3CCVS

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 20
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ccvS00
1P1TA 1FO1A 2YH1A 2KVIA 1U1MA 1YTYA 2FHOB 2X1FA 3CUNA 2MGZB 1WHWA 3JB9k 1KQSR 3U1MA 4EGLA 1Q86T 4IOAQ 3MUTP 2HVZA 3IRWP 3CPWR 2KM8B 3UCUP 2LA6A 1HD0A 2LEBA 1VQNS 1WWHA 2BOPA 1JJ2R 1VQMS 2SXLA 1UW4A 2F9JA 2MB0B 4WFAQ 4IUFA 2DGSA 3CCJS 2DNYA 1UAWA 3DXBA 3ZZYA 2V94A 2LMIA 5JVHQ 1UP1A 2CPXA 2DIUA 1DRZA 2DGXA 5CA5A 1K9MT 2MZ1A 2YH0A 2DK2A 4CQ1A 2CQ4A 2CPEA 2MZJA 3CMAS 2L08A 4WCEQ 1SJ3P 2JWNA 1ZZNA 2DH7A 2JVOA 5BJRA 2RUGA 4ERDA 2MJNA 5D77A 1YJ9S 2U1AA 2YKAA 2MZQA 3L3CA 2VOOA 2DHAA 4CIOA 2HGNA 2KXHA 5DDOC 1X5PA 1D8ZA 5GAEU 2MKJA 4PRFA 2RQCA 2DNPA 2JRSA 2JVRA 3J7ZT 1L3KA 2MQQA 2KXNB 2OJ3A 1VQ5S 2RU3A 1ZZFA 3ZZZA 1U1KA 1WEZA 2KFYA 1VQ9S 2MZTA 2M8HA 3D2WA 1VQ7S 2O3DA 4FXVA 4C7QA 2MYFA 3EGNA 2DB1A 3R1HA 3S8SA 1M1KT 3VAGA 2DNHA 4PKDB 3UD3P 2UP1A 4W92B 3S7RA 2WBRA 1P27B 1YJNS 2VODA 2AYBA 2MXYA 1DZ5A 3UCGA 3VF0B 2L9WA 3UE2A 2MQPA 1U1OA 1FJEB 1WHYA 2KM8C 4TU8A 2EK1A 3BEGB 2M0GB 3CCLS 2YTCA 1WF1A 1FXLA 2CQHA 3K0JA 1B7FA 2G0CA 2MQNA 2ADCA 2EK6A 1WI8A 2ERRA 5DDPC 3BO3A 3Q2SC 2E5GA 2M8DB 1JJHA 3NNAA 3VAHA 2VOPA 3G6ES 2CPDA 4V19X 1WG5A 2I2YA 2F3JA 2CQPA 1WHVA 2DO4A 3H2VE 3THTA 2KG1A 2KH9A 1YJWS 4QQBA 3S01A 5IFMA 4IOCQ 4CH0S 2MKSA 1DHMA 1HD1A 1M90T 5GAGU 2DGVA 2DNLA 2CQ0A 1NU4A 1BY9A 3LQVA 1YWXA 1WG4A 2CPJA 2F9DA 1SJRA 1U1NA 2XNQA 2DGTA 5GAHU 3CC4S 1ZH5A 2CJKA 2MQMA 2HGLA 3HHNB 5DETA 5LSLA 1N8RT 2KT5A 2N3OA 1X5TA 2K3KA 4ED5A 2E5IA 3CMES 2KI2A 1HL6A 1VBXA 2E5JA 3MD1A 3EX7B 3CCUS 5GVQA 2MHNA 3I56S 1X4HA 2KHCA 1VBZA 3CXCR 2OTJS 1HA1A 2MGZA 2QA4S 2CQ3A 2X1GA 2YWKA 2G4BA 1F9FA 3R1LA 2MPUA 2D9OA 4U67Q 2M7SA 2CQ2A 2RRBA 1X4DA 3EGZA 2XB2D 1N52B 5LJ3Y 2VONA 2DNMA 4Y00A 1SXLA 2ZJQQ 1S79A 2CQBA 2KXFA 1U2FA 1KOHA 3V4MA 2OSQA 3B4DA 2QEXS 3CC7S 3NS5A 1Q7YT 2DH8A 4P6QA 2MQOA 4TU7A 1WEYA 1R8HA 3CCSS 5JVGQ 3SXLA 3RW7A 1M5OC 1URNA 2MSTA 1WI6A 3CTRA 2ADBA 1VQPS 2XS5A 2J8AA 1PGZA 3VAMA 1X4BA 4FXWA 1OWXA 1U1RA 4ZKAA 4PR6A 2KYXA 3MI7X 4F26A 4QU6A 4LJMA 1R8PA 1M5KC 4OZ1A 2DGUA 2CQDA 1U1PA 2E44A 1U1QA 2GHPA 4WF9Q 2CPIA 1RK8A 2N82B 1U6FA 4YB1P 3FEYB 3CCQS 1Q82T 2K8GA 3VALA 5DDQC 2KG0A 1D9AA 4LMZA 3IWNC 1VQ4S 1CVJA 2CQ1A 2RS2A 3Q2TC 4UQTA 3BO4A 4QPTA 2KRRA 1SJQA 2MKIA 2FY1A 3TP2A 1VQ8S 4TLQA 3G8SA 2LQ5A 1DBDA 2NZ4A 2MKHA 5EN1A 2CPZA 2X1BA 3UWTA 1K73T 2ZJPQ 3CCMS 1FJ7A 2RQ4A 3G71S 1WG1A 1H2VZ 1YHQS 2J0SD 3THPA 2CPHA 2MY7A 3NMRA 1QM9A 2KU7A 2MJUA 3P6YC 2DH9A 2DNNA 3B4MA 1AUDA 2XS2A 3MOJB 2I38A 2DHGA 3NS6A 2DNRA 1W2BR 3US5A 3CF5Q 2AYGA 2KRBA 2HGMA 1OIAA 1VQKS 2PEHA 4W90B 3VAIA 1QVFR 2CQGA 1VC0A 5DM7Q 5IQQA 2AYMA 2DNGA 2JX2A 2MMYA 1A9NB 3CCVS 3CULA 1IQTA 1XN9A 2E5HA 4OZ0A 4C0OC 2MZSA 1X5SA 3MD3A 4WIIA 2DHXA 5LJ5Y 2DGQA 3BS9A 3N9UC 2CPFA 3RW6A 2X1AA 2BZ2A 2D3OR 1KC8T 1NJIT 3G96A 3SDEB 1OPIA 1PO6A 5GMKa 1M5VC 1H6KX 3I55S 1X4AA 2A3JA 4CH1A 3P5TL 1SJ4P 2CQCA 4A8XA 2RVJA 4RU2A 4LIRA 5H1SV 2OIHA 3CCES 1UFWA 2Q79A 1SJFA 1S72S 1FNXH 5DDRC 3CC2S 2B0GA 3DLLQ 2U2FA 3H2UB 4M5DB 5ITHA 2MY8A 1X4GA 3VAFA 3VAKA 3MDFA 4TU9A 3MXHP 2FPHX 3HI9A 1OO0B 3NNCA 2AYEA 2LXUA 4UY8T 2LCWA 2OSRA 2M9KA 2MQLA 4F02A 2MZRA 2MSSA 4YUDA 1X5OA 2HZCA 2M88A 2J76E 5LSOA 3OW2R 2RT3A 3LPYA 1M5PC 2AD9A 2LECA 2KN4A 4IO9Q 2PE8A 3SMZA 4Y0FA 5GADU 2RRAA 1VC5A 5HL7Q 2ZJRQ 2DO0A 2XS7A 2NLWA 3SDEA 5IM0B 3G9CA 1X4CA 3R27A 3UD4P 2DITA 4WKRA 2LA4A 2OTLS 4BS2A 3MURP 1X0FA 1YIJS 2DHSA 2RNEA 5FJ4A 1VC6A 5HO4A 1NO8A 2DGWA 4QU7A 2G1DA 2D9PA 2M4MA 2LYVA 2M70A 3ULHA 1U1LA 1WF0A 3P49B 1WEXA 2DNZA 1KD1T 1YITS 1FHTA 1VBYA 1A7GE 2M52A 1YI2S 2DNOA 5DM6Q 2LKZA 3G4SS 2MKCA 2FC8A 1WHXA 4Z2XA 1X4EA 2GO9A 2LXIA 2EVZA 2RS8A 1VQOS 4C4WA 1U6BA 1FJCA 2DNQA 3PIOQ 3G8TA 1VQ6S 5IM0A 1JJ4A 5CYJA 3NNHA 1K8AT 1Q81T 3TO8A 3U1LA 4WFBQ 2N3LA 3P3DA 1G2EA 2FC9A 1N54B 3FEXB 4F25A 4WFNQ 3PIPQ 2LEAA 2CPYA 2MKKA 2DGOA 2DNKA 3S6EA 3MUVP 2CQIA 2QFJA 5CXTA 1WELA 5D78A 3MUMP 2L41A 1WTBA 1KOOA 1X4FA 2M2BA 3TYTA 2J0QD 5LXRA 1FT8A 2HYIB 2DISA 3CCRS 1H2UX 5MLCV 1N88A 3J7YU 2XNRA 3CD6S 2N7CA 3BO2A 1VQLS 3UCZP 1RKJA 4YOEA 2DIVA 5LXYA 3VAJA 1JMTA 1H2TZ 1WF2A 4J5OA 2XSFA 1QVGR 1O0PA
chains in the Genus database with same CATH superfamily
4XPEA 3CNQP 1BC6A 3TRGA 4DPWA 2PMHA 3NGTA 5IWAJ 1DARA 1KN6A 3T3FA 1U1MA 4PPZA 2NZCA 1R6YA 3U1MA 4E2FB 3QGPA 4U9RA 4USHA 1BQNA 2W9CA 3HM9A 1IBKF 3GCWP 4TYBA 1RQ0A 1GNKA 1JQGA 2DJWA 2F8EX 2JNJA 3MUTP 3MWBA 1YZ6A 1VQNS 2BOPA 4QYZK 4CO3A 3I5BA 1O51A 4CLTA 1JLQA 1NZAA 2F9JA 2MB0B 1YK9A 2NQPA 3WZ0A 4IUFA 5B08A 3AA8A 3MEGA 5CYMB 3OTOF 1C0UB 4I2PB 3M8PB 3OD2A 3J7A1 3RB0A 3BSAA 1TAUA 1YGYA 4DSKA 1QVFR 2DIUA 4B3SF 4YP3A 4HACB 4OYZA 2VA3A 4LF4J 1FE0A 2HS4A 1IN0A 4ELUA 4FZVA 3TX0A 4DV6F 2BMBA 2J6TA 2ZBQA 4I6YA 3BH7B 2CQ4A 3H2LA 4DUZF 1J5EF 1ACMB 1RAIB 1SUQA 2YVSA 4WFYA 4WCEQ 2J8SA 4ZIWA 1CQNA 1U09A 3CJ4A 3CCTA 2ZH8A 2Y1JA 3KLEB 4LFCJ 1BQXA 4NA1A 3IBFB 1IXKA 1S7HA 3SFGA 4KRWA 4A8SA 4ZJLA 4DR5F 4CO2A 3FJ2A 4F50A 2YX1A 2P9EA 1R0CB 3IP0A 1QTNB 2OPPA 2VHGA 1YJ9S 2PFDA 2HQIA 1ZETA 5K9FA 2K06A 1NHVA 2BE7D 3DDKA 2W7AA 1DY3A 5FLXU 2Q6BA 2ZOGA 1UWAA 2IRUA 4WP8A 1FD2A 2ILZA 1RYRA 3DM2B 2R8JA 4G1PA 1VRUA 1HWKA 4E98A 4PZVA 5GAEU 4ER8A 3PW4A 3NAIA 3C14B 2VKZG 5K20B 4AQYJ 3T1HJ 2GHWA 4JI8F 2E66A 1XNQF 4J9LA 1MWYA 4Z7YA 2YBVA 4U7CA 4X62F 1UPMB 3FZ2A 2WVDA 3FRZA 3RB4A 1FEHA 1HQEB 1VQ5S 2POKA 5E33A 1VFJA 3ZZZA 5BR8J 1FX2A 4LIWA 4NLTA 4LBIA 1CJKA 2OUGA 4WP9A 3R7SB 1FWLA 2WCXA 2E1RA 3I0SB 4NA3A 3UW1A 4ZHRA 3PHEA 1Q8KA 2VPWB 4H4KC 2FGOA 2M8HA 2GVDB 2ROGA 2IJNA 3BSNA 5D3GB 3D66A 2QRRA 2VF3A 2WB4A 1VQ7S 3M8RA 4FBTA 2JLFA 2YNFA 2E9ZA 4BBYA 5CD4H 4EYHB 4LF4F 1J5OB 1LV5A 4PYAA 3RBZA 1AZSB 2VQFJ 2ZWOA 4ZPBA 4HYKA 4M95A 4C3KA 4DSIA 5F8NA 2CUYA 1WC4A 4B3RJ 2Z57B 4F4AA 2VG6B 2YWFA 3TAMA 2DNHA 2OFHX 4P74A 4W92B 2GIQA 2LP4A 1IKXA 2XLJA 2QMWA 3U7JA 2XEXA 4JI2F 1XBWA 4OI3A 3VF0B 3T5JA 1MU2B 1NDCA 3LO3A 4N8NA 1NSQA 2OD6A 4H4MB 3ZZTA 3EXCX 1TVRB 4FP9A 2W8LA 4K0KJ 1WHYA 3MEDA 3NS7B 4P52A 1ZBTA 2VBXA 2J6UA 1ZM9A 3TUIC 1RT1B 4Q5VA 2ZC4A 2G2YA 3KJVA 4OV1A 2FY8A 2GJIA 1HNWJ 2MTLA 3T9ZA 3WIVA 1RT7B 3CCLS 4IQXA 1SJ1A 1WF1A 2LXFA 2Y0BB 3B8HA 3FCHA 1KVKA 4CT9A 1JK9B 1W25A 2YNHB 2V4JA 4NYZA 2OHDA 4X66J 4AQYF 1XNRJ 1B7FA 3ZZRA 2G0CA 4RW4B 3K17A 3MMCA 3EM1A 3QWUA 2KB2A 4LRAA 5DS7A 5E3RA 3VZHA 3HKZD 5A8RA 4Q0BB 2UXBJ 4O4GB 1FDAA 2CWXA 1KRPA 1QE1B 4HTJA 2BDPA 4DR4F 4KJIA 5IT0A 3KJFB 4CZCA 4X84A 2O67A 2QLBB 4DSEA 2HNYA 1VI7A 3P8BB 2CPDA 1VS3A 2XBPA 3HVWA 3DOLA 2HBRB 2OMOA 1UEVA 3OVBA 1OJ4A 2I2YA 2F63A 2AEMA 4DFMA 3OPKA 1BHNA 1TELA 3OFFA 2BKPA 2XWXA 5L8RC 7FDRA 1WHVA 2DO4A 4PAAA 2KG1A 2W9BB 2OEJA 2UUCJ 3ZTSA 3DXSX 4FS2A 1BD6A 2DXFA 3RB3A 3MTJA 4LSLA 4NWBA 4OHXA 4CH0S 4IOCQ 4OX8A 2FYXA 1TQLA 3GWCA 4LSNB 4HI2A 3JAMU 2VJUA 1UFKA 2DRAA 2FJVA 4HKQA 3RAXA 4G1QA 3B78A 3GQCA 2B43A 1D9DA 1F6TA 2COLA 2DGVA 4ED3A 1JWWA 3KMSA 4JI7F 1BY9A 3I4PA 3OFEA 4B9UA 3HDSA 3CDBA 3D6MB 2AW0A 2CJQA 3V81B 3OSNA 3GIKA 2KJVA 5F8IA 1HYSB 1SJRA 2NS1B 1PJ6A 2BOAA 3DHWC 1HNWF 2B8PA 4Y34A 3P45B 4DN0A 2B9XA 3H40A 2YNIA 2P2CB 2BQUA 1HMVA 2FTRA 5KT5A 2CJKA 2QZ8A 4WK1A 3OXFA 2RKIB 3DOKA 2DPIA 2AGPA 1IKYB 1RKIA 3DRSB 1C1BB 2ABYA 1TR0A 2ZBPA 1HWJA 2ZWPA 2K3KA 1WKJA 2EFVA 3CMES 2R7RA 3EX7B 4DQRA 5GVQA 1HQEA 2W2OP 4KB7A 2RB7A 4WFZA 1NB2A 3VGSA 1S1TB 4MT1A 1IJEB 2XMWA 1AB8A 3HKWA 3I56S 2KHCA 3C16B 3H8YA 4NE9C 1VJWA 3H20A 1YJTA 2X1GA 3JQJA 2QA4S 1HBMB 4FBUA 2ZBRA 2IYIA 3IC1A 1Q5YA 5HP1B 2D9OA 5KFKA 3LANA 1PBUA 4U67Q 3OL6A 1RBOB 3CB4A 1G3OA 1OS5A 1VRTB 4D3GA 2BW2A 5LJ3Y 2DNMA 2GVZB 3LAMA 1UZHA 4YFUA 3N6MA 4GVBA 4WBFA 1VQYA 4OX9J 4Q44A 4YB7A 1HMVB 1VISA 2DEJA 2V8HA 3PKMA 4M1KA 1UWBB 3RRGA 2BA9A 1NLKL 1U2FA 2DY9A 1S97A 1KOHA 3W5ZA 3V4MA 5I42B 2GHVC 2RD5C 3QIPB 1FDDA 1HI8A 2OSQA 1R0AB 4O44A 4DU8A 4QIFA 3MR3A 4LF6J 3OL9A 4CNYA 4RKUC 4U6PA 4DU7A 4P6QA 4TU7A 1RAOA 1CULA 3CO0P 1R8HA 1DTTA 4C9DA 4Y2MA 3SXLA 5JVGQ 2XMTA 1RT5B 1HNZF 3I82A 2DYAA 1UA0A 3MCNA 2YNHA 3U27A 6FDRA 1TK5A 1RABB 2JJ4D 4DR1F 4ZVRB 1X4BA 2P6TA 3BGUA 2FVSA 2QL5B 4TQRA 3X1LB 3QIDA 1RB0A 3ENVA 3JAMY 1Q0NA 2AMCB 4PR6A 2DEIA 3SCJE 3POTB 1X9WA 2HRTA 4ZVEA 2B9EA 1R8PA 4IRDA 4KKOB 4OZ1A 2BJ9A 2RQKA 4WF9Q 3DOLB 1UEUA 4O0NA 3TARA 1TK0A 4X4NA 3MFIA 3JXOA 3W5YA 4P71A 2QJ3A 2ZEJA 2VFVA 4N7TA 4N5SA 4N56A 1U6FA 2V2QA 3MMBA 4PUOB 3I5AA 4F4ZA 5E3PA 2GJFA 2K8GA 4UOFA 3SSRA 9RUBA 4GKJJ 1R0AA 4CLYA 5HBMA 4I1TA 2E5LJ 3W9JA 2R4FA 3I0SA 1WORA 5KG0A 6FD1A 5GMEA 5K8MA 4A8YA 3Q2TC 3FEZA 5D3GA 1Z2ZA 5B0AA 3KG0A 2DRBA 3SSQA 3KYLA 4LF7J 1S5ZA 3PDNA 4F7VA 3E01B 4HH0A 2FY1A 5I3UA 2H54B 4ES2A 2J6SA 4FYDA 1T94A 3UDLA 2PI4A 2ZZNA 4RNHA 6AT1B 1DBDA 5EN1A 5DO2A 4QR2A 1PIEA 3L09A 3WC2A 2XCAA 4A8FA 4FF2A 4B9VA 5FIIA 1SL2A 4K4SA 2IBOA 1IKWB 5HK4A 3VWSA 1F9HA 4MYUA 3W62A 4ZLLA 2W9CB 2QL7B 3D54A 1NJWA 1FJ7A 3E2EA 1KQFB 2RQ4A 4LFBJ 4C8OA 3IMQJ 1RJJA 1EQ0A 4K7QA 2UVWA 1NUEA 1UVIA 1VBKA 1W2IA 3ZTOA 3KFWX 1HPZA 2MY7A 1RI7A 1ELOA 5B0GA 3MECB 1R89A 2B4PA 3ISZA 4JV0A 4N41A 4LF1A 1T05B 1GMUA 2W4DA 4C6AA 3T5HA 2A6MA 4DSJA 4ELVA 1XERA 3GG1A 1HFEL 3SEOA 1OMSA 3NGKA 3CF5Q 3FZBA 2AYGA 2IC3A 4OX6A 5L9NA 1U0SA 2AQ4A 4USKA 4DV4F 1VQKS 1RTJB 1ZTWA 2WAQD 1JLBA 4V19J 1KSPA 1CJTA 1HNVB 1LW0B 4FN5A 4ZA1A 2KO1A 3G82A 3VVTA 1FDBA 2X51A 4DQIA 1R27B 5IQ6A 2Z56B 3UQSA 5HJYA 1FJGJ 3PY8A 4EFAC 2OPRB 2AYMA 4IH6A 1A9NB 2HIQA 3J81j 3MZIA 1HBOB 3CULA 2EFQA 3HMJG 1UJ5A 1XN9A 2E5HA 2HLTA 5KFNA 2VQFF 1ZM4A 1CJUA 2DKOB 5J1PA 3NAHA 4LRFA 1RT6B 1T9VA 2VG7B 1SVDA 3QAUA 3GFYA 4FYWB 5KFPA 4P73A 5ETSA 2IVMA 5HATA 4L72B 3KLGB 3RBDA 1N36J 1FFGB 1DTQB 3NLCA 1D9FA 1TFWA 4JI2J 3EVOA 3DGVA 1PCAA 4CH7A 2R7TA 3DDNA 3C3LA 3TQ1A 1DQ9A 1OQ3A 1WSVA 2W24A 4K0KF 4WTOB 3G96A 1OPIA 1TL1B 3IWLA 2EBEA 4O3PA 3GYGA 4NRTA 3OTBA 1X4AA 3I55S 3PYGA 4CH1A 1TUWA 3GMGA 1N5VA 2E7WA 2WBMA 4P7VA 1EZZB 4ZCMA 5BXIA 4WE1A 3KJQB 1GFWB 3HZGA 4G3IA 1R43A 4V1Ak 5AXNA 1S4EA 2J9EA 2B9YA 3BF4A 3NY0A 3OFGA 3MMAA 4ZJOA 3UI3A 3CDWA 1GTHA 3EGVA 3DLEA 1JLAA 2K2PA 2B4UA 4RU9A 2R7SA 2ZNYA 2HMIB 1F5BA 2VPYB 3HPOA 3NGSA 2Z2LA 3H0PA 5KAKA 1S6QB 2AJQA 1AW0A 3FMWA 3G82B 3H2UB 4F4XA 1WNEA 3BB5A 2UUBF 1FRHA 3VAFA 2QC3A 2RJZA 4Z37A 4UZCA 2OO4A 4ZN1A 2O5DA 3LPEA 4LBHA 4QJVA 3NNCA 1Y5NB 3NBPA 1FTRA 4O3RA 3D4JA 4B9SA 4X4VA 1LEOA 5HN0A 2HWIA 2B4OA 1N0UA 2K7KA 3AH6A 2MSSA 4G1IA 5HMXA 3K5LA 1NKBA 1RLDA 2CNLB 3AD9C 5F0WA 3VHQA 2FLLA 1EARA 4R0EA 3LGHA 3F41A 1RCOB 3LPYA 1U02A 1NM2A 3JSBA 4CI0B 1I51B 4ZVFA 3O44A 2WOMB 1M5HA 2OGUA 4TLRA 3AB4B 3O6QA 4ZPCA 1S1VA 4Y0FA 4LQ9A 4YHHF 4KPYA 1RT3A 1JLEB 1SCJB 2VG5A 3PG9A 2L9NA 4KIAA 2EPIA 4NZ0A 3EICA 3UDVA 1L3VA 5IM0B 2Q43A 2JDJA 5KG6A 3DM2A 1S10A 4JV5J 1U24A 3JQMA 2A1BA 1HWLA 2HFUA 3AJ2A 4C3LA 2DITA 5A8RB 4MK9A 3UVJA 3MURP 3R5CA 3OV7A 1UVJA 5ETQA 5AE2A 3HVAA 1AUSL 1TKTB 5DQIA 1JLGA 5J2PA 1T9WA 3I96A 4QU7A 2RF2A 4PWDB 1E6YB 1ZAXA 2M4MA 2WRMA 4DOZA 3BBCA 1U1LA 3HF5A 4EUVA 3P49B 3WHIA 1KD1T 2Y9HA 1M1HA 1A7GE 4PWUA 1CSJA 3RZAA 3ZFVA 3N4WA 3MPWA 8AT1B 3ZTQA 1XIQA 3KLVA 4IYQA 3KNAA 1ZOTA 3T9NA 2AF6A 4W4MA 1GMWD 1HHQA 4R5PB 4NLWA 2FIUA 5ETTA 2IBKA 2ZC3A 1U48A 2F4VJ 4C8YA 1X4EA 3KK2B 1LOUA 1VQOS 1Y3JA 4C4WA 2HQCA 3KK1A 2DNQA 4ALZA 1QAJA 2OPQA 4F2SA 1VQ6S 5F0UA 3NWRA 3W61A 5F8GA 3PKYA 3QJPA 3N0VA 2C2EA 3MPDA 5EWEA 3PJ9A 3KUHA 2EC2A 2V4QA 5AT1B 2N3LA 1N56A 4LR8A 1V6HA 4OJHA 3MCMA 5DQHA 2GIRA 3QMQA 2VBYA 2GVZA 3RG6A 4KTQA 1NK6A 2Y8WA 2GFFA 2QIFA 4ZOSA 2CPYA 5C25A 2HAFA 3FGVA 4IG0B 1JLCA 3R5JB 3M9NB 3MR5A 2DGOA 1WKLA 4BLGA 1UWBA 3BQ0A 3BV8A 4GVLA 4F8RA 4KH1B 1ULRA 2D1CA 3N79A 2FJAB 4AFFA 5H9EK 2I8EA 2FZGB 2NUUG 2BJ8A 3IG1B 2L41A 1HNZJ 2BW7A 1F0XA 4DSFA 1KOOA 1NK9A 3MM5A 1S1WA 3MM9B 2AV5A 4ICLA 1QAYA 4WIQA 2GGPB 5E3CA 1FT8A 3BZQA 2DISA 4CLWA 8RUCA 2Q6CA 4DR5J 2HYIB 4RW8A 1H2UX 2NREA 3M4XA 4JI4J 2IIHA 2K1RB 2RILA 1UMJA 2A2DA 2APOA 4HDGA 4JB8B 4CLLA 1S57A 2BKOA 3W65A 3GJQB 1C1CA 4C48A 2JLEA 5KFAA 4Z7CA 2BJ7A 5A6PA 3T41A 3HSDA 4JV1A 3HO1A 1EKRA 3LP2A 4M5HA 1OYEA 4J5OA 2XSFA 4KQZA 2XC9A 4EZ9A 2HVHA 1GT8A 1RAAB 1S1XA 1YVFA 2H51B 3A3PB 2WW4A 3SBMA 3VZIA 1XNQJ 4ZCIA 2YH1A 3MAQA 2ZM6F 1ZA1B 2FHOB 4KHMA 4PG6A 3I6PA 4C2MA 5C42B 2MGZB 2X1FA 1WHWA 2LFVA 3HX9A 5SZTA 2HWHA 5D0HA 2C2ZB 5KT7A 2IRYA 4EGLA 3H59A 4IG0A 1HWIA 2LVWA 3SCIE 2CZ9A 4NZ6A 3TWZA 1PYSB 2AX1A 2HVZA 3MMBB 4U95A 1V3RA 3Q22A 3UCUP 3Q24A 2AWZA 2LEBA 4PXBA 1UVLA 3WC0A 1EQMA 3AOAA 4LF7F 3CCJS 1UAWA 3JQKA 3ZZYA 2R7WA 5ETPA 3IGNA 5L39A 4NOHA 4W98A 2HQDA 4NLDA 1NH7A 4AT1B 2XHWA 1K9MT 3KHLA 4IDKA 4X65J 1F3FA 2YH0A 2V2ZA 2DK2A 3K8WA 2WK4A 2BRLA 4K5RA 3R5AA 3M6XA 4KYZA 4NMLA 1S1XB 2O01C 2XYGB 5K8NA 2CPEA 1NKCA 4URQU 4YDXA 3TANA 5F8HA 3DNCA 1FNOA 1H74A 2Z2ZA 3R3TA 2AEJA 1DURA 2QYGA 4K50A 1MG7A 5H9FK 2G2OA 1XR5A 1EIYB 4U7UK 4OX7A 2DH7A 3R2DJ 1RWVB 4YQWA 1RAGB 2RUGA 4FF1A 3PEHA 2MJNA 3AOCA 2PMWA 1RAJA 5EGYA 3WBZA 1CC7A 2E9TA 3QT7A 2ZUAA 3UN5A 2ALYB 1HPZB 4C8LA 3R6GB 3EXYA 4DFPA 1UTAA 2ATCB 2MZQA 4MFBA 2DCUB 4ZVPB 4ZLPA 4DFJA 4F4KA 2DHAA 1P1LA 4M5JA 1SQGA 3AODA 1YJRA 2HBYB 2KXHA 2BRKA 5DDOC 1NHUA 1S59A 3QLHA 5E41A 1D8ZA 3RAMA 2C3OA 1BGXT 4D3HA 5J1EB 2DNPA 2RQCA 2PGCA 2JVRA 3ITHB 3LP0A 4OYWA 1RTJA 1L3KA 3KKFA 2IMOA 4ZK7M 4JI6J 1TV6B 1JLFA 2UV8A 2N7YA 1IR0A 2W7OA 1U1KA 3A4TA 1IR1A 3A8KA 2XMJA 3MPVA 5AE3A 1XWLA 2VD3A 2AKWB 3KDOA 2KFYA 1IM6A 3D7SB 3OBIA 3G87A 3I31A 5KG4A 2ZHBA 2PFFB 3A8IA 3ZZOA 4YS2A 1ZTTA 1VR6A 4I2QB 2MYFA 3W2VA 3EJMA 4PWWA 2R7UA 4DZDA 4WFXA 1AT1B 4GO7X 5L1KA 1S99A 3ZTPA 1HR0F 3R1HA 3KHHA 3RRHA 1VIXA 2E1CA 4JI7J 2CG8A 4K4UA 2D3UA 2Q1LA 1Q78A 2QSFA 4FVCA 4PKDB 2HVDA 5I4MA 4DV0J 2UP1A 4ZVTB 2JEIA 2K1RA 2HFOA 1REGX 4C8ZA 4OFZA 4OZ5A 4X4UA 2R42A 4R8UA 1Y5IB 3MM8A 4PPDA 1VIOA 5B0EA 1TL1A 3D6FB 4WTYA 5EWFA 5CHCB 2V50A 1JLBB 1RADB 2B3TB 2XULA 3PACA 3TJ8A 1U1OA 1EJ7L 4DL6A 3PEJA 4ETXA 5CCMA 4MFBB 1QDUB 4DDFA 2MDAA 1TV6A 1TKTA 5J2PB 3HK2A 1JLGB 1S9GA 4RX6A 4U8VA 2W01A 1I6JA 2ZH7A 2YTCA 1RGVA 3IA0A 1FXLA 1K0TA 3LALA 3DI6B 1JLAB 3A3OB 2H5JB 3EVMA 2FZKB 3I0RA 4Q43A 5HLFB 3K0JA 2UUBJ 1FRKA 1QSLA 2RSQA 3CJSA 2CG4A 2EK6A 4O3NA 1WI8A 2ERRA 2WB1D 1AROP 1SH2A 1QE1A 2EKNA 3KLGA 1BXNA 2VFSA 3MR6A 1OPZA 2VPXB 3MM6A 4OZJA 4DEZA 2DR8A 3FCVA 3Q2SC 4UTGA 2DCLA 4DV1F 3H4DA 2ZHOA 4ID5A 2VOPA 1IBMF 1EB0A 1LW2B 3W9HA 2XO7A 3TJAA 4AL5A 1WG5A 1XMQJ 4OX9F 2LU1A 3MM8B 1F60B 1SC1B 2CQPA 3EE3A 4CTAA 5HSPA 3THTA 4IR9A 4GKKJ 4QQBA 4PCQA 2ZHAA 4NEZA 5IFMA 3M9OB 5KFHA 1JXLA 3L7OA 4DL2A 1DHMA 1DLOA 2ZBIA 3ILOA 3R7NB 1Y7PA 4RNNA 4OHYA 1B64A 3O1LA 1P8GA 2DNLA 2CQ0A 5F9NA 1S6QA 1SQEA 3C6UA 1IQZA 2HFNA 3LQVA 2DXEA 5JUMA 4JI1J 4FF4A 1YWXA 5M2PA 3IM9A 2CPJA 3FBCA 3ISND 2C2MB 2VB6A 3HLUA 5LM7E 4DS5A 1C4AA 2IAJA 2XNQA 4DR1J 2DGTA 1J5EJ 3HFZB 2ZKUA 4OHWA 1N32F 1FI4A 3AA9A 2RKIA 2MQMA 2HGLA 3DOKB 3CIZA 3M2VB 5B0CA 4QWCA 3HHNB 2ACYA 4FDFA 1H73A 2NXNA 4YY3F 2WVEA 3RR8A 1NSKL 4C8NA 1UKUA 4DUYJ 1S49A 4OLOA 4UUWA 1C1CB 2VQEF 1IKVB 1N5YA 2HHTA 1X60A 1X5TA 4DV7J 4ED5A 4DR3J 3MAAB 4Q0BA 2KI2A 4IFVA 2UXDJ 3B54A 2E5JA 5A2QU 3MD1A 1VK8A 1KVIA 1H72C 1XMBA 3IS9A 4F3QA 3QSYB 2W4CA 4B17A 3KXDA 2I6WA 2KFZA 1Y4ZB 1GMVA 5BR8F 3DLHA 3AXKA 2R8HA 3CDEA 2HK3A 4MIBA 4RBTA 2MGZA 2CQ3A 5MAOA 4B3TF 4U7UD 3QNWB 2BJDA 2C2DA 2KZMA 3DU6A 2FVPA 1F9FA 3TA1A 3C66A 2FQQB 2XMAA 4P2FA 2MPUA 4H4MA 5A6WA 4B9NA 1TVRA 4C97A 2RMLA 4K2XA 2RRBA 4OYIA 4ZVGA 4AXJA 4YR0A 3EZUA 1I94J 4LFAF 3EGZA 1N52B 3CD0A 5LSRA 2C2RA 1FRIA 4ZVOB 4DI6A 3A13A 4PQAA 4QBUA 4QWBA 2B5JA 2BE9B 2D74B 2MLXA 3GE9A 3OTDA 3DLBA 2PD1A 4CCHA 4IRCA 3GR0A 4Y28C 2B9WA 3Q8RB 3DMJA 1W7WA 3DLEB 2CQBA 2R2UA 4USMA 2BQ3A 2XI2A 2ZE2A 3EUNA 1YBTA 2QGFB 2Z0GA 3M6WA 4TY8A 4O3OA 1MMLA 1KHWA 3OHAA 2HNZA 4NCGA 2QA2A 5IV4A 4DZ6A 4ECUA 3B4DA 3FC9A 3IRXA 3NL0A 3GZ7A 3UD5A 4CLZA 1SC6A 4X4PA 4B02A 1T11A 2MQOA 1UVNA 5IT9U 3D0GE 5BYQA 5JXSA 1N6QB 2HW3A 4CLUA 3RW7A 5ETVA 4YY3J 2BBEA 1C2PA 3OTCA 3MR7A 3HP6A 4K4TA 1T03B 4AE5A 5KFTA 1VCTA 4DR7F 4EO8A 4RW9A 4NLXA 2VPZB 2HZAA 4ANCA 2YXLA 4NASA 4DR3F 5HVHA 2FDNA 4A47A 2R2RA 4CO1A 1TL4A 3GG0A 1R6VA 1MWQA 2H65B 4JUZA 5EX0A 1UPPA 1U1RA 1VOMA 4LSLB 1KNZA 2QO3A 4CLSA 4ZKAA 2BR0A 2RRNA 3F0NA 1LNQA 1RAHB 1RT2A 1BWVA 2C1EB 2QV6A 4LJMA 4F26A 3JSMA 2YKNA 3TAMB 2PN6A 5KFWA 3L7PA 2DGUA 1OY9A 3C19A 4X66F 1JLEA 2VG5B 5EX3A 1H7WA 3J80U 3DMJB 1U45A 4OJ3A 5KT3A 2RDDA 4A4JA 5FDLA 2GV1A 4HI1A 4YB1P 3CCQS 3V81A 3MTKA 5A8KA 3PX4A 2DR5A 4QIGA 2MLZA 3VGTA 2IMWP 1VRTA 4LVOP 1KTVA 1U26A 5FD1A 2VDHA 2C3MA 4NYPA 4LMZA 2DY1A 2KG0A 3HHLC 3IWNC 1DLOB 1RT7A 4CO0A 4EI2A 1VQ4S 1GXUA 3V6DA 3M6UA 1OQ6A 2B8QA 2PIIA 4XK8C 1N36F 4NLOA 2QN6B 4UQTA 4ES3A 4RR5A 5G0RA 4LR7A 4YN3B 4QPTA 2ZBCA 3PYDA 1SJQA 3R9LA 3TEHB 4E0DA 2A6OA 3RAQA 3H5UA 1YX2A 3BREA 2K3IA 3GFHA 2GA7A 1RT4B 1IWGA 3LGNA 3P4UB 3QO9A 4TLQA 3TP2A 5IT4A 2YKOA 2LQ5A 1ZA2B 1L3SA 4C8MA 2B6AA 2CPZA 2FHJA 2ZH9A 5D0EA 1RHUB 3KHRA 4WXWA 3HHLB 1NDPA 2XQCA 3BKTA 3HXMA 2AZ3A 4KGVB 3UWTA 1T8EA 4OYPA 3CCMS 3ETMA 3AY0A 2HMIA 4FYVB 2JC1A 4TKTA 4DBQA 5L1JA 3KK3A 3G71S 1WG1A 2M5YA 2IJFA 4Y3CA 1U47A 4LF8J 2C42A 5D0GA 5D0RA 1FRMA 5DRKA 2J0SD 3SCKE 1QM9A 5HVFA 1O8BA 2CVIA 2MJUA 2V63A 4RW7A 5GAHI 5HQ8A 1TL3B 1NPRA 4AXIA 3B4MA 1AUDA 2JHEA 2R8GA 2I38A 3MOJB 3SQGB 2DNRA 4FNHA 3US5A 1BLUA 1L5UA 5DLGA 4XDDA 2EXUA 4ED4A 2KRBA 5FDLB 1U8SA 2UXCF 2HGMA 2YWHA 3LGMA 3DYAA 2QLWA 2OFGX 1M0SA 2IM1A 4FPIA 1QUPA 2R7XA 4W90B 2YKMB 5KFCA 2ZVSA 2IYGA 2CQGA 1HYSA 1YJUA 1VC0A 1HBUB 4BWMA 4HACA 5KFMA 3MEGB 3N5FA 4I64A 4ECVA 1NPKA 2DNGA 4EBEA 3RR7A 3PW0A 5T14A 3CCVS 1YZ7A 1IQTA 3M8PA 1G7CB 2NPIA 4OZ0A 3HHLA 3KNGA 2EC0A 1X5SA 3MD3A 4WIIA 2XMUA 3OL7A 4GMKA 5T7LA 3G8QA 1PC4A 1YQHA 5KG5A 2AU0A 3W2VB 2A2CA 3BS9A 3HFVA 5J1NA 3BBFA 1RE1B 4ZLJA 2J7KA 2BZ2A 1N6QA 3C46A 1S1TA 2D3OR 3DRRB 3J81U 3FBBA 3MEEB 4M5IA 1KQKA 3WX8A 1TKXA 2P9GA 2NYIA 4X4OA 2EI5A 4KO0A 2YWEA 1PYTA 1NJIT 5DQGA 1VHFA 2YWGA 2PI5A 3AQPA 3MR2A 1FX4A 3M8QB 3TAQA 1NB7A 3QT6A 3RYLA 4OHVA 4F3OA 4ILRA 4UOGA 1WDTA 2OPPB 2QX0A 4UOHA 3T6JA 2BM1A 3P5TL 2QMXA 4TXSA 2CQCA 2VU5A 2JEFA 1TK8A 1T0TV 1T05A 2ZZTA 5KFZA 3KMQA 2OIHA 4DWIA 1D09B 1B7YB 2Q79A 4M63A 2F4VF 4ZDNA 3UN3A 4CRJA 4NMXA 2VFUA 2KL8A 5E0OA 1IBLF 2ZNZA 3CC2S 3X3UA 3FBFA 4PQUB 3DFEA 2BABA 3DGPA 2MY8A 2IHR1 4TN2A 1PGZA 4ECSA 3VAKA 4LF5J 4UY85 2FPHX 1B0PA 1Y00A 3HI9A 2FVCA 3QT5A 1OO0B 3NBPB 4ETZA 1N48A 2JOQA 2AYEA 1XMQF 5ETMA 3K89A 2E5LF 1CBKA 1T95A 2GNKA 2HQFA 2LCWA 3PCOB 4A8OA 2OSRA 2M9KA 2IJRA 4JI8J 3QRRA 4GKKF 1K44A 1AFJA 2MZRA 2OEMA 1X9MA 4AD6A 2HZCA 3VTIA 4CLKA 2ZFHA 2VIHA 3OW2R 3OR2B 2OH2A 3BSCA 1U0HB 3HVRA 4DL5A 4UOCA 3MM7B 1HQ2A 3DRRA 3PVXA 1M5PC 1IBCB 1DTQA 1Q8BA 2A0FB 2KYZA 1W26A 2KN4A 3CD5A 1RT3B 3QRPA 2BEFA 2H5EA 2L48A 3OUYB 3W3SA 5HL7Q 2ZJRQ 1Z4UA 2XS7A 2Y0SD 4DX6A 3IM8A 3M2RA 3M8QA 5HQMA 3LAKA 2Y1LB 1NH8A 2HSEB 1P9QC 3ENQA 3KLIA 4HR2A 1X4CA 2V8DA 4NLRA 5L1LA 2FJXA 3J81Y 1FWKA 2V4JB 1RHRB 4Y6IA 2ASLA 4JI4F 3UD4P 4GO5X 4H4OB 4LF9F 1WTFA 2MLYA 3CT9A 4YDDB 4Q2LA 3U02A 3NGDA 2AGQA 1ZAWA 4RW7B 1YIJS 5D4OA 5FJ4A 5HO4A 4ED7A 3M8SA 2DGWA 3OLBA 2VDIA 2V5HG 1E6YA 2G1DA 2D9PA 3GB0A 1QVGR 2LYVA 2M70A 3MHYA 4PG5A 4J90A 3ULHA 3EPGA 1BUXA 2D3O1 1T03A 1SQFA 3PJWA 2BQRA 4J9VA 3L7UA 1RZMA 4ANEA 2HHSA 5IV3A 3C14A 2HAIA 2G0JA 1YI2S 2O66A 2DNOA 1N5YB 1B3TA 2H48B 1LQ9A 1R8BA 2FJEB 4DV4J 1HIYA 2UUAJ 4EEYA 3G4SS 1F5CA 1Q53A 1S0VA 3A1YG 3ZC4A 2CJYB 2HFZA 5KFQA 4M5GA 2AZ1A 4PXEA 2EVZA 2ZH2A 1Z1ZA 5IT9Y 3BN4A 4RNFA 3NEKA 4G6VB 4I7FA 3KK1B 3ZZPA 2WONA 1IJFB 3DOMA 3QFHA 3G8TA 3D67A 1CLFA 1H7XA 2OELA 1SBRA 2W2QP 2CWKA 3HULA 3TA0A 1SC4B 1JJ4A 3NNHA 1SKWA 2QA1A 3OR2A 4NLPA 5IXUA 2ZOMA 3M8YA 2V8VA 3U1LA 4WFBQ 3CJ3A 4ANDA 3P3DA 1X9SA 1G2EA 2FC9A 3CJ5A 4A8MP 1WSRA 2GO8A 4LSNA 3FEXB 3CSKA 1RTDB 3PIPQ 3SV3A 2Q3PA 2LEAA 4DV5F 3CVKA 2W8KA 1F9EB 1S9EB 1KKHA 2OPSB 2BUNA 3HVTB 3QYYA 5CYQB 1NK4A 3AQOA 2I9SA 1DAXA 2CQIA 1XK8A 3A12A 3MOZA 3W2WA 4QWEA 3PM9A 4MH8A 3R5GA 2FHJD 5HMYA 3IRXB 1WTBA 3BKFA 3Q8SB 2X3GA 3M7VA 2D7SA 5J2NA 1SKRA 3GILA 1WOOA 2ASYA 3DKDA 4N77A 2GCFA 3RRKA 3Q86A 2OPRA 3CCRS 3DRSA 3DRPA 3CD6S 3EYZA 2XNRA 4PG7A 4OMFG 4RW6B 4DFKA 2N7CA 4BC7A 1QD1A 4OZ3A 3BO2A 1MNEA 3H5SA 5KFOA 3LWLA 3T5LA 3UCZP 3M1VA 5KFBA 4B9MA 2JC0A 1M5SA 1UCNA 1EX8A 4K4XA 1YBUA 1RUSA 2DIVA 2Z2YB 1WF2A 1YBAA 3LUYA 1O0PA 2ACMA 3E8OA 1S6UA 4KHPJ 5IOLA 1FF2A 1FO1A 1S48A 3N01A 4NLYA 3SQGA 3D9BA 1NK8A 5DJBA 3IR5B 1KQSR 4YMEA 3JB9k 4NCBA 4DPTA 3R97A 1KDNA 3HVTA 5F41A 1S76D 1FXRA 4NZ7A 1M1GA 1R3NA 2HNZB 3V6JA 3SI8A 3CPWR 2KM8B 2LA6A 2FHMA 3IBWA 3DCAA 1RA7A 3GP9A 4I4BA 3MCOA 4WWSA 1JJ2R 3JSYA 3N5BA 1UW4A 3PO4A 3T1YJ 4CDIA 4WFAQ 1CC8A 1R7IA 2GQ2A 2CNKB 5C24A 3DXBA 3GV8B 4QW9A 4K4ZA 2V94A 4DPXA 3BDEA 2QL9B 2RE1A 4M5NA 4OIXA 4RW9B 3K5NA 3EPIA 5I42A 1DQ8A 1IM4A 2G13A 3PTWA 2F5GA 3NG8A 2IM0A 4ZN3A 1UP1A 4HTIA 3ADAC 4JOUA 2NCKL 4ZMMA 5A0YB 2FZCB 2BV3A 4LF6F 5CA5A 4TYAA 4DPUA 4IOBA 2XTJP 2D41A 1FESA 1S6PA 2MZ1A 1S0MA 2GC8A 3A8JA 4MKVA 5CAAA 2G1HA 1XR6A 1YRTA 4CQ1A 3FK4A 2CZVC 1NAQA 4MK7A 1N5SA 3S1TA 3W8PA 4CM0A 2OPQB 2VICA 3GV5B 1ZZNA 3TUPA 1U2RA 5KT6A 4OZ2A 1T02A 3FRYA 2GMLA 4Q8EA 2JVOA 5BJRA 3HD1A 3JTOA 3NGRA 1UW9A 4ZPAA 4LR9A 1RACB 1VLOA 4LSZB 4ERDA 1YLXA 5D77A 4MTPA 4UT4A 2XY7A 1QTMA 4KHPF 3POTA 2YKAA 2KFNA 3KG1A 1RSCA 3H90A 4MYTA 1ZS6A 1AYEA 2QYCA 4NLQA 3GV7B 2V9WA 5T41A 4ES1A 1DFDA 4CIOA 4ILMA 1IKXB 2V9KA 1NPPA 1WDDA 1X5PA 2YKQA 3CGIA 2J7WA 1FFSB 5IC4B 4OYAA 5AE1A 4WZMA 3SSSA 4PRFA 4DV1J 2IDEA 1V3ZA 2IPOB 2YKPA 1IBMJ 1WC0A 5F3ZA 1RT4A 1RT1A 1UVKA 1X8DA 5IS2A 5I3UB 3T1HF 1RWKB 1ZZFA 1B70B 1RTDA 4JI3F 3QJLA 4QWAA 2NSCA 3GPAA 3BPDA 4PG4A 3IFEA 1LWFB 4BCAA 4X62J 5AJ3J 4DLEA 3K5MA 2OPSA 2W9AA 4DXLA 1F1BB 1VQ9S 3D3CJ 4LRDA 3D2WA 2FLPA 2E29A 4ZP9A 2IM3A 4NLSA 4ECTA 4GKJF 4FXVA 4USWA 1CJVA 4RUCA 4OHZA 1RAEB 2N4CA 3CDUA 4B3RF 2EBGA 1S6PB 3EGNA 5B0BA 2H4WB 3DLGA 3HHKA 2DB1A 4M5LA 4TQSA 3J7Z5 3FSIA 4FXDA 4UZBA 1EETA 4KHRA 1ZM3A 1K0VA 3N6NA 3KK2A 1M1KT 4DR2J 2KT2A 3HT0A 4F0KA 1RBLA 1N4LA 2YKNB 1C4CA 1Z2LA 2WBRA 3FKBA 3S7RA 2XZDB 2FLNA 3KTQA 3OTEA 4IKAA 2VODA 1LWEB 4U96A 3UCGA 2MXYA 2L9WA 2HK2A 3CJRA 3ZZUA 5LL6d 4Q45A 3PV8A 3OXGA 3G2XA 3ZTRA 2MQPA 1T7PA 5LMUJ 4ATNA 4B3MF 2FB0A 3HCXA 4QR0A 2NXJA 1R8CA 2CZ4A 3N6LA 4DV7F 4NXNF 2EK1A 3D5MA 3V2UC 1Q79A 2VC1A 4X4QA 1XNRF 2M0GB 1YSJA 5L1IA 5LMNJ 2CQHA 1PAUB 5C25B 4WPAA 1RTHB 1JNRB 3M8WA 2BJ3A 2LQBA 3IN5A 1GAOA 1LK7A 5DDPC 1OY6A 2GGPA 2UXBF 3DC2A 3HHEA 1FTCA 4DQPA 2QMUB 5C24B 1JJHA 1RWOB 2WONB 1DQAA 4P75A 5B0FA 5KG3A 2UU9J 1KLNA 1FVSA 3K7RA 1WACA 1R0BG 1Y9OA 3MMJA 2V0NA 2GMHA 2HVEA 4URGA 1FD8A 2XYHB 4YR2A 1U6ZA 3H2VE 2ZOFA 2CKWA 2KH9A 1YJWS 2NUHA 2Y1RI 2AX0A 4IO1A 4KFBB 4DR6F 5GMDA 3ILLA 4XPCA 2MKSA 4MK8A 3CJKB 2RQMA 2UUCF 5D15A 1S9EA 5CYQA 3K58A 3CJTA 1B99A 3D1OA 2NXUA 3I5CA 4NEYA 5GAGU 2V69A 2V67A 4ELTA 3NCRA 1C0TB 3NKYA 2V4RA 3ITHA 3K2YA 3KDNA 3LP0B 3SIPB 3AAWB 3Q8QB 2WTFA 3U1NA 1U1NA 2YKMA 3D6HB 3MECA 2VJVA 2HHPA 4XTTA 4MIAA 2ZH4A 3TX8A 4DF8A 3CC4S 2P9CA 3ZXWA 3M2VA 1FXDA 2HQGA 3O3LA 1PKUA 4J9RA 2HBZB 4HVZA 4X2BA 4R0JA 5LSLA 1TUGB 2WVFA 2JH3A 2Z58B 1KQGB 2L3MA 3CDAA 3HZEA 2JSXA 2CJBA 2H9ZA 5KFGA 2N3OA 3OJSA 3ELHA 3HJFA 2E5IA 1Q8IA 1HL6A 1VBXA 4JI5F 3G6YA 2D3ZA 4UQGA 3CCUS 4E8UA 1HNXJ 1GEHA 3D0HE 2MHNA 2IA6A 4DPOA 3NOGA 4J91A 5L9XA 4PG8A 1WOPA 2XGQA 4NA2A 3H5YA 1VBZA 2CJXB 3LA0A 3NCQA 3CXCR 2OTJS 4KGXB 2HKEA 1IKWA 1HA1A 1TKXB 4DN9A 2YWKA 4WXOA 2E1AA 4P9SA 1VRUB 1SB6A 3R7BB 5EHHA 1APSA 3R1LA 2HZVA 4ED2A 4F0MA 1TFYA 2FJBB 4YEAA 2OI2A 1MU2A 5DG9A 2CQ2A 3FVYA 4ENOA 4C8KA 1SH0A 1X7VA 3QPIA 3OJUA 1TKDA 2XB2D 1PBAA 2VONA 1GX6A 3THVA 4Y00A 3KLHA 3TVKA 2ZJQQ 3BQ1A 9ATCB 1JX4A 1E6VA 1RTIA 2HHXA 3VGVA 4TVAB 3AT1B 1RHJB 2E9RX 4BWJA 1LWCB 4OI1A 3UNGC 2ZE2B 1HARA 4JV5F 4FF3A 2GVDA 1HKAA 1KHVA 4B3OB 4MKYA 5KFRA 2VL1A 2BACA 3FFIB 4MMOA 4AUKA 1RISA 4BHQA 3MMCB 3Q23A 4RUAA 2FVRA 2Z30B 3IAM9 1Q7YT 2R8KA 4MKBA 2DH8A 2KHDA 1JLFB 3TVZA 1KEKA 1WEYA 4O0IA 3CCSS 3RGIA 1M5OC 1URNA 2IA0A 1WI6A 2JL9A 3FUYA 1Q4RA 3W9IA 2ZH5A 1REVB 3QGIA 1FCAA 3G6VA 2R8IA 2XS5A 1LWXA 4ZVSB 3H4BA 4IG3B 4O3SA 1CEZA 4JYAF 2AT1B 2XHCA 5KT4A 3D0IE 3M1VB 3MAAA 1U4BA 1SPBP 3MPYA 1UEKA 1NNDA 8ATCB 4KGMA 2ALZA 4S0MA 3IO1A 2E1PA 1A6LA 2KYXA 4RZRA 3JSMB 3MI7X 2EFNA 5C2GA 2F4FA 1NK7A 3LH2S 4KV8A 1K1QA 2VUGA 4Y65A 4X64F 2CQDA 1FWPA 2VASA 3D68A 2AIRB 3PRBA 2GHPA 3TUZC 2MHEA 1U1QA 2B4VA 4R8UB 1QY7A 1NSAA 3KLIB 2O1PA 2N82B 2B7CB 2VC0A 4WE1B 2PSZA 2IAJB 4C0HA 2DTJA 3AXMA 1N0VC 3BM7A 4ZVHA 1VQSA 2WOMA 1VK3A 3BBBA 5DG7A 1CULB 1HNIA 5DDQC 4DJBA 1QSSA 2G9OA 1PSDA 3A3NB 1CJKB 1ZAVA 2RS2A 1NK0A 4H54A 3RUBL 2QTWA 3I0RB 5K8PA 3DN9A 2PA3A 4J9UE 1S9FA 2KRRA 2CDQA 2W9BA 1TMJA 1RU2A 1N34J 1VQ8S 3IS9B 4RUHA 3G8SA 4ECZA 2HFSA 2NZ4A 1HWUA 1R31A 4QIEA 1TKZA 3R6LB 2HS3A 2EFGA 2C2OB 2VG6A 1HBOA 3I9ZA 1H0HB 3PO5A 1UJ4A 4KV8B 1RA6A 5CABA 3GFZA 3BR8A 4N8OA 1K73T 4JYAJ 3ILIA 2XMMA 4WK3A 3DLJA 3EZ5A 4HT7A 1J5OA 4OLPA 3OHBA 4CP5A 3QRQA 2C3UA 5E3QA 4DMZA 3Q8PB 1NZ8A 3Q8YA 4YR3A 1RWPB 1U2CA 3THPA 3QT8A 3MEDB 4RLEA 1N32J 4LFBF 2KU7A 4DX5A 3MEKA 4C98A 1S4FA 2DH9A 2DNNA 5K8OA 2ZM6J 5H9EJ 1UVMA 5ETOA 1KFDA 3UPFA 2JFDA 3ET6B 2XCPA 4EMDA 1UFLA 4NX9A 1FK9A 1JB0C 1MN7A 3QATA 5KG7A 1RTHA 1XJWB 4PYDA 1SV5A 3KG4A 2JZ5A 2LQ8A 1BE4A 1OIAA 3GSIA 2VKRA 4EWTA 2PEHA 4I6WA 3VAIA 3JS9A 4AYBD 3P5BP 4M5DA 1Q7LB 2FJDB 2IFXA 3PRDA 3KJVB 4J9NA 2BJEA 4DL7A 4RWXA 5J2QB 3A8EA 3OR1A 4Y2AA 3Q8UA 1V5VA 5DM7Q 3TW0A 2KTQA 1RTIB 2B51A 2PEBA 1GMWA 1RAFB 4P2XA 3PRVA 1WOSA 4LRBA 1L3TA 2RH3A 2W25A 4FPRA 1FJGF 4AL6A 3K5OA 3MGJA 2MZSA 4ITSA 4C0OC 2RDIA 2D69A 3IR6B 1T9YA 3PYFA 3MPUB 2WVBA 4AL7A 2C22A 2ATLA 1I94F 5LJ5Y 2DGQA 5HROB 1G1XA 4DCPB 1JJCB 3N9UC 4ZP8A 2CPFA 4F0HA 3DLGB 3NXZA 4EO6A 2UVVA 3RW6A 4LT6A 2X1AA 1SJ3P 1VHIA 3GFXA 3KUEA 1G4CA 2E7XA 2Y1IA 1REVA 1ZYQA 3ET6A 3HSGA 4LF2A 4Q8FA 2DRDA 4B3MJ 1CQMA 4Q7AA 3SDEB 1S0NA 3ZNUA 5C5JA 1LWEA 3UDEA 1M5VC 1UJ6A 4NXNJ 2E7VA 2ZZMA 4EU0A 1TL7B 4IR1A 2HURA 4DR4J 1TTHB 2R7OA 4I6AA 1SJ4P 3F73A 2P6SA 1L3UA 3AB2B 4DSLA 2F65A 4LIRA 2YNIB 4CM2A 1YJVA 1YRUA 3FCWA 3W1YC 1Y0HA 2FUG9 2HRUA 4EYIB 1T9TA 5GADI 1S72S 1SJFA 1HQUB 3JYTA 1FNXH 4NXMF 5DDRC 4QWDA 4QYZJ 4L73A 5KFSA 2BKNA 4EBDA 2HEKA 1B4SA 1I3OB 2U2FA 7FD1A 4DX7A 5ITHA 3MM5B 3MM9A 4ICLB 4J37A 1X4GA 4J9OA 2W2PP 3MDFA 4ZPVR 1HW9A 2HG4A 4TU9A 4A48A 2LU2A 4HT5A 5B7WA 2LEPA 4ZCLA 2LXUA 4PWDA 1QUVA 2ZD1B 3CJQA 2YPYA 5HAOA 2VV5A 3E51A 3W5XA 4GC6A 2XZTB 2MQLA 5C2CA 3QZ7A 1I1GA 4F02A 1CS4B 1S7IA 2IY5B 2NXEA 1QSYA 5LT5A 4DV5J 5HROA 1KR4A 1FKAF 4P72A 3T6BA 4OZLA 2M88A 3BJYA 4ZS6A 1HI1A 5LSOA 4F67A 2UUAF 3Q0AA 4B3SJ 3W7BA 3HT3A 1NXIA 2MKYA 1EP4B 4LREA 2LECA 1E6VB 3FBEA 4DV3F 3L4BC 4Q2MA 1VC5A 3OTOJ 3V5RA 5AXKA 1J2VA 1LFPA 3SDEA 1X31C 3BSOA 3G9CA 4UF4A 4YHHJ 4A8KA 1SKSA 1T3NA 1TMMA 4DV2F 5HLFA 3EDQB 4ZLNA 4WKRA 2F8HA 2LA4A 2Z8QA 3CCWA 4GC7A 3PW7A 1AXQA 3BGRB 3BGOP 3E01A 3GIRA 2OTLS 4BS2A 3EGWB 1SIZA 2DHSA 3E3XA 2HWTA 5C7PA 1SC3B 2AJ1A 2HVIA 1NO8A 4PEOA 4PXCA 5L38A 3AD7C 1PILA 2XM3A 2ZDOA 3KHGA 2KJWA 3DI6A 1S1UA 3TEGA 3V4IB 1RT5A 3VQSA 2DNZA 2RHQB 2FVQA 4EZ6A 4CYUB 4NXMJ 2NR0A 4IG3A 4A8WA 1VBYA 1GX5A 1G6BA 2BE2A 3CJ8A 2DR9A 5F3TA 3W63A 2LKZA 2XI3A 3T5KA 3IG1A 1WHXA 4CTAB 3OR1B 1DTTB 2WHOA 3QO9B 2LXIA 2C3PA 2JFKA 1WC3A 1CPZA 1EETB 3LF0A 2EFOA 1S1VB 2B6AB 2V2KA 2VZ9A 3QSIA 2A10A 3BYRA 3PIOQ 2N4DA 4FS1A 1K47A 3W64A 5IM0A 2IC3B 4HHUA 4ECYA 2YQ3A 2HHVA 1B0VA 5CYJA 2IVYA 2J0WA 2G2ZA 1C0TA 3LTOA 3EWGA 4I56A 4QW8A 4LUBA 3JTPA 4IH5A 3OL8A 1K8AT 2RU9A 2YWWA 3TVYA 3TO8A 1Q81T 3BDPA 3J80Y 1O6XA 1AFIA 1FRXA 4RWWA 3PW5A 1H38A 3RU0A 1JKHB 1N54B 1DJ0A 4WFNQ 4DV3J 3M30B 3KLHB 1GXTA 5J2MB 5M2RA 4LQ3A 1BWEA 2V6AA 2RF2B 2VBWA 1N5TA 2FD2A 1KS2A 4N47A 4A8QA 3KWMA 2MKKA 2BANA 3S6EA 2Z4PA 2F1FA 2QFJA 2QLFB 1RT6A 2VG7A 4NLUA 2JEGA 5D78A 4EK2A 1RP5A 2YQ0A 3MUMP 4WKYA 4DF4A 3TYTA 1HBUA 1MWZA 2M2BA 2QLXA 1NCLA 2J0QD 5LXRA 4OYXA 3GR1A 4F36A 5MLCV 4J9KA 2M3DA 1N88A 3M8ZA 2HNYB 3J7YU 4DUYF 4ED8A 4HLBA 4JI1F 3IR7B 2I1RA 2GZOA 4QR1A 4JP8A 3QAEA 4I2QA 2OD4A 2DXDA 3DLKA 4A46A 2OLWA 1RKJA 2GQCA 2V34A 4J7CA 1VRQC 4Y2KA 2Q66A 4YOEA 2J9CA 3VAJA 3OSPA 1H2TZ 3PZPA 1NHKL 5HMZA 1KP6A 4CLFA 2B7BB 1Q95G 3M32A 3OFHA 4K4VA 2AJFE 1P1TA 2YX7A 4YB5A 5KFXA 3H5XA 3GIJA 4LF5F 2EW9A 2HHUA 2KVIA 1YTYA 2ROEA 4G1QB 1N33F 2H1YA 1MN9A 3M2RB 5GAGI 3CUNA 1RXOB 2XYPB 2DBBA 3GLJA 3ISNC 1ZM2A 3PYEA 4RL1A 3WQPA 1J27A 3KLFB 1NDLA 4FNIA 3KJNB 4J9PA 4ECWA 1Q86T 3IRWP 4KAIA 4IOAQ 3ENWA 1HD0A 2AEFA 5A8WA 1WWHA 2V8GA 1ICEB 3AHPA 3DRYA 3J7AN 1MROB 1VQMS 2V68A 1LXNA 2SXLA 3HHLD 2I0XA 1JLQB 2AJ4A 3VGUA 1RLCL 5KTQA 1SIWB 3F56A 3RBEA 2PO4A 2BANB 2DGSA 1IKYA 2GQQA 3PFOA 2DNYA 5CYMA 4CO5A 4RNMA 2WZ1A 3QGGA 2KZZA 4DR2F 5I3QA 3VQTA 2YNFB 1CJTB 2LMIA 3QWPA 5KFEA 2XWYA 2CPXA 2HPUA 1HI0P 1DRZA 5DZ6A 5HJXA 2DGXA 2CNOB 3IGVA 5KFDA 4JI0J 1JIHA 2GX8A 4WJBA 4ZVQB 5DG8A 2XZWA 3MM6B 4R5PA 2NSBA 3D28A 2OMLA 5HI7A 3C16A 5H9FJ 3FSXA 2MZJA 3CMAS 4DR7J 2L08A 1D8YA 2IRXA 4F4YA 1SUQB 2JWNA 2GW8A 4K5SA 4K8RA 4M5KA 4MAKA 5B09A 3QJJA 3DLKB 3FNNA 1SL0A 3CWJA 3CMQA 1PYOB 2GJ2A 2NPFA 2ZDPA 2QE5A 3KUGA 4OI0A 5ETNA 4O23A 1S6OA 3HFKA 3B6BA 2U1AA 2R7VA 3AFGA 4WU3A 1MROA 1Q8LA 3L3CA 1HBNA 2VOOA 4NI2B 2HGNA 3ETOA 3GCXP 3IWXA 3LW5C 5I3PA 3UNYA 1T9UA 1V3SA 3KLFA 4ECRA 2MKJA 4K4WA 1RBAA 4L76A 2J9DA 1HHSA 2JRSA 2X7IA 3ONQA 4OV6A 3UDCA 1XR7A 4DPYA 4DCOB 4K4YA 5IWAF 4UW2A 5A8WB 1LKZA 2MQQA 2VH7A 3J7ZT 4R25A 2KXNB 2OJ3A 2B56A 3Q89A 3W66A 3CJ2A 3CIMA 5CD4A 3M30A 4M5MA 2RU3A 4J9QA 5J2MA 1ROFA 5EWGA 3TNVA 3V6DB 1WEZA 4RNOA 4DHVA 4M94A 3LOUA 4ZHRB 3FSYA 1IWAA 2MZTA 1D3WA 1X0PA 2KT3A 2O3DA 4FKYA 5ADZA 1ZPVA 4IFVB 4NCGB 4C7QA 2XMVA 4DCJB 4L3NA 4ED0A 4I69A 4HHHA 1UZDA 3S8SA 2R2TA 2QLJB 3M2UA 3VAGA 3OQ2A 3PR4A 4KKOA 3UD3P 1IUJA 2EG2A 5CZVA 1P27B 1YJNS 2L9DA 4NI2A 2BM0A 2EEYA 5KFUA 1HHTP 3AD8C 2CDRB 4KT0C 1PG5B 2HIYA 5K5MA 5J1EA 1DZ5A 2AYBA 2LQJA 4BDPA 2UXCJ 1FFWB 2XLKA 3UE2A 4P10A 1F2HA 2W1BA 5HP1A 1FJEB 4J9MA 2YQ1A 2KM8C 1U49A 5J2QA 2ZITA 1HW8A 4TU8A 4XIUA 3BEGB 1SH3A 4JBCA 2XY6A 4HH1A 1OSCA 2DR7A 3G86A 4CNZA 1NDKA 1HQUA 5ETLA 3JYTB 2JLGA 2MQNA 2P5VA 4KSEB 3UVJB 2ADCA 2J0XA 3QIPA 1QJHA 4CO4A 3KOAA 2CRLA 3LP2B 2CVEA 2R2SA 3BO3A 4K2JA 3VCDA 3NWGA 4PXDA 5K14B 1N5QA 1V9OA 4ECQA 1U7LA 3O2IA 5F8MA 3LP1B 2QA4G 4I0WA 2E5GA 1TKZB 3H98A 3M2UB 3OLAA 2M8DB 3NNAA 3VAHA 4NLGA 4USUA 3G6ES 1GXLA 2V8PA 4V19X 2FHKA 2I5JB 1XC9A 5E3AA 1HLWA 4OI2A 1O5JA 1CS4A 4LRCA 2F3JA 1PC5A 3HHDA 3WIUA 3JTNA 2J7UA 5CZXA 3S01A 5M2UA 3T1YF 2ASDA 1IVZA 2OEKA 4OL8A 1T3OA 5KFVA 4DV2J 1HD1A 1WC6A 1M90T 2WSCC 1WC5A 3AJ1A 3RTVA 3DHXA 3GSDA 4IQMA 1TZ0A 5KFIA 5HANA 1NU4A 2UVRA 2WW8A 1Y3KA 4Y2IA 4BC9A 1NJYA 4PUOA 1LFWA 2A18A 1WG4A 2YNGA 3GTYX 3IBCB 2F9DA 4TNOA 3NMAA 3UO0A 5DGAA 5GAHU 4B9LA 4X4RA 1ZH5A 1FVQA 2ZH6A 1HBNB 1R8AA 5THWA 3I9V9 1C0UA 5DETA 4O3QA 3GIMA 4OYMA 1N8RT 3K5PA 4I67A 1C1BA 2CIMA 2KT5A 4I68A 1Y10A 5KOXA 3D3BJ 3DYAB 3BKUA 2XMKA 4X64J 4KPCA 3D1QA 1F2GA 4ZIVA 2UUTA 3L9ZA 3R8YA 5IZHA 4ZCKA 2E1MC 4IFYB 2DVIA 3EVWA 2UXDF 1RWUA 1X4HA 2EWHA 3H7HB 4DQSA 4JI3J 3K57A 4DQQA 4O4RA 5D4LA 1VGYA 1IBLJ 3BGFA 4IRKA 2VFRA 4HEA9 4JV2A 4KE5A 2G4BA 3QLHB 1HBMA 4L74A 1KTQA 2R3VA 3GJRB 5G4DA 3RBXA 1ZPWX 4U8YA 5FLXY 1RDRA 3IAS9 3K8VA 4UUXA 3D1HA 2M7SA 4F04B 3OVAA 1X4DA 3CEDA 3BGRA 2CJAA 1NJXA 2XGPA 2FGCA 1T9XA 4KBIA 1TU0B 1SXLA 4NL5A 1RT2B 1JKHA 2F7VA 5ETKA 1FRJA 4WYLA 2KKHA 3QBCA 4CWBA 1S79A 3SFUA 2KXFA 3C8YA 1BQNB 3EZOA 2Z2MA 2VA2A 1A0OB 2ILYA 3Q8VA 4LVNP 2PA8D 1YKWA 1TUVA 2JEJA 2MQ8A 3M05A 3GYNA 4RO0A 2QEXS 1HNVA 1LW0A 3I87A 3TJ9A 3NS5A 3CC7S 1EKSA 3TOQA 4CLPA 2XSJA 4IDKB 4X65F 3GIIA 2RDJA 1Q5VA 5JJBA 4IH7A 4WP3A 2CYYA 2PMZD 2XY5A 1LWFA 2MSTA 3CTRA 2ADBA 4ZP6A 1BQMB 2ZD1A 4ZP7A 4QZVB 5IC6B 1VQPS 2V2VA 3GYXB 1YG0A 2J5AA 4EBCA 2QG9B 2OKQA 2DR6A 5B0DA 2J8AA 3DOMB 2AHOB 2BYCA 1CG2A 4HHJA 3F44A 3Q83A 3VAMA 2BVZA 2HRYA 3TA2A 5LMUF 4FXWA 2Y3YA 2WVCA 2XLIA 2FLOA 2PT0A 4PQUA 1OWXA 1OSDA 2DT9A 2RHSB 3HSZA 4KFBA 3TUJC 3V6KA 5F8LA 2IDLA 2B5JB 3M32B 3C6TA 5L46A 2UZAA 3M9MB 3SV4A 4KR0B 3LP1A 1M5KC 4QU6A 4RBVA 3VVUA 3W8GA 2YX4A 3DU5A 3L95X 1U1PA 2E44A 1GTEA 3C15A 4OI6A 2Y8YA 4MIWA 3GONA 2HBQB 4ED6A 1Y11A 2CPIA 3ENAA 3PX0A 3PFEA 4DLGA 1S77D 4USJC 1RK8A 3JSRA 5HVGA 1PAEX 2QFIA 2GAGC 2H5IB 3FEYB 5EDWA 5A2QY 3MFHA 1Q82T 1MSWD 3OVSA 1FRLA 4PABA 4CT8A 3ILJA 1IBKJ 1NBEB 5DZ7A 4XO0A 4JI6F 3OT9A 3GU0A 2EKYA 1HNIB 3EDRB 4OZNA 3VALA 1TL3A 5DLFA 5HBMB 1D9AA 1RCXB 3QFWA 4OQJA 2XSJB 3CD7A 3UFCX 2XO6A 2UVUA 1P9YA 1XQIA 1HR0J 1F5AA 2CQ1A 2C3YA 3TI0A 1CVJA 1LWCA 1S1UB 4USIA 4ID8A 3W2WB 3BO4A 3OXLA 5KG1A 4RW6A 2C2KB 3PHTA 2HNDB 3VR1A 5DGBA 2MKIA 2ROPA 4X4SA 4O4GA 1S0OA 1Y5LB 5AXMA 1PJ7A 1B0TA 4MKAA 1AA1B 2GAHC 5J2NB 5CCLA 5KFYA 5ETRA 4DL4A 2QT7A 4FVMA 3NOCA 2MKHA 4ED1A 3DRPB 2GS8A 4L3KA 1GQEA 2RUSA 1RYSA 1V5IB 1BMQB 2ZUGA 2X1BA 1FDNA 3NGUA 4HDHA 4WZQA 4RPFA 3O5TB 2ZJPQ 4DUZJ 4TY9A 1WC1A 4USTA 1H2VZ 1U0HA 1YHQS 2AJ0A 2CPHA 4B3OA 4OYBA 4JI5J 3NMRA 1FERA 1PJ5A 1FNMA 1TL5A 2LQ9A 1D1UA 3FMBA 3MMAB 3P6YC 1KLMB 2XS2A 4LF8F 3VV2B 2DHGA 4WU2A 4QOTA 3NS6A 1FK9B 4KY3A 3W60A 2LDIA 4KO0B 1W2BR 1JXVA 1YRXA 1TAQA 5AXLA 3UR3C 3FFIA 1IKVA 1XEZA 4H4OA 2HQ3A 4TY8B 3V6HA 2ZH1A 3SZ2A 3O8WA 4QPXA 1HNXF 3BN7A 1MMDA 1S1WB 4P2SA 2HLUA 3K59A 2CFXA 3P96A 1FEEA 5K14A 2W7PA 1QAIA 3R5DA 4RW8B 5IQQA 2MMYA 2JX2A 3HSJA 5D4NA 1FKOB 3PJXA 2H4YB 4M8LA 2ASJA 3T1AA 1VMBA 2I5JA 1H98A 3G6XA 2HNDA 2WSFC 4NLVA 1CJUB 2DHXA 1RWNB 3CJ0A 3NP5A 2CAJA 2HHWA 1OYDA 1RWWB 1SI9A 2VBZA 1NJZA 1NK5A 4OI4A 1D0EA 2G0IA 1RWXB 2OAUA 4XAKA 2EG1A 2C28A 4ZITA 2XG8A 1NRKA 3FQLA 4P7TA 1NSPA 2AGOA 2MEWA 2AJ2A 3WDOA 5C42A 1NMEB 1LW2A 4RBUA 1BQMA 1KC8T 3ZZ0A 3CE8A 2IM2A 3TAPA 1ITPA 1EAYC 3HJVA 4XDCA 3PNIA 3KLEA 3MAHA 3AJDA 1RHMB 2HFVA 1P6TA 2K7JA 4ZPTR 1Q16B 2UUWA 4Y2CA 5CQGA 5GMKa 1PO6A 1H6KX 2HHHJ 5E7OB 2A3JA 1YJ7A 5KFJA 1SL1A 3UR0A 5A8KB 2VQEJ 3MM7A 1KLMA 4A8XA 2RVJA 2W2MP 4GVBB 4RU2A 2CJ9A 3C6TB 3TZXA 5H1SV 4FYYB 3PXGa 5BYRA 3CCES 1UFWA 2KDOA 3C15B 2ZVIA 1FKOA 3BH6B 1SV5B 3C6UB 4RW4A 3BYPA 3FQKA 3GJSB 3ZO7A 1S12A 5LOQA 4DUTA 3IXQA 2B0GA 4DG1A 3DLLQ 1JNZB 2CNNB 2J9DE 4ZJQA 5KFFA 4M5DB 5KOWA 3MXHP 4ILLA 3CCZA 4OJGA 1MLAA 3B82A 4LFAJ 2HHQA 3MEEA 1UL3A 3DDIA 4ZPWR 2W4PA 2GMJA 3PR5B 1VLYA 4UY8T 2LLZA 4L75A 3CW2C 5D6GA 1XMOF 4ZPDA 4B3TJ 4RUBA 4YUDA 1X5OA 4FYXB 4KGZB 1KFSA 3BR9A 4H4KA 1FE4A 3FDSA 4NPOA 5A0YA 5SUHA 2J76E 3H42A 3TZYA 5AJ3F 3J7YI 1AZSA 2RT3A 4KH0B 2DPJA 4HL9A 4OJ1A 4B9TA 3PW2A 1VYAA 1SKUB 2AD9A 3AOBA 4IO9Q 2PE8A 3SMZA 5GADU 4I7FB 2RRAA 2F40A 3EMTA 4NCAA 3R2CJ 2ZH3A 1FA0A 2DO0A 2EFPA 2NLWA 4C11A 5E2QA 3BGLA 4LF9J 4I2PA 3ICLA 4DL0C 4DX8H 5JMNA 3TZZA 2HHHF 3R27A 1XTZA 4N76A 2BX6A 2RIJA 1JXEA 1N34F 4F3MA 4OYOA 3H25A 4C3MA 3BQ2A 3SYZA 5D4PA 1U25A 2H3EB 5EUHA 2KVQE 3R5BA 1X0FA 2RNEA 2YPZA 1FKPB 1VC6A 2PC6A 2FJWA 1LK5A 1IR2A 1TP7A 4KC5A 5LMNF 3DRXA 3WX4A 1VDHA 4RJVA 1WF0A 5F9LA 4CYUA 1WEXA 1UETA 4USVA 2NYHA 1YITS 4NRUA 5GAEI 2WSEC 4NYOA 4F4WA 1FHTA 2M52A 4DG1B 2OP5A 1RWMB 2NXCA 4MJKA 4URSA 2IVFB 1YDLA 5DM6Q 3KK3B 1N33J 5HMWA 5CH7B 3GJTB 4O44B 5KFLA 2MKCA 2FC8A 2LDYA 3TZWA 1H3DA 4FKXA 1RTZA 4GRSA 4Z2XA 4LBPA 2RS8A 2GO9A 2F8MA 3QZ8A 3M6VA 5JVHQ 5F8JA 1KVJA 3HD2A 3MCSA 1U6BA 1LXJA 3BPSP 3OUYA 4L6V3 2W2NP 2VFTA 2RAQA 2UU9F 1KBRA 1XMOJ 1FJCA 5D8HB 1VJQA 1F3VA 1NKEA 2CA9A 4C11B 2P8IA 1QAXA 1CJVB 2R9LA 4WYWA 5KG2A 2DD8S 2HS0A 1TL7A 2CXEA 4G65A 4QIVA 3I32A 1EHWA 4QCLA 2YNGB 4QYRA 1RHKB 5KT2A 1U8WA 2UV8G 4KGKA 4DR6J 4C0BA 3LWMA 3CJKA 1S9GB 3NCPA 4F25A 1OY8A 2ZKTA 1WKKA 2GIFA 2YY3A 1WJ9A 1GH8A 2R7QA 4JI0F 3N28A 3TR5A 2PDAA 4X4TA 3SQOP 1I5OB 4ECXA 3NRBA 3CO9A 1JLCB 2DNKA 3MUVP 5CXTA 5T7LB 2CADA 1WELA 3QGHA 2QSWA 4DS4A 3UN2A 3PX6A 1QLNA 5RUBA 1FKPA 1KONA 1NEEA 2DHHA 1X4FA 3D6TB 3DGPB 4K59A 5U47A 4J9SA 4IFYA 4DV0F 3RB6A 3ZNJ1 4B08A 5HQLA 4DV6J 1WUUA 2X3DA 1K1SA 4QIWD 4YB6A 5A76A 2C2NA 3TQEA 2AP6A 1MMNA 1KWMA 4ID5B 4ZVUB 2BJ1A 3RJMB 4DL3A 1GK8A 5G0RB 3V4IA 5BYSA 4LFCF 1RHQB 3MF5A 5E5NA 1VQLS 2BXJA 1MW7A 4P2MA 3I4HX 4F2RA 1UA1A 3SCLE 1URRA 7AT1B 2BE2B 3QQCD 3T19A 5LXYA 3C2PA 1JMTA 1Q1KA 1RU1A 1WD6A 1EP4A
chains in the Genus database with same CATH topology
4XPEA 1BC6A 3TRGA 2PMHA 1KN6A 1DARA 3T3FA 1U1MA 4PPZA 1R6YA 3U1MA 3QGPA 4U9RA 4USHA 1BQNA 2W9CA 3HM9A 1IBKF 4TYBA 1RQ0A 1GNKA 2DJWA 2F8EX 3MUTP 3MWBA 1VQNS 2BOPA 4CO3A 3I5BA 1O51A 1JLQA 1NZAA 2F9JA 2MB0B 2NQPA 3WZ0A 4IUFA 5B08A 3AA8A 3MEGA 5CYMB 3OTOF 1C0UB 4I2PB 3M8PB 3J7A1 1TAUA 3RB0A 3BSAA 1YGYA 4DSKA 1QVFR 2DIUA 4B3SF 4YP3A 2VA3A 1FE0A 2HS4A 1IN0A 4ELUA 4FZVA 4DV6F 2J6TA 4I6YA 3H2LA 2CQ4A 4DUZF 1J5EF 1SUQA 2YVSA 4WFYA 4WCEQ 2Y1JA 1SJ3P 1CQNA 1U09A 3CJ4A 3CCTA 2ZH8A 3KLEB 1BQXA 4NA1A 1IXKA 1S7HA 3SFGA 4KRWA 4A8SA 4DR5F 4CO2A 3FJ2A 4F50A 2YX1A 2P9EA 1YJ9S 2OPPA 2HQIA 1ZETA 5K9FA 1NHVA 3DDKA 2W7AA 2Q6BA 2ZOGA 2IRUA 1FD2A 2ILZA 1RYRA 3DM2B 2R8JA 4G1PA 1VRUA 1HWKA 4E98A 3PW4A 5GAEU 3NAIA 2VKZG 2GHWA 4JI8F 2E66A 1XNQF 4J9LA 1MWYA 4U7CA 4X62F 3FZ2A 3FRZA 3RB4A 1FEHA 1HQEB 1VQ5S 2POKA 5E33A 1VFJA 3ZZZA 4NLTA 4LIWA 5LSRA 2WCXA 2E1RA 3I0SB 4NA3A 3UW1A 4ZHRA 3PHEA 2VPWB 4H4KC 2FGOA 2M8HA 2ROGA 3BSNA 2IJNA 5D3GB 1VQ7S 3HK2A 2QRRA 2WB4A 4FBTA 2E9ZA 3M8RA 2JLFA 2YNFA 4BBYA 5CD4H 4EYHB 4LF4F 1J5OB 1LV5A 4ZPBA 4HYKA 4M95A 4C3KA 4DSIA 5F8NA 2VG6B 2YWFA 3TAMA 2DNHA 2OFHX 4W92B 2GIQA 1IKXA 2XLJA 2QMWA 3U7JA 2XEXA 4JI2F 1XBWA 4OI3A 3VF0B 3T5JA 1MU2B 3MR2A 3LO3A 4N8NA 1D8YA 2OD6A 4H4MB 3ZZTA 3EXCX 1TVRB 4FP9A 2W8LA 1WHYA 3MEDA 1ZBTA 2VBXA 2J6UA 1ZM9A 3TUIC 1RT1B 4Q5VA 2ZC4A 3KJVA 4OV1A 2GJIA 3T9ZA 1RT7B 3CCLS 4IQXA 1SJ1A 1WF1A 2LXFA 3B8HA 3FCHA 4CT9A 1JK9B 1W25A 2YNHB 2V4JA 4NYZA 4AQYF 1B7FA 3ZZRA 2G0CA 4RW4B 3MMCA 3QWUA 5DS7A 2KB2A 5E3RA 4Q0BB 3VZHA 3HKZD 5A8RA 4O4GB 1FDAA 1KRPA 1QE1B 4HTJA 2BDPA 4DR4F 4KJIA 5IT0A 4CZCA 4X84A 2O67A 4DSEA 2HNYA 1VI7A 2CPDA 1VS3A 2XBPA 3HVWA 3DOLA 2OMOA 1UEVA 3OVBA 2I2YA 4DFMA 3OPKA 3OFFA 5L8RC 2XWXA 7FDRA 2W9BB 1WHVA 2DO4A 2KG1A 3DXSX 4FS2A 1BD6A 3RB3A 3MTJA 4LSLA 4NWBA 4OHXA 4CH0S 4IOCQ 4OX8A 3GWCA 1TQLA 4LSNB 4HI2A 2DRAA 4HKQA 2FJVA 3RAXA 4G1QA 3B78A 3GQCA 2B43A 1D9DA 2COLA 2DGVA 4ED3A 1JWWA 3KMSA 4JI7F 1BY9A 3I4PA 3OFEA 4B9UA 3HDSA 3CDBA 2AW0A 2CJQA 3V81B 3OSNA 3GIKA 2KJVA 5F8IA 1HYSB 1SJRA 2NS1B 3DHWC 1HNWF 4Y34A 4DN0A 3H40A 2B9XA 2YNIA 2BQUA 1HMVA 2FTRA 5KT5A 2CJKA 2QZ8A 4WK1A 3OXFA 2RKIB 3DOKA 2DPIA 2AGPA 1IKYB 1RKIA 3DRSB 1C1BB 2ABYA 1TR0A 1HWJA 2K3KA 2EFVA 3CMES 2R7RA 3EX7B 4DQRA 5GVQA 1HQEA 4KB7A 4WFZA 2RB7A 1S1TB 1IJEB 2XMWA 3HKWA 3I56S 2KHCA 3H8YA 1VJWA 3H20A 1YJTA 2X1GA 2QA4S 4FBUA 1HBMB 2IYIA 3IC1A 5HP1B 2D9OA 5KFKA 3LANA 4U67Q 3OL6A 3CB4A 1G3OA 1OS5A 1VRTB 4D3GA 2BW2A 5LJ3Y 2DNMA 3LAMA 4YFUA 3N6MA 1VQYA 4Q44A 4YB7A 1HMVB 2V8HA 3PKMA 4M1KA 1UWBB 3RRGA 2BA9A 1U2FA 1S97A 1KOHA 3V4MA 5I42B 2GHVC 2RD5C 3QIPB 1FDDA 1HI8A 2OSQA 1R0AB 4O44A 4QIFA 3MR3A 3OL9A 4CNYA 4RKUC 4U6PA 4P6QA 4TU7A 1R8HA 1DTTA 4C9DA 4Y2MA 3SXLA 5JVGQ 2XMTA 1RT5B 1HNZF 3I82A 1UA0A 2YNHA 3U27A 6FDRA 1TK5A 2JJ4D 4DR1F 1X4BA 2P6TA 3BGUA 2FVSA 4TQRA 3X1LB 3QIDA 3ENVA 3JAMY 4PR6A 3SCJE 3POTB 1X9WA 4ZVEA 1R8PA 4IRDA 4KKOB 4OZ1A 2RQKA 4WF9Q 3DOLB 1UEUA 3TARA 1TK0A 4X4NA 3MFIA 2VFVA 4N5SA 4N56A 1U6FA 3MMBA 4PUOB 3I5AA 4F4ZA 5E3PA 2K8GA 3SSRA 1R0AA 5HBMA 4I1TA 2R4FA 3I0SA 5KG0A 6FD1A 5K8MA 4A8YA 3Q2TC 3FEZA 5D3GA 1Z2ZA 5B0AA 3KG0A 2DRBA 3SSQA 3KYLA 3PDNA 3E01B 4HH0A 2FY1A 5I3UA 4ES2A 4FYDA 1T94A 3UDLA 2PI4A 2ZZNA 4RNHA 1DBDA 5EN1A 5DO2A 4QR2A 4FF2A 3L09A 3WC2A 2XCAA 4A8FA 4B9VA 5FIIA 1SL2A 2IBOA 1IKWB 3VWSA 4MYUA 2W9CB 3D54A 1NJWA 1FJ7A 3E2EA 1KQFB 2RQ4A 4C8OA 1RJJA 2UVWA 1UVIA 1W2IA 3KFWX 1HPZA 2MY7A 1RI7A 1ELOA 5B0GA 3MECB 1R89A 2B4PA 3ISZA 4JV0A 4N41A 1T05B 2W4DA 3T5HA 4DSJA 4ELVA 1XERA 3GG1A 1HFEL 3SEOA 3NGKA 3CF5Q 3FZBA 2AYGA 2IC3A 4OX6A 5L9NA 2AQ4A 4DV4F 1VQKS 1RTJB 1ZTWA 2WAQD 1JLBA 4V19J 1KSPA 1HNVB 1LW0B 4FN5A 4ZA1A 2KO1A 1FDBA 2X51A 4DQIA 1R27B 5IQ6A 3UQSA 3PY8A 4EFAC 2OPRB 2AYMA 4IH6A 1A9NB 2HIQA 3MZIA 1HBOB 3CULA 2EFQA 3HMJG 1UJ5A 1XN9A 2E5HA 2HLTA 5KFNA 2VQFF 1ZM4A 5J1PA 3NAHA 1RT6B 2VG7B 3QAUA 3GFYA 5KFPA 2IVMA 4L72B 3KLGB 3RBDA 1DTQB 3NLCA 1D9FA 1TFWA 4CH7A 2R7TA 3DDNA 3C3LA 3TQ1A 1DQ9A 1OQ3A 4K0KF 2W24A 3G96A 1OPIA 1TL1B 3IWLA 2EBEA 4O3PA 4NRTA 3OTBA 1X4AA 3I55S 4CH1A 3GMGA 1N5VA 2E7WA 2WBMA 4P7VA 4ZCMA 4WE1A 4G3IA 3HZGA 1R43A 5AXNA 2J9EA 3BF4A 2B9YA 3OFGA 3MMAA 3UI3A 3CDWA 1GTHA 3DLEA 1JLAA 2K2PA 2B4UA 4RU9A 2R7SA 2ZNYA 2HMIB 1F5BA 2VPYB 3HPOA 2Z2LA 5KAKA 1S6QB 2AJQA 1AW0A 3FMWA 3H2UB 4F4XA 1WNEA 3BB5A 2UUBF 1FRHA 3VAFA 2RJZA 4Z37A 2OO4A 2O5DA 3NNCA 4QJVA 1Y5NB 3NBPA 1FTRA 4O3RA 4B9SA 4X4VA 5HN0A 2HWIA 2B4OA 1N0UA 2K7KA 3AH6A 2MSSA 4G1IA 5HMXA 3K5LA 1NKBA 2FLLA 5F0WA 4R0EA 3F41A 3LPYA 3JSBA 4CI0B 4ZVFA 3O44A 2WOMB 1M5HA 4TLRA 3AB4B 3O6QA 4ZPCA 1S1VA 4Y0FA 4LQ9A 4YHHF 4KPYA 1RT3A 1JLEB 2VG5A 4NZ0A 4KIAA 2L9NA 1L3VA 2EPIA 5IM0B 2Q43A 2JDJA 5KG6A 3DM2A 1S10A 1U24A 2A1BA 1HWLA 3AJ2A 4C3LA