2G9OA

Solution structure of the apo form of the third metal-binding domain of atp7a protein (menkes disease protein)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
77
structure length
77
Chain Sequence
NDSTATFIIDGMHCKSCVSNIESTLSALQYVSSIVVSLENRSAIVVYNASSVTPESLRKAIEAVSPGLYRVSITSEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and intermolecular interactions of the third metal-binding domain of ATP7A, the Menkes disease protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Copper-transporting ATPase 1
total genus 17
structure length 77
sequence length 77
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2006-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2g9oA00
1QUPA 3BF4A 2OFGX 2HLTA 2XMTA 1OQ6A 2XMJA 4DN9A 1CPZA 1JK9B 3HHLC 2FTRA 2OD6A 4DPOA 1TR0A 2W4CA 1FE0A 1APSA 2W4DA 1X0PA 2FIUA 3QGPA 5B09A 4NL5A 3CJKA 2EW9A 2GV1A 1Y9OA 5T7LA 3LGNA 1Y0HA 3LO3A 1XBWA 1TL5A 1N5SA 2KKHA 2GA7A 2JDJA 5KAKA 1X7VA 1RJJA 1ULRA 1Q8BA 2K1RA 5B0AA 3FMBA 2BBEA 1SI9A 2N7YA 3BGUA 2BJDA 3KNGA 1K0VA 1SQEA 1KVIA 1FEEA 3BN7A 4Q2MA 1KQKA 1N5TA 5IXUA 3HHLB 3HF5A 3WDOA 5F0UA 2OFHX 2KYZA 2AJ0A 1Q4RA 5A6WA 1X8DA 4ZA1A 1P6TA 2N4DA 5B0CA 3BR8A 3DCAA 2Q3PA 3BM7A 2BJEA 3HX9A 3QMQA 2L3MA 2GGPB 2OP5A 4OJGA 5B0FA 3I9ZA 4A47A 1LQ9A 2RMLA 1U7LA 2HIQA 5B0GA 1URRA 4HH1A 2XMMA 1R6YA 4Y2KA 2FHMA 2GGPA 2QYCA 1S6UA 2PD1A 4A46A 2AP6A 2KT3A 2ACYA 3TNVA 2QLWA 5B0EA 2OMOA 2BYCA 2RILA 3FGVA 3HFKA 2XMUA 1CC7A 1Q53A 3F44A 1OPZA 1TZ0A 5F0WA 2HFNA 2HQIA 2K2PA 4OIXA 4EFAC 5B08A 1AFJA 4QOTA 2N4CA 2RSQA 3KG0A 4U9RA 1FE4A 2IYGA 4HH0A 2GCFA 1FVQA 2AJ1A 3MCSA 1YJVA 2QLXA 1P8GA 4YEAA 1AFIA 3HHLA 5T7LB 2W4PA 1AW0A 1TL4A 3BDEA 3VTIA 3HHLD 2ZDOA 1YG0A 2ZDPA 3IWXA 2LQBA 2K1RB 1YJUA 3KKFA 1Y3KA 2CRLA 5B0BA 1GXTA 3IWLA 2ASYA 4A48A 2XMVA 1MWZA 1Q8LA 2PGCA 2IFXA 3CJKB 3T9NA 1N5VA 1S6OA 2G9OA 1TUVA 3KG1A 1YRXA 1MWYA 3MZIA 3TOQA 3BB5A 4A4JA 4Y2MA 1FESA 1WD6A 1OSDA 4FNHA 2LDIA 2BUNA 1YJTA 4DL0C 1VQSA 1VQYA 1IUJA 4FNIA 3UDCA 4OJHA 1Y3JA 4HI2A 3K7RA 1W2IA 2AW0A 2GFFA 2ROPA 4NPOA 5K9FA 2QIFA 1FVSA 2HFOA 2RU9A 2FB0A 1OQ3A 1N5QA 2VV5A 3DXSX 4Q2LA 4ZOSA 2XMKA 5B0DA 4YDXA 1V3ZA 1FD8A 3FRYA 2K7KA 3TRGA 3HDSA 5A6PA 4OJ1A 4OJ3A 1CC8A 2IYIA 2LXFA 4HL9A 2OD4A 2K7JA 2ROEA 2HLUA 1GXUA 2OKQA 2XMWA 3LGMA 3GZ7A 4F67A 2GO8A 1YJRA 2VH7A 2OAUA 4HI1A 4Y2IA 2ROGA 1KVJA 3E8OA 2KT2A 1SB6A 1JWWA 2LQ9A
chains in the Genus database with same CATH superfamily
2G4BA 3DLGA 3AD9C 4Z2XA 4A8YA 4ED2A 2ZHAA 3RB6A 2YWWA 1UL3A 1X4GA 3E51A 4F3OA 2XB2D 4EYHB 2PN6A 2V8GA 2ZJRQ 1QSYA 2G2ZA 2FTRA 3ZZZA 3FEZA 5BYQA 4LF5J 3VR1A 3LAKA 4KV8A 4NL5A 2DR8A 2F7VA 2EW9A 4O44A 5ETKA 1DARA 5KG1A 3NBPA 1EB0A 3VGSA 4IQMA 3O6QA 4M5LA 4CO4A 2AGPA 1U1MA 3FBFA 2H1YA 3L09A 3SV3A 1Z2LA 2O5DA 3QZ8A 1Q5VA 2K3KA 4ILRA 2ZNZA 3D0HE 4QWBA 4LF7J 2FGOA 4B9TA 2BJDA 3VAKA 5I3UA 4J7CA 1S76D 2DGXA 1N34J 1S9EA 3R6GB 2XEXA 2V5HG 2PDAA 4JV0A 3PHEA 1SH3A 1S6PA 3LA0A 1B4SA 5F8IA 2E9ZA 5KFRA 2HMIA 3W2WA 5IWAF 4NLUA 4Q0BB 3THPA 4NXNJ 1NU4A 1TK8A 3QMQA 2M70A 4FP9A 4KRWA 4N76A 4OJGA 1NJZA 2R3VA 2KVQE 2VQEJ 1U7LA 1UWAA 2HSEB 3I87A 2GIRA 4C0OC 4ED0A 3ET6A 4X4PA 4LF4F 1YVFA 1TFWA 5C7PA 1NZAA 2DNHA 4N41A 2C1EB 7FD1A 4XPEA 4LBPA 1YJWS 2EFOA 2ZWOA 1LEOA 1RGVA 2KL8A 4C6AA 1F9HA 4OX6A 4RBTA 5KFSA 3K58A 2OEKA 2VQFF 1NK0A 5F0WA 3MWBA 3MD3A 3BN4A 3IG1B 2DGSA 1YK9A 4UTGA 5GVQA 4DV6J 4DL2A 5ITHA 2R9LA 1RU2A 1X9WA 2K2PA 3R27A 1F6TA 2DNYA 3A1YG 4LFBF 2UUCF 2E5LF 1IKXB 1SVDA 4MTPA 4R25A 4EZ9A 3VAGA 1RB0A 3CJTA 5CYJA 1MWQA 1S9EB 1Z1ZA 3JS9A 3TX8A 1DZ5A 2L9NA 3SDEB 1IBMF 2PMZD 2K1RB 1HWKA 2PT0A 5HMYA 3M8PA 3MPUB 4HR2A 3LH2S 1P1LA 1E6YB 3IWLA 4M63A 4MFBB 3M30B 5KOWA 2ZNYA 3A4TA 3OL6A 2VIHA 3DU6A 4ED7A 2R7VA 5T14A 1NMEB 3N0VA 1WG5A 4DR5J 1MW7A 2AGQA 1TUVA 3QGHA 2J0SD 3VQTA 2D1CA 3GR0A 3HFVA 2Z2MA 2R42A 1YHQS 2CA9A 1H7XA 1RAAB 5GAHU 3HSGA 4LRFA 1SKSA 2V67A 5J2QA 2BE2A 2DCLA 1RQ0A 4IO9Q 3OTDA 1MROB 2ZVIA 3MEEB 2CUYA 3I6PA 2CQGA 4WIIA 3MAHA 5K9FA 4J9RA 2AKWB 4ZPDA 1RISA 3NGTA 1E6VB 1WUUA 2ZH1A 1BQNB 4KO0B 2W2PP 4EWTA 3RR7A 1XNRF 2BM0A 2Q6CA 4L3KA 4OYAA 3Q86A 3MAAA 2HQDA 5D0EA 4J9LA 1RTHB 2ZE2B 2LA4A 1PO6A 1RADB 1UEKA 2IAJB 3KK3A 3FSYA 2OELA 4OYXA 1LW2A 2BQ3A 3K5NA 1T9WA 3UW1A 2K7JA 5EN1A 3NMAA 2QLJB 4KQZA 2R8IA 1WSVA 1RSCA 3D6MB 1PBUA 4LFAJ 4AQYJ 1YRTA 4RWWA 2HYIB 1UEVA 1IKWB 1AYEA 1IBCB 2CQBA 2OPPA 4Y2IA 2YKNB 2ROGA 4ILLA 2QJ3A 1R43A 2GHPA 4NLQA 4UQTA 5E0OA 3BO2A 1M5SA 3AODA 3NGUA 1NBEB 3PG9A 5ETNA 2RQCA 2AX1A 3AH6A 1OQ6A 5HO4A 2B4PA 2R8JA 4DF8A 1PYOB 2FDNA 4I64A 2V2QA 4MK9A 4ECYA 4JV1A 1J2VA 2NLWA 4ICLB 1NK7A 2DT9A 5B09A 5L39A 3KLHB 5K14A 1ZBTA 4DFMA 1REVB 2GVZA 2W2NP 3MOJB 4PZVA 2MQQA 3RBEA 1XJWB 3V4MA 3KLVA 1RT2A 2VA2A 1XMQF 3M32B 4L74A 3C3LA 2VOOA 2BBEA 2IM2A 4WZMA 5IT9Y 1SJ4P 1KVIA 2YH0A 3UE2A 2CJ9A 4YB1P 1RWUA 4CTAA 2V4QA 1YBUA 2CDQA 4UZCA 1BQMB 4KHMA 2DRAA 2HKEA 4GMKA 3EDQB 3W66A 1KOOA 1BE4A 4TY9A 4WZQA 2CNKB 3W9JA 1XTZA 4RBVA 3BR8A 3DHWC 1JNRB 1MMLA 3CEDA 4OV6A 4ZVSB 5JJBA 2C2DA 3B78A 2VBZA 4G3IA 1UVNA 4WK3A 3GR1A 4LR7A 3QPIA 4GRSA 5KFQA 2QEXS 3K0JA 4C3KA 3DGVA 2B9YA 2B3TB 2FHMA 1I1GA 4JYAJ 1HPZB 4B3OA 1R8CA 1NKEA 2ZUAA 1UVIA 2Z58B 4C97A 3PR4A 5DLFA 2L9WA 2RDJA 1RTJB 2BYCA 3U1NA 5D15A 2CJYB 3HHNB 1JLCB 4X64J 1RAJA 1CC7A 2DNZA 4LJMA 2F4VF 3DKDA 4LF6F 2I1RA 1IWAA 3C19A 3FUYA 2MLXA 4LMZA 5KFTA 1S9GA 1S0OA 2FGCA 3GFZA 4OZNA 5HSPA 2MQMA 5KFXA 4Z37A 2R8GA 4GKJF 1F2GA 1RWPB 1VK8A 2AZ1A 3KJNB 2VJVA 1X4FA 2KFYA 4IO1A 1C1BA 4F2RA 2YWFA 1O6XA 3M6XA 5IOLA 2CDRB 2GQQA 3POTA 4ZITA 1TL4A 3BDEA 3BYPA 5IT0A 1DLOA 1TL1A 2NUHA 5JMNA 1UWBA 2EG2A 3CDUA 1FWLA 2OGUA 1OWXA 3TAMB 1FDAA 1HI8A 2ASYA 5A8KB 2KI2A 3DGPB 4JI3F 5KFEA 3DN9A 5DM6Q 1RCXB 1HQ2A 4R0JA 1C2PA 1U1KA 4P2XA 2BKNA 1IM4A 5KG7A 2VJUA 2G9OA 3UN5A 1K8AT 3C15A 3CCVS 5H9FK 3RAMA 2ALZA 3D3BJ 4M5GA 3W9IA 4ECXA 2Z8QA 1UJ5A 2F8EX 2QL5B 3P96A 3CCTA 2RRAA 3DHXA 4CNYA 2LVWA 3CJ8A 3QZ7A 1D8ZA 3MR5A 2L41A 3MM6B 2NYIA 1R8AA 4YY3J 3MMCA 2HFOA 1QTMA 4ELTA 4H4MA 5FJ4A 3DXSX 2IY5B 1MLAA 1U2CA 2XMKA 2GS8A 3UDEA 1FD8A 1LFPA 3N28A 3J7YU 1S4FA 3IR6B 2HK2A 4A8KA 2E5GA 5CZXA 5CCMA 2HZCA 1YJ9S 1NK6A 5GAGI 3X3UA 4C8NA 2HRUA 2CVIA 4AT1B 1RLDA 2HLUA 1NXIA 3SBMA 1R7IA 1WORA 3VGTA 1DURA 5A8RA 4F67A 4ZLNA 3J81Y 2W9AA 1P9YA 1R0AA 4EBCA 1AZSB 1KTQA 4ZCIA 1U48A 3VHQA 4XIUA 3IO1A 5DQIA 3DLHA 3DDIA 1FRXA 1PJ5A 1RXOB 2OMLA 3MTKA 3KK1A 4DL3A 2UVVA 3BKFA 4HTJA 3NNHA 1Q1KA 2MSSA 3WIUA 3D28A 3TJAA 4FZVA 1CPZA 2YNGB 3MPWA 4J91A 3OTCA 1SJ3P 3M8QB 4LR8A 3IBCB 1FE0A 2DJWA 1OYDA 2E7WA 2RDIA 4NI2B 4ZVRB 3TVZA 4U6PA 3BKTA 3BJYA 1RAEB 2LEBA 1X4BA 1XBWA 4RW7A 3UFCX 2ZHBA 3JB9k 3HHKA 3L3CA 4NWBA 4DU7A 1JX4A 3EGWB 1TKTA 4Y6IA 2N7YA 3KNGA 1SQEA 2RT3A 2F3JA 3DLKA 1YZ7A 2HRTA 5F0UA 4TU9A 2BW7A 3OQ2A 4O4RA 1HHQA 1NDLA 2AJ2A 3EZOA 1S9GB 1P6TA 1HQEB 1RT7B 2PC6A 1OY9A 3FZ2A 2Q3PA 3D6HB 4PABA 2MKIA 2FJDB 4NX9A 4JUZA 3H7HB 5H9FJ 4CP5A 3NLCA 2GGPB 4Y0FA 1HQUA 1D0EA 2M52A 3N9UC 2FJBB 1FRKA 1LQ9A 2BABA 3HMJG 2W9BB 1D8YA 2QLFB 1Q16B 2WW4A 3FBEA 3PJWA 4KGZB 4NMXA 5CCLA 4ZN1A 2KVIA 2J9DE 5J2NB 3T9ZA 2GGPA 1OSCA 4Y3CA 3HHEA 2D3OR 1CLFA 1HPZA 4B3OB 1YGYA 3G6VA 2IC3B 3MTJA 1LWCB 3WQPA 2HS4A 3RUBL 1D9AA 2CQPA 3NGRA 2HVDA 1RWVB 4QU7A 3QGIA 4JI0J 4DR7J 2CQ0A 3PNIA 2HZVA 2HK3A 3ADAC 3HPOA 3CCQS 1AUSL 3ETMA 4DR1J 1DTQA 4A8FA 4I6YA 3OD2A 2HNYB 2XS7A 1S6QA 3D4JA 2Q6BA 3A3PB 2QA4S 1VQOS 4W90B 1LW0A 3EE3A 4ZP9A 3LP2B 2XS5A 5EX3A 1ROFA 4P73A 5HATA 3KUHA 3OR2A 1AW0A 2BJ9A 4I0WA 3MEKA 2ASDA 4XAKA 5KFJA 4DQIA 2KFNA 2G2OA 2MQ8A 3C16A 2QTWA 1UW9A 3JSMA 3D0IE 1REVA 2DD8S 3M2UB 2LLZA 3PXGa 3PTWA 4LF9J 2FVSA 1G4CA 5C24B 2OPSA 3Q8RB 1JXLA 2BZ2A 3ZZTA 1FX4A 2XBPA 1PIEA 4URGA 5DDRC 3MZIA 1ZYQA 4OYOA 2GO9A 1U45A 3OL9A 4QCLA 1SUQB 2J9DA 1NK9A 1I6JA 4X62F 4X4RA 4A8MP 2E9RX 3U27A 4DL0C 1VQSA 4ECQA 1F5AA 4O23A 3MM5A 4N47A 5AXMA 2O01C 2I38A 1UFKA 2UUCJ 1KFSA 1XEZA 2OPRA 2ZD1A 4ID8A 2GFFA 1UEUA 3TAQA 4IRCA 4C3MA 3LGHA 2RU9A 2RS8A 1DY3A 1JLAA 4IFYA 3SQGB 1P27B 2AYGA 3R2CJ 3I4PA 5J1NA 4FKXA 2E7VA 4NE9C 1N33J 3ONQA 1OYEA 2YXLA 5J1PA 1IVZA 2ZH4A 2BDPA 3IRXB 3KHRA 3HDSA 4Y2AA 4DUTA 3K57A 3H90A 2JLFA 5E41A 5F8MA 3MUMP 4OJ3A 2G13A 4JB8B 1ITPA 2OD4A 3VWSA 3ZNJ1 2IA0A 3PR5B 5D0GA 3P45B 2HVEA 1KBRA 2BACA 1S7HA 1KQFB 1EETA 2MY8A 4X2BA 3RAQA 2CQ1A 2VH7A 1RKIA 2QMWA 1K47A 2OHDA 1F60B 1NDKA 2MHEA 3BR9A 3I4HX 5KT4A 1U1PA 3I31A 3QSIA 1JWWA 2VOPA 1WC5A 4CLYA 4RW9B 1CQNA 3DI6A 2HAIA 3CWJA 2C2OB 3EJMA 2RQMA 1JJ4A 2EBEA 1VJQA 4PXCA 3EWGA 3UCUP 2RHSB 2GHVC 4CZCA 2A0FB 5ETPA 2W4CA 4WE1B 5F9LA 1O8BA 2PE8A 3AOBA 3U7JA 4DXLA 1N5YB 1VMBA 1RT1B 4TYAA 2BRKA 3MCOA 4PG5A 1ZAXA 2OH2A 2GA7A 2V8HA 3D0GE 4E0DA 1ICEB 4L73A 1EQMA 1X7VA 4NA1A 1RTDA 2XSJA 1N0VC 4FXDA 4ZHRB 5AXLA 1FDNA 2DHSA 2HPUA 2HRYA 3P5TL 2KYZA 2W24A 3A12A 3PHTA 4C7QA 1RTJA 3V6DB 4DV1J 2PFFB 5KFUA 4KPYA 1X31C 3HCXA 2YNFA 1K44A 3ISND 3PKYA 2C28A 2EI5A 2L3MA 4KT0C 1AROP 1DQ8A 2DNMA 4LIRA 4Q44A 3IG1A 3MCMA 4CLPA 1RWNB 2MQLA 4V1Ak 3CJ5A 3KLIA 5HANA 4QJVA 1GMUA 2XMMA 2ZOMA 4OZJA 2MGZB 3JAMU 3PEJA 4BBYA 2PMWA 3TUPA 4OQJA 5KFYA 3MHYA 4AD6A 1T8EA 2M3DA 4DSIA 1ZM3A 2CQCA 2NZCA 3ET6B 3RGIA 1HNZF 3Q0AA 4WF9Q 2FC8A 3UR0A 3RJMB 3MUVP 1BQMA 1U0HA 2V8PA 3CF5Q 2DXFA 3C14A 4F26A 5AXKA 3PIOQ 2F4VJ 2L9DA 1A9NB 2HQIA 1WG4A 3E3XA 2O1PA 1CQMA 1KHVA 3GLJA 3VQSA 4B9LA 5HQ8A 3IR5B 4JOUA 4NOHA 2RSQA 5K8OA 3G8TA 2ATLA 3LUYA 5E7OB 5DDQC 8RUCA 3NS7B 1T9VA 1S9FA 3X1LB 4O4GB 3NWGA 2WCXA 1C0TA 3AB4B 1GTEA 1WC3A 3NP5A 3BBBA 2MKYA 5T7LB 4BLGA 8AT1B 3ZZPA 2BXJA 3AFGA 4QWDA 5I3UB 3W63A 2QA4G 3V81A 1KWMA 1R0AB 4OX9J 3M8QA 4LFCJ 3P49B 4P71A 4F4WA 3UNGC 1GXTA 4RZRA 4LREA 4DF4A 1KEKA 4J9OA 1D9DA 1MWZA 3NAIA 4JI3J 1XNQF 3T6BA 1GEHA 2R2SA 3R2DJ 2KO1A 1JLQB 1YRXA 2W25A 3M8WA 5CYMB 3N5FA 3NXZA 3UNYA 2JZ5A 2QA2A 1U8WA 2QE5A 2WONA 3NCPA 4HEA9 1IQZA 3NNCA 3MPYA 5F3ZA 4DFJA 1U6ZA 1RAGB 1R8BA 2VG6A 1F1BB 4OI4A 4D3GA 2GNKA 2WHOA 4PXEA 3EVMA 4JI6F 3TARA 3DMJA 5ETSA 5KFZA 3DRRA 4OYWA 1JMTA 5HMZA 1N56A 1WNEA 1HMVA 1GX5A 1Y4ZB 3KWMA 5A8WA 2J6TA 4G1QA 4RLEA 4JI4F 2IRUA 5DG7A 3OR1A 3VF0B 5GAHI 3FRYA 2X1GA 3K17A 3KK2B 3NS6A 1NJWA 1T03A 3DYAA 2NREA 3MURP 4JI1J 4LF4J 2LU2A 4QW8A 4GC7A 2E1AA 4P7TA 3J80Y 2ZH3A 1HR0J 4LFAF 2HFZA 4HYKA 2DGOA 4X4QA 1FXLA 2XM3A 4MKVA 2J7KA 1A0OB 2CPIA 2XMWA 3C6TA 5HJXA 4CT9A 5C25B 4Z7CA 2QN6B 3IRWP 4QQBA 5KG0A 1FRHA 5GAEU 2CJAA 2NXNA 3MM5B 4DCOB 5IZHA 3G82A 3IWXA 2M8DB 4PQUB 1Q0NA 1GAOA 2KFZA 1S1TB 5CD4A 4DOZA 3BQ0A 2UUAJ 2OFGX 3QWPA 2C2EA 2WOMB 3OTEA 1TR0A 2N82B 3AQPA 4FF2A 4YR2A 1N48A 1FJ7A 2J9EA 2EWHA 3H42A 4MAKA 4YY3F 3LO3A 1RWOB 2UV8A 3N5BA 2JDJA 1IKXA 5M2RA 3BYRA 2ZM6J 1F9FA 1B3TA 4DV0F 4LSNB 3VALA 3CULA 3OL7A 1IQTA 3UPFA 3PEHA 3GG0A 2FZCB 1N5TA 1X5PA 3GFYA 4O0IA 4JI2J 3HF5A 3QRRA 2B7BB 2PA3A 1XR7A 1RHJB 3EGZA 3AJ2A 1F0XA 2G0JA 1X8DA 3QT7A 3TEHB 2DKOB 2N4DA 2MZSA 4C8ZA 3CTRA 3BM7A 1HW8A 2BJEA 3HX9A 2ZFHA 3GCXP 3M9NB 4DS4A 2AEJA 2CXEA 2FZGB 4GVBA 2APOA 2ZBIA 2JEJA 4QIEA 3RW7A 3G9CA 3D5MA 3IR7B 3ZXWA 2DR6A 4K0KF 1JLEB 3BBFA 2RQKA 2DR5A 7FDRA 2XO6A 2ZKTA 2R2RA 2IC3A 3QJLA 4BWMA 4RW6B 1SQGA 5CHCB 1SC4B 4Y28C 4TN2A 2ZJPQ 2F8MA 1Q5YA 5H1SV 3HVAA 4B9NA 2RUSA 4G1PA 1Y10A 1Y5NB 3HT0A 3PM9A 1S6PB 4EZ6A 2B43A 3FGVA 4UOGA 4DV4F 4IUFA 5IQ6A 3M9OB 1HQUB 1YBAA 2W2QP 3FBBA 5BXIA 1AFJA 1ZM2A 2XNRA 3HSDA 3OT9A 1RT7A 3M32A 1J5EF 7AT1B 1KSPA 2D69A 4S0MA 5LSLA 1MN7A 1U6FA 2HFUA 2RIJA 4B17A 2B8PA 2GVZB 3BGLA 4K5SA 5K8NA 4DI6A 2OIHA 3DLLQ 2H5JB 2CQ2A 2IM3A 2YWEA 4EO8A 1VQ5S 1B0PA 5DRKA 2UU9F 3VTIA 3HP6A 4WE1A 2MHNA 1FKPA 2KRBA 4K2XA 1YJUA 2V4JB 4ZPTR 1S48A 4NLTA 3ENWA 2VHGA 1QVFR 3OVAA 3FNNA 4USJC 1VC0A 4U67Q 3CCSS 4RW7B 3BS9A 4MKBA 2QYGA 4BHQA 4ES3A 3FCVA 4J9NA 2GHWA 3T9NA 4TQRA 4C8YA 1PYSB 1QSSA 2AJFE 5KT2A 3G96A 3BSNA 1VC5A 4B9UA 1JLGB 3RB0A 1HHTP 4ZN3A 2E1CA 5LXYA 3TOQA 1EETB 4X84A 3ITHB 5DO2A 4MK7A 1U49A 4DR4F 4N8NA 1I3OB 3S6EA 2OTLS 1RHUB 2BE7D 2NXCA 3WZ0A 3QAEA 4ZMMA 3HFZB 1H0HB 2YY3A 2RF2A 2J8SA 3BH6B 3IRXA 1HYSA 1QAIA 2KT5A 1MU2B 4TNOA 3TANA 2JEGA 2R7OA 3W3SA 3OTOJ 1T03B 3JTOA 2G0CA 1SV5A 4TLRA 2JH3A 3CIMA 4KC5A 4WFYA 2KB2A 3Q8YA 4UOHA 1Q8KA 2FPHX 1XMBA 3V5RA 1Q81T 3VZIA 5DQGA 4N77A 3TVKA 2V2KA 4WFZA 3THTA 3DRSB 5HL7Q 4J9KA 1X0FA 2IMWP 3ETOA 1RACB 1RI7A 1X4HA 2IYIA 3MECB 5E33A 3QT5A 3T1AA 1H2VZ 3LANA 3LP1B 4C11B 2QFJA 2FVPA 1TAUA 1B7YB 3M2RA 4FN5A 4I56A 4OV1A 1P1TA 2C3YA 1LWFB 2NZ4A 4DMZA 3M6WA 3PVXA 5KG4A 1C4CA 2C42A 4XTTA 4O3PA 3GCWP 2CQ3A 2FYXA 2XY7A 2FJAB 3PY8A 1T3NA 2J0QD 5E5NA 5IWAJ 2A6OA 3NS5A 4F0MA 3GJTB 4IG3B 4NLPA 1H7WA 1DTTA 1HW9A 3ITHA 1FERA 3R7SB 2E1RA 2KJWA 4DN9A 4ZJQA 2UUBJ 2CPXA 1PSDA 2F40A 3SDEA 1V6HA 4C9DA 1ELOA 2HHWA 2HWIA 2HHPA 3IFEA 4FBTA 3DLEA 3R5AA 3AA9A 1T11A 3QO9A 4YUDA 3R1LA 3MDFA 3AAWB 1M5HA 3FEXB 1UWBB 4I2QB 3J7YI 1FKPB 2AQ4A 1DLOB 2NR0A 1XQIA 2DH9A 1KN6A 3M4XA 3D2WA 2CPJA 5J2PA 1K0TA 4IR1A 4NCGA 1FTCA 3JTPA 3VZHA 4C8LA 1XK8A 2DBBA 4J90A 2KM8C 2ZBQA 3ZZRA 3G8SA 4UQGA 2CZ4A 3ZTRA 1T9YA 3DM2A 2AYEA 4PG6A 4WTYA 2RMLA 4FS1A 2XGQA 3KLIB 3PV8A 1JKHB 2D3UA 3HO1A 1KQSR 1ZS6A 2VU5A 3HXMA 1R6YA 3MMJA 4KGMA 3R6LB 4UOCA 2XULA 2CYYA 3DOKA 5AE2A 5AXNA 2YQ1A 4RW6A 3LTOA 4ANEA 3PIPQ 3OSNA 4USKA 4H4KC 4A46A 1NK8A 2AP6A 4KTQA 3QRPA 1EARA 2E29A 4DQRA 1FWPA 3CO0P 2HFNA 2NS1B 1QAXA 1WTBA 2VFSA 4DV6F 1MMNA 4CCHA 4LVOP 4PCQA 2CADA 3CMQA 1WF2A 1C1CB 3A13A 1YWXA 2HGLA 1SH0A 4K4ZA 1JJ2R 3R3TA 3PW4A 2M8HA 2C2KB 3H2VE 2D9PA 5CXTA 4IOAQ 4LSNA 2DNRA 3LOUA 1H6KX 2VASA 1G2EA 3S01A 1VYAA 2HBZB 2ILZA 4JI1F 2HAFA 2WBMA 3CT9A 4U8YA 1R8PA 2VD3A 3MM7A 3TUJC 3ZZYA 5JUMA 1N5VA 3ENAA 4J9SA 4O3NA 3PO5A 4GKKF 4X4VA 5KFKA 1RHQB 1UFLA 3CVKA 4ZPBA 4ZDNA 4HT5A 2FUG9 2WOMA 1FNXH 1HA1A 1FESA 2NCKL 2BRLA 3ICLA 2D9OA 3HVTB 2AYMA 2YX1A 3IMQJ 3L7UA 4EUVA 4WU2A 4FVCA 4O3OA 5EUHA 1VQ4S 2B0GA 2POKA 5C42B 2W7AA 3G82B 2HS3A 5HVFA 4JI6J 1IKWA 2OPPB 1YJNS 3MMAB 2HVIA 3QT8A 4EBEA 4A8SA 4EGLA 1WI6A 3O3LA 3I9V9 2Q43A 2GJFA 1CJTB 2DXDA 4G6VB 4H4MB 3UR3C 5D3GA 2J8AA 2ALYB 1RWMB 3DYAB 4ID5B 1HNXJ 3FJ2A 2R7UA 4XDCA 2VUGA 4OI2A 2MKSA 1RTHA 3HSJA 3JQMA 4NLOA 4WU3A 4YB6A 1UJ6A 2MZTA 3CCWA 3D7SB 4BWJA 5F8JA 3IBFB 3KDNA 1FDDA 2YWHA 2P2CB 3MEGB 1S1UB 4USTA 3C8YA 2VODA 1YI2S 4MIAA 4J5OA 1C0UB 5ETVA 2FLNA 1RBAA 1QVGR 1MMDA 3BZQA 3GONA 2PSZA 2U1AA 4OZ0A 4W98A 2XY5A 1L5UA 4F2SA 1NSAA 4LSZB 4Q0BA 1VGYA 1KLMB 2XMJA 1LKZA 3KJQB 4CLZA 3NL0A 1F9EB 1YDLA 2G2YA 3TZYA 1UKUA 1YIJS 1S4EA 3W60A 4G1IA 1JB0C 4HACA 3QGPA 3KDOA 4DCPB 2PFDA 4YS2A 1TQLA 1VI7A 1FI4A 3ELHA 3LGNA 4C98A 4QU6A 4U7UD 2VKRA 4F3MA 3CE8A 1E6YA 1NHUA 5KAKA 3HT3A 5L9NA 1KKHA 1RAIB 1ULRA 1XMOF 2DR7A 1FNMA 2X1BA 2EEYA 1X4DA 3WX4A 4QWEA 1V9OA 4LF1A 1PBAA 1TELA 1FEEA 1RAHB 3TVYA 5IXUA 1HI0P 2RNEA 4TVAB 4H4KA 2D41A 3OL8A 2EFGA 1B99A 2DY1A 3P8BB 3D3CJ 4ZVTB 2GVDB 5A0YA 2DGWA 3SCIE 2JFKA 3QJPA 2I9SA 4YQWA 5EGYA 1VQ6S 1RUSA 2YH1A 3JQJA 4DBQA 3DCAA 2Z30B 1T02A 2HS0A 4MMOA 4DV5F 3Q24A 2YKOA 1TTHB 3CB4A 2OP5A 2JL9A 2E5HA 1TL7B 1U0HB 3M6UA 1HNIB 3PACA 1WKKA 4A47A 1NKCA 3T1YJ 3ZTPA 1NH7A 1N8RT 1VRUA 3SEOA 3R9LA 3VGUA 3Q8QB 1LNQA 3KLGB 3H0PA 1WHXA 2CG4A 4ZS6A 1HNXF 1X60A 4ZKAA 4FPIA 2MLYA 1BQXA 3C2PA 1S7IA 3EVWA 1YSJA 1WF1A 2ACYA 2KT3A 4ZP7A 4B08A 4PEOA 4DEZA 3D6FB 1Z2ZA 5B0EA 2FVRA 2YKQA 2U2FA 4FYXB 5E3AA 5I4MA 1U8SA 2P5VA 1SJRA 3RBXA 4DV4J 3VVTA 4TLQA 1B0VA 1RT6A 2EC0A 3KLFB 2W2OP 5D4NA 1U47A 4Y34A 3PFOA 4NYOA 4ZVEA 1IWGA 3H4DA 2EXUA 3VAMA 2CPYA 4DS5A 4AL5A 3L7PA 1DAXA 1ZPVA 4CO2A 5M2PA 2AHOB 4WFBQ 3JYTB 3BQ2A 4G65A 3GG1A 3HVWA 3HVRA 4H54A 1TUGB 2Q66A 2DXEA 2X3DA 1QUVA 4ICLA 3W5XA 3IAM9 3KKFA 1SPBP 2ZH9A 1S97A 2IVMA 2DH8A 4NLGA 2DNGA 2V69A 2BJ3A 2JLEA 2XMVA 3KLEA 4KHPF 3NGSA 3CPWR 5KFMA 4DSJA 1U1OA 1MWYA 1BWVA 2CPZA 2JWNA 5DGBA 4LSLB 1CJUA 1BXNA 4OZ5A 2IVYA 4Y2MA 3SSQA 1QD1A 2XMAA 2W7OA 1GMWA 2PEHA 3M2VA 3BEGB 3FFIA 4USVA 1KTVA 4CLFA 1S99A 3BPSP 4DPUA 1KP6A 3LPYA 1UPPA 4DL4A 1H38A 1CJKB 1SJ1A 2MQNA 3PRDA 3M1VB 2C2NA 2RD5C 5ETRA 3PYGA 4ZLPA 3GB0A 2IRYA 1WC1A 5IS2A 4K4XA 3B54A 4DV7J 4K4SA 4JV5J 1IKYB 1CULA 4DR6F 2UVRA 2ZEJA 4WK1A 1M5KC 1BQNA 1VR6A 2P8IA 4KO0A 3H4BA 4HT7A 1JJHA 1NJXA 4NZ6A 1SV5B 3O8WA 3D6TB 3O2IA 2BV3A 4OI0A 4L76A 3QJJA 4N8OA 4DLEA 1AUDA 2N7CA 3TRGA 3MEEA 3UQSA 2BR0A 1U1NA 2BX6A 3GV5B 2MKJA 3A8KA 1WHWA 2B4OA 2F5GA 1PAEX 3SCJE 2UZAA 3SFGA 3SSRA 3UDLA 1SL1A 2WVBA 5J2QB 4Q5VA 1HL6A 3MR2A 2GO8A 2YKAA 2KU7A 3RU0A 4FBUA 4A8OA 2IDLA 4RX6A 1NSPA 2HNDB 3PYFA 2Y3YA 4LRCA 2FC9A 1S1XA 3KOAA 2R4FA 2JLGA 2NSBA 4MT1A 2CQHA 4GO7X 4N7TA 1XR6A 4R5PA 4DL5A 3THVA 3TZZA 4DPOA 2OSQA 4IOCQ 1DRZA 4PRFA 2W4DA 4TXSA 1VIOA 3FBCA 1UZDA 4HTIA 2RAQA 2RB7A 1QM9A 2QRRA 1XNRJ 4B3RF 1U2RA 2GV1A 1PGZA 1Y0HA 3E2EA 1VDHA 2A10A 2ZUGA 3W5YA 9ATCB 5KG2A 4DZ6A 3R7BB 3C16B 3JSMB 1UJ4A 3W62A 2HHQA 1NAQA 4HLBA 1SI9A 5CQGA 1K0VA 1NH8A 1VLOA 5RUBA 2WTFA 1DJ0A 2K8GA 1LK7A 3OPKA 1NCLA 4NLVA 1N4LA 3D1QA 3JYTA 2EFQA 1HNZJ 4CLSA 1LW0B 4K8RA 5AE3A 1SC1B 5A6WA 4DV3F 1VS3A 2CZ9A 2DTJA 2H4WB 2IPOB 4KJIA 5B0CA 2B56A 3LPEA 2ZZMA 2OPQB 4M5MA 4MIWA 2VG7A 2DHGA 4ZJOA 3AT1B 3MFHA 5HK4A 2WW8A 4DG1A 2VFUA 2VG5A 4L72B 2NPFA 1IN0A 2XCPA 3GSDA 3H59A 2XS2A 4USIA 1B0TA 1XIQA 3EGVA 5CAAA 1VC6A 3K89A 1U26A 5E3RA 5F8NA 1BWEA 3E01A 2VKZG 4X4SA 2ZZTA 4FYDA 2LMIA 2ZM6F 4JI4J 5EWEA 4XK8C 2IBKA 4ECUA 2E44A 1EJ7L 4RL1A 3HFKA 3MM9B 1HNIA 1Q53A 2XMUA 1OIAA 4X64F 2HURA 2HBRB 4K50A 4MYUA 3AJDA 4LF6J 3IS9A 3BH7B 4CM2A 5DQHA 4X4NA 3UN2A 3PRVA 3H8YA 3K5MA 5DG8A 2OUGA 5F9NA 3A8EA 2AYBA 5KT3A 4NLXA 1PG5B 2XG8A 3I55S 2DNKA 3MCSA 3O1LA 2EKYA 5C2GA 4H4OA 2KJVA 3UO0A 4DL6A 1CS4B 4ELUA 3BO3A 3BQ1A 4FF4A 1HBMA 1QY7A 3I56S 3JSYA 4F50A 2HBQB 5CA5A 5ETOA 3NCQA 4BC7A 1Q8LA 1D1UA 4ED5A 1NSQA 3C46A 3W8PA 5GAEI 1S6OA 2XZTB 4LF9F 2HVHA 1HFEL 2MZQA 5IV4A 3T1HF 1TFYA 4A4JA 4U95A 4QR0A 1WD6A 5ETTA 1YX2A 1FNOA 1QJHA 3GYXB 2Z4PA 4O3QA 5J2MB 3H5YA 2QZ8A 1V3RA 3FEYB 1N6QA 1YJTA 4UT4A 3KK1B 3OTOF 3UWTA 5KOXA 3IA0A 2Z0GA 4OJHA 4NRUA 2UUTA 2IAJA 4PR6A 3KK3B 2M5YA 2C2RA 1SKRA 1C0UA 3A8JA 3W9HA 1GMWD 3K8WA 1WF0A 4J9QA 2IA6A 3O44A 3KK2A 2PI4A 1DQ9A 5A8RB 3MAAB 4CLWA 4G1QB 4RW8A 3TZWA 1F5BA 1VQ8S 4WP8A 2A18A 5G0RB 1IBLF 2A3JA 3SIPB 5E3QA 2GZOA 1SQFA 4ZCKA 2VC0A 4N5SA 3EZ5A 3B4DA 5U47A 2WVCA 3V2UC 2B8QA 2DPIA 4OJ1A 2LQ5A 1CC8A 1ZZNA 1L3SA 2ATCB 5THWA 1K73T 3L95X 1GXUA 3LGMA 3M2VB 3GZ7A 6FDRA 3FKBA 4EYIB 3MM6A 4R8UA 2BQUA 1U2FA 3DRPB 2W01A 3I5CA 2I2YA 2KT2A 1W25A 4ZA1A 4DV1F 4IR9A 1GH8A 1GFWB 2MPUA 3EPIA 4JI2F 4EO6A 4F36A 3PYDA 3L7OA 4LT6A 5EWGA 3HHLC 1YZ6A 1HBOA 4ZVUB 2ERRA 3BPDA 1FF2A 4PAAA 3NG8A 3OUYA 2J5AA 4JI0F 3ZZOA 4MJKA 2F1FA 1HIYA 2ILYA 5A8KA 2BKOA 4O4GA 4DUYJ 4QW9A 1KLNA 2KTQA 1RABB 2V4JA 4ZVHA 4C8KA 3GP9A 3SCLE 2BVZA 2DCUB 2FVQA 4AXJA 4X4UA 5LSOA 4O3RA 4DV2F 1CBKA 1T95A 3PJ9A 2UUAF 2I5JB 2ZOGA 2OFHX 3KUGA 1OY6A 2LKZA 1R6VA 1Q4RA 4ANDA 4CYUB 2R8HA 4DR3J 2WVFA 2DY9A 2FHKA 2YPYA 4QBUA 5GMDA 5HQLA 2I0XA 2JVRA 2IIHA 1FFWB 3QYYA 2ASJA 3CJRA 2HHHJ 3NWRA 1NHVA 1NRKA 2ZVSA 1JIHA 2V94A 2M2BA 2J76E 3W65A 1ZZFA 2XY6A 1CJVB 4OX9F 4IQXA 1YQHA 3GJRB 5DM7Q 2NUUG 2QMUB 5IT4A 4WWSA 1S6UA 2WVDA 2CPDA 3DC2A 2C3PA 4UF4A 2NPIA 1JXVA 4ZVPB 1NNDA 4U7CA 2RKIA 3RRGA 5FLXY 3BV8A 2IVFB 4PXDA 4ZHRA 4OIXA 4X66F 1NSKL 1WWHA 4K59A 2V2VA 2N4CA 1IJFB 2KH9A 4AFFA 2V63A 2DH7A 4F02A 1ZAVA 1EP4B 4IFVB 1ZTWA 3Q2TC 3DFEA 1MN9A 1P8GA 3MUTP 1AFIA 1C4AA 5J2PB 3OLAA 2XZWA 4CTAB 1N5YA 3G8QA 2FLLA 1A6LA 2FHJA 3ENQA 4KIAA 4PYAA 1TKZB 4P2FA 4DWIA 3ISZA 1S49A 1WOPA 2BE9B 2LQBA 2WVEA 2YNHB 4A8XA 2ZJQQ 3TA2A 3M8YA 2JRSA 2UP1A 3R7NB 1S1VA 2DHHA 2PGCA 3DI6B 2V4RA 1RBOB 4DUYF 4RUCA 1TV6A 2P9EA 3FSXA 4WKRA 3GFXA 2BANA 3KUEA 5HVGA 2Y1IA 3C6UB 3OV7A 1J5EJ 1U6BA 1ZH5A 4PG4A 2W9CA 5KFLA 1I94J 3R5CA 1S1UA 5DZ6A 3H40A 5KT7A 3SZ2A 4WYWA 1N34F 1VRTA 2MEWA 1NLKL 3N6NA 1OSDA 2C2ZB 1TUWA 2F63A 4ZPAA 3VGVA 4CIOA 2XLKA 5HJYA 3KNAA 4P2SA 2NSCA 4ER8A 4NLDA 4V19J 5ETQA 4DHVA 2RQ4A 2VPWB 2W1BA 3JQKA 5CH7B 4F04B 2HHUA 2AW0A 1VLYA 3J7AN 5C25A 1LXJA 3D54A 1CJTA 2RJZA 4CH0S 3KJVA 1QTNB 4B02A 1SIWB 1M90T 2F4FA 1LW2B 2GMLA 5F8LA 1I51B 2DEIA 5HROA 1VOMA 2K7KA 5K8MA 1TKDA 3OR1B 1B70B 1RU1A 1Y11A 2ASLA 4K5RA 2GAHC 2UXCJ 2LXFA 3BSAA 3D67A 3UVJB 1O0PA 2AU0A 3N79A 2E7XA 4EEYA 1T05A 2C22A 1M5VC 1WEZA 4QIVA 1ZM4A 3BREA 4RUHA 4HI1A 2DGVA 2G1DA 3W61A 3GE9A 3GPAA 3DNCA 2LQ9A 5D6GA 3MM7B 4LF8J 1IXKA 2CPHA 1VJWA 4CRJA 2XMTA 3M2UA 4WKYA 1LK5A 4I1TA 3KYLA 2OD6A 2ADCA 1APSA 2W2MP 4RW4A 2FIUA 2YTCA 3I32A 1RAFB 4CO0A 2HBYB 2KG0A 2B7CB 3D1HA 4LBIA 4OLPA 5FDLA 4CM0A 2RE1A 4UZBA 3KLEB 3RBDA 5HLFA 1NJIT 5A2QU 1CEZA 1X9SA 3K5LA 1M1HA 2K1RA 1S6QB 1H2UX 3FMBA 4HDGA 1LXNA 1CSJA 2BJ8A 2BOAA 5DS7A 3DRYA 4A8QA 3V81B 1SL0A 2V8VA 4EI2A 1BUXA 2BKPA 1HNWF 1HI1A 4FXVA 5IM0A 1JJCB 4TKTA 4OLOA 1O51A 4DV5J 2V50A 2B5JA 1TKXB 3TO8A 2MMYA 1FK9B 4CO1A 4DPYA 4TU8A 1LWCA 3HULA 4NYZA 1U4BA 4DUZJ 3M6VA 4ANCA 3KLFA 4J37A 3AY0A 3DOKB 2AX0A 4E8UA 3C14B 2ABYA 3F41A 3MM9A 3M8SA 1HNVA 1NB2A 4KR0B 2UU9J 2YX4A 1ZM9A 4RNHA 2QX0A 1FKOA 4B3MF 2XHWA 3MR3A 3CJSA 3UD5A 5G4DA 4DCJB 1N36F 3TX0A 1TK0A 3NNAA 2CPFA 3U02A 3R5DA 4HDHA 1NM2A 2M88A 3K8VA 3ULHA 1S0NA 1FKOB 2H48B 1TKXA 2OMOA 2V68A 2NXEA 2UVUA 1HYSB 2Y8WA 2WK4A 2DISA 2OLWA 1TL7A 4L75A 4OL8A 5H9EJ 5IM0B 1AT1B 2ZC3A 3NGKA 4ITSA 1RHRB 5B08A 3EZUA 1K1QA 1TKTB 3EPGA 2AT1B 3HZEA 4U9RA 2J6UA 1FK9A 3M8RA 2M4MA 3NEKA 1GNKA 2Z2ZA 3GQCA 3T5JA 2AJ1A 4LBHA 5CYQB 4PQAA 1UVKA 2QLXA 1SC3B 1X4EA 2XTJP 3AQOA 3HKWA 2VF3A 4YHHF 5BR8J 1XERA 2JX2A 5L1JA 3ILOA 2YWGA 1T9TA 2IM0A 1EHWA 2ZH5A 1YG0A 2KHDA 1I5OB 2YKMA 4ELVA 1HBOB 3CDWA 4EU0A 4JI5J 2B6AA 2CRLA 4F3QA 4QIFA 1WELA 3TAPA 5MAOA 2Y8YA 2Y1LB 3NBPB 5HQMA 1TK5A 1YBTA 1RT4B 2B51A 2QGFB 3PCOB 1H74A 4HVZA 3PX6A 1URNA 4RW4B 1H73A 2QT7A 4JP8A 2DB1A 2SXLA 4F7VA 3TI0A 3I82A 1SCJB 4I7FB 2VFRA 2YQ3A 3BSCA 4F0HA 3HJVA 1T3OA 3T5KA 1UAWA 3LP1A 2V9KA 4OX8A 4ZLLA 2AJQA 2HQFA 4DV7F 3TW0A 4FNIA 5D4PA 2LXIA 4YB7A 2F9JA 4HHHA 3KHGA 4RR5A 3CJQA 2ROPA 1F5CA 2QIFA 2ZKUA 1FXDA 4YMEA 1Z4UA 1N5QA 2HNZA 4IG0B 3HHDA 1M5OC 5LSRA 2Q1LA 4YDXA 2I6WA 5B7WA 4B3SJ 2JC0A 2XLJA 4XDDA 5KFCA 3CCES 5FD1A 4JYAF 2A2DA 3D66A 1OJ4A 2IJFA 4JI7F 2CAJA 2RF2B 2KXFA 3QLHB 5KG3A 1FJGJ 1NO8A 2YPZA 5A6PA 1XNQJ 3SMZA 1WHYA 4HL9A 2HNZB 4IG0A 4PKDB 4IFYB 3SQGA 1WKLA 5A8WB 5F3TA 5LT5A 3KJVB 1VRTB 3QBCA 3GJQB 2ZD1B 4IDKA 3DRRB 3MMAA 2NQPA 4Q7AA 1VBKA 4A8WA 3OFEA 2VA3A 1HLWA 4JV5F 3SCKE 4PWDB 1S79A 2LEAA 3V6HA 3FFIB 3DDNA 3QIPB 2XO7A 4ECRA 3OVBA 4PXBA 2IJNA 2FLOA 1IR1A 5AJ3J 3CJ0A 2E1MC 3C6UA 2C3UA 1TKZA 1X0PA 3DOLA 2J9CA 4M5DB 4CH1A 3SYZA 4X4TA 1CS4A 2UXDJ 1FDBA 1ZA2B 2Y0BB 4H4OB 4YP3A 2RU3A 4PWWA 5IFMA 4EBDA 3PO4A 4HHUA 4IFVA 3LAMA 3W8GA 1HARA 3H98A 4DDFA 4ES1A 2F9DA 4CO5A 2N3OA 2Z57B 4F4XA 3OSPA 4KHPJ 3PW2A 2FY8A 3I0SB 2DIVA 2JJ4D 2HFVA 3EICA 1VIXA 3GMGA 1K1SA 3QFHA 1H72C 3CJ2A 5LMUJ 4ED3A 2CNNB 3MCNA 3ZO7A 4F8RA 3H25A 1P9QC 1UPMB 1V5VA 1FEHA 1RK8A 5GMKa 3N4WA 1KC8T 3FK4A 1DTQB 4RUBA 1TVRA 1PILA 4MK8A 3UD3P 4BC9A 1U0SA 4TU7A 4ED4A 1Q79A 1CJVA 3VAJA 3PYEA 3MOZA 2ZOFA 3H5XA 4DR6J 5HAOA 4DG1B 2LDYA 4NEZA 5LM7E 1J5OB 2IMOA 3WHIA 3HI9A 1RWWB 1DFDA 3OFHA 2PD1A 3KLGA 4DSFA 2HIYA 1GK8A 1WEYA 3ILJA 3MXHP 4AXIA 1U1LA 3QSYB 2I5JA 2VB6A 3S7RA 1Q7YT 2CZVC 5AT1B 5D8HB 1YKWA 4NXNF 3DLJA 4ECSA 4DR2J 2E9TA 3HD2A 2BQRA 1T7PA 5JXSA 1QE1B 2GVDA 2GCFA 2H54B 2IHR1 4KGVB 4YEAA 5K14B 5HVHA 3QWUA 3D68A 3PX0A 1F2HA 1TAQA 2OEMA 4FVMA 2RH3A 2FJEB 3BGRB 3VAFA 4USWA 4YR0A 4DR3F 5I42B 5AJ3F 2H3EB 1A7GE 4DR4J 1IBMJ 1VBYA 2XSJB 4RBUA 4ES2A 4I2QA 3EXCX 3DLBA 2EC2A 3GIRA 3QIPA 4A48A 3S1TA 1XMOJ 1JQGA 1S1TA 2E1PA 3AHPA 1KQGB 1BMQB 1S1XB 4NLWA 4QR1A 3VV2B 3OUYB 2PMHA 4CT8A 1NB7A 2GIQA 4PQUA 2B4UA 3SFUA 1G1XA 5L9XA 3GYNA 3RBZA 4R8UB 5L1LA 2R7TA 3I0RA 3BB5A 4FYVB 3LQVA 2R2UA 3T19A 1S72S 3Q89A 3C6TB 4USHA 1UA1A 1XMQJ 2MKCA 4Y00A 3RAXA 4PYDA 5GADI 1IUJA 1KONA 2R8KA 5C2CA 1JLBB 2CJQA 3SQOP 2L48A 4MYTA 4DJBA 1UA0A 2AEMA 2VBXA 3RG6A 3MD1A 2WB4A 3MEDA 1FVSA 3P5BP 4M5HA 5T41A 5KFGA 2VPYB 1IM6A 3UVJA 4F0KA 5FLXU 2XC9A 3AD8C 1L3TA 1HD1A 1DQAA 2A6MA 1HBUB 1KR4A 1Y00A 3H2UB 4U8VA 5KFHA 2WB1D 3GIJA 1IKYA 3OTBA 2UXBJ 2QL9B 1WC6A 3GJSB 4I6AA 5L38A 2KN4A 4ECTA 3L9ZA 2VG6B 4OYPA 2KM8B 4KKOA 5EHHA 1N6QB 1R89A 1XWLA 3EM1A 3GU0A 3M05A 2OSRA 1YTYA 3V4IA 4B9VA 1BLUA 1CJUB 1RT5B 1N32F 3IN5A 2DNNA 2QC3A 4WP9A 3DXBA 4ATNA 1H3DA 2IDEA 4AYBD 4PG8A 4ZK7M 4XO0A 4K4TA 2AD9A 5C42A 1EAYC 1R0CB 2RHQB 4JI8J 1UTAA 5J2MA 1FCAA 3Q22A 1WKJA 2A1BA 1REGX 3M8PB 4M5NA 4MFBA 3ILIA 4NA3A 4U96A 5I3PA 4P72A 3C15B 1TP7A 1TL3A 2K06A 3MM8B 5LJ3Y 2XSFA 1U1QA 4W4MA 2HZAA 2GW8A 1S1VB 4B3TJ 2KKHA 1X9MA 3W7BA 2H5EA 3IM8A 3G6YA 3MAQA 1Q8BA 2YNHA 3M7VA 4M1KA 1WC4A 4FYYB 1U25A 3IXQA 1KQKA 1VQ7S 5KFWA 1HNWJ 3CW2C 1KNZA 4DQPA 1QLNA 2UXCF 2VPXB 3FQLA 3KTQA 1RTIA 2COLA 2G0IA 3N6MA 3W1YC 4ED8A 2C2MB 4ZVQB 3FC9A 2XZDB 4ZCMA 4DSEA 1NHKL 1UFWA 1HWIA 1WC0A 4B3RJ 5E3CA 1RE1B 2J7WA 4IH6A 4LF5F 4MKAA 1GMVA 1H98A 2VL1A 3R1HA 4K4UA 2VG5B 4KFBA 2RDDA 3EXYA 3IP0A 3OHBA 4Q8EA 2YNFB 3GFHA 3TUIC 4OHYA 4RU2A 2Y1RI 2NXUA 2EFVA 1Q82T 3TJ8A 2MDAA 1D09B 1L3KA 3NGDA 1FX2A 1MG7A 4DX6A 2RRBA 3P3DA 3V6DA 1WG1A 2RILA 3WC2A 2HW3A 3BKUA 4AL7A 1SJQA 2M7SA 3TJ9A 3NCRA 1U02A 4V19X 3EGNA 4QPXA 2DO4A 4RKUC 2X7IA 1UZHA 4OI6A 1RTDB 1RTIB 4DSLA 1FE4A 1JNZB 2VDIA 3PFEA 5HLFB 1YJVA 2LQ8A 3BGFA 2EKNA 5IT9U 3RYLA 1X4CA 1UMJA 2B9WA 2IJRA 2ZH8A 2Y1JA 3OW2R 4KV8B 4AE5A 4MKYA 4NXMJ 1ZPWX 4QZVB 3DOLB 4M5DA 4K4VA 4QYZK 2P9CA 4ENOA 3SXLA 2ZDPA 4RPFA 5CABA 1TU0B 4KE5A 2KZZA 4DLGA 5BJRA 3GYGA 4ZPVR 3QO9B 4WIQA 3H5SA 3HKZD 1LWEA 4DQQA 4DFKA 1NK4A 4RNNA 2IFXA 4M95A 1FJGF 3CJKB 1RA7A 2DEJA 5KFNA 4P2MA 4OZ3A 4NI2A 3CC4S 1TL3B 2AWZA 2QSFA 3TA0A 2CWXA 5DG9A 3KMSA 2KRRA 1IBLJ 2CFXA 3MFIA 4WBFA 2AEFA 3H2LA 2QV6A 3VCDA 1OY8A 4FNHA 1NJYA 2ACMA 3D9BA 1VBXA 2OEJA 2ADBA 1VQYA 4KB7A 4ED6A 3M8ZA 2E5IA 4OZ1A 3NMRA 2AIRB 1FRLA 2UUWA 5KFPA 3OXGA 4ZIVA 4B9MA 4ILMA 1RT5A 3WIVA 1LWXA 2DNOA 1UVLA 1XN9A 4WPAA 3PZPA 4P9SA 2VV5A 1NPKA 2BM1A 2XNQA 4KKOB 2WBRA 4RUAA 2CQIA 3G6XA 4IOBA 4K0KJ 3D1OA 3OFGA 1WDDA 3R5GA 2EK6A 5B0DA 3TQ1A 2MLZA 4RNMA 2I8EA 3G87A 2XLIA 2C3OA 4I2PA 4J9VA 5IC4B 3SSSA 5LJ5Y 2VICA 1RKJA 3LW5C 2DNLA 2R7WA 5KFFA 1ZETA 1VQLS 3MF5A 1SUQA 3MMCB 1F3FA 1WEXA 1FFGB 2QLBB 3DDKA 3GSIA 3MEDB 4TQSA 2DR9A 4I67A 4OI1A 4XPCA 2BANB 3JXOA 3CCMS 2KZMA 3FMWA 3E8OA 4Q2LA 1SB6A 2CIMA 3CSKA 3MPDA 1AA1B 2BE2B 4K7QA 4ZVOB 3CMAS 1BD6A 2WONB 3PJXA 4LSLA 1H2TZ 4LF2A 2YKMB 3UDVA 1DHMA 4J9PA 3RB4A 1Q86T 1RA6A 1BHNA 4ZP6A 5GMEA 1L3UA 4RWXA 2Z56B 1F3VA 4DFPA 1N5SA 1WACA 2X1AA 3RR8A 5LMNF 1EP4A 2CVEA 4L6V3 4MH8A 4Q43A 4I4BA 5L1KA 1X4AA 3QATA 2XI2A 4YFUA 4QYZJ 5L8RC 4PWUA 1VQNS 2QFIA 3RW6A 4AQYF 2ZITA 3KXDA 4OYZA 2HHSA 1PKUA 1WTFA 3HHLB 3WDOA 2KDOA 3DOMB 5KT5A 4X65F 2MQPA 2XGPA 1I94F 1CG2A 2Z2LA 4LF8F 3FRZA 4KSEB 2YWKA 2CJBA 2C3MA 3HJFA 4K4WA 2H5IB 2KG1A 4DV3J 1FT8A 1RT6B 1YLXA 3I9ZA 4LFBJ 2HQ3A 2HIQA 5B0GA 2IBOA 1EX8A 3NOGA 4ETZA 1KDNA 4HH1A 4LIWA 2B9EA 1BGXT 3CJ3A 4Y2KA 6AT1B 1NPPA 1RBLA 4LF7F 2CWKA 1Y5IB 5DDPC 2DGQA 4OYIA 3E01B 3CDEA 3T41A 5D78A 3MR7A 4ZJLA 4ETXA 5A0YB 3DU5A 3FCWA 4LQ3A 1SXLA 1EKRA 1RDRA 2R7XA 2XQCA 1OPZA 3CNQP 3MPVA 5ETMA 4EFAC 1JXEA 4C8OA 4YOEA 4FF1A 2GC8A 3BO4A 2D7SA 4OHVA 4QOTA 1FRIA 4DR7F 3R97A 2VBYA 2IYGA 2YX7A 3VAIA 3J81j 4NZ0A 2P9GA 2J7UA 3DLEB 2FY1A 4OZLA 4F4YA 3CO9A 3MM8A 1OMSA 1RYRA 5GADU 1JLFB 1VRQC 4C8MA 3T1YF 5B0BA 1Y3KA 3PW5A 4P10A 1Y5LB 5K20B 3EYZA 2PI5A 2YKPA 1TMJA 1RT1A 3LALA 4RNFA 2YBVA 3AA8A 2F8HA 5MLCV 1Q7LB 1FO1A 2DPJA 2V34A 2DHXA 4W92B 1S59A 2H9ZA 4ZPWR 3B4MA 3RRHA 2CQ4A 5CD4H 1IBKJ 2V9WA 4NEYA 5ADZA 4P7VA 3T1HJ 1UETA 2BUNA 2XYPB 2F65A 3DLGB 3NKYA 3OFFA 4UY8T 4GKJJ 1SBRA 3Q2SC 1D3WA 2DRDA 3GV8B 3HK2A 2AGOA 2HNDA 2H51B 1SH2A 2HVZA 4URQU 4HI2A 2HGNA 3F0NA 2VDHA 4IDKB 5SZTA 1T0TV 2CJXB 2VBWA 5SUHA 3MEGA 3ZZ0A 3OJUA 3RRKA 4NMLA 5G0RA 1VISA 2DNPA 4DSKA 2RUGA 3N01A 3T3FA 5DLGA 2QG9B 4RW8B 4ZPCA 2O3DA 4DR5F 2WRMA 4OYBA 4PPZA 1MU2A 4HKQA 2BJ1A 2LP4A 2MJUA 5D4OA 4E2FB 5I3QA 1K9MT 4IRDA 3PDNA 2FLPA 3Q23A 4X66J 2ROEA 3CCRS 5HMXA 3HVTA 5LXRA 3AXKA 2MXYA 2ZH6A 4PUOB 2J0XA 1BC6A 4J9UE 4DPTA 5HP1A 2OAUA 1UVJA 1JLGA 2UV8G 1KVJA 3UN3A 3M1VA 3V6JA 3B8HA 2HHXA 5A2QY 2VONA 4ZP8A 2XWXA 4WYLA 4I69A 1RP5A 1LWEB 4NRTA 1VQ9S 2V8DA 3G86A 3LWMA 1IJEB 2GIFA 3BBCA 3TAMA 1QAYA 3OLBA 2FJVA 3KMQA 1JLQA 1HBMB 3G2XA 5BR8F 3HM9A 8ATCB 1N52B 3BGRA 2OPSB 3POTB 2D3ZA 2XI3A 3J7ZT 4JI7J 4CNZA 4B3TF 3I5AA 3AXMA 1X5TA 2MKKA 3JSBA 2B6AB 4USUA 5FIIA 3ZNUA 1JLFA 1N0UA 1SC6A 5B0AA 4ECZA 3UD4P 3QQCD 1N36J 4DPWA 3TYTA 4RO0A 4CLTA 2VQFJ 4Q2MA 1V5IB 1GQEA 2AZ3A 3B82A 4HHJA 5DZ7A 3M9MB 4UY85 1M1KT 3LP2A 1SKWA 2HWTA 4DX7A 1PYTA 1IKVA 1R27B 4DZDA 1T9XA 2DIUA 3S8SA 3P4UB 2E5LJ 5D4LA 3G6ES 3TUZC 4FKYA 2CG8A 2HGMA 4O0NA 4UW2A 4EMDA 1RAOA 3GIIA 3OXFA 3K2YA 2LEPA 4CI0B 3CCJS 2CNOB 3UCZP 3IBWA 3SV4A 1EQ0A 4UUWA 3CC7S 1KHWA 1TMMA 2V6AA 3IAS9 4M5IA 2ZH2A 2HHHF 1NEEA 2EPIA 1OPIA 1MNEA 2JNJA 2W8LA 4NCBA 2B9XA 2Q79A 3Q8UA 2YNIA 5HMWA 2DGUA 2ZWPA 4NZ7A 2V0NA 2HEKA 3RB3A 1J27A 3WC0A 2DNQA 4URSA 4WCEQ 4QYRA 1BY9A 1VRUB 4DR1F 4CO3A 1PC5A 3PX4A 1JKHA 3TP2A 4DR2F 3WBZA 3WX8A 2W9BA 5A76A 4M94A 5M2UA 4RU9A 4NLRA 2LXUA 1T9UA 4UUXA 2JC1A 3KG0A 4J9MA 1RHKB 1RCOB 4E98A 1KD1T 1WJ9A 4LUBA 1U24A 3W2WB 2B5JB 1AB8A 1FVQA 1HD0A 2WZ1A 3QFWA 4NCGB 4QR2A 2Y0SD 2H65B 3JTNA 3HHLA 3CGIA 4UOFA 2W4PA 1SIZA 3KLHA 1S0MA 2IM1A 2UUBF 4WTOB 1G3OA 2H4YB 3KG4A 4DPXA 1FHTA 2JEIA 3BGOP 4FYWB 4GO5X 5F41A 3TR5A 2PO4A 4C48A 4CDIA 6FD1A 1W2BR 2HQCA 1DTTB 2V2ZA 5FDLB 3A3NB 3DRXA 2FJXA 4PWDA 1M5PC 4YR3A 4Z7YA 2JVOA 2CNLB 3PW0A 3KG1A 4HACB 1GX6A 1X5OA 2MZRA 1QDUB 2YNGA 3RZAA 2EFPA 5DDOC 4GC6A 1PC4A 3V4IB 3M2RB 2L08A 3ZTSA 4WJBA 4IG3A 1WHVA 4KAIA 1WI8A 2GQ2A 1Y7PA 4C3LA 1M0SA 5KG6A 3MECA 3TQEA 3U1LA 4CQ1A 4F4AA 4DUZF 1UW4A 2AMCB 2LCWA 3W2VA 3GTYX 4Q45A 3CCUS 4NASA 1CVJA 4C4WA 1AZSA 2JEFA 3FCHA 3TEGA 4NCAA 4B3MJ 2FB0A 1T05B 4QPTA 1HBUA 1OQ3A 1VCTA 3A8IA 4C11A 5EWFA 3GIKA 1E6VA 2OI2A 1GT8A 2E5JA 4OYMA 4KHRA 4B3SF 1IR2A 4LVNP 2Z2YB 4I2PB 1SJFA 4KGXB 1UVMA 4WP3A 3DMJB 4P74A 4ECVA 1JLBA 2BEFA 3PKMA 2LA6A 5D3GB 3HD1A 3TWZA 1N32J 5HI7A 5KFVA 2EVZA 4FXWA 1OS5A 2O67A 5EDWA 4AL6A 4X65J 4C0HA 4OZ2A 4QIWD 3CDAA 3K5PA 3ZFVA 2HQGA 4JBCA 4CLUA 3GV7B 3RTVA 2EBGA 4YHHJ 3JAMY 1LOUA 4LRAA 4FF3A 2XHCA 2MKHA 5D0HA 5LMUF 2KXNB 2HLTA 3M30A 5EX0A 3HZGA 1NK5A 2CJKA 4JI5F 2VPZB 2NYHA 1MSWD 5KTQA 3QGGA 4YDDB 2A2CA 1SL2A 3QAUA 1ZOTA 1PJ6A 1RWKB 5HBMA 1LFWA 1TV6B 3CD7A 4FPRA 4WXOA 3CJKA 5T7LA 1T94A 5C24A 1TL5A 1R3NA 4D3HA 5CYQA 1VQKS 1QE1A 4BDPA 2MQOA 4GKKJ 1RJJA 1M1GA 4ZVGA 1FJEB 2JHEA 4WFNQ 3OJSA 2DRBA 1S12A 2HHVA 1S5ZA 2OTJS 3BN7A 4TY8A 1C1BB 4KH0B 3QIDA 1GXLA 3H20A 3AOCA 3CIZA 2LQJA 4U7UK 2FJWA 1ZA1B 3K5OA 1XR5A 4GVLA 2HNYA 1UP1A 2VZ9A 5JVGQ 3T5HA 3P6YC 2PIIA 2YNIB 1G6BA 2UXDF 1HHSA 2FVCA 5B0FA 1DBDA 2VQEF 3T5LA 2QMXA 3KHLA 2RKIB 2CPEA 1JLEA 2VC1A 3F56A 1R31A 5ETLA 4C2MA 3I5BA 5KFAA 1NPRA 4L3NA 3R8YA 2QA1A 3CCLS 5L46A 4NA2A 1KFDA 2QYCA 1EIYB 1TVRB 2VG7B 1YRUA 4Y2CA 3Q8VA 5F8HA 4BS2A 4ERDA 2OPQA 3IC1A 2WSFC 4OI3A 5J2NA 4KFBB 2QO3A 4DX8H 3TNVA 2HMIB 4M5KA 1WOOA 4IRKA 4GVBB 4QWCA 1VQPS 3DM2B 3J7A1 4KBIA 1VQMS 2R7QA 3I0SA 2BOPA 4USMA 3GIMA 1W7WA 9RUBA 2R7SA 2MTLA 4I68A 2GMJA 3GWCA 4M8LA 3CD5A 4HH0A 2ZC4A 4QWAA 3CMES 1UCNA 1NZ8A 1S10A 4O44B 5CZVA 1FKAF 2QSWA 1RLCL 2MY7A 5E3PA 3EX7B 1RZMA 2ZDOA 3VVUA 3MI7X 4RNOA 4R0EA 1RT2B 4YN3B 2M0GB 2P6SA 4X4OA 1S77D 3MMBB 1KLMA 2AV5A 3QT6A 3OHAA 1O5JA 3CUNA 3ZTQA 4F4ZA 4ZIWA 5DGAA 1VBZA 4DX5A 2BA9A 2ZH7A 5HBMB 4CH7A 5F8GA 2UXBF 2LU1A 1L3VA 1RWXB 4TYBA 1IBKF 4PUOA 1S1WB 1N88A 2LDIA 4QIGA 4I6WA 3Q8SB 2WSEC 3FSIA 3PRBA 1NDCA 1WDTA 1FFSB 5H9EK 5KFIA 3DRPA 3QLHA 1GTHA 1Y3JA 2JFDA 2XYHB 5JVHQ 2DYAA 4FDFA 1XC9A 3ISNC 3K7RA 1ZAWA 4Y65A 2G1HA 4NPOA 5IV3A 5HROB 2FQQB 4P52A 3K59A 2BJ7A 2AJ4A 3MGJA 2EFNA 3OBIA 5L1IA 4LFCF 3LF0A 4ZOSA 1FRJA 4JI8F 3G4SS 1HMVB 3NRBA 1CULB 1WSRA 3NAHA 1HR0F 2HHTA 2ZE2A 3AOAA 4ZCLA 4RJVA 3GILA 2D3O1 2DITA 4X62J 1CJKA 4DN0A 4OHZA 1S0VA 1NDPA 4K2JA 3HLUA 2OKQA 3B6BA 2YQ0A 3EDRB 2MYFA 4WXWA 5AE1A 1YJRA 2VFVA 4I7FA 1R8HA 2DK2A 5CYMA 1KOHA 5IQQA 4M5JA 1KS2A 1VFJA 2QL7B 4CLLA 4ZLJA 2KYXA 3W2VB 2XCAA 2DVIA 1MROA 1PJ7A 3US5A 4ZVFA 1ACMB 1RT4A 3OXLA 5KFDA 1QUPA 2JOQA 2LYVA 3BF4A 1R0BG 3T6JA 1VHIA 3O5TB 4BCAA 4F25A 1S1WA 1NKBA 1N33F 5LOQA 4AUKA 1VHFA 3I0RB 2ZZNA 1JK9B 2Y9HA 4F4KA 2OJ3A 1KVKA 1B7FA 1WOSA 4NXMF 2GMHA 5DJBA 5K5MA 4PG7A 5LMNJ 2IRXA 3OR2B 4IH5A 5D0RA 4KYZA 1Y9OA 3IM9A 4OHXA 3CCZA 3DGPA 3CXCR 5KFBA 1YJ7A 1C1CA 2EK1A 3CDBA 4ECWA 3IGNA 1X5SA 4IYQA 2GJ2A 4C0BA 1TL1B 2ZHOA 3BGUA 3ZC4A 3NY0A 4NYPA 4CWBA 3G71S 5I42A 4LR9A 3BDPA 4OX7A 3J7Z5 3N6LA 2B4VA 3CD0A 2MZJA 3L4BC 4KPCA 4MIBA 1C0TB 4OHWA 5KT6A 1PCAA 1ZTTA 2AJ0A 3I96A 1FJCA 4WFAQ 3F73A 5HN0A 3W5ZA 5C5JA 2R7RA 4NLYA 3TA1A 2BMBA 3CD6S 3IS9B 1Q78A 3CC2S 3J81U 3AD7C 2N3LA 1HKAA 1HWLA 2MGZA 1JLCA 2HWHA 2X3GA 2X51A 2RS2A 1URRA 1HNVB 2WSCC 1QAJA 1V3SA 3QNWB 4EK2A 3QRQA 1G7CB 4WFXA 2CKWA 1J5OA 3NOCA 3R5BA 1HQEA 2GX8A 2VFTA 2QLWA 2FZKB 4KY3A 4DU8A 2P6TA 4CYUA 5BYRA 3FDSA 3FQKA 3U1MA 3EVOA 3DOMA 3VAHA 3H5UA 2GJIA 1AXQA 2FD2A 1TZ0A 3F44A 4OFZA 3IWNC 1RTZA 3DLKB 5KG5A 3EUNA 2UVWA 2PA8D 3SI8A 3OVSA 4KGKA 4YB5A 1IKVB 1Q95G 1VK3A 2KHCA 4DQSA 3Q83A 3HSZA 4TY8B 2PEBA 2EG1A 2LFVA 1LV5A 3V6KA 3TZXA 3IGVA 3HHLD 4ED1A 3ILLA 1U1RA 2R2TA 1KRPA 2J0WA 3ENVA 2MSTA 2O66A 3MR6A 4DL7A 1NUEA 1FXRA 2FHOB 2X1FA 3A3OB 3Q8PB 3R5JB 4K4YA 4N56A 4RW9A 5IC6B 4ALZA 2HFSA 4PPDA 1HWJA 2DHAA 2GAGC 1FD2A 2HG4A 2W7PA 4DV2J 1RYSA 1LWFA 5DETA 2YVSA 2MJNA 4R5PB 4OMFG 4JV2A 4FS2A 3AJ1A 2ZBCA 2GQCA 2DGTA 5GAGU 3PW7A 2K3IA 3EMTA 1FA0A 4B9SA 2ZBPA 1HBNB 5K8PA 3UDCA 2YKNA 3FZBA 2BW2A 3DRSA 2W8KA 2RRNA 4CLKA 1B64A 1N54B 3ZTOA 2JSXA 2E66A 1W2IA 1FWKA 1RT3A 4ID5A 4KH1B 4P6QA 3J80U 5HP1B 1Q8IA 3C66A 3KHHA 5BYSA 5J1EA 2MZ1A 4O3SA 5E2QA 4LQ9A 2RVJA 3LP0B 4IH7A 3ZZUA 2KXHA 2MB0B 1YITS 1FRMA 1V3ZA 3W64A 1IR0A 1RHMB 2NXJA 3FVYA 3BSOA 1FTRA 3LWLA 3CJ4A 3KFWX 1HWUA 3AB2B 2AF6A 3JSRA 1U09A 3LP0A 4LRBA 3UI3A 2M9KA 1D9FA 1QSLA 4P75A 2J6SA 1S57A 2WAQD 5J1EB 2FHJD 2DO0A 1SKUB 4LRDA 4NLSA 2LECA 1EKSA 1JLAB 2D74B 3KJFB 3MMBA 4IKAA 1RT3B 3UCGA 2ZBRA 1PAUB 2OPRB 5KFOA 2W9CB 4DV0J 2OO4A 2CQDA 5LL6d 2XYGB 1W26A 1HBNA 5D77A 4Q8FA 1EZZB 1OO0B 2XWYA
chains in the Genus database with same CATH topology
2G4BA 3DLGA 4ED2A 4Z2XA 4A8YA 3RB6A 2ZHAA 4F3OA 2XB2D 1UL3A 1X4GA 3E51A 4EYHB 2PN6A 2V8GA 2ZJRQ 1QSYA 2FTRA 3ZZZA 3FEZA 5BYQA 3VR1A 3LAKA 4KV8A 4NL5A 2DR8A 2F7VA 2EW9A 4O44A 5KG1A 1DARA 1U1MA 3NBPA 4DR7F 4CO4A 4IQMA 3O6QA 2AGPA 3SV3A 3L09A 1Z2LA 2O5DA 3QZ8A 2K3KA 4ILRA 2ZNZA 3D0HE 4QWBA 2FGOA 4B9TA 2BJDA 3VAKA 5I3UA 1S76D 2DGXA 1S9EA 2XEXA 2V5HG 2PDAA 4JV0A 3PHEA 1SH3A 1S6PA 5F8IA 2E9ZA 5KFRA 2HMIA 3W2WA 5IWAF 4NLUA 3THPA 1NU4A 1TK8A 3QMQA 2M70A 4FP9A 4KRWA 4N76A 4OJGA 1NJZA 1U7LA 3I87A 2GIRA 4C0OC 4ED0A 4X4PA 4LF4F 1YVFA 1TFWA 1NZAA 2DNHA 4N41A 7FD1A 4XPEA 1YJWS 2EFOA 1RGVA 3K58A 4OX6A 4RBTA 5KFSA 1NK0A 2VQFF 5F0WA 3MWBA 3MD3A 3BN4A 3IG1B 2DGSA 4DL2A 5GVQA 1X9WA 5ITHA 2R9LA 2K2PA 3R27A 2DNYA 3A1YG 4LFBF 2E5LF 1IKXB 4MTPA 4R25A 4EZ9A 3VAGA 5CYJA 1S9EB 1Z1ZA 3TX8A 1DZ5A 2L9NA 3SDEB 1IBMF 2PMZD 2K1RB 1HWKA 2PT0A 5HMYA 3M8PA 4MFBB 3LH2S 1P1LA 1E6YB 3IWLA 4M63A 5KOWA 3M30B 3OL6A 2ZNYA 4CCHA 4F02A 2R7VA 3DU6A 4ED7A 5T14A 3N0VA 1WG5A 1MW7A 2AGQA 1TUVA 3QGHA 3VQTA 2D1CA 3GR0A 2Z2MA 1YHQS 1H7XA 5GAHU 1SKSA 2BE2A 2DCLA 1RQ0A 4IO9Q 3OTDA 1MROB 3MEEB 3I6PA 2CQGA 4WIIA 3MAHA 5K9FA 4J9RA 4ZPDA 1RISA 3RR7A 1E6VB 2ZH1A 1BQNB 4KO0B 4EWTA 1XNRF 2BM0A 2Q6CA 4J9LA 1RTHB 2ZE2B 2LA4A 1PO6A 2IAJB 3KK3A 3FSYA 1LW2A 2BQ3A 3K5NA 3UW1A 2K7JA 5EN1A 3NMAA 4KQZA 2R8IA 2HYIB 1YRTA 4RWWA 1UEVA 1IKWB 2OPPA 2CQBA 4Y2IA 4ILLA 2YKNB 2ROGA 1R43A 2GHPA 4NLQA 4UQTA 5E0OA 3BO2A 1M5SA 2RQCA 2AX1A 3AH6A 1OQ6A 5HO4A 2B4PA 2R8JA 4DF8A 2FDNA 4ECYA 4I64A 4MK9A 4JV1A 1J2VA 2NLWA 4ICLB 1NK7A 2DT9A 5B09A 5L39A 3KLHB 5K14A 1ZBTA 4DFMA 1REVB 3MOJB 2MQQA 2VOOA 3V4MA 3KLVA 1RT2A 2VA2A 3C3LA 3M32B 5IT9Y 2BBEA 2IM2A 4WZMA 1KVIA 1SJ4P 2YH0A 3UE2A 2CJ9A 4YB1P 1RWUA 4CTAA 2V4QA 2CDQA 1BQMB 4KHMA 2DRAA 4GMKA 1KOOA 4TY9A 4WZQA 1XTZA 4RBVA 3BR8A 3DHWC 1JNRB 1MMLA 3CEDA 5JJBA 2C2DA 3B78A 2VBZA 4G3IA 1UVNA 4WK3A 3GR1A 3QPIA 5KFQA 3K0JA 4C3KA 2B9YA 2B3TB 2FHMA 1I1GA 1HPZB 4B3OA 1R8CA 1NKEA 1UVIA 4C97A 3PR4A 5DLFA 2L9WA 2RDJA 1RTJB 2BYCA 3U1NA 3HHNB 1JLCB 1RAJA 1CC7A 2DNZA 4LJMA 2F4VF 4LF6F 2I1RA 4LMZA 5KFTA 1S9GA 1S0OA 2FGCA 3GFZA 4OZNA 2MQMA 5KFXA 4Z37A 2R8GA 4GKJF 1F2GA 1VK8A 1X4FA 2KFYA 4IO1A 1C1BA 4F2RA 2YWFA 3M6XA 2GQQA 3POTA 1TL4A 3BDEA 5IT0A 1DLOA 1TL1A 2NUHA 1UWBA 2EG2A 3CDUA 3TAMB 1OWXA 1FDAA 1HI8A 2ASYA 5A8KB 2KI2A 4JI3F 5KFEA 3DN9A 5DM6Q 4R0JA 1C2PA 1U1KA 5KG7A 1IM4A 2G9OA 1K8AT 3CCVS 3RAMA 2ALZA 4ECXA 2Z8QA 1UJ5A 2F8EX 3P96A 3CCTA 2RRAA 3DHXA 4CNYA 2LVWA 3QZ7A 1D8ZA 3MR5A 2L41A 3MM6B 2NYIA 1R8AA 4ELTA 3MMCA 2HFOA 1QTMA 4H4MA 5FJ4A 3DXSX 2XMKA 1FD8A 1LFPA 3N28A 3J7YU 1S4FA 3IR6B 4A8KA 2E5GA 5CZXA 5CCMA 2HZCA 1YJ9S 1NK6A 5GAGI 3X3UA 4C8NA 2HRUA 2CVIA 2HLUA 4F67A 1R7IA 3J81Y 1DURA 5A8RA 2W9AA 1R0AA 4EBCA 4ZCIA 1KTQA 1U48A 4XIUA 3IO1A 5DQIA 3DLHA 1FRXA 2OMLA 3KK1A 4DL3A 3MTKA 2UVVA 4HTJA 3NNHA 1Q1KA 2MSSA 3D28A 4FZVA 1CPZA 2YNGB 3MPWA 1SJ3P 3OTCA 3M8QB 1FE0A 2DJWA 2E7WA 2RDIA 3TVZA 4U6PA 3BJYA 2LEBA 1X4BA 1XBWA 4RW7A 3UFCX 2ZHBA 3JB9k 3HHKA 3L3CA 4NWBA 1JX4A 3EGWB 1TKTA 4Y6IA 2N7YA 3KNGA 1SQEA 2RT3A 2F3JA 3DLKA 5F0UA 4TU9A 3OQ2A 4O4RA 1S9GB 1P6TA 1HQEB 1RT7B 2PC6A 3FZ2A 2MKIA 2Q3PA 2FJDB 4NX9A 4JUZA 5H9FJ 3NLCA 2GGPB 4Y0FA 1HQUA 1D0EA 2M52A 3N9UC 2BABA 1FRKA 1LQ9A 2FJBB 3HMJG 2W9BB 1D8YA 5CCLA 1Q16B 3PJWA 2KVIA 2J9DE 5J2NB 3T9ZA 2GGPA 1OSCA 4Y3CA 3HHEA 2D3OR 1CLFA 1HPZA 4B3OB 1YGYA 3G6VA 2IC3B 3MTJA 1LWCB 2HS4A 1D9AA 2CQPA 4QU7A 3QGIA 2CQ0A 3PNIA 3HPOA 3CCQS 4A8FA 1DTQA 4I6YA 2HNYB 2XS7A 1S6QA 2Q6BA 2QA4S 1VQOS 4W90B 1LW0A 4ZP9A 3LP2B 2XS5A 5EX3A 1ROFA 1AW0A 3OR2A 4I0WA 2ASDA 3MEKA 4XAKA 5KFJA 4DQIA 2KFNA 3JSMA 4ECRA 1FKAF 3D0IE 1REVA 2DD8S 3M2UB 2LLZA 3PXGa 2FVSA 5C24B 2OPSA 3Q8RB 1JXLA 2BZ2A 3ZZTA 2XBPA 4URGA 5DDRC 3MZIA 1ZYQA 2GO9A 1U45A 3OL9A 1SUQB 2J9DA 1NK9A 1I6JA 4X62F 4X4RA 4A8MP 2E9RX 3U27A 4DL0C 1VQSA 4ECQA 1F5AA 4O23A 3MM5A 4N47A 5AXMA 2O01C 2I38A 1KFSA 1XEZA 2OPRA 2ZD1A 4ID8A 2GFFA 1UEUA 3TAQA 4IRCA 4C3MA 2RU9A 2RS8A 1JLAA 4IFYA 3SQGB 1P27B 2AYGA 3I4PA 5J1NA 3ONQA 5J1PA 2ZH4A 2BDPA 3IRXB 3KHRA 3HDSA 4Y2AA 3K57A 5E41A 2JLFA 5F8MA 3MUMP 4OJ3A 2G13A 2OD4A 3VWSA 2IA0A 3PR5B 2BACA 1S7HA 1KQFB 2MY8A 1EETA 4X2BA 3RAQA 2CQ1A 2VH7A 1RKIA 2QMWA 3BR9A 1F60B 3I4HX 2MHEA 1U1PA 5KT4A 3I31A 1JWWA 2VOPA 4RW9B 1CQNA 3DI6A 2HAIA 3CWJA 2RQMA 1JJ4A 2EBEA 4PXCA 3UCUP 2GHVC 4CZCA 2W4CA 4WE1B 5F9LA 1O8BA 2PE8A 1N5YB 3U7JA 1VMBA 1RT1B 4TYAA 2BRKA 4PG5A 1ZAXA 2OH2A 2GA7A 2V8HA 3D0GE 4E0DA 1X7VA 4NA1A 1RTDA 2XSJA 1N0VC 4FXDA 4ZHRB 5AXLA 1FDNA 2DHSA 2HPUA 2HRYA 3P5TL 2KYZA 2W24A 4C7QA 4TQRA 1RTJA 3V6DB 2PFFB 5KFUA 4KPYA 2YNFA 3ISND 3PKYA 2C28A 2EI5A 2L3MA 4KT0C 1AROP 1DQ8A 2DNMA 4LIRA 4Q44A 3IG1A 2MQLA 3CJ5A 3KLIA 4QJVA 4OZJA 2XMMA 2ZOMA 2MGZB 3PEJA 4BBYA 4OQJA 5KFYA 3MHYA 1T8EA 4DSIA 2M3DA 1ZM3A 2CQCA 1HNZF 3Q0AA 2FC8A 3UR0A 3MUVP 1BQMA 3CF5Q 1A9NB 4F26A 5AXKA 3PIOQ 2L9DA 1BWEA 2HQIA 1WG4A 3E3XA 2O1PA 1CQMA 1KHVA 3VQSA 4B9LA 5HQ8A 3IR5B 4JOUA 4NOHA 2RSQA 5K8OA 3G8TA 2ATLA 3LUYA 5E7OB 5DDQC 1S9FA 3X1LB 4O4GB 3NWGA 2WCXA 1C0TA 3AB4B 1GTEA 3NP5A 3QJPA 5T7LB 4QWDA 3ZZPA 2BXJA 5I3UB 2QA4G 3V81A 3M8QA 3P49B 4F4WA 3UNGC 1GXTA 4RZRA 4DF4A 1KEKA 4J9OA 1D9DA 1MWZA 3NAIA 1XNQF 3T6BA 2R2SA 2KO1A 1JLQB 1YRXA 2W25A 5CYMB 3N5FA 2JZ5A 2QA2A 2QE5A 3NNCA 2WONA 3NCPA 4HEA9 1IQZA 3MPYA 5F3ZA 4DFJA 1U6ZA 1R8BA 2VG6A 4OI4A 4D3GA 2GNKA 2WHOA 4PXEA 4JI6F 3TARA 3DMJA 5KFZA 3DRRA 1JMTA 5HMZA 1N56A 1WNEA 1HMVA 1GX5A 1Y4ZB 3KWMA 5A8WA 2J6TA 4G1QA 4RLEA 4JI4F 2IRUA 5DG7A 3OR1A 3VF0B 5GAHI 3FRYA 2X1GA 3KK2B 1T03A 3NS6A 1NJWA 3DYAA 2NREA 3MURP 2LU2A 4QW8A 4GC7A 2E1AA 4P7TA 3J80Y 2ZH3A 4LFAF 2HFZA 4HYKA 2DGOA 4X4QA 1FXLA 2J7KA 2XMWA 2CPIA 3C6TA 5C25B 4CT9A 3IRWP 4QQBA 5KG0A 1FRHA 5GAEU 2CJAA 3MM5B 5IZHA 2M8DB 4PQUB 3IWXA 1GAOA 2KFZA 1S1TB 3BQ0A 4DOZA 2OFGX 3QWPA 2C2EA 2WOMB 3OTEA 1TR0A 2N82B 3AQPA 4FF2A 4YR2A 1N48A 1FJ7A 2J9EA 2EWHA 4MAKA 4YY3F 3LO3A 2UV8A 3N5BA 2JDJA 1IKXA 5M2RA 1F9FA 4DV0F 4LSNB 3VALA 3CULA 3OL7A 1IQTA 3UPFA 3PEHA 3GG0A 1N5TA 1X5PA 3GFYA 4O0IA 3HF5A 2B7BB 2PA3A 1XR7A 3EGZA 3AJ2A 1F0XA 1X8DA 2N4DA 2MZSA 4C8ZA 3CTRA 3BM7A 1HW8A 2BJEA 3HX9A 2ZFHA 3M9NB 4DS4A 3G9CA 2JEJA 2APOA 2ZBIA 4QIEA 3RW7A 3D5MA 3IR7B 4K0KF 1JLEB 2RQKA 2DR5A 7FDRA 2ZKTA 2R2RA 2IC3A 3QJLA 4BWMA 4RW6B 5CHCB 4Y28C 4TN2A 2ZJPQ 2F8MA 5H1SV 3HVAA 4B9NA 4G1PA 1Y5NB 3PM9A 1S6PB 4EZ6A 2B43A 3FGVA 4DV4F 4IUFA 5IQ6A 3M9OB 1HQUB 1YBAA 1AFJA 1ZM2A 2XNRA 1J5EF 1RT7A 3M32A 1KSPA 5LSLA 1U6FA 2RIJA 5K8NA 4B17A 3BGLA 4K5SA 2OIHA 3DLLQ 2CQ2A 2IM3A 2YWEA 4EO8A 1VQ5S 1B0PA 5DRKA 2UU9F 3VTIA 3HP6A 4WE1A 2MHNA 1FKPA 2KRBA 4K2XA 1YJUA 2V4JB 4ZPTR 1S48A 4NLTA 3ENWA 1QVFR 3OVAA 3FNNA 4USJC 1VC0A 4U67Q 3CCSS 4RW7B 3BS9A 4MKBA 4ES3A 4BHQA 4J9NA 4C8YA 2GHWA 3T9NA 1QSSA 2AJFE 5KT2A 3G96A 3BSNA 1VC5A 4B9UA 1JLGB 3RB0A 1HHTP 2E1CA 5LXYA 3TOQA 1EETB 4X84A 3ITHB 5DO2A 4MK7A 1U49A 4DR4F 4N8NA 3S6EA 2OTLS 3WZ0A 3QAEA 4ZMMA 1H0HB 2YY3A 2RF2A 1HYSA 3IRXA 1QAIA 2KT5A 1MU2B 4TNOA 3TANA 2JEGA 2R7OA 2KZMA 1T03B 3JTOA 2G0CA 1SV5A 4TLRA 2JH3A 3CIMA 4KC5A 4WFYA 2KB2A 2FPHX 1XMBA 3V5RA 1Q81T 3VZIA 5DQGA