1T05B

Hiv-1 reverse transcriptase crosslinked to template-primer with tenofovir-diphosphate bound as the incoming nucleotide substrate
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
427
structure length
414
Chain Sequence
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords oligonucleotide template
publication title Structures of HIV-1 RT-DNA complexes before and after incorporation of the anti-AIDS drug tenofovir
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 89
structure length 414
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1t05B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t05B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t05B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t05B03
4B3OB 3JSMA 3C6TA 1S6QB 3CJ4A 4RZRA 4RNOA 2BANA 2RKIA 4RW9B 5DGBA 4RW6A 2WOMB 2W7OA 2B5JA 1HQEA 3MR2A 3KHHA 4KO0B 2OPSB 3IRXA 2R2SA 4YR2A 5L1IA 4LSLA 2C2RA 5CYQB 2RDIA 5KFUA 4URGA 5F9LA 5DQHA 3GIMA 3ICLA 3IGVA 3PW7A 4DL6A 1HYSB 3KLIA 4NLRA 5L1LA 1DLOB 1C0TA 4KB7A 3SFGA 5KFZA 4O4GA 2AGPA 5KFGA 4X2BA 1TKXA 3C6UA 1JLGA 3BGRB 1HNIB 1SUQA 1FK9B 5I3UB 4IFVB 1T03B 1RT4B 5J2NB 3KK3A 2FVRA 4WXOA 4ED1A 1XR5A 2UVRA 3CDUA 2HNDB 1TVRB 1S9GB 2XGQA 5I42A 4URSA 5KFFA 1TL1B 4MK8A 4MKBA 2YNHB 1SH0A 2BQUA 1S9FA 3KHGA 1HMVB 2ZKUA 3BREA 3QYYA 4KKOB 1FKPA 3D28A 3LAMA 1HQUA 1S97A 1JLCB 5CYMB 4ZVGA 1D0EA 3ITHA 5C25B 1N48A 3QIPA 5HBMB 1BQNB 4I2QB 5F8LA 4R5PA 2XI2A 3KK1B 1JLBA 1EETA 3T5JA 1R0AA 3BSCA 2WB4A 1S0NA 2WTFA 4Y2CA 2D41A 4NLTA 4G3IA 1C0UB 3V6DB 3FRZA 5EDWA 2W9AA 4KV8A 3T5LA 1T94A 4RW9A 3DLGB 3UR0A 4ECTA 2B6AA 2OPPB 1LW0B 1WNEA 4KO0A 1TL3B 4H4OB 2BRLA 4O3OA 3OLBA 3MR6A 1C1BB 4MKAA 4XPCA 5HLFB 5CYQA 3DRPA 4OL8A 4DL5A 2BR0A 5K14A 3DOLB 3CJ2A 5L1JA 3NKYA 1KHVA 4K4WA 2D7SA 2BQ3A 2J6SA 4NLUA 4FS2A 4F4ZA 4K4SA 3DRRB 3RB6A 1IKWA 3NGDA 1S1UB 1HNIA 1FK9A 5I3UA 1T03A 5HROA 1RT4A 5J2NA 2HAIA 3OL9A 3NMAA 3QLHA 4TY9A 4RUCA 4Q45A 1TVRA 2YKNA 1S9GA 4ECWA 5F8MA 5T14A 4J9NA 4IR1A 1IKYB 4WZMA 4RU9A 1TL1A 3C6TB 3JSMB 2YNHA 1OS5A 4NLPA 4F50A 3PJXA 2RDJA 1FKOA 1HMVA 1RT6B 2BANB 1JIHA 2RKIB 3H2LA 4KKOA 5DG9A 4RW6B 4FS1A 2FLNA 2XI3A 2B5JB 4KSEB 3HVWA 5KT2A 4DL4A 1HQEB 4K50A 5F8NA 1JLCA 1KLMB 4RUAA 3GQCA 3IRXB 4RW8B 2UUWA 4LSLB 1BQNA 2GIQA 2FJWA 3UPFA 1RTHA 2FLPA 2R8JA 4G1QB 4KBIA 3KK1A 4ECVA 4IKAA 4ECXA 3I0RB 4YP3A 1C0TB 2FLLA 1C0UA 3V6DA 2C22A 1S1TB 4ZMMA 2IM0A 2R8IA 1JLGB 1S9EB 1ZTTA 4KHMA 5KFPA 2W9BB 2OPPA 1LW0A 4MFBB 1TKTA 2VA3A 4NRTA 2RF2B 5KFRA 2BQRA 4ECYA 2FVSA 1C1BA 3UQSA 5C5JA 5HLFA 5I42B 3GIIA 5EWGA 3GV7B 4LQ3A 2VG6A 4J9RA 5F8HA 4ECUA 3DOLA 2VG7A 2WK4A 4NLSA 3MR3A 3QO9B 1Z4UA 1FKPB 4XO0A 3KLGB 1TV6A 3DRRA 3FSIA 3ITHB 4O44A 3IG1A 3V6HA 3OL7A 3QIPB 3EZUA 3MECB 2W7PA 3CJ5A 3DM2A 1T3NA 4K4ZA 1IM4A 4EBDA 5J2QA 1LWCA 5J2MB 3OHAA 3GYNA 4YQWA 3CIZA 1IKYA 4IH5A 4EO8A 4U7CA 1N4LA 3VQSA 4I7FB 1RT6A 4KV8B 2JEIA 4Y3CA 4ED6A 2B6AB 1RT5A 3GIJA 2UUTA 4NLQA 1KLMA 2ASLA 4K4XA 4RW8A 4ID5B 2V0NA 1K1SA 1HARA 3CWJA 4RNNA 2CJQA 4ED7A 2ATLA 3OL6A 3DRPB 3M9MB 4G1QA 5K14B 3PJWA 2WCXA 4IRDA 1S0OA 5KT5A 3I0RA 3PZPA 3QZ8A 4TXSA 2UVUA 3PW4A 5HP1B 3LP0B 2BRKA 4J9SA 3OSNA 1S1TA 3D5MA 1IKWB 1S9EA 4EYHB 2FVCA 5EWFA 3M9NB 4F4XA 4NLXA 2W9BA 4MFBA 5HROB 3FQKA 4WFXA 4NZ0A 4ZP9A 1VRUB 3QLHB 5KFDA 2RF2A 2YKNB 2EC0A 3T5KA 3TQ1A 1IKVB 1S48A 5KFTA 1JXLA 1IKXA 4IH6A 4IFYB 4TYAA 1FKOB 1YVFA 2ILZA 3PVXA 3QO9A 3H40A 4R0EA 3MR5A 4ED2A 3RAXA 3G6XA 4GC6A 4Y2AA 2JEGA 3Q8PB 4F4WA 3KLGA 2XCPA 2OPRA 5KFVA 4PWDB 3M8QB 3N6NA 3LAKA 4O3NA 5D3GB 5DLGA 3MECA 4O3RA 4ZPCA 1RTHB 1KHWA 5J2MA 5KFLA 4QWAA 3DOKB 1RTDB 3NAIA 1CSJA 1GX6A 1TP7A 4NLVA 4IDKB 1U09A 3CJ0A 1D1UA 4I7FA 3DMJB 5DGAA 3CDEA 3HKWA 4KAIA 5KFKA 2XWYA 4O3SA 4J9LA 3V4IA 4K4UA 2V4RA 1TKTB 2QE5A 3LP1B 2JEJA 5KG6A 4ID5A 1JX4A 3KMSA 1HPZB 4JV0A 3H5YA 2IMWP 5J2PB 2GIRA 2VG6B 1QAIA 1C2PA 3LANA 2ZE2B 2ILYA 3G6VA 2UVWA 2VG7B 5KT6A 1XR7A 1NHUA 5HP1A 4WXWA 2UVVA 3GILA 3QGGA 3LP0A 4TQRA 4QW9A 1TV6B 5KG2A 1RAJA 3MFIA 4TYBA 3NAHA 4O44B 3IG1B 5FDLA 5KFNA 3OSPA 3NBPB 2YNFA 4RW7B 2R8KA 1VRUA 4MH8A 3DM2B 3BSAA 3GV8B 2R8GA 5J2QB 2R2UA 2JEFA 1LWCB 1IKVA 4ZHRB 2YKMA 5KG4A 3FFIA 5KFSA 3NL0A 2D3UA 5DQIA 4URQU 4Q44A 4ED3A 2AGOA 4IFYA 4ZPAA 4RNFA 4K4VA 4QWCA 3RB4A 1LWEB 4DL2A 3DLEB 1RT5B 1S4FA 3QGIA 4PWDA 3M8QA 3HVTA 3RAQA 3H5XA 4M94A 1K1QA 1JLEB 3E51A 5L9XA 5D3GA 1RTIB 3JYTB 2CKWA 1SH2A 1JKHA 5C24B 2HMIB 3UDLA 5KG5A 1QE1B 1BQMA 4ECZA 3DOKA 2ZD1B 1RTDA 2YNGA 4ZVFA 4O3PA 1RA6A 4ZP8A 4IDKA 1ZETA 4J9PA 3DMJA 3DRSB 1I6JA 4QW8A 1RA7A 1LWFB 3LP1A 4M95A 4MK7A 2OH2A 2WONA 3KJVB 3KK2B 4Q8FA 2FJVA 1QAJA 3KHRA 4FBUA 1HPZA 1T05A 3Q8RB 3H5SA 5J2PA 1J5OB 4Q8EA 3Q8QB 1IKXB 2GC8A 2ASJA 1S1VB 3IGNA 2ZE2A 3HVAA 4Q0BB 4O4RA 5KFXA 2R2RA 2C28A 3IS9B 3OHBA 3V6KA 1RYSA 3MEGA 2IJNA 2VG5B 2OPRB 4ZVHA 1QUVA 4KFBB 4H4MB 2W8LA 5F8JA 3CDWA 3NBPA 4RW7A 2QV6A 3PR5B 4NLWA 4QPXA 3FQLA 1SV5A 2JLEA 3MF5A 4J9OA 1C1CA 3ISNC 4IRCA 4ZHRA 1JLAB 2HWIA 3N6MA 1N5YA 4O3QA 4GC7A 5EWEA 3LP2A 4ECSA 1NNDA 3T1AA 4NYZA 1TKZB 3I0SB 1LWEA 3MTKA 3V4IB 1NHVA 4ECRA 3DLEA 5KG0A 4JV2A 4RNMA 1S1WB 1RT1B 4K4TA 3H59A 5KFCA 4ED8A 1JLEA 1S1XB 1RTIA 3JYTA 1RT2A 4TN2A 2HMIA 5C24A 5DQGA 1EP4A 1RT7B 3KHLA 1QE1A 4LQ9A 3I5AA 2W8KA 4HYKA 4J9KA 1LW2A 2ZD1A 2IC3A 3DYAA 2AU0A 4KHRA 4EBEA 2IM1A 4ZP6A 4WE1B 5JXSA 1JLFB 4IG0A 4IRKA 2B43A 4JV1A 3H98A 4IG3B 4KE5A 1DTQB 4MIAA 1MU2B 3DRSA 1ZTWA 1S10A 2E9RX 5DG8A 3IN5A 5FDLB 1LWFA 2VA2A 3PHEA 1VRTB 2YNFB 3CO9A 3KJVA 3KK2A 4IR9A 2HNZB 3BQ2A 4WFYA 4NCGB 2YKMB 3FFIB 2XCAA 5J1EB 1J5OA 4Y34A 3DLKA 3ISND 3PR4A 4ZPDA 1S1VA 2DPIA 4Q0BA 5KG1A 3CJ3A 3MEDB 3H5UA 2I5JA 3H4BA 2W9CB 3DI6A 4IOBA 3IS9A 5KFHA 3G6YA 2AWZA 4YMEA 2HNYB 3M8PB 4K4YA 2DPJA 2VG5A 2I1RA 3M9OB 3DDKA 4KFBA 3HVTB 4H4MA 3BR9A 4WZQA 2O5DA 1S6PA 3E01B 2IA6A 1JKHB 3V81A 3RBDA 1BQMB 1RDRA 3KLEB 2J6TA 2F8EX 2YNIA 1JLAA 1N6QA 4IH7A 1DTTB 4LSNA 2YNGB 4I2PB 2JC1A 3KLHB 3PW2A 3KMQA 2D3ZA 1TKZA 3I0SA 4MK9A 3BJYA 1REVB 4ICLB 4R8UB 4EBCA 3KLFA 5KFJA 1S1WA 1RT1A 2IAJB 3PW0A 3PW5A 2WONB 3MFHA 5JUMA 1TQLA 5KG3A 4Q43A 1S1XA 2FVPA 1MMLA 3N6LA 3T5HA 1T05B 4RNHA 4QWEA 2XC9A 3RBEA 1RT7A 4DG1A 2IBKA 2XGPA 4F4YA 4ZP7A 2WHOA 2FVQA 2BE2A 2WRMA 4WE1A 3GIKA 1JLFA 4DEZA 2R8HA 1UWBA 2J6UA 4IG3A 3MEGB 1DTQA 2FJXA 1GX5A 1MU2A 4B3OA 4WYLA 5KFEA 1S6QA 4EEYA 1RT3B 3QIDA 2OPQB 4EYIB 4PUOB 5KT3A 3TAMB 3BQ0A 3V6JA 1VRTA 3EPIA 4RW4B 2HNZA 2WOMA 1SV5B 4TY8B 4J9MA 4NLGA 1C1CB 3KNAA 4NCGA 3T19A 5KFWA 3BSNA 2OPSA 3BQ1A 5J1EA 3GV5B 1N5YB 1S49A 3LP2B 5KFAA 5KFQA 2W9CA 3MEDA 3TVKA 3KLVA 1HYSA 1HNVB 2HNYA 3M8PA 4WFZA 5KG7A 3BSOA 3QZ7A 5F8GA 1DLOA 4XPEA 2HWHA 3E01A 5DLFA 2ASDA 3I5BA 3OL8A 1RT2B 5C42B 4U6PA 3BGRA 1EP4B 3MEEB 4JUZA 4TQSA 1RTJB 4IFVA 3KLEA 2AX1A 4DL3A 1LW2B 3DYAB 2IC3B 4YR3A 2HNDA 3I5CA 4ZPBA 1DTTA 4PQUB 4I2PA 4EO6A 1JLQB 3KLHA 4IG0B 2IM2A 4WYWA 1W25A 3H4DA 3CVKA 1REVA 5KFOA 4ICLA 4R8UA 2AGQA 4NLYA 4TLRA 2IM3A 2IAJA 3QGHA 3Q8SB 2R2TA 5KFBA 4IQXA 4NLOA 5CYMA 5KFYA 1N56A 5C25A 3DLKB 4QWDA 5HBMA 3RB0A 4I2QA 4MIBA 2E9ZA 2IJFA 3SI8A 2I5JB 3DI6B 2AQ4A 3HHKA 3KLIB 4ZVEA 3EPGA 2AX0A 4ED0A 2V9WA 1RT3A 3OLAA 2OPQA 4PUOA 4O4GB 3TAMA 1S6PB 2E9TA 2JC0A 1TKXB 3C6UB 5EUHA 4RW4A 3V81B 3DLGA 1SUQB 4TY8A 2ALZA 4FBTA 3KK3B 1S0MA 1TL3A 2YNIB 4H4OA 1N6QB 5KT4A 4LSNB 3LALA 1SH3A 4QWBA 5DG7A 1XR6A 5F9NA 5F8IA 4H54A 1RYRA 1HNVA 2C2DA 2C2EA 3KLFB 5L1KA 4DL7A 4NLDA 4J9QA 4YR0A 1HQUB 5KT7A 5C42A 1S1UA 3MEEA 4DG1B 3RB3A 1RTJA 3KOAA 4NRUA 5KFIA 3G86A 3SFUA 4R5PB 4PQUA 3FDSA 2V4QA 2BE2B 1JLQA 4HKQA 1JLBB 5KFMA 1EETB 4ECQA 1UWBB 1R0AB
chains in the Genus database with same CATH superfamily
2E5GA 1T3OA 3CJ4A 1U8SA 2ROEA 1YITS 1HQEA 2Z56B 1SJRA 2DEJA 2HQFA 1OQ3A 2HLUA 4W98A 1JMTA 4JI4J 1HNIB 4WXOA 2JZ5A 1VLOA 3U7JA 5CCLA 2BQUA 3V4MA 5A2QU 3MAAB 2VONA 4QR0A 3SZ2A 1XNRJ 3O6QA 4ZJQA 2WB4A 4G3IA 2B7BB 1U6FA 1F60B 4QIGA 3QJLA 3MR6A 3CULA 3J7AN 3AJ1A 3TZYA 5B08A 4DUZJ 4F3OA 4K4SA 3NGDA 4ELVA 5I3UA 2YPZA 3HZGA 3HX9A 1D09B 3C6TB 4XDCA 3MGJA 4HL9A 4RW6B 3ZNJ1 4DL4A 2M2BA 2CJXB 2I6WA 1XQIA 1RWWB 4HACA 3LTOA 2NCKL 1N36F 1APSA 2EI5A 3AFGA 1LW0A 4PYAA 4NCAA 1LXJA 3MM5B 5HLFA 1MWYA 1UVJA 3HHLC 4O44A 2YWWA 2KFZA 3DM2A 1NJXA 1IM4A 3GYNA 1RT6A 2MKIA 3PYEA 1Y5IB 1XMOF 1TUVA 1R8BA 2ATLA 3ILOA 2B8PA 3TEHB 1OPIA 4MKVA 1AUSL 4W4MA 5KOWA 1UPPA 3GZ7A 3FQKA 1MWZA 3QLHB 4QZVB 2EKYA 3AXMA 1IKXA 1LK5A 3IR7B 4X64J 4PKDB 1DBDA 1MN9A 5KFVA 1ZM3A 2FHMA 1SIZA 4C3KA 3NS7B 1NK5A 4YOEA 2CQGA 2V34A 4J9LA 4ZJOA 2XO7A 3QMQA 4JV0A 2CPYA 2OSRA 3VAKA 3QWPA 3AOAA 3NAHA 2P8IA 2QLJB 1MW7A 2YKMA 5DZ7A 2D3UA 2DGSA 4ED3A 3IBFB 2UV8G 3DLEB 3HM9A 1JLEB 1S57A 3FUYA 4KJIA 1U24A 3DRSB 2YKQA 4ZCLA 2F63A 2C42A 4MK7A 4J90A 2RE1A 3SQOP 3Q8QB 4MJKA 1OY8A 2V2QA 4JI8F 1V3RA 1XN9A 3AB4B 4KFBB 1SL0A 1M1GA 3M6UA 4J9OA 4IO9Q 2WSEC 2MKCA 4NL5A 1AXQA 1FERA 3W64A 3TANA 4RNMA 3ETOA 3H59A 2FIUA 2EK1A 2NYIA 2MXYA 2J0WA 4UZBA 3CCZA 4J9KA 2ZD1A 3DYAA 4WP9A 3POTA 2AU0A 2LEPA 1MLAA 3MPWA 2W4DA 5FDLB 3R5GA 3KK2A 1CBKA 3QRQA 3BQ2A 3MXHP 1Q5VA 4Y34A 1VBXA 5E3PA 2QL5B 1LKZA 4NI2B 3EMTA 2MQ8A 2J6TA 2BE7D 3N9UC 4LSNA 3KLHB 2Y0BB 2QLWA 3ZTRA 4XTTA 1CJTA 2ZUAA 1WEXA 4Q43A 2DNPA 1RADB 2EG1A 1HNZF 2ZDOA 1M5SA 3GIKA 4DXLA 2FJXA 4B3OA 5LMUF 1QUPA 4NCGA 2CNLB 2C3MA 1ZPWX 2A2CA 3LP2B 3UCUP 2CJ9A 3G6ES 1HI0P 4Q5VA 3I5BA 2HS3A 2Z2ZA 3MCMA 3SDEA 4YR3A 1H6KX 4OX9J 1FJ7A 4ICLA 4ZPVR 1SJ1A 2IM3A 1TL7B 4AXIA 3G82A 5AXKA 2F40A 1WC5A 3AQPA 4DQRA 2M3DA 4O4GB 3TAMA 2BACA 3J81Y 1YJVA 4TY8A 4FBTA 1IBMJ 1T9YA 5HSPA 3PX4A 3I4HX 3GWCA 4U8YA 4NZ7A 4YB6A 2VQFF 3PEHA 3RB3A 2MQNA 2P9EA 2RNEA 1VLYA 2CQ3A 4I6YA 3CC7S 1LFWA 4E0DA 3KHHA 1RQ0A 3P8BB 5F9LA 5GAEU 3IGVA 4KPCA 1AW0A 2E5IA 3J7YI 4CQ1A 2L9DA 3GG0A 4N41A 3KK3A 2QYGA 4EZ9A 2HNDB 3R3TA 4QQBA 3EGVA 2KG1A 3L7PA 3QT6A 3M2RA 3QYYA 4CO4A 3P5BP 2L08A 4BWMA 2CFXA 1WC0A 3BSCA 2WTFA 1NEEA 5D4OA 4DUYF 1WNEA 3Q23A 4JOUA 3TWZA 4JI1J 3TUPA 2RILA 3DRRB 4KYZA 2LLZA 2LKZA 2W4CA 3NGSA 1DQ8A 1XBWA 5HQ8A 1M1KT 3EDRB 1FWPA 4LBHA 3UPFA 2R8JA 3I0RB 3CCTA 3BH7B 3VZHA 4OJ1A 4OJ3A 4C11A 4Y65A 4ECYA 1RXOB 5C5JA 2C3OA 1F9EB 3RW7A 4AXJA 1QSSA 2FYXA 4XO0A 3RBXA 5K8MA 2QL7B 3MD1A 3KDOA 4EBDA 3VF0B 2RHSB 3MM7A 4DQQA 1H73A 3GIJA 3EVOA 2ZH6A 3OPKA 3CCMS 1CULA 5FLXU 3TJ9A 3Q86A 3D4JA 5IZHA 1NHKL 3MTJA 5KT5A 1L3TA 3KG0A 5HP1B 4M1KA 4FYYB 3DLJA 3D5MA 3UD5A 3M9NB 1F9FA 4F3MA 2ERRA 2QMUB 4OHYA 4LFBF 3T5KA 4HHHA 4ZCKA 1AROP 2QC3A 3QO9A 4C8ZA 4PCQA 2DCLA 1DQAA 3KLGA 3ZTPA 4OI6A 5ETMA 1CSJA 4NLVA 4ELTA 4I7FA 4C97A 3V4IA 4X4VA 4FPRA 3K2YA 3D1QA 5LT5A 4YB5A 2J7WA 4AFFA 3PCOB 2HFUA 2YNFA 3KXDA 3HDSA 4DV0F 4CWBA 1FCAA 3UFCX 2B7CB 2HHXA 3ET6A 5LMNJ 5D3GA 4BWJA 2ZVIA 3OXLA 3CJRA 2Z2MA 5ETPA 1UVKA 3C15B 5A8RB 3FKBA 2OH2A 1PYTA 2KXHA 1S1VB 1TAQA 2ZE2A 3HVAA 1E6VB 2R2RA 3WBZA 3WX8A 5IT4A 4OX8A 2G2ZA 3D9BA 1UJ5A 2HEKA 1KTVA 4LF6J 4IRCA 1OSDA 3N6MA 4NYZA 2QEXS 3CCQS 2WVBA 5DQGA 1EP4A 2ZNZA 2ZH9A 3D0HE 4GRSA 3ULHA 1G3OA 1I51B 2E9RX 1YBAA 4AUKA 1FFGB 4WFYA 3AQOA 5ETSA 2GVZA 2DPIA 4L76A 4Q0BA 3CJ3A 2CPFA 4P2XA 1FRXA 3VWSA 4IH7A 2DIUA 4ILRA 2O3DA 1TU0B 1L3UA 2OHDA 5KFJA 3PY8A 1RT1A 2IAJB 2FVPA 5LSLA 4ZP7A 2QGFB 2WRMA 3PRDA 4WYLA 2OPQB 5KT3A 3BQ0A 1SKUB 4LRDA 1J5EJ 3BSNA 4WF9Q 3VGTA 2OEKA 1R0BG 1DHMA 2D69A 2R9LA 2GJ2A 2HGMA 4DS5A 2YKOA 3WHIA 1VOMA 2BJ8A 2IC3B 2GQ2A 1VQLS 1REVA 3DLHA 1HWUA 5DS7A 1IBLJ 2PGCA 2FY1A 3MPVA 2YX4A 4OX6A 2CPDA 1ZPVA 1HNVA 3HSDA 2FDNA 1R6YA 5L39A 4YR0A 5KT7A 2GO9A 2BJ3A 2COLA 3HHLA 2R7OA 3D1OA 2V4QA 2MGZB 1JLBB 3I96A 2CQ0A 3C6TA 2DCUB 4RW6A 3LWLA 3D68A 3UNGC 2XMVA 3EE3A 2ZDPA 3CJ8A 4ZVSB 5L1LA 2DRAA 1T9VA 3HHLD 1RWPB 4BS2A 1TKXA 1N0UA 4ED1A 1VBZA 1RT4B 3CDUA 2AZ1A 1VC5A 1S9FA 2OP5A 2Q43A 4OQJA 5CYMB 4JI3J 4GMKA 4ES1A 4DFPA 3TJ8A 1XJWB 3MAHA 3SEOA 1R0AA 4LVNP 1LEOA 4LIRA 5H9FJ 1AB8A 2VD3A 3SBMA 3R5AA 3GB0A 2V68A 4R25A 3CJ2A 4K4WA 3M2UB 3IWLA 4E2FB 1P8GA 3DDNA 3QLHA 4P73A 5E3QA 3OJUA 3ENQA 1WOOA 2WZ1A 1TL1A 3DOMA 3NLCA 5CZVA 4KKOA 2W2PP 4CT9A 3A8IA 3GG1A 1U8WA 1KS2A 1ZM4A 3K5PA 4ANCA 2DY9A 5IWAF 2J76E 3CXCR 1EB0A 4HVZA 2BMBA 4MFBB 3VTIA 2YX7A 2WW8A 1ZA1B 2C2ZB 4CO1A 4O0NA 1HD0A 3BM7A 1HW8A 1GMVA 4ZLNA 4K5SA 3QIPB 1A6LA 2EW9A 3P45B 2DITA 2EFQA 4OI0A 3G9CA 3K5NA 4UOCA 2IRUA 1A7GE 2KHCA 4FYWB 2G9OA 2QA2A 3MM9A 1K1SA 2E1AA 3PJWA 2Z2YB 5DDQC 2P2CB 4JI5F 4ZP9A 3DC2A 4C8MA 3U1NA 1VJQA 3O3LA 5KFTA 2FZGB 1QVFR 1FKOB 1YVFA 4GC6A 4F4WA 2XCPA 3GSDA 1XIQA 3HSJA 3D54A 3M2VB 3HZEA 1GX6A 2LQ9A 5KFKA 1Y9OA 4CLKA 2K8GA 4YFUA 4LF5F 5ETRA 1A0OB 1CS4B 1KSPA 1YI2S 3OUYB 4X4UA 2HG4A 3DU6A 3O2IA 4C2MA 5FDLA 3MMAB 4ZIWA 2HK3A 2QSWA 1FESA 5D0GA 2PA3A 4J7CA 2XS2A 2RRAA 3VV2B 3QBCA 4K4VA 1K1QA 5CD4H 1RTIB 3JYTB 1OPZA 4NI2A 1AUDA 4ZP8A 4LF1A 3HHEA 1Y7PA 5AJ3J 1K9MT 2RS8A 3FMWA 5CHCB 3LP1A 2V67A 1TMMA 3M8YA 5RUBA 2CDQA 4EI2A 2J9CA 3BDEA 5B0DA 4ZVHA 1GH8A 1BMQB 3H2UB 1Y0HA 1HA1A 2BDPA 2KJVA 3SSRA 4GC7A 3LP2A 3TX8A 3T1AA 2ZNYA 2XMTA 1NHVA 4ECRA 1UVIA 2HFNA 4ED8A 3K58A 4WP8A 4RPFA 4IG3B 1LNQA 1IR1A 1PBUA 1S10A 5DG8A 4UUXA 4CH7A 3HJFA 2DGUA 2CADA 3PR4A 2BKPA 5KG1A 2G0CA 5IM0B 1FXLA 3E01B 2H5EA 2YNGB 3PW2A 4M8LA 2M9KA 3JS9A 1TKZA 3ZC4A 4ZITA 2VFSA 4PG4A 5KG3A 4C98A 1BWVA 4DHVA 3A13A 1EKRA 5HVHA 3QIDA 3LGHA 4LMZA 1FTCA 2XMMA 3KJNB 4C7QA 5KFQA 3W61A 2MZSA 3BN7A 2CJBA 2V6AA 2HWHA 4LF4J 2JRSA 2HNDA 4CNYA 4IG0B 2NUUG 2NZCA 2HZAA 2MHEA 1GEHA 2DNYA 2UU9F 3ONQA 2E44A 4NLOA 4QIVA 3PFOA 1TAUA 1RKIA 3DLKB 1VYAA 4PG6A 1L3KA 3ILIA 3DI6B 4DSLA 2DK2A 3EPGA 1RT3A 3OLAA 3OTCA 2YNIB 3SCJE 1VBYA 2DISA 3R5CA 1RAHB 4RUBA 1N5VA 2LU1A 2HQGA 3TX0A 2BM0A 4BHQA 2MZ1A 4HKQA 2UUBF 2YKPA 4MIWA 2HHSA 4RZRA 2PMHA 1DQ9A 3WC0A 5KFUA 1WHVA 2F9DA 1NPRA 3FBBA 5KFGA 2HRUA 4F02A 2ACYA 4M5NA 1U1KA 4QYZK 1VQPS 4ZJLA 2ZFHA 3VVTA 2KYZA 1S0NA 4I67A 4QU6A 1GNKA 1N5QA 3T5LA 2ZEJA 3LF0A 2AD9A 4KO0A 4OYWA 2BR0A 1H2VZ 1NZAA 2CVEA 2JFKA 1S1UB 3OL9A 1YRTA 4CO3A 4C0BA 2HWTA 1S9GA 3J7ZT 1Q8BA 3EYZA 2B5JB 4LSLB 2VFVA 3J81U 2FJWA 4IKAA 1HHTP 2HURA 2XZTB 4RKUC 4FNIA 3UQSA 5I42B 1PCAA 4UTGA 4UQTA 4ECUA 8AT1B 3UDEA 2ZBCA 1YZ7A 4GKKF 2LXUA 2K7JA 1TR0A 4YQWA 4K59A 1SJ4P 2XULA 5AE1A 2GHPA 1NK9A 3GMGA 2BJ9A 4NLQA 4PPZA 1KLMA 2JFDA 2XTJP 4MYUA 4OJGA 3FCWA 2KT2A 1EJ7L 3K8VA 1KLNA 3OSNA 3BO4A 4I1TA 3D1HA 5A8RA 5KTQA 4LF9F 3MCOA 1TL5A 1WF1A 4DV7F 1JXLA 4M5HA 1H2UX 3BV8A 2YQ0A 1E6VA 1SXLA 2HGNA 5LXRA 4KH1B 3G6XA 3Q8PB 4JI7F 1UPMB 3MECA 3OV7A 3QPIA 1VQ8S 2DNOA 1D1UA 2CQIA 3NXZA 2QTWA 1UZDA 3S1TA 2WBRA 2HZVA 1HPZB 1GAOA 2GIRA 1HKAA 2CNKB 3PHTA 4X62F 3G6VA 1Y5LB 4HDHA 2OD6A 4AYBD 1ZH5A 1O6XA 3IMQJ 2B9WA 1D9AA 3OTBA 2R8KA 2HBYB 4I6WA 1IKVA 4NXNJ 4QWCA 3FEXB 3H5XA 3Q83A 2HMIB 1WORA 4DR2J 1I6JA 3B78A 3M32A 2PO4A 4HLBA 3P3DA 4WIIA 1OIAA 2KH9A 4FF3A 2GC8A 4O4RA 1RYSA 3DDIA 4BCAA 2VG5B 4TVAB 1UETA 1HBMA 3IA0A 4DX7A 3PR5B 1U0HB 2APOA 4AT1B 4ZN3A 3GONA 1UZHA 5EWEA 5A8KB 3L09A 2F4VF 1PIEA 4PEOA 1FNXH 1U47A 2MDAA 1FD8A 4K4TA 2DRBA 1RAOA 1S1XB 1ZA2B 4NASA 5HAOA 4LQ9A 3S01A 2IC3A 1G4CA 1JJHA 1LOUA 2BKNA 3FFIB 4DR7J 2VPWB 4F0MA 3DNCA 2AWZA 2MZQA 5E5NA 2QA4G 2HHHJ 3OVSA 2XG8A 1I1GA 2PT0A 5THWA 3CEDA 3GR0A 2ZJPQ 1RJJA 3FNNA 4RNHA 4DR4F 4C3MA 4QWEA 2Z30B 2DXEA 1VJWA 4DEZA 4OZLA 2GHWA 2Q1LA 1RWXB 1OO0B 5HJYA 2G0JA 2FUG9 3S6EA 3M8PA 2GW8A 5E41A 2XLJA 4G6VB 4P52A 1MROA 4GVLA 3KLEA 4I2PA 3CVKA 1YBUA 4OYMA 4L74A 1XNRF 3CO0P 2M0GB 5CYMA 1MMNA 5KFYA 2IJFA 4QPTA 3X3UA 2YXLA 1RTZA 4PUOA 2BEFA 5AE3A 4RW4A 2ALZA 4DUZF 2W2NP 4C4WA 3J80Y 2FJAB 3W9HA 5DG7A 4B3SF 1FJGJ 2P6SA 3HD1A 4EUVA 1PKUA 3M2UA 4CCHA 1YIJS 1TFYA 3DRYA 2V2ZA 1SL1A 2IYIA 1IBCB 1HBUB 2E1MC 4B9TA 3SSQA 2V2KA 5DQHA 1UEVA 1GK8A 2IFXA 4X2BA 1FK9B 1T03B 2H3EB 5LSRA 1XR5A 2KFNA 1U25A 4URSA 4S0MA 2DXDA 1WKJA 3BPSP 5GADU 3I32A 1N48A 2YPYA 3QIPA 1U1LA 4FF1A 3KK1B 1AYEA 2ZKTA 2EVZA 2CQ2A 1GTEA 1CLFA 4JB8B 2R7SA 3OTOJ 1W2IA 1RHJB 4LIWA 4JBCA 3P49B 1T9TA 1DY3A 4F4ZA 2ZITA 3JB9k 1N33F 4J9NA 2VASA 3JSMB 1R31A 2R3VA 1FKOA 5LJ3Y 1HMVA 2J0QD 2EC2A 3HVWA 3A3PB 4K5RA 3M6XA 2WVEA 2OLWA 2DNQA 3MUVP 2HQDA 4I0WA 3VGSA 2LXFA 1ZTTA 1KKHA 1C1BA 2GVDB 4RLEA 4JYAF 2GFFA 1RWUA 4DV5J 2RQ4A 3OUYA 3FSIA 3EZUA 5J2MB 4LRBA 1U1PA 2B9EA 4WK1A 3GFZA 1R0CB 3ILLA 2ASLA 2P9GA 1HARA 2DH8A 2XMKA 1ELOA 3QT5A 4KTQA 4C8YA 1UA1A 1S1TA 3BGLA 1S9EA 3VQTA 4F4XA 4NZ0A 5KFDA 4Z7YA 1JB0C 3PKYA 3D0IE 4F4KA 2M5YA 4LBIA 5G4DA 2B8QA 1WUUA 2MSSA 3CCWA 1B0PA 4O3RA 2ROGA 5HQLA 1FXDA 4CZCA 2O67A 5KG6A 4ID5A 2FGCA 1JX4A 1CEZA 3W5XA 1Q79A 2VG6B 1G7CB 3TAQA 2E29A 1C2PA 3LANA 1X5OA 5E0OA 4TQRA 3D6TB 1VFJA 5HQMA 4ZHRB 1V5IB 1X5PA 2GMLA 4ZPAA 4FN5A 4OZ3A 1O51A 3TA0A 5L9XA 5B7WA 2VH7A 3W1YC 2YNGA 4IDKA 4DQPA 4YS2A 4WJBA 3GYGA 4QCLA 3H5SA 4XAKA 5J2PA 1VQSA 5GVQA 4B9SA 3OR2A 3V6KA 4DI6A 3AJDA 4FXVA 2W8LA 4RW7A 3P96A 2XBPA 3MF5A 4G1IA 4O3QA 2CDRB 1FX2A 3MTKA 5CH7B 2CJYB 3MOZA 2D9OA 4QBUA 3HPOA 4YDDB 5HL7Q 3SCIE 2XS7A 5IC4B 2NPFA 4DR3J 4EBEA 2XM3A 4IG0A 4KGZB 1DTQB 2C3PA 3PEJA 1YJRA 4DV4F 2VA2A 3K89A 4M5GA 1J5OA 3DLKA 2HKEA 1DARA 3C2PA 3H4BA 1IBMF 4RWXA 3DI6A 1EZZB 3G6YA 3QWUA 4DN0A 3SIPB 1BQMB 2VBZA 2YNIA 2V9KA 3GFXA 1DTTB 4WTYA 2D3ZA 3KYLA 3CF5Q 2ZH8A 2Z57B 1OMSA 2HVIA 3MFHA 2W4PA 1BUXA 1T05B 1GXUA 5HATA 5A8WB 2DR5A 2WHOA 1VQKS 3HKZD 2N3OA 3GJSB 2CQHA 3S8SA 2DTJA 1C1CB 3DKDA 1HI8A 2D74B 5K9FA 1N5YB 2NXEA 2N4CA 2DJWA 4YY3J 4DV2J 5DDPC 3LH2S 3OL8A 2NQPA 3UR3C 1LW2B 3H4DA 5CD4A 1RUSA 1NDKA 2R2TA 4I64A 2NZ4A 5BYQA 4U7UK 1FWLA 2I38A 2JC0A 4JI1F 3I56S 1VIXA 1SC4B 1N6QB 3BH6B 1RP5A 5F9NA 2RQKA 4OLPA 4YEAA 1Z1ZA 2AEFA 1S1UA 2N7YA 3BS9A 4NRUA 2I2YA 4PQUA 1X4BA 2BE2B 2ZH7A 4E8UA 5GAGI 4RNOA 1F5BA 2GV1A 2B5JA 2YTCA 3MR2A 3DRXA 4LSLA 2RDIA 4N56A 2C3YA 3TRGA 5DDOC 4NLRA 5BXIA 4CLLA 3KUEA 1YK9A 2BJ7A 4Q2MA 4A48A 4O0IA 5I3UB 3UE2A 1FX4A 1RSCA 4ZLJA 5I42A 2PDAA 4MKBA 3KHGA 4X66F 3EXYA 1Q7YT 1LK7A 1FDBA 1FFWB 1HQUA 3QT7A 1RE1B 4ZVQB 2MQOA 2OJ3A 3UW1A 2CG8A 4Y2CA 5GAEI 1WI6A 1Q0NA 5D77A 1LW0B 5A0YB 2GX8A 1RBLA 5HLFB 3D6HB 5H1SV 5L1JA 3LOUA 1T02A 1Q1KA 4OV6A 5E2QA 3NMAA 1YSJA 3EGNA 5T14A 4NXMF 1YJNS 4C48A 2YNHA 2RDJA 4FYVB 1RT6B 3H2LA 4FS1A 4CNZA 1JLCA 1U6BA 3JQMA 1BE4A 1FNMA 2HGLA 1BQNA 5CA5A 4DLGA 2PSZA 4PR6A 2MY8A 4PWUA 1ZZFA 2HFVA 4KHMA 3W63A 2HVDA 3RW6A 3ZZ0A 4B3RJ 2XLIA 3GV7B 4J9RA 3U27A 4WFBQ 4YHHF 4DR6F 2XO6A 3LW5C 1O8BA 3THPA 4AQYF 2MY7A 2ZM6F 2WSCC 4CH1A 3CJTA 2KM8B 2AZ3A 3MMBB 4RNNA 2RQCA 4IRDA 1DURA 2AMCB 4A4JA 5EWFA 2VQEJ 1HQ2A 1S48A 3FMBA 1ACMB 4LF6F 3RAXA 2AIRB 2CPZA 5LM7E 2NPIA 1U0HA 1RTHB 3NAIA 4NEZA 2HBRB 3NY0A 5A8KA 1U09A 3O44A 4I4BA 2FB0A 1DRZA 1RI7A 4CIOA 2UUAJ 3PG9A 1NHUA 2UVVA 1CC8A 2DXFA 3A1YG 1UEKA 4TLQA 3I82A 3PX0A 5J2QB 3FFIA 4ES2A 1JJ2R 4RX6A 4DN9A 2PC6A 3T1HJ 4RNFA 5CQGA 4QIEA 2KO1A 4M94A 2XHWA 2XSJA 1URRA 2XQCA 3UDLA 1QY7A 1U1QA 2ZD1B 1RA6A 3RR7A 4OHXA 2KFYA 2A6OA 4DCOB 3KK2B 3I87A 4ED5A 1R3NA 4B17A 1Q81T 1P6TA 1J5EF 4CRJA 1QTMA 2DD8S 4X4PA 1EKSA 2XSFA 4LFAJ 3AY0A 4DF8A 1NB7A 3C66A 4F8RA 2E5HA 1FDNA 5L38A 2IBOA 1JJ4A 4IYQA 1HWIA 1LWEA 3MMJA 2HFZA 2HS4A 2AJ2A 5C24A 5M2PA 3W2VA 2BA9A 2H65B 3H98A 2GIFA 3IN5A 3SV3A 3VR1A 3M05A 4C0OC 1M5VC 4NCGB 1RAIB 3HP6A 1D8YA 2LEAA 1VQ7S 3EX7B 4A8WA 4B9UA 1VQ4S 1VC0A 5HVGA 2BM1A 5GMKa 4ER8A 3SDEB 1S59A 4QU7A 2JC1A 3I55S 3MWBA 4ICLB 3IBCB 2DY1A 2WONB 2KT3A 1N36J 3W9IA 2Y9HA 1RT7A 3G82B 2HW3A 2V63A 2J6SA 2J6UA 4C8OA 3A8EA 3TAMB 1AT1B 2PD1A 1HBUA 4NLGA 4TY8B 3T19A 5CXTA 3V5RA 4H4KC 3PJ9A 2CQ1A 3VGVA 3WX4A 2DNGA 2OO4A 1B0VA 3MUTP 4ZPBA 2CJAA 5ETVA 3CMAS 2AGQA 2D3O1 1F6TA 4DSFA 3TA1A 3IM9A 4MIBA 2E7XA 3CB4A 3GYXB 1ITPA 2YQ3A 3RRHA 1S6PB 4ZOSA 2AYBA 3KK3B 1RBAA 5KT4A 2BJ1A 3K0JA 3THTA 3HULA 3L7UA 3M2RB 1RAGB 2M7SA 4DSIA 2YKAA 4WFAQ 1AZSA 3FDSA 2MZRA 3JSMA 3CIMA 1SQEA 2HVZA 4B9MA 1M5HA 2DR6A 3RRKA 2PEBA 1FRMA 5L1IA 1Q82T 2ZOGA 3B54A 2KJWA 2MTLA 3KLIA 5KFZA 4A46A 3BGRB 4MYTA 2VUGA 2ZKUA 5B0GA 4DFJA 2FTRA 2CZ4A 4WKYA 1S7HA 2IMOA 4I2QB 1N32J 3X1LB 3ENAA 3FRZA 2X1FA 2M52A 2V2VA 4JI8J 4DFKA 2YWKA 3NS5A 3F0NA 4O3OA 4LF8F 4Z2XA 4LBPA 3C16B 3ZZUA 4N5SA 5A6WA 4DL5A 5T7LA 4DZDA 2BOAA 3GCWP 3RB6A 4F2RA 2HRYA 4RWWA 4Y2MA 4USWA 3W60A 1TVRA 2HHWA 1Z2ZA 4WZMA 3MM7B 1GMWA 5ITHA 4N47A 5KT2A 3QQCD 3IRXB 1CULB 1IWAA 2FLPA 2AYEA 2KZMA 3J80U 3T41A 4X4RA 1C0UA 2N3LA 2HHVA 2JL9A 3GJRB 2OPPA 3GIIA 1GMWD 3M8WA 4MMOA 4I6AA 2VG6A 4WPAA 3DOLA 4JV5F 3QO9B 1UL3A 3JTNA 3KLGB 5C2GA 3CC4S 2J9EA 4GVBA 2R7TA 1Q16B 2WAQD 1IKYA 1N4LA 1HNZJ 1RHUB 3VGUA 4I7FB 4DR5J 1X4GA 2KTQA 3P4UB 1LXNA 5AJ3F 1IWGA 5LMUJ 4G1QA 1NDCA 2GGPB 3Q8YA 2C2KB 3FZBA 5HROB 2HK2A 2RF2A 2A3JA 4NMLA 4ED2A 4Y2AA 4ENOA 4W92B 3ET6B 5D3GB 4PXDA 4USMA 5KFLA 1VQNS 2XY6A 1KQFB 1K47A 3TYTA 1VQOS 1U1RA 5IQ6A 2RD5C 1QAIA 2ZE2B 1K8AT 2ZBRA 4HHJA 4C6AA 2Y1LB 2IJRA 2R8GA 4QYZJ 2VV5A 2VQFJ 4DSKA 2HQCA 2J0SD 3NL0A 2HBQB 2E66A 1LWXA 3N79A 3DCAA 4KGVB 3M8QA 3A3NB 3HSZA 3OTDA 5KG5A 1HNXJ 4ZN1A 1BQMA 3C14A 3DOKA 4LF2A 1FDDA 3SXLA 1NH7A 1OY6A 1I5OB 3DMJA 5HMWA 1HHSA 5BYSA 3Q8RB 1T05A 2GVZB 4UUWA 3ZZRA 4Q0BB 5IFMA 5DM7Q 4TU9A 2C28A 2IJNA 4BLGA 2OPRB 2NXUA 4DX6A 1RACB 4QPXA 3FQLA 1Y4ZB 1C1CA 1N5YA 1F0XA 3H2VE 2CUYA 2B4PA 1RT1B 2MJUA 3D3BJ 4TN2A 1LW2A 4DUYJ 1U1OA 4ALZA 1I94F 1FE4A 1XMQF 1RB0A 1FVSA 1QLNA 1KDNA 5DJBA 2ALYB 3UN5A 3CD6S 2R7WA 1XK8A 2OSQA 2EK6A 3M9OB 2O5DA 3ZZZA 2FHJA 3HFKA 1NSQA 2XHCA 1JLAA 1N6QA 3GTYX 2E5JA 1REVB 4PRFA 4PG8A 3T5HA 2Z4PA 2ZH3A 1MMLA 3N6LA 1YRUA 3SMZA 3QNWB 1TMJA 2RRNA 1S5ZA 1FDAA 2BE2A 2R8HA 2FHJD 5C7PA 3QSIA 4NZ6A 4ETZA 5H9EK 3OVAA 2LQBA 1WTBA 3NEKA 5FIIA 1HNVB 2HNYA 2F4FA 4FDFA 3K5OA 2PIIA 4OI3A 1L3VA 2L9WA 3HHLB 3KKFA 4IO1A 3NRBA 2VDHA 2JHEA 1HWLA 1TELA 1QSYA 1N56A 1K73T 4QWDA 2F1FA 3NCRA 2VBXA 3WQPA 2HHPA 5FD1A 4NCBA 1TKXB 3H0PA 5A0YA 1U1MA 1RYRA 1H74A 4KHPF 3KLFB 1Q8LA 3AH6A 2UXBJ 5C42A 5KFIA 2HVHA 2CPHA 1R0AB 2CXEA 4P74A 2NYHA 2B4UA 3BPDA 4D3GA 4QIFA 1VQ5S 1IXKA 2XYHB 1CJKB 2C2RA 2MQQA 5HMZA 3GIMA 3PW7A 2AGPA 4DV0J 1SUQA 2FVRA 2GMHA 4WK3A 2VC0A 1VI7A 3WDOA 5KFFA 1TL1B 5DZ6A 2LA6A 3DOMB 4KKOB 3D28A 1X5SA 2KVIA 5F3TA 1M0SA 3CE8A 3ZZOA 1FA0A 2RIJA 3OTEA 3GCXP 1EETA 3T5JA 4A8FA 2EFGA 3BBFA 2W9AA 5BR8J 4RW9A 2M8HA 4CTAA 2D1CA 1TL3B 2KYXA 3MMBA 3OLBA 3RR8A 4OL8A 1RU1A 2OKQA 1XC9A 4LF7F 1KHVA 3DHWC 1TK0A 1VS3A 3TP2A 4A8YA 1R8PA 5J2NA 3PRBA 4TY9A 1NU4A 5F8MA 3K57A 1YQHA 1QD1A 2DNNA 4M5JA 2GCFA 4K50A 3MM9B 4CM2A 5AXMA 3L7OA 1RTHA 1YHQS 1CPZA 2UXCJ 3ENVA 4KH0B 1X7VA 2V8GA 2C22A 2IM0A 1IR2A 3UN2A 1PAUB 5BJRA 4L73A 1KWMA 1SKSA 5KFRA 5IT0A 5EWGA 2KKHA 2UXDF 4MT1A 1FKPB 2XZWA 4DMZA 2QG9B 2ZH5A 3CD5A 2VBWA 1SB6A 3V6HA 4NXNF 5D0EA 1T3NA 5J2QA 2MKYA 3L95X 2LFVA 5D6GA 3CT9A 2G2YA 4KPYA 4KC5A 3TR5A 4A47A 4OYPA 2YBVA 5HO4A 5K14B 4ITSA 3UO0A 4ZVRB 2EKNA 3TUZC 3LO3A 1WJ9A 1IJFB 3TVZA 1TZ0A 3HCXA 3U1MA 3ZO7A 1EARA 2H5IB 2HS0A 3MR5A 3N28A 1SVDA 1RZMA 5D15A 3BEGB 1VQ6S 4Y2IA 1JQGA 1NSAA 3KG4A 4QWAA 4Z7CA 1F3FA 2MLYA 3CNQP 1D9DA 3QAUA 3LP1B 2N7CA 2JEJA 3R97A 3D66A 2FQQB 2VODA 4LR9A 1U2FA 2UVWA 4WFNQ 2VG7B 4P10A 1M1HA 2JSXA 3KUGA 4DR7F 3LP0A 2NSCA 2ZBPA 3IG1B 3HSGA 3F41A 1U2CA 6AT1B 5KAKA 2AGOA 1B3TA 1WKLA 4YB1P 2FZCB 4LR7A 3TQEA 4I56A 4DL2A 1KQGB 5I3QA 3RAQA 4H4KA 1RAFB 2AW0A 1X4EA 3QRRA 2W7AA 2WONA 1QAJA 1NBEB 3J7Z5 2KVQE 1D9FA 2MQMA 4PZVA 4F7VA 2AJQA 5GAGU 2LDIA 3CCVS 1T9XA 2QV6A 1X9MA 1Q86T 4ECSA 1TKZB 1VK3A 5D0HA 3MCSA 4OZJA 1CC7A 4PG7A 3RG6A 1SC3B 3E8OA 1OSCA 1YRXA 4IQMA 5MAOA 4KHRA 4DS4A 1X9SA 2J7UA 1DFDA 3GR1A 4MIAA 3UD4P 2NS1B 1LWFA 1P1TA 3HHNB 4IR9A 3KJVA 1ROFA 2Y1RI 3G8QA 2LDYA 4RU2A 1Q8KA 1PAEX 4ELUA 4K0KF 3L9ZA 1X4FA 1S6PA 1FJGF 4KGKA 1S72S 1JKHB 2Z8QA 1N34J 2F8EX 3I0SA 3NCQA 4EBCA 4OZ5A 2IDEA 4USJC 3IR6B 1YZ6A 4B9VA 3IAS9 4AD6A 2H1YA 5IWAJ 4ZS6A 3SCLE 3R7SB 2IRXA 3EGWB 1RT3B 4EYIB 4CT8A 1VRTA 1ZZNA 4V1Ak 1SV5B 5J1EA 4CYUB 2W1BA 1IBKF 5F8GA 3CJQA 3BGRA 3VAIA 1PSDA 2DGWA 1Y3KA 1D8ZA 2CJKA 1D3WA 3Q8SB 5KFBA 1NSPA 1NJZA 4I2QA 4IOCQ 2I5JB 2VIHA 2V9WA 3MMCB 3EDQB 2VPXB 1LV5A 5EUHA 2KG0A 2YVSA 3IR5B 1KBRA 3PYGA 3C16A 4QIWD 1RK8A 1U6ZA 3DXSX 1JWWA 4FPIA 2XY7A 1RWNB 3FBFA 3MPUB 3AB2B 3SFUA 3AA8A 3T6JA 5KFMA 4HR2A 4LF5J 2I8EA 3B6BA 4KO0B 3IRXA 2R2SA 1EQ0A 1O5JA 4DX8H 3JSBA 3A12A 3IM8A 2MLXA 1HYSB 2WSFC 3IXQA 2VDIA 4F0KA 1QAYA 1S9GB 3BKUA 2CYYA 2R7QA 5C25B 5CZXA 3TA2A 1NPKA 3ADAC 3MD3A 4R5PA 1U2RA 3R2DJ 4NE9C 5EDWA 4PPDA 1T94A 2EEYA 4ECTA 4RO0A 2IHR1 3RRGA 3CTRA 2GGPA 5HROA 2E1CA 3L4BC 1VQYA 5GADI 1MNEA 4OX7A 2BANB 3T1YF 1KFSA 3TUJC 1KLMB 4F04B 4X4OA 4KBIA 1VHIA 5E3RA 2I0XA 2R8IA 4NWBA 3R5JB 1UP1A 4L72B 3GFYA 1QM9A 3R2CJ 4WU3A 1RHMB 4JI2J 4DL0C 2IYGA 3MECB 3CJKA 4LRCA 4UOHA 2ASYA 4CM0A 2W2OP 3OR1B 3K59A 1PYOB 1H0HB 5CAAA 4K4XA 2ZBIA 2LCWA 5C2CA 4E98A 4CO5A 5B0CA 2ZJQQ 5LJ5Y 3M8ZA 2OIHA 1WHXA 1Y5NB 2EC0A 4Y6IA 1IKVB 2V94A 2JDJA 2W2MP 2OPRA 2KU7A 2MB0B 2R7XA 4USUA 5J1PA 1TP7A 3M32B 3VCDA 1TKTB 1RBOB 2ZOMA 4I68A 1YWXA 3RJMB 5E7OB 1XR7A 1BGXT 4QW9A 1WF0A 3NOCA 3OSPA 4HI1A 1HBMB 4MH8A 3T9ZA 1R89A 2R2UA 1LWCB 2BZ2A 2FPHX 4Q44A 2XMJA 2MJNA 4FKXA 3R6GB 2H4WB 4A8XA 1HHQA 2UUBJ 4PWDA 1H7WA 1KTQA 1KQKA 4ECZA 1RTDA 2FC8A 2E5LJ 4X65F 4M95A 2FJVA 4ZVUB 3MEKA 3GP9A 4Q8EA 2DH7A 3QT8A 1FXRA 2QX0A 1T0TV 5GAHI 2JLEA 1Y11A 4BDPA 1RWOB 3JTPA 1CG2A 5T41A 1YGYA 2Q6BA 4JV2A 3R5BA 1WOSA 1HLWA 4P7VA 3UI3A 1QE1A 3WIUA 4DDFA 4F67A 3J7A1 1RCXB 4DSEA 3KTQA 2QO3A 2RVJA 2NXJA 3CW2C 3IS9A 3VAMA 3M8PB 4H4MA 1TL4A 3PXGa 2IA6A 1U0SA 4HH0A 1MROB 1AA1B 3N5FA 3KLEB 4I2PB 3ILJA 2RHQB 1Q8IA 3BGOP 1VISA 3KLFA 2RRBA 1B4SA 1E6YA 2ACMA 2AEMA 1B70B 4ZA1A 5HI7A 3N5BA 1GX5A 1MU2A 2CPEA 4PUOB 3KWMA 3MM8B 1PC5A 3OFHA 4RW4B 2HNZA 5AXLA 1CJKA 2W9CA 2UUCF 5KG7A 2BABA 2QSFA 5DLFA 1UW9A 1SJ3P 3HK2A 1WF2A 1BC6A 5KFOA 4R8UA 1FFSB 1NDLA 3RB0A 2E9ZA 3LGMA 1H38A 4LF9J 1HIYA 3H7HB 4DV7J 4A8SA 1TL3A 4N8NA 1T11A 4JI7J 1GMUA 4O23A 3HT0A 1WHWA 2I9SA 2HQ3A 1SC6A 4ZLLA 4CLZA 4OI1A 1JLQA 2BQRA 1UWBB 3LPYA 5DGBA 4X62J 5EGYA 2V4JA 3EVWA 3SFGA 2UVRA 4FZVA 4L75A 4LREA 5EHHA 3PFEA 4MK8A 2EWHA 1WG1A 4XDDA 1HMVB 1FKPA 2XMWA 2ZC3A 3RUBL 1ZS6A 3KDNA 2X1BA 1K0TA 4NLTA 1OJ4A 3PRVA 2WB1D 3KG1A 4QR1A 4B08A 2OTLS 1IQTA 1NAQA 1C1BB 1W7WA 5K14A 5K20B 1VIOA 3GE9A 3CCLS 3H20A 2DGVA 4NLUA 4HT5A 2F4VJ 3C19A 1U4BA 2B51A 1XTZA 3PJXA 2C2OB 2IPOB 2XI3A 4P75A 1X4CA 2C2NA 3QATA 1ZOTA 2DR9A 4ECVA 3FEZA 1UTAA 4ERDA 4JI6J 1S6OA 1IQZA 1OYEA 1S1TB 1I3OB 2PI5A 1S9EB 2VA3A 2FVSA 1WWHA 3PIPQ 2VG7A 3GPAA 2QLBB 3ENWA 1L3SA 2FJDB 4RBUA 2E1RA 3IG1A 4OYBA 3OL7A 2O66A 3CJ5A 4UZCA 3G2XA 4ES3A 2JLFA 2YH1A 4DR4J 2AV5A 2M4MA 4RUHA 2K7KA 1VGYA 4UOFA 4ID5B 2GAGC 3DRPB 1HWKA 4OLOA 1R6VA 3E2EA 3M30A 2YKNB 3TQ1A 4M5DB 1Z2LA 4Y0FA 4LFAF 4TYAA 4IUFA 4R0EA 5IT9Y 1YBTA 4DLEA 4ZVPB 3LAKA 5DLGA 1LQ9A 3I4PA 1KHWA 4IDKB 3FBCA 4U96A 5DGAA 3CDEA 2POKA 4K4UA 4HH1A 2GAHC 3KMSA 2IMWP 3QJJA 5J2PB 4D3HA 3OR2B 3GILA 1S76D 5KFNA 2OMLA 4B3SJ 4RW7B 4OHVA 3GLJA 1VRUA 2EXUA 3KFWX 5KG4A 3PDNA 1TK8A 5DQIA 4URQU 4N77A 3T3FA 4CDIA 2X3GA 4F4AA 5JVHQ 3E51A 2O1PA 5KOXA 1UJ4A 2ABYA 1JKHA 1V3ZA 3TI0A 5IXUA 2H4YB 4PYDA 1SPBP 2M70A 2AF6A 5CYJA 2ZH4A 4FBUA 1J5OB 2ASJA 4LFCF 3GJTB 1H98A 2CZVC 1QAXA 3F73A 4OI4A 3CDWA 2NXNA 1NUEA 1SV5A 4DR1J 2VZ9A 3T9NA 1RAEB 4CYUA 4ZCIA 5U47A 5KG0A 1OY9A 2DO4A 3K8WA 2HFOA 1OWXA 2E1PA 1RHQB 2IM1A 4IRKA 4LVOP 3AD8C 4NA2A 3GJQB 2GQQA 1SL2A 2XCAA 4UY85 2I5JA 1N33J 3VAFA 1TK5A 3MMCA 4WZQA 4V19J 1IM6A 2XYPB 3KMQA 1PYSB 1XEZA 3BJYA 3R5DA 3K17A 1S1WA 3PW5A 1S79A 2VC1A 3FSYA 3RBEA 1R8HA 2IBKA 4F4YA 1JLFA 1KRPA 3EPIA 4JYAJ 5KFWA 4MTPA 5SUHA 4FXWA 4LR8A 1HYSA 3BSOA 1ICEB 3FCVA 5HJXA 2PA8D 4TQSA 2LVWA 4DX5A 5F0UA 4EO6A 4PQUB 3BBCA 2Q6CA 2DNZA 1GQEA 4B3TF 2EG2A 1N32F 3TAPA 4OJHA 4WP3A 5C25A 1VRQC 3SI8A 3BDPA 2R42A 4AE5A 2AX0A 2JX2A 2HSEB 3TJAA 4L3NA 3V81B 1KOOA 2OFGX 5F0WA 1VK8A 2F65A 4ILLA 3OQ2A 1NKEA 1WTFA 1XR6A 4AL7A 5L1KA 3DFEA 2DB1A 3J81j 4J9QA 1HQUB 2DGQA 2X3DA 3OJSA 4GKJJ 2QYCA 3MEEA 2C3UA 5CCMA 3G86A 1LFPA 2PEHA 1MMDA 4XK8C 1RABB 6FDRA 2BANA 3R8YA 2OPSB 2HFSA 3ICLA 5D8HB 5B0AA 1S77D 1WSVA 3AHPA 4DPTA 8ATCB 3R9LA 1Q95G 1JK9B 5IV3A 3M6VA 2XGQA 2W25A 4DPXA 2YNHB 1RWKB 2LQ8A 3NS6A 3W8GA 1JLCB 4ZVGA 4DJBA 1BQNB 4DR5F 3H90A 3OR1A 3PM9A 2V8HA 4UOGA 3TZWA 1YDLA 4JP8A 2W24A 4OZNA 3ZNUA 1NK6A 3Q24A 1CQMA 5CYQA 1WEYA 3K5LA 1PBAA 2RSQA 3RAMA 1UKUA 2BQ3A 2V50A 3ZTSA 2CG4A 1XNQF 1YJTA 1F2HA 3GSIA 4FP9A 2AEJA 4OV1A 4CLTA 4USTA 3NP5A 5G0RB 3OXGA 1KQSR 5H9EJ 2UUWA 3QGPA 4NPOA 1FRIA 4DV1F 2MKSA 4DV4J 2BKOA 3HFVA 3NNAA 3EZ5A 1C0TB 3MM6A 1UJ6A 3V6DA 2EFNA 1JLGB 1TKTA 2IA0A 4A8OA 2B4VA 1HNWF 1S12A 4IOAQ 5BYRA 5B0EA 2LMIA 1G1XA 2L48A 1ZAXA 3R7BB 1ZM9A 4NLSA 2Y8YA 1VQMS 4WKRA 4K4ZA 1LWCA 1FF2A 3OHAA 3LWMA 3CIZA 2CAJA 2JWNA 2V5HG 4U7CA 4JI0J 2AKWB 1HNXF 2JEIA 1BLUA 2J9DA 4LJMA 4CLFA 2VU5A 4RW8A 1L5UA 2XLKA 2AJ0A 3D7SB 4TXSA 2BRKA 2B9XA 4DV3J 4ED4A 2W9BA 3GFHA 3OFGA 1RCOB 1URNA 1N52B 3H40A 4G65A 3W9JA 4CH0S 3N6NA 2XSJB 4B02A 4KGMA 4ZPCA 3IP0A 1FRKA 1A9NB 4KAIA 4O3SA 2QE5A 2K2PA 3M8RA 1GXTA 4WXWA 3OFEA 5KG2A 4CI0B 5GMEA 5LSOA 2JEFA 4JI4F 3QRPA 4IFYA 2L9NA 1LWEB 3EZOA 3SYZA 5C24B 1IN0A 1SIWB 3W2VB 2CNOB 4O3PA 4YUDA 2DNRA 3I6PA 2FHKA 3H25A 2CPIA 3CD0A 4B3MJ 3TNVA 4WU2A 2FY8A 5KFXA 3C46A 1QUVA 1PILA 1OQ6A 9RUBA 3MM8A 2G13A 3NBPA 4NLWA 3IAM9 4X66J 1NJYA 2VICA 3QJPA 1NNDA 3H8YA 1N0VC 2Y0SD 2KRBA 4HT7A 2G1DA 5DETA 4UF4A 1X4DA 1RT7B 4WTOB 3TO8A 1SJQA 5L9NA 3DHXA 3EUNA 3D67A 2IVYA 3ISND 3HI9A 4PABA 4BBYA 1GXLA 2RDDA 1FJEB 2ADBA 1WG5A 2BVZA 4NXMJ 2H9ZA 3PIOQ 2DIVA 3RBDA 1N88A 2UXBF 3BB5A 1P9QC 3PV8A 1ZBTA 3FJ2A 3TZZA 4U8VA 1PJ7A 5JUMA 3A4TA 2KB2A 2FGOA 3O5TB 1G6BA 5D4PA 1PJ6A 4N76A 4WE1A 3OBIA 1UWBA 4DFMA 3PZPA 3GU0A 4DR6J 4YHHJ 1B7YB 3MEDA 1VHFA 4AQYJ 2R7UA 4QOTA 2ZM6J 4ZDNA 2ZWPA 3ETMA 3CUNA 3EXCX 1RT2B 1X4AA 5IQQA 4JUZA 4PAAA 1NKCA 4X64F 1AZSB 3I5CA 4WCEQ 2NREA 3JQKA 4WYWA 2R7VA 2DVIA 2VJVA 3MPDA 1IJEB 4L6V3 2BE9B 5BR8F 4FF4A 2DNHA 3KLIB 4ED0A 3THVA 1R7IA 4KRWA 3KNGA 2OUGA 3I9V9 3GIRA 3HT3A 3LALA 2C1EB 4QWBA 1BHNA 2LYVA 1P27B 4NLDA 1FHTA 2DO0A 5IC6B 1RTJA 1R43A 1HBNB 3O1LA 1SKWA 1CQNA 4NYPA 4YDXA 2GNKA 2UXCF 1EHWA 3CD7A 2VKZG 5T7LB 1F5CA 5A6PA 1GT8A 4KB7A 3C6UA 1U48A 5I4MA 3K7RA 3Q0AA 2OGUA 1TVRB 3AXKA 1KEKA 4NA3A 4ZPTR 5L8RC 1F9HA 3WZ0A 4EWTA 5M2UA 2MLZA 2Q79A 3UVJB 2BOPA 3DLBA 2A10A 4RBVA 2MEWA 2ZVSA 2VB6A 1C0UB 2PMZD 2OPPB 4MKAA 3DN9A 3DRPA 1X60A 5EN1A 4Y2KA 3DOLB 1DJ0A 2D7SA 3LA0A 4XIUA 1HNIA 3TW0A 4GVBB 1NK8A 2YKNA 4NOHA 4YB7A 3NGKA 1IKYB 4M5DA 4NLPA 3MPYA 2BXJA 4DV6J 3JSYA 3MAAA 5GAHU 3GQCA 1Q5YA 1NXIA 4G1QB 1X8DA 1G2EA 4ZMMA 1RWMB 4ZLPA 1R8CA 2Y1JA 4KIAA 2RF2B 1HWJA 4J9VA 1N8RT 4P2FA 4KT0C 4P6QA 2ATCB 1FEHA 3OVBA 3RYLA 1NJIT 4IH5A 3PTWA 3W3SA 3VQSA 1HR0J 4KV8B 2ZOFA 5LOQA 2X7IA 2QMXA 2AHOB 4OX9F 2CJQA 3OL6A 3CSKA 1S0OA 3T6BA 3W66A 4AL5A 1TKDA 2UVUA 4J9SA 1QJHA 2PI4A 1IKWB 3S7RA 4NLXA 3JAMY 3MM5A 1KD1T 3LGNA 3NGUA 1JNZB 1PG5B 4RR5A 2ZBQA 2EBGA 3M8QB 3PX6A 1SBRA 1X0PA 3M1VB 2BV3A 3C14B 3DOKB 1NK0A 2FLOA 3HMJG 4I69A 3DMJB 2DR8A 2V8VA 5E33A 3NNHA 5IOLA 1NM2A 1HBOB 1RU2A 2GMJA 3FBEA 5JMNA 1RAJA 2XMUA 4FXDA 1N34F 3W65A 4DU8A 2CQ4A 1T8EA 3QGIA 1T7PA 4DBQA 1SH2A 2A1BA 5AE2A 2Y8WA 4KY3A 2V8PA 4J9PA 4TNOA 1RHRB 1M90T 1F1BB 3CCES 2LQJA 1NZ8A 2E7WA 2YWGA 1CJUB 3BF4A 3R1HA 3ELHA 1HFEL 1GFWB 1JLAB 4QJVA 3BGFA 3ZTQA 2JH3A 2JVOA 3DLEA 2KXFA 2BX6A 1JLEA 3HXMA 2LQ5A 1GTHA 3L3CA 2W8KA 2HLTA 2MKKA 2R4FA 5JXSA 1VQ9S 3NGRA 3DRSA 4LF8J 2DHGA 5IT9U 2YQ1A 3QAEA 3H5UA 4ZKAA 3MR7A 4K4YA 2HNYB 4KFBA 4BC9A 2MYFA 1YJ9S 3HVRA 3V81A 3VAJA 1Y10A 4ILMA 3AA9A 4KR0B 1F2GA 4OHZA 1UA0A 3FRYA 4J9MA 2XMAA 4JV5J 1QDUB 2G0IA 2OPSA 2QFJA 5KFAA 4WFZA 3ZZYA 1IVZA 5C42B 3MI7X 3UD3P 2AX1A 4WWSA 4DL3A 3KLHA 4EGLA 1N5SA 4F36A 1U1NA 2V69A 4NLYA 1Y3JA 2QT7A 1W26A 4TKTA 2DHAA 4ZVEA 1YTYA 3FGVA 4BC7A 4GO5X 4J91A 1SUQB 2LEBA 5HN0A 4C0HA 2DHXA 2C2DA 2KI2A 2CNNB 4UY8T 1EETB 2XEXA 5LMNF 3OXFA 1TL7A 4RW9B 4C8KA 2CIMA 5G0RA 4CTAB 4YN3B 3WC2A 4URGA 2AYMA 1C0TA 4O4GA 1JLGA 2ZHAA 5J2NB 4CO0A 2DGXA 2W2QP 1YX2A 3I9ZA 4JI2F 8RUCA 4DPOA 1WDDA 3BREA 3LAMA 3RU0A 3UCZP 1D0EA 4GO7X 2XYGB 3G4SS 2XY5A 7FDRA 2OELA 2XI2A 1ZYQA 4LUBA 1HW9A 1FNOA 5HMYA 3ZXWA 2XNRA 2DT9A 4OMFG 1HD1A 3PYFA 2YX1A 2VPYB 2AP6A 4RU9A 4F2SA 1JIHA 2OTJS 2MKHA 3HFZB 5D78A 1MSWD 4RUAA 1I94J 1TUWA 1XMQJ 2RU9A 5K8OA 4X4TA 5FJ4A 3NWRA 2FLLA 2A2DA 3EGZA 3F44A 1UVLA 5HVFA 4AL6A 3DGPB 3DRRA 2QN6B 3BO2A 4OZ1A 4RJVA 3PYDA 3MDFA 2GZOA 1UVNA 4DCJB 2B6AB 3I31A 3FC9A 2E5LF 1FI4A 2DHHA 2OD4A 3W8PA 3RTVA 1CJVB 4DU7A 4UW2A 3I0RA 1IBLF 4C3LA 3PW4A 1X9WA 3LP0B 1FKAF 1WKKA 5IV4A 2F8HA 2L3MA 5EX0A 2P6TA 2ILZA 2GS8A 4PXEA 5ETNA 2PN6A 5L46A 4ZVOB 4Q2LA 3P6YC 2EPIA 4HTJA 4OFZA 2EFVA 3CJ0A 1EAYC 2VFTA 2G2OA 5F3ZA 3H5YA 4DQIA 3G87A 7AT1B 2VOPA 5HP1A 2BYCA 4TYBA 2FHOB 3BSAA 4KHPJ 4P2MA 1AFIA 3PNIA 2QA4S 2HHQA 2P9CA 2EBEA 4OYAA 4ZVFA 4JI3F 1WC6A 1XMOJ 3UDCA 1KVKA 1ZETA 1X0FA 1KVJA 1YJ7A 1RA7A 1LWFB 1ZAWA 1SC1B 3KJVB 4HEA9 1YJWS 2LXIA 3W2WB 5SZTA 3A8JA 2NLWA 3BKFA 2HYIB 4P72A 2K1RB 5DRKA 4DOZA 1UVMA 1OYDA 2RJZA 1B99A 3I0SB 2DR7A 2ZZTA 2U1AA 3LPEA 1HI1A 4TU7A 1RT2A 1TTHB 5AT1B 5ETQA 4KE5A 2ZC4A 3C15A 3DU5A 4C8LA 2JNJA 3BN4A 2CPJA 1VRTB 3CO9A 4LF7J 1Y00A 2LA4A 1SCJB 5J1EB 3QFHA 1S1VA 2FJEB 4ATNA 2IDLA 3N4WA 3A8KA 4YMEA 3AD7C 2DPJA 2IRYA 4DF4A 2KZZA 2DNMA 4OIXA 2CRLA 2B56A 5CABA 4P71A 2DRDA 1M5OC 5D0RA 3MURP 3PW0A 2OEJA 4EZ6A 3CJSA 3MZIA 4EEYA 2NXCA 1HBNA 1S7IA 3V6JA 3IO1A 4DZ6A 2UXDJ 3R6LB 1VDHA 4U7UD 2F5GA 4NMXA 1UFKA 3TVKA 2ZUGA 2IVFB 4M5KA 3RBZA 2CA9A 5D4NA 2ADCA 4P7TA 2QJ3A 4X4NA 5F41A 4J9UE 1W25A 2MHNA 2DHSA 4M5MA 2HQIA 4TLRA 2BJEA 2IAJA 4OYZA 2J0XA 4J5OA 4FVCA 3UVJA 2OPQA 5DM6Q 3NGTA 4F3QA 3OW2R 4EU0A 3IFEA 2QMWA 2ZH2A 4H54A 3J7YU 2C2EA 1EX8A 4DG1B 4K2XA 4MAKA 3KOAA 4R5PB 3US5A 2KXNB 5LXYA 3NMRA 3UWTA 2A6MA 2RUGA 3OFFA 3RZAA 3HD2A 1TFWA 4NA1A 4JI6F 4YR2A 2B3TB 1NCLA 1NO8A 1VCTA 4EMDA 1DLOB 2KN4A 3FEYB 4OYXA 3HHDA 4IFVB 1BY9A 2CWKA 2J5AA 4C8NA 3BO3A 1V9OA 5ETOA 3AOBA 1B7FA 1WC3A 3IC1A 3IRWP 1AFJA 2MGZA 1JLBA 2OMOA 1NRKA 4KV8A 3UR0A 4NEYA 1F5AA 3KJQB 1RISA 2BRLA 1UCNA 1FJCA 4FVMA 4PQAA 1FRJA 1VC6A 3D0GE 4FS2A 3MUMP 1IKWA 3B8HA 4HHUA 1RT4A 2MZTA 3CJKB 4Q45A 4ECWA 2U2FA 1U02A 4Y28C 3TUIC 1IR0A 2PFDA 5DG9A 2RKIB 2Y3YA 4KSEB 1Q4RA 1TUGB 3FZ2A 3SQGB 1WI8A 2GIQA 1UW4A 2MSTA 3M1VA 3AJ2A 2DYAA 4C9DA 3CDAA 4NRTA 4A8QA 4K0KJ 3CMES 4LQ3A 1WG4A 5F8HA 1HBOA 2DNLA 4B9NA 2WW4A 1P1LA 3ITHB 2JLGA 2DGTA 2W7PA 4DPWA 3B4MA 3M8SA 4LF4F 3VAHA 2UUTA 2V0NA 2KHDA 3JQJA 4A8MP 3CWJA 3QSYB 2XS5A 4ED7A 3M9MB 1XMBA 1XERA 4CLWA 4CLSA 2YWHA 1W2BR 4K8RA 3JTOA 4MFBA 4WFXA 2JVRA 2Y1IA 3LUYA 1IBKJ 1J27A 3DGVA 4DR1F 1CJUA 2YH0A 1T9WA 4PWDB 3SV4A 4U9RA 1RTDB 2ZZNA 1RHKB 1B0TA 4F25A 3VZIA 6FD1A 2ILYA 3UCGA 2ZZMA 2D9PA 1TV6B 3MFIA 1UAWA 3GV8B 2ZHOA 4N8OA 2H54B 1QVGR 5KFSA 3FCHA 9ATCB 2CZ9A 3RB4A 1RKJA 1RT5B 2CKWA 1YKWA 1QE1B 3M2VA 3H42A 4Q8FA 1RAAB 3KHRA 3AT1B 2K3IA 3IWNC 2KT5A 1CS4A 3VVUA 3IS9B 3OHBA 2ZJRQ 4LFBJ 4H4MB 3MMAA 4CLPA 5GMDA 3AOCA 3W5ZA 2DBBA 1KN6A 1E6YB 1U26A 1RTIA 3JYTA 5E3CA 3C3LA 4HYKA 3JAMU 2CPXA 1MU2B 2HIYA 2HIQA 2HNZB 2F7VA 2MPUA 1X31C 2W9CB 4X84A 2GJFA 5KFHA 2CWXA 2QLFB 3HVTB 1FVQA 4DWIA 3T1YJ 1UFWA 4GKJF 4R8UB 3O8WA 3VHQA 5M2RA 2XC9A 1S99A 5A2QY 1UMJA 4IG3A 3MEGB 2HZCA 5KFEA 2QL9B 1UEUA 2QRRA 3EVMA 2N4DA 4PXBA 3TZXA 1F3VA 1KOHA 2GQCA 2PE8A 3KLVA 1WACA 2FC9A 3OD2A 5IM0A 3QZ7A 4XPEA 3E01A 2ASDA 2MZJA 2X1AA 2VL1A 2W01A 2Q66A 2HBZB 1JLQB 1T95A 5B0BA 3N01A 2WVDA 4DPYA 1WDTA 3QGHA 4V19X 2V4JB 4G1PA 2F3JA 1ZM2A 3ZZPA 1X5TA 2K06A 2G1HA 2E9TA 4N7TA 1X4HA 1S0MA 2VBYA 2IIHA 2BW7A 5F8IA 3HJVA 4DL7A 2OEMA 2CVIA 1SKRA 1V3SA 3ZTOA 4IQXA 5DDRC 3ISZA 2XNQA 1S6QB 1NSKL 3MCNA 4DPUA 4NX9A 2WOMB 2W7OA 2AT1B 4DR2F 1VMBA 1PJ5A 4DL6A 3A3OB 1HL6A 5ETKA 2P5VA 2BJDA 4MKYA 2A18A 1SH0A 2B4OA 1C4CA 2V8DA 1SQFA 2CQBA 2ROPA 5DO2A 3DGPA 1UWAA 5HK4A 4JI0F 1V6HA 5HBMB 2DGOA 5F8LA 4X65J 4RL1A 1S4EA 3HO1A 2MQLA 2FD2A 5A76A 2VPZB 3DLGB 2B6AA 3EJMA 4H4OB 4DV3F 1J2VA 3DLLQ 1CJVA 1C4AA 2YY3A 2O01C 2HAIA 2HHHF 4K2JA 4F50A 1S0VA 4DCPB 2FLNA 4OYOA 5F8NA 1HQEB 4QR2A 2DH9A 1WC4A 3NOGA 4ECXA 1JXEA 1FWKA 3Q22A 4RBTA 3M30B 2GHVC 3CMQA 1NMEB 3W7BA 1V5VA 2WK4A 1Z4UA 1FRLA 3CDBA 5EX3A 5D4LA 2VOOA 4WBFA 1KONA 1PC4A 4EO8A 1U49A 3D2WA 3Q89A 4Y3CA 2RQMA 4ED6A 2WVFA 2WVCA 4OHWA 3W62A 1FTRA 4B3MF 4HDGA 1VR6A 2K3KA 4EYHB 2FVCA 2UUCJ 1VRUB 4QYRA 4B9LA 3W2WA 4IH6A 4A8KA 3AD9C 4X4SA 3R1LA 1FEEA 2JEGA 2MQPA 1JJCB 2K1RA 4PWWA 1NK4A 4ZIVA 5B0FA 2DKOB 4ID8A 4HACB 4HTIA 3Q2TC 2UP1A 2DEIA 3HKWA 2V4RA 4HI2A 2MMYA 3G8TA 4FF2A 2F8MA 4M5IA 2RUSA 3QGGA 4UQGA 4O44B 2CQCA 3DM2B 1PGZA 1H7XA 3SSSA 1BD6A 2EFOA 2LP4A 2KRRA 3RGIA 4ANEA 1S6UA 5B09A 4Q7AA 1QSLA 2QZ8A 5ETLA 1MN7A 1R27B 3TVYA 1XWLA 3B82A 1HPZA 1IKXB 5JVGQ 3IGNA 4EFAC 4JI5J 3OTOF 5F8JA 2HPUA 1YG0A 2NSBA 4OZ2A 3NG8A 2RS2A 2E7VA 1S1WB 5KFCA 2HMIA 5K5MA 3CCJS 1NH8A 3KHLA 3N0VA 2J8SA 3F56A 4FYDA 1JLFB 3V2UC 4JV1A 1BQXA 4CLYA 5HANA 3DXBA 2G4BA 1QTNB 2YKMB 1WSRA 4Y00A 4ZPDA 2RT3A 5H9FK 4IOBA 2M8DB 2VG5A 4LRFA 3DDKA 3BR9A 3CPWR 1SJFA 2GO8A 2KM8C 4DV5F 2XZDB 3LQVA 3IWXA 5J1NA 3HLUA 1KNZA 1S1XA 1JXVA 3AAWB 2QIFA 4DG1A 2HVEA 1BWEA 2XGPA 1UFLA 4F26A 1WD6A 2YWFA 3D3CJ 3W5YA 2RH3A 4F0HA 3KNAA 3BQ1A 3GV5B 4FKYA 3EM1A 1O0PA 1DLOA 1Q53A 4P9SA 3JXOA 3MEEB 3BZQA 1NKBA 4IFVA 2IVMA 4OZ0A 3DYAB 2KDOA 3POTB 3NWGA 2CQPA 2BBEA 1T9UA 2IM2A 2J7KA 3B4DA 3BYPA 5ADZA 2VJUA 3K5MA 2AJFE 1NPPA 1FT8A 4DQSA 2Q3PA 3HHKA 4U67Q 2H5JB 2XB2D 2OI2A 4LSNB 3JSRA 1SH3A 4Z37A 1IUJA 1CJTB 3IBWA 4M63A 2D3OR 1KP6A 2Z58B 3MOJB 4DV6F 2QFIA 2GA7A 2KL8A 3OT9A 4ECQA 4LT6A 4B3OB 4CP5A 4KQZA 3FK4A 2RKIA 4PG5A 2B9YA 2VHGA 3SQGA 2HHUA 2RAQA 2QLXA 2BW2A 5CYQB 2SXLA 3KUHA 2EFPA 1H2TZ 5FLXY 3ZFVA 2GJIA 3U1LA 5HMXA 2HAFA 4FYXB 3FSXA 3QFWA 1S97A 2MKJA 1HR0F 3ITHA 1YJUA 2ZHBA 5AXNA 2UU9J 3PACA 1KVIA 2D41A 2CQDA 3MM6B 3V6DB 2AJ4A 4DR3F 2DNKA 3TOQA 4LFCJ 2AYGA 3CCUS 4XPCA 3EICA 4LRAA 4ZVTB 3NKYA 3CCRS 2X51A 1FK9A 1T03A 3VAGA 1KFDA 4RUCA 7FD1A 4NYOA 4IR1A 1OS5A 2BUNA 3BYRA 3MAQA 1YLXA 3CC2S 2JJ4D 4RW8B 3R7NB 1WHYA 3KK1A 2N82B 4X4QA 2OAUA 2PFFB 4OYIA 4YP3A 1FD2A 3KJFB 4ZK7M 5KFPA 2W9BB 1Q78A 3UNYA 4TU8A 5MLCV 2HHTA 1CVJA 3MR3A 5I3PA 1TV6A 2FJBB 4YY3F 4DV2F 1KR4A 1WOPA 1Q7LB 4CLUA 1RT5A 2A0FB 2WBMA 2Z0GA 3FVYA 2NUHA 2WCXA 3QZ8A 3ZZTA 2HRTA 1B64A 1BXNA 1MG7A 1FE0A 2GVDA 1EIYB 4U95A 4K7QA 4IFYB 2VF3A 5LL6d 3PVXA 1RGVA 4PXCA 5IS2A 3M6WA 4B3TJ 4O3NA 2B0GA 2R7RA 2ZH1A 5J2MA 2FZKB 2H51B 2XWYA 4C11B 4USIA 3MHYA 4R0JA 3D6FB 5KT6A 1VBKA 1SI9A 2J9DE 1RWVB 2RB7A 3NBPB 1K44A 1KC8T 2X1GA 2L41A 1RLCL 4L3KA 2VFRA 1NB2A 5JJBA 3UN3A 4FNHA 3TEGA 4ZCMA 4GKKJ 1S4FA 4J37A 3HVTA 1SQGA 2C2MB 2YWEA 2RU3A 3G8SA 3R27A 4P2SA 5ETTA 3D6MB 4QW8A 4ETXA 1U45A 3BBBA 4USHA 1WC1A 2NR0A 4ANDA 3MEGA 4OI2A 4USVA 2XWXA 4KGXB 3VALA 1DAXA 2OFHX 3ISNC 4ZHRA 2HWIA 3PKMA 1JNRB 2AJ1A 1K0VA 1REGX 1EQMA 3V4IB 1NJWA 5K8PA 1N5TA 3G96A 3Q8UA 3I5AA 4ZP6A 4WE1B 2B43A 4LSZB 1ZTWA 3U02A 3PHEA 2YNFB 1N54B 3BKTA 4WIQA 4DSJA 3MEDB 1MWQA 4B3RF 3E3XA 2I1RA 1XNQJ 2QA1A 5K8NA 2F9JA 2H48B 1RDRA 3TARA 3NCPA 1WELA 1ZAVA 4MK9A 4DV1J 2PMWA 1M5PC 1TQLA 2VKRA 3AODA 3M7VA 1M5KC 2IY5B 4UT4A 2FVQA 1DTQA 1HNWJ 1S6QA 1NLKL 3M4XA 3HF5A 1ULRA 2WOMA 1NK7A 3PO5A 2UV8A 1S49A 4DUTA 2VQEF 3SCKE 3EWGA 3CCSS 1FO1A 4ZPWR 1NDPA 3P5TL 4U6PA 1EP4B 1RTJB 3BGUA 4EK2A 4M5LA 3CGIA 1DTTA 2UZAA 1WEZA 3BR8A 2ZWOA 1H72C 1H3DA 3WIVA 3PO4A 2VFUA 5A8WA 2Z2LA 5HBMA 2JOQA 3UDVA 2LU2A 2AQ4A 4W90B 3C8YA 2M88A 1PO6A 1DZ5A 3NNCA 3G71S 3C6UB 2RMLA 3DLGA 2UUAF 3Q8VA 4USKA 4H4OA 1R8AA 3Q2SC 4CO2A 1RLDA 2LECA 1FRHA 1P9YA 3T1HF 2J8AA 5E3AA 1U7LA
chains in the Genus database with same CATH topology
5LMNF 2E5GA 1T3OA 3CJ4A 1U8SA 3OXFA 1SL1A 2ROEA 1YITS 2IYIA 2I8EA 4RW9B 1HBUB 4C8KA 2CIMA 5G0RA 4CTAB 1HQEA 4KO0B 2E1MC 4B9TA 3IRXA 2R2SA 1L3VA 1SJRA 1O5JA 3SSQA 4DX8H 3JSBA 1OQ3A 3WC2A 2V2KA 4URGA 5DQHA 1UEVA 2HLUA 1HYSB 2WSFC 2AYMA 3IXQA 1C0TA 1JMTA 4O4GA 2IFXA 4X2BA 1JLGA 1HNIB 2ZHAA 1FK9B 1T03B 5J2NB 4WXOA 2DGXA 4CO0A 5LSRA 1QAYA 1XR5A 2JZ5A 3I9ZA 4JI2F 1S9GB 2KFNA 1U25A 3U7JA 5CCLA 4URSA 4DPOA 2BQUA 3BREA 2CYYA 3V4MA 3LAMA 3RU0A 3UCZP 1D0EA 3I32A 2R7QA 5C25B 4GO7X 5CZXA 3TA2A 5GADU 3QIPA 3G4SS 2XY5A 3MD3A 4QR0A 7FDRA 1U1LA 1N48A 2VONA 4FF1A 4R5PA 2XI2A 3SZ2A 1U2RA 3KK1B 1ZYQA 4LUBA 3O6QA 2WB4A 1HW9A 1FNOA 2ZKTA 5HMYA 4G3IA 2B7BB 1U6FA 5EDWA 4PPDA 1F60B 1T94A 2EVZA 2CQ2A 4QIGA 4ECTA 2XNRA 1GTEA 1CLFA 2DT9A 4OMFG 3QJLA 2R7SA 3MR6A 2IHR1 1W2IA 3RRGA 3CULA 3AJ1A 4LIWA 3CTRA 5B08A 4JBCA 3P49B 2GGPA 1HD1A 4F4ZA 2ZITA 4F3OA 4K4SA 3JB9k 3NGDA 4ELVA 5I3UA 5HROA 2E1CA 3HZGA 1N33F 3HX9A 1VQYA 5GADI 2YX1A 1MNEA 2VPYB 4J9NA 2VASA 4OX7A 2AP6A 4RU9A 3JSMB 3C6TB 1R31A 4XDCA 4F2SA 1FKOA 3MGJA 5LJ3Y 1HMVA 2BANB 1JIHA 2J0QD 2OTJS 4HL9A 4RW6B 2MKHA 3T1YF 4DL4A 3HVWA 1KFSA 2M2BA 5D78A 1MSWD 4K5RA 1KLMB 3M6XA 3TUJC 4RUAA 4X4OA 2RU9A 5K8OA 2OLWA 4KBIA 2DNQA 4X4TA 5E3RA 3MUVP 5FJ4A 4I0WA 1N36F 2I0XA 2LXFA 1APSA 2FLLA 2A2DA 3EGZA 2EI5A 2R8IA 1ZTTA 4NWBA 3F44A 1LW0A 1UVLA 4NCAA 1UP1A 4L72B 3GFYA 1LXJA 1C1BA 3MM5B 5HLFA 1QM9A 1MWYA 4WU3A 4RLEA 4JYAF 1UVJA 2GFFA 3HHLC 1RWUA 4AL6A 2RQ4A 3DRRA 4DL0C 3OUYA 3BO2A 3FSIA 4OZ1A 4O44A 3EZUA 2IYGA 3MECB 3CJKA 3DM2A 1NJXA 2KFZA 1IM4A 2ASYA 5J2MB 1U1PA 3GYNA 3OR1B 4WK1A 3GFZA 3MDFA 3K59A 1RT6A 2MKIA 1UVNA 1Y5IB 1H0HB 2B6AB 3I31A 2ASLA 4K4XA 1XMOF 1TUVA 2E5LF 2ZBIA 2LCWA 2P9GA 1HARA 4E98A 1R8BA 2DH8A 2ATLA 4CO5A 2OD4A 2XMKA 5B0CA 3RTVA 1ELOA 4UW2A 3I0RA 1IBLF 1OPIA 4C3LA 3PW4A 4KTQA 1X9WA 3LP0B 1FKAF 5KOWA 4C8YA 1UA1A 1S1TA 2ZJQQ