4DV0F

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 21
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dv0F00
4LFAF 1CQNA 4DR7F 2UUCF 4DV4F 1G1XA 2UXBF 3T1YF 3T1HF 2UUBF 1I94F 1VMBA 4JI4F 4YHHF 4DR2F 1J5EF 3OTOF 4YY3F 4DV0F 2UXCF 5BR8F 4DR1F 1G7CB 1N33F 1XMOF 1HR0F 1CQMA 1IBMF 4JI8F 1IJEB 4DV5F 2UU9F 4DUYF 4B3MF 4DV3F 1B64A 2F4VF 1IBKF 1QJHA 5LMUF 4JI5F 2E5LF 4LF6F 1FKAF 4X66F 4DV7F 1XNQF 1FJGF 4X64F 2BXJA 4OX9F 4JI0F 2KJVA 4KHPF 2VQFF 1HNZF 4DV1F 4DR3F 4DR6F 4LF9F 1IJFB 4B3SF 4DR5F 1GH8A 5IWAF 2ZM6F 1F60B 4LF5F 4LF7F 4GKKF 4JI2F 4JI1F 1XMQF 2VQEF 4DR4F 4GKJF 1N32F 4B3RF 4JI7F 3ZZPA 1RISA 1XNRF 1HNXF 4JV5F 2BVZA 2HHHF 1IBLF 5LMNF 4JYAF 4K0KF 4X65F 4NXMF 1LOUA 4DV6F 2UUAF 4X62F 1N34F 2UXDF 4LF8F 2B7BB 4JI3F 1N36F 2J5AA 2YY3A 4NXNF 4LFBF 2RJZA 2B7CB 4DUZF 4LFCF 4AQYF 2KJWA 4JI6F 4B3TF 4LF4F 4DV2F 1HNWF 3R3TA 5AJ3F
chains in the Genus database with same CATH superfamily
5HMZA 2QE5A 2XS2A 2E1MC 2IBOA 1RT1A 1S5ZA 2MZQA 2WSEC 2R2SA 2FZKB 4QPTA 2VDIA 2CQ0A 2PA8D 2W7PA 4V19X 1UVLA 2UUBF 3PZPA 4I56A 1EHWA 1XEZA 1UVMA 4C4WA 3EGVA 2X51A 4DV1J 1J5EF 3EUNA 1P27B 2U2FA 4O3PA 4F50A 3IA0A 2HWTA 2W7OA 4G3IA 1RA6A 4PCQA 3KUHA 2ILZA 3LO3A 1VIXA 4QWDA 1KC8T 4OX6A 4GC7A 1NB7A 1M1KT 4DQPA 4LQ3A 1FRJA 1FI4A 2LP4A 3AT1B 3AHPA 4YB5A 4IFYA 2P6SA 3RUBL 2R7WA 4N56A 5I3QA 1HNVA 3ADAC 5H9EJ 3EXCX 3LP1A 1ROFA 4ZKAA 4MKVA 5B0FA 1T8EA 2HZVA 1GXLA 2J9CA 3K5PA 1WOSA 4ED0A 4DQIA 4DSKA 3OR2B 1TP7A 3JQJA 5A0YB 4FBTA 2M3DA 3PO4A 1OIAA 1MLAA 3T6BA 3V4MA 4Q45A 3PKMA 3BPSP 1IBKF 2QGFB 2MPUA 1Q81T 3FBFA 2IRUA 3UDLA 1QAYA 2BABA 1SUQA 3D67A 2BQRA 4G1IA 4KIAA 3GWCA 3DLGB 1I5OB 3A1YG 4OZ0A 5ETLA 2I5JA 3L7PA 2HYIB 2DGVA 2XMWA 2QL9B 3R97A 3WHIA 1H73A 2BXJA 1F5AA 3I56S 4OV6A 4ALZA 3WQPA 2JEIA 2OGUA 2W2NP 5F3TA 3BGUA 5L39A 1S0MA 2GCFA 3A3NB 3M2RA 1VQNS 1JXVA 1JNRB 2W4CA 3CJRA 2V8HA 1PC4A 4DX6A 4P72A 1LWCA 4K59A 2DXEA 3IGVA 4F3QA 2PI5A 1FDBA 1BGXT 1MW7A 1Q82T 4QW9A 3CJ5A 1IKXB 4L76A 4M5IA 1Y11A 2V5HG 2VPYB 3CJTA 3J80Y 2GGPB 2CQBA 2C22A 3WX8A 2K1RA 4WE1B 3WC2A 2N7CA 1LV5A 3BGOP 5G0RA 1QVGR 4QU7A 4Y00A 1YRXA 3IRXA 3U7JA 3FEYB 5F3ZA 2VQEF 2EVZA 3FC9A 2OLWA 4LREA 4NX9A 5K9FA 4YDDB 3KDNA 3KK1A 3THTA 4NXMJ 1IM6A 2AYMA 5GAHI 2ZUGA 4FPIA 1FRLA 2P2CB 4RNFA 2UXCF 2HHHJ 2ZDOA 2J0QD 1HI8A 2HVDA 2PT0A 4CP5A 4GMKA 1NNDA 4NXMF 3RJMB 3ZZZA 4M5DA 2VONA 4F8RA 2PN6A 2BX6A 2DIVA 3OXFA 1EJ7L 2WCXA 1PC5A 4ANEA 2DKOB 5IM0B 4OI3A 3PEJA 1HBMA 2RUSA 5C2CA 2DNYA 2ZZMA 2AF6A 4OX7A 5E5NA 3X3UA 5EN1A 4X84A 2FTRA 2MTLA 5E3RA 3TZXA 1MWQA 2Q66A 2HNYB 2IVMA 3GCXP 4NRTA 4USKA 2COLA 2W7AA 1HQUA 1YBTA 1PO6A 2J0SD 1HD1A 4DX8H 4CLTA 3GTYX 3C8YA 1C1CA 2LA4A 2GHWA 4OX8A 1S0VA 2UXDJ 1TUGB 3IRXB 3O6QA 1J5OB 2Y8WA 1L3SA 1RI7A 3DLJA 1SV5A 3I82A 1Q1KA 1HHQA 2DJWA 5IT9Y 3Q83A 2LLZA 3D1QA 3MR3A 4ZIVA 1QSYA 4DWIA 1R27B 1NSQA 3J7AN 1OY9A 4F4YA 2WAQD 2M0GB 1NU4A 2V67A 3BV8A 4CT9A 3R3TA 1VQPS 2QLXA 2G0CA 3HLUA 3IAS9 2N82B 1BUXA 5J2PA 2XNQA 3TNVA 5AJ3F 4X4PA 3TYTA 5D6GA 2BKOA 4DLEA 4EBCA 1M1GA 2DNNA 4IR9A 4PABA 2FD2A 4YN3B 9RUBA 3T1YF 2LU1A 2HRTA 3LAKA 1M1HA 1F9HA 2RF2A 3CDWA 1GEHA 5F8GA 4A48A 4IOAQ 4C7QA 4QIEA 3M8PA 3EZOA 3Q0AA 4FDFA 2M2BA 3K57A 4Q5VA 2H65B 4MJKA 2ERRA 4ZLLA 2MY8A 3TJ8A 2I8EA 2W2PP 4HI2A 1LWEA 4DQSA 1FX2A 1FTRA 2ZHAA 1J27A 2C3MA 1XR6A 4WJBA 2MGZA 1N34J 4B3OB 1VDHA 2FJAB 4Q8FA 4LUBA 3KNGA 1K1QA 1FDNA 3OR2A 3R9LA 4KHPJ 2QN6B 2ATCB 2RE1A 1I94F 4ECWA 2DH9A 4ZVHA 4LVNP 1T05A 2BANA 4N77A 2XYPB 2VPWB 3F56A 1I94J 2MQ8A 2CJ9A 2B56A 4W92B 1TKXA 1ICEB 1VGYA 1OMSA 4L72B 2JEGA 3PX6A 1KHVA 5KFGA 2V9WA 4IRCA 3EJMA 2CPIA 4UF4A 4DEZA 1MROB 2M5YA 5LXYA 3OW2R 3TUZC 3FCVA 4ECTA 4HT5A 3KLEB 2H5EA 5IM0A 1QE1A 3I5BA 3G82A 3ET6B 2VASA 3DC2A 3OR1B 2KTQA 4NMXA 3VGVA 2KU7A 2R8HA 2OFHX 4OX9F 1NHUA 3MM6A 2FPHX 4JI0F 5K20B 1RT6B 3D66A 4DU7A 1Q5YA 5KTQA 4CLLA 1TZ0A 1RHQB 1RWPB 3B4DA 3TANA 2F8MA 2JLFA 3A8EA 4U7CA 4CLUA 1HNZF 2BW2A 5J2QA 2X1FA 1S49A 1HNIB 3SDEB 4CIOA 4USWA 1RT7B 2E7WA 3IGNA 3T5KA 1NKEA 5H9FJ 1IR0A 1IJFB 1F1BB 3RBDA 3GIMA 3NNAA 3W2VB 2J8AA 2ZNZA 5IFMA 4PWWA 2B5JB 1IR2A 1MWYA 1RT2B 4DCJB 1AFJA 2WSCC 1ZTTA 1D8YA 5BYSA 4NWBA 3PYDA 1FRKA 3DRSA 1UWAA 4WK1A 4DS4A 4RW7B 4ECVA 4GC6A 1UA0A 3I0SB 3QT8A 3HHNB 4JUZA 3RZAA 1X9SA 4FNHA 3QAEA 4RPFA 4JI2F 4CO1A 2P9CA 2KM8B 4J9QA 1U2FA 3IAM9 3QT6A 2X1AA 1XNRF 3RRGA 3LGNA 4M1KA 4CDIA 3B54A 1LXNA 2V8DA 2BVZA 3TW0A 4TU9A 3KLHA 4M5DB 3G8TA 3RR8A 2F3JA 3I6PA 3SCJE 4WFBQ 1JJ2R 1QAIA 1RWMB 1DLOA 3CCUS 1XR5A 2BDPA 1DHMA 1VIOA 3PY8A 4KTQA 2MSTA 2W2MP 3QSYB 1S76D 4Q7AA 1FVQA 1H98A 1LK5A 2XHWA 4I6AA 3BJYA 1G2EA 2AJ0A 3KXDA 1XMQJ 4MIBA 3UDEA 3C15A 1O8BA 2NS1B 3CGIA 2NR0A 3FK4A 2PD1A 2ABYA 2B7BB 4I4BA 2HAIA 2MLXA 4LR9A 4J9MA 1U45A 1X9MA 1N36F 2UUCJ 4IUFA 4IOCQ 2E5GA 5A0YA 2MQLA 4R25A 4HHHA 2EFNA 2FDNA 1RSCA 2L3MA 3NGTA 2VDHA 3NLCA 2CZ4A 4QZVB 2IRXA 2YKPA 4V19J 2XSFA 4QWBA 4EYHB 3AJ2A 2YNFB 4NCAA 1VCTA 2ZH2A 1YJNS 4XO0A 3V6DB 1VHFA 3UO0A 3KTQA 1NSPA 2QYCA 5T7LB 2B4PA 2V6AA 2DCLA 5B0DA 4AL6A 3FMBA 2JEJA 4CYUB 4OHXA 4K4WA 2PFFB 3OFFA 5FIIA 3Q89A 1C2PA 3N4WA 4EO6A 4F4ZA 2BM1A 1S0OA 2V2QA 1WKJA 2VG6A 1OPZA 3BZQA 4BHQA 5D0EA 2HVHA 1W25A 3DU5A 3PYEA 3BQ2A 2CQ2A 2K1RB 4WE1A 3R8YA 5DG7A 1O51A 3SFUA 2OMLA 4TYAA 5KT3A 1SIZA 5ETTA 2VODA 5C7PA 2NUUG 3GLJA 2VZ9A 3MEDA 1Z2ZA 2YX4A 4DR1F 4ED5A 5CYQB 2IM2A 4RW9B 3H5YA 2V8PA 1P1LA 3LH2S 1IWGA 2BE2B 2FZGB 3M05A 3TX8A 3H42A 2DR5A 3D0GE 4WZMA 2OKQA 2OH2A 4TXSA 4B3RJ 2ZE2A 1YSJA 1TELA 3J80U 2R2UA 2ACMA 2J9EA 5RUBA 2HHTA 4ETXA 4M5JA 1NPKA 2V69A 1UJ5A 2Y0BB 3CCZA 3NEKA 2X7IA 5KT7A 3V6HA 4FP9A 4R8UB 3UWTA 2HW3A 2JVRA 1YJVA 4NLOA 2C42A 3IMQJ 4RNOA 1KQGB 1WG4A 3PW7A 3BYPA 2VA3A 2O67A 1VHIA 4NZ7A 1SVDA 1NB2A 1C1BB 2PMWA 2E1CA 4DSFA 1S1VB 2AX1A 4ZP6A 4FF4A 4DR3J 1YZ7A 3CO9A 2CPZA 2V4JA 3MZIA 2OD4A 2HHUA 2F8HA 4PUOB 4K4SA 2PGCA 2XHCA 2CPXA 1C1CB 3H98A 4LBIA 1VR6A 2C2DA 4JI8J 4EZ6A 2AZ3A 5CZVA 2HHXA 4HR2A 3O44A 5LL6d 2HLTA 1S6QA 2GQQA 2BM0A 5E33A 5E3AA 2BEFA 3CSKA 3GIRA 1M5VC 2MYFA 2ZBCA 3D28A 1WUUA 4TNOA 4DUTA 2OEJA 3TWZA 4ELVA 3BBCA 4PKDB 2C2EA 2M9KA 2R7OA 4GO7X 4JB8B 1U1QA 2ZE2B 4NZ0A 2ZBIA 4O4RA 5CD4A 4C8YA 1A6LA 3GR0A 1IKVA 4RUCA 5EDWA 3CVKA 1FFGB 2ZNYA 5C42B 4HDGA 1IQZA 2DBBA 3BH7B 2BYCA 3LWLA 2UUWA 2PI4A 2E5LJ 4K4VA 3CJ2A 2Z2MA 5KFSA 3FSIA 1N5TA 1U0HA 1QVFR 4A8SA 2DNRA 2DNKA 2HFSA 2ZBRA 3PG9A 1QAJA 2IBKA 1HYSB 4FYDA 4F4AA 1LXJA 4BWMA 1UFLA 3EWGA 3C2PA 2DNGA 4AUKA 1URNA 1R8AA 2QIFA 5I3PA 3WIVA 3SQGA 5D4LA 3VV2B 5KFOA 2XLJA 1L3KA 1MU2A 3Q8VA 3W61A 5LMNF 4XDDA 4EBEA 3QRRA 4B3OA 4DSLA 5F41A 3H2LA 4A8FA 3OL9A 5IC6B 4R0JA 5L1IA 1PJ7A 3KLFB 1EETA 3GV7B 3P6YC 2JWNA 2NXNA 4CH0S 3KLGB 2ZEJA 1AZSB 2R42A 4HTJA 3CT9A 5E2QA 2ZHOA 4ID5B 2ADCA 3CJ0A 4K4UA 1RXOB 3VAHA 2YH1A 2JFKA 2UUTA 5ADZA 2WVBA 1S1TA 1RT5A 3Q2SC 3T1HJ 1RKJA 2FJXA 1Y10A 4BBYA 2FJDB 4Y34A 3T1AA 5L1KA 4LSNA 2EFQA 5HQLA 4E0DA 4NXNJ 2VPZB 4DN9A 4S0MA 3QRQA 1YQHA 2XO7A 3M32B 1VBYA 3J7Z5 2IMOA 3RB0A 1D8ZA 1CC8A 4F36A 2ACYA 2VKRA 3OD2A 3QSIA 3T1YJ 3C66A 4AD6A 1FERA 1KHWA 2GIQA 3ZZRA 1LW2B 1HD0A 1YJUA 1F2HA 3D68A 4B08A 2V4JB 4RNMA 4P9SA 4RKUC 3IN5A 1MU2B 2E66A 3T19A 2CPHA 4KO0A 4C8KA 1G1XA 4B3SJ 1JWWA 1WACA 3H40A 3MWBA 3G86A 1FXRA 1NCLA 3QFHA 4LIWA 3OJUA 1FF2A 5C25B 2YKNA 3M30B 3TEGA 1A9NB 4KH1B 4TY8B 2N4CA 2BJ7A 4LMZA 1BWVA 1S9EA 1N33F 2HQ3A 1T02A 3V6DA 3DOLB 3L4BC 3M2RB 1HHSA 3S01A 5HVHA 1T9XA 3MM7B 2RQKA 1F5BA 1SKWA 1XIQA 2Y1LB 4ZP9A 3CCRS 2W4DA 1IJEB 3FBEA 3G8QA 1G6BA 2HNDA 2WW4A 3IS9A 2CFXA 1S99A 2WVEA 4KGKA 3LPYA 2Z4PA 1RU1A 2B8PA 2K8GA 2OP5A 3CEDA 4NLQA 2I6WA 1LFWA 2AMCB 1NXIA 5H1SV 4B9MA 2CQCA 1MMNA 2DRDA 3PRVA 5ETRA 2R7QA 2F4VF 1QDUB 1H6KX 4JI7J 4IG0A 1AUDA 1F5CA 5IV3A 3SDEA 4UZBA 1QSLA 2YNHA 1DZ5A 2OD6A 2XQCA 2QL5B 4ECXA 4DX7A 3W2VA 3K58A 4M95A 2LQBA 2W25A 1IXKA 2AJQA 3A4TA 5EGYA 5CZXA 4GKJJ 4NI2B 3QO9B 4FXDA 3BEGB 2HHVA 5KFIA 2DTJA 1GK8A 1SB6A 3CMAS 4WZQA 4PG4A 4F0HA 1BD6A 2KFYA 1SXLA 4DR6F 4GVBA 1XMOJ 4GVLA 4RBVA 4E98A 1IR1A 5IWAJ 2DD8S 1H2VZ 1NBEB 2QV6A 2HQIA 1F0XA 2XTJP 3CC2S 2FLNA 5I3UA 2I0XA 1RTHB 3DI6A 1NSAA 2BOAA 1GMWA 1HQEB 3OBIA 3TJ9A 1REGX 1X4AA 2HIQA 1LWXA 5IWAF 5KFHA 4KGXB 4TLQA 4JV2A 1OSDA 2VUGA 1SI9A 3MPYA 2XC9A 1U6ZA 3MEEB 4FN5A 3Q24A 3NKYA 3PTWA 1FHTA 3HF5A 2VFTA 2CWKA 4CLSA 3DYAB 2RH3A 3MUVP 1OYEA 1ZBTA 4NOHA 1S72S 5KFNA 1KNZA 1WD6A 1UTAA 1WEZA 3C15B 1LW0A 1IM4A 3DFEA 5KFUA 2P9EA 5DDRC 4QCLA 1KVJA 2G0JA 4ZPWR 4J9UE 4X4UA 3PNIA 1RE1B 2H5JB 2XI2A 4OYXA 1KVIA 4XTTA 1S1XB 5BR8J 3C14B 3VALA 1IBLF 3MCOA 1VQ4S 3AOBA 4RW4B 1NLKL 2RNEA 5CYMB 3M8RA 2VFRA 1VQOS 1LQ9A 4OZ5A 3KK3A 1CJUA 4JYAF 2KN4A 1IBLJ 2YBVA 1KONA 1MROA 5B0AA 4AYBD 5A2QU 2BV3A 2XMMA 2IPOB 5HVGA 2ZH9A 3AB2B 2HHSA 3CJSA 1SJRA 1ZZFA 2QLJB 1RA7A 1FD8A 1YBAA 1N54B 4FPRA 4KE5A 4ZP7A 3GIJA 3R7BB 4DR5J 2ZKUA 3NMAA 3CPWR 2LMIA 2J7KA 2KZMA 3MGJA 1QY7A 4WYLA 5DM7Q 2UXBJ 5L9XA 3CCVS 4C8ZA 4IDKA 1SQFA 1N88A 1S1VA 3CCQS 2H54B 1H2TZ 5DZ6A 1FDDA 1N0UA 1S6UA 3VVUA 3SQGB 1R8HA 3HVRA 1BWEA 2KXHA 2HHQA 4DR4J 2VKZG 4MAKA 3FSXA 1XJWB 1R8CA 2XI3A 4P2MA 3MCMA 3RYLA 4WKYA 1ZM2A 1X5TA 4C0BA 3NY0A 4YR2A 3IC1A 4B9LA 4PG8A 5B0CA 1N36J 3TVKA 2CQDA 2UUCF 3KHGA 1S59A 1M5SA 2CDQA 4FZVA 2NSCA 2ZH1A 1CVJA 4NL5A 4TY8A 3DDIA 1KN6A 4M8LA 4DR2F 1T9YA 2DR9A 1VI7A 4QR1A 3VWSA 2RILA 2B9XA 3MI7X 3NAHA 4YUDA 3I55S 4OJ3A 4YEAA 1FXDA 2H51B 3QJJA 3JTOA 2WW8A 1WC4A 5F0WA 3CCJS 1HR0F 2V2VA 2W4PA 4V1Ak 5CABA 4UQGA 2CVEA 1BXNA 3V6KA 1WHWA 1FWKA 3G6VA 3SYZA 3ILJA 4B9VA 4KB7A 3GIIA 2K7JA 4ZPCA 3EPGA 2CJAA 2H5IB 4D3HA 2UU9F 4C8NA 4KKOB 3DLLQ 3BDPA 3SXLA 3H90A 2I38A 3RTVA 5ETMA 1N48A 1TMJA 2VH7A 5K8OA 5HO4A 3CO0P 1NK5A 1NK9A 2DNHA 2Z30B 3C16A 1XR7A 4QYRA 2A6OA 4KAIA 2L41A 1PBUA 2QJ3A 4PWDA 1MMDA 1PKUA 2CWXA 2AP6A 3G96A 4ECZA 3UVJB 2NPIA 3WZ0A 4NA1A 5HATA 2IVYA 4QJVA 4DV7F 5KFJA 3EX7B 2CQIA 4MK7A 1S1TB 1T9WA 4NLPA 2DO4A 3R1LA 2HIYA 1P1TA 4C11A 2R7SA 1RAHB 2VHGA 4A8QA 2QLWA 4M5GA 4DDFA 2LEBA 2DRBA 2CVIA 5KG1A 4KGZB 2F7VA 3OFGA 2IAJB 1TL7A 1Z1ZA 1NDPA 2KT3A 4EGLA 5J1EA 2FVQA 1TTHB 3OTBA 1YRTA 4MFBB 2ZM6J 4M63A 4HHJA 3KLIA 4LRBA 3HULA 1MN9A 4ELTA 1SH0A 2ZBQA 5G4DA 3OLAA 4RO0A 1LW2A 3W5ZA 3J7YU 3T9ZA 3O8WA 2DB1A 2HRUA 4RNHA 3OV7A 4IG0B 3OSNA 2ZM6F 1W2IA 3NOGA 1KLMA 3NG8A 2XMJA 3L7OA 1UMJA 2NXEA 4UOFA 1FRXA 3OTCA 3Q8PB 1CJKA 2MY7A 3G6YA 1VBZA 1VQ9S 1O0PA 3VAIA 2NQPA 2EKYA 2KKHA 5GMDA 2PEBA 1B3TA 3ZZPA 3BQ1A 4DL6A 1OY6A 1R31A 4AE5A 4Q0BA 2FLLA 3OXGA 4ZLPA 2CPJA 1OSCA 4WF9Q 4Y2IA 3EMTA 1RGVA 1KFDA 1RT5B 4OHWA 1WG1A 4PAAA 4KR0B 3BO4A 4FF3A 1WF2A 3DHWC 2KH9A 3R5BA 4KSEB 2YX7A 4QIVA 3M9NB 2QRRA 3IR6B 2Q6CA 4IFVA 4PXDA 2OPSB 3JAMU 1VRUB 1N34F 1ZAWA 4Q8EA 1AYEA 4EI2A 4KV8B 3QZ8A 3GJTB 3H7HB 3ETMA 4JP8A 1XNRJ 2DK2A 1UEUA 4DR2J 2GC8A 5J2QB 1VQYA 3HPOA 2KHCA 2AX0A 1CULA 5AE1A 4BC7A 4GRSA 4PPZA 2VC0A 5B0BA 4I0WA 4OZ1A 1DTQA 4M5MA 4LFCF 3M6XA 3S1TA 4J9LA 1GMWD 4OHZA 3R5GA 2D69A 2FGCA 3IR7B 1I1GA 2X1BA 2IIHA 2VU5A 4B3TF 3HVTA 3OQ2A 4I67A 3DU6A 5HMXA 3KWMA 1SL2A 2HQFA 4USVA 5ETQA 4QWEA 4RNNA 2HBRB 2KT2A 1MNEA 2M88A 8RUCA 3FGVA 3G6XA 1SJ4P 1N8RT 1KDNA 2J9DA 4LBPA 1FKOB 1OQ3A 1TU0B 3RW7A 1Y9OA 4CI0B 4ZHRB 2NYHA 4IO1A 2XMTA 2JDJA 1JLBB 3V4IA 2R7VA 3OLBA 2P9GA 1EZZB 5DG9A 2XO6A 1JLCA 5HAOA 5B0GA 1NO8A 3S8SA 4KBIA 5IT9U 1NSKL 2XZTB 3O1LA 1D0EA 1U1MA 5K5MA 1VBKA 2C3UA 5KG6A 3ZTSA 4YY3F 4EBDA 4ED6A 4P10A 3GG1A 3DYAA 3EXYA 4KY3A 3GSIA 1MG7A 2QTWA 2ADBA 4C98A 4X64J 3GYXB 4ELUA 3AXMA 2RAQA 1RCXB 2LQJA 2LQ8A 2VL1A 3BKTA 4N47A 2E1RA 2IRYA 3IBWA 1Q7LB 2B6AA 3OXLA 5AXLA 3ZTRA 2KYZA 4UOGA 4CLWA 2QA4S 3HHLD 4DV0J 3TAPA 4WYWA 3AQPA 1FJCA 1N52B 4F26A 1B64A 5E0OA 1RP5A 2KT5A 4A46A 1XMBA 5A6PA 3NL0A 4ZVUB 2CNOB 1U48A 2CPDA 4KHMA 2XZDB 2XNRA 4KHRA 1UWBA 2WOMA 1RT4A 2GV1A 3TQEA 3CULA 1UPPA 3J81U 4FBUA 2JEFA 4MH8A 1HMVB 4I2PB 3W9JA 4DR6J 1CJTB 2Z0GA 4QOTA 4G1QA 4YR0A 4KJIA 4N7TA 2AHOB 5CAAA 2AYEA 2DEJA 1H38A 3K5OA 2B0GA 5JXSA 4K4YA 2E9TA 4F67A 4NPOA 5LSLA 4IDKB 2YH0A 3RGIA 3F73A 4J37A 1K0TA 3TA2A 3NCRA 2PEHA 3C46A 1R0AA 3CD7A 2QL7B 4ICLA 4PQUB 3PCOB 2WZ1A 3NCPA 3PJXA 4NEZA 4JI5J 4GO5X 4PR6A 2LDIA 2PDAA 2HZCA 1N0VC 3I4PA 4QWCA 3NBPB 3DLBA 2XEXA 2LYVA 4JI1F 1VQLS 1L5UA 2KVQE 3AOCA 4JI0J 1TMMA 1T3OA 4NLDA 4OHVA 3ISNC 2MHEA 4BS2A 1RCOB 1RISA 1ITPA 2D1CA 1HNXF 3M9MB 3UD4P 2BZ2A 2AV5A 4CTAA 5JUMA 1NK0A 1C0UA 3DGPB 2HHHF 1F3FA 4NLWA 4DV5J 1AXQA 2MXYA 1QSSA 4DR7J 1SQGA 4RW6B 3EDRB 4LF1A 4TLRA 2HFZA 2PO4A 4BDPA 1FESA 4KV8A 4WTOB 1FCAA 5MAOA 1RT7A 2JFDA 4XDCA 2KG0A 2UUAF 1BLUA 3P5BP 2QO3A 1RABB 1RJJA 4P6QA 4HI1A 3K89A 5HLFA 4TKTA 3QYYA 4DFKA 1HWLA 2FUG9 4J91A 2RRAA 3G8SA 1EAYC 2GVDA 5I42A 1UEKA 4H4KC 1S7IA 4LSLB 4Y2KA 4C0OC 5KFMA 3BGRB 3RR7A 1GTEA 5A8WB 3R27A 2MQQA 4I7FB 3GZ7A 3LQVA 4OZJA 3CCSS 4DUZF 4DQQA 2ZC3A 1ZH5A 4NCBA 4M94A 4Q0BB 2Z2LA 4MYTA 3KK3B 3CUNA 5THWA 3KYLA 4DQRA 2I5JB 4A8KA 2XGPA 4Y2CA 1X9WA 2JNJA 4JI6F 2K3IA 5EX3A 3WX4A 5KT2A 4YFUA 3W5YA 1U49A 5GADU 3M8ZA 2BE9B 5KG5A 5KFEA 1JLFB 1WTBA 2YWEA 2L08A 3ZC4A 4OIXA 2KL8A 4LFAF 2LEAA 1FFSB 3K7RA 5KG2A 4O3OA 4DBQA 2DGXA 1OY8A 3CJ8A 4PUOA 4JV5J 4FYXB 1VC6A 3D6MB 5KT4A 2L9WA 2QX0A 3H5SA 1R8PA 3I0RA 3MEKA 4DZ6A 2AW0A 4JI2J 3RBXA 3T5JA 3ILOA 3GE9A 1CG2A 4J7CA 1WOPA 5CYMA 4ED7A 3FBCA 4E8UA 4B3MJ 3TQ1A 4H4KA 1O6XA 1HNXJ 2H3EB 4ZA1A 4B9SA 1U1PA 4Z2XA 3I0SA 3W63A 4PG5A 4OV1A 1CJUB 1W7WA 4LF8J 1RTIA 3P5TL 4C6AA 5HMWA 1NRKA 5KFDA 2R8JA 1S9GB 4FYWB 1YITS 1N5QA 4D3GA 4ILLA 2G1DA 3MM5B 2Y1RI 4HTIA 5K14B 2NPFA 5DGBA 4MKAA 3IG1B 3M7VA 3UNGC 5DDQC 3M9OB 5L1JA 1NK8A 4X4NA 5D3GB 1JLCB 1SIWB 1U25A 1WWHA 1YBUA 2KDOA 4OMFG 4ZPVR 5BJRA 5JJBA 1V3SA 3M8WA 4K2XA 1X5PA 4ZPDA 1B99A 3ENWA 3KJNB 2YQ3A 1RT6A 1FKAF 2BOPA 3J7A1 2KM8C 3T6JA 1XNQF 3ILLA 3D2WA 1CJVA 2IYGA 3ISND 3LP2B 2ASJA 1TKZB 3C6TA 1TL3A 3MM9B 4KFBB 4F3OA 3MAAB 5SUHA 4DR3F 2OTJS 1RTDA 4IKAA 3UR0A 2AD9A 3E01B 3T5LA 4ZPBA 2EFPA 3IWNC 2DNPA 5A8RB 1EP4B 2ZFHA 4H4OB 2CA9A 5F8HA 1IUJA 3OVAA 1V5IB 3UVJA 1K44A 2WVCA 4GVBB 4NLUA 2RQMA 5EUHA 3VHQA 1DQ8A 1RB0A 1WDTA 2V2ZA 2YTCA 5J2PB 3MECA 1N5VA 2IFXA 2QFJA 5L9NA 1S97A 2VICA 4LF7F 3H4DA 2DHXA 3NRBA 4J90A 5DQIA 4I64A 3HDSA 2KG1A 3HT3A 4EZ9A 4Z7CA 3NXZA 1W2BR 3EGWB 3C19A 3LP1B 1LFPA 3I9V9 2FJWA 1X0PA 1T11A 3MPDA 3BBFA 4WU2A 1DQ9A 1NJWA 4IG3A 2MZJA 4NASA 2VOOA 1S79A 2W2QP 5C24B 2E9RX 2FC9A 3DRPB 1JK9B 1NPPA 2IVFB 1DAXA 3PV8A 1RYSA 1RBAA 1TVRA 1S0NA 3NNCA 4IQXA 1FRMA 5DZ7A 2IJFA 1L3UA 1NMEB 3AB4B 4ZJOA 2BQ3A 3LOUA 3CTRA 1S9EB 3H8YA 2YWKA 5AE3A 1HNWJ 3A12A 4CO2A 1T0TV 3D3BJ 2WRMA 1GXUA 2DNOA 1GXTA 4WPAA 4QIGA 3P49B 2VIHA 4DCOB 1HBNB 2F9DA 3KFWX 1EKSA 1BMQB 2BJDA 1Q95G 3GFYA 3N5FA 4ECSA 1IKWB 4HACB 2FQQB 1X4EA 3TUJC 4CT8A 1B0VA 2KJWA 1NK7A 2UUBJ 1UVNA 1FWPA 5FLXU 2QSWA 2XZWA 3KJQB 1RHMB 4YR3A 1ZPVA 3UCZP 3HD1A 2JLEA 3D0IE 5JVGQ 2B4OA 4PG7A 1FJEB 3L9ZA 2R4FA 4CNYA 2FVRA 1URRA 3GJSB 1HNIA 3J81Y 1CQNA 1U26A 2M8DB 3EGNA 1Y5IB 2KYXA 3JSMB 4O3SA 1B70B 3CDAA 1KD1T 2E1PA 4TQSA 2D9PA 2Q1LA 2QLFB 4NZ6A 5CA5A 3OHAA 2DGWA 1RU2A 3TR5A 2VBWA 4I7FA 2CZ9A 2HG4A 5CYQA 3VQSA 3QMQA 5IT0A 2MB0B 4DV0F 4JI3J 4RR5A 2LXUA 5DRKA 1X31C 4UUWA 3Q23A 3JYTA 1K8AT 1DQAA 3QQCD 1KOOA 1BQMB 1A0OB 1U8WA 1TL1B 2GO9A 1PJ5A 3TZWA 3CDEA 1I6JA 2H4YB 2UVRA 3EPIA 3HI9A 1YI2S 5F8NA 3BSNA 3DLEA 2GQCA 2WK4A 1YJWS 1BY9A 2V9KA 4FF1A 1BQXA 4CLZA 2G2ZA 2CJKA 1VFJA 4ER8A 3CD0A 2CPYA 1HYSA 1CLFA 3O2IA 3CMES 2Z58B 3Q86A 2LDYA 1HLWA 3NMRA 1C1BA 3QLHB 4DR1J 5HMYA 1F3VA 4R0EA 2FJBB 4USHA 4RBTA 1O5JA 2MGZB 3EGZA 2CQPA 2UXCJ 2FJVA 3CJ3A 4W98A 3A8KA 1WF1A 1H74A 3MF5A 4CLYA 1BE4A 4P2FA 3TAMB 3W62A 2XM3A 5HJYA 3BSOA 2F9JA 5IC4B 4X64F 1ZETA 4XPCA 1RTDB 5KOXA 2Q43A 4DF4A 4CM2A 3NBPA 4Q44A 4LBHA 4X4QA 4W90B 2P5VA 1KVKA 5C2GA 2GJIA 2HEKA 1VK3A 5HBMA 2GA7A 2ZH3A 2DH8A 3HT0A 4RLEA 2ZJRQ 5KFFA 3UN3A 3PO5A 4ES1A 4N5SA 3K8WA 1ZM9A 3M1VA 3L3CA 1QD1A 1TFWA 3D5MA 5FDLB 4KQZA 4KC5A 4AFFA 5DLGA 3CJ4A 2DY1A 2ZH8A 4U9RA 4C8MA 2KB2A 3SSRA 4LF5F 2CDRB 3HJFA 1JJCB 4TY9A 2JC0A 4X4TA 4F04B 4HLBA 2VG6B 2XB2D 4QYZJ 3MOJB 1VQ8S 4U8VA 1RTJB 4MK8A 1WHXA 1D9FA 2UVUA 1V3RA 2VG5B 3WC0A 3BYRA 4RW8B 4CZCA 2ILYA 2PMZD 5M2UA 3GP9A 3H0PA 1Q8IA 1MSWD 2FYXA 3DRRB 4LSLA 4DPYA 2BRKA 3JSYA 2DT9A 2RIJA 2DHHA 3ETOA 1XERA 4ECUA 3BGFA 4RW7A 3FQLA 4DPTA 1RHJB 4NLYA 1WC6A 3EVWA 3FBBA 1TKXB 3W64A 2R7UA 4TVAB 4EU0A 5CCLA 5KOWA 5M2RA 2ZOGA 4PXCA 2BKPA 3A13A 2DNZA 1FFWB 1ZS6A 5KFYA 4PEOA 3MR7A 3UR3C 1BQNA 4IR1A 4G65A 4NYPA 4A47A 3W66A 3QIPB 3NOCA 1RAJA 2OFGX 1NJXA 1VYAA 2A3JA 2GIRA 3N0VA 5KFVA 4J9SA 2PFDA 1UEVA 3TAQA 3HP6A 4OI4A 1VJWA 3KLIB 4HACA 4RUHA 4DOZA 3MM6B 2MKHA 4GKKJ 2B7CB 3TX0A 5LT5A 4DFPA 4HVZA 2K06A 3MEEA 1T9VA 3MMJA 4HHUA 4I1TA 1TAQA 2PMHA 4LF4F 3MMAB 4ZVRB 3M6UA 4A8WA 3H5UA 4LF5J 2CQGA 2HNZB 4NLSA 2UUAJ 4DL4A 2JZ5A 2J0WA 5A8RA 2Y1IA 1T05B 1TL5A 2YNIB 1WHVA 1YVFA 3BSCA 3C16B 3SCKE 1RTZA 5LMNJ 1TK5A 3GCWP 2V8VA 3KKFA 5IOLA 4H4MB 3G2XA 2AU0A 4C97A 1FJGJ 2J8SA 2O01C 4DG1B 1VMBA 4O0IA 5D8HB 2H9ZA 2JJ4D 3G87A 5FD1A 2ZHBA 1EB0A 1UW4A 1R89A 2OPSA 2DR7A 3CIMA 3DHXA 3DLEB 3BO2A 3NCQA 4O0NA 1Q0NA 1H3DA 3N6NA 4DS5A 2DR8A 4X4VA 1H72C 4OZ3A 2HK2A 3HHKA 1HQUB 2Y8YA 4C3MA 3DGVA 5DM6Q 4J5OA 1IBMF 4XIUA 4DV5F 3JQMA 2QMUB 2ALYB 2CIMA 5GAGU 3KK2A 1FE0A 3MDFA 3QGGA 3S6EA 2A6MA 3HVAA 1N32J 4QU6A 2ZITA 5DQGA 1VK8A 3POTB 4B3MF 2LKZA 1C0TB 5KFXA 3OL8A 3TRGA 2JC1A 5LMUF 4KH0B 2UU9J 1YZ6A 2WB1D 3E01A 1HWKA 3QT7A 2EK6A 4NA3A 3FJ2A 5DETA 5M2PA 1S9FA 1M5PC 2BE2A 2POKA 3CD6S 2X1GA 2O5DA 4M5HA 2HAFA 4ID5A 3M30A 2NXJA 3CCTA 2HSEB 3BREA 3CF5Q 2HS4A 5LM7E 1YWXA 1P9QC 3CDUA 3GJRB 5ETKA 1HQ2A 2VQFF 4RWWA 3TUPA 3SBMA 1FEHA 1ZTWA 4MT1A 3MPVA 1DY3A 4DN0A 2MKCA 2MHNA 1XK8A 2F63A 2A2DA 4USUA 3MXHP 4CM0A 8AT1B 1LWEB 4TQRA 2D3OR 2EBGA 3M2UA 1Y3JA 3SV3A 2W01A 3QIDA 5KFTA 1M5HA 3HSJA 5B09A 3W1YC 2J7WA 2M70A 1U6BA 2DNQA 5E3PA 2G2OA 3Q8YA 2XLIA 2BJ1A 2YKMB 3P45B 1S4EA 1TKTA 4KFBA 4P74A 4IRKA 3Q2TC 1BC6A 4B02A 2WBMA 4J9VA 2AJ2A 3BBBA 2MSSA 4RW8A 3TAMA 4YS2A 1N32F 1EP4A 1Q4RA 3AH6A 4H4OA 1GTHA 5K8MA 1JIHA 4TN2A 3HHLC 5FLXY 1IQTA 1SH2A 3EVOA 2BA9A 1EIYB 2AGOA 4ZLJA 2V34A 2EKNA 2J6SA 4DLGA 3PACA 5KFLA 4W4MA 2HGLA 4YY3J 4ITSA 4WIQA 5E3QA 1KQKA 5LMUJ 5GAEU 1NDLA 3PW5A 2MKJA 5K14A 1EX8A 2JL9A 3HHLB 3NP5A 4R5PB 3DOMA 3I96A 4C3LA 3M1VB 3NWGA 3BS9A 4RW6A 3UQSA 1WORA 4ANDA 3MAHA 3N5BA 1H7XA 3MURP 3I32A 5D3GA 2HFVA 2HFOA 2J5AA 2FVCA 1APSA 3M8PB 3OUYB 2GGPA 2PA3A 2EXUA 5KG3A 4RU2A 4NE9C 1FE4A 1IKXA 2HLUA 4F0MA 1WC3A 3MMCB 2DITA 3BN4A 4LFBF 2OAUA 1AFIA 1ZAXA 2QSFA 3EICA 2RHQB 1RTJA 1YTYA 3P3DA 3CCLS 2WHOA 1R8BA 1YJ7A 4ZOSA 4C2MA 5F9LA 2IA0A 3MUTP 4AQYF 1ZZNA 3MM8B 5A8WA 3TZYA 1Q53A 4NI2A 3TVYA 5DJBA 3KMSA 4RL1A 2HVZA 1KOHA 3PIOQ 2XS5A 1YK9A 1DTTB 1SC1B 2F4FA 2Z2ZA 3HCXA 2GFFA 2RUGA 1KRPA 3ICLA 2QFIA 1H2UX 3AQOA 3LP0B 4DV4F 2FZCB 3SV4A 5KFPA 2B3TB 1T9TA 3T1HF 2BW7A 3THPA 3UCUP 3JB9k 4XAKA 3EVMA 4WK3A 3ZTPA 4YHHF 3H25A 1X0FA 3KMQA 4URQU 3T5HA 2C2RA 2CQ3A 5KFRA 4NRUA 2A2CA 2CRLA 2ZKTA 1HBUA 2X3GA 5F8JA 3E2EA 1VS3A 2FY1A 4QYZK 1IVZA 2D3ZA 2YWWA 3QJLA 2B9EA 1CQMA 2C1EB 3MM8A 4L75A 4OYOA 5I42B 3FMWA 3MAAA 3W2WB 4ECQA 1PAEX 2QT7A 3HVTB 1FXLA 2WBRA 4RW9A 2W2OP 4P71A 2LXFA 1KLNA 2DXDA 1CC7A 1OYDA 1UZDA 4AXIA 3UE2A 4P73A 3UN5A 3FRZA 1WOOA 3NGRA 1JKHB 2E1AA 4LF2A 1QJHA 1PIEA 1WELA 3G71S 2E5LF 1FDAA 2B51A 2E5JA 2VJUA 3ZNUA 2BJEA 4OHYA 1X4BA 1KBRA 1Y4ZB 2DIUA 2HGNA 3HHLA 2RQCA 5D4NA 1HI0P 1OPIA 3KOAA 3KG0A 4Y3CA 1EKRA 3GILA 4KGVB 1W26A 2KJVA 4KHPF 4OJHA 3D1OA 4DV1F 1E6YA 4LRFA 2FVSA 5EWFA 1Q8KA 2LECA 1FNOA 5A2QY 4OYBA 2IC3A 4CO4A 4ED4A 4P2XA 1UFWA 2YKMA 4U95A 4OJGA 4IQMA 2GVDB 2O66A 3DRRA 2XY5A 5C25A 2RHSB 2HWIA 2IDEA 3I5CA 4DV3J 1V6HA 1UVJA 3ZTQA 2UP1A 4PQAA 5CHCB 4LFCJ 3DLKA 3ENAA 1HHTP 4Q2LA 3M8QB 4LJMA 3H20A 2XYGB 3IM9A 2HQDA 1HPZA 4KPCA 1R6YA 4O44A 4XK8C 3KNAA 3T41A 5LJ5Y 1FT8A 4JV5F 1VOMA 3BR8A 3IG1A 3QJPA 1ZM3A 2IAJA 3AD9C 5AXNA 3VCDA 2OJ3A 3FCWA 4DV2J 1JJ4A 4B9NA 4N41A 2E7VA 4DV6J 4UZCA 1S48A 2UV8G 2R2TA 2DPJA 1R7IA 2XCPA 2HRYA 1AROP 2HS0A 4WFNQ 4I2QB 1QTNB 3AA9A 4HH0A 2R8IA 2W8KA 2IC3B 1SBRA 5LJ3Y 3GFHA 2DEIA 1VRQC 2K2PA 4LRAA 4YMEA 1C0TA 2F1FA 1GFWB 2CXEA 3KUEA 3C14A 1NHVA 2XBPA 4USTA 3GMGA 1NJIT 4UY8T 3P8BB 4IH7A 4OYPA 3ZZTA 5EWEA 3W5XA 2CNLB 2YKNB 1RT3B 3D1HA 4RW4A 5CCMA 1B7FA 4LFBJ 3KK1B 4F4XA 4FKXA 2BANB 2HK3A 1RKIA 1XQIA 2A18A 2G2YA 2YPYA 3BB5A 5L8RC 4U7UK 3VQTA 4RZRA 3KHRA 1V5VA 1WEXA 3TA0A 4PPDA 3KHLA 2AQ4A 2AEFA 3SIPB 1RAIB 2V50A 2UV8A 3A8JA 2VQEJ 3RG6A 2FB0A 3MFHA 4DFJA 2H4WB 3M32A 1JQGA 4I68A 3DOMB 4OFZA 4MTPA 5DS7A 2DGTA 3ZNJ1 2Y9HA 3MM5A 4JOUA 3GYNA 1Q7YT 1ACMB 1VRUA 2ZC4A 4NA2A 2C2NA 4ZVPB 5GAEI 4USIA 2OI2A 4A4JA 1WC5A 2XMAA 2VBXA 4Y65A 2ZVIA 2AGQA 2P6TA 2OPPB 2ASYA 4HL9A 2B8QA 1N5YB 2CQ4A 2Q79A 2HKEA 3ITHB 1U1LA 2GZOA 3MPUB 1RACB 2RDIA 3GSDA 1HA1A 4KYZA 5ETPA 3JSMA 3OTOF 2KO1A 3M6WA 4JV0A 1YGYA 4J9RA 3B82A 1CEZA 3CE8A 3CNQP 3KLGA 4JI1J 4ZJLA 2W24A 3PYFA 1RHUB 3QATA 2IHR1 1XMOF 1H7WA 2GW8A 2DYAA 4LSZB 2YNFA 1L3TA 2MKYA 1TV6B 2QLBB 1N4LA 4FYYB 3CD5A 4JI8F 4BLGA 4KPYA 5HQMA 3IXQA 3OSPA 5IT4A 2CJQA 3CB4A 4RX6A 1QAXA 4K5RA 1IBKJ 2YPZA 2AJ1A 3M8YA 1FNXH 4DV3F 2Z8QA 4LF6J 1Y7PA 2MKSA 2WSFC 3DDKA 4WTYA 1UFKA 1RLCL 2NXUA 2VB6A 3F44A 2BUNA 3GPAA 2M7SA 3L95X 3UW1A 4EEYA 4LF6F 2V68A 2CG8A 2M4MA 3KG4A 4OZLA 4M5NA 3W65A 3MD3A 4I2QA 1KP6A 4L3NA 4UOCA 3DM2B 3DLHA 3PW2A 2FY8A 3DRPA 2CQHA 3MOZA 1X4DA 2GAGC 2HNZA 2MMYA 4ZN1A 4ED1A 3PXGa 1U1OA 1G3OA 5B0EA 3VR1A 3WDOA 3HSDA 1TVRB 2EW9A 2IM1A 3SEOA 5HVFA 1XNQJ 2NREA 4OJ1A 3DMJB 2CADA 1N33J 4C9DA 3PR5B 3UN2A 3N79A 1CSJA 1FKPB 4OI6A 3C6UB 4BCAA 4NYOA 4DR5F 1SC4B 4MYUA 3OTOJ 4ANCA 1AT1B 1UAWA 5E3CA 2W9CA 2VV5A 1I51B 3M8QA 4WIIA 5DQHA 4U6PA 3DN9A 3GV5B 3K5NA 5HP1A 1ZYQA 4LIRA 4K4ZA 1FJ7A 5HK4A 2GO8A 2YVSA 4FVCA 1M5OC 3PYGA 3OTEA 4I2PA 3VZIA 2QC3A 4JI7F 1WC1A 2RVJA 2ZBPA 1VBXA 2RRBA 3Q8RB 1HNVB 5HN0A 3GV8B 3MR5A 3DXSX 1GX6A 1XBWA 1CS4B 2HNYA 3SFGA 1JLGA 1HL6A 4YDXA 5BYQA 1TR0A 4IO9Q 4MMOA 2Q6BA 1VRTA 2EG2A 1WEYA 2VF3A 5HLFB 4DV6F 2A1BA 1HWIA 1DURA 2FIUA 4WFYA 2N3OA 2R2RA 2RS2A 4FS1A 3W9HA 2DHAA 4LVOP 2DGSA 4LT6A 3OJSA 1K73T 4LF8F 1VQMS 5KFZA 3KLVA 4LF7J 2YKQA 2V8GA 3ZZUA 2EG1A 3DLGA 2VG7B 4CO3A 4F3MA 3DKDA 3JTNA 2ZH4A 4NLXA 5HANA 4ETZA 1JJHA 2GJFA 3A8IA 3QIPA 4DPWA 1RAAB 4QIFA 4CNZA 3TP2A 5IQ6A 3GR1A 5ETVA 1HW9A 3OL7A 3V81A 2B9YA 5IQQA 1X4CA 1TL7B 4F7VA 1T3NA 4Z7YA 1PAUB 1HNZJ 3RW6A 3OFHA 3RAXA 5K8NA 1LWCB 1FEEA 2FGOA 2CJYB 4HYKA 3ZXWA 4PRFA 3MCSA 4UOHA 3VAFA 2ZWOA 1UVKA 5DDPC 1JLAA 1KEKA 3PX4A 3U1MA 1V9OA 1PYSB 3EZUA 2VFVA 2V63A 3F0NA 5LOQA 5J1PA 3D54A 1TKTB 2KFNA 1ZAVA 5DLFA 2HS3A 2LCWA 2DO0A 4UT4A 3NGDA 4DUZJ 3E51A 1PYTA 1FTCA 1TKZA 3ZO7A 2R8KA 4B9UA 2Z2YB 3M6VA 3NNHA 4X62J 1S6QB 2OEKA 4J9PA 2ZH7A 5T41A 4DV7J 1KQSR 4JI6J 4O3RA 4HKQA 1AB8A 2E44A 3TOQA 3SSQA 1J2VA 2VJVA 3R5AA 4ZDNA 2F40A 3QWUA 7AT1B 3M2VB 4O3NA 5H9EK 4K0KJ 4WKRA 1KTVA 1U1RA 1EQ0A 3OPKA 3D6TB 1FK9B 3KUGA 5HP1B 2FC8A 3HSGA 5HBMB 3UD3P 3CMQA 1IKWA 3PRDA 5FDLA 1S4FA 3RAMA 4DI6A 4ED2A 3TARA 4A8OA 2QMWA 4WP3A 4B3TJ 4IFYB 1CJTA 4DXLA 3AA8A 4YB6A 4DUYF 3R6LB 1UA1A 3W8GA 2E7XA 1DLOB 2GVZB 3BSAA 4ZCMA 5JVHQ 4F25A 2QEXS 3MMCA 2MZRA 5HJXA 4NEYA 3K8VA 3THVA 1M90T 2UVVA 3DRXA 4WFAQ 2L48A 2VG5A 3POTA 1P9YA 2CYYA 2HPUA 4UQTA 3S7RA 5DGAA 4RUAA 3R5DA 3ISZA 4LFAJ 1RHRB 4ZMMA 3W60A 4X66F 2GX8A 1F6TA 4QIWD 3BGRA 3NGUA 4FXWA 2RU9A 5KFWA 3N01A 3MR2A 1S6PA 3GU0A 3US5A 2U1AA 3EE3A 3D7SB 2RDJA 3MCNA 5L1LA 2E9ZA 4LRCA 1DRZA 2ZH6A 3RB3A 3CJKB 5AXKA 4OYMA 2HHWA 1HWUA 1SCJB 4AQYJ 3HVWA 3M2VA 4LF9F 3Q8QB 2AKWB 4A8XA 1KS2A 3OVBA 2W9CB 2HHPA 3KHHA 3V81B 5HL7Q 1FKOA 4Y6IA 3AY0A 1RWOB 4U8YA 4IFVB 5J1EB 2EWHA 3ET6A 4OI1A 1C4CA 1GH8A 1C0UB 1Q78A 3DGPA 4LF9J 3OFEA 5D0GA 2PC6A 5F8MA 4DL3A 1ZA2B 2VOPA 2HVEA 2WVDA 3FNNA 4P52A 4ZVFA 1FD2A 2GMLA 1RWVB 3O5TB 3CCES 1CS4A 1LWFA 2DGUA 1KR4A 1RAGB 4WFXA 4GKJF 4MK9A 2IMWP 4JV1A 3HJVA 4UY85 3K0JA 3D0HE 3W2WA 4ICLB 1VRTB 1WNEA 2MQPA 3K5MA 3MMAA 3BO3A 4USMA 1SL0A 1D1UA 3C6TB 5GAGI 5KAKA 4WP8A 1S7HA 1FRIA 3QO9A 4FKYA 1RT1B 1XC9A 4Y2AA 3MEDB 2HBQB 4PXEA 3VGSA 3FFIA 4UTGA 3UFCX 3LAMA 3K59A 3HHEA 4YB1P 1F9FA 2QMXA 1IWAA 2ALZA 1KKHA 2EC2A 1U24A 3MHYA 4K7QA 1VC5A 1RWKB 5FJ4A 1WI8A 4FVMA 4JBCA 1B7YB 3SZ2A 3Q8UA 2E29A 2Y3YA 3DXBA 1RT4B 2XG8A 3RU0A 4DG1A 3L09A 2NZ4A 3MM7A 2VA2A 2RF2B 2CAJA 4L74A 3DRYA 2OPRA 2C2MB 1RTHA 1SPBP 4G1QB 3IWLA 3RBZA 4KRWA 3WIUA 2WONA 4DPXA 4ES2A 5A8KA 5HSPA 5IV4A 2OTLS 4NMLA 2GQ2A 2XSJA 1VISA 2XCAA 3V6JA 3AXKA 3JXOA 3BDEA 4H54A 4ED3A 3OL6A 5T14A 3KJVA 2HVIA 4DV2F 3ITHA 1F9EB 2CUYA 4Y2MA 3RB4A 4ZVSB 4KO0B 3P4UB 2MZTA 2NZCA 1IKYA 1S1UA 1UKUA 2L9NA 3GJQB 2VQFJ 4KT0C 2E5HA 3B6BA 1R3NA 4DSJA 2DHSA 1JLQA 2RKIA 5F0UA 3ULHA 1QTMA 2YNGA 3A3OB 2RRNA 1RWWB 1TUVA 3FFIB 4P75A 5DDOC 4J9OA 2WB4A 4PWUA 4F4WA 2J9DE 3QRPA 2DISA 2PE8A 3NWRA 5EHHA 5ITHA 3ELHA 3W7BA 4XPEA 3PKYA 2NSBA 4C8OA 3MECB 4JI4F 3HO1A 1BQMA 4R5PA 2FLPA 1JLFA 1NAQA 3LUYA 3HFVA 3U27A 3PDNA 1HBMB 1Y0HA 3V5RA 3R1HA 1N5YA 1GMUA 2EFVA 5F8LA 2NYIA 3IM8A 2ROPA 3LGMA 5EX0A 2W9BB 1QM9A 3NS5A 1P6TA 1S6OA 3AAWB 4P7TA 3M8SA 1UL3A 4DL7A 1PILA 3HD2A 3QT5A 5KG0A 2ROGA 1LWFB 4OX9J 2G0IA 4K4TA 3PM9A 3HXMA 5J1NA 2A0FB 2EI5A 2X3DA 3I0RB 2DPIA 3M4XA 4ZP8A 2EC0A 1K0VA 1TL3B 3MM9A 2BMBA 4RBUA 7FDRA 1B0TA 4WXWA 5MLCV 1R0CB 3BR9A 2D3O1 2IM3A 3PJ9A 3B78A 2B4UA 1SJ1A 2NCKL 5LSOA 3MAQA 1JLEA 4RWXA 4URGA 1T03B 2DNLA 4NCGB 4O4GA 2LXIA 2EK1A 2LEPA 4WXOA 2R7TA 4MIAA 2AEJA 2YWGA 1TFYA 4K8RA 1HBNA 3CCWA 1FO1A 2IDLA 1JLBA 2D74B 3IO1A 4U67Q 2RU3A 1ZA1B 2G9OA 3BKUA 4KGMA 2Z57B 5C42A 3TVZA 5LSRA 2IM0A 3GONA 2K3KA 2AYGA 1YDLA 2F65A 3K17A 1U0HB 2ZD1A 1RYRA 2BR0A 3HFZB 3PJWA 1X5SA 4WU3A 4CLPA 5HROB 2MKKA 4C48A 2OHDA 3GYGA 1NUEA 2FLOA 4N76A 3KJVB 1GMVA 2W1BA 4TU8A 4ECRA 5KFAA 4PYDA 1WTFA 3PEHA 2EFOA 1Y5LB 4OYZA 4AL5A 1K47A 5D4PA 4GKKF 2C2KB 1X7VA 3UD5A 4ZCIA 1XMQF 4ILMA 3I87A 3IP0A 4LF4J 1VJQA 5AT1B 1HKAA 4JI4J 2XLKA 1SUQB 4X65J 1U1NA 3U1NA 1GNKA 4PWDB 5GADI 4AL7A 1T03A 1RWXB 4EFAC 2OO4A 1NZ8A 2M8HA 1JMTA 4NLTA 4USJC 1N5SA 2BJ8A 2AGPA 1S12A 4M5LA 1TL1A 2VBZA 1YX2A 1LOUA 1T7PA 4C11B 4OYIA 4ZHRA 2Z56B 4MFBA 1PBAA 3LANA 3P96A 4MIWA 3G6ES 3BPDA 1HFEL 3E3XA 2R3VA 4U7UD 2D41A 2MJNA 1N6QB 2MLZA 1TAUA 4ERDA 1YLXA 2KRRA 2DH7A 4ZK7M 1U2CA 5IS2A 3UPFA 1E6YB 3QPIA 1HI1A 4L3KA 3N9UC 2KI2A 2YY3A 1FNMA 3EDQB 1NEEA 2F5GA 4M5KA 5KT6A 4ZVOB 4NXNF 3UNYA 4C3KA 2IJNA 1V3ZA 2AEMA 2YKAA 4NLVA 2O3DA 3BGLA 1YIJS 3TO8A 3JSBA 3B4MA 2KZZA 3HKZD 4DJBA 3MEGA 1S1XA 3Q22A 5AJ3J 1UCNA 2OEMA 2GMJA 4OYAA 4YQWA 1VLYA 4F2SA 4CWBA 4LR8A 5C5JA 4IOBA 2E5IA 5ETSA 4A8MP 2N4DA 5GMEA 4C0HA 5EWGA 3K2YA 2CPFA 2AJFE 1NK4A 1OO0B 2OSRA 2ATLA 2CKWA 2MZSA 3CC7S 4RU9A 3LF0A 3HMJG 1HMVA 4DR7F 4ATNA 3QZ7A 2UXBF 2YQ0A 4CTAB 4ZITA 3R5JB 1HQEA 5B08A 1X4FA 1XWLA 4G6VB 3PX0A 3OR1A 1KQFB 4DHVA 1OQ6A 5D78A 4IYQA 1HW8A 2GVZA 4QR0A 3VGUA 4AT1B 4B9TA 5HROA 2R9LA 1VQ6S 2BJ3A 2A10A 1D9DA 1G7CB 2GJ2A 1KSPA 1R0AB 4NLRA 3MR6A 1XTZA 2WTFA 4IG3B 2ZOFA 1RBOB 1WDDA 2GNKA 2WVFA 1MN7A 2EPIA 1P8GA 1WF0A 3JSRA 4WP9A 4YB7A 1D09B 4YP3A 4KKOA 4QWAA 1LK7A 1DTQB 3DRSB 2I9SA 4O23A 2MQNA 2PIIA 1S1WA 2RD5C 2VPXB 5IXUA 4ZVGA 3KLFA 1SV5B 3DOKA 4CH7A 2YQ1A 1XN9A 3T3FA 2GMHA 1CPZA 2DCUB 4I6YA 1FA0A 1FKPA 2FHOB 2NLWA 4O44B 3G4SS 2HURA 1NHKL 2XY7A 1OJ4A 1EQMA 1FK9A 3A3PB 3LP0A 1EARA 2CJXB 4JI5F 1QLNA 4OL8A 2XS7A 1B4SA 1NH7A 2OUGA 1TUWA 2GHPA 3N6MA 3ONQA 3CCMS 4CLKA 2V4RA 2QG9B 3IR5B 3N28A 4CYUA 2BRLA 4K2JA 2HNDB 1NJYA 3VAKA 2ASDA 4CCHA 4ZIWA 4CH1A 4ZCKA 2HMIA 4BWJA 1FVSA 2OELA 5I4MA 3HSZA 4F4KA 2WONB 3PHEA 1T94A 1ELOA 1HBOA 2ZWPA 3BH6B 3IFEA 2VBYA 2GIFA 1M0SA 3MTJA 3CJQA 3TJAA 1Q79A 3CWJA 1SH3A 2YX1A 3DM2A 3JS9A 4X66J 4EUVA 4EYIB 4NLGA 5IZHA 1IN0A 5D77A 4FYVB 1U09A 3KG1A 1NDKA 3GIKA 5C24A 2EFGA 2ZJPQ 3V4IB 2CNNB 2B6AB 2EBEA 5H9FK 3GQCA 1EETB 2JHEA 3QWPA 5GVQA 3PVXA 1J5EJ 1S57A 4LRDA 3I9ZA 2JLGA 1YJ9S 3U02A 2MLYA 3PRBA 1SKRA 2YWFA 2KXNB 3FKBA 4OYWA 2FHJD 2G13A 1GX5A 2RKIB 2R7RA 2J6UA 3EM1A 3JTPA 3JYTB 1YG0A 3RBEA 5DG8A 4WFZA 7FD1A 3LPEA 1VQ5S 2XY6A 1NDCA 3F41A 1RAEB 3GG0A 1X60A 1D9AA 2D7SA 1WKLA 4G1PA 4K0KF 5J2NB 3VTIA 3VGTA 1JB0C 2YKOA 2ZUAA 1Q86T 2XULA 3J7ZT 1N6QA 3QFWA 3ENQA 5CXTA 2XSJB 4Y28C 3M2UB 3NGSA 3FCHA 1HBUB 5D0HA 3SMZA 4DUYJ 3RRKA 3FRYA 3KK2B 3K5LA 4PQUA 4ZCLA 1M5KC 4J9NA 3AJ1A 2N3LA 4YHHJ 1AZSA 1SJFA 3W9IA 3D6HB 4I6WA 1RHKB 2BKNA 2G1HA 2OPQB 1PYOB 5KG4A 3EZ5A 1N56A 1Q8BA 1R0BG 2I1RA 3UDCA 2MZ1A 3VZHA 3ZFVA 5L46A 2V4QA 3HZGA 1U1KA 5U47A 1YKWA 5D4OA 3FEXB 3CC4S 5KG7A 2DNMA 4E2FB 1RAFB 2ZZTA 1SKSA 1YJRA 5CD4H 2OIHA 3G9CA 2LFVA 2QA1A 2ZZNA 2J0XA 5I3UB 3MMBA 3R6GB 4QR2A 3AFGA 4MKBA 4JI3F 4FS2A 2D3UA 2RSQA 3DDNA 1VLOA 3GB0A 2MEWA 2GS8A 2QYGA 5J2MB 4PG6A 2YWHA 2VFSA 4EWTA 3I31A 1UJ6A 1TKDA 4ILRA 4CO5A 2C3YA 3CXCR 1RK8A 4X4RA 2LU2A 4U96A 1NKBA 2P8IA 3N6LA 1NH8A 2UVWA 1KLMB 2SXLA 3J7YI 2H1YA 2V2KA 5ETOA 1LEOA 2C2ZB 4K5SA 1NJZA 3QBCA 4F2RA 5HI7A 4DZDA 2KXFA 1KTQA 3UDVA 4Y0FA 1SKUB 4OZ2A 4QBUA 1WSRA 2C3PA 2YXLA 2ZOMA 2M52A 5K8PA 3SCIE 1MMLA 1H0HB 2LVWA 3FZ2A 4LQ9A 1GQEA 8ATCB 5E41A 4ECYA 3VAGA 5CYJA 4ZJQA 4EO8A 5CH7B 2GHVC 3CJKA 3BF4A 3KDOA 5BYRA 6FDRA 2ASLA 2BACA 1JKHA 2HFUA 1HPZB 2L9DA 2XMUA 4ZN3A 2FVPA 2HFNA 2RDDA 3WBZA 3TZZA 1YHQS 2F4VJ 3VAJA 4ZS6A 1WG5A 1CBKA 2MQMA 1RBLA 5GMKa 1PSDA 3H5XA 3GFXA 2OPPA 4L73A 3LGHA 3TA1A 1WSVA 1A7GE 5GAHU 1JLAB 3SSSA 1JNZB 3IRWP 4CRJA 1X5OA 4RJVA 4ES3A 1LKZA 2CJBA 3BM7A 5JMNA 4DU8A 2J7UA 3MPWA 9ATCB 3D3CJ 1CULB 2BQUA 2AWZA 5G0RB 1PGZA 4QPXA 2V94A 1AUSL 1T95A 2VD3A 4CO0A 1K9MT 6FD1A 3X1LB 3SCLE 3MEGB 1JLQB 4ZVTB 1BHNA 2CQ1A 2AZ1A 1GAOA 4N8OA 4NCGA 1RAOA 4O4GB 4AXJA 2VC1A 4B3SF 1DARA 1K1SA 4OLPA 2C3OA 3FUYA 2KRBA 3NGKA 2DY9A 4H4MA 3VAMA 1U47A 3U1LA 1DTTA 1SJQA 3Q8SB 2JSXA 4FXVA 4P2SA 5AXMA 4IH6A 4K50A 4X4SA 2HBYB 1VQ7S 1C4AA 3T9NA 4B17A 1S9GA 3TI0A 1F2GA 4DR4F 3H59A 4FF2A 3KLHB 4TU7A 4B3RF 4DPOA 5SZTA 2DRAA 2LQ9A 4HDHA 4DL0C 2FJEB 3ZTOA 5L38A 2OMOA 2HMIB 2EEYA 2XMKA 1RQ0A 3HHDA 1PG5B 1WHYA 1AW0A 1HBOB 2JH3A 3IWXA 3H2VE 3HZEA 2Q3PA 1SC3B 2QA2A 2AIRB 3QNWB 4TYBA 5D0RA 4X65F 2B9WA 3PW0A 1L3VA 4PYAA 5KFKA 2MJUA 3BKFA 3DNCA 4F02A 3GFZA 2F8EX 3EYZA 2APOA 4ZPAA 2J76E 3DOKB 3D9BA 4Z37A 2UXDF 4URSA 4ZLNA 2CNKB 3PR4A 2OPQA 3QGPA 1TQLA 5LXRA 3AODA 2AT1B 2D9OA 3MTKA 3FVYA 2ZJQQ 3CIZA 3O3LA 3RRHA 2UZAA 3I4HX 2R7XA 2JRSA 1WKKA 1FX4A 1QUVA 4J9KA 1VQSA 2RJZA 4Q43A 3FZBA 2R8GA 4X4OA 3DI6B 3ENVA 1UWBB 2WOMB 2N7YA 3LALA 1QE1B 1IKVB 4NYZA 2G4BA 2RB7A 3KLEA 2ZD1B 1HARA 3MMBB 2K7KA 4R8UA 1TK8A 2RMLA 4ZVQB 5KT5A 1U2RA 2LA6A 4EK2A 3BQ0A 1GT8A 3QGIA 2C28A 1HNWF 5CQGA 4DSIA 3PFOA 3OUYA 2ZVSA 4N8NA 5J2MA 4C8LA 1UETA 3CW2C 2ZH5A 1AA1B 5A76A 2XYHB 4L6V3 2QA4G 2C2OB 3OTDA 3NAIA 1I3OB 1X8DA 5A6WA 3PFEA 2DXFA 5AE2A 1CJKB 1RDRA 1UJ4A 1YJTA 3KJFB 4UUXA 5F8IA 3HKWA 2XGQA 1E6VA 4LR7A 4QW8A 1Y5NB 4DSEA 4JYAJ 1SL1A 2DR6A 3LA0A 3HM9A 1QUPA 2BJ9A 2PSZA 4ZVEA 3NS6A 1RT2A 3AJDA 3FEZA 1ZOTA 2VG7A 3JAMY 1REVB 2XWYA 1UZHA 5B7WA 2B4VA 2CPEA 1S6PB 1KWMA 1S10A 4IH5A 1NM2A 1RZMA 3C6UA 5BR8F 2HQCA 3ZZYA 4DF8A 4DCPB 1U4BA 1WC0A 4WWSA 3FSYA 1RUSA 5HQ8A 1U02A 1JX4A 1NK6A 1DFDA 3JQKA 2RS8A 4DX5A 4X2BA 3PW4A 1DBDA 1Z4UA 1UVIA 4P7VA 3G82B 3OT9A 4HH1A 3DCAA 4PXBA 3W8PA 3AD8C 5F9NA 4ENOA 4ZPTR 3RB6A 6AT1B 2LQ5A 1Q5VA 1S77D 2BBEA 2QZ8A 4QQBA 5J2NA 2AYBA 4WBFA 5D15A 1RWUA 1UP1A 3LW5C 2J6TA 1NZAA 1JLGB 2JVOA 3R2DJ 3LTOA 2JOQA 3UCGA 3PIPQ 4YOEA 5BXIA 1ULRA 3NS7B 1LW0B 2W9AA 4DPUA 2FHJA 3R5CA 3ZZ0A 2MQOA 2VFUA 1REVA 2ZDPA 1SC6A 4ID8A 1IKYB 1S1UB 1JLEB 5KFBA 3TUIC 3H4BA 4A8YA 1FJGF 1RT3A 3DMJA 2H48B 2YNGB 2DGOA 3IBCB 4PZVA 4I69A 2DGQA 3DLKB 3OVSA 1TV6A 1BQNB 3R7NB 3VVTA 1RADB 2IYIA 4WCEQ 1HWJA 2AJ4A 3QAUA 2W8LA 4HEA9 4K4XA 4MKYA 1R43A 3TEHB 1SJ3P 1WJ9A 3FDSA 1RTIB 1Y00A 3ILIA 3R2CJ 2IY5B 1U0SA 5KFQA 3IS9B 1MWZA 1PJ6A 2GAHC 1WI6A 5T7LA 2DVIA 2ROEA 1ZPWX 1IBMJ 4IRDA 5A8KB 1X4HA 1D3WA 2FHKA 2KVIA 2Y0SD 2IJRA 1TK0A 2IA6A 3E8OA 2OPRB 3ZZOA 4DFMA 1F60B 1Z2LA 1Q8LA 2MDAA 5KFCA 2KHDA 4Q2MA 2HQGA 4DL2A 2JX2A 3FQKA 3W3SA 3UI3A 4CQ1A 1B0PA 3SI8A 4UW2A 2RQ4A 4OI2A 5ETNA 1CJVB 2V0NA 3D4JA 2KFZA 1DJ0A 1J5OA 1HR0J 2CG4A 1HIYA 3LWMA 1X4GA 3J81j 2OSQA 1LNQA 2HZAA 1S1WB 1OS5A 4OQJA 3MUMP 3HK2A 3MD1A 1R6VA 3B8HA 4DV4J 2Y1JA 1VC0A 3IBFB 1OWXA 2B43A 1NKCA 4DMZA 1YRUA 3C3LA 2YNIA 3I5AA 4X62F 1ZM4A 5E7OB 3MFIA 1JXLA 2NXCA 1U8SA 1RWNB 2MKIA 4OZNA 3H2UB 3AD7C 3R7SB 2FHMA 1TL4A 4BC9A 3DOLA 3L7UA 4DL5A 3CDBA 4F0KA 3OHBA 4FNIA 3QGHA 4O3QA 2I2YA 4LSNB 3V2UC 2CZVC 1PCAA 1U7LA 1VQKS 2BE7D 1Y3KA 4OI0A 1Q16B 1UW9A 4ED8A 3BN7A 1SQEA 1NPRA 2DHGA 2RT3A 2W9BA 1KFSA 1FRHA 3AOAA 5DO2A 2HWHA 3QLHA 1UPMB 1JXEA 1IBCB 1T9UA 2O1PA 2XMVA 1FWLA 1U6FA 2HGMA 2XWXA 2YNHB 3LP2A 3HX9A 2B5JA 3PHTA 4OLOA 3RAQA 3D6FB 3HFKA 1G4CA 2HBZB 4EMDA 4HT7A 1RLDA 4RUBA 3VF0B 1E6VB 2NUHA 3SQOP 4CLFA
chains in the Genus database with same CATH topology
5HMZA 2QE5A 2XS2A 2E1MC 2IBOA 1RT1A 2MZQA 2WSEC 2R2SA 4QPTA 2CQ0A 2PA8D 2W7PA 4V19X 1UVLA 2UUBF 3PZPA 4I56A 1XEZA 1UVMA 4C4WA 3C46A 2X51A 1J5EF 3EUNA 1P27B 2U2FA 4O3PA 4F50A 3IA0A 2HWTA 2W7OA 4G3IA 1RA6A 4PCQA 3LO3A 2ILZA 4QWDA 1VIXA 1KC8T 1NB7A 4OX6A 4GC7A 1M1KT 4DQPA 4LQ3A 1FRJA 4YB5A 3AHPA 4IFYA 2P6SA 2R7WA 4N56A 5I3QA 1HNVA 5H9EJ 3EXCX 3LP1A 1ROFA 4ZKAA 5B0FA 1T8EA 4DQIA 1GXLA 2J9CA 3K5PA 4ED0A 4DSKA 3OR2B 1TP7A 4FBTA 5A0YB 2M3DA 3PO4A 1OIAA 3T6BA 3V4MA 4Q45A 3PKMA 1IBKF 1Q81T 2MPUA 2IRUA 3UDLA 1QAYA 2BABA 1SUQA 4G1IA 4KIAA 3GWCA 3DLGB 3A1YG 4OZ0A 2I5JA 3L7PA 2HYIB 2DGVA 2XMWA 2BXJA 1F5AA 3I56S 4ALZA 2JEIA 5F3TA 3BGUA 5L39A 1S0MA 2GCFA 3M2RA 1VQNS 1JNRB 2W4CA 2V8HA 1PC4A 1LWCA 4K59A 3IGVA 4F3QA 2PI5A 1FDBA 1BGXT 1MW7A 1Q82T 4QW9A 3CJ5A 1IKXB 2V5HG 2VPYB 3J80Y 2GGPB 2CQBA 2C22A 2K1RA 4WE1B 3WC2A 2N7CA 1LV5A 4QU7A 5G0RA 4Y00A 1YRXA 3IRXA 3U7JA 3FEYB 5F3ZA 2VQEF 2EVZA 2OLWA 4NX9A 5K9FA 4YDDB 3KK1A 3THTA 2AYMA 5GAHI 2ZUGA 4RNFA 1FRLA 2UXCF 2ZDOA 2J0QD 1HI8A 2PT0A 4GMKA 1NNDA 4NXMF 3ZZZA 4M5DA 2VONA 4F8RA 2PN6A 2DIVA 5IM0B 3OXFA 2WCXA 1PC5A 4OI3A 3PEJA 1HBMA 2ZZMA 2DNYA 2AF6A 4OX7A 5E5NA 3X3UA 5EN1A 4X84A 2FTRA 5E3RA 2Q66A 2HNYB 2IVMA 4NRTA 1PO6A 2J0SD 2COLA 2W7AA 1HQUA 1HD1A 4DX8H 3C8YA 1C1CA 2LA4A 2GHWA 4OX8A 1S0VA 3IRXB 3O6QA 1J5OB 1L3SA 1RI7A 3DLJA 1SV5A 3I82A 1Q1KA 2DJWA 5IT9Y 1QSYA 2LLZA 3D1QA 3MR3A 4DWIA 1R27B 4F4YA 2WAQD 2M0GB 1NU4A 4CT9A 3R3TA 1VQPS 2QLXA 2G0CA 3HLUA 3IAS9 2N82B 5J2PA 2XNQA 3TNVA 5AJ3F 4X4PA 3TYTA 5D6GA 4DLEA 4EBCA 2DNNA 4IR9A 2FD2A 3T1YF 2LU1A 3LAKA 2RF2A 3CDWA 4IOAQ 5F8GA 4A48A 4C7QA 4QIEA 3M8PA 3Q0AA 2M2BA 3K57A 4Q5VA 4MJKA 2MY8A 2I8EA 4HI2A 4DQSA 1LWEA 1FTRA 2ZHAA 2C3MA 1XR6A 4WJBA 2MGZA 4B3OB 2FJAB 4LUBA 3KNGA 1K1QA 1FDNA 3OR2A 2RE1A 4ECWA 2DH9A 4ZVHA 4LVNP 1T05A 2BANA 4N77A 3F56A 2VPWB 2CJ9A 2B56A 4W92B 1TKXA 1VGYA 2JEGA 4L72B 3PX6A 1KHVA 5KFGA 2V9WA 4IRCA 2CPIA 4DEZA 1MROB 2M5YA 5LXYA 3OW2R 3TUZC 4ECTA 4HT5A 3KLEB 2H5EA 5IM0A 1QE1A 3I5BA 2KTQA 2VASA 3DC2A 3OR1B 2KU7A 2R8HA 2OFHX 4OX9F 1NHUA 3MM6A 2FPHX 4JI0F 1RT6B 5KTQA 1TZ0A 3B4DA 3TANA 2F8MA 2JLFA 3A8EA 4U7CA 1HNZF 2X1FA 2BW2A 5J2QA 1S49A 1HNIB 3SDEB 4CIOA 1RT7B 2E7WA 3IGNA 3T5KA 1NKEA 5H9FJ 1IR0A 1IJFB 3RBDA 3NNAA 3GIMA 3W2VB 2J8AA 2ZNZA 5IFMA 2B5JB 1MWYA 1RT2B 1AFJA 2WSCC 1ZTTA 1D8YA 5BYSA 4NWBA 1FRKA 3DRSA 4WK1A 4DS4A 4RW7B 4ECVA 4GC6A 1UA0A 3I0SB 3HHNB 4JUZA 3RZAA 1X9SA 4FNHA 3QAEA 4JI2F 4CO1A 2P9CA 2KM8B 4J9QA 1U2FA 3IAM9 2X1AA 1XNRF 3RRGA 3LGNA 4M1KA 1LXNA 2V8DA 2BVZA 3TW0A 4TU9A 3KLHA 4M5DB 3G8TA 3RR8A 2F3JA 3I6PA 3SCJE 4WFBQ 1JJ2R 1QAIA 1DLOA 3CCUS 1XR5A 2BDPA 1DHMA 1VIOA 3PY8A 4KTQA 2MSTA 1S76D 4Q7AA 1FVQA 1H98A 1LK5A 2XHWA 4I6AA 3BJYA 1G2EA 2AJ0A 4MIBA 3CGIA 1O8BA 2NS1B 2NR0A 2PD1A 2ABYA 2B7BB 4I4BA 2HAIA 4J9MA 1U45A 1X9MA 1N36F 4JI3F 4IUFA 4IOCQ 2E5GA 5A0YA 2MQLA 4R25A 2EFNA 2FDNA 2L3MA 3NLCA 2CZ4A 4QZVB 2IRXA 2YKPA 4V19J 2XSFA 4QWBA 4EYHB 3AJ2A 2YNFB 4NCAA 2ZH2A 1YJNS 4XO0A 3V6DB 1VHFA 3KTQA 2QYCA 5T7LB 2B4PA 5B0DA 2DCLA 4AL6A 3FMBA 2JEJA 4OHXA 4K4WA 2PFFB 3OFFA 5FIIA 4EO6A 1C2PA 3N4WA 4F4ZA 1S0OA 2BM1A 2VG6A 1OPZA 3BZQA 2HVHA 1W25A 3DU5A 3BQ2A 2CQ2A 2K1RB 4WE1A 5DG7A 1O51A 3SFUA 2OMLA 4TYAA 5KT3A 1SIZA 2VODA 2NUUG 2VZ9A 3MEDA 4DR1F 1Z2ZA 2YX4A 4ED5A 5CYQB 2IM2A 4RW9B 3H5YA 3LH2S 1P1LA 2DR5A 2BE2B 3M05A 3TX8A 3D0GE 4WZMA 2OKQA 2OH2A 4TXSA 2ZE2A 1YSJA 2R2UA 2J9EA 2HHTA 4ETXA 1UJ5A 3CCZA 5KT7A 3V6HA 4FP9A 4R8UB 3UWTA 2HW3A 2JVRA 1YJVA 4NLOA 2C42A 4RNOA 1KQGB 1WG4A 3PW7A 2VA3A 2O67A 4NZ7A 1C1BB 2E1CA 4DSFA 1S1VB 2AX1A 4ZP6A 4FF4A 3CO9A 2CPZA 2V4JA 3MZIA 2OD4A 2HHUA 2F8HA 4PUOB 4K4SA 2PGCA 3H98A 2CPXA 1C1CB 2C2DA 4EZ6A 5CZVA 2HHXA 5LL6d 3O44A 2HLTA 1S6QA 2GQQA 2BM0A 5E33A 5E3AA 3CSKA 1M5VC 2MYFA 2ZBCA 3D28A 4TNOA 4ELVA 4PKDB 2C2EA 2M9KA 2R7OA 4GO7X 1U1QA 2ZE2B 4NZ0A 2ZBIA 4O4RA 4C8YA 1A6LA 3GR0A 1IKVA 5EDWA 3CVKA 2ZNYA 5C42B 4HDGA 1IQZA 2DBBA 2BYCA 3LWLA 2UUWA 2PI4A 4K4VA 3CJ2A 2Z2MA 5KFSA 3FSIA 1N5TA 1QVFR 4A8SA 2DNRA 2DNKA 1HYSB 4FYDA 1QAJA 2IBKA 3C2PA 1LXJA 4BWMA 1UFLA 1URNA 2DNGA 4AUKA 1R8AA 2QIFA 5I3PA 3SQGA 5D4LA 5KFOA 2XLJA 1L3KA 1MU2A 5LMNF 4EBEA 4XDDA 4B3OA 4DSLA 5F41A 3H2LA 4A8FA 3OL9A 4R0JA 5L1IA 3KLFB 1EETA 3GV7B 3P6YC 2JWNA 4CH0S 3KLGB 4HTJA 3CT9A 5E2QA 2ZHOA 4ID5B 2ADCA 3CJ0A 4K4UA 3VAHA 2YH1A 2JFKA 2UUTA 5ADZA 1S1TA 1RT5A 3Q2SC 1RKJA 4BBYA 2FJDB 4Y34A 3T1AA 5L1KA 4LSNA 2EFQA 4E0DA 2VPZB 4DN9A 1YQHA 2XO7A 3M32B 1VBYA 3J7Z5 2IMOA 3RB0A 1D8ZA 1CC8A 2ACYA 2VKRA 3C66A 1FERA 1KHWA 2GIQA 3ZZRA 1LW2B 1HD0A 1YJUA 4B08A 2V4JB 4RNMA 4RKUC 3IN5A 1MU2B 2E66A 3T19A 2CPHA 4KO0A 4C8KA 1G1XA 1JWWA 1WACA 3H40A 3MWBA 3G86A 1FXRA 3OJUA 4LIWA 1FF2A 5C25B 2YKNA 3M30B 1A9NB 4TY8B 2N4CA 4LMZA 1S9EA 1N33F 2HQ3A 1T02A 3V6DA 3DOLB 3M2RB 1HHSA 3S01A 3MM7B 2RQKA 1F5BA 1SKWA 4ZP9A 3CCRS 2W4DA 1IJEB 2PMZD 3G8QA 1G6BA 2HNDA 3IS9A 4KGKA 2CFXA 1S99A 3TQ1A 3LPYA 2Z4PA 2K8GA 2OP5A 3CEDA 4NLQA 1LFWA 5H1SV 4B9MA 2CQCA 1MMNA 2F4VF 2R7QA 1H6KX 4IG0A 1AUDA 1F5CA 3SDEA 2YNHA 1DZ5A 2OD6A 4ECXA 3W2VA 3K58A 4M95A 2LQBA 2W25A 1IXKA 2AJQA 5EGYA 5CZXA 3QO9B 4FXDA 3BEGB 2HHVA 5KFIA 2DTJA 1SB6A 3CMAS 4WZQA 4PG4A 1BD6A 2KFYA 1SXLA 4DR6F 4RBVA 4E98A 2XS5A 3G9CA 2DD8S 1H2VZ 2QV6A 2HQIA 1F0XA 3CC2S 2FLNA 5I3UA 2I0XA 1RTHB 3DI6A 1HQEB 3OBIA 1X4AA 2HIQA 5IWAF 5KFHA 4TLQA 4JV2A 2VUGA 1OSDA 1SI9A 3MPYA 2XC9A 1U6ZA 3MEEB 4FN5A 3Q24A 3NKYA 1FHTA 3HF5A 2VFTA 3DYAB 2RH3A 3MUVP 1ZBTA 4NOHA 1S72S 5KFNA 1KNZA 1WD6A 1WEZA 5KFUA 1LW0A 1IM4A 3DFEA 1KVJA 2P9EA 5DDRC 4QCLA 4ZPWR 4X4UA 3PNIA 2XI2A 1KVIA 1S1XB 3VALA 1IBLF 1VQ4S 4RW4B 2RNEA 5CYMB 3M8RA 1VQOS 2VFRA 1LQ9A 4OZ5A 3KK3A 2KN4A 5B0AA 1KONA 1MROA 4AYBD 2BV3A 2XMMA 2ZH9A 3AB2B 2HHSA 1SJRA 1ZZFA 4KE5A 1RA7A 1FD8A 1YBAA 1N54B 4FPRA 4ZP7A 3GIJA 2ZKUA 3NMAA 3CPWR 2LMIA 2J7KA 2KZMA 3MGJA 1QY7A 4WYLA 5DM7Q 5L9XA 3CCVS 4C8ZA 4IDKA 3CCQS 1N88A 1S1VA 2ERRA 1H2TZ 1FDDA 1N0UA 1S6UA 3HVRA 3SQGB 1R8HA 1BWEA 2KXHA 2HHQA 2VKZG 4MAKA 3FSXA 1R8CA 2XI3A 3RYLA 4WKYA 1ZM2A 1X5TA 4C0BA 4YR2A 3IC1A 4B9LA 4PG8A 5B0CA 2UUCF 3TVKA 2CQDA 3KHGA 1M5SA 2CDQA 4FZVA 2NSCA 2ZH1A 1CVJA 4NL5A 4TY8A 1KN6A 4M8LA 4DR2F 2DR9A 1VI7A 4QR1A 3VWSA 2RILA 2B9XA 3MI7X 3NAHA 4YUDA 3I55S 4OJ3A 4YEAA 1FXDA 3QJJA 3JTOA 2WW8A 5F0WA 3CCJS 1HR0F 2W4PA 4UQGA 2CVEA 3V6KA 1WHWA 3G6VA 3SYZA 4B9VA 4KB7A 3GIIA 2K7JA 4ZPCA 3EPGA 2CJAA 4D3HA 2UU9F 4C8NA 4KKOB 3DLLQ 3BDPA 3SXLA 2I38A 3RTVA 1N48A 2VH7A 5K8OA 5HO4A 1NK5A 1NK9A 2DNHA 1XR7A 4QYRA 4KAIA 2L41A 1MMDA 3G96A 2AP6A 4ECZA 2NPIA 3WZ0A 4NA1A 2IVYA 4QJVA 4DV7F 5KFJA 3EX7B 2CQIA 4MK7A 1S1TB 4NLPA 3R1LA 2DO4A 2R7SA 1P1TA 4C11A 4A8QA 2QLWA 2LEBA 4DDFA 2DRBA 2CVIA 5KG1A 2F7VA 3OFGA 2IAJB 1Z1ZA 2FVQA 2KT3A 4EGLA 5J1EA 3OTBA 1YRTA 4MFBB 4M63A 4HHJA 3KLIA 4ELTA 1SH0A 5G4DA 3OLAA 1LW2A 3J7YU 3T9ZA 3O8WA 2DB1A 2HRUA 4RNHA 3OV7A 4IG0B 3OSNA 2ZM6F 1W2IA 1KLMA 3NG8A 2XMJA 3L7OA 1UMJA 4EYIB 1VBZA 1FRXA 3OTCA 3Q8PB 2MY7A 3G6YA 1VQ9S 1O0PA 3VAIA 2NQPA 2EKYA 2KKHA 3ZZPA 3BQ1A 4DL6A 1R31A 4AE5A 4Q0BA 2FLLA 3OXGA 4ZLPA 2CPJA 1OSCA 4WF9Q 4Y2IA 4OHWA 1RGVA 1KFDA 1RT5B 1WG1A 4KR0B 3BO4A 4FF3A 1WF2A 3DHWC 2KH9A 3R5BA 4KSEB 2YX7A 4QIVA 3M9NB 2QRRA 3IR6B 2Q6CA 4IFVA 4PXDA 2OPSB 1N34F 1VRUB 1ZAWA 4Q8EA 4KV8B 3QZ8A 2DK2A 1UEUA 5J2QB 2GC8A 1VQYA 3HPOA 2KHCA 2AX0A 5AE1A 4BC7A 4PPZA 2VC0A 5B0BA 4I0WA 4OZ1A 1DTQA 4LFCF 3M6XA 3S1TA 4J9LA 4OHZA 2FGCA 3IR7B 1I1GA 2X1BA 4B3TF 3HVTA 3OQ2A 4I67A 3DU6A 5HMXA 3KWMA 1SL2A 4QWEA 4RNNA 2KT2A 1MNEA 2M88A 3G6XA 3FGVA 1SJ4P 1N8RT 2J9DA 2R2RA 4ZHRB 1FKOB 1OQ3A 3RW7A 1Y9OA 4CI0B 4IO1A 2XMTA 2JDJA 1JLBB 3V4IA 2R7VA 3OLBA 2P9GA 5DG9A 1JLCA 3S8SA 5B0GA 1NO8A 4KBIA 1D0EA 3O1LA 1U1MA 5K5MA 2C3UA 4EBDA 5KG6A 4YY3F 4ED6A 3GG1A 3DYAA 3EXYA 2ADBA 4C98A 3GYXB 4ELUA 2LQJA 2VL1A 4N47A 2E1RA 2IRYA 3IBWA 1Q7LB 2B6AA 3OXLA 5AXLA 2QA4S 2KYZA 3HHLD 3TAPA 4WYWA 3AQPA 1FJCA 1N52B 4F26A 1B64A 5E0OA 1RP5A 2KT5A 4A46A 1XMBA 5A6PA 3NL0A 1U48A 2CPDA 4KHMA 2XNRA 4KHRA 1UWBA 2WOMA 1RT4A 2GV1A 3CULA 4FBUA 2JEFA 4MH8A 1HMVB 4I2PB 2Z0GA 4QOTA 4G1QA 4YR0A 4KJIA 2AYEA 1H38A