1T05B

Hiv-1 reverse transcriptase crosslinked to template-primer with tenofovir-diphosphate bound as the incoming nucleotide substrate
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
427
structure length
414
Chain Sequence
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords oligonucleotide template
publication title Structures of HIV-1 RT-DNA complexes before and after incorporation of the anti-AIDS drug tenofovir
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/dna
total genus 89
structure length 414
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1t05B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t05B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t05B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t05B03
4IG0A 4DL6A 3EZUA 2JEGA 3KNAA 1KLMA 1N5YB 3H2LA 1N56A 3MR2A 3SI8A 5EWGA 4I2PB 5FDLA 4NZ0A 2OH2A 3PHEA 2EC0A 3CJ4A 1VRTA 1JXLA 1BQNA 2F8EX 3PW7A 4NLWA 3ISND 1LW0B 4ZHRB 3DLKA 4O44B 1T03B 4MK7A 3FFIB 2IJFA 2AGPA 2VA3A 4O3RA 2WCXA 3NL0A 2IJNA 1SV5B 1KHWA 3IS9B 1RTDA 5KFMA 3FSIA 1RT7B 2HNZA 4YMEA 4PWDA 4K4ZA 1HNIA 1RT5B 3MTKA 1QAIA 5JXSA 3GIKA 5HP1A 4NLPA 4G3IA 1HPZA 4HKQA 3LP2A 4ED2A 1C1BB 5KG0A 4URGA 3BQ0A 4J9PA 1EETB 3BSAA 4IH5A 3MEGB 4KHRA 1J5OA 2IM3A 3JYTA 3CIZA 4TY9A 5D3GB 4ZVEA 5EUHA 3PW0A 3MF5A 1RT4B 2FLPA 4WE1A 2XC9A 4TYBA 4F50A 5F8MA 4RU9A 3CJ5A 4ZVFA 5EDWA 4GC6A 3IGVA 3FQLA 4ZVHA 3GV8B 2XI2A 3JSMA 2ZE2B 3H40A 2RDJA 3G6VA 3QYYA 3KK2A 2E9TA 4B3OB 5C42A 4ECUA 4IOBA 4ECXA 1TKZB 1FKOA 4R8UB 4KSEB 5KFGA 2HNYB 2VG5B 4Y3CA 2AQ4A 4RW8B 3HKWA 4O3SA 3DLEA 4H4OA 2B5JB 2R2RA 3NAIA 5KFCA 3NGDA 2RF2B 1LWFB 2RDIA 2OPSB 4ECWA 1HQEB 1R0AB 3BR9A 3BQ2A 4TN2A 2QV6A 3H5UA 2IMWP 1S1VB 3KLFB 2VG7B 4IDKB 4H54A 3HVAA 2C22A 3FQKA 1S0NA 4YR0A 1RYSA 5J2MA 2WOMB 2XCPA 3G86A 1C1CA 3PR5B 1HYSA 3G6XA 5DLGA 4WFXA 3I0RA 3V4IA 4Q8FA 1S9FA 2XCAA 4ID5A 1S6QB 4RW7A 4O3QA 2GIQA 1YVFA 3CVKA 4QW8A 2W9AA 2HWIA 2BQ3A 1HQUA 2DPJA 4WFZA 5F9NA 2FJWA 3H5XA 1RTIA 4TQSA 4TYAA 1DTTB 4QW9A 2XGPA 1HNVA 1RT1A 3D5MA 4ZPCA 3KHGA 1SUQA 4IQXA 4MFBA 4RW4B 1FK9A 5HROA 1N6QA 3Q8RB 2HNDB 5HBMB 1N4LA 2GIRA 1JLCB 5KG7A 4J9NA 4DL5A 4U6PA 2V4RA 5L1KA 1IKWA 1TKTA 3IG1B 3M8QB 1DLOB 4ED1A 4O3PA 4IG3B 5KG4A 2OPQA 3KK3A 5HLFB 4QPXA 5KG6A 5KT5A 3DI6A 2ALZA 4JUZA 3NMAA 2BQUA 2C2EA 2FLLA 4KKOA 3OHAA 3CJ2A 3DRSB 1SH3A 1LWCB 2I5JB 4Q43A 2B43A 5L1JA 1RTJA 2RKIA 4H4MA 4YQWA 1S97A 5KFWA 2ILYA 3QO9B 1TL3B 5KFUA 2R8HA 3NBPB 1EP4A 3KK1B 4ZPAA 3QZ8A 1RT2B 3UDLA 3OL9A 4IRCA 3C6TA 3OLBA 4IR9A 2E9RX 2OPPB 2IBKA 2R8JA 2WK4A 5I3UA 4F4YA 3MFIA 3V81B 4K4UA 3QIPB 3LP1A 4XPCA 2W9BA 4ECZA 1T05B 2IAJA 1S49A 4F4WA 3LALA 3ITHA 3TAMA 2YNGA 3DYAA 3RBEA 4O4GB 2FVSA 1IKVA 1IKYB 1S48A 2VA2A 4NLXA 4WYLA 5EWFA 1WNEA 3DOKA 2YNIB 1JLEB 5DG8A 3C6UA 1C0TB 2J6UA 3G6YA 3H5SA 3KLHB 5I42B 3DMJA 5F8IA 3M9OB 1VRUB 3MFHA 3H5YA 4J9KA 3Q8SB 1REVA 3DRRB 4O4RA 4I2QB 4RW6B 3RB4A 3DRPB 1MU2B 2AX1A 3MECA 5F8HA 4EO6A 2IC3B 1S9EA 4NLDA 1LW2A 4TQRA 4KV8B 1W25A 4ED7A 3UPFA 1NHVA 3N6NA 2DPIA 4NCGA 3KLIA 4IFYB 1TV6B 5J2PA 2YKMB 2BE2B 1U09A 4I7FB 1KHVA 4NLQA 5C5JA 3MEEA 4QWEA 3Q8QB 1RT6A 3HVTB 3DOLB 5K14A 4O3NA 1DTQB 4ECTA 3DM2A 1JLFA 4X2BA 4DG1A 2JC0A 2W8KA 4ICLA 2FVRA 4WZMA 1S6PB 1JLGA 3QLHB 4KHMA 5F8JA 1N48A 2HMIB 1S1TB 1RT3B 5L9XA 4FS1A 4RW9A 2ZD1B 4K4XA 3MEDA 1HMVA 2AGOA 2J6TA 5C24B 4TLRA 4KO0A 3T19A 2ZKUA 4Y2CA 4JV0A 5F9LA 4RNNA 1TKXB 4QWAA 4EBEA 4MIBA 2VG6B 4IKAA 2UVWA 3PJWA 2BRKA 2UVUA 3T5HA 3DLGB 5CYQA 3BGRB 1OS5A 4ZMMA 5CYMB 4RW8A 1S0OA 5J2QB 3E01A 4R5PB 4Q0BB 3CJ3A 3CO9A 1QE1B 1S1WA 1S9GB 2BANA 3V6DB 4ECRA 4KE5A 1ZTTA 4URSA 4F4XA 2W7OA 1S0MA 4KFBB 4LSLB 3BSNA 4TY8B 1S1UB 3HVWA 4IG0B 1KLMB 3BSCA 2AGQA 3BQ1A 4PUOA 1HARA 2WONA 4PQUA 1RTHA 3I0SA 5FDLB 4NRTA 2AWZA 4IRDA 1VRTB 4IFVA 1BQNB 3IRXA 5J2NA 3EPIA 5J1EA 3RB0A 2AX0A 1TL1A 3DLKB 3H59A 1IKXA 1S1XA 2YKNA 1SH2A 5KT7A 4U7CA 3KOAA 3PW5A 2WB4A 3I5BA 1RTDB 5KFXA 5KG1A 5KFKA 3KLVA 4ED0A 2HNZB 4PWDB 2ASJA 3KLGA 2R8KA 3OHBA 3KHLA 4NLYA 3SFGA 5KFBA 5HP1B 1HPZB 2BRLA 3LP2B 4J9SA 2IM0A 4YR2A 5C25A 4FBTA 3PW2A 3ISNC 1J5OB 4M94A 3JYTB 2J6SA 2FJXA 3T5KA 4WE1B 2R2SA 4K4YA 1TVRA 1XR7A 4ECSA 2XGQA 5JUMA 1FKPA 2OPRA 5KT4A 4RNMA 1RDRA 5KG5A 3OL7A 2YNFA 1JLAA 4QWDA 1JLQA 3JSMB 3GIMA 5KFVA 4EYIB 1GX6A 3KK2B 2WTFA 5C42B 5KFNA 5KFSA 1S4FA 1FKOB 2YNHA 3BJYA 4TXSA 4J9MA 1C0UA 4J9QA 5F8GA 3LAMA 3DLEB 4G1QA 2B6AA 4H4OB 4LQ3A 4Q8EA 4NLVA 3I5CA 1LWEA 1UWBA 5KFPA 5KFZA 2D41A 1QAJA 3LP0B 2JC1A 3VQSA 3OLAA 4IH7A 4OL8A 2ILZA 3T1AA 1K1SA 3CDUA 2FVQA 1D1UA 4LSNA 3FDSA 1C1CB 3QGIA 1HYSB 3UR0A 3KMSA 2W9CA 2R2UA 1XR5A 5L1IA 3I0RB 3KJVA 3V4IB 1TQLA 2C2RA 2WHOA 4ID5B 3M8PA 4RW7B 4MKAA 3KLEA 1JLBA 4WYWA 5KFIA 5KG3A 1BQMA 1JKHA 4WXOA 3GQCA 1HQUB 3KMQA 2D3UA 4ECYA 4FBUA 3QGHA 1RTIB 3FRZA 5DQGA 1HNVB 1RT1B 1N5YA 5EWEA 1SUQB 4JV2A 4MFBB 2BE2A 1FK9B 5HROB 4I2PA 4XO0A 1N6QB 2W7PA 2AU0A 4ZP9A 5DLFA 4K4VA 4ZPDA 1IKWB 1TKTB 3RB3A 1C2PA 3QLHA 5DQHA 5KFAA 1LW0A 4ZHRA 3GILA 4O44A 2OPQB 1T03A 3FFIA 3KK3B 2HWHA 4RNFA 1NNDA 5DGBA 4EBCA 3DI6B 1RA7A 1SV5A 4WXWA 2V9WA 5DGAA 4DEZA 5KFFA 3IS9A 4KKOB 1RT7A 2CKWA 5KFYA 1RTJB 5KT3A 1RT5A 4K4TA 2RKIB 4H4MB 4R0EA 4FS2A 4RUCA 3TQ1A 1IM4A 1RAJA 1T94A 4ZP8A 1EP4B 3H4BA 1C1BA 2ASDA 1EETA 2V4QA 3C6TB 3MEGA 4NRUA 5D3GA 2R8IA 1RT4A 5I3UB 3PW4A 3GIJA 5KFDA 5KFHA 5KFEA 3LP1B 3T5LA 2W9BB 4M95A 2IAJB 3QGGA 3CDEA 4J9LA 2FJVA 4MK8A 3CJ0A 4IH6A 2C28A 4HYKA 3ITHB 3TAMB 2YNGB 3DYAB 4MK9A 4ED3A 1IKVB 2ZE2A 1GX5A 3H4DA 3E51A 3I5AA 4B3OA 1Z4UA 3DOKB 1TKZA 3C6UB 3LANA 2UVRA 4R8UA 2FVPA 2IA6A 2HNYA 3EPGA 3DMJB 2VG5A 2W8LA 2B5JA 1REVB 2RF2A 1LWFA 2D7SA 2OPSA 1HQEA 1R0AA 3MECB 2JLEA 3MR5A 1S1VA 3KLFA 2VG7A 4IDKA 3TVKA 3OSPA 4K4WA 2BQRA 4WZQA 1S9EB 2WOMA 1D0EA 1LW2B 4ZP7A 4ZPBA 4NCGB 3KLIB 3PZPA 1S6QA 5J2PB 4EYHB 3QZ7A 3NKYA 3V6JA 3IGNA 3MEEB 4J9RA 1QUVA 1RT6B 4O3OA 2UVVA 5K14B 1RA6A 1XR6A 3DM2B 1JLFB 5KFRA 3PVXA 4DG1B 4ICLB 3GYNA 3RBDA 4GC7A 3N6MA 3OL6A 1JLGB 4EBDA 4ZVGA 1DTTA 1S10A 5KFJA 4NLOA 4RW4A 5F8NA 1I6JA 2HNDA 4RW9B 5HBMA 1JLCA 3DDKA 1NHUA 3IG1A 3M8QA 1DLOA 3MEDB 3N6LA 1HMVB 1HNIB 5DQIA 4IG3A 2UUWA 4KO0B 5KG2A 5HLFA 5KFLA 2E9ZA 1T3NA 2WRMA 3PJXA 3M9MB 2XWYA 1MMLA 3DRSA 4NYZA 1LWCA 2I5JA 5CYQB 1SH0A 4J9OA 3V6HA 4DL2A 4RUAA 4ZP6A 4WFYA 3Q8PB 3QO9A 1TL3A 3E01B 2R2TA 4NLRA 4JV1A 2C2DA 3LP0A 1S1WB 3NBPA 2BANB 3KK1A 1TP7A 2IM1A 5KFQA 4IRKA 4ED8A 1RT2A 3GV7B 4KAIA 2OPPA 3OSNA 3IN5A 3PR4A 3V81A 4MKBA 3QIPA 4PUOB 2WONB 4PQUB 1T05A 1RTHB 3I0SB 3D28A 3V6KA 1JX4A 4IFVB 3IRXB 5J2NB 4O4GA 2D3ZA 5J1EB 3ICLA 1IKYA 1K1QA 2XI3A 1TL1B 3SFUA 3T5JA 1IKXB 1S1XB 2YKNB 2JEJA 2JEIA 1JIHA 2YNIA 1JLEA 3LAKA 2O5DA 4LQ9A 4QWCA 1C0TA 3QIDA 4NLUA 2BR0A 3KLHA 2R8GA 5I42A 5J2MB 3CDWA 4RNOA 4NLGA 1VRUA 3KLGB 1ZETA 4ECQA 3DRRA 5F8LA 4I2QA 4RW6A 3RB6A 3DRPA 4DL7A 1MU2A 4MIAA 5KT2A 4ECVA 4KBIA 4K4SA 2IC3A 4QWBA 2JEFA 5C25B 4YR3A 4YP3A 4KV8A 2FLNA 5L1LA 4IFYA 1TV6A 2GC8A 2YKMA 4F4ZA 4Y34A 4I7FA 1TVRB 5DG7A 3RAQA 2FVCA 1FKPB 2OPRB 3HVTA 3DOLA 4XPEA 1CSJA 1DTQA 3UQSA 4Y2AA 3H98A 3RAXA 3NAHA 2YNFB 1S6PA 3GIIA 1JLAB 2I1RA 4URQU 4Q45A 1JLQB 2IM2A 5T14A 2HMIA 1S1TA 3MR6A 1RT3A 1RYRA 3KHHA 4DL4A 4KB7A 4RZRA 2ZD1A 2YNHB 4NLTA 4NLSA 2QE5A 1C0UB 3BREA 3BSOA 5C24A 3M9NB 1ZTWA 4EO8A 4Q44A 4G1QB 2B6AB 1TKXA 3MR3A 2HAIA 4DL3A 1LWEB 1UWBB 2VG6A 5DG9A 3GV5B 4IR1A 2UUTA 2CJQA 3DLGA 5KFTA 4EEYA 3KHRA 4K50A 4ED6A 3BGRA 2ATLA 4LSNB 5CYMA 2V0NA 3HHKA 2W9CB 3CWJA 3KJVB 5J2QA 3OL8A 4RNHA 3M8PB 4MH8A 4R5PA 1JLBB 3KLEB 4Q0BA 5KFOA 1BQMB 1JKHB 1QE1A 1S9GA 3V6DA 2ASLA 4KFBA 4LSLA 4TY8A 5KT6A 1S1UA
chains in the Genus database with same CATH superfamily
4CP5A 2XLIA 3MR2A 5FDLA 2GJFA 2K1RA 3GZ7A 2AGPA 3EVWA 3GP9A 1VFJA 2IJNA 1HKAA 1RT7B 4YMEA 3U1LA 2MQOA 2QZ8A 1IWAA 2ADBA 2FLPA 4TYBA 2G1HA 2CQHA 5A6WA 2PMWA 4NXMJ 2M70A 4JI2J 5C7PA 2R7SA 3C16A 4IOBA 4RPFA 4PPZA 3K8VA 1DBDA 3PCOB 4C0HA 2B5JB 3UDCA 2HHXA 1DQAA 1N5QA 1PJ7A 2ZH1A 2JRSA 2VOPA 1U0HB 3IBCB 1EHWA 3H5XA 1T9XA 1DTTB 1RT1A 4GMKA 3Q8RB 4J9NA 4DL5A 4EGLA 1DLOB 2LQJA 2YWGA 1TL7A 1IBMJ 2XO7A 1S79A 4B9TA 2ALZA 3PKYA 2KL8A 4KKOA 1SH3A 4Y0FA 4DR7J 2DNOA 4NOHA 1H6KX 4IRCA 4RU2A 3CJQA 3OLBA 2ZOGA 3CCTA 5I3UA 1YJWS 4LIWA 2E5LF 2MKKA 5EWFA 1WNEA 3ZTOA 4KPYA 5GADI 4BWJA 3KLHB 4KTQA 1N33F 4OMFG 4O4RA 1HIYA 4RW6B 1NDPA 3DHXA 1K8AT 5L46A 2IC3B 3GLJA 3PEJA 4ED7A 2JOQA 4W4MA 5GVQA 4X4UA 3N6NA 2J7UA 2W8KA 1S6PB 2KTQA 1X31C 3OXLA 1FXRA 4DV6F 1RISA 1D8ZA 5CYMB 3L09A 3CJ3A 3F44A 5A8WA 4F4XA 4ES2A 2RU3A 1HARA 2BJEA 4PWUA 4X64J 3H59A 5KT7A 3PHTA 2XNQA 1C4CA 5KG1A 4S0MA 2JVRA 2ROPA 2IMOA 3LP2B 3O3LA 2KXFA 3K7RA 1R8PA 1TVRA 2BV3A 2J0XA 3I31A 3PO5A 2LU1A 1FRXA 3GJSB 3SV3A 4EMDA 4UOCA 3BJYA 1LQ9A 3PDNA 3CE8A 3PEHA 3CC7S 1K1SA 1T95A 1OJ4A 3KMSA 3I0RB 3PG9A 2IA0A 5KG3A 1Q4RA 2IVYA 2ROGA 4DQIA 1ZH5A 2MZQA 2CZ9A 5HVHA 1FK9B 4I2PA 1GEHA 4WKRA 5KFAA 5BYSA 2OPQB 2C42A 1EKSA 1Q81T 2E7VA 3T9NA 2R7RA 4I56A 2HVHA 2B7CB 1APSA 1EP4B 2XYPB 4BS2A 3W62A 3HXMA 1VC6A 5HSPA 3PW4A 4ER8A 2IAJB 2UU9F 1FRMA 1MNEA 3E51A 3I5AA 4C98A 1TKZA 3RYLA 3ULHA 3HF5A 5IT4A 2QA2A 4WFNQ 1LW2B 4M5DA 4ZPBA 2HVEA 4NCGB 3KLIB 5IT0A 1DFDA 1RA6A 1NLKL 3FCWA 2XSJA 4RW4A 4FXVA 3JSRA 1I6JA 3M4XA 4CLSA 3GSIA 3IG1A 5H9FJ 4KQZA 3M9MB 3W1YC 3HX9A 2VBYA 4DL2A 1WORA 2MB0B 3Q8PB 2LCWA 3JQMA 4P74A 2AF6A 5KFQA 3CCQS 1H2UX 2Z56B 1RAOA 4C11B 4OZ5A 4FXWA 1KQSR 4HH0A 3UR3C 3T5JA 1TL4A 2XMTA 4D3HA 2YNIA 1M5HA 4HVZA 4NLGA 2JNJA 3J81j 2BKPA 1N36F 4DL7A 1FESA 4KV8A 2LQBA 3RAQA 2OPRB 3TA2A 1T0TV 3GIIA 4M5HA 3PKMA 5AXKA 1HR0J 1VQ4S 4KB7A 5L39A 2ZFHA 2QE5A 3BSOA 4MJKA 3FMBA 1RTZA 3MR3A 2CQ2A 1H3DA 4CI0B 4X4VA 2CNKB 4LT6A 5AXNA 2HHHF 1BQMB 1JKHB 2G0JA 2HLUA 2IHR1 3A12A 4DL6A 1WI6A 3SI8A 1EZZB 1T03B 4ES1A 1H74A 4G3IA 1MWQA 4DCOB 2G4BA 4URGA 2BJDA 4J9PA 2XLKA 5A8RA 1SB6A 2B9EA 4F3OA 4HTJA 2RRNA 1URNA 1UVLA 2FJAB 2YH1A 4LSZB 3BR9A 2Z57B 2DIUA 2KZMA 1S6QB 1WC4A 3UCZP 3HD1A 5M2PA 4TQSA 7AT1B 4QW9A 1HNVA 4ZPCA 1U6ZA 1CEZA 1IKWA 2QO3A 1B0TA 3DC2A 4X66J 3TEGA 4JUZA 2BQUA 3MR7A 5CYJA 3BV8A 3UD3P 5KFUA 2KVQE 3OL9A 4Y65A 4DSLA 2R8JA 4W98A 4XPCA 3JAMU 2E5HA 4AQYJ 1S48A 2VA2A 4L6V3 5ETRA 1ZBTA 2J6UA 4USMA 4QYRA 2NUHA 1U02A 4YN3B 2VFRA 1KTVA 1FD2A 3QRRA 3CIMA 2D74B 4WTOB 4NLQA 1TV6B 2RS2A 3DOLB 1JJ4A 1K9MT 4IUFA 2HZAA 2VOOA 2DR8A 5DDOC 2K3IA 4WU2A 2X1FA 2UVUA 3OR1A 2V67A 5CYQA 4WIIA 4DR2F 2GJ2A 4R5PB 2JHEA 3BSNA 4I6WA 4V19J 1UVMA 5F0UA 1R0CB 5M2RA 1TL1A 1SH2A 1HL6A 4C97A 3TUIC 2WB4A 3I5BA 4OYOA 3A4TA 2A2CA 3EICA 3SFGA 2QFJA 2NSCA 2C2ZB 3D0GE 3MAQA 2FJXA 3DHWC 3CJSA 3EX7B 1KR4A 1CJKA 5ETOA 3RAMA 3ILJA 4QOTA 1JLAA 2JZ5A 3G96A 3PIPQ 3TUZC 5DM6Q 3I56S 1RAFB 2VFTA 4P75A 4X4PA 2W01A 3WDOA 1D1UA 3FDSA 4NZ6A 1HYSB 2DNGA 3KLEA 4WYWA 3W65A 4YS2A 2JJ4D 2D3UA 4KY3A 5HVFA 3UN2A 2H5IB 2W7PA 3VAKA 1RWNB 1UJ4A 3KK3B 2VICA 1HI1A 1SV5A 5DGAA 2AW0A 5KFFA 3IS9A 4LF6F 1VHIA 2QA4S 4K4TA 4H4MB 2W2QP 2PEBA 2LEPA 3JAMY 4JI5F 2PA8D 3MEGA 4NL5A 5DZ6A 1NK7A 3TR5A 2FJVA 3E8OA 4ILRA 1M5KC 1NEEA 3LANA 4FF1A 1F6TA 2HNYA 3VZHA 3OVSA 2AYEA 2Z2YB 1KNZA 2HKEA 1WELA 2KDOA 3D9BA 2R7UA 2OD4A 4WZQA 4RX6A 1RHKB 3DM2B 4LFCJ 3CTRA 2P6SA 4CLFA 1VQSA 1SH0A 5HL7Q 2QL7B 4C7QA 4NPOA 4WFYA 1L3KA 3I55S 2Y1LB 2ZZMA 1EQ0A 1CJTB 3OT9A 1UVIA 5SUHA 4P52A 1YRUA 2EFVA 4DFMA 1ZS6A 3N4WA 2XI3A 4RLEA 1S1XB 4KR0B 2HBQB 1YHQS 4CYUB 4I2QA 4DSIA 4ECVA 2VONA 1WUUA 1B99A 4I7FA 1IM6A 3NAHA 3PACA 5ETQA 3CC4S 4GKKJ 4NI2B 3Q22A 2ZD1A 2DXDA 3N0VA 4NLSA 2HQIA 2DCUB 2C2NA 2G0IA 2J8AA 1OY9A 1U49A 2Z2ZA 3MM6B 3RJMB 2W9CB 4CLKA 4MH8A 1SJ1A 1QE1A 4DX5A 1DHMA 2KJWA 4JV5J 3HJVA 2ABYA 3H2LA 1X7VA 2HW3A 2EC0A 1JXLA 4B3RJ 2D9OA 2Y9HA 3QATA 4QU6A 3OXGA 1V3RA 3SCJE 4AE5A 2MLYA 3WX8A 1ZM9A 2JL9A 3QAEA 4XIUA 2XMJA 3TAPA 3BQ0A 3O1LA 1RYRA 3RR7A 1FVQA 4TY9A 3VZIA 5CZXA 4WE1A 2KRBA 1KD1T 1UMJA 4JB8B 2UXBF 5G0RA 1IVZA 1U4BA 3PYDA 1VQYA 3NAIA 1UFLA 2G2YA 4ILLA 3LW5C 2YKQA 2DNPA 4YR0A 1RYSA 3P8BB 1Q79A 2M5YA 3V4IA 1GXLA 4FZVA 4QW8A 2DPJA 1FWPA 1Y10A 2XGPA 1FFGB 2GIRA 4A8WA 2O01C 1HBMA 2FJEB 4R0JA 5B0CA 2FLLA 3C66A 4EZ6A 2LXIA 3DXSX 4PZVA 2OIHA 3KK1B 3O44A 1QUPA 6FD1A 3I6PA 1LXJA 2OPPB 3HHNB 2F8MA 1M5SA 3LP1A 1GFWB 2BX6A 1T05B 1FDNA 3EUNA 1YK9A 9ATCB 1TK8A 4C8NA 2AJ1A 1JLEB 1C0TB 1WEXA 3KUGA 1FWLA 3ZO7A 1ULRA 1PYTA 2A3JA 2OFGX 2ZJQQ 4TQRA 2WZ1A 3ENWA 2DEJA 4IFYB 4FKXA 2AJ2A 3TNVA 3A8JA 3HHLC 3D6FB 4FS1A 1UL3A 3QWUA 4Y2MA 3MEDA 4CIOA 4P72A 1F2HA 4LJMA 4DUZF 2CVEA 4CH0S 3V6DB 4LSLB 2VFVA 5LSLA 2IJRA 3CCES 2DD8S 3NRBA 4DQRA 2DRBA 3KKFA 1VRTB 1BQNB 3O2IA 1SC6A 2EFNA 2DHSA 2QSFA 3OHBA 3TWZA 3M8SA 4UUWA 2ZDPA 4FBTA 3TVZA 1FKAF 2HHWA 5GMKa 3P5TL 4OHXA 3UWTA 1QSLA 2MKJA 2CQ1A 2YNFA 3AOCA 4QWDA 3JSMB 1NZ8A 4N77A 1S4FA 1NPPA 1C0UA 4CRJA 3LP0B 1FD8A 3LQVA 1O51A 4LFAJ 3K5PA 3NGSA 4LSNA 3J7AN 3UR0A 1U1MA 4PXEA 1KWMA 5HAOA 1HQUB 4UT4A 3PX4A 4V19X 1LNQA 4JYAF 2RUGA 4OX9J 1NK6A 4MMOA 4K4VA 4GVBA 1HI0P 4DV4J 4BLGA 4RO0A 1M0SA 1X4EA 3VGUA 5IM0B 3ET6B 4DV3J 5KFEA 3P4UB 1NSAA 2J9EA 4MK8A 4HYKA 3QNWB 4MK9A 3JSBA 3K58A 1O5JA 4K59A 3WQPA 4OV1A 3IR5B 4ZPTR 1IBKF 2UXDJ 2E29A 2VG7A 3TVKA 3SXLA 5CQGA 1MN9A 4DV1J 3NY0A 1XTZA 4QU7A 4OJHA 2I9SA 2ZWPA 4EZ9A 2DGVA 3TA1A 2C2OB 4JI6J 1NBEB 3N6LA 3NS5A 4NA2A 5ETPA 2MQLA 3VGVA 1MMLA 1UEKA 1RABB 3FGVA 3HHDA 3SBMA 4G1PA 2OGUA 5H9FK 2CRLA 1RT2A 2CQPA 3C15A 3IR6B 2G1DA 4ZCIA 2OMLA 3IRXB 5J1EB 2OJ3A 4MYUA 4NLUA 1KDNA 2UXCJ 3HHLD 3DRPA 1SL1A 2B4PA 3PRDA 4K4SA 4F02A 1FCAA 4KRWA 2DGUA 2QLFB 1UWAA 1JLQB 2HMIA 1TUVA 3KWMA 3H25A 5B0BA 3HHLB 4EI2A 3T1HF 2HURA 4UW2A 3M6VA 5KFOA 5HI7A 4TY8A 1VBZA 1UEUA 1FTRA 5HMWA 1BUXA 4A8XA 2MGZB 1WDTA 1LW0B 1RWVB 4OI4A 5L8RC 2VPWB 1KHWA 1I5OB 3G2XA 2PT0A 1LFPA 4UZCA 1N32F 1EETB 3KG1A 3W9JA 3JYTA 2KYXA 3JS9A 1BQXA 1U1OA 4ITSA 4ZLPA 1E6VA 1TAUA 2XZDB 3CCWA 2R7QA 2NYHA 2W2MP 3BGUA 2ZE2B 2M0GB 1RSCA 5DS7A 1Q82T 3BZQA 2HQDA 3HFVA 5KFCA 4LF4J 3DOMB 3H5UA 3OW2R 2IMWP 3FQKA 5J2MA 1G1XA 4LFBF 4LR8A 1GMVA 4WFZA 2F9JA 3D5MA 1N6QA 2BJ7A 3Q86A 5KG7A 1WHWA 3P49B 2FY8A 4CM0A 5LT5A 2RQKA 3NOGA 1NPKA 4Q43A 3D2WA 4KH0B 3DU5A 2ZH7A 2DXEA 3UDLA 2QX0A 3W5XA 4WJBA 3LGNA 1YKWA 4K4UA 2HHQA 4ZCKA 1SBRA 2CG8A 3OTOF 4U8VA 3RBEA 4CTAB 5EGYA 4WYLA 4B3MF 3PRBA 5B0EA 2HVZA 3RB4A 5LJ3Y 1IQTA 4EO6A 1NDCA 1WF2A 3ETMA 4YHHJ 1SKUB 2VZ9A 1FTCA 1KHVA 2KM8B 4ZVQB 1ZAXA 4A47A 1S1TB 4RW9A 5F41A 3UI3A 1XMQJ 3S8SA 3T19A 4RNNA 3Q8VA 1UJ5A 4PR6A 1Y5IB 2ZH2A 1S0OA 2LKZA 5J2QB 1S1WA 2FQQB 3I9V9 2W7OA 2FPHX 3HSZA 3ZZUA 2ZVSA 4F36A 3RB0A 2QG9B 2BOPA 2Y1JA 4JI4F 3G8TA 5C25A 3JQJA 1NKEA 1YJ9S 2MLXA 6FDRA 4C8MA 3GIMA 2WTFA 2AJ4A 1FKOB 3AH6A 2B6AA 3I5CA 1FJGJ 1GTHA 3FNNA 1XR5A 2CQGA 3J7ZT 1RTIB 4ZA1A 1N5YA 4JP8A 2BE2A 3O6QA 1Y3JA 2XO6A 1MSWD 2V4JB 2UUCJ 4O44A 3S01A 1RKJA 1JJCB 2IPOB 2J9CA 4ATNA 1SJ3P 3OTBA 2EEYA 3H2VE 2DITA 2UUAF 2GVDA 1OSDA 1KEKA 3C6TB 4L75A 1AROP 2JWNA 1HBUB 3OBIA 3LPYA 3M6WA 3R8YA 2FB0A 1S77D 2ADCA 4ZIWA 1Z4UA 1XNQJ 1VQOS 2ZBRA 5IT9U 1KOOA 5IWAF 2R7TA 2W4CA 4FYXB 3TOQA 2FHOB 3PZPA 1X5TA 4O3OA 4FKYA 3PVXA 1VQ6S 1JLFB 3QSYB 2ZH4A 1JLGB 3MM8B 2VPYB 4LBHA 3M8QA 2HHVA 4FNHA 4OZ1A 3J80U 4KO0B 2E9ZA 3G9CA 5ETTA 3DRSA 2J8SA 1GQEA 2PDAA 4NCBA 4ES3A 1R8BA 3KJNB 4DV2J 1XMOJ 4GKJJ 3V81A 1PKUA 3FZ2A 2V69A 3DU6A 1IR0A 1FXDA 4ED5A 2E1AA 4OYAA 3QIDA 2R8GA 1AUDA 4LF5F 3J7YI 4ZVSB 2XS2A 1KSPA 3LGMA 4YR3A 4YP3A 2GC8A 4CQ1A 4W92B 2HS0A 1BXNA 2RT3A 2UV8G 3BGOP 1Q8LA 2YNHB 2BXJA 4YOEA 3VAMA 1TKXA 4KJIA 3ONQA 2CUYA 2H3EB 3SCKE 2AP6A 2EVZA 5I3QA 3V5RA 2XZTB 2MMYA 1N5SA 3CGIA 5GMEA 2KZZA 3IWLA 1VQ7S 4IQMA 1H7WA 5CCMA 4F8RA 4USIA 1ZA2B 3CCUS 2R7VA 1RHUB 1GK8A 2LFVA 4A8QA 3SSRA 1QTMA 1LKZA 1I51B 3CJ5A 2YX1A 3IBFB 3GV8B 5IT9Y 2VDIA 2YKOA 2XSFA 3C46A 3IWNC 4R8UB 1FFSB 1PBUA 2YWWA 3FCHA 4KGXB 2RF2B 4OYIA 2OPSB 3AQOA 4F0MA 3F73A 3TW0A 1C1CA 3PR5B 5HANA 3HP6A 4ID5A 3MI7X 4P10A 4TYAA 3J80Y 1LFWA 3FVYA 1SUQA 2CQ0A 1N4LA 4A8FA 3UN5A 2G2OA 1TKTA 1BGXT 2YH0A 1X5SA 4USHA 4HI1A 3NMAA 2LDYA 1EKRA 1FNOA 1YBAA 3X3UA 4IR9A 5A0YB 2GVZB 1PO6A 1WHYA 2NXUA 2IYIA 3US5A 4O4GB 1Y00A 1PYSB 4FYVB 5DG8A 3C6UA 5I42B 3VAHA 2V2VA 3MECA 4LF7F 5CXTA 2GAGC 1U6BA 3DN9A 2CPEA 1YX2A 5C5JA 5J2PA 4QWEA 3LF0A 1UJ6A 2KB2A 4ICLA 4YY3J 1T9VA 1BC6A 1RWWB 4DSEA 1HMVA 2AGOA 3MCMA 1VI7A 2AIRB 1AXQA 2F7VA 2DGTA 4WTYA 2ZWOA 2MQPA 3CJKA 2V8GA 4RW8A 2FUG9 3AB4B 1FVSA 1I94F 3VVUA 1BWEA 1S9GB 3W63A 5ADZA 4KFBB 3M7VA 3K57A 3M2UB 1KLMB 2YX4A 3CDAA 3D66A 1RTHA 3I0SA 4OI6A 4IFVA 1AZSB 2VQEJ 4X4RA 1IKXA 2QTWA 3JQKA 3CCLS 1CJUB 1RTDB 1SIZA 1YBUA 5LL6d 4PWDB 4M5DB 3KLGA 1FRKA 1NK5A 2R8KA 2FIUA 4LR7A 4E8UA 2Z58B 4J9SA 3PW2A 4JI0J 2G9OA 1CC8A 1Q86T 5KG5A 5E3AA 1WF1A 4DR5F 2CWKA 4J9QA 2P9GA 4H4OB 1JJ2R 2NZCA 1QSSA 5KFZA 1HBOA 3T1AA 1YBTA 2E5LJ 4F26A 5L1IA 2GO9A 5AE1A 2BW2A 4ZJLA 3QMQA 1SJFA 4FBUA 1HD0A 2EKYA 2IRUA 4O0NA 3PYFA 5DQGA 4X4QA 1UPMB 4P73A 4JV2A 2VJVA 1EIYB 2W4DA 2V94A 4PG4A 1X4HA 5AXLA 1JQGA 3RW6A 1RTJB 5KT3A 4WP8A 3DKDA 3NS6A 5GADU 2ZHBA 1H73A 1UAWA 1YJVA 3FK4A 2VFUA 2WW8A 4DV6J 1Q1KA 3HLUA 2XHCA 1NJIT 5KFHA 2W9BB 2R4FA 2HZCA 2DRAA 4Q2MA 2CPFA 3KLFA 4O23A 2QYGA 2X51A 3GB0A 5E3PA 2B8QA 1GT8A 2OD6A 4PG8A 1WEZA 5J1NA 3VALA 1AW0A 4QIGA 3QZ7A 2P2CB 4DG1B 2DH7A 2OLWA 4K0KF 2F1FA 2F4VJ 1NHKL 3PYGA 5FLXU 2VL1A 1U26A 2FGCA 4NX9A 1UEVA 2HG4A 4B9LA 4DR3J 3SCLE 2C2DA 3AFGA 1EJ7L 2V5HG 3QJLA 3BH7B 1ZZNA 2WONB 3OPKA 2DO0A 1IKYA 3FBBA 4JI7F 4QWCA 3VWSA 3Q2TC 1RCOB 4B9VA 4DPYA 1OY8A 3M2RA 1S99A 1WHXA 2C3OA 1KP6A 4WKYA 4TKTA 1NK9A 2YKMA 1S7IA 2ZC3A 1FKPB 4U8YA 5HMZA 4URQU 3RZAA 4NZ7A 4OZ2A 2BDPA 1U6FA 4DOZA 1FDAA 2MZ1A 3QGPA 3BREA 3FEZA 2RMLA 4QBUA 4Y2IA 2OSQA 3MAHA 3L3CA 1REGX 3PO4A 2ZDOA 3KJVB 2NPIA 1CVJA 2O1PA 3W61A 3OVBA 5EWGA 1K0TA 1KVIA 4ILMA 2F8EX 1VC5A 4KC5A 1Q78A 1S0VA 1RT5B 3R7SB 3GIKA 2O67A 2BVZA 1C1BB 3SMZA 3BSAA 3TVYA 4FXDA 3M05A 2ZC4A 5DO2A 2VU5A 3UNGC 4ZVHA 4ETXA 2CDQA 4B3OB 5C42A 1NCLA 2OKQA 2VG5B 3F0NA 4NXMF 4JI2F 1N54B 1HQEB 1R0AB 3DDIA 3HVAA 1R3NA 4OX7A 4MTPA 3G6XA 1S9FA 4N56A 3OUYB 1NZAA 1V5VA 3NS7B 5FLXY 2L08A 2ZNYA 1B70B 4IG3B 3L7PA 4QIFA 1RHJB 2VBZA 5BR8J 1LOUA 1LWCB 3B82A 1FX4A 3MAAA 1VQMS 1IBMF 3OV7A 1H2TZ 2AT1B 3T6BA 1R8CA 5HVGA 4DR7F 4C3LA 3ISZA 4GVLA 3LALA 2U2FA 1T11A 1W7WA 2OTJS 3IM8A 4FP9A 5KTQA 1RWPB 3VR1A 3HPOA 1S9EA 4NLDA 3L9ZA 2V8HA 4H4KA 3U7JA 2CWXA 3HVTB 5K14A 2DHXA 2FVRA 2VC1A 4DF4A 3CPWR 3D67A 1Z1ZA 3I4HX 2F3JA 3GR1A 2G2ZA 2FYXA 2AYBA 1M1KT 4LREA 3PJWA 3T5HA 3DLGB 1V3SA 4QJVA 5LOQA 4Z7YA 4DV7J 1TU0B 4IG0B 4DQQA 3S7RA 3HDSA 4UOHA 4DSKA 2ZVIA 2M2BA 3POTB 1WC5A 3KOAA 5C2CA 2RNEA 3Q23A 4X64F 2HNZB 5BYQA 2ASJA 3ZXWA 4NLYA 4DCJB 4LRFA 5HP1B 2B4UA 1J5OB 5AT1B 2GGPB 3T5KA 3GU0A 1BHNA 3TJ8A 4DN0A 1YZ6A 2E1PA 4DUTA 2ZHOA 1CS4A 4HACA 4A46A 3AXKA 2XBPA 2AYGA 2ZUGA 2VUGA 2GMLA 4Q8EA 3OLAA 4EFAC 1V9OA 1P1LA 4B3TJ 1JLBA 2GNKA 1U8SA 3NGUA 2M7SA 2CXEA 3R5JB 5HROB 4ZPDA 4PEOA 5HK4A 2DGXA 1P6TA 4ZJQA 1NNDA 3DI6B 4DEZA 2B4VA 1JMTA 1RT7A 3A8KA 2RKIB 4DPTA 1JXVA 3TQ1A 2ZZTA 3Q8YA 5JVGQ 4ALZA 4C3MA 1NH7A 3O8WA 4Q5VA 2Q66A 3R6GB 5A2QU 1UFWA 4UUXA 3DMJB 4DQSA 1B4SA 3DCAA 5B0GA 3EXCX 2B5JA 4I0WA 1VQKS 2GV1A 3GIRA 4WPAA 4DU7A 4Z37A 3MHYA 2RB7A 3W8GA 1L3SA 1FWKA 3V6JA 3MEEB 2Q43A 3U02A 1U0HA 2AEFA 3N6MA 4NA1A 3OL6A 1DTTA 2QL5B 4AUKA 2KN4A 1DLOA 5DQIA 3D68A 4C4WA 1VMBA 1ZZFA 4H4KC 1GH8A 3BBCA 3E01B 4BC9A 4K5RA 4ZK7M 1PAEX 4IRKA 4MKYA 3PR4A 3GPAA 3JSYA 2GQCA 2I6WA 1NSQA 3KLHA 4RW6A 2E5GA 1SL2A 4KBIA 2ATCB 2IC3A 3GCWP 2Z2LA 2VHGA 5L1LA 2F5GA 2UP1A 3SQGB 2ZOFA 1S6PA 3GG0A 4OI1A 5HJXA 3UCGA 4JI5J 2BJ8A 1TELA 1HR0F 3BKTA 4J91A 1M90T 3HM9A 3U1NA 5CYMA 2V0NA 2QLJB 3OL8A 2ZITA 2JH3A 3T9ZA 3KNAA 2M3DA 3ILOA 1T9UA 2F40A 5JMNA 2ZOMA 4IO1A 4ZHRB 2IJFA 4OLOA 1KTQA 1RWKB 4HH1A 4NXNJ 4B3SJ 1RB0A 5E41A 1HNIA 4KHPJ 4EU0A 3LP2A 4GRSA 4N8NA 5A2QY 1HNZJ 2OEJA 4MKVA 4ZITA 3FKBA 4F50A 1UETA 5AE2A 3CJ8A 2K8GA 1Y5LB 4GC6A 1G7CB 4IYQA 4X65F 4QCLA 4ENOA 5EX3A 4KSEB 1LWFB 1KQGB 3TZYA 2C22A 3B4DA 2KYZA 3IAM9 1NJXA 3I0RA 3RW7A 2HWIA 2YKPA 2K7KA 1BY9A 4NEYA 1FK9A 1NSKL 1RLDA 2HNDB 2GHPA 4PG5A 2V4RA 1Q7YT 2IFXA 4K2JA 3C3LA 2VKZG 2OPQA 3NOCA 5L1JA 4X66F 2EFPA 1EP4A 1HA1A 3IP0A 2MHEA 1SQGA 2IBKA 2K06A 2IAJA 4FN5A 1YSJA 1L3UA 2DK2A 4WIQA 4DR6J 2B9XA 4CLWA 4PQAA 2KT3A 4AQYF 3DRRB 5K5MA 2Y0BB 1L3VA 3WC0A 4PYAA 4DUYJ 1LW2A 4PABA 1RBOB 3N79A 5A6PA 4NCGA 3KLIA 3PNIA 2CJXB 3EGWB 1NUEA 3W2VA 3TRGA 2EW9A 2IY5B 5KAKA 1X5PA 1KLNA 1F9FA 1YRXA 1VBYA 1NU4A 2ZBQA 1RI7A 5D78A 1WJ9A 3KDOA 2CQBA 3PY8A 3BQ1A 4C11A 2FZCB 2FY1A 3BN4A 3KUHA 2GCFA 1VRQC 4DDFA 5D8HB 2V8PA 3F41A 1M5PC 2M8HA 3W7BA 2HRUA 1J2VA 1XBWA 1ZM3A 2V6AA 2OPRA 3OL7A 1FEHA 5F0WA 4UY8T 4X4NA 5GAEI 1DURA 5KFSA 1HQ2A 5KFPA 4IH7A 2NXEA 3QGIA 3MM7B 4RW7B 1RHRB 2PGCA 4ID8A 1BQMA 1JKHA 4LR9A 1YJRA 4NA3A 4WXOA 5BJRA 1VYAA 1QVGR 2HLTA 2Q79A 1UZDA 2DH9A 1RWMB 2L9NA 1HWIA 1T03A 1Y3KA 1H0HB 5CHCB 2V9WA 2P9CA 3Q8UA 3D4JA 4FS2A 1K44A 3TANA 4U67Q 2HHUA 3AY0A 4K7QA 4PXCA 2Y8WA 3T5LA 4I68A 3CD0A 3ITHB 3VF0B 3SZ2A 1YLXA 2F8HA 2PI4A 1NDKA 5H1SV 2ZHAA 3SSSA 2GA7A 4CNYA 2NYIA 1K0VA 3IMQJ 3D1QA 2M52A 1KFDA 4DV5J 3MR5A 4FYWB 4R25A 4I1TA 2KXHA 1KQKA 4FVCA 1S6QA 4J9RA 5M2UA 3GYNA 4GC7A 2ZM6J 3RG6A 2AV5A 1OPIA 4OIXA 4LUBA 3HMJG 4DI6A 5D0EA 4J9OA 3CULA 4LFCF 3ENVA 3HO1A 4LRDA 1Q8KA 2YPYA 3NCRA 1RWUA 2YBVA 3MUTP 4HHHA 4PQUB 3MTJA 4ANEA 1HWUA 1HNWJ 5J2NB 2G13A 3BGFA 2EG1A 3ICLA 3MCNA 2DR9A 3QFHA 1E6YB 1RAAB 3M8RA 5J2MB 3DLLQ 4ZN1A 2VODA 1FJ7A 2FLNA 3E2EA 1TV6A 3MPYA 3DOLA 1U45A 4Q45A 3WIVA 4DL4A 4YDDB 1X60A 4QR2A 3CCJS 1NJWA 2WSCC 4GKKF 1ZTWA 2OP5A 4JI1J 2VD3A 2DB1A 3FZBA 1XN9A 4EEYA 1QVFR 4TU8A 3FCVA 3HHKA 3CWJA 1MMNA 1ZA1B 3M8PB 4R5PA 4Z7CA 2BZ2A 2ASLA 2HK3A 2K2PA 3EZUA 1R6YA 2X7IA 3CJ4A 4U7UK 2OMOA 4JV5F 3RRKA 4F3MA 4MK7A 2CJ9A 3B54A 5ETVA 1F3VA 2DHAA 2ACYA 3FSIA 3A8EA 4OYXA 2OSRA 2KJVA 5K8MA 2PFFB 5F8MA 3K2YA 2DHGA 5D3GB 2DR5A 4QZVB 3UVJB 4PWWA 2CPZA 2XI2A 2DKOB 4ECUA 2BW7A 3D54A 4YB1P 1UVNA 1CULB 1S1VB 2DTJA 3D3BJ 1HYSA 3MWBA 4M8LA 5DLGA 1FJCA 3ZZPA 1VGYA 2W9AA 5F9NA 3BH6B 2SXLA 1UA0A 3GYGA 5HBMB 1F5CA 4F2RA 2C2KB 4ED1A 3GJRB 2B51A 3KK3A 5HLFB 3W2WB 2R9LA 2PO4A 3DGPB 1YQHA 2ACMA 4H4MA 1H2VZ 2ILYA 4NYOA 1TL3B 4LF8F 3NBPB 3QZ8A 4DMZA 1R89A 3B4MA 3ZZRA 2WK4A 1KBRA 3AD7C 4XTTA 3R5DA 1OO0B 2HFSA 5F8IA 3QRPA 2XMUA 2B8PA 2FC9A 4DFKA 2JDJA 3R5BA 3QFWA 3UPFA 3OR2B 2BE2B 1BMQB 5LM7E 3DM2A 5F8JA 1R7IA 2J0SD 4OZNA 3CB4A 4M5JA 5D6GA 3MCOA 4JI3J 3TUPA 4KGMA 3I87A 1WACA 4LVNP 2FHMA 3BGRB 3M8ZA 2HQFA 2DGQA 4Z2XA 4X84A 2MDAA 3I4PA 4ECRA 2DH8A 1FXLA 1CJTA 1U1KA 7FDRA 1KKHA 2VBWA 1X4AA 3Q2SC 1VOMA 4P7TA 2PC6A 4OI0A 4LFBJ 2AX0A 3DLKB 1S1XA 3EYZA 1UTAA 2HBZB 3PW5A 3N9UC 4LMZA 3TI0A 4CYUA 2P9EA 2RILA 4YEAA 3MMCB 1HPZB 4OYMA 1VQNS 1VISA 4M94A 4NEZA 3KJFB 4CO5A 2N3OA 4ZVOB 1RGVA 4B17A 4NI2A 1NAQA 2J7WA 2JFKA 3KG4A 2LEAA 1FJEB 1HBNB 1QAJA 2E44A 4I4BA 3MM6A 3QBCA 2W9CA 1RAHB 2UUBJ 1RUSA 3LGHA 3VVTA 5KFIA 1SVDA 1WKJA 4LFAF 2XMKA 2DNKA 5GAGI 2MZSA 1RAGB 5DLFA 4G65A 3RB3A 1X0FA 4A8SA 2MSTA 4OX9F 2A0FB 4RNFA 3ENQA 4EBCA 4EWTA 2V8VA 3GWCA 2NXCA 3W5ZA 3EDRB 3C14B 3GTYX 2WVEA 2DNNA 3T6JA 4NRUA 5KFDA 5DRKA 3QT6A 4DV3F 3TYTA 4ELVA 5ETKA 1UKUA 2A1BA 3CCRS 2FVPA 4HL9A 3IXQA 1REVB 4V1Ak 1RZMA 3GCXP 4DWIA 5LMUJ 1KN6A 3L7UA 1RT6B 5B7WA 5F3ZA 4DV1F 4DU8A 5CH7B 1YTYA 4WU3A 5D77A 3AA9A 1WOSA 4X4OA 3AA8A 3PJXA 2XWYA 2ZNZA 4JI6F 3ELHA 4C3KA 3VHQA 4PPDA 4CLPA 4ERDA 3KK1A 5BXIA 2OPPA 1NH8A 1RHQB 1T05A 3D28A 2E1CA 1J5EJ 3SFUA 4Y00A 4B08A 3EVOA 3JB9k 2VIHA 3BBFA 1JLEA 2O5DA 1C0TA 3CDWA 4OJ1A 1VIXA 3THVA 1CPZA 4QIWD 1HD1A 1XJWB 3K0JA 1FRHA 1GMUA 1DARA 3QT8A 4IFYA 3N5FA 1SXLA 4E0DA 2XY5A 3FBCA 4DV0J 2IM2A 5IZHA 5LJ5Y 2LXUA 4PG6A 2GQQA 2QMWA 4NLTA 1FFWB 3M9NB 1NMEB 3GJTB 2WVCA 2PEHA 1LWEB 1UWBB 5IQQA 2XWXA 3D1OA 4C6AA 1CQNA 1SIWB 3A3NB 3V6DA 2GZOA 5AXMA 4LSLA 3K5MA 3IGNA 2DVIA 1I3OB 1VRTA 1BQNA 1Y9OA 4CCHA 4F4KA 3H42A 2GAHC 2AYMA 4O3RA 2EC2A 2WCXA 3SSQA 2P8IA 2B3TB 3QRQA 4J7CA 3NCQA 1M5OC 1PG5B 3CJRA 2E66A 3P45B 2MQ8A 2MZTA 3VAFA 3HI9A 3JSMA 1VLOA 3PX0A 2HS3A 2A10A 2VBXA 2MTLA 4RW8B 4DLEA 4TLQA 1OY6A 4TN2A 1MG7A 1S0NA 3M30B 1Q8BA 3IWXA 4WFXA 4LF4F 1GXTA 1WEYA 3CVKA 3TX0A 1HQUA 3P96A 2XLJA 5E2QA 1XK8A 2IVFB 1A0OB 2D9PA 4ZOSA 2NLWA 5KG6A 3OJUA 3CJ2A 4L3KA 4B9UA 4ZLLA 1X0PA 5IM0A 3ET6A 1X9MA 1WC0A 3J7YU 2E9RX 1KRPA 4B9MA 3MFIA 4F4WA 2CJBA 1D9FA 3UD4P 1SKRA 1I1GA 2AJFE 3M6XA 3MFHA 4OYZA 3H5YA 4J9KA 1MU2B 5F8HA 5GAHI 3NWGA 3VAIA 2MHNA 4F25A 4WF9Q 3NNAA 4YHHF 2XB2D 1GXUA 2LMIA 1X4FA 4PYDA 1AA1B 2KFYA 2I38A 1RBLA 4DPWA 2RE1A 4QWAA 2VG6B 1VLYA 4ETZA 1XMQF 1R0BG 1F5BA 4Q0BB 5DETA 1ZTTA 3RGIA 2AGQA 3MPDA 4QYZJ 5EN1A 4NRTA 4DF8A 3IRXA 5G4DA 5J1EA 2ZZNA 1HFEL 2PA3A 1NM2A 3K8WA 3W60A 2Y1IA 4QQBA 3OTCA 4K4YA 1XR7A 1VJQA 2D69A 1WTFA 2QFIA 4I69A 1JLQA 3TZWA 4EYIB 2HRYA 4DL0C 1SKSA 4FF2A 3OFGA 3SIPB 4P2MA 2PD1A 3HHLA 4P9SA 4A4JA 1PGZA 5K20B 3CF5Q 4OHYA 2H51B 3GQCA 1FJGF 3RUBL 2W24A 2AU0A 1GTEA 4LF7J 1ICEB 1LW0A 2HWHA 1AFJA 2CKWA 2UUCF 1IQZA 2JSXA 4OJGA 1IXKA 1EETA 2XMWA 4B9SA 1UPPA 2BKOA 4J9LA 4NE9C 3TAMB 2YNGB 4OX8A 1IKVB 2ZE2A 3MM5B 2OI2A 3JTOA 5L9NA 3DOMA 1XNQF 3ZZYA 4K4WA 2LYVA 3P5BP 2YWKA 1X4BA 3R5GA 2KHCA 2MKHA 5A8KB 4ZN3A 3HSGA 5HJYA 3DDKA 3CJTA 1TL5A 1IBLF 3SCIE 2CPDA 1Z2ZA 2UUWA 1FERA 3O5TB 5T7LB 4OYWA 4DR1F 4P2FA 4ZP6A 2IM1A 3OVAA 5AJ3J 3HFKA 4KAIA 2X3GA 2XQCA 4PUOB 1B0VA 1HWLA 3RR8A 2DY9A 1QDUB 4PKDB 1XMOF 4GKJF 4CTAA 3PM9A 1G2EA 4LQ9A 2BR0A 1VQ5S 4N7TA 5GMDA 2AZ3A 2Z8QA 3EMTA 2JEFA 1V6HA 2M9KA 3BS9A 4Y34A 3FUYA 2Z4PA 3K59A 2CJYB 2EG2A 1S1TA 2RJZA 9RUBA 3KYLA 5AE3A 4IR1A 3D6MB 4JOUA 4N8OA 2LXFA 5J2QA 1UW9A 2YY3A 2HFZA 2GHWA 2VASA 4C8KA 2DJWA 2MKIA 5D0HA 2H54B 3NEKA 2J9DA 2WVDA 2VQFJ 4LIRA 2WAQD 2GHVC 1X8DA 5JXSA 1ZYQA 2AEMA 3VV2B 4KHRA 2F4FA 3PW0A 3CCVS 1M1GA 3ZTQA 2KO1A 5EDWA 1NPRA 4M63A 1FKOA 2C3UA 3R1LA 3C19A 1TK5A 4H54A 4IDKB 2WOMB 2LQ5A 4WK1A 3SQOP 2HQCA 1RTIA 3DFEA 2HEKA 2H1YA 3KHGA 4L74A 2EKNA 4U6PA 3SV4A 2BYCA 3EGZA 3DRYA 5KT5A 4ANDA 1WSVA 3RTVA 2I5JB 4KPCA 5KFWA 2YQ3A 3QO9B 1RE1B 1RJJA 2R8HA 4ZPAA 2DYAA 1YJ7A 1NDLA 1WSRA 3C6TA 1UVJA 3QIPB 1HBUA 2NREA 3M1VB 2Z2MA 1SC1B 2V68A 3AODA 1S5ZA 3FBFA 2JVOA 3AOBA 1K73T 1EQMA 2BKNA 1IBCB 3Q8QB 2XYGB 1JLFA 2JC0A 1JLGA 3MM8A 2C2MB 1RT3B 4G1IA 4LF2A 1U1NA 4YY3F 1R27B 3VAGA 4KO0A 1U2CA 2NCKL 4MIBA 3AJ1A 2QMXA 1W2BR 1OS5A 2XY6A 2KM8C 2WBRA 5D4NA 4URSA 2V34A 2OTLS 2VB6A 1HWJA 1G3OA 4EUVA 3G4SS 4F0HA 3SDEB 3EPIA 7FD1A 2NXNA 3ZTSA 2VQEF 1U1QA 3A1YG 4M5IA 2IM0A 1QJHA 1KC8T 3I96A 5KT4A 2QA1A 4OI3A 3IA0A 2HZVA 4JI0F 2NS1B 4J9VA 2PSZA 5KFVA 1GX6A 3KK2B 2YNHA 1Y7PA 4RUHA 2CQ4A 2BJ3A 3DLEB 4M5GA 3KXDA 4OJ3A 4ZVRB 1HNXJ 2I8EA 2WHOA 2NZ4A 4DS5A 4MFBB 2VFSA 2OELA 4J9UE 2QN6B 1FHTA 1PC5A 2VDHA 1FNXH 2BE7D 1UCNA 4ELTA 5DQHA 3OJSA 4B9NA 1MMDA 1HI8A 3AD8C 2LQ8A 4HEA9 2RHSB 1RAJA 4YFUA 1T94A 3LWMA 4BWMA 2ALYB 3GIJA 3G71S 2I2YA 4DR4J 3QGGA 2A6OA 2DHHA 3DYAB 2NXJA 4USVA 3DOKB 2UVRA 4Y28C 2YKAA 4R8UA 2RQ4A 3ZZ0A 2RF2A 2OPSA 3FEYB 4USKA 1WC3A 4DX6A 1D0EA 3GYXB 3R1HA 1VQLS 1MN7A 1N5VA 4CLZA 1QUVA 2RIJA 4YUDA 2NR0A 2JFDA 2MLZA 1HNIB 3OTEA 3CDBA 2ZKTA 4CLYA 3BDEA 2F4VF 4WWSA 3PX6A 3C2PA 3F56A 3MMAB 3M2VA 4HHJA 1NO8A 5C2GA 3V6HA 3OFFA 1U2RA 2YTCA 1GMWD 2BANB 3H20A 4DR3F 2DR7A 2ZEJA 5A0YA 3IN5A 2GVZA 4ZCLA 2HK2A 2EFQA 3CCZA 4USUA 4O4GA 4A8KA 4FF3A 1U7LA 2YKNB 3LAKA 5I42A 2MEWA 5F8LA 2JX2A 3RBXA 1ITPA 2BBEA 4CO3A 5MAOA 1JNRB 3GSDA 3RBZA 4W90B 2QRRA 4CO0A 2L48A 4AL7A 1RAIB 3MR6A 1MROB 1N52B 4F3QA 1XNRJ 3CD5A 3KUEA 2ZH3A 2ZUAA 2XZWA 1UZHA 4G1QB 3MOZA 1BE4A 4I6YA 3BO3A 3MM9B 3LWLA 3VCDA 1S9GA 1Q5VA 1YGYA 4KGZB 4XK8C 4KFBA 4C0OC 5U47A 4GO5X 3M2UA 1KLMA 4KYZA 1KVJA 2PMZD 2DNRA 4C8OA 1AZSA 5IC6B 1SQFA 1CJVB 3FFIB 1CC7A 4LF9J 1CJUA 1RTDA 2Y8YA 1T9TA 1U8WA 1VR6A 4PWDA 4K4ZA 4ZVTB 2LECA 4NLPA 3W2VB 3HCXA 3ZTPA 3TO8A 1RT4B 1YDLA 2IRXA 2GO8A 4WK3A 4ZVFA 3IGVA 2B56A 1PAUB 4OYPA 1CG2A 4ECXA 1SJQA 3VTIA 3B6BA 4H4OA 2R2RA 3NGDA 4HDHA 1D09B 2CDRB 3DDNA 2CADA 3R2CJ 2HFOA 1VDHA 4X62J 1JLCB 3K17A 4O3PA 2HSEB 2P6TA 2CPHA 5E0OA 1RTJA 4C9DA 1D9DA 5BR8F 1RU1A 1RU2A 2HBYB 2ZH6A 1JK9B 4HDGA 2RRBA 4MT1A 2E5IA 2W9BA 3V4MA 2MY7A 3OQ2A 1NKCA 2PI5A 4RKUC 5L38A 1VRUB 2DRDA 3QT5A 3VGSA 4OHWA 1YRTA 3G82B 5LMNJ 3MD3A 2R7OA 2DPIA 3GFZA 3RRHA 1DTQB 4DG1A 4FF4A 3T1YJ 1VCTA 5HO4A 1HHTP 2HQGA 4K4XA 3M32A 5C24B 1VBKA 1FE0A 4Y2CA 4DJBA 5F9LA 4JV0A 4CT8A 1UW4A 2W2NP 2BACA 4A8YA 3B8HA 2CPYA 1T02A 4X65J 3D7SB 4I67A 1D8YA 2B4OA 4M5LA 1ELOA 1S1UB 1A6LA 3HVWA 3MMBB 2WONA 1W2IA 5FDLB 4DV7F 4OZ3A 2K1RB 4BCAA 4XAKA 1QM9A 4DHVA 3NGTA 4QYZK 1B0PA 4ED0A 4P71A 5KFBA 2KG0A 2BRLA 3LPEA 4PXDA 5J1PA 3W3SA 2YWHA 2CJAA 1FKPA 1FI4A 2GMHA 4M5KA 1NK4A 3C16B 3UN3A 2M88A 5KFNA 3W5YA 4C8YA 2DNHA 4TXSA 5F8GA 1WF0A 2D41A 3VQSA 3N28A 2XY7A 4F04B 3KJVA 1BD6A 1ZM2A 1U0SA 4B3TF 1RT1B 2NUUG 3OXFA 1DAXA 4L3NA 4YB5A 1TL7B 2ZJRQ 1U24A 3GILA 3I82A 5H9EJ 3AB2B 2QLWA 4KKOB 1JWWA 1RT5A 1FDDA 3MEKA 3ENAA 8RUCA 1CQMA 1C1BA 1U47A 4KGKA 4PAAA 5I3UB 5LXRA 3DRXA 4L76A 2C28A 1DJ0A 2RHQB 1TKDA 3D3CJ 1F2GA 4B3OA 4NWBA 5B0DA 4RBTA 4C2MA 2VG5A 3DLHA 1HQEA 1R0AA 2B9WA 2RU9A 1LV5A 1MWZA 2CZ4A 3IAS9 3OUYA 2GFFA 4ZVGA 2CNLB 2HHTA 2LDIA 1N34J 2NSBA 5K8PA 2B0GA 1TFYA 4RR5A 4IG3A 1N5TA 3NNCA 5KFLA 3BO4A 3K5LA 1VBXA 3EVMA 2CQ3A 1LWCA 1B7YB 2FTRA 2MKYA 2CQDA 1NJYA 1HHQA 3D6HB 3KDNA 5A8WB 1EX8A 1Q7LB 4FNIA 2EBGA 2W7AA 4YB6A 1KQFB 3LO3A 5KOXA 2J7KA 2JEIA 1JIHA 3QWPA 3CMES 1YJTA 2GS8A 2CNOB 5GAEU 2EPIA 2RS8A 4ECQA 3HK2A 3A3OB 4JI8J 4RBUA 1TVRB 3HVTA 2CPXA 3GR0A 2I1RA 2CYYA 4ANCA 4RZRA 1MWYA 1SI9A 2CA9A 4J90A 2CG4A 4Q44A 4RUBA 1ZAVA 4TVAB 2QT7A 3QPIA 3G8QA 1B7FA 3DLGA 1C4AA 3PFEA 8AT1B 1S76D 4RNHA 1NKBA 4IG0A 3IO1A 1L5UA 2L3MA 2OFHX 4I2PB 1SKWA 3DXBA 2DCLA 4ZS6A 3POTA 2LVWA 2HNZA 4Y6IA 5HP1A 4NXNF 4B3SF 2DT9A 1VC0A 3TQEA 3UNYA 3MD1A 2B7BB 1J5OA 4ZVEA 4KHPF 1AYEA 2GGPA 5CD4H 4RL1A 2XC9A 1HNZF 3JTNA 2RDDA 2E9TA 3G6VA 3HZEA 3FSXA 1TKZB 5DDPC 2ERRA 2RDIA 4F67A 3DNCA 4O3QA 2GIQA 1RQ0A 2FJWA 2D3O1 2XSJB 5SZTA 4RW4B 5HROA 2E5JA 4CLTA 1X5OA 1P9YA 5L1KA 3IG1B 1KONA 1LK5A 2AJQA 2Y0SD 3BYPA 3DI6A 3HVRA 2B43A 2RKIA 2MKSA 2O3DA 2NPFA 1G4CA 3BKUA 3ZZOA 3MURP 1T9WA 1H38A 1WOOA 3J7Z5 4DSJA 1VIOA 4A8MP 2K7JA 1N33J 2YNIB 5MLCV 3DMJA 2X1GA 4DR6F 4ELUA 4KH1B 2HGLA 4KV8B 2RRAA 2M8DB 1NHVA 2AHOB 3WBZA 1U09A 5ETLA 3MEEA 4O3NA 4DUYF 4DQPA 2KFZA 4WZMA 2MJUA 1N0VC 2LLZA 4OHVA 2MQQA 4DFJA 1DY3A 5D0GA 4IKAA 5HATA 5IV4A 4ZMMA 1FE4A 3ZNJ1 3CT9A 3E01A 3PFOA 3TEHB 3RRGA 2BMBA 3OFHA 2W2OP 5E33A 3PIOQ 3UW1A 3EXYA 2N7CA 4N5SA 3DLBA 2BM1A 1F9EB 1WOPA 2AEJA 2RVJA 5KFXA 2VC0A 2OEMA 4HLBA 4OYBA 1IN0A 1RBAA 3H90A 5A8RB 2J6SA 1QY7A 2R2SA 3SQGA 5JUMA 3ZFVA 4WFAQ 2FZGB 2N82B 2XMAA 3UD5A 1M5VC 1VQ8S 4LF8J 2E1RA 2HPUA 3MDFA 2PFDA 3LAMA 4CZCA 3K89A 5ETSA 4CM2A 2HVDA 1IR2A 3PV8A 2CIMA 2WSFC 2UV8A 3QGHA 1HNVB 3CO0P 2ZBIA 1IKWB 2MZJA 3L7OA 3TARA 1C2PA 3QLHA 2V2QA 4OV6A 2KH9A 4ZHRA 5DGBA 2DNYA 3FBEA 2OO4A 3THTA 4DSFA 3IM9A 5KFYA 1Y0HA 4F7VA 2HIYA 1N0UA 3H4BA 4YDXA 2UU9J 2GJIA 2KKHA 1QD1A 1XC9A 1WD6A 2D1CA 2J0QD 3BM7A 4F4AA 4IH6A 4NMXA 3H4DA 1HLWA 4HT7A 1LWFA 4AXIA 2N3LA 1Q0NA 3TUJC 2BQRA 1N8RT 2FDNA 1TK0A 3HHEA 4DV5F 4EYHB 1RXOB 1YZ7A 3C8YA 2RH3A 4ZJOA 2HVIA 5EX0A 5IV3A 2LU2A 4ZLJA 2HNDA 2YX7A 1IUJA 1NHUA 1JXEA 2ZM6F 5KG2A 4DCPB 1T3NA 4G6VB 2FHKA 3OR1B 2WSEC 5CYQB 3U1MA 3R27A 2XYHB 4KGVB 1JJHA 5CABA 1YJUA 5DZ7A 1TTHB 4FPIA 1F5AA 2DGSA 2IDLA 3UDEA 3AXMA 1NK8A 3IR7B 2YQ1A 1TL1B 1V3ZA 1N36J 1HNWF 4EK2A 2XS5A 4NMLA 3DRRA 3G87A 1X4CA 2HFUA 2COLA 3QT7A 2ZH5A 2D3OR 2OHDA 5DG7A 2FVCA 4CO4A 4XPEA 1CJKB 3MGJA 3AOAA 1JLAB 1U1PA 2BE9B 1X4GA 1VK8A 3I9ZA 4OZ0A 5D0RA 5GAGU 4DL3A 2XULA 2HHHJ 3GV5B 5DG9A 2X1BA 2DXFA 3KHRA 1VQ9S 3CEDA 4JI1F 3KLEB 1Q5YA 5KT6A 1F9HA 1S12A 4RJVA 3ILLA 3HFZB 1R8HA 2OH2A 3PHEA 3SEOA 2RSQA 3BPDA 1H72C 1SV5B 3IS9B 2PMHA 1FRIA 1SPBP 5BYRA 3R6LB 3NG8A 3MEGB 3CIZA 1SL0A 2ZJPQ 2PIIA 1QAYA 4RU9A 3UFCX 1RK8A 4UOFA 1B3TA 2W25A 2HNYB 5LXYA 2E1MC 2GW8A 4Q8FA 3MM7A 4ZCMA 1RADB 1PILA 4RW7A 1ZM4A 1YVFA 2BQ3A 2BA9A 3BEGB 4MYTA 1X9WA 4M1KA 3GE9A 3RU0A 1NB2A 2GX8A 3EWGA 5JJBA 2V50A 4WP9A 4TNOA 1OMSA 4OZJA 1PC4A 3NXZA 3EDQB 3M6UA 1WI8A 2LQ9A 2BOAA 5E3QA 3ITHA 5IC4B 5IS2A 2EXUA 1WKLA 1FT8A 3K5NA 3OTDA 5D4LA 1BLUA 3CD7A 4I2QB 3TA0A 4O0IA 3M8WA 1ROFA 2DNMA 4HT5A 1W25A 3D0IE 4I7FB 4K8RA 4BBYA 2BABA 2ZD1B 3Q83A 1O8BA 4FDFA 5B0AA 4DR2J 3CCMS 4EBEA 1OWXA 2X3DA 4JI3F 2OAUA 2QA4G 3CO9A 4C8ZA 1QE1B 1LXNA 1NRKA 2ZBPA 4PQUA 2AWZA 5J2NA 1FNMA 3L4BC 2QLXA 2VH7A 5I3PA 1E6YA 1HW8A 4CH1A 4F2SA 1YITS 3NP5A 2L9DA 1T9YA 2MXYA 1O6XA 4P7VA 3ISNC 4WE1B 4ECSA 2V9KA 2XGQA 2CZVC 2FGOA 4CO2A 1NB7A 3MPUB 3PJ9A 3R5CA 5G0RB 3OFEA 2CVIA 4USJC 2ILZA 4DS4A 2V2KA 2APOA 3V4IB 2KT5A 3M8PA 1U2FA 1WWHA 1JB0C 3KMQA 1PJ6A 1TMJA 2EI5A 2UUBF 4U7UD 2Y1RI 3V2UC 5FJ4A 1XIQA 4UZBA 4LF6J 3TJ9A 1RACB 1HBMB 4K2XA 1LK7A 2V2ZA 4LBPA 3FC9A 4NASA 3TAQA 4R0EA 2HAFA 2IRYA 4ZP8A 5H9EK 2ASDA 3WIUA 5D3GA 2R8IA 2HHPA 1P9QC 1WG4A 5GAHU 3LTOA 3LP1B 3UVJA 3CDEA 2DNZA 1NJZA 4UF4A 1FX2A 1G6BA 3EPGA 3D6TB 2W8LA 4F0KA 3UDVA 1CULA 1S1VA 3OSPA 3CD6S 3QSIA 5THWA 3FMWA 4HHUA 3ZTRA 5LMUF 3UCUP 2VPZB 5KFRA 5ITHA 4EBDA 5KFJA 1SC4B 5HBMA 3MEDB 1OYDA 4J37A 2IYGA 5HLFA 5I4MA 2R7XA 3W2WA 1ZPVA 4UOGA 2HS4A 4NYZA 3DGPA 3QQCD 2B9YA 1TL3A 2R2TA 1FA0A 3NBPA 3IRWP 3GV7B 1YWXA 4Y2KA 4MKBA 1XEZA 2CJKA 3V6KA 5CCLA 3H2UB 2J5AA 3FRYA 3S1TA 4AL5A 2EK6A 1YG0A 4DLGA 2MYFA 1DRZA 2JEJA 6AT1B 1TUGB 1FRJA 4RNOA 2QLBB 1J5EF 1Y11A 5CAAA 4ZKAA 4MIAA 5DDQC 2ASYA 3X1LB 2VV5A 3OR2A 1HHSA 1F3FA 1PYOB 2YNFB 3EM1A 3PRVA 2P5VA 3K5OA 3KHHA 1K47A 4DV0F 3NCPA 4N76A 1C0UB 2GIFA 2J9DE 3FEXB 4EO8A 2F65A 2HAIA 2ZH8A 3ZC4A 2UUTA 2QJ3A 1RWOB 2PE8A 3BGRA 2ATLA 4LSNB 2HQ3A 4TU9A 3AD9C 4JBCA 3WC2A 3CMAS 2FLOA 3WZ0A 4A8OA 1L3TA 1X4DA 1D9AA 4QR0A 5RUBA 1N56A 4NZ0A 3KJQB 4GVBB 3PW7A 3ISND 1S7HA 3DLKA 3W64A 5KFMA 4DZ6A 3MUVP 4FVMA 4L73A 3TJAA 2BJ9A 3MMCA 4L72B 1HPZA 1UVKA 1TR0A 1DQ8A 1IBLJ 2QC3A 1AT1B 3MF5A 2UXBJ 1RWXB 5F3TA 3FQLA 1Y5NB 4DR1J 3LUYA 4PXBA 3A13A 4FYDA 1S57A 1HBNA 2XTJP 3BB5A 3BQ2A 2QV6A 1R8AA 2VG7B 2XCPA 2CPJA 2XCAA 2V8DA 4NCAA 3H7HB 5LSOA 4CO1A 1WKKA 1DZ5A 5KG4A 5B09A 2W2PP 4CT9A 2XS7A 2C2EA 2HGNA 2DGWA 4CNZA 3HZGA 2MKCA 2XMVA 3T41A 3C14A 1RT2B 3C15B 4F4YA 1URRA 2H4YB 3G6YA 1PCAA 2QMUB 3Q8SB 1REVA 3DRPB 2EFGA 1F1BB 4PG7A 1R31A 2CQIA 4I64A 4E98A 1RT6A 2Q3PA 1A7GE 4ECTA 4X2BA 4XDDA 1QTNB 2WW4A 4DZDA 4KHMA 2HMIB 3J81U 5EHHA 2J6TA 2YXLA 4DUZJ 2BEFA 2MJNA 2XEXA 2BRKA 4RWWA 1EAYC 2RQMA 4AFFA 4E2FB 4KE5A 1S0MA 4TY8B 3VGTA 1SC3B 2A18A 2EFOA 4U7CA 3CXCR 1AFIA 2J0WA 2QSWA 1RHMB 2A6MA 4BC7A 1CBKA 5IOLA 1MLAA 1RAEB 1Y4ZB 3P3DA 4YR2A 3MOJB 1S72S 3JYTB 3DLJA 2X1AA 1E6VB 3IFEA 1IJFB 1H98A 3M2VB 4J9MA 2QEXS 4NLVA 1LWEA 1UWBA 2AJ0A 2DNQA 3PTWA 4OL8A 3CDUA 2FVQA 2AKWB 2C2RA 2R2UA 1TQLA 4JYAJ 3ETOA 1IWGA 3FRZA 3MMJA 1N6QB 3M8YA 4ZP9A 1XQIA 1W26A 5KOWA 2KU7A 1H7XA 4HR2A 1IM4A 2LA6A 2ROEA 1YJNS 5D15A 4C8LA 2U1AA 1IBKJ 1KS2A 4B3RF 4USTA 3M30A 2HIQA 4DN9A 3J81Y 4ZPVR 4CLLA 1XR6A 3VQTA 3BN7A 5E3RA 2KXNB 4RW9B 2H65B 4UTGA 1GNKA 4I6AA 2BM0A 1ZOTA 2RUSA 4RUAA 5E7OB 1FO1A 1Q8IA 4NLRA 2FZKB 1S1WB 1Q16B 4CDIA 1UFKA 4FPRA 4DPUA 4AYBD 3BGLA 2R3VA 5AJ3F 1OYEA 4UQGA 2WVBA 2OEKA 2DISA 2MZRA 1ZETA 1MU2A 5KT2A 2HFNA 3Q89A 3T3FA 5CA5A 5C25B 4AT1B 2CAJA 3UQSA 4Y2AA 2XG8A 3H98A 1RP5A 3EZ5A 2FD2A 5ETNA 1MW7A 1PBAA 3AJDA 3T1HJ 2B6AB 2VG6A 4K50A 4Q0BA 1FRLA 3R97A 3MCSA 1N5YB 3EGNA 1OSCA 2CFXA 4O44B 5HQLA 2VA3A 2HWTA 1OQ6A 4P6QA 2Q6CA 1N32J 3FJ2A 2VQFF 1QAIA 2LEBA 2GVDB 5KG0A 1OQ3A 4X4SA 2IBOA 2IM3A 5EUHA 1RCXB 4LRCA 1RLCL 3M32B 3WHIA 2MQNA 5IXUA 3QYYA 2AQ4A 1XERA 3HKWA 5IQ6A 5JVHQ 3CNQP 3GG1A 1AB8A 4FYYB 4IQXA 1S4EA 4UY85 1AUSL 2QL9B 4M5NA 3M8QB 3E3XA 4QPXA 3OHAA 3DRSB 2WVFA 1WC1A 4ZDNA 1S97A 2ZH9A 4DX7A 1NXIA 3OTOJ 2EWHA 4CH7A 3V81B 4HTIA 5LSRA 1S49A 4B3MJ 3TAMA 2YNGA 2FVSA 2H4WB 1IKVA 1A9NB 2HBRB 3MM5A 3HULA 4DPOA 4U9RA 3H5SA 3HKZD 3M9OB 2XM3A 3P6YC 4J5OA 5IFMA 3DGVA 2K3KA 3BKFA 4U95A 4ZPWR 4WBFA 4ZIVA 4ED2A 4DV4F 1N88A 3HT3A 1VQPS 2KFNA 3MZIA 5A8KA 3CSKA 1SJRA 1GAOA 2DNLA 5L9XA 3W9IA 2VKRA 4RWXA 3FSYA 5HMYA 4N47A 4TLRA 2C3PA 4PCQA 4A48A 1HW9A 1TKXB 1Q95G 5T7LA 2UVWA 3LH2S 3BO2A 3HSJA 3N01A 4BDPA 1S6OA 1WDDA 1LEOA 1XMBA 4RBVA 2VPXB 2H5JB 3D0HE 2UXDF 4PUOA 2YWFA 3G8SA 4IRDA 1SCJB 4QR1A 4AL6A 4OFZA 2YPZA 3U27A 2IDEA 5CD4A 4JI4J 1U25A 1KOHA 5KFKA 2DR6A 4KT0C 1PIEA 4CWBA 3KHLA 3VAJA 4IOAQ 1FEEA 2RAQA 3R2DJ 2CNNB 5CZVA 4RNMA 1RDRA 5HQ8A 5DDRC 3NNHA 2MY8A 4AD6A 2KHDA 4WP3A 3NGRA 3NGKA 2F9DA 2JC1A 5DJBA 2CPIA 2JLGA 4OHZA 2FHJA 1C1CB 4ID5B 4MKAA 1XWLA 2DEIA 2HRTA 1O0PA 2C3YA 5K8OA 2UXCF 1D3WA 2Q1LA 1HNXF 3W66A 1SUQB 2R42A 3BBBA 3EGVA 4C48A 1T3OA 3R3TA 1TKTB 4WXWA 1RA7A 4DFPA 2KT2A 1TFWA 2UUAJ 2Q6BA 2KRRA 1WHVA 2O66A 3EJMA 2C1EB 2WB1D 3PXGa 3ZZTA 2V4QA 2HGMA 2GQ2A 3BYRA 1CLFA 5IWAJ 5A76A 8ATCB 4DR4F 3C6UB 2H48B 1TZ0A 2N7YA 1M1HA 3MECB 2JLEA 4IDKA 4DX8H 2KVIA 1WTBA 2WOMA 3Q24A 4LF1A 5J2PB 2CQCA 2UVVA 3GONA 4ICLB 4MIWA 3RBDA 1S10A 4QPTA 3HJFA 4NLOA 3NWRA 3CC2S 2YVSA 1HMVB 3AHPA 4Q7AA 1LWXA 3CJKB 2I5JA 4WCEQ 4K5SA 2VJUA 2DBBA 3ADAC 3QO9A 3LP0A 4KIAA 4ED8A 1F60B 2BJ1A 2YQ0A 3QIPA 3ZNUA 1JX4A 1RTHB 3I0SB 3CMQA 4IFVB 1TUWA 4ZVPB 3M1VA 2D3ZA 4LF5J 1K1QA 1IKXB 2I0XA 2HHSA 3KLGB 5HN0A 3A8IA 1T7PA 4DXLA 3ILIA 3AAWB 2L9WA 3AQPA 4QIVA 2MPUA 1WG1A 3RAXA 2H5EA 4ED4A 2XMMA 3HSDA 3TZZA 1RT3A 1U1LA 4QIEA 1ZPWX 2HFVA 1QAXA 5ETMA 4GO7X 1XNRF 1HBOB 5KFTA 5HQMA 3S6EA 1DQ9A 2DIVA 4IO9Q 4Q2LA 5FIIA 1V5IB 2YWEA 4LRAA 1FDBA 2Z30B 3R7BB 1SJ4P 2JEGA 3MXHP 3THPA 3LA0A 4NLWA 5FD1A 3SDEA 1U1RA 3NL0A 1OIAA 5E3CA 2NQPA 3MTKA 3B78A 4LF9F 1R43A 5D4OA 4HKQA 4PRFA 4IH5A 3H0PA 4DPXA 2MQMA 1BWVA 1EB0A 3H40A 2RDJA 3KK2A 2MSSA 4LVOP 5KFGA 4Y3CA 4ZVUB 4O3SA 3R9LA 3DLEA 4ECWA 1Z2LA 3R5AA 3KLFB 3G86A 5K9FA 4D3GA 2QGFB 3MPVA 4YB7A 4USWA 4MFBA 2EBEA 3AJ2A 3CCSS 3JXOA 5HMXA 4X62F 1QSYA 2FJDB 3GJQB 3EZOA 2AZ1A 1TAQA 5B08A 4YQWA 2FC8A 1EARA 1F0XA 4TU7A 4XDCA 3TX8A 2DY1A 3AT1B 4ECZA 3R7NB 3DYAA 1IKYB 4LRBA 4NLXA 3DOKA 2KI2A 4OLPA 2MGZA 3KG0A 1S6UA 2AX1A 2KG1A 2F63A 3M2RB 3L95X 4OI2A 3BDPA 1R6VA 2YKMB 5LMNF 1WC6A 2LA4A 3QLHB 1N48A 4N41A 3UE2A 1T8EA 4NYPA 2AD9A 3GFXA 2J76E 3T1YF 1J27A 2ZKUA 1PJ5A 2RQCA 1I94J 3MMAA 2C3MA 2GMJA 2POKA 2R7WA 3GFHA 1YI2S 4BHQA 3IBWA 2BANA 3H8YA 2WBMA 4C0BA 3BSCA 4OZLA 1OPZA 2W4PA 1X9SA 2YKNA 5DM7Q 3KLVA 4B02A 1JNZB 2Y3YA 1GMWA 1Q53A 3JTPA 3CW2C 4DR5J 3GFYA 1HWKA 3MUMP 2L41A 3KNGA 5K8NA 3LOUA 4CLUA 2VF3A 4OX6A 1UP1A 1MROA 5C42B 3TP2A 4X4TA 4DV2F 4P2SA 4G1QA 4LQ3A 1IR1A 1B64A 2E7WA 3MM9A 2M4MA 4WFBQ 2XNRA 2RD5C 3KTQA 4ECYA 3MPWA 2FHJD 4LBIA 4DBQA 5EWEA 3I32A 4XO0A 1RKIA 3NLCA 1YIJS 1CJVA 3FFIA 1PSDA 4MAKA 3Q0AA 3MAAB 2H9ZA 4RUCA 3NMRA 1KVKA 2IVMA 1KFSA 1WG5A 3PYEA 1RT4A 1NSPA 4M95A 3CJ0A 5B0FA 1UA1A 4ED3A 1GX5A 3HT0A 3HD2A 1P27B 1VHFA 1VJWA 2OUGA 2Z0GA 2IA6A 2D7SA 2DGOA 2N4CA 1S9EB 5D4PA 4ZP7A 3EE3A 1U48A 3A3PB 3NKYA 4K0KJ 5K14B 2HYIB 3G6ES 2W1BA 1S59A 2E7XA 5F8NA 3OD2A 1JLCA 1IJEB 1VK3A 2EK1A 1N34F 2WRMA 2IIHA 3BPSP 3QAUA 2AMCB 3IC1A 2PN6A 2QIFA 2FJBB 4JV1A 1TP7A 2LP4A 3OSNA 5T41A 3UO0A 3GMGA 3SYZA 4JI7J 2DO4A 4U96A 5E5NA 4OQJA 1FF2A 1ZAWA 3KFWX 1TMMA 1ACMB 2V4JA 1VRUA 2UZAA 1NK0A 4IOCQ 3RB6A 4P2XA 3G82A 4QWBA 3QJPA 3QJJA 2QYCA 3CUNA 3TZXA 2BUNA 4F4ZA 2G0CA 1CSJA 3ZZZA 1DTQA 4JI8F 2ZBCA 2JLFA 2XHWA 3BF4A 1CS4B 5T14A 1QLNA 4HACB 2V63A 3BR8A 4M5MA 5C24A 1VS3A 2A2DA 3J7A1 3W9HA 4HI2A 2N4DA 2CJQA 3W8PA 3D1HA 4ED6A 1P8GA 3WX4A 1P1TA 1JLBB 4UQTA 3N5BA 4ZLNA 4AXJA 1SQEA 1S1UA 3MMBA
chains in the Genus database with same CATH topology
2XLIA 2KZZA 3IWLA 3MR2A 1VQ7S 2DVIA 4IQMA 5FDLA 1R8HA 2OH2A 3PHEA 1VRTA 3SEOA 2RSQA 1BQNA 2K1RA 1H7WA 1Y9OA 4CCHA 4F4KA 3GZ7A 2AGPA 2AYMA 5CCMA 4O3RA 2WCXA 1VFJA 2IJNA 4F8RA 1SV5B 4USIA 3SSQA 3IS9B 2B3TB 2PMHA 1RT7B 4YMEA 1FRIA 3U1LA 3NCQA 1M5OC 5BYRA 3CCUS 2MQOA 2QZ8A 2R7VA 2ADBA 3NG8A 3MEGB 4A8QA 2E66A 3CIZA 1SL0A 2ZJPQ 2PIIA 2FLPA 1QAYA 3SSRA 4TYBA 1QTMA 1LKZA 4RU9A 3CJ5A 2MZTA 3UFCX 3VAFA 2CQHA 5A6WA 2YX1A 1RK8A 3GV8B 5IT9Y 3HI9A 2M70A 3JSMA 2R7SA 2YKOA 2XSFA 3PX0A 3C46A 2W25A 4IOBA 3IWNC 2HS3A 2A10A 2VBXA 4PPZA 4R8UB 2HNYB 3K8VA 5LXYA 1DBDA 3FCHA 4RW8B 2E1MC 4DLEA 4C0HA 2B5JB 2GW8A 4TLQA 2RF2B 3UDCA 2HHXA 2OPSB 3AQOA 4TN2A 1S0NA 1DQAA 3M30B 1Q8BA 3IWXA 3TW0A 3F73A 1N5QA 1C1CA 3PR5B 4Q8FA 3MM7A 4WFXA 4ZCMA 1GXTA 1PILA 3HP6A 2ZH1A 4ID5A 4RW7A 1ZM4A 2JRSA 1WEYA 1YVFA 3CVKA 2VOPA 3MI7X 2BQ3A 1HQUA 3P96A 2XLJA 5E2QA 3H5XA 4TYAA 1DTTB 2BA9A 3J80Y 1LFWA 1RT1A 3FVYA 3BEGB 1XK8A 4MYTA 1SUQA 4GMKA 1X9WA 2CQ0A 4M1KA 2IVFB 3Q8RB 1N4LA 3GE9A 4J9NA 4A8FA 3RU0A 4DL5A 1TKTA 4EGLA 1DLOB 2LQJA 2GX8A 2YWGA 2D9PA 4ZOSA 2XO7A 1S79A 2NLWA 1BGXT 5KG6A 4B9TA 2ALZA 3OJUA 2YH0A 3PKYA 1X5SA 4USHA 4HI1A 3NMAA 4KKOA 5JJBA 3CJ2A 1SH3A 2LDYA 4B9UA 4Y0FA 1FNOA 1YBAA 3X3UA 1X0PA 5IM0A 2DNOA 4TNOA 1X9MA 4NOHA 1H6KX 4IRCA 4OZJA 4RU2A 1PC4A 3OLBA 3J7YU 4IR9A 2E9RX 5A0YB 2ZOGA 1KRPA 3CCTA 5I3UA 3M6UA 1PO6A 3MFIA 1YJWS 4B9MA 1WI8A 1WHYA 2LQ9A 4F4WA 2CJBA 4LIWA 2NXUA 2IYIA 3ITHA 5E3QA 2E5LF 5IS2A 1D9FA 3US5A 3UD4P 4O4GB 1Y00A 1SKRA 2MKKA 5EWFA 1WNEA 1I1GA 5DG8A 4KPYA 2AJFE 3C6UA 1FT8A 5GADI 3K5NA 4BWJA 3KLHB 5I42B 3OTDA 4KTQA 3VAHA 1N33F 3M6XA 4OMFG 5D4LA 3MFHA 3H5YA 4J9KA 1BLUA 3CD7A 4O4RA 3DHXA 4I2QB 4RW6B 3TA0A 4O0IA 1MU2B 3MECA 5F8HA 5GAHI 4LF7F 3NWGA 1ROFA 1K8AT 5CXTA 1U6BA 3DN9A 2IC3B 2DNMA 3PEJA 4ED7A 2JOQA 1W25A 2CPEA 4HT5A 5GVQA 3N6NA 4X4UA 3VAIA 2MHNA 5C5JA 5J2PA 4F25A