2G9OA

Solution structure of the apo form of the third metal-binding domain of atp7a protein (menkes disease protein)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
77
structure length
77
Chain Sequence
NDSTATFIIDGMHCKSCVSNIESTLSALQYVSSIVVSLENRSAIVVYNASSVTPESLRKAIEAVSPGLYRVSITSEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Copper-transporting ATPase 1
publication title Solution structure and intermolecular interactions of the third metal-binding domain of ATP7A, the Menkes disease protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 77
sequence length 77
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2006-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2g9oA00
2HLUA 2QYCA 2BJDA 2KKHA 3BGUA 1TL4A 5IXUA 3HDSA 1OQ6A 1N5TA 2FTRA 3TNVA 5F0WA 3CJKA 4A47A 4OJHA 2LXFA 1OSDA 1YJRA 1Q8BA 1WD6A 2OKQA 1Q8LA 2ASYA 3BF4A 3LGNA 4DN9A 1GXTA 2W4PA 3IWLA 3KNGA 4YDXA 2K2PA 2ACYA 2BBEA 3GZ7A 5K9FA 2RMLA 5B08A 2XMVA 4ZOSA 3HHLB 2IYGA 5B09A 1URRA 3QMQA 4A4JA 2ROGA 4U9RA 2K7JA 4YEAA 2AJ0A 1Y9OA 5KAKA 1P6TA 3HFKA 3FRYA 2GO8A 1N5SA 3HHLC 3I9ZA 1FVSA 2IYIA 3KG1A 1W2IA 5A6WA 2FHMA 2CRLA 2KYZA 2Q3PA 4Y2MA 1R6YA 2HFOA 2K7KA 2KT2A 2QLXA 4OJ1A 2LQBA 4OJGA 2ROPA 1CPZA 2GV1A 3UDCA 2ZDPA 2G9OA 3FMBA 1SB6A 4HH1A 4Q2LA 1ULRA 5B0DA 2L3MA 3MZIA 1CC8A 1MWZA 1V3ZA 4Q2MA 1Y3JA 2PGCA 1LQ9A 2ZDOA 2RSQA 3K7RA 3LO3A 1TZ0A 4F67A 1YJVA 2AP6A 1XBWA 2LDIA 2RILA 2K1RA 2EW9A 1CC7A 2PD1A 1AW0A 1MWYA 1IUJA 1FEEA 3HHLD 1APSA 2W4CA 3BDEA 5B0BA 4DL0C 1VQSA 5B0EA 5T7LA 4FNIA 3CJKB 1FD8A 1YJUA 1Y0HA 1Q53A 2XMUA 5F0UA 1AFJA 3HX9A 3FGVA 1K0VA 3DCAA 3HF5A 3DXSX 4QOTA 2OD6A 2OAUA 2OFGX 2OMOA 4DPOA 1S6UA 3BR8A 1JK9B 3KG0A 1Y3KA 1FE4A 2HQIA 4HH0A 1FVQA 5B0GA 2HFNA 2K1RB 2IFXA 3WDOA 1AFIA 2FB0A 2XMMA 1VQYA 3VTIA 1TL5A 2GGPA 1OPZA 3E8OA 1GXUA 1N5VA 4OIXA 4Y2IA 4Y2KA 5T7LB 2GFFA 3T9NA 1KVJA 2LQ9A 4NL5A 2OFHX 4HI1A 1RJJA 1KQKA 1OQ3A 2GCFA 2OP5A 3LGMA 4HI2A 1FE0A 2BUNA 1P8GA 2ROEA 1TUVA 2QIFA 1X8DA 2W4DA 3BN7A 3HHLA 2BJEA 3KKFA 1U7LA 1YG0A 5A6PA 1JWWA 2KT3A 5B0FA 5B0AA 4NPOA 1Q4RA 2FIUA 2GA7A 2VV5A 3F44A 2GGPB 3TRGA 2XMJA 4OJ3A 4FNHA 2XMKA 2N4CA 2XMWA 2N4DA 1YRXA 3BB5A 1YJTA 5B0CA 1N5QA 2N7YA 4ZA1A 3MCSA 1TR0A 3IWXA 3TOQA 3BM7A 4EFAC 1QUPA 1X7VA 2HLTA 2OD4A 2RU9A 2JDJA 2AW0A 2VH7A 2XMTA 3QGPA 1S6OA 1FESA 4A48A 1SI9A 4HL9A 2BYCA 2AJ1A 2HIQA 1KVIA 4A46A 1SQEA 2QLWA 1X0PA
chains in the Genus database with same CATH superfamily
1XR7A 1Q8KA 5H9FK 1M1HA 3IO1A 3FSXA 2D3ZA 1S0NA 4K0KF 1PJ7A 3RBEA 1JLCB 2P9EA 3U7JA 2BDPA 1HNZJ 1GMUA 1PYTA 4LFBJ 2E29A 4YFUA 3OVAA 2R7XA 3FVYA 1R6YA 1UVIA 1WI6A 4JV1A 4OI1A 1J2VA 1HQEA 4ID5A 4DR6F 2HHTA 3AA9A 2PDAA 1CC8A 3TQ1A 2AP6A 1FXLA 4LF8F 5AXNA 2F40A 1PAEX 5M2UA 2RT3A 4QOTA 4C2MA 3MR7A 4JI5J 3M1VB 3KHGA 2AF6A 4DR2F 3B6BA 2OH2A 2UUBJ 2ZM6F 2OPQB 3MF5A 3AB4B 1T0TV 2HPUA 2V68A 5LSLA 1IXKA 5J2PA 1NHVA 4KGZB 4FNHA 2M52A 2ZC4A 3M8SA 1RHQB 2GW8A 2RDDA 2E5JA 4O4GB 2HFUA 1X7VA 3ZZ0A 1JLAA 2R8IA 1VBKA 2R7VA 3FFIB 1TV6B 2J9CA 4J9RA 2RS8A 1U4BA 3EGZA 3BGFA 5A8RA 3HVTB 5DQIA 1S7IA 3I6PA 4LFCF 3QIPB 3FRYA 1WKKA 2B8QA 3T41A 1CEZA 4CLSA 1IJEB 2V8GA 1YSJA 3AHPA 1VRQC 1Q79A 3NMAA 4B3SJ 4OX6A 3RRHA 1M5HA 5T14A 3GYXB 4K4ZA 3GIKA 4BDPA 2UXDF 3UW1A 1O51A 3BH6B 1JLQB 1ZPWX 2X3GA 2BQUA 3ENVA 4C8YA 2KZZA 2QLBB 2JFKA 2BM0A 1BLUA 4IR1A 5KFJA 4GKKJ 1HNWJ 3BZQA 4Q5VA 2EFGA 1XIQA 1Q7LB 1SIZA 2DH9A 5F8LA 1R6VA 2AV5A 2KO1A 4OZ3A 3KWMA 2DY9A 1WACA 2VPXB 8AT1B 1SJ4P 3KFWX 1U6FA 2XMAA 1HBNA 1IVZA 1F60B 3H90A 3QQCD 1A9NB 3TZXA 1X0PA 3D6FB 1FKAF 3KG4A 4XAKA 4R0JA 2D3UA 4QYRA 2B3TB 4Y3CA 2RIJA 3G71S 3ITHA 4CO4A 4RNMA 3BV8A 3R6LB 5C7PA 3TP2A 4BLGA 3RR8A 2E66A 2CPJA 3D67A 1NKEA 1LW0A 4DN0A 3SFUA 1N0UA 3V6KA 4WZMA 3K5OA 4NLQA 5T41A 3CJKB 2XMUA 4R5PA 4DV3J 4HTIA 1Z2LA 1YJNS 3K59A 3IRXB 5B0GA 1VBZA 4PUOA 3OLAA 1ZETA 1M1GA 1VQ7S 1TK0A 4OIXA 3RAMA 1KVJA 3A3PB 2B6AB 4H4KA 1VQ8S 2O3DA 1NZ8A 3M6WA 1RTIB 1S9EA 5C2GA 4WZQA 3SCIE 4ECRA 1VIXA 3TJ9A 3BO3A 3S01A 5DGAA 1MMDA 2DGTA 4OI2A 4O3SA 1ZZFA 1HHTP 5KFQA 4PKDB 2V4JB 1N48A 1MROA 2YWKA 2ZNZA 2DH7A 2J7UA 3MDFA 3M2UB 5ADZA 5C42B 4WTOB 5JMNA 3AH6A 2R8HA 1XK8A 2L9WA 3KLEA 4R8UB 4AT1B 3HXMA 2OELA 5F8MA 5IFMA 3GPAA 5RUBA 5CA5A 3VALA 1I1GA 2DISA 4NLTA 3K17A 2M2BA 4RWXA 3NRBA 4CO2A 4NL5A 1FE0A 4B9VA 1PO6A 4ZVFA 1HQEB 4ID5B 1GNKA 3DFEA 2XSFA 3CJ3A 4F04B 1S48A 2HIYA 3I5AA 4F4XA 2RE1A 2P9GA 5B7WA 2BE2A 4ZJLA 2PA8D 4RW6B 1RCOB 3AJDA 2HGLA 3J80U 2HWIA 3JAMY 2BRLA 1NJXA 2YKPA 1RWKB 4LRBA 3TZYA 2GQ2A 3CULA 2NLWA 2F4VF 5L39A 1BXNA 2VFSA 3DM2A 1C1BA 1G2EA 2AJFE 3GV7B 1MSWD 1CPZA 2WHOA 2ZDPA 1JLAB 4LSNB 4C0HA 1HIYA 3DU6A 4XIUA 2J5AA 3SCLE 3IBWA 1XBWA 3M2RA 4IDKA 3Q8SB 2K3IA 2XBPA 4ED3A 2NQPA 2NZ4A 2VG5A 2HK2A 1FVQA 2LXUA 1BC6A 4U95A 3CUNA 2FGCA 4G1QA 4LF7J 1PIEA 3M2VA 4RJVA 3BKUA 2XLIA 5KT7A 2OTJS 1FRJA 3VAIA 4ECUA 1OYEA 1R8PA 3BO2A 2YY3A 2B9EA 1YRXA 4JB8B 2CPIA 1SXLA 3EX7B 1BQMB 4UUXA 1DFDA 1H7XA 3PFEA 1HYSA 4Q8EA 1WSRA 2W8KA 2PFFB 3H98A 3IMQJ 3EICA 2NCKL 4DV1F 4Y28C 3UN5A 3IFEA 2B4OA 2KFZA 4NE9C 5KFYA 1HR0F 5L9NA 3QSIA 2KFNA 2FJXA 4CT8A 1NNDA 2I38A 3MM7A 3BQ2A 1NH8A 4ZS6A 5D77A 2QMUB 4QW8A 2H51B 3UN3A 1TL7B 3GTYX 4B3OB 2BKNA 3PX4A 2YNHA 2XMMA 5HN0A 3D0HE 3QJPA 4XTTA 1GQEA 1V3RA 2UXBJ 3BGRB 1ZM4A 1HNVB 2AQ4A 1LW0B 1N6QB 2CPFA 1A0OB 2X3DA 1SV5A 2AHOB 2V8HA 3ILIA 1S9GA 1DHMA 2DNLA 3PRDA 4WKYA 3E51A 3WX8A 3PIPQ 4R5PB 1RYSA 3UFCX 2NUUG 2MKHA 2V2QA 2HIQA 3D1OA 3TUPA 4IOAQ 4ZLJA 1UJ4A 4TY9A 1SKSA 2QLJB 5HK4A 3QFWA 1Q5VA 4X62J 1O5JA 2AYBA 4USMA 1UW4A 1S9EB 3MR5A 4J5OA 2KT2A 2XLKA 1VLYA 2IRXA 4DZ6A 3QWPA 2B5JA 4QBUA 5B0DA 5M2PA 3LO3A 1NSPA 2LDIA 2HURA 3IGVA 1FRLA 4Y0FA 3H40A 4JP8A 1XQIA 4LQ9A 5HVHA 2ZH2A 4PG5A 2VPYB 3DLGA 5EDWA 1HI0P 3NWRA 2R7SA 4H4OA 1U45A 3UN2A 4C8MA 3Q8VA 4K2XA 3VAKA 4KHPF 5EUHA 2VV5A 3KLEB 1Y11A 3TQEA 5D3GA 2R42A 2AX0A 2RU9A 3TX0A 3EDRB 2G1HA 5J1PA 4PWUA 5HL7Q 3G96A 2RHQB 4L75A 2MHEA 4OZLA 2EG1A 3WIVA 2XI2A 4F50A 3N5FA 1CJUB 2HQ3A 4I68A 1YJWS 2XYPB 2OPRA 1NDLA 4U9RA 3AT1B 2F8HA 1IBLF 1LK7A 4F3OA 1VS3A 2J9EA 2HS0A 3V6HA 5GADI 4X4UA 3KNAA 4LT6A 4QU7A 1VI7A 5KT5A 2BE2B 3MAHA 5KFGA 1HWJA 3LW5C 1DTTA 1U02A 4FDFA 2F3JA 4URGA 4CZCA 3OL8A 1U1NA 4C11A 4ZPVR 4MIAA 4N47A 3PVXA 4IO9Q 2ZD1B 2W7PA 1CJKA 3GSIA 3DM2B 3PTWA 2G2YA 1B4SA 5KT3A 1U7LA 2B4PA 4R25A 3W2VA 3RB4A 1YBAA 2YX7A 4EU0A 3HJVA 4IDKB 3UD5A 3BBFA 2VU5A 4DPUA 2BE7D 5GAHI 2VG5B 4G1IA 4LRAA 1X4DA 5D0GA 2G2OA 4G1QB 5LL6d 4USTA 3M2VB 1GXTA 1UVKA 3GZ7A 3OFGA 4CI0B 4L72B 2KXNB 3EVOA 2ILZA 2B9XA 1TK8A 1G6BA 2DYAA 2KM8C 3CXCR 5DG8A 2H4WB 3HO1A 5LXRA 1GTEA 4NYOA 2EKYA 3K0JA 2FDNA 1SC6A 2HQFA 5JVGQ 1UZDA 2ASDA 2V34A 2JLEA 3UDLA 2ZBIA 2VFTA 2HS3A 4DL2A 3QSYB 3C19A 9ATCB 3UPFA 4ZVQB 3K5NA 2XO6A 4M5JA 2OSQA 1R8CA 4OYIA 1XNQF 3T1YJ 3GB0A 4OX8A 1FERA 1RBOB 2YVSA 3TUIC 3AFGA 1VGYA 3AD9C 2YNHB 4I2PB 3OSPA 4YMEA 4DUYJ 3T1AA 2ZVSA 3DMJA 1VJWA 5K9FA 2BBEA 1S1XA 3B8HA 4J9UE 2HHHJ 4FYWB 1UAWA 3IXQA 1BQNB 5HQMA 4EK2A 1SV5B 2IVYA 2FHMA 2GVDA 1S9GB 3CMQA 4WU3A 4DLEA 1JXVA 2OLWA 2E5GA 4AFFA 5J2NB 1X9MA 4K4WA 1NK7A 3DLHA 5T7LA 3JQJA 2DB1A 3HX9A 3SXLA 3GJQB 2GIQA 3A8KA 1R7IA 4KFBA 3VTIA 3O44A 2GJ2A 2DGUA 1NBEB 3D54A 1T03A 4RL1A 4TKTA 3W64A 1TK5A 4IRKA 3PJ9A 2B5JB 3L7UA 3T19A 6FD1A 3D9BA 1HL6A 1GT8A 3DNCA 1U25A 2VH7A 2GAGC 4Z2XA 4RW7B 2UU9J 5JXSA 2CNOB 1RWVB 3DLGB 4ERDA 3KHHA 3NGSA 5E3CA 1YWXA 2HHVA 3THVA 2HWHA 2Y1RI 3SCJE 4A8XA 3D0IE 3FCVA 2CJAA 3L9ZA 4DN9A 3PX0A 5JJBA 1WKLA 4C98A 3QRQA 5HMYA 2HHXA 2HZAA 3C8YA 1B3TA 3CWJA 5D3GB 4M94A 4Z37A 1TU0B 4AUKA 2YWGA 3QT5A 2EFVA 3PYFA 2J0SD 4PG4A 1TELA 3TAQA 1KTQA 4CH1A 4OZ2A 1PSDA 4Z7CA 1NJIT 2QTWA 5IC4B 2VFVA 1SKRA 2GJFA 3M6UA 1APSA 2HFZA 2UZAA 1FJGJ 3DRPA 3KMSA 1NXIA 4HH0A 1YQHA 1NJZA 2OPRB 3C16A 1S97A 4X65F 2MQLA 1F9FA 2MJNA 2RRBA 3TW0A 5F9NA 3A3NB 1SIWB 4DFKA 2ILYA 4NX9A 1L3KA 5E3PA 3EWGA 3F44A 1TFYA 4OYMA 2XMWA 3CCRS 2GNKA 1DTTB 5CHCB 4EFAC 2YNIA 1RCXB 5DJBA 3QIDA 4CO5A 3LP1B 4KPCA 3CD6S 2H54B 2CPXA 4C11B 2DNKA 1EIYB 4PR6A 4ZK7M 3TUZC 3H2VE 4N76A 5ETNA 4X4QA 1UVNA 3W2VB 1RHRB 3GMGA 3NG8A 4NA1A 1WC4A 2ASJA 3DHWC 2Z58B 3TANA 2CQ0A 3QAEA 4DV6F 3OV7A 3C14A 1SJ1A 5L1LA 2RH3A 3AODA 2GVZB 3LUYA 4PZVA 4UOCA 3PHTA 3D0GE 3OQ2A 1FXRA 2JC0A 2XYGB 3RJMB 2ATCB 1FNOA 3QT6A 5KG5A 2MXYA 4PG8A 2GZOA 4NYZA 3M8PA 2E5LF 3JB9k 3A3OB 4CRJA 4A8WA 3V6DA 2M88A 2BV3A 2F8EX 1AA1B 5K8MA 2HZVA 2GFFA 2IM1A 1HNXF 1N33J 2AT1B 5KFRA 2G0IA 3I4PA 2GA7A 3PFOA 1IM6A 1RKJA 4W98A 4UUWA 3CC4S 5HMXA 3L3CA 6AT1B 4B3MJ 1S49A 5ETRA 2I2YA 4NZ7A 1RT6B 3EZ5A 2C2OB 2CVEA 5K8OA 2MLYA 1C1CA 3W2WA 3CD5A 3SZ2A 1PC4A 2MTLA 4NXNJ 2C3YA 2J6TA 2M9KA 4IR9A 4HDGA 2W7OA 2A1BA 3O5TB 1ITPA 4C9DA 1LW2B 2ZH3A 1YK9A 3GWCA 2RVJA 1PKUA 1FTCA 4DG1A 2DCUB 3E3XA 4DF4A 1F3VA 3GIJA 4FVMA 2XGQA 3O3LA 2PEBA 1RWUA 4KTQA 1RAOA 5HANA 1TMMA 1YJVA 4ZVTB 2IM0A 4RBUA 1R8BA 3DMJB 2HW3A 2VG7B 5D0HA 5GAEU 3KHRA 2HNZA 2UXCF 4Y2KA 1X9WA 2BW2A 1RQ0A 3BKTA 1NHKL 1UEUA 2VC0A 2ASLA 4OYBA 4N77A 1SL2A 3C46A 4DR7J 3W61A 1S6OA 1WG5A 4HACA 1FXDA 3Q2TC 1XTZA 4WPAA 4DQSA 4AL5A 3H59A 2XWXA 1I94J 1EAYC 4PAAA 3VAGA 1RKIA 3LP0A 3AD8C 4ZLLA 1T03B 3LGHA 3KMQA 1TKXA 4UTGA 2IYGA 4KGXB 4OZNA 1XMQF 1B70B 3EYZA 3OL6A 2C28A 1QUVA 1DTQB 2Z2LA 1YI2S 1N56A 2LXIA 4EO6A 4IG0A 1HQUB 2HBRB 4DSIA 4FXWA 3GJRB 4XDCA 2ZBPA 2WRMA 5MLCV 4K50A 1YBUA 4DR4F 5CXTA 3SV4A 2WOMA 4KY3A 4M5HA 4ILMA 3IR5B 4C7QA 4D3GA 4F0HA 3TVYA 5J1NA 3OSNA 3HK2A 3G8TA 2D74B 3H0PA 3PJWA 5D6GA 4EYIB 2WW8A 5D4LA 3TAMA 2ALZA 3EPGA 3CCQS 2F65A 1O0PA 3UCUP 4I2QB 3TI0A 3D1HA 3C16B 3KDNA 1OSDA 4X66F 4DUZJ 2YKQA 4P10A 1S59A 1SH3A 3DN9A 4J9LA 1I6JA 4MYUA 2UVUA 2FHOB 3VV2B 2JOQA 4ZVEA 2NZCA 1YVFA 1WORA 4HLBA 2YNIB 1O8BA 4HH1A 1JJ2R 1DARA 1Y3JA 4J37A 4IKAA 2ZWOA 2JFDA 1RTHA 2VODA 3CD7A 4NZ0A 2EBGA 2MZTA 2JEGA 1TVRA 1L3UA 5E0OA 1JK9B 3DOLB 1VISA 3CCWA 3T5KA 4ICLB 2QN6B 1FEHA 2VF3A 1WNEA 1JKHA 4Y2IA 3ZO7A 3QGHA 3I31A 2XLJA 4P52A 5FJ4A 1HNIA 2VKZG 4KPYA 3ZXWA 1J5EJ 1Y7PA 1W7WA 3C14B 5H1SV 3SBMA 1SJ3P 3UD4P 3GR0A 1UEVA 2L9NA 4F4YA 3ZTOA 3CW2C 2U2FA 2UVVA 1FRIA 4LR9A 3V6DB 4CYUA 3MM5A 3N9UC 1RTZA 5F3ZA 4A8YA 2XMVA 3G82A 1VQ6S 2J8AA 3CCSS 4K4XA 1RT4A 1LWXA 2DITA 4X64J 2Q1LA 3UWTA 2D3OR 1L5UA 4TNOA 3W2WB 1EB0A 3LAMA 1S1VA 3EZUA 2FZKB 1FEEA 3HHLD 4DL0C 1VQSA 4NLDA 1Y0HA 4ZP8A 1NK4A 4HEA9 2VFUA 5ETPA 1FJCA 2OFHX 3ZNUA 1TUVA 1VC0A 2CQ2A 2Z2ZA 1WG4A 4DQRA 3MEDB 1HMVA 2GGPB 1UWBA 3MD1A 2KVQE 1JJCB 3R3TA 3AAWB 1JJ4A 1PYOB 4LSLA 1FESA 3MHYA 4F3MA 2WVDA 2HNZB 3A8JA 1FFSB 2CPHA 3X3UA 5MAOA 3MI7X 4DR5J 5KFMA 1Z2ZA 3OXLA 1XMOJ 3AOAA 4IG3A 3DU5A 4DPWA 3H4DA 2AZ1A 5LMNF 4USUA 1FVSA 4DV7F 4CO0A 4NI2A 1U6ZA 2LU1A 2PT0A 1SB6A 4BC7A 4CM0A 1IBKJ 2UUWA 1B64A 1LFPA 3IR7B 3PZPA 1SKUB 4ZN3A 4B17A 4DX7A 5IM0A 2JRSA 2NXJA 2J8SA 1Y3KA 3P8BB 2XULA 3NL0A 4DFMA 2ZE2B 4TQSA 3SDEA 1IJFB 3NNAA 2CZ4A 1SVDA 4IG0B 2OJ3A 2CQ3A 2EK1A 1S77D 3M30A 4LRDA 2PE8A 3I0SA 1HW8A 2WOMB 2EBEA 2DHHA 3K2YA 1RZMA 1Y5NB 1E6VB 4YDDB 3KHLA 2A2DA 1BY9A 3DOMA 1WD6A 1T05A 1FKOA 3KNGA 1F1BB 3ENAA 1URRA 2EPIA 4W90B 2BE9B 4FYDA 2CPZA 1YZ6A 3FJ2A 1W26A 1WHXA 1JLFA 2AGOA 3TAMB 3TVKA 2UUAJ 3OHBA 2HK3A 1KQSR 2EK6A 3R5AA 2A3JA 2M5YA 2CWXA 4N8OA 1T9VA 4F7VA 3NNCA 1AW0A 4LF2A 2AEFA 3F73A 3KK1A 4QWEA 1SC4B 4WYLA 1NDCA 3HF5A 3PRBA 4YY3F 1VRUA 1N88A 4AQYF 4KC5A 1TAUA 1T02A 1YKWA 1C0TB 1KS2A 2G1DA 2BM1A 1CVJA 5KT4A 1KFDA 2PMHA 5DM7Q 5KT2A 4M8LA 4USJC 5EHHA 2LA6A 3KK3B 2AD9A 3EZOA 3H8YA 1QSYA 1RAEB 1U8SA 3R5JB 2HVDA 2B43A 2BJ3A 4NCGA 4NXMJ 3NGDA 2C2ZB 2LECA 4B3RJ 4PYAA 1TVRB 3NCRA 5K20B 2MZQA 1X5OA 1FWPA 2YH1A 1JKHB 5KFDA 2AU0A 5E3QA 2MGZB 1LV5A 3I4HX 2QMWA 4ZOSA 2B8PA 1HNIB 3K5PA 1WHWA 3N28A 2J6UA 2WBMA 3KLGA 1K1SA 2I6WA 3M8QA 5C5JA 1SCJB 2W1BA 3PACA 2FUG9 2V4QA 4W4MA 3SCKE 3RG6A 2UUBF 1IBMJ 3R27A 2ZEJA 4B3TF 4X4RA 3CC7S 4CYUB 4KAIA 1R89A 3V4IA 1KR4A 5KOXA 5AXKA 3G82B 3MMBA 3FK4A 1RAAB 4JI1J 1S4EA 3CJRA 1F0XA 1RT4B 1OQ3A 3GIIA 4JV5F 2PSZA 3ENQA 1S1TB 3RUBL 5E2QA 1FJEB 3D66A 3ADAC 1GMVA 1NZAA 2FD2A 1QAXA 2VBXA 2WK4A 5KG0A 4C8KA 1CSJA 3U1MA 5EWEA 4DV4J 4G3IA 4JYAF 1NK5A 1U1KA 3ZZRA 3LWMA 3HJFA 1WC5A 4R0EA 2CFXA 1WUUA 2UUCF 2DK2A 2RRAA 2MMYA 3R5GA 1UKUA 4X4PA 3FRZA 3ZZUA 4DR3F 3HPOA 4KR0B 2W9BA 4A8SA 4CLYA 5H9EK 4M5KA 5LXYA 1YX2A 2W4CA 7FD1A 5B0EA 3OR1B 2C2DA 3U27A 3BSOA 4K0KJ 1SKWA 3GIRA 2GO9A 1WWHA 2P6TA 1FA0A 2KN4A 4NI2B 4RO0A 2KXHA 4L3KA 2KTQA 3D2WA 2HRUA 3K89A 2GX8A 3IAS9 2QA4G 2C2RA 4ZVUB 3C6UA 1R0BG 2JH3A 3D28A 4DR6J 5KG7A 2D41A 4MK8A 1UFLA 4P74A 2KL8A 1KVIA 2V2KA 4DEZA 1CBKA 2ZVIA 4LF8J 2BANA 3PNIA 1MNEA 2KG0A 4P2FA 1HWIA 2XEXA 3WC2A 4MAKA 2YPYA 3PR4A 2YKOA 5HBMA 1LWFA 3H42A 4DSFA 1VC6A 4CTAB 4DR2J 2DPIA 2O5DA 3IM9A 3Q86A 3M30B 2DNQA 3I0SB 2HSEB 2D9OA 4OHVA 4YN3B 3BDEA 1J5OA 2NYHA 2V6AA 3DOMB 1T05B 1KNZA 3BR8A 1AZSA 4Q45A 1I51B 2JLFA 1F2HA 1DBDA 4DHVA 3SSRA 2IRYA 1RB0A 2E9RX 4K5RA 4CLTA 4KKOB 1JLFB 2BUNA 3ILJA 2DGXA 4LFCJ 4YOEA 3QT7A 1U1MA 4MKAA 1P9QC 1NDKA 2HEKA 2EEYA 4C8ZA 1OMSA 1N8RT 2RKIA 2OTLS 2N7CA 2OSRA 2OD4A 2PI5A 2UV8G 4JV2A 3KK1B 4GO5X 4DXLA 2Z30B 2VDIA 3CDWA 2KZMA 4ZIWA 4FF4A 1VRUB 2UXDJ 3C15B 3JTOA 5F0WA 1PG5B 1OY8A 2XO7A 4O23A 4FS2A 2BXJA 3ICLA 1KD1T 4X4NA 3SYZA 4M5NA 8RUCA 2W2NP 1VHFA 2IJRA 2LP4A 4MTPA 2X7IA 3NCQA 3VZHA 1ZTTA 4RNOA 4DX5A 3KLIA 1VRTB 1VQLS 5KFAA 4U6PA 2B51A 1T9TA 4Y6IA 2FYXA 1KN6A 1RHMB 1CJVB 3JTPA 1T9UA 4ED2A 4UF4A 4UQGA 1QDUB 5EX3A 3MMCB 3KLGB 3LGMA 4ENOA 2VQEF 3M8QB 2MZRA 3PV8A 2QYGA 2V2ZA 2HWTA 5KOWA 1NK6A 3I96A 5DETA 4HHHA 5F8HA 4M63A 2DTJA 2R7TA 1O6XA 3RBXA 2WVEA 1DRZA 5D78A 3KJQB 4CLLA 3MMBB 3CVKA 4CLZA 3GV5B 3BSAA 4NLSA 4F4WA 1OSCA 5HROA 2D9PA 4WXOA 3FBEA 3QRRA 4OYAA 4YB1P 2OPPB 1SBRA 1A6LA 5L1KA 4ZHRA 4ZVRB 2CRLA 4BWJA 3GQCA 1MMLA 4QR0A 4AL7A 3MM8A 2QC3A 2PGCA 2FVRA 3R7SB 5EGYA 2Q66A 3H5UA 4LFAF 1YJUA 4DJBA 2VZ9A 4ECTA 1S6UA 3DDNA 5GADU 5FIIA 3P3DA 1WTBA 1OO0B 4FF1A 2LQ9A 3LP2A 1RT2A 4JUZA 2BACA 1NH7A 2RHSB 1ROFA 2R2SA 1VDHA 3U02A 4FP9A 2W9BB 4LVNP 3I9V9 4RZRA 5GMDA 2W9CA 3B78A 4QR2A 2AJ1A 3W9JA 2R2UA 1Q8IA 3BSCA 2CNNB 1LWCA 4JI4F 4F8RA 2WBRA 3RAQA 1VYAA 2WZ1A 3GIMA 4LREA 3MMAA 3NXZA 1H2TZ 1UCNA 5JUMA 2C2NA 3NS5A 5GAHU 4Q0BA 5I4MA 3T6BA 1Q78A 3G8QA 2HFOA 3C6UB 1ZA1B 4F2RA 5L9XA 2HAIA 1S9FA 1MMNA 1YRTA 2VG6A 4LJMA 1LQ9A 5F9LA 2GHPA 1RT3A 1HD1A 2BANB 2AYGA 3MEEA 1RT5A 3LH2S 4FS1A 4J9PA 2LCWA 3CJ2A 5HBMB 1HPZA 1Q95G 2NXCA 4LMZA 3BH7B 2IJFA 2DNHA 4I6AA 1S79A 4OYZA 3R8YA 2DGVA 1ZPVA 2F4VJ 3P49B 4OJ3A 3W63A 4OHWA 1CS4A 1N5QA 4A8KA 5M2RA 2J7WA 1U26A 5KFEA 5C24A 1RT7B 4UZCA 4P7TA 5A8KA 1Q82T 1RTDA 1FI4A 2MEWA 1Z1ZA 1WHVA 3C6TB 4J9NA 2RAQA 2ZH8A 1RXOB 5IWAF 3FNNA 1U1LA 1FRXA 4ZJOA 1RYRA 1KC8T 3FEYB 2V69A 4J9MA 2H4YB 2FVPA 3PX6A 4QYZJ 4PEOA 5CZXA 2NSCA 1NLKL 4QW9A 4DV1J 4IQXA 2PEHA 4AYBD 2P6SA 3G2XA 3HVAA 1WC3A 2PIIA 2D3O1 5L8RC 2XCPA 4ECYA 2EFQA 2ZJRQ 3P5TL 2YXLA 3KLIB 2X1BA 3J81U 3M6VA 2LEBA 1NJWA 3KYLA 3T6JA 4CO3A 2CQ1A 2HZCA 1FWLA 5D0RA 3OFEA 3W62A 2ZBQA 4S0MA 1FDBA 5DGBA 1C4AA 5KFLA 4O3NA 3IBFB 3DLEA 4ELTA 3W5XA 5CD4H 1FFGB 2FQQB 3MCOA 1D9DA 2R7UA 3HZEA 3DGPA 3THPA 4ZPBA 2ZUGA 2V63A 5ETQA 1NM2A 2PO4A 2ZH4A 4N5SA 3J80Y 1G3OA 4PG6A 3JTNA 1HBOA 2DGOA 4LF6F 3ZTRA 3QYYA 2POKA 1ZBTA 4ZHRB 1EQMA 1KQKA 2FZCB 1BUXA 4EYHB 2CQIA 3VVUA 1KQGB 2VBZA 3MM8B 2LQJA 1K1QA 4OHXA 2KRRA 2L08A 2WONB 2GHWA 4P71A 4LBPA 1M5OC 3FUYA 3D5MA 1TTHB 4CLUA 3L95X 2ASYA 2BX6A 2GHVC 3LP2B 3UQSA 3Q8YA 2ZH5A 2BJ1A 1L3SA 2H5EA 1XEZA 3I9ZA 2AWZA 1F6TA 4KHPJ 2OPSB 3VGTA 1FX2A 2W9CB 3IP0A 4RUCA 3D1QA 1ZH5A 3D68A 2AJ4A 2W2QP 3DI6A 3ETMA 1TZ0A 2VJVA 2K1RA 3NMRA 1LWCB 3UDEA 2AIRB 3HHDA 4ZJQA 3MMAB 2VL1A 2R7OA 4Q0BB 2XSJA 4ELUA 4JI0F 3KKFA 3TVZA 4U8VA 1IBLJ 2VG6B 2LQ5A 4MK9A 1RT3B 3WHIA 3MEEB 1RT5B 4WFNQ 2DH8A 1OY9A 3OLBA 5DG9A 4L6V3 2FZGB 2IAJB 4D3HA 1KWMA 3LPEA 3NLCA 3G6ES 1HPZB 4UOGA 4F4ZA 3W5ZA 3S8SA 5KAKA 3UI3A 1ZAWA 2CWKA 1CS4B 2C2MB 4C97A 3LAKA 3NCPA 4C3LA 5F8JA 1BD6A 1RLCL 4Y2CA 3O1LA 3EVMA 1IQTA 5A8KB 2A18A 4IYQA 1GX6A 1RTDB 2VHGA 1RA6A 2DNOA 1NRKA 2ZKUA 2GQCA 4YUDA 3ISND 2VASA 4DQQA 1U1RA 5HVFA 3PEHA 3DLKA 4LIWA 4GVLA 1X4EA 3POTA 2XZTB 3P45B 4FZVA 3T5HA 3GV8B 3KLFA 2VDHA 3QZ7A 1BWVA 4DX8H 4AE5A 5CQGA 1EARA 5BYRA 2HNDA 1L3VA 4Q8FA 4J9OA 1RT1B 2VONA 4IRDA 1H6KX 3N79A 3FQKA 4GO7X 1KLMB 2RJZA 2NS1B 1S72S 5FLXU 4OYWA 1RHUB 2AGPA 2BVZA 4UT4A 2MHNA 2DRAA 3QO9A 1WF1A 3NBPB 1DLOB 1GK8A 3PJXA 1XNQJ 4JI7F 2ABYA 4ZVGA 3VAJA 3KLHA 2F9JA 5IT9U 4WFBQ 3KXDA 2CPDA 4JOUA 5DDRC 4NWBA 4DPOA 1X4AA 2YKNA 1L3TA 2ZJQQ 3DLEB 2CPEA 3T9NA 1HW9A 3E01A 3HHKA 2A2CA 5LT5A 4EO8A 3TA0A 3EGNA 1Z4UA 2Y0SD 1FFWB 3HD1A 1YJ9S 3TA1A 3K5LA 3DKDA 4DU7A 3CSKA 3LA0A 1FD2A 4H4MA 4CLPA 4MYTA 4I7FA 4WK1A 1HBOB 4IH5A 4FF2A 2IBOA 4YB7A 4KGKA 3ZZPA 5IXUA 1JLBA 3NP5A 3VWSA 4DV2J 5B08A 1RE1B 4X4VA 3NGRA 3Q23A 4ZCMA 3CIZA 3MCMA 3UDVA 2A6MA 2KJWA 4LVOP 4MKVA 4OJ1A 2YPZA 2CJKA 1K73T 1NMEB 3ZTQA 3VCDA 3PO5A 2OIHA 1X4GA 1IUJA 1S1UA 1VQ9S 5HP1A 1REVA 2QMXA 1FNMA 4PXDA 4DPXA 4KB7A 4URSA 5KG3A 2G13A 1KQFB 1VR6A 3FSIA 2A0FB 1WEXA 3HSGA 2B7BB 4OI6A 4UQTA 3MTKA 3MPDA 5HMZA 4A8QA 5J2QA 4DOZA 3B4MA 2JSXA 1RLDA 5H9EJ 4OX9F 4ECZA 2RNEA 3R5DA 3CCZA 2CZ9A 4A46A 4ZDNA 1B0TA 4NMXA 2H5JB 1E6YA 2XSJB 2KHCA 2DO4A 3VGVA 2MQ8A 4GC7A 2MQQA 2WVFA 2HBZB 1V5VA 2UVWA 2QA2A 1ICEB 4X65J 3K8WA 2G2ZA 2XY7A 2VPWB 1R0AA 2P9CA 1RA7A 4Q2MA 2ZDOA 4PPZA 3CO9A 2XZWA 3DDIA 4PXCA 1S0VA 1DZ5A 2RD5C 3MECA 3T9ZA 3PG9A 3QBCA 6FDRA 1JXLA 2WB1D 1NB7A 2HHPA 3ZTPA 4OI4A 3W9HA 2E1AA 2QA1A 4EEYA 5A2QU 4P75A 3QWUA 2H3EB 2GS8A 5ETMA 2HMIA 5AE2A 4J9KA 2HHWA 1YJ7A 1H3DA 5HSPA 3KJFB 3ZZOA 3QATA 4DV6J 4JI2F 5J2PB 3WBZA 1XC9A 3Q24A 2JLGA 1MU2A 5LMUF 3JYTA 4NLUA 2DNZA 3ET6A 3M9OB 2DNPA 5AJ3F 5CD4A 2E5LJ 1WC0A 3DLKB 5I3PA 2I0XA 1Y9OA 2YTCA 3HFKA 1HNXJ 3POTB 5A8RB 1JQGA 3GFHA 4G65A 3KLFB 1UTAA 2QJ3A 2VA2A 3VHQA 3OD2A 2WVCA 2N3LA 3TX8A 4ZVHA 3KTQA 4M5IA 2R7WA 3M6XA 3M8RA 4KRWA 4WIIA 1KOHA 3MAQA 2ZOFA 3I5CA 5A0YA 3RW7A 1U49A 1QTMA 1X8DA 5DZ6A 5FDLA 5B0AA 2VUGA 2HNYA 1LXNA 1OS5A 1F5AA 1RACB 4WFYA 3CB4A 5CYQA 3KLHB 4V19J 1M5VC 1HARA 4OZJA 4USIA 1K0TA 3BREA 2PA3A 2ZH1A 2XY5A 1SJFA 4TYAA 1VQPS 3EGWB 2Y0BB 2YKNB 3PR5B 2GAHC 3K57A 4QPXA 4Z7YA 4EZ9A 1HBNB 4G1PA 2OKQA 3E01B 1WDDA 2AMCB 1S1WA 2CQ4A 2MKSA 1H74A 2K7JA 2R7RA 2FHJA 1Q0NA 2UXCJ 5LJ3Y 3MAAA 4KJIA 2QLXA 4H4MB 1W2BR 3MPWA 3ITHB 4I7FB 4CO1A 2QO3A 3DRYA 2FPHX 1MWZA 1WC1A 2Q79A 5ETLA 2G4BA 4GKJF 1JLBB 2R3VA 1TL1A 4RW8A 2R8JA 1DAXA 1KKHA 4DR1F 5KFWA 2XHWA 4M1KA 4M5GA 2LLZA 1ZS6A 4IH7A 4KE5A 3PW0A 4UZBA 1TKTA 1VFJA 4PUOB 1XMQJ 1P27B 2MSSA 4J9SA 1HA1A 4P2XA 3BB5A 4WP8A 2EI5A 4EUVA 5HP1B 1EP4A 1DJ0A 1UEKA 2BRKA 1AROP 3CEDA 1TKZA 2V8DA 4ANDA 3QT8A 4TVAB 4PXBA 4NZ6A 3MR2A 4DR4J 3AJ1A 4OZ0A 2BJ9A 3AQOA 4KV8A 4YB5A 2RMLA 1QSLA 3OTOF 4K59A 1T95A 5J2QB 4ECVA 1W2IA 2I8EA 1MROB 3DHXA 1D3WA 1FDAA 4HTJA 2PD1A 3N4WA 3NWGA 1LEOA 3LPYA 1E6YB 2VJUA 3UNGC 3NY0A 1HKAA 2BZ2A 2CQHA 4QCLA 3TA2A 2V9KA 3ILOA 2J6SA 4X66J 2CJYB 3H4BA 1XJWB 2FLLA 2IM2A 5DDQC 5K8PA 1T9XA 1Q86T 4LR7A 1LOUA 2X1FA 2FGOA 4KIAA 1UPPA 4F36A 4Y2AA 2Q6BA 3DGVA 1YJTA 4UW2A 3PM9A 3CDUA 2LVWA 2EFPA 1SI9A 2KHDA 4ED4A 4ETZA 1KLNA 3MECB 2U1AA 4ANEA 2K3KA 1T3NA 5G0RA 2CNLB 1K44A 1S5ZA 2V9WA 2JX2A 2WAQD 1S10A 4FPRA 3JSYA 1SC3B 4PPDA 1N34F 3KJNB 4HKQA 2Q43A 1HI8A 2Y8YA 4OI3A 4PWWA 1XR6A 2XCAA 4J91A 2HMIB 1V3SA 1IKYA 4YB6A 2W2PP 4E98A 2E1CA 4BCAA 4ZP9A 1C1BB 3DDKA 3PYEA 3M05A 1QY7A 3CIMA 2D69A 2OPQA 3NOGA 1RAHB 2E1RA 5LOQA 4M95A 3M2RB 1FWKA 3VGUA 3SSSA 2FHKA 1QVGR 5D15A 4YP3A 4DV0F 1F5BA 3UD3P 2KYXA 1JWWA 2EFOA 2O01C 2DNGA 1Y4ZB 4WIQA 5IQQA 1AUSL 3FFIA 3CF5Q 1FNXH 5KG2A 4USVA 2DHGA 3G6YA 2E9TA 4TYBA 4V1Ak 2DEJA 2VC1A 3MCSA 2CG8A 2AJQA 3HVTA 2ZNYA 5HQLA 1X5SA 2J0XA 5AT1B 5A0YB 3QIPA 4DQPA 2IIHA 2YWWA 4DZDA 3HM9A 1HYSB 1D8YA 2BQ3A 3FEZA 4E0DA 2HNYB 5DG7A 4HR2A 2KG1A 2GO8A 1ZA2B 1QAYA 3UE2A 2PMWA 5CYQB 4B9TA 5A8WA 2GV1A 3BQ0A 2ZKTA 3WX4A 1VQOS 3KUHA 3Q22A 3MFIA 2FC8A 1KFSA 4ATNA 1CULA 2MSTA 4F0MA 4N56A 1S1WB 3MD3A 3MM7B 4TU9A 1M5KC 2K06A 3JSMA 1RJJA 3V5RA 3MAAB 1P8GA 2R8KA 3B54A 2DRDA 1GMWD 2ADCA 5LMNJ 2Z2YB 4DV7J 4EBEA 2JEIA 2G0CA 4RNFA 1QUPA 2NUHA 5CH7B 5GMEA 2C1EB 1A7GE 2ACMA 1U2FA 5HI7A 4Y00A 4YR2A 1NJYA 3OTCA 2A10A 1TKTB 5HMWA 2BOPA 3DLJA 2CQDA 4JI8F 3GYNA 1HBUA 1HI1A 4MH8A 2Q6CA 3PXGa 3DRRA 1AB8A 4DL6A 1F9EB 1IR2A 1U1PA 4ZCIA 3LOUA 1EP4B 4EI2A 3FMBA 1B7FA 1KHWA 1RAFB 1UPMB 3IRXA 2BOAA 1TKZB 3HVWA 3T1HF 1S99A 4JI3F 1X4BA 1RTIA 2XTJP 5U47A 4CLKA 1C0UA 2OEJA 4ZPTR 3DC2A 2J76E 1UFWA 1UA1A 3V6JA 2GIRA 4H4OB 2F1FA 2FLOA 2V94A 3AA8A 3PHEA 2PMZD 4LQ3A 2W8LA 1T3OA 4RNHA 3Q8UA 2IDEA 2HVEA 1FRHA 2V4JA 2QLWA 1NAQA 2P5VA 3LANA 2VB6A 4MIBA 5L1JA 3MR3A 4O3QA 2NPIA 4XK8C 2ERRA 1YDLA 2W4PA 4YY3J 4ZVPB 2RQKA 4AQYJ 2KRBA 1M5PC 4C0BA 2V2VA 5KFXA 2OO4A 3T5JA 2Y9HA 2HHSA 2CJBA 3GILA 3TEHB 1WEYA 4LF4F 3PW2A 4XDDA 2LMIA 2BA9A 2YKAA 4ITSA 2D7SA 4QIGA 2M70A 1K9MT 1CC7A 5KFSA 4PQUA 3Q83A 4RBTA 5G0RB 1AUDA 2HFVA 1R31A 3EM1A 5J2MA 5G4DA 3R1LA 2JL9A 1FE4A 2LA4A 5BR8F 1ACMB 1S7HA 2ZH9A 4IFYA 1SL0A 5IZHA 2W7AA 2Z2MA 1T8EA 1IKYB 1VQKS 3KK2A 3KOAA 1UVJA 4F2SA 4RW6A 1CJKB 1QM9A 3FZBA 3PW5A 3OHAA 3A13A 2HFSA 2HKEA 2HLUA 4B3TJ 1IKVA 2HQDA 4O3PA 1YJRA 1H7WA 1Y5IB 3BF4A 4CLWA 2DNNA 2CZVC 5F8GA 4K4YA 1KRPA 2XQCA 4LSNA 2QL9B 4E2FB 2H1YA 2MKIA 4URQU 2IYIA 3EVWA 4F0KA 4JV5J 4U7UD 2W25A 4ED8A 2B4UA 3CNQP 4I56A 4O0IA 2N82B 3ENWA 2ZHOA 2MY7A 2HRYA 2Y3YA 2C3MA 4DPTA 2QV6A 2DGQA 1WOPA 5HJXA 2BJ8A 4YHHF 3BEGB 3ISZA 2QSWA 5KFPA 1KHVA 2E1MC 4JV0A 1U8WA 3RW6A 1N32F 1N36F 1EJ7L 3D3CJ 1N52B 2FB0A 3KUEA 1VQYA 1OPZA 4DU8A 4FF3A 4JYAJ 2UUCJ 2ROEA 5A8WB 1BQMA 1RAJA 3VGSA 3I0RA 1P1TA 1NSQA 1JNZB 3U1NA 3S6EA 3MUMP 4K8RA 3LF0A 2DEIA 3MXHP 2YWFA 1CULB 2Y1IA 4DR3J 1UW9A 5ITHA 3BQ1A 4LF5F 2OGUA 1WHYA 3JSMB 1BHNA 2AKWB 1MN7A 1BGXT 1EQ0A 2FJAB 1VK8A 3GYGA 2IY5B 3H7HB 1OJ4A 2MPUA 4WFXA 1DQAA 3CDEA 3OPKA 5A6WA 5KFFA 4UY8T 1S1XB 2RQ4A 2LYVA 4LSZB 2HHUA 1TL7A 4B3OA 3IGNA 2GVDB 5AXMA 2Z0GA 1N4LA 1GXLA 1RU1A 3HSDA 4QU6A 1AT1B 3BGRA 1HNVA 2E7WA 1N6QA 1HBUB 3DRRB 5T7LB 1KOOA 4C3MA 3M32A 4HDHA 1F2GA 5JVHQ 4L3NA 4FBTA 1YG0A 2F7VA 4KFBB 1TL3A 1AYEA 1FDDA 4DDFA 4CH7A 3L4BC 4WKRA 4K4SA 2NXEA 2VQFF 3TO8A 1QAIA 2VOPA 1FO1A 1HD0A 3P4UB 1B0PA 2IM3A 3W3SA 5KT6A 1C0UB 3LGNA 3OBIA 1KTVA 4WJBA 3GG0A 4OI0A 2AJ0A 3W66A 4OMFG 3GFXA 2MQOA 3Q0AA 3HFVA 4X84A 4QIEA 1M0SA 3Q8PB 2NSBA 2M7SA 2J0QD 2KJVA 1F9HA 4DL3A 3RB0A 3TJ8A 3DXSX 2CUYA 2E44A 3NGTA 3MEKA 1YBTA 3PKYA 2B7CB 1ZOTA 5LSOA 2EKNA 2KDOA 4HI1A 4EBCA 4RNNA 2AGQA 1H72C 3DRPB 4KHRA 1SPBP 3A8EA 1V9OA 2RQCA 4MT1A 4QYZK 2DXFA 2LEAA 4PQUB 4B08A 1Q16B 2JDJA 3AQPA 3QGPA 1U2RA 1VHIA 1CJUA 5J2MB 4P72A 2V5HG 3AY0A 3HKZD 3UCGA 3TZWA 3AOBA 2KB2A 3TNVA 1IR0A 1F5CA 3G86A 4RX6A 5DDOC 4IFYB 3CJSA 5E33A 3IS9A 3NEKA 1VJQA 4CCHA 2QT7A 3VZIA 4OFZA 3KK2B 1G1XA 4N7TA 1NU4A 4DS4A 2VQEJ 2YWEA 3J7YI 3N6NA 4L76A 2RDJA 2VICA 4LF9F 1RWWB 3GFYA 4FKYA 1IKVB 2ZD1A 1S6PA 4ELVA 1DY3A 4RU9A 4QZVB 3IAM9 4MKYA 2CQPA 1IWGA 1RWNB 4JBCA 3IN5A 5F41A 3M8PB 2BQRA 1PJ5A 4XPEA 1P1LA 1G4CA 3HULA 2W24A 3TYTA 4ILLA 5B0CA 2RQMA 3RU0A 1YGYA 3EDQB 1IR1A 1NUEA 4NEZA 2BYCA 2UV8A 4LFAJ 3MCNA 4C8OA 2WVBA 2Z4PA 3VAFA 1NDPA 1C1CB 4LR8A 3LTOA 1WEZA 2LFVA 2WTFA 4A4JA 4EMDA 4HT7A 3I0RB 3GE9A 1RI7A 2MKJA 4JI6F 4ZPDA 4DFPA 4Y2MA 4I67A 1NSKL 4FYVB 3U1LA 3CJTA 2MQMA 3BGOP 5KFHA 4FXVA 4OQJA 3BJYA 4DG1B 1OWXA 2AYEA 2GMJA 4RPFA 2JZ5A 2HYIB 1CLFA 3OTDA 2E1PA 4Q43A 3WQPA 2IVMA 3H5XA 4LRFA 1EKSA 4JI4J 2CYYA 3PCOB 1N5VA 1SJQA 1N0VC 2OP5A 1FCAA 5IT0A 3M7VA 5A6PA 2J9DE 4UY85 1NKCA 1YRUA 3DRXA 4RU2A 3HZGA 4RKUC 4N8NA 2DPJA 2CDQA 4MMOA 4I2PA 5SZTA 5IQ6A 5C25A 3F0NA 1H2VZ 2NPFA 1RAGB 3MPUB 2CXEA 1XMBA 4TXSA 1BQNA 3I5BA 3VQSA 4OJHA 3IM8A 3M32B 1G7CB 4TN2A 4HACB 3FQLA 1TL3B 5BXIA 4QWBA 5J2NA 3LP0B 4ED7A 2EC2A 4DV5F 1TKXB 2O1PA 2RDIA 4F26A 2DJWA 3EE3A 2YBVA 2IVFB 2PI4A 3H5YA 2N3OA 3R5CA 4RW4A 1TQLA 5F0UA 2PFDA 2JC1A 4ES2A 4ED1A 1HFEL 2W01A 3QGGA 2JVRA 4DL7A 2AJ2A 1HLWA 1TKDA 1Q4RA 3ETOA 2E9ZA 4RW7A 1UJ5A 4WTYA 5C2CA 3VQTA 1NCLA 1P9YA 5IWAJ 1UWAA 1XNRF 1REGX 3CDAA 2DR6A 2BJ7A 3QZ8A 4IO1A 2MZ1A 2DO0A 5E3AA 3OVSA 3JSRA 3CJ5A 3K8VA 3CDBA 2DHAA 5B09A 1M1KT 3QMQA 2OI2A 1QVFR 1RWPB 2I1RA 2KYZA 3F41A 2Q3PA 4A8FA 4C0OC 3P6YC 4ECWA 2Z57B 4QWCA 2L48A 2CPYA 2V50A 1Y10A 4O44A 2HQCA 4K4UA 1YTYA 3IS9B 4F3QA 2HQIA 1HNZF 1RTHB 3RYLA 1Q1KA 4UOFA 1MLAA 4CLFA 2M0GB 2ZOGA 4LFBF 2ZJPQ 1T7PA 2YX4A 4HI2A 1EX8A 1RBLA 1KONA 4RW9A 1NHUA 1PILA 3LP1A 3PW7A 4FPIA 1KDNA 4ZA1A 4QWDA 1XERA 2AW0A 2KU7A 4KT0C 1S6PB 2YH0A 3FEXB 2OMLA 2CJQA 2FJEB 4JI5F 5CYMA 1W25A 2MQNA 1NK9A 4MFBA 1EETA 2H48B 4LIRA 5ETKA 4LF6J 1OIAA 1VQ5S 5GAGI 2IA0A 1Q7YT 5HO4A 1UP1A 3MM5B 1S4FA 3H20A 3KG1A 2GVZA 3M8ZA 2AEMA 2LQBA 4OJGA 2GMLA 4NLYA 1VLOA 2DT9A 1H2UX 1ZM2A 2HAFA 2XI3A 1JIHA 3VAMA 3N01A 3MGJA 2VOOA 2XHCA 3K5MA 3HI9A 4K5SA 2W9AA 3SV3A 3JS9A 1K0VA 2DHSA 5DQHA 4BWMA 4PG7A 5BYSA 4ED0A 1U2CA 1S1VB 4QIWD 2VA3A 3H25A 2QL7B 5ETOA 2MKKA 2HS4A 3I87A 1RT6A 1EHWA 3UO0A 4YQWA 4B3SF 4WBFA 5IT4A 1H73A 3J81j 3CD0A 1RWXB 2L9DA 2XB2D 2DR5A 1WELA 1SJRA 3TOQA 2KM8B 1SL1A 1HMVB 1JLEA 1UWBB 1LW2A 2RS2A 3PO4A 1RAIB 1LFWA 5DRKA 2LXFA 4LSLB 4GKKF 3PYGA 3THTA 1HNWF 5E41A 1PBUA 2C2KB 3J81Y 3N5BA 1IQZA 1T11A 2DNYA 1DURA 3SIPB 4JI0J 3QRPA 2DGSA 4ALZA 5C25B 2LDYA 4IG3B 2B0GA 1YITS 3CE8A 3K7RA 2RSQA 3RBZA 2HBQB 4ETXA 2VG7A 3V81A 4QWAA 4ZCLA 3EGVA 2LU2A 4Y34A 3BN4A 2SXLA 3VVTA 2DXDA 4WCEQ 1VQ4S 1ZAXA 4OL8A 3I32A 1JB0C 2VIHA 5IM0B 1VC5A 3D6HB 3AOCA 2IJNA 1UVMA 2BMBA 2FIUA 5HQ8A 4K2JA 2WSCC 4F02A 4DV2F 3JAMU 1LK5A 4X4TA 3SDEB 4RW4B 2HLTA 4C8LA 2I5JA 3MR6A 4EWTA 4DV3F 3ZZYA 4DX6A 3MPVA 2RB7A 4PWDA 3GCXP 2ZM6J 4AL6A 4I4BA 4ES3A 2DGWA 2GIFA 2JHEA 1D8ZA 3NAIA 2Z8QA 3OR2A 2QA4S 4ZVSB 4M5MA 4FKXA 4NLXA 1DTQA 3WC0A 1HQUA 1SUQA 1IN0A 4NEYA 1FKOB 3OFHA 2R2TA 3CJ8A 3BPDA 3R9LA 4IRCA 3W60A 1IBCB 1ULRA 2FLNA 3CT9A 4J9QA 2OD6A 1VMBA 3GSDA 4J90A 5CCLA 2EVZA 2GMHA 1NK8A 1CQNA 2XWYA 4GC6A 3OJSA 4DSJA 2Y8WA 1BMQB 3GFZA 2FVCA 4G6VB 5AE1A 5H9FJ 3P96A 5K8NA 2XMJA 4HT5A 4I2QA 1S12A 3M8WA 3A12A 2ZH7A 4O44B 2BKPA 4IFVA 5I42A 4JI7J 4WE1A 3MPYA 4CDIA 3SFGA 4C4WA 5KTQA 1FJ7A 2XGPA 4RR5A 4NCGB 4P7VA 1JLGA 1JNRB 3R2CJ 1Q8LA 2KI2A 4RW9B 4WF9Q 3D3BJ 5KG1A 4O3OA 2XZDB 1WTFA 3DOLA 4U67Q 3DLBA 2LQ8A 4ICLA 2FJVA 5CYMB 3O6QA 2ZBCA 1S76D 4NMLA 4MFBB 1EETB 2J7KA 5IV3A 2M8HA 2OFGX 4WYWA 2ZZMA 5DM6Q 2ZUAA 2ATLA 1R0CB 4W92B 5K14A 2XYHB 2IC3A 2DXEA 1GXUA 4Q7AA 2CG4A 3V4IB 1YLXA 2R2RA 2B9YA 3VF0B 4HVZA 3MUTP 3FKBA 3CO0P 1VIOA 5F3TA 2XMKA 1FX4A 1QTNB 4DWIA 4TLQA 3PRVA 4CIOA 4HL9A 4QQBA 2GC8A 4QIVA 3QLHA 1B99A 4AD6A 2M3DA 1Y5LB 1OQ6A 2NXNA 3V4MA 4LF7F 3I56S 1RISA 4NRUA 3IWLA 2ZHBA 3FBFA 1M5SA 2R4FA 3BYRA 3HMJG 1P6TA 5KG4A 4XO0A 2IMOA 1HBMA 3EUNA 1VBYA 5EN1A 3D4JA 1TMJA 1LXJA 4J7CA 1JLEB 4BHQA 1U6BA 2XM3A 2EFNA 3ZC4A 3V2UC 4X2BA 4OX9J 3UNYA 2ZWPA 4FNIA 1X9SA 2RUSA 4A8MP 1IWAA 5FLXY 2YKMA 4RLEA 2FVQA 2HVIA 2ZC3A 2ZOMA 3MEDA 4NLOA 2GGPA 4DSKA 4NLPA 4OYPA 2CJ9A 3CCLS 4GMKA 2JWNA 2VFRA 4YR0A 3G8SA 2DVIA 4X4SA 4KQZA 4F25A 5IT9Y 2XNQA 3IA0A 5HJYA 3NNHA 3V81B 1JX4A 1LKZA 3FSYA 4OHYA 2FJBB 4EGLA 3JXOA 3NKYA 1WSVA 2FLPA 2O66A 1MG7A 4O3RA 4EZ6A 4QPTA 3ZZTA 3BGUA 1TL4A 4HHUA 3OVBA 2MKYA 4Y65A 2UXBF 1FDNA 2ALYB 4HHJA 5EWGA 2H65B 2GQQA 3OFFA 1X5PA 4ID8A 4IOBA 3SMZA 3L7OA 4TLRA 3RRKA 1QLNA 2G9OA 2I5JB 1LWFB 3FBCA 3TJAA 3ULHA 2K8GA 1QSSA 4B9MA 1ZAVA 5D4PA 2CIMA 4PWDB 3RB3A 3CCUS 2R8GA 3FC9A 2VPZB 2IBKA 2ZE2A 5B0BA 1AFJA 3OR2B 4JI2J 5KFTA 3GONA 2M8DB 4X62F 3US5A 3A4TA 2HFNA 4IH6A 2C3OA 4P2MA 3GG1A 5LMUJ 1RTJA 4I6WA 3E8OA 1SUQB 1J5OB 4DQIA 5EX0A 5AJ3J 1KVKA 1AZSB 3BN7A 2JNJA 2VBWA 1Q5YA 3JQMA 3FCWA 1E6VA 2XS7A 1WKJA 4MIWA 4LBIA 2V67A 1SQFA 2MKCA 2RKIB 3IG1A 4TU7A 3HDSA 5HATA 4OYOA 4USKA 3KJVA 2RRNA 4RWWA 1FK9A 1V5IB 4DFJA 4ZPAA 2MJUA 4M5LA 3PIOQ 5KFKA 3O8WA 1D9AA 3HHLC 1WOSA 4E8UA 2ZBRA 2W2OP 4ZP7A 3HSZA 2FJWA 2V8VA 2KFYA 3NGKA 3UDCA 4IFVB 2CDRB 3I55S 3CJQA 2X1AA 5I42B 5K5MA 4WE1B 2DD8S 3BYPA 4ZLPA 2ZZNA 1S57A 3KUGA 3G87A 2R9LA 1JLGB 3W5YA 1U47A 1C0TA 1HR0J 4ECSA 3R6GB 3MOJB 3KK3A 1C4CA 3T5LA 1TL5A 2HBYB 3UR3C 5J1EA 2QFJA 2KT5A 3IRWP 2A6OA 2DIUA 1GFWB 3OL9A 3IR6B 5GVQA 2F9DA 4U96A 2B4VA 2MLZA 1WG1A 3CCJS 2LEPA 3JQKA 3DOKA 2MGZA 1EZZB 3SSQA 3HVRA 4GKJJ 5K14B 3S1TA 3ZTSA 2IC3B 3W7BA 4B9SA 3KDOA 3NS6A 1UVLA 4DR1J 5IV4A 5A2QY 3RRGA 2GJIA 2D1CA 2XS5A 3QGIA 3BSNA 1F3FA 1TUWA 3R7NB 3ZZZA 1VK3A 5KG6A 1GMWA 5HROB 4K4TA 4I69A 2WB4A 3CJ4A 3R5BA 3QLHB 1B7YB 2EW9A 1LWEA 3CGIA 1ZM9A 4NOHA 4OHZA 2F63A 4ECXA 2OMOA 1S1TA 2XY6A 1PC5A 3QJJA 4O4RA 2CNKB 1MW7A 3NS7B 1ZYQA 1HQ2A 3MM9A 4KYZA 2AZ3A 3BKFA 1HBMB 2MYFA 1UJ6A 2MZSA 3OTOJ 5F8NA 1UFKA 1U1OA 2DR9A 4BS2A 4H54A 1RT2B 2OUGA 1YHQS 1C2PA 2FHJD 5DS7A 3SQGA 2YKMB 4N41A 1SC1B 3EMTA 5EWFA 4ZKAA 1IKXA 4CNYA 3AB2B 4YR3A 2HHQA 3QJLA 1PYSB 2Y1LB 3CPWR 2X1GA 1IM4A 3T1YF 3I82A 1SH0A 2OEMA 5L46A 3OR1A 3RTVA 2YNGA 5KFIA 1HHQA 5DO2A 2CKWA 2HGNA 3W1YC 5F8IA 3C3LA 4Q44A 4DUYF 3FGVA 4IOCQ 2HHHF 4DCJB 4FYXB 3CTRA 1VQNS 3FZ2A 2BABA 4DCPB 2HVZA 2WSFC 1GX5A 1N34J 3M8YA 3G4SS 3CCMS 5THWA 3G6VA 4ER8A 1HHSA 3ELHA 2FY8A 4ES1A 3H2UB 1TR0A 4M5DA 3MFHA 4KH1B 3HT3A 1BE4A 1RTJB 2FTRA 3OUYA 4CTAA 2V8PA 4ZN1A 4CQ1A 3GU0A 5C24B 2ZITA 3PYDA 3RZAA 4U7CA 3ZFVA 2CJXB 3MEGA 4DV0J 1M90T 1QAJA 1RWOB 4MJKA 4I0WA 4FVCA 2UU9F 5BJRA 1JXEA 5CCMA 1U0SA 3IG1B 2IA6A 3PY8A 2DY1A 1Y00A 2IHR1 3KJVB 2VD3A 4KKOA 2CQBA 1WOOA 1FK9B 3R97A 4OYXA 4ZIVA 1OPIA 2C2EA 2WCXA 2RUGA 4WFZA 5ETVA 2BKOA 1HWLA 2RF2A 1UMJA 4NA2A 3A8IA 4CH0S 3BBCA 3C15A 3OT9A 2P2CB 5HVGA 5LJ5Y 3AD7C 2R7QA 1FJGF 1FTRA 1CJTA 2KH9A 3T3FA 1X4HA 4USHA 4P2SA 1R27B 2DHXA 2C22A 5J1EB 1R8HA 1PGZA 2M4MA 1H98A 4B9LA 3OXGA 4LF1A 4GVBA 4YEAA 3H2LA 2F4FA 4PCQA 3UR0A 1VRTA 2YQ3A 5D4NA 1N5SA 3FBBA 3B82A 3BR9A 3DOKB 4NCAA 2LKZA 3O2IA 1CJVA 4NLVA 2E5HA 5SUHA 2QFIA 2ZFHA 4ILRA 3MMCA 3DGPB 2QX0A 1RADB 2UP1A 1WF2A 4QIFA 2IMWP 2F5GA 5D4OA 2MLXA 1TAQA 5LM7E 2GCFA 3EXYA 2EC0A 2QIFA 4WU2A 4JI8J 4OV1A 2YQ0A 3GJSB 4B9UA 4F4AA 2N4CA 2C3PA 3M9MB 1LWEB 4B02A 5KFNA 3BM7A 2B56A 3CCTA 4MKBA 2OPPA 4KO0A 2PC6A 3GLJA 3T1HJ 2HRTA 5LSRA 1N33F 2HG4A 3MM9B 4JI3J 2XG8A 4ZCKA 4LBHA 2MY8A 3TZZA 1R3NA 3NGUA 3FMWA 2QL5B 3AJ2A 2KVIA 2CQCA 1OYDA 1FF2A 4B3MF 3DYAA 4TQRA 4WFAQ 4B9NA 4YS2A 3TAPA 5KFBA 3SQGB 1RK8A 1RP5A 4NXNF 1FT8A 3N6MA 1VBXA 1IKXB 3DI6B 3J7YU 3MUVP 5HAOA 4WP3A 2F8MA 5IS2A 1HWUA 2K1RB 4QR1A 3TUJC 3Q8QB 1NEEA 2DIVA 4ECQA 2B9WA 4DPYA 4WK3A 4DCOB 2BJEA 3MTJA 2W2MP 2YNGB 3PDNA 5GMKa 2OHDA 4LF4J 3LWLA 3OJUA 2HQGA 3G9CA 5L38A 4P6QA 1T9YA 4FN5A 2QEXS 1FKPA 4HYKA 2W4DA 1LNQA 1PBAA 4LUBA 2Z56B 3R7BB 1SH2A 1Q8BA 2H9ZA 4ZP6A 5KFUA 2ACYA 4AXJA 2ROGA 4CP5A 5BR8J 3RBDA 1WJ9A 2JEJA 4CM2A 1U1QA 3OTEA 2ROPA 3W65A 4DR7F 3HD2A 4M5DB 2FY1A 2L3MA 1QD1A 1H0HB 3MOZA 2QZ8A 3OUYB 3M9NB 1DQ9A 1I94F 1GEHA 2KXFA 3S7RA 3CCES 5KFCA 2DR8A 4P73A 1J27A 5KFOA 3WDOA 1AXQA 1S0OA 1YIJS 3D6TB 4KGMA 2V4RA 3MEGB 1T94A 3AXMA 4ED5A 5IC6B 2O67A 3RAXA 2JJ4D 3HKWA 3RR7A 3CC2S 1VCTA 4OX7A 4OZ1A 4DSLA 2EWHA 2X51A 2JEFA 1RT7A 3IWXA 2C42A 1U0HA 5B0FA 2G0JA 4DSEA 3C6TA 4O0NA 5CZVA 4YHHJ 4NLGA 3MURP 5HLFA 2RF2B 1N32J 1N36J 2HNDB 3KLVA 2JVOA 4DUTA 3N0VA 3QNWB 4IQMA 2DRBA 4L73A 2YWHA 2CVIA 3MMJA 4PQAA 1CJTB 2IPOB 3R1HA 3UVJA 1HWKA 4FXDA 3QO9B 5I3QA 1FD8A 4NYPA 1R8AA 5CAAA 4DUZF 4KHMA 4GRSA 4CNZA 1PJ6A 3W9IA 3K58A 2E5IA 3J7A1 2PN6A 4LF5J 1WDTA 4GVBB 3LALA 2RU3A 1JJHA 2FVSA 2C3UA 1QE1A 4RUHA 1RABB 3CMES 5E7OB 1NKBA 4I6YA 3HHLA 4I64A 4K4VA 1UETA 3BO4A 2DKOB 3IBCB 2XC9A 2NR0A 5ETSA 3J7ZT 1WI8A 1S0MA 3DXBA 2MB0B 1TP7A 3CMAS 1SQEA 2KKHA 2ZZTA 3HT0A 3MM6A 5E5NA 2EXUA 1MWQA 2YX1A 2ADBA 1NB2A 2XS2A 2VKRA 4H4KC 1J5EF 2YNFA 4ED6A 1B0VA 3Q8RB 3C2PA 3D6MB 4V19X 2QGFB 4Q2LA 1N54B 5KFVA 4F67A 1RSCA 3W8PA 4CT9A 1MWYA 4KO0B 3GR1A 1DQ8A 3BDPA 3GCWP 2VQFJ 1Q53A 3DCAA 3DRSA 1RBAA 2J9DA 3KG0A 1CQMA 5L1IA 1KSPA 3B4DA 1S1UB 1PCAA 3PEJA 5A76A 1REVB 1URNA 4X4OA 3BBBA 1NPRA 1IKWA 3BGLA 1ELOA 4AXIA 3DYAB 4MK7A 2WONA 1PAUB 4X64F 1VOMA 1XN9A 3W8GA 1NPPA 2DNRA 3QFHA 3R2DJ 1U09A 4PABA 2N4DA 4FBUA 1UA0A 1N5YA 2WW4A 1S6QA 4WXWA 3TWZA 2XMTA 2CADA 4BBYA 3PW4A 3Q89A 2IDLA 3CJ0A 5I3UA 3OXFA 2BJDA 3QAUA 4A47A 1Q81T 4DBQA 4U8YA 1FRMA 2K2PA 2OPSA 2BW7A 4RUBA 4TY8A 2HVHA 4ZPWR 5BYQA 1EKRA 1RHJB 3X1LB 2NREA 1GTHA 4RBVA 3IC1A 5GAGU 3L09A 3MZIA 3L7PA 4KSEB 1FKPB 2RILA 2COLA 3RB6A 1R0AB 2OEKA 3N6LA 4DR5F 3PKMA 1ZM3A 2H5IB 3BPSP 4ZMMA 2MQPA 1NO8A 1KP6A 4L74A 2IFXA 1XMOF 3EXCX 4C48A 3WIUA 1WC6A 3H5SA 2CQGA 1JLCA 3HLUA 3F56A 7FDRA 1TFWA 3HSJA 4WWSA 2E7VA 1RHKB 5IOLA 3JSBA 1IBKF 1OY6A 4ZVOB 1BQXA 1D9FA 4OLPA 4DF8A 2QLFB 1X0FA 2IAJA 4ZPCA 1MN9A 2FJDB 2N7YA 4OV6A 3J7AN 4A48A 4WP9A 4LF9J 3A1YG 1X4CA 2ZHAA 1WF0A 4DL5A 3GP9A 1K47A 3TR5A 1RWMB 3GJTB 4DL4A 1MU2B 3HHNB 3JYTB 3M1VA 3ET6B 4NRTA 1VQMS 1X31C 3UCZP 9RUBA 3IWNC 2I9SA 2K7KA 4OLOA 5CYJA 3ONQA 5GAEI 2NXUA 2VBYA 4C6AA 1U0HB 1BWEA 4OZ5A 3TEGA 4O4GA 2QRRA 1D1UA 4NA3A 2FC9A 1TV6A 5HLFB 5D0EA 3NOCA 3LQVA 1D09B 4DLGA 1AFIA 3SI8A 1JMTA 4UOHA 4CWBA 1RGVA 1T9WA 4DS5A 2BR0A 2L41A 5DLGA 2UVRA 2QE5A 4F4KA 2UUAF 4NPOA 5DQGA 1XWLA 2NYIA 4JI6J 1UZHA 1H38A 3UVJB 4BC9A 1RT1A 1I5OB 5E3RA 1ZTWA 2AYMA 5FDLB 3HFZB 1D0EA 2P8IA 1U48A 1KLMA 1YZ7A 3P5BP 4RUAA 4NASA 3RGIA 1N5TA 1JLQA 3EJMA 4QJVA 1GAOA 1QE1B 4YDXA 3SQOP 1NSAA 4A8OA 3HHLB 3NBPA 1DLOA 1FRKA 3AXKA 1NPKA 5KFZA 2XNRA 4NXMF 4C3KA 5CABA 1TUGB 3HCXA 4XPCA 2YQ1A 4B3RF 7AT1B 4KGVB 1RUSA 3J7Z5 5D8HB 1U24A 2Y1JA 1KEKA 3MM6B 3CCVS 2OAUA 2DNMA 5ETTA 3G6XA 3TARA 4NLWA 4PRFA 1NK0A 2DR7A 2EG2A 1ZZNA 2MZJA 2AEJA 2DBBA 3EPIA 3D7SB 2YNFB 1TL1B 4K7QA 2QSFA 4RW8B 2CA9A 1QJHA 3M4XA 1FHTA 3FCHA 1X4FA 4FYYB 1CG2A 3DLLQ 3TRGA 3WZ0A 2MDAA 1IBMF 4IUFA 5FD1A 4DV5J 3MWBA 2UUTA 3DRSB 3OW2R 1UL3A 3BS9A 2QYCA 4KBIA 1XR5A 4DI6A 3ZNJ1 3CJKA 3NAHA 4LRCA 4JI1F 4ZLNA 1IKWB 4TU8A 2CAJA 1X60A 1KBRA 4ZITA 2B6AA 4I1TA 3OL7A 1I3OB 1GH8A 4P9SA 3ILLA 1R43A 3HP6A 4KV8B 1N5YB 3VR1A 4PXEA 1S6QB 1V6HA 3HHEA 4C8NA 4DMZA 2QG9B 3C66A 1V3ZA 3ISNC 2DCLA 2IRUA 5I3UB 2AX1A 3OTBA 4DV4F 1XNRJ 5DDPC 1SQGA 1RU2A 2HGMA 4J9VA 4KH0B 3QPIA 8ATCB 2ZH6A 4TY8B 2BEFA 3VAHA 4PYDA 1X5TA 4ANCA 4EBDA 3E2EA 4U7UK 3Q2SC 2J0WA 5DLFA 1K8AT 3FDSA 5DZ7A 3SEOA 2KT3A 2APOA 4NLRA 2V0NA 3M2UA 4USWA 5C42A 1RDRA 4NCBA 2WSEC 5AE3A 4R8UA 5AXLA 2E7XA
chains in the Genus database with same CATH topology
1XR7A 3PR5B 4F3MA 4NCGB 3IO1A 3K57A 4P7VA 2HNZB 3FSXA 1JLGA 2D3ZA 4QPXA 1S0NA 4K0KF 1JNRB 2CPHA 3X3UA 5MAOA 1HBNB 3MI7X 4EZ9A 4G1PA 2OKQA 5KFMA 1Q8LA 1Z2ZA 3E01B 3RBEA 3OXLA 2KI2A 1JLCB 1S1WA 2CQ4A 2MKSA 2P9EA 3U7JA 2BDPA 4RW9B 2K7JA 2R7RA 2FHJA 4WF9Q 4IG3A 3DU5A 3H4DA 5LJ3Y 5LMNF 2E29A 4YFUA 3OVAA 1FVSA 2R7XA 5KG1A 4DV7F 3FVYA 1R6YA 1UVIA 1WI6A 4KJIA 2QLXA 4CO0A 4H4MB 4O3OA 1W2BR 4JV1A 3MPWA 4OI1A 3ITHB 1J2VA 1U6ZA 2LU1A 2PT0A 1HQEA 1SB6A 4I7FB 4ID5A 4DR6F 2HHTA 1WTFA 3AA9A 2PDAA 4BC7A 2QO3A 4CO1A 3DRYA 2FPHX 2UUWA 1CC8A 1MWZA 1B64A 3DOLA 4U67Q 2Q79A 1LFPA 3IR7B 3TQ1A 2AP6A 3PZPA 3DLBA 1FXLA 4ICLA 2G4BA 2FJVA 4LF8F 5AXNA 4GKJF 2F40A 5CYMB 3O6QA 2ZBCA 1JLBB 1S76D 4NMLA 4MFBB 5M2UA 1EETB 2J7KA 4B17A 1TL1A 2RT3A 4QOTA 2JRSA 4C2MA 4RW8A 2M8HA 5IM0A 1DAXA 4DR1F 2OFGX 5KFWA 4WYWA 2R8JA 2ZZMA 5DM6Q 1Y3KA 2ATLA 2XHWA 4M1KA 2XULA 4W92B 5K14A 3NL0A 2IC3A 4DFMA 2LLZA 4IH7A 2ZE2B 1GXUA 4KE5A 3M1VB 3KHGA 4Q7AA 2AF6A 4TQSA 4DR2F 3PW0A 2CG4A 1TKTA 3V4IB 2OH2A 1VFJA 3SDEA 1IJFB 2ZM6F 2OPQB 2R2RA 3MF5A 2B9YA 3VF0B 4HVZA 3AB4B 2HPUA 5LSLA 4PUOB 3NNAA 1IXKA 1P27B 2CZ4A 5J2PA 3MUTP 4IG0B 1NHVA 2MSSA 4J9SA 1HA1A 1VIOA 5F3TA 4FNHA 2M52A 2XMKA 2ZC4A 2OJ3A 3M8SA 3BB5A 2GW8A 2CQ3A 2E5JA 2EI5A 2EK1A 4O4GB 4EUVA 5HP1B 1EP4A 1X7VA 3ZZ0A 1S77D 3M30A 1JLAA 4DWIA 2PE8A 2R8IA 4TLQA 1DJ0A 3I0SA 4CIOA 4HL9A 2R7VA 3FFIB 1HW8A 1TV6B 4QQBA 2BRKA 2GC8A 2J9CA 3QLHA 4QIVA 2WOMB 4J9RA 1AROP 2RS8A 2EBEA 1TKZA 3CEDA 3K2YA 2M3DA 2V8DA 1Y5NB 1E6VB 4YDDB 1U4BA 1Y5LB 3KHLA 4PXBA 3EGZA 4NZ6A 1OQ6A 3MR2A 2A2DA 1BY9A 3V4MA 3AJ1A 1WD6A 3DOMA 3BGFA 4OZ0A 3I56S 4LF7F 1T05A 1RISA 4NRUA 1FKOA 5A8RA 3IWLA 3AQOA 3KNGA 4KV8A 4YB5A 2ZHBA 2RMLA 3HVTB 5DQIA 1M5SA 3I6PA 1URRA 2R4FA 4LFCF 2EPIA 3HMJG 1QSLA 3OTOF 4K59A 1T95A 4W90B 4FYDA 5J2QB 2CPZA 4ECVA 3QIPB 1P6TA 3FRYA 5KG4A 3FJ2A 1CEZA 1W2IA 1IJEB 2I8EA 1WHXA 4XO0A 1JLFA 2AGOA 3TAMB 2V8GA 2IMOA 1HBMA 1YSJA 3TVKA 3AHPA 1MROB 3OHBA 3DHXA 1Q79A 3EUNA 3NMAA 4OX6A 1VBYA 3RRHA 1KQSR 5EN1A 1D3WA 1LXJA 1M5HA 2EK6A 3R5AA 2A3JA 5T14A 2M5YA 3GYXB 4K4ZA 1FDAA 1JLEB 4BHQA 1U6BA 4N8OA 3GIKA 2EFNA 4HTJA 4BDPA 3NNCA 2PD1A 1AW0A 2UXDF 3ZC4A 3N4WA 3V2UC 3NWGA 3F73A 4X2BA 3UW1A 1O51A 3LPYA 1JLQB 3KK1A 4FNIA 1ZPWX 2X3GA 4QWEA 1E6YB 2BQUA 3ENVA 1X9SA 3UNGC 4C8YA 4WYLA 3HF5A 2KZZA 2BZ2A 3PRBA 4A8MP 2CQHA 4YY3F 4QCLA 2JFKA 1VRUA 5FLXY 2BM0A 2YKMA 1N88A 1BLUA 3TA2A 4AQYF 4KC5A 2V9KA 4RLEA 1TAUA 2FVQA 1T02A 2HVIA 2ZC3A 2ZOMA 3MEDA 4NLOA 2J6SA 2GGPA 5KFJA 4IR1A 1C0TB 4DSKA 4NLPA 1KS2A 2G1DA 3BZQA 4Q5VA 2BM1A 3H4BA 2EFGA 2FLLA 1CVJA 1Q7LB 2IM2A 1SIZA 5KT4A 2DH9A 3CCLS 1KFDA 2CJ9A 2PMHA 4GMKA 5DDQC 2JWNA 5K8PA 5F8LA 5DM7Q 5KT2A 4M8LA 2VFRA 4YR0A 3G8SA 2AV5A 2KO1A 4USJC 5EHHA 2LA6A 4X4SA 2DVIA 3KWMA 3KK3B 2AD9A 4KQZA 1LOUA 4F25A 1Q86T 2X1FA 1WACA 2FGOA 4KIAA 2VPXB 1SJ4P 3H8YA 5IT9Y 2XNQA 1QSYA 4Y2AA 1U8SA 3IA0A 3KFWX 2Q6BA 3NNHA 2B43A 1U6FA 1YJTA 3V81B 4NCGA 1JX4A 1LKZA 3NGDA 3FSYA 4OHYA 1HBNA 2FJBB 4UW2A 3PM9A 3CDUA 2LVWA 4EGLA 2LECA 1F60B 2EFPA 1TVRB 3NKYA 3NCRA 2FLPA 1A9NB 1SI9A 2KHDA 2O66A 4O3RA 4ETZA 4EZ6A 1X0PA 4QPTA 2MZQA 3ZZTA 3MECB 1KLNA 1X5OA 1FKAF 2U1AA 3BGUA 3KG4A 1TL4A 2K3KA 1T3NA 4XAKA 2YH1A 5G0RA 1JKHB 5KFDA 4R0JA 2AU0A 3OVBA 5E3QA 4Y65A 2D3UA 4QYRA 2MGZB 2B3TB 1LV5A 2V9WA 2UXBF 1FDNA 3I4HX 2JX2A 2WAQD 1S10A 2QMWA 4FPRA 3JSYA 4Y3CA 4ZOSA 2RIJA 3G71S 3ITHA 4CO4A 4RNMA 4HHJA 4PPDA 1N34F 5EWGA 1HNIB 3K5PA 4HKQA 2Q43A 3TP2A 1WHWA 1HI8A 3N28A 2GQQA 4OI3A 2J6UA 1XR6A 2WBMA 3KLGA 2E66A 1K1SA 3OFFA 3RR8A 2XCAA 3M8QA 5C5JA 2HMIB 2CPJA 1V3SA 1NKEA 1X5PA 4ID8A 4IOBA 3SMZA 3L7OA 4TLRA 1LW0A 3PACA 3RRKA 1IKYA 1QLNA 2FUG9 2G9OA 4YB6A 2V4QA 2I5JB 1LWFB 4DN0A 3SFUA 3ULHA 2K8GA 1QSSA 3SCKE 2UUBF 4B9MA 1ZAVA 4E98A 5D4PA 2CIMA 1N0UA 4PWDB 3V6KA 2E1CA 4WZMA 3R27A 3K5OA 4ZP9A 4BCAA 3RB3A 3CCUS 2R8GA 1C1BB 4B3TF 4NLQA 5T41A 2VPZB 2IBKA 2ZE2A 4X4RA 5B0BA 3CC7S 3DDKA 3CJKB 2XMUA 1AFJA 4R5PA 3OR2B 1R89A 4KAIA 3M05A 3V4IA 4HTIA 1KR4A 1QY7A 5KFTA 3CIMA 2M8DB 1Z2LA 2OPQA 5KOXA 4X62F 1YJNS 3K59A 3IRXB 5AXKA 5B0GA 2E1RA 3US5A 1VBZA 4M95A 3M2RB 2HFNA 4IH6A 4PUOA 2C3OA 3OLAA 3GG1A 3MMBA 1RTJA 3SSSA 1ZETA 1VQ7S 4I6WA 2FHKA 1TK0A 1QVGR 3E8OA 4OIXA 1SUQB 1J5OB 1F0XA 4DQIA 3RAMA 1KVJA 2B6AB 4YP3A 1RT4B 4DV0F 5EX0A 1OQ3A 3GIIA 1F5BA 4JV5F 2PSZA 3ENQA 4H4KA 1VQ8S 1S1TB 3UD3P 2O3DA 2KYXA 3BN7A 1JWWA 5E2QA 2EFOA 2O01C 3M6WA 2DNGA 1Y4ZB 2VBWA 1RTIB 1S9EA 1FJEB 5IQQA 3FFIA 3CF5Q 2E9TA 1FNXH 5KG2A 3G6YA 2DHGA 4TYBA 1NZAA 4WZQA 2FD2A 1E6VA 3SCIE 1QAXA 4ECRA 2VC1A 2XS7A 3MCSA 1VIXA 3BO3A 4MIWA 2VBXA 3S01A 2AJQA 2MKCA 3HVTA 2ZNYA 2WK4A 5DGAA 5KG0A 1MMDA 2RKIB 1CSJA 3IG1A 3U1MA 4C8KA 2DGTA 1X5SA 4TU7A 2J0XA 5A0YB 5EWEA 3HDSA 4G3IA 3QIPA 4JYAF 1NK5A 4OI2A 4O3SA 1U1KA 4DQPA 3ZZRA 3LWMA 1ZZFA 3KJVA 3HJFA 1HHTP 4R0EA 2CFXA 5KFQA 4PKDB 2UUCF 2RRNA 2DK2A 2V4JB 4RWWA 3HM9A 1N48A 1FK9A 1HYSB 2RRAA 1MROA 4DFJA 2MMYA 2BQ3A 1D8YA 4ZPAA 2MJUA 3FEZA 2YWKA 5KFKA 3PIOQ 3O8WA 4E0DA 1D9AA 2HNYB 2DH7A 2J7UA 2ZNZA 3MDFA 5DG7A 3M2UB 5ADZA 2GO8A 2KG1A 3HHLC 1QAYA 4E8UA 4ZP7A 5C42B 3UE2A 5CYQB 2FJWA 4B9TA 2V8VA 5A8WA 1UKUA 4X4PA 3FRZA 2KFYA 3AH6A 3NGKA 2GV1A 3UDCA 2ZKTA 2R8HA 3BQ0A 4IFVB 3WX4A 3ZZUA 3I55S 1XK8A 2X1AA 1VQOS 2L9WA 5I42B 5K5MA 3KLEA 4R8UB 4WE1B 4DR3F 2DD8S 3Q22A 4ZLPA 3HPOA 3HXMA 2ZZNA 4KR0B 3MFIA 2W9BA 2FC8A 4A8SA 5F8MA 5LXYA 5IFMA 1KFSA 2W4CA 2R9LA 1JLGB 5CA5A 7FD1A 1C0TA 1U47A 5B0EA 4ATNA 3OR1B 3VALA 2C2DA 2MSTA 1I1GA 2DISA 4N56A 4NLTA 3U27A 4ECSA 3BSOA 2M2BA 1S1WB 4RWXA 3MD3A 3MM7B 3MOJB 3KK3A 4TU9A 1C4CA 3NRBA 3T5LA 1TL5A 1SKWA 1M5KC 3UR3C 4CO2A 3JSMA 5J1EA 4NL5A 1RJJA 2QFJA 2GO9A 3V5RA 1WWHA 2P6TA 1FE0A 1FA0A 1P8GA 2KT5A 2KN4A 2R8KA 4B9VA 3IRWP 1PO6A 2DIUA 4ZVFA 3OL9A 1HQEB 4ID5B 1GNKA 3DFEA 3IR6B 2ADCA 2XSFA 2KXHA 5GVQA 2KTQA 2F9DA 3CJ3A 3D2WA 2HRUA 2GX8A 3IAS9 4EBEA 1S48A 2B4VA 2QA4G 3I5AA 2JEIA 2C2RA 2G0CA 1WG1A 3C6UA 3CCJS 2JH3A 4F4XA 2RE1A 2LEPA 4RNFA 1QUPA 3DOKA 3D28A 2NUHA 2P9GA 5KG7A 2MGZA 5CH7B 2D41A 4MK8A 5B7WA 1UFLA 2BE2A 1KVIA 2PA8D 2V2KA 4DEZA 1A7GE 3SSQA 1U2FA 4RW6B 2BANA 5HI7A 3HVRA 5K14B 3S1TA 4Y00A 2IC3B 3PNIA 4YR2A 1MNEA 1NJYA 3OTCA 3W7BA 2KG0A 4B9SA 1HWIA 2HGLA 2A10A 3NS6A 1TKTB 2XEXA 1UVLA 3WC2A 4MAKA 2HWIA 5A2QY 3RRGA 5HMWA 3PR4A 3JAMY 2BRLA 2YKOA 1NJXA 2GJIA 2YKPA 2CQDA 3DLJA 2BOPA 4JI8F 2GQ2A 3GYNA 3CULA 1HBUA 1HI1A 1LWFA 2D1CA 5HBMA 4MH8A 2Q6CA 3PXGa 2NLWA 2XS5A 3QGIA 3DRRA 4DSFA 1VC6A 4CTAB 3BSNA 2DPIA 2F4VF 3ZZZA 5L39A 1VK3A 4DL6A 2O5DA 2VFSA 3DM2A 5KG6A 5HROB 1C1BA 4K4TA 1U1PA 4I69A 4ZCIA 1G2EA 2AJFE 3GV7B 1MSWD 2WB4A 3CJ4A 1CPZA 2WHOA 3LOUA 1EP4B 2ZDPA 3M30B 1JLAB 3R5BA 4LSNB 3FMBA 1B7FA 4C0HA 1KHWA 2DNQA 3I0SB 3DU6A 3IRXA 3QLHB 4XIUA 2J5AA 3SCLE 3IBWA 1TKZB 1XBWA 3M2RA 2EW9A 4IDKA 1LWEA 3Q8SB 2D9OA 2K3IA 4OHVA 2XBPA 3BDEA 3CGIA 1ZM9A 1J5OA 3HVWA 4ED3A 3T1HF 4NOHA 2NQPA 4OHZA 4ECXA 1T05B 2NZ4A 2OMOA 1S99A 1KNZA 1S1TA 2VG5A 3BR8A 4JI3F 2XY6A 1FVQA 2LXUA 1PC5A 1BC6A 3QJJA 4Q45A 3CUNA 1X4BA 2JLFA 1RTIA 5U47A 2FGCA 4G1QA 4O4RA 1DBDA 4DHVA 3SSRA 1MW7A 2IRYA 1C0UA 2E9RX 3M2VA 1ZYQA 4K5RA 4ZPTR