2KH9A

Solution structure of yeast prp24-rrm2 bound to a fragment of u6 rna
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
86
structure length
86
Chain Sequence
b'MTECTLWMTNFPPSYTQRNIRDLLQDINVVALSIRLPSLRFNTSRRFAYIDVTSKEDARYCVEKLNGLKIEGYTLVTKVSNPLELE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords U4/U6 snRNA-associated-splicing factor PRP24
molecule tags Splicing/rna
source organism Saccharomyces cerevisiae
publication title Structure and functional implications of a complex containing a segment of U6 RNA bound by a domain of Prp24.
pubmed doi rcsb
total genus 15
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kh9A00
2DNYA 4Z2XA 2L9WA 1KD1T 4IUFA 1N88A 2M70A 4Y0FA 1F9FA 1N52B 3G6ES 2MQMA 2BZ2A 1H2VZ 2FPHX 2MKSA 3UCGA 1OO0B 2LMIA 1S79A 3D2WA 3S01A 5GADU 2KHCA 2XNQA 1O0PA 3IWNC 3HI9A 1FJEB 1WF1A 5GAGU 3RW6A 2RVJA 4CQ1A 3ZZZA 1VQ8S 3NNCA 1P27B 3UCUP 2MJUA 3NS6A 2M0GB 2KU7A 2KVIA 2DHAA 1WG1A 5CXTA 2EK6A 3Q2TC 2J8AA 1R8HA 5DM7Q 5LXRA 1X4BA 4QU6A 2YWKA 3UD4P 2G4BA 4LJMA 3MI7X 3CUNA 4FXWA 2CJKA 1X5SA 1G2EA 2DB1A 2RRAA 3BO2A 3U1LA 2M52A 2QFJA 3EGNA 2CPEA 2DH8A 2M8DB 2KT5A 2DHGA 4LMZA 2XSFA 1NO8A 1U2FA 1AUDA 2DIUA 2CPIA 4WIIA 4WFBQ 1VQPS 2HGLA 2KG0A 1UAWA 1VQ4S 2E5HA 2F9DA 1N8RT 2DHXA 2LA6A 3J7YU 2MQQA 2LXUA 1VC5A 2CPZA 2DISA 2X1AA 5IFMA 2LEBA 2JX2A 5DM6Q 3VALA 2CQHA 1U1KA 2AYEA 1L3KA 3R1HA 1P1TA 1U1RA 2MZ1A 3NS5A 1VBYA 2DNOA 1FJ7A 2RUGA 2XNRA 1Q81T 2MZSA 3K0JA 2ZJQQ 2LXIA 3MD1A 4QPTA 2KN4A 2MHNA 2J0QD 2DGXA 2XS5A 2DH7A 1DZ5A 3P49B 1DBDA 2GO9A 2KM8B 3MDFA 2VOPA 4F25A 2AYMA 3PIPQ 1FJCA 1WG5A 2B0GA 1WI8A 1ZZNA 2DNHA 1WEYA 5H1SV 5LJ5Y 3CCJS 1X5OA 1VQ9S 2ZJPQ 2U2FA 2DGVA 2RS8A 2MGZA 2KYXA 4IOAQ 2CPXA 2YH0A 3OW2R 2KG1A 2VONA 2PEHA 3B4MA 5GVQA 2Q79A 3CCLS 2LQ5A 1KOHA 1YITS 5IM0B 3TYTA 1U1PA 2RU3A 4TU8A 4BS2A 1S72S 5DETA 2V94A 1H2TZ 3MURP 1K73T 2E5JA 1YWXA 2DITA 2F9JA 2JVRA 2G1DA 2OTJS 4OZ1A 5IQQA 3V4MA 5HO4A 1WHWA 3P6YC 1M1KT 2MKKA 2KFYA 1WI6A 5GMKa 1YJ9S 2JRSA 2DNMA 2XS7A 4CH1A 2F3JA 2MPUA 3B4DA 4QU7A 2MKIA 1JMTA 2NLWA 4FXVA 2CQ4A 3G8SA 1U1LA 4P6QA 1RKJA 4PRFA 2HGMA 2FC9A 2YKAA 4YOEA 2RNEA 2I38A 2KXNB 1M5KC 4M5DB 2LEAA 1M90T 3SDEB 2CQBA 2UP1A 2HYIB 4UQTA 2XB2D 2L08A 4J5OA 1K9MT 3CCMS 2CPDA 2SXLA 2OJ3A 1FHTA 1R8PA 2HVZA 2KI2A 2HZCA 1PO6A 4ED5A 3VAFA 2MQOA 3FEYB 2N3LA 3ZZYA 1U1OA 1QM9A 4WKRA 5HL7Q 3S8SA 5MLCV 4OZ0A 3EX7B 1NJIT 2M88A 1X4FA 5LXYA 1VQMS 3VF0B 3LPYA 1SJRA 2AD9A 2J76E 1WTBA 3CC7S 3SDEA 3DXBA 2LYVA 4IO9Q 3G8TA 1FXLA 1WF0A 4W90B 2DNZA 1FT8A 5GAHU 2QA4S 3VAJA 1CVJA 3VAGA 2D9PA 1X4GA 2LA4A 5LSOA 3BS9A 3SMZA 5GAEU 2L41A 1DHMA 2DGUA 3MUTP 3P5TL 4F26A 1UFWA 2GHPA 2DNPA 3VAKA 2ADBA 1KQSR 2CPFA 1VQOS 1URNA 2MY8A 2JVOA 4EGLA 1FNXH 3H2VE 2DNLA 2DGWA 2N82B 4CIOA 1SJQA 3G71S 3HHNB 1X5PA 1WHXA 2EK1A 4A8XA 2CQ2A 2CQ3A 2ADCA 5DDPC 3CCRS 2CQCA 5DDRC 2DGSA 2D3OR 1WHYA 2FY1A 3FEXB 3VAMA 5ITHA 4TU9A 1YIJS 1YTYA 5D77A 2NZ4A 4TLQA 4CH0S 2CQGA 4RU2A 1QVFR 1QVGR 2M7SA 2FHOB 1U1MA 2LECA 3DLLQ 2DNNA 3I56S 4Y00A 1YJWS 1JJ4A 1IQTA 4WFNQ 1XN9A 3CTRA 3MUMP 1VC6A 3CCVS 4PKDB 1WWHA 3S6EA 2N7CA 2MSSA 2MXYA 1HA1A 3CD6S 2X1BA 2KXHA 2RT3A 1SJFA 1WF2A 1W2BR 1K8AT 3NMRA 5FJ4A 3CCSS 3CCES 2M9KA 2MZTA 3CF5Q 1KC8T 3MD3A 2G0CA 2MZRA 1H6KX 2CPJA 5CA5A 2RRBA 1N54B 1X4AA 2CQDA 2ZJRQ 4U67Q 2OSQA 2RQ4A 2DIVA 1VQLS 3L3CA 1M5VC 2WBRA 1YI2S 2CQ1A 4C7QA 1Q86T 4C4WA 3ULHA 2OIHA 5LJ3Y 2CQPA 4F02A 2MQPA 3UE2A 3THPA 2MJNA 2MMYA 3P3DA 1D8ZA 2MSTA 1X4HA 1H2UX 2D9OA 2KXFA 2MQLA 1VBZA 1YHQS 1HL6A 5EN1A 5IM0A 1OWXA 3NNHA 3G9CA 2OSRA 3VAHA 3IRWP 1KOOA 3R1LA 4WF9Q 1RK8A 2AYBA 1VBXA 1UP1A 4TU7A 2DO4A 2XS2A 1YJNS 2DGOA 2MB0B 5D78A 3CC4S 1FO1A 3RW7A 3I55S 2DGTA 1VQNS 2MQNA 2FC8A 2CQ0A 3CC2S 3MUVP 2U1AA 1VC0A 5CYJA 1ZH5A 4YB1P 4IOCQ 1SXLA 2MZQA 4YUDA 1U6BA 4WFAQ 1D9AA 3LQVA 4V19X 3BEGB 1OIAA 2ERRA 3CCQS 3R27A 1WELA 3H2UB 1WEXA 2E5IA 3UCZP 2RS2A 1DRZA 2OTLS 2LCWA 4ERDA 1U6FA 1VQKS 2MKHA 2M8HA 3SXLA 2MGZB 1U1NA 1JJHA 3JB9k 2X1GA 2QEXS 2E44A 4PR6A 1UW4A 2DK2A 1ZZFA 2K3KA 3Q2SC 1Q7YT 1U1QA 2DNRA 4ZKAA 5LSLA 2MKCA 2K8GA 3U1MA 1WEZA 2N3OA 5JVGQ 3EGZA 2KM8C 1SJ3P 3S7RA 1M5OC 1PGZA 2KRBA 1X0FA 4W92B 1A7GE 2MZJA 5DDOC 4C0OC 3MOJB 4LIRA 2CQIA 1WHVA 1B7FA 2LKZA 3N9UC 2J0SD 1X4CA 2X1FA 3CXCR 2I2YA 3CMAS 2VOOA 1VQ5S 2VODA 3NNAA 1JJ2R 2M4MA 1A9NB 3CULA 1WG4A 1VQ6S 1OPIA 3J7ZT 3CMES 2BOPA 2MY7A 3TP2A 1HD1A 2DHSA 3CPWR 2DH9A 2CPYA 2O3DA 1M5PC 1BY9A 3THTA 2KRRA 2CPHA 2DNKA 3UWTA 3G4SS 2A3JA 3TO8A 2HGNA 2MYFA 3UD3P 2DGQA 1NU4A 5DDQC 2M2BA 2E5GA 3PIOQ 3US5A 3BO4A 1VQ7S 2DNQA 1X5TA 3BO3A 3VAIA 4WCEQ 2RQCA 2JWNA 1HD0A 4UY8T 2DNGA 1SJ4P 1Q82T 3CCUS 1X4DA 2YH1A 2EVZA 5JVHQ 2AYGA 5BJRA 2PE8A 2DO0A 1X4EA 2YTCA 4QQBA 3G96A 2KH9A 3MXHP 2MKJA
chains in the Genus database with same CATH superfamily
2WW4A 4A8OA 4ZN1A 3TAMA 2FZGB 5IT0A 5KFSA 3UNGC 3PHTA 2HNZA 1TR0A 2M70A 2RQMA 2YKPA 3CMQA 4Y28C 1M0SA 4AQYJ 1N52B 2V68A 2HBRB 4FYDA 1UVIA 4QIWD 2FPHX 3GJRB 2KB2A 1ITPA 5EWFA 3D2WA 2LMIA 3IR6B 1VRUB 3GIIA 5J2MB 3KLEB 4EBEA 4DPWA 3I6PA 4JP8A 2ZH7A 4FPIA 1SQFA 1SL0A 2KFNA 1QAXA 1ZBTA 1SIZA 1VRTB 2GJ2A 4DX8H 4QW9A 3A8EA 2XHCA 5IT9U 2IAJA 5D4PA 3RW6A 1I6JA 1HMVA 3PFEA 4CQ1A 4DR6J 1UZDA 3Q22A 1VQ8S 4WPAA 5H9EJ 2KL8A 3JSYA 1U02A 1RWVB 2XEXA 3D0IE 1R3NA 3HSGA 1RAJA 3EGWB 1P27B 5KOWA 4A8SA 1CBKA 2MJUA 3PCOB 3KLEA 2R3VA 1S1UA 1S97A 4FF2A 3A1YG 4FF1A 2DR7A 4P74A 1RCOB 1JJCB 2KVIA 3BQ1A 4ZVQB 2DHAA 4ZVUB 1FEEA 3OXLA 3H59A 2C3OA 3VZIA 5IV3A 3Q2TC 3GYNA 3BGFA 5B0CA 1R8HA 2BJEA 3AXMA 4RNOA 3MTJA 5C2GA 4QU6A 2YWKA 2VQFF 3ADAC 3UD4P 1T03A 3DLHA 2GQ2A 2G4BA 1J5EF 1L3SA 3OFEA 3CUNA 3MECA 2HG4A 2IRXA 4ZLPA 1VDHA 3BO2A 1I94J 1RXOB 3RRKA 1FRIA 1BQNA 3DI6B 1S9FA 1JLEB 1FTRA 3DDKA 4IFYB 1YQHA 2Z2MA 4FN5A 1T9TA 2J8SA 3TQEA 3KJVB 1I94F 3GR0A 2J9DE 2KT5A 2DHGA 3OTEA 3ZTQA 4M5MA 4ZP7A 1U2FA 2CPIA 3PYGA 2XWYA 7FD1A 1VQPS 2HAIA 3ILIA 2CA9A 1HBNA 2KG0A 1ZA2B 3KYLA 4HACB 4QYRA 2ZOMA 4CLZA 5DQHA 5KFHA 3QGPA 1HQ2A 4ZLNA 4TY8B 2F9DA 1A0OB 3A4TA 3OL6A 4IR1A 1CEZA 2JC1A 3G8QA 4LIWA 4P2XA 3TQ1A 2COLA 4YR3A 1AB8A 2B5JB 2CPZA 4U8VA 3RB4A 1XMQJ 2E66A 1B0TA 1JLCB 2GMHA 3OTDA 4DR5F 2R7UA 5DM6Q 5F8JA 2GVDA 2K7JA 2Y0SD 3IR7B 4TN2A 4DSFA 2W24A 4PQUB 1VS3A 2L3MA 3M8PB 4NYOA 4PAAA 5CYQA 4FS2A 4N41A 3QATA 1RWUA 4X84A 4NMLA 5J2QB 3KNGA 1YZ7A 2RILA 2HHQA 2VQEJ 3LGMA 5B0FA 1T02A 3I0RA 3SZ2A 2MLZA 5HSPA 4K2XA 1QLNA 2OLWA 3PW5A 4QIGA 5IC6B 3G82A 3SQOP 5BXIA 3D1QA 5KFUA 1JLEA 4B3SJ 4L75A 3K0JA 3UVJA 5DO2A 5D15A 4Q2LA 1VYAA 3MD1A 2BJ1A 2OD6A 4USVA 1X60A 1VR6A 2MHNA 3BGOP 4LSNA 5LL6d 3M8SA 2WONB 4AL5A 3I4HX 2DH7A 4ZDNA 5C42A 2IY5B 4B9UA 2VIHA 1TP7A 4YB7A 3H42A 2MEWA 2IJFA 4FDFA 1RCXB 5JXSA 3A12A 1RA6A 1GMUA 2W2PP 2UUAJ 3I0SA 4OV1A 3ENVA 3HVWA 4DL7A 1MU2B 1U2CA 1U0SA 4PEOA 4UOFA 4P2SA 1BHNA 4XPCA 2YQ0A 3ZFVA 3PIPQ 3QJJA 1FDDA 2EWHA 2NPFA 2JEIA 4GVBB 4RLEA 2M3DA 4UOHA 4HR2A 3KLHA 3QMQA 2R2RA 4ED6A 5H9FK 4DR4J 5IXUA 4N47A 4K4VA 5U47A 4NZ7A 1HR0J 1WEYA 5H1SV 3L4BC 3MEEA 5KT2A 2GFFA 3D6MB 3H7HB 4K4SA 3CO0P 1LFPA 3BQ0A 1T9VA 3ILJA 3C6UB 4WIQA 4Y65A 2MGZA 1VQ9S 1HBUB 3OPKA 2KYXA 3MMAA 3SSQA 2GIRA 3C15A 1RTJB 1S4FA 8ATCB 2BM1A 3M8WA 1Q53A 3PNIA 5FLXY 1M1GA 1RU2A 3T1AA 1X8DA 3R5JB 5E41A 1RTZA 2Q79A 1CULA 1PG5B 4DPUA 2J9EA 1AW0A 2RU9A 4NYZA 5DLFA 2LQ5A 5D0HA 3C14B 2XC9A 2R8GA 5IM0B 4P2FA 3TYTA 3JSMA 1IR1A 4ECWA 5KFQA 1V9OA 1BQMB 1OYDA 4C98A 1C0TB 1JNRB 2IM1A 2OPQA 2RU3A 2FUG9 1CS4B 4N8OA 2FIUA 5DRKA 5DETA 4GC7A 3HJFA 5KFWA 3QQCD 2OPSA 2E9TA 1YWXA 4Q0BA 2OO4A 3O44A 3I5BA 2EI5A 4TVAB 2F9JA 2XZTB 2FZCB 1HWLA 4HI1A 4LBIA 2W2QP 2G9OA 1NZ8A 2VDIA 1DARA 2YWEA 4O44A 5IQQA 4WTOB 4UUXA 1RLCL 4OYPA 2XMMA 5E0OA 4MIBA 3UNYA 2QO3A 5HO4A 1SL2A 3RR7A 4WZQA 3Q86A 1XMBA 1D3WA 3Q0AA 2IYGA 2QA1A 2H51B 4OZ2A 2KFYA 4UY85 1WI6A 3SBMA 4KO0B 3R7BB 1BWEA 3CJ8A 2DNMA 2XS7A 1FX2A 2YKNA 3D0HE 3UN3A 5E3QA 2NYIA 2W4DA 2BE7D 2F4FA 2V67A 2WOMB 2ZD1A 4JBCA 4DLGA 4NLXA 3J7AN 4QU7A 1SKRA 2MKIA 4CLSA 3VR1A 3GU0A 2EKYA 3MPWA 1DLOB 3CJKB 4YR0A 3QJLA 1GTEA 4DR6F 3KLFB 1OY6A 3BB5A 2R8HA 1F6TA 3G6YA 4F4XA 2LLZA 2K1RA 3EWGA 3IWLA 2OHDA 4LF9F 2KXNB 3M05A 3VGUA 1FJGF 4M5DB 3K59A 3HHLA 4DV1F 2LEAA 1UJ5A 2UUCJ 2UV8G 1XIQA 3DRYA 4ZP9A 4DUZJ 1FKAF 3AAWB 1K1QA 3BDPA 3B78A 1F3VA 1OYEA 2UXCF 1RBAA 2FJBB 2L08A 4KB7A 3C66A 1WOSA 2SXLA 4YR2A 1OY9A 2V2VA 3FQLA 4PYDA 1GK8A 4BHQA 1FHTA 4KH1B 2DXFA 1HWKA 4CLYA 2LDIA 4L74A 2QL7B 3UVJB 2IVFB 4MKYA 2AEJA 1NK0A 4Q43A 3N5FA 3ENQA 3FDSA 3G86A 3D4JA 4LBHA 4OX9F 4ZVFA 4BWJA 3ZZYA 4C3KA 4A8MP 4NXNF 3BPSP 3UI3A 1ZA1B 3ZZTA 3GB0A 1FA0A 3PW0A 1HNZF 4HT5A 3M32B 2OKQA 3D54A 3Q83A 5MLCV 2XMVA 4DQQA 2BQ3A 4N77A 1NJIT 4PUOA 2KZMA 2Z2YB 2VC0A 5KT4A 4DHVA 3LPYA 1DTTA 2AD9A 1HYSA 1FF2A 3SDEA 2LYVA 4QIEA 3DM2B 4ZVOB 2EG1A 2ACYA 1FXLA 4W90B 2VDHA 5C42B 5HQLA 3QT5A 5A76A 2D9PA 4QR0A 2HWIA 3LP2A 3BS9A 3GSIA 3SEOA 2C2DA 1NK8A 1T94A 2VJVA 5EX0A 4DUYF 1QSSA 1NHUA 2AJFE 1WD6A 1UZHA 2AZ3A 2R4FA 1Y00A 2QTWA 2V8PA 2VUGA 3BZQA 3IP0A 3NOGA 4X66J 3U1NA 3P5TL 1OQ3A 3OV7A 4F26A 4ZCMA 5MAOA 1UFWA 4QPXA 2DNPA 2PMWA 4P7VA 1N4LA 4OHWA 3MR2A 2CADA 1URNA 1R0BG 2Z0GA 2JVOA 4KV8B 1UWBA 5FD1A 3AA9A 2E29A 4K50A 4KY3A 3KJVA 1G2EA 1K0VA 1FNXH 4NLUA 3J81U 4LF5J 3QLHB 3LGHA 2EFQA 3CJ2A 1S4EA 1XWLA 4I7FB 3W61A 1N6QA 2HMIA 2EK1A 5F8NA 4JI0F 4B3MF 3F56A 4NZ6A 4I6WA 4B3SF 3H5YA 3CCRS 5J2NB 3KK2B 2CQCA 1OY8A 2DGSA 3PYDA 1YSJA 2D3OR 2ZZTA 1QUVA 2FY1A 1FK9A 1HLWA 3AOBA 2QLWA 3FEXB 3TUIC 5C2CA 5ITHA 4TU9A 4A8WA 3M7VA 4DFPA 3BPDA 3C6TA 2AKWB 2AMCB 2YWGA 3PKYA 4J9MA 1SC3B 4DX6A 4A47A 4CH0S 1LOUA 2CQGA 4WE1A 1J5OA 1HBNB 1V5VA 5ETLA 4RW8B 1NZAA 2BJ3A 3GR1A 4WYLA 2M7SA 1TL1B 4ECZA 4DQIA 2RIJA 2V2KA 4OHYA 1LXNA 1F2GA 5KT3A 2ZBPA 2DNNA 2FLNA 2DCUB 1Q8IA 4Y00A 1YJWS 3GFYA 4QZVB 4DF8A 3D67A 3M6XA 2Y8WA 3PJXA 2B43A 3MUMP 2UU9J 1GXUA 3O5TB 5FDLA 1XR6A 1BQXA 3GG1A 4DWIA 1ZOTA 1FEHA 4K0KJ 1EARA 1HQUA 1HQEB 5KAKA 5L9XA 3I32A 2R42A 1SJFA 2FHMA 1HIYA 2W9CA 4M5GA 1K8AT 3SSRA 3NMRA 2UXBF 3P8BB 4I0WA 1ZAXA 2MZTA 2BOAA 3OFGA 3BKTA 5C25A 5HMWA 1EKRA 3CJSA 2OI2A 5HI7A 3SFGA 4NRTA 8RUCA 5K9FA 2XY7A 2VG6A 4MK8A 4YEAA 2KT3A 1EHWA 4DV6J 1RDRA 1N36F 1WDDA 1NAQA 3PKMA 4I67A 4AL6A 2XMUA 4U67Q 1U24A 2ZH6A 2UUCF 2J6TA 4N76A 3EVOA 1DQAA 1KFSA 1JLAB 1M5VC 2CQ1A 4U7UK 5LSRA 1S5ZA 3K57A 2BJ8A 4C7QA 4ECUA 5LMNF 5HLFA 4RW7B 1Q86T 2JLEA 3TJ8A 5THWA 3T1YF 1RADB 3I5CA 7FDRA 4MK7A 3KHHA 3MCOA 2AJQA 3GE9A 2CQPA 3ISZA 3DLEB 1SL1A 5AE1A 2MMYA 3P3DA 2IYIA 3EPIA 2P5VA 2BMBA 2RB7A 2W8LA 4A46A 1X4HA 1H2UX 3R5AA 3PEHA 5KFPA 1RT5B 1IXKA 3I9V9 1LWEB 4EO6A 4FYVB 4LF2A 2R7VA 2GA7A 2LFVA 4ED3A 5IM0A 5EN1A 4I7FA 6FD1A 2Y1IA 2NS1B 3RR8A 2BE2B 3NNHA 3G9CA 1JLFB 4K7QA 3RRHA 1RT7B 4MYTA 3R1LA 3W2WA 3K2YA 3FCWA 4AXJA 1RAIB 4ZVHA 4RNMA 4DV5F 1CQMA 1UP1A 2DO4A 5K8MA 1Y5IB 2VG7B 3DFEA 4C6AA 2VFUA 2XS2A 4ETXA 2N4DA 3EZOA 2PIIA 1W25A 4HL9A 2CJQA 3MM6A 4OV6A 3D6FB 5D78A 2CKWA 1R0AA 3CEDA 2CQ0A 4Z37A 3MUVP 2U1AA 4P73A 3IM8A 5CYJA 5LMUF 1IKVB 5JUMA 1NKBA 1XNRJ 1SXLA 1YZ6A 4WFAQ 4FNIA 2HW3A 3LQVA 4V19X 2HFOA 3KG4A 2HIQA 3HKZD 1S57A 4NLSA 3MR7A 1S6QA 4CLKA 3KJQB 2DBBA 4F0KA 4N56A 4WBFA 1IBLF 3R27A 2HMIB 2AJ1A 3HVTA 1WC3A 3MM8A 1JQGA 1RABB 3SCIE 4U7CA 3CJ5A 4FBUA 1IKYA 1WC4A 2E5IA 2EFPA 2B6AA 2GJFA 3AHPA 3UCZP 1DRZA 2OTLS 2F1FA 3M1VB 4ELTA 4M5NA 1U6FA 1FWLA 1FRMA 2UUAF 2D1CA 2M8HA 1OSCA 3WZ0A 3LP1B 2V2QA 2C22A 1IKXA 3VZHA 4KC5A 2QSWA 3HKWA 2E1MC 2VFSA 3Q8VA 3JB9k 2FJWA 2P9CA 1RKIA 4E2FB 2WVFA 4F3QA 1X9MA 2W8KA 3KHRA 2YXLA 2B7BB 4OYIA 4KHPF 4PWDB 1KVIA 2YBVA 2JHEA 4YFUA 1V5IB 3MOZA 4IO1A 5C7PA 2BJ9A 3KMQA 1RP5A 4NCGA 4PQAA 1ZZFA 3NLCA 2QV6A 4LQ3A 1JWWA 4JI5J 4X4QA 4F0HA 2ZH9A 3MM8B 5CCMA 3DOKA 5HJYA 1WC5A 2IBKA 4FPRA 4FKYA 3AB4B 1KHWA 4M5DA 4QIVA 4DLEA 2BDPA 4G65A 2FQQB 3D0GE 4FVMA 4WWSA 2KM8C 5ETQA 4O23A 5ETNA 4PUOB 3JTOA 2GIQA 3HF5A 2HQCA 3JSRA 2ATLA 1R0CB 1XMOF 2R7OA 2GGPB 3CT9A 3S7RA 2XCPA 4KH0B 1HBMB 2OUGA 2QMXA 2XLIA 1X0FA 1A7GE 2MZJA 2VPWB 4ZLLA 5L46A 5KG7A 3GFZA 2CQIA 4HACA 4K2JA 5AXKA 3N9UC 1B7FA 4DS4A 3IWXA 1KQFB 1GH8A 4OZ5A 1S49A 4USJC 4U6PA 2NXNA 3CMAS 2CUYA 5IT4A 3R3TA 1T9XA 1UA1A 1F0XA 2FJAB 2JSXA 4UZCA 4G1IA 3PX4A 5DZ6A 2VODA 4DFJA 2RKIB 4RPFA 1URRA 3DI6A 4GVLA 4NXMJ 2R7XA 1HNIB 2V9KA 2FD2A 2CIMA 1OPIA 4QWBA 1D9DA 4U96A 4RO0A 2A1BA 3VV2B 3TP2A 4ZITA 5GAHI 1C1CA 1TTHB 2J7UA 3M2RB 1XK8A 1BQMA 4TQSA 3HD1A 3FBCA 3HM9A 1M5PC 3THTA 2JZ5A 3TA2A 2ZHBA 4MK9A 4DS5A 1HWUA 2PFDA 2Y1RI 3DC2A 1Q0NA 4LBPA 1HHSA 3NAIA 4TYBA 4Z7YA 3OR2B 1CSJA 2KO1A 3H40A 2E7VA 2UVWA 2MYFA 1FKPA 3C16A 3UD3P 4JV5J 4MTPA 4DSLA 2ZFHA 1UETA 1RBLA 3DRXA 4IG0A 4OX6A 2M2BA 5AXLA 4USHA 3PIOQ 1RWOB 2P6SA 3BO4A 2JC0A 1KLMB 1ZM9A 3KUGA 3RAXA 3EXYA 1U8WA 3M8QB 3BO3A 2ZWPA 4EEYA 4WCEQ 1KWMA 3N4WA 4FF3A 2E9RX 4JUZA 2XCAA 5K8PA 1X9WA 2DNGA 3DMJA 4F4YA 4KRWA 2JEJA 4IDKA 4JYAJ 2B3TB 2ZHOA 1X4DA 3EJMA 4KGZB 5I3UA 2DPIA 1VGYA 2ASLA 2PD1A 4X4NA 3OD2A 1WC1A 5F9LA 2WHOA 2VG6B 3PHEA 3RYLA 2UVVA 4DV2J 3CO9A 4F2RA 3BR9A 2YTCA 1ZM4A 2P2CB 2KH9A 2GJIA 4KE5A 2RD5C 4MMOA 2DNYA 2VKRA 5A6WA 3QRQA 4Z2XA 1YJTA 2R8KA 1G7CB 4QCLA 2ZOGA 4DR7F 5C5JA 1NPPA 4Y0FA 4OX8A 1QE1B 2DEIA 1EJ7L 3ET6A 2HNZB 1PC4A 1U48A 3G6ES 3OFHA 1HQEA 2BZ2A 1H2VZ 3UCGA 3R97A 1NM2A 1OO0B 1RHKB 1S79A 2QMUB 4FKXA 1BLUA 3MMCA 3S01A 4OX7A 1JLQA 2R2TA 3AQOA 4JI6J 2XNQA 1GMWA 2BJ7A 1UPMB 1KTQA 1XBWA 1Y11A 2HHPA 3IG1B 4OYOA 4URSA 4HYKA 4KFBA 3HI9A 1WF1A 3D7SB 3BSAA 3TA0A 2QT7A 3OL8A 3BN7A 3ZZZA 4EFAC 2GCFA 1FX4A 5B0AA 3NNCA 3H20A 2CXEA 1Y0HA 1JLBB 2HQIA 2IC3B 4M5HA 1DJ0A 3UW1A 2HHTA 3QPIA 2FVPA 1Q1KA 2IDEA 2C3YA 2HS4A 3KDNA 1JLGA 3MCNA 4NL5A 4R25A 3KLGA 3UCUP 5KFCA 2NYHA 3MM7A 2WB4A 4J9SA 3CJTA 3QRRA 3HVTB 2RH3A 5CXTA 2EK6A 1HNWJ 2GV1A 4G1PA 2BW2A 3OR1A 4QJVA 5DM7Q 2O66A 1TK5A 2DPJA 1NNDA 4EI2A 1CJUA 2RHSB 1UEVA 2QJ3A 4WU3A 3NXZA 3UDEA 3LA0A 3MI7X 4CO3A 4CYUA 4LSNB 4RNNA 1X5SA 1H3DA 3NAHA 2ZVIA 5EGYA 4K4WA 2RRAA 2CJKA 2HZVA 2UUBJ 3U1LA 1X0PA 3KK1A 1VHIA 2WSCC 2EG2A 1R43A 2QFJA 3CD7A 4USTA 3V6HA 1R0AB 4E98A 2W25A 3EGNA 2IVMA 3KLIA 4LQ9A 2CPEA 1FKOB 4DOZA 4KV8A 4DN0A 2YNHB 1RT1A 3WQPA 3K5NA 1FRHA 3NEKA 1RAFB 2I1RA 4PWUA 1RBOB 5DS7A 1AUDA 2IIHA 2RMLA 2EFOA 3A8IA 2AGPA 3OTBA 4OI3A 2HNYA 2HGLA 4GKKF 1FRKA 3MPVA 5KTQA 3T19A 1T05B 3TVKA 2DHHA 5HAOA 3OLAA 2DHXA 5J1EB 2AWZA 2HRTA 1UEKA 3IAS9 4K4YA 1GMWD 1TL5A 3LP0B 1VQSA 2LXUA 3DRPB 3V81B 2CNLB 4NWBA 4H4OA 3WX8A 2X1AA 2LEBA 3RB3A 2IRUA 1FFSB 3BH7B 3K8WA 3D66A 4F8RA 3VALA 1S1TA 3DRRA 2VH7A 3GPAA 5HBMB 2ZH4A 1U1KA 4LFBJ 4AL7A 2B9EA 1YJUA 2R2UA 2R7SA 4BC7A 5K20B 2AYEA 2FLOA 4L3NA 1L3KA 2BRKA 1P1TA 4MIWA 1RT2A 3HPOA 1VBYA 4GKJF 1BUXA 1U0HA 4JI3J 4J9LA 1WKKA 1N56A 3VWSA 4FF4A 2DNOA 4NLRA 5KOXA 1VISA 1YVFA 1NKEA 2AGQA 3PW7A 2OPRB 2XNRA 4GKJJ 8AT1B 2NXCA 5HLFB 2YX1A 3GV5B 1G1XA 2QLFB 2MZSA 3OVBA 3M9OB 1RTIB 2IHR1 4CNZA 2G13A 4LVNP 4CNYA 4DR3J 1NH7A 2ZUAA 1MROB 3BGRA 1QSYA 2F8HA 1T9YA 1RQ0A 5E3CA 4LRFA 3ZTRA 1JLQB 2F4VJ 4O3PA 1LWCB 4X4UA 1DBDA 2ZC3A 2GO9A 5DG8A 4PABA 2YNFB 1RWXB 1Y5NB 4MFBA 1H73A 3TI0A 4OYAA 4ELVA 1YRTA 2ZZNA 1FI4A 4BDPA 2FHJA 2DD8S 3DRSA 4LUBA 2AYMA 4C8ZA 3HZGA 1MWZA 1SH0A 2IMOA 1LW2B 1FJCA 3UWTA 4ALZA 4JI4J 2IM0A 4DV4J 5I42A 1ZZNA 3J7YI 4KJIA 1FERA 1Z2LA 2DNHA 4FP9A 3CJ0A 1HPZA 4IDKB 1HBOB 4OZ3A 5E3RA 2YKQA 1HW8A 2ZJPQ 2JEFA 1NSKL 3Q8QB 2DGVA 2RS8A 2XULA 2K7KA 3G2XA 4A4JA 3M8QA 1RWWB 5L1KA 3OW2R 2VONA 1FXRA 5CYMA 4J9UE 2DR6A 3ISNC 2C2OB 3ZZPA 5M2UA 4TXSA 3CCLS 3O8WA 2V2ZA 4CTAA 1KOHA 2XG8A 1WDTA 1SKUB 3MPDA 2V8GA 3TZYA 2V4QA 3ZNUA 4TU8A 3M2RA 4JYAF 2Q1LA 3FJ2A 1S72S 3N6LA 4H4OB 1AUSL 1Y10A 2V94A 4DN9A 1VFJA 4WK3A 2E5JA 4ATNA 3FFIB 3D9BA 3C14A 2G1DA 3BSCA 3PW2A 4PG7A 1YGYA 2GMLA 4OZ1A 3UQSA 2GIFA 1HNWF 3FK4A 4CO2A 4YHHJ 3LOUA 3HDSA 5JMNA 1Y9OA 3AOCA 4TNOA 5IC4B 2PA3A 4AFFA 4KKOB 1YRXA 4NLVA 3UDLA 1CC7A 4B02A 1M1KT 4I2QB 1PJ5A 3IXQA 1SBRA 1UEUA 1TAUA 1FKOA 4OYMA 4WK1A 3IS9A 9ATCB 3P4UB 3OVSA 4O0NA 1W2IA 3KLIB 4J9KA 5D3GB 3OL9A 3EZUA 3PR5B 1KONA 1JMTA 3ETOA 4FXVA 3AQPA 1DY3A 2CQ4A 3G8SA 2LVWA 4NA1A 1LWXA 1L3TA 1RT6B 4P6QA 1RKJA 2HGMA 2FC9A 1NKCA 2RNEA 3G87A 2I38A 4TY9A 4UOCA 4YN3B 4ECQA 4DUTA 4ELUA 3OR1B 3A3OB 3IM9A 5ETKA 1C1BA 3H25A 2QZ8A 4DSEA 1VBKA 3PFOA 2HBQB 2UP1A 3E01A 3OUYA 4NCAA 5EHHA 1FESA 1S76D 3QO9B 2R2SA 4OL8A 1K9MT 1H0HB 2CPDA 3IBWA 3MZIA 4HLBA 5D4LA 3V6KA 3CE8A 4U95A 3H2LA 3OTOF 2FJXA 4X66F 1R8PA 4ZCIA 4X64F 3KTQA 2WAQD 2R7RA 4PXEA 2EC2A 2EC0A 2B8QA 4NX9A 2XMJA 4L3KA 2PT0A 2F5GA 2OGUA 1U1OA 4RX6A 2HQGA 2I6WA 3UDCA 2XMWA 1S1VA 3IA0A 3NGDA 4WKRA 1H98A 1AROP 2BV3A 3IG1A 1EETA 3T6BA 4BBYA 3L95X 3EX7B 3JYTB 1YBUA 2QIFA 2PEBA 5CYQB 4CT9A 3M8PA 3VF0B 1AFIA 2VV5A 2J76E 3ITHA 2VHGA 3JAMU 4J9OA 2EEYA 1RA7A 2OEJA 3DXBA 3G8TA 1NK4A 3QFWA 4GKKJ 1EP4B 4G1QA 3AD9C 1JLCA 1KVJA 1WF0A 2DNZA 4RBUA 1V3SA 4X65F 4ZJOA 3QWUA 4OI4A 4ZVTB 3VAGA 2FJVA 5KFBA 5LSOA 2XLKA 1U49A 1HNVA 2JOQA 3NCRA 2GQCA 3RGIA 4F3MA 3Q8RB 4YDDB 2L41A 1EAYC 4NI2A 2VPZB 3PM9A 3IFEA 3JTNA 3MGJA 2C2ZB 4NLQA 3I31A 2V8VA 3UN5A 1ICEB 3GONA 1JXEA 2N4CA 3BBBA 2YWWA 1KQSR 4FVCA 1IKWA 1LFWA 2VPXB 2ZEJA 3BN4A 3M2VB 5A8KB 1RLDA 2BE2A 3W65A 4DL0C 2D3ZA 5E7OB 3HHNB 1WHXA 1NPKA 2WSEC 4CH7A 4DEZA 5D4OA 3ELHA 4HDGA 4CI0B 5DDPC 2ZH1A 1KRPA 1UPPA 5AJ3J 4ECSA 2HFUA 2NPIA 1XTZA 1G3OA 3HXMA 3VAMA 1J2VA 4F36A 1GQEA 3HFZB 4KAIA 5D77A 3TEHB 3CDWA 3IGNA 3OFFA 5F0UA 1YLXA 3V6DB 3V4IA 1ACMB 4Y2MA 3R5DA 3OL7A 4OJ1A 1NEEA 4X4PA 4UZBA 4RU2A 3T5KA 4O3NA 5ETVA 2I9SA 2YPYA 2FHOB 3DLLQ 4HTJA 5A8WB 5J1PA 3I9ZA 3BM7A 4B17A 2Q6CA 4XDCA 1N5YB 3TUPA 2IFXA 4ZLJA 3W3SA 2GW8A 5CD4H 4Y6IA 2AF6A 4JV1A 1Q4RA 1XN9A 3LWLA 2V63A 5BYQA 3PR4A 4NXNJ 2IVYA 1B99A 3CDBA 4RWWA 4F7VA 5C25B 1PBUA 2AQ4A 1N33F 4NXMF 5F3TA 3DRSB 2RT3A 1WF2A 4EYIB 3FRYA 4IG3A 1ULRA 1B0VA 2G2YA 2V4JB 2FTRA 3G6VA 1W2BR 4A8FA 1Q8LA 2F8MA 1P9QC 2M9KA 3TAMB 3CF5Q 4UUWA 2Y3YA 2VFVA 2MZRA 3MD3A 3M9MB 2A6OA 4ETZA 4DUZF 1DTQB 4H54A 4EBDA 2HHXA 1KS2A 2F8EX 3FEZA 5CA5A 2P8IA 3HMJG 2NCKL 1S12A 2YY3A 2FY8A 2UUTA 5D8HB 2BW7A 2R7TA 2OFHX 2ZNZA 2DIVA 2KKHA 1F2HA 3L3CA 3PW4A 1IKXB 4QIFA 5KFMA 5D0RA 1YI2S 3EXCX 4M63A 1U09A 3HFVA 1SH2A 4CO1A 5KFNA 2PMZD 4HHJA 4RKUC 4CZCA 4C4WA 3Q24A 2OEMA 2V0NA 3OHAA 2HQDA 2IJNA 1H7XA 4LT6A 1Q5YA 3NS7B 4CWBA 1N5QA 2AX1A 2JEGA 1NH8A 3OUYB 3GP9A 3N6NA 1NJYA 1ZPWX 1L3UA 4L73A 4L76A 3GJQB 2EW9A 2C2KB 4F02A 4C48A 3DCAA 2R7WA 2MSTA 2X3DA 1WC6A 1FFWB 4MT1A 4OI0A 4Q44A 2UXDJ 3KUHA 5EDWA 2D9OA 2HHVA 4UT4A 2E1AA 1FRLA 3SCKE 1YHQS 4FNHA 4YS2A 4ZJQA 3AXKA 3M6WA 4RNFA 4IR9A 4IH7A 2HWHA 3H0PA 3MM6B 2HK2A 5AE3A 4KTQA 4QYZK 4RW4B 5EX3A 5CABA 4MJKA 1Y3JA 3GCWP 4IYQA 4USWA 2BR0A 2P9EA 3QIPB 1S7IA 1QDUB 2AEFA 3NGSA 2AYBA 2FB0A 4KGKA 2GAHC 1DQ9A 5B0EA 3KKFA 1X7VA 4JI1F 1WJ9A 1PILA 5GMEA 1RTHA 2HHHJ 2DGOA 1JLFA 2J5AA 1PJ6A 1FO1A 5B0DA 3RW7A 4ZVSB 3I55S 3TJ9A 2BQRA 4L6V3 1BQNB 3KK1B 3FFIA 3CC2S 3GYXB 3MEDB 1ZH5A 3LP2B 3LO3A 2EFNA 3PYEA 2HNDB 3CJQA 4RUBA 3POTA 2EFVA 4YB1P 4LF5F 1D9AA 4CDIA 1TELA 3RB6A 2QLJB 4KYZA 3BEGB 1TUWA 3DM2A 3DNCA 3EGVA 5KFVA 1VQYA 1WELA 1NSQA 2XMTA 5KFDA 1GXLA 1MMNA 3H2UB 1WEXA 3TVYA 4UW2A 5HMXA 1TKDA 2Q66A 3PRVA 2LCWA 2XY6A 3V2UC 4ERDA 2NSCA 1RE1B 2WW8A 2M5YA 3I5AA 4Y2IA 2YNGB 3H90A 2Q3PA 5K14A 3D1HA 4R0EA 3ZXWA 2WTFA 4ED7A 4Z7CA 2IAJB 3UPFA 4KFBB 4I2PA 2Z4PA 4URQU 3PV8A 1ZYQA 1TL7A 2E44A 5JJBA 3HHKA 2RDDA 4K4ZA 1B70B 1HARA 1ZETA 1UW4A 1HNXJ 2CJYB 4DCPB 2CRLA 5F8IA 4QWCA 3Q2SC 2ATCB 3BGLA 5KT7A 2DNRA 1U1QA 3MMJA 3UFCX 4ZKAA 1HNXF 2B4PA 4M95A 1XC9A 1QE1A 2QA2A 3DGPA 3BR8A 2VU5A 4N7TA 3I96A 3U1MA 1NMEB 3MMBB 1XQIA 1B64A 4RBTA 1CLFA 5JVGQ 1TKZB 3W8GA 5F8GA 4DR4F 4ZPWR 3HO1A 2NZCA 4WP8A 4Q45A 2Z58B 4XAKA 1X9SA 3R6LB 3M2UA 3MPUB 2IDLA 1RWPB 4QR2A 2UV8A 1S6PA 1PGZA 2KRBA 1WKLA 1L3VA 1G6BA 3SIPB 4LIRA 4R8UA 5K14B 2VD3A 2LKZA 1WACA 3AH6A 3QAUA 5FIIA 4CLLA 4M5LA 2X1FA 4QYZJ 3R2DJ 1J5EJ 2H48B 4OYZA 4C8LA 3SV3A 2HBZB 4ECRA 2I2YA 1S6OA 2CZ4A 4ID8A 1KNZA 5AXMA 2FDNA 5LM7E 2VOOA 4NE9C 4DR3F 1FRJA 3VQSA 1J5OB 4WE1B 3Q23A 2FJDB 3M30A 3NGKA 2RSQA 5AE2A 2K2PA 2WSFC 3ILLA 4DV3J 3HT0A 1QSLA 2ZE2A 3SQGB 4NEYA 4OX9J 2MY7A 3L7PA 4ICLB 2HS0A 3MM5B 3FSYA 2W2MP 2DHSA 3AJ2A 3R6GB 4PCQA 3SFUA 3W9HA 4DPOA 4C9DA 1C0TA 2CPYA 2O3DA 2OPQB 3M8RA 3TAQA 2AIRB 1V3RA 4ECVA 1BY9A 1IBMJ 3KOAA 2CPHA 2DNKA 4DV0J 1QTMA 2A3JA 1IM4A 2RKIA 3TO8A 4NA3A 5B08A 2XY5A 2HGNA 1KDNA 4C0HA 5EUHA 2EBGA 2DGQA 4LF7J 5DDQC 5B7WA 1CJTA 1VQ7S 2I8EA 1YRUA 2C3PA 4DR5J 2IA0A 4OI6A 1FDNA 3C15B 4HVZA 5T41A 2W2NP 3GIKA 1UVKA 2DXEA 2PGCA 2QRRA 4HDHA 4F4KA 3O1LA 4RW4A 4JI8J 3W2VA 4DU7A 3D3BJ 4IRKA 1K47A 1TV6B 3FBBA 3HULA 3KJFB 4M8LA 2EVZA 4A8QA 1C0UB 4FBTA 3KG0A 4URGA 4Q8EA 5JVHQ 1PKUA 4ED8A 3HHDA 2ASYA 2PE8A 1OQ6A 4J91A 3QFHA 3OTOJ 1U1PA 4DU8A 4M1KA 1HW9A 1TQLA 1EP4A 2L9WA 2GQQA 1KD1T 4IUFA 4MH8A 4NZ0A 2D3UA 1KQKA 5C24A 2VBYA 1F9FA 1FDBA 3T9ZA 5C24B 1UL3A 1UCNA 4LR9A 4WFXA 2MQMA 4E0DA 1AXQA 4XK8C 4B9TA 3NGRA 3QSIA 2AX0A 3H5SA 3ILOA 4Y34A 3FBFA 4H4KC 5GADU 3KLGB 3KUEA 3LWMA 5F8MA 4IKAA 3AFGA 1R89A 4LSLA 5KFGA 3H98A 4DF4A 4NLGA 1XMOJ 3IWNC 1FJEB 3BKUA 2HLUA 5GAGU 4ZHRB 2VQEF 1P6TA 3DHXA 3G82B 4CM2A 2BRLA 2PSZA 3BJYA 4ED4A 1C4CA 3F41A 4X65J 3NS6A 2OP5A 2M0GB 3MMCB 4MIAA 2UVRA 5DG7A 5H9EK 3PZPA 5HN0A 2GS8A 5T7LA 3BQ2A 2O1PA 4ANDA 3T5LA 2J6SA 4RR5A 1NCLA 3FC9A 1TU0B 2JLFA 4P9SA 1WG1A 4DFKA 1Q79A 1IWAA 3NL0A 4P72A 2GVZB 2CJXB 2J8AA 2QFIA 2FVRA 4K4XA 4ZVEA 4CM0A 5LXRA 3GIJA 4I6AA 4LJMA 1CJKB 2B5JA 4PXDA 1F9HA 1LQ9A 4LF8F 1NDCA 2DB1A 1MLAA 2DY9A 4F04B 3SCLE 2M52A 2J7WA 3V6JA 1TV6A 3M30B 3UR3C 5HQ8A 2QYCA 4DR1J 2HQ3A 2VFRA 3GG0A 3JQJA 2HWTA 2ZBCA 2CJBA 3EE3A 4DFMA 2ALZA 1H38A 3NG8A 5D3GA 2VG7A 2Z57B 2ZH2A 4CO4A 2XSFA 3GIRA 1FNOA 3PY8A 3LUYA 1KHVA 2AJ2A 2DIUA 4OYWA 4WIIA 4ZPAA 3DKDA 4Y3CA 5A0YA 4C8NA 3RBZA 3P45B 2C28A 2B9XA 1N5SA 3W2WB 4A48A 3D6TB 1RT7A 1UAWA 2F7VA 4ID5A 3SSSA 1VQ4S 4R8UB 2E5HA 2W4CA 2ILYA 3EVMA 4IRDA 1VCTA 5A2QU 1HI8A 1REVA 1YDLA 2KDOA 2XYGB 1P8GA 4JI0J 4C11A 3W7BA 1VHFA 3DLGB 1FRXA 2L48A 3GFXA 4MKBA 4XIUA 2MQQA 4MAKA 2RF2B 2DISA 4ZJLA 2RF2A 5IFMA 3N28A 2D3O1 4ILMA 4ZCKA 1EZZB 1WSRA 1U6ZA 3MMBA 2CQHA 1N0VC 3W62A 2MTLA 1NK7A 4B3OB 2J7KA 3NRBA 1RAAB 3JAMY 3KHLA 2EKNA 2ROGA 1S77D 3NS5A 2XO7A 3VGSA 3JS9A 4HTIA 1T3NA 2YX7A 4CLFA 1FJ7A 1GTHA 2RUGA 1RTJA 5CAAA 4YDXA 1W7WA 2NSBA 4I2PB 2PFFB 5CZVA 4CT8A 1RT3B 3AA8A 3PRBA 5B0GA 4DCOB 1OJ4A 4I6YA 3MEEB 4UTGA 3ZO7A 4DG1B 4A8YA 1FVQA 1HBMA 2QGFB 2V6AA 3ZTPA 4AQYF 1UVLA 3ONQA 4M5KA 2H5IB 3CWJA 4GVBA 4J37A 1S9EA 5I3PA 5FLXU 1DZ5A 4RUHA 5KFAA 2NUUG 3P49B 1LK5A 2BABA 3MDFA 2BQUA 2IA6A 2GVZA 3I0SB 4DCJB 4J9QA 3SI8A 1NXIA 3ITHB 2YNFA 2B4UA 2JNJA 1EKSA 2G1HA 2H65B 1HHQA 3NWGA 3QGHA 4MFBB 1K1SA 4BC9A 3W5XA 1F5CA 4F25A 5D6GA 1SVDA 1UVJA 2LQ9A 3MF5A 2BXJA 2WONA 1WG5A 4NMXA 4AYBD 1WI8A 5FDLB 3K5MA 5F0WA 3OXFA 1TL7B 2OH2A 2UXCJ 2ROEA 4NLYA 3AB2B 2UUBF 3CCJS 1Z2ZA 3KG1A 2B9WA 4Y2CA 4ZN3A 1GAOA 5HP1A 3A8JA 1NUEA 3K8VA 2HAFA 1MSWD 3KFWX 3E8OA 5KG3A 1NDLA 3T5HA 1Q8KA 2MKYA 3A3NB 1WC0A 4X4TA 2CPXA 2YH0A 1RUSA 1RWKB 3FCVA 2PI5A 2WRMA 3FMBA 2DCLA 2PEHA 1F60B 4RW8A 2HPUA 1NHKL 2NUHA 3MCMA 4KSEB 4M94A 2BKNA 4B3RF 1IVZA 2RQKA 3KMSA 2XSJB 1DAXA 2O5DA 3GYGA 1TUGB 4FZVA 5IQ6A 1IWGA 2ZBIA 4PQUA 4FYYB 1S10A 3WIUA 1BD6A 3CD5A 1S6QB 1Q8BA 1Q7LB 1RWMB 4RW9B 1RI7A 3KK3A 4LSZB 4K5RA 4BS2A 3MEGB 1PYSB 3U7JA 2A2DA 2OAUA 5KG2A 3QRPA 2QN6B 2OFGX 2CWKA 4ZPVR 4L72B 2A6MA 3JQMA 4DL4A 2CG8A 4PPDA 5J1EA 2JVRA 3MM9B 4TY8A 4CLPA 3UR0A 1WSVA 2R9LA 2D7SA 2OTJS 2QL9B 3V4MA 4NEZA 3L09A 1AT1B 5HVHA 1U4BA 3P6YC 4P2MA 4JI3F 2UXDF 2GC8A 1U47A 4JB8B 1NSAA 1UJ6A 2JRSA 4P7TA 5GMKa 4NCBA 3KNAA 3GFHA 4ZP8A 2DKOB 2F3JA 3GZ7A 1PYTA 5L8RC 3TVZA 1IBKF 1OPZA 1IBCB 1E6YA 4IFYA 3RZAA 4CLTA 6AT1B 2VG5B 5GAGI 2NLWA 3T41A 1TKTB 2O01C 3VVTA 5HMZA 1U1LA 4JV5F 4B9MA 4MKVA 2YKAA 1VMBA 5A8RA 4NA2A 2W7OA 1LEOA 2Z8QA 4BCAA 1S0NA 2ZDOA 3HX9A 3OQ2A 1MG7A 3CB4A 2ZBRA 4DXLA 1T11A 1CQNA 1GT8A 1T9UA 5CH7B 3SDEB 3OBIA 4CTAB 4LRAA 1HYSB 1OS5A 2HYIB 4O3RA 2E9ZA 2L9DA 2YNIA 3RAMA 3CCMS 3K5OA 3B8HA 3K89A 2OJ3A 4RU9A 3H5XA 2HZCA 2IC3A 1NDKA 1ZPVA 3Q8SB 1PO6A 3CDUA 4F2SA 1RWNB 2XZWA 3QT8A 3TX0A 4FYWB 3VAFA 3NWRA 1UW9A 2MQOA 4H4KA 3IGVA 2KJWA 2N3LA 5BYSA 1S0MA 1YJ7A 1RT4A 1N5YA 1TVRA 1S6PB 1QM9A 5AJ3F 1VRTA 5HL7Q 3H8YA 4ES2A 3RU0A 3NBPB 4ED5A 3S8SA 3X1LB 3T5JA 1T95A 2B8PA 2CJAA 4OZ0A 2MLYA 2M88A 2O67A 4J9PA 3Q89A 2C1EB 5LXYA 1CPZA 3O3LA 1SJRA 2HHWA 2WB1D 1WTBA 3NCPA 5HANA 4C2MA 1N34J 3J81Y 2W7PA 3CC7S 1T9WA 1T3OA 2XI3A 5F8LA 3RJMB 3F0NA 1U26A 3HZEA 5ETTA 3EYZA 1FE4A 2W9BB 1SI9A 5GAHU 1NB7A 2JL9A 3PRDA 3BBCA 4WP3A 3W1YC 3VAJA 1X4GA 2LA4A 4OHZA 3H5UA 4RW6B 3CIMA 1BGXT 3PO5A 2UXBJ 3SMZA 2C2MB 4OLPA 5GAEU 3BGRB 4DR7J 4HH1A 1DHMA 1MMLA 1PBAA 3EICA 2DGUA 1VK3A 2BYCA 3EM1A 3M2VA 4F67A 5A8KA 2DRBA 3QBCA 2DR5A 1B7YB 3R5GA 4B3TJ 2H54B 2GHPA 3NCQA 3R7SB 1VLYA 4ECYA 3W9JA 3WBZA 4JI7F 4J90A 1VQOS 3K58A 1RTDA 2V8DA 3VHQA 2AJ4A 4EGLA 1RT2B 1FKPB 1QUPA 1CC8A 1SUQA 3C16B 4TKTA 5HJXA 4NLOA 4DZDA 4O44B 1NK6A 3H2VE 1SV5A 3T1HJ 2DNLA 1WNEA 1NJZA 2BE9B 4CIOA 1SH3A 1SJQA 2IMWP 4B9LA 5GMDA 1X5PA 2WCXA 1S1TB 3DRRB 4A8XA 2CQ2A 2W9AA 1GXTA 3C8YA 4EBCA 1AYEA 1I1GA 3VQTA 4DV5J 2ADCA 4LF7F 4LFCF 3IMQJ 3PTWA 4YQWA 3KK2A 5J2NA 4PZVA 3POTB 4CP5A 3E2EA 1WHYA 4YY3J 2MQ8A 2Z30B 1LWFB 3DLGA 3JSMB 5IOLA 3M8ZA 1YTYA 4O3QA 3WC2A 3QLHA 5J1NA 1N6QB 1H7WA 4CO5A 3AOAA 3HHLC 5F41A 1TKXB 1UTAA 2C3UA 3X3UA 4ID5B 4O4RA 2E1CA 2HNYB 2XHWA 5CQGA 4WYWA 4C8KA 2DEJA 3M8YA 3TOQA 4NLPA 1Y4ZB 1WUUA 1N36J 1AZSA 4DQRA 3QIPA 4ZIVA 1R6YA 3EUNA 1JKHB 2QYGA 4OHXA 3K5PA 2KFZA 2KHDA 1J27A 4OFZA 3I56S 1D1UA 1AA1B 2J0XA 1Y7PA 1N0UA 2ZH3A 4LF9J 1IQTA 4HT7A 4TYAA 4X4OA 1QAJA 4USUA 3JSBA 4WFNQ 1TK8A 2XM3A 2WVDA 2IPOB 1VC6A 2L9NA 3T6JA 3CCVS 4PG5A 2AV5A 1WWHA 4PKDB 2WZ1A 3S6EA 1JNZB 4KQZA 4ZPTR 2MSSA 2N7CA 2V8HA 3ETMA 4S0MA 1Y5LB 2MXYA 1HA1A 3CD6S 2X1BA 4P75A 3ZZRA 4EMDA 1MU2A 2KXHA 2PC6A 4DQSA 3E01B 1UJ4A 4DDFA 5IV4A 4X4VA 4R5PA 3K7RA 3PX6A 4OZJA 4R5PB 1FCAA 3M6UA 5FJ4A 3CCSS 3CCES 1H72C 1ZS6A 3MM7B 2VFTA 1RYSA 3BV8A 1LKZA 1KC8T 5A8RB 3WC0A 4HHUA 2PMHA 4O3SA 4OZLA 2I5JB 1H6KX 1RHUB 2CPJA 5CZXA 3GIMA 1C0UA 1N54B 4DV0F 5KG4A 4QR1A 2G2ZA 2BKPA 2CVEA 2OSQA 4XTTA 4I68A 1HR0F 4EZ6A 2XZDB 1VQLS 4ZHRA 1MN9A 3QGIA 4C8YA 1IJEB 4DPXA 2V4RA 2V50A 4ENOA 3UN2A 1HWJA 4J9VA 4C97A 2RDJA 2VA2A 1U8SA 2XMKA 3O2IA 3CCZA 5J2QA 2OIHA 1RU1A 4JI2F 5LJ3Y 3MAAB 3RBEA 5L39A 5SUHA 2EPIA 2V4JA 4DL6A 4JI4F 4H4MB 5J2PB 4HEA9 3M6VA 3UE2A 3GSDA 3DYAB 5E3PA 1IQZA 2MJNA 3K17A 5F3ZA 4JI5F 1O8BA 5K8NA 4BWMA 2GHVC 1I51B 2CDQA 2OPPA 5HROA 1FDAA 2KXFA 2AEMA 2MQLA 4D3HA 1VBZA 1SB6A 1IBLJ 4KT0C 4RW9A 5BYRA 4C3LA 2DVIA 1OWXA 1YX2A 5HK4A 1XR5A 3BGUA 1NPRA 7AT1B 1GX6A 2DYAA 2HRUA 1IR0A 2OSRA 4XPEA 3IRWP 1KOOA 1X31C 1N5TA 2OD4A 2YKNB 2UVUA 1RK8A 1I3OB 2YQ1A 1EB0A 2KJVA 3CDEA 3FUYA 4OQJA 4DZ6A 1VBXA 4IG0B 2K3IA 2D41A 2JH3A 3DXSX 1BMQB 1KN6A 4Q8FA 3D6HB 3MUTP 4RWXA 3V6DA 4V19J 4U7UD 2DGTA 2Y1JA 2MQNA 2FC8A 3VVUA 2C2RA 4Q0BB 2DT9A 1S9GA 3CDAA 2VKZG 4KBIA 1U6BA 4PG8A 2ALYB 4P10A 4ICLA 1M5SA 1XR7A 3NGUA 5M2RA 2ZHAA 2GAGC 1OIAA 4A8KA 3R9LA 2ERRA 2X3GA 1GEHA 3UO0A 3TZXA 1VIOA 3DLEA 3DHWC 3FVYA 1RHQB 1CULB 3QJPA 2B7CB 5BR8F 2QX0A 1QD1A 4DSIA 1IKWB 2EFGA 4OJGA 2WK4A 1HFEL 2HFVA 2LDYA 3W9IA 3ZZ0A 1U45A 2DY1A 1VQKS 5BR8J 2MKHA 3LPEA 2DTJA 1HBUA 1TVRB 5KG6A 3SXLA 1NSPA 1RT4B 4UQGA 4DV3F 2HBYB 5DG9A 2FHJD 3MEKA 2X1GA 3OSNA 2QEXS 1HPZB 2GHWA 4USKA 3TR5A 4JV0A 5KG0A 3R5CA 3FMWA 4LR8A 2E7WA 4LVOP 1SC1B 1ZTWA 1VRUA 1FVSA 2ASDA 4ZPCA 1HNZJ 1U0HB 2HS3A 2C2EA 2KYZA 1P1LA 2YNIB 1L5UA 1S6UA 3N79A 1T0TV 4JI7J 2HHSA 2HVEA 2ZWOA 3TA1A 4D3GA 1NLKL 5LSLA 4O0IA 4DL3A 2CWXA 1ELOA 1APSA 1QAYA 1WEZA 4WTYA 2N3OA 1R7IA 3EGZA 1YJRA 4DV7J 4P52A 3ZTSA 9RUBA 1RYRA 4NCGB 1LW0B 4XDDA 4X62J 3DU6A 1JB0C 5KT5A 4RUAA 4GMKA 1M5OC 4ZA1A 1TKTA 4ER8A 3PACA 1SKSA 1G4CA 1W26A 3BYPA 1H74A 1PAEX 1RACB 4MKAA 5DDOC 4YB6A 2XI2A 2ZDPA 1YJVA 1X4CA 3N01A 1KP6A 4ZP6A 4USMA 4WKYA 2HVDA 4RBVA 2A0FB 3BSNA 2YKMB 5GADI 5KT6A 5HATA 1RT1B 2CNKB 4NPOA 4WFZA 3T9NA 1FJGJ 2BKOA 4UF4A 5LMUJ 2X7IA 2CZ9A 3CCTA 3LAMA 2P6TA 1VQ5S 4JI1J 2KT2A 1JJ2R 3NNAA 4NOHA 2M4MA 3CULA 1WG4A 2GZOA 2OEKA 1NB2A 1C1BB 5HBMA 3CW2C 3J7ZT 1VQ6S 2DRAA 5SZTA 3MTKA 5A2QY 4AE5A 3OJSA 1CJUB 1F5AA 1HD1A 2Y9HA 2DH9A 3MEGA 4E8UA 4WZMA 3QGGA 4U9RA 3TWZA 2OMLA 4NASA 2XO6A 5HQMA 2VBZA 2KRRA 2RUSA 4NLWA 3DU5A 4RZRA 4F3OA 2GO8A 3VTIA 3AJ1A 2OELA 4YHHF 4DX5A 1KVKA 4RNHA 1T05A 2CG4A 1M5HA 1UWBB 4JI6F 3DLBA 2VASA 2DNQA 2HIYA 2LQBA 1LK7A 3D28A 1X5TA 3ISND 2XQCA 2XGQA 3KWMA 2IJRA 3KHGA 4TQRA 2JWNA 2RJZA 1YKWA 2XYHB 1HD0A 3PJ9A 2AJ0A 1VRQC 2ZM6F 4KHMA 5G0RA 1SJ4P 3GJSB 3M4XA 3MM9A 3CCUS 2ACMA 1VJWA 5B0BA 5M2PA 4RJVA 4Q5VA 2YH1A 3C2PA 3J7A1 1R27B 2NXJA 2I5JA 2AYGA 4OHVA 4KHRA 5BJRA 2DO0A 1X4EA 4PYAA 1LW0A 1TAQA 4QQBA 3B82A 2E1RA 3G96A 1T03B 4B3RJ 4QW8A 4DR1F 3SYZA 4DUYJ 2Z2LA 2K06A 1N88A 3TJAA 2LEPA 3ET6B 3J80Y 2VBWA 4PG4A 2CAJA 1EX8A 2XSJA 3LANA 1S1WA 2MKSA 3HSDA 3BH6B 5EWGA 1KSPA 2AW0A 1M5KC 3W5ZA 3PX0A 1S1UB 3PJWA 1JLGB 1MW7A 1IUJA 2KHCA 2G2OA 2YWFA 3DOMA 4ES1A 4HH0A 3MR6A 1MNEA 1O0PA 1JLAA 5KFIA 3DDNA 3FSXA 2RVJA 3IBFB 3N5BA 3OT9A 1ZM2A 2X51A 1NDPA 1SQEA 3NY0A 3TEGA 1IR2A 1HMVB 5AXNA 1FWKA 1RT3A 5ETPA 3G6XA 1Q95G 2LQJA 3HSJA 4LF6J 1GMVA 5KFFA 1LW2A 3AJDA 3WX4A 5DZ7A 2KU7A 5D4NA 1R8CA 5KFKA 3QSYB 3CJ3A 2FVCA 4CO0A 4C0BA 4K4TA 2E5LF 4B3OA 4AD6A 4JV2A 3HHLB 1WOPA 3I82A 4IH5A 3H4DA 1HQUB 1X4BA 1D9FA 1YBTA 1C1CB 2W7AA 4ED0A 1UWAA 1KR4A 2VF3A 2AT1B 2BBEA 4FXWA 3KLFA 3HVRA 3BSOA 1WTFA 2AP6A 1DURA 1HNIA 3E3XA 4LF4J 1SQGA 3LF0A 1SKWA 5HVGA 2A2CA 2VPYB 3DMJB 2IM2A 1TL3A 4NLTA 5K8OA 2WOMA 4RUCA 1RTIA 2DH8A 4DV4F 2M8DB 2BEFA 3KXDA 1AFJA 4LMZA 2VICA 4LFCJ 1NO8A 2LU1A 2FJEB 3GV8B 1XJWB 2HZAA 1KLMA 4OLOA 2B51A 4WFBQ 4GC6A 1TFWA 3MCSA 3IRXA 2Q6BA 4YY3F 4I4BA 1N48A 1M1HA 4P71A 1YK9A 2CDRB 1Z1ZA 2QC3A 3IN5A 1NK9A 1JX4A 1S59A 3OR2A 4IQMA 4KGVB 5L1JA 3SCJE 1GX5A 3PEJA 4JI8F 1N8RT 2LA6A 4FXDA 3J7YU 4X2BA 1FK9B 3CVKA 4B3TF 2BVZA 2ZKUA 1BXNA 4HKQA 4O4GB 1CJKA 4EK2A 1VC5A 2CNOB 2B9YA 3DRPA 2W9BA 4R0JA 1CS4A 2ZBQA 5A6PA 3V81A 1P9YA 2JX2A 4G1QB 4UOGA 1KEKA 4G3IA 3DYAA 1VLOA 3DGPB 3R7NB 3FRZA 4DX7A 3RBXA 3LAKA 3QNWB 5LT5A 3R1HA 1Q78A 3OHBA 1U1RA 2MZ1A 3T3FA 2NXUA 4EWTA 3RTVA 3DN9A 4ZPBA 3CCWA 3VCDA 3ZNJ1 5A0YB 1EETB 3NBPA 1TZ0A 3QZ7A 1Q81T 2LP4A 1UVNA 2WVBA 2A10A 5E33A 1CJVB 1U25A 2B56A 2GNKA 2LXFA 5DLGA 2ZJQQ 2HFZA 3MAQA 2LXIA 2FLLA 3VGTA 4LSLB 2GGPA 3HLUA 3NGTA 1U2RA 3DOMB 2KN4A 4QPTA 3KLHB 2XTJP 4DL2A 1SPBP 4CYUB 1UKUA 2DGXA 5KFRA 2J0QD 1N33J 2VA3A 3DLKA 3O6QA 2XS5A 3OSPA 4ZK7M 5L1LA 1NBEB 2BACA 3FNNA 2I0XA 2KM8B 2BUNA 4OJ3A 4LRDA 2HHHF 2ZM6J 1XNQJ 3QWPA 4XO0A 1DTTB 4W98A 5B09A 2VOPA 1BWVA 3DOLA 3D5MA 2H1YA 5I3QA 3J81j 2VL1A 4EUVA 3BBFA 3PG9A 4ILLA 5KFYA 1S7HA 4J9RA 3ZZUA 2XWXA 2B0GA 3M32A 4QWAA 3MEDA 1T8EA 4PWDA 1Y3KA 1UFLA 2ILZA 6FDRA 2QSFA 5LJ5Y 2ZITA 2HEKA 5G0RB 4NYPA 1R6VA 3CSKA 1E6YB 4ZPDA 3PXGa 4EYHB 1X5OA 3IS9B 3A13A 2U2FA 3PO4A 3QT6A 3LP1A 4V1Ak 1VIXA 1DFDA 4AXIA 4IOAQ 2HQFA 1LNQA 3I0RB 3H4BA 2G0JA 3OLBA 4KKOA 2KG1A 3KLVA 1B4SA 2PO4A 2QA4G 3I4PA 1IKYB 3B4MA 2APOA 3RB0A 2YVSA 5GVQA 3NP5A 4WP9A 2NR0A 4JOUA 4KPYA 1F5BA 1NK5A 1YITS 1FXDA 2V34A 4WFYA 3JTPA 3GQCA 4M5IA 1IJFB 5RUBA 2YX4A 3EVWA 5CCLA 4QBUA 4LF6F 1TFYA 1H2TZ 3MURP 1K73T 5AT1B 5IT9Y 2Y8YA 2H3EB 2N7YA 2DITA 1WORA 1S48A 2ZE2B 4CLWA 3TZZA 5IS2A 3RUBL 1HI1A 4J7CA 4WJBA 5F8HA 5I3UB 4F50A 1RHRB 1SV5B 1F9EB 4OI2A 4YB5A 1NJWA 4OIXA 5IZHA 1SUQB 1WHWA 3IBCB 5KFEA 4KPCA 5KFZA 4DI6A 1KKHA 3IRXB 4C8OA 2MKKA 4I2QA 4LFAJ 4RW7A 5KG5A 3FGVA 1YJ9S 1REGX 3KDOA 1D09B 2VBXA 4CH1A 1QY7A 3AD8C 3NOCA 5ADZA 2E1PA 1TL3B 2MPUA 3B4DA 1HBOA 1NJXA 1E6VA 2F4VF 3HP6A 4LFBF 3LW5C 4IFVB 2V9WA 3CD0A 3BF4A 3W8PA 3TUZC 1MN7A 3LTOA 1O5JA 3GWCA 4K0KF 4PRFA 3MECB 3Q8YA 4DJBA 1ZTTA 5KFJA 4DL5A 2DXDA 4YOEA 3DGVA 1TKZA 3QYYA 1YBAA 2IBOA 1D8YA 1TMJA 3SQGA 3AY0A 4ES3A 1TUVA 3IAM9 2W1BA 5J2MA 4LF8J 4EO8A 1M90T 3ZC4A 2CQBA 2W9CB 1N32J 4UQTA 3QAEA 2HLTA 4I69A 2VC1A 4DV6F 3GILA 1S9EB 1IM6A 2Y0BB 3CGIA 2D69A 3DDIA 3FCHA 4J5OA 4K5SA 4N8NA 2XB2D 3OXGA 1K0TA 2J0WA 2LU2A 3FZ2A 2YQ3A 3LALA 5DQGA 2HVZA 4B9NA 2KI2A 3B54A 2CYYA 1MROA 2V5HG 1DQ8A 2Y1LB 3C6UA 3PDNA 4OI1A 1R31A 4ANCA 3FEYB 2HVHA 2KVQE 4X4RA 3T1YJ 4C3MA 1S99A 2NREA 4B08A 3M2UB 3L7OA 3TANA 1NRKA 3HVAA 1B3TA 3A8KA 3IC1A 2H5EA 1BE4A 3A3PB 3U27A 2ASJA 1S1WB 1X4FA 1UMJA 2RAQA 3HFKA 3W63A 4DSJA 1VQMS 2AHOB 4ZCLA 4DQPA 4ZOSA 5HVFA 3TRGA 3TNVA 2FVSA 1UVMA 1T7PA 4IO9Q 3L9ZA 3QT7A 2IM3A 4OMFG 4NRUA 3HSZA 1LWCA 1KLNA 3W5YA 1FT8A 3EZ5A 2QA4S 4IOBA 1O6XA 5KFLA 1CVJA 1FD2A 1LV5A 1VOMA 1S9GB 2Z2ZA 2CNNB 4C11B 2F65A 1REVB 2VG5A 1E6VB 4G6VB 3TZWA 2FVQA 3OJUA 2FLPA 1HHTP 3GTYX 1RTHB 2YNGA 3W64A 1EIYB 1FNMA 2P9GA 1VI7A 1WOOA 2A18A 3V5RA 4DV2F 2BJDA 2F63A 4ILRA 2OPRA 1EQMA 3EDQB 4DV7F 5K5MA 3VAKA 1TMMA 1TL1A 2C2NA 2JDJA 2YWHA 3HHLD 4AT1B 2ADBA 2B6AB 1S1XA 2CPFA 2MY8A 4YP3A 3TAPA 2IRYA 4DPTA 2HSEB 2H9ZA 4NI2B 4BLGA 1XNRF 2FGCA 4LRBA 2DGWA 2N82B 3FQKA 3OVAA 3C6TB 1ROFA 5E5NA 5KFXA 3LGNA 3G71S 2POKA 4LREA 4QWEA 5LOQA 1FD8A 4OZNA 1GFWB 1ZAVA 2CQ3A 2ZVSA 3ENWA 3E51A 3GCXP 4U8YA 2JLGA 5DDRC 4Y2KA 2OPPB 5HROB 3B6BA 2HNDA 3TARA 2ZZMA 1IKVA 1Q5VA 3NKYA 4CLUA 2XGPA 1YIJS 4ZVGA 2NZ4A 3AT1B 4TLQA 5ETRA 1PIEA 4W4MA 3MAAA 3SV4A 3C46A 2NQPA 2B4VA 4X64J 3RG6A 5T7LB 1QVFR 3GMGA 1QVGR 1ZAWA 3ENAA 2QL5B 2KTQA 3OTCA 4K4UA 4GRSA 3R2CJ 2NXEA 4HI2A 2LECA 1U1MA 3FSIA 3PVXA 2YNHA 1JLBA 2R7QA 4KGXB 4KGMA 3U02A 3EMTA 3THVA 5KG1A 2PDAA 1U1NA 1JJ4A 2CJ9A 4ANEA 1RZMA 3I87A 2HFSA 4TLRA 2QMWA 1JK9B 3CTRA 4ZVRB 1RSCA 2CFXA 1RJJA 3N6MA 4CRJA 4DBQA 4DR2J 1IBKJ 2DR9A 2XMAA 1TK0A 2ZC4A 4KIAA 2EXUA 4IRCA 2BANA 5HMYA 4DR2F 2DR8A 4LFAF 2WVCA 4ECTA 2BM0A 3Q8UA 4QWDA 3DOLB 2OMOA 4GO7X 3RRGA 2DJWA 5CD4A 2VJUA 4C8MA 3ZZOA 2AU0A 2GX8A 1R8BA 3ICLA 5L9NA 3JXOA 3R8YA 3FBEA 2FYXA 3DLKB 3HK2A 2G0CA 1SC6A 5DGBA 5E3AA 4OYXA 1F1BB 4OYBA 3Q8PB 4J9NA 2RRBA 3BKFA 3MR3A 4WXOA 4DG1A 1DLOA 1X4AA 2CQDA 2ZJRQ 2RQ4A 1RHMB 3CIZA 1XEZA 1Q16B 4ZMMA 2E5LJ 2WBRA 4F4ZA 4DSKA 2G0IA 3EPGA 5A8WA 1SC4B 4KO0A 1AZSB 1VK8A 3BREA 3ULHA 2RE1A 2HVIA 1K44A 5E2QA 1RAOA 5IWAF 1QAIA 4YMEA 2KZZA 3ZTOA 3N0VA 4PWWA 3WHIA 3J7Z5 3V4IB 5ETOA 4IG3B 2C42A 3W66A 2MQPA 5IWAJ 3THPA 5DQIA 1PAUB 3D1OA 1D8ZA 1S0VA 3KJNB 2OPSB 2ZOFA 5F9NA 2K1RB 2H4WB 1OSDA 2EBEA 2RHQB 3L7UA 1ZM3A 1KBRA 2HKEA 3HD2A 2AGOA 3M9NB 2QLXA 2V69A 4B9VA 1R8AA 1HL6A 2MLXA 1XERA 4IFVA 4QOTA 5T14A 1SIWB 2W4PA 3CJKA 1KQGB 3S1TA 4IQXA 3FKBA 3QIDA 2PI4A 2QG9B 3J80U 4F4AA 1MMDA 5D0EA 1C2PA 3JQKA 3VAHA 2XBPA 3F73A 1FTCA 2D74B 2FZKB 2PA8D 5CYMB 3UDVA 4WF9Q 2F40A 2Z56B 4NLDA 1EQ0A 1HKAA 3BDEA 4Y2AA 4TU7A 1RAEB 3CNQP 2JJ4D 2YPZA 5LMNJ 1YJNS 5ETMA 4FS1A 2ABYA 1C4AA 1MWQA 2ZUGA 2BA9A 3VGVA 4USIA 2MB0B 3CC4S 1PC5A 3WDOA 1VQNS 5KFOA 2XLJA 3LH2S 5I42B 1VC0A 1HNVB 4RW6A 1UFKA 4IOCQ 2MZQA 4YUDA 3HJVA 3IO1A 2LQ8A 3TX8A 3T1HF 4OJHA 3HT3A 4N5SA 4LF1A 3RBDA 5KFTA 2JFDA 2RRNA 4K59A 1QJHA 3CCQS 2C3MA 1MWYA 4H4MA 5J2PA 4ECXA 4WXWA 1D0EA 4RL1A 4X62F 1F3FA 2WBMA 2HFNA 1OMSA 2J9DA 1IBMF 4WU2A 1RB0A 2MHEA 3D68A 3JYTA 2RS2A 2R8JA 3CJ4A 4LF4F 3NMAA 3MFHA 5L38A 1XNQF 3MMAB 3P96A 2MGZB 1IN0A 1YG0A 1JJHA 3IR5B 3AD7C 4ZVPB 4EZ9A 4X4SA 2B4OA 4EU0A 4DV1J 1JXLA 3MHYA 3BYRA 5G4DA 5GAEI 1XMQF 4B9SA 4PR6A 2VQFJ 3QZ8A 2DK2A 4B3MJ 4ED2A 2K3KA 3P5BP 3GV7B 1HWIA 1Q7YT 1RGVA 2PN6A 2QE5A 3HCXA 2RDIA 4JI2J 1FE0A 3UD5A 2MKCA 2HURA 3DOKB 2K8GA 3CJRA 1BC6A 1JXVA 1V3ZA 2BANB 1FWPA 4AUKA 1SJ3P 1S0OA 3MFIA 2UUWA 1N5VA 2FGOA 3LP0A 3MPYA 4LR7A 4ZS6A 5I4MA 1VJQA 1S1VB 1RISA 4HHHA 4DPYA 3K5LA 4ED1A 3W60A 1KFDA 1V6HA 4W92B 3C19A 3W2VB 4C0OC 2JFKA 1PCAA 4LRCA 3RAQA 3MOJB 1CJVA 1WHVA 1JIHA 2W01A 2J0SD 3R5BA 4KR0B 3FZBA 2ROPA 3CXCR 1JKHA 2ZH5A 2MDAA 5CHCB 2ZH8A 3GLJA 3M1VA 5DJBA 5DGAA 2UU9F 4K8RA 2DRDA 1CJTB 1RAHB 3QO9A 4Q7AA 4KHPJ 4PXBA 1TKXA 2J9CA 2GMJA 4I64A 2HHUA 1WKJA 2E7XA 5D0GA 3MWBA 2HRYA 4PXCA 1A9NB 2GVDB 1TL4A 2CVIA 1KTVA 2ZKTA 3AODA 1LWFA 4I1TA 2FHKA 3CMES 4Q2MA 2BOPA 3DLJA 4IH6A 4ZIWA 1A6LA 1LXJA 1PSDA 2WVEA 3MM5A 4O4GA 4F4WA 4M5JA 2H5JB 2R8IA 3CPWR 4MYUA 3KK3B 1RT6A 2YKOA 2QLBB 4GO5X 2J6UA 1O51A 1PJ7A 2VZ9A 3G4SS 1SCJB 3GJTB 1FFGB 4ITSA 2ZD1B 3PYFA 3MAHA 1UA0A 1N34F 3HHEA 3C3LA 1RTDB 1NU4A 1S1XB 1B0PA 1RAGB 2BX6A 2CZVC 2E5GA 3D3CJ 3F44A 4PPZA 2YKMA 3US5A 4F0MA 4CCHA 2AZ1A 2H4YB 2W2OP 1U7LA 3VAIA 2XYPB 1Z4UA 5H9FJ 5L1IA 1GNKA 3EDRB 1NHVA 4I56A 4DMZA 2RQCA 1HI0P 1N32F 4O3OA 4UY8T 5HP1B 1Q82T 4PG6A 1QTNB 1CG2A 1PYOB 4FYXB 2VB6A 1I5OB 5EWEA 3MR5A 3TUJC 3WIVA 1DTQA 1LWEA 1RT5A 5ETSA 2ZNYA 2Q43A 1RHJB 3TW0A 1SJ1A 2HK3A 3MXHP 2UZAA 2MKJA
chains in the Genus database with same CATH topology
4A8OA 3TAMA 5IT0A 5KFSA 3UNGC 2HNZA 1TR0A 2M70A 2RQMA 2YKPA 4Y28C 1M0SA 1N52B 4FYDA 1UVIA 4QIWD 2FPHX 2KB2A 5EWFA 3D2WA 2LMIA 3IR6B 1VRUB 3GIIA 3KLEB 4EBEA 2ZH7A 3I6PA 1SL0A 2KFNA 1QAXA 1ZBTA 1SIZA 1VRTB 2GJ2A 4DX8H 4QW9A 3A8EA 2IAJA 5D4PA 3RW6A 1I6JA 1HMVA 3PFEA 4CQ1A 3Q22A 1VQ8S 5H9EJ 3JSYA 3D0IE 2XEXA 1R3NA 1RAJA 3EGWB 1P27B 5KOWA 2MJUA 1S97A 3KLEA 4FF2A 1S1UA 3A1YG 4FF1A 2DR7A 2KVIA 3BQ1A 2DHAA 1FEEA 3OXLA 3H59A 2C3OA 3VZIA 3Q2TC 3GYNA 3BGFA 5B0CA 1R8HA 2BJEA 4RNOA 3MTJA 4QU6A 2YWKA 2VQFF 3UD4P 1T03A 2G4BA 3DLHA 2GQ2A 1J5EF 1L3SA 3OFEA 3CUNA 3MECA 2HG4A 2IRXA 4ZLPA 3BO2A 3RRKA 1FRIA 1BQNA 3DI6B 1S9FA 1JLEB 1FTRA 3DDKA 4IFYB 1YQHA 2Z2MA 4FN5A 3KJVB 1I94F 3GR0A 2J9DE 2KT5A 2DHGA 3OTEA 4ZP7A 1U2FA 2CPIA 2XWYA 7FD1A 1VQPS 2HAIA 1HBNA 2KG0A 3KYLA 4QYRA 2ZOMA 5DQHA 5KFHA 3QGPA 4TY8B 2F9DA 3OL6A 4IR1A 1CEZA 2JC1A 3G8QA 4LIWA 3TQ1A 2COLA 4YR3A 2B5JB 2CPZA 3RB4A 2E66A 1B0TA 1JLCB 2GMHA 3OTDA 4DR5F 2R7UA 5DM6Q 5F8JA 2K7JA 2Y0SD 3IR7B 4TN2A 4DSFA 2W24A 4PQUB 1VS3A 2L3MA 3M8PB 4NYOA 5CYQA 4FS2A 4N41A 1RWUA 4X84A 4NMLA 5J2QB 3KNGA 2RILA 2HHQA 3LGMA 5B0FA 1T02A 3I0RA 3SZ2A 4K2XA 1QLNA 2OLWA 3PW5A 4QIGA 3D1QA 5KFUA 1JLEA 3K0JA 5DO2A 4Q2LA 3MD1A 2OD6A 4LSNA 2MHNA 5LL6d 3M8SA 2WONB 4AL5A 3I4HX 2DH7A 4ZDNA 5C42A 4B9UA 1TP7A 4YB7A 2IJFA 5JXSA 1RA6A 3I0SA 4OV1A 3ENVA 3HVWA 4DL7A 1MU2B 3PIPQ 4P2SA 4XPCA 3ZFVA 3QJJA 1FDDA 2EWHA 2NPFA 2JEIA 4RLEA 2M3DA 2R2RA 3KLHA 3QMQA 4ED6A 5IXUA 4N47A 4K4VA 5U47A 4NZ7A 1WEYA 5H1SV 5KT2A 3MEEA 2GFFA 4K4SA 1LFPA 3BQ0A 1VQ9S 3C6UB 4Y65A 2MGZA 1HBUB 3OPKA 2KYXA 3MMAA 3SSQA 2GIRA 1RTJB 1S4FA 2BM1A 1Q53A 3PNIA 5FLXY 3T1AA 1X8DA 5E41A 2Q79A 2J9EA 1AW0A 2RU9A 4NYZA 5DLFA 2LQ5A 2XC9A 2R8GA 5IM0B 4ECWA 3TYTA 3JSMA 5KFQA 1V9OA 1BQMB 4C98A 2RU3A 1C0TB 1JNRB 2IM1A 2OPQA 2FUG9 4GC7A 4N8OA 2FIUA 5DRKA 5DETA 3HJFA 5KFWA 2OPSA 2E9TA 1YWXA 4Q0BA 2OO4A 3O44A 3I5BA 2EI5A 2F9JA 1HWLA 4HI1A 2G9OA 1DARA 2YWEA 4O44A 5IQQA 4UUXA 5HO4A 5E0OA 2XMMA 3RR7A 4MIBA 1SL2A 2QO3A 4WZQA 1XMBA 1D3WA 3Q0AA 2IYGA 2QA1A 2KFYA 4UY85 1BWEA 1WI6A 4KO0B 2DNMA 2XS7A 2YKNA 3D0HE 5E3QA 2NYIA 2W4DA 2ZD1A 2WOMB 4JBCA 4DLGA 4NLXA 4QU7A 1SKRA 2MKIA 3VR1A 3MPWA 2EKYA 3CJKB 1DLOB 4YR0A 3QJLA 1GTEA 4DR6F 3KLFB 3BB5A 2R8HA 3G6YA 4F4XA 2LLZA 2K1RA 3IWLA 4LF9F 2KXNB 3M05A 1FJGF 4M5DB 3K59A 3HHLA 4DV1F 2LEAA 1UJ5A 2UV8G 3DRYA 4ZP9A 1FKAF 3AAWB 1K1QA 3BDPA 3B78A 2UXCF 4KB7A 2FJBB 2L08A 3C66A 2SXLA 4YR2A 4BHQA 3FQLA 1FHTA 1HWKA 2LDIA 4MKYA 2IVFB 1NK0A 4Q43A 3N5FA 3ENQA 3FDSA 3G86A 4BWJA 3ZZYA 4OX9F 4ZVFA 4C3KA 4A8MP 4NXNF 3UI3A 3ZZTA 3PW0A 3GB0A 1FA0A 1HNZF 4HT5A 3M32B 2OKQA 3D54A 5MLCV 2XMVA 4DQQA 2BQ3A 4N77A 1NJIT 4PUOA 2KZMA 2VC0A 5KT4A 4DHVA 3LPYA 1DTTA 2AD9A 1HYSA 1FF2A 3SDEA 2LYVA 4QIEA 3DM2B 2EG1A 2ACYA 1FXLA 4W90B 5C42B 2D9PA 4QR0A 2HWIA 3LP2A 3BS9A 3SEOA 2C2DA 1NK8A 1T94A 5EX0A 4DUYF 1QSSA 1NHUA 2AJFE 1WD6A 2R4FA 3LUYA 3MUTP 1Y00A 2VUGA 3BZQA 4DJBA 3OV7A 3U1NA 3P5TL 1OQ3A 4F26A 4ZCMA 5MAOA 1UFWA 4QPXA 2DNPA 4P7VA 1N4LA 4OHWA 3MR2A 1URNA 2Z0GA 5FD1A 2JVOA 4KV8B 1UWBA 4K50A 3AA9A 2E29A 3KJVA 1K0VA 1FNXH 4NLUA 3QLHB 1N6QA 2EFQA 3CJ2A 4I7FB 1XWLA 2HMIA 5F8NA 2EK1A 4JI0F 4B3MF 3F56A 4NZ6A 4I6WA 4B3SF 3H5YA 3CCRS 5J2NB 3KK2B 2CQCA 2DGSA 1YSJA 2D3OR 2FY1A 1QUVA 1FK9A 3TUIC 3FEXB 2QLWA 5ITHA 4TU9A 4DFPA 4A8WA 3C6TA 4J9MA 4A8SA 2YWGA 3PKYA 4A47A 4CH0S 1LOUA 2CQGA 4WE1A 1J5OA 1HBNB 4RW8B 1NZAA 3GR1A 4WYLA 2M7SA 1TL1B 4ECZA 4DQIA 2RIJA 2V2KA 4OHYA 1LXNA 1F2GA 5KT3A 2FLNA 2DNNA 2DCUB 1Q8IA 4Y00A 1YJWS 3GFYA 4QZVB 4DF8A 3M6XA 3PJXA 2B43A 3MUMP 1GXUA 3O5TB 5FDLA 1XR6A 1BQXA 3GG1A 4DWIA 1ZOTA 1FEHA 1HQUA 1HQEB 5KAKA 5L9XA 3I32A 1SJFA 2FHMA 2W9CA 1K8AT 3SSRA 3NMRA 2UXBF 4I0WA 1ZAXA 2MZTA 3OFGA 5C25A 5HMWA 3SFGA 5HI7A 4NRTA 5K9FA 2XY7A 2VG6A 4MK8A 4YEAA 2KT3A 1RDRA 1N36F 3PKMA 1NAQA 4I67A 4AL6A 2XMUA 4U67Q 1U24A 2ZH6A 2UUCF 2J6TA 4N76A 1DQAA 1KFSA 1JLAB 1M5VC 2CQ1A 4U7UK 5LSRA 3K57A 4ECUA 5HLFA 4C7QA 1Q86T 5LMNF 4RW7B 2JLEA 5THWA 3T1YF 3I5CA 7FDRA 4MK7A 3KHHA 2AJQA 3GE9A 2CQPA 3ISZA 3DLEB 1SL1A 5AE1A 2MMYA 3P3DA 2IYIA 3EPIA 2P5VA 2RB7A 2W8LA 4A46A 1X4HA 1H2UX 3R5AA 3PEHA 5KFPA 1RT5B 1IXKA 3I9V9 1LWEB 4EO6A 2R7VA 2GA7A 4ED3A 5EN1A 5IM0A 4I7FA 6FD1A 2Y1IA 2NS1B 3RR8A 2BE2B 3NNHA 3G9CA 1JLFB 3RRHA 1RT7B 4MYTA 3R1LA 3W2WA 3K2YA 4AXJA 4RNMA 4ZVHA 4DV5F 1CQMA 1UP1A 2DO4A 5K8MA 1Y5IB 2VG7B 3DFEA 2XS2A 2VFUA 4ETXA 2N4DA 2PIIA 1W25A 4HL9A 2CJQA 3MM6A 5D78A 2CKWA 1R0AA 3CEDA 2CQ0A 4Z37A 3MUVP 2U1AA 5LMUF 5CYJA 1IKVB 5JUMA 1NKBA 1SXLA 4WFAQ 4FNIA 2HW3A 3LQVA 4V19X 2HFOA 3KG4A 2HIQA 3HKZD 4NLSA 1S6QA 2DBBA 4N56A 2HMIB 1IBLF 3R27A 2AJ1A 3HVTA 3MM8A 3SCIE 4U7CA 3CJ5A 4FBUA 1IKYA 2E5IA 2EFPA 2B6AA 3UCZP 3AHPA 1DRZA 2OTLS 2F1FA 3M1VB 4ELTA 1U6FA 1FRMA 2UUAF 2D1CA 2M8HA 1OSCA 3WZ0A 3LP1B 1U1NA 2C22A 1IKXA 3VZHA 4KC5A