1SJ4P

Crystal structure of a c75u mutant hepatitis delta virus ribozyme precursor, in cu2+ solution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
95
structure length
95
Chain Sequence
PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords precursor form of the Hepatitis Delta virus ribozyme
publication title A Conformational Switch controls hepatitis delta virus ribozyme catalysis
pubmed doi rcsb
source organism Hepatitis delta virus
molecule tags Translation/rna
total genus 22
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sj4P00
5H1SV 1HD1A 2LECA 2L9WA 2DNZA 2DNRA 2KHCA 2KRRA 2L41A 3ZZZA 3VAMA 2UP1A 2DGSA 3MDFA 2LEAA 4Z2XA 1M1KT 2XNRA 4WFBQ 2F9DA 2RRAA 1R8HA 2O3DA 3SMZA 2F9JA 2M8HA 2HZCA 4J5OA 3FEXB 2LMIA 2DNMA 2U1AA 3U1LA 2KH9A 2JVRA 1FJCA 2QEXS 5LSLA 1SXLA 3G8TA 1SJRA 1N88A 5DETA 2U2FA 5JVHQ 1L3KA 2OSQA 4IOAQ 2XNQA 1WEXA 2LEBA 2FPHX 2OJ3A 1WEZA 2N3LA 3D2WA 2DNOA 4WF9Q 3VAKA 2LCWA 2AYBA 2FC8A 2FY1A 1HL6A 1QVGR 2G4BA 3S8SA 1RK8A 3P49B 4TLQA 1WHYA 1WF0A 1VC5A 4FXWA 3UCGA 2N82B 1X4DA 1Q7YT 3THPA 2MQPA 2HVZA 3VAJA 1A9NB 2DNQA 1X4CA 2MZ1A 5GAEU 2V94A 1YJWS 1URNA 2MZSA 2XS7A 3IWNC 4V19X 4PRFA 2VOPA 4IOCQ 4CH1A 5LJ3Y 1NO8A 1KC8T 1M5KC 1M5OC 3FEYB 3P3DA 3H2UB 1YHQS 5LSOA 1OPIA 1UAWA 5D78A 2CPZA 1OIAA 1WI8A 3Q2SC 2CQ4A 1HA1A 4TU9A 3S7RA 1AUDA 3ZZYA 2WBRA 4QU7A 2CQ0A 1VQOS 1W2BR 3UWTA 1FJEB 1U1KA 3OW2R 1X4HA 5DM6Q 4WFNQ 3THTA 5IM0A 2CPYA 2DIVA 3VF0B 4CQ1A 3CPWR 4RU2A 4F25A 2OTJS 3CCSS 4YOEA 3DXBA 1U1NA 2KM8B 2LA4A 2QFJA 2MSSA 2MQQA 3EX7B 3CCES 2PEHA 5IM0B 1X0FA 2KVIA 3MXHP 2DGVA 3SDEA 2CQ3A 2MQMA 5GAGU 3MUVP 2KM8C 2JVOA 4UY8T 3P5TL 2K8GA 5BJRA 5GAHU 3G4SS 3CC7S 1X4FA 4QU6A 2MKHA 2DGOA 2EK6A 2KG1A 1WHVA 1X4GA 3CUNA 5LXRA 1U6BA 2CPIA 4WKRA 1NU4A 2DNPA 2MKJA 4PR6A 5GVQA 1U1PA 1DRZA 5LXYA 2OIHA 5HL7Q 2A3JA 2GHPA 1FJ7A 1U6FA 2E5JA 1VBYA 2JRSA 5GMKa 1UP1A 2ZJPQ 2RQ4A 3HHNB 2RS2A 1D9AA 1VQ4S 1QM9A 1K73T 1QVFR 2CQIA 1X4BA 1CVJA 1O0PA 1U1MA 2CPJA 1SJ4P 2DGXA 2AYGA 3IRWP 3N9UC 1X4AA 2HGLA 3ULHA 2DNHA 3J7YU 2KFYA 3CCLS 3CXCR 1H6KX 2EVZA 3CF5Q 2YH1A 5DDPC 4LIRA 5DDRC 5GADU 1WG5A 2EK1A 3MD1A 2F3JA 3VAHA 4ZKAA 2MMYA 1VQLS 2AYEA 2DGQA 3NNAA 2XB2D 2MY8A 2MB0B 3B4DA 3LPYA 1SJFA 2DHXA 2G0CA 3NNCA 1VQPS 2NLWA 2RNEA 2CQPA 3BO3A 3CCUS 2M2BA 1X5PA 2CQBA 1X5OA 2RU3A 2VODA 3TO8A 3MUMP 2CPXA 2LA6A 2X1BA 1XN9A 2YH0A 2RVJA 2X1GA 2G1DA 2DH8A 3S6EA 1M90T 2MQOA 2DNNA 2KXNB 4Y00A 2M4MA 1PGZA 1FXLA 1Q81T 1YI2S 5IQQA 1WWHA 2M9KA 3R1HA 1B7FA 1S72S 2MKCA 4M5DB 1VQKS 3UD4P 2N7CA 3MUTP 2DNGA 2CQHA 2LKZA 2RUGA 2X1FA 3S01A 1VBXA 2RRBA 2KU7A 5MLCV 2VONA 1D8ZA 3VAGA 1X5SA 1H2TZ 2DH7A 3SXLA 3G9CA 2FC9A 1WEYA 3UE2A 3UCUP 1K8AT 2M8DB 3CULA 1VQ9S 3CD6S 1YJ9S 1OWXA 2YKAA 4WFAQ 2MKKA 3TP2A 1Q86T 1FNXH 2ADCA 1VQ6S 3CCMS 3I55S 1YITS 2MZTA 3R27A 2MZJA 1VBZA 5DDOC 2QA4S 4C0OC 3UD3P 1H2VZ 2Q79A 4OZ0A 5CYJA 3CCJS 1A7GE 2VOOA 3U1MA 3CC2S 2JX2A 2ERRA 5DM7Q 3VALA 3MI7X 1ZZFA 3RW6A 2MZQA 2AD9A 2D9OA 1H2UX 2MJUA 4UQTA 4C7QA 4WCEQ 4YB1P 4ERDA 1S79A 1U1RA 1JJHA 5D77A 2D3OR 1DZ5A 4TU8A 2I2YA 2MPUA 5HO4A 5ITHA 1WELA 2MYFA 3SDEB 4IO9Q 2KT5A 5CA5A 1WHXA 2CPFA 2HGNA 4OZ1A 1YWXA 2FHOB 3LQVA 2DISA 1VQ5S 1N8RT 3CTRA 3K0JA 4C4WA 3G6ES 2MSTA 2DNKA 1P1TA 2KYXA 3BS9A 2DGWA 4Y0FA 2M88A 1M5PC 4U67Q 1F9FA 2RQCA 2MJNA 4LJMA 3TYTA 1KOHA 3RW7A 2B0GA 2DHAA 2KXHA 2E5IA 1M5VC 1IQTA 2E44A 1K9MT 3NMRA 1VC0A 2DHGA 3US5A 3PIPQ 1VQ7S 1YTYA 1R8PA 2SXLA 1KOOA 2CPEA 2DHSA 4ED5A 2D9PA 2E5HA 2ZJQQ 4YUDA 2MY7A 3G71S 3R1LA 2DNLA 1WF2A 2M70A 2JWNA 1WG4A 2DK2A 1VC6A 2CJKA 5EN1A 1YJNS 5IFMA 2ZJRQ 3CCQS 2DB1A 3CMAS 2BZ2A 2MQNA 2MKIA 5LJ5Y 2XS5A 3MURP 2DGTA 1SJQA 2KG0A 2J8AA 2AYMA 1ZH5A 2OTLS 4QPTA 4CIOA 2LYVA 2ADBA 3BO4A 4IUFA 3EGZA 1U1OA 1KD1T 1JJ2R 2L08A 3NNHA 3JB9k 3CCVS 1OO0B 2GO9A 2DITA 2YTCA 1HD0A 1ZZNA 2BOPA 4W90B 5FJ4A 1PO6A 4QQBA 2KRBA 2J76E 1VQMS 1X5TA 1WTBA 3VAIA 1YIJS 2J0SD 2YWKA 3I56S 1VQNS 1N54B 3CMES 4P6QA 1WI6A 2M7SA 1X4EA 1FT8A 4FXVA 2PE8A 3BEGB 4BS2A 5JVGQ 2XS2A 1JMTA 2LQ5A 2M52A 2DO4A 4EGLA 2DNYA 1KQSR 2NZ4A 3L3CA 2I38A 1WF1A 2HGMA 2CPHA 3B4MA 1FO1A 1U1QA 1JJ4A 1WHWA 2MHNA 3BO2A 4A8XA 4PKDB 1UW4A 2E5GA 2KI2A 1P27B 2DGUA 2CQCA 2K3KA 4F02A 2RT3A 1VQ8S 3VAFA 5DDQC 2RS8A 4WIIA 4TU7A 1N52B 2CQDA 2HYIB 2XSFA 3H2VE 4F26A 2CPDA 2LXIA 3Q2TC 2MXYA 1DBDA 1FHTA 4CH0S 2CQ2A 1BY9A 3MD3A 2MGZA 3CC4S 2OSRA 2KN4A 1G2EA 3G96A 2M0GB 1U1LA 3G8SA 2LXUA 1Q82T 1NJIT 3P6YC 1RKJA 2CQGA 1SJ3P 3UCZP 2N3OA 2MQLA 1DHMA 2MGZB 3DLLQ 2X1AA 5CXTA 1WG1A 3NS6A 3V4MA 2MZRA 4W92B 2CQ1A 3CCRS 3PIOQ 4LMZA 3MOJB 3HI9A 2DIUA 2MKSA 3NS5A 1UFWA 3J7ZT 2DO0A 2J0QD 2KXFA 2DH9A 1U2FA 3EGNA
chains in the Genus database with same CATH superfamily
4BWMA 2J6UA 4GC6A 2OP5A 5F8NA 4WP3A 3E01A 2KRRA 2KHCA 4B9TA 3N6NA 3K5LA 4OZ2A 3TA1A 3MDFA 1M1KT 4DHVA 3FUYA 1R8HA 1XTZA 2WAQD 3PHTA 1NH8A 1HBOB 3MAAB 1VLOA 5F0UA 3SIPB 4ZJQA 4DX5A 1HWJA 2LEBA 4RPFA 4C9DA 1U26A 1GXLA 3EDQB 4HACB 2XY6A 3C6UA 3ISNC 5EHHA 5HMXA 5GMDA 2XS7A 1RWKB 3H2LA 2ASLA 1UW9A 3P3DA 1SKWA 4C97A 1H7WA 1LKZA 2EC0A 1Q53A 4ZS6A 4QBUA 4NLUA 2A2DA 4NEZA 2NZCA 3EXYA 3MWBA 2KM8B 5CAAA 3EX7B 2NXJA 4MT1A 4NL5A 2JOQA 3TAMB 5GAGU 1DAXA 4FF2A 2BRLA 8RUCA 3Q8RB 4CYUA 2E1CA 3VGTA 3K8WA 2W7OA 2R7RA 3HHNB 5KFIA 3M9NB 2GGPB 4JOUA 2YWWA 5C42A 3CJRA 2KFYA 3CCLS 5A8KA 3SCJE 2PO4A 3PYGA 3PXGa 3MD1A 5D0RA 3VAHA 3D0IE 3UN5A 1JLQA 2P2CB 1OSCA 4OYXA 4DV3F 2VJVA 4KO0B 4E8UA 2DHXA 2BE2A 2UV8A 2ZD1A 2C2OB 4XDCA 2RU3A 1SUQA 3NGUA 1IBLF 2J0XA 2W25A 4OZNA 3ET6B 4USIA 3KJNB 3MAQA 3CD0A 4FNHA 5KFSA 2IRUA 2WSCC 4LRCA 4O3NA 1RUSA 4USHA 3FDSA 1VQ6S 1BLUA 3T6JA 2MZJA 5DG8A 4X4SA 1NK0A 5HBMA 3DDNA 2MLXA 3IGVA 3MM9A 4NRTA 3MI7X 1SB6A 2XMVA 5ETPA 1RHMB 3P5BP 2HPUA 1LWCA 1NK4A 4GKJF 2MPUA 3HF5A 2WSEC 4CNZA 3OXFA 5H9FK 4C8MA 4Q44A 1MROA 2DISA 5HROA 1WSVA 2XBPA 5IV3A 1S4FA 3KG4A 2LDIA 1F9HA 5C24A 2I1RA 2KYXA 3GJTB 3GIIA 3GFHA 1M5PC 3OHAA 1GAOA 4LIWA 3H90A 3QGPA 5J1EB 4O0IA 2NQPA 2C2DA 3N5FA 3MECB 4F4ZA 4DS5A 2OMOA 4UT4A 1KS2A 4QWBA 1T02A 1WF2A 2K7JA 3GJSB 3SI8A 5F8JA 3HHLC 1RAJA 3LGHA 3VQTA 4HACA 2O01C 2DGTA 3UFCX 1Y4ZB 3HP6A 1Z2ZA 1I1GA 1P8GA 1C4AA 4P72A 2DY1A 2RKIA 2YTCA 2OO4A 4QR1A 4DV6F 1HYSA 1PO6A 2VD3A 4AQYJ 4U96A 1GH8A 4DPTA 1N54B 3PW0A 1PC4A 1JJCB 4Y34A 1RWNB 2M5YA 2XS2A 4PG8A 1NDPA 1YRXA 1V5IB 1SVDA 3CGIA 5T14A 2GIRA 4EBEA 3IGNA 3TAMA 5L1IA 4QR2A 3HZEA 3K2YA 4U6PA 1F3VA 4NOHA 2KI2A 3V6HA 1P27B 3CD7A 3GIKA 2IBOA 2Z2LA 3GV8B 4HTIA 1Y3KA 1DBDA 3W2VB 4ANCA 1TFWA 5AJ3J 1LOUA 2XMWA 3TUIC 2GGPA 3C16A 2YWGA 3I4HX 1VRTA 4TY8A 4NXMF 2BW7A 2BABA 1WG1A 3DLHA 2K7KA 3IAM9 3DRYA 3TEHB 4G3IA 3P45B 4KO0A 4B3SJ 1F5AA 3OTBA 2RRAA 4XPEA 2HK2A 2LMIA 3TA0A 2UUAF 4DSFA 2DTJA 3NBPB 4PUOB 1K44A 5E2QA 4ECQA 3BPDA 2BJDA 3G8TA 3IMQJ 4X66J 4IKAA 2FPHX 3ET6A 3GONA 4I7FB 1NHUA 2KHDA 2AYBA 3VWSA 4LSLB 4OYBA 1RT1B 3BF4A 4DN9A 2MQPA 3DLEB 3VZIA 4UZBA 1X60A 4BDPA 4K4YA 3QWUA 2O1PA 2CQ4A 4RUBA 4GKKF 3FNNA 4HR2A 3KLVA 3M6WA 1Q1KA 3MFIA 2VC0A 4WXWA 3THTA 4RU9A 4EUVA 1DJ0A 2AMCB 3HX9A 3DGVA 5IM0B 1LV5A 1D8YA 4USVA 2C2NA 1KVKA 4ZPCA 1S9FA 4LBIA 2UXDF 3QNWB 1AW0A 2C22A 2F7VA 4PR6A 1CG2A 1RI7A 1FD2A 3J7Z5 3CCTA 1UP1A 3HVTA 2RQ4A 1VISA 2ZC3A 4DR5F 2CQIA 1MWQA 2YX4A 1HI8A 3FCWA 2V68A 2CWKA 3BYPA 3TUJC 2RH3A 1GTHA 2IJNA 2OPSB 3FSYA 1JKHB 2CVIA 2WVEA 3KLGB 3FRZA 3EZUA 3CO9A 2ZUAA 2RB7A 4HH1A 1YJVA 3MR2A 1UEVA 4DV4J 1U49A 1VBKA 2MKYA 1IKVB 1NHKL 3AJDA 2R8IA 2DNGA 1XC9A 4D3GA 1VQYA 3ENQA 2B4VA 2HWTA 5KAKA 4O0NA 1S48A 4YR2A 3TUZC 2VV5A 1UJ6A 5HMWA 1S0NA 3RW6A 4ZLJA 2APOA 2YNFA 2PD1A 2D3OR 4GO7X 3DHWC 4JI1J 4IRDA 3W2VA 1JWWA 3OSNA 1NUEA 4ZLNA 3QSIA 2CZ4A 1VQ5S 4C11B 3PDNA 3G6XA 1FNOA 3W60A 1I6JA 3G6ES 2RQKA 3W63A 3MEDB 2XO6A 2W9AA 2XCAA 3NAIA 2FJBB 3BKFA 4EO8A 1F9FA 1FRMA 2R7VA 3N0VA 2UV8G 1SKRA 1PAEX 5AXMA 3NRBA 2V63A 3QBCA 4UOGA 2CPEA 1UZHA 3V4IB 3NBPA 4N41A 4PUOA 3D1OA 3JQJA 4USWA 2M70A 3R6LB 3CCQS 4OI2A 4LSLA 1RT1A 4WYLA 3GIRA 1RB0A 4DR3F 3G8QA 2ADBA 4IG3B 3HSJA 3DLEA 1WJ9A 1NNDA 2BOPA 1EZZB 1TZ0A 4C3MA 3JS9A 2G2ZA 1YIJS 4B3TJ 3ENAA 2ASYA 3MEGA 4OYAA 4P2XA 2BJ9A 1FEHA 1HW8A 2Y1RI 1EKRA 5J2QB 2LQ5A 1KFSA 3IFEA 1C4CA 3MEEB 1EB0A 2NZ4A 2J7KA 2E1RA 2CPHA 4DL6A 1U1QA 3GIMA 3IM8A 2HFSA 2DGUA 5LOQA 2IA0A 4CO2A 2CXEA 1MSWD 1RAHB 4X4NA 5B0FA 2H5IB 1HWUA 4M5IA 4I6AA 3R6GB 3NCPA 3AHPA 4ZCKA 2VFSA 1JKHA 2DO0A 2J0QD 1KBRA 1RTDA 5KG0A 3KLGA 4DUZJ 4S0MA 3UQSA 1FJGJ 2DCUB 3KMQA 2HG4A 3KFWX 1XNQJ 3NL0A 1EP4A 2H54B 2YXLA 4ZPDA 5DETA 3NP5A 2OSQA 1IKVA 4CTAA 4IOAQ 2COLA 3PRVA 1X9SA 1WEZA 5KG7A 4ZVPB 2DNOA 3FMBA 2FLLA 4RW8B 3RBZA 3R5AA 2ZZMA 1WF0A 2PMHA 3UCGA 3NGKA 4JV2A 5ETTA 3AQPA 3GCXP 2GHVC 3FBBA 2CG4A 1KC8T 3RRGA 2ZC4A 2OEMA 3DU6A 3JAMU 4DU8A 2XQCA 1M5SA 4YN3B 2A6MA 2E9ZA 2XLKA 1TFYA 3F56A 4LF8J 3AB2B 2IPOB 5CZXA 1MNEA 3UDEA 1F60B 3AT1B 3CCSS 4HDHA 4AUKA 4CLWA 3PRDA 2DXEA 5HLFA 3AOAA 1X0FA 1Q5VA 1Q5YA 3R5GA 3ZNUA 4USMA 3GJRB 3G6YA 3CC7S 4B9MA 3IBFB 2PSZA 4C11A 1FVQA 2VG7B 3PR4A 5GVQA 3CDBA 4K5SA 1Y0HA 4PCQA 3I96A 1F0XA 2AP6A 2DR9A 1FKPB 3OQ2A 3GB0A 5DDRC 1KNZA 3CJ5A 1JLBA 1RT3B 3V4IA 2ZDPA 2K2PA 4ZVHA 1UA1A 1GTEA 2G0CA 4ECRA 2QZ8A 1UPMB 4ETXA 4UOHA 3KNAA 3BO3A 2W2PP 4N8NA 2IBKA 4CRJA 1T9UA 3V2UC 2QMXA 5CD4A 1CEZA 1M90T 4HH0A 1UVIA 1HBNB 3L7PA 1WWHA 2M9KA 4UOCA 1NK5A 4I67A 1IBMF 2XEXA 2X1FA 4YHHF 3BZQA 5F8IA 3DFEA 3FGVA 1RT4B 1NMEB 1VS3A 4ES3A 4OJGA 1SH2A 3BYRA 1HHTP 4L72B 5J2QA 5HQMA 4F0KA 4WE1B 3UD3P 4G1QB 2ZNYA 1YJTA 5M2UA 4DV1F 4NASA 1H98A 2P6TA 2FVQA 4UQTA 2D3UA 4AL5A 5HMYA 2Y8WA 1SJ1A 1RDRA 3T3FA 4R5PB 3T1AA 2CPFA 2B7BB 3SV3A 3WQPA 3M2VB 4MIWA 3OHBA 3RBDA 2HHUA 3T5JA 1TL1B 5KFBA 5HSPA 2HHQA 4L75A 3M6XA 1K9MT 1ZBTA 3CDAA 1NAQA 2VB6A 3US5A 3WC2A 5A6WA 4A48A 1WKKA 4P2SA 2D9PA 1Y5LB 2VBXA 5F3TA 3PW4A 2AJFE 3KHGA 1Q95G 1BHNA 2ZE2B 2DB1A 2MQNA 5A8WA 2WVFA 1SC6A 4RW8A 1KVJA 3KHLA 3HVAA 2BYCA 3E51A 5I4MA 2LYVA 5L1LA 4JI2J 4C98A 2CNKB 1LEOA 3M6UA 4CH7A 2GO9A 7FD1A 3KJFB 2OH2A 4ZPBA 4BC7A 4JI3F 3IM9A 2R2TA 5E3PA 2GV1A 4DR6J 4TXSA 5T7LB 5KFZA 3TOQA 1A0OB 3UN3A 2ZH8A 2IMWP 4ZLLA 5D8HB 2QC3A 2G2OA 2CZ9A 1OMSA 4IH7A 1SQGA 1VK8A 1CQMA 1F5BA 1KFDA 4ELTA 3SFGA 2XYHB 4ZVQB 2XSFA 1Q8IA 3R5BA 1FHTA 1FK9B 4N76A 1BY9A 3MD3A 3SEOA 1HNXF 1SIZA 3CC4S 1KHVA 3G8SA 5L46A 2AJ2A 4F50A 1FKPA 2AGQA 1SJ3P 3R7BB 5CXTA 1T03B 4IQXA 3VGVA 4CLZA 2V4RA 1UFWA 1N36J 1RT3A 4UF4A 3BH7B 4YP3A 4PG6A 1JLFB 5DG9A 4WFBQ 4PQAA 4JYAJ 2M8HA 2U1AA 3FSXA 2ACYA 1IKWB 5LSLA 4LREA 2HMIB 2IM0A 1SJRA 3PYEA 2ALZA 5GMEA 2ZH7A 1HBNA 2OJ3A 2RJZA 3OR2A 4GMKA 2N3LA 3DI6B 4YR3A 4ED3A 1N32J 3NLCA 3EE3A 1VHFA 2OMLA 1RT4A 2DNQA 2CDRB 2AHOB 2HVDA 4PRFA 1HI1A 1HNVB 5B7WA 1T8EA 1UAWA 3KJVB 1REGX 1R6YA 4YEAA 2VF3A 4WE1A 4G1QA 5I3UB 2H9ZA 1HIYA 4ZIWA 3OW2R 2CPYA 2HVEA 1PBUA 3GU0A 5KT5A 2PEHA 3G6VA 1FKOA 2DGVA 4I64A 1RAOA 1EIYB 2VFRA 3H20A 3LALA 4PXBA 4C8YA 3M2VA 1IQZA 2CPIA 3HD2A 4MYUA 1U1PA 5ETLA 1DRZA 1A6LA 4X2BA 1VFJA 3M05A 2XMUA 1TL1A 3ZTSA 4YY3J 3NXZA 4ZP7A 1SJ4P 2AYGA 1Q79A 2JHEA 2IYIA 4QWDA 3KWMA 4F4YA 3DLBA 3HVWA 1RCOB 4CZCA 2H4WB 2V69A 2NYIA 1JX4A 2J5AA 2NUUG 2AYEA 1B3TA 2ZE2A 5KFYA 4L76A 3O1LA 1LXNA 4URQU 4OYIA 5FDLB 2GQQA 2HQCA 4FXDA 1XMOF 2GAHC 3MPDA 1Y11A 2LKZA 5F9LA 1FRJA 2KU7A 1KDNA 2R7SA 4JI5F 5T7LA 1UWBB 4HVZA 2P8IA 1FTCA 1FNXH 4FF4A 2HIYA 1NSAA 3IR7B 3I9ZA 1GMVA 1H2VZ 2Q79A 2XZDB 4J9PA 1S49A 3JSYA 4J90A 4OX9F 3CJQA 3N79A 1D3WA 4LBHA 3D1QA 3OSPA 3OL7A 2NXNA 4DFKA 2EEYA 5CZVA 1X31C 2XWYA 2OHDA 5H9EJ 1HNWJ 1FK9A 2V8VA 9ATCB 2VDIA 3D0GE 3I82A 1FRLA 3M7VA 4DG1B 3KJQB 1FDDA 1EJ7L 4B3MJ 3EICA 5F41A 1T03A 1HFEL 1E6VB 3BS9A 4ANDA 1K0VA 3RR8A 5K8MA 5KFDA 3TYTA 4DSIA 3RW7A 2DHAA 3MMAB 3DDIA 1JLFA 3KXDA 2R7WA 1YJ7A 2B8PA 4LF6F 4MYTA 4O3SA 4K4ZA 3GWCA 1IKWA 5E3QA 4CT8A 2A2CA 3KHRA 3DI6A 2EFVA 3FJ2A 2V2VA 3GG0A 4AFFA 4LF5F 1SH0A 3DGPB 4DR6F 1IR0A 1ZA1B 5JXSA 1JJ2R 2E66A 2ALYB 2UUCF 1HNVA 4QYZK 4KH0B 3CDEA 3TRGA 1ZZNA 1Z2LA 1AB8A 3W66A 4JI7J 3BBBA 3H5YA 3B78A 2RD5C 4DPUA 3CMES 3OVBA 5I3UA 3V5RA 4KV8B 4IDKB 4BS2A 4YMEA 2Z0GA 4LR8A 3W3SA 4NLXA 2R8JA 2DNYA 2AW0A 4NE9C 4BWJA 2E1MC 2F4VF 4CLLA 1L3SA 4A8MP 4F02A 4K4TA 4FN5A 5KFPA 3RBEA 3EPIA 1XMQJ 5C7PA 2Y9HA 1H38A 2CFXA 3CIZA 2ZH2A 3ICLA 2OSRA 4A8WA 5KG6A 1VLYA 2EKYA 2ZZNA 2W2MP 1DURA 1NPRA 3ADAC 2GIFA 1ZTWA 2IMOA 1R8BA 5KFKA 5H1SV 4ECWA 1TK8A 2W4DA 4I0WA 2ZKTA 3GIJA 1LFPA 2XNRA 2H5JB 4K8RA 1XNRJ 4RW9B 4OX7A 1BMQB 5HVGA 5FDLA 1REVB 2FLPA 1Q8BA 3OUYB 4B9VA 4M63A 4M5LA 3R3TA 1AUSL 4WPAA 3R5DA 3U1NA 2JLGA 3GJQB 3LGMA 4OZJA 3FBCA 3OFEA 3PVXA 4Y2CA 2IVFB 1MG7A 2QL9B 4FXWA 3BSCA 3VAJA 4X84A 1UWBA 2B7CB 2B56A 2YKNB 2AV5A 4DXLA 3HFKA 1R0BG 4AL6A 5ETKA 3F73A 2AGOA 2ZKUA 1N5YB 4LFAJ 1RHKB 1T94A 3DXBA 4JI0F 4EYIB 2KJVA 2BKNA 1FFGB 3UW1A 2J7UA 2Z2ZA 3H7HB 4DG1A 5C2GA 4ECYA 3CUNA 1WHVA 4O3QA 4TLRA 5LXRA 2B9XA 1RISA 2L48A 3PRBA 2PN6A 2XMMA 1E6VA 5CABA 2GVDA 3QT5A 9RUBA 2B3TB 4QW9A 3CSKA 3TQ1A 4EFAC 3MMAA 1V5VA 5HQ8A 1APSA 1UVKA 3L7UA 1H6KX 2QO3A 3ZZPA 2BRKA 3R8YA 2WOMB 4NI2B 5K14B 1NPKA 3GYXB 2MMYA 1GT8A 2XB2D 2MY8A 5F8MA 4ZHRB 1S59A 3NNCA 2NLWA 3CCUS 4AT1B 2AWZA 4RZRA 2LA6A 3W2WB 1UVMA 2CA9A 5KFMA 2Q43A 4KAIA 4TKTA 3S6EA 1ELOA 4GVBB 1K1QA 1Q81T 3TX8A 2IIHA 1Y5NB 3K5NA 3HFVA 3MUTP 2CQHA 1VBXA 2FHJA 2RRBA 2YNHB 3AD7C 3TZWA 1WACA 3A4TA 3UCUP 3RU0A 2W2NP 3OVSA 4IDKA 1N33J 4MKBA 2YNGB 1PBAA 2HKEA 3T1YJ 1DY3A 4OFZA 1RYSA 1S1UB 3CCJS 1HNWF 3LA0A 3UD5A 1R8CA 2J9DE 4CO1A 1N0VC 1L3VA 1R27B 3HDSA 4N5SA 5ETRA 2K06A 3MMJA 2GFFA 3H5UA 3NWGA 1U1RA 5D77A 4JV5J 1SL2A 4DF4A 2QLJB 5KG4A 1CPZA 1F2GA 2QMWA 4RNMA 3G86A 1UPPA 2NREA 4OHYA 2E5LF 1RT7A 2HQFA 2RQCA 1KQGB 2IVMA 2LU2A 3N28A 2ZH6A 4R8UA 1JLEB 1RAIB 4X65F 1M5VC 3HHLA 3Q8YA 3CJ8A 5IS2A 3D66A 2DHSA 4NXNF 2VUGA 4RW9A 3O8WA 3A1YG 5EWFA 1ZAXA 3G87A 4NMXA 2Z2YB 4DUYJ 1PJ7A 2XLJA 2OPQB 2ZVSA 2QTWA 1NJXA 4F4KA 1HBUB 3ISZA 4DV7J 5A8RB 2MKIA 3DCAA 4P2MA 4ILLA 3GMGA 1RAEB 4ZVGA 5KOXA 4UTGA 1SBRA 4PWWA 2B4UA 2OI2A 4PYDA 4K0KF 3GSIA 2AIRB 3MHYA 1OO0B 2IJFA 1C0UB 5FJ4A 1BQNB 2HFUA 2KRBA 3H0PA 3W7BA 1HARA 1VOMA 3MTJA 5D6GA 2NPIA 4RJVA 5HJXA 4RO0A 2E7WA 3MCMA 1XMQF 3P8BB 3MCOA 4U9RA 1NM2A 4TNOA 3POTA 1PJ6A 1S57A 3CT9A 3KDOA 3MPUB 2YKOA 3D0HE 2WZ1A 2AU0A 3HULA 1KQKA 3T1HF 1S10A 2IDLA 1NZ8A 2KN4A 4O4GB 3FQLA 4USJC 1VIXA 1VI7A 2MGZB 2XZWA 2WOMA 2C3MA 4NI2A 5K14A 1NK6A 2F8MA 3NG8A 2DH9A 5L38A 5KFNA 4HI2A 5DZ7A 2ZH3A 1KVIA 4ZHRA 2LEAA 5D0HA 5AE1A 4DX8H 4BC9A 3GZ7A 5GAEI 3ZTPA 2LU1A 3W2WA 2KH9A 1FJCA 4H4MA 1TUGB 4GVBA 3EZ5A 2FQQB 4J9MA 3UVJB 1HL6A 2FVPA 1FF2A 1BWEA 3I4PA 4ZVTB 2FIUA 2V94A 3MR6A 3IWNC 4X4TA 4EZ6A 4LFAF 3MPYA 2YNGA 1M5OC 4WFXA 1IJFB 5LMUJ 1ICEB 4ZPVR 2HHHJ 5LMNJ 3M2UB 3A13A 5M2RA 2WBRA 2ZOGA 5B0DA 1S1UA 4QU7A 4HHUA 3V81B 1F6TA 3ZFVA 3ZZ0A 4DL3A 4ALZA 8ATCB 4YOEA 2RIJA 1BXNA 2FHMA 4ES1A 3K17A 4DCOB 3MXHP 3J7YI 4QWAA 2H5EA 4LSZB 1DTQA 1Q7LB 1ZETA 3T19A 3Q8SB 4C8NA 3TEGA 2OIHA 2WW4A 3OTOJ 3BB5A 1SC4B 1YZ6A 1P1LA 1NJZA 3HSDA 1N4LA 4C0HA 2GJ2A 3PY8A 2VG6B 4X4QA 3LO3A 1JLEA 2VU5A 2OD4A 5DZ6A 4ZN1A 3ULHA 5J1NA 2FDNA 4JV0A 2EK1A 2GQ2A 3H40A 5HAOA 1EQMA 4PG7A 3CJ0A 1TL3B 5A76A 3PR5B 1FRHA 5SUHA 3NNAA 4JI6J 3CJ3A 1RAAB 3NEKA 1HBUA 4TYAA 5SZTA 5A8RA 5D4NA 2B4OA 5FD1A 2XGPA 3CE8A 1S6QB 3O3LA 3QLHB 2GVZB 4KYZA 3NCQA 4Y00A 1XK8A 4OQJA 2EC2A 4GC7A 2J8SA 1S72S 1UA0A 1N33F 5DO2A 3T1YF 2VH7A 1C0UA 5E3AA 2VA2A 3S1TA 3IG1B 1PYOB 1RTJB 3SXLA 1T7PA 5E3CA 1VQ9S 2BV3A 3N5BA 2PMZD 1OSDA 1U2RA 3OFHA 4Q8FA 4YQWA 2GMHA 1SC3B 4DL7A 1OY8A 4KJIA 4JI8J 4CO3A 4DZDA 2EG1A 1RBLA 3DRXA 3C3LA 2QA4S 5CYJA 1B99A 1LXJA 4X4RA 3VALA 3F44A 3R97A 4QWEA 3B54A 4NLRA 2WVDA 4LF9J 4ERDA 4MFBB 5B09A 1FCAA 4MTPA 4D3HA 4MK8A 4CT9A 4DCJB 5E0OA 2YX1A 4ZVFA 3UR3C 4O4GA 5CCLA 2WONB 1P1TA 4PQUB 3W9HA 3Q8UA 3PJXA 4F3MA 2G9OA 3GTYX 4ES2A 4Y0FA 3IAS9 1FESA 5FIIA 3UNYA 1KOHA 1OPZA 4DUYF 4F2RA 4LF1A 2LQJA 1TK0A 1HKAA 4IFYB 3NMRA 4NZ6A 2AJ1A 3FCHA 4KFBB 2WHOA 2EW9A 4DV5J 1RJJA 2Z57B 2GAGC 3RRKA 1XR6A 1SC1B 1URRA 1ZAWA 4B3OB 3NGDA 1RLCL 5IFMA 3N4WA 1G7CB 2PDAA 4F0HA 2JFDA 4OX6A 3UVJA 1TKTB 4FBUA 2PFDA 1ZH5A 1E6YB 3GPAA 2HS0A 2V8GA 3ETOA 1KHWA 2K3IA 5AE2A 1NZAA 4BHQA 2J76E 1W26A 2YWKA 1VDHA 3V81A 2HFOA 2BOAA 2UXCF 2XTJP 3HKZD 2A18A 1WUUA 3BH6B 1JMTA 4FF3A 5EX3A 3FC9A 2R9LA 5T41A 2HGMA 2VQEF 4IR9A 2O66A 2ZH9A 1EKSA 4AXIA 1WHWA 3BO2A 1JXLA 1UW4A 2I6WA 4PG5A 3HD1A 2Y0SD 4ECZA 2RS8A 3M9MB 1T9XA 3H2VE 3W9JA 3CEDA 4Y65A 5L8RC 1HQUB 1EETB 3GR0A 4WFYA 4ZA1A 2VG6A 4EEYA 1U1LA 2HS3A 2NS1B 4DFPA 2FZCB 2QMUB 2VPWB 2GJIA 1U25A 2HQ3A 2BR0A 1U45A 2XC9A 3VZHA 4ZVRB 5DS7A 4DR2F 4J5OA 2R8HA 3FEXB 1RQ0A 5MAOA 4KH1B 3GE9A 4EU0A 3SFUA 2AT1B 2GVZA 2ZH5A 4ZP6A 4CCHA 3EMTA 1ZM2A 4QIFA 3FKBA 3VAKA 2LCWA 2XMJA 3QO9A 3LW5C 3IG1A 3MCSA 4WK3A 2DPJA 2ZH4A 5FLXY 3BJYA 4RW4A 4O3RA 5ETOA 5KFAA 4B02A 3MFHA 4V19J 2FVRA 4LBPA 4NCGB 1IBLJ 3L95X 3Q2SC 4FBTA 3J81Y 2C2KB 1PC5A 2CNOB 1FJEB 2OGUA 4CQ1A 2FJXA 3BGRB 4MFBA 4FYXB 5IC6B 1MWZA 1YK9A 4DQSA 2HHWA 3GLJA 3VV2B 1N34F 2BKOA 4QIEA 2KM8C 2L9NA 2EK6A 2LDYA 3GR1A 2ZZTA 4CLKA 2WONA 3DDKA 1U6FA 4PQUA 1YG0A 4NEYA 1H74A 3QIDA 5AXKA 3RB6A 2FZKB 2DGXA 5EX0A 1YBUA 1S9GA 4GKJJ 2P9EA 1RP5A 3CXCR 2EVZA 3O5TB 4KFBA 4CP5A 3HK2A 1DQ9A 4B3OA 3DOKB 1KP6A 4C2MA 2O5DA 1JLQB 1EHWA 4NLWA 1HWLA 3JTNA 1TKTA 1E6YA 3TVYA 5IQQA 4Q7AA 4M5DB 1MMDA 3RGIA 4NLPA 4C3LA 2CUYA 2RUGA 4F3OA 1CS4A 2QV6A 2DRDA 3G9CA 3H59A 1K8AT 3DRSB 3CULA 1OWXA 2I0XA 4NLVA 4OMFG 4PG4A 3KDNA 1AFJA 4LF9F 4A8KA 4YB7A 4KGMA 3NKYA 4UY85 4OZ5A 4LQ9A 4IG0A 3JYTB 4DV6J 3HZGA 3TX0A 4AE5A 1S1TA 2QJ3A 3O6QA 3OTCA 2BUNA 4YB1P 1GK8A 4FPRA 2HAFA 2HVIA 4O4RA 1HQUA 5H9FJ 4OZ1A 1EETA 6AT1B 1UKUA 4B3RF 3QZ8A 1LWCB 4O44B 4F7VA 2FTRA 3K0JA 2FJVA 3VQSA 4M95A 1ZPVA 2AQ4A 2KO1A 1HW9A 4NPOA 4K4UA 2EFPA 2EKNA 4DR4F 1F5CA 3Q89A 3MPVA 4E0DA 1FX4A 2RHQB 3TJ9A 2GO8A 3PO5A 2BMBA 1NK7A 2AKWB 3QSYB 3EGWB 4NXMJ 3BSOA 3TWZA 3C8YA 4KHMA 1TELA 3H98A 3T5LA 2CNLB 4PEOA 2M3DA 2XS5A 2RHSB 4UW2A 3GSDA 1RACB 4WXOA 3U7JA 1I5OB 1NDLA 2AEFA 1NKEA 4QPTA 1R0AB 2PIIA 4LQ3A 1RADB 2HEKA 3JB9k 2UUAJ 4KT0C 4NCGA 1J5OA 4F3QA 2RE1A 1IKXB 4Q0BA 4QW8A 2RKIB 1HYSB 2GNKA 1FT8A 5DLFA 4K4XA 5EDWA 4X62F 3BGRA 3RB0A 2NUHA 2G1HA 4ED6A 1KQSR 1WC6A 1S9EA 2UXBF 1JJ4A 4DSJA 2N7YA 4DF8A 3RB3A 2BJ8A 4QCLA 1U8SA 1VQ8S 3VAFA 4GKKJ 2ZITA 2FLNA 1BWVA 1I51B 3ILLA 1UWAA 1HLWA 2DHHA 2PT0A 4ZDNA 5C2CA 1WC5A 4DL0C 2LXUA 1CULB 5E5NA 3UCZP 2OLWA 4M5NA 2V4JA 3EYZA 2RUSA 4B08A 3C16B 2CZVC 2DIUA 2JC1A 2UXDJ 1VRTB 4TY8B 1C2PA 1ZM3A 1VJWA 2DNZA 4A8QA 3DOKA 3RZAA 5F0WA 5KOWA 4DR5J 4WK1A 3SMZA 4I2QA 1W2IA 3CDUA 2JC0A 5KFRA 1PYSB 1N88A 5JVHQ 4L3NA 4ZCMA 2AGPA 2R8KA 4M5DA 4RR5A 4FS2A 4ZPWR 2KT3A 3LTOA 1N56A 2YVSA 1EQ0A 5CH7B 3UN2A 1Q7YT 2VKRA 3DRSA 1A9NB 2KFNA 1S7IA 3VHQA 3QIPB 1UETA 2EPIA 1OPIA 5LSOA 4UUXA 1OIAA 2KKHA 1GMWA 2GZOA 2EFGA 1AA1B 5K9FA 1T9TA 2KL8A 3BM7A 1SKSA 1X4HA 3JYTA 2DIVA 2W2OP 2BJ1A 4ANEA 2W9CB 2DRBA 3AXKA 3D3CJ 3R9LA 5AE3A 1ZAVA 1S97A 5F8HA 1QTNB 4Y6IA 2XM3A 4O44A 2G2YA 3MR7A 4QWCA 3EGVA 4PABA 4MK9A 4U8YA 1CVJA 2K1RB 2CPJA 4QIGA 4PXEA 4NZ0A 3HVTB 3AD9C 3GFYA 4P75A 2UVUA 4L3KA 1HWIA 1SPBP 5GADU 4PPDA 4QJVA 5BR8J 3BN7A 4RNFA 1TL4A 1VQPS 4RL1A 2CQPA 3IS9B 2RAQA 3T41A 4ID5B 2PFFB 3GP9A 3QFWA 4ZMMA 4I2PA 1R0AA 1N5VA 3KOAA 5KFWA 1NJYA 2FY8A 3D5MA 2XI2A 2BA9A 3S01A 2RRNA 2WRMA 4KHPJ 1H2TZ 2YWEA 1IKXA 1LW2B 2JSXA 2WK4A 3DLKB 1RWWB 5KFLA 3M8PB 2E1AA 1BQMA 4RBVA 4KGZB 1RE1B 2QRRA 1RSCA 3I55S 4YB6A 4DR3J 2XG8A 3M8SA 4OZ0A 1Y5IB 5U47A 2ATCB 1QAXA 2BQ3A 1RLDA 3PEJA 2F5GA 4LF7J 3HO1A 3T6BA 3P4UB 5HO4A 3WHIA 3SDEB 1VQSA 2HGNA 4NX9A 2HBRB 1HR0F 2YNFB 3LQVA 2QG9B 1S1WB 5CYMA 3I0SB 1CULA 1Z4UA 4NLSA 1R8AA 1K1SA 3AJ1A 2ZHAA 1FKAF 5I3PA 4RBTA 3TW0A 1CJTA 4IRKA 3UI3A 2HNDB 4Q2LA 3AD8C 2VA3A 1K0TA 4K59A 2W9BA 3A3PB 1NB7A 2E1PA 2MDAA 3ZNJ1 3Q22A 3W1YC 4FYYB 2ZBRA 3ENVA 4M5MA 4CLTA 4FYDA 2Q6BA 4KR0B 1SV5B 2ZWOA 3KK3A 2ZJRQ 2Q3PA 2BZ2A 4ED2A 2D41A 2RF2B 2HBYB 4NLGA 4XO0A 5ETSA 2J8AA 2HRUA 5JJBA 1RBOB 3GILA 3BO4A 1M5HA 4DPYA 2VKZG 2ILZA 3QIPA 1JB0C 5KT6A 3BGFA 1VQNS 5KTQA 1AZSB 2KFZA 2RDIA 3ENWA 1S99A 1RCXB 2JLEA 2BXJA 2W9CA 3MEGB 3DKDA 1EAYC 1XBWA 1Q16B 4KTQA 2E7XA 1S1VB 3DMJB 4DI6A 2R42A 4PKDB 2K3KA 3M8WA 4N7TA 1RGVA 1N52B 1JLCB 1RT5B 4OJ1A 2WCXA 3BKUA 2PA3A 2F1FA 1FA0A 3W5XA 3L09A 2CQ2A 3MM6B 2K1RA 3IRXB 2HLTA 2BJ3A 5C25B 4YS2A 4DL2A 2G13A 1HPZA 4FVCA 7FDRA 5HI7A 2K8GA 1U2FA 2GQCA 1HD1A 2Q1LA 4Y2AA 3C46A 2DNRA 5I3QA 3QT7A 1RTDB 4HT7A 4KGKA 3IS9A 4ID5A 3IXQA 3WIVA 1TKXB 1B0PA 2OPPA 4OLOA 1G3OA 1FWKA 2HWIA 1EP4B 1RWOB 3AAWB 3RG6A 2DJWA 3MF5A 2WVBA 4OJHA 4CTAB 5KFOA 4OI0A 1VC5A 3H5XA 1AYEA 1LW2A 3CJTA 3DLKA 2MZSA 3M8PA 4DQPA 1NO8A 1KRPA 1YHQS 4ZVOB 2C2ZB 2WSFC 1IJEB 4X4PA 3L9ZA 5HATA 1IBMJ 2D3ZA 4DPXA 4YHHJ 1U7LA 4BBYA 4Z7CA 2ASDA 1S76D 2IY5B 2MHEA 4LF2A 3NOGA 1TUWA 3SDEA 2HURA 3ZO7A 2KTQA 2MKHA 1S1WA 5HLFB 3I0SA 1RU2A 5JMNA 2MKJA 4FZVA 4DV1J 2R7TA 2R2UA 3BGUA 4F4WA 5BR8F 4OI6A 3A8IA 2HNDA 1YZ7A 4XTTA 3FCVA 3SQGB 2B9EA 1WOOA 4J9KA 1X8DA 2QT7A 3CJKA 3BDEA 2J9CA 4P7VA 2OD6A 3OPKA 1SV5A 3T5KA 1JLBB 3Q0AA 1NSQA 4WZMA 2RF2A 3QATA 1FDNA 3TO8A 3MUMP 5HANA 1XN9A 4KHPF 2NR0A 4NYOA 2DH8A 2N4CA 2MQOA 4ECXA 2IM3A 3Q8QB 3K7RA 2F65A 3DOLB 4ED0A 1UJ4A 1CC7A 4ZOSA 1MU2A 1U6ZA 2ZBIA 3NY0A 2V2QA 2FHKA 3J80Y 3PM9A 5AXNA 1C1CB 1AZSA 2HFVA 2DPIA 4OX8A 2ADCA 5K5MA 1G1XA 4LF7F 1V3ZA 3QYYA 1S1VA 2JDJA 3DMJA 1D9FA 1U0HB 4AXJA 2MZQA 1H2UX 4JI3J 3CJSA 2RILA 1CQNA 4WCEQ 1JLCA 1RT5A 4TU8A 1AROP 4IO9Q 3MM6A 2KT5A 3HHKA 3I5AA 2CRLA 2OEKA 5K8OA 1S4EA 3IRXA 4DS4A 3CTRA 1X0PA 5D0EA 1TVRB 2Y1JA 6FD1A 4C4WA 5C25A 2IC3B 3QT8A 2NCKL 1NKCA 2M88A 4J9UE 1IN0A 2JEIA 1VRUB 4GVLA 3PKYA 1HNXJ 1R8PA 3VGUA 3KYLA 2E5HA 2ZJQQ 2MY7A 4X64F 4DU7A 5G0RB 1TKXA 4CLSA 1B0TA 1WG4A 4OYOA 3CMAS 1KTVA 4DR1F 4NCAA 3MM7B 4C8ZA 2V8PA 1G6BA 4WKYA 4KQZA 2Z8QA 1TKZB 4Q2MA 5A8WB 2ROEA 4DJBA 1KD1T 2L08A 3RBXA 3NNHA 1QAIA 3CCVS 4UOFA 2LP4A 4Q45A 1GQEA 3RAMA 2EBGA 4TN2A 3PX4A 4YB5A 2YBVA 4ZVSB 3CIMA 5IT9U 4ETZA 1U2CA 3IBCB 1LW0A 1CJKA 3OLAA 4FXVA 4C3KA 5JVGQ 1KSPA 3J7AN 4B9NA 3CJ2A 3D28A 1Q78A 1TKDA 3IC1A 2DO4A 2I38A 2W2QP 1RKIA 1FD8A 5HP1A 2XYGB 3RR7A 4C8LA 4OI3A 2RT3A 3RJMB 4TU7A 4WFZA 3IO1A 4FDFA 3QAEA 1S0MA 2HBZB 3DRPB 1XEZA 4CH0S 2Y8YA 4QR0A 1N0UA 4IFVB 2AEMA 5DGBA 5A2QU 3P6YC 1RKJA 3V6DB 4F8RA 2VICA 1FRKA 3DLLQ 2HRTA 3M2RB 2CWXA 2IAJB 1XQIA 3HI9A 3SQGA 3TAPA 5DGAA 1NK8A 4LRDA 2AZ3A 4NLYA 4J9QA 1QTMA 2CJYB 4Z2XA 3BR9A 3ZTOA 3CD5A 1PSDA 2J9DA 4AYBD 2R2RA 1DQAA 3D67A 4ILRA 1JLGB 2QEXS 3TARA 1UJ5A 3ONQA 4PZVA 3DOLA 1N48A 1H73A 2B43A 4LUBA 1T0TV 3S8SA 3OR2B 2ZBPA 4DOZA 1FFWB 1C1CA 5GAEU 3HJVA 4URSA 1YJWS 4IOCQ 4ED1A 1TP7A 2H48B 1FE4A 3EWGA 1YBTA 4KY3A 3KG0A 5KT7A 5GAHI 2CJ9A 3WZ0A 1XMOJ 2QLBB 4TU9A 3ZZYA 4CLFA 3FFIA 4NYPA 1U1KA 4JBCA 4DQQA 3C14B 5D15A 5C5JA 5DM6Q 3GV7B 2XY7A 1U0HA 4CM0A 1QE1A 4JI5J 2IRYA 2VZ9A 4GRSA 4B9SA 4ED4A 2LQBA 3M32B 2DGOA 4WIQA 2PMWA 1TVRA 1MN7A 1YKWA 1FKOB 3PW2A 3DNCA 4OX9J 4F04B 2IC3A 1BQXA 1FJ7A 3BGOP 5GMKa 2AX0A 2FZGB 4EK2A 3M4XA 1X4BA 2JH3A 5I42B 2D1CA 4K2JA 1VRUA 2WBMA 4ZJLA 3J7YU 2DR7A 1XJWB 5B0AA 5DDPC 3NMAA 1WG5A 2HHTA 4HKQA 5G0RA 2VDHA 1M1HA 2MB0B 2KB2A 3LPYA 4I1TA 1SJFA 3PV8A 1F9EB 2YY3A 3MM7A 3OJSA 2HHSA 1ZA2B 4DLEA 2DY9A 1S0VA 1VR6A 1ZPWX 1TKZA 2X1GA 4B9UA 3J7A1 2DNNA 3SSQA 1SH3A 2M4MA 2WB4A 4LF6J 3NGRA 1YI2S 4NA2A 2AEJA 4RX6A 4WP9A 4FF1A 2MKCA 1ITPA 3LP1B 2N7CA 2UVRA 4MIBA 2XY5A 3NAHA 2YPYA 4Z37A 1B64A 2M8DB 4ZK7M 4WFAQ 4U8VA 5L9XA 2ZOMA 2ZFHA 4LF5J 3CCMS 1YITS 3QPIA 4PYAA 2VG5B 4G1IA 2UUCJ 1KTQA 3IWXA 4JI4F 1LK7A 4N77A 4DMZA 3EXCX 1DTTB 3DLGB 3SSSA 3CB4A 2I2YA 1O8BA 3DRPA 4EO6A 3OT9A 4IFVA 4NLOA 3QMQA 4Q8EA 3R5JB 4M5JA 3V6DA 2FYXA 4KGVB 2F4VJ 4HHHA 3M2RA 2DGWA 2IAJA 4ZVUB 1H3DA 4CO0A 3PW7A 3I31A 3GG1A 5J2MB 3KLIA 1J27A 1S77D 4JB8B 3PIPQ 1VQ7S 1VCTA 5EUHA 5J2PB 2IDEA 2QGFB 2Z30B 4KPYA 2F8EX 1JLGA 1N6QB 4EI2A 4HL9A 3KLFB 4DFJA 2HS4A 3D6HB 3D6MB 2PI4A 3O44A 2ZH1A 1VRQC 2GX8A 1QUVA 3M1VB 3K5MA 2GHWA 3JQMA 4QYZJ 2A6OA 3ZZUA 3VVUA 2CJXB 4QQBA 1YX2A 4LF4F 4E98A 5CYQB 4PAAA 1Q4RA 1UL3A 2YKMB 3C14A 3MMBB 1WI6A 3ZC4A 2ZM6J 4L6V3 3BN4A 4DN0A 2HQDA 1Q0NA 4EGLA 3CO0P 5THWA 2UUBF 1ZTTA 1WC0A 1Y10A 3GFXA 3M32A 4ZPTR 2CQCA 4F67A 2Y1LB 3KLHB 3TJAA 2LXIA 3Q2TC 1Z1ZA 5RUBA 5GADI 3ZZRA 3RB4A 5I42A 2M0GB 4JI0J 2F4FA 2XMTA 1DHMA 4KB7A 5IWAF 2HHXA 2MKSA 3J7ZT 4W90B 3EGNA 3K5PA 2V8HA 5AT1B 2BACA 4CI0B 5B0EA 2YX7A 4KBIA 3NWRA 3VAMA 1HBOA 1R3NA 3MAAA 1S6UA 4F4AA 2F9DA 1IBKJ 2HZCA 2V8DA 4QIWD 1LK5A 4HI1A 5F8LA 5ETVA 1NXIA 1GX6A 4F0MA 2BJEA 4DPWA 3LP1A 4WF9Q 2IA6A 4M1KA 4J9NA 1RYRA 4KHRA 3Q86A 1GX5A 3SZ2A 1RT2B 1XR7A 2Z56B 1T3OA 4BLGA 5FLXU 1M5KC 1RABB 3H2UB 4ITSA 2FB0A 2CPZA 4LFCF 2VG5A 5HJYA 2VBZA 2QSWA 4K2XA 4OLPA 3J81U 4F4XA 1J2VA 2VFVA 3QT6A 3QAUA 1DTTA 3DLGA 1CLFA 1QY7A 1ULRA 2CQ3A 2KDOA 2OFGX 4ZIVA 2XLIA 3EJMA 3IR6B 1X4GA 2POKA 3FVYA 4WKRA 3SCLE 1DFDA 3EDRB 5E7OB 4DQIA 3TJ8A 1D9AA 1VQ4S 3TVKA 3FRYA 4CNYA 1CJUB 5J2MA 2GVDB 1OYDA 3BKTA 4Y2IA 5J2PA 4H4KC 4NLDA 1P9QC 4RNHA 1N6QA 1BC6A 3WIUA 2JNJA 2E5LJ 4M5HA 2XHCA 1DARA 3KLFA 2JL9A 1JK9B 2KYZA 3LOUA 4KIAA 1V6HA 2Z4PA 1X5PA 3W65A 3EUNA 2OFHX 4X65J 4LRFA 5KFVA 1UZDA 3M1VA 1PIEA 2BM1A 1MMLA 3PJWA 2DKOB 4NXNJ 4DL4A 3E2EA 1OS5A 3U02A 2ZOFA 3NGTA 3DLJA 2FGCA 5MLCV 3D6TB 5CYQA 2H1YA 2DH7A 2E9RX 3W62A 2YKMA 2YKAA 3MMBA 2HQIA 3K5OA 3TP2A 4PXCA 4IYQA 4LRAA 4J9SA 3TVZA 4OZ3A 3WX4A 2IFXA 1W7WA 4U7UK 2EBEA 4K0KJ 1OQ3A 2F40A 1ZZFA 2L9DA 5F8GA 3KHHA 4LVNP 1YGYA 2GCFA 1S79A 3LF0A 3KLHA 1R6VA 2BW2A 2J7WA 3HPOA 2X7IA 3D3BJ 5G4DA 1WHXA 2BM0A 4A8SA 2MLYA 2ASJA 4RW6B 1TMJA 5IXUA 3D4JA 3PNIA 4RW7B 2DNKA 3QRQA 5J1EA 1SKUB 1FDAA 3KK2B 2E7VA 2YQ0A 2QYGA 3MECA 1OYEA 3BSNA 5DG7A 1FFSB 2AJ0A 4ZCIA 1PJ5A 1RT7B 2Z58B 2HWHA 3AY0A 3T1HJ 2DHGA 2E29A 1I3OB 1YTYA 2W7AA 4R8UB 2DYAA 3C15B 3HHLB 2DNLA 1D9DA 4CLPA 5KFHA 2JWNA 3FSIA 5B0BA 1MMNA 5B0GA 3JSBA 1IR2A 5KT3A 3MURP 1LWFB 2KG0A 1PKUA 1RT2A 3AFGA 4CLUA 4CIOA 2OEJA 5J1PA 4NLTA 3EGZA 4MKAA 1U02A 2W4PA 1N5QA 1RHRB 2YKQA 2ZM6F 4RUHA 4ECVA 1TU0B 2IYGA 2DITA 2IHR1 5KT2A 1WTBA 3I56S 2JEFA 2XZTB 3D68A 4ELVA 2O67A 3K89A 5DQGA 1X4EA 4B17A 3ETMA 4M94A 3RTVA 2C3YA 3L3CA 3OJUA 2X3DA 3B4MA 1UVNA 4PWDB 4OYZA 4A8XA 4HTJA 3QJPA 1YQHA 4U7CA 3W9IA 3A12A 4USTA 2BQRA 3POTB 1PILA 3M8YA 3OFGA 2DD8S 1G2EA 4RLEA 3R2CJ 1CJUA 2VHGA 1DLOB 2MQLA 2X1AA 1IBKF 3V4MA 3NS6A 2MZRA 4LMZA 3LH2S 1B4SA 4MK7A 3D7SB 2EWHA 5KG5A 2YWHA 1F2HA 3MPWA 2UVWA 2FJAB 2J9EA 3ZZZA 4M5GA 2UP1A 5HVHA 4WU3A 5K8PA 1AXQA 2R7QA 2VPYB 2JVRA 4I7FA 2FGOA 1NDKA 4AQYF 4ZP8A 4DR7J 2GA7A 3PX0A 4KE5A 1RZMA 4M5KA 4H4MB 5KFJA 2DT9A 1QVGR 4P52A 3P49B 4TLQA 1RTIB 1X4DA 2C1EB 5CD4H 2GW8A 2MZ1A 2JFKA 4W98A 1RWPB 3G2XA 2DEIA 3S7RA 4ZLPA 3K8VA 4OV1A 1W2BR 5IM0A 4KC5A 2V2ZA 3GFZA 2OUGA 5AJ3F 3SYZA 1B0VA 2LA4A 4TYBA 2QFJA 2MQQA 1UVJA 3H42A 4L73A 4RBUA 2C28A 3B6BA 2MQMA 3SBMA 1RTHB 2NYHA 5BYRA 4OI4A 4RW6A 3AOCA 3R7NB 2DVIA 1FE0A 4RW7A 1Q8KA 2VJUA 1QAYA 5DQIA 1DTQB 5J2NB 1I94J 3KK2A 2E5JA 4B3SF 2ZJPQ 3MR3A 3DXSX 3QGIA 1TK5A 1K73T 2OPSA 1XIQA 4YFUA 3OTDA 4R0JA 2KZMA 3LWMA 1GFWB 3CJ4A 3M30B 2V50A 4ILMA 1XERA 2MEWA 1QSYA 4LIRA 4X66F 3KKFA 1UEKA 2F3JA 3C15A 1MW7A 4CDIA 3HFZB 2FVSA 4I6YA 2EFNA 1R89A 2PA8D 3B4DA 2BE9B 3SQOP 2RNEA 2EFQA 2XSJB 2D7SA 1LWFA 3MMCB 2CJBA 3NGSA 2X1BA 1NHVA 4IR1A 3LWLA 2H51B 4H4OB 1RA7A 3PEHA 4G1PA 2PI5A 3W8GA 3VAGA 1YRUA 2ZNZA 1WEYA 3UE2A 1FNMA 3BSAA 4KKOB 3W5YA 1YJ9S 4NRUA 2UZAA 2H4YB 3R27A 2JEGA 3LP0B 2QN6B 3Q8VA 2CJAA 4PWDA 2XULA 3C2PA 1N5SA 2DRAA 2Y0BB 4R0EA 2MJUA 3GV5B 4QPXA 1VIOA 3AXMA 4DUTA 2UXCJ 2MYFA 5K20B 5A0YB 1HNZJ 3MEDA 4ENOA 1S0OA 1T95A 1N8RT 4UUWA 2VQEJ 1L3TA 1DLOA 2V4QA 4QZVB 4KGXB 5L1KA 1U09A 4U67Q 2D74B 3BR8A 3ZZTA 1TL7B 3ZTQA 1R31A 4DV4F 3HCXA 2AX1A 2SXLA 1RHJB 4P7TA 2HHVA 4NLQA 3QZ7A 2ROGA 3PX6A 1VC6A 2CJKA 3PYDA 1HQ2A 2QX0A 1WSRA 2X51A 1FDBA 2FJEB 4IG3A 1LQ9A 4O3PA 3DHXA 1YBAA 4P73A 2KJWA 5KFTA 1RTIA 4OJ3A 1WTFA 3I5CA 4DR2J 3R5CA 3T9ZA 1NSPA 5HQLA 3WDOA 2CNNB 4C0BA 1TAUA 3ELHA 2HZVA 1P6TA 1S5ZA 5CQGA 2J0SD 2IRXA 3MEEA 4DV0J 3MAHA 4JI1F 3C6TB 3LANA 3AQOA 7AT1B 5HN0A 1X9WA 5IV4A 3EPGA 3KLEB 4FS1A 5HMZA 1IUJA 1WF1A 1XMBA 4OYPA 3PFOA 1GEHA 1RTZA 1UFKA 1RTHA 2VFTA 2B9YA 2YKPA 3RAQA 2E5GA 1V3RA 3WBZA 4WIIA 2JEJA 2UUWA 4JUZA 4F26A 3H4DA 5J2NA 2QE5A 3Q83A 1FERA 1K47A 1D09B 1FTRA 3M8QB 4P71A 4EBCA 4HYKA 3MR5A 2N3OA 3M30A 2GS8A 1N34J 3X1LB 3JTPA 3TZYA 2DR8A 3PIOQ 1KLNA 2V9WA 4A8YA 5KFEA 2L41A 1KR4A 1T11A 2ZHOA 3HT3A 1WOPA 4DR7F 3HHEA 3ISND 2XSJA 2W24A 3MMCA 5L1JA 1OY6A 2R7OA 1SXLA 4FKXA 4A4JA 2U2FA 2W1BA 4H4OA 1X9MA 1WEXA 4B3TF 4J9RA 3H4BA 1UTAA 2XHWA 4KPCA 4N8OA 2EG2A 2B8QA 2XCPA 2ZBCA 3WC0A 1RK8A 1WHYA 1JXEA 1QDUB 4ICLB 1NH7A 1X4CA 4KKOA 4P9SA 4ED8A 3I6PA 3QO9B 4DSKA 4CH1A 4EZ9A 3OL9A 3ITHB 2LQ8A 5GAGI 5D78A 1RA6A 4YR0A 5KFGA 1WI8A 4RW4B 2HNZB 3LP0A 4ATNA 1VQOS 3R2DJ 1KWMA 3VF0B 3BPSP 4WJBA 1B70B 1QSSA 3ILJA 2MSSA 5HVFA 1I94F 2D3O1 2W01A 2VG7A 5A0YA 3MOZA 3QQCD 5BJRA 3G4SS 4OI1A 1X4FA 1TL5A 1H7XA 4DUZF 1FJGF 4BCAA 5LXYA 2HVHA 4KSEB 1FI4A 5EGYA 3NS7B 4Q5VA 1SL0A 1XNQF 4X4UA 3AJ2A 3Q23A 1X4AA 1TL7A 2HGLA 2XMAA 4C6AA 1C0TB 4B3RJ 1FWLA 1S9GB 3JSMB 4ZKAA 4C8KA 4HLBA 4CO5A 1U4BA 2DXDA 3TANA 2C2MB 5JUMA 3LP2B 4DSEA 4DWIA 2N4DA 4W4MA 3BQ0A 4DR4J 1RXOB 2YH0A 1FWPA 2OKQA 5L9NA 3I87A 1KEKA 4EBDA 2F8HA 4CO4A 1VQKS 4XIUA 2FHJD 4LRBA 4LF8F 1IWAA 4K7QA 3HKWA 1UFLA 2QL7B 3BBFA 2P9CA 2VONA 1CC8A 2GC8A 1TV6B 3J80U 4DX6A 1Q8LA 3FQKA 3C6TA 1O5JA 4NA3A 1CS4B 4FP9A 2B4PA 3KLEA 4TVAB 1TR0A 2MQ8A 3W8PA 2V6AA 4ZCLA 2RMLA 3Q8PB 1HNZF 2R4FA 4K5RA 4OYMA 4R5PA 3TR5A 1S1XB 4MH8A 1NPPA 4IG0B 3TZZA 2YQ3A 4IOBA 1S1TB 4X62J 1VK3A 4I69A 1WD6A 4K4VA 3M8QA 4PXDA 1WORA 2UXBJ 3JSRA 2MSTA 3FK4A 2V67A 2WW8A 3UO0A 2PGCA 4FKYA 3H5SA 3HHLD 1HWKA 1IQTA 2E44A 1NBEB 4A8FA 1RWVB 3OR1B 4N47A 2I5JB 4DLGA 1KOOA 1IXKA 4U7UD 3PYFA 4YUDA 3PJ9A 5IOLA 2NSBA 3HSGA 4Y2MA 2YWFA 1O6XA 3KMSA 3D1HA 5M2PA 1YJNS 1T9YA 3FBFA 5LT5A 5LJ5Y 4WZQA 2NPFA 4DV0F 1HMVB 4DV2J 4I56A 1HHQA 4ICLA 1U1OA 1BD6A 4LR7A 4RUCA 2GIQA 4KRWA 3ITHA 3UPFA 2HNZA 3I32A 4G65A 5KFQA 3VAIA 4A46A 1F3FA 1ACMB 3QRPA 4OHWA 3HVRA 3UDVA 4P6QA 2J6SA 2NXUA 4USKA 1RWUA 1J5OB 1XR5A 2HFNA 3E3XA 2C2EA 2M52A 4Q0BB 1GMUA 1NKBA 3HXMA 2JZ5A 3PG9A 2MLZA 1VGYA 2BDPA 3A3OB 4ID8A 1S9EB 5IQ6A 2BKPA 2VL1A 2CPDA 1KLMB 2XWXA 2V5HG 2ACMA 2Y3YA 1HHSA 4MMOA 1C0TA 3HM9A 2EI5A 4R25A 5IT4A 2Q6CA 2CQ1A 3DRRB 2C42A 3JSMA 1AT1B 1U8WA 4F36A 2VC1A 3KNGA 2LECA 4LVOP 3ZTRA 2V4JB 4LFBJ 2J0WA 3LP2A 3RYLA 2HMIA 2XMKA 1ZS6A 2R7UA 2CAJA 3AB4B 4JI2F 3JTOA 1JQGA 1PAUB 3CMQA 4IH5A 4Y3CA 1M0SA 2W8LA 5KG1A 1QJHA 1L3KA 4I2QB 2ZBQA 1IBCB 2ZWPA 1LWXA 1YVFA 4ER8A 1ROFA 5ETMA 2QLWA 2FC8A 3CW2C 2G4BA 2G0IA 3OVAA 1TV6A 3VR1A 3KJVA 3THPA 2HVZA 3MM8B 1NRKA 2VASA 4V19X 3IBWA 3FEYB 1N5TA 1AUDA 2CYYA 2YNIB 4I6WA 3UWTA 3OXGA 1FXRA 1WC4A 4F25A 3GYNA 3AODA 1S1XA 5LL6d 1SL1A 2KVIA 1NJWA 4WP8A 5GAHU 1KKHA 1D1UA 3TNVA 1N36F 2HBQB 2DNPA 4RWWA 2UVVA 3CWJA 3I0RB 5F9NA 2WVCA 2RDJA 2RS2A 2A1BA 1QM9A 1QVFR 4JYAF 1O0PA 2VPZB 4EWTA 3N9UC 1OY9A 2DNHA 1FRXA 3FBEA 3SV4A 1V3SA 3OR1A 1HR0J 2I5JA 3IA0A 1B7YB 2DR6A 2ROPA 3CDWA 5ETQA 4NYZA 1N32F 1GNKA 3AA9A 1VQLS 2DGQA 3QRRA 3HSZA 3OL6A 1RT6B 4WTYA 3O2IA 1WKLA 2CQBA 4IH6A 5L39A 2OPRB 1NB2A 3BREA 4UQGA 2G1DA 2KXNB 1HMVA 3OBIA 3X3UA 4TY9A 4I2PB 3OV7A 1RWXB 3PZPA 4DX7A 2FJDB 2MKKA 3IWLA 4C48A 3EVMA 1VHIA 3CCZA 5A6PA 5DDOC 2VBWA 4MIAA 1BQMB 2VOOA 3KUGA 2C2RA 5BXIA 2R3VA 2JX2A 1S7HA 3BV8A 3B82A 4FPIA 4C7QA 4X4OA 4YY3F 1GXTA 1DZ5A 1PG5B 2P9GA 4CLYA 5LSRA 1Y00A 1KLMA 3K59A 5DRKA 1WELA 1R0CB 3B8HA 3LPEA 4WTOB 3EVOA 2DXFA 3N01A 5CA5A 4ECTA 5H9EK 1W25A 2FHOB 4PPZA 4JV1A 4NWBA 4MKVA 1WDTA 1O51A 5DLGA 4O3OA 3L4BC 3DRRA 3PKMA 5CYMB 2CADA 5KFUA 1NDCA 3OD2A 4P74A 2B0GA 2KXHA 3SSRA 3D6FB 2E5IA 4TQRA 3PFEA 5E41A 8AT1B 4WU2A 1S6PB 6FDRA 2HFZA 1CJTB 1GXUA 2VQFJ 3TUPA 2VBYA 2QSFA 1YSJA 2W9BB 4DV2F 3KTQA 3DGPA 5KG3A 1PCAA 1WNEA 3TZXA 2YPZA 2R8GA 1SQEA 1SJQA 2LLZA 4J7CA 3KK3B 3FMWA 2OTLS 1QD1A 3ILOA 1RHQB 4HHJA 4IUFA 3MM8A 2ZEJA 3HLUA 5HK4A 1HD0A 2B6AB 2ZDOA 4KV8A 2RU9A 1YLXA 1X5TA 1J5EJ 3QWPA 5F3ZA 1NSKL 4ZVEA 2YNIA 1QLNA 2C3UA 4NCBA 3KUHA 2PE8A 3MZIA 1BE4A 3V6KA 3FZ2A 3OFFA 1FXDA 4OL8A 3GCWP 1HNIB 4B3MF 4ZITA 5DQHA 3HMJG 3I5BA 1MN9A 4Z7YA 2HYIB 2XI3A 3W61A 3A8JA 1QUPA 3DU5A 5IT0A 3HJFA 3I0RA 1U0SA 3N6MA 1IVZA 2IM2A 1NLKL 1IM6A 3JQKA 1L5UA 1LFWA 1S12A 2ZUGA 1LNQA 3L7OA 4LFBF 2CQGA 4DPOA 3CCRS 3NS5A 3KK1B 2L9WA 2HK3A 3TA2A 3JXOA 4DDFA 4FYWB 1REVA 5D4PA 2DGSA 1HPZB 3OUYA 3FEZA 3ZXWA 2F9JA 1RT6A 2HW3A 4OYWA 4K4SA 2MTLA 3PCOB 3W5ZA 2OPRA 1T05B 3M6VA 2UU9J 2B51A 2GMJA 3PTWA 3RUBL 5KFFA 4JI7F 2A10A 2XNQA 3LGNA 3BBCA 3D2WA 2HRYA 1YRTA 1FVSA 4N56A 2OPPB 2YKNA 1BGXT 4ZP9A 2V2KA 1U48A 2N82B 5IT9Y 1IKYB 1URNA 2VOPA 2LEPA 4XAKA 5B08A 3JAMY 1YDLA 1N5YA 5E3RA 2B5JB 1HA1A 3GYGA 3G82B 1WDDA 2CQ0A 3C66A 3UDCA 4WFNQ 3CPWR 4O23A 2VIHA 2OTJS 1U1NA 5B0CA 1FRIA 2QYCA 2NXEA 1UMJA 2YQ1A 3MUVP 3W64A 3P5TL 3FZBA 2KG1A 5A2QY 3CNQP 2CVEA 1U6BA 3M8RA 5KFXA 4OHZA 1NU4A 2QA1A 5HL7Q 2GHPA 1VBYA 2HQGA 4H4KA 2BX6A 1ZM4A 4IRCA 1P9YA 1XNRF 1U1MA 1R7IA 4ECUA 4J37A 2Q66A 1CBKA 4HEA9 2NXCA 2YH1A 2GMLA 1S6PA 4LSNB 2CIMA 3SCKE 1SCJB 3VGSA 5BYQA 3MCNA 2HNYB 2W4CA 3EM1A 1T9WA 2M2BA 3DC2A 1X5OA 3CJKB 1EX8A 2YNHA 1PGZA 4NMLA 1TMMA 1UCNA 2LXFA 4X64J 3UD4P 4RWXA 2B6AA 1VYAA 1X5SA 1JIHA 3SCIE 4DEZA 1MU2B 2FC9A 4DR1J 1TQLA 3BDPA 3CD6S 3H8YA 4XK8C 1Q86T 1RWMB 4FNIA 1TUVA 1KONA 3OXLA 1OJ4A 4C0OC 1HNIA 1R43A 3U1MA 1WKJA 2AJ4A 3EVWA 2VFUA 2D9OA 1BUXA 4I4BA 4A8OA 4P10A 4MAKA 2KVQE 2X3GA 3MEKA 5KG2A 1HBMB 3Q24A 1H0HB 2FD2A 1NK9A 1HI0P 4X4VA 3THVA 3KK1A 2VQFF 4YDXA 1ZOTA 2MJNA 4LJMA 4OHVA 4DZ6A 2AF6A 4WYWA 3U27A 2E9TA 3WX8A 1M1GA 2OPQA 4ED5A 4IO1A 3F41A 4RNNA 4UZCA 3G71S 3VVTA 1G4CA 1T05A 1X7VA 3HHDA 1H72C 1UVLA 1ZM9A 2DK2A 2LFVA 5IZHA 5EN1A 3RRHA 4U95A 2EFOA 2QL5B 2QA4G 4J91A 2LVWA 2BQUA 5CHCB 2R2SA 2I9SA 4K50A 1J5EF 4CM2A 2HLUA 3OTEA 1BQNA 1NEEA 1IKYA 3TAQA 4ECSA 2QLFB 1RHUB 4L74A 1RBAA 3ZZOA 4ZJOA 2B5JA 3G82A 2XGQA 4JV5F 5D3GB 2XYPB 2M7SA 3BEGB 2IVYA 3MM5B 4ZN3A 1MWYA 3LAMA 1Y7PA 2IM1A 1LW0B 1CJKB 1L3UA 4J9LA 4C8OA 3E8OA 2W8KA 2RDDA 4J9OA 2ZHBA 2VPXB 2ABYA 3MTKA 3T5HA 5DDQC 2CQDA 2QLXA 4DL5A 2MXYA 4FYVB 5HP1B 3BQ2A 3PW5A 2BVZA 2MGZA 1JLAB 3G96A 2BANB 2OELA 1Q82T 1NJIT 2FUG9 3LAKA 1WOSA 5K8NA 2UUTA 3TQEA 4OIXA 4W92B 2C3OA 3EZOA 3MOJB 4LSNA 2F63A 4DV7F 2KXFA 1D8ZA 4ZPAA 1QSLA 4A47A 2UU9F 1VJQA 2Y1IA 3A3NB 2HNYA 2JJ4D 3DM2B 1FEEA 2O3DA 1D0EA 4RUAA 2DNMA 2HSEB 3U1LA 5ADZA 1JNRB 1EARA 2H65B 2HHPA 1CSJA 1JNZB 1RU1A 1C1BB 3BGLA 3A8EA 2P6SA 1OQ6A 4FVMA 2ZVIA 2FY1A 2FLOA 2WB1D 2BJ7A 3P96A 3M2UA 3UDLA 4DSLA 1U24A 1XWLA 5LJ3Y 1V9OA 2AZ1A 4XPCA 1GMWD 3NOCA 2CJQA 1CJVB 4DCPB 3DYAB 3KG1A 2EXUA 3DOMB 4RU2A 1KN6A 5EWGA 2NSCA 4MKYA 1SQFA 3FFIB 4HT5A 2FVCA 1LWEB 3CCES 4IQMA 3A8KA 3OL8A 2RSQA 2JVOA 4CWBA 4UY8T 1QE1B 2P5VA 4OV6A 4JP8A 3OLBA 3CVKA 1TAQA 3VCDA 4QU6A 3AOBA 1HQEB 1HBMA 2RQMA 4JI4J 2A3JA 3KUEA 4WWSA 2JRSA 2V0NA 5IC4B 3M8ZA 3VTIA 5ETNA 4F2SA 1SI9A 3IRWP 3N6LA 4TQSA 1TL3A 3R7SB 5EWEA 3CF5Q 4DFMA 4LR9A 1FX2A 2HIQA 2IJRA 2WTFA 3E01B 1IM4A 2V9KA 4J9VA 1IR1A 1S6QA 4GO5X 2QFIA 4B9LA 1F1BB 3QLHA 4Y2KA 3PHEA 3K57A 4URGA 4E2FB 4I68A 3I9V9 3HT0A 2VODA 2CKWA 2J6TA 2CPXA 2RVJA 3F0NA 5LMUF 4DV3J 3NCRA 3AA8A 2HHHF 5LMNF 1RTJA 5D0GA 4M8LA 1FXLA 3AH6A 1S6OA 1KQFB 3K58A 3R1HA 2AJQA 1B7FA 2A0FB 1RAFB 4H54A 2XO7A 3C6UB 1T3NA 3CCWA 1DQ8A 1Y3JA 1VMBA 1UEUA 1IWGA 5D3GA 2ATLA 2L3MA 1JXVA 2CG8A 3MM5A 4OHXA 2MZTA 5KFCA 4MJKA 1VBZA 5AXLA 3C19A 2GJFA 3PACA 4ED7A 3LUYA 1QAJA 1A7GE 1SIWB 3CC2S 2ERRA 5DM7Q 2Z2MA 3TI0A 3OTOF 2ILYA 4P2FA 2AD9A 3QJLA 4LF4J 5KT4A 1JJHA 1TTHB 4HDGA 5ITHA 4Q43A 3PO4A 1JLAA 1YWXA 2JLFA 2G0JA 2BANA 4CYUB 3T9NA 2QA2A 2DEJA 5E33A 4QIVA 4OZLA 2UUBJ 2KZZA 3QGGA 2I8EA 4JI6F 5BYSA 4RKUC 4WBFA 3V6JA 4IFYA 2D69A 4USUA 3IN5A 5C42B 5D4OA 5A8KB 1VC0A 3QJJA 3D54A 4Y28C 3DM2A 2B9WA 4YDDB 1YJRA 2BE7D 3D9BA 4QOTA 2DR5A 3QGHA 3R1LA 3KLIB 3RAXA 3BQ1A 3GQCA 1U47A 4PWUA 5IWAJ 3H25A 2BE2B 1C1BA 3DN9A 2V34A 2ZD1B 5LM7E 4DBQA 4LT6A 2CDQA 4RNOA 2R7XA 2HAIA 1SUQB 1ZYQA 4DQRA 2DCLA 4JI8F 2AYMA 3ILIA 2DBBA 2HZAA 4QYRA 1WC3A 2OAUA 3QFHA 2PEBA 1MLAA 4V1Ak 1VQMS 4EYHB 1CJVA 3DYAA 4EMDA 2LQ9A 2W7PA 2H3EB 3DOMA 3UNGC 2BBEA 4K4WA 1LWEA 1PYTA 1FO1A 3MGJA 1Y9OA 5HBMB 4AD6A 3MM9B 2MHNA 5DJBA 1WC1A 4LFCJ 4NZ7A 1AFIA 4ELUA 1HQEA 4AL7A 4NA1A 3M9OB 2PC6A 5D4LA 1NCLA 3IR5B 2BEFA 5CCMA 1T9VA 3IP0A 4XDDA 1MROB 2QIFA 2FJWA 5HROB 4DV5F 1RAGB 2C3PA 3UR0A 4G6VB 5C24B 1YJUA 2KT2A 3J81j
chains in the Genus database with same CATH topology
4BWMA 2GQCA 5H1SV 4GC6A 2J6UA 2OP5A 2V9WA 1HD1A 5F8NA 2Q1LA 3E01A 4ECWA 4A8YA 1TK8A 2W4DA 4Y2AA 5KFEA 3C46A 4I0WA 2DNRA 2KHCA 2KRRA 1KR4A 2ZKTA 3N6NA 2L41A 3GIJA 3K5LA 4B9TA 1LFPA 2ZHOA 3HT3A 3TA1A 3MDFA 1M1KT 2XNRA 5I3QA 4DHVA 4DR7F 1RTDB 1R8HA 3HHEA 4HT7A 1XTZA 4KGKA 3IS9A 2WAQD 3ISND 4RW9B 2XSJA 2W24A 4OX7A 4ID5A 5FDLA 3IXQA 1REVB 3MMCA 2FLPA 1Q8BA 1NH8A 5L1JA 1HBOB 1TKXB 1B0PA 2R7OA 1SXLA 3OUYB 4B9VA 4A4JA 2OPPA 4OLOA 1G3OA 2U2FA 5F0UA 4M63A 4H4OA 2HWIA 1X9MA 1WEXA 4B3TF 4J9RA 3R3TA 1HWJA 3H4BA 2XHWA 1EP4B 2LEBA 4C9DA 1U26A 3R5DA 3U1NA 1GXLA 2JLGA 3AAWB 4N8OA 2EG2A 3LGMA 4OZJA 2XY6A 2DJWA 2XCPA 3OFEA 3PVXA 2ZBCA 3WC0A 3C6UA 1RK8A 3MF5A 4OJHA 4CTAB 4Y2CA 1WHYA 3ISNC 2IVFB 5KFOA 4OI0A 5EHHA 1VC5A 5HMXA 3H5XA 4FXWA 1LW2A 3BSCA 3VAJA 1JXEA 4X84A 4ICLB 1NH7A 1X4CA 1UWBA 4KKOA 4ED8A 3DLKA 3I6PA 2MZSA 3QO9B 2XS7A 3M8PA 2B7CB 4DSKA 3H2LA 4DQPA 4CH1A 2ASLA 4EZ9A 1NO8A 2B56A 2YKNB 3ITHB 3OL9A 1KRPA 2AV5A 3P3DA 1SKWA 5GAGI 1YHQS 4C97A 5D78A 1RA6A 4YR0A 1H7WA 5KFGA 1WI8A 4RW4B 2HNZB 3HFKA 4AL6A 3LP0A 2WSFC 1LKZA 1IJEB 2EC0A 4X4PA 3F73A 4ATNA 1Q53A 1VQOS 4ZS6A 2AGOA 2D3ZA 4QBUA 2ZKUA 1N5YB 3VF0B 4NLUA 1U7LA 2A2DA 4BBYA 2ASDA 1T94A 4WJBA 3DXBA 3EXYA 3MWBA 2KM8B 1S76D 1QSSA 2MSSA 2MHEA 4JI0F 3EX7B 1I94F 4EYIB 2VG7A 4NL5A 2KJVA 2JOQA 3SDEA 5A0YA 3TAMB 5GAGU 3MOZA 3UW1A 1DAXA 2J7UA 4FF2A 2BRLA 5BJRA 3G4SS 4OI1A 1X4FA 2KTQA 4DG1A 1TL5A 2MKHA 3Q8RB 4ECYA 3CUNA 1WHVA 1S1WA 4O3QA 5HLFB 4TLRA 5LXRA 3I0SA 2B9XA 2E1CA 1H7XA 1RISA 2L48A 3PRBA 2MKJA 4DUZF 4FZVA 1FJGF 4BCAA 2PN6A 2XMMA 5LXYA 4KSEB 2R2UA 2HVHA 2R7TA 1E6VA 3K8WA 2W7OA 2R7RA 3HHNB 5KFIA 3M9NB 3BGUA 5EGYA 2B3TB 4F4WA 2GGPB 4Q5VA 4QW9A 1SL0A 3CSKA 4JOUA 5BR8F 1XNQF 3TQ1A 4EFAC 4X4UA 3AJ2A 3MMAA 4OI6A 5C42A 3Q23A 5HQ8A 1X4AA 1APSA 2HGLA 1UVKA 2HNDA 2KFYA 3CCLS 1H6KX 5A8KA 1C0TB 2QO3A 3ZZPA 2BRKA 3SCJE 2WOMB 2PO4A 5K14B 3PXGa 3SQGB 1S9GB 3JSMB 3MD1A 3GYXB 3VAHA 3D0IE 4ZKAA 4C8KA 1JLQA 1X8DA 2QT7A 4J9KA 3CJKA 1OSCA 3BDEA 2MMYA 4HLBA 4DV3F 4CO5A 1U4BA 2J9CA 4P7VA 1GT8A 2XB2D 3TANA 2MY8A 4KO0B 2OD6A 5JUMA 3LP2B 5F8MA 4DSEA 4E8UA 4ZHRB 3OPKA 2DHXA 4DWIA 1SV5A 2BE2A 2N4DA 3NNCA 2NLWA 2UV8A 1JLBB 2ZD1A 3T5KA 3Q0AA 3CCUS 3BQ0A 4WZMA 2RF2A 4XDCA 2RU3A 2AWZA 1FDNA 4RZRA 3TO8A 3MUMP 1SUQA 2LA6A 3W2WB 2YH0A 1XN9A 1UVMA 4KHPF 2NR0A 2OKQA 5KFMA 4NYOA 2Q43A 4KAIA 2DH8A 2N4CA 4TKTA 3I87A 3S6EA 5L9NA 2MQOA 1KEKA 1ELOA 4EBDA 1IBLF 2J0XA 4ECXA 2IM3A 3Q8QB 3K7RA 3DOLB 1K1QA 4ED0A 1UJ4A 1Q81T 2W25A 4OZNA 3TX8A 1CC7A 1Y5NB 2F8HA 3K5NA 4ZOSA 1MU2A 1U6ZA 4USIA 4CO4A 1VQKS 4XIUA 2FHJD 2ZBIA 4LF8F 3MUTP 2FHKA 2CQHA 3HKWA 1VBXA 3MAQA 1UFLA 2FHJA 2RRBA 2P9CA 2YNHB 3CD0A 4FNHA 2VONA 3J80Y 5KFSA 1WACA 1CC8A 3PM9A 2GC8A 2IRUA 2WSCC 1TV6B 5AXNA 3UCUP 3RU0A 1C1CB 4O3NA 1Q8LA 3OVSA 2DPIA 3FQKA 4USHA 4OX8A 3FDSA 4IDKA 3C6TA 2ADCA 1VQ6S 1O5JA 4MKBA 2YNGB 4NA3A 5K5MA 4FP9A 1BLUA 3T6JA 2B4PA 3KLEA 2MZJA 1G1XA 1TR0A 4LF7F 4OFZA 1RYSA 1V3ZA 4ZCLA 2RMLA 5DG8A 1S1UB 4X4SA 3QYYA 3CCJS 3Q8PB 1HNWF 1NK0A 1R8CA 2J9DE 1HNZF 4CO1A 1S1VA 1N0VC 2JDJA 3DDNA 3DMJA 5HBMA 3IGVA 3MM9A 4NRTA 3MI7X 1L3VA 1D9FA 2R4FA 1R27B 3HDSA 4K5RA 1SB6A 4AXJA 2MZQA 2XMVA 4R5PA 4N5SA 1H2UX 3TR5A 2RILA 1CQNA 3MMJA 4WCEQ 2GFFA 1S1XB 2HPUA 3H5UA 3NWGA 4MH8A 5D77A 1U1RA 1LWCA 1JLCA 1RT5A 4IG0B 4TU8A 1NK4A 4GKJF 2MPUA 1SL2A 4DF4A 2YQ3A 3HF5A 4IOBA 1AROP 4IO9Q 3MM6A 2KT5A 3HHKA 1S1TB 2WSEC 3I5AA 5KG4A 4CNZA 1CPZA 1F2GA 3OXFA 2QMWA 4RNMA 2CRLA 5K8OA 3G86A 1VK3A 4C8MA 3IRXA 4Q44A 1MROA 4DS4A 4I69A 2NREA 1WD6A 2DISA 4K4VA 3CTRA 1X0PA 3M8QA 5HROA 4OHYA 1TVRB 4PXDA 2Y1JA 2XBPA 6FD1A 4C4WA 3JSRA 5C25A 2MSTA 1S4FA 2E5LF 3KG4A 1RT7A 2IC3B 2LDIA 2WW8A 5C24A 2I1RA 1NKCA 2KYXA 3GIIA 2M88A 3GFHA 1M5PC 2PGCA 2RQCA 1IN0A 1KQGB 3OHAA 1GAOA 2IVMA 2LU2A 3N28A 2ZH6A 3H5SA 2JEIA 4LIWA 4R8UA 1JLEB 3QGPA 3HHLD 5J1EB 1VRUB 4O0IA 2NQPA 1HWKA 4X65F 2C2DA 3PKYA 3N5FA 1M5VC 3MECB 1IQTA 2E44A 3HHLA 4A8FA 5IS2A 4F4ZA 3OR1B 4N47A 2I5JB 1R8PA 4DLGA 1KOOA 1IXKA 2DHSA 3KYLA 2OMOA 4DS5A 4NXNF 2VUGA 4RW9A 2E5HA 2ZJQQ 3O8WA 3A1YG 4YUDA 2MY7A 5EWFA 4X64F 1KS2A 4QWBA 1T02A 1ZAXA 5G0RB 1TKXA 2NSBA 1WF2A 2K7JA 4Y2MA 1B0TA 2YWFA 2XLJA 3KMSA 1WG4A 2OPQB 3D1HA 2ZVSA 5M2PA 3SI8A 1YJNS 5F8JA 3HHLC 1RAJA 1NJXA 1HBUB 4F4KA 3CMAS 1KTVA 3ISZA 4DR1F 4NCAA 5A8RB 5LT5A 3MM7B 4C8ZA 3VQTA 2MKIA 3DCAA 5LJ5Y 2O01C 1G6BA 4ILLA 4WKYA 4KQZA 2Z8QA 3GMGA 2DGTA 4ZVGA 4WZQA 1TKZB 2NPFA 5KOXA 3UFCX 1Y4ZB 3HP6A 1Z2ZA 4DV0F 1HMVB 4Q2MA 5A8WB 4I56A 1I1GA 2ROEA 4ICLA 4DJBA 1U1OA 1BD6A 1SBRA 1KD1T 2B4UA 2L08A 3NNHA 4RUCA 4K0KF 1P8GA 2GIQA 1C4AA 1QAIA 3CCVS 3MHYA 4KRWA 1OO0B 3ITHA 4Q45A 1GQEA 3RAMA 2EBGA 2RKIA 2OO4A 2YTCA 2IJFA 1C0UB 4QR1A 4TN2A 4YB5A 4DV6F 3PX4A 1HYSA 5FJ4A