3CCVS

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 20
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ccvS00
1U1OA 1L3KA 3NMRA 2D9OA 4PRFA 1WHYA 2G0CA 1UAWA 3RW6A 1X4FA 3NNCA 1H6KX 1VBXA 1URNA 2HGLA 4CIOA 2YH0A 4CH1A 3CMAS 2D3OR 2AD9A 2J0SD 4EGLA 2PEHA 3VAHA 2RUGA 2RU3A 3MUTP 1YTYA 3UD3P 2LXIA 4WF9Q 1WEXA 2KM8B 4F26A 1A9NB 2DHXA 1K8AT 2KRBA 3TO8A 4CH0S 2XSFA 1U1KA 3MUVP 5HO4A 2DO4A 2DNLA 2J0QD 1N88A 3P5TL 3G9CA 4OZ1A 1QM9A 2MKHA 2FHOB 2MQQA 1FT8A 2B0GA 3FEXB 2OTJS 2CQ0A 2OJ3A 2X1FA 1YHQS 2MGZB 3R27A 5IFMA 3CC7S 3MURP 1HD0A 2J8AA 1WEYA 1X4GA 4IO9Q 2U1AA 2CQ4A 2DIUA 1X5PA 2MQNA 4WFAQ 4YB1P 2ADCA 1H2VZ 2JX2A 1X4AA 5DETA 3P49B 2DH7A 1HL6A 1X4DA 2DITA 2RT3A 3VAJA 2KVIA 2DGSA 3G71S 3IRWP 2XNRA 4QPTA 3IWNC 2RVJA 5GAEU 2OTLS 2DH9A 3I56S 3CCLS 2DNKA 2M9KA 2DB1A 4OZ0A 1OPIA 2CQ1A 2J76E 2MKIA 2OIHA 1VQNS 2CQ3A 2MY8A 3D2WA 2HGNA 4IUFA 4YUDA 4YOEA 1JJ2R 2M52A 2L9WA 1S79A 4LJMA 5DM7Q 2DISA 3DLLQ 4W92B 2MZSA 4A8XA 3CC2S 2VOPA 1UFWA 1N8RT 2MKSA 4FXWA 1WI8A 4CQ1A 2RNEA 3G6ES 4C0OC 1FO1A 4FXVA 2LECA 3THPA 2KM8C 3R1HA 1K9MT 2FC8A 3CPWR 1U1LA 5DDRC 3CF5Q 4V19X 2M8DB 3UD4P 4LIRA 2CPFA 1WF0A 3L3CA 3SXLA 3MOJB 2HZCA 1VBZA 4F25A 2M8HA 2HVZA 2DNRA 2DNZA 1U1QA 4PR6A 3UCZP 1CVJA 1WI6A 2VODA 3PIOQ 1YJWS 2DGUA 1WG5A 2DHGA 2KH9A 5ITHA 2BOPA 1IQTA 3NS5A 2K3KA 3G96A 3BO2A 3S6EA 2DGTA 2CQCA 1VQPS 1DBDA 2RQ4A 3VALA 2KXNB 1QVGR 2M4MA 3G8TA 3S01A 3US5A 2E5GA 2KYXA 3LPYA 3VF0B 4ZKAA 3CCUS 3CC4S 1YIJS 5LJ3Y 3G4SS 2XB2D 2CPJA 2DK2A 2RQCA 1N54B 1Q82T 3I55S 1M5OC 1VQ5S 4U67Q 2MSTA 4C4WA 1VC6A 3P6YC 3R1LA 3U1MA 3UCGA 1WF1A 3V4MA 2U2FA 4F02A 3HHNB 1RKJA 2X1AA 1YJNS 1PO6A 5JVGQ 5GVQA 4W90B 2MQPA 1UW4A 1U2FA 5GAHU 5JVHQ 1FJCA 1NO8A 4WFNQ 4TU8A 2XS2A 2I38A 4P6QA 1Q86T 1AUDA 4QU7A 2XS5A 1D9AA 2DH8A 5DDOC 3SDEB 2YTCA 2CQBA 2NLWA 1M1KT 2EK6A 1U1NA 2I2YA 3B4MA 4UY8T 2MQMA 3EGNA 2M2BA 1FJ7A 1X4HA 1WWHA 2DNHA 5LSOA 2QFJA 2CPHA 3G8SA 2LKZA 2X1GA 2KXHA 1KQSR 1U6FA 1VQ4S 1JMTA 2CQDA 5MLCV 2MZTA 2KFYA 1KC8T 2O3DA 1WHWA 3EX7B 2N3LA 3OW2R 4C7QA 2D9PA 2F3JA 1ZH5A 2NZ4A 2E5HA 2MY7A 2CPEA 2VOOA 4J5OA 3N9UC 1OO0B 2MJNA 2HYIB 2CPZA 2MQLA 2M88A 4WFBQ 1JJHA 5DDPC 2MXYA 2YWKA 2MGZA 2JVOA 2LEAA 1F9FA 5D78A 2LMIA 3VAIA 1VQ6S 1M5VC 1N52B 1YWXA 3MD1A 5CYJA 5HL7Q 5EN1A 2RS2A 1WHXA 2DGVA 2LXUA 2KXFA 2KI2A 1FNXH 2JRSA 4QQBA 3S7RA 2FPHX 4UQTA 2N82B 2K8GA 2L08A 2LYVA 1SJ3P 2ERRA 2DNQA 2UP1A 4BS2A 2KRRA 1X4CA 1SJRA 2MKJA 3DXBA 2MMYA 5H1SV 2SXLA 1X0FA 2MSSA 5CXTA 5BJRA 2CQHA 3CCRS 1VC0A 5FJ4A 4TU7A 1YI2S 3VAFA 5DDQC 2EK1A 3P3DA 1KOHA 1X5OA 5DM6Q 2CQIA 2DNYA 1R8HA 4IOAQ 3S8SA 2Q79A 2YH1A 3MD3A 2ZJQQ 3ULHA 1YJ9S 2G4BA 1S72S 2MJUA 4TLQA 2MYFA 2DGQA 2V94A 1H2UX 3LQVA 2DNGA 2DNOA 2MHNA 2AYEA 1VC5A 2KHCA 1KOOA 1B7FA 1H2TZ 1YITS 2MZ1A 2EVZA 1O0PA 2CQ2A 3MDFA 4TU9A 2QA4S 4WIIA 1OWXA 2M0GB 2M70A 2KT5A 3HI9A 2GO9A 2CPYA 1M90T 5GAGU 4Y0FA 2MKCA 3MI7X 3EGZA 3PIPQ 3CUNA 2F9JA 2E44A 1SJ4P 4PKDB 3J7ZT 2MZRA 2LA6A 1Q7YT 4RU2A 2A3JA 2LEBA 1JJ4A 1X4EA 2KU7A 2OSQA 3FEYB 1NJIT 5LSLA 2KG1A 1FXLA 3H2VE 2DGXA 3CCVS 4WCEQ 1K73T 5GADU 1HA1A 2DNNA 3TP2A 3NNHA 1FHTA 2MZQA 1DZ5A 3CXCR 3CCSS 2L41A 1ZZFA 2BZ2A 3JB9k 3THTA 1Q81T 3ZZYA 2DGOA 2KG0A 1SJFA 4ED5A 1X4BA 1NU4A 2GHPA 1U1MA 3Q2TC 1FJEB 2QEXS 1DHMA 1WG1A 2MB0B 1P27B 1M5KC 1A7GE 1OIAA 2CPIA 2DHAA 2MPUA 5LXRA 1M5PC 2LQ5A 4M5DB 3NNAA 3CD6S 3BO3A 1RK8A 2G1DA 4Y00A 2DHSA 1D8ZA 3BEGB 1QVFR 1WELA 3BS9A 3VAMA 3VAGA 3RW7A 2F9DA 5CA5A 3MXHP 3SDEA 2LA4A 1XN9A 2XNQA 2XS7A 2KN4A 3Q2SC 5D77A 3UE2A 2ZJPQ 3UCUP 3CCMS 2N7CA 1WF2A 5GMKa 3U1LA 5LJ5Y 1VQ8S 1P1TA 2VONA 1X5TA 2N3OA 1UP1A 1DRZA 4LMZA 3BO4A 1G2EA 1W2BR 3K0JA 1WEZA 2AYBA 2E5IA 2FC9A 2JVRA 3H2UB 5IQQA 1BY9A 2RRAA 1VQOS 2RRBA 1U6BA 2PE8A 3CCQS 2FY1A 2LCWA 1WTBA 2ZJRQ 3CULA 2YKAA 2MKKA 2ADBA 2CPXA 3CCES 1SXLA 2OSRA 5IM0B 3SMZA 1X5SA 3CTRA 2CQPA 2AYMA 1R8PA 2MZJA 3J7YU 5LXYA 3UWTA 1VQ7S 1ZZNA 1KD1T 2AYGA 2DNMA 3ZZZA 1WHVA 3TYTA 2DGWA 2CQGA 2MQOA 1VQ9S 1PGZA 4QU6A 1VQKS 1HD1A 3CCJS 2HGMA 1VQLS 2DO0A 4Z2XA 4IOCQ 2CJKA 3MUMP 4ERDA 2E5JA 2RS8A 2CPDA 2M7SA 2WBRA 1U1RA 1WG4A 2X1BA 2JWNA 3B4DA 3VAKA 3CMES 1SJQA 5IM0A 2DIVA 2DNPA 1U1PA 4WKRA 3NS6A 1VBYA 1VQMS
chains in the Genus database with same CATH superfamily
3DI6B 1UAWA 3NNCA 3MEDB 2XY6A 4RBUA 3CMAS 2JJ4D 2D3OR 2AD9A 2J0SD 4EGLA 2PEHA 3OXFA 1PBAA 4P7VA 2DCLA 4NA3A 2FVSA 3DU6A 2B43A 2DO4A 3O5TB 4CWBA 4RWWA 2D74B 2OHDA 3OR1B 4ILRA 2X3DA 3GIIA 2NXEA 1YZ6A 2YPYA 3CC7S 1CC7A 3CJRA 4M5JA 4A8YA 3HSDA 3CGIA 4GO5X 1S99A 4UY85 3T9ZA 3ZTSA 5ETTA 2VH7A 2YNHA 5DJBA 5KT5A 1U49A 2HVEA 3GJTB 1L5UA 4E2FB 4FS2A 2XY7A 2M52A 4WJBA 4I6AA 4RNNA 4QIVA 2HHHF 4LF2A 2HHHJ 3CC2S 4B9MA 3FRYA 1PG5B 4C97A 3L7OA 1BLUA 1GEHA 2B3TB 2OLWA 1U1LA 5A2QU 5J1PA 1VRTB 1JLEA 4A8QA 1N48A 2ROPA 1QSYA 3KJFB 1UWAA 2ZNZA 2QL7B 1WI6A 1YSJA 4MKAA 5ITHA 4KRWA 2FJAB 1IQTA 3NS5A 3BQ1A 4IO1A 5CYQA 5KFOA 1SL2A 4N7TA 4G6VB 3S01A 3EPGA 2DXEA 4IR9A 3HMJG 4ZVRB 3UN3A 4ECWA 5F3TA 3WDOA 1H7WA 3R1LA 3V4MA 1C0TA 3I0SA 4K5RA 4CO2A 3BSCA 1IR1A 2C2EA 4Q2MA 2IM0A 2XZDB 1M0SA 4OX9F 1T7PA 2XS5A 2DH8A 3NLCA 2PA3A 1I51B 2HNZB 1UPMB 3G8SA 4KHRA 4X4QA 2XCAA 3S1TA 5MLCV 2VPZB 2AEJA 3G82B 1RWWB 1SUQB 4NLSA 3RB0A 4M5NA 3DLJA 3TA2A 1TUWA 1OO0B 4M8LA 2BYCA 1SQFA 1RAGB 1Q16B 2MXYA 2EI5A 2LEAA 2HHWA 4C3KA 4ED2A 3SV3A 1XK8A 3QRQA 1YWXA 2D3O1 5KFDA 1JJCB 2V4QA 2FPHX 3GV5B 4DUTA 1FDAA 2A6MA 3GSDA 4K8RA 2MMYA 1AZSB 1O5JA 4DI6A 2SXLA 3AA9A 4JI6F 4JI6J 3AOAA 3KDOA 3JQMA 1JLGA 1RAHB 4NA2A 1F9HA 4IRCA 1ACMB 2DNYA 1NSPA 5HP1A 2HLUA 1Q53A 1YJ9S 4NCAA 3VCDA 3JYTB 4K4YA 2PIIA 1S57A 3ZTQA 3GJSB 1S4EA 4K2XA 3DLGB 2BV3A 3MOZA 3M2RB 2PGCA 3IWLA 4I68A 2DCUB 2WW8A 3J7ZT 1ULRA 4X4PA 4ZVSB 3TNVA 3TAMA 2R7UA 1ZA1B 2C2MB 1ZPVA 4NCBA 4WCEQ 1LOUA 4DX8H 4RR5A 3M2RA 5J2NB 2DGOA 1SJFA 1R7IA 1X4BA 2QLWA 2XULA 3TUPA 3BV8A 2DT9A 3R3TA 3MM6B 1TELA 1EB0A 3CD6S 4M5LA 2CNNB 3M9NB 3RRKA 4DR3F 3J7AN 1D8ZA 4DR3J 1Z2ZA 3VAMA 2H1YA 1ELOA 3M6UA 4KGZB 3N0VA 2ZJPQ 2FQQB 3SQOP 5CAAA 1P1TA 5HROB 5AJ3F 5AJ3J 2Y1IA 4DQIA 3KLGB 4DV7J 1C0UA 1WKKA 2GA7A 2ZH8A 2ZH7A 3IR5B 1JKHB 2JFKA 3W62A 4DL3A 3KLVA 2XMMA 1RT1A 2YQ3A 2DD8S 3HXMA 3KLFA 4RX6A 2MQOA 3GG1A 1HI0P 3JS9A 5B0AA 3KLGA 3IFEA 4IG3A 4JV0A 1JKHA 1U1RA 3G87A 4I6YA 1RGVA 3D1OA 4QYZK 1Y10A 3OFGA 2VFRA 4RLEA 2D9OA 5SZTA 3Q22A 3BGRB 1FRHA 2JNJA 4OI0A 3U1NA 1ZETA 3QAEA 2BXJA 1TL5A 2DYAA 1RCOB 1C1CB 1KP6A 3HLUA 5D8HB 2BE2A 2RH3A 1WC5A 5F8HA 3OHAA 1SC4B 1FT8A 4HHHA 2OTJS 3PR4A 4QR2A 1FF2A 4JBCA 1R0AB 4N8OA 1HD0A 2J8AA 5F3ZA 1X4GA 3IO1A 3EICA 4KE5A 3LP0B 4WP8A 1X4AA 4DV4F 4ELUA 2ACYA 4QPTA 1SL0A 2OTLS 2NYIA 2HFSA 1FK9B 1SKWA 4M5GA 3UQSA 1HWUA 2UXBF 2UXBJ 1C4CA 4CLZA 2IIHA 4CTAA 2ZM6F 4KHMA 2ZM6J 3BKUA 3KG4A 4BWJA 1KVJA 3C16B 2UUBF 4CYUB 2XGQA 2UUBJ 2W2PP 1KQFB 1LWCA 3MOJB 2PC6A 3C46A 4M63A 3M1VB 1BQMA 1VK3A 2UU9J 3BM7A 3W8GA 1NH8A 3EYZA 1HKAA 2PMHA 2I8EA 2PI5A 2KDOA 2W24A 4QIWD 4YB6A 2W9AA 1Y4ZB 1YJTA 1QAJA 4N47A 3M1VA 5KG2A 5CQGA 2OPQB 5GAHU 5U47A 2CZVC 3AD8C 1M1KT 1RTZA 3QJJA 3GFHA 5LSOA 3KLEB 2V2QA 3LW5C 1KQSR 4PEOA 5GMDA 2MZTA 1KC8T 1LKZA 1Q0NA 4K4ZA 2ZZMA 2OPQA 2ZH1A 3LGNA 5T7LA 4EBDA 2AGPA 1OY9A 4P10A 4C9DA 5CYMB 2XTJP 2AZ3A 1MN7A 5DZ6A 1M5VC 1JQGA 2K7KA 5HJXA 1PYOB 1D3WA 1SJ3P 2VPXB 4ZCKA 2ERRA 5FLXY 1PC4A 2GJFA 5C25B 1LW2B 1LFPA 5CXTA 2C3UA 1I3OB 1NBEB 5C2GA 4JV5F 2HS0A 4JV5J 1ZTWA 3I5BA 4LIWA 2QA1A 3ENQA 4ZN1A 3AQPA 1RHKB 2GQCA 2M3DA 1KFSA 5LT5A 4PPDA 4ZHRA 1I5OB 4Y2CA 1O0PA 3PO5A 2FHJA 4P2MA 5AT1B 5AE1A 3PIPQ 1G1XA 5T14A 2IVFB 1ZOTA 4ZP9A 3OSPA 2OSQA 1Y3KA 1FXLA 3DRXA 2VZ9A 4QYZJ 2DEIA 2BEFA 2CDRB 4GC6A 5K8MA 4OYBA 1REGX 1UJ4A 2DJWA 2IA0A 1A7GE 3V2UC 3DGPB 2GJIA 5A8RB 3C15B 4I1TA 4F4ZA 4Y00A 1A0OB 2ZBCA 4ZPBA 1F2HA 1GXUA 3OTCA 4CCHA 2NXJA 4DBQA 2VV5A 3PFOA 2LEPA 4NL5A 3C15A 3DDIA 2HNYB 4K7QA 4LVNP 5H9FK 3OD2A 4URGA 2AYBA 2JVRA 3FK4A 3K5LA 2W8KA 1NZAA 2YKQA 3NGDA 3QWPA 5B0BA 3TZXA 5F9NA 5GAGI 4PXDA 3GJRB 5FDLA 2OMOA 1PSDA 1VIOA 5KFPA 4H4OA 4DFJA 2CJKA 5KAKA 4PABA 1W7WA 4ZDNA 2R7XA 1RTHB 4Y6IA 2FTRA 1HLWA 3I9ZA 5GADI 1M1HA 1UA0A 1N33F 1N33J 4WKRA 1VQMS 6FD1A 2V8DA 2HRUA 2QA2A 3T6JA 3M9MB 1BGXT 2HMIA 2FHJD 3HVWA 2RU3A 2DPJA 2LQBA 2BE9B 1K8AT 3VGUA 2KRBA 4CLSA 1EQMA 2FZCB 2C2RA 2XWXA 1JB0C 2VC0A 5IT4A 2B9XA 4ED7A 2GV1A 2XSJB 4AD6A 2ALYB 3OPKA 1NDLA 3ZZ0A 4MMOA 2DY9A 3NGUA 2UUWA 1D1UA 1SIZA 3QZ7A 3PXGa 4F4YA 2YKNB 3D67A 3GP9A 2WONA 4E0DA 2CQ1A 3MEEB 2MKIA 2FB0A 2XSJA 1RTDB 3F73A 4IKAA 3AHPA 4YUDA 2Q66A 4YOEA 5CD4H 1KTQA 3POTA 3ADAC 5F0UA 4UQGA 1L3SA 4C0OC 2OPRA 4B9TA 1V3SA 5DS7A 4EWTA 3CF5Q 5J1EA 2ZDPA 3CDBA 1VBZA 3DOLB 3Q24A 5H9EJ 1EZZB 5K20B 2DNZA 2VODA 1N5SA 1HYSB 2K3KA 4LUBA 5DG8A 2CQCA 4EO8A 2JEFA 1U26A 1PAUB 1AT1B 4DR7F 4DR7J 3LPYA 4ZKAA 4NLGA 2ZKUA 2AIRB 2BDPA 2QX0A 1R6YA 4PWWA 2LU1A 3DOLA 3SCKE 1VC6A 4EYHB 3I5AA 1WF1A 2BANA 4F02A 2A0FB 4R8UA 2BQ3A 1CQNA 2WAQD 1Y5NB 1HYSA 1XMOF 4WU3A 1KDNA 1XMOJ 4W90B 4OX6A 3LAKA 3MM9B 3EJMA 5DDOC 2VF3A 2YTCA 4AXJA 2QLBB 1UPPA 4QPXA 2ZBRA 2RQMA 4KV8B 4PQUA 4KY3A 4HYKA 3CO0P 4NZ6A 5A6PA 5C2CA 1FA0A 4UUXA 1HWKA 3L4BC 1ZH5A 2MJNA 3HVTA 2YVSA 1RTJA 4D3HA 3K8VA 1HQEB 3MF5A 2PN6A 2HAIA 1PYTA 2XQCA 2BM1A 3WC2A 2L08A 3R5AA 2UUCF 2UUCJ 2UP1A 4XIUA 2RB7A 1HFEL 4NLVA 4LQ3A 4MFBB 1HQEA 1NK7A 1GTEA 5J1NA 3BF4A 2WSCC 2DNGA 1XTZA 1Y11A 3B6BA 2R7TA 1S1TB 2LFVA 3P96A 4ZCLA 2CQ2A 4M95A 3OFEA 4WIIA 2QN6B 4WTOB 4RW9A 4Y3CA 1IN0A 5HLFA 2AEFA 3KG1A 3P45B 3QLHA 2BJ3A 3IRXB 4KR0B 3BGOP 4UZCA 1UFLA 1HNVB 4EZ9A 1JLFB 2DNNA 5JMNA 1S6QB 3QRRA 5HMWA 3HPOA 5GAEI 2BKOA 3PEJA 5L9XA 3RR8A 1SV5A 3GFXA 3IRXA 2PEBA 4LRDA 4K4TA 2QL9B 4LRCA 5JUMA 1Q8LA 1Y5IB 3VQSA 3OL8A 2HNDA 4K2JA 4OJ3A 4QZVB 1FX4A 1HPZA 3SDEA 2GVZB 1QSLA 2ZFHA 2QV6A 4Y2IA 4LR7A 2EC0A 3GV7B 1HBUB 1L3VA 4ANCA 3TUJC 5KG5A 2GIFA 2AF6A 1QAXA 4OYZA 3MM8B 4DR1J 1P6TA 3R7NB 1B4SA 2WOMA 4QCLA 1IBCB 3LP2A 2JC0A 4IOCQ 2FZGB 3RB6A 2KFNA 2WBRA 3MM8A 5I4MA 4FBUA 1N5YA 1WC4A 1SC6A 1KKHA 4H4KC 2W8LA 2GGPB 4G1QB 3GQCA 3CMQA 1RAOA 3RW6A 3VTIA 1URNA 7FDRA 2HW3A 1IWAA 1OMSA 2WW4A 1VK8A 3AD7C 2ZHOA 4B3SF 3U27A 4B3SJ 1WEXA 3VZIA 3OL7A 2BJ9A 1U48A 3L7UA 3I87A 1NM2A 3ENVA 2C2KB 2CJQA 2FHOB 4HH1A 4QYRA 2CQ0A 3FZ2A 1MMDA 2DIUA 5HANA 1S0MA 2ROEA 3GYXB 5D3GA 1WC3A 2B4OA 2HFUA 3I56S 4F3QA 3MM7A 5KFSA 2RF2A 1EHWA 4ECRA 3QMQA 4NLXA 3CJ3A 1ZPWX 4FNHA 2VOPA 3G6ES 5JJBA 3QO9B 4P52A 3PX0A 2F7VA 1RWKB 1O51A 4ID5A 3KHLA 4U8VA 2V9WA 3MCMA 2ZEJA 2FGOA 3LALA 1WD6A 1GMUA 2LVWA 1UL3A 2B8QA 5IXUA 2IDLA 4NCGA 3KHRA 2OFGX 2GMJA 3GONA 3QIPB 1D8YA 1M5OC 4P9SA 3IS9B 4MIBA 3W5XA 5HBMB 2XMVA 4WIQA 4UOCA 1EX8A 5GVQA 2OD4A 5L39A 1KNZA 2KT2A 1GAOA 1AUDA 2C28A 1PYSB 2MQMA 1NPPA 1IKXB 3VHQA 2YNIA 2VA3A 7FD1A 2IJFA 3KDNA 4IFYB 3T6BA 2D3UA 3TEGA 3PRDA 4URQU 1HQUA 2EKYA 3TUZC 3C66A 4ZN3A 3AJDA 4ZLLA 3J7YI 3H20A 1YJ7A 2W25A 3HJVA 2BKNA 2R42A 2FDNA 1NJXA 2KXFA 3M2UA 3NOGA 4DPTA 2HFVA 2B6AA 2LYVA 3W64A 4DU8A 3HSJA 3TRGA 5KFNA 1H7XA 2EK1A 2R7OA 1RDRA 5I3UB 1EJ7L 2VB6A 1RCXB 2GAGC 4OZ3A 2MYFA 1D9FA 4J9KA 2J0WA 2F65A 4LFCF 4LF9F 2NZCA 4LFCJ 4LF9J 2AGQA 4EZ6A 2B5JB 3CJ8A 5K8NA 1BUXA 4F36A 2H48B 5KFWA 1DTQB 2BJ1A 3EGZA 3KK1A 4DQQA 2DRAA 5I3UA 2LEBA 4L6V3 1S1VB 3IG1B 3FEYB 4ED1A 2YQ1A 2J8SA 3CCVS 3V81A 5CH7B 3EUNA 5LM7E 4WYWA 4ZVEA 1K73T 1V3ZA 4NPOA 1UTAA 2G0IA 1FKOA 1TZ0A 1ZZFA 3M30B 3DCAA 5DLGA 1U45A 3ZZYA 2VG7B 2MKYA 1N5TA 1HBMB 1TUGB 5LXRA 4LRAA 5KFJA 2LQ5A 3IG1A 3HVRA 5K8PA 3RB3A 1CLFA 1GXLA 1NJZA 2HVHA 2G1DA 5IV4A 2E9ZA 2VFUA 2QC3A 1XR7A 3M30A 1FXDA 4F2SA 4ECVA 3DRRB 2VG7A 5EUHA 1U0HB 2QMWA 3UCUP 4RBTA 2ILZA 2N7CA 4F4AA 2I0XA 2IYGA 4DSKA 3PJ9A 3JQJA 1GMWA 5E0OA 1AROP 1UEVA 2VU5A 2KHDA 2G9OA 2WCXA 3KTQA 2B56A 1VQOS 1RWXB 2RRBA 4OIXA 1IBMF 3TW0A 1IBMJ 1KHWA 3OVSA 1U0HA 3ILIA 2CQPA 1YBUA 3DOKA 3UWTA 3CO9A 4BC9A 2MQ8A 1HNZJ 2C3MA 2HGMA 3W2VA 2FYXA 2RS8A 4RWXA 5L38A 1WG4A 1MWQA 3BN4A 4CRJA 4TY9A 2MHEA 2CNKB 2EXUA 3TAPA 3MEGB 4LSZB 4X4SA 1H6KX 1KQGB 2HURA 3QBCA 3QAUA 3GTYX 3FBFA 1J2VA 4O44B 1DQ8A 4LFBF 4LFBJ 3AAWB 2DHXA 5LL6d 2XSFA 5HO4A 4TXSA 4ZPWR 2D7SA 2RUSA 2X7IA 4DV6J 3MEGA 3M6VA 3EMTA 2MQQA 1YLXA 1EKRA 2XZWA 4XAKA 3HFVA 3I9V9 2KFZA 4DL2A 3R6LB 5ETOA 4O4GB 2U1AA 2Y8YA 3HDSA 4DSFA 4YB1P 4WK1A 1VRUA 5KFEA 2POKA 2YKPA 2OD6A 5KFKA 2WVCA 2RVJA 5GAEU 2FD2A 1H0HB 3C6UB 3R5DA 3ILOA 2VICA 2HGNA 5K8OA 2V0NA 1JJ2R 3TVYA 4PYAA 4Y2KA 1W25A 3MMAB 1IVZA 4X4TA 1WC0A 2JHEA 5KG7A 3PR5B 1SKSA 3W60A 1Y00A 1FO1A 3C6UA 3R1HA 3CPWR 1CULB 5EGYA 1EIYB 4PQAA 1WF0A 3SXLA 3LWLA 2P9EA 2R4FA 3KUEA 3CJ4A 1S77D 3H8YA 4LF8F 2HHUA 1CVJA 1N5VA 2XMJA 4LF8J 1T05B 2O1PA 4O0NA 2XLIA 5LSRA 4J9LA 1S1WA 1CULA 4CLWA 3HZEA 2VG5B 2DK2A 4FNIA 4JI0F 1G7CB 5DQHA 3PKMA 5ETKA 3NGKA 3QQCD 3UCGA 3J7Z5 3TWZA 1RKJA 2RHQB 3VGSA 3A13A 4WE1B 4YR2A 4DDFA 3ITHA 2NLWA 1NSAA 3RZAA 4C8YA 2VG5A 2C2ZB 2CPHA 2HBRB 2X1GA 1CBKA 1NKCA 1K1QA 4K4SA 2W01A 2WZ1A 2IAJA 1HBOB 5EDWA 2MY7A 2ZH5A 3T9NA 4ES1A 1XMBA 2LU2A 2M88A 2D1CA 3GG0A 2I6WA 3QSIA 1FWLA 4RUBA 1MLAA 1OYDA 3GLJA 1VYAA 3OR2B 2GHWA 4NZ7A 4C0HA 2KB2A 4DN9A 5K14B 3NBPB 1LW0B 2GHVC 3W2WB 5AE3A 3AD9C 3B8HA 2VASA 3DDKA 1ZTTA 2V50A 4W98A 2MSSA 4RW7B 1ZA2B 5KFXA 1UEUA 5FJ4A 3EE3A 3K5OA 5ETQA 2HWIA 3BKFA 3MD3A 1S72S 2KL8A 1LFWA 3CB4A 4TLQA 9ATCB 3PW5A 2AHOB 1TAQA 3BQ2A 1N5QA 4NLOA 1IKYA 1FX2A 3T19A 3TEHB 1FRLA 2F5GA 1QTNB 3L09A 2V6AA 2F9JA 2BA9A 4USUA 1IXKA 3BBCA 3K17A 3MCNA 2RKIB 3A4TA 5LSLA 4AL7A 3WC0A 1GX5A 2CA9A 2QT7A 5A0YA 1X9MA 4ECYA 3CXCR 3GFYA 3IXQA 1WC1A 4GKJJ 2XMUA 3MCSA 5KFRA 2ZBQA 4CP5A 1F3VA 4U95A 3MPYA 3AB2B 2A6OA 3DOMB 4OHXA 2VBYA 4J9SA 1T9UA 1YZ7A 2A2CA 2Z30B 3X3UA 1WELA 1RT6A 2DVIA 2LA4A 1U02A 5D77A 3KNGA 4USJC 4Z7CA 1TL1B 2J7WA 2AJQA 3DRPB 4DF8A 2N3OA 1UP1A 3DRSA 3F41A 3CCZA 1W2BR 5DQIA 2AZ1A 1DTTB 4P72A 2CWKA 2W1BA 3CCQS 2DR6A 4CLTA 5A76A 3C3LA 3CULA 4OJ1A 2OSRA 3FZBA 1SBRA 3K89A 2ZWPA 2XEXA 4ZJOA 3J7YU 1V5IB 2Y0BB 1QDUB 2QSFA 3UO0A 5LMNF 4PUOB 5LMNJ 3DLHA 4NXMF 1UVIA 4ILMA 4ERDA 2ATCB 3TZWA 5A8WA 2E5LF 2E5LJ 1JWWA 1P1LA 1ROFA 2DIVA 2GIRA 3TZYA 4FXDA 4ITSA 7AT1B 1IKWA 3W1YC 2C2NA 4OI4A 5E41A 4HL9A 4CIOA 3RAXA 4H54A 4DR5F 1NHVA 1QSSA 4DR5J 2RMLA 3HSGA 3VAHA 2RUGA 3BB5A 3VV2B 1G4CA 2O67A 3OTOJ 3G6VA 4Q0BB 4JV1A 2RAQA 1XEZA 3FBBA 1B0PA 2ZOMA 4JI4F 3G9CA 2W9CB 4JI4J 4ZPCA 1AA1B 2ZVSA 3NL0A 1AW0A 4ED3A 4DS5A 3SEOA 1NMEB 1RHRB 2OPPB 3E01B 1QE1A 2C3OA 3P49B 2DITA 3LUYA 4A47A 3HP6A 4FKYA 1YGYA 3A3NB 3SQGB 2VDHA 4QWEA 3C6TB 5HN0A 5L1JA 4FS1A 3V4IB 1KHVA 3PJXA 2MDAA 2OPPA 1RKIA 2IVYA 3N79A 2GIQA 2BBEA 1HNIB 1NKEA 4PCQA 3BGFA 3UNYA 2KM8C 1IM4A 4O3QA 2HFNA 2FHKA 1LWEA 1YX2A 3AJ1A 2XWYA 2QA4G 3RJMB 5E3RA 3DDNA 4CDIA 2HVZA 1XMQF 2FUG9 2GVDA 1XMQJ 3D1HA 4ZIWA 3UN5A 2BOPA 3MCOA 4KFBB 3BO2A 4KIAA 2N4CA 3T1HJ 1GH8A 3G8TA 3CCUS 2UUTA 2XB2D 2CPJA 1ITPA 2GNKA 4Q44A 4DL7A 3P6YC 3DMJA 2EFQA 1V5VA 3D0GE 1U24A 5C42B 4OZ5A 3Q8YA 5MAOA 3DGVA 4KFBA 2KO1A 2APOA 5D0HA 2MQPA 5HI7A 3FQLA 1T9TA 3IP0A 3PNIA 1T0TV 1ZAVA 4OI3A 5CCLA 1FJ7A 1JLAB 3AODA 1RSCA 1SVDA 2RU9A 1XIQA 1S0VA 5L1KA 4ES2A 4FF3A 4TYBA 5DGAA 1FXRA 4ZVQB 4Q43A 5B7WA 2K3IA 1Y5LB 2VOOA 1NPKA 2Y8WA 2HYIB 1JJHA 3Q8VA 3MM5B 2W9BA 1SPBP 4RW6A 5B0GA 5D78A 4LSNB 1RYSA 4ZVGA 3D9BA 4DL0C 5HL7Q 1IBKF 1IBKJ 1G6BA 5DG7A 2CZ4A 1NNDA 1XNQF 5L9NA 1I94F 4JI5F 1I94J 2QL5B 4JI5J 1AB8A 3RR7A 3RU0A 1X7VA 2JFDA 2EC2A 4O0IA 1PBUA 3CCRS 4TU7A 4DR4F 4IRKA 4Z7YA 4DR4J 1HHTP 4ANEA 2BE7D 2AV5A 1FEEA 1JNRB 1BD6A 3A8KA 2DXDA 4CLUA 1WTFA 4RJVA 1UW9A 4QIFA 4TU9A 5KT4A 2KTQA 2M0GB 4WBFA 2CPYA 1UWBA 3H40A 2L48A 3H59A 1Q7YT 4QIGA 3GCWP 3FKBA 3FQKA 3ET6A 4LBIA 4B02A 3ENWA 4LQ9A 2FLLA 4C0BA 3NNHA 1N4LA 2IMOA 4K59A 1REVA 3UDVA 3CCSS 2KZZA 3IC1A 3JTPA 3OL9A 1RT3B 1Y7PA 2KJWA 1WG1A 2V8VA 5DQGA 3A8JA 4LF7F 3D3CJ 4LF7J 3NNAA 5AXLA 4ED0A 5CCMA 3DM2A 2YKMB 3AOCA 4OHVA 4AE5A 2XS7A 3Q2SC 4JI3F 2I5JA 4JI3J 2PFDA 4O3NA 4ETZA 4Y2MA 3JAMU 4EYIB 2YNFB 4WZQA 4DV5F 4KT0C 4DV5J 3ZNUA 2HVDA 5KFTA 4ICLB 3IR7B 2CVIA 3VZHA 1R8AA 1B99A 2YKAA 2B51A 2D41A 5IM0B 3T5JA 3J81Y 2QE5A 3ZZZA 2HG4A 1FRIA 2Y3YA 2VG6A 4PYDA 4FPRA 4MAKA 3OL6A 2QMUB 2HHXA 2GC8A 3D54A 4TN2A 1KONA 3ZZTA 4ICLA 1H73A 2UUAF 2UUAJ 1Q5YA 5IM0A 3FEZA 4WP9A 4HH0A 3UPFA 1L3KA 2WSEC 3KLIA 2I9SA 2UVWA 2VIHA 2RJZA 5IZHA 4YP3A 1UVJA 2ZOGA 5D4PA 3JSYA 3PW0A 2YWFA 2ZUGA 4CO0A 3HD2A 1KVIA 2DKOB 1A9NB 4LF4F 4LF4J 1U1KA 3N01A 3R6GB 2E1MC 1F60B 1TFWA 3W9HA 3TX8A 2IC3A 2HBYB 4RNHA 3W9IA 3R27A 2DR9A 1KLMB 5BYQA 4IO9Q 5C24A 1WSVA 5KFAA 4YS2A 3I0RB 2B4PA 1RAJA 1SH3A 2DH7A 3MAAA 4URSA 1XR6A 5AXNA 1G3OA 3UR0A 2DB1A 3PRVA 2L3MA 3FCHA 2B4VA 4M5HA 4KPYA 4BBYA 2EG1A 3D2WA 2ZOFA 3OXGA 3J81j 1SKRA 2L9WA 4HI2A 1S79A 4J9OA 1Y9OA 4ZITA 4H4MA 4B3MF 1TU0B 4B3MJ 3PY8A 6FDRA 4N76A 2NPFA 1WI8A 1VGYA 4Y65A 2RIJA 3BR9A 5L8RC 4ILLA 2BJEA 3MECA 3CDEA 2ZC3A 1Q5VA 3L3CA 2BQRA 5I3PA 3J80U 2XZTB 2DR8A 2ASYA 5LOQA 3GIMA 4DG1B 1C1BA 2CXEA 3S6EA 4FBTA 2DGTA 1VQPS 3QYYA 3VALA 1NK5A 1BXNA 3PKYA 2IRXA 5KG4A 2UXDF 3VF0B 2UXDJ 4I6WA 1MSWD 2RE1A 2ZE2B 5KFYA 2GMLA 4DR6J 3HKWA 3ILJA 3O6QA 2VD3A 3SSQA 1RWNB 5KFHA 3BYPA 4L73A 2W7AA 2FVQA 2AX1A 2CYYA 3MMBA 5M2PA 4DG1A 2XS2A 4BDPA 5HATA 3LGMA 3M32A 4ECZA 3B4MA 3B82A 2HSEB 1J5EJ 4RW4A 2M2BA 1U6FA 3W63A 2WVEA 2V2ZA 1WHWA 1FNOA 1KSPA 2OAUA 2NZ4A 4NI2B 2AGOA 3OJUA 3LP1B 4NLUA 4ZLNA 1IBLF 1FRKA 1IBLJ 1JLQA 4UT4A 5IWAJ 1RT5B 5ETNA 4TQRA 1VI7A 1HHQA 2E1PA 3MD1A 5EN1A 2LXUA 5T41A 4GVBA 2KI2A 4RUAA 2PFFB 3H2LA 4P7TA 4X84A 1XR5A 1SJRA 3ZTRA 2W7OA 3TZZA 2GCFA 3NAHA 2C2DA 3V6DB 1VC0A 2HBZB 3EVWA 2R7QA 2NUUG 1X5OA 4KO0A 1UVMA 4M94A 4UW2A 4N5SA 3MMCA 4NLWA 4ZA1A 2FJVA 1NDKA 4DCOB 1RABB 1R0CB 2NQPA 3V6DA 2NSBA 2J5AA 1H72C 4HI1A 2PSZA 3CUNA 3DNCA 3O2IA 2E44A 4PKDB 1Q95G 2XI2A 3OJSA 1BC6A 1IKVB 1F5AA 5KG6A 3LH2S 2QIFA 2V2KA 1CJUA 3SCLE 4DZ6A 2YWHA 3M8YA 2CG4A 4ZS6A 1HMVA 2BZ2A 3V6KA 4PXCA 1U25A 5HVGA 2QEXS 1MMNA 3SV4A 2CJAA 1YJUA 2LXFA 4AL5A 2MPUA 4K4WA 4M5IA 4KAIA 1OQ3A 2YNHB 1IKVA 1FESA 4PG5A 1HW8A 1NJWA 1Y0HA 1T94A 4QWCA 1S6UA 5DRKA 4ZOSA 1KR4A 3DLKA 3AFGA 3N6MA 4QWBA 3UE2A 4BCAA 1VCTA 2J7KA 4R5PB 3DLEB 3G6YA 1OY8A 2XHWA 1JLCA 1AYEA 4IFVA 3K0JA 1VLYA 1T9WA 2D69A 3HHKA 4CT8A 5J2PB 5EX3A 3AT1B 4I67A 2RRAA 2IMWP 1JLEB 4K5SA 1TV6A 2VPWB 5KFMA 3FMBA 2MKKA 5KOXA 1VRQC 3MPVA 1X5SA 3TJ9A 2AYMA 2AP6A 2AYGA 4OQJA 1R8BA 4LT6A 4DV3F 4R5PA 5CYQB 4DV3J 1F1BB 3DLEA 3Q86A 4TQSA 2XBPA 4JI1F 4JI1J 2ZD1B 1U4BA 1WORA 5J2PA 2YNGA 3LGHA 2CUYA 4YDXA 2K1RB 5SUHA 4C8NA 2QO3A 3PZPA 2BVZA 3CWJA 2KT3A 2DNPA 1C0TB 5KT6A 3I0SB 1IWGA 3M8ZA 3ZTOA 2DRDA 1VBYA 4C8ZA 2VHGA 3Q89A 1JIHA 2FVRA 4GKKF 4GKKJ 1HWLA 2AJ1A 5B0CA 4KH0B 3LANA 2ZD1A 2AX0A 3GMGA 1PILA 1F5BA 2K1RA 4HEA9 3WBZA 4HVZA 2WVFA 4E98A 3KK3A 2UV8A 1RXOB 2OJ3A 2XLJA 5DO2A 3GIKA 4J9VA 3Q8SB 3R7SB 4OX9J 4PWDA 2VJVA 3MURP 3H98A 1YKWA 3GE9A 3M8QA 1HNWF 3NG8A 1HNWJ 4TYAA 4DU7A 1S7IA 5E3QA 2XLKA 3H4DA 3G71S 1NB2A 1FDNA 4HTJA 1JLGB 4OZ2A 1TUVA 2CG8A 2J76E 2OIHA 1VQNS 4NOHA 4C8OA 5HP1B 1K0VA 5DM7Q 2ZZNA 2MKSA 4NE9C 1O8BA 3L7PA 4CM0A 1Z1ZA 3W5ZA 4IR1A 3VR1A 1TAUA 3OFHA 2DR7A 5K9FA 3EDRB 3ZZUA 1S1XA 2OO4A 4KB7A 1KTVA 1TVRB 2IJRA 2WVDA 2KKHA 3TAMB 2DNRA 2OMLA 4PR6A 3UDCA 2EPIA 2BUNA 1S0OA 2IRYA 2KH9A 3W5YA 4FYDA 4HTIA 2NXCA 1OSCA 2YWEA 1SQEA 3N28A 4UOHA 1N0VC 5KT7A 1E6VA 1TVRA 2UV8G 4I0WA 4F67A 1F5CA 3GPAA 3U1MA 5D15A 2J7UA 3EXYA 4I2PA 3DYAA 3SSSA 3M2VA 4FVCA 3QFHA 2BACA 3IGVA 3HHLB 2HVIA 2CQBA 2GX8A 2X3GA 3UD5A 1YJRA 3LOUA 2HQCA 2KFYA 3BZQA 4OYPA 5KFZA 2P6TA 1C0UB 1RADB 4WK3A 3SI8A 1H98A 3FCWA 3HHLA 3RBXA 2JVOA 1RT1B 4RUCA 2PMWA 2ZH6A 3KLFB 3JTNA 1GMVA 4U7UD 2H9ZA 4IG3B 2HQ3A 3TA1A 1X8DA 4F3OA 1X0FA 1KBRA 5BJRA 4I64A 4EU0A 2E29A 2QLJB 3JSMA 4XDDA 3P3DA 3GIJA 2VQEF 1FKPA 2VQEJ 4IOAQ 2Q79A 3M8RA 4USWA 1X60A 3G86A 1VC5A 2Z2MA 1KOOA 4N77A 3LAMA 2MZ1A 5D0GA 1K44A 2M70A 2V67A 3R97A 3HX9A 2BE2B 2H5JB 2MZRA 4I2QA 2FLOA 5KFFA 2XY5A 3DFEA 1LNQA 3W65A 4RO0A 1FHTA 4YHHF 3J80Y 2QTWA 1DZ5A 1ZM9A 4YHHJ 2L41A 4JI2F 4JI2J 1U7LA 3RTVA 4FP9A 1H74A 2NSCA 4OL8A 4ZLPA 5KT3A 2YQ0A 1MU2B 2CPIA 1RE1B 2Z2ZA 4WPAA 4M5DB 3W3SA 4F8RA 4DZDA 4PWUA 2AWZA 2IM1A 4YQWA 4DOZA 4CTAB 1QVFR 4ER8A 2F9DA 1EP4A 3A1YG 1TL3A 1RT2B 2XNQA 2XCPA 1MU2A 3CCMS 5KFCA 4DV4J 1VHIA 1GTHA 5GMKa 2VONA 4M5DA 4I7FA 1DRZA 4EFAC 1S1UB 3BO4A 4DJBA 1ZM4A 1WEZA 3QGGA 2J0XA 2FC9A 1RZMA 3PX4A 3HHLD 1LWCB 3N4WA 2VQFF 5K5MA 2HK2A 1RT2A 2VQFJ 2BJDA 4OFZA 1BQMB 5FIIA 3ONQA 2CQGA 3C8YA 5G0RA 1S1UA 5JXSA 4ATNA 5IOLA 4WP3A 3IM9A 3U7JA 2H51B 3B4DA 4J37A 4HT7A 2UXCF 4RZRA 2UXCJ 4NLYA 4HHUA 2RHSB 4OHWA 3W7BA 1V9OA 2BJ8A 2G0JA 1D9DA 2YX1A 2G0CA 4KHPF 4DSEA 4KHPJ 2BQUA 2Z56B 1F9EB 3TJAA 4FYYB 3QNWB 4JV2A 4PG7A 2KM8B 3VGVA 5E3AA 3R2DJ 4CH0S 4MKYA 3FBCA 1UMJA 4ZJQA 4QW9A 3EVMA 4P2SA 5T7LB 1RA6A 3AA8A 4BHQA 1WKLA 4OI2A 2MTLA 1RT7A 3T5LA 3E8OA 1FERA 3I32A 4L72B 2QMXA 1S6PA 2G1HA 4HACA 4F4WA 1X5PA 5KFIA 2H65B 5D4NA 1WACA 1H2VZ 4QR0A 3FSXA 4OI1A 2M9KA 2RRNA 4OV6A 2HZVA 1OQ6A 1CJKA 1DLOA 2P8IA 3PACA 3RBEA 3PDNA 4ZHRB 3CJ2A 4BC7A 4X4OA 4CLYA 4K4VA 2ALZA 4M5KA 5H9EK 3G6XA 3UD4P 1RHQB 2B7CB 4NYPA 1WDTA 2IM2A 3MR7A 2F8EX 3I5CA 2W2OP 1RHJB 3DLBA 2FJWA 1WG5A 4E8UA 3Q8QB 1DBDA 2WTFA 2E5GA 2IA6A 3IAM9 2KJVA 5LJ3Y 3G4SS 3BPDA 4DEZA 4F4KA 3JQKA 4O3RA 3I55S 2IYIA 2MSTA 4C4WA 4ZVTB 3KOAA 5L1LA 5A2QY 4RNFA 4ZCIA 2RDDA 1MNEA 4F0KA 3DU5A 2HHSA 5JVHQ 3EZUA 1S49A 4L75A 2PDAA 1U1NA 3CCWA 1H38A 5C5JA 1WWHA 2LKZA 3HT0A 1S97A 4ECQA 2Q3PA 4Q7AA 3O1LA 3K5NA 4RW8A 2O3DA 3A12A 5KFLA 2CZ9A 3KFWX 5CZVA 3EWGA 4A8WA 4USVA 4C98A 2MEWA 1VDHA 2MQLA 3T1AA 1OPZA 2ZBPA 4KQZA 3RB4A 2MGZA 4U9RA 4P2FA 3D28A 2LQJA 3VAIA 1N52B 5FDLB 2DGVA 2YWGA 4J9PA 3S7RA 3NS7B 3GR1A 4H4OB 2FJXA 4B3RF 2ASJA 4B3RJ 4R25A 2CQHA 3EGVA 2VC1A 3WHIA 5IQ6A 5DM6Q 2CQIA 2V63A 2BX6A 4KYZA 2I1RA 4V19J 3BH6B 4WKYA 1RAEB 3CVKA 3T5HA 3C14A 3OTDA 2HMIB 3MDFA 2CRLA 4QOTA 2XO7A 1CJVA 4LRFA 2W4CA 4MT1A 1HW9A 3MEKA 2ZH9A 1EETB 2GZOA 5E2QA 2XC9A 2CAJA 2NUHA 2DRBA 4Y34A 1TK5A 3IA0A 1UVKA 4RKUC 1RWVB 3N5BA 2ZITA 2JC1A 1YJVA 2J9EA 4MYTA 2WK4A 3F56A 1FJEB 3BJYA 1Q8IA 1S9GA 2COLA 1EETA 2XO6A 2W2QP 4LRBA 1UJ6A 1UVNA 4A48A 1LV5A 3BO3A 1VOMA 1GQEA 2WONB 1TKXA 4OMFG 4OJHA 5KTQA 3GR0A 1CJTA 1XN9A 3BBBA 4HHJA 1FI4A 4KGXB 3POTB 1S5ZA 4X4NA 5F8IA 3KUGA 1SC1B 1KN6A 2OPRB 4G1IA 4OZLA 4C2MA 3QPIA 1MROA 1T03A 3PYEA 4AQYF 2G13A 3NAIA 1RJJA 4ED4A 5J1EB 4G1PA 4AQYJ 4NZ0A 1RT4B 3ZNJ1 3D4JA 1SXLA 4OYOA 3KK2A 4ZPDA 4F3MA 1R8PA 2QYCA 3CIMA 2W4PA 2OEKA 2IY5B 1IQZA 4WFYA 2JWNA 1RT4A 1R43A 1SJQA 1S48A 5I42A 1IR0A 2VDIA 2BANB 3PV8A 4R8UB 1U1PA 4LREA 3KLHA 2DPIA 3M05A 1X4FA 1VBXA 2MLXA 2HFOA 4P2XA 2AMCB 3MUTP 1L3TA 1TKZA 4WF9Q 1NEEA 1RACB 4PQUB 4J9QA 2NR0A 2JDJA 4RU9A 1UCNA 3FJ2A 4FPIA 3HVTB 3FDSA 1RTJB 4NRTA 1YHQS 4J7CA 3EGWB 5C7PA 2JEIA 4YFUA 5E7OB 1YRUA 4F2RA 2BRKA 1J27A 3N6LA 3LA0A 2CQ4A 3D1QA 3HF5A 3M8WA 2GO8A 2BM0A 2YWWA 3D0IE 1X4DA 2RT3A 2ZZTA 4G65A 4ELTA 2W7PA 4IOBA 2DH9A 4CLKA 2HKEA 1HI1A 4CM2A 2BR0A 4IRDA 1HWIA 2XI3A 3GWCA 1WSRA 2Y9HA 4C3MA 3WQPA 1TKTA 3OFFA 3K57A 2NCKL 1WOSA 3EZOA 2IVMA 3HFKA 4ZP6A 4Q8FA 4DPOA 4RW9B 2QSWA 3SCIE 1K9MT 2HLTA 1CS4A 1NDCA 3SCJE 5HLFB 1N36F 1N36J 4JP8A 1FRJA 4FVMA 5M2UA 3QLHB 2V4JB 3A8IA 1RUSA 3UDEA 2DHGA 4K4UA 4YMEA 1TL7A 1FFGB 4DX6A 4MTPA 2M4MA 4B3OA 2KYXA 3CC4S 4KKOB 4DFMA 1WOOA 1VISA 2XG8A 2VA2A 2BRLA 3AXMA 3M8PA 2F4VF 1SV5B 2V4JA 3Q83A 4U67Q 2BKPA 2F4VJ 3E2EA 4ZLJA 2U2FA 2R8GA 4USTA 3M7VA 1WNEA 2MLZA 2ROGA 3DI6A 2HNDB 3MEDA 2F8MA 1HPZB 4ZVFA 3SDEB 4KKOA 2AKWB 5FLXU 2CWXA 3EGNA 2KXHA 1DQ9A 2CQDA 4MKVA 2DXFA 3PRBA 3U02A 4C7QA 3EZ5A 3QWUA 2E5HA 2CPEA 4J5OA 3OR1A 2P5VA 4L74A 4WYLA 4EI2A 1KS2A 4RNOA 1LXNA 2WOMB 4DSIA 2K06A 2UVUA 3WZ0A 1FNXH 4OYMA 2JRSA 3LP2B 3H5YA 3DXBA 5L46A 1NJYA 5LMUF 1F2GA 5A8KB 5LMUJ 2O66A 3H0PA 1N5YB 3GB0A 1R8HA 3E3XA 2YH1A 2VJUA 3ULHA 4DLGA 2EEYA 1FEHA 1AFJA 2ZWOA 1JNZB 2JLEA 1GFWB 2KVQE 2KT5A 5A8KA 1DARA 4Y0FA 4NEYA 1VRTA 4FN5A 2N7YA 1SJ4P 3CDAA 1JJ4A 2B4UA 3H2VE 1B70B 3T1YF 1UVLA 3T1YJ 5FD1A 1CQMA 2Q6CA 4CZCA 2C1EB 3JB9k 2NYHA 1QAYA 2R8JA 1KLNA 4ED5A 5KFUA 3KMQA 5D3GB 4J9NA 2WSFC 3AH6A 2HIQA 2JZ5A 4MIAA 3TVZA 2C3PA 1N0UA 3I6PA 4Q2LA 4R0JA 4O3PA 3MM7B 2OFHX 1T02A 2RF2B 2VL1A 2R7WA 1C4AA 2HK3A 1KWMA 3MXHP 3VVUA 2IPOB 2HNZA 2ASDA 3KHHA 2DHHA 2W4DA 1FRXA 1FVSA 3G82A 5DZ7A 3W9JA 4TNOA 1SUQA 3PW2A 2XYGB 5F8LA 3AY0A 5ETRA 2V68A 2HQGA 3JSRA 5HMZA 1LWXA 3JSBA 2PE8A 3CJQA 3ZC4A 4ID5B 1OSDA 3SMZA 5IV3A 2VFVA 3WIVA 2HQFA 1ZZNA 2DEJA 3GFZA 3K5MA 5KFQA 4IH6A 3OQ2A 1FTCA 1N56A 4BWMA 3MUMP 1AZSA 2E5JA 4NCGB 4XPEA 3BPSP 1HQ2A 2M7SA 4AFFA 3VAKA 3K2YA 1YBAA 1RWUA 2ABYA 5F8JA 1YRXA 3NS6A 1PJ7A 4V1Ak 4DF4A 4EBEA 3NMRA 3JYTA 3G8QA 1ZAXA 4CH1A 4OX7A 2RDIA 3DLGA 1X9SA 2FVPA 3EM1A 4J9UE 3UD3P 2YNIB 4F26A 1P9YA 2RILA 4X65F 2Q43A 4X65J 3CDWA 1N88A 1HQUB 1LXJA 1AXQA 2C3YA 2LLZA 5E33A 1OJ4A 2ASLA 5F0WA 2LQ8A 1WEYA 3M2UB 3OVBA 5J2NA 2B6AB 2B9YA 3CCTA 4DR2F 3OTBA 4DR2J 3IRWP 2XMWA 3MM6A 4ZPAA 4AT1B 3RRGA 1QY7A 1TK8A 1Y3JA 3PM9A 1KFDA 2DNKA 4DV7F 4OZ0A 3MR2A 4QR1A 1P8GA 3CSKA 3HKZD 1NSKL 4GMKA 4CNYA 1Q78A 5EHHA 1NXIA 4LF5F 4LF5J 2DISA 5J2QB 3KJNB 1UFWA 3RAQA 2BABA 5HROA 3P8BB 3P5BP 1WKJA 1X31C 2FLPA 1HI8A 3KK1B 4V19X 4LIRA 3I4HX 1RAIB 3CJ5A 2FIUA 1U1QA 3UCZP 4MJKA 3PIOQ 1YJWS 5J2QA 3V81B 2EFNA 3NCPA 1BE4A 4F4XA 2H3EB 3IWXA 2AJ0A 2KXNB 1FKOB 1UZDA 1XJWB 4FDFA 2NREA 1K0TA 2RQCA 2CJ9A 3QT6A 1FRMA 3CD0A 1APSA 3C19A 1NO8A 1NLKL 1TMMA 3BGRA 3CW2C 2I2YA 4CH7A 1ZS6A 4JOUA 5ADZA 4LVOP 4OV1A 1X4HA 3BYRA 1X9WA 1C1CA 1SIWB 4KH1B 2H4YB 1JK9B 2CADA 3OW2R 2F3JA 2E7VA 1IUJA 2L9DA 3FC9A 2QYGA 1SL1A 2Y1LB 5KFBA 1RYRA 5DDPC 4DCJB 1YDLA 4NMXA 3DXSX 3OVAA 3ZFVA 4ES3A 1VFJA 1R0AA 2PD1A 3DOKB 2QLFB 4KSEB 2LQ9A 3LP0A 3OV7A 4UF4A 3T3FA 4UQTA 1X4CA 2MKJA 5H1SV 2YY3A 3W2VB 5HSPA 2WHOA 3GU0A 3BSOA 1S7HA 3H5SA 1FK9A 2B9EA 3OLBA 1SC3B 2VKRA 1GX6A 1T11A 2ZJQQ 1RAFB 4KJIA 4YB5A 2MJUA 2DGQA 4DX5A 3QGPA 2C22A 4USMA 3UN2A 5HVHA 2UU9F 2DY1A 1FKAF 5HK4A 4EK2A 1MW7A 4ZVUB 4UOFA 3C16A 3HI9A 4CYUA 2WBMA 4RU2A 2A3JA 1TL4A 5E3PA 2IDEA 3L9ZA 3P4UB 4YN3B 5BYSA 3CD7A 3HFZB 4K50A 1HA1A 3TP2A 2MZQA 4DQSA 3UFCX 3RYLA 1XERA 1VRUB 1N6QB 1DHMA 4P75A 1LK7A 3ICLA 3R5CA 2CNLB 2ZVIA 4Y2AA 3L95X 1DURA 1N32F 4NMLA 2DR5A 1N32J 1PIEA 1IM6A 1RK8A 4DUYF 4MK8A 4DUYJ 4MK7A 4ALZA 3BS9A 3PTWA 1GK8A 4IG0B 1N6QA 2ZH3A 1QAIA 3ZZRA 3KLEA 1QUVA 2BOAA 1Q79A 5GMEA 3PEHA 3Q8RB 3M9OB 3C2PA 2E1CA 5IC6B 3H2UB 4DL4A 1VHFA 4M1KA 3MAQA 2Q1LA 3DN9A 2LCWA 1LQ9A 1QTMA 5CYMA 4XTTA 2ADBA 2CPXA 4IG0A 1MMLA 1YG0A 2MZJA 1WHVA 1VQ9S 1PGZA 1CPZA 3NGSA 1GMWD 3MPUB 1XNRF 1S1WB 5C25A 1LW2A 1XNRJ 2JL9A 2FHMA 4W4MA 4OYWA 3SYZA 1W2IA 3GZ7A 3T5KA 2ZH4A 1RU1A 1RQ0A 2X51A 5THWA 1U1OA 1TP7A 2HGLA 2HPUA 3ITHB 3PYDA 1S12A 3SBMA 3QGHA 1B0VA 4I4BA 2L9NA 3HCXA 4JI0J 4IH7A 2ZNYA 4U6PA 1RWOB 1NCLA 3TO8A 3WIUA 1FDDA 2IAJB 2DNLA 3FSYA 3TR5A 3VGTA 4KPCA 3ZZOA 4LBPA 3BH7B 1S9EB 4KTQA 2X1FA 4QJVA 2ILYA 1Q8BA 4NLQA 1URRA 3GV8B 2GQQA 3R7BB 3R9LA 2OI2A 1PJ6A 3UW1A 2JSXA 2ADCA 2JX2A 2ZC4A 4J91A 3CJ0A 3DGPA 3NEKA 5A8RA 2OEJA 4ZCMA 1S9EA 4X64F 4X64J 1DAXA 2WRMA 2HRYA 3K8WA 1YQHA 1MWYA 1U47A 4LBHA 4CLLA 4QWAA 1HBNB 2Z57B 2E9RX 2MZSA 2VFSA 4EEYA 4OYIA 5HJYA 2BW2A 1IKYB 3CD5A 2HNYA 3CNQP 4FXVA 3LPEA 1B7YB 3THPA 5DDRC 4G3IA 1C2PA 1R8CA 3D7SB 5KG0A 4B9VA 1ZM2A 4F25A 4DHVA 1HBNA 1PC5A 3HHLC 3PYFA 3KWMA 3Q8PB 2XMKA 4DSJA 5A0YB 2Z2YB 2Z0GA 4Y28C 4HLBA 1T8EA 4UZBA 4A8OA 4DPUA 5KFVA 1RTHA 4AYBD 4OLPA 1Q82T 3SFGA 2QJ3A 3HHNB 1RBAA 1FE0A 2J9DA 8RUCA 1UW4A 3NOCA 4WXOA 1RT6B 4TU8A 3Q8UA 4YB7A 2QFJA 4CLFA 3FRZA 3DRSB 3A8EA 2J6UA 3H90A 3GYNA 4I56A 1SQGA 2C42A 4K4XA 1A6LA 3GILA 1ZYQA 3IMQJ 4A4JA 3CT9A 5CYJA 1WHXA 3OSNA 2K8GA 4A8SA 4BS2A 5B08A 2AQ4A 3PW7A 5A8WB 3I82A 5KT2A 2IFXA 2YKNA 3F44A 1U6ZA 2HZAA 3MEEA 2CJYB 1RTDA 1NK6A 1QD1A 2PI4A 3DHXA 2G4BA 2HBQB 2V94A 4CO4A 1IKWB 5EX0A 4O3OA 1TMJA 3QT7A 4NXMJ 4ZJLA 2R7RA 1RLCL 4ZVPB 3OLAA 3KYLA 1RWMB 1UJ5A 3CEDA 4GRSA 2EW9A 1O6XA 4F04B 4X2BA 2JLGA 2HHVA 4C8LA 4CLPA 5IT0A 1IJEB 2C2OB 1U09A 2B8PA 3J7A1 4ZPTR 5D4OA 1FNMA 3GJQB 1V3RA 1Q81T 1GT8A 1QE1B 3Q2TC 1J5OB 1BWEA 2GJ2A 3M8SA 3TARA 4B08A 4USKA 1M5SA 1MWZA 2OH2A 5HVFA 1RBOB 2XMAA 2YX4A 3MM9A 3NCRA 5CA5A 2NS1B 4C11B 4OZJA 1J5OA 1SH0A 2GFFA 3U1LA 5LJ5Y 3UI3A 1FFWB 4KV8A 4XO0A 1T9VA 1LWEB 3A3OB 3PX6A 3BSNA 2E9TA 1BY9A 5CD4A 2R8HA 1PJ5A 1H3DA 5H9FJ 3NXZA 2GVDB 4C11A 3CCES 5LXYA 4MKBA 1UZHA 4CNZA 1EARA 1Q4RA 3CCJS 2V69A 4Z2XA 2J6SA 5ETVA 1F3FA 3NKYA 2HFZA 3Q23A 4M5MA 3CMES 1VQYA 2Q6BA 3IAS9 3V6HA 3DMJB 5HQLA 1WUUA 5IS2A 4MFBA 4YR0A 2CIMA 4Q5VA 3SZ2A 2ZHBA 1VQ5S 3HT3A 3JXOA 3LTOA 3KG0A 1DY3A 1VQSA 2YH0A 1S1TA 3FBEA 5CABA 5CHCB 4ZVOB 3WX4A 2IM3A 4OZ1A 3H42A 2XYPB 3THVA 3FEXB 4WU2A 2W9BB 1HNVA 4RW6B 1JLFA 1XC9A 1ZM3A 2QLXA 2K7JA 1S6QA 2OP5A 2HWTA 2MQNA 2F4FA 4RPFA 1RISA 2KVIA 4JI7F 1U2RA 4JI7J 1NK0A 1BQXA 2N4DA 2HHTA 4NLTA 2A2DA 5DGBA 2CQ3A 4DR1F 2MY8A 3FUYA 3KHGA 3BBFA 2Y1JA 4A8XA 2GVZA 1XNQJ 4NRUA 2ATLA 1N8RT 4EMDA 1LK5A 4CQ1A 1HBUA 1HIYA 3ETMA 1L3UA 2HQIA 1UWBB 1Q7LB 3HO1A 2UVVA 2FC8A 1D09B 4YDDB 2H4WB 5CZXA 1PCAA 3IBCB 3DRYA 4WFZA 2VBWA 1XBWA 3ET6B 2HQDA 4DV1F 4S0MA 2HRTA 4DV1J 3G96A 2HIYA 4R0EA 1REVB 2G2ZA 2M5YA 1FWKA 3UR3C 2QRRA 1UA1A 3LWMA 3NMAA 1FVQA 3RAMA 2GGPA 1SH2A 3DM2B 4G1QA 3PYGA 5JVGQ 3TX0A 4DPYA 4QU7A 4P6QA 1Q86T 1D9AA 2A10A 2EK6A 4TY8B 2AW0A 4UY8T 2I5JB 1ZAWA 4C3LA 1FWPA 1VQ4S 4OI6A 1R27B 4ZPVR 2N3LA 1VJQA 1RP5A 2WB4A 3K5PA 3EDQB 3CE8A 1YVFA 3ISND 3R5JB 3TJ8A 3MR3A 1ICEB 4FF2A 1GNKA 2V8PA 1HWJA 4TY8A 1NK9A 3BGLA 4DLEA 3H5XA 4IH5A 3ETOA 1QJHA 2VG6B 4NA1A 4PG4A 3IM8A 5B0FA 4OYXA 1BQNB 1M1GA 3RGIA 2DBBA 1YI2S 2H54B 3B54A 3QRPA 3A3PB 2E7WA 1NDPA 4F7VA 1R31A 2PO4A 5HMYA 3KLIB 1JXVA 1CEZA 6AT1B 2DNOA 3F0NA 2AYEA 5J2MB 2R3VA 1BQNA 5ETSA 4WFXA 2QA4S 2VBXA 3TANA 2KYZA 5GAGU 3UVJB 3RRHA 3QO9A 2LA6A 2Z58B 2NPIA 4DUZF 1X4EA 4DUZJ 5D0EA 1I6JA 2IC3B 5ETPA 4NEZA 5J2MA 1KQKA 5GADU 3K59A 2O01C 5C24B 3THTA 4U7UK 3H5UA 5AXKA 3QIDA 1NKBA 1NU4A 1KEKA 1RU2A 1NUEA 3UVJA 2MB0B 2PMZD 3QIPA 1NK4A 2K2PA 3MAAB 1RA7A 4AXIA 3IS9A 1CG2A 4XK8C 5HBMA 3SSRA 1WOPA 3Q0AA 9RUBA 2V5HG 1TKDA 4B9LA 2XYHB 4H4MB 1WJ9A 1IKXA 1UETA 4DQRA 2V8HA 1S59A 3OBIA 4IFYA 1TK0A 1G2EA 4ZMMA 4JYAF 2E5IA 3MECB 4JYAJ 4UTGA 2LDYA 4J9RA 2G2OA 3CTRA 2JOQA 3D3BJ 1VQ7S 1C1BB 2XHCA 3N5FA 3VWSA 1HD1A 1Q8KA 1VS3A 3OXLA 1HR0F 4LSLB 3H25A 1HR0J 4WZMA 1VLOA 2CKWA 3ISZA 5L1IA 4L76A 3MMBB 3HM9A 3R5GA 2ZKTA 3MPDA 4PRFA 2D3ZA 3D6HB 4A8KA 4DV0F 3M32B 4LSLA 2B5JA 1FCAA 4DV0J 3WX8A 1LEOA 4RW4B 4KGKA 5DLFA 3X1LB 4DL5A 2LXIA 1DTQA 3QSYB 1NZ8A 1KRPA 2J0QD 1S1VA 1QM9A 4N8NA 2R2SA 1EQ0A 1DQAA 4USHA 1NHUA 1JLQB 4WTYA 4ZP7A 4OZNA 4AUKA 4GVBB 2JEGA 1HBMA 3DKDA 4DPWA 2F63A 3K7RA 4P74A 2CFXA 3CCLS 3GIRA 2FY8A 3FNNA 5A6WA 3TQ1A 4RNMA 4KO0B 1KVKA 4L3KA 3W66A 4DPXA 4DSLA 4PAAA 3MMCB 2ZHAA 2PA8D 4YY3F 3DRRA 4YY3J 1T9YA 1P9QC 1T9XA 4ECSA 1B0TA 1E6YB 3KNAA 4EBCA 1HNZF 1HNXF 2RNEA 1HNXJ 3PFEA 4LFAF 4LFAJ 4RUHA 1SB6A 1TTHB 2M8DB 2J9CA 5G4DA 2DTJA 2CPFA 3D68A 2IRUA 2V9KA 2IJNA 5KG1A 4KGMA 2QGFB 1Q1KA 1E6YA 1CJUB 2R8IA 2HHQA 1HMVB 2RSQA 1UFKA 4DV2F 1S76D 4DV2J 5ETMA 4ZP8A 4NYOA 2NXUA 2FJEB 3O44A 2BJ7A 4DV6F 3FGVA 4NWBA 1YJNS 2V34A 4LF1A 4NXNF 1I1GA 3CJKB 2JH3A 4NXNJ 2I38A 3DLKB 1WDDA 3FMWA 4GO7X 4O44A 5BXIA 1YK9A 4K0KF 3HK2A 4K0KJ 2FGCA 2EFPA 1JLCB 4IFVB 2OUGA 1JXEA 5ETLA 4ZIVA 3JTOA 1PAEX 4LR8A 3N9UC 4A46A 5EWEA 1TV6B 1OY6A 3CJKA 1YBTA 4FYVB 1VJWA 4PG8A 3HVAA 2F40A 3PHEA 4O4GA 2VFTA 3AOBA 2RS2A 3EXCX 4Z37A 1IJFB 2DNQA 3I96A 4YEAA 2YNGB 2Y1RI 2A18A 2ZUAA 4P71A 4WXWA 2QFIA 2J6TA 3I4PA 4OHYA 2EWHA 2R7SA 4X66F 3S8SA 4X66J 2CNOB 2R8KA 2B7BB 1H2UX 3LQVA 4U96A 2MHNA 4X4RA 3MMAA 2KHCA 2EVZA 2R7VA 4B3TF 4B3TJ 1M90T 2KZMA 3LO3A 3E51A 3R2CJ 3PO4A 2P9CA 2YXLA 3HULA 3PVXA 3R5BA 3KK3B 5M2RA 1U8SA 1D0EA 3KUHA 3CDUA 3D6FB 4PWDB 1T05A 3QJLA 5F9LA 4KGVB 1RAAB 3M8QB 1RBLA 2KG0A 4QBUA 3HHEA 1OIAA 1JXLA 1VMBA 2CVEA 4CI0B 4IQMA 1B3TA 3J81U 4WE1A 4NLPA 4NLRA 4DN0A 3VAGA 1QUPA 4PG6A 1QLNA 1JX4A 5AXMA 5HQ8A 2GAHC 3IGNA 4N56A 3D66A 1VQ8S 8ATCB 2ZH2A 1HBOA 3RBZA 4HDGA 3BR8A 4ZK7M 5IQQA 1S1XB 1GXTA 4PPZA 1WTBA 1F6TA 5EWFA 3OR2A 3SFUA 2DNMA 3TYTA 3M6XA 1T3OA 5K14A 3NBPA 1LW0A 4C8MA 4QU6A 1EAYC 2OPSB 5AE2A 3W2WA 1RTIB 2DO0A 1MN9A 1S4FA 4RW7A 4F50A 1E6VB 2X1BA 2XMTA 4CO3A 3JAMY 5F8NA 4I2PB 3DYAB 3M2VB 4B17A 3TAQA 1S9FA 2CJBA 2LP4A 4CT9A 2OPSA 3BDEA 1NPRA 1S10A 2EG2A 4DXLA 1RTIA 3KJQB 5KG3A 2WVBA 4NX9A 1SCJB 2YX7A 4GKJF 1R6VA 2RDJA 3MUVP 1UEKA 4DWIA 3M6WA 3EPIA 5D6GA 2RKIA 2B0GA 3BQ0A 4NYZA 4ECXA 4JUZA 4HKQA 2EFOA 3NWRA 3TI0A 1SI9A 4X62F 4X62J 3QZ8A 2V8GA 3MR5A 4WFAQ 5DETA 2JLFA 3NGTA 1OS5A 4MYUA 4IDKB 4DFKA 4J9MA 3ZZPA 3IWNC 3DOMA 2H5EA 4N41A 2B9WA 3JSMB 4D3GA 1FKPB 4IYQA 1T3NA 3OT9A 1FE4A 4O4RA 4W92B 3RG6A 3FCVA 4IDKA 2E66A 1K1SA 5F8GA 1TL1A 3MMJA 4FXWA 3DRPA 1HHSA 1OYEA 3ENAA 2F8HA 4PXEA 2LECA 4DL6A 3FFIB 1DTTA 3IBWA 3KMSA 5HAOA 4DCPB 2M8HA 2V2VA 4I2QB 2AJ2A 2CDQA 3KKFA 2HAFA 3UNGC 2RQ4A 4PUOA 2QG9B 1NRKA 3MTKA 3US5A 1R0BG 3FFIA 1YIJS 2FLNA 4AL6A 1N54B 1CC8A 3H7HB 3OTOF 2AJ4A 1M5HA 2VKZG 3GYGA 1PO6A 2Z8QA 3IN5A 4WFNQ 1EP4B 5IT9U 1TL3B 3W61A 2AEMA 4UUWA 2IBKA 2DNHA 4LR9A 1RHUB 4OX8A 1LWFB 3NRBA 4USIA 5HQMA 5D4LA 4I7FB 1HARA 3W8PA 4Q0BA 3EX7B 2D9PA 2IBOA 4DFPA 4MH8A 2XM3A 2W9CA 1TR0A 2CPZA 1XWLA 2V4RA 1F9FA 3HZGA 3K58A 3TVKA 1VQ6S 3HJFA 2G2YA 4OHZA 5G0RB 1LWFA 4QQBA 3E01A 1SKUB 1NK8A 3D0HE 2ZBIA 4B9UA 2W2MP 3GCXP 4RL1A 3SQGA 4TLRA 4IQXA 1NH7A 1KOHA 3C6TA 3R8YA 3QATA 3V4IA 3TUIC 2HS3A 3I31A 5D0RA 1YITS 5RUBA 3T1HF 3ZTPA 1HNIA 1WC6A 2GS8A 3NCQA 4QW8A 3VVTA 2MKCA 3QT8A 4FZVA 5HMXA 3BDPA 4OJGA 2GQ2A 1RHMB 4OYAA 3PW4A 4NASA 2KU7A 2KG1A 2DGXA 2E1RA 4YR3A 4C48A 3MFHA 1RT7B 4MIWA 5F41A 1K47A 2PT0A 2YBVA 2EFVA 1S6PB 4HACB 5IC4B 4GVLA 3AJ2A 1P27B 1M5KC 3O8WA 2DHAA 3EVOA 3O3LA 4A8FA 4OLOA 3D6TB 3QJPA 4B9SA 5C42A 3V6JA 2RD5C 2GMHA 1S0NA 4PZVA 1CJKB 1DLOB 3ZO7A 2GW8A 2P2CB 1JLAA 1WF2A 1NB7A 3TQEA 1U0SA 3ELHA 1X5TA 2XGPA 2HWHA 1RLDA 4UOGA 4B9NA 4X4UA 4J90A 3HSZA 1U6BA 1S6OA 2FY1A 3MM5A 1W26A 1JLBB 4LSNA 2R2TA 3FSIA 3PHTA 3SIPB 1KD1T 3RBDA 2DGWA 3CJSA 5KFGA 4ED6A 2OKQA 1RB0A 2HEKA 1Z2LA 3PJWA 3OHBA 4U8YA 4C6AA 3RUBL 1JLBA 3CIZA 2W2NP 1EKSA 1FFSB 1NSQA 4Q45A 4QWDA 1ZBTA 1WHYA 2VBZA 3IBFB 1BHNA 2F1FA 2E7XA 1VBKA 3UDLA 1UKUA 2LDIA 4GC7A 1YTYA 3MFIA 4L3NA 4CO5A 4RW8B 4ECTA 4KBIA 3ILLA 4FF4A 3MR6A 3P5TL 2FJDB 2MKHA 1AUSL 3PG9A 1FD8A 3MZIA 2R2UA 2MGZB 1RI7A 5IFMA 1BWVA 4O3SA 2BW7A 2NXNA 5EWGA 5I3QA 4ANDA 1RT3A 1HL6A 5DG9A 3VAJA 3NWGA 2DGSA 1FDBA 2XNRA 2VUGA 5KOWA 4QIEA 4H4KA 1OPIA 2YKMA 1DFDA 4IUFA 4FF1A 8AT1B 2HHPA 4LJMA 4TKTA 3DLLQ 3C14B 5E5NA 1CJVB 4F0MA 2YNFA 3LF0A 2RQKA 2QZ8A 1V6HA 2R9LA 2Y0SD 3KXDA 2HZCA 4ZVHA 2DGUA 4WWSA 4ETXA 3B78A 3BREA 4MK9A 3V5RA 2HS4A 4TVAB 4KC5A 1QVGR 3D6MB 3MTJA 2FJBB 3HD1A 2Z4PA 1X0PA 1PKUA 4PXBA 1S9GB 2UZAA 4DX7A 4CO1A 1MG7A 3FVYA 3MAHA 2X1AA 1TKXB 4HT5A 1U2FA 4O23A 1VR6A 1FJCA 2Z2LA 2JEJA 3BSAA 1U8WA 4I69A 1CJTB 3PCOB 5B09A 1DJ0A 2AU0A 3NP5A 1JMTA 1N34F 4DS4A 1N34J 1MROB 1R89A 4RBVA 3BGUA 1T03B 3QFWA 3M4XA 3AXKA 4U7CA 4LF6F 1XQIA 2IHR1 4LF6J 5BYRA 4WFBQ 1NHKL 1NAQA 4HR2A 3MPWA 1FJGF 2YWKA 2ZDOA 1FJGJ 3DHWC 3KK2B 2R2RA 2LMIA 1KLMA 4A8MP 1T95A 1U2CA 3I0RA 2N82B 3IR6B 3VQTA 1VIXA 4DQPA 3ZXWA 2KRRA 2FZKB 1F0XA 5E3CA 4ID8A 1Z4UA 3VAFA 1SJ1A 5DDQC 3QT5A 5I42B 3G2XA 4P73A 4DMZA 5B0DA 3GSIA 3KLHB 3D5MA 2EBGA 2AJFE 3KJVB 3H4BA 2UVRA 4X4VA 2AT1B 1H2TZ 1B7FA 1OWXA 2OELA 2ACMA 1TKZB 2GO9A 4XPCA 3MI7X 5BR8F 2P6SA 2VPYB 5BR8J 4DR6F 2P9GA 2EFGA 1B64A 4EUVA 3N6NA 3KJVA 1NJIT 2CJXB 2YKOA 2WB1D 4FYXB 5B0EA 1TQLA 3HHDA 1FD2A 4ELVA 2J9DE 1R3NA 3OUYB 1YRTA 4F0HA 2H5IB 4JI8F 4JI8J 4C8KA 1J5EF 1U1MA 2GHPA 2ZE2A 1IR2A 2OGUA 4HDHA 1TFYA 3BKTA 4ENOA 1M5PC 3BN7A 4FYWB 4ECUA 2E1AA 4XDCA 2DHSA 3BEGB 3OUYA 3MGJA 4ED8A 3RW7A 5IWAF 1FTRA 1TKTB 3OTEA 2KN4A 3T41A 1RWPB 2YPZA 3MWBA 5IT9Y 4LMZA 3AB4B 3QGIA 2A1BA 4NI2A 1CS4B 3LP1A 2EKNA 2MLYA 1AFIA 2BMBA 4JB8B 1BMQB 2ZJRQ 1RT5A 4BLGA 3NY0A 3ISNC 3NGRA 1CSJA 3DC2A 3MHYA 4EO6A 1TL7B 5F8MA 1VQKS 1VQLS 4B3OB 3AQOA 3TOQA 2CPDA 3TA0A 4FKXA 3M8PB 4Q8EA 2FVCA 4NLDA 2EBEA 5GAHI 3CJTA 2O5DA 2OEMA
chains in the Genus database with same CATH topology
3TAPA 3W7BA 1V9OA 1D9DA 3MEGB 3HT3A 3DI6B 2YX1A 2G0CA 1UAWA 4KHPF 4X4SA 3NNCA 3KG0A 1H6KX 3MEDB 1KQGB 4DSEA 2XY6A 2BQUA 1VQSA 2YH0A 4RBUA 1S1TA 3QAUA 3CMAS 2JJ4D 5CHCB 2D3OR 2AD9A 2J0SD 4EGLA 2PEHA 4JV2A 1J2VA 4O44B 3OXFA 1DQ8A 4LFBF 4P7VA 4PG7A 2KM8B 2DCLA 5E3AA 3AAWB 4NA3A 2FVSA 2DHXA 3DU6A 5LL6d 4CH0S 2XSFA 2B43A 5HO4A 2DO4A 3O5TB 3WX4A 4TXSA 4MKYA 4ZPWR 1UMJA 2D7SA 4RWWA 4QW9A 2IM3A 2D74B 4OZ1A 4P2SA 3MEGA 3OR1B 4ILRA 5T7LB 3M6VA 3THVA 2MQQA 1RA6A 3FEXB 3GIIA 3AA8A 4WU2A 4BHQA 2W9BB 4OI2A 1HNVA 4RW6B 1JLFA 1XC9A 3CC7S 2XZWA 4XAKA 3I9V9 1CC7A 1RT7A 3T5LA 3E8OA 4DL2A 1ZM3A 2KFZA 2QLXA 4O4GB 1FERA 2K7JA 3I32A 1S6QA 4L72B 2QMXA 1S6PA 2OP5A 2U1AA 4A8YA 2HWTA 2F4VF 3HDSA 4F4WA 1X5PA 3CGIA 5KFIA 4DSFA 4GO5X 1S99A 5D4NA 2MQNA 1WACA 4YB1P 4WK1A 1H2VZ 4UY85 1VRUA 5KFEA 4QR0A 2POKA 3T9ZA 1RISA 2KVIA 2YKPA 2OD6A 2VH7A 5KFKA 2YNHA 4JI7F 2RVJA 5GAEU 2FD2A 1U2RA 1H0HB 3C6UB 1BQXA 2N4DA 3FSXA 1NK0A 3R5DA 5DJBA 4OI1A 2M9KA 5KT5A 2HHTA 1U49A 4NLTA 2A2DA 2RRNA 5DGBA 1L5UA 4FS2A 2CQ3A 1OQ6A 4DR1F 2MY8A 2HGNA 5K8OA 2V0NA 2XY7A 1DLOA 1JJ2R 2M52A 3TVYA 3KHGA 4WJBA 4I6AA 3PACA 4RNNA 4Y2KA 4QIVA 3RBEA 3PDNA 4ZHRB 2Y1JA 4A8XA 1W25A 2HHHF 3CJ2A 4NRUA 2ATLA 3MMAB 3CC2S 4BC7A 4X4TA 1N8RT 4B9MA 4X4OA 2JHEA 5KG7A 3FRYA 4K4VA 4C97A 1LK5A 2ALZA 4CQ1A 3PR5B 3L7OA 1BLUA 1HBUA 1SKSA 2B3TB 1Y00A 1FO1A 3C6UA 1L3UA 2HQIA 2OLWA 1UWBB 1Q7LB 3HO1A 3R1HA 2UVVA 2FC8A 3CPWR 1U1LA 4YDDB 5J1PA 5EGYA 5CZXA 3G6XA 1VRTB 3UD4P 2B7CB 3DRYA 4PQAA 1WF0A 4NYPA 1JLEA 3SXLA 3LWLA 2IM2A 4A8QA 2P9EA 4WFZA 2VBWA 1N48A 2F8EX 2R4FA 2ROPA 3CJ4A 1QSYA 1XBWA 3H8YA 3I5CA 1S77D 4LF8F 2HHUA 1CVJA 2ZNZA 1N5VA 1WI6A 2XMJA 3DLBA 1YSJA 2FJWA 4MKAA 1WG5A 4DV1F 5ITHA 4KRWA 2FJAB 1IQTA 3NS5A 4E8UA 3BQ1A 3G96A 1T05B 4IO1A 5CYQA 2O1PA 3Q8QB 1DBDA 4R0EA 2WTFA 5KFOA 1SL2A 1REVB 2M5YA 4G6VB 2XLIA 5LSRA 4J9LA 3S01A 2E5GA 2IA6A 3UR3C 3IAM9 3EPGA 1S1WA 4KTQA 4IR9A 2KJVA 3HMJG 5LJ3Y 3G4SS 3HZEA 4ECWA 2VG5B 2DK2A 4FNIA 2QRRA 5F3TA 4DEZA 3WDOA 4JI0F 4F4KA 4O3RA 3I55S 1G7CB 5DQHA 2IYIA 1UA1A 3PKMA 3LWMA 2MSTA 3NGKA 4C4WA 1H7WA 3R1LA 3KOAA 3UCGA 3V4MA 3J7Z5 4N76A 5L1LA 5A2QY 1C0TA 3NMAA 1RKJA 1FVQA 3I0SA 3RAMA 2GGPA 4RNFA 1SH2A 4ZCIA 3DM2B 4G1QA 4K5RA 4CO2A 4WE1B 4YR2A 4DDFA 5JVGQ 3BSCA 1MNEA 3DU5A 2C2EA 2HHSA 4Q2MA 3EZUA 5JVHQ 2IM0A 1M0SA 1S49A 3ITHA 4OX9F 4P6QA 1Q86T 4QU7A 1T7PA 2PDAA 1D9AA 2DH8A 3NLCA 2XS5A 2A10A 2NLWA 2EK6A 2PA3A 1U1NA 3CCWA 4TY8B 1H38A 2AW0A 3RZAA 4UY8T 5C5JA 2HNZB 2I5JB 4C8YA 1WWHA 2VG5A 1ZAWA 2CPHA 4C3LA 3G8SA 2LKZA 2X1GA 4KHRA 4X4QA 1S97A 1NKCA 1K1QA 4ECQA 2Q3PA 4Q7AA 1VQ4S 3O1LA 4OI6A 1R27B 4ZPVR 2XCAA 4K4SA 3S1TA 4RW8A 5MLCV 3K5NA 2VPZB 2O3DA 1SUQB 2N3LA 4NLSA 2IAJA 1HBOB 5KFLA 3RB0A 1RP5A 3KFWX 2WB4A 3K5PA 5CZVA 5EDWA 4A8WA 2MY7A 3CE8A 2ZH5A 3DLJA 1YVFA 3ISND 3T9NA 3TA2A 4C98A 4ES1A 1OO0B 4M8LA 1XMBA 2BYCA 3MR3A 2MQLA 2LU2A 2M88A 3T1AA 1OPZA 1Q16B 2D1CA 3GG0A 4KQZA 2MXYA 2EI5A 3RB4A 4FF2A 2MGZA 1GNKA 2LEAA 4U9RA 1HWJA 4TY8A 3D28A 2LQJA 2HHWA 4C3KA 1NK9A 4ED2A 3VAIA 3SV3A 1XK8A 1N52B 1YWXA 3OR2B 3BGLA 4DLEA 5FDLB 2GHWA 4NZ7A 3H5XA 2DGVA 2YWGA 4C0HA 5KFDA 2KB2A 4DN9A 5K14B 3NBPB 2V4QA 4J9PA 3S7RA 4IH5A 1LW0B 3ETOA 2FPHX 3GV5B 1QJHA 2GHVC 3W2WB 5AE3A 2VG6B 1FDAA 4NA1A 3GR1A 4PG4A 4H4OB 5B0FA 3B8HA 2FJXA 2VASA 3DDKA 3GSDA 4B3RF 2MMYA 2ASJA 1O5JA 1BQNB 1ZTTA 2SXLA 2MSSA 3AA9A 4RW7B 4R25A 4JI6F 2CQHA 5KFXA 1UEUA 2DBBA 5FJ4A 1JLGA 1YI2S 4NA2A 4IRCA 2VC1A 5IQ6A 2E7WA 5DM6Q 2CQIA 2DNYA 3K5OA 2HWIA 1R31A 2I1RA 2HLUA 3MD3A 5HP1A 1Q53A 1YJ9S 1S72S 4NCAA 4WKYA 1LFWA 3CB4A 4V19J 2PO4A 4TLQA 3KLIB 5HMYA 3VCDA 3JYTB 4K4YA 3CVKA 1CEZA 2DNOA 2PIIA 3PW5A 2AYEA 5J2MB 3T5HA 3OTDA 4K2XA 2HMIB 1BQNA 1TAQA 3MDFA 2QA4S 4WFXA 1N5QA 2CRLA 3DLGB 4NLOA 4QOTA 2XO7A 1IKYA 2VBXA 3BQ2A 3T19A 2BV3A 3TANA 2KYZA 1FRLA 5GAGU 3MOZA 3L09A 3M2RB 2PGCA 2W4CA 3IWLA 4I68A 2F9JA 2BA9A 1HW9A 3MEKA 2DCUB 1IXKA 3RRHA 2WW8A 3QO9A 2LA6A 3J7ZT 2ZH9A 1ULRA 1EETB 2NPIA 4X4PA 5E2QA 4DUZF 3TNVA 1X4EA 3TAMA 2XC9A 2RKIB 5LSLA 2NUHA 4AL7A 2R7UA 1I6JA 2IC3B 2DRBA 3WC0A 4Y34A 1ZPVA 4NCBA 5J2MA 1GX5A 4WCEQ 2QT7A 1TK5A 5A0YA 1KQKA 3IA0A 1UVKA 4RKUC 5GADU 3K59A 2O01C 3N5BA 2ZITA 1LOUA 4DX8H 1X9MA 4ECYA 3CXCR 2JC1A 5C24B 1YJVA 3THTA 4U7UK 3H5UA 2J9EA 4MYTA 5AXKA 3GFYA 3M2RA 3IXQA 3QIDA 5J2NB 1NKBA 2DGOA 2XMUA 1SJFA 2WK4A 3MCSA 1R7IA 1NU4A 1X4BA 2QLWA 3F56A 5KFRA 1KEKA 3BJYA 1FJEB 2XULA 2MB0B 2PMZD 3QIPA 1NK4A 1Q8IA 2K2PA 1S9GA 2DT9A 2COLA 1EETA 3R3TA 1RA7A 3MPYA 4AXIA 3MM6B 1UJ6A 3AB2B 3IS9A 1UVNA 1CG2A 4OHXA 4XK8C 5HBMA 4A48A 3CD6S 2VBYA 1LV5A 3BO3A 3M9NB 1VOMA 1GQEA 3RRKA 3SSRA 2WONB 1TKXA 4J9SA 3Q0AA 4OMFG 4DR3F 1D8ZA 2A2CA 2V5HG 1Z2ZA 3X3UA 1TKDA 1WELA 3VAMA 1RT6A 4B9LA 1ELOA 4OJHA 3M6UA 5KTQA 2DVIA