1SJ4P

Crystal structure of a c75u mutant hepatitis delta virus ribozyme precursor, in cu2+ solution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
95
structure length
95
Chain Sequence
b'PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords precursor form of the Hepatitis Delta virus ribozyme
publication title A Conformational Switch controls hepatitis delta virus ribozyme catalysis
pubmed doi rcsb
source organism Hepatitis delta virus
molecule tags Translation/rna
total genus 22
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sj4P00
1M5PC 4WF9Q 1VQNS 2ZJPQ 1FXLA 3EX7B 1WF0A 2BZ2A 4UQTA 4BS2A 2K3KA 3CC7S 2UP1A 2F9JA 2NLWA 3S7RA 2MSSA 3MOJB 5ITHA 5IFMA 1OPIA 3P3DA 1G2EA 3Q2TC 1U1LA 4WFAQ 1HA1A 1P1TA 3SXLA 3HI9A 1U2FA 2PE8A 2CQ0A 5H1SV 2AYBA 1K73T 1VC0A 5GADU 5IM0B 2KHCA 2MJNA 1D9AA 1H6KX 3CCLS 2M52A 2MZQA 3NMRA 4TLQA 2MGZB 2MKHA 2X1GA 1FJ7A 2DGQA 2JRSA 3BO3A 3G4SS 2DHAA 1U1KA 2OIHA 2EVZA 5GAEU 1VQ7S 3VAKA 2HVZA 1X5OA 1XN9A 2HGMA 2KRBA 2DNPA 1FJEB 3MDFA 2XS5A 2CQCA 3ZZYA 1SJ4P 2DNRA 1HD1A 2CQDA 2RQ4A 2AYGA 1URNA 1JMTA 4ED5A 1WEYA 4UY8T 2JWNA 2RU3A 2MKKA 4EGLA 1K8AT 2RVJA 1UFWA 2MPUA 2MQQA 1OIAA 1WG1A 1U1MA 3NS5A 3LQVA 1QVGR 4ERDA 4WFNQ 2CQPA 2JX2A 2YTCA 3UD4P 2XS2A 1ZZNA 1NJIT 3BEGB 2DIVA 2LA6A 1FT8A 2CPXA 3OW2R 3CCMS 4W92B 1WHXA 3SDEB 4PKDB 1SJRA 2MXYA 3J7ZT 2RUGA 2DH8A 4V19X 2LCWA 1AUDA 1VQKS 2JVOA 1YJWS 1X5PA 4J5OA 2DISA 2KRRA 3NS6A 3S6EA 1WELA 4U67Q 5HO4A 3G8TA 2Q79A 2M9KA 3U1MA 3BS9A 2I38A 2MKCA 3ZZZA 3CPWR 2AD9A 3RW6A 5CXTA 4QU6A 4YOEA 1NO8A 3R1LA 3LPYA 2M4MA 1Q82T 1U1NA 2OSRA 1VQPS 2KM8C 2M70A 1X4CA 2LA4A 2YH1A 1DRZA 2D9OA 1VQMS 2ERRA 2CQBA 2GO9A 2U1AA 1VBZA 1VQ8S 1U1RA 3MUVP 1RK8A 1N54B 2DNHA 2DGTA 2DH9A 4LIRA 3CXCR 1VQLS 2HGLA 5IM0A 5CYJA 2MQLA 4QU7A 1X4DA 2KVIA 5GMKa 2MGZA 4YUDA 2LXUA 1UP1A 1N88A 2ZJQQ 3J7YU 2M8HA 3P6YC 3CCUS 1X5TA 2YKAA 2CQHA 1VBXA 2B0GA 5BJRA 4IOCQ 2AYEA 2DNLA 3UCUP 3VAJA 3K0JA 2CPZA 3THTA 1R8HA 3UWTA 1U6FA 3MI7X 2L41A 2CQ4A 3TO8A 2X1FA 4F25A 4C7QA 1DZ5A 3FEXB 3B4MA 2DNOA 1SJFA 3DXBA 2MQPA 4CH1A 1A9NB 3PIPQ 1WHVA 4QQBA 3R27A 2E5IA 4FXVA 1YWXA 2DHXA 2XNQA 3SMZA 3CMAS 1Q7YT 1X0FA 3MUTP 2M88A 2CQ3A 2KN4A 3UCGA 2G4BA 2LXIA 2YWKA 1QVFR 3PIOQ 1YTYA 2E44A 2QA4S 1WF1A 1S72S 4WCEQ 2MZ1A 1M5OC 3CCVS 1KD1T 2G0CA 2FY1A 2ZJRQ 2KU7A 2E5HA 3CD6S 5DDQC 2AYMA 2M7SA 2VONA 2RT3A 1X4GA 1YIJS 3NNHA 3B4DA 3CMES 1WHYA 4C0OC 2DNMA 1KOOA 3CF5Q 1R8PA 1YITS 3ULHA 5IQQA 2KXNB 1WHWA 3G9CA 3G8SA 4FXWA 1WEZA 1SJQA 3VALA 1VQ9S 4A8XA 5GAHU 2MY7A 2CQ1A 1JJHA 2DNZA 1VQOS 2DGWA 5JVHQ 2N3OA 3NNCA 2KXFA 5FJ4A 3TP2A 2MKSA 3VAHA 2CQGA 4IOAQ 2J8AA 3EGNA 1QM9A 1WWHA 1U1OA 2KM8B 5DDRC 1FHTA 1HL6A 1PO6A 3CULA 5GAGU 4F02A 5CA5A 2DHGA 1F9FA 2N3LA 3FEYB 3VAIA 1P27B 1X4EA 2QFJA 3CCRS 2XNRA 3L3CA 1PGZA 4WIIA 4F26A 2KH9A 1IQTA 4QPTA 5HL7Q 3VF0B 4PR6A 1L3KA 1H2UX 1VQ4S 2DNNA 2PEHA 4TU8A 4TU7A 2FPHX 4CH0S 2HYIB 3NNAA 3CCES 1SJ3P 2MQNA 1WTBA 1Q86T 1WG4A 2CPYA 2FHOB 2MHNA 3MD1A 2A3JA 2MZTA 1YHQS 1D8ZA 2KG0A 3S01A 2J0SD 2OTLS 2GHPA 3IRWP 3CUNA 2DNQA 1VQ6S 1A7GE 2DGSA 2MJUA 1X4FA 4PRFA 4YB1P 2CPDA 2CQIA 3VAFA 2NZ4A 2OTJS 2U2FA 4W90B 3S8SA 3CCSS 2YH0A 1N52B 3Q2SC 2MB0B 3HHNB 1OWXA 2KG1A 2RS2A 2ADBA 2E5GA 3VAMA 1UAWA 2VODA 1WI6A 1WI8A 1X5SA 3MUMP 1KC8T 2LKZA 2RS8A 2KT5A 1W2BR 2M2BA 1VBYA 2XS7A 2J76E 2FC9A 5LSOA 5DM7Q 4IUFA 1KOHA 3CC4S 2MQMA 2M0GB 2MSTA 1ZH5A 2MZRA 2XB2D 2KFYA 2D9PA 2JVRA 4RU2A 3VAGA 3UCZP 2HZCA 2J0QD 2DGXA 1U6BA 2KYXA 3DLLQ 1X4HA 2MKIA 3CCQS 3BO4A 1FNXH 3IWNC 4C4WA 2RRBA 3CCJS 2RQCA 1X4BA 3P49B 2V94A 2G1DA 3US5A 4Y0FA 2CPJA 3SDEA 2DHSA 1KQSR 2DGOA 4LMZA 1BY9A 1UW4A 3EGZA 5GVQA 3N9UC 2CPFA 1WEXA 2RNEA 2CPEA 2EK6A 2XSFA 3D2WA 2DGUA 2KI2A 2MYFA 2CPHA 1U1PA 3I56S 2DITA 4LJMA 4OZ0A 3MURP 4Z2XA 1JJ2R 2LQ5A 1RKJA 3MD3A 2I2YA 5LSLA 4ZKAA 2X1BA 2BOPA 2ADCA 2LEAA 3MXHP 5LJ3Y 3JB9k 2DH7A 1B7FA 5DDPC 3BO2A 1DHMA 3U1LA 2CPIA 1YJNS 2DO4A 1CVJA 1HD0A 5LJ5Y 3G71S 2MZSA 4M5DB 2F3JA 1M5KC 3TYTA 4TU9A 2FC8A 4WFBQ 2M8DB 4CIOA 3P5TL 1S79A 2VOOA 2HGNA 2DO0A 3V4MA 1U1QA 2L08A 1VQ5S 1WG5A 2DIUA 3G6ES 5LXYA 3THPA 1YI2S 1X4AA 1N8RT 3H2VE 5DDOC 2LECA 1JJ4A 2QEXS 4CQ1A 5D78A 3UD3P 2X1AA 2OJ3A 2LYVA 1FJCA 2DGVA 1M5VC 1SXLA 1H2TZ 2DNYA 1K9MT 2MY8A 2MZJA 2EK1A 2WBRA 3R1HA 1OO0B 2MKJA 2DK2A 3CTRA 2DB1A 2DNGA 5EN1A 3I55S 2O3DA 2F9DA 2L9WA 2SXLA 5MLCV 1Q81T 2N82B 2VOPA 1NU4A 3UE2A 3G96A 5DETA 2MQOA 4WKRA 2LEBA 2D3OR 1VC6A 1M90T 1VC5A 1YJ9S 2CQ2A 1H2VZ 1FO1A 2E5JA 2MMYA 2CJKA 1WF2A 3CC2S 2KXHA 1ZZFA 5DM6Q 2K8GA 1M1KT 5D77A 2N7CA 2RRAA 2LMIA 1O0PA 4Y00A 5JVGQ 3H2UB 1DBDA 4IO9Q 4P6QA 3RW7A 2OSQA 5LXRA 2DNKA 4OZ1A
chains in the Genus database with same CATH superfamily
3D6TB 3EX7B 4EUVA 4OL8A 4KPYA 3CC7S 4I7FA 2UP1A 3WBZA 3H5XA 3I87A 3J7Z5 3PZPA 3AOCA 3TRGA 3TOQA 2FY8A 1CJVA 2DYAA 2F4VF 1H6KX 1KFSA 4OV1A 4DUTA 3W64A 2DXFA 2JRSA 1QSYA 4DV4F 2G9OA 1V9OA 3J81Y 4ECVA 2BANB 2E9ZA 1X5OA 1MNEA 2Z0GA 2A6OA 1HYSA 4KBIA 4B3SJ 1GMVA 4DHVA 2MLZA 5BXIA 3KMQA 2RDIA 3Q8YA 2DHHA 4B9TA 4CO0A 3MPVA 4IRCA 1UFLA 1QVGR 2WONA 5CH7B 1B70B 2HW3A 2CPXA 4W92B 2LCWA 2C42A 1T94A 2DPJA 3R6GB 4HDGA 4R0JA 2I38A 4ZP9A 3I31A 4MMOA 4PXEA 5KT6A 1S10A 3MPDA 3R1LA 4EK2A 4USMA 3GSIA 4AYBD 2HZAA 1U1NA 5EWFA 2WVCA 4Y65A 5HBMA 1GTEA 4DXLA 2E9TA 1VQMS 4FBTA 4HLBA 1UVJA 1HI8A 4AXIA 3R8YA 4WZMA 3BSCA 4BWJA 4S0MA 3QYYA 2DH9A 2PC6A 2BE2A 1RU1A 1GX6A 3CXCR 1Y00A 3QO9B 4JYAJ 5CYJA 1SCJB 4OX9F 1NK4A 3LGNA 2HVDA 2CQHA 4OX6A 1F60B 4DU7A 2FJXA 2ZH1A 3HHLD 1N32F 3TAMB 3WZ0A 2P2CB 4RNFA 1T03B 5KFWA 2RQKA 4FXVA 4JV5J 1X0FA 2CADA 2LVWA 1NK0A 2KN4A 2I0XA 2KU7A 3CD6S 4UUXA 2R2TA 2VG5B 1AUSL 4CYUA 2FZKB 3F41A 1RTJB 2KXNB 4ECTA 1JLAA 4LRDA 1NH8A 1WC4A 3VALA 1XMQF 2H4YB 3MCOA 3D0IE 2RF2B 4JI8J 3NNCA 4K2XA 1ZAVA 2CJXB 3EGNA 1AZSB 1J5OB 3DC2A 3DLEA 4F04B 2IAJA 2AX1A 5I42B 2UVWA 4QIWD 3CCRS 4LRFA 1LWCA 3T41A 4FNHA 1Q8IA 2VQEF 1N4LA 2CFXA 3D66A 4USTA 2E9RX 1O51A 1VI7A 3OV7A 3CJQA 2XY5A 2YKMA 2KG0A 4NLXA 2OTLS 3KNGA 2EG2A 2MJUA 1QSLA 3FSYA 1FTCA 2PI5A 3MM7B 3G8QA 1QE1A 1N52B 4I0WA 2I5JA 2XSJA 4N7TA 2DY1A 3N6LA 3VAMA 3AOAA 4DL2A 1QUPA 1RWVB 2VBZA 4PAAA 1TFWA 3TZZA 2QT7A 4OJ3A 2VG7B 4D3GA 3G82B 4ICLB 3TX0A 4ETXA 4MKVA 2YX4A 1F5CA 2J0QD 5KG5A 1PJ7A 2V8GA 2XI3A 3A8IA 4EI2A 3W1YC 3A12A 4UQGA 5D3GA 5HMZA 4IFYA 3EGZA 4RUHA 4YB7A 2KI2A 1YVFA 2V4QA 1YBTA 2W4DA 4M5KA 1V3SA 4JI2J 3BH6B 2YNGA 3PYDA 2H5IB 5CAAA 3BO2A 3U1LA 4DSEA 3OFEA 1N36J 4MJKA 3DHXA 7FD1A 1QJHA 2DR5A 4USIA 3T1YJ 2PIIA 1DLOA 1XJWB 2DIUA 5HVGA 2F4VJ 3CJ4A 3EUNA 2ZVSA 4ZCKA 1WUUA 4LBPA 4JV1A 2YNIB 4DV4J 4CRJA 3MMCA 1OY6A 4TYAA 4CTAA 1PBUA 2B6AA 2MKJA 2DK2A 4CO3A 4OI4A 2N82B 1BQMB 1IKYA 1ZTTA 1RUSA 3W9JA 2FZGB 2VJVA 3W60A 2UVUA 2CQ2A 4ZVPB 2A1BA 1WF2A 3AH6A 5KG1A 2KXHA 2BR0A 4M5GA 2VPYB 3TUJC 1O0PA 1DBDA 5GAGU 1M5PC 4PUOB 2ZJPQ 4UQTA 3UI3A 4AD6A 3DKDA 2H4WB 2MSSA 4PWDA 3ISND 1G2EA 3Q2TC 3UNGC 4YMEA 4MK7A 3J7A1 2OD6A 1P1TA 2VDIA 3N01A 5LM7E 3NGUA 3QPIA 1FJGJ 5GADU 1OSDA 2KHCA 3TWZA 1D9AA 2MZQA 1S9GB 5J2NB 3G4SS 1AW0A 2ZM6J 4NL5A 2AMCB 2ABYA 3FBFA 1DQ9A 5IZHA 4DQSA 3DRPB 5I3QA 2ILZA 2AGQA 1N32J 4K50A 2Z30B 2BBEA 2VH7A 1WC6A 4DV6F 1KFDA 2MPUA 4FPIA 5DG8A 1U4BA 2JX2A 3MCMA 2NUHA 3M8PB 4CWBA 4X62F 3J7ZT 1LXNA 4KSEB 2F65A 1TVRB 3ZZ0A 4F36A 2D7SA 3H7HB 3OQ2A 3RYLA 5E2QA 3JTPA 2C2KB 2M70A 2LA4A 4HACA 1KVJA 2W1BA 3MM9A 1VBZA 4R8UB 5E41A 2DGTA 1U24A 4HH0A 3ZZOA 2P9EA 2KVIA 5EX0A 2MGZA 3RU0A 1XNRJ 2OO4A 3CO0P 2HBRB 2ZBRA 5LOQA 5C24A 3B78A 4YB6A 3K7RA 3G6YA 2HQDA 1NSPA 4WU2A 4C7QA 1DZ5A 4ED3A 5ETVA 4CLTA 3M2VA 5CYMA 3LP0A 1XMBA 4LFAF 1CEZA 1N6QB 2QYGA 3OHBA 5LMUF 3KNAA 4WCEQ 3JSRA 2ZE2A 3CJ0A 2XGQA 3K2YA 1NK9A 1Y5NB 1HW9A 2VUGA 3OT9A 1IBMF 1MLAA 4DPUA 2EC0A 4C48A 5GAHU 3FVYA 1VJQA 2N3OA 4EZ6A 4CO5A 2HNDB 3VAHA 4ZMMA 2HWIA 3KJVB 2HNZA 3UR0A 2DHGA 2B3TB 2XLIA 5FIIA 2PFDA 3TR5A 3LALA 3DLKB 3CCES 1VK3A 5HQMA 1Q86T 1C1CB 1REVA 3R5GA 3BYPA 4X4RA 1VQ6S 4F8RA 4H4OA 1CS4A 2HS0A 3VAFA 4RWWA 4HH1A 4Z7YA 4C8NA 3CCSS 2YH0A 3CDEA 4DSIA 1W2IA 3BQ1A 3IFEA 3OR1A 3L7PA 2EFPA 3QIDA 1CG2A 2C2NA 1S4FA 4ED6A 3DGPB 5ETKA 1FRMA 5HVHA 4EU0A 2BACA 1LFWA 3QT7A 5CD4H 2VBXA 2XYPB 1FI4A 2RQCA 4MTPA 4Y0FA 3SDEA 1FWPA 1X9MA 1UW4A 1MROA 3W9IA 2OI2A 1DTTA 4NLTA 4DV7F 1KLNA 4RO0A 1RKJA 3C15B 2H5EA 4M8LA 2AWZA 3G71S 4NLVA 4NYPA 3M8RA 4CH7A 4O3SA 4C3LA 4CP5A 5G0RB 1GMUA 4ZIVA 3Q8PB 3M8SA 2ZUGA 3P96A 4NCGB 2QMWA 1RYRA 4RUAA 1KSPA 4AQYF 2XULA 3L7UA 4NZ6A 1LWFB 1R0BG 4HI1A 1L3SA 1NK8A 3H2VE 1C2PA 4CQ1A 3GV5B 5AXKA 4K0KF 3DDNA 2DBBA 2WSEC 2D41A 1HMVB 3PG9A 1K9MT 4RW9B 3PEHA 2KHDA 2FZCB 2W9BB 2EPIA 3CMQA 5EN1A 3C6TB 4X4SA 2W8LA 3UN3A 1K0VA 2PDAA 1YBUA 1SL1A 5T7LB 1RTIB 4WKRA 3L95X 4I69A 4DV6J 1X31C 4ZVHA 3CCWA 1NAQA 4L72B 2B5JB 2BXJA 4OI6A 1YJRA 3CC2S 2NCKL 5ETTA 4DCOB 5DM6Q 2BMBA 4IO9Q 3E01A 3ZO7A 2QC3A 2FJEB 1NCLA 1APSA 1UCNA 2E1CA 3ENVA 1FE0A 2ZOFA 2V4JA 3W5XA 3KLGB 4WKYA 5I3UB 4TY8A 5DG9A 3AJDA 3C46A 3AODA 2X1GA 5KFXA 1VISA 1JLBA 1TK0A 1C1BB 1RTZA 5GAEU 2HHHF 5ETNA 2XM3A 1XN9A 3O2IA 4LF4F 4P7TA 3DOLB 5DQGA 5J2PA 1IM4A 2KB2A 1YJTA 1SJ4P 3KG0A 4KGVB 1S48A 4DV0F 3CDUA 2CVEA 3KUGA 2MLYA 1UFWA 2GIQA 3R6LB 1WACA 3KUHA 3K5PA 5D0RA 4OYBA 4TQSA 5KFSA 2YTCA 5DZ7A 1RT3B 1NJIT 2OHDA 2LA6A 4LFAJ 2QV6A 3V81B 1CULB 2ZWPA 3PW4A 1DFDA 4B17A 5LMUJ 2X3GA 2A18A 4XTTA 2M9KA 4ZHRA 2H3EB 3GONA 3M8QB 3CPWR 3R5JB 1FVQA 1T11A 2X51A 3D6HB 2RQMA 1RTHB 2V0NA 4OQJA 4K4TA 1IKWA 2VQFF 1FK9B 1EJ7L 1S1TA 3EVOA 2Z2LA 2HGLA 3GYXB 3SSSA 2VV5A 3D5MA 2LXUA 3GCWP 3QAEA 1T3OA 5KFTA 2CPZA 1V5IB 2QYCA 5HROB 1HPZA 3R5CA 3AD9C 2HHVA 5EWEA 2EBEA 2HZVA 1CQNA 3OTOJ 4QQBA 3OLBA 2UXCF 3OFHA 2HS3A 1U09A 1RU2A 4KV8B 4ANEA 3PVXA 3PDNA 4ELUA 5EGYA 4YS2A 3CMES 2CZ4A 2OPRA 3ZXWA 4C0OC 2IM1A 5M2UA 1TMJA 2XMVA 3PX6A 3BM7A 4NEYA 1HNVA 1ZM2A 1IBLF 4P72A 3JYTA 2AT1B 4BC7A 5A8KA 5J2MA 1RE1B 1RGVA 3H20A 3CJKA 4LIWA 2E1PA 1OQ3A 2ROEA 2N3LA 2WVBA 1P27B 4PCQA 1UJ6A 5A8RB 3FZ2A 4DV7J 5HL7Q 3JXOA 1JJCB 3LP2B 4OHVA 3GWCA 3DLGA 1T95A 3BGUA 1Y9OA 3ZTOA 3O3LA 2GO8A 3IRWP 3MMAB 3FMBA 2NZ4A 3MAHA 3HHDA 4AQYJ 1S97A 2K3IA 2YNHA 3NCPA 1HNWF 3KLFA 2E7WA 3MTKA 2K7KA 3H4BA 4K0KJ 1WKLA 5LMNJ 2FD2A 1DTQB 4OZLA 4NYOA 4CDIA 1U48A 4NWBA 3CSKA 3I0RB 1T7PA 3Q89A 1GT8A 5EDWA 3OXLA 2QA2A 4C0BA 1FDDA 4LUBA 1U1PA 1MWQA 4ZJOA 4I7FB 3J81j 3GJTB 3QSYB 2RMLA 4K5RA 5HP1B 1S49A 4AL7A 4YHHJ 2ZZMA 2ASDA 2WSFC 4WFBQ 2CWKA 1CJVB 4DQPA 1S79A 1N5TA 5AE2A 3HULA 3NAHA 4C8LA 3DRSB 1WNEA 3X1LB 2G2YA 4ZPVR 4DV2F 4YFUA 2NUUG 2LYVA 1XC9A 1HYSB 1Z1ZA 4M5HA 2HHHJ 1TKTB 2EK1A 1LV5A 4ECYA 4LF4J 4GC7A 1QSSA 3D1QA 1T05B 4U7UD 2GAHC 4TLRA 5K8NA 2W9CA 1Q81T 3LH2S 1HQEA 2XMWA 2FB0A 2NXCA 1WJ9A 1TELA 4DUZJ 4FNIA 2BJ9A 4LVNP 2LDYA 3CWJA 3A13A 1HKAA 3D1HA 1ZZFA 1F9EB 1N5SA 3RW7A 2OSQA 4DL3A 3LW5C 2UUCJ 5SUHA 1TR0A 5HBMB 2CXEA 4K4WA 2CKWA 1TKZA 4KH1B 2BEFA 3PFEA 1UWBB 3HVWA 1T9XA 2VQFJ 3RRKA 3FSIA 4LF6J 1FJ7A 3UN5A 3BGLA 3K89A 8AT1B 4MIAA 1UKUA 1U8SA 2ZZNA 3MDFA 4J7CA 3RBXA 2L48A 1SV5A 2HNYA 3D68A 3ZTSA 2DRBA 3ZZPA 1URNA 1JMTA 3T9ZA 1WEYA 4TNOA 3MEDA 1KONA 1DARA 2B51A 2VB6A 4LF9J 5E3RA 1UJ4A 2CIMA 5KFVA 3AB2B 4IR1A 1SJRA 5HMYA 4P71A 4CNYA 1EETB 2OMLA 3G8TA 2HIYA 4CYUB 1U0SA 6FD1A 4CO1A 2IDLA 4L76A 2PEBA 1JLAB 1WSVA 4USWA 5E3QA 5GMDA 2M4MA 2BDPA 2J9EA 2D9OA 3MOZA 2G0JA 1T9WA 2HWHA 3ETOA 1RK8A 3GTYX 4EYIB 3G2XA 4O3OA 2DEJA 3DLEB 3ITHA 1IBLJ 4J9RA 3CEDA 3RBEA 3M2RA 2BRKA 4I6YA 5HSPA 4RJVA 1UP1A 2ZJQQ 1LWCB 4ZVRB 4OZ5A 1YQHA 4KB7A 5BJRA 1S1WA 1MMLA 2HMIB 4DR5F 3DYAB 5C2GA 5HANA 1FERA 2PMZD 4CH1A 4ZPBA 4NCAA 4DV1F 4KGXB 4NXMF 1BWEA 3E3XA 1JNZB 3KTQA 2YWKA 1QVFR 3IR5B 4BBYA 3PYEA 4IH6A 1WC0A 3BN7A 1YGYA 4LREA 4B02A 4UW2A 4PEOA 5BYSA 4M95A 2AYMA 4ECSA 4X4VA 3GJSB 2MDAA 4C3MA 3G8SA 3AD8C 5F9LA 3ENAA 4DQQA 1RBAA 4B9VA 2VF3A 1KHVA 5KFFA 4RZRA 1KTQA 4IFYB 2MKSA 1TKXB 1SC6A 4K4XA 5HAOA 1U1OA 2NXNA 1RTDA 1WOSA 4QW8A 2OFGX 4NPOA 4BC9A 2XZTB 2YNGB 2CDRB 3F44A 1N56A 3K59A 4J9UE 2MQNA 4N47A 4KHMA 4OLOA 4WXWA 3S01A 1FXDA 2GHPA 1DLOB 1X4FA 4DL6A 5B0BA 1D3WA 3QJLA 4HYKA 2EKYA 1RHQB 4ZPDA 4EBDA 3MMCB 2J9DA 5GMEA 2ZD1A 2VA2A 4CTAB 4I67A 2BE7D 4DV2J 2B6AB 1RT4A 1FRXA 2DTJA 3H90A 3GJQB 1HBMA 2EKNA 1X4HA 4RX6A 1IKYB 3ZZRA 3AQOA 2UV8A 1HBNA 1QY7A 4KKOA 4OMFG 3BH7B 3G6XA 3CNQP 4K5SA 2W2OP 2ZBPA 3M2UA 4KHRA 3HHKA 2DCUB 1N34F 3ETMA 1HNXJ 1FNOA 3PEJA 4H4MA 4XAKA 4PWDB 4NA3A 2AF6A 2DH7A 3IBWA 3UVJA 1S1VB 4DR3F 1IM6A 4A8QA 3M1VA 2IBKA 2VBWA 3CE8A 3NGRA 2Y1IA 2R4FA 1YDLA 1RA7A 2L08A 1VMBA 3N6MA 3M9OB 4X4PA 1JXLA 3PY8A 3ZFVA 4X65J 2LECA 5D78A 4N41A 3UDEA 4B9MA 3TZYA 2LP4A 1S99A 4JI5F 5KG7A 1R3NA 2L3MA 4IO1A 4DL0C 4F67A 1I3OB 5KOXA 1B0VA 1Q8BA 3NKYA 3GSDA 4LR7A 4LF5F 2HPUA 5EUHA 1H2VZ 3ICLA 2E5JA 1YJVA 1F3VA 3QT8A 2MMYA 3HJFA 2W8KA 2RKIA 3W63A 4Q5VA 1RT7A 2HAIA 3OTCA 2YKPA 2F9JA 1BD6A 3MM9B 5L9NA 4RBTA 1HA1A 2CQ0A 3CD0A 5D8HB 1MG7A 4FS2A 1CJTA 2Z57B 1LFPA 2K2PA 2MGZB 2CNNB 5KFEA 4DBQA 2Y9HA 4ECUA 5C24B 2DNPA 5F9NA 3CJSA 2FJDB 2RQ4A 4DX5A 4ED4A 1OMSA 3M2VB 1P6TA 1L3UA 5CYMB 4ZPCA 1RBOB 3GU0A 2MQQA 1RCOB 3M9NB 3NS5A 2LXFA 4IQXA 1X9WA 5L46A 3BEGB 4NXMJ 2ZE2B 1VQKS 1HNIA 5H9EK 3D3BJ 2DISA 3ISZA 3A8KA 1OQ6A 2NYIA 5KFKA 1RBLA 3OVSA 3BS9A 1UZHA 2J0XA 4Y34A 3LPYA 3MM8A 3OSPA 4DS5A 4IKAA 3Q24A 4O3NA 3UR3C 2U1AA 4PG6A 1EHWA 3HHLB 2DNHA 4KY3A 4LIRA 2GQCA 5E7OB 1X4DA 1FDNA 1Q0NA 2YBVA 3GE9A 4OYOA 1LWEB 3VAJA 1JLQB 3K0JA 2PGCA 2W2PP 1NEEA 4NI2B 1REVB 1HLWA 1P1LA 4N5SA 3FEXB 2BUNA 1GXLA 4H4OB 1MWZA 1YBAA 2UXDF 4RW7A 4JV2A 3MEGA 1U02A 1R7IA 2E5IA 3R27A 3HVRA 2DHXA 5F8MA 2EW9A 4M5IA 1NDKA 5FLXU 4NLWA 1M5OC 3CCVS 2J6UA 2R9LA 2E5HA 1D8YA 1HNZF 5DDQC 4QZVB 3H5SA 2QL5B 3WHIA 2DNMA 1I1GA 3ADAC 2DR8A 2OEKA 1F1BB 2HQIA 2VZ9A 4XDDA 3PNIA 3ZNJ1 2DGWA 3CD5A 1S1XA 1ZM4A 1MROB 3BYRA 1J5EJ 2HVIA 3CULA 1PO6A 4B3OA 2QFJA 4KPCA 3OL9A 1IQTA 4PXBA 1T8EA 1HBOA 3NNAA 1GH8A 1SJ3P 3JQKA 1VS3A 3OFFA 3F0NA 5T14A 3W62A 1K47A 3EICA 4HEA9 4EWTA 4I56A 1TK8A 3EM1A 2QL9B 5F3ZA 2KDOA 2MB0B 3HHNB 1OWXA 2KG1A 2RS2A 3TA0A 4WU3A 2AGOA 3I4PA 1R6YA 4FVCA 2FC9A 4IUFA 1UPMB 1U6BA 2MKIA 2GVDB 4EO6A 3BBCA 2HHQA 2IM3A 4RW8A 4QJVA 4LF5J 3N9UC 4PQUA 2RNEA 3CCTA 2X3DA 4XPEA 5D4LA 1RHRB 3E01B 1DURA 3NGSA 4OZ0A 3IR6B 4OYXA 1S59A 3H8YA 3JB9k 2ZHAA 2V4JB 3TNVA 2CPIA 4DR2F 1RHUB 4TY8B 3I5BA 3BGRB 2V4RA 3TEGA 5KG2A 3V2UC 4UOHA 3T1AA 4F3QA 2XYHB 1DJ0A 3I32A 4OV6A 3KG1A 2QEXS 3PHEA 3OVBA 2VG6B 1TP7A 1CQMA 5ETQA 4ECZA 2J5AA 2YNFA 3J80U 5M2PA 5LSRA 4IFVA 3SBMA 5A8WA 2BJDA 4DSFA 1VC6A 3QT6A 1D09B 1YJ9S 1FO1A 2FVQA 2HRUA 4CI0B 2ACMA 1OJ4A 3QGGA 4CO4A 4ZHRB 2Y1RI 3MEEA 1MW7A 3EDRB 3G87A 3HHLC 3U02A 1U8WA 4ER8A 1BXNA 1SKSA 4KC5A 3BKFA 2UU9F 2XTJP 4RKUC 3TQEA 1U2FA 1U2CA 2BVZA 3JQMA 2G1HA 4J9VA 1VRTB 4U95A 3PV8A 1R6VA 2PMHA 1TL7A 1GAOA 3QNWB 4CM0A 2UUAF 4ID5A 1ZM3A 3IAM9 3HKZD 4ANCA 4NLSA 1T9UA 4JI4F 3WIUA 2JWNA 1VCTA 4RNHA 2HQ3A 1IN0A 2QIFA 1FF2A 1AB8A 1Q95G 1OIAA 2UXDJ 5B0FA 4RU9A 4KHPF 3CCMS 5F0WA 1JKHB 2FLLA 2R7XA 3IRXA 3DMJA 4OZ2A 2OPRB 5HO4A 4MT1A 3FNNA 3U1MA 3RR8A 2YWGA 4N77A 4GC6A 4F4KA 3KKFA 7FDRA 4RW4B 1HNVB 4WJBA 4NLQA 4ZVTB 2CQBA 5A8KB 2R8JA 3V6HA 2AW0A 2MQLA 2PO4A 2AHOB 3PYGA 4F4ZA 3KK3A 4NE9C 3QQCD 3DLGB 1P9YA 1RAGB 1FWLA 2FJAB 3BN4A 3NS7B 4F25A 1S76D 2B56A 4DF4A 1HBUA 2VA3A 1DQ8A 1PAEX 1HW8A 2CWXA 2XNQA 3SMZA 4J9SA 5JJBA 2CQ3A 3T5HA 2MHEA 1XQIA 3DRRA 2J6TA 2YNHB 5LT5A 4TXSA 4KIAA 1D0EA 1X4GA 3NWRA 3DLJA 1IJFB 3CF5Q 3MZIA 3EPIA 5CD4A 3VGTA 1OYEA 3IBFB 4FXWA 5HMXA 3NMAA 1VQ9S 1BLUA 1W7WA 5F8LA 1F6TA 4EEYA 4QWCA 1CC7A 3RBZA 3DU5A 1IVZA 3HVTA 3FBEA 1RAOA 1X4EA 2YPZA 3ET6A 4ED0A 1FRJA 5I3PA 3POTA 4TU8A 3GILA 2NSBA 2AJ2A 1MU2B 2ASJA 1OSCA 3GMGA 3K57A 1B3TA 3HFVA 3W66A 3HM9A 3ZNUA 4LR9A 3M8ZA 4EYHB 4PG7A 4A47A 2KT2A 1KS2A 1WI8A 2QLJB 1FKOA 1W2BR 2AKWB 2B4OA 5IT9U 1JK9B 3BDPA 2DRDA 2N4DA 2W9CB 5DM7Q 2ZUAA 2V2KA 2H1YA 2ZH7A 2WHOA 4RU2A 3BQ2A 2DGXA 3CCQS 1BUXA 3LANA 5IWAF 1EZZB 1TL5A 3H0PA 5L9XA 1ZPWX 3BSAA 2V94A 4ZVGA 2I9SA 3GCXP 2QSFA 4YQWA 2JFKA 3HZEA 4JI3F 2AGPA 3D2WA 1BC6A 4DX8H 1O5JA 2WVDA 1UTAA 1FRHA 1XK8A 3I4HX 5LJ3Y 3M05A 4F2RA 1HFEL 1FEEA 2DO4A 4ITSA 5KFPA 1FKAF 4LQ9A 5GAGI 2MZSA 1YX2A 2BQ3A 1FDBA 2FC8A 4KTQA 3W3SA 2UU9J 1UJ5A 3P5TL 1GTHA 4M63A 1N0UA 3VZHA 1K1QA 1CJKA 1VQ5S 1TL4A 1KLMA 1FRLA 1NB7A 5GADI 1SV5B 2HNYB 1WOPA 3O1LA 1JLCA 3GR1A 2IY5B 3U1NA 1HARA 2UUAJ 2NYHA 4QR2A 5D6GA 5EWGA 2DJWA 4Z7CA 2F8MA 1B4SA 4U8YA 1KVIA 1W25A 1TK5A 3OPKA 4KHPJ 2NSCA 1UWAA 1RAEB 3C16A 2OPPB 4Y00A 5A2QU 5H9EJ 2CQPA 1B99A 1FXLA 2E7VA 3DI6A 4B3SF 2QO3A 5K8OA 1JXVA 2Y0SD 2R3VA 1QTNB 1B0PA 1RWUA 3WX8A 1N33F 3R7NB 3BO3A 1BQNA 1EQ0A 2V5HG 1BQXA 2K7JA 2F4FA 3D4JA 2HFNA 1S1WB 2RUSA 3HCXA 3BSNA 4DJBA 5C25B 3JS9A 4HTIA 2WRMA 2IBOA 2QA4G 3MTJA 2IC3A 2Z2ZA 1RT2A 1NSQA 1RA6A 2XMKA 3M32A 2NR0A 3I5AA 1M5HA 2MKKA 1LW2B 3VWSA 2VPZB 3K5OA 5DS7A 1WHXA 2V69A 4JYAF 2ZOGA 1WELA 3M6WA 1ZTWA 4IH7A 2KFNA 1C0TA 4QU6A 2XO6A 4BCAA 5J2QA 4NXNJ 1EKRA 3TVYA 4P74A 1Q79A 4CT9A 3HD2A 1PKUA 1UETA 3QATA 1QTMA 4Q0BA 3IM8A 2XY6A 2HBZB 3J7AN 1UVIA 4JV5F 1RTDB 4DFMA 5GAHI 4DLGA 2EXUA 1VQSA 2WCXA 5ADZA 2F7VA 2XYGB 3CDBA 2AYEA 4MAKA 1RT1A 4TY9A 2EBGA 5AXMA 2PFFB 3Q8RB 3VGSA 4WPAA 1XR6A 2V2QA 2C3PA 2ROGA 3C3LA 4W98A 1SJFA 2K06A 4FYXB 2EG1A 2JEJA 1ICEB 2IFXA 2QRRA 1KP6A 4JI8F 1BWVA 3LOUA 1RAAB 2JNJA 1S9EA 5G4DA 4F4YA 4QOTA 3TAPA 1YTYA 4DFPA 4I4BA 2A0FB 1VRQC 3SCLE 2M7SA 5D4OA 2YQ3A 4ZLLA 5DQIA 3ZZUA 2POKA 4I2QA 2EFNA 1HBMB 4USUA 3CO9A 3SSQA 2E1RA 2GJ2A 4DL4A 3QRQA 1MN7A 4DV5J 4ELTA 1S5ZA 4DS4A 2UXBJ 5DRKA 1FKPA 4PWUA 1T9YA 1VQOS 5KFCA 1HBNB 2D3ZA 3D0HE 5FJ4A 2V68A 4KKOB 2FHKA 2JSXA 1FHTA 2BE9B 4U9RA 9ATCB 3NWGA 2J7KA 3M2UB 4O0NA 4ZJLA 4NZ7A 4JI3J 1R8CA 1PGZA 4WIIA 3R9LA 2KH9A 4O4GA 1NZAA 3VF0B 3UVJB 4FF1A 2LQBA 4J90A 3D3CJ 3C19A 2FHOB 3IG1A 2MZTA 3AY0A 3DFEA 2KJVA 3N0VA 3D67A 3M8YA 2V6AA 1OYDA 4GMKA 2CQIA 2Y8YA 4B9SA 1G6BA 3Q2SC 3TZWA 3E51A 2AJ4A 3ZZTA 4PG4A 2VODA 1R27B 2I8EA 3EZ5A 3MUMP 1KC8T 4LR8A 2VPWB 4JI2F 4LQ3A 2MQMA 4YY3F 4A8OA 1N36F 4Y6IA 4NLGA 4ALZA 3BO4A 3T1YF 2XZWA 3H5YA 3T3FA 1Y3JA 3NRBA 1KQSR 3VZIA 1SPBP 5CHCB 3V6KA 4JBCA 1R8BA 4TVAB 5FDLB 4YR0A 2RKIB 3GFHA 4K7QA 1PJ6A 3NBPA 1RT7B 2LQ5A 4ZP8A 1IWGA 4YN3B 2A2DA 1B7FA 2Y8WA 3PCOB 4DR4F 1KQFB 5KFJA 2C22A 1WTFA 1Z2ZA 4OYWA 2J9DE 3EMTA 1S6UA 3PYFA 2XEXA 3OFGA 3QO9A 4ZVOB 3A3OB 1VIOA 2J7UA 1RXOB 1N33J 1X4AA 3IGNA 4RL1A 1Q53A 4OI1A 2D3O1 1RWOB 4DPTA 1L3TA 2MY8A 5J1EA 3FBCA 2WBRA 2GNKA 5GAEI 2LLZA 2BRLA 2L9NA 4LF7F 2Q1LA 1TTHB 1CJUB 1T03A 1BGXT 4XIUA 3I96A 3HJVA 1M1HA 4TQRA 1FWKA 1S4EA 2HRTA 1FJGF 1LW0A 4KH0B 3B54A 2FJVA 1XIQA 3A1YG 2ZM6F 2ZNZA 2WTFA 4NRUA 2LMIA 3W7BA 1F5BA 2VG5A 3SEOA 2FUG9 2Q6CA 3MM8B 1RTJA 3SQGB 3GFZA 1FFWB 1WF0A 2K3KA 4DF8A 3W61A 3EYZA 4PXDA 4HT5A 4NX9A 2RF2A 3Q22A 2RIJA 3BB5A 2V67A 5BR8J 3UFCX 2QLWA 1SQGA 1J5OA 4CLWA 3VR1A 3VVTA 1RT6B 1VQ7S 1QUVA 2RU9A 4X64J 1TMMA 2KRBA 5B0CA 2H65B 2YY3A 5CYQA 3PJ9A 5RUBA 1H72C 2DNRA 4DUYJ 2R7UA 2FVSA 2VD3A 3TW0A 3JSBA 3N5FA 4RW7B 3MEGB 2ALZA 3TVZA 2FLPA 3TVKA 2VKRA 2NXUA 2V2ZA 3MM7A 2C2DA 4TYBA 1F2HA 2FIUA 3TJ8A 1XNRF 2UUBJ 1XMOJ 3V6DA 1RLCL 2GCFA 3ZZZA 4DPOA 3MECA 1N5YA 3AXKA 1X9SA 4P2XA 3I9V9 2FYXA 2HQGA 3EZOA 2IVYA 1LQ9A 1DRZA 1RLDA 4FYYB 2ERRA 1S1XB 3BV8A 4O3QA 2YPYA 3GP9A 3N6NA 4B3OB 4YUDA 5F8NA 1X5TA 3QAUA 4DLEA 4I6WA 3T19A 2ZFHA 2ZVIA 1S6OA 3VCDA 2AEJA 1U6FA 3A3NB 3I0SB 3BPSP 3PTWA 2RHQB 1I51B 4WP9A 5DQHA 1KVKA 2QFIA 1NPPA 3HMJG 4NYZA 1PC5A 2E44A 2UV8G 3K5LA 3OL7A 1S1UB 1WD6A 2MEWA 1V3ZA 3NGKA 3B4DA 1SC4B 2IA6A 4LT6A 3R7BB 1YITS 3LPEA 1VR6A 1WHWA 2HK2A 1HWJA 1AXQA 1NSAA 2C2ZB 1WEZA 3KK1B 4WIQA 4YY3J 2ATLA 3PJWA 2AX0A 2OGUA 3TP2A 2G13A 2B9XA 4RW8B 2ZEJA 3JTOA 4NLDA 4PQUB 1U26A 2C3YA 4MK9A 3PKMA 1HL6A 2HFUA 1JX4A 2AIRB 3L3CA 3DGVA 4R0EA 4PUOA 4NEZA 2Y1JA 3C6UB 1SC3B 1AROP 3RG6A 1WTBA 1WG4A 1C0UA 2J8SA 2A3JA 5CCMA 4B9NA 4DR4J 1VRUA 2E66A 2R2UA 1ZAXA 1EARA 1VBKA 3QZ8A 4ZIWA 1IKXB 5J2NA 4ZCIA 1NHKL 5B08A 3GFXA 1PSDA 5B7WA 4QYRA 2D3UA 1FD2A 4ZA1A 2EFOA 2R7QA 2HSEB 2RS8A 3DRPA 2M2BA 1TV6A 1VBYA 4WYWA 3MR2A 2YNFB 1RACB 3VAGA 2RD5C 2KYXA 4ZK7M 4LF7J 2HG4A 3GJRB 2OD4A 4O23A 3IA0A 4LVOP 4QW9A 1WKKA 3KYLA 2OAUA 5E0OA 5A6PA 2CA9A 3P49B 4KQZA 3M8PA 2L9DA 1IKVA 1WEXA 4KR0B 3AHPA 4OYIA 3T6BA 3TAQA 2ZHOA 3MEEB 4OYPA 4L6V3 2OLWA 3PR4A 3PRBA 5EX3A 1DHMA 4LSZB 1YJNS 4M5DB 6FDRA 3SCKE 4KJIA 3TYTA 4R8UA 4RBUA 2CNKB 1TL7B 3CVKA 3FFIA 3MAAB 2CG4A 3D7SB 1RSCA 4N8NA 5U47A 4ID5B 3KK2B 2GGPA 3UDVA 3PW5A 4DFKA 2P8IA 3LA0A 2VOPA 4G1PA 1VQYA 1KWMA 5IC4B 2CJ9A 5A76A 1N6QA 4DQIA 3BF4A 2XLKA 2GZOA 4C2MA 3DMJB 4UOGA 5L1LA 2XGPA 2CDQA 1V5VA 2K8GA 3QGPA 5LXRA 3VGVA 3GIJA 2C28A 1VQNS 3UNYA 4G1QB 4WTOB 4OI3A 2BZ2A 2N4CA 4OZJA 2QJ3A 5L38A 4O3RA 4Y2AA 2B8PA 4U96A 3R2CJ 2HHTA 4WFAQ 4MYTA 3UD5A 2CVIA 3PKYA 1HR0J 3IMQJ 3NMRA 4TLQA 2V2VA 3TZXA 4GRSA 3NOCA 3VAKA 4C8OA 3KK3B 2XMJA 3QGHA 4BWMA 1SUQA 4XO0A 3DLKA 1GQEA 2BJEA 3HFKA 1OY9A 3P45B 4P2SA 4ELVA 4FKXA 2PA3A 2CNLB 3MMBB 2WW4A 3DRRB 2FVRA 2RJZA 3QJPA 4V19X 2KRRA 1UA0A 3THVA 3HSDA 3NAIA 3IS9A 2IHR1 4G6VB 1NO8A 4A8MP 3SI8A 3HPOA 3DGPA 3E8OA 2CJQA 4P2FA 1X4CA 2PD1A 4Z37A 1TL1B 3UQSA 5JMNA 3OTOF 1YRTA 3DM2B 2CRLA 1F0XA 1OY8A 4C8YA 2H48B 4Q43A 2HRYA 3ET6B 1Q5VA 2RRNA 3THTA 1QAJA 3C15A 4RUBA 3CIMA 1SH0A 4DR6J 3H2LA 3MI7X 5E3CA 5A6WA 1VYAA 1NNDA 2DNOA 2VASA 2YWWA 3RB6A 5IXUA 3PIPQ 5G0RA 4ID8A 3AQPA 4IDKB 4MKAA 4CCHA 5IV3A 3CMAS 2OPQB 5F8HA 3VGUA 1NXIA 2COLA 1S6QA 2QA4S 3AXMA 3WC0A 2MZ1A 5KFZA 3HX9A 4RNNA 4AUKA 3NNHA 2RH3A 4LSLA 2W9BA 3UDLA 1SIWB 3ULHA 2JLGA 3LWMA 2W2MP 2WVFA 1RP5A 3WX4A 3VQSA 4A8XA 4A8KA 2OP5A 1XR5A 1RTIA 4DR1J 4HKQA 4K4UA 5CQGA 1DY3A 5K14B 5CA5A 1RJJA 4ZVFA 4ZN3A 5D4NA 2QL7B 2X7IA 4QPTA 2FLOA 1EIYB 5LMNF 3SSRA 4CH0S 1MSWD 2WB4A 3L9ZA 2HHPA 4FF3A 5I3UA 5LL6d 2FHJD 2J0SD 2M3DA 2VC1A 2DGSA 3BREA 2WBMA 1B64A 2O5DA 4QWEA 1C1BA 3BKUA 3Q8SB 2GAGC 1X5SA 1JLCB 3VVUA 2HHWA 1S0VA 2OEMA 1EX8A 2BJ1A 4PYDA 4WE1B 1Y5IB 2OKQA 4IRKA 5LSOA 2MSTA 4NASA 2A2CA 2XWYA 4YDXA 2FDNA 4YHHF 3JTNA 1Z4UA 4DEZA 2ZITA 1LOUA 1CULA 3ZC4A 4LMZA 4NLPA 3C16B 2XHCA 3HT0A 2XMAA 3CIZA 2H9ZA 2IYIA 1NBEB 2NPIA 3SFUA 3EZUA 4PPZA 1TL3A 2ADCA 2Q66A 2F5GA 2IRXA 1Q1KA 3D6FB 3OXFA 5CZVA 3ILLA 1M5KC 3FRZA 4DUZF 4ZITA 1U0HB 3OR2A 3OUYA 3NXZA 5DZ6A 5B0GA 1BQNB 2IMOA 2QA1A 4HHHA 1NDCA 4OFZA 5I4MA 3FGVA 4C9DA 1DQAA 2P9CA 5AT1B 2W2NP 3P8BB 3R1HA 4H4KC 2UUCF 2AJQA 1RAJA 3CTRA 3KJQB 2CZVC 2DNGA 4LF2A 2FGOA 4UOCA 2BM1A 3UE2A 5KT4A 5DETA 4HHJA 2B9EA 3IWXA 2Q43A 2D3OR 4DG1A 3N79A 1M90T 2HQCA 1VC5A 1ITPA 1KNZA 4LF6F 2HURA 4M5LA 4FBUA 2WW8A 1HWIA 1IJEB 4YDDB 3SCJE 1C0TB 3A4TA 3KLHA 2NXEA 4IR9A 1XNQF 3W65A 1U7LA 2J7WA 2XY7A 2G0IA 1ZS6A 2V34A 2DR7A 4B9UA 3F56A 4XDCA 2OH2A 5FLXY 4Q0BB 2KVQE 2GMJA 2LQ9A 2ZKTA 3QFWA 3BPDA 1T0TV 4NLRA 1GXUA 4LF9F 2W2QP 4Y28C 1C4CA 2DGQA 3ILOA 3WIVA 2DHAA 1UW9A 1U1KA 4QBUA 3PW0A 3HXMA 1JQGA 3T9NA 1RT1B 3C8YA 3LP2A 4NLYA 3ZZYA 4PG8A 5F0UA 4WK1A 1H0HB 1LK7A 3H25A 4G3IA 2JFDA 4USKA 2BKNA 1Y7PA 1S7HA 1FXRA 1YZ6A 3MMAA 3L7OA 1S9EB 1ZOTA 3UD4P 4PKDB 1IR0A 3RBDA 2DH8A 1X5PA 2RE1A 3MR3A 4C6AA 2Q79A 3CCZA 3O5TB 2MKCA 5F3TA 4I2QB 4YOEA 4USVA 2JEFA 3Q8VA 4RBVA 3Q23A 3I0RA 1KRPA 4M5NA 1FRKA 3KFWX 2XMUA 2JJ4D 3D54A 4DX6A 4Q2MA 1JLGA 4KFBB 3IM9A 3D9BA 3ILIA 3PR5B 4HL9A 3RRHA 2PN6A 4O4GB 3CCUS 1O8BA 4QCLA 1NHVA 5FD1A 2QMUB 1R8HA 1NSKL 2IIHA 1RQ0A 2L41A 3IG1B 4MKYA 5C5JA 5HP1A 2X1FA 2JHEA 3PJXA 1M0SA 3KDNA 2XQCA 2BKPA 4RNOA 4LF8J 2ATCB 1HI1A 3DRSA 3MAQA 3LTOA 3PHTA 5ETMA 4P75A 2ZJRQ 2ZOMA 2BJ3A 1TKTA 3GB0A 1R8AA 4QIGA 3FCHA 1NK5A 1T05A 3SIPB 4ILRA 1SJQA 1GMWA 3FCVA 3ZTRA 1E6VA 1RT5A 2MY7A 5JVHQ 3GV8B 4CLZA 1PCAA 3H42A 3A8EA 5D0HA 2MLXA 3BSOA 3FZBA 4PWWA 3NBPB 3IN5A 2JZ5A 4OX8A 3J80Y 2BJ7A 4ZLNA 4DL5A 1P9QC 1XERA 1VQ4S 3HHEA 1NPKA 1IQZA 2ZH9A 2E5LF 1Y4ZB 1Y5LB 1ZETA 2P5VA 1UWBA 2DNQA 1SIZA 4MYUA 5HLFA 1AA1B 4PRFA 2WONB 3KHLA 4B3TF 1SKUB 1ELOA 1WORA 4KE5A 3IC1A 5HQ8A 4ZPTR 1UAWA 1HQ2A 3UDCA 5J1EB 3CJ5A 2CYYA 2LKZA 3MM6A 1HNXF 3OBIA 3IXQA 3CT9A 2XB2D 3TI0A 2HZCA 3P5BP 4B3RJ 3MFIA 3R5BA 1UFKA 4M5MA 1AFIA 2R42A 1X7VA 3JSMA 4L75A 5MAOA 1LW0B 4IYQA 3AA9A 4CLUA 1X4BA 1EP4A 1JXEA 3IR7B 3US5A 3SZ2A 1TZ0A 2DHSA 2BE2B 2BW7A 4ED1A 3NGDA 2E7XA 2DD8S 4X65F 5K8PA 2MYFA 1QAXA 2FHJA 4JI7J 1EETA 2XI2A 3I56S 2DITA 4LJMA 4V1Ak 2R7SA 3QGIA 4DCJB 5LSLA 5HJXA 4UUWA 2LEAA 2DKOB 3KDOA 1XNQJ 1X8DA 1F3FA 2CJBA 4LRBA 2M8DB 1JB0C 2FJWA 4WWSA 1BMQB 2H5JB 5KT3A 2QG9B 4E8UA 5LXYA 1YI2S 2B8QA 3NEKA 3MM5A 5DDOC 4FN5A 2OJ3A 1HHQA 2DGVA 1RCXB 5CYQB 2HMIA 1Y0HA 3DYAA 2QN6B 2Z2YB 2DB1A 1O6XA 1OPZA 1F5AA 3I55S 3OLAA 2C3UA 2YWFA 5IV4A 4ZP6A 3M30A 3OTDA 4I64A 3TQ1A 4NOHA 1HWKA 1T3NA 3N5BA 1NKEA 4DR7J 2AQ4A 2IAJB 3M7VA 3V6DB 3W9HA 1M1KT 2XC9A 4OLPA 3MECB 4DN9A 1N5YB 1FRIA 4HHUA 5KAKA 4BS2A 4LSNA 3S7RA 2LQJA 3HZGA 2LFVA 3NLCA 5IFMA 4Q8FA 3HP6A 2YKMB 4O44A 2F40A 4GO7X 1EQMA 5H1SV 1K73T 1TKXA 4OZNA 3CCLS 1L3VA 1N5QA 3KMSA 2ZH8A 5KOWA 2YQ1A 1QE1B 2I5JB 2XSJB 4NLOA 4PABA 2HFVA 4URQU 3BKTA 4XK8C 2HEKA 1S57A 4J9QA 1LKZA 4ED5A 4ZP7A 2RU3A 2RVJA 1FD8A 1Q78A 5B0AA 3LQVA 3JAMU 1R31A 4FF2A 1JLFA 2BM0A 5D3GB 1KEKA 3FK4A 3W2VA 3OTBA 1CPZA 4X4NA 4WP3A 3R97A 1S77D 2YWEA 2J9CA 3RW6A 4Q8EA 3W2WA 2O01C 1EB0A 4F0MA 4O3PA 1RHJB 3OSNA 1RWKB 2KL8A 1PYTA 2G2ZA 3MUVP 1N54B 4A8WA 3KHGA 3C14A 2PMWA 5IM0A 4DN0A 1NK7A 4DPYA 5IT9Y 2M5YA 3J7YU 4C97A 5KT2A 2V9KA 3UCUP 4V19J 1YG0A 3UWTA 1C0UB 2CJAA 1S1VA 2E5LJ 4ED8A 1VRUB 1SBRA 1VFJA 1A9NB 2DY9A 1GNKA 2A10A 3C2PA 5HN0A 4OX9J 2IMWP 4B3TJ 1J5EF 5KFMA 2G0CA 3AT1B 2HQFA 3LO3A 3D28A 5CZXA 2VONA 1TV6B 3G6VA 3QIPA 2C2EA 2BQRA 2QLBB 3U7JA 1TAUA 3G9CA 4L3KA 1A6LA 4PYAA 1HHTP 2RB7A 1CSJA 1PYOB 3CJTA 3UW1A 2CQ1A 4BDPA 4DFJA 3OD2A 2DCLA 1SC1B 1IKVB 1R89A 2WZ1A 1QM9A 2HHSA 4A8YA 3LGHA 3Q0AA 4ZVSB 2CZ9A 4USJC 5E3PA 3MR5A 2PEHA 2ZBQA 3MPUB 4NLUA 2HYIB 3AOBA 1ZAWA 1XMQJ 1TUGB 4CT8A 4JI6F 2HFSA 3W5YA 3QJJA 3H4DA 2CPDA 3A8JA 5A2QY 4ZPAA 3DRYA 4U7CA 3FFIB 2AP6A 1Q4RA 4RWXA 2R7VA 5KFRA 2GHWA 4UF4A 1WI6A 3NP5A 4WK3A 2OPSA 2BX6A 4YR2A 1PILA 2VQEJ 4MFBA 2GGPB 2JL9A 4KAIA 5K8MA 2ZC3A 2ASLA 4FYWB 3DLLQ 4ILLA 2A6MA 2GX8A 2QZ8A 2HBQB 4HACB 4PZVA 1NJWA 2LEPA 2G1DA 1SH3A 2C3OA 1BY9A 4QYZK 4FP9A 1UMJA 2CPHA 5C42A 2NS1B 3PX0A 2VICA 3MD3A 4ZKAA 2ILYA 4RLEA 2BOPA 1Y10A 5LJ5Y 2BKOA 5D15A 3HHLA 3F73A 4Q2LA 4CIOA 2P9GA 2P6SA 3LP0B 2VOOA 2HGNA 3EDQB 2LU2A 1FNMA 2ZKUA 3QLHA 2GQ2A 1SUQB 4JP8A 1LWEA 1JLQA 4C0HA 2VFUA 2MZJA 2YKQA 4KGMA 4NI2A 3ZTPA 3DHWC 3BR8A 4ENOA 2W7OA 4CO2A 3QFHA 2SXLA 3RGIA 3LP1A 1Y3KA 1RHKB 4FDFA 4HVZA 2GW8A 2KTQA 1TQLA 3AJ2A 1C4AA 1RB0A 4DSKA 4IG0A 2HNZB 3I5CA 4E2FB 3PACA 3IS9B 2HKEA 4JOUA 3MEKA 3OJUA 3TANA 4J9NA 1U1LA 3GG0A 2GVZA 3SXLA 2PE8A 4HT7A 1VDHA 2AYBA 3GYGA 3CJRA 4RPFA 1CS4B 1WOOA 4EBEA 1V6HA 3KG4A 3QMQA 1PBAA 2HVZA 3GIKA 3LAMA 3OR1B 2B4VA 1ZA1B 2ACYA 3N28A 3ENWA 3CJ3A 4HTJA 1KN6A 2IM0A 3MF5A 4H54A 4X4TA 2QLFB 2Y3YA 1K8AT 5JXSA 1NKBA 4DSLA 5HVFA 3N4WA 2VPXB 1XEZA 1EAYC 4OJ1A 4D3HA 5AJ3F 1S6QB 1XTZA 2DIVA 3HK2A 3GG1A 3OW2R 5DGAA 3SDEB 4DZ6A 1R43A 1TKDA 3OHAA 2DT9A 3NS6A 4LSLB 1DTTB 4IG3A 1S7IA 4P52A 5KFYA 5DG7A 4IRDA 4Q45A 5CXTA 4WTYA 4CLSA 4E0DA 2DR6A 2K1RA 1S6PA 3ONQA 3NGTA 2GVDA 4Y2MA 1VQ8S 2DXEA 1R0AA 2C1EB 4OIXA 5BYQA 1IR1A 1NH7A 2GS8A 4PG5A 1QD1A 4JV0A 1VQLS 2JC1A 4X62J 3BJYA 2R2SA 1N88A 2HAFA 1UVKA 4ZJQA 5IQ6A 2BA9A 2JC0A 4DWIA 4ZCMA 1YRUA 1GK8A 2MQPA 3BGRA 3L4BC 3HKWA 5ETRA 4JI6J 1WHVA 1GFWB 3RZAA 4ECXA 3TJAA 1K44A 2RDJA 5E5NA 2LXIA 3UO0A 4ZPWR 5AE3A 4DV3F 2HIQA 4A8FA 5KFIA 2VG6A 1WHYA 2OUGA 5IQQA 3J81U 2F8EX 4G65A 1U6ZA 3Q8QB 2F8HA 3Q8UA 2VFVA 2ZBCA 1S0OA 2BOAA 1WWHA 4RUCA 3RB0A 2R8HA 3FEYB 1JLBB 1B7YB 3VV2B 4OZ3A 8ATCB 5C2CA 3QT5A 4K4SA 1TL3B 5J2PB 1IBMJ 3H98A 1NDLA 2JEIA 3CUNA 3OR2B 2YQ0A 3OUYB 1RKIA 1VRTA 1TAQA 4URGA 2BQUA 1GXTA 4JI0F 2VL1A 2E5GA 2BYCA 3B6BA 1YSJA 2HBYB 5B0EA 2DR9A 1ZYQA 2KT5A 1VK8A 3S1TA 1XWLA 2XG8A 3QWUA 3FCWA 4YP3A 4A8SA 1ZH5A 2MZRA 3TX8A 4DL7A 3RUBL 1HQUA 4QWDA 1FNXH 4DG1B 5KFLA 1RAHB 1IKWB 1NB2A 4C8MA 1S1TB 3CDAA 5AXLA 5T41A 5KFHA 3D6MB 1JKHA 1GX5A 2HFZA 4ZVQB 2CPFA 4U7UK 4X4UA 2EK6A 2XSFA 3M9MB 3KLHB 2C2OB 4IOBA 2KO1A 3EJMA 1H98A 2X1BA 7AT1B 4ECRA 1UEUA 3MXHP 4FXDA 1U47A 1HPZB 4RW4A 2F3JA 4K8RA 2ZH3A 2LQ8A 3ZTQA 2CUYA 5DLGA 4B08A 1YK9A 2NXJA 5KFQA 5H9FK 4WYLA 8RUCA 5F8IA 1D1UA 3T5LA 3MPYA 1SXLA 1UZDA 4N56A 4M1KA 3DOKA 3A3PB 2F9DA 2AU0A 4FS1A 2B7CB 3KHHA 3G96A 3O8WA 3QWPA 4FVMA 4QR1A 4ZS6A 3JYTB 2FVPA 4F0KA 5J2MB 5AJ3J 3H59A 5CCLA 3CJKB 3EPGA 4LRCA 3PW7A 2RRAA 5E3AA 2WK4A 3H2UB 4UY85 2QE5A 4GVBA 1NDPA 3KLIA 1L5UA 5JUMA 1X60A 3HSJA 2D74B 5BYRA 4ES1A 2FHMA 1RADB 3HI9A 4U8VA 1JLGB 2Z4PA 4WZQA 2B4PA 2MJNA 2M52A 4WP8A 3JSYA 2MKHA 2OIHA 2FGCA 4C11A 4ZOSA 1QLNA 5F8GA 4Y2KA 3HDSA 4U6PA 1URRA 4O0IA 3KLFB 4LFBF 2OMOA 2XS5A 2CQCA 1MU2A 3QSIA 4AXJA 2V9WA 4Q44A 5HI7A 2FQQB 4UTGA 3PO5A 4NXNF 1WDDA 5M2RA 3AAWB 4X4OA 2RSQA 2W01A 1LWXA 4WFNQ 3DRXA 3R5AA 5D4PA 2UUWA 5KG4A 1ZBTA 4NA1A 4I68A 1DAXA 1TUVA 4J5OA 2IRUA 2C2RA 5L8RC 4DV3J 1NRKA 2UVVA 4LBIA 4B3MF 2IJRA 6AT1B 1V3RA 3G86A 4OYMA 1E6VB 1RT5B 3HSZA 4DV0J 5J1PA 2YH1A 3D0GE 4OI2A 3D1OA 4YR3A 1NKCA 2Z58B 4Q7AA 5C7PA 4DU8A 3OTEA 2JEGA 3V4IA 4KO0A 3LF0A 3T5KA 2Z56B 2AV5A 2V63A 3SYZA 2IVMA 2M8HA 2GIRA 1IR2A 2UZAA 2B0GA 2LDIA 4F4AA 2HK3A 2V8DA 4KGZB 1P8GA 4F3MA 4K4VA 1VGYA 3PXGa 1RWNB 3NL0A 2O67A 1HQEB 4DV5F 3ISNC 3M6UA 5HLFB 4NMLA 2UXBF 2ZHBA 4LBHA 2B4UA 1MMDA 2QLXA 4L3NA 3MUTP 3DDKA 1XR7A 3KLEA 1WF1A 4J9LA 2GIFA 4JI0J 3MM6B 2MKYA 1I5OB 3GIRA 1Z2LA 3RTVA 1RISA 5DO2A 1BE4A 1NHUA 4Y2IA 4M94A 3JSMB 3BBFA 4EMDA 1JJHA 2DNZA 1EP4B 1TKZB 2UXCJ 1GEHA 1HWUA 5F41A 1IXKA 4TKTA 2FVCA 3JQJA 3MFHA 2J8AA 4DPXA 2YKNA 2KM8B 1KHWA 4ES3A 2ZZTA 4JI1F 4DPWA 1F9FA 1LNQA 3VAIA 4QYZJ 2GV1A 2OPPA 2R8IA 5KFUA 2CJYB 4F26A 2IRYA 3HF5A 4URSA 5A0YA 1RWMB 4ZCLA 4GKJF 3MEDB 1SKWA 4YB1P 3E2EA 3RRGA 3AFGA 2R7WA 2VKZG 3MM5B 4HI2A 3W8PA 3LGMA 4FKYA 1D9FA 4F2SA 2AEMA 2XO7A 5C25A 4DSJA 3DCAA 4R5PA 2J76E 5B09A 5KG0A 2OELA 2AZ1A 5KG3A 1RABB 3M30B 1WDTA 3LAKA 1LW2A 1JLEA 3IWNC 4C4WA 2DEIA 1VOMA 2GHVC 3CCJS 2CPJA 2XMTA 4E98A 3ITHB 4I2PA 2IM2A 3M2RB 5GVQA 1RWPB 4RW6A 3CW2C 1G7CB 1HNWJ 1FCAA 1I94F 4LSNB 2RILA 1J2VA 3VTIA 3OL8A 4MIBA 3X3UA 3PW2A 2KZMA 1OS5A 2W9AA 5KTQA 1SL2A 1CVJA 4O44B 2JLEA 3W8GA 1IBCB 1N48A 2DRAA 1YKWA 1JWWA 2KKHA 1U1QA 5HQLA 3AB4B 1WG5A 2B7BB 4ED7A 2GC8A 1KTVA 4G1IA 2RAQA 3MMJA 1M5VC 2DNYA 4OYZA 4IH5A 1OO0B 4LFBJ 1WC1A 1HI0P 4DMZA 5L1KA 1NU4A 2V8HA 4N8OA 4EZ9A 1FVSA 1RI7A 3ELHA 5BR8F 1JLFB 3MGJA 3K17A 5KT5A 2AJ1A 5DLFA 2YKOA 2XCPA 3W2VB 1IBKF 2CAJA 4DZDA 2O1PA 3FSXA 1B0TA 4OJGA 1FEHA 4X64F 3TUIC 4OZ1A 4WF9Q 3TUZC 1HWLA 3W2WB 1SVDA 3NCRA 1Q16B 3Q86A 4B3MJ 4DUYF 1JNRB 3PRVA 1AT1B 3AA8A 5ITHA 2VIHA 4AFFA 2HWTA 4KGKA 1PYSB 1E6YA 4JUZA 3C14B 1RAFB 1SJ1A 2QMXA 1UVMA 4DI6A 5IM0B 4QIEA 1NZ8A 3T1HF 4OJHA 2W7PA 2ZH4A 3MHYA 4CLPA 5AE1A 2Y0BB 1SI9A 3PFOA 2AJFE 2ZD1B 3FBBA 1SH2A 1Q7LB 2UUBF 5B0DA 2HGMA 1XMOF 4CLLA 2BJ8A 4F7VA 1RT4B 2YXLA 2WOMA 2AYGA 2XMMA 5IC6B 4UY8T 2R2RA 3NG8A 1FESA 2DPIA 1U1MA 2NPFA 4J37A 3KJNB 4LRAA 3GFYA 4MK8A 3K8VA 4ANDA 2F1FA 4OHXA 2B43A 4K4ZA 1AUDA 3DOMA 3WDOA 3QIPB 3PRDA 3S6EA 2R7RA 4U67Q 4A4JA 5L1IA 4NCBA 4A46A 1RWWB 1X0PA 4H4MB 4P2MA 4NZ0A 4F4XA 3GR0A 2OSRA 2VHGA 1VQPS 2KM8C 4KRWA 1SB6A 3M1VB 5KG6A 1WC3A 2ZNYA 1U1RA 3CJ2A 3KUEA 5FDLA 4QU7A 4NRTA 1NJZA 3HO1A 4JI1J 2YKAA 1VBXA 4IOCQ 5AXNA 4C8KA 2DNLA 3FRYA 2BANA 1YRXA 3KHRA 1LEOA 1NPRA 2G2OA 1YJ7A 4K4YA 4I1TA 3TO8A 2YX7A 2ZDOA 3U27A 1Q8LA 4MH8A 3FJ2A 4AL6A 2EFVA 3BBBA 4GKJJ 3V6JA 1S9FA 2M88A 3PIOQ 5KFGA 1MN9A 4KYZA 1TU0B 1KQGB 3R2DJ 5HJYA 1KD1T 1FDAA 2OPSB 2XLJA 1PAUB 2W4PA 3KJFB 2RT3A 4MFBB 3UN2A 5IT4A 1EKSA 3SFGA 1R8PA 1AYEA 2VDHA 4DR5J 4XPCA 2E1AA 1CJUA 2JH3A 3BDEA 4DCPB 2GMHA 1R0CB 2Z8QA 2D69A 4DV1J 2KXFA 3FUYA 3PX4A 4PQAA 4ES2A 2WSCC 2IJFA 2OFHX 4IOAQ 1CJTB 5DDRC 4F02A 2CG8A 3MWBA 5C42B 4N76A 5L39A 2GMLA 4Y3CA 1FA0A 4FYDA 4LF1A 1I94J 3SQGA 1L3KA 2DNNA 4TU7A 2FPHX 3KLVA 2HVHA 4HDHA 3GV7B 1PG5B 3TAMA 3QZ7A 5SZTA 2W4CA 4TN2A 4CLKA 2ZH6A 3CJ8A 3SV3A 2U2FA 3QLHB 3GQCA 1RT6A 3EGVA 4HR2A 2ADBA 1HNIB 1Y11A 5H9FJ 2RDDA 2NQPA 4CLYA 4DQRA 3UPFA 2VJUA 1VLYA 4QPXA 2DVIA 4UZBA 2XS7A 2ZDPA 3W5ZA 3CC4S 4P73A 2M0GB 3LP1B 4IQMA 3GIMA 4GKKF 1VHIA 3I82A 2RRBA 3SV4A 3TA2A 3VQTA 3RB4A 2C2MB 4IG0B 2F63A 2LU1A 2R8GA 2R8KA 2NREA 2DGOA 4ILMA 1AZSA 1RWXB 1YLXA 2EEYA 2R7TA 3DLBA 1IBKJ 1FTRA 5KFBA 5I42A 5DJBA 4Z2XA 1JJ2R 1CBKA 2HS4A 1HIYA 4J9OA 3H40A 3B8HA 1SL0A 4P10A 3V5RA 3RAQA 1HD0A 2GVZB 4FZVA 4MKBA 1REGX 1UEVA 4UT4A 4ETZA 1K1SA 3V4MA 2KT3A 3T1HJ 1AFJA 1KDNA 3TARA 1UL3A 1FJCA 3M8WA 1N34J 1H2TZ 2VU5A 1KR4A 3MR7A 2VG7A 3CB4A 3I0SA 3DU6A 3G82A 4ICLA 4DR3J 2W25A 2O3DA 2L9WA 4ZLPA 5KFAA 3TA1A 3WQPA 3OJSA 2AEFA 2WVEA 3GZ7A 4YEAA 1KKHA 1HR0F 3AJ1A 1UPPA 4BLGA 3GYNA 2CJKA 1S1UA 4IG3B 1VIXA 1RZMA 2N7CA 3NCQA 4AT1B 4JI5J 4R25A 2K1RB 1S6PB 1HBOB 2NLWA 3KK1A 1QDUB 1R0AB 1FFGB 2ZH2A 1VC0A 2ZBIA 4C3KA 2OEJA 1T9TA 1KBRA 2VFRA 2EVZA 1LXJA 2VFSA 1FX2A 1M5SA 2GFFA 1WC5A 2YNIA 4RR5A 1M1GA 1FJEB 3C6UA 3SQOP 3K5NA 4GVLA 1HD1A 2CQDA 1TUWA 2HHXA 4X2BA 4GO5X 5K20B 5E33A 1YZ7A 1WG1A 1BQMA 4MIWA 1JIHA 3BZQA 2XS2A 1ZZNA 1IKXA 1SQFA 3AD7C 4ED2A 3MR6A 2RUGA 5J1NA 1YJWS 1J27A 3IGVA 4DR6F 2XHWA 1FX4A 1H7WA 2JDJA 4F50A 5ETPA 1UA1A 2I6WA 4QR0A 3T6JA 3FDSA 1ACMB 3HD1A 4WFZA 2IDEA 5DGBA 4O4RA 4ECWA 4ZN1A 2W7AA 4LFCF 5GMKa 3QRPA 1S9GA 4K59A 4C98A 3P6YC 1YJUA 2H51B 3NY0A 2NZCA 2QGFB 4RNMA 2Q3PA 2CQ4A 2ALYB 2BW2A 3M6XA 1FE4A 1MMNA 1VJWA 4M5DA 5KFDA 4YB5A 3K58A 4OHWA 4USHA 4IFVB 2AZ3A 3MCNA 5A8WB 4DR1F 1QAIA 1YWXA 2EC2A 3IAS9 1S0NA 3UCGA 2G4BA 1KQKA 1WKJA 3MAAA 2KYZA 4F0HA 2FY1A 1U2RA 1G3OA 4AL5A 1TVRA 1ULRA 3TJ9A 1H38A 3KK2A 3L09A 1HQUB 4WXOA 3OXGA 1NUEA 3Q83A 4OHYA 4GKKJ 2CQGA 2KJWA 1K0TA 2VBYA 2QTWA 5EHHA 1U25A 4EFAC 5CABA 1HNZJ 2O66A 3PM9A 2Z2MA 4G1QA 2YVSA 2FTRA 4PR6A 2FJBB 2WAQD 3FQKA 1HHSA 4OYAA 2CPYA 5HATA 2MHNA 2XWXA 3HSGA 1H73A 1YHQS 3C66A 1A7GE 1XBWA 3PO4A 2OTJS 4OI0A 3S8SA 3O6QA 4FPRA 4QWAA 4UOFA 3IRXB 3DXSX 1NK6A 1Q8KA 1ROFA 1UVLA 3DOKB 1U45A 2MQ8A 1H3DA 3QRRA 2JVRA 3KWMA 3MMBA 4H4KA 2FLNA 4CM2A 2HNDA 1NLKL 3HVAA 1SQEA 3KJVA 2VC0A 2CPEA 2JOQA 3MURP 1PIEA 1CLFA 1RAIB 4GVBB 1WSRA 5HK4A 3KLIB 4ZLJA 4QIFA 4X66F 2ZC4A 3EXCX 3JAMY 4KT0C 2V8VA 1C1CA 2UUTA 1PC4A 3I9ZA 1TL1A 1HBUB 1G1XA 4W4MA 1NJXA 4ATNA 3HT3A 2D1CA 2DO0A 3MCSA 3LUYA 1D9DA 2GJFA 4C11B 3DM2A 2APOA 1JJ4A 2HHUA 4L74A 4K2JA 2HLUA 4CZCA 2BABA 2PI4A 4X4QA 3SCIE 2QSWA 3HFZB 4NA2A 1VLOA 2ZWOA 2V50A 4DR2J 1UVNA 4IDKA 2IYGA 3O44A 2MQOA 2OPQA 2E1MC 2IJNA 4J9KA 3KOAA 2E29A 3NOGA 3H5UA 3ILJA 1VHFA 4I6AA 3HVTB 4EBCA 5D77A 3R3TA 5JVGQ 4P6QA 1KOOA 1GMWD 1PJ5A 3POTB 4WBFA 2Y1LB 1W26A 3R5DA 1ZA2B 3FEZA 3DNCA 3MOJB 1OPIA 1Q5YA 3P3DA 2ZH5A 4JB8B 1I6JA 5IT0A 5K14A 3V4IB 4KO0B 4F3OA 4NCGA 3GPAA 1LWFA 4LFCJ 4P9SA 3EXYA 1TFYA 1N0VC 1HMVA 1FKOB 4F4WA 4RW9A 3J7YI 2GQQA 2EWHA 2KZZA 1A0OB 2H54B 4PPDA 4BHQA 3C6TA 4EGLA 2Q6BA 1IWAA 2GJIA 4ERDA 3M6VA 5T7LA 1MWYA 1UEKA 4OHZA 4ZVUB 3KLEB 1FT8A 2BV3A 2MXYA 2B5JA 3LWLA 2EFQA 2JVOA 3DDIA 1ZM9A 5K9FA 3FMWA 3EVWA 1U49A 4WE1A 3EVMA 1T02A 2B9WA 4QWBA 2AD9A 1QAYA 1Q82T 3QBCA 4JI4J 3CGIA 1ZPVA 2GO9A 1H74A 2YWHA 3KLGA 2EI5A 3T5JA 5F8JA 5K5MA 3OVAA 2YKNB 4UZCA 4LF8F 3K5MA 3FKBA 1CJKB 5IS2A 4L73A 4ZDNA 4ECQA 2UVRA 1KLMB 2JLFA 2AJ0A 2B9YA 1N5VA 4OX7A 1RHMB 3KXDA 2CNOB 3DOLA 4X84A 5A0YB 3RJMB 3B4MA 1S0MA 3DXBA 1FFSB 2PSZA 3B82A 2P6TA 1CC8A 2IA0A 4DOZA 1T9VA 1U0HA 1Q7YT 2HLTA 4DDFA 4PXCA 1RT3A 1S72S 2GA7A 3VHQA 3V81A 3BR9A 3MPWA 2ASYA 4R5PB 1YIJS 4WFXA 4AE5A 3M8QA 3DI6B 2W24A 4QIVA 1JLEB 2J6SA 1RTHA 1FK9A 3P4UB 4I2PB 1G4CA 4RW6B 1LK5A 2IPOB 2XCAA 3IWLA 3HLUA 4CNZA 2XNRA 3DN9A 2N7YA 1H2UX 5THWA 2V8PA 1NMEB 4WFYA 5KFOA 2IC3B 4J9PA 5HROA 1RT2B 2R7OA 3GLJA 2XZDB 1H7XA 2J0WA 3MD1A 3IO1A 4X66J 1S12A 1D8ZA 3M32B 4B3RF 3CD7A 4FF4A 2PA8D 4EO8A 3EGWB 4W90B 3BGFA 3EE3A 5D0EA 3M4XA 4KV8A 4JI7F 3FC9A 1NJYA 4P7VA 4Y2CA 3WC2A 5IOLA 1RYSA 1KOHA 4M5JA 2KFYA 2D9PA 5J2QB 2DXDA 2I1RA 3TEHB 3UCZP 1F2GA 3RB3A 2XBPA 2IVFB 2EFGA 4NMXA 3R7SB 1RDRA 4J9MA 4B9LA 5D0GA 3OL6A 2DGUA 1NM2A 3I6PA 5A8RA 2I2YA 4A48A 4CLFA 5KT7A 9RUBA 5DDPC 4C8ZA 3RAXA 4J91A 3IP0A 1E6YB 5IWAJ 2HFOA 4TU9A 3RR7A 5L1JA 2MTLA 2C3MA 4KFBA 3CDWA 5ETOA 3G6ES 3GIIA 3THPA 1N8RT 4DR7F 4DX7A 1IUJA 3UD3P 2X1AA 3EWGA 3FQLA 2WOMB 3K8WA 3BGOP 2WB1D 1DTQA 3IBCB 2VFTA 5MLCV 3RAMA 2HVEA 1FKPB 3ENQA 3DLHA 5KFNA 4ZVEA 2YX1A 2RHSB 2LEBA 5ETLA 2PT0A 3TUPA 2KFZA 1SKRA 2ROPA 3BQ0A 1BHNA 3DOMB 2QX0A 5HMWA 4FYVB 5ETSA 1F9HA 2DNKA
chains in the Genus database with same CATH topology
1RT7A 2QE5A 2HAIA 3OTCA 2C28A 2YKPA 1VQNS 4G1QB 4OI3A 3EX7B 4EUVA 2BZ2A 3KLIA 1L5UA 5JUMA 2N4CA 4KPYA 4OL8A 4OZJA 4I7FA 3CC7S 2UP1A 2F9JA 3WBZA 1BD6A 5L38A 4O3RA 4Y2AA 3MM9B 2D74B 5BYRA 3H5XA 4ES1A 3I87A 2FHMA 2HHTA 5L9NA 3J7Z5 3PZPA 4WFAQ 3TRGA 4MYTA 4RBTA 1HA1A 3HI9A 2CQ0A 3CD0A 3TOQA 2CVIA 2FLPA 5D8HB 1JLGB 3PKYA 3TVKA 2Z4PA 4WZQA 2F4VF 2B4PA 2MJNA 4FS2A 1H6KX 1KFSA 2M52A 4OV1A 3NMRA 4TLQA 1LFPA 3JSYA 2K2PA 2MGZB 2MKHA 2JRSA 1QSYA 4DV4F 2OIHA 2FGCA 2G9OA 4C11A 4ZOSA 1V9OA 3J81Y 1QLNA 5F8GA 3VAKA 4C8OA 4Y2KA 3HDSA 2XMJA 4U6PA 3KK3B 4ECVA 5KFEA 4DBQA 2BANB 4ECUA 1URRA 3QGHA 4O0IA 2E9ZA 4BWMA 1X5OA 1SUQA 5C24B 3KLFB 4LFBF 2DNPA 1MNEA 5F9NA 2OMOA 2Z0GA 4XO0A 2CQCA 2XS5A 1HYSA 2FJDB 4KBIA 3DLKA 1MU2A 4DHVA 4AXJA 2RQ4A 2V9WA 4Q44A 5HI7A 3PO5A 1GQEA 4NXNF 3KMQA 2RDIA 5M2RA 2BJEA 3HFKA 3M2VB 4CO0A 4B9TA 1P6TA 3AAWB 1L3UA 4X4OA 5CYMB 2RSQA 4P2SA 4ELVA 4ZPCA 3MPVA 2PA3A 4IRCA 2MQQA 3M9NB 1UFLA 3NS5A 1QVGR 2WONA 3MMBB 2LXFA 4IQXA 5CH7B 1X9WA 4WFNQ 3DRXA 3R5AA 3DRRB 5D4PA 3BEGB 2FVRA 2HW3A 2CPXA 2UUWA 5KG4A 4W92B 2ZE2B 2RJZA 3QJPA 1ZBTA 4NA1A 4I68A 1DAXA 4V19X 2LCWA 1TUVA 1HNIA 1VQKS 4J5OA 2IRUA 2DISA 2C2RA 2C42A 2KRRA 1T94A 3ISZA 5L8RC 2DPJA 1NRKA 1OQ6A 2NYIA 5KFKA 3OVSA 1UA0A 4HDGA 4R0JA 3BS9A 2I38A 4ZP9A 3THVA 3I31A 4MMOA 4PXEA 2UVVA 5KT6A 3NAIA 1S10A 3IS9A 2J0XA 2IHR1 4B3MF 4G6VB 4Y34A 1NO8A 4A8MP 3SI8A 3HPOA 3R1LA 3LPYA 3DGPA 3E8OA 3MM8A 4AYBD 1V3RA 1U1NA 3G86A 5EWFA 2CJQA 3OSPA 4DS5A 1E6VB 4Y65A 1RT5B 5HBMA 1GTEA 1X4CA 5J1PA 4IKAA 2YH1A 3D0GE 4OI2A 3Q24A 1VQMS 3D1OA 2PD1A 4YR3A 4O3NA 1NKCA 4Z37A 2E9TA 1TL1B 4FBTA 3UR3C 2U1AA 4HLBA 4Q7AA 4PG6A 3UQSA 3HHLB 1UVJA 1HI8A 4AXIA 3OTOF 4WZMA 3BSCA 4BWJA 2DNHA 3QYYA 2DH9A 2PC6A 2BE2A 4LIRA 1GX6A 3OTEA 3CXCR 2GQCA 1Y00A 2JEGA 5E7OB 3QO9B 3V4IA 1YRTA 4KO0A 5CYJA 3LF0A 4OX9F 3DM2B 1NK4A 1X4DA 3T5KA 2CRLA 2AV5A 1F0XA 4C8YA 1FDNA 4Q43A 3LGNA 3SYZA 2IVMA 2HRYA 2M8HA 2GIRA 3GE9A 2CQHA 2RRNA 4OX6A 2UZAA 1LWEB 2B0GA 2LDIA 3VAJA 1JLQB 3K0JA 2PGCA 3THTA 1QAJA 3CIMA 1SH0A 1F60B 1NEEA 2FJXA 3H2LA 2ZH1A 3HHLD 3MI7X 5E3CA 1N32F 5A6WA 1REVB 2V8DA 1P1LA 1P8GA 4F3MA 3TAMB 1NNDA 3FEXB 4N5SA 2DNOA 2VASA 2BUNA 3WZ0A 4K4VA 1VGYA 1GXLA 3PXGa 3RB6A 3NL0A 2O67A 1HQEB 4DV5F 4RNFA 3ISNC 5IXUA 3M6UA 4H4OB 1MWZA 5G0RA 3PIPQ 1T03B 1YBAA 2UXDF 5HLFB 4NMLA 5KFWA 4ID8A 2ZHBA 2UXBF 4RW7A 3AQPA 4IDKB 4MKAA 4JV2A 3MEGA 3R27A 1R7IA 2B4UA 2E5IA 2RQKA 4FXVA 3HVRA 1MMDA 2DHXA 2QLXA 4L3NA 4CCHA 3CMAS 1X0FA 2LVWA 2OPQB 3MUTP 1NK0A 2KN4A 5F8HA 5F8MA 2EW9A 2COLA 3DDKA 1XR7A 3KLEA 1S6QA 2QA4S 1WF1A 4J9LA 3WC0A 4NLWA 2MZ1A 1M5OC 3CCVS 2J6UA 2I0XA 2R9LA 2KU7A 5KFZA 2E5HA 1D8YA 1HNZF 3HX9A 5DDQC 4QZVB 4RNNA 3H5SA 3CD6S 3MM6B 4AUKA 3NNHA 4UUXA 2RH3A 4LSLA 2VG5B 2R2TA 1Z2LA 2W9BA 2DNMA 3UDLA 1I1GA 3F41A 3RTVA 1RISA 1RTJB 1SIWB 3ULHA 2JLGA 2DR8A 2KXNB 3LWMA 4ECTA 5DO2A 1NHUA 1JLAA 4Y2IA 4M94A 1NH8A 1RP5A 3VALA 2HQIA 2VZ9A 1XMQF 4XDDA 3WX4A 3JSMB 3VQSA 4A8XA 3D0IE 4A8KA 2OP5A 1JJHA 3PNIA 1XR5A 2DNZA 2RF2B 2DGWA 1RTIA 3NNCA 1EP4B 1TKZB 4HKQA 3CD5A 4K4UA 5CQGA 1HWUA 1S1XA 4K2XA 5F41A 1IXKA 4TKTA 2FVCA 1ZM4A 5K14B 1ZAVA 3MFHA 2J8AA 1MROB 3EGNA 1J5OB 2YKNA 3DC2A 2KM8B 3DLEA 1KHWA 4ES3A 3CULA 1PO6A 2HVIA 5CA5A 2IAJA 4JI1F 1F9FA 3VAIA 2AX1A 5I42B 2UVWA 4B3OA 4QYZJ 2GV1A 2OPPA 4QIWD 2QFJA 2R8IA 3CCRS 5KFUA 3OL9A 1RJJA 4ZVFA 4F26A 1IQTA 5D4NA 1LWCA 4FNHA 4PXBA 4QPTA 1Q8IA 2IRYA 2VQEF 1N4LA 2CFXA 2FLOA 5LMNF 3SSRA 1T8EA 4CH0S 1HBOA 3NNAA 1GH8A 1MSWD 2WB4A 1SJ3P 1VS3A 3HF5A 3OFFA 2E9RX 1O51A 5T14A 1VI7A 3OV7A 2HHPA 4FF3A 4URSA 2XY5A 5A0YA 5I3UA 4HEA9 2YKMA 5LL6d 2KG0A 2FHJD 4NLXA 4ZCLA 2J0SD 4GKJF 2M3DA 2OTLS 3KNGA 3MEDB 4EWTA 2VC1A 2EG2A 2DGSA 2MJUA 1QSLA 4I56A 1SKWA 3FSYA 1FTCA 2PI5A 3BREA 2WBMA 4YB1P 1TK8A 3E2EA 3RRGA 1B64A 2R7WA 2VKZG 3MM7B 2O5DA 4QWEA 3MM5B 3G8QA 1QE1A 5F3ZA 4HI2A 1C1BA 1N52B 2KDOA 2I5JA 2XSJA 3LGMA 4I0WA 2MB0B 1OWXA 2KG1A 2RS2A 3HHNB 3N6LA 3TA0A 3VAMA 4DL2A 3Q8SB 1QUPA 1D9FA 4F2SA 2XO7A 1X5SA 1JLCB 2VBZA 4WU3A 5C25A 1TFWA 2HHWA 4DSJA 1S0VA 3DCAA 2AGOA 2QT7A 4OJ3A 2VG7B 4D3GA 3I4PA 1R6YA 4FVCA 4R5PA 4WE1B 4ICLB 1Y5IB 2OKQA 4ETXA 2J76E 2YX4A 5B09A 4IRKA 1F5CA 2FC9A 5LSOA 4IUFA 5KG0A 2MSTA 5KG3A 2A2CA 2J0QD 1U6BA 5KG5A 3M30B 2XWYA 3LAKA 1LW2A 4YDXA 2MKIA 2FDNA 1JLEA 4YHHF 3IWNC 4C4WA 1VOMA 2GHVC 4EO6A 2HHQA 2V8GA 3CCJS 2XI3A 3JTNA 2IM3A 1Z4UA 4DEZA 2ZITA 1LOUA 2CPJA 2XMTA 3ITHB 4E98A 4UQGA 5D3GA 5HMZA 3ZC4A 4RW8A 4IFYA 4I2PA 4LMZA 4QJVA 2IM2A 3M2RB 3N9UC 4NLPA 5GVQA 3EGZA 4PQUA 4RW6A 2RNEA 3CCTA 4RUHA 4YB7A 4XPEA 2KI2A 5D4LA 1YVFA 1G7CB 1FCAA 1I94F 3E01B 1DURA 3CIZA 2H9ZA 2IYIA 4OZ0A 2V4QA 2NPIA 3SFUA 3IR6B 2W4DA 4LSNB 3EZUA 2RILA 4PPZA 1TL3A 1V3SA 1J2VA 2YNGA 3VTIA 2ADCA