QEXS 1WEYA 3G71S 2OTJS 3R1LA 1WI8A 2RS2A 4WFAQ 4QU7A 3NNHA 2KRRA 1H2UX 2VODA 3FEXB 3CCVS 2MZ1A 1X5TA 1K9MT 3SDEB 3BO3A 2YH0A 1VQKS 2I38A 2RT3A 2OSRA 1FJ7A 3MUVP 5DDOC 3CF5Q 2NZ4A 2CPIA 2CQGA 1VQMS 3US5A 4YB1P 3CCSS 3VAGA 1X4AA 3NMRA 1U1MA 1YHQS 1SJQA 2L08A 1KC8T 2MKCA 2X1GA 3S6EA 3U1MA 3J7YU 2N7CA 5CA5A 2G0CA 2HZCA 2M70A 1UFWA 1X0FA 1WF2A 1OO0B 1NU4A 2F9DA 2MPUA 2KHCA 2LA4A 2MHNA 5DDPC 1M1KT 2HGLA 3VAIA 2DNPA 2FHOB 3CD6S 1DHMA 2I2YA 3CULA 1R8PA 2D9OA 3P6YC 3MUTP 1DZ5A 3LQVA 1PGZA 1H2VZ 2RUGA 4F25A 3I56S 1YTYA 2DK2A 1O0PA 4PKDB 1SXLA 3CC4S 2ADBA 1QVFR 2RRAA 2DO4A 3CPWR 3RW6A 4EGLA 3NNCA 1X5SA 3MURP 2ZJQQ 1X5OA 1WHYA 3H2VE 4BS2A 2VOOA 3IRWP 5IFMA 1VQOS 1WTBA 3CCUS 2KH9A 1URNA 4V19X 3B4DA 2MQLA 2J0SD 2MSTA 1VQNS 1VBZA 2B0GA 2VONA 1U1LA 3CC2S 1M5VC 5DM7Q 2DNHA 2DGXA 2QA4S 3G9CA 1VC6A 3UWTA 1WG1A 2G1DA 2HVZA 3MUMP 3MD3A 4J5OA 2L41A 5LJ5Y 1WWHA 1X4BA 4YUDA 1YITS 2DNMA 2KXHA 1VC0A 4WKRA 5BJRA 2RRBA 5GAEU 2OTLS 3CTRA 3P3DA 4TLQA 4W92B 1WEXA 2V94A 2EVZA 2LKZA 1U1NA 2KI2A 2DITA 3ULHA 2MYFA 2LQ5A 2FPHX 4WIIA 3VF0B 2MKHA 2MJNA 2J76E 1FT8A 3FEYB 2M0GB 4FXVA 2MJUA 4QPTA 3NS6A 1FJEB 2MGZA 2LA6A 2KXNB 2DH9A 2DO0A 2KXFA 2MB0B 2YWKA 5GAHU 1X4GA 1WHVA 4PR6A 3D2WA 2DHGA 1WEZA 1FNXH 5D78A 2DHAA 4Y0FA 1NJIT 2N82B 2QFJA 2DGUA 1Q7YT 3CCLS 4C7QA 1Q86T 4WFNQ 1KOOA 1PO6A 3RW7A 2RQ4A 2RS8A 5GVQA 1M5KC 3U1LA 2KG1A 2DHSA 1VQ8S 1XN9A 2GHPA 1JJHA 2MKSA 2K8GA 3EGNA 1ZZNA 1RK8A 2A3JA 1ZH5A 2MY7A 2HGNA 4U67Q 3BO2A 3HHNB 2LXIA 4W90B 2FC8A 4ED5A 4OZ0A 1AUDA 1X4DA 3UD3P 3NS5A 1UP1A 2DGOA 2ERRA 1WF0A 2AYGA 3L3CA 2CQ1A 2KFYA 5LXYA 2M4MA 1VQ5S 2K3KA 3CCMS 3ZZYA 2MSSA 1Q82T 3BS9A 3THPA 3TP2A 1OIAA 2MQMA 2DGQA 2DNGA 2FC9A 2OJ3A 1X4EA 1X4CA 1X4FA 3N9UC 3MD1A 2CQ3A 2CQPA 2CPFA 4OZ1A 1YIJS 5CXTA 3VALA 2YTCA 3EGZA 3P5TL 3NNAA 1HD0A 3MDFA 5FJ4A 2DHXA 1A7GE 2DIVA 2GO9A 2DGVA 2SXLA 1WHWA 1YI2S 4F26A 1OWXA 2BOPA 4ERDA 2FY1A 1D8ZA 2DH8A 4UY8T 1QVGR 3S7RA 2M88A 5DDRC 2CQ0A 2CQ4A 2JVRA 4Z2XA 4ZKAA 1M5PC 4TU8A 2M2BA 4CQ1A 2XS2A 2DNOA 3G6ES 2Q79A 4F02A 2YKAA 1WG5A 5JVHQ 1VQPS 1R8HA 1KQSR 5IM0A 4YOEA 1SJFA 2O3DA 2DNYA 2M52A 1YJWS 2CQBA 1Q81T 2CPHA 1UW4A 2MY8A 2HYIB 2X1FA 1DBDA 4C0OC 2MZRA 1S79A 1WI6A 4WFBQ 2D9PA 2CPZA 1N52B 1VQ4S 3SMZA 1H2TZ 3G4SS 3G8TA 1KOHA 2DISA 2N3LA 2ADCA 1U1PA 5LSLA 1U1OA 3MI7X 4WF9Q 2PEHA 2MQOA 1FXLA 1NO8A 3DXBA 3UCZP 2MZQA 2EK1A 2NLWA 2RQCA 1P27B 3DLLQ 1HL6A 1VQ6S 1HA1A 2KVIA 1X5PA 1YWXA 4CIOA 1P1TA 1RKJA 2M9KA 4M5DB 3B4MA 2RU3A 2MKKA 2MQPA 4TU7A 3V4MA 3CCQS 2U1AA 5EN1A 2CPEA 4A8XA 3VAHA 4UQTA 2KRBA 2MKJA 1VQLS 1CVJA 1OPIA 2XS5A 2JX2A 2M7SA 2MQQA 1K8AT 1S72S 3CXCR 4QU6A 2MZTA 1U1QA 2MGZB 3VAKA 2XNQA 2LMIA 2MMYA 5MLCV 2MXYA 1WELA 3PIOQ 2U2FA 3K0JA 2E5GA 3CMAS 2DIUA 1VQ7S 4PRFA 2DNRA 2ZJRQ 2CPJA 2RVJA 4TU9A 2AYMA 3S01A 5D77A 4IUFA 1FO1A 2MKIA 3MXHP 2M8HA 2CQIA 4CH1A 1N88A 2DNNA 3SDEA 2VOPA 2DH7A 3G96A 3Q2TC 2KN4A 2CQ2A 4IO9Q 2E44A 1QM9A 4LMZA 2DNKA 2KG0A 3LPYA 3CMES 1UAWA 4P6QA 1W2BR 4LIRA 1U1RA 2L9WA 2G4BA 3UCUP 3PIPQ 2KT5A 1VC5A 1JJ2R 3UE2A 3I55S 1H6KX 2MZSA 1YJ9S 1A9NB 3IWNC 1SJRA 5JVGQ 2DGTA 3ZZZA 1N8RT 3CUNA 2KM8B 3MOJB 4IOCQ 1BY9A 4QQBA 5DM6Q 1G2EA 5LSOA 2CPXA 4FXWA 3BO4A 2F9JA 2N3OA
chains in the Genus database with same CATH superfamily
3AXKA 5ETKA 3QZ7A 1WF1A 1BGXT 3IM8A 5ITHA 4U95A 3BJYA 3AQOA 3EUNA 4WFYA 1KONA 3J7Z5 3MOZA 2VC1A 5EWGA 3CCJS 4KIAA 3DHWC 3I6PA 2YKNA 1JB0C 4M5MA 3I0SB 5C42B 3ELHA 4ICLA 3QLHB 2Q6CA 2ZEJA 1Q95G 3THTA 3ADAC 2XNRA 2H4WB 5K5MA 2WB4A 4RUBA 4DZDA 1VQ9S 1T03A 3GB0A 4KO0A 3JAMU 1RWMB 4U7UK 3F44A 1D8YA 2B4OA 2HQFA 3C16B 2EBEA 2OP5A 4WZMA 1FDNA 4PWDB 1BD6A 2LYVA 2ZC3A 2G9OA 3PW4A 5F8GA 4KB7A 1FK9A 3TAQA 4NZ7A 5GMDA 4K4UA 3PY8A 4F67A 1CS4B 2CNNB 3VQSA 3OVBA 3FEXB 3CCVS 1K9MT 2DYAA 4PG4A 3O3LA 3R5JB 2IBOA 4P52A 4F04B 2NXEA 4RW6A 2PSZA 1UFLA 4OJHA 4LF7J 1N5TA 1IR2A 1L3SA 1NZ8A 5K14B 3GYGA 1NU4A 3CEDA 2LA4A 1T94A 4TN2A 3VWSA 3OJSA 1U49A 4F2RA 1DHMA 1AXQA 4NASA 2V4RA 2D9OA 3PG9A 4A8SA 3LQVA 2ZWOA 1LFPA 4DR5F 3TUZC 2FJBB 1HMVA 1JLFB 3HD1A 5IFMA 2Z2YB 2E1AA 4OLOA 3B4DA 1FA0A 3KJNB 4HH1A 3CC2S 4O44A 2VDIA 4DS5A 1U47A 2G2OA 1WWHA 4KRWA 4WU3A 1PIEA 2AEJA 4M5DA 2RU9A 4R8UB 2GQQA 4F3MA 5IS2A 2HHUA 2E1CA 2MKHA 3EZUA 2J76E 3UFCX 4DL2A 1I3OB 1NRKA 2YNGB 2FHMA 1VLYA 2RDDA 4JI8J 1JNZB 3CJRA 1WOSA 1WDTA 2QMUB 1WJ9A 5GADI 3CCLS 2IAJB 1PO6A 3J81j 2KG1A 4MTPA 3HHKA 2BR0A 2IYIA 2A3JA 2RRNA 8AT1B 4XIUA 4KPCA 2LXIA 5F8IA 4B3RF 1GT8A 5E3PA 5KFWA 1SKSA 2UU9J 2CQ1A 4KE5A 2MLYA 2W2NP 1Q82T 2BE7D 3THPA 2Q66A 2MEWA 2GGPB 4A8OA 3QWPA 3CDAA 3G87A 4DFJA 4DUYJ 1NDKA 4PG5A 4LF9F 3NNAA 4WFZA 1WNEA 2DHXA 4NI2A 2HVEA 1NPPA 2HKEA 4DV6J 2R7OA 3LPEA 4F4YA 2BOPA 2A1BA 3T1YF 2L48A 1KVKA 1FDDA 2CJBA 4CQ1A 3TR5A 2WZ1A 1EB0A 3RG6A 4X4PA 2JH3A 3M2RB 4NLXA 2A6OA 3SCJE 1BQXA 2CQBA 1XEZA 2B8QA 3PYFA 2F65A 1H2TZ 1CJTA 1U1PA 5LSLA 3GJSB 2VJVA 2E7XA 2LLZA 1X5PA 3EMTA 1AFIA 3V4MA 1T9VA 2HHVA 2ASDA 1B0TA 1OPIA 3UR0A 2XYGB 4QIWD 4ZITA 1S72S 2HHQA 2FJAB 3R9LA 2YVSA 4LF1A 2V68A 1TUGB 1NB7A 4PRFA 2DNRA 2HQCA 2RVJA 5D77A 5IXUA 4ECTA 1Y00A 5AE3A 4K4WA 4C8YA 4J9NA 2AW0A 2L9NA 1FDBA 1W2BR 1SJ1A 4K50A 2EWHA 3Q8QB 1RT1A 1Y0HA 2W2MP 5DJBA 1RHRB 4I2QB 1SJRA 1PYTA 4J9QA 2V8VA 3H7HB 2CVEA 4B3TJ 3W9HA 4RBUA 3CDBA 2I5JB 3H0PA 2B3TB 2CJKA 4PG6A 5AE2A 2HIQA 2C1EB 2AYEA 2HWTA 4IDKA 2CDRB 4NCAA 3LAKA 1Q1KA 4OYOA 4G65A 3K17A 3AXMA 1FKPA 4C2MA 4AL7A 4G6VB 4ALZA 3EZOA 5E2QA 4I6AA 1EARA 4HR2A 1LWEB 3PM9A 3R97A 2CJXB 2DXEA 4IYQA 1REVB 3BYRA 3FQLA 1F5BA 2AD9A 4CO3A 4F50A 1IKWB 2GIFA 4DSIA 3GG1A 1XMOF 2KTQA 2DNZA 3BM7A 2ZE2B 3LALA 2V4QA 2HS4A 4LF7F 2VFVA 4PUOA 4WCEQ 1IQZA 4DF4A 4CT8A 4K4XA 1LXJA 4ZCIA 4FYWB 3BEGB 4RJVA 4JI7J 2ZZTA 3G6XA 3VVUA 2PI4A 2JEGA 5EWFA 4KKOA 4HT5A 1D1UA 2NSCA 2ACYA 1Y10A 5HROB 4NA3A 2BV3A 1YHQS 1VFJA 5EGYA 1ZTTA 1KQFB 4LRDA 3QJPA 4YR0A 3PVXA 1UFWA 5A2QU 1R0CB 2MPUA 4HTJA 3WX8A 3RGIA 4OHYA 3K8WA 4FNIA 2FLOA 3PYDA 3BQ2A 1JLGA 4ZVGA 2XMTA 3KLHB 1WKJA 2QZ8A 3K8VA 4PKDB 1RCOB 2VZ9A 2V67A 4OL8A 3MURP 2VOOA 3Q8PB 1VQOS 3DOKA 3JTPA 2OKQA 1ULRA 3TVYA 4JI8F 1VLOA 1S99A 1AFJA 4LR7A 3D7SB 4ES3A 3BPSP 1JWWA 2YKNB 4DSJA 2P9GA 1RT7A 4ICLB 4TKTA 3HSJA 3ULHA 4ETZA 4WIIA 2AZ1A 4ES1A 1T03B 4Z7YA 4KO0B 1RACB 2UU9F 2ZH4A 3MPYA 4KBIA 4ZVSB 5GAHU 3GZ7A 2J7WA 4DR3J 2DHAA 1PKUA 1YK9A 1NZAA 2VB6A 1RTIA 4PQUA 4YS2A 2CKWA 4MIBA 1MLAA 1QY7A 1VMBA 1VQ8S 2GHPA 3FNNA 4PG8A 5FDLA 1FK9B 1ZH5A 3LWMA 2W24A 4EO8A 1T9UA 3UDLA 4DV6F 2AU0A 1URRA 3VHQA 3R5AA 2XGPA 1J5OA 2NS1B 2P9EA 3OXFA 1SQFA 4JUZA 2GJIA 3BR8A 2F4VF 3ETOA 3CJ8A 4USKA 3OFHA 2JC0A 4ID5A 3WHIA 4RW6B 5F0UA 3RU0A 2VBWA 2VQEF 3MDFA 4M5NA 4DCOB 2HPUA 7FDRA 1RAAB 3GV8B 1Z4UA 3IRXA 1WHWA 4ZVPB 3K7RA 2Z8QA 4X4RA 2M88A 1U4BA 4DX6A 1R8HA 1NDPA 1HMVB 3HJFA 4FF2A 2CPHA 5KFKA 3GG0A 4WWSA 1WC5A 2XY7A 2XTJP 5B0DA 3DRPB 4O44B 2PA8D 4ZOSA 3V6DA 1NK5A 2C2DA 3UI3A 1RKJA 4M5DB 1R43A 4NYZA 3FBFA 4UQTA 2EFOA 2HBYB 3WZ0A 2E7WA 3GR1A 4OV1A 2MQQA 4LBPA 5KOWA 4ZJOA 3H98A 2D1CA 2BQUA 3JS9A 3K5NA 1RT2A 1S48A 2WVBA 3AD9C 1XTZA 1JLAA 3EVWA 1PYSB 5GAEI 2XMUA 4B3TF 1XNRJ 1RISA 2HVHA 3N28A 2PMZD 4LMZA 3HPOA 2DNKA 3ENQA 3UDVA 3LPYA 5KFZA 3CMES 1WTFA 3M2UA 3TW0A 1CSJA 5A8RA 4AXJA 4PQAA 4B9UA 2ZDOA 3RAQA 4G1IA 3MEGA 3Q8VA 4DEZA 4KGMA 3JQJA 3KG0A 3DLBA 4ANEA 2F9JA 2W4DA 4ZP6A 2XM3A 3IMQJ 5A8WA 4MH8A 3QGIA 4NI2B 3LF0A 1YLXA 4A8MP 2DY1A 3NWGA 2GVDA 5J2QA 4YFUA 3K59A 3MPVA 3LGNA 1OYEA 1S7IA 2XS7A 1VBXA 4HACA 5KG4A 2CQHA 4R25A 3AD7C 3GIRA 2C2MB 2C2NA 3FJ2A 2XI3A 1YX2A 2ZDPA 4ILLA 4USUA 2Y8YA 4WFXA 5LT5A 5KFPA 5HO4A 4IRDA 4JI7F 1CJVA 1FRLA 5KFXA 1CJTB 1S6PB 1B7FA 3CCES 5IV3A 2FVSA 3NWRA 3NS7B 1NK4A 4AD6A 4CO4A 2A0FB 1RSCA 3PXGa 2FGCA 3OFGA 3SEOA 2OLWA 5LSRA 2CWXA 2OPQA 2GX8A 3UD4P 3WIUA 1C1BA 5F3ZA 1HIYA 2HGMA 2CQCA 2Z30B 1N0VC 3K57A 5G0RA 2HQGA 1MSWD 4PAAA 3H2UB 3HI9A 2BJ3A 2QEXS 5A8KA 1WI8A 2RS2A 4X66J 3IBWA 3OXGA 1SC4B 1KRPA 3ZZRA 4E8UA 3US5A 9RUBA 1U09A 1U1MA 2ZFHA 1KC8T 1RT1B 3J7YU 2G0CA 4RNNA 3ONQA 1M1KT 1Z2ZA 2QLBB 3DU5A 3Q83A 1IN0A 3O2IA 1PGZA 2RUGA 4JI0J 4LUBA 4HHUA 4C11A 1NUEA 2RRAA 2XZWA 2B7BB 3OTBA 4WE1A 3EPIA 2IY5B 3PR5B 4DR3F 2MSTA 3PJ9A 4IDKB 3PW0A 4OJ1A 2BJEA 4DX8H 2Y1RI 4ECZA 1NKBA 3J80U 3FSXA 2IVFB 4FPRA 1OSCA 3D1QA 1FKPB 4W92B 4WP3A 4GKKJ 4ILRA 1ZAXA 2MYFA 1IJFB 3TUIC 3M1VA 2JFDA 2CZVC 3IAM9 3H25A 2MB0B 4YB7A 4F4AA 2W9CA 2XO7A 1S77D 4L3NA 3SI8A 2ZBCA 2R2UA 3GILA 4WFNQ 1ZPVA 1LFWA 5L46A 2XG8A 4ZLLA 4PUOB 3NLCA 4D3HA 3O44A 3CJKA 2VU5A 4IR1A 2HK3A 1LOUA 3BBFA 1PJ7A 4ZJLA 4OI1A 1NSPA 2KFYA 1RT4B 4MFBA 5E3RA 3ZZYA 3GR0A 4KKOB 4DS4A 1L5UA 4L74A 4X84A 3U7JA 3D0HE 1TK0A 3MPDA 2GVZA 3EGZA 3P5TL 1AROP 1NKEA 1K0TA 5IC4B 3HK2A 3A3NB 3NXZA 1P6TA 3IO1A 3HSDA 2FIUA 1TKDA 2H9ZA 1JLGB 2IDEA 1NSAA 4F02A 4IOBA 3CDUA 2JDJA 3DOKB 4LRBA 2HYIB 1DBDA 1S79A 4V19J 3LTOA 4ITSA 5G4DA 1KOHA 3W8GA 3MI7X 5KT6A 1NO8A 2E9RX 5KFHA 2DR9A 1D09B 4I69A 1P1TA 4ECVA 2VPYB 4PYAA 1RT7B 3QZ8A 3ZTPA 2MQPA 3UNYA 3AA8A 1I51B 3GJTB 3J81U 5FLXY 1JLEA 5HP1A 2EKNA 1RZMA 1RLCL 4ZPTR 4YDXA 1RHQB 3UNGC 5DS7A 4I56A 3NP5A 3KMSA 3OSPA 4B3SJ 1GK8A 1RTIB 4B9TA 4PQUB 4AL5A 2O5DA 4K0KJ 1V3ZA 5I42B 1Q5YA 2E44A 4IO9Q 5FDLB 4ZPBA 1LW2A 4RW9A 2Z2ZA 1EIYB 2KZZA 3UCUP 3GU0A 4RO0A 3UE2A 1J5OB 2NPIA 3AB4B 3NL0A 1JLBA 2D41A 2FQQB 3MOJB 1D9DA 1RBOB 4QWDA 1EJ7L 2CPXA 4NEZA 3BH6B 3QIDA 4ID5B 2ZBRA 5D0EA 2HBZB 4K4TA 1CC8A 1HWJA 2FJVA 4DL3A 1IQTA 5HVHA 1RUSA 3E8OA 5CH7B 3N6LA 2DB1A 3IRXB 4JV1A 4N8OA 2EC0A 3MFIA 4J9KA 3ZFVA 5RUBA 3GV5B 4A8KA 1Q8LA 5DG8A 4KV8A 4TY9A 2VFUA 2DPJA 2B4VA 2RH3A 4M63A 2QL7B 3IBCB 2OFHX 3A12A 3M8QA 3AOCA 1N33J 1OMSA 4LSZB 3RAXA 5KAKA 4GO7X 4HHJA 3V6DB 2CFXA 1JXLA 7AT1B 3BGRA 4J91A 1VRQC 4RNHA 3VAJA 3BDPA 2QL5B 2DGWA 3Q8RB 2A2DA 1YJRA 4RUHA 4Q0BA 2EFNA 1UEVA 1RT2B 3HHEA 1JLAB 1WEYA 2OTJS 3JXOA 4JI0F 2VODA 3NGUA 1FWKA 3PW5A 5C24A 2X3GA 1VQKS 2R2SA 2RT3A 4EBEA 3KG4A 1HHSA 1CC7A 2G2ZA 3CCSS 3M2UB 4X2BA 5A8RB 2YQ3A 2XY5A 2G0IA 2V2KA 5CA5A 3T1HF 2Y1LB 3MEGB 4NCGA 2E1RA 3GPAA 4IG0A 5E3CA 4GKKF 3HDSA 2ZH1A 1S6QA 4ZK7M 5E7OB 1T9YA 5A8WB 2RUSA 1YG0A 3M9NB 3B8HA 4E2FB 3CPWR 5B0EA 5CQGA 1WHYA 2NSBA 2F7VA 2GVDB 4J90A 3LW5C 4OI2A 2MQLA 1UPMB 5J2QB 3E01A 4YP3A 3DU6A 1F5CA 4NWBA 2H5IB 2HVZA 4DV0J 1VBKA 3H90A 3JSBA 3W1YC 1WEXA 2Q3PA 1KFSA 2H5EA 1E6YA 2FZCB 2RQKA 2HLUA 3VF0B 2P2CB 1CJVB 3EZ5A 1TU0B 2DH9A 1FI4A 2NR0A 4B9NA 5D78A 2A2CA 2D7SA 4LFAF 4IH5A 5ETMA 2OPQB 2BVZA 2CADA 4UY85 4OV6A 3VR1A 1C1BB 1JJHA 2B5JA 3QIPA 2HGNA 4ED0A 3HJVA 2BJDA 3HHNB 5G0RB 1X7VA 1KQKA 1IWAA 3MM8A 5A8KB 5HMWA 3V5RA 3NGTA 4ZN1A 5HBMA 3L3CA 3MR3A 5GMEA 2MSSA 4GKJJ 2MLXA 3GFHA 4LFCJ 2CPFA 1AZSA 3ENWA 2VC0A 2VG7A 1F3VA 2YTCA 2QX0A 3DRXA 4JYAJ 1Y11A 3KG1A 3LP0A 3SCIE 2DRDA 2FY1A 4O3RA 2CXEA 4E98A 4MKVA 3S7RA 5I3QA 2R8JA 3A8EA 4TU8A 5DO2A 4YB5A 3G6ES 2Q79A 3IP0A 4C11B 5JVHQ 3OTCA 3TVZA 1BQNA 4WE1B 3H59A 3DFEA 4OX7A 3PFEA 1FCAA 3JSRA 2VG5A 4ZPAA 5I4MA 1WI6A 1KLMA 4ZA1A 2Y1IA 3EDRB 2V9WA 4OI6A 1RCXB 4UW2A 3TARA 2ABYA 4B3SF 3UD5A 3UW1A 2MZQA 4K0KF 2FJXA 2AJ4A 3HVRA 2KVIA 1YWXA 1Q79A 2E1PA 1KHWA 3C2PA 1RJJA 1KSPA 1R6YA 1N34F 3ENVA 5DG7A 4JI1J 4QU6A 3CXCR 2QMWA 3M1VB 1FRIA 3VAKA 3DI6A 2MMYA 3W9IA 4DCPB 2W9CB 5JMNA 2ZH6A 2M8HA 4CCHA 4CH1A 2VOPA 3MCSA 1RADB 3C14A 2DBBA 2KFNA 3CJKB 3MPWA 1UAWA 3E3XA 4MAKA 2L9WA 3W2VA 5GAHI 2K2PA 4MFBB 1U2CA 2PFFB 5H9FK 3DRRA 3CUNA 4FN5A 2OHDA 1MNEA 2KM8B 1ZA1B 1QSLA 1XNQF 2FUG9 1IXKA 2GVZB 1N33F 1W26A 1WORA 3HVWA 4U9RA 1DURA 4DBQA 3JQKA 3B78A 1UA1A 2OELA 3W64A 4OJ3A 1OQ6A 1VQSA 5T41A 3HKZD 2C2KB 3EX7B 3KKFA 2QG9B 4NLYA 4M95A 5CAAA 4NX9A 1RBAA 2CQDA 3D28A 2EBGA 2P8IA 3C6UA 3BKUA 2YNFA 4CLSA 2ATLA 4E0DA 1F60B 1B70B 1F9HA 4CNYA 2AYBA 1VJQA 1FERA 1TL3B 2GIRA 2W7OA 3CVKA 3J7ZT 3BBBA 1IM4A 1JLEB 5HP1B 3AHPA 4Q5VA 4Y2MA 3BSCA 2X7IA 3EVOA 4DR7J 4OI3A 3FRYA 3PV8A 4N47A 1NJXA 4JI4F 2OFGX 2NREA 2H51B 4DZ6A 2I38A 3H40A 4DSKA 2OH2A 3BQ1A 3F73A 1LW2B 1VQMS 4YR2A 4RW9B 1HW9A 3MAAA 4YY3F 3NMRA 3TUJC 1U8SA 2HQDA 3NKYA 1MWQA 5KG1A 1XR5A 5LMNJ 5BYQA 4P75A 2HS0A 2F9DA 4J9VA 1SKUB 3U02A 4C6AA 3NG8A 1JLBB 1FRJA 2NPFA 3MUTP 3H5YA 3V6KA 1NLKL 4CO1A 3KHGA 3I9ZA 4JI3J 3L9ZA 4ANDA 2W8LA 2Z58B 1SXLA 3G6VA 1C2PA 4EGLA 1FE4A 2ZJQQ 4RUAA 4JV0A 1RA7A 1N36J 3FCWA 3M6WA 3UWTA 2XLJA 4DCJB 4MYTA 4BLGA 4KV8B 1S49A 5KFBA 1RP5A 5C5JA 2V94A 1XR7A 2I9SA 3PYEA 1U1NA 3M8QB 4DN0A 3W5XA 3K5OA 3NS6A 4Y2KA 3D5MA 4UF4A 3TJAA 2YWKA 4ZVRB 3PRBA 4GKJF 2GHWA 2C2RA 3O5TB 1QJHA 4LFCF 3BGRB 2HSEB 2VH7A 4KC5A 5KFVA 5AXMA 2DHSA 1XN9A 3EGNA 1KN6A 4JYAF 4Q0BB 3R8YA 1VS3A 4W90B 1HWKA 2V34A 2VL1A 1X4DA 2BUNA 2BX6A 3KWMA 2M4MA 5C24B 2OPPA 1OY9A 2HVIA 2POKA 2HIYA 2D3UA 1TTHB 1HR0F 5F41A 4N56A 1R0AA 5CABA 4TQRA 3OXLA 1CPZA 2GO9A 2XMWA 4P72A 1D0EA 2CJYB 3UN2A 1H38A 4PYDA 4IG0B 2VFSA 5E41A 2ZH3A 1S6QB 2JVRA 4YN3B 4JI1F 3OBIA 2YKAA 4DQQA 4ZVUB 2HS3A 5IM0A 3GCXP 4JV5J 2QLXA 4MJKA 3W62A 3J7YI 4ZVHA 3ENAA 4DDFA 1NHKL 2EG1A 2MZRA 1KNZA 4WFBQ 1Y9OA 3E01B 4DV2F 5AXLA 2BKNA 2XMAA 3R2CJ 3TUPA 1TELA 4MIAA 1FXLA 3DXBA 3UCZP 2EK1A 2HFOA 3EVMA 4JOUA 2QGFB 2UUTA 3UQSA 1KHVA 2M9KA 5CYQA 3OL7A 1E6YB 1DQ9A 4LQ3A 2KRBA 2KVQE 2LEPA 2QMXA 2UV8G 4QWCA 2KHDA 5IT9Y 1KFDA 1FE0A 5E3AA 3SCKE 5B0CA 3KNGA 2CPJA 2ZJRQ 4Q8EA 1SUQA 2DH7A 4B9MA 3T19A 2B5JB 4OHVA 3QIPB 3A3PB 1KP6A 3MM8B 4KH0B 1QUPA 3BKFA 2GQ2A 2I0XA 5HBMB 1XIQA 2E1MC 3GTYX 1S0NA 1N8RT 2EFPA 4LF6J 1AZSB 2N3OA 2VG7B 1N6QA 2R9LA 4NLWA 3H42A 2BKPA 2HG4A 3H5UA 3OW2R 5B0AA 3N6MA 4ECXA 5L9NA 3LP0B 1XQIA 4L72B 3C66A 2WVCA 1OSDA 4P2MA 3MZIA 2J7KA 2OAUA 4DR1J 2WOMA 5A6WA 1NDLA 1VBYA 2AQ4A 3PO4A 1WOPA 1TK5A 4Y00A 1BQNB 2K06A 2XSFA 3PJWA 4O0NA 2OIHA 2WRMA 2FVCA 2AHOB 2VG5B 4DR7F 2E5IA 1KLMB 2W8KA 3UN3A 2X1BA 2DEJA 3W7BA 3L7OA 1S4EA 3DM2A 1SJ3P 2RILA 3AOAA 3KK3A 1RHJB 3IGVA 1P9QC 5LXRA 1BHNA 4LVNP 3H20A 5LMNF 4JI5J 3ILOA 4DV5J 4KR0B 1TAUA 2J0QD 3DI6B 1A0OB 2EKYA 2ZNYA 4ILMA 1F2GA 1RGVA 2DHHA 4QU7A 3DKDA 2YKPA 3OVSA 1X5TA 2XYPB 4Q8FA 3RB6A 4OYBA 2MTLA 5D4OA 3MUVP 3C14B 3M7VA 3KLIA 1JNRB 2NZ4A 1T9WA 4QPXA 3W2VB 3FQKA 5L1LA 3MAQA 1N36F 4BHQA 1Y7PA 2MKCA 1BLUA 3V6HA 3GIIA 1WKKA 3DRRB 4UZBA 4DQRA 4ZP7A 1Q16B 2RIJA 3W63A 4OHXA 4EI2A 1DZ5A 4GVLA 1SI9A 4F25A 1U8WA 2RF2A 4R0EA 4KGKA 3FEZA 4J9UE 2O1PA 2QRRA 3BQ0A 2DO4A 5D4LA 1QSSA 4ZCLA 4U8VA 2R3VA 3OFFA 3IXQA 4Y34A 2Y0BB 3UDEA 2AGOA 3R5GA 1M5VC 5DM7Q 5C42A 2DNHA 3KOAA 1HHQA 1PAEX 4LR9A 1WG1A 1OPZA 4ZS6A 2L41A 3WDOA 1Y5NB 2ZH5A 3VV2B 2LQJA 4F4KA 2EVZA 2DITA 2J0WA 1RWWB 2F40A 5M2PA 4NOHA 2G13A 1PSDA 1XMBA 1IM6A 4OI0A 1J2VA 2KDOA 4DOZA 3C6UB 3GV7B 4WXOA 2KXFA 3LGMA 2DHGA 1RXOB 2YNFB 2UXCJ 3F56A 2R7WA 1IBLF 3OR1A 4RNMA 4NEYA 3KNAA 1PILA 3MMCA 4J9PA 1KOOA 3I5AA 4DV7J 4F36A 3RW7A 2RS8A 1X9SA 4IFVA 2R7UA 3DLKA 1FJGJ 2E5LF 4U67Q 3GYNA 2FC8A 1AUDA 3W65A 4FF4A 2XO6A 4I68A 2IRYA 2JLEA 3T5LA 4FZVA 3I96A 1VQ5S 3JTOA 4OJGA 3TP2A 2W4CA 4C8MA 3MD1A 4FYVB 3DMJA 4JP8A 3EJMA 4XPEA 2NXNA 4ZCKA 3MAAB 4ECSA 5HK4A 4CLYA 3OJUA 2IC3A 4A48A 1W25A 1QD1A 5EUHA 3KJVA 9ATCB 5AXKA 2B9EA 4GC7A 2VPWB 3J7A1 3EGVA 3HVAA 4QOTA 3AODA 2CQ0A 1S0VA 4F7VA 4R0JA 3TJ8A 1NJZA 4FKXA 2DKOB 5C2GA 2X51A 2M52A 3NCQA 1HQ2A 1ZM4A 3DLEA 3CDEA 2AMCB 1H7WA 4B9VA 3K5PA 3BYPA 4TYBA 5KFSA 3UO0A 1C4CA 3BKTA 3PHTA 3TI0A 1RYSA 4C9DA 3CJ2A 4KHRA 5CCMA 4L73A 4DUZJ 2NCKL 3IS9A 4N76A 2MZTA 2JLGA 2YBVA 5DLFA 3TRGA 1B99A 3K89A 2L3MA 2PEBA 4X4OA 5BR8J 4AQYF 2E5GA 4LF6F 3KYLA 3CIMA 3HSZA 5KG3A 4ZPVR 3R7SB 2HRTA 3Q8SB 1RE1B 1N88A 5L8RC 3OTEA 4CLKA 3F41A 1QM9A 3ZZOA 1BMQB 4DPTA 3PIPQ 3DLJA 1VJWA 1VC5A 3BSOA 1NK6A 2QLWA 2ZBQA 5E0OA 1YJ9S 3QQCD 5EX3A 3MGJA 5DRKA 2OPPB 4IH7A 2V4JA 4CLPA 6FD1A 1RAIB 1Y3JA 1F5AA 1MMLA 1R0AB 4F4XA 1S10A 3OLAA 1NAQA 3R5CA 3Q2SC 3CC7S 1GTEA 5B0BA 1RWUA 4ZJQA 3DLHA 4I6WA 2MZJA 4QW8A 1X60A 1RYRA 3QSIA 4JI5F 5IM0B 4DV5F 1W2IA 3OL8A 4MK7A 1VISA 1NH8A 3TQEA 1CLFA 2ASYA 3CJTA 4LSNA 2B6AA 4OZJA 2IA6A 4NLVA 2KU7A 4GVBA 3WC2A 3CGIA 2VD3A 4CLZA 3D1OA 1Z2LA 3KLGA 1FEEA 4DFPA 2XLKA 2AJ2A 4FP9A 2HNZB 2WAQD 1N5QA 5FLXU 1UEUA 1SUQB 1UJ6A 3GIKA 2MZ1A 3A1YG 3PJXA 5FIIA 1G4CA 1XMQJ 1RBLA 6FDRA 1PJ6A 3A3OB 4ZPWR 2DVIA 4QR2A 3VAGA 4FNHA 2BJ1A 4J9SA 1SJQA 2IM2A 4YEAA 3FZBA 2FDNA 3S6EA 2V6AA 1X0FA 4G1QA 3MF5A 5L1KA 3HO1A 3NAIA 2BJ9A 1H74A 3PACA 3AB2B 2C22A 1HKAA 1P1LA 2RSQA 1N6QB 5CD4H 4EMDA 2RAQA 2Y0SD 5IT0A 3PNIA 2Z0GA 1GH8A 2LDIA 3DOLA 1VBZA 1IKVA 1YBAA 2LXFA 4C3KA 1EZZB 1QAYA 4DV7F 2WOMB 2QE5A 1OY8A 3BBCA 1RI7A 4WKRA 2KKHA 1FJGF 1YJUA 4DU7A 4PWUA 2GW8A 4A8WA 1U25A 1FF2A 3MEDA 2COLA 2OUGA 2J8SA 2MJUA 4KJIA 2DCUB 1H0HB 1J5EJ 2IM0A 2ZE2A 3DM2B 1WOOA 3N01A 3MTKA 2GA7A 4PABA 1T3NA 2V8HA 3KK3B 4LFBF 1UWAA 4URQU 1HNXJ 2B51A 5H9FJ 1HQEA 3FCHA 3LOUA 3IC1A 1WC6A 4F0KA 1YRTA 1JKHA 1RT5A 4LSLA 4ED1A 3BS9A 2FY8A 2DGQA 2HHXA 4GC6A 3KLIB 1GQEA 2JJ4D 1NPKA 2JEIA 5CXTA 3G8QA 4WIQA 4LF8J 5L9XA 5FJ4A 1RWXB 1PCAA 4DL7A 4ENOA 4OX9J 4DL4A 4RWWA 1WC3A 4EU0A 2DT9A 3HZGA 1ACMB 4F26A 4ERDA 3TJ9A 2IRUA 1QVGR 1GMVA 4NYPA 2BE2A 2RF2B 2LP4A 3I5CA 1N48A 4DUZF 3SBMA 1T9XA 2E29A 1ZM9A 3MEEA 1JLQA 1NJYA 2E7VA 5BR8F 3HFKA 3PR4A 5KFUA 3W3SA 3DHXA 3DLLQ 3GP9A 1HL6A 1UVMA 4S0MA 1JJCB 2RE1A 4MT1A 3HM9A 2MKJA 1VQLS 3EXYA 1U1QA 2YY3A 4P7VA 3H4BA 3KLFA 5KT5A 3IFEA 4L75A 3MM9A 1WELA 1LEOA 3CMAS 1VQ7S 3FVYA 3OR1B 1MMDA 3RBEA 3MMCB 3QFHA 4HI1A 3CJ0A 4IFVB 3DLKB 2HQ3A 5KOXA 1HBMA 3ZXWA 2KT5A 3D1HA 4ZLNA 2WSFC 1Q8BA 2FVPA 2DD8S 3ZZZA 1UKUA 1Q4RA 3DMJB 5EDWA 2FHKA 4NA2A 1TQLA 1ZETA 3P8BB 2F4FA 1NEEA 3NOCA 2MQNA 5HL7Q 2IC3B 1DFDA 3KJVB 2XGQA 1M5OC 2DNLA 1VIOA 2MLZA 2JLFA 2G0JA 2LQ8A 4J9OA 1G3OA 1YBUA 2V5HG 3CD0A 1HNVA 4Y2IA 4WK3A 2FLLA 4CLTA 1RTHA 3SFUA 2HRUA 4CH0S 1UVNA 2FB0A 5DDQC 1Y4ZB 3LP1A 3DRPA 1S1UA 3NEKA 1LWXA 4KSEB 2ZKTA 2CIMA 3DLEB 1F2HA 2XQCA 3HXMA 4ZVEA 4NPOA 3QBCA 1VGYA 1XMQF 2MQ8A 4EZ9A 2UP1A 4XO0A 3V2UC 2BACA 4IOAQ 4WTOB 5LJ3Y 4FS1A 1VDHA 1FJCA 3DGVA 5HI7A 3BGOP 3IS9B 3Q22A 3N4WA 5HLFA 4JI6J 1F6TA 2KZMA 4Q43A 1H2UX 2W2OP 4WJBA 5CD4A 5BYSA 5IWAF 3QO9A 2EI5A 2YX4A 5DDOC 3CF5Q 3TNVA 5AXNA 1Q78A 5ETSA 2GQCA 5F3TA 2QA2A 4X4VA 3CJ3A 3PW7A 1RHKB 2KHCA 3W2WA 3NGSA 2HGLA 3VAIA 4USIA 2FHOB 2V4JB 4H4OA 2JL9A 4N8NA 2WBMA 2J7UA 1S1VA 4HL9A 3M30A 1MG7A 2FHJA 1HARA 1UVLA 2UXDF 5IT4A 4HVZA 1PAUB 3P4UB 2KH9A 2J0SD 4ECQA 4DR6J 2JOQA 2GMJA 4AT1B 1H72C 3IWLA 5BJRA 2FJEB 3P3DA 1CBKA 3NRBA 1S6PA 1YJ7A 4KH1B 4O3NA 4QWAA 2MJNA 1SPBP 2EEYA 4J7CA 4M5GA 4EEYA 4OHZA 4J37A 1M5SA 3LH2S 5H9EK 1WHVA 3JSMA 4LSNB 2B6AB 4EYHB 4GMKA 1RWKB 1UZDA 3EICA 3RRKA 1Q8KA 2W4PA 3D6MB 1QTNB 4GVBB 4LF8F 2ZD1A 3JTNA 1ZBTA 4OX9F 3KLGB 2BRLA 1P9YA 2D3O1 5F0WA 2WTFA 4O4RA 1CJKA 5HJXA 4F3QA 2GZOA 1F9EB 3CCMS 3FFIA 1E6VB 1RDRA 2DNGA 3DOMA 2YPZA 4UQGA 4DF8A 2R2RA 5DG9A 2WK4A 5B7WA 4Q45A 5B0FA 1SCJB 3QSYB 4CLWA 1EAYC 1I6JA 1UJ5A 2DIVA 2BEFA 4G1QB 4M5JA 4C98A 2QA4G 2SXLA 1R7IA 3NBPA 3D6HB 5J2PA 1M0SA 4IQMA 4UY8T 5KFNA 2VBZA 4X4UA 3H2LA 1SB6A 3BGUA 5JXSA 5F9LA 2VFRA 2XHWA 3DOLB 1YJWS 1Q81T 3W66A 4ECRA 1S57A 1IKVB 1KKHA 2CDQA 4IG3A 3BSAA 4C8NA 2ZH8A 5E33A 3CCZA 4JV2A 5KFJA 2ZWPA 4O4GA 2YNIA 1NPRA 1FKAF 3MEDB 4Y2CA 4ID8A 2XS5A 1N32J 1R3NA 1K8AT 2IBKA 2XSJA 2CUYA 3MMAA 3RR8A 3PZPA 3JYTA 5M2UA 4QCLA 1UWBA 2Z2LA 1TFWA 1HFEL 4N7TA 4O3OA 4DSEA 3MXHP 1HQEB 1IBKJ 4ZDNA 2MDAA 2O01C 3OFEA 2W9AA 2KG0A 4PCQA 2H1YA 4PXDA 1RT4A 4P6QA 4A4JA 1U1RA 2RJZA 1U02A 1JKHB 1JJ2R 1RT5B 3I55S 4LSLB 3TZXA 3M32A 1A9NB 1AUSL 4EWTA 3DNCA 4DJBA 1RT6A 2Y8WA 4QQBA 2FVQA 3FBBA 3ETMA 2B4UA 3BO4A 1NBEB 1BXNA 2VQFJ 4A8FA 2RNEA 3QNWB 1XERA 1SH3A 1VR6A 1L3UA 5LM7E 2VBYA 4LF2A 3O1LA 2B4PA 4IRKA 3QATA 4AFFA 1V9OA 3CCRS 2ZC4A 4HTIA 2BE2B 1DRZA 3MCNA 1G6BA 3NGDA 8RUCA 1FHTA 3MEEB 4PPZA 1JLQB 2GJ2A 1U2FA 2FZKB 5DZ7A 1QDUB 5ETRA 3L4BC 4JI6F 3D67A 1N5SA 3Q23A 1N5VA 4RWXA 2KM8C 3WC0A 2LECA 1JMTA 3W5ZA 3DCAA 3I0RA 2DRBA 2ZOFA 2DNQA 3AAWB 4AXIA 2F63A 1U1KA 4F4WA 1S0OA 3M8PA 4PWWA 3S8SA 3VQTA 1GMUA 3KLFB 1ICEB 4DUYF 1KTQA 1L3KA 3MM9B 1HNWJ 5I42A 5IT9U 2HAIA 1GEHA 3ZNUA 2F5GA 1FJ7A 2G1HA 2IVYA 3FDSA 1HBMB 1F3FA 5AE1A 3AJDA 4DPWA 2R7VA 1TFYA 4J9RA 4DR6F 4RLEA 4ED4A 1FRKA 1SIZA 2MHNA 3MECA 1Q7LB 1QUVA 2FHJD 1RWNB 5IQ6A 1NJWA 2HBRB 3ZZUA 5KFQA 2BMBA 3D3BJ 3FBCA 3PCOB 1V5VA 1IKXA 2YX7A 3GLJA 1YJVA 4O3QA 5KFDA 4IR9A 3TVKA 3CD5A 4B02A 1TL7A 1Q0NA 5IV4A 5JUMA 1HPZA 5JJBA 3T5KA 2ZM6J 4CO2A 2GO8A 2RB7A 1U1LA 2OEJA 2QYGA 1HNVB 1LWFA 3MD3A 1GXLA 3NY0A 3GSIA 2VV5A 2KXHA 1RTHB 1VC0A 4EZ6A 4TY8A 3CTRA 3C6TA 5L39A 1T05A 2KI2A 4B3MJ 3LP1B 3Q24A 1S1UB 4DMZA 1FWLA 3EYZA 2M0GB 1RAOA 1S6OA 2D74B 4ZN3A 2ZITA 1QE1A 4PR6A 2C3PA 3VZHA 2N82B 1RKIA 1U26A 4CO0A 1SL2A 1FFWB 3HD2A 1Q86T 4QWEA 2AEFA 1TL4A 1RAEB 4RR5A 1ZZNA 2MY7A 4A47A 1S1TA 3DDNA 3BZQA 4CM2A 5HLFB 2BXJA 5F8LA 4CO5A 4I7FA 4DI6A 3GSDA 2MQMA 2HNYA 2QSWA 2AJ1A 3QO9B 3R2DJ 1YKWA 3HLUA 1XR6A 1Y3KA 4P71A 4NRTA 4OZ5A 1SC3B 3H8YA 2DJWA 1OY6A 3W2WB 3MMBA 3TA2A 4H4OB 2I1RA 2HHSA 3IGNA 4PXEA 4UUXA 1S1VB 1RA6A 4ZP9A 5E3QA 3M30B 3M9OB 3UVJA 1VQPS 3FGVA 4ATNA 1IR1A 1TR0A 3OTOJ 2FVRA 4PEOA 3TA0A 2M3DA 3G82B 1FNOA 2VFTA 2QO3A 1PBAA 2HVDA 5KT7A 4O0IA 4B9SA 2DISA 4WF9Q 1TKXA 5BXIA 3AJ2A 3PRDA 4ECWA 1LW0A 5A6PA 3UPFA 4RPFA 2E9TA 1IBKF 1S97A 1DAXA 4AYBD 2OD6A 3RB3A 3CCQS 3FSYA 2GC8A 1NKCA 5HMYA 5L38A 1TK8A 4ZCMA 3JSMB 4DPOA 1S1WA 3IAS9 4X4QA 3RB0A 2R8KA 3PIOQ 3HMJG 5F8JA 1ZAWA 5KG2A 4ZMMA 2BW7A 4TQSA 4IUFA 1FRXA 1VRTA 2ZD1B 3SDEA 3DRSA 1NHUA 2KFZA 5KFTA 1MWZA 4BC7A 2ZHOA 3SYZA 5T14A 2XMJA 3M2VA 2CG8A 4WTYA 1CJKB 3SZ2A 4ELUA 4DL5A 2AX1A 1XJWB 3FFIB 5JVGQ 4UZCA 5K8OA 3D3CJ 1TP7A 3LUYA 4FKYA 3DOMB 1PC4A 3HHLA 1T02A 4ED6A 1FD2A 2J9DA 1V3SA 4B3RJ 3JB9k 4RNFA 1M1HA 1UW9A 4K2JA 4C0HA 3NBPB 2RDIA 3CIZA 3CDWA 5J2PB 2ILZA 4USHA 3EE3A 2BDPA 4KAIA 5GMKa 1WD6A 2WONA 3TX0A 1JXEA 4ER8A 4LF9J 2KYXA 2EFGA 1MMNA 2H65B 3B82A 4HYKA 4DUTA 5K8MA 3M8YA 2BABA 1HNWF 3T1YJ 4IRCA 3ZNJ1 2HZVA 1PG5B 2DR6A 3AD8C 2JVOA 3C15A 1T95A 4IG3B 5IQQA 2HK2A 4NLOA 3CD7A 2XCPA 2LEAA 1HI8A 1QAJA 2LFVA 2JRSA 1B7YB 4NMLA 4O4GB 3MTJA 2YNIB 4MKBA 1VHFA 4F0HA 2XSJB 3KLEA 2CPYA 2EC2A 2XB2D 3MMAB 2YH1A 3JYTB 5DZ6A 1BWEA 3D9BA 3CJQA 2DR7A 3TEHB 4KPYA 1UWBB 4Y28C 1UTAA 2CZ4A 2AJFE 2CNOB 4ZPDA 1TZ0A 4OX6A 1NCLA 3KHLA 1X4AA 1EKRA 4FF3A 2ZM6F 1B3TA 2L08A 3RBZA 3U27A 5J2MA 5KFYA 3M32B 1AB8A 2GAHC 2KJWA 3P5BP 3T5JA 1RT6B 4CZCA 3CD6S 4DV1J 4QIGA 3BR9A 2P6TA 3C19A 4DG1A 4B3MF 1NH7A 1DQ8A 4V1Ak 2ADBA 1R27B 3QT5A 4EBDA 5CCLA 4ZVFA 4CRJA 4DX5A 2XI2A 1LQ9A 2VHGA 1X4BA 4G3IA 4DL0C 4XTTA 4HKQA 5HAOA 1BQMA 1XNRF 1SIWB 1HNZJ 3R6LB 2DEIA 2CJ9A 1RAHB 5AJ3J 2XWYA 4U96A 1NXIA 4B08A 2XBPA 3I0RB 1TL3A 1XK8A 4MIWA 1VHIA 3EDQB 1UA0A 2IMOA 2HWHA 2OMLA 1SC1B 3CCTA 3M8PB 4FYXB 5J1NA 5MAOA 4DR2J 5ETOA 1XMOJ 2B9XA 3M6VA 1C0TA 2AIRB 3FBEA 5LL6d 1WF0A 4LBHA 1U45A 3AH6A 2CWKA 3MM6A 1ZTWA 4P73A 4QR1A 3LWLA 1S6UA 3OTOF 1EHWA 1TV6A 4ZVQB 4XAKA 2B43A 5KFGA 5HQMA 3AT1B 2OI2A 3EPGA 2QN6B 3MECB 1OWXA 2OEMA 1Y5IB 4YQWA 2HNDA 3CNQP 1SKRA 4QJVA 1IKXB 1XBWA 2EG2A 3IA0A 3KK1A 1M5HA 3MAHA 1TL7B 2O3DA 5HMZA 4P74A 2NUUG 2V8DA 1RQ0A 1UW4A 1HPZB 1TUVA 1ZM3A 3ZZTA 1VQ4S 3ILJA 2YKMA 3N5FA 4CYUA 1LWFB 4CI0B 2YPYA 1P27B 4TY8B 4ES2A 1YDLA 3C6TB 5M2RA 3KTQA 1T05B 4X66F 2MKKA 1N5YA 2RHSB 2JEFA 2JX2A 3WX4A 2BQ3A 2UVRA 2A10A 2IFXA 1S5ZA 1QE1B 3IR6B 1S59A 2DY9A 1TMMA 3UDCA 5ETTA 5D0HA 1FO1A 3FUYA 5LOQA 1RTZA 4EO6A 8ATCB 2OPSA 1KDNA 3VTIA 1S1TB 4BDPA 2KB2A 1LV5A 3IBFB 3HHLD 5DQGA 4USMA 1N0UA 1RLDA 4QWBA 4X64J 4OHWA 4O3PA 1UVIA 4I7FB 1T0TV 2LDYA 1BY9A 5DM6Q 1G2EA 2HNYB 1OQ3A 1CEZA 1TKTA 3CT9A 4IKAA 3ICLA 3RAMA 3WIVA 4NLQA 2K3IA 1PC5A 3W61A 2J6UA 3QRPA 4P2XA 1M90T 1H7XA 3VAMA 3MMBB 5KFCA 3HCXA 2R42A 2MKYA 3K5LA 2F4VJ 1U7LA 2Q43A 2ZVSA 4BCAA 3UN5A 2OD4A 1Y5LB 2AJ0A 4CLUA 5H9EJ 2VQEJ 1K73T 3UVJB 2J8AA 4RU2A 4GO5X 5HN0A 4AE5A 3TYTA 5DGAA 2F1FA 3NMAA 5CYJA 4K5SA 3ZTQA 5H1SV 1TKXB 2XY6A 4NXMJ 1GMWA 2VDHA 1LW0B 4M5HA 5A76A 2GIQA 2JNJA 3KHRA 2PGCA 3SXLA 1UZHA 2PIIA 3RJMB 4BWMA 3D4JA 3QJJA 3ILIA 2HHWA 4KGZB 4ZP8A 2LCWA 3EGWB 4DQSA 4DV1F 1S1WB 3G71S 4K4ZA 2Q1LA 5KFRA 3OSNA 1WSRA 3HZEA 3THVA 3MEKA 1VRTB 3SDEB 3DRSB 1JX4A 2DR5A 3GCWP 1W7WA 2CQGA 1UFKA 5F8HA 4LT6A 3M2VB 5CHCB 1QLNA 4F0MA 2N7CA 4WU2A 3SIPB 2QLJB 4B17A 2P6SA 3N6NA 4F4ZA 2H48B 1ZOTA 1R8PA 3P6YC 3HHLB 1RHUB 2ALYB 3OVAA 2AV5A 2NYHA 1HNZF 3CC4S 4P2FA 2VA2A 3GIMA 1WUUA 1X5SA 3QGGA 4BS2A 3H2VE 1MW7A 4UT4A 5AJ3F 2XHCA 4M5KA 1URNA 4ZLJA 2DGXA 1VC6A 2WONB 4YUDA 4FVCA 2QV6A 4TLQA 2ZUAA 3P45B 4DR2F 3DXSX 2AJQA 3PX6A 1YJTA 4DPYA 4FXVA 2YNHA 3I32A 4QPTA 3C15B 3GWCA 1HHTP 3SQGA 3QRQA 2VPZB 3QYYA 3Q8YA 4LRCA 3BH7B 3SV4A 2BJ8A 4C7QA 4ANCA 3KJFB 4A8YA 2G2YA 2RQ4A 4TVAB 2GAGC 5K9FA 3KLEB 2KJVA 2MKSA 2ATCB 3ITHA 4K4YA 1S0MA 4OZ0A 5BYRA 2QFIA 1WC4A 2IVMA 3NS5A 1NB2A 4B3OA 1GAOA 4X62J 2DCLA 3FCVA 3T41A 2J6SA 4BWJA 2YWGA 1IJEB 2ZOGA 1X4CA 4OZNA 2CQ3A 4OZ1A 2AF6A 2GMHA 3IG1A 4PPDA 2B56A 2GV1A 2ZBPA 3G2XA 2J6TA 3GFYA 2BQRA 5J2MB 4NMXA 2BE9B 4HHHA 4LF5J 3HX9A 1UCNA 2W7PA 5D4NA 1NNDA 4DG1B 1HW8A 3O6QA 5DDRC 2CQ4A 4Z2XA 1M5PC 2M2BA 2DNOA 1JXVA 1KQSR 2B9WA 2AGQA 5HMXA 4ZVTB 1EQ0A 3M9MB 4TNOA 3SMZA 4P10A 3D6FB 1TL1A 3G8TA 4OYZA 3KDOA 5L1IA 4L3KA 2BM1A 5DLGA 2NLWA 3FZ2A 3TWZA 3O8WA 2IM1A 4K4VA 1DARA 1BQMB 3VAHA 3HT3A 2FJWA 4YDDB 3E51A 2N4DA 1G1XA 4X64F 2WW4A 4F8RA 4DQIA 1REGX 1A6LA 3AJ1A 1RU2A 3EXCX 2I6WA 4QBUA 3M05A 3K0JA 2DIUA 1FFGB 2XYHB 5J1PA 4F2SA 2BJ7A 3M6XA 2CQIA 1YSJA 2LQ9A 3RZAA 3Q2TC 4Y65A 2KN4A 3Q86A 3K58A 2UXBJ 4CLFA 3KMQA 2Y1JA 4JI2J 3H5XA 1SC6A 2G4BA 3NGRA 1C0TB 2P9CA 3ZTRA 5ETNA 1MWYA 4CT9A 2JSXA 3T9ZA 3QFWA 3MM6B 1RTJA 1EKSA 3T6JA 2D3ZA 4NLGA 4DV0F 5EX0A 1G7CB 1HLWA 2LEBA 1DLOA 1TV6B 1R6VA 3OV7A 1JJ4A 2J0XA 4LVOP 2W01A 4FS2A 4NXMF 2WHOA 2HEKA 3MPUB 2UUAJ 4RUCA 4QIVA 2F8HA 2H3EB 3GMGA 3M8SA 2HNDB 4K8RA 1SJ4P 4HH0A 1SL0A 4NLUA 2C2OB 4LJMA 3OLBA 3KK1B 1KD1T 3R5DA 1GMWD 3VGVA 3BREA 4OQJA 3I9V9 1RAGB 2J9DE 2ACMA 2YKMB 1HBNA 1YJNS 1YBTA 4CYUB 3N0VA 2RKIA 4ZIVA 3I4HX 4DV3J 4NCBA 5HQ8A 3MCMA 1X4HA 3W60A 3IN5A 1N5YB 2BOAA 4KYZA 1WHXA 4Y3CA 4M5LA 2CPDA 4B9LA 2F3JA 4M1KA 2ZOMA 3MR2A 2O67A 1U48A 1N56A 2DGSA 3BB5A 2JWNA 1HD1A 4FPIA 2RHQB 2KRRA 4C8LA 3QRRA 4QW9A 3GFZA 4OYIA 3R7NB 2YWFA 5A0YA 1ZYQA 2BKOA 2OPSB 2QSFA 2CPIA 4K59A 4I0WA 2BA9A 4TYAA 4MKAA 3U1MA 1UL3A 1AT1B 1WF2A 1VOMA 1NK0A 4JBCA 2YX1A 3NOGA 4DQPA 3AFGA 4Z7CA 1YQHA 2HLTA 4XPCA 1TKTB 3PX4A 2PMHA 2DK2A 3OQ2A 3V4IA 5D4PA 1HQUA 1UPPA 1KBRA 1WTBA 3CCUS 4O3SA 3TANA 3D54A 2V63A 2FLNA 4DLGA 5CZVA 3G9CA 3I4PA 3PX0A 5E5NA 4QYZK 2HMIA 2OTLS 5CYMA 1CG2A 4ETXA 4W4MA 4I67A 2LKZA 7FD1A 4NE9C 2HFZA 2VKZG 3GJQB 3FKBA 4X62F 2XMKA 3A13A 3M8RA 1X4GA 4KGXB 2DRAA 2Q6BA 2UZAA 1RTDA 2JZ5A 1F1BB 4WP9A 3SSRA 2KT3A 5GVQA 5D0RA 2NZCA 2HNZA 2ROPA 3MM5A 1RK8A 4LF5F 1YRUA 4ED5A 2FTRA 2X3DA 5D0GA 4M94A 2ZVIA 2APOA 1X4EA 1X4FA 1HI1A 2WVEA 1SH2A 3VGTA 2CJQA 3UR3C 4XDCA 1HD0A 3GFXA 5CZXA 3CO9A 5HSPA 3W8PA 2QTWA 5KFAA 3ZTSA 1FRHA 1RU1A 3M8WA 1LNQA 4K4SA 2QJ3A 3OHAA 2GHVC 1EETA 1Z1ZA 2XS2A 3B6BA 5L1JA 4WYLA 4NZ6A 2XULA 4OYAA 2AZ3A 1X8DA 2DNYA 5IC6B 3T1HJ 1MU2A 3VGSA 3KK2A 2CPZA 4I6YA 2VUGA 1U1OA 4EFAC 1NMEB 1FTRA 1S9EA 4KY3A 2UXBF 4JI2F 5LMUJ 2ALZA 1FX4A 2DXDA 1RHMB 2Z4PA 2M7SA 2VIHA 2UV8A 3M8ZA 3I5BA 2YNHB 3I31A 2C42A 4ZIWA 3W9JA 3SQGB 5EHHA 4YMEA 4TU9A 4Z37A 2NXCA 2ZH9A 4WBFA 2A18A 2CQ2A 4FBUA 3DC2A 3ITHB 4RW8A 4USVA 4OMFG 3TZZA 4JI3F 3QJLA 2R4FA 2UUAF 4HT7A 2GMLA 4LFAJ 4B3OB 4DPXA 1NSKL 2DGTA 2XCAA 4LRAA 4C48A 4I4BA 4FXWA 3IG1B 2N7YA 5HVGA 1EP4A 1DTQA 1HBUA 2C2EA 3C8YA 1BUXA 5THWA 1CQNA 4URSA 1VCTA 1CULA 2WVFA 5KG6A 1SKWA 4DN9A 5DETA 4DV3F 2FLPA 4FYDA 1N54B 2UUCJ 3P49B 4ED3A 5GAGU 3T5HA 2CG4A 4LQ9A 2ZZNA 2P5VA 1WC1A 1TL1B 1JK9B 1F9FA 1U6ZA 3BPDA 1H98A 1KVIA 1HWUA 3K5MA 3PFOA 1ZZFA 3C3LA 4MK9A 3DLGA 1GTHA 2C3OA 2YKOA 2IJRA 3PKYA 2CZ9A 1OYDA 3FSIA 3R1LA 4WFAQ 4DXLA 1YZ6A 4RW4A 2FJDB 2R8IA 1RAJA 1N34J 3OT9A 3QGPA 3MFHA 3ILLA 4FXDA 3LAMA 3RTVA 2O66A 3CB4A 2K7KA 5C25A 4F3OA 1JQGA 3VGUA 3BSNA 3NAHA 1FVSA 4DR4J 1LK7A 2X1GA 4JV5F 4NYOA 3LP2A 1AYEA 2I2YA 1OJ4A 2UVVA 1RTJB 3HKWA 1DLOB 1O0PA 3RW6A 3NNCA 1X5OA 2HHPA 4LR8A 2B7CB 2BW2A 1S7HA 3ISNC 5AT1B 1XNQJ 1Q5VA 1TMJA 5IOLA 2G1DA 1S1XA 4Q44A 1VIXA 5KT2A 2DNMA 4GRSA 2HAFA 4X65J 3L09A 1IBCB 3OUYA 4NLTA 4C3MA 4XDDA 4X4TA 1FXRA 2E66A 4UOCA 2R7RA 1HBNB 2RKIB 4N5SA 4QR0A 1FRMA 3D2WA 1GFWB 2QFJA 1Q7YT 4ED2A 2K7JA 3DRYA 4OI4A 4EYIB 2OGUA 1RT3A 1M5KC 2CYYA 3U1LA 4DV4J 2DPIA 1KQGB 1T11A 5HQLA 5D3GA 3OPKA 4DHVA 3WQPA 3HP6A 3OL9A 1R8BA 5K8NA 1TAQA 2DGOA 1JLCA 1KWMA 1WSVA 4X4NA 1X0PA 1M1GA 3JQMA 5A0YB 1OIAA 2V2QA 3SQOP 3HFVA 2BYCA 4DR1F 4NLDA 4C8OA 1ITPA 1FXDA 1H3DA 4JI4J 3ZC4A 4DPUA 3DDKA 3G6YA 1U0SA 2DH8A 1FKOA 5LMUF 1SH0A 2HWIA 1S9FA 3POTA 4YY3J 2XWXA 1QSYA 2PFDA 3V4IB 1TVRA 1HQUB 2IDLA 4OYPA 2CAJA 5K8PA 2ILYA 3JAMY 1IVZA 4HACB 1GX6A 2MY8A 2X1FA 5C2CA 2ZHAA 2R7TA 1N52B 4USTA 1QAIA 1F0XA 2FD2A 3AY0A 4DU8A 4WYWA 2Y3YA 2PEHA 5KG7A 4HDGA 3RRHA 1RWVB 3CO0P 2HMIB 2QT7A 4UTGA 5CYMB 1VQ6S 2HRYA 3P96A 1TKZA 4RW7A 4HDHA 3B4MA 3HFZB 2YXLA 3CWJA 1X9WA 4FYYB 1CVJA 2H4YB 1R8CA 1S12A 2K1RA 1DJ0A 2ROEA 1FVQA 2LMIA 2ZH2A 5KTQA 2U2FA 4UUWA 1RTDB 3K2YA 2AYMA 1HWIA 5KFOA 2ROGA 4DX7A 3HULA 2DNNA 2DTJA 2VG6A 2Y9HA 3MM5B 1KTVA 2WB1D 4EK2A 3RUBL 2JFKA 1PBUA 3CJ4A 1E6VA 3RRGA 3IR7B 1LK5A 2UUCF 2MZSA 1J27A 3R7BB 4I2PA 1QTMA 4NXNJ 3CMQA 3QT8A 2IMWP 2E9ZA 3PO5A 2IM3A 4YHHJ 1WC0A 4NLRA 1WKLA 5C7PA 4KHPJ 3T6BA 1WG4A 4UOHA 3ZZPA 2YWWA 4J9LA 3PHEA 3TO8A 2NUHA 1NK9A 4P2SA 3QPIA 5I3UA 1C0UA 1T7PA 1HR0J 1EETB 4U7UD 1RB0A 2UXCF 3CE8A 1TL5A 3G8SA 3OD2A 4I1TA 1UVKA 2OSQA 1MU2B 4WKYA 4NZ0A 4CH7A 3T3FA 3HVTA 3KK2B 1SV5A 2YWHA 5B08A 1D9AA 3ET6A 3TA1A 2HFUA 1S9EB 5D6GA 2X1AA 5T7LA 2AP6A 3CSKA 3VAFA 3MHYA 3VCDA 1NM2A 1VI7A 2LXUA 3D68A 4DR4F 4DV2J 2A6MA 3A8JA 1VQYA 4C4WA 1U6FA 4HLBA 4PXBA 1U24A 2QLFB 4OZ3A 3MCOA 3CJ5A 3L95X 2CNKB 1BE4A 1ZS6A 2J9EA 4N77A 3RBDA 2PDAA 5KFIA 3LA0A 4RW8B 2VBXA 2CVIA 1S9GA 2QIFA 3OR2A 2OMOA 2GCFA 3MR5A 4DFKA 2W9BA 4ED7A 4IFYA 3TQ1A 2HZCA 1FDAA 3HHDA 3V6JA 5DDPC 3PRVA 3FMWA 5ETPA 3CULA 1HYSA 4BBYA 4X65F 2PC6A 1HBOA 4Y6IA 1EP4B 2BANA 1DTQB 1QVFR 3SV3A 1HBUB 1B0VA 3X3UA 4K5RA 4UOFA 3FRZA 3RR7A 1CULB 4V19X 2GFFA 3W5YA 1O8BA 1T9TA 4P9SA 2QA4S 3MUMP 4DV4F 5LJ5Y 4CTAA 1YITS 3KUGA 4H4MA 5HJYA 4QYRA 2LQ5A 2WW8A 2ASJA 4TXSA 2VICA 3L7PA 1FT8A 2HFVA 1YRXA 1K1QA 2V2VA 2M5YA 2KXNB 3BV8A 2DO0A 1I94J 4USWA 5KT3A 3SSSA 3MM7A 2L9DA 1MROA 5F9NA 1FNXH 1O6XA 4Y0FA 2RQMA 1DQAA 1X9MA 2VJUA 4WK1A 1GNKA 3E2EA 3DLGB 5ETLA 1KLNA 3X1LB 2F8MA 2AGPA 3BO2A 2ZH7A 2HHHJ 2KT2A 1XWLA 1UP1A 4RW4B 4QIFA 1N4LA 3SCLE 3VZIA 1GXTA 2MHEA 1H73A 2LQBA 3HT0A 3N9UC 4L6V3 5C25B 2CQPA 4G1PA 1YIJS 1BC6A 2BRKA 2HHTA 3PDNA 1FESA 3L7UA 1A7GE 5KT4A 4FVMA 4WPAA 5J2NA 3LP2B 2QA1A 5EWEA 2HQIA 4I64A 1B4SA 3GJRB 4PZVA 2AKWB 2CA9A 3R5BA 4Q7AA 3GQCA 3CW2C 3A8IA 1SJFA 1HWLA 2JC1A 3BN4A 3G4SS 3QGHA 2ADCA 2KL8A 2VKRA 1FEHA 1DTTA 1S1XB 4ZPCA 4RNOA 1FNMA 4ZVOB 2RQCA 2YKQA 4WZQA 2EFQA 2GJFA 4CIOA 2RU3A 3KJQB 3KFWX 3OUYB 4A8XA 1EQMA 3I82A 3V81A 2WSCC 2HFSA 1LWCA 2GNKA 4IO1A 5D15A 1ROFA 2R7SA 1UETA 4NRUA 3A8KA 4NXNF 1L3TA 5MLCV 2AWZA 3EM1A 3C46A 4H4KC 4KQZA 6AT1B 3TAMA 2IRXA 3JSYA 2FGOA 2MKIA 1RT3B 4YHHF 3G96A 1AW0A 4KFBA 4A46A 5D3GB 4KHPF 1T3OA 5U47A 1BWVA 2XZDB 5SUHA 5A2QY 1B64A 4U6PA 2BBEA 3ZO7A 1IBLJ 1JLCB 1ZM2A 1H6KX 3T1AA 1V3RA 2PT0A 4ZHRA 2J5AA 2E5LJ 2HZAA 4RU9A 1S4FA 4NCGB 5DQHA 4QYZJ 5DQIA 2BZ2A 5SZTA 4FBTA 4NL5A 3NCPA 3Q8UA 3S1TA 1FKOB 5KFEA 3POTB 4OZLA 1FD8A 5HATA 1J5EF 2M8DB 4CWBA 1VYAA 2EW9A 1UJ4A 3G82A 1TVRB 3G86A 5GADU 2J9CA 5HVFA 2WBRA 3R1HA 1HNXF 3PTWA 2QC3A 4R5PA 5J1EA 1GXUA 3SFGA 4NLPA 3BGFA 3R27A 2ASLA 3D6TB 2UUBJ 4Q2MA 1TKZB 4RW7B 2ZNZA 1K44A 1IKYA 3PW2A 4RX6A 4XK8C 1RWOB 1C4AA 2K1RB 1UMJA 3D66A 2YQ1A 2D3OR 2PA3A 4AUKA 1NDCA 3MWBA 2YH0A 1OS5A 2VG6B 2JHEA 3FC9A 3TZYA 2XZTB 2Z56B 4YB1P 3OL6A 1WDDA 4RL1A 2HBQB 4LBIA 3DYAA 4AQYJ 2OPRA 2PO4A 2M70A 1IBMJ 1OO0B 2C3YA 1LKZA 4I2PB 3OTDA 3T9NA 1CJUA 4DWIA 2DNPA 4O23A 1H2VZ 2DR8A 1P8GA 1VRUA 1YVFA 4KGVB 4MYUA 1R89A 1I94F 3RYLA 3GONA 3TAPA 2FYXA 2AX0A 1VQNS 1U0HA 5I3UB 1ELOA 1C0UB 2B8PA 2RRBA 2ZBIA 3KUEA 2IPOB 4OYXA 1HNIA 1MN9A 2PD1A 4C8ZA 2FPHX 2HHHF 5IZHA 3HVTB 5K20B 3FEYB 1SV5B 2PMWA 1FJEB 3GE9A 2MGZA 2LA6A 2R2TA 4N41A 4LF4J 3ET6B 1Q8IA 5GAGI 1WEZA 5T7LB 1NJIT 3HHLC 4LRFA 1IWGA 3ISND 1SVDA 3CJSA 2DGUA 4DFMA 2VPXB 1QAXA 2ZZMA 3TOQA 1SBRA 3UD3P 3DGPA 2ERRA 1PYOB 2AYGA 5LXYA 2C3MA 2V8GA 2EPIA 4PG7A 3LGHA 4MK8A 4PXCA 5F8NA 4CM0A 4EBCA 1S9GB 1C1CA 1S76D 3OR2B 3VALA 4USJC 2C28A 3Q0AA 2UVWA 2W9BB 4IFYB 2D69A 4MKYA 2GS8A 4HEA9 5KG0A 3GIJA 2VASA 1HYSB 3R3TA 3D0IE 1HBOB 4ZKAA 2IJFA 4OYMA 2ZKUA 2BANB 2HW3A 1VK8A 3U1NA 3I0SA 1X31C 4YOEA 5D8HB 2V50A 2W25A 3QT6A 3QLHA 2V2ZA 1K47A 3J7AN 2QL9B 4WXWA 3BN7A 4LREA 5FD1A 3OHBA 2N3LA 2MQOA 3MMJA 3C16A 4CTAB 3ZTOA 2KO1A 3M6UA 4KHMA 4NA1A 4H4MB 2VF3A 2V9KA 4TU7A 5EN1A 4RZRA 2CPEA 4PWDA 4P7TA 2IJNA 4D3GA 3N79A 1L3VA 3PEJA 2R8HA 3KHHA 3HSGA 4KTQA 5F8MA 1R0BG 2CJAA 2CNLB 2JEJA 3MM7B 1K0VA 5KG5A 1MROB 2MXYA 1CS4A 1APSA 3QT7A 4Q2LA 2F8EX 4LIWA 3S01A 2OEKA 3EWGA 5ETQA 2IYGA 1IR0A 2HFNA 2R7XA 3A4TA 1SQGA 2V0NA 2WCXA 1RWPB 4LFBJ 1NSQA 5K14A 4M8LA 5DGBA 1FTCA 5ETVA 3IWNC 3GYXB 4H54A 5LSOA 1KR4A 2XLIA 2OO4A 1ZA2B 2NXUA 1TUWA 1O5JA 2YWEA 5KFMA 4IQXA 1NK7A 1JLFA 4CNZA 4H4KA 2E5JA 5J2NB 4X4SA 4HI2A 1RABB 3HF5A 2UUBF 1UEKA 4OFZA 3IR5B 3J80Y 5ADZA 4W98A 1MN7A 4TLRA 3SSQA 2H5JB 1U6BA 1HI0P 1KS2A 1I1GA 4MMOA 2H54B 3MR6A 2I8EA 4R8UA 3F0NA 3UCGA 4DLEA 3BGLA 3BDEA 5KFLA 3B54A 5I3PA 4EUVA 3QWUA 3H5SA 1R8AA 2E5HA 3Q89A 4FDFA 4RKUC 4JB8B 1DTTB 1Q53A 2NXJA 2YNGA 2N4CA 1YGYA 2NQPA 3IWXA 2C3UA 2W2PP 2IA0A 2W2QP 2PE8A 2IAJA 2QYCA 4ZLPA 3V81B 4C3LA 1LWCB 1IBMF 2ZJPQ 2EK6A 1LXNA 1K1SA 3LO3A 1EX8A 4ELVA 4QIEA 4YR3A 3WBZA 3NNHA 3TAMB 3BO3A 2IHR1 2GGPA 2OSRA 4KFBB 3CCWA 4C0BA 2B9YA 3N5BA 2Z2MA 4DSFA 1KVJA 2WSEC 1NK8A 4C8KA 5B0GA 4YB6A 4ZHRB 4OIXA 2UUWA 2EFVA 1AA1B 1CQMA 1XC9A 2Z57B 4DL6A 3I56S 1YTYA 4RBTA 3QAEA 3M2RA 3QMQA 1B0PA 2ZUGA 1RAFB 3FMBA 4LF4F 3IRWP 2FZGB 3TEGA 1N32F 2B0GA 2VONA 2RMLA 1KEKA 2W7AA 3VVTA 4J5OA 1V5IB 4KT0C 5B09A 2RDJA 5GAEU 4DSLA 4J9MA 4C97A 2R7QA 1R31A 4U8YA 2HURA 4QZVB 3J81Y 2EXUA 4K2XA 3KLVA 3AQPA 3RB4A 2AT1B 4R5PB 4DR5J 5J1EB 3FK4A 3QAUA 1O51A 5CYQB 2DXFA 1ZAVA 1D3WA 2V69A 1FFSB 4CLLA 4AL6A 2XMMA 2RD5C 3RBXA 2V8PA 3KDNA 3TX8A 4URGA 3M4XA 1I5OB 1IKYB 2XMVA 1VK3A 2K8GA 2LVWA 2VA3A 3D0GE 3DN9A 2VQFF 4UOGA 4OYWA 4NLSA 4I2QA 1T8EA 3PEHA 2K3KA 3IM9A 2XC9A 4OX8A 3NCRA 2OJ3A 2FC9A 3PYGA 4CP5A 3AOBA 3TZWA 1ZPWX 2CRLA 1NHVA 3DYAB 2OPRB 2I5JA 2DGVA 1SQEA 5IWAJ 1CJUB 1YI2S 2PN6A 2LU1A 2AEMA 1GX5A 1D8ZA 4FF1A 4WP8A 1IUJA 1VRUB 3H4DA 3MR7A 3I87A 3ZZ0A 1WG5A 2C2ZB 2NYIA 1LWEA 2XEXA 2PI5A 4IH6A 4C0OC 3ISZA 2D9PA 1REVA 3AA9A 2LU2A 3R6GB 1U0HB 1IKWA 1PJ5A 4U7CA 4M5IA 4BC9A 4ECYA 4ECUA 4A8QA 4RBVA 1JIHA 1HA1A 1WACA 2IIHA 3NGKA 2UXDJ 1HNIB 1YZ7A 2BM0A 1DY3A 2U1AA 1V6HA 4L76A 1SL1A 1UVJA 5HANA 2MGZB 2UVUA 4K7QA 2XNQA 2R8GA 2KYZA 3PKMA 2ZHBA 3KXDA 3LANA 1D9FA 3KUHA 4OZ2A 4ELTA 1U2RA 5HROA 3DDIA 3BF4A 4LIRA 3DGPB 1FWPA 4CDIA 1FX2A 5KFFA 2WVDA 4IOCQ 4Y2AA 4OLPA 2W1BA 4ED8A 3KLHA 2YQ0A 1C1CB
chains in the Genus database with same CATH topology
1N33F 1EP4A 3HVWA 4U9RA 1DURA 4DBQA 1DTQA 3B78A 3QZ7A 4A8FA 2RNEA 1XERA 1WF1A 1BGXT 1HBUA 1UA1A 2C2EA 3C8YA 5THWA 1SH3A 5ITHA 1CQNA 1L3UA 4URSA 4OJ3A 2VBYA 3BJYA 3AQOA 3EUNA 3O1LA 4WFYA 1KONA 5KG6A 2B4PA 4DN9A 5DETA 4DV3F 1SKWA 1OQ6A 1VQSA 3J7Z5 2FLPA 4IRKA 5T41A 3MOZA 2VC1A 4AFFA 1V9OA 3CCRS 2ZC4A 3HKZD 4FYDA 1N54B 4HTIA 5EWGA 3P49B 3CCJS 4ED3A 5GAGU 2BE2B 3T5HA 1DRZA 3EX7B 1G6BA 4KIAA 3NGDA 2CG4A 3DHWC 3I6PA 2YKNA 1JB0C 3KKFA 4LQ9A 1FHTA 3I0SB 5C42B 4NLYA 3MEEB 4PPZA 4ICLA 3QLHB 4M95A 1JLQB 2GJ2A 2Q6CA 1U2FA 2ZZNA 4NX9A 3THTA 2P5VA 2XNRA 5K5MA 2WB4A 2CQDA 1VQ9S 1T03A 3D28A 4JI6F 3GB0A 4KO0A 1TL1B 2EBGA 4U7UK 3C6UA 1N5SA 3Q23A 1N5VA 3F44A 1JK9B 1D8YA 4RWXA 1F9FA 1U6ZA 2KM8C 3WC0A 2LECA 1JMTA 2B4OA 1H98A 1KVIA 3DCAA 2YNFA 3I0RA 2ATLA 2EBEA 4E0DA 2DRBA 1HWUA 3K5MA 1F60B 2OP5A 2ZOFA 2DNQA 3AAWB 3PFOA 5D3GA 4AXIA 4WZMA 1ZZFA 4CNYA 3C3LA 2AYBA 1FDNA 4PWDB 1FERA 1U1KA 4F4WA 4MK9A 3DLGA 1TL3B 1BD6A 1GTHA 2C3OA 2GIRA 1S0OA 3M8PA 2LYVA 3S8SA 2ZC3A 2G9OA 2YKOA 3VQTA 2W7OA 3PW4A 5F8GA 3CVKA 4KB7A 1FK9A 3J7ZT 1IM4A 3TAQA 3PKYA 1JLEB 5HP1B 3AHPA 3KLFB 4Q5VA 4Y2MA 4NZ7A 4DUYF 3BSCA 4K4UA 1KTQA 1L3KA 3MM9B 4OI3A 3FSIA 4F67A 3PY8A 3FRYA 3R1LA 4WFAQ 5I42A 4RW4A 3VQSA 3PV8A 4N47A 2FJDB 3OVBA 1NJXA 3FEXB 3CCVS 2R8IA 4JI4F 1RAJA 1K9MT 3QGPA 2HAIA 2OFGX 3MFHA 2NREA 4PG4A 3O3LA 4FXDA 2I38A 2IBOA 1FJ7A 3H40A 3LAMA 4DSKA 3RTVA 2IVYA 2O66A 2OH2A 3BQ1A 3CB4A 2K7KA 5C25A 4F3OA 4RW6A 2PSZA 3FDSA 1HBMB 1LW2B 4YR2A 4RW9B 1UFLA 4OJHA 3F73A 5AE1A 1HW9A 4YY3F 3NMRA 3TUJC 3BSNA 1U8SA 1N5TA 3NAHA 3NKYA 1L3SA 1FVSA 5KG1A 1XR5A 2R7VA 1TFYA 1LK7A 4J9RA 2X1GA 4DR6F 5K14B 4JV5F 5BYQA 4RLEA 1FRKA 1NU4A 2F9DA 2HS0A 1SIZA 3CEDA 4NYOA 2LA4A 2MHNA 3U02A 3LP2A 1T94A 3NG8A 3MECA 1JLBB 1Q7LB 4TN2A 1QUVA 3VWSA 3OJSA 2FHJD 1U49A 4F2RA 1DHMA 2I2YA 5IQ6A 1AXQA 1NJWA 2V4RA 1FRJA 2UVVA 3ZZUA 2D9OA 5KFQA 2NPFA 3MUTP 3H5YA 1RTJB 3V6KA 4A8SA 3HKWA 3LQVA 4CO1A 3KHGA 3I9ZA 1IKXA 2YX7A 1DLOB 1LFPA 4DR5F 2W8LA 1O0PA 1YJVA 3TUZC 1SXLA 4O3QA 2FJBB 5KFDA 3G6VA 4IR9A 1C2PA 3TVKA 3CD5A 1HMVA 4B02A 3RW6A 4EGLA 1FE4A 1JLFB 3NNCA 2ZJQQ 1X5OA 2HHPA 2B7CB 2BW2A 4RUAA 5IFMA 5JUMA 1HPZA 4JV0A 5JJBA 2E1AA 1RA7A 3B4DA 4OLOA 1S7HA 3T5KA 3ISNC 1FA0A 4CO2A 2GO8A 2RB7A 4HH1A 3CC2S 1U1LA 3M6WA 4O44A 2G1DA 3UWTA 2XLJA 4DS5A 1HNVB 1LWFA 1S1XA 3MD3A 1U47A 4Q44A 4MYTA 1GXLA 1WWHA 4KRWA 1VIXA 5KT2A 2DNMA 2VV5A 2KXHA 1RTHB 4KV8B 1VC0A 4EZ6A 1S49A 4TY8A 4WU3A 5KFBA 3CTRA 1RP5A 3C6TA 5C5JA 2V94A 1XR7A 2I9SA 4M5DA 5L39A 1T05A 3L09A 1U1NA 2KI2A 2RU9A 4R8UB 3LP1B 2GQQA 3Q24A 3OUYA 4NLTA 4F3MA 5IS2A 1S1UB 4C3MA 2HHUA 3M8QB 2E1CA 4DMZA 2MKHA 3EZUA 2J76E 4XDDA 4DN0A 4X4TA 1FXRA 3UFCX 3EYZA 2M0GB 2E66A 4UOCA 1S6OA 2D74B 2R7RA 4DL2A 3K5OA 3NS6A 4Y2KA 1NRKA 1HBNB 3D5MA 2ZITA 2YNGB 2YWKA 2RKIB 2FHMA 4N5SA 4QR0A 1QE1A 1VLYA 3PRBA 4GKJF 1FRMA 2GHWA 4PR6A 3D2WA 2C3PA 2C2RA 3O5TB 1QJHA 3VZHA 2N82B 1JNZB 4LFCF 1RKIA 2QFJA 1Q7YT 1U26A 4CO0A 4ED2A 1SL2A 2K7JA 3BGRB 3DRYA 5GADI 3CCLS 4OI4A 4EYIB 2IAJB 2VH7A 1Q86T 4KC5A 5KFVA 1PO6A 4QWEA 1M5KC 1RT3A 5AXMA 2CYYA 3U1LA 2DPIA 2KG1A 1TL4A 1KQGB 4MTPA 2DHSA 1XN9A 3HHKA 3EGNA 3OPKA 1ZZNA 2BR0A 2IYIA 2A3JA 2RRNA 4DHVA 4XIUA 2MY7A 3HP6A 4JYAF 4Q0BB 4A47A 1S1TA 3DDNA 1VS3A 4W90B 2LXIA 3BZQA 3OL9A 1R8BA 1HWKA 5F8IA 5K8NA 2VL1A 5HLFB 1X4DA 4B3RF 1GT8A 1TAQA 5E3PA 5KFWA 2BXJA 2BUNA 2DGOA 1JLCA 5F8LA 1SKSA 2CQ1A 3KWMA 2M4MA 4X4NA 1X0PA 4KE5A 4CO5A 5C24B 1Q82T 4I7FA 3THPA 2Q66A 5A0YB 2GGPB 2OPPA 3GSDA 1OIAA 2MQMA 4A8OA 3QWPA 2HVIA 2HNYA 2POKA 3CDAA 2QSWA 2AJ1A 3QO9B 3HLUA 2D3UA 2BYCA 1XR6A 1Y3KA 4DFJA 1HR0F 4DR1F 5F41A 4PG5A 4NRTA 4OZ5A 4LF9F 3NNAA 4WFZA 4N56A 4NLDA 1WNEA 1R0AA 4C8OA 2DHXA 3H8YA 4TQRA 3OXLA 1CPZA 2GO9A 2DJWA 2XMWA 1FXDA 1H3DA 3ZC4A 1D0EA 3W2WB 3MMBA 2R7OA 1H38A 4F4YA 3TA2A 2BOPA 3DDKA 4IG0B 3G6YA 2A1BA 2DH8A 1FKOA 4H4OB 3T1YF 2I1RA 2VFSA 5LMUF 1SH0A 2HWIA 1S9FA 3POTA 2HHSA 3IGNA 2L48A 5E41A 2ZH3A 1S6QB 1FDDA 4PXEA 2JVRA 2CJBA 4UUXA 1S1VB 2XWXA 1RA6A 4CQ1A 4ZP9A 5E3QA 3TR5A 1QSYA 3M30B 3M9OB 4JI1F 3OBIA 2YKAA 4DQQA 3V4IB 4X4PA 2HS3A 1VQPS 3FGVA 4ATNA 1TVRA 1HQUB 2JH3A 3M2RB 5IM0A 4NLXA 2QLXA 5K8PA 4MJKA 3SCJE 3J7YI 1BQXA 1TR0A 4ZVHA 2ILYA 2CQBA 3JAMY 1GX6A 2MY8A 2X1FA 2FVRA 4DDFA 2M3DA 1XEZA 2EG1A 2MZRA 1FNOA 1Y9OA 2VFTA 2QO3A 3TA0A 4WFBQ 2ZHAA 1KNZA 2R7TA 1N52B 3E01B 1QAIA 1F0XA 2FD2A 3AY0A 4DV2F 5AXLA 5KT7A 4WYWA 4O0IA 1H2TZ 4B9SA 2DISA 4WF9Q 4MIAA 1TKXA 5LSLA 1U1PA 2PEHA 5KG7A 3AJ2A 1FXLA 3DXBA 4HDGA 3PRDA 4ECWA 3RRHA 3UCZP 1LW0A 2EK1A 2E7XA 5A6PA 2HMIB 3UPFA 2LLZA 2HFOA 2E9TA 2QT7A 4JOUA 1IBKF 5CYMB 1VQ6S 1S97A 2UUTA 2HRYA 1X5PA 3P96A 3UQSA 1KHVA 1TKZA 1DAXA 2M9KA 4RW7A 4HDHA 4AYBD 3B4MA 2OD6A 1AFIA 5CYQA 3RB3A 3V4MA 3OL7A 2HHVA 1E6YB 3CWJA 3CCQS 2ASDA 1DQ9A 4LQ3A 2KRBA 1X9WA 2LEPA 1B0TA 1CVJA 1OPIA