4FKYA

Crystal structure of nucleoside diphosphate kinase b from trypanosoma brucei bound to gtp
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
152
structure length
152
Chain Sequence
MPSERTFIAVKPDGVQRNLVGEIIKRFENKGYKLVGLKLLQPTEEQAKQHYIDLASKPFYSGLVSYFSSGPIVGMVWEGLGVVKGGRVLLGATNPADSLPGTIRGDFAVDVGRNVCHGSDSVESAKREIAFWFKAEELVSWTSHSVKQIYER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title Crystal structure of nucleoside diphosphate kinase B from Trypanosma brucei bound to GTP
rcsb
source organism Trypanosoma brucei brucei
molecule tags Transferase
total genus 46
structure length 152
sequence length 152
chains with identical sequence B, C
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2012-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 4fkyA00
1NLKL 4ANEA 3FC9A 4FKYA 1LEOA 2DXDA 2DY9A 3VGUA 2CWKA 3ZTQA 5C7PA 3NGUA 4W98A 2NCKL 4F4AA 4CP5A 3G2XA 4WBFA 2B8QA 3Q89A 1XIQA 1S5ZA 3Q86A 1JXVA 1U8WA 3BBFA 3PRVA 3EM1A 1NDPA 1ZS6A 3EE3A 5IOLA 4ENOA 1HHQA 3VGSA 1NSKL 1WKLA 1K44A 1BUXA 1NSPA 3VVTA 2BX6A 4ANDA 4EK2A 4KPCA 3ZTPA 3FBCA 3FCVA 3FCWA 4UOHA 3FBBA 3FKBA 1UCNA 3EICA 3MPDA 3Q8UA 3VGTA 1NUEA 1S59A 3GPAA 3Q8YA 3EVMA 1F3FA 1LWXA 3Q83A 1VYAA 1PAEX 1WKJA 3BBCA 4O0NA 1PKUA 3ZTOA 1BE4A 4DUTA 5CABA 3ENAA 3FBEA 3NGTA 2B8PA 3ELHA 1HIYA 5CAAA 1F6TA 3PJ9A 3VGVA 5BXIA 1B99A 1W7WA 3WX8A 2AZ3A 3NGRA 2ZUAA 3R9LA 1BHNA 3BBBA 2DXEA 4HR2A 1NHKL 2HVDA 4FKXA 3NGSA 3EVOA 3VVUA 1EHWA 3BH6B 1B4SA 1NB2A 1NCLA 4DI6A 2BEFA 3ETMA 3DKDA 4S0MA 2DYAA 1S57A 3JS9A 3L7UA 1XQIA 3EJMA 1NDLA 3FBFA 1NPKA 3EVWA 3Q8VA 4DZ6A 2HVEA 3BH7B 1MN9A 2VU5A 3ZTSA 1MN7A 4UOGA 3B54A 1NSQA 4C6AA 4UOFA 4ANCA 2HURA 3GP9A 1NDKA 1HLWA 3B6BA 2AZ1A 2DXFA 3DDIA 1WKKA 4F36A 3EMTA 1KDNA 1NDCA 3ZTRA
chains in the Genus database with same CATH superfamily
2VG7A 4K0KJ 2XZWA 4M5MA 2V4JB 1DTTB 2RKIB 4A8XA 2XHWA 2CJBA 4W98A 2JLGA 1RT1A 3CJQA 2ZH4A 4PZVA 4KPCA 1D09B 2DNQA 1C4AA 3PY8A 4E0DA 1R8AA 2JFDA 2PI5A 3BS9A 4R5PB 4ECXA 2YKMB 1K0VA 4KE5A 3I56S 1MU2A 3DLJA 1NHKL 4YQWA 1KS2A 4P7TA 1FVQA 1WC5A 2XLKA 5EX0A 1KKHA 2HVZA 1U2RA 2BDPA 3D6FB 2BJEA 2Z2MA 3PW0A 3MPWA 2ZH1A 1U6BA 2B4PA 4Q0BB 3HK2A 1NBEB 4UY8T 2QC3A 1U1PA 1FDBA 2HURA 1N0VC 4LF8F 1H7XA 4IR9A 1FRHA 1RTZA 1RT4A 5THWA 2PA3A 2FHKA 4AYBD 3AA9A 3H5XA 1ZOTA 2RB7A 4C7QA 1BQNA 3D9BA 2R2RA 3C6TB 3ZO7A 1WTFA 4U95A 3DI6B 2CJYB 2B9EA 2P8IA 2KT3A 3SV4A 3PRVA 3K5LA 5G0RA 4PQUB 1K44A 2OFGX 5HQMA 1TKTB 2E5GA 4L6V3 3D66A 5T7LA 1M5OC 1C1BB 3UN3A 2HAFA 4X4OA 3AQPA 1F3FA 4ZVOB 3I32A 3M9MB 4K5SA 3JB9k 4MMOA 1W7WA 1RYSA 1VIXA 2R8HA 2WVEA 1Y00A 1GXUA 2CNLB 1N36F 3CD6S 3TJ9A 3C14B 4O23A 1U1MA 4JOUA 1IBCB 4RL1A 2XMMA 1XNQF 4MFBA 3QGHA 1N6QB 4LBHA 4H4OB 1VLOA 4ED2A 3UI3A 5EN1A 3MCNA 4LFBF 1T94A 1AYEA 3D0GE 3PACA 1JJ2R 2WVCA 3GP9A 1FRXA 5DG8A 4TQSA 2PDAA 4OYMA 1YRXA 5KT3A 1HYSA 4U67Q 1CPZA 3M1VB 3EDQB 4XDDA 2VFVA 3LPYA 4FF2A 1H6KX 4BDPA 4ANDA 2NUUG 3DGPB 2AJQA 4DWIA 2M0GB 3W61A 2D41A 3W2VB 2XMKA 4NMLA 2DCUB 1D8YA 4IO9Q 1U6FA 3CSKA 2J9DE 2ZBRA 3GG1A 4WFYA 4GVBA 2CDRB 1F6TA 4FBTA 4HHUA 2CPJA 5A2QU 1RB0A 5J2MB 2R8JA 1Z4UA 2KT5A 2ZUAA 2R2TA 1ZZNA 1S4FA 2UUAF 1D9FA 4DR5J 1SXLA 1FNXH 4KAIA 1TU0B 2M88A 3Q8PB 5HO4A 4CT9A 3PFEA 1F2GA 3T1YJ 4LF1A 2XEXA 5HMYA 1RTDB 2WB1D 4DR2F 2IVYA 1RTJA 1CULB 1NMEB 3GB0A 2M4MA 3QT6A 2N4CA 2DR7A 2NYHA 4MKVA 2ZH9A 1UZHA 2QL9B 4X66J 3TI0A 3Q8RB 5K14A 4ZVTB 1B0PA 1WUUA 1SJ4P 2F63A 1CS4B 1HARA 4GO5X 4B3OA 1RDRA 3G2XA 2CQGA 3RRKA 3GV8B 2CG4A 2C2KB 3DRSA 5C2GA 3R5JB 3TUZC 1XTZA 4FPIA 4PEOA 2HFOA 4DV6F 2F4FA 3V4MA 2KKHA 1Z1ZA 4FYXB 5DZ7A 2WBRA 1RXOB 1NKCA 1N33J 3J7A1 4FYVB 2QSWA 3BR9A 2HBQB 4I2QA 2R7XA 2RHQB 2H48B 3MM6A 2F8EX 5HVGA 1JIHA 2MZQA 4KHMA 2O1PA 2ZH7A 1S6UA 2ZKUA 2YQ1A 4DN9A 3IRWP 1W2IA 1MN7A 1JLBA 4CI0B 1GXTA 4JV1A 1M90T 1WOOA 2EBEA 4CLPA 2F4VJ 4D3HA 2KO1A 1WD6A 2DNZA 1FFGB 1N88A 2VOOA 3QLHB 1U1OA 1HW9A 4X4TA 4AL5A 4OI0A 3HT0A 2N7CA 2B6AA 3O5TB 2HRTA 3LQVA 2HVIA 2AEFA 5KFEA 2DNMA 1EP4A 4O3QA 2J6TA 4ICLB 4RW4B 5CQGA 5CA5A 2LLZA 4QW8A 1WELA 5ETLA 2G0JA 3FRZA 1FNMA 3M32A 2RD5C 2OHDA 4WZQA 4L3KA 2ROGA 2DGUA 1SJRA 4WFAQ 1RT3B 3U27A 2DNYA 1S12A 1CJKB 1ZPWX 3SI8A 2DPJA 2YPZA 5CD4A 4QU6A 3RTVA 1ZM2A 1CJUA 3MMBA 1P8GA 2RRNA 5CZXA 1FK9A 3CB4A 3FVYA 4DZ6A 4QW9A 2Q6CA 3T1HF 1VDHA 4QR2A 4RWWA 4BS2A 2GV1A 4IOAQ 1VCTA 3W9HA 2IJFA 4HT5A 4ZPAA 2ZOGA 2YKPA 5C42B 1YJNS 4ZVEA 3MTJA 3BPDA 2LXIA 3U1MA 3KJNB 4JI5F 2H65B 3OLAA 4O3RA 3ZTQA 4RU9A 1L3SA 3MM5A 1RJJA 3MZIA 2E1PA 4IR1A 1YZ7A 1X31C 2MKYA 1REGX 1VIOA 4IFVA 4LQ9A 4N8OA 1D8ZA 2BKOA 4DX7A 3GWCA 2EG2A 3C2PA 4G1QB 5KT7A 4ZPTR 5D15A 2MY8A 4KR0B 4Y28C 1YX2A 1WEZA 4QBUA 3A12A 4IOBA 4RZRA 2V2QA 3OV7A 2KG1A 1RWVB 2K06A 3D6MB 3QNWB 4KFBB 5KFCA 3MURP 1S72S 3IRXA 3R1HA 4JI8J 3PX0A 2V67A 1RWPB 3TZZA 2MKCA 4N7TA 1VI7A 3P3DA 1S57A 4I2PB 2YNIA 1GTEA 2ROEA 2CQHA 5B08A 1F9HA 3AQOA 5KG1A 2B43A 1S0NA 3KG4A 2GFFA 3KLVA 1NDKA 5HL7Q 4RBTA 1VJQA 4JUZA 2GVZB 4OQJA 3RBEA 2RUSA 2WONA 5I3UB 1DLOB 4LSZB 2N3LA 3WZ0A 1VLYA 4C9DA 3MFHA 3KK1B 2LECA 1UW9A 5K8PA 3FCVA 1FO1A 2NLWA 3N0VA 1H2UX 4PAAA 2HK3A 3G9CA 1Q53A 3C8YA 3HSGA 3O2IA 4CO2A 4I0WA 2NPIA 4IKAA 1Q7YT 4WYLA 5A2QY 3KK2A 2OPSA 2GC8A 5H1SV 2IJRA 1F5BA 3TARA 3KYLA 3S7RA 1ZAWA 1IM4A 2BEFA 5B7WA 3PYDA 3WHIA 3K59A 1NHVA 2AP6A 3OR1B 3EJMA 2XYGB 3M8RA 2Z57B 5KG6A 5E3RA 2DRDA 1DQ9A 4LF5F 2OD4A 1VQ9S 2AX0A 3DU6A 4DEZA 3J7YI 3M6WA 4ZLPA 3RJMB 5I3QA 3NNHA 4IDKB 5B0EA 5IFMA 3HHDA 2SXLA 4KY3A 4ERDA 4LVOP 3I0RB 2EVZA 1WEXA 1HFEL 4R0EA 1WNEA 3I4PA 3OL6A 3SCLE 3BQ0A 5LM7E 2V68A 2MQMA 1HD0A 1V9OA 8AT1B 2ZZTA 2QL5B 4TNOA 5H9FK 5H9EJ 1LWXA 4ILRA 4BLGA 4Q5VA 1UPMB 1CBKA 1AB8A 4LF4J 4DV2J 2BR0A 2M70A 5ETPA 2B4UA 3R2DJ 2X51A 3PM9A 2LEAA 3LWMA 3W2WA 4NYPA 4RBVA 2OPPA 3E8OA 4HH0A 2EWHA 2DNHA 4U6PA 4MYUA 5KG2A 1MNEA 3LPEA 2J9DA 1D1UA 1SC1B 1C2PA 3Q2TC 3H7HB 2LQBA 4MK7A 4FZVA 4B3MJ 4DV3F 1WSVA 3HFKA 2ZBIA 1B7YB 3TA1A 2JFKA 3OL8A 4CCHA 1CSJA 1K9MT 6FD1A 2W7AA 1VQKS 3M9NB 1X4BA 1J5EJ 1FJCA 4KKOA 4ZKAA 1MWYA 3R7NB 2RKIA 1VC5A 3P4UB 1Y11A 4BC7A 2R7WA 2KFZA 5F8HA 1BE4A 4TU8A 4M95A 1RHRB 3GV7B 1S10A 5HAOA 1I94J 2V6AA 2VG6B 2IM3A 3KHRA 2HHPA 1SKWA 4A8OA 2ZDOA 2AIRB 3IP0A 2NZCA 3PDNA 3SDEA 3HD1A 2ZC4A 2KFNA 2ROPA 1TL3A 4J9VA 1JLGB 1N34J 5A8WA 5D3GA 5HLFB 1RKJA 2PGCA 2CZVC 1HPZA 3WC0A 4RW7B 5GAEU 4P73A 1R0AB 4ES2A 3M2VA 3KJVA 2CPYA 3E01A 1S1VB 3FZBA 2MLXA 3QWUA 5FIIA 1VRQC 3R6GB 2W4PA 3BGLA 2RE1A 2OSQA 1FKOB 1VRUB 1U09A 4CO0A 1N0UA 3M8WA 4ZHRB 4I1TA 4C8ZA 1F9FA 2XGPA 4CYUA 4LFCF 2HLTA 1X5SA 2WBMA 1VRTA 1HHTP 2E9ZA 1TL1A 1UCNA 1XMQJ 2HAIA 3Q8UA 2KM8B 2JL9A 1LKZA 1PILA 3CCJS 2ABYA 1FF2A 2MMYA 5K8OA 5IT9Y 1JLEB 4ELTA 1MROB 2AZ3A 3UR0A 1DJ0A 4CT8A 4CWBA 1IKYB 2OELA 2RQ4A 3G82A 1NB2A 4M5IA 2J8AA 3OUYA 3NGKA 3M8ZA 2W9BA 4ID5B 2AJ1A 5HBMA 4IO1A 3H2LA 1FXDA 2HMIB 3DN9A 1KSPA 3THPA 2V69A 1WHYA 2CQ1A 1F2HA 1FESA 4RUCA 5KFDA 3KHHA 4NLRA 2CKWA 4AXJA 1KDNA 4USUA 3N6NA 3NGDA 4CM0A 2CZ9A 5FJ4A 4ZVRB 2N3OA 2K1RB 3VGUA 1W25A 4Y34A 2CWXA 3DM2A 3P5BP 5FDLB 1LFPA 4MYTA 3J7Z5 2MHEA 4C11A 2CPEA 5IQ6A 2CQBA 3MEGA 4JI3J 1RAIB 3WQPA 5CCMA 2DEIA 4MAKA 4FPRA 3FBEA 4OX6A 4LR7A 3M30B 3DMJA 3K58A 3CNQP 3IXQA 2I5JB 1FI4A 1HWIA 1XBWA 3PW4A 3T3FA 2HWIA 4DL4A 3W5ZA 1P6TA 2VQFF 2PFFB 5KFOA 4L74A 7AT1B 2IYGA 4M5DA 1TL4A 4P2FA 2GO9A 4N56A 1NJIT 3Q0AA 5IV3A 4NXNF 2DXFA 1KBRA 2KFYA 3LP0A 4JYAJ 4LF7F 3P8BB 3FEZA 1QE1B 4DU7A 4X62J 4YB6A 2VA2A 1S1TB 4DV5J 4WJBA 3MCMA 1BUXA 4CNYA 3MAAB 4DR1F 2AYEA 1QAXA 3HHLC 4RNOA 3MR3A 3NEKA 1ZAVA 1ZZFA 4DUTA 3TZXA 3V6JA 3A3PB 1UJ6A 5D0RA 1Y7PA 2HZVA 2GIFA 3JYTB 3N5FA 3MMCA 1JX4A 4FDFA 1NPPA 1BMQB 4DCOB 1S7HA 3KMSA 3W62A 3Q8SB 4B3SJ 4J9MA 2L9DA 3L95X 3H5SA 3KNAA 2UXDJ 4QU7A 1RWKB 2EK6A 1WHXA 2BQUA 5KFJA 5F8NA 2DYAA 2U1AA 2KXFA 2RF2B 5CZVA 2RNEA 2W1BA 4YUDA 4DFKA 3TAQA 2JC1A 4KH0B 1F9EB 5CHCB 4O4GA 1QTMA 1XNRJ 3JSMA 5I4MA 3G6YA 4M5LA 1NH8A 2YWKA 3NGUA 3W64A 1SPBP 1G1XA 3NS5A 2P6SA 4K4UA 3K5MA 4ZS6A 2DGOA 1S49A 4DSFA 1SIZA 3CMES 1OWXA 3RUBL 4URGA 2XO6A 3FMWA 2C2NA 2LMIA 4JB8B 3G96A 4ECYA 3MTKA 4WKRA 3CTRA 2OSRA 5ETQA 1T02A 2YNHA 1GFWB 2AMCB 4X4VA 1NEEA 2H1YA 3DOKB 3KG1A 2Y8YA 1MW7A 5HVFA 4KTQA 3ITHA 3QGIA 1FJGJ 2UV8A 3H20A 2VDIA 2MJUA 1NHUA 4LRBA 2LYVA 3OD2A 3CCVS 1VC6A 3UDEA 4B3TJ 5AE3A 4O0IA 3VCDA 1TKZA 2CFXA 1X9SA 2H9ZA 4ZP6A 1A9NB 1SVDA 1N5TA 2C2DA 3DLEA 2W24A 4YEAA 4J9UE 5F0UA 5CYMA 3PZPA 3AOAA 1LWFA 1HMVB 2NXUA 2ALZA 2PI4A 3L4BC 2YY3A 2CQ3A 2OKQA 2HK2A 4M8LA 2AJ4A 4JI0J 2CVIA 5KFYA 4HI2A 4QZVB 4A8KA 1VQPS 4ECSA 1AUDA 2J5AA 3K89A 3OR2A 4J9NA 1SV5B 4ENOA 1ZYQA 1KOOA 2LFVA 4CTAB 3OHAA 3FDSA 3GE9A 3S8SA 2XYHB 1RABB 1KQKA 2LQ8A 2Y9HA 4GKKF 3TEGA 2EI5A 2RILA 1C0TB 2V2KA 4U7UD 5AXNA 4DQPA 4NA1A 3GFZA 1X4DA 1HWJA 3OFHA 3WX8A 5F3ZA 2P9GA 5IC4B 3Q22A 3N6MA 2FHMA 2AD9A 2QGFB 4KV8B 2MHNA 2YKOA 2A1BA 1NU4A 1QVFR 3N4WA 4K5RA 4DR6F 4YY3J 2GA7A 3IS9A 2V5HG 5DQHA 3S1TA 4DPXA 1LK5A 1LFWA 3RYLA 2ZE2B 4J5OA 2LEPA 2Z30B 5KT5A 4K2XA 2JNJA 2DGVA 3FUYA 2BJ1A 2DY9A 3A3OB 1X9WA 5LMUF 2HQFA 3F44A 4RW9A 4USHA 5J2PB 2OEJA 2A2DA 2HWTA 4OYZA 1V3RA 4YR2A 4YHHJ 5DZ6A 3GQCA 2GHPA 4I56A 3R8YA 3UN5A 4X65F 5HK4A 4BC9A 3DXBA 2VC0A 5IWAF 4DUYJ 1FFSB 2K7KA 4TLQA 3UN2A 1HQUB 1FERA 3PJ9A 1VBYA 2ZEJA 3Q8QB 3RRHA 4MT1A 1GAOA 1T9XA 1SH0A 3NAHA 1S1XA 4OI1A 1R8PA 4DSLA 1K0TA 1RHMB 2Z2LA 3OFGA 5BYQA 3FSIA 2QTWA 4YFUA 1SKSA 1R8HA 3R7BB 4LRFA 3MD3A 4HL9A 1KVJA 2GHVC 4Y00A 1FD2A 1EJ7L 4HDGA 2H51B 3DHWC 1HI1A 1Q8BA 3ZZTA 3A8EA 1NK6A 1HBOB 4LBPA 2CPXA 2MKIA 1U7LA 4LF9F 4CP5A 2VJUA 2E5LF 5A8RA 4DPYA 4NLVA 4G1IA 1QVGR 4KHPF 3CF5Q 4UQTA 4RKUC 4WP3A 2OPRA 3MR6A 1F60B 2ZH8A 3MEDB 3NGTA 1HWKA 3CJ4A 4CQ1A 5BXIA 3MMJA 3AOCA 4B17A 1DTQB 1RT5B 1O0PA 4U9RA 2PMWA 1VQYA 3VAIA 4JI1J 1EB0A 1IM6A 2ALYB 5JJBA 4ILLA 1RT6B 3BSNA 3OVSA 4OZ0A 5DDPC 1JLQA 5C24A 1NPKA 4OFZA 5L46A 4DFJA 4C2MA 1NSQA 2LDYA 4KO0A 5J1EA 4P71A 2BRLA 1JMTA 2Q66A 2AJ2A 4URSA 1DQAA 4EO6A 1U1LA 1YQHA 4C8NA 2G0CA 4NX9A 5D4OA 4R8UA 2UZAA 1IJEB 2B9XA 2W2NP 4RO0A 4ZPCA 2VPYB 5AJ3F 1TVRB 3TYTA 1TFYA 1N5YB 3CCUS 2V8PA 3RAQA 3LALA 1ACMB 3QRRA 1Q8IA 5B0DA 4ED8A 1WKLA 5ETOA 1HBUB 3M8QA 3W8GA 5J2NB 5J2QB 1NUEA 1HNIA 4PG5A 1FDAA 1AFIA 1IVZA 3KLEB 3GLJA 3CCTA 4I4BA 2ZVIA 4RU2A 2KXHA 2HHHF 2OI2A 4DUZJ 3NBPA 4DR4F 4B9MA 3I5BA 3WBZA 3HVTA 4IRKA 2ZM6F 4C0HA 4CH7A 1KHVA 1RACB 5HROA 1DZ5A 3V4IB 4OLOA 1HBMA 2KHCA 1HBNA 3I4HX 5HQ8A 2HHVA 1LEOA 1T9VA 3CW2C 2QX0A 2QT7A 1TFWA 3AOBA 2IBOA 2NR0A 5ETSA 1XR5A 2BQRA 3KLIA 4DPTA 4G6VB 2F9DA 3TJAA 5ETVA 1O6XA 4ITSA 2RDJA 2N7YA 3MM7A 4IFYA 1FE0A 4F0HA 5BYRA 3M8PB 2A10A 4LF6F 1I51B 1FKAF 3QFHA 1FXRA 3ISZA 3A13A 5GMDA 1IBKF 1EKRA 4FBUA 1Q79A 2HFNA 3I0SA 2KTQA 2MGZA 1TP7A 2FB0A 5E0OA 2L9WA 4QYZK 1FJ7A 2X7IA 2PN6A 2A6OA 3MR5A 3V5RA 2R8IA 1TL5A 2OO4A 1RWUA 4C6AA 2OFHX 1YJ7A 2HNYB 2UU9F 2O67A 3BGRA 2KG0A 3T5LA 1NLKL 3IR5B 1RAOA 5M2UA 2B5JA 4ED3A 1E6YA 1F5AA 2L9NA 1FHTA 1MLAA 3PW5A 3CIMA 3SBMA 1FA0A 4NLTA 5KT4A 1LW2A 1IR1A 3BSAA 5KG3A 5BYSA 3VQTA 1FEEA 3M7VA 5EHHA 4G3IA 4B9NA 4LFAJ 5E3CA 1Y4ZB 1OO0B 2NPFA 5GVQA 1Q95G 1VQSA 3H2VE 1XWLA 1JLCA 3W65A 3FSYA 3GPAA 3G6VA 2F5GA 2EK1A 4DSJA 2RRAA 2VG7B 3JSBA 4X64J 4EBDA 4DOZA 2DKOB 5KFNA 3UFCX 1RT1B 1YIJS 2QLXA 3R3TA 2ZHBA 2YXLA 3KOAA 2HVHA 3H5UA 4B9SA 4NRTA 2CPZA 4NWBA 2JC0A 4TYBA 4ES1A 1Q82T 3C15A 3KTQA 4MIBA 3G6ES 3CC2S 3FFIA 4DL5A 2RU3A 2UVUA 2QA4G 2Z58B 3R9LA 3FJ2A 4DF8A 5KFSA 1MU2B 3HULA 1NH7A 3KLGA 2ADBA 4NOHA 4XDCA 5KFQA 2B8QA 3TOQA 2QMWA 5CH7B 3MMAA 3SQGA 2RQKA 4CO5A 4MKBA 2J6SA 4JV5F 3FQKA 4R25A 1S77D 2GMLA 4J90A 3VGSA 4GRSA 4ZP8A 4NL5A 1NK9A 2HRYA 1DFDA 1HI8A 3CCZA 2AEJA 2C42A 1QAYA 4P52A 1LW0A 1BLUA 3KUHA 2ZNYA 1RT4B 2UVVA 1RWMB 1UA0A 1BQNB 3DOMA 2CNOB 4DPWA 1XEZA 2GS8A 3OTOJ 3TJ8A 1NJYA 2V8DA 1N8RT 1VK8A 3F0NA 2CAJA 4DXLA 4USTA 5CD4H 4XO0A 4DL7A 2C2ZB 2DD8S 1Q4RA 4UW2A 2VBYA 4W92B 2XQCA 3ZZYA 1RQ0A 1SKUB 1ICEB 2I0XA 5T7LB 4FN5A 2MZJA 2W2PP 4KGXB 1H7WA 3PRBA 4A8YA 1WKKA 5EX3A 4ZIWA 4CNZA 3BKFA 5IT4A 2GQCA 1G3OA 4WF9Q 1T3OA 2XMUA 4GMKA 3W3SA 4B9LA 4MFBB 3PXGa 2FDNA 1V5VA 1NJWA 2JSXA 1HHSA 3M6VA 4M1KA 4CO3A 1Y0HA 1U4BA 3W1YC 1DRZA 4J9LA 2CQIA 3VV2B 2VONA 2UVWA 3GIKA 3BN4A 2I8EA 3CC4S 4OYXA 2ZVSA 2B8PA 1NK5A 4LF8J 1HYSB 4NYOA 1LWCA 3PTWA 2CQPA 3R97A 4DI6A 4OZLA 3GIIA 2DB1A 1A6LA 4LREA 4ETXA 1C0UA 3EWGA 2XTJP 1YJ9S 1W2BR 1U2CA 2UUWA 3VQSA 4OZJA 4GVBB 3FEXB 5LJ5Y 3UNYA 2XMAA 2HBYB 4AUKA 2FJVA 1OY8A 5AE2A 4NZ0A 2M5YA 2RJZA 4JBCA 4F4ZA 3TQ1A 1HMVA 5T14A 1N36J 4MKYA 2DR9A 4DX5A 1VBZA 1RP5A 3CD7A 1RTJB 4NASA 2BVZA 4QWBA 2BE7D 4NPOA 2MPUA 3ENVA 2FYXA 1XNQJ 3ISNC 2CPIA 1ZH5A 1IR2A 3UD3P 4ZDNA 4LFBJ 4NZ6A 3BZQA 5K14B 3CC7S 2VPZB 1OY9A 1JNRB 4WWSA 2D74B 2EXUA 1SUQA 1PBAA 2YWEA 4K7QA 4NCBA 3SSSA 4B3OB 1TAUA 1Y5LB 1R7IA 3DRSB 2W8KA 3A8KA 4P72A 3KDNA 7FD1A 3EGVA 2KYZA 1CQNA 5K9FA 4WIIA 4EEYA 1IWAA 4ZVUB 5JVGQ 1K47A 3IR7B 3RAMA 3I5AA 3BB5A 4NLOA 3MEKA 1NJXA 2CYYA 3G86A 2YPYA 4I2QB 2UUBF 3I31A 4ANEA 3MM6B 4NI2A 3LGMA 4HHHA 4ZJOA 3MAHA 3SQOP 3HSZA 2GHWA 2UUCF 2UUAJ 1NXIA 3CVKA 2D3UA 3EGNA 1SL0A 2GIRA 1FNOA 3PJXA 2OIHA 1JLBB 5LJ3Y 5J2PA 5GAGU 5LXRA 3Q83A 4PQAA 3QRPA 4DR2J 5F3TA 3B4MA 2ZJRQ 2L41A 4EI2A 9RUBA 2XMVA 1E6VA 2VG5A 3HHKA 4TY8A 2B6AB 1DHMA 1Q86T 2GO8A 2WB4A 5GAHU 2C2EA 1ULRA 3CDUA 1EP4B 4Y6IA 4UZCA 1HNZF 3M32B 2XSFA 1UFKA 3ZZPA 2R42A 2JZ5A 2BOPA 3TP2A 1YJTA 2HS0A 1TKXA 1LV5A 3E2EA 1RA7A 1U48A 4IYQA 3PR5B 4FVCA 2HQIA 3CCES 1VQ4S 1M5KC 1Z2ZA 3ET6A 1CJUB 4NLSA 3GSDA 3MMBB 4PPZA 4ES3A 1OSDA 1FK9B 3IO1A 5DG7A 2WSCC 2DNNA 3DCAA 1JJCB 1S6OA 1PO6A 4WFNQ 2HQDA 1Y9OA 4K4XA 1FWPA 4ED5A 2X1AA 1D3WA 1VQ5S 2RVJA 3ENWA 1KEKA 4RW8A 2W25A 5I3PA 1U6ZA 3MM5B 3HM9A 2JEIA 1GQEA 2R3VA 4LMZA 1HI0P 1Y5IB 3DRXA 4OYOA 4IFVB 3CCRS 3AD8C 1OJ4A 2J0XA 2F65A 4V1Ak 1VQLS 4X4UA 1R8BA 2GAHC 4WU2A 3C3LA 1O8BA 4F25A 2C3PA 5HVHA 5E33A 1G2EA 3M9OB 2E9RX 2QLFB 2OAUA 4J91A 4I6AA 3K2YA 4L76A 4QIWD 1RUSA 4Y2KA 5F41A 3W5XA 2DHGA 1ELOA 3IRXB 4WBFA 4ZVPB 1CJVA 2XG8A 2XM3A 1LWEA 2QMXA 2V2ZA 2YNIB 1G6BA 2KU7A 3RW6A 5BR8F 5E7OB 2IRYA 5LSOA 1TK0A 2ADCA 1SQGA 1TVRA 4K4SA 1KP6A 2YKNA 3T1HJ 1ZETA 2HBZB 3CDEA 1TV6A 5K20B 2FLOA 2MY7A 1W26A 3GV5B 2HFUA 3M8YA 1XC9A 2WONB 2FVQA 2CQCA 4F50A 3UPFA 4USVA 4HR2A 3VZIA 5J2QA 3WIUA 4CLSA 2LVWA 1SJFA 5D0HA 3AXKA 2EKYA 2GZOA 2MZRA 4JI5J 3HHNB 1UMJA 4DX6A 1UWBA 2HHTA 4QWDA 1IBLF 1AUSL 4KB7A 5E41A 5GADU 1YJRA 3D5MA 3HKWA 3U1LA 2CJQA 3BGUA 3DLKA 4UY85 2QMUB 2B9WA 5SUHA 4TU7A 3KK2B 1HNXF 3FQLA 3QO9A 1D0EA 4Z7YA 2OPSB 1R8CA 1TUWA 4OYPA 2CJXB 4J9SA 3QT7A 3A1YG 4OV6A 4NYZA 3DYAA 2YTCA 4Y2MA 2VBZA 5T41A 2D7SA 2VJVA 1NK0A 3MOZA 2F7VA 3N79A 4HVZA 4ZPVR 3TZYA 2WHOA 3Q8YA 2DCLA 1TK8A 3UCUP 2RS8A 4KBIA 3KUGA 2N4DA 3N6LA 3IG1A 4USIA 1GMWD 4K4ZA 2KN4A 1X4AA 3GJSB 4EZ9A 3G87A 3CJKA 2HQCA 2KRBA 2L08A 4CLZA 4ZK7M 2X1GA 5LXYA 3I9ZA 2ZJPQ 1S9GA 5DLFA 3OVBA 3AXMA 5IXUA 3LP2A 3PR4A 4OYBA 4LSNA 3SXLA 1QTNB 5E2QA 2OTLS 4CLFA 4DL3A 1AZSA 4LR9A 3W2WB 2FPHX 4C0OC 4L73A 1U0HA 2OPPB 4F3MA 3CCWA 3GIMA 1C1CA 4X4NA 2W8LA 3I5CA 2JEGA 3SYZA 2X3DA 3QPIA 1U1RA 3W66A 4PG6A 2IVMA 2OTJS 2APOA 4O0NA 1RU2A 2ZBPA 2KM8C 4LF5J 3W8PA 4DFMA 2QA2A 3L7OA 2FD2A 1NJZA 4DHVA 1SBRA 3PW2A 4ZN1A 1PJ7A 4ZVFA 1U49A 4O3NA 2ZZNA 4KKOB 3QBCA 3N01A 1NPRA 1S9FA 5D8HB 2HEKA 2G1DA 3PKMA 3HJFA 1SIWB 4QCLA 1U47A 1RU1A 3MFIA 3PCOB 3KLFA 4HHJA 2JVOA 2XCPA 2BXJA 1T11A 1IN0A 4O3PA 1RAEB 3GU0A 3TUPA 3SDEB 3KK3A 2MYFA 3HVWA 1TL3B 3F73A 5A8WB 2Y8WA 2VD3A 5D3GB 3ILOA 3BV8A 1BC6A 4WFZA 1HPZB 5F8LA 4QWEA 3VHQA 2WK4A 1DARA 5F8IA 3M2VB 1T0TV 2K7JA 3KJVB 3E01B 2IA0A 1FKPA 4DMZA 4A46A 2GGPA 2XY7A 1VQOS 4DV3J 3LP1A 4I69A 1HW8A 2FJAB 1X9MA 3RBDA 2EFNA 2VZ9A 3CEDA 4ATNA 4CYUB 1FDNA 1RLDA 1VRTB 3SCJE 1TL1B 2LU2A 4RBUA 3N28A 3JTOA 1RTIA 1UVMA 1WF0A 1HKAA 3GTYX 4EZ6A 4JI4F 2OEMA 5IQQA 3OLBA 3FC9A 2ACMA 4DR7F 1G7CB 2DXDA 1Y5NB 1B64A 3PEHA 2BE2A 1S5ZA 3G82B 3RR8A 3OUYB 2Y1RI 3PIPQ 4DSEA 2W9BB 1S9EA 3D0IE 5HBMB 4Z37A 2R7RA 3CDAA 3BPSP 3U02A 2JRSA 2IYIA 2HHUA 4M5JA 2UXCF 4NE9C 3UD4P 2E7VA 2QJ3A 4OI2A 3PG9A 4I6WA 2J9EA 2RH3A 2V4QA 3TQEA 2DK2A 2IRXA 3BR8A 3MPYA 2ACYA 3DM2B 4IRCA 3T9ZA 2DNGA 4C11B 1ZAXA 3ETMA 2KH9A 2BUNA 1RKIA 4FF3A 3MEGB 5KFZA 2W01A 4EO8A 1FWLA 3ZZZA 4WCEQ 3B54A 4P6QA 2YBVA 1WG4A 3MPVA 3HKZD 4LFCJ 4WTOB 4CH1A 3RRGA 3DMJB 1U1QA 4YR3A 3EDRB 1L3KA 3V6DA 4E98A 1OYEA 1T9YA 3TO8A 1KC8T 4HH1A 3HHEA 2W2MP 3EZOA 4RUBA 3WC2A 3MWBA 3Q23A 3K0JA 1BWEA 3B8HA 5MAOA 4OZ1A 3EE3A 5DRKA 4M5DB 3H4BA 1JLAA 1YBAA 3TAMA 4Q8EA 2V63A 3CDBA 4QQBA 3DU5A 4JV0A 2Q6BA 5CYQA 2YNGA 3MPDA 5M2PA 3G8QA 1Q16B 3PRDA 5KFMA 1RWWB 1IUJA 1VYAA 1B70B 3LP0B 2DT9A 3D6HB 1QUPA 8RUCA 4NLYA 1SL2A 2ZHOA 2VPWB 1FX2A 1UEUA 3ICLA 1H0HB 3O6QA 2HLUA 2GJIA 2XCAA 3EZ5A 3GIRA 3OJSA 4BCAA 4KGZB 4P74A 1OPZA 3R7SB 1Q7LB 2NXCA 1S99A 2FY8A 3TUIC 1L5UA 3OVAA 3DRYA 2Y0SD 3KMQA 3QMQA 3MMCB 5KAKA 4ZJQA 2YKAA 2W9CA 2UUTA 1NM2A 1AW0A 5IM0A 2HSEB 4A8MP 2FVPA 3MI7X 4NXMF 3LO3A 2O01C 4MIWA 1B0VA 3L7PA 3O3LA 2PO4A 4NLWA 2DHSA 1Q5VA 1PC4A 2VQFJ 1CQMA 3U7JA 5L1KA 4QR0A 1H38A 3EICA 2ILYA 4LIWA 3VAMA 2ZD1A 3CJ5A 1U45A 4O4GB 2LQ9A 3FCHA 2H3EB 1EARA 5E3QA 3JSMB 2YWGA 4Y65A 2MQ8A 3GYGA 1YSJA 4NXNJ 2LQ5A 3M6UA 4LF7J 4FXDA 5IZHA 3S6EA 3RBZA 4N41A 3MECA 1Y10A 1LQ9A 2MTLA 4IUFA 4IH5A 1AXQA 3SEOA 2E7XA 4FS2A 2OLWA 3QQCD 2MZ1A 2EFQA 3FGVA 3NRBA 4DR1J 1DAXA 5LSRA 2YNHB 2DVIA 2MQOA 2GVDA 2BW7A 1IKWA 2HQ3A 4F3OA 3ITHB 3MGJA 1NK4A 3QJJA 5D4LA 4DL6A 1X0PA 1X4CA 3UDLA 1H98A 4WFBQ 1VJWA 1HNWF 1TKZB 4GO7X 3DRPA 3M2UA 1UVLA 4UOHA 3JAMU 4A4JA 2M8DB 3DLEB 2H54B 2RUGA 3W9JA 4EBCA 2F3JA 5CYMB 2BJ8A 1LWFB 1IWGA 1XN9A 3D3CJ 2MSTA 3K17A 1HWLA 4DSKA 1WF1A 3HP6A 3BF4A 4ED1A 1T9TA 3OR2B 2E5JA 4DS5A 1H74A 5L8RC 3VAHA 1M5PC 1XQIA 1N32F 5BJRA 2FJWA 1B7FA 1J2VA 3W63A 1L3VA 4I7FA 2JHEA 1LXNA 3JSRA 5ETMA 2HYIB 1RWOB 4EUVA 3VAGA 4USWA 2UVRA 4LQ3A 1S7IA 1FD8A 2HNDA 2ERRA 5JUMA 4URQU 2BANA 1CLFA 1YITS 1RCXB 4P7VA 3IS9B 3CJ8A 2Z2YB 2IDLA 4MK8A 1O51A 5KG0A 3LWLA 1APSA 4PPDA 5B0FA 1YJUA 2Z56B 4CZCA 3KWMA 4LSLA 2OGUA 1VHIA 7FDRA 2FGOA 2B4VA 3NGRA 3MUVP 2B4OA 4RW9B 1S6QA 5DGAA 2ZWPA 2XS7A 2XULA 5G4DA 3P5TL 3ZNJ1 2DNLA 1VGYA 1SB6A 2V34A 2R8KA 2X3GA 3AY0A 1RADB 4ZLLA 5DDRC 1NO8A 3HFVA 4XK8C 3UDCA 2UXBF 4K4YA 4H4KC 2R7SA 2KZMA 1YGYA 3LA0A 4K8RA 4RPFA 4GKKJ 4O44A 4YP3A 1NKBA 1FRJA 4PKDB 1K8AT 1S1XB 1TELA 4TLRA 1RWXB 4M5GA 2KDOA 5E3AA 2LEBA 3VVTA 3NWRA 4ZLNA 4O3SA 2XS2A 4TU9A 1RTHA 1RZMA 4DR6J 1WKJA 3G4SS 4KYZA 1KQFB 1WORA 1YK9A 3CJ2A 3MM9A 2CA9A 2DNRA 3MF5A 1CC8A 2HHQA 1UAWA 5KFHA 3NOGA 3ILJA 3MUTP 3BH6B 5A8RB 1B4SA 1R31A 3PYEA 2VQEF 3QZ7A 4FXVA 3BYRA 1B0TA 1O5JA 5LMUJ 2CPFA 1URNA 4NA2A 2XSJA 1RAFB 2E29A 1MN9A 3D28A 2XYPB 2ZFHA 2OPRB 2CPDA 2KZZA 3D7SB 4X65J 4BBYA 2G13A 2IM0A 2L3MA 3D54A 4J9OA 3CMQA 5IWAJ 1SC3B 2DR6A 2K3KA 4GKJF 2HNZA 5C7PA 1WTBA 2NCKL 4M5NA 1KTQA 1T05A 3MPUB 3MR7A 2DGQA 3T1AA 1S97A 3NMAA 4JI6F 3RB0A 4WU3A 3LTOA 1JLQB 5C24B 4OJ3A 2WVBA 4UTGA 4KO0B 5J1EB 3M2RA 4KGVB 3IAS9 2NSCA 3AB4B 3K8WA 2FJDB 4R8UB 3ZZUA 3ZC4A 1TL7A 1J5OA 4AD6A 3IWXA 4GVLA 4USJC 1UW4A 2ZWOA 2DEJA 2DPIA 4H4KA 1GH8A 4OHYA 4YMEA 4LF9J 2CQDA 3CE8A 1YRTA 2O66A 4QPXA 3MM8B 1VFJA 2FVRA 4WYWA 2E5LJ 3M8QB 1R0CB 1I3OB 2FC9A 1ZTTA 1HNIB 3K5NA 2NS1B 4KHPJ 2YWFA 2FIUA 4Y3CA 1NZ8A 3UE2A 2LDIA 1WI8A 4Y2IA 3NBPB 2AX1A 2QEXS 3QIDA 2PEHA 4TKTA 3HVTB 1YRUA 5HJXA 2C28A 1BWVA 3RAXA 3EGWB 3EXYA 1NDPA 2VBXA 2MQQA 5HROB 3FCWA 3GJTB 4OZ2A 3JAMY 1HBMB 2EW9A 5A76A 4DN0A 5ITHA 4OYAA 1ZTWA 2QV6A 1HBNB 3D1QA 1KWMA 3K57A 4TQRA 3GR0A 1WDDA 1SKRA 5ETRA 2XZDB 1PCAA 2LA4A 3QAUA 3ETOA 2BZ2A 3IC1A 3HDSA 2KYXA 4HLBA 2QL7B 4DV7F 3ILLA 2QIFA 3KLIB 1TUGB 5AT1B 2MJNA 5AJ3J 1NDLA 2CNNB 1L3UA 5B0AA 4DQQA 2R2SA 2DRBA 3CJ3A 4ED0A 1JLFA 4PWUA 4Z7CA 1XMOF 1LNQA 3MM7B 3PO4A 1HLWA 4IFYB 4OV1A 2J9CA 4YR0A 5KFTA 1RA6A 1WI6A 1SL1A 3I0SB 2HHHJ 2MGZB 4DR4J 2MKSA 1WC4A 4U7CA 4C8YA 1Q1KA 1XK8A 2COLA 1GK8A 4YOEA 5AXLA 2BRKA 3OSPA 5HATA 4PCQA 2R7VA 2ZM6J 3QJLA 1OMSA 2MKKA 5E5NA 3CO0P 1S1UA 3BGRB 2FZCB 5H9EK 4Y0FA 1SQFA 2PD1A 2B5JB 4F2SA 1E6YB 1P9QC 1X4FA 2IAJA 2D9OA 4NMXA 1LW2B 1OIAA 5ETNA 2LXUA 3HZGA 2V8GA 5I42A 2B9YA 3TUJC 3RB3A 3K5OA 3IGVA 2U2FA 3IBWA 2DHHA 5F9LA 3H59A 5DO2A 1IQTA 4RUHA 1JLCB 1OQ6A 1REVA 3FEYB 1T8EA 1X8DA 1SJ3P 2IPOB 1RWNB 2W2QP 2VPXB 5KFUA 3NG8A 1F0XA 2XC9A 1XIQA 4LRCA 4LF6J 2PEBA 3UNGC 1PYOB 3BEGB 3OPKA 5B09A 1IBKJ 4BWMA 5KFIA 1FEHA 2HFSA 4NRUA 2M8HA 1RHUB 3C15B 3C6UA 5FLXU 1JNZB 3CT9A 1TMJA 3FFIB 1T9WA 2OPQA 5D0EA 2BKNA 2B56A 2G2OA 3OW2R 2NYIA 3NKYA 2D9PA 3OTCA 3QZ8A 2UU9J 5KOXA 3KLGB 3QGPA 2VL1A 4NLGA 2B7BB 3C66A 4RUAA 1GTHA 3MMAB 3VVUA 3SQGB 1OPIA 2XO7A 2KVQE 2IIHA 2Z2ZA 2XWYA 1P27B 5B0BA 3POTA 4EU0A 3KNGA 3T9NA 2BYCA 3HVAA 4P2XA 1H3DA 2HHWA 2BBEA 3I82A 1V6HA 3K8VA 3DRRA 8ATCB 5KFAA 3UD5A 1LW0B 1QAJA 1BQMA 4ZN3A 2KB2A 3GFHA 1YJWS 2PMHA 3DOMB 4B3RF 2ASYA 2IRUA 4WFXA 3KLHA 2E1MC 2J7WA 2ZKTA 3JQJA 1HQEA 4F3QA 3PKYA 3ILIA 3CCSS 4E2FB 1JQGA 4AQYF 1FFWB 3KFWX 1FWKA 2J0QD 3G6XA 4YB1P 3ADAC 1HNVA 3B78A 3TX8A 1DBDA 2CQ0A 3CULA 1RT2A 5A0YA 3QWPA 1U8SA 4ZCLA 1TZ0A 1YG0A 1BHNA 5U47A 2E5IA 1KLNA 3P49B 1EHWA 5RUBA 3J80U 2VHGA 4WXWA 2F40A 3A8IA 4KC5A 2QFJA 4JV5J 1S6PA 1R89A 2VFSA 3P45B 1ZA2B 1OQ3A 1OY6A 1Q8LA 2QLWA 4OHXA 2MZTA 1I1GA 1TUVA 2ZHAA 3DFEA 2HFZA 3THVA 3R5DA 3DNCA 2DRAA 4AT1B 1LWCB 2ZJQQ 2ZOFA 3QRQA 1PC5A 3Q86A 5L9XA 4DQSA 2OUGA 2NSBA 1PYSB 5GAEI 2F8HA 5DG9A 1PJ5A 2EPIA 1F3VA 1C0UB 3DOLA 3RB6A 4CLLA 1RAJA 4JI2F 2DR8A 2G9OA 5D77A 3FSXA 4JV2A 2C22A 2FVSA 3OBIA 1FCAA 4N8NA 2IFXA 5F8MA 4A8QA 1WHVA 3DDNA 3FZ2A 4K4WA 3VALA 1Q81T 3CDWA 3BKUA 4Y2AA 3HHLA 3HHLD 1X5PA 1AROP 1JXEA 5JMNA 3PW7A 5SZTA 1HR0F 2V8VA 4UOGA 2DIUA 3T6JA 1P9YA 3CJTA 3ZZ0A 2WOMA 4IG3A 3BJYA 1SUQB 2NZ4A 2CUYA 4DV0F 1VQ7S 2A0FB 4OI6A 4W4MA 3VAJA 3OL7A 2AGQA 2GCFA 3NXZA 3SSRA 3AA8A 2O3DA 2Y1JA 4RW6A 3PV8A 1Q78A 2MQNA 4B9TA 5LMNF 4DV1F 3PX6A 5DLGA 4C8LA 3OTBA 4MKAA 4CO1A 2V2VA 3CXCR 2D1CA 5HMZA 3LANA 4HT7A 3NS6A 1IKVA 3D0HE 5L1JA 2IBKA 1B99A 3LAKA 4NI2B 3C16A 3SCKE 2VFTA 3J7YU 3V6KA 4U8YA 2QA4S 3NGSA 2BE9B 1IKXA 3GCXP 3DLGA 5K8MA 2ATLA 1SJ1A 3NCPA 3JS9A 2HGLA 5B0GA 1JKHA 1U1KA 2P5VA 1FTRA 2XHCA 2J76E 2VB6A 1V3ZA 5DJBA 4UOCA 2B51A 4Q44A 2V0NA 5DDOC 1OYDA 1OSCA 1WJ9A 4KPYA 2CVEA 3QAEA 3R6LB 1N5QA 2K3IA 1ZPVA 4RNMA 3B4DA 4X4RA 3MOJB 1E6VB 3H98A 2VG5B 4J9KA 4TY8B 2RHSB 2C2RA 2CJKA 4TYAA 4WPAA 2FC8A 4X4SA 1JJHA 3MR2A 1X4GA 2DH7A 2XLIA 3UCZP 3W9IA 4NEZA 1TQLA 2DJWA 2AV5A 5FLXY 2WSFC 3BO4A 4AL6A 1A7GE 2P6TA 2E1RA 3GG0A 1YVFA 3TVKA 2ZH3A 3WX4A 3OXGA 3M05A 1TKXB 3NAIA 3VGVA 4ED7A 3NWGA 2EKNA 2Q79A 4OX9F 2UUBJ 3ET6B 4DLEA 4AFFA 1GXLA 4PG4A 1IBMF 1YWXA 5D78A 4NCGA 3H42A 2DGXA 1UWAA 2IC3A 2CG8A 4FS1A 2UUCJ 4PABA 2D3O1 3D2WA 5KFKA 3M6XA 5A6WA 2QFIA 2G0IA 2DNKA 3QFWA 4RW8B 3TWZA 1Z2LA 5ETTA 3GJRB 4F4AA 1VMBA 4UT4A 4GC6A 5D6GA 5IT0A 1S4EA 4EMDA 3V6HA 2JVRA 3UDVA 1BXNA 1NSPA 2MB0B 5H9FJ 5EWEA 2L48A 3I87A 2YNFA 2ZDPA 3PNIA 1CEZA 2QRRA 2BV3A 4K59A 4AE5A 3ZTOA 3GR1A 4FF1A 1UL3A 4DR3F 1HNZJ 1YJVA 4P2MA 2UP1A 2VIHA 1HQ2A 3SCIE 3MEEA 4DV4F 2HS3A 1F1BB 1CJVB 2BABA 3EVOA 3HFZB 2ATCB 4CLKA 2DR5A 3J80Y 2HHXA 3IGNA 2DHXA 4WK1A 3CJSA 1LWEB 1EETA 5IT9U 1UTAA 3SZ2A 4DQRA 1NKEA 3EPGA 4UUXA 3LW5C 2DBBA 2GAGC 2NXNA 2WAQD 4I6YA 2EEYA 2YKNB 3T5HA 1FRMA 1H2TZ 1TV6B 3ZXWA 3HJVA 3MM8A 4F4YA 2BMBA 1JXLA 4DSIA 4WZMA 3QIPA 4DG1A 4IG0A 1YLXA 1UWBB 3CMAS 5F0WA 4ZITA 3CCQS 2YX7A 2RMLA 3DLKB 3O1LA 5C25A 1S59A 3CPWR 1N52B 3D4JA 3FMBA 1WHWA 1WACA 4PG7A 4R0JA 1CJTA 5D0GA 1UVIA 5E3PA 3DLBA 3QO9B 1EQMA 3DHXA 1K1SA 3VZHA 1U2FA 3QJPA 4LVNP 6AT1B 2CQ2A 2Y0BB 4ZIVA 3DYAB 4ZPWR 3RU0A 2CZ4A 3X3UA 3TA2A 3T5JA 4DBQA 4JI7F 1S1WA 3VWSA 1N56A 1VQ8S 1QSLA 3OQ2A 2IM1A 3GILA 4H4MA 4Z2XA 2HW3A 1BY9A 2XMJA 1KOHA 2MLZA 3ZFVA 4FYDA 3BQ2A 4PWWA 4DS4A 5BR8J 2BKPA 2CADA 1SJQA 5J1NA 3CJRA 3IG1B 4ZLJA 2BJ9A 3V81A 2ASJA 4EYHB 4U96A 5EWFA 2MZSA 1JXVA 5HP1A 3CJKB 3UVJA 3MHYA 3ZZOA 3ZNUA 1IQZA 1N48A 2H5EA 4HYKA 2GQQA 1S9GB 1GT8A 2VC1A 1IBLJ 4K0KF 1RE1B 2ZNZA 3LP2B 2CIMA 1VC0A 1EIYB 4HACA 4LSNB 4ETZA 2W4DA 2B0GA 1NRKA 3VF0B 1VR6A 3HVRA 2AWZA 2LKZA 2HVDA 1AZSB 4NLDA 5DGBA 1HNXJ 1U0HB 4OJ1A 4YB7A 1T03A 1RT7A 1TK5A 2FLPA 1C1CB 1FX4A 2EFGA 2VKZG 3OSNA 4ECRA 1KTVA 3ZTSA 2FTRA 4N5SA 4DDFA 4F67A 2LXFA 3H8YA 3QGGA 1UJ4A 2H4YB 3HCXA 4X2BA 4BWJA 2Q3PA 3LGHA 3NL0A 4OZ3A 4CIOA 1VQMS 3W60A 1EQ0A 1WC1A 2DNPA 4LRDA 1RLCL 2F9JA 3EZUA 2W9AA 2BM0A 1V3SA 2MKJA 1FDDA 2IMWP 3G8TA 2EBGA 5A8KA 1S48A 3GONA 1UJ5A 1PKUA 3KLFB 2V9WA 1S0OA 4PUOA 2V4JA 1UKUA 2AF6A 1DTTA 4L72B 5KFBA 5KFWA 2PFDA 4ECWA 3KK3B 1SC6A 4OHVA 3AH6A 3EUNA 1GMUA 2VUGA 5JXSA 1X7VA 4HTIA 2HZAA 1WSRA 4ECTA 1BD6A 2RIJA 4DFPA 2FHJA 2FHJD 2RS2A 3KDOA 1FKPB 4R5PA 2GGPB 2YKMA 3N9UC 2DITA 2KRRA 1ZBTA 4ILMA 3LP1B 4NLPA 1YBTA 4USKA 1GMVA 3RB4A 1SI9A 4LUBA 4M5HA 3PYGA 4CLYA 4I67A 3RR7A 2AYBA 1SQEA 1LOUA 1FRLA 4K4TA 3D6TB 4F4KA 1AFJA 2PSZA 3FBBA 3FKBA 5A6PA 4CLWA 3I6PA 4Q0BA 1RTIB 1T3NA 4WE1B 1B3TA 3ENAA 1RBAA 1FVSA 4ZPBA 1XR6A 5K8NA 3R5GA 4D3GA 4XPEA 1SC4B 4B9VA 3BDEA 3C6TA 5DQIA 4FKXA 2BE2B 2W7PA 2YX1A 3DI6A 1H72C 3NNAA 1S9EB 3C46A 2N82B 2OJ3A 4PQUA 2I9SA 1UEKA 3FNNA 3IN5A 3K5PA 2RAQA 3IM8A 3MCSA 1TKTA 1C1BA 4YB5A 2O5DA 1RAHB 3WIVA 2GJ2A 4F36A 2MKHA 4DR5F 1NDCA 4ECZA 4OYIA 3SV3A 1WG5A 3T1YF 1FE4A 3QATA 1M5HA 4CLUA 3NY0A 1RYRA 3BGFA 3C14A 4EK2A 1N6QA 4DCPB 4H4OA 3CJ0A 2ZH5A 2R7UA 3VTIA 4X66F 4ED4A 3FRYA 3OJUA 2BOAA 1X4HA 3KJQB 6FDRA 4ER8A 2R8GA 3TRGA 1UZDA 1KVKA 1D9AA 3V6DB 4OHWA 2W2OP 1NNDA 2G4BA 1EX8A 3OTDA 2Q1LA 1YI2S 1Y3KA 2PT0A 4JI4J 3HLUA 1PIEA 4OYWA 2VFRA 2C3YA 4QPTA 3M1VA 4Q7AA 4DR7J 3BQ1A 1UVNA 1JLAB 2OP5A 3TAMB 3DGPA 4K2JA 1TAQA 1N33F 4KQZA 2WVFA 5CYQB 2YNGB 4MIAA 4AXIA 4C3LA 4YDXA 3X1LB 3W2VA 2ZH2A 2JOQA 3T6BA 2DNOA 2UXCJ 3EYZA 3AAWB 3V2UC 3EMTA 4OJGA 4C48A 2P9EA 1YDLA 4TVAB 2C3UA 2QSFA 5J2MA 4F04B 2F8MA 2FHOB 2E9TA 1KNZA 1QD1A 2AW0A 3EM1A 2JLFA 3H2UB 1UETA 4O3OA 4M5KA 5KG5A 2XWXA 3ZTPA 4XPCA 1RTDA 2F4VF 5CXTA 4ECUA 1CULA 4DX8H 1D9DA 4C3MA 5F9NA 1IR0A 4ZCMA 4ELVA 3KHLA 1HA1A 2FJEB 3UR3C 4WXOA 2YWWA 2HG4A 4OLPA 2FVCA 2W9CB 3TEHB 2DGWA 5IM0B 3OXFA 1RGVA 1CS4A 5KFFA 4TN2A 1BGXT 3BKTA 3PFOA 3F41A 2QG9B 2JWNA 2XBPA 3OL9A 2ASDA 4U7UK 2C1EB 2DH9A 2M9KA 1M0SA 2ZD1B 4ZVQB 4NCAA 2DH8A 1PBUA 3B6BA 1UEVA 1FT8A 1UFWA 3NP5A 3SFUA 4FF4A 1KQGB 2BJDA 2E44A 5KG7A 2WTFA 4IQMA 1EZZB 4DJBA 2VKRA 3F56A 3JTPA 2PA8D 2RDDA 3QSYB 1JWWA 2F1FA 4KGMA 2CJAA 1VQNS 3MECB 4IH7A 5CCLA 3BYPA 3TAPA 1FJEB 2DO4A 3AFGA 3JTNA 3ZZRA 4A47A 2GNKA 2NUHA 4RNHA 5L9NA 2X1BA 2RT3A 1R43A 3LF0A 5HMWA 2NQPA 5LOQA 3ELHA 2GVDB 3KJFB 3LH2S 1GEHA 3QYYA 1IKWB 1RSCA 3BBBA 2DXEA 4I68A 3LUYA 3CCLS 3QLHA 3UQSA 4C0BA 2LP4A 4DV6J 3OT9A 3HT3A 2VICA 2KHDA 3KXDA 4CH0S 2E7WA 4NXMJ 3DRPB 4B02A 3M2UB 3ISND 4ICLA 4RW4A 2MSSA 4OZ5A 3NS7B 3H5YA 2QYGA 3QT8A 2IJNA 2FGCA 3ULHA 2VFUA 2M3DA 4Q43A 1K73T 3MXHP 1EKSA 4PXBA 4JI8F 3TW0A 3WDOA 1RT3A 1CJKA 3NMRA 1U0SA 2DGSA 2IDEA 3I9V9 4RWXA 1JK9B 3J7ZT 2QE5A 5KOWA 4JP8A 3MCOA 4RNNA 3R27A 5KT6A 3IBCB 2V50A 2RRBA 4I7FB 2CQ4A 3IFEA 2JH3A 4HTJA 2VODA 4CM2A 4F02A 5C42A 4A8SA 4IQXA 1YKWA 1XR7A 2HNDB 1WOSA 3TA0A 3AT1B 2G1HA 1DY3A 3D1OA 4RR5A 2BANB 2J7UA 2GMJA 4ELUA 3T19A 1KR4A 5C5JA 1UA1A 1WF2A 4PG8A 2R7OA 5IS2A 4CRJA 1MMDA 2MEWA 2W4CA 5F8JA 4K4VA 4G1QA 3GZ7A 1TMMA 1HNWJ 4EGLA 3EGZA 1CG2A 4LSLB 4LJMA 3NLCA 1S79A 4CDIA 3GIJA 4A48A 3LAMA 4LRAA 2BJ7A 1RBOB 1S6QB 4KFBA 5KFVA 3UO0A 4PWDB 3VAFA 4NA3A 3SSQA 5AXMA 2Q43A 1QUVA 1HL6A 3BSOA 2R4FA 2WVDA 3J7AN 2Y3YA 2MDAA 4I2PA 4WKYA 2EG1A 4QJVA 4N77A 1NB7A 1M1GA 3Q2SC 1N32J 3OFEA 2MQPA 3U1NA 3AB2B 4ZPDA 2GVZA 4O44B 2ZOMA 1ZA1B 3A8JA 1G4CA 2E1AA 1FTCA 2LU1A 3A4TA 4ZVHA 5I3UA 2GQ2A 3R5AA 1DLOA 3SFGA 1RK8A 3DKDA 3KK1A 1V5IB 2Y1LB 3HD2A 4BHQA 1RTHB 2YWHA 2HVEA 1VOMA 1RCOB 4LF4F 4DV2F 1VS3A 2QO3A 4OI3A 2A18A 4KJIA 4X84A 4ID8A 2VA3A 1R6VA 1M5SA 4B9UA 4TY9A 2RSQA 2OH2A 2VASA 5DS7A 3MM9B 4RLEA 3PEJA 1MG7A 1N5SA 5GMEA 4X4PA 3Q89A 1MMNA 1U8WA 2D3ZA 2A2CA 4PYAA 3BO2A 4WIQA 2XSJB 4M63A 2VH7A 3OR1A 1M1HA 4B3MF 5EUHA 3Q24A 2KVIA 1S0MA 3VGTA 2M7SA 3EVMA 5JVHQ 1PAEX 1TKDA 3IM9A 2K8GA 3OFFA 2Z0GA 2R2UA 1YHQS 2HNZB 4IDKA 2C2OB 2DISA 1U26A 1J5EF 4F8RA 1U25A 3CWJA 2UXBJ 1T05B 4DF4A 3LGNA 4QYZJ 3I0RA 3DDKA 4CLTA 1R6YA 1RHKB 3MUMP 2MXYA 5GAGI 2XMWA 2J6UA 3EVWA 4U8VA 3ENQA 4XIUA 1R0BG 1N4LA 4WP9A 3M2RB 2J0SD 2E66A 4YS2A 2KI2A 5KFPA 4PXCA 1I94F 4MJKA 4YN3B 4F7VA 1TL7B 1U1NA 3TVZA 1J5OB 5GAHI 4Y2CA 4FKYA 1VBKA 5IV4A 5M2RA 4CO4A 4F4WA 3TANA 3PHEA 1N34F 1J27A 2PMZD 4HEA9 2XY6A 4DL2A 2BX6A 4PRFA 3EX7B 2VQEJ 4LR8A 4FVMA 3D67A 3O8WA 1VK3A 5MLCV 3NCQA 3I96A 3MD1A 4HKQA 1KVIA 2BJ3A 3JQMA 2KT2A 3UCGA 1UVJA 4GKJJ 3D1HA 1XMQF 4W90B 2EC2A 3HZEA 3CD0A 2XLJA 4ZOSA 2M52A 2R9LA 4PXDA 2Y1IA 1QSYA 2AJFE 3BH7B 4JI6J 2YX4A 3R2CJ 4MK9A 3UW1A 4QOTA 3DC2A 3CGIA 2FLLA 3H25A 4ZVSB 1P1TA 1URRA 3ZTRA 3EPIA 4DL0C 1P1LA 4KGKA 2E1CA 1T95A 3MAQA 4NLQA 2C3MA 2VG6A 4OI4A 4B08A 3DXSX 2HBRB 2V94A 4AL7A 1OS5A 3HSJA 4PYDA 1XMBA 2NREA 2AKWB 3AD7C 1PAUB 1SH2A 2OMLA 4OX8A 1JLGA 5HLFA 1JLFB 1N54B 3BREA 5DM7Q 1WDTA 4G65A 4RW7A 3BBCA 2HPUA 1R0AA 1Q0NA 2J7KA 2HIQA 5CABA 1HIYA 5KFLA 1S1VA 4OJHA 2MQLA 4J9QA 1KQSR 4KHRA 4EBEA 2EFVA 2M2BA 1C4CA 1FKOA 2DHAA 4JI3F 4WE1A 1QDUB 3L3CA 1VRUA 1NCLA 1CVJA 5IC6B 2ZC3A 1M5VC 2HKEA 4ZHRA 5L1IA 5KG4A 4FP9A 3S01A 4DZDA 2W7OA 1Q5YA 3PIOQ 5AXKA 5HANA 1GX5A 4GC7A 1S1UB 2R7TA 3GMGA 2QLBB 5LL6d 1JLEA 5KT2A 1MROA 2IAJB 3VAKA 1GX6A 4KH1B 3IWNC 1IKYA 5GADI 1RAGB 5I42B 4ZP7A 3K7RA 4C8MA 4ECVA 4F4XA 1ZS6A 2WCXA 1QAIA 1SH3A 3T5KA 4ID5A 1NSKL 3T41A 3GYNA 1RBLA 2HMIA 4MH8A 4EYIB 1I5OB 5J1PA 4DV7J 1REVB 4JYAF 1A0OB 1KLMB 4OX7A 2VF3A 4X62F 1XMOJ 4DV5F 2MLYA 4FNHA 4F2RA 4J9RA 2K1RA 2JJ4D 1TR0A 2BW2A 5DM6Q 1TTHB 4C3KA 5FDLA 3SIPB 4Q2LA 1XERA 2YQ0A 3C6UB 4PR6A 5HJYA 4QWCA 2OPQB 1U02A 2AYMA 3ONQA 4B3SF 3M30A 2UXDF 3KKFA 2I5JA 5K5MA 4RX6A 5AE1A 4XTTA 1U24A 3BGOP 1WC0A 3POTB 3BN7A 2J8SA 4NLXA 4ZVGA 3R5CA 3DRRB 1IXKA 2A3JA 1MSWD 1BQMB 3P96A 1XNRF 1S0VA 2KXNB 2ZBQA 2XZTB 4C8OA 3RW7A 3M8SA 2EC0A 3SMZA 2Z4PA 5ADZA 2WW8A 3KLHB 1HD1A 4IH6A 2FLNA 4FYWB 4H54A 2HFVA 2IMOA 2D69A 1HQEB 4WTYA 1QE1A 5HSPA 3E3XA 2K2PA 5F8GA 5L1LA 1AT1B 2AHOB 4USMA 1S1TA 4QIGA 1QJHA 4OL8A 5KTQA 3BDPA 2AJ0A 1JJ4A 2RQMA 3MAAA 2ZZMA 1HNVB 2V9KA 5EWGA 3J81j 4Q8FA 2G2ZA 3THTA 2IM2A 1PYTA 4F0KA 2HGNA 3H0PA 2RDIA 3IAM9 2GIQA 1RT2B 5A0YB 5G0RB 2DO0A 4LBIA 1FJGF 3GCWP 4KRWA 3JYTA 2HRUA 2IA6A 3I55S 4IRDA 4B3TF 4P75A 2CNKB 1RISA 2AGPA 1KRPA 4F26A 2RF2A 1H73A 1PSDA 5DQGA 4HDHA 5HMXA 3EXCX 1KHWA 4ALZA 1S6PB 3BM7A 4ZJLA 3TX0A 2JLEA 2RU9A 1QY7A 4JI0F 4V19J 3D3BJ 4ZP9A 2FQQB 1T9UA 4ECQA 4C4WA 4B3RJ 5L39A 3J81U 1X5OA 4LT6A 2BACA 1CC7A 2BQ3A 4IOCQ 4DPOA 1KD1T 2JDJA 2JX2A 2QYCA 3RBXA 1Q8KA 4FNIA 3DOLB 4AQYJ 2E5HA 4RNFA 2GX8A 3B82A 1WWHA 1VISA 4KSEB 2IY5B 4MTPA 4X4QA 1FRKA 3GFXA 3DOKA 2I6WA 4YDDB 3A3NB 2IVFB 1WG1A 2KJWA 2CJ9A 2Z8QA 1YBUA 4YY3F 1VBXA 2G2YA 4L3NA 1SCJB 1QM9A 4A8WA 4QIEA 3TVYA 3HHLB 1HHQA 1BQXA 3OTEA 3HPOA 4OHZA 2YH0A 3UWTA 3CCMS 2HWHA 3O44A 1VHFA 4Q2MA 2CXEA 1H2VZ 2P2CB 2D3OR 3JQKA 3N5BA 1ZM4A 4DLGA 3GYXB 3HI9A 2DTJA 2NXEA 2WOMB 4IG3B 4QWAA 3IBFB 3PJWA 2LQJA 2B3TB 2V4RA 4LF2A 4YHHF 5ETKA 2C3OA 2FJBB 3HO1A 4QR1A 2XB2D 4EFAC 3JXOA 4RW6B 2FZGB 4OMFG 1LXJA 1X0FA 1SV5A 4DUYF 3L7UA 4LIRA 1PJ6A 2KJVA 4CTAA 4DPUA 3IR6B 4RJVA 2VU5A 1UPPA 1YZ6A 2ZH6A 1DQ8A 1IKVB 3PYFA 5LT5A 4ED6A 1KFSA 3PVXA 2AZ1A 2B7CB 1C0TA 4JI2J 3C16B 2J0WA 2I1RA 4P2SA 5EDWA 1IKXB 1QSSA 1WC3A 3DLGB 1RAAB 4KV8A 2YKQA 2DY1A 1JKHB 3FBCA 2UV8G 3TZWA 2DIVA 3AJ1A 3W5YA 4PWDA 2CDQA 1UP1A 1HR0J 1MWZA 2ZE2A 2QN6B 5CAAA 2H5IB 2ILZA 2IHR1 1RHJB 2HGMA 2AGOA 2PC6A 4C97A 3AHPA 1WEYA 3GJQB 1IJFB 4DV0J 4J9PA 4UF4A 1MWQA 1NK7A 4S0MA 2VV5A 2WW4A 1NSAA 2GW8A 4EWTA 2DGTA 3Q8VA 3G8SA 2I2YA 4Q45A 3CIZA 3H40A 1UVKA 1RHQB 2JEJA 4PXEA 3L09A 5LMNJ 2JEFA 4DV1J 1PGZA 5HN0A 9ATCB 2I38A 1HQUA 2VOPA 4NZ7A 4JI1F 3HMJG 4G1PA 3H90A 3CD5A 1NZAA 3BBFA 3RG6A 1Y3JA 3H4DA 4NCGB 2PE8A 3OHBA 4NEYA 2IC3B 3C19A 1S76D 2FJXA 2HIYA 1R27B 1L3TA 2OEKA 4ZMMA 2XI3A 1F5CA 1UFLA 2A6MA 1HBOA 3FK4A 5KFRA 3TR5A 3HX9A 4OIXA 4TXSA 3RZAA 2OMOA 4J37A 2AEMA 4ZA1A 4KT0C 3R1LA 1R3NA 2AYGA 5L38A 2QZ8A 5DDQC 3NCRA 3FBFA 2YNFB 2HQGA 2BA9A 5DETA 2WRMA 4ANCA 4DUZF 1ZM3A 3PHTA 4K50A 1FRIA 4FYYB 3MEDA 3AJDA 4UQGA 1KFDA 2X1FA 3MEEB 1DTQA 2GJFA 1RT5A 1NK8A 2ZBCA 1FXLA 2HS4A 2XMTA 2OD6A 5EGYA 2XY5A 3MDFA 1EETB 2XI2A 3BSCA 1RT6A 4OX9J 1I6JA 2ZITA 3AJ2A 2AT1B 3US5A 1IBMJ 2POKA 2XGQA 1X60A 3QT5A 3M4XA 2H5JB 4L75A 3DLLQ 3QIPB 4ZCKA 4DG1B 3JSYA 4IG0B 3J81Y 2LA6A 4NLUA 4WP8A 5D4PA 1N5YA 4C8KA 3AD9C 5HQLA 3LOUA 5B0CA 2FUG9 1HBUA 5D4NA 3HXMA 2H4WB 4P9SA 5J2NA 5C25B 4UOFA 5GMKa 1PG5B 2CRLA 2HZCA 2FZKB 1MMLA 5LSLA 1CJTB 1ZM9A 3KLEA 3IMQJ 1X4EA 3RGIA 1JB0C 3IWLA 3KHGA 4DR3J 3AODA 1YTYA 1K1QA 1QLNA 1HWUA 1DURA 4DV4J 1NAQA 1S1WB 2P9CA 3G71S 5HI7A 1X5TA 4F0MA 4H4MB 5KFXA 3NOCA 4DQIA 3V4IA 1XJWB 4N47A 2YVSA 5FD1A 3E51A 4O4RA 2GMHA 1KONA 3HSDA 4C98A 4P10A 1WC6A 3V81B 3L9ZA 5C2CA 4LFAF 2WSEC 2XS5A 4A8FA 2FY1A 3BO3A 3KUEA 5HP1B 3UVJB 1EAYC 3PO5A 4DU8A 3KG0A 4QIFA 2VDHA 2AQ4A 2C2MB 4FXWA 3DLHA 4DCJB 2V8HA 3CO9A 3PX4A 4QIVA 4X64F 1GMWA 3TNVA 4HACB 1ITPA 3D68A 3QSIA 3CUNA 2RQCA 2PIIA 2XNQA 2QA1A 3M8PA 1N5VA 3R5BA 3DGVA 2CPHA 2CWKA 3IA0A 2VBWA 2AU0A 3OXLA 1T03B 1RT7B 5IOLA 1VQ6S 4ZCIA 4M94A 4OZNA 3P6YC 1WOPA 4QYRA 4HI1A 5CYJA 5KFGA 4N76A 4JI7J 4E8UA 2HNYA 2YH1A 2BM1A 3VR1A 1T7PA 1GNKA 4KIAA 2ASLA 4XAKA 1LK7A 2KL8A 3NNCA 1ROFA 2LCWA 1M1KT 1KLMA 3GFYA 2HHSA 4UUWA 2EFPA 2QLJB 2XNRA 2NXJA 1KN6A 1RI7A 4UZBA 2WZ1A 1AA1B 4J7CA 5A8KB 2R7QA 3W7BA 2ZUGA 4V19X 2YQ3A 2EFOA 3GSIA 3HF5A 4I64A 4WK3A 3DDIA 3OTOF 4PUOB
chains in the Genus database with same CATH topology
1NLKL 4ANEA 3FC9A 4FKYA 1LEOA 2DXDA 2DY9A 3VGUA 2CWKA 3ZTQA 5C7PA 3NGUA 4W98A 2NCKL 4F4AA 4CP5A 3G2XA 4WBFA 2B8QA 3Q89A 1XIQA 1S5ZA 3Q86A 1JXVA 1U8WA 3BBFA 3PRVA 3EM1A 1NDPA 1ZS6A 3EE3A 5IOLA 4ENOA 1HHQA 3VGSA 1NSKL 1WKLA 1K44A 1BUXA 1NSPA 3VVTA 2BX6A 4ANDA 4EK2A 4KPCA 3ZTPA 3FBCA 3FCVA 3FCWA 4UOHA 3FBBA 3FKBA 1UCNA 3EICA 3MPDA 3Q8UA 3VGTA 1NUEA 1S59A 3GPAA 3Q8YA 3EVMA 1F3FA 1LWXA 3Q83A 1VYAA 1PAEX 1WKJA 3BBCA 4O0NA 1PKUA 3ZTOA 1BE4A 4DUTA 5CABA 3ENAA 3FBEA 3NGTA 2B8PA 3ELHA 1HIYA 5CAAA 1F6TA 3PJ9A 3VGVA 5BXIA 1B99A 1W7WA 3WX8A 2AZ3A 3NGRA 2ZUAA 3R9LA 1BHNA 3BBBA 2DXEA 4HR2A 1NHKL 2HVDA 4FKXA 3NGSA 3EVOA 3VVUA 1EHWA 3BH6B 1B4SA 1NB2A 1NCLA 4DI6A 2BEFA 3ETMA 3DKDA 4S0MA 2DYAA 1S57A 3JS9A 3L7UA 1XQIA 3EJMA 1NDLA 3FBFA 1NPKA 3EVWA 3Q8VA 4DZ6A 2HVEA 3BH7B 1MN9A 2VU5A 3ZTSA 1MN7A 4UOGA 3B54A 1NSQA 4C6AA 4UOFA 4ANCA 2HURA 3GP9A 1NDKA 1HLWA 3B6BA 2AZ1A 2DXFA 3DDIA 1WKKA 4F36A 3EMTA 1KDNA 1NDCA 3ZTRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NLK L;  4ANE A;  3FC9 A;  4FKY A;  1LEO A;  2DXD A;  2DY9 A;  3VGU A;  2CWK A;  3ZTQ A;  5C7P A;  3NGU A;  4W98 A;  2NCK L;  4F4A A;  4CP5 A;  3G2X A;  4WBF A;  2B8Q A;  3Q89 A;  1XIQ A;  1S5Z A;  3Q86 A;  1JXV A;  1U8W A;  3BBF A;  3PRV A;  3EM1 A;  1NDP A;  1ZS6 A;  3EE3 A;  5IOL A;  4ENO A;  1HHQ A;  3VGS A;  1NSK L;  1WKL A;  1K44 A;  1BUX A;  1NSP A;  3VVT A;  2BX6 A;  4AND A;  4EK2 A;  4KPC A;  3ZTP A;  3FBC A;  3FCV A;  3FCW A;  4UOH A;  3FBB A;  3FKB A;  1UCN A;  3EIC A;  3MPD A;  3Q8U A;  3VGT A;  1NUE A;  1S59 A;  3GPA A;  3Q8Y A;  3EVM A;  1F3F A;  1LWX A;  3Q83 A;  1VYA A;  1PAE X;  1WKJ A;  3BBC A;  4O0N A;  1PKU A;  3ZTO A;  1BE4 A;  4DUT A;  5CAB A;  3ENA A;  3FBE A;  3NGT A;  2B8P A;  3ELH A;  1HIY A;  5CAA A;  1F6T A;  3PJ9 A;  3VGV A;  5BXI A;  1B99 A;  1W7W A;  3WX8 A;  2AZ3 A;  3NGR A;  2ZUA A;  3R9L A;  1BHN A;  3BBB A;  2DXE A;  4HR2 A;  1NHK L;  2HVD A;  4FKX A;  3NGS A;  3EVO A;  3VVU A;  1EHW A;  3BH6 B;  1B4S A;  1NB2 A;  1NCL A;  4DI6 A;  2BEF A;  3ETM A;  3DKD A;  4S0M A;  2DYA A;  1S57 A;  3JS9 A;  3L7U A;  1XQI A;  3EJM A;  1NDL A;  3FBF A;  1NPK A;  3EVW A;  3Q8V A;  4DZ6 A;  2HVE A;  3BH7 B;  1MN9 A;  2VU5 A;  3ZTS A;  1MN7 A;  4UOG A;  3B54 A;  1NSQ A;  4C6A A;  4UOF A;  4ANC A;  2HUR A;  3GP9 A;  1NDK A;  1HLW A;  3B6B A;  2AZ1 A;  2DXF A;  3DDI A;  1WKK A;  4F36 A;  3EMT A;  1KDN A;  1NDC A;  3ZTR A; 
#chains in the Genus database with same CATH topology
 2VG7 A;  4K0K J;  2XZW A;  4M5M A;  2V4J B;  1DTT B;  2RKI B;  4A8X A;  2XHW A;  2CJB A;  4W98 A;  2JLG A;  1RT1 A;  3CJQ A;  2ZH4 A;  4PZV A;  4KPC A;  1D09 B;  2DNQ A;  1C4A A;  3PY8 A;  4E0D A;  1R8A A;  2JFD A;  2PI5 A;  3BS9 A;  4R5P B;  4ECX A;  2YKM B;  1K0V A;  4KE5 A;  3I56 S;  1MU2 A;  3DLJ A;  1NHK L;  4YQW A;  1KS2 A;  4P7T A;  1FVQ A;  1WC5 A;  2XLK A;  5EX0 A;  1KKH A;  2HVZ A;  1U2R A;  2BDP A;  3D6F B;  2BJE A;  2Z2M A;  3PW0 A;  3MPW A;  2ZH1 A;  1U6B A;  2B4P A;  4Q0B B;  3HK2 A;  1NBE B;  4UY8 T;  2QC3 A;  1U1P A;  1FDB A;  2HUR A;  1N0V C;  4LF8 F;  1H7X A;  4IR9 A;  1FRH A;  1RTZ A;  1RT4 A;  5THW A;  2PA3 A;  2FHK A;  4AYB D;  3AA9 A;  3H5X A;  1ZOT A;  2RB7 A;  4C7Q A;  1BQN A;  3D9B A;  2R2R A;  3C6T B;  3ZO7 A;  1WTF A;  4U95 A;  3DI6 B;  2CJY B;  2B9E A;  2P8I A;  2KT3 A;  3SV4 A;  3PRV A;  3K5L A;  5G0R A;  4PQU B;  1K44 A;  2OFG X;  5HQM A;  1TKT B;  2E5G A;  4L6V 3;  3D66 A;  5T7L A;  1M5O C;  1C1B B;  3UN3 A;  2HAF A;  4X4O A;  3AQP A;  1F3F A;  4ZVO B;  3I32 A;  3M9M B;  4K5S A;  3JB9 k;  4MMO A;  1W7W A;  1RYS A;  1VIX A;  2R8H A;  2WVE A;  1Y00 A;  1GXU A;  2CNL B;  1N36 F;  3CD6 S;  3TJ9 A;  3C14 B;  4O23 A;  1U1M A;  4JOU A;  1IBC B;  4RL1 A;  2XMM A;  1XNQ F;  4MFB A;  3QGH A;  1N6Q B;  4LBH A;  4H4O B;  1VLO A;  4ED2 A;  3UI3 A;  5EN1 A;  3MCN A;  4LFB F;  1T94 A;  1AYE A;  3D0G E;  3PAC A;  1JJ2 R;  2WVC A;  3GP9 A;  1FRX A;  5DG8 A;  4TQS A;  2PDA A;  4OYM A;  1YRX A;  5KT3 A;  1HYS A;  4U67 Q;  1CPZ A;  3M1V B;  3EDQ B;  4XDD A;  2VFV A;  3LPY A;  4FF2 A;  1H6K X;  4BDP A;  4AND A;  2NUU G;  3DGP B;  2AJQ A;  4DWI A;  2M0G B;  3W61 A;  2D41 A;  3W2V B;  2XMK A;  4NML A;  2DCU B;  1D8Y A;  4IO9 Q;  1U6F A;  3CSK A;  2J9D E;  2ZBR A;  3GG1 A;  4WFY A;  4GVB A;  2CDR B;  1F6T A;  4FBT A;  4HHU A;  2CPJ A;  5A2Q U;  1RB0 A;  5J2M B;  2R8J A;  1Z4U A;  2KT5 A;  2ZUA A;  2R2T A;  1ZZN A;  1S4F A;  2UUA F;  1D9F A;  4DR5 J;  1SXL A;  1FNX H;  4KAI A;  1TU0 B;  2M88 A;  3Q8P B;  5HO4 A;  4CT9 A;  3PFE A;  1F2G A;  3T1Y J;  4LF1 A;  2XEX A;  5HMY A;  1RTD B;  2WB1 D;  4DR2 F;  2IVY A;  1RTJ A;  1CUL B;  1NME B;  3GB0 A;  2M4M A;  3QT6 A;  2N4C A;  2DR7 A;  2NYH A;  4MKV A;  2ZH9 A;  1UZH A;  2QL9 B;  4X66 J;  3TI0 A;  3Q8R B;  5K14 A;  4ZVT B;  1B0P A;  1WUU A;  1SJ4 P;  2F63 A;  1CS4 B;  1HAR A;  4GO5 X;  4B3O A;  1RDR A;  3G2X A;  2CQG A;  3RRK A;  3GV8 B;  2CG4 A;  2C2K B;  3DRS A;  5C2G A;  3R5J B;  3TUZ C;  1XTZ A;  4FPI A;  4PEO A;  2HFO A;  4DV6 F;  2F4F A;  3V4M A;  2KKH A;  1Z1Z A;  4FYX B;  5DZ7 A;  2WBR A;  1RXO B;  1NKC A;  1N33 J;  3J7A 1;  4FYV B;  2QSW A;  3BR9 A;  2HBQ B;  4I2Q A;  2R7X A;  2RHQ B;  2H48 B;  3MM6 A;  2F8E X;  5HVG A;  1JIH A;  2MZQ A;  4KHM A;  2O1P A;  2ZH7 A;  1S6U A;  2ZKU A;  2YQ1 A;  4DN9 A;  3IRW P;  1W2I A;  1MN7 A;  1JLB A;  4CI0 B;  1GXT A;  4JV1 A;  1M90 T;  1WOO A;  2EBE A;  4CLP A;  2F4V J;  4D3H A;  2KO1 A;  1WD6 A;  2DNZ A;  1FFG B;  1N88 A;  2VOO A;  3QLH B;  1U1O A;  1HW9 A;  4X4T A;  4AL5 A;  4OI0 A;  3HT0 A;  2N7C A;  2B6A A;  3O5T B;  2HRT A;  3LQV A;  2HVI A;  2AEF A;  5KFE A;  2DNM A;  1EP4 A;  4O3Q A;  2J6T A;  4ICL B;  4RW4 B;  5CQG A;  5CA5 A;  2LLZ A;  4QW8 A;  1WEL A;  5ETL A;  2G0J A;  3FRZ A;  1FNM A;  3M32 A;  2RD5 C;  2OHD A;  4WZQ A;  4L3K A;  2ROG A;  2DGU A;  1SJR A;  4WFA Q;  1RT3 B;  3U27 A;  2DNY A;  1S12 A;  1CJK B;  1ZPW X;  3SI8 A;  2DPJ A;  2YPZ A;  5CD4 A;  4QU6 A;  3RTV A;  1ZM2 A;  1CJU A;  3MMB A;  1P8G A;  2RRN A;  5CZX A;  1FK9 A;  3CB4 A;  3FVY A;  4DZ6 A;  4QW9 A;  2Q6C A;  3T1H F;  1VDH A;  4QR2 A;  4RWW A;  4BS2 A;  2GV1 A;  4IOA Q;  1VCT A;  3W9H A;  2IJF A;  4HT5 A;  4ZPA A;  2ZOG A;  2YKP A;  5C42 B;  1YJN S;  4ZVE A;  3MTJ A;  3BPD A;  2LXI A;  3U1M A;  3KJN B;  4JI5 F;  2H65 B;  3OLA A;  4O3R A;  3ZTQ A;  4RU9 A;  1L3S A;  3MM5 A;  1RJJ A;  3MZI A;  2E1P A;  4IR1 A;  1YZ7 A;  1X31 C;  2MKY A;  1REG X;  1VIO A;  4IFV A;  4LQ9 A;  4N8O A;  1D8Z A;  2BKO A;  4DX7 A;  3GWC A;  2EG2 A;  3C2P A;  4G1Q B;  5KT7 A;  4ZPT R;  5D15 A;  2MY8 A;  4KR0 B;  4Y28 C;  1YX2 A;  1WEZ A;  4QBU A;  3A12 A;  4IOB A;  4RZR A;  2V2Q A;  3OV7 A;  2KG1 A;  1RWV B;  2K06 A;  3D6M B;  3QNW B;  4KFB B;  5KFC A;  3MUR P;  1S72 S;  3IRX A;  3R1H A;  4JI8 J;  3PX0 A;  2V67 A;  1RWP B;  3TZZ A;  2MKC A;  4N7T A;  1VI7 A;  3P3D A;  1S57 A;  4I2P B;  2YNI A;  1GTE A;  2ROE A;  2CQH A;  5B08 A;  1F9H A;  3AQO A;  5KG1 A;  2B43 A;  1S0N A;  3KG4 A;  2GFF A;  3KLV A;  1NDK A;  5HL7 Q;  4RBT A;  1VJQ A;  4JUZ A;  2GVZ B;  4OQJ A;  3RBE A;  2RUS A;  2WON A;  5I3U B;  1DLO B;  4LSZ B;  2N3L A;  3WZ0 A;  1VLY A;  4C9D A;  3MFH A;  3KK1 B;  2LEC A;  1UW9 A;  5K8P A;  3FCV A;  1FO1 A;  2NLW A;  3N0V A;  1H2U X;  4PAA A;  2HK3 A;  3G9C A;  1Q53 A;  3C8Y A;  3HSG A;  3O2I A;  4CO2 A;  4I0W A;  2NPI A;  4IKA A;  1Q7Y T;  4WYL A;  5A2Q Y;  3KK2 A;  2OPS A;  2GC8 A;  5H1S V;  2IJR A;  1F5B A;  3TAR A;  3KYL A;  3S7R A;  1ZAW A;  1IM4 A;  2BEF A;  5B7W A;  3PYD A;  3WHI A;  3K59 A;  1NHV A;  2AP6 A;  3OR1 B;  3EJM A;  2XYG B;  3M8R A;  2Z57 B;  5KG6 A;  5E3R A;  2DRD A;  1DQ9 A;  4LF5 F;  2OD4 A;  1VQ9 S;  2AX0 A;  3DU6 A;  4DEZ A;  3J7Y I;  3M6W A;  4ZLP A;  3RJM B;  5I3Q A;  3NNH A;  4IDK B;  5B0E A;  5IFM A;  3HHD A;  2SXL A;  4KY3 A;  4ERD A;  4LVO P;  3I0R B;  2EVZ A;  1WEX A;  1HFE L;  4R0E A;  1WNE A;  3I4P A;  3OL6 A;  3SCL E;  3BQ0 A;  5LM7 E;  2V68 A;  2MQM A;  1HD0 A;  1V9O A;  8AT1 B;  2ZZT A;  2QL5 B;  4TNO A;  5H9F K;  5H9E J;  1LWX A;  4ILR A;  4BLG A;  4Q5V A;  1UPM B;  1CBK A;  1AB8 A;  4LF4 J;  4DV2 J;  2BR0 A;  2M70 A;  5ETP A;  2B4U A;  3R2D J;  2X51 A;  3PM9 A;  2LEA A;  3LWM A;  3W2W A;  4NYP A;  4RBV A;  2OPP A;  3E8O A;  4HH0 A;  2EWH A;  2DNH A;  4U6P A;  4MYU A;  5KG2 A;  1MNE A;  3LPE A;  2J9D A;  1D1U A;  1SC1 B;  1C2P A;  3Q2T C;  3H7H B;  2LQB A;  4MK7 A;  4FZV A;  4B3M J;  4DV3 F;  1WSV A;  3HFK A;  2ZBI A;  1B7Y B;  3TA1 A;  2JFK A;  3OL8 A;  4CCH A;  1CSJ A;  1K9M T;  6FD1 A;  2W7A A;  1VQK S;  3M9N B;  1X4B A;  1J5E J;  1FJC A;  4KKO A;  4ZKA A;  1MWY A;  3R7N B;  2RKI A;  1VC5 A;  3P4U B;  1Y11 A;  4BC7 A;  2R7W A;  2KFZ A;  5F8H A;  1BE4 A;  4TU8 A;  4M95 A;  1RHR B;  3GV7 B;  1S10 A;  5HAO A;  1I94 J;  2V6A A;  2VG6 B;  2IM3 A;  3KHR A;  2HHP A;  1SKW A;  4A8O A;  2ZDO A;  2AIR B;  3IP0 A;  2NZC A;  3PDN A;  3SDE A;  3HD1 A;  2ZC4 A;  2KFN A;  2ROP A;  1TL3 A;  4J9V A;  1JLG B;  1N34 J;  5A8W A;  5D3G A;  5HLF B;  1RKJ A;  2PGC A;  2CZV C;  1HPZ A;  3WC0 A;  4RW7 B;  5GAE U;  4P73 A;  1R0A B;  4ES2 A;  3M2V A;  3KJV A;  2CPY A;  3E01 A;  1S1V B;  3FZB A;  2MLX A;  3QWU A;  5FII A;  1VRQ C;  3R6G B;  2W4P A;  3BGL A;  2RE1 A;  2OSQ A;  1FKO B;  1VRU B;  1U09 A;  4CO0 A;  1N0U A;  3M8W A;  4ZHR B;  4I1T A;  4C8Z A;  1F9F A;  2XGP A;  4CYU A;  4LFC F;  2HLT A;  1X5S A;  2WBM A;  1VRT A;  1HHT P;  2E9Z A;  1TL1 A;  1UCN A;  1XMQ J;  2HAI A;  3Q8U A;  2KM8 B;  2JL9 A;  1LKZ A;  1PIL A;  3CCJ S;  2ABY A;  1FF2 A;  2MMY A;  5K8O A;  5IT9 Y;  1JLE B;  4ELT A;  1MRO B;  2AZ3 A;  3UR0 A;  1DJ0 A;  4CT8 A;  4CWB A;  1IKY B;  2OEL A;  2RQ4 A;  3G82 A;  1NB2 A;  4M5I A;  2J8A A;  3OUY A;  3NGK A;  3M8Z A;  2W9B A;  4ID5 B;  2AJ1 A;  5HBM A;  4IO1 A;  3H2L A;  1FXD A;  2HMI B;  3DN9 A;  1KSP A;  3THP A;  2V69 A;  1WHY A;  2CQ1 A;  1F2H A;  1FES A;  4RUC A;  5KFD A;  3KHH A;  4NLR A;  2CKW A;  4AXJ A;  1KDN A;  4USU A;  3N6N A;  3NGD A;  4CM0 A;  2CZ9 A;  5FJ4 A;  4ZVR B;  2N3O A;  2K1R B;  3VGU A;  1W25 A;  4Y34 A;  2CWX A;  3DM2 A;  3P5B P;  5FDL B;  1LFP A;  4MYT A;  3J7Z 5;  2MHE A;  4C11 A;  2CPE A;  5IQ6 A;  2CQB A;  3MEG A;  4JI3 J;  1RAI B;  3WQP A;  5CCM A;  2DEI A;  4MAK A;  4FPR A;  3FBE A;  4OX6 A;  4LR7 A;  3M30 B;  3DMJ A;  3K58 A;  3CNQ P;  3IXQ A;  2I5J B;  1FI4 A;  1HWI A;  1XBW A;  3PW4 A;  3T3F A;  2HWI A;  4DL4 A;  3W5Z A;  1P6T A;  2VQF F;  2PFF B;  5KFO A;  4L74 A;  7AT1 B;  2IYG A;  4M5D A;  1TL4 A;  4P2F A;  2GO9 A;  4N56 A;  1NJI T;  3Q0A A;  5IV3 A;  4NXN F;  2DXF A;  1KBR A;  2KFY A;  3LP0 A;  4JYA J;  4LF7 F;  3P8B B;  3FEZ A;  1QE1 B;  4DU7 A;  4X62 J;  4YB6 A;  2VA2 A;  1S1T B;  4DV5 J;  4WJB A;  3MCM A;  1BUX A;  4CNY A;  3MAA B;  4DR1 F;  2AYE A;  1QAX A;  3HHL C;  4RNO A;  3MR3 A;  3NEK A;  1ZAV A;  1ZZF A;  4DUT A;  3TZX A;  3V6J A;  3A3P B;  1UJ6 A;  5D0R A;  1Y7P A;  2HZV A;  2GIF A;  3JYT B;  3N5F A;  3MMC A;  1JX4 A;  4FDF A;  1NPP A;  1BMQ B;  4DCO B;  1S7H A;  3KMS A;  3W62 A;  3Q8S B;  4B3S J;  4J9M A;  2L9D A;  3L95 X;  3H5S A;  3KNA A;  2UXD J;  4QU7 A;  1RWK B;  2EK6 A;  1WHX A;  2BQU A;  5KFJ A;  5F8N A;  2DYA A;  2U1A A;  2KXF A;  2RF2 B;  5CZV A;  2RNE A;  2W1B A;  4YUD A;  4DFK A;  3TAQ A;  2JC1 A;  4KH0 B;  1F9E B;  5CHC B;  4O4G A;  1QTM A;  1XNR J;  3JSM A;  5I4M A;  3G6Y A;  4M5L A;  1NH8 A;  2YWK A;  3NGU A;  3W64 A;  1SPB P;  1G1X A;  3NS5 A;  2P6S A;  4K4U A;  3K5M A;  4ZS6 A;  2DGO A;  1S49 A;  4DSF A;  1SIZ A;  3CME S;  1OWX A;  3RUB L;  4URG A;  2XO6 A;  3FMW A;  2C2N A;  2LMI A;  4JB8 B;  3G96 A;  4ECY A;  3MTK A;  4WKR A;  3CTR A;  2OSR A;  5ETQ A;  1T02 A;  2YNH A;  1GFW B;  2AMC B;  4X4V A;  1NEE A;  2H1Y A;  3DOK B;  3KG1 A;  2Y8Y A;  1MW7 A;  5HVF A;  4KTQ A;  3ITH A;  3QGI A;  1FJG J;  2UV8 A;  3H20 A;  2VDI A;  2MJU A;  1NHU A;  4LRB A;  2LYV A;  3OD2 A;  3CCV S;  1VC6 A;  3UDE A;  4B3T J;  5AE3 A;  4O0I A;  3VCD A;  1TKZ A;  2CFX A;  1X9S A;  2H9Z A;  4ZP6 A;  1A9N B;  1SVD A;  1N5T A;  2C2D A;  3DLE A;  2W24 A;  4YEA A;  4J9U E;  5F0U A;  5CYM A;  3PZP A;  3AOA A;  1LWF A;  1HMV B;  2NXU A;  2ALZ A;  2PI4 A;  3L4B C;  2YY3 A;  2CQ3 A;  2OKQ A;  2HK2 A;  4M8L A;  2AJ4 A;  4JI0 J;  2CVI A;  5KFY A;  4HI2 A;  4QZV B;  4A8K A;  1VQP S;  4ECS A;  1AUD A;  2J5A A;  3K89 A;  3OR2 A;  4J9N A;  1SV5 B;  4ENO A;  1ZYQ A;  1KOO A;  2LFV A;  4CTA B;  3OHA A;  3FDS A;  3GE9 A;  3S8S A;  2XYH B;  1RAB B;  1KQK A;  2LQ8 A;  2Y9H A;  4GKK F;  3TEG A;  2EI5 A;  2RIL A;  1C0T B;  2V2K A;  4U7U D;  5AXN A;  4DQP A;  4NA1 A;  3GFZ A;  1X4D A;  1HWJ A;  3OFH A;  3WX8 A;  5F3Z A;  2P9G A;  5IC4 B;  3Q22 A;  3N6M A;  2FHM A;  2AD9 A;  2QGF B;  4KV8 B;  2MHN A;  2YKO A;  2A1B A;  1NU4 A;  1QVF R;  3N4W A;  4K5R A;  4DR6 F;  4YY3 J;  2GA7 A;  3IS9 A;  2V5H G;  5DQH A;  3S1T A;  4DPX A;  1LK5 A;  1LFW A;  3RYL A;  2ZE2 B;  4J5O A;  2LEP A;  2Z30 B;  5KT5 A;  4K2X A;  2JNJ A;  2DGV A;  3FUY A;  2BJ1 A;  2DY9 A;  3A3O B;  1X9W A;  5LMU F;  2HQF A;  3F44 A;  4RW9 A;  4USH A;  5J2P B;  2OEJ A;  2A2D A;  2HWT A;  4OYZ A;  1V3R A;  4YR2 A;  4YHH J;  5DZ6 A;  3GQC A;  2GHP A;  4I56 A;  3R8Y A;  3UN5 A;  4X65 F;  5HK4 A;  4BC9 A;  3DXB A;  2VC0 A;  5IWA F;  4DUY J;  1FFS B;  2K7K A;  4TLQ A;  3UN2 A;  1HQU B;  1FER A;  3PJ9 A;  1VBY A;  2ZEJ A;  3Q8Q B;  3RRH A;  4MT1 A;  1GAO A;  1T9X A;  1SH0 A;  3NAH A;  1S1X A;  4OI1 A;  1R8P A;  4DSL A;  1K0T A;  1RHM B;  2Z2L A;  3OFG A;  5BYQ A;  3FSI A;  2QTW A;  4YFU A;  1SKS A;  1R8H A;  3R7B B;  4LRF A;  3MD3 A;  4HL9 A;  1KVJ A;  2GHV C;  4Y00 A;  1FD2 A;  1EJ7 L;  4HDG A;  2H51 B;  3DHW C;  1HI1 A;  1Q8B A;  3ZZT A;  3A8E A;  1NK6 A;  1HBO B;  4LBP A;  2CPX A;  2MKI A;  1U7L A;  4LF9 F;  4CP5 A;  2VJU A;  2E5L F;  5A8R A;  4DPY A;  4NLV A;  4G1I A;  1QVG R;  4KHP F;  3CF5 Q;  4UQT A;  4RKU C;  4WP3 A;  2OPR A;  3MR6 A;  1F60 B;  2ZH8 A;  3MED B;  3NGT A;  1HWK A;  3CJ4 A;  4CQ1 A;  5BXI A;  3MMJ A;  3AOC A;  4B17 A;  1DTQ B;  1RT5 B;  1O0P A;  4U9R A;  2PMW A;  1VQY A;  3VAI A;  4JI1 J;  1EB0 A;  1IM6 A;  2ALY B;  5JJB A;  4ILL A;  1RT6 B;  3BSN A;  3OVS A;  4OZ0 A;  5DDP C;  1JLQ A;  5C24 A;  1NPK A;  4OFZ A;  5L46 A;  4DFJ A;  4C2M A;  1NSQ A;  2LDY A;  4KO0 A;  5J1E A;  4P71 A;  2BRL A;  1JMT A;  2Q66 A;  2AJ2 A;  4URS A;  1DQA A;  4EO6 A;  1U1L A;  1YQH A;  4C8N A;  2G0C A;  4NX9 A;  5D4O A;  4R8U A;  2UZA A;  1IJE B;  2B9X A;  2W2N P;  4RO0 A;  4ZPC A;  2VPY B;  5AJ3 F;  1TVR B;  3TYT A;  1TFY A;  1N5Y B;  3CCU S;  2V8P A;  3RAQ A;  3LAL A;  1ACM B;  3QRR A;  1Q8I A;  5B0D A;  4ED8 A;  1WKL A;  5ETO A;  1HBU B;  3M8Q A;  3W8G A;  5J2N B;  5J2Q B;  1NUE A;  1HNI A;  4PG5 A;  1FDA A;  1AFI A;  1IVZ A;  3KLE B;  3GLJ A;  3CCT A;  4I4B A;  2ZVI A;  4RU2 A;  2KXH A;  2HHH F;  2OI2 A;  4DUZ J;  3NBP A;  4DR4 F;  4B9M A;  3I5B A;  3WBZ A;  3HVT A;  4IRK A;  2ZM6 F;  4C0H A;  4CH7 A;  1KHV A;  1RAC B;  5HRO A;  1DZ5 A;  3V4I B;  4OLO A;  1HBM A;  2KHC A;  1HBN A;  3I4H X;  5HQ8 A;  2HHV A;  1LEO A;  1T9V A;  3CW2 C;  2QX0 A;  2QT7 A;  1TFW A;  3AOB A;  2IBO A;  2NR0 A;  5ETS A;  1XR5 A;  2BQR A;  3KLI A;  4DPT A;  4G6V B;  2F9D A;  3TJA A;  5ETV A;  1O6X A;  4ITS A;  2RDJ A;  2N7Y A;  3MM7 A;  4IFY A;  1FE0 A;  4F0H A;  5BYR A;  3M8P B;  2A10 A;  4LF6 F;  1I51 B;  1FKA F;  3QFH A;  1FXR A;  3ISZ A;  3A13 A;  5GMD A;  1IBK F;  1EKR A;  4FBU A;  1Q79 A;  2HFN A;  3I0S A;  2KTQ A;  2MGZ A;  1TP7 A;  2FB0 A;  5E0O A;  2L9W A;  4QYZ K;  1FJ7 A;  2X7I A;  2PN6 A;  2A6O A;  3MR5 A;  3V5R A;  2R8I A;  1TL5 A;  2OO4 A;  1RWU A;  4C6A A;  2OFH X;  1YJ7 A;  2HNY B;  2UU9 F;  2O67 A;  3BGR A;  2KG0 A;  3T5L A;  1NLK L;  3IR5 B;  1RAO A;  5M2U A;  2B5J A;  4ED3 A;  1E6Y A;  1F5A A;  2L9N A;  1FHT A;  1MLA A;  3PW5 A;  3CIM A;  3SBM A;  1FA0 A;  4NLT A;  5KT4 A;  1LW2 A;  1IR1 A;  3BSA A;  5KG3 A;  5BYS A;  3VQT A;  1FEE A;  3M7V A;  5EHH A;  4G3I A;  4B9N A;  4LFA J;  5E3C A;  1Y4Z B;  1OO0 B;  2NPF A;  5GVQ A;  1Q95 G;  1VQS A;  3H2V E;  1XWL A;  1JLC A;  3W65 A;  3FSY A;  3GPA A;  3G6V A;  2F5G A;  2EK1 A;  4DSJ A;  2RRA A;  2VG7 B;  3JSB A;  4X64 J;  4EBD A;  4DOZ A;  2DKO B;  5KFN A;  3UFC X;  1RT1 B;  1YIJ S;  2QLX A;  3R3T A;  2ZHB A;  2YXL A;  3KOA A;  2HVH A;  3H5U A;  4B9S A;  4NRT A;  2CPZ A;  4NWB A;  2JC0 A;  4TYB A;  4ES1 A;  1Q82 T;  3C15 A;  3KTQ A;  4MIB A;  3G6E S;  3CC2 S;  3FFI A;  4DL5 A;  2RU3 A;  2UVU A;  2QA4 G;  2Z58 B;  3R9L A;  3FJ2 A;  4DF8 A;  5KFS A;  1MU2 B;  3HUL A;  1NH7 A;  3KLG A;  2ADB A;  4NOH A;  4XDC A;  5KFQ A;  2B8Q A;  3TOQ A;  2QMW A;  5CH7 B;  3MMA A;  3SQG A;  2RQK A;  4CO5 A;  4MKB A;  2J6S A;  4JV5 F;  3FQK A;  4R25 A;  1S77 D;  2GML A;  4J90 A;  3VGS A;  4GRS A;  4ZP8 A;  4NL5 A;  1NK9 A;  2HRY A;  1DFD A;  1HI8 A;  3CCZ A;  2AEJ A;  2C42 A;  1QAY A;  4P52 A;  1LW0 A;  1BLU A;  3KUH A;  2ZNY A;  1RT4 B;  2UVV A;  1RWM B;  1UA0 A;  1BQN B;  3DOM A;  2CNO B;  4DPW A;  1XEZ A;  2GS8 A;  3OTO J;  3TJ8 A;  1NJY A;  2V8D A;  1N8R T;  1VK8 A;  3F0N A;  2CAJ A;  4DXL A;  4UST A;  5CD4 H;  4XO0 A;  4DL7 A;  2C2Z B;  2DD8 S;  1Q4R A;  4UW2 A;  2VBY A;  4W92 B;  2XQC A;  3ZZY A;  1RQ0 A;  1SKU B;  1ICE B;  2I0X A;  5T7L B;  4FN5 A;  2MZJ A;  2W2P P;  4KGX B;  1H7W A;  3PRB A;  4A8Y A;  1WKK A;  5EX3 A;  4ZIW A;  4CNZ A;  3BKF A;  5IT4 A;  2GQC A;  1G3O A;  4WF9 Q;  1T3O A;  2XMU A;  4GMK A;  3W3S A;  4B9L A;  4MFB B;  3PXG a;  2FDN A;  1V5V A;  1NJW A;  2JSX A;  1HHS A;  3M6V A;  4M1K A;  4CO3 A;  1Y0H A;  1U4B A;  3W1Y C;  1DRZ A;  4J9L A;  2CQI A;  3VV2 B;  2VON A;  2UVW A;  3GIK A;  3BN4 A;  2I8E A;  3CC4 S;  4OYX A;  2ZVS A;  2B8P A;  1NK5 A;  4LF8 J;  1HYS B;  4NYO A;  1LWC A;  3PTW A;  2CQP A;  3R97 A;  4DI6 A;  4OZL A;  3GII A;  2DB1 A;  1A6L A;  4LRE A;  4ETX A;  1C0U A;  3EWG A;  2XTJ P;  1YJ9 S;  1W2B R;  1U2C A;  2UUW A;  3VQS A;  4OZJ A;  4GVB B;  3FEX B;  5LJ5 Y;  3UNY A;  2XMA A;  2HBY B;  4AUK A;  2FJV A;  1OY8 A;  5AE2 A;  4NZ0 A;  2M5Y A;  2RJZ A;  4JBC A;  4F4Z A;  3TQ1 A;  1HMV A;  5T14 A;  1N36 J;  4MKY A;  2DR9 A;  4DX5 A;  1VBZ A;  1RP5 A;  3CD7 A;  1RTJ B;  4NAS A;  2BVZ A;  4QWB A;  2BE7 D;  4NPO A;  2MPU A;  3ENV A;  2FYX A;  1XNQ J;  3ISN C;  2CPI A;  1ZH5 A;  1IR2 A;  3UD3 P;  4ZDN A;  4LFB J;  4NZ6 A;  3BZQ A;  5K14 B;  3CC7 S;  2VPZ B;  1OY9 A;  1JNR B;  4WWS A;  2D74 B;  2EXU A;  1SUQ A;  1PBA A;  2YWE A;  4K7Q A;  4NCB A;  3SSS A;  4B3O B;  1TAU A;  1Y5L B;  1R7I A;  3DRS B;  2W8K A;  3A8K A;  4P72 A;  3KDN A;  7FD1 A;  3EGV A;  2KYZ A;  1CQN A;  5K9F A;  4WII A;  4EEY A;  1IWA A;  4ZVU B;  5JVG Q;  1K47 A;  3IR7 B;  3RAM A;  3I5A A;  3BB5 A;  4NLO A;  3MEK A;  1NJX A;  2CYY A;  3G86 A;  2YPY A;  4I2Q B;  2UUB F;  3I31 A;  4ANE A;  3MM6 B;  4NI2 A;  3LGM A;  4HHH A;  4ZJO A;  3MAH A;  3SQO P;  3HSZ A;  2GHW A;  2UUC F;  2UUA J;  1NXI A;  3CVK A;  2D3U A;  3EGN A;  1SL0 A;  2GIR A;  1FNO A;  3PJX A;  2OIH A;  1JLB B;  5LJ3 Y;  5J2P A;  5GAG U;  5LXR A;  3Q83 A;  4PQA A;  3QRP A;  4DR2 J;  5F3T A;  3B4M A;  2ZJR Q;  2L41 A;  4EI2 A;  9RUB A;  2XMV A;  1E6V A;  2VG5 A;  3HHK A;  4TY8 A;  2B6A B;  1DHM A;  1Q86 T;  2GO8 A;  2WB4 A;  5GAH U;  2C2E A;  1ULR A;  3CDU A;  1EP4 B;  4Y6I A;  4UZC A;  1HNZ F;  3M32 B;  2XSF A;  1UFK A;  3ZZP A;  2R42 A;  2JZ5 A;  2BOP A;  3TP2 A;  1YJT A;  2HS0 A;  1TKX A;  1LV5 A;  3E2E A;  1RA7 A;  1U48 A;  4IYQ A;  3PR5 B;  4FVC A;  2HQI A;  3CCE S;  1VQ4 S;  1M5K C;  1Z2Z A;  3ET6 A;  1CJU B;  4NLS A;  3GSD A;  3MMB B;  4PPZ A;  4ES3 A;  1OSD A;  1FK9 B;  3IO1 A;  5DG7 A;  2WSC C;  2DNN A;  3DCA A;  1JJC B;  1S6O A;  1PO6 A;  4WFN Q;  2HQD A;  1Y9O A;  4K4X A;  1FWP A;  4ED5 A;  2X1A A;  1D3W A;  1VQ5 S;  2RVJ A;  3ENW A;  1KEK A;  4RW8 A;  2W25 A;  5I3P A;  1U6Z A;  3MM5 B;  3HM9 A;  2JEI A;  1GQE A;  2R3V A;  4LMZ A;  1HI0 P;  1Y5I B;  3DRX A;  4OYO A;  4IFV B;  3CCR S;  3AD8 C;  1OJ4 A;  2J0X A;  2F65 A;  4V1A k;  1VQL S;  4X4U A;  1R8B A;  2GAH C;  4WU2 A;  3C3L A;  1O8B A;  4F25 A;  2C3P A;  5HVH A;  5E33 A;  1G2E A;  3M9O B;  2E9R X;  2QLF B;  2OAU A;  4J91 A;  4I6A A;  3K2Y A;  4L76 A;  4QIW D;  1RUS A;  4Y2K A;  5F41 A;  3W5X A;  2DHG A;  1ELO A;  3IRX B;  4WBF A;  4ZVP B;  1CJV A;  2XG8 A;  2XM3 A;  1LWE A;  2QMX A;  2V2Z A;  2YNI B;  1G6B A;  2KU7 A;  3RW6 A;  5BR8 F;  5E7O B;  2IRY A;  5LSO A;  1TK0 A;  2ADC A;  1SQG A;  1TVR A;  4K4S A;  1KP6 A;  2YKN A;  3T1H J;  1ZET A;  2HBZ B;  3CDE A;  1TV6 A;  5K20 B;  2FLO A;  2MY7 A;  1W26 A;  3GV5 B;  2HFU A;  3M8Y A;  1XC9 A;  2WON B;  2FVQ A;  2CQC A;  4F50 A;  3UPF A;  4USV A;  4HR2 A;  3VZI A;  5J2Q A;  3WIU A;  4CLS A;  2LVW A;  1SJF A;  5D0H A;  3AXK A;  2EKY A;  2GZO A;  2MZR A;  4JI5 J;  3HHN B;  1UMJ A;  4DX6 A;  1UWB A;  2HHT A;  4QWD A;  1IBL F;  1AUS L;  4KB7 A;  5E41 A;  5GAD U;  1YJR A;  3D5M A;  3HKW A;  3U1L A;  2CJQ A;  3BGU A;  3DLK A;  4UY8 5;  2QMU B;  2B9W A;  5SUH A;  4TU7 A;  3KK2 B;  1HNX F;  3FQL A;  3QO9 A;  1D0E A;  4Z7Y A;  2OPS B;  1R8C A;  1TUW A;  4OYP A;  2CJX B;  4J9S A;  3QT7 A;  3A1Y G;  4OV6 A;  4NYZ A;  3DYA A;  2YTC A;  4Y2M A;  2VBZ A;  5T41 A;  2D7S A;  2VJV A;  1NK0 A;  3MOZ A;  2F7V A;  3N79 A;  4HVZ A;  4ZPV R;  3TZY A;  2WHO A;  3Q8Y A;  2DCL A;  1TK8 A;  3UCU P;  2RS8 A;  4KBI A;  3KUG A;  2N4D A;  3N6L A;  3IG1 A;  4USI A;  1GMW D;  4K4Z A;  2KN4 A;  1X4A A;  3GJS B;  4EZ9 A;  3G87 A;  3CJK A;  2HQC A;  2KRB A;  2L08 A;  4CLZ A;  4ZK7 M;  2X1G A;  5LXY A;  3I9Z A;  2ZJP Q;  1S9G A;  5DLF A;  3OVB A;  3AXM A;  5IXU A;  3LP2 A;  3PR4 A;  4OYB A;  4LSN A;  3SXL A;  1QTN B;  5E2Q A;  2OTL S;  4CLF A;  4DL3 A;  1AZS A;  4LR9 A;  3W2W B;  2FPH X;  4C0O C;  4L73 A;  1U0H A;  2OPP B;  4F3M A;  3CCW A;  3GIM A;  1C1C A;  4X4N A;  2W8L A;  3I5C A;  2JEG A;  3SYZ A;  2X3D A;  3QPI A;  1U1R A;  3W66 A;  4PG6 A;  2IVM A;  2OTJ S;  2APO A;  4O0N A;  1RU2 A;  2ZBP A;  2KM8 C;  4LF5 J;  3W8P A;  4DFM A;  2QA2 A;  3L7O A;  2FD2 A;  1NJZ A;  4DHV A;  1SBR A;  3PW2 A;  4ZN1 A;  1PJ7 A;  4ZVF A;  1U49 A;  4O3N A;  2ZZN A;  4KKO B;  3QBC A;  3N01 A;  1NPR A;  1S9F A;  5D8H B;  2HEK A;  2G1D A;  3PKM A;  3HJF A;  1SIW B;  4QCL A;  1U47 A;  1RU1 A;  3MFI A;  3PCO B;  3KLF A;  4HHJ A;  2JVO A;  2XCP A;  2BXJ A;  1T11 A;  1IN0 A;  4O3P A;  1RAE B;  3GU0 A;  3TUP A;  3SDE B;  3KK3 A;  2MYF A;  3HVW A;  1TL3 B;  3F73 A;  5A8W B;  2Y8W A;  2VD3 A;  5D3G B;  3ILO A;  3BV8 A;  1BC6 A;  4WFZ A;  1HPZ B;  5F8L A;  4QWE A;  3VHQ A;  2WK4 A;  1DAR A;  5F8I A;  3M2V B;  1T0T V;  2K7J A;  3KJV B;  3E01 B;  2IA0 A;  1FKP A;  4DMZ A;  4A46 A;  2GGP A;  2XY7 A;  1VQO S;  4DV3 J;  3LP1 A;  4I69 A;  1HW8 A;  2FJA B;  1X9M A;  3RBD A;  2EFN A;  2VZ9 A;  3CED A;  4ATN A;  4CYU B;  1FDN A;  1RLD A;  1VRT B;  3SCJ E;  1TL1 B;  2LU2 A;  4RBU A;  3N28 A;  3JTO A;  1RTI A;  1UVM A;  1WF0 A;  1HKA A;  3GTY X;  4EZ6 A;  4JI4 F;  2OEM A;  5IQQ A;  3OLB A;  3FC9 A;  2ACM A;  4DR7 F;  1G7C B;  2DXD A;  1Y5N B;  1B64 A;  3PEH A;  2BE2 A;  1S5Z A;  3G82 B;  3RR8 A;  3OUY B;  2Y1R I;  3PIP Q;  4DSE A;  2W9B B;  1S9E A;  3D0I E;  5HBM B;  4Z37 A;  2R7R A;  3CDA A;  3BPS P;  3U02 A;  2JRS A;  2IYI A;  2HHU A;  4M5J A;  2UXC F;  4NE9 C;  3UD4 P;  2E7V A;  2QJ3 A;  4OI2 A;  3PG9 A;  4I6W A;  2J9E A;  2RH3 A;  2V4Q A;  3TQE A;  2DK2 A;  2IRX A;  3BR8 A;  3MPY A;  2ACY A;  3DM2 B;  4IRC A;  3T9Z A;  2DNG A;  4C11 B;  1ZAX A;  3ETM A;  2KH9 A;  2BUN A;  1RKI A;  4FF3 A;  3MEG B;  5KFZ A;  2W01 A;  4EO8 A;  1FWL A;  3ZZZ A;  4WCE Q;  3B54 A;  4P6Q A;  2YBV A;  1WG4 A;  3MPV A;  3HKZ D;  4LFC J;  4WTO B;  4CH1 A;  3RRG A;  3DMJ B;  1U1Q A;  4YR3 A;  3EDR B;  1L3K A;  3V6D A;  4E98 A;  1OYE A;  1T9Y A;  3TO8 A;  1KC8 T;  4HH1 A;  3HHE A;  2W2M P;  3EZO A;  4RUB A;  3WC2 A;  3MWB A;  3Q23 A;  3K0J A;  1BWE A;  3B8H A;  5MAO A;  4OZ1 A;  3EE3 A;  5DRK A;  4M5D B;  3H4B A;  1JLA A;  1YBA A;  3TAM A;  4Q8E A;  2V63 A;  3CDB A;  4QQB A;  3DU5 A;  4JV0 A;  2Q6B A;  5CYQ A;  2YNG A;  3MPD A;  5M2P A;  3G8Q A;  1Q16 B;  3PRD A;  5KFM A;  1RWW B;  1IUJ A;  1VYA A;  1B70 B;  3LP0 B;  2DT9 A;  3D6H B;  1QUP A;  8RUC A;  4NLY A;  1SL2 A;  2ZHO A;  2VPW B;  1FX2 A;  1UEU A;  3ICL A;  1H0H B;  3O6Q A;  2HLU A;  2GJI A;  2XCA A;  3EZ5 A;  3GIR A;  3OJS A;  4BCA A;  4KGZ B;  4P74 A;  1OPZ A;  3R7S B;  1Q7L B;  2NXC A;  1S99 A;  2FY8 A;  3TUI C;  1L5U A;  3OVA A;  3DRY A;  2Y0S D;  3KMQ A;  3QMQ A;  3MMC B;  5KAK A;  4ZJQ A;  2YKA A;  2W9C A;  2UUT A;  1NM2 A;  1AW0 A;  5IM0 A;  2HSE B;  4A8M P;  2FVP A;  3MI7 X;  4NXM F;  3LO3 A;  2O01 C;  4MIW A;  1B0V A;  3L7P A;  3O3L A;  2PO4 A;  4NLW A;  2DHS A;  1Q5V A;  1PC4 A;  2VQF J;  1CQM A;  3U7J A;  5L1K A;  4QR0 A;  1H38 A;  3EIC A;  2ILY A;  4LIW A;  3VAM A;  2ZD1 A;  3CJ5 A;  1U45 A;  4O4G B;  2LQ9 A;  3FCH A;  2H3E B;  1EAR A;  5E3Q A;  3JSM B;  2YWG A;  4Y65 A;  2MQ8 A;  3GYG A;  1YSJ A;  4NXN J;  2LQ5 A;  3M6U A;  4LF7 J;  4FXD A;  5IZH A;  3S6E A;  3RBZ A;  4N41 A;  3MEC A;  1Y10 A;  1LQ9 A;  2MTL A;  4IUF A;  4IH5 A;  1AXQ A;  3SEO A;  2E7X A;  4FS2 A;  2OLW A;  3QQC D;  2MZ1 A;  2EFQ A;  3FGV A;  3NRB A;  4DR1 J;  1DAX A;  5LSR A;  2YNH B;  2DVI A;  2MQO A;  2GVD A;  2BW7 A;  1IKW A;  2HQ3 A;  4F3O A;  3ITH B;  3MGJ A;  1NK4 A;  3QJJ A;  5D4L A;  4DL6 A;  1X0P A;  1X4C A;  3UDL A;  1H98 A;  4WFB Q;  1VJW A;  1HNW F;  1TKZ B;  4GO7 X;  3DRP A;  3M2U A;  1UVL A;  4UOH A;  3JAM U;  4A4J A;  2M8D B;  3DLE B;  2H54 B;  2RUG A;  3W9J A;  4EBC A;  2F3J A;  5CYM B;  2BJ8 A;  1LWF B;  1IWG A;  1XN9 A;  3D3C J;  2MST A;  3K17 A;  1HWL A;  4DSK A;  1WF1 A;  3HP6 A;  3BF4 A;  4ED1 A;  1T9T A;  3OR2 B;  2E5J A;  4DS5 A;  1H74 A;  5L8R C;  3VAH A;  1M5P C;  1XQI A;  1N32 F;  5BJR A;  2FJW A;  1B7F A;  1J2V A;  3W63 A;  1L3V A;  4I7F A;  2JHE A;  1LXN A;  3JSR A;  5ETM A;  2HYI B;  1RWO B;  4EUV A;  3VAG A;  4USW A;  2UVR A;  4LQ3 A;  1S7I A;  1FD8 A;  2HND A;  2ERR A;  5JUM A;  4URQ U;  2BAN A;  1CLF A;  1YIT S;  1RCX B;  4P7V A;  3IS9 B;  3CJ8 A;  2Z2Y B;  2IDL A;  4MK8 A;  1O51 A;  5KG0 A;  3LWL A;  1APS A;  4PPD A;  5B0F A;  1YJU A;  2Z56 B;  4CZC A;  3KWM A;  4LSL A;  2OGU A;  1VHI A;  7FDR A;  2FGO A;  2B4V A;  3NGR A;  3MUV P;  2B4O A;  4RW9 B;  1S6Q A;  5DGA A;  2ZWP A;  2XS7 A;  2XUL A;  5G4D A;  3P5T L;  3ZNJ 1;  2DNL A;  1VGY A;  1SB6 A;  2V34 A;  2R8K A;  2X3G A;  3AY0 A;  1RAD B;  4ZLL A;  5DDR C;  1NO8 A;  3HFV A;  4XK8 C;  3UDC A;  2UXB F;  4K4Y A;  4H4K C;  2R7S A;  2KZM A;  1YGY A;  3LA0 A;  4K8R A;  4RPF A;  4GKK J;  4O44 A;  4YP3 A;  1NKB A;  1FRJ A;  4PKD B;  1K8A T;  1S1X B;  1TEL A;  4TLR A;  1RWX B;  4M5G A;  2KDO A;  5E3A A;  2LEB A;  3VVT A;  3NWR A;  4ZLN A;  4O3S A;  2XS2 A;  4TU9 A;  1RTH A;  1RZM A;  4DR6 J;  1WKJ A;  3G4S S;  4KYZ A;  1KQF B;  1WOR A;  1YK9 A;  3CJ2 A;  3MM9 A;  2CA9 A;  2DNR A;  3MF5 A;  1CC8 A;  2HHQ A;  1UAW A;  5KFH A;  3NOG A;  3ILJ A;  3MUT P;  3BH6 B;  5A8R B;  1B4S A;  1R31 A;  3PYE A;  2VQE F;  3QZ7 A;  4FXV A;  3BYR A;  1B0T A;  1O5J A;  5LMU J;  2CPF A;  1URN A;  4NA2 A;  2XSJ A;  1RAF B;  2E29 A;  1MN9 A;  3D28 A;  2XYP B;  2ZFH A;  2OPR B;  2CPD A;  2KZZ A;  3D7S B;  4X65 J;  4BBY A;  2G13 A;  2IM0 A;  2L3M A;  3D54 A;  4J9O A;  3CMQ A;  5IWA J;  1SC3 B;  2DR6 A;  2K3K A;  4GKJ F;  2HNZ A;  5C7P A;  1WTB A;  2NCK L;  4M5N A;  1KTQ A;  1T05 A;  3MPU B;  3MR7 A;  2DGQ A;  3T1A A;  1S97 A;  3NMA A;  4JI6 F;  3RB0 A;  4WU3 A;  3LTO A;  1JLQ B;  5C24 B;  4OJ3 A;  2WVB A;  4UTG A;  4KO0 B;  5J1E B;  3M2R A;  4KGV B;  3IAS 9;  2NSC A;  3AB4 B;  3K8W A;  2FJD B;  4R8U B;  3ZZU A;  3ZC4 A;  1TL7 A;  1J5O A;  4AD6 A;  3IWX A;  4GVL A;  4USJ C;  1UW4 A;  2ZWO A;  2DEJ A;  2DPI A;  4H4K A;  1GH8 A;  4OHY A;  4YME A;  4LF9 J;  2CQD A;  3CE8 A;  1YRT A;  2O66 A;  4QPX A;  3MM8 B;  1VFJ A;  2FVR A;  4WYW A;  2E5L J;  3M8Q B;  1R0C B;  1I3O B;  2FC9 A;  1ZTT A;  1HNI B;  3K5N A;  2NS1 B;  4KHP J;  2YWF A;  2FIU A;  4Y3C A;  1NZ8 A;  3UE2 A;  2LDI A;  1WI8 A;  4Y2I A;  3NBP B;  2AX1 A;  2QEX S;  3QID A;  2PEH A;  4TKT A;  3HVT B;  1YRU A;  5HJX A;  2C28 A;  1BWV A;  3RAX A;  3EGW B;  3EXY A;  1NDP A;  2VBX A;  2MQQ A;  5HRO B;  3FCW A;  3GJT B;  4OZ2 A;  3JAM Y;  1HBM B;  2EW9 A;  5A76 A;  4DN0 A;  5ITH A;  4OYA A;  1ZTW A;  2QV6 A;  1HBN B;  3D1Q A;  1KWM A;  3K57 A;  4TQR A;  3GR0 A;  1WDD A;  1SKR A;  5ETR A;  2XZD B;  1PCA A;  2LA4 A;  3QAU A;  3ETO A;  2BZ2 A;  3IC1 A;  3HDS A;  2KYX A;  4HLB A;  2QL7 B;  4DV7 F;  3ILL A;  2QIF A;  3KLI B;  1TUG B;  5AT1 B;  2MJN A;  5AJ3 J;  1NDL A;  2CNN B;  1L3U A;  5B0A A;  4DQQ A;  2R2S A;  2DRB A;  3CJ3 A;  4ED0 A;  1JLF A;  4PWU A;  4Z7C A;  1XMO F;  1LNQ A;  3MM7 B;  3PO4 A;  1HLW A;  4IFY B;  4OV1 A;  2J9C A;  4YR0 A;  5KFT A;  1RA6 A;  1WI6 A;  1SL1 A;  3I0S B;  2HHH J;  2MGZ B;  4DR4 J;  2MKS A;  1WC4 A;  4U7C A;  4C8Y A;  1Q1K A;  1XK8 A;  2COL A;  1GK8 A;  4YOE A;  5AXL A;  2BRK A;  3OSP A;  5HAT A;  4PCQ A;  2R7V A;  2ZM6 J;  3QJL A;  1OMS A;  2MKK A;  5E5N A;  3CO0 P;  1S1U A;  3BGR B;  2FZC B;  5H9E K;  4Y0F A;  1SQF A;  2PD1 A;  2B5J B;  4F2S A;  1E6Y B;  1P9Q C;  1X4F A;  2IAJ A;  2D9O A;  4NMX A;  1LW2 B;  1OIA A;  5ETN A;  2LXU A;  3HZG A;  2V8G A;  5I42 A;  2B9Y A;  3TUJ C;  3RB3 A;  3K5O A;  3IGV A;  2U2F A;  3IBW A;  2DHH A;  5F9L A;  3H59 A;  5DO2 A;  1IQT A;  4RUH A;  1JLC B;  1OQ6 A;  1REV A;  3FEY B;  1T8E A;  1X8D A;  1SJ3 P;  2IPO B;  1RWN B;  2W2Q P;  2VPX B;  5KFU A;  3NG8 A;  1F0X A;  2XC9 A;  1XIQ A;  4LRC A;  4LF6 J;  2PEB A;  3UNG C;  1PYO B;  3BEG B;  3OPK A;  5B09 A;  1IBK J;  4BWM A;  5KFI A;  1FEH A;  2HFS A;  4NRU A;  2M8H A;  1RHU B;  3C15 B;  3C6U A;  5FLX U;  1JNZ B;  3CT9 A;  1TMJ A;  3FFI B;  1T9W A;  2OPQ A;  5D0E A;  2BKN A;  2B56 A;  2G2O A;  3OW2 R;  2NYI A;  3NKY A;  2D9P A;  3OTC A;  3QZ8 A;  2UU9 J;  5KOX A;  3KLG B;  3QGP A;  2VL1 A;  4NLG A;  2B7B B;  3C66 A;  4RUA A;  1GTH A;  3MMA B;  3VVU A;  3SQG B;  1OPI A;  2XO7 A;  2KVQ E;  2IIH A;  2Z2Z A;  2XWY A;  1P27 B;  5B0B A;  3POT A;  4EU0 A;  3KNG A;  3T9N A;  2BYC A;  3HVA A;  4P2X A;  1H3D A;  2HHW A;  2BBE A;  3I82 A;  1V6H A;  3K8V A;  3DRR A;  8ATC B;  5KFA A;  3UD5 A;  1LW0 B;  1QAJ A;  1BQM A;  4ZN3 A;  2KB2 A;  3GFH A;  1YJW S;  2PMH A;  3DOM B;  4B3R F;  2ASY A;  2IRU A;  4WFX A;  3KLH A;  2E1M C;  2J7W A;  2ZKT A;  3JQJ A;  1HQE A;  4F3Q A;  3PKY A;  3ILI A;  3CCS S;  4E2F B;  1JQG A;  4AQY F;  1FFW B;  3KFW X;  1FWK A;  2J0Q D;  3G6X A;  4YB1 P;  3ADA C;  1HNV A;  3B78 A;  3TX8 A;  1DBD A;  2CQ0 A;  3CUL A;  1RT2 A;  5A0Y A;  3QWP A;  1U8S A;  4ZCL A;  1TZ0 A;  1YG0 A;  1BHN A;  5U47 A;  2E5I A;  1KLN A;  3P49 B;  1EHW A;  5RUB A;  3J80 U;  2VHG A;  4WXW A;  2F40 A;  3A8I A;  4KC5 A;  2QFJ A;  4JV5 J;  1S6P A;  1R89 A;  2VFS A;  3P45 B;  1ZA2 B;  1OQ3 A;  1OY6 A;  1Q8L A;  2QLW A;  4OHX A;  2MZT A;  1I1G A;  1TUV A;  2ZHA A;  3DFE A;  2HFZ A;  3THV A;  3R5D A;  3DNC A;  2DRA A;  4AT1 B;  1LWC B;  2ZJQ Q;  2ZOF A;  3QRQ A;  1PC5 A;  3Q86 A;  5L9X A;  4DQS A;  2OUG A;  2NSB A;  1PYS B;  5GAE I;  2F8H A;  5DG9 A;  1PJ5 A;  2EPI A;  1F3V A;  1C0U B;  3DOL A;  3RB6 A;  4CLL A;  1RAJ A;  4JI2 F;  2DR8 A;  2G9O A;  5D77 A;  3FSX A;  4JV2 A;  2C22 A;  2FVS A;  3OBI A;  1FCA A;  4N8N A;  2IFX A;  5F8M A;  4A8Q A;  1WHV A;  3DDN A;  3FZ2 A;  4K4W A;  3VAL A;  1Q81 T;  3CDW A;  3BKU A;  4Y2A A;  3HHL A;  3HHL D;  1X5P A;  1ARO P;  1JXE A;  5JMN A;  3PW7 A;  5SZT A;  1HR0 F;  2V8V A;  4UOG A;  2DIU A;  3T6J A;  1P9Y A;  3CJT A;  3ZZ0 A;  2WOM A;  4IG3 A;  3BJY A;  1SUQ B;  2NZ4 A;  2CUY A;  4DV0 F;  1VQ7 S;  2A0F B;  4OI6 A;  4W4M A;  3VAJ A;  3OL7 A;  2AGQ A;  2GCF A;  3NXZ A;  3SSR A;  3AA8 A;  2O3D A;  2Y1J A;  4RW6 A;  3PV8 A;  1Q78 A;  2MQN A;  4B9T A;  5LMN F;  4DV1 F;  3PX6 A;  5DLG A;  4C8L A;  3OTB A;  4MKA A;  4CO1 A;  2V2V A;  3CXC R;  2D1C A;  5HMZ A;  3LAN A;  4HT7 A;  3NS6 A;  1IKV A;  3D0H E;  5L1J A;  2IBK A;  1B99 A;  3LAK A;  4NI2 B;  3C16 A;  3SCK E;  2VFT A;  3J7Y U;  3V6K A;  4U8Y A;  2QA4 S;  3NGS A;  2BE9 B;  1IKX A;  3GCX P;  3DLG A;  5K8M A;  2ATL A;  1SJ1 A;  3NCP A;  3JS9 A;  2HGL A;  5B0G A;  1JKH A;  1U1K A;  2P5V A;  1FTR A;  2XHC A;  2J76 E;  2VB6 A;  1V3Z A;  5DJB A;  4UOC A;  2B51 A;  4Q44 A;  2V0N A;  5DDO C;  1OYD A;  1OSC A;  1WJ9 A;  4KPY A;  2CVE A;  3QAE A;  3R6L B;  1N5Q A;  2K3I A;  1ZPV A;  4RNM A;  3B4D A;  4X4R A;  3MOJ B;  1E6V B;  3H98 A;  2VG5 B;  4J9K A;  4TY8 B;  2RHS B;  2C2R A;  2CJK A;  4TYA A;  4WPA A;  2FC8 A;  4X4S A;  1JJH A;  3MR2 A;  1X4G A;  2DH7 A;  2XLI A;  3UCZ P;  3W9I A;  4NEZ A;  1TQL A;  2DJW A;  2AV5 A;  5FLX Y;  2WSF C;  3BO4 A;  4AL6 A;  1A7G E;  2P6T A;  2E1R A;  3GG0 A;  1YVF A;  3TVK A;  2ZH3 A;  3WX4 A;  3OXG A;  3M05 A;  1TKX B;  3NAI A;  3VGV A;  4ED7 A;  3NWG A;  2EKN A;  2Q79 A;  4OX9 F;  2UUB J;  3ET6 B;  4DLE A;  4AFF A;  1GXL A;  4PG4 A;  1IBM F;  1YWX A;  5D78 A;  4NCG A;  3H42 A;  2DGX A;  1UWA A;  2IC3 A;  2CG8 A;  4FS1 A;  2UUC J;  4PAB A;  2D3O 1;  3D2W A;  5KFK A;  3M6X A;  5A6W A;  2QFI A;  2G0I A;  2DNK A;  3QFW A;  4RW8 B;  3TWZ A;  1Z2L A;  5ETT A;  3GJR B;  4F4A A;  1VMB A;  4UT4 A;  4GC6 A;  5D6G A;  5IT0 A;  1S4E A;  4EMD A;  3V6H A;  2JVR A;  3UDV A;  1BXN A;  1NSP A;  2MB0 B;  5H9F J;  5EWE A;  2L48 A;  3I87 A;  2YNF A;  2ZDP A;  3PNI A;  1CEZ A;  2QRR A;  2BV3 A;  4K59 A;  4AE5 A;  3ZTO A;  3GR1 A;  4FF1 A;  1UL3 A;  4DR3 F;  1HNZ J;  1YJV A;  4P2M A;  2UP1 A;  2VIH A;  1HQ2 A;  3SCI E;  3MEE A;  4DV4 F;  2HS3 A;  1F1B B;  1CJV B;  2BAB A;  3EVO A;  3HFZ B;  2ATC B;  4CLK A;  2DR5 A;  3J80 Y;  2HHX A;  3IGN A;  2DHX A;  4WK1 A;  3CJS A;  1LWE B;  1EET A;  5IT9 U;  1UTA A;  3SZ2 A;  4DQR A;  1NKE A;  3EPG A;  4UUX A;  3LW5 C;  2DBB A;  2GAG C;  2NXN A;  2WAQ D;  4I6Y A;  2EEY A;  2YKN B;  3T5H A;  1FRM A;  1H2T Z;  1TV6 B;  3ZXW A;  3HJV A;  3MM8 A;  4F4Y A;  2BMB A;  1JXL A;  4DSI A;  4WZM A;  3QIP A;  4DG1 A;  4IG0 A;  1YLX A;  1UWB B;  3CMA S;  5F0W A;  4ZIT A;  3CCQ S;  2YX7 A;  2RML A;  3DLK B;  3O1L A;  5C25 A;  1S59 A;  3CPW R;  1N52 B;  3D4J A;  3FMB A;  1WHW A;  1WAC A;  4PG7 A;  4R0J A;  1CJT A;  5D0G A;  1UVI A;  5E3P A;  3DLB A;  3QO9 B;  1EQM A;  3DHX A;  1K1S A;  3VZH A;  1U2F A;  3QJP A;  4LVN P;  6AT1 B;  2CQ2 A;  2Y0B B;  4ZIV A;  3DYA B;  4ZPW R;  3RU0 A;  2CZ4 A;  3X3U A;  3TA2 A;  3T5J A;  4DBQ A;  4JI7 F;  1S1W A;  3VWS A;  1N56 A;  1VQ8 S;  1QSL A;  3OQ2 A;  2IM1 A;  3GIL A;  4H4M A;  4Z2X A;  2HW3 A;  1BY9 A;  2XMJ A;  1KOH A;  2MLZ A;  3ZFV A;  4FYD A;  3BQ2 A;  4PWW A;  4DS4 A;  5BR8 J;  2BKP A;  2CAD A;  1SJQ A;  5J1N A;  3CJR A;  3IG1 B;  4ZLJ A;  2BJ9 A;  3V81 A;  2ASJ A;  4EYH B;  4U96 A;  5EWF A;  2MZS A;  1JXV A;  5HP1 A;  3CJK B;  3UVJ A;  3MHY A;  3ZZO A;  3ZNU A;  1IQZ A;  1N48 A;  2H5E A;  4HYK A;  2GQQ A;  1S9G B;  1GT8 A;  2VC1 A;  1IBL J;  4K0K F;  1RE1 B;  2ZNZ A;  3LP2 B;  2CIM A;  1VC0 A;  1EIY B;  4HAC A;  4LSN B;  4ETZ A;  2W4D A;  2B0G A;  1NRK A;  3VF0 B;  1VR6 A;  3HVR A;  2AWZ A;  2LKZ A;  2HVD A;  1AZS B;  4NLD A;  5DGB A;  1HNX J;  1U0H B;  4OJ1 A;  4YB7 A;  1T03 A;  1RT7 A;  1TK5 A;  2FLP A;  1C1C B;  1FX4 A;  2EFG A;  2VKZ G;  3OSN A;  4ECR A;  1KTV A;  3ZTS A;  2FTR A;  4N5S A;  4DDF A;  4F67 A;  2LXF A;  3H8Y A;  3QGG A;  1UJ4 A;  2H4Y B;  3HCX A;  4X2B A;  4BWJ A;  2Q3P A;  3LGH A;  3NL0 A;  4OZ3 A;  4CIO A;  1VQM S;  3W60 A;  1EQ0 A;  1WC1 A;  2DNP A;  4LRD A;  1RLC L;  2F9J A;  3EZU A;  2W9A A;  2BM0 A;  1V3S A;  2MKJ A;  1FDD A;  2IMW P;  3G8T A;  2EBG A;  5A8K A;  1S48 A;  3GON A;  1UJ5 A;  1PKU A;  3KLF B;  2V9W A;  1S0O A;  4PUO A;  2V4J A;  1UKU A;  2AF6 A;  1DTT A;  4L72 B;  5KFB A;  5KFW A;  2PFD A;  4ECW A;  3KK3 B;  1SC6 A;  4OHV A;  3AH6 A;  3EUN A;  1GMU A;  2VUG A;  5JXS A;  1X7V A;  4HTI A;  2HZA A;  1WSR A;  4ECT A;  1BD6 A;  2RIJ A;  4DFP A;  2FHJ A;  2FHJ D;  2RS2 A;  3KDO A;  1FKP B;  4R5P A;  2GGP B;  2YKM A;  3N9U C;  2DIT A;  2KRR A;  1ZBT A;  4ILM A;  3LP1 B;  4NLP A;  1YBT A;  4USK A;  1GMV A;  3RB4 A;  1SI9 A;  4LUB A;  4M5H A;  3PYG A;  4CLY A;  4I67 A;  3RR7 A;  2AYB A;  1SQE A;  1LOU A;  1FRL A;  4K4T A;  3D6T B;  4F4K A;  1AFJ A;  2PSZ A;  3FBB A;  3FKB A;  5A6P A;  4CLW A;  3I6P A;  4Q0B A;  1RTI B;  1T3N A;  4WE1 B;  1B3T A;  3ENA A;  1RBA A;  1FVS A;  4ZPB A;  1XR6 A;  5K8N A;  3R5G A;  4D3G A;  4XPE A;  1SC4 B;  4B9V A;  3BDE A;  3C6T A;  5DQI A;  4FKX A;  2BE2 B;  2W7P A;  2YX1 A;  3DI6 A;  1H72 C;  3NNA A;  1S9E B;  3C46 A;  2N82 B;  2OJ3 A;  4PQU A;  2I9S A;  1UEK A;  3FNN A;  3IN5 A;  3K5P A;  2RAQ A;  3IM8 A;  3MCS A;  1TKT A;  1C1B A;  4YB5 A;  2O5D A;  1RAH B;  3WIV A;  2GJ2 A;  4F36 A;  2MKH A;  4DR5 F;  1NDC A;  4ECZ A;  4OYI A;  3SV3 A;  1WG5 A;  3T1Y F;  1FE4 A;  3QAT A;  1M5H A;  4CLU A;  3NY0 A;  1RYR A;  3BGF A;  3C14 A;  4EK2 A;  1N6Q A;  4DCP B;  4H4O A;  3CJ0 A;  2ZH5 A;  2R7U A;  3VTI A;  4X66 F;  4ED4 A;  3FRY A;  3OJU A;  2BOA A;  1X4H A;  3KJQ B;  6FDR A;  4ER8 A;  2R8G A;  3TRG A;  1UZD A;  1KVK A;  1D9A A;  3V6D B;  4OHW A;  2W2O P;  1NND A;  2G4B A;  1EX8 A;  3OTD A;  2Q1L A;  1YI2 S;  1Y3K A;  2PT0 A;  4JI4 J;  3HLU A;  1PIE A;  4OYW A;  2VFR A;  2C3Y A;  4QPT A;  3M1V A;  4Q7A A;  4DR7 J;  3BQ1 A;  1UVN A;  1JLA B;  2OP5 A;  3TAM B;  3DGP A;  4K2J A;  1TAQ A;  1N33 F;  4KQZ A;  2WVF A;  5CYQ B;  2YNG B;  4MIA A;  4AXI A;  4C3L A;  4YDX A;  3X1L B;  3W2V A;  2ZH2 A;  2JOQ A;  3T6B A;  2DNO A;  2UXC J;  3EYZ A;  3AAW B;  3V2U C;  3EMT A;  4OJG A;  4C48 A;  2P9E A;  1YDL A;  4TVA B;  2C3U A;  2QSF A;  5J2M A;  4F04 B;  2F8M A;  2FHO B;  2E9T A;  1KNZ A;  1QD1 A;  2AW0 A;  3EM1 A;  2JLF A;  3H2U B;  1UET A;  4O3O A;  4M5K A;  5KG5 A;  2XWX A;  3ZTP A;  4XPC A;  1RTD A;  2F4V F;  5CXT A;  4ECU A;  1CUL A;  4DX8 H;  1D9D A;  4C3M A;  5F9N A;  1IR0 A;  4ZCM A;  4ELV A;  3KHL A;  1HA1 A;  2FJE B;  3UR3 C;  4WXO A;  2YWW A;  2HG4 A;  4OLP A;  2FVC A;  2W9C B;  3TEH B;  2DGW A;  5IM0 B;  3OXF A;  1RGV A;  1CS4 A;  5KFF A;  4TN2 A;  1BGX T;  3BKT A;  3PFO A;  3F41 A;  2QG9 B;  2JWN A;  2XBP A;  3OL9 A;  2ASD A;  4U7U K;  2C1E B;  2DH9 A;  2M9K A;  1M0S A;  2ZD1 B;  4ZVQ B;  4NCA A;  2DH8 A;  1PBU A;  3B6B A;  1UEV A;  1FT8 A;  1UFW A;  3NP5 A;  3SFU A;  4FF4 A;  1KQG B;  2BJD A;  2E44 A;  5KG7 A;  2WTF A;  4IQM A;  1EZZ B;  4DJB A;  2VKR A;  3F56 A;  3JTP A;  2PA8 D;  2RDD A;  3QSY B;  1JWW A;  2F1F A;  4KGM A;  2CJA A;  1VQN S;  3MEC B;  4IH7 A;  5CCL A;  3BYP A;  3TAP A;  1FJE B;  2DO4 A;  3AFG A;  3JTN A;  3ZZR A;  4A47 A;  2GNK A;  2NUH A;  4RNH A;  5L9N A;  2X1B A;  2RT3 A;  1R43 A;  3LF0 A;  5HMW A;  2NQP A;  5LOQ A;  3ELH A;  2GVD B;  3KJF B;  3LH2 S;  1GEH A;  3QYY A;  1IKW B;  1RSC A;  3BBB A;  2DXE A;  4I68 A;  3LUY A;  3CCL S;  3QLH A;  3UQS A;  4C0B A;  2LP4 A;  4DV6 J;  3OT9 A;  3HT3 A;  2VIC A;  2KHD A;  3KXD A;  4CH0 S;  2E7W A;  4NXM J;  3DRP B;  4B02 A;  3M2U B;  3ISN D;  4ICL A;  4RW4 A;  2MSS A;  4OZ5 A;  3NS7 B;  3H5Y A;  2QYG A;  3QT8 A;  2IJN A;  2FGC A;  3ULH A;  2VFU A;  2M3D A;  4Q43 A;  1K73 T;  3MXH P;  1EKS A;  4PXB A;  4JI8 F;  3TW0 A;  3WDO A;  1RT3 A;  1CJK A;  3NMR A;  1U0S A;  2DGS A;  2IDE A;  3I9V 9;  4RWX A;  1JK9 B;  3J7Z T;  2QE5 A;  5KOW A;  4JP8 A;  3MCO A;  4RNN A;  3R27 A;  5KT6 A;  3IBC B;  2V50 A;  2RRB A;  4I7F B;  2CQ4 A;  3IFE A;  2JH3 A;  4HTJ A;  2VOD A;  4CM2 A;  4F02 A;  5C42 A;  4A8S A;  4IQX A;  1YKW A;  1XR7 A;  2HND B;  1WOS A;  3TA0 A;  3AT1 B;  2G1H A;  1DY3 A;  3D1O A;  4RR5 A;  2BAN B;  2J7U A;  2GMJ A;  4ELU A;  3T19 A;  1KR4 A;  5C5J A;  1UA1 A;  1WF2 A;  4PG8 A;  2R7O A;  5IS2 A;  4CRJ A;  1MMD A;  2MEW A;  2W4C A;  5F8J A;  4K4V A;  4G1Q A;  3GZ7 A;  1TMM A;  1HNW J;  4EGL A;  3EGZ A;  1CG2 A;  4LSL B;  4LJM A;  3NLC A;  1S79 A;  4CDI A;  3GIJ A;  4A48 A;  3LAM A;  4LRA A;  2BJ7 A;  1RBO B;  1S6Q B;  4KFB A;  5KFV A;  3UO0 A;  4PWD B;  3VAF A;  4NA3 A;  3SSQ A;  5AXM A;  2Q43 A;  1QUV A;  1HL6 A;  3BSO A;  2R4F A;  2WVD A;  3J7A N;  2Y3Y A;  2MDA A;  4I2P A;  4WKY A;  2EG1 A;  4QJV A;  4N77 A;  1NB7 A;  1M1G A;  3Q2S C;  1N32 J;  3OFE A;  2MQP A;  3U1N A;  3AB2 B;  4ZPD A;  2GVZ A;  4O44 B;  2ZOM A;  1ZA1 B;  3A8J A;  1G4C A;  2E1A A;  1FTC A;  2LU1 A;  3A4T A;  4ZVH A;  5I3U A;  2GQ2 A;  3R5A A;  1DLO A;  3SFG A;  1RK8 A;  3DKD A;  3KK1 A;  1V5I B;  2Y1L B;  3HD2 A;  4BHQ A;  1RTH B;  2YWH A;  2HVE A;  1VOM A;  1RCO B;  4LF4 F;  4DV2 F;  1VS3 A;  2QO3 A;  4OI3 A;  2A18 A;  4KJI A;  4X84 A;  4ID8 A;  2VA3 A;  1R6V A;  1M5S A;  4B9U A;  4TY9 A;  2RSQ A;  2OH2 A;  2VAS A;  5DS7 A;  3MM9 B;  4RLE A;  3PEJ A;  1MG7 A;  1N5S A;  5GME A;  4X4P A;  3Q89 A;  1MMN A;  1U8W A;  2D3Z A;  2A2C A;  4PYA A;  3BO2 A;  4WIQ A;  2XSJ B;  4M63 A;  2VH7 A;  3OR1 A;  1M1H A;  4B3M F;  5EUH A;  3Q24 A;  2KVI A;  1S0M A;  3VGT A;  2M7S A;  3EVM A;  5JVH Q;  1PAE X;  1TKD A;  3IM9 A;  2K8G A;  3OFF A;  2Z0G A;  2R2U A;  1YHQ S;  2HNZ B;  4IDK A;  2C2O B;  2DIS A;  1U26 A;  1J5E F;  4F8R A;  1U25 A;  3CWJ A;  2UXB J;  1T05 B;  4DF4 A;  3LGN A;  4QYZ J;  3I0R A;  3DDK A;  4CLT A;  1R6Y A;  1RHK B;  3MUM P;  2MXY A;  5GAG I;  2XMW A;  2J6U A;  3EVW A;  4U8V A;  3ENQ A;  4XIU A;  1R0B G;  1N4L A;  4WP9 A;  3M2R B;  2J0S D;  2E66 A;  4YS2 A;  2KI2 A;  5KFP A;  4PXC A;  1I94 F;  4MJK A;  4YN3 B;  4F7V A;  1TL7 B;  1U1N A;  3TVZ A;  1J5O B;  5GAH I;  4Y2C A;  4FKY A;  1VBK A;  5IV4 A;  5M2R A;  4CO4 A;  4F4W A;  3TAN A;  3PHE A;  1N34 F;  1J27 A;  2PMZ D;  4HEA 9;  2XY6 A;  4DL2 A;  2BX6 A;  4PRF A;  3EX7 B;  2VQE J;  4LR8 A;  4FVM A;  3D67 A;  3O8W A;  1VK3 A;  5MLC V;  3NCQ A;  3I96 A;  3MD1 A;  4HKQ A;  1KVI A;  2BJ3 A;  3JQM A;  2KT2 A;  3UCG A;  1UVJ A;  4GKJ J;  3D1H A;  1XMQ F;  4W90 B;  2EC2 A;  3HZE A;  3CD0 A;  2XLJ A;  4ZOS A;  2M52 A;  2R9L A;  4PXD A;  2Y1I A;  1QSY A;  2AJF E;  3BH7 B;  4JI6 J;  2YX4 A;  3R2C J;  4MK9 A;  3UW1 A;  4QOT A;  3DC2 A;  3CGI A;  2FLL A;  3H25 A;  4ZVS B;  1P1T A;  1URR A;  3ZTR A;  3EPI A;  4DL0 C;  1P1L A;  4KGK A;  2E1C A;  1T95 A;  3MAQ A;  4NLQ A;  2C3M A;  2VG6 A;  4OI4 A;  4B08 A;  3DXS X;  2HBR B;  2V94 A;  4AL7 A;  1OS5 A;  3HSJ A;  4PYD A;  1XMB A;  2NRE A;  2AKW B;  3AD7 C;  1PAU B;  1SH2 A;  2OML A;  4OX8 A;  1JLG A;  5HLF A;  1JLF B;  1N54 B;  3BRE A;  5DM7 Q;  1WDT A;  4G65 A;  4RW7 A;  3BBC A;  2HPU A;  1R0A A;  1Q0N A;  2J7K A;  2HIQ A;  5CAB A;  1HIY A;  5KFL A;  1S1V A;  4OJH A;  2MQL A;  4J9Q A;  1KQS R;  4KHR A;  4EBE A;  2EFV A;  2M2B A;  1C4C A;  1FKO A;  2DHA A;  4JI3 F;  4WE1 A;  1QDU B;  3L3C A;  1VRU A;  1NCL A;  1CVJ A;  5IC6 B;  2ZC3 A;  1M5V C;  2HKE A;  4ZHR A;  5L1I A;  5KG4 A;  4FP9 A;  3S01 A;  4DZD A;  2W7O A;  1Q5Y A;  3PIO Q;  5AXK A;  5HAN A;  1GX5 A;  4GC7 A;  1S1U B;  2R7T A;  3GMG A;  2QLB B;  5LL6 d;  1JLE A;  5KT2 A;  1MRO A;  2IAJ B;  3VAK A;  1GX6 A;  4KH1 B;  3IWN C;  1IKY A;  5GAD I;  1RAG B;  5I42 B;  4ZP7 A;  3K7R A;  4C8M A;  4ECV A;  4F4X A;  1ZS6 A;  2WCX A;  1QAI A;  1SH3 A;  3T5K A;  4ID5 A;  1NSK L;  3T41 A;  3GYN A;  1RBL A;  2HMI A;  4MH8 A;  4EYI B;  1I5O B;  5J1P A;  4DV7 J;  1REV B;  4JYA F;  1A0O B;  1KLM B;  4OX7 A;  2VF3 A;  4X62 F;  1XMO J;  4DV5 F;  2MLY A;  4FNH A;  4F2R A;  4J9R A;  2K1R A;  2JJ4 D;  1TR0 A;  2BW2 A;  5DM6 Q;  1TTH B;  4C3K A;  5FDL A;  3SIP B;  4Q2L A;  1XER A;  2YQ0 A;  3C6U B;  4PR6 A;  5HJY A;  4QWC A;  2OPQ B;  1U02 A;  2AYM A;  3ONQ A;  4B3S F;  3M30 A;  2UXD F;  3KKF A;  2I5J A;  5K5M A;  4RX6 A;  5AE1 A;  4XTT A;  1U24 A;  3BGO P;  1WC0 A;  3POT B;  3BN7 A;  2J8S A;  4NLX A;  4ZVG A;  3R5C A;  3DRR B;  1IXK A;  2A3J A;  1MSW D;  1BQM B;  3P96 A;  1XNR F;  1S0V A;  2KXN B;  2ZBQ A;  2XZT B;  4C8O A;  3RW7 A;  3M8S A;  2EC0 A;  3SMZ A;  2Z4P A;  5ADZ A;  2WW8 A;  3KLH B;  1HD1 A;  4IH6 A;  2FLN A;  4FYW B;  4H54 A;  2HFV A;  2IMO A;  2D69 A;  1HQE B;  4WTY A;  1QE1 A;  5HSP A;  3E3X A;  2K2P A;  5F8G A;  5L1L A;  1AT1 B;  2AHO B;  4USM A;  1S1T A;  4QIG A;  1QJH A;  4OL8 A;  5KTQ A;  3BDP A;  2AJ0 A;  1JJ4 A;  2RQM A;  3MAA A;  2ZZM A;  1HNV B;  2V9K A;  5EWG A;  3J81 j;  4Q8F A;  2G2Z A;  3THT A;  2IM2 A;  1PYT A;  4F0K A;  2HGN A;  3H0P A;  2RDI A;  3IAM 9;  2GIQ A;  1RT2 B;  5A0Y B;  5G0R B;  2DO0 A;  4LBI A;  1FJG F;  3GCW P;  4KRW A;  3JYT A;  2HRU A;  2IA6 A;  3I55 S;  4IRD A;  4B3T F;  4P75 A;  2CNK B;  1RIS A;  2AGP A;  1KRP A;  4F26 A;  2RF2 A;  1H73 A;  1PSD A;  5DQG A;  4HDH A;  5HMX A;  3EXC X;  1KHW A;  4ALZ A;  1S6P B;  3BM7 A;  4ZJL A;  3TX0 A;  2JLE A;  2RU9 A;  1QY7 A;  4JI0 F;  4V19 J;  3D3B J;  4ZP9 A;  2FQQ B;  1T9U A;  4ECQ A;  4C4W A;  4B3R J;  5L39 A;  3J81 U;  1X5O A;  4LT6 A;  2BAC A;  1CC7 A;  2BQ3 A;  4IOC Q;  4DPO A;  1KD1 T;  2JDJ A;  2JX2 A;  2QYC A;  3RBX A;  1Q8K A;  4FNI A;  3DOL B;  4AQY J;  2E5H A;  4RNF A;  2GX8 A;  3B82 A;  1WWH A;  1VIS A;  4KSE B;  2IY5 B;  4MTP A;  4X4Q A;  1FRK A;  3GFX A;  3DOK A;  2I6W A;  4YDD B;  3A3N B;  2IVF B;  1WG1 A;  2KJW A;  2CJ9 A;  2Z8Q A;  1YBU A;  4YY3 F;  1VBX A;  2G2Y A;  4L3N A;  1SCJ B;  1QM9 A;  4A8W A;  4QIE A;  3TVY A;  3HHL B;  1HHQ A;  1BQX A;  3OTE A;  3HPO A;  4OHZ A;  2YH0 A;  3UWT A;  3CCM S;  2HWH A;  3O44 A;  1VHF A;  4Q2M A;  2CXE A;  1H2V Z;  2P2C B;  2D3O R;  3JQK A;  3N5B A;  1ZM4 A;  4DLG A;  3GYX B;  3HI9 A;  2DTJ A;  2NXE A;  2WOM B;  4IG3 B;  4QWA A;  3IBF B;  3PJW A;  2LQJ A;  2B3T B;  2V4R A;  4LF2 A;  4YHH F;  5ETK A;  2C3O A;  2FJB B;  3HO1 A;  4QR1 A;  2XB2 D;  4EFA C;  3JXO A;  4RW6 B;  2FZG B;  4OMF G;  1LXJ A;  1X0F A;  1SV5 A;  4DUY F;  3L7U A;  4LIR A;  1PJ6 A;  2KJV A;  4CTA A;  4DPU A;  3IR6 B;  4RJV A;  2VU5 A;  1UPP A;  1YZ6 A;  2ZH6 A;  1DQ8 A;  1IKV B;  3PYF A;  5LT5 A;  4ED6 A;  1KFS A;  3PVX A;  2AZ1 A;  2B7C B;  1C0T A;  4JI2 J;  3C16 B;  2J0W A;  2I1R A;  4P2S A;  5EDW A;  1IKX B;  1QSS A;  1WC3 A;  3DLG B;  1RAA B;  4KV8 A;  2YKQ A;  2DY1 A;  1JKH B;  3FBC A;  2UV8 G;  3TZW A;  2DIV A;  3AJ1 A;  3W5Y A;  4PWD A;  2CDQ A;  1UP1 A;  1HR0 J;  1MWZ A;  2ZE2 A;  2QN6 B;  5CAA A;  2H5I B;  2ILZ A;  2IHR 1;  1RHJ B;  2HGM A;  2AGO A;  2PC6 A;  4C97 A;  3AHP A;  1WEY A;  3GJQ B;  1IJF B;  4DV0 J;  4J9P A;  4UF4 A;  1MWQ A;  1NK7 A;  4S0M A;  2VV5 A;  2WW4 A;  1NSA A;  2GW8 A;  4EWT A;  2DGT A;  3Q8V A;  3G8S A;  2I2Y A;  4Q45 A;  3CIZ A;  3H40 A;  1UVK A;  1RHQ B;  2JEJ A;  4PXE A;  3L09 A;  5LMN J;  2JEF A;  4DV1 J;  1PGZ A;  5HN0 A;  9ATC B;  2I38 A;  1HQU A;  2VOP A;  4NZ7 A;  4JI1 F;  3HMJ G;  4G1P A;  3H90 A;  3CD5 A;  1NZA A;  3BBF A;  3RG6 A;  1Y3J A;  3H4D A;  4NCG B;  2PE8 A;  3OHB A;  4NEY A;  2IC3 B;  3C19 A;  1S76 D;  2FJX A;  2HIY A;  1R27 B;  1L3T A;  2OEK A;  4ZMM A;  2XI3 A;  1F5C A;  1UFL A;  2A6M A;  1HBO A;  3FK4 A;  5KFR A;  3TR5 A;  3HX9 A;  4OIX A;  4TXS A;  3RZA A;  2OMO A;  4J37 A;  2AEM A;  4ZA1 A;  4KT0 C;  3R1L A;  1R3N A;  2AYG A;  5L38 A;  2QZ8 A;  5DDQ C;  3NCR A;  3FBF A;  2YNF B;  2HQG A;  2BA9 A;  5DET A;  2WRM A;  4ANC A;  4DUZ F;  1ZM3 A;  3PHT A;  4K50 A;  1FRI A;  4FYY B;  3MED A;  3AJD A;  4UQG A;  1KFD A;  2X1F A;  3MEE B;  1DTQ A;  2GJF A;  1RT5 A;  1NK8 A;  2ZBC A;  1FXL A;  2HS4 A;  2XMT A;  2OD6 A;  5EGY A;  2XY5 A;  3MDF A;  1EET B;  2XI2 A;  3BSC A;  1RT6 A;  4OX9 J;  1I6J A;  2ZIT A;  3AJ2 A;  2AT1 B;  3US5 A;  1IBM J;  2POK A;  2XGQ A;  1X60 A;  3QT5 A;  3M4X A;  2H5J B;  4L75 A;  3DLL Q;  3QIP B;  4ZCK A;  4DG1 B;  3JSY A;  4IG0 B;  3J81 Y;  2LA6 A;  4NLU A;  4WP8 A;  5D4P A;  1N5Y A;  4C8K A;  3AD9 C;  5HQL A;  3LOU A;  5B0C A;  2FUG 9;  1HBU A;  5D4N A;  3HXM A;  2H4W B;  4P9S A;  5J2N A;  5C25 B;  4UOF A;  5GMK a;  1PG5 B;  2CRL A;  2HZC A;  2FZK B;  1MML A;  5LSL A;  1CJT B;  1ZM9 A;  3KLE A;  3IMQ J;  1X4E A;  3RGI A;  1JB0 C;  3IWL A;  3KHG A;  4DR3 J;  3AOD A;  1YTY A;  1K1Q A;  1QLN A;  1HWU A;  1DUR A;  4DV4 J;  1NAQ A;  1S1W B;  2P9C A;  3G71 S;  5HI7 A;  1X5T A;  4F0M A;  4H4M B;  5KFX A;  3NOC A;  4DQI A;  3V4I A;  1XJW B;  4N47 A;  2YVS A;  5FD1 A;  3E51 A;  4O4R A;  2GMH A;  1KON A;  3HSD A;  4C98 A;  4P10 A;  1WC6 A;  3V81 B;  3L9Z A;  5C2C A;  4LFA F;  2WSE C;  2XS5 A;  4A8F A;  2FY1 A;  3BO3 A;  3KUE A;  5HP1 B;  3UVJ B;  1EAY C;  3PO5 A;  4DU8 A;  3KG0 A;  4QIF A;  2VDH A;  2AQ4 A;  2C2M B;  4FXW A;  3DLH A;  4DCJ B;  2V8H A;  3CO9 A;  3PX4 A;  4QIV A;  4X64 F;  1GMW A;  3TNV A;  4HAC B;  1ITP A;  3D68 A;  3QSI A;  3CUN A;  2RQC A;  2PII A;  2XNQ A;  2QA1 A;  3M8P A;  1N5V A;  3R5B A;  3DGV A;  2CPH A;  2CWK A;  3IA0 A;  2VBW A;  2AU0 A;  3OXL A;  1T03 B;  1RT7 B;  5IOL A;  1VQ6 S;  4ZCI A;  4M94 A;  4OZN A;  3P6Y C;  1WOP A;  4QYR A;  4HI1 A;  5CYJ A;  5KFG A;  4N76 A;  4JI7 J;  4E8U A;  2HNY A;  2YH1 A;  2BM1 A;  3VR1 A;  1T7P A;  1GNK A;  4KIA A;  2ASL A;  4XAK A;  1LK7 A;  2KL8 A;  3NNC A;  1ROF A;  2LCW A;  1M1K T;  1KLM A;  3GFY A;  2HHS A;  4UUW A;  2EFP A;  2QLJ B;  2XNR A;  2NXJ A;  1KN6 A;  1RI7 A;  4UZB A;  2WZ1 A;  1AA1 B;  4J7C A;  5A8K B;  2R7Q A;  3W7B A;  2ZUG A;  4V19 X;  2YQ3 A;  2EFO A;  3GSI A;  3HF5 A;  4I64 A;  4WK3 A;  3DDI A;  3OTO F;  4PUO B; 
#chains in the Genus database with same CATH homology
 1NLK L;  4ANE A;  3FC9 A;  4FKY A;  1LEO A;  2DXD A;  2DY9 A;  3VGU A;  2CWK A;  3ZTQ A;  5C7P A;  3NGU A;  4W98 A;  2NCK L;  4F4A A;  4CP5 A;  3G2X A;  4WBF A;  2B8Q A;  3Q89 A;  1XIQ A;  1S5Z A;  3Q86 A;  1JXV A;  1U8W A;  3BBF A;  3PRV A;  3EM1 A;  1NDP A;  1ZS6 A;  3EE3 A;  5IOL A;  4ENO A;  1HHQ A;  3VGS A;  1NSK L;  1WKL A;  1K44 A;  1BUX A;  1NSP A;  3VVT A;  2BX6 A;  4AND A;  4EK2 A;  4KPC A;  3ZTP A;  3FBC A;  3FCV A;  3FCW A;  4UOH A;  3FBB A;  3FKB A;  1UCN A;  3EIC A;  3MPD A;  3Q8U A;  3VGT A;  1NUE A;  1S59 A;  3GPA A;  3Q8Y A;  3EVM A;  1F3F A;  1LWX A;  3Q83 A;  1VYA A;  1PAE X;  1WKJ A;  3BBC A;  4O0N A;  1PKU A;  3ZTO A;  1BE4 A;  4DUT A;  5CAB A;  3ENA A;  3FBE A;  3NGT A;  2B8P A;  3ELH A;  1HIY A;  5CAA A;  1F6T A;  3PJ9 A;  3VGV A;  5BXI A;  1B99 A;  1W7W A;  3WX8 A;  2AZ3 A;  3NGR A;  2ZUA A;  3R9L A;  1BHN A;  3BBB A;  2DXE A;  4HR2 A;  1NHK L;  2HVD A;  4FKX A;  3NGS A;  3EVO A;  3VVU A;  1EHW A;  3BH6 B;  1B4S A;  1NB2 A;  1NCL A;  4DI6 A;  2BEF A;  3ETM A;  3DKD A;  4S0M A;  2DYA A;  1S57 A;  3JS9 A;  3L7U A;  1XQI A;  3EJM A;  1NDL A;  3FBF A;  1NPK A;  3EVW A;  3Q8V A;  4DZ6 A;  2HVE A;  3BH7 B;  1MN9 A;  2VU5 A;  3ZTS A;  1MN7 A;  4UOG A;  3B54 A;  1NSQ A;  4C6A A;  4UOF A;  4ANC A;  2HUR A;  3GP9 A;  1NDK A;  1HLW A;  3B6B A;  2AZ1 A;  2DXF A;  3DDI A;  1WKK A;  4F36 A;  3EMT A;  1KDN A;  1NDC A;  3ZTR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...