4FKYA

Crystal structure of nucleoside diphosphate kinase b from trypanosoma brucei bound to gtp
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
152
structure length
152
Chain Sequence
MPSERTFIAVKPDGVQRNLVGEIIKRFENKGYKLVGLKLLQPTEEQAKQHYIDLASKPFYSGLVSYFSSGPIVGMVWEGLGVVKGGRVLLGATNPADSLPGTIRGDFAVDVGRNVCHGSDSVESAKREIAFWFKAEELVSWTSHSVKQIYER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
publication title Crystal structure of nucleoside diphosphate kinase B from Trypanosma brucei bound to GTP
rcsb
source organism Trypanosoma brucei brucei
total genus 46
structure length 152
sequence length 152
chains with identical sequence B, C
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2012-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 4fkyA00
3B54A 3EICA 3NGTA 2HURA 3VVUA 3ZTRA 2DY9A 3FBCA 3FCVA 1LEOA 1MN9A 1JXVA 1U8WA 5CAAA 3ZTQA 4O0NA 2HVDA 3Q8VA 3G2XA 1XIQA 1WKKA 3VGVA 3WX8A 1WKLA 1B99A 1HHQA 1XQIA 1NUEA 1W7WA 1NSPA 5IOLA 4DZ6A 3BH7B 4S0MA 4ENOA 4FKYA 1S59A 5C7PA 1K44A 2DYAA 2CWKA 4DI6A 3VGSA 3ZTSA 4ANEA 2VU5A 1BHNA 3JS9A 4DUTA 2ZUAA 1HIYA 1LWXA 3FCWA 1NPKA 3Q83A 3DKDA 3EJMA 4EK2A 3EM1A 1F6TA 3FBBA 1BUXA 4HR2A 1ZS6A 2AZ1A 1NDKA 3ENAA 4F36A 3Q89A 2NCKL 3DDIA 4ANCA 3BH6B 3EMTA 3B6BA 2DXDA 1F3FA 3ZTOA 1NCLA 1NSKL 3VVTA 3ZTPA 3PJ9A 4CP5A 3NGSA 4ANDA 4FKXA 3Q8YA 3ETMA 1S57A 1UCNA 1NB2A 3GP9A 3R9LA 3VGUA 3MPDA 4W98A 1NDCA 2BEFA 3BBCA 1EHWA 3GPAA 3PRVA 1S5ZA 3BBFA 3EVOA 3Q8UA 5CABA 3FBFA 1B4SA 1NDLA 4F4AA 3NGRA 2HVEA 3FKBA 4WBFA 4UOFA 1WKJA 2B8QA 3VGTA 5BXIA 1NSQA 4C6AA 3EE3A 1NLKL 1NHKL 3BBBA 4KPCA 1BE4A 3EVMA 2BX6A 2AZ3A 3L7UA 3Q86A 1PKUA 3ELHA 4UOGA 3FC9A 3FBEA 3NGUA 1MN7A 1NDPA 1PAEX 1KDNA 1VYAA 2DXEA 2B8PA 2DXFA 1HLWA 4UOHA 3EVWA
chains in the Genus database with same CATH superfamily
2GGPA 2KDOA 4D3GA 4PUOA 1S9GA 1NK7A 2GQ2A 1VK8A 1LW2B 4WYLA 2H1YA 1UPPA 2DCUB 1HMVA 5B0FA 2MTLA 1JLCA 1VHFA 2DRDA 3NNAA 2HZAA 2EFGA 3W8GA 1U6BA 3JQJA 4KFBA 3R6LB 2JC0A 1R8BA 3ILLA 2ZE2B 4YR0A 3LWLA 3W63A 4WKRA 4DCOB 5BR8J 5KFTA 3UPFA 4QWAA 4B3OA 3NCQA 2NXEA 1ZAXA 2AYGA 2VQEJ 2DHXA 2W01A 5A2QU 4Y00A 2FVPA 1U02A 1OY9A 3U1LA 3UR0A 1TL1B 3RW6A 3DRPB 2JH3A 4WTOB 3KDOA 1LW0A 1PKUA 2V5HG 5BR8F 1SJ1A 2AHOB 1ZAWA 3M32B 2OELA 4NZ6A 1VYAA 4Q2LA 3VVUA 1HBNA 3DYAA 2LEAA 4K50A 5CAAA 2PFFB 4F0KA 3X1LB 3QT8A 2CVIA 2DHHA 4RKUC 4EGLA 4K4UA 4IOCQ 2V6AA 4K4WA 3HT0A 2PO4A 1GTEA 1R7IA 4KY3A 1AUDA 2VU5A 4RNOA 2BYCA 2F5GA 3R8YA 1WC4A 3E3XA 3EJMA 3FVYA 1Y7PA 3DRXA 2QRRA 2AJ1A 4KYZA 2W9AA 2X1FA 4P75A 3TAMA 2LEPA 3DRYA 1JLFA 1YRXA 3DLEA 2JLGA 1NZAA 4RW9B 3MCNA 3HM9A 1VQYA 4LF6J 4X2BA 5LL6d 3G87A 1C0TA 5KG0A 5H9FK 4I1TA 1AYEA 2MLXA 2FLOA 3OSNA 2B3TB 1CSJA 2WVBA 3ZZYA 4MYUA 3PFEA 4QYRA 1T03B 1H6KX 2V4RA 1DZ5A 1BQMA 3NMAA 3L3CA 2EFPA 2BRKA 4LF6F 1JLGA 3MM9B 4O23A 4PG6A 3CCQS 3G82A 4OYOA 2DEIA 2OKQA 1CJKB 3D2WA 4KB7A 3LGMA 5DETA 2VOPA 3DOKA 4FKYA 1WTFA 4DSIA 1FNOA 4KPYA 4B02A 3BGRA 1J5EJ 2CA9A 3GG1A 1HKAA 4ECWA 2RH3A 5JJBA 2MQ8A 1VQ4S 1CJTA 1H72C 1SV5A 2FZGB 2V9KA 2R2RA 4IG3A 4CYUA 3TRGA 4ES1A 5E3PA 4CP5A 5B0BA 2OH2A 1FRLA 2NZ4A 2F4FA 3G8TA 1J5EF 3WQPA 4UOFA 1NK0A 2OPSA 4P7TA 1XR6A 1S1XA 1NNDA 4KGKA 4CTAB 2HK3A 1YKWA 2QN6B 1NKCA 1MWQA 3KK2A 1ZPWX 2OLWA 3BQ2A 1UTAA 4DL0C 1LWCA 4TN2A 2Q1LA 5KG4A 5GAHI 1SKSA 3T5LA 3KLFA 3M8PA 2ILZA 5HK4A 2FJXA 2ASYA 3KLIB 6FD1A 1ZTTA 4F4YA 2VONA 3L7OA 4P10A 2V50A 4OYZA 4NEZA 4DX5A 2AU0A 3Q2SC 3MOJB 3M30B 2LP4A 4RW6B 3WHIA 4ANEA 5KFCA 3GV8B 3F0NA 4FDFA 2MZSA 1ELOA 2VG7B 1WWHA 4J7CA 2VJVA 4M5DA 4NCAA 2LU2A 3ILJA 5KFWA 2XHWA 2N3LA 4ZCKA 4OZ1A 2I5JA 4LFAJ 3H90A 2BJDA 4KT0C 5I3PA 3FSYA 2WOMA 4C4WA 3NRBA 4DWIA 4EYIB 2ZOMA 3OJSA 2LQ8A 2YNIB 2VODA 2IA6A 2VOOA 1WD6A 3MPUB 2DNRA 1RZMA 2VFTA 5JVGQ 4N47A 2Z2ZA 3BR8A 3UCGA 1TL4A 1IJFB 4HH0A 4ZCIA 4HHUA 3F73A 1E6VB 2RT3A 4IH6A 4OZ0A 3DM2B 1XWLA 3G6YA 1DTTB 3IRWP 3CCLS 3FK4A 3W9HA 4UOHA 3QSYB 3BO2A 5KG7A 3EICA 1FRIA 3HT3A 1H73A 4X4NA 4I6WA 3FQKA 2C2KB 1WOSA 3LOUA 4DL6A 3HHEA 5K8NA 4KC5A 4YDXA 1NUEA 1R31A 1ZM9A 3GLJA 4O4RA 4OYMA 3TA1A 3KLGA 1ZETA 3CJ8A 1UZHA 3UDEA 2AIRB 5EWEA 1NDKA 2MGZB 2DR8A 1FVQA 3KFWX 3HSGA 3VAIA 5LMUJ 5HQLA 1N6QB 2XM3A 2DHAA 1Q81T 1N34F 3Q8YA 4YHHF 4ZVOB 1EX8A 2VDIA 4HH1A 3OUYA 3W2VA 4F4AA 2L9NA 1LWFA 3WC2A 1YTYA 4WFNQ 2M3DA 3C6UA 2CJKA 3ELHA 2AF6A 5LMUF 4ES3A 5CYMB 2PA8D 2BMBA 3CMQA 3WIVA 3NWGA 2IPOB 3TUJC 2L08A 4DR3J 4H4OB 3M8YA 1J27A 2HVDA 1F60B 2DT9A 3VQSA 4QZVB 1T03A 2HNZA 4TQRA 2C2EA 1S9EB 3HD1A 4JI7J 4B9SA 3DMJA 1WG1A 1RQ0A 3HULA 2XZDB 2WONB 3BGUA 1FJ7A 3CE8A 4DR3F 4QIVA 3H98A 2GX8A 1NJXA 3CCTA 3R2CJ 1FWLA 3N6NA 5KFYA 1Q86T 2QYCA 3OXLA 1WC1A 2E7VA 5AXLA 2OUGA 1PYTA 3ADAC 2CUYA 4P71A 5FDLB 2ZNYA 1JWWA 4H4MA 4C6AA 2LQJA 2CJAA 1HQEB 1VDHA 2NPFA 3MECB 1WF0A 3GCXP 1SJ3P 3QGHA 3HVRA 1NPPA 5MAOA 2M2BA 1EQMA 3CULA 1U0HA 4PG5A 1BQXA 4KO0A 4PXBA 2WHOA 4CO4A 1TL5A 4PYDA 4CTAA 1HWUA 2CQ2A 1WOOA 1BXNA 1KHWA 3LW5C 3NNCA 4FPIA 2DHGA 4DV5J 2QV6A 4JI2J 4C8MA 3CC2S 3HO1A 5L46A 1HD1A 2MKSA 4JI3J 4HI2A 4OZ3A 3IBCB 2G2OA 3AOBA 1VMBA 2VIHA 1S1TB 4WCEQ 2BQRA 2CPFA 3C8YA 2FHJD 2HEKA 4GMKA 1FWPA 4IUFA 2C28A 2XMUA 4UTGA 1WNEA 1I51B 3THPA 5D8HB 5K8MA 5K20B 1FD2A 4WK1A 4DV5F 2RQ4A 5B7WA 4JI2F 2VG7A 2FYXA 1TAUA 4I56A 4JI3F 3S6EA 3W62A 4NASA 2DH8A 3K89A 3IWNC 3GONA 2HRTA 1F5CA 2XLJA 1RE1B 2EFNA 3RAQA 1SH0A 4TY9A 3PZPA 4RZRA 3GTYX 1RAIB 2D41A 3C6TB 2HBZB 3EE3A 4DV3J 4ECVA 4DJBA 4OX9J 4PCQA 1Q8IA 3LA0A 2E1PA 2MYFA 3LP1B 1X4CA 1DY3A 4DV4J 1NJZA 1U1PA 2LCWA 1PAEX 1Z1ZA 1TK0A 1D0EA 2F8EX 1KWMA 3EVWA 2QMUB 1F9FA 4QIEA 1DTTA 4YB1P 1NK4A 1BWEA 1RYSA 1IBKJ 3HLUA 4DV3F 3OL9A 1WHVA 1Y3JA 4CT8A 1HBOB 4N77A 5K8PA 2CAJA 3MEGA 5A6PA 3QWUA 3H4DA 2CQ1A 3HZEA 2CQCA 4CLSA 4L3KA 1HWKA 1HR0J 1BUXA 4HR2A 3BEGB 2A3JA 3DXSX 4OYIA 1TZ0A 3DRRA 2NCKL 1IBKF 3A8JA 2R8HA 4TLRA 1DFDA 2H9ZA 2O5DA 2MGZA 1NDCA 2YKNB 1FTRA 4Y2AA 2M88A 3SV4A 3BB5A 3MR6A 1HR0F 4WJBA 1FJEB 1REVB 2B8QA 2NSCA 1FXLA 3MMBB 3VR1A 1DHMA 2H65B 4ECRA 4QU6A 3CCRS 4ZN1A 2V94A 2M70A 1RACB 2RDDA 1VGYA 5GAEI 4Z7CA 1N52B 2DD8S 2GAGC 4WKYA 2IAJA 1D1UA 3ZZZA 1VLYA 2V2ZA 2R7XA 4J90A 1BMQB 2OIHA 1CQMA 4EI2A 2ZH6A 3T6JA 3HPOA 2CQHA 4FYVB 3HHKA 3GWCA 4CCHA 1JLQB 3PYFA 4PRFA 1QDUB 1RAOA 2K1RB 3DLKB 1SC6A 2RVJA 1U47A 4USUA 3T5HA 2GS8A 3P5BP 3HHNB 4IO9Q 4ANCA 2D9PA 3SSSA 1X4EA 2D3UA 3LWMA 3CCWA 4NLOA 1RAGB 2ZBCA 4WIIA 2YNHA 2HGMA 2HVHA 3MPVA 2W9BB 4QIFA 1A6LA 3M9OB 1HNZJ 2H51B 3HVAA 2MXYA 3RYLA 1R6VA 3J7Z5 1RAEB 4FP9A 5DO2A 4DR6J 3IMQJ 5FDLA 3NAHA 5EX0A 2KO1A 4LF7J 2FHOB 1EZZB 1SXLA 5DQHA 1HLWA 2UP1A 1S1WB 1HNZF 3RBDA 4MTPA 1RTHB 1UA1A 2E5IA 1S0OA 1RAFB 4NLGA 4DR6F 3I96A 2CJ9A 1KLMB 2N7CA 2WSEC 4AXJA 4DG1A 5T41A 5ETKA 4OJGA 1JB0C 2EG2A 2EBGA 1TV6B 1S1UA 1V3ZA 1C0UB 2HHTA 1JK9B 3DLGA 1TVRB 4DFMA 2C1EB 4FXVA 2WB1D 4ETZA 3PV8A 4C8ZA 1FHTA 2FJAB 1HWIA 3OTBA 4MT1A 2DGSA 3NLCA 3GSDA 1G6BA 1S5ZA 1Q53A 1FF2A 1AA1B 2ROGA 3EGZA 1FKPA 3G6XA 3K5NA 3C2PA 2BE2B 1KONA 4Q2MA 1KP6A 2CPDA 5E41A 1RT7B 4K0KJ 1FD8A 4BC7A 4ZP8A 1ZA2B 5U47A 1H2VZ 3C6TA 1JMTA 1ZM4A 4GRSA 3R7BB 3QRPA 2B5JA 1SKRA 1RCOB 2AEFA 2JFKA 3VZHA 3A8EA 3VAGA 2KRRA 3DGVA 1FKAF 1WDTA 1P6TA 3T6BA 1F3VA 1ZTWA 4YUDA 2HBYB 4K0KF 4DFPA 5D6GA 3Q0AA 2CWXA 3TUZC 3ZZUA 3O44A 3P4UB 4BWJA 1QD1A 2P9EA 2YWKA 3SYZA 4PQUB 2XNQA 4RJVA 1CQNA 4CLKA 4IFYB 3AJ1A 4X4RA 2X1AA 2JNJA 4X65F 3W9JA 2CZ9A 4I2PA 1NKBA 2H5IB 1C1BB 4WYWA 4ZVSB 2J7KA 1B64A 1GX5A 2N82B 1F2GA 1WORA 3RUBL 2W4PA 1Q8KA 1NHKL 1P27B 2OI2A 5HVFA 4NI2B 9ATCB 3CJ3A 1GFWB 4A47A 1D3WA 3NOGA 5E5NA 1URNA 4XPCA 3M8ZA 3T1YJ 3IRXB 2ZVIA 2J6TA 4U8VA 1KSPA 3RBEA 3QWPA 3H20A 3M6VA 2Z2LA 3J80Y 4DL5A 1B3TA 2DNMA 3EXCX 4EBEA 3KG0A 4X4PA 4LF5J 3DC2A 1NKEA 3M2RB 3T1YF 4A4JA 3KLEA 3BQ0A 5KFEA 4EUVA 4KKOB 1TL3A 4R5PB 4M5GA 4NA2A 2K3IA 2BANB 1LWEA 2MEWA 4CH0S 2C22A 4WZQA 2FJBB 5LJ3Y 2EW9A 4FF3A 4IH7A 4LF5F 3V4MA 2BA9A 2GIRA 4X64F 4FS1A 4CM2A 2KT2A 1S9FA 2XI2A 3MD3A 3AXKA 4H4KC 4M5IA 2FGCA 5H9FJ 3HSZA 2W9BA 2E1CA 5E3RA 3AXMA 3S1TA 1EKSA 2DR7A 1U8SA 1M5PC 4A8YA 3H0PA 4OYPA 4WE1B 1VFJA 2MKJA 2B8PA 1SIZA 4IKAA 2RAQA 2DNKA 5KG1A 2ZBPA 5IV4A 2BDPA 1X8DA 1PYSB 2XHCA 3EDQB 3HMJG 3S8SA 2MDAA 1SC1B 1T05A 3ILIA 4O44A 4MIWA 3DNCA 4I2QA 4PAAA 3CD6S 2YNGA 1T9XA 3DI6B 1NBEB 2MSSA 5I3QA 5JXSA 2ACMA 3R5DA 1JKHB 2A6OA 4Q5VA 1S7IA 1QVFR 2MKHA 3GIKA 5B0EA 3POTB 3WZ0A 4F7VA 1FKOA 1UEKA 4RW8B 3N01A 5LSOA 1TV6A 1C0UA 1Y9OA 2XQCA 5M2UA 4ZVQB 1UCNA 1V3SA 2YKQA 1GXTA 2ZUGA 4ZLPA 2MQMA 4RBVA 1NJIT 3ILOA 4V19X 4WF9Q 3VGTA 2FLPA 2EK1A 1SUQB 2LXFA 2H3EB 3C3LA 1QJHA 5D15A 2FDNA 1FFSB 3BS9A 5E0OA 2RU9A 1IUJA 5D0RA 4MMOA 3J81Y 2HQ3A 4N56A 2C2OB 3SFGA 1SL1A 4XIUA 1OSCA 4GKJJ 2V8VA 2W25A 4P73A 1RWNB 1CULA 3IO1A 2DGQA 2ZBQA 4YB7A 4J91A 4DF4A 1YGYA 5J1PA 2CQ3A 2D69A 3T1HJ 3N4WA 3TVYA 4DMZA 4L73A 3RB4A 2HQCA 2MHNA 4GKJF 4URSA 4M5NA 3E2EA 1MSWD 1TKZB 5KFKA 4A8SA 2J5AA 4PQUA 2R4FA 1XR7A 4IFYA 2JX2A 2GFFA 3T1HF 2QLWA 1U1NA 2LA6A 2R7UA 2FJDB 1WI6A 3MR2A 2J9DE 1PC5A 4ZPBA 3W5ZA 4USVA 1C1BA 3PG9A 4B9LA 4RL1A 1VJWA 1IKVA 3H59A 2ALZA 2ZZNA 3BSOA 2ZH2A 3JTOA 5KFFA 2CPIA 4O4GA 4LR7A 4OJ1A 4O0NA 4Y2MA 3ZZRA 3R1LA 2E5LJ 4HTIA 4RUCA 3M7VA 2XMJA 4DZ6A 2XI3A 1OWXA 2NYIA 4EZ6A 1FJCA 1KNZA 1XMOF 1AW0A 1N0VC 1MU2B 3THTA 3NEKA 1JX4A 4ZVFA 2HIQA 2RJZA 1PBUA 3PX4A 5J1EB 3U1NA 3TAPA 3SDEB 2XSJA 2E5LF 2FD2A 1NSKL 2EFVA 4R5PA 4WFAQ 2RRNA 2E44A 3ULHA 3PRVA 5L1JA 2Z0GA 5AXNA 3K17A 3I87A 5C2CA 3CW2C 1Z4UA 1YJ9S 1T7PA 1VRUA 3NG8A 3HZGA 1W25A 1BC6A 1S12A 4JI4F 3UN2A 1YITS 2APOA 3FSXA 2ZVSA 1JJ2R 1KEKA 4JOUA 2OPRA 2DR9A 4B3RJ 1JXVA 4YQWA 3PCOB 1XTZA 2BJ3A 4WE1A 1U7LA 3RB0A 1IKYA 1WKKA 4BLGA 3CNQP 3GR1A 5IWAJ 1C4CA 3VGSA 4WXOA 3B82A 4JP8A 3C16B 4WPAA 4I7FB 1JIHA 3ZZOA 1HNXJ 4XDDA 3V5RA 4PXEA 1YWXA 4B3RF 2J0XA 4RUAA 3D68A 2YQ3A 1G1XA 5IQQA 3CSKA 1X4GA 4QIGA 5ETTA 3POTA 5IWAF 3I5CA 3ENQA 4RW8A 3DDNA 3MUVP 1FK9A 1MG7A 1YBAA 3BPSP 3H25A 1B4SA 5KT4A 1FDDA 4OV6A 1RT5B 3CEDA 1HNXF 5GADI 2KHDA 5FLXY 3KLHB 4KGZB 2W2MP 2DNHA 4M94A 5IT9Y 2V8DA 2AZ3A 2R2UA 5T7LB 2VBWA 2ATCB 1FERA 2GVDB 2KXFA 3H5UA 5L1LA 3GJQB 4JI8J 2BXJA 2D3ZA 4NA3A 5E3CA 2MZRA 3LQVA 2WAQD 2EFQA 1Y10A 2HHWA 1F5AA 5IQ6A 2DRBA 3QO9A 3W64A 1XNQJ 2QYGA 3KG4A 3W2WA 3L9ZA 3NY0A 3C15B 4J37A 3V2UC 1RA6A 2HBRB 2HZVA 2L48A 5CZXA 2FQQB 2VBZA 3FUYA 1QM9A 3VAHA 5F8NA 3UN3A 3BH6B 3NCPA 2CQGA 2YWHA 4LRBA 1S7HA 3PHEA 3KXDA 3R5BA 5EWFA 5HP1B 2GJ2A 2E66A 1HWJA 4C3KA 3MPDA 3A8KA 3HHLD 5KG5A 3MUTP 1RUSA 2MQNA 3NBPA 2G0IA 5HL7Q 3EDRB 1LKZA 1WKJA 3MZIA 2W2NP 2OEKA 5J1NA 4KH0B 4OZ2A 2X1BA 4KQZA 4CRJA 5HMWA 1HARA 2HQGA 5CHCB 3TJ8A 1Z2ZA 4PG4A 2JVRA 3CJSA 1UETA 2Y9HA 3B8HA 1R43A 1T0TV 1IQTA 1R8PA 3EZ5A 1N54B 5IZHA 4HHJA 2JEIA 3A3NB 3D0GE 3ZTQA 1SBRA 2CPJA 2W4DA 1FFGB 2WVFA 1UFKA 5B08A 2E9ZA 1S0MA 2F65A 3KKFA 2W2OP 4ZPTR 1GX6A 4LUBA 1RWXB 4CM0A 2AGQA 2DR6A 5LMNF 2DNQA 3MCOA 3K5MA 1OYEA 1MU2A 4U7UK 3SCIE 4EZ9A 4WWSA 1I94J 4N8NA 4DPWA 2PSZA 2XMKA 1KQFB 3AD9C 2JVOA 4GVBA 3SDEA 4ZP7A 4WXWA 1T02A 3FBFA 4Y65A 3R2DJ 2UV8A 3TVZA 1UW4A 4NLUA 1SKWA 4ZN3A 1SCJB 1X31C 3R7NB 2IA0A 1I94F 1WEZA 4O3SA 3LANA 3CTRA 2CDRB 2QTWA 3J81j 1HBMA 3BF4A 1B0TA 3QGPA 4KHMA 2V2QA 3HSDA 4USIA 4LSLB 1Y5IB 4ZPWR 2ZNZA 1VQ7S 1VQKS 4C9DA 5KFVA 2D74B 5DGAA 1RBAA 2ZDOA 2PGCA 4ILMA 3K57A 4ZP6A 5GMEA 5LJ5Y 3DKDA 2EG1A 5L9XA 3L09A 3PXGa 4JI1J 1H7XA 2RMLA 3C16A 1T3OA 4ZJOA 3DDIA 2H5JB 4I7FA 2RF2B 4FYXB 1WHXA 4DV7J 1N5TA 3ICLA 1U0SA 3O2IA 2QC3A 2JWNA 1NDLA 4OQJA 4PYAA 4WBFA 3RGIA 3QGGA 4PG7A 4IRKA 3SI8A 4JI1F 1TUWA 2MKIA 2UVUA 2M7SA 1N0UA 3CF5Q 5DG9A 3LAKA 2DGVA 4F26A 4DV7F 3MUMP 2MY8A 1HBUB 4MFBB 1W2IA 4YR2A 3H4BA 2DKOB 3RB6A 2NXJA 2O01C 2OPQB 3MM5B 2W8LA 2JEGA 4O3RA 4P2FA 3HSJA 1K44A 1NAQA 2XS7A 1HIYA 1XJWB 1B0VA 3HCXA 1WC3A 4OYWA 3I0SA 5F3ZA 2W1BA 3C15A 2GO9A 3BKFA 3OFGA 2DGUA 4NCBA 1DTQB 3CD7A 1YX2A 4TY8B 5HAOA 1UKUA 3IBWA 2GHPA 4NLYA 4BWMA 1EKRA 5MLCV 1RAAB 5CABA 5HP1A 4E98A 1K0TA 5HROB 4ERDA 2AJ2A 3D67A 1NLKL 3IAM9 4O3NA 5HMZA 2HHSA 3M6XA 2YWFA 1RT1A 1LXJA 4UY8T 3TW0A 5IXUA 5G0RB 2GHWA 2PIIA 3OT9A 4RPFA 1AROP 1W2BR 3B54A 3BDPA 1D8ZA 2XWXA 4I68A 2Q3PA 5CH7B 1E6YB 3PVXA 3IBFB 4I64A 2OD4A 1UMJA 3CGIA 4JUZA 3VALA 4OZ5A 2RQCA 2B9YA 4BHQA 3RRKA 3K0JA 1XR5A 2CZVC 2Z30B 1YJUA 4MK8A 3UWTA 5L39A 2MLZA 2Y8WA 1X5TA 4HDGA 2QA4S 5KG6A 3L7PA 2KG0A 4JBCA 1WHYA 1GMWD 2LVWA 4QBUA 1YJTA 2IVFB 2J76E 4N76A 5KFMA 2J7WA 3ITHB 8RUCA 4KV8A 4B9NA 2NUHA 1MNEA 1U25A 3M2UB 8ATCB 1PJ7A 1RAJA 1IBMF 4BBYA 1FA0A 2QE5A 1N36F 2HS0A 1P1LA 5EN1A 2LQ9A 5F8JA 1ZA1B 4P6QA 3MPYA 3GV5B 2HWIA 4OYXA 4DPOA 2XCPA 3FBCA 4CLZA 1WF2A 4ZVEA 1QUPA 1YZ7A 2M52A 4Y2CA 2UUTA 4A8XA 4MIAA 1K47A 3LGHA 5F9NA 1X4AA 2XEXA 2OAUA 4G3IA 1YRUA 1GH8A 2YWWA 2KJVA 3H42A 1RT4A 2JJ4D 4IRCA 1CPZA 2RE1A 3FMWA 1N5QA 3CJTA 4ZMMA 3PACA 3GR0A 5FD1A 3SIPB 5M2RA 2VG5B 2N3OA 1Q5VA 3MAAA 4QOTA 3JSRA 1Y5LB 4DUZJ 4C3LA 3TEHB 2OMOA 2IJFA 4NRTA 2AEJA 4AE5A 4WFZA 9RUBA 3EX7B 4DFKA 2HNYB 4M5MA 5KFZA 2XC9A 6AT1B 1BQNA 4RNMA 3HKWA 2POKA 4E2FB 2YNFA 5THWA 3PFOA 5A0YA 3M05A 2GIQA 4DUZF 4DL2A 2HMIA 4ED1A 3MF5A 4A8KA 4IDKB 4OX6A 1JQGA 4N8OA 2MZJA 2MQLA 3SQGA 4PXDA 3AA8A 1RTJA 4MFBA 3AOAA 4CZCA 3MM5A 1SH3A 1SL0A 2I38A 2R42A 2AYBA 3PYEA 2WSFC 1IKWB 2XNRA 4LSZB 4LJMA 2AGOA 2WTFA 2WW8A 2B4PA 1S4EA 4J9MA 4RW4B 4AUKA 3ZZTA 4LMZA 2AKWB 5DG7A 1X5OA 5B09A 3M6WA 2J0SD 2JLFA 1RU1A 2PEHA 2FGOA 1LK5A 2A2DA 4CH1A 3V81B 3Q8UA 3OVSA 5IC4B 1RCXB 4E8UA 5HSPA 4C3MA 3AFGA 2VG6B 4GC7A 4NZ7A 1JLEA 4L75A 2ALYB 2NS1B 1R3NA 4NYZA 5HROA 5LOQA 3PIPQ 1ZZNA 5FJ4A 4ITSA 2XZWA 5J2QA 4DN0A 1N56A 2B4UA 1QTNB 5L1KA 2BKOA 2DPJA 1OJ4A 5A8RA 1PIEA 5G0RA 1CC8A 5D3GB 3ISZA 4JV0A 3UD3P 3CB4A 4FXDA 5IV3A 3KK1B 1K0VA 4TVAB 5C25A 1E6YA 1ULRA 2Q79A 1K9MT 3WC0A 4PABA 4QWDA 2MJUA 4DU8A 3M2VA 4X4OA 3G71S 3HJVA 1S6PB 3BGFA 2G2ZA 5A8KB 1VR6A 1TUVA 4IG0B 4Q7AA 4MIBA 2PFDA 1WUUA 4ECSA 1U48A 2AX0A 3ETMA 4UUXA 5I3UB 4DV1F 4AQYJ 1T94A 3PEHA 2BEFA 3R27A 2LYVA 3NGKA 2NXCA 3CD0A 5F8GA 2UVVA 2HW3A 1NSQA 1FE4A 4NLDA 5D0EA 2OJ3A 3CWJA 4U6PA 3ET6B 3ITHA 4ZIWA 2OPPA 3M2UA 4ED5A 4M1KA 1NPRA 2H5EA 1JLAB 2HLTA 5D77A 1WG4A 3VF0B 2DNOA 3K5OA 3Q22A 1U24A 2A6MA 2PMHA 4O3OA 1TK5A 4XTTA 1SC4B 3JXOA 3PEJA 1HYSA 2C2NA 1M90T 1AXQA 1GMVA 2XY7A 4MYTA 5HVHA 3H5YA 3OHAA 1UJ4A 3HJFA 4CLUA 1TKXA 4ZCMA 4A8WA 4KGMA 2BJEA 5ETPA 1OPZA 2IC3B 3D1HA 2GW8A 2GQCA 3D1OA 1HNIA 3KMQA 4MK7A 2YBVA 4XO0A 4JV1A 1CC7A 3A4TA 2J8AA 3D6MB 4HT5A 4ALZA 5GVQA 3WX4A 2CPEA 2VFRA 2OTLS 2HFSA 4C97A 2HNYA 2WSCC 1NM2A 5JMNA 2KZMA 3HVTA 4EFAC 1RTDB 2MZTA 3M9NB 2B43A 4EEYA 2BR0A 3BN4A 2VB6A 2DNNA 5KAKA 3ZZ0A 4RU2A 4C11A 2QL5B 1D9FA 2FVRA 2KFNA 4DSJA 1K1SA 4HACB 3GJTB 1QSLA 2ERRA 3I31A 1YRTA 4DUTA 3MWBA 1X0PA 1SQGA 4EK2A 2DB1A 3QT7A 1HFEL 2ROPA 3JSBA 4G6VB 4DV0J 3AHPA 1O51A 1CBKA 3PW0A 3K5LA 1WDDA 5L1IA 5ETNA 1U4BA 1RGVA 4RW4A 5IFMA 3I32A 5DS7A 3HXMA 4HKQA 1F9EB 2J6UA 4NMXA 4Y28C 3GIMA 1FVSA 3LP2B 4N41A 2YPYA 2NUUG 5HLFB 4LF2A 4DV0F 1F2HA 3V81A 1G4CA 2WVDA 2EKYA 4RW7A 5F0UA 2DXFA 4IR1A 2LEBA 3OTOF 4IO1A 4ZDNA 2AJFE 1L5UA 3GYNA 2N4CA 3IR7B 3RTVA 2ZH3A 4CDIA 2DNZA 1YBTA 4ZVTB 3I9V9 3TR5A 1KTQA 3U1MA 4C48A 1FDNA 4PZVA 4J5OA 2J8SA 2R7WA 1H74A 3KK1A 3AB4B 2B4VA 3KG1A 2RU3A 3JSMB 4XPEA 1EB0A 2K7KA 5AXKA 2KXNB 2KG1A 4LT6A 2HHXA 2LECA 3OLAA 5HMYA 3ZNUA 4XDCA 1F3FA 3ZTOA 1S6PA 2DRAA 2JL9A 1J5OB 4LQ9A 5D78A 4F0MA 3WBZA 2IRYA 3AAWB 3QT6A 1VRQC 3ISND 4WFYA 3VHQA 3QYYA 2LDIA 2D3OR 4OI4A 3CCVS 2YKPA 3OL7A 2BKNA 2WRMA 2DH9A 3EYZA 3UFCX 3ET6A 2QGFB 1RTIA 3AQPA 5AE1A 1ICEB 2BUNA 1URRA 1LV5A 3ENWA 4L6V3 1WJ9A 1R6YA 1JLAA 3VGVA 4DQPA 3MMAB 3IGVA 3RAMA 5HBMA 2QEXS 3MM8B 3UDVA 2EEYA 4UUWA 2YY3A 1VC5A 4NLVA 3HHLB 2LU1A 1VBZA 1AZSB 2BQ3A 5DG8A 1WI8A 1N33J 5DLFA 1VQ8S 1WHWA 4C0HA 3J81U 1EETB 4DR1J 1S1VA 1WSVA 1PCAA 3P6YC 3DXBA 4UW2A 3KJNB 4QR0A 3MTJA 1MW7A 3GB0A 3PR4A 2IC3A 3KK3A 1X60A 4CNZA 2A2CA 5KFIA 3MEDA 5AJ3J 2UXDF 1NH7A 1N33F 2RUSA 4J9QA 1KRPA 2HZCA 2FLNA 4HL9A 3IR5B 3TO8A 4DR1F 1V3RA 3W65A 1IQZA 3Q86A 1RU2A 1IXKA 3MEEA 2HGLA 3PO4A 2B6AB 5C42B 1TKTB 3PKMA 3QFWA 4F4XA 2VPXB 3CPWR 3UR3C 4PXCA 2NREA 5KFAA 3JYTB 5LSRA 5AJ3F 1R8CA 3GSIA 2Z4PA 1D9DA 2V63A 1RTDA 3C19A 5HMXA 3PW2A 3TARA 1VK3A 2RKIB 4FYYB 1S99A 2W7OA 3D9BA 3CCUS 1Q7LB 2GA7A 5KFNA 4NLRA 1P9YA 1TKDA 4HACA 1VI7A 2IIHA 3KDNA 1X4HA 1B0PA 3R3TA 5KG3A 4DOZA 2HFNA 1FJGJ 3BZQA 2O3DA 2KTQA 4FS2A 2L9WA 2GVZA 1M5HA 4U67Q 1HNVB 1FRKA 1IM4A 1JJCB 2P9GA 4ECZA 4ICLB 5CYQA 5DZ6A 4K8RA 2A1BA 4F2RA 2BRLA 3NS7B 3M8SA 4C2MA 1DJ0A 2OMLA 5IC6B 1FJGF 5C24A 4HLBA 3RZAA 2QLJB 3N79A 1S10A 3GJRB 4ZP9A 2ZM6F 5DDQC 3CCMS 5CQGA 1RT2B 3IN5A 4ZS6A 2LLZA 2A10A 2JRSA 5K14A 1U8WA 4K7QA 1PBAA 3A3PB 2VUGA 2MMYA 3JTNA 3MTKA 1HL6A 1T9UA 5IOLA 2AW0A 2EC2A 1TL7B 4F0HA 1NK5A 3C14B 4KGVB 3K2YA 1RLDA 1HQ2A 2OSRA 2MPUA 2OFGX 2F8MA 4KAIA 5EGYA 2EXUA 1CJVB 3M1VB 3VV2B 3TJAA 4RBTA 1R8HA 2DITA 5F8IA 2FZKB 3QBCA 2DXDA 3MMCB 3JSMA 3D6FB 3ZTPA 1IKXA 1LFPA 2E7XA 3TUPA 3MI7X 2KYZA 4ID5B 4FVCA 2C2RA 1J5OA 2UUBF 1X4BA 4DSKA 1KOHA 1WG5A 2ZDPA 3BDEA 2W24A 1NK8A 2GZOA 4U96A 1FEHA 3IM9A 3NGUA 1FEEA 1QUVA 3AD8C 3GFHA 1PG5B 1RWOB 1VQ5S 1F1BB 2GJFA 1VQOS 3KUEA 1LW2A 4Y2IA 1C2PA 4ZK7M 1LEOA 1FDAA 3GIJA 4HTJA 2IMOA 2B0GA 1EQ0A 5FLXU 2Z2YB 1Q8LA 2B51A 1MWZA 5EDWA 1RWWB 5IT9U 4W92B 5DM6Q 4DI6A 2XLIA 4L72B 2ZE2A 2MHEA 3MM8A 4M63A 5GAHU 1PILA 2V4QA 2Y8YA 2GCFA 2VBXA 4MJKA 1Y00A 1T11A 3CJKB 1AZSA 3V6KA 4RUHA 5E7OB 3OD2A 1LXNA 4YB5A 2UVWA 3UQSA 1Y3KA 2HRYA 1SJFA 1TL1A 2V68A 3DRPA 3BSNA 4CO3A 1IBLJ 3W1YC 4KHRA 5HJXA 3M32A 4CQ1A 4X4SA 4ECUA 3KJVB 4WFBQ 3D28A 2XYGB 4UOGA 2ZJPQ 3PYDA 1X0FA 1NDPA 2DNYA 4W90B 1N34J 4OZNA 1FNXH 4YHHJ 4I4BA 4F3OA 1YJ7A 3DOLB 4DR4J 1MWYA 1UEUA 1Q8BA 4DBQA 2XY6A 3G2XA 4X4VA 1IBLF 2IM1A 4FYWB 3JYTA 4PPZA 2CVEA 3CIMA 2P6SA 1RKIA 3A8IA 1FT8A 1JXEA 2ADCA 3JS9A 4BS2A 3SXLA 3UDLA 1F9HA 4USJC 4M5JA 4DR4F 4U9RA 2E7WA 2ZJRQ 1ZPVA 3CO0P 5D0GA 4RW9A 1NCLA 4Q44A 3IWXA 1WSRA 3NCRA 3EZUA 2IDEA 4F3MA 3UE2A 4ANDA 2ZD1B 3TNVA 2DJWA 2NLWA 3PM9A 5F9LA 1T9TA 4UQTA 3D66A 1HNVA 2UU9F 4LRDA 4NL5A 3THVA 1U2FA 1BE4A 3OBIA 4KGXB 3TI0A 2IJNA 4DFJA 3KHRA 3T9NA 3MM9A 1KDNA 1QE1B 3PHTA 3M9MB 4AYBD 5LSLA 1CJKA 4F8RA 4RWXA 4QQBA 1R8AA 2X3DA 2M9KA 3SMZA 4LRFA 3QIPB 7FDRA 2YKMB 2EPIA 4PWUA 1X9MA 3D0HE 2GQQA 4CO0A 1GMUA 4B3MJ 4ZCLA 5ITHA 2F3JA 3IC1A 2QA4G 1OY6A 2FLLA 4ED3A 2LMIA 3QIDA 1Y4ZB 2XBPA 1O8BA 4FF2A 2WZ1A 2OFHX 1N32J 5EHHA 1PO6A 1TR0A 2BJ7A 4Q0BB 2UUAF 1B70B 2F7VA 4K5SA 4B3MF 2E5GA 2ZC4A 1EHWA 2PT0A 2IDLA 3WDOA 3MMCA 4NEYA 3AY0A 5AT1B 3DOMB 4OYBA 4X66J 2X3GA 4QIWD 2KXHA 4PQAA 2HGNA 1N32F 5GMKa 4YOEA 4OHZA 3M8WA 3KLIA 4IOAQ 2MZQA 3I0RB 2U1AA 1YIJS 2I9SA 3ZZPA 3M30A 4X66F 4RW6A 2FJWA 2LQ5A 4M5KA 3M8QB 1OIAA 2CDQA 3AJDA 1RHKB 5IM0B 1NPKA 4Q45A 4IH5A 3ONQA 2Y0SD 2J0WA 1QY7A 1NRKA 1RWPB 2DIUA 2AJQA 3N5BA 3TA2A 2DR5A 2XGPA 2PDAA 2CQ0A 3KTQA 2E29A 1M5KC 2M5YA 2YNIA 2HAIA 4ZJQA 4O3PA 3EGVA 5L8RC 1FO1A 1ROFA 4ZA1A 4FXWA 4H4KA 4RLEA 3PW7A 1UA0A 2V2VA 2ZKTA 1E6VA 3HFZB 3CDUA 3NXZA 1VIOA 3DM2A 1FWKA 2XY5A 3VCDA 3AJ2A 2CNKB 3JAMU 2B9XA 1ZZFA 1W26A 1WACA 1CS4B 3KJVA 1YJWS 5EWGA 3AA9A 2C2DA 2Q6BA 2JC1A 4P7VA 1H0HB 1C1CB 3D6TB 2DIVA 3Q23A 3NL0A 2GGPB 2WK4A 3OPKA 1PJ5A 4HDHA 3R5JB 4ZVHA 2V0NA 4GC6A 4OL8A 4PR6A 5KFQA 1JLCB 4LVNP 1N6QA 4NLQA 2EWHA 2KM8B 3MR5A 2C42A 3MFHA 2CIMA 4R25A 1XN9A 1S57A 5ETOA 1RB0A 1F0XA 1JJHA 4B3OB 2HHVA 4TQSA 3FKBA 2ZD1A 5BJRA 4DCPB 2P6TA 5CYMA 2BX6A 5CA5A 3HX9A 2KVIA 3D5MA 3KOAA 4URQU 4DCJB 2KFYA 1R0AB 4FVMA 4H4OA 4C8LA 1LW0B 5CZVA 2XYHB 5B0CA 2KKHA 1XEZA 2LKZA 4ZVRB 2YVSA 2QLBB 1S9EA 1S77D 1U1RA 2HKEA 1HI1A 3H7HB 1VQPS 1HBNB 2AD9A 2E1MC 1U45A 2WONA 1RBOB 4OHYA 3PNIA 4BDPA 3TWZA 4ZVUB 2I8EA 2IM2A 3QIPA 3TX0A 2BM1A 2XZTB 3LTOA 1S76D 2GIFA 2CKWA 3L4BC 3HHLC 4URGA 2ZOFA 3JTPA 5IT0A 1IR0A 3PW5A 1VHIA 1UJ6A 4NCGB 2V8GA 1APSA 4AL7A 4XK8C 1GXLA 3AODA 2ZBRA 4FBTA 1BGXT 2DCLA 2V2KA 2Y1JA 3TAQA 1JLFB 2HFVA 3FJ2A 2DNGA 2K06A 1HQEA 3MECA 1Q1KA 4I67A 1SC3B 4Z7YA 5GAGI 1WELA 3R6GB 3UNGC 4K2JA 1V6HA 3BKUA 1HD0A 1R27B 3MCMA 3KMSA 2F40A 4TYAA 6FDRA 3Q2TC 4LBHA 2WCXA 2CADA 2FC8A 4DUYJ 1OYDA 2MB0B 4KBIA 1BQMB 4DR5J 3OSPA 1S1TA 1S59A 3R1HA 5HJYA 2RQKA 2LXUA 4Y6IA 2XMMA 2ZFHA 2AGPA 2VA3A 4F3QA 2YXLA 5IM0A 4F36A 4DUYF 3T5JA 5HI7A 2HIYA 1X9WA 2OD6A 1IR2A 4DR5F 4OYAA 2R7RA 3TEGA 2VFVA 2VKRA 3DDKA 2HPUA 5KFSA 3AOCA 1M0SA 4P9SA 1SV5B 1TFYA 2Z57B 4CYUB 1K8AT 1RJJA 4M5HA 3HKZD 2VH7A 2ZC3A 3CIZA 4YMEA 1AFIA 1SI9A 4CT9A 5F8LA 2CPXA 3LP1A 3G8SA 5HN0A 2CG8A 2HBQB 3I5AA 2PMWA 1KLNA 1N88A 2CQDA 1HHSA 2GJIA 3G6ES 3AT1B 2RS2A 3R5CA 5DDRC 1OSDA 4Y34A 1S72S 4X65J 3QLHB 1RP5A 5CCLA 3J7YU 3KK2B 4K4VA 2R8GA 5L38A 4CO5A 1HBOA 2Q6CA 2J9DA 4OI3A 3M8PB 4A46A 3KHGA 2V8HA 2CNNB 1V5IB 3FRYA 4KJIA 3QPIA 3ZTSA 4A8OA 2QL9B 3BR9A 4RUBA 5A8WB 2Y1LB 5E3AA 4A8QA 4QR2A 3B6BA 4M5DB 2YKNA 3J7A1 4PG8A 1VQMS 2I5JB 3I9ZA 2ABYA 1REVA 1TAQA 5KFRA 4DL7A 1WC6A 2AEMA 3MMBA 3PO5A 2WOMB 3NGRA 3PRBA 5GMDA 1K73T 3PR5B 5DLGA 2V9WA 2F9DA 4PWWA 2I6WA 3F44A 2NZCA 3EWGA 3GQCA 1ITPA 3PKYA 3BO4A 2Y1RI 2YH0A 3HI9A 3OFFA 3UCUP 4QR1A 3GYXB 2BE7D 4X64J 1XMQJ 2ZZTA 1R0AA 3RJMB 4ED6A 1B7FA 1B99A 3BKTA 1JLQA 3RRHA 2PD1A 4ENOA 2Y0BB 3GE9A 2CQBA 2K1RA 3I4PA 3DLKA 4ELTA 4UOCA 4KRWA 4UZCA 3HDSA 1DQAA 1SL2A 2VQEF 3AB2B 5LT5A 2BJ8A 3KLGB 5RUBA 2CXEA 4USHA 2HNDB 5K9FA 5E33A 4FBUA 3FZBA 1XMQF 4IYQA 2YWGA 3B78A 2JOQA 4CWBA 4DDFA 3GG0A 4NCGA 4OI6A 2KRBA 2NXUA 4ZKAA 3GPAA 3SCKE 4CIOA 4A8FA 3N6MA 1UWBB 4F50A 3UO0A 3OUYB 2QLXA 1LNQA 3W2VB 5E3QA 2MZ1A 1YJVA 2HHUA 5KFGA 1KQGB 1LWFB 4O0IA 4ELVA 2OGUA 3FFIB 1LK7A 2YX7A 5I4MA 1S1WA 3C6UB 4QPXA 4WP9A 1NSAA 2HFUA 4TKTA 1FXRA 5T14A 1RTHA 3FCVA 2VQFJ 3UN5A 1DAXA 1XERA 2MQPA 3PX6A 1FFWB 3SZ2A 1FRHA 2ZKUA 2YKOA 1KLMA 1KHVA 2H54B 1UVJA 1S79A 3R97A 4ED0A 1U1OA 4EBDA 1NB7A 3US5A 2HNZB 1XNRJ 1BHNA 1FRJA 4C98A 3ZFVA 3DMJB 1Q79A 2DGTA 1TVRA 4TLQA 3M8RA 4AFFA 2VQFF 2W7AA 3EPIA 1U2CA 3IG1B 4DEZA 2D3O1 3IS9B 4A48A 1XNRF 2KT3A 2HFZA 3N6LA 4G65A 4DQSA 2BE2A 2G13A 1REGX 4RX6A 1RT7A 4ZHRB 3KLVA 2ASJA 2QA1A 3LGNA 4YR3A 1FTCA 4H4MB 1OQ6A 1VCTA 4NXNJ 4C8YA 1UVLA 2G1DA 5J2NB 1U0HB 4KO0B 3Q8VA 3QLHA 1IR1A 2JEJA 2HLUA 4ZPAA 3U02A 4NXNF 2K8GA 1LWXA 1N5SA 2J9CA 3SQOP 3G96A 2JZ5A 1NZ8A 3KJFB 1RAHB 4K2XA 4ATNA 5ETMA 4J9PA 2RD5C 4QWBA 5A8WA 1H2TZ 1QTMA 3GMGA 1NJWA 4DZDA 1X5PA 2RRBA 3D7SB 3GP9A 2L9DA 1VRTB 1XMOJ 4RNNA 2D1CA 1RT3B 4B08A 4NI2A 3V6DB 3LO3A 1IWGA 3LAMA 3IRXA 3TP2A 2HSEB 3OLBA 4YY3J 1AFJA 1JNZB 1IJEB 3DU6A 1UPMB 2QZ8A 4C7QA 1WC5A 3HP6A 2F63A 4EYHB 2QIFA 2VPWB 4ED7A 4P74A 4LFAF 2E5JA 3QAEA 3FGVA 4LSNB 3M2RA 4P2XA 1KVIA 2JEFA 2H4YB 2R7TA 2QO3A 3SSRA 4JI4J 4KKOA 2VJUA 3AD7C 1X7VA 4YY3F 4H54A 2YWEA 3HF5A 4C0OC 2R8KA 3W66A 4OZJA 3MEGB 2BANA 3PX0A 3K7RA 2G2YA 2C3YA 2IVYA 2OSQA 5DM7Q 4ID8A 2GO8A 5B0AA 2VASA 2HNDA 3VVTA 1QSSA 2AX1A 3DRRB 1G3OA 1NB2A 3BV8A 3CD5A 1BWVA 1WEXA 3KHHA 3MPWA 2KYXA 4ZLJA 2BE9B 3LPEA 4C8KA 2IMWP 3JB9k 3CJ0A 2M8DB 4UY85 2VHGA 1UWBA 2ZH4A 3H5SA 2WB4A 1SH2A 2HRUA 2QA2A 4ILRA 4ZVPB 3H40A 4LIWA 3NOCA 1DLOB 2XULA 3FFIA 4TU8A 2IAJB 2X1GA 3DI6A 2AMCB 1HW9A 2RDJA 4LQ3A 1TELA 3I55S 1JKHA 2XO7A 5KFPA 2DYAA 3D4JA 2FVQA 4R0JA 4ES2A 1KFSA 3TZXA 4N5SA 5CYJA 2PA3A 3HHDA 1TQLA 2FHMA 4XAKA 2WW4A 2KH9A 4QWEA 2KM8C 3Q8RB 3P3DA 2PE8A 3FSIA 3O1LA 2U2FA 4DS5A 4NX9A 4FKXA 5DDPC 3TQEA 3BBCA 3IG1A 4J9LA 1SUQA 5EX3A 3MURP 2JDJA 2PI5A 3IS9A 2YNHB 2CQIA 3MAQA 1OPIA 2IRUA 4FNHA 1IBCB 1MLAA 4JI7F 1L3TA 4KHPJ 3BSAA 4ZHRA 1N48A 2OO4A 2CYYA 4HVZA 2ZJQQ 3GV7B 3SCLE 5ETSA 4CLTA 2DXEA 1O6XA 2MQOA 4EO8A 2QLFB 3TQ1A 3QJLA 2DY9A 5GADU 4YDDB 1A0OB 1ZH5A 4O3QA 1XQIA 5J2NA 4P72A 1ZM2A 2YX1A 4ZIVA 2C3OA 4LBIA 4KHPF 3BGLA 2VKZG 1OY8A 1Q82T 2MJNA 2R7QA 2ZUAA 5DJBA 3RBZA 3I56S 4DG1B 3Q8PB 2R8JA 5AXMA 1TKZA 4WK3A 1XMBA 3QRRA 1S1UB 3LUYA 1P1TA 1Q4RA 2L41A 3DLGB 2HHHJ 5DQIA 3IWLA 2FVCA 3VGUA 4DV2J 2NR0A 1RLCL 4FN5A 5LMNJ 2MLYA 1NMEB 3QZ8A 3LF0A 1VRTA 5J2MB 3OR2B 1HW8A 2O67A 1RT3A 4DSFA 5F0WA 3BGOP 2UZAA 1FKPB 3V6DA 3BYPA 2HHHF 4HHHA 2BJ9A 4HI1A 4DV2F 5KFLA 3TZZA 2B5JB 1O5JA 3WX8A 3UVJB 5ETLA 1W7WA 2RSQA 4DQRA 2ZEJA 3T9ZA 1KKHA 3BSCA 2CRLA 3HFVA 5J1EA 3CJQA 4LSNA 4ER8A 1P8GA 3U7JA 1M1GA 4L76A 4OHXA 5KT3A 1ZS6A 3JQKA 2HQFA 4OX9F 2QFIA 4NLPA 1TP7A 3I4HX 2R3VA 1J2VA 3OXFA 4DV4F 3BN7A 2QFJA 1H7WA 2J9EA 3NMRA 3LH2S 1Q78A 2XB2D 3W61A 3R9LA 4DLEA 2FTRA 4ED8A 5LXRA 1KQSR 4TYBA 1KVJA 1T8EA 1RHUB 4I2PB 5D4NA 2QL7B 4JV2A 3K5PA 1A9NB 2P8IA 3S7RA 1T9VA 3HK2A 2NSBA 3FBEA 3D0IE 3FRZA 5K5MA 1YZ6A 4I6AA 1Q5YA 4QJVA 2EKNA 2HURA 4K4TA 2V4JB 5C5JA 3G86A 3DFEA 1HHQA 3FMBA 3BQ1A 1DLOA 1P9QC 7AT1B 4G1QB 5HVGA 5DDOC 4DR7J 1BLUA 2HG4A 3PJXA 4G1IA 4DPXA 3SSQA 4MAKA 1VJQA 2BW7A 4FZVA 4WU2A 5C2GA 4JYAJ 1GTHA 1TUGB 3ISNC 4K4XA 1NHUA 4NA1A 3KLEB 2O1PA 4A8MP 1D09B 3UI3A 3IR6B 1TL3B 1RWUA 1KFDA 5KT7A 2MSTA 1RT5A 4DQQA 4ZJLA 1LWEB 2DHSA 2RIJA 4DR7F 5KT2A 4V19J 2DTJA 3GU0A 3KLHA 4MK9A 3C46A 2LDYA 2XTJP 4JYAF 3V4IB 3MCSA 1KQKA 5T7LA 2GVDA 1WTBA 1UJ5A 4EWTA 2XMVA 2NXNA 3QJPA 4LVOP 3UD4P 4NLSA 3D3BJ 4DPYA 3MDFA 1ZM3A 4NLTA 2J6SA 2KFZA 2VPZB 1NK9A 2VPYB 4FPRA 3QRQA 4WZMA 1GT8A 1R89A 2AT1B 4LR8A 1A7GE 3SBMA 1TTHB 2EVZA 3CDEA 1T05B 1SQFA 2SXLA 4O44B 4I2QB 2YNGB 4LIRA 2XG8A 2PC6A 3H2LA 3G9CA 2ATLA 1M5OC 2HQIA 2A18A 4NYOA 3OL6A 4DR2J 4LF7F 1T9YA 2KVQE 3QSIA 2LA4A 3FEYB 1FKOB 4QW9A 2R7VA 1N5YB 3Q8SB 2ZITA 3DLHA 4YB6A 5H9EJ 1S49A 1UWAA 2BVZA 4LREA 4CLFA 2KI2A 1FX2A 4IQXA 1RYRA 3ENVA 1T3NA 4NXMJ 4DR2F 4U7UD 2FHJA 2P9CA 3J7YI 5J2MA 1IN0A 2Z56B 3OR2A 3KYLA 2HWTA 3PY8A 2UXBJ 4MKYA 1L3SA 2AV5A 1FRMA 2BKPA 5A76A 1IBMJ 2J7UA 2GMJA 3ZO7A 3R7SB 3WIUA 2ZWOA 4OLPA 1U1LA 4NXMF 1DQ8A 1N36J 5HQMA 2B56A 2BZ2A 5B0DA 3NKYA 1CULB 5HATA 3UVJA 5F8HA 2UXBF 2M0GB 4YFUA 5KOXA 3DLBA 1T95A 4ZVGA 1SQEA 4QU7A 5JUMA 2F9JA 4QYZK 1WOPA 4OI1A 2BW2A 3CJ2A 2FJVA 4K4SA 3P96A 2W2PP 4HT7A 1Q16B 3GFYA 2XMWA 5IS2A 1LQ9A 5IT4A 3QQCD 1S6OA 4L3NA 2VA2A 3NWRA 1RI7A 3OHBA 3BBBA 2RUGA 2GMHA 1RHRB 5E2QA 1UEVA 3KUHA 4P52A 4LSLA 1IKVB 5ETRA 3FQLA 1G7CB 3V6HA 2GHVC 4DX8H 4CLLA 4LF4J 3W9IA 4O4GB 2V4JA 1L3UA 2VICA 4CO2A 1VC6A 3TA0A 1GQEA 4PPDA 4OMFG 3F41A 4USTA 3R5AA 1OQ3A 2RF2A 2E5HA 4G1QA 1YQHA 4RO0A 5K8OA 4IFVB 1SPBP 1U09A 1LOUA 2ADBA 2IM0A 4OLOA 2CPYA 4LF4F 2LFVA 5LM7E 2YTCA 1QLNA 3PTWA 2CJBA 2FIUA 2MKKA 5SUHA 2CPZA 3OR1B 2XSJB 1NH8A 2OTJS 2RB7A 3NS6A 3BBFA 4QPTA 1XK8A 2G1HA 2L3MA 3SCJE 1RWVB 1C4AA 4Q43A 1UW9A 4WFXA 1I3OB 1HBUA 3KUGA 4I69A 2CZ4A 3N9UC 3V4IA 2GAHC 2OPQA 1VRUB 4FF1A 3BO3A 3EPGA 3IP0A 1VISA 4GO5X 2FJEB 1EP4B 2DBBA 1BD6A 1PC4A 2OPRB 2IM3A 1Y5NB 4USKA 4HYKA 4L74A 2IBKA 1MMNA 1VBKA 1T9WA 4S0MA 4OV1A 1IKYB 3RR8A 3RRGA 2CJXB 2VF3A 4DL3A 4M8LA 3HD2A 1SJ4P 3X3UA 2X51A 5CD4H 1DTQA 3T41A 4TY8A 4NE9C 1GAOA 1XC9A 2CNOB 4OFZA 2XS5A 1YHQS 1QAIA 1YSJA 5CCMA 4X62J 1HNWJ 4NOHA 5D4LA 2ZZMA 2YQ0A 1S4FA 2MKCA 3KNAA 1N5YA 3OL8A 4B3TJ 1D8YA 1FK9B 1R0CB 2C3MA 4NMLA 3U27A 4Y0FA 1VOMA 3MXHP 2DO0A 3FC9A 3P45B 5KFDA 3NS5A 4X62F 1HNWF 4DV1J 4LFBJ 1HWLA 2VV5A 4DV6J 3ZTRA 1NXIA 2V34A 1H3DA 3S01A 3GJSB 2Y1IA 3P49B 3T5KA 4G1PA 2Z2MA 4B3TF 2CFXA 4OX8A 4RU9A 2HVZA 3IFEA 4DL4A 1KVKA 2QSFA 2K7JA 2PN6A 5A2QY 3QO9B 3EM1A 3OVAA 2BACA 2EI5A 4LFBF 3W2WB 4DV6F 2E1AA 1M5VC 3E01B 3QGIA 3MM6B 5I42B 2W9CB 2R7SA 2IBOA 3EXYA 3H2VE 4LR9A 2B7CB 2MY7A 4X4UA 3K8WA 5J2PB 1CLFA 4C8NA 2DEJA 5A6WA 2FUG9 2EBEA 2ILYA 2DK2A 5KFUA 3TZYA 4ECTA 1YG0A 2EFOA 2F8HA 3NBPB 5DQGA 3J7ZT 1RDRA 3DGPB 3IAS9 4M5LA 2C3PA 5G4DA 2I0XA 1CJUB 2B4OA 1RT6B 2B9WA 4I6YA 2R2TA 2ZH5A 4TXSA 4AL6A 2H48B 4JI6J 2CQPA 1KC8T 3N0VA 4ECYA 2Y3YA 5KFOA 2HHPA 3B4DA 3BH7B 4F25A 3TANA 1DBDA 2KJWA 1RHMB 2AQ4A 2HS3A 2B9EA 4F04B 2PEBA 1FESA 4Y2KA 3H8YA 2CG4A 4JI6F 1QSYA 4B17A 2MKYA 3MMJA 1M1HA 2AZ1A 2VG5A 2YX4A 4OJ3A 1F5BA 1U49A 2AJ0A 1SB6A 2CQ4A 4DPTA 3PJ9A 4IFVA 2HAFA 4GO7X 1Z2LA 3EGWB 4IRDA 3W60A 4RWWA 2GNKA 4AXIA 1LFWA 4FYDA 3OR1A 4GVBB 5D4PA 1N5VA 2P5VA 3CCZA 3FCHA 1EAYC 4IDKA 2FY1A 2G0JA 2G0CA 2V67A 2NQPA 3OTDA 3OXGA 1HBMB 1U26A 1UFLA 1X4DA 4WP8A 2EC0A 2HHQA 1XBWA 1IKWA 2YH1A 1EP4A 1JJ4A 3T1AA 3J80U 4TNOA 3UDCA 2HS4A 4IOBA 1JLBB 3FCWA 4LFCJ 2E9RX 3FBBA 3OTOJ 4P2MA 1KOOA 2BOPA 1SIWB 5KG2A 4WP3A 2I2YA 1UAWA 1RK8A 2D9OA 5KFBA 4JI0J 4OIXA 4HEA9 3FEZA 2VG6A 4LFCF 2XWYA 2O66A 4OX7A 1UVMA 1FDBA 4R0EA 1S6QB 2N7YA 2I1RA 1HHTP 1RSCA 4RBUA 3OTCA 4KH1B 1FI4A 2J0QD 4R8UB 2HWHA 4DHVA 3Q8QB 4JI0F 5D3GA 2FPHX 2IY5B 2XLKA 2H4WB 2B7BB 3CC4S 1H38A 4NPOA 3GILA 3UW1A 1DRZA 4YP3A 3OQ2A 1HQUB 2KB2A 1RISA 1CEZA 3ZC4A 2JSXA 1S97A 1ZOTA 5A8KA 2VZ9A 3DN9A 1MMLA 4IG0A 1ZBTA 2IRXA 2IYIA 4BCAA 4B3SJ 3R5GA 3T19A 3VAJA 3VTIA 1GXUA 5I3UA 4EU0A 1KR4A 3I0SB 1RABB 3E01A 4CNYA 3MM6A 5I42A 4JI8F 2W9CA 2JLEA 5KOWA 4LRAA 2D7SA 2OEJA 5J2PA 4KTQA 1DARA 3G8QA 5DRKA 4B3SF 3PJWA 4KPCA 1EIYB 4K4ZA 4WIQA 5SZTA 1KD1T 1XNQF 4GVLA 3TX8A 4NZ0A 4M95A 2QT7A 4ZITA 5HANA 1TK8A 1WC0A 1ACMB 1YK9A 1RT1B 3A12A 3TJ9A 3DGPA 5KTQA 1I1GA 3FZ2A 3O3LA 1PGZA 2UXDJ 1CJUA 1RT6A 3UD5A 5JVHQ 4QW8A 2XMTA 3TYTA 1VQNS 3HVWA 2CJQA 3MR3A 3MAHA 3SFUA 3W3SA 3ETOA 3H2UB 2RQMA 4X4TA 4UQGA 3VZIA 1S0VA 1B7YB 4K59A 3V6JA 5AE2A 2QX0A 2QG9B 1U1QA 4U95A 3M4XA 2G4BA 2A0FB 3K58A 2XGQA 4B9UA 1RA7A 4I0WA 3CUNA 1X9SA 4N7TA 3CCSS 2AYEA 4B9MA 1PAUB 2RHSB 2M8HA 2E9TA 4F4ZA 4J9NA 4KV8B 4GKKJ 2NPIA 4J9SA 2AP6A 4RNHA 4DS4A 1I6JA 4LF9J 1MN9A 2BBEA 1NK6A 2BABA 1IWAA 1ZAVA 3C66A 1WKLA 4NWBA 3P8BB 3MFIA 3HFKA 4OHWA 4GKKF 3NGDA 2Q66A 3BYRA 2ZM6J 2BJ1A 3RW7A 2RNEA 4UZBA 1V5VA 1SVDA 1O0PA 4LF9F 1RT4B 1JLBA 3CVKA 3Q89A 3H5XA 2R7OA 1Q7YT 1EARA 4ED4A 2OP5A 5KT6A 2UXCJ 2WVEA 4KE5A 5ETVA 2VC1A 3G6VA 3LP2A 2YKAA 4MKAA 4DF8A 5HLFA 3PRDA 2GMLA 3MAAB 3EVOA 3GYGA 3W7BA 3E51A 2UV8G 1HPZB 3JSYA 2P2CB 3P5TL 1WF1A 1HI8A 3EUNA 1MROB 1S6QA 3CCES 4X84A 2UXCF 1BQNB 1Q95G 4EBCA 2HFOA 1UVNA 2YNFB 3O6QA 4R8UA 4J9KA 1X5SA 5A0YB 4PEOA 3RB3A 5BYRA 2HMIB 5ADZA 1OO0B 4U8YA 2UUBJ 1M5SA 4AD6A 4EO6A 3QMQA 4ZLLA 2BV3A 1CG2A 1VQ9S 3SQGB 1PSDA 1RTJB 1UVKA 1GEHA 2JHEA 3FNNA 1U1MA 1YBUA 3NNHA 1SJQA 1HQUA 2XMAA 7FD1A 3DRSB 1I5OB 3KNGA 4AL5A 4CH7A 2C2MB 2VBYA 2UVRA 1YJRA 4DLGA 1NU4A 4NYPA 2V8PA 4USMA 2ASLA 4U7CA 4OI2A 4ZPDA 3F56A 1KN6A 3RBXA 2YPZA 4OI0A 2IYGA 1TFWA 2IJRA 5D4OA 3JAMY 4DX6A 2KN4A 3A1YG 5BXIA 3CJ5A 2FY8A 3TVKA 3IM8A 3ZNJ1 1VBYA 4NRUA 2OHDA 2KZZA 1JLEB 3UCZP 3LPYA 3CDWA 2GV1A 1KS2A 3MMAA 5HO4A 5J2QB 5DGBA 3EGNA 1RWKB 3OTEA 3Q24A 4X4QA 3CO9A 1UZDA 5A8RB 1VBXA 2ZH9A 1RWMB 1U6ZA 3HHLA 3MOZA 2W2QP 2DH7A 2XSFA 3PDNA 2KL8A 1EETA 2DVIA 2ZBIA 4FF4A 3D3CJ 4F2SA 5C25B 3VAFA 2DNLA 4QYZJ 1DURA 2GC8A 1AB8A 3M2VB 3FEXB 2CPHA 1TMMA 5KT5A 2DO4A 4CI0B 5CXTA 1FE0A 3IGNA 4B9VA 2QSWA 4MKVA 2R8IA 4Y3CA 4Z2XA 4ECXA 2B6AA 5C42A 4USWA 4CO1A 1TKTA 3RU0A 3LP0B 1VQSA 2QMWA 1K1QA 1SJRA 1RBLA 1WEYA 5HQ8A 2OPPB 1FCAA 1VQLS 4IR9A 2ZHBA 3NGTA 1VC0A 2RKIA 1UP1A 3OV7A 3LALA 3DCAA 2UU9J 3CXCR 2R9LA 1QAJA 4J9OA 2AYMA 4E0DA 4QWCA 3CCJS 4DU7A 4F4WA 1U1KA 1BY9A 1HYSB 4DXLA 3OFEA 2Z58B 3GFZA 4YS2A 4CLWA 1YI2S 5F41A 4DN9A 4MKBA 1TKXB 2RHQB 2ZHAA 2PMZD 3IA0A 4ICLA 2RILA 3MEKA 2M4MA 8AT1B 1HNIB 3CT9A 3NP5A 1VS3A 1RXOB 5FIIA 4BC9A 3EZOA 3DU5A 1L3VA 3KWMA 3NAIA 3TZWA 4KSEB 3AH6A 4ED2A 2LQBA 1Y0HA 3L7UA 1RT2A 2VFUA 4ZLNA 2DPIA 1HPZA 3I6PA 3CMES 3QATA 2UUAJ 3GIIA 2E1RA 1MROA 2UUCJ 2JFDA 2WBRA 3HVTB 2COLA 4F67A 3J7AN 1TL7A 5KFHA 1HA1A 1RTZA 3C14A 4F4KA 4NLWA 5C7PA 1FXDA 2F4VJ 1PJ6A 1RADB 4C11B 3L95X 5F3TA 3BREA 1CJVA 3M1VA 2G9OA 3MGJA 2UUCF 3KHLA 4OHVA 3MM7B 4PWDB 1V9OA 3CDAA 3DRSA 1H2UX 2N4DA 4DQIA 4W4MA 4ID5A 4K5RA 1FRXA 2FZCB 2F4VF 3W5YA 1OS5A 1U2RA 3O8WA 1SKUB 3ZXWA 2ZH1A 3KJQB 3A13A 1NHVA 4Q8FA 3CDBA 2FVSA 4LF8J 3OVBA 3O5TB 1EJ7L 5B0GA 4PKDB 4RW7B 2ASDA 3G4SS 2F1FA 2ZWPA 3VAMA 1VIXA 4LF1A 2OEMA 3QZ7A 4Z37A 3B4MA 3CJKA 3CJ4A 2KT5A 4LF8F 1D9AA 1G2EA 3M6UA 3D1QA 2PI4A 2VDHA 2W8KA 2UUWA 2IHR1 3RAXA 2BM0A 3RG6A 1X4FA 5CD4A 1PYOB 2XCAA 1IM6A 1R0BG 4W98A 3DLJA 4TU9A 1RKJA 3VWSA 2HK2A 3QNWB 1OMSA 4DSLA 2HVEA 3OJUA 3SV3A 1UFWA 4RR5A 2AJ4A 1NO8A 2KU7A 2ZH7A 4YEAA 3D6HB 4PUOB 2RS8A 1S9GB 3DOLA 4UT4A 4CLYA 2W4CA 4MH8A 4TU7A 3QAUA 4C0BA 1Q0NA 1YJNS 4KIAA 1DQ9A 1YVFA 1VQ6S 3LP0A 4V1Ak 4WTYA 1GMWA 1HMVB 3TUIC 1UVIA 5DZ7A 3MR7A 1RTIB 2DISA 3GFXA 3PW4A 4FNIA 4J9UE 2XO6A 2ZH8A 4KFBB 1ZYQA 5L9NA 4AQYF 2VC0A 4DSEA 2IFXA 5LXYA 3CMAS 5HBMB 1NJYA 2K2PA 2FHKA 3CJRA 3N5FA 4EMDA 4DPUA 2XYPB 2QJ3A 2NYHA 1VLOA 2ZHOA 4NLXA 5BYSA 5KFXA 2AWZA 4ILLA 5ETQA 3GIRA 3MHYA 5AE3A 1S1VB 2ROEA 4AT1B 3NGSA 2ACYA 1AT1B 1UL3A 2CJYB 2Q43A 1AUSL 3KK3B 3QT5A 4J9VA 3W8PA 2HVIA 3MEDB 5F8MA 4IQMA 2YQ1A 1YDLA 3MD1A 4WU3A 1QE1A 4JB8B 3JQMA 3GCWP 1H98A 3DYAB 1M1KT 5M2PA 1MN7A 4JI5J 3VAKA 3MEEB 2DGXA 3K59A 4YN3B 1QAXA 4J9RA 1FNMA 4RNFA 4CLPA 5GAEU 1TMJA 2YKMA 1XIQA 1Y11A 1U6FA 2QMXA 5EUHA 3DHWC 1FX4A 2R2SA 4JI5F 3CC7S 1S6UA 4B9TA 3TAMB 1S0NA 1MMDA 2LXIA 1F6TA 1QAYA 1L3KA 3DLEB 3K8VA 2DNPA 3ENAA 4KR0B 4ZPCA 2BOAA 4Q0BA 3BM7A 2FB0A 1QVGR 2V69A 3D54A 3MM7A 4PWDA 3OW2R 3BJYA 4P2SA 1C0TB 3DOMA 2GVZB 4LRCA 4LBPA 2Z8QA 3SEOA 3I82A 1KBRA 3A3OB 3BPDA 3W5XA 3EVMA 5CYQB 5H1SV 1GK8A 4ZOSA 1JLGB 2DY1A 2WVCA 4ELUA 5C24B 3I0RA 3G82B 4C8OA 4ETXA 2CNLB 4QCLA 3PIOQ 3DOKB 3M8QA 4K4YA 2MQQA 3AQOA 2IVMA 1N8RT 3I5BA 3OFHA 5GAGU 3FDSA 5K14B 3BGRB 1NSPA 4ZPVR 2BQUA 3DHXA 1NEEA 2VD3A 3GZ7A 3UNYA 1JXLA 2CWKA 3T3FA 2HYIB 1N4LA 2RRAA 3RR7A 2FC9A 4DX7A 1CJTB 1GNKA 3Q83A 2VL1A 2DGOA 4IG3B 2C2ZB 3QFHA 4Q8EA 2K3KA 4UF4A 5BYQA 3IXQA 3TOQA 5H9EK 4JV5J 1S48A 3EMTA 2DGWA 5KFJA 2RDIA 3VQTA 1RHJB 3E8OA 3DLLQ 1KTVA 1YLXA 4OJHA 3PYGA 4OZLA 4F02A 2OPSB 1RHQB 2X7IA 1S1XB 4ECQA 1IKXB 2XS2A 2VFSA 5D0HA 2KHCA 1LWCB 1JNRB 1CVJA 4JV5F 2ZOGA 1TU0B 2EK6A 1CS4A 2C3UA 2WBMA 4D3HA 3QJJA 1HI0P 2HQDA 2W7PA 3KLFB 3N28A 1C1CA 1IVZA
chains in the Genus database with same CATH topology
3B54A 3EICA 3NGTA 2HURA 3VVUA 3ZTRA 2DY9A 3FBCA 3FCVA 1LEOA 1MN9A 1JXVA 1U8WA 5CAAA 3ZTQA 4O0NA 2HVDA 3Q8VA 3G2XA 1XIQA 1WKKA 3VGVA 3WX8A 1WKLA 1B99A 1HHQA 1XQIA 1NUEA 1W7WA 1NSPA 5IOLA 4DZ6A 3BH7B 4S0MA 4ENOA 4FKYA 1S59A 5C7PA 1K44A 2DYAA 2CWKA 4DI6A 3VGSA 3ZTSA 4ANEA 2VU5A 1BHNA 3JS9A 4DUTA 2ZUAA 1HIYA 1LWXA 3FCWA 1NPKA 3Q83A 3DKDA 3EJMA 4EK2A 3EM1A 1F6TA 3FBBA 1BUXA 4HR2A 1ZS6A 2AZ1A 1NDKA 3ENAA 4F36A 3Q89A 2NCKL 3DDIA 4ANCA 3BH6B 3EMTA 3B6BA 2DXDA 1F3FA 3ZTOA 1NCLA 1NSKL 3VVTA 3ZTPA 3PJ9A 4CP5A 3NGSA 4ANDA 4FKXA 3Q8YA 3ETMA 1S57A 1UCNA 1NB2A 3GP9A 3R9LA 3VGUA 3MPDA 4W98A 1NDCA 2BEFA 3BBCA 1EHWA 3GPAA 3PRVA 1S5ZA 3BBFA 3EVOA 3Q8UA 5CABA 3FBFA 1B4SA 1NDLA 4F4AA 3NGRA 2HVEA 3FKBA 4WBFA 4UOFA 1WKJA 2B8QA 3VGTA 5BXIA 1NSQA 4C6AA 3EE3A 1NLKL 1NHKL 3BBBA 4KPCA 1BE4A 3EVMA 2BX6A 2AZ3A 3L7UA 3Q86A 1PKUA 3ELHA 4UOGA 3FC9A 3FBEA 3NGUA 1MN7A 1NDPA 1PAEX 1KDNA 1VYAA 2DXEA 2B8PA 2DXFA 1HLWA 4UOHA 3EVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B54 A;  3EIC A;  3NGT A;  2HUR A;  3VVU A;  3ZTR A;  2DY9 A;  3FBC A;  3FCV A;  1LEO A;  1MN9 A;  1JXV A;  1U8W A;  5CAA A;  3ZTQ A;  4O0N A;  2HVD A;  3Q8V A;  3G2X A;  1XIQ A;  1WKK A;  3VGV A;  3WX8 A;  1WKL A;  1B99 A;  1HHQ A;  1XQI A;  1NUE A;  1W7W A;  1NSP A;  5IOL A;  4DZ6 A;  3BH7 B;  4S0M A;  4ENO A;  4FKY A;  1S59 A;  5C7P A;  1K44 A;  2DYA A;  2CWK A;  4DI6 A;  3VGS A;  3ZTS A;  4ANE A;  2VU5 A;  1BHN A;  3JS9 A;  4DUT A;  2ZUA A;  1HIY A;  1LWX A;  3FCW A;  1NPK A;  3Q83 A;  3DKD A;  3EJM A;  4EK2 A;  3EM1 A;  1F6T A;  3FBB A;  1BUX A;  4HR2 A;  1ZS6 A;  2AZ1 A;  1NDK A;  3ENA A;  4F36 A;  3Q89 A;  2NCK L;  3DDI A;  4ANC A;  3BH6 B;  3EMT A;  3B6B A;  2DXD A;  1F3F A;  3ZTO A;  1NCL A;  1NSK L;  3VVT A;  3ZTP A;  3PJ9 A;  4CP5 A;  3NGS A;  4AND A;  4FKX A;  3Q8Y A;  3ETM A;  1S57 A;  1UCN A;  1NB2 A;  3GP9 A;  3R9L A;  3VGU A;  3MPD A;  4W98 A;  1NDC A;  2BEF A;  3BBC A;  1EHW A;  3GPA A;  3PRV A;  1S5Z A;  3BBF A;  3EVO A;  3Q8U A;  5CAB A;  3FBF A;  1B4S A;  1NDL A;  4F4A A;  3NGR A;  2HVE A;  3FKB A;  4WBF A;  4UOF A;  1WKJ A;  2B8Q A;  3VGT A;  5BXI A;  1NSQ A;  4C6A A;  3EE3 A;  1NLK L;  1NHK L;  3BBB A;  4KPC A;  1BE4 A;  3EVM A;  2BX6 A;  2AZ3 A;  3L7U A;  3Q86 A;  1PKU A;  3ELH A;  4UOG A;  3FC9 A;  3FBE A;  3NGU A;  1MN7 A;  1NDP A;  1PAE X;  1KDN A;  1VYA A;  2DXE A;  2B8P A;  2DXF A;  1HLW A;  4UOH A;  3EVW A; 
#chains in the Genus database with same CATH topology
 2GGP A;  2KDO A;  4D3G A;  4PUO A;  1S9G A;  1NK7 A;  2GQ2 A;  1VK8 A;  1LW2 B;  4WYL A;  2H1Y A;  1UPP A;  2DCU B;  1HMV A;  5B0F A;  2MTL A;  1JLC A;  1VHF A;  2DRD A;  3NNA A;  2HZA A;  2EFG A;  3W8G A;  1U6B A;  3JQJ A;  4KFB A;  3R6L B;  2JC0 A;  1R8B A;  3ILL A;  2ZE2 B;  4YR0 A;  3LWL A;  3W63 A;  4WKR A;  4DCO B;  5BR8 J;  5KFT A;  3UPF A;  4QWA A;  4B3O A;  3NCQ A;  2NXE A;  1ZAX A;  2AYG A;  2VQE J;  2DHX A;  2W01 A;  5A2Q U;  4Y00 A;  2FVP A;  1U02 A;  1OY9 A;  3U1L A;  3UR0 A;  1TL1 B;  3RW6 A;  3DRP B;  2JH3 A;  4WTO B;  3KDO A;  1LW0 A;  1PKU A;  2V5H G;  5BR8 F;  1SJ1 A;  2AHO B;  1ZAW A;  3M32 B;  2OEL A;  4NZ6 A;  1VYA A;  4Q2L A;  3VVU A;  1HBN A;  3DYA A;  2LEA A;  4K50 A;  5CAA A;  2PFF B;  4F0K A;  3X1L B;  3QT8 A;  2CVI A;  2DHH A;  4RKU C;  4EGL A;  4K4U A;  4IOC Q;  2V6A A;  4K4W A;  3HT0 A;  2PO4 A;  1GTE A;  1R7I A;  4KY3 A;  1AUD A;  2VU5 A;  4RNO A;  2BYC A;  2F5G A;  3R8Y A;  1WC4 A;  3E3X A;  3EJM A;  3FVY A;  1Y7P A;  3DRX A;  2QRR A;  2AJ1 A;  4KYZ A;  2W9A A;  2X1F A;  4P75 A;  3TAM A;  2LEP A;  3DRY A;  1JLF A;  1YRX A;  3DLE A;  2JLG A;  1NZA A;  4RW9 B;  3MCN A;  3HM9 A;  1VQY A;  4LF6 J;  4X2B A;  5LL6 d;  3G87 A;  1C0T A;  5KG0 A;  5H9F K;  4I1T A;  1AYE A;  2MLX A;  2FLO A;  3OSN A;  2B3T B;  1CSJ A;  2WVB A;  3ZZY A;  4MYU A;  3PFE A;  4QYR A;  1T03 B;  1H6K X;  2V4R A;  1DZ5 A;  1BQM A;  3NMA A;  3L3C A;  2EFP A;  2BRK A;  4LF6 F;  1JLG A;  3MM9 B;  4O23 A;  4PG6 A;  3CCQ S;  3G82 A;  4OYO A;  2DEI A;  2OKQ A;  1CJK B;  3D2W A;  4KB7 A;  3LGM A;  5DET A;  2VOP A;  3DOK A;  4FKY A;  1WTF A;  4DSI A;  1FNO A;  4KPY A;  4B02 A;  3BGR A;  1J5E J;  2CA9 A;  3GG1 A;  1HKA A;  4ECW A;  2RH3 A;  5JJB A;  2MQ8 A;  1VQ4 S;  1CJT A;  1H72 C;  1SV5 A;  2FZG B;  2V9K A;  2R2R A;  4IG3 A;  4CYU A;  3TRG A;  4ES1 A;  5E3P A;  4CP5 A;  5B0B A;  2OH2 A;  1FRL A;  2NZ4 A;  2F4F A;  3G8T A;  1J5E F;  3WQP A;  4UOF A;  1NK0 A;  2OPS A;  4P7T A;  1XR6 A;  1S1X A;  1NND A;  4KGK A;  4CTA B;  2HK3 A;  1YKW A;  2QN6 B;  1NKC A;  1MWQ A;  3KK2 A;  1ZPW X;  2OLW A;  3BQ2 A;  1UTA A;  4DL0 C;  1LWC A;  4TN2 A;  2Q1L A;  5KG4 A;  5GAH I;  1SKS A;  3T5L A;  3KLF A;  3M8P A;  2ILZ A;  5HK4 A;  2FJX A;  2ASY A;  3KLI B;  6FD1 A;  1ZTT A;  4F4Y A;  2VON A;  3L7O A;  4P10 A;  2V50 A;  4OYZ A;  4NEZ A;  4DX5 A;  2AU0 A;  3Q2S C;  3MOJ B;  3M30 B;  2LP4 A;  4RW6 B;  3WHI A;  4ANE A;  5KFC A;  3GV8 B;  3F0N A;  4FDF A;  2MZS A;  1ELO A;  2VG7 B;  1WWH A;  4J7C A;  2VJV A;  4M5D A;  4NCA A;  2LU2 A;  3ILJ A;  5KFW A;  2XHW A;  2N3L A;  4ZCK A;  4OZ1 A;  2I5J A;  4LFA J;  3H90 A;  2BJD A;  4KT0 C;  5I3P A;  3FSY A;  2WOM A;  4C4W A;  3NRB A;  4DWI A;  4EYI B;  2ZOM A;  3OJS A;  2LQ8 A;  2YNI B;  2VOD A;  2IA6 A;  2VOO A;  1WD6 A;  3MPU B;  2DNR A;  1RZM A;  2VFT A;  5JVG Q;  4N47 A;  2Z2Z A;  3BR8 A;  3UCG A;  1TL4 A;  1IJF B;  4HH0 A;  4ZCI A;  4HHU A;  3F73 A;  1E6V B;  2RT3 A;  4IH6 A;  4OZ0 A;  3DM2 B;  1XWL A;  3G6Y A;  1DTT B;  3IRW P;  3CCL S;  3FK4 A;  3W9H A;  4UOH A;  3QSY B;  3BO2 A;  5KG7 A;  3EIC A;  1FRI A;  3HT3 A;  1H73 A;  4X4N A;  4I6W A;  3FQK A;  2C2K B;  1WOS A;  3LOU A;  4DL6 A;  3HHE A;  5K8N A;  4KC5 A;  4YDX A;  1NUE A;  1R31 A;  1ZM9 A;  3GLJ A;  4O4R A;  4OYM A;  3TA1 A;  3KLG A;  1ZET A;  3CJ8 A;  1UZH A;  3UDE A;  2AIR B;  5EWE A;  1NDK A;  2MGZ B;  2DR8 A;  1FVQ A;  3KFW X;  3HSG A;  3VAI A;  5LMU J;  5HQL A;  1N6Q B;  2XM3 A;  2DHA A;  1Q81 T;  1N34 F;  3Q8Y A;  4YHH F;  4ZVO B;  1EX8 A;  2VDI A;  4HH1 A;  3OUY A;  3W2V A;  4F4A A;  2L9N A;  1LWF A;  3WC2 A;  1YTY A;  4WFN Q;  2M3D A;  3C6U A;  2CJK A;  3ELH A;  2AF6 A;  5LMU F;  4ES3 A;  5CYM B;  2PA8 D;  2BMB A;  3CMQ A;  3WIV A;  3NWG A;  2IPO B;  3TUJ C;  2L08 A;  4DR3 J;  4H4O B;  3M8Y A;  1J27 A;  2HVD A;  1F60 B;  2DT9 A;  3VQS A;  4QZV B;  1T03 A;  2HNZ A;  4TQR A;  2C2E A;  1S9E B;  3HD1 A;  4JI7 J;  4B9S A;  3DMJ A;  1WG1 A;  1RQ0 A;  3HUL A;  2XZD B;  2WON B;  3BGU A;  1FJ7 A;  3CE8 A;  4DR3 F;  4QIV A;  3H98 A;  2GX8 A;  1NJX A;  3CCT A;  3R2C J;  1FWL A;  3N6N A;  5KFY A;  1Q86 T;  2QYC A;  3OXL A;  1WC1 A;  2E7V A;  5AXL A;  2OUG A;  1PYT A;  3ADA C;  2CUY A;  4P71 A;  5FDL B;  2ZNY A;  1JWW A;  4H4M A;  4C6A A;  2LQJ A;  2CJA A;  1HQE B;  1VDH A;  2NPF A;  3MEC B;  1WF0 A;  3GCX P;  1SJ3 P;  3QGH A;  3HVR A;  1NPP A;  5MAO A;  2M2B A;  1EQM A;  3CUL A;  1U0H A;  4PG5 A;  1BQX A;  4KO0 A;  4PXB A;  2WHO A;  4CO4 A;  1TL5 A;  4PYD A;  4CTA A;  1HWU A;  2CQ2 A;  1WOO A;  1BXN A;  1KHW A;  3LW5 C;  3NNC A;  4FPI A;  2DHG A;  4DV5 J;  2QV6 A;  4JI2 J;  4C8M A;  3CC2 S;  3HO1 A;  5L46 A;  1HD1 A;  2MKS A;  4JI3 J;  4HI2 A;  4OZ3 A;  3IBC B;  2G2O A;  3AOB A;  1VMB A;  2VIH A;  1S1T B;  4WCE Q;  2BQR A;  2CPF A;  3C8Y A;  2FHJ D;  2HEK A;  4GMK A;  1FWP A;  4IUF A;  2C28 A;  2XMU A;  4UTG A;  1WNE A;  1I51 B;  3THP A;  5D8H B;  5K8M A;  5K20 B;  1FD2 A;  4WK1 A;  4DV5 F;  2RQ4 A;  5B7W A;  4JI2 F;  2VG7 A;  2FYX A;  1TAU A;  4I56 A;  4JI3 F;  3S6E A;  3W62 A;  4NAS A;  2DH8 A;  3K89 A;  3IWN C;  3GON A;  2HRT A;  1F5C A;  2XLJ A;  1RE1 B;  2EFN A;  3RAQ A;  1SH0 A;  4TY9 A;  3PZP A;  4RZR A;  3GTY X;  1RAI B;  2D41 A;  3C6T B;  2HBZ B;  3EE3 A;  4DV3 J;  4ECV A;  4DJB A;  4OX9 J;  4PCQ A;  1Q8I A;  3LA0 A;  2E1P A;  2MYF A;  3LP1 B;  1X4C A;  1DY3 A;  4DV4 J;  1NJZ A;  1U1P A;  2LCW A;  1PAE X;  1Z1Z A;  1TK0 A;  1D0E A;  2F8E X;  1KWM A;  3EVW A;  2QMU B;  1F9F A;  4QIE A;  1DTT A;  4YB1 P;  1NK4 A;  1BWE A;  1RYS A;  1IBK J;  3HLU A;  4DV3 F;  3OL9 A;  1WHV A;  1Y3J A;  4CT8 A;  1HBO B;  4N77 A;  5K8P A;  2CAJ A;  3MEG A;  5A6P A;  3QWU A;  3H4D A;  2CQ1 A;  3HZE A;  2CQC A;  4CLS A;  4L3K A;  1HWK A;  1HR0 J;  1BUX A;  4HR2 A;  3BEG B;  2A3J A;  3DXS X;  4OYI A;  1TZ0 A;  3DRR A;  2NCK L;  1IBK F;  3A8J A;  2R8H A;  4TLR A;  1DFD A;  2H9Z A;  2O5D A;  2MGZ A;  1NDC A;  2YKN B;  1FTR A;  4Y2A A;  2M88 A;  3SV4 A;  3BB5 A;  3MR6 A;  1HR0 F;  4WJB A;  1FJE B;  1REV B;  2B8Q A;  2NSC A;  1FXL A;  3MMB B;  3VR1 A;  1DHM A;  2H65 B;  4ECR A;  4QU6 A;  3CCR S;  4ZN1 A;  2V94 A;  2M70 A;  1RAC B;  2RDD A;  1VGY A;  5GAE I;  4Z7C A;  1N52 B;  2DD8 S;  2GAG C;  4WKY A;  2IAJ A;  1D1U A;  3ZZZ A;  1VLY A;  2V2Z A;  2R7X A;  4J90 A;  1BMQ B;  2OIH A;  1CQM A;  4EI2 A;  2ZH6 A;  3T6J A;  3HPO A;  2CQH A;  4FYV B;  3HHK A;  3GWC A;  4CCH A;  1JLQ B;  3PYF A;  4PRF A;  1QDU B;  1RAO A;  2K1R B;  3DLK B;  1SC6 A;  2RVJ A;  1U47 A;  4USU A;  3T5H A;  2GS8 A;  3P5B P;  3HHN B;  4IO9 Q;  4ANC A;  2D9P A;  3SSS A;  1X4E A;  2D3U A;  3LWM A;  3CCW A;  4NLO A;  1RAG B;  2ZBC A;  4WII A;  2YNH A;  2HGM A;  2HVH A;  3MPV A;  2W9B B;  4QIF A;  1A6L A;  3M9O B;  1HNZ J;  2H51 B;  3HVA A;  2MXY A;  3RYL A;  1R6V A;  3J7Z 5;  1RAE B;  4FP9 A;  5DO2 A;  4DR6 J;  3IMQ J;  5FDL A;  3NAH A;  5EX0 A;  2KO1 A;  4LF7 J;  2FHO B;  1EZZ B;  1SXL A;  5DQH A;  1HLW A;  2UP1 A;  1S1W B;  1HNZ F;  3RBD A;  4MTP A;  1RTH B;  1UA1 A;  2E5I A;  1S0O A;  1RAF B;  4NLG A;  4DR6 F;  3I96 A;  2CJ9 A;  1KLM B;  2N7C A;  2WSE C;  4AXJ A;  4DG1 A;  5T41 A;  5ETK A;  4OJG A;  1JB0 C;  2EG2 A;  2EBG A;  1TV6 B;  1S1U A;  1V3Z A;  1C0U B;  2HHT A;  1JK9 B;  3DLG A;  1TVR B;  4DFM A;  2C1E B;  4FXV A;  2WB1 D;  4ETZ A;  3PV8 A;  4C8Z A;  1FHT A;  2FJA B;  1HWI A;  3OTB A;  4MT1 A;  2DGS A;  3NLC A;  3GSD A;  1G6B A;  1S5Z A;  1Q53 A;  1FF2 A;  1AA1 B;  2ROG A;  3EGZ A;  1FKP A;  3G6X A;  3K5N A;  3C2P A;  2BE2 B;  1KON A;  4Q2M A;  1KP6 A;  2CPD A;  5E41 A;  1RT7 B;  4K0K J;  1FD8 A;  4BC7 A;  4ZP8 A;  1ZA2 B;  5U47 A;  1H2V Z;  3C6T A;  1JMT A;  1ZM4 A;  4GRS A;  3R7B B;  3QRP A;  2B5J A;  1SKR A;  1RCO B;  2AEF A;  2JFK A;  3VZH A;  3A8E A;  3VAG A;  2KRR A;  3DGV A;  1FKA F;  1WDT A;  1P6T A;  3T6B A;  1F3V A;  1ZTW A;  4YUD A;  2HBY B;  4K0K F;  4DFP A;  5D6G A;  3Q0A A;  2CWX A;  3TUZ C;  3ZZU A;  3O44 A;  3P4U B;  4BWJ A;  1QD1 A;  2P9E A;  2YWK A;  3SYZ A;  4PQU B;  2XNQ A;  4RJV A;  1CQN A;  4CLK A;  4IFY B;  3AJ1 A;  4X4R A;  2X1A A;  2JNJ A;  4X65 F;  3W9J A;  2CZ9 A;  4I2P A;  1NKB A;  2H5I B;  1C1B B;  4WYW A;  4ZVS B;  2J7K A;  1B64 A;  1GX5 A;  2N82 B;  1F2G A;  1WOR A;  3RUB L;  2W4P A;  1Q8K A;  1NHK L;  1P27 B;  2OI2 A;  5HVF A;  4NI2 B;  9ATC B;  3CJ3 A;  1GFW B;  4A47 A;  1D3W A;  3NOG A;  5E5N A;  1URN A;  4XPC A;  3M8Z A;  3T1Y J;  3IRX B;  2ZVI A;  2J6T A;  4U8V A;  1KSP A;  3RBE A;  3QWP A;  3H20 A;  3M6V A;  2Z2L A;  3J80 Y;  4DL5 A;  1B3T A;  2DNM A;  3EXC X;  4EBE A;  3KG0 A;  4X4P A;  4LF5 J;  3DC2 A;  1NKE A;  3M2R B;  3T1Y F;  4A4J A;  3KLE A;  3BQ0 A;  5KFE A;  4EUV A;  4KKO B;  1TL3 A;  4R5P B;  4M5G A;  4NA2 A;  2K3I A;  2BAN B;  1LWE A;  2MEW A;  4CH0 S;  2C22 A;  4WZQ A;  2FJB B;  5LJ3 Y;  2EW9 A;  4FF3 A;  4IH7 A;  4LF5 F;  3V4M A;  2BA9 A;  2GIR A;  4X64 F;  4FS1 A;  4CM2 A;  2KT2 A;  1S9F A;  2XI2 A;  3MD3 A;  3AXK A;  4H4K C;  4M5I A;  2FGC A;  5H9F J;  3HSZ A;  2W9B A;  2E1C A;  5E3R A;  3AXM A;  3S1T A;  1EKS A;  2DR7 A;  1U8S A;  1M5P C;  4A8Y A;  3H0P A;  4OYP A;  4WE1 B;  1VFJ A;  2MKJ A;  2B8P A;  1SIZ A;  4IKA A;  2RAQ A;  2DNK A;  5KG1 A;  2ZBP A;  5IV4 A;  2BDP A;  1X8D A;  1PYS B;  2XHC A;  3EDQ B;  3HMJ G;  3S8S A;  2MDA A;  1SC1 B;  1T05 A;  3ILI A;  4O44 A;  4MIW A;  3DNC A;  4I2Q A;  4PAA A;  3CD6 S;  2YNG A;  1T9X A;  3DI6 B;  1NBE B;  2MSS A;  5I3Q A;  5JXS A;  2ACM A;  3R5D A;  1JKH B;  2A6O A;  4Q5V A;  1S7I A;  1QVF R;  2MKH A;  3GIK A;  5B0E A;  3POT B;  3WZ0 A;  4F7V A;  1FKO A;  1UEK A;  4RW8 B;  3N01 A;  5LSO A;  1TV6 A;  1C0U A;  1Y9O A;  2XQC A;  5M2U A;  4ZVQ B;  1UCN A;  1V3S A;  2YKQ A;  1GXT A;  2ZUG A;  4ZLP A;  2MQM A;  4RBV A;  1NJI T;  3ILO A;  4V19 X;  4WF9 Q;  3VGT A;  2FLP A;  2EK1 A;  1SUQ B;  2LXF A;  2H3E B;  3C3L A;  1QJH A;  5D15 A;  2FDN A;  1FFS B;  3BS9 A;  5E0O A;  2RU9 A;  1IUJ A;  5D0R A;  4MMO A;  3J81 Y;  2HQ3 A;  4N56 A;  2C2O B;  3SFG A;  1SL1 A;  4XIU A;  1OSC A;  4GKJ J;  2V8V A;  2W25 A;  4P73 A;  1RWN B;  1CUL A;  3IO1 A;  2DGQ A;  2ZBQ A;  4YB7 A;  4J91 A;  4DF4 A;  1YGY A;  5J1P A;  2CQ3 A;  2D69 A;  3T1H J;  3N4W A;  3TVY A;  4DMZ A;  4L73 A;  3RB4 A;  2HQC A;  2MHN A;  4GKJ F;  4URS A;  4M5N A;  3E2E A;  1MSW D;  1TKZ B;  5KFK A;  4A8S A;  2J5A A;  4PQU A;  2R4F A;  1XR7 A;  4IFY A;  2JX2 A;  2GFF A;  3T1H F;  2QLW A;  1U1N A;  2LA6 A;  2R7U A;  2FJD B;  1WI6 A;  3MR2 A;  2J9D E;  1PC5 A;  4ZPB A;  3W5Z A;  4USV A;  1C1B A;  3PG9 A;  4B9L A;  4RL1 A;  1VJW A;  1IKV A;  3H59 A;  2ALZ A;  2ZZN A;  3BSO A;  2ZH2 A;  3JTO A;  5KFF A;  2CPI A;  4O4G A;  4LR7 A;  4OJ1 A;  4O0N A;  4Y2M A;  3ZZR A;  3R1L A;  2E5L J;  4HTI A;  4RUC A;  3M7V A;  2XMJ A;  4DZ6 A;  2XI3 A;  1OWX A;  2NYI A;  4EZ6 A;  1FJC A;  1KNZ A;  1XMO F;  1AW0 A;  1N0V C;  1MU2 B;  3THT A;  3NEK A;  1JX4 A;  4ZVF A;  2HIQ A;  2RJZ A;  1PBU A;  3PX4 A;  5J1E B;  3U1N A;  3TAP A;  3SDE B;  2XSJ A;  2E5L F;  2FD2 A;  1NSK L;  2EFV A;  4R5P A;  4WFA Q;  2RRN A;  2E44 A;  3ULH A;  3PRV A;  5L1J A;  2Z0G A;  5AXN A;  3K17 A;  3I87 A;  5C2C A;  3CW2 C;  1Z4U A;  1YJ9 S;  1T7P A;  1VRU A;  3NG8 A;  3HZG A;  1W25 A;  1BC6 A;  1S12 A;  4JI4 F;  3UN2 A;  1YIT S;  2APO A;  3FSX A;  2ZVS A;  1JJ2 R;  1KEK A;  4JOU A;  2OPR A;  2DR9 A;  4B3R J;  1JXV A;  4YQW A;  3PCO B;  1XTZ A;  2BJ3 A;  4WE1 A;  1U7L A;  3RB0 A;  1IKY A;  1WKK A;  4BLG A;  3CNQ P;  3GR1 A;  5IWA J;  1C4C A;  3VGS A;  4WXO A;  3B82 A;  4JP8 A;  3C16 B;  4WPA A;  4I7F B;  1JIH A;  3ZZO A;  1HNX J;  4XDD A;  3V5R A;  4PXE A;  1YWX A;  4B3R F;  2J0X A;  4RUA A;  3D68 A;  2YQ3 A;  1G1X A;  5IQQ A;  3CSK A;  1X4G A;  4QIG A;  5ETT A;  3POT A;  5IWA F;  3I5C A;  3ENQ A;  4RW8 A;  3DDN A;  3MUV P;  1FK9 A;  1MG7 A;  1YBA A;  3BPS P;  3H25 A;  1B4S A;  5KT4 A;  1FDD A;  4OV6 A;  1RT5 B;  3CED A;  1HNX F;  5GAD I;  2KHD A;  5FLX Y;  3KLH B;  4KGZ B;  2W2M P;  2DNH A;  4M94 A;  5IT9 Y;  2V8D A;  2AZ3 A;  2R2U A;  5T7L B;  2VBW A;  2ATC B;  1FER A;  2GVD B;  2KXF A;  3H5U A;  5L1L A;  3GJQ B;  4JI8 J;  2BXJ A;  2D3Z A;  4NA3 A;  5E3C A;  2MZR A;  3LQV A;  2WAQ D;  2EFQ A;  1Y10 A;  2HHW A;  1F5A A;  5IQ6 A;  2DRB A;  3QO9 A;  3W64 A;  1XNQ J;  2QYG A;  3KG4 A;  3W2W A;  3L9Z A;  3NY0 A;  3C15 B;  4J37 A;  3V2U C;  1RA6 A;  2HBR B;  2HZV A;  2L48 A;  5CZX A;  2FQQ B;  2VBZ A;  3FUY A;  1QM9 A;  3VAH A;  5F8N A;  3UN3 A;  3BH6 B;  3NCP A;  2CQG A;  2YWH A;  4LRB A;  1S7H A;  3PHE A;  3KXD A;  3R5B A;  5EWF A;  5HP1 B;  2GJ2 A;  2E66 A;  1HWJ A;  4C3K A;  3MPD A;  3A8K A;  3HHL D;  5KG5 A;  3MUT P;  1RUS A;  2MQN A;  3NBP A;  2G0I A;  5HL7 Q;  3EDR B;  1LKZ A;  1WKJ A;  3MZI A;  2W2N P;  2OEK A;  5J1N A;  4KH0 B;  4OZ2 A;  2X1B A;  4KQZ A;  4CRJ A;  5HMW A;  1HAR A;  2HQG A;  5CHC B;  3TJ8 A;  1Z2Z A;  4PG4 A;  2JVR A;  3CJS A;  1UET A;  2Y9H A;  3B8H A;  1R43 A;  1T0T V;  1IQT A;  1R8P A;  3EZ5 A;  1N54 B;  5IZH A;  4HHJ A;  2JEI A;  3A3N B;  3D0G E;  3ZTQ A;  1SBR A;  2CPJ A;  2W4D A;  1FFG B;  2WVF A;  1UFK A;  5B08 A;  2E9Z A;  1S0M A;  2F65 A;  3KKF A;  2W2O P;  4ZPT R;  1GX6 A;  4LUB A;  1RWX B;  4CM0 A;  2AGQ A;  2DR6 A;  5LMN F;  2DNQ A;  3MCO A;  3K5M A;  1OYE A;  1MU2 A;  4U7U K;  3SCI E;  4EZ9 A;  4WWS A;  1I94 J;  4N8N A;  4DPW A;  2PSZ A;  2XMK A;  1KQF B;  3AD9 C;  2JVO A;  4GVB A;  3SDE A;  4ZP7 A;  4WXW A;  1T02 A;  3FBF A;  4Y65 A;  3R2D J;  2UV8 A;  3TVZ A;  1UW4 A;  4NLU A;  1SKW A;  4ZN3 A;  1SCJ B;  1X31 C;  3R7N B;  2IA0 A;  1I94 F;  1WEZ A;  4O3S A;  3LAN A;  3CTR A;  2CDR B;  2QTW A;  3J81 j;  1HBM A;  3BF4 A;  1B0T A;  3QGP A;  4KHM A;  2V2Q A;  3HSD A;  4USI A;  4LSL B;  1Y5I B;  4ZPW R;  2ZNZ A;  1VQ7 S;  1VQK S;  4C9D A;  5KFV A;  2D74 B;  5DGA A;  1RBA A;  2ZDO A;  2PGC A;  4ILM A;  3K57 A;  4ZP6 A;  5GME A;  5LJ5 Y;  3DKD A;  2EG1 A;  5L9X A;  3L09 A;  3PXG a;  4JI1 J;  1H7X A;  2RML A;  3C16 A;  1T3O A;  4ZJO A;  3DDI A;  2H5J B;  4I7F A;  2RF2 B;  4FYX B;  1WHX A;  4DV7 J;  1N5T A;  3ICL A;  1U0S A;  3O2I A;  2QC3 A;  2JWN A;  1NDL A;  4OQJ A;  4PYA A;  4WBF A;  3RGI A;  3QGG A;  4PG7 A;  4IRK A;  3SI8 A;  4JI1 F;  1TUW A;  2MKI A;  2UVU A;  2M7S A;  1N0U A;  3CF5 Q;  5DG9 A;  3LAK A;  2DGV A;  4F26 A;  4DV7 F;  3MUM P;  2MY8 A;  1HBU B;  4MFB B;  1W2I A;  4YR2 A;  3H4B A;  2DKO B;  3RB6 A;  2NXJ A;  2O01 C;  2OPQ B;  3MM5 B;  2W8L A;  2JEG A;  4O3R A;  4P2F A;  3HSJ A;  1K44 A;  1NAQ A;  2XS7 A;  1HIY A;  1XJW B;  1B0V A;  3HCX A;  1WC3 A;  4OYW A;  3I0S A;  5F3Z A;  2W1B A;  3C15 A;  2GO9 A;  3BKF A;  3OFG A;  2DGU A;  4NCB A;  1DTQ B;  3CD7 A;  1YX2 A;  4TY8 B;  5HAO A;  1UKU A;  3IBW A;  2GHP A;  4NLY A;  4BWM A;  1EKR A;  5MLC V;  1RAA B;  5CAB A;  5HP1 A;  4E98 A;  1K0T A;  5HRO B;  4ERD A;  2AJ2 A;  3D67 A;  1NLK L;  3IAM 9;  4O3N A;  5HMZ A;  2HHS A;  3M6X A;  2YWF A;  1RT1 A;  1LXJ A;  4UY8 T;  3TW0 A;  5IXU A;  5G0R B;  2GHW A;  2PII A;  3OT9 A;  4RPF A;  1ARO P;  1W2B R;  3B54 A;  3BDP A;  1D8Z A;  2XWX A;  4I68 A;  2Q3P A;  5CH7 B;  1E6Y B;  3PVX A;  3IBF B;  4I64 A;  2OD4 A;  1UMJ A;  3CGI A;  4JUZ A;  3VAL A;  4OZ5 A;  2RQC A;  2B9Y A;  4BHQ A;  3RRK A;  3K0J A;  1XR5 A;  2CZV C;  2Z30 B;  1YJU A;  4MK8 A;  3UWT A;  5L39 A;  2MLZ A;  2Y8W A;  1X5T A;  4HDG A;  2QA4 S;  5KG6 A;  3L7P A;  2KG0 A;  4JBC A;  1WHY A;  1GMW D;  2LVW A;  4QBU A;  1YJT A;  2IVF B;  2J76 E;  4N76 A;  5KFM A;  2J7W A;  3ITH B;  8RUC A;  4KV8 A;  4B9N A;  2NUH A;  1MNE A;  1U25 A;  3M2U B;  8ATC B;  1PJ7 A;  1RAJ A;  1IBM F;  4BBY A;  1FA0 A;  2QE5 A;  1N36 F;  2HS0 A;  1P1L A;  5EN1 A;  2LQ9 A;  5F8J A;  1ZA1 B;  4P6Q A;  3MPY A;  3GV5 B;  2HWI A;  4OYX A;  4DPO A;  2XCP A;  3FBC A;  4CLZ A;  1WF2 A;  4ZVE A;  1QUP A;  1YZ7 A;  2M52 A;  4Y2C A;  2UUT A;  4A8X A;  4MIA A;  1K47 A;  3LGH A;  5F9N A;  1X4A A;  2XEX A;  2OAU A;  4G3I A;  1YRU A;  1GH8 A;  2YWW A;  2KJV A;  3H42 A;  1RT4 A;  2JJ4 D;  4IRC A;  1CPZ A;  2RE1 A;  3FMW A;  1N5Q A;  3CJT A;  4ZMM A;  3PAC A;  3GR0 A;  5FD1 A;  3SIP B;  5M2R A;  2VG5 B;  2N3O A;  1Q5V A;  3MAA A;  4QOT A;  3JSR A;  1Y5L B;  4DUZ J;  4C3L A;  3TEH B;  2OMO A;  2IJF A;  4NRT A;  2AEJ A;  4AE5 A;  4WFZ A;  9RUB A;  3EX7 B;  4DFK A;  2HNY B;  4M5M A;  5KFZ A;  2XC9 A;  6AT1 B;  1BQN A;  4RNM A;  3HKW A;  2POK A;  4E2F B;  2YNF A;  5THW A;  3PFO A;  5A0Y A;  3M05 A;  2GIQ A;  4DUZ F;  4DL2 A;  2HMI A;  4ED1 A;  3MF5 A;  4A8K A;  4IDK B;  4OX6 A;  1JQG A;  4N8O A;  2MZJ A;  2MQL A;  3SQG A;  4PXD A;  3AA8 A;  1RTJ A;  4MFB A;  3AOA A;  4CZC A;  3MM5 A;  1SH3 A;  1SL0 A;  2I38 A;  2R42 A;  2AYB A;  3PYE A;  2WSF C;  1IKW B;  2XNR A;  4LSZ B;  4LJM A;  2AGO A;  2WTF A;  2WW8 A;  2B4P A;  1S4E A;  4J9M A;  4RW4 B;  4AUK A;  3ZZT A;  4LMZ A;  2AKW B;  5DG7 A;  1X5O A;  5B09 A;  3M6W A;  2J0S D;  2JLF A;  1RU1 A;  2PEH A;  2FGO A;  1LK5 A;  2A2D A;  4CH1 A;  3V81 B;  3Q8U A;  3OVS A;  5IC4 B;  1RCX B;  4E8U A;  5HSP A;  4C3M A;  3AFG A;  2VG6 B;  4GC7 A;  4NZ7 A;  1JLE A;  4L75 A;  2ALY B;  2NS1 B;  1R3N A;  4NYZ A;  5HRO A;  5LOQ A;  3PIP Q;  1ZZN A;  5FJ4 A;  4ITS A;  2XZW A;  5J2Q A;  4DN0 A;  1N56 A;  2B4U A;  1QTN B;  5L1K A;  2BKO A;  2DPJ A;  1OJ4 A;  5A8R A;  1PIE A;  5G0R A;  1CC8 A;  5D3G B;  3ISZ A;  4JV0 A;  3UD3 P;  3CB4 A;  4FXD A;  5IV3 A;  3KK1 B;  1K0V A;  4TVA B;  5C25 A;  1E6Y A;  1ULR A;  2Q79 A;  1K9M T;  3WC0 A;  4PAB A;  4QWD A;  2MJU A;  4DU8 A;  3M2V A;  4X4O A;  3G71 S;  3HJV A;  1S6P B;  3BGF A;  2G2Z A;  5A8K B;  1VR6 A;  1TUV A;  4IG0 B;  4Q7A A;  4MIB A;  2PFD A;  1WUU A;  4ECS A;  1U48 A;  2AX0 A;  3ETM A;  4UUX A;  5I3U B;  4DV1 F;  4AQY J;  1T94 A;  3PEH A;  2BEF A;  3R27 A;  2LYV A;  3NGK A;  2NXC A;  3CD0 A;  5F8G A;  2UVV A;  2HW3 A;  1NSQ A;  1FE4 A;  4NLD A;  5D0E A;  2OJ3 A;  3CWJ A;  4U6P A;  3ET6 B;  3ITH A;  4ZIW A;  2OPP A;  3M2U A;  4ED5 A;  4M1K A;  1NPR A;  2H5E A;  1JLA B;  2HLT A;  5D77 A;  1WG4 A;  3VF0 B;  2DNO A;  3K5O A;  3Q22 A;  1U24 A;  2A6M A;  2PMH A;  4O3O A;  1TK5 A;  4XTT A;  1SC4 B;  3JXO A;  3PEJ A;  1HYS A;  2C2N A;  1M90 T;  1AXQ A;  1GMV A;  2XY7 A;  4MYT A;  5HVH A;  3H5Y A;  3OHA A;  1UJ4 A;  3HJF A;  4CLU A;  1TKX A;  4ZCM A;  4A8W A;  4KGM A;  2BJE A;  5ETP A;  1OPZ A;  2IC3 B;  3D1H A;  2GW8 A;  2GQC A;  3D1O A;  1HNI A;  3KMQ A;  4MK7 A;  2YBV A;  4XO0 A;  4JV1 A;  1CC7 A;  3A4T A;  2J8A A;  3D6M B;  4HT5 A;  4ALZ A;  5GVQ A;  3WX4 A;  2CPE A;  2VFR A;  2OTL S;  2HFS A;  4C97 A;  2HNY A;  2WSC C;  1NM2 A;  5JMN A;  2KZM A;  3HVT A;  4EFA C;  1RTD B;  2MZT A;  3M9N B;  2B43 A;  4EEY A;  2BR0 A;  3BN4 A;  2VB6 A;  2DNN A;  5KAK A;  3ZZ0 A;  4RU2 A;  4C11 A;  2QL5 B;  1D9F A;  2FVR A;  2KFN A;  4DSJ A;  1K1S A;  4HAC B;  3GJT B;  1QSL A;  2ERR A;  3I31 A;  1YRT A;  4DUT A;  3MWB A;  1X0P A;  1SQG A;  4EK2 A;  2DB1 A;  3QT7 A;  1HFE L;  2ROP A;  3JSB A;  4G6V B;  4DV0 J;  3AHP A;  1O51 A;  1CBK A;  3PW0 A;  3K5L A;  1WDD A;  5L1I A;  5ETN A;  1U4B A;  1RGV A;  4RW4 A;  5IFM A;  3I32 A;  5DS7 A;  3HXM A;  4HKQ A;  1F9E B;  2J6U A;  4NMX A;  4Y28 C;  3GIM A;  1FVS A;  3LP2 B;  4N41 A;  2YPY A;  2NUU G;  5HLF B;  4LF2 A;  4DV0 F;  1F2H A;  3V81 A;  1G4C A;  2WVD A;  2EKY A;  4RW7 A;  5F0U A;  2DXF A;  4IR1 A;  2LEB A;  3OTO F;  4IO1 A;  4ZDN A;  2AJF E;  1L5U A;  3GYN A;  2N4C A;  3IR7 B;  3RTV A;  2ZH3 A;  4CDI A;  2DNZ A;  1YBT A;  4ZVT B;  3I9V 9;  3TR5 A;  1KTQ A;  3U1M A;  4C48 A;  1FDN A;  4PZV A;  4J5O A;  2J8S A;  2R7W A;  1H74 A;  3KK1 A;  3AB4 B;  2B4V A;  3KG1 A;  2RU3 A;  3JSM B;  4XPE A;  1EB0 A;  2K7K A;  5AXK A;  2KXN B;  2KG1 A;  4LT6 A;  2HHX A;  2LEC A;  3OLA A;  5HMY A;  3ZNU A;  4XDC A;  1F3F A;  3ZTO A;  1S6P A;  2DRA A;  2JL9 A;  1J5O B;  4LQ9 A;  5D78 A;  4F0M A;  3WBZ A;  2IRY A;  3AAW B;  3QT6 A;  1VRQ C;  3ISN D;  4WFY A;  3VHQ A;  3QYY A;  2LDI A;  2D3O R;  4OI4 A;  3CCV S;  2YKP A;  3OL7 A;  2BKN A;  2WRM A;  2DH9 A;  3EYZ A;  3UFC X;  3ET6 A;  2QGF B;  1RTI A;  3AQP A;  5AE1 A;  1ICE B;  2BUN A;  1URR A;  1LV5 A;  3ENW A;  4L6V 3;  1WJ9 A;  1R6Y A;  1JLA A;  3VGV A;  4DQP A;  3MMA B;  3IGV A;  3RAM A;  5HBM A;  2QEX S;  3MM8 B;  3UDV A;  2EEY A;  4UUW A;  2YY3 A;  1VC5 A;  4NLV A;  3HHL B;  2LU1 A;  1VBZ A;  1AZS B;  2BQ3 A;  5DG8 A;  1WI8 A;  1N33 J;  5DLF A;  1VQ8 S;  1WHW A;  4C0H A;  3J81 U;  1EET B;  4DR1 J;  1S1V A;  1WSV A;  1PCA A;  3P6Y C;  3DXB A;  4UW2 A;  3KJN B;  4QR0 A;  3MTJ A;  1MW7 A;  3GB0 A;  3PR4 A;  2IC3 A;  3KK3 A;  1X60 A;  4CNZ A;  2A2C A;  5KFI A;  3MED A;  5AJ3 J;  2UXD F;  1NH7 A;  1N33 F;  2RUS A;  4J9Q A;  1KRP A;  2HZC A;  2FLN A;  4HL9 A;  3IR5 B;  3TO8 A;  4DR1 F;  1V3R A;  3W65 A;  1IQZ A;  3Q86 A;  1RU2 A;  1IXK A;  3MEE A;  2HGL A;  3PO4 A;  2B6A B;  5C42 B;  1TKT B;  3PKM A;  3QFW A;  4F4X A;  2VPX B;  3CPW R;  3UR3 C;  4PXC A;  2NRE A;  5KFA A;  3JYT B;  5LSR A;  5AJ3 F;  1R8C A;  3GSI A;  2Z4P A;  1D9D A;  2V63 A;  1RTD A;  3C19 A;  5HMX A;  3PW2 A;  3TAR A;  1VK3 A;  2RKI B;  4FYY B;  1S99 A;  2W7O A;  3D9B A;  3CCU S;  1Q7L B;  2GA7 A;  5KFN A;  4NLR A;  1P9Y A;  1TKD A;  4HAC A;  1VI7 A;  2IIH A;  3KDN A;  1X4H A;  1B0P A;  3R3T A;  5KG3 A;  4DOZ A;  2HFN A;  1FJG J;  3BZQ A;  2O3D A;  2KTQ A;  4FS2 A;  2L9W A;  2GVZ A;  1M5H A;  4U67 Q;  1HNV B;  1FRK A;  1IM4 A;  1JJC B;  2P9G A;  4ECZ A;  4ICL B;  5CYQ A;  5DZ6 A;  4K8R A;  2A1B A;  4F2R A;  2BRL A;  3NS7 B;  3M8S A;  4C2M A;  1DJ0 A;  2OML A;  5IC6 B;  1FJG F;  5C24 A;  4HLB A;  3RZA A;  2QLJ B;  3N79 A;  1S10 A;  3GJR B;  4ZP9 A;  2ZM6 F;  5DDQ C;  3CCM S;  5CQG A;  1RT2 B;  3IN5 A;  4ZS6 A;  2LLZ A;  2A10 A;  2JRS A;  5K14 A;  1U8W A;  4K7Q A;  1PBA A;  3A3P B;  2VUG A;  2MMY A;  3JTN A;  3MTK A;  1HL6 A;  1T9U A;  5IOL A;  2AW0 A;  2EC2 A;  1TL7 B;  4F0H A;  1NK5 A;  3C14 B;  4KGV B;  3K2Y A;  1RLD A;  1HQ2 A;  2OSR A;  2MPU A;  2OFG X;  2F8M A;  4KAI A;  5EGY A;  2EXU A;  1CJV B;  3M1V B;  3VV2 B;  3TJA A;  4RBT A;  1R8H A;  2DIT A;  5F8I A;  2FZK B;  3QBC A;  2DXD A;  3MMC B;  3JSM A;  3D6F B;  3ZTP A;  1IKX A;  1LFP A;  2E7X A;  3TUP A;  3MI7 X;  2KYZ A;  4ID5 B;  4FVC A;  2C2R A;  1J5O A;  2UUB F;  1X4B A;  4DSK A;  1KOH A;  1WG5 A;  2ZDP A;  3BDE A;  2W24 A;  1NK8 A;  2GZO A;  4U96 A;  1FEH A;  3IM9 A;  3NGU A;  1FEE A;  1QUV A;  3AD8 C;  3GFH A;  1PG5 B;  1RWO B;  1VQ5 S;  1F1B B;  2GJF A;  1VQO S;  3KUE A;  1LW2 A;  4Y2I A;  1C2P A;  4ZK7 M;  1LEO A;  1FDA A;  3GIJ A;  4HTJ A;  2IMO A;  2B0G A;  1EQ0 A;  5FLX U;  2Z2Y B;  1Q8L A;  2B51 A;  1MWZ A;  5EDW A;  1RWW B;  5IT9 U;  4W92 B;  5DM6 Q;  4DI6 A;  2XLI A;  4L72 B;  2ZE2 A;  2MHE A;  3MM8 A;  4M63 A;  5GAH U;  1PIL A;  2V4Q A;  2Y8Y A;  2GCF A;  2VBX A;  4MJK A;  1Y00 A;  1T11 A;  3CJK B;  1AZS A;  3V6K A;  4RUH A;  5E7O B;  3OD2 A;  1LXN A;  4YB5 A;  2UVW A;  3UQS A;  1Y3K A;  2HRY A;  1SJF A;  1TL1 A;  2V68 A;  3DRP A;  3BSN A;  4CO3 A;  1IBL J;  3W1Y C;  4KHR A;  5HJX A;  3M32 A;  4CQ1 A;  4X4S A;  4ECU A;  3KJV B;  4WFB Q;  3D28 A;  2XYG B;  4UOG A;  2ZJP Q;  3PYD A;  1X0F A;  1NDP A;  2DNY A;  4W90 B;  1N34 J;  4OZN A;  1FNX H;  4YHH J;  4I4B A;  4F3O A;  1YJ7 A;  3DOL B;  4DR4 J;  1MWY A;  1UEU A;  1Q8B A;  4DBQ A;  2XY6 A;  3G2X A;  4X4V A;  1IBL F;  2IM1 A;  4FYW B;  3JYT A;  4PPZ A;  2CVE A;  3CIM A;  2P6S A;  1RKI A;  3A8I A;  1FT8 A;  1JXE A;  2ADC A;  3JS9 A;  4BS2 A;  3SXL A;  3UDL A;  1F9H A;  4USJ C;  4M5J A;  4DR4 F;  4U9R A;  2E7W A;  2ZJR Q;  1ZPV A;  3CO0 P;  5D0G A;  4RW9 A;  1NCL A;  4Q44 A;  3IWX A;  1WSR A;  3NCR A;  3EZU A;  2IDE A;  4F3M A;  3UE2 A;  4AND A;  2ZD1 B;  3TNV A;  2DJW A;  2NLW A;  3PM9 A;  5F9L A;  1T9T A;  4UQT A;  3D66 A;  1HNV A;  2UU9 F;  4LRD A;  4NL5 A;  3THV A;  1U2F A;  1BE4 A;  3OBI A;  4KGX B;  3TI0 A;  2IJN A;  4DFJ A;  3KHR A;  3T9N A;  3MM9 A;  1KDN A;  1QE1 B;  3PHT A;  3M9M B;  4AYB D;  5LSL A;  1CJK A;  4F8R A;  4RWX A;  4QQB A;  1R8A A;  2X3D A;  2M9K A;  3SMZ A;  4LRF A;  3QIP B;  7FDR A;  2YKM B;  2EPI A;  4PWU A;  1X9M A;  3D0H E;  2GQQ A;  4CO0 A;  1GMU A;  4B3M J;  4ZCL A;  5ITH A;  2F3J A;  3IC1 A;  2QA4 G;  1OY6 A;  2FLL A;  4ED3 A;  2LMI A;  3QID A;  1Y4Z B;  2XBP A;  1O8B A;  4FF2 A;  2WZ1 A;  2OFH X;  1N32 J;  5EHH A;  1PO6 A;  1TR0 A;  2BJ7 A;  4Q0B B;  2UUA F;  1B70 B;  2F7V A;  4K5S A;  4B3M F;  2E5G A;  2ZC4 A;  1EHW A;  2PT0 A;  2IDL A;  3WDO A;  3MMC A;  4NEY A;  3AY0 A;  5AT1 B;  3DOM B;  4OYB A;  4X66 J;  2X3G A;  4QIW D;  2KXH A;  4PQA A;  2HGN A;  1N32 F;  5GMK a;  4YOE A;  4OHZ A;  3M8W A;  3KLI A;  4IOA Q;  2MZQ A;  3I0R B;  2U1A A;  1YIJ S;  2I9S A;  3ZZP A;  3M30 A;  4X66 F;  4RW6 A;  2FJW A;  2LQ5 A;  4M5K A;  3M8Q B;  1OIA A;  2CDQ A;  3AJD A;  1RHK B;  5IM0 B;  1NPK A;  4Q45 A;  4IH5 A;  3ONQ A;  2Y0S D;  2J0W A;  1QY7 A;  1NRK A;  1RWP B;  2DIU A;  2AJQ A;  3N5B A;  3TA2 A;  2DR5 A;  2XGP A;  2PDA A;  2CQ0 A;  3KTQ A;  2E29 A;  1M5K C;  2M5Y A;  2YNI A;  2HAI A;  4ZJQ A;  4O3P A;  3EGV A;  5L8R C;  1FO1 A;  1ROF A;  4ZA1 A;  4FXW A;  4H4K A;  4RLE A;  3PW7 A;  1UA0 A;  2V2V A;  2ZKT A;  1E6V A;  3HFZ B;  3CDU A;  3NXZ A;  1VIO A;  3DM2 A;  1FWK A;  2XY5 A;  3VCD A;  3AJ2 A;  2CNK B;  3JAM U;  2B9X A;  1ZZF A;  1W26 A;  1WAC A;  1CS4 B;  3KJV A;  1YJW S;  5EWG A;  3AA9 A;  2C2D A;  2Q6B A;  2JC1 A;  4P7V A;  1H0H B;  1C1C B;  3D6T B;  2DIV A;  3Q23 A;  3NL0 A;  2GGP B;  2WK4 A;  3OPK A;  1PJ5 A;  4HDH A;  3R5J B;  4ZVH A;  2V0N A;  4GC6 A;  4OL8 A;  4PR6 A;  5KFQ A;  1JLC B;  4LVN P;  1N6Q A;  4NLQ A;  2EWH A;  2KM8 B;  3MR5 A;  2C42 A;  3MFH A;  2CIM A;  4R25 A;  1XN9 A;  1S57 A;  5ETO A;  1RB0 A;  1F0X A;  1JJH A;  4B3O B;  2HHV A;  4TQS A;  3FKB A;  2ZD1 A;  5BJR A;  4DCP B;  2P6T A;  5CYM A;  2BX6 A;  5CA5 A;  3HX9 A;  2KVI A;  3D5M A;  3KOA A;  4URQ U;  4DCJ B;  2KFY A;  1R0A B;  4FVM A;  4H4O A;  4C8L A;  1LW0 B;  5CZV A;  2XYH B;  5B0C A;  2KKH A;  1XEZ A;  2LKZ A;  4ZVR B;  2YVS A;  2QLB B;  1S9E A;  1S77 D;  1U1R A;  2HKE A;  1HI1 A;  3H7H B;  1VQP S;  1HBN B;  2AD9 A;  2E1M C;  1U45 A;  2WON A;  1RBO B;  4OHY A;  3PNI A;  4BDP A;  3TWZ A;  4ZVU B;  2I8E A;  2IM2 A;  3QIP A;  3TX0 A;  2BM1 A;  2XZT B;  3LTO A;  1S76 D;  2GIF A;  2CKW A;  3L4B C;  3HHL C;  4URG A;  2ZOF A;  3JTP A;  5IT0 A;  1IR0 A;  3PW5 A;  1VHI A;  1UJ6 A;  4NCG B;  2V8G A;  1APS A;  4AL7 A;  4XK8 C;  1GXL A;  3AOD A;  2ZBR A;  4FBT A;  1BGX T;  2DCL A;  2V2K A;  2Y1J A;  3TAQ A;  1JLF B;  2HFV A;  3FJ2 A;  2DNG A;  2K06 A;  1HQE A;  3MEC A;  1Q1K A;  4I67 A;  1SC3 B;  4Z7Y A;  5GAG I;  1WEL A;  3R6G B;  3UNG C;  4K2J A;  1V6H A;  3BKU A;  1HD0 A;  1R27 B;  3MCM A;  3KMS A;  2F40 A;  4TYA A;  6FDR A;  3Q2T C;  4LBH A;  2WCX A;  2CAD A;  2FC8 A;  4DUY J;  1OYD A;  2MB0 B;  4KBI A;  1BQM B;  4DR5 J;  3OSP A;  1S1T A;  1S59 A;  3R1H A;  5HJY A;  2RQK A;  2LXU A;  4Y6I A;  2XMM A;  2ZFH A;  2AGP A;  2VA3 A;  4F3Q A;  2YXL A;  5IM0 A;  4F36 A;  4DUY F;  3T5J A;  5HI7 A;  2HIY A;  1X9W A;  2OD6 A;  1IR2 A;  4DR5 F;  4OYA A;  2R7R A;  3TEG A;  2VFV A;  2VKR A;  3DDK A;  2HPU A;  5KFS A;  3AOC A;  1M0S A;  4P9S A;  1SV5 B;  1TFY A;  2Z57 B;  4CYU B;  1K8A T;  1RJJ A;  4M5H A;  3HKZ D;  2VH7 A;  2ZC3 A;  3CIZ A;  4YME A;  1AFI A;  1SI9 A;  4CT9 A;  5F8L A;  2CPX A;  3LP1 A;  3G8S A;  5HN0 A;  2CG8 A;  2HBQ B;  3I5A A;  2PMW A;  1KLN A;  1N88 A;  2CQD A;  1HHS A;  2GJI A;  3G6E S;  3AT1 B;  2RS2 A;  3R5C A;  5DDR C;  1OSD A;  4Y34 A;  1S72 S;  4X65 J;  3QLH B;  1RP5 A;  5CCL A;  3J7Y U;  3KK2 B;  4K4V A;  2R8G A;  5L38 A;  4CO5 A;  1HBO A;  2Q6C A;  2J9D A;  4OI3 A;  3M8P B;  4A46 A;  3KHG A;  2V8H A;  2CNN B;  1V5I B;  3FRY A;  4KJI A;  3QPI A;  3ZTS A;  4A8O A;  2QL9 B;  3BR9 A;  4RUB A;  5A8W B;  2Y1L B;  5E3A A;  4A8Q A;  4QR2 A;  3B6B A;  4M5D B;  2YKN A;  3J7A 1;  4PG8 A;  1VQM S;  2I5J B;  3I9Z A;  2ABY A;  1REV A;  1TAQ A;  5KFR A;  4DL7 A;  1WC6 A;  2AEM A;  3MMB A;  3PO5 A;  2WOM B;  3NGR A;  3PRB A;  5GMD A;  1K73 T;  3PR5 B;  5DLG A;  2V9W A;  2F9D A;  4PWW A;  2I6W A;  3F44 A;  2NZC A;  3EWG A;  3GQC A;  1ITP A;  3PKY A;  3BO4 A;  2Y1R I;  2YH0 A;  3HI9 A;  3OFF A;  3UCU P;  4QR1 A;  3GYX B;  2BE7 D;  4X64 J;  1XMQ J;  2ZZT A;  1R0A A;  3RJM B;  4ED6 A;  1B7F A;  1B99 A;  3BKT A;  1JLQ A;  3RRH A;  2PD1 A;  4ENO A;  2Y0B B;  3GE9 A;  2CQB A;  2K1R A;  3I4P A;  3DLK A;  4ELT A;  4UOC A;  4KRW A;  4UZC A;  3HDS A;  1DQA A;  1SL2 A;  2VQE F;  3AB2 B;  5LT5 A;  2BJ8 A;  3KLG B;  5RUB A;  2CXE A;  4USH A;  2HND B;  5K9F A;  5E33 A;  4FBU A;  3FZB A;  1XMQ F;  4IYQ A;  2YWG A;  3B78 A;  2JOQ A;  4CWB A;  4DDF A;  3GG0 A;  4NCG A;  4OI6 A;  2KRB A;  2NXU A;  4ZKA A;  3GPA A;  3SCK E;  4CIO A;  4A8F A;  3N6M A;  1UWB B;  4F50 A;  3UO0 A;  3OUY B;  2QLX A;  1LNQ A;  3W2V B;  5E3Q A;  2MZ1 A;  1YJV A;  2HHU A;  5KFG A;  1KQG B;  1LWF B;  4O0I A;  4ELV A;  2OGU A;  3FFI B;  1LK7 A;  2YX7 A;  5I4M A;  1S1W A;  3C6U B;  4QPX A;  4WP9 A;  1NSA A;  2HFU A;  4TKT A;  1FXR A;  5T14 A;  1RTH A;  3FCV A;  2VQF J;  3UN5 A;  1DAX A;  1XER A;  2MQP A;  3PX6 A;  1FFW B;  3SZ2 A;  1FRH A;  2ZKU A;  2YKO A;  1KLM A;  1KHV A;  2H54 B;  1UVJ A;  1S79 A;  3R97 A;  4ED0 A;  1U1O A;  4EBD A;  1NB7 A;  3US5 A;  2HNZ B;  1XNR J;  1BHN A;  1FRJ A;  4C98 A;  3ZFV A;  3DMJ B;  1Q79 A;  2DGT A;  1TVR A;  4TLQ A;  3M8R A;  4AFF A;  2VQF F;  2W7A A;  3EPI A;  1U2C A;  3IG1 B;  4DEZ A;  2D3O 1;  3IS9 B;  4A48 A;  1XNR F;  2KT3 A;  2HFZ A;  3N6L A;  4G65 A;  4DQS A;  2BE2 A;  2G13 A;  1REG X;  4RX6 A;  1RT7 A;  4ZHR B;  3KLV A;  2ASJ A;  2QA1 A;  3LGN A;  4YR3 A;  1FTC A;  4H4M B;  1OQ6 A;  1VCT A;  4NXN J;  4C8Y A;  1UVL A;  2G1D A;  5J2N B;  1U0H B;  4KO0 B;  3Q8V A;  3QLH A;  1IR1 A;  2JEJ A;  2HLU A;  4ZPA A;  3U02 A;  4NXN F;  2K8G A;  1LWX A;  1N5S A;  2J9C A;  3SQO P;  3G96 A;  2JZ5 A;  1NZ8 A;  3KJF B;  1RAH B;  4K2X A;  4ATN A;  5ETM A;  4J9P A;  2RD5 C;  4QWB A;  5A8W A;  1H2T Z;  1QTM A;  3GMG A;  1NJW A;  4DZD A;  1X5P A;  2RRB A;  3D7S B;  3GP9 A;  2L9D A;  1VRT B;  1XMO J;  4RNN A;  2D1C A;  1RT3 B;  4B08 A;  4NI2 A;  3V6D B;  3LO3 A;  1IWG A;  3LAM A;  3IRX A;  3TP2 A;  2HSE B;  3OLB A;  4YY3 J;  1AFJ A;  1JNZ B;  1IJE B;  3DU6 A;  1UPM B;  2QZ8 A;  4C7Q A;  1WC5 A;  3HP6 A;  2F63 A;  4EYH B;  2QIF A;  2VPW B;  4ED7 A;  4P74 A;  4LFA F;  2E5J A;  3QAE A;  3FGV A;  4LSN B;  3M2R A;  4P2X A;  1KVI A;  2JEF A;  2H4Y B;  2R7T A;  2QO3 A;  3SSR A;  4JI4 J;  4KKO A;  2VJU A;  3AD7 C;  1X7V A;  4YY3 F;  4H54 A;  2YWE A;  3HF5 A;  4C0O C;  2R8K A;  3W66 A;  4OZJ A;  3MEG B;  2BAN A;  3PX0 A;  3K7R A;  2G2Y A;  2C3Y A;  2IVY A;  2OSQ A;  5DM7 Q;  4ID8 A;  2GO8 A;  5B0A A;  2VAS A;  2HND A;  3VVT A;  1QSS A;  2AX1 A;  3DRR B;  1G3O A;  1NB2 A;  3BV8 A;  3CD5 A;  1BWV A;  1WEX A;  3KHH A;  3MPW A;  2KYX A;  4ZLJ A;  2BE9 B;  3LPE A;  4C8K A;  2IMW P;  3JB9 k;  3CJ0 A;  2M8D B;  4UY8 5;  2VHG A;  1UWB A;  2ZH4 A;  3H5S A;  2WB4 A;  1SH2 A;  2HRU A;  2QA2 A;  4ILR A;  4ZVP B;  3H40 A;  4LIW A;  3NOC A;  1DLO B;  2XUL A;  3FFI A;  4TU8 A;  2IAJ B;  2X1G A;  3DI6 A;  2AMC B;  1HW9 A;  2RDJ A;  4LQ3 A;  1TEL A;  3I55 S;  1JKH A;  2XO7 A;  5KFP A;  2DYA A;  3D4J A;  2FVQ A;  4R0J A;  4ES2 A;  1KFS A;  3TZX A;  4N5S A;  5CYJ A;  2PA3 A;  3HHD A;  1TQL A;  2FHM A;  4XAK A;  2WW4 A;  2KH9 A;  4QWE A;  2KM8 C;  3Q8R B;  3P3D A;  2PE8 A;  3FSI A;  3O1L A;  2U2F A;  4DS5 A;  4NX9 A;  4FKX A;  5DDP C;  3TQE A;  3BBC A;  3IG1 A;  4J9L A;  1SUQ A;  5EX3 A;  3MUR P;  2JDJ A;  2PI5 A;  3IS9 A;  2YNH B;  2CQI A;  3MAQ A;  1OPI A;  2IRU A;  4FNH A;  1IBC B;  1MLA A;  4JI7 F;  1L3T A;  4KHP J;  3BSA A;  4ZHR A;  1N48 A;  2OO4 A;  2CYY A;  4HVZ A;  2ZJQ Q;  3GV7 B;  3SCL E;  5ETS A;  4CLT A;  2DXE A;  1O6X A;  2MQO A;  4EO8 A;  2QLF B;  3TQ1 A;  3QJL A;  2DY9 A;  5GAD U;  4YDD B;  1A0O B;  1ZH5 A;  4O3Q A;  1XQI A;  5J2N A;  4P72 A;  1ZM2 A;  2YX1 A;  4ZIV A;  2C3O A;  4LBI A;  4KHP F;  3BGL A;  2VKZ G;  1OY8 A;  1Q82 T;  2MJN A;  2R7Q A;  2ZUA A;  5DJB A;  3RBZ A;  3I56 S;  4DG1 B;  3Q8P B;  2R8J A;  5AXM A;  1TKZ A;  4WK3 A;  1XMB A;  3QRR A;  1S1U B;  3LUY A;  1P1T A;  1Q4R A;  2L41 A;  3DLG B;  2HHH J;  5DQI A;  3IWL A;  2FVC A;  3VGU A;  4DV2 J;  2NR0 A;  1RLC L;  4FN5 A;  5LMN J;  2MLY A;  1NME B;  3QZ8 A;  3LF0 A;  1VRT A;  5J2M B;  3OR2 B;  1HW8 A;  2O67 A;  1RT3 A;  4DSF A;  5F0W A;  3BGO P;  2UZA A;  1FKP B;  3V6D A;  3BYP A;  2HHH F;  4HHH A;  2BJ9 A;  4HI1 A;  4DV2 F;  5KFL A;  3TZZ A;  2B5J B;  1O5J A;  3WX8 A;  3UVJ B;  5ETL A;  1W7W A;  2RSQ A;  4DQR A;  2ZEJ A;  3T9Z A;  1KKH A;  3BSC A;  2CRL A;  3HFV A;  5J1E A;  3CJQ A;  4LSN A;  4ER8 A;  1P8G A;  3U7J A;  1M1G A;  4L76 A;  4OHX A;  5KT3 A;  1ZS6 A;  3JQK A;  2HQF A;  4OX9 F;  2QFI A;  4NLP A;  1TP7 A;  3I4H X;  2R3V A;  1J2V A;  3OXF A;  4DV4 F;  3BN7 A;  2QFJ A;  1H7W A;  2J9E A;  3NMR A;  3LH2 S;  1Q78 A;  2XB2 D;  3W61 A;  3R9L A;  4DLE A;  2FTR A;  4ED8 A;  5LXR A;  1KQS R;  4TYB A;  1KVJ A;  1T8E A;  1RHU B;  4I2P B;  5D4N A;  2QL7 B;  4JV2 A;  3K5P A;  1A9N B;  2P8I A;  3S7R A;  1T9V A;  3HK2 A;  2NSB A;  3FBE A;  3D0I E;  3FRZ A;  5K5M A;  1YZ6 A;  4I6A A;  1Q5Y A;  4QJV A;  2EKN A;  2HUR A;  4K4T A;  2V4J B;  5C5J A;  3G86 A;  3DFE A;  1HHQ A;  3FMB A;  3BQ1 A;  1DLO A;  1P9Q C;  7AT1 B;  4G1Q B;  5HVG A;  5DDO C;  4DR7 J;  1BLU A;  2HG4 A;  3PJX A;  4G1I A;  4DPX A;  3SSQ A;  4MAK A;  1VJQ A;  2BW7 A;  4FZV A;  4WU2 A;  5C2G A;  4JYA J;  1GTH A;  1TUG B;  3ISN C;  4K4X A;  1NHU A;  4NA1 A;  3KLE B;  2O1P A;  4A8M P;  1D09 B;  3UI3 A;  3IR6 B;  1TL3 B;  1RWU A;  1KFD A;  5KT7 A;  2MST A;  1RT5 A;  4DQQ A;  4ZJL A;  1LWE B;  2DHS A;  2RIJ A;  4DR7 F;  5KT2 A;  4V19 J;  2DTJ A;  3GU0 A;  3KLH A;  4MK9 A;  3C46 A;  2LDY A;  2XTJ P;  4JYA F;  3V4I B;  3MCS A;  1KQK A;  5T7L A;  2GVD A;  1WTB A;  1UJ5 A;  4EWT A;  2XMV A;  2NXN A;  3QJP A;  4LVO P;  3UD4 P;  4NLS A;  3D3B J;  4DPY A;  3MDF A;  1ZM3 A;  4NLT A;  2J6S A;  2KFZ A;  2VPZ B;  1NK9 A;  2VPY B;  4FPR A;  3QRQ A;  4WZM A;  1GT8 A;  1R89 A;  2AT1 B;  4LR8 A;  1A7G E;  3SBM A;  1TTH B;  2EVZ A;  3CDE A;  1T05 B;  1SQF A;  2SXL A;  4O44 B;  4I2Q B;  2YNG B;  4LIR A;  2XG8 A;  2PC6 A;  3H2L A;  3G9C A;  2ATL A;  1M5O C;  2HQI A;  2A18 A;  4NYO A;  3OL6 A;  4DR2 J;  4LF7 F;  1T9Y A;  2KVQ E;  3QSI A;  2LA4 A;  3FEY B;  1FKO B;  4QW9 A;  2R7V A;  1N5Y B;  3Q8S B;  2ZIT A;  3DLH A;  4YB6 A;  5H9E J;  1S49 A;  1UWA A;  2BVZ A;  4LRE A;  4CLF A;  2KI2 A;  1FX2 A;  4IQX A;  1RYR A;  3ENV A;  1T3N A;  4NXM J;  4DR2 F;  4U7U D;  2FHJ A;  2P9C A;  3J7Y I;  5J2M A;  1IN0 A;  2Z56 B;  3OR2 A;  3KYL A;  2HWT A;  3PY8 A;  2UXB J;  4MKY A;  1L3S A;  2AV5 A;  1FRM A;  2BKP A;  5A76 A;  1IBM J;  2J7U A;  2GMJ A;  3ZO7 A;  3R7S B;  3WIU A;  2ZWO A;  4OLP A;  1U1L A;  4NXM F;  1DQ8 A;  1N36 J;  5HQM A;  2B56 A;  2BZ2 A;  5B0D A;  3NKY A;  1CUL B;  5HAT A;  3UVJ A;  5F8H A;  2UXB F;  2M0G B;  4YFU A;  5KOX A;  3DLB A;  1T95 A;  4ZVG A;  1SQE A;  4QU7 A;  5JUM A;  2F9J A;  4QYZ K;  1WOP A;  4OI1 A;  2BW2 A;  3CJ2 A;  2FJV A;  4K4S A;  3P96 A;  2W2P P;  4HT7 A;  1Q16 B;  3GFY A;  2XMW A;  5IS2 A;  1LQ9 A;  5IT4 A;  3QQC D;  1S6O A;  4L3N A;  2VA2 A;  3NWR A;  1RI7 A;  3OHB A;  3BBB A;  2RUG A;  2GMH A;  1RHR B;  5E2Q A;  1UEV A;  3KUH A;  4P52 A;  4LSL A;  1IKV B;  5ETR A;  3FQL A;  1G7C B;  3V6H A;  2GHV C;  4DX8 H;  4CLL A;  4LF4 J;  3W9I A;  4O4G B;  2V4J A;  1L3U A;  2VIC A;  4CO2 A;  1VC6 A;  3TA0 A;  1GQE A;  4PPD A;  4OMF G;  3F41 A;  4UST A;  3R5A A;  1OQ3 A;  2RF2 A;  2E5H A;  4G1Q A;  1YQH A;  4RO0 A;  5K8O A;  4IFV B;  1SPB P;  1U09 A;  1LOU A;  2ADB A;  2IM0 A;  4OLO A;  2CPY A;  4LF4 F;  2LFV A;  5LM7 E;  2YTC A;  1QLN A;  3PTW A;  2CJB A;  2FIU A;  2MKK A;  5SUH A;  2CPZ A;  3OR1 B;  2XSJ B;  1NH8 A;  2OTJ S;  2RB7 A;  3NS6 A;  3BBF A;  4QPT A;  1XK8 A;  2G1H A;  2L3M A;  3SCJ E;  1RWV B;  1C4A A;  4Q43 A;  1UW9 A;  4WFX A;  1I3O B;  1HBU A;  3KUG A;  4I69 A;  2CZ4 A;  3N9U C;  3V4I A;  2GAH C;  2OPQ A;  1VRU B;  4FF1 A;  3BO3 A;  3EPG A;  3IP0 A;  1VIS A;  4GO5 X;  2FJE B;  1EP4 B;  2DBB A;  1BD6 A;  1PC4 A;  2OPR B;  2IM3 A;  1Y5N B;  4USK A;  4HYK A;  4L74 A;  2IBK A;  1MMN A;  1VBK A;  1T9W A;  4S0M A;  4OV1 A;  1IKY B;  3RR8 A;  3RRG A;  2CJX B;  2VF3 A;  4DL3 A;  4M8L A;  3HD2 A;  1SJ4 P;  3X3U A;  2X51 A;  5CD4 H;  1DTQ A;  3T41 A;  4TY8 A;  4NE9 C;  1GAO A;  1XC9 A;  2CNO B;  4OFZ A;  2XS5 A;  1YHQ S;  1QAI A;  1YSJ A;  5CCM A;  4X62 J;  1HNW J;  4NOH A;  5D4L A;  2ZZM A;  2YQ0 A;  1S4F A;  2MKC A;  3KNA A;  1N5Y A;  3OL8 A;  4B3T J;  1D8Y A;  1FK9 B;  1R0C B;  2C3M A;  4NML A;  3U27 A;  4Y0F A;  1VOM A;  3MXH P;  2DO0 A;  3FC9 A;  3P45 B;  5KFD A;  3NS5 A;  4X62 F;  1HNW F;  4DV1 J;  4LFB J;  1HWL A;  2VV5 A;  4DV6 J;  3ZTR A;  1NXI A;  2V34 A;  1H3D A;  3S01 A;  3GJS B;  2Y1I A;  3P49 B;  3T5K A;  4G1P A;  2Z2M A;  4B3T F;  2CFX A;  4OX8 A;  4RU9 A;  2HVZ A;  3IFE A;  4DL4 A;  1KVK A;  2QSF A;  2K7J A;  2PN6 A;  5A2Q Y;  3QO9 B;  3EM1 A;  3OVA A;  2BAC A;  2EI5 A;  4LFB F;  3W2W B;  4DV6 F;  2E1A A;  1M5V C;  3E01 B;  3QGI A;  3MM6 B;  5I42 B;  2W9C B;  2R7S A;  2IBO A;  3EXY A;  3H2V E;  4LR9 A;  2B7C B;  2MY7 A;  4X4U A;  3K8W A;  5J2P B;  1CLF A;  4C8N A;  2DEJ A;  5A6W A;  2FUG 9;  2EBE A;  2ILY A;  2DK2 A;  5KFU A;  3TZY A;  4ECT A;  1YG0 A;  2EFO A;  2F8H A;  3NBP B;  5DQG A;  3J7Z T;  1RDR A;  3DGP B;  3IAS 9;  4M5L A;  2C3P A;  5G4D A;  2I0X A;  1CJU B;  2B4O A;  1RT6 B;  2B9W A;  4I6Y A;  2R2T A;  2ZH5 A;  4TXS A;  4AL6 A;  2H48 B;  4JI6 J;  2CQP A;  1KC8 T;  3N0V A;  4ECY A;  2Y3Y A;  5KFO A;  2HHP A;  3B4D A;  3BH7 B;  4F25 A;  3TAN A;  1DBD A;  2KJW A;  1RHM B;  2AQ4 A;  2HS3 A;  2B9E A;  4F04 B;  2PEB A;  1FES A;  4Y2K A;  3H8Y A;  2CG4 A;  4JI6 F;  1QSY A;  4B17 A;  2MKY A;  3MMJ A;  1M1H A;  2AZ1 A;  2VG5 A;  2YX4 A;  4OJ3 A;  1F5B A;  1U49 A;  2AJ0 A;  1SB6 A;  2CQ4 A;  4DPT A;  3PJ9 A;  4IFV A;  2HAF A;  4GO7 X;  1Z2L A;  3EGW B;  4IRD A;  3W60 A;  4RWW A;  2GNK A;  4AXI A;  1LFW A;  4FYD A;  3OR1 A;  4GVB B;  5D4P A;  1N5V A;  2P5V A;  3CCZ A;  3FCH A;  1EAY C;  4IDK A;  2FY1 A;  2G0J A;  2G0C A;  2V67 A;  2NQP A;  3OTD A;  3OXG A;  1HBM B;  1U26 A;  1UFL A;  1X4D A;  4WP8 A;  2EC0 A;  2HHQ A;  1XBW A;  1IKW A;  2YH1 A;  1EP4 A;  1JJ4 A;  3T1A A;  3J80 U;  4TNO A;  3UDC A;  2HS4 A;  4IOB A;  1JLB B;  3FCW A;  4LFC J;  2E9R X;  3FBB A;  3OTO J;  4P2M A;  1KOO A;  2BOP A;  1SIW B;  5KG2 A;  4WP3 A;  2I2Y A;  1UAW A;  1RK8 A;  2D9O A;  5KFB A;  4JI0 J;  4OIX A;  4HEA 9;  3FEZ A;  2VG6 A;  4LFC F;  2XWY A;  2O66 A;  4OX7 A;  1UVM A;  1FDB A;  4R0E A;  1S6Q B;  2N7Y A;  2I1R A;  1HHT P;  1RSC A;  4RBU A;  3OTC A;  4KH1 B;  1FI4 A;  2J0Q D;  4R8U B;  2HWH A;  4DHV A;  3Q8Q B;  4JI0 F;  5D3G A;  2FPH X;  2IY5 B;  2XLK A;  2H4W B;  2B7B B;  3CC4 S;  1H38 A;  4NPO A;  3GIL A;  3UW1 A;  1DRZ A;  4YP3 A;  3OQ2 A;  1HQU B;  2KB2 A;  1RIS A;  1CEZ A;  3ZC4 A;  2JSX A;  1S97 A;  1ZOT A;  5A8K A;  2VZ9 A;  3DN9 A;  1MML A;  4IG0 A;  1ZBT A;  2IRX A;  2IYI A;  4BCA A;  4B3S J;  3R5G A;  3T19 A;  3VAJ A;  3VTI A;  1GXU A;  5I3U A;  4EU0 A;  1KR4 A;  3I0S B;  1RAB B;  3E01 A;  4CNY A;  3MM6 A;  5I42 A;  4JI8 F;  2W9C A;  2JLE A;  5KOW A;  4LRA A;  2D7S A;  2OEJ A;  5J2P A;  4KTQ A;  1DAR A;  3G8Q A;  5DRK A;  4B3S F;  3PJW A;  4KPC A;  1EIY B;  4K4Z A;  4WIQ A;  5SZT A;  1KD1 T;  1XNQ F;  4GVL A;  3TX8 A;  4NZ0 A;  4M95 A;  2QT7 A;  4ZIT A;  5HAN A;  1TK8 A;  1WC0 A;  1ACM B;  1YK9 A;  1RT1 B;  3A12 A;  3TJ9 A;  3DGP A;  5KTQ A;  1I1G A;  3FZ2 A;  3O3L A;  1PGZ A;  2UXD J;  1CJU A;  1RT6 A;  3UD5 A;  5JVH Q;  4QW8 A;  2XMT A;  3TYT A;  1VQN S;  3HVW A;  2CJQ A;  3MR3 A;  3MAH A;  3SFU A;  3W3S A;  3ETO A;  3H2U B;  2RQM A;  4X4T A;  4UQG A;  3VZI A;  1S0V A;  1B7Y B;  4K59 A;  3V6J A;  5AE2 A;  2QX0 A;  2QG9 B;  1U1Q A;  4U95 A;  3M4X A;  2G4B A;  2A0F B;  3K58 A;  2XGQ A;  4B9U A;  1RA7 A;  4I0W A;  3CUN A;  1X9S A;  4N7T A;  3CCS S;  2AYE A;  4B9M A;  1PAU B;  2RHS B;  2M8H A;  2E9T A;  4F4Z A;  4J9N A;  4KV8 B;  4GKK J;  2NPI A;  4J9S A;  2AP6 A;  4RNH A;  4DS4 A;  1I6J A;  4LF9 J;  1MN9 A;  2BBE A;  1NK6 A;  2BAB A;  1IWA A;  1ZAV A;  3C66 A;  1WKL A;  4NWB A;  3P8B B;  3MFI A;  3HFK A;  4OHW A;  4GKK F;  3NGD A;  2Q66 A;  3BYR A;  2ZM6 J;  2BJ1 A;  3RW7 A;  2RNE A;  4UZB A;  1V5V A;  1SVD A;  1O0P A;  4LF9 F;  1RT4 B;  1JLB A;  3CVK A;  3Q89 A;  3H5X A;  2R7O A;  1Q7Y T;  1EAR A;  4ED4 A;  2OP5 A;  5KT6 A;  2UXC J;  2WVE A;  4KE5 A;  5ETV A;  2VC1 A;  3G6V A;  3LP2 A;  2YKA A;  4MKA A;  4DF8 A;  5HLF A;  3PRD A;  2GML A;  3MAA B;  3EVO A;  3GYG A;  3W7B A;  3E51 A;  2UV8 G;  1HPZ B;  3JSY A;  2P2C B;  3P5T L;  1WF1 A;  1HI8 A;  3EUN A;  1MRO B;  1S6Q A;  3CCE S;  4X84 A;  2UXC F;  1BQN B;  1Q95 G;  4EBC A;  2HFO A;  1UVN A;  2YNF B;  3O6Q A;  4R8U A;  4J9K A;  1X5S A;  5A0Y B;  4PEO A;  3RB3 A;  5BYR A;  2HMI B;  5ADZ A;  1OO0 B;  4U8Y A;  2UUB J;  1M5S A;  4AD6 A;  4EO6 A;  3QMQ A;  4ZLL A;  2BV3 A;  1CG2 A;  1VQ9 S;  3SQG B;  1PSD A;  1RTJ B;  1UVK A;  1GEH A;  2JHE A;  3FNN A;  1U1M A;  1YBU A;  3NNH A;  1SJQ A;  1HQU A;  2XMA A;  7FD1 A;  3DRS B;  1I5O B;  3KNG A;  4AL5 A;  4CH7 A;  2C2M B;  2VBY A;  2UVR A;  1YJR A;  4DLG A;  1NU4 A;  4NYP A;  2V8P A;  4USM A;  2ASL A;  4U7C A;  4OI2 A;  4ZPD A;  3F56 A;  1KN6 A;  3RBX A;  2YPZ A;  4OI0 A;  2IYG A;  1TFW A;  2IJR A;  5D4O A;  3JAM Y;  4DX6 A;  2KN4 A;  3A1Y G;  5BXI A;  3CJ5 A;  2FY8 A;  3TVK A;  3IM8 A;  3ZNJ 1;  1VBY A;  4NRU A;  2OHD A;  2KZZ A;  1JLE B;  3UCZ P;  3LPY A;  3CDW A;  2GV1 A;  1KS2 A;  3MMA A;  5HO4 A;  5J2Q B;  5DGB A;  3EGN A;  1RWK B;  3OTE A;  3Q24 A;  4X4Q A;  3CO9 A;  1UZD A;  5A8R B;  1VBX A;  2ZH9 A;  1RWM B;  1U6Z A;  3HHL A;  3MOZ A;  2W2Q P;  2DH7 A;  2XSF A;  3PDN A;  2KL8 A;  1EET A;  2DVI A;  2ZBI A;  4FF4 A;  3D3C J;  4F2S A;  5C25 B;  3VAF A;  2DNL A;  4QYZ J;  1DUR A;  2GC8 A;  1AB8 A;  3M2V B;  3FEX B;  2CPH A;  1TMM A;  5KT5 A;  2DO4 A;  4CI0 B;  5CXT A;  1FE0 A;  3IGN A;  4B9V A;  2QSW A;  4MKV A;  2R8I A;  4Y3C A;  4Z2X A;  4ECX A;  2B6A A;  5C42 A;  4USW A;  4CO1 A;  1TKT A;  3RU0 A;  3LP0 B;  1VQS A;  2QMW A;  1K1Q A;  1SJR A;  1RBL A;  1WEY A;  5HQ8 A;  2OPP B;  1FCA A;  1VQL S;  4IR9 A;  2ZHB A;  3NGT A;  1VC0 A;  2RKI A;  1UP1 A;  3OV7 A;  3LAL A;  3DCA A;  2UU9 J;  3CXC R;  2R9L A;  1QAJ A;  4J9O A;  2AYM A;  4E0D A;  4QWC A;  3CCJ S;  4DU7 A;  4F4W A;  1U1K A;  1BY9 A;  1HYS B;  4DXL A;  3OFE A;  2Z58 B;  3GFZ A;  4YS2 A;  4CLW A;  1YI2 S;  5F41 A;  4DN9 A;  4MKB A;  1TKX B;  2RHQ B;  2ZHA A;  2PMZ D;  3IA0 A;  4ICL A;  2RIL A;  3MEK A;  2M4M A;  8AT1 B;  1HNI B;  3CT9 A;  3NP5 A;  1VS3 A;  1RXO B;  5FII A;  4BC9 A;  3EZO A;  3DU5 A;  1L3V A;  3KWM A;  3NAI A;  3TZW A;  4KSE B;  3AH6 A;  4ED2 A;  2LQB A;  1Y0H A;  3L7U A;  1RT2 A;  2VFU A;  4ZLN A;  2DPI A;  1HPZ A;  3I6P A;  3CME S;  3QAT A;  2UUA J;  3GII A;  2E1R A;  1MRO A;  2UUC J;  2JFD A;  2WBR A;  3HVT B;  2COL A;  4F67 A;  3J7A N;  1TL7 A;  5KFH A;  1HA1 A;  1RTZ A;  3C14 A;  4F4K A;  4NLW A;  5C7P A;  1FXD A;  2F4V J;  1PJ6 A;  1RAD B;  4C11 B;  3L95 X;  5F3T A;  3BRE A;  1CJV A;  3M1V A;  2G9O A;  3MGJ A;  2UUC F;  3KHL A;  4OHV A;  3MM7 B;  4PWD B;  1V9O A;  3CDA A;  3DRS A;  1H2U X;  2N4D A;  4DQI A;  4W4M A;  4ID5 A;  4K5R A;  1FRX A;  2FZC B;  2F4V F;  3W5Y A;  1OS5 A;  1U2R A;  3O8W A;  1SKU B;  3ZXW A;  2ZH1 A;  3KJQ B;  3A13 A;  1NHV A;  4Q8F A;  3CDB A;  2FVS A;  4LF8 J;  3OVB A;  3O5T B;  1EJ7 L;  5B0G A;  4PKD B;  4RW7 B;  2ASD A;  3G4S S;  2F1F A;  2ZWP A;  3VAM A;  1VIX A;  4LF1 A;  2OEM A;  3QZ7 A;  4Z37 A;  3B4M A;  3CJK A;  3CJ4 A;  2KT5 A;  4LF8 F;  1D9A A;  1G2E A;  3M6U A;  3D1Q A;  2PI4 A;  2VDH A;  2W8K A;  2UUW A;  2IHR 1;  3RAX A;  2BM0 A;  3RG6 A;  1X4F A;  5CD4 A;  1PYO B;  2XCA A;  1IM6 A;  1R0B G;  4W98 A;  3DLJ A;  4TU9 A;  1RKJ A;  3VWS A;  2HK2 A;  3QNW B;  1OMS A;  4DSL A;  2HVE A;  3OJU A;  3SV3 A;  1UFW A;  4RR5 A;  2AJ4 A;  1NO8 A;  2KU7 A;  2ZH7 A;  4YEA A;  3D6H B;  4PUO B;  2RS8 A;  1S9G B;  3DOL A;  4UT4 A;  4CLY A;  2W4C A;  4MH8 A;  4TU7 A;  3QAU A;  4C0B A;  1Q0N A;  1YJN S;  4KIA A;  1DQ9 A;  1YVF A;  1VQ6 S;  3LP0 A;  4V1A k;  4WTY A;  1GMW A;  1HMV B;  3TUI C;  1UVI A;  5DZ7 A;  3MR7 A;  1RTI B;  2DIS A;  3GFX A;  3PW4 A;  4FNI A;  4J9U E;  2XO6 A;  2ZH8 A;  4KFB B;  1ZYQ A;  5L9N A;  4AQY F;  2VC0 A;  4DSE A;  2IFX A;  5LXY A;  3CMA S;  5HBM B;  1NJY A;  2K2P A;  2FHK A;  3CJR A;  3N5F A;  4EMD A;  4DPU A;  2XYP B;  2QJ3 A;  2NYH A;  1VLO A;  2ZHO A;  4NLX A;  5BYS A;  5KFX A;  2AWZ A;  4ILL A;  5ETQ A;  3GIR A;  3MHY A;  5AE3 A;  1S1V B;  2ROE A;  4AT1 B;  3NGS A;  2ACY A;  1AT1 B;  1UL3 A;  2CJY B;  2Q43 A;  1AUS L;  3KK3 B;  3QT5 A;  4J9V A;  3W8P A;  2HVI A;  3MED B;  5F8M A;  4IQM A;  2YQ1 A;  1YDL A;  3MD1 A;  4WU3 A;  1QE1 A;  4JB8 B;  3JQM A;  3GCW P;  1H98 A;  3DYA B;  1M1K T;  5M2P A;  1MN7 A;  4JI5 J;  3VAK A;  3MEE B;  2DGX A;  3K59 A;  4YN3 B;  1QAX A;  4J9R A;  1FNM A;  4RNF A;  4CLP A;  5GAE U;  1TMJ A;  2YKM A;  1XIQ A;  1Y11 A;  1U6F A;  2QMX A;  5EUH A;  3DHW C;  1FX4 A;  2R2S A;  4JI5 F;  3CC7 S;  1S6U A;  4B9T A;  3TAM B;  1S0N A;  1MMD A;  2LXI A;  1F6T A;  1QAY A;  1L3K A;  3DLE B;  3K8V A;  2DNP A;  3ENA A;  4KR0 B;  4ZPC A;  2BOA A;  4Q0B A;  3BM7 A;  2FB0 A;  1QVG R;  2V69 A;  3D54 A;  3MM7 A;  4PWD A;  3OW2 R;  3BJY A;  4P2S A;  1C0T B;  3DOM A;  2GVZ B;  4LRC A;  4LBP A;  2Z8Q A;  3SEO A;  3I82 A;  1KBR A;  3A3O B;  3BPD A;  3W5X A;  3EVM A;  5CYQ B;  5H1S V;  1GK8 A;  4ZOS A;  1JLG B;  2DY1 A;  2WVC A;  4ELU A;  5C24 B;  3I0R A;  3G82 B;  4C8O A;  4ETX A;  2CNL B;  4QCL A;  3PIO Q;  3DOK B;  3M8Q A;  4K4Y A;  2MQQ A;  3AQO A;  2IVM A;  1N8R T;  3I5B A;  3OFH A;  5GAG U;  3FDS A;  5K14 B;  3BGR B;  1NSP A;  4ZPV R;  2BQU A;  3DHX A;  1NEE A;  2VD3 A;  3GZ7 A;  3UNY A;  1JXL A;  2CWK A;  3T3F A;  2HYI B;  1N4L A;  2RRA A;  3RR7 A;  2FC9 A;  4DX7 A;  1CJT B;  1GNK A;  3Q83 A;  2VL1 A;  2DGO A;  4IG3 B;  2C2Z B;  3QFH A;  4Q8E A;  2K3K A;  4UF4 A;  5BYQ A;  3IXQ A;  3TOQ A;  5H9E K;  4JV5 J;  1S48 A;  3EMT A;  2DGW A;  5KFJ A;  2RDI A;  3VQT A;  1RHJ B;  3E8O A;  3DLL Q;  1KTV A;  1YLX A;  4OJH A;  3PYG A;  4OZL A;  4F02 A;  2OPS B;  1RHQ B;  2X7I A;  1S1X B;  4ECQ A;  1IKX B;  2XS2 A;  2VFS A;  5D0H A;  2KHC A;  1LWC B;  1JNR B;  1CVJ A;  4JV5 F;  2ZOG A;  1TU0 B;  2EK6 A;  1CS4 A;  2C3U A;  2WBM A;  4D3H A;  3QJJ A;  1HI0 P;  2HQD A;  2W7P A;  3KLF B;  3N28 A;  1C1C A;  1IVZ A; 
#chains in the Genus database with same CATH homology
 3B54 A;  3EIC A;  3NGT A;  2HUR A;  3VVU A;  3ZTR A;  2DY9 A;  3FBC A;  3FCV A;  1LEO A;  1MN9 A;  1JXV A;  1U8W A;  5CAA A;  3ZTQ A;  4O0N A;  2HVD A;  3Q8V A;  3G2X A;  1XIQ A;  1WKK A;  3VGV A;  3WX8 A;  1WKL A;  1B99 A;  1HHQ A;  1XQI A;  1NUE A;  1W7W A;  1NSP A;  5IOL A;  4DZ6 A;  3BH7 B;  4S0M A;  4ENO A;  4FKY A;  1S59 A;  5C7P A;  1K44 A;  2DYA A;  2CWK A;  4DI6 A;  3VGS A;  3ZTS A;  4ANE A;  2VU5 A;  1BHN A;  3JS9 A;  4DUT A;  2ZUA A;  1HIY A;  1LWX A;  3FCW A;  1NPK A;  3Q83 A;  3DKD A;  3EJM A;  4EK2 A;  3EM1 A;  1F6T A;  3FBB A;  1BUX A;  4HR2 A;  1ZS6 A;  2AZ1 A;  1NDK A;  3ENA A;  4F36 A;  3Q89 A;  2NCK L;  3DDI A;  4ANC A;  3BH6 B;  3EMT A;  3B6B A;  2DXD A;  1F3F A;  3ZTO A;  1NCL A;  1NSK L;  3VVT A;  3ZTP A;  3PJ9 A;  4CP5 A;  3NGS A;  4AND A;  4FKX A;  3Q8Y A;  3ETM A;  1S57 A;  1UCN A;  1NB2 A;  3GP9 A;  3R9L A;  3VGU A;  3MPD A;  4W98 A;  1NDC A;  2BEF A;  3BBC A;  1EHW A;  3GPA A;  3PRV A;  1S5Z A;  3BBF A;  3EVO A;  3Q8U A;  5CAB A;  3FBF A;  1B4S A;  1NDL A;  4F4A A;  3NGR A;  2HVE A;  3FKB A;  4WBF A;  4UOF A;  1WKJ A;  2B8Q A;  3VGT A;  5BXI A;  1NSQ A;  4C6A A;  3EE3 A;  1NLK L;  1NHK L;  3BBB A;  4KPC A;  1BE4 A;  3EVM A;  2BX6 A;  2AZ3 A;  3L7U A;  3Q86 A;  1PKU A;  3ELH A;  4UOG A;  3FC9 A;  3FBE A;  3NGU A;  1MN7 A;  1NDP A;  1PAE X;  1KDN A;  1VYA A;  2DXE A;  2B8P A;  2DXF A;  1HLW A;  4UOH A;  3EVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...