1T05B

Hiv-1 reverse transcriptase crosslinked to template-primer with tenofovir-diphosphate bound as the incoming nucleotide substrate
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
427
structure length
414
Chain Sequence
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of HIV-1 RT-DNA complexes before and after incorporation of the anti-AIDS drug tenofovir
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/dna
molecule keywords oligonucleotide template
total genus 89
structure length 414
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1t05B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t05B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t05B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t05B03
3IS9A 1FKPB 4O3NA 5KFAA 3MFIA 3LAMA 1LW0A 4KKOB 4RZRA 3DYAA 2UUTA 4R0EA 3FFIB 4QWCA 1JLFA 2BANA 3T5JA 3IN5A 3JSMA 1QUVA 3V81A 3M9OB 4MKBA 2OPQA 1KLMB 2VG7B 3BQ1A 5C5JA 1IM4A 2OPQB 4Q45A 3QO9A 3GYNA 2AGQA 3DM2A 4JUZA 4IG0B 2QV6A 3V81B 2C22A 5F8NA 1N6QA 3KLIA 5KT3A 2XC9A 4RNNA 4J9QA 1UWBA 4PWDB 3ITHA 2XWYA 1C2PA 3D28A 4KSEB 5HLFA 3I5CA 4QW8A 2OPRB 4YR0A 1HYSA 5KFMA 2XI2A 4RNMA 1C1CB 5KG1A 1RT1A 5KFXA 4FS1A 1RYSA 4O4RA 2ZKUA 2WHOA 3CJ2A 1ZTTA 3PW7A 2AGOA 1DLOB 4NLYA 4RW9A 4IG3B 1N5YA 3PW2A 4IFYB 4RW4B 1S0MA 3OLBA 3KLFB 4U7CA 4RW6A 4ECUA 2C2DA 4NLGA 5FDLA 3OL7A 1S6PA 4R5PA 2AGPA 4NLVA 2UVUA 1RTIB 2J6UA 3G86A 3CJ4A 4IR1A 3C6TB 3DLEA 5KT2A 2WONB 4NZ0A 2B6AB 1S49A 4KBIA 1HMVA 4G1QA 2FVSA 4ICLB 2JC1A 1IKXA 3QZ8A 4G3IA 3KK1B 3H5YA 1JKHB 5KG6A 2QE5A 4DL3A 3LAKA 1IKYA 1FKOB 3QIPB 5HP1B 2FLPA 4Q0BA 2W8KA 5DLFA 4ICLA 5I3UB 3N6NA 4KE5A 3IRXA 1HNIA 1D0EA 4URSA 4EO6A 3KMSA 2R2TA 4GC6A 2BQUA 1S0NA 2FLLA 5HBMB 4NLSA 2ASDA 3CO9A 5DG7A 3I0RA 1JLCA 3CDWA 1MU2A 3RBEA 5C25A 3HVAA 4QWDA 1LW2A 3DLGA 2B5JB 2GC8A 3M8PB 2GIQA 2J6TA 3QLHA 3KNAA 4EYHB 2VA3A 4DL6A 4TN2A 1N6QB 3N6MA 4B3OA 5L1IA 1ZTWA 2IAJB 3E51A 3DM2B 4IRKA 2B5JA 1XR7A 1QE1A 3OL9A 4DG1A 3NBPA 4QWAA 2D3UA 3NAIA 3DRRB 3PJWA 2UVRA 4WE1B 5C24B 5D3GA 2ATLA 3FDSA 1ZETA 3Q8QB 3LP2B 5KFEA 3PW4A 3BREA 1GX5A 3RB6A 1FK9A 1NHUA 3DDKA 4RU9A 2AX0A 3KHHA 4IR9A 1DTTA 3H5SA 1JLBA 1S1UA 1S1XA 2IC3A 2RDJA 3RB0A 4RW4A 2RKIA 3BSOA 1TKXA 4DEZA 1DLOA 3OSNA 2R8GA 2HNZA 3MEEA 4Y2AA 4ED8A 3PW0A 5DLGA 2B6AA 2XGQA 3OSPA 2HNZB 4ECWA 2ZD1A 4Q0BB 3IG1A 4NLUA 5KFIA 4ECRA 3FFIA 2BQRA 5KFDA 4DL5A 5KG7A 2RDIA 1S9GB 3FRZA 4ED3A 2OPSA 3Q8RB 4JV1A 3KK1A 1KHVA 1BQNA 3VQSA 2WRMA 4NLTA 2YKMA 2O5DA 4ZPAA 1LW0B 2HMIA 2ASJA 2YKMB 1T05B 5J1EA 4O44A 4MFBB 1REVB 1S1VA 1HNIB 4MK8A 4ZHRA 3DLKA 4IG0A 4Y3CA 2J6SA 2XGPA 2HNYA 1S6QB 3KLHA 1S6QA 2FJXA 5C42B 4RW8A 4WZMA 3NAHA 4DL2A 3CWJA 3ISND 5HLFB 2V4QA 2W7OA 1RTHA 1DTQA 2FJVA 3FSIA 3GIJA 2GIRA 1T03B 2XCAA 3BQ2A 3KHGA 3GIIA 2HNDB 3DOLA 4XPEA 4ECTA 3I5AA 5DGAA 4RW7B 1C1CA 5EWGA 2FVRA 2R8HA 4FBTA 2VA2A 4RW7A 3MEDA 5CYMB 4NCGA 2E9RX 4I7FA 4IG3A 5F8GA 5F8HA 1K1SA 4KO0A 2IM3A 4WE1A 5C24A 1BQMB 1SH2A 3GV7B 2VG6A 1RA7A 2BE2A 4K4SA 4I2QB 5I42B 4I7FB 4LQ9A 4K50A 5DQGA 1VRTB 3KK3A 3V6DA 1SV5A 3TQ1A 4LQ3A 3BSAA 4G1QB 2IBKA 3DLEB 3T5KA 2FJWA 3TVKA 1BQNB 3BGRB 1TL3A 1SV5B 1TV6B 3PZPA 4NYZA 4WFXA 3GV5B 3NGDA 2JEFA 5EDWA 3KHRA 2OPSB 4KKOA 4ZPCA 1EP4B 1JLAA 4ED7A 4ED2A 5K14A 2C2EA 1KHWA 3IRXB 4H4OA 4YP3A 1HMVB 2YKNA 3M8QA 3RB4A 1REVA 1S1VB 1TKTB 3ICLA 3GIKA 1RT4A 4ECZA 5DGBA 1JLFB 1S10A 2F8EX 3MTKA 3EPIA 1FKOA 3V6KA 3DI6B 1N48A 1HQEA 2AWZA 1U09A 4PQUB 1T94A 4KFBA 2B43A 3QGIA 4ZMMA 4QPXA 2R2SA 3I0RB 1T05A 3UQSA 3M9MB 3G6YA 2HNDA 3DOLB 2W9AA 3ITHB 4K4ZA 5EWEA 4NLWA 4R8UB 5KT5A 1TKZA 2VG5B 4PQUA 5L9XA 3BSNA 4EBCA 5DG9A 5HROB 5C42A 1QE1B 3KK2B 3QO9B 1LWEB 1QAIA 3RBDA 5KFJA 2IAJA 2R2RA 4WXOA 5KFCA 1C1BB 2VG5A 3CJ5A 3OHAA 4ECXA 1VRUB 3BR9A 4KAIA 4B3OB 2FLNA 5J2PB 4RNFA 4IH5A 5JXSA 3G6XA 2BQ3A 1SUQB 3QYYA 1CSJA 5KFSA 2ILZA 3D5MA 3T19A 4J9MA 1S0OA 4TY8A 4WYWA 5EUHA 2WB4A 4TY8B 5L1JA 4YR3A 4I2QA 3KLEA 5EWFA 4WZQA 1SUQA 4IKAA 1N5YB 4ZVHA 3IG1B 5J2QA 3KJVB 2D7SA 4ECVA 3Q8SB 4X2BA 3CJ0A 3QGGA 4EEYA 1S1UB 1S1XB 2IC3B 3DRSA 2JC0A 3GQCA 1JLQB 2D41A 3OLAA 2BR0A 4K4VA 2IM1A 4MFBA 4ZP9A 2R2UA 5F8IA 5KFWA 3IS9B 4H4MA 3JSMB 4NLQA 4QWBA 4EO8A 3NMAA 3LALA 1GX6A 2YNFB 4H4MB 5KFVA 3PR5B 3IGVA 4FS2A 4IDKB 5F8LA 4J9LA 1LWCA 2W9BB 1TP7A 4Y34A 4YMEA 1S97A 4NLXA 4RNOA 1MMLA 3DLKB 5F8MA 1EETA 3DMJA 3KLGB 3PJXA 4Q8FA 4O44B 4R8UA 3MFHA 4ZHRB 2V0NA 3CVKA 5DQIA 2UVWA 2WOMB 1IKWB 3FQLA 2E9ZA 1R0AB 3MEDB 3M8PA 1LWEA 4EBEA 5KG0A 3H4DA 4Q44A 1RT6B 4NLOA 3PW5A 4K4TA 3I0SB 3MECB 1UWBB 4PWDA 4NRTA 4F4YA 2V9WA 1JLGA 5KFTA 2DPIA 4IQXA 3CJ3A 4TQSA 5KFUA 3H59A 4YQWA 1TVRA 2RF2A 1RTJB 5CYQA 3DRRA 2W9CB 4M95A 1K1QA 3KLVA 3KK3B 4DL4A 1WNEA 3H5XA 2ALZA 3PR4A 4U6PA 3DOKB 4J9PA 4JV0A 2IM2A 5DG8A 2E9TA 3DOKA 3E01B 2VG6B 1JLBB 2BRLA 3CDEA 5L1KA 4J9KA 4M94A 3T5LA 3SFGA 3BGRA 1BQMA 3BSCA 4Q43A 4J9OA 2YNGA 3HHKA 1HQUB 3QIDA 2AX1A 2V4RA 2RKIB 4O3RA 5KG4A 3MR6A 3ISNC 2OH2A 1HARA 1VRTA 3V6DB 4RW6B 2JEGA 4KB7A 4ED1A 2YNIB 4KV8A 1TL3B 3TAMA 1HQUA 4URQU 3M9NB 3EPGA 2ZD1B 5J2NB 1S1TB 3RB3A 4IOBA 3LP1B 3C6UA 2I5JB 4TLRA 2YKNB 3M8QB 5I3UA 5KFOA 1RT3A 4LSNA 2I5JA 4ZP7A 4QW9A 3GIMA 3GILA 5L1LA 4ECYA 1EETB 3DMJB 3KLGA 3KLHB 5J2NA 3HVWA 2CKWA 3CDUA 1SH3A 3T5HA 2HNYB 3PHEA 5KG5A 4NRUA 3DYAB 1LWCB 2W9BA 2ZE2A 2WTFA 4K4UA 5HBMA 1T03A 3UPFA 3OL8A 2I1RA 4NLDA 4KFBB 3BQ0A 3OHBA 4TXSA 4ECQA 3DI6A 1HQEB 3UDLA 1MU2B 1N56A 1R0AA 4MIBA 4TY9A 4WFZA 4ZPBA 3G6VA 3SFUA 5KT6A 1HPZA 4F4WA 4EYIB 3MEGB 3JYTB 1RTHB 1TKZB 4H54A 1JXLA 2R8KA 4KO0B 5KFGA 1HNVB 3LP0B 4O4GB 4PUOA 4NCGB 3MECA 5FDLB 1HYSB 2FVCA 4O3SA 4R5PB 1TQLA 4J9SA 4IFYA 2C2RA 4O3QA 3IGNA 1FK9B 4ECSA 5KT7A 4KHMA 2ASLA 1JX4A 3EZUA 3H5UA 2HWIA 5KFKA 1IKVB 3MR3A 4MK9A 4ZVEA 2FVQA 5KFYA 3DRPA 1S9GA 4LSLA 3DRSB 1EP4A 1JLAB 1RTDA 2UUWA 5JUMA 3Q8PB 1RT5A 4ID5B 5KFQA 3QZ7A 3V4IA 5J2QB 1TV6A 4IDKA 1S1WA 5J1EB 3MEEB 4DL7A 2BANB 1S1WB 4GC7A 2BRKA 2ZE2B 3KOAA 2R8IA 4ED6A 3V6JA 5C25B 1FKPA 1J5OB 4I2PA 2WOMA 3GV8B 5F8JA 1RT3B 4LSNB 2VG7A 4K4XA 3KLIB 1TKTA 4RW8B 4RNHA 3H4BA 3OL6A 1TL1B 5KFRA 4I2PB 4WXWA 2YNHB 2WK4A 3DLGB 1LWFA 5KFNA 4ZP8A 1RT6A 2DPJA 1XR6A 4IRDA 2FVPA 1TVRB 2RF2B 3T1AA 1RA6A 5KG2A 3H98A 5KFFA 4ZP6A 4O3OA 5KFZA 3UR0A 4FBUA 1I6JA 3LP2A 2D3ZA 1VRUA 4HKQA 1DTQB 2IM0A 3NKYA 2JEJA 3I0SA 5J2PA 3JYTA 4ZPDA 3LANA 1C1BA 1JLEA 4IFVA 3SI8A 3E01A 2UVVA 4J9RA 4MK7A 1RT2A 3KLFA 2BE2B 4O3PA 4DG1B 4ED0A 1RT7A 3HVTA 1RT2B 4Y2CA 4EBDA 1S9EB 2ILYA 3KJVA 3PVXA 3KMQA 4XO0A 1S48A 2XCPA 1S9EA 3C6TA 5KG3A 5DQHA 3KLEB 5KFLA 1C0TA 1D1UA 1RTIA 4KV8B 3TAMB 5J2MA 4MKAA 2C28A 2WCXA 4TYAA 1C0UA 3NL0A 1JKHA 4MH8A 1XR5A 4MIAA 3QGHA 4NLRA 1C0UB 3BJYA 2JLEA 4ZVFA 4YR2A 1C0TB 3MR5A 2YNGB 4RUAA 4ZVGA 1QAJA 1RYRA 1RT4B 1N4LA 4RUCA 2OPPB 3H40A 3FQKA 1OS5A 1RT5B 4ID5A 5KFHA 1RAJA 1S9FA 2YNIA 1IKYB 3QIPA 5HP1A 1S4FA 1J5OA 3I5BA 4IH6A 5F9NA 1KLMA 1SH0A 4WFYA 4J9NA 2R8JA 2OPPA 3N6LA 3C6UB 4F50A 2W8LA 5F9LA 4QWEA 2HMIB 4OL8A 3MF5A 1LW2B 2IJNA 3H2LA 4K4YA 2XI3A 4URGA 1LWFB 4KHRA 4WYLA 3RAQA 2OPRA 1TL1A 3MR2A 3NBPB 1JLCB 2HAIA 4NLPA 1JIHA 2YNHA 4Q8EA 1IKWA 1W25A 3LP0A 4O4GA 4PUOB 3MEGA 3HKWA 4TQRA 3KHLA 2W7PA 4F4XA 5KFPA 3QLHB 1HPZB 3CIZA 4JV2A 5KT4A 3KK2A 5CYMA 1DTTB 5HROA 1RT1B 2EC0A 1JLEB 4IFVB 2AU0A 2HWHA 1IKVA 1RTJA 5CYQB 2W9CA 4TYBA 2AQ4A 1JLGB 5T14A 5J2MB 1YVFA 1HNVA 2IJFA 5KFBA 5D3GB 3RAXA 4F4ZA 1S6PB 2IMWP 4K4WA 1T3NA 1NNDA 1RT7B 3HVTB 3V4IB 1JLQA 1RDRA 4LSLB 1RTDB 4HYKA 4IRCA 5I42A 3V6HA 4RW9B 1Z4UA 1NHVA 3DRPB 2IA6A 2JEIA 2CJQA 4IH7A 1IKXB 4XPCA 4H4OB 1S1TA 2YNFA 1TKXB 2WONA 3LP1A 5K14B
chains in the Genus database with same CATH superfamily
3VGUA 1U1LA 4A47A 4O3NA 1HL6A 4EGLA 1LW0A 2XWXA 4DCPB 1Y4ZB 1PGZA 4R0EA 3MPUB 2CQDA 3OR2A 3EXYA 3NNHA 1NXIA 2BANA 2FD2A 3MGJA 4CLYA 2FHKA 3JSMA 3DOMA 1QUVA 4WTOB 1R8AA 2CPZA 2EBGA 4QQBA 1NJZA 1ZH5A 4P73A 1M5OC 1KLMB 1YKWA 1JJCB 2W2MP 4LF9F 5BYQA 4DHVA 1IM4A 3HSDA 3P45B 1VQMS 2CPJA 2CZ9A 2DGQA 4DX5A 1N6QA 5DDQC 1PCAA 4OZNA 1Z2ZA 4QPTA 4LFAJ 5GADI 2P6SA 4FXVA 3FEZA 1SKRA 2NUHA 2QEXS 1HNWF 3I5CA 5HLFA 3D0HE 5C2CA 4DFPA 2I9SA 4YR0A 2LDIA 2XMUA 3J7AN 4RNMA 5CYJA 4C7QA 4FS1A 2DNYA 2NUUG 3J7Z5 4OX6A 1CJVB 4DV1J 4NE9C 2ZKUA 3BDEA 1ZTTA 3TJ9A 1NH8A 4LT6A 4ZVTB 3J81j 3FZ2A 2AGOA 1DLOB 2GJIA 2V69A 2UUAJ 2AJQA 1KQKA 4S0MA 3PW2A 4IFYB 4RW4B 4A8KA 2HHPA 2KYXA 3RZAA 4B08A 2L48A 3GE9A 5ETSA 4ZKAA 4X64F 3OLBA 2RT3A 3OL7A 4DFKA 1NEEA 2EBEA 3OFFA 4RR5A 3NNAA 4USTA 4DX7A 4OHWA 2DNRA 3QRRA 4YUDA 1Z2LA 4IR1A 4DR2F 2YPYA 3MMBA 2LP4A 1S49A 1EARA 4WU2A 4DQQA 4G1QA 4MT1A 1SL0A 1K9MT 3OT9A 4C0HA 3EWGA 2Z0GA 4Y00A 2QE5A 2OJ3A 1I3OB 4A8YA 4CM0A 1YRUA 1GTHA 2MKYA 5FD1A 4LFCF 4ICLA 2E1RA 3VCDA 4KE5A 4CO2A 1HNIA 3K5MA 1RYSA 2KFNA 5IC6B 2R2TA 4DU8A 4B9SA 2I38A 1GXUA 4RX6A 2FLLA 3CULA 5HBMB 4W90B 2ROGA 3CO9A 5DG7A 3JTNA 3FC9A 4HEA9 2UP1A 1JLCA 5T7LA 1MU2A 2W01A 5C25A 2HPUA 3GONA 2AEMA 4J90A 1U1NA 5DO2A 1SIWB 2XB2D 5F0WA 3KNAA 3Q0AA 4EYHB 3NY0A 2Y8WA 2QGFB 4LFBJ 1H6KX 1Z1ZA 1SB6A 2ZKTA 1HA1A 1WWHA 1RHKB 3IBFB 3THPA 3UN5A 4AD6A 5HMZA 1QE1A 5E5NA 3OTBA 4X62J 4JYAF 3Q8YA 5E3AA 2MSTA 3HHLC 3K5PA 3DRRB 3NAIA 4L75A 4WE1B 1AB8A 2ZH1A 2UVRA 3OFEA 1VC5A 4FF3A 2DGSA 2GQ2A 4ZDNA 3CC2S 1RZMA 2V2QA 2YWEA 3Q8QB 4J7CA 4YFUA 4IO9Q 1MROA 1AT1B 2LA4A 4OHVA 4FYYB 2R7SA 5IM0A 1OWXA 3O1LA 1R8BA 5M2UA 1PJ5A 1WG4A 2GO9A 3MCSA 1VQKS 1S1XA 3P8BB 2FC8A 4RW4A 4X65F 1S77D 2QSWA 4A8MP 1TKXA 3FK4A 1DLOA 2KT3A 1RWKB 1YJ7A 2B6AA 3GJRB 5H1SV 5DLGA 2VICA 2HNZB 2R7OA 4ZIVA 3NLCA 2QA2A 4ECRA 2JFKA 2BQRA 3BPDA 4CDIA 3PEHA 2DGWA 4DOZA 1S9GB 5K8MA 1N33J 4F8RA 2OPSA 2ZJPQ 2VFSA 4JV1A 5HL7Q 3BPSP 3KTQA 2BJ8A 4AT1B 3NOGA 2JH3A 5CHCB 2F9DA 2BMBA 4A8FA 3QJJA 2PEHA 4OZ3A 2CJYB 1YJRA 1REVB 1S1VA 1UFWA 3ZZUA 4CLZA 2XLKA 1WSRA 3LUYA 1D9AA 2YWKA 1SC4B 1ELOA 3I82A 1CS4B 2BKPA 2CPFA 2X1BA 4LIWA 1O5JA 3O2IA 1KQSR 4C8LA 2QRRA 2XMMA 1RWXB 2XSJB 3BBCA 3SYZA 2AMCB 3FEYB 1DTQA 4WIIA 2XHCA 3ET6A 3QT7A 2KM8B 3BQ2A 4OJGA 3KHGA 1EKRA 5ETRA 3NMRA 3BKUA 4NI2B 4XPEA 2X1GA 3I4HX 3WX4A 4Q5VA 4RW7B 2OP5A 2VA2A 4RW7A 2OEMA 1L3TA 3B4MA 2J9EA 2Y0BB 3ILLA 3JXOA 3FKBA 3NCRA 2E9RX 4IG3A 1GXTA 1X8DA 5A8WA 1LFPA 1UP1A 2IM3A 5B0AA 4WE1A 4UOHA 2GV1A 5DM7Q 1FJGJ 2M8HA 4PKDB 2O1PA 2ZBPA 1C4AA 2C3YA 2GMHA 2VKRA 3D6HB 4I2QB 3J81U 4CRJA 5BYRA 1Y5IB 2CJAA 4EWTA 5EGYA 4DMZA 4N76A 1SV5A 5EN1A 2PMWA 2IVYA 1NPKA 5A76A 2VB6A 4OI4A 4M5GA 3EZ5A 1QSSA 4CP5A 2FJWA 1X0FA 1WC1A 2IDLA 2VFUA 4OYWA 1A7GE 2F4VJ 1L3SA 1TL3A 1ZS6A 2PN6A 3UDCA 1NJWA 3R5JB 4NYZA 1WHYA 1HNXJ 3EDRB 3NGDA 3KHRA 3PXGa 4DV6J 3FNNA 2EI5A 4ED7A 2C2EA 1MMDA 1HI1A 4C98A 2DVIA 3QMQA 2HWTA 2YX1A 4JI2J 1HMVB 1IJFB 1FHTA 3ICLA 1FRLA 3B8HA 2KDOA 1S4EA 3HFVA 1AA1B 3M2UA 1OMSA 3KFWX 1S10A 3MTKA 3EPIA 1FKOA 5CZXA 4LBHA 3N79A 3POTB 2RMLA 4NYOA 2VC0A 5GVQA 1N5SA 1QJHA 2JX2A 4C0OC 3HHLA 4ZMMA 4QPXA 3PTWA 5F3ZA 3S8SA 4LRAA 4K4YA 2R2SA 2C42A 2Y3YA 1T3OA 4MMOA 3ITHB 3WX8A 4NLWA 2KB2A 3KG0A 5KT5A 1NJXA 4L76A 2F65A 1FEEA 4EBCA 2PFDA 1IBKJ 4AL5A 3BN4A 2VPXB 3DXSX 1NK6A 2XS5A 2DY9A 1ZM4A 1LWEB 4C6AA 1DY3A 3VAMA 2UUCF 2IAJA 2CG8A 5KFCA 5ETTA 4X66F 3U1MA 2DH8A 3IM9A 2FLNA 1HWIA 2NLWA 1CJVA 1P8GA 2V2VA 1ULRA 2GCFA 2K7KA 4RNFA 5CA5A 5LSRA 4WFBQ 4QU6A 3QYYA 2MHEA 1IR2A 2ILZA 3D6FB 3KUHA 3R27A 3H20A 3IC1A 3OXFA 3HM9A 3CCQS 1S0OA 3CJQA 1HHTP 4U95A 5IQ6A 1J27A 1GQEA 4TY8B 1CC7A 1KVKA 2LQ9A 2DNHA 4OQJA 5EWFA 2VPWB 1M1HA 2O67A 2ZZTA 3OV7A 4PG4A 3BF4A 4ZVHA 2YKAA 3KXDA 3N0VA 3IG1B 3US5A 5ETMA 4C0BA 1KRPA 1UEVA 1RBAA 1D9FA 1AYEA 1WDTA 1M5KC 4ECVA 4X2BA 3BGUA 1SC6A 3DCAA 3C15B 2YWWA 4PZVA 2XLIA 2JC0A 1VLOA 3B54A 3BBFA 1JLQB 2D41A 3OLAA 2ERRA 2ZBQA 1UVMA 2BZ2A 2B7CB 2F7VA 3CCWA 3FUYA 2OSRA 4M5NA 1MN9A 3IBCB 2CQHA 2VPYB 1WELA 4QOTA 3K59A 4LBIA 1GX6A 2N4DA 3G96A 4Y2MA 3MAAA 4FS2A 1DRZA 1OQ3A 5B08A 2IMOA 5F8LA 3MWBA 2BACA 2W9BB 3K5NA 4P75A 4N5SA 4CLFA 4RNOA 2XY7A 1S97A 1MMLA 4DR3F 3ET6B 1K47A 5F8MA 3THVA 4P74A 2HBZB 4O44B 1YBTA 1EHWA 2A0FB 5ETOA 2E1AA 2KJVA 1JXEA 2YVSA 3MFHA 1UWAA 2UVWA 2WOMB 2CQ4A 5LSOA 3PYDA 1IKWB 2E9ZA 3Q8UA 4GC6A 3IMQJ 1GXLA 3M8PA 2EC2A 3EGNA 4EMDA 4EBEA 3KJQB 4KC5A 1RT6B 5DZ6A 4Q44A 2LECA 4I0WA 2I2YA 3PW5A 1FWKA 3TUZC 4W98A 2BA9A 2MJUA 1UWBB 3DGPB 2OLWA 4F4YA 1S5ZA 2V9WA 1X5TA 2DPIA 3CJ3A 5E0OA 4GVBB 1XN9A 2UV8A 5M2PA 3H59A 4JB8B 2HK2A 4CT9A 1RTJB 2M9KA 3DRRA 3R2CJ 1K1QA 3H5XA 1OPZA 1X4DA 1SPBP 3KUEA 1PILA 2VQFF 4J9PA 5DG8A 2IM2A 1UW9A 2BRLA 2VG6B 2EFPA 4HHJA 4J9KA 2WVCA 1T9TA 2P9GA 3OR1B 4Q43A 2YNGA 1U2FA 4USJC 1HQUB 3VZIA 4B3RJ 2E5LF 4DV4F 1JNRB 3CE8A 5KG4A 2OH2A 4NOHA 2H65B 4UUWA 4DDFA 3F73A 3BKTA 1X9MA 2DNPA 1Y5NB 2LA6A 4ZOSA 3M9NB 1WTFA 3BS9A 3SV3A 4ED1A 2XYPB 2UUBF 3EPGA 2ZD1B 1N33F 2HFOA 1REGX 2MZTA 1NM2A 4C9DA 3C6UA 2G0JA 1B99A 4UQTA 5L1LA 1EETB 4ILLA 2BJ9A 5J2NA 2W2NP 4P2XA 5KAKA 2UUCJ 4OFZA 4AXJA 4BS2A 1RBLA 2YQ0A 4FXWA 2DO4A 4U9RA 5GAGU 3GFXA 3M6VA 4X4RA 1YJNS 1K0TA 4FNHA 2N82B 5DJBA 1UVJA 2ZBCA 3MM7A 2A2CA 4J9UE 1HLWA 4UZBA 2EFGA 4NLDA 1CQMA 4KFBB 4DPXA 3I55S 2XO7A 2QLFB 2QG9B 2X7IA 3THTA 3CF5Q 3ZXWA 4DV2F 3GR0A 3DI6A 4QIWD 4ECQA 3D67A 4OJ3A 2KZZA 2B4VA 1MU2B 1R3NA 2VFTA 3GWCA 2VQFJ 4WFZA 4I64A 1J2VA 1Q8BA 1RAAB 4I4BA 4YB5A 4EYIB 3JYTB 1RTHB 3NS7B 1MWZA 4CH1A 1CVJA 2EFQA 1X0PA 1J5EJ 3JQKA 5KFGA 2DR5A 3LP0B 4O4GB 1H2TZ 1HQ2A 3AJDA 3AT1B 1LV5A 5D0HA 4M5LA 1TZ0A 1H7WA 3JQMA 1RACB 1S6UA 1V5VA 2V8VA 3MCOA 3HXMA 4PEOA 4O3SA 1TQLA 4J9SA 2BJDA 1ZZFA 5HATA 4O3QA 1U25A 1WJ9A 4BHQA 5C7PA 4ECSA 1TUWA 2RQMA 4DF8A 2ASLA 1Q7YT 5IV4A 2YWHA 3D3BJ 2UU9J 3ENVA 4ELUA 4ZVEA 1T11A 5KFYA 3PO4A 1Y9OA 4NLGA 4A48A 1P1TA 2UUWA 3AOBA 1CC8A 3L9ZA 5JUMA 3Q8PB 3GFYA 2X3DA 5G0RB 1TUVA 4LBPA 3N4WA 2W25A 4PXEA 1RAGB 1VHIA 1XMOJ 4DV6F 4DL7A 2KKHA 5E41A 3SCIE 3MPDA 1HIYA 1S1WB 3QQCD 1U6BA 2BRKA 3B82A 2JLFA 1RHRB 2VU5A 3KOAA 4ZVUB 1VFJA 4ED6A 2OI2A 4RPFA 3V6JA 3CB4A 1B7YB 2DR6A 2MZJA 2IBOA 1VQLS 2ZH4A 1KOOA 1FVSA 3HHEA 3U27A 2GQCA 4HLBA 4NASA 1Q95G 3KLIB 2LXUA 2QSFA 3VAKA 3AXMA 1S7IA 2B3TB 2H5EA 1TL1B 1H7XA 5KFRA 4BC7A 2BDPA 3P6YC 2YNHB 1RISA 4WKYA 5KFNA 2FHJA 2L9WA 1RT6A 5B0BA 2DPJA 3P5BP 5GAHU 4DR1J 2FVPA 1TVRB 2RF2B 1H74A 1TR0A 1RA6A 2HS0A 3HLUA 4DPWA 4CLUA 3RYLA 2CG4A 1VRUA 2IM0A 3IR6B 4M1KA 4ZPDA 4OZ2A 1RUSA 1KFSA 1VR6A 1ZZNA 2DH9A 1VQNS 3ISZA 3R5BA 3KLFA 4F67A 1N54B 4M5HA 1RT7A 3HVTA 1FDAA 3MURP 3GU0A 3VAHA 4ED0A 2GGPA 4IUFA 4DV0J 3KJVA 4Z2XA 1FRXA 1SJ4P 1T9YA 1G6BA 2Q6BA 2V50A 4NA2A 3C6TA 3AODA 3KLEB 1D1UA 3I56S 2FZCB 2C28A 2DR9A 3PNIA 1EQ0A 4TYAA 1C0UA 4AFFA 1N36J 1JKHA 3W5YA 4NLRA 2G2YA 2ATCB 1C0UB 3BJYA 2JLEA 1WOPA 4P72A 1RWMB 2YH1A 1SJRA 1FD8A 4OYOA 4DR6F 4RUAA 4ZVGA 2MQQA 3PIOQ 1N4LA 3OJSA 1FE0A 2C2NA 2A3JA 1XTZA 2RUGA 1UVNA 2B4PA 1LWXA 2P2CB 2PE8A 2RHSB 4NMLA 1QTNB 1JXVA 4CIOA 2HHXA 1WG1A 2Y1LB 1J5OA 5B0FA 4IH6A 5F9NA 1RHQB 2XZTB 1O8BA 2R8JA 2UXCJ 2X1FA 1JK9B 5F9LA 1Q78A 3M8ZA 4ZIWA 4QWEA 2K2PA 1G2EA 3M1VA 4KGKA 1O51A 2MMYA 1LXJA 1VQYA 1W7WA 5GAEU 1APSA 4NEYA 4URGA 1IWGA 2D74B 2M88A 3G87A 2HAIA 3R6GB 4KPYA 2YNHA 3RU0A 1IKWA 1PYTA 2YX4A 1AXQA 5IC4B 1B64A 2CNLB 1OY6A 2EG1A 3KMSA 1F1BB 2R7UA 3FBCA 4ILMA 1FX4A 3TA1A 1WF1A 2ZOMA 3QWUA 4ZVSB 2V34A 4A46A 3QLHB 3P96A 1P6TA 5A8WB 2H5IB 3MR7A 3ZFVA 5HROA 5CYMA 2OD4A 2EC0A 1JLEB 1KDNA 2HWHA 1RTJA 3MXHP 5T14A 1T9VA 5J2MB 1YVFA 3DFEA 3GIRA 1X9SA 1KSPA 4WP3A 1AFJA 3W9JA 3BZQA 5KFBA 2CJBA 1X4BA 4AE5A 5CD4A 2IMWP 2XS2A 1RT7B 3HVTB 1JLQA 1ZYQA 4LSLB 1RTDB 2BBEA 3W5ZA 3CMAS 3V6HA 1SL2A 4LF8J 5CD4H 1UPPA 2F63A 1T8EA 5ETQA 1NHVA 3HFZB 3DRPB 4OHXA 1QAYA 3TEHB 3W8GA 1K8AT 1FJCA 1IKXB 3GSIA 5H9EK 3UFCX 4F3QA 2QL9B 2WONA 1X4HA 4OJ1A 4FPRA 3VVUA 4NXNJ 1FKPB 1WOOA 2G0CA 3LAMA 3ENWA 4F36A 3MFIA 3DYAA 2UUTA 4JI7F 1XNRJ 3FFIB 4OYIA 3M2VA 1XIQA 1B70B 2G13A 2ZM6J 3NEKA 3CJKB 3IP0A 3T5JA 4O0NA 3G71S 3AXKA 3C16B 4MKBA 1HBOA 1XMOF 2OPQA 2Z30B 4PG5A 4W92B 4PYAA 1X4CA 2HURA 1NDLA 2WVFA 2P9EA 2OPQB 4OI3A 3GYNA 3V2UC 2AGQA 1NKCA 4IG0B 2QV6A 3V81B 2WSFC 1BY9A 1B0TA 3R5CA 2M52A 1MN7A 3GLJA 4CLSA 3R2DJ 3R7SB 2FLOA 5HJYA 1BGXT 4EZ9A 1VYAA 1MLAA 4J9QA 4PWDB 2PMHA 4IQMA 4DR2J 1C2PA 3IM8A 4KSEB 4DCJB 4OYXA 3MUMP 2DJWA 1VBZA 1ROFA 1FRJA 1HW8A 2DY1A 2FJBB 1J5EF 5KG1A 1U2RA 2VH7A 3O6QA 4E98A 1NBEB 3J7ZT 3PX6A 4O4RA 2IHR1 1W2BR 2OEJA 1FNXH 2B8QA 3H90A 1N5TA 3M6WA 2WHOA 1IJEB 4Y28C 2HS3A 3PW7A 1UJ6A 2J9DE 3JTOA 3CSKA 2CXEA 4CLLA 1H2VZ 3DKDA 4E8UA 4C48A 1WC4A 4C2MA 2DO0A 2MKJA 4JI5F 3PCOB 2VFVA 3JSYA 2UU9F 2MKSA 3S6EA 4R5PA 2I0XA 3JS9A 1WHXA 2AGPA 4KIAA 3TP2A 1RTIB 4CTAB 2J6UA 3MMBB 2QLJB 4QYZK 1RWPB 5D0GA 1EX8A 2W24A 1IN0A 4XIUA 1NJYA 4JI5J 2GMJA 4NZ0A 2E1PA 3HVRA 4G3IA 2FVSA 2JC1A 4I6WA 1IKXA 3QZ8A 2KG0A 1PAEX 1UEUA 4PG8A 3H5YA 4BWJA 7AT1B 5JVHQ 2B8PA 2Y9HA 3GZ7A 2FDNA 3LAKA 2J9DA 2YBVA 3GB0A 1IKYA 5HP1B 4XK8C 5EX3A 3CO0P 5F8NA 3N6NA 4OZJA 2GW8A 4WK1A 3ZTQA 3M30A 1GK8A 3K8WA 2JVOA 3OR2B 2V63A 1FI4A 4NYPA 3OTOJ 4DR5J 3MZIA 3M2VB 1WKJA 3BYPA 3HVAA 2F4FA 3EVMA 4X4PA 2VJVA 2VOPA 1CJKA 4FPIA 2B9WA 3M8PB 2XS7A 2E66A 3UDEA 1VK8A 3QLHA 3NGSA 2J6TA 2PDAA 1FJ7A 3R1HA 3PX0A 2VC1A 1N6QB 2FIUA 3N6MA 2RNEA 2CNKB 4C3KA 2IAJB 2RJZA 3DM2B 3EDQB 1SJQA 5D77A 3OVBA 1HBUB 2DK2A 3UN2A 4DG1A 3NBPA 2R9LA 2HQDA 3HFKA 2BM0A 3AFGA 1Y11A 4DV3J 3QT5A 5C24B 4LF2A 1HNZJ 3W62A 2ATLA 2LKZA 3W2WA 2FY1A 1G7CB 3OR1A 1OIAA 3Q83A 1FK9A 4WJBA 1TTHB 2VBXA 1IWAA 4C8ZA 1DTTA 4OV1A 4CWBA 1T9XA 3LPEA 1JLBA 2IC3A 2DIUA 4ZN3A 3HT3A 3RB0A 3BSOA 1NKEA 1VI7A 2PC6A 4M5IA 4V1Ak 1VBXA 1NSQA 3OSNA 3C15A 2HNZA 4CH7A 3E3XA 2V8HA 2XGQA 2BEFA 2V8DA 3A3OB 4KQZA 4AL7A 1FDBA 4QR2A 1LK7A 3NRBA 2ZD1A 4DQRA 5KFIA 2CJKA 3FFIA 1KTVA 3KJNB 3PYGA 5AT1B 4DN0A 4DL5A 3TJAA 3BYRA 4PCQA 3I4PA 4ITSA 2ZJRQ 2ZH6A 1Q4RA 1SCJB 2WRMA 2YKMA 5DDOC 2HMIA 2A18A 3CGIA 5D4LA 2YKMB 2KU7A 3TJ8A 4RUBA 5J1EA 1E6YA 1NAQA 2EKNA 5L46A 4F7VA 3HK2A 1HNIB 1X5SA 4IG0A 2CQBA 1PC5A 4E0DA 2BM1A 2HNYA 1HWLA 4JOUA 5HN0A 1FWPA 3DLJA 3KLHA 2GVZB 2R7TA 3DC2A 2EK6A 4X65J 1YZ6A 1RHUB 4K5SA 3ISND 5HLFB 3AHPA 3VQTA 2XZWA 1RTHA 3MMCB 3GIJA 1FESA 1HI8A 2GIRA 2HLTA 2B0GA 2F4VF 4XTTA 3HSZA 1V3ZA 3I5AA 1MWQA 1H0HB 4LF6J 2E7XA 2CQ2A 5EWGA 2MZ1A 3CD0A 2R8HA 4C11B 1LK5A 4ERDA 1AW0A 3O5TB 2HVIA 4ZCMA 4R25A 1X4AA 5B09A 4DL0C 2CPEA 1K1SA 5F8GA 1BUXA 2LQBA 3OFGA 5C24A 2N3LA 1BQMB 2PO4A 3HULA 4NXMJ 4ID8A 2ASYA 1UKUA 3H8YA 4DUZF 2UUAF 2VG6A 1RA7A 2BE2A 1VC6A 4K4SA 3EX7B 5I42B 1SJ3P 1UFKA 2OMOA 2L41A 4DLEA 1VRTB 3KK3A 3V6DA 1AROP 2C3OA 2ZVSA 2CQ3A 4DCOB 2P5VA 4IOCQ 3TQ1A 4LQ3A 4G1QB 1QLNA 2IBKA 1U8WA 2JHEA 4BLGA 2QN6B 3T5KA 5CABA 2QMXA 2JDJA 4B9LA 2W4PA 3EGZA 1BQNB 1RBOB 2ZZNA 3GV5B 3FVYA 2HRUA 1PG5B 2KO1A 2BJEA 1RI7A 3HD1A 4ZPCA 1EP4B 1JLAA 7FDRA 1KHWA 1EJ7L 1PIEA 3F41A 1AZSB 5IT4A 1H38A 4H4OA 2EG2A 5BR8F 2XO6A 3PIPQ 2W1BA 1REVA 1S1VB 1G4CA 3SV4A 1Q8LA 2Q43A 1JLFB 1N5VA 2BJ3A 3ENAA 3HD2A 2E7WA 2ROEA 2RRBA 3GFZA 3V6KA 2DCLA 1U1QA 1WC3A 4LF6F 2QLXA 4UZCA 1HQEA 3QGIA 4YQWA 4KFBA 3RB6A 2Y8YA 3TARA 1T05A 3I0RB 4FYDA 2V2ZA 3G82B 3DOLB 1T9WA 3SQOP 2L9DA 3L4BC 2C2KB 3G82A 4R8UB 2FY8A 4PQUA 3BSNA 1O6XA 2FGOA 1RK8A 3MM9B 5K8NA 3G4SS 2JVRA 1I1GA 5HROB 3TRGA 1RKJA 3QO9B 1NK0A 1D8YA 3GG1A 1SKUB 2VFRA 4P71A 3WIUA 4WXOA 2K3KA 2NXJA 4W4MA 2VG5A 3CJ5A 1MNEA 4ECXA 1RHMB 4KAIA 5JMNA 4B3OB 3CIMA 5HQMA 4DV5F 5J2PB 2ZH2A 1NB7A 5JXSA 4PPZA 5KFSA 3PYEA 2MKKA 2Q66A 3T19A 4C11A 4TY8A 4YN3B 3A3PB 2KI2A 1NSPA 2WB4A 4DJBA 2DGXA 5L1JA 1XWLA 2H51B 4I2QA 3KLEA 3GSDA 4ZPVR 1SUQA 3ILOA 4K8RA 2A1BA 4IKAA 4LRFA 5THWA 3HPOA 1VHFA 3C2PA 4B3RF 3PKYA 3VAIA 4FKXA 1NJIT 3M8WA 3QWPA 3PO5A 2VDIA 1HW9A 3MAHA 3QGGA 4EEYA 1X31C 4V19J 1S1UB 5K5MA 2KN4A 4UUXA 3AD8C 3NS6A 1TAQA 1WKKA 3NWRA 3JB9k 4PRFA 2BE7D 2U1AA 5SUHA 5IWAJ 4KJIA 4HT7A 2IM1A 4ZP9A 1S99A 1ZBTA 3AB4B 2R2UA 2QYGA 3AQOA 3CJKA 3RJMB 4H4MA 2CQ1A 4HR2A 4NLQA 5F8IA 5KFWA 4EO8A 3MMAA 5KFVA 3NMAA 4H4MB 1A6LA 2AJFE 5LT5A 4IDKB 1TFWA 4J9LA 2JNJA 1LWCA 1VQ7S 1GMWD 1YI2S 1UJ5A 5A2QU 3W65A 3OBIA 2HS4A 3C66A 4NLXA 3TA0A 2KL8A 1RWUA 2CWKA 2FHJD 3DLKB 5LMUJ 1JJHA 1EETA 3PJXA 6FD1A 1NSKL 1Y3KA 4Q8FA 4ES2A 3C16A 2EFOA 4ZHRB 2DNOA 3CVKA 1IR0A 3SCLE 2HZAA 1CG2A 4LR9A 1R0AB 2PMZD 3CCVS 3P3DA 4HDHA 4JV5J 2HHSA 2QIFA 1LWEA 3IAM9 3LW5C 1FE4A 2RAQA 4WU3A 4F2RA 1KKHA 4NLOA 5D15A 5AXLA 2B51A 4A8XA 1LOUA 4AQYJ 4OX7A 3IRWP 4MIWA 1QVFR 2G2ZA 2Z4PA 3FMWA 4USKA 4TQSA 4HH1A 5KFUA 5SZTA 2AYMA 1G1XA 2OFGX 2VZ9A 2W9CB 4M95A 3KLVA 4DL4A 2E5GA 3AOCA 4RL1A 4U6PA 4QR0A 2OELA 2E9TA 3E01B 3FSYA 1JLBB 4P2FA 5L1KA 1L3VA 4YEAA 2IYIA 2L3MA 2ZH7A 2QO3A 2C3UA 3EGWB 1RE1B 1RWOB 3RUBL 2AX1A 5F3TA 2JOQA 1N36F 2QA4S 2FHMA 1N0UA 3ZNUA 2ZJQQ 4EZ6A 1CLFA 3A4TA 3T9NA 2FHOB 2J7WA 2JEGA 1U45A 4PPDA 5FLXU 1L3KA 2IY5B 3Q8VA 4F3MA 3U1NA 1HBNA 4TLRA 1UCNA 2VL1A 2OUGA 5I3UA 3MEKA 5M2RA 3ZO7A 1RT3A 4LSNA 1QAXA 3N28A 4JI0F 4X4SA 4QW9A 3M8YA 2IYGA 3GIMA 3DMJB 3KLGA 2E29A 3HVWA 3VV2B 2XY6A 2KZMA 2CKWA 1SH3A 2XYGB 3T5HA 3DLLQ 2NSCA 3KNGA 3PHEA 5KG5A 1VQ5S 3T1YJ 3CJRA 4TLQA 2W9BA 2ZE2A 2WTFA 4K4UA 5HBMA 1T03A 5FIIA 1Q8IA 3OL8A 2HKEA 1U7LA 2I1RA 2O3DA 2VBYA 1S0VA 2XYHB 2M3DA 1NK9A 2BKNA 4I69A 4N8OA 3UDLA 4U8VA 4UY8T 4JV5F 1NB2A 3FMBA 4K5RA 1R0AA 4MIBA 4TY9A 4QYRA 4UF4A 4DQPA 3HF5A 1GH8A 3C14B 3L7PA 4ZPTR 3I96A 2WBRA 4X66J 4F4WA 2UXDJ 1BC6A 1WI8A 4H54A 2Z58B 3GJQB 4M5DB 1JXLA 1SJFA 1HNVB 3ZZOA 1XNQF 2XEXA 3QATA 3WC2A 4K50A 4WKRA 3IWXA 4EUVA 1WDDA 3CCMS 3MM8A 1VLYA 1K0VA 2M7SA 1W26A 1UEKA 1HYSB 2GA7A 3NOCA 2FVCA 4GO5X 2FPHX 4R5PB 4LRCA 5CCMA 5LOQA 3OJUA 3DNCA 3IGNA 5D4NA 2DR8A 1VDHA 2C2ZB 3LTOA 4KHMA 5D0EA 2RQ4A 5L39A 2R7VA 1NZ8A 2HWIA 3H5UA 1ZPVA 1IKVB 2HQ3A 1TUGB 1X4EA 1KBRA 2V67A 3CDAA 4P10A 1FTCA 1R8CA 3ILIA 5C2GA 3FJ2A 3PYFA 4LSLA 1RTDA 1LXNA 4ID5B 2CJXB 3QZ7A 3V4IA 1NDPA 1YX2A 3RBXA 5J2QB 1TV6A 5KTQA 3QSYB 4IDKA 3TEGA 1S1WA 5J1EB 3MEEB 1E6YB 1VGYA 3VVTA 3CPWR 1ZAXA 1N88A 4WWSA 1FF2A 2D3OR 3IWNC 3NCPA 2ZE2B 2AT1B 1NK5A 1HKAA 1VQ9S 4G1PA 2A6OA 2JZ5A 3GYGA 5C25B 3IWLA 2H4WB 1R43A 3MD3A 3POTA 2QMWA 3CD7A 2WOMA 4ZS6A 1RT3B 4LSNB 2UXDF 4CO3A 3D68A 1YJWS 1TKTA 4RW8B 2CIMA 2GIFA 2JJ4D 3C14A 3PFEA 4I2PB 1WHVA 2OTLS 2WK4A 1U0HB 3DLGB 2B9EA 2DNGA 2HFUA 5IT9U 2LMIA 4ZP8A 3K7RA 2X1AA 3TI0A 5H9FK 1XR6A 2HQCA 3FCHA 2EFVA 4L72B 5KG2A 1IBLJ 3P4UB 4ZP6A 4O3OA 3UR0A 4FBUA 5GMEA 3T1YF 2ZNYA 1UMJA 5J2PA 3JYTA 1C1BA 4IFVA 1TL7A 2XTJP 3E01A 1NK7A 2UVVA 4K59A 4J9RA 3JTPA 4V19X 4WCEQ 2COLA 3K2YA 5HQLA 1N0VC 2QL7B 1U6ZA 2YXLA 3MCMA 4TU8A 4EBDA 1WC6A 1F3FA 1VC0A 1Q53A 1ITPA 3KJFB 4LRDA 3KMQA 2ZUAA 4ZVQB 1FCAA 1D09B 3D1QA 1UA1A 1SIZA 3M6XA 3OTCA 5DQHA 3R1LA 5KFLA 1C0TA 2QFIA 1RTIA 4CTAA 5J2MA 4DBQA 5DZ7A 2HZVA 4JI4J 1RAEB 2D9OA 3WHIA 4NWBA 2CQIA 4MIAA 5D0RA 1XNQJ 2LYVA 3AOAA 4ZVFA 4Y65A 4DN9A 4DR1F 3B6BA 5ETNA 2KT5A 3WIVA 5K20B 4OI0A 2IVFB 4EFAC 4WP8A 1HD1A 2BYCA 1WC0A 2BJ1A 5IWAF 1WG5A 3DHXA 3H40A 4C8YA 4ID5A 1FO1A 4ANEA 5AE3A 4KGXB 9ATCB 1RAJA 1V6HA 1IKYB 5HP1A 4CH0S 1FXLA 3EGVA 3FCVA 3I5BA 2RILA 2VUGA 4C97A 1FFSB 1OY8A 2L9NA 4DR7J 2OPPA 2HHUA 3C6UB 4WPAA 1FXRA 1SQEA 2U2FA 3X3UA 3H7HB 2R7QA 3IA0A 2K3IA 2ADCA 1CJKB 5L38A 3HHLB 1R7IA 1KVJA 2XY5A 1LFWA 4UOGA 2MKHA 4PAAA 2GNKA 1U24A 2OPRA 1TL1A 2EK1A 4F3OA 1E6VA 2POKA 1HR0F 2E5LJ 2MYFA 1IBMF 2W2OP 4AL6A 2F9JA 3LP0A 4O4GA 1NPRA 4USVA 3N9UC 3HKWA 1UZDA 4X4TA 2XQCA 1PO6A 3D1HA 4F0KA 1QUPA 3KWMA 3L7UA 4PABA 3CIZA 5E3QA 3BO2A 1GMWA 3QFWA 3VZHA 1NRKA 3MPVA 1OYEA 5KT4A 3KK2A 5GMDA 1TK8A 1RT1B 2LQJA 4PXDA 2XNQA 4FN5A 2HVHA 5D8HB 4FYVB 3TUIC 4X4QA 1IKVA 2NYIA 2UZAA 2W9CA 4TYBA 1U6FA 1JLGB 2DNKA 2OD6A 1S57A 4P7TA 1CJTB 2DEIA 5D3GB 1GAOA 2HK3A 2J9CA 4L6V3 2G4BA 1UL3A 4K4WA 2DBBA 1T3NA 1NO8A 4M5KA 3V4IB 2HRYA 3Q22A 2DHGA 1G3OA 1ICEB 4YDDB 4DQSA 3DLBA 4IRCA 1YJ9S 4RW9B 1F6TA 4DI6A 4KRWA 4DZ6A 1UFLA 1I94J 4D3HA 3QT8A 1MG7A 4YS2A 4CLTA 4XDCA 4MYTA 3H25A 4ZVPB 4XPCA 2MQMA 3AD7C 4NA1A 4U7UK 2RDDA 3D4JA 1AFIA 5K14B 3OTEA 3IS9A 4PG7A 2OEKA 3F0NA 4OYAA 1N32F 5KFAA 2OO4A 4LUBA 4DX6A 2CQPA 2XMTA 1SC3B 2AP6A 3H0PA 5KOWA 3NCQA 1RCXB 4A8SA 2EVZA 4QWCA 1JLFA 4DPYA 2H5JB 3HJVA 1VQ8S 4DZDA 2ZDPA 4RBTA 4U67Q 1YBAA 3IN5A 1NUEA 2XSJA 1OPIA 2VBZA 4B9UA 2BW7A 2HG4A 2J0XA 2KFYA 2QTWA 3CC4S 3K5LA 3OQ2A 2VG7B 3IR7B 5C5JA 4JI1F 4Q45A 3QO9A 2ZBRA 3DM2A 1RCOB 2DGVA 4JUZA 1U2CA 1Y7PA 3A13A 3JAMY 2C22A 1F0XA 3KLIA 2KRRA 5HMYA 5KT3A 3T3FA 2XC9A 1K73T 4LF7J 3MMCA 4RNNA 3PJ9A 4J5OA 2BOAA 1BWVA 2XWYA 5GAHI 2SXLA 1VRQC 2B4UA 2MEWA 3D28A 4L73A 3W2WB 2OPRB 3AQPA 5KFMA 1C1CB 4I67A 1Q79A 2PGCA 3T1HJ 1BHNA 2GZOA 2QC3A 1IUJA 4DV7J 3M32B 5U47A 1F2GA 1HBUA 4Z7CA 2GAHC 5BYSA 3CJ2A 4DV0F 4Q2LA 2J7KA 4DUZJ 2PA3A 2V2KA 3CUNA 1HR0J 4Y0FA 4NLYA 4RW9A 2HHVA 2EWHA 9RUBA 1S0MA 2C2DA 3D3CJ 1ZA1B 4RW6A 2PD1A 2CDRB 5FDLA 4H4KC 3KYLA 3GYXB 1TFYA 3ZTOA 2FGCA 4TKTA 2GAGC 2X51A 1CJTA 2HRTA 2AEFA 1CEZA 3G86A 3NGKA 3HHNB 3CJ4A 3C6TB 3WDOA 2AF6A 1D3WA 3L09A 2IPOB 4KBIA 3CCLS 1DZ5A 1HMVA 2J8SA 4ICLB 4Y6IA 3KUGA 4DU7A 1VBKA 2B9YA 2GHVC 3VALA 2C3PA 2MLXA 1Q0NA 3MM5A 5KG6A 1S72S 1TK5A 2AJ0A 1QSLA 4G6VB 1Y10A 3FGVA 4DFJA 2H9ZA 3MM5B 3BV8A 3W2VA 2NCKL 4ZJQA 2W8KA 5DLFA 1RTZA 3KDNA 2DR7A 3GCXP 1D0EA 1R8HA 1UAWA 1ZM9A 4URSA 4OHZA 3R5DA 4QZVB 1FNMA 3HKZD 2Y1IA 3OW2R 1VQ4S 2OIHA 4OMFG 3CDWA 3GFHA 1VJWA 3AB2B 4CNYA 5A8KA 3RBEA 4QWDA 5AE2A 4Z7YA 4B3TJ 1LW2A 5CQGA 1LNQA 3MDFA 2CPXA 1EZZB 2BABA 3NXZA 1N32J 2CZ4A 1YDLA 2LCWA 4OLOA 5G4DA 3TVZA 3SZ2A 2M70A 3M1VB 4KHPF 4NA3A 4TN2A 2JL9A 4WF9Q 2ZC3A 1YHQS 1YITS 1ZTWA 2NQPA 3E51A 1R0CB 3FBEA 4PR6A 4UQGA 2MB0B 2B5JA 4IRKA 2HVEA 4KH1B 1QTMA 1JJ4A 3BGFA 3M6UA 4QWAA 1UVLA 2JWNA 3BM7A 1SBRA 1UPMB 2D3UA 2XULA 1VMBA 3T9ZA 4FXDA 3AAWB 3FDSA 4KH0B 3J7YI 2NS1B 3T6BA 4HI2A 2KG1A 3CJSA 5K8OA 3BREA 2HGMA 2N4CA 1NHUA 5DM6Q 1WACA 1X5PA 2P6TA 1RU1A 1VISA 2W4DA 3Q8RB 3DLHA 3ILJA 4IR9A 5A0YA 3RAMA 3V4MA 3D6MB 2G1DA 3SSRA 4OJHA 2FTRA 2GHWA 3UO0A 2MZQA 3UD4P 2AJ2A 3OXLA 2H54B 3MEEA 4Y2AA 3PW0A 3UE2A 3LQVA 2DIVA 2KXHA 1AUDA 3OSPA 1IQTA 2RB7A 1QDUB 3EUNA 1D8ZA 4C8KA 1RWWB 4NLUA 4OI2A 5KFDA 2M8DB 2D69A 4I1TA 2CUYA 4HACA 3IO1A 5KG7A 2KHCA 4NX9A 3Q23A 3CNQP 5LMNJ 3ZZRA 1WKLA 1M1GA 2E1MC 1BQNA 1WOSA 4ZA1A 3VQSA 4F26A 4M5MA 2JFDA 3TZYA 2O5DA 4WFAQ 3I6PA 2DNMA 2ASJA 2ZM6F 2HHTA 4KR0B 1T05B 5K9FA 2XMVA 4N47A 4PXCA 4WBFA 2B7BB 3SEOA 2FYXA 3DLKA 4K0KF 1AZSA 1PBUA 1U0HA 2XGPA 3DDNA 1U47A 2YKPA 5IS2A 2J6SA 2LU2A 1FXDA 1FDNA 2CWXA 5DRKA 4DPOA 4F4AA 5E3RA 3C8YA 2FJXA 4RW8A 2HZCA 3BO4A 3NAHA 1KNZA 3G2XA 2A2DA 2BV3A 3CWJA 3DRYA 5ETPA 2FJVA 3FSIA 3Q2TC 4N56A 2DXEA 3EMTA 2XCAA 4GKJF 4ANCA 3LO3A 2EW9A 3DOLA 2CDQA 4X4OA 3GIIA 5A8RB 4ETXA 4RKUC 1C1CA 4CI0B 4FBTA 3PACA 4GMKA 1QY7A 3MEDA 4OV6A 5CYMB 3OVSA 4NCGA 3ONQA 3S7RA 5LJ3Y 2XLJA 2R3VA 2YX7A 1FFGB 2DNZA 2E5IA 1SH2A 2QJ3A 3EXCX 2AYEA 2ZWOA 1RB0A 3KG4A 5BJRA 4I7FB 1H3DA 3LF0A 3QGPA 4DPUA 4LF5J 4KHPJ 1IM6A 2CYYA 5DQGA 3BEGB 2MQOA 1T95A 5A0YB 2KVQE 5CCLA 2IFXA 3T1HF 3BH6B 1PAUB 3PRDA 3UD3P 3DLEB 1WEYA 2ZDOA 2AW0A 1ZAWA 2DRDA 4IYQA 5E3PA 3TVKA 1RGVA 2QLWA 4DPTA 1SV5B 4DS5A 1TV6B 2VASA 3PZPA 4WFXA 3J7A1 2ZZMA 1YG0A 3GCWP 1JJ2R 1TK0A 3BR8A 5EDWA 2OPSB 3D54A 1TU0B 1YRXA 1NCLA 4BBYA 4K2JA 1FFWB 4RO0A 1U26A 1DAXA 5K14A 4P6QA 2B4OA 4BC9A 4ED2A 4OI6A 3M8QA 3WBZA 4WK3A 3RB4A 1TKTB 3G8QA 4ECZA 1RT4A 5DGBA 1X7VA 5LXRA 3QBCA 3PV8A 2F8EX 1FDDA 1H72C 2OSQA 4DR5F 2LEBA 1IBKF 1M5PC 1N48A 2AWZA 1U09A 1UTAA 2B43A 4YHHJ 3TNVA 3UQSA 2ZNZA 4K4ZA 2HNDA 5HJXA 1DQAA 3MUTP 3VAFA 3UNGC 5EWEA 4FZVA 5LMNF 2UXCF 1HBMA 1RJJA 1S59A 4ES1A 1TKZA 4G65A 2VG5B 4GVLA 5L9XA 4C8MA 3BDPA 4F4KA 4DSJA 3KK2B 5C42A 1P1LA 1QAIA 4DR3J 3RBDA 1FA0A 2R2RA 2IRXA 3R6LB 1C1BB 3RW6A 3ULHA 4OI1A 1OY9A 3BB5A 2HVDA 3M32A 4CO1A 2GS8A 3TQEA 4GVBA 2KM8C 1QVGR 1DFDA 4IH5A 2V4JB 3U7JA 4DV7F 1SUQB 2BQ3A 2OHDA 4J9MA 3D5MA 1U02A 4LR7A 4ELTA 3CJ8A 4WYWA 5EUHA 1RU2A 3NP5A 8AT1B 1L3UA 2VOOA 2DXFA 1Q1KA 1SVDA 2ABYA 3TZZA 3OVAA 3DGVA 4F04B 1VBYA 4WZQA 1GMUA 3R97A 2CQ0A 2GO8A 2D7SA 1FEHA 3Q8SB 2A10A 3CDBA 3CJ0A 2DITA 3PDNA 2UXBJ 2OMLA 1S1XB 2GVDA 3AJ1A 4C8NA 3W5XA 4HHHA 5MAOA 4RBUA 4ZCIA 2V68A 3G6ES 4AQYF 3JAMU 4K4VA 5L9NA 3IS9B 4HL9A 4LVNP 4GKJJ 3LALA 1V3RA 1A0OB 2MY8A 2AJ1A 1DHMA 4DXLA 3PRVA 3UCUP 4WIQA 1BQXA 3H2VE 3PEJA 1NHKL 3A3NB 3U1LA 5IZHA 2I8EA 2VV5A 2HLUA 4ZJLA 2KXNB 4YMEA 2DHSA 2Z2LA 3EZOA 2FZKB 4NXNF 3DMJA 3KLGB 2F5GA 3HT0A 4L3NA 4OZ5A 4CLKA 4C8OA 2ZEJA 3M8SA 2V0NA 3C19A 4UTGA 1P9YA 1X4FA 3FQLA 3AY0A 1WI6A 5KG0A 3H4DA 2FQQB 3CCES 2WSCC 1U8SA 4U96A 3MM9A 5L8RC 4K4TA 2ACYA 2AV5A 3A1YG 4NRTA 4PWDA 2BX6A 3HJFA 1JLGA 5KFTA 4NMXA 3IXQA 4QIGA 4JI8J 2ZHBA 2F1FA 1UZHA 2J76E 5CYQA 2LQ5A 4JI0J 3KK3B 2MZRA 4G1IA 2MLZA 1R31A 2WVDA 3PR4A 4USUA 2ZC4A 4JV0A 4F02A 3DOKA 3CDEA 2R7RA 5LMUF 4M94A 2MSSA 3UW1A 1BQMA 2C3MA 3BSCA 3TUJC 2IDEA 4J9OA 2R7XA 3HHKA 3T6JA 4U8YA 4J9VA 2MQLA 1YQHA 2ACMA 3P49B 1WD6A 2RRNA 3TAQA 2C2MB 4A4JA 4ZCKA 3VTIA 4B9TA 4RW6B 2CQCA 2XSFA 4KB7A 3ZTPA 2YNIB 3TAMA 2ZBIA 4URQU 1HQUA 4DL6A 2KYZA 4BCAA 3PRBA 5J2NB 1RABB 2B9XA 3N5FA 5CH7B 2HGNA 3WC0A 3LP1B 5B0CA 1V5IB 3M8QB 4DV3F 4OLPA 2OAUA 4ZP7A 4ECYA 1P27B 3I9ZA 1NMEB 3W2VB 2DXDA 3KLHB 1NPPA 2GVZA 2ZHAA 3CDUA 1RWNB 3BN7A 4EU0A 2HNYB 5LSLA 4K0KJ 1ZA2B 4NRUA 3DYAB 1LWCB 1NDCA 2FB0A 1VQSA 3Q86A 4Z37A 3UPFA 3G8TA 2XZDB 3EE3A 1VK3A 3FRYA 3GG0A 1ZM2A 4TXSA 1H98A 4LRBA 3DU5A 3TZWA 1WSVA 4FP9A 1FX2A 4AYBD 1GTEA 1SC1B 2Z56B 4I68A 5A8KB 1N56A 3CJTA 4UY85 4X4NA 4LR8A 4NEZA 1I51B 3SFUA 2H3EB 5KT6A 1S0NA 3MEGB 1TL4A 1X4GA 2K1RA 4OYZA 4TU9A 3ZZPA 4MAKA 5D78A 4RWWA 2HFNA 4PUOA 2P8IA 2ZHOA 4NCGB 4DUTA 1IXKA 1VCTA 4I56A 1RP5A 2C1EB 3OUYB 2V5HG 2F40A 2RVJA 3OTDA 1FK9B 2ADBA 1L5UA 2V94A 2RS2A 1JX4A 4CNZA 1R0BG 2CPIA 2AZ3A 1U4BA 3TANA 2MLYA 1AUSL 2DRBA 1FJGF 4ZCLA 1KEKA 3DRPA 2HBYB 1FNOA 1EP4A 1JLAB 2IIHA 2XHWA 3CW2C 4LREA 1RT5A 4ELVA 3VAJA 3OXGA 4CO0A 2ZOGA 4KPCA 1WEXA 2RHQB 3GP9A 4DSLA 1VIXA 1WF0A 2DCUB 3UR3C 1XC9A 2AYGA 1IBLF 4OZ0A 2QA1A 2YKOA 2BANB 4X4UA 1VOMA 4YDXA 5HK4A 1U1RA 4ER8A 2KFZA 2R8IA 3W60A 1R27B 3Q2SC 4KYZA 4PXBA 1TMMA 1J5OB 5IXUA 5LM7E 4I2PA 2ZFHA 3D9BA 3GV8B 2QL5B 2HQFA 2L08A 2VG7A 1HHQA 4FF4A 1A9NB 3K17A 1BD6A 4K4XA 3W8PA 4DFMA 3M30B 4JI2F 4ES3A 3LA0A 5IOLA 2KTQA 5D4OA 1VIOA 4Q7AA 4DSFA 4K7QA 3OL6A 4JI1J 3TAPA 1U1OA 2PFFB 3RBZA 3PY8A 5B7WA 2DKOB 1LWFA 2VPZB 3QSIA 3ZTRA 5HSPA 2E44A 2DD8S 4IRDA 4NZ6A 5KFFA 3H98A 3C3LA 5KFZA 1SKSA 5HAOA 2FJEB 1I6JA 1PJ6A 2YTCA 3ZZTA 2GMLA 2JEJA 3I0SA 4M63A 3LANA 3L3CA 1ACMB 3MM8B 4ZPWR 3ZNJ1 1GNKA 3RTVA 3R7NB 3DRXA 4H4KA 2DHHA 3EM1A 4Y2CA 1S9EB 2LXIA 2ILYA 3AD9C 4J91A 4XO0A 1S48A 3BO3A 2XCPA 1S9EA 2CVIA 2J8AA 2ZWPA 3EICA 5KG3A 4HDGA 4DR6J 2RQKA 1TELA 4MKAA 4KGVB 3TAMB 2EKYA 4OHYA 1XERA 3IBWA 5FLXY 3ZZZA 4MH8A 4IOAQ 1BMQB 1TMJA 3QGHA 2EXUA 5E33A 5HVGA 5AJ3J 4B9VA 2H4YB 4YR2A 5ETVA 2MDAA 1YJTA 3MMAB 5IV3A 3TZXA 2YNGB 1RLCL 5KOXA 2F8HA 1FTRA 2W7AA 1QAJA 3CMQA 1HWUA 1RT4B 2J5AA 1HHSA 1FVQA 3B78A 3JSBA 2OPPB 4LF7F 2Z2MA 3FQKA 5HVHA 2NREA 2HIQA 1RT5B 1DURA 5AXKA 1BLUA 3K57A 3SIPB 1GMVA 6AT1B 1PKUA 1S9FA 2BQUA 1IBCB 1S4FA 2DGOA 3W1YC 1CQNA 1RLDA 1SH0A 3EJMA 4J9NA 2RU3A 4LFCJ 3N6LA 1S6OA 1HBNB 5K8PA 2PEBA 2VODA 3RRHA 4F50A 2W8LA 2GHPA 2ROPA 2RE1A 3MF5A 2DNNA 3RRKA 2HHWA 4UW2A 2IJNA 2EFNA 1EKSA 2VD3A 3D1OA 4JI7J 4B3TF 2XI3A 2D1CA 3R9LA 4WYLA 3SQGA 1PSDA 2Y0SD 3O44A 3W9IA 4X4VA 1HD0A 3MR2A 4O23A 3NBPB 1JLCB 4ATNA 5FJ4A 1JIHA 3AH6A 4Q8EA 3M8RA 1W25A 1YTYA 3MEGA 3EVWA 4HHUA 4TQRA 3KHLA 4LF1A 4GRSA 2W7PA 1VJQA 4NXMF 1JQGA 1MWYA 3K5OA 3NS5A 3W66A 4CYUB 5KFPA 4X62F 1HPZB 2DYAA 4CLWA 2IJRA 4YB1P 1NSAA 2NZ4A 3SSSA 4JI6J 1EAYC 2MXYA 3R5GA 4ED3A 4IFVB 1TL7B 2HBRB 4ED5A 2WB1D 3QFHA 5CYQB 1DQ9A 4OZ1A 4ALZA 2HHHJ 2QLBB 2ZH8A 2KXFA 2IJFA 3TVYA 5DDPC 1M1KT 2NXEA 2E5JA 2ZVIA 4F4ZA 1S6PB 2NXNA 3ETMA 2GQQA 1OSCA 3HX9A 1IR1A 1Y00A 5HMXA 4LF9J 1V3SA 3GJSB 4HYKA 3RRGA 5E3CA 5I42A 3SCJE 3GTYX 1Z4UA 1WF2A 2LVWA 4BDPA 4B02A 2RUSA 1WUUA 2YH0A 2IA6A 1YSJA 2CJQA 4F0MA 2JEIA 4H4OB 2HGLA 3UCGA 2YNFA 4FF2A 1TKXB 3G6XA 2YPZA 2VQEF 4B9MA 2LQ8A 2OGUA 5IT0A 4KKOB 2RSQA 4RZRA 3OPKA 4LIRA 1UETA 1M5SA 3CD6S 2AIRB 1YJUA 2DHXA 3HSGA 4DF4A 3HHLD 4P2MA 4ILRA 1T9UA 2HSEB 1FERA 2NXCA 4UT4A 3ZZ0A 3V81A 2HEKA 3LWMA 2IVMA 3M9OB 2VONA 3AA8A 1RKIA 5I3QA 3M7VA 1X60A 2NPIA 3TO8A 3BQ1A 3DU6A 4PWUA 1X9WA 3LWLA 4CYUA 1B4SA 4B3MJ 4ZLJA 2O66A 1HNXF 2Q79A 1URNA 1UWBA 3DGPA 3ITHA 4QJVA 4QW8A 2HAFA 2CFXA 3N01A 3B4DA 3U02A 3UVJB 8RUCA 1HYSA 3UCZP 2XI2A 2DRAA 1PBAA 2DT9A 4OIXA 4HH0A 1RT1A 5KFXA 3LOUA 3VHQA 3MUVP 3BGOP 1FT8A 1JNZB 2F8MA 5E7OB 1F5BA 3M05A 2DGTA 5HVFA 1RWVB 2WW4A 8ATCB 2NYHA 2XBPA 3K89A 2V8GA 3OFHA 2GJFA 4IG3B 1N5YA 3UNYA 3W9HA 3KLFB 2HIYA 4PG6A 4U7CA 4ECUA 1S6PA 2FUG9 2XMJA 2PSZA 1CBKA 3FSXA 2LDYA 4NLVA 1SKWA 2UVUA 2G1HA 4JI6F 1RADB 3DLEA 2Q6CA 2VBWA 5KT2A 2WONB 4DSKA 2B6AB 1HNWJ 1IQZA 5IFMA 1NK8A 2J7UA 4MYUA 4RWXA 3KK1B 3TX0A 4FF1A 4DX8H 1JKHB 2N3OA 2G9OA 2CRLA 2IRYA 5AXNA 4DL3A 3QIPB 1FKOB 2ZOFA 2KT2A 3HCXA 3HI9A 2FLPA 4Q0BA 4DV1F 1RXOB 3X1LB 2J0WA 5I3UB 5AE1A 2CPHA 3IRXA 3S01A 5J1NA 1S79A 3NGRA 2DISA 3L7OA 4ETZA 2VDHA 3SMZA 3MAAB 4EO6A 5ITHA 1U1PA 4CQ1A 3QJLA 1F9HA 4N7TA 3MM7B 3UDVA 4NLSA 2PA8D 4DUYF 5H9EJ 1VQPS 2ASDA 4DR4F 3I0RA 1E6VB 5MLCV 1KONA 2M2BA 2YQ3A 2AJ4A 1NH7A 2BKOA 3NGTA 1OYDA 1EB0A 3DLGA 4P7VA 1UJ4A 4RLEA 2B5JB 2IA0A 2GC8A 2GIQA 2MTLA 1FKAF 1DJ0A 1F5CA 4USHA 3SXLA 5GADU 2YWGA 2W4CA 2VA3A 3D2WA 1PJ7A 4DLGA 1KWMA 5L1IA 4B3OA 3VGTA 4F25A 1YBUA 4YY3J 1XR7A 3QAEA 4QR1A 2UUBJ 3OL9A 1B0VA 2JRSA 3NGUA 2RH3A 4ZITA 3PJWA 3K58A 5H9FJ 5D3GA 1NZAA 2CNNB 1T0TV 1ZAVA 4GO7X 2MKIA 1ZETA 2CADA 3LP2B 2CA9A 3HZGA 5KFEA 3PW4A 4F2SA 1F5AA 1GX5A 3MM6B 4HTJA 2LU1A 3DDKA 2AX0A 4RU9A 2KH9A 3D6TB 4HVZA 3KHHA 3VAGA 2BOPA 4B3MF 3MTJA 2J0QD 3PM9A 5J1PA 1Q16B 3H5SA 1O0PA 2LLZA 5D6GA 1S1UA 1HNZF 2RDJA 3J80Y 2RKIA 1CJUB 4X64J 1I94F 1VQ6S 2W2QP 4DEZA 2R8GA 5T41A 4USMA 3C46A 4ED8A 3I9V9 1PYOB 1SQGA 2APOA 3NG8A 4LFBF 2VJUA 2XMWA 4DV2J 3VF0B 1YLXA 1K44A 1UW4A 4Q0BB 3IG1A 1FRHA 2CPYA 4ED4A 4ECWA 4XDDA 5HMWA 4JI3F 1Y3JA 2RDIA 3ZC4A 3FRZA 3QPIA 3TA2A 3KK1A 1KHVA 4ZLNA 4NLTA 1VQOS 4ZPAA 1LW0B 2WBMA 3ZZYA 2OTJS 2DGUA 1XMBA 2R4FA 4LVOP 3H42A 5HANA 4O44A 4MFBB 3MPYA 5I4MA 4MK8A 4ZHRA 3CTRA 4USWA 3CCJS 2ZH9A 3S1TA 4Y3CA 2Q3PA 1RAHB 2R7WA 1S6QB 1HWKA 3W7BA 5ADZA 3LGMA 3AA9A 1S6QA 4PYDA 1MW7A 5C42B 3QT6A 4WZMA 2HQGA 3MOZA 4DL2A 2VIHA 2V4QA 3J81Y 3ETOA 1S12A 3FCWA 3HDSA 1PYSB 3P5TL 2W7OA 1Y5LB 3A8JA 2MY7A 3GPAA 4JBCA 1T03B 3SBMA 5CAAA 1YZ7A 3W61A 2HHHF 2HNDB 4ECTA 1KLNA 5DGAA 1SI9A 2CVEA 2DNLA 2MQNA 1XMQF 1GT8A 2FVRA 1TL5A 3D7SB 2G0IA 3WQPA 2HBQB 1OSDA 3MM6A 4DR4J 4P52A 5IM0B 2X3GA 4I7FA 5F8HA 4KO0A 5EHHA 3E8OA 4OX9F 4RU2A 2K8GA 3GV7B 2A6MA 2N7YA 3JSRA 5LL6d 4EK2A 3HSJA 1Q86T 5A6PA 3W64A 1WORA 1YK9A 2QZ8A 2K7JA 2BJ7A 2VF3A 4LQ9A 3GJTB 2PT0A 5A6WA 3TYTA 1H73A 3MI7X 2ZUGA 3I87A 2UV8G 4J37A 3TUPA 3BSAA 3F44A 4YHHF 1U1KA 4F0HA 2BVZA 4NZ7A 3MPWA 4QCLA 5ETLA 4DUYJ 2ALYB 1KR4A 1HWJA 2VKZG 3BGRB 3DXBA 1ZM3A 1KQGB 4ZLPA 1TAUA 4WP9A 4ANDA 1XQIA 4HACB 1B7FA 3VGVA 2JEFA 2WAQD 4KKOA 2W2PP 2VQEJ 1Q8KA 1M0SA 2H1YA 1YRTA 3HP6A 3IRXB 2DEJA 3BKFA 3ZTSA 4YP3A 2YKNA 3HO1A 2Z2YB 3T41A 3GIKA 1RSCA 2YWFA 5GAEI 4YY3F 1QM9A 3ELHA 5AXMA 4DSEA 3OD2A 3A8EA 3SQGB 4B17A 3DI6B 4FYXB 2E5HA 1XMQJ 1IVZA 3KG1A 4PQUB 1T94A 3I31A 4FDFA 3G6YA 3M9MB 4NCBA 5GMKa 2W9AA 4KY3A 5A2QY 4WTYA 4KGZB 1HI0P 5CXTA 1UVIA 4C4WA 1N34J 3JQJA 1S7HA 3V5RA 5DG9A 1QSYA 2MHNA 4BWMA 1QE1B 1JMTA 2UXBF 2OKQA 1KQFB 2PIIA 5KFJA 4LF4F 1NU4A 1KVIA 4JI8F 3OHAA 2JLGA 3UVJA 3K8VA 1VRUB 1KS2A 3BR9A 4PQAA 3FEXB 5HO4A 4LF4J 3Q89A 1CSJA 1KD1T 3TWZA 4JI4F 1Q81T 4GKKJ 4I6YA 2C2OB 1JB0C 3PG9A 3R5AA 5B0GA 3PFOA 1U1MA 3GR1A 3TR5A 4AUKA 3OUYA 2F3JA 4YR3A 2KVIA 2XM3A 4DV5J 3HMJG 4HI1A 2N7CA 1N5YB 3A8KA 1UA0A 5RUBA 4MKYA 5J2QA 5ETKA 3KJVB 1T02A 3CT9A 3N5BA 4Q2MA 3PKMA 1M5HA 3CCTA 2IC3B 3DRSA 4KT0C 3GQCA 1BXNA 4RJVA 2BR0A 3GMGA 4LMZA 1WC5A 2V6AA 2YY3A 4DWIA 4MFBA 1KTQA 4MKVA 2BUNA 4KGMA 4QWBA 3JSMB 1PC4A 3DN9A 2I6WA 1CULA 2YNFB 1BE4A 3PR5B 1XJWB 3IGVA 3FZBA 4C3LA 1Q5YA 2DH7A 2VHGA 1N8RT 1TP7A 4Y2KA 4TU7A 5DS7A 4B9NA 4Y34A 1CS4A 3IAS9 4QIVA 2IRUA 3CEDA 4JI3J 1NDKA 2LEAA 5BXIA 3EVOA 3EYZA 4R8UA 5DQIA 2LEPA 3VR1A 2PI5A 4FKYA 1FJEB 3MEDB 1Y0HA 4OYPA 1KN6A 1R8PA 1F3VA 3E2EA 3NNCA 1SXLA 2BW2A 4M5JA 4NI2A 3I0SB 3MECB 3SCKE 2E7VA 4ZLLA 4IQXA 4OYMA 5E2QA 1R89A 2HFZA 2Z2ZA 5HI7A 5JJBA 1OO0B 1TVRA 2RF2A 4M5DA 1H2UX 1WEZA 3R8YA 1DBDA 3RW7A 4LSZB 4NL5A 1TKDA 1WNEA 3QJPA 2ALZA 3KKFA 3DOKB 1N52B 3RG6A 4LF5F 2NSBA 2GFFA 4USIA 4NCAA 2CAJA 1NLKL 2XMAA 1N34F 3CCUS 1KFDA 3LPYA 1F2HA 4QU7A 3T5LA 3I32A 3SFGA 3BGRA 1C4CA 2HQIA 1XEZA 2NXUA 1T7PA 4CCHA 4MJKA 4CT8A 3CMES 1D9DA 3CXCR 4CZCA 3QIDA 2V4RA 1BWEA 4LJMA 4RUHA 2RKIB 1CJUA 4O3RA 3MR6A 2XG8A 4B3SF 3ISNC 1HFEL 4CO4A 2EEYA 1HARA 1VRTA 3V6DB 1URRA 3FBBA 3IFEA 3W63A 1XK8A 2MGZB 3Q24A 1Q82T 4KV8A 1TL3B 2YKQA 2GVDB 2ZITA 1NKBA 5JVGQ 3RB3A 1S1TB 6FDRA 3DHWC 4IOBA 3OTOF 3QRQA 2I5JB 2FJAB 2MPUA 2YKNB 3MMJA 3UN3A 2CJ9A 5KFOA 3GILA 2I5JA 4P2SA 2OFHX 2HFVA 3ADAC 1SL1A 1ZPWX 1DARA 2CQGA 1DQ8A 5T7LB 1NK4A 1HBMB 3M2RB 1CULB 4HTIA 4QIFA 1XBWA 3G9CA 4P9SA 2ZH5A 3BQ0A 4CLPA 3OHBA 4GKKF 1B0PA 2RIJA 1HQEB 2LXFA 4FVMA 1LKZA 3NWGA 4HT5A 4ZPBA 3G6VA 3CCZA 4FVCA 1EIYB 3UWTA 2AKWB 3A12A 1HPZA 3CD5A 3AJ2A 1TKZB 3O3LA 3QNWB 1YIJS 4OZLA 2R8KA 4KO0B 1FRKA 3MAQA 3TW0A 2K06A 2WZ1A 2PI4A 4B3SJ 2RRAA 4N8NA 2H48B 2M5YA 3RR7A 3SDEA 3G8SA 3MECA 4OX9J 4L3KA 3MHYA 4M8LA 5FDLB 1ZOTA 4DQIA 1M90T 3SDEB 4QYZJ 2WSEC 4IFYA 1EQMA 3MD1A 1KOHA 3F56A 4D3GA 1U48A 5B0EA 5KT7A 2HHQA 3CCRS 4DSIA 2V4JA 3EZUA 2CZVC 5KFKA 3J7YU 2HYIB 4YB6A 3MR3A 4YOEA 4U7UD 3K0JA 3MCNA 4MK9A 5EX0A 2FVQA 1MMNA 5HQ8A 2FZGB 2MJNA 2RU9A 4L74A 2AD9A 4A8QA 1S9GA 2HVZA 3DRSB 1W2IA 2QX0A 2D3O1 2MZSA 4LF8F 4N41A 5KFQA 1X5OA 2NPFA 1F9FA 2AYBA 3ENQA 4OYBA 4CM2A 3O8WA 3UD5A 1FRIA 1VS3A 2FC9A 2J0SD 1RAFB 4CO5A 2YQ1A 3QRPA 4C3MA 3D66A 1WHWA 5CZVA 4GC7A 4Y2IA 3M2RA 3DDIA 5G0RA 2MQ8A 3L95X 4A8WA 2R42A 4PWWA 3W3SA 4WFNQ 5DDRC 4O0IA 1JWWA 1FKPA 2Y1RI 1GFWB 3QAUA 4YB7A 1I5OB 2QMUB 3M2UB 2ZH3A 5F8JA 5F41A 4R0JA 1OQ6A 3DOMB 2KJWA 3D0GE 3VGSA 3VWSA 4DS4A 5BR8J 4RNHA 1UVKA 3H4BA 1RHJB 4WXWA 4EI2A 4KTQA 1GEHA 1HBOB 2RS8A 5B0DA 2AHOB 1Q7LB 4FYWB 3J80U 5AJ3F 1CPZA 3T1AA 1YWXA 2QT7A 2WVBA 2BXJA 3LP2A 2D3ZA 4HKQA 2FJDB 1DTQB 2B56A 3HHDA 3NKYA 4MTPA 3M4XA 2K1RB 1JLEA 3SI8A 1YGYA 4X84A 1SJ1A 3HZEA 3A8IA 2AEJA 2GJ2A 1RT2A 1F9EB 4MK7A 3TX8A 2BE2B 4O3PA 4DG1B 2V9KA 5D4PA 5DETA 1RT2B 2XMKA 5LJ5Y 1FRMA 1M5VC 2DHAA 4ENOA 3PVXA 1WTBA 3PX4A 2EPIA 3UI3A 2O01C 2BE9B 2CNOB 2DTJA 2V8PA 4KV8B 3WZ0A 2RD5C 1Q5VA 2WCXA 3BGLA 1RQ0A 3LGNA 4DV4J 2Q1LA 3BBBA 4AXIA 1XR5A 2MGZA 3NL0A 4RBVA 3MOJB 1OJ4A 2DB1A 3BH7B 2QFJA 1C0TB 4DR7F 3MR5A 1LEOA 1RYRA 1QD1A 2HW3A 4RUCA 1MSWD 1OS5A 2D9PA 4UOFA 2WW8A 4QIEA 4XAKA 5KFHA 2YNIA 3QIPA 1KP6A 4QBUA 1FD2A 3SSQA 7FD1A 1KLMA 4WFYA 4UOCA 3IR5B 4N77A 2LFVA 2Y1JA 1U0SA 3R3TA 2G2OA 2P9CA 4K2XA 1RAOA 1IBMJ 2KRBA 5IT9Y 2HMIB 4OL8A 3CC7S 2NR0A 2MQPA 4ZVRB 1S76D 1LW2B 3CCSS 3H2LA 4NPOA 1N5QA 1RAIB 1P9QC 1V9OA 1B3TA 2NZCA 3LGHA 2M0GB 4ZVOB 1LWFB 4ZJOA 2E1CA 2QYCA 4KHRA 3R7BB 3RAQA 1R6VA 4NLPA 5IQQA 4TNOA 2HFSA 4PUOB 1F60B 4F4XA 2MKCA 4ZK7M 4A8OA 2Z8QA 3RR8A 4JV2A 2AZ1A 2KHDA 4OX8A 1DTTB 2CPDA 5A8RA 1XNRF 2AU0A 2XNRA 2WVEA 5LXYA 2AQ4A 4LFAF 1SQFA 1YJVA 3FBFA 1HNVA 1MROB 3H2UB 2C2RA 2QA4G 3RAXA 1KC8T 4TVAB 2JSXA 3PHTA 1FWLA 2M4MA 1NNDA 4E2FB 1RDRA 2GGPB 1R6YA 2Z57B 4JYAJ 4I6AA 5I3PA 5GAGI 2GX8A 1U49A 3LH2S 1LQ9A 4FNIA 3RGIA 2RQCA 3D0IE 4IH7A 4ZN1A 4IO1A 1S1TA 2DNQA 3TOQA 4JP8A 5F0UA 3KDOA 3LP1A
chains in the Genus database with same CATH topology
1U1LA 4A47A 4O3NA 1HL6A 4EGLA 1LW0A 2XWXA 1Y4ZB 1PGZA 4R0EA 2CQDA 3OR2A 3EXYA 3NNHA 2BANA 2FD2A 3MGJA 2FHKA 3JSMA 3DOMA 1QUVA 1R8AA 2CPZA 2EBGA 4QQBA 1NJZA 1ZH5A 1M5OC 1KLMB 4LF9F 5BYQA 4DHVA 1IM4A 1VQMS 2CPJA 2DGQA 1N6QA 5DDQC 4OZNA 1Z2ZA 4QPTA 5GADI 2P6SA 4FXVA 3FEZA 1SKRA 2NUHA 1HNWF 3I5CA 5HLFA 3D0HE 4DFPA 2I9SA 4YR0A 2LDIA 2XMUA 4RNMA 5CYJA 4C7QA 4FS1A 2DNYA 2NUUG 3J7Z5 4OX6A 2ZKUA 3BDEA 1ZTTA 2AGOA 1NH8A 4LT6A 2AJQA 3FZ2A 1DLOB 2GJIA 1KQKA 3PW2A 4IFYB 4RW4B 4A8KA 2HHPA 2KYXA 3RZAA 4B08A 2L48A 3GE9A 4ZKAA 4X64F 3OLBA 3I56S 2RT3A 3OL7A 4DFKA 1NEEA 2EBEA 3OFFA 3NNAA 4OHWA 2DNRA 4YUDA 1Z2LA 4IR1A 4DR2F 3MMBA 1S49A 4DQQA 4WU2A 4G1QA 1K9MT 1SL0A 4C0HA 2Z0GA 4Y00A 2QE5A 2OJ3A 4A8YA 1YRUA 1GTHA 5FD1A 4LFCF 4ICLA 2E1RA 3VCDA 4KE5A 4CO2A 1HNIA 3K5MA 1RYSA 2KFNA 4B9SA 2R2TA 2I38A 1GXUA 4RX6A 2FLLA 3CULA 5HBMB 4W90B 2ROGA 3CO9A 5DG7A 3JTNA 2UP1A 4HEA9 1JLCA 5T7LA 1MU2A 5C25A 2HPUA 1U1NA 5DO2A 1SIWB 2XB2D 5F0WA 3KNAA 3Q0AA 4EYHB 1H6KX 1Z1ZA 1SB6A 2ZKTA 1HA1A 1WWHA 3THPA 4DV2F 5HMZA 1QE1A 5E5NA 3OTBA 4JYAF 5E3AA 2MSTA 3HHLC 3K5PA 3DRRB 3NAIA 2UVRA 4WE1B 2ZH1A 3OFEA 1VC5A 4FF3A 2DGSA 2GQ2A 4ZDNA 3CC2S 2YWEA 4IO9Q 3Q8QB 4YFUA 1MROA 2LA4A 2R7SA 4OHVA 5IM0A 1OWXA 3O1LA 1R8BA 5M2UA 1WG4A 2GO9A 3MCSA 1VQKS 1S1XA 2FC8A 4RW4A 4X65F 1S77D 2QSWA 4A8MP 1TKXA 1DLOA 2KT3A 5H1SV 2B6AA 5DLGA 2HNZB 2R7OA 3NLCA 2QA2A 4ECRA 2JFKA 2BQRA 3PEHA 2DGWA 4DOZA 1S9GB 5K8MA 4F8RA 2OPSA 2ZJPQ 2VFSA 4JV1A 5HL7Q 3KTQA 2JH3A 5CHCB 2F9DA 4A8FA 3QJJA 2PEHA 3ZZUA 1YJRA 1REVB 1S1VA 1UFWA 2XLKA 1D9AA 2YWKA 1ELOA 3I82A 2CPFA 2X1BA 4LIWA 1O5JA 3O2IA 1KQSR 4C8LA 2QRRA 2XMMA 2XSJB 3SYZA 3FEYB 1DTQA 4WIIA 2KM8B 3BQ2A 4OJGA 3KHGA 3NMRA 3WX4A 4XPEA 2X1GA 3I4HX 4Q5VA 4RW7B 2OP5A 2VA2A 4RW7A 1L3TA 3B4MA 2J9EA 3NCRA 2E9RX 4IG3A 1GXTA 1X8DA 5A8WA 1LFPA 1UP1A 2IM3A 5B0AA 4WE1A 2GV1A 5DM7Q 2M8HA 4PKDB