2KH9A

Solution structure of yeast prp24-rrm2 bound to a fragment of u6 rna
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
86
structure length
86
Chain Sequence
MTECTLWMTNFPPSYTQRNIRDLLQDINVVALSIRLPSLRFNTSRRFAYIDVTSKEDARYCVEKLNGLKIEGYTLVTKVSNPLELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords U4/U6 snRNA-associated-splicing factor PRP24
publication title Structure and functional implications of a complex containing a segment of U6 RNA bound by a domain of Prp24.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Splicing/rna
total genus 15
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kh9A00
2DO4A 3MUMP 2A3JA 5HL7Q 2FY1A 2MKHA 1M5KC 4P6QA 2B0GA 5GMKa 2F3JA 2MXYA 1FJCA 3CD6S 1NJIT 2AYEA 5HO4A 4YOEA 1WF2A 3VAIA 1VQ8S 2E44A 1SJ4P 2E5GA 3FEXB 3G9CA 1X4CA 2L08A 1ZH5A 2DNQA 2DB1A 2KFYA 1OIAA 2CPFA 1D9AA 4CQ1A 1WTBA 2DGQA 1WEZA 1OWXA 3IRWP 5IFMA 2MKIA 1X4EA 2I38A 3H2VE 2MZSA 1X4DA 2KXNB 1X5SA 4CH0S 3LPYA 1UAWA 2J0SD 2CPHA 2J8AA 2DGWA 2CQ3A 1ZZNA 1U1LA 2O3DA 2KH9A 2XNRA 1URNA 3UD3P 4ERDA 1JJ2R 2FPHX 1WHXA 3EGZA 3MD3A 3MI7X 4LMZA 2XSFA 2MZJA 2D3OR 5JVHQ 1Q81T 1N52B 3TO8A 1YHQS 1HD0A 2U2FA 2VOPA 2OTJS 4C4WA 2DNRA 1KOOA 2RRBA 1UW4A 2RNEA 2RUGA 3L3CA 1KC8T 1XN9A 2CQBA 2MQLA 3VAFA 2AYMA 2XS2A 3CCMS 4Y0FA 2X1AA 3EX7B 1X4FA 1NO8A 3U1LA 4YUDA 4WKRA 3JB9k 2CQGA 1WWHA 1VC6A 3NNCA 3NMRA 1OPIA 5ITHA 1WHWA 2LA4A 1RK8A 2DNOA 1K9MT 2J0QD 2M0GB 2KRRA 4WFBQ 2CPYA 2DNPA 2JX2A 1FJEB 2LMIA 4TU8A 5DETA 5LSOA 3VAMA 1HL6A 5MLCV 3MDFA 2XB2D 2EVZA 2J76E 4A8XA 1D8ZA 4M5DB 2DGUA 3I56S 2U1AA 1U1PA 1VQ6S 5LSLA 2VODA 4UQTA 3CULA 2MPUA 3CUNA 2DO0A 4FXVA 3U1MA 4IOCQ 5D78A 5LJ5Y 2YWKA 1AUDA 1WG4A 3S6EA 5CYJA 3IWNC 4OZ0A 4TU7A 2LA6A 3BO2A 2HGNA 2DK2A 2DNMA 3ZZYA 2GHPA 2JVOA 2WBRA 3BEGB 1VQLS 1YTYA 1M90T 4LJMA 1K73T 1A7GE 3UD4P 2CQCA 4C0OC 2BOPA 1VQ5S 3P49B 2MJUA 4YB1P 1OO0B 3ULHA 2DGVA 2E5IA 1X4BA 4OZ1A 3CCUS 2ADCA 2FC8A 2KU7A 2CJKA 5EN1A 2YH1A 1M5OC 2EK6A 1H2VZ 4PKDB 2HYIB 1B7FA 1NU4A 1Q82T 2MSTA 1WI6A 2XS5A 1M1KT 1JMTA 1WELA 1WG5A 1CVJA 2MGZB 1FJ7A 1H6KX 1SJQA 3CCJS 3BO3A 2CQ2A 2MGZA 4PRFA 2KT5A 3SXLA 3MURP 1WG1A 4QPTA 2MKSA 1L3KA 2N3OA 3S7RA 2KM8C 1X0FA 1Q86T 2KI2A 3NS6A 1WHYA 3MD1A 1KQSR 2DHAA 3CMES 2ZJPQ 2QEXS 2RS2A 4WCEQ 2KRBA 2KG1A 2OIHA 4IOAQ 2ZJRQ 2LCWA 2X1FA 2LECA 2M8DB 2BZ2A 2LXIA 2PEHA 1VC5A 2X1BA 4QU7A 5JVGQ 1W2BR 1X5OA 1SJ3P 4V19X 3THPA 2DHSA 2I2YA 2DNZA 3CCQS 1U6FA 1RKJA 1R8PA 3CF5Q 1VQ7S 1PO6A 2JVRA 4Z2XA 2N7CA 4IUFA 1IQTA 3DLLQ 2HVZA 1VQMS 4ED5A 2RU3A 2E5JA 2MYFA 2K3KA 1WHVA 3BS9A 3PIOQ 1X5PA 2DGOA 1YIJS 1KOHA 1VQOS 4TLQA 1H2TZ 4RU2A 2NLWA 3NS5A 1FHTA 2RT3A 2RRAA 1BY9A 4U67Q 1SXLA 5DM7Q 4WFNQ 3P5TL 1U1NA 2OSQA 3CC4S 2CPXA 2K8GA 3VAHA 5IM0B 3CCVS 2CQPA 4W92B 4CIOA 3J7ZT 4PR6A 2MQMA 2DHGA 2KXFA 3ZZZA 4J5OA 5IM0A 2ADBA 2MZTA 2G0CA 2M70A 4Y00A 2M8HA 3G96A 4F26A 3RW6A 2XS7A 2M2BA 1JJHA 2MKJA 1YWXA 2QFJA 3VAGA 3MUVP 1ZZFA 1A9NB 2SXLA 1F9FA 2KXHA 2DGXA 2CQ0A 2FC9A 3B4DA 2DHXA 3TYTA 2MQPA 5FJ4A 2JRSA 1U1RA 3NNHA 3UCUP 3P6YC 2CPZA 5GAEU 3G6ES 2CPDA 2UP1A 1QM9A 2CQIA 5GAGU 1K8AT 2DIVA 5LXRA 3H2UB 2KG0A 2FHOB 3UCGA 1VQNS 3B4MA 3BO4A 3Q2SC 5GADU 2RVJA 2LKZA 2HZCA 3VALA 3P3DA 2YH0A 2DNNA 2LEBA 2MZRA 2M52A 3PIPQ 3HHNB 4QQBA 3EGNA 3CMAS 4QU6A 5CA5A 2AYBA 2VONA 3N9UC 3RW7A 3CC7S 5H1SV 2DISA 2KN4A 2V94A 3UE2A 3NNAA 2JWNA 1G2EA 1SJFA 4UY8T 2CPEA 3CCES 1VBYA 3THTA 1FXLA 1X4HA 2CQ1A 3LQVA 4WIIA 5GVQA 2MZ1A 1R8HA 1M5PC 3CTRA 4F02A 3S8SA 3US5A 2LEAA 2OJ3A 2OSRA 4W90B 2CPJA 2KM8B 3R27A 1P1TA 2MJNA 4F25A 1DBDA 2DH8A 4ZKAA 3CCSS 2CPIA 2L41A 3UWTA 2D9PA 3R1LA 5GAHU 2KVIA 1DRZA 4BS2A 5IQQA 1PGZA 3MOJB 1U1KA 1P27B 2DIUA 4CH1A 3CXCR 2ERRA 2MQQA 1HA1A 2M7SA 3G71S 1YJ9S 2PE8A 2N3LA 3HI9A 2RS8A 2ZJQQ 5LJ3Y 1VQPS 1U1MA 4WF9Q 1U1QA 2MHNA 2QA4S 2DNKA 3FEYB 2M88A 2L9WA 2DNLA 3CCLS 2OTLS 1JJ4A 1FO1A 2XNQA 1DZ5A 1X4GA 1KD1T 2MMYA 1VQKS 2X1GA 5DDRC 3I55S 2LYVA 2CQ4A 1VC0A 1DHMA 2VOOA 1SJRA 2MSSA 2DNGA 1YITS 2AD9A 4EGLA 4TU9A 5DDQC 5DDOC 1N8RT 1S72S 1H2UX 1X5TA 2E5HA 2YTCA 5D77A 2MY7A 2MZQA 3SDEB 3DXBA 2G1DA 3D2WA 3CCRS 2LQ5A 3VAKA 3CC2S 1FNXH 1HD1A 4WFAQ 3SDEA 3MUTP 1FT8A 1WF1A 3SMZA 1N88A 5CXTA 1VBZA 1S79A 2DNYA 3TP2A 2HGLA 2Q79A 3UCZP 2KYXA 2DGTA 2DH7A 4FXWA 3S01A 3Q2TC 2GO9A 2DNHA 4C7QA 1VBXA 2KHCA 1Q7YT 5DM6Q 3MXHP 2CQHA 2RQCA 2HGMA 1N54B 1WI8A 2M9KA 3VF0B 3J7YU 1X4AA 5DDPC 4LIRA 2MKCA 1WEXA 5BJRA 1UFWA 3R1HA 1YJNS 2F9JA 1M5VC 3K0JA 2LXUA 2CQDA 2DITA 2YKAA 2D9OA 2N82B 2G4BA 3VAJA 2AYGA 2MKKA 3G8TA 3V4MA 3OW2R 2NZ4A 2MQNA 2EK1A 3G8SA 1O0PA 1QVFR 3CPWR 2DGSA 2MY8A 1VQ9S 4IO9Q 2MB0B 1QVGR 3G4SS 2RQ4A 5LXYA 1YI2S 2M4MA 1WF0A 1UP1A 1WEYA 2F9DA 1YJWS 1VQ4S 1U2FA 2MQOA 1U1OA 1U6BA 2DH9A
chains in the Genus database with same CATH superfamily
1Y10A 1YG0A 4OX7A 1P8GA 2MXYA 3BQ1A 2AYEA 1K1QA 1YJRA 4O4RA 2E5GA 1HHQA 5AE3A 4B9UA 3D7SB 3HSDA 5A2QY 3KK1B 2V8PA 1X4CA 4ZHRA 4K5SA 5SUHA 3OR2A 2PIIA 1Z1ZA 3U27A 1ZA1B 4C3KA 2VPXB 3RBDA 2I38A 2J0SD 2NXEA 4WP8A 3RR7A 2V50A 1ZTTA 2FHMA 2FUG9 3DC2A 4F50A 1KVJA 5KG7A 2I5JA 4LMZA 4GVBB 2D3OR 4G65A 4DSLA 1HD0A 1TV6B 2VOPA 4FS1A 4PAAA 3AAWB 1Y3KA 2HBQB 1XN9A 4UQGA 3BSCA 1O6XA 3K58A 4B9VA 2XYPB 3BH7B 2WSEC 2JL9A 5KG2A 4RW7A 1SUQB 4LFAF 2CJQA 4FDFA 2KRRA 5GAEI 2DNPA 5CAAA 4OX6A 4JI1F 4QIVA 4I2PA 1HL6A 4DPXA 4CLUA 4F4YA 4IR1A 3MMCA 5G0RA 4RUHA 1TKZB 4NZ6A 4UQTA 2DO0A 2P6TA 4OZ5A 2E9TA 3IG1B 2J9EA 5K8PA 2ZH3A 5KAKA 1ZETA 3BR9A 4AFFA 2D41A 1XMQF 3KLHA 1IJFB 1RQ0A 3GIRA 3ICLA 4YY3J 4C3LA 1RLDA 2WVCA 1KQFB 3UN3A 2KZMA 2EK6A 5DQGA 3J80Y 4ZP6A 5J2NA 1JNRB 3DRRA 2AV5A 2G2ZA 1N0VC 2XS5A 2GVZB 2VV5A 3SBMA 1SJQA 2HS4A 2KVQE 1VQSA 1IXKA 4JBCA 4LF9J 3UFCX 4TXSA 4JYAJ 1Q86T 2C3UA 1VIXA 1A0OB 1WC4A 3V4IB 2MQ8A 5D8HB 3FCWA 4WCEQ 2LECA 3IN5A 5KFCA 3MR6A 3KUHA 3LUYA 1CC8A 3TA1A 4WYWA 1TAUA 1HNIA 4RNNA 2ZH8A 2G0IA 3T41A 1Q8BA 3TEHB 4DPTA 1ZYQA 2LU2A 3T1AA 5HN0A 3IA0A 5F8HA 6AT1B 2EBGA 2C2MB 2QA1A 3TR5A 4DU8A 5L9NA 1RTIA 4WXOA 2KB2A 3GPAA 3VAGA 3DMJA 3BH6B 2H54B 2VF3A 1RT6A 1T7PA 3JQMA 3HHLB 2HFVA 3QGIA 2ZBCA 3OSPA 3D0HE 3QSIA 2CQIA 2BJ3A 4C8NA 1RTHA 1NCLA 2I1RA 3DLHA 3M30B 3PW7A 2B5JB 2YH0A 1HNWF 5D15A 1XBWA 5CA5A 2C2ZB 4RW8A 2ZZNA 3CC7S 2V94A 1Q79A 2L3MA 2AZ3A 1BLUA 3W2VA 2UU9F 5HAOA 4CM2A 3FJ2A 2OSRA 4KHPF 2L41A 2W2OP 3BBCA 3QIPA 4IQXA 2HZAA 4NCBA 2HHHJ 4DQQA 5KFHA 5E5NA 2HHSA 3CNQP 1KN6A 4RPFA 3IBFB 4J9SA 4WP3A 5EWEA 4DL6A 2QA4S 3HPOA 3LOUA 1RWMB 5KFDA 1NDLA 3MEDB 4X4UA 3KLFA 3FSXA 1RU2A 1RYRA 3CJ0A 4QZVB 1FTRA 1URRA 2OEKA 4K4XA 4OI4A 4GKKF 2WW8A 2EWHA 3IWLA 3CC2S 1HD1A 4FXDA 2ZOGA 1U0HA 3KUGA 4CNYA 1X7VA 3M1VB 3K5MA 2W8LA 1S7IA 1HHTP 1RU1A 1NPRA 2Z4PA 1RHJB 3SCKE 1U09A 3GV7B 2GJFA 2EXUA 1QAYA 4AXIA 4JI8F 2YNGA 3Q23A 2R8GA 1QVFR 3J81j 2DR8A 4IFVB 2AJ4A 1CG2A 5LXYA 1YJWS 4LSNA 3AB2B 1QSYA 1Q1KA 4NPOA 2PA3A 3UR0A 2VZ9A 1KONA 2MKHA 2F40A 2BM1A 2EFGA 2V2QA 1NPPA 3CDEA 4YOEA 3LO3A 2BJ8A 3PHEA 2ZH4A 3C16B 3VZIA 1HWIA 2L9NA 4I69A 2HNYA 4ZK7M 4KFBA 2ZH5A 4P9SA 1RADB 2DRBA 4OI6A 3RRKA 3ISND 2JJ4D 4F0HA 4C98A 2HRYA 2IC3B 4C4WA 2DNRA 1YZ7A 2FLPA 4WXWA 4ZVTB 3VAFA 4MKAA 2FVQA 3R6LB 4WK1A 1X4FA 3U1LA 2WHOA 3QJJA 1IJEB 3E01B 3ENVA 4OHXA 2YY3A 4NA2A 5I42A 4C8YA 3IBWA 3MPUB 3TAMB 5KT2A 1JWWA 3M8ZA 3VAMA 4OFZA 3T1YF 1LNQA 3NY0A 3S1TA 2J76E 1RT4B 3ZFVA 3A8KA 4HH1A 4XDCA 1VQ6S 4Y2AA 2VODA 4PUOA 2VFTA 1IQZA 1E6YA 2DNMA 4P71A 1WSVA 4TQSA 1NHVA 1S1WA 3QZ8A 4X4PA 1BWVA 2EKYA 4JV0A 2KU7A 1FKAF 5K9FA 4EMDA 3HF5A 2UXCF 2OPQA 1SC6A 1JLQA 3W3SA 4H4KA 1M1KT 3M6UA 1WG5A 1TL7B 1FXRA 3D6TB 4X4RA 2HQGA 1NAQA 1N33F 2W4DA 4TN2A 4OIXA 3EVMA 1X0FA 1UW9A 3K59A 2HLUA 1WD6A 1ELOA 4B17A 2QEXS 5HQ8A 1C1BA 1HBOB 3Q24A 1W2BR 5AT1B 1SJ3P 4WYLA 2VQEJ 2UVVA 4Y2CA 2FVRA 2QMXA 4NASA 4YB6A 4LF6F 3DU6A 3CO9A 4MFBA 4DV7J 1Q95G 4B3MF 4U7UD 1S1TA 3V6JA 3ISZA 3OT9A 3QMQA 2RILA 3HVWA 3W63A 2E9RX 4R0JA 4HACA 2LDIA 4MIWA 1J2VA 3G96A 2IRUA 3A3NB 1NJWA 1YWXA 4DV2F 5GADI 1M1HA 4CLWA 2MTLA 4XO0A 5HROA 1U1RA 3NNHA 4E8UA 2DXFA 3W1YC 4JV5F 1J27A 3KMQA 2JLEA 4OYPA 1QM9A 5KT6A 3QPIA 1DTTB 4PPZA 1UL3A 3T1HF 2KG0A 1J5EJ 1NDCA 2OGUA 3EXYA 1N0UA 3M6XA 3BREA 3L09A 2QLXA 1C1CA 4ILRA 2LEBA 4QQBA 4AL7A 4LQ3A 2ILYA 3GCXP 2DISA 2OPPB 4NMLA 3W9HA 3HMJG 3M4XA 1IN0A 3QAUA 3EVWA 3N5FA 3THTA 4KHRA 4WFYA 5GVQA 1TL4A 3RRHA 4FYYB 3E2EA 1YJ7A 2W24A 3QLHA 4LUBA 1S97A 4NXNJ 5CABA 1HQEA 1N32J 2APOA 4CLSA 3AA9A 4QIEA 4DPYA 2DNKA 3FEYB 2OTLS 1BC6A 2LFVA 2CQ4A 1ITPA 2H1YA 1UVMA 1K1SA 1OMSA 4WE1A 2EEYA 3UN5A 2JEFA 1FNXH 2CRLA 4K0KF 4LF4J 2W7OA 3TP2A 3MM9A 3OTEA 4NLXA 5C25A 4DR4F 5ETMA 1SQGA 3MAAA 5HMZA 1GXTA 4MH8A 2AJ1A 1Q7YT 1MMLA 3M2UB 4K4VA 4OV6A 4GO5X 4ES2A 2QFIA 2V2KA 1T9YA 3T19A 3I96A 3TJ9A 5CYQB 2G4BA 1FWKA 3NKYA 3NRBA 1GX6A 1RXOB 3FNNA 4X62F 2ZITA 4JI7J 1TUGB 1HQ2A 2H9ZA 3HD2A 3MUMP 3I4PA 4ZPAA 1AB8A 3RR8A 4P6QA 2F3JA 3OR1A 3Q8UA 1VQ8S 5F0WA 1KQKA 3FEXB 3ONQA 3GG0A 2B3TB 5D3GB 4Q0BB 1LW2B 2OPRB 2FZGB 2P8IA 4USTA 3RBEA 2H5IB 1F9HA 1WEZA 3E51A 1X4EA 1EIYB 5KFSA 3UVJA 2YWWA 3VGTA 4A8OA 2ZWOA 2KH9A 2XLKA 3MEGB 2Q66A 5BXIA 1BUXA 3EGZA 2BJ7A 3B82A 1N52B 4E98A 4M5LA 4Q45A 4FYXB 5J2QA 3DKDA 1JKHB 1KOOA 2HNZB 2RQKA 2C22A 4DS4A 1HNXF 1RHRB 1ZBTA 1SH0A 4PABA 4NA3A 2B6AA 3BN4A 2FJVA 4LFCJ 3NMRA 3JSMB 2LQBA 4P73A 1Q7LB 5HMXA 2JHEA 3HHKA 4WFBQ 1ZAXA 1SBRA 1JLGB 1OY8A 4M5DB 2NXUA 4AT1B 2JC0A 3NAIA 1G3OA 1IBKJ 2BM0A 3L7OA 1FI4A 4KC5A 4QYZJ 2DD8S 3ZZYA 2WBRA 2AW0A 2V4JB 1R27B 4QOTA 3CJRA 4DBQA 2BOPA 1F2GA 2V8HA 5L38A 2WOMB 2PI4A 3CCUS 1M5OC 4KBIA 2JEGA 3M05A 2AJFE 1FX2A 2W01A 1NU4A 4J9LA 1CVJA 4DQSA 4FN5A 3KUEA 2OKQA 4B08A 4QPTA 2MKSA 3S7RA 1B4SA 3LTOA 3TVZA 3WX4A 1FEEA 2ZNZA 3ZZRA 2PEHA 3EMTA 4U8VA 3KFWX 1HNZF 1IKWA 4ZCLA 1BXNA 2NQPA 2DNZA 2XI2A 1WC0A 1VHFA 1U02A 2HFOA 1VQMS 3HSGA 1QUPA 2NXNA 2BW2A 1JLFB 5HP1B 3KNAA 1YIJS 1ZAWA 2N4DA 4TLQA 2NLWA 3NS7B 1FHTA 2VB6A 3PX0A 4KV8A 4LFAJ 2E29A 2RKIA 5IM0B 1HR0F 4PG4A 1RT5A 2C2RA 4JI1J 3ZZZA 1JK9B 4Y00A 1I6JA 2DVIA 1JLEB 1MW7A 1HW8A 2QFJA 3AQPA 3G6VA 5M2UA 3TYTA 4TY8A 3T5KA 2CPZA 2CPDA 2MLXA 1UWAA 2CNNB 2DT9A 4KYZA 5GAGU 3MMAA 1XMQJ 2UVUA 3HVTB 3OTBA 1AROP 4J90A 5A0YB 3CT9A 3DGVA 1XERA 5E41A 2KN4A 4A48A 3RRGA 2DPIA 1U24A 1DTQA 1VBYA 3UNYA 4URQU 4N7TA 3LQVA 4DL0C 2NYHA 1M5PC 2QMWA 5M2PA 3QO9B 3M9MB 5ETPA 1UJ5A 1P1TA 2GA7A 2YKQA 3LA0A 3CCSS 3AOCA 1U7LA 1U1KA 7FD1A 1FK9B 2E1CA 1GX5A 2N3LA 2Y0BB 1QSLA 1LXNA 3LALA 1QAIA 1JJ4A 1AYEA 2MMYA 4QCLA 5JMNA 1CQMA 2LYVA 4H54A 4RW9A 1G1XA 1FXDA 2XLJA 3DLEB 4HDGA 5C42A 1PJ7A 2MY7A 3SFGA 2DRAA 3SDEA 3MUTP 2E66A 1N88A 1S79A 4EI2A 3HLUA 4DSKA 1T95A 3JYTB 2AEMA 2GC8A 4NYPA 4Q44A 4JUZA 2MKCA 4RW4B 2ZUAA 2CQDA 3DLKB 2A18A 2HAIA 3H5UA 2K7KA 2AYGA 2G1HA 2GS8A 2F8HA 4J9RA 1YQHA 4ENOA 4MIAA 1HNWJ 2ROGA 3FDSA 3TWZA 2ZE2A 2YWGA 1VQ4S 1GMVA 2UVRA 3NBPB 2F9DA 4I6WA 2FHKA 1P1LA 4ZDNA 2AT1B 3CD5A 4DL5A 3AJ1A 1S1UA 2B0GA 2IJRA 2UU9J 3AOAA 1NK8A 4WU2A 4KHPJ 3Q8VA 3AD7C 1OSDA 4BC7A 3VAIA 4RUAA 2XY6A 4YR2A 4P74A 4HEA9 3K57A 2QL5B 4CQ1A 5CCMA 2Y1IA 3BV8A 1I3OB 2EFPA 4H4MB 2YNIA 3H5YA 2C2DA 2J8AA 5HVGA 4I68A 1U1LA 1VRUB 1JJ2R 3GIIA 2K3IA 4IRKA 3H5SA 4N77A 2ILZA 1NHKL 4ES1A 1PCAA 3T9ZA 1RWOB 4DU7A 2RRBA 4FZVA 4GKKJ 1HIYA 2RUGA 1NH8A 2CQBA 2DRDA 2XTJP 2XMMA 2GHWA 2RF2B 1UMJA 5KFWA 3IMQJ 1ZS6A 1KVKA 1S4EA 4NLQA 4M5MA 1V5VA 4UY85 4DMZA 2DCUB 4BDPA 1NSAA 1UVNA 5C24A 3EPGA 1R0AB 2UUTA 5F8GA 1PAUB 1EP4B 2X3GA 1TUWA 1KTVA 5MLCV 1HBUA 2VPYB 4JI8J 1B0TA 4BLGA 4GC6A 4C0BA 4TYAA 4PQUA 2VG5B 3F44A 1JX4A 5I3UB 1HBNB 1DLOB 4FF4A 3U1MA 2M3DA 2OUGA 1CS4A 4OJ3A 4KQZA 1RT1A 4JI6F 3BBBA 3GJTB 2V68A 4QWAA 2KFNA 4MK9A 1AUSL 1KQGB 1TKTB 4OZJA 1C0TB 3MZIA 4PKDB 1B7FA 4LFBF 1FFSB 3L9ZA 4FYVB 2EFOA 3ETMA 5J2PB 3MWBA 5D0HA 4LF5F 1JXEA 1N36F 2HMIA 3GJSB 1WHYA 2ZBRA 3QRQA 1U2CA 3R8YA 2KO1A 5EWGA 3JSBA 3SZ2A 2PI5A 1YX2A 3I4HX 4X66F 1NDKA 2JVRA 2XSJA 3WHIA 4ED5A 3GE9A 3PW2A 3DDNA 2FTRA 2DGOA 1PJ6A 5IV3A 1BY9A 1U1NA 2B56A 4LR8A 2KKHA 2NZCA 2OPSA 4K4ZA 1PC5A 3UR3C 2B9YA 2K1RA 3T1YJ 3M6VA 1OY9A 1DQ8A 2MZTA 3FKBA 3X3UA 2R7QA 2VD3A 3GFXA 5F8IA 2BQ3A 4P10A 2DGXA 3B4DA 2GMLA 5HK4A 1W2IA 4LBPA 3G6ES 3PM9A 1IM4A 1B70B 4ZPVR 3D66A 1K8AT 1REVB 3F0NA 1SL0A 2UXCJ 3OVBA 4UOCA 2YX4A 3FVYA 2F4FA 4A8SA 5LMUF 3NXZA 1N33J 3JAMY 2EFVA 3GYGA 1VFJA 5CQGA 1N5YA 3IRXB 3UQSA 2B43A 4W90B 2MJNA 3B6BA 4Q8FA 1JIHA 1QUVA 4I4BA 1B7YB 2D9PA 2ZD1B 4RWWA 2KVIA 1HI1A 2XC9A 3V6HA 2C3MA 1TUVA 5FDLA 1SKUB 5T7LB 3NWRA 2P6SA 4WF9Q 3N28A 3GYNA 3LGHA 2DNLA 4LF6J 2XO7A 3CVKA 4FVMA 4UOFA 2ZOFA 4C8MA 1TK5A 4B3MJ 4V19J 4J37A 4ANDA 4TU9A 3OUYB 1H2UX 2VA3A 4N47A 4O0NA 1JLAA 3LW5C 5B08A 3W5YA 4LT6A 2XGPA 2BW7A 4O44A 1T9WA 4DV2J 1CJKB 3Q2TC 4P2XA 3MM6A 3MMBA 4DX6A 2GQCA 5DM6Q 2PDAA 4JV5J 1HLWA 3GTYX 3FBFA 2LQ8A 3OSNA 1S6PA 3T1HJ 2F9JA 4CH7A 4HR2A 2YNHA 3TVKA 2OFGX 2QO3A 2B7CB 3RAQA 2QMUB 2IA0A 2ZDOA 3W2WA 1T9UA 4MAKA 3DLJA 1H38A 5A6WA 1EX8A 3IR7B 4NLSA 3BN7A 2BKOA 3IR5B 4C3MA 2L48A 2V9WA 4O3OA 4ZHRB 3MEEA 4U9RA 5KFTA 5KG4A 3OR2B 1XNRF 2DNQA 3KWMA 4WU3A 1OIAA 5ETVA 4BHQA 3H40A 1T03A 3EGWB 3PEJA 4G1IA 3BJYA 1DURA 4W4MA 1L3TA 3DHWC 2I5JB 2PFDA 3W7BA 4ANCA 4OYOA 1YRUA 2XSFA 2RB7A 1Q81T 3EYZA 4IRCA 3BM7A 2PMWA 4K0KJ 5JUMA 4E0DA 2B9EA 2WBMA 3CCMS 1KSPA 2Z56B 4DR4J 4RW7B 1UJ6A 4WKRA 3LGMA 3V81A 3KG0A 1OPIA 2HAFA 3Q83A 3PR5B 3FGVA 1QLNA 3MAHA 5HVFA 2WTFA 2M0GB 1GH8A 4I2PB 3MMCB 5G0RB 1EHWA 3HFZB 2BE7D 3TQ1A 3W65A 5LSLA 4DL3A 4FXVA 3BSNA 4N8OA 1H7WA 5D78A 1NKCA 5A2QU 2V4QA 4TU7A 2HGNA 2DK2A 3KLHB 2Z30B 4IFYA 4J9KA 1VQ5S 3LWMA 3P49B 4DPWA 3A13A 1OO0B 2QSFA 2DGVA 4PG6A 1S0NA 3QWPA 2VG6A 5J2NB 2YH1A 3DRRB 3KK2A 5GMEA 3SQGA 1F3FA 1WI6A 4KR0B 2F8MA 2NSBA 2BVZA 1XEZA 4ED3A 2OEJA 4F4WA 2VICA 3FEZA 2QT7A 2RMLA 2LCWA 4J9VA 2BZ2A 4LRCA 3QAEA 1WC3A 1UVKA 1NUEA 1HNIB 1U8WA 2XO6A 1HNXJ 2BABA 3PIOQ 2W9BA 1YK9A 2Q6CA 1IVZA 2WAQD 4EBEA 3W62A 2J0XA 1WOSA 1N5SA 3EZ5A 5IC6B 2RRAA 2GCFA 3OL9A 2RRNA 1IUJA 1RWPB 3KHLA 3CSKA 3LAMA 1RP5A 1SB6A 3QIDA 4XDDA 1RTIB 2XZDB 4DPOA 3PZPA 3DMJB 2IMWP 3OD2A 1RT6B 2HQDA 4B3OA 5D0RA 1FA0A 3BDPA 2CQ0A 5FJ4A 2XWYA 3GB0A 4UUXA 3J80U 3TRGA 1RTHB 2GAGC 1F0XA 3QYYA 3MM5B 3Q86A 3A8EA 3BO4A 4C0HA 1FKOA 2RVJA 2HZCA 2R2RA 2YBVA 4XAKA 3WZ0A 4RW8B 2J7UA 3QFHA 4G1PA 3OHAA 4EZ9A 2XMJA 5RUBA 3N9UC 5IXUA 5KOWA 3W60A 1R3NA 5GAHI 2CVIA 1G2EA 3V6DA 4CO4A 3W2VB 3CDAA 3WC2A 1FXLA 2CQ1A 3GLJA 1NMEB 2YVSA 3QFWA 1R8HA 3HT0A 2FD2A 2ZFHA 1TMJA 3J81Y 1IBCB 5D4NA 4DL7A 4F25A 4AL6A 2A10A 1P27B 4WWSA 4FYWB 3OHBA 3G71S 3A12A 1L5UA 4I0WA 1TELA 2B4PA 4FBUA 1VLOA 3RTVA 3DI6A 3OBIA 4PWUA 3C6UA 3OLAA 4P52A 4DXLA 3KLFB 3BB5A 3C14A 1HR0J 1UA1A 4DSIA 3IC1A 3VAKA 4ID5A 1U0HB 2BEFA 1Q4RA 1WF1A 3BDEA 4FXWA 3EGVA 2QZ8A 2DNHA 1HFEL 3PKYA 3P96A 3VF0B 3J7YU 1ROFA 1Y3JA 3K0JA 3K5PA 2YKAA 4PWDA 2YNGB 3G8TA 2IAJA 2PSZA 2FJWA 3OW2R 1IWAA 2LDYA 3M8WA 3MR5A 4DFPA 4LSNB 1MN9A 1XC9A 4EUVA 2HHVA 1U1OA 2E7VA 2XMKA 3SFUA 4IDKA 3N6NA 4R5PA 2BKNA 3G82A 1HPZA 1GK8A 1U8SA 3G9CA 4RBUA 1ZH5A 2KFYA 3TAPA 4ZP9A 3K5NA 4B3TF 3W9JA 2Y8YA 4KFBB 2ZH2A 4CTAA 5LM7E 3HJFA 4CH0S 4MKVA 1R6YA 4MYUA 1FDDA 1VOMA 5U47A 2J9DE 3M8QA 4UF4A 3JXOA 1D09B 1CJVA 1JXVA 1KLMA 3EPIA 4LR7A 3IAM9 4UOHA 5GMDA 4DFJA 2CG8A 1D0EA 2GMHA 2XS2A 5HMWA 4FPRA 1NB2A 4ED8A 1Q8LA 5I42B 3N79A 3AXMA 3H7HB 4C6AA 2HIQA 4ED1A 1LWCA 2AX1A 2ZM6F 4DL2A 5D4PA 2H65B 2DGUA 1SKSA 4PUOB 1TVRA 3CULA 3VV2B 4NA1A 4PG7A 1E6YB 5L39A 1F9EB 3H20A 1S0OA 4DR3F 2C2OB 4PYAA 3DGPA 1S1WB 4GO7X 1OS5A 3TZYA 2W2MP 1MLAA 3Q0AA 1CSJA 1N6QA 1YJUA 3IP0A 2DKOB 3ULHA 2Q1LA 4X84A 4OZ1A 2FC8A 2DY1A 2OPQB 1JLQB 3GCWP 2YXLA 3I0SA 3JQKA 3ZC4A 4Y2KA 1JMTA 4K4TA 2G2YA 3KKFA 2MGZA 5B0BA 2J5AA 1C1BB 3AODA 2BQUA 4KGZB 1RYSA 1VC5A 2X51A 4KTQA 4CT8A 4GVBA 3G8QA 4F4ZA 9ATCB 2RJZA 3P4UB 5CD4A 1WC5A 4OHZA 4MFBB 2R42A 3BSAA 1S1TB 1X9MA 2V8VA 3NS5A 3MR3A 2CDQA 1QE1A 1U26A 3ZNUA 5SZTA 2IVMA 2L9DA 3IAS9 2CNKB 4HACB 2ZNYA 2VDIA 4G6VB 2R8IA 5J2MB 3ITHA 2W1BA 1T3OA 4L75A 1FEHA 5HROB 4K8RA 2FC9A 5F41A 3POTA 4OI2A 4PEOA 4ITSA 4JI6J 3OTOF 3QRPA 2IJNA 4DUZF 2OP5A 2ZHOA 4C8KA 7FDRA 1C1CB 2ZC3A 3ZZ0A 1HBMA 2G9OA 4Y2IA 1KFSA 1WJ9A 3NAHA 4LFBJ 3M8SA 2J6SA 4LF5J 1Q78A 2WB1D 2AMCB 3KLEA 1N34F 1N36J 3D6FB 2VG7A 2MZ1A 2KYZA 2A1BA 2R7UA 3US5A 1TFWA 1NB7A 3QLHB 2KM8B 2QX0A 4USMA 4LVNP 1HQEB 1WUUA 1CJUA 4FKYA 3UWTA 1DRZA 1OYDA 2A2DA 2VPZB 4X66J 4CLYA 1YJ9S 1HA1A 4O3PA 2ASDA 2CZ4A 2R7OA 2XYGB 4QWBA 2CVEA 4CRJA 1PBUA 6FDRA 4DL4A 2QE5A 1X8DA 2IRXA 2RHQB 1FWLA 1UFLA 3PY8A 4R25A 1VC0A 1QAJA 4WTYA 4WE1B 2DNGA 1HWKA 1B0VA 3BBFA 4DV4F 1FKPB 3VHQA 2G1DA 1LKZA 4U7UK 2A6MA 3MM9B 3SMZA 1RAOA 3CJ2A 5CXTA 4N5SA 4M63A 5C25B 3MAAB 5J1PA 4U96A 5CCLA 1RB0A 3PRVA 1VBXA 2B9WA 4F4XA 1PBAA 3F56A 3IS9A 4I67A 1P6TA 1RACB 3ZZTA 1MWYA 4DHVA 2FJEB 5T41A 2ZOMA 2IBOA 2W2QP 4ED6A 4JP8A 2EK1A 1GXUA 2F1FA 1FF2A 4YFUA 2R2TA 4IO1A 1U6BA 4DSFA 1LFWA 5LMUJ 3PACA 5EX0A 2FY1A 2IM0A 3OR1B 1Y5NB 3NGSA 2QSWA 4K7QA 4ZLNA 4U6PA 1FTCA 2E44A 2K2PA 1SJ4P 2WRMA 2CUYA 1DY3A 2MHEA 2OH2A 5KFIA 1H74A 5IFMA 5DLGA 3UVJB 4HI1A 2QGFB 4M5IA 3LPYA 1XMOF 4PXBA 4CLLA 5BR8F 2Z58B 4ZP7A 2BJ9A 1TK8A 4EO6A 5J2QB 2MZJA 5JVHQ 1NPKA 3IBCB 2CAJA 2FHJA 1UW4A 2XHCA 1UVIA 1N56A 2B6AB 5CZVA 5HANA 2ZHAA 3JB9k 4LVOP 5KT5A 4JI4F 1WWHA 1TL5A 4RNOA 3ET6A 3M1VA 2X7IA 4HKQA 2HHQA 4CCHA 4LF7F 1RK8A 4UTGA 3P8BB 1XNQF 3I5CA 5E3AA 4EZ6A 4P2MA 1M1GA 2CPYA 2JX2A 3GILA 4DF8A 1D8YA 5DETA 4NLVA 2EVZA 4A8XA 2EFNA 2GZOA 5LT5A 4URGA 1NEEA 4NI2A 3HHLC 2DHHA 3S6EA 5CYJA 4UT4A 3MPWA 4IQMA 4DPUA 3DM2A 4YR3A 3W8GA 2OI2A 1HI0P 4KY3A 4ANEA 5HQLA 1WTFA 4PXCA 4HHUA 1TL3A 2YX7A 3O5TB 2AIRB 1Q82T 2CJ9A 5F8LA 1V3RA 1IR1A 2C3PA 1S49A 5E0OA 3RB0A 4ZPTR 3CJTA 2QA4G 2DXDA 1R8AA 1KQSR 4NL5A 1CULA 3BYRA 1IKWB 2ZJRQ 1S10A 4DV5F 3DDKA 2DHSA 3DRSB 1RKIA 1UJ4A 2UZAA 1IQTA 3UDLA 1HMVA 1RWUA 3HX9A 4USKA 4KV8B 2PMZD 3HK2A 4OYIA 2RKIB 4KE5A 3E01A 3C3LA 1RT5B 3D3CJ 3JTNA 2XM3A 2CPXA 3WBZA 2XLIA 3J7ZT 3R97A 4PR6A 3PX4A 1HHSA 3LGNA 4K50A 3HKWA 3K17A 2W8KA 2XS7A 4OJ1A 3QZ7A 4AYBD 4TY8B 2V0NA 2GJ2A 8ATCB 4KKOA 3MMAB 1EQ0A 2UP1A 3MPYA 1S12A 5LXRA 4X4NA 3TZZA 4NZ7A 2VASA 3HVAA 4RX6A 3SCIE 2LKZA 4MKBA 4M5JA 2WZ1A 1BQNA 2MZRA 3LH2S 1UCNA 3MPVA 4WFZA 1CBKA 1S77D 4YDXA 1S9GA 3BGRA 2H51B 1VYAA 1DTQB 2WVDA 2O66A 1IM6A 3GFZA 3RBXA 2ABYA 1X4HA 4WIIA 4B9LA 4ZVUB 5E7OB 2XMTA 4OJGA 3R27A 1SCJB 1F6TA 1RA6A 4L6V3 1T3NA 1W26A 3PCOB 2CPIA 2DCLA 4M5GA 1OQ6A 3FCHA 3QJPA 1J5OA 1NK6A 2V63A 3HULA 1NSKL 2RS8A 2ZJQQ 4KHMA 4O0IA 5ETTA 2KTQA 3MM7A 3IM8A 4RW9B 3AB4B 1RJJA 3CJ8A 3N6MA 4EGLA 5C42B 3SSQA 1F5AA 2V5HG 2E5HA 1NZAA 5KG5A 1TL1A 3RG6A 3SDEB 3DXBA 3OJUA 4WFAQ 4KB7A 2FHJD 4H4OA 3HVRA 2XCPA 2ROPA 2R2UA 2R8KA 2HGLA 3U1NA 4URSA 4EK2A 2RQCA 2M9KA 2GFFA 4X4VA 3CCWA 4EYHB 2R8JA 2N4CA 3IM9A 1QSSA 4F0KA 2XBPA 2XY7A 3TJ8A 1VJQA 1FDNA 3SV3A 4JI3F 2ZE2B 2QLWA 1VQ9S 1YBUA 2MB0B 3JS9A 3K89A 5IOLA 2RQ4A 2JH3A 1WEYA 3V6KA 1FRJA 1OQ3A 1S1XA 4M5KA 2DO4A 1RWXB 1S1UB 4A8QA 2B8QA 1ZPWX 4CYUA 3R5DA 1T05A 3I9ZA 4KH0B 2A6OA 5HBMA 1RAGB 2L08A 3MCMA 2CPFA 2FDNA 4R8UB 2YNIB 4B9SA 1S48A 3FQKA 4L3NA 2HFUA 2C2NA 2CPHA 1H72C 1B0PA 1KKHA 2I0XA 3HSJA 4ZCKA 3OL8A 1WHXA 5DO2A 2Z2ZA 4ZOSA 4DLEA 2WVEA 2RNEA 1WOOA 4LF8F 1JXLA 3FUYA 1OYEA 4Y0FA 1C2PA 2BANA 2HHUA 2CQGA 1N5TA 2VBYA 5C24B 4O3QA 2AU0A 4EEYA 3FSYA 2UXDF 2GIQA 1HBUB 3M2UA 3AFGA 1EARA 2XB2D 2CJYB 5IC4B 4PQUB 2NSCA 2RDIA 4J7CA 2XI3A 3NWGA 4FF2A 1CS4B 1WG4A 1RT1B 3J7AN 4XIUA 3MR7A 2Z2YB 1UEVA 2FGCA 3MCSA 2E5IA 2CJKA 3BZQA 5EN1A 1U2RA 4KAIA 4ECXA 4B3TJ 4PG5A 5IWAJ 4LREA 5E3RA 1FJ7A 1RZMA 1YJTA 2HMIB 4DG1A 1U0SA 1FDAA 3UDVA 1RUSA 2ZWPA 4NLTA 3EWGA 5F8MA 1S6QA 2DHAA 2KRBA 2HWHA 3BF4A 2MLZA 2R7SA 3R5JB 2XSJB 3THPA 4N76A 3CF5Q 2BA9A 4F7VA 2N7CA 4RU9A 4ID8A 3K2YA 5FLXY 1UPPA 4X64F 1SVDA 1VQOS 4QYRA 4HH0A 4OZ3A 5CD4H 4U67Q 2OPSB 2E7WA 3TUZC 4Y3CA 3CC4S 1TKDA 2K1RB 2K8GA 4W92B 4ECWA 3JSMA 3AQOA 3ETOA 2RUSA 5KFXA 4ES3A 2ZM6J 1Q5YA 3QGPA 1JJHA 1RHUB 1A9NB 2W7AA 5B7WA 1NNDA 2B4UA 2BJEA 2MQPA 4DR3J 4ECQA 3UCUP 5D4OA 4I7FA 1NKEA 2LEPA 2R7XA 5GADU 4DX5A 4PXDA 4F3QA 3QJLA 4C8OA 1ZM3A 5JJBA 1MWQA 4RL1A 4Y6IA 1CQNA 2OD6A 1HQUA 2ZEJA 1VK8A 4CO0A 2ZBQA 1GMWA 5KTQA 2NYIA 4U7CA 1VRQC 3DOKA 3AY0A 1SJFA 1N5YB 4ZVFA 2OJ3A 1VI7A 2NUUG 4K2XA 5IZHA 2DH8A 5E33A 1U25A 3PFOA 5FDLB 4J9UE 5HLFA 3CXCR 2ERRA 2WVFA 4ZVGA 4DCPB 5LJ3Y 4DEZA 2CXEA 3CCLS 2X1GA 3CIMA 3DLBA 3CCZA 2VFSA 1SJRA 3M9OB 2W4CA 4QYZK 2HHWA 1YITS 3ZXWA 5HP1A 3CJKA 4RZRA 2WSFC 2YTCA 5C2GA 3OVAA 1MU2A 1JLAB 1YGYA 1NK0A 4PXEA 1U45A 5F3TA 4O44B 3TJAA 1IKXA 2DNYA 3EJMA 3MM6B 3U7JA 3MMBB 3BYPA 2XG8A 2DGTA 3S01A 1WKKA 1EKSA 5K5MA 3W66A 5H9FK 2LVWA 2FIUA 4F2RA 1S6PB 1X4AA 3OTOJ 2RDDA 4DUZJ 3W9IA 3IWXA 2YNHB 3JAMU 4ZVEA 1HKAA 4CLTA 3HT3A 4ZJLA 3PJXA 4DUYF 1RT3A 3V4MA 1IWGA 2PO4A 3UD5A 5JXSA 4DFKA 2DTJA 4YHHF 3G4SS 1CJTA 4LRFA 4K59A 1YI2S 1WF0A 2FLOA 1VDHA 1ACMB 3WIVA 1FNOA 1N34J 1RHQB 1JJCB 1EETA 3MEEB 3KK3A 1GT8A 4NLYA 2VH7A 1T03B 4HLBA 4ILMA 1D9AA 1Q8KA 5DQIA 1WTBA 2DGQA 1PYOB 1OWXA 3F41A 1SC1B 2P9CA 3IRWP 1SIZA 3GMGA 1MMNA 1YLXA 1TK0A 3NGTA 2CQ3A 3CJ3A 4RKUC 4DN0A 4DV4J 4RNHA 4MIBA 4OX8A 3HZEA 1NJXA 1RT2A 2I8EA 2AGQA 3EX7B 3B78A 3V81B 3MMJA 4BC9A 1HNVA 4F04B 5C2CA 3HM9A 3KJVA 1WHWA 3QT8A 2DNOA 1K9MT 1H98A 4ZVQB 4ZPBA 1LK5A 4K4SA 2R7TA 4NEYA 1B64A 2BMBA 4CO2A 2UVWA 3DRXA 5LSOA 3MECA 4N8NA 4ZLPA 1Y4ZB 3JSRA 2R9LA 2DEJA 3A3OB 5LJ5Y 4F4AA 4IFYB 4OZ0A 3UPFA 2VKZG 3BEGB 4HHJA 1M90T 1MROA 1PKUA 4YN3B 1RAAB 3ZZPA 4RUBA 2BRKA 4JB8B 2GX8A 4YB1P 2VG6B 3KK2B 1FE0A 3SQGB 4ZN1A 2EKNA 3PO5A 3MAQA 2HIYA 3RB4A 1NM2A 2MDAA 3BKTA 2HSEB 3CCJS 1TAQA 4NLDA 1XMOJ 1GMWD 3SXLA 1Y0HA 3K5OA 5T14A 4F8RA 3QWUA 3HDSA 4H4MA 1VISA 2KI2A 3OFFA 5AXKA 1GXLA 1ZPVA 4B3RF 3VZHA 1QJHA 3A1YG 4X4SA 1BD6A 9RUBA 1RLCL 3IXQA 3OXGA 5AXMA 2DJWA 2VFRA 4BBYA 4IOBA 3TA2A 4ZMMA 3KNGA 2W9BB 5DG9A 2RU3A 4WIQA 2MYFA 2OD4A 1YKWA 2KDOA 4CI0B 4C8LA 1P9YA 2V34A 4LF7J 4ZITA 2DR5A 1XNQJ 2CZ9A 1EQMA 2OSQA 3CCVS 2YKMA 1RCOB 2HW3A 3PKMA 4J5OA 4NLWA 2C2EA 3CW2C 3HKZD 4B3OB 2ZH6A 2AJQA 1TMMA 5E3QA 2H3EB 3M8PA 4FVCA 2O01C 4Z7YA 3C15A 2J7KA 3NCQA 3M32A 4CO5A 3TZWA 1R8CA 2R7VA 1FCAA 4RJVA 3DOLA 1L3SA 2RAQA 3AHPA 3BKUA 2W7PA 1SC3B 1DLOA 3HD1A 2HG4A 5A8KA 1D1UA 2CKWA 1R7IA 2XHWA 3W61A 4EYIB 3RB3A 1VQYA 2DNNA 2YWFA 3RU0A 3Q22A 2AYBA 1UFKA 3RW7A 1SJ1A 3V6DB 5BYSA 2HK3A 4X4OA 2NCKL 2CJBA 1WC6A 4DX8H 4AE5A 2VFVA 3PYDA 1RCXB 2Y3YA 4KO0A 2LEAA 3T5JA 3QSYB 2CPJA 1U49A 1U6ZA 2QRRA 2IPOB 1IKVB 4DV5J 1RTJA 3R1LA 4DQIA 2FQQB 5IQQA 3KHHA 5KFJA 3RAXA 1M5HA 5BYRA 3DI6B 3R3TA 5B09A 2MHNA 2IVYA 3C6UB 4GMKA 4USHA 2DR6A 2HHTA 3C14B 4L72B 3AT1B 2AWZA 1VLYA 3KG1A 8AT1B 1REGX 4ID5B 2MZQA 2IDLA 3PYGA 1JLBA 4CP5A 4KT0C 3N01A 4OLOA 4Z37A 5K20B 5KFVA 4WJBA 3GSDA 1S59A 4KJIA 1VS3A 3MXHP 3ELHA 4MT1A 1GTEA 1R0CB 1G6BA 4PWDB 1SPBP 4ALZA 2DITA 2GNKA 2IAJB 3MF5A 3VAJA 2WK4A 2ZH1A 1WC1A 2YX1A 3J81U 1FJGF 1R8BA 2HHXA 3TX0A 1U2FA 4IDKB 4DUTA 2XQCA 3H2LA 1QTNB 4M94A 4R5PB 1HARA 4NXMF 1M5KC 1HYSA 3G82B 2VQFF 1HPZB 1FJCA 1NJIT 2VPWB 3K5LA 2XGQA 4AQYF 1LW0A 3QT5A 4B9TA 4O3RA 4CTAB 1O5JA 3Q8SB 3KHRA 3TUJC 2OFHX 1S7HA 3WDOA 2P5VA 1UAWA 4FPIA 1RWVB 3C66A 1F60B 3FC9A 3M8QB 1K0VA 3MR2A 1CJVB 2YQ1A 4OYXA 5A8WA 1KLMB 5THWA 4K2JA 1FRKA 1D3WA 4OHWA 4ETZA 2JNJA 4NCGA 3D3BJ 4HHHA 2H4YB 3V5RA 3BPSP 3LANA 2V2ZA 2WONA 4Y2MA 1N4LA 4Q2MA 4NWBA 2IVFB 1KRPA 2LA4A 3GU0A 3H59A 1APSA 1LWCB 1S4FA 2IRYA 1ZOTA 4FNHA 4LBHA 2DBBA 1TVRB 4LIWA 4JI3J 3SSSA 1EAYC 4G1QA 2MPUA 3SI8A 2ROEA 3QRRA 1C4AA 4OI0A 2AQ4A 3DGPB 5IT0A 2R3VA 2YPYA 3ILOA 5CYMA 1AZSA 1KFDA 3R7NB 1RA7A 1N6QB 1DJ0A 4C0OC 4ICLA 4ZS6A 2CADA 5DLFA 3ZTQA 5LMNF 3I0SB 5C7PA 4KGXB 1MSWD 1T9XA 1FE4A 2MGZB 2ZHBA 3FRZA 3BO3A 2D74B 2W4PA 4KPCA 4PRFA 4QIGA 2N3OA 3NS6A 3MD1A 1FRMA 4K5RA 2M8DB 1XTZA 4LF8J 2I2YA 1U6FA 1R8PA 1VQ7S 3EXCX 4IUFA 1Q5VA 4TYBA 2QLFB 1GQEA 3N5BA 4Q43A 1QE1B 1NSPA 3ZTRA 3FFIA 2HQ3A 5DM7Q 1FX4A 4WFNQ 4ZVPB 3E3XA 2O1PA 5J1EB 1R43A 2HQFA 2UXDJ 1X31C 2YKNA 1I94F 2ACMA 3ITHB 3T9NA 3LF0A 3EVOA 4F26A 1OY6A 1HW9A 4EFAC 4Q2LA 2EC0A 4GKJF 3POTB 4EWTA 4ECRA 4YS2A 4U95A 1F1BB 3EZOA 3A4TA 2HQIA 1W25A 5HQMA 3K8WA 3H2UB 4NYZA 3TAQA 1RHKB 1HBMB 3Q2SC 5AE1A 3CE8A 3FBBA 2D69A 2YKPA 3R2CJ 4LRDA 3GSIA 3KLEB 3IGNA 2F8EX 1EZZB 4CWBA 1FRLA 3NNAA 2VG7B 2MEWA 1YJVA 2J9DA 2BV3A 3CDBA 4MK7A 1CJUB 5KFKA 5E3CA 3F73A 3PO4A 1HWUA 2KFZA 2MQQA 4ETXA 1VQPS 4YMEA 5L1JA 2CG4A 2UUAF 4LRBA 4X64J 4KPYA 5DDRC 2ATCB 1B99A 1NBEB 1X9WA 3M2VA 4IYQA 3KHGA 4CDIA 2MKYA 1N8RT 1S72S 1X5TA 1RAHB 3D54A 3OLBA 1XR5A 4AD6A 2JOQA 5IS2A 1RT7B 2HHPA 3R5BA 2Y1JA 3IS9B 1WI8A 3UDEA 1YBAA 2DYAA 4DR1F 4PYDA 2D9OA 1RISA 2MKKA 2NS1B 2D7SA 4DCJB 3VGSA 4LF2A 3MM5A 4K4UA 1JLCA 1LWEA 2A0FB 2ALYB 2ZVIA 1Y11A 2K7JA 4WP9A 2XULA 5D0EA 2J7WA 3P45B 4RNFA 2DEIA 2Z8QA 3D1QA 2B7BB 1SQEA 3H5XA 4AUKA 4HTIA 4WFXA 2HURA 3TEGA 1VMBA 4IG0B 4O4GA 2PN6A 1CC7A 1PIEA 2QYCA 3PJ9A 1QDUB 4USJC 2FJDB 1GFWB 3PDNA 1YSJA 4Q7AA 3DYAA 2CNLB 4N41A 1RAFB 5D6GA 3ISNC 2WCXA 3L7PA 2W9CA 5D0GA 4RNMA 2Y1RI 2IM1A 2DGWA 3FRYA 2DY9A 4YB7A 3BSOA 3RJMB 2PEBA 2KJWA 3TO8A 2U2FA 1HWJA 4ED2A 1FD8A 1JB0C 2OELA 1UWBA 4ZVSB 5KFEA 3NOCA 3ET6B 1VC6A 3NGUA 5H9EK 1RHMB 1F3VA 1C0UB 2AX0A 3VGUA 3MGJA 4DUYJ 2HS3A 2O5DA 2FVCA 4NI2B 1U1PA 1BQXA 4YB5A 4YHHJ 3CUNA 2VJUA 4ZVHA 1KEKA 3CJ4A 4IOCQ 4NLRA 4CZCA 3DM2B 4DV0F 2IJFA 2GVDA 2JVOA 3DRPA 4TY9A 5K14A 5CZXA 1OSCA 1TL3B 3EDRB 1Z2LA 1X4BA 1HWLA 4GC7A 2ADCA 2GMJA 4JOUA 4X4TA 4J91A 4P72A 4F2SA 2CYYA 1I51B 2MSTA 3MPDA 2KT3A 1E6VA 3OXFA 1Q0NA 3MHYA 4RW6A 4ZCIA 4AL5A 2E1RA 1TKXB 2CQ2A 2PD1A 4LF1A 4FF1A 1CULB 2ZJPQ 4BCAA 2X1BA 1X5OA 3KMSA 2HBYB 1HMVB 5M2RA 1XQIA 1T9TA 3R2DJ 3H98A 3VVUA 1MNEA 1RAJA 1KOHA 3TI0A 2VKRA 4LSLA 2VJVA 4NRUA 4QW8A 3C8YA 2CQPA 2RU9A 2P9EA 4OI3A 1LXJA 3M2RA 4J9PA 5F3ZA 4DCOB 4KKOB 2SXLA 3EM1A 2IMOA 4OL8A 1QD1A 2AKWB 3MTJA 3R5CA 4CLZA 4RLEA 1N5VA 4XPEA 3C19A 4YR0A 2V6AA 5FIIA 3B4MA 3KJFB 1BQNB 1QTMA 5C5JA 3P3DA 4I2QA 1S9GB 3D0GE 3BGRB 4DZDA 5E2QA 2Q3PA 5AJ3F 4I6YA 3LP2A 3TQEA 4ILLA 4CLPA 1NJYA 1RTDA 3BGLA 4F02A 1NK9A 3R5GA 4B3RJ 1XIQA 4ZPWR 3JQJA 2CWKA 1J5OB 2P9GA 2PT0A 2BKPA 4OQJA 5GAHU 4C11A 3MOJB 4O23A 3BGFA 4CLKA 1KVIA 3MM7B 3BPDA 3I32A 3Q8PB 4XTTA 3D0IE 2M88A 2L9WA 3L95X 2XNQA 4B3SF 2KL8A 3I55S 2ASJA 3AD9C 2VUGA 2XMUA 5AXLA 2AD9A 1TL1B 3OPKA 4M5NA 1NHUA 2HRTA 2G0JA 4H4OB 3D2WA 1VK3A 3OVSA 3PYFA 1WNEA 3DDIA 3TUPA 1VRTA 5G4DA 3ZTPA 5J2MA 4M5HA 2VDHA 2HGMA 1WORA 1NXIA 2M5YA 1KBRA 1Y5IB 1VR6A 3VR1A 1YJNS 1EKRA 2ACYA 3ZZOA 1NDPA 3KLGA 4GVLA 3OTCA 4X62J 2JDJA 1S1XB 3PRBA 1KS2A 3BGOP 1UP1A 1NH7A 1LWFA 2BE2A 4CYUB 4D3HA 3DNCA 1T05B 3NP5A 5HL7Q 2RHSB 4HTJA 2QA2A 5ETRA 5HBMB 1S9EA 5LOQA 3SQOP 3MTKA 4ZLLA 3D4JA 4H4KC 3HP6A 3HJVA 2OO4A 3DOMA 1SH3A 4NEZA 5KG6A 4B02A 4ECVA 2MKIA 2GGPA 2ZH7A 3TZXA 3CB4A 2JZ5A 2O3DA 1AFJA 4Z7CA 3I5AA 3KLIA 3MD3A 1PC4A 4OLPA 1D9DA 5DJBA 1UPMB 1F2HA 4RBVA 1FRIA 3PX6A 4S0MA 4CNZA 3SV4A 4TQRA 1NK5A 3DRYA 1FKPA 1BQMA 2X1AA 2BANB 4RBTA 1PYSB 5DQHA 4A8MP 2I6WA 2F4VF 2I9SA 2V9KA 4F36A 2EI5A 2J0QD 1LWXA 3NEKA 3WX8A 3WIUA 1N5QA 4IRDA 4CT9A 3MDFA 3X1LB 3LP0A 2U1AA 2YQ0A 2H5JB 2QIFA 5DG8A 3D1HA 3EDQB 1T11A 2VBZA 3M8YA 4BWMA 2X3DA 2HBRB 1FJGJ 2BXJA 3K7RA 3IWNC 2QL9B 1VQLS 4NXMJ 3CEDA 1S0MA 2VQFJ 5F8NA 4OMFG 3PV8A 1FD2A 2EW9A 5B0DA 4QR0A 1R0BG 4LRAA 3ZNJ1 4ZJOA 2Z2MA 1H3DA 1VIOA 4AQYJ 4IG3A 5B0GA 2FVSA 3D9BA 2FZKB 1Z4UA 4DG1B 1AXQA 2QLJB 3DLGA 2H48B 2KT5A 5DS7A 1S6QB 2KM8C 3LP1A 2RD5C 4L73A 3QIPB 2B4VA 1OPZA 2KHDA 1HNZJ 3D6MB 2UV8A 4WBFA 4IOAQ 3D68A 2F65A 4RUCA 3CCQS 2N7YA 5IT9Y 3FK4A 3BQ2A 4Z2XA 1NK7A 3I5BA 1BGXT 5F9LA 2HNDA 4FBTA 1KHWA 2JEIA 2NREA 1YVFA 1VCTA 4U8YA 2C1EB 2FVPA 1RAIB 2COLA 4DWIA 3MOZA 2Y0SD 1X9SA 3CCTA 4O3SA 1SH2A 3RW6A 5HJYA 2MKJA 2AHOB 3D6HB 2YNFA 3GFHA 2PFFB 4ECSA 4P2FA 2JRSA 4I7FB 2VFUA 4YEAA 4R0EA 5A8RA 1IR0A 2C3YA 4KGKA 4DN9A 5CH7B 2HEKA 4JI0F 3UCGA 3C6TA 1YZ6A 5LMNJ 4FYDA 3VALA 1HQUB 4LQ9A 1RGVA 3TARA 2ZZMA 2VONA 1U48A 3DOKB 1P9QC 3TUIC 1RSCA 1CPZA 1V3ZA 3CCES 3CJSA 5H9FJ 4J9OA 4DV6F 4DV1F 3RB6A 1NRKA 2OHDA 4OZLA 3Q8YA 3T5HA 5FLXU 1WDDA 2FB0A 4OX9F 3GG1A 3BKFA 1T9VA 1XK8A 2VA2A 5ETNA 1FVSA 3GJQB 5HLFB 1IKYA 2HNYB 3HFKA 1TP7A 2DIUA 2W9AA 3HI9A 3G6XA 1U1QA 1SV5A 3DRSA 1FO1A 3QQCD 2HWIA 2IYGA 3SEOA 3CJKB 3A8JA 3ENWA 5DDQC 5DDOC 1MU2B 3NL0A 1I94J 3I0RA 2RIJA 4I1TA 1IKXB 1M0SA 3LAKA 1KP6A 4A8YA 1V3SA 2Q79A 4ED7A 4GKJJ 2DH7A 3EICA 2PC6A 1Q16B 4JV2A 2KHCA 1FRXA 5KG0A 2CQHA 2WW4A 4PCQA 4E2FB 3R1HA 1V5IB 4USUA 3GWCA 1M5VC 4DSEA 1RT3B 3QATA 2CA9A 3MM8A 1CJTB 3HCXA 2DGSA 4DZ6A 1S1VA 4WKYA 2Y9HA 1NJZA 3B54A 4X65F 1EETB 2CWXA 2Y1LB 4MMOA 3KK3B 2CZVC 3VQTA 2POKA 3RGIA 3J7Z5 4ZPDA 2B9XA 5IT4A 1FVQA 1R89A 1UEUA 2MLYA 2VHGA 2R2SA 1RAEB 3KK1A 4M1KA 1H0HB 1TZ0A 5A76A 2G13A 3H25A 3ILIA 2MZSA 4IKAA 4DR5F 3RAMA 1X5SA 2UUAJ 5EDWA 4Y65A 2OMOA 1ZZNA 4OJHA 2XNRA 1URNA 3I82A 2FPHX 4DR2F 1PYTA 3MI7X 2ASLA 2NXCA 4I6AA 1RT2B 1TV6A 4TLRA 4P75A 4HDHA 4USWA 4ZN3A 1HNVB 3T3FA 1SC4B 3KJVB 5ITHA 4DS5A 5DGBA 3B8HA 3GZ7A 1C4CA 2XY5A 1SUQA 4IH6A 3M8RA 1AA1B 4F4KA 2E5LF 1H7XA 4DR1J 3MECB 4C97A 3EZUA 3A8IA 3QGHA 5B0CA 4DR6F 1TKZA 4DSJA 1AUDA 4W98A 2RSQA 1XR6A 4UZCA 2HVHA 3IG1A 1MROB 4QIWD 2LA6A 2GIRA 2FY8A 1ZM9A 3HHDA 5KG3A 5IQ6A 4J9MA 4C9DA 4OYWA 2MJUA 2CJXB 4HT5A 3G86A 4P7TA 2YWHA 5HI7A 2F63A 2IBKA 3OFHA 2GVZA 5L46A 1ZM2A 4R8UA 1WG1A 1GAOA 3MEKA 2BOAA 4EBCA 1U4BA 2NXJA 2Q6BA 1T02A 4ZLJA 2RS2A 3V4IA 2LXIA 4D3GA 4FP9A 2QLBB 4MK8A 2HFNA 3DLLQ 4CM0A 2HVZA 1LFPA 3AOBA 4IR9A 3PRDA 3ZZUA 3BS9A 1BE4A 4PG8A 1NK4A 2RH3A 3MFHA 4FKXA 2RT3A 2IDEA 2HZVA 2YKMB 3P5TL 2CFXA 1PSDA 3G6YA 2C3OA 3R5AA 2B8PA 2MQMA 4ZVRB 2KXFA 3D1OA 2G0CA 2XZTB 3L4BC 5GAGI 3M8PB 3IO1A 1WACA 2E1AA 2HBZB 3C15B 3I87A 2GJIA 3M32B 5KFLA 1NSQA 1PAEX 4ATNA 2HVIA 4AXJA 3DOLB 2XYHB 4WK3A 2DHXA 4DV0J 3P6YC 5A8KB 3HHLA 4ECTA 1KHVA 2HVDA 1VQNS 3PVXA 2EBEA 1XWLA 4C2MA 2EFQA 3M30A 4YQWA 5A6PA 1FERA 3JTPA 1BHNA 4QWEA 2B5JA 3OL6A 4DX7A 5LL6d 2HK2A 4NMXA 3NOGA 5HJXA 2CPEA 5KFOA 3OQ2A 4KO0B 1F5BA 4KRWA 3CTRA 4KH1B 4CO1A 3S8SA 1RTJB 3KLVA 3VTIA 2PMHA 3TX8A 1NKBA 2QTWA 2YKOA 2JC1A 5L1LA 3LPEA 2VBWA 4NLGA 3P5BP 3C46A 2NR0A 3D67A 2E1PA 3OJSA 1KD1T 4DR7F 2W2NP 5DZ6A 2VOOA 3TVYA 2MSSA 1DQ9A 3MEDA 2JEJA 2D3ZA 1JLBB 5K8MA 2XMVA 3RUBL 1IBLF 3O6QA 4KGMA 1YBTA 5DZ7A 3ILLA 1VBZA 2C2KB 2VBXA 4UOGA 2GO9A 3SYZA 4A8FA 3T6BA 5L1KA 1FFWB 5CHCB 1Z2ZA 3GIKA 2RQMA 1N54B 1GTHA 4LIRA 1KWMA 1WEXA 1Y7PA 3R6GB 2G2OA 3HZGA 5E3PA 3CMQA 3Q89A 2UUBF 2GHVC 1CLFA 1O0PA 3FMBA 3QT7A 1RBAA 1LOUA 1RWNB 3HXMA 1LQ9A 4OYZA 5AJ3J 4IFVA 2MQOA 5KFBA 1HYSB 4JI5F 1K0TA 3L7UA 2HVEA 5GMKa 5HO4A 2PGCA 2XCAA 3GIMA 1XNRJ 3N4WA 3DCAA 2BJ1A 3HO1A 1LW0B 3WC0A 1SIWB 2DB1A 5IV4A 1GEHA 3GV8B 3PNIA 5I3PA 3C16A 5MAOA 4NLUA 4DLGA 2IIHA 3H2VE 3NG8A 5KG1A 2EG1A 3IGVA 2NPFA 4B3SJ 5DG7A 5KFMA 5A8WB 4ERDA 3QT6A 1BMQB 3H4DA 4EU0A 3SCLE 1PILA 5LSRA 2OTJS 3W64A 4F0MA 2IC3A 2MQLA 4NCGB 2AYMA 3FSIA 1AT1B 4IH7A 4NX9A 4A46A 3DFEA 2WONB 1IBMF 1T8EA 1ICEB 1TR0A 2AP6A 4QPXA 2OLWA 1NZ8A 4L76A 3TAMA 2LMIA 4TU8A 1K44A 2XWXA 1UTAA 2CIMA 3H4BA 2A2CA 4DV3F 2QC3A 4G1QB 4RO0A 4RWXA 4ZIVA 1RT4A 1SQFA 5CYMB 5EWFA 2YWKA 1AZSB 5HSPA 4Y34A 2W25A 4ICLB 2ZC4A 5FD1A 4OYBA 3HHLD 2JLGA 3O2IA 3NGKA 2LQ9A 1UVLA 2BDPA 1H2VZ 2WSCC 3G87A 2JFDA 2HYIB 4WTOB 2Z0GA 1NLKL 3SSRA 3NGRA 2HS0A 3CDUA 1Q8IA 1VBKA 1H6KX 4K4WA 3AJ2A 1TL7A 2UXBF 2ZDPA 3HHEA 2AEJA 4KGVB 2ZH9A 1FDBA 1FESA 5I3QA 3CMES 3PXGa 1RBOB 2VL1A 2ASYA 2Z2LA 2AF6A 5AXNA 2V8DA 4V19X 3HFVA 1HBOA 4P2SA 3W8PA 3WQPA 3CWJA 2W2PP 2E5JA 2YPZA 1WHVA 3O44A 3FFIB 3TANA 4ZIWA 2F4VJ 4DJBA 2DXEA 4MKYA 2YKNB 1X0PA 2GIFA 3IFEA 1XR7A 2BQRA 3UNGC 4FS2A 1XMBA 2UUCF 4ECZA 4UW2A 1DAXA 2HKEA 3KDOA 4C48A 2M2BA 1RTZA 2UUWA 2J6UA 3MUVP 1S6OA 1ZZFA 4KSEB 4ECUA 5KFYA 5I4MA 3KOAA 3DXSX 3V2UC 4JV1A 3MCOA 4QR1A 1KR4A 4UUWA 1VJWA 4DOZA 3PTWA 1DTTA 5KFZA 2FHOB 1UKUA 3I31A 3VWSA 5KFPA 3PR4A 4NE9C 4NLOA 2HFSA 2BR0A 3HHNB 4QU6A 1K47A 4JI2F 4DFMA 4IH5A 1FRHA 3SIPB 5ETLA 2OPPA 4UZBA 4UY8T 1MWZA 3CO0P 5EUHA 3W5ZA 1AFIA 1YRXA 3KDNA 1DBDA 4QWDA 4PQAA 3EE3A 4OZ2A 4ECYA 4BS2A 2XMAA 1VHIA 4ZVOB 1UZDA 4QWCA 5EGYA 1SL2A 3GYXB 3O1LA 2QN6B 2OMLA 3M2VB 1X4GA 5EHHA 1VQKS 2EG2A 4ZPCA 4YP3A 3U02A 3RZAA 5KFFA 2PA8D 4Q8EA 5D77A 2EPIA 1UVJA 2B51A 1X60A 1MN7A 3FMWA 4WZQA 2O67A 1T0TV 3KJNB 4C8ZA 4ED0A 2KYXA 2BJDA 1SI9A 2LXFA 1SKRA 4C7QA 2FLLA 1RABB 4B9NA 4DI6A 3OFEA 4JI0J 3T5LA 1BWEA 1JLCB 1LWEB 5CYQA 3M9NB 1G4CA 3G8SA 3CPWR 1WKJA 4IO9Q 3PHTA 4Q5VA 4LBIA 2FJXA 8RUCA 2DH9A 4N56A 3AD8C 2A3JA 5H9EJ 4DV6J 4O4GB 4DV1J 4HYKA 2QG9B 2DR7A 3GR0A 1PG5B 3AJDA 4OX9J 4YY3F 2VIHA 1I1GA 4TVAB 2E7XA 3DYAB 5B0FA 2D3UA 1IKVA 3EUNA 4ZCMA 4Q0BA 5D3GA 3VVTA 1LW2A 2OPRA 2W9CB 5BYQA 1OJ4A 2IYIA 1X4DA 2KXNB 2WB4A 1ULRA 2VC1A 4LF9F 4QBUA 4JYAF 4OHVA 3UD3P 2LLZA 3AH6A 5ETSA 1JQGA 2AJ0A 4GRSA 3MEGA 1YHQS 1L3UA 4CLFA 3L3CA 5KT4A 1DARA 4P7VA 1KC8T 1RWKB 1JKHA 3ENAA 1UWBB 5EX3A 5ETQA 4OHYA 1UA0A 2HNZA 2WVBA 1F5CA 4G3IA 4B9MA 3GONA 3KTQA 4YUDA 4PWWA 3PYEA 2V8GA 2NUHA 3ZTSA 3M6WA 3VGVA 3D28A 5KFRA 1UEKA 4FF3A 1LV5A 2KJVA 2VU5A 4ZP8A 1W7WA 1FJEB 1D8ZA 1JLGA 4EO8A 3I56S 1CEZA 4M5DA 2CNOB 4OZNA 4CO3A 4NRTA 2GVDB 5KT3A 3DRPB 1S6UA 4X65J 5K14B 1WOPA 1PJ5A 2ZBPA 4TKTA 2HWTA 3ILJA 2GHPA 3PEHA 3H8YA 1YTYA 3OL7A 1K73T 1A7GE 5KFNA 4EBDA 3TOQA 3NGDA 3FQLA 2V4JA 2CQCA 4HT7A 5AE2A 2H4WB 1RE1B 1TFYA 3FBEA 4TNOA 2WOMA 1L3VA 1E6VB 3CD7A 2JSXA 4RW6B 4DF4A 4ELUA 2FLNA 4DR5J 2H5EA 5IWAF 2GAHC 1U47A 4X2BA 3UN2A 2FGOA 2BBEA 3MURP 2AGOA 2QJ3A 2HPUA 4DR2J 2DR9A 5KFGA 2E1MC 3VCDA 2X1FA 4QU7A 3CJQA 3JTOA 1O51A 5K8OA 1R31A 1RDRA 4I56A 2HHHF 2F7VA 1S57A 1PO6A 4NCAA 4WPAA 2C42A 3G2XA 4NLPA 3QNWB 4F3OA 2K3KA 2AJ2A 4OYAA 1X5PA 4ZA1A 4LSLB 1H2TZ 4RU2A 1JLFA 2D1CA 3RYLA 1SXLA 5KFUA 1QAXA 3ZO7A 2E5LJ 1YDLA 4O3NA 3VAHA 4CIOA 2C28A 2BYCA 2DHGA 4A4JA 5IM0A 2V2VA 3M2RB 3MFIA 1Q53A 2M70A 4DR6J 2M8HA 1S9FA 4LR9A 3UDCA 4A47A 1JLEA 1WSRA 3J7A1 2KXHA 1FNMA 3MCNA 2LQJA 4WZMA 4QR2A 2DIVA 2R7RA 3TNVA 3CD0A 2BRLA 3H0PA 2V4RA 4I2QB 1ZA2B 3HVTA 2BACA 3TW0A 1LEOA 2ZZTA 4MYTA 2R8HA 3GIJA 1D9FA 3EGNA 3W2WB 3CMAS 4PPDA 3H42A 5A0YA 2IM2A 3LP2B 1GNKA 2KT2A 3UE2A 1O8BA 2FZCB 3PJWA 2JWNA 1RTDB 1KNZA 1H73A 3OTDA 3I6PA 2IY5B 4HI2A 3IR6B 2FJAB 4XPCA 3GR1A 3QO9A 1T94A 4C11B 4ZKAA 1PGZA 3OXLA 4CH1A 2M7SA 1S99A 1RWWB 3AXKA 1FK9A 1DFDA 3BQ0A 1SKWA 1DZ5A 1IR2A 5K8NA 1I5OB 1KTQA 2ZVSA 3CIZA 4MJKA 4DQPA 3DLEA 1Y5LB 3J7YI 2GW8A 2EC2A 5J1EA 1VRTB 2F5GA 3OFGA 1ZAVA 3NCRA 1G7CB 3UW1A 4X4QA 2E9ZA 3JYTA 2HFZA 1ZM4A 3I9V9 3AA8A 5KOXA 1UFWA 2LXUA 5KT7A 2BE9B 3KLGB 4RW4A 5DGAA 2N82B 3DLKA 1TU0B 4LSZB 2QV6A 3FCVA 5L8RC 2NZ4A 2V67A 4USVA 3DU5A 4OI1A 2MY8A 1LWFB 2FYXA 2BE2B 2M4MA 5B0AA 3SCJE 3NBPA 1S9EB 2ALZA 3CD6S 1WF2A 1YRTA 3PW5A 4ER8A 4NZ0A 1WDTA 3PW0A 3NCPA 3DOMB 2RE1A 5L9XA 2XEXA 3T6JA 1TQLA 3BGUA 2HRUA 2GGPB 2HQCA 3W5XA 2P2CB 2K06A 5BR8J 3M7VA 4DR7J 3KLIB 4M95A 1VRUA 2B4OA 2RDJA 2YWEA 4A8WA 1IBLJ 2Y8WA 4PZVA 2VQEF 1EB0A 1BQMB 1RBLA 4Y28C 5F9NA 2R4FA 2RF2A 5ETKA 4JI4J 3GQCA 2UV8G 1NO8A 1FWPA 1UZHA 3DN9A 1UETA 1JNZB 4DV7F 3NNCA 3GV5B 1RT7A 2JFKA 1QY7A 1B3TA 5DRKA 1KLNA 1R0AA 1EP4A 3LP0B 2IFXA 2UUBJ 3GJRB 4HL9A 5J1NA 2AGPA 1VGYA 1LK7A 1HI8A 2VG5A 3A3PB 3E8OA 2J8SA 5I3UA 1HBNA 2XZWA 4V1Ak 1WKLA 5F0UA 4JI5J 3N6LA 3BO2A 3DHXA 2AEFA 4A8KA 4I64A 4LJMA 1FKOB 2HLTA 3N0VA 2R7WA 3UD4P 4ED4A 1J5EF 3JSYA 5KFQA 3KG4A 3PW4A 3LWLA 4IG3B 4IG0A 1TKTA 4FNIA 3KYLA 1C0TA 1M5SA 4L3KA 1WELA 3DLGB 3CGIA 2Q43A 1TTHB 5J2PA 2QL7B 3LP1B 2KZZA 1AW0A 4KIAA 1L3KA 2GQQA 5KFAA 2ZKUA 2J9CA 4F67A 2KG1A 2OIHA 1DQAA 7AT1B 4NXNF 5JVGQ 4F3MA 2CJAA 2ATLA 1N32F 2GQ2A 1RKJA 3KXDA 1EJ7L 5ADZA 2HNDB 3VQSA 5B0EA 2OEMA 4M8LA 4DQRA 1IBMJ 1V6HA 3K8VA 4XK8C 3O3LA 3PG9A 2ZUGA 5ETOA 3RBZA 3FZ2A 2V69A 1C0UA 2ADBA 3PFEA 4DV3J 5D4LA 4LF4F 5HATA 2YNFB 2BX6A 3TA0A 6FD1A 1F9FA 2DPJA 2VC0A 4USIA 3FBCA 5GAEU 5A8RB 1FFGB 4QW9A 2FJBB 3THVA 2LP4A 5F8JA 4ELVA 2ZBIA 3C6TB 1S0VA 4HVZA 3UI3A 2JLFA 3CJ5A 3H90A 1REVA 2D3O1 3UO0A 1SL1A 2IHR1 5HMYA 2M52A 3PIPQ 3C2PA 1GMUA 1MMDA 3GFYA 5H1SV 1Y9OA 4JI7F 3OV7A 4YDDB 5IT9U 2UXBJ 3CDWA 4OYMA 4MTPA 1TKXA 2BUNA 2IM3A 3IRXA 1RI7A 4QJVA 1IKYB 3NMAA 2AZ1A 1ZTWA 2ZD1A 2PE8A 1SV5B 4ZJQA 3QBCA 1U1MA 3R7SB 3O8WA 5T7LA 4DDFA 3QGGA 2GO8A 2LU1A 3Q8RB 3GP9A 1S5ZA 2XMWA 1DHMA 2J0WA 4ELTA 4BWJA 1R6VA 3I0RB 2IA6A 3D5MA 4NYOA 1XJWB 1S76D 3CCRS 3OUYA 2LQ5A 3FZBA 2YQ3A 2UUCJ 1FT8A 1N48A 5L1IA 2J6TA 2NPIA 4RR5A 3UCZP 3NLCA 4OV1A 2QYGA 3ZTOA 4NOHA 3R9LA 4K4YA 1Y00A 5HVHA 1CJKA 4LFCF 2GV1A 3ADAC 5DDPC 1KDNA 2ZKTA 5BJRA 3HSZA 1V9OA 2OAUA 3KJQB 3MM8B 3ENQA 1A6LA 3BR8A 3Q8QB 1MG7A 2Z57B 4QIFA 2MQNA 1S1VB 2CDRB 4J9QA 4J9NA 1IBKF 1QVGR 4JI2J 4L74A 3R7BB
chains in the Genus database with same CATH topology
2ZDOA 3W2WA 1FNOA 1EETB 4MAKA 3DLJA 4MMOA 1YG0A 4OX7A 1H38A 1P8GA 5A6WA 3IR7B 1EETA 3KK3B 2CZVC 4NLSA 3BN7A 2MXYA 3VQTA 3MEEB 3BQ1A 2POKA 2AYEA 3IR5B 4C3MA 2L48A 1K1QA 3J7Z5 3KK3A 2V9WA 4O3OA 4ZPDA 1YJRA 2B9XA 5IT4A 1FVQA 4O4RA 4ZHRB 3MEEA 1GT8A 2E5GA 4NLYA 1R89A 4B9UA 4U9RA 5AE3A 1UEUA 2VH7A 5A2QY 5KFTA 5KG4A 3KK1B 3OR2B 1X4CA 4ZHRA 1XNRF 2DNQA 3KWMA 4HLBA 1T03B 4K5SA 2R2SA 4WU3A 5SUHA 4ILMA 1OIAA 3KK1A 1D9AA 3OR2A 4M1KA 1H0HB 2PIIA 4BHQA 3H40A 3EGWB 5DQIA 1TZ0A 1Z1ZA 1WTBA 3U27A 2DGQA 1T03A 2G13A 3PEJA 1OWXA 4G1IA 3F41A 3H25A 2P9CA 3IRWP 4C3KA 3BJYA 2VPXB 3RBDA 2I38A 1DURA 2MZSA 4IKAA 4DR5F 1SIZA 3GMGA 3RAMA 1MMNA 1X5SA 2J0SD 1TK0A 5EDWA 1L3TA 3DHWC 4Y65A 3RR7A 2CQ3A 2I5JB 2OMOA 1ZZNA 1ZTTA 2FHMA 4OJHA 2XNRA 3W7BA 1URNA 2FUG9 3DC2A 3I82A 4F50A 2FPHX 1KVJA 5KG7A 2I5JA 4DR2F 4LMZA 3MI7X 1YRUA 2XSFA 2D3OR 2RB7A 3CJ3A 1Q81T 4RKUC 3EYZA 4DSLA 4IRCA 1HD0A 1TV6B 2VOPA 4DN0A 3BM7A 2ASLA 4RNHA 4FS1A 4MIBA 4I6AA 1RT2B 1TV6A 4OX8A 3AAWB 4TLRA 1Y3KA 1XN9A 3HZEA 4UQGA 4HDHA 1NJXA 3BSCA 1RT2A 2I8EA 5JUMA 4E0DA 2WBMA 3CCMS 2AGQA 1KSPA 3EX7B 1HNVB 3B78A 3T3FA 3K58A 3V81B 4B9VA 4RW7B 3MMJA 1UJ6A 4WKRA 3LGMA 4BC9A 3KJVB 1HNVA 2WSEC 2JL9A 5KG2A 3V81A 4RW7A 1SUQB 3HM9A 3KG0A 1OPIA 5ITHA 3KJVA 4DS5A 3PR5B 5DGBA 3B8HA 1WHWA 3GZ7A 1C4CA 3FGVA 2XY5A 1SUQA 4IH6A 4LFAF 2DNOA 1K9MT 3MAHA 2WTFA 2CJQA 1QLNA 1H98A 2M0GB 2KRRA 3M8RA 4ZPBA 1LK5A 4F4KA 2E5LF 4K4SA 2R7TA 1H7XA 2DNPA 5GAEI 4I2PB 1GH8A 3MECB 3MMCB 5G0RB 1B64A 4CO2A 4C97A 4OX6A 4JI1F 3EZUA 4QIVA 2UVWA 3DRXA 4I2PA 5LSOA 1HL6A 3MECA 4F4YA 4IR1A 3MMCA 5G0RA 4RUHA 3QGHA 4N8NA 4ZLPA 5B0CA 3TQ1A 1TKZB 4DR6F 4NZ6A 1Y4ZB 5LSLA 1TKZA 4UQTA 3JSRA 2R9LA 2DO0A 2P6TA 4OZ5A 4DL3A 4FXVA 3BSNA 2E9TA 3IG1B 4N8OA 1H7WA 2J9EA 4DSJA 5D78A 5LJ5Y 1NKCA 1AUDA 2RSQA 2V4QA 1XR6A 2HVHA 3IG1A 5K8PA 1MROB 4IFYB 4OZ0A 4QIWD 2LA6A 3UPFA 2HGNA 2DK2A 2VKZG 4TU7A 2GIRA 3KLHB 3BEGB 2ZH3A 4HHJA 5KAKA 1ZETA 1M90T 3BR9A 1ZM9A 3HHDA 1MROA 4IFYA 4AFFA 2D41A 4J9KA 5KG3A 1XMQF 3KLHA 1IJFB 1RQ0A 5IQ6A 3ZZPA 4J9MA 4C9DA 3ICLA 1VQ5S 3LWMA 3P49B 2MJUA 2BRKA 4YB1P 2GX8A 1OO0B 2QSFA 2VG6B 2DGVA 4HT5A 4PG6A 3KK2B 1FE0A 4C3LA 3SQGB 1KQFB 1S0NA 3QWPA 2VG6A 5J2NB 3G86A 2YH1A 2KZMA 2EK6A 3DRRB 4P7TA 3KK2A 5DQGA 3PO5A 3J80Y 3MAQA 2YWHA 3SQGA 4ZP6A 5J2NA 1JNRB 3DRRA 2AV5A 1WI6A 5HI7A 3RB4A 1N0VC 2XS5A 4KR0B 2F8MA 2VV5A 2MDAA 2IBKA 2NSBA 1SJQA 3CCJS 3OFHA 2BVZA 1TAQA 1XEZA 2HS4A 4NLDA 1VQSA 4ED3A 1IXKA 1ZM2A 4JBCA 4R8UA 3SXLA 1Y0HA 3K5OA 5T14A 4F8RA 1WG1A 3UFCX 1GAOA 4TXSA 4F4WA 1Q86T 3QWUA 3HDSA 3MEKA 2C3UA 1VIXA 2KI2A 3FEZA 4H4MA 3OFFA 5AXKA 4EBCA 1U4BA 3V4IB 1GXLA 2QT7A 1ZPVA 2RMLA 2Q6BA 4B3RF 3VZHA 1T02A 5D8HB 2RS2A 4WCEQ 1QJHA 3V4IA 2LCWA 3A1YG 3IN5A 2LECA 2BZ2A 2LXIA 3QAEA 1BD6A 4X4SA 5KFCA 3MR6A 3LUYA 1CC8A 1UVKA 3IXQA 4D3GA 4FP9A 1HNIB 3TA1A 3OXGA 4WYWA 2DJWA 2VFRA 5AXMA 1TAUA 4BBYA 4IOBA 4MK8A 2HFNA 1HNIA 4RNNA 3TA2A 4ZMMA 3KNGA 3DLLQ 2HVZA 2W9BB 1LFPA 2ZH8A 5DG9A 2RU3A 4IR9A 3PRDA 3ZZUA 2MYFA 2BABA 2OD4A 3BS9A 3PIOQ 2W9BA 2Q6CA 2KDOA 2WAQD 4CI0B 4EBEA 4PG8A 4C8LA 1NK4A 2RH3A 3MFHA 2J0XA 2RT3A 1N5SA 3EZ5A 2RRAA 2GCFA 3OL9A 2DR5A 1Q8BA 2YKMB 2RRNA 1IUJA 2CFXA 3P5TL 1PSDA 2OSQA 3G6YA 1ZYQA 2LU2A 2C3OA 3KHLA 3T1AA 5HN0A 2YKMA 3CSKA 3R5AA 3LAMA 3CCVS 2HW3A 2MQMA 3PKMA 1RP5A 1SB6A 2KXFA 3IA0A 3D1OA 3QIDA 4J5OA 5F8HA 4XDDA 4NLWA 2EBGA 2QA1A 1RTIB 2C2EA 2G0CA 3HKZD 5GAGI 3M8PB 3IO1A 3TR5A 4B3OB 2ZH6A 2AJQA 1WACA 2E1AA 5E3QA 4DPOA 3I87A 1RTIA 3DMJB 4WXOA 2GJIA 5L9NA 3M32B 2KB2A 5KFLA 3PZPA 3M8PA 2IMWP 1RT6B 4FVCA 2O01C 4B3OA 4ATNA 2HVIA 4AXJA 3VAGA 2J7KA 3DMJA 3DOLB 3NCQA 3M32A 4CO5A 1FA0A 3BDPA 1RT6A 1R8CA 4WK3A 2CQ0A 2DHXA 1T7PA 2R7VA 1FCAA 5FJ4A 2XWYA 3DOLA 3HHLB 1L3SA 3GB0A 4UUXA 3QGIA 2ZBCA 5A8KB 3P6YC 3AHPA 3TRGA 1RTHB 3OSPA 3D0HE 2W7PA 2CQIA 1DLOA 1F0XA 3HHLA 4ECTA 2HG4A 5A8KA 1D1UA 4C8NA 1KHVA 1RTHA 3QYYA 2CKWA 2I1RA 1R7IA 3DLHA 3MM5B 1VQNS 3A8EA 2XHWA 3PVXA 2EBEA 1XWLA 3BO4A 3M30B 4EYIB 4C0HA 1FKOA 4C2MA 3PW7A 2EFQA 2RVJA 2HZCA 3RB3A 1VQYA 2R2RA 3M30A 4YQWA 2B5JB 2YH0A 4XAKA 2DNNA 2YWFA 3WZ0A 1HNWF 5A6PA 4RW8B 1FERA 2J7UA 3JTPA 3RU0A 4QWEA 3Q22A 4G1PA 3OHAA 2B5JA 4EZ9A 1XBWA 2XMJA 5CA5A 3OL6A 2AYBA 2ZZNA 3N9UC 4RW8A 5IXUA 3RW7A 3CC7S 1SJ1A 3V6DB 2V94A 5BYSA 5KOWA 5LL6d 1Q79A 2L3MA 4X4OA 1R3NA 5GAHI 2CVIA 1G2EA 3V6DA 2CJBA 4CO4A 3W2VB 3CDAA 4DX8H 4AE5A 2CPEA 5KFOA 3OQ2A 4KO0B 3WC2A 2VFVA 1FXLA 2CQ1A 2YVSA 1F5BA 1R8HA 4KRWA 1BLUA 3W2VA 3CTRA 4KO0A 4CO1A 3S8SA 2UU9F 2LEAA 3FJ2A 3T5JA 2OSRA 4KHPF 2CPJA 1RTJB 2FD2A 2ZFHA 1U6ZA 2QRRA 2PMHA 3VTIA 5D4NA 3J81Y 3KLVA 1IKVB 4DL7A 4F25A 3TX8A 1RTJA 1NKBA 2L41A 2YKOA 4AL6A 3R1LA 4DQIA 3QIPA 4IQXA 5IQQA 2A10A 3KHHA 4NCBA 2JC1A 5KFJA 5L1LA 1P27B 4DQQA 3RAXA 5KFHA 2VBWA 3OHBA 5E5NA 3G71S 2HHSA 1M5HA 1KN6A 5BYRA 3DI6B 3R3TA 4J9SA