4DV0F

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 21
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dv0F00
5AJ3F 3OTOF 4YHHF 4DV5F 4DR5F 4X64F 1IBKF 2RJZA 4K0KF 1I94F 2J5AA 2HHHF 1XNRF 5IWAF 1CQMA 1FKAF 4B3RF 4LFBF 4X66F 4KHPF 4JI3F 1G7CB 2B7BB 4JI4F 1IBMF 2F4VF 2ZM6F 4DR2F 4LF5F 2B7CB 1N36F 2UXCF 2UXBF 2E5LF 4X65F 1LOUA 2UU9F 4DR7F 4LFAF 1QJHA 1CQNA 3ZZPA 4DV4F 4JI1F 4JI7F 4LF9F 1N32F 4DR3F 2VQFF 4AQYF 2UUCF 4DV0F 1XMQF 2KJWA 5LMUF 4NXNF 1HNWF 4OX9F 4DV6F 4JI5F 1HNZF 4B3MF 5LMNF 2BVZA 1RISA 4JI0F 2KJVA 1N33F 4LF4F 4JI2F 5BR8F 4B3SF 4B3TF 4X62F 4DUYF 1IJEB 4GKJF 1VMBA 1HNXF 4DR6F 4DV2F 2UUBF 4LF7F 1F60B 4GKKF 4DUZF 1GH8A 1B64A 4LF8F 3R3TA 1XMOF 1IBLF 4DR1F 1IJFB 1HR0F 4DV7F 3T1YF 2UXDF 4LF6F 1G1XA 2UUAF 4DR4F 2VQEF 4YY3F 4JV5F 4DV3F 1N34F 2YY3A 4DV1F 1J5EF 1FJGF 4JI6F 4LFCF 4JYAF 1XNQF 4JI8F 4NXMF 3T1HF 2BXJA
chains in the Genus database with same CATH superfamily
1B0TA 1RWOB 2WZ1A 3K5NA 4RBTA 4FXDA 3NG8A 1VGYA 2IJFA 1LWCB 2ZNYA 3CSKA 4IO9Q 3C6TA 2DR7A 2J9DA 3CE8A 2V69A 4HL9A 3K5LA 3LO3A 4WU3A 4N76A 3ILLA 1PYTA 2PC6A 5F8LA 2R2UA 2FC8A 3DOKA 2D9OA 2E1AA 2PN6A 1LEOA 3GJRB 1JLGA 1FVQA 3SMZA 1EETB 1UEKA 1S99A 1ZM3A 4A8XA 1JX4A 4YOEA 4RW7A 4ZOSA 3K59A 2OEKA 3SV3A 2PEHA 1WG5A 4M5MA 5D4OA 2AZ1A 1T95A 4MIAA 5GMEA 1P9YA 3TWZA 2W9BA 1YRTA 5J1EB 5EWGA 3NGTA 4K5RA 2VOOA 1VCTA 3JSYA 4DR1F 2E44A 4FYXB 2CFXA 4B3TJ 2ABYA 3SV4A 3T1AA 3DOLB 4RBUA 1VJWA 1Q8LA 2MYFA 2I1RA 1AB8A 3K89A 1NJWA 4KY3A 3D1HA 2JJ4D 3BO3A 1AUSL 4WPAA 1MNEA 2DR9A 2MGZB 3LW5C 2OMLA 1U0HB 2ZITA 2HQIA 2V8PA 1JLFB 5ETKA 2XMKA 4MJKA 3V6DA 2EKNA 1L3KA 1C0TB 3N01A 1T94A 5L46A 2DRDA 2GQ2A 2A3JA 4ITSA 1QJHA 1X4AA 4QWDA 2D41A 3UR0A 1A7GE 3G6XA 1NSAA 3QJPA 3CGIA 4FYYB 4DV5J 4MAKA 8ATCB 3PW7A 5GADI 4JP8A 1C1CB 1EETA 2CJKA 2W9AA 1F60B 1NJYA 3KG4A 4C8OA 4GKKF 3TZZA 3PRBA 1S72S 4C2MA 4O3PA 4KB7A 2ZUGA 1ZYQA 1YWXA 1RJJA 4AD6A 4LRCA 1V6HA 3MEDB 1XMQJ 2J76E 5F9LA 3A3NB 1N34F 1H2UX 3UVJB 4UOFA 5DETA 5DQGA 3HZEA 2OPQB 5CD4H 2DBBA 2HVIA 1UWAA 1MG7A 2D1CA 1XQIA 1WC5A 4EI2A 1U1OA 2VFUA 1SPBP 1I5OB 1K9MT 3U02A 3D5MA 2CRLA 1RBLA 4NLPA 3N6LA 2NXEA 4ES3A 4DL2A 2MGZA 4DCOB 4LF9F 2L3MA 1U0HA 4ANDA 3PACA 1HIYA 5LM7E 2MZTA 4DX5A 1KRPA 5KFQA 2HNYA 1WG4A 3O1LA 4QWCA 3GJSB 1V3SA 2MZ1A 2HHUA 1RWPB 5ETNA 3KHGA 2HMIB 2GW8A 3OQ2A 4X62F 3CF5Q 2GGPA 3M2UB 2UUBF 1VK3A 4GRSA 3OXGA 5EDWA 1TK8A 2G0CA 1RDRA 2D3OR 1SH0A 3CDWA 4AQYJ 1K47A 5ETOA 2Y1IA 4JV2A 2R2TA 5B0AA 3VALA 4ZPWR 2POKA 1RAGB 4DR1J 4ZVTB 4OI3A 3BDEA 2RQ4A 5EHHA 3MEDA 2HFVA 3HHLB 4I67A 4C4WA 1NHUA 2CVEA 2LEBA 2XLJA 1RWNB 1FKAF 2XULA 4WZMA 2YX1A 1WF1A 1BE4A 1T9TA 5F9NA 4WIIA 4KIAA 4IYQA 3EUNA 1RAAB 4L76A 3GPAA 2Z2ZA 4OJ1A 1RT5A 3EVWA 2GMHA 5CCLA 5EN1A 1PBUA 4ILLA 4UZBA 1WF0A 5KFKA 2F40A 3V6KA 1R6YA 4PWDB 1SBRA 2DO4A 1XR7A 5HVHA 5BYQA 3CIZA 4MMOA 2CADA 3FK4A 3CD7A 2HMIA 3QPIA 2C42A 2J0XA 4CTAB 4LF6F 5KG5A 4LBPA 4NPOA 2O5DA 5E3CA 4GKKJ 3Q8YA 1FO1A 1TU0B 2QA4G 5AT1B 4Y2KA 3BYPA 5DS7A 2FYXA 3ELHA 3M8QB 1N34J 1VRQC 3EGZA 4OMFG 3HK2A 5GAGI 4QW9A 5LXRA 3FEXB 1N4LA 4M1KA 5HL7Q 2JNJA 3BSOA 1VYAA 4I6YA 1PSDA 1VS3A 4B9UA 3RB4A 2R7RA 2W2OP 1HHSA 1MROB 4A8SA 5KFTA 3W9HA 2HHHJ 3ZTQA 1KVJA 3J7ZT 3I0SB 1OQ6A 1ZA1B 2XMUA 4LBHA 1ULRA 2QZ8A 4NI2B 1QD1A 2MQ8A 3G6ES 8AT1B 3PX4A 3UR3C 1RT7B 2GHWA 5F0UA 4PWDA 3GZ7A 1LK7A 1LWFB 5DG7A 2UV8A 2EBEA 1VLOA 4C8KA 4X4OA 4HKQA 4BLGA 2KXHA 1IM4A 2AYBA 1U47A 3QGIA 1FCAA 3HHNB 4ZP6A 5MLCV 4IDKB 3AT1B 4DL7A 1OSCA 3T3FA 3ICLA 3Q2TC 1F3FA 4F4AA 4F0HA 3FGVA 2OEJA 1N6QA 2V5HG 5LSLA 2LXUA 1JQGA 2RU9A 3HMJG 2ROEA 2IA6A 4K4WA 2CXEA 4OZ2A 3AB4B 3OHAA 1B99A 3CC2S 3GV7B 1NSPA 3KMSA 1X0PA 2IJRA 5SUHA 4NRUA 2BQRA 1L3SA 4PG4A 2ZOGA 3W5XA 3ZNJ1 1WC6A 2D69A 2C1EB 2FJWA 3ZXWA 4MT1A 2ZH7A 4NLYA 3KK1B 2IVFB 2L9WA 2IBKA 3QGHA 4GVBB 5KFHA 1IQZA 5IT4A 5KFNA 4HI2A 2Y1LB 2QEXS 3QLHB 1S57A 4URQU 1R0AB 1EP4B 2G2YA 5F0WA 1RT7A 2HWIA 1DFDA 2A6MA 4LF6J 1HNIA 3RAQA 3TAMA 1LWFA 4Q8EA 4A48A 2IC3B 2U2FA 2H65B 2K06A 3OR1B 3MR2A 4LRDA 3QAUA 2GVZA 3G87A 3J80U 4ED6A 3MECB 1DY3A 4IDKA 4ZPTR 3OL8A 3GB0A 3EGWB 2LDYA 2CZVC 1KONA 4OHXA 3P45B 5C2CA 3U1NA 2BVZA 3IRWP 4W92B 1OWXA 2DXFA 4IOAQ 5B0CA 2KFNA 1IQTA 2BJ9A 1MMNA 3CDAA 3ISND 2C2OB 3C14A 2VC1A 1UVMA 4Z37A 1SJ4P 1JB0C 2V8DA 4IG3B 2APOA 5F3TA 3C2PA 1JNRB 4QR2A 3W60A 5FD1A 2Z56B 3JTNA 5HLFA 1LQ9A 3WX8A 2OTJS 2GHPA 3N6NA 4GVBA 4C3KA 3A8EA 3H5XA 3AD7C 1MU2A 4TNOA 1U1QA 1ZZFA 3QLHA 1R0AA 5BYRA 3DRYA 3D0IE 3GCWP 1N52B 3CW2C 2XO7A 4ECTA 5K14B 3RJMB 3VR1A 1K73T 4XDCA 3OR1A 3LWLA 3UD5A 4URSA 4NOHA 2DNMA 3O44A 3W2VB 4DDFA 3BB5A 2NYHA 2ASLA 1SJRA 1HBOA 4HACB 2PE8A 3MR5A 2DNGA 2F7VA 4LBIA 2QSWA 5D0EA 4RBVA 4R5PA 1KDNA 2R4FA 2FJBB 1YGYA 3OD2A 4FVMA 2UV8G 2EW9A 3HKZD 5J2NB 3B6BA 1OPZA 1UP1A 4ECXA 1RABB 1S1VB 1Y7PA 5IM0B 4O44A 5A0YA 1HR0F 3U27A 1S5ZA 4Y2MA 4NXNJ 4IRKA 3ZZ0A 4FVCA 4LSNB 4Y34A 4IG3A 2K7KA 2CNOB 2BW2A 4ID8A 2E5GA 2ZUAA 5CZVA 3BZQA 3D3CJ 3TARA 2P9EA 2BM0A 2KZMA 4LF8J 4I69A 3NNCA 4G1QB 5ETRA 1ZM4A 4YR2A 4KC5A 1WHYA 3I5AA 2AIRB 3QRPA 2ZZTA 3DRRB 5K14A 2DGTA 2OMOA 2RD5C 4H4KC 3TOQA 4Q0BB 4UF4A 5CYMA 1YBUA 2W7PA 3I5CA 2LQ5A 5LJ5Y 2YKNB 1M1KT 3CCJS 3LGHA 4TYBA 4HACA 2D74B 1RE1B 3WZ0A 3NNAA 2IDEA 2IVYA 4MK8A 2EG2A 3B78A 1NK4A 4USUA 3BYRA 2GX8A 3CNQP 5J2MB 3Q23A 1S1VA 4EU0A 3NY0A 4R0JA 1R8AA 3R5AA 3MR6A 4Y3CA 2ZBIA 5LSRA 4M5KA 4WBFA 4NZ0A 1K0TA 3BSNA 5JXSA 1Q86T 2ZBQA 4TKTA 2G9OA 2FTRA 2Z4PA 1SKRA 3A3PB 2ZVSA 1D9AA 4QBUA 3MXHP 2VA2A 1CULB 4W90B 3CVKA 3DXSX 3VGTA 5L9XA 4YQWA 1TAUA 4B17A 2P9CA 1EZZB 4G1QA 4FF1A 3N5FA 5H9EJ 3E51A 3W5ZA 1VFJA 3KG1A 3GFXA 4ZITA 4DXLA 1T03B 3BQ2A 1NPPA 4ZDNA 3PY8A 4NA2A 3R3TA 5KFRA 2DRBA 3SCJE 1RHRB 3T1YF 3NBPA 3M1VA 2MPUA 2ZE2B 4L72B 2YKMB 3O5TB 4J9VA 4EBDA 1UKUA 4DF4A 2F3JA 1JJ4A 3FEYB 7AT1B 4V1Ak 2FLLA 2CG8A 4B9SA 2FVSA 5J2MA 4ZVHA 2IPOB 2VKRA 2F65A 2W9CB 1ROFA 2LQJA 1DTQA 2IRXA 2I5JA 3R7SB 4HYKA 1AROP 3UN5A 2X3DA 2Z2MA 2RHQB 2A2DA 4DUTA 1LWEB 3CULA 2MEWA 1OS5A 3DRPA 4IR1A 1Y10A 2B51A 3EM1A 3SSQA 2BEFA 2GO8A 4OZ0A 2Z2LA 1GXTA 1PC4A 3KJVA 2LA4A 3M2VB 2HHQA 3BGFA 1F2HA 4B9MA 2I38A 3KK2B 4MK9A 4K4ZA 2BW7A 1G1XA 2CYYA 3HHEA 1D8ZA 1T03A 4PEOA 3TEHB 1F2GA 2OI2A 1YLXA 5F8HA 2O1PA 5L39A 3SSSA 5HJXA 5G4DA 2ATCB 3U1LA 2QLWA 2Z0GA 2N3LA 1EB0A 3R5CA 2ZE2A 3PYEA 2J7WA 3BDPA 2YKMA 2KFZA 4S0MA 1AFIA 2Q79A 3AODA 4I56A 2F8MA 5CYJA 2R7QA 1S6QB 4KHPF 2ADBA 2N7YA 2A18A 1AXQA 1LOUA 4NZ7A 2CIMA 2BBEA 3ENAA 3BBFA 2Z2YB 5KG0A 4UOHA 2KXNB 4NCGA 5KFZA 3WBZA 4EGLA 1UJ6A 1M5OC 1JLQB 1VJQA 1CJKB 2OO4A 2V34A 1NHVA 5M2RA 4GC6A 1HWLA 4DPTA 1XERA 2NXUA 4K4TA 4DR6F 1LWEA 4ECUA 2RIJA 2JFKA 4KSEB 3DC2A 2EWHA 2HHSA 4IFVB 5IS2A 2J8AA 4YN3B 4ZJOA 2LYVA 1JLAB 4UW2A 2UUAF 2XLKA 1QAXA 3M2VA 2HNZB 4LF1A 4WFZA 4DV1F 3AH6A 1APSA 2MKYA 2V67A 3KK2A 2KG0A 3IR5B 3T1YJ 2AYMA 4GO7X 5IXUA 1U2FA 2JEIA 3FRZA 3PYDA 4OFZA 4ECQA 3VTIA 1HYSB 1HQUB 4OHWA 3PG9A 4M5LA 3A13A 2ZZMA 3A4TA 4DR7F 1NDCA 1HLWA 1RT4B 3MZIA 4WJBA 4DR3F 2X1FA 1S6QA 3DHWC 1O6XA 3MAAA 3IR7B 4ES1A 3OVAA 2HEKA 3SFGA 5KFAA 4LF4F 1HFEL 2RRNA 3MUMP 1Y00A 2OD4A 1U49A 4QJVA 1AT1B 3R1LA 3OTBA 5E3PA 4I2QA 1L5UA 1N88A 2EEYA 1HPZB 3HD2A 3T5KA 1CJKA 1M5HA 4U8YA 1X4GA 1RHKB 2GO9A 1VDHA 3CCSS 3THPA 2XSJA 3QSIA 2B8QA 4LREA 1YJRA 3PVXA 4WIQA 2FHOB 3BS9A 3FRYA 3BGLA 4NWBA 2I8EA 4QYZK 2QGFB 2HIQA 3C8YA 2UVVA 4P2FA 4NYZA 4RU2A 2HNZA 2OPRA 4LR9A 4L73A 2B9WA 2QL5B 2XYGB 1F1BB 3R5BA 3PYGA 2R7OA 4KHPJ 3PJ9A 1HYSA 1HQUA 1TMMA 1MW7A 1JJHA 1VOMA 1UFWA 4CT9A 3BF4A 1RTIA 1N0VC 4IRCA 4I1TA 2HWHA 1KN6A 1EIYB 2OD6A 1C0UB 1RT4A 3F56A 4M5IA 2B9EA 2O67A 2YNFB 1UVKA 1YK9A 2XY5A 2G1HA 2Y1RI 1H6KX 2P8IA 4N47A 4QPTA 3PIPQ 1RCXB 2NSCA 3TA1A 3GSIA 2NS1B 4I0WA 4OYIA 5I3UA 2DNNA 4DQQA 4CIOA 3S7RA 4DR6J 2FJEB 1HPZA 1U7LA 1UW9A 4OYWA 1F6TA 2CQIA 2ZOMA 5RUBA 4M5NA 2UUAJ 2YKOA 3PKYA 5HANA 2BYCA 4ZCKA 4DV1J 1RU1A 3PRDA 3FKBA 2DNHA 1YJVA 2CDRB 3JAMU 3MMBB 4Y2CA 4ZCIA 3AB2B 3SYZA 4DR2F 1HW8A 3UFCX 3M8RA 1VIOA 4N5SA 3EGVA 1T3NA 4JI7F 2BJDA 3TR5A 3JSRA 2DIVA 5B0FA 4FBTA 2V8VA 3OV7A 1HNWF 3NMAA 1EQMA 5D0HA 4C7QA 3PR5B 4CQ1A 4DR7J 4ZN3A 2YNHB 3NL0A 4J9LA 1JLCB 3PO5A 3TA0A 2AZ3A 3SQOP 2YX4A 2RMLA 3JAMY 2LECA 2J8SA 4UOGA 1YTYA 1KKHA 1HHTP 1LFWA 3MOJB 4LF4J 1GQEA 3ENQA 4YB1P 1Z1ZA 4ZPCA 5KFPA 1S4FA 2VBZA 1WEXA 2GJFA 2G0JA 2V9KA 3M6WA 4ID5A 4WFYA 2NSBA 3I9ZA 2A1BA 1RLDA 1VQMS 2Q43A 5HATA 1SCJB 3G71S 2FVCA 2RUSA 1FDAA 2OHDA 2YNIA 4Y00A 1KBRA 5T41A 2QFJA 2UXBF 2G2ZA 3AAWB 3D6FB 4CH1A 4CCHA 2YWEA 3LP0B 3F0NA 5KFVA 3MMBA 1QTNB 2R7TA 4NE9C 1RBAA 3K8VA 1V5IB 4DFKA 2J0QD 2NXNA 2DNRA 4RW8B 2R7WA 5C42B 4DF8A 1W2IA 4RUCA 4QQBA 2YNGB 4HLBA 1S4EA 1FX2A 1SKUB 2YNHA 2KRRA 4WTYA 1JLCA 4DWIA 4DN9A 4ZVQB 1TL5A 4JI1J 4HH1A 1L3TA 3NGSA 3NLCA 4CP5A 3W7BA 3RUBL 2UUWA 3PEHA 5T7LA 3VV2B 3PHEA 2M8HA 1R6VA 1VQNS 3FQLA 3TNVA 3CJTA 5DDOC 4BCAA 1X8DA 1V9OA 1U09A 5L8RC 5B0EA 4ZJQA 4YB7A 3LGMA 2K1RB 4WE1B 2BANA 2VD3A 2HQCA 1CS4B 3L3CA 3X1LB 2EC2A 5A8RB 1PJ7A 4MFBA 3PNIA 3U1MA 3C3LA 1N5YB 2AYEA 2LVWA 2AJ0A 2CPIA 3BN4A 3LP0A 3UE2A 5K8PA 2HK3A 1HNWJ 4GKJF 3CCMS 3RYLA 4BWJA 1LK5A 5DM7Q 4QWEA 1SC1B 2AJFE 1IKWB 3O6QA 1Q78A 2I6WA 2FHJA 5C42A 2AJ2A 2HQGA 1S79A 4P74A 1JWWA 2YNGA 2OAUA 4KR0B 4JI5J 4JI6F 4BBYA 2V63A 1HBNB 1KR4A 1KFDA 3UDLA 1DURA 1T9YA 3V6JA 4J9OA 1QM9A 1MWZA 3Q86A 2CPZA 3D1QA 1NO8A 3H7HB 3WX4A 1HWIA 2C2EA 3LALA 2HHVA 1TK0A 1NSQA 3NXZA 3P5TL 4DSJA 4AXJA 4C3MA 1YQHA 1RP5A 1NUEA 2IFXA 4CH7A 1TL3A 3AQOA 2XMAA 2MLYA 1D1UA 2FQQB 4RNOA 2YX7A 3MI7X 2DNQA 2K1RA 1VBKA 4WE1A 2FY8A 2VFVA 2KT5A 1CS4A 3EJMA 4ETXA 3HHKA 1S49A 3DN9A 1DTTA 3H0PA 5A8RA 2M3DA 1JLEB 3WQPA 5LJ3Y 2AW0A 1SL1A 5K9FA 1N5YA 4LRFA 1A6LA 2DCUB 5CH7B 4TXSA 2Q1LA 4GMKA 3PZPA 2YWWA 3Q8PB 2WSFC 4DSKA 2CAJA 4XPEA 2QL7B 2BJ8A 2VG5B 4CLLA 2H54B 1SL0A 4PYDA 1OY6A 1RWVB 4P7VA 5CXTA 2WW8A 3T1HF 4QIGA 4W98A 3CJ2A 2HZCA 3R8YA 2CQGA 4IH5A 4ZVRB 5L1JA 1TL4A 2WSCC 3M8PB 5IWAF 3W63A 5E3RA 3R7NB 1HBNA 2F4VF 3CJRA 3W66A 1FWLA 3D66A 2UU9F 1S7HA 2VG6B 5C25B 1UPMB 1Q4RA 3KLVA 2BJ1A 2ILZA 5D3GA 3AHPA 2J6UA 5GMDA 2QYCA 2WRMA 4A8KA 3I31A 1SUQB 2B4PA 3OBIA 2AP6A 4M5DA 4ENOA 2WBRA 2ZH1A 3D6HB 2P2CB 2IM1A 1BY9A 2LCWA 4RZRA 3PXGa 4OI1A 2KTQA 3VAHA 2VZ9A 4C0BA 2JHEA 2IM3A 2DR5A 1O8BA 1NCLA 5HQMA 1NB2A 3G9CA 1JLEA 3QMQA 4GKJJ 4O3QA 1UA0A 1KNZA 3PR4A 3GIJA 2IRUA 3BR9A 4JYAF 1JXLA 4TY9A 1PG5B 3JSBA 3QGPA 2OH2A 1KP6A 4RWWA 3BGUA 1F5BA 3HVRA 1RU2A 1FA0A 5HI7A 1NPRA 3FJ2A 2DCLA 3OLBA 2VG5A 3C16B 3SDEB 4JI6J 4JI3F 4X4QA 1G7CB 2B7BB 3P49B 2R8JA 2FJDB 2VICA 4B02A 3OJSA 2DY9A 4TU9A 2E5LF 3W1YC 3M8PA 5HMZA 3QAEA 4MH8A 4DSIA 5DQIA 1YG0A 1WHXA 1VC0A 1DLOB 2DGWA 1WC0A 1U1LA 2BJEA 2W24A 1FRJA 2DRAA 2VG6A 2CQCA 1N33F 4KGVB 3PIOQ 2C2RA 4OJGA 1R8BA 1SH2A 1YKWA 3GU0A 4USIA 2C2KB 2DITA 3VAIA 4DSFA 1U25A 2YWFA 1R8CA 1R89A 4KV8A 2PSZA 3N0VA 4FP9A 2E1MC 3V4MA 3TVKA 1S7IA 2NXJA 4OI2A 4DR4F 3BV8A 3DKDA 4YP3A 2BOPA 5DZ6A 4USHA 3C19A 5B0DA 1VQLS 1FEHA 4ELTA 3L9ZA 4EUVA 2MKIA 4MKAA 2VG7B 1IBKF 3FBEA 2IHR1 1EKRA 3MGJA 4RWXA 2FJXA 4JBCA 5JMNA 3KJFB 4PXCA 3T1HJ 4A8MP 2QO3A 1BQNA 1HA1A 3MCSA 2MQQA 5IWAJ 4YFUA 1RTDA 3DRSA 2F5GA 3QQCD 2F4VJ 4OYBA 3GV8B 2CPFA 2V4QA 2HGLA 1HNZF 2UU9J 2HVHA 1WSVA 3ADAC 2RH3A 4FF3A 1DLOA 3AJ2A 1VQ5S 1U8WA 3MM8B 5KT5A 3I4PA 2RHSB 4N7TA 3LP2B 1M5PC 1OO0B 2OFHX 5EX0A 3FFIB 1TUWA 1KHVA 2W7AA 2EBGA 4FKYA 5F3ZA 3TUIC 5LOQA 5G0RB 2OPPB 1X9MA 3N9UC 4DPXA 4DQPA 5IFMA 1XMBA 1PGZA 4ZIVA 2VG7A 4RW9B 1RT3A 2YXLA 1VQOS 4BWMA 1U45A 4WK3A 4OX6A 1WEZA 1TVRB 4U9RA 5D6GA 1YITS 4DV6F 3VGVA 2W4CA 2E5LJ 3M05A 5DG9A 5A8KB 1QUVA 1FDNA 3DLEB 3VGUA 2JEFA 2E1PA 3DLGA 4MKBA 1GNKA 3HPOA 3FDSA 2CZ9A 2Z58B 2ZM6J 3VF0B 5A2QY 1N33J 3KLGA 2FZKB 3S6EA 3MAQA 2NLWA 1LNQA 1GMVA 2QLJB 1EX8A 4Y0FA 4OYMA 2NZ4A 1U2CA 4LIWA 2XM3A 3KLIB 4N8NA 3C15B 1TV6B 4DHVA 2LEPA 3LANA 2R9LA 1ZOTA 4USTA 1Y11A 2HBYB 4TYAA 2ROPA 3K5PA 4UT4A 5C5JA 2BQ3A 2XMTA 4DR4J 3D68A 4QU7A 5EUHA 1WDDA 3HXMA 1C4CA 1U6ZA 2BKOA 3JSMB 3M8WA 1T9XA 1CG2A 1EJ7L 3I4HX 3MR3A 1YDLA 5G0RA 4J7CA 4X65F 1IBKJ 3SFUA 1QLNA 1VQ7S 2BKPA 3SQGB 3IC1A 4O0IA 2MZJA 1I51B 4V19J 5BJRA 3TO8A 3EZOA 2RT3A 4N41A 3CCUS 4RW9A 5KT3A 2Y8WA 1BQMA 4N77A 3R6GB 3QIDA 4K4SA 2HHXA 4DPWA 4TQSA 2RE1A 4P10A 1SXLA 1PYOB 3EVOA 1RAIB 4H4MB 5A8KA 3D0HE 3EMTA 3TVZA 1S9EB 1BGXT 4DLEA 3SI8A 1SQFA 3QIPA 4ED3A 3P8BB 3PYFA 1QVGR 2VL1A 4YDDB 3DYAA 4FBUA 2OELA 3QT8A 2KT2A 2DEIA 1FE4A 3CD6S 4FNHA 2RJZA 1KSPA 4AFFA 3KLIA 2DYAA 4DCJB 4ILRA 2N82B 3C15A 3GWCA 3DNCA 4ECVA 4MIWA 3TYTA 1UCNA 1UVLA 3NAIA 2IAJA 4Y28C 2G2OA 3E2EA 1PYSB 2DXEA 3T6BA 5KFBA 4DZDA 4DV0F 4PAAA 3JSMA 3Q89A 3ZFVA 3AOCA 4X2BA 4FYVB 4KQZA 3V4IA 3NGUA 3CO0P 2XB2D 4A8OA 3SQGA 1HARA 1T9VA 1V5VA 4CO2A 3QO9B 4RNFA 4DV6J 3DGVA 1PC5A 2QX0A 4IH6A 3HHLC 1G4CA 3FVYA 1AA1B 2WTFA 2QSFA 1X9SA 1URRA 3W5YA 2HAIA 2E5JA 4FYDA 3MPVA 3BBCA 2PEBA 1K1QA 1FFWB 4P72A 3CJSA 4OJ3A 1WNEA 3M6VA 4IQMA 4H4MA 2BACA 1DJ0A 3CT9A 2X7IA 1VQPS 2PFFB 2EVZA 1FNOA 4IFYB 3GILA 2ZOFA 1R43A 1NZ8A 3HVTB 4J9QA 2CPHA 3ZZYA 1RACB 4OZNA 3BGOP 1NJZA 2BQUA 4OZJA 4YB5A 3H20A 3CJQA 5HO4A 3MM6B 4O0NA 1UVJA 3IMQJ 3GIMA 1RXOB 3RR8A 4P52A 4A4JA 4OJHA 4DL3A 1GXUA 4B3MF 2VF3A 2EI5A 1YJWS 2BA9A 4QIEA 1L3VA 2MKCA 2H1YA 5D4PA 2DVIA 4LFBJ 3V81B 4DFMA 4WP9A 2PMHA 1TKXA 2BABA 4KPCA 4QU6A 4DUZF 4FZVA 3MWBA 2KU7A 3MEGB 2PFDA 2M88A 4J9NA 3DCAA 4ZP7A 3QO9A 2AJQA 3FC9A 3CMES 2UXDF 2XYPB 3BREA 1PBAA 1RKIA 3BJYA 1FJGF 2ALYB 3M9OB 4JI8F 3KNGA 1MWYA 3NOGA 1MN9A 3BSAA 5AJ3F 4QW8A 3AY0A 1T02A 1Q8IA 3ET6B 3GJQB 4DL5A 3AXKA 1HNXJ 2ZHOA 2RS8A 2BRLA 1V3ZA 1SIZA 2CG4A 1X5SA 5MAOA 4LFAF 3WIVA 5IQQA 4ZS6A 1FKPA 2XO6A 4F2SA 1TTHB 4RO0A 3NGKA 3VVUA 1AZSB 4NLTA 2M2BA 3QWUA 3CCZA 5E5NA 2AT1B 3MM6A 3MM5B 4F4XA 1FNXH 2YPZA 1YBAA 5E41A 4DV0J 1W25A 3GFYA 3LGNA 3KYLA 3IFEA 4J9KA 3LA0A 3MEKA 1RBOB 1D8YA 3H90A 4K8RA 1Q82T 1JKHB 3E3XA 3Q8UA 1RUSA 3IGNA 4MKVA 1YVFA 4J9SA 4LR8A 4ZVOB 3H5UA 2Z8QA 3V81A 3MPDA 4PG6A 2ZD1B 3QGGA 1KVKA 2CNNB 1JLGB 5LT5A 3VWSA 5CZXA 2UP1A 4LSLA 1CJUB 1QAIA 3MEGA 4PXEA 3X3UA 3ILOA 2L08A 4KHRA 3S8SA 3B82A 4FF4A 2RKIB 4DV5F 3US5A 4RW7B 1YRUA 3IM8A 2X1GA 2M52A 3BEGB 2ZBCA 3WC0A 2MHNA 1LXNA 4G1IA 3DOMB 3A8IA 4PG5A 3G86A 4ZVGA 2C2DA 2HSEB 4CO5A 3POTB 3MM7A 2MSSA 1XMQF 4H4KA 2QTWA 5HSPA 3PJWA 1WWHA 1SJ1A 3GFZA 1G3OA 3CO9A 2QMUB 2RRBA 3DFEA 4M5JA 2WK4A 4K2XA 2BE2B 2KZZA 1MSWD 3V2UC 2FLNA 1OPIA 2B3TB 3HSZA 2L41A 1XWLA 4B3MJ 1IM6A 2FC9A 4ZVUB 3DLLQ 3MM5A 4R8UA 2AEFA 4HR2A 4WP3A 1S10A 1R3NA 3JYTB 4F4WA 1JKHA 4DUZJ 2DIUA 4ECSA 3H4DA 3I82A 2ACMA 2UXDJ 2ZD1A 4C3LA 4K0KF 1UEUA 2B0GA 2R8IA 4OHZA 5CAAA 2FJVA 4FKXA 3J7YU 1FJGJ 1HMVB 1AYEA 4HHUA 4JI8J 1CJUA 1IKVA 1G2EA 5AJ3J 2RKIA 4C8NA 1N5SA 4ZLNA 4AQYF 5AXNA 1QAYA 4B9TA 3DOMA 1HHQA 4LFAJ 2LFVA 5KG1A 2KM8B 2DGVA 1UETA 3POTA 3I5BA 1UFKA 2HBZB 3QZ7A 1W7WA 4LF7F 4ZPBA 1MLAA 3FSYA 3VGSA 4MKYA 3PW0A 1SJ3P 3TAQA 2WOMA 2BE2A 5ETPA 2E1CA 4H4OB 2WVEA 2VBXA 3DRXA 5ETMA 1FTCA 4NEZA 1OSDA 4L75A 3MDFA 2OTLS 2YH0A 2HNYB 1CJTB 4BC7A 1HWJA 3CJ3A 5JJBA 4ZK7M 2H9ZA 3JYTA 4DPOA 4UTGA 3HFKA 1CLFA 9ATCB 2B56A 4K4XA 3GFHA 2GGPB 3MMAA 1H2TZ 1LW0B 1LW2A 4B08A 2JEJA 3AD8C 5B7WA 3VAGA 2FUG9 4O3SA 1Z2LA 4OX8A 5ITHA 1DQAA 1HMVA 3RB6A 3M2RA 5KFIA 4ANCA 1RHUB 1WC3A 1KLMB 4F26A 5LMUF 1WTBA 5IT9U 3M8YA 1IKXA 3CCQS 2J0SD 3KTQA 3OSNA 4B9LA 4P71A 2E9ZA 3UDCA 3LPYA 3PO4A 5BR8F 4O23A 2MKSA 3NP5A 5J2QB 2CPYA 1HNVA 4ECYA 1WTFA 1B64A 4HDGA 3MF5A 4EYHB 1B7YB 2HHWA 5IT9Y 3AJ1A 5GMKa 4TU7A 1BQXA 1U8SA 3PDNA 2VPXB 2MLZA 1NLKL 1YJTA 3QWPA 1RT5B 3UN3A 4NXMF 1FJCA 4H4OA 4PYAA 1X4HA 3CCRS 1NK8A 3Q2SC 2J7UA 3UCGA 4ZCLA 2J5AA 2HHHF 2WCXA 3MEEB 3HZGA 2WVCA 4K2JA 3TZWA 3R6LB 1CJTA 1SC6A 4UY85 3QFHA 6FDRA 1I3OB 2PT0A 4K0KJ 2IM2A 3GSDA 2DNPA 1O5JA 3OFGA 4DX6A 4F4YA 1N5VA 3P5BP 1NNDA 1LW0A 1W26A 1HBUB 3DGPB 1Y0HA 2EFOA 3HSDA 1K1SA 2BE7D 2W2NP 2GQQA 2JSXA 2A6OA 2MSTA 3RGIA 2Y9HA 1KLMA 3HFZB 1TL7B 5DZ7A 2K3IA 3PM9A 3OJUA 2WVBA 4QCLA 3D2WA 3MR7A 2J6SA 4DZ6A 2ALZA 3D6MB 2DHSA 4DV7F 2ADCA 5J2QA 3G8SA 1HBMA 4WWSA 4LF7J 3L7UA 5A6PA 1CPZA 3PX0A 3N4WA 1IBCB 4F4KA 2X3GA 2F8HA 3I56S 2BXJA 1K8AT 1WHWA 3JB9k 3Q0AA 4NLGA 3TZXA 2DNZA 2ZH9A 3R27A 3GYXB 2YWKA 1GMWD 3EZUA 3A1YG 1RQ0A 3UDVA 5HQ8A 3IA0A 3TEGA 1H74A 3H42A 1T0TV 1RTHA 2LQ8A 1ZS6A 3MEEA 5KFGA 2DO0A 2GC8A 3CJ4A 1S59A 2F4FA 4KGZB 2MQPA 4ED0A 1KFSA 4QIWD 1VQ4S 4O4GB 4F36A 5LMUJ 4Q2MA 5KFWA 1YJ9S 4Z7YA 1HBUA 3DGPA 4JI4J 3O3LA 3LP1A 3T5JA 1RT6B 2CNKB 2Y8YA 1N6QB 2ERRA 1OYEA 5BR8J 1TL7A 1F3VA 2CQ2A 2IMOA 4OI6A 2X1BA 3T6JA 2BE9B 1U1PA 3L4BC 3F73A 5HN0A 3VAJA 2WB4A 2YH1A 1UAWA 2N4CA 1YJUA 4CLPA 4F67A 4NXMJ 2DHAA 3IBWA 2VH7A 1YJ7A 3FBBA 4QZVB 1VBYA 4KTQA 1FJ7A 3T9ZA 1T9UA 2YBVA 2AWZA 3BH6B 4K4YA 2VDIA 4WF9Q 1N5QA 1VBXA 1H73A 2CQ4A 1HWKA 1RYRA 3A12A 1HNIB 2QYGA 2CVIA 3TAMB 3AQPA 4ICLB 5K8NA 4ECWA 2LMIA 3PRVA 1SVDA 2FZGB 2HFZA 2QV6A 3GONA 3SXLA 2GVZB 3HDSA 2RSQA 4EO6A 1XMOF 4O4GA 3K7RA 2XNQA 2CJXB 2XY6A 2P9GA 4ZVSB 2FLOA 3BGRB 4ALZA 4BC9A 2R2RA 1RT6A 2C2MB 1GTEA 4WK1A 1Q16B 3D67A 4CI0B 3DLHA 4DV7J 4C97A 4CYUB 3DU5A 1QE1B 1F5CA 3UW1A 3NMRA 7FDRA 2B4VA 3M6XA 3C14B 3Q8SB 3HO1A 4UQTA 2UVWA 4U7UK 3MCNA 1N56A 4MTPA 2GCFA 5DJBA 2X51A 2W2QP 1R7IA 3Q24A 5HLFB 3LWMA 4NXNF 1TKZA 1RT1B 2ZZNA 3A3OB 4DSLA 2IYGA 2XZWA 3CDEA 1MU2B 3SIPB 4XPCA 3LQVA 4XDDA 4ZCMA 5B08A 4OZ1A 2B43A 3ILIA 2MXYA 1IKYB 2CQHA 5ETQA 4NMXA 3NNHA 4LF8F 5IT0A 4ICLA 4K4UA 3G82A 3UNYA 2IBOA 1Q5YA 2I2YA 3D4JA 4A46A 3MTJA 1HBOB 1UJ4A 1VRUB 2Q66A 5F8NA 3BGRA 1J2VA 3AD9C 2LQBA 4R5PB 4Q43A 5M2UA 5KAKA 2AD9A 4CYUA 4J9UE 4KPYA 4B9VA 2RU3A 3GLJA 3PX6A 1QE1A 3HHDA 4O44B 5A0YB 4G1PA 3GG1A 1FTRA 1FRLA 3CWJA 2KFYA 4WCEQ 2J6TA 5CQGA 5HBMA 3TJ8A 4K5SA 2MJUA 1XNRJ 1FK9B 1HI0P 3FEZA 5I4MA 4DQRA 1KOOA 1RT1A 4ES2A 4J91A 2E1RA 2ZC4A 2WSEC 1SV5A 2VJVA 1VRTB 1XN9A 2DPJA 1SI9A 4ZVFA 1D9FA 3W8PA 3ZO7A 2BDPA 2M70A 1IKYA 4ED8A 5H9EK 1XMOJ 3ZTSA 5H9FJ 2HS3A 2K8GA 3MOZA 1U1RA 5CYMB 1RZMA 1S1XB 2X1AA 2JLGA 5DM6Q 1IWGA 1FRIA 1X7VA 1T3OA 2VFRA 5I42A 2M7SA 2HS4A 4RL1A 1E6VB 2KN4A 1HKAA 3KNAA 4IOCQ 4PZVA 1VRUA 4CLWA 4Q44A 4TQRA 1SIWB 1C4AA 4L74A 4LVNP 3J7A1 1N32F 2HFSA 2ZDOA 4OYAA 1AUDA 1N5TA 4IKAA 2ZBRA 1X4FA 2Z57B 5CHCB 1VBZA 1TUGB 4A47A 2EKYA 1D09B 1M90T 4B3SF 1TR0A 3TW0A 5HMYA 1S9GB 2JVRA 3DMJB 4P2XA 3OPKA 4U6PA 4CLUA 2M9KA 5KTQA 3H5SA 2V6AA 3NEKA 4I64A 2CNLB 2GVDB 1NZAA 5K20B 1FK9A 3KK3A 4YUDA 4XTTA 2MLXA 1UL3A 4QR0A 2EFGA 1RKJA 1O0PA 5KFJA 3CJKB 1VRTA 3OFFA 4E2FB 1NBEB 2BMBA 3H8YA 4TLRA 3G2XA 2N4DA 1CQMA 1NKEA 2G0IA 5BYSA 4EO8A 4A8FA 5HVFA 3HSJA 2WVDA 3GYNA 4DQIA 3LTOA 1S1XA 1Q53A 3NBPB 4JOUA 3M1VB 4HH0A 2KJWA 1E6VA 4NL5A 2VBYA 2QA1A 4I4BA 1VHFA 1F9EB 2XMMA 4C8ZA 5SZTA 1X4EA 4NLRA 3E8OA 4ED5A 3OTCA 2CQBA 3UDEA 1S12A 1Q81T 1Y5LB 1NK5A 2FHKA 1IBMJ 2EFQA 2IY5B 2XWXA 3ILJA 2V2QA 4LT6A 3BQ1A 1KVIA 4NZ6A 3UCZP 3Q22A 3G6YA 3HD1A 3HHLD 1S9GA 1DTQB 1GMWA 3U7JA 2ZH2A 2I5JB 3DMJA 3GTYX 3BPSP 1L3UA 3O2IA 2H5EA 2XYHB 2GVDA 2FGOA 3DRPB 3EXCX 4YHHF 4I68A 3CJ5A 4B9NA 1NK9A 4USMA 1RSCA 1U1NA 3P96A 4KHMA 1FD8A 3K5OA 3KJVB 2ZKUA 3EPIA 2ZH4A 1P9QC 3OT9A 1RCOB 3CJKA 3ULHA 4FXWA 1JLBB 3HLUA 1RK8A 2V2KA 1WDTA 1KQSR 2HZVA 3OL6A 2FDNA 1T7PA 4FPIA 4F7VA 3P6YC 3CCWA 4UUWA 4TLQA 3J7YI 1UVNA 1Y3KA 1N32J 2AGOA 3H5YA 1H38A 2Y0BB 2KRBA 2HLTA 3TX8A 4Z7CA 4PPZA 3VZHA 1KWMA 4ZHRB 3RU0A 2J7KA 3EPGA 4B3SJ 3I87A 1QAJA 1WOPA 3W64A 1NPKA 4K50A 1FFSB 4ED2A 2CWKA 4NCGB 3ISZA 3D1OA 5DRKA 3WDOA 5DLFA 2B4UA 4ZIWA 2FB0A 3EICA 1I1GA 2HVEA 2AX0A 2CUYA 1HI8A 4NYOA 4LMZA 4QWAA 1FX4A 2U1AA 1H2VZ 1N36F 3IWNC 4DU8A 1S48A 1S1UB 5KFUA 3D6TB 4JV5J 1R8HA 3D0GE 4JV0A 1X5PA 1JLBA 1ZAVA 2DXDA 1Q8KA 3A8KA 4PG7A 5HROB 2NZCA 1PIEA 2H5IB 1H0HB 3IAS9 2PA3A 3KXDA 1D3WA 2KG1A 1KQFB 3QT7A 1QTMA 2OUGA 1FDBA 4NLSA 3HCXA 4RUAA 3MPUB 1BXNA 3FNNA 3CTRA 1S1TB 4FYWB 3CC7S 2ZDPA 1K0VA 3MAAB 5HP1B 1NEEA 1PO6A 2XMJA 4ZHRA 4NLUA 3C66A 4KGKA 2R3VA 3KKFA 3L7OA 2XZTB 2DH8A 2Y0SD 4AL7A 2C3OA 1RYSA 4I2QB 4B3RF 5AXMA 4C98A 2KT3A 2BM1A 3DLBA 3T41A 1UVIA 4YHHJ 3KHLA 4FS2A 2B9YA 4ERDA 2ZKTA 1TQLA 5A8WB 2XSJB 4OYPA 4DJBA 1VR6A 4LFCJ 1NKBA 4D3HA 3R97A 5FLXU 4P6QA 5HVGA 4UQGA 2C22A 2L9DA 4PXBA 1T8EA 1S1UA 5FJ4A 4EFAC 2R7UA 3AJDA 1LWCA 2XZDB 4WFAQ 3T5HA 2OPRB 3H2UB 2V68A 2COLA 2QG9B 2DGXA 2HYIB 4KFBB 4NLVA 3RB0A 2Q6CA 3LAMA 5HROA 4K4VA 2DY1A 4ZLPA 5FLXY 3PCOB 1ZM9A 4OIXA 1VIXA 8RUCA 4F50A 1OJ4A 2QJ3A 5KFYA 2RS2A 1RTIB 2LXIA 4TU8A 1WELA 3K0JA 1S1TA 2V4JB 1P1TA 4Z2XA 3KWMA 1RAEB 5HP1A 3MMJA 1LWXA 4EWTA 2AJ1A 2MJNA 3MD3A 5J1EA 1SQEA 1KQKA 2VASA 1NKCA 1DBDA 4DPUA 3DOLA 1UPPA 5I3UB 1FXRA 2J0WA 2QT7A 1JXEA 3ONQA 2DNYA 1N36J 2FY1A 2JVOA 3JTOA 2YQ0A 3D7SB 3CCVS 1ACMB 2FVPA 5CA5A 5A8WA 2DT9A 1URNA 1R31A 1X5OA 1NDPA 3NWGA 1S0MA 1YBTA 1JLFA 3GG0A 4DV2F 2A10A 1C0TA 2ZWOA 1GH8A 2ZVIA 2DGQA 1S77D 1Q0NA 1H7WA 4OI0A 5KFLA 3CJ0A 3DXBA 3KLHB 2PDAA 3C46A 3AA9A 1UJ5A 1FDDA 2HFUA 2VPYB 3K57A 1RA6A 1RGVA 4KFBA 2RDIA 3F44A 4M5GA 2KHCA 3H98A 3R5GA 1I94F 1C1CA 3ZZRA 3D54A 3GIRA 2W2PP 1Q1KA 1WD6A 2HVDA 2DHHA 2GQCA 4F0KA 4DS5A 3CB4A 2KHDA 2RQMA 4YDXA 2V4JA 3OFHA 1KC8T 4JI1F 2YPYA 4UOCA 2ATLA 4B3RJ 2AV5A 4FPRA 1ELOA 4YB6A 3UVJA 3FCVA 3IRXB 2OPQA 4ID5B 2MZQA 4OYOA 4TVAB 2KXFA 2BJ3A 3LAKA 4EZ6A 3B4DA 2XEXA 2CQDA 4NEYA 3VVTA 1LV5A 1ZETA 3RBDA 4XK8C 4NYPA 5GAEU 1VHIA 5DDPC 1ZPVA 1N8RT 1XTZA 4RR5A 1PJ6A 2CQ0A 2EC0A 2YNIB 4CLSA 4NCAA 1RWWB 1RA7A 2C3YA 3K5MA 3N28A 4QWBA 2VU5A 2RQCA 4O3NA 2V8GA 3HVAA 1GMUA 2CJYB 1IR1A 2DNOA 2QFIA 3JTPA 2XI3A 2AEMA 3R2CJ 3KLHA 1REVB 1PJ5A 4G6VB 3M2UA 2DGUA 3FUYA 3MD1A 4DSEA 2BJ7A 2HBQB 3NCQA 4I7FB 4UY8T 5IV3A 2JC1A 2CQ1A 1FXLA 4DG1B 3CCTA 4FXVA 4H54A 1UTAA 3UCUP 5JVHQ 3CD5A 1TAQA 4JI5F 3ITHB 2B5JB 2RF2B 5T7LB 1Q79A 1M5KC 4NLDA 1IXKA 3HHLA 2LU2A 2E7WA 1IVZA 3G96A 2IA0A 2E5HA 3CDBA 3IRXA 5JVGQ 1NH8A 4A8QA 1WG1A 4J5OA 2Q3PA 2QE5A 2FIUA 1RHMB 2LU1A 5E3AA 4CLTA 1FRMA 5HQLA 4DBQA 4LF9J 2BANB 1S97A 3OW2R 1NH7A 1X4DA 4DV2J 4B3OB 4CO0A 1QSYA 3KJNB 1TFYA 4KYZA 2OGUA 4MFBB 1NMEB 4RNHA 2GS8A 3CCLS 2AF6A 2VBWA 2MQMA 4X62J 4RU9A 2ROGA 3M4XA 5E7OB 2XHCA 3RBEA 2UUBJ 4LVOP 3MHYA 1JXVA 3I6PA 4LIRA 2W4DA 2RQKA 5F41A 1WUUA 4FDFA 3HJVA 2YWGA 3HJFA 1REVA 4CTAA 1I94J 2GMLA 4CNYA 1JJCB 2F9DA 1F9HA 3MURP 4I7FA 3TA2A 3OTDA 2EK6A 3UWTA 4DG1A 3R5JB 1KTQA 5D0RA 5HAOA 1FE0A 3M8QA 1YRXA 2XMVA 3R7BB 1R8PA 3ITHA 2B5JA 2RF2A 4OL8A 3PJXA 1WC4A 3GIKA 4DN0A 5DDQC 4IQXA 2HNDB 3NKYA 3R1HA 4RPFA 4IUFA 5LXYA 2HFOA 1TL3B 2DB1A 3W9JA 1FI4A 3DDNA 4YY3F 3HI9A 5CABA 1BMQB 2A2CA 4LJMA 1MROA 4U95A 2MZSA 4DCPB 3IWLA 4B3OA 4FN5A 2R7XA 1DTTB 2M4MA 3I0SA 5DGAA 5KOXA 2FD2A 4NI2A 4ZN1A 4DL4A 4PQUB 1X31C 4MYUA 2KVIA 4I6AA 4ILMA 3JQMA 2FJAB 5CD4A 4PQAA 1VQ9S 1WF2A 2GAHC 4CT8A 4F2RA 2VKZG 4OYXA 4CH0S 2F9JA 1RWMB 3QSYB 2QC3A 4YR0A 1RB0A 2MQOA 2XSFA 3ZTOA 4CLYA 4P73A 1SQGA 3RAMA 2MKHA 4F0MA 1NRKA 2GFFA 5KT2A 1B3TA 2VQEF 2HIYA 3CIMA 5D3GB 2H4WB 3NGDA 3J80Y 4P75A 3RZAA 3TANA 2HNDA 2B9XA 4KGXB 4IR9A 4M5DB 2K3KA 3OTOF 1U6FA 2V2ZA 2JZ5A 3L95X 4K59A 4AUKA 3KK1A 2DPIA 1FT8A 4IG0B 3LUYA 2XS7A 4TN2A 4XIUA 1DZ5A 5F8JA 3N5BA 2JFDA 3FBFA 4X4TA 1EP4A 2BUNA 5IOLA 2OSRA 2MKKA 2O3DA 4PQUA 1WHVA 2EFPA 2WB1D 3MUVP 3BN7A 4Y65A 4AYBD 2ACYA 2IC3A 3OXFA 1TFWA 4E98A 3F41A 1KOHA 4U7CA 3NCPA 3W61A 3RBXA 3MECA 4LQ3A 2LQ9A 3KUHA 3RRGA 3BPDA 3ENWA 1Q7YT 3EZ5A 3B4MA 4M95A 3ETMA 4EBCA 4RX6A 2B4OA 4J90A 1NHKL 3DDKA 1Y5NB 3W9IA 4KRWA 1YSJA 1Y3JA 1RT2B 5THWA 1FEEA 3AA8A 3PW4A 3LH2S 4YY3J 1HD1A 2H51B 2ZWPA 2F1FA 3T9NA 2XI2A 5ETLA 3IGVA 2VUGA 2YTCA 2QL9B 4KV8B 2W7OA 2HVZA 4NMLA 1WC1A 1HI1A 3NOCA 3ZZPA 1NAQA 4OHVA 4I6WA 2QMXA 4NLQA 5DO2A 4JUZA 4IG0A 3OUYB 2O01C 2JL9A 4OLPA 1FWPA 4KBIA 5F8IA 4JI2F 1BD6A 3SEOA 3VCDA 4USJC 3CXCR 5KFOA 3M9MB 4EMDA 5L1KA 4C9DA 2ZC3A 3PTWA 1NK0A 1NXIA 2Y1JA 2CPDA 2MDAA 1XJWB 3GP9A 1BQNB 1Q7LB 4EK2A 3K17A 4ED1A 1QSSA 1AFJA 1FXDA 4HTIA 1RTDB 2DNLA 3DRSB 3W2VA 4OZ5A 5LSOA 2ZEJA 4DPYA 1B0VA 2VQEJ 4PWUA 2HHPA 2C3MA 5K8MA 2IYIA 2NCKL 3OHBA 4KE5A 5J2NA 5B0GA 1RT2A 5IM0A 2ZM6F 3M32B 3OTOJ 1FFGB 3W3SA 1RHQB 1WACA 2QMWA 2V2VA 2GHVC 4RJVA 3WHIA 1WOSA 1RADB 4LSNA 3UNGC 2VFTA 3NS6A 2HQFA 3T19A 4Q5VA 2J9CA 3QYYA 4J37A 2EFNA 3QNWB 2L9NA 3BO2A 4ED7A 4OI4A 4ZP9A 1RLCL 4NX9A 4OV6A 3OUYA 2YWHA 1TELA 4F4ZA 1NM2A 4Y6IA 4X84A 4PKDB 2BKNA 2XLIA 3OXLA 1RT3B 2HKEA 1IBLF 4HI1A 1C2PA 3OTEA 4OLOA 3AOBA 1KLNA 2ASDA 2DH7A 2E7VA 4RLEA 3DRRA 4Q0BA 1B4SA 3R9LA 2ZH3A 3TX0A 4CDIA 5IZHA 2F8EX 3SCKE 5KOWA 2YKNA 3DLGB 5L1LA 1F0XA 2VIHA 2VPWB 4NRTA 4QR1A 3BKUA 4CWBA 2B7CB 4LF5F 4DL0C 3KLGB 1DQ8A 4F8RA 3HM9A 1HR0J 3ZTPA 1HL6A 4HDHA 1YX2A 3IBCB 3FSIA 2DHXA 1UWBB 3NS7B 2KH9A 2WHOA 3M8SA 1SKSA 4OX9F 3M32A 4Q45A 4AXIA 3QRRA 4DI6A 2XNRA 2NPIA 4JB8B 4ED4A 1OYDA 4X4RA 1PAUB 2SXLA 5DGBA 1VISA 4XAKA 4JI2J 3BKTA 3RW6A 4LF2A 2H48B 2HGNA 1QUPA 3CDUA 2DKOB 3IN5A 2JLEA 2QLBB 1T9WA 1CULA 4Q8FA 2AHOB 3KHRA 3DLKB 3GCXP 3M7VA 1VI7A 2IMWP 3HFVA 4O4RA 5A2QU 1XR5A 1BQMB 3W62A 3IO1A 2HAFA 4O3OA 4EEYA 2KM8C 2HQDA 3GR0A 1KTVA 3THVA 2QRRA 3H59A 1FESA 1R0CB 5L9NA 4CLZA 4HVZA 4OX7A 2FHJD 4DX8H 6AT1B 2N7CA 1FWKA 3QIPB 1OQ3A 1C1BB 1S9FA 3GE9A 3BR8A 1RAOA 3KOAA 1MMDA 5LMNF 1RTJB 1U0SA 4WYLA 3DYAB 2HRTA 2AX1A 4QIVA 4LRBA 3EE3A 3DHXA 5KG2A 1UWBA 1ZBTA 1IJEB 1U24A 1N54B 4WKYA 1U4BA 4DEZA 2R2SA 5KFXA 3ZZOA 1FNMA 1HWUA 1ZTTA 2W9CA 2JEGA 4MIBA 4RUBA 2CJBA 3UN2A 2OEMA 1H3DA 3QRQA 2IAJB 1GT8A 3HP6A 1P6TA 6FD1A 3VHQA 3TUPA 2ZJPQ 2E66A 1IBLJ 4WXWA 5AE1A 3V4IB 4LUBA 1F9FA 3TVYA 1Q8BA 3DLKA 3H2VE 3S01A 5D77A 4LFBF 1FJEB 1CSJA 4N8OA 4IO1A 4IH7A 3G4SS 5IC6B 3J81U 3I9V9 1K44A 2M0GB 1NK6A 2DR8A 4AT1B 4P9SA 1M5VC 3UQSA 4CLKA 1NDKA 4HTJA 2GA7A 4LF5J 3KMQA 1CVJA 1R0BG 2D9PA 2LA6A 2E9TA 2KYXA 3N79A 3QJJA 2OJ3A 1C1BA 2KB2A 4OX9J 4Q2LA 1HNXF 2A0FB 4BS2A 3NRBA 4YMEA 1RTJA 3ZNUA 3J81Y 2C3PA 4HEA9 4Y2AA 5A76A 5FDLB 1RHJB 7FD1A 3MCOA 1B7FA 3Q8QB 4ZVPB 3KG0A 1JLQA 3HX9A 2B8PA 4OZ3A 2GJIA 2B6AB 5GAEI 2EFVA 3VAMA 5LL6d 3H40A 5CYQB 1X9WA 4DOZA 3OL7A 4PCQA 4IFVA 4I2PB 3KJQB 1TKXB 1FD2A 3N6MA 1HQ2A 4IOBA 3HT0A 5CCMA 4HHHA 1JIHA 1CBKA 2FPHX 1JLAA 2MHEA 2OPSB 5KG6A 4F02A 3IG1B 3RAXA 1Y5IB 3HSGA 2CJ9A 2E5IA 4KGMA 4ANEA 2XC9A 2EK1A 2PD1A 4CZCA 4J9RA 2R8HA 3IWXA 2HRYA 1TKTB 2E9RX 4AL5A 1U02A 3GMGA 2XG8A 2OFGX 1WOOA 2GAGC 5LMNJ 1BHNA 3UD4P 3BH7B 3Q8VA 3KUGA 2OIHA 2IVMA 2C2NA 2ZNZA 3BM7A 1FKPB 1IWAA 3W2WB 1DAXA 5C2GA 4ELVA 1CEZA 2RB7A 3FSXA 2OSQA 4GC7A 2NUHA 3NWRA 2DISA 5FDLA 4OYZA 1VLYA 4J9PA 2LDIA 3PV8A 2DD8S 1U48A 2B6AA 5JUMA 4C11B 4RNMA 3SBMA 4CO1A 3MFHA 3EYZA 1H7XA 3J7AN 5CYQA 2N3OA 4HT5A 4WFNQ 2ZH6A 4I2PA 3RRKA 4DQSA 4LSLB 2XHWA 5KFDA 2XY7A 1SC4B 2CQ3A 2OPSA 3IG1A 2W25A 3IXQA 2HURA 2HWTA 2MB0B 2HGMA 4J9MA 2HS0A 1WI6A 1TKTA 2H5JB 2P5VA 3RBZA 1S6OA 4NA1A 1RWKB 4C8LA 3S1TA 2MQNA 1XR6A 2GV1A 4DR3J 1XIQA 1N48A 2GMJA 3KHHA 3TZYA 4ECRA 4DFPA 3MM7B 1WKJA 2PA8D 3MPYA 1X0FA 1REGX 3VAKA 2NQPA 3TJAA 3TI0A 1C0UA 1VC5A 4TY8B 2YNFA 5K8OA 1GXLA 1P27B 3W2WA 4KKOB 2G4BA 5DLGA 4Y2IA 4ZKAA 3FMBA 4ER8A 4ZLJA 3FCHA 2IRYA 2FZCB 2FGCA 1M0SA 4R8UB 4CLFA 2K2PA 4C11A 4L3KA 1OMSA 3CJ8A 2QLXA 2VPZB 4ZPDA 2L48A 4OQJA 4KH1B 2XMWA 1EHWA 4O3RA 3DLJA 3M6UA 1H98A 4QYZJ 5GAHU 1DHMA 2DGOA 2FVRA 4WZQA 1IKVB 3FZ2A 1U6BA 1VQYA 2AKWB 2RRAA 2Y3YA 1ITPA 2ZH5A 5HMXA 2XGPA 1GX5A 1XEZA 5FIIA 4WFBQ 3PKMA 2VJUA 4YR3A 4C8MA 3CMAS 2FHMA 1H72C 5I3PA 1FRKA 2G1DA 3VQSA 4DR5F 4X4UA 1TK5A 2PMZD 1E6YB 4X66F 1BWVA 3L09A 1A0OB 1SJQA 4TY8A 2Q6BA 2DK2A 4X4SA 3DM2B 1YHQS 1HD0A 2R8KA 4OV1A 2WOMB 4KKOA 1CQNA 3EWGA 2VONA 4CM2A 2KVQE 5U47A 3E01B 3SZ2A 3PW2A 4LSZB 1ZAWA 4U96A 1TMJA 1RWXB 1CC7A 1FKOB 3BQ0A 5C24B 4YEAA 4DUYF 1KS2A 5J2PB 4DR2J 3MMAB 2VHGA 2M5YA 2V94A 1LW2B 5D4LA 4N56A 4WKRA 2CJQA 2XWYA 2PMWA 2R7SA 2EPIA 4JI7J 3IP0A 2UZAA 2VFSA 2D3O1 3M2RB 1JK9B 1X60A 2YY3A 2DH9A 2LEAA 3BO4A 2RDDA 1ZPWX 1XNQF 1IKXB 4XO0A 5ETVA 2JRSA 3ZZUA 4PG8A 4RW8A 2M8DB 3PFOA 2CPEA 2IIHA 4X4VA 4P7TA 3K58A 4DS4A 4AE5A 1WI8A 3KLEB 2GIQA 1BUXA 4OZLA 1HNVB 3OLAA 1EQ0A 1YZ6A 4ETZA 4ZP8A 3I0RB 4CO3A 1SKWA 1OY9A 5KG3A 1E6YA 4D3GA 2R8GA 1DRZA 5DG8A 1Z2ZA 1WORA 3DM2A 2LP4A 4X4PA 3KDNA 4MYTA 2AYGA 1NB7A 2E29A 4L6V3 1PAEX 1WKLA 2NR0A 3E01A 5KFEA 2CPXA 3QZ8A 4M94A 1HW9A 2UXBJ 5T14A 2HW3A 4E8UA 4PUOB 1FKOA 2XS2A 2RUGA 1TL1B 5C24A 1VC6A 3PEJA 1NJIT 1QDUB 3H25A 3OVBA 2MY7A 5ADZA 5J2PA 4CNZA 2KKHA 2GIFA 2RILA 1FRXA 2YKAA 1UMJA 1IR2A 2JLFA 4NLWA 4DLGA 2PGCA 3K2YA 1T11A 4A8YA 2CKWA 1Q95G 3OL9A 3GJTB 1NDLA 1WKKA 1R27B 5ETTA 5B09A 1LFPA 2MTLA 2VB6A 4C0HA 4WTOB 2YQ3A 1IKWA 4M8LA 2CQPA 4JI4F 4JV1A 2HBRB 2W8KA 2JX2A 4DR5J 2GIRA 2QIFA 2W8LA 4A8WA 4R0EA 3KLEA 3NCRA 2E7XA 4X66J 1G6BA 1HBMB 2VODA 3GV5B 3SCIE 1V3RA 4K7QA 1WSRA 2CWXA 3I0RA 3A8JA 4W4MA 2CZ4A 2DTJA 1RAJA 5D78A 2WW4A 5L1IA 2Z30B 1ZZNA 1B70B 3IR6B 4ATNA 4NLOA 1SC3B 2OP5A 1FVSA 1F5AA 2UVRA 1GFWB 4DUYJ 1D9DA 2DNKA 1RTHB 3PHTA 1FF2A 3FZBA 4LRAA 2PIIA 2V50A 2LLZA 4WP8A 3EX7B 4DFJA 1NJXA 4PUOA 1QSLA 4Q7AA 2XBPA 4ZPAA 1TL1A 3IS9B 4FNIA 1B0PA 1RAHB 3HULA 4U7UD 3JS9A 2XTJP 3B8HA 4EZ9A 3NS5A 3HT3A 2ASYA 2YVSA 1XNQJ 3V6HA 2AGQA 5GADU 5F8GA 2HQ3A 2J9DE 1X4CA 3LP1B 3K8WA 4WXOA 3SSRA 1PKUA 2LXFA 3AOAA 1S76D 1SJFA 4DL6A 2UUCF 1ZTWA 1IR0A 3IM9A 2MMYA 1W2BR 1RISA 3I32A 4F3OA 3LPEA 3RR7A 1U26A 1VMBA 3J7Z5 5D8HB 4EBEA 4NCBA 3QJLA 2R42A 3Q83A 4AL6A 4WU2A 1JNZB 3VQTA 3KLFB 3ZZZA 1KHWA 5C25A 5KFFA 2AMCB 1U1KA 1DQ9A 1M1GA 3MM9B 3I55S 2P6TA 1T05B 4F04B 1SUQA 3Q8RB 2V9WA 3CCES 1GAOA 1AW0A 4UUXA 2XGQA 5J1NA 1TZ0A 4HT7A 5KG7A 3B54A 2FVQA 3W65A 1S0NA 2H3EB 1S6UA 3R2DJ 5EWFA 3AXMA 2D3UA 1UEVA 5DQHA 2OKQA 3IS9A 4GO5X 4USVA 3CEDA 2AJ4A 2PO4A 2VDHA 1FERA 2RDJA 2VQFF 1J5OB 1FRHA 5AE3A 2YQ1A 3JQJA 1N0UA 5A6WA 2KI2A 3KUEA 3M30B 4QIFA 2DR6A 3UO0A 5IQ6A 3C16A 3OVSA 3SDEA 1GEHA 3GR1A 3VAFA 2XS5A 3P4UB 2ZJQQ 2GZOA 5D4NA 5KFSA 1O51A 3QATA 2KL8A 1SL2A 1QVFR 1D0EA 4USKA 2BZ2A 2JOQA 3ZZTA 3OSPA 2P6SA 1J5EF 3I96A 5DDRC 1TKZB 3KLFA 1EAYC 2C28A 3TAPA 1S0OA 4PR6A 3QBCA 4G65A 3MM9A 3FQKA 3D3BJ 3GYGA 2J9EA 5EWEA 1OIAA 2W2MP 1T05A 1XNRF 2W4PA 2CA9A 1SB6A 1A9NB 2ZHBA 2RVJA 3BBBA 2BRKA 5IC4B 1XBWA 3R5DA 3RTVA 2GJ2A 1JMTA 5KG4A 3M9NB 1S1WB 2R7VA 2QA4S 2BX6A 4M63A 1RTZA 4NLXA 4CM0A 3G82B 5H9FK 1M5SA 4JYAJ 4V19X 2O66A 2YKPA 3D28A 3ISNC 3DI6B 4JI0F 2WVFA 5KT4A 3TUZC 3HF5A 1J5OA 2UUCJ 1GTHA 1NK7A 3BKFA 4F3QA 1DARA 4GVLA 4JI3J 3LOUA 4USWA 2RAQA 3M30A 3OR2B 4LQ9A 5GAGU 1NU4A 2PI4A 4MK7A 1YIJS 1X5TA 2MY8A 1TKDA 3OFEA 3PW5A 4DV3F 2F63A 5AXKA 1RAFB 5HMWA 2DJWA 2W01A 3EDQB 2WAQD 5HBMB 3D9BA 2ZHAA 4X64F 2HFNA 3MM8A 3MPWA 3TUJC 1BLUA 4C0OC 2NUUG 2XCAA 4ZJLA 1CJVB 2WONB 2UXCF 3LP2A 5D0GA 3CD0A 2JWNA 4DMZA 2C3UA 4PWWA 5HK4A 1SV5B 2HK2A 5C7PA 5K5MA 3G8QA 2GNKA 1TP7A 3FFIA 4OHYA 1U1MA 5J1PA 2EG1A 5E2QA 2MZRA 1S1WA 1UZDA 3QFWA 2OPPA 4URGA 1MN7A 4NA3A 3J81j 2VQFJ 4CRJA 1HQEB 1ZAXA 2NPFA 3RB3A 2HRUA 1RWUA 3TQEA 5I42B 3MUTP 3DI6A 4WFXA 3DDIA 4QYRA 3JQKA 1MWQA 4NASA 3O8WA 3WIUA 5H1SV 3QT6A 2V8HA 1TVRA 1YI2S 3LF0A 3ZTRA 3AFGA 1HNZJ 3OR2A 1VQSA 2C2ZB 3DLEA 2EXUA 1PCAA 2YKQA 3KDOA 2AEJA 1SH3A 1XC9A 1QY7A 1J5EJ 1IUJA 2DHGA 2I9SA 1GK8A 1IBMF 1BC6A 3PFEA 1UW4A 4RW6B 4P2SA 4RKUC 2CPJA 4RUHA 4F25A 3KK3B 2WBMA 5EGYA 4LR7A 3W8GA 4KJIA 1TV6A 1CJVA 5KFMA 2WONA 2NREA 2VC0A 2NYIA 3MCMA 2QA2A 2MQLA 4L3NA 1M1HA 3C6UB 2KJVA 2XCPA 9RUBA 4UZCA 1UA1A 3FBCA 4C8YA 2FLPA 1UZHA 1ZA2B 3TJ9A 4KAIA 4JI0J 4BHQA 1RI7A 4BDPA 5IV4A 2OLWA 4DU7A 2BOAA 1BWEA 4KO0B 4PPDA 1HQEA 1CC8A 1U2RA 3MMCB 2K7JA 2H4YB 2JC0A 1NSKL 2LKZA 5L38A 5E0OA 3DU6A 4DV3J 2HZAA 3FCWA 2JH3A 3TRGA 1Z4UA 4QPXA 1UFLA 2RNEA 2BV3A 4X64J 3P3DA 2HLUA 1S9EA 1S6PB 4IRDA 5D15A 4DV4F 4CO4A 4U67Q 1PILA 1JJ2R 3GQCA 2UXCJ 1LXJA 1FHTA 4U8VA 3HVWA 2G13A 3NGRA 4RW6A 2KDOA 3TQ1A 4HHJA 4ZLLA 3H4BA 3G6VA 1X4BA 2HHTA 2I0XA 3M8ZA 4F3MA 2CJAA 3SCLE 3UD3P 2NXCA 3C6UA 4X65J 2IM0A 2D7SA 5KT7A 5GVQA 3CPWR 1MMLA 3VZIA 3RG6A 2VV5A 3ZC4A 3MFIA 3GIIA 5F8MA 4JV5F 5I3QA 1ZM2A 5AE2A 2KYZA 5KT6A 4ZVEA 1I6JA 3CUNA 4E0DA 3WC2A 4KO0A 1EARA 4KH0B 3G8TA 2D3ZA 3MMCA 3RRHA 2CDQA 4R25A 5GAHI 1GX6A 2KO1A 4QOTA 3TP2A 1YZ7A 3JXOA 2IDLA 3MAHA 4ELUA 2V4RA 3UI3A 1P8GA 3V5RA 2AU0A 2DEJA 2ILYA 2UVUA 2ZFHA 3QT5A 1VQ6S 3MTKA 1YJNS 4C48A 5E3QA 4KT0C 5M2PA 4PABA 5HJYA 1S6PA 4RNNA 4IFYA 2ASJA 4B3TF 3HVTA 1IN0A 1EKSA 1ZH5A 3L7PA 5ETSA 3EXYA 1Y4ZB 1WEYA 3EDRB 2QN6B 4ZMMA 4WYWA 4YS2A 1KD1T 4RW4B 2ZH8A 4G3IA 2AGPA 3UPFA 2MKJA 2VOPA 1WJ9A 3IAM9 1VQKS 4LFCF 3CMQA 4ECZA 2BR0A 3C6TB 3ETOA 5B0BA 1TUVA 3ENVA 4PRFA 2HG4A 3DOKB 4PXDA 5E33A 2PI5A 1VQ8S 1P1LA 5KFCA 4C6AA 3CC4S 3NAHA 2V0NA 4ZA1A 3EGNA 1S0VA 1OY8A 2ZJRQ 2VA3A 5BXIA 4EYIB 3H2LA 5AXLA 2W1BA 3KFWX 2ZBPA 2W9BB 4M5HA 4DV4J 3ET6A 1LKZA 4DX7A 1Q5VA 1VK8A 2AQ4A 4ZPVR 5EX3A 2HPUA 4P2MA 2QLFB 2UUTA 3HKWA 2JDJA 1KEKA 3BSCA 4FF2A 3RW7A 1IJFB 4FS1A 4X4NA 3T5LA 3IBFB 3EVMA 1AZSA 1J27A 3THTA 1KQGB 2DGSA 2IJNA 2XQCA 3FMWA 1XK8A 1Y9OA 4RW4A 3V6DB 1ICEB
chains in the Genus database with same CATH topology
1B0TA 3DU5A 2M8HA 3K5NA 4RBTA 4FXDA 1QE1B 1VQNS 3IO1A 3FQLA 3TNVA 4O3OA 1F5CA 4EEYA 3NG8A 2KM8C 1VGYA 3UW1A 3NMRA 2IJFA 1LWCB 2ZNYA 5DDOC 4BCAA 7FDRA 3CSKA 4IO9Q 2B4VA 1X8DA 1V9OA 2J9DA 3C6TA 3CE8A 1U09A 3M6XA 2DR7A 3Q8SB 5L8RC 3HO1A 5B0EA 4HL9A 4UQTA 3GR0A 3K5LA 4YB7A 2UVWA 1KTVA 4U7UK 3THVA 3LGMA 3LO3A 2QRRA 2K1RB 3H59A 4WU3A 4N76A 1FESA 5L9NA 4WE1B 4HVZA 2BANA 4OX7A 2PC6A 5F8LA 2VD3A 2R2UA 2FC8A 3DOKA 1N56A 2D9OA 2E1AA 2FHJD 4MTPA 2PN6A 3L3CA 2GCFA 5DJBA 2X51A 4DX8H 3X1LB 1JLGA 1R7IA 3Q24A 2N7CA 1FVQA 5A8RB 5HLFB 3QIPB 3LWMA 1OQ3A 4NXNF 1C1BB 1TKZA 3SMZA 1S9FA 1EETB 3GE9A 1RT1B 3PNIA 4MFBA 3U1MA 3BR8A 1S99A 3KOAA 1ZM3A 3C3LA 1N5YB 1MMDA 2ZZNA 5LMNF 1RTJB 2AYEA 2LVWA 4DSLA 2AJ0A 4WYLA 2IYGA 2XZWA 3DYAB 3CDEA 2AX1A 4A8XA 1JX4A 1MU2B 4QIVA 4YOEA 4RW7A 4XPCA 4ZOSA 3K59A 2CPIA 3DHXA 3LQVA 3BN4A 3LP0A 4XDDA 3UE2A 4ZCMA 5B08A 1UWBA 5K8PA 1ZBTA 3SV3A 2PEHA 1IJEB 1U24A 1WG5A 4GKJF 1N54B 4WKYA 3CCMS 3RYLA 5D4OA 4BWJA 1LK5A 4OZ1A 5DM7Q 4QWEA 1U4BA 1T95A 4MIAA 2B43A 4DEZA 2MXYA 2AJFE 5KFXA 1IKWB 3O6QA 2W9BA 1IKYB 1Q78A 1YRTA 3ZZOA 1FNMA 1HWUA 5J1EB 2CQHA 4K5RA 5EWGA 2W9CA 1ZTTA 2JEGA 3NNHA 4LF8F 5IT0A 2VOOA 2FHJA 3JSYA 4MIBA 2CJBA 5C42A 1S79A 4DR1F 1H3DA 2E44A 2CFXA 2IAJB 4ICLA 1JWWA 2ABYA 4K4UA 3SV4A 2YNGA 1GT8A 3HP6A 3T1AA 1P6TA 2OAUA 1VJWA 3DOLB 4KR0B 2IBOA 4RBUA 1Q8LA 6FD1A 2MYFA 2I2YA 2I1RA 1NJWA 4JI6F 4BBYA 3D1HA 2JJ4D 3BO3A 2ZJPQ 4A46A 2E66A 3MTJA 4WXWA 1HBNB 1KR4A 5AE1A 3V4IB 1KFDA 1HBOB 3UDLA 4LUBA 1UJ4A 1VRUB 2Q66A 5F8NA 1DURA 1MNEA 3V6JA 4J9OA 2DR9A 1F9FA 1QM9A 1MWZA 3BGRA 1J2VA 2MGZB 3TVYA 2CPZA 3LW5C 3D1QA 1Q8BA 1NO8A 2LQBA 2OMLA 3DLKA 3H2VE 3S01A 3WX4A 4R5PB 5D77A 1HWIA 4LFBF 2ZITA 2HQIA 4Q43A 5M2UA 3LALA 2C2EA 1JLFB 1FJEB 1CSJA 4N8OA 1TK0A 2HHVA 4IO1A 2XMKA 4IH7A 4MJKA 5KAKA 3G4SS 3V6DA 2AD9A 3P5TL 1L3KA 1C0TB 3I9V9 4DSJA 4AXJA 4KPYA 4C3MA 1YQHA 2M0GB 3N01A 4B9VA 2RU3A 1T94A 1RP5A 3PX6A 2GQ2A 1QE1A 1NK6A 3HHDA 2DR8A 4O44B 5A0YB 2A3JA 2IFXA 4ITSA 1QJHA 1X4AA 4CH7A 4G1PA 4QWDA 1TL3A 2D41A 3AQOA 1M5VC 3UQSA 3UR0A 3GG1A 1D1UA 1A7GE 1FTRA 3G6XA 1FRLA 3CWJA 4HTJA 2KFYA 4WCEQ 2GA7A 2YX7A 4RNOA 3MI7X 2DNQA 3KMQA 2J6TA 2K1RA 3QJPA 4WE1A 5CQGA 5HBMA 2VFVA 3CGIA 4K5SA 1CVJA 2KT5A 2D9PA 4ETXA 2LA6A 2E9TA 3HHKA 2KYXA 1S49A 3DN9A 3N79A 4MAKA 1DTTA 2MJUA 3PW7A 3QJJA 1FK9B 5A8RA 1HI0P 2OJ3A 5GADI 2M3DA 1C1BA 1JLEB 2KB2A 3FEZA 5LJ3Y 5I4MA 1C1CB 4Q2LA 1EETA 4DQRA 1KOOA 1RT1A 2AW0A 1HNXF 1SL1A 2CJKA 3NRBA 4YMEA 4BS2A 5K9FA 1N5YA 4ES2A 2W9AA 1RTJA 1F60B 3J81Y 1NJYA 2C3PA 3KG4A 4C8OA 4GKKF 3PRBA 4HEA9 4Y2AA 1S72S 4C2MA 1A6LA 2E1RA 2ZC4A 2DCUB 4O3PA 4KB7A 5CH7B 2ZUGA 2WSEC 4TXSA 1ZYQA 1YWXA 2Q1LA 1SV5A 1RJJA 4GMKA 1VRTB 5FDLB 1XN9A 1V6HA 2DPJA 1SI9A 3MEDB 3PZPA 4ZVFA 1D9FA 7FD1A 3Q8PB 2BDPA 2J76E 2WSFC 4DSKA 1B7FA 4XPEA 5F9LA 2M70A 3Q8QB 1IKYA 1N34F 1H2UX 2VG5B 4ED8A 1SL0A 4P7VA 5DETA 3KG0A 5DQGA 1JLQA 3HZEA 2OPQB 3HX9A 5CD4H 5CXTA 5H9FJ 2HS3A 2K8GA 2WW8A 2GJIA 3T1HF 4QIGA 2B6AB 5GAEI 3CJ2A 2HZCA 2DBBA 2EFVA 2HVIA 2CQGA 2D1CA 3VAMA 3MOZA 4IH5A 1U1RA 5CYMB 1U1OA 2VFUA 5LL6d 5L1JA 1TL4A 2WSCC 3M8PB 1S1XB 5IWAF 2X1AA 2JLGA 3H40A 5DM6Q 5CYQB 1FRIA 1K9MT 1X7VA 1T3OA 2VFRA 5E3RA 2M7SA 3U02A 5I42A 1X9WA 4DOZA 2HS4A 1HBNA 4PCQA 3OL7A 1E6VB 2F4VF 2KN4A 4IFVA 4I2PB 3D5MA 3KNAA 2CRLA 1TKXB 4NLPA 4IOCQ 1FD2A 3N6MA 1VRUA 4Q44A 3N6LA 4IOBA 4TQRA 4ES3A 2UU9F 5CCMA 1SIWB 4DL2A 1JIHA 1S7HA 2VG6B 2MGZA 2FPHX 1JLAA 2MHEA 5C25B 1Q4RA 1C4AA 2OPSB 5KG6A 2L3MA 4LF9F 4LVNP 3J7A1 4F02A 1N32F 3KLVA 3IG1B 3RAXA 2ILZA 2ZDOA 3PACA 5D3GA 3AHPA 1Y5IB 2J6UA 2MZTA 1AUDA 2QYCA 1KRPA 1N5TA 2WRMA 4A8KA 3I31A 2CJ9A 5KFQA 2E5IA 4KGMA 4IKAA 2HNYA 2XC9A 1WG4A 3O1LA 1SUQB 2B4PA 2EK1A 1X4FA 4QWCA 3OBIA 5CHCB 1V3SA 2PD1A 2AP6A 4M5DA 1VBZA 2MZ1A 2HHUA 4CZCA 4J9RA 4A47A 2EKYA 2WBRA 2R8HA 2ZH1A 3IWXA 2HRYA 1TKTB 2E9RX 3KHGA 2HMIB 2GW8A 4AL5A 1M90T 2IM1A 4B3SF 1BY9A 3OQ2A 1TR0A 3TW0A 2LCWA 5HMYA 4X62F 3CF5Q 4RZRA 3GMGA 1S9GB 3PXGa 2XG8A 2GGPA 2JVRA 2OFGX 3DMJB 3M2UB 3OPKA 4U6PA 4OI1A 2UUBF 2KTQA 3VAHA 3UD4P 1VK3A 2M9KA 2VZ9A 5KTQA 3OXGA 3H5SA 4C0BA 2OIHA 2JHEA 2IM3A 5EDWA 2IVMA 2DR5A 4I64A 1O8BA 2ZNZA 1TK8A 2G0CA 1NZAA 3G9CA 1FK9A 1RDRA 3BM7A 3KK3A 1JLEA 4YUDA 2D3OR 1SH0A 3QMQA 4O3QA 3CDWA 1UA0A 1KNZA 2Y1IA 4JV2A 2R2TA 1FKPB 5B0AA 3PR4A 3W2WB 3GIJA 3VALA 1DAXA 2IRUA 3BR9A 1UL3A 4ELVA 1CEZA 2RB7A 4ZPWR 4JYAF 3FSXA 1JXLA 4TY9A 4QR0A 2OSQA 2POKA 4GC7A 2EFGA 3JSBA 3QGPA 1RKJA 1O0PA 2OH2A 2NUHA 2DISA 4RWWA 3BGUA 5KFJA 5FDLA 1VRTA 3OFFA 4OI3A 3CJKB 1F5BA 3BDEA 2RQ4A 5EHHA 3HVRA 3MEDA 1VLYA 4J9PA 2LDIA 1FA0A 3HHLB 5HI7A 4I67A 4C4WA 3H8YA 3FJ2A 2DCLA 1NHUA 2CVEA 4TLRA 3OLBA 3PV8A 2DD8S 2VG5A 2N4DA 1CQMA 3SDEB 1NKEA 2LEBA 2XLJA 1FKAF 2XULA 5BYSA 4EO8A 4WZMA 1U48A 4A8FA 4JI3F 4X4QA 1G7CB 2YX1A 2B7BB 3P49B 2R8JA 2FJDB 4B02A 2B6AA 1WF1A 3OJSA 5JUMA 4C11B 5F9NA 4RNMA 4TU9A 2E5LF 4CO1A 3MFHA 3EYZA 4WIIA 3GYNA 4DQIA 3M8PA 1S1XA 4KIAA 1H7XA 5HMZA 1Q53A 3QAEA 4MH8A 4DSIA 5DQIA 1YG0A 4IYQA 1WHXA 3EUNA 3NBPB 5CYQA 2N3OA 1VC0A 4HT5A 4JOUA 3M1VB 4WFNQ 4HH0A 2KJWA 1E6VA 4NL5A 2ZH6A 4I2PA 1DLOB 2DGWA 4OJ1A 1RT5A 3RRKA 2GMHA 2VBYA 4DQSA 5CCLA 5EN1A 1U1LA 2BJEA 2QA1A 4ILLA 4I4BA 1VHFA 4LSLB 2W24A 1FRJA 2DRAA 2XHWA 5KFDA 2VG6A 2CQCA 2XMMA 4C8ZA 1N33F 5SZTA 2XY7A 1X4EA 2CQ3A 4NLRA 2OPSA 3PIOQ 2C2RA 3E8OA 3IG1A 2W25A 4OJGA 3IXQA 1R8BA 4ED5A 3OTCA 1SH2A 1WF0A 2CQBA 5KFKA 2F40A 4USIA 2HWTA 3V6KA 1R6YA 4PWDB 2MB0B 1Q81T 1Y5LB 1NK5A 1SBRA 2FHKA 2DITA 3VAIA 2EFQA 2HGMA 4J9MA 2DO4A 4DSFA 1XR7A 2XWXA 1U25A 2YWFA 5BYQA 3CIZA 2HS0A 1WI6A 4MMOA 1R8CA 1TKTA 1R89A 3CD7A 4KV8A 4LT6A 3BQ1A 2HMIA 2PSZA 2P5VA 3N0VA 4FP9A 2E1MC 3QPIA 2C42A 1S6OA 1KVIA 4NA1A 4NZ6A 4C8LA 3V4MA 3S1TA 3UCZP 3TVKA 2J0XA 3G6YA 3Q22A 2MQNA 4CTAB 1XR6A 2GV1A 3HHLD 1S9GA 1N48A 4LF6F 1DTQB 3U7JA 4OI2A 2ZH2A 2I5JB 3DMJA 5KG5A 2GMJA 4NPOA 4DR4F 2O5DA 3KHHA 4ECRA 4DFPA 5E3CA 3MM7B 4YP3A 2BOPA 1FO1A 4USHA 2PA8D 3MPYA 1L3UA 3O2IA 2H5EA 5B0DA 1FEHA 1X0FA 1VQLS 4ELTA 3VAKA 2NQPA 2FGOA 4EUVA 3DRPB 3TI0A 1C0UA 2MKIA 4MKAA 1VC5A 2VG7B 3EXCX 4TY8B 2QA4G 4Y2KA 4YHHF 4I68A 2YNFA 3CJ5A 1IBKF 5K8OA 4B9NA 1GXLA 5DS7A 1P27B 1NK9A 3W2WA 2IHR1 3M8QB 4KKOB 1U1NA 3MGJA 2G4BA 5DLGA 3P96A 4KHMA 3EGZA 4RWXA 2FJXA 1FD8A 3K5OA 4JBCA 4Y2IA 4ZKAA 2ZKUA 3KJVB 3EPIA 3FMBA 2ZH4A 1P9QC 4OMFG 3HK2A 4PXCA 5GAGI 4QW9A 3FCHA 4A8MP 2IRYA 3CJKA 5LXRA 3ULHA 2QO3A 2FGCA 4FXWA 1M0SA 1JLBB 1BQNA 1HA1A 3FEXB 3HLUA 1N4LA 3MCSA 4R8UB 4M1KA 1RK8A 2MQQA 2V2KA 1KQSR 5HL7Q 4YFUA 1RTDA 3OL6A 2K2PA 3DRSA 3BSOA 2FDNA 4I6YA 1PSDA 1VS3A 1T7PA 3GV8B 4B9UA 2CPFA 2V4QA 3RB4A 4C11A 2R7RA 2HGLA 1HNZF 1HHSA 2QLXA 3P6YC 2VPZB 4ZPDA 2HVHA 1MROB 3CCWA 4UUWA 2L48A 4OQJA 4TLQA 4A8SA 3J7YI 5KFTA 1Y3KA 1UVNA 2AGOA 2XMWA 3H5YA 4O3RA 1H38A 2RH3A 4FF3A 1DLOA 3DLJA 3AJ2A 3M6UA 1KVJA 3J7ZT 1VQ5S 3I0SB 2KRBA 1H98A 1OQ6A 4QYZJ 3MM8B 2XMUA 5KT5A 5GAHU 3I4PA 2HLTA 1DHMA 3TX8A 4PPZA 1ULRA 2DGOA 2QZ8A 3VZHA 2FVRA 1IKVB 3FZ2A 1U6BA 3EPGA 4ZHRB 3RU0A 2J7KA 3G6ES 4WZQA 3PX4A 3UR3C 1VQYA 1RT7B 3LP2B 3I87A 2RRAA 1M5PC 1QAJA 2GHWA 2ZH5A 1OO0B 5HMXA 2OFHX 5F0UA 4PWDA 5EX0A 3GZ7A 2XGPA 1GX5A 1LK7A 1LWFB 5DG7A 2UV8A 2EBEA 1XEZA 5FIIA 4K50A 4WFBQ 3FFIB 4C8KA 3PKMA 4X4OA 4HKQA 4ED2A 1KHVA 2KXHA 4YR3A 2W7AA 1IM4A 2EBGA 4C8MA 2AYBA 4NCGB 3CMAS 2FHMA 3ISZA 3QGIA 1U47A 5I3PA 5F3ZA 3TUIC 1FCAA 3D1OA 1FRKA 2G1DA 5DRKA 5G0RB 3WDOA 2OPPB 3VQSA 4DR5F 1X9MA 4X4UA 5DLFA 3HHNB 4ZP6A 5MLCV 2B4UA 3N9UC 4IDKB 4DQPA 2FB0A 4DL7A 1TK5A 2PMZD 1OSCA 3T3FA 1I1GA 5IFMA 2AX0A 1E6YB 4X66F 3ICLA 1HI8A 4NYOA 3Q2TC 4LMZA 4QWAA 3L09A 2U1AA 1XMBA 1PGZA 3FGVA 1SJQA 2V5HG 2VG7A 4RW9B 1RT3A 1H2VZ 2Q6BA 4TY8A 5LSLA 1N36F 3IWNC 2DK2A 2LXUA 4X4SA 3DM2B 1YHQS 1VQOS 1HD0A 2R8KA 4OV1A 1S48A 4BWMA 2WOMB 2RU9A 4KKOA 3HMJG 1S1UB 1U45A 4WK3A 4OX6A 5KFUA 1CQNA 2ROEA 1WEZA 1R8HA 1TVRB 2IA6A 2VONA 4U9RA 4K4WA 5D6GA 1YITS 3AB4B 5U47A 3OHAA 4DV6F 3D0GE 3E01B 3CC2S 4JV0A 2W4CA 1X5PA 3SZ2A 3PW2A 3M05A 1JLBA 1ZAVA 3GV7B 3KMSA 1X0PA 5SUHA 5DG9A 1ZAWA 4NRUA 5A8KB 2BQRA 1QUVA 1FDNA 1CC7A 4PG7A 1FKOB 3DLEB