2KH9A

Solution structure of yeast prp24-rrm2 bound to a fragment of u6 rna
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
86
structure length
86
Chain Sequence
MTECTLWMTNFPPSYTQRNIRDLLQDINVVALSIRLPSLRFNTSRRFAYIDVTSKEDARYCVEKLNGLKIEGYTLVTKVSNPLELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and functional implications of a complex containing a segment of U6 RNA bound by a domain of Prp24.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Splicing/rna
molecule keywords U4/U6 snRNA-associated-splicing factor PRP24
total genus 15
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kh9A00
1N54B 1WEYA 1WEZA 1VQNS 3THTA 3K0JA 1VQ5S 2RVJA 3CMAS 1KD1T 3EX7B 5H1SV 3H2VE 2ZJPQ 2FPHX 3BO2A 3FEYB 5LJ3Y 2J0SD 5GAGU 3VAFA 1DHMA 2FC8A 3SXLA 1M1KT 2FY1A 3CC2S 1R8HA 2EK1A 3P3DA 2KXFA 3BEGB 5GMKa 3S6EA 2ZJRQ 3CC4S 1WG5A 1UW4A 2N82B 2X1AA 2CQIA 4FXVA 2N3OA 2DNHA 4WFNQ 3LQVA 1VQOS 3RW7A 3MUTP 3UD3P 1H2UX 4C0OC 4PKDB 1D9AA 1OO0B 5FJ4A 2N7CA 2I2YA 2CPDA 5GADU 2DIUA 1WF2A 2N3LA 1ZH5A 2MKCA 1X4AA 2ERRA 2AD9A 2LMIA 1WG4A 4WFAQ 1X4HA 3BO4A 1FJ7A 2LA4A 1RKJA 3TYTA 2KRRA 1FHTA 2MZRA 2AYMA 1ZZFA 4OZ1A 2GHPA 2KN4A 2WBRA 4UY8T 2LKZA 2VOPA 2LYVA 2MZJA 1YHQS 3DXBA 3CCQS 3R1HA 1VQ6S 3L3CA 3G71S 2UP1A 2OTJS 3UD4P 4W92B 2CPXA 1DRZA 2KXNB 3VAHA 3VF0B 1SJQA 3THPA 3DLLQ 1K9MT 2XNQA 1U6BA 5EN1A 1U1NA 5JVHQ 3Q2TC 3CUNA 1VQ7S 1L3KA 1SJRA 2A3JA 2DNZA 1K73T 3CC7S 1U6FA 2JX2A 3MD3A 3IRWP 4F25A 2B0GA 4CIOA 3G96A 1OPIA 2OSQA 2OTLS 3B4MA 4W90B 3J7ZT 1U1OA 2DH7A 2DNOA 2X1FA 2GO9A 3P49B 4IOAQ 4YUDA 3CD6S 4TU7A 3CCLS 3UE2A 4WCEQ 1JJ2R 1SJFA 2YWKA 3PIOQ 3P6YC 1NO8A 2DNMA 4WIIA 3JB9k 2PEHA 1JJHA 2J76E 2DHXA 4TU8A 2CPYA 3SMZA 1X4EA 3D2WA 5DDOC 3MUMP 2LECA 2HZCA 1R8PA 3SDEB 1QVGR 1IQTA 1M5KC 1P27B 1HD0A 3LPYA 2OSRA 5LSLA 2DNYA 2MJUA 3NMRA 5MLCV 1VQLS 3MUVP 3HHNB 5LSOA 3CCES 3UCUP 3FEXB 1YIJS 2VODA 1S72S 3MDFA 4Z2XA 3I55S 2DGUA 3J7YU 5D77A 3UCGA 5LXRA 1FJCA 4IUFA 2MQOA 2EVZA 3G8TA 3ZZYA 1FO1A 1HA1A 2YKAA 4PR6A 1A9NB 1N8RT 2E44A 1WHWA 2DIVA 2JWNA 2RS8A 3SDEA 4CH0S 3NS5A 2DGXA 3HI9A 1FNXH 4WFBQ 4FXWA 2M88A 3UCZP 2RRBA 3CTRA 1WWHA 4V19X 2G0CA 1YI2S 2DB1A 5CXTA 1JJ4A 1WHYA 3N9UC 3CCMS 2K3KA 2M8DB 1B7FA 5HO4A 2CQ0A 2DNPA 2RNEA 1SJ4P 3TP2A 2D9OA 2SXLA 2RRAA 1KOHA 1X5OA 2F3JA 2MSTA 3P5TL 2DGTA 2DNKA 2Q79A 5LJ5Y 4QU7A 1U2FA 2CPJA 3MURP 4BS2A 2E5HA 2HVZA 1Q82T 2EK6A 4UQTA 5IFMA 2RT3A 2AYEA 1RK8A 1QM9A 1PGZA 4C4WA 2RQ4A 2CJKA 3NNHA 1M5PC 1FXLA 1U1RA 2DK2A 1VC6A 3S8SA 4C7QA 1U1PA 2MSSA 3CXCR 5GAHU 2CQ2A 2MY8A 2RS2A 1YWXA 5CYJA 2QA4S 1U1LA 1K8AT 1VC5A 2MKKA 2DH9A 1CVJA 4RU2A 2MQMA 3CCUS 3VAGA 2MZ1A 1H2VZ 1VQ8S 4YOEA 1X5SA 5DDPC 1VQPS 1M5OC 1VQKS 2DHGA 3Q2SC 1O0PA 2U2FA 1YJNS 2E5JA 1X4DA 3UWTA 1X4GA 2XB2D 2MKSA 2CQDA 2D3OR 2MZSA 2AYBA 3H2UB 1U1QA 1HL6A 1KC8T 4F26A 1YTYA 2BOPA 3V4MA 1DZ5A 2KU7A 1WELA 2MZQA 2LEAA 2MMYA 2XSFA 1WF1A 1YJ9S 3EGZA 3IWNC 4CH1A 5IQQA 2MXYA 2CQPA 2D9PA 5DDRC 4Y00A 1VBZA 1BY9A 1VQ4S 1F9FA 2M70A 2DNGA 1X5TA 1Q86T 2JVRA 4WF9Q 2MHNA 2I38A 1OIAA 2DHAA 1XN9A 2X1BA 2OIHA 5CA5A 1YJWS 2YH1A 2MYFA 4J5OA 5LXYA 4U67Q 2DISA 1FT8A 2LXUA 2CPFA 2KI2A 4A8XA 4OZ0A 1AUDA 1WEXA 1WTBA 3G6ES 2JVOA 2X1GA 4ZKAA 2MPUA 2M52A 1VQMS 3ULHA 2J0QD 4YB1P 2LQ5A 1FJEB 1URNA 3MI7X 3S01A 1KOOA 2MY7A 1X4CA 2OJ3A 2CQHA 2CQCA 5ITHA 1M90T 4M5DB 2LA6A 1QVFR 2DNLA 1S79A 2MGZA 2KYXA 2DHSA 3I56S 2KXHA 1DBDA 4LIRA 2F9JA 4IOCQ 3NNCA 2PE8A 5DM7Q 4QQBA 5IM0A 5IM0B 3ZZZA 2J8AA 4F02A 2YH0A 1U1KA 4LMZA 3BS9A 1UAWA 2M7SA 3NNAA 1G2EA 3CCVS 4PRFA 2CPZA 2DITA 2KHCA 3U1LA 2HGLA 1NU4A 2M4MA 2MQLA 1WHXA 2CPIA 2E5IA 2CPHA 4TU9A 2KG1A 1UFWA 4Y0FA 2DGVA 2KRBA 2HGNA 2LCWA 5DDQC 2RU3A 1WI8A 2M9KA 2DGOA 1X0FA 2KM8C 3U1MA 1VBXA 3VAKA 3TO8A 3OW2R 1WG1A 2MB0B 2FHOB 3CCSS 3VAMA 2KH9A 1VQ9S 2QEXS 4WKRA 4P6QA 1OWXA 3VAJA 2L08A 1UP1A 2CQ1A 1D8ZA 1A7GE 5D78A 5DM6Q 4QU6A 5BJRA 2ADBA 1X4FA 3NS6A 5JVGQ 3G4SS 3EGNA 2MQPA 3CMES 1PO6A 2MJNA 2MKHA 1U1MA 1YITS 2HYIB 1X5PA 4IO9Q 2G1DA 1JMTA 2LXIA 3BO3A 2QFJA 2JRSA 2RUGA 2CQ3A 2MZTA 2MGZB 1H6KX 2MKJA 1NJIT 2CQGA 2CPEA 2VONA 1W2BR 4LJMA 2YTCA 3CCRS 2E5GA 2M2BA 2XS7A 3CCJS 2MQNA 1H2TZ 3PIPQ 1X4BA 2NLWA 3R27A 3MXHP 2DGQA 2DNQA 2M0GB 1Q7YT 2VOOA 2K8GA 1M5VC 1N88A 5GVQA 2MQQA 1P1TA 3R1LA 3MOJB 2DGWA 2AYGA 1WHVA 1WF0A 2DO0A 1KQSR 4EGLA 4ED5A 4ERDA 2U1AA 3MD1A 2KG0A 2ADCA 4CQ1A 2L9WA 1ZZNA 1Q81T 1VBYA 2KVIA 2KFYA 2L41A 2RQCA 5HL7Q 1HD1A 5GAEU 2MKIA 3CULA 3VALA 3US5A 3B4DA 2NZ4A 3CPWR 4TLQA 1N52B 3RW6A 2CQ4A 2BZ2A 1WI6A 3S7RA 4QPTA 5DETA 3CF5Q 3VAIA 2KM8B 2CQBA 2M8HA 2FC9A 2G4BA 2KT5A 2F9DA 2XS5A 2V94A 2ZJQQ 2O3DA 2DNNA 2DO4A 1VC0A 3G9CA 2XS2A 3G8SA 2DH8A 2LEBA 2DGSA 1SXLA 2DNRA 2XNRA 1SJ3P 2HGMA
chains in the Genus database with same CATH superfamily
2RSQA 3TARA 1N54B 3KHLA 3KHRA 3THVA 1BHNA 2FHJD 2R3VA 4NCGB 3K0JA 2DEIA 2UUCF 4EU0A 1VQ5S 1NK4A 2ATCB 1FDAA 2P9GA 4OYXA 4HVZA 4RBTA 5G0RB 3OL6A 3EX7B 4DSJA 3J7A1 2GAGC 3ZZUA 2CDQA 3DGPB 1JB0C 3IM8A 4WYWA 3ZFVA 4G1IA 5A8KB 2AF6A 2HS0A 2ZJPQ 3BQ1A 2NXEA 4ECSA 2GQ2A 4OI3A 1OYDA 4LFAJ 4CO0A 3NGRA 1RAEB 3VAFA 4DV0J 1KRPA 1M5SA 2HVHA 4UZBA 1M1KT 2IYIA 5K14A 3L4BC 1S97A 1FEEA 2ALYB 2QA1A 2VL1A 5B08A 5GMKa 2V4QA 5KFAA 3GJTB 5BYSA 4YY3J 2ZJRQ 3CC4S 4CM0A 4N76A 1ZTWA 1T8EA 4X4SA 3GIKA 2Q1LA 4M95A 1Q1KA 1CJUB 4LRFA 4PWDB 3JS9A 3SV3A 2JFDA 2CQIA 2W2OP 4ZVUB 4FXVA 4DOZA 4ECRA 1RT5B 2W7PA 1ZM4A 1VQOS 2EEYA 3JYTA 3C16A 1RBLA 4ZVHA 1SVDA 1VS3A 5I3PA 2OH2A 4IR9A 3IR6B 1H2UX 1FX2A 1RBOB 1D9AA 1OO0B 3BR8A 5KFUA 1NH7A 3HM9A 4E2FB 5GADU 4NLDA 4ZCMA 2XI3A 5K8NA 4EZ9A 2YKPA 4ZVGA 4M5NA 2ZBIA 2Y1IA 1B0PA 1MMNA 4WFAQ 3RB0A 5DO2A 4A47A 1X4HA 4HI2A 1FJ7A 4G3IA 4Q0BA 1FE4A 1FHTA 3PRBA 2V0NA 2QFIA 2OEMA 3VQTA 1E6YB 2GHPA 4X4TA 2F7VA 3C19A 2K06A 2HHVA 1XMOJ 1B0VA 1TV6A 1WSRA 1KSPA 2VOPA 3BF4A 3OUYA 2AV5A 3DXBA 3AB2B 3FMBA 3OQ2A 4KIAA 4DV5F 4DF4A 1NJWA 3FEZA 3NRBA 1GXTA 4JBCA 4ES3A 3CJ3A 2OEKA 5CZVA 1AT1B 2LFVA 2EI5A 3GTYX 3P5BP 4G6VB 3W5ZA 4CYUB 1N56A 4A8FA 2EC0A 4DR4J 3KJFB 4WTOB 1LQ9A 1UVNA 2BJ8A 2PDAA 2H4YB 3PW5A 2D41A 1S48A 3PEHA 4ZVEA 3EPGA 2WSFC 2WVCA 4ZVRB 2FJXA 1CLFA 5FDLB 3A13A 1HR0F 2RKIA 1SJQA 3M30B 4FYVB 2FYXA 4IH6A 5DQHA 3DRPA 3MEKA 2VHGA 4I0WA 4DV3J 2IY5B 1KQGB 5EN1A 3HJVA 1S59A 4K0KJ 1PJ5A 4R8UA 2K1RA 1WD6A 1TKDA 2K1RB 2DNZA 2PIIA 3CC7S 4KGKA 5KFHA 4PEOA 1EKRA 2HAFA 1U6FA 1OPZA 1KVJA 3IRWP 1E6VA 5KFZA 1JKHA 1AUSL 2GJFA 3D5MA 3L7OA 4JI4J 3G96A 1ZOTA 2G2ZA 2XMAA 2DTJA 5B09A 1GEHA 1VMBA 1X9SA 1KN6A 3OT9A 4LF2A 1KLNA 3AOBA 4L3NA 3GILA 1EETB 4RJVA 2WCXA 4H4OA 1ZAWA 2XQCA 4J9MA 4ECUA 2DRBA 4QYZJ 4ZP7A 2E9ZA 4GVBB 4OI6A 2X51A 3K5NA 2R42A 4X65F 1CS4A 4YQWA 4RW6A 3UE2A 4J37A 4RUBA 2VBXA 3H8YA 3LGHA 4L6V3 1SJFA 2GW8A 1HHQA 4C8MA 1NO8A 1S1WA 3J7Z5 4DPWA 1VRTB 3BH7B 3JB9k 2PEHA 4R5PA 1KNZA 3RAXA 3K8WA 2ZHOA 3SMZA 3GQCA 1RT3A 3D2WA 1NSQA 4NLOA 3PW0A 4RBVA 2MQ8A 2ZDPA 3CJSA 3MMBB 4LRDA 2KT3A 2MJUA 3I6PA 3LP1A 1OQ3A 4DSKA 4I64A 4Z7YA 3BBFA 4X4PA 2DKOB 4NX9A 1P6TA 2CZ4A 2EFVA 4DR5J 1Y5IB 2CA9A 2HPUA 3CCES 1IKXA 2LXFA 4LQ9A 1Y11A 4F4YA 5F8IA 1S72S 1JWWA 3FRYA 1NCLA 2C2KB 3TZXA 1SKRA 4LFAF 4Z37A 3DC2A 4LF7F 4LSLA 2DGUA 2O1PA 1H7WA 1T9VA 4FYXB 6FDRA 3K8VA 3J7YU 4X2BA 1UMJA 2WB4A 4USKA 3UCGA 1CC8A 4W90B 1I94F 1FJCA 2EVZA 1VIXA 1NK8A 4M5JA 3SI8A 2YKAA 4HH1A 4E98A 3HSGA 3MECB 4KKOA 2E44A 4PUOB 1A9NB 4K59A 4R0EA 2RS8A 4RL1A 4I7FA 3JAMY 1EAYC 5F8NA 1FKPA 4RUAA 4ELUA 4LQ3A 4L73A 3KLIB 1N6QA 4JI8J 1KTVA 2OPRB 2M88A 5CCLA 4LF4F 3G87A 2YWFA 3IN5A 1WWHA 1SKWA 1PJ7A 2J8SA 1WORA 2W4CA 1GMVA 1RI7A 4WP9A 2YX4A 3GV5B 3NEKA 4KPYA 2HG4A 4ANEA 3KK1A 2FUG9 3PNIA 4O4GB 1V9OA 4RO0A 4NLGA 2DXDA 3DOKA 4CO2A 1BXNA 1EARA 5HO4A 4ILRA 5AXMA 2RNEA 4CLYA 4X62F 4NZ7A 4Q45A 2SXLA 1NAQA 2FHMA 5LM7E 1Q16B 4PPZA 2OKQA 3ISND 1GTHA 3M1VA 2F3JA 4U9RA 2YY3A 1UWBA 3MPVA 3TJ9A 2DNKA 3I5CA 4ECVA 7FD1A 2Q79A 3GJQB 4C48A 3R5JB 4UQGA 4QIGA 1FRLA 5DQIA 3M8PA 3N5BA 2Q6BA 4BS2A 4LFCJ 2W9AA 2HVZA 3H98A 2G0IA 4WE1A 3D54A 5J2QA 1RKIA 2J5AA 2XZDB 2BQ3A 2UUCJ 2HQGA 4NLTA 2UVUA 4J9NA 3JXOA 3C15A 2F40A 2C2ZB 3CB4A 1DY3A 2KKHA 2ZUGA 4WTYA 4FKXA 4C4WA 1JNZB 4KFBA 3KHHA 2CJKA 1LOUA 3AAWB 4KFBB 2XLJA 1YJRA 3VWSA 2E5LF 2DK2A 5F3TA 1PSDA 1RT7A 3A3NB 3R97A 3N79A 4WXOA 5KFWA 3V81B 1F9EB 1EKSA 2LQ9A 4DL4A 1TFWA 3ELHA 5G0RA 4F4WA 5GAHU 2MY8A 1UWBB 2B9EA 3PEJA 4OX8A 1YWXA 4LIWA 2IVFB 3TVZA 1H73A 2QA4S 4DV2J 4Y28C 1U1LA 1F5BA 2XYGB 3J80U 5L46A 1T94A 4ZP8A 3J7ZT 3V6DB 1SH2A 3CCUS 3VAGA 1H7XA 1REVB 1MWZA 1H2VZ 2GVZA 2HS3A 2WK4A 3J7YI 4A8SA 1FKAF 3MEEB 1D8YA 1VQPS 5HVGA 2HWTA 3RBZA 1VQKS 3MMAA 2V63A 3Q2SC 2UV8A 4CTAA 5AJ3F 3PG9A 1O0PA 2LQ8A 3QJJA 4RNMA 2EFGA 3LAKA 1FJGF 1MMDA 2YPZA 1RA7A 2V8VA 4FPIA 2HZAA 4MIBA 5J2MB 3F56A 2OGUA 4FYDA 2GFFA 2ASLA 1WTFA 2W4PA 1OYEA 3TUZC 1BGXT 1S1TA 1BQNA 1UW9A 2MZSA 2ZBCA 4UZCA 3T19A 3VVUA 4KGXB 1HR0J 3TUPA 4DV6F 4JI2F 3HDSA 1U1QA 1DTQA 2PEBA 2BYCA 5B0GA 1YTYA 1R8BA 2XMMA 3L9ZA 4HACB 1NZAA 3V4MA 1T11A 2XZTB 5DZ7A 5C42A 1REVA 3Q8UA 1Y4ZB 2MZQA 2ZDOA 3T1YF 1RKJA 1J5EF 1YJ9S 4C8OA 2HHHF 3QPIA 4LVNP 3MEGA 3WX4A 2MXYA 3M32B 4OLOA 3HHLB 1C1BB 1FFWB 2DT9A 1PYOB 1FEHA 5DDRC 4B9TA 2AEJA 4FNHA 1F9FA 2M70A 3ENAA 1UZHA 4MYTA 3TAMB 1IKXB 2HBRB 3PRVA 2MHNA 3MEDA 4FF1A 4DBQA 2DHAA 4KH1B 2W2QP 4ID8A 5L39A 4ALZA 1XN9A 3QZ8A 2OIHA 5CA5A 1EJ7L 2YH1A 3HLUA 4IR1A 4U67Q 2DISA 2KJWA 3FZ2A 3R9LA 6AT1B 5B0EA 4YY3F 2R7OA 3S1TA 3G6YA 2GMJA 2OI2A 2P5VA 2OP5A 1BMQB 4A8XA 2QLFB 4ZPWR 4CLFA 4OZ0A 2YKOA 3TQ1A 1C2PA 5JUMA 2X1GA 5CYMA 3HK2A 2M52A 2C3PA 4PABA 5U47A 4ZVOB 1DTTA 1YRUA 4U7UD 4OI4A 3AY0A 2MY7A 1X31C 3VGUA 4KBIA 2ZZNA 4LFCF 2CQHA 3PXGa 5KFVA 1VRUA 2CG8A 5ITHA 4JI8F 4F4ZA 2LA6A 2A2DA 5A76A 3ADAC 4XAKA 5LOQA 2CIMA 1M1GA 4Y34A 3W8GA 2R7VA 4C98A 4O44B 1TP7A 3FBBA 3JTPA 4MFBB 2HRYA 3NAHA 2M3DA 2AU0A 2HVEA 1N0UA 2P9CA 3TUJC 5DQGA 4ANCA 4AXIA 2UXDJ 1DBDA 3C6TB 3PW7A 3GPAA 4LIRA 5CYQB 1FD8A 1KKHA 2R2SA 1YGYA 2GVDA 3SCLE 4FF2A 4RX6A 4OYAA 3UN5A 1Y9OA 1GFWB 3K7RA 1RGVA 2CKWA 2VQEJ 4F4XA 4DR6F 1OY6A 2EW9A 3WC0A 3HXMA 4O3OA 3OBIA 1YSJA 1S1XA 3IBCB 4QWCA 2UXDF 3ETMA 2WVFA 5D4OA 2MHEA 4FVMA 4PYAA 3RZAA 1HI0P 1U4BA 2HQ3A 1CQMA 2XG8A 1NB7A 3SYZA 1NU4A 4DFPA 1S9FA 1F2GA 1T95A 2ZH1A 3HVWA 1YZ6A 1JLEB 1WHXA 2MQLA 1PYSB 1NPRA 2CPHA 2DRAA 1UFWA 2X3GA 1IKWA 3DLKA 4Y0FA 2VQFF 4WFYA 3CNQP 3AT1B 3TAPA 2KRBA 3BB5A 3DRXA 1T9WA 3GV7B 2KO1A 3BYPA 3O6QA 1ZM3A 2IM0A 2K7JA 4HH0A 3TWZA 3ZZTA 1HWKA 4R25A 3B82A 4DUZJ 1X0FA 4LFBJ 1N34F 1QAJA 1KHWA 3U1MA 1WJ9A 2VZ9A 3AXMA 3UI3A 2IA6A 4EO8A 1NJZA 1RLDA 2DY1A 2D3UA 1RTDB 2VICA 3Q8YA 2AJ2A 5M2UA 4IG0A 5ETVA 3IMQJ 2KH9A 2VKRA 1FRIA 1J5OB 2O67A 4DG1A 1OWXA 3HHEA 4YDXA 4HL9A 5KG5A 4DV7J 2L08A 1LEOA 3ENQA 4MKVA 4EYIB 2BKPA 2BW2A 5CHCB 4ED2A 5EDWA 1I3OB 2VUGA 4DR2F 1N5YB 3SQOP 2H1YA 3WC2A 3L7UA 5D15A 3MM5A 1S6QA 3R1HA 3NS6A 3UQSA 1HBUA 4BHQA 3EM1A 2R4FA 3O2IA 4GO7X 2I5JA 3KHGA 4KTQA 2XI2A 2FJDB 5HN0A 3CMES 3GU0A 2ZM6F 3CW2C 2HFNA 3M2VA 3CO9A 1CJUA 2HYIB 1X5PA 4IO9Q 2BANA 2LXIA 1JMTA 4Y65A 3QRQA 2G0JA 5KG2A 2QFJA 5LMUJ 3MM8A 3AHPA 3RBEA 2CQ3A 2EPIA 2Q3PA 5AJ3J 4U6PA 4DMZA 2BDPA 5HLFB 3CJQA 4TQSA 1NJIT 3BGOP 4AYBD 3UR3C 1W2BR 1K1QA 1K47A 2L9DA 3F0NA 1AZSA 1S12A 2IJNA 2BRKA 3C66A 4LJMA 4DHVA 2Y9HA 2R7QA 3TX8A 3NOGA 2BM0A 2AW0A 1PBUA 3CJRA 3SCKE 3A8IA 2H48B 1OJ4A 2DNQA 3K5PA 4QIFA 4HT7A 3GWCA 3RAQA 2BJDA 4IH7A 2OPPA 4C8LA 1FRJA 1IWGA 4IRCA 3ZNJ1 4QYRA 2AYGA 4Y2MA 4A8YA 4F3MA 1OSDA 2OFHX 2QGFB 4BBYA 1NJYA 3J81U 2NQPA 5DZ6A 4HLBA 4WFXA 4A48A 1BQMB 2AJ1A 5F0UA 2ADCA 1B64A 2QYGA 4LF1A 1SBRA 2OLWA 1Q81T 4DUZF 2F4VJ 4KYZA 2KFYA 2KL8A 3HULA 3FQKA 5GAEU 4RW9B 3C6TA 3Q89A 1BLUA 2BVZA 2QC3A 2HK3A 3IAS9 4JP8A 4J9KA 3CULA 3D66A 1URNA 2ZH3A 4JYAF 2ZKUA 2GIFA 3K5OA 3HSDA 3MMAB 2NZ4A 2ZH4A 3WX8A 1NRKA 1W26A 3I0SA 4P2SA 4LRCA 3CPWR 1SKUB 1N52B 3M30A 1PCAA 1Q0NA 2A18A 3VVTA 2Y8YA 3S7RA 1IBKJ 4I67A 3IS9A 1XJWB 3VAIA 4GRSA 1U49A 5B0DA 2M8HA 1RDRA 4WIQA 4DCJB 2CNLB 1AROP 2XGPA 5A2QY 1FTCA 2CJAA 5HMXA 1WSVA 2NXNA 1RWKB 4K2JA 4HACA 1WKJA 1IBCB 2B3TB 2VG6A 4ZVTB 3M9NB 2XS5A 1NEEA 3F41A 3QWPA 4EMDA 3W3SA 3CDEA 1QAXA 2DNNA 3FSXA 3FBFA 3K2YA 2R9LA 4JI3F 5KG3A 2PFFB 1O51A 3KLIA 1VC0A 2UU9F 1S1VA 3AA9A 2XO6A 3G8SA 2B9WA 2AWZA 2IA0A 2QLWA 3QSYB 2IVYA 2DH8A 1BD6A 3ZXWA 3IRXA 4ER8A 3UD5A 1AYEA 2B4VA 3EE3A 2P6TA 3TA0A 1H74A 4KHMA 5DGAA 4DUYJ 1VQNS 4MT1A 1MMLA 4GKKJ 1RT5A 1WOPA 4M5GA 4URQU 4Y2AA 3EPIA 1JLGA 1VI7A 5GADI 1KD1T 3RBXA 2YNGA 3W7BA 3SQGA 3GP9A 4DL2A 4EBDA 2FPHX 4IG3B 4QIVA 4USUA 2IDEA 2BJ3A 4KO0A 2ZNYA 5GAGU 3MM7A 1IBLJ 1CULA 1U26A 1R6VA 1FDBA 1JXVA 1IM4A 1NPPA 3OD2A 4ICLB 4M5MA 4DEZA 1O8BA 3KMQA 3SXLA 4NLRA 1CG2A 2FY1A 4PG5A 2EK1A 4ED8A 1GXUA 4EBEA 1F2HA 3IBFB 1RTHA 1EQMA 2C3OA 3DM2A 3P3DA 4OHVA 4QR1A 3JSMB 1VQYA 4OZLA 3A12A 1W2IA 3K57A 5HLFA 1HBOA 4J9OA 2N82B 2BE7D 2YKMA 1RP5A 1S10A 1HHSA 2N3OA 3RYLA 2BJ7A 2NYHA 4XTTA 1X60A 4NCGA 4U96A 4WFNQ 2VF3A 5A8RA 4ZK7M 4N77A 4C0HA 3MUTP 3UD3P 1FRKA 2NS1B 4C3LA 2QIFA 3PRDA 3SQGB 1T9XA 4B02A 4C3MA 3GCWP 3EZ5A 5C25A 1BWEA 4PKDB 2GHWA 3TA1A 5FJ4A 3GIRA 2CPDA 1PC4A 2BJ9A 2BKNA 3QQCD 2DIUA 1KBRA 2UVRA 3FBCA 1U47A 4OI1A 1ZH5A 3I32A 1X4AA 5LMUF 1CJKB 2EFNA 2ERRA 1RXOB 5KFTA 2HHUA 3BPDA 2AD9A 3U02A 3H4BA 3DYAA 1N48A 2BACA 3IRXB 3BO4A 2BRLA 2GV1A 3Q8QB 3DI6A 2QRRA 1FNOA 4ZPVR 3TYTA 1WACA 2KRRA 2JLGA 4QR0A 4W98A 2DPJA 2DXEA 3IGNA 3UN3A 1DLOA 4RWWA 2BANB 1NUEA 1RCOB 2WBRA 3LWMA 4O3NA 2Q43A 3T1HJ 2VG7B 3CJKA 4UY8T 4UOGA 2LVWA 4QZVB 5GAEI 4OI0A 4GKJF 2HSEB 2PI5A 3CCQS 2H3EB 4LFBF 4I6YA 3R7SB 4MKBA 1VQ6S 4ZVFA 4F0KA 2HVIA 4PUOA 5CAAA 2QLJB 2KJVA 2LEPA 1UEVA 4RW4A 1NSKL 2OTJS 2HHXA 2GGPB 4CNYA 4OMFG 5DGBA 1I5OB 1MLAA 5C42B 4G1QA 4C6AA 2W4DA 4RZRA 1RQ0A 3BM7A 1B0TA 1EETA 5F8GA 2VH7A 3UO0A 2HNYA 3KUGA 2JEGA 4CDIA 2FLPA 3THPA 3W9HA 3CT9A 5DJBA 1Q4RA 3HKZD 2XMWA 4P2XA 2XNQA 4XIUA 1LXJA 4P72A 4CM2A 5JVHQ 2OPSA 1LKZA 3CUNA 2HLTA 2OHDA 3TVYA 4ED0A 1MWYA 5CD4A 1RHKB 1KQFB 3OPKA 3L7PA 4LR9A 2BEFA 1U2CA 3SCJE 5DG9A 5SZTA 2HNDB 5KFDA 3DLGA 1FK9B 1IR1A 2B0GA 3GYNA 3EZOA 4FP9A 4I7FB 1F3VA 1OPIA 1U7LA 2GVZB 2B8PA 3B4MA 3NY0A 3QBCA 4KPCA 1HKAA 1SCJB 3W61A 4ZPAA 4QW9A 3Q24A 5IV4A 3T9NA 2WOMA 4LBPA 1G1XA 1NPKA 5KT6A 3HP6A 1GT8A 4CTAB 1SV5A 2KHDA 1ICEB 2VFUA 3TW0A 3E2EA 4ZN3A 3P49B 2IVMA 4I2PA 3CD6S 4GVBA 2EBEA 1UCNA 3HZEA 4TYAA 2YWWA 3CCLS 2AGQA 1RT7B 4JI0J 1RISA 3ZTOA 1JJ2R 3JTNA 3MPYA 3P96A 2IYGA 4NOHA 4N47A 3PIOQ 2RD5C 2Y1JA 2CNNB 3P6YC 2DNMA 5G4DA 2R8KA 8ATCB 5FD1A 4K4WA 3DMJB 2VC0A 2E9TA 2DHXA 3DDKA 1G6BA 3DLEA 1FRXA 1ZM2A 2DYAA 2ZD1B 3Q8RB 1FCAA 3EDQB 1YKWA 4Y2CA 5DDOC 2HZCA 3SDEB 3PR5B 3MUMP 1QVGR 1M5KC 1LWCA 2IBOA 1QY7A 1HD0A 2QG9B 2OSRA 1SC6A 1HQUB 2RMLA 1RTJA 3N0VA 4WXWA 5IC4B 5LSLA 3GZ7A 4NLYA 4ICLA 3OJUA 3NMRA 4KT0C 2YXLA 5D3GB 3W2WB 1R0BG 2DR6A 1S1UB 4LT6A 1R0AB 2UUAF 5BYQA 3N01A 4DWIA 2J7WA 1H72C 4AQYF 1HWLA 1DAXA 2W8KA 1NBEB 2J7UA 1ZETA 2VODA 3MDFA 3DRRB 3BPSP 3FCHA 3IGVA 2PA8D 1R31A 2Z0GA 4LSLB 2HNZB 3NWGA 5LXRA 5IT9Y 2ZHBA 4JV1A 2WW4A 1LV5A 3GMGA 3QAEA 4IH5A 3WQPA 1FK9A 1FKOA 2E66A 2OD4A 5ETQA 2DIVA 2PFDA 3CO0P 2V2KA 3MM6B 3VGVA 3UDVA 2ILYA 1XNRJ 3NS5A 2DGXA 2HQIA 3D9BA 2B7BB 3HI9A 1XNQJ 1TTHB 4M63A 4GKJJ 1R27B 3LP1B 4ZN1A 1NSAA 3C2PA 4J9VA 4O23A 3ZZOA 4EBCA 4NCBA 2G0CA 3OLBA 2DB1A 5CXTA 1PBAA 1U8SA 1WHYA 4O3QA 1KLMB 3H20A 4NZ6A 1HPZA 4Y6IA 2K3KA 4LVOP 4AT1B 5EHHA 5I42B 3CCMS 2J6TA 4B9NA 3G6VA 2E7XA 2YX1A 1B7FA 2G2YA 1U0HB 3HHLC 2CQ0A 2B4PA 4HT5A 3IXQA 4LF6J 1MROB 4H4MA 1A0OB 1X5OA 5K8OA 1UJ5A 1Q8IA 1V3SA 2KB2A 2RU9A 4HDGA 1GQEA 3P5TL 1B7YB 1VK8A 3EGWB 1XR7A 3W8PA 2XZWA 3JYTB 4KJIA 2BQUA 3LA0A 2I6WA 3R5DA 3J80Y 3I4PA 4ZHRA 3IWLA 2YQ0A 4NA3A 5IFMA 4M5HA 5KFKA 1HNZF 4DV2F 3FZBA 1NLKL 1C4CA 3PDNA 2DXFA 4J9SA 1NDLA 1QM9A 3BV8A 3I82A 3QZ7A 4DV6J 5J1EB 1APSA 1HBOB 2RQ4A 1EZZB 1F1BB 3OR2A 4EEYA 2NXCA 2VG5A 1E6YA 1M5PC 4LF5F 1YX2A 4OJ1A 3BDPA 1Q79A 2EBGA 4ELTA 3R8YA 2FZCB 3QIPB 3BGRA 4FYYB 2MSSA 2R7TA 3R5BA 5E3RA 2RS2A 4KGMA 4KC5A 1RHUB 3GYGA 3M2RB 2XYHB 3PW4A 1K8AT 3LOUA 3D6FB 3ZZPA 2CZVC 8AT1B 3H25A 3LUYA 4RU2A 3BGUA 1CJVB 1LK7A 1TU0B 4F3OA 2KZMA 2D3O1 4JI6F 3DKDA 4J9UE 4YOEA 4KAIA 4ZPBA 4F7VA 5DDPC 5LMNF 4IQXA 4DF8A 3AD7C 3I96A 2U2FA 4ID5B 3CDAA 2NXJA 5L8RC 4DL0C 4WKYA 5BR8J 3KK1B 3GIIA 4DR2J 1GMUA 3QIDA 4DDFA 3W64A 4ETZA 4J9QA 5EWGA 3LP2B 5D4NA 1RYRA 2C42A 3JSRA 2ATLA 2C2EA 3UWTA 2CWKA 2JEFA 1X4GA 4CLTA 4I6AA 2MKSA 1SC1B 4I2QB 1JNRB 2RE1A 2QMUB 3QFHA 4OQJA 3P45B 1BE4A 3D0IE 4UOHA 2YNFA 3LP0A 2D3OR 2QSFA 2D69A 3ETOA 5HANA 1HL6A 3NGUA 5CABA 3KFWX 1KC8T 1AW0A 3FRZA 3ICLA 3KJNB 4IFYB 3JAMU 4YHHF 1CSJA 1JLBB 3L95X 4X64J 1X9MA 1DZ5A 2E5LJ 2F5GA 3U7JA 3NG8A 2KU7A 5KG7A 5DRKA 3M6VA 1QJHA 1IN0A 1WF1A 1HBUB 3IWNC 2L48A 5HJYA 3KNAA 1SJ1A 4P2MA 2BA9A 2CQPA 5IQQA 4ECZA 3ITHA 1NKCA 5D3GA 3R2CJ 2D3ZA 3K59A 3MZIA 2P9EA 4ZVSB 1VYAA 3M8WA 2XTJP 1DTTB 4W4MA 1P1LA 5A0YA 3KG0A 2EKYA 5AE1A 1EB0A 1Q86T 1HBMA 2YKMB 4F36A 3M8QB 2JVRA 2R7RA 4WF9Q 3V6HA 3K17A 4LF4J 2AZ1A 4UOFA 3EXYA 4O3SA 1OIAA 5KT3A 4U95A 2F63A 2QTWA 3EJMA 3G82B 1TKTB 2X1BA 4ZJOA 2ZH8A 2RRNA 2CG4A 2MYFA 2PN6A 3DU6A 5LXYA 1C0UB 1CC7A 1XR5A 3C6UB 5KT4A 2XSJA 2DRDA 4YS2A 2HMIB 1SI9A 3D1OA 1JLAB 4LSZB 4UY85 3FUYA 1HNIA 2CPFA 3DU5A 2HFSA 2YWEA 3I9ZA 4M5KA 4RNOA 4JV2A 5J2NB 2IAJA 1AUDA 1PIEA 4I4BA 4ATNA 3G6ES 2MPUA 2O01C 2F8EX 3VGSA 4AFFA 3MR2A 4B3RF 4X64F 4ETXA 4YHHJ 5HROA 4OZ3A 2DBBA 3HF5A 1X4CA 3NGTA 1ZYQA 3KLFA 1XMQJ 2CQCA 4USIA 2OO4A 2XMTA 3TRGA 5J2PA 4M5DB 3F73A 1QVFR 3NP5A 1VHIA 1VISA 2DNLA 1RJJA 4NMXA 4B3TJ 4NXMJ 3KOAA 1HQEB 4BCAA 5HQMA 2DHSA 4USTA 1ZPVA 4RW8B 4O0NA 4QPXA 1SKSA 1IKYB 5JXSA 3RR7A 1IBKF 1KTQA 3NCQA 3CD0A 2JC1A 2W7AA 1SUQB 2B6AA 4BLGA 2PE8A 3UVJB 4IOCQ 3NNCA 5T41A 4K5SA 2YKNB 3GYXB 4I1TA 4P71A 2WSEC 2YKNA 3CCZA 1XTZA 2PA3A 4ZHRB 5IM0A 2R7XA 2OMOA 4TXSA 3M8RA 5DLFA 1HNVA 2C2OB 3QNWB 2VPXB 4RKUC 5IS2A 1JXLA 4C3KA 4F02A 1U1KA 3Q8PB 1YRTA 1UAWA 1V3RA 2M7SA 1QUPA 4F0HA 2UVWA 3NNAA 4LMZA 1G2EA 1K0TA 2DITA 2HFZA 1D3WA 4DFJA 4ILLA 2KHCA 4MJKA 1VQSA 2HGLA 4JI5F 1DJ0A 4AL7A 1J5EJ 5KAKA 4B9LA 3GE9A 2BJ1A 3PX6A 1QAYA 5SUHA 4PG8A 3OLAA 4JV0A 5AXKA 1RTIA 4R0JA 1X9WA 2B51A 1TL3A 3PO4A 2YWGA 5KFLA 4NXNJ 3N6LA 2LCWA 2V67A 3T1HF 3D7SB 2HW3A 3W66A 4YB5A 2RU3A 4N41A 4NMLA 5F9LA 3I5AA 3PYFA 3BH6B 3DYAB 3CDWA 1Z2ZA 2GIRA 2BBEA 4QJVA 4KV8B 4OIXA 1U6ZA 4NI2B 3TO8A 2AEFA 5KFIA 3M2VB 1HNXF 3CCSS 2DR8A 4J90A 1F5AA 3GR0A 2RHSB 1VOMA 2FDNA 4G65A 3OSPA 3BREA 4WKRA 3IWXA 1U45A 3MGJA 2AX1A 1IM6A 3BQ2A 2FJWA 4JI1J 2CQ1A 1L5UA 4QWBA 4GVLA 4FXDA 1FA0A 3FFIB 4A8KA 2WVEA 3DLKB 3HJFA 4QU6A 2J6SA 2ADBA 3X1LB 1HFEL 3BDEA 4NEZA 2G1HA 2F1FA 1Q7LB 1N34J 2IRYA 3HKWA 1JX4A 2WONA 1L3UA 4P7TA 2FLLA 4UTGA 3GB0A 4DV7F 2FB0A 1FWLA 1FDNA 1UEKA 1NK0A 4DPUA 1NJXA 3A8JA 4OX7A 4O4GA 2BW7A 4NE9C 2MKHA 2Y0SD 4OLPA 1TL1B 4DL5A 2Y0BB 1YITS 1HI1A 1TL1A 4PCQA 1EP4A 1TL7A 2G1DA 1KEKA 2YWHA 2XLIA 5LSRA 2R8IA 3NBPA 3BO3A 4OV1A 2LQBA 3DRSB 1RT1B 5HBMA 1RT1A 5F8JA 3Q86A 1P8GA 2YNGB 3HVTA 4P74A 1U8WA 3EUNA 2YTCA 2E5GA 2XS7A 2W9CA 1KONA 1TL3B 4OZ5A 2NLWA 4U8VA 1Y3KA 5D4LA 3J81Y 4F3QA 2PMHA 4LRAA 5F3ZA 4C8NA 1QDUB 3MWBA 3QLHB 2XHWA 1PKUA 1V5VA 4Q2MA 3SSQA 1Q7YT 2IM2A 2ZC3A 1LWEB 2K8GA 3I4HX 3MEEA 1M5VC 2BE2B 4P7VA 1NXIA 4UUWA 1BWVA 1RWMB 2BE2A 1P1TA 3VQSA 3UR0A 2V4RA 3CDUA 2J9CA 3R1LA 4NEYA 2KFNA 2IIHA 1S99A 3NKYA 2W9BA 1WF0A 2DO0A 3G2XA 1K44A 1Y00A 2VKZG 2N4DA 3NBPB 4IG0B 4PXCA 4EGLA 4RNHA 4F04B 4LF8J 2JFKA 2ZOFA 4ED5A 3EMTA 4ERDA 4PWDA 1TV6B 3FSIA 2E29A 3MD1A 2KG0A 2CJYB 1P9YA 4CQ1A 1L3VA 1EIYB 1NDKA 4IRDA 4ECXA 3KNGA 1F6TA 4MKAA 4NRUA 1QSLA 4CT9A 3GFXA 4H4KC 1URRA 4IDKA 1KQKA 1HD1A 4JI3J 2ASYA 1RWPB 3BN4A 1X7VA 3GONA 5C2GA 1I51B 2BKOA 2YVSA 5EX3A 4WWSA 3US5A 4DCPB 3VALA 1PILA 2HIYA 4ECQA 3T41A 1XWLA 4TLQA 5FDLA 1TUGB 2QL7B 2E1AA 4U7CA 4QR2A 1GMWD 4PG7A 4USMA 1WDDA 2IHR1 4L72B 5T7LB 4QPTA 3QRRA 4DX6A 4S0MA 3BGFA 2CQBA 4OV6A 5K20B 1HI8A 3IR7B 2Z2MA 4ZVPB 3OHAA 2LQJA 1HWJA 1I1GA 2HEKA 5LL6d 3T1YJ 1FF2A 1UTAA 1O5JA 2KVQE 1BQNB 2WHOA 5ETPA 3OL8A 3HVAA 1RE1B 1VLYA 2HZVA 2AHOB 3GG0A 8RUCA 4OI2A 3BSNA 2NXUA 1VQ4S 4ZPDA 3SSSA 3OL7A 1S7IA 1R0CB 4DR1J 4XDDA 2HMIA 1TKZA 2V94A 5CYQA 3M9MB 1ZPWX 3MM7B 4NA2A 4X66J 3BKTA 3AQOA 4A8QA 1RAHB 4HTJA 3LTOA 4K4SA 1RWUA 1VGYA 2GMHA 2HQCA 3RR8A 2LEBA 2XNRA 5I3UB 1SJ3P 1K1SA 2FJAB 4AL6A 1DURA 3BYRA 3DRYA 3SFUA 3PTWA 4I2PB 1T3OA 3M8QA 3WZ0A 5HQ8A 3RTVA 1P9QC 4Y2KA 4Z7CA 1WEZA 4B17A 3HT3A 1U09A 3QGGA 3THTA 3OVBA 3EZUA 3HHDA 2XCAA 3IM9A 3DRRA 2HHPA 2HHSA 2CJ9A 4DZDA 3C8YA 3SFGA 2MKYA 2RVJA 2HWHA 2V9KA 5KG1A 3MR3A 3T5LA 3E3XA 2D7SA 2CNKB 4C97A 1GAOA 2QN6B 2VFVA 1KFDA 5C25B 3DLGB 3BO2A 1H38A 1IVZA 4DQPA 3FEYB 2BABA 5CH7B 4GC6A 2J0SD 2HS4A 4MAKA 2PT0A 4OX9J 4UW2A 1RTJB 5KFBA 3RG6A 1XMOF 4KR0B 2OTLS 1RHQB 4NZ0A 4RBUA 2ZZTA 4ZLNA 1R8HA 4N7TA 1HNVB 2GO8A 5IXUA 1S6PB 2R7UA 3BEGB 2HKEA 2P8IA 3IAM9 4QOTA 4ELVA 4WK1A 5EUHA 2K2PA 1HBMB 1UW4A 2MTLA 3OR1B 3AJ2A 1RT2A 2H51B 2WB1D 4OZJA 2Z2YB 2WW8A 4MK8A 2X1AA 1RADB 4R8UB 3IA0A 2DNHA 2O66A 4WBFA 2OAUA 2ZBQA 4K4UA 2WVBA 4C0OC 2V8GA 4M5IA 5K5MA 3RB4A 3GIJA 4ECTA 4I69A 2VPZB 2RDJA 3KXDA 2BUNA 1G3OA 2JH3A 2VB6A 4ZA1A 2ZVIA 2MKCA 3PHEA 2RAQA 4HTIA 4QW8A 5FLXU 1C1CB 3D0GE 3WDOA 4DX8H 1WG4A 4C8YA 1J27A 5KOXA 4KV8A 1RT6B 1T0TV 2PO4A 3GSDA 2XC9A 1HPZB 2MZRA 3M6XA 2AP6A 2AYMA 1NHUA 2RHQB 4OZ1A 4OZ2A 4PXBA 1NK6A 3OR2B 2FQQB 2L9NA 3OTDA 4DV0F 1S1WB 2LYVA 4X66F 4BC7A 4D3HA 4CO1A 2Y8WA 2XO7A 3O1LA 4I2QA 4KHPF 3M6UA 3NMAA 3MR6A 1TMMA 2V6AA 3DN9A 3GJRB 3P4UB 2QX0A 2RDIA 3ZZRA 1FKOB 4CLWA 3KJVB 3OFFA 3L3CA 3G71S 2UP1A 4K4VA 2MLZA 3MECA 4KKOB 3UD4P 3D67A 3V6DA 5ETOA 1VLOA 2NCKL 2YKQA 2CPXA 3D1HA 4PQAA 4B9UA 2V8PA 2ZC4A 4WP8A 5CZXA 2WOMB 3H5SA 5ETLA 1RWNB 2BMBA 4C2MA 5HAOA 2CADA 2KXNB 3VAHA 4OYOA 2PD1A 1GMWA 4LREA 1H0HB 2JL9A 4XK8C 2VBZA 4USJC 4YN3B 4KE5A 1IKVA 4LUBA 3WHIA 3RB3A 4Q2LA 2EFOA 4F0MA 3BJYA 4YFUA 5MAOA 5KFOA 3OUYB 1N0VC 2FTRA 3BGRB 3Q0AA 1RYSA 4O44A 3MFHA 3G82A 3PJWA 3DNCA 2YNFB 3FCVA 3LP0B 3M4XA 4TVAB 5F41A 4CT8A 4FVCA 4DN9A 4DV4J 3DGPA 3TNVA 2XBPA 2VJVA 5DG7A 2HRUA 5H9EK 2FIUA 4KSEB 2C3YA 4HHHA 1UA0A 2W25A 1TAQA 2OSQA 2YBVA 1Y5LB 3CIZA 4DX5A 3OJSA 1CJVA 5ETTA 2VFTA 1CJKA 1S9GB 1KVKA 5FIIA 4D3GA 2DH7A 3KK3A 2BV3A 1RBAA 1FTRA 2DNOA 3W2VA 2VPYB 4ID5A 4DLGA 5IT9U 5EWFA 3HHLA 2R8HA 2GO9A 3D6TB 1S49A 1S77D 4EO6A 3QGPA 1N5QA 3OVAA 1QSYA 1SIZA 5CCMA 4TU7A 4ECWA 1V5IB 4CLPA 1RHJB 2CVIA 3AOCA 1RLCL 5KFNA 4WCEQ 5HMYA 4ZDNA 2XMKA 2ZH6A 3KLHB 4B3MF 4H4MB 1REGX 3NAIA 2HQDA 4DL6A 1JJHA 2J76E 3H4DA 1UEUA 2E1PA 4RU9A 2CPYA 1X4EA 1AZSB 4XDCA 2VIHA 3FK4A 1UL3A 1HBNB 3QT5A 3IBWA 1TZ0A 2UUBJ 2BX6A 1FKPB 2QT7A 3NOCA 4YR0A 1P27B 4JV5J 4U7UK 4ZP9A 5J1NA 2R8GA 2DNYA 3H59A 4DS4A 5RUBA 1TR0A 1N36F 2JNJA 2XWYA 1CPZA 1S0VA 3T5HA 4NYPA 2ASDA 2RQKA 1ELOA 5MLCV 3LF0A 1N5SA 1VQLS 3MUVP 2E1CA 4AL5A 5LSOA 2QMWA 3UCUP 2HBZB 3FEXB 4FN5A 4H54A 1JLFA 4QWDA 3KLGB 2C2RA 1YIJS 1EX8A 1JLFB 1FXRA 2X7IA 1XMBA 1U0HA 4DPXA 4DUTA 4DZ6A 4Z2XA 3V6JA 4DG1B 2DY9A 2GNKA 4X4QA 2VFSA 3GJSB 3I55S 1XMQF 1QAIA 1JIHA 4ZJQA 3T5JA 4NWBA 5AXLA 3KUHA 5D77A 3JQJA 4PWWA 4IUFA 3MR7A 4Y2IA 3G8TA 3ZZYA 1FO1A 1HA1A 3FQLA 3VR1A 2E7VA 2AZ3A 2QLBB 1F0XA 4PR6A 4X65J 3KLEB 1SL1A 1N8RT 3SDEA 1U0SA 1NM2A 2IMOA 3H90A 3Q22A 4LF5J 3OXLA 4WFBQ 4FXWA 2RRBA 3HX9A 1R7IA 3VZHA 1MN7A 3H7HB 3HFVA 1T9UA 4V19X 2YNHA 1YI2S 5M2RA 3BSCA 3N9UC 2W8LA 3T6JA 3D28A 1RT4A 1JLQA 4F4AA 5E0OA 2EFPA 1F5CA 1D9DA 4IOBA 2QE5A 4P52A 5IC6B 1FRHA 5L1IA 2V4JA 1CS4B 2Z58B 3E01A 3MEDB 2QMXA 3LALA 5DG8A 1SJ4P 4OFZA 1L3TA 4YB7A 1FI4A 4RPFA 4X62J 2JC0A 1NK9A 2UVVA 3OTBA 4CWBA 3P8BB 1QSSA 1LFWA 2DGTA 4EI2A 2ZM6J 2FJVA 2VA2A 3BR9A 2IM1A 3IR5B 4PPDA 2DR5A 3TJAA 4RUCA 5LJ5Y 5KFFA 4YR2A 1LWCB 2XEXA 4NLSA 4QU7A 2D1CA 1CJTA 4WJBA 3MURP 4DR5F 2ZOMA 3FJ2A 5J2NA 4JI7F 1N33F 1Q82T 4NLVA 2AJFE 2EK6A 1QTMA 4U8YA 2E7WA 1M5HA 2YX7A 4Q44A 3AFGA 1S1UA 1RK8A 1LFPA 4N56A 1T05B 3M8SA 4E8UA 1PGZA 3VGTA 3T3FA 3ISNC 2J9DA 4O0IA 4DR1F 1H3DA 2G13A 3A8EA 2NYIA 3GCXP 5C24A 3W9JA 4DPOA 3HMJG 3HVRA 5HVHA 4ED3A 4URGA 4BWMA 1SL0A 1BQMA 3X3UA 4C7QA 1RZMA 4DFKA 3CD5A 1VRUB 3HT0A 3MAQA 1Q53A 2HNZA 1SQEA 3CXCR 2CQ2A 1NDPA 2PI4A 5KG4A 5CYJA 1PYTA 1GH8A 3AOAA 1RU2A 4FF3A 2OMLA 4AXJA 4IG3A 1S9EB 4NYOA 2DH9A 2POKA 3BBBA 4CI0B 2K7KA 1SQFA 4P73A 2MQMA 2UUTA 4WK3A 2NPFA 2ZH2A 1Q78A 2HHWA 3MAHA 1I6JA 1VQ8S 4USWA 1LW2A 1X5SA 2RH3A 4FPRA 2RF2A 3MCSA 5K8PA 1UJ4A 4H4OB 4N8OA 1M5OC 4KHPJ 3ZTPA 1WC6A 2XY7A 1YG0A 1KLMA 2Z2LA 1YJNS 5HP1B 2CJQA 3EVOA 4O4RA 2ZH5A 4ED6A 2AIRB 2RJZA 3N6NA 4MIAA 2E5JA 1RAAB 2H4WB 2VG5B 1X4DA 3RUBL 2XCPA 2ZH7A 1IUJA 5CQGA 2XB2D 3MM8B 3I0RB 4CLKA 4J9RA 3NXZA 3F44A 2OPQB 2UU9J 3FBEA 2FHKA 1TK5A 2AYBA 4TKTA 1B3TA 3H2UB 1S4EA 2B43A 2HBYB 4KY3A 3VCDA 4A46A 5BR8F 5FLXY 2JHEA 2Z2ZA 3AH6A 3R7NB 4ZLPA 2H5JB 4KO0B 2J9EA 1HYSB 4A8MP 1G7CB 1YK9A 2MDAA 4DR7F 2HFUA 2XULA 2MMYA 1S6QB 3ZZ0A 4X84A 4B3SJ 1AFJA 3EGZA 2WONB 3NS7B 2LLZA 4EUVA 5KG6A 4CH1A 2D9PA 2A10A 1NMEB 3NCRA 4P2FA 4Y00A 5M2PA 3ITHB 4JI2J 2XYPB 3B6BA 4CLLA 1WDTA 4G1PA 2DNGA 2R2RA 1W25A 3SBMA 3QFWA 2L3MA 3KK2A 1MG7A 1DLOB 2I38A 4UOCA 4HI1A 1J5OA 4JI7J 2J9DE 3DRSA 1Q5VA 3PHTA 3OTOJ 3W62A 3POTA 1YJWS 9RUBA 2AJQA 3AA8A 3O5TB 1TUWA 4J5OA 3IG1A 3VV2B 1DTQB 4RW8A 3UN2A 4Q5VA 1C0UA 4PQUA 1FT8A 3A1YG 2LXUA 2UXCF 4OZNA 5ETNA 3N4WA 4FS2A 2KI2A 3M8YA 2QO3A 4TLRA 3M8PB 1J2VA 1N6QB 4YMEA 4USVA 2RF2B 2UXBJ 1YDLA 4MIWA 2A6OA 1ITPA 4P75A 4B3OB 1WEXA 1WTBA 3LH2S 4WU2A 2IPOB 2KZZA 2RILA 1T9TA 1WC0A 3PV8A 2J0QD 1SV5B 2LQ5A 2JLFA 4FDFA 3RBDA 3AQPA 3MAAB 4QIWD 3S01A 2H9ZA 2PMZD 3MAAA 1KOOA 2FY8A 3DHWC 3H42A 5KOWA 2OJ3A 1N33J 2B5JB 2V4JB 4K2XA 4M94A 2KDOA 1LWXA 3PVXA 4OX6A 3CJ5A 3MFIA 1VDHA 3DOMA 3DLHA 1RU1A 3EVWA 4TY8A 1FRMA 4WPAA 2Q6CA 4ZPTR 4ZIWA 1S79A 2FLOA 3T1AA 3M2RA 3TZWA 4ZCKA 2MGZA 3QGHA 1D09B 2FJEB 1UFLA 4XO0A 1RCXB 2PMWA 3I56S 2XMJA 2KXHA 2QA2A 3CEDA 2F9JA 3FCWA 2DR7A 2W2NP 1RB0A 3NL0A 5THWA 1F60B 1S0OA 2NUHA 2YNIB 1OMSA 4WE1B 4ZVQB 1UVIA 2YNIA 7AT1B 4F67A 1PAEX 5L9NA 5IM0B 1HLWA 1TQLA 3N5FA 3LAMA 4NRTA 3ZZZA 5B7WA 3TZZA 4XPCA 2C22A 2JEIA 3TAQA 5ETRA 2AJ4A 1N5VA 2YH0A 3BS9A 5ETKA 4DL3A 4TNOA 5B0FA 3AJ1A 2RIJA 5E3QA 4DPTA 2UUBF 3CCVS 3BSOA 2CPZA 3MR5A 3V5RA 3BZQA 1QUVA 2BXJA 2QYCA 3HSZA 4DCOB 1NH8A 4K4ZA 5KT2A 4IYQA 2M4MA 1U48A 2J7KA 3J7AN 1FXDA 4TYBA 5L38A 4XPEA 4B3RJ 2QV6A 4TU9A 5IT4A 1MWQA 2KG1A 2VC1A 5KFYA 1NK5A 5KFGA 1NDCA 4ZCLA 2DGVA 2HGNA 1S9GA 3LGNA 1NZ8A 1YJTA 2FHJA 2GMLA 2ROPA 2BOAA 3BGLA 3PM9A 4LR7A 1S7HA 3TEHB 4LF6F 2DGOA 4A8OA 1Z1ZA 1WOSA 1SC3B 2KM8C 4K50A 1VBXA 5ETSA 1T05A 4MH8A 2QL5B 2N7YA 3WIUA 2ROGA 3VAKA 5J1EA 3HFZB 4OYMA 4O3RA 4DX7A 1PC5A 2FHOB 2JLEA 2A2CA 4I6WA 2AGPA 1IBLF 1Q8LA 2CWXA 3W63A 4KRWA 3IS9B 4OHWA 4M8LA 3L09A 1VQ9S 3AD8C 3KWMA 3K89A 2A1BA 3H5XA 2APOA 1VBKA 3OV7A 1D8ZA 3M2UB 1A7GE 5D78A 4CLSA 3ISZA 3MCMA 4K4TA 5DM6Q 1S9EA 2VASA 1QE1B 5C5JA 2V9WA 4F2RA 2DVIA 1QE1A 4BC9A 2RB7A 2F8MA 2YQ3A 4ENOA 5BJRA 2VA3A 1VJWA 1X4FA 4LSNB 2OELA 3RJMB 2GA7A 4HR2A 5I4MA 5JVGQ 4WZMA 3G4SS 3H40A 3DGVA 3EGNA 2MQPA 3IP0A 2WAQD 3OFEA 2MJNA 5AE3A 5C24B 1HNWF 1VIOA 2GQCA 4K5RA 4NI2A 1XEZA 4I68A 1U1MA 5B0BA 1FE0A 3SV4A 4CP5A 2I1RA 1WUUA 3H5UA 4CRJA 3V2UC 5IT0A 1UA1A 5LMNJ 1MU2A 2RUGA 1B4SA 1T9YA 2NUUG 3N6MA 4HHJA 5A2QU 4YDDB 4JYAJ 3OHBA 2CQGA 4DQSA 2CPEA 3DLEB 4IFVA 5KT5A 3V4IA 1RT3B 5KFQA 1LNQA 2M2BA 4NL5A 1YQHA 4DJBA 2VDIA 3CJ0A 2IC3A 3FKBA 3CCJS 4RNNA 1Y10A 5KFXA 1X4BA 4EYHB 3MTJA 5KFRA 1A6LA 2ZEJA 1B70B 1R3NA 1N5YA 3PFEA 4LF8F 3SEOA 1KHVA 4N8NA 5H9EJ 1JJCB 4NLXA 1FWKA 3MXHP 1YJ7A 4F50A 3R5CA 3MEGB 4JI1F 2F4FA 1PAUB 5B0AA 1N88A 3MMCA 1C0TB 5GVQA 5EX0A 3PJXA 4AD6A 1I94J 1GK8A 2COLA 2DGWA 4EFAC 3MOJB 2CXEA 2FGCA 3ET6A 1WHVA 1S4FA 2OD6A 1CQNA 4L3KA 2HURA 3FGVA 1DQ9A 2VPWB 3U1NA 3TA2A 3GSIA 1HNZJ 2U1AA 3QIPA 3GIMA 4IFVB 4B9SA 2IDLA 2LU1A 1VCTA 3QMQA 5E33A 3EWGA 4QWEA 5A8WB 2MEWA 4MKYA 1FJGJ 5D6GA 3CJ4A 2XSJB 1IKWB 2CDRB 1IWAA 4DU7A 3MF5A 2O5DA 2MKIA 3C46A 4K0KF 2EG1A 1HARA 4URSA 2H54B 1QD1A 3I31A 1KFSA 1V6HA 2QSWA 1VFJA 3NGDA 4F2SA 4CO5A 2I5JB 3PO5A 4M1KA 5D0GA 2HNYB 5D0HA 3T6BA 1DFDA 3FMWA 4J9LA 2DCUB 2CQ4A 2ZE2B 2BZ2A 3NGSA 1WI6A 5HROB 3T9ZA 2UXCJ 2E1MC 1AB8A 3LGMA 5T7LA 2Y3YA 2OUGA 4DR4F 5D8HB 4AE5A 4ES2A 1S0NA 2IFXA 2ASJA 3HHKA 4MK9A 1NNDA 2HHHJ 3R5AA 2Z4PA 3K5MA 2G4BA 3RRHA 1Q95G 2GJIA 3JQMA 3PYDA 2KT5A 1TK8A 2JZ5A 1EQ0A 4IFYA 4CO4A 2GC8A 1M1HA 2Z57B 2ZJQQ 2O3DA 4B3MJ 4A4JA 1WKLA 3BKFA 4PXDA 5C2CA 4DV1F 2HHQA 4NXMF 3PZPA 5KFMA 2AQ4A 5J2QB 2IRUA 3DI6B 2ZFHA 1S6OA 2DNRA 1SXLA 5KFSA 5HSPA 1RABB 3FC9A 4PG4A 3LP2A 1U25A 2F8HA 3WBZA 5A6PA 4QYZK 2VQFJ 2HGMA 4ZLLA 5ADZA 2ZZMA 4NXNF 1WEYA 3DCAA 1TVRA 4YEAA 3PKYA 1XNRF 3HD1A 2AJ0A 4TY8B 4Q43A 4X4NA 4K4YA 1WC4A 1HWUA 4HDHA 3CMAS 1HIYA 2FVSA 5H1SV 3KJVA 3JQKA 3T5KA 3H2VE 1MSWD 3VZIA 3W65A 1UVLA 2XLKA 1DQ8A 1E6VB 1S0MA 5LJ3Y 3SCIE 1X0PA 4NYZA 2LDYA 1JLAA 4RW9A 2W7OA 1TKZB 2XMUA 2BQRA 2JSXA 1DHMA 2FC8A 2H65B 1Y3JA 2QJ3A 4MYUA 4WFZA 1JLCB 3B78A 3CC2S 4FBUA 4WYLA 4ED7A 2VU5A 2KXFA 3S6EA 1UPPA 3W5XA 1T03A 2ZOGA 1UJ6A 4RW7A 1WG5A 3MMJA 2ROEA 2ACYA 1RWOB 2I9SA 1T02A 2WSCC 4RWXA 5GMDA 5J2MA 1U2RA 3NCPA 1Z2LA 3KLHA 3LWLA 1V3ZA 3LQVA 2B4UA 1Y5NB 3R6LB 3RW7A 1YVFA 2VQEF 3BQ0A 1QLNA 4FNIA 1RUSA 1KS2A 4Q7AA 2AEMA 2FD2A 3M2UA 5A8KA 5EGYA 2XGQA 4K4XA 2N7CA 4CYUA 1UPMB 3ILLA 3NGKA 2I2YA 1CEZA 2VBYA 3EDRB 3E51A 4OYIA 1WF2A 3PKMA 2N3LA 2OFGX 4YB6A 1RAJA 5C7PA 1F3FA 1DARA 1HQUA 3M8ZA 4ZPCA 2LMIA 4CH7A 1XC9A 1KR4A 2LA4A 2V5HG 3MPUB 4OHXA 3UFCX 3D4JA 1RAFB 1S6PA 3Q8VA 4FKYA 4RW7B 5KTQA 3VTIA 5KFCA 1RT4B 3HD2A 4IKAA 4ECYA 3TZYA 1Q8KA 1ZZFA 3PR4A 3TI0A 2DR9A 2GQQA 2C3UA 2KN4A 2YQ1A 2HWIA 2P6SA 2LKZA 1GNKA 3OFHA 1MN9A 1S1TB 5D4PA 2MZJA 5KFJA 1YHQS 4C11A 3I0RA 5D0RA 4DSIA 3FSYA 3QSIA 4MMOA 1JK9B 4AUKA 2G2OA 4DN0A 5BXIA 1U24A 4ED1A 1SL2A 2HRTA 4NLWA 4C8KA 1UETA 1TFYA 2B9YA 1JXEA 2DEJA 4O3PA 2ABYA 3JSYA 3QRPA 4X4OA 1RTIB 4LF9F 4W92B 4X4RA 1NKBA 3O44A 2K3IA 5IV3A 3QJPA 3KDOA 1DRZA 5HK4A 3DOLA 3W2WA 3KK3B 1C1BA 1T3NA 3ZTSA 4TQRA 2J0WA 2HIQA 3VF0B 1T03B 1ZA2B 1JQGA 3CJ2A 3DM2B 2XHCA 3GG1A 3KG1A 3OR1A 2YPYA 3ZC4A 3JSMA 1UVKA 5IWAF 1K9MT 1RHMB 2I8EA 3DLLQ 4DSLA 3DOKB 1U6BA 4UT4A 3EVMA 1U1NA 3Q2TC 4DV1J 1FFGB 1MU2B 3ZNUA 4WP3A 1VQ7S 1L3KA 4C11B 2C2MB 1SJRA 2A3JA 3DMJA 2HLUA 4JUZA 5GAGI 2XM3A 1HQEA 4RNFA 1SH3A 3W60A 2VD3A 2HK2A 1Y0HA 3PX0A 3KTQA 2VBWA 1RTZA 4MFBA 2B7CB 2JX2A 3MD3A 1YRXA 1KDNA 2Y1LB 2H5IB 4F25A 4ZLJA 5AXNA 5F0WA 4CIOA 5E7OB 3TANA 2ZNZA 4KB7A 5EWEA 1T7PA 2HAIA 1AXQA 2VV5A 4QWAA 2IM3A 2UZAA 1ZAXA 2A6MA 4LSNA 5A6WA 3TR5A 1H98A 3MM5B 5HJXA 2FGOA 3QLHA 5F8MA 1U1OA 1K73T 1UVMA 2KFZA 3CDBA 3JTOA 2JOQA 3A3OB 4L74A 4ZS6A 4CNZA 2FVQA 2X1FA 1LXNA 4IOAQ 4YUDA 3G86A 2CFXA 2KYZA 4DQQA 2R7SA 4C9DA 1TKXB 2B4OA 2LP4A 3KLGA 5E3AA 5K8MA 2CJXB 1WC5A 2CUYA 3DLBA 4PXEA 2YWKA 1TVRB 1N36J 2ZWPA 1QTNB 2QL9B 1XBWA 3MTKA 4H4KA 3DDNA 4WIIA 1WKKA 2IBKA 3UDEA 5JJBA 3QGIA 1YJUA 3EGVA 4TU8A 5IWAJ 5A8WA 1IJEB 2LECA 2R8JA 1R8PA 3D6MB 2GS8A 2HNDA 3KLEA 1D9FA 2GVDB 3ILJA 3MPDA 3K58A 2B8QA 1S76D 2AX0A 1IQTA 2X3DA 3HPOA 4KH0B 3LPYA 2GZOA 5HMZA 3ILOA 2FLNA 5HI7A 2B9XA 2WZ1A 4I56A 4OJHA 4BWJA 3RRKA 5KFPA 3B8HA 5L1KA 4GKKF 1NK7A 2EC2A 1HW8A 1W7WA 2FJBB 4HYKA 5GMEA 3HHNB 2FZGB 2Y1RI 2V8DA 3H5YA 3MPWA 1PJ6A 3KG4A 4HEA9 2PC6A 5F9NA 2AGOA 3KLFB 1YBTA 3R5GA 3BBCA 1SPBP 1LWFB 1FD2A 1D0EA 3I5BA 3CSKA 2ZUAA 3QAUA 3D0HE 4OHYA 1IQZA 2MQOA 1L3SA 3TEGA 1LW0A 2IC3B 3TUIC 5IOLA 2C2DA 1TL4A 1YJVA 4AQYJ 1HBNA 1WHWA 2JWNA 1JLBA 2CJBA 4CH0S 4DFMA 2G9OA 3UVJA 3SZ2A 2VFRA 1FNXH 1ZM9A 3KJQB 3CTRA 3O8WA 4ED4A 4GO5X 3CE8A 4DLEA 3UCZP 4ZJLA 4OYBA 2EKNA 3CWJA 4ILMA 1HMVA 5HP1A 1JJ4A 3N28A 4DS5A 4DSFA 3G8QA 4B3TF 4QBUA 2R2TA 3RRGA 4L76A 4ES1A 1IKVB 1NB2A 2MLYA 1ROFA 3OXGA 4TN2A 3KK2B 1CBKA 2GHVC 2M8DB 2DNPA 3TAMA 1ZS6A 3MCOA 3TP2A 4B3SF 2D9OA 3MM9B 2B56A 2NZCA 2RRAA 1KOHA 3M1VB 5LT5A 2RDDA 3GV8B 2MSTA 1JLEA 4FF4A 3Q23A 4FBTA 3CMQA 3QATA 3GFZA 2UV8G 1WC3A 1MW7A 1HNIB 1U2FA 2CPJA 3UNGC 3BSAA 5HQLA 1FJEB 2E5HA 3W2VB 4UQTA 3PJ9A 2QZ8A 1JLCA 2RT3A 2AYEA 2EXUA 5E41A 2C3MA 1KWMA 3NLCA 1R43A 2LU2A 1R8AA 3RAMA 3CCTA 2F4VF 3Q8SB 4K8RA 3DRPB 3NNHA 5E3CA 1U1RA 2CAJA 4OYZA 4RW6B 1FXLA 1VC6A 3S8SA 4OYWA 4LR8A 5E3PA 5J2PB 2HQFA 1U1PA 1XQIA 2FVRA 3HHLD 2BR0A 3UW1A 4DI6A 2ZBPA 3G6XA 1TMJA 1IKYA 1IR2A 3GFYA 1VC5A 3NWRA 2MKKA 3FVYA 2DPIA 1CVJA 1HNWJ 4N5SA 3LO3A 4FS1A 1VRQC 3OL9A 2MZ1A 1WOOA 4NCAA 2IAJB 4DUYF 3QO9A 1AA1B 1OSCA 1UFKA 2R2UA 4ZP6A 2DHGA 2CVEA 5H9FJ 1HMVB 1S1VB 3EXCX 1ULRA 1FWPA 1GX5A 1R0AA 3ZTQA 3OVSA 2V2VA 2ZWOA 3C14B 2W24A 3KMSA 1FNMA 1AFIA 2ZVSA 2ZHAA 4JI4F 3R2DJ 3ILIA 4WZQA 1FERA 1GX6A 4FYWB 4C0BA 3QT6A 5H9FK 1XR6A 1BUXA 3LW5C 1SIWB 3IFEA 2CQDA 4CZCA 1IR0A 4R5PB 2R7WA 2NR0A 1N32F 1VRTA 2NSBA 4TY9A 3D3BJ 2WTFA 2JEJA 1IBMF 1UKUA 2LDIA 3POTB 4NASA 1KVIA 4F26A 3Q83A 3HFKA 2BOPA 5K9FA 1S6UA 1SQGA 3R6GB 2V2ZA 5AT1B 3MM6A 2VG6B 3PACA 4B9MA 2DHHA 2FVCA 2HVDA 3HO1A 1TAUA 1WELA 2PGCA 2LEAA 2XSFA 3AD9C 3EYZA 1XK8A 1C1CA 2AKWB 3I0SB 1ZTTA 3DOLB 4E0DA 2V68A 3ENWA 2IRXA 2GIQA 2QA4G 2CRLA 4B08A 2DCLA 4J91A 1S5ZA 3H2LA 4ZITA 1IBMJ 1VBZA 4Q8FA 1BY9A 4P9SA 2Z56B 3QWUA 1RT2B 2NREA 3W5YA 1X5TA 2ZE2A 2M5YA 3E01B 3I87A 5AE2A 2VOOA 4JV5F 2XWXA 2UXBF 2J6UA 3LPEA 3HSJA 1RHRB 4V1Ak 4X4VA 4RR5A 5HBMB 5E2QA 2HFOA 3ZTRA 1ACMB 1RA6A 4V19J 3QJLA 3E8OA 4DPYA 4YP3A 3OFGA 4BDPA 3IC1A 3IG1B 9ATCB 3M9OB 4LRBA 5ETMA 4EWTA 5IZHA 5DS7A 2CNOB 3MMCB 3BN7A 4JI5J 2IJFA 2JVOA 4JB8B 4ZKAA 1Y7PA 3ULHA 1VQMS 4Q8EA 3RGIA 1PG5B 4YB1P 3MI7X 3PCOB 2Z8QA 4KGVB 4PWUA 3I9V9 1NSPA 2V34A 1TKXA 1UWAA 4RLEA 4DR7J 4A8WA 3DHXA 3MOZA 2XY6A 2B5JA 3M6WA 3ENVA 1M90T 4ZMMA 3V4IB 4DQRA 5A8RB 3CVKA 4CLUA 5L1LA 5KG0A 1TELA 2KYXA 3JSBA 2MLXA 3TX0A 3GLJA 1B99A 1RSCA 3KDNA 2W9CB 3AODA 4DU8A 3C6UA 2OEJA 4DR3J 3FNNA 4OX9F 2ALZA 3U27A 1EHWA 5DM7Q 3CJTA 2OPRA 4JI0F 3PX4A 4QQBA 4PG6A 5F8HA 1WC1A 5KFEA 4X4UA 2E1RA 2IMWP 1FX4A 3C15B 3KKFA 5K14B 4DV5J 2CYYA 2J8AA 3ONQA 3O3LA 3CCWA 3OTCA 1ZBTA 3ET6B 3R3TA 5BYRA 2EG2A 2EFQA 5A0YB 2F65A 5F8LA 1RWVB 2UUWA 3OSNA 1UVJA 2W9BB 3GR1A 3D3CJ 4PRFA 4OJ3A 1DQAA 3QT7A 1R8CA 1XNQF 2Q66A 4LF9J 1MROA 3U1LA 3H0PA 5B0CA 3MM9A 3UPFA 1OS5A 2I0XA 4PAAA 3PYGA 4M5LA 4F4KA 1HW9A 1TK0A 4CCHA 3C16B 3QT8A 2XY5A 4PYDA 1GTEA 3HCXA 2E5IA 2CPIA 1S57A 2V50A 3TVKA 3IO1A 2UUAJ 2WRMA 2XMVA 7FDRA 2GGPA 2GAHC 4IDKB 4UUXA 4RW4B 1R6YA 4UF4A 2DD8S 5DDQC 6FD1A 2GCFA 2Z30B 1WI8A 2M9KA 1FDDA 3OXFA 5DLGA 3FDSA 3TOQA 1RTHB 2DJWA 4Q0BB 2CZ9A 4CO3A 2YNHB 4DV4F 4DR3F 2FVPA 4YR3A 2A0FB 1Q5YA 3OW2R 1RTDA 1WG1A 1TUVA 1XIQA 1EP4B 1TL7B 2MB0B 5J1PA 1Z4UA 1RAIB 3PFOA 5E5NA 1HWIA 3PYEA 4ZOSA 2OPSB 5KT7A 2EWHA 3VAMA 1HHTP 3WIVA 3UNYA 1LWFA 3DOMB 4NLUA 4ZCIA 4P6QA 3TQEA 4K7QA 2QEXS 4JI6J 4M5DA 3VAJA 3CD7A 1N4LA 3HZGA 5JMNA 1UP1A 3GFHA 5T14A 2AMCB 3DDIA 3AJDA 3RU0A 2H5EA 3SSRA 3D1QA 4QCLA 2W01A 1RWWB 4HHUA 5HVFA 2KTQA 2HFVA 2ZBRA 3AB4B 3LANA 3OTEA 4G1QB 4KGZB 4LF7J 2W1BA 4OYPA 2ZH9A 4B9VA 1LWEA 4L75A 4B3OA 4PZVA 1OQ6A 2NPIA 1OY8A 2BE9B 3DFEA 3M05A 3R7BB 4IQMA 2V69A 1PO6A 1NKEA 1X8DA 3A8KA 1R89A 4CLZA 1N32J 4OHZA 3UDLA 4QIEA 3D6HB 4P10A 2V8HA 3TJ8A 2JRSA 2AT1B 3V81A 1YZ7A 1XERA 4J7CA 4ZIVA 4HKQA 2MZTA 2V2QA 1TKTA 5D0EA 5HMWA 4DL7A 2MGZB 1H6KX 2MKJA 2N4CA 3DXSX 1JLGB 3VHQA 1LW0B 3KLVA 3CCRS 1RACB 1F9HA 2VONA 4J9PA 4C8ZA 1FESA 2MQNA 1H2TZ 2RUSA 2ZKTA 4GMKA 3ZO7A 3QYYA 3FFIA 3PIPQ 1VJQA 1RAOA 1HQ2A 3A3PB 3DLJA 4DV3F 5GAHI 3R27A 4NPOA 3QO9B 1CJTB 2DGQA 3J81j 2M0GB 1C4AA 2HHTA 4MK7A 5CYMB 1NHVA 4IRKA 2C2NA 2RQMA 2MQQA 5I3UA 3C3LA 1JLQB 3W9IA 1YBAA 2VJUA 4JOUA 4MTPA 1S1XB 4LBHA 5I42A 2GJ2A 1KQSR 1O6XA 2NSCA 5L9XA 1N5TA 3PW2A 3V6KA 4ANDA 1FFSB 4EK2A 1ZZNA 2L9WA 1FVQA 2BJEA 3HVTB 4WU3A 2ZD1A 1UZDA 4IO1A 1VK3A 3UDCA 1VBYA 2KVIA 2E9RX 2L41A 2RQCA 5HL7Q 2IJRA 3MCNA 3KYLA 1TL5A 1VR6A 1SUQA 2B6AB 2GX8A 3K5LA 3W1YC 2KT2A 1HNXJ 2J0XA 3BKUA 1K0VA 4Y3CA 2P2CB 1MNEA 1G4CA 2JJ4D 3PY8A 4OL8A 3B4DA 3SIPB 1LW2B 1M0SA 5I3QA 3M32A 4KQZA 4OJGA 4F8RA 4DQIA 1WNEA 1KP6A 1SB6A 1GXLA 2OPPB 2RKIB 3CIMA 4KHRA 1RWXB 1C0TA 1YBUA 2C1EB 3KUEA 1VHFA 3RW6A 4DSEA 2C28A 1SC4B 1U02A 1SH0A 1NHKL 5DETA 3CF5Q 2HBQB 2KM8B 4GC7A 4EZ6A 2FZKB 4ITSA 3MHYA 3RB6A 2VDHA 3A4TA 1RAGB 2FC9A 4NA1A 2VG7A 3CJKB 5IQ6A 2W2PP 5HATA 2ILZA 4FZVA 4LBIA 4DR6J 2OPQA 1ZAVA 1LK5A 4NLPA 2W2MP 1JKHB 1Q8BA 3CGIA 1IJFB 2QLXA 1HYSA 2F9DA 4PQUB 1OY9A 2BM1A 3M7VA 1D1UA 2WBMA 1CULB 4USHA 1BQXA 3MMBA 5CD4H 2PSZA 2DO4A 2WVDA 3AXKA 4RUHA 1ZA1B 4DXLA 3G9CA 3CJ8A 2XS2A 3B54A 5L1JA 1BC6A 3OTOF 3EICA 1RT6A 2ZITA 4NLQA 2DGSA 2D74B 1FVSA 3C14A 3D68A 1YLXA 2ACMA 1IXKA 2JDJA
chains in the Genus database with same CATH topology
2RSQA 3TARA 1N54B 3KHLA 3KHRA 3THVA 2FHJD 4NCGB 3K0JA 2UUCF 4EU0A 1VQ5S 1FDAA 2P9GA 4RBTA 4HVZA 5G0RB 3OL6A 3EX7B 4DSJA 3J7A1 3ZZUA 4DUYF 2CDQA 4WYWA 1JB0C 3ZFVA 5A8KB 4G1IA 2AF6A 2HS0A 2ZJPQ 3BQ1A 4ECSA 2GQ2A 4OI3A 1KRPA 3VAFA 1M5SA 2HVHA 1M1KT 2IYIA 5K14A 1S97A 1FEEA 2QA1A 5B08A 2VL1A 5GMKa 2V4QA 5KFAA 5BYSA 2ZJRQ 3CC4S 4N76A 1ZTWA 1T8EA 4X4SA 3GIKA 2Q1LA 4M95A 1Q1KA 4PWDB 3SV3A 2JFDA 2CQIA 4ECRA 4DOZA 4FXVA 1RT5B 2W7PA 1ZM4A 1VQOS 3JYTA 4ZVHA 1VS3A 5I3PA 2OH2A 4IR9A 3IR6B 1H2UX 1D9AA 1OO0B 3BR8A 5KFUA 1NH7A 3HM9A 5GADU 4NLDA 4ZCMA 2XI3A 5K8NA 4EZ9A 2YKPA 4ZVGA 2ZBIA 2Y1IA 1B0PA 1MMNA 4WFAQ 3RB0A 5DO2A 4A47A 1X4HA 4HI2A 1FJ7A 4G3IA 4Q0BA 1FE4A 1FHTA 3PRBA 2V0NA 3VQTA 1E6YB 2GHPA 4X4TA 2F7VA 2HHVA 1B0VA 1TV6A 1KSPA 2VOPA 3BF4A 3OUYA 2AV5A 3DXBA 3AB2B 3FMBA 3OQ2A 4KIAA 4DV5F 4DF4A 1NJWA 3FEZA 3NRBA 1GXTA 4JBCA 4ES3A 3CJ3A 5CZVA 2EI5A 4G6VB 1N56A 4A8FA 2EC0A 1LQ9A 2PDAA 3PW5A 2D41A 1S48A 3PEHA 4ZVEA 3EPGA 2WSFC 2FJXA 1CLFA 5FDLB 1HR0F 2RKIA 1SJQA 3M30B 4IH6A 5DQHA 3DRPA 3MEKA 4I0WA 5EN1A 1KQGB 4R8UA 2K1RA 1WD6A 2K1RB 2DNZA 2PIIA 3CC7S 4KGKA 5KFHA 1U6FA 1OPZA 1KVJA 3IRWP 1E6VA 5KFZA 1JKHA 3D5MA 3L7OA 3G96A 1ZOTA 2DTJA 5B09A 1VMBA 1X9SA 1KN6A 1KLNA 3GILA 4L3NA 1EETB 2WCXA 4H4OA 1ZAWA 2DRBA 4J9MA 4ECUA 4ZP7A 2E9ZA 4OI6A 2X51A 3K5NA 4X65F 4YQWA 4RW6A 3UE2A 4J37A 2VBXA 3H8YA 4L6V3 1SJFA 2GW8A 4C8MA 1NO8A 1S1WA 3J7Z5 1VRTB 3JB9k 2PEHA 4R5PA 1KNZA 3RAXA 3K8WA 2ZHOA 3SMZA 3GQCA 1RT3A 3D2WA 4NLOA 3PW0A 4RBVA 2ZDPA 3MMBB 2KT3A 2MJUA 3I6PA 3LP1A 1OQ3A 4DSKA 4I64A 4X4PA 4NX9A 1P6TA 2CZ4A 2EFVA 1Y5IB 2HPUA 3CCES 1IKXA 2LXFA 4LQ9A 4F4YA 5F8IA 1S72S 1JWWA 3FRYA 1SKRA 4LFAF 4Z37A 3DC2A 4LF7F 4LSLA 2DGUA 2O1PA 1H7WA 6FDRA 3K8VA 3J7YU 4X2BA 1UMJA 2WB4A 3UCGA 1FJCA 1CC8A 4W90B 1I94F 2EVZA 1VIXA 1NK8A 3SI8A 2YKAA 4HH1A 4E98A 4PUOB 3MECB 4KKOA 2E44A 1A9NB 4K59A 4R0EA 2RS8A 5F8NA 4I7FA 3JAMY 1FKPA 4RUAA 4ELUA 4LQ3A 3KLIB 1N6QA 1KTVA 2OPRB 2M88A 5CCLA 4LF4F 3IN5A 2YWFA 1WWHA 1SKWA 2W4CA 4KPYA 1RI7A 2YX4A 3GV5B 2HG4A 3KK1A 2FUG9 3PNIA 4O4GB 1V9OA 4NLGA 3DOKA 4CO2A 5HO4A 4ILRA 5AXMA 2RNEA 4X62F 4NZ7A 4Q45A 2SXLA 1NAQA 2FHMA 1Q16B 4PPZA 2OKQA 3ISND 1GTHA 3M1VA 2F3JA 4U9RA 2YY3A 1UWBA 3MPVA 2DNKA 3I5CA 4ECVA 7FD1A 2Q79A 4UQGA 4QIGA 1FRLA 5DQIA 3M8PA 3N5BA 2Q6BA 4BS2A 2W9AA 2HVZA 3H98A 4WE1A 3D54A 5J2QA 1RKIA 2J5AA 4NLTA 2UVUA 4J9NA 2F40A 3CB4A 2KKHA 2ZUGA 4WTYA 4C4WA 1JNZB 4KFBA 3KHHA 2CJKA 1LOUA 3AAWB 4KFBB 2XLJA 1YJRA 3VWSA 2DK2A 5F3TA 1PSDA 1RT7A 3N79A 4WXOA 5KFWA 3V81B 2LQ9A 4DL4A 1TFWA 5G0RA 4F4WA 5GAHU 2MY8A 1UWBB 3PEJA 4OX8A 3TVZA 1YWXA 4LIWA 2IVFB 2QA4S 4B3TF 4Y28C 1U1LA 1F5BA 1T94A 4ZP8A 3V6DB 1SH2A 3CCUS 3VAGA 1H7XA 1REVB 1MWZA 1H2VZ 2HS3A 2WK4A 3J7YI 4A8SA 1FKAF 1D8YA 3MEEB 1VQPS 2HWTA 1VQKS 3MMAA 3Q2SC 4CTAA 2UV8A 5AJ3F 1O0PA 3QJJA 4RNMA 2EFGA 3LAKA 1FJGF 1MMDA 1RA7A 2V8VA 5J2MB 4MIBA 3F56A 4FYDA 2GFFA 2ASLA 1WTFA 2W4PA 3TUZC 1BGXT 1S1TA 1BQNA 2MZSA 2ZBCA 3T19A 4DV6F 4JI2F 3HDSA 1U1QA 1DTQA 2BYCA 5B0GA 1YTYA 1R8BA 2XMMA 3V4MA 1NZAA 5C42A 1REVA 1Y4ZB 2ZDOA 2MZQA 3T1YF 1J5EF 1YJ9S 4C8OA 2HHHF 3QPIA 4LVNP 3MEGA 3WX4A 2MXYA 3M32B 4OLOA 3HHLB 1C1BB 2DT9A 5DDRC 1FEHA 4B9TA 4FNHA 1F9FA 2M70A 4MYTA 3TAMB 1IKXB 2MHNA 3MEDA 4FF1A 4DBQA 2DHAA 4ID8A 5L39A 4ALZA 1XN9A 3QZ8A 2OIHA 5CA5A 2YH1A 3HLUA 4IR1A 4U67Q 2DISA 2KJWA 3FZ2A 5B0EA 4YY3F 2R7OA 3S1TA 3G6YA 2GMJA 2P5VA 2OP5A 4A8XA 4ZPWR 4OZ0A 2YKOA 3TQ1A 1C2PA 5JUMA 2X1GA 5CYMA 3HK2A 2M52A 2C3PA 5U47A 1DTTA 1YRUA 4OI4A 3AY0A 2MY7A 4KBIA 2ZZNA 4LFCF 2CQHA 3PXGa 5KFVA 1VRUA 5ITHA 4JI8F 4F4ZA 2LA6A 2A2DA 4XAKA 2CIMA 4Y34A 4C98A 4O44B 1TP7A 3JTPA 4MFBB 2HRYA 3NAHA 2M3DA 2AU0A 3TUJC 1N0UA 2P9CA 5DQGA 4AXIA 1DBDA 3C6TB 3PW7A 4LIRA 5CYQB 1FD8A 1YGYA 3SCLE 4FF2A 4RX6A 1Y9OA 4F4XA 3K7RA 1RGVA 2CKWA 4DR6F 2EW9A 3WC0A 3HXMA 4O3OA 3OBIA 1YSJA 1S1XA 4QWCA 2UXDF 5D4OA 2MHEA 4FVMA 3RZAA 1HI0P 1U4BA 2HQ3A 1CQMA 2XG8A 1NB7A 3SYZA 1NU4A 4DFPA 1S9FA 1F2GA 1T95A 2ZH1A 3HVWA 2MQLA 1JLEB 1WHXA 2CPHA 2DRAA 1UFWA 2X3GA 1IKWA 3DLKA 4Y0FA 2VQFF 4WFYA 3TAPA 2KRBA 3BB5A 3DRXA 3GV7B 2KO1A 3O6QA 1ZM3A 2IM0A 2K7JA 4HH0A 3ZZTA 1HWKA 4R25A 3B82A 1X0FA 1N34F 1QAJA 1KHWA 3U1MA 2VZ9A 3UI3A 2IA6A 4EO8A 1NJZA 2D3UA 1RTDB 5M2UA 4IG0A 2KH9A 2VKRA 1FRIA 1J5OB 2O67A 4DG1A 1OWXA 3HHEA 4YDXA 4HL9A 5KG5A 2L08A 3ENQA 4EYIB 5CHCB 2BW2A 4ED2A 5EDWA 2VUGA 4DR2F 1N5YB 3WC2A 3MM5A 1S6QA 3NS6A 3UQSA 1HBUA 4BHQA 2R4FA 3O2IA 4GO7X 2I5JA 3KHGA 4KTQA 2XI2A 2FJDB 5HN0A 3CMES 2ZM6F 3M2VA 2HFNA 3CO9A 2HYIB 1X5PA 4IO9Q 2BANA 2LXIA 1JMTA 4Y65A 5KG2A 2QFJA 3MM8A 3AHPA 3RBEA 2CQ3A 2EPIA 2Q3PA 4U6PA 4DMZA 2BDPA 1NJIT 4TQSA 4AYBD 3UR3C 1W2BR 1K1QA 2L9DA 4LJMA 4DHVA 3C66A 2IJNA 2BRKA 2R7QA 3TX8A 2BM0A 2AW0A 3SCKE 4QIFA 2DNQA 3K5PA 4HT7A 3GWCA 3RAQA 2BJDA 4IH7A 2OPPA 4C8LA 1FRJA 4IRCA 4QYRA 2AYGA