4DV0F

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 21
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dv0F00
1XNQF 4DUYF 2UXDF 4DR2F 1HNZF 1G1XA 5LMUF 1FJGF 2KJVA 2UUAF 3OTOF 4B3MF 4DR3F 1CQMA 4X64F 4JI2F 2KJWA 1N32F 2VQFF 1G7CB 1IBMF 4DV5F 4X66F 4GKKF 4LF9F 2HHHF 4LFBF 4X65F 1HR0F 4X62F 2UUBF 4KHPF 4JI6F 2ZM6F 4AQYF 5LMNF 4JI8F 2B7BB 5AJ3F 4DR5F 3R3TA 1J5EF 4DV0F 4GKJF 1LOUA 4LF8F 2UU9F 4B3TF 4NXNF 4LF4F 1VMBA 4LF6F 4YHHF 1F60B 4K0KF 2B7CB 1N34F 4JI3F 2VQEF 4LFAF 5IWAF 1IBKF 4JI7F 1N36F 2UXCF 2J5AA 1HNWF 4DUZF 1FKAF 3T1HF 2UUCF 1I94F 2YY3A 1XMOF 4LFCF 4DR4F 2RJZA 4LF5F 4YY3F 2E5LF 1QJHA 4DV6F 4B3RF 1XNRF 1RISA 4DV4F 4DR1F 2BVZA 3T1YF 4JI4F 4JI5F 4DR7F 2F4VF 4DV3F 1XMQF 4NXMF 4B3SF 1GH8A 1CQNA 2BXJA 4OX9F 4DR6F 4JYAF 4DV2F 5BR8F 4JV5F 1HNXF 1B64A 4DV7F 1IJFB 4LF7F 4JI0F 1IBLF 4JI1F 4DV1F 3ZZPA 2UXBF 1N33F 1IJEB
chains in the Genus database with same CATH superfamily
1EAYC 3R9LA 4PG5A 3TP2A 2JHEA 5J2MA 1VRTB 3G4SS 1U6FA 1UFWA 4IYQA 1TK5A 2XLIA 3SV4A 3TJ9A 1FI4A 2M2BA 1X4BA 5CCLA 4PCQA 3EPIA 2BR0A 1FXLA 4NI2B 4C11A 4JI8F 2IC3B 4YMEA 3FRYA 1OY9A 3MM5B 1XBWA 1F1BB 4USHA 3ZNUA 4W98A 5KAKA 3DOKB 2CADA 3RGIA 3ZTSA 2M7SA 2PIIA 1WSVA 4P72A 1TL7B 5DJBA 4RNHA 1TKDA 1U24A 1AFIA 4RW7A 2IJRA 2YKQA 3HD1A 3BO2A 1T9YA 1Q78A 4DSEA 4DR2J 4OLOA 1LWEA 2CNOB 3R5BA 5IXUA 4WP3A 3PYEA 3EZUA 3HSDA 1AROP 3KOAA 3DOMB 5KG0A 3BF4A 2BJ3A 2MGZB 3F56A 4NLTA 2AT1B 3FJ2A 1LK5A 1W2BR 3SSSA 4X65F 4I6YA 2HS4A 3GSIA 2DNHA 2Q6CA 5H9EK 3LP1B 5AXNA 3MEKA 1RTIA 4JI7J 5D0EA 4YHHF 2XMMA 3GR0A 1MW7A 1QAIA 2RU3A 1YRXA 3B78A 3MCOA 3M30A 3T1HF 3CJ0A 1WC4A 4LF5F 1AT1B 4I2QA 1Y4ZB 3OUYB 2WSCC 5C24B 1XMBA 2WONB 1XEZA 2FD2A 1A6LA 5F8HA 2ZHBA 4XIUA 4QIWD 2LQJA 4B9LA 4K4UA 2F5GA 4EGLA 5C7PA 2M8DB 5DGBA 5L46A 4NE9C 1RBAA 2ADCA 4GC7A 1VQNS 1VIOA 2X3DA 3ZZPA 3DM2A 2HK3A 2P6SA 2IJFA 4RU2A 3MI7X 5GAHI 3ZTOA 3N4WA 1O6XA 1H2UX 1KFDA 5D0HA 2VBXA 2J0QD 1E6VA 2FUG9 2VONA 2XMVA 4R0JA 1YZ6A 4M5HA 4H4KC 3BJYA 1X4EA 1F2GA 5HROB 3EDQB 5IC6B 3K89A 4LJMA 5U47A 1CJVB 4URQU 5IT0A 3MMAA 4P7TA 1N56A 1RTJA 1Q1KA 3CCWA 2LDYA 4EFAC 2XNRA 2HFSA 2KU7A 1BXNA 3GZ7A 4ER8A 9RUBA 3VHQA 3SFGA 1FK9B 1KONA 4CLYA 4WFAQ 3G6VA 4V19J 3GYNA 4DG1A 4WP8A 1NK8A 4PG8A 1HIYA 3FBCA 5KFGA 4EBDA 4JV1A 3BH7B 1HBUA 1B3TA 4OYXA 1SPBP 2MYFA 3MM8A 5IM0A 5DDRC 4NA3A 3PJ9A 1GMVA 2RRNA 3HKZD 1I51B 2XMTA 2FHOB 3NS7B 2PMZD 2PDAA 5C42A 3D4JA 4HTIA 1XNQF 3IO1A 1QY7A 2CKWA 1NHKL 1DTQA 2HYIB 2AGPA 4H4OB 2LMIA 1X0FA 1LW0A 3O3LA 5HVHA 3KLHB 3SIPB 1HR0F 3C16A 3PW2A 3WC2A 4K5RA 3BYRA 4O3NA 4YB6A 3HPOA 4Q45A 2B9EA 1IM4A 1NUEA 2DNKA 4WKYA 3FCWA 3D1QA 1YQHA 2DGWA 1U0SA 2DCUB 1U7LA 1QD1A 3HHLD 4DCOB 1UPPA 1ZAWA 4UQGA 4LIRA 2KRBA 2L9DA 1SKUB 4H54A 1D9FA 2UV8A 3IM8A 2Y9HA 2DJWA 2OPQA 2BXJA 4KFBA 3DLBA 4JI1J 1IM6A 2HRYA 3DLEB 5E3CA 3J7AN 2CWKA 1BD6A 3M8PB 2A3JA 4QWCA 1J5OA 4TY9A 2X1GA 1F9HA 3M9OB 3BEGB 2VDHA 4PXCA 4RR5A 4Z2XA 2V2VA 4UT4A 5GVQA 1NPRA 3F73A 2A2DA 1WG4A 4AD6A 2WVBA 1FKPB 1PSDA 2XYPB 2JVOA 1HMVB 2Y0SD 5LSOA 2MKCA 2G9OA 1VISA 3BS9A 2ZWOA 2LEAA 4CLTA 3LO3A 2JC0A 5E33A 3AJ1A 2C2RA 5KFKA 3CIZA 2VHGA 1CLFA 4LBPA 4N77A 2YKMA 3GP9A 4CZCA 4MK8A 2L3MA 1SUQB 1UA0A 1ZZNA 4K4XA 1JXEA 2J8SA 2WTFA 2DXEA 3TAPA 5E3RA 1T9XA 5A8KA 5CHCB 3NEKA 2B8PA 3JYTA 3FBEA 4GRSA 4YB5A 4MKBA 3UO0A 4DN0A 4WFBQ 1L3VA 2DNRA 2RRAA 4B3MF 1WKJA 1IVZA 1EP4A 3PV8A 1FDAA 4ED4A 3M9MB 2CPIA 3MM7A 5K8MA 1J5EJ 3UNGC 4KIAA 4USTA 1RB0A 1IR1A 3HFZB 1S7IA 4OYPA 2RQCA 3K5MA 1RADB 5B0AA 1PC5A 3EE3A 1MROA 3QGGA 4CI0B 1Q79A 4NLSA 4CO2A 3QJJA 1Y11A 5C25B 3PTWA 1K8AT 1F3FA 2DNPA 3BH6B 3PY8A 2GC8A 4YQWA 5F9LA 1R0BG 2HNZA 1UVLA 3A8IA 3TQ1A 2DGSA 3QJLA 4KR0B 4F0MA 2EG1A 1F2HA 3OXGA 3PNIA 3IXQA 4LF7J 2QLJB 4MIWA 3EUNA 1RT2B 3I4HX 3L7OA 4ZVGA 4I6AA 3BQ2A 4B9VA 4M63A 1MG7A 5JUMA 1C1CA 4ECSA 4UQTA 3K5OA 2UUAF 1R89A 4DX6A 1UEVA 1NPPA 5D0GA 2XTJP 5LMNJ 1TKTA 1Q53A 4PWUA 4J9KA 1ICEB 1FRLA 2MEWA 4J9NA 2IPOB 3OSNA 3EGVA 4RW9A 3FZ2A 3Q2SC 4TY8B 4RL1A 3PW5A 3RBZA 4WIQA 2KG0A 2MQMA 3TUIC 4EBEA 3G6XA 2KXFA 5JVGQ 2Z56B 2WB1D 2W8KA 1LXNA 4HH1A 1U4BA 4J7CA 3T9NA 2ZZNA 1VK8A 4J9OA 3VF0B 3V4IB 3X1LB 2OIHA 2X1FA 4QR2A 5EHHA 4PPDA 3EXYA 4WE1A 2W9CA 3H25A 1GK8A 1NJYA 3T19A 5KOWA 2RDJA 1N88A 1VHFA 4ID5A 2HSEB 4JI0F 2CVIA 1JLBA 4KO0B 3TJAA 8RUCA 3CTRA 3THPA 1FJGJ 2DVIA 2QGFB 2Y1JA 1L3SA 1FVQA 4X2BA 3H0PA 1T9TA 4EZ9A 3SCLE 5AXLA 4JI6J 4IFYA 5KT4A 4LFBF 1C4CA 1UZDA 1RYRA 4DN9A 4X4SA 5FDLA 1REVB 4A48A 4YS2A 4EWTA 3P96A 4ZVOB 1VMBA 3C8YA 3TUZC 2MZJA 3KDNA 4ZJOA 1FRHA 3S7RA 2MZTA 2CIMA 1C1BA 4N56A 1X9SA 3UQSA 1XMQJ 2CA9A 6AT1B 2HZVA 3CJ4A 1YLXA 1N5TA 2CQBA 1B0PA 2J9CA 2W9BA 3CD7A 4OX9F 2AEFA 2K1RA 5JJBA 1TR0A 5GAHU 2LECA 4FPIA 2OGUA 3G8QA 2IMWP 2FYXA 1SXLA 5ETOA 3BGRA 1QUVA 4XO0A 4F0HA 2RB7A 1WTFA 5DETA 1MSWD 4I69A 4OZJA 4U95A 3HVTB 1B4SA 2I38A 1MWZA 2HAIA 1N54B 3V81B 4USWA 5BXIA 1SIZA 2HZAA 2DXFA 2IAJA 2XWXA 4BHQA 2RS8A 1XJWB 3ZTPA 2YNFB 4ED3A 2E5IA 1H2TZ 4ES2A 3U1NA 4E2FB 3MUTP 1ULRA 3P45B 3IBCB 1RHKB 3RAXA 2DR8A 5ETPA 4CH1A 1HBNB 4DL4A 4L72B 2HHQA 1S1UA 2BABA 3I5CA 5KFTA 2VG5A 3N5BA 5D3GB 1SL0A 2DNLA 1Y5NB 3ENVA 2KFNA 1HBMB 1RT3B 3M4XA 4DV3F 1HQEA 4MKYA 4EMDA 2P9GA 4B9TA 2FVRA 4NYPA 1HNXJ 4B17A 4M5DA 4X4RA 5K8NA 2BJ1A 4XDCA 3T5KA 1SIWB 1AXQA 4OL8A 2YNHA 3TVKA 5F9NA 4W92B 1YK9A 2HBRB 3EZOA 3Q2TC 2HNYB 4G6VB 1TU0B 4UZBA 3QT5A 1FNOA 3QLHB 4FYYB 3CE8A 1L3UA 3JAMY 3PZPA 2AW0A 1YTYA 3E2EA 4ZITA 4LREA 4GKJJ 3KXDA 2PGCA 4C8NA 3FFIB 2K3IA 3J81U 2HFUA 4ZVQB 1FESA 2FY8A 2LXFA 1XR7A 3PXGa 4MYUA 3NGKA 1KSPA 3KTQA 2QMWA 3C66A 1SJQA 1JLCA 2A0FB 1AYEA 1S6PB 3MTJA 1T7PA 3P6YC 5E7OB 3QATA 1CC7A 3Q0AA 4JYAF 5GMEA 5DGAA 1YBUA 1U6BA 3AFGA 3DGPA 4RWXA 4CLLA 2IBKA 1FTCA 3V2UC 1YJUA 1H98A 2WBRA 3BSAA 3QIPB 1C0UB 1LWCA 2IIHA 2K3KA 2NYHA 2EPIA 1U47A 1KHWA 1IBMF 3IWLA 4YN3B 1S77D 2ZNYA 1EQMA 4TN2A 1OPZA 2UU9J 3M8QB 4X4VA 4C8ZA 3DOLA 2V0NA 2YBVA 4WBFA 4C7QA 4QYZK 1S1TA 2HQ3A 1JJHA 1R8PA 3UVJB 3V6JA 4LFAF 5CD4A 3EVWA 1S72S 2HIYA 2C2EA 4IG3B 3KJVB 3MAAB 4DPUA 3QWPA 4WXWA 4ZVUB 1T03B 2HMIB 1GEHA 4P2FA 2VKZG 4FS2A 2ZBQA 2IM3A 2W4CA 2ZJPQ 4O3SA 2NUUG 2DT9A 4P2XA 3M8SA 4ZP8A 3B82A 2CPFA 1B7FA 1PBUA 3JQKA 3CCUS 2XMKA 4NCBA 3DI6B 2G4BA 2BBEA 4ES1A 5DG7A 1FEHA 4QPXA 3QNWB 2X1AA 1WTBA 4CLZA 4ECTA 3TW0A 2M88A 3KHGA 1FJCA 4DCPB 4A8KA 4X62F 1NCLA 5B0CA 2W2NP 3G86A 3NCPA 3D0HE 4A8YA 3MPYA 3NKYA 1NDPA 4ECWA 2ACYA 3THVA 3FQKA 1HLWA 3HHEA 4I0WA 2QA4G 1KVIA 1UVJA 2LXIA 3OR1A 1VI7A 3R6GB 2PMWA 2RT3A 3OFFA 2MKSA 1RT1A 3ADAC 3D5MA 5F41A 4RNNA 4QIEA 1I94F 3D3BJ 4NRTA 4JBCA 2QX0A 1HHQA 1FE4A 4NXMJ 1U1RA 1S1WB 2OTLS 2CVEA 2MKYA 1KLMB 3ZTQA 3MM6B 4EO8A 3ET6A 1GTHA 2EVZA 2ZH5A 4EBCA 2ABYA 2BUNA 1TAQA 4N47A 1TV6B 2B8QA 2ZUGA 4LVNP 1RAHB 4G3IA 3PG9A 5K14A 1C0TA 4G1IA 1KLNA 1HNZJ 3NOCA 3M6UA 3KFWX 4EU0A 1FKOB 3LGHA 2V50A 3EX7B 4F50A 2HHSA 1HI0P 3A13A 4X4OA 3QZ8A 2UUBJ 1T3OA 3ZZUA 3H4DA 5CABA 4KBIA 3K8WA 3BSNA 2OJ3A 4R8UB 2HFOA 2MHNA 3VCDA 4WKRA 4YB7A 2NXNA 3RR8A 2JC1A 1IQZA 3B54A 1Q4RA 2VODA 1GXTA 4QIVA 3GV5B 4CTAA 5THWA 1XMOJ 1V6HA 2CJXB 1QM9A 4J9MA 2HWIA 3JSYA 3IR5B 3H40A 3PIPQ 3CWJA 2RJZA 3J7Z5 4P9SA 2F1FA 5DLFA 4B3RF 5B09A 3TANA 2RVJA 3VAMA 1HNIA 3CD5A 1YJ9S 2ERRA 4DV7J 3GIIA 3F0NA 3A3NB 1K9MT 1WC6A 2YX4A 3UWTA 1V3ZA 5GAEI 2QV6A 3PYFA 2MJUA 2R2RA 2DNNA 3A1YG 2ZH2A 1K47A 3UDLA 3MR7A 4YDDB 4DPOA 1ZTWA 1G1XA 2ZFHA 3QRRA 2GGPA 2IA6A 2HHTA 2WVEA 2QFIA 1MNEA 1B0TA 5C2CA 1NJIT 2HWTA 2GJFA 1AUSL 4JP8A 1DQAA 2EKNA 5KT5A 5J1EA 3ZNJ1 3SV3A 2QIFA 3GFYA 3R2DJ 3NWRA 3J7YI 3HK2A 3V6HA 2UV8G 3DLHA 2X1BA 4RBTA 3H5UA 4DS4A 4LQ9A 1N5VA 2R2UA 3VGTA 4LFCJ 3N6LA 2AYGA 5CZXA 1KVJA 4OYWA 2M52A 5T7LB 3VZIA 2GZOA 2N4CA 1PAUB 2F4VJ 4DV6F 2I8EA 2KI2A 1R0AA 2KXNB 3T1YF 3MPVA 3HZGA 1Z1ZA 2YWHA 3CCTA 3O8WA 3VAIA 1IR0A 2MTLA 3IG1B 2XGQA 4C8LA 5LJ3Y 4DR6F 2PA8D 2OMLA 1D8ZA 2E1CA 2WAQD 2IM0A 2IRXA 4TU7A 4L75A 1B7YB 2BE9B 3TWZA 2WOMA 1RHQB 3L9ZA 2EWHA 4UOGA 4NA1A 4WFZA 3W3SA 2NXJA 3NBPB 2QFJA 3IRXA 2VG6A 3MEEB 1RK8A 4KY3A 1VBXA 3SXLA 1MWQA 2UVWA 3GYGA 1KVKA 2V4JB 4G1QA 3CC4S 2CQDA 4ZLJA 5J2MB 3GJQB 1S1VB 4FBTA 1LK7A 2BA9A 1A9NB 2J8AA 2OO4A 1WWHA 2QL9B 2B9WA 4NA2A 3AD9C 3HDSA 4DUZJ 2ZH8A 2KYXA 3ZC4A 1NSPA 4R25A 1NH8A 4C11B 3HM9A 4JI4J 4DDFA 2RKIB 3GU0A 2CQGA 4AYBD 3CDAA 3K57A 2V9KA 2YKOA 3GV7B 2XS5A 4FYXB 4YFUA 2XS2A 4UW2A 5LJ5Y 1IBLJ 5J2QA 4WZQA 2IYGA 3OR2A 1IJFB 2Z2YB 4WPAA 1LFWA 3JTNA 3HXMA 5DZ6A 3PHEA 3H5SA 3EM1A 1SH3A 2GHPA 3DDNA 1Y00A 1SKRA 2GHVC 2FJDB 3K58A 3MECA 5KTQA 3CB4A 1HQUB 1KHVA 2HHUA 3OLBA 1HHSA 2AF6A 3NNHA 1SV5A 4JI2F 5I42A 1T05A 1S48A 1LWEB 2RRBA 3D6FB 4DEZA 1HWKA 2CPHA 2HBZB 3AQOA 1LWFB 1UVMA 4HHUA 1RXOB 3T1AA 3VGUA 5KFDA 3MGJA 1FXRA 2U1AA 2E7VA 1UTAA 3IBWA 1LFPA 2GJ2A 3JS9A 2R7XA 2Z8QA 3W2VA 1G3OA 3R2CJ 5T14A 4K2JA 4ZKAA 4Y28C 4RNMA 1S9GA 2NPIA 1TUWA 2B4OA 1MN9A 1RTIB 2DNOA 2UZAA 3DFEA 4F3OA 3W7BA 4G1PA 4FVCA 4B3OB 1JXVA 3M30B 3DYAA 2HS3A 4Y2MA 3EWGA 1RTDA 4DLGA 3K5NA 2BANA 1NZAA 1APSA 4HTJA 2VPYB 1GQEA 1CG2A 4X4UA 4KV8A 4CDIA 2FZCB 4PEOA 1ZAVA 5A8RA 3S8SA 3DM2B 3KYLA 1LW2B 2HHWA 2DNMA 5DDQC 1VDHA 4KHPF 3G9CA 2C3YA 2JEFA 4LF6J 3TZZA 2NXEA 3NGDA 1X8DA 1LWXA 3MZIA 1E6VB 3KDOA 1N0VC 3KLIA 1HNWJ 4ZHRA 1YRUA 3PX0A 3B4MA 3RG6A 2ASJA 1S79A 1UKUA 1FFGB 2VC1A 3FGVA 3MEGA 2XMUA 5BR8J 3G6YA 4U7UK 3US5A 4CO4A 5IT4A 2QL5B 3DHWC 5DG8A 2DKOB 4DG1B 5K20B 1N33F 5L1IA 3CMAS 2RDIA 1HBUB 1R8AA 3K5LA 3MM8B 1X5SA 1MMLA 3CO9A 2R7OA 5IM0B 2J9DA 4I6WA 2NSBA 4X66J 2M3DA 2WCXA 4UY85 1WEZA 3PEJA 3AB4B 3CJRA 2EK6A 4F7VA 5E3QA 5HMXA 2QMUB 4RW8A 1DTQB 5KT2A 2FIUA 2LCWA 4KTQA 4PR6A 4B3TF 4ILLA 2DO0A 1Q7LB 1S0NA 3DRPA 4JI3F 1LXJA 3M6WA 3AAWB 1WG1A 1HNVB 1XTZA 2VKRA 5F3ZA 3MPUB 4KGXB 5CAAA 2R9LA 4DL7A 3KWMA 2HWHA 1NK5A 5BJRA 3TUPA 2HIQA 2A2CA 4WU2A 5DS7A 1U6ZA 2DHXA 2XCAA 1UW4A 3CPWR 3C14A 2WVDA 3TOQA 2CNNB 2G0CA 2VA3A 4JV5F 2LXUA 3RR7A 2MZ1A 2G1HA 3L7PA 3PEHA 3V4MA 4TKTA 1TKXA 2FJWA 2OPQB 2J7KA 2ZUAA 1NJXA 5EGYA 2FY1A 3CF5Q 1U1KA 3SQGB 4KKOA 2JVRA 4AE5A 2KYZA 2EK1A 2VDIA 2CQCA 5L1JA 4YOEA 1WELA 1I94J 4LT6A 4ES3A 4ZN3A 2AYMA 7FD1A 3JQJA 4L76A 1KR4A 3R6LB 4K0KJ 1J5OB 1HPZA 2MKKA 5KFPA 2X51A 1N8RT 1RWNB 1GAOA 2VQEF 4ECVA 3O44A 1L5UA 2MSTA 2ILYA 4DQPA 4ZOSA 4NLGA 2KVQE 4GO7X 1U25A 1IKXB 3IN5A 1YWXA 2FJVA 3NY0A 1NSKL 1CS4A 2XY6A 4WTOB 2Z30B 5GAEU 5HVFA 3MMCA 2NQPA 2CJQA 5I3QA 2ZOMA 2E1MC 2NLWA 1KTVA 4JOUA 3KJNB 5HP1A 1BHNA 1BQNA 3LPYA 1YJNS 2POKA 1NJZA 1HD1A 3V5RA 3U02A 4P2MA 4LSNA 3E8OA 2APOA 3CCJS 3QO9B 1BE4A 5ETNA 2YKNA 4ZLPA 2CNLB 1HFEL 2R2SA 1VC5A 3GQCA 3JYTB 1VQPS 5CA5A 3J7YU 2WVFA 4O3OA 4AQYF 3VWSA 4USJC 3B4DA 1DJ0A 3QSYB 4USMA 2BEFA 1VFJA 3CCQS 1BLUA 4J9RA 4IQXA 3SDEA 1EP4B 2H5JB 3KK1A 3CCES 3MM7B 5IV4A 3RYLA 3GB0A 2XG8A 2HVIA 2HHVA 1HW9A 4JI5J 1MROB 3UN5A 4K4YA 1NM2A 1NRKA 4KHMA 2KZZA 2NXUA 3RW7A 4K4ZA 4DFJA 3HCXA 4DHVA 2Q3PA 2OPPA 2FVPA 2KHDA 3HSGA 3N5FA 2J0SD 2H4WB 2KHCA 4CO1A 4MFBA 4F2RA 4NMXA 3ENQA 2VOOA 4K4TA 1JNRB 1F9EB 4DX5A 3NG8A 2LU2A 3I5AA 3ISZA 1WDTA 4URGA 4U67Q 5KFFA 4NLXA 5HLFA 3FQLA 4RU9A 2BX6A 1T11A 2BE2A 2V69A 4PUOA 1NAQA 3OHAA 4DQIA 1NHUA 4Q7AA 2W9AA 1MN7A 3FRZA 4U96A 4GVLA 3QGPA 3KNAA 3NCRA 3OJUA 2VFRA 4KYZA 5EWEA 1TKTB 4B02A 1NBEB 3OTCA 1FO1A 2YWWA 1SC1B 2EFPA 4F67A 3VAFA 3MWBA 1RWXB 2PE8A 2VBYA 1TL1A 2FZKB 4RW9B 1O51A 4B3SJ 3DLKA 2JLGA 3R1HA 3LP0A 2W4DA 3HLUA 4A8WA 3QRQA 2DNQA 1RWOB 3CJ3A 4X4NA 1N6QB 3TA1A 3BN7A 1M5PC 2LQBA 3BBBA 2BQ3A 1QAXA 3DCAA 2W4PA 3JB9k 5LM7E 4DR2F 3OTBA 1VQ4S 3KHLA 4WE1B 2W9CB 2XI2A 2ZD1A 1CQMA 4ILMA 4QU6A 2LU1A 4PG6A 4ID5B 4QW8A 1JLBB 3T9ZA 5AJ3J 3BGLA 1BGXT 2ZNZA 3D6MB 2ZHAA 4ZVRB 3T5JA 4RUHA 4HVZA 2MLYA 1JLAA 2QC3A 5IWAJ 1C4AA 4IFYB 2HFVA 1UEUA 4JI7F 5HQLA 4K59A 4A8SA 4DV4J 5FDLB 1FWLA 1Y0HA 1YBTA 1JJ4A 1JLQA 2V2ZA 2UVVA 1G6BA 4A8QA 1ZYQA 2HBQB 1D9DA 3FSYA 3NGUA 3D0IE 5A0YA 1RP5A 4P52A 1M5HA 1RT7A 1C1BB 4Q2MA 1M1GA 4EI2A 3WQPA 4DUTA 4C8MA 4M5IA 4LSLA 4Q8FA 1FRMA 1WC0A 3H8YA 3ZZTA 5AT1B 2K1RB 2EKYA 3ILLA 1FXDA 1ZM2A 2KJWA 1M5VC 3RRKA 1DRZA 1Y5LB 2IVFB 1AUDA 3BGRB 2WHOA 3KKFA 2XULA 2E44A 4R5PA 4H4KA 1CEZA 3UCUP 1PYOB 1VC6A 2MHEA 1CC8A 2C1EB 2HS0A 3TYTA 1SI9A 1VBYA 3M1VB 2ZBRA 1VQYA 3DU5A 3AT1B 2IAJB 2B5JA 4CLPA 3D1HA 1GX6A 2YWKA 5IOLA 2E7XA 3ETMA 4OJHA 4J9PA 4USKA 2VFVA 1KNZA 1B70B 5ITHA 2A10A 2GCFA 3FKBA 2HNDB 1S1UB 2YH0A 2I0XA 2MLXA 4QR1A 4OJ3A 1S6UA 1Y3KA 1HQEB 1Q16B 2OH2A 3I9V9 4PG7A 1VRTA 2DD8S 3OXFA 2LQ8A 1DZ5A 4FYWB 3M2VA 3UR0A 4DBQA 3G82A 4DPWA 4CLUA 3HULA 2AZ3A 3ELHA 4F4KA 1TK8A 4C0OC 3DMJA 4ALZA 1Q8IA 3UCGA 3GFZA 5F8NA 4ED7A 4RUBA 4FXDA 2JZ5A 3TZXA 4FXVA 3MURP 1S76D 2GIQA 4OYBA 1WF2A 3DLGA 1FJEB 1YJTA 1IKWA 5DRKA 2BE7D 1FDDA 4DF8A 4OJ1A 4CP5A 1FA0A 2GAGC 1EHWA 2HQFA 1KC8T 3CC2S 2KM8C 1TL7A 1Q8BA 4KC5A 4K5SA 4LRBA 3BDEA 4Y2AA 2AU0A 4C6AA 2D9PA 4J5OA 3DGVA 1SJFA 1M90T 1JLCB 2IY5B 2F3JA 3CVKA 4JI1F 1DAXA 5HQMA 3PW4A 2V5HG 4C98A 1CJTB 1HWJA 2GIRA 4OHWA 1GMWA 1NXIA 3NCQA 3BBCA 5GADU 1MMNA 3DGPB 2CZ9A 3H2LA 3DRSA 1JKHB 4RWWA 1LWCB 3BKUA 3D28A 3BM7A 3FEXB 3OFGA 4M5MA 3LP1A 2CWXA 1N36J 2UXCJ 1PYTA 1PKUA 3EICA 2RH3A 1JX4A 2AJ0A 4NMLA 2FLOA 4PABA 4HLBA 1XK8A 4N8NA 4OX8A 1FT8A 3DOLB 4OJGA 4F25A 3GFHA 3PRBA 2QRRA 1S1TB 3JQMA 5FJ4A 3BSCA 3VV2B 1Q95G 1KBRA 1Q7YT 1X5TA 5LSRA 3CJSA 2L9NA 1AB8A 2OSRA 1VQ6S 4KQZA 2DHHA 2DYAA 5B0DA 4A4JA 3PRDA 4BDPA 3QFWA 3IA0A 3Q8SB 3MCSA 5KFQA 1P1LA 5KFHA 1NEEA 3SZ2A 5F8GA 3C3LA 3CCMS 2CNKB 1IXKA 3QBCA 3HF5A 3JAMU 5HROA 3UDCA 2I1RA 2YQ3A 3IRWP 4DPYA 2GVDA 2J7UA 1J5EF 4IOAQ 5GMDA 3KJFB 2CZ4A 1K0TA 2GS8A 3N6NA 2DB1A 1U0HA 2QTWA 1RUSA 3DNCA 1D3WA 2QJ3A 1QJHA 3J81j 2C2KB 3NS5A 1RWMB 1RZMA 1KOOA 3I0RA 3OR1B 4DV2J 2V4RA 2V67A 1R6VA 1YKWA 1HWUA 1RT1B 4KGKA 3TVYA 1M5SA 2NCKL 2CRLA 4OFZA 4UOFA 3HMJG 1FRXA 1X4HA 2JSXA 4LF7F 4D3GA 3HT3A 3ET6B 4QYRA 1M5KC 5L38A 4CT8A 2C22A 1P6TA 1RAFB 3TI0A 3U1MA 2CQ0A 5K14B 3RUBL 1C0TB 3FSXA 2IM2A 1FF2A 2Y0BB 3SCKE 1UZHA 5HJXA 1EX8A 2P9EA 4WF9Q 4FN5A 1HI8A 2AJ4A 3L3CA 5LMNF 3KMQA 2I9SA 3JSMA 5B0EA 1LOUA 2DCLA 1KN6A 2VG7A 1TFYA 3R5AA 2GHWA 2AJ2A 2C2OB 1UFKA 4ZVHA 3M2UA 2ZVSA 1QAYA 1VQSA 2W25A 4FKYA 2RHQB 1K73T 2W2QP 4EYIB 4TLQA 2C3UA 3EPGA 2U2FA 2GA7A 2QLFB 3BKTA 2E29A 2MZRA 1ZETA 4Z7YA 5KFYA 2ROPA 2W8LA 2QMXA 2N3LA 4ED0A 3K59A 4AL5A 1AZSA 1NJWA 2MXYA 4C0HA 1CJKA 1PAEX 1U48A 1RI7A 1N5YB 5G0RA 3M2RA 1D0EA 2XQCA 3AB2B 4AXIA 2VBZA 2B56A 1FJGF 3SQOP 4ZCMA 4P75A 4V19X 3KLEA 2R42A 3W65A 2ZM6J 2FJAB 2CQIA 1UCNA 1O0PA 3NLCA 2PA3A 2J6TA 4BBYA 4JI6F 3QQCD 3N01A 1ZPWX 3VGVA 1R31A 2O67A 4TYAA 5KFCA 1YJWS 2EFVA 5J2PA 2EEYA 3CJ8A 3NL0A 2NZ4A 1ZTTA 2CQHA 1KQFB 1RTHB 1TL5A 1ZA2B 1WDDA 5BYQA 5L1LA 2H4YB 3MPWA 1N4LA 4LRDA 3AOBA 2D3O1 1DLOB 3UN2A 3OTEA 1SUQA 1XMQF 2GFFA 3Q89A 4NZ6A 2XO6A 2FVQA 4P6QA 4WCEQ 1R0AB 1I5OB 2YNGA 1W7WA 1FD8A 5KFIA 4OYIA 1FE0A 1N48A 3QIDA 2HZCA 4QU7A 2NSCA 3VR1A 2XM3A 1QSLA 2XZTB 5FD1A 4MMOA 4GKKJ 2B43A 3EYZA 4FNIA 5KG4A 5DDPC 2E7WA 2WOMB 2LP4A 2G2OA 4I2PB 3AOCA 5EN1A 3HHLA 3R5CA 4N8OA 1I6JA 3MD3A 2OLWA 3BGUA 1U1NA 2JEJA 2GMJA 3IRXB 2VG6B 5FLXY 1RT4A 1VBZA 1R27B 3GFXA 1IBCB 1XQIA 1X4GA 4G1QB 3BB5A 2Y1IA 3EZ5A 5BYRA 2MSSA 2E5LJ 1RAEB 3W2WB 1RAAB 3TX0A 3KK3B 4ZDNA 2I6WA 2CPZA 3M32A 4DS5A 2G0JA 5HSPA 2LYVA 5HK4A 5KFBA 5KFOA 4ZP7A 3H7HB 2QA1A 2VFUA 2XB2D 3D0GE 5ADZA 3OVSA 1HNXF 4RBVA 2R3VA 3E3XA 2QL7B 2DR5A 1YI2S 3UFCX 4IRDA 3RTVA 3HSZA 5BYSA 1CULA 2HQDA 5J2QB 1U09A 1Q5YA 3MTKA 5CYQA 3JTPA 1NB7A 1AFJA 7FDRA 2F63A 4O44B 3HJVA 2P5VA 1RWUA 4DL5A 5IFMA 3MECB 2WK4A 4GKJF 3IAM9 1FWKA 1SV5B 3OSPA 5K8PA 3T5HA 2HLUA 1EARA 4IH7A 2RQMA 5I42B 1T05B 4IDKB 1R8BA 4C3KA 1WF0A 3O6QA 1HA1A 3GE9A 4O4GB 4KGZB 1S49A 3GONA 3DRRB 5F8IA 3FDSA 4OIXA 1O5JA 3V4IA 3FSIA 3W1YC 1YBAA 4DPXA 5D4PA 3HZEA 3S1TA 3O5TB 2R7VA 5KT6A 3H2UB 4RPFA 3W2VB 1Y7PA 2B0GA 5C2GA 4ZPBA 4DQSA 2E5JA 4HEA9 1JXLA 3NRBA 1SB6A 1PJ5A 2RMLA 2R8JA 4IO1A 3O2IA 3TAQA 3Q23A 3VTIA 3MR6A 4IRKA 2NUHA 3ILIA 3RRGA 1S9EA 3DYAB 3PX6A 3AA9A 1RTDB 4L3NA 1RT5B 3NMAA 2BANB 2XGPA 2QO3A 4NX9A 4PYDA 1R3NA 3TR5A 4KV8B 4A46A 1KD1T 1N5QA 2UU9F 2I2YA 4W4MA 5A8RB 2E1RA 1WEXA 1QSSA 5H9EJ 2N7YA 2HQCA 2EG2A 4ZPWR 2YPZA 5KFZA 3HSJA 2CQ3A 2DHAA 3UI3A 3HVRA 1M0SA 4ID8A 2FGOA 4I64A 1JLGA 2VU5A 3KLIB 2VFSA 4P2SA 4O0IA 4OI3A 5EUHA 2DGQA 2NXCA 2KB2A 3ISND 3I5BA 1WSRA 4DWIA 4RNFA 1WC5A 2CJBA 3OJSA 4F4XA 1S4FA 1S57A 2OSQA 2CPJA 3MEGB 2RHSB 4MKAA 2ASDA 2HEKA 4YR0A 1IKVA 3T5LA 3PYGA 1MMDA 4LF9J 2HHHJ 1RWKB 3C15A 2KRRA 3A8JA 5LXYA 5AXMA 4ELUA 2PD1A 1ZM4A 3ETOA 1ACMB 4ZVFA 4OZ2A 4I4BA 1U49A 3KUEA 5LSLA 1UW9A 2WRMA 2L9WA 5HATA 1RHRB 4LSZB 2DRDA 3VALA 2V8HA 2O01C 1WNEA 2B9YA 2KO1A 4RW8B 5D4OA 3HFKA 3VAJA 2C2NA 4KT0C 1SQGA 1AW0A 4NYOA 2ATLA 1HBMA 2ZZTA 2ACMA 3DRPB 4NXMF 3GV8B 4ZPDA 2ZDPA 5LOQA 3ITHA 3PIOQ 4L73A 2GQCA 4DSKA 3IFEA 4ANEA 1G4CA 1UFLA 2VH7A 4CT9A 1OPIA 3C14B 1TUVA 3OTOJ 4C8OA 4MKVA 1HNZF 1LQ9A 3W62A 2HNYA 2HVZA 1SJ1A 1JJCB 4WTYA 5IZHA 1VJWA 4PXEA 2DPJA 5KG2A 2FVCA 1RT6A 5DG9A 2K06A 4MIAA 2HVDA 2FDNA 2V6AA 4OYAA 2UUBF 2DNYA 3GTYX 4LF4J 5D0RA 4Y00A 3OL6A 4EUVA 3P5TL 4QCLA 4KH1B 1VRQC 4F0KA 3R7BB 1T9VA 4KKOB 3NNCA 2BKPA 1N0UA 2W7AA 3D3CJ 2DGUA 4ZIVA 2CPYA 3MXHP 2A6OA 3D9BA 2YQ1A 4NEZA 2ZH9A 1XMOF 2AJQA 2P6TA 1YITS 4PQUA 1OYEA 1HPZB 2QYGA 3BYPA 2M0GB 1TVRA 2F8MA 4UOHA 3HI9A 2BM1A 1F3VA 4O23A 4J9UE 6FDRA 3KLVA 3UNYA 3FC9A 1NNDA 4DV7F 3SSRA 3GMGA 2AZ1A 2UXDJ 3Q24A 1CS4B 4U7UD 1CPZA 2NR0A 2F8HA 3MMCB 3GYXB 5DDOC 1TTHB 4ICLA 2DR9A 2VQFJ 4ED6A 5DM7Q 4OZLA 1TFWA 2MMYA 5HP1B 3OPKA 2H54B 3LAKA 2JRSA 1BQNB 1FFWB 1TKZA 4C97A 4LUBA 4ED8A 3UD4P 2DIVA 4DV0J 1S9FA 2FHKA 3IM9A 2I5JA 3T3FA 4LSNB 4NPOA 1BWEA 1PJ6A 2YKNB 4WP9A 2UUCJ 2CJ9A 4GMKA 2VUGA 2XMWA 4YY3J 2PMHA 2XS7A 4ERDA 5KFRA 4NYZA 1J2VA 1PCAA 1S1XA 4NLYA 4LFCF 3F41A 1U8SA 1RAOA 5L8RC 1T03A 2XHCA 1TUGB 3SDEB 3KK1B 2Q79A 2ZH1A 2F4VF 1RAGB 2XEXA 1FHTA 1DQ9A 5L9NA 4LR9A 4ITSA 4H4MA 5JVHQ 8ATCB 2ZHOA 3T6BA 1NDKA 3J80Y 2IJNA 2IFXA 3R8YA 2E1PA 2ZC3A 4Y0FA 4XTTA 4MFBB 3TA0A 4CH7A 1RSCA 3AQPA 3PX4A 1AA1B 5KT7A 3CDEA 4M95A 4DZDA 3VZHA 4ZP6A 5IC4B 3LGMA 2OEKA 3IR6B 2CPDA 3MHYA 4IOBA 1FFSB 1S6QB 2FC9A 3M05A 5HLFB 1HBOA 4DJBA 1N34J 1KTQA 3HP6A 5IT9Y 2F65A 2BE2B 3SFUA 2J6UA 1VHIA 2DHSA 5EDWA 4DUZF 3GIRA 2C42A 4ECYA 3C2PA 2NS1B 1N52B 3RB6A 4WFXA 1JLFA 1S1WA 4FNHA 1EKRA 2FZGB 3GLJA 4YP3A 2OAUA 2W7OA 4JI4F 2X7IA 4DFPA 4EZ6A 3JTOA 3I31A 4TU9A 3MM6A 4HI1A 4WYWA 1FRIA 5KOXA 3Q8PB 2R2TA 2AX0A 2WBMA 2DK2A 4HHJA 3TEHB 4U7CA 3CGIA 1TL1B 1ZZFA 3HHLC 1IBLF 5HMZA 3Q8UA 3WIUA 3LP0B 2H65B 2DIUA 4X64J 1N5SA 3GG0A 4N76A 1V3RA 4MJKA 4CLFA 3VGSA 4X4TA 2UVUA 4ENOA 3VQSA 2CQ4A 3MUMP 4X4PA 4DQRA 3MM9B 2WW4A 1D9AA 5KFXA 4E98A 3EXCX 2AKWB 3DDIA 2V2KA 2RF2A 2ZD1B 2BV3A 2OEJA 2Z4PA 2EXUA 5AXKA 1SL2A 1F60B 4ANCA 1XWLA 4W90B 1OY8A 4Q5VA 1XNRJ 3NOGA 3MD1A 1WHYA 1OQ3A 4ZJLA 1RGVA 4YUDA 4LR8A 1JLAB 3AY0A 2F4FA 1KQSR 3PYDA 3KLFA 2VFTA 4K2XA 5CYJA 2G2YA 4ZPAA 2JOQA 4OHXA 4YR2A 1TP7A 1DHMA 3AJDA 1IKYB 1CBKA 1JLQB 4LIWA 1BUXA 5DQGA 4M5KA 2DITA 1KKHA 1SC6A 5A0YB 1A0OB 2LDIA 2GQ2A 4ED5A 1X9MA 4QZVB 2D3UA 4RNOA 1NKEA 2V94A 5M2UA 1WUUA 3ZXWA 1QDUB 4LF8J 1WJ9A 3OV7A 4F3QA 1OO0B 4FDFA 4LF6F 1IBKJ 3R1LA 4DXLA 3UN3A 1Q5VA 4R5PB 3BPSP 2H48B 4DFKA 1HNWF 3MMBA 1ZAXA 3TX8A 4AT1B 1RABB 3W5YA 1GMWD 2V8GA 1VBKA 3LWMA 2IDLA 4ZPCA 3J7A1 1LNQA 4IFVA 3CJKA 4WK3A 2PO4A 8AT1B 2AWZA 3BKFA 3OFEA 2Y8YA 2OTJS 5KG6A 2B5JB 3DHXA 5T41A 3IMQJ 4DV1J 2O3DA 4PZVA 2BW2A 3UE2A 3FZBA 5BR8F 4S0MA 2JEGA 2AP6A 4OYMA 4KAIA 1YX2A 2HBYB 3OL8A 1N32J 3NBPA 4NZ7A 3L4BC 1VQKS 1RQ0A 2AX1A 2V4JA 2LVWA 2PN6A 4X66F 4ECUA 3S6EA 1U8WA 4DR5J 4JUZA 2BYCA 2XY7A 3PDNA 1CJUA 2VZ9A 1S1VA 3M2VB 1SJRA 1QE1A 4MYTA 3G82B 1NDLA 5AE1A 1V5VA 3R7SB 1FWPA 4WJBA 2RE1A 3BO3A 6FD1A 1WHVA 3QRPA 3QT8A 5ETLA 3DMJB 2XBPA 3HD2A 2RKIA 2OPRA 4DR7J 2DY9A 4IG0A 2AYEA 3HHDA 3ZZYA 3B8HA 1S10A 1JQGA 3TQEA 1EKSA 1YJRA 1G2EA 2BQUA 3PACA 3N28A 4IR1A 2QSFA 3DLGB 3TRGA 4WXOA 2R7WA 1URRA 4ILRA 1IKWB 1H2VZ 3MR2A 4QWBA 3TZYA 2OEMA 4NCGB 3BSOA 1QAJA 3QJPA 4RW4A 5EWGA 1S59A 1H74A 3CDWA 5L39A 5ETRA 3OHBA 1J27A 7AT1B 1HQUA 3M9NB 3L7UA 4N7TA 4FPRA 4U6PA 5AE2A 3SSQA 3W5XA 1SKSA 3MOZA 5J2NA 2MPUA 2A6MA 1KWMA 3OBIA 2LQ5A 1LWFA 3I56S 2IVYA 4MT1A 3C19A 1DBDA 3W66A 4K0KF 4RZRA 3UDVA 1SC4B 3DRSB 4LRFA 3AXMA 4KB7A 4DR4J 1U2RA 1OSCA 2DEJA 2GW8A 1REGX 2DGTA 1HL6A 1Q8KA 4I7FA 4PRFA 3H42A 1RISA 1FDBA 1M1KT 1NLKL 1WEYA 2CZVC 1FCAA 4DQQA 2W01A 5L9XA 1RLDA 1WHXA 3SI8A 4OHZA 4O3RA 4OZ0A 1S5ZA 4B3OA 3HHNB 2V63A 3AJ2A 3Q8VA 2AYBA 1RWPB 3SCJE 4F4WA 2YKPA 1FERA 3I96A 4FKXA 3RZAA 1NDCA 3KK2A 1OY6A 2AMCB 3PR4A 2RAQA 1WHWA 2ZBCA 4HKQA 1GXUA 1LW2A 5K9FA 4DL0C 1NO8A 3M6XA 3UDEA 3ENWA 1FNXH 2VPXB 4PPZA 3AD7C 1HYSA 3D6TB 4QYZJ 1QTNB 3FMBA 4F02A 3TEGA 2H9ZA 4DR1J 1X4DA 4ATNA 2GVDB 1YJ7A 3FCVA 4HACA 4JI5F 3FNNA 2QLWA 3K5PA 1F9FA 5H9FJ 4FS1A 3ILJA 1U0HB 2XHWA 4DL2A 1K44A 1TMJA 1NKBA 5IQQA 2DGVA 3I0RB 4B9MA 4CO0A 1Q86T 1NK6A 2DR7A 5HANA 4I67A 5FIIA 1TELA 2PEBA 3FEYB 3LA0A 3A4TA 2J0XA 3ILOA 3IR7B 2O66A 3K17A 2ZH7A 1E6YA 3KLGB 2VICA 4F26A 2YX1A 3PJXA 2L08A 5J1PA 2DNZA 2D7SA 1EETB 4BLGA 4WIIA 4JB8B 4CRJA 3KMSA 2J7WA 2FPHX 1HNVA 5SZTA 1U2FA 3R97A 2JJ4D 1U1PA 2FB0A 3FK4A 5C5JA 3JSMB 2HW3A 1NK0A 1IQTA 1KRPA 4PWDA 2YNIA 3IGVA 4DPTA 2V34A 4X4QA 2VG7B 4DSLA 1EB0A 4B3SF 2FQQB 2D3OR 2GIFA 3M2UB 4NLRA 4USUA 2V2QA 4ZPVR 1L3KA 1U1MA 3Q83A 1KQKA 3WBZA 2WSFC 2RS2A 3D6HB 3PFOA 1GNKA 3SQGA 3M6VA 5MAOA 4M8LA 2PI4A 5DM6Q 4QPTA 1AZSB 1CJKB 5G0RB 3M2RB 1UJ5A 5EWFA 5AJ3F 4NLUA 2LFVA 2C2DA 3NGTA 4OI6A 4DU7A 3I0SA 3KLEB 4HL9A 4ZIWA 3M8WA 1SC3B 5IWAF 2ZKUA 3OVBA 3X3UA 2QA2A 2JWNA 1IKXA 3ZFVA 3BREA 1RBLA 1K0VA 5HMYA 2VD3A 2VASA 3RB0A 4DV4F 1RHUB 5J2PB 3KUHA 2QLXA 4IOCQ 4NLQA 4IQMA 2F9DA 5K5MA 2BRKA 1JIHA 1F5AA 4RW7B 2XSJA 4B9UA 3MFIA 3NAIA 3P5BP 2QZ8A 3PRVA 1GT8A 1YRTA 4DUYJ 1VCTA 3G71S 4KSEB 3PO4A 5LMUJ 2VJVA 3A8KA 2EBEA 1VYAA 3I4PA 4DR3J 4N5SA 2K7KA 2E66A 5JMNA 4HT5A 1DTTA 4MK9A 3QO9A 5IQ6A 2C28A 4P73A 3GJRB 1ZH5A 4DV5J 3CJQA 2RQ4A 3P49B 1NSQA 1PGZA 2PI5A 2YNGB 2FTRA 4NLWA 3GIKA 4ZLNA 4EYHB 3KJQB 1RYSA 2M70A 4XDDA 1RU2A 2UUTA 2J6SA 1RWVB 4LF1A 5AE3A 1NB2A 3E01A 3BZQA 3HHLB 1FRKA 1EZZB 3M7VA 4KGMA 2HRTA 2RUGA 1VQLS 4I2QB 1RT4B 3W9JA 3PJWA 1YHQS 3TNVA 2CJKA 2M9KA 3OLAA 2K7JA 1UWBA 5H1SV 2BJ9A 2R8IA 5F8JA 1V3SA 4LF2A 1QVGR 4M5JA 2Q43A 3LPEA 2EC0A 3DRXA 1HW8A 4J9LA 4BC7A 2FHJA 2UXBJ 3DRYA 2Y3YA 3RB4A 3MF5A 5E3AA 3M32B 3PKMA 1O8BA 2MKIA 2E1AA 1PILA 2B4VA 5CYMA 3EDRB 4BCAA 4YR3A 4R0EA 2OD6A 3AA8A 2YWFA 1XIQA 2CPXA 4P7VA 3UD3P 3CJTA 1WOSA 2HRUA 3F44A 4U8YA 3VVUA 3CDBA 4CCHA 3MPDA 2IVMA 2VJUA 2ZEJA 5A76A 4PWWA 4NLVA 3MMAB 1CULB 3LP2A 1PYSB 1RTJB 5CYQB 1BMQB 3LGNA 2YH1A 3T6JA 2B7CB 4EEYA 4HR2A 1Z4UA 1X4FA 2DGXA 2OHDA 4NWBA 1UP1A 2SXLA 4K4VA 2K8GA 3MDFA 2E5HA 1HHTP 4HI2A 4ZA1A 2KFZA 3HFVA 5HMWA 3CEDA 4BWMA 1RHJB 2BM0A 2F8EX 1U2CA 4ETZA 1N6QA 1B0VA 4K4SA 2KZMA 3G8SA 1B99A 3JSBA 1RDRA 5C42B 3C6TA 2IDEA 1NH7A 3PR5B 3TAMA 5HQ8A 1PJ7A 1WACA 2M5YA 1YG0A 1YDLA 2Z57B 2PEHA 1Q0NA 5CCMA 3CC7S 3LW5C 4FF3A 2R8KA 1LW0B 3BPDA 5D15A 3D1OA 2B4UA 4CLWA 4JI8J 1XN9A 4UUWA 4YB1P 5A8WA 5ETMA 3GPAA 2ALYB 3C16B 3BQ0A 5L1KA 2LKZA 4WFYA 4USVA 1T0TV 2RUSA 1S9EB 4DCJB 3QWUA 5FLXU 3GIMA 4M1KA 2ZH4A 2HFZA 5J1NA 2HGNA 2ZJRQ 3QPIA 3HHKA 2V68A 1N36F 2UXCF 2RQKA 3L09A 1NKCA 2KN4A 5A2QY 3CD0A 1H6KX 2FVSA 4U9RA 2BVZA 2G2ZA 2MY7A 1R7IA 3ZZOA 3EGNA 3M8ZA 4KFBB 2GNKA 2EC2A 3MOJB 2Q1LA 3IP0A 4BWJA 4KH0B 3PM9A 1VLOA 4AL6A 2PFFB 4ED2A 1JLGB 2B3TB 1A7GE 1CSJA 5GADI 2YX7A 4ZLLA 2MZQA 4X65J 1KOHA 3OXLA 1XR5A 2C2ZB 2R4FA 3FBFA 2R8HA 2BJ7A 1YSJA 2BDPA 3CCZA 2HVHA 3W63A 3Q8YA 2FHMA 1IKVB 2N7CA 4YHHJ 2LLZA 3N9UC 1T3NA 4DL3A 2E5GA 1NSAA 2B9XA 3C15B 3M1VA 3I87A 3HKWA 3T1HJ 2DISA 1U1LA 4LF5J 4C9DA 4OQJA 1S0VA 1UJ6A 4Y2IA 4KGVB 2Y1LB 1U45A 2OD4A 2YKMB 1JJ2R 2C3MA 5DZ7A 2O1PA 3DU6A 2XLKA 4KRWA 1PO6A 1GMUA 3POTA 4DV2F 2HNDA 4EK2A 4NRUA 2AQ4A 4OI2A 5A8KB 1VRUA 5B0GA 3LOUA 5I3UA 2HLTA 4K8RA 5LXRA 2CG8A 1M5OC 2MQPA 2ZZMA 4QW9A 2BMBA 1IR2A 1W25A 1FNMA 2AV5A 3H2VE 3ITHB 4QQBA 1NU4A 2MQNA 1WI8A 1IWAA 4RW6A 2DY1A 3TO8A 1FRJA 3MEDA 1T9UA 3J7ZT 3ZO7A 5DO2A 1I1GA 3GSDA 5EX0A 2DHGA 3VAKA 4LBIA 2D1CA 3H98A 2MKJA 3V6DA 2YQ0A 2HVEA 4HYKA 1RT6B 1PC4A 2DNGA 1TZ0A 5KFUA 5F0UA 2XO7A 3QT6A 3K8VA 1HI1A 2HK2A 3GJSB 3NGRA 1TL3A 5DQHA 1JWWA 4ECQA 3W5ZA 1H7WA 2OPSA 2HNZB 5KG7A 1KQGB 2ASLA 3DKDA 3NWGA 3BV8A 3MFHA 1KS2A 1F0XA 2E9RX 2LEBA 4PQUB 4NASA 1XNQJ 1Q82T 2OI2A 1BWVA 3W8GA 4PQAA 3ZTRA 4DI6A 1TVRB 4ZVTB 1CJTA 3GG1A 5HBMA 2DGOA 2M4MA 4CYUA 3MCMA 1C1CB 1P9YA 4MH8A 1GTEA 3H5XA 1YGYA 2V8PA 1HR0J 4KPYA 2JX2A 1WF1A 4RLEA 1KFSA 1JKHA 1SH2A 1URNA 3MAHA 2WB4A 3NAHA 2ZM6F 2XZDB 1BQMA 4ICLB 2FLNA 4F04B 3LF0A 2YWGA 3RJMB 1UPMB 2NREA 3BO4A 1RAIB 1YZ7A 1TKZB 3JXOA 4AFFA 1WOPA 3IS9A 3LALA 3U1LA 2I5JB 1WC1A 2BOPA 1RAJA 3U27A 2BKOA 2XMJA 2W7PA 2EFOA 4PXBA 4PG4A 3UPFA 2XLJA 3PFEA 2FJXA 3FVYA 4MTPA 4Q8EA 3EVMA 4OV1A 1S1XB 4E0DA 4ETXA 1OYDA 3QSIA 3MAQA 1UEKA 5H9FK 2BRLA 2D69A 3G96A 2ZE2A 4BS2A 4Q0BA 1IJEB 1JLEA 2QLBB 1IN0A 4KHRA 1X9WA 4GVBA 2XC9A 1XERA 3Q86A 4H4MB 2H5IB 9ATCB 4F4YA 1OQ6A 4ZPTR 2R7QA 3K2YA 5D8HB 4WYLA 2GAHC 3CCLS 2XNQA 2W24A 4GKKF 2MDAA 2HKEA 2OP5A 3LH2S 5B0BA 4QWEA 3C6UA 2M8HA 4C3LA 2DH8A 2VC0A 1BQXA 3AODA 5SUHA 3MR3A 5M2RA 1UA1A 2IBOA 3D67A 1S99A 2CUYA 4FXWA 4IH6A 2EFNA 3THTA 4HT7A 1H3DA 1ZBTA 2RIJA 2BZ2A 2E5LF 1HBOB 4ZMMA 2G1DA 4P71A 4ELVA 2BJDA 4FF2A 2ZITA 4IO9Q 1DURA 2QT7A 3TUJC 2Z2ZA 3MCNA 2W9BB 4JV0A 1S7HA 3CMQA 1H73A 3NMRA 1JLFB 3CJ2A 4LRCA 4HDHA 3VVTA 2YTCA 3G8TA 3SBMA 3IAS9 2GVZA 4B3MJ 4C0BA 1MU2A 4Y3CA 4G65A 4NZ0A 1TL4A 2ROGA 1OS5A 4L74A 2QG9B 1VLYA 4TVAB 4LQ3A 5K8OA 3AD8C 3PHTA 3QGHA 2H3EB 2ZKTA 1P27B 2IYIA 3BBFA 1FKAF 1QTMA 4Y2CA 1VS3A 3CJ5A 2RF2B 2IM1A 2B6AA 1HD0A 2CJYB 2VG5B 3K7RA 2HPUA 4PAAA 4I68A 4L6V3 1X5PA 1UL3A 1P8GA 2KH9A 4M5DB 4HH0A 1R6YA 4XPCA 2KT2A 1PBAA 3OD2A 1JMTA 2YNHB 4MAKA 3J80U 4UUXA 1N5YA 2UUAJ 4NI2A 5F8LA 4NEYA 3R5GA 3KLFB 1FJ7A 4TQRA 3KUGA 3LAMA 2R8GA 2IC3A 4Z37A 2KJVA 1S97A 1HQ2A 1NPKA 2HG4A 3R5DA 1ZPVA 3MM5A 2VB6A 1RLCL 2GMLA 2WZ1A 1Z2ZA 4RBUA 2OUGA 3DOKA 2OFGX 5A6WA 1VR6A 2LA6A 1T8EA 4ECRA 1K1SA 4Q44A 2MLZA 3Q8QB 5IT9U 3NP5A 1SJ3P 5EX3A 1RTHA 2KL8A 4M5GA 4URSA 4P10A 5KFJA 1KDNA 2ZOGA 2RU9A 1LV5A 1DLOA 5E2QA 2C3PA 1FD2A 4ELTA 4MIBA 1S4EA 4M94A 5HN0A 1IWGA 3DOMA 5DQIA 3MMBB 3RBXA 4UY8T 1PG5B 4JI0J 2MGZA 4CO3A 3PCOB 1SL1A 2KT5A 1B64A 4K7QA 1VQ5S 3IC1A 1EJ7L 2C2MB 3W64A 4IFVB 4U8VA 3CJKB 3GIJA 2R7RA 3G87A 4PXDA 2G13A 2PC6A 2JH3A 1EIYB 3RBEA 1VOMA 3JSRA 3WDOA 2KDOA 1P9QC 1QLNA 4LFBJ 5JXSA 5RUBA 3UD5A 1FVSA 4USIA 4LF9F 2HHHF 4I2PA 2EBGA 1C2PA 2IRYA 1TK0A 4OZNA 3OUYA 3WC0A 4FF1A 5C24A 2BACA 4B9SA 4JV2A 1LEOA 1PIEA 1T94A 2VBWA 2WONA 3CNQP 3DLJA 2MQLA 1DFDA 2IMOA 3LTOA 1CJUB 3W2WA 3HVWA 2GV1A 2KKHA 4DU8A 3KK3A 3NS6A 3RB3A 1QE1B 2QE5A 2GX8A 3OL7A 5CD4H 4OX9J 4UF4A 3GILA 3GJTB 3AOAA 2VA2A 4CM0A 2B4PA 1CQNA 3ZZ0A 2OPRB 2DRBA 4IG0B 2KXHA 4A8MP 2XCPA 2OMOA 3ZZRA 3QYYA 4NLPA 3A3PB 2UP1A 2BOAA 2BQRA 3KHHA 1CJVA 2A1BA 5I3PA 3P4UB 1OMSA 3OTOF 4V1Ak 4DZ6A 1Y10A 2AEJA 2CYYA 4DF4A 2RNEA 4RW4B 1FK9A 4O44A 4KE5A 4AXJA 2B7BB 1NZ8A 1X0PA 3BR8A 2W2PP 4NXNF 4LF4F 2D41A 5HVGA 1EQ0A 4IDKA 2GQQA 4OYZA 3LWLA 4J9SA 4O4GA 5J2NB 3DRRA 2AJ1A 4OZ3A 2IRUA 3G2XA 4DV3J 4AL7A 4NLDA 2GO9A 3HX9A 1DARA 3N6MA 2ZJQQ 4RUAA 4TYBA 2D74B 4DSJA 2JEIA 3EMTA 4C2MA 3VQTA 1R8HA 3M8YA 3CO0P 4H4OA 2XY5A 4AUKA 1OSDA 2V8DA 4WU3A 1TQLA 4I7FB 3SCIE 1NK7A 4ZVPB 3N0VA 5F0WA 4KJIA 3A8EA 2G0IA 3KLHA 2UXDF 4NLOA 2CDQA 4PKDB 3EGZA 3B6BA 3DLLQ 2Q66A 2VQFF 4OV6A 1RT5A 1WG5A 2YWEA 1ITPA 2J9DE 4ZJQA 2QEXS 1SQEA 1TMMA 4F3MA 3KK2B 3OL9A 2LA4A 2CDRB 2QSWA 2ILZA 4ANDA 2J76E 4DV0F 4NCAA 5I4MA 4DL6A 4CTAB 5KG5A 1F5CA 2VL1A 2JFKA 1ZA1B 3KHRA 1JB0C 2UUCF 3U7JA 2HAFA 4YY3F 3EVOA 3DLEA 1HWLA 3Q22A 1HYSB 1HNIB 3M8PA 4JYAJ 2AD9A 4CLSA 1X5OA 1TAUA 4YEAA 4IRCA 2XMAA 1K1QA 1RBOB 4K50A 2NPFA 4QWDA 2H1YA 4HACB 2ZOFA 2L41A 1VIXA 2KFYA 4ZCLA 5D4LA 1IBMJ 4DSIA 2GGPB 4OZ1A 5KFMA 2XYGB 4I56A 1FKPA 1WC3A 1VQ9S 4FVMA 4P74A 1KP6A 4WZMA 1HMVA 4RO0A 1WOOA 2V9WA 4O3QA 3UW1A 2ZC4A 2JNJA 2AIRB 1X31C 2CXEA 5J1EB 1ZOTA 5B08A 4D3HA 4LFAJ 3GR1A 1N34F 3CIMA 1E6YB 1V9OA 2YPYA 1U1OA 3RW6A 3MR5A 2DTJA 4ZN1A 3VAHA 2CPEA 2IHR1 3AXKA 4OI0A 2N82B 4Y65A 4QJVA 2P2CB 1U26A 4HHHA 4RUCA 4XK8C 4Y34A 4OLPA 4ZP9A 3VAGA 5HL7Q 3RBDA 2L48A 4Y2KA 1R43A 4C3MA 4QWAA 1OWXA 3KNGA 1Y3JA 4PWDB 2YNIB 2PSZA 1U1QA 3HO1A 3FUYA 1MLAA 5D78A 3E51A 5G4DA 4FF4A 3CD6S 1DY3A 5KT3A 2BJEA 1UVIA 5ETSA 4X64F 2KTQA 3W9IA 4X62J 5C25A 5HJYA 3ZZZA 4LRAA 2F9JA 2AEMA 3AHPA 3I82A 1S6OA 3QGIA 5KFLA 2XI3A 1ROFA 2FHJD 1W2IA 5KFVA 2FC8A 4M5LA 3H4BA 1R8CA 4FP9A 2UUWA 1GXLA 4B9NA 1RT2A 1YJVA 2Z0GA 2MJNA 1LKZA 1XNRF 3I0SB 4UOCA 3DXSX 3D54A 1X4AA 3NXZA 5DLGA 4L3KA 4J37A 2CG4A 3D7SB 1RE1B 4PYAA 3OR2B 4RX6A 2DR6A 4DFMA 3HVAA 1Q81T 3WZ0A 1QVFR 4DSFA 1VJQA 4DX8H 2X3GA 2VF3A 5KG1A 3W61A 1M1HA 3CMES 3TA2A 2XSJB 2KT3A 3EJMA 1WKLA 4TY8A 4QIGA 1S12A 4GC6A 2NZCA 1T02A 2XYHB 4BC9A 2IA0A 4OHVA 1YVFA 1DTTB 2V8VA 4LF8F 3S01A 3IGNA 2BW7A 5A6PA 1IBKF 2DXDA 3SEOA 1DQ8A 4TXSA 4B3RJ 4KPCA 5ETVA 2EI5A 2EFGA 3I32A 1S9GB 4OZ5A 1NHVA 1MWYA 5KG3A 2RDDA 5CQGA 4KO0A 2KVIA 3CT9A 3L95X 2AJFE 3LQVA 3RU0A 3E01B 4GO5X 1GX5A 1F6TA 2E9ZA 4O3PA 2MZSA 2VPZB 4N41A 5IS2A 2LEPA 4DOZA 4DV1F 4A8XA 4TQSA 4CIOA 2ROEA 5KFEA 1UWBB 3R27A 5F3TA 4WFNQ 4CH0S 1REVA 3WIVA 1H7XA 2GMHA 3KG4A 5B0FA 1T95A 4YDXA 1N32F 4OHYA 3WX8A 5E3PA 2FGCA 1IUJA 2JFDA 1P1TA 1VGYA 3J81Y 2ZBIA 2C3OA 2DRAA 1S6QA 5CYMB 4DR5F 1ELOA 5HI7A 3SMZA 3N79A 2HHPA 3RAQA 4F2SA 4DLEA 4ZHRB 2HURA 1H0HB 3OVAA 3KG1A 3I9ZA 4DV6J 2ZBPA 1U02A 4MK7A 3T1YJ 5GAGI 2ZDOA 2E9TA 3LP2B 3W60A 2VOPA 1RA7A 4DR7F 1SVDA 1RTZA 1OIAA 4DR6J 1WD6A 1KEKA 3KG0A 3HVTA 1HKAA 4TLRA 4ZCIA 4IR9A 2KG1A 2R7TA 2P8IA 2Q6BA 3H5YA 3V81A 4Z7CA 1FTRA 3OTDA 2CQPA 3UR3C 5ETTA 2KM8B 2YNFA 4Y6IA 3R7NB 3PO5A 4OX7A 2ALZA 3QT7A 3CXCR 2DPIA 4LBHA 1L3TA 2PT0A 2AHOB 5CXTA 3MM9A 2ADBA 1HBNA 2DH7A 3C6TB 2LQ9A 2Z2MA 3TAMB 2EFQA 2CFXA 5HAOA 4OI1A 4B08A 4NL5A 5D3GA 3H90A 4CWBA 1RT3A 3OQ2A 3FMWA 5KFNA 5A8WB 3DXBA 3FEZA 2J5AA 2DEIA 1NK4A 2JLFA 3LUYA 2YVSA 4DR4F 3ULHA 4RJVA 3QFHA 3I55S 3PW0A 2HFNA 2W1BA 3TVZA 2ASYA 4QBUA 5GMKa 2QN6B 1XC9A 2FJEB 1SCJB 2N3OA 1D8YA 2XSFA 4UZCA 3W8PA 3ICLA 3OT9A 2WVCA 1QSYA 3QLHA 4ED1A 2OKQA 1IKYA 1RCXB 5KFAA 3DC2A 3BGOP 2ZVIA 3PVXA 5D4NA 2AGOA 1R0CB 3FFIA 1TKXB 4NXNJ 4A47A 5MLCV 4JI2J 4C48A 4Q2LA 4OYOA 1X60A 4CQ1A 4J91A 2ZH6A 4ZVSB 1RA6A 3M8RA 3ENAA 4DX7A 2YKAA 2HQIA 4Q43A 4ZS6A 2VIHA 1WI6A 1UWAA 1ZM9A 1JNZB 1FX2A 4TU8A 1S6PA 3IWNC 4XAKA 4C4WA 2ATCB 4OMFG 2Z2LA 5CH7B 2FJBB 1VQ8S 5D6GA 4DR1F 3CUNA 3BGFA 3GCXP 1F5BA 3QMQA 3QIPA 2R7SA 1C0UA 3CCVS 4RKUC 4QIFA 4CLKA 1GH8A 3CDUA 2MQOA 3LANA 3G6ES 3BN4A 3IWXA 2W2OP 1Q8LA 5F8MA 2H5EA 4LR7A 1OJ4A 3PW7A 1I3OB 2MY8A 1BY9A 3M8QA 4FBUA 3C46A 1UETA 3POTB 1BC6A 4C8KA 1VQ7S 3CULA 2WW8A 1SJ4P 4HDGA 1XR6A 3UVJA 3K0JA 4KHPJ 3FCHA 1VRUB 4J9VA 3GWCA 5I3UB 2AGQA 5D77A 4ECXA 1RCOB 3A3OB 3OW2R 3EGWB 3A12A 1NMEB 2HHXA 1SH0A 2QYCA 2RD5C 4IG3A 3KJVA 3MAAA 4RW6B 1FEEA 4FYDA 2HMIA 3MEDB 1FDNA 1RU1A 5LT5A 5HO4A 4OI4A 2F40A 4WWSA 2CQ2A 3GCWP 2YXLA 2GO8A 5A2QU 1UAWA 3V6DB 3OFHA 4ZVEA 2H51B 5M2PA 4J9QA 4IH5A 1V5IB 2F7VA 2OPPB 3DI6A 5E0OA 3P8BB 5KFWA 4TNOA 1TL3B 2Y8WA 2XWYA 1HARA 3UCZP 3TARA 1H38A 4CNZA 1ZM3A 1N33J 2NYIA 4NCGA 2OPSB 2QA4S 3QZ7A 4M5NA 3Q8RB 2DH9A 5IV3A 2GJIA 4I1TA 1RHMB 4O4RA 2Y1RI 2ZH3A 5KFSA 1UJ4A 4CO5A 4XPEA 2J9EA 1UVKA 2PFDA 1UVNA 1G7CB 4NOHA 5B7WA 4PUOB 2D3ZA 2B51A 3D66A 4B3TJ 5HBMB 2DBBA 3FBBA 4ZCKA 3I6PA 3R3TA 4CYUB 4F36A 3BR9A 4JI3J 4O0NA 2VV5A 2JL9A 1KLMA 2WSEC 1CVJA 4ECZA 1NK9A 3DN9A 2BKNA 2OELA 1BQMB 2YY3A 1TV6A 5ETKA 3RRHA 2V4QA 3CCRS 3CSKA 3IBFB 4J90A 3DLKB 2FLLA 2UVRA 4IUFA 2HGLA 5E41A 4FYVB 1VQOS 3DDKA 1FKOA 2JLEA 1YIJS 4JV5J 4DMZA 1RACB 3IS9B 1X4CA 3AH6A 3W9HA 2W2MP 4UTGA 1S0MA 3HJFA 4E8UA 1T9WA 1VC0A 4QR0A 3BDPA 2HQGA 4DUYF 4R8UA 3ONQA 2O5DA 3R5JB 1VK3A 1RKIA 1WKKA 5LMUF 4DR3F 2P9CA 4QOTA 2ZWPA 2ZE2B 2JDJA 3PKYA 1W26A 4DV5F 3ISNC 1WORA 4Q0BB 1JLEB 1SQFA 5LL6d 2CAJA 2BJ8A 3HT0A 4GVBB 3BQ1A 3NNAA 2VQEJ 3P3DA 2CJAA 5ETQA 3NGSA 3MUVP 4CM2A 1QUPA 4CNYA 1HWIA 3C6UB 3RAMA 2MQ8A 2D9OA 3D2WA 5CZVA 4A8OA 3MMJA 4F4ZA 4OX6A 1RWWB 4WK1A 1GFWB 5E5NA 1RT7B 2R7UA 3T41A 1ZS6A 2A18A 1H72C 2K2PA 3TZWA 2COLA 4EO6A 1UMJA 2UXBF 4LSLB 1FX4A 4FZVA 3CCSS 2EW9A 3SYZA 2N4DA 3O1LA 1JK9B 2XZWA 3H59A 4AQYJ 4F4AA 2OFHX 4ZK7M 4A8FA 3KLGA 2GVZB 3TJ8A 2MQQA 5T7LA 4F8RA 1MU2B 1EETA 2FLPA 1X7VA 1D09B 4LVOP 1SKWA 3D68A 5GAGU 3CW2C 2VPWB 1D1UA 1SBRA 3IG1A 4LMZA 1RJJA 2RSQA 2MB0B 1Z2LA 4IKAA 3QAEA 2RILA 1VQMS 3WX4A 3H20A 2HGMA 2J0WA 3QAUA 2CQ1A 1Y5IB 1Y9OA 3MEEA 2MKHA 2DO4A 1RKJA 4X84A 2Z58B 3WHIA 1S0OA 2B6AB 3V6KA 4K4WA 4C8YA
chains in the Genus database with same CATH topology
1OPIA 4PG5A 1TUVA 4X4UA 1IN0A 4KHRA 4KV8A 2JHEA 3TP2A 1X9WA 4C8OA 5J2MA 1HNZF 1VRTB 1LQ9A 1U6FA 1UFWA 2HNYA 1XERA 4IYQA 2XC9A 4H4MB 2HVZA 1TK5A 1SJ1A 4F4YA 2XLIA 4WTYA 5IZHA 1VJWA 4PXEA 1OQ6A 4ZPTR 2DPJA 3SV4A 5KG2A 2FVCA 2R7QA 3K2YA 1RT6A 1ZAVA 4WYLA 5A8RA 2M2BA 3S8SA 5DG9A 3CCLS 1X4BA 5CCLA 2XNQA 2W24A 4PCQA 4MIAA 4GKKF 3DM2B 2MDAA 2FDNA 3EPIA 2OP5A 3KYLA 1LW2B 2BR0A 1FXLA 2UUBF 2HHWA 2DNMA 5DDQC 3LH2S 4KHPF 5B0BA 4C11A 2DNYA 4JI8F 4QWEA 2C3YA 4Y00A 2JEFA 3G9CA 5D8HB 3OL6A 4EUVA 3NGDA 3P5TL 2IC3B 1X8DA 3C6UA 2M8HA 4C3LA 4YMEA 4QCLA 2DH8A 2VC0A 3MZIA 1E6VB 1BQXA 3FRYA 5SUHA 4KKOB 1N0VC 3MR3A 3NNCA 3KLIA 5M2RA 1N0UA 1UA1A 2IBOA 3MM5B 2W7AA 4ZHRA 1XBWA 1YRUA 2DGUA 1S99A 3PX0A 4FXWA 3B4MA 4USHA 2CPYA 4IH6A 3MXHP 2EFNA 3THTA 5KAKA 4HT7A 3DOKB 1H3DA 1ZBTA 2ZH9A 2ASJA 1XMOF 2RIJA 2AJQA 2P6TA 1S79A 2BZ2A 2E5LF 1YITS 4PQUA 1HBOB 4ZMMA 2G1DA 2M7SA 1UKUA 1HPZB 2PIIA 2VC1A 3FGVA 3MEGA 4ELVA 2M0GB 2BJDA 5DJBA 4RNHA 1TVRA 4FF2A 2ZITA 2XMUA 4IO9Q 1DURA 2F8MA 2QT7A 3HI9A 1TKDA 1U24A 3TUJC 1AFIA 3G6YA 2BM1A 4RW7A 2W9BB 4O23A 2YKQA 4U7UK 3US5A 6FDRA 4CO4A 5IT4A 3KLVA 3BO2A 4JV0A 1S7HA 3DHWC 1NNDA 4DV7F 3SSRA 3GMGA 5DG8A 3NMRA 4DG1B 1JLFB 1Q78A 4DSEA 3CJ2A 4OLOA 1LWEA 3Q24A 4HDHA 2YTCA 3R5BA 5IXUA 1CPZA 3G8TA 1N33F 3EZUA 5L1IA 3CMAS 2RDIA 2NR0A 2F8HA 1HBUB 1R8AA 3IAS9 3MMCB 3K5LA 1AROP 3GYXB 3MM8B 5DDOC 4ICLA 3KOAA 4C0BA 1X5SA 2DR9A 1MMLA 3CO9A 2R7OA 5KG0A 5IM0B 1MU2A 3BF4A 4ED6A 2J9DA 4I6WA 4OZLA 5DM7Q 1TFWA 4Y3CA 2NSBA 2MGZB 2MMYA 5HP1B 3F56A 3OPKA 2M3DA 4NLTA 2WCXA 3LAKA 2JRSA 4UY85 1WEZA 3PEJA 1BQNB 3AB4B 1TKZA 1LK5A 3FJ2A 4C97A 1W2BR 3SSSA 2EK6A 4LUBA 4X65F 4ED8A 3UD4P 2DIVA 4I6YA 5E3QA 5HMXA 2HS4A 4NZ0A 1S9FA 4RW8A 1TL4A 2FHKA 2I5JA 3T3FA 2ROGA 1OS5A 1DTQB 2DNHA 4LSNB 5KT2A 2FIUA 2Q6CA 2LCWA 4NPOA 1BWEA 3LP1B 4KTQA 4PR6A 5AXNA 4B3TF 1VLYA 4LQ3A 4ILLA 3MEKA 2DO0A 1RTIA 2YKNB 1Q7LB 5K8OA 4YHHF 2XMMA 1S0NA 3GR0A 1MW7A 3DRPA 4JI3F 1QAIA 2RU3A 2CJ9A 3QGHA 1YRXA 1LXJA 3M6WA 2VUGA 4GMKA 3B78A 2XMWA 1WG1A 3AAWB 2PMHA 1HNVB 2XS7A 5KFRA 1XTZA 4ERDA 2VKRA 1J2VA 4NYZA 3M30A 2ZKTA 5F3ZA 1P27B 2IYIA 2R9LA 1FKAF 4DL7A 3T1HF 1QTMA 4Y2CA 3KWMA 2HWHA 1NK5A 1S1XA 4NLYA 4LFCF 1VS3A 3CJ5A 3CJ0A 4LF5F 2RF2B 3F41A 1U8SA 5BJRA 4I2QA 2HIQA 2A2CA 4WU2A 2IM1A 5DS7A 1Y4ZB 1U6ZA 3OUYB 2B6AA 1HD0A 2DHXA 2VG5B 2WSCC 3K7RA 5L8RC 1T03A 3SDEB 2XCAA 2HPUA 3KK1B 2Q79A 2ZH1A 1UW4A 5C24B 2F4VF 3CPWR 4I68A 2XEXA 4L6V3 1FHTA 1DQ9A 1XMBA 5L9NA 3TOQA 1X5PA 2WONB 1XEZA 1UL3A 2FD2A 1P8GA 4ITSA 4H4MA 1A6LA 5F8HA 4M5DB 2KH9A 2ZHBA 5JVHQ 4XIUA 4HH0A 4QIWD 1R6YA 2LQJA 4XPCA 4B9LA 4K4UA 4EGLA 2G0CA 2M8DB 2KT2A 5DGBA 2VA3A 4JV5F 2LXUA 2ZHOA 3RR7A 3T6BA 2ADCA 2MZ1A 4GC7A 1VQNS 1JMTA 1VIOA 3J80Y 3ZZPA 3DM2A 2YNHB 4MAKA 3L7PA 2P6SA 3PEHA 4UUXA 2IJFA 3V4MA 1N5YA 3MI7X 2IJNA 5GAHI 4RU2A 2IFXA 4TKTA 1TKXA 2FJWA 5F8LA 2OPQB 3KLFB 1FJ7A 2J7KA 2ZC3A 3N4WA 1NJXA 1H2UX 1KFDA 4Y0FA 4TQRA 3TA0A 4MFBB 4CH7A 3LAMA 2VBXA 2IC3A 4Z37A 5EGYA 2FY1A 2KJVA 2J0QD 2R8GA 3CF5Q 3AQPA 1U1KA 1S97A 1E6VA 2FUG9 3SQGB 3PX4A 4KKOA 2HG4A 2JVRA 2XMVA 4R0JA 5KT7A 2VONA 4AE5A 2KYZA 2EK1A 3R5DA 1ZPVA 3CDEA 4H4KC 4M95A 3MM5A 3BJYA 2CQCA 1X4EA 5L1JA 4YOEA 2VB6A 1WELA 1F2GA 5HROB 4LT6A 3VZHA 2GMLA 4ZP6A 4ES3A 1Z2ZA 2AYMA 4RBUA 4LJMA 3LGMA 7FD1A 5U47A 3DOKA 2OFGX 3IR6B 2CPDA 4URQU 5A6WA 3MHYA 4IOBA 2FC9A 1S6QB 3M05A 5IT0A 5HLFB 1KR4A 2LA6A 3MMAA 4P7TA 1HBOA 4DJBA 1T8EA 4ECRA 1K1SA 1KTQA 4Q44A 1N56A 1J5OB 1RTJA 1Q1KA 3CCWA 1HPZA 3Q8QB 2MKKA 3HP6A 2LDYA 4EFAC 5KFPA 2XNRA 2X51A 2KU7A 1N8RT 5IT9Y 3GZ7A 2BE2B 3SFUA 1GAOA 2VQEF 2J6UA 3NP5A 3O44A 4ECVA 1SJ3P 1L5UA 5EX3A 2MSTA 3SFGA 1FK9B 2ILYA 1RTHA 4DQPA 5EDWA 2DHSA 4ZOSA 4DUZF 2C42A 4NLGA 4ECYA 3C2PA 1KONA 2NS1B 4GO7X 4URSA 4WFAQ 3G6VA 1U25A 1N52B 4V19J 1IKXB 3RB6A 3GYNA 4WFXA 4DG1A 1JLFA 3IN5A 1YWXA 5KFJA 2FJVA 1NK8A 1S1WA 2ZOGA 4FNHA 4PG8A 4YP3A 2RU9A 1LV5A 2OAUA 2W7OA 1DLOA 2XY6A 4JI4F 4DFPA 5KFGA 3JTOA 5E2QA 4EZ6A 4EBDA 4JV1A 3I31A 4TU9A 3MM6A 4HI1A 5GAEU 4WYWA 1HBUA 2C3PA 3MMCA 1FRIA 5KOXA 3Q8PB 2MYFA 1FD2A 3MM8A 2R2TA 4ELTA 4MIBA 2NQPA 4M94A 2AX0A 5HN0A 2WBMA 2CJQA 3DOMA 2ZOMA 5I3QA 5IM0A 5DQIA 2E1MC 5DDRC 2DK2A 2NLWA 4NA3A 3MMBB 1KTVA 4HHJA 4UY8T 4JOUA 2MGZA 4CO3A 1SL1A 5HP1A 2KT5A 2RRNA 3HKZD 4U7CA 1B64A 3CGIA 1TL1B 2XMTA 1VQ5S 2FHOB 1ZZFA 1BQNA 3IC1A 3LPYA 3HHLC 1IBLF 2PMZD 1YJNS 2PDAA 5HMZA 5C42A 4IFVB 3CJKB 2POKA 3GIJA 3LP0B 4HTIA 1NJZA 1XNQF 1HD1A 2R7RA 4PXDA 2G13A 3IO1A 2PC6A 2JH3A 2DIUA 3V5RA 1QY7A 1N5SA 2CKWA 3GG0A 3U02A 3RBEA 4N76A 1DTQA 4LSNA 1VOMA 3JSRA 1V3RA 3E8OA 2AGPA 2APOA 3WDOA 2HYIB 2KDOA 4MJKA 3CCJS 3QO9B 1P9QC 4H4OB 2LMIA 4X4TA 1QLNA 5JXSA 2UVUA 2YKNA 4ZLPA 1HFEL 3VQSA 1X0FA 1LW0A 2CQ4A 3O3LA 3MUMP 2R2SA 1VC5A 4X4PA 3GQCA 4DQRA 1FVSA 3MM9B 4USIA 3JYTB 4I2PA 2HHHF 4LF9F 3KLHB 1HR0F 1VQPS 5CA5A 3J7YU 1D9AA 5KFXA 3PW2A 2EBGA 4O3OA 4E98A 3EXCX 4AQYF 4K5RA 3WC2A 3VWSA 2V2KA 4USJC 3B4DA 2RF2A 1DJ0A 1C2PA 2IRYA 1VFJA 4O3NA 2ZD1B 1TK0A 4YB6A 3HPOA 3CCQS 1BLUA 2BV3A 4OZNA 4Q45A 4J9RA 2Z4PA 5AXKA 3OUYA 4IQXA 1IM4A 2DNKA 3SDEA 1SL2A 1EP4B 3WC0A 3KK1A 4FF1A 1F60B 5C24A 2BACA 4WKYA 3CCES 3MM7B 4B9SA 3D1QA 3RYLA 4JV2A 3GB0A 1YQHA 2XG8A 2HVIA 1XWLA 2HHVA 1T94A 2DGWA 2VQFF 2DCUB 2VBWA 2WONA 3DLJA 2MQLA 1DFDA 1U7LA 4W90B 2IMOA 3HHLD 4Q5VA 1HW9A 3W2WA 1ZAWA 3HVWA 2GV1A 2KKHA 3MD1A 1MROB 1WHYA 4UQGA 1OQ3A 4K4YA 3KK3A 1NRKA 3NS6A 4KHMA 2KRBA 2L9DA 1RGVA 4LIRA 2KZZA 4YUDA 3RB3A 1QE1B 2NXUA 3RW7A 4K4ZA 1JLAB 4H54A 3AY0A 1D9FA 2UV8A 2QE5A 4DFJA 2GX8A 3OL7A 4DHVA 2Q3PA 5CD4H 1KQSR 2OPPA 2FVPA 3GILA 2KHDA 2VA2A 2B4PA 3N5FA 1CQNA 2DJWA 3ZZ0A 2OPQA 2BXJA 4KFBA 2J0SD 3KLFA 2VFTA 4K2XA 3DLBA 2KHCA 5CYJA 4CO1A 4MFBA 4F2RA 4ZPAA 2JOQA 4OHXA 2OPRB 3ENQA 1TP7A 1DHMA 4YR2A 4K4TA 2DRBA 1IKYB 2VOOA 1JLQB 4IG0B 4LIWA 1JNRB 2KXHA 4K4WA 2HRYA 3DLEB 5DQGA 4A8MP 2XCPA 3NG8A 5E3CA 2DITA 2OMOA 3ZZRA 2LU2A 3QYYA 3I5AA 4NLPA 1BD6A 3ISZA 4U67Q 1SC6A 3M8PB 4URGA 2UP1A 5A0YB 2BQRA 3KHHA 2LDIA 2A3JA 2A1BA 5KFFA 4NLXA 2GQ2A 5HLFA 4QWCA 4ED5A 3FQLA 5I3PA 4RU9A 1X9MA 3OTOF 1J5OA 4QZVB 4TY9A 2X1GA 2D3UA 4RNOA 1NKEA 3M9OB 2CYYA 2BE2A 2V94A 2RNEA 4DF4A 4RW4B 3BEGB 4PUOA 5M2UA 1FK9A 4PXCA 4Z2XA 1NAQA 4O44A 3OHAA 4DQIA 1NHUA 4KE5A 4AXJA 2B7BB 3OV7A 4F3QA 1OO0B 4Q7AA 5GVQA 2W9AA 1X0PA 3FRZA 3F73A 2A2DA 3BR8A 3QGPA 1WG4A 4NXNF 4LF4F 2D41A 4LF6F 3KNAA 3NCRA 1FKPB 3OJUA 1PSDA 4IDKA 2GQQA 2VFRA 5EWEA 1TKTB 4B02A 3R1LA 4R5PB 3LWLA 3OTCA 2JVOA 1FO1A 1HMVB 2Y0SD 4J9SA 5LSOA 2MKCA 2G9OA 4O4GA 4DFKA 1HNWF 2EFPA 3MMBA 4F67A 1ZAXA 5J2NB 3BS9A 3TX8A 3DRRA 2AJ1A 3VAFA 2LEAA 3LO3A 2IRUA 2JC0A 3MWBA 2PE8A 5E33A 2VBYA 1TL1A 4AL7A 2V8GA 3AJ1A 4NLDA 5KFKA 3CIZA 3LWMA 2C2RA 4RW9B 4ZPCA 1O51A 1CLFA 2GO9A 3DLKA 4N77A 2JLGA 3R1HA 3J7A1 2YKMA 3HX9A 1DARA 4IFVA 4MK8A 4CZCA 2L3MA 3CJKA 3N6MA 3LP0A 4WK3A 2ZJQQ 2W4DA 1SUQB 2PO4A 1UA0A 2AWZA 3OFEA 3HLUA 4RUAA 1ZZNA 2OTJS 5KG6A 2B5JB 4TYBA 2D74B 3DHXA 4DSJA 2JEIA 5T41A 4K4XA 4A8WA 1JXEA 4C2MA 2DNQA 3VQTA 1R8HA 4H4OA 2XY5A 2WTFA 2O3DA 3UE2A 2BW2A 4AUKA 3CJ3A 1OSDA 3FZBA 5BR8F 3TAPA 4X4NA 2V8DA 1N6QB 5E3RA 4WU3A 1TQLA 4I7FB 3SCIE 3TA1A 5A8KA 3BN7A 1NK7A 1M5PC 2JEGA 5CHCB 2AP6A 2LQBA 3N0VA 5F0WA 4KJIA 3JYTA 3A8EA 2BQ3A 1QAXA 3KLHA 3DCAA 4KAIA 2UXDF 4YB5A 2W4PA 4MKBA 3JB9k 4DR2F 3OL8A 3OTBA 4NLOA 2CDQA 1VQ4S 3NBPA 4PKDB 4DN0A 4WFBQ 3KHLA 4WE1B 1L3VA 2W9CB 2DNRA 3EGZA 2XI2A 4NZ7A 2RRAA 2ZD1A 4B3MF 1CQMA 3DLLQ 4ILMA 4QU6A 2LU1A 2Q66A 1VQKS 1EP4A 1RQ0A 2AX1A 4ID5B 4PG6A 1FDAA 2V4JA 4QW8A 3M9MB 2CPIA 3PV8A 3MM7A 2LVWA 1RT5A 5K8MA 1WG5A 2PN6A 4X66F 1JLBB 2YWEA 3T9ZA 4ECUA 3S6EA 3BGLA 4JUZA 3UNGC 2J9DE 4KIAA 2QEXS 1SQEA 2BYCA 4F3MA 2XY7A 3PDNA 3KK2B 1BGXT 2ZNZA 2VZ9A 2RQCA 1S1VA 3K5MA 3OL9A 5B0AA 1PC5A 2ZHAA 2LA4A 1MROA 2QSWA 3QGGA 4CI0B 2ILZA 1Q79A 2J76E 4DV0F 3M2VB 3T5JA 4RUHA 4NLSA 4NCAA 4CO2A 4HVZA 1SJRA 1QE1A 4MYTA 1JLAA 5I4MA 4DL6A 3QJJA 5AE1A 1C4AA 4CTAB 5C25B 4WJBA 2RE1A 4IFYB 3BO3A 5KG5A 6FD1A 1WHVA 1F5CA 1K8AT 1UEUA 4JI7F 3DMJB 2VL1A 2XBPA 2JFKA 4K59A 3KHRA 4A8SA 1JB0C 2UUCF 2DNPA 5FDLB 1Y0HA 1KVIA