2G9OA

Solution structure of the apo form of the third metal-binding domain of atp7a protein (menkes disease protein)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
77
structure length
77
Chain Sequence
NDSTATFIIDGMHCKSCVSNIESTLSALQYVSSIVVSLENRSAIVVYNASSVTPESLRKAIEAVSPGLYRVSITSEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and intermolecular interactions of the third metal-binding domain of ATP7A, the Menkes disease protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Copper-transporting ATPase 1
total genus 17
structure length 77
sequence length 77
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2006-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2g9oA00
2HFOA 2HLTA 1Q8BA 1TUVA 1Y0HA 3HX9A 2OMOA 2GGPA 3LGNA 5T7LA 3TNVA 5B0CA 4HI1A 1Q4RA 1SQEA 1U7LA 3BM7A 2OP5A 2OD6A 2RILA 3DXSX 2K7JA 2HLUA 2GGPB 2GCFA 3MZIA 1OSDA 1TR0A 3IWXA 3T9NA 3UDCA 3KKFA 2FB0A 2AP6A 1R6YA 1SB6A 3BF4A 1CC7A 2XMVA 1FEEA 2ZDOA 2PD1A 2K7KA 2KKHA 2K2PA 5A6WA 2BJDA 2FTRA 1KVJA 1FESA 4OJ1A 2CRLA 2XMJA 2OFGX 3FGVA 3LGMA 2BUNA 5B0AA 1APSA 3CJKB 1AW0A 4A46A 3BN7A 2BJEA 2JDJA 3HDSA 2XMTA 2FIUA 2VH7A 2HFNA 5T7LB 1FVSA 1FE4A 2VV5A 1N5TA 1URRA 5F0UA 2GV1A 1CC8A 4F67A 1Q53A 1TZ0A 5B09A 2QIFA 2KYZA 2Q3PA 2BBEA 1VQYA 1Q8LA 1Y9OA 3E8OA 3I9ZA 2RMLA 4OJGA 1P8GA 2OD4A 1IUJA 3KG0A 2BYCA 1FD8A 4Y2MA 2KT3A 3BB5A 5F0WA 1YJTA 3HFKA 2K1RB 2W4PA 1VQSA 1TL4A 3BDEA 2XMKA 3HHLD 4Y2KA 3KG1A 2LXFA 5KAKA 1ULRA 2L3MA 2XMUA 4DL0C 2N4DA 4DN9A 5B0GA 4A4JA 3CJKA 2W4CA 1AFJA 1N5VA 3HHLC 4FNIA 3HHLA 3KNGA 1Y3KA 5IXUA 2N4CA 4Q2MA 1WD6A 2G9OA 3F44A 3QMQA 2HIQA 2LQBA 1RJJA 1TL5A 1S6UA 1FE0A 2OAUA 2AW0A 2N7YA 2IYGA 2GA7A 3LO3A 4Q2LA 4Y2IA 1KVIA 2GO8A 1LQ9A 2ROEA 2IFXA 1CPZA 3MCSA 1OQ3A 1K0VA 1YJVA 1KQKA 1GXUA 4ZA1A 5B0FA 4HL9A 2FHMA 1JWWA 4NPOA 3VTIA 1QUPA 1MWYA 3K7RA 2OFHX 1X0PA 2ZDPA 1OQ6A 3FRYA 2IYIA 2GFFA 2KT2A 2HQIA 4DPOA 4EFAC 2RU9A 2K1RA 2LQ9A 2W4DA 1SI9A 2ROPA 4YEAA 2AJ1A 3TRGA 1YJUA 4NL5A 2QLXA 4QOTA 2XMWA 4OJHA 1X7VA 4U9RA 1YG0A 1N5QA 2ACYA 1X8DA 1GXTA 2QLWA 3BGUA 1W2IA 3WDOA 1JK9B 1OPZA 1FVQA 1P6TA 2ASYA 2LDIA 3BR8A 4FNHA 4HH1A 4OJ3A 1N5SA 3HHLB 2ROGA 4YDXA 5B0BA 3TOQA 5A6PA 2OKQA 3HF5A 2RSQA 4ZOSA 1S6OA 2QYCA 1V3ZA 2EW9A 4HH0A 5B08A 5B0EA 3FMBA 3QGPA 1YRXA 2XMMA 1YJRA 1AFIA 2AJ0A 2PGCA 3DCAA 4OIXA 5B0DA 3IWLA 1XBWA 1MWZA 3GZ7A 4HI2A 1Y3JA 4A47A 4A48A 5K9FA
chains in the Genus database with same CATH superfamily
2HFOA 4KHMA 4JI7F 1U0SA 5B0CA 3DXBA 2ZVSA 5HK4A 2FY1A 4EBCA 1T03A 4Z37A 2E5LJ 3BGRB 3NBPB 1O0PA 1VRTB 3IN5A 3W2VB 2J5AA 3MZIA 3QSIA 3PVXA 1D3WA 1VC0A 1GMWD 3GLJA 1VQOS 2F8MA 4YB5A 1PC5A 2QEXS 2HK3A 5CYQA 3ELHA 3NS5A 4CRJA 1WI6A 3PJWA 1IWAA 2KFYA 3PACA 4ECVA 2KDOA 2UUBF 1RT4B 2YH1A 1D1UA 2XM3A 4ZDNA 2ZH4A 3B54A 4LF9F 2R7RA 4ZVUB 1UWAA 1WELA 2R7OA 4ERDA 1HBMB 5B0AA 3LGMA 3GE9A 3KLGB 3CJKB 1BWVA 1APSA 2RQMA 2GQCA 1S1TB 2H51B 5L1KA 3W5ZA 4EYHB 3D6TB 3TEGA 5IFMA 3RU0A 1TKZB 3AD9C 2VH7A 1PJ6A 2DO0A 4LRAA 2DR5A 1S97A 2YQ0A 4C8KA 2ZHBA 3SQGB 1KDNA 2VV5A 1G2EA 2VFRA 3Q86A 2BJ3A 1SPBP 1Q82T 5K8MA 1N6QA 4DF4A 2NUUG 4RNHA 2E1PA 3DOKA 2UVVA 2DNKA 2FD2A 3CJ4A 2D3O1 2YKAA 3KLVA 5HQ8A 2DY1A 1HNIA 3D3CJ 3M1VA 1IKXB 2W9CA 4P72A 2PO4A 4NASA 2ZOFA 2VU5A 3P4UB 4OJGA 5DG7A 3IGVA 3LTOA 5KT6A 3RZAA 2GZOA 1HNXJ 2J76E 1J5OB 3DDIA 1RAGB 4U8VA 1SQGA 2B0GA 2MKSA 5F41A 2OTLS 3HHLD 4MKYA 1FRXA 1F5AA 1L3KA 4H4KA 3CD0A 2L3MA 4DL0C 4RBVA 1VQ4S 1VC5A 4EEYA 4DR7F 4KFBB 1SVDA 4R0EA 1AFJA 3GFHA 3M32A 3DYAB 1XNRJ 3DLGA 2XS2A 2BE2B 3I96A 3OTCA 2ZVIA 1Q1KA 1SBRA 1NO8A 3CSKA 1S6UA 3QLHB 4FXDA 3ITHB 3NP5A 2OAUA 4Y2IA 2Z56B 3CVKA 4CWBA 1NPRA 1LQ9A 3OD2A 2BX6A 3R7NB 4GKJJ 2MY8A 3L95X 4ZITA 4P10A 1RU1A 3MCNA 5KG1A 3C16B 1HR0F 3HZEA 3PEHA 4LQ3A 4ZMMA 2YNFA 1QUPA 4YY3F 5GADU 1J5OA 2HMIA 4X2BA 2F4FA 2XHCA 4MIWA 1HI1A 1KD1T 2IDEA 1OWXA 4M8LA 4EFAC 5DQHA 2ATCB 1UPMB 3QGIA 3SFUA 3FBCA 3FQLA 2DGXA 2EKNA 4WE1B 4U7UK 4KHPJ 4B3SJ 4KSEB 1ROFA 3A1YG 1W25A 2M88A 1HFEL 2IM2A 3D1HA 2CPFA 3U7JA 5H1SV 2ZBPA 2AX0A 1OPZA 4MFBA 3BR8A 4DFKA 2IPOB 4YP3A 5KFXA 1HHQA 1PKUA 4I6YA 3DN9A 2QT7A 3M6XA 4OI3A 2IJRA 5F8NA 3EE3A 3MEDA 1D8YA 1HQ2A 3NAIA 1S9EB 1LV5A 1T94A 4CYUB 2XLJA 1I5OB 2V63A 2VPWB 2EW9A 3PX0A 1MSWD 4WKRA 4UUXA 3I5BA 3CWJA 1NSPA 3HJFA 3H2VE 1M5SA 3ZZYA 2CUYA 2YKPA 2X1GA 5ETPA 3MOJB 2Y0BB 3D6FB 3UVJA 2WK4A 4WTOB 2DH8A 2YXLA 5F8LA 2DB1A 1WHXA 3BSCA 3O6QA 1R3NA 3AQOA 5AE2A 5CA5A 5IT4A 1IXKA 1F9EB 3T41A 4XO0A 4DSEA 3QSYB 2C22A 3NMRA 2H1YA 2M0GB 2DKOB 1XEZA 4NYOA 3RBEA 4OHYA 1U1MA 2W24A 3DDNA 4ECWA 5BR8F 3OTBA 4B3MJ 1H6KX 1X4BA 1M5VC 4O3NA 1MLAA 3OLBA 3I56S 5IT9Y 2KU7A 4XIUA 2QO3A 2CQCA 4UQTA 4XDDA 3UDCA 4QU7A 1HNVA 1MMLA 5CAAA 5HQMA 2HHQA 5A2QU 5KFTA 4DQIA 4DSFA 1VIXA 4IG0B 1CC7A 2LXUA 4ZVFA 2HIYA 5HANA 4KV8B 1RBOB 2LVWA 4I2PA 3BDPA 3ISZA 5MAOA 1IKVB 4RZRA 3THTA 2F1FA 4EI2A 5L1LA 3PCOB 1VLOA 3Q8RB 3BQ1A 4CLTA 4IDKA 1A0OB 4C7QA 5HMWA 5DM6Q 5E41A 3EDRB 1P9YA 1NKBA 1ZBTA 4M5GA 1E6YA 4NYPA 2VF3A 4JI2J 3PM9A 3LP1B 3A8EA 1GQEA 1WKLA 2NUHA 3POTB 4CLLA 1N34F 2CQGA 4I7FB 4LBHA 4WU3A 1I1GA 3FCHA 4TU9A 4DV7J 2O66A 1IBMF 2WCXA 1JNZB 3IRXB 1WEXA 2HGNA 2J6TA 2R7VA 3VR1A 4QYZJ 2ASJA 2D3OR 3UO0A 2Q43A 4PKDB 3DOLB 3K5LA 3PW0A 1Q8LA 4NOHA 4RU9A 4C0OC 4AL7A 4WU2A 1UA0A 3TI0A 1S1TA 3CDBA 2DNNA 3G8SA 1QTMA 4R5PA 4ELUA 3QATA 1S57A 1NJZA 3GU0A 1PBUA 2R8JA 1S9GB 1D09B 1NK7A 2XMKA 2Y3YA 1E6VB 2JLGA 3HSZA 3BO3A 1KTVA 1ULRA 1RHMB 2FLOA 2H48B 1TVRB 3M6WA 4NLOA 4JI4J 1Y00A 3IG1B 1SJ3P 2HWHA 3KNGA 4DR4J 3ILJA 3CCLS 2ATLA 2XZDB 2AV5A 4NRUA 1FXRA 2B6AB 4DR1J 4KGMA 3MM6B 3KXDA 4DUTA 5A8WB 5DQIA 4QQBA 2H5JB 4ECXA 2GA7A 1T03B 3KJNB 4WE1A 1NDKA 2RKIA 4ZCLA 4KAIA 2Z2ZA 1RISA 2B8PA 3D3BJ 1KQKA 4R8UB 3MM7A 2W7AA 4FBTA 1NHKL 1HWKA 2M4MA 4MJKA 1H72C 1TK8A 1PYOB 5D0EA 1IVZA 1MROB 4HACB 5DM7Q 1RQ0A 2KT2A 3NRBA 1S1XA 4LF9J 1REVA 2LQJA 1KP6A 3VAKA 1Q0NA 4L73A 4IRDA 3M2UA 1TL7A 3UDEA 4IH5A 2BABA 1VQ9S 4QU6A 5A2QY 1I94F 1X8DA 4U8YA 3SQOP 4Z7CA 4ZIVA 3A3NB 4I2QA 4MIBA 1XC9A 3PO4A 2YNHA 4L75A 2XNRA 1KHWA 1RBAA 3BKTA 1N5SA 3DGVA 1SL0A 1M5KC 3HJVA 4O4GA 1EETB 2V9KA 3RBDA 1WG5A 2RSQA 4FXVA 1LWCA 4P73A 4P2SA 4DCOB 2P2CB 2HQFA 4WFXA 3TEHB 2VBWA 3PZPA 3FMBA 4OI0A 2HGLA 1WC6A 1SL2A 2XMMA 3DM2A 1FJGJ 4RW9B 3KK3B 3G6XA 1H7WA 1EETA 3I82A 5B0DA 1WNEA 1I51B 3HSGA 3SI8A 3I0SB 4X4NA 3EGNA 4B9TA 1UVIA 2UUAJ 2ZEJA 1JLQA 4WKYA 1QVFR 1Y0HA 3GJQB 2ZJRQ 3OR1B 4J9KA 2VG5B 4HKQA 4EGLA 4WCEQ 3K57A 4F4YA 1ELOA 1RWMB 2JHEA 2V8DA 2FVPA 1XQIA 3G6YA 4K4UA 4P75A 3ZTSA 4WK1A 4XAKA 4Y6IA 1IBLJ 3C46A 1FJCA 1RK8A 4OX8A 1R6YA 1RT7B 4RU2A 2R8GA 4ZPBA 3W7BA 4F0MA 3OVBA 3M7VA 1X4HA 5A6WA 3KOAA 1FESA 3QNWB 2C2KB 1VQMS 3SIPB 1L3SA 2MZ1A 3Q2TC 2GC8A 3PHEA 4NLPA 1WTBA 2XULA 4AFFA 4DUYJ 4X4UA 2XWXA 4LSNB 2YVSA 4WPAA 4K4VA 3GCXP 1U49A 3C8YA 3L9ZA 2AGOA 2G2OA 1IKYA 1TL3B 2YNIA 2Z4PA 3BKUA 2V4JA 3CCMS 3VQTA 1VK3A 4ZPAA 3NG8A 4C0BA 5F0UA 1T05B 2FJEB 3M8PA 1GH8A 2W8LA 1K0VA 5A0YA 3CXCR 3C19A 1JB0C 2KJWA 1DRZA 5F8JA 3KLGA 3GG0A 4MYUA 1TFYA 3C15B 2G0CA 2Q79A 3JB9k 2CPHA 4ZHRA 5C2CA 3E01A 2Y8YA 2E1CA 4LF7F 1YJTA 2JFDA 2W4PA 3K5PA 1N5YA 3EGZA 5GMEA 2CQ4A 3PKMA 2HURA 1NRKA 3M8SA 1HBUB 4DN9A 3MM7B 5B0GA 2FLPA 2NXJA 3CCZA 3N6LA 1BE4A 4WIIA 2VPYB 1HNIB 4QIVA 2GQ2A 3VAJA 2CPEA 4IOCQ 4ED7A 3F44A 3FDSA 2KT5A 3QMQA 4PABA 1HW9A 1JIHA 3ZZUA 2RS2A 1VI7A 2B6AA 1FDAA 2KXFA 3GV5B 2MTLA 2V5HG 2R8IA 5CYMB 1LOUA 1Y11A 4RR5A 3MMAB 4BCAA 3NWGA 2IVMA 4OYZA 4ZA1A 3W61A 3MEKA 3DLGB 1R8AA 3QT6A 1E6VA 1WDDA 4I2PB 3IS9B 1KLMB 1KN6A 2WW4A 2JJ4D 2JSXA 5GAGU 4JV2A 4DQRA 4OZ5A 3N5FA 4KJIA 1TQLA 5FIIA 1H2UX 4C0HA 1HNZJ 3ILOA 3LOUA 4JYAJ 1U0HA 3CULA 3NS7B 4KKOB 4FP9A 4DX6A 5ETVA 3Q8SB 3MTJA 4QOTA 3OFEA 3J7ZT 4F4AA 4J9UE 4C8NA 3G8TA 3BO4A 2BEFA 2CWKA 3E51A 4I7FA 5HSPA 1Q5YA 2ASYA 2DGVA 4CO5A 5KFKA 1HWUA 3O8WA 5G4DA 4UQGA 3L7UA 3BSOA 1YLXA 5KTQA 2EC0A 3ILLA 5GAEU 5IZHA 1X5OA 1WSVA 3KLHA 1RT5B 5JVHQ 1LW2B 2EBEA 2OKQA 3MECB 3GIMA 4KKOA 4JI5J 3J7AN 5E3CA 4U67Q 2L41A 4I69A 5KFDA 1QAXA 4G1QB 3SXLA 1TVRA 2QLBB 3S1TA 2VKRA 4OX9F 3QQCD 3V4IA 1K1SA 2V8PA 2FYXA 5C24B 4DR7J 2J6SA 2HBRB 1FRLA 3SDEB 5GMKa 3J7Z5 4C8LA 3MEDB 1IQZA 1SIZA 1JLFA 1ZTTA 3WX8A 1TV6A 2YQ3A 1HIYA 1Q7LB 1WF2A 4KH1B 4LIRA 4WFAQ 1FKAF 4G1IA 5DETA 1ZETA 3P49B 2OMOA 5DLGA 2RRAA 1NUEA 1EAYC 3CCWA 4PXEA 5HMZA 4LFBF 5HP1A 4RWXA 4ITSA 1UEKA 4NI2B 2OPPB 1X4DA 3Q8VA 4B3TF 1IKWB 5KFFA 3BH6B 3ZTRA 5FLXY 3MUMP 3KLIA 2F65A 2Y0SD 4DR3J 4X65J 5F9LA 1RT6A 1V5IB 2M52A 3OHBA 4AUKA 5GVQA 2JC1A 2DVIA 1DQAA 4OHVA 4NXMJ 3JAMY 1HNZF 4FPRA 3A8JA 3WC0A 3NL0A 4UOCA 5A8KB 4JI1F 3AFGA 3OFGA 3SCJE 3CIZA 3FMWA 2H4WB 3G82B 2UV8G 4DF8A 1HNVB 3O3LA 1RCXB 2EK1A 1TFWA 5FJ4A 2MDAA 4RNOA 2DNPA 4JUZA 3OR1A 4DU7A 4J9LA 3C6UA 3IAM9 4DV1J 3Q24A 2JLFA 3EZOA 2P5VA 1KONA 4Q0BB 4J90A 2FLLA 4QWBA 1HD0A 2GV1A 1H3DA 1CC8A 2R42A 5BYRA 5B09A 1XMBA 3DC2A 4NX9A 2E5LF 1AT1B 2E5HA 2VQEF 3LW5C 4TYAA 2M8DB 3MUTP 5ETTA 3VWSA 1HMVB 5AJ3J 2WSFC 2WAQD 3EM1A 3THVA 2YWGA 2AT1B 3CTRA 3UVJB 3KG0A 4ZN3A 2ZC4A 2XI2A 4RO0A 4DL4A 1T0TV 1YRTA 2E1RA 2YNFB 1UVNA 4HTJA 4ETZA 2HZVA 4DL3A 3V5RA 5D0RA 1XMOF 2QJ3A 3QWPA 2N4DA 1U6BA 1HA1A 2I0XA 5EUHA 4ID5B 4J5OA 3TUIC 1PO6A 1S9EA 4LFCJ 1S0VA 1IM6A 2H54B 4EYIB 2HVHA 1YI2S 1N6QB 1DURA 2HWTA 4P2MA 1LXNA 2H4YB 4TYBA 4A8FA 2ZKUA 2UUWA 1RAOA 3N9UC 4Y65A 4ZVRB 3G86A 2CVEA 4LT6A 3VAMA 3GV8B 1S0NA 5H9FK 1QTNB 3GR0A 1F2GA 4JV5F 2VB6A 1UFWA 3UD4P 1KWMA 1W26A 4LSLA 2HRTA 4HVZA 4QZVB 1HBMA 2YKNA 2GS8A 1OQ3A 1ICEB 1N54B 3OL7A 2RHSB 1RTHB 3BO2A 3QJJA 4IO1A 4PUOA 2O67A 2Z2YB 1VFJA 3LGHA 1A9NB 2NREA 4DDFA 3AA8A 2HRUA 2QYGA 2ZBQA 2PN6A 3TO8A 1U48A 4F8RA 3HHKA 5EWEA 2C3PA 3U1MA 2GFFA 4GVBB 3LQVA 1Q8KA 4N41A 1GFWB 2VFSA 3N4WA 5GAHU 1SI9A 2KRBA 4LMZA 1FRKA 3HVAA 1VRUB 3NBPA 1RTIB 1VBXA 4DPXA 1X7VA 2VASA 2VOPA 4IFYB 1GX5A 2F8EX 3FSYA 2PEBA 3AAWB 1CBKA 2QG9B 1VYAA 2LDIA 3JSMA 3UCGA 1YJWS 1JNRB 3PEJA 1TTHB 1TAQA 3KUEA 1TL1A 5H9EJ 3MPUB 4LF8J 4DUZJ 4ZJQA 2I2YA 1TL7B 2EVZA 3CJ5A 2QYCA 3M32B 1NNDA 4CT9A 2W1BA 5HVGA 5LSLA 1NSKL 1V3ZA 5AT1B 2OGUA 2C2ZB 2VFVA 3QIDA 4R5PB 1B7FA 1QD1A 2VC1A 4J7CA 3V4IB 3CC2S 3PRBA 4LFCF 1TELA 2D9PA 1FX4A 2FHKA 3DI6B 2AJ0A 2PGCA 4OYOA 2JNJA 2OUGA 2PEHA 3HCXA 2J0QD 4PQUB 1C4CA 1RT3A 3FC9A 3GZ7A 3BEGB 3G2XA 1XNQF 2OEJA 3B78A 4URQU 4DX8H 5BXIA 3EZ5A 3HX9A 3IBWA 3IR5B 2VQEJ 4N76A 1KQFB 1D8ZA 2X7IA 1LK7A 3HP6A 4UY85 3G71S 2MY7A 5E2QA 3IWNC 3VZIA 4YS2A 1MN7A 2K06A 4R25A 2DRBA 1BXNA 3R5JB 2ZBRA 3B6BA 4DFJA 3DOMA 4BWMA 1KC8T 2A1BA 2RF2B 4DR2F 3IS9A 2F40A 2J0XA 4ZLNA 3VAFA 4QW8A 1VBYA 2KKHA 2FTRA 4TKTA 1EQ0A 1FDDA 5KG5A 1S5ZA 2LEAA 2JLEA 1H74A 3A8IA 5AXKA 1ACMB 4NMXA 3TVYA 4K0KJ 3OJUA 2Y8WA 3L09A 1AB8A 3JSYA 1EKRA 5HO4A 4NWBA 4CNZA 1YITS 1U45A 5C2GA 2XO6A 5K20B 3IBFB 3GSDA 2GJIA 3NNAA 3CD5A 3D1OA 1FRIA 1RBLA 2GHVC 3ENAA 5D3GB 3ILIA 1XNQJ 1QUVA 2R7WA 2DNOA 3U1NA 4F67A 3ET6A 1UCNA 1S99A 4PQAA 3FFIA 1RHKB 4EWTA 1UPPA 3KMSA 4DV3J 4PWUA 1QSSA 1DHMA 2VA3A 3R5CA 4USVA 1GMUA 3I0RA 1ZM2A 3P6YC 4FYDA 2C2NA 2HBQB 1N0UA 3PG9A 4UOGA 4L74A 1Y5LB 2DIUA 1NMEB 2NLWA 4BS2A 1F1BB 5A0YB 4A8KA 2BDPA 3NXZA 1X9WA 2FVQA 4RJVA 4TY8A 4J91A 4DI6A 4F3QA 2DHGA 3UCUP 2LQBA 3EYZA 3PHTA 4KE5A 3JTNA 1FE0A 2GVZA 2IYGA 2DRDA 2POKA 3N6MA 2DNMA 3CDEA 2ROEA 2F7VA 3H5XA 3WIUA 1IBMJ 4E8UA 3BPSP 2Y1IA 4FZVA 5I42B 2HHTA 2AEMA 5KFLA 1X4GA 5L39A 1JKHA 5K14B 2OTJS 4HL9A 2MKCA 4NEYA 3W2WB 3MM8A 4USUA 2CG4A 2ZH5A 4YB1P 1IQTA 1VQ8S 5F8MA 4ED6A 2UUCJ 1ITPA 5D15A 3CJ3A 2JZ5A 2NZ4A 4RWWA 1S77D 1JLAA 2Z30B 3RUBL 1R8HA 3JSBA 3W2WA 3J7YI 2ZZTA 5L9XA 3HXMA 3CJQA 2CFXA 3KK1A 3M8YA 2C3MA 1F3VA 3FZ2A 5KG4A 2ZUAA 3ET6B 2C3YA 3CCQS 4DL2A 3SZ2A 2J6UA 3QT5A 1VJQA 1P6TA 2QTWA 3GYXB 2BA9A 5B7WA 3EGWB 5KFHA 3M8WA 4Q0BA 3MAQA 2B9YA 4B3RF 2E7VA 2KTQA 4F3MA 3MEEB 3CE8A 1FJGF 1WTFA 4FF3A 4C48A 1G6BA 4LR9A 1TUWA 2DR9A 2DGQA 2RIJA 4DZDA 3O44A 5F3TA 1G7CB 3FJ2A 4F7VA 5H9EK 3EVMA 2XLKA 2R7SA 1OS5A 1JLAB 3C14A 2QSFA 1S7HA 1YRXA 3I31A 5C5JA 3BJYA 2KHDA 2J9DE 1JJ2R 2DXDA 1WC5A 4CO4A 1YJNS 4OIXA 1C0TB 1FFSB 3IWLA 3HPOA 5DDOC 1N48A 1SL1A 4DQQA 2V94A 4LF6J 1M5HA 1N33F 2P6SA 2PT0A 5K8NA 1RAAB 1T9UA 4A48A 2B9XA 4Q44A 4DV1F 5I42A 3ITHA 1VCTA 4LUBA 1FDBA 3DU6A 3EUNA 3TA2A 4DU8A 2V50A 4IG3A 1KNZA 2CQ3A 3AH6A 2M70A 4TLRA 2DGOA 3LUYA 3CJKA 2XMAA 3V81B 5KFQA 2I9SA 2ZJPQ 3ENVA 5IV3A 2M7SA 2DCUB 1R0CB 2IVYA 6AT1B 4J9PA 1ZZFA 3TAPA 4PQUA 3GONA 2VDIA 3FEZA 5HBMB 1KQGB 2CJXB 1JQGA 2F9DA 2Y1JA 4OZ2A 1CS4A 3O5TB 5FDLB 3GR1A 2J8SA 1VHIA 2Q6CA 3IAS9 1C4AA 4USIA 2AIRB 1R43A 4I6AA 4IYQA 3W62A 5HQLA 1U1PA 4ZPWR 1K9MT 3PYEA 3W65A 1KBRA 2YTCA 1Y5NB 4PR6A 4IOAQ 4H4OB 3CJSA 3ETOA 4MT1A 4A46A 3BN7A 5C25B 2AJFE 4ANEA 2JDJA 3HDSA 3Q8PB 3KLFB 3GSIA 1FVSA 3PW2A 1AZSA 3C2PA 1FX2A 3GYGA 5AXLA 4QIWD 1R8PA 2GAGC 3IO1A 2O3DA 1WC1A 3M8QB 4WFNQ 1CQMA 3TAQA 1WG4A 2KRRA 3POTA 1Q7YT 4CTAA 4BDPA 4H4OA 4NXNJ 3R7BB 2YWHA 3E8OA 4QR1A 1NKEA 1WOOA 2DR6A 1YWXA 4OX9J 2OPRA 1H73A 1QAYA 2I6WA 3JYTB 1DJ0A 4O3QA 2NYHA 3MPYA 2C2RA 2BJ1A 1KLMA 2DNLA 2WONA 3CMQA 3VZHA 4A4JA 2RUSA 3HKZD 5C42B 5THWA 5J2PB 2MHEA 4ECRA 4DFMA 3HHLA 2VBYA 3T9ZA 1RA7A 1QSYA 1Y7PA 1FFWB 3ADAC 3QWUA 4W90B 3TWZA 4P52A 4USJC 2IHR1 4KO0A 4F0HA 4M95A 3BGOP 2AYBA 3KK1B 3T3FA 1U1QA 2WB4A 2XNQA 4MTPA 3L4BC 2QSWA 4P6QA 2JRSA 2OPQB 1HQEB 1FERA 2HFUA 4RW7A 4C98A 2CDQA 5E3AA 5DG8A 4DR6J 2D3UA 5U47A 2CA9A 2XSJA 4S0MA 3VTIA 4C8YA 1UVMA 3W66A 2XB2D 2GHPA 2BZ2A 2CG8A 2EFVA 1HLWA 3CUNA 2K1RA 2EWHA 4FDFA 2FZGB 2GJFA 1BC6A 2DO4A 4TY9A 2FJDB 1UEVA 2KZMA 1YTYA 1XTZA 4N7TA 5E3PA 4PXBA 5BR8J 3PYDA 4YHHJ 3DLBA 4B3MF 2ACYA 1WF0A 4CTAB 3UR3C 1JK9B 4CI0B 1UJ5A 4O23A 1RHJB 3P8BB 3AB2B 2AZ3A 2KH9A 3VF0B 1UA1A 1S1UA 2WVCA 3QJLA 4YDXA 5DQGA 1RHQB 2ABYA 3FSXA 2RJZA 1TL3A 2AQ4A 2BJ7A 3AJDA 3LWLA 3PIPQ 5ETOA 4LRBA 1AYEA 2PMWA 3CO9A 3DLKB 3OHAA 4M5LA 4K8RA 3MR5A 4WZMA 2COLA 3GFZA 1RYRA 4LSNA 1NDLA 2GAHC 3ICLA 5CQGA 5I3UB 2KJVA 3ENWA 3DLKA 4B9SA 3H0PA 1Q86T 2XY5A 1AFIA 1CJUB 2WVEA 2JL9A 3B4MA 3GWCA 1VLYA 2VL1A 5DJBA 4F04B 1NK4A 2GVDA 1V3RA 3WIVA 5LMUF 1UJ4A 3D0HE 4DR3F 4ZLPA 1S79A 2YKNB 1TUVA 4NLSA 4U96A 2GGPA 3H25A 4RUHA 3J81U 5AXMA 5DDPC 5KOWA 4HYKA 2UVWA 1RT1A 3HFZB 4DZ6A 4DV4F 4LSZB 5KFVA 3K8WA 3LALA 1TR0A 1GMVA 2R2RA 2DEIA 3EZUA 4ECTA 1FKPB 1VIOA 1S72S 1Q16B 4AXJA 1XIQA 4I0WA 1VBZA 1P1LA 3BF4A 4OFZA 4P7VA 4CH7A 3TQEA 5HJYA 5F8HA 1FEEA 2ZDOA 3K59A 1FK9B 3FSIA 4IQMA 2HRYA 1OY8A 3UWTA 1V9OA 2HNYB 2CJKA 4BHQA 1KVJA 4USTA 4DSIA 1FK9A 4C3MA 2DGWA 3KYLA 2CRLA 2XMJA 2R2SA 4F3OA 1TKTB 1UZHA 5SZTA 1HNWF 2E9RX 2HHSA 1LW2A 1WJ9A 3PJXA 3MMBA 4LREA 3PX4A 2RKIB 3A3PB 4O44B 1O5JA 1JXEA 4G65A 5T7LB 5K8PA 4KGKA 4DLEA 4KGVB 4Q7AA 5DLFA 5LMUJ 2D3ZA 3IA0A 1XR6A 4ED3A 3G6ES 2IJFA 2NZCA 5IWAJ 2FVSA 2HQCA 4V19J 1WG1A 4F25A 2DPJA 4OL8A 2AYGA 3PW4A 4OQJA 4KC5A 5AE1A 1F0XA 1SV5B 2BANB 2W8KA 5KG7A 1Y9OA 3CEDA 1JLFB 5IQQA 1D0EA 3OSPA 3TJAA 3D68A 5HATA 4LF4J 1LKZA 5J2NA 4LF5F 1SXLA 3RB6A 2RF2A 3BDEA 2IAJA 2AD9A 3KG1A 2LXFA 3O1LA 1U1OA 2OJ3A 4DR6F 1LWXA 1AA1B 2APOA 5E3QA 3M8QA 5D4LA 1YKWA 4JI0F 1XMQF 2XY6A 1S1VA 2VPZB 2N4CA 3DOLA 3ZZOA 4B17A 3Q22A 1WD6A 4F4ZA 2ZD1B 1AZSB 3P5BP 3SQGA 3TR5A 3V4MA 3K17A 4DPUA 4IFYA 7FDRA 1FNXH 2AW0A 2NCKL 3HMJG 2ZH2A 3US5A 2AGPA 1CPZA 4OI2A 3MCSA 3RRHA 3LP1A 1RT3B 2VFUA 5AE3A 2WRMA 1G4CA 2PA3A 4ZP8A 2R2UA 4HT7A 4X66F 3LWMA 1NJIT 2M9KA 4B3SF 2UV8A 5FDLA 1JWWA 2GMJA 1MWYA 2B5JA 1HQUB 3QO9A 3VVUA 1BQMA 3MI7X 2IBOA 2VIHA 3FRZA 3AT1B 4Z2XA 1OPIA 2B9WA 5IT9U 2CADA 3I0RB 2FUG9 4LF5J 1SKWA 2F9JA 4NL5A 4YY3J 1DTTB 3ZXWA 4LF7J 2EK6A 4G1QA 3QRPA 4IG3B 3Q23A 1FRMA 2QLWA 4MIAA 2KFNA 1WORA 2GIRA 2WVFA 2RRBA 2YWEA 4M5JA 4ZVQB 4UOHA 5J1NA 2WSCC 2DGTA 3VV2B 4L6V3 5D4NA 3R9LA 3UPFA 2GO9A 4WZQA 4DEZA 1HBNA 4CDIA 3TOQA 5B0BA 1ZYQA 1C1CA 3ZZZA 3Q8QB 2IAJB 4CLPA 4QR2A 4DMZA 2WONB 4L3NA 4GVBA 3RRKA 4RW4A 4X84A 3RB0A 4EZ6A 3F0NA 1MWQA 1N32J 1BQMB 2QLJB 2HAFA 4F50A 3RB4A 1U4BA 3EMTA 2CQ1A 4DUZF 2CAJA 5I3QA 4TQSA 4G3IA 3IC1A 2VG6A 1IM4A 2OSRA 4CYUA 1FDNA 2IA0A 2Q1LA 2U1AA 3EDQB 4LSLB 4RLEA 5DDQC 3MR3A 4DV7F 2YPYA 4PG7A 3B4DA 1CVJA 4FF4A 4DPYA 1TL1B 1KQSR 1IBLF 1F3FA 3C6UB 3THPA 4DPWA 2JOQA 4HI1A 4I67A 4OZ1A 1JLQB 1Q4RA 2OIHA 1OYEA 3ZZTA 3BZQA 2OD6A 2RILA 1DTQB 4WK3A 2W9AA 4CNYA 1F9FA 2QV6A 4OYMA 1C0TA 1EB0A 1NHUA 3ISND 4TQRA 4C11A 3K0JA 1KHVA 2XMVA 2P9EA 4LF2A 3RBXA 2ADBA 5D0GA 4L76A 4IRCA 3H4BA 3HVRA 4AE5A 1CLFA 3CT9A 3ZNUA 4LRFA 1FT8A 5LL6d 5EGYA 2M2BA 4DR5J 2BUNA 3UN2A 3X1LB 1WWHA 1HPZB 2GQQA 2OEKA 4ICLB 3F41A 4ANDA 4AL6A 3DRRA 1LFWA 2HFNA 2QC3A 1IR0A 2RT3A 4Q43A 3TUPA 3Q89A 2CJ9A 4XK8C 3SEOA 4BLGA 1N5TA 2B8QA 4OX6A 4V1Ak 3PR5B 3H40A 4N8NA 3N5BA 4Y2CA 5HI7A 2F63A 1L3UA 5KFSA 2YX4A 2QIFA 3VGVA 2CJAA 4C6AA 1H7XA 2AKWB 4TXSA 3CNQP 2DH9A 2IC3A 3UFCX 5CZXA 1VOMA 2ZJQQ 3MXHP 2MKYA 2BYCA 4K2JA 4OI4A 4CIOA 4IKAA 5F0WA 2RDDA 2I1RA 3HI9A 1K47A 2ZZNA 3MM8B 2IC3B 2R7TA 2DNZA 4WP8A 1DY3A 4IR1A 3W60A 1OIAA 2C2DA 2R9LA 2MLZA 4ILRA 4LF1A 1WACA 1VRQC 3OL9A 2KXNB 3LH2S 4DSKA 5ETMA 4X4QA 1P27B 2D74B 4LBPA 2V4QA 3DFEA 4ECQA 2BKOA 2FZCB 2ZE2B 3OBIA 4QYRA 1Q79A 3H98A 2HHHJ 1UETA 1OJ4A 4ZCMA 3G6VA 3FEYB 1XMQJ 1TKXB 4HTIA 3QT8A 1PIEA 2HSEB 2HPUA 1U02A 1TKZA 1U2FA 2V2ZA 3AB4B 3GJTB 2NS1B 4O3OA 1P9QC 2H3EB 1B7YB 3ZTQA 3J81Y 4B9UA 1SJ1A 4YB6A 2DTJA 4F2SA 1NZ8A 1REVB 2YY3A 1ZM9A 3EPIA 1JLGB 1S9GA 4RW6A 1JLEB 1NH8A 2Z57B 4X65F 4IR9A 4CLZA 2MMYA 4PXDA 1RT4A 3MR6A 1FD2A 2ZZMA 1G3OA 1SIWB 4URGA 4ED5A 4A8SA 2LQ9A 1CSJA 2B56A 2W4DA 3MFHA 3D67A 2MJNA 1Y5IB 3D54A 2MXYA 2RQCA 2XSFA 2PMZD 3RW7A 4DV6F 4UW2A 2I5JB 1N5QA 2M8HA 3BGUA 2J9EA 4P7TA 4ZLLA 4GKKJ 1YHQS 1VRTA 4F4XA 2A3JA 4DHVA 1FVQA 1RI7A 1RABB 2RD5C 2YNGB 3G9CA 1XNRF 1LWEA 3EICA 3HHLB 4O3SA 2J7WA 1U6FA 3H5SA 3N01A 1EKSA 2DNRA 4QPTA 2W7OA 5D4OA 5CCLA 3HF5A 4KGXB 3T6BA 3M6UA 1U0HB 1Z2ZA 2DEJA 2Z2LA 4GMKA 3EX7B 1HBOB 4ZVOB 2KG0A 4XDCA 4PRFA 4GC7A 4WF9Q 4ZN1A 3RR7A 2EFNA 2IRUA 4C9DA 1WUUA 3UD3P 4DV3F 3LPYA 2LQ8A 3T1HF 1RAHB 2VJUA 1IJEB 3WQPA 1U1LA 4NLWA 1T8EA 4QCLA 5KT2A 1RA6A 3M9MB 3EXYA 4JI5F 2VOOA 2FQQB 1X60A 1UMJA 2W2QP 2ZNZA 3CDUA 1EHWA 3JTPA 2ZH8A 3DLHA 1R89A 5G0RB 3UCZP 3GYNA 4M5KA 3OT9A 3IR6B 3MECA 4HI2A 4OYIA 4YQWA 2XZTB 2UVRA 5E33A 2YNIB 4DN0A 2DIVA 2QL5B 1LWEB 1NM2A 4IH7A 2CNNB 4KR0B 9ATCB 3BN4A 1FFGB 3CCRS 2MGZB 4NXNF 2K3IA 1FXLA 2VZ9A 2K7JA 2XY7A 1X5PA 1OSDA 4ES1A 1PCAA 1K1QA 3EVWA 3BYPA 1U8WA 4H4MA 4UOFA 3OSNA 2A18A 1HI0P 3OTDA 1T3NA 3PR4A 3W9JA 2J9CA 4CO0A 2B5JB 4KYZA 2PD1A 2FVRA 3H5UA 2K2PA 1RHRB 2A0FB 4U6PA 4KV8A 5CH7B 2ZOMA 3DGPA 4E98A 3R6LB 4WFBQ 4JI6J 1NSQA 3D4JA 2MJUA 1KSPA 2ZHOA 3DRSB 1U2CA 1Y4ZB 2BRKA 4RPFA 3BPDA 4ED2A 2BJ8A 4OI6A 3CCSS 2P9CA 3DLEA 4RUCA 4FPIA 1DQ8A 2CQ2A 4MFBB 4Q8EA 4IQXA 2YKOA 1BQXA 3M30B 3SCLE 4M5NA 2OEMA 4O3PA 3WX4A 1U26A 3CO0P 4ID5A 4V19X 1HWLA 2Q3PA 1WHWA 1MMNA 3ZTOA 2HKEA 2HFSA 2LEPA 3MPDA 4KH0B 1RWKB 4A8OA 1X0FA 2JEGA 1WOPA 1U1NA 2BACA 1S6QA 3MAAB 2KM8B 1QLNA 1JJHA 1N4LA 3V6DB 3U1LA 1VQ7S 2FGOA 4OZJA 5LJ5Y 3TAMB 3TZYA 1RT7A 3E01B 1SV5A 5BJRA 3I9V9 5HL7Q 5ETLA 1RTHA 3GTYX 1DARA 3CCTA 4IH6A 2XYPB 2JFKA 3TX0A 1N5VA 3TUJC 3W64A 1SKUB 2NR0A 5D78A 2CXEA 1JLCA 2XBPA 1SH2A 2HIQA 3DDKA 4DG1B 4DCPB 3QZ7A 8AT1B 4I4BA 3W8PA 1M90T 3T5HA 5D4PA 7AT1B 1RTDA 3LO3A 1MN9A 1KFSA 2N82B 4DUYF 2BM1A 4QWCA 3S7RA 1RTIA 1GXUA 5B0FA 3VGSA 1QE1B 4FYVB 1PSDA 2W7PA 3C14B 1U25A 2KB2A 2P8IA 3K7RA 2AEJA 4DWIA 1UFKA 1OQ6A 2HEKA 3ETMA 1JKHB 3HVTA 5K14A 3OXFA 2HQIA 3SCKE 4K4ZA 1FKPA 4W4MA 3T6JA 5LJ3Y 2DITA 2V4RA 4YEAA 2AJ1A 1EARA 4P2FA 1R8BA 2KI2A 2CPIA 2G13A 2NSCA 4EU0A 3CW2C 2L9WA 1ZAWA 1H2VZ 3V6JA 3T1YJ 4HHJA 5A8WA 2QL9B 1S1WA 1M0SA 2X1AA 3H7HB 2FGCA 1HHTP 1DBDA 5D8HB 2X3DA 2QN6B 4U7CA 3OL8A 3QFWA 4K4YA 1U8SA 2ROGA 2HBZB 1UFLA 1O51A 1C2PA 3R5DA 4DV0J 4DS5A 1GK8A 2KZZA 2WW8A 1Q81T 1P1TA 3NGKA 3KHGA 2XTJP 3CJ0A 2PFFB 1RUSA 1S1XB 4KB7A 4ZPTR 1YGYA 1QAIA 1MROA 4HACA 5B0EA 1HW8A 3KUGA 4USHA 1S9FA 1TUGB 2EFGA 3M9NB 5KFEA 2FHOB 2V68A 3VVTA 4FF2A 1YBUA 2HVDA 4TVAB 1XR7A 4GO5X 1B0PA 3KLHB 2LEBA 1F60B 4LR8A 1EP4B 3GG1A 3P5TL 1S0OA 1XERA 3NCRA 4ELVA 3CIMA 1QY7A 2AMCB 1M1KT 2OPQA 4A8WA 3GB0A 1I94J 1J5EJ 2WBMA 2MQNA 3R2DJ 3LGNA 4M5DB 3GIIA 4B3OB 1S10A 2DRAA 1SQEA 2FHJD 2FJVA 3GFXA 4HT5A 1JJCB 1NEEA 3DXSX 2VG5A 3CMAS 2GCFA 1SJFA 3MM9B 2AZ1A 4E2FB 4NCBA 4NXMF 4LQ9A 2BE2A 3TVZA 4NE9C 2H5IB 2OHDA 3L7OA 1EQMA 1RWXB 4ILLA 5A8KA 4WFZA 1HWJA 5C24A 3KK3A 3BQ0A 3FBBA 3ZO7A 3DOMB 3NOCA 4MK8A 4RW9A 3NNCA 4NLDA 1T9TA 3MOZA 1RHUB 2LA4A 1YVFA 2F5GA 2OFGX 2WSEC 3AJ1A 2MB0B 3J7A1 1AW0A 2IM3A 4MKAA 3CCVS 2CNLB 2CQHA 3IRWP 4A8QA 4DSLA 2ZH7A 2IMOA 2CJYB 4JB8B 2V2VA 2NPFA 3JQMA 1I3OB 4LF8F 1EIYB 2JC0A 2YWFA 1HNWJ 2J0SD 1ZA1B 2DBBA 3BBFA 5C42A 5J2PA 1S6PA 4JOUA 4TN2A 3OQ2A 3I9ZA 2UUCF 1UWBB 2E66A 2KL8A 3DRSA 4ZIWA 2FJAB 5GAEI 4J9SA 1HYSA 1M1GA 3BR9A 3HFKA 4DV5F 1HKAA 2BM0A 4AQYJ 2C42A 2X1FA 5K5MA 5SUHA 2BW7A 4M5IA 1HQUA 1Q95G 1VHFA 2MLYA 2W4CA 4CH1A 2QZ8A 4PG4A 3TUZC 2FLNA 2UU9F 2WVDA 3TANA 4K2XA 5HMYA 4H4MB 3MUVP 5JVGQ 3R27A 4YR2A 3K8VA 5EX3A 1RJJA 2P6TA 4UZCA 1X9MA 4JI2F 1KVIA 2MGZA 4CQ1A 2VG7A 1N36J 2V69A 1NCLA 2WOMB 1FRJA 3NGTA 6FDRA 4JYAF 3KFWX 1RXOB 2ZUGA 4NA1A 2BKNA 4UF4A 5JMNA 3EPGA 1YJVA 1ZPVA 1C0UA 1SH3A 5I4MA 1K73T 2DNHA 2FPHX 4OLPA 1NDPA 1TKTA 3SMZA 4LVOP 3UI3A 2MPUA 4F4WA 1TKDA 3VGUA 4NA2A 4J9RA 2W9CB 1IN0A 1QE1A 2NXUA 1U24A 2IYIA 3FRYA 4PZVA 1DLOB 1U09A 5A8RA 4PUOB 4RNNA 1B70B 2UVUA 3KLEB 1X31C 1GTEA 4JI3J 2GNKA 3QIPB 1AXQA 2LXIA 3UR0A 1RTDB 3DRXA 1S0MA 1VQ6S 4EO8A 1N52B 2BANA 1X5TA 2IDLA 4YMEA 1RT1B 3PYGA 5M2PA 4DCJB 3GMGA 3MHYA 5L9NA 4ZVSB 3IM9A 3IRXA 4EUVA 1WDTA 5KFCA 2MQOA 2IVFB 2ZE2A 2RH3A 3TX8A 2QFJA 3A12A 1NH7A 2U2FA 4QWEA 2HFZA 5LMNF 3R5BA 4K4WA 2K3KA 3OL6A 3TAMA 4CM2A 1AUDA 4QYZK 3UDLA 2IM0A 1UTAA 3A4TA 3T5KA 2JEFA 1NHVA 2DGUA 1RT2A 3MFIA 2LQ5A 1HD1A 3HVTB 3MF5A 3R3TA 3KK2B 2YWWA 1WOSA 4BBYA 2Y1LB 1S76D 1R8CA 2YQ1A 1RWOB 4H54A 1RADB 1YJRA 3RBZA 3ZZPA 5CD4A 1HL6A 1N5YB 1KOHA 3RRGA 4N8OA 3RG6A 3OPKA 3EJMA 1L5UA 4E0DA 2DHXA 2VFTA 2UP1A 3DOKB 4R0JA 3M2VA 1ZZNA 1YIJS 2E5JA 2F4VF 4NCAA 1T9YA 3LAMA 4DOZA 4ES3A 3M8PB 2MSSA 4P2XA 2O01C 3BBCA 4I64A 4DG1A 4N56A 3RW6A 4KHPF 4OYBA 2EPIA 8RUCA 4I1TA 3PV8A 2GX8A 1MW7A 3K2YA 4M5DA 2AJ2A 1Q8IA 2GGPB 5FD1A 4B9LA 4ZJOA 1XK8A 5CYJA 4AQYF 2FB0A 5D0HA 3NCPA 1D9FA 2JEJA 4ZLJA 1X5SA 4PWDB 2OPSA 3EGVA 4USMA 1UW4A 2ZH1A 3MD1A 1RDRA 4Q5VA 3H8YA 3GILA 4NLUA 1K0TA 1Q78A 2EKYA 4UY8T 1FXDA 4M63A 1IBCB 3FBEA 3WZ0A 2GMHA 2L9NA 3M1VB 2MQQA 3KHLA 4C8ZA 1C1CB 3R7SB 4DV2F 3D28A 1VISA 3SSSA 1SQFA 3D6HB 1KVKA 1KLNA 5IM0B 2VHGA 2W2OP 1H38A 2OSQA 1QDUB 4JI8F 3QLHA 4CLUA 2XS7A 5LXYA 4LR7A 1VJWA 2VUGA 5F8IA 1NPPA 4C8MA 1RE1B 1J5EF 5KFBA 8ATCB 3BV8A 1GTHA 1TP7A 2D41A 4X4PA 5KT5A 3QPIA 3HO1A 4ECYA 1T9WA 1IUJA 2GIQA 1WI8A 4RNFA 3OVSA 1KS2A 1REGX 3UN5A 3QO9B 4NZ6A 1UWBA 3L7PA 1LXJA 3D5MA 4J9VA 4HEA9 4ZVGA 3VAIA 1RU2A 5F8GA 3JTOA 2CPJA 2I8EA 4B9NA 2R7QA 4GO7X 4F36A 2R8HA 5IV4A 2PDAA 1N8RT 3HSDA 3CGIA 2UUBJ 3MMJA 5DGAA 2DH7A 3HT0A 4F0KA 1HBNB 3GQCA 4YN3B 2ALYB 4HHHA 4I56A 4ZVTB 3QRQA 2ZD1A 1S49A 1QAJA 1UW9A 1YSJA 1F5BA 3AHPA 3DLEB 5AXNA 5G0RA 3IBCB 3VGTA 1S7IA 4A8YA 3A3OB 3MGJA 4BWJA 1JLCB 5EDWA 2MKHA 1RWWB 4Y28C 4KHRA 3VALA 3T1YF 5CXTA 3CMES 4F2RA 2RDJA 2Q66A 4NPOA 1FWPA 1SUQA 2LECA 4QIGA 3DHXA 5DG9A 1RYSA 5L38A 4DR5F 4KTQA 1S6QB 3MAAA 1FHTA 3MMCB 5L46A 2HS3A 5LXRA 1RT5A 4QR0A 3QFHA 1XR5A 2AYMA 4PWWA 3C3LA 2R7UA 1MU2A 4JI7J 3PJ9A 2WOMA 4FBUA 3OV7A 5DZ7A 1NBEB 1LK5A 4DL7A 2B4VA 1YX2A 2IY5B 1WEZA 3UQSA 2R2TA 2ERRA 3M30A 2Z2MA 5A76A 4DR4F 1J27A 1URNA 4MKBA 1Z2LA 1SC3B 4OYXA 2NQPA 3LANA 5KT4A 1NK8A 1UJ6A 3MM5A 5HVHA 3IG1A 4ZVEA 3WC2A 5L8RC 3LP0A 4CH0S 3NNHA 2DNYA 2GW8A 2W25A 1LFPA 2FC9A 2Y9HA 4DQSA 1BQNA 3C6TA 4IFVA 2CJBA 3QGPA 9RUBA 3QT7A 3PTWA 2BXJA 2MQPA 2MZJA 5E3RA 2YPZA 2HVEA 3DCAA 2YX1A 2QMUB 1XN9A 1MNEA 2DD8S 4HDGA 2J9DA 4ALZA 1MWZA 7FD1A 4RUAA 4X4VA 3R1LA 1N34J 1UAWA 2OELA 3SCIE 2QRRA 4UZBA 5JJBA 2HLTA 3I5CA 1Q8BA 5IC4B 2QX0A 2ILYA 4ZJLA 4X4RA 1NKCA 3JQJA 3CJ2A 4TLQA 1YDLA 5KT3A 1CEZA 4PPZA 4X4SA 4N47A 1UL3A 3BSAA 3M8RA 3R97A 3NGSA 2OP5A 2UXCJ 2HHVA 2CQIA 4NLYA 1C1BB 2BOAA 4FKXA 3PW7A 3KKFA 4ZPDA 3PXGa 2DNGA 3R5AA 4EK2A 1SB6A 2EFOA 5C7PA 3D6MB 2UUAF 4X62F 1VQ5S 2YX7A 3F56A 3PNIA 3VHQA 4ED1A 1N32F 4KIAA 2CZVC 1T11A 2UXBJ 2D9OA 4RBTA 2K7KA 4PWDA 3DHWC 1VMBA 2J7KA 5J1PA 4DFPA 2FZKB 5M2RA 1FTRA 3BREA 1XJWB 2ILZA 2E1MC 2WB1D 1PG5B 1YQHA 2Z0GA 1W7WA 2CKWA 2M3DA 4OV6A 2BV3A 5HROA 1RWVB 2DY9A 5EHHA 2DISA 1FE4A 3NGRA 3KG4A 5IOLA 2MKKA 2VC0A 2ZOGA 3PIOQ 3OJSA 1NDCA 4ZS6A 4B9MA 2ZWOA 1AROP 1ZAVA 3IFEA 3HZGA 4D3GA 4C2MA 1RWPB 2NXCA 1WKJA 3CD7A 1Z4UA 3DRRB 3H20A 1TZ0A 3TYTA 4Q45A 1FWLA 1NSAA 1GMWA 3MAHA 4PPDA 2KO1A 3AXMA 3JSMB 4F4KA 4K0KF 3L3CA 1VQYA 2HHPA 2GIFA 4OYPA 5IT0A 2K8GA 2G1HA 4DBQA 1G1XA 3UDVA 2RMLA 3MMBB 3UN3A 3M8ZA 2YKMB 4CLKA 1LW0A 2DXFA 2Z58B 3KK2A 2BQRA 4ELTA 3GFYA 1RT2B 4NZ7A 2BMBA 4RW8A 1X9SA 3EWGA 4CLWA 4F26A 2XGQA 3OVAA 1LWCB 5KT7A 4OMFG 5KG2A 4QWAA 3BS9A 2B7BB 3DRPA 3V6HA 5KFIA 2L08A 2GJ2A 4YR3A 4LF4F 1R6VA 1KFDA 1UZDA 1L3TA 3H2LA 4Q2MA 2FC8A 5IXUA 1SC4B 3KHHA 1PC4A 1B3TA 3AJ2A 5J2MA 1R31A 2N7CA 4GRSA 3AODA 2JWNA 1BGXT 4NI2A 4WXOA 3MWBA 4B3TJ 2HS4A 4WBFA 4EO6A 4JI0J 1GNKA 2L48A 1NXIA 3CJRA 4H4KC 4LRDA 3M2UB 4LFBJ 4LRCA 4L72B 2C2OB 1IR2A 2RVJA 3DGPB 1NLKL 3KJFB 3OR2A 2LKZA 1FJEB 3R8YA 4ZPVR 4FXWA 4DR1F 3M9OB 1S12A 2AYEA 3NAHA 1T95A 2FHMA 1CULB 4DQPA 3PFOA 5KFRA 4YB7A 1VQPS 4ZPCA 4ZCKA 2OFHX 3QZ8A 2DHAA 3UNGC 5DGBA 4NLGA 3S01A 3KLIB 4AYBD 2HMIB 4GKJF 4ED8A 1BWEA 3ULHA 1TMMA 5J2QB 2UXCF 2UZAA 1WEYA 1VC6A 1YJUA 2CPDA 1HQEA 3H5YA 4K4XA 3I5AA 1PBAA 2HWIA 2CWXA 4W92B 3AOAA 4C97A 3FFIB 5E0OA 4BC7A 3KJVA 5JXSA 2BQUA 3PYFA 4K5RA 4OZ0A 2ASDA 4U7UD 3Q83A 4UT4A 3Q0AA 1WC4A 4DV6J 5HLFA 1BHNA 2DK2A 4PG6A 3FQKA 5A6PA 3T5LA 3HVWA 1UVLA 3QIPA 5DZ6A 3OLAA 2FDNA 1IJFB 2YBVA 3CJTA 1IR1A 3CDAA 1TAUA 3HM9A 1UP1A 3U02A 1X4CA 3FBFA 2HVIA 2HGMA 6FD1A 4OYWA 1HYSB 1NJXA 2CVIA 1OMSA 3LP0B 2P9GA 4OZLA 2AEFA 4YR0A 3W63A 4RNMA 2QA4S 1R0BG 2HAIA 2M5YA 1YZ7A 3LP2B 4OZNA 2XSJB 2BE7D 5DRKA 2I38A 2G0IA 1XBWA 3HHEA 4DV4J 3NY0A 3AD7C 2HG4A 5KFUA 4A47A 1HWIA 3W8GA 3GJRB 2EI5A 4CO1A 2HHHF 3FZBA 3QGHA 4LFAJ 1DTQA 1RAFB 3D0IE 3BM7A 2BRLA 5K8OA 4WJBA 3NOGA 3N0VA 3DKDA 3PFEA 2E7WA 3NCQA 2XLIA 1OY6A 3BGLA 1IKVA 1VGYA 5KG0A 3DLLQ 1R27B 4RW6B 5J2QA 2ZNYA 1SUQB 2CQBA 2VDHA 1Z1ZA 3CJ8A 4J9MA 4Y0FA 3KMQA 4ZVPB 2V67A 4MK7A 1MMDA 5DO2A 2B4OA 1RTZA 1LWFA 3OTEA 4ZP9A 2Q6BA 2PE8A 1S4FA 2VPXB 3R1HA 3V6KA 2CQPA 4K50A 2Z8QA 4WFYA 4LBIA 5HN0A 4WYWA 3M2RA 1EJ7L 1AUSL 3H59A 2E5IA 3JXOA 4YHHF 2XYGB 2JVOA 2IBKA 1X4FA 3MCMA 4O44A 2SXLA 1N36F 1JX4A 3T1AA 3Q8YA 4JI1J 1HI8A 2BBEA 2VBXA 2B4UA 4NA3A 4A8XA 5GADI 1ZA2B 5HJXA 2QA1A 1P8GA 2OD4A 4P71A 1BY9A 1VDHA 5BYQA 4QWDA 3BB5A 4FN5A 2V34A 2HS0A 4EMDA 3CC4S 5D77A 2KFZA 1RAJA 4AT1B 4X64J 1H2TZ 1FO1A 2RU3A 5LSOA 4HDHA 1M1HA 1CJTB 2PIIA 5HBMA 3MM9A 4NLVA 4M5MA 3HSJA 4OX7A 1CJVA 2YH0A 2ALZA 4PEOA 1HR0J 4CP5A 1UKUA 2QGFB 3TARA 4F02A 1S1WB 1NK9A 2XCAA 1KKHA 2FY8A 2N3LA 2LDYA 2FJWA 1J2VA 4ZVHA 4DS4A 4JI4F 2CNOB 4USWA 2XZWA 3E3XA 3TZZA 2CZ4A 4HLBA 3GPAA 4P74A 5HROB 4N5SA 3SYZA 1CJTA 3SV3A 3LAKA 1PILA 1YBAA 1NZAA 2CDRB 3AD8C 3N6NA 2XO7A 3GIKA 2G2ZA 1S1VB 4QIEA 2HBYB 2ACMA 4JV0A 4PCQA 3NGDA 1V5VA 2AX1A 3QYYA 2ASLA 1VBKA 2BKPA 3DRPB 3MCOA 5KFMA 2RRNA 4KBIA 3CF5Q 2A2CA 2ZH9A 3JSRA 1KRPA 2QL7B 3G8QA 1K8AT 4OV1A 2KVQE 3Q2SC 2RU9A 2AU0A 4YOEA 3D0GE 1JLBA 2W2MP 3WHIA 3HHNB 3TRGA 3NMAA 1OYDA 2YKMA 4B08A 5D6GA 2QLXA 4ENOA 1WHVA 3GP9A 1R0AA 1N56A 1B0VA 4O3RA 2NPIA 1SCJB 2CIMA 4MYTA 4OJHA 3W5XA 1IKWA 1RWUA 1YG0A 3HHDA 3IXQA 4XPEA 2RDIA 3WDOA 3OXLA 3ZZRA 4TU8A 3H2UB 3MTKA 1BD6A 2R7XA 3M2VB 3EVOA 3HD1A 1NK6A 3FEXB 4RKUC 2CZ9A 1PJ7A 2MZTA 3TZXA 2VA2A 1TV6B 2V2QA 1JJ4A 4CT8A 4OHZA 1WC0A 4CO3A 1N33J 1DAXA 2OPRB 5B08A 5J1EA 1SC1B 4X66J 3I4PA 1TU0B 3UD5A 5EWGA 2HYIB 2C3UA 2V8VA 1XWLA 5I3UA 2PMHA 3VQSA 3E2EA 1YJ9S 5T41A 4O4GB 2UUTA 2JX2A 3SFGA 3QJPA 2YKQA 2PC6A 4OHXA 1Q5VA 2MLXA 4KY3A 3TW0A 4NRTA 2E44A 2YNHB 4USKA 2ZFHA 3TNVA 1SKSA 3NEKA 2D7SA 1D9AA 1F6TA 4LF6F 2LMIA 4ATNA 2MQ8A 1U7LA 2GVZB 3W9HA 4DV0F 2W2PP 5D3GA 2XG8A 4MH8A 3LA0A 3MDFA 4Y3CA 3UNYA 2AHOB 2EXUA 2AP6A 4MKVA 4TY8B 5KG3A 4QPXA 1U47A 1DQ9A 5DS7A 3S8SA 2D69A 5H9FJ 1DFDA 2B51A 2RHQB 4NLXA 1HARA 3IR7B 2E1AA 2FJXA 3QRRA 2BQ3A 2BJDA 3H4DA 2LU2A 3TVKA 3C66A 5CCMA 1I6JA 4WTYA 1M5PC 3J80Y 4CZCA 1F9HA 5EN1A 5KOXA 5IWAF 3CD6S 4C3KA 2HNDA 2BJEA 2VG7B 3DLJA 4YUDA 1ZTWA 5EX0A 3DRYA 2LU1A 4ZCIA 2V8HA 1NB7A 2G2YA 4J9QA 2WBRA 1S1UB 4DJBA 4YDDB 1PYTA 1EX8A 3BSNA 3AQPA 1FCAA 2EFPA 2ZH3A 1PJ5A 2KYZA 4WWSA 3J80U 5KFOA 1DTTA 1UVKA 1BUXA 1A7GE 2DHSA 5KFPA 1HHSA 5CABA 2C2MB 1EZZB 2X51A 4NLRA 3T19A 4FS2A 1VK8A 3AY0A 1W2BR 2WZ1A 4Y2MA 2W9BA 2XEXA 2PSZA 2MSTA 4RUBA 2DCLA 4NLTA 2K1RB 2QFIA 4K5SA 5L1IA 4NEZA 3W5YA 2HVZA 4M94A 2G1DA 3FNNA 5KAKA 3BKFA 4FS1A 2ADCA 3MEEA 5ETQA 1H98A 2KVIA 3H42A 4ID8A 2HNZA 3MPVA 3CPWR 2HHWA 5T14A 1FI4A 1WSRA 2AGQA 5EWFA 2ZKTA 1FNOA 1TMJA 5ETSA 3W2VA 2RQKA 3UW1A 3K5MA 4CLYA 2PA8D 2B9EA 2XWYA 3IGNA 5LMNJ 1TL5A 2O1PA 3CDWA 2LP4A 2IIHA 3KWMA 3QGGA 5GMDA 2N7YA 4Q2LA 4B02A 5DDRC 2QA2A 2H65B 2GO8A 2IFXA 3TA0A 3N28A 2VODA 2CNKB 1T9VA 2KYXA 1VRUA 4PXCA 2DJWA 5CHCB 1IBKJ 1Y10A 4GVLA 4O0IA 1FRHA 1SH0A 3NWRA 1YK9A 1EP4A 3B82A 3TA1A 1QJHA 2L9DA 2CYYA 1JMTA 2JH3A 4JI6F 2DPIA 4IO9Q 2IMWP 4P9SA 3HK2A 2RUGA 4O0NA 2B3TB 1TK0A 1D9DA 2V6AA 4DPTA 2VQFJ 3FKBA 1WHYA 2EBGA 3AA9A 5KFGA 4EZ9A 2R8KA 1RP5A 2V2KA 2NXEA 3I87A 4JP8A 1RAIB 4DL5A 3V81A 3K5NA 5KG6A 4BC9A 4O4RA 4CM0A 4DL6A 3ZTPA 3OFHA 3K89A 3MURP 5M2UA 1NK5A 2VONA 2IRYA 4A8MP 2XQCA 2LYVA 4KPCA 4FNHA 4IUFA 2I5JA 3TJ9A 5J2MB 1T05A 3FK4A 4K59A 4MMOA 2FJBB 4OHWA 1CJUA 5IM0A 5KFWA 2A6OA 3RAQA 2DGSA 3X3UA 4J9NA 5BYSA 1V6HA 2WVBA 4DR2J 3R2CJ 4FF1A 1JLEA 1VR6A 2E7XA 3D9BA 1ZPWX 3S6EA 3ZNJ1 1T7PA 2KM8C 3VAHA 1ZM3A 5J2NB 2MQLA 3OUYA 3RR8A 2CPXA 4WYLA 2HZCA 2KXHA 2OI2A 4LJMA 3GV7B 2V0NA 4AD6A 1KOOA 2BE9B 4DV5J 2EG1A 2XI3A 3CB4A 4JI8J 2WHOA 3HLUA 3U27A 1TK5A 2CPZA 3FCVA 4PAAA 3I32A 3OR2B 1S48A 4G1PA 4LIWA 4RBUA 4URSA 2OO4A 3A8KA 4PYDA 3QAEA 5HAOA 5ADZA 3SV4A 4NCGB 2HQDA 1RLCL 2EFQA 2B4PA 4XPCA 2EG2A 2D1CA 3DMJA 2MZQA 1PAEX 2GVDB 3K5OA 3M6VA 3BH7B 4FVMA 2C3OA 3T9NA 4ECSA 1UVJA 1FA0A 2J8AA 1NB2A 2FHJA 3ONQA 2XCPA 2LA6A 3NLCA 2OLWA 3QBCA 1JLBB 4Y34A 3RB3A 2MKJA 3KDNA 1CG2A 1RWNB 5KFZA 4KFBA 1QVGR 3RJMB 2V9WA 1DLOA 5A8RB 5IS2A 4ZP6A 4EBEA 3KDOA 4DX5A 3DM2B 4PG8A 2GMLA 1RTJA 1SKRA 2YWKA 4RW7B 4RW8B 1CJKA 3HT3A 2RE1A 5I3PA 5J1EB 2N3OA 3I55S 4B3RJ 1B4SA 2HHUA 2R4FA 3GCWP 2PI4A 5F3ZA 2PFDA 1IKXA 1GX6A 2FIUA 1ZOTA 3OXGA 4I68A 1OO0B 1N0VC 3FCWA 4WP9A 5LOQA 4UUWA 3CCUS 2F4VJ 1RB0A 2VKZG 4CO2A 5HP1B 4NCGA 2HW3A 3QAUA 1URRA 2GHWA 2CJQA 1RZMA 4NLQA 4ES2A 3TQ1A 4JV5J 1KR4A 2HNZB 3CCES 3FUYA 2E9TA 2QMXA 3PY8A 2CPYA 3F73A 4X64F 5GAGI 1KTQA 3V6DA 1ZH5A 3JYTA 3BQ2A 4FKYA 2RQ4A 4FYWB 1GAOA 1FD8A 3IM8A 4ER8A 1FTCA 1FNMA 4RW4B 3OFFA 3MPWA 4JV1A 1ZAXA 2HQGA 1VQSA 4QIFA 1TL4A 4WXWA 1SJ4P 1B64A 3NGUA 1UEUA 1MG7A 2KN4A 3AXKA 3A13A 2X3GA 4J37A 5CZVA 2XMUA 4KGZB 4C11B 1NJYA 3PRVA 2DYAA 4PYAA 3ZZ0A 1RACB 2LLZA 2IRXA 4C3LA 2LFVA 4FNIA 1RGVA 1Y3KA 1X4EA 1S6PB 2A10A 2CQDA 2CQ0A 2MZSA 2VD3A 3D1QA 3UE2A 2ZC3A 2G9OA 4KO0B 5AJ3F 3J7YU 5LT5A 3LF0A 1NPKA 5KFJA 4B9VA 4Q8FA 4MAKA 5JUMA 4ZP7A 1RAEB 2MEWA 1B99A 1BMQB 2NXNA 2ZBIA 3D7SB 3AOCA 3BGRA 2HNDB 3P96A 2ZM6F 2C1EB 3I6PA 2HQ3A 4JI3F 3RAMA 3G87A 5ITHA 4PG5A 1JXLA 1VQNS 4KT0C 5MLCV 2E9ZA 1IWGA 1CJVB 3DNCA 4D3HA 3JQKA 3BGFA 4X4OA 2ZHAA 1SJQA 4M1KA 2MYFA 4K7QA 4CCHA 1X0PA 3TZWA 4NZ0A 1RKJA 4OLOA 5CYQB 5CD4H 2G4BA 1L3VA 2KG1A 2ROPA 2E29A 1YZ6A 3O2IA 5HMXA 3ENQA 4K4TA 4KPYA 3Q8UA 3TJ8A 4IRKA 1A6LA 3MM5B 4DXLA 4CLSA 1YJ7A 4LFAF 2A6MA 2ZWPA 3MD3A 1W2IA 1VS3A 1ZM4A 3GIRA 4ANCA 1FF2A 4ETXA 2V4JB 3ZC4A 1RKIA 1VQLS 1B0TA 2H9ZA 4B3OA 1U1RA 4AL5A 3KLFA 3MEGB 1V3SA 2YNGA 5E7OB 3ISNC 1ZS6A 3R6GB 3N79A 2BOPA 2ZITA 3M2RB 3KJQB 4ILMA 1RSCA 1S6OA 4DLGA 4HR2A 3RGIA 2QMWA 2J7UA 1T02A 2A2DA 1U2RA 1S59A 3GJSB 4HH0A 4TNOA 3B8HA 1X4AA 3DI6A 3D2WA 4DV2J 2BVZA 4GC6A 3GIJA 1PAUB 1CS4B 5HVFA 2MZRA 3SBMA 1H0HB 2AWZA 3P45B 1NU4A 3SSRA 1T9XA 3MR2A 1F2HA 1O8BA 3C15A 4IG0A 1Y3JA 2ZH6A 1FEHA 3DU5A 2VJVA 3AOBA 1SJRA 1U6ZA 3HD2A 3RYLA 2VICA 3NKYA 5T7LA 2MKIA 3RTVA 4M5HA 1TKXA 1R0AB 2H5EA 1IKYB 1CJKB 3KUHA 3PDNA 4ZKAA 2HLUA 1QM9A 3T5JA 3IWXA 1KEKA 5C25A 4C4WA 3D66A 1PGZA 2BJ9A 3MR7A 2EC2A 4XTTA 1HNXF 2HNYA 1JLGA 1O6XA 4ECUA 2J0WA 3LP2A 2DT9A 2OH2A 4QBUA 4ECZA 2DR7A 4OZ3A 4MK9A 4OJ1A 4W98A 1FKOB 4RL1A 3IP0A 2XGPA 2PI5A 2DHHA 2R3VA 2XYHB 1CULA 3FGVA 3C16A 2HHXA 5E5NA 4ZK7M 5ETNA 2XMTA 1LEOA 3R5GA 4DX7A 3G4SS 4Z7YA 1VQKS 4C8OA 4FYYB 2UXDJ 3EXCX 4IOBA 2MHNA 3W3SA 4U95A 4I2QB 5GAHI 5KFYA 4FVCA 1GXLA 1RLDA 5HLFB 1Q53A 2DR8A 2AF6A 4LVNP 4G6VB 1OY9A 3G82A 3TP2A 5L1JA 2HZAA 3KJVB 4UTGA 2JVRA 2W2NP 3I0SA 4OYAA 1FWKA 5ETKA 3SDEA 2UXDF 1RTJB 3M4XA 4IFVB 3PRDA 1FJ7A 1WC3A 2KT3A 4WIQA 4EBDA 2VQFF 4YFUA 3V2UC 2XS5A 1WF1A 4Y2KA 5LM7E 3K58A 4J9OA 1RT6B 1LW0B 2OMLA 2QLFB 5FLXU 3G96A 2QE5A 4R8UA 3T1HJ 1HMVA 2OPSB 1NAQA 4QJVA 3HHLC 2ZM6J 1U1KA 1R7IA 3HKWA 3DMJB 4NMLA 5KFNA 2OPPA 4X62J 2XC9A 2O5DA 3CCJS 1JXVA 3OW2R 1NK0A 4I6WA 2G0JA 2WTFA 1IBKF 3VCDA 2LCWA 1MU2B 2RNEA 2V8GA 3HULA 4KQZA 5IC6B 1HPZA 4ICLA 4CLFA 3W1YC 1YRUA 4DSJA 2DXEA 3PW5A 1GT8A 3FVYA 2B7CB 5KFAA 2AJQA 1F5CA 3WBZA 3IMQJ 4WP3A 1FKOA 3KNAA 1YBTA 4GKKF 3DYAA 4HHUA 4FYXB 2QA4G 3OUYB 2VG6B 2AJ4A 4OI1A 3KLEA 3BBBA 2UU9J 2UXBF 2HK2A 3ZFVA 2ZDPA 4Y2AA 1BQNB 4X4TA 4QW9A 4DPOA 3JAMU 4AXIA 2JEIA 2F3JA 3PKYA 2XHWA 3SSQA 3OTOF 1K44A 2IJNA 2E5GA 3VAGA 4TU7A 3PX6A 3PO5A 2KHCA 2VBZA 1GEHA 3HFVA 1SC6A 2XMWA 1C0UB 3LPEA 3P3DA 4ED4A 5F9NA 3KTQA 1C1BA 4U9RA 3H90A 2DNQA 1GXTA 2RB7A 2HFVA 1DZ5A 2IA6A 1N88A 1CQNA 2RS8A 1OSCA 3NS6A 4ED0A 3CC7S 4NYZA 5IQ6A 2RAQA 4HH1A 4KRWA 4OJ3A 4JBCA 3MM6A 1M5OC 1E6YB 2IM1A 2ZBCA 3BYRA 3M05A 3OTOJ 1HBUA 2MQMA 2EEYA 4RX6A 5LSRA 1QSLA 4ZOSA 1WKKA 2BR0A 3MMCA 4IDKB 2NSBA 1LWFB 3RAXA 5ETRA 1PYSB 1LNQA 4K4SA 2W9BB 4ZHRB 3J81j 2FVCA 1XMOJ 1BLUA 2B43A 2Y1RI 4Y00A 2BW2A 3C6TB 3W9IA 2NYIA 4N77A 1T3OA 2W01A 3I4HX 1HBOA 3MEGA 1RCOB 3MMAA 4L3KA 1NJWA 2F8HA 2C2EA 3KHRA 5CYMA 2C28A 3JS9A 5RUBA 1S4EA 2X1BA 5K9FA
chains in the Genus database with same CATH topology
2HFOA 4KHMA 4JI7F 5B0CA 3DXBA 2ZVSA 2FY1A 4EBCA 1T03A 4Z37A 3BGRB 3NBPB 1O0PA 1VRTB 3IN5A 3W2VB 2J5AA 3MZIA 3PVXA 1VC0A 1D3WA 1VQOS 2F8MA 4YB5A 1PC5A 2QEXS 5CYQA 3NS5A 1WI6A 3PJWA 2KFYA 3PACA 4ECVA 2KDOA 2UUBF 1RT4B 2YH1A 1D1UA 4ZDNA 2ZH4A 4LF9F 2R7RA 1WELA 2R7OA 4ERDA 1HBMB 5B0AA 3LGMA 3GE9A 3KLGB 3CJKB 1APSA 2RQMA 2GQCA 1S1TB 5L1KA 4EYHB 4C8YA 5IFMA 3RU0A 1TKZB 2VH7A 2DO0A 2DR5A 1S97A 4C8KA 2ZHBA 3SQGB 2VV5A 1G2EA 2KTQA 2VFRA 1Q82T 5K8MA 1N6QA 4DF4A 2NUUG 4RNHA 2UVVA 3DOKA 2DNKA 2FD2A 3CJ4A 2YKAA 3KLVA 5HQ8A 3M1VA 1HNIA 1IKXB 2W9CA 2PO4A 2ZOFA 5DG7A 4OJGA 3IGVA 5KT6A 3RZAA 2J76E 1J5OB 2B0GA 2MKSA 5F41A 2OTLS 4MKYA 3HHLD 1FRXA 1F5AA 1L3KA 4H4KA 3CD0A 2L3MA 4DL0C 4RBVA 1VQ4S 1VC5A 4EEYA 4DR7F 4KFBB 4R0EA 1AFJA 3GFHA 3M32A 3DYAB 3DLGA 2XS2A 2BE2B 3I96A 3OTCA 1Q1KA 1SBRA 1NO8A 3CSKA 1S6UA 3QLHB 4FXDA 3ITHB 3NP5A 2OAUA 4Y2IA 3CVKA 1LQ9A 2MY8A 3L95X 5KG1A 1HR0F 3HZEA 3PEHA 4LQ3A 4ZMMA 2YNFA 1QUPA 4YY3F 5GADU 1J5OA 2HMIA 4X2BA 4MIWA 1HI1A 1KD1T 4M8LA 1OWXA 4EFAC 5DQHA 3QGIA 3SFUA 3FQLA 2DGXA 4WE1B 4U7UK 4KSEB 1ROFA 3A1YG 1W25A 2M88A 1HFEL 2IM2A 3D1HA 2CPFA 3U7JA 5H1SV 2AX0A 1OPZA 4MFBA 3BR8A 4DFKA 4YP3A 5KFXA 4I6YA 3DN9A 2QT7A 3M6XA 4OI3A 5F8NA 3MEDA 1D8YA 3NAIA 1S9EB 1LV5A 1T94A 2XLJA 2VPWB 2EW9A 3PX0A 1MSWD 4WKRA 4UUXA 3I5BA 3CWJA 3HJFA 3H2VE 1M5SA 3ZZYA 2YKPA 2X1GA 3MOJB 2WK4A 4ED0A 2DH8A 5F8LA 2DB1A 3BSCA 1WHXA 3O6QA 1R3NA 3AQOA 5AE2A 5CA5A 5IT4A 1IXKA 4XO0A 4DSEA 2C22A 3NMRA 2M0GB 4NYOA 1XEZA 3RBEA 4OHYA 1U1MA 2W24A 3DDNA 4ECWA 5BR8F 3OTBA 1H6KX 1X4BA 1M5VC 4O3NA 3OLBA 3I56S 5IT9Y 2KU7A 4XIUA 2QO3A 2CQCA 4UQTA 4XDDA 3UDCA 4QU7A 1HNVA 1MMLA 2HHQA 4DQIA 5KFTA 4DSFA 1VIXA 4IG0B 1CC7A 2LXUA 4ZVFA 3BDPA 4KV8B 2LVWA 4I2PA 3ISZA 5MAOA 1IKVB 4RZRA 3THTA 2F1FA 5L1LA 3BQ1A 3Q8RB 4IDKA 5HMWA 4C7QA 5DM6Q 5E41A 1NKBA 1ZBTA 4NYPA 1E6YA 3PM9A 3LP1B 3A8EA 1GQEA 2NUHA 3POTB 1N34F 2CQGA 4I7FB 4WU3A 1IBMF 1I1GA 3FCHA 4TU9A 2O66A 2WCXA 1JNZB 3IRXB 1WEXA 2HGNA 2J6TA 2R7VA 3VR1A 4QYZJ 2ASJA 2D3OR 2Q43A 4PKDB 3DOLB 3K5LA 3PW0A 1Q8LA 4NOHA 4RU9A 4C0OC 4AL7A 4WU2A 1UA0A 3TI0A 1S1TA 3CDBA 2DNNA 3G8SA 1QTMA 4R5PA 4ELUA 1NJZA 2R8JA 1S9GB 1NK7A 2XMKA 1E6VB 2JLGA 1KTVA 1ULRA 2FLOA 1TVRB 3M6WA 4NLOA 1Y00A 3IG1B 1SJ3P 2HWHA 3KNGA 3CCLS 2ATLA 2AV5A 4NRUA 1FXRA 2B6AB 4KGMA 3MM6B 5A8WB 5DQIA 4QQBA 4ECXA 2GA7A 1T03B 4WE1A 2RKIA 4ZCLA 4KAIA 1RISA 1KQKA 4R8UB 3MM7A 2W7AA 4FBTA 1HWKA 2M4MA 4MJKA 1TK8A 1MROB 5DM7Q 1RQ0A 2KT2A 3NRBA 1S1XA 1REVA 2LQJA 3VAKA 4IRDA 3M2UA 4IH5A 2BABA 1VQ9S 4QU6A 5A2QY 1I94F 1X8DA 3PO4A 4I2QA 1XC9A 4MIBA 2YNHA 2XNRA 1KHWA 1N5SA 1SL0A 1M5KC 4O4GA 1EETB 2V9KA 3RBDA 1WG5A 2RSQA 4FXVA 1LWCA 4P2SA 4WFXA 2VBWA 3PZPA 3FMBA 4OI0A 2HGLA 1SL2A 2XMMA 3DM2A 4RW9B 3KK3B 3G6XA 1H7WA 1EETA 3I82A 5B0DA 1WNEA 2EC0A 3SI8A 3I0SB 4X4NA 3EGNA 4B9TA 1UVIA 1JLQA 4WKYA 1QVFR 1Y0HA 2ZJRQ 3OR1B 4J9KA 2VG5B 4HKQA 4EGLA 4WCEQ 3K57A 4F4YA 1ELOA 2JHEA 2V8DA 2FVPA 3G6YA 4K4UA 4WK1A 4XAKA 4Y6IA 3C46A 1FJCA 1RK8A 4OX8A 1R6YA 1RT7B 4RU2A 2R8GA 4ZPBA 3W7BA 3OVBA 1X4HA 5A6WA 1FESA 1VQMS 1L3SA 2MZ1A 3Q2TC 2GC8A 3PHEA 4NLPA 1WTBA 2XULA 4AFFA 4X4UA 2XWXA 4LSNB 2YVSA 4K4VA 1U49A 3C8YA 2AGOA 2YNIA 1IKYA 1TL3B 2Z4PA 2V4JA 3CCMS 3VQTA 1VK3A 4ZPAA 3NG8A 4C0BA 5F0UA 1T05B 2FJEB 3M8PA 1GH8A 2W8LA 5A0YA 3CXCR 1JB0C 2KJWA 1DRZA 5F8JA 3KLGA 3GG0A 4MYUA 1TFYA 2G0CA 2Q79A 3JB9k 2CPHA 4ZHRA 3E01A 2E1CA 4LF7F 1YJTA 2JFDA 2W4PA 3K5PA 1N5YA 3EGZA 2CQ4A 1NRKA 3M8SA 1HBUB 4DN9A 3MM7B 5B0GA 2FLPA 3CCZA 3N6LA 4WIIA 2VPYB 1HNIB 4QIVA 2GQ2A 3VAJA 2CPEA 4IOCQ 4ED7A 3F44A 3FDSA 2KT5A 3QMQA 1HW9A 1JIHA 3ZZUA 2RS2A 1VI7A 2B6AA 1FDAA 2KXFA 3GV5B 2V5HG 5CYMB 1LOUA 3MMAB 4BCAA 3NWGA 2IVMA 4ZA1A 3MEKA 3DLGB 1R8AA 1E6VA 4I2PB 3IS9B 1KLMB 1KN6A 5GAGU 2JJ4D 2JSXA 4JV2A 4DQRA 4OZ5A 3N5FA 4KJIA 1TQLA 5FIIA 1H2UX 4C0HA 3LOUA 3CULA 4KKOB 4FP9A 3Q8SB 3MTJA 4QOTA 3OFEA 3J7ZT 4C8NA 3G8TA 3BO4A 3E51A 4I7FA 1NJYA 2ASYA 2DGVA 5KFKA 4CO5A 4UQGA 1HWUA 3O8WA 5G4DA 3BSOA 5KTQA 5GAEU 5IZHA 1X5OA 3KLHA 5JVHQ 1RT5B 1LW2B 2EBEA 2OKQA 3MECB 3GIMA 4KKOA 5E3CA 4U67Q 2L41A 4I69A 5KFDA 1QAXA 4G1QB 3SXLA 1TVRA 3V4IA 3S1TA 2VKRA 4OX9F 4C9DA 1K1SA 5C24B 2J6SA 1FRLA 3SDEB 5GMKa 3J7Z5 4C8LA 3MEDB 1IQZA 1SIZA 1JLFA 1ZTTA 1TV6A 2YQ3A 1Q7LB 1WF2A 4LIRA 4WFAQ 1FKAF 4G1IA 5DETA 1ZETA 3P49B 2OMOA 5DLGA 2RRAA 3CCWA 4PXEA 5HMZA 4LFBF 5HP1A 4RWXA 4ITSA 2OPPB 1X4DA 4B3TF 1IKWB 5KFFA 5FLXY 3MUMP 3KLIA 2Y0SD 5F9LA 1RT6A 2M52A 3OHBA 4AUKA 5GVQA 2JC1A 2DVIA 1DQAA 4OHVA 3JAMY 1HNZF 4FPRA 3WC0A 3NL0A 4UOCA 5A8KB 4JI1F 3OFGA 3SCJE 3CIZA 3FMWA 2UV8G 1TFWA 4DF8A 1HNVB 3O3LA 2EK1A 5FJ4A 2MDAA 4RNOA 2DNPA 4JUZA 3OR1A 4J9LA 3C6UA 3IAM9 3Q24A 2JLFA 2P5VA 1KONA 4Q0BB 2FLLA 4QWBA 1HD0A 1H3DA 1CC8A 2GV1A 5BYRA 5B09A 1XMBA 3DC2A 4NX9A 2E5LF 2E5HA 2VQEF 3LW5C 4TYAA 2M8DB 3MUTP 3VWSA 1HMVB 2WSFC 2WAQD 3THVA 2YWGA 3CTRA 3KG0A 2ZC4A 2XI2A 4DL4A 1YRTA 2E1RA 2YNFB 1UVNA 4HTJA 4ETZA 4DL3A 3V5RA 1XMOF 3QWPA 2N4DA 1U6BA 1HA1A 2I0XA 5EUHA 4ID5B 4J5OA 3TUIC 1PO6A 1S9EA 1S0VA 2HVHA 4EYIB 1YI2S 1N6QB 1DURA 2HWTA 1LXNA 4TYBA 4A8FA 2ZKUA 2UUWA 3N9UC 4Y65A 3G86A 2CVEA 4LT6A 3VAMA 3GV8B 1S0NA 3GR0A 1F2GA 4JV5F 2VB6A 1UFWA 3UD4P 4LSLA 4HVZA 4QZVB 1HBMA 2YKNA 1OQ3A 1N54B 3OL7A 3BO2A 1RTHB 3QJJA 4IO1A 4PUOA 2O67A 1VFJA 1A9NB 2NREA 4DDFA 3AA8A 2HRUA 2PN6A 3TO8A 1U48A 4F8RA 3HHKA 5EWEA 2C3PA 3U1MA 2GFFA 3LQVA 4N41A 2VFSA 3N4WA 5GAHU 1SI9A 2KRBA 4LMZA 1FRKA 3HVAA 1VRUB 3NBPA 1RTIB 1VBXA 1X7VA 2VASA 2VOPA 4IFYB 1GX5A 2F8EX 3FSYA 3AAWB 3JSMA 1YJWS 2LDIA 3UCGA 1JNRB 3PEJA 1TAQA 1TL1A 5H9EJ 2I2YA 3CJ5A 2EVZA 2QYCA 3M32B 1NNDA 4CT9A 5LSLA 1V3ZA 4R5PB 2VFVA 3QIDA 1B7FA 2VC1A 3V4IB 3CC2S 3PRBA 2D9PA 3DI6B 2FHKA 2AJ0A 2PGCA 2J0QD 2PEHA 4PQUB 1C4CA 1RT3A 3GZ7A 3BEGB 1XNQF 3B78A 4URQU 4DX8H 3EZ5A 3HX9A 3IBWA 3IR5B 4N76A 1KQFB 1D8ZA 1LK7A 3HP6A 4UY85 3G71S 2MY7A 5E2QA 3IWNC 3VZIA 4R25A 2DRBA 4DFJA 3DOMA 4BWMA 1KC8T 2A1BA 2RF2B 4DR2F 3IS9A 2F40A 2J0XA 3VAFA 4QW8A 2KKHA 2FTRA 4TKTA 1FDDA 5KG5A 2LEAA 2JLEA 5AXKA 3TVYA 3OJUA 3L09A 3JSYA 5HO4A 1YITS 4NWBA 4CNZA 1U45A 3GSDA 2GJIA 3NNAA 3CD5A 3D1OA 1FRIA 5D3GB 2GHVC 1QUVA 2R7WA 2DNOA 3U1NA 4F67A 1S99A 4PQAA 3FFIA 4EWTA 3KMSA 4PWUA 1QSSA 1DHMA 3R5CA 3I0RA 1ZM2A 3P6YC 4FYDA 1N0UA 1Y5LB 2DIUA 2NLWA 4BS2A 4A8KA 5A0YB 2BDPA 1X9WA 2FVQA 4TY8A 4F3QA 2DHGA 3UCUP 2LQBA 3EYZA 4KE5A 3JTNA 1FE0A 2POKA 2IYGA 3N6MA 2DNMA 3CDEA 2ROEA 2F7VA 3H5XA 4E8UA 2Y1IA 4FZVA 5I42B 2HHTA 5KFLA 1X4GA 1JKHA 5K14B 2OTJS 4HL9A 2MKCA 3W2WB 2ZH5A 3MM8A 1IQTA 2CG4A 4YB1P 1VQ8S 5F8MA 4ED6A 3CJ3A 2JZ5A 2NZ4A 4RWWA 1S77D 1JLAA 1R8HA 3JSBA 3W2WA 3J7YI 5L9XA 3HXMA 2CFXA 3KK1A 2C3MA 3FZ2A 5KG4A 3CCQS 4DL2A 2C3YA 3SZ2A 2J6UA 3GYXB 1P6TA 5B7WA 2BA9A 3EGWB 5KFHA 4Q0BA 3MAQA 2B9YA 4F3MA 3MEEB 3CE8A 1FJGF 1WTFA 4FF3A 1G6BA 2DR9A 2DGQA 2RIJA 3O44A 5F3TA 1G7CB 3FJ2A 2XLKA 2R7SA 1OS5A 1JLAB 2QSFA 1S7HA 1YRXA 3I31A 5C5JA 3BJYA 2KHDA 2J9DE 1JJ2R 4CO4A 1YJNS 4OIXA 1C0TB 3IWLA 3HPOA 5DDOC 1N48A 1SL1A 4DQQA 2V94A 1N33F 1M5HA 2P6SA 2PT0A 5K8NA 4A48A 2B9XA 4Q44A 4DV1F 5I42A 3ITHA 4LUBA 1FDBA 3DU6A 3EUNA 3TA2A 1KNZA 4IG3A 2CQ3A