3CCVS

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 20
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ccvS00
3CMES 4WFNQ 2CQ3A 4M5DB 5CA5A 2YH0A 3EX7B 1B7FA 2U1AA 4TU9A 3NS5A 1F9FA 4OZ0A 5DDPC 2M52A 3IWNC 2OJ3A 1N54B 2A3JA 4J5OA 1A7GE 3CC4S 1X5SA 2MKJA 3L3CA 1VQ6S 3G96A 3CCMS 3CCUS 1M5KC 2MQLA 1M90T 3R1HA 1U1RA 2MJUA 4W92B 2CQ4A 1N8RT 1H6KX 1SJ3P 3NNCA 2HZCA 5DDOC 3CMAS 3THTA 2MZQA 2MQPA 2RS2A 5HL7Q 5DM6Q 1R8HA 2E5JA 2EK6A 4F25A 1Q7YT 5IM0B 3PIPQ 2DNMA 4C0OC 2K3KA 1VQ5S 3I55S 1VQ8S 2PEHA 2DGVA 2QA4S 3G71S 4WCEQ 2F3JA 1FJ7A 1P27B 2LXIA 2LECA 3BEGB 1NJIT 1WF0A 2X1GA 3THPA 3UCUP 4Z2XA 3CF5Q 1WEXA 4YB1P 1K73T 2XNQA 2D9OA 3OW2R 1U1KA 2KHCA 1L3KA 1X5PA 2XB2D 4CH0S 3VAIA 1NO8A 1DBDA 2FHOB 2M2BA 4OZ1A 3TO8A 4TU7A 1VQNS 5IFMA 1K8AT 4Y0FA 3NS6A 2LA6A 3CC2S 3VAHA 4ZKAA 2MZJA 2CPEA 3TYTA 3DXBA 4TU8A 2KYXA 1X4GA 1A9NB 2MKIA 1M5PC 2LEAA 2RQCA 4WF9Q 1JJHA 2CQBA 1VQ7S 1ZZNA 2MXYA 3NNAA 5IQQA 5LSLA 1VBXA 2KM8C 4PKDB 2MKCA 1U1PA 1G2EA 2CPHA 1HA1A 1YJ9S 5FJ4A 2LMIA 1M5VC 2MGZB 1WEZA 1U6FA 1JJ2R 3CCLS 1VQPS 3SDEB 2YTCA 3SDEA 3MI7X 1O0PA 2MSSA 1FXLA 2MZ1A 1Q81T 3P6YC 4WKRA 2WBRA 2HGMA 4IO9Q 1WF1A 1PGZA 2KXHA 2N3LA 1HL6A 1OWXA 2RUGA 1N52B 4YUDA 2DHAA 5HO4A 1VC5A 3LPYA 1PO6A 2QFJA 1U1OA 3G9CA 4A8XA 3S01A 2DNKA 3EGZA 2CPJA 1WWHA 1YIJS 4UY8T 1WG5A 2DGQA 3U1LA 2CQCA 2N3OA 4LIRA 2X1BA 2LYVA 2VOOA 4ERDA 3MUVP 1WTBA 1WELA 4RU2A 3UD3P 1X0FA 2MB0B 2MSTA 3SMZA 2NLWA 5ITHA 4CQ1A 1X4EA 2MZSA 2DNGA 5H1SV 1N88A 2MKHA 2DNRA 2MZRA 2G0CA 2DNOA 3Q2SC 3VAGA 1VQ4S 1X4CA 5IM0A 1WHYA 2AYBA 3K0JA 2HGNA 3CPWR 2X1FA 2DO0A 5GVQA 2CPDA 3CCJS 2LKZA 2KXFA 2J8AA 3JB9k 2DH8A 2VODA 2GHPA 3H2VE 2DGSA 3Q2TC 4UQTA 3UCZP 1HD1A 1SJRA 1VQOS 2Q79A 3MUMP 1X4FA 2DNHA 1VQKS 2OSRA 3BS9A 1FO1A 2HVZA 2JWNA 1S72S 2RS8A 2DITA 1X4BA 1S79A 5BJRA 3P3DA 1YJWS 4Y00A 1X5OA 2V94A 2AD9A 1SXLA 2L08A 3B4DA 2KT5A 1WG4A 2FY1A 1R8PA 3H2UB 1U1LA 1VC0A 4BS2A 1ZZFA 2HYIB 5D77A 4WFBQ 3D2WA 1NU4A 4WIIA 1DZ5A 2M8HA 1WHWA 2KG1A 1X4HA 4WFAQ 1UP1A 1KOOA 2E5GA 1KOHA 2XSFA 1X5TA 2VONA 2CPIA 3EGNA 1W2BR 2G1DA 2LQ5A 1UAWA 2OTLS 2MQQA 2VOPA 1WHXA 3RW6A 1YITS 5LSOA 1D8ZA 2ZJRQ 2OIHA 2E44A 3VAMA 1QVFR 3UE2A 2KI2A 2LXUA 2KRBA 2PE8A 1FT8A 1WF2A 4P6QA 1YHQS 4EGLA 2DISA 2DNNA 2RRAA 2HGLA 2KRRA 1YI2S 2YH1A 2RU3A 2MZTA 2YWKA 1DRZA 2GO9A 3VAJA 3U1MA 3R1LA 3V4MA 1RKJA 1U1NA 2ADBA 5CXTA 3I56S 2LA4A 4YOEA 1VBZA 4LJMA 2LEBA 2DGWA 2CPYA 2F9JA 5JVGQ 5LXRA 2CPZA 3UWTA 5EN1A 2I38A 2KM8B 3PIOQ 2JRSA 1M5OC 3ZZYA 5GAEU 2CQ2A 2QEXS 1CVJA 3BO2A 1OO0B 1UFWA 2AYGA 1FHTA 2E5IA 4ED5A 2AYMA 2D3OR 1KD1T 3FEXB 5MLCV 2M9KA 2DHSA 3FEYB 3G8SA 3CCVS 4F02A 2MQOA 3ULHA 3CC7S 3MOJB 1P1TA 1YWXA 2MKKA 2KH9A 2DB1A 2J0SD 4CH1A 5JVHQ 3RW7A 1WG1A 4F26A 1KC8T 2DGXA 2RRBA 3US5A 1DHMA 1Q86T 4QPTA 4U67Q 5GAHU 1WEYA 3R27A 2RT3A 2M8DB 5GADU 1QVGR 2L9WA 2DHGA 2DH7A 2LCWA 3S6EA 2KG0A 2BZ2A 4W90B 4PRFA 2MQNA 1Q82T 2XS5A 2EVZA 2EK1A 2M88A 3BO3A 4C7QA 5GAGU 1U1MA 2N7CA 3MXHP 2CQPA 2DH9A 1QM9A 3CD6S 1ZH5A 1FJEB 4IUFA 2YKAA 3MDFA 2DNYA 2CQGA 3CXCR 1VBYA 2FPHX 1VQMS 3DLLQ 1OPIA 4V19X 2FC9A 1U1QA 1H2VZ 2CPXA 5DM7Q 2ZJQQ 2CJKA 2U2FA 2CQDA 3CCES 2E5HA 2N82B 2MQMA 2DGUA 5GMKa 4PR6A 5LXYA 2KVIA 2KXNB 1AUDA 2DIVA 2CQHA 2XS7A 2DO4A 2M4MA 2ADCA 1HD0A 3N9UC 1VQLS 2CQ1A 1U2FA 1H2UX 2G4BA 1OIAA 1BY9A 1U6BA 3TP2A 3VALA 1SJ4P 2MPUA 5DETA 4QQBA 4FXWA 5LJ5Y 2SXLA 5CYJA 4CIOA 3CCQS 2BOPA 2AYEA 2DIUA 3P49B 3VF0B 1WHVA 2DNPA 3S8SA 2JVRA 2O3DA 2RNEA 3G4SS 4C4WA 1YTYA 3CULA 3J7YU 1RK8A 1UW4A 4QU7A 4FXVA 2CQ0A 3CTRA 2DK2A 2MKSA 1M1KT 2MYFA 3P5TL 3CUNA 2MGZA 1SJFA 1VC6A 1X4DA 5DDRC 1VQ9S 1KQSR 3B4MA 2OSQA 3VAKA 2MMYA 3S7RA 2MY7A 2ZJPQ 2UP1A 2I2YA 3MD3A 2DHXA 3BO4A 1SJQA 2NZ4A 2XNRA 3J7ZT 2MY8A 3G8TA 4IOAQ 2JX2A 3VAFA 2J0QD 3NNHA 3NMRA 4TLQA 5LJ3Y 1URNA 3SXLA 2D9PA 1JMTA 2DGTA 2FC8A 5DDQC 2L41A 2B0GA 2MJNA 3HI9A 1WI8A 2RQ4A 3HHNB 3ZZZA 1X4AA 1D9AA 1FJCA 3UCGA 3MUTP 1YJNS 2CQIA 4QU6A 5D78A 3LQVA 3IRWP 2DNLA 3UD4P 1H2TZ 2K8GA 3MD1A 4LMZA 2OTJS 1XN9A 2JVOA 2DNQA 1IQTA 2DNZA 2KN4A 1WI6A 2M7SA 2M70A 2RVJA 1K9MT 2M0GB 2X1AA 2F9DA 2XS2A 1FNXH 2ERRA 3CCSS 2DGOA 2KU7A 2MHNA 2CPFA 2J76E 3G6ES 2KFYA 1JJ4A 3CCRS 3MURP 4IOCQ
chains in the Genus database with same CATH superfamily
2NREA 3R3TA 2V4JA 4OHZA 5KG7A 2XTJP 4WFNQ 5KG2A 1S0OA 3HPOA 1RT3A 2XY6A 5KT4A 1HKAA 2YH0A 2VPZB 3AXMA 5FDLA 1UA0A 3HVTB 1RWNB 4HACB 3T41A 4DV5F 4PQUA 1NK7A 1IVZA 3KK2A 4BDPA 1DARA 2IMOA 3CGIA 3DI6A 5A8WA 3C8YA 3AD7C 4NI2A 4UF4A 3NS5A 2V2ZA 2WHOA 5JUMA 1F9FA 4OZ0A 2UUAJ 3MFHA 1HYSB 2KTQA 3MMCB 1TKXA 2R9LA 4DF4A 3GZ7A 3SZ2A 2IM0A 4RZRA 3N28A 2VG5B 5F3TA 2HBRB 4KE5A 4X66J 1FX2A 3L3CA 1F3VA 1C1BA 4EK2A 1BQNB 5L9XA 1RTHB 1TKTB 3FZ2A 3LGMA 1J5EJ 3CCMS 3KMQA 4FYVB 4Q44A 3FRZA 1M90T 1DTTA 1QTMA 4LQ3A 1NHVA 4MKBA 1OSCA 4Y2AA 2VD3A 4WU2A 4PWUA 3H5YA 3NXZA 4LVOP 4P74A 4GMKA 2HQFA 1D09B 1EKSA 2AIRB 2LU2A 4QZVB 5BR8F 4RW8B 4JI2F 4CWBA 4DR4F 5DDOC 3CMAS 3THTA 1PBUA 2MQPA 5HL7Q 1T05A 3MM5A 2BXJA 2AU0A 5KFVA 1HMVA 3OSPA 5F8GA 5HLFA 2J9CA 4LBPA 4RLEA 3AJ2A 1FFSB 2DNMA 3G8QA 4C0OC 2K3KA 4CLTA 5EX0A 1TL7A 3I55S 1VQ8S 1CULB 2OPQB 3T5KA 4LF1A 2BW2A 1WC1A 1FK9B 2RF2B 1H73A 3FDSA 3NWRA 1LFWA 3M2VB 1JLGA 2PA3A 3BEGB 4IDKB 4DV6F 1WF0A 1YKWA 2B5JA 3LALA 3OXGA 4ZPDA 3THPA 2ASJA 1VGYA 1ZOTA 4EZ6A 1IR2A 2KKHA 1C0TA 4KGVB 2Z0GA 1GX5A 4ZP9A 3T1YF 1S1WA 4JI0F 4NA3A 1V3RA 1WEXA 3EWGA 5C7PA 3CD0A 1GEHA 2Z2ZA 3BR8A 1NBEB 4HEA9 2C3YA 4F0MA 5EX3A 2Y1LB 1T8EA 3TUJC 5AXNA 1S0NA 2VQFF 2ASYA 4TYBA 3HZGA 4DPOA 3IFEA 3QJPA 4DV1J 2EW9A 2JHEA 2NUHA 2PO4A 4LF9F 1YZ6A 2P9GA 1Y4ZB 2XZTB 3R5CA 1YJ7A 4H4OA 2W7OA 4DV2F 1PBAA 1VBKA 1KLMB 2W2QP 3BH6B 1QSSA 1NO8A 2BKOA 5KFXA 1DBDA 2M2BA 3QGHA 2VDHA 2G2OA 4Q8FA 5D4NA 5IFMA 4O3NA 1IQZA 4ZMMA 4Y0FA 4OI6A 2Q1LA 2LA6A 1HQEA 1R0BG 1JLQB 2AHOB 3EVWA 1R6VA 1U09A 3GJRB 1LWFA 2V9KA 3ZTRA 5LMUJ 4OX9F 2A2CA 3EM1A 2GMHA 3VAHA 2CPEA 4AE5A 1DJ0A 2FZCB 4YHHJ 4TU8A 4RO0A 3K8VA 4KKOA 3PY8A 3NOGA 1TVRB 5EWGA 2AV5A 1RAAB 2MKIA 3PR5B 4J9RA 3T3FA 4LRBA 2WONB 2B4VA 3IG1A 4I2PB 2RQCA 1MWYA 4WF9Q 4PG4A 1JJHA 5DG7A 2FLLA 1QAJA 2V4QA 1M1HA 4RBTA 5AXKA 4DF8A 4WZMA 1NH8A 4IQMA 4USIA 2H5EA 5D4PA 3LUYA 4PKDB 2AGPA 4KGKA 3DGPA 4PYAA 2EG1A 2EFVA 1QY7A 4FPRA 2BQ3A 3GMGA 5KFWA 3BJYA 4DL6A 3UR0A 3MMBA 5KFJA 1YZ7A 2J5AA 4N77A 1RWUA 4F3MA 2HLTA 2VFVA 4K59A 5EDWA 5FJ4A 4OI4A 3C15B 3SCKE 3W9JA 1WACA 2MGZB 4ZPCA 1WEZA 4LUBA 2IPOB 5THWA 2HHUA 1GFWB 5ETSA 2YTCA 2J7WA 4UZBA 3DLGA 5DZ6A 1VC0A 1KNZA 4C8OA 4CRJA 1WJ9A 2ZITA 3UVJB 1U2RA 1HNIA 4JV5J 1Q81T 3P6YC 4IOBA 5D3GA 3IMQJ 4FPIA 3GIMA 5K8MA 2OEMA 2WBRA 1F9HA 1RTZA 1YJVA 2G1HA 4FXDA 4PUOA 2KZMA 3ENWA 2CG8A 4GVBA 1PGZA 5J1PA 4I67A 4GC6A 1OWXA 2GAHC 4OFZA 1N52B 1Z2LA 2OPRA 4RW9B 1N48A 1UZHA 2DHAA 1Q7LB 2CRLA 5HO4A 1HBNB 3M9MB 3M8SA 1MNEA 1S6OA 1NK6A 3LPYA 3NP5A 4DR5J 3H2LA 1WKKA 1TP7A 4RW8A 2JSXA 2IAJB 5KFEA 3S01A 4LRFA 4Q7AA 1D1UA 2BQUA 2BJDA 1S9GA 1O51A 1URRA 4CM0A 5A8WB 3M32B 3WIVA 1S0MA 3UDEA 1TL1A 1RT7A 5T7LA 3QRQA 2IVFB 3R7BB 4DFKA 3H25A 2ZC4A 1S6PB 2K1RB 4DEZA 4LSZB 2VOOA 3JXOA 4PWDB 3DRRB 1L3TA 1Q79A 1VCTA 3NCQA 4ED0A 4LF4F 1UJ5A 5E2QA 1EETA 4RPFA 3KLHA 1RA6A 2LDIA 2WOMB 3CT9A 2OD6A 2G2YA 3CC2S 4ECSA 4USJC 5ITHA 3CCTA 2YKNA 1P9QC 1TV6B 1X4EA 1RHRB 3ITHB 8AT1B 5ETKA 2POKA 1QLNA 3VZHA 4FNHA 1HBOA 2GMLA 1ZTTA 2MKHA 2QLXA 3RR7A 4KSEB 4RNOA 3BDPA 2CJBA 1GTHA 2BE9B 1SV5A 2GA7A 1I51B 2GVZA 1Q8IA 1SC6A 5J2QB 2HNYB 2DR5A 1JXLA 2XBPA 4RBUA 3OL7A 1WHYA 4DQQA 4FF4A 3K5PA 4MMOA 3K0JA 1HARA 3UDVA 5AJ3F 2F65A 4JP8A 3TVKA 1MN9A 1E6YA 3QRRA 1FI4A 2DO0A 2IRYA 2IYGA 1JIHA 3W7BA 4XIUA 3WIUA 2KXFA 3GE9A 3MEKA 3OFEA 3JB9k 1T7PA 5ETVA 2C1EB 4U7CA 1EQ0A 3TI0A 4J37A 3NGTA 1FKOB 3UCZP 1SJRA 3FSXA 4ZN1A 3IRXA 1MROA 3MUMP 3CDAA 5L1JA 4IDKA 4ZP6A 2V67A 4MH8A 4JI8J 1DQAA 3L7OA 2JWNA 3N5FA 3JTPA 4YB5A 1BWEA 1IKVA 3GCWP 1C0TB 2V69A 1S79A 4H4KA 4OZ3A 2Z2LA 4ZA1A 2D7SA 1NB7A 5BJRA 4K5SA 4YDDB 2ZE2A 4JV5F 4NLTA 1X5OA 3HULA 4F7VA 1WC0A 4C11A 4K4YA 2HBQB 2YKPA 4FS2A 3UW1A 1SVDA 2AJQA 4HLBA 2C3MA 2W2MP 2GAGC 4JYAJ 3B4DA 3D9BA 3LOUA 2GHVC 4F4WA 2FY1A 1R8PA 4OZNA 1U1LA 4A46A 3GV5B 6FD1A 3KUGA 2R7XA 2W24A 4M5LA 5CZXA 3W63A 5KFYA 3W9IA 4WFBQ 4RNHA 2VKRA 3HD1A 3N79A 3M8WA 3P5BP 2XZDB 2UZAA 5DQIA 1JLQA 4L3KA 2E9RX 2E5GA 1A0OB 1QUVA 3FEZA 2ZBCA 3MCMA 1BXNA 4KQZA 4NLDA 4P2MA 2BUNA 4WE1B 3EGNA 4NEYA 1HLWA 4NX9A 4Y28C 4ILRA 5KT2A 4X4QA 3HZEA 3QFHA 4HDGA 1BQNA 3MF5A 2HMIA 2OTLS 2QC3A 1N0VC 3K5NA 2MQQA 3J81U 1EETB 2XMKA 1WHXA 3BGUA 3MEGB 3O3LA 1K0VA 3OVSA 3DKDA 1YITS 2E44A 4PXDA 4QR0A 3RRKA 3W2VB 5IS2A 4YQWA 1KTVA 2KI2A 1LWEB 2PE8A 3NGRA 1FT8A 1JLBA 1HQUA 3PHEA 5HN0A 1WORA 4Z37A 2B9YA 3ILLA 3GU0A 4C2MA 2R2TA 2YH1A 1Y5IB 4X4RA 2WB4A 3HSGA 4ID5A 1WKLA 5G0RB 3UNYA 1TR0A 4URQU 4TNOA 3WC2A 2BACA 3V4MA 3RB0A 1RKJA 2HG4A 2UXBJ 3GSIA 2J6SA 3WC0A 1J2VA 1Y0HA 3HHEA 5DLGA 1MG7A 1VBZA 1NDKA 1G7CB 3JSBA 4MIWA 4H4MB 3MR7A 1H72C 3DOLA 5LXRA 1F5BA 3OL8A 1YBUA 3JAMY 1Q95G 2QJ3A 5IZHA 1RT1B 4EYIB 3T5HA 1RTDB 3QO9B 3UWTA 3W66A 2UUCF 1QD1A 2ZKUA 1N56A 3BR9A 3BQ1A 4IR1A 4TN2A 3FQKA 1T3NA 2H9ZA 5CAAA 3QIPB 1VFJA 1N32J 3OV7A 4ZPVR 1YK9A 4F04B 1LKZA 1SJ1A 5KG1A 3KLHB 2YQ1A 5U47A 3KJVB 4DV6J 3SI8A 1YX2A 3BO2A 2C22A 3OHBA 1KRPA 1CVJA 1TUVA 2IM3A 1AZSB 2AX1A 4F4XA 1AW0A 3TARA 3JSRA 2VC0A 1Q8LA 1U0HB 4K0KF 3BQ0A 4BBYA 2OAUA 1WNEA 2BE2B 3BPDA 2CADA 5HK4A 3SFUA 4EU0A 2D3OR 1U25A 5A2QU 3KLGA 4CM2A 2PI5A 4M5NA 3M32A 1VMBA 3EDRB 4QYZJ 5ETRA 3U27A 1W2IA 2DVIA 2E7XA 3AOCA 1N36J 2F8EX 2HFSA 2YVSA 2R8GA 1YWXA 3IBCB 3PRVA 4HTJA 3R5JB 2MKKA 4NLRA 4J7CA 5JVHQ 4JI1J 1E6YB 2WVCA 4D3HA 2B7CB 2HFUA 2W2NP 3IS9B 5J1NA 3W62A 5J2PA 2W01A 1WDTA 1DTQA 4WU3A 2R4FA 5KFBA 4B9NA 4NXMF 2ZUAA 4E2FB 4CO2A 2KYZA 4OQJA 4DQSA 1WUUA 4MIBA 3W2WA 2HSEB 2W4CA 4U67Q 4FYDA 3DCAA 3DRSB 1F60B 2AZ1A 2KO1A 4R5PA 3G82A 4DFPA 1BQMA 3HSDA 1IBKF 4K4XA 2ROEA 3GFHA 2L9WA 4L75A 2DH7A 1EKRA 2BW7A 1R6YA 2V4JB 3DGPB 3S6EA 4CNYA 9RUBA 4OV1A 1V5VA 1S12A 5LT5A 3VHQA 2QG9B 4C48A 2NQPA 2M88A 1FD8A 4QR1A 3BO3A 3ZZPA 2ZHBA 1FEEA 3CE8A 2ZH8A 1RAHB 2GIRA 2HBZB 1LNQA 2HQIA 4C7QA 5GAGU 4TVAB 4DL3A 4UOHA 1KFDA 3MR6A 1HNWF 5SUHA 3TEHB 4P73A 4GO5X 3DLGB 1QE1B 2O5DA 3HDSA 5IC4B 4LFAF 5H9FK 3NMAA 3ZTPA 5A76A 3CD6S 2NXCA 1ZH5A 2BM1A 2BKPA 1Z2ZA 1SIZA 1ZM4A 1REVA 3BGRB 3W3SA 1LW0A 2FJXA 3RBEA 2DNYA 2I5JA 1HW9A 2YQ3A 3BGLA 4EWTA 2RHSB 5DQGA 2HMIB 1VBYA 3LAMA 2J7UA 1RWKB 1YVFA 2HEKA 2HWTA 3FFIA 4ZVGA 4QWAA 4V19X 5IWAJ 5K14B 3MEGA 1EP4A 3M8QB 3KMSA 2ZBIA 1TMJA 1XBWA 3BKUA 2C3OA 2JLEA 4ZITA 1B0PA 2CPXA 4KAIA 3ADAC 5GAHI 4LSLB 3KHGA 4V1Ak 3ET6A 3K5MA 3MAHA 4E98A 3BM7A 4NLYA 3GWCA 2OI2A 2E1AA 2N82B 2A6MA 1RADB 2HQ3A 3NBPB 4OIXA 2DGUA 4EI2A 3H42A 5GMKa 1L3SA 5DG8A 2CJAA 1KBRA 4ID5B 4KHRA 1T05B 4DR5F 2NZCA 5CYMA 3CJTA 2R8IA 4RX6A 2J6UA 1PILA 2W8LA 2ADCA 3RB3A 2XS7A 5HAOA 5FD1A 5KOXA 4LRDA 2NSCA 5LMNF 1U2FA 3QGIA 1C2PA 3HCXA 1M1GA 1H2UX 2F8MA 3DLKA 1NZ8A 3C16A 1OIAA 1RAIB 3R9LA 2Q43A 2I1RA 1HPZB 4DSEA 2KJWA 2MPUA 4NZ7A 5D4LA 3W8PA 4K4VA 1EARA 3N01A 1SKRA 4FXWA 5HJXA 1RWOB 4ZVSB 3MAQA 3GYGA 5CYJA 2YBVA 4TQSA 4CIOA 4F4KA 2QZ8A 1S7IA 5BXIA 3OTOJ 3RYLA 1KEKA 2W7AA 2ZBQA 5E0OA 5A0YA 3T9NA 2RDIA 5C5JA 7FD1A 4ICLA 1B99A 2HPUA 3BSCA 3P49B 3VGSA 1KLNA 1TFYA 4HYKA 2K7JA 1Y3KA 4A8FA 1PCAA 1NHUA 2YWGA 2PSZA 2XG8A 2JEJA 4WTYA 2V4RA 4NMLA 1S99A 2XULA 1RK8A 2HNYA 4ZN3A 4DQIA 4QU7A 1S57A 2CQ0A 2QFIA 4CO3A 1HBUA 2DK2A 3W5XA 4IFVB 3OSNA 3GSDA 3FMWA 1ZAVA 4O3OA 3UQSA 3CUNA 5KFHA 2R7UA 4RW6A 1X9MA 1S1VB 3DLBA 5L8RC 1X4DA 4ZVQB 1RWMB 1SIWB 3B6BA 2H48B 1VQ9S 4JI7J 4KHPJ 5FIIA 5KFUA 5G4DA 2WSCC 2E5LJ 5AE2A 2MMYA 1W25A 3ENAA 2IC3A 3H4BA 2UVUA 2PMWA 1QAIA 2VG5A 1ZA1B 4CYUA 4EBDA 3ILIA 3CCWA 4CLWA 4K5RA 4LR7A 4NLQA 3V6KA 2XY5A 1SBRA 1GNKA 3G2XA 2NZ4A 4PPZA 2XYGB 1GMUA 4B3MF 2ZZMA 3D0IE 4LVNP 1SQGA 1NJXA 1U4BA 2BRKA 2HHSA 2IVMA 1JLAA 1LQ9A 2B8PA 3LP0B 3N6NA 2ZVIA 3QT8A 4NLWA 4L6V3 3SXLA 3ZO7A 4B3RF 5HQ8A 2UXDJ 1JMTA 1VQYA 4M63A 1X0PA 3DOMB 2B0GA 4UTGA 3RU0A 2H65B 1PYTA 2BYCA 4F36A 2HWHA 2OFHX 4RU9A 2QSFA 3HHNB 1D9AA 1RT2B 4ZPAA 1FEHA 3UCGA 2CQIA 2BANB 2YQ0A 3LQVA 3BN4A 5F8JA 2COLA 3H7HB 1BLUA 1OYDA 3TAQA 5KFSA 3MCNA 2C3UA 5LOQA 5HVFA 4NCBA 4F4YA 1TL3B 2ZH4A 3OL6A 1RBOB 2KN4A 5K9FA 4K4TA 2M7SA 1IR0A 1FK9A 2AX0A 2C2NA 2GQCA 3W5YA 4DPWA 1T9TA 2XS2A 1REVB 3U7JA 1X9WA 2DGOA 1TUGB 2J9EA 2KU7A 3GTYX 3I4PA 5B0EA 6AT1B 3IO1A 4PAAA 1P6TA 1EX8A 1N5TA 2YWFA 4XDCA 9ATCB 3G6ES 3TQ1A 2FVSA 2K06A 2Z8QA 1JLCB 3CO0P 1RWVB 4FYWB 4L72B 1UWAA 3EDQB 3K7RA 2APOA 2O01C 2LU1A 4PG8A 2KDOA 1HNZJ 4M5DB 5CA5A 4LF6F 1JXVA 4OL8A 2E9TA 2BJ9A 1RKIA 2VDIA 4I7FB 2PMZD 1RLDA 4RJVA 3EX7B 1B7FA 1UEUA 2AW0A 2IAJA 2Q66A 3SQOP 3SSQA 2PEBA 3GR0A 4LF7F 4MFBA 3KUEA 3OTDA 2KT3A 3DFEA 4PG7A 4U8YA 1CS4B 1NXIA 3MMCA 4P10A 4TXSA 5CCLA 3MR2A 5HBMB 4CO5A 2HFOA 5I3UB 4DR3F 3LAKA 2VBXA 2DY1A 1YSJA 3QO9A 1T9WA 4ELUA 3IXQA 1FRKA 4IFYB 1ACMB 1D3WA 4BCAA 2A3JA 4KKOB 1A7GE 3C46A 3CC4S 1RWXB 1PKUA 3R7NB 1VQ6S 1K47A 3HO1A 1QSYA 1VLOA 5K14A 4IRKA 3PRBA 4PYDA 4P2FA 3R1HA 1Y3JA 2C2ZB 4RWWA 4C6AA 1ICEB 2DR6A 3P45B 3MPVA 2CQ4A 3A8JA 4LSLA 2NR0A 4EO8A 1RT4B 2ZFHA 1JLFB 3DRPB 4ZCMA 1CBKA 3E3XA 1KTQA 1QUPA 3MXHP 1Z4UA 2D3UA 3W8GA 1MWZA 1M0SA 4KFBA 1RT5B 4OJGA 3EICA 1RHUB 3NAIA 3LPEA 1R8HA 3Q86A 2E5JA 4LREA 1Q7YT 5IM0B 1U8WA 4QW9A 3N0VA 1VQ5S 4CLPA 4HH0A 2PEHA 3I9V9 3O1LA 4IG0B 2LP4A 3EZUA 4IKAA 3T5JA 1T03A 3G71S 1LK7A 4B9SA 4KHMA 3CJ3A 1FJ7A 1HI1A 3Q8VA 3ZZOA 4DV5J 1K0TA 4DSFA 4RKUC 4A8SA 1RYRA 2DRAA 4J9PA 4GKJF 4DR7J 4DI6A 1JJCB 2G0JA 3G82B 4P9SA 3PG9A 1NPKA 2X1GA 1KHVA 5EWEA 2NXJA 2QIFA 1TKZB 5LSRA 4NE9C 4Z2XA 3LWLA 4B9LA 1JKHB 1RT6A 1U02A 1YBTA 2ZWPA 4YB1P 2XMMA 2CIMA 2KJVA 1LWCA 2GQ2A 5KG6A 1H0HB 5E3AA 5GAGI 3BSAA 3OW2R 2R3VA 2YXLA 3QMQA 2E5LF 1FRJA 1HBUB 2CXEA 3R1LA 1X5PA 1YBAA 2PD1A 3DDIA 3KNGA 3KXDA 3PHTA 1FXRA 4NPOA 2IDLA 5KFKA 5C25B 4X84A 2FHOB 1GMVA 4TU7A 2OFGX 2BOAA 2VB6A 3VTIA 1VQNS 4GKKF 2HNZA 5HQLA 4X2BA 3HKWA 2QSWA 3D67A 3MTJA 5ETLA 5K8PA 2BE7D 3M30B 2FVRA 1UVIA 3BKFA 4C3LA 1RAEB 1FVQA 4PEOA 4DR2J 4USMA 2KZZA 2CNKB 2MZJA 3QT6A 3TAPA 2D69A 2KYXA 4I6AA 2NXEA 1GK8A 3LO3A 4P7TA 1IBLJ 2XEXA 3M8QA 2IJNA 3R6GB 3ISZA 4Q5VA 3BPSP 4E0DA 1S1XA 5IOLA 3T6JA 4ZCKA 4ENOA 5IQQA 4QIFA 4I68A 3IM9A 4FZVA 1FE0A 5LSLA 1VBXA 2J0WA 5BYRA 3DOMA 2OLWA 3MZIA 1JNRB 1R27B 3M1VA 5D0HA 3PO4A 4FF1A 3TNVA 4FKXA 4J9VA 4DQRA 4A8OA 1U1PA 1YQHA 3KHHA 3IR5B 3GYNA 1G2EA 5ETPA 2UUBF 4O0IA 1HA1A 4B3SF 1SUQA 2F4VF 3LW5C 2RE1A 1YJ9S 1Q78A 3ELHA 1UPPA 1IXKA 4MKAA 3QATA 1KKHA 1M5VC 2CVEA 2WZ1A 1JJ2R 4DN0A 2YWHA 3HF5A 4RW4A 2FDNA 4MYTA 3CJKB 3TX0A 4QW8A 3SDEA 5J2NB 2ZBPA 5EGYA 4DUZJ 3TR5A 1TKXB 2HIQA 1BWVA 1N5SA 1O0PA 3KK1A 1M5HA 3M2UA 1FXLA 5KFRA 1I94F 3F44A 3GILA 3IRXB 4U9RA 1FRHA 1SL1A 1RHMB 2AGOA 3PO5A 1HIYA 2HQCA 2RQMA 3CJSA 3I5BA 3MMAA 4FN5A 2HGMA 4O0NA 4DPUA 3OTOF 2E1CA 2ILZA 1HWKA 1PJ5A 3H90A 3PTWA 4QYZK 2N3LA 3BGOP 1C0UA 3GFXA 2IBOA 3AOAA 2QL9B 3LWMA 3O6QA 4YUDA 4YS2A 3ETOA 1D8YA 5E33A 1KVKA 3IGNA 3L4BC 3NG8A 3D68A 4ZHRB 2YNHA 5D6GA 2YPZA 3CJRA 1B3TA 4IFVA 3POTB 4ECRA 3NGKA 3G9CA 3AHPA 4A8XA 4AL6A 4PQUB 2JLGA 4Y65A 1DAXA 4F2SA 3EGZA 5D4OA 4OZJA 3FBEA 2R2UA 2H3EB 5CHCB 3HSZA 5DZ7A 4DN9A 4O3QA 1X60A 2CQCA 4K2XA 3AQPA 5KFIA 2HK2A 3IBWA 2CNOB 2N3OA 3OJSA 4EBCA 3D66A 4YY3J 3QZ7A 3GB0A 1HI0P 2UXCJ 1HFEL 4ERDA 2OPQA 2ROGA 3TVZA 1WELA 2EI5A 2HS3A 3ZZ0A 4RU2A 1FKPB 3FGVA 4AD6A 1CC7A 2FGOA 4ZVUB 3NKYA 2MB0B 1LXNA 1G1XA 2VPXB 3SMZA 2NLWA 3B8HA 1RE1B 3LGNA 4ZPWR 1OY6A 1V9OA 4DV0F 2R7SA 2PIIA 1IKXB 1RGVA 2MZSA 2NCKL 3PJ9A 1T11A 3GP9A 3EMTA 4QJVA 4J9QA 3TA1A 1N88A 2DY9A 4HVZA 4TLQA 1MWQA 3V81B 4RNFA 4MKVA 3UD5A 2DNRA 1SV5B 5M2RA 3NGDA 3RB4A 1NM2A 2QLWA 4O4GB 5HI7A 3ZFVA 1RLCL 3JS9A 3G6VA 4AL7A 1VQ4S 2DKOB 1HNWJ 2P9EA 2BANA 2HRTA 3SBMA 5IM0A 3V5RA 2ZHOA 2QYCA 2ZUGA 2UV8A 4KH0B 3Q8PB 3H40A 2Y1RI 2HGNA 5LM7E 1O8BA 2W4PA 3BF4A 2UXCF 2AT1B 4YB6A 3CCJS 4F50A 4IG0A 2ASDA 2VODA 2DH8A 2KVQE 4KH1B 2GHPA 4K8RA 2DGSA 2OO4A 4UQTA 4AQYJ 1HD1A 4B9UA 1YRXA 2BA9A 1PJ6A 2GC8A 3KLIB 1X4FA 2DNHA 1VQKS 4LFBJ 3BS9A 3LGHA 1FO1A 1REGX 4NLSA 2V8PA 3HVWA 4JI4J 3KLVA 4R25A 1X4BA 1R0AB 2WONA 1NDLA 4KO0A 2V8VA 1XNQF 2XQCA 2V8HA 2K3IA 1RTIB 4LR9A 1FNOA 2V94A 4RL1A 1HNVA 4WP3A 2R8HA 4N5SA 5KT6A 1LWCB 2LQ8A 5F41A 3UPFA 3OR2A 5A8RA 4C8NA 4AXJA 1RXOB 4IO1A 4ZP7A 3J81Y 1ZZFA 4ER8A 2PI4A 3QGPA 4Y2MA 3SCIE 3OVBA 3D2WA 4LSNB 2M8HA 3T6BA 4ECZA 1X4HA 3HHLC 1UP1A 4ZVPB 1N0UA 1BUXA 2JZ5A 1X9SA 2R7TA 4WE1A 1DTQB 2DRDA 1JQGA 2VKZG 3IS9A 2VONA 3UR3C 1W2BR 1RISA 4J91A 1Q0NA 3DN9A 1U49A 4W4MA 4IH7A 3MAAA 2W9BB 2GW8A 1MSWD 1FERA 1JLGB 2PMHA 2IBKA 4C0BA 5HVHA 3TUPA 1WOPA 2OIHA 1QVFR 3AJDA 2FLOA 3F56A 4GVLA 4NYZA 3IP0A 2BM0A 1X31C 1VQSA 4KGMA 2NYHA 2ZH7A 2A1BA 5CABA 2HURA 2DISA 3FBCA 3G86A 4HHJA 4PCQA 4Z7YA 2HQDA 2KRRA 4PABA 4JV0A 1S59A 3CD7A 4DZ6A 1NK4A 5A6PA 1XR7A 2MZTA 4OYXA 1IM4A 4TKTA 3VAJA 2VQEJ 3C3LA 2HQGA 2WRMA 4H4KC 4OLOA 1FRIA 2XCPA 1NMEB 2GMJA 2ADBA 1U1NA 2V2VA 1MMDA 3I56S 4W92B 2A0FB 1OSDA 4F2RA 5AXMA 1CULA 4LJMA 2UUBJ 3P8BB 2F4VJ 1WTFA 3L7UA 2NXUA 5JVGQ 2A6OA 3N5BA 3W65A 1RTDA 3QJLA 2FVCA 2CPZA 4XTTA 2OGUA 1YJUA 1HWLA 3AOBA 1FFGB 2C28A 1R3NA 3HLUA 3O44A 1AT1B 4NOHA 4WWSA 2KM8B 3EVOA 2JRSA 3J7AN 3K58A 2H51B 3GJTB 5KG4A 2V0NA 4DLEA 5GAEU 2CQ2A 2QEXS 4J9UE 4Z7CA 4N41A 4GVBB 3MCSA 4Q0BB 3EPGA 2E9ZA 3W64A 4RWXA 2VC1A 4HH1A 1FX4A 4J9NA 1SKSA 4DL5A 2CZ9A 1TAUA 1FHTA 1PC5A 1YLXA 4FP9A 4ZHRA 3HVTA 4HACA 2AYMA 4DS4A 2VPYB 4Y3CA 2M9KA 3R6LB 2DHSA 2BJ1A 4G65A 4TY8A 5CQGA 5CYQA 2PN6A 3CCVS 1KVIA 1IBCB 3MMJA 2MQOA 1Y7PA 5HQMA 5AJ3J 3TANA 2C2KB 1QDUB 2PA8D 3KDOA 3M6VA 3QSIA 4DX8H 1NNDA 2RDDA 2KH9A 3C15A 1WC5A 3MM8A 4I4BA 3OVAA 5IT9Y 2AF6A 1LW2B 1APSA 1R8CA 2YWWA 3PEJA 2HNDB 1XNRF 4NCGA 2CAJA 3RG6A 4N76A 3OD2A 2RRBA 3OXLA 1TVRA 4OYZA 3US5A 1DHMA 2EBGA 1Q86T 4X65J 3I6PA 3KOAA 3I82A 4N8OA 4CLZA 1F3FA 4U8VA 1F0XA 2K7KA 2P5VA 3I9ZA 3PYDA 2YKNB 4ZIVA 4QWCA 3QNWB 2XMAA 3PR4A 1VLYA 2M8DB 3T1HF 2IRXA 1QVGR 1S1UB 2DHGA 4B3OA 1UFLA 2LCWA 2BZ2A 4EZ9A 1T95A 4W90B 2J7KA 3C66A 4DXLA 1DFDA 2LXFA 5DQHA 1JX4A 1OQ6A 2DXDA 4DSKA 2YX7A 2ZOMA 3EXYA 3MEEA 4IG3B 1Y5NB 3TZXA 4HI2A 2V50A 4M5KA 2VFRA 5HATA 4WYWA 2CDQA 5B08A 2N7CA 1VRUA 4P2XA 4XO0A 3KFWX 1GMWA 3CJ8A 2FYXA 3DRXA 3E8OA 3E01A 4LF2A 4OHWA 1QM9A 4MYUA 3P96A 4JI5J 4JI3F 2RU9A 4KRWA 1Q53A 4IUFA 1VK3A 2YNFB 1HHSA 3M2VA 5A6WA 3DU6A 3A8IA 2W1BA 3V6HA 3ETMA 3Q8UA 1HNXJ 4WK3A 4DV7J 1VK8A 3FFIB 3TUIC 1VQMS 2W4DA 4UZCA 5CD4A 4IRDA 1FJGF 1S1WB 4LFBF 5KFLA 4NZ6A 3VVTA 4YR3A 5KFCA 2CJKA 1EHWA 4CT8A 4AL5A 1WOSA 3JQMA 2U2FA 2FY8A 1TFWA 3POTA 2CJYB 3DNCA 3PYEA 3CCES 2IVYA 2VBZA 5DJBA 4CZCA 3OR2B 1N6QA 3RAQA 5J2QA 2ZZTA 4L74A 2BBEA 3IWNC 2XLJA 1Y5LB 2A18A 3RGIA 1BGXT 2HWIA 3PZPA 1LEOA 1SH3A 3E2EA 2CQ1A 2N4CA 2AGQA 1GT8A 1LWFB 1S48A 3Q8RB 2CNNB 2OMLA 1IKWB 3SCJE 3JQJA 5DETA 3RRGA 4QOTA 5LJ5Y 2QL5B 4CLLA 3MAAB 2SXLA 4DPYA 2B43A 3Q22A 3D6MB 3I4HX 1S6QA 2ZJPQ 4X4VA 5HP1A 4FKYA 1KS2A 5JXSA 5F0WA 2CWXA 1B64A 5DG9A 2I8EA 1ZAWA 1JWWA 1T9XA 4DR6F 1YJRA 1WHVA 3W2VA 2GQQA 3FMBA 3NGUA 4DU7A 1KP6A 2DNPA 5KT7A 2BJEA 3G4SS 4C4WA 3T1AA 2V34A 1T9VA 3HT0A 3TOQA 3J7YU 2GVZB 4C3KA 4DG1B 4LR8A 5D0GA 4DX5A 4B3TJ 1NPPA 5HMWA 5DGBA 4FXVA 2C2EA 4RNMA 2WAQD 2UVWA 1VHFA 2MYFA 1U48A 3IR7B 3NS6A 1VC6A 3FC9A 2GX8A 5KFMA 2VQEF 4M5GA 1XWLA 3I32A 1NLKL 1HWUA 3A8KA 3TJAA 1XMQF 2DR7A 1S76D 2Y1IA 4HR2A 1RB0A 2CYYA 2BEFA 2HVDA 2Q3PA 3MD3A 4IFYA 2E7VA 2BKNA 2V2KA 2UXDF 3ZZUA 4CNZA 4F0HA 4GKKJ 1F9EB 1HWJA 4PG5A 3J7ZT 2WSFC 4I64A 2B3TB 2JFDA 2ZD1B 3CWJA 3OR1B 2OPRB 5KTQA 3VAFA 4J9LA 4USVA 1U45A 4F3OA 3NNHA 3NMRA 3HFKA 1F2GA 3VZIA 2BDPA 1BMQB 4NA1A 2D9PA 1SH0A 4OV6A 2DGTA 3A8EA 5IV4A 1JLEB 1SC1B 4J90A 1XNQJ 3D54A 2EFNA 2RKIB 4E8UA 3DMJB 4KPCA 2J9DA 2XI2A 1UWBB 4ZLJA 1RT2A 1KSPA 3H4DA 5FLXY 1X4AA 2QLJB 3I0RA 1EQMA 2LQ9A 3RJMB 4DV2J 3UD4P 2K8GA 3M7VA 3X1LB 2YNGA 3KG0A 1M5SA 4X65F 3EPIA 1DQ8A 1ULRA 5KG0A 3R2DJ 4GKJJ 1N5YB 2OTJS 2JVOA 2DNQA 2EKNA 2DNZA 1VRUB 2R7OA 1OPZA 3KKFA 4JI3J 4LF5J 4ZJOA 1WI6A 3FCWA 2W7PA 4PWDA 2KFNA 4IRCA 4UOCA 5I42B 1UPMB 2L9NA 2F9DA 5F9LA 4O3SA 5F0UA 4ANDA 3PW0A 3CCSS 1VIXA 2I5JB 4UW2A 5EHHA 1SB6A 4OI0A 2A2DA 3MECA 2CPFA 2OD4A 2HHTA 2KFYA 4IYQA 4PWWA 4JUZA 2QO3A 3MURP 2W9AA 1MLAA 2ZKTA 2EEYA 4HT7A 1HBOB 1E6VA 2YKQA 5GMEA 4C3MA 3BN7A 1O5JA 7FDRA 3CMES 3FK4A 2CQ3A 1RT3B 2Y8WA 5CYMB 2DTJA 5J2MB 4G1IA 2IDEA 1MN7A 3TA2A 2G0IA 4RUCA 4WTOB 2C3PA 2U1AA 2Y8YA 3EXCX 3CJ0A 1XMBA 3M6UA 2Z30B 4YEAA 3TZYA 4ZPTR 2CJQA 1CJVB 2HLUA 5ETQA 4ZVTB 2FHMA 3H0PA 3I96A 4DV3J 1HYSA 5DDPC 2M52A 1KR4A 2Y0BB 3FSYA 3HSJA 5KT3A 1NSAA 2GS8A 2WW4A 5L1IA 2DR9A 4LF9J 4ZLLA 1JK9B 1N54B 3H8YA 4CTAA 4PXBA 1QAXA 4OJ1A 4UOFA 3AB4B 5KFZA 3ZZTA 4DU8A 4J5OA 1D9FA 5K5MA 1SC4B 2MKJA 2NPFA 4CO4A 3BKTA 1S97A 1TELA 3TAMB 2VJUA 3W2WB 4KV8A 1M5KC 4LFCJ 1LXJA 2NXNA 1KONA 1QTNB 2L3MA 1NRKA 2MTLA 4RW7A 4ZCLA 1ROFA 4YMEA 4R5PB 5T14A 2QA1A 1H6KX 4DCPB 1N8RT 1UVJA 2MLXA 3CJ2A 1TL5A 1NK8A 4WK1A 4U7UK 1RHKB 2Y0SD 2ZH2A 4B3TF 1U24A 3PW2A 2XMJA 3V81A 1FXDA 1UEKA 3PXGa 4ALZA 2GJFA 2MZQA 4O23A 1AROP 2XLIA 1N6QB 4B9TA 5DM6Q 1UKUA 2XO7A 1N33F 3IAM9 2DCLA 5L1KA 2EK6A 1YDLA 1A6LA 1DURA 3IC1A 4FYYB 2ZOGA 3OT9A 4FNIA 3QGGA 3M8RA 2XHCA 3M9OB 3KTQA 2BJ7A 2UU9J 3QWUA 1TL7B 4KB7A 5J1EA 2F3JA 2G13A 3KK3B 3TZWA 1P27B 2DXFA 2FZKB 2LXIA 4ITSA 2LECA 3NEKA 4HHHA 1NPRA 3N6MA 2DJWA 4DMZA 2OPSA 3PX6A 5IWAF 1R0CB 4KR0B 5HP1B 4HL9A 2XO6A 3FBFA 3PFOA 4LFCF 1HBMA 3L7PA 4CLYA 4KO0B 2FJWA 1S1UA 3A3OB 4IH6A 3CF5Q 4LBIA 3OFFA 1K73T 3D3CJ 4UY85 3CIZA 5FDLB 2XY7A 5D8HB 1SQFA 4QBUA 2HAFA 3ET6B 3MEEB 4IG3A 3T1YJ 1UEVA 3KK2B 2RQKA 4DV4J 4Q43A 1KLMA 2NPIA 2ZNYA 3PX4A 2XB2D 2GJIA 4H4OB 4CH0S 3VAIA 1OYEA 4H4MA 2OMOA 1NKBA 2XCAA 3DOLB 1QE1A 4P2SA 1IN0A 4QIWD 1FWLA 4P52A 1P9YA 2DT9A 2F63A 4OX6A 4YB7A 4CT9A 4A8YA 2R7QA 1NK0A 4XAKA 1K8AT 2K2PA 3WX4A 1FESA 3BGRA 4ZLNA 2E1RA 1LWXA 2X7IA 3N4WA 4ZKAA 1BD6A 5IQ6A 4CLSA 4JV2A 2D3O1 3HVAA 3NAHA 1X4GA 2RMLA 1AXQA 2XMWA 5KFFA 3EZ5A 1RWWB 3I0SA 2MEWA 3J7YI 1YRUA 4MKYA 4U7UD 3SEOA 3OUYB 1UFKA 1S1XB 2GZOA 3SYZA 1VQ7S 2CQBA 4Y2CA 1ZZNA 1UJ4A 3V6JA 4OX9J 2IY5B 2MXYA 2OKQA 2QLBB 2YX4A 2ZH6A 2KM8C 4K50A 2Y3YA 1EJ7L 3I87A 4NASA 3BV8A 1NJZA 1V3ZA 1FRLA 3CJ5A 2MKCA 1K1QA 1YRTA 3RZAA 4LF5F 2DD8S 3ILOA 4FBTA 3NRBA 1ZPWX 2CPHA 5HLFB 4Q2MA 5AE3A 3ISNC 2NS1B 4P7VA 3PVXA 5E5NA 3D4JA 2ZH5A 2LMIA 4S0MA 3CJKA 1G3OA 1NKEA 3ZXWA 1VQPS 1N5YA 2H5IB 4CI0B 4JI8F 1L3UA 2VA2A 2BJ3A 4JI1F 3BGFA 3A12A 2YWEA 2Z58B 3MI7X 5HBMA 4YY3F 3OJUA 2P9CA 1FF2A 4OYIA 2MZ1A 2PT0A 1CQNA 3KK3A 4BLGA 3GG0A 4OYPA 5D3GB 3BB5A 5C42A 2DR8A 4M5JA 4I2QB 4WKRA 4B3MJ 1QJHA 4WP9A 2DEJA 3IR6B 3ONQA 4IO9Q 3TAMA 4ICLB 1SL0A 1IBLF 1WDDA 1WF1A 2FLNA 2KXHA 5DLFA 3MWBA 2JJ4D 2HHPA 1WKJA 3PM9A 5KT5A 2HBYB 1I3OB 1S0VA 1HBNA 2QRRA 1VJWA 2YNHB 3CB4A 2HFVA 2RHQB 1LOUA 5J2MA 1PO6A 1KN6A 1OS5A 3RTVA 5ETNA 1RDRA 1U1OA 2QLFB 2XMVA 3KDNA 5IC6B 1NCLA 4DL0C 2DNKA 4I0WA 2CPJA 1AA1B 1HHTP 3TA0A 3H5UA 1WWHA 2XMTA 1UVLA 4UY8T 3IN5A 2UXBF 3U1LA 4AYBD 1Q16B 2HS4A 2ACYA 2FD2A 4WP8A 4FBUA 4LIRA 4F67A 1TL3A 4DUZF 3GLJA 3MUVP 4R0JA 1XMQJ 2VICA 3LANA 2FZGB 2GNKA 2DCUB 1Y11A 4WXOA 5LL6d 3CDBA 4X4TA 1X0FA 1WSRA 2MSTA 5A2QY 5HSPA 4O3PA 2IA6A 5EUHA 1S5ZA 4ED2A 2XGPA 1U0SA 2FGCA 5E7OB 3GV7B 3BSNA 3ZZRA 3PW5A 5H1SV 4A47A 3QZ8A 2VQFJ 1RCOB 4IQXA 4CCHA 1JLFA 3DRPA 4CLKA 1UA1A 4L3NA 4K0KJ 4O4GA 2G0CA 5H9EJ 2HYIB 4F8RA 2DNOA 3D3BJ 3Q2SC 3VAGA 2E1PA 1U7LA 2XSJA 4LRCA 3GIJA 2V68A 2BABA 3QYYA 4LF7J 4OX7A 1IWAA 3M8PA 4BWMA 1Y9OA 4TY9A 2O1PA 1RTJA 4Q2LA 3CPWR 2ZH1A 2X1FA 4OHYA 4MFBB 3JQKA 3JAMU 5GVQA 2AQ4A 2LKZA 3U02A 2J8AA 2VBYA 2UV8G 4O4RA 5B0GA 5I3PA 3H2VE 5I3UA 3Q2TC 3AFGA 4ECWA 1VQOS 3FRYA 1ZAXA 4URSA 2UU9F 4KGZB 3QQCD 5DO2A 4B3RJ 3AQOA 1J5EF 2DBBA 2HKEA 3Q89A 3QBCA 3BSOA 2YKMB 3FNNA 4CO0A 1S72S 2RS8A 4W98A 5E3CA 3LF0A 4RW9A 4TLRA 5L39A 2F1FA 3DHXA 1YJWS 4EYHB 4FF2A 2KT2A 4RUHA 1KHWA 2H1YA 2IYIA 1C1CB 1SXLA 2IMWP 4Y34A 1V5IB 1FDDA 2L08A 2LEPA 2AJFE 2Q6BA 3D0HE 3R97A 3Q24A 4KYZA 5M2UA 5IV3A 5L46A 3J80Y 1VS3A 5KFQA 4B02A 3DOKA 5ETTA 4GC7A 4ETXA 2PGCA 4BS2A 2ALYB 4FVMA 2WVEA 2X3GA 3FBBA 4QIGA 1YGYA 4LSNA 5IXUA 5KFGA 1NU4A 4WIIA 3CEDA 3BREA 1DZ5A 1WHWA 3PYGA 4YR2A 1LK5A 2KG1A 4OJHA 4WFAQ 1H7WA 2YNIA 4ANEA 2ZBRA 2HNZB 1KOOA 5KFTA 2MLZA 2VJVA 1KOHA 2XZWA 2XSFA 4I6YA 4YP3A 1UVMA 4NMXA 2CPIA 2IM1A 4ILLA 2G1DA 1PAUB 2QX0A 3CSKA 4OYAA 3HM9A 3PW7A 3CDEA 3MR3A 1S77D 5F8HA 2RH3A 2RB7A 1WC4A 2VL1A 4LRAA 1FA0A 4I56A 4K4WA 2E7WA 4JI6J 5BYSA 5LSOA 1D8ZA 2ZJRQ 3VAMA 1SQEA 1ZTWA 5HMYA 4NLXA 3MHYA 2FHJD 2KRBA 1XMOF 1WF2A 1NAQA 1YHQS 4EGLA 1XEZA 2DNNA 5DS7A 1SKUB 1CC8A 2WSEC 1YI2S 2VZ9A 1CG2A 4K4SA 4B9MA 2YWKA 3OTEA 2HVHA 2ZEJA 3FJ2A 2GO9A 1DRZA 3S1TA 3U1MA 4DR6J 3QJJA 1RAOA 3C14B 5CXTA 1Q1KA 5ETOA 2LA4A 4YOEA 4NI2B 2L9DA 2ZWOA 3CJQA 3M2RB 3DLJA 1IBMJ 2LEBA 2DGWA 3PW4A 2CPYA 4M5IA 4DUYF 1CJTA 2VG6A 3Q8YA 2IIHA 4AUKA 2P2CB 5B0BA 2HRYA 3HHLD 3WX8A 4ED3A 4NXNF 3HFVA 5JMNA 1WC3A 4KBIA 3TW0A 5B09A 3MCOA 3PIOQ 1UL3A 3QLHA 2BR0A 1HBMB 4U6PA 3C2PA 4Q0BA 1V6HA 2Z56B 1UFWA 2ZM6F 2AYGA 4ECYA 4ZCIA 4CH7A 5JJBA 3K59A 4LF6J 3ICLA 2JC1A 2D41A 1I5OB 5E3QA 1KD1T 2OP5A 2RD5C 1AFJA 3IA0A 2RAQA 1BC6A 8RUCA 4DCOB 3G8SA 3F73A 3ZTOA 3L9ZA 2V63A 3CC7S 1KDNA 5AE1A 3DM2A 4ED7A 1P1TA 1GQEA 4LF8F 4ECTA 4DOZA 3D6HB 4A8KA 2DB1A 1R43A 2NUUG 3DHWC 2HHHF 1QAYA 3DLHA 4EUVA 1GMWD 3RW7A 1S6UA 4F26A 4HTIA 1B7YB 3GV8B 2DXEA 3DLKB 3G6XA 3UN3A 5A8KA 1RJJA 2AJ1A 3O8WA 3UVJA 1RTHA 1TKTA 1FKPA 3JSMA 1CJKB 4USTA 1VISA 1ZM3A 3CO9A 3MEDA 2ZDOA 5GAHU 1WEYA 1HNXF 3BBFA 1S6QB 3R27A 4NWBA 2IJRA 1UJ6A 5IT9U 4J9MA 3DGVA 2BMBA 3MPYA 4G1QB 1KQKA 5GADU 3GPAA 2LFVA 4OI2A 3PKYA 3RAXA 1W26A 1KQGB 2KG0A 2JEIA 1HNVB 2Z57B 3C6UB 1Q8BA 1X8DA 5G0RA 4J9OA 1Q82T 2EVZA 2EK1A 4OI1A 3R5GA 5KAKA 5L1LA 2GIFA 3M8PB 4ANCA 2P8IA 1RTJB 3RBDA 1Q8KA 1RP5A 4DLGA 1U1MA 5LMUF 2EG2A 3CMQA 3PX0A 1T03B 1FWKA 2DH9A 2Z2YB 3A3PB 3OFGA 1ZETA 1L3VA 4FF3A 4MK7A 3F0NA 5E3RA 1FDNA 1XNRJ 2RRNA 1RACB 5HROB 1FJEB 4DV3F 2JNJA 2YKAA 3MDFA 2V9WA 3DRRA 2CQGA 3MTKA 3PDNA 4DSLA 3MOZA 2IHR1 2M3DA 4JI7F 2HAIA 1IWGA 2FPHX 2QA2A 4ECXA 1NDPA 3GFYA 1TKZA 1VIOA 4EEYA 4M5MA 4ZDNA 2HS0A 2MLYA 1S49A 3AJ1A 5D0RA 1H2VZ 5DM7Q 1JLAB 2FTRA 3A13A 2AEJA 3NL0A 5BYQA 2CQDA 3DOKB 1C4AA 2E5HA 4O3RA 2MQMA 3PV8A 1P8GA 2H54B 3KNAA 1UWBA 2B7BB 4PR6A 5C2CA 3QRPA 1Z1ZA 2KVIA 5F8IA 1RAJA 4EMDA 2YNGB 2DIVA 2CQHA 3JTOA 3PNIA 3OHAA 1RABB 4KC5A 3I31A 3V6DB 3A4TA 1ITPA 2V5HG 2IRUA 4P71A 2B51A 1NEEA 1HQEB 1T02A 3JYTB 5HANA 3HXMA 2FUG9 2ASLA 2G4BA 1ZYQA 1H3DA 4DL7A 1U6BA 3TP2A 3ZNJ1 2OELA 3VALA 4JI5F 5J1EB 4LT6A 2AJ4A 2B4OA 3CCQS 4DSJA 4V19J 2HHQA 3FCVA 1CJKA 3MECB 2B5JB 3PFEA 2BJ8A 3OPKA 2BOPA 2OPSB 4DV7F 3GFZA 2AYEA 2DIUA 1B0VA 3B82A 4LQ9A 5GAEI 4DL4A 2ACMA 3VF0B 3LP1B 3S8SA 2JVRA 2O3DA 1EB0A 2RNEA 2VG7B 3WZ0A 1YTYA 1L5UA 2VPWB 4JYAF 4KJIA 2JLFA 4RR5A 4DQPA 3GJQB 2E1MC 1NUEA 3CTRA 4WIQA 3JSYA 4WFYA 2F7VA 1JB0C 1HR0F 2MGZA 2JFKA 1FTRA 3SSSA 1SJFA 4B3SJ 4B9VA 4B17A 4NL5A 4WFXA 5B0DA 2JH3A 2G9OA 1KQSR 1VDHA 3B4MA 4CDIA 1UCNA 2OSQA 2KHDA 1RAFB 2EXUA 2HFZA 3AXKA 4ED8A 3S7RA 3G6YA 2VG6B 2UP1A 4YFUA 4ZP8A 2HK3A 3DLEA 3W61A 4CTAB 2I2YA 4CYUB 3SFGA 3D0GE 2ZH3A 4HKQA 5H9EK 2YKMA 3BO4A 5C24B 3FSIA 4LIWA 7AT1B 2XNRA 1GAOA 2MY8A 3NS7B 4IOAQ 4TQRA 4ZLPA 4KV8B 3I0SB 2WOMA 3SQGA 3OUYA 2B4PA 3E51A 1N33J 4MT1A 4WPAA 1FCAA 4L76A 5LJ3Y 2V2QA 4ECUA 3T1HJ 1S10A 1URNA 4U96A 1TL4A 2FJVA 3SV4A 2VFSA 2FC8A 2L41A 3R2CJ 3KYLA 3CDUA 3HI9A 3NBPA 4XPEA 2YY3A 3W60A 4QYRA 4TY8B 3ZZZA 1HR0J 2AEMA 1NJYA 1VRTA 4DV1F 1FJCA 3MUTP 1RT7B 4QU6A 3AY0A 5D78A 3ZNUA 4A8QA 4C97A 2XHWA 1P1LA 2R2SA 1SL2A 1KFSA 2KL8A 1XN9A 4K7QA 4ED4A 2J9DE 1IQTA 2RDJA 2GO8A 4RUAA 4AT1B 1K9MT 2RVJA 2HNDA 2M0GB 5A8KB 1FTCA 2HHHJ 2R7VA 4M1KA 2ERRA 5AXLA 4C8ZA 1FJGJ 3RR8A 2IFXA 2H5JB 3MEDB 3NLCA 3QT5A 5A0YB 4PUOB 1OJ4A 2W2PP 1JJ4A 3KUHA 1R31A 3J7Z5 1ZA2B 2QTWA 4A48A 3GIRA 3KJVA 3R7SB 2BRLA 3W1YC 1RI7A 2GVDB 1SPBP 3AH6A 3LP1A 4A4JA 4DBQA 5BR8J 2ZZNA 1CEZA 2VG7A 4M5DA 1XR5A 4DZDA 1HQ2A 4NYOA 2H4YB 1ELOA 2C2RA 4TU9A 1H7XA 2YKOA 3TVYA 3UN2A 1HHQA 2QV6A 5IT4A 1CS4A 1FDBA 1FDAA 1TMMA 2B9WA 2W2OP 4N7TA 3AD8C 2WBMA 3NOCA 3GCXP 4ATNA 1VHIA 1PG5B 3CNQP 4NEZA 2OJ3A 1T3OA 2F40A 4TYAA 1TTHB 1GTEA 3MR5A 3JYTA 2R8KA 1H74A 3PCOB 4NYPA 1TZ0A 3U1NA 1H38A 2F4FA 2O66A 5HROA 2HW3A 4X4PA 4DR1F 2UUAF 1FE4A 1X5SA 1SC3B 3HHLB 2VV5A 2OHDA 5GMDA 1EAYC 5FLXU 3G96A 3CCUS 4ZVRB 2MQLA 2W9CB 2QMXA 4P72A 1U1RA 1JXEA 3I5AA 2R2RA 3DC2A 4WBFA 1TUWA 2MJUA 4C11B 2CNLB 3NGSA 3KJNB 4WJBA 3CDWA 2NSBA 3K5LA 4X62J 1SJ3P 3NNCA 4M94A 2HZCA 2RJZA 3KG1A 4DWIA 1EZZB 1MW7A 4ZVHA 1S1TA 3M1VB 3VR1A 3NCPA 5KFNA 2ABYA 3M6WA 4ZJQA 2NYIA 3AODA 4MJKA 4ZVOB 1OQ3A 1OMSA 4DG1A 2RS2A 4QCLA 4XDDA 2XYPB 4M8LA 4F25A 2XC9A 4DV4F 1Q5YA 1TAQA 2F8HA 2QN6B 2MDAA 3DXSX 4HI1A 3PIPQ 4ZPBA 1HWIA 2ILYA 3MM8B 4X4SA 4N56A 1VR6A 3D1OA 2YX1A 3FQLA 5L9NA 1XIQA 2DGVA 2QA4S 2EFPA 2VHGA 1BQXA 4WCEQ 4MK9A 1IKWA 4AFFA 5KFPA 2HHWA 1TKDA 3IM8A 4DSIA 2CJXB 5SZTA 1RQ0A 5C42B 3GQCA 1CPZA 3FUYA 2RF2A 1LW0B 1S9EA 1NJIT 5C24A 1U8SA 2VASA 3DYAA 3MM6A 3RUBL 2QA4G 4F4ZA 3UCUP 2ZE2B 3HHKA 3OTBA 3KG4A 4OYWA 3SQGB 2JEFA 1IUJA 1GXUA 2FJAB 3NCRA 4N8NA 3BBCA 4DJBA 2XNQA 2D9OA 2ZHAA 1XMOJ 4OZLA 1U1KA 2OEJA 2KHCA 2KB2A 3ENVA 4UUWA 4CP5A 2JL9A 1N36F 1L3KA 2RKIA 3AT1B 3DRYA 1WC6A 2L48A 3WQPA 2AZ3A 3C19A 4C8YA 2BX6A 4RBVA 4XPCA 4OZ1A 2C2DA 3TO8A 3N6LA 3CW2C 1WOOA 2HIYA 1Y10A 4Y2IA 5D15A 2RSQA 3OXFA 4USKA 4BC9A 3ZC4A 4OZ5A 1MROB 5DRKA 3PJWA 1CLFA 1T0TV 2CDRB 5L38A 3TYTA 3DXBA 2WTFA 2DPIA 1A9NB 1M5PC 1LV5A 3A1YG 2LEAA 3CCZA 3IWXA 4FYXB 4DX7A 1N32F 3LA0A 2W25A 3CIMA 3MM9B 3EE3A 3MM7B 3QT7A 4ES2A 3GJSB 4X66F 4QWEA 3DU5A 1U0HA 3VCDA 3NNAA 3RBZA 2CWKA 3KLEA 1W7WA 2EFGA 2DHHA 1XC9A 3DDKA 2XGQA 4ES3A 2EFQA 1FNMA 4JBCA 2JC0A 2CKWA 4DCJB 3KLGB 3H20A 3A3NB 4KHPF 2G2ZA 2WK4A 3BH7B 4ES1A 3V4IB 1H98A 5HJYA 1SUQB 4KGXB 1EIYB 2HRUA 1RCXB 1FWPA 1B4SA 3CVKA 3KHRA 4DPXA 2B56A 3EVMA 4YR0A 4F4AA 4EFAC 1RHQB 4NLOA 1U6FA 2VFTA 3CCLS 2JEGA 2AJ0A 1SCJB 3Q8SB 3SDEB 5J2NA 2FVPA 3AAWB 4RW4B 1U47A 2FB0A 4XK8C 2AJ2A 5K8NA 3Q8QB 4ECVA 1VRQC 3GR1A 4ELVA 2IC3B 2MSSA 2FHKA 4NLPA 4G1PA 3TZZA 3FZBA 3Q0AA 3QWPA 4L73A 4K4ZA 4OI3A 1T94A 2XM3A 4C8MA 1WSVA 4DR7F 2RILA 4NLVA 1HL6A 1LFPA 1PC4A 1EP4B 1UTAA 1OY9A 2RUGA 5B0CA 1CJUB 2ZOFA 1I94J 1UVNA 4B3OB 1NKCA 5K8OA 1K1SA 1N5QA 3H59A 1SI9A 3BZQA 3T19A 1VC5A 2OPPA 3HK2A 2JOQA 4ELTA 2C2MB 2AP6A 4UT4A 2IA0A 4QR2A 5H9FJ 2CG4A 4RNNA 1S1TB 2FVQA 3DI6B 4MK8A 5KG5A 2E29A 2QFJA 4UOGA 5KFAA 3D6TB 1KWMA 3QAUA 4LBHA 5C25A 2WVBA 1S9GB 3M8ZA 4K4UA 1YIJS 1R89A 3AA8A 1WG5A 2DGQA 2Z4PA 3DM2B 3PYFA 1GXLA 3E01B 2WVDA 3EUNA 3QAEA 8ATCB 5F8NA 4DDFA 2I9SA 3M30A 4R8UA 1TK0A 3OLAA 2WB1D 3KHLA 3J81j 3EZOA 4X64J 2X1BA 2LYVA 4OZ2A 2PFFB 3SCLE 3K57A 3O2IA 1WTBA 3HFZB 1XJWB 3F41A 3ZTSA 1C1BB 3ZTQA 2FJEB 2BQRA 3UD3P 1VI7A 3IAS9 3JSMB 2ZD1A 3OR1A 1HW8A 2EKYA 5IT0A 3ENQA 2XMUA 4PZVA 4CO1A 1IKXA 4DR1J 4HDHA 4X4UA 3L09A 3H98A 2O67A 4CQ1A 5ETMA 5GADI 3OLBA 4AXIA 1ZBTA 3KLFB 2DNGA 3BYRA 4A8WA 2BE2A 1WD6A 2ROPA 3GG1A 4NLUA 2ZNZA 1G4CA 4U95A 5MAOA 2GGPA 3H5XA 2UUTA 1RU2A 2MZRA 3B54A 4PQAA 2B6AA 4KPYA 3KJQB 1MU2B 1X4CA 1X7VA 3QFWA 1HMVB 1J5OA 3UNGC 3MGJA 1S9FA 3KWMA 3HX9A 4O44B 4ZVFA 1IJEB 2EC2A 2V8DA 2AYBA 1GH8A 3FKBA 1RSCA 3PACA 3C14A 4CLFA 2HVIA 3BBBA 4K2JA 4N47A 4DFJA 3THVA 2B9EA 2CPDA 5KFDA 1IKYA 1F5AA 2W9BA 4ECQA 3BDEA 5AT1B 4KTQA 3LP2A 1CJTB 3WHIA 2I6WA 3UN5A 4WXWA 5LMNJ 3WBZA 2Q79A 2Z2MA 2ZM6J 3VV2B 2OSRA 3BYPA 2HZAA 4Q45A 3EGVA 3UDLA 1FKAF 2HVZA 3IBFB 2A10A 2IJFA 4OX8A 2DITA 5B0FA 1C0UB 1T9UA 1XERA 2LVWA 1RHJB 2HVEA 3P3DA 2VH7A 3PEHA 1RTIA 4JB8B 1G6BA 4Y00A 4PPDA 4NA2A 4P75A 1ZM2A 4C0HA 4NXNJ 1UETA 2XWYA 4RW7B 2VFUA 1BE4A 2GV1A 3LP0A 2GJ2A 2AD9A 1PIEA 2XYHB 3O5TB 4URGA 2KT5A 1WG4A 4C9DA 4KY3A 2P6SA 3H2UB 3QPIA 5HVGA 3M6XA 4NRTA 2VUGA 3P4UB 3PRDA 4KFBB 1I1GA 3OBIA 3TWZA 2OUGA 5F8LA 1TL1B 5T7LB 5D77A 4BHQA 1XR6A 3HT3A 4G6VB 2VA3A 2GCFA 3NWGA 2ZDPA 2D74B 4ILMA 3IWLA 3CD5A 2Y9HA 3QIDA 4OJ3A 3VGUA 2ALZA 4C98A 3SSRA 2M5YA 2KFZA 4CLUA 5K20B 1S6PA 1X5TA 1HI8A 2K1RA 1UVKA 4LFAJ 1NB2A 5M2PA 2AEFA 2AWZA 1N34J 3HHLA 2LQ5A 1UAWA 1T9YA 1RU1A 3VWSA 1NH7A 2VOPA 1DLOB 3RW6A 1UW9A 2B8QA 4ZVEA 4OHXA 2QT7A 3J80U 1TK5A 1TV6A 3W9HA 3MM7A 3OQ2A 4G1QA 3UE2A 2AMCB 2LXUA 3R5BA 2PFDA 4P6QA 2RRAA 1JKHA 1RT6B 4OLPA 4EBEA 1D9DA 2HGLA 4QIVA 3C6UA 2GGPB 3RAMA 1V3SA 2RU3A 4I7FA 4I1TA 3I0RB 4ED1A 1GX6A 2EFOA 3D1QA 1AUSL 3TJ8A 3UO0A 1O6XA 5EWFA 3V4IA 1U6ZA 3Q83A 3GONA 1ZM9A 1S4FA 3RRHA 1IM6A 2RIJA 1U2CA 3MPDA 3K8WA 4LF8J 5CZVA 2CA9A 3D28A 4DR2F 3FVYA 1YJTA 3VGVA 4DR3J 2HZVA 1XQIA 3W5ZA 1CSJA 2F9JA 4EO6A 2CJ9A 2HFNA 1S4EA 2XWXA 3AD9C 3CJ4A 4KIAA 4IH5A 4DUTA 3TUZC 3HVRA 1PYOB 5EN1A 1J27A 5KFOA 4G3IA 1S9EB 1AYEA 2FQQB 2I38A 2RUSA 3M05A 3R8YA 3X3UA 4GRSA 3QLHB 2CVIA 3I5CA 1M5OC 1KQFB 4A8MP 4WKYA 4FVCA 3ZZYA 2B9XA 4FDFA 4OYBA 1NJWA 3EYZA 1CJUA 2QE5A 1OO0B 5CD4H 4JI2J 4YN3B 1RUSA 1ZPVA 1TK8A 4DR4J 4F0KA 1AZSA 4DFMA 2PDAA 2N7YA 5DGAA 1RT4A 2E5IA 2N4DA 3NY0A 4ED5A 1TU0B 3EGWB 2OPPB 1PYSB 3FEXB 5MLCV 1NK5A 3FEYB 4USWA 3PJXA 1PJ7A 5CYQB 4Q8EA 3GIIA 4IR9A 4F02A 3Q23A 1RT5A 4RW6B 3ULHA 1F2HA 4B08A 5B7WA 2XSJB 3MOJB 4DHVA 3V6DA 1IBMF 1R8AA 2AKWB 1SKWA 3JTNA 4USUA 3UFCX 2J0SD 4X4NA 2GIQA 1CQMA 2X3DA 4CH1A 1B70B 3SIPB 1WG1A 4R8UB 3VQTA 1LW2A 4DUYJ 1KC8T 5KG3A 3C6TB 5J2PB 4NLGA 2DGXA 3KJFB 1NK9A 3KK1B 4NCAA 2YPYA 1RWPB 4JOUA 4QPTA 2LQBA 2EBEA 2WCXA 4R0EA 1RAGB 3MMAB 2RT3A 3ITHA 2ATLA 6FDRA 1N34F 3K5OA 4QWDA 2HHXA 1BHNA 3GYXB 1BQMB 2QMUB 3UI3A 3KLFA 2R7WA 4C8KA 4DS5A 1VYAA 2GVDA 2I0XA 4X62F 2B4UA 3HJVA 1QSLA 4PRFA 4FS1A 3HKZD 1MU2A 2MQNA 3D7SB 5I3QA 2ATCB 2B6AB 2ZVSA 2XS5A 3HD2A 1IBKJ 2CFXA 3HMJG 1NSPA 1F5CA 3AA9A 4I6WA 3MFIA 4RUBA 4O44A 2MQ8A 2F5GA 2GHWA 3H5SA 4OYOA 2CUYA 4WFZA 5CH7B 4BC7A 1XTZA 3PKMA 1Y00A 2V8GA 4KT0C 2ZC3A 4OMFG 4DX6A 2CQPA 2LDYA 4YHHF 2ZH9A 1IKYB 4UUXA 1RT1A 2UVVA 4NXMJ 2DRBA 4M5HA 4ED6A 4Y6IA 4ZK7M 1F6TA 3T5LA 4I2QA 4ETZA 1Q5VA 1IKVB 1DQ9A 3TEGA 3CXCR 4MAKA 3QIPA 3DLLQ 1DTTB 1OPIA 2D3ZA 1JLCA 3M8YA 3J7A1 2UUWA 2FC9A 1U1QA 3AB2B 4DPTA 1SH2A 5CCMA 2WVFA 2VU5A 2BVZA 2ZJQQ 1NHKL 5E41A 2R7RA 2OH2A 2EC0A 3LH2S 3M4XA 1S7HA 1RYSA 1R7IA 2FIUA 2EPIA 3ILJA 3M9NB 1FNXH 1UZDA 3TQEA 1MMNA 4QWBA 2FLPA 3SV3A 3MMBB 5LXYA 3HHDA 2KXNB 1AUDA 1FD2A 3WDOA 1C4CA 3B78A 2J0XA 1OY8A 2DO4A 2LQJA 2D1CA 1HD0A 2M4MA 3D5MA 3MPUB 3N9UC 4GO7X 4PXCA 1D0EA 1VQLS 3M2RA 2UVRA 2R8JA 2C42A 4ZIWA 2C2OB 2XLKA 4NCGB 1XK8A 3OFHA 5HMXA 1ZS6A 4PXEA 1BY9A 1AB8A 2DEIA 1SJ4P 2V6AA 5I42A 4QQBA 3M2UB 3HJFA 2H4WB 1YG0A 3K89A 1VJQA 5T41A 1NSKL 1U26A 4NRUA 4MIAA 3TJ9A 4JI4F 5B0AA 1DY3A 3DRSA 5E3PA 3GIKA 1N4LA 2FHJA 1LWEA 1R0AA 2FJDB 2QGFB 1JLBB 1HQUB 1RZMA 2VIHA 2E66A 4JV1A 4C8LA 1E6VB 1NDCA 1RBAA 2QL7B 2XI3A 3VGTA 3CULA 4WZQA 2P6TA 1B0TA 3HP6A 1UW4A 1J5OB 4ID8A 3RBXA 2MKYA 3T9ZA 1Q4RA 2J8SA 2EWHA 2MKSA 1M1KT 3R5DA 4OYMA 5A8RB 3P5TL 3TRGA 4NZ0A 1KVJA 2LLZA 3D6FB 2R42A 2Y1JA 2W8KA 5DDRC 1S1VA 4D3GA 2Q6CA 1CJVA 3K17A 5D0EA 4J9KA 3BQ2A 3FCHA 4USHA 5RUBA 3VAKA 4ZS6A 4LF4J 3LP2B 3OL9A 2YNIB 3IGVA 2X51A 4H54A 2MY7A 3DLEB 4MTPA 5C2GA 5F8MA 4WYLA 1PSDA 2YNFA 2QMWA 2J0QD 3VVUA 3VQSA 2DHXA 4JI6F 4DV0J 1AFIA 1IR1A 2DYAA 4M95A 3MPWA 2IM2A 1SJQA 1FFWB 4F3QA 3RB6A 2J6TA 3G8TA 2CZVC 2W9CA 5I4MA 1VOMA 3V2UC 2UUCJ 2JX2A 4QIEA 1N5VA 3MM9A 2VF3A 1MMLA 2GFFA 1C1CA 4YDXA 4OHVA 2MHEA 3UDCA 1F1BB 1IJFB 1JLEA 4ZJLA 2QYGA 5DDQC 3KLEB 1HNZF 1RBLA 1K44A 2MJNA 4UQGA 1WI8A 2RQ4A 1R8BA 3MM5B 5F3ZA 1I6JA 3DMJA 1VRTB 1YJNS 4DL2A 1NZAA 4Y2KA 3LTOA 4HHUA 4J9SA 3IRWP 2DNLA 2WW8A 1H2TZ 3MD1A 2DPJA 4LMZA 4AQYF 1FRXA 2OEKA 1NSQA 2JDJA 1UMJA 3EJMA 2PC6A 4PG6A 5ADZA 5KOWA 3TX8A 1JNZB 4I69A 1HPZA 2M70A 2VBWA 3R5AA 3C16B 4X4OA 1HNIB 2X1AA 3C6TA 1FRMA 1RA7A 3DDNA 3ISND 3L95X 1FVSA 1FKOA 5F9NA 4X64F 3G87A 3QSYB 4JI0J 2HHVA 1DLOA 1GXTA 2BV3A 3D1HA 3IG1B 3K2YA 3KLIA 3OTCA 4I2PA 4ZOSA 4QPXA 4BWJA 3DYAB 2MHNA 2J76E 1TQLA 4HT5A 2CZ4A 5HMZA 3CCRS 3MM6B 4IOCQ 1PAEX 2FJBB
chains in the Genus database with same CATH topology
2NREA 3R3TA 2V4JA 4OHZA 5KG7A 4WFNQ 5KG2A 1S0OA 3HPOA 1RT3A 2XY6A 5KT4A 2YH0A 5FDLA 2VPZB 1UA0A 3HVTB 4PQUA 1NK7A 3KK2A 4BDPA 1DARA 2IMOA 3CGIA 3DI6A 5A8WA 3C8YA 3NS5A 2WHOA 5JUMA 1F9FA 4OZ0A 3MFHA 1HYSB 2KTQA 3MMCB 1TKXA 2R9LA 4DF4A 3GZ7A 3SZ2A 2IM0A 4RZRA 3N28A 2VG5B 5F3TA 4KE5A 3L3CA 1C1BA 1BQNB 5L9XA 1RTHB 1TKTB 3FZ2A 3LGMA 3KMQA 3CCMS 4Q44A 3FRZA 1M90T 1DTTA 1QTMA 4LQ3A 1NHVA 4MKBA 1OSCA 4Y2AA 2VD3A 4WU2A 4PWUA 3H5YA 4LVOP 4GMKA 4QZVB 2LU2A 5BR8F 4RW8B 4JI2F 4DR4F 5DDOC 3CMAS 3THTA 2MQPA 5HL7Q 1T05A 3MM5A 2BXJA 2AU0A 5KFVA 1HMVA 3OSPA 5F8GA 5HLFA 2J9CA 4RLEA 3AJ2A 2DNMA 3G8QA 4C0OC 2K3KA 5EX0A 3I55S 1VQ8S 3T5KA 2OPQB 2BW2A 1FK9B 2RF2B 4DV6F 3FDSA 4FYDA 1LFWA 3M2VB 1JLGA 2PA3A 3BEGB 4IDKB 1WF0A 2B5JA 3LALA 3OXGA 4ZPDA 3THPA 2ASJA 4G3IA 1VGYA 1ZOTA 4EZ6A 3T1YF 2KKHA 1C0TA 4ZP9A 2Z0GA 1GX5A 1S1WA 4JI0F 4NA3A 1V3RA 1WEXA 3CD0A 3BR8A 4HEA9 2C3YA 1T8EA 5EX3A 3TUJC 5AXNA 1S0NA 2VQFF 2ASYA 4TYBA 3HZGA 4DPOA 3IFEA 3QJPA 2EW9A 2JHEA 2NUHA 2PO4A 4LF9F 2P9GA 1Y4ZB 3R5CA 4H4OA 2W7OA 4DV2F 3RB4A 1QSSA 1KLMB 1NO8A 5KFXA 1DBDA 2M2BA 3QGHA 4Q8FA 5D4NA 5IFMA 4O3NA 1IQZA 4ZMMA 4Y0FA 4OI6A 2Q1LA 2LA6A 1HQEA 3NS6A 1JLQB 3CC2S 4J9KA 1U09A 3VAHA 1LWFA 2V9KA 4DV5F 4OX9F 2A2CA 2GMHA 2CPEA 4AE5A 1DJ0A 4TU8A 3K8VA 4KKOA 3PY8A 5EWGA 1TVRB 2MKIA 2AV5A 3PR5B 4J9RA 3T3FA 2WONB 2B4VA 3IG1A 4I2PB 2RQCA 1MWYA 4WF9Q 4PG4A 1JJHA 5DG7A 2FLLA 1QAJA 2V4QA 4RBTA 5AXKA 4DF8A 4WZMA 1NH8A 4IQMA 4USIA 2H5EA 5D4PA 3LUYA 4PKDB 2AGPA 4KGKA 3DGPA 2EFVA 2EG1A 1QY7A 4FPRA 2BQ3A 3GMGA 5KFWA 3BJYA 4DL6A 3UR0A 3MMBA 5KFJA 2J5AA 4N77A 1RWUA 4F3MA 2HLTA 2VFVA 4K59A 5EDWA 5FJ4A 4OI4A 3SCKE 1WACA 2MGZB 4ZPCA 1WEZA 4LUBA 5THWA 2HHUA 2YTCA 2J7WA 3DLGA 1KNZA 4C8OA 2ZITA 1U2RA 1HNIA 1Q81T 3P6YC 4IOBA 5D3GA 3GIMA 5K8MA 2WBRA 1YJVA 4FXDA 4PUOA 2KZMA 3ENWA 1PGZA 4I67A 5J1PA 4GC6A 1OWXA 4OFZA 1N52B 1Z2LA 2OPRA 4RW9B 1N48A 2DHAA 1Q7LB 2CRLA 5HO4A 1HBNB 3M9MB 3M8SA 1MNEA 1S6OA 1NK6A 3LPYA 3NP5A 3H2LA 1TP7A 4RW8A 2JSXA 2IAJB 5KFEA 3S01A 4Q7AA 1D1UA 2BQUA 2BJDA 1S9GA 1O51A 1URRA 5A8WB 1S0MA 3M32B 1TL1A 1RT7A 5T7LA 2IVFB 4DFKA 3H25A 2ZC4A 1S6PB 2K1RB 4DEZA 2VOOA 4PWDB 3DRRB 1L3TA 1Q79A 3NCQA 4ED0A 4LF4F 1UJ5A 5E2QA 1EETA 3KLHA 1RA6A 2LDIA 2WOMB 3CT9A 2OD6A 4ECSA 4USJC 5ITHA 3CCTA 2YKNA 1P9QC 1TV6B 1X4EA 3ITHB 2POKA 1QLNA 3VZHA 4FNHA 1HBOA 2GMLA 1ZTTA 2MKHA 2QLXA 3RR7A 4KSEB 4RNOA 3BDPA 2CJBA 1GTHA 1SV5A 2GA7A 1Q8IA 1SC6A 5J2QB 2HNYB 2DR5A 1JXLA 2XBPA 4RBUA 3OL7A 1WHYA 4DQQA 4FF4A 3K5PA 4MMOA 3K0JA 1HARA 5AJ3F 3TVKA 1E6YA 2DO0A 2IRYA 2IYGA 1JIHA 3W7BA 4XIUA 2KXFA 3GE9A 3MEKA 3OFEA 3JB9k 1T7PA 4U7CA 3TI0A 4J37A 1FKOB 3UCZP 1SJRA 3FSXA 5L1JA 3IRXA 1MROA 3MUMP 3CDAA 1CLFA 4IDKA 4ZP6A 4MH8A 1DQAA 3L7OA 2JWNA 3N5FA 3JTPA 4YB5A 1BWEA 1IKVA 4H4KA 1C0TB 1S79A 4ZA1A 2Z2LA 1NB7A 2D7SA 5BJRA 4K5SA 4YDDB 2ZE2A 4JV5F 4NLTA 1X5OA 4K4YA 4C11A 2YKPA 4FS2A 3UW1A 2AJQA 4HLBA 2C3MA 3B4DA 3LOUA 2GHVC 4F4WA 2FY1A 1R8PA 4OZNA 1U1LA 4A46A 3GV5B 6FD1A 2R7XA 2W24A 5CZXA 5KFYA 4WFBQ 4RNHA 2VKRA 3N79A 2UZAA 5DQIA 1JLQA 2E9RX 2E5GA 1QUVA 3FEZA 4NLDA 2ZBCA 4KQZA 5K8OA 4WE1B 3HXMA 4Y28C 2BUNA 4DS5A 3EGNA 4NX9A 5KT2A 4X4QA 4ILRA 2HMIA 3HZEA 4HDGA 1BQNA 3MF5A 2OTLS 1N0VC 3K5NA 2MQQA 1EETB 3BGUA 1WHXA 2XMKA 3MEGB 3O3LA 1K0VA 3OVSA 1YITS 2E44A 4PXDA 4QR0A 3RRKA 3W2VB 5IS2A 4YQWA 1KTVA 2KI2A 1LWEB 2PE8A 1FT8A 1JLBA 1HQUA 3PHEA 5HN0A 4Z37A 2B9YA 4C2MA 2R2TA 2YH1A 1Y5IB 4X4RA 2WB4A 4ID5A 5G0RB 1TR0A 4URQU 4TNOA 3WC2A 2BACA 3V4MA 3RB0A 1RKJA 2HG4A 2J6SA 3WC0A 1J2VA 1Y0HA 3HHEA 5DLGA 1VBZA 4MIWA 1G7CB 3JSBA 4H4MB 3DOLA 5LXRA 1F5BA 3OL8A 3JAMY 5IZHA 1RTDB 1RT1B 4EYIB 3T5HA 3QO9B 3UWTA 2UUCF 2ZKUA 1N56A 3BR9A 3BQ1A 4IR1A 4TN2A 3FQKA 1T3NA 2H9ZA 3QIPB 1VFJA 3OV7A 4ZPVR 1LKZA 1SJ1A 5KG1A 3KLHB 5U47A 3KJVB 3SI8A 1CVJA 3BO2A 2C22A 3OHBA 1KRPA 1TUVA 2IM3A 2AX1A 4F4XA 1AW0A 3TARA 3JSRA 2VC0A 1Q8LA 4K0KF 3BQ0A 4BBYA 2OAUA 1WNEA 2BE2B 2D3OR 3SFUA 4EU0A 1U25A 3KLGA 2PI5A 3M32A 1VMBA 4QYZJ 3U27A 2R8GA 1W2IA 2DVIA 2E7XA 2F8EX 2YVSA 1YWXA 2MKKA 4HTJA 4NLRA 5JVHQ 1E6YB 4D3HA 2B7CB 3IS9B 5J1NA 5J2PA 4WU3A 1DTQA 4NXMF 2R4FA 5KFBA 4B9NA 4CO2A 2KYZA 4OQJA 4DQSA 4MIBA 3W2WA 4U67Q 2W4CA 3DCAA 3DRSB 1F60B 2KO1A 4R5PA 4DFPA 1BQMA 1IBKF 4K4XA 2ROEA 3GFHA 2L9WA 2DH7A 2V4JB 3S6EA 1R6YA 4CNYA 4OV1A 5LT5A 2NQPA 2M88A 1FD8A 4QR1A 3BO3A 3ZZPA 2ZHBA 1FEEA 3CE8A 2ZH8A 2GIRA 4C7QA 2HQIA 5GAGU 4DL3A 3MR6A 1KFDA 1HNWF 5SUHA 4GO5X 3DLGB 1QE1B 2O5DA 3HDSA 4LFAF 3NMAA 3CD6S 1ZH5A 2BM1A 1Z2ZA 1SIZA 1ZM4A 1REVA 3BGRB 3W3SA 1LW0A 2FJXA 3RBEA 2DNYA 2I5JA 1HW9A 2YQ3A 3BGLA 4EWTA 5DQGA 2HMIB 1VBYA 3LAMA 1YVFA 2J7UA 2HWTA 4ZVGA 3FFIA 4QWAA 4V19X 5K14B 3MEGA 1EP4A 3M8QB 3KMSA 2ZBIA 1XBWA 2C3OA 2JLEA 5GAHI 1B0PA 2CPXA 4KAIA 4LSLB 3KHGA