4DV0F

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 21
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dv0F00
4X65F 1XMQF 1N33F 1J5EF 1HR0F 4DUYF 2YY3A 2UUCF 4JI8F 4DR3F 1N36F 1IBLF 2ZM6F 1HNXF 1HNWF 4JV5F 4B3MF 1IBKF 1FJGF 4DR1F 5LMUF 4JI6F 2HHHF 1G7CB 2VQFF 4LFCF 2BVZA 2UXCF 1XNRF 1N32F 2KJWA 1N34F 2UUAF 3R3TA 5BR8F 4DR2F 4K0KF 3OTOF 1I94F 4LF6F 3ZZPA 4GKKF 4X62F 4JI7F 2BXJA 2J5AA 4YHHF 4X66F 1FKAF 1IJFB 4DV7F 2B7BB 5LMNF 1QJHA 4NXMF 4JI3F 4NXNF 4JI1F 1G1XA 2VQEF 4LFBF 4LF4F 4KHPF 4GKJF 1VMBA 4LF9F 5IWAF 1XMOF 4JI5F 4JYAF 4AQYF 2E5LF 4YY3F 3T1YF 4DR6F 2UXBF 4B3RF 1GH8A 1IBMF 1CQNA 4DV0F 4LF7F 4LF8F 1XNQF 4LF5F 1B64A 1HNZF 4JI4F 4DV3F 2RJZA 4DV4F 2UXDF 2UU9F 1RISA 2KJVA 1IJEB 1LOUA 5AJ3F 4DUZF 4DV5F 4DR7F 4X64F 1CQMA 4DV6F 4DV1F 4DR4F 4DV2F 2UUBF 3T1HF 4B3SF 4B3TF 2B7CB 2F4VF 1F60B 4OX9F 4LFAF 4JI0F 4JI2F 4DR5F
chains in the Genus database with same CATH superfamily
1Q4RA 2F1FA 5C25B 3BGRA 4WFAQ 3R5GA 1SBRA 2VG6B 2C1EB 3VCDA 2CFXA 4ZVFA 5ETQA 1ZBTA 3BO3A 2HQCA 4EZ9A 3B78A 2ZNZA 2H1YA 4LF6F 3B8HA 3BBCA 3W63A 1S12A 3M2VB 3QYYA 1XR7A 2AV5A 1QAJA 1KDNA 2ZWOA 2XLKA 1YTYA 5HLFA 1WI6A 4HR2A 1LWEB 4CLWA 4I4BA 3G8TA 2ASJA 4Y28C 3VAJA 3ZC4A 2JEJA 5HROB 1UZDA 3CCUS 3KNAA 4KGXB 3WC0A 2YQ1A 3VGUA 3AD8C 1Y4ZB 1H2VZ 4ZPAA 3UD3P 2QTWA 2HRTA 2CVEA 2HIYA 4B9LA 3FQLA 5CABA 1WELA 3TZXA 3OUYA 1U8SA 5GAEU 2VPYB 2G0IA 4KGMA 2XYPB 3GMGA 2CNLB 2HRUA 4OYIA 1FA0A 2MY8A 4F2RA 4DUYF 3QFHA 4OI4A 4M5KA 2R7VA 3GYXB 2ZBIA 2DNHA 4JV5F 2WOMA 5LL6d 4QPXA 1IBKF 2CADA 2KG1A 1JLFA 5KG6A 1X4BA 1SH0A 3MAHA 1MU2A 2PIIA 2IM2A 4KV8B 1I94F 1QE1A 1WWHA 4CM0A 2FLLA 5D3GB 1FE4A 2W9CB 5KT6A 5CH7B 4RL1A 1H2TZ 3EGZA 2VUGA 3ENWA 2V8GA 1QAIA 4LMZA 1G1XA 3RBEA 5B0EA 1KRPA 1U2CA 3VGTA 1X4FA 2WONB 3HVTA 1FX2A 3CJKB 3BKUA 3CXCR 2WW4A 1RT4A 1N48A 2FHMA 3SFGA 2PFFB 2DIUA 2ZJQQ 1BC6A 1U26A 2LA4A 3LP0A 2CDRB 3CTRA 2UUAJ 3PJXA 2UV8G 1EQMA 2O66A 4X2BA 5I3UB 1HR0J 4HEA9 3M8WA 2HPUA 3IN5A 4Y0FA 3GIJA 3QWPA 2J9DE 4DFKA 4PG7A 1TAQA 4ZVOB 3CCMS 1YVFA 3H98A 4DLGA 2MQ8A 4FYYB 2Z2MA 1QAYA 3A8JA 3DRRA 4DQQA 1RHMB 4RWXA 2OMLA 2VG7A 2QFJA 1U49A 4LRDA 4IG0B 4DHVA 5H9FK 2RILA 3G82A 4ED6A 4HYKA 2IVFB 5C24A 2COLA 3SCJE 1UFKA 1CS4B 1SL2A 1XWLA 2AJFE 2BANA 4GKJF 1TL7A 3KOAA 1S5ZA 4GC6A 2E9ZA 1EKSA 1SV5A 1GEHA 1E6VA 1ULRA 5H9EJ 4L76A 4DR6F 3TJAA 1CG2A 4LIWA 2B9XA 3BSOA 3PFEA 1BHNA 5M2RA 4ZP7A 5CD4H 2Z57B 3UN5A 2B51A 4DV1F 1RKIA 3CJ3A 1HNIA 1RWWB 3A3OB 3MPVA 3PCOB 2QZ8A 4EO6A 2ZKTA 4O0NA 2GS8A 2RS8A 4CO2A 3A8IA 1UEKA 2XMVA 3A4TA 4X66J 3BS9A 4TKTA 1SJQA 3TO8A 1UVMA 1CJTB 4USJC 4NWBA 1ZS6A 4EBCA 1EETB 2OI2A 3BH6B 2DYAA 4LF9J 2FQQB 2YNHB 1JJ4A 2IJNA 4ED4A 4C8ZA 4NLPA 4HVZA 2A1BA 1S57A 1DRZA 1TV6A 4U7CA 3M9MB 3Q8PB 3DLJA 3NLCA 1F9HA 3R5AA 2DNLA 5LSRA 3GG0A 1FE0A 1VQ7S 5DQHA 1GH8A 1FDDA 1LW0B 1FD8A 4LF5F 2GQCA 2PSZA 3SDEB 5JMNA 4P74A 3T6JA 2K3KA 5KFEA 3GIMA 1F5AA 2YWKA 1RT1A 2FHJD 2FDNA 2Y9HA 4RW4B 2IDEA 2B5JA 1SC1B 5IWAJ 3UDCA 5IQQA 2HVEA 4IFVA 1NJYA 2V67A 2DGVA 1ZH5A 3G71S 1W25A 3GJSB 4UZCA 3CJQA 1KVKA 3AA8A 5JJBA 1NO8A 5KFVA 1U1LA 1T03A 4NRTA 4UUWA 1C4AA 1X4CA 4RR5A 3NRBA 1B0VA 4AXIA 3GYNA 5KFAA 4OZLA 3MMAA 4PUOA 4QU7A 1H7WA 3H42A 4K59A 2OLWA 2PI4A 2MDAA 5A8RA 1WSVA 2KU7A 1MW7A 4BS2A 1DFDA 2MHEA 2KFZA 2E5LF 1HW9A 5H1SV 3CIZA 4U6PA 1X5SA 1K8AT 1Z1ZA 3BR8A 1RWVB 2A0FB 2XYGB 1RT7A 3WHIA 3NS6A 5D15A 2B4VA 5F0WA 3N0VA 2W9BA 2AJ2A 1FDAA 4HHHA 5J1EB 5GMEA 4DQRA 3RB0A 3DRSB 4OYMA 7FD1A 3OXGA 4MIBA 2YWWA 4ZN3A 5DDQC 4CQ1A 1FNOA 4Y34A 4L72B 4J9RA 3NMRA 1HL6A 3BPDA 3KLEA 1QLNA 3W5XA 4ED1A 2CQ0A 4PXBA 4OHZA 3MWBA 3W9IA 3AOAA 1N54B 3ZZPA 2CA9A 2VKRA 3QRQA 3ZNUA 3KLGA 1OY9A 1IKYA 4DX7A 2NXNA 2YX1A 3DRXA 4ZOSA 1ZM9A 4NXMF 2H5IB 3FEYB 4WWSA 4LVNP 1AYEA 2MZJA 1KQSR 1HMVA 2OFHX 2ZHAA 3NWRA 2J0XA 2M70A 1XIQA 2E5HA 3KJFB 3NCQA 3QMQA 1Q7LB 3P49B 2YKNA 5D8HB 3CDAA 2FJWA 2R2TA 3FC9A 3EDQB 2HFZA 1F2GA 4GKKJ 3CULA 2Y0SD 3WZ0A 4NZ0A 2D7SA 1C1CB 4QYZK 4DPYA 3V2UC 3PACA 4ERDA 4DOZA 3QT6A 2V34A 4QWDA 1N5QA 1HBMB 2K8GA 2IPOB 4JI2F 2DTJA 2LP4A 3B82A 1Q86T 5IM0A 1HQ2A 3A13A 2HHXA 5KT7A 5KTQA 2H5JB 2KL8A 1Q1KA 2RHSB 4U96A 4KHPJ 3TR5A 3HHNB 2ZFHA 1TKZB 3M8SA 5F8JA 4K4WA 4WXWA 5ETVA 3EZOA 4Q5VA 3MECB 4MKVA 3PYFA 3TANA 3Q24A 1YGYA 4ATNA 4EBDA 5ETRA 1CJUB 4PG6A 3D2WA 4TY8A 3D1QA 4TY9A 1VMBA 2GVZA 5HN0A 2MY7A 3CNQP 5KFGA 1KN6A 3PW2A 3T9ZA 3ILOA 4ECXA 4FXWA 1RKJA 2B4PA 1NSAA 4AFFA 1RAAB 2QT7A 2EK6A 5DGBA 1LXNA 3GIIA 1UWBB 3TVZA 4KFBB 5CZXA 4PG5A 4LUBA 4DCJB 3Q8VA 4GO5X 4DV7J 3T6BA 5HP1B 4F0MA 3MTKA 1PBUA 1WDTA 1X9MA 3FCHA 3NBPA 2OMOA 1OQ3A 3KNGA 4HT7A 3BYPA 4HH1A 3RB6A 3W5YA 4N56A 4ED8A 1FKOA 2Y1JA 1EP4A 3L9ZA 1F1BB 2RKIB 5D78A 2OPSA 4Y2IA 4D3GA 2HGMA 2CZ4A 1M90T 2MQOA 4IO1A 1U4BA 4FKYA 4X4RA 3I55S 3VR1A 1CSJA 1TUWA 3PTWA 3VAFA 3EUNA 5HO4A 1R27B 3OFEA 2OSQA 3C14B 4ZPTR 3AB2B 5DG7A 3UR0A 2X1BA 5KFLA 1XJWB 3ZTQA 1FX4A 5A0YB 3CCES 4ZP6A 2IYIA 2XY6A 4M5LA 3MCOA 2GAHC 4JP8A 4V1Ak 1UJ6A 4PQUB 1X4HA 2CUYA 3V6KA 5KT5A 1BQMA 1OYDA 1HBOA 5HANA 1JLGA 2XLJA 1QSSA 4V19J 2UUAF 4AUKA 5IC6B 4NEZA 4DV5J 4C48A 3M1VA 3UPFA 3KK1B 2XMWA 2DR8A 2RVJA 1Y5NB 4QIEA 3DLKA 3WBZA 3MMJA 3GWCA 3QNWB 1UJ5A 3FUYA 4CWBA 4AQYF 2YKAA 3UCGA 4X64J 1HNWJ 2ADBA 4YR0A 1NEEA 1WF1A 3FCVA 2DGTA 3LANA 4JI6J 3S6EA 3FGVA 3AH6A 3FEXB 1N34J 1U0HB 3DOMB 4WFXA 3GCXP 2GIQA 2DNRA 2VC1A 2XZTB 1CVJA 3T41A 3GQCA 4NXNJ 5GAGU 3CJ2A 5DGAA 1S7HA 1GTEA 2IBKA 5EN1A 2L9DA 3MTJA 5T14A 4K4VA 2ZC3A 1MN9A 3VV2B 1PBAA 4ELUA 2BE2B 4K8RA 3A3NB 1PJ5A 3VWSA 3JTNA 2KFNA 4EUVA 2AEFA 2PC6A 5J2QA 1DTTA 1WI8A 2FY1A 1PGZA 2W24A 4Y65A 4NLTA 2CPHA 4ECTA 2OPRA 1HYSA 2V9KA 4LIRA 1WF0A 1L3KA 4OHYA 1K9MT 3OTBA 3IGNA 1WDDA 2R7RA 3IG1A 2LA6A 2IRYA 3EWGA 1JLEB 2IHR1 4ER8A 2JVRA 3F41A 4WYWA 1JJHA 4MK7A 4CYUA 4QIVA 1N0UA 2WB4A 1TKXB 2CZ9A 2RQ4A 5D0EA 1MMDA 5LMNJ 1JKHA 1RWPB 1UA0A 4JI1J 4QIGA 5B0AA 3SQOP 5E3AA 3EX7B 1NPKA 1RACB 2G2ZA 4AL5A 4OIXA 1HARA 1IR2A 4LR9A 3N6NA 2R4FA 1HBNB 1A0OB 3LPEA 4DCOB 4RW8B 4RX6A 1R0AB 4ZIVA 4ZVGA 2ZWPA 3PFOA 4M5DB 3N6LA 5H9EK 2XQCA 4TLRA 1NJWA 2HBQB 1Y11A 3WC2A 1QJHA 1YJ7A 2RAQA 4FP9A 3GR0A 1NCLA 2BKNA 2QIFA 4PYDA 1TVRB 2VPZB 5IWAF 1RWMB 1KWMA 4PXDA 4A8MP 5KFSA 1FRLA 1QSYA 5ETOA 2CVIA 4ETZA 4M1KA 4N8NA 4DV0F 1EX8A 4OZ0A 5LJ5Y 4LRAA 4GRSA 3HI9A 4AE5A 4UOFA 2IAJB 4HHJA 2V2ZA 4LRBA 3O2IA 3D28A 3RG6A 1WD6A 4O3NA 4DEZA 4PPZA 1KVJA 2AJQA 3B4MA 3AJDA 3H4BA 3I87A 2XNQA 2P8IA 4U67Q 2Z0GA 4MTPA 4OX8A 3V6DB 2VIHA 3SYZA 2Z4PA 1UEVA 2B8QA 1MWQA 1JNRB 4CO5A 1Y10A 2RNEA 3BQ0A 3UW1A 5EUHA 1FDBA 2FC8A 2GJFA 3ILLA 4X4QA 2E1RA 2KVIA 1SL0A 2UXDJ 2H48B 4PEOA 3LAKA 2EFPA 2LQ8A 2HBYB 3K5OA 5ITHA 4IRCA 3LGMA 1X4DA 2KVQE 4MIAA 2OH2A 2Q1LA 3AJ1A 3MCNA 5GMKa 2CQ4A 1QTMA 4NLVA 4QZVB 3D4JA 4ZPVR 2NQPA 2CWXA 4B02A 3FK4A 3RBDA 3PZPA 3LWLA 3CJ4A 1VRTA 4P75A 3HLUA 1VC6A 2HAIA 2C3UA 1GX5A 1RWXB 3H2LA 1U7LA 1R6VA 4USKA 4URQU 1XNRJ 4J5OA 4ID5A 2I9SA 3BGRB 1WC0A 3DLEB 2HFOA 1KVIA 4C6AA 5B0CA 4QR0A 2R7SA 1CLFA 1QM9A 5AXLA 1VBZA 2MZQA 1S6OA 1S48A 1E6YA 3G2XA 1S79A 1RU2A 1IBCB 3NY0A 5G0RA 5HLFB 3I9V9 5CYQA 1WG4A 4LF1A 4PXEA 5EWEA 3I32A 3QZ7A 2NPFA 1U2FA 4TXSA 4YN3B 4J9OA 4YP3A 2EFNA 1TR0A 2E5GA 3Q89A 4GKKF 1Q8BA 1UPPA 2GA7A 4M5JA 3GV8B 1HPZA 1UP1A 3CGIA 9RUBA 5HJYA 2V63A 4NLQA 4NCGA 4C3MA 1YJ9S 1JLCA 3OUYB 2EG2A 1HI1A 4ZMMA 2HFNA 1WG1A 4LREA 1MROA 2G0CA 4O23A 2JHEA 4ZVUB 2QLFB 3CD6S 3OR1A 2NYHA 2EI5A 4P2FA 1PYOB 3CMES 3KLVA 3IR7B 2XSFA 5KAKA 2WOMB 4RWWA 3SV3A 4FVMA 3ET6A 1JLFB 4ZPBA 3MAAA 5J2PA 1MU2B 2N7YA 3IR6B 3I0SA 2BJ8A 2OFGX 4LFAF 1A7GE 1U25A 1QE1B 3PX4A 3MI7X 4FYVB 5D6GA 1Q81T 4U95A 2HHPA 3ISND 4O44A 4DFJA 1CEZA 5LMUF 4MFBB 4J9LA 4P7VA 3PW5A 4KT0C 2X3GA 4KAIA 4PZVA 3W2WB 5HJXA 2UU9J 2NCKL 2J6SA 3AHPA 1RT4B 3DLLQ 3CPWR 3ZZTA 2F8MA 3PEHA 3TVKA 4NI2A 1UETA 5K8MA 3LP0B 1U6FA 4DV7F 2PT0A 1F9EB 4RO0A 5K14A 4LSZB 1Z2LA 4GVBA 3OL9A 4HDGA 2E5IA 2PO4A 1U24A 5GAEI 3W60A 2UXBF 4A8XA 4CDIA 4AT1B 1NKBA 1NM2A 1O8BA 1S1VA 1UJ4A 3SSSA 3HSJA 1EKRA 4C3KA 1P9QC 1KC8T 1X4GA 2MGZA 1TELA 3DRRB 1VQMS 3Q22A 2VG7B 3KK3A 1K73T 4IFYA 2DGUA 5ETPA 3G82B 5KFDA 1KD1T 3I5AA 2HHVA 4ETXA 2R42A 4OJ1A 4G1QA 1O5JA 3ADAC 4WU3A 3EMTA 2BANB 1TL7B 2EXUA 1VS3A 1RAHB 3H7HB 1TL1B 2RF2B 5AXMA 2AX1A 2J9EA 1SV5B 4Q8FA 1E6VB 2HVHA 3T9NA 2R7UA 1SJ1A 4EO8A 4IR1A 5C42B 1IKXA 3T1HJ 2CQ1A 1FRIA 2AZ1A 3RBZA 2LDIA 1U1MA 1T95A 1S10A 4X65J 3IRXA 3BO4A 2RQCA 4FS1A 3FEZA 2MJUA 3HXMA 3RZAA 1HNIB 2QX0A 2JH3A 1UW4A 4O3RA 4KQZA 3LH2S 2V8PA 5L1JA 3QT5A 1SJRA 4ECUA 2P6SA 2HHSA 2JC1A 2D74B 3F56A 4ALZA 4DV5F 3UNYA 1WC4A 3OXFA 2DNGA 4I0WA 3QSYB 4DQIA 3A8EA 2XHWA 4EGLA 1RT5A 3GONA 2PEBA 2YXLA 1TKTA 1NRKA 2YWFA 1N32J 4LR8A 3LP2A 2HRYA 2A6MA 1HNWF 4P52A 1XN9A 3OHAA 4JI6F 3M9NB 2R7TA 5KG5A 4K2JA 1PC5A 2MZ1A 3DKDA 3TEHB 1N34F 2XWYA 2ZH2A 4WTOB 2AF6A 3X1LB 4UQTA 2QRRA 4AL7A 2CZVC 3ZNJ1 4L75A 1D9DA 1X0PA 2QA4S 3ZZOA 4NXNF 1G4CA 3CWJA 2H5EA 4R25A 3FVYA 4Q0BA 1YQHA 2K2PA 1RTZA 1Y9OA 4P9SA 1UCNA 1RT1B 4IRKA 3VZHA 3KFWX 2B5JB 2R9LA 1T9XA 3D0IE 1NJZA 3TEGA 5HQMA 2VPXB 1KQGB 3D68A 2YBVA 4IFVB 3RRGA 3Q23A 1NPRA 3QGGA 2M9KA 2V50A 2V68A 1SXLA 4YFUA 1T03B 3ZXWA 2YX4A 4EZ6A 2V6AA 2F8HA 2W01A 2XB2D 2X7IA 2R8IA 1WSRA 2E5JA 1UAWA 3MMAB 5L1LA 1TL5A 3DI6A 3SSRA 2V5HG 5A8RB 2HHHF 2OKQA 2YKMB 2Y8WA 3K5PA 3AA9A 3KHLA 2OPQA 2P9GA 2NPIA 2GGPA 2CPIA 3BGOP 4LVOP 3RBXA 3JQMA 5E3RA 5EGYA 3BKTA 5E3QA 4DV6J 2OGUA 2AW0A 2DIVA 3E8OA 5LMNF 4JI1F 2R8HA 3POTA 2MQNA 1RT7B 4CCHA 5KFTA 3R7BB 1KLMA 4CH1A 2M88A 5A6WA 1AUSL 3SXLA 1UVIA 2W9BB 1Y00A 3MMBA 2KZMA 4F2SA 3RUBL 5KFNA 3CMQA 1NH8A 3CJ5A 1SC3B 4OYAA 1V6HA 2DBBA 3MR7A 1IJEB 3V4IA 4ICLB 4FNIA 3VZIA 3KLEB 4F04B 5F9LA 2NR0A 5DS7A 3D7SB 4MT1A 2LVWA 2ZKUA 1N5YA 4OI1A 3DDNA 3KLGB 2J6UA 1IKYB 5L39A 1VRQC 3HFZB 5J2MA 2ZZNA 2CQDA 3FQKA 2ATCB 2N3LA 1HMVB 1IQTA 1WKJA 1RDRA 3A8KA 4UF4A 3TUJC 3R6LB 1KKHA 2YKNB 2HQGA 4CP5A 2ROPA 4ZCLA 2FJEB 4WXOA 3PYGA 4N47A 1YBUA 3T5HA 2LYVA 2NXUA 3LGHA 3BN4A 3OLBA 5LSOA 5AT1B 2GHPA 4X4NA 1YITS 1S6QA 1IUJA 4YEAA 3CC7S 2KZZA 5IM0B 5ETLA 1GX6A 2UXDF 2KG0A 1WOOA 3H2VE 5AJ3F 4IR9A 1N5SA 3M8PB 4U9RA 1UVKA 2RMLA 4I6YA 2MQPA 4N8OA 3GU0A 3ZZZA 1X0FA 2G9OA 1NSPA 4DR5F 2V8HA 3TAQA 1UW9A 3W3SA 3AQOA 3T1YJ 4ZK7M 3Q2TC 4TY8B 4CT8A 4DR1F 1URRA 4K2XA 2GVZB 3RYLA 3IC1A 3Q8SB 1XNRF 4NE9C 2HZCA 1MMNA 2KDOA 3J7AN 4AL6A 1QUVA 3AODA 2F65A 1J5OA 1JLQA 1ZA2B 3W8PA 3M30A 2VG5A 1XMQJ 1ZPVA 2FJXA 1I51B 4F50A 2XWXA 3FSXA 3BBFA 2KN4A 1JXLA 1R0CB 4RBTA 4XO0A 4ANEA 1D8ZA 1UWAA 3NBPB 3C16A 2VA2A 2ZZTA 2X3DA 3HVWA 3W2VB 3KK2A 2V0NA 1SC4B 2ZH7A 3S8SA 1FKOB 4NOHA 2W2QP 5J2NA 1Q82T 1JLBA 2MZRA 3ZTRA 5F8IA 4HI1A 3C66A 4DWIA 2OPSB 3Q86A 1Q5VA 2XMKA 3PKYA 3KMSA 3DDIA 1PC4A 1IM4A 4B9NA 1U02A 1XTZA 2YQ0A 3MUVP 2DNQA 4CNZA 2JOQA 2XM3A 4NLGA 4FPRA 1REGX 2HG4A 1FWPA 1NZ8A 2UUBJ 2B7BB 1I3OB 4UT4A 1SVDA 4OX9J 4OV1A 2BZ2A 2Y1IA 3MUTP 4NYZA 2EWHA 1EZZB 4C8MA 4E98A 4PWWA 3M8YA 2V2VA 2JJ4D 4FF2A 1LWFA 3V4MA 4F36A 1KR4A 4J9UE 2XS2A 2AEMA 1M5HA 2DXFA 2CIMA 2UU9F 4DSFA 4P73A 2R8GA 1BQMB 2D69A 2HURA 1JLGB 4L3KA 1VFJA 2R8KA 3H20A 2A2CA 2FVSA 5G4DA 5KT2A 3ICLA 1RLDA 3M1VB 3I56S 5LSLA 4OQJA 5L1KA 2A6OA 3DLKB 2J76E 1JWWA 1OYEA 3CMAS 1YDLA 2BVZA 2DPIA 4FDFA 5B0FA 1X31C 2NREA 2H54B 3ISZA 2MHNA 5KFYA 2CJ9A 5DM6Q 2LXIA 4F4WA 2L3MA 5F8MA 3M6XA 4CO1A 4B3RJ 2UVUA 4RUBA 3N28A 2C2KB 2JEIA 4J9MA 2MKHA 2J7WA 2V4QA 1KOHA 2PGCA 4IG3B 3NCRA 3EE3A 1BXNA 1M5VC 3DMJA 3EPGA 5AXKA 1BUXA 4WYLA 3BBBA 4H4KC 3NGDA 4KO0A 4ZPCA 1SI9A 2GHWA 1DZ5A 4P71A 1KTQA 3PJWA 3BO2A 2XS5A 3BGUA 4YMEA 5J2QB 3T1HF 1DTTB 4WFNQ 4ZVRB 1ZTWA 2EG1A 2DHXA 4ED7A 3I31A 5DDPC 5KFWA 4X65F 5DZ7A 1GAOA 4WK3A 1HYSB 2OPRB 3TJ9A 3MF5A 2KKHA 2DGQA 1TFYA 3CUNA 4DV3J 3OT9A 3NP5A 3K2YA 3IG1B 1TUGB 4DLEA 2BXJA 4ILRA 2MLXA 5H9FJ 2B43A 4J9QA 4ENOA 4CYUB 1XERA 1RP5A 3IBWA 1GMWA 1JKHB 2AYEA 2CNNB 1RAIB 4IOAQ 4JV0A 4H4MA 1HBUA 4OJ3A 2DR5A 2VQFJ 5GAGI 2RUSA 4DDFA 2R3VA 3QJPA 3UVJA 1R8AA 2XGQA 2D3O1 1Y7PA 4KH0B 3DLBA 2VBXA 2AU0A 2CWKA 2QLJB 1ZZNA 1WF2A 4WFZA 4ZPWR 1T3OA 1KBRA 4Y6IA 2LCWA 2ZVSA 1EAYC 4KRWA 4ZLJA 4Q8EA 4B9MA 1FD2A 2LQ5A 1N5TA 3ZTSA 3BV8A 4NA2A 1MWZA 4XIUA 3FBCA 2UVRA 2QFIA 4OLOA 4ZVQB 1S1XA 2AYGA 2NYIA 5KG0A 4USMA 2F5GA 2M52A 4K4SA 1RLCL 1X9SA 3MR5A 1V5IB 3LUYA 2OEJA 3BEGB 3RB4A 5C5JA 1KTVA 4JOUA 3GP9A 2HNYA 2W2OP 2PMHA 4LR7A 1UL3A 2G2YA 5M2UA 4KHRA 5KFRA 1X7VA 3HT3A 1NK4A 3IS9A 5L38A 3EGWB 4OYXA 4DMZA 3VQTA 1TMJA 4LSNA 3DOKB 3K8VA 1CQNA 3D6MB 1FFSB 2HZVA 2CQ3A 3ETOA 3MD1A 1OSDA 1TU0B 4DV6F 2BA9A 1M1HA 4XK8C 1M5OC 4JI3J 2DR9A 2HW3A 4R5PA 3ONQA 3OPKA 1R89A 2VASA 1D9FA 1N4LA 1S1WA 1VISA 1VHFA 3QSIA 3MUMP 4A4JA 5K5MA 3JSYA 1ZYQA 1VRTB 4CIOA 4O3QA 4L73A 2DNPA 5EX0A 3H40A 2NZ4A 2GC8A 1N8RT 4FKXA 4F4ZA 1S72S 3G4SS 2R7OA 4ID5B 1ROFA 3C6TB 2MPUA 1WHWA 4L3NA 4NASA 3TAMA 4M63A 4DL4A 2QGFB 2CPXA 5FJ4A 2ZOFA 3PEJA 4DZDA 3ZZUA 4PRFA 2XY7A 1E6YB 2IMOA 1R3NA 2VF3A 1U09A 3HHDA 4ES2A 5CYQB 4PCQA 4DFPA 2KFYA 2PEHA 4Y2KA 3V6JA 3TQ1A 4LRFA 3KG4A 3MURP 3W66A 4C11A 4N5SA 3R7NB 1L3UA 3D54A 1C1BA 4KSEB 5CHCB 4IYQA 3OFGA 2CPFA 2ZC4A 1O0PA 5E2QA 1Q78A 1U1PA 1TL3A 5A8WA 1RXOB 1TAUA 4NCGB 3I4HX 5AE2A 1JLCB 4H4KA 1U6BA 3NS7B 3H0PA 2GNKA 4ZS6A 2EK1A 1MNEA 1PAEX 1MROB 1EJ7L 2FYXA 4CLSA 2J5AA 3NCPA 3R6GB 2HHTA 1LXJA 3OR1B 2XI3A 4DSKA 1RTIA 3PYEA 4OLPA 1XMBA 1Q53A 3QIPA 4B17A 3ET6B 1NDLA 1AFJA 2LU1A 1S6PA 2DR7A 3MAAB 3E3XA 5J2PB 3T1YF 4DPOA 2PI5A 3ZTPA 2C2DA 1YWXA 3LA0A 3I0SB 3P96A 1FDNA 4HKQA 2H51B 3CCZA 1LV5A 3C46A 4O44B 2DNOA 2QC3A 4X62J 4O3PA 2UUTA 1UVNA 2ZH9A 4B3MJ 2MMYA 5M2PA 2YWHA 5J1NA 3BQ2A 4K0KJ 2ZUGA 4NI2B 1XMQF 1HD1A 2XBPA 1UEUA 4ZLPA 1APSA 4QBUA 3TAPA 5FDLA 1ZAXA 1A6LA 2B8PA 3DU5A 1RAOA 4N41A 1P9YA 5JUMA 5K14B 1WTBA 2FY8A 4F4AA 3FSIA 4GVBB 2NXCA 4QCLA 3RB3A 3OTDA 5BYRA 2KYZA 3OVBA 1V9OA 2QA2A 3GFYA 1T05A 2Q6BA 4YB7A 5K20B 4OJHA 1AA1B 1S1VB 1OPIA 2GV1A 1TK5A 2D1CA 1PIEA 2MGZB 3I5BA 4TU7A 4OYBA 4WK1A 4ZDNA 2IA6A 5DRKA 3KK3B 4IFYB 3KJQB 4A8FA 5DQGA 2C2RA 2XSJA 2ZH4A 4CLZA 2C2OB 2F40A 4G1QB 5CZVA 5D4NA 1RHQB 1U0SA 2MSSA 4P7TA 1NNDA 3KKFA 3H5UA 2KT3A 4MK8A 1JXEA 2UUBF 3I5CA 4OX9F 3MGJA 3GJRB 1SIZA 4CO0A 1RZMA 3I0RA 4PG8A 3BSNA 8ATCB 1IKXB 4U8YA 1DARA 3M8ZA 3DM2A 3P4UB 4QR2A 2BJDA 2VQEJ 4M5HA 4I2QA 3G6ES 3R1HA 5GADU 1P27B 1ICEB 3G96A 3HSZA 1RI7A 1SIWB 1IVZA 1H72C 2L48A 1IJFB 3DHWC 2J9CA 2VDHA 4QW8A 3MM5A 1SKWA 1DQAA 1S4FA 1EHWA 3I96A 3CC2S 2ATLA 3OQ2A 3NL0A 4DR3J 4K4YA 1RT5B 2BJ1A 1GMUA 1TKTB 3G6VA 3W64A 2O5DA 1FFGB 2IM0A 4MJKA 2FPHX 1N5VA 1OIAA 3N5FA 4RNFA 3LP2B 2PE8A 1FRXA 5F9NA 3O1LA 3K5LA 4LT6A 3QWUA 2VC0A 4CLFA 3D6FB 4DS4A 2HGNA 2EFGA 2NZCA 2IJFA 2CPEA 2ZH8A 1EB0A 5HMYA 1XR6A 1GTHA 2PN6A 3UR3C 3AOCA 1AT1B 2HQ3A 2Z56B 5ETKA 3HZGA 3I82A 1MSWD 3BQ1A 1B70B 4Q0BB 2OSRA 3PHEA 3KWMA 1C0TA 1B4SA 4DL6A 4RLEA 4DX5A 2MYFA 4WPAA 1HHTP 1ZZFA 2BW2A 2WVCA 1RWOB 2CJQA 4RNNA 9ATCB 1JJCB 1NH7A 1NDCA 1VQSA 5CXTA 4S0MA 3DYAA 3OVSA 1WNEA 5IT9U 4RKUC 3IFEA 5DZ6A 4DV3F 3ILIA 4B9SA 1BMQB 5JVGQ 4DR2J 2RB7A 1X4EA 2DB1A 1PSDA 2V9WA 2HGLA 2BV3A 1HQUA 3F44A 2XNRA 3PRDA 4U8VA 2D3UA 2GGPB 1KQKA 4Z7YA 3IWLA 3MOJB 1JJ2R 2YNGA 4BWMA 3LQVA 2FHOB 2AP6A 1T9TA 2XEXA 3POTB 1GMVA 1ZM2A 2BE9B 2VQFF 4JI4J 1KLMB 2YTCA 2BKPA 2IJRA 2GO9A 2VDIA 1FRHA 3Q8QB 4BCAA 3R27A 2N4DA 2ZH1A 3MMBB 3THVA 4I64A 2HFSA 4I7FA 3CCWA 5DETA 4B3TJ 3GSIA 3L7UA 2VJVA 3VVUA 2FZCB 3GYGA 3V4IB 4CT9A 3KDNA 1N33J 2HHQA 3C15A 1K0VA 3ZZYA 4DU8A 4MKYA 3KTQA 5KG3A 4P2XA 3IM8A 1NK6A 1N5YB 1O6XA 1W26A 1B64A 1H6KX 3VAMA 2VOPA 3AY0A 4X4SA 4UOGA 4KPYA 2WVDA 5J2MB 3V5RA 3OLAA 1DQ9A 1R8PA 4DN0A 4CNYA 1RTHA 4DFMA 4U7UD 2GMLA 3JSRA 2QMWA 1KNZA 1M5SA 1IN0A 3MPWA 4NYOA 3MEEA 1S9GA 4RUHA 4I67A 4IH6A 4ZVPB 1HNZJ 1P8GA 1RHKB 2FIUA 2Q43A 3OHBA 1LFPA 3T19A 1VK3A 3M8QA 1HW8A 3HP6A 2ASDA 1G3OA 1S6QB 3R5DA 1K1SA 4CI0B 3T3FA 4PG4A 1M5PC 4JI3F 3CB4A 3N6MA 4J9KA 4ZJLA 3TA1A 4RW4A 5JXSA 1TTHB 2KM8B 3IGVA 1WEXA 2H4WB 2WRMA 5AE1A 1VGYA 4CLTA 2C2ZB 4CO4A 2MKSA 4KC5A 2Q66A 4KHMA 3RAQA 1OY8A 2FUG9 1AZSA 4USVA 2HAFA 4M5NA 1VQ8S 3TJ8A 4LRCA 4OJGA 4EYIB 2IRXA 1BE4A 4ZCIA 2XI2A 1SJ3P 1J5OB 1JLQB 1YRXA 1W2BR 3CVKA 2E29A 2RHQB 3M30B 2ZUAA 4X84A 3GB0A 4LF8J 2JEGA 4DL2A 1SQGA 3HF5A 1FXRA 1SKRA 3AQPA 4DV4J 4BHQA 4O4RA 2E9TA 3M2RA 2D3ZA 4M5IA 2X1GA 3TRGA 5HSPA 3TOQA 3QRRA 3C16B 3JQKA 2RDDA 2Q79A 2A10A 4HT5A 1OY6A 3KK2B 5HI7A 1YJNS 3HCXA 3SQGA 2BMBA 3HHKA 5C2GA 3CCJS 5J2NB 1JLBB 2N82B 2HS4A 1GXUA 1DURA 1KSPA 2W9AA 5A6PA 1R0BG 5C7PA 4IQMA 2DRAA 1U1OA 1RGVA 5L9NA 3FRZA 2ZHOA 1VC0A 4QJVA 5EHHA 1K0TA 2AGPA 4OZNA 1XBWA 2QLWA 4LF6J 1LNQA 4PPDA 2DR6A 1CJKA 2IM1A 4OHWA 1S0MA 4J9VA 1GT8A 3NNAA 1KEKA 1FT8A 1LWFB 3R5BA 1N6QA 2DNMA 4X62F 3UQSA 1RUSA 1RWUA 3DCAA 2DH7A 2G1DA 2F4VJ 2GJ2A 3PIPQ 3JYTA 1KFSA 1RTJA 4UOHA 5HBMB 3N5BA 2ACMA 2W2NP 3FRYA 6FD1A 4V19X 2OTLS 1JXVA 4FN5A 4F4YA 5ETTA 2J7UA 2QSWA 4URGA 1D8YA 2IFXA 4CO3A 2YWGA 4N7TA 2W7PA 5JVHQ 1IQZA 5FLXU 2NUHA 2ZOGA 1RQ0A 1FWKA 4WF9Q 5D77A 2ZZMA 3MDFA 3ZFVA 3E2EA 4QWEA 3MZIA 3GV5B 2I2YA 3TA0A 3D0HE 4YDDB 2J8AA 3OD2A 2JX2A 2BABA 3NNCA 3SCLE 1XNQJ 2JZ5A 1BGXT 3HX9A 1VCTA 2FTRA 1FXLA 2HNZB 5F3ZA 1SH3A 2Z2ZA 5ETSA 2P9CA 3J80U 3VHQA 3AXMA 3DMJB 2ZH5A 2DHHA 2IY5B 4KO0B 4O3OA 2UUCJ 1F5CA 2K7JA 2QMXA 3CCRS 4USIA 2YH0A 4ECWA 3LAMA 4PWDA 2HVDA 3VALA 1S0NA 3HT0A 4ZHRA 4JI7J 1OWXA 4WTYA 1VLYA 1WORA 3H5SA 2B7CB 4NMXA 4NZ7A 2QYGA 3SFUA 3QJJA 1X60A 4RNMA 1YJTA 3N9UC 2JWNA 1RTDA 2RH3A 2HMIB 2YNFA 4DR3F 2B4OA 4ECSA 4IOCQ 4ANCA 2J8SA 4G1PA 1TQLA 2RU3A 2XMMA 2UZAA 2DRBA 5IT0A 1JMTA 2L9NA 5THWA 3QT7A 3H90A 4KGZB 4H4MB 2J7KA 1VIXA 1HBUB 3HK2A 3CSKA 5I3QA 3CJSA 3UVJB 4ECZA 4HHUA 1NK7A 4XAKA 3K5MA 2F7VA 4G65A 5HL7Q 4I69A 1NK9A 2HBZB 1IR0A 3CDUA 1AW0A 2DNZA 2VBYA 1P1TA 2PMZD 4Y3CA 4Z7CA 3TARA 3UDLA 4I6WA 1NZAA 1S1XB 3W9HA 4WCEQ 1U1QA 2GQQA 4P72A 1TK8A 2E1MC 3K89A 4LF4J 2VPWB 4CLYA 4NEYA 2IRUA 3CIMA 3M05A 2HNYB 2LKZA 1RT3A 3W9JA 5K8OA 1IWGA 1WC6A 2FJBB 1SH2A 3IS9B 2BM1A 2AMCB 4DR2F 2WSCC 1M1KT 2H65B 4LSNB 1L5UA 2I8EA 1H74A 3FSYA 1X8DA 4QR1A 3MD3A 4KH1B 4C7QA 2MXYA 1CULA 4LF5J 4DG1A 2E7VA 3PVXA 2ZDOA 1OQ6A 2DNYA 1Y0HA 2RDIA 4R5PB 2EFQA 2W2MP 1R8HA 3GILA 1RK8A 1WKLA 4A8SA 4KIAA 3CT9A 2SXLA 4I2PA 3OW2R 2WVBA 4WBFA 4AYBD 4JI4F 3OSPA 4CLKA 3HPOA 2DO4A 1S1WB 1S6UA 4N77A 4ZPDA 5T41A 3BDPA 1M1GA 2C2EA 4B3TF 4A8QA 2CJAA 3MM7B 5CQGA 4DSLA 3CO9A 3UO0A 1CJVA 1N33F 1HR0F 2D9PA 1NMEB 3EPIA 3TAMB 5KOXA 1H0HB 1SCJB 1HHSA 4B3OA 1TKDA 3QT8A 5KFQA 4LQ3A 1LFWA 2F9DA 3QGHA 1JLEA 3J80Y 2DGOA 2OP5A 4C2MA 2HEKA 3PRVA 3LW5C 3RR7A 1F0XA 3HKZD 3CC4S 2DKOB 1ZOTA 3PXGa 2CRLA 1Y5LB 1TKXA 1HI0P 5D4OA 3UCZP 1OJ4A 3OFFA 4ZA1A 2XGPA 4OI6A 3PR5B 5K8NA 1MMLA 3DXSX 3SSQA 5GMDA 4C11B 1HBNA 1ELOA 3NAIA 1FJCA 1HNZF 4IH7A 1C1BB 4RW7A 4HTJA 3UE2A 1TL3B 5EWGA 1XK8A 4ED0A 2G2OA 3LP1A 4OYPA 1GMWD 2EKNA 1NKCA 1QUPA 3VF0B 5I4MA 3D1OA 4UQGA 5HVHA 2QLXA 2I5JA 2UV8A 4Z37A 1RAEB 2W4PA 1RTIB 1KOOA 5KFUA 3QIPB 4DX6A 2BOPA 3BZQA 3J7A1 1F6TA 1S6PB 4DPWA 2HQFA 4QQBA 4HDHA 4X66F 4QWAA 1FXDA 3OR2A 3QGPA 4AXJA 1VYAA 2XULA 4CM2A 4LF9F 4NLRA 2XLIA 3BPSP 1FNMA 5E0OA 2ZBRA 4XPEA 4QPTA 3MCMA 1FEHA 4G6VB 4YB1P 1KHVA 1X9WA 4LF8F 4BC9A 1NAQA 1U45A 5IT4A 4WP3A 3DOLA 4DV4F 1YBAA 3VTIA 5FDLB 1MG7A 1CQMA 4P2MA 3FBFA 1VQNS 4FYXB 5D0HA 2WCXA 2FHKA 1T05B 3B54A 3NNHA 4ECRA 2FC9A 3SV4A 2JL9A 1UA1A 4JB8B 2G1HA 2R2RA 2ZBQA 3NGRA 3S7RA 3R3TA 4W98A 5F41A 4ELTA 1RB0A 3MEKA 4K4UA 2XSJB 3DLEA 2YKPA 2R7QA 1SQFA 3PG9A 4QIFA 1RA6A 2HVIA 2Z30B 4E2FB 3N01A 3BB5A 4HACA 1Q79A 2HYIB 2WBRA 3K57A 3P45B 4MKBA 2WHOA 1NB2A 3I0RB 4WP9A 3M32A 2AWZA 4BBYA 1KONA 2FJAB 2HSEB 2DT9A 2K06A 3MEGB 2OELA 1Q16B 2VOOA 3DM2B 2FVRA 1NU4A 1T94A 3P5BP 4ECVA 2YWEA 3AJ2A 1YI2S 2WBMA 2B9YA 4A47A 3HD2A 3P6YC 3Q2SC 4I2QB 4FS2A 2F4VF 3EJMA 5DLGA 4TN2A 2DJWA 2CQBA 3UDVA 3TZYA 1X5TA 3MM5B 2G4BA 2AJ1A 3W7BA 5LOQA 1N56A 5A2QU 1AFIA 4J9PA 2KJWA 1SB6A 1Q8KA 3GTYX 1FJ7A 1D3WA 4TQRA 4ZVEA 5KFXA 4OFZA 4KE5A 5CCLA 3UN3A 2NXEA 2UVWA 2DEJA 1BQXA 1RCOB 3CCTA 2ROEA 4EU0A 3RRHA 3ZZRA 1J5EJ 1RHUB 2VHGA 4F8RA 3AB4B 3OFHA 4JBCA 1S1TA 4HH0A 2BRKA 2IVMA 2EBGA 3BH7B 3NGKA 1XNQF 4TYBA 4MFBA 3KJNB 5IFMA 4KB7A 3EDRB 3W2WA 2HQIA 2XZWA 3O8WA 3PX0A 2QO3A 1JQGA 2FB0A 3IP0A 3MFHA 1NBEB 2DPJA 2VU5A 5U47A 1C0TB 5GADI 2NSCA 2AGOA 4LSLA 2PA3A 4IDKA 1C0UA 2UUCF 1KLNA 2PA8D 2APOA 5EX3A 5IS2A 5CYMA 4KR0B 1F5BA 3DGVA 5KFIA 2FGOA 3MM6A 3DRPA 3KLFA 3FBBA 3M7VA 2ZDPA 3IXQA 2YQ3A 2MB0B 6AT1B 4AQYJ 3DYAB 4JI7F 3G87A 4KY3A 3QFWA 4KHPF 2QV6A 1V3ZA 2CQHA 4UZBA 4ILMA 3NGSA 3R5CA 4A8OA 2BX6A 3OTEA 1HQUB 3GFXA 2XY5A 3IAS9 3WIVA 1L3VA 3TI0A 1XQIA 2FLPA 2CJXB 5D0RA 4ZJOA 1VQYA 3F0NA 3CCLS 5KFBA 2ZD1A 2DH8A 2I0XA 2YNGB 5BR8J 1LWCA 1T02A 5B0GA 2JLGA 4WE1A 2KJVA 1LOUA 1TL1A 3IRWP 3BSAA 2RF2A 3IR5B 4DN9A 5CD4A 5C42A 3S01A 4RNOA 1JLAA 3GE9A 2HIQA 3HVTB 4NYPA 3ENQA 4I7FB 2DGXA 1WC5A 5MLCV 3M6VA 3NEKA 3R1LA 4X4TA 2BACA 3QJLA 5HQLA 1LW2A 2YVSA 1JK9B 1FO1A 4YR2A 3C15B 3I6PA 2BQRA 5L46A 2IMWP 3X3UA 2DRDA 3HSGA 4LF4F 3H59A 4X4PA 1RTHB 1PCAA 3DRYA 4OZ3A 1H98A 1BD6A 2N3OA 1GXLA 1VRUA 3SCKE 1LEOA 1F3VA 1UTAA 1VQ4S 3FFIA 1S9GB 3MEEB 2O3DA 1NK5A 3CW2C 3MOZA 1G6BA 3HSDA 5C24B 1NDKA 3NXZA 2Z58B 4NLOA 5F8LA 3M8QB 3QLHA 4RBVA 2FZKB 4JYAJ 3BGFA 1HA1A 4IQXA 1FCAA 2JSXA 3V81A 1UZHA 2QL5B 3DFEA 4PYAA 5A2QY 3QO9A 2VFRA 2MKYA 4XTTA 4C8OA 4UY85 1YHQS 2HLTA 2CQGA 5ADZA 3KJVA 3L95X 2LU2A 3QATA 4DV0J 3CJ8A 1AZSB 2E1PA 4HL9A 2OEKA 1J27A 3MR2A 2HFUA 2UXCJ 4YR3A 2Y8YA 1V5VA 4F4XA 2FD2A 6FDRA 1QSLA 2CNKB 3HVAA 2HBRB 2YKMA 3U27A 4DS5A 4FPIA 3NKYA 3MHYA 1TV6B 2GIFA 4YHHJ 4X64F 3CDEA 4TU8A 4XDCA 2JRSA 2B4UA 4RZRA 1QD1A 4ID8A 3M2RB 1EIYB 4JI5J 1B0PA 1ACMB 1RABB 2M2BA 2YY3A 2AHOB 3VAHA 3SCIE 4ZLLA 3KMQA 1VIOA 2HK3A 2MQMA 1FK9A 2VFUA 4Y2CA 3PW0A 3OL7A 2AD9A 1QY7A 1S7IA 4PKDB 2RRBA 3SQGB 4DPUA 1NSKL 4RBUA 1S97A 4WKRA 2MZTA 4L74A 4CH7A 2DHAA 1GFWB 1KQFB 4IH5A 4ICLA 3SMZA 2E7XA 3JSMA 4JI0J 2LEAA 2VJUA 4NZ6A 3UWTA 3MMCA 3EZ5A 2BW7A 1T9YA 3HHLC 3KUGA 1N36J 3OVAA 1WG5A 1RYSA 1VBKA 1S99A 3U1LA 1FF2A 3CDWA 1MLAA 2IBOA 2YKQA 3PDNA 2MKKA 2E1AA 3RR8A 2XMUA 3RW6A 2G13A 3WDOA 4BC7A 3OTOJ 1RISA 1CJKB 4PUOB 2ADCA 3CD5A 4ZN1A 3W1YC 3HDSA 2J0SD 3QGIA 3EXYA 4W4MA 2OD6A 3AD7C 4FYWB 5E3CA 1N6QB 1LK7A 3DN9A 1NK0A 2QSFA 5EWFA 4O3SA 3G6XA 4TNOA 2FLNA 3TX0A 2HHUA 2RD5C 4MH8A 3JYTB 1RTJB 1R6YA 2MTLA 1HQEA 1BQNA 4EWTA 2VBWA 2V4JA 2LEPA 5KT3A 2WAQD 4R0EA 3LWMA 4C4WA 4ZITA 4NCAA 3M8PA 4OV6A 3PIOQ 1T9VA 1VHIA 3NGUA 2ZM6J 2HHWA 2DH9A 2DHGA 2GCFA 2B6AA 3OL8A 2KHDA 1TZ0A 3DLGA 3ZO7A 4LFAJ 1D09B 3LO3A 1WHVA 3J7Z5 4KPCA 3M6UA 3A12A 3QIDA 5BYSA 1IKWA 1URNA 1WACA 4IKAA 1U47A 5IV4A 5LMUJ 3HM9A 2QA4G 4X4OA 4LFBJ 4I56A 4RW9A 4C0HA 2K3IA 2HWHA 2IC3A 4XDDA 2GVDA 2MKIA 1X5PA 3CCVS 4K4XA 2DNNA 3PJ9A 4NPOA 3G8QA 4QWBA 3U1NA 5LXYA 1K1QA 2JEFA 4M8LA 5IV3A 3K7RA 4WIIA 4A46A 1S9EA 2UXBJ 1IKVA 5CAAA 4PWDB 2B9WA 1FTRA 5SZTA 4B3SJ 3W2VA 4ZHRB 4OZJA 3PNIA 4N76A 4OX6A 2W4CA 2B3TB 3IWXA 1IBLJ 1SUQA 3JS9A 3N4WA 2BR0A 2BEFA 2HLUA 5SUHA 3RW7A 1WC3A 4UW2A 4C98A 2M3DA 2HVZA 1VR6A 3U7JA 1RAGB 5HK4A 1RTDB 1S1UA 2YNFB 2BJ3A 3M4XA 1S59A 4ILLA 1PYSB 1DAXA 3QRPA 2NXJA 3D3CJ 2PMWA 1FNXH 4Z2XA 1T9WA 1H3DA 4ZCMA 1WOPA 1F60B 3CO0P 3P5TL 1J5EF 2V94A 1RHJB 2XMAA 3D5MA 1ZAVA 2BOAA 3EVWA 2DXEA 2CYYA 4RPFA 3R9LA 4YB5A 1FVQA 2EC0A 2W8KA 1MN7A 4ZP8A 1T0TV 4C3LA 1IR1A 2BQ3A 2AKWB 1Y3KA 5AXNA 3BKFA 3PY8A 3GIKA 2W7AA 2DD8S 3THTA 3BDEA 4M94A 4RUCA 4DQPA 1I5OB 3PW4A 4F02A 1OO0B 3GZ7A 3ULHA 3OV7A 3EGNA 2CJBA 2DISA 4NL5A 3H4DA 1RT6A 1OSCA 2VH7A 5IXUA 4MKAA 1EP4B 2ZNYA 2RE1A 2MEWA 2E9RX 1YJRA 1RT3B 3D3BJ 4TU9A 4O4GA 1AB8A 3O3LA 4WP8A 5KG7A 3CEDA 1B7YB 3HHLA 3G6YA 2RUGA 4J9SA 3ITHA 2XS7A 3AD9C 3L7OA 5GVQA 4F3OA 1YRTA 3OXLA 5ETMA 1CULB 2QN6B 7AT1B 3C19A 4DG1B 4IG3A 1JB0C 1ZM3A 2J9DA 2P2CB 3SZ2A 5BR8F 3KLHA 5E3PA 3MM9A 2ASLA 2D3OR 2VONA 3AT1B 2H3EB 1FKAF 2JFDA 3W65A 4I2PB 3UD5A 3J7YU 5I42A 5D0GA 5KFZA 1Q0NA 2OTJS 2Q6CA 4KKOA 2RSQA 3D9BA 2VICA 1HBOB 1S4EA 3NOGA 3PV8A 2AIRB 2K1RA 1RADB 2C22A 5BJRA 4DF4A 1Y5IB 1CJVB 3T5JA 1FHTA 8AT1B 2A18A 1HNVA 2RJZA 2YPZA 1YRUA 3Q8RB 2ZH6A 4B3OB 1VQLS 2HHHJ 3UD4P 1FJEB 1RA7A 3TWZA 1R8BA 5ETNA 2ZE2A 4XPCA 2FJVA 4USHA 2CQ2A 3GJTB 2NSBA 2KTQA 2V8DA 5I3PA 1H2UX 3RU0A 1HWKA 4DUTA 2HWTA 3TUPA 2JFKA 1UFWA 2BRLA 2QLBB 4F7VA 4FBUA 1A9NB 3TVYA 1WOSA 1X5OA 1FVSA 1FESA 3LF0A 4UOCA 4F26A 2M8DB 1SPBP 1FWLA 5AE3A 2ZVIA 1K44A 4GC7A 3CD7A 2LQJA 1QVGR 3I4PA 1F3FA 4DR4J 4LBPA 4RW7B 1UKUA 2LEBA 2OIHA 5HMZA 4U7UK 4MIWA 4NA3A 4JYAF 4JI8J 1HNXJ 3LP1B 3RGIA 3FNNA 1I1GA 4P2SA 5A8KA 1YZ7A 4R8UA 1NUEA 4J90A 4E0DA 2I5JB 4KBIA 5KFKA 3W8GA 4OMFG 3OSNA 1AUDA 4C9DA 1VQOS 2CQIA 3HULA 3DLHA 4TLQA 2ACYA 4D3HA 1FTCA 1PJ7A 5CA5A 2H4YB 3GCWP 3GLJA 2C3PA 2P5VA 3OR2B 2L9WA 1XC9A 3KUEA 1FFWB 1XR5A 1RAFB 2CJYB 5FD1A 4LF7J 1FRKA 2UXCF 5HQ8A 1YIJS 3DOKA 1N32F 1FEEA 2F63A 4RU9A 1ZTTA 2FGCA 1REVA 2QL9B 2ZJPQ 3L7PA 5KFFA 2CPZA 2QJ3A 4YHHF 2WVEA 2LXFA 1T9UA 5F8GA 3QAEA 3R2CJ 3SIPB 3DOLB 4CZCA 4NLUA 1HWLA 2Y1LB 1TP7A 4JI5F 3TX8A 1B7FA 2HK2A 5AJ3J 1F2HA 2M0GB 3IO1A 2PD1A 3BN7A 4ITSA 1S77D 3E01A 1C4CA 2RQKA 4H4OA 3HVRA 2XCPA 1SKSA 4USUA 4DR5J 3KG1A 2CPJA 4I1TA 1NLKL 4Y00A 3LALA 4ES1A 2F9JA 1Y3JA 4EYHB 2BE7D 4DR1J 4ED3A 4MK9A 5HATA 3AAWB 2AJ4A 1Q8LA 3MM8A 4JI0F 3M8RA 1DTQA 1RWKB 3HMJG 4M95A 3C6TA 4OYWA 2ZJRQ 3G8SA 4YY3J 1N36F 3FZ2A 3H2UB 3M6WA 2AGQA 3HJFA 3LGNA 2WTFA 1J2VA 4ZP9A 1B0TA 2QG9B 4HACB 1RT2A 4CRJA 2KT5A 4BLGA 3OTOF 3OJUA 4ZVTB 4DCPB 4CTAA 3RAXA 4DR7J 2AQ4A 2ZHBA 1HFEL 2XC9A 2EEYA 3M32B 4Q45A 4CH0S 2OD4A 2OPPA 4ZKAA 4K4ZA 4UY8T 5DM7Q 4I68A 2FZGB 2R7XA 3OJSA 3KLIA 2DGWA 4Y2MA 4G3IA 4C8LA 1G2EA 2ZBPA 4F0HA 1TFWA 3LOUA 4KJIA 4H54A 2XZDB 2H9ZA 1IWAA 2CG4A 3GV7B 1TK0A 3I9ZA 2XMTA 3QAUA 2BJEA 4RU2A 2A2DA 4OI3A 2LDYA 3KHRA 3GR1A 4DL3A 1FKPA 3BF4A 3RAMA 1Q95G 4KTQA 1RAJA 1NHVA 2ZM6F 3HFKA 1DJ0A 1VLOA 2KI2A 3DNCA 5KG4A 3G9CA 1PILA 1OS5A 1S1TB 4JV1A 1X4AA 1DBDA 3CCQS 1BLUA 1EQ0A 2YNIA 2WVFA 3A3PB 4OI2A 4OZ5A 3DDKA 1S76D 1S0OA 4QW9A 4LFBF 3NGTA 5G0RB 3U1MA 2VFVA 1VQ5S 4F3MA 3PO5A 5B7WA 3BSCA 4NLDA 5T7LA 1FJGJ 5F8HA 2KB2A 2DY1A 2DNKA 3Q8YA 1QVFR 4LSLB 3NOCA 2VV5A 3PR4A 4IDKB 1C0UB 3VGVA 3H5YA 2KRBA 1HPZB 5CYMB 4NLSA 1S49A 3MM6B 3DRPB 4FXVA 3KLFB 2FVPA 5GAHU 5DLFA 2JC0A 2I38A 4B3SF 2O67A 4RW6A 3HZEA 5B08A 3WX4A 1S9FA 3ENAA 1KFDA 3MEDA 2RQMA 2IDLA 1IBLF 2HWIA 1PKUA 1IBMJ 2R2UA 2K7KA 1FRJA 1G7CB 3J81j 2W25A 4MYUA 2GW8A 2W2PP 4WU2A 3THPA 3TUIC 1YX2A 3R97A 2OJ3A 3D66A 2ZD1B 1NSQA 4EEYA 2YKOA 3VVTA 4WZMA 1LWCB 1JNZB 2MSTA 1D0EA 1DLOA 2W8LA 4WE1B 1WJ9A 4F0KA 5KFOA 1M0SA 4O0IA 2O01C 2HNDA 3AXKA 4A48A 1JLAB 4LBIA 4WJBA 2QA1A 2CG8A 4W92B 2KM8C 3QQCD 3UDEA 2MJNA 1QAXA 1D9AA 3IWNC 2LMIA 2ROGA 4OYZA 1LW2B 3O44A 1LK5A 3ELHA 2BJ7A 1ZPWX 2JLFA 3K59A 3C6UA 3J7ZT 2AJ0A 3W62A 3Q0AA 2UUWA 2V2QA 4F3QA 3DGPA 4BDPA 2M5YA 1IM6A 1H7XA 1O51A 4HTIA 2C3OA 5IC4B 5K9FA 5B0BA 4URSA 2F4FA 2U1AA 5KFCA 2ZITA 4P6QA 3M2UA 1YJWS 5L9XA 1Q8IA 5F0UA 1TUVA 1VRUB 5DG8A 1B3TA 4A8WA 2LXUA 1N0VC 5C25A 2VG6A 2WZ1A 1PO6A 4OHVA 3FFIB 1SJ4P 1FI4A 3O6QA 4EI2A 3R8YA 1SL1A 1U6ZA 1KP6A 4LF2A 5L8RC 2NLWA 3QLHB 4X4VA 1UVJA 1VQ6S 3M2VA 3KUHA 4PABA 4FNHA 2GMJA 3EZUA 4EFAC 3IBCB 2DGSA 3SBMA 4PXCA 5KOWA 2ZOMA 1IXKA 3V81B 1LWEA 2F8EX 2UVVA 1GK8A 3QO9B 1V3RA 5HROA 1VJWA 3BREA 3TW0A 3IRXB 4Q44A 3FDSA 2E66A 3HHEA 2EFOA 3KJVB 2A3JA 2GFFA 2N4CA 2PFDA 4J91A 1YJUA 2R8JA 2OAUA 5BXIA 2KXHA 5FIIA 3D6TB 3IBFB 5LJ3Y 2ALYB 2FJDB 2GJIA 2WB1D 3D67A 4QYRA 1BWVA 1NHUA 1Q7YT 4NLXA 4M5MA 2VFTA 3ETMA 3F73A 2FHJA 4HLBA 2VB6A 2RU9A 1M5KC 4KV8A 4B3RF 2ZBCA 5KG2A 5D3GA 2E1CA 4QIWD 2W9CA 3R7SB 2AEJA 4ZVSB 4R0JA 2ALZA 1FK9B 2WONA 4DR4F 1SQEA 3CJKA 4OI0A 2EC2A 2EFVA 4TYAA 5HMXA 2D41A 2AYMA 1DQ8A 3PX6A 3EM1A 4JI8F 5KFHA 1HNXF 2V8VA 5I3UA 1AROP 4MMOA 3JSMB 2X1FA 1HHQA 5IQ6A 1YKWA 1HLWA 3MMCB 1NK8A 2DCUB 1RJJA 3OTCA 1R8CA 1DHMA 4DUZJ 3R5JB 1Z2ZA 1ITPA 2CQPA 4K7QA 2GMHA 5DDRC 1WHYA 3FMBA 1C2PA 3TZZA 3O5TB 3DXBA 2GZOA 3HJVA 2GHVC 3DI6B 1ZA1B 3D0GE 4C0OC 3MCSA 2DXDA 4FF3A 5IZHA 3PM9A 4IG0A 2M7SA 4ANDA 4WZQA 2CKWA 4LF7F 3V6HA 4LFCJ 2OPQB 2D9OA 4QWCA 3FKBA 3N79A 3PW7A 5B09A 4YS2A 3Q8UA 3JTPA 1CS4A 3PHTA 3MFIA 3GSDA 1K47A 1YZ6A 1RWNB 2YX7A 3T5LA 2W1BA 4ZCKA 1OPZA 2R2SA 3JQJA 5J1PA 1HQEB 2AX0A 1XMOJ 3C8YA 1CC8A 4DI6A 1BQNB 2EKYA 1CPZA 3JSBA 2QL7B 4DQSA 3MR3A 2RT3A 4B9VA 2V4JB 2XTJP 3BR9A 2HQDA 3VAKA 4WFBQ 3W5ZA 4K50A 3FMWA 1V3SA 3MR6A 4TVAB 4BWJA 4OYOA 3M9OB 4ED2A 2B6AB 2CPYA 1QDUB 4DSIA 4JV2A 3DLGB 1UVLA 4GVLA 1VQPS 1TMMA 2AZ3A 3FZBA 1CJTA 1IKWB 1QTNB 1U1RA 3P8BB 1EETA 1NDPA 4GO7X 3PRBA 2YNHA 3CJ0A 3NWGA 4YY3F 3EXCX 3UFCX 3W61A 3EICA 2OHDA 4RW9B 1H73A 4WKYA 2DHSA 2IC3B 4KGKA 3DU6A 3CCSS 2GVDB 1BWEA 4JUZA 1ZETA 2QEXS 5KG1A 1YLXA 4DR7F 4YUDA 2BBEA 2HKEA 4DU7A 4DBQA 3C3LA 4PWUA 2POKA 3IM9A 4K5SA 5E5NA 1LW0A 1SJFA 1VOMA 2W7OA 2VKZG 3WQPA 4DSJA 1S9EB 1IKVB 2EBEA 3SDEA 1N88A 3H8YA 1VK8A 2I6WA 4LBHA 2V4RA 1SUQB 2IA0A 4EBEA 4OZ2A 2ZEJA 1S0VA 4FF1A 2ILZA 4C0BA 5E33A 1S1UB 2JLEA 2RRNA 2IVYA 4YQWA 2RRAA 4FBTA 4ZJQA 1SKUB 3CJTA 3QPIA 4J37A 4F4KA 1R7IA 3VAGA 3EYZA 1HWIA 3FCWA 3QBCA 5LT5A 2I1RA 5RUBA 3RJMB 4DF8A 4QOTA 5KFJA 1KHWA 5EDWA 2MQLA 5DDOC 2VFSA 4FXDA 1F9FA 1Q5YA 4WFYA 2VG5B 4USTA 4YB6A 1RHRB 2XMJA 4PQAA 2LQ9A 1LKZA 4USWA 5L1IA 4OL8A 1YK9A 5K8PA 1T7PA 3T5KA 2Z2YB 3TQEA 2ASYA 3FJ2A 2DEIA 2Q3PA 2VL1A 4UTGA 1FJGF 5HBMA 3RRKA 2QE5A 2E7WA 2C3MA 2N7CA 3MPYA 2QYCA 3PKMA 4DX8H 3MPDA 2VA3A 1R31A 5J1EA 3GJQB 3KHGA 3DRSA 1RCXB 1DY3A 1RT6B 3KHHA 3JB9k 4DV2J 3AOBA 5IT9Y 2DY9A 3HFVA 3E51A 2C3YA 2CAJA 1ZAWA 3LPYA 4O4GB 1W7WA 2V2KA 1RE1B 2BDPA 2C28A 5CYJA 3L3CA 1IBMF 4IO9Q 3HHLB 1JX4A 4K5RA 3TP2A 1D1UA 3FBEA 3ITHB 4DL0C 4Y2AA 4LJMA 1EARA 1L3SA 4OX7A 2HNZA 1VQ9S 4ECYA 3GG1A 2VD3A 2BJ9A 4B9UA 2B9EA 1VBYA 2AYBA 2CJKA 3KLHB 5DO2A 2CXEA 3MM9B 3WX8A 2W4DA 2CQCA 5I42B 2IYGA 3B6BA 5HMWA 1L3TA 4B3MF 3B4DA 1C1CA 2BM0A 3CF5Q 4KKOB 5KFPA 2C2NA 4ZIWA 4K0KF 1HBMA 2K1RB 1VBXA 5HVFA 3L4BC 2DK2A 2YPYA 1WKKA 1VI7A 2EVZA 5CCMA 2C42A 1RBAA 2KHCA 3VQSA 1HNVB 2WSFC 5B0DA 3Q83A 7FDRA 3DHXA 1VJQA 3TZWA 4DUYJ 4MAKA 2BKOA 1SC6A 2EW9A 1TKZA 3C2PA 4JV5J 1IBKJ 3K5NA 2ZE2B 2HMIA 3MECA 4PR6A 2G0JA 3AFGA 2O1PA 1GQEA 5A76A 1CJUA 1TL4A 1BY9A 4ED5A 4DPXA 1PYTA 1I94J 2GX8A 1U1KA 2E44A 3ENVA 4I6AA 2L41A 3IMQJ 1T3NA 2XCAA 5DJBA 1VDHA 1WTFA 1UMJA 1UWBA 3K58A 2X51A 4KFBA 2MLZA 1NB7A 1JIHA 1NHKL 3PYDA 2B56A 3BM7A 3J7YI 4IRDA 3NS5A 4Q2LA 1W2IA 3J81U 2WW8A 4FZVA 1OMSA 3IA0A 4C8KA 5HP1A 2MKJA 2V69A 2R7WA 2LLZA 3RTVA 3VAIA 3ISNC 3MAQA 3H5XA 4B08A 4C8NA 5A8KB 2OUGA 4R8UB 3KDOA 3S1TA 4KGVB 2KO1A 2VQEF 5LXRA 1KS2A 4FVCA 2KRRA 4CLLA 4MYTA 3KYLA 1WEYA 2DVIA 4NCBA 4DSEA 1RBLA 2RKIA 4DL7A 2VBZA 1NJIT 4C97A 2QMUB 3EVOA 4A8KA 3SI8A 2FLOA 4OHXA 2RDJA 3TNVA 2B0GA 2LQBA 1CBKA 4AD6A 4EMDA 2KH9A 4F25A 4HI2A 4GKJJ 1REVB 1R43A 4J9NA 1WC1A 2M8HA 1WHXA 3C14A 1RYRA 4DR6J 4FF4A 3TYTA 4M5GA 4DZ6A 2CDQA 2EPIA 3KXDA 3A1YG 3T1AA 5D4PA 4RUAA 2F3JA 5A0YA 4J7CA 3E01B 1ZM4A 3HKWA 3VGSA 4YDXA 1HKAA 4H4OB 2BYCA 4DV1J 3JTOA 3HHLD 2ERRA 3K8WA 2Y1RI 4PQUA 2XO6A 1HIYA 1GNKA 5KFMA 2KXFA 1NKEA 3MM7A 5F3TA 5IOLA 3K0JA 4RNHA 1HWJA 2VODA 3MM8B 1HWUA 3NG8A 3BYRA 3IAM9 1DTQB 3KK1A 1I6JA 4NX9A 4CLUA 3JAMU 4DUZF 4NRUA 1RBOB 3CJRA 2KYXA 4NMLA 1RT2B 5DG9A 2J6TA 2IM3A 4NLYA 3HD1A 4CTAB 4W90B 2Z8QA 3K17A 1U0HA 4YOEA 2GIRA 2L08A 2XO7A 3P3DA 3DOMA 1VC5A 2HZAA 2OPPB 2PDAA 2JDJA 2HFVA 5F8NA 3UCUP 4LFCF 4FYDA 1MWYA 3KLIB 2ABYA 3UN2A 3WIUA 3BJYA 1FRMA 5C2CA 3MXHP 4IOBA 3EVMA 2JNJA 2NUUG 4NA1A 3MPUB 1NXIA 2BE2A 1RSCA 2XG8A 1PG5B 1XMOF 2DCLA 4E8UA 4G1IA 5FLXY 4DPTA 1YSJA 1T11A 4EK2A 2FVCA 4DL5A 3ILJA 1LQ9A 1FKPB 2ILYA 3UI3A 3CD0A 4X4UA 3NMAA 4B9TA 2GO8A 2DITA 4NLWA 3G86A 3ZTOA 2UP1A 2MLYA 1FERA 3LTOA 4DXLA 2FVQA 2ZH3A 4ELVA 4ZVHA 4RJVA 5LM7E 2YNIB 2J0WA 4DJBA 2E5LJ 3J81Y 2U2FA 3PO4A 4QYZJ 4K4TA 3ZZ0A 1NJXA 5MAOA 1GXTA 3TUZC 4Q7AA 1Z4UA 5T7LB 2HS0A 4GMKA 1WUUA 3GIRA 4PAAA 2KXNB 5BYQA 4RW8A 2KT2A 1R0AA 3GPAA 1VQKS 1UFLA 2GQ2A 3U02A 3L09A 3D1HA 4M5DA 5A8WB 1UPMB 3OL6A 1RU1A 3D6HB 4RW6B 1YG0A 1U8WA 2LFVA 1U2RA 2CNOB 2Y0BB 3MEDB 2BQUA 3GFZA 2OO4A 2Z2LA 2GAGC 2JVOA 3EGVA 1XEZA 2M4MA 2DO0A 4ZLNA 1TVRA 1P6TA 2RS2A 1PAUB 4ES3A 3TA2A 4C8YA 4P10A 3BGLA 2WK4A 3JXOA 4NXMJ 4CLPA 4A8YA 2NS1B 3DC2A 3NAHA 5HAOA 1T8EA 1H38A 3GFHA 1HD0A 5E7OB 2IAJA 1U1NA 1WEZA 4Q2MA 4Q43A 3H25A 1N52B 1DLOB 4WIQA 1CC7A 3CE8A 2CPDA 2XYHB 4LQ9A 2AT1B 2OEMA 3CDBA 2HNDB 2HS3A 1NPPA 3QZ8A 3US5A 2IIHA 2RIJA 3KG0A 3MEGA 3OBIA 3V6DA 4ECQA 1B99A 2BUNA 2MZSA 4UUXA 4JI2J 3HO1A 3UNGC 5DQIA 4L6V3 4KYZA 1PJ6A 2C2MB 3R2DJ 5KT4A 1P1LA 2Y3YA 5E41A 8RUCA 2MKCA 3C6UB 5GAHI 1YJVA 5HVGA 4F67A 4QU6A 1HI8A 2P9EA 4TQSA 3DGPB 2VZ9A 3JAMY 2XHCA 1LWXA 2X1AA 4IUFA 2YH1A 2P6TA 1U48A 5D4LA 4OZ1A 4DV2F 1AXQA 3M2UB 3SEOA 2WSEC 2LECA 1YBTA 2J0QD 2MQQA
chains in the Genus database with same CATH topology
2C3PA 1Q4RA 2R8IA 2E5JA 3TA0A 3D0HE 1UAWA 2F1FA 3MMAB 4YDDB 5C25B 2P5VA 3BGRA 3OR2B 2J8AA 4WFAQ 1SBRA 1TL5A 5L1LA 2VG6B 2JX2A 2L9WA 1XC9A 3DI6A 3SSRA 1XR5A 2BABA 5FD1A 3NNCA 2V5HG 3VCDA 2CFXA 2OKQA 5A8RB 2HHHF 3SCLE 4ZVFA 2JZ5A 2YKMB 1BGXT 3HX9A 1ZBTA 1FRKA 3K5PA 2FTRA 2UXCF 3AA9A 5HQ8A 1YIJS 1FXLA 3DOKA 1N32F 3BO3A 2HNZB 3KHLA 4EZ9A 5F3ZA 1FEEA 1SH3A 2OPQA 2P9GA 2P9CA 2NPIA 4RU9A 3B78A 2GGPA 2CPIA 2FGCA 2ZNZA 1ZTTA 4LF6F 1REVA 3B8HA 4LVOP 5E3RA 2ZJPQ 5EGYA 3L7PA 5KFFA 3M2VB 5E3QA 2CPZA 4YHHF 3QYYA 1XR7A 2AW0A 2DIVA 2LXFA 2AV5A 3E8OA 1QAJA 5LMNF 2XLKA 1YTYA 5F8GA 3DMJB 3QAEA 5HLFA 1WI6A 2ZH5A 3DOLB 4CZCA 4JI1F 1LWEB 2R8HA 4I4BA 3G8TA 4NLUA 2ASJA 1HWLA 3POTA 2MQNA 4KO0B 4Y28C 3VAJA 1RT7B 1TP7A 4O3OA 4JI5F 3TX8A 5KFTA 3ZC4A 1KLMA 4CH1A 5HROB 2M88A 2JEJA 4CCHA 1B7FA 5A6WA 3SXLA 3CCUS 2M0GB 3IO1A 1UVIA 2PD1A 3KNAA 2W9BB 3BN7A 1F5CA 2K7JA 4ITSA 1S77D 3E01A 2QMXA 1Y00A 3MMBA 1C4CA 3CCRS 2RQKA 2KZMA 4F2SA 4USIA 2YH0A 4H4OA 3WC0A 5KFNA 3HVRA 4ECWA 3LAMA 1NH8A 2XCPA 1Y4ZB 4PWDA 1SKSA 1H2VZ 3CJ5A 3VALA 1S0NA 4ZPAA 3KG1A 1V6HA 2CPJA 4I1TA 4ZHRA 3UD3P 2DBBA 2CVEA 1IJEB 4Y00A 3LALA 4ES1A 3V4IA 2F9JA 4ICLB 1OWXA 4FNIA 4B9LA 3FQLA 4WTYA 1WELA 3VZIA 3OUYA 1Y3JA 4EYHB 3KLEB 1U8SA 5GAEU 1VLYA 2VPYB 4ED3A 3H5SA 5F9LA 4KGMA 2NR0A 4MK9A 2B7CB 3AAWB 3GMGA 2AJ4A 4NZ7A 5DS7A 2HRUA 1Q8LA 3MM8A 2LVWA 2ZKUA 4JI0F 1FA0A 3SFUA 1N5YA 3QJJA 4OI1A 2MY8A 3M8RA 4RNMA 1DTQA 1YJTA 3N9UC 2JWNA 4F2RA 3HMJG 4M95A 1RTDA 3DDNA 3KLGB 3C6TA 2J6UA 1IKYB 4DUYF 2RH3A 5L39A 2ZJRQ 4OI4A 3G8SA 2HMIB 2YNFA 4DR3F 1N36F 2B4OA 2R7VA 5J2MA 3GYXB 4ECSA 2ZBIA 3FZ2A 4IOCQ 3H2UB 3M6WA 2DNHA 4JV5F 2WOMA 5LL6d 4QPXA 2AGQA 1IBKF 2ZZNA 4G1PA 1TQLA 3HJFA 3LGNA 2CQDA 2RU3A 3FQKA 1JLFA 2KG1A 2WTFA 2N3LA 1HMVB 2XMMA 1IQTA 1J2VA 2UZAA 5KG6A 1RDRA 1X4BA 1SH0A 2DRBA 4ZP9A 1B0TA 5IT0A 1RT2A 3MAHA 3TUJC 1JMTA 1MU2A 2KT5A 2L9NA 2PIIA 5THWA 2IM2A 4KV8B 3OTOF 3OJUA 1I94F 1QE1A 1WWHA 4CTAA 4H4MB 3RAXA 2YKNB 2J7KA 1VIXA 2FLLA 5D3GB 1HBUB 1FE4A 2ZHBA 2AQ4A 3HK2A 3CSKA 2W9CB 2ROPA 5KT6A 5CH7B 4ZCLA 1HFEL 2XC9A 5I3QA 2FJEB 3M32B 4WXOA 4ECZA 4Q45A 1H2TZ 4CH0S 2VUGA 2OD4A 3ENWA 3EGZA 2OPPA 4ZKAA 2V8GA 1NK7A 4K4ZA 4UY8T 4N47A 5DM7Q 1QAIA 4LMZA 3T5HA 1G1XA 4XAKA 2LYVA 2F7VA 4I68A 5B0EA 3K5MA 3RBEA 2NXUA 5HL7Q 3OJSA 1KRPA 2R7XA 4I69A 3BN4A 3OLBA 1NK9A 1X4FA 2WONB 3HVTA 5LSOA 1IR0A 2GHPA 3KLIA 4X4NA 3CDUA 2DGWA 3CJKB 1AW0A 1YITS 3CXCR 1RT4A 1S6QA 2DNZA 4Y2MA 4G3IA 1N48A 1IUJA 2VBYA 2FHMA 3SFGA 2PFFB 4YEAA 4C8LA 2DIUA 2ZJQQ 1BC6A 1G2EA 1P1TA 1U26A 1TFWA 2LA4A 3LOUA 4KJIA 3LP0A 2PMZD 4Y3CA 4H54A 3TARA 3UDLA 3CC7S 3CTRA 2KZZA 4I6WA 3PJXA 5IM0B 1GX6A 2UV8G 2UXDF 2O66A 4X2BA 2H9ZA 2KG0A 5I3UB 3H2VE 5AJ3F 4HEA9 1NZAA 2HPUA 2CG4A 3IN5A 4Y0FA 1S1XB 3GIJA 3GV7B 4IR9A 1TK0A 3I9ZA 1N5SA 3QWPA 2J9DE 4DFKA 4PG7A 2XMTA 3QAUA 2BJEA 4WCEQ 4RU2A 2A2DA 4OI3A 3M8PB 4U9RA 2LDYA 3KHRA 1UVKA 1U1QA 2RMLA 4I6YA 2MQPA 2GQQA 4N8OA 1TK8A 2E1MC 3GR1A 4DL3A 1FKPA 3ZZZA 1X0FA 2G9OA 3BF4A 3RAMA 4DR5F 2VPWB 4KTQA 1RAJA 1TAQA 2V8HA 3TAQA 3CCMS 1YVFA 3H98A 4DLGA 3W3SA 2IRUA 1NHVA 3AQOA 3CIMA 2ZM6F 3M05A 2HNYB 3HFKA 4ZK7M 1DJ0A 3Q2TC 4TY8B 4CT8A 2LKZA 4DR1F 1RT3A 5K8OA 1URRA 2Z2MA 4K2XA 2KI2A 1QAYA 3DNCA 2FJBB 1SH2A 3IS9B 3DRRA 3RYLA 3IC1A 2BM1A 4RWXA 5KG4A 3Q8SB 4DQQA 1XNRF 2OMLA 3G9CA 2VG7A 2HZCA 2QFJA 1PILA 4DR2F 2WSCC 1M1KT 1MMNA 1U49A 1OS5A 1S1TB 2KDOA 4IG0B 4AL6A 4DHVA 4JV1A 2RILA 4LSNB 1L5UA 1QUVA 1X4AA 4ED6A 1DBDA 2I8EA 3CCQS 1BLUA 2YNIA 3FSYA 1J5OA 1JLQA 1X8DA 4OI2A 4HYKA 2IVFB 4QR1A 4OZ5A 3MD3A 3DDKA 5C24A 2COLA 3SCJE 1S76D 4C7QA 1S0OA 2MXYA 3M30A 4QW9A 1SL2A 2VG5A 1XWLA 4LFBF 2AJFE 2BANA 4DG1A 4GKJF 3PVXA 5G0RB 1ZPVA 2ZDOA 3U1MA 2VFVA 1VQ5S 1OQ6A 4F3MA 3KOAA 2FJXA 3PO5A 5B7WA 4F50A 2XWXA 4GC6A 2E9ZA 3FSXA 2DNYA 1SV5A 3BSCA 1Y0HA 1E6VA 4NLDA 1ULRA 5T7LA 2RDIA 4R5PB 2EFQA 5H9EJ 2KN4A 5F8HA 1R8HA 2KB2A 1JXLA 4DR6F 3GILA 4RBTA 1CG2A 1RK8A 2DNKA 4LIWA 4XO0A 4A8SA 2B9XA 3BSOA 4KIAA 1QVFR 4LSLB 3CT9A 2SXLA 3PFEA 4I2PA 3OW2R 1D8ZA 5M2RA 4AYBD 2VV5A 3PR4A 4JI4F 3OSPA 4IDKB 1C0UB 3HPOA 3H5YA 2KRBA 1HPZB 2DO4A 4ZP7A 3NBPB 1S1WB 1S6UA 2VA2A 5CD4H 4N77A 4ZPDA 3HVWA 5T41A 5CYMB 3W2VB 3BDPA 4NLSA 1S49A 2B51A 4DV1F 1RKIA 3CJ3A 3MM6B 1HNIA 3DRPB 4FXVA 3KLFB 2V0NA 3KK2A 2FVPA 5GAHU 2ZH7A 2JC0A 5DLFA 3S8SA 2C2EA 2I38A 4B3SF 4B3TF 2O67A 4A8QA 3MPVA 1FKOB 4NOHA 5J2NA 2QZ8A 3HZEA 4RW6A 2CJAA 5B08A 1Q82T 3MM7B 3WX4A 5CQGA 4EO6A 1S9FA 4DSLA 1JLBA 2MZRA 3CO9A 2ZKTA 1KFDA 3MEDA 2RQMA 5F8IA 1N33F 1HR0F 2RS8A 4CO2A 4HI1A 3C66A 4DWIA 2XMVA 1IBLF 2OPSB 2HWIA 2XMKA 3PKYA 3KMSA 2D9PA 1PC4A 3BS9A 4TKTA 1IM4A 4B9NA 1SJQA 3TO8A 2R2UA 1XTZA 2K7KA 3EPIA 1FRJA 3TAMB 5KOXA 3MUVP 1G7CB 1UVMA 2DNQA 1H0HB 4B3OA 1HHSA 4USJC 4NWBA 1TKDA 4CNZA 4EBCA 1EETB 2W25A 4MYUA 2GW8A 5KFQA 4LQ3A 2JOQA 1LFWA 2F9DA 2YNHB 4WU2A 3QGHA 3THPA 1JLEA 3J80Y 2DGOA 1JJ4A 2IJNA 3TUIC 4NLGA 2OP5A 4C2MA 4C8ZA 4NLPA 4FPRA 4HVZA 3LW5C 3RR7A 1F0XA 3HKZD 3CC4S 2HG4A 2A1BA 1ZOTA 2OJ3A 1DRZA 3PXGa 2CRLA 1Y5LB 2ZD1B 1TV6A 4U7CA 2B7BB 4EEYA 1TKXA 2YKOA 1HI0P 4WZMA 3M9MB 3Q8PB 5D4OA 1LWCB 1JNZB 2MSTA 3UCZP 4OV1A 2BZ2A 2Y1IA 1D0EA 3MUTP 4NYZA 3DLJA 3NLCA 1DLOA 2W8LA 4WE1B 2EWHA 4C8MA 4E98A 3R5AA 5KFOA 2DNLA 3OFFA 4ZA1A 2XGPA 1M0SA 4OI6A 4O0IA 5LSRA 3PR5B 2JJ4D 4FF2A 2O01C 3GG0A 1LWFA 1FE0A 2HNDA 5K8NA 3V4MA 1MMLA 3DXSX 3SSQA 1VQ7S 4A48A 1JLAB 1KR4A 5DQHA 1GH8A 1FDDA 4WJBA 2QA1A 1LW0B 2XS2A 4C11B 1HBNA 1ELOA 4W92B 2KM8C 3NAIA 1FJCA 1FD8A 1M5HA 4LF5F 1HNZF 2GQCA 4IH7A 2PSZA 3SDEB 1C1BB 2CIMA 2MJNA 4RW7A 1QAXA 1D9AA 3IWNC 2UU9F 2LMIA 4HTJA 2ROGA 4DSFA 3UE2A 1TL3B 5EWGA 2R8GA 1LW2B 1BQMB 1XK8A 3T6JA 4ED0A 2K3KA 5KFEA 3O44A 1LK5A 3GIMA 1F5AA 2YWKA 3LP1A 1JLGB 1RT1A 2FHJD 1ZPWX 2JLFA 2FDNA 3K59A 3C6UA 4RW4B 1NKCA 3J7ZT 2AJ0A 1VFJA 2B5JA 1QUPA 3VF0B 2R8KA 3H20A 5I4MA 3Q0AA 2A2CA 2UUWA 3D1OA 2FVSA 5G4DA 4UQGA 5KT2A 3ICLA 3UDCA 3M1VB 4F3QA 5LSLA 3I56S 4OQJA 3DGPA 2QLXA 4BDPA 5IQQA 2I5JA 5L1KA 2UV8A 2M5YA 4Z37A 2W4PA 1RTIB 1H7XA 4IFVA 1NJYA 1O51A 1KOOA 4HTIA 3DLKB 2DGVA 2J76E 1JWWA 1ZH5A 3G71S 5KFUA 1W25A 2C3OA 3QIPB 3CMAS 3AA8A 2BVZA 3BZQA 5JJBA 2BOPA 2DPIA 5B0FA 5K9FA 5B0BA 3J7A1 1NO8A 1S6PB 5KFVA 4URSA 2NREA 2U1AA 1U1LA 1T03A 5KFCA 4NRTA 2ZITA 4P6QA 3M2UA 4UUWA 1YJWS 1C4AA 3ISZA 1X4CA 2MHNA 5L9XA 5KFYA 2CJ9A 1Q8IA 3NRBA 4QQBA 5F0UA 1TUVA 2ZH1A 4HDHA 5DM6Q 1B0VA 2LXIA 4F4WA 1VRUB 2L3MA 4AXIA 5F8MA 5DG8A 3M6XA 4A8WA 4X66F 3GYNA 4CO1A 2LXUA 5KFAA 4OZLA 1N0VC 3MMAA 2UVUA 5C25A 4QWAA 4PUOA 1FXDA 3OR2A 3N28A 2VG6A 4QU7A 3QGPA 1PO6A 1H7WA 4OHVA 3FFIB 4AXJA 4K59A 1SJ4P 3O6QA 2OLWA 2JEIA 2XULA 2PI4A 2MDAA 4J9MA 5A8RA 1SL1A 1U6ZA 2KU7A 2MKHA 4LF9F 1MW7A 4NLRA 2XLIA 1FNMA 2J7WA 2V4QA 4BS2A 1KOHA 2PGCA 1DFDA 5E0OA 2MHEA 4XPEA 4QPTA 2KFZA 2E5LF 4IG3B 1HW9A 5L8RC 3NCRA 5H1SV 2NLWA 1FEHA 3CIZA 3QLHB 4U6PA 1UVJA 4X4VA 1VQ6S 3M2VA 4G6VB 4YB1P 1KHVA 1X5SA 4FNHA 2GMJA 1X9WA 4LF8F 3EZUA 4BC9A 1NAQA 1U45A 4EFAC 1M5VC 2DGSA 4PXCA 5IT4A 3DMJA 5KOWA 3EPGA 1K8AT 1Z1ZA 2ZOMA 1IXKA 3V81B 3BR8A 3DOLA 5AXKA 4DV4F 1YBAA 1LWEA 3VTIA 4WYLA 2F8EX 4H4KC 5FDLB 3NGDA 4KO0A 4ZPCA 1RT7A 1SI9A 2UVVA 2GHWA 3QO9B 3NS6A 1CQMA 1DZ5A 1V3RA 2B4VA 5F0WA 5HROA 1KTQA 3N0VA 3PJWA 3BO2A 1VQNS 2XS5A 3BGUA 2W9BA 4YMEA 2WCXA 5J2QB 1FDAA 1VJWA 3T1HF 3BREA 3TW0A 1DTTB 2FHKA 3IRXB 5J1EB 4Q44A 3FDSA 4WFNQ 2E66A 3HHEA 4DQRA 3RB0A 1ZTWA 2EFOA 3KJVB 3DRSB 2A3JA 2EG1A 2DHXA 7FD1A 4ED7A 3I31A 5DDPC 3OXGA 1T05B 5KFWA 4MIBA 4X65F 2GFFA 3NNHA 4ECRA 1GAOA 2FC9A 4WK3A 3SV4A 2JL9A 2N4CA 1UA1A 5DDQC 2OPRB 1HYSB 4CQ1A 1FNOA 1YJUA 3MF5A 2KKHA 4L72B 4Y34A 2R8JA 4J9RA 2R2RA 3NMRA 2DGQA 1HL6A 1TFYA 3CUNA 3KLEA 1QLNA 3S7RA 2OAUA 4ED1A 2CQ0A 2KXHA 4PXBA 4OHZA 3MWBA 3R3TA 5FIIA 3NP5A 3K2YA 5F41A 3IG1B 5LJ3Y 4ELTA 1N54B 3ZZPA 3MEKA 2FJDB 2VKRA 4DLEA 4K4UA 2BXJA 4ILRA 2GJIA 2XSJB 2WB1D 3KLGA 4QYRA 5H9FJ 1IKYA 3DLEA 2YX1A 3DRXA 4ZOSA 2YKPA 2B43A 2R7QA 1ZM9A 4J9QA 4NXMF 1NHUA 1Q7YT 4NLXA 3FEYB 4QIFA 2VFTA 4LVNP 1RA6A 2MZJA 1XERA 2HVIA 1KQSR 1HMVA 3F73A 1RP5A 2OFHX 3IBWA 2ZHAA 2FHJA 4HLBA 3N01A 2J0XA 2VB6A