4FKYA

Crystal structure of nucleoside diphosphate kinase b from trypanosoma brucei bound to gtp
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
152
structure length
152
Chain Sequence
b'MPSERTFIAVKPDGVQRNLVGEIIKRFENKGYKLVGLKLLQPTEEQAKQHYIDLASKPFYSGLVSYFSSGPIVGMVWEGLGVVKGGRVLLGATNPADSLPGTIRGDFAVDVGRNVCHGSDSVESAKREIAFWFKAEELVSWTSHSVKQIYER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title Crystal structure of nucleoside diphosphate kinase B from Trypanosma brucei bound to GTP
rcsb
source organism Trypanosoma brucei brucei
molecule tags Transferase
total genus 46
structure length 152
sequence length 152
chains with identical sequence B, C
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2012-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 4fkyA00
3FCVA 1MN7A 3EICA 4UOFA 3BBBA 1LWXA 2DXFA 3NGTA 1PAEX 3EMTA 3VVTA 1UCNA 1HIYA 3BH7B 3Q83A 3PJ9A 3B54A 1NDLA 3Q89A 3FBBA 1BUXA 4ANDA 3FBCA 1NHKL 4F36A 1F6TA 3ZTRA 1NDCA 4EK2A 3EVOA 3VVUA 1NSKL 2B8PA 5C7PA 1NLKL 4DI6A 4W98A 4C6AA 3ZTOA 3FKBA 3BBFA 3NGSA 1MN9A 1B99A 2HVDA 1S59A 3WX8A 1NB2A 3Q8YA 3Q86A 3NGRA 2HVEA 3VGVA 5CAAA 1S5ZA 2B8QA 3FC9A 5BXIA 3DDIA 3EJMA 1PKUA 4CP5A 1NSPA 4ANCA 3FBFA 1HLWA 3L7UA 2HURA 2NCKL 4UOHA 4FKXA 1B4SA 2VU5A 2BEFA 1W7WA 4O0NA 1HHQA 1XQIA 4FKYA 4DUTA 2BX6A 3VGSA 2DY9A 2AZ3A 2AZ1A 3ZTPA 4F4AA 2ZUAA 3EVMA 1NSQA 3EVWA 4HR2A 1ZS6A 2DXDA 3NGUA 1U8WA 1NCLA 4WBFA 3R9LA 5CABA 1EHWA 1F3FA 1BE4A 1LEOA 3JS9A 3VGUA 1KDNA 1WKJA 3Q8UA 4UOGA 2DXEA 1NDKA 1WKKA 3ELHA 4ENOA 1K44A 3BBCA 2DYAA 3GP9A 3ZTQA 1BHNA 5IOLA 3ETMA 3EM1A 1NUEA 4KPCA 3PRVA 4S0MA 4DZ6A 1JXVA 2CWKA 1NDPA 1S57A 4ANEA 1NPKA 3DKDA 3MPDA 3ENAA 3FCWA 3VGTA 3B6BA 3FBEA 3ZTSA 1WKLA 3GPAA 1XIQA 3BH6B 1VYAA 3G2XA 3Q8VA 3EE3A
chains in the Genus database with same CATH superfamily
4F3OA 2X1BA 4JOUA 2EFOA 2KFNA 2OSQA 2ZUGA 3AB4B 1LFPA 2YTCA 1DTQB 2ILYA 2F7VA 3CEDA 3AHPA 4TYBA 2JEGA 3UNYA 1RTHA 1Q0NA 2DISA 3TWZA 3R5JB 4K2JA 1MROA 4LSNA 3T9NA 3QIDA 1FRXA 1PBAA 3G6ES 3TOQA 5B09A 1K0TA 1FKOA 2FHJD 2HVIA 1Y11A 2YXLA 2EEYA 3KDOA 1NSPA 3EYZA 4PAAA 2EKNA 2QYGA 4I1TA 4EYIB 2GS8A 4RUAA 3HF5A 3BGOP 1MWZA 2N7YA 9ATCB 2RKIA 3LTOA 2YQ1A 3OVSA 3CDAA 3DLGA 2QE5A 3K8WA 1WKJA 4C8MA 4DUZJ 3ITHA 3L7PA 2VC0A 1DBDA 1VI7A 1QAJA 3TA2A 3M9MB 4IFVA 2D9OA 3BSAA 4O0IA 3T6JA 3HX9A 2K7KA 3SQGA 1N6QB 1TFWA 1RQ0A 4R5PA 4HT7A 1GMWA 3MTJA 4WZMA 4B9LA 4A47A 3BPSP 3ZFVA 1XR7A 5LT5A 4AT1B 4DV3J 3GU0A 4X4SA 4OYMA 2EI5A 4Q44A 2QJ3A 1ZA2B 2GIRA 2O5DA 2E29A 1VK8A 3ILOA 4MTPA 2F9JA 4HACA 1PIEA 1MW7A 4DL5A 4P7TA 2KG0A 1S1TB 4N76A 2IPOB 3EPIA 4DUZF 1FT8A 4TQSA 4I2PB 1FKAF 3UWTA 3A8EA 4QWBA 4L72B 2XNQA 4QYZJ 3HO1A 1UEVA 1Z2ZA 2JEJA 4Y2MA 1FWKA 4ZIVA 2DNOA 3K58A 3HJFA 2WB1D 3VAJA 3TUPA 1ZM2A 4QZVB 1JB0C 3UDLA 3M30B 4DV3F 4QR2A 4DR3J 2CZ4A 1DFDA 2FTRA 1PJ7A 2FC9A 4KH1B 2FZCB 1C0UB 3TZYA 2VG7A 3PW0A 4RUBA 3M4XA 4NLRA 3BYRA 5B0EA 5HQLA 3FGVA 1NKBA 2HFZA 1TP7A 4WFZA 3CD6S 2J9EA 3BSCA 5I3UB 2C2ZB 1VHIA 3WX8A 2ZWOA 4TU9A 3OXGA 3SFGA 3VTIA 1RHQB 2DPJA 3CJ5A 4EGLA 1SIZA 2VG6B 4JUZA 3CW2C 2J8SA 1P9YA 1B0VA 3AD8C 2DR9A 4FNIA 1NU4A 5D4NA 3NMAA 3MR5A 3Q2TC 4B9MA 3PW7A 1JJ4A 3MEEB 4Y34A 4U7CA 4U67Q 4Q8EA 3U1NA 3MXHP 5DZ6A 1F60B 2ZE2A 3EZOA 3BGFA 5F9LA 4ZJLA 3AOBA 4LR8A 2RU3A 4JB8B 5SZTA 2CA9A 4JI8J 4OI3A 3B4MA 3OFGA 1RBOB 1FDBA 4LBIA 3EX7B 4DX6A 1XBWA 3GYGA 1TL4A 1SXLA 2XMAA 3VGTA 2AEMA 1WF2A 3BQ2A 2ZD1A 5F0WA 4FPIA 1U49A 3D9BA 2RUGA 2WW8A 4IYQA 2PFFB 2F40A 4Y2IA 3FCHA 4X66F 3RRGA 1WNEA 1PJ6A 4YQWA 2HG4A 5HP1A 2V8GA 1XTZA 4J91A 3A8KA 3L4BC 3G8QA 4ED8A 1EP4A 2FVQA 2XGPA 1JLGA 1YGYA 1FX2A 5EWFA 4OHVA 2WZ1A 3C14A 3EPGA 3KUEA 2I2YA 4JI8F 4NLUA 5DDPC 4AL6A 4TYAA 1NSQA 1SQGA 1S1TA 5C25A 3B4DA 1FXDA 1EHWA 1YHQS 3F73A 1VQ5S 3VGUA 3C6UA 5KFSA 2OTJS 3P45B 2RS8A 2P5VA 1NBEB 3DOMA 4DG1A 2Y1JA 4NYZA 3J80U 3MR3A 3CSKA 4J5OA 1T3NA 4KV8A 2JVRA 2MQ8A 3OL9A 2NUHA 3ENWA 4O44B 2RMLA 4ECYA 2COLA 3DHWC 4NEZA 1S7HA 2E1CA 1IBLJ 1WTBA 1F5AA 2ZZTA 2XGQA 4ECTA 4DV4J 1YLXA 4DS5A 4RNHA 4QQBA 2JLFA 2BOAA 2EG1A 2VKRA 4J9NA 4W92B 2D69A 2H4YB 3I55S 3D54A 3LANA 1SH2A 4DR2J 2ZHOA 2VBYA 2AJQA 1VQ8S 2MQLA 5L9XA 2C2RA 3MECB 1X31C 1T94A 2XWXA 1F9EB 5L39A 2J7WA 4CH7A 1AW0A 3CGIA 3TAMB 1P6TA 4NLVA 2UXBJ 1TMMA 1KD1T 4OYIA 4DN0A 1YJTA 3DLHA 5AE1A 2V4JB 4U8VA 1IBLF 1N4LA 2GJ2A 1RUSA 3NEKA 5BJRA 3PVXA 4DV4F 2HHXA 1HPZB 1MN7A 3RGIA 2HKEA 4RX6A 1U25A 4J9MA 5M2PA 2XC9A 3Q83A 3SFUA 3CJ3A 4WK3A 4RKUC 1M5HA 2VG5B 2CG4A 1LWFA 5HLFA 3KKFA 3NS7B 1KHWA 2Y8WA 5HMWA 4WCEQ 1RLCL 3H2UB 4L3KA 4ETXA 5AXNA 3C46A 4OIXA 5C42B 4NLDA 4ELTA 1RADB 1RGVA 4QW8A 2W2QP 4JI1J 4WKRA 4WXWA 3SDEB 2IC3B 2BYCA 1Y5IB 1TTHB 1A9NB 2RT3A 4ZN1A 1N48A 2UV8A 4NLTA 1RTIA 1VBKA 2HHHJ 3R9LA 2XS2A 2L08A 4ZLPA 4K0KF 1L5UA 1GMWD 2JEIA 3BBCA 3KLFB 3H7HB 1FFWB 5L1JA 4ZJOA 3A8IA 5GAEU 6FDRA 3O2IA 1B7FA 2Y1IA 2HHVA 1U1LA 1GK8A 3OFHA 4X4NA 2QG9B 3M1VB 3NNHA 2JZ5A 4ATNA 2BE2B 2VASA 5C2GA 4JI1F 4U8YA 1YJVA 1JX4A 3WX4A 1LW0A 3E01A 4C3KA 1N56A 2YX7A 4OLOA 2P2CB 2MQPA 1UJ4A 4M5DB 3OLAA 4P9SA 4D3HA 1MU2B 3FZBA 2V68A 4HI2A 4DOZA 4IO1A 3M8PB 3W7BA 3CD7A 3CCUS 4OI4A 4DQQA 1N5YB 2D7SA 3JQKA 1TV6B 1JJHA 4NI2B 2DNZA 1MWYA 2CQGA 2P9CA 4NRTA 2VOPA 3HCXA 2OEJA 4M5LA 2BM1A 1KN6A 1X0FA 2PC6A 5DGBA 1T7PA 3MPUB 1HFEL 2E44A 2RDJA 3OBIA 3UVJB 3H5SA 1S76D 4ZS6A 4DLEA 1HR0F 4DR1J 2B4PA 7FD1A 1RT6A 1HPZA 5KG3A 5A76A 4O4GB 1TAQA 2I5JA 1X4GA 4PUOB 1MSWD 3FRYA 4CO0A 4RW9A 2BJ8A 2BRLA 3NWRA 4XPEA 5LMNJ 1NB2A 3QT6A 2YX4A 1KR4A 3S01A 3M32A 2HBZB 2ZBCA 4IH7A 4M5JA 3UD4P 1FERA 3H90A 4J9RA 4ECRA 3DLEA 4R25A 5C42A 5D0HA 3LA0A 2OELA 4P75A 4OZLA 4WIIA 3D6MB 4RUCA 2GHWA 1SC4B 4FS2A 4H4OA 4DR1F 3HM9A 3MPWA 2XI2A 1LNQA 3R8YA 2ZH6A 1BQMB 1IXKA 4OMFG 3KLFA 1EJ7L 3D5MA 4OZ3A 1VC6A 3ZTRA 2DGUA 1VQLS 1JLBB 3HSGA 5F8IA 2VL1A 2HBQB 4P71A 4GVLA 4QBUA 4M5GA 2GHVC 3FDSA 2NZ4A 2Z0GA 3JSYA 4XPCA 1Q4RA 4C0HA 5J2QB 2VPWB 3GFYA 2JFKA 2R2RA 3DRSB 1XMQJ 3N5FA 2X3GA 4C0BA 2GVDA 1ZBTA 2IRYA 4CP5A 2H4WB 2FPHX 1A6LA 4U96A 4FXDA 1DQAA 1RT4A 3WC2A 2M0GB 5J1EB 2ROGA 2RQCA 1XQIA 3OUYA 3TEHB 5KFLA 2D3OR 2MSSA 2HLUA 5B0DA 3FFIB 2D9PA 5A0YA 3J81Y 3DGPB 3BM7A 5KT5A 3KMQA 4BS2A 4USVA 4QIWD 4QU6A 3W9HA 2R9LA 2BJ7A 1RHUB 4WFXA 1N5YA 4NE9C 2QGFB 4PG8A 5KFZA 1ELOA 4PQUA 4NI2A 1VQOS 5E2QA 4BLGA 1X9SA 4GVBB 3DNCA 5LMUJ 2LU2A 1XMQF 4KHRA 3UD5A 2FZKB 1YBUA 3SMZA 5CYQB 2VJVA 5KFYA 1UW9A 2B9XA 4Y00A 5C7PA 1U1QA 1B64A 2MQOA 1KQFB 3SSRA 3Q8YA 4O4GA 3AD7C 3IBFB 1KNZA 4YDXA 4A8YA 1K1SA 2HQGA 4NWBA 4FYDA 4NCGB 2DNHA 1U8SA 2DR5A 1RWUA 3DXBA 4ZVHA 2MZ1A 3RR8A 1RHJB 3MEGA 4O23A 1RKJA 4USTA 4C11B 3NRBA 4FVMA 2VDIA 3ILLA 4K7QA 3AA9A 2V2KA 2ASYA 2ZEJA 3KUHA 5JUMA 3GMGA 1KC8T 2OJ3A 4PPZA 4B9NA 2CUYA 2WBMA 2GJIA 2DNRA 4XK8C 3KMSA 3VAKA 3PEJA 2BJ3A 3CVKA 4ZA1A 2DNMA 1Q53A 1YDLA 4ICLA 5ETTA 3QWPA 2XSJA 3OFEA 1IBKJ 1PAUB 2W4CA 1HQ2A 2JSXA 4RR5A 2QA4G 4DSLA 2DNPA 2FB0A 3R5BA 2L41A 4KTQA 4IH5A 1X4FA 1YRTA 1SL2A 4OQJA 5J1PA 1N33J 2ZH2A 1QD1A 5ETNA 3FQKA 4P2XA 1CJVA 3W65A 4JI6F 2FD2A 4KHMA 3DRSA 3HT0A 2FGOA 1QDUB 2Z2YB 3IG1A 4WTOB 2BA9A 3HHKA 1U2FA 2G9OA 1FFSB 5J1EA 2CJAA 5FLXU 1S99A 1WACA 5HAOA 2V2QA 5DLFA 3C2PA 3FRZA 2HFVA 2J6TA 1CG2A 3PX6A 4AUKA 1CSJA 4CT8A 3P4UB 3DGPA 1IBKF 3TA0A 4KPCA 5ETQA 1F5BA 3NS5A 2CWKA 3NOGA 1SJFA 2AX1A 4USIA 3HZGA 3SCIE 2CKWA 1N0UA 5CXTA 1N33F 5KFEA 3F44A 3ZNJ1 4KFBB 3JQJA 2XMVA 1RISA 3RR7A 2QRRA 3I0RB 2BACA 3W8GA 2XYHB 5CH7B 3LW5C 5CYQA 3IRXB 4RO0A 4CCHA 2Q6BA 3RYLA 3T1YJ 1S12A 3M8QB 3KLEB 3O5TB 2QA2A 4O4RA 3VALA 3V6HA 1MG7A 2ATLA 3HD2A 1L3SA 1X5PA 5A8RA 4I64A 3MPVA 1ACMB 2QN6B 1N32J 1NPRA 4I56A 4G6VB 4I0WA 1D09B 4HYKA 1GNKA 3Q8UA 3CPWR 4XO0A 1SJRA 2E5LJ 2HZAA 5AJ3J 1X4EA 2EBGA 2W7PA 3KNAA 4Q2LA 1RKIA 3PYFA 4OV6A 1L3KA 1FF2A 3T1YF 1G7CB 1RU2A 4C8OA 2OMLA 1J5OA 3TO8A 2KZMA 3VCDA 4Y6IA 2E5IA 3QT8A 2CQCA 5GMEA 2XLJA 2G0CA 5GMDA 2CZVC 3ULHA 4QR0A 3FK4A 2OPQB 4WU3A 5IS2A 4GMKA 1K8AT 4NZ7A 3HFVA 1GXLA 2DIUA 3P5BP 1W7WA 1WC3A 5AJ3F 1I1GA 1LFWA 2AZ1A 1Y7PA 3KG0A 3SI8A 1JLCB 3MAAB 4DQSA 4HL9A 3HHLC 4M5HA 1R0AB 4P52A 2DGVA 2W9AA 2DR7A 1UJ6A 3IC1A 2OO4A 3D0IE 2QEXS 1R89A 3FQLA 1R6YA 3HSDA 3MD1A 3PO5A 4USHA 2DGQA 1M1KT 2AJFE 2C3PA 4ZMMA 5BYQA 4B9SA 1S9EB 3MMCB 3DXSX 2JFDA 3I0SB 1KFDA 1VQMS 3GYNA 1KQSR 1G6BA 3DOLA 1YBTA 4KFBA 2RVJA 2KVIA 3I0RA 1FXRA 4ALZA 2U2FA 2KG1A 3W66A 3FZ2A 4ZDNA 2KXFA 1ZZNA 1U48A 3LF0A 4TKTA 2RS2A 3I31A 4K4TA 4PWUA 3QJPA 1HL6A 1KLMA 5M2UA 4ZPWR 3CF5Q 5EUHA 2AX0A 2XMKA 3M8QA 3KLEA 3QLHB 1QSLA 1RAAB 2CYYA 1XWLA 4LF9J 5KFDA 2ADCA 1U26A 1RT2A 4Y65A 4DV2J 1RI7A 2X1GA 2MGZA 2P8IA 2KU7A 3EZ5A 2CJYB 1CVJA 3TJ8A 2MQMA 3M8RA 4BDPA 1EAYC 3T6BA 4UT4A 1IM4A 1UKUA 1NK9A 3PG9A 4GC7A 1VIOA 2VOOA 2ZH8A 4FF1A 5GAHU 1ZZFA 4RNOA 3LP0A 1FDDA 2FY8A 2XMTA 3J7YI 3H2LA 3UR0A 2IAJA 2C3UA 2W7OA 2C2EA 4IG0A 3N79A 5ETRA 2J0SD 3P49B 4LF9F 5G0RB 2VQEF 4QOTA 4JBCA 2DRBA 2BJDA 1T9UA 3ET6B 4RBTA 2DO0A 2R4FA 2OPQA 1RCXB 2ACMA 4U95A 4C48A 1YJWS 3V6KA 2UXDJ 4PXEA 3SCLE 4EUVA 4ENOA 3BB5A 3N01A 1JLCA 2YWHA 4L6V3 2QMXA 1BHNA 2AV5A 4DQIA 5KAKA 1FJGF 1Y9OA 3M6VA 4ECWA 1YG0A 3G9CA 1SUQA 3JTNA 2Q79A 2NXJA 5HBMB 3PKYA 2VJUA 4L3NA 3BKFA 4EFAC 3FUYA 1FKPB 4OJHA 3M8YA 4ZPTR 2XMUA 4A8FA 2XZDB 2HW3A 1VQ9S 3K17A 2KXNB 4A4JA 2UXDF 2ACYA 4X4UA 3HKWA 3U7JA 3EGWB 1NEEA 3BQ1A 2HHQA 1I51B 4KY3A 1S1WA 1KOHA 1Q78A 4OJ3A 5GVQA 4G1PA 5KFNA 4LVNP 2MY8A 1JLAA 2UUCJ 1JQGA 4USUA 1WEZA 3LAKA 4LSLA 1HBMA 1VHFA 3V81B 4O3OA 1PGZA 1UVJA 5E3AA 3MAQA 1UWBB 2O3DA 3B82A 3QLHA 2DXEA 1NDKA 2C42A 4IOBA 4IFYB 5HMZA 5KG5A 4L74A 3D3CJ 2AW0A 3CJ4A 2JOQA 2HK3A 4WP9A 2DB1A 2YWGA 5K9FA 2DH7A 3NCQA 3P8BB 1D3WA 1TVRB 2Q1LA 4PG6A 2ZC4A 4YR2A 3H25A 4LUBA 4K4YA 4CWBA 2N3OA 3Q2SC 2WRMA 1UVNA 4LF4J 3KJNB 3MEDB 3Q24A 3X1LB 3JSBA 3VVUA 1QAXA 2CG8A 2YVSA 2F5GA 1Q79A 2UUCF 2HBYB 4I7FB 3VAIA 4YHHJ 1VQ7S 5IFMA 2MKYA 2FHOB 5GAGU 2W4PA 2MLZA 3AB2B 1F5CA 2V67A 4B3MJ 5IT9Y 1B4SA 4X65J 1T03A 3TAQA 1T9XA 4OI1A 5G0RA 4R8UA 1WD6A 2B9YA 3G87A 2Z57B 3NG8A 1W2IA 4TVAB 2F3JA 3ET6A 3HD1A 4JV1A 2HNZB 3R2DJ 5B0FA 3CCSS 4TQRA 4K5RA 3HULA 2V2VA 4F4ZA 1IWGA 3OSPA 4LF4F 2DNKA 3DKDA 2YX1A 2YY3A 4ZPVR 3D6FB 4X64J 3FCVA 4DL2A 2PDAA 4YHHF 4B9UA 1HQUB 1RT1B 2Z2ZA 3RB3A 4DV5J 4OX9J 3US5A 4RW8B 4LBHA 5KFWA 4AQYJ 3CJSA 4B3MF 3HKZD 3DM2B 1SL1A 3C3LA 2NLWA 4QIVA 4E2FB 1QJHA 3ENVA 1S77D 1FRIA 3CCLS 4GO5X 4ECSA 3A12A 4ES2A 4K4WA 2UU9J 2PGCA 2EC0A 4M1KA 1H74A 5KT6A 1FKPA 3KOAA 3TUJC 1J27A 3A4TA 1PYOB 5CZVA 5HANA 4IDKB 3KFWX 5DQGA 2WSEC 2XTJP 3J7YU 2BUNA 2B51A 3CCQS 4FBTA 2EK6A 3VGSA 3BGUA 3GWCA 1ITPA 5D4PA 5KFPA 2W2PP 4X64F 2LQBA 5MLCV 5DGAA 3KLIB 2FJXA 1OQ3A 4D3GA 2OMOA 1SQEA 4KGVB 3AQOA 2MKHA 1GMVA 4DV5F 1QE1B 4OX9F 3J7ZT 4AQYF 3MM5A 4I2QB 3W8PA 4TLRA 4F0HA 2UU9F 1IKWB 3PJWA 2AQ4A 2MKKA 2YKAA 3BH7B 1EETA 1TVRA 3UW1A 3GONA 3HSJA 3RBXA 3F41A 1BUXA 3SCKE 5F8LA 4JYAJ 1OPIA 2UVRA 4J37A 3R97A 4HH0A 4QWCA 3BO2A 2CNOB 5L1IA 3R7NB 1N52B 1M0SA 2H54B 1T9TA 3M2VB 2VV5A 1HBNB 4YR3A 2BMBA 2IBOA 4ED6A 1CC7A 2R7TA 2C2NA 4C3MA 1M5PC 1N54B 1QY7A 4PZVA 4WE1B 5B08A 4JI7F 2V34A 3AQPA 4Y2AA 4M94A 3POTB 2HNYB 2QMUB 2EG2A 1PILA 4DU7A 1FNXH 1QSSA 2UZAA 2IMWP 2AKWB 4LR9A 2ASJA 3V6DB 4HHJA 1K47A 2ZH4A 4CQ1A 3W9IA 2CJXB 2PMWA 4ITSA 1IN0A 1LWCA 2Y0BB 3CCJS 4LR7A 4DWIA 4YFUA 4DF8A 4LSZB 1IKVB 3HLUA 1NK0A 2BKPA 3DOKB 2SXLA 4OHZA 1Q95G 2MLYA 4KYZA 2V6AA 2ERRA 4RPFA 4IOCQ 2AP6A 2IDEA 1HQUA 1FNMA 1WC6A 2G4BA 2HHSA 2E1PA 3FKBA 2MZRA 2OPSB 3D7SB 2YKNB 3Q86A 3DM2A 2GJFA 2IM3A 2VUGA 4KGXB 3P3DA 4YY3J 3DRPA 2HIYA 4HVZA 3D0GE 2QTWA 2HURA 3WDOA 2V0NA 3J81j 2HQIA 3HFKA 2V2ZA 3GYXB 3WIVA 1RAFB 1YZ6A 5H9FK 4B3RJ 3IM9A 3IXQA 2CJQA 4QPTA 1TL7B 4QIEA 1R8HA 2E1RA 1TAUA 2M3DA 3RU0A 2YNIB 4KKOB 5IOLA 3D1QA 1G4CA 4B02A 4ZVTB 2IJNA 4YB1P 1VQNS 3UI3A 2R2TA 4OHWA 5A8WA 3IA0A 2L3MA 2NXNA 5D4LA 4AXJA 4CH1A 4DX5A 5AE3A 2R2SA 4CO2A 1OY9A 3HHNB 4Q0BA 3Q23A 1U2RA 3BKUA 1SKUB 2XMMA 4I2QA 4FF2A 3I5AA 4F4YA 3RAQA 1PBUA 2XB2D 3OTBA 3OXFA 1AXQA 4WWSA 4YB7A 1M5VC 3UCZP 2DCUB 2IM2A 2OP5A 1YKWA 2GVZA 4B3RF 1HI1A 1O0PA 3D28A 4ANCA 3MR2A 1FVQA 2Z2MA 1HBNA 4BCAA 1D0EA 5D15A 4ERDA 4DR4F 4PG7A 4ZP9A 5ETMA 2HRUA 3EDRB 2CWXA 3MHYA 3GV8B 1DY3A 4NL5A 4LFBJ 1SIWB 4A8SA 5A6WA 3GQCA 2HNYA 5LSRA 4KIAA 2I9SA 3HZEA 3I4HX 2JRSA 4OFZA 2YNGB 2YNHB 3QJLA 1L3UA 2K7JA 2CQIA 4EI2A 1SKRA 3ZZPA 3TVYA 8ATCB 4QPXA 2E9TA 3I87A 3K57A 2QSWA 3QPIA 4H4MB 3SBMA 2Y9HA 3OL7A 2CPHA 1IKVA 3DGVA 3CDUA 4YB5A 1DURA 5B0AA 4ZCKA 4HDHA 1U09A 3OXLA 2VPYB 3KJFB 2HVEA 4KGZB 2WSFC 4RW7A 2V8DA 3CJKA 4LFBF 3LQVA 1Q8KA 2HK2A 3QZ7A 3MCNA 3NOCA 1HNWJ 1WHXA 1S72S 2KT2A 1UVKA 4ED3A 2VB6A 1YJ7A 1TK5A 4UQTA 2DRDA 2DXDA 1S48A 1YX2A 1VRTB 4E98A 2FLLA 2D3UA 2KM8C 2LYVA 1M5OC 2AEJA 2W2OP 4CI0B 1CEZA 5EDWA 4MK9A 1U0HB 2OEKA 1GAOA 3QO9A 4G1QB 3CJTA 3CULA 1X7VA 4KQZA 1EKRA 1RHRB 1RWNB 1S6UA 4J9SA 2YNIA 2H65B 4KKOA 1MWQA 3TVKA 1TL3A 2AGOA 2B5JB 4MH8A 1NDLA 1WOSA 4QWEA 3ZC4A 1HNWF 4CO5A 2XULA 1XEZA 1SI9A 2NXEA 3HVAA 1U45A 1O5JA 4CNZA 4B17A 3EGVA 2FJDB 2MZJA 2GMLA 2O66A 4ECUA 2V9WA 4LF1A 1U1MA 2V94A 5HVFA 2EFNA 1Q8BA 2LEPA 2CPIA 2GAHC 3H5YA 1YWXA 3DRRA 1C4AA 3DLJA 4DFKA 4DPTA 1JNZB 1S9GB 3JYTB 4N77A 3N4WA 1K73T 4F0KA 2VQFJ 3EDQB 3S6EA 3U02A 1AUDA 4NCBA 2XO7A 1QAIA 3H2VE 1GTEA 3IBCB 3G8SA 2B0GA 2ZDPA 2IM1A 3M7VA 4XIUA 2JDJA 3AOCA 3ZZOA 1I6JA 1FTCA 3G2XA 3PFOA 1S49A 2RDIA 2YNHA 1NHUA 3PW4A 2Z8QA 3TZXA 2CJBA 2EW9A 1X5OA 2LKZA 5AXMA 5KFKA 1D1UA 2HVHA 1OY8A 2PD1A 3EXCX 5H9EK 2CRLA 1N88A 4N47A 2GGPB 2W2MP 4GKKJ 4DSFA 2M7SA 4HLBA 2CQ3A 4IKAA 3UCUP 1VQKS 2FGCA 3OR2A 1TKTB 2LA4A 3CJQA 2UXCJ 3FC9A 3IWNC 3PNIA 3I9V9 2C3MA 3FJ2A 2G0IA 2ALYB 4ZHRA 4DR7J 3OR1A 4NMXA 1EARA 2JNJA 3HK2A 1TUVA 4PABA 2QMWA 1F3VA 3A3NB 3BYPA 3BPDA 2MLXA 5H9FJ 4PR6A 3QBCA 4ZPCA 3OL6A 2JJ4D 3E51A 4V1Ak 4CNYA 3N5BA 1SL0A 3A8JA 1NHVA 2UVVA 3LPYA 4F2SA 2NREA 1HARA 4GKKF 3C6TB 4LVOP 4G1QA 4WKYA 4NA1A 2WVDA 5K5MA 3MPYA 1JKHB 4I6YA 2F8EX 3LP1A 1RWVB 2UXCF 1SJ3P 4X84A 1WEYA 3OW2R 3LP2A 1REVA 5EX0A 1UVIA 2B5JA 3ZTOA 5HO4A 4DR7F 3E3XA 5D6GA 3ZZUA 2B8QA 3QJJA 1RT5B 3T1HF 1VLOA 1TKXA 4B3OB 4HI1A 4DUYF 1I94J 1CC8A 3W5XA 1UPPA 2WOMB 4LRBA 1R6VA 5BYSA 3BGRA 1ZAWA 4UZCA 2CADA 2EVZA 2GA7A 2KYXA 4V19J 1MROB 2V5HG 1M5KC 5IC6B 1IJEB 2IBKA 2YKMB 3B6BA 1FKOB 3KTQA 4NLSA 4P72A 5K8MA 2HIQA 1JJ2R 2QFIA 2XBPA 2ABYA 4JI4J 3GZ7A 5DO2A 3W64A 4ES3A 4RUHA 2QLXA 1U6FA 4F4WA 2NSCA 3WHIA 1SVDA 3K8VA 2KXHA 3IRWP 1I94F 1IR0A 4W90B 4B3SJ 2RKIB 2OFHX 2G1HA 1YI2S 4DU8A 4JI2J 5KFGA 2FYXA 5IM0B 3ITHB 2YQ0A 1LWEA 5J2NB 3RW6A 1IVZA 1H73A 3OD2A 2P9EA 2CPEA 2LA6A 4IFVB 4O0NA 4GO7X 4R0JA 1RAHB 2OEMA 1HI8A 3SQGB 1WI8A 2MZSA 1RAJA 2X7IA 4M5IA 4R5PB 5CCMA 5L8RC 4DV0J 2UVWA 1RCOB 1D8ZA 3IFEA 2L9NA 3W5YA 1H7WA 4JI4F 4K4XA 2V8PA 3BO4A 3I5BA 5KFIA 2CQ4A 1RAEB 4DZ6A 3MZIA 1ZA1B 4YUDA 1N8RT 3GG0A 1Q5YA 4URQU 3SV3A 2Y1RI 2ZVIA 2IY5B 4B3SF 2XEXA 2H5IB 4JI2F 4NXNJ 5IWAJ 1NRKA 3OLBA 3MR6A 2QSFA 2LXUA 3EXYA 3I4PA 3PYDA 4DEZA 1SPBP 5KFBA 4PRFA 2IYGA 2A18A 1U1NA 2HS4A 2DIVA 2CQPA 4CLZA 3AJ1A 4DV0F 4PEOA 3V5RA 4FYYB 2NCKL 1RTDA 1URNA 3JAMY 1O6XA 5L38A 1RT5A 2LEAA 1HNVB 3D2WA 2HFOA 3RUBL 1VQ4S 3R5GA 5ETOA 1ZS6A 2KVQE 2VD3A 4DR6J 4N8OA 3RRKA 2BZ2A 5HQMA 4UUXA 5E3RA 2APOA 2FVSA 2WOMA 1F9FA 1X5TA 2B9WA 2KHDA 4DPOA 5HROA 4NXNF 5IWAF 1WF0A 2WHOA 1GXTA 2HFSA 1RABB 1U47A 4FYXB 2J0QD 3IO1A 4QWDA 1SH0A 3L9ZA 3DDKA 2WK4A 3QATA 2NPFA 2CQ0A 4ZJQA 2YKMA 4C8YA 1FRJA 4NYPA 1IBMJ 2H3EB 3O6QA 1N36J 2ALZA 4CLKA 4EO6A 2MTLA 1KRPA 3G8TA 3JSMA 2ZE2B 5F8JA 1CJTB 3O1LA 4JP8A 3BBFA 1B99A 2DBBA 1OMSA 4C4WA 1BWVA 2RSQA 4DR6F 1D9FA 2XLKA 3HVWA 4CLWA 3FSYA 4IUFA 5IM0A 3DU5A 4L73A 5J2NA 4YEAA 1NK4A 2ZD1B 4JI5J 1JJCB 1FA0A 3VQTA 1VK3A 4CO3A 5CYJA 3VZHA 4IQMA 5CABA 2CDRB 4WYLA 1QVFR 5CZXA 4HKQA 1IBMF 5HP1B 1N36F 2OKQA 3KDNA 1NPKA 1EP4B 5B0BA 1BWEA 3UN3A 1JLGB 3NLCA 1WG4A 2XSFA 4UOFA 2K3KA 2LQ5A 2VBXA 3C14B 5HSPA 3GIIA 3BV8A 2H5EA 1RBAA 2GW8A 1UA1A 4P2MA 4ECVA 5B7WA 3CJ8A 5C25B 5THWA 4PPDA 3C16B 4Z7YA 1RWXB 2PFDA 4WP3A 2Z2LA 4DSEA 3ZZTA 3JB9k 4O3QA 2ZHAA 1VLYA 3C6UB 2J9CA 2RF2B 2FIUA 3DOMB 4NLXA 3KHGA 4NOHA 4DG1B 1RLDA 3EUNA 2D3O1 1AA1B 2VFVA 3UNGC 1HQEA 3CCTA 2R7SA 4NASA 2UUBJ 4WTYA 3VZIA 2XQCA 1UMJA 2WCXA 3J7AN 4KV8B 3J81U 1FRLA 4Z2XA 3PHEA 4DFJA 3KHRA 2Q3PA 3KK3B 2DHAA 2RHQB 1HNVA 1T02A 2AT1B 2ZZMA 4X4RA 1RACB 3K5OA 3R7BB 5HL7Q 2ROPA 2DPIA 1N34J 4I68A 1JMTA 3GR0A 2PEHA 2PSZA 1CBKA 1UEKA 1BY9A 1TL1B 2GMJA 2OFGX 4CM0A 4RU9A 1O8BA 3R5CA 2ZH7A 2A0FB 2UUBF 2B8PA 1APSA 1W26A 4B08A 1RTJB 1N0VC 2J76E 5RUBA 4LQ3A 4DR3F 1WUUA 3HVTB 1DRZA 2DO4A 3CIMA 4Y2CA 5EHHA 4IQXA 1CJTA 1WC1A 2ZH3A 5HK4A 4ZP7A 1HHQA 1YJUA 1ZM9A 1EQMA 3TP2A 4TY8A 5DM7Q 7FDRA 4WBFA 3BN4A 4HTIA 2CNLB 4MKYA 1LK7A 2F1FA 1X4CA 4MJKA 1BQXA 2GHPA 5E7OB 1N34F 3UO0A 3H20A 5LXRA 3DLKA 4DHVA 4PXDA 4M5MA 1LWFB 5HLFB 1RWKB 1HMVB 2FY1A 4NMLA 3RBEA 2W9CB 4TNOA 4NLOA 3HHDA 1JLEB 2VFTA 2VFSA 4K4SA 2DGOA 2OHDA 2BOPA 4NZ0A 2YKOA 1T0TV 2DD8S 2KRBA 3BDPA 5AXLA 2FJVA 3L7OA 3OHBA 1WORA 6FD1A 3ZXWA 1N5SA 2OTLS 4F0MA 1RTIB 2KRRA 1R0CB 4DI6A 2CQ1A 1S1UA 1YRUA 3KJVB 4BWJA 2OD4A 1ROFA 2A6OA 4CZCA 3C16A 3BJYA 2ZBRA 2C2DA 3KJQB 1XC9A 2NUUG 3CJ2A 2RF2A 2BR0A 4QW9A 4F4AA 1YRXA 4F2RA 2HWIA 1H0HB 2AJ1A 4Q8FA 4TU8A 5DZ7A 5KFFA 3SCJE 5ETVA 1VRUA 3KK3A 2X3DA 4M95A 1VBXA 2V4RA 2BJEA 1BC6A 4YN3B 3I56S 4ANEA 4P73A 2JC0A 1LW0B 2CZ9A 3ZTSA 5EGYA 1SC6A 3E01B 4DSKA 5KG7A 2LECA 2HHUA 5KG4A 1HD0A 2DXFA 1IM6A 1JXEA 1DAXA 3RJMB 1T95A 4F50A 3PJ9A 2V8VA 4USWA 2PMHA 2CPXA 5F8NA 3GFXA 3SZ2A 1R0BG 4NEYA 1KKHA 3KK1A 3CJ0A 3K5NA 3HXMA 1D9DA 4ZVFA 4CLPA 1WJ9A 1RA7A 3ILJA 2JHEA 1TL1A 5BR8J 1TFYA 2OSRA 1RTJA 3RZAA 3M2UA 5ADZA 4JV0A 3BF4A 2AYMA 5D0RA 3SXLA 2V8HA 4QJVA 1PO6A 4WYWA 4A8MP 2HEKA 3QAEA 2GQQA 3HVTA 4ZCMA 3AFGA 4G1IA 2VICA 3UQSA 2C3OA 4A46A 1R27B 2FLNA 3R3TA 1RT6B 5KFJA 3PO4A 3M8WA 2HHTA 1CULB 1FHTA 1UL3A 2VC1A 4KSEB 1OPZA 4X4VA 2I5JB 2JL9A 4RW9B 4X4TA 4DR5J 4ZCIA 3GFHA 1S57A 2RRBA 1QTNB 3GG1A 1NSAA 4DR2F 4HHUA 1H2UX 3FSIA 5EN1A 3M32B 5LXYA 1HMVA 3S8SA 5BR8F 1UCNA 2W9CA 4ED0A 3DLEB 1JLEA 2VPXB 4DCJB 3HDSA 3TI0A 1NAQA 4WFAQ 2YNFB 4AE5A 1Z4UA 5DQHA 2UXBF 2KZZA 2ZFHA 1S0MA 2R7UA 2VKZG 1Q81T 3NGSA 3WBZA 3WC0A 4H4OB 1UVLA 5LJ5Y 3MI7X 4F7VA 3GIRA 4I67A 1YJ9S 2KT3A 1CJKA 1R8PA 3KJVA 2O1PA 2Z4PA 3C66A 1FJEB 5JXSA 4DR5F 1R8BA 5HN0A 3HT3A 2EK1A 2PIIA 1KVIA 1QLNA 2PMZD 1B70B 4NX9A 4IG3B 1RTZA 3MOJB 4DCPB 4BC7A 1S1XB 1VISA 1QUPA 2UUWA 1H3DA 2LEBA 4UY85 3KLHA 3ENQA 2PE8A 1YJNS 2C22A 2MPUA 1MNEA 2I1RA 2LP4A 5HVGA 4URGA 2GVDB 4F4KA 2QLFB 3WQPA 3TQ1A 5EWGA 2YWKA 3DCAA 1RT4B 3TNVA 3RB6A 1F9HA 2LU1A 4WXOA 2HHHF 2K8GA 3OUYB 2KJWA 2WVEA 4ES1A 2EBEA 4OX6A 2E7VA 3HHLB 2HLTA 2XWYA 5A0YB 3W2VA 2GX8A 4DQPA 1A7GE 1NH7A 5FDLB 3X3UA 1Z1ZA 5D4OA 1W25A 1S5ZA 3M05A 2XLIA 4CYUA 1RXOB 4DL3A 2LQJA 1EIYB 1AZSA 1K1QA 2XO6A 1U6ZA 1X8DA 2XYGB 2IVFB 4PQUB 1D8YA 3LAMA 2AGPA 1QSYA 2W2NP 2OPPB 4C8NA 2HSEB 2AD9A 4HR2A 1WSVA 1Y5NB 4C3LA 3NCRA 7AT1B 4OHYA 4UOGA 2KN4A 2KI2A 4DLGA 4XDCA 2D3ZA 3R1LA 4BBYA 2QLWA 1CULA 4KO0A 4B9VA 2J9DA 3H5UA 2ZJQQ 2WTFA 2A2DA 2QIFA 3SSSA 2W01A 1RB0A 1F0XA 5ETPA 2ZC3A 2BBEA 3M8ZA 2IM0A 4LREA 3IR7B 2R7VA 4A8XA 4FXWA 2XYPB 2G0JA 3MEGB 1RAOA 3ZO7A 4LFAJ 1VR6A 3IWLA 4TN2A 3CD0A 2YNFA 1UJ5A 3CC2S 3SIPB 4F8RA 1Y5LB 2AYEA 1C1CB 4HDGA 1WTFA 4LF7J 3ILIA 3ZZRA 1HA1A 2HHWA 2ZVSA 3RTVA 4OYWA 2R42A 2CNNB 4ICLB 5KG0A 2XSJB 1LEOA 2YH1A 1Q1KA 2BQ3A 1NB7A 5LMNF 4QYZK 2MKIA 2ZM6J 2R8GA 3MEKA 5M2RA 5U47A 1V3ZA 4AL5A 4IG3A 2J7KA 3FMBA 1S1XA 1RAIB 2ZHBA 3EWGA 2M2BA 3K59A 4DZDA 5A2QY 3BN7A 1CJVB 3DI6A 4LFAF 2AHOB 1Q16B 2A2CA 2V4QA 2MY7A 4Q2MA 1NJYA 3IG1B 2GIQA 3IWXA 4KHPJ 1C0TB 4X4OA 1C2PA 2PEBA 4LF7F 3TJ9A 2JX2A 2WONB 3N9UC 3HHLA 2MKJA 3OSNA 1WHWA 1S6PB 5CAAA 2W4DA 1HYSB 2EWHA 3HP6A 3C19A 2POKA 5EX3A 5DG7A 2DGTA 3PTWA 5FDLA 3WIUA 2R7XA 4ZVRB 2ZM6F 2BABA 1T05A 3OTDA 3EVWA 4OYBA 1VCTA 3DU6A 1KTQA 2MQQA 2W9BA 4ZLLA 2HQFA 3Q8QB 2Y3YA 2OPPA 1QM9A 3K5MA 5HATA 5LJ3Y 3OJSA 3K0JA 4RW4A 3MM8B 2VBZA 4MFBA 4K2XA 3MGJA 1PC4A 2P6SA 3NS6A 1GQEA 3BZQA 1J5EJ 3QGIA 2E5HA 2QT7A 1IR2A 5E3PA 4KHPF 1JLQB 1BMQB 2XCAA 3LO3A 1FE4A 3HHEA 4DX8H 2YBVA 5A8KA 1D9AA 1TELA 4RBUA 1N5TA 1B0PA 4DPUA 1SV5A 4ED2A 2BM0A 3KG1A 2AF6A 1IKXA 5IC4B 4V19X 1OQ6A 3FNNA 5A8RB 3DYAA 5KG2A 5SUHA 4K59A 2E5JA 4M8LA 1GX6A 3RW7A 3QGGA 1VQPS 3MUTP 5CD4A 1NJXA 2IIHA 4ZK7M 5IT9U 4PG4A 2M4MA 3SSQA 3THVA 3VR1A 4DX7A 1Q8IA 5LMUF 4AXIA 2E1AA 5IT0A 2BX6A 2HQ3A 2EFGA 3F0NA 1PG5B 1E6YB 3H5XA 3G86A 4B3TJ 1C1CA 1NZ8A 3K89A 1AT1B 2FC8A 3GLJA 1J5OB 3IR5B 4MMOA 4M63A 3ETMA 2LLZA 4YS2A 3D1OA 3MPDA 4USMA 2R7OA 1DJ0A 3LPEA 1GMUA 2RE1A 1BLUA 2WW4A 3NWGA 3PEHA 1PAEX 1NNDA 2LDYA 4YMEA 3LGMA 2KDOA 2L48A 4RNMA 1XJWB 2K1RA 1JK9B 3D66A 1VFJA 1WEXA 4ZVQB 4ECXA 1NPPA 1KTVA 1MLAA 5KT2A 4C6AA 4WPAA 4ZPDA 4L75A 3L95X 4G3IA 1C0TA 4B3TF 4DPWA 2WONA 4CH0S 2VU5A 3MMAB 1S6PA 1HYSA 2N82B 2FJEB 5KG6A 3DMJA 4ZVEA 1SC3B 3QIPB 2M70A 1PC5A 3H8YA 3ICLA 1RSCA 5B0GA 2O01C 1M1HA 1RWWB 1UAWA 3M2RB 3CXCR 4BC9A 4RZRA 4USKA 3QGHA 1RYSA 4ZVGA 1HW8A 1U1PA 2IRUA 3PJXA 3DOLB 3PFEA 4CM2A 1X60A 1SH3A 1NJIT 1VS3A 3MM8A 3Q0AA 1FD8A 1S4EA 2ZDOA 1KLMB 4J9VA 1JLQA 2CJ9A 4OX7A 3DLLQ 4L76A 5E3QA 3B78A 1F6TA 4EZ6A 3PR4A 3MAHA 4Z37A 1FWLA 3G82A 4DL6A 1RT2B 1OJ4A 4K4ZA 2MGZB 4X4QA 4DS4A 3MM6B 5ETKA 3M6WA 2BW2A 2AYBA 3L7UA 3M8SA 1S79A 1RT7B 3QGPA 5KFQA 1AB8A 2QL7B 2OH2A 1U2CA 2IRXA 5AXKA 5HMXA 3DFEA 1U1KA 2G2YA 2N4DA 1KOOA 1XN9A 3TQEA 1H6KX 3LP0B 3Q8PB 2ATCB 5A6PA 2JC1A 4TLQA 2HWTA 4Q7AA 1E6YA 2IAJB 2XY7A 1GTHA 1H98A 1K44A 3PW2A 3CC4S 4IG0B 5C24A 4Q45A 3EM1A 2CPJA 1RWMB 8AT1B 1KONA 2XMWA 2FHMA 1U1OA 2EFQA 1C4CA 2NYHA 1Q86T 5DS7A 4EMDA 1RT3A 4URSA 3H0PA 1BQNB 5CQGA 3SV4A 4WIQA 4LFCJ 1N32F 2HGLA 2RAQA 1ZM3A 1CS4A 1LW2A 3RAXA 3AAWB 4TXSA 1SB6A 3G4SS 3QWUA 2E5LF 2LCWA 5D3GB 2J8AA 2I6WA 2NXUA 4EWTA 3CCZA 2E9ZA 2C2MB 4OYOA 4PYDA 4F02A 4QCLA 3BKTA 2DGWA 4EZ9A 4C9DA 1DTQA 3CMES 2F4FA 1SUQB 4LF6J 3MMAA 4ID8A 4OI2A 2BANB 1ZM4A 4N5SA 2B3TB 1S0OA 3QIPA 5GAEI 4FNHA 4X66J 3OL8A 4PG5A 1E6VB 1HWUA 4I69A 3M2RA 2PI4A 4LFCF 4QIGA 2BRKA 2EC2A 3MD3A 3P6YC 1ZPVA 2GZOA 3G71S 2LMIA 2ILZA 4J90A 3HHLD 3Q8SB 1UW4A 1S1WB 2XHCA 3QFHA 3D3BJ 1RU1A 5HQ8A 4IH6A 2GO9A 2R2UA 5K20B 4U7UD 1OSCA 1JLAB 2NZCA 5K8NA 4LSLB 1HBMB 3TAPA 3BEGB 5ETSA 2VDHA 4J9KA 4LF6F 2N7CA 3FSXA 4OZ2A 1S6QB 5ETLA 1N6QA 1YK9A 1XK8A 4P10A 3I32A 1WG5A 2NSBA 3EZUA 3MM6A 4DL4A 2OGUA 1HKAA 4N56A 1RT7A 4PXCA 2IA0A 3N6LA 2CAJA 1H7XA 2HS0A 2GQ2A 5KFAA 1FJ7A 3DHXA 1CLFA 4DF4A 4I4BA 2H1YA 4UF4A 4DL7A 2DRAA 3ZTQA 4ZPAA 2LQ8A 2IYIA 1AFJA 1U24A 2ZBPA 4I2PA 4NA3A 2V63A 3CDEA 1M1GA 3Q22A 3IM8A 1W2BR 5FJ4A 5DQIA 3GV5B 1T03B 1WC5A 1G2EA 1VDHA 4R8UB 2OUGA 2R8KA 2W8LA 4RNFA 1BQNA 4DV2F 1M5SA 1V3RA 1WF1A 1WOOA 3M30A 1B7YB 2VZ9A 4RW6B 5L46A 3VGVA 3ISZA 1TKZB 2M9KA 5D3GA 1C0UA 3M6XA 2E66A 4KRWA 2BVZA 3MMBB 5KT3A 3D6HB 4MK7A 1LQ9A 3TRGA 3D68A 1FESA 4ZP6A 3O44A 2DY1A 1F3FA 4H4KA 5I3UA 2CQ2A 4LQ9A 3TZZA 2VG6A 2BANA 2DGSA 3HPOA 1RA6A 1V5VA 3MF5A 4ZN3A 2GCFA 2CQBA 4OV1A 1E6VA 3GPAA 4CO1A 3PR5B 2HZCA 3MEEA 1KP6A 1FD2A 2X51A 1AFIA 5JMNA 1HHSA 3OHAA 2KM8B 4NLGA 2ASDA 3PDNA 1HI0P 5F8GA 4K0KJ 1YJRA 3ISNC 2PN6A 1FXLA 1XMOJ 2PO4A 2VHGA 4XDDA 3QMQA 2IJRA 2WVFA 3CJRA 2IVMA 2BEFA 3JSRA 2MZQA 3Q8RB 3GV7B 3MM5B 4DUTA 1S6QA 5DG9A 3BREA 3I9ZA 2VA3A 5CCLA 4MYTA 5KFXA 4O3SA 3CNQP 1EETB 6AT1B 1UWAA 5HJYA 4CLSA 1LK5A 3MFIA 3ISND 2VH7A 3JXOA 3I5CA 2F8HA 3ENAA 1HNZJ 4ZIWA 5GMKa 3QNWB 3Q8VA 2MB0B 1XMOF 5F8HA 1RE1B 5LOQA 2L9WA 1IUJA 1RJJA 3TR5A 3T3FA 1VOMA 3K2YA 3I6PA 3HI9A 5C2CA 2B4UA 2RHSB 3EVOA 1QUVA 1TR0A 4CIOA 1WHVA 3VAHA 2FJBB 2OAUA 4Q43A 5CA5A 3CDWA 3MURP 1GH8A 4X62J 3QT5A 1JWWA 4O44A 4UOHA 3DC2A 3CO9A 4RW6A 1R43A 4OHXA 2Y8YA 1LWCB 1TKZA 4PCQA 4F25A 1HR0J 3CCWA 4Y2KA 2OLWA 1HNZF 1IJFB 1XNRJ 3MMBA 3I96A 5GADI 4Q5VA 4MIBA 3W63A 3T5LA 2NS1B 5DDQC 1S97A 1OSDA 2AMCB 4OZNA 2MHEA 3PM9A 3R5DA 2ZNYA 4X65F 3BH6B 3DRPB 1IQTA 3KHHA 3EMTA 3MECA 4E0DA 3LWLA 3NXZA 4X62F 1ZAXA 2ROEA 3TAMA 5LSOA 5LM7E 3CWJA 1IQZA 4DMZA 2V4JA 1FRKA 3OTOJ 2A3JA 4ZITA 4EYHB 1DHMA 3AJ2A 4F3QA 3N6NA 1UFWA 1NMEB 2KJVA 1XNRF 4DV1J 2F8MA 4FP9A 1HBOB 2J5AA 2QX0A 3T5KA 4LRDA 3A1YG 5A8WB 3VHQA 3IN5A 4ZVPB 3IR6B 2VG5A 4Q0BB 3G6VA 4MYUA 1IR1A 4J7CA 4RWWA 4R0EA 1H38A 3PCOB 1S6OA 2DTJA 1DZ5A 1NO8A 2K2PA 2AU0A 3H4DA 2GVZB 4NPOA 3RAMA 3THTA 2RD5C 5E33A 3SDEA 3OPKA 2IC3A 2KYZA 3OTOF 4IR1A 2ASLA 1S10A 2GC8A 1TK0A 2R7QA 5C5JA 5AT1B 5HJXA 4LIRA 4DV1F 4OYPA 4DCOB 4TU7A 5J2PB 3FBBA 2IA6A 3TJAA 4K50A 2HGMA 3TANA 3U1MA 2M8DB 3N0VA 2PA8D 4FDFA 1LV5A 1WSRA 4Y3CA 4Y28C 3V4MA 4JV5J 3IGVA 2H9ZA 1ICEB 3FBFA 2I8EA 4ER8A 2LXIA 2ZKTA 3M1VA 2B4OA 2I38A 2YKQA 3GTYX 1HW9A 4FKYA 4BHQA 3KWMA 4ZVUB 2R8JA 2BE2A 1FRMA 5DM6Q 5D78A 1WC0A 4F67A 1OYDA 4JYAF 4HT5A 4ED1A 2DCLA 2XY6A 1R7IA 3TARA 4H4KC 1FNOA 2DGXA 4K8RA 2MKSA 1NUEA 4MKVA 3PRVA 3UDVA 4M5DA 4AL7A 4LRCA 1A0OB 1MU2A 2RDDA 3H59A 2KL8A 1NK6A 3BS9A 1Y3KA 4RW7B 3M8PA 4DQRA 2HAIA 1KQGB 4U9RA 1ZAVA 3CJKB 1JNRB 1KBRA 2M5YA 4JV5F 3T5HA 3KG4A 2NR0A 1F2HA 1TV6A 5L9NA 2VIHA 4DPXA 2QA1A 2RRNA 4EK2A 2CPYA 1ULRA 4P6QA 5KFUA 3MMJA 2EFVA 1HWJA 4TY9A 3JAMU 3UVJA 2EPIA 1DQ8A 3QO9B 4C98A 1SC1B 3QZ8A 2VF3A 1WDDA 2HFUA 1U6BA 4OZ1A 5KG1A 1VQ6S 2H5JB 4PUOA 1HBOA 1TL3B 1X4DA 3GJSB 3UFCX 4P74A 5T7LB 4AFFA 1BD6A 1WKKA 1U1RA 4P2FA 3BSOA 3UE2A 4YY3F 5F0UA 1TQLA 5KFMA 1L3TA 2LVWA 3PACA 4JI6J 1SBRA 3G6YA 2YPYA 3ONQA 4C8LA 5FD1A 1LWXA 2QFJA 3A3OB 3OT9A 3PZPA 5GADU 3QQCD 3AH6A 4NCAA 3DRRB 5DG8A 2P6TA 1X9WA 2FUG9 3UN5A 3BSNA 1NHKL 5T41A 2R8IA 3CB4A 1GT8A 4NLYA 2HVDA 5J2PA 1BQMA 3UCGA 4FXVA 1JIHA 2AJ4A 4ECQA 4C8ZA 1AYEA 5IQ6A 2HQDA 1V6HA 1JLBA 2A6MA 2XHWA 2JVOA 3GE9A 2D41A 4ILRA 2CJKA 3PRBA 2LXFA 4OI6A 1Y10A 1P1LA 3NP5A 4FVCA 4PXBA 3W2WB 5CHCB 5I3PA 5J2QA 3R5AA 1XR5A 2IJFA 2MSTA 1RWPB 1TK8A 2XCPA 3FVYA 2BV3A 3DLBA 5EWEA 1Q7YT 2A1BA 4FF4A 1V5IB 2WVBA 3OR2B 5GAHI 3FBEA 3MFHA 2V9KA 2W24A 2ADBA 3J80Y 2QC3A 3PX0A 4OZ0A 1VC5A 3EICA 1UPMB 3FFIA 2NPIA 3TUZC 1DARA 4X4PA 2Z58B 4XAKA 4ZHRB 3OR1B 1HWKA 4JI0J 2ZH1A 1WDTA 1PYTA 2WBRA 1S1VB 4CO4A 1JLFB 1FEHA 2J0XA 2NYIA 1URRA 1VC0A 5T14A 4GVBA 2Q66A 3MM7B 2A10A 2R7WA 4KH0B 1YZ7A 4A48A 3ZTPA 4QIFA 1WC4A 3QFWA 1SJ4P 1N5QA 4WJBA 4OL8A 2KT5A 5LL6d 3LP1B 5IV3A 2RJZA 2JLGA 1KDNA 4CLTA 4EBDA 1GEHA 3QRRA 3LP2B 1REVB 2AJ2A 1DTTB 1Y00A 2YQ3A 3L3CA 1XR6A 4JI0F 3BGLA 4RU2A 5T7LA 4NCGA 5K14B 3KNGA 4CT9A 4O3RA 1FX4A 4KGKA 2FVRA 1TKXB 3BBBA 1RWOB 3L09A 4C11A 4CLUA 3NAHA 5I3QA 1T9WA 1L3VA 1O51A 3BGRB 1LXNA 3VWSA 4NLPA 1F1BB 5KOXA 4GC6A 1UZDA 3OJUA 2BJ1A 3BO3A 1ZTTA 3PW5A 1R8CA 4YR0A 5KOWA 4IRCA 1TL5A 2R8HA 1KFSA 5MAOA 1U8WA 3NBPB 1NCLA 2QLBB 1BE4A 2YPZA 1J2VA 1FJCA 3R1HA 3W2WA 4KC5A 1X4AA 4WZQA 1FCAA 2J7UA 4OZJA 2DNNA 2BJ9A 4KPYA 1SKWA 3H42A 2BKOA 1VRQC 3LGHA 4ZKAA 4C7QA 1LWEB 4MK8A 1I5OB 3I82A 5BYRA 3GFZA 4MKAA 2HYIB 1HNXJ 2RQKA 2VQFF 2XMJA 1OIAA 1P27B 3MWBA 4F36A 1S4FA 5GAGI 1Z2LA 2X1FA 1S59A 4LRFA 2QL9B 3NGRA 4HEA9 1P1TA 1S1VA 1RZMA 4YOEA 1JLFA 1ZYQA 2VPZB 4CLFA 2OPRB 2AGQA 2GO8A 2ZITA 3NMRA 3GJRB 3MM7A 4OJ1A 3IRXA 3BQ0A 3OVBA 4HH1A 1REGX 4OLPA 1V9OA 2DEIA 3CE8A 1FFGB 1KS2A 3KK2B 1HNXF 1PSDA 2QL5B 5IXUA 1NDPA 2CIMA 1FEEA 1YSJA 1KEKA 2VQEJ 1DTTA 2KFZA 3NAIA 2KTQA 2ZBIA 3RBZA 1RTDB 1AROP 5L1LA 5K14A 3TA1A 2XY5A 1T9YA 4PYAA 3B54A 5IT4A 2B43A 3V4IB 2CDQA 5K8PA 1X9MA 1WI6A 4C8KA 4UW2A 4PKDB 1UTAA 3GJQB 3QRPA 4YDDB 1MN9A 1ZOTA 5IV4A 5HROB 4ELUA 4ETZA 1XNQJ 3NGDA 2CQDA 3T19A 4IO9Q 5K8OA 2DEJA 4GKJJ 1FJGJ 2XI3A 1YQHA 4GRSA 2ZOMA 2ZBQA 2XM3A 3KLVA 1NM2A 3PKMA 1JXLA 4CTAB 1IWAA 2ZJRQ 1CPZA 2Y1LB 4M5NA 2XZWA 3NBPA 2B56A 3JSMB 4N41A 3UDEA 1WOPA 2KHCA 2BW7A 1XIQA 4ILLA 1B3TA 1NK7A 1XNQF 1UFKA 3MAAA 4U6PA 3J7Z5 3W9JA 1R0AA 2YWEA 4N7TA 5KFHA 1I3OB 1RBLA 3MUVP 1T11A 4LF8J 4GKJF 4RBVA 4EU0A 4IRKA 3IBWA 1UEUA 3PIOQ 3LALA 4KR0B 3LH2S 4QWAA 2VODA 1S9EA 3MMCA 5HI7A 1IBCB 2Z56B 4KT0C 4XTTA 3I0SA 1Y4ZB 4F4XA 1KVJA 5F3ZA 1NKEA 2GAGC 2DJWA 1MMLA 2OPRA 2Z30B 2JLEA 4Y0FA 4FYVB 2O67A 3W1YC 4F26A 1CQNA 1DLOB 1RK8A 3ELHA 2QA4S 1TUWA 2DYAA 3GP9A 1RYRA 2IFXA 2FHKA 1R31A 5AE2A 4LF8F 1FI4A 5CYMB 4QR1A 4J9PA 3KK2A 5E5NA 4DV6J 1NZAA 1RAGB 2DNGA 1FWPA 1HQEB 3IP0A 1HIYA 4E8UA 4NLWA 1VIXA 2HVZA 2GV1A 4ED7A 1WWHA 1G1XA 3AXMA 3KYLA 1NSKL 5KT4A 4Z7CA 2B6AB 3V4IA 4FF3A 3JTOA 2CPDA 5HMYA 2CQHA 2Y0SD 3TEGA 4ZVSB 3CCVS 4NZ6A 2F63A 4O3NA 2G2OA 1ZTWA 1T8EA 3NGKA 1RHMB 3DRXA 2I0XA 2JEFA 3RB0A 2ZH5A 3AJDA 1ZPWX 2DNLA 3H4BA 4DV6F 3UD3P 4CLLA 3MOZA 2NQPA 4DFMA 4MIWA 4WFBQ 4CTAA 2E7WA 3C8YA 1IKYB 4FYWB 1JXVA 3PY8A 2VA2A 1R8AA 1SQFA 3W62A 1ZETA 5H9EJ 3RBDA 1U02A 1EX8A 3GIMA 4ZLJA 2N3LA 2GFFA 1VJQA 2UV8G 2RU9A 4DV7J 3SQOP 1AUSL 1H2TZ 4TY8B 1HHTP 1NDCA 2EKYA 2HGNA 1NLKL 2IMOA 3SEOA 1VBZA 1KSPA 2DNQA 4RWXA 5J2MB 2AJ0A 4DN9A 1UZHA 2EXUA 3DLKB 2EFPA 2MDAA 2RRAA 2F65A 2M8HA 4ZCLA 5E41A 1EQ0A 5HBMA 5DDRC 2U1AA 2V69A 2ZOGA 1KWMA 2FLPA 2OI2A 2J0WA 3CD5A 4ZOSA 3VQSA 4LRAA 3NNCA 3PYEA 5G4DA 5FLXY 3HMJG 3BDEA 4LF5J 2HNDB 2HPUA 3RB4A 1OYEA 2JWNA 3UPFA 5A2QU 1S1UB 5I42B 2PT0A 4DV7F 1QTMA 4WU2A 1DLOA 5KTQA 3FCWA 5JJBA 4ZLNA 3QRQA 4WK1A 4UTGA 3A13A 1SKSA 4NLQA 2E5GA 1NKCA 4UUWA 2QV6A 4JI5F 3VVTA 3V81A 3VV2B 4JI7J 5CYMA 3H40A 1UWBA 3VAFA 2WAQD 2DK2A 4ED4A 3TVZA 4DDFA 1UA0A 5I4MA 4IFYA 2HRTA 3CDBA 4A8QA 3MUMP 2J9DE 2QYCA 3GSIA 1VRUB 2XS5A 3GR1A 4CLYA 3M6UA 1BXNA 2B6AA 5D0GA 4OYZA 4LF5F 4FKXA 4KE5A 3TW0A 2AZ3A 4KJIA 5J1NA 3MEDA 3NGUA 1RP5A 4AD6A 2OIHA 1KHVA 5KFCA 2DR6A 3C15B 2HBRB 4I7FA 1WHYA 2DT9A 3D1HA 4NA2A 4NRUA 4KBIA 3KK1B 5ITHA 4LT6A 3R27A 3W3SA 1TZ0A 1P9QC 2WB4A 1C1BB 1LOUA 1IKYA 3IGNA 3T41A 2B7CB 1G3OA 3M2UB 8RUCA 2FVPA 3R2CJ 2HNZA 1FK9B 1UVMA 2AYGA 5FIIA 1UETA 2D74B 4WFNQ 3Q89A 3DRYA 3NY0A 4UZBA 3ZZ0A 4F3MA 2RUSA 3G96A 2YWWA 1HBUB 4MAKA 3UR3C 2X1AA 3D4JA 3FMWA 4EBCA 3VAGA 2W25A 3ZZYA 1U4BA 2M88A 5J2MA 1RT1A 3U1LA 1PJ5A 4RW8A 2DY9A 1PYSB 2ZUAA 4ED5A 2HQCA 4JV2A 4IR9A 2KH9A 1SCJB 2W8KA 4W4MA 1KVKA 2L9DA 2C28A 3AT1B 2FJWA 1LKZA 3D67A 2KB2A 1KQKA 3OFFA 5F3TA 3CMQA 3O8WA 2HS3A 4JI3J 2FQQB 4I6AA 4AYBD 4IDKA 5KFOA 3UN2A 1NJWA 1RHKB 2CFXA 2HNDA 5E0OA 3FEXB 3E8OA 3QYYA 5I42A 2ZOFA 1FDAA 1CJKB 3AD9C 4KGMA 2HAFA 1DQ9A 4J9UE 2MMYA 4P7VA 2RNEA 4DR4J 3KLIA 3QT7A 2G1DA 2DHXA 3NCPA 4MKBA 2W1BA 3EGZA 3MCSA 2DVIA 3HFZB 3E2EA 4J9OA 2AWZA 3J7A1 1QE1A 1TKDA 4C2MA 4QYRA 3AA8A 5DRKA 3CO0P 2B9EA 2MQNA 3OVAA 2R7RA 4A8WA 1IKWA 3KLHB 1CJUB 1ZH5A 2RB7A 1GXUA 2XZTB 4IRDA 4A8OA 3GSDA 4JI3F 1VGYA 4HTJA 3GCXP 5CD4H 5IQQA 3TZWA 3CIZA 1BGXT 1SJ1A 3PV8A 5D8HB 3T1AA 1P8GA 1FVSA 4EEYA 3M2VA 1Q82T 2DITA 2H51B 4C97A 4BWMA 1RDRA 4MIAA 4NXMJ 4OYAA 2DR8A 3C15A 3HVRA 1NH8A 3W2VB 4IOAQ 4DFPA 1K9MT 1FRHA 2BDPA 3W61A 4N8NA 4WE1A 2BQRA 4PWWA 1K0VA 4CYUB 5KT7A 3POTA 2Q6CA 1AZSB 4YP3A 2WVCA 5L1KA 1C1BA 1Q8LA 2CVIA 2F9DA 3AOAA 2DKOB 1FE0A 3HSZA 5E3CA 5JVHQ 5DETA 2YWFA 2B7BB 3IAM9 5HVHA 4FPRA 3V6DA 3HJVA 3MTKA 3OTCA 1FK9A 2H48B 1S0VA 4HHHA 3RG6A 4UQGA 1OS5A 3NNAA 3W60A 4G65A 4A8KA 2CXEA 3EJMA 3IS9B 2C1EB 2E9RX 1Y0HA 2WSCC 3DOKA 4KO0B 1HBUA 3KXDA 1GFWB 4NXMF 1VJWA 1KLNA 3AY0A 1TMJA 2PI5A 1FDNA 2IDLA 2FDNA 2QZ8A 2OPSA 2BE9B 2E7XA 2MZTA 2YKNA 1HNIB 2MJNA 2ZH9A 3R7SB 3KHLA 4I6WA 5DJBA 2AEFA 3GB0A 4DJBA 2UUTA 1R3NA 3TX0A 3ETOA 3PXGa 3PHTA 2UP1A 3GIJA 3MM9B 3V2UC 1FO1A 2K3IA 4J9QA 4UOCA 4EO8A 3T9ZA 1XMBA 1TL7A 3K5LA 2ZKUA 4ANDA 4KAIA 4YB6A 4K5SA 4P2SA 2FLOA 2MKCA 2HHPA 1H2VZ 2YH0A 4X2BA 2UVUA 2GMHA 3QAUA 2VBWA 1VQSA 4OJGA 3CMAS 2DHSA 3LGNA 3DDNA 3D0HE 1OY6A 4ECZA 1EB0A 2VFUA 1B0TA 1CJUA 3DI6B 4FZVA 4O3PA 4ILMA 2DHHA 1NK8A 5KFTA 4CDIA 2J6UA 2HWHA 4DSJA 2LQ9A 2RQ4A 2FHJA 3S7RA 1UFLA 4FN5A 1OWXA 1LXJA 2N4CA 3H98A 1NXIA 1VYAA 3PX4A 3EE3A 4LF2A 2GNKA 2W7AA 3IMQJ 2BXJA 4B9TA 3ZNUA 4EBEA 4LBPA 1T05B 4MT1A 3KLGB 3TX8A 1MMDA 3MR7A 2MJUA 4DBQA 1TUGB 4ID5B 2HFNA 4W98A 2W9BB 5LSLA 2C2OB 2CVEA 2F4VJ 4DL0C 1X4HA 2HMIB 2YNGA 3PIPQ 2DHGA 2Q43A 2ZJPQ 4FBUA 4RW4B 1XERA 3BR8A 4MFBB 2G2ZA 5BXIA 4OX8A 2BQUA 1PCAA 1TU0B 9RUBA 2JH3A 4NYOA 1YIJS 4H4MA 2K06A 4RL1A 4LMZA 3IS9A 3CTRA 4PWDB 5A8KB 3PRDA 3OV7A 3P96A 1SV5B 1M90T 3T5JA 2NXCA 1IKXB 4LIWA 5F41A 1F2GA 4FS1A 3OTEA 3DYAB 3A3PB 3CUNA 4QU7A 1HNIA 2FZGB 2C2KB 3CT9A 1YVFA 3T1HJ 2VONA 1NJZA 1T3OA 4F04B 2F4VF 2QLJB 3W5ZA 4DUYJ 4OI0A 3GCWP 1GX5A 2RIJA 1VRTA 3LWMA 3MM9A 4K4UA 1VBYA 3LUYA 1HWLA 4H54A 2OD6A 2XG8A 3FBCA 2XNRA 1U0HA 5B0CA 3UDCA 1YTYA 3KUGA 3K5PA 2HZVA 1Q7LB 3F56A 3K7RA 4WFYA 3V6JA 3MCMA 3R6LB 5H1SV 2FVCA 4ELVA 2KFYA 2CPZA 3D6TB 3EVMA 4U7UK 1MMNA 2MYFA 1YBAA 2VFRA 3TYTA 4DPYA 3JS9A 2K1RB 5JVGQ 3LOUA 3B8HA 3CCES 4KB7A 4CRJA 4RLEA 1S9FA 4WF9Q 1WG1A 4K4VA 2M52A 4J9LA 1Y3JA 2B4VA 2RILA 3M9OB 1QAYA 1H72C 3P5TL 1U7LA 1S9GA 3JYTA 1RTHB 3PYGA 3EGNA 1T9VA 2MEWA 2C3YA 4ZP8A 2UUAJ 4LSNB 2IVYA 3DMJB 5F8MA 3TUIC 3U27A 3GJTB 4DXLA 2R3VA 1HD1A 2V50A 3BR9A 3RRHA 1VMBA 2KO1A 3M9NB 2MXYA 2LDIA 4RJVA 4RNNA 3KLGA 3ZZZA 3AODA 5F9NA 4DSIA 4ID5A 3G6XA 2YKPA 2HMIA 2DH9A 1HLWA 2RQMA 5IZHA 2D1CA 2PA3A 3THPA 2ZNZA 4UY8T 3MDFA 3S1TA 3OQ2A 1OO0B 4OZ5A 3DLGB 2CPFA 4OYXA 2MHNA 5KFRA 2GGPA 2J6SA 3DN9A 5DDOC 1HWIA 3ADAC 3CCMS 3QSYB 1EZZB 1CQMA 4USJC 4C0OC 4PWDA 1TKTA 1VQYA 1Q5VA 1YITS 4M5KA 2G13A 2UUAF 2ZWPA 3G82B 4S0MA 4ZVOB 3VAMA 3NL0A 5D77A 1UP1A 3AXKA 4PQAA 1N5VA 3NGTA 3CCRS 3NKYA 3IAS9 1SJQA 3MCOA 2FJAB 2BKNA 1X4BA 3GIKA 2BE7D 5D0EA 4HACB 3VF0B 3QSIA 2DH8A 3R6GB 1J5EF 2P9GA 3O3LA 2AIRB 3C6TA 1U0SA 2GIFA 3DDIA 5C24B 1PKUA 1JKHA 1X0PA 4WP8A 2GQCA 5DLGA 2XS7A 1QVGR 3JQMA 2HRYA 2DNYA 3GILA 3WZ0A 1NK5A 3FEYB 2IHR1 1RT3B 2ZZNA 1EKSA 3N28A 2CNKB 3CC7S 1FTRA 1CS4B 1LW2B 5KFVA 1V3SA 4B3OA 2QO3A 3N6MA 1S7IA 1X5SA 1S0NA 4LJMA 2RH3A 3SYZA 1WELA 2LFVA 2KKHA 3FEZA 2E1MC 2VG7B 4ZPBA 1WKLA 3JTPA
chains in the Genus database with same CATH topology
3FCVA 1MN7A 3EICA 4UOFA 3BBBA 1LWXA 2DXFA 3NGTA 1PAEX 3EMTA 3VVTA 1UCNA 1HIYA 3BH7B 3Q83A 3PJ9A 3B54A 1NDLA 3Q89A 3FBBA 1BUXA 4ANDA 3FBCA 1NHKL 4F36A 1F6TA 3ZTRA 1NDCA 4EK2A 3EVOA 3VVUA 1NSKL 2B8PA 5C7PA 1NLKL 4DI6A 4W98A 4C6AA 3ZTOA 3FKBA 3BBFA 3NGSA 1MN9A 1B99A 2HVDA 1S59A 3WX8A 1NB2A 3Q8YA 3Q86A 3NGRA 2HVEA 3VGVA 5CAAA 1S5ZA 2B8QA 3FC9A 5BXIA 3DDIA 3EJMA 1PKUA 4CP5A 1NSPA 4ANCA 3FBFA 1HLWA 3L7UA 2HURA 2NCKL 4UOHA 4FKXA 1B4SA 2VU5A 2BEFA 1W7WA 4O0NA 1HHQA 1XQIA 4FKYA 4DUTA 2BX6A 3VGSA 2DY9A 2AZ3A 2AZ1A 3ZTPA 4F4AA 2ZUAA 3EVMA 1NSQA 3EVWA 4HR2A 1ZS6A 2DXDA 3NGUA 1U8WA 1NCLA 4WBFA 3R9LA 5CABA 1EHWA 1F3FA 1BE4A 1LEOA 3JS9A 3VGUA 1KDNA 1WKJA 3Q8UA 4UOGA 2DXEA 1NDKA 1WKKA 3ELHA 4ENOA 1K44A 3BBCA 2DYAA 3GP9A 3ZTQA 1BHNA 5IOLA 3ETMA 3EM1A 1NUEA 4KPCA 3PRVA 4S0MA 4DZ6A 1JXVA 2CWKA 1NDPA 1S57A 4ANEA 1NPKA 3DKDA 3MPDA 3ENAA 3FCWA 3VGTA 3B6BA 3FBEA 3ZTSA 1WKLA 3GPAA 1XIQA 3BH6B 1VYAA 3G2XA 3Q8VA 3EE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FCV A;  1MN7 A;  3EIC A;  4UOF A;  3BBB A;  1LWX A;  2DXF A;  3NGT A;  1PAE X;  3EMT A;  3VVT A;  1UCN A;  1HIY A;  3BH7 B;  3Q83 A;  3PJ9 A;  3B54 A;  1NDL A;  3Q89 A;  3FBB A;  1BUX A;  4AND A;  3FBC A;  1NHK L;  4F36 A;  1F6T A;  3ZTR A;  1NDC A;  4EK2 A;  3EVO A;  3VVU A;  1NSK L;  2B8P A;  5C7P A;  1NLK L;  4DI6 A;  4W98 A;  4C6A A;  3ZTO A;  3FKB A;  3BBF A;  3NGS A;  1MN9 A;  1B99 A;  2HVD A;  1S59 A;  3WX8 A;  1NB2 A;  3Q8Y A;  3Q86 A;  3NGR A;  2HVE A;  3VGV A;  5CAA A;  1S5Z A;  2B8Q A;  3FC9 A;  5BXI A;  3DDI A;  3EJM A;  1PKU A;  4CP5 A;  1NSP A;  4ANC A;  3FBF A;  1HLW A;  3L7U A;  2HUR A;  2NCK L;  4UOH A;  4FKX A;  1B4S A;  2VU5 A;  2BEF A;  1W7W A;  4O0N A;  1HHQ A;  1XQI A;  4FKY A;  4DUT A;  2BX6 A;  3VGS A;  2DY9 A;  2AZ3 A;  2AZ1 A;  3ZTP A;  4F4A A;  2ZUA A;  3EVM A;  1NSQ A;  3EVW A;  4HR2 A;  1ZS6 A;  2DXD A;  3NGU A;  1U8W A;  1NCL A;  4WBF A;  3R9L A;  5CAB A;  1EHW A;  1F3F A;  1BE4 A;  1LEO A;  3JS9 A;  3VGU A;  1KDN A;  1WKJ A;  3Q8U A;  4UOG A;  2DXE A;  1NDK A;  1WKK A;  3ELH A;  4ENO A;  1K44 A;  3BBC A;  2DYA A;  3GP9 A;  3ZTQ A;  1BHN A;  5IOL A;  3ETM A;  3EM1 A;  1NUE A;  4KPC A;  3PRV A;  4S0M A;  4DZ6 A;  1JXV A;  2CWK A;  1NDP A;  1S57 A;  4ANE A;  1NPK A;  3DKD A;  3MPD A;  3ENA A;  3FCW A;  3VGT A;  3B6B A;  3FBE A;  3ZTS A;  1WKL A;  3GPA A;  1XIQ A;  3BH6 B;  1VYA A;  3G2X A;  3Q8V A;  3EE3 A; 
#chains in the Genus database with same CATH topology
 4F3O A;  2X1B A;  4JOU A;  2EFO A;  2KFN A;  2OSQ A;  2ZUG A;  3AB4 B;  1LFP A;  2YTC A;  1DTQ B;  2ILY A;  2F7V A;  3CED A;  3AHP A;  4TYB A;  2JEG A;  3UNY A;  1RTH A;  1Q0N A;  2DIS A;  3TWZ A;  3R5J B;  4K2J A;  1MRO A;  4LSN A;  3T9N A;  3QID A;  1FRX A;  1PBA A;  3G6E S;  3TOQ A;  5B09 A;  1K0T A;  1FKO A;  2FHJ D;  2HVI A;  1Y11 A;  2YXL A;  2EEY A;  3KDO A;  1NSP A;  3EYZ A;  4PAA A;  2EKN A;  2QYG A;  4I1T A;  4EYI B;  2GS8 A;  4RUA A;  3HF5 A;  3BGO P;  1MWZ A;  2N7Y A;  9ATC B;  2RKI A;  3LTO A;  2YQ1 A;  3OVS A;  3CDA A;  3DLG A;  2QE5 A;  3K8W A;  1WKJ A;  4C8M A;  4DUZ J;  3ITH A;  3L7P A;  2VC0 A;  1DBD A;  1VI7 A;  1QAJ A;  3TA2 A;  3M9M B;  4IFV A;  2D9O A;  3BSA A;  4O0I A;  3T6J A;  3HX9 A;  2K7K A;  3SQG A;  1N6Q B;  1TFW A;  1RQ0 A;  4R5P A;  4HT7 A;  1GMW A;  3MTJ A;  4WZM A;  4B9L A;  4A47 A;  3BPS P;  3ZFV A;  1XR7 A;  5LT5 A;  4AT1 B;  4DV3 J;  3GU0 A;  4X4S A;  4OYM A;  2EI5 A;  4Q44 A;  2QJ3 A;  1ZA2 B;  2GIR A;  2O5D A;  2E29 A;  1VK8 A;  3ILO A;  4MTP A;  2F9J A;  4HAC A;  1PIE A;  1MW7 A;  4DL5 A;  4P7T A;  2KG0 A;  1S1T B;  4N76 A;  2IPO B;  3EPI A;  4DUZ F;  1FT8 A;  4TQS A;  4I2P B;  1FKA F;  3UWT A;  3A8E A;  4QWB A;  4L72 B;  2XNQ A;  4QYZ J;  3HO1 A;  1UEV A;  1Z2Z A;  2JEJ A;  4Y2M A;  1FWK A;  4ZIV A;  2DNO A;  3K58 A;  3HJF A;  2WB1 D;  3VAJ A;  3TUP A;  1ZM2 A;  4QZV B;  1JB0 C;  3UDL A;  3M30 B;  4DV3 F;  4QR2 A;  4DR3 J;  2CZ4 A;  1DFD A;  2FTR A;  1PJ7 A;  2FC9 A;  4KH1 B;  2FZC B;  1C0U B;  3TZY A;  2VG7 A;  3PW0 A;  4RUB A;  3M4X A;  4NLR A;  3BYR A;  5B0E A;  5HQL A;  3FGV A;  1NKB A;  2HFZ A;  1TP7 A;  4WFZ A;  3CD6 S;  2J9E A;  3BSC A;  5I3U B;  2C2Z B;  1VHI A;  3WX8 A;  2ZWO A;  4TU9 A;  3OXG A;  3SFG A;  3VTI A;  1RHQ B;  2DPJ A;  3CJ5 A;  4EGL A;  1SIZ A;  2VG6 B;  4JUZ A;  3CW2 C;  2J8S A;  1P9Y A;  1B0V A;  3AD8 C;  2DR9 A;  4FNI A;  1NU4 A;  5D4N A;  3NMA A;  3MR5 A;  3Q2T C;  4B9M A;  3PW7 A;  1JJ4 A;  3MEE B;  4Y34 A;  4U7C A;  4U67 Q;  4Q8E A;  3U1N A;  3MXH P;  5DZ6 A;  1F60 B;  2ZE2 A;  3EZO A;  3BGF A;  5F9L A;  4ZJL A;  3AOB A;  4LR8 A;  2RU3 A;  4JB8 B;  5SZT A;  2CA9 A;  4JI8 J;  4OI3 A;  3B4M A;  3OFG A;  1RBO B;  1FDB A;  4LBI A;  3EX7 B;  4DX6 A;  1XBW A;  3GYG A;  1TL4 A;  1SXL A;  2XMA A;  3VGT A;  2AEM A;  1WF2 A;  3BQ2 A;  2ZD1 A;  5F0W A;  4FPI A;  1U49 A;  3D9B A;  2RUG A;  2WW8 A;  4IYQ A;  2PFF B;  2F40 A;  4Y2I A;  3FCH A;  4X66 F;  3RRG A;  1WNE A;  1PJ6 A;  4YQW A;  2HG4 A;  5HP1 A;  2V8G A;  1XTZ A;  4J91 A;  3A8K A;  3L4B C;  3G8Q A;  4ED8 A;  1EP4 A;  2FVQ A;  2XGP A;  1JLG A;  1YGY A;  1FX2 A;  5EWF A;  4OHV A;  2WZ1 A;  3C14 A;  3EPG A;  3KUE A;  2I2Y A;  4JI8 F;  4NLU A;  5DDP C;  4AL6 A;  4TYA A;  1NSQ A;  1SQG A;  1S1T A;  5C25 A;  3B4D A;  1FXD A;  1EHW A;  1YHQ S;  3F73 A;  1VQ5 S;  3VGU A;  3C6U A;  5KFS A;  2OTJ S;  3P45 B;  2RS8 A;  2P5V A;  1NBE B;  3DOM A;  4DG1 A;  2Y1J A;  4NYZ A;  3J80 U;  3MR3 A;  3CSK A;  4J5O A;  1T3N A;  4KV8 A;  2JVR A;  2MQ8 A;  3OL9 A;  2NUH A;  3ENW A;  4O44 B;  2RML A;  4ECY A;  2COL A;  3DHW C;  4NEZ A;  1S7H A;  2E1C A;  1IBL J;  1WTB A;  1F5A A;  2ZZT A;  2XGQ A;  4ECT A;  4DV4 J;  1YLX A;  4DS5 A;  4RNH A;  4QQB A;  2JLF A;  2BOA A;  2EG1 A;  2VKR A;  4J9N A;  4W92 B;  2D69 A;  2H4Y B;  3I55 S;  3D54 A;  3LAN A;  1SH2 A;  4DR2 J;  2ZHO A;  2VBY A;  2AJQ A;  1VQ8 S;  2MQL A;  5L9X A;  2C2R A;  3MEC B;  1X31 C;  1T94 A;  2XWX A;  1F9E B;  5L39 A;  2J7W A;  4CH7 A;  1AW0 A;  3CGI A;  3TAM B;  1P6T A;  4NLV A;  2UXB J;  1TMM A;  1KD1 T;  4OYI A;  4DN0 A;  1YJT A;  3DLH A;  5AE1 A;  2V4J B;  4U8V A;  1IBL F;  1N4L A;  2GJ2 A;  1RUS A;  3NEK A;  5BJR A;  3PVX A;  4DV4 F;  2HHX A;  1HPZ B;  1MN7 A;  3RGI A;  2HKE A;  4RX6 A;  1U25 A;  4J9M A;  5M2P A;  2XC9 A;  3Q83 A;  3SFU A;  3CJ3 A;  4WK3 A;  4RKU C;  1M5H A;  2VG5 B;  2CG4 A;  1LWF A;  5HLF A;  3KKF A;  3NS7 B;  1KHW A;  2Y8W A;  5HMW A;  4WCE Q;  1RLC L;  3H2U B;  4L3K A;  4ETX A;  5AXN A;  3C46 A;  4OIX A;  5C42 B;  4NLD A;  4ELT A;  1RAD B;  1RGV A;  4QW8 A;  2W2Q P;  4JI1 J;  4WKR A;  4WXW A;  3SDE B;  2IC3 B;  2BYC A;  1Y5I B;  1TTH B;  1A9N B;  2RT3 A;  4ZN1 A;  1N48 A;  2UV8 A;  4NLT A;  1RTI A;  1VBK A;  2HHH J;  3R9L A;  2XS2 A;  2L08 A;  4ZLP A;  4K0K F;  1L5U A;  1GMW D;  2JEI A;  3BBC A;  3KLF B;  3H7H B;  1FFW B;  5L1J A;  4ZJO A;  3A8I A;  5GAE U;  6FDR A;  3O2I A;  1B7F A;  2Y1I A;  2HHV A;  1U1L A;  1GK8 A;  3OFH A;  4X4N A;  2QG9 B;  3M1V B;  3NNH A;  2JZ5 A;  4ATN A;  2BE2 B;  2VAS A;  5C2G A;  4JI1 F;  4U8Y A;  1YJV A;  1JX4 A;  3WX4 A;  1LW0 A;  3E01 A;  4C3K A;  1N56 A;  2YX7 A;  4OLO A;  2P2C B;  2MQP A;  1UJ4 A;  4M5D B;  3OLA A;  4P9S A;  4D3H A;  1MU2 B;  3FZB A;  2V68 A;  4HI2 A;  4DOZ A;  4IO1 A;  3M8P B;  3W7B A;  3CD7 A;  3CCU S;  4OI4 A;  4DQQ A;  1N5Y B;  2D7S A;  3JQK A;  1TV6 B;  1JJH A;  4NI2 B;  2DNZ A;  1MWY A;  2CQG A;  2P9C A;  4NRT A;  2VOP A;  3HCX A;  2OEJ A;  4M5L A;  2BM1 A;  1KN6 A;  1X0F A;  2PC6 A;  5DGB A;  1T7P A;  3MPU B;  1HFE L;  2E44 A;  2RDJ A;  3OBI A;  3UVJ B;  3H5S A;  1S76 D;  4ZS6 A;  4DLE A;  1HR0 F;  4DR1 J;  2B4P A;  7FD1 A;  1RT6 A;  1HPZ A;  5KG3 A;  5A76 A;  4O4G B;  1TAQ A;  2I5J A;  1X4G A;  4PUO B;  1MSW D;  3FRY A;  4CO0 A;  4RW9 A;  2BJ8 A;  2BRL A;  3NWR A;  4XPE A;  5LMN J;  1NB2 A;  3QT6 A;  2YX4 A;  1KR4 A;  3S01 A;  3M32 A;  2HBZ B;  2ZBC A;  4IH7 A;  4M5J A;  3UD4 P;  1FER A;  3H90 A;  4J9R A;  4ECR A;  3DLE A;  4R25 A;  5C42 A;  5D0H A;  3LA0 A;  2OEL A;  4P75 A;  4OZL A;  4WII A;  3D6M B;  4RUC A;  2GHW A;  1SC4 B;  4FS2 A;  4H4O A;  4DR1 F;  3HM9 A;  3MPW A;  2XI2 A;  1LNQ A;  3R8Y A;  2ZH6 A;  1BQM B;  1IXK A;  4OMF G;  3KLF A;  1EJ7 L;  3D5M A;  4OZ3 A;  1VC6 A;  3ZTR A;  2DGU A;  1VQL S;  1JLB B;  3HSG A;  5F8I A;  2VL1 A;  2HBQ B;  4P71 A;  4GVL A;  4QBU A;  4M5G A;  2GHV C;  3FDS A;  2NZ4 A;  2Z0G A;  3JSY A;  4XPC A;  1Q4R A;  4C0H A;  5J2Q B;  2VPW B;  3GFY A;  2JFK A;  2R2R A;  3DRS B;  1XMQ J;  3N5F A;  2X3G A;  4C0B A;  2GVD A;  1ZBT A;  2IRY A;  4CP5 A;  2H4W B;  2FPH X;  1A6L A;  4U96 A;  4FXD A;  1DQA A;  1RT4 A;  3WC2 A;  2M0G B;  5J1E B;  2ROG A;  2RQC A;  1XQI A;  3OUY A;  3TEH B;  5KFL A;  2D3O R;  2MSS A;  2HLU A;  5B0D A;  3FFI B;  2D9P A;  5A0Y A;  3J81 Y;  3DGP B;  3BM7 A;  5KT5 A;  3KMQ A;  4BS2 A;  4USV A;  4QIW D;  4QU6 A;  3W9H A;  2R9L A;  2BJ7 A;  1RHU B;  4WFX A;  1N5Y A;  4NE9 C;  2QGF B;  4PG8 A;  5KFZ A;  1ELO A;  4PQU A;  4NI2 A;  1VQO S;  5E2Q A;  4BLG A;  1X9S A;  4GVB B;  3DNC A;  5LMU J;  2LU2 A;  1XMQ F;  4KHR A;  3UD5 A;  2FZK B;  1YBU A;  3SMZ A;  5CYQ B;  2VJV A;  5KFY A;  1UW9 A;  2B9X A;  4Y00 A;  5C7P A;  1U1Q A;  1B64 A;  2MQO A;  1KQF B;  3SSR A;  3Q8Y A;  4O4G A;  3AD7 C;  3IBF B;  1KNZ A;  4YDX A;  4A8Y A;  1K1S A;  2HQG A;  4NWB A;  4FYD A;  4NCG B;  2DNH A;  1U8S A;  2DR5 A;  1RWU A;  3DXB A;  4ZVH A;  2MZ1 A;  3RR8 A;  1RHJ B;  3MEG A;  4O23 A;  1RKJ A;  4UST A;  4C11 B;  3NRB A;  4FVM A;  2VDI A;  3ILL A;  4K7Q A;  3AA9 A;  2V2K A;  2ASY A;  2ZEJ A;  3KUH A;  5JUM A;  3GMG A;  1KC8 T;  2OJ3 A;  4PPZ A;  4B9N A;  2CUY A;  2WBM A;  2GJI A;  2DNR A;  4XK8 C;  3KMS A;  3VAK A;  3PEJ A;  2BJ3 A;  3CVK A;  4ZA1 A;  2DNM A;  1Q53 A;  1YDL A;  4ICL A;  5ETT A;  3QWP A;  2XSJ A;  3OFE A;  1IBK J;  1PAU B;  2W4C A;  1HQ2 A;  2JSX A;  4RR5 A;  2QA4 G;  4DSL A;  2DNP A;  2FB0 A;  3R5B A;  2L41 A;  4KTQ A;  4IH5 A;  1X4F A;  1YRT A;  1SL2 A;  4OQJ A;  5J1P A;  1N33 J;  2ZH2 A;  1QD1 A;  5ETN A;  3FQK A;  4P2X A;  1CJV A;  3W65 A;  4JI6 F;  2FD2 A;  4KHM A;  3DRS A;  3HT0 A;  2FGO A;  1QDU B;  2Z2Y B;  3IG1 A;  4WTO B;  2BA9 A;  3HHK A;  1U2F A;  2G9O A;  1FFS B;  5J1E A;  2CJA A;  5FLX U;  1S99 A;  1WAC A;  5HAO A;  2V2Q A;  5DLF A;  3C2P A;  3FRZ A;  2HFV A;  2J6T A;  1CG2 A;  3PX6 A;  4AUK A;  1CSJ A;  4CT8 A;  3P4U B;  3DGP A;  1IBK F;  3TA0 A;  4KPC A;  5ETQ A;  1F5B A;  3NS5 A;  2CWK A;  3NOG A;  1SJF A;  2AX1 A;  4USI A;  3HZG A;  3SCI E;  2CKW A;  1N0U A;  5CXT A;  1N33 F;  5KFE A;  3F44 A;  3ZNJ 1;  4KFB B;  3JQJ A;  2XMV A;  1RIS A;  3RR7 A;  2QRR A;  3I0R B;  2BAC A;  3W8G A;  2XYH B;  5CH7 B;  3LW5 C;  5CYQ A;  3IRX B;  4RO0 A;  4CCH A;  2Q6B A;  3RYL A;  3T1Y J;  1S12 A;  3M8Q B;  3KLE B;  3O5T B;  2QA2 A;  4O4R A;  3VAL A;  3V6H A;  1MG7 A;  2ATL A;  3HD2 A;  1L3S A;  1X5P A;  5A8R A;  4I64 A;  3MPV A;  1ACM B;  2QN6 B;  1N32 J;  1NPR A;  4I56 A;  4G6V B;  4I0W A;  1D09 B;  4HYK A;  1GNK A;  3Q8U A;  3CPW R;  4XO0 A;  1SJR A;  2E5L J;  2HZA A;  5AJ3 J;  1X4E A;  2EBG A;  2W7P A;  3KNA A;  4Q2L A;  1RKI A;  3PYF A;  4OV6 A;  1L3K A;  1FF2 A;  3T1Y F;  1G7C B;  1RU2 A;  4C8O A;  2OML A;  1J5O A;  3TO8 A;  2KZM A;  3VCD A;  4Y6I A;  2E5I A;  3QT8 A;  2CQC A;  5GME A;  2XLJ A;  2G0C A;  5GMD A;  2CZV C;  3ULH A;  4QR0 A;  3FK4 A;  2OPQ B;  4WU3 A;  5IS2 A;  4GMK A;  1K8A T;  4NZ7 A;  3HFV A;  1GXL A;  2DIU A;  3P5B P;  1W7W A;  1WC3 A;  5AJ3 F;  1I1G A;  1LFW A;  2AZ1 A;  1Y7P A;  3KG0 A;  3SI8 A;  1JLC B;  3MAA B;  4DQS A;  4HL9 A;  3HHL C;  4M5H A;  1R0A B;  4P52 A;  2DGV A;  2W9A A;  2DR7 A;  1UJ6 A;  3IC1 A;  2OO4 A;  3D0I E;  2QEX S;  1R89 A;  3FQL A;  1R6Y A;  3HSD A;  3MD1 A;  3PO5 A;  4USH A;  2DGQ A;  1M1K T;  2AJF E;  2C3P A;  4ZMM A;  5BYQ A;  4B9S A;  1S9E B;  3MMC B;  3DXS X;  2JFD A;  3I0S B;  1KFD A;  1VQM S;  3GYN A;  1KQS R;  1G6B A;  3DOL A;  1YBT A;  4KFB A;  2RVJ A;  2KVI A;  3I0R A;  1FXR A;  4ALZ A;  2U2F A;  2KG1 A;  3W66 A;  3FZ2 A;  4ZDN A;  2KXF A;  1ZZN A;  1U48 A;  3LF0 A;  4TKT A;  2RS2 A;  3I31 A;  4K4T A;  4PWU A;  3QJP A;  1HL6 A;  1KLM A;  5M2U A;  4ZPW R;  3CF5 Q;  5EUH A;  2AX0 A;  2XMK A;  3M8Q A;  3KLE A;  3QLH B;  1QSL A;  1RAA B;  2CYY A;  1XWL A;  4LF9 J;  5KFD A;  2ADC A;  1U26 A;  1RT2 A;  4Y65 A;  4DV2 J;  1RI7 A;  2X1G A;  2MGZ A;  2P8I A;  2KU7 A;  3EZ5 A;  2CJY B;  1CVJ A;  3TJ8 A;  2MQM A;  3M8R A;  4BDP A;  1EAY C;  3T6B A;  4UT4 A;  1IM4 A;  1UKU A;  1NK9 A;  3PG9 A;  4GC7 A;  1VIO A;  2VOO A;  2ZH8 A;  4FF1 A;  5GAH U;  1ZZF A;  4RNO A;  3LP0 A;  1FDD A;  2FY8 A;  2XMT A;  3J7Y I;  3H2L A;  3UR0 A;  2IAJ A;  2C3U A;  2W7O A;  2C2E A;  4IG0 A;  3N79 A;  5ETR A;  2J0S D;  3P49 B;  4LF9 F;  5G0R B;  2VQE F;  4QOT A;  4JBC A;  2DRB A;  2BJD A;  1T9U A;  3ET6 B;  4RBT A;  2DO0 A;  2R4F A;  2OPQ A;  1RCX B;  2ACM A;  4U95 A;  4C48 A;  1YJW S;  3V6K A;  2UXD J;  4PXE A;  3SCL E;  4EUV A;  4ENO A;  3BB5 A;  3N01 A;  1JLC A;  2YWH A;  4L6V 3;  2QMX A;  1BHN A;  2AV5 A;  4DQI A;  5KAK A;  1FJG F;  1Y9O A;  3M6V A;  4ECW A;  1YG0 A;  3G9C A;  1SUQ A;  3JTN A;  2Q79 A;  2NXJ A;  5HBM B;  3PKY A;  2VJU A;  4L3N A;  3BKF A;  4EFA C;  3FUY A;  1FKP B;  4OJH A;  3M8Y A;  4ZPT R;  2XMU A;  4A8F A;  2XZD B;  2HW3 A;  1VQ9 S;  3K17 A;  2KXN B;  4A4J A;  2UXD F;  2ACY A;  4X4U A;  3HKW A;  3U7J A;  3EGW B;  1NEE A;  3BQ1 A;  2HHQ A;  1I51 B;  4KY3 A;  1S1W A;  1KOH A;  1Q78 A;  4OJ3 A;  5GVQ A;  4G1P A;  5KFN A;  4LVN P;  2MY8 A;  1JLA A;  2UUC J;  1JQG A;  4USU A;  1WEZ A;  3LAK A;  4LSL A;  1HBM A;  1VHF A;  3V81 B;  4O3O A;  1PGZ A;  1UVJ A;  5E3A A;  3MAQ A;  1UWB B;  2O3D A;  3B82 A;  3QLH A;  2DXE A;  1NDK A;  2C42 A;  4IOB A;  4IFY B;  5HMZ A;  5KG5 A;  4L74 A;  3D3C J;  2AW0 A;  3CJ4 A;  2JOQ A;  2HK3 A;  4WP9 A;  2DB1 A;  2YWG A;  5K9F A;  2DH7 A;  3NCQ A;  3P8B B;  1D3W A;  1TVR B;  2Q1L A;  4PG6 A;  2ZC4 A;  4YR2 A;  3H25 A;  4LUB A;  4K4Y A;  4CWB A;  2N3O A;  3Q2S C;  2WRM A;  1UVN A;  4LF4 J;  3KJN B;  3MED B;  3Q24 A;  3X1L B;  3JSB A;  3VVU A;  1QAX A;  2CG8 A;  2YVS A;  2F5G A;  1Q79 A;  2UUC F;  2HBY B;  4I7F B;  3VAI A;  4YHH J;  1VQ7 S;  5IFM A;  2MKY A;  2FHO B;  5GAG U;  2W4P A;  2MLZ A;  3AB2 B;  1F5C A;  2V67 A;  4B3M J;  5IT9 Y;  1B4S A;  4X65 J;  1T03 A;  3TAQ A;  1T9X A;  4OI1 A;  5G0R A;  4R8U A;  1WD6 A;  2B9Y A;  3G87 A;  2Z57 B;  3NG8 A;  1W2I A;  4TVA B;  2F3J A;  3ET6 A;  3HD1 A;  4JV1 A;  2HNZ B;  3R2D J;  5B0F A;  3CCS S;  4TQR A;  4K5R A;  3HUL A;  2V2V A;  4F4Z A;  1IWG A;  3OSP A;  4LF4 F;  2DNK A;  3DKD A;  2YX1 A;  2YY3 A;  4ZPV R;  3D6F B;  4X64 J;  3FCV A;  4DL2 A;  2PDA A;  4YHH F;  4B9U A;  1HQU B;  1RT1 B;  2Z2Z A;  3RB3 A;  4DV5 J;  4OX9 J;  3US5 A;  4RW8 B;  4LBH A;  5KFW A;  4AQY J;  3CJS A;  4B3M F;  3HKZ D;  3DM2 B;  1SL1 A;  3C3L A;  2NLW A;  4QIV A;  4E2F B;  1QJH A;  3ENV A;  1S77 D;  1FRI A;  3CCL S;  4GO5 X;  4ECS A;  3A12 A;  4ES2 A;  4K4W A;  2UU9 J;  2PGC A;  2EC0 A;  4M1K A;  1H74 A;  5KT6 A;  1FKP A;  3KOA A;  3TUJ C;  1J27 A;  3A4T A;  1PYO B;  5CZV A;  5HAN A;  4IDK B;  3KFW X;  5DQG A;  2WSE C;  2XTJ P;  3J7Y U;  2BUN A;  2B51 A;  3CCQ S;  4FBT A;  2EK6 A;  3VGS A;  3BGU A;  3GWC A;  1ITP A;  5D4P A;  5KFP A;  2W2P P;  4X64 F;  2LQB A;  5MLC V;  5DGA A;  3KLI B;  2FJX A;  1OQ3 A;  4D3G A;  2OMO A;  1SQE A;  4KGV B;  3AQO A;  2MKH A;  1GMV A;  4DV5 F;  1QE1 B;  4OX9 F;  3J7Z T;  4AQY F;  3MM5 A;  4I2Q B;  3W8P A;  4TLR A;  4F0H A;  2UU9 F;  1IKW B;  3PJW A;  2AQ4 A;  2MKK A;  2YKA A;  3BH7 B;  1EET A;  1TVR A;  3UW1 A;  3GON A;  3HSJ A;  3RBX A;  3F41 A;  1BUX A;  3SCK E;  5F8L A;  4JYA J;  1OPI A;  2UVR A;  4J37 A;  3R97 A;  4HH0 A;  4QWC A;  3BO2 A;  2CNO B;  5L1I A;  3R7N B;  1N52 B;  1M0S A;  2H54 B;  1T9T A;  3M2V B;  2VV5 A;  1HBN B;  4YR3 A;  2BMB A;  2IBO A;  4ED6 A;  1CC7 A;  2R7T A;  2C2N A;  4C3M A;  1M5P C;  1N54 B;  1QY7 A;  4PZV A;  4WE1 B;  5B08 A;  4JI7 F;  2V34 A;  3AQP A;  4Y2A A;  4M94 A;  3POT B;  2HNY B;  2QMU B;  2EG2 A;  1PIL A;  4DU7 A;  1FNX H;  1QSS A;  2UZA A;  2IMW P;  2AKW B;  4LR9 A;  2ASJ A;  3V6D B;  4HHJ A;  1K47 A;  2ZH4 A;  4CQ1 A;  3W9I A;  2CJX B;  2PMW A;  4ITS A;  1IN0 A;  1LWC A;  2Y0B B;  3CCJ S;  4LR7 A;  4DWI A;  4YFU A;  4DF8 A;  4LSZ B;  1IKV B;  3HLU A;  1NK0 A;  2BKP A;  3DOK B;  2SXL A;  4OHZ A;  1Q95 G;  2MLY A;  4KYZ A;  2V6A A;  2ERR A;  4RPF A;  4IOC Q;  2AP6 A;  2IDE A;  1HQU A;  1FNM A;  1WC6 A;  2G4B A;  2HHS A;  2E1P A;  3FKB A;  2MZR A;  2OPS B;  3D7S B;  2YKN B;  3Q86 A;  3DM2 A;  2GJF A;  2IM3 A;  2VUG A;  4KGX B;  3P3D A;  4YY3 J;  3DRP A;  2HIY A;  4HVZ A;  3D0G E;  2QTW A;  2HUR A;  3WDO A;  2V0N A;  3J81 j;  2HQI A;  3HFK A;  2V2Z A;  3GYX B;  3WIV A;  1RAF B;  1YZ6 A;  5H9F K;  4B3R J;  3IM9 A;  3IXQ A;  2CJQ A;  4QPT A;  1TL7 B;  4QIE A;  1R8H A;  2E1R A;  1TAU A;  2M3D A;  3RU0 A;  2YNI B;  4KKO B;  5IOL A;  3D1Q A;  1G4C A;  4B02 A;  4ZVT B;  2IJN A;  4YB1 P;  1VQN S;  3UI3 A;  2R2T A;  4OHW A;  5A8W A;  3IA0 A;  2L3M A;  2NXN A;  5D4L A;  4AXJ A;  4CH1 A;  4DX5 A;  5AE3 A;  2R2S A;  4CO2 A;  1OY9 A;  3HHN B;  4Q0B A;  3Q23 A;  1U2R A;  3BKU A;  1SKU B;  2XMM A;  4I2Q A;  4FF2 A;  3I5A A;  4F4Y A;  3RAQ A;  1PBU A;  2XB2 D;  3OTB A;  3OXF A;  1AXQ A;  4WWS A;  4YB7 A;  1M5V C;  3UCZ P;  2DCU B;  2IM2 A;  2OP5 A;  1YKW A;  2GVZ A;  4B3R F;  1HI1 A;  1O0P A;  3D28 A;  4ANC A;  3MR2 A;  1FVQ A;  2Z2M A;  1HBN A;  4BCA A;  1D0E A;  5D15 A;  4ERD A;  4DR4 F;  4PG7 A;  4ZP9 A;  5ETM A;  2HRU A;  3EDR B;  2CWX A;  3MHY A;  3GV8 B;  1DY3 A;  4NL5 A;  4LFB J;  1SIW B;  4A8S A;  5A6W A;  3GQC A;  2HNY A;  5LSR A;  4KIA A;  2I9S A;  3HZE A;  3I4H X;  2JRS A;  4OFZ A;  2YNG B;  2YNH B;  3QJL A;  1L3U A;  2K7J A;  2CQI A;  4EI2 A;  1SKR A;  3ZZP A;  3TVY A;  8ATC B;  4QPX A;  2E9T A;  3I87 A;  3K57 A;  2QSW A;  3QPI A;  4H4M B;  3SBM A;  2Y9H A;  3OL7 A;  2CPH A;  1IKV A;  3DGV A;  3CDU A;  4YB5 A;  1DUR A;  5B0A A;  4ZCK A;  4HDH A;  1U09 A;  3OXL A;  2VPY B;  3KJF B;  2HVE A;  4KGZ B;  2WSF C;  4RW7 A;  2V8D A;  3CJK A;  4LFB F;  3LQV A;  1Q8K A;  2HK2 A;  3QZ7 A;  3MCN A;  3NOC A;  1HNW J;  1WHX A;  1S72 S;  2KT2 A;  1UVK A;  4ED3 A;  2VB6 A;  1YJ7 A;  1TK5 A;  4UQT A;  2DRD A;  2DXD A;  1S48 A;  1YX2 A;  1VRT B;  4E98 A;  2FLL A;  2D3U A;  2KM8 C;  2LYV A;  1M5O C;  2AEJ A;  2W2O P;  4CI0 B;  1CEZ A;  5EDW A;  4MK9 A;  1U0H B;  2OEK A;  1GAO A;  3QO9 A;  4G1Q B;  3CJT A;  3CUL A;  1X7V A;  4KQZ A;  1EKR A;  1RHR B;  1RWN B;  1S6U A;  4J9S A;  2YNI A;  2H65 B;  4KKO A;  1MWQ A;  3TVK A;  1TL3 A;  2AGO A;  2B5J B;  4MH8 A;  1NDL A;  1WOS A;  4QWE A;  3ZC4 A;  1HNW F;  4CO5 A;  2XUL A;  1XEZ A;  1SI9 A;  2NXE A;  3HVA A;  1U45 A;  1O5J A;  4CNZ A;  4B17 A;  3EGV A;  2FJD B;  2MZJ A;  2GML A;  2O66 A;  4ECU A;  2V9W A;  4LF1 A;  1U1M A;  2V94 A;  5HVF A;  2EFN A;  1Q8B A;  2LEP A;  2CPI A;  2GAH C;  3H5Y A;  1YWX A;  3DRR A;  1C4A A;  3DLJ A;  4DFK A;  4DPT A;  1JNZ B;  1S9G B;  3JYT B;  4N77 A;  3N4W A;  1K73 T;  4F0K A;  2VQF J;  3EDQ B;  3S6E A;  3U02 A;  1AUD A;  4NCB A;  2XO7 A;  1QAI A;  3H2V E;  1GTE A;  3IBC B;  3G8S A;  2B0G A;  2ZDP A;  2IM1 A;  3M7V A;  4XIU A;  2JDJ A;  3AOC A;  3ZZO A;  1I6J A;  1FTC A;  3G2X A;  3PFO A;  1S49 A;  2RDI A;  2YNH A;  1NHU A;  3PW4 A;  2Z8Q A;  3TZX A;  2CJB A;  2EW9 A;  1X5O A;  2LKZ A;  5AXM A;  5KFK A;  1D1U A;  2HVH A;  1OY8 A;  2PD1 A;  3EXC X;  5H9E K;  2CRL A;  1N88 A;  4N47 A;  2GGP B;  2W2M P;  4GKK J;  4DSF A;  2M7S A;  4HLB A;  2CQ3 A;  4IKA A;  3UCU P;  1VQK S;  2FGC A;  3OR2 A;  1TKT B;  2LA4 A;  3CJQ A;  2UXC J;  3FC9 A;  3IWN C;  3PNI A;  3I9V 9;  2C3M A;  3FJ2 A;  2G0I A;  2ALY B;  4ZHR A;  4DR7 J;  3OR1 A;  4NMX A;  1EAR A;  2JNJ A;  3HK2 A;  1TUV A;  4PAB A;  2QMW A;  1F3V A;  3A3N B;  3BYP A;  3BPD A;  2MLX A;  5H9F J;  4PR6 A;  3QBC A;  4ZPC A;  3OL6 A;  2JJ4 D;  3E51 A;  4V1A k;  4CNY A;  3N5B A;  1SL0 A;  3A8J A;  1NHV A;  2UVV A;  3LPY A;  4F2S A;  2NRE A;  1HAR A;  4GKK F;  3C6T B;  4LVO P;  4G1Q A;  4WKY A;  4NA1 A;  2WVD A;  5K5M A;  3MPY A;  1JKH B;  4I6Y A;  2F8E X;  3LP1 A;  1RWV B;  2UXC F;  1SJ3 P;  4X84 A;  1WEY A;  3OW2 R;  3LP2 A;  1REV A;  5EX0 A;  1UVI A;  2B5J A;  3ZTO A;  5HO4 A;  4DR7 F;  3E3X A;  5D6G A;  3ZZU A;  2B8Q A;  3QJJ A;  1RT5 B;  3T1H F;  1VLO A;  1TKX A;  4B3O B;  4HI1 A;  4DUY F;  1I94 J;  1CC8 A;  3W5X A;  1UPP A;  2WOM B;  4LRB A;  1R6V A;  5BYS A;  3BGR A;  1ZAW A;  4UZC A;  2CAD A;  2EVZ A;  2GA7 A;  2KYX A;  4V19 J;  1MRO B;  2V5H G;  1M5K C;  5IC6 B;  1IJE B;  2IBK A;  2YKM B;  3B6B A;  1FKO B;  3KTQ A;  4NLS A;  4P72 A;  5K8M A;  2HIQ A;  1JJ2 R;  2QFI A;  2XBP A;  2ABY A;  4JI4 J;  3GZ7 A;  5DO2 A;  3W64 A;  4ES3 A;  4RUH A;  2QLX A;  1U6F A;  4F4W A;  2NSC A;  3WHI A;  1SVD A;  3K8V A;  2KXH A;  3IRW P;  1I94 F;  1IR0 A;  4W90 B;  4B3S J;  2RKI B;  2OFH X;  2G1H A;  1YI2 S;  4DU8 A;  4JI2 J;  5KFG A;  2FYX A;  5IM0 B;  3ITH B;  2YQ0 A;  1LWE A;  5J2N B;  3RW6 A;  1IVZ A;  1H73 A;  3OD2 A;  2P9E A;  2CPE A;  2LA6 A;  4IFV B;  4O0N A;  4GO7 X;  4R0J A;  1RAH B;  2OEM A;  1HI8 A;  3SQG B;  1WI8 A;  2MZS A;  1RAJ A;  2X7I A;  4M5I A;  4R5P B;  5CCM A;  5L8R C;  4DV0 J;  2UVW A;  1RCO B;  1D8Z A;  3IFE A;  2L9N A;  3W5Y A;  1H7W A;  4JI4 F;  4K4X A;  2V8P A;  3BO4 A;  3I5B A;  5KFI A;  2CQ4 A;  1RAE B;  4DZ6 A;  3MZI A;  1ZA1 B;  4YUD A;  1N8R T;  3GG0 A;  1Q5Y A;  4URQ U;  3SV3 A;  2Y1R I;  2ZVI A;  2IY5 B;  4B3S F;  2XEX A;  2H5I B;  4JI2 F;  4NXN J;  5IWA J;  1NRK A;  3OLB A;  3MR6 A;  2QSF A;  2LXU A;  3EXY A;  3I4P A;  3PYD A;  4DEZ A;  1SPB P;  5KFB A;  4PRF A;  2IYG A;  2A18 A;  1U1N A;  2HS4 A;  2DIV A;  2CQP A;  4CLZ A;  3AJ1 A;  4DV0 F;  4PEO A;  3V5R A;  4FYY B;  2NCK L;  1RTD A;  1URN A;  3JAM Y;  1O6X A;  5L38 A;  1RT5 A;  2LEA A;  1HNV B;  3D2W A;  2HFO A;  3RUB L;  1VQ4 S;  3R5G A;  5ETO A;  1ZS6 A;  2KVQ E;  2VD3 A;  4DR6 J;  4N8O A;  3RRK A;  2BZ2 A;  5HQM A;  4UUX A;  5E3R A;  2APO A;  2FVS A;  2WOM A;  1F9F A;  1X5T A;  2B9W A;  2KHD A;  4DPO A;  5HRO A;  4NXN F;  5IWA F;  1WF0 A;  2WHO A;  1GXT A;  2HFS A;  1RAB B;  1U47 A;  4FYX B;  2J0Q D;  3IO1 A;  4QWD A;  1SH0 A;  3L9Z A;  3DDK A;  2WK4 A;  3QAT A;  2NPF A;  2CQ0 A;  4ZJQ A;  2YKM A;  4C8Y A;  1FRJ A;  4NYP A;  1IBM J;  2H3E B;  3O6Q A;  1N36 J;  2ALZ A;  4CLK A;  4EO6 A;  2MTL A;  1KRP A;  3G8T A;  3JSM A;  2ZE2 B;  5F8J A;  1CJT B;  3O1L A;  4JP8 A;  3BBF A;  1B99 A;  2DBB A;  1OMS A;  4C4W A;  1BWV A;  2RSQ A;  4DR6 F;  1D9F A;  2XLK A;  3HVW A;  4CLW A;  3FSY A;  4IUF A;  5IM0 A;  3DU5 A;  4L73 A;  5J2N A;  4YEA A;  1NK4 A;  2ZD1 B;  4JI5 J;  1JJC B;  1FA0 A;  3VQT A;  1VK3 A;  4CO3 A;  5CYJ A;  3VZH A;  4IQM A;  5CAB A;  2CDR B;  4WYL A;  1QVF R;  5CZX A;  4HKQ A;  1IBM F;  5HP1 B;  1N36 F;  2OKQ A;  3KDN A;  1NPK A;  1EP4 B;  5B0B A;  1BWE A;  3UN3 A;  1JLG B;  3NLC A;  1WG4 A;  2XSF A;  4UOF A;  2K3K A;  2LQ5 A;  2VBX A;  3C14 B;  5HSP A;  3GII A;  3BV8 A;  2H5E A;  1RBA A;  2GW8 A;  1UA1 A;  4P2M A;  4ECV A;  5B7W A;  3CJ8 A;  5C25 B;  5THW A;  4PPD A;  3C16 B;  4Z7Y A;  1RWX B;  2PFD A;  4WP3 A;  2Z2L A;  4DSE A;  3ZZT A;  3JB9 k;  4O3Q A;  2ZHA A;  1VLY A;  3C6U B;  2J9C A;  2RF2 B;  2FIU A;  3DOM B;  4NLX A;  3KHG A;  4NOH A;  4DG1 B;  1RLD A;  3EUN A;  2D3O 1;  1AA1 B;  2VFV A;  3UNG C;  1HQE A;  3CCT A;  2R7S A;  4NAS A;  2UUB J;  4WTY A;  3VZI A;  2XQC A;  1UMJ A;  2WCX A;  3J7A N;  4KV8 B;  3J81 U;  1FRL A;  4Z2X A;  3PHE A;  4DFJ A;  3KHR A;  2Q3P A;  3KK3 B;  2DHA A;  2RHQ B;  1HNV A;  1T02 A;  2AT1 B;  2ZZM A;  4X4R A;  1RAC B;  3K5O A;  3R7B B;  5HL7 Q;  2ROP A;  2DPI A;  1N34 J;  4I68 A;  1JMT A;  3GR0 A;  2PEH A;  2PSZ A;  1CBK A;  1UEK A;  1BY9 A;  1TL1 B;  2GMJ A;  2OFG X;  4CM0 A;  4RU9 A;  1O8B A;  3R5C A;  2ZH7 A;  2A0F B;  2UUB F;  2B8P A;  1APS A;  1W26 A;  4B08 A;  1RTJ B;  1N0V C;  2J76 E;  5RUB A;  4LQ3 A;  4DR3 F;  1WUU A;  3HVT B;  1DRZ A;  2DO4 A;  3CIM A;  4Y2C A;  5EHH A;  4IQX A;  1CJT A;  1WC1 A;  2ZH3 A;  5HK4 A;  4ZP7 A;  1HHQ A;  1YJU A;  1ZM9 A;  1EQM A;  3TP2 A;  4TY8 A;  5DM7 Q;  7FDR A;  4WBF A;  3BN4 A;  4HTI A;  2CNL B;  4MKY A;  1LK7 A;  2F1F A;  1X4C A;  4MJK A;  1BQX A;  2GHP A;  5E7O B;  1N34 F;  3UO0 A;  3H20 A;  5LXR A;  3DLK A;  4DHV A;  4PXD A;  4M5M A;  1LWF B;  5HLF B;  1RWK B;  1HMV B;  2FY1 A;  4NML A;  3RBE A;  2W9C B;  4TNO A;  4NLO A;  3HHD A;  1JLE B;  2VFT A;  2VFS A;  4K4S A;  2DGO A;  2OHD A;  2BOP A;  4NZ0 A;  2YKO A;  1T0T V;  2DD8 S;  2KRB A;  3BDP A;  5AXL A;  2FJV A;  3L7O A;  3OHB A;  1WOR A;  6FD1 A;  3ZXW A;  1N5S A;  2OTL S;  4F0M A;  1RTI B;  2KRR A;  1R0C B;  4DI6 A;  2CQ1 A;  1S1U A;  1YRU A;  3KJV B;  4BWJ A;  2OD4 A;  1ROF A;  2A6O A;  4CZC A;  3C16 A;  3BJY A;  2ZBR A;  2C2D A;  3KJQ B;  1XC9 A;  2NUU G;  3CJ2 A;  2RF2 A;  2BR0 A;  4QW9 A;  4F4A A;  1YRX A;  4F2R A;  2HWI A;  1H0H B;  2AJ1 A;  4Q8F A;  4TU8 A;  5DZ7 A;  5KFF A;  3SCJ E;  5ETV A;  1VRU A;  3KK3 A;  2X3D A;  4M95 A;  1VBX A;  2V4R A;  2BJE A;  1BC6 A;  4YN3 B;  3I56 S;  4ANE A;  4P73 A;  2JC0 A;  1LW0 B;  2CZ9 A;  3ZTS A;  5EGY A;  1SC6 A;  3E01 B;  4DSK A;  5KG7 A;  2LEC A;  2HHU A;  5KG4 A;  1HD0 A;  2DXF A;  1IM6 A;  1JXE A;  1DAX A;  3RJM B;  1T95 A;  4F50 A;  3PJ9 A;  2V8V A;  4USW A;  2PMH A;  2CPX A;  5F8N A;  3GFX A;  3SZ2 A;  1R0B G;  4NEY A;  1KKH A;  3KK1 A;  3CJ0 A;  3K5N A;  3HXM A;  1D9D A;  4ZVF A;  4CLP A;  1WJ9 A;  1RA7 A;  3ILJ A;  2JHE A;  1TL1 A;  5BR8 J;  1TFY A;  2OSR A;  1RTJ A;  3RZA A;  3M2U A;  5ADZ A;  4JV0 A;  3BF4 A;  2AYM A;  5D0R A;  3SXL A;  2V8H A;  4QJV A;  1PO6 A;  4WYW A;  4A8M P;  2HEK A;  3QAE A;  2GQQ A;  3HVT A;  4ZCM A;  3AFG A;  4G1I A;  2VIC A;  3UQS A;  2C3O A;  4A46 A;  1R27 B;  2FLN A;  3R3T A;  1RT6 B;  5KFJ A;  3PO4 A;  3M8W A;  2HHT A;  1CUL B;  1FHT A;  1UL3 A;  2VC1 A;  4KSE B;  1OPZ A;  4X4V A;  2I5J B;  2JL9 A;  4RW9 B;  4X4T A;  4DR5 J;  4ZCI A;  3GFH A;  1S57 A;  2RRB A;  1QTN B;  3GG1 A;  1NSA A;  4DR2 F;  4HHU A;  1H2U X;  3FSI A;  5EN1 A;  3M32 B;  5LXY A;  1HMV A;  3S8S A;  5BR8 F;  1UCN A;  2W9C A;  4ED0 A;  3DLE B;  1JLE A;  2VPX B;  4DCJ B;  3HDS A;  3TI0 A;  1NAQ A;  4WFA Q;  2YNF B;  4AE5 A;  1Z4U A;  5DQH A;  2UXB F;  2KZZ A;  2ZFH A;  1S0M A;  2R7U A;  2VKZ G;  1Q81 T;  3NGS A;  3WBZ A;  3WC0 A;  4H4O B;  1UVL A;  5LJ5 Y;  3MI7 X;  4F7V A;  3GIR A;  4I67 A;  1YJ9 S;  2KT3 A;  1CJK A;  1R8P A;  3KJV A;  2O1P A;  2Z4P A;  3C66 A;  1FJE B;  5JXS A;  4DR5 F;  1R8B A;  5HN0 A;  3HT3 A;  2EK1 A;  2PII A;  1KVI A;  1QLN A;  2PMZ D;  1B70 B;  4NX9 A;  4IG3 B;  1RTZ A;  3MOJ B;  4DCP B;  4BC7 A;  1S1X B;  1VIS A;  1QUP A;  2UUW A;  1H3D A;  2LEB A;  4UY8 5;  3KLH A;  3ENQ A;  2PE8 A;  1YJN S;  2C22 A;  2MPU A;  1MNE A;  2I1R A;  2LP4 A;  5HVG A;  4URG A;  2GVD B;  4F4K A;  2QLF B;  3WQP A;  3TQ1 A;  5EWG A;  2YWK A;  3DCA A;  1RT4 B;  3TNV A;  3RB6 A;  1F9H A;  2LU1 A;  4WXO A;  2HHH F;  2K8G A;  3OUY B;  2KJW A;  2WVE A;  4ES1 A;  2EBE A;  4OX6 A;  2E7V A;  3HHL B;  2HLT A;  2XWY A;  5A0Y B;  3W2V A;  2GX8 A;  4DQP A;  1A7G E;  1NH7 A;  5FDL B;  3X3U A;  1Z1Z A;  5D4O A;  1W25 A;  1S5Z A;  3M05 A;  2XLI A;  4CYU A;  1RXO B;  4DL3 A;  2LQJ A;  1EIY B;  1AZS A;  1K1Q A;  2XO6 A;  1U6Z A;  1X8D A;  2XYG B;  2IVF B;  4PQU B;  1D8Y A;  3LAM A;  2AGP A;  1QSY A;  2W2N P;  2OPP B;  4C8N A;  2HSE B;  2AD9 A;  4HR2 A;  1WSV A;  1Y5N B;  4C3L A;  3NCR A;  7AT1 B;  4OHY A;  4UOG A;  2KN4 A;  2KI2 A;  4DLG A;  4XDC A;  2D3Z A;  3R1L A;  4BBY A;  2QLW A;  1CUL A;  4KO0 A;  4B9V A;  2J9D A;  3H5U A;  2ZJQ Q;  2WTF A;  2A2D A;  2QIF A;  3SSS A;  2W01 A;  1RB0 A;  1F0X A;  5ETP A;  2ZC3 A;  2BBE A;  3M8Z A;  2IM0 A;  4LRE A;  3IR7 B;  2R7V A;  4A8X A;  4FXW A;  2XYP B;  2G0J A;  3MEG B;  1RAO A;  3ZO7 A;  4LFA J;  1VR6 A;  3IWL A;  4TN2 A;  3CD0 A;  2YNF A;  1UJ5 A;  3CC2 S;  3SIP B;  4F8R A;  1Y5L B;  2AYE A;  1C1C B;  4HDG A;  1WTF A;  4LF7 J;  3ILI A;  3ZZR A;  1HA1 A;  2HHW A;  2ZVS A;  3RTV A;  4OYW A;  2R42 A;  2CNN B;  4ICL B;  5KG0 A;  2XSJ B;  1LEO A;  2YH1 A;  1Q1K A;  2BQ3 A;  1NB7 A;  5LMN F;  4QYZ K;  2MKI A;  2ZM6 J;  2R8G A;  3MEK A;  5M2R A;  5U47 A;  1V3Z A;  4AL5 A;  4IG3 A;  2J7K A;  3FMB A;  1S1X A;  1RAI B;  2ZHB A;  3EWG A;  2M2B A;  3K59 A;  4DZD A;  5A2Q Y;  3BN7 A;  1CJV B;  3DI6 A;  4LFA F;  2AHO B;  1Q16 B;  2A2C A;  2V4Q A;  2MY7 A;  4Q2M A;  1NJY A;  3IG1 B;  2GIQ A;  3IWX A;  4KHP J;  1C0T B;  4X4O A;  1C2P A;  2PEB A;  4LF7 F;  3TJ9 A;  2JX2 A;  2WON B;  3N9U C;  3HHL A;  2MKJ A;  3OSN A;  1WHW A;  1S6P B;  5CAA A;  2W4D A;  1HYS B;  2EWH A;  3HP6 A;  3C19 A;  2POK A;  5EX3 A;  5DG7 A;  2DGT A;  3PTW A;  5FDL A;  3WIU A;  2R7X A;  4ZVR B;  2ZM6 F;  2BAB A;  1T05 A;  3OTD A;  3EVW A;  4OYB A;  1VCT A;  3DU6 A;  1KTQ A;  2MQQ A;  2W9B A;  4ZLL A;  2HQF A;  3Q8Q B;  2Y3Y A;  2OPP A;  1QM9 A;  3K5M A;  5HAT A;  5LJ3 Y;  3OJS A;  3K0J A;  4RW4 A;  3MM8 B;  2VBZ A;  4MFB A;  4K2X A;  3MGJ A;  1PC4 A;  2P6S A;  3NS6 A;  1GQE A;  3BZQ A;  1J5E J;  3QGI A;  2E5H A;  2QT7 A;  1IR2 A;  5E3P A;  4KHP F;  1JLQ B;  1BMQ B;  2XCA A;  3LO3 A;  1FE4 A;  3HHE A;  4DX8 H;  2YBV A;  5A8K A;  1D9A A;  1TEL A;  4RBU A;  1N5T A;  1B0P A;  4DPU A;  1SV5 A;  4ED2 A;  2BM0 A;  3KG1 A;  2AF6 A;  1IKX A;  5IC4 B;  4V19 X;  1OQ6 A;  3FNN A;  5A8R B;  3DYA A;  5KG2 A;  5SUH A;  4K59 A;  2E5J A;  4M8L A;  1GX6 A;  3RW7 A;  3QGG A;  1VQP S;  3MUT P;  5CD4 A;  1NJX A;  2IIH A;  4ZK7 M;  5IT9 U;  4PG4 A;  2M4M A;  3SSQ A;  3THV A;  3VR1 A;  4DX7 A;  1Q8I A;  5LMU F;  4AXI A;  2E1A A;  5IT0 A;  2BX6 A;  2HQ3 A;  2EFG A;  3F0N A;  1PG5 B;  1E6Y B;  3H5X A;  3G86 A;  4B3T J;  1C1C A;  1NZ8 A;  3K89 A;  1AT1 B;  2FC8 A;  3GLJ A;  1J5O B;  3IR5 B;  4MMO A;  4M63 A;  3ETM A;  2LLZ A;  4YS2 A;  3D1O A;  3MPD A;  4USM A;  2R7O A;  1DJ0 A;  3LPE A;  1GMU A;  2RE1 A;  1BLU A;  2WW4 A;  3NWG A;  3PEH A;  1PAE X;  1NND A;  2LDY A;  4YME A;  3LGM A;  2KDO A;  2L48 A;  4RNM A;  1XJW B;  2K1R A;  1JK9 B;  3D66 A;  1VFJ A;  1WEX A;  4ZVQ B;  4ECX A;  1NPP A;  1KTV A;  1MLA A;  5KT2 A;  4C6A A;  4WPA A;  4ZPD A;  4L75 A;  3L95 X;  4G3I A;  1C0T A;  4B3T F;  4DPW A;  2WON A;  4CH0 S;  2VU5 A;  3MMA B;  1S6P A;  1HYS A;  2N82 B;  2FJE B;  5KG6 A;  3DMJ A;  4ZVE A;  1SC3 B;  3QIP B;  2M70 A;  1PC5 A;  3H8Y A;  3ICL A;  1RSC A;  5B0G A;  2O01 C;  1M1H A;  1RWW B;  1UAW A;  3M2R B;  3CXC R;  4BC9 A;  4RZR A;  4USK A;  3QGH A;  1RYS A;  4ZVG A;  1HW8 A;  1U1P A;  2IRU A;  3PJX A;  3DOL B;  3PFE A;  4CM2 A;  1X60 A;  1SH3 A;  1NJI T;  1VS3 A;  3MM8 A;  3Q0A A;  1FD8 A;  1S4E A;  2ZDO A;  1KLM B;  4J9V A;  1JLQ A;  2CJ9 A;  4OX7 A;  3DLL Q;  4L76 A;  5E3Q A;  3B78 A;  1F6T A;  4EZ6 A;  3PR4 A;  3MAH A;  4Z37 A;  1FWL A;  3G82 A;  4DL6 A;  1RT2 B;  1OJ4 A;  4K4Z A;  2MGZ B;  4X4Q A;  4DS4 A;  3MM6 B;  5ETK A;  3M6W A;  2BW2 A;  2AYB A;  3L7U A;  3M8S A;  1S79 A;  1RT7 B;  3QGP A;  5KFQ A;  1AB8 A;  2QL7 B;  2OH2 A;  1U2C A;  2IRX A;  5AXK A;  5HMX A;  3DFE A;  1U1K A;  2G2Y A;  2N4D A;  1KOO A;  1XN9 A;  3TQE A;  1H6K X;  3LP0 B;  3Q8P B;  2ATC B;  5A6P A;  2JC1 A;  4TLQ A;  2HWT A;  4Q7A A;  1E6Y A;  2IAJ B;  2XY7 A;  1GTH A;  1H98 A;  1K44 A;  3PW2 A;  3CC4 S;  4IG0 B;  5C24 A;  4Q45 A;  3EM1 A;  2CPJ A;  1RWM B;  8AT1 B;  1KON A;  2XMW A;  2FHM A;  1U1O A;  2EFQ A;  1C4C A;  2NYH A;  1Q86 T;  5DS7 A;  4EMD A;  1RT3 A;  4URS A;  3H0P A;  1BQN B;  5CQG A;  3SV4 A;  4WIQ A;  4LFC J;  1N32 F;  2HGL A;  2RAQ A;  1ZM3 A;  1CS4 A;  1LW2 A;  3RAX A;  3AAW B;  4TXS A;  1SB6 A;  3G4S S;  3QWU A;  2E5L F;  2LCW A;  5D3G B;  2J8A A;  2I6W A;  2NXU A;  4EWT A;  3CCZ A;  2E9Z A;  2C2M B;  4OYO A;  4PYD A;  4F02 A;  4QCL A;  3BKT A;  2DGW A;  4EZ9 A;  4C9D A;  1DTQ A;  3CME S;  2F4F A;  1SUQ B;  4LF6 J;  3MMA A;  4ID8 A;  4OI2 A;  2BAN B;  1ZM4 A;  4N5S A;  2B3T B;  1S0O A;  3QIP A;  5GAE I;  4FNH A;  4X66 J;  3OL8 A;  4PG5 A;  1E6V B;  1HWU A;  4I69 A;  3M2R A;  2PI4 A;  4LFC F;  4QIG A;  2BRK A;  2EC2 A;  3MD3 A;  3P6Y C;  1ZPV A;  2GZO A;  3G71 S;  2LMI A;  2ILZ A;  4J90 A;  3HHL D;  3Q8S B;  1UW4 A;  1S1W B;  2XHC A;  3QFH A;  3D3B J;  1RU1 A;  5HQ8 A;  4IH6 A;  2GO9 A;  2R2U A;  5K20 B;  4U7U D;  1OSC A;  1JLA B;  2NZC A;  5K8N A;  4LSL B;  1HBM B;  3TAP A;  3BEG B;  5ETS A;  2VDH A;  4J9K A;  4LF6 F;  2N7C A;  3FSX A;  4OZ2 A;  1S6Q B;  5ETL A;  1N6Q A;  1YK9 A;  1XK8 A;  4P10 A;  3I32 A;  1WG5 A;  2NSB A;  3EZU A;  3MM6 A;  4DL4 A;  2OGU A;  1HKA A;  4N56 A;  1RT7 A;  4PXC A;  2IA0 A;  3N6L A;  2CAJ A;  1H7X A;  2HS0 A;  2GQ2 A;  5KFA A;  1FJ7 A;  3DHX A;  1CLF A;  4DF4 A;  4I4B A;  2H1Y A;  4UF4 A;  4DL7 A;  2DRA A;  3ZTQ A;  4ZPA A;  2LQ8 A;  2IYI A;  1AFJ A;  1U24 A;  2ZBP A;  4I2P A;  4NA3 A;  2V63 A;  3CDE A;  1M1G A;  3Q22 A;  3IM8 A;  1W2B R;  5FJ4 A;  5DQI A;  3GV5 B;  1T03 B;  1WC5 A;  1G2E A;  1VDH A;  4R8U B;  2OUG A;  2R8K A;  2W8L A;  4RNF A;  1BQN A;  4DV2 F;  1M5S A;  1V3R A;  1WF1 A;  1WOO A;  3M30 A;  1B7Y B;  2VZ9 A;  4RW6 B;  5L46 A;  3VGV A;  3ISZ A;  1TKZ B;  2M9K A;  5D3G A;  1C0U A;  3M6X A;  2E66 A;  4KRW A;  2BVZ A;  3MMB B;  5KT3 A;  3D6H B;  4MK7 A;  1LQ9 A;  3TRG A;  3D68 A;  1FES A;  4ZP6 A;  3O44 A;  2DY1 A;  1F3F A;  4H4K A;  5I3U A;  2CQ2 A;  4LQ9 A;  3TZZ A;  2VG6 A;  2BAN A;  2DGS A;  3HPO A;  1RA6 A;  1V5V A;  3MF5 A;  4ZN3 A;  2GCF A;  2CQB A;  4OV1 A;  1E6V A;  3GPA A;  4CO1 A;  3PR5 B;  2HZC A;  3MEE A;  1KP6 A;  1FD2 A;  2X51 A;  1AFI A;  5JMN A;  1HHS A;  3OHA A;  2KM8 B;  4NLG A;  2ASD A;  3PDN A;  1HI0 P;  5F8G A;  4K0K J;  1YJR A;  3ISN C;  2PN6 A;  1FXL A;  1XMO J;  2PO4 A;  2VHG A;  4XDD A;  3QMQ A;  2IJR A;  2WVF A;  3CJR A;  2IVM A;  2BEF A;  3JSR A;  2MZQ A;  3Q8R B;  3GV7 B;  3MM5 B;  4DUT A;  1S6Q A;  5DG9 A;  3BRE A;  3I9Z A;  2VA3 A;  5CCL A;  4MYT A;  5KFX A;  4O3S A;  3CNQ P;  1EET B;  6AT1 B;  1UWA A;  5HJY A;  4CLS A;  1LK5 A;  3MFI A;  3ISN D;  2VH7 A;  3JXO A;  3I5C A;  2F8H A;  3ENA A;  1HNZ J;  4ZIW A;  5GMK a;  3QNW B;  3Q8V A;  2MB0 B;  1XMO F;  5F8H A;  1RE1 B;  5LOQ A;  2L9W A;  1IUJ A;  1RJJ A;  3TR5 A;  3T3F A;  1VOM A;  3K2Y A;  3I6P A;  3HI9 A;  5C2C A;  2B4U A;  2RHS B;  3EVO A;  1QUV A;  1TR0 A;  4CIO A;  1WHV A;  3VAH A;  2FJB B;  2OAU A;  4Q43 A;  5CA5 A;  3CDW A;  3MUR P;  1GH8 A;  4X62 J;  3QT5 A;  1JWW A;  4O44 A;  4UOH A;  3DC2 A;  3CO9 A;  4RW6 A;  1R43 A;  4OHX A;  2Y8Y A;  1LWC B;  1TKZ A;  4PCQ A;  4F25 A;  1HR0 J;  3CCW A;  4Y2K A;  2OLW A;  1HNZ F;  1IJF B;  1XNR J;  3MMB A;  3I96 A;  5GAD I;  4Q5V A;  4MIB A;  3W63 A;  3T5L A;  2NS1 B;  5DDQ C;  1S97 A;  1OSD A;  2AMC B;  4OZN A;  2MHE A;  3PM9 A;  3R5D A;  2ZNY A;  4X65 F;  3BH6 B;  3DRP B;  1IQT A;  3KHH A;  3EMT A;  3MEC A;  4E0D A;  3LWL A;  3NXZ A;  4X62 F;  1ZAX A;  2ROE A;  3TAM A;  5LSO A;  5LM7 E;  3CWJ A;  1IQZ A;  4DMZ A;  2V4J A;  1FRK A;  3OTO J;  2A3J A;  4ZIT A;  4EYH B;  1DHM A;  3AJ2 A;  4F3Q A;  3N6N A;  1UFW A;  1NME B;  2KJV A;  1XNR F;  4DV1 J;  2F8M A;  4FP9 A;  1HBO B;  2J5A A;  2QX0 A;  3T5K A;  4LRD A;  3A1Y G;  5A8W B;  3VHQ A;  3IN5 A;  4ZVP B;  3IR6 B;  2VG5 A;  4Q0B B;  3G6V A;  4MYU A;  1IR1 A;  4J7C A;  4RWW A;  4R0E A;  1H38 A;  3PCO B;  1S6O A;  2DTJ A;  1DZ5 A;  1NO8 A;  2K2P A;  2AU0 A;  3H4D A;  2GVZ B;  4NPO A;  3RAM A;  3THT A;  2RD5 C;  5E33 A;  3SDE A;  3OPK A;  2IC3 A;  2KYZ A;  3OTO F;  4IR1 A;  2ASL A;  1S10 A;  2GC8 A;  1TK0 A;  2R7Q A;  5C5J A;  5AT1 B;  5HJX A;  4LIR A;  4DV1 F;  4OYP A;  4DCO B;  4TU7 A;  5J2P B;  3FBB A;  2IA6 A;  3TJA A;  4K50 A;  2HGM A;  3TAN A;  3U1M A;  2M8D B;  3N0V A;  2PA8 D;  4FDF A;  1LV5 A;  1WSR A;  4Y3C A;  4Y28 C;  3V4M A;  4JV5 J;  3IGV A;  2H9Z A;  1ICE B;  3FBF A;  2I8E A;  4ER8 A;  2LXI A;  2ZKT A;  3M1V A;  2B4O A;  2I38 A;  2YKQ A;  3GTY X;  1HW9 A;  4FKY A;  4BHQ A;  3KWM A;  4ZVU B;  2R8J A;  2BE2 A;  1FRM A;  5DM6 Q;  5D78 A;  1WC0 A;  4F67 A;  1OYD A;  4JYA F;  4HT5 A;  4ED1 A;  2DCL A;  2XY6 A;  1R7I A;  3TAR A;  4H4K C;  1FNO A;  2DGX A;  4K8R A;  2MKS A;  1NUE A;  4MKV A;  3PRV A;  3UDV A;  4M5D A;  4AL7 A;  4LRC A;  1A0O B;  1MU2 A;  2RDD A;  3H59 A;  2KL8 A;  1NK6 A;  3BS9 A;  1Y3K A;  4RW7 B;  3M8P A;  4DQR A;  2HAI A;  1KQG B;  4U9R A;  1ZAV A;  3CJK B;  1JNR B;  1KBR A;  2M5Y A;  4JV5 F;  3T5H A;  3KG4 A;  2NR0 A;  1F2H A;  1TV6 A;  5L9N A;  2VIH A;  4DPX A;  2QA1 A;  2RRN A;  4EK2 A;  2CPY A;  1ULR A;  4P6Q A;  5KFU A;  3MMJ A;  2EFV A;  1HWJ A;  4TY9 A;  3JAM U;  3UVJ A;  2EPI A;  1DQ8 A;  3QO9 B;  4C98 A;  1SC1 B;  3QZ8 A;  2VF3 A;  1WDD A;  2HFU A;  1U6B A;  4OZ1 A;  5KG1 A;  1VQ6 S;  2H5J B;  4PUO A;  1HBO A;  1TL3 B;  1X4D A;  3GJS B;  3UFC X;  4P74 A;  5T7L B;  4AFF A;  1BD6 A;  1WKK A;  1U1R A;  4P2F A;  3BSO A;  3UE2 A;  4YY3 F;  5F0U A;  1TQL A;  5KFM A;  1L3T A;  2LVW A;  3PAC A;  4JI6 J;  1SBR A;  3G6Y A;  2YPY A;  3ONQ A;  4C8L A;  5FD1 A;  1LWX A;  2QFJ A;  3A3O B;  3OT9 A;  3PZP A;  5GAD U;  3QQC D;  3AH6 A;  4NCA A;  3DRR B;  5DG8 A;  2P6T A;  1X9W A;  2FUG 9;  3UN5 A;  3BSN A;  1NHK L;  5T41 A;  2R8I A;  3CB4 A;  1GT8 A;  4NLY A;  2HVD A;  5J2P A;  1BQM A;  3UCG A;  4FXV A;  1JIH A;  2AJ4 A;  4ECQ A;  4C8Z A;  1AYE A;  5IQ6 A;  2HQD A;  1V6H A;  1JLB A;  2A6M A;  2XHW A;  2JVO A;  3GE9 A;  2D41 A;  4ILR A;  2CJK A;  3PRB A;  2LXF A;  4OI6 A;  1Y10 A;  1P1L A;  3NP5 A;  4FVC A;  4PXB A;  3W2W B;  5CHC B;  5I3P A;  5J2Q A;  3R5A A;  1XR5 A;  2IJF A;  2MST A;  1RWP B;  1TK8 A;  2XCP A;  3FVY A;  2BV3 A;  3DLB A;  5EWE A;  1Q7Y T;  2A1B A;  4FF4 A;  1V5I B;  2WVB A;  3OR2 B;  5GAH I;  3FBE A;  3MFH A;  2V9K A;  2W24 A;  2ADB A;  3J80 Y;  2QC3 A;  3PX0 A;  4OZ0 A;  1VC5 A;  3EIC A;  1UPM B;  3FFI A;  2NPI A;  3TUZ C;  1DAR A;  4X4P A;  2Z58 B;  4XAK A;  4ZHR B;  3OR1 B;  1HWK A;  4JI0 J;  2ZH1 A;  1WDT A;  1PYT A;  2WBR A;  1S1V B;  4CO4 A;  1JLF B;  1FEH A;  2J0X A;  2NYI A;  1URR A;  1VC0 A;  5T14 A;  4GVB A;  2Q66 A;  3MM7 B;  2A10 A;  2R7W A;  4KH0 B;  1YZ7 A;  4A48 A;  3ZTP A;  4QIF A;  1WC4 A;  3QFW A;  1SJ4 P;  1N5Q A;  4WJB A;  4OL8 A;  2KT5 A;  5LL6 d;  3LP1 B;  5IV3 A;  2RJZ A;  2JLG A;  1KDN A;  4CLT A;  4EBD A;  1GEH A;  3QRR A;  3LP2 B;  1REV B;  2AJ2 A;  1DTT B;  1Y00 A;  2YQ3 A;  3L3C A;  1XR6 A;  4JI0 F;  3BGL A;  4RU2 A;  5T7L A;  4NCG A;  5K14 B;  3KNG A;  4CT9 A;  4O3R A;  1FX4 A;  4KGK A;  2FVR A;  1TKX B;  3BBB A;  1RWO B;  3L09 A;  4C11 A;  4CLU A;  3NAH A;  5I3Q A;  1T9W A;  1L3V A;  1O51 A;  3BGR B;  1LXN A;  3VWS A;  4NLP A;  1F1B B;  5KOX A;  4GC6 A;  1UZD A;  3OJU A;  2BJ1 A;  3BO3 A;  1ZTT A;  3PW5 A;  1R8C A;  4YR0 A;  5KOW A;  4IRC A;  1TL5 A;  2R8H A;  1KFS A;  5MAO A;  1U8W A;  3NBP B;  1NCL A;  2QLB B;  1BE4 A;  2YPZ A;  1J2V A;  1FJC A;  3R1H A;  3W2W A;  4KC5 A;  1X4A A;  4WZQ A;  1FCA A;  2J7U A;  4OZJ A;  2DNN A;  2BJ9 A;  4KPY A;  1SKW A;  3H42 A;  2BKO A;  1VRQ C;  3LGH A;  4ZKA A;  4C7Q A;  1LWE B;  4MK8 A;  1I5O B;  3I82 A;  5BYR A;  3GFZ A;  4MKA A;  2HYI B;  1HNX J;  2RQK A;  2VQF F;  2XMJ A;  1OIA A;  1P27 B;  3MWB A;  4F36 A;  1S4F A;  5GAG I;  1Z2L A;  2X1F A;  1S59 A;  4LRF A;  2QL9 B;  3NGR A;  4HEA 9;  1P1T A;  1S1V A;  1RZM A;  4YOE A;  1JLF A;  1ZYQ A;  2VPZ B;  4CLF A;  2OPR B;  2AGQ A;  2GO8 A;  2ZIT A;  3NMR A;  3GJR B;  3MM7 A;  4OJ1 A;  3IRX A;  3BQ0 A;  3OVB A;  4HH1 A;  1REG X;  4OLP A;  1V9O A;  2DEI A;  3CE8 A;  1FFG B;  1KS2 A;  3KK2 B;  1HNX F;  1PSD A;  2QL5 B;  5IXU A;  1NDP A;  2CIM A;  1FEE A;  1YSJ A;  1KEK A;  2VQE J;  1DTT A;  2KFZ A;  3NAI A;  2KTQ A;  2ZBI A;  3RBZ A;  1RTD B;  1ARO P;  5L1L A;  5K14 A;  3TA1 A;  2XY5 A;  1T9Y A;  4PYA A;  3B54 A;  5IT4 A;  2B43 A;  3V4I B;  2CDQ A;  5K8P A;  1X9M A;  1WI6 A;  4C8K A;  4UW2 A;  4PKD B;  1UTA A;  3GJQ B;  3QRP A;  4YDD B;  1MN9 A;  1ZOT A;  5IV4 A;  5HRO B;  4ELU A;  4ETZ A;  1XNQ J;  3NGD A;  2CQD A;  3T19 A;  4IO9 Q;  5K8O A;  2DEJ A;  4GKJ J;  1FJG J;  2XI3 A;  1YQH A;  4GRS A;  2ZOM A;  2ZBQ A;  2XM3 A;  3KLV A;  1NM2 A;  3PKM A;  1JXL A;  4CTA B;  1IWA A;  2ZJR Q;  1CPZ A;  2Y1L B;  4M5N A;  2XZW A;  3NBP A;  2B56 A;  3JSM B;  4N41 A;  3UDE A;  1WOP A;  2KHC A;  2BW7 A;  1XIQ A;  4ILL A;  1B3T A;  1NK7 A;  1XNQ F;  1UFK A;  3MAA A;  4U6P A;  3J7Z 5;  3W9J A;  1R0A A;  2YWE A;  4N7T A;  5KFH A;  1I3O B;  1RBL A;  3MUV P;  1T11 A;  4LF8 J;  4GKJ F;  4RBV A;  4EU0 A;  4IRK A;  3IBW A;  1UEU A;  3PIO Q;  3LAL A;  4KR0 B;  3LH2 S;  4QWA A;  2VOD A;  1S9E A;  3MMC A;  5HI7 A;  1IBC B;  2Z56 B;  4KT0 C;  4XTT A;  3I0S A;  1Y4Z B;  4F4X A;  1KVJ A;  5F3Z A;  1NKE A;  2GAG C;  2DJW A;  1MML A;  2OPR A;  2Z30 B;  2JLE A;  4Y0F A;  4FYV B;  2O67 A;  3W1Y C;  4F26 A;  1CQN A;  1DLO B;  1RK8 A;  3ELH A;  2QA4 S;  1TUW A;  2DYA A;  3GP9 A;  1RYR A;  2IFX A;  2FHK A;  1R31 A;  5AE2 A;  4LF8 F;  1FI4 A;  5CYM B;  4QR1 A;  4J9P A;  3KK2 A;  5E5N A;  4DV6 J;  1NZA A;  1RAG B;  2DNG A;  1FWP A;  1HQE B;  3IP0 A;  1HIY A;  4E8U A;  4NLW A;  1VIX A;  2HVZ A;  2GV1 A;  4ED7 A;  1WWH A;  1G1X A;  3AXM A;  3KYL A;  1NSK L;  5KT4 A;  4Z7C A;  2B6A B;  3V4I A;  4FF3 A;  3JTO A;  2CPD A;  5HMY A;  2CQH A;  2Y0S D;  3TEG A;  4ZVS B;  3CCV S;  4NZ6 A;  2F63 A;  4O3N A;  2G2O A;  1ZTW A;  1T8E A;  3NGK A;  1RHM B;  3DRX A;  2I0X A;  2JEF A;  3RB0 A;  2ZH5 A;  3AJD A;  1ZPW X;  2DNL A;  3H4B A;  4DV6 F;  3UD3 P;  4CLL A;  3MOZ A;  2NQP A;  4DFM A;  4MIW A;  4WFB Q;  4CTA A;  2E7W A;  3C8Y A;  1IKY B;  4FYW B;  1JXV A;  3PY8 A;  2VA2 A;  1R8A A;  1SQF A;  3W62 A;  1ZET A;  5H9E J;  3RBD A;  1U02 A;  1EX8 A;  3GIM A;  4ZLJ A;  2N3L A;  2GFF A;  1VJQ A;  2UV8 G;  2RU9 A;  4DV7 J;  3SQO P;  1AUS L;  1H2T Z;  4TY8 B;  1HHT P;  1NDC A;  2EKY A;  2HGN A;  1NLK L;  2IMO A;  3SEO A;  1VBZ A;  1KSP A;  2DNQ A;  4RWX A;  5J2M B;  2AJ0 A;  4DN9 A;  1UZH A;  2EXU A;  3DLK B;  2EFP A;  2MDA A;  2RRA A;  2F65 A;  2M8H A;  4ZCL A;  5E41 A;  1EQ0 A;  5HBM A;  5DDR C;  2U1A A;  2V69 A;  2ZOG A;  1KWM A;  2FLP A;  2OI2 A;  2J0W A;  3CD5 A;  4ZOS A;  3VQS A;  4LRA A;  3NNC A;  3PYE A;  5G4D A;  5FLX Y;  3HMJ G;  3BDE A;  4LF5 J;  2HND B;  2HPU A;  3RB4 A;  1OYE A;  2JWN A;  3UPF A;  5A2Q U;  1S1U B;  5I42 B;  2PT0 A;  4DV7 F;  1QTM A;  4WU2 A;  1DLO A;  5KTQ A;  3FCW A;  5JJB A;  4ZLN A;  3QRQ A;  4WK1 A;  4UTG A;  3A13 A;  1SKS A;  4NLQ A;  2E5G A;  1NKC A;  4UUW A;  2QV6 A;  4JI5 F;  3VVT A;  3V81 A;  3VV2 B;  4JI7 J;  5CYM A;  3H40 A;  1UWB A;  3VAF A;  2WAQ D;  2DK2 A;  4ED4 A;  3TVZ A;  4DDF A;  1UA0 A;  5I4M A;  4IFY A;  2HRT A;  3CDB A;  4A8Q A;  3MUM P;  2J9D E;  2QYC A;  3GSI A;  1VRU B;  2XS5 A;  3GR1 A;  4CLY A;  3M6U A;  1BXN A;  2B6A A;  5D0G A;  4OYZ A;  4LF5 F;  4FKX A;  4KE5 A;  3TW0 A;  2AZ3 A;  4KJI A;  5J1N A;  3MED A;  3NGU A;  1RP5 A;  4AD6 A;  2OIH A;  1KHV A;  5KFC A;  2DR6 A;  3C15 B;  2HBR B;  4I7F A;  1WHY A;  2DT9 A;  3D1H A;  4NA2 A;  4NRU A;  4KBI A;  3KK1 B;  5ITH A;  4LT6 A;  3R27 A;  3W3S A;  1TZ0 A;  1P9Q C;  2WB4 A;  1C1B B;  1LOU A;  1IKY A;  3IGN A;  3T41 A;  2B7C B;  1G3O A;  3M2U B;  8RUC A;  2FVP A;  3R2C J;  2HNZ A;  1FK9 B;  1UVM A;  2AYG A;  5FII A;  1UET A;  2D74 B;  4WFN Q;  3Q89 A;  3DRY A;  3NY0 A;  4UZB A;  3ZZ0 A;  4F3M A;  2RUS A;  3G96 A;  2YWW A;  1HBU B;  4MAK A;  3UR3 C;  2X1A A;  3D4J A;  3FMW A;  4EBC A;  3VAG A;  2W25 A;  3ZZY A;  1U4B A;  2M88 A;  5J2M A;  1RT1 A;  3U1L A;  1PJ5 A;  4RW8 A;  2DY9 A;  1PYS B;  2ZUA A;  4ED5 A;  2HQC A;  4JV2 A;  4IR9 A;  2KH9 A;  1SCJ B;  2W8K A;  4W4M A;  1KVK A;  2L9D A;  2C28 A;  3AT1 B;  2FJW A;  1LKZ A;  3D67 A;  2KB2 A;  1KQK A;  3OFF A;  5F3T A;  3CMQ A;  3O8W A;  2HS3 A;  4JI3 J;  2FQQ B;  4I6A A;  4AYB D;  4IDK A;  5KFO A;  3UN2 A;  1NJW A;  1RHK B;  2CFX A;  2HND A;  5E0O A;  3FEX B;  3E8O A;  3QYY A;  5I42 A;  2ZOF A;  1FDA A;  1CJK B;  3AD9 C;  4KGM A;  2HAF A;  1DQ9 A;  4J9U E;  2MMY A;  4P7V A;  2RNE A;  4DR4 J;  3KLI A;  3QT7 A;  2G1D A;  2DHX A;  3NCP A;  4MKB A;  2W1B A;  3EGZ A;  3MCS A;  2DVI A;  3HFZ B;  3E2E A;  4J9O A;  2AWZ A;  3J7A 1;  1QE1 A;  1TKD A;  4C2M A;  4QYR A;  3AA8 A;  5DRK A;  3CO0 P;  2B9E A;  2MQN A;  3OVA A;  2R7R A;  4A8W A;  1IKW A;  3KLH B;  1CJU B;  1ZH5 A;  2RB7 A;  1GXU A;  2XZT B;  4IRD A;  4A8O A;  3GSD A;  4JI3 F;  1VGY A;  4HTJ A;  3GCX P;  5CD4 H;  5IQQ A;  3TZW A;  3CIZ A;  1BGX T;  1SJ1 A;  3PV8 A;  5D8H B;  3T1A A;  1P8G A;  1FVS A;  4EEY A;  3M2V A;  1Q82 T;  2DIT A;  2H51 B;  4C97 A;  4BWM A;  1RDR A;  4MIA A;  4NXM J;  4OYA A;  2DR8 A;  3C15 A;  3HVR A;  1NH8 A;  3W2V B;  4IOA Q;  4DFP A;  1K9M T;  1FRH A;  2BDP A;  3W61 A;  4N8N A;  4WE1 A;  2BQR A;  4PWW A;  1K0V A;  4CYU B;  5KT7 A;  3POT A;  2Q6C A;  1AZS B;  4YP3 A;  2WVC A;  5L1K A;  1C1B A;  1Q8L A;  2CVI A;  2F9D A;  3AOA A;  2DKO B;  1FE0 A;  3HSZ A;  5E3C A;  5JVH Q;  5DET A;  2YWF A;  2B7B B;  3IAM 9;  5HVH A;  4FPR A;  3V6D A;  3HJV A;  3MTK A;  3OTC A;  1FK9 A;  2H48 B;  1S0V A;  4HHH A;  3RG6 A;  4UQG A;  1OS5 A;  3NNA A;  3W60 A;  4G65 A;  4A8K A;  2CXE A;  3EJM A;  3IS9 B;  2C1E B;  2E9R X;  1Y0H A;  2WSC C;  3DOK A;  4KO0 B;  1HBU A;  3KXD A;  1GFW B;  4NXM F;  1VJW A;  1KLN A;  3AY0 A;  1TMJ A;  2PI5 A;  1FDN A;  2IDL A;  2FDN A;  2QZ8 A;  2OPS A;  2BE9 B;  2E7X A;  2MZT A;  2YKN A;  1HNI B;  2MJN A;  2ZH9 A;  3R7S B;  3KHL A;  4I6W A;  5DJB A;  2AEF A;  3GB0 A;  4DJB A;  2UUT A;  1R3N A;  3TX0 A;  3ETO A;  3PXG a;  3PHT A;  2UP1 A;  3GIJ A;  3MM9 B;  3V2U C;  1FO1 A;  2K3I A;  4J9Q A;  4UOC A;  4EO8 A;  3T9Z A;  1XMB A;  1TL7 A;  3K5L A;  2ZKU A;  4AND A;  4KAI A;  4YB6 A;  4K5S A;  4P2S A;  2FLO A;  2MKC A;  2HHP A;  1H2V Z;  2YH0 A;  4X2B A;  2UVU A;  2GMH A;  3QAU A;  2VBW A;  1VQS A;  4OJG A;  3CMA S;  2DHS A;  3LGN A;  3DDN A;  3D0H E;  1OY6 A;  4ECZ A;  1EB0 A;  2VFU A;  1B0T A;  1CJU A;  3DI6 B;  4FZV A;  4O3P A;  4ILM A;  2DHH A;  1NK8 A;  5KFT A;  4CDI A;  2J6U A;  2HWH A;  4DSJ A;  2LQ9 A;  2RQ4 A;  2FHJ A;  3S7R A;  1UFL A;  4FN5 A;  1OWX A;  1LXJ A;  2N4C A;  3H98 A;  1NXI A;  1VYA A;  3PX4 A;  3EE3 A;  4LF2 A;  2GNK A;  2W7A A;  3IMQ J;  2BXJ A;  4B9T A;  3ZNU A;  4EBE A;  4LBP A;  1T05 B;  4MT1 A;  3KLG B;  3TX8 A;  1MMD A;  3MR7 A;  2MJU A;  4DBQ A;  1TUG B;  4ID5 B;  2HFN A;  4W98 A;  2W9B B;  5LSL A;  2C2O B;  2CVE A;  2F4V J;  4DL0 C;  1X4H A;  2HMI B;  2YNG A;  3PIP Q;  2DHG A;  2Q43 A;  2ZJP Q;  4FBU A;  4RW4 B;  1XER A;  3BR8 A;  4MFB B;  2G2Z A;  5BXI A;  4OX8 A;  2BQU A;  1PCA A;  1TU0 B;  9RUB A;  2JH3 A;  4NYO A;  1YIJ S;  4H4M A;  2K06 A;  4RL1 A;  4LMZ A;  3IS9 A;  3CTR A;  4PWD B;  5A8K B;  3PRD A;  3OV7 A;  3P96 A;  1SV5 B;  1M90 T;  3T5J A;  2NXC A;  1IKX B;  4LIW A;  5F41 A;  1F2G A;  4FS1 A;  3OTE A;  3DYA B;  3A3P B;  3CUN A;  4QU7 A;  1HNI A;  2FZG B;  2C2K B;  3CT9 A;  1YVF A;  3T1H J;  2VON A;  1NJZ A;  1T3O A;  4F04 B;  2F4V F;  2QLJ B;  3W5Z A;  4DUY J;  4OI0 A;  3GCW P;  1GX5 A;  2RIJ A;  1VRT A;  3LWM A;  3MM9 A;  4K4U A;  1VBY A;  3LUY A;  1HWL A;  4H54 A;  2OD6 A;  2XG8 A;  3FBC A;  2XNR A;  1U0H A;  5B0C A;  3UDC A;  1YTY A;  3KUG A;  3K5P A;  2HZV A;  1Q7L B;  3F56 A;  3K7R A;  4WFY A;  3V6J A;  3MCM A;  3R6L B;  5H1S V;  2FVC A;  4ELV A;  2KFY A;  2CPZ A;  3D6T B;  3EVM A;  4U7U K;  1MMN A;  2MYF A;  1YBA A;  2VFR A;  3TYT A;  4DPY A;  3JS9 A;  2K1R B;  5JVG Q;  3LOU A;  3B8H A;  3CCE S;  4KB7 A;  4CRJ A;  4RLE A;  1S9F A;  4WF9 Q;  1WG1 A;  4K4V A;  2M52 A;  4J9L A;  1Y3J A;  2B4V A;  2RIL A;  3M9O B;  1QAY A;  1H72 C;  3P5T L;  1U7L A;  1S9G A;  3JYT A;  1RTH B;  3PYG A;  3EGN A;  1T9V A;  2MEW A;  2C3Y A;  4ZP8 A;  2UUA J;  4LSN B;  2IVY A;  3DMJ B;  5F8M A;  3TUI C;  3U27 A;  3GJT B;  4DXL A;  2R3V A;  1HD1 A;  2V50 A;  3BR9 A;  3RRH A;  1VMB A;  2KO1 A;  3M9N B;  2MXY A;  2LDI A;  4RJV A;  4RNN A;  3KLG A;  3ZZZ A;  3AOD A;  5F9N A;  4DSI A;  4ID5 A;  3G6X A;  2YKP A;  2HMI A;  2DH9 A;  1HLW A;  2RQM A;  5IZH A;  2D1C A;  2PA3 A;  3THP A;  2ZNZ A;  4UY8 T;  3MDF A;  3S1T A;  3OQ2 A;  1OO0 B;  4OZ5 A;  3DLG B;  2CPF A;  4OYX A;  2MHN A;  5KFR A;  2GGP A;  2J6S A;  3DN9 A;  5DDO C;  1HWI A;  3ADA C;  3CCM S;  3QSY B;  1EZZ B;  1CQM A;  4USJ C;  4C0O C;  4PWD A;  1TKT A;  1VQY A;  1Q5V A;  1YIT S;  4M5K A;  2G13 A;  2UUA F;  2ZWP A;  3G82 B;  4S0M A;  4ZVO B;  3VAM A;  3NL0 A;  5D77 A;  1UP1 A;  3AXK A;  4PQA A;  1N5V A;  3NGT A;  3CCR S;  3NKY A;  3IAS 9;  1SJQ A;  3MCO A;  2FJA B;  2BKN A;  1X4B A;  3GIK A;  2BE7 D;  5D0E A;  4HAC B;  3VF0 B;  3QSI A;  2DH8 A;  3R6G B;  1J5E F;  2P9G A;  3O3L A;  2AIR B;  3C6T A;  1U0S A;  2GIF A;  3DDI A;  5C24 B;  1PKU A;  1JKH A;  1X0P A;  4WP8 A;  2GQC A;  5DLG A;  2XS7 A;  1QVG R;  3JQM A;  2HRY A;  2DNY A;  3GIL A;  3WZ0 A;  1NK5 A;  3FEY B;  2IHR 1;  1RT3 B;  2ZZN A;  1EKS A;  3N28 A;  2CNK B;  3CC7 S;  1FTR A;  1CS4 B;  1LW2 B;  5KFV A;  1V3S A;  4B3O A;  2QO3 A;  3N6M A;  1S7I A;  1X5S A;  1S0N A;  4LJM A;  2RH3 A;  3SYZ A;  1WEL A;  2LFV A;  2KKH A;  3FEZ A;  2E1M C;  2VG7 B;  4ZPB A;  1WKL A;  3JTP A; 
#chains in the Genus database with same CATH homology
 3FCV A;  1MN7 A;  3EIC A;  4UOF A;  3BBB A;  1LWX A;  2DXF A;  3NGT A;  1PAE X;  3EMT A;  3VVT A;  1UCN A;  1HIY A;  3BH7 B;  3Q83 A;  3PJ9 A;  3B54 A;  1NDL A;  3Q89 A;  3FBB A;  1BUX A;  4AND A;  3FBC A;  1NHK L;  4F36 A;  1F6T A;  3ZTR A;  1NDC A;  4EK2 A;  3EVO A;  3VVU A;  1NSK L;  2B8P A;  5C7P A;  1NLK L;  4DI6 A;  4W98 A;  4C6A A;  3ZTO A;  3FKB A;  3BBF A;  3NGS A;  1MN9 A;  1B99 A;  2HVD A;  1S59 A;  3WX8 A;  1NB2 A;  3Q8Y A;  3Q86 A;  3NGR A;  2HVE A;  3VGV A;  5CAA A;  1S5Z A;  2B8Q A;  3FC9 A;  5BXI A;  3DDI A;  3EJM A;  1PKU A;  4CP5 A;  1NSP A;  4ANC A;  3FBF A;  1HLW A;  3L7U A;  2HUR A;  2NCK L;  4UOH A;  4FKX A;  1B4S A;  2VU5 A;  2BEF A;  1W7W A;  4O0N A;  1HHQ A;  1XQI A;  4FKY A;  4DUT A;  2BX6 A;  3VGS A;  2DY9 A;  2AZ3 A;  2AZ1 A;  3ZTP A;  4F4A A;  2ZUA A;  3EVM A;  1NSQ A;  3EVW A;  4HR2 A;  1ZS6 A;  2DXD A;  3NGU A;  1U8W A;  1NCL A;  4WBF A;  3R9L A;  5CAB A;  1EHW A;  1F3F A;  1BE4 A;  1LEO A;  3JS9 A;  3VGU A;  1KDN A;  1WKJ A;  3Q8U A;  4UOG A;  2DXE A;  1NDK A;  1WKK A;  3ELH A;  4ENO A;  1K44 A;  3BBC A;  2DYA A;  3GP9 A;  3ZTQ A;  1BHN A;  5IOL A;  3ETM A;  3EM1 A;  1NUE A;  4KPC A;  3PRV A;  4S0M A;  4DZ6 A;  1JXV A;  2CWK A;  1NDP A;  1S57 A;  4ANE A;  1NPK A;  3DKD A;  3MPD A;  3ENA A;  3FCW A;  3VGT A;  3B6B A;  3FBE A;  3ZTS A;  1WKL A;  3GPA A;  1XIQ A;  3BH6 B;  1VYA A;  3G2X A;  3Q8V A;  3EE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...