1SJ4P

Crystal structure of a c75u mutant hepatitis delta virus ribozyme precursor, in cu2+ solution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
95
structure length
95
Chain Sequence
PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Conformational Switch controls hepatitis delta virus ribozyme catalysis
pubmed doi rcsb
source organism Hepatitis delta virus
molecule tags Translation/rna
molecule keywords precursor form of the Hepatitis Delta virus ribozyme
total genus 22
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sj4P00
2FC8A 1WI8A 4PR6A 2KI2A 2MY8A 1QM9A 3CCMS 2GHPA 2RNEA 3VAKA 3SXLA 2MKJA 2DITA 4CQ1A 2MQOA 4FXVA 2M88A 2MJNA 2LEAA 2KG1A 3HHNB 2OTJS 3CCUS 4RU2A 2RS2A 3VAIA 3H2UB 2DH9A 3MURP 4C4WA 4LIRA 1X0FA 1WEYA 5DDQC 2XNRA 3P6YC 1VQ4S 5GADU 4LMZA 3G4SS 2V94A 2QFJA 3UWTA 3P5TL 3R1HA 1VQ7S 1VC5A 2KYXA 2G1DA 5GAGU 3VAMA 2LXIA 2VOPA 1SJRA 2DNQA 2DHGA 1PO6A 2DGXA 3CCLS 2ADCA 2MZTA 2MHNA 3R1LA 2K8GA 3G6ES 5GAEU 3PIPQ 3N9UC 1FJCA 1M5PC 1JJ4A 2AD9A 2KVIA 2XNQA 2VODA 3G9CA 4Y0FA 2DNLA 2LECA 2I2YA 2DNRA 1N8RT 3CF5Q 1M90T 2JVRA 1X5OA 2JRSA 3CC2S 3JB9k 2DNPA 2KM8B 2M0GB 2M2BA 3G8TA 1R8PA 2CPDA 4TU8A 1ZZFA 1VQ6S 1WEZA 2DGWA 3UCZP 4CIOA 5LXYA 3I56S 3UD3P 2KRRA 3CCQS 3BEGB 3DXBA 4WFBQ 3DLLQ 4LJMA 2KT5A 5MLCV 2E5IA 5DDPC 3CMES 2WBRA 1Q7YT 3S01A 1X4DA 1M5KC 2PEHA 2HGLA 2L41A 2DGOA 2KHCA 2X1GA 1VQ8S 2RQCA 2DHXA 1WG5A 2MQNA 1N88A 4F02A 2CPZA 2YH0A 1WHYA 2MZ1A 1K8AT 2MYFA 2DNGA 2B0GA 2XS7A 4C7QA 3MUMP 2AYGA 4BS2A 2CQIA 4Z2XA 2RVJA 2DISA 2ZJRQ 1BY9A 2KXFA 3LPYA 3CC4S 1KC8T 2KXHA 2HYIB 2DNNA 1DBDA 2DO0A 2KU7A 1FJEB 2MPUA 5IM0A 3ZZYA 2M9KA 2RU3A 4IUFA 3SDEB 2ADBA 2CQ4A 1N54B 1Q86T 2DNKA 1X5TA 5ITHA 2HZCA 1VQKS 1JMTA 2N82B 3VALA 1IQTA 2CQ3A 1YJWS 3MUVP 1N52B 2F3JA 2OJ3A 1FO1A 2MJUA 4U67Q 4EGLA 2ZJPQ 4TU9A 5JVGQ 2J0SD 3CCJS 3UCUP 1K9MT 4V19X 3EGZA 4WIIA 1JJ2R 3L3CA 3BO3A 1U1KA 2DNOA 2JWNA 5BJRA 1VQLS 1A7GE 1YITS 4P6QA 4J5OA 1B7FA 1H2TZ 2AYEA 3H2VE 1U1RA 2A3JA 4Y00A 3SDEA 2KXNB 2E5JA 2G0CA 3J7YU 1F9FA 5LJ5Y 2DGTA 2F9DA 1Q82T 3G8SA 2EK1A 4TLQA 3CCRS 1QVFR 1YIJS 3IWNC 2EVZA 2BOPA 2CPXA 3K0JA 1P27B 2YWKA 2BZ2A 5EN1A 2FHOB 2CQ1A 5LXRA 2DGUA 4OZ0A 2MQLA 2LQ5A 3BO4A 1HL6A 1KD1T 2DH8A 1M5OC 2MKIA 1NJIT 2DGVA 5DM7Q 2M7SA 5CYJA 3D2WA 2KFYA 1WTBA 1VBYA 3Q2SC 2D3OR 2KH9A 5IQQA 4W90B 3MOJB 4QPTA 1R8HA 5FJ4A 3B4MA 4UY8T 4PRFA 5IM0B 2DNMA 3CCES 1D9AA 3CUNA 4C0OC 1YWXA 2M8DB 2FC9A 3RW6A 1FNXH 3S8SA 2OIHA 2OTLS 3VAJA 2O3DA 2L08A 3MI7X 4WF9Q 1KOOA 1URNA 3NS6A 1UW4A 2DIUA 2RQ4A 2E5GA 1WF2A 1WF1A 5H1SV 1X4GA 5LSLA 1VBXA 3CD6S 1WHVA 2DO4A 1WG1A 2F9JA 3FEYB 1X4CA 3NMRA 1G2EA 2D9OA 5IFMA 1ZH5A 1RK8A 2JX2A 3FEXB 3U1MA 2LKZA 4UQTA 2XB2D 2CQBA 2MGZA 3J7ZT 1U6FA 1SJQA 2DIVA 3EGNA 2ERRA 1PGZA 5CXTA 2OSRA 2X1AA 2CJKA 1U1MA 2XS2A 5D77A 3NNCA 2AYMA 3Q2TC 2MB0B 3U1LA 4QQBA 2DHSA 2MKHA 2MZSA 1QVGR 4PKDB 1WEXA 3MDFA 4QU7A 1VQMS 3S7RA 1SJFA 4WKRA 2N3LA 4W92B 2DH7A 4ED5A 2RRBA 2HGNA 2LA4A 2MMYA 5DDOC 1FT8A 2XSFA 3BS9A 2MZRA 3OW2R 3MXHP 1X4AA 2JVOA 2MQPA 3UD4P 1XN9A 1VC0A 1DHMA 2CPFA 3VAGA 4OZ1A 2YKAA 2PE8A 5CA5A 2MGZB 2RUGA 1U1QA 3R27A 2CPIA 3MUTP 1WHWA 2M70A 2DK2A 3I55S 3US5A 4ERDA 4WFNQ 1NU4A 2N7CA 1L3KA 2CQ2A 2NLWA 2CQCA 2OSQA 3CCSS 3BO2A 2KG0A 4IOCQ 1H6KX 1HD1A 1D8ZA 2DNYA 1OWXA 1WI6A 3CCVS 2J76E 1A9NB 2DNHA 2XS5A 1JJHA 3TP2A 4TU7A 2QA4S 2CQPA 1U1PA 1DZ5A 2MXYA 3MD3A 2M4MA 4YB1P 3CULA 3V4MA 5GMKa 4FXWA 3P49B 2LEBA 2AYBA 5D78A 1K73T 2M52A 4WFAQ 2I38A 4ZKAA 2RT3A 2RRAA 2K3KA 2VONA 3S6EA 2U2FA 5LSOA 5LJ3Y 3G71S 1X4BA 1WWHA 3IRWP 1AUDA 5HO4A 2MZJA 1YJ9S 3P3DA 1SJ4P 2MKKA 3NS5A 3ULHA 5GAHU 2LXUA 4F25A 2N3OA 1RKJA 1X4HA 1HD0A 2CPEA 2MKCA 3UCGA 1YTYA 1VQNS 1HA1A 3NNAA 2DGQA 1VQ5S 2ZJQQ 5GVQA 3HI9A 1SXLA 1H2UX 2L9WA 4M5DB 2KM8C 1FHTA 1OO0B 1WHXA 3SMZA 4WCEQ 3ZZZA 1VQPS 4CH0S 1H2VZ 2KRBA 2NZ4A 1KQSR 1M1KT 1WG4A 1OIAA 1S79A 5HL7Q 2M8HA 1KOHA 3CXCR 3VAHA 1S72S 2GO9A 1CVJA 1O0PA 2J8AA 1YHQS 4F26A 2FY1A 4IO9Q 2MQQA 3UE2A 3NNHA 1WELA 2E44A 1VQOS 3CPWR 2KN4A 1UFWA 3B4DA 3LQVA 4A8XA 2HGMA 3TO8A 2QEXS 2DB1A 2MSTA 5JVHQ 2X1FA 1U6BA 2G4BA 5DM6Q 1X4EA 3THPA 5DETA 2LA6A 2CPHA 4QU6A 4IOAQ 1U2FA 2UP1A 2CPYA 2YTCA 2FPHX 3THTA 3EX7B 2DHAA 3CTRA 3TYTA 1WF0A 1VQ9S 1SJ3P 1DRZA 2EK6A 1U1NA 2SXLA 1UAWA 3MD1A 1U1LA 2MQMA 3CMAS 2MY7A 3PIOQ 2MSSA 1X5PA 4YUDA 1FJ7A 1Q81T 2X1BA 1VBZA 3RW7A 2J0QD 2CQGA 5DDRC 1U1OA 1VC6A 2DGSA 2U1AA 1YI2S 2YH1A 1OPIA 3VAFA 3G96A 4CH1A 1P1TA 1X5SA 2E5HA 2Q79A 1ZZNA 2LMIA 3CC7S 2LYVA 2MKSA 2HVZA 2CQDA 1M5VC 2DNZA 3VF0B 1FXLA 1UP1A 1NO8A 2LCWA 2MZQA 2RS8A 2CQ0A 4YOEA 1YJNS 1W2BR 2CPJA 2VOOA 2CQHA 1X4FA 2D9PA
chains in the Genus database with same CATH superfamily
2FC8A 1KNZA 4FPIA 4PR6A 1FEEA 2EI5A 4J9RA 1V6HA 3RB0A 1IM4A 3KYLA 4ED0A 3DGVA 1FERA 1KTVA 2DITA 1R43A 2J0XA 2QX0A 2ZZTA 3GFXA 4KSEB 3T9NA 1HNVB 2BE2B 4LSNA 3WC0A 4B3SF 2C2MB 4LBPA 4LVOP 4JV1A 2MJNA 3K5PA 3MMAA 2R7OA 1B0VA 4KFBA 2KG1A 1SH2A 2BKNA 3HHNB 5HP1B 4CP5A 3CCUS 1RAAB 4DI6A 2B6AA 3M1VB 4ICLA 5DG8A 4M5KA 1YG0A 1SV5A 1C1BA 2DR6A 4C4WA 2W8KA 4OV6A 5GMDA 1E6VA 1F5CA 4NYOA 1FRXA 4LF4F 4I2PA 1WEYA 2HBYB 4USKA 2DXFA 3PW4A 1VQ4S 2PA3A 2V94A 1WC5A 3FBBA 2F7VA 2HWIA 3DLGB 2QFJA 3P5TL 1KS2A 2GJ2A 2HG4A 4ID5A 4K7QA 2AKWB 4ZITA 3V81A 4HACB 3R1HA 4L3KA 2KYXA 2G1DA 1TUGB 3VAMA 2LXIA 2VICA 1N32F 3AQOA 4JI7F 2DNQA 2VOPA 5D4OA 1P9QC 3OSNA 3FC9A 1R6YA 2PGCA 3BM7A 3HT0A 3HVTB 3TVKA 1HW8A 2BABA 5F8NA 5KFLA 3IBFB 2K06A 3BBBA 2AEMA 2FDNA 2MHNA 3GJQB 2XI2A 1DY3A 1RISA 1DAXA 3PIPQ 4TQSA 2RKIB 4UUWA 1HWIA 3DHXA 1XQIA 1LW0B 2GAGC 4IRCA 2VODA 2IDLA 5RUBA 1DLOB 2DNLA 3SIPB 2LECA 3KUGA 4Y28C 1KSPA 4OLOA 3KK3B 3HJVA 3PO5A 3OR1B 3AFGA 5C24B 2DRDA 2CAJA 3FVYA 3I9ZA 5T14A 1FVSA 1QDUB 2CNLB 2JVRA 1TMMA 1GXTA 1HWJA 1X5OA 3AD8C 3DU5A 4FDFA 5KG6A 2FJXA 2UU9J 3TUPA 1T03A 1SIWB 1BQNA 2DNPA 3M2RB 2M0GB 1NHKL 4RNHA 4OZ5A 3H90A 5AXNA 1LFWA 2ROEA 1PYOB 4EO8A 2GNKA 5A8KA 1V3ZA 3OD2A 4J91A 3J7YI 1TUVA 2HQ3A 1TMJA 2DGWA 2VL1A 1JLBA 1IBCB 3HF5A 1V3RA 1V3SA 5T7LA 3RBZA 1D0EA 1MMLA 2UU9F 3HHDA 3K8WA 4FYXB 2HS0A 1WDTA 2V4JB 2XNRA 2UZAA 3BEGB 2EKYA 3HD2A 3ILLA 2LQBA 4WFBQ 3DLLQ 1VI7A 2WVFA 3QFHA 4PEOA 1LKZA 1ZYQA 1I1GA 2HHTA 4M63A 2CIMA 2HQGA 2BE9B 2MTLA 4PPDA 4W98A 3THVA 2ALZA 1N6QB 3ENQA 3NOGA 2PA8D 4DV4F 1M5KC 1FFWB 2PEHA 2L48A 4IFVA 3M9NB 3GIIA 1NK0A 2VA2A 5D8HB 2YKMA 3BQ2A 2IAJA 2X1AA 4ZVPB 3I87A 4OYZA 2AJ0A 2DHXA 4B08A 1NB2A 2KT3A 2RQCA 4DS5A 1NK9A 1N36J 1N88A 3DHWC 2UV8A 1SQFA 3MM6A 4PWWA 3I0SA 1RAHB 2YH0A 4F4YA 1MMDA 1MN7A 4TY8A 1LWFB 2CJ9A 5AXKA 3SSQA 4A8OA 3M9OB 3OSPA 5J1EA 2XYHB 4O3PA 2C2ZB 2B0GA 5I42B 1JX4A 3Q8RB 3CDUA 2AYGA 4BS2A 4OZJA 4DSFA 1BY9A 1MROA 4RR5A 3CC4S 2V2KA 5EWEA 3MMCA 3SQGB 1KC8T 4F2RA 2WK4A 4KC5A 1NSPA 2DNNA 2Y1IA 1DBDA 2DO0A 3MTKA 2ZBPA 3KMQA 3CJKB 4DR6J 3FZ2A 2V2QA 5F8HA 1VLYA 4RU9A 2J7WA 4PQUB 3UNYA 1T9TA 3UN3A 1B64A 4H4MB 3RRGA 2ADBA 1VMBA 2CQ4A 4A8FA 1X5TA 2NREA 1F2GA 2HZCA 1VQKS 1JMTA 2CA9A 3VALA 4HR2A 5A0YB 4J9QA 3EICA 1I94J 3CCZA 2YNGA 1S6PB 3F73A 4FBTA 4C3KA 2J9DA 2FJEB 5KFVA 1N52B 4H54A 1XEZA 2CXEA 3MECA 2ATCB 4PQUA 1NDCA 3RBDA 4X66F 5DGBA 2J6UA 2QLJB 4JI2J 1C0UA 1RDRA 2ZH5A 1R8BA 3G82B 2JZ5A 3HZGA 3K2YA 3KJVB 2DR7A 1FJ7A 2DCLA 5A0YA 4CNZA 3UCUP 2W4PA 1K9MT 3DOKB 1HPZB 1ZM2A 1JNRB 2VC0A 4WIIA 5HN0A 4Y6IA 2Y9HA 1DFDA 3L3CA 3PR4A 3PW0A 3MECB 1ZM4A 2GIFA 9ATCB 2XHWA 2H1YA 1B99A 2JWNA 3VQSA 5IS2A 3FQKA 5KT2A 1VQLS 1K0VA 1YITS 2NYIA 1QSLA 3H2VE 5IT0A 4LFCJ 5AE3A 2HZAA 2J0WA 3AY0A 4CCHA 1X8DA 3GJSB 2EFPA 3FCHA 3MTJA 2HHXA 4DFPA 4DV1J 1RWOB 2W1BA 2WW8A 3EXYA 2CZVC 3FDSA 3A13A 5ETTA 4TYBA 3TAMA 5DQGA 3ILIA 1FWLA 3UVJB 1LK7A 1X0PA 4PZVA 4K4SA 4F2SA 5E41A 4DR1J 3Q24A 1S1WA 4NLVA 5C25B 2P9EA 5C5JA 4EEYA 1QVFR 2FQQB 3AB2B 3SSRA 1YIJS 2E1CA 3HSJA 1S9EA 2CPXA 3H25A 1T11A 1QUVA 1GTHA 1P27B 1RHQB 2LDYA 3PYDA 4IH5A 2BZ2A 3PJXA 5CZXA 3UI3A 2DVIA 2UXCJ 4X4UA 2QGFB 4LRFA 3KLVA 2CQ1A 4DV0F 2KTQA 4U8VA 1FESA 1GH8A 2HIQA 5IT9U 3RB6A 2DGUA 4ZCLA 3TAPA 1UVNA 2QO3A 1RB0A 4OZ0A 2JSXA 4QPXA 5HMXA 1KD1T 2HMIB 1XK8A 4DV5J 3M30B 3W9JA 3KTQA 2P6SA 3LA0A 1M5OC 3VV2B 2XM3A 3QJLA 3UD5A 1S6PA 3NWRA 3KKFA 5J1NA 2W24A 3MAQA 2HVIA 5SUHA 1FWPA 2WBMA 4M5DA 5KFNA 2KH9A 2ZZNA 1TL3B 3Q8PB 2WOMA 5KT6A 1VIOA 4M1KA 1REVB 5B0FA 3RAQA 3FFIB 1XR7A 3MCOA 4H4KC 4KBIA 2D3O1 3TZWA 5KFDA 4UQGA 1DTQA 2BW7A 1FTCA 2J7KA 1XMQJ 1HNWF 1MW7A 1FFSB 1YLXA 4UY8T 1RA6A 1RHMB 2KO1A 1FA0A 4HLBA 4V1Ak 1D9AA 1NBEB 1RT7B 3D1OA 3L4BC 4RX6A 4LF8J 2XULA 4KGXB 3T41A 4K4UA 2IDEA 4ZN1A 3M8PA 5IWAJ 2WB1D 3S8SA 1IKWA 1NH7A 3AXMA 3N6MA 3I0RB 5CZVA 1J2VA 4AL5A 2P8IA 5F9NA 4ECTA 3GWCA 2P9CA 1R3NA 3GG0A 3OQ2A 1NSKL 1XMBA 2OD6A 3FK4A 4I69A 4ZPWR 1KOOA 2B9YA 3NAHA 4NLQA 4QWEA 3SYZA 1URNA 1XNRJ 3BGRA 3NS6A 5LSRA 4NASA 3UW1A 5KG7A 4O0IA 4JI4F 4FKXA 4FF4A 5H1SV 1R89A 3CD6S 4X4NA 4RW4A 4LSLB 2H5EA 1TVRB 2VBYA 4QR2A 2XWXA 2XY7A 4DUYF 3KHGA 4MKAA 2VQEJ 1WG1A 2F9JA 1N4LA 2QYGA 3FEYB 4LF7J 3G8QA 1RGVA 1NHVA 1WC1A 2F4FA 2B51A 4DQIA 3BSNA 3BGFA 4WK1A 1TKXA 3DOMB 3Q8YA 3QJPA 1TAQA 3SQGA 4DU7A 6FD1A 3NMAA 1Q8LA 3TAQA 2FVPA 2HPUA 2RDIA 3W62A 2CKWA 2CQBA 2MGZA 3J7ZT 3EXCX 5HAOA 1S9FA 1NK4A 3PW5A 2IA0A 1C1CA 1NSAA 3GONA 2XMVA 2O67A 1ULRA 3KJFB 2AYMA 2QL9B 5GADI 3WIVA 4DSIA 3C2PA 2OGUA 4DOZA 3PYGA 1FE4A 4NCAA 3U1LA 2MLZA 3PHEA 4QQBA 1RHRB 2D3UA 3CT9A 4HVZA 3C16B 1TTHB 4Z7YA 2XHCA 1F0XA 2MKHA 2N7YA 1F9EB 2RAQA 4JI0F 2XO7A 3FMWA 3R5GA 4RL1A 4KT0C 1VQMS 1KFDA 3EWGA 1B0TA 2PDAA 3S7RA 4QWDA 1MU2B 3PV8A 2V2VA 4TVAB 1R27B 1WSRA 2OLWA 3JXOA 3OFHA 2VJUA 3BGLA 3M8ZA 1SJFA 5J2MB 2GHVC 3WX4A 1DTTB 2ZH1A 3OHBA 4C8LA 3F56A 2CVIA 2RRBA 1F60B 4WFZA 5HVFA 4EFAC 4RUHA 2UXDJ 2OPSA 4P71A 3NXZA 3SCLE 4F0HA 5DDOC 4UZCA 1QD1A 3KDNA 4FBUA 4ZJQA 4R5PB 2EFNA 3E2EA 1FX4A 1VRTB 2MEWA 3V5RA 1ZTTA 4U96A 2YX7A 3V4IA 3M8RA 2BQUA 3HD1A 2CYYA 2CPFA 1FRLA 1AW0A 4GVBB 2W9BB 2PE8A 2VF3A 3M7VA 4HTJA 4MKVA 3GIMA 2YNIA 1JLGB 1C0TA 1HWUA 1VRQC 2OPPA 1O6XA 4YHHF 1WHWA 3BSOA 3CD7A 2DK2A 5HVHA 2JFKA 1T7PA 4ERDA 4TKTA 2E5LF 3V6KA 1CS4A 4NRUA 4CYUA 1TV6B 1YRTA 3AJDA 2K2PA 5KFWA 2NLWA 2UVUA 1BC6A 1ZA2B 2RILA 5F3ZA 3CCSS 1ELOA 5H9FK 5DJBA 4EYIB 1DQAA 1UZHA 4IOCQ 2LQJA 1LOUA 1C1BB 2CFXA 1OWXA 3ISZA 2VPXB 3FGVA 1N0UA 4MIBA 1SC1B 2J76E 4LF6F 1A9NB 1RWNB 3SBMA 2DNHA 2AT1B 1UWBA 2XS5A 4RBVA 3TA1A 4WPAA 1DZ5A 3O1LA 2YNFB 4I2QB 3T1YF 3FBEA 4ZVFA 1FNOA 1M1GA 2AMCB 3IRXA 3R5JB 4RKUC 4ETZA 4ZCMA 2W4DA 3VGVA 1KHVA 1BWVA 4WFAQ 3SV3A 1IR2A 1S4FA 3JTPA 4ZN3A 4X4OA 4B9VA 2RT3A 3KLIA 2K3KA 3HVTA 5FD1A 1T3OA 3MR2A 1RWKB 3EZOA 1RXOB 4USTA 1IBMF 2U2FA 5LSOA 3WBZA 4AFFA 4CLSA 3IRWP 4ECVA 2B7CB 1AFJA 5HO4A 2UVRA 2G0IA 3HMJG 3GYGA 3HHLC 3TW0A 2MKKA 1JLCB 3TUJC 2GAHC 4BWMA 2AGOA 1HNWJ 2ZC3A 3J80Y 3PVXA 3G6XA 2GVDB 3FNNA 3LWLA 4DSLA 1XMOJ 1FD2A 4ES3A 3OR2A 3NEKA 1RKJA 2OO4A 2CZ4A 5CD4A 3MAAA 1U0HA 2HNDB 3UO0A 4ANCA 2DGQA 1WC3A 3OBIA 4OMFG 1WJ9A 1U4BA 4O3QA 5D4NA 2ZJQQ 1IBLJ 2HHHF 2NS1B 2ILYA 3FUYA 3H5SA 3KHHA 4C8OA 2C42A 1KBRA 1CLFA 1SJ1A 1ZBTA 2AP6A 3M8QB 2KKHA 3DRPB 2BXJA 4MYTA 5ETMA 1SPBP 3CCWA 1TP7A 2GQCA 3M1VA 3KHLA 1QLNA 4KGKA 2KZZA 1FD8A 1VR6A 1ACMB 1VQPS 1S12A 3MMAB 4MKBA 1ZPWX 4YS2A 2IJFA 5F8MA 2NZ4A 5D0RA 1KQSR 1T95A 3I4HX 5EDWA 1M1KT 1H0HB 4F8RA 1RT4A 5HI7A 3NG8A 1S79A 4Z7CA 1E6YA 3HDSA 2MKYA 4IFYA 2B6AB 3N28A 4ICLB 4PYDA 4JI5J 1KOHA 1PAEX 4RO0A 5I3PA 2GO9A 3NBPB 1SQGA 1B4SA 1NDPA 3MM8B 4QIFA 4IO9Q 1ZETA 3UE2A 2B5JA 1WELA 2E44A 3DI6B 2ZH2A 4I68A 2CJYB 4DS4A 3GILA 1K1QA 1G1XA 1S97A 2X7IA 4WE1B 4M5IA 1VBKA 5JVHQ 1CBKA 4F7VA 1S1TA 3MMJA 3MFIA 1J5OA 4RLEA 3ZTSA 3T19A 4F3OA 3C3LA 4OJ3A 4LRDA 5DM6Q 3IC1A 2RRNA 1ZAVA 1U2FA 2F65A 2AWZA 5DLGA 1S6QB 2YPYA 2ZHBA 4OI4A 3I9V9 4I6AA 5IZHA 1KHWA 5AJ3F 3TARA 3DLEA 3DNCA 4DR7J 4HDGA 4GO5X 2YWEA 4ATNA 2M5YA 3THTA 2VFTA 4PUOA 5HJXA 1J5OB 3CD5A 4A48A 4P52A 2GMLA 3TYTA 5KFBA 3KK3A 2XMUA 4IDKA 1VQ9S 3C16A 4NYZA 5KT3A 4R25A 1RT1B 1TKTA 1SJ3P 2EK6A 2Z30B 1EIYB 1VGYA 4ECYA 3JSMA 2D7SA 3U02A 3RB4A 2SXLA 4KGVB 1U1NA 3H7HB 1ZS6A 4A8KA 4KIAA 5B0EA 3POTA 2FLPA 3CDBA 1QAXA 3F44A 5L1KA 2MY7A 3EVMA 2V8VA 5CABA 1QSYA 4DV2F 1X5PA 2PN6A 2X1BA 3SSSA 2W7OA 1IJFB 1GNKA 3W63A 4LF5J 1U1OA 1T9VA 4KFBB 4PG7A 4V19J 1SQEA 4R0EA 3IMQJ 3JAMY 4JI1F 2ZH8A 5A8KB 5H9EK 4NRTA 4DWIA 1M5HA 5HLFA 2YNGB 4QW9A 3CJ3A 2ZH9A 4WYLA 2JOQA 4U7UK 4A8QA 3D9BA 2ASLA 3QAEA 3M4XA 4IKAA 4OYIA 2EFQA 2E5HA 4NLRA 3W2WA 4WJBA 5BR8F 4DR5F 2MQ8A 2LMIA 4J7CA 3Q8QB 4AQYJ 3CC7S 3RBXA 4YB6A 4AQYF 4KKOA 4DR2F 4ILRA 2LYVA 4DF4A 2E7WA 3AA9A 3CCTA 5KG5A 1EZZB 2DNZA 3OTDA 3OFEA 1KQFB 5HBMB 1FRIA 2V4QA 3DLHA 3BSCA 4NXNJ 1BLUA 2LU2A 4IG0B 3J80U 4YOEA 2ZC4A 2C2NA 4S0MA 3HO1A 1EQ0A 2JJ4D 2OEMA 3AD9C 3Q8VA 4J9VA 2R3VA 4KGMA 1X4FA 2GHWA 1JXLA 2F4VJ 4LR7A 2YQ1A 4PCQA 4XPEA 2WVEA 1U26A 2JLEA 3IG1A 4YMEA 3V6DB 4JI5F 2A2DA 4DV6J 3GYXB 3VAKA 4GKKF 4BCAA 3IXQA 2JC0A 4TY8B 2OAUA 4OI2A 3FCVA 2ZE2A 3DM2B 4CQ1A 3R2CJ 3CJQA 3ITHB 2Z56B 1NKCA 1Y9OA 2BYCA 4FYYB 2G2OA 5AT1B 2W2MP 4ANDA 2YWFA 5KFHA 5KG4A 2NXUA 1VOMA 2Q6CA 4USIA 1BD6A 3HVRA 1TUWA 1DQ9A 2CG8A 1Q8IA 2W9CA 1FXRA 2RS2A 4DR6F 3LF0A 4WXWA 3D6TB 3OFGA 2HHQA 4KE5A 4DL7A 5K20B 1RACB 1KEKA 3W5YA 4C48A 5ETVA 1RJJA 2FJAB 5CQGA 5DDQC 3TOQA 1OQ3A 5E3PA 1RZMA 3K59A 1UCNA 1IBLF 3FJ2A 4HI2A 1S4EA 4C11B 3CJSA 4K5SA 5IT9Y 4U95A 1AXQA 1U02A 2Z2LA 1JLBB 1HNVA 5T7LB 2HVEA 3WHIA 1HBMB 2EG2A 1VQ7S 1T05A 4ZPBA 5GAEI 1DJ0A 3BR9A 2NSBA 3D6MB 4O44A 1SJRA 3M2VB 1Y00A 1NZAA 1QJHA 2DHGA 3T9ZA 3TWZA 4DZ6A 4J9OA 3X1LB 2VA3A 4PG5A 4JI3J 1YRXA 5KFUA 3HFKA 1N5YB 3NGUA 3R1LA 3SFUA 2BOAA 2BJ8A 4Y2AA 1JLAA 3R6GB 4ZVSB 3ET6B 5GAEU 2WTFA 5HQMA 2IBKA 1EKSA 1U48A 1JLFB 5HJYA 1NDKA 3CSKA 2BR0A 1HIYA 2AD9A 1JJ4A 4RW7B 3ZFVA 2IC3A 1D9DA 1UL3A 4ZIVA 4E2FB 4Y0FA 1NM2A 3BKFA 1HBUB 2DYAA 5I3UA 4NEZA 4X4RA 1BGXT 1KN6A 4L3NA 2GQ2A 3NBPA 2B8QA 2H51B 1H74A 4FYVB 1TL4A 4PWDA 1XR6A 2JEFA 3G2XA 3TAMB 1Y4ZB 5C42B 4C2MA 3VR1A 2E29A 2V8PA 2KM8B 4PG6A 3JB9k 1XIQA 1MSWD 1RUSA 2QRRA 1X9MA 1R8PA 4DL0C 2BV3A 2EW9A 1K44A 1MG7A 4WZQA 2IVMA 4TU8A 2OPRA 1RTZA 5DS7A 1WEZA 4LSLA 4ZCKA 3PRDA 1HARA 2L3MA 3DM2A 3M2UB 3JAMU 3UCZP 5THWA 3C6TA 4P9SA 4Y2MA 3A12A 3HHLD 1VRUA 4KPCA 5LXYA 3UD3P 2QMUB 2I8EA 4H4MA 3L09A 1GX5A 2CNNB 4RW8A 4CM0A 5HSPA 3CCQS 1RT6B 3JYTA 4B3TF 1HWLA 1MWZA 1M5SA 1Q95G 1S9EB 5MLCV 2E5IA 1BQNB 5DDPC 2UUAJ 1TKTB 5D0HA 2G1HA 2WBRA 3Q86A 1P6TA 3A8KA 3S01A 1Q7YT 4XTTA 3T1AA 1C4CA 2HGLA 2C3MA 3J7Z5 1MNEA 1ITPA 3C14B 3R3TA 3IFEA 4OYWA 1OQ6A 2DT9A 5IOLA 1PC5A 5KFJA 3EPGA 2MQNA 4P75A 3W2VA 1SKRA 4Q0BA 4ZHRB 4GC7A 2CPZA 5B0GA 3CIMA 4DQRA 3TQ1A 3CDEA 1QAIA 1ZM9A 2OH2A 2IRYA 5A2QY 1MLAA 2MZ1A 1K8AT 1FRKA 1GEHA 2YKQA 1NZ8A 4FYWB 4XPCA 2CQIA 2HLUA 2DISA 4DN9A 4ES2A 2ZJRQ 3KG1A 3EZUA 3CW2C 3NAIA 4IFVB 4OZ2A 3FFIA 3M8PB 1WDDA 1L3TA 1Q1KA 3L95X 2OFHX 4J9PA 1RT7A 4UOFA 2FGOA 1S76D 3RU0A 3AA8A 4DPUA 2MPUA 2QLFB 4CT8A 1JXEA 4YDDB 3KLGA 1KLNA 2W2NP 2M9KA 2YNHA 2RU3A 4IUFA 5AXLA 5J2NA 2WVCA 3LANA 1IWGA 1OYEA 3IO1A 3LTOA 4OIXA 3EDQB 3OV7A 4K50A 4N76A 2DNKA 3KXDA 2H4WB 3GR1A 3DRRB 3J7A1 2VG6A 3BSAA 1KVKA 2HNYB 1JXVA 1RWWB 1A0OB 1S49A 2CQ3A 5E3QA 4IR1A 4K2XA 4NE9C 3PR5B 3M6UA 2I5JA 3QMQA 5HMZA 4F4XA 2Z57B 2ZJPQ 4D3GA 4TU9A 3RB3A 4JI4J 4A8WA 3BPDA 3QZ8A 5LT5A 3ZTRA 3W1YC 4RNNA 4YN3B 2NSCA 4QYZK 4QIVA 1FWKA 1WC4A 3ZTPA 1CJVA 1FXDA 2PMHA 3O5TB 4FP9A 5KG1A 4F04B 5L8RC 2IJNA 4RW6A 2XLIA 2IHR1 1Y7PA 3MF5A 1TL1A 4DL3A 1SL0A 1UEUA 4MT1A 9RUBA 5AJ3J 1BUXA 3HK2A 2XZDB 1X60A 1H2TZ 4I7FB 3QLHB 3DDIA 5FDLB 1LW2A 2A3JA 4CT9A 3NGKA 1WKJA 3S1TA 1PC4A 3KJVA 2JC1A 2IM1A 4JV2A 2EPIA 1UW9A 3CEDA 1C4AA 2X3GA 2E5JA 2MHEA 4NPOA 5KT5A 1QAJA 3OJSA 4DV7F 1F9FA 1T02A 2DR5A 4DX8H 5FDLA 2F9DA 4C8MA 1WOPA 3CCRS 2F5GA 4PXDA 4TLQA 4ZVRB 2FHMA 5E5NA 2EVZA 2BOPA 2XZTB 3MEEB 5CCLA 3EYZA 4LIWA 1RLCL 1AZSA 2GX8A 3UN5A 3KK2A 4RBTA 4RW7A 1LWEB 3W3SA 2OPQA 2FHOB 1IJEB 1S59A 2HBQB 3K5LA 3ETMA 2IYIA 2V34A 2R2RA 3OVBA 2IMWP 2MQLA 1KWMA 2LQ5A 3ZZOA 2LEPA 4K4TA 4USHA 4DF8A 3DU6A 2G2YA 2GFFA 4AT1B 5G4DA 5ADZA 2CJAA 4KAIA 3W60A 4B9UA 1WTFA 2ACYA 1H98A 1OS5A 1HNXF 3R6LB 2M7SA 1R31A 1JK9B 3D2WA 1MN9A 1SV5B 1VBYA 3DRYA 3Q2SC 2YNIB 1DURA 3GIRA 2R7WA 2D3OR 4OHYA 3GFHA 3M32B 1M1HA 4O0NA 2YVSA 2ZH6A 4W90B 3MOJB 4ED1A 4YB7A 1UETA 3M05A 4FVMA 4PWUA 1TFWA 5GAHI 2ZUGA 2HEKA 2NXNA 2VFVA 2W7AA 3BYRA 3FSYA 3R8YA 4IRKA 5DO2A 4CO3A 2DNMA 1MWQA 2I9SA 1AYEA 3IM8A 1AUSL 1VQYA 5MAOA 5JUMA 3CUNA 4C0OC 1YWXA 1OYDA 1RTHB 2DEIA 2UUWA 4QYRA 3VAJA 2L08A 1SH3A 4C98A 3DLKB 1NH8A 2DJWA 2JEJA 4Q8FA 4ZVQB 2FVSA 4DCJB 4OHVA 4JOUA 4WF9Q 2AZ3A 3KLIB 1LW2B 3CWJA 2ROGA 3GSDA 3HKZD 2J8SA 2DIUA 4ZDNA 3TRGA 4DZDA 2XO6A 4DPWA 1WF1A 3SFGA 1UJ6A 3W2VB 5LSLA 1WHVA 1NXIA 2CJQA 1S1UB 2R9LA 4UY85 1PJ5A 3E01A 4P73A 1FDNA 3ETOA 1FDAA 2VG5A 3NMRA 4P2SA 1CJTB 1NHUA 3RZAA 3ZTQA 4HL9A 2OEKA 2BANA 3AODA 2FVQA 3MAAB 5HATA 1ZH5A 2QA1A 1VRTA 4J9LA 2EXUA 4ECRA 1AZSB 1CQNA 4ELTA 4TQRA 3E01B 4LF1A 3CJTA 4QZVB 3GPAA 1SJQA 2ERRA 4E8UA 1TVRA 2V69A 5CD4H 1NKBA 5CXTA 3LGNA 3KLEA 1U1MA 2CJKA 2XS2A 3NNCA 1OMSA 2XYPB 3HPOA 5KFIA 3T5HA 1PG5B 2IVYA 4GRSA 2YKNB 5F8IA 3Q2TC 3M6VA 1ZAXA 4J9NA 1S7HA 3FSXA 2WONB 4FYDA 1RTJA 3GP9A 2HFSA 5FIIA 4DLGA 4H4OA 2DHSA 3MEDB 2DR8A 3MM5B 4ENOA 1WEXA 3SZ2A 3MDFA 1HMVB 2HVHA 2W4CA 3HHLA 2C3PA 1K0TA 4KYZA 1FJGF 4DR4J 2G9OA 4WE1A 3C8YA 4WKRA 2N3LA 3A3PB 1U2RA 1YJ7A 4NX9A 1NNDA 2CDRB 3H5UA 3IR5B 4W92B 3DI6A 2HGNA 3H8YA 4NXMJ 2GW8A 4DQQA 2QMWA 1Z2LA 2C2OB 2HQCA 2XSFA 4KHRA 2FJWA 5CAAA 5ETOA 1FI4A 1HMVA 3IA0A 3MXHP 2GJFA 1LWFA 3R5CA 4RZRA 4ZVTB 2QTWA 2QYCA 5KFMA 4FPRA 1WORA 2BA9A 3ENVA 2BRLA 4X65J 1OSDA 2QN6B 1D8YA 2Q1LA 3K58A 2UXBF 1TKZA 2YKAA 2K1RA 4L6V3 1CULA 3IGNA 4TLRA 3HHKA 2RUGA 5HMWA 1R0AB 2CPIA 3EDRB 2M70A 3UDEA 2R8IA 3ITHA 2R2SA 4FKYA 1SBRA 2RE1A 1NPKA 2VG7A 3OTCA 4CLYA 4EU0A 3OVAA 3RTVA 3V2UC 3NLCA 3MPYA 3IAM9 1FEHA 3LOUA 3TR5A 2BDPA 4Y3CA 2Z4PA 3A8EA 1WNEA 5EWFA 2KG0A 3H5YA 1H6KX 1XBWA 2VBXA 1HD1A 3D5MA 1S0OA 4IH7A 4WFYA 2DRAA 3LAMA 2N4DA 3DRPA 4P72A 4CM2A 3CCVS 1YQHA 2DBBA 1HHTP 3MZIA 3BZQA 3NWGA 2JNJA 2E9TA 1JJHA 2GMHA 4TU7A 5HLFB 3MEGB 1U1PA 3PEJA 1C0TB 1F5BA 2M4MA 4YB1P 3V4MA 3CVKA 3GFZA 3DCAA 4YQWA 2LEBA 1K73T 1PYSB 1B0PA 1LFPA 2HFZA 3OHAA 3HP6A 2RRAA 2VFRA 5J2PB 2ZKTA 4ANEA 4LBIA 3PX4A 5BXIA 2KT2A 2MZJA 1YJ9S 3P3DA 3H4BA 2W01A 1I51B 3ULHA 4K4XA 5KFKA 3DLBA 4QYZJ 2IAJB 3SQOP 3TUIC 4FNIA 2YNFA 2LXUA 4I2QA 3GMGA 2O5DA 3DDKA 1X4HA 3FZBA 1FFGB 2MKCA 5HBMA 1HA1A 1UPMB 5D15A 3TVZA 3BGUA 4C0HA 1NLKL 3K8VA 4F0MA 1KLMB 2OD4A 2DHHA 2HQFA 3IWLA 3GIKA 4KV8B 1VQ5S 4ZPTR 2J5AA 1I5OB 2GZOA 2F8MA 1N33J 1X9SA 2VC1A 5HVGA 3QWUA 4F3MA 1H2UX 2GC8A 4ED4A 1MWYA 1TQLA 3T1YJ 3PNIA 4OHWA 5LMUJ 4DLEA 4IDKB 1N34J 2I0XA 2PEBA 2QMXA 4DN0A 3K5NA 2QV6A 3PDNA 4WFXA 2W9CB 3ONQA 2POKA 1CULB 3BDEA 1NDLA 4BWJA 4WCEQ 1R0CB 3ZZZA 5KFCA 1HFEL 2B4PA 4NLYA 4AXJA 4CH0S 3E51A 3H0PA 5CH7B 5KTQA 3ENAA 2BJ1A 1U6ZA 3MR6A 2XC9A 3V6HA 4TN2A 4QIWD 2AV5A 5HL7Q 3IS9A 1HI1A 1RWXB 5D4LA 2C3UA 4DEZA 3VAHA 4NCGB 5HROB 4NI2A 2J8AA 1FKOA 1T9WA 1YHQS 1UA0A 1JKHA 5BYSA 4K8RA 5EHHA 2MQQA 4AL6A 3RAXA 4K4YA 4TY9A 1S48A 1UFWA 4MFBA 3LQVA 2HGMA 4NLPA 2ZBIA 5CYQB 3QSYB 3KLFB 2QEXS 4OX9J 2RF2B 3AT1B 2WOMB 4X4TA 4NXNF 4U6PA 3M9MB 2I6WA 3THPA 4LR9A 3IS9B 4MK8A 4C8KA 2FGCA 2H54B 3ET6A 4NLTA 3C6UB 5A6WA 4OI3A 1XNQF 4ZHRA 4M5JA 2UP1A 1I3OB 2COLA 2AHOB 2HFNA 3O8WA 3CDAA 3TA2A 3TJ8A 2R8JA 1IXKA 4X4QA 2C2DA 2V67A 2YX1A 1F9HA 2FUG9 2YTCA 3MM8A 4IG0A 4NZ7A 2PIIA 4ILLA 3PRBA 5AXMA 2P9GA 3W61A 4EI2A 1KONA 2H4YB 4UZBA 1GMWA 1S5ZA 1UWAA 3N4WA 1U2CA 1AROP 2AIRB 2DY1A 4LUBA 5LL6d 1RT5B 1EQMA 2BVZA 5K14A 3TEGA 4GO7X 1U1LA 2MQMA 4L76A 4USWA 3CMAS 2RH3A 4UW2A 4NA2A 5D4PA 2FHJA 2MSSA 2OELA 3UDLA 3ZZRA 1KP6A 4YUDA 2QZ8A 1U49A 1S10A 1CJUA 1FTRA 1VBZA 2RD5C 3QGHA 4BC7A 1GMVA 2V4RA 2AZ1A 4GKJJ 4F4KA 1H73A 3TZXA 3GCXP 2U1AA 3KG0A 4OX7A 5JMNA 2YH1A 1YI2S 2MLXA 3H42A 1D1UA 1CEZA 1D3WA 2XI3A 2HZVA 2R7TA 3G96A 2BJEA 2YPZA 2ZDPA 3I31A 4LF9F 3NY0A 2K7JA 4CH1A 4X4VA 5HMYA 2R2TA 4ZLLA 4LQ9A 2CNKB 3TI0A 2V2ZA 2ZWPA 4FXDA 4ELVA 1UMJA 3AB4B 1JLEB 1U7LA 1ZOTA 1ZM3A 2GA7A 3FRYA 1DARA 4DR3J 2VPYB 3TX8A 5KT4A 2HVZA 2LLZA 2CQDA 4G1IA 4KO0A 3KHRA 1BWEA 3MR5A 3BYPA 2FJDB 4NZ0A 2BW2A 1YBAA 3VF0B 1NO8A 4OHXA 1NCLA 2MZQA 5KG3A 2YWWA 3EUNA 1RT2A 5HQ8A 4RPFA 3QT7A 2HWHA 2CPJA 2RQMA 2A1BA 1N5SA 2QG9B 5B7WA 3PIOQ 4YEAA 1HKAA 5K8MA 2R7QA 2ZOMA 3BB5A 4OHZA 4ES1A 1H38A 4KTQA 4GMKA 1WI8A 4QR0A 1REVA 2KI2A 1MU2A 2YY3A 1CQMA 1QM9A 3BPSP 3LP2A 4CDIA 1N56A 2GHPA 2RNEA 3PO4A 4NL5A 4WBFA 5IT4A 1TK8A 4ELUA 1JNZB 5FLXY 2C3YA 1WOSA 3D28A 1J5EF 4Q0BB 3PM9A 2PFFB 4KH0B 4KHMA 2E1PA 4H4KA 2MQOA 3TEHB 4N47A 5I3UB 3DMJA 4JV5F 2CDQA 2HHWA 4KQZA 2M88A 4QIGA 1XJWB 1BQMA 3BBFA 3X3UA 3GFYA 1J27A 4RU2A 4G3IA 2HRUA 1JLQA 1VJWA 2QJ3A 3VAIA 3MURP 1YKWA 1CPZA 5E2QA 4EMDA 1N6QA 4HHHA 4OI6A 2ZM6F 4YFUA 3BGOP 3KK2B 1X0FA 3P6YC 1LWEA 4JV0A 1JLGA 3CB4A 3G4SS 1JWWA 5E0OA 1RA7A 4NMXA 2WRMA 3UWTA 3MHYA 2WVBA 1TKXB 3Q8SB 1CG2A 2ZM6J 1TV6A 4BLGA 2HLTA 3C6TB 2HNYA 4O4GA 3H5XA 2E9ZA 4WYWA 2DGXA 5L9XA 3CCLS 5KG0A 2ADCA 3MOZA 4KPYA 2WSCC 1FJCA 2XSJB 2EKNA 4NMLA 5F0WA 3DOMA 1LWCA 2DPIA 1YBTA 2K8GA 4CLLA 3C46A 1FCAA 1UEVA 2XMKA 3G6ES 4FVCA 2LVWA 4CI0B 2NYHA 1S99A 1T9UA 4F67A 4WTOB 3HLUA 5IV3A 4ECUA 1M5PC 1OPZA 4LF2A 2XNQA 1JB0C 1W2IA 4O4GB 4WTYA 4Q45A 3G9CA 2AJFE 3RGIA 1HR0F 4DUZF 4B02A 1RYRA 2VU5A 3JQJA 2A18A 3OTEA 4J9KA 4M8LA 1Q78A 4RW6B 4DCOB 4CLUA 3UR0A 3QATA 4A8SA 3PW7A 2XGQA 1NJWA 5KFTA 1CJVB 3QFWA 5J2MA 4NCBA 4ER8A 3FKBA 3OXLA 2B3TB 3R7BB 2J6SA 1R8CA 2V0NA 2JHEA 2JRSA 2QIFA 1WACA 5CYQA 3K5MA 2BRKA 2NXCA 1LV5A 2KFZA 2M2BA 1EHWA 1B70B 1DQ8A 2CPDA 2HFUA 2KVQE 2OUGA 3GIJA 2W9AA 2MDAA 3NCRA 3N79A 4UF4A 2G2ZA 3ILOA 4XDDA 4X4SA 3NRBA 1RWPB 2NUUG 1VQ6S 3C15B 3RJMB 3EGVA 4LF4J 3DOLB 4OJ1A 1IKXB 3B54A 5K9FA 2YQ3A 4URGA 3T1HJ 4I64A 1D9FA 3KOAA 2PI4A 4R5PA 3I56S 2VPZB 1VK8A 3LAKA 3DXBA 4YR0A 1U45A 1KVJA 4LF5F 4OYAA 1OY6A 7AT1B 3HXMA 1UVLA 1IQZA 1PJ6A 2KT5A 3MEEA 1H7WA 4RUBA 5IQ6A 4DUZJ 3CMES 1Y3KA 3VWSA 4B3SJ 5KFXA 1Q4RA 4D3HA 3IN5A 1IWAA 3DOLA 1X4DA 2HFOA 2OPQB 2W2QP 2OPPB 5K14B 4ILMA 2L41A 2CZ9A 5D3GA 2OPRB 3DGPB 3QT5A 1M0SA 3NP5A 1RBAA 4ID8A 4J37A 5G0RB 3T5LA 1W25A 2DGOA 3BH6B 4NA3A 2K7KA 1CJUB 1ZA1B 2BEFA 3A8JA 4YDXA 2AW0A 4ZVHA 3T6BA 4IR9A 3SEOA 4F02A 4F0KA 3A3NB 2YKNA 1RT3B 4NEYA 5EUHA 1GXLA 3JQKA 3GV5B 1O8BA 3QRRA 4HT5A 2XMTA 5L1LA 5KFQA 2MYFA 3Q89A 2DNGA 3R5DA 2HAIA 4H4OB 2ZBQA 2XWYA 1EARA 2VPWB 2B5JB 3D0HE 4P7VA 4JI6F 4PG8A 2W8LA 3VGUA 1GQEA 3GTYX 3OL8A 2VIHA 4B9TA 2NXJA 4CLWA 2KXHA 2HYIB 2RKIA 2YWHA 1RT3A 2VQFF 4IQMA 3UDCA 5EX0A 2KU7A 5I4MA 1FRHA 4ED6A 5H9EJ 3RRKA 1FJEB 4NLGA 4HHJA 1GMUA 2N4CA 5A8WA 3ZZYA 3ZXWA 4LRAA 4DV3F 2UV8G 1LWXA 4M94A 3C66A 5IC4B 3OXFA 1RE1B 2HVDA 1N54B 4A4JA 1Q86T 4DL2A 3R2DJ 5ITHA 1SB6A 2LP4A 2JL9A 2LXFA 1SC3B 3U7JA 4DX7A 1IKYA 2L9NA 3HSZA 4B9NA 4B9SA 1YJWS 3MUVP 2QC3A 4K0KJ 2ZD1B 4LRBA 3ZTOA 2E1AA 1Z1ZA 3BH7B 3LP2B 1R0AA 3POTB 1NJXA 2OJ3A 1G6BA 4M5NA 4U67Q 2QA4G 3O3LA 2EEYA 2W9BA 5JVGQ 3QIDA 4DCPB 3LPEA 2WVDA 3KFWX 4TYAA 3KLGB 1R8AA 5DRKA 4JI3F 1XERA 3EGZA 4B3MF 2UXBJ 3OLBA 4QBUA 4DX6A 2VG5B 2HSEB 1HBOB 1CJTA 1OJ4A 3JSBA 1U09A 4LBHA 2HHHJ 2ZVIA 1EP4A 1B7YB 1U1KA 1UPPA 2BKOA 3OFFA 2HHSA 3ISND 3K89A 2IM0A 2IY5B 1HHSA 1A7GE 4DR3F 4P6QA 1HNIA 3P5BP 5B09A 3NS7B 5A6PA 4Q8EA 2XMMA 1B7FA 4F4AA 3QPIA 3AOAA 3BGRB 3W2WB 3ZNUA 1U1RA 1Q5VA 4RNFA 1XMOF 1UA1A 3MEDA 5M2UA 3H4DA 1K1SA 2B56A 4Y00A 2KDOA 3SDEA 2DPJA 1TR0A 2HKEA 3KUHA 3FRZA 3EJMA 2KXNB 5CCMA 3IRXB 5DZ6A 1HW9A 1N32J 3J7YU 3I0SB 5CYMA 5LJ5Y 2DGTA 1RYSA 3HHLB 1AFIA 2C3OA 3K7RA 3P4UB 3NL0A 4L72B 1Q82T 3AHPA 3MM5A 3WZ0A 3SV4A 3G8SA 3BDPA 3MWBA 1N5QA 5EX3A 2FHKA 3H98A 3HJFA 4I67A 3MM7A 1HQ2A 4DR4F 1UVKA 2GVZA 3HULA 4CTAA 5ETQA 3JS9A 3A4TA 3RYLA 4DV0J 5D0GA 4KB7A 3M8SA 3J81j 3BQ1A 3KJQB 1Y11A 2X51A 3GB0A 1TK0A 4K59A 5C2CA 2VUGA 4ZMMA 4CLFA 2DGVA 3TX0A 3RBEA 5T41A 4KRWA 1RTIA 4B9MA 2BANB 2ZITA 2VD3A 5CYJA 3DLJA 2KFYA 1WTBA 5M2PA 1RAJA 2V68A 1PYTA 3M8QA 3J7AN 2CADA 4XO0A 2NQPA 1VDHA 4ALZA 1TK5A 2K3IA 3EGWB 3HVWA 4MIAA 5IQQA 2ASYA 2QLXA 1DTTA 5B0BA 2FLNA 2GIRA 4MH8A 1R8HA 4U7UD 3B4MA 2C22A 2IA6A 3KNGA 3EPIA 4F4WA 5IM0B 3I5CA 1HQUA 4HTIA 4XAKA 3BN7A 3BV8A 2B8PA 4OZNA 3MM9B 1KRPA 4R8UA 1APSA 4WIQA 2M8DB 1KR4A 2IRUA 1FNXH 1UTAA 3D3CJ 2AX1A 2BM0A 1VCTA 4GVBA 4N56A 1VLOA 4RNOA 4N41A 4DJBA 2F4VF 3TA0A 4DFJA 3J81Y 2Q6BA 3MI7X 5JXSA 2F8EX 4RW9B 5E3CA 3DGPA 3RUBL 2BMBA 2IYGA 2KB2A 1RTDA 1HQUB 4DV6F 3SI8A 1S1TB 1UW4A 4HT7A 2H5IB 1Z4UA 2RQ4A 2E5GA 1WF2A 4P2FA 1H3DA 3D0GE 2LU1A 3UN2A 5DLFA 5LMUF 1VBXA 3PY8A 2GGPA 4ID5B 1FX2A 2QT7A 1L3VA 3IM9A 4DR7F 3H20A 3OUYA 1N33F 5L9NA 2DO4A 4IOBA 5L39A 4PXEA 1E6VB 1LQ9A 1QUPA 1R7IA 1X4CA 3I96A 4X2BA 2YQ0A 4DQPA 5BR8J 2VH7A 1UKUA 2LQ9A 3KUEA 2FTRA 2Z58B 3J81U 2R8KA 3TZYA 2QL7B 4I6YA 4C9DA 2FLOA 4PYAA 5CHCB 3RR7A 4HH0A 2O66A 3JSMB 2XB2D 2K1RB 3D54A 1SIZA 1S72S 2DIVA 4C3LA 4OL8A 2Y1LB 1PGZA 4X84A 1HWKA 2NCKL 4P2MA 1PSDA 3M2UA 5J1EB 4CWBA 3PFOA 2W2PP 2ZKUA 3JTOA 5D77A 4ZLNA 5ETSA 1HYSA 2OFGX 3IBCB 3HFZB 1R0BG 1RWUA 5B0CA 3PW2A 5KFEA 1WD6A 2BM1A 3TNVA 2QA2A 4KH1B 5A8RB 3NGRA 3SCKE 1NK7A 3GLJA 1IBKF 3TJ9A 2MZSA 2RB7A 1UEKA 3MM6B 4PKDB 2R42A 1DLOA 5AE2A 4YR3A 4B3MJ 3PCOB 1XNRF 4WK3A 1U8WA 1WKLA 4BBYA 4RJVA 2JFDA 4LFBF 2HS4A 4LFBJ 1FKPB 1SKSA 1HBMA 2RF2A 1T05B 1X31C 3QO9B 3GJRB 4F3QA 2B4OA 4ED5A 3VGTA 2RSQA 4NCGA 2IC3B 2MMYA 2HRTA 4N7TA 4DV4J 1HBOA 5HROA 1FT8A 3CJ8A 3BS9A 2MZRA 2JEIA 2V8HA 5GMEA 4DV7J 1S77D 1X4AA 2JVOA 3M6WA 2MQPA 1JLAB 4ZP7A 3QSIA 2D3ZA 3AOBA 4N8OA 1XN9A 3UD4P 1DHMA 5I3QA 1RHKB 3CJ2A 3VAGA 4K5RA 1SC4B 3HM9A 1T3NA 4OZ1A 4CO0A 1QY7A 2IM2A 1U1QA 2AJ2A 3R27A 1KTQA 3D1QA 4PG4A 2OHDA 3MUTP 1F3FA 2L9DA 3PTWA 3MR3A 2VQFJ 1T8EA 4TXSA 1SL2A 3LUYA 3TZZA 2UUAF 4DHVA 1NU4A 3JSYA 2N7CA 1L3KA 4HACA 5L1JA 4OX8A 3PX6A 1VIXA 3H2LA 2OSQA 2PT0A 1EETA 1Y3JA 2A0FB 3LALA 3D1HA 4I4BA 1KLMA 3BN4A 4RBUA 3BO2A 1RT5A 5LMNJ 1O51A 1S0NA 1VRUB 4ZIWA 2H3EB 2DNYA 1X7VA 4L73A 2B43A 4EWTA 1WI6A 3RR8A 5ETPA 1FK9A 3PJ9A 8RUCA 4B9LA 3G6VA 2HK2A 2QA4S 2CQPA 2PSZA 1KFSA 1H7XA 4DSKA 4LF6J 2MXYA 3MD3A 4AUKA 4KHPF 8AT1B 2YKOA 5GMKa 3CULA 4FXWA 2ZBCA 1IBKJ 2HS3A 1TAUA 4X62J 2D74B 5D78A 1AT1B 3KK1B 4FS2A 2CG4A 2M52A 3LP1A 4ITSA 1TL5A 2HNZB 4DL5A 2I38A 1UVMA 1JLEA 2V6AA 4C8YA 4HKQA 3T5JA 2ATLA 4P2XA 4EBCA 1FRMA 5LJ3Y 3G71S 3OR1A 4ECXA 3D4JA 1A6LA 5ETNA 2Y8WA 2CJBA 4DV1F 1RTIB 1IM6A 4DV3J 2OMLA 5A8RA 4BC9A 2VZ9A 2GCFA 4DFKA 1TL1B 4ZS6A 3BBCA 1HNZF 5GAHU 3C14A 3MEGA 4JI7J 2UUTA 5ETLA 4F25A 2N3OA 4ED8A 1HD0A 2CPEA 2VBZA 1YTYA 3VGSA 4ECSA 2AGPA 2E1MC 3OL9A 1JLFA 4DL6A 3NNAA 4J9UE 2GV1A 3CGIA 4MIWA 5DQHA 2HFVA 2WHOA 2BQ3A 3GCWP 1D09B 2I1RA 3DXSX 3HKWA 2Y1RI 3CO0P 3HI9A 5KFGA 4NXMF 1KQGB 1HI8A 1FNMA 4I56A 4NLDA 2XQCA 1NSQA 4NLWA 2R2UA 4WWSA 1N48A 1S1XA 1Q7LB 2G13A 1NPPA 2L9WA 2YX4A 2RHQB 4M5DB 1UJ5A 4N8NA 1RWVB 1C2PA 4MTPA 2ZHOA 4Y34A 1UVJA 1FHTA 4URSA 1C0UB 3GR0A 2C1EB 5E3AA 1S6OA 3HFVA 2HRYA 1TELA 1WHXA 4RW9A 3SMZA 3QYYA 4A47A 1RTDB 5C7PA 2XLJA 1H2VZ 4IH6A 1F2HA 1G7CB 3DMJB 2YNHB 3QNWB 1WG4A 3MFHA 3BREA 2M8HA 4ED7A 2IPOB 3A1YG 4JB8B 3ZZPA 2Y3YA 1FKAF 2ASJA 4EZ6A 3CXCR 1CVJA 3GV7B 4RWXA 1O0PA 4B3TJ 4YHHJ 4NOHA 4JI8F 5D6GA 2RJZA 3MPUB 2BQRA 1K47A 1GTEA 4QWBA 4FF2A 2KN4A 3B4DA 4A8XA 2NPIA 2QE5A 1I6JA 2KYZA 1F5AA 3U27A 3FBCA 4EO6A 4ZCIA 2MSTA 1OY8A 5GAGI 1N0VC 2HHPA 3W65A 3E8OA 5DETA 2LA6A 1RAFB 2IFXA 3AXKA 2FIUA 1BXNA 4QU6A 4P74A 2B9EA 4MK7A 1P8GA 4OLPA 3L9ZA 2ZDOA 4EK2A 4OQJA 5KT7A 1HNXJ 2R8HA 1NEEA 1EX8A 2XSJA 5HK4A 3CJKA 3DC2A 4C6AA 2AF6A 3VTIA 4DXLA 2EBEA 3VCDA 2AU0A 5BYRA 4IO1A 1YGYA 1F1BB 4NI2B 2DTJA 1NKEA 2BBEA 3I5AA 4RNMA 4ECWA 3VQTA 3QJJA 3CTRA 1RQ0A 1ZAWA 4LREA 4IRDA 4DPYA 1Y5IB 5HQLA 4ECZA 1NJZA 3OVSA 1JLCA 1DRZA 4JV5J 2OP5A 4GC6A 4NLOA 4C11A 1SCJB 2E66A 1UAWA 2DR9A 2QFIA 2VB6A 2RIJA 4OYBA 1JQGA 2V8DA 3W66A 3W7BA 1TL3A 2IRXA 5U47A 3WQPA 1AB8A 2CVEA 3DRSB 3P45B 5IWAF 4IG3A 1HBNB 4G1QA 2HNDA 1U0HB 3IBWA 2CRLA 4JP8A 2BJDA 4WP8A 2NPFA 3A8IA 5KFFA 3OL7A 1W26A 2NZCA 1QTMA 2DCUB 2CQGA 1UFLA 3ZZTA 2DGSA 5J2NB 1CJKB 4G65A 2PO4A 3NKYA 5ETKA 3CIZA 3ZNJ1 2ZD1A 2VDIA 3BR8A 5SZTA 1WC6A 3DRSA 4PXCA 4B3RJ 1NUEA 2CWKA 2FY8A 2F1FA 2VG6B 4IG3B 1REGX 4CH7A 2CJXB 3F41A 3CD0A 2XLKA 5DG9A 1ZZNA 1S9GA 4CRJA 3NOCA 5IV4A 1QAYA 5E7OB 2V9KA 3K17A 2QLWA 2MKSA 2WSEC 2ZH7A 4DUYJ 3LP0B 4JI6J 3QIPB 3TUZC 2FB0A 2H48B 4DX5A 5AE1A 2J9EA 4YB5A 2LCWA 2V50A 4DDFA 2XCPA 2W2OP 2RS8A 1LEOA 1RCXB 4IFYB 2PC6A 1YJNS 4DSEA 5K8NA 3JQMA 3MPWA 5HP1A 2H9ZA 4B17A 2D9PA 3UFCX 5A2QU 4O3RA 1RTJB 5F9LA 2XCAA 3GSIA 1RTHA 3M32A 2IMOA 2MY8A 1VHIA 4JYAF 3CCMS 4EZ9A 2ASDA 1NAQA 2YWGA 3PZPA 3SXLA 1SH0A 1CS4B 4K0KF 2MKJA 2VKRA 3KMSA 4I7FA 2EG1A 3DLKA 3IR6B 4KO0B 3BJYA 3AJ2A 1F6TA 3D67A 4XIUA 1RBLA 3Q23A 4FS1A 1LNQA 3V6JA 3MCSA 4FXVA 3M30A 2LEAA 2C2RA 4ZLJA 3W64A 2OTJS 1PKUA 1RT2B 1T94A 3FCWA 4LFAJ 4UOCA 3DYAA 2DH9A 1BQXA 3H2UB 4OX6A 4CO2A 2DRBA 1Y10A 4ZVOB 4LT6A 2MLYA 1YRUA 1CSJA 3JTNA 4LIRA 3W5ZA 5L46A 3DN9A 3B82A 1G4CA 4UT4A 2VBWA 2GVZB 2PFDA 3CJ4A 3NCPA 4IYQA 2QSFA 5GADU 5DGAA 3ELHA 4LMZA 4E98A 2HWTA 1SKWA 1HHQA 3I82A 3D0IE 2WSFC 1S1UA 2B4VA 1NK5A 4E0DA 1HBNA 4G1QB 1BMQB 3DYAB 3OLAA 4ECQA 1IKYB 5GAGU 1VC5A 4LF9J 1FRJA 1S57A 3QQCD 1AA1B 1BQMB 3PHTA 1PO6A 4ZVEA 3EMTA 2B4UA 2FZCB 1RAEB 4ZVUB 2ZFHA 3NGDA 2CUYA 4ED3A 2XTJP 3I0RA 2MZTA 1XR5A 2EFVA 2KHDA 4Q7AA 2ROPA 4Y2KA 4YY3J 2JEGA 1EB0A 2IVFB 4CO1A 3V4IB 3QAUA 3N9UC 4GKKJ 1IKVB 4ZJOA 2ACMA 2AJ4A 1HQEB 2AX0A 2LFVA 3FEZA 3IAS9 3MAHA 2KVIA 4FN5A 5KFSA 2OPSB 2FZKB 1VJQA 3KLHA 2ILZA 4QW8A 1I94F 3HSGA 3G6YA 2B9XA 4KKOB 2BE2A 4LSNB 1S0MA 2I2YA 3PRVA 4RW4B 2PI5A 1KKHA 2DNRA 4NWBA 3MM9A 4W4MA 4AXIA 3LW5C 4PABA 2V4JA 4DMZA 4QR1A 1N8RT 1ROFA 3CF5Q 2Z2ZA 4USJC 4HHUA 2RDJA 1M90T 1HQEA 3MCNA 2HHVA 3O44A 4ZJLA 3CC2S 2R4FA 3GV8B 1LXJA 3G86A 1U24A 3Q8UA 2FD2A 4QWAA 3G8TA 5BYQA 2NXEA 2BJ9A 2YBVA 3D6FB 1NJYA 4OFZA 1ZZFA 2HIYA 2YKMB 4WU2A 6AT1B 3MMBA 2ZH4A 4X64F 4UTGA 1C1CB 3QGGA 4Y2IA 4UOGA 3PXGa 1S7IA 1N5VA 1S1VA 5IXUA 4CIOA 3QWPA 1HNZJ 2EBGA 2UVWA 4LRCA 1U8SA 2KRRA 4KV8A 2B9WA 2IBOA 1HI0P 1WSVA 4JI2F 4X66J 1HLWA 4LJMA 1KQKA 4Q44A 2D41A 4CNYA 3N6NA 4UUXA 3O2IA 3GQCA 1LW0A 2XY6A 3MCMA 2OI2A 3T1HF 4OI1A 5B0DA 3R97A 2R7XA 1IUJA 4X62F 3I32A 4O3NA 3Q22A 2W25A 1VQ8S 2KHCA 2X1GA 4QWCA 3FSIA 1FVQA 2LQ8A 1WG5A 3HX9A 4HI1A 1JJCB 2FZGB 4Q2LA 1UVIA 4MAKA 3E3XA 1HYSB 3AOCA 1GT8A 2EFOA 3W9HA 2ABYA 4O44B 1VISA 1WHYA 3C19A 3DKDA 3EE3A 3KLEB 4ZPAA 5JJBA 1PBUA 3N0VA 2XS7A 4C7QA 3MUMP 3KDOA 2GQQA 3UPFA 4Z2XA 4NLXA 2RVJA 1N5YA 1WKKA 4MFBB 4LVNP 2KXFA 4Q5VA 3LPYA 4BDPA 2XG8A 3HHEA 5H9FJ 3JSRA 2WAQD 1HNIB 2C2KB 1N5TA 1ICEB 5IM0A 1IR0A 3QIPA 4DU8A 4F4ZA 3P8BB 4CO4A 1TL7B 5A76A 1EJ7L 3SDEB 3DLGA 1TZ0A 2APOA 1YJUA 3WIUA 4J9SA 2Z0GA 3U1NA 1IN0A 2N82B 1NB7A 1IQTA 1RU2A 3QGIA 4EBEA 4CZCA 4U8YA 5KOXA 2Z2MA 1YVFA 1GX6A 2LDIA 1RABB 2F3JA 2DD8S 1VK3A 1Y5LB 2HQDA 3QGPA 4G1PA 1FO1A 2Q43A 1TL7A 3VVTA 2MJUA 3OT9A 4EGLA 3D6HB 3AJ1A 4NLUA 4B3OA 2F40A 4XK8C 3T6JA 5A8WB 2AJQA 1TKDA 2H5JB 3CCJS 2J0SD 4V19X 2R7UA 1VFJA 4CLTA 4JBCA 2V5HG 4OZ3A 2G0JA 4R0JA 3SCIE 2WW4A 4Y2CA 3VHQA 4C97A 3PX0A 2R8GA 8ATCB 3OTOF 1JJ2R 2JLGA 1S0VA 3BO3A 4OYOA 4F50A 1NRKA 2DNOA 2UVVA 2KJWA 5BJRA 2P5VA 2HBRB 5C25A 1GK8A 2Y0BB 3AQPA 4UOHA 5K8PA 2E5LJ 4J5OA 1FKOB 2JH3A 3O6QA 3KNAA 3ICLA 5DZ7A 4KHPJ 1YZ6A 2AYEA 5J2PA 4DR5J 3R5AA 4RUCA 4O3SA 2DXEA 1QE1A 2BJ7A 3A3OB 3I6PA 3KK1A 2XMWA 2ZOGA 3ILJA 3HCXA 2HNZA 4X65F 4OX9F 4FF3A 1GAOA 4GVLA 5LOQA 1UZDA 1FKPA 1Q16B 1JKHB 1R6VA 2G0CA 2XMJA 2ZUAA 3C6UA 2HBZB 5F3TA 4K4WA 4R8UB 2E9RX 3N5BA 2HQIA 3T5KA 2EC2A 3CJRA 3MEKA 2VFSA 3KLFA 4DV2J 2EK1A 3SCJE 2NR0A 3CE8A 2EFGA 3KWMA 3R7NB 4DPXA 2UXDF 5DQIA 3BF4A 2VASA 1PAUB 4C0BA 3IWNC 4Q2MA 4YY3F 3K0JA 2AEJA 2B7BB 1RHJB 2YWKA 6FDRA 4OYXA 4I2PB 4P10A 3ZO7A 1NPRA 3QT8A 4LSZB 5F8GA 5J2QA 4OI0A 5EN1A 3TJAA 1LXNA 5LXRA 1RT4B 2CWXA 5KFPA 1P1LA 4DG1A 3PEHA 5E3RA 1U0SA 1CC8A 1SUQA 3V81B 4JI0J 4USVA 3MR7A 4PAAA 4AYBD 1HL6A 1SVDA 1YJVA 2Z2YB 3BKTA 3BO4A 4DFMA 2Y8YA 1Y5NB 1W7WA 1Q8BA 2DH8A 1G3OA 4I1TA 4MJKA 2GGPB 2V63A 2M3DA 4DUTA 4MYUA 3L7PA 1VS3A 2P2CB 2MKIA 4DR2J 4HEA9 1NJIT 3QRQA 1QTNB 1PBAA 5DM7Q 2P6TA 3DRXA 4J9MA 3DRRA 3KG4A 4USUA 3BKUA 1SL1A 5F8LA 2A2CA 4NA1A 1FDDA 1P9YA 3M8WA 4LR8A 3HZEA 3N6LA 3V6DA 2VHGA 3VZIA 1KVIA 4LFAF 1ZPVA 1EETB 1JIHA 1V9OA 2BKPA 4PPZA 4QPTA 1MROB 1IR1A 4A46A 5DG7A 5FJ4A 4KGZB 1S1VB 3GE9A 3UNGC 3PG9A 5L38A 1EKRA 4ZLPA 2KFNA 2FLLA 5I42A 4PRFA 1OSCA 3CCES 1FF2A 4LF7F 2ALYB 2D1CA 3TVYA 3RW6A 2FC9A 3W9IA 3IG1B 4PUOB 4DBQA 4RWWA 2XYGB 4HDHA 4QOTA 3RG6A 2OIHA 2ZZMA 2OTLS 4P7TA 3L7UA 3BQ0A 2O3DA 3RAMA 1LWCB 2ZOFA 5FLXU 4EBDA 1T03B 4K4VA 2ZE2B 5KG2A 2JLFA 2JDJA 3PYFA 2Z8QA 1QE1B 2DKOB 3GZ7A 3QLHA 3NCQA 4I0WA 2VG7B 4CLZA 4LQ3A 1N34F 1X4GA 4QJVA 4YR2A 2HK3A 3GU0A 2C28A 4U7CA 2ZVSA 3QO9A 2D69A 2OMOA 3FQLA 5LMNF 1LK5A 1HPZA 1G2EA 4QIEA 4DPOA 2XZWA 3DOKA 2D9OA 3R7SB 5IFMA 1XMQF 3NGSA 4O23A 1RK8A 3G82A 2JX2A 4HYKA 3FEXB 2GJIA 2E7XA 3U1MA 4PXBA 5J2QB 2LKZA 3OPKA 3OXGA 4UQTA 3T3FA 3M2VA 4U9RA 3ZZUA 1U6FA 5L1IA 3EGNA 3ADAC 3D68A 4ZPVR 4WP9A 3OL6A 4DG1B 2OSRA 2IIHA 2VDHA 2ZBRA 3OTBA 5KFAA 1IKXA 1GXUA 4URQU 1Q0NA 2A6OA 1XC9A 1T9XA 5K8OA 1VQSA 2WZ1A 1WUUA 2IM3A 1S1XB 3D7SB 3I4PA 1IBMJ 3LO3A 2KZMA 2MB0B 1NMEB 4DV5F 2GS8A 1J5EJ 1IKWB 4NZ6A 1PILA 4OJHA 1KDNA 1RADB 4DQSA 2V8GA 4IQXA 3QT6A 5LM7E 4X4PA 1Q5YA 2IJRA 4ZP6A 1QVGR 2UUBJ 2EWHA 5C42A 5KAKA 4ZPCA 5D3GB 4QU7A 2RU9A 3HSDA 1Y0HA 4I6WA 4A8YA 3LWMA 3MMCB 3AH6A 1FK9B 3QBCA 4KY3A 3TQEA 2DY9A 4FZVA 1QSSA 3PJWA 4DL4A 3B6BA 3CJ5A 1RSCA 2FYXA 2DH7A 3PKYA 4MKYA 2C2EA 2LA4A 2EC0A 1S1WB 5D0EA 4M95A 3CDWA 3PYEA 2KL8A 3IR7B 2VKZG 1RAOA 3CJ0A 4WU3A 3NGTA 5ETRA 1RU1A 2ZNYA 4K2JA 3PFEA 2PMZD 4DR1F 3OW2R 3WC2A 4KJIA 1X9WA 4G6VB 2F8HA 2QSWA 3AD7C 1VC0A 4MMOA 2F63A 5M2RA 2HHUA 2RHSB 5CA5A 2MGZB 4M5GA 4ZOSA 1PJ7A 3EVOA 4ZA1A 1WOOA 4X64J 1XTZA 4JI8J 2DXDA 2HMIA 3PKMA 1F3VA 2OKQA 1YSJA 4XDCA 3US5A 3I55S 3ZZ0A 4WFNQ 1L5UA 4C8ZA 2R7RA 4QCLA 3IP0A 2CQ2A 1DTQB 2CQCA 4B3OB 3H59A 2ZH3A 1O5JA 2HURA 2CNOB 3D3BJ 4OJGA 1D8ZA 4JUZA 2J9CA 2OEJA 4OYPA 4BHQA 2J6TA 1JLQB 2QL5B 3ENWA 1FJGJ 3TP2A 1CJKA 3M8YA 4AD6A 2UXCF 1SI9A 4K4ZA 1Q53A 2YXLA 2ZWOA 4M5HA 3ISNC 5B08A 1HR0J 3P49B 1U25A 4M5LA 2AYBA 1Q79A 5KOWA 1T9YA 1SUQB 4DSJA 1HBUA 1UJ4A 1YK9A 4WP3A 1S9GB 3VZHA 4ZKAA 5C2GA 2UUCF 1NK6A 2VONA 5J1PA 4FNHA 3S6EA 3UVJA 1RP5A 2Q66A 1X4BA 1WWHA 5EGYA 2BUNA 1AUDA 4PWDB 3N01A 3F0NA 1SJ4P 4CLPA 3NS5A 2WONA 3P96A 1GFWB 2BJ3A 4L74A 2GMJA 1L3UA 5G0RA 1XWLA 1YZ7A 2A6MA 1WC0A 3KJNB 3UCGA 1VQNS 3LP0A 4ETXA 2FJBB 3LH2S 4OZLA 3G87A 3LP1B 3UR3C 1MMNA 3W8GA 2XGPA 5EWGA 2UUCJ 1FDBA 4Z37A 4RW8B 5GVQA 4DPTA 3OTOJ 1RT6A 3JYTB 1TFYA 4AE5A 3I5BA 3DDNA 1SXLA 5F0UA 2ZHAA 4N5SA 2J7UA 2KM8C 5F8JA 1N36F 1OO0B 2VV5A 4ZP9A 2BACA 3D66A 3W8PA 1U47A 3EVWA 3OJUA 4Y65A 4O3OA 1TKZB 1TU0B 1SKUB 3MPVA 3N5FA 3Q0AA 3MM7B 4USMA 2KRBA 3EZ5A 4ZVGA 1VHFA 3GYNA 3AAWB 3IGVA 1S6QA 2KJVA 3CO9A 1OIAA 3LGMA 3PACA 1OY9A 3M6XA 2FVCA 1NK8A 3C15A 4JYAJ 1L3SA 4LF8F 5KFRA 4HH1A 4NYPA 5C24A 2W7PA 2FY1A 5KFYA 4F26A 2O1PA 3UQSA 3NNHA 2A10A 3Q83A 2GVDA 4OYMA 3WX8A 3K57A 3CPWR 1YX2A 1FE0A 3EM1A 3GJTB 3TO8A 1VQOS 3L7OA 3H40A 1RAIB 1RT1A 2DB1A 2Y1JA 1EP4B 4A8MP 2X1FA 3UDVA 3RRHA 1U6BA 1B3TA 4FF1A 3DFEA 3OR2B 5B0AA 5KFZA 4YP3A 1X4EA 2G4BA 3QZ7A 4WZMA 2CPHA 2RQKA 7FDRA 4IOAQ 3CNQP 2O01C 3HVAA 4AL7A 4RUAA 1GMWD 4ZP8A 1SC6A 7FD1A 4MK9A 3K5OA 2VQEF 4B3RF 2RDDA 2AJ1A 3KLHB 2AEFA 2HW3A 3R9LA 2E1RA 2CPYA 2FPHX 2XEXA 3EX7B 2DHAA 1IKVA 1V5VA 1WF0A 2WCXA 2FVRA 4J90A 1V5IB 3IWXA 3CMQA 2GIQA 2FHJD 1CC7A 4L75A 4TNOA 4ZPDA 1RWMB 2NUHA 4EUVA 2XY5A 1ZTWA 2R7VA 1RBOB 2UUBF 1BHNA 1S6UA 3B78A 4CLKA 4GKJF 3LGHA 5IC6B 3MD1A 1UWBB 2I5JB 4CYUB 3MPDA 4NLSA 1E6YB 4M5MA 2XBPA 2FJVA 1UFKA 4ED2A 1Q81T 1PCAA 2GO8A 1Z2ZA 3MGJA 1T0TV 3WDOA 5CYMB 3RW7A 1YBUA 3FMBA 3MMBB 4N77A 5DDRC 3HT3A 4O4RA 1VC6A 2J0QD 2J9DE 4EYHB 2R7SA 5KFOA 1URRA 3OUYB 3QRPA 1H72C 2VFUA 4OV1A 1OPIA 3GG1A 3VAFA 2X3DA 2Q3PA 2PMWA 2WB4A 2PD1A 2BE7D 1BE4A 2RUSA 2Y0SD 1P1TA 4KR0B 2ZEJA 1X5SA 2VJVA 4CTAB 4Q43A 2Q79A 4LFCF 4WKYA 5F41A 4C3MA 2YKPA 3R5BA 2H65B 2HAFA 3FBFA 1XNQJ 3DLEB 2QLBB 2E7VA 1VYAA 1YJRA 3ZC4A 3TANA 4C8NA 4ZK7M 4WXOA 1RLDA 1M5VC 1YJTA 2V9WA 1IVZA 2RMLA 1FXLA 5HANA 1Q8KA 1UP1A 1RI7A 1YDLA 2ZNZA 4PQAA 1RAGB 3B8HA 5E33A 2DEJA 5K5MA 2CQ0A 3VVUA 4F36A 2AGQA 1RHUB 2AQ4A 3W5XA 1W2BR 2XMAA 1EAYC 1PIEA 1RCOB 4CO5A 4JI1J 2BX6A 2VOOA 2CQHA 1RKIA 3M2RA
chains in the Genus database with same CATH topology
2FC8A 1KNZA 4PR6A 1FEEA 2EI5A 4J9RA 1V6HA 3RB0A 1IM4A 3KYLA 4ED0A 1FERA 1KTVA 2DITA 1R43A 2J0XA 4KSEB 3GFXA 3T9NA 1U48A 1HNVB 2BE2B 4LSNA 4B3SF 4LVOP 4JV1A 2MJNA 3K5PA 3MMAA 2R7OA 1B0VA 4KFBA 2KG1A 1SH2A 3HHNB 5HP1B 3CCUS 5DG8A 2B6AA 3M1VB 4ICLA 1YG0A 1SV5A 1C1BA 4C4WA 2W8KA 1E6VA 1F5CA 4NYOA 1FRXA 4LF4F 4I2PA 1WEYA 1VQ4S 3PW4A 2PA3A 2V94A 2QFJA 2F7VA 2HWIA 3DLGB 3P5TL 1KS2A 2GJ2A 2HG4A 4ID5A 3V81A 3R1HA 2KYXA 2G1DA 3VAMA 2LXIA 1N32F 2VOPA 3AQOA 4JI7F 2DNQA 5D4OA 1P9QC 3OSNA 1R6YA 2PGCA 3BM7A 3HVTB 3TVKA 1HW8A 2BABA 5F8NA 5KFLA 2FDNA 2MHNA 2XI2A 1RISA 1DAXA 3PIPQ 4TQSA 2RKIB 4UUWA 1HWIA 3DHXA 1LW0B 2VODA 4IRCA 1DLOB 2DNLA 2LECA 4Y28C 1KSPA 4OLOA 3KK3B 3PO5A 3OR1B 5C24B 3FVYA 3I9ZA 5T14A 1FVSA 3ZZPA 2JVRA 5KG6A 1GXTA 1HWJA 1X5OA 3DU5A 2FJXA 1T03A 1SIWB 1BQNA 2DNPA 3M2RB 2M0GB 4RNHA 4OZ5A 5AXNA 1LFWA 2ROEA 4EO8A 5A8KA 2GNKA 1V3ZA 3J7YI 1TUVA 2HQ3A 2VL1A 2DGWA 1JLBA 3HF5A 5T7LA 1V3RA 1V3SA 1D0EA 2UU9F 1MMLA 3HHDA 3K8WA 2HS0A 2V4JB 2UZAA 3BEGB 2EKYA 4WFBQ 2LQBA 3DLLQ 1VI7A 1ZYQA 1LKZA 1I1GA 2HHTA 4M63A 2CIMA 4PPDA 4K0KF 3THVA 1N6QB 3ENQA 1M5KC 2PA8D 4DV4F 2PEHA 3M9NB 2L48A 4IFVA 3GIIA 1NK0A 2VA2A 5D8HB 2YKMA 3BQ2A 2IAJA 3I87A 2AJ0A 2DHXA 4B08A 2RQCA 2KT3A 4DS5A 1NK9A 1N88A 3DHWC 2UV8A 3MM6A 3I0SA 2YH0A 4F4YA 1MMDA 4TY8A 5AXKA 1LWFB 2CJ9A 3SSQA 4A8OA 3M9OB 3OSPA 5J1EA 4O3PA 2B0GA 5I42B 1JX4A 3Q8RB 3CDUA 2AYGA 4BS2A 4OZJA 4DSFA 1BY9A 1MROA 3CC4S 2V2KA 5EWEA 3MMCA 3SQGB 1KC8T 4F2RA 2WK4A 4KC5A 2DNNA 2Y1IA 1DBDA 2DO0A 3MTKA 3KMQA 3CJKB 3FZ2A 5F8HA 1VLYA 4RU9A 2J7WA 4PQUB 1B64A 4H4MB 3RRGA 2ADBA 1VMBA 2CQ4A 4A8FA 1X5TA 2NREA 1F2GA 2HZCA 1VQKS 1JMTA 3VALA 4J9QA 5A0YB 3CCZA 2YNGA 1S6PB 3F73A 4FBTA 4C3KA 2J9DA 2FJEB 5KFVA 1N52B 4H54A 1XEZA 3MECA 4PQUA 3RBDA 4X66F 5DGBA 2J6UA 1C0UA 1RDRA 2ZH5A 1R8BA 3HZGA 2JZ5A 3K2YA 3KJVB 2DR7A 1FJ7A 2DCLA 5A0YA 4CNZA 3UCUP 2W4PA 1K9MT 3DOKB 1HPZB 1ZM2A 1JNRB 2VC0A 4WIIA 5HN0A 4Y6IA 1DFDA 3L3CA 3PR4A 3PW0A 3MECB 1ZM4A 5IS2A 2XHWA 2JWNA 3VQSA 3FQKA 5KT2A 1VQLS 1K0VA 1YITS 2NYIA 1QSLA 3H2VE 5IT0A 5AE3A 2J0WA 3AY0A 4CCHA 1X8DA 2EFPA 3FCHA 3MTJA 2HHXA 4DFPA 2WW8A 3EXYA 2CZVC 3FDSA 3KMSA 4TYBA 3TAMA 5DQGA 1LK7A 1X0PA 4K4SA 4F2SA 5E41A 3Q24A 1S1WA 4NLVA 5C25B 2P9EA 5C5JA 4EEYA 1QVFR 2E1CA 3AB2B 3SSRA 1YIJS 1S9EA 2CPXA 3H25A 1QUVA 1GTHA 1P27B 2LDYA 4IH5A 5CZXA 3UI3A 2BZ2A 3PJXA 4X4UA 2DVIA 2KTQA 3KLVA 2CQ1A 4DV0F 1FESA 1GH8A 2HIQA 3RB6A 2DGUA 4ZCLA 3TAPA 2QO3A 4OZ0A 2JSXA 4QPXA 5HMXA 1KD1T 2HMIB 1XK8A 3M30B 3KTQA 2P6SA 1M5OC 3QJLA 1S6PA 5J1NA 3KKFA 3MAQA 2W24A 2HVIA 5SUHA 2WBMA 4M5DA 5KFNA 2KH9A 2ZZNA 1TL3B 3Q8PB 2WOMA 5KT6A 1VIOA 4M1KA 1REVB 5B0FA 3RAQA 3FFIB 1XR7A 4H4KC 4KBIA 5KFDA 4UQGA 1DTQA 2J7KA 1FTCA 1HNWF 1MW7A 4UY8T 1RA6A 2KO1A 1FA0A 4HLBA 1D9AA 1RT7B 3D1OA 4RX6A 2XULA 4K4UA 3M8PA 2WB1D 3S8SA 1IKWA 1NH7A 3N6MA 4AL5A 3I0RB 5CZVA 1J2VA 5F9NA 4ECTA 3GWCA 2P9CA 1R3NA 3GG0A 3OQ2A 1XMBA 2OD6A 4I69A 4ZPWR 1KOOA 2B9YA 3NAHA 4NLQA 4QWEA 3SYZA 1URNA 3BGRA 3NS6A 5LSRA 3UW1A 5KG7A 4O0IA 4JI4F 4FF4A 5H1SV 1R89A 3CD6S 4X4NA 4RW4A 4LSLB 2H5EA 1TVRB 2VBYA 4QR2A 2XWXA 2XY7A 4DUYF 3KHGA 4MKAA 1WG1A 2F9JA 1N4LA 3FEYB 3G8QA 1RGVA 1NHVA 4DQIA 2B51A 3BSNA 3BGFA 4WK1A 1TKXA 3QJPA 1TAQA 3SQGA 6FD1A 3NMAA 1Q8LA 3TAQA 2FVPA 2HPUA 2RDIA 2CKWA 2CQBA 2MGZA 3J7ZT 3EXCX 1S9FA 1NK4A 3PW5A 2IA0A 1C1CA 2XMVA 2O67A 1ULRA 2AYMA 5GADI 4DSIA 3C2PA 4DOZA 1FE4A 4NCAA 3U1LA 3PHEA 4QQBA 3CT9A 2D3UA 4HVZA 3OL8A 4JI0F 1F0XA 2MKHA 2N7YA 2XO7A 3FMWA 4KT0C 1VQMS 1KFDA 1B0TA 2PDAA 3S7RA 4QWDA 1MU2B 3PV8A 1CEZA 1R27B 2OLWA 3OFHA 3BGLA 1SJFA 5J2MB 2GHVC 3WX4A 1DTTB 2ZH1A 3OHBA 4C8LA 3F56A 2CVIA 2RRBA 1F60B 4WFZA 4EFAC 4RUHA 2OPSA 3SCLE 5DDOC 4FBUA 4R5PB 3E2EA 2EFNA 1VRTB 3V5RA 1ZTTA 2YX7A 3V4IA 3M8RA 2BQUA 2CYYA 2CPFA 1FRLA 2W9BB 2PE8A 4HTJA 3GIMA 2YNIA 1JLGB 1C0TA 1HWUA 2OPPA 3BSOA 4YHHF 1WHWA 3CD7A 2DK2A 4ERDA 2JFKA 1T7PA 4TKTA 2E5LF 3V6KA 4NRUA 1BC6A 1TV6B 1YRTA 2UVUA 2K2PA 5KFWA 2NLWA 2RILA 5F3ZA 3CCSS 1ELOA 5DJBA 4EYIB 1DQAA 4IOCQ 2LQJA 1LOUA 1C1BB 2CFXA 1OWXA 3ISZA 2VPXB 3FGVA 1N0UA 4MIBA 2J76E 4LF6F 1A9NB 2DNHA 1UWBA 2XS5A 4RBVA 3TA1A 1DZ5A 3O1LA 2YNFB 4I2QB 3T1YF 4ZVFA 1FNOA 3IRXA 4RKUC 4ETZA 4ZCMA 2W4DA 1J5EF 1KHVA 4WFAQ 3SV3A 1D9FA 1S4FA 4X4OA 3JTPA 4B9VA 2RT3A 3KLIA 2K3KA 3HVTA 5FD1A 1T3OA 3MR2A 1IBMF 1UVNA 2U2FA 5LSOA 3WBZA 4AFFA 4ECVA 3IRWP 1AFJA 2B7CB 5HO4A 2UVRA 3HMJG 3HHLC 3TW0A 2MKKA 2AGOA 1JLCB 3TUJC 4BWMA 2ZC3A 3J80Y 3PVXA 3G6XA 3LWLA 3FNNA 4DSLA 1FD2A 4ES3A 3OR2A 1RKJA 2OO4A 2CZ4A 2HNDB 2DGQA 3OBIA 4OMFG 1U4BA 4O3QA 5D4NA 2ZJQQ 2HHHF 2NS1B 2ILYA 3H5SA 3KHHA 4C8OA 1CLFA 2C42A 1SJ1A 1ZBTA 2AP6A 3M8QB 2KKHA 3DRPB 2BXJA 4MYTA 3CCWA 1TP7A 2GQCA 3M1VA 3KHLA 1QLNA 4KGKA 2KZZA 1FD8A