1SJ4P

Crystal structure of a c75u mutant hepatitis delta virus ribozyme precursor, in cu2+ solution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
95
structure length
95
Chain Sequence
PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation/rna
molecule keywords precursor form of the Hepatitis Delta virus ribozyme
publication title A Conformational Switch controls hepatitis delta virus ribozyme catalysis
pubmed doi rcsb
source organism Hepatitis delta virus
total genus 22
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sj4P00
5IQQA 4F25A 3NS6A 2FC9A 2YH0A 5IFMA 4WCEQ 3DXBA 2D3OR 1VC0A 2DHGA 4TU8A 3CCJS 1JJ2R 1BY9A 2KU7A 2CQHA 3UD3P 1PGZA 2DNZA 2LEAA 2CPHA 2HGMA 3FEYB 2DNMA 2RQCA 2E5IA 3RW7A 1VQKS 3VAMA 1VBYA 1VBXA 1YJWS 2MKCA 1S79A 3VAJA 3EGNA 1Q86T 5DDOC 5GAGU 3CC2S 5CA5A 1WG5A 3HHNB 5GAHU 2DNYA 3CCRS 5GMKa 1X0FA 5D77A 2X1BA 1HA1A 1X4AA 1S72S 3ZZYA 3CCLS 2CPFA 3CD6S 3THTA 3BS9A 1PO6A 2M8HA 2G4BA 1WHYA 2E5JA 2M88A 2KT5A 5ITHA 1WHXA 3ULHA 2ZJQQ 2MZ1A 2X1AA 3P6YC 4FXVA 3U1MA 3VAFA 2G1DA 2HYIB 1VQMS 2DNKA 3VALA 5CXTA 2OJ3A 1OO0B 1WF1A 2DNOA 3N9UC 5LJ5Y 2MQMA 1JJHA 2DB1A 3TP2A 2MB0B 4F26A 5DDRC 3CF5Q 1WHVA 2LEBA 2OIHA 2ZJRQ 3NNHA 2M70A 2E44A 1U1OA 3NMRA 2M52A 2DNQA 3UWTA 2XS5A 3S7RA 3CMES 3UD4P 2SXLA 2DO4A 1OIAA 4EGLA 2VOOA 1U2FA 2OSQA 2ADCA 2JVOA 1U1NA 5JVGQ 2CQCA 1X4CA 2MJUA 3MXHP 3SDEA 3G4SS 1X5PA 2RS2A 2RRBA 2DGXA 1M5VC 1WWHA 4TU9A 3PIPQ 4IOCQ 2DNGA 1ZZFA 2DGOA 2HZCA 2VODA 3MUTP 1SJ4P 2F3JA 4WF9Q 3CULA 4Z2XA 1VQPS 1VC6A 1KQSR 5IM0A 2YTCA 2YH1A 3CCMS 3SXLA 2AD9A 1VC5A 1VQ6S 4Y00A 2LA4A 1A7GE 3EX7B 5JVHQ 3R27A 4M5DB 2CQ4A 1X4HA 1N54B 2RS8A 1KOHA 1L3KA 3R1LA 4CQ1A 1U1KA 2DISA 2MKKA 4C0OC 2DNNA 3UE2A 1WTBA 1NJIT 1A9NB 1DHMA 2MJNA 3FEXB 5BJRA 1OWXA 5GVQA 4W90B 1P1TA 3J7YU 1HL6A 2N3LA 3G96A 2DIVA 5D78A 1FNXH 1H2VZ 2DGUA 2LYVA 3DLLQ 4LMZA 3BEGB 5DETA 3US5A 5CYJA 2VOPA 2LECA 2AYEA 3NS5A 4BS2A 1WG4A 2CPDA 3CMAS 2XS7A 2CPXA 2MZRA 1U1PA 2DHAA 4QU6A 2O3DA 4WFBQ 2KRBA 2PEHA 1H2TZ 3J7ZT 1X4DA 4YUDA 2RQ4A 1UW4A 3CCSS 4IO9Q 1U1RA 1VBZA 2QFJA 1NO8A 2DH8A 2ERRA 3CCQS 2EVZA 1ZZNA 3RW6A 2KRRA 2MZJA 1FO1A 5DM6Q 2I2YA 2DNHA 1WG1A 1URNA 1VQLS 3VF0B 3CC7S 2KG0A 2U2FA 1YHQS 2MY8A 1DZ5A 3S8SA 2MYFA 1VQ9S 5EN1A 1YITS 1X4BA 3CTRA 1M1KT 2MY7A 1HD0A 2MSSA 1K8AT 4FXWA 5LSOA 2BOPA 3MUMP 1R8PA 3S6EA 2RRAA 2HGNA 4TU7A 1N52B 2U1AA 1H2UX 1F9FA 5DDPC 3MUVP 1DRZA 3NNAA 1KC8T 1X4GA 2ZJPQ 3MDFA 1M5PC 2AYMA 2KXFA 3B4DA 2N82B 2M0GB 1HD1A 2B0GA 2VONA 2KFYA 2YWKA 1UFWA 4QU7A 4CH1A 2DNRA 2X1FA 2MSTA 3IRWP 2V94A 1YJNS 4ERDA 1YTYA 3PIOQ 2LCWA 1RK8A 2J76E 2MKSA 2OTLS 1JMTA 2DK2A 2RUGA 4YOEA 1K73T 2KH9A 1U1MA 2YKAA 3OW2R 3L3CA 3THPA 4WIIA 4CH0S 1SXLA 3BO4A 2CQDA 2CQ2A 2DH7A 2LMIA 4LJMA 1SJ3P 2XB2D 1ZH5A 2MMYA 2X1GA 2J8AA 5GAEU 2MKIA 2LKZA 2RVJA 1FJCA 3Q2TC 2MGZB 1U6FA 1WEZA 2JRSA 1SJQA 5MLCV 5LJ3Y 2CPIA 2HGLA 2MZTA 4V19X 3G9CA 2AYBA 1D9AA 2A3JA 1FJ7A 1Q81T 4OZ1A 1U6BA 1YIJS 2GO9A 1KOOA 3MI7X 2DGWA 3B4MA 4WFAQ 1WEYA 1YJ9S 2JWNA 4U67Q 1FXLA 1N88A 2UP1A 2MKJA 4PR6A 3JB9k 3CC4S 4IUFA 3G71S 5LXYA 2CQGA 3G8SA 1VQ5S 2L41A 3LPYA 1QM9A 1M90T 2QEXS 2KVIA 2GHPA 3VAIA 2KXNB 2F9JA 3ZZZA 2DO0A 3P49B 2OSRA 2LA6A 4WKRA 1XN9A 4P6QA 5DM7Q 1SJRA 1VQ7S 3HI9A 3MD3A 3VAKA 1FHTA 2D9OA 5HO4A 2MPUA 1CVJA 1O0PA 3BO2A 3UCUP 3CCVS 2XSFA 2KYXA 4W92B 4WFNQ 2CQ3A 2L9WA 4CIOA 3U1LA 1OPIA 1FT8A 4ZKAA 1FJEB 2J0SD 5GADU 2LQ5A 2FHOB 2L08A 1Q7YT 3G6ES 4RU2A 2J0QD 1W2BR 2E5HA 2MXYA 2K3KA 4PRFA 2HVZA 2N3OA 2XNRA 3EGZA 2F9DA 1M5KC 4A8XA 2FPHX 2DH9A 2Q79A 2QA4S 4QQBA 2KM8B 3I55S 4F02A 3VAHA 1WEXA 1KD1T 2DGQA 1H6KX 2JX2A 3IWNC 2DITA 1JJ4A 2MQOA 2KM8C 2XNQA 2N7CA 2JVRA 4TLQA 5LSLA 3V4MA 1YI2S 2DHSA 1B7FA 3S01A 2NZ4A 2KXHA 2ADBA 3TO8A 2M7SA 3UCZP 3P3DA 2FC8A 2D9PA 1SJFA 1D8ZA 2DHXA 4PKDB 2CQ0A 3VAGA 2DGTA 4J5OA 2XS2A 4YB1P 3H2VE 2K8GA 2KHCA 1G2EA 2LXIA 2NLWA 3P5TL 2RT3A 1UP1A 2CQ1A 3MD1A 2MZQA 1NU4A 1VQ4S 2MGZA 3TYTA 3CCES 2WBRA 5HL7Q 1RKJA 1QVFR 2MHNA 3MURP 2CPYA 4ED5A 2G0CA 2CPZA 3CXCR 5LXRA 1N8RT 1AUDA 2CPJA 1U1QA 2CJKA 5DDQC 3I56S 4C4WA 2MQNA 1X4FA 2E5GA 1Q82T 2M2BA 4UY8T 1WI8A 1U1LA 2CQIA 1P27B 1IQTA 2M9KA 3MOJB 2KN4A 1X4EA 1X5OA 1R8HA 3SMZA 2MQQA 4IOAQ 2DGSA 2MQLA 3R1HA 2M8DB 3Q2SC 2MZSA 1WF2A 1K9MT 2KG1A 2I38A 3G8TA 2DNLA 1VQ8S 2KI2A 3SDEB 2DGVA 1VQNS 2RNEA 1M5OC 2M4MA 5FJ4A 2EK1A 1WHWA 1DBDA 2EK6A 1WI6A 3BO3A 3CPWR 3K0JA 2LXUA 3CCUS 1QVGR 3NNCA 1WELA 3D2WA 4C7QA 4QPTA 2CQBA 2CPEA 4UQTA 1YWXA 5IM0B 2MQPA 2CQPA 2DIUA 2MKHA 4LIRA 2RU3A 1WF0A 2PE8A 4OZ0A 5H1SV 4Y0FA 2OTJS 2DNPA 3LQVA 1VQOS 2AYGA 1X5TA 1X5SA 2BZ2A 3CUNA 2FY1A 1UAWA 3UCGA 3H2UB
chains in the Genus database with same CATH superfamily
4A47A 5IQQA 2FJDB 4IFVB 4NLUA 2UVWA 5KFZA 3BKTA 3UD3P 4OMFG 2RDJA 1GAOA 2FB0A 3VAMA 2KVQE 5ETRA 4C9DA 4YS2A 3UN3A 4P73A 3DLEB 3TA0A 4QWAA 2ZZMA 5I3UA 4IFYB 5C24B 2G0JA 2AKWB 3HHDA 3HD1A 4QWDA 5RUBA 4B02A 3BB5A 5EX0A 1CQMA 1S9GB 4NXMF 4ZPAA 2DNOA 4DX8H 2F4VF 4YN3B 5KFAA 3ILLA 1S0OA 1UCNA 4KJIA 1WHVA 2M70A 2Y8YA 1U1OA 1HBNB 2XS5A 4U7UD 1DFDA 1BHNA 2VQEJ 2DO4A 4H4KA 2C42A 2N7YA 2JVOA 3HHKA 2EKNA 2VBYA 4Q8FA 1KQGB 3T5HA 2ZBRA 1JKHA 4A8SA 3ZO7A 4DR5J 3DGPA 2WRMA 4RPFA 3T5JA 2HQ3A 1KQSR 3HX9A 4USIA 3CJRA 2AD9A 3KHRA 1JKHB 3CJ2A 4CT8A 4DR4J 3J81j 5KTQA 4CQ1A 2MKKA 4C0OC 1IM6A 4OYXA 5GVQA 4BC7A 3A12A 4RUHA 3M9NB 3P96A 3V6KA 2C2OB 4ALZA 5DO2A 3ZZUA 4AL5A 4USWA 3PO4A 2DHAA 4TY8B 3DI6A 4C3KA 5FD1A 3MEEA 1HHQA 1C0TA 2ERRA 3HXMA 3MCSA 1FO1A 4X66J 3DI6B 3PJ9A 3QWPA 3MEEB 3JSBA 5ETTA 4TVAB 3MECB 3NBPA 4DL4A 3F44A 4C0HA 2W2NP 1TKXA 3QT5A 5A2QU 1TK5A 2MY7A 2ATLA 4OFZA 3R5CA 3DOMA 3M8YA 4QIVA 3MUMP 2RRAA 2Z57B 4AQYJ 3D1QA 1GTHA 1REGX 3PYEA 3IXQA 2XMTA 1DTTA 3NY0A 5KAKA 3DOMB 1UFWA 1LKZA 3MPUB 2ZKUA 4J37A 4M5KA 2LCWA 1LWXA 3VZHA 1NZAA 3UDLA 2R8HA 1FESA 3TJ9A 1GQEA 2F40A 4M5DA 4N56A 2VFTA 2DH7A 3UVJB 2J8AA 2HFUA 5KFHA 4PYAA 3OFEA 2KO1A 3CCZA 4MYUA 1PYOB 3BREA 2C28A 2KDOA 4Y6IA 1NM2A 4DQRA 1FEEA 3MR2A 3MCNA 3W8PA 2ZZNA 4ED0A 1YIJS 2DGWA 1YJ9S 4U67Q 1QLNA 3GFHA 2YY3A 1M90T 2GHPA 3M9OB 2KXNB 3OFFA 1S7IA 1TV6B 2UV8G 2FHJD 3MEDB 1SC3B 3MEKA 4ZLNA 1KHVA 1ZM2A 3AY0A 2XSFA 2IRXA 4QR0A 4NXMJ 3BGOP 2YKQA 4ZPWR 2F4VJ 4TKTA 3U1LA 4BWJA 3THVA 3I31A 5IZHA 2FHOB 3BYRA 4RWWA 2FPHX 4CLPA 2DGQA 4Q0BA 2XYGB 2H1YA 2AJ4A 2G9OA 3T9ZA 3EVMA 3AT1B 3TO8A 2DHXA 5IT9Y 1AXQA 3W2WA 1NKEA 3H2VE 5DJBA 4FS2A 4NCBA 5BYRA 4F4XA 1F0XA 5KFDA 3MM8B 2IRYA 2BJ1A 3QWUA 3W2WB 2ZBQA 2C3PA 2VDHA 4ES3A 4ANCA 2AX1A 1YQHA 2CPJA 1U4BA 1VYAA 1BWVA 3D1HA 1SKRA 4C8ZA 2CQIA 4ZCKA 4J9NA 4JV1A 5G0RB 2OLWA 5DLFA 3FQLA 3EYZA 3TVZA 2KG1A 3G8TA 3OL7A 2M4MA 3D6FB 2VFRA 3W60A 3K0JA 2CJYB 3NNCA 4FKXA 4EMDA 1MN7A 3M32B 2CQBA 1R6YA 3FC9A 4ECWA 3OV7A 4C8KA 4RKUC 2YWEA 2OEJA 3C14A 3H2UB 3BR8A 4ZLLA 2YH0A 2JLEA 1VC0A 3O3LA 1BY9A 2P6TA 1I6JA 2FYXA 4JI4F 2AQ4A 3ONQA 2AZ1A 2XTJP 1H7WA 1QD1A 1HW8A 3DRRA 5LSRA 3CCLS 4O4GA 4J9PA 5D4OA 2E5JA 1VDHA 2KT5A 3ULHA 4HH1A 3CD0A 2BRLA 4HYKA 2ZWPA 3KLGB 3OHBA 4FZVA 4O4GB 2ZHAA 5CXTA 1F60B 3NAHA 4DF4A 3BGUA 4ZPVR 1S4EA 2XGPA 1JJHA 2EC0A 2NQPA 4ECXA 1TK0A 2BEFA 3V6DB 1S1UB 2DNQA 2KZZA 5K8MA 2VPYB 2OPRA 3MM9B 4EGLA 5ETQA 3DDNA 3O6QA 1AZSB 1B0VA 1VRTA 3QNWB 1S0NA 3W3SA 2OPRB 4LT6A 4ETXA 3QFHA 2A2DA 1VRTB 2LA4A 3R27A 3ZZTA 4IG0A 1RAIB 2ZNYA 4CLWA 4NWBA 3EDQB 3FEXB 4LBIA 1OWXA 4W90B 2B9XA 1R6VA 1JXEA 3O5TB 2D3ZA 4IG0B 3EJMA 5D78A 3J80Y 4TQRA 1HW9A 4D3GA 2CFXA 8RUCA 4HTJA 1HBMB 1RI7A 4OZ2A 1PJ6A 3PYFA 4LSNA 1JWWA 2GQCA 2KRBA 4JYAF 2K06A 4U96A 5DG9A 4F3MA 2QFJA 4KO0B 2FLLA 4DI6A 2KRRA 4QWEA 4LSNB 3MAAA 1MNEA 4AYBD 1VK8A 3ENAA 1D09B 1QSLA 4RL1A 1U2RA 2B4OA 3CJ8A 1NH8A 5HK4A 1RTJA 3MAAB 2HGNA 3TX0A 4IH7A 1S0VA 4OQJA 1FWPA 2DR9A 3R7BB 1QAJA 2BJ3A 1YX2A 3WIUA 3GV8B 4DL7A 3KJVA 5JMNA 3CCTA 3DKDA 1K73T 3LGHA 3OW2R 1Q78A 4WBFA 2Y3YA 2YNHA 4URQU 3OD2A 3R8YA 1WC5A 1FWKA 4P2XA 3BSNA 3HVRA 2R2UA 1LNQA 4JI4J 3PHTA 2VBXA 1UFKA 1RYSA 1NKBA 1FXLA 5GMDA 3KK2B 4XIUA 5LXYA 4X4TA 3NMAA 4RBTA 1QM9A 2DD8S 2IM3A 1X0PA 5E0OA 1U48A 3OFGA 1WTFA 2VU5A 4OZLA 1SJRA 3HI9A 5IV4A 1T9YA 2JC0A 3DLKB 4FVCA 2KYXA 4WFNQ 4CLYA 2L9WA 5D8HB 3FCHA 4DS5A 2ZUGA 2QE5A 4LF9F 4PRFA 4K2XA 3KJFB 4I69A 2WVEA 4ZPBA 5DZ7A 2DH9A 4QQBA 3KK1B 1RAAB 4XDDA 4MMOA 3FBCA 2QZ8A 3FJ2A 1FKPA 4QCLA 3DRSA 2KXHA 3CD5A 2FZCB 1PYTA 2V67A 3UCZP 4QBUA 1JNRB 4MK7A 1Q8IA 4PPZA 4EYHB 2E7VA 3PW4A 4HLBA 3QZ7A 2LXIA 2UXCF 5KFEA 3SV3A 2P2CB 1FKPB 2V2VA 2R9LA 2XYHB 3GZ7A 3QJJA 3GE9A 3PRBA 3EPGA 3I56S 3IGNA 3FK4A 2GZOA 2BABA 1RWKB 4B9UA 4N8NA 2HRYA 1IBKF 4JYAJ 1DTQB 1N36F 1ZA2B 2HS3A 2KI2A 3G8QA 1LWFB 3JSYA 1Q8LA 1DBDA 4ZVUB 4N5SA 3BJYA 3DRPA 1RE1B 4F0MA 4QPTA 4IRKA 3SYZA 2B7CB 2AJ0A 1WKJA 1S1WA 2BA9A 1JK9B 2DIUA 3GYNA 3MM7A 3N28A 5H1SV 1HNIB 2DNPA 3P5BP 3IA0A 4RW9A 3UPFA 3UCGA 5B0EA 3OL9A 3DXBA 3TWZA 2NXNA 2KU7A 1PGZA 2DNZA 2K3IA 3L95X 4RW9B 4WYLA 2HZVA 1S79A 4DUYF 4ZITA 4JV5F 1WORA 5F0UA 1GNKA 3PHEA 2AMCB 5KG7A 3VR1A 5E3AA 1FRKA 4M5HA 2FDNA 3J7Z5 2FLOA 5T14A 1FNMA 2VPWB 4OI3A 4ZN3A 1IKVA 1SQFA 4USTA 2DEIA 1RBLA 3VHQA 3Q86A 8ATCB 5MAOA 2MQMA 3PRDA 5H9EJ 3M9MB 3Q22A 1CS4A 3IBCB 3GIMA 3ILIA 3NNHA 3KK3A 3GILA 1NPRA 2YKPA 2Y9HA 1IKVB 3V81B 3DOLA 3TAQA 2VOOA 1RCXB 4IYQA 3HCXA 1CS4B 1DLOA 2NUHA 4PG7A 1AW0A 4X62F 5FLXU 4DL2A 4RW6B 4NLRA 3QGPA 2C22A 2ZH3A 1KQFB 4IOCQ 3EZ5A 3BH6B 1XQIA 3R2CJ 3I9V9 1UJ5A 4JOUA 1QDUB 4LF9J 3OVAA 1BWEA 2DVIA 2CJBA 2DNNA 1WTBA 1A9NB 1UVNA 2HRTA 3OR1A 1SUQA 3GB0A 3OXGA 3DLLQ 1MROB 1RAFB 2AGOA 1FNOA 3ICLA 3OR1B 2W7AA 3BM7A 2UXCJ 5AE3A 1P9YA 1RBAA 2FVPA 4KT0C 1S1XA 1VQYA 3B8HA 3BKUA 3QT7A 2HFZA 3HPOA 4RUBA 1P6TA 3ILJA 2W8LA 1IBKJ 4OZ3A 3MUVP 3NNAA 3DYAA 1YBUA 1N36J 4O3NA 2DNRA 4NYZA 1NDCA 1YJNS 2RUSA 5IV3A 3CJ0A 1FXDA 3DYAB 3H90A 5HMZA 4J90A 3AAWB 3OVBA 3D3CJ 4KY3A 2HNYA 2BUNA 1SC6A 3Q2TC 1C4AA 4A8WA 1WJ9A 3MCMA 4YB7A 3MR6A 2I5JB 3QGGA 1Q81T 4OX9F 3TR5A 3EE3A 3UDVA 4DUYJ 1PILA 4JV5J 3JB9k 4K0KF 2AEFA 2WZ1A 4CO5A 4RBVA 4ZCMA 2YVSA 1EHWA 2YNIA 2QN6B 3CNQP 1WUUA 4ZVPB 4Z7CA 1OY9A 2OPQA 4YQWA 2CG8A 2JLGA 4QYZJ 4M63A 1JLEB 4TYBA 5GAHI 4B9NA 3EDRB 3SBMA 3PTWA 4BWMA 2OPQB 5G4DA 3H20A 4AT1B 4CM0A 3PR4A 5ETSA 2DITA 4OYZA 2D41A 2OP5A 2NXCA 4X62J 2HQIA 2NZ4A 4OIXA 1NCLA 4PKDB 5KT6A 4FYVB 2XZWA 4ZP8A 3D6HB 4WP9A 2JFKA 4ZCLA 2QL9B 4EEYA 5AXNA 2G13A 1HNZF 3OSNA 3TYTA 3GYGA 5KFQA 2DEJA 3UFCX 4DV0F 3HHLA 1EIYB 1S4FA 4ZLPA 1YSJA 3MHYA 2BJ8A 2XCAA 1RTZA 4M1KA 3ZZPA 1KFSA 3AA8A 1T0TV 4CLLA 4C3MA 3DLJA 3HHLB 2VG7B 3KG0A 5KFCA 5J1EA 1WF2A 3BDPA 4Y2KA 4PQAA 3AOAA 5D3GA 3CWJA 1WDTA 1QE1B 2LXUA 3IP0A 4C7QA 4B9TA 4ED7A 3RR8A 4ITSA 3ZZ0A 1HQUA 4P10A 1NJXA 2RU3A 2C3MA 3CJKA 4G3IA 4OHXA 4NCGA 3RUBL 1Z2LA 1NDLA 3BKFA 2Q43A 2W4CA 1HQUB 3NCRA 3PJWA 1S6QA 5KG3A 1TTHB 2DNMA 3BF4A 1S59A 2YNGA 1ELOA 3CJKB 5I3QA 1EB0A 3Q24A 2FZKB 2FUG9 5ETNA 5BYSA 4DN0A 3W9JA 1X4AA 1S6QB 1VRUB 2YNGB 2VC1A 2AEJA 4QIEA 4NLQA 4L76A 1JLAA 3I6PA 4DOZA 4ZIVA 2DYAA 3TP2A 2CADA 2F5GA 1KVIA 2ZJRQ 2OMOA 5IT0A 2VASA 4OX9J 1H7XA 2SXLA 2R7VA 1OSDA 1IR2A 3V2UC 3CO0P 4K0KJ 3T6BA 1RA7A 1Q5YA 2MJUA 1TELA 4BBYA 3G4SS 4HL9A 3L7UA 4DG1A 1S5ZA 2B9EA 2BBEA 2HZCA 2CJ9A 3CULA 1VLYA 1UFLA 2J0WA 2OHDA 1N54B 4MFBA 2VJVA 3QT8A 2MEWA 1RTDA 1RT6B 1RAHB 1DHMA 1MU2A 1E6VB 1U0SA 1HL6A 4R5PA 2N3LA 3G96A 5KG1A 4MFBB 3NAIA 3BEGB 5CYJA 1U09A 4YHHF 4X4RA 2AYEA 1FTCA 1MU2B 4OYPA 2PMHA 5E3CA 4HACA 3JQMA 3NGRA 3AD7C 1VBZA 2DH8A 1BMQB 4GO5X 1DQ9A 3PW2A 1YGYA 1HNZJ 3M2VB 1SQEA 1CJVA 4F2RA 4DV0J 2MYFA 3DOKA 2LFVA 2IMOA 4WFZA 2B3TB 4C0BA 2MDAA 4N41A 1M5SA 3CJ3A 2EFQA 1N32F 3D28A 1HPZB 2LVWA 2ZUAA 3QIPA 2PIIA 3DOKB 3M8WA 2HVEA 4M95A 4ED2A 3H2LA 3OL8A 2VONA 1V3RA 3DFEA 2MSTA 5BR8F 3IRWP 2VKRA 5I42A 2LQ8A 3TI0A 4ATNA 3G82A 3T1HF 4AFFA 3MR3A 5F9LA 2YKAA 1RAOA 3GJQB 3RAQA 2VF3A 2CQ2A 1Q8KA 2E29A 1SJ1A 1LQ9A 4TYAA 3ITHB 5A0YA 1S77D 4L75A 4FXDA 4KFBA 2JRSA 3ADAC 5DG8A 1EP4A 3QSIA 4ZA1A 2V2KA 2OEKA 3QJLA 4IRCA 3G9CA 2ZZTA 4GKKF 5KFPA 4RNHA 3D9BA 1GX6A 2UP1A 2VICA 2Z2ZA 5D0EA 4PXEA 7AT1B 1SKWA 3G8SA 3FRZA 1IR1A 2FVSA 4CI0B 3E3XA 1WKKA 1VQ7S 1FDBA 4OI0A 5L38A 3A8IA 4J91A 3HVTA 5HANA 4ZPCA 2DJWA 3H40A 3RBXA 3W8GA 2R7OA 4OI6A 5E41A 3PZPA 3SFGA 2KYZA 2Q79A 3WIVA 1D9DA 2BYCA 3IFEA 3PW5A 3MGJA 5DZ6A 3W65A 1GXTA 3P3DA 2GO8A 3VZIA 3VAGA 2OPSA 3PEHA 5HQMA 4ZP9A 3ZTQA 2G1HA 1R89A 5HL7Q 4NL5A 4C2MA 3T6JA 4ED5A 2W9BA 1U1QA 4O4RA 1CJTA 2IA0A 2ZM6F 2E5LF 1YG0A 1HI8A 4YHHJ 4YEAA 4JI5F 4TNOA 4NRUA 3QSYB 1I5OB 3HHLC 4K4YA 1CJTB 5EHHA 4G1QA 3RYLA 3GR0A 4DX7A 1WI6A 4CNZA 3CCUS 1FX2A 3ENQA 4C8LA 2RU9A 5KT2A 1C1CA 3QQCD 2E9ZA 3RB3A 3JQKA 4MAKA 4Y0FA 3R7NB 1UAWA 1N32J 9RUBA 2OD6A 3NS6A 2FC9A 4WXOA 2VG5A 2VA3A 1KBRA 1F3FA 2LEAA 2E5IA 4JI6F 1CEZA 4K5SA 1Q1KA 1YJWS 1HHSA 5BR8J 1XC9A 4UUWA 4WP8A 3HHNB 2VG5B 1X0FA 2A6MA 4NE9C 3T1HJ 4JI8F 4WIQA 3CD6S 1S99A 2M8HA 1L5UA 1J5OA 2XSJA 5F8NA 3KTQA 1LWEB 1JIHA 1ULRA 1J5OB 2MB0B 4FS1A 2DHHA 2M52A 4GKKJ 2GQ2A 1VJWA 3AD8C 4IO1A 3LW5C 2UUCF 2V8PA 4ECRA 2OMLA 1K1QA 1FI4A 2C1EB 3LP0A 2DNGA 2HZAA 1VQPS 1S6OA 3JAMY 2XMVA 4QPXA 1XEZA 4OV1A 3LP0B 4WK3A 2GJIA 5KFXA 4RO0A 1TAQA 2BJ7A 2H5JB 3KG4A 3HKZD 2MJNA 2P9GA 3JSMA 3JXOA 2DIVA 1RISA 2RSQA 2EXUA 5DETA 3KLFB 5GADI 2GVDB 4DL0C 4DV2F 2ZD1A 4EU0A 4DWIA 1U2CA 4C11A 3CDUA 5JUMA 3ELHA 2RAQA 3IAM9 3HJFA 2IIHA 4H4MA 3RGIA 4U7CA 4F4KA 2VA2A 3RTVA 2X3GA 2Z2LA 4ED8A 1TUGB 2MZJA 1F6TA 3SEOA 1URNA 3OQ2A 1JLQB 3ISNC 4H4MB 1DARA 1DZ5A 4ANDA 1HNXF 5EN1A 1YITS 2ZM6J 2E5LJ 5HP1A 4YB6A 4DV4F 1FDNA 4JI5J 3H5SA 3EUNA 2E1MC 2CRLA 4ZJLA 4MK8A 2B0GA 2QLBB 2P5VA 3M6UA 2V94A 2FHKA 3PYGA 1C0UA 2FVQA 3RB4A 4PQUB 3EICA 2LU2A 5B0GA 2HQFA 4PXBA 2XLJA 5A76A 4CH0S 2XMMA 3C46A 3DN9A 2IRUA 1KNZA 4F50A 2Q6CA 1AYEA 3E51A 4O3QA 5KFVA 2MGZB 1WEZA 4Y2MA 4HI2A 1OYEA 3EZOA 1S1TA 5LJ3Y 3BSOA 4GKJF 2NPIA 5E3PA 2CPIA 2HGLA 2V50A 2XLIA 4JI6J 1D9AA 5A8RA 2ZC3A 1LW2B 1FJ7A 7FD1A 1TUVA 4TXSA 2H65B 1V9OA 1HNWF 4WFAQ 2JWNA 3A3NB 3W5XA 5KFKA 2A18A 4J9QA 1OMSA 4JI8J 3IM8A 3VWSA 2DO0A 2OSRA 3EXCX 1T02A 4CO2A 1NK8A 3BSCA 3KDNA 3OBIA 1PYSB 4K7QA 4I2QB 2CQ3A 2V8VA 1NDKA 3PV8A 1OYDA 3TUJC 5HJYA 3U02A 1Q4RA 5KFTA 2XNRA 3DLBA 5T7LB 1ZM4A 3BYPA 4CO0A 2GIFA 1WSVA 5KFNA 4PWUA 3ETOA 2UUCJ 4LRDA 3UN2A 1Z2ZA 1YI2S 4I7FA 2BJ9A 2BW2A 1QSYA 2UUWA 4FYYB 4UOHA 2HNZB 2K8GA 3SIPB 3KUEA 4X4UA 3GFZA 4Y3CA 1BQNA 4I7FB 2PT0A 1U45A 1LW0B 4EBDA 4PXDA 2UZAA 2WBRA 3LGMA 2BW7A 3SQGB 5LL6d 2R7WA 3RG6A 2BOAA 1BQNB 1PC4A 3DLHA 4ZOSA 3QGHA 2C2DA 2M2BA 4UY8T 1FRLA 4DV2J 4PWWA 2K1RA 1PAUB 3HSJA 1RT1B 2RH3A 4ELTA 2DGSA 4R25A 4AD6A 5KT5A 2Z58B 3I82A 1UW9A 2UU9F 3FZBA 3KLEB 1FK9A 4FN5A 1UZHA 2ZH8A 3TZYA 4DU7A 3KLHA 3D2WA 4CZCA 1HNXJ 4A8FA 1TL3A 5IM0B 1DURA 4LIRA 2XHWA 1WF0A 4ECYA 1VQOS 3UQSA 2XO6A 4U8VA 5HQLA 2BRKA 4DV4J 5K8OA 1LOUA 2CQHA 3MCOA 1CG2A 2Z0GA 3VAJA 4KGXB 1JXVA 3LOUA 4KKOB 1OJ4A 1EZZB 2PI4A 2AU0A 3M2RB 4ZPTR 1AROP 1S49A 2Z2MA 2Z2YB 3VALA 4FDFA 1WF1A 3N9UC 2DPJA 4GKJJ 2DB1A 3Q8QB 4K4SA 1SV5B 4DPXA 3D6TB 2ASYA 4EFAC 4QIGA 1GMWA 2D7SA 3CMES 1HNWJ 3D7SB 2PFFB 1XNRF 2OSQA 2IYGA 1NJWA 1WC3A 3IWLA 1R0BG 1UPMB 5HBMA 1RTHA 1R3NA 4TU9A 1D3WA 2HW3A 1RWUA 1R8BA 5EUHA 1IXKA 1TVRA 5HBMB 1RTHB 3EX7B 1AFJA 5J1NA 4UOGA 4ICLB 3RRHA 1L3KA 2AGQA 2B9WA 4L74A 5IXUA 5BJRA 3Q8UA 2CKWA 4BC9A 1TVRB 4IOBA 4DX6A 1SKUB 3FCWA 1WC0A 3I87A 2YNFB 2VG6A 2LDYA 4OYWA 4XTTA 1KVJA 2B5JA 3CDWA 1H2TZ 2KKHA 2ZH2A 1NLKL 5HJXA 3CCSS 4MYTA 4FYWB 2BMBA 2J6TA 3NGDA 2EC2A 3CC7S 2V0NA 4LBHA 4EO6A 3BGRA 3L7OA 1ICEB 2IVMA 2XMJA 1B99A 3LP2A 3C3LA 1JXLA 1NPKA 1YJ7A 1R8PA 2Z30B 5KFRA 1XMQF 1KQKA 2IA6A 1Q53A 3BGRB 2YPZA 3HHEA 2M0GB 3LP2B 4P52A 2UU9J 2NR0A 4P7VA 4PWDA 1GT8A 2IAJA 2KFNA 1KTQA 4U6PA 3IRXB 3MMCA 3SSSA 4YOEA 2ZE2A 4LR7A 3GIIA 4YDDB 4B3TF 2VFSA 3L3CA 3HFKA 3RB0A 1Y0HA 4Z7YA 2K7JA 4CYUA 5DQIA 3MMCB 2ZE2B 1SJQA 3M8QA 1RABB 2EFOA 4IH6A 4CYUB 2ZNZA 4LF5F 1WOOA 3C6UA 1WEYA 5DS7A 1RLCL 4WKYA 3CC4S 4E2FB 2C2MB 2KVIA 2A10A 3KYLA 2BACA 1CLFA 3EZUA 2LA6A 4IRDA 3T1AA 4ZHRB 2C2RA 2W9CB 1JLBA 4OI1A 4ZVHA 3NGTA 3Q23A 2QL7B 2ZEJA 1U0HA 2MXYA 1RGVA 1JLBB 1NRKA 3WX4A 2QA4S 1XNRJ 2L48A 2JX2A 1JJ4A 2QA4G 3LAMA 1MWYA 2IM2A 4EK2A 4UZBA 1QTMA 4J5OA 1N0UA 4P71A 3TVYA 2C2KB 1TL1B 1WSRA 2XBPA 3C19A 1G7CB 1FDDA 1LEOA 2XY5A 2G2ZA 3TEHB 4QR1A 3GIKA 1BD6A 3BGLA 3VCDA 1Z1ZA 4LQ9A 4MKYA 3H42A 3LF0A 2JEJA 1Q95G 5L8RC 4O3RA 3K8VA 3BDEA 4B3SF 1GH8A 3BO3A 2HVDA 3CPWR 2OUGA 4A8MP 4M5LA 4J9VA 4JV0A 1QUPA 4F67A 4J9LA 4RW4B 4XDCA 1FRIA 3J81Y 1XMQJ 4B9SA 3FGVA 4HTIA 1T9VA 5IFMA 2DHGA 3FRYA 2QA1A 2F65A 2E66A 4OZNA 1S10A 1ITPA 5AXMA 1K0TA 4FPIA 3K2YA 4LREA 1SL1A 5CH7B 3HZEA 4B3TJ 4KC5A 2LQJA 2W01A 2M88A 3PO5A 3GLJA 1G6BA 8AT1B 4NLWA 4ECSA 2DR5A 3HT0A 3OXFA 3R5GA 5DDRC 3HSDA 2FJWA 4LF5J 4UQGA 1B3TA 2BKPA 4C3LA 5A8KA 1SQGA 3TANA 1U2FA 1YRUA 4X64F 2JC1A 5HVHA 4LFBF 5C42B 3OHAA 2RRBA 2ZITA 5A8KB 4P9SA 1FX4A 4GC7A 4EI2A 4ELVA 3VQSA 2CZ4A 2EBEA 1VHIA 1RWVB 3CCMS 1HWLA 1RHKB 3TA1A 3CIMA 3KJNB 1KOHA 3TARA 3LALA 4B9MA 4ECTA 3HP6A 2OFGX 1NJZA 1FJGF 1JLGB 4H4OA 4LMZA 4OI4A 2OEMA 3R5BA 2PMWA 3PX4A 3IR6B 3EGVA 1OQ3A 1U1PA 1HWJA 3TAMA 1YKWA 2WSFC 3T9NA 2VUGA 3LWMA 1ZAXA 1CPZA 4LQ3A 4KH1B 6FDRA 4EZ6A 2XEXA 4DEZA 3MZIA 3M05A 4FYDA 4C98A 1NK7A 3UN5A 4E98A 4FXWA 1PIEA 4WWSA 4FYXB 1KR4A 1DRZA 4NYOA 2PN6A 1YBAA 1M5PC 5CCLA 1NEEA 2UV8A 4D3HA 4FPRA 3JYTA 4LFAF 1Z4UA 2Q1LA 2Y8WA 4DFPA 4PXCA 3CCWA 3PIOQ 2WB4A 4ZDNA 4B3SJ 2J7KA 1RK8A 1SL0A 1JMTA 2V2QA 3AOCA 4HH0A 1N0VC 4U95A 2HMIA 5L9XA 3JYTB 1E6YA 1HWUA 3BO4A 1SJ3P 4LF7F 5GAEU 2HMIB 1CJKA 3OPKA 3TZZA 2E1AA 1RT5B 2MZTA 2UXDF 4A46A 2OAUA 4KR0B 2AP6A 1U6BA 1SPBP 2QMXA 3S1TA 3GU0A 4NA3A 1CJKB 2FHMA 3W7BA 3MM6B 3G71S 4I56A 2CQGA 1S9FA 2R8IA 1YJRA 2VKZG 2E9RX 3CJQA 1HMVB 4ILLA 1ZETA 3ZFVA 1BUXA 4QIWD 4I6YA 9ATCB 4DFMA 1O0PA 1XERA 2V69A 3FFIB 2J9EA 3MPWA 1FJEB 4KHMA 5F8GA 1OQ6A 2QYGA 2HRUA 3UD5A 3UO0A 2OPPA 2AGPA 3CSKA 4X64J 1NUEA 4RU9A 3VAHA 5F41A 1CSJA 2XNQA 3J7AN 3GSDA 1VQSA 2HHQA 5E7OB 3PVXA 4LFBJ 1UPPA 4QZVB 2FVRA 3R2DJ 1Y3JA 2KHCA 5I3UB 4CH7A 2RT3A 2IBKA 1Y5LB 3GG1A 5F3ZA 1YZ7A 4URGA 4A8OA 2GC8A 1RJJA 4O44A 1KLNA 5ETVA 2CVEA 3CXCR 5DDQC 1FJGJ 3IGVA 2QO3A 1Q82T 4GVBA 2HS0A 5IS2A 1WI8A 3D5MA 1O51A 1RT3A 1CC7A 3ZZOA 2P9CA 3BGFA 3D54A 5H9EK 4EYIB 4WPAA 1NMEB 4GVBB 4OJ3A 2QG9B 3R5AA 1JJCB 3MWBA 1X60A 1M5OC 1RT3B 4FF4A 5FJ4A 2EK1A 1A6LA 1WHWA 3DGPB 3C2PA 2GS8A 1WELA 2B8QA 3PW7A 4OZ0A 2R8KA 3LQVA 2AYGA 5J2NA 4EO8A 2D3OR 1JLCA 2H3EB 4I6WA 3RAXA 1ZOTA 4LFAJ 2R8JA 5J2NB 5GAGU 3CC2S 4JB8B 3E01A 1PC5A 2HHWA 3W62A 1HI1A 3CCRS 1Q7LB 2IFXA 3PCOB 5EGYA 3HMJG 2HFNA 1LV5A 4CLFA 1C0TB 3OLBA 5ITHA 3V6HA 2IC3A 1F5CA 4LF7J 1N33F 3VAFA 3RR7A 2BE2A 4F36A 4J9RA 3NBPB 4MH8A 1RT7A 2XZDB 1I3OB 1TKXB 2IC3B 2UXDJ 4IR1A 4NA2A 3C8YA 3QT6A 4C8OA 4O23A 2VQFF 4I2PA 4ZPDA 2ADCA 1NK5A 4ZN1A 4DV1J 3A3PB 1DTTB 1RT4A 2NXUA 3CJSA 4JUZA 2VODA 4WF9Q 4P2FA 1LFPA 2J7UA 2YTCA 3TJAA 2V63A 2V8DA 1RT4B 3I0RA 4M5DB 3LUYA 4ZLJA 2RS8A 4KAIA 5KFBA 4WP3A 1K47A 4O3PA 5HROA 1P1TA 2UUTA 1RAGB 1NB7A 5KG6A 3JSRA 5D15A 3IBFB 4Q2LA 4DSJA 1WG4A 1R0AA 1SI9A 4LIWA 1X4DA 4YUDA 2PO4A 4TN2A 3R6LB 3LP1A 3EPIA 5K5MA 1T95A 4EBCA 3IBWA 3AQPA 2V4JA 1WC6A 3G86A 4Y2AA 1DQAA 1YDLA 3W5YA 4BCAA 2D69A 4UOFA 2KL8A 4ILMA 3D0IE 4DV5F 2U1AA 4DXLA 4H54A 3FBFA 4AL6A 3MDFA 1YJTA 2CZ9A 3B4DA 3OXLA 4Q0BB 1M0SA 1RWOB 3VGVA 4Q43A 4O3OA 4OX8A 3G6XA 3H4DA 1HR0F 4OLOA 2YQ3A 2J76E 3Q8VA 4N76A 2B56A 4KH0B 4WU3A 1UVJA 3QATA 5CYQA 2CQDA 2MMYA 3QO9A 1FJCA 2IDLA 2HFVA 2CJXB 3GFXA 4X4NA 3M7VA 5CYQB 2HPUA 2AYBA 2E9TA 5F8MA 2ZOFA 1YLXA 2A0FB 2G2OA 1K1SA 3RBDA 2JSXA 2VD3A 3N4WA 4ED6A 1IKWA 2QEXS 5K20B 3L4BC 1RU2A 3NOGA 2V34A 4P75A 2CZVC 3V4IA 2XMUA 1KRPA 3UR0A 3K57A 2GA7A 2RMLA 3WC0A 1N33J 1T9XA 3PX6A 1IKWB 4DPTA 1U47A 4W92B 4RNNA 3IC1A 4CIOA 2KTQA 2QX0A 3V4IB 1S7HA 3AHPA 1NHVA 2R7RA 1SB6A 2F9DA 4OJGA 3I5BA 2PGCA 2RDDA 2CJAA 1RBOB 3C14B 1SVDA 1M1GA 2XZTB 4IDKA 3N0VA 1H6KX 2VQFJ 3IM9A 2BANA 4FVMA 4MIWA 4WFYA 2PEBA 3HO1A 3G87A 5ADZA 4KGKA 1Q5VA 4QWBA 3DRRB 3SCIE 1P8GA 4DJBA 4KGZB 1ZAWA 3NRBA 4LSLA 4ZVTB 1URRA 2MHNA 3A3OB 2CPYA 2G0CA 3I4HX 2XM3A 3N5FA 4C4WA 2MQNA 4LR9A 4OHZA 4DPWA 2HQCA 2KN4A 5CZVA 5SUHA 2RKIA 4IOAQ 3PJXA 2MQLA 4H4KC 3PX0A 4ZP6A 2DNLA 3J7YI 4WJBA 1VQ8S 2RKIB 2EK6A 1NPPA 3LAKA 1UA0A 5AXLA 4LUBA 1D0EA 4IR9A 1YWXA 5CABA 1F2HA 2POKA 1SIWB 1V6HA 3K89A 4NLDA 2DCUB 2W7OA 3O1LA 5BXIA 2BXJA 1TU0B 4A8QA 3U1NA 4RW7A 1XK8A 4DV5J 4YMEA 4F25A 1S6PA 2CG4A 1PBUA 3I5AA 5M2RA 2ZBIA 5LM7E 4QWCA 5ETKA 1CJUA 4EUVA 2AHOB 1NJYA 4ZP7A 4RW7B 2WONA 3EGNA 1HR0J 1S6PB 2ASLA 5EWFA 3T3FA 2JZ5A 2G2YA 1N6QA 1S72S 1CJUB 2RHQB 1IBLF 1RWPB 2FJBB 3WZ0A 2JEIA 1WHXA 5HAOA 4LF1A 5E3RA 2VH7A 2W2QP 2OJ3A 3PYDA 4F4AA 1UVKA 3J7A1 4AUKA 2HHXA 4UUXA 4ZS6A 5EDWA 2DRBA 2E44A 4USMA 1RTJB 2ROPA 2CXEA 2HHVA 2KFZA 2HIYA 4K4VA 4L73A 5JVGQ 4ZK7M 3SDEA 2JOQA 1HLWA 2JHEA 4ZJOA 3OTDA 4N8OA 2IJFA 3MUTP 5BYQA 4K8RA 1S48A 3K5OA 4DDFA 3KJVB 2D74B 4DHVA 4MTPA 3O8WA 1VQ6S 2Q66A 2CJQA 1TP7A 3MOZA 2VPZB 2UXBF 4F8RA 5FIIA 2YNHB 1M1HA 3MR7A 2ZVSA 2LYVA 1N48A 3MMAA 2F8MA 3K5NA 2CPDA 3IG1A 4UT4A 3DGVA 4WFBQ 2HIQA 1YZ6A 3NWGA 2RQ4A 1KEKA 1WNEA 3MMAB 4DR1F 1B4SA 1TFWA 3IG1B 3HVWA 2I2YA 1KP6A 3ISZA 2KG0A 2KT3A 3G2XA 2GCFA 5J1PA 1FE0A 3S8SA 3I4PA 5CZXA 5DRKA 3CTRA 4HHUA 2R7UA 1HBOA 2APOA 2ZC4A 4HDGA 4CP5A 5H9FK 3H5YA 4TU7A 2JEGA 5FLXY 3QJPA 4DS4A 2HSEB 2BDPA 4B3RF 1HBOB 1TR0A 3DHXA 4DLGA 2O66A 4RNFA 2BR0A 1RLDA 3H59A 1GMVA 7FDRA 3DRSB 2OTLS 5U47A 1EQMA 3MEGA 1YBTA 1QTNB 4K59A 2RVJA 2H51B 5AE2A 2DXEA 2E7WA 2GJ2A 2Z56B 4NASA 1PJ5A 2ACYA 2E1RA 4LF4F 4DPUA 2IVFB 4LSZB 4Q7AA 4QW8A 2QRRA 2IDEA 4LVOP 4DR3F 3FUYA 1IBLJ 1HFEL 4HHHA 4P6QA 5HLFA 1S57A 3UW1A 3VAKA 4PABA 2MPUA 3WBZA 4YR0A 3DRPB 5C2GA 2K2PA 1S1VA 1T8EA 1FT8A 1S1WB 4RU2A 3MM7B 3ENWA 4LF2A 3I5CA 3TJ8A 1MLAA 3BQ1A 1EKSA 1Y5IB 5KG0A 4OX6A 3BN4A 1S1VB 3DLGA 2KM8B 3I55S 2OELA 3IR7B 4UTGA 2AJ2A 1VBKA 2CDRB 4ECQA 2PA3A 1UEKA 3AJDA 2D9PA 5KFSA 3CDAA 3NCPA 1IVZA 2R7SA 3P5TL 2BQRA 2CQ1A 2UXBJ 2VBZA 2QMWA 3R97A 2WHOA 1RCOB 1SH0A 4Q45A 4DQIA 3MURP 4MJKA 5IT4A 2CPZA 4DUTA 2GIRA 1ZA1B 2FHJA 4DSIA 2D3UA 1SIZA 1Q0NA 2HNDA 4R0JA 2XG8A 3KK3B 1IQTA 1R8CA 1UWBA 3F73A 3DOLB 4JBCA 1JQGA 4ZVEA 4RWXA 2J9CA 1DLOB 2YWHA 4DR1J 2DXFA 2V5HG 3RU0A 2WVCA 4UF4A 4M5NA 1B64A 1WD6A 2ZH6A 2R4FA 1L3TA 1S6UA 3FSYA 4V1Ak 1LK5A 4I68A 2YKNA 1UTAA 4ZVRB 3K7RA 4KBIA 3M30A 4B3RJ 4TU8A 3NEKA 1SUQB 2YX1A 1VBXA 2MKCA 1UA1A 4C6AA 1TZ0A 3PDNA 4PG8A 2XMAA 1GXUA 3TQ1A 5KFFA 4ED4A 1SH3A 1EARA 4LFCF 2ROGA 2PDAA 1RHQB 1XR6A 3FMWA 2ZJQQ 1RWXB 1S1XB 1CQNA 2OGUA 3BPDA 2HVIA 5LJ5Y 1TFYA 4FBTA 2D3O1 1VGYA 3NMRA 3A8EA 3N5BA 3UWTA 1OIAA 3D4JA 2NXEA 3D67A 2GQQA 4LF4J 3DDIA 5E2QA 2Q3PA 4OJ1A 3EVOA 1NKCA 4Q5VA 4DR3J 1M5VC 1IJFB 1WWHA 3CIZA 3R9LA 3CGIA 2DGOA 2W25A 4JI0F 4F4WA 1XNQF 2KHDA 1FXRA 4HEA9 4DF8A 3L09A 4F0KA 1JLFA 4WE1A 3WX8A 2HNYB 1KWMA 4IFVA 1KN6A 1X31C 2BQUA 4WE1B 1FERA 1BXNA 3FSIA 2GGPA 2H4YB 3DLEA 3RBEA 3M8RA 2HAFA 4IFYA 1NSAA 5C24A 4IO9Q 1RQ0A 4A8YA 1TKZA 4U7UK 4A48A 2GGPB 4XK8C 1VR6A 2YNIB 4FF2A 3IN5A 1F5BA 5L9NA 1BQXA 3BZQA 4MKAA 2V2ZA 1S9GA 1T9UA 5M2UA 1TKZB 2BVZA 4J9MA 4NLXA 1C1BA 4NLPA 2HQGA 1HBNA 1U02A 1N52B 1C1BB 4I67A 4P2MA 3QYYA 2AZ3A 2WVDA 3TEGA 2CWXA 3D68A 2L3MA 5LOQA 6FD1A 2YKMA 1R7IA 2GX8A 3AXMA 3HSZA 2QJ3A 5C5JA 2XB2D 1ZH5A 2X1GA 1S76D 2QIFA 2MKIA 2MLZA 2XHCA 3WC2A 2YKMB 1U6FA 4CLUA 3VTIA 5EWGA 4WZQA 3CD7A 2R2SA 1RT2A 4CO3A 5LMUF 2UVRA 3KUGA 2CA9A 3GSIA 4OZ1A 2FJAB 4TY8A 4MIBA 2B43A 2V8HA 2VB6A 2W2OP 4O3SA 4PR6A 1RT2B 4UY85 1VQ5S 3LPYA 3HT3A 2QGFB 5J1EB 4KYZA 4X4OA 2F9JA 2WCXA 3GIJA 4LFCJ 1ZPWX 2DR6A 2D9OA 3GR1A 4ZVFA 5D3GB 2AV5A 1PSDA 2EI5A 3IAS9 1Y3KA 3MECA 1PJ7A 3K5LA 3RBZA 3AXKA 2HAIA 2CWKA 1F1BB 1N5QA 2KT2A 2E5HA 2K3KA 4A8XA 3V5RA 2MKYA 3HK2A 4K5RA 4NCGB 3BBFA 3VVTA 3FBEA 4G1PA 3CEDA 2KM8C 2J9DA 2EFPA 1W7WA 1VI7A 3H5UA 3HKWA 1I51B 4MIAA 4JI0J 1XNQJ 5IOLA 2NLWA 2ZHBA 3N01A 3UVJA 1A0OB 1VQ4S 1XBWA 1YRXA 2B51A 2CDQA 2HK3A 4L72B 3AFGA 1N8RT 1JLAB 2G0IA 2FQQB 1IN0A 1MMLA 1FRJA 4ETZA 2ZOGA 1U1LA 5KFUA 2C2NA 3KG1A 3K8WA 2WK4A 1Y10A 3SSRA 4J9SA 5I4MA 1NK6A 1K9MT 2ZFHA 1TV6A 3MEDA 4DV6F 1IKYA 3I0SA 4IKAA 3TZXA 4QJVA 4DG1B 4CT9A 5B0BA 1UEVA 1RXOB 1NBEB 1FDAA 4K4WA 2ALYB 2NUUG 3CDEA 1IKYB 1ZAVA 3BH7B 2CQPA 3I0SB 1NAQA 1NHKL 5D0HA 2W8KA 3OJUA 3TQEA 3GONA 1RTDB 4M5IA 1HHTP 3PNIA 2EFNA 4R5PB 4WFXA 1WC1A 2RQCA 1PBAA 1KTVA 2HBQB 4OYAA 3P4UB 1Q86T 5DDOC 2HLTA 4XO0A 4FNIA 5GAHU 4K2JA 3PW0A 3ZTPA 2HG4A 3UR3C 1HA1A 4ENOA 4HACB 2CPFA 1WACA 3THTA 1TL7A 3R6GB 3CT9A 5KOXA 2W9AA 1WHYA 3MM8A 2X1AA 3P6YC 3U1MA 4KTQA 2HYIB 1VMBA 1TL7B 1CJVB 2IHR1 2JEFA 4I64A 5LMUJ 3GQCA 1MMNA 1UWAA 3Q8SB 2P6SA 4F26A 4F2SA 3QRRA 1FA0A 4DR2F 3TUZC 5G0RA 2VJUA 3UD4P 4QIFA 3TUPA 1MMDA 3QIPB 5HMYA 1DJ0A 1RYRA 4ID5A 4LRFA 2DGXA 1ZM9A 3GP9A 5I42B 3M32A 3Q83A 3D0HE 4Z2XA 3M6VA 4ID5B 1QUVA 1AFIA 3W64A 3G82B 4AXIA 4FF3A 5JVHQ 1A7GE 4N47A 1X4HA 1TKDA 3K59A 1OPZA 2CNNB 5A0YB 3ZZRA 2LQ9A 3NGKA 3UE2A 1NJIT 3QRQA 4KFBB 1EX8A 4QR2A 4PG5A 2AF6A 5SZTA 1EP4B 4F4ZA 3KXDA 2EFVA 2JDJA 3US5A 2FD2A 3N6LA 5L46A 1FE4A 3TAPA 2XS7A 1ROFA 2WAQD 4J7CA 1UW4A 1NO8A 2QLWA 5B0CA 1QY7A 4NPOA 4GVLA 5L1IA 3OTOF 1ZTWA 3KLGA 3HVAA 1G4CA 1YRTA 2PD1A 4B17A 2HWHA 3Q8YA 3AODA 2QL5B 3BN7A 3HVTB 3CMQA 3QIDA 2B6AA 1QAYA 3V6DA 1S1UA 1Y11A 1GXLA 2AJFE 4ZMMA 3MM9A 4OYOA 2HLUA 1BGXT 1AZSA 1X4GA 2V8GA 1U8SA 1UEUA 1XWLA 3OVSA 2B6AB 3N79A 3TNVA 2N82B 2KFYA 2HEKA 2YWKA 4DV6J 2XMWA 1B0PA 3EM1A 4X4QA 1UVMA 2GMHA 4NZ7A 2RUGA 2Y0SD 1K0VA 1GK8A 1B7YB 2OPSB 4WIIA 4DSKA 1SXLA 1D8YA 2GJFA 2IJNA 4ZVOB 5IT9U 3JQJA 1VOMA 4IQXA 4I1TA 1RACB 3HZGA 2W9BB 2HFOA 3W1YC 1U7LA 2R2TA 4F3OA 3MI7X 1CBKA 1HBMA 1N88A 4IUFA 3LTOA 4KO0A 1EJ7L 3M1VA 3O2IA 2UVUA 3QMQA 3DU6A 3C6TA 2FJEB 3HHLD 4G1QB 1RDRA 1XN9A 5DM7Q 3QPIA 3V6JA 3IMQJ 3AD9C 4NX9A 4X2BA 5CCMA 2CUYA 2BKOA 1NK0A 3KFWX 3M1VB 3KLIA 3CCVS 2RF2A 3KLVA 3C6TB 1C1CB 2ZVIA 4KPYA 4ED1A 1LFWA 4Y28C 2IMWP 4U9RA 1W2BR 3DNCA 4DR2J 1M5KC 3KLIB 2RF2B 2L9DA 3H8YA 2HBRB 1WEXA 4CDIA 5F3TA 1Q16B 4Y34A 3S01A 5ETLA 2EG2A 2J5AA 2VPXB 3GG0A 1MW7A 2ILZA 2F8EX 3TX8A 4DFJA 1N5SA 4NYPA 1APSA 1U24A 5C25A 4HDHA 4OLPA 3CCES 2XSJB 2ZDPA 5C25B 2CJKA 5DGBA 4M5GA 4FNHA 3KK2A 3KWMA 1X9WA 5CD4A 2J0XA 3NKYA 2I38A 2NS1B 2DGVA 5D0GA 3DLKA 3OTOJ 2EBGA 5K8PA 1LWCA 4UQTA 3H5XA 1FRXA 4MKBA 3TOQA 4YDXA 4X4VA 1F5AA 1N34F 3GJTB 2HHUA 3NL0A 1G3OA 1LWCB 3OUYA 3DRXA 1QAXA 4WCEQ 3KK1A 4KQZA 1JJ2R 1IKXA 2ASDA 4NCAA 3JSMB 1QSSA 4L6V3 2CPHA 2OH2A 1XMBA 1VIXA 4NMXA 3OUYB 1WG5A 4DQQA 2ZD1B 1IKXB 1B70B 4C11B 3GTYX 3J80U 5K14A 1HQ2A 4DL3A 1YJUA 4FP9A 4DU8A 3C66A 2V9WA 1FKAF 1NHUA 1VQMS 5K14B 3ISND 5KG5A 2F4FA 3CF5Q 2OIHA 2JLFA 5F8IA 5HP1B 3PG9A 4OHVA 1IBMF 3GJSB 1TL5A 4BLGA 2HWIA 1DTQA 4YY3F 3MXHP 1LWFA 2RS2A 2IYIA 3PIPQ 1Y4ZB 4RNOA 2XI2A 1C0UB 2F7VA 1RUSA 4BDPA 2CNKB 3SCLE 1F3VA 2YH1A 4PEOA 3WDOA 1HNIA 2Y1IA 5AXKA 2QLFB 4B08A 3W9HA 4V19J 2P8IA 3GFYA 3QGIA 2XGQA 1S1TB 2FTRA 2QC3A 3OSPA 2YWFA 5A8RB 2DY9A 3CDBA 2MZRA 4QU6A 2XY7A 4YFUA 2NYIA 1FRHA 4RR5A 4PPDA 4AE5A 3CCQS 3VGSA 5IC6B 5DM6Q 3Q0AA 3EWGA 4OZ5A 1X4BA 1HD0A 5HMXA 2RB7A 5JXSA 4J9KA 3V81A 2C3UA 1KONA 4NLOA 3R5JB 5KFYA 4DL5A 3FMBA 3M2UA 1OY8A 5KFMA 4E0DA 2B8PA 2AYMA 4IH5A 1Y7PA 4YR2A 1LXNA 2VDIA 4RW6A 3VGTA 3H4BA 4LF8F 1YTYA 3M2UB 4DN9A 5L39A 1T94A 4OL8A 3FDSA 3U7JA 1RKIA 1V5VA 4CCHA 3TA2A 4HT7A 4G1IA 2V9KA 4DPOA 1H0HB 3QLHA 1SC4B 1Y9OA 4OHYA 1N34J 5KT4A 4CWBA 2GHVC 3VQTA 3PR5B 4XPEA 4PG6A 2EPIA 1U6ZA 3QLHB 1MROA 3P45B 4UOCA 4FKYA 2ZH1A 4EBEA 4OV6A 3EVWA 1S0MA 2MKJA 2K1RB 4JI2F 1DQ8A 3QFWA 3NGUA 1J5EF 1YVFA 3ZZZA 1B0TA 1S97A 3PFOA 1FK9B 2VFVA 1FHTA 2BJEA 1HWKA 4DR6F 3W5ZA 2X7IA 1JX4A 1JNZB 3KLHB 3M6WA 1HBUA 2X3DA 4LVNP 2NREA 2O67A 4K4TA 1TL3B 4ZKAA 2J0SD 5GADU 1T9WA 2J0QD 3G6ES 3W9IA 5IWAF 5IQ6A 2V68A 1OS5A 2COLA 1T3NA 1HBUB 2L9NA 2MHEA 1IBMJ 3E2EA 2J6SA 4F02A 5DQHA 2W24A 4YY3J 4NRTA 2I9SA 4CTAA 4DFKA 1RHMB 2M7SA 1SJFA 4CLKA 1H72C 2ZH4A 5CAAA 3MPVA 4LRBA 2XCPA 1WDDA 2EFGA 4CTAB 2YWGA 1HWIA 4RJVA 1DY3A 4KRWA 2QFIA 2GHWA 2ZWOA 1O6XA 1W2IA 2QLJB 3GYXB 5C2CA 4JI1F 3Q8RB 2R7TA 2I5JA 2V6AA 2RD5C 2ZH9A 4P72A 3F41A 4RNMA 3H98A 1GTEA 1X5OA 2MQQA 3PM9A 5B0AA 2MZSA 2RDIA 1I1GA 3ZNUA 4QW9A 1OSCA 2R42A 2A2CA 5KG4A 2ZH5A 1U8WA 4X65F 1L3SA 1JLEA 2WB1D 3AOBA 1NH7A 2MKHA 2LLZA 3FBBA 3RRGA 1R0CB 5CHCB 2FY1A 2AJ1A 3D3BJ 4OYIA 5LT5A 3AJ2A 3RW7A 2VG6B 4LF8J 1UMJA 5CA5A 1Y5NB 5D4PA 2DNYA 2RJZA 2B5JB 1FF2A 2C3YA 2GIQA 2IVYA 1EQ0A 3HFVA 3C15A 3MMJA 3GWCA 1SCJB 5EWEA 2EW9A 1NZ8A 4DZ6A 1H74A 3OTBA 1TMMA 4A4JA 2DNKA 1OO0B 3C15B 1VHFA 5K9FA 2MTLA 1U26A 3JTOA 4YB5A 2B7BB 3CB4A 3SZ2A 1LXJA 3K5MA 2DBBA 4RZRA 3R3TA 2VG7A 2YWWA 4JI2J 2WSCC 1J5EJ 2CQCA 1X4CA 4HVZA 2IM1A 2OI2A 4PWDB 1QE1A 3M8ZA 2IAJB 4OI2A 4USHA 1P9QC 4UW2A 4NEYA 4DR6J 1FFGB 4DZDA 2W7PA 1VC5A 4URSA 4USVA 2ZDOA 2FLNA 3SSQA 4DSLA 5F8LA 5IWAJ 3MF5A 3R1LA 1U1KA 3ZXWA 4DL6A 4DBQA 3L7PA 2O5DA 1FFWB 3M8QB 2HBZB 2IJRA 1T11A 4NOHA 2VOPA 3C6UB 4P2SA 4BHQA 4ZCIA 4WTYA 3FVYA 1VRUA 2B4VA 1U1RA 4NEZA 4G6VB 4NMLA 2CAJA 2EVZA 4X84A 3KJQB 3MFIA 2H9ZA 1WG1A 1VQLS 1EETA 4PAAA 2U2FA 4TLRA 3NG8A 3BBCA 4JI1J 3T1YF 5LSOA 1EETB 2QLXA 1U0HB 3FEZA 1BC6A 2NPFA 4B9LA 3O44A 4M8LA 2FIUA 3K58A 3KNAA 4CH1A 4ECZA 4EZ9A 5B7WA 4ERDA 1IQZA 3DU5A 2E1PA 1MWQA 4X65J 4ER8A 4CLTA 3GIRA 3JTNA 3MTJA 3LH2S 2BJDA 5L1KA 4G65A 5K8NA 5GMEA 1HKAA 1RT6A 2LKZA 1E6VA 3P8BB 4GC6A 2A1BA 1NSPA 3X3UA 3PACA 1RSCA 4KIAA 3AB4B 3GJRB 2H5EA 4JV2A 1T05A 3MFHA 3NGSA 2V4RA 1H38A 5A6PA 1MWZA 2HHHF 2L41A 1VIOA 1T05B 3OJSA 4K50A 4R8UA 4C48A 1RADB 2WW8A 1F2GA 3M2VA 3KHHA 3RZAA 3KHGA 3K17A 4R8UB 4HR2A 2XWXA 1I94F 2HVZA 1HPZA 1QAIA 2GFFA 1NK9A 1KFDA 3NWRA 4YR3A 3BV8A 1EKRA 5D0RA 1MN9A 1VCTA 4CM2A 1R8AA 2N7CA 1N56A 1UVIA 1ZBTA 1AA1B 4L3NA 2WBMA 1W26A 4LR8A 5AE1A 3GMGA 2FC8A 2EKYA 1RP5A 4B3MF 4U8YA 1RHRB 1LK7A 2Y1JA 4M5MA 1BLUA 2W1BA 4OYBA 3D1OA 1SL2A 3ITHA 4RUCA 1KVKA 3MD1A 3AA9A 2Z8QA 4R0EA 1RKJA 3AQOA 3Q8PB 1G1XA 4NLSA 2X51A 5LXRA 1AUDA 3ENVA 3TVKA 2F1FA 3W66A 2ACMA 1RTIA 1TUWA 1ZPVA 4W98A 3KDOA 3SMZA 4DLEA 2VV5A 1RTIB 1GX5A 2CIMA 1U49A 2MLYA 1YJVA 4S0MA 4OYMA 5KFGA 4ZVGA 4I0WA 4MK9A 2VHGA 3FSXA 2VFUA 1GMWD 4IQMA 4OHWA 1SKSA 2V4QA 5LMNF 1RHUB 5ETPA 1VS3A 3T1YJ 3T41A 3DDKA 5H9FJ 5L1LA 1S12A 2GVZA 2UUAF 3IS9A 4W4MA 1XIQA 5DGAA 4PZVA 2HGMA 3FEYB 1VQKS 4H4OB 2GVZB 3M4XA 3IS9B 5B09A 4AL7A 2XMKA 4N7TA 1NB2A 1V3SA 5GMKa 3GV5B 3TAMB 5D77A 4KSEB 3NS7B 1PO6A 3MAQA 1IWAA 1WOSA 5F8HA 4FXVA 4DCOB 4NLGA 2HHSA 1NXIA 5HSPA 2RRNA 4RLEA 5AJ3F 5THWA 4LF6F 2QYCA 2LEBA 2I8EA 1X9SA 3S7RA 3FQKA 1HQEA 2HHHJ 1T9TA 2DKOB 3MMBA 1V3ZA 3POTA 3NLCA 3HLUA 3EXYA 4HI1A 3NXZA 4DSEA 2XWYA 1HQEB 4O0NA 3WHIA 2KJWA 2LEPA 1ZZFA 3MMBB 2JL9A 3POTB 1VC6A 4K4XA 2CYYA 4ANEA 4Y00A 3B78A 2NCKL 4DPYA 1E6YB 3LWLA 3NP5A 1ACMB 3FZ2A 1I94J 4N77A 4KE5A 5KFLA 2QSWA 2KJVA 5J2QA 1FVQA 2ATCB 3KNGA 4P74A 2EG1A 1V5IB 2GAGC 2LECA 3MAHA 1UETA 4BS2A 3CMAS 3CVKA 1CC8A 2O3DA 5A2QY 5J2QB 2PEHA 3J7ZT 4B3MJ 1FRMA 2NXJA 2OD4A 3IO1A 3RW6A 1HIYA 3A8JA 1L3VA 2VL1A 1XR7A 1OY6A 3VF0B 1LWEA 1TMJA 2MY8A 1REVA 2IBOA 3WQPA 2DT9A 3T5KA 1UZDA 4EWTA 3IR5B 1M1KT 2CVIA 2MSSA 2FJXA 5KG2A 2H54B 4HKQA 2BV3A 4PG4A 1REVB 3QBCA 2UVVA 2ZJPQ 2QMUB 2OPPB 2KXFA 2DPIA 2FJVA 1WC4A 4CO4A 4QU7A 1T3OA 1X8DA 5KT7A 3BPSP 1KSPA 1FVSA 2D1CA 2DK2A 4KV8A 1U1MA 3DHWC 4Y2IA 5LMNJ 1F9HA 2A6OA 3T19A 1X7VA 1PG5B 2RE1A 2UUAJ 3VVUA 2BM0A 1M5HA 2I1RA 4KV8B 5MLCV 3PFEA 1O8BA 4E8UA 2W2PP 4O44B 1O5JA 2DY1A 3KLFA 1FD8A 4DQPA 4KPCA 2GVDA 2A3JA 3CE8A 2GO9A 1YK9A 3B4MA 2HQDA 4K4UA 1RWNB 3GCWP 3OT9A 1W25A 3C16A 5FDLA 3TUIC 5KFOA 3GV7B 2VC0A 4DX5A 2UUBF 4NLTA 3ET6A 1JLQA 4TY9A 5HO4A 3C16B 3MPDA 5FDLB 1F9EB 4JP8A 4Q2MA 2LQ5A 1NK4A 5AJ3J 4LF6J 1FEHA 3ET6B 2AX0A 4F04B 2WTFA 4P7TA 1KD1T 1PKUA 4UZCA 2B9YA 1JLCB 2O1PA 2QT7A 2JVRA 1KLMA 3V4MA 1B7FA 3BR9A 3D0GE 4PQUA 2R7QA 1NDPA 3E01B 2DGTA 2XS2A 2GV1A 4YB1P 1RA6A 3LA0A 1KLMB 2YKOA 5D6GA 2MGZA 1DAXA 2PC6A 1QVFR 3A13A 2BE2B 3H7HB 4DQSA 2RHSB 1AB8A 1LW2A 1RT7B 4F4YA 1Q8BA 1UJ6A 1N5TA 2H4WB 1X4EA 2HKEA 3DMJA 2GMJA 4I2PB 2W4DA 1IJEB 2R2RA 2YBVA 3B6BA 2ZHOA 1MG7A 4ZIWA 4I2QA 3DMJB 2ZH7A 4GMKA 3SCJE 3I0RB 2OTJS 5T7LA 2BZ2A 3L9ZA 4HT5A 1K44A 3JAMU 4NZ0A 5HROB 2VBWA 3AJ1A 4Y2CA 3MR5A 3CJTA 2Q6BA 4OJHA 1VBYA 5CD4H 1ZTTA 3UNYA 2E1CA 1R0AB 5D4NA 2HNZA 4WU2A 1WOPA 3HM9A 3ZZYA 3BS9A 1JB0C 1KS2A 1U25A 2XYPB 3LP1B 3MM5A 1LW0A 2G4BA 3I32A 1BE4A 2BX6A 5J2PA 3PEJA 3SQGA 1D9FA 2ABYA 2YX7A 4MT1A 2V4JB 3W63A 4QYZK 3MM5B 3H25A 1ZM3A 2E7XA 5HVGA 5HQ8A 4OZJA 4C8NA 5A8WA 1FD2A 5J2PB 4MKVA 2EEYA 1N5YA 2AJQA 1RT1A 5ETMA 1R27B 1QJHA 3RRKA 2AT1B 3KLEA 5A8WB 4LBPA 1RU1A 2H48B 1RZMA 1N5YB 3A1YG 2UUBJ 4RX6A 1SJ4P 1UL3A 1RAJA 5IM0A 3FNNA 4WXWA 1H73A 3QAEA 4XPCA 4DV7F 5KT3A 2CQ4A 4CNYA 2HHPA 4OX7A 4WK1A 1J27A 3QO9B 5F0WA 4K4ZA 3F0NA 5JJBA 2B4UA 1X9MA 2XC9A 2OFHX 2Y1LB 1FNXH 1H2VZ 2JJ4D 4KKOA 3NS5A 5HATA 2CPXA 5E3QA 3U27A 5HVFA 3OL6A 2FY8A 4Q44A 1N5VA 3M2RA 2XULA 1GEHA 2J9DE 4DCJB 2DNHA 1VLOA 2W2MP 1SBRA 3R5DA 3IWXA 3LANA 2GNKA 1GMUA 4KHPF 3F56A 4ED3A 1VQ9S 4DV3F 1SV5A 1VFJA 2VZ9A 2HVHA 3HF5A 1K8AT 4QYRA 2WOMA 2K7KA 2EWHA 1VISA 4I6AA 2WW4A 3FKBA 3QAUA 3RB6A 2YXLA 4AXJA 4IDKB 1H3DA 5DQGA 1VRQC 2WOMB 4L3KA 1HARA 2BANB 2YQ0A 3EMTA 4O0IA 2HK2A 3THPA 4C97A 3BBBA 4ICLA 3D6MB 4LJMA 1XTZA 5J2MA 3VV2B 2PI5A 4DUZF 5HMWA 4LSLB 1IUJA 2N4CA 4V19X 2YNFA 5J2MB 5CYMA 2LXFA 2BM1A 1KOOA 3KHLA 2DCLA 3A4TA 4JI7F 3SI8A 2QV6A 1Q79A 3GCXP 4KHRA 3VAIA 4KGVB 5CYMB 4Q8EA 3P49B 2C2EA 4WKRA 2BE7D 3MD3A 2FGOA 1FWLA 1NSKL 1CVJA 3BO2A 3BSAA 4DMZA 3LPEA 3LGNA 1OPIA 3RJMB 1L3UA 4JI3F 2N3OA 3EGZA 3N6NA 1HNVA 2VIHA 2RQKA 3OFHA 2PSZA 4J9OA 1KDNA 3IWNC 4X4SA 3OTCA 2HS4A 4TLQA 4NZ6A 5DLGA 5HI7A 1VK3A 1HNVB 2QA2A 3ZTSA 2I0XA 2ADBA 2WONB 3OR2A 3TZWA 2JH3A 5E5NA 3IRXA 3LO3A 1NSQA 2CQ0A 1G2EA 1N6QB 4CLZA 2ZOMA 2J8SA 1RWWB 3HULA 3W61A 4DV7J 1UP1A 1TQLA 3HFZB 3OR2B 1NU4A 4LRCA 5B0FA 3Q89A 4ZJQA 4NXNF 1VJQA 2OO4A 4DR7F 3PKYA 2DRAA 2GAHC 5M2PA 2AWZA 1X4FA 4F7VA 2FVCA 4PYDA 1ZYQA 4ZVQB 3MOJB 3ZTOA 1R8HA 5KFJA 4LRAA 4XAKA 2AIRB 2M8DB 3R1HA 2HHTA 4A8KA 3BQ2A 3EGWB 3SFUA 3UDEA 3MPYA 2H5IB 3NOCA 3SDEB 2RILA 4ZHRA 2W9CA 4USKA 4DSFA 3JS9A 1QVGR 2CPEA 4KHPJ 3B82A 4FF1A 3RAMA 5EX3A 4M5JA 4DV3J 2PA8D 2DRDA 3FCVA 4DCPB 2ZKTA 1TKTA 2JFDA 1T7PA 3SV4A 4QOTA 2R8GA 5C7PA 3CCJS 3W2VA 5D4LA 1Y00A 4PUOA 5IC4B 1TKTB 3UDCA 3AB2B 2F63A 2O01C 2X1BA 2FLPA 2I6WA 3W2VB 4NI2A 3R7SB 3TW0A 1PAEX 4PUOB 1KKHA 2F8HA 5B08A 3QZ8A 2XI3A 4USUA 1TL1A 2XLKA 2NYHA 3VGUA 1TL4A 4B9VA 2ASJA 2ZBPA 2MZ1A 4C8MA 2GW8A 2G1DA 2YX4A 4NI2B 4DUZJ 1ZS6A 3HDSA 2MQ8A 3ZNJ1 3ILOA 3H0PA 2R7XA 3BQ0A 2PMZD 3DC2A 3PXGa 5HN0A 2IY5B 2HURA 4ELUA 1R43A 5GAEI 4JI7J 1U1NA 2RQMA 2PFDA 4WYWA 4NLYA 2WSEC 4RUAA 5ETOA 1X5PA 3KKFA 3M6XA 1PCAA 3KMSA 2F3JA 3KOAA 2M3DA 3SXLA 3DM2A 1GFWB 4WTOB 2XO7A 4ECVA 1S9EA 1XR5A 1RWMB 4RW4A 3MEGB 5AT1B 1WKLA 3A8KA 2ALZA 2XQCA 3X1LB 4JI3J 2FZGB 2DISA 1XMOF 3M8PA 2IPOB 1CULA 3DM2B 3J7YU 4ES1A 1AUSL 1S9EB 1FTRA 2DGUA 4Y65A 2QSFA 2BKNA 4GO7X 3M8PB 4NA1A 3E8OA 1CULB 3DCAA 4ZVSB 3ZTRA 4ES2A 2C2ZB 1T03A 2R3VA 6AT1B 3PKMA 3TRGA 3JTPA 1TAUA 5CQGA 1ZZNA 5T41A 2CNLB 4FBUA 3CO9A 2N4DA 5HLFB 3CW2C 1T03B 3CJ5A 1YHQS 1IBCB 1C2PA 2C3OA 4CRJA 4NXNJ 5DG7A 2KB2A 5B0DA 4DR7J 1UJ4A 2Z4PA 2BOPA 3S6EA 4I4BA 2NSBA 1H2UX 1F9FA 5L1JA 5DDPC 1KC8T 3DLGB 1N4LA 3OLAA 1HD1A 5F8JA 2AW0A 5C42A 4ILRA 5A6WA 2X1FA 1RB0A 2DR8A 2YQ1A 1FCAA 2MKSA 3DRYA 2KH9A 4KGMA 4F3QA 2J6UA 1IR0A 2GMLA 3HJVA 5KFWA 2LMIA 2DTJA 4Z37A 3PY8A 1BQMA 3N6MA 2ROEA 1P1LA 2WVFA 3MTKA 2ILYA 3NCQA 1HYSA 1JLGA 3SCKE 3HD2A 3M8SA 2IM0A 2HWTA 4ID8A 1BQMB 5KOWA 2HNDB 2LU1A 2VQEF 1TK8A 5KFIA 2LQBA 1UWBB 1XJWB 1HYSB 4IG3A 3T5LA 2M5YA 4CLSA 1SH2A 4DR5F 1EAYC 2YPYA 3ZC4A 3G6VA 4PCQA 2BE9B 2RIJA 4IG3B 3UCUP 1D1UA 5GAGI 4HHJA 2MLXA 2CNOB 4DR4F 1Q7YT 2L08A 5E33A 3UI3A 2WVBA 2LP4A 5I3PA 3HSGA 2JNJA 1UKUA 1FKOA 1AT1B 2YKNB 3D66A 4M94A 1H98A 3M30B 2MQOA 2Y1RI 4YP3A 3CJ4A 3AH6A 2XY6A 1HI0P 4ECUA 1NNDA 3J81U 3G6YA 5LSLA 1R31A 2W4PA 2DHSA 1FFSB 1FKOB 4WZMA 1D8ZA 2DXDA 2LDIA 2DR7A 2KZMA 1IM4A 1KHWA 2B4PA 2HFSA 2AEMA 4NLVA 1RAEB 3DXSX 2MZQA 3OTEA 4X66F 4C8YA 4USJC 2Y0BB 3PRVA 1UVLA 1IWGA 2QTWA 1XMOJ 4B3OA 2OKQA 4X4PA 1J2VA 1RT5A 3I9ZA 4RW8A 4F0HA 3KUHA 3I96A 3QRPA 4TQSA 2E5GA 4AQYF 4B3OB 1P27B 4GRSA 4CO1A 2M9KA 4RBUA 2BQ3A 3ETMA 2J7WA 3MM6A 4RW8B 2HBYB 3Q2SC 4J9UE 2ZBCA 2NZCA 1HMVA 3GPAA 1VQNS 4KB7A 2RNEA 3K5PA 2P9EA 3KMQA 4DV1F 3FFIA 1C4CA 1RHJB 1MSWD 1SC1B 2NSCA 3B54A 2MQPA 3SQOP 1JLFB 2PE8A 1X5TA 1X5SA 2FGCA 3CUNA 3UNGC 5F9NA
chains in the Genus database with same CATH topology
4A47A 5IQQA 2AJ1A 4F25A 1S6PA 3NS6A 2FC9A 4WXOA 2FJDB 2CG4A 2VG5A 4IFVB 2VA3A 3I5AA 4NLUA 2UVWA 5M2RA 5KFZA 2ZBIA 3UD3P 4QWCA 4OMFG 5LT5A 2RDJA 2LEAA 1GAOA 2E5IA 3AJ2A 2FB0A 4JI6F 3RW7A 3VAMA 1CEZA 4EUVA 4K5SA 1Q1KA 1NJYA 1YJWS 4ZP7A 4RW7B 2WONA 3EGNA 1HHSA 4C9DA 1XC9A 2VG6B 4UUWA 1S6PB 1UMJA 5CA5A 2ASLA 1Y5NB 5D4PA 3HHNB 2VG5B 2DNYA 5EWFA 3T3FA 2RJZA 3DLEB 1X0FA 3TA0A 2JZ5A 4QWAA 2B5JB 2ZZMA 1FF2A 2C3YA 1N6QA 2GIQA 5I3UA 1S72S 2IVYA 4IFYB 4JI8F 3CD6S 5C24B 1IBLF 1S99A 2M8HA 3MMJA 3GWCA 3HHDA 5EWEA 2EW9A 1L5UA 2FJBB 3WZ0A 1J5OA 2JEIA 1WHXA 3OTBA 2XSJA 4QWDA 5E3RA 4B02A 2VH7A 3BB5A 5F8NA 5EX0A 4A4JA 3KTQA 1LWEB 1JIHA 2DNKA 1CQMA 1S9GB 2OJ3A 4NXMF 1OO0B 1ULRA 4ZPAA 1UVKA 2DNOA 4DX8H 2F4VF 3J7A1 5KFAA 1S0OA 4AUKA 1J5OB 2HHXA 1VHFA 5K9FA 2MB0B 1U26A 3JTOA 4FS1A 4UUXA 4YB5A 2B7BB 4ZS6A 4KJIA 1WHVA 3CB4A 5EDWA 2DRBA 2M70A 2E44A 3SZ2A 1U1OA 1LXJA 1HBNB 2M52A 1RTJB 3K5MA 2XS5A 2ROPA 2GQ2A 1DFDA 1VJWA 2HHVA 2KFZA 2DO4A 2DBBA 4H4KA 4RZRA 3R3TA 2VG7A 2C42A 4IO1A 4K4VA 2N7YA 3LW5C 2JVOA 3HHKA 2UUCF 2VBYA 5JVGQ 4Q8FA 2WSCC 4ZK7M 1KQGB 4ECRA 2CQCA 1X4CA 2OMLA 3SDEA 2JOQA 1K1QA 3T5HA 2JHEA 3OTDA 1JKHA 4HVZA 4N8OA 4A8SA 2IM1A 3DGPA 2IJFA 4PWDB 1QE1A 3LP0A 2DNGA 2IAJB 4OI2A 3MUTP 2WRMA 5BYQA 1VQPS 4USHA 1P9QC 4UW2A 1S48A 3K5OA 1S6OA 4DDFA 2D74B 3KJVB 2HQ3A 3T5JA 4DHVA 1KQSR 3HX9A 3JAMY 2W7PA 4MTPA 4USIA 2XMVA 4QPXA 2AD9A 1XEZA 3O8WA 1VC5A 4OV1A 2CJQA 4URSA 1VQ6S 3KHRA 2Q66A 1JKHB 2ZDOA 2FLNA 3CJ2A 4CT8A 1TP7A 3MOZA 2VPZB 2UXBF 4F8RA 3SSQA 3LP0B 4WK3A 5FIIA 2GJIA 5F8LA 4DSLA 5KFXA 1TAQA 5KTQA 3MF5A 3R1LA 4CQ1A 1U1KA 2MKKA 4C0OC 3KG4A 2YNHB 4DL6A 3HKZD 2MJNA 5GVQA 4BC7A 2P9GA 3M9NB 4RUHA 4DBQA 3JSMA 3L7PA 2O5DA 3P96A 3V6KA 3M8QB 2ZVSA 2DIVA 1RISA 2LYVA 5DO2A 4ALZA 3MMAA 2RSQA 1N48A 3ZZUA 5DETA 4NOHA 3KLFB 4AL5A 2VOPA 2F8MA 5GADI 3PO4A 3K5NA 3C6UB 4DL0C 2CPDA 4DV2F 4P2SA 2ZD1A 4EU0A 3IG1A 4BHQA 2DHAA 4TY8B 4DWIA 3DI6A 4ZCIA 4WTYA 4C11A 3CDUA 3FVYA 4WFBQ 5JUMA 2HIQA 4C3KA 1VRUA 5FD1A 2B4VA 3IAM9 3HJFA 3NWGA 2RQ4A 3MEEA 1KEKA 1U1RA 1WNEA 4H4MA 3MMAB 1C0TA 4U7CA 4F4KA 2ERRA 4G6VB 4DR1F 2VA2A 4NMLA 3HXMA 3RTVA 2X3GA 2Z2LA 2EVZA 4X84A 1TFWA 4ED8A 2MZJA 3IG1B 1FO1A 2H9ZA 3MCSA 3HVWA 3MFIA 2I2YA 3DI6B 3ISZA 1WG1A 3SEOA 3QWPA 1URNA 3OQ2A 1VQLS 1EETA 2KG0A 1JLQB 2KT3A 3ISNC 2U2FA 3MEEB 2GCFA 3JSBA 4H4MB 5J1PA 1DARA 1DZ5A 1FE0A 3S8SA 3MECB 3NBPA 4TLRA 4DL4A 1HNXF 3F44A 3I4PA 5CZXA 5EN1A 3NG8A 4C0HA 1YITS 1TKXA 5DRKA 3CTRA 1TK5A 2MY7A 2ATLA 2R7UA 1HBOA 3T1YF 2APOA 5LSOA 2ZC4A 3R5CA 3DOMA 4OFZA 4QIVA 5HP1A 3MUMP 1EETB 2QLXA 4HDGA 3D1QA 4YB6A 3H5YA 4TU7A 1GTHA 2RRAA 2JEGA 5FLXY 3FEZA 4DV4F 1FDNA 1BC6A 3H5SA 3QJPA 2NPFA 4DS4A 4B9LA 2BDPA 4B3RF 3EUNA 3O44A 2E1MC 3IXQA 4M8LA 2FIUA 3K58A 1HBOB 2CRLA 1TR0A 2XMTA 4MK8A 3KNAA 2B0GA 3DHXA 1DTTA 5KAKA 2O66A 4DLGA 4RNFA 2BR0A 1UFWA 1LKZA 4CH1A 2P5VA 3M6UA 4ECZA 4EZ9A 2ZKUA 5B7WA 2V94A 2FHKA 4ERDA 1IQZA 1C0UA 4J37A 2FVQA 3DU5A 3H59A 7FDRA 2LCWA 3RB4A 3DRSB 3VZHA 1NZAA 4PQUB 3UDLA 2R8HA 1FESA 2LU2A 2OTLS 5B0GA 4PXBA 1GQEA 2F40A 2XLJA 5U47A 4CH0S 4M5DA 4N56A 2XMMA 3JTNA 3MTJA 3MEGA 3LH2S 2BJDA 5L1KA 2VFTA 3C46A 2DH7A 3DN9A 2IRUA 1KNZA 2J8AA 5K8NA 4F50A 5KFHA 2Q6CA 4K59A 1RT6A 3OFEA 2KO1A 2LKZA 2RVJA 3E51A 4O3QA 5KFVA 1E6VA 3CCZA 2MGZB 1WEZA 4Y2MA 4MYUA 3BREA 4HI2A 2C28A 2KDOA 4Y6IA 4GC6A 2A1BA 1S1TA 5AE2A 5LJ3Y 3BSOA 3X3UA 4GKJF 3PACA 4DQRA 2NPIA 5E3PA 2CPIA 2E7WA 2HGLA 1FEEA 4KIAA 3MR2A 3AB4B 2XLIA 2H5EA 4JV2A 2ZZNA 2GJ2A 1D9AA 5A8RA 1T05A 2ZC3A 1LW2B 1FJ7A 7FD1A 3MFHA 1TUVA 4ED0A 4TXSA 1YIJS 1V9OA 1HNWF 2ACYA 2DGWA 2V4RA 1H38A 5A6PA 1MWZA 2E1RA 2HHHF 4WFAQ 1YJ9S 2JWNA 4U67Q 4LF4F 1QLNA 3GFHA 2IVFB 5KFKA 2YY3A 2A18A 4Q7AA 4QW8A 2QRRA 4J9QA 2L41A 4LVOP 1VIOA 1M90T 4DR3F 2GHPA 3M9OB 2KXNB 3OFFA 1T05B 3OJSA 3VWSA 1TV6B 2DO0A 2UV8G 4K50A 4R8UA 1HFEL 2OSRA 3EXCX 1T02A 4CO2A 2FHJD 1NK8A 3MEDB 3BSCA 4P6QA 3MEKA 2WW8A 5HLFA 1F2GA 3UW1A 3M2VA 3VAKA 3KHHA 1KHVA 1ZM2A 2MPUA 3AY0A 3OBIA 3RZAA 3WBZA 4YR0A 3KHGA 3DRPB 2XSFA 2IRXA 4QR0A 2K2PA 4I2QB 2YKQA 1S1VA 2CQ3A 4ZPWR 2V8VA 4TKTA 1T8EA 3U1LA 4R8UB 4BWJA 1FT8A 3THVA 3PV8A 3I31A 1S1WB 5IZHA 2FHOB 3TUJC 4RU2A 3MM7B 2XWXA 3U02A 3ENWA 1I94F 1Q4RA 2HVZA 5KFTA 1HPZA 2XNRA 4RWWA 3DLBA 1QAIA 3I5CA 5T7LB 2GFFA 2FPHX 1ZM4A 3BQ1A 1Y5IB 5KG0A 1NK9A 1KFDA 4YR3A 4OX6A 3BN4A 1S1VB 3DLGA 4CO0A 2KM8B 3I55S 2DGQA 4Q0BA 5KFNA 4PWUA 1R8AA 3ETOA 2N7CA 1N56A 1UVIA 1ZBTA 2AJ4A 3IR7B 1Z2ZA 2G9OA 4ECQA 4L3NA 3T9ZA 1YI2S 4I7FA 2WBMA 2PA3A 2BW2A 3TO8A 5AE1A 1QSYA 3GMGA 2FC8A 2D9PA 2UUWA 2EKYA 2DHXA 1RP5A 5IT9Y 1AXQA 5KFSA 3W2WA 1NKEA 2HNZB 3CDAA 3H2VE 4B3MF 2K8GA 5DJBA 3NCPA 4X4UA 3GFZA 1LK7A 2R7SA 3P5TL 4Y3CA 2Y1JA 2BQRA 1BQNA 1BLUA 4FS2A 4NCBA 3D1OA