2G9OA

Solution structure of the apo form of the third metal-binding domain of atp7a protein (menkes disease protein)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
77
structure length
77
Chain Sequence
b'NDSTATFIIDGMHCKSCVSNIESTLSALQYVSSIVVSLENRSAIVVYNASSVTPESLRKAIEAVSPGLYRVSITSEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-transporting ATPase 1
publication title Solution structure and intermolecular interactions of the third metal-binding domain of ATP7A, the Menkes disease protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 17
structure length 77
sequence length 77
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2006-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2g9oA00
2FIUA 5B0BA 1YJTA 4YEAA 5F0UA 2LDIA 2ZDPA 3QGPA 4HI2A 3TNVA 2IFXA 4Q2MA 2G9OA 1V3ZA 2W4CA 1K0VA 3VTIA 1ULRA 2GA7A 5KAKA 2KKHA 2XMUA 3HFKA 2PGCA 3E8OA 3IWLA 3BGUA 3KKFA 3FMBA 2RMLA 1FD8A 1N5TA 2IYGA 5T7LA 1APSA 5T7LB 1N5VA 3HX9A 1P6TA 3WDOA 1Q8LA 5A6WA 1FE4A 2ROPA 3MCSA 4FNIA 1S6UA 2K7KA 4A47A 3CJKA 3GZ7A 2OD6A 1OSDA 2AP6A 3CJKB 2FHMA 2N4DA 1X8DA 4A4JA 4OJHA 1N5QA 2QYCA 2PD1A 1MWZA 2BJEA 4HI1A 4OJ3A 4DN9A 1XBWA 2CRLA 2GGPB 2FTRA 5A6PA 3KG1A 1X0PA 1SQEA 2AW0A 2N7YA 3KG0A 3BF4A 4NPOA 3HHLA 1OPZA 2HFOA 3HHLB 4DL0C 1AFIA 1R6YA 1IUJA 2K7JA 3I9ZA 5IXUA 1TUVA 1TL5A 1WD6A 2OFGX 2L3MA 3DXSX 1W2IA 5B0FA 4A46A 2BJDA 2BYCA 1JK9B 2ASYA 4DPOA 2LXFA 3LGMA 2W4DA 2QLWA 2RU9A 1TZ0A 4HH0A 3UDCA 1FVSA 1YG0A 1Y9OA 2OAUA 5B0EA 2JDJA 5B0GA 2FB0A 4OJGA 1SB6A 2ROGA 1KVJA 1TR0A 1FESA 2LQ9A 3LGNA 2XMVA 3HHLD 2QIFA 2GGPA 4Y2IA 4NL5A 2GFFA 4FNHA 1KVIA 2AJ1A 2RSQA 5B0CA 1AFJA 2BUNA 1X7VA 4ZA1A 1N5SA 2EW9A 4OJ1A 3F44A 5F0WA 1OQ3A 2ACYA 1GXUA 2K2PA 3K7RA 1JWWA 1Q53A 5B08A 3FGVA 4OIXA 4QOTA 2XMMA 1VQYA 1Y3KA 3BN7A 2XMKA 2XMJA 3IWXA 4ZOSA 5B0DA 2OP5A 2XMWA 2QLXA 1OQ6A 2ROEA 1S6OA 2HLTA 2VV5A 3KNGA 1QUPA 3TRGA 1GXTA 4HH1A 1AW0A 3LO3A 1RJJA 4Q2LA 1U7LA 1SI9A 1FE0A 2BBEA 1YRXA 2HLUA 2LQBA 3MZIA 2OMOA 1YJUA 3HDSA 1TL4A 2AJ0A 3BB5A 4YDXA 3BDEA 1KQKA 4EFAC 2GV1A 2IYIA 2RILA 1YJVA 1CC8A 4F67A 1YJRA 1FVQA 2XMTA 2W4PA 1CC7A 1P8GA 1Q4RA 1URRA 2HQIA 2K1RA 1FEEA 2OD4A 2OKQA 2K1RB 2OFHX 3DCAA 4Y2KA 2VH7A 1MWYA 5B09A 2HFNA 1CPZA 3HHLC 2Q3PA 5K9FA 3FRYA 3TOQA 1LQ9A 2KT2A 4Y2MA 2GCFA 2N4CA 1Y0HA 4A48A 2HIQA 2GO8A 2ZDOA 3HF5A 2KYZA 2KT3A 5B0AA 3BR8A 1Y3JA 3BM7A 1VQSA 4HL9A 3QMQA 3T9NA 1Q8BA 4U9RA
chains in the Genus database with same CATH superfamily
1T9YA 2HQGA 5F9LA 5A8RB 4UOHA 4OZJA 3LAMA 3GV8B 3QGIA 3TA0A 3J7AN 1TVRB 3GIKA 4W98A 2LDYA 4NRTA 1NK6A 4IRCA 5FDLA 3GG1A 1HR0J 3PX4A 2IM3A 5ETRA 7AT1B 2HG4A 4L72B 2XO7A 1H0HB 1ZZFA 2BJ7A 2HSEB 2PSZA 5B7WA 2HHPA 3DOMA 4MMOA 4HH0A 3RRKA 4G1QA 3WC0A 4KV8A 3CDEA 4KE5A 1UP1A 4UUXA 3UCUP 5HVGA 5KFEA 1U0HB 4O0NA 3H25A 4OHYA 3BGRB 4G65A 4ID5B 3MAQA 1YZ7A 4WU3A 1F2GA 4TVAB 5I3UB 2E1AA 1KTQA 3AH6A 4QR1A 3JQJA 1NB2A 2V2VA 3GR0A 2XO6A 4IH7A 4P2SA 1Q79A 2MQNA 4J5OA 3MM9A 2HIQA 2EEYA 2VFUA 3KJFB 3KFWX 4RW9A 3GJTB 1XEZA 2IC3A 5IC4B 3CMES 3TWZA 4BWJA 4JI6J 2Y9HA 5HLFA 3VGSA 2BV3A 3R97A 1U24A 4FF3A 3M1VB 2QTWA 2C2EA 3W2VB 1N6QB 1W25A 5KFSA 2MQPA 3MD1A 4IRKA 3DRSA 2N3LA 3AXMA 4J9UE 4DPXA 2WVEA 1FVSA 2NR0A 1FT8A 1FXRA 4DV1F 3SCKE 3NL0A 3SV4A 1TUGB 2MKIA 3QAUA 3ILOA 3MCMA 4MTPA 3W5XA 3QZ8A 3CCZA 2Z57B 4Q2LA 3BV8A 5D77A 3EX7B 3PW4A 4U95A 3S8SA 3CF5Q 1MLAA 3V6KA 1MW7A 4Y2KA 1GH8A 2B7BB 3D3BJ 3KLVA 4GKKF 2H65B 4C8OA 5DG9A 5I4MA 2NSBA 1IJFB 4IR1A 1UZDA 4OZ5A 1JLQA 2KYXA 2FHMA 1H2VZ 2X1FA 2V5HG 1WNEA 3T1HJ 4ICLB 2XLKA 1NSKL 3D6FB 5F8IA 2H5EA 2R7TA 3HP6A 5H9FJ 4AFFA 1HBUA 4M5IA 1U1KA 2DHGA 1SXLA 5B0GA 1FHTA 2ROGA 4NXMJ 4I2PA 1V3SA 2AQ4A 2FVPA 1JJCB 3SBMA 1BE4A 3OSNA 2WOMB 3P8BB 5HMYA 3M9MB 3KLGA 2DO0A 2EFNA 1NPRA 5AE1A 3LA0A 3C14A 1Z1ZA 2VA2A 4ES1A 3TAPA 2XULA 3PX6A 1NBEB 2DHHA 2Q6BA 4WTYA 3C66A 1B7YB 1CPZA 1ZM3A 1LKZA 2W2NP 5CYMA 1D8YA 2FJWA 1NK9A 2VG5A 2B8PA 5B0BA 3HCXA 3IRWP 2UUAJ 2RRAA 2LMIA 4F0HA 4C8NA 3EXYA 2OD6A 5K8PA 3DU6A 3KLHB 2GAHC 3QGHA 5KFPA 1FO1A 3OR1B 1PILA 3OJUA 4M94A 2A1BA 1DARA 3CCMS 4K50A 1T9VA 4CLKA 4TY9A 2DB1A 4CH1A 4C6AA 2E5GA 3GFHA 1K9MT 2BKPA 4NCGB 4F0KA 3PZPA 2F40A 1TV6A 2ADBA 3IG1A 2I38A 2B3TB 4YUDA 2LYVA 2Z2ZA 2XMKA 4DXLA 2YKPA 3KDNA 1YITS 2XLJA 2HLTA 1Q1KA 3E01B 3PEHA 1NB7A 4IFVB 5SUHA 3QO9A 2HHUA 3PRDA 1IKWA 1PJ5A 2C22A 3IO1A 5F3TA 4PG7A 4DR3F 5KOXA 1RTDA 2C2ZB 4JI0F 1NXIA 2HAFA 1UFKA 4HACA 3B82A 2YQ3A 3RJMB 2J5AA 4LREA 3R2DJ 3CDUA 4RU9A 1ZPVA 4GMKA 5HI7A 2KJVA 1VBZA 5L46A 5JMNA 2SXLA 3TZYA 5DLGA 3BYPA 2MDAA 2PD1A 1REGX 1FA0A 5H9EK 1FRHA 4M5HA 3KG1A 2QEXS 4NE9C 1PBUA 2VASA 3D6HB 1S77D 4A46A 3CTRA 5E3PA 3DGVA 1HBOB 4DR2F 2YX7A 2DH7A 2B7CB 1YZ6A 3M32A 2FUG9 4JI2F 1EHWA 1XNRJ 3Q8RB 1GAOA 3R3TA 1UEVA 4BLGA 4P6QA 3I96A 4DX5A 1N48A 3PXGa 4H4MA 2OPSB 4UZCA 3D1HA 1VMBA 2AJ2A 2RQMA 3AT1B 3TRGA 3UQSA 1OYEA 4RW9B 3FDSA 4LF4J 2IC3B 1T9UA 1N33J 4WZQA 2NYIA 5EX0A 1MU2A 3DLHA 2ZH3A 2R9LA 3C19A 3PM9A 3QMQA 4I7FA 6AT1B 5E3QA 2IFXA 2VL1A 5D4NA 2C42A 4LJMA 1WF2A 4B9NA 2JX2A 2YKMB 5A76A 4LF6F 1JXVA 3MM5A 2C2DA 2GJ2A 3RBZA 3DOKA 3T41A 3NMAA 4KGVB 2CRLA 4WIQA 2XS7A 4WKYA 2QL5B 3RG6A 3IR7B 2NCKL 1LXJA 4B9VA 4FF2A 2PFDA 3I4PA 2RU9A 1FRLA 1BMQB 3JSRA 4P10A 4F7VA 4DL4A 5J2PA 1FD2A 2VOOA 4EO8A 4OIXA 2EFVA 2ZJPQ 4NLGA 4ZIWA 1XMOF 5C24A 3L9ZA 3IR5B 2MXYA 3MPDA 3LANA 3BBBA 4DBQA 5HQLA 2R8JA 4WK3A 2H48B 2EXUA 5KG1A 2E29A 2V68A 1Q8IA 1U1LA 3POTA 4O4RA 3TOQA 4UY85 2D69A 3HHNB 1G6BA 1RHJB 3BR8A 1QM9A 5DDOC 4NA3A 2ZDPA 1OPIA 4NLDA 4AL6A 2F9DA 4LF2A 4K59A 3HX9A 4EBEA 4KB7A 1P6TA 4GKJJ 4O0IA 4Q45A 2UUWA 3NGKA 1WUUA 2D41A 3NG8A 4RPFA 1S97A 2JHEA 1JLAB 5D4PA 3ZTOA 3K57A 1S4EA 1HQUB 4NLVA 4OZLA 5E3RA 2JC0A 4Z37A 4UZBA 3W60A 3WC2A 4RWWA 3QNWB 1WG4A 3C14B 4JBCA 2XMVA 2ZH2A 3ZZTA 1S1VA 1BQXA 5AXNA 4EI2A 2L41A 3GYGA 3PKMA 3VCDA 5CYMB 2UU9J 2MB0B 3LPYA 1PAUB 3H2UB 2JEIA 4PQUA 1N32F 3DLGA 3TAMA 1FVQA 1S76D 1RT3A 2FZKB 2X1GA 5D4OA 2HQIA 1Q0NA 4OX8A 3V4IB 3PO4A 3D0HE 3HT0A 3L95X 4JI7J 1D0EA 3GJQB 1AROP 4OYWA 1ZYQA 2HYIB 4K7QA 2XNQA 1FJEB 2MSTA 4O3QA 2F4VJ 2MMYA 3W5YA 1N5VA 4MKYA 2J8AA 3RYLA 2KZMA 1RAGB 3M6XA 4ES3A 2AYGA 1D3WA 1FKOA 2F8EX 4DV5F 2IRXA 3EWGA 3UNYA 3IG1B 2CPZA 2M70A 3DLEB 3CNQP 2ZC4A 4ZVGA 3C15B 4P9SA 1BQNA 4NXNF 3ENWA 1HMVA 3UI3A 1HHTP 4QQBA 5HBMB 1X7VA 2DITA 1YX2A 1BD6A 4F0MA 2CQ2A 1RTDB 4C8YA 1RWOB 4ZCLA 2H5JB 2UXDJ 2ZH7A 2CQIA 2H9ZA 2BE7D 4KJIA 5C42B 4B3RJ 4NEYA 2P9CA 3MUVP 1KR4A 4QWEA 3EZUA 4DSFA 3VAGA 5DLFA 1R8HA 1Q81T 1RBAA 4D3HA 1B99A 4RLEA 3GCWP 1YRTA 3NWRA 5E0OA 4U9RA 2C3PA 2ASLA 1VYAA 2V69A 1K0VA 3MEDB 1N5TA 1DJ0A 1HLWA 5I3PA 1HNZF 4P75A 4KC5A 2AP6A 3BGOP 4ED8A 3M32B 4NI2B 1XBWA 1M5PC 1CJUA 3H42A 1G3OA 5K5MA 4K5SA 2M5YA 3RRGA 1FK9B 4PZVA 4B9TA 5BXIA 2I9SA 5F8GA 1RHRB 1HWKA 4CLUA 3N4WA 5DETA 1SB6A 4DF8A 4LF8F 4K4VA 4DR7F 2ZVSA 4Z2XA 5LSLA 1KVIA 5M2RA 1U48A 1V6HA 2HAIA 2ZH6A 2BACA 4NLWA 5BYQA 2HBRB 2VU5A 2CJ9A 3DXBA 4CO3A 2KM8C 2H51B 4B17A 2HQDA 2A0FB 4I7FB 4CTAB 2DBBA 2HNZA 1P8GA 1VJQA 1OIAA 5K9FA 2B5JB 3MM5B 4X4OA 4CYUA 2HHVA 1MWQA 2GHVC 2QA1A 1CVJA 1FEHA 1KD1T 4LF7J 1M5VC 2C2NA 1V9OA 1FD8A 2CJAA 3KWMA 4J9QA 1ZAVA 2PC6A 1X0PA 5J2PB 5AXLA 2XGQA 2YBVA 3DXSX 5C25A 4WFYA 4NMLA 2XYHB 2V94A 5GMKa 1TKZB 5CCLA 3MM8B 4LRDA 2ZH9A 3M8ZA 5THWA 3H98A 4IG0B 3BH7B 4F2RA 5J1PA 2DNQA 5B0CA 1WHWA 2LU2A 3W65A 1VQ9S 1R31A 4MFBA 8RUCA 1QDUB 5F8JA 4RW6A 1OMSA 1K73T 1WC1A 3BDEA 3RB0A 4L76A 2W8LA 2B4OA 2AD9A 1CC7A 3BO4A 4RUHA 1XIQA 1VI7A 2N4CA 4TQRA 4Y2AA 1FNXH 3MMBB 1FI4A 4XDDA 2J8SA 3T19A 4WWSA 1YKWA 1MMDA 3R5JB 3TUPA 1NK5A 1RWKB 2G1HA 2V8PA 3DMJB 1R89A 4X2BA 4FNIA 3QT8A 1CJTA 2N7CA 2HNYB 1TAUA 3TARA 4MK8A 4PYDA 2NXEA 2ASJA 3WZ0A 1DLOA 2GVDB 3A1YG 2OUGA 3E51A 2IBKA 1S4FA 1TKXB 4U6PA 3O8WA 1IR1A 2FGOA 1EZZB 3CB4A 3Q83A 1U45A 1QTMA 4I69A 3DLJA 5D15A 3BKTA 3AOCA 3DLGB 2IY5B 3KHRA 1TL1A 3J81j 1NDPA 1LWEA 5DM6Q 5IOLA 3ZTRA 2OH2A 8AT1B 2KI2A 4FXDA 2B9YA 3ISZA 1M1GA 2P8IA 2W9AA 1JKHA 1SI9A 4YB1P 4NLQA 3UDEA 3DRRB 3TA2A 5ETQA 1SBRA 2EFQA 5AXKA 4CO2A 2DIUA 3TAQA 1X5PA 1IKYB 2R2SA 1PJ6A 1RWNB 3JSBA 1FKOB 4DV1J 1DQ9A 1GT8A 4JI8F 4F4ZA 3L4BC 2IYGA 2OIHA 4QWAA 1BUXA 4ZPWR 2JVOA 2I5JB 1HMVB 2YVSA 1YBAA 2APOA 4JI3F 2HFVA 2RUSA 4R5PA 2RT3A 4LBPA 5KFGA 3EGZA 1H3DA 3KYLA 1RDRA 4KHRA 3UDCA 3KK1A 1R0BG 4PXCA 1TELA 4HHHA 2OMLA 2DJWA 4CDIA 4V19X 1K8AT 4GKKJ 4DLGA 3AOBA 3ADAC 3M2VA 3ZNUA 4ZLLA 3CE8A 3U1MA 5KT4A 1KLMA 2FLPA 2OTLS 5AXMA 5HP1A 3RAQA 3NLCA 4YR3A 2AYBA 3NOGA 2K1RB 2OFHX 2IM1A 3TI0A 4CCHA 3CDAA 4AQYF 4DLEA 3PNIA 4MAKA 2JVRA 2DNNA 1O51A 5GADU 5LXRA 1VBKA 2M2BA 1NZAA 4HDGA 2CYYA 5IWAF 3CMAS 2CPXA 4QIGA 3Q23A 4JOUA 4NLXA 1JB0C 3VVTA 1Q8KA 2EBGA 3BDPA 5IS2A 1S9FA 2K7JA 4X64F 4ZCIA 4N47A 2IAJA 1DQ8A 4ZS6A 4M5DA 2KJWA 4A8MP 1ZOTA 5EWFA 2M7SA 4URGA 6FD1A 4KO0A 1N0VC 5EHHA 3QYYA 3MMCA 2R7RA 4RR5A 4J9NA 3EDQB 4DCOB 4X4UA 2RKIB 2RDDA 1FNMA 4CH7A 2KDOA 1CQMA 2Q3PA 3G96A 2WVFA 2YKQA 1JNRB 3MECB 2B9WA 4QWCA 4XPCA 1VQSA 4BCAA 1F6TA 1RBOB 1WDTA 3PFEA 1U6ZA 2IRYA 3W7BA 4DV2F 1S9GB 3HVTB 2W7AA 7FDRA 3MCOA 4DFPA 2CJYB 1SJQA 4DCJB 1RB0A 3AHPA 2EC0A 3PTWA 1B7FA 1SJ4P 1FRMA 2AJ4A 3RAXA 3A8EA 4X84A 2CPHA 2J0XA 4DR3J 1KRPA 1YIJS 5AJ3F 5EDWA 3SCJE 4JI0J 2W25A 4QYRA 3OHAA 4HTIA 4J9RA 4TYBA 1OY6A 2BABA 4JB8B 2AHOB 4CLYA 4CQ1A 5ETVA 1T95A 4LT6A 3SXLA 1MROB 4CNYA 5BYRA 4WK1A 5FIIA 3NGSA 2R42A 1SV5A 2B4VA 3B78A 3M30A 1IKXA 3UVJA 1JNZB 2MZRA 3MPWA 1Y0HA 2Y8YA 3GB0A 3G86A 2UV8A 2YWWA 3KLFA 5G0RA 4DR2J 4OI4A 1DLOB 2H54B 4JI2J 2HS0A 4X66F 4ECWA 4B9MA 3CJ8A 2IMOA 5CH7B 3BQ0A 4QWBA 4NCAA 3PACA 5T7LB 1HI8A 4AUKA 3G71S 4N41A 3GZ7A 1NDCA 1EP4A 2YH1A 4CT9A 3QZ7A 2XCPA 3J7A1 2YXLA 4ZP8A 3AB4B 2BM1A 5HROB 2CQ0A 3TQ1A 3AJ2A 3GYNA 4QIWD 4WFBQ 2KU7A 1RU1A 4ZVTB 1FTCA 2YKNA 3T5LA 3EGWB 1YG0A 3V81A 4USJC 5K20B 1KQGB 2ZM6F 5EWGA 2ZNZA 4HT5A 2J7WA 2BJ1A 1SPBP 2IA6A 2CJXB 2YNFB 1IQTA 4LF6J 4YFUA 3ICLA 2UP1A 3B4MA 3M2RA 4DQSA 3CJ2A 3T6JA 4DFKA 5KG4A 2OKQA 2ZD1B 3AXKA 4DOZA 2XZTB 4WXWA 4CLLA 1MN9A 4XDCA 2BJ9A 1QJHA 3KUGA 3PYEA 2Y1LB 3PO5A 3NS6A 3EGVA 2OELA 1SQFA 4H4OA 3CWJA 3LP2A 4QW9A 1H73A 2MEWA 4KBIA 4TU9A 1XMOJ 4LIWA 3MR6A 2DTJA 3KJVB 1EETA 4D3GA 1YJWS 1TL5A 3RW7A 1F5CA 3TUJC 5GADI 2VBZA 2RHSB 3H4BA 3R7NB 3MR5A 5E7OB 5J2MA 4ZCMA 1CS4A 2P2CB 2KHDA 5HP1B 4NL5A 1FDBA 2RSQA 3FJ2A 1DURA 2AZ1A 4RW4A 3F41A 3S01A 4UT4A 2YNIA 1TAQA 2WSFC 4YS2A 4BBYA 4FBUA 2HNDB 4TLRA 2Z2LA 4K4UA 2R7QA 2GAGC 2KVQE 3FSXA 3CVKA 4FN5A 1RWMB 4MK9A 4FZVA 4CLPA 4WP9A 4L3KA 1SJ1A 2FZCB 1X5SA 3GIRA 5DQHA 4B08A 4DS5A 1BY9A 3V6DA 4FYDA 2EK6A 2DXDA 1NHKL 4QJVA 3GTYX 2V4JA 1QY7A 4QIVA 5IM0A 2JLGA 4M5DB 5BR8F 2OSQA 3VZIA 3EPGA 1NJZA 1ZM4A 4M5GA 1IR2A 1V3RA 5E41A 4YDDB 5KT5A 2DPIA 3MMCB 4C8LA 2FHJD 4F26A 2LXFA 2W9CA 2CPFA 3R5AA 1BGXT 5FLXU 3RAMA 3TUIC 2B9EA 2GX8A 4AYBD 1U09A 2RJZA 1C1BA 2J6TA 1LW0A 1U2RA 3D66A 4ZVUB 3G6YA 3QLHA 2Z8QA 2RAQA 2HBQB 1LWFA 1LFWA 4IO1A 1RT2A 3KLIA 1T11A 1YSJA 1JLCB 1H7XA 4RZRA 4DV5J 2VH7A 2HFNA 4NLOA 4A48A 2J6SA 1E6VA 3TR5A 3OBIA 4Q44A 4NXNJ 2D9PA 4KH1B 4PWDB 1KTVA 2VF3A 1IM4A 2G1DA 2KN4A 2Z4PA 3BPDA 3ELHA 2BANB 2V8VA 1T0TV 4DDFA 2LQ8A 2IVMA 2E9RX 3H2LA 2Q66A 3WX4A 2WVCA 2JLEA 4Q8FA 4F25A 2KT5A 5KFJA 4QU6A 4IO9Q 3U7JA 1Y9OA 5B0EA 2RQCA 5DS7A 3J81U 3IM9A 3KMSA 3SQOP 2KL8A 3M8PB 1S7HA 1R6VA 3M30B 3UVJB 1TL3A 4ZLJA 1ZM9A 3N01A 3OJSA 3PKYA 3KLFB 1HNZJ 3P6YC 4K8RA 2XS5A 2HHWA 3TVKA 4Y00A 3QSIA 4NEZA 1AUDA 4CNZA 3ZO7A 1RU2A 2G0IA 2FC8A 4ELUA 1EKSA 1EP4B 3CMQA 2B56A 2P6TA 2D3UA 4LF8J 4DR7J 5GAEU 5HMZA 1N5YA 3MTKA 1MNEA 2JNJA 1P1TA 2QMWA 3LPEA 5ADZA 1UJ5A 5LJ5Y 3MPVA 4ZVQB 4RO0A 3M9NB 1T9XA 2FC9A 1FFWB 3UR3C 4ZN3A 1RBLA 1D9DA 2NZCA 4OI1A 5H9EJ 3WX8A 3PW5A 3HHKA 3JTNA 2VKRA 2OI2A 2XG8A 4CLTA 4RW7B 2K2PA 3C46A 1BQMA 4HVZA 1GK8A 2AIRB 3W64A 1WSVA 3GE9A 2YY3A 1S1TB 1NK0A 4LSZB 5L1IA 1XR5A 4U7UD 1AZSB 3AQPA 2DT9A 4KYZA 2GS8A 1VGYA 3QQCD 5A8KA 3W3SA 2HWIA 4WTOB 3NCRA 2BE2A 4Y3CA 2XY5A 2VKZG 3HF5A 2L48A 1RCOB 1LWXA 2V2ZA 1FKPB 1IKVB 3L7PA 1EETB 4M5KA 4DMZA 5FJ4A 3FMBA 4OYBA 1PKUA 3MM6A 4OI2A 2ROPA 2HVEA 2CADA 4OJHA 5J2MB 2PMZD 4Y34A 1N8RT 4GVLA 5IV3A 4DN0A 5KOWA 1GNKA 4DPWA 1C2PA 2AV5A 2ZKTA 3CJSA 3MEKA 4MIBA 3SV3A 2QLBB 5A8WA 1KVJA 3OUYA 2OPQB 2JZ5A 1YJNS 3MOJB 2E7VA 1PC5A 2RQKA 3RB3A 3SMZA 5B08A 1UVIA 4IG3B 2V9KA 1VQNS 5KFRA 3UR0A 1WC4A 4LSLB 5FD1A 4CLFA 1U7LA 2WRMA 3S6EA 2CAJA 2G4BA 2XI2A 2XZWA 3PX0A 2QN6B 5SZTA 5B09A 2ZUAA 2MKSA 3T3FA 3W9JA 2UVRA 1SKUB 4USWA 2GO8A 4C2MA 2ERRA 4C98A 2F8MA 1KWMA 4DI6A 2XMUA 3HKWA 3KUHA 4ECSA 3LW5C 2V8HA 2XY7A 2PEHA 4PXBA 3OL7A 1OO0B 2QSWA 5IQ6A 4CWBA 1U49A 1X4HA 1RYSA 3MCNA 2OEMA 3IRXA 5KFMA 2IVFB 3EMTA 1CSJA 3A3NB 2N7YA 1GTHA 2MZJA 3VR1A 2OEJA 3MAAA 2ZBQA 3J80U 1RHQB 1FXLA 3R6GB 3VZHA 4PKDB 3C2PA 2QLJB 1RT2B 3M8SA 5LMUF 4PRFA 3ONQA 3UO0A 3NNHA 4JI8J 1IWGA 2ROEA 4C9DA 1E6VB 2VQFF 1KDNA 3HXMA 2RILA 2DNOA 1YJRA 4WBFA 2XSJA 4JI3J 2J7UA 3ZZYA 2MLZA 1TQLA 5HJYA 1HYSA 1Q82T 3MM7A 3UPFA 4KFBB 5C2CA 4P2MA 1G4CA 2QRRA 1SCJB 4P74A 2CQHA 1SC4B 1EX8A 5ETNA 1KS2A 3BBCA 1K47A 3WQPA 2FLNA 5I42A 3SYZA 2ZE2B 2W24A 4A8XA 2VA3A 4JP8A 3FBEA 2NUHA 2GQQA 4A8WA 2F4FA 1UWBA 2HEKA 3DHWC 4KRWA 3A12A 3AD8C 4O44B 1LW2A 4ED7A 5KFVA 4XIUA 4WFZA 1WD6A 3KHGA 4LF9F 3CJ0A 4K2XA 2VOPA 4AQYJ 3LH2S 4PXDA 4J9VA 1TP7A 2XHCA 3DI6B 3EYZA 5KTQA 1PO6A 4F4AA 2OLWA 4P7VA 2CQDA 3H20A 3MPYA 1O8BA 2GJIA 2XMJA 2F65A 3GSDA 5IWAJ 3EGNA 4ANEA 5HMXA 2OGUA 2CDRB 4Y0FA 2FYXA 2D3O1 4P7TA 3AQOA 3N5FA 2CZ4A 3JB9k 1RWUA 4OZ3A 3MUTP 1WF1A 2CJBA 3DLKB 2JOQA 3MOZA 4X64J 4USUA 3JAMU 3Q8PB 1DTQA 1CJKA 4YHHF 2HMIA 2J76E 4URSA 4OL8A 4RNFA 4NCBA 1VQ6S 2F1FA 2HHXA 1FJGF 1KP6A 2CZVC 4XO0A 2CNOB 1L3UA 5KFQA 2QGFB 4ZHRA 3D3CJ 1IUJA 5LSOA 1TUVA 1EIYB 3UD5A 5KFNA 2YPZA 2JEFA 4I6WA 3GLJA 2VZ9A 2PEBA 3EUNA 2MQMA 2AWZA 3BREA 4I6AA 2DGQA 1X0FA 2IHR1 2LEBA 2OO4A 1GXUA 3IGNA 1R0AA 3FGVA 4DV2J 3OL8A 3ENVA 2BE2B 2VV5A 3LP1A 4C11B 3R1LA 1CJVA 2ATLA 4EK2A 1B0TA 3H7HB 3BQ1A 5EGYA 1Y4ZB 3DOLA 3MM6B 3KK2B 3I0RA 4G3IA 4HDHA 5AJ3J 1RLCL 2FHOB 4CI0B 4DV0F 3OTCA 5A8RA 2AYMA 1V3ZA 3WIUA 3D28A 2CQ1A 3OLAA 4RNNA 5F8NA 3GIIA 1TVRA 2KG0A 4OMFG 4YR2A 3GG0A 1N36F 5A8WB 1TKTB 1PAEX 3GSIA 2NUUG 5JUMA 4RNOA 3KG0A 1NH8A 1XK8A 2VD3A 4UW2A 3O5TB 4F4XA 4ITSA 3EVWA 3SCIE 2QSFA 1JLBA 1B0PA 3H59A 4X66J 2LQ5A 1Q53A 3OFGA 5DJBA 3PDNA 4ID5A 1K1SA 2YNGB 3JQKA 5ITHA 4DV4F 5I3UA 4MJKA 5ETSA 4UF4A 5CHCB 2MQLA 4X4SA 3H5XA 1RK8A 1KLNA 1DTTA 1WC0A 2XWXA 5D0GA 4RUCA 4DSEA 2DH9A 4C0OC 5A0YB 2Y0SD 2BQUA 3TUZC 4ZVSB 3TANA 3MHYA 2DHAA 2DXFA 2WK4A 2ZM6J 2KXFA 3U27A 1K44A 2DNMA 3MAAB 3NWGA 4IRDA 2KXNB 2JSXA 3ILIA 3W2VA 1N6QA 4DFJA 2WHOA 3HHLB 2MZQA 1FRKA 3SQGB 2VHGA 4DQRA 5IC6B 3PW7A 3D4JA 2RF2B 1LK5A 1P9QC 2FGCA 2D3ZA 3SSRA 2CPIA 2XSJB 1QD1A 4KH0B 3O3LA 3MM7B 1YGYA 4YB5A 4P2FA 3RZAA 2Y1RI 3HI9A 1Q4RA 1OY8A 3GMGA 3IWNC 2E1MC 1GXLA 3DN9A 1PC4A 4DX8H 4F02A 5J1NA 2RVJA 2UXCF 1DRZA 1YBTA 3NGTA 4HR2A 1NJIT 1N52B 4FP9A 3DFEA 4F4KA 3QFHA 1S5ZA 4OI6A 4ICLA 1JQGA 5L1JA 2XBPA 4FBTA 4DPOA 1G1XA 2FJXA 4YP3A 1RI7A 3DC2A 2QMXA 2JH3A 4FNHA 4BHQA 2WOMA 4OYIA 4LVOP 4F36A 1PGZA 4QR2A 4DZ6A 4IOCQ 2Z56B 3DRYA 3KNGA 3K0JA 5IV4A 5BR8J 4I6YA 4EFAC 2HWTA 3S7RA 1YJVA 3F0NA 3ULHA 2OD4A 2HMIB 1RT1B 1C1CA 3CJRA 4P71A 2J9EA 4H54A 1X31C 3M05A 4YN3B 2FY1A 4ZJOA 3T5HA 3BZQA 5DDRC 1O0PA 2GHWA 2Z58B 1RSCA 2HHSA 3CD6S 1ZTWA 1NK7A 1VBXA 4TKTA 3KLHA 2FVRA 3OR1A 2G0JA 4HI1A 4RBUA 4NPOA 4ES2A 3M6WA 3I9ZA 1R0AB 2Q79A 1RAHB 3OTEA 3GIMA 5HVHA 4NCGA 4P72A 1N4LA 3DOLB 1UMJA 4JI4F 3E01A 3I0RB 4IFVA 4HH1A 1VOMA 1YRXA 1BHNA 4E98A 2O1PA 2N3OA 4PUOB 4OI3A 1S49A 5KT6A 2RNEA 3CD0A 2WVDA 3TEHB 1VJWA 4B3SF 4K4XA 3JTOA 2CQ4A 4Q2MA 3IM8A 4OQJA 3PG9A 3WDOA 1FE4A 4NYOA 5KG3A 4DF4A 4OYAA 4QPXA 3CCRS 1QSLA 1D1UA 1JLBB 1U4BA 3BO2A 1U25A 4ZK7M 3NGDA 4X4RA 1HI0P 4DL6A 3MWBA 2HFOA 2HK2A 4RWXA 1HBOA 1KQSR 1TK5A 1QAJA 4V19J 1FDAA 2C3OA 1AT1B 1HIYA 4LRAA 2BUNA 1FERA 4RU2A 2VODA 3IBFB 4PG4A 1BLUA 2OPSA 1VRTB 4UUWA 1RAFB 3W8PA 3HVAA 1DTTB 1RTHB 2H3EB 4YDXA 1YJUA 2GV1A 2HHTA 3EVOA 3JSMA 3KG4A 3I5AA 3JS9A 5EN1A 1RWWB 1S0VA 3K5LA 5DZ7A 2ZBIA 3KJQB 2VDIA 3UNGC 4F67A 1CQNA 3W66A 3J7YU 3MEGA 2MLXA 4K4ZA 1APSA 2YKMA 3IN5A 4IR9A 2F3JA 4MYUA 1ZZNA 8ATCB 1J27A 2CA9A 3HHDA 1TK0A 3RU0A 1SQEA 2C3MA 3ET6A 3D68A 2HRUA 5GAHI 2K3IA 1WI6A 4PPZA 2BYCA 4M5NA 4V1Ak 2IMWP 2AGPA 2HURA 3M2UB 4Y2IA 3FKBA 3L3CA 2Y3YA 2G2OA 2NPFA 4MKAA 2ZZNA 3TJ9A 3TZWA 2RS8A 2NXJA 1I94J 5L1LA 5L8RC 3WHIA 1VRQC 3EPIA 3W63A 2FLOA 4FYYB 1HW9A 2PIIA 4USIA 3SFUA 2PDAA 4E2FB 5DG7A 4I0WA 2UVWA 2EFPA 2EKNA 1SL1A 2CUYA 2VQEF 4QU7A 4I67A 1KOHA 3E8OA 1WOSA 4OYXA 2N82B 3Q2TC 1WG5A 2MQQA 2HKEA 5GMEA 2MHNA 2H1YA 1TFWA 2V8DA 4YB7A 1PG5B 1X9SA 1JLAA 1DFDA 1HQUA 3AJ1A 2BJ3A 3O1LA 5DQIA 4ALZA 3BS9A 4KKOA 1BWEA 3HHLD 3TQEA 2BQRA 1Z2LA 3G6XA 1PIEA 4ILMA 2DNYA 4QWDA 2OPPB 4UOFA 5D0HA 3IWXA 3H5UA 5DO2A 1F3VA 4M5JA 1C1CB 4KSEB 1HHSA 4MKBA 3LTOA 3Q8VA 3P5BP 2VBWA 1XMQF 3W61A 4UQGA 3X3UA 3MUMP 2ZH8A 1JXLA 2DR8A 3GR1A 3V4IA 4FS2A 4ZVPB 1XR6A 3NKYA 1M1KT 5D78A 1IM6A 1X4DA 2VPZB 1S10A 2FJDB 2AU0A 4KIAA 1F2HA 1QUVA 4F50A 3GU0A 4K4YA 5LMUJ 3BH6B 4JI1F 1J5EF 1KVKA 1WEZA 1AXQA 1OSDA 1LK7A 4B02A 4J37A 2CNLB 3D0IE 4ED3A 3ISND 2VQFJ 1UCNA 2P5VA 4O3PA 3DLEA 3VVUA 3C15A 1IQZA 2D1CA 2GIFA 2CIMA 1KONA 2V8GA 2OAUA 4IDKA 5HBMA 3LWMA 1OQ3A 1X9WA 1UJ4A 4ZKAA 2A6OA 4N56A 1HL6A 2HFZA 3GFYA 4ED6A 2Z0GA 1VFJA 2DNLA 3US5A 2BJ8A 1RT6B 2KZZA 4OYPA 5C42A 1C0TB 2A18A 2BRLA 1C0UB 1ICEB 2QL9B 2RE1A 3NBPA 5HMWA 3HZGA 4ECQA 1SH0A 1T9TA 1SL0A 4KQZA 2V0NA 3V2UC 2ILYA 4LF9J 1YBUA 1Y3JA 4HI2A 5E2QA 1NKEA 3MEDA 3FBBA 4BC9A 4N8NA 4NI2A 2RB7A 4DSKA 3G6VA 1VQ5S 3QIPA 3BF4A 1FK9A 1HNIB 5CQGA 4RBVA 1NO8A 2OFGX 3R7SB 3HPOA 2AMCB 1Z2ZA 2LFVA 1YJ7A 2GMHA 2VJVA 5CAAA 4LFCJ 1UEUA 3H0PA 3IGVA 3UCGA 3CULA 1M5KC 4I2QA 1LWCA 3J7YI 3MURP 1XC9A 3G9CA 2X1BA 4EZ9A 3JSMB 5IT0A 1J2VA 4EWTA 4UOCA 2DVIA 4YHHJ 2OP5A 2AEFA 2OHDA 1S6OA 1YLXA 2VPWB 3DM2B 2DO4A 4CTAA 1FJGJ 2FZGB 4OHWA 1RA7A 4BC7A 4OHZA 3MEGB 2Q43A 5CXTA 3EJMA 2B5JA 3HSZA 1DQAA 4K5RA 5GVQA 1N56A 2LDIA 3QGPA 3ET6B 3I5BA 5KAKA 3HFKA 4N77A 4WIIA 2JL9A 2WONB 4DR4F 3TJ8A 4IOAQ 4LSNB 2CPJA 1DHMA 4K0KF 1SUQB 2DNKA 1EJ7L 3BN4A 4F3OA 1JJ4A 2BJDA 1TKZA 3MM8A 3LGMA 4OX9F 4K4WA 1JLGB 5KFBA 3UN2A 4IG0A 3R9LA 2HHHF 4HT7A 5CZXA 4DV0J 5ETOA 3FMWA 1RHMB 5KFOA 1I6JA 1VISA 1VQYA 4N5SA 4RUAA 3DNCA 3UW1A 1KEKA 1N36J 5D0RA 1P1LA 1PSDA 2A6MA 2CPDA 2CQ3A 2CVEA 3CCWA 3NMRA 3D54A 4ANDA 2X7IA 2GVZB 3TA1A 3MMBA 4DJBA 3HKZD 4RUBA 1T03B 4J9PA 1Q8BA 3OTBA 2V50A 4CO4A 4L6V3 3OPKA 1FWLA 2L08A 3DMJA 2YNHB 5A6WA 1IWAA 5BYSA 4FKYA 5IZHA 2HNYA 3MEEB 5J1EB 4KKOB 4KGZB 4PWWA 4NASA 2GVDA 4WXOA 2GNKA 4CO1A 3OVSA 4DV4J 3WIVA 3NCPA 5L1KA 1TKXA 1OPZA 2BW2A 4TXSA 4WYLA 4Q43A 4FS1A 2BW7A 1LNQA 1QLNA 2IM2A 1MSWD 3G82B 1UPMB 4WCEQ 1S99A 5DQGA 4FVCA 4JV2A 1S6QB 1UTAA 2V34A 5B0DA 2HVIA 3GJRB 2Q1LA 3N6NA 4ZP9A 2WVBA 1S0MA 3EICA 3OR2A 4DL3A 3D67A 4ID8A 2KRRA 3DRRA 3NGRA 2L9NA 4ZPTR 2HBYB 1H2TZ 2DK2A 3HSDA 5LJ3Y 2DR6A 4RX6A 4ED0A 3PW0A 3UN5A 2AT1B 1IKYA 5HQMA 2KT3A 3MR7A 4QCLA 2MLYA 2CQCA 4HL9A 2PT0A 2W2PP 1Q5YA 1S59A 2L9WA 1Z4UA 5C7PA 9RUBA 1OYDA 3ITHB 2BXJA 1G2EA 4E8UA 4EGLA 4DR1F 2Z2YB 3MCSA 2GZOA 1H38A 2FHJA 2I5JA 1Y11A 2NZ4A 4P2XA 4IDKB 4QZVB 5IQQA 1H98A 2K06A 1Y5NB 4GO7X 4NZ0A 2GC8A 4TNOA 3U02A 5F3ZA 2J0SD 4MT1A 3GQCA 2QIFA 2GGPA 2KRBA 2KXHA 2GFFA 2CNKB 1XTZA 4DCPB 2NQPA 1N5SA 3NBPB 3PHEA 2UXCJ 2B6AB 4M8LA 1F9EB 3TJAA 2XMWA 3PEJA 3PY8A 3LO3A 3G87A 4EBDA 1DZ5A 3G8SA 2VUGA 2QT7A 2K1RA 4JYAF 2EK1A 2GO9A 1R8BA 3CJQA 2JRSA 3P5TL 5MAOA 1D09B 3TP2A 5DG8A 1R8PA 4YY3F 2QA4S 4RJVA 1RADB 2XCAA 3QIPB 3QRQA 4GVBA 4OV6A 4USTA 1XN9A 2MYFA 4CM2A 1ZH5A 2W2QP 4GC7A 3FRZA 1X8DA 5CYQB 2KFNA 4I2QB 5LMNF 1LWCB 5JVHQ 3A8KA 3IBCB 1HPZA 2F63A 3DGPB 1SJRA 5EUHA 3VQTA 3MMAA 3NNAA 1S1XB 1Q7YT 5DM7Q 2VBXA 1S0OA 2VDHA 3TX8A 4IFYB 4TLQA 3RBEA 1NSQA 1UVJA 3W2WB 3A3PB 3OFEA 2PMWA 1X4CA 2DR5A 1RTIB 2XWYA 4CO0A 4A8KA 4ZOSA 1O5JA 4B3MF 2YKOA 1P27B 3QJLA 1VK8A 2DD8S 3OLBA 1Q86T 3FUYA 4J91A 4MKVA 3S1TA 2FJVA 1X4FA 2RKIA 3N6LA 3RGIA 2XMTA 5IT9Y 2WSEC 3VALA 3HHLC 3BQ2A 3ENAA 3MECA 3C6TB 2DGVA 2DNGA 3T5JA 2XQCA 2ZUGA 2ZJQQ 2PI4A 1FDDA 3N79A 2GW8A 3PHTA 1S9GA 2XTJP 3HVTA 2E9ZA 2YQ1A 4HYKA 3MF5A 4JI4J 2U1AA 4Q5VA 1T02A 3KHHA 2AJFE 5LXYA 1ZA1B 4LQ3A 3EXCX 4DSLA 4NA2A 4ECTA 2HFSA 2XC9A 1HNWF 2ASYA 5LL6d 3THPA 2QLWA 4G6VB 3CIZA 1X4AA 5E33A 1I5OB 1TUWA 4EUVA 2EFGA 3K89A 4B3SJ 4F4YA 3DRPB 2E1CA 3JQMA 2KFYA 1IVZA 2VFTA 3KLEB 3MPUB 3ISNC 2XEXA 1MROA 3HFZB 4DX6A 3D6TB 1X4BA 2UUCF 3W5ZA 1M5OC 4CP5A 2QFJA 4PCQA 2B9XA 3UDLA 1CC8A 2F9JA 4R8UB 4UY8T 3JSYA 3TZZA 1FRJA 4FF4A 4LFAF 2MJUA 1ZBTA 3CO0P 2QYGA 3C8YA 1M0SA 3H5SA 1H74A 1HQEA 3OL6A 5T7LA 5K14B 1S6UA 4ECYA 2R7SA 4O3OA 1K0TA 1NM2A 3LP0A 2KHCA 4O4GB 4C7QA 5HROA 3PJ9A 2HQFA 3ZTQA 3V4MA 1GX5A 2XGPA 3DDKA 5KFKA 2W4DA 3C16A 1RQ0A 2MKCA 1Y00A 4UQTA 3LWLA 2XYGB 3OR2B 1OJ4A 3BO3A 4F3QA 3T5KA 3AJDA 3GILA 3D1OA 1RTJA 2YNFA 4OX6A 4TY8A 4I1TA 4WF9Q 4PAAA 3HDSA 2VJUA 1XQIA 4LR7A 1U8SA 2ZD1A 1YRUA 2R7VA 3OTOF 3K58A 4RW8A 5DRKA 2Y1JA 1XR7A 1NLKL 3KXDA 2JC1A 1BC6A 1H72C 2AF6A 1FCAA 3JYTA 1U1PA 5KFTA 4QPTA 1X60A 1OSCA 5J2QA 2ZJRQ 1Q8LA 2QC3A 4NLRA 3CJKB 1REVA 3PFOA 1NDKA 4O3NA 4M63A 2COLA 2GGPB 3KJVA 3QGGA 2PA8D 3LF0A 4QIEA 3RBXA 1NKBA 3PV8A 1WKKA 5KFCA 3PVXA 2R2TA 3AD9C 1RKJA 3AFGA 4MH8A 2F7VA 2VQEJ 1RT5A 2DYAA 2CWKA 4DPUA 3KOAA 4QYZK 4ELTA 1M1HA 3EZ5A 2HNDA 4RKUC 1HWIA 3D7SB 2BMBA 2IYIA 5ETLA 5HATA 4GVBB 3VGUA 4EBCA 1URRA 4DV7F 3NP5A 2XM3A 1MN7A 1E6YB 3DDIA 4CO5A 4ZDNA 4HLBA 1VC5A 2ZWPA 1SKWA 3IS9B 4NZ6A 4LBHA 1HPZB 2W4CA 5IT4A 1FWKA 3IR6B 3MMAB 3HVRA 3O6QA 3QSYB 1IN0A 1U1MA 1WELA 4DR6F 3RR7A 1XMQJ 1VBYA 5HJXA 1ZM2A 4Q0BB 1SC1B 1PJ7A 1SIWB 3T6BA 1R6YA 4DV6F 3QIDA 3KK3A 4S0MA 3LALA 2ZFHA 1N88A 2E5LF 4W90B 2ADCA 3PIPQ 1VC6A 1NMEB 1J5OB 3IBWA 3D1QA 4EZ6A 2AX1A 1H7WA 3OD2A 4IH6A 1IBKF 4RNHA 3KUEA 4JI1J 2ZKUA 1J5EJ 2VFVA 5HANA 4I68A 2DNRA 3EDRB 3UCZP 1KQKA 1FX2A 2O66A 2FVSA 1UVMA 1JLCA 1JMTA 1S1WB 2FDNA 4ZJQA 1XWLA 3KDOA 1KHWA 1HBNB 4Z7YA 3H8YA 2N4DA 4KGKA 4LUBA 3HD2A 3AOAA 1X9MA 2G9OA 1F5BA 4PWDA 1WC5A 2LEPA 2VG7A 1MMLA 3IFEA 3BGUA 1P9YA 4ER8A 5C5JA 2CPYA 1RT4B 2E9TA 3CPWR 2VG6B 2BANA 2BQ3A 3GCXP 1PCAA 4NLPA 5C2GA 5EWEA 4DL0C 2GIQA 3MTJA 4ERDA 1W2IA 2ZOFA 1HNXF 1RTZA 1TZ0A 2XNRA 1Q5VA 2MZ1A 2ZBCA 2WZ1A 3EZOA 3M8PA 1TMMA 1NJWA 2GQCA 2HZVA 5KFWA 2DGTA 2FHKA 3SSQA 3ZZRA 1RAOA 3PW2A 3SDEB 1QE1B 4WFNQ 3ZNJ1 3CSKA 4ZPBA 2DHXA 1UETA 3V6HA 4DV3F 1HQEB 4KT0C 1NSAA 4J9SA 2R3VA 1RT7A 3I56S 1MMNA 2O5DA 2ZC3A 2GCFA 4NYPA 3PIOQ 2V4RA 3NY0A 2EBEA 2DKOB 3LP0B 1QVGR 3JTPA 2UVVA 2G13A 2DIVA 1R43A 2CQBA 2BOPA 1U1NA 1HQ2A 2UV8G 3C16B 4B9LA 3QRRA 2X3GA 4NZ7A 2KTQA 3ILLA 1JJHA 5KT3A 2VIHA 3QPIA 1NH7A 5FDLB 3ZZZA 1RAAB 5ETMA 3CUNA 5KG6A 1W7WA 2HRYA 1RTJB 3DOMB 1F0XA 4G1QB 4TY8B 4KV8B 1EQ0A 2DGOA 2IBOA 4FVMA 2C3UA 4WFAQ 2WB1D 4RW7A 4IQXA 3K7RA 2YWFA 2MPUA 4WU2A 4AL5A 5LOQA 4RW8B 4DR4J 2HIYA 2R7XA 4IUFA 1S1TA 2IJFA 2BBEA 1SH2A 1AZSA 3JYTB 4LMZA 1T05A 2VC0A 2AKWB 4K0KJ 1WACA 2ATCB 2QG9B 1DY3A 2JFDA 5J2QB 7FD1A 2CDQA 3TVYA 2NREA 1REVB 3MM9B 4AD6A 4OX9J 1FKPA 3T9NA 2ALYB 1IKVA 3PCOB 4J90A 1A9NB 2C3YA 2RD5C 2HHHJ 1WEXA 5DZ6A 5CYJA 4IYQA 4X65F 1S72S 1B64A 5I3QA 4UOGA 2W9BA 3M6UA 5HLFB 1RISA 5KG7A 4A8SA 4DN9A 3Q0AA 3H40A 3FNNA 1YQHA 2H5IB 1GMWD 1RT5B 3CC2S 2QFIA 2PA3A 2EVZA 3DRSB 2WCXA 2VONA 5D4LA 2UXBF 5KG0A 4J9MA 2OPQA 2LCWA 2HVDA 5J2NA 4JI5F 4IG3A 2LU1A 3PRVA 4TU8A 1B3TA 4LSLA 1GXTA 2WSCC 5DDQC 2UUBF 2AEJA 2RDJA 1VS3A 4X4QA 3VAHA 2G0CA 2JFKA 5K8OA 3CCUS 2FJBB 4NLUA 5JXSA 3OL9A 1DAXA 5IT9U 2DY9A 1U0SA 2EPIA 4O23A 1UZHA 2M8HA 2IA0A 4LVNP 1ZA2B 3UWTA 5KT7A 1T7PA 2HZAA 3VAMA 4USKA 3KK3B 5G4DA 2VPXB 2D3OR 2I8EA 1JLQB 4F3MA 3K17A 2I1RA 4FF1A 2AJQA 1RABB 4C3KA 1CBKA 5B0FA 3BSOA 4FYWB 3Q2SC 2DXEA 1HBUB 3VAIA 1VQ8S 1GEHA 4I2PB 4CRJA 3CGIA 2WW4A 2HHQA 2IPOB 4TN2A 4ZA1A 3OFFA 5KFFA 1O6XA 5BJRA 4CH0S 4LR8A 3KLGB 1NKCA 2CG4A 4DR1J 3DKDA 2AEMA 2VG7B 1ELOA 4EO6A 4Q7AA 3VAJA 1D8ZA 1WHYA 2CFXA 3ZTSA 4KFBA 1VC0A 4B9SA 4WFXA 3CCES 4OLPA 5B0AA 1HWJA 1ZETA 5DGAA 2VG5B 2J0QD 1R8CA 4OFZA 2ZE2A 2M52A 2BEFA 3T1YF 3HSGA 3R8YA 2IIHA 5KFLA 4O44A 1FDNA 1VHFA 4GO5X 4Z7CA 4X4VA 1H2UX 3L7UA 2KFZA 4ZN1A 3TZXA 4O3RA 3K8WA 2EG2A 2BA9A 1AA1B 4JYAJ 3UFCX 1HHQA 2ZBPA 1WG1A 4YY3J 2QLFB 3BGFA 4OX7A 1JXEA 4DPTA 3DI6A 5CA5A 2AJ1A 3VAFA 3ZFVA 1TV6B 3FCVA 1S57A 2KO1A 3B54A 1RT7B 1CULA 2K8GA 2M0GB 2P9EA 1VLYA 2A2CA 2I6WA 4KPYA 3SIPB 3MZIA 1Y5LB 2LQBA 3QWUA 5LMNJ 1HD1A 4XK8C 2AJ0A 4EYHB 1WOOA 3QO9B 1LOUA 1IKWB 2Z2MA 1RXOB 1WEYA 3EM1A 3Q8UA 3DLKA 1MWYA 4PG5A 1VQLS 2A2DA 4ECXA 3FEYB 3LGHA 4HACB 4C97A 4R0JA 1NU4A 4OHXA 1TK8A 4DS4A 1SH3A 3HK2A 2QE5A 3FCWA 4ZVEA 3TYTA 4DL2A 1S6PA 1VLOA 3QWPA 4OLOA 1RWPB 4DL5A 2MKYA 2W2MP 3IAM9 2ZH4A 2O3DA 5H1SV 1KFSA 4B3MJ 1NHUA 1N5QA 3DHXA 2CVIA 3CD5A 2G2ZA 1VHIA 3N6MA 4OYZA 4FYXB 1OS5A 5D8HB 4LF5J 1LFPA 1M5HA 3GJSB 3BSCA 4NLTA 2LKZA 1NNDA 3KTQA 3A3OB 1T05B 2H4YB 3BSNA 5JJBA 4J9OA 2LA6A 3GV7B 4H4MB 5AT1B 1WKJA 2EFOA 4NRUA 3VV2B 1X5TA 4M5MA 4DEZA 4C11A 4B9UA 3BEGB 2WB4A 1KKHA 1EB0A 4DUYF 4DSIA 4NYZA 3DLBA 4U7CA 2ZVIA 4MYTA 4NOHA 3THVA 2RRBA 4ANCA 1I94F 2W9BB 3KK2A 1N34F 1MU2B 4U8VA 1HNWJ 1RUSA 1U1RA 2YPYA 2M88A 5F9NA 2LECA 3IA0A 3AY0A 1C4CA 1NUEA 4X4TA 3D9BA 4DQQA 3R7BB 3N9UC 3BYRA 4OYOA 4X4PA 1TKTA 3DOKB 5GMDA 1T3NA 2MY7A 2UUCJ 2MTLA 3P96A 4A8QA 5J2NB 1FFSB 2NPIA 5KFXA 4ETZA 2BM0A 2FJAB 1RA6A 3HZEA 1EAYC 5KFAA 2YWKA 4LFAJ 3DLLQ 2WW8A 3K5OA 5F8HA 2CJQA 4TQSA 4BWMA 3MI7X 1AYEA 4RL1A 4DSJA 2W1BA 1RAJA 2V6AA 4RNMA 2WBRA 3W8GA 3F44A 3BR9A 2ACYA 5FLXY 1X4EA 4ZJLA 3BN7A 3ENQA 3N28A 4OZNA 1FRXA 2OEKA 4ZPAA 2YNGA 1SKSA 5C24B 4U7UK 2DCLA 2B51A 1UA0A 2BOAA 4DPYA 4ED1A 1WC3A 3POTB 1TFYA 5LM7E 1Q78A 4O3SA 4WYWA 5JVGQ 2VC1A 3CCTA 5A0YA 5M2PA 4X62F 2R2RA 3R5DA 5CD4H 4OV1A 3KKFA 1JLEA 1R27B 2ABYA 1IBLF 5CZVA 4KY3A 2QYCA 4H4KA 4DR5F 3OFHA 3B8HA 3M4XA 2O01C 3HHLA 1PYOB 1R0CB 4WP3A 3SQGA 1QSYA 1XJWB 2JWNA 1YWXA 2QA2A 3OTOJ 2RF2A 3BBFA 3PJWA 2UVUA 1WTFA 2XI3A 2AX0A 2E1PA 2POKA 1S1VB 1GX6A 2XHWA 4L3NA 2DRBA 1Y3KA 4DUZF 3J81Y 2R8HA 3E2EA 1RWXB 2KB2A 3M6VA 1KC8T 3RTVA 3I5CA 1B0VA 4PQUB 3HM9A 1M5SA 3TAMB 2HFUA 3PYDA 1RT3B 3HSJA 2CJKA 4BDPA 2ACMA 2V2KA 4P73A 2NLWA 2ZDOA 3M9OB 2C28A 1WWHA 1WSRA 1WC6A 4G1IA 1R3NA 4ECRA 1GFWB 4QR0A 2XB2D 4E0DA 3X1LB 1L3TA 1RAIB 2EI5A 2CPEA 5GAEI 3VGTA 1XMBA 2MZSA 4NLYA 1T9WA 2DRDA 1U1QA 4DV7J 2QZ8A 1CULB 4LQ9A 4X4NA 2PMHA 1B4SA 2BRKA 3OXGA 3VAKA 1BQNB 1GMUA 3BSAA 4R0EA 2U2FA 2VFSA 4LFCF 5E3AA 1JLFA 1WI8A 4FXWA 3IP0A 4YMEA 3BB5A 2R7OA 4DR6J 1F60B 5ETKA 4DU8A 2W4PA 3DCAA 1S6PB 1SVDA 3NAHA 1RT1A 3K2YA 4DV6J 1CG2A 2ZHAA 4LRCA 1WJ9A 2F5GA 4ZVHA 4C4WA 2E5LJ 1KHVA 3ZC4A 4EMDA 3OT9A 2AYEA 3TNVA 4AE5A 4PG8A 5MLCV 3UDVA 2VBYA 1ULRA 2K3KA 3FFIA 1IBKJ 1SC6A 3DRXA 4OJ3A 4ZIVA 3AODA 1S0NA 4G1PA 3W1YC 1Y7PA 1NPKA 2AW0A 1CJUB 1VIXA 5GAGU 4LRBA 1UVNA 4ELVA 5K8NA 4KGMA 2DEIA 3M8RA 2QJ3A 1OY9A 1NEEA 4HKQA 1AUSL 4Y2CA 3HT3A 2BE9B 4ZPCA 4OJ1A 1JWWA 5U47A 3DDNA 4MIAA 1HARA 2OMOA 5IXUA 4KHPF 1RHKB 2AZ3A 1GMVA 4PUOA 5E5NA 4TYAA 2HNZB 1NSPA 1H6KX 1L5UA 3RBDA 1FF2A 3CEDA 2E66A 4M5LA 1HNXJ 4TU7A 4CYUB 3MFHA 2E7WA 3SCLE 2CKWA 1U2CA 4DFMA 1YHQS 3FCHA 2K7KA 4PABA 1RAEB 1IBMF 3SFGA 4ECZA 4OHVA 3VGVA 4ED5A 3H5YA 3G6ES 1FXDA 2Y0BB 2HQCA 4DV3J 4PXEA 4QIFA 5C25B 2B0GA 1A0OB 1NHVA 2M3DA 4FDFA 1KQFB 2DEJA 3FSIA 4ILRA 4OJGA 3I4HX 3LGNA 2HBZB 3ZZPA 3GYXB 3J80Y 1I3OB 1VRTA 3FZBA 1SQGA 5L38A 3MR3A 4MFBB 1RTHA 1UKUA 1QUPA 4ZPDA 1UJ6A 4RW6B 4I4BA 1JLEB 2KT2A 4YR0A 3RB6A 2VPYB 5DGBA 1UVKA 3D6MB 3GWCA 3GFXA 1K1QA 3GPAA 2A10A 2PGCA 1HWLA 3F56A 3D5MA 1CJTB 4M1KA 2B4PA 1W26A 1X4GA 1KNZA 1NZ8A 2DH8A 2R7WA 3G8TA 5KFUA 3P4UB 4C0HA 2R7UA 4B3OA 3M2UA 3SZ2A 2HW3A 4AXJA 1VQ4S 2ZZMA 2ZOMA 2MGZA 1VR6A 3H2VE 1S48A 1BWVA 1TL1B 2PE8A 3CDWA 1LWEB 3DU5A 4X65J 2QLXA 4DQIA 3A8JA 4K4SA 3PYFA 1KBRA 1JKHB 4J9KA 1SIZA 2ALZA 2QA4G 1FRIA 5F8MA 1L3VA 3PR4A 4CLZA 1HKAA 2AGOA 4C48A 1U26A 1UAWA 1IBCB 1LQ9A 3H4DA 2W8KA 2C2MB 2LQJA 1T8EA 2RS2A 2UXBJ 2FJEB 1KOOA 5HSPA 4DHVA 3K8VA 2NXCA 4ATNA 4JI5J 2YX4A 3JAMY 2D7SA 1XNQF 4PR6A 4DUTA 5H9FK 4LF1A 2UUBJ 1HBMA 4IOBA 4R5PB 1GQEA 2JEJA 2BDPA 1CLFA 4RBTA 2ILZA 3TX0A 4J9LA 4PG6A 1Y10A 1JLFB 3V5RA 5KFDA 2NYHA 3OV7A 1WDDA 3KK1B 1JIHA 5HVFA 3NOCA 2XSFA 4HHJA 2NSCA 1RACB 2OPPA 2C1EB 3OXLA 2IVYA 3M2VB 2G2YA 2VFRA 3CJTA 4CLWA 1KLMB 5HQ8A 4USMA 3W9HA 3BJYA 2R8IA 2RDIA 5GAGI 4ZVFA 2EG1A 3SI8A 3FFIB 4ZCKA 3CJ4A 4QYZJ 3ETOA 1U1OA 2XS2A 2XYPB 1WHXA 2WTFA 4FYVB 4HHUA 5F0UA 4JV0A 4Q8EA 3SSSA 2GA7A 3UE2A 4YB6A 4F2SA 4JV5F 1C4AA 3CCSS 1TL7A 1MWZA 2BKNA 1KFDA 5T14A 4NA1A 2WAQD 1U47A 2J6UA 2MKJA 2W7PA 2B43A 3CCJS 1IR0A 2I0XA 2L3MA 5K8MA 4K4TA 4LIRA 4U8YA 1U6FA 2IJNA 3OXFA 2IAJB 5CABA 1KSPA 3CCLS 2EC2A 4MK7A 3PR5B 2RUGA 2LQ9A 2I2YA 2CZ9A 4KO0B 1HA1A 5D6GA 2LLZA 1SJFA 1N32J 2HQ3A 4LBIA 2DY1A 4HEA9 1FX4A 4C8ZA 2ZOGA 4W4MA 4PEOA 3UD4P 3T1YJ 3OVBA 1RT6A 2X51A 2YWEA 3I9V9 4YOEA 2XY6A 1C0TA 1EKRA 1F5AA 4WE1A 1C0UA 3IAS9 2D74B 2HWHA 1W2BR 1BXNA 3O44A 3K5PA 2UZAA 4N7TA 3CD7A 1S9EA 2KYZA 3I32A 1WF0A 2RU3A 1YI2S 4C8KA 3Q24A 4ENOA 3KHLA 4R25A 3KJNB 2CG8A 3HULA 1WOPA 2VICA 4LFBF 3HVWA 4NMXA 4A8YA 2P6SA 3MAHA 1D9AA 2BZ2A 1HNIA 4NX9A 1AFIA 3HMJG 4B3TF 2YWHA 1KN6A 1SJ3P 5A2QY 1HNVA 3CT9A 2AGQA 4CT8A 4ILLA 1IXKA 4XTTA 3L09A 2J9CA 1R8AA 5LT5A 2RHQB 1MG7A 1RGVA 2OTJS 1Q95G 2ZWOA 5DDPC 1Y5IB 4WKRA 1VCTA 5CCMA 3DM2A 9ATCB 1RE1B 2YTCA 3SEOA 3QT7A 1HR0F 1TL4A 2PI5A 3I55S 3NRBA 3CCQS 1SV5B 1RWVB 4KTQA 1VRUA 2DISA 2BX6A 4DQPA 1IKXB 1PBAA 1UEKA 4ZITA 1ZTTA 1U02A 5G0RB 2L9DA 2EWHA 3MR2A 4YQWA 2F8HA 1HI1A 2QV6A 5KG2A 2KH9A 2KKHA 1ZPWX 3IWLA 2WONA 4DU7A 1UL3A 1UVLA 1I51B 2QO3A 4EYIB 1QAYA 4A47A 4URQU 3O2IA 1LXNA 4LSNA 2BJEA 4B3OB 1HD0A 1R7IA 1A6LA 3FC9A 1SUQA 2MGZB 3NXZA 2GIRA 4DUYJ 2CQGA 1RHUB 1F9HA 2HGLA 3TVZA 1EARA 1JLGA 2EKYA 4NLSA 1N34J 2YKNB 2LXIA 1FESA 3V81B 3P3DA 1YK9A 4JI6F 3B4DA 3M8WA 5F8LA 2KG1A 4LR9A 1OQ6A 2C2RA 2DNHA 5AE2A 1FE0A 3M2RB 5KFZA 2V4QA 1L3KA 4C8MA 2GVZA 3BKUA 2DGUA 2M4MA 3IXQA 1UW9A 2YH0A 2BR0A 5D3GA 1T03A 3NS5A 3ZXWA 4ZMMA 3I87A 1HBMB 3IMQJ 1S79A 2YNHA 4H4OB 2KVIA 3LP2B 4ZVOB 3FSYA 3MEEA 4IKAA 4ETXA 5J1EA 4A8FA 3QBCA 4F8RA 2FPHX 3I82A 2ZH5A 5ETTA 4CLSA 2R4FA 1QVFR 5RUBA 6FDRA 4Y6IA 3MMJA 3N5BA 2RH3A 1QAIA 3G82A 1CS4B 1GTEA 1RKIA 3C6UA 1OWXA 2M9KA 3HLUA 5D0EA 4KAIA 1S6QA 2PO4A 3AAWB 4X62J 2FD2A 5T41A 4RW4B 3VQSA 1D9FA 3HJFA 1NK8A 2XMMA 3H90A 2FQQB 2R2UA 2YNIB 3WBZA 2J7KA 2FY8A 3MGJA 1IBLJ 4C3LA 2HVZA 1JJ2R 3JXOA 3T1HF 1NK4A 1PYTA 3CW2C 3KNAA 4DR5J 2UUTA 1UPPA 4Y2MA 2C2KB 4A8OA 2LP4A 4NXMF 1TL7B 1AW0A 3V6DB 4U96A 4YEAA 3GONA 3NS7B 4FXVA 2DPJA 2RMLA 3ITHA 2V4JB 2NS1B 5IM0B 5HK4A 4DUZJ 2HPUA 2R8KA 3F73A 3Q89A 3OHBA 3FEXB 1G7CB 2J0WA 4FPIA 4L74A 2W9CB 2W2OP 3M7VA 2VB6A 4WP8A 1NJXA 3VHQA 1Q16B 3ETMA 2V63A 2Q6CA 1VIOA 2MSSA 2UUAF 1PYSB 4HTJA 2D9OA 4WE1B 2H4WB 3CJ3A 3FVYA 1SC3B 2EW9A 2B6AA 2CWXA 3AA9A 1C1BB 3R5BA 5KT2A 3GFZA 1YVFA 4OZ1A 1LW0B 3OTDA 2BKOA 4WJBA 1S9EB 4AL7A 3W62A 3QLHB 4MIWA 4Y28C 4I56A 2PFFB 2YKAA 1LWFB 4U67Q 1WKLA 5EX3A 2ZHOA 1HWUA 1B70B 3KLIB 5KFHA 2MZTA 3PRBA 1SL2A 1NDLA 4PQAA 3DYAA 1UW4A 2DCUB 1V5VA 2DGSA 3QT6A 2R8GA 3LOUA 2V9WA 4OI0A 3Q22A 1U2FA 2E5HA 3R5CA 4IQMA 1T94A 2HS4A 2NXNA 3BKFA 3R1HA 4N8OA 2LXUA 4DX7A 4ZLNA 2JLFA 1L3SA 4FKXA 1HNVB 2HVHA 3QRPA 5CYQA 2LEAA 3HFVA 2E5JA 5KFYA 4L73A 3ZZOA 4W92B 4AT1B 4ZLPA 3DGPA 1FTRA 4EEYA 1T3OA 1S1XA 3G8QA 4K2JA 4IFYA 3I6PA 3G4SS 3OQ2A 3FK4A 3W2WA 2YQ0A 2B8QA 2GJFA 1TTHB 2YWGA 3RRHA 1RTIA 2HGNA 1NPPA 3CJ5A 1VRUB 3G2XA 3J7Z5 1TL3B 3M8QA 3NEKA 2HK3A 1FKAF 3AB2B 1VQPS 4C0BA 2C2OB 3V6JA 2IDEA 2V67A 4DG1A 3C6TA 1EQMA 3PJXA 2IJRA 3UD3P 1XNRF 1NAQA 2FIUA 3QJJA 1TKDA 3RW6A 4F04B 4GC6A 3NCQA 3IC1A 3I0SA 5L39A 3RR8A 1N5YB 5CD4A 3CCVS 2QX0A 2BVZA 4A4JA 3KMQA 2A3JA 2E44A 4LF4F 1N33F 4XAKA 2DNZA 1SKRA 4P52A 4KHPJ 1ZAXA 4ZP7A 4CIOA 2IM0A 1AB8A 3CXCR 1M90T 3T9ZA 2NXUA 2ZBRA 3B6BA 1UA1A 2DHSA 2MY8A 2J9DA 1DBDA 3HD1A 2QL7B 3ZZUA 3DRPA 1AFJA 4EU0A 4ECUA 2LA4A 2DRAA 2HS3A 3KLEA 3MFIA 1VDHA 3FBFA 4ZP6A 1I1GA 4PYAA 2RIJA 1BQMB 4KGXB 5D3GB 3W9IA 3D0GE 1IBMJ 4R8UA 2DR9A 3E3XA 4DWIA 4KHMA 5F41A 5HN0A 3EVMA 4CM0A 5A8KB 1ZS6A 1VK3A 3LAKA 3OW2R 2ZEJA 3BM7A 3AD7C 1YJTA 4PWUA 2GMJA 2GMLA 3N0VA 4C3MA 3NNCA 4WPAA 2OPRA 5M2UA 4ECVA 3VTIA 2J9DE 4IH5A 1TU0B 5K14A 1FFGB 1GMWA 1N54B 3Q8YA 3A13A 3HHEA 1F9FA 2QMUB 1RP5A 4LRFA 1WHVA 1S1UA 3Q8SB 2JEGA 5KFIA 2MKHA 3C6UB 4O4GA 4DL7A 1HW8A 1JK9B 1Q7LB 2MJNA 2CXEA 4UTGA 2HRTA 1UWAA 3MXHP 1TMJA 3T1AA 2YX1A 2FB0A 1TR0A 3TO8A 3VF0B 3OUYB 3AA8A 1WORA 2W01A 3FBCA 1VQ7S 1QTNB 3Q86A 2DGWA 1RCXB 4GKJF 4QOTA 2IRUA 3CC4S 4JV1A 2ZH1A 3VWSA 1S7IA 1NCLA 1RJJA 3NAIA 1RLDA 2HLUA 5L9XA 1U0HA 5KG5A 4ZPVR 2HGMA 2GQ2A 4AXIA 3QJPA 2Z30B 4N76A 2FVCA 3L7OA 1FJ7A 5E3CA 3BGRA 2CNNB 4CZCA 2RQ4A 3MD3A 4DZDA 1ROFA 5HL7Q 4I64A 3M8YA 2E7XA 1LEOA 2WBMA 3CJKA 2UU9F 2KM8B 3C3LA 1UFWA 3TEGA 1UFLA 3IRXB 2XZDB 2FTRA 3D2WA 1U8WA 2OSRA 1ZAWA 2RRNA 4M95A 4QBUA 1RZMA 4OZ2A 2MKKA 3EE3A 4JI7F 4JUZA 2ZNYA 3CIMA 3NGUA 3ZTPA 3R2CJ 3M1VA 2FLLA 5A2QU 4L75A 2F4VF 3GV5B 3OSPA 3HO1A 1RYRA 1A7GE 4GRSA 3P49B 3A8IA 3FEZA 3DYAB 2X3DA 1XNQJ 1U6BA 2ZITA 3CO9A 2MQ8A 3CDBA 3QATA 1X5OA 1YJ9S 5LSRA 3RB4A 4OZ0A 3LQVA 4NWBA 3U1LA 1HFEL 2V2QA 1URNA 1LV5A 1E6YA 1HYSB 3A4TA 3QT5A 2MHEA 3P45B 3I31A 2P9GA 4PPDA 3THTA 3IS9A 3UN3A 2M8DB 4F4WA 1CEZA 5I42B 2UXDF 4ED2A 2GHPA 5GAHU 2E5IA 1UWBB 1XERA 5L9NA 4B3RF 1LW2B 4Q0BA 3OVAA 3ZZ0A 2OJ3A 3ILJA 3FQKA 3TW0A 3M8QB 5IFMA 2DNPA 3QAEA 1NRKA 1J5OA 3CC7S 4OYMA 4LF5F 4H4KC 2CQPA 3K5MA 1V5IB 5F0WA 4DG1B 2E1RA 2HZCA 1VQOS 4USVA 4JV5J 4BS2A 2ASDA 1YTYA 5AE3A 2O67A 2ZHBA 1N0UA 3R5GA 3J7ZT 3RUBL 4XPEA 1S1WA 3I0SB 1HBNA 3FRYA 1S12A 1FJCA 1WTBA 4FPRA 3R27A 4USHA 1JX4A 5ETPA 2XLIA 1DTQB 2X1AA 1FWPA 3LUYA 1YDLA 2DGXA 1CJKB 2MQOA 2W7OA 1RT4A 2LVWA 3R6LB 3MDFA 2VG6A 5A6PA 1NJYA 4ED4A 4ZHRB 3U1NA 3FZ2A 3PYGA 4ZVRB 1VQMS 3K59A 1QAXA 3BPSP 2JDJA 1IJEB 3QFWA 4LF7F 4Y65A 5HAOA 4WZMA 3BGLA 3FQLA 4KPCA 4QW8A 5HO4A 1VQKS 1F3FA 2IDLA 2B4UA 2JJ4D 1FNOA 3K5NA 3LP1B 3SDEA 1QE1A 4LFBJ 2Y1IA 1F1BB 1ITPA 4J7CA 2OPRB 1CJVB 2Y8WA 2XMAA 1FEEA 2DR7A 3GP9A 1QSSA 1ACMB 2FVQA 3HJVA 4B3TJ 4KR0B 2PN6A 2ZZTA 3GIJA 1S1UB 3Q8QB
chains in the Genus database with same CATH topology
4G1IA 1N56A 1R3NA 2EK6A 5F9LA 5A8RB 4ECRA 2LDIA 3QGPA 4QJVA 4QR0A 4OZJA 3I5BA 3LAMA 5KAKA 3HFKA 4N77A 4WIIA 2JL9A 2V4JA 1QY7A 3GV8B 3QGIA 3TA0A 2WONB 4QIVA 2XB2D 5IM0A 4DR4F 4E0DA 2JLGA 3X1LB 1L3TA 1TVRB 3GIKA 4IOAQ 4M5DB 5BR8F 2LDYA 2OSQA 4LSNB 4NRTA 2CPJA 1NK6A 4IRCA 2EI5A 3VZIA 3EPGA 1DHMA 5FDLA 3GG1A 4K0KF 1SUQB 1ZM4A 1NJZA 2CPEA 5GAEI 1XMBA 1V3RA 2MZSA 2DNKA 4NLYA 3PX4A 5E41A 3BN4A 2IM3A 4YDDB 1U1QA 2HG4A 5KT5A 4L72B 2XO7A 3MMCB 2DPIA 4C8LA 2FHJD 4F3OA 1JJ4A 2BJDA 2QZ8A 1H0HB 1TKZA 1ZZFA 4LQ9A 2PMHA 3MM8A 4X4NA 2PSZA 2LXFA 3LGMA 4F26A 5B7WA 2HHPA 4OX9F 2W9CA 4K4WA 3DOMA 2BRKA 4MMOA 1JLGB 5KFBA 3OXGA 4HH0A 3RRKA 3VAKA 4G1QA 3WC0A 4IG0A 4KV8A 2CPFA 3R5AA 1BQNB 1BGXT 3BSAA 3RAMA 3CDEA 3TUIC 4KE5A 1UP1A 4UUXA 4R0EA 2HHHF 4HT7A 5CZXA 3UCUP 2GX8A 4AYBD 5KFEA 3FMWA 2U2FA 1U09A 2RJZA 3H25A 5KFOA 1I6JA 4OHYA 1C1BA 2VFSA 2J6TA 4LFCF 1VQYA 5E3AA 4N5SA 1LW0A 1JLFA 4RUAA 1U2RA 3BGRB 3G6YA 3QLHA 3DNCA 2Z8QA 1WI8A 4FXWA 4ID5B 3UW1A 1KEKA 3MAQA 4WU3A 1LWFA 1F2GA 1P1LA 1LFWA 4IO1A 4YMEA 3BB5A 2R7OA 5I3UB 1PSDA 2E1AA 1RT2A 3KLIA 1KTQA 1YSJA 1JLCB 1F60B 1H7XA 3AH6A 2CPDA 4QR1A 2CQ3A 2W4PA 4RZRA 2CVEA 3CCWA 3DCAA 3NMRA 1S6PB 3GR0A 3D54A 2VH7A 3NAHA 2HFNA 1RT1A 3K2YA 3TA1A 1CG2A 4NLOA 2ZHAA 4IH7A 3MMBA 1Q79A 2MQNA 4J5OA 4P2SA 4A48A 3MM9A 4DJBA 3HKZD 2HIQA 1T03B 4ZVHA 2VFUA 4J9PA 2J6SA 3KFWX 4C4WA 1E6VA 4RW9A 1KHVA 3ZC4A 1Q8BA 3OBIA 3OTBA 3TR5A 4Q44A 1XEZA 2AYEA 2IC3A 3TNVA 2D9PA 4AE5A 4PG8A 5MLCV 4CO4A 4L6V3 2VBYA 1ULRA 2K3KA 3FFIA 3CMES 4PWDB 3OPKA 4BWJA 1KTVA 1IM4A 2L08A 2G1DA 3DMJA 2YNHB 5A6WA 5HLFA 2KN4A 2Z4PA 5BYSA 2BV3A 5IZHA 2HNYA 3MEEB 4FF3A 1U24A 1SC6A 5J1EB 4KKOB 3DRXA 3M1VB 4OJ3A 4WXOA 2GNKA 2C2EA 1S0NA 4CO1A 3W2VB 1N6QB 4G1PA 1W25A 1Y7PA 2BANB 2V8VA 2AW0A 4DDFA 5KFSA 3OVSA 2IVMA 3NCPA 5L1KA 1VIXA 1TKXA 1OPZA 2BW2A 2E9RX 3H2LA 2MQPA 3MD1A 2Q66A 3WX4A 4IRKA 5GAGU 4TXSA 2JLEA 3DRSA 4Q8FA 2N3LA 4WYLA 4F25A 1UVNA 2KT5A 5KFJA 4Q43A 4ELVA 4FS1A 4QU6A 1FVSA 5K8NA 4IO9Q 2NR0A 1FT8A 4KGMA 1Y9OA 5B0EA 3U7JA 1QLNA 2RQCA 2IM2A 1FXRA 3M8RA 4DV1F 1MSWD 3SCKE 3NL0A 5DS7A 3SV4A 1NEEA 4HKQA 4WCEQ 3KMSA 1S99A 5DQGA 4Y2CA 4FVCA 3HT3A 4JV2A 1S6QB 4ZPCA 4OJ1A 3M8PB 1S7HA 1JWWA 3M30B 2MKIA 3QAUA 1TL3A 5U47A 5B0DA 2HVIA 4MTPA 3DDNA 2Q1LA 1ZM9A 3QZ8A 3N01A 3N6NA 4MIAA 4ZP9A 3CCZA 3OJSA 3PKYA 3KLFB 3P6YC 1HARA 1S0MA 2XS5A 3OR2A 4DL3A 4Q2LA 3EX7B 5D77A 4ID8A 2HHWA 3TVKA 3PW4A 2KRRA 2OMOA 3DRRA 5IXUA 3S8SA 2L9NA 4KHPF 4ZPTR 4PUOA 4Y00A 3CF5Q 1H2TZ 5E5NA 3V6KA 1MW7A 4CNZA 1AUDA 2DK2A 4TYAA 2HNZB 5LJ3Y 4Y2KA 2FC8A 1GH8A 2B7BB 1H6KX 4RX6A 1L5UA 4ELUA 3RBDA 1FF2A 3CEDA 4ED0A 3PW0A 1EP4B 2E66A 4TU7A 2B56A 1IKYA 2KT3A 4QCLA 2P6TA 2CQCA 3MFHA 4HL9A 2PT0A 3KLVA 4GKKF 2D3UA 2L9WA 2E7WA 4C8OA 5DG9A 5I4MA 1Z4UA 2NSBA 3SCLE 2CKWA 1IJFB 3ITHB 2BXJA 4IR1A 4E8UA 4EGLA 4DFMA 1YHQS 1G2EA 3FCHA 5GAEU 4DR1F 3MCSA 5HMZA 1N5YA 3MTKA 4OZ5A 2K7KA 1MNEA 1H38A 2FHJA 1JLQA 2KYXA 2FHMA 2I5JA 1IBMF 3SFGA 1P1TA 2QMWA 2NZ4A 4IDKB 4QZVB 5IQQA 4ECZA 1H2VZ 2X1FA 4OHVA 1H98A 2V5HG 1WNEA 1Y5NB 5ADZA 4ED5A 3H5YA 4GO7X 4ICLB 1UJ5A 4NZ0A 3G6ES 1FXDA 2XLKA 5LJ5Y 3MPVA 2GC8A 4PXEA 4QIFA 5F8IA 3M9NB 4TNOA 2B0GA 2H5EA 5C25B 2FC9A 1NHVA 3UR3C 2R7TA 3OUYB 1D9DA 2M3DA 5H9FJ 3U02A 1KQFB 1HBUA 4AFFA 5F3ZA 3HP6A 4OI1A 2J0SD 1U1KA 5H9EJ 3FSIA 2DHGA 1SXLA 3HHKA 3JTNA 4ILRA 4OJGA 5B0GA 3PW5A 1FHTA 2ROGA 2VKRA 3I4HX 3LGNA 1V3SA 4I2PA 3GQCA 2QIFA 2GGPA 2KRBA 2KXHA 2GFFA 2AQ4A 2XG8A 2FVPA 3ZZPA 1XTZA 3GYXB 3J80Y 2NQPA 1N5SA 3NBPB 3PHEA 3OSNA 2WOMB 4RW7B 2B6AB 2K2PA 4M8LA 1VRTA 3FZBA 3C46A 5HMYA 3M9MB 1BQMA 5L38A 3KLGA 2DO0A 3MR3A 2XMWA 4HVZA 2EFNA 4MFBB 1RTHA 1UKUA 1QUPA 4ZPDA 3PEJA 1UJ6A 3PY8A 3LO3A 5AE1A 2VA2A 1Z1ZA 4ES1A 4EBDA 3GE9A 2YY3A 4RW6B 1DZ5A 1S1TB 1NK0A 3TAPA 5L1IA 2XULA 1XR5A 4I4BA 3G8SA 3AQPA 3PX6A 2DT9A 2VUGA 2QT7A 2Q6BA 4WTYA 2K1RA 3C66A 4JYAF 1JLEB 1VGYA 2EK1A 2GO9A 1R8BA 1CPZA 2JRSA 3P5TL 1ZM3A 5A8KA 5MAOA 3W3SA 1LKZA 2KT2A 3TP2A 2HWIA 4YR0A 3RB6A 5DG8A 3NCRA 2BE2A 4Y3CA 2XY5A 2VKZG 2VPYB 1R8PA 2L48A 3HF5A 4YY3F 5DGBA 2QA4S 5CYMA 1D8YA 2FJWA 1NK9A 1UVKA 1FKPB 3GWCA 2VG5A 2XCAA 3GFXA 5B0BA 1IKVB 1K1QA 3L7PA 3QIPB 1EETB 4DMZA 3IRWP 2A10A 1XN9A 2MYFA 5FJ4A 2PGCA 2RRAA 1ZH5A 3FMBA 4GC7A 3MM6A 1HWLA 4OI2A 2LMIA 2ROPA 3F56A 3FRZA 3D5MA 4C8NA 3EXYA 2OD6A 5K8PA 3DU6A 3KLHB 4M1KA 3QGHA 5KFPA 1FO1A 1X8DA 4OJHA 3OR1B 5CYQB 4I2QB 1PILA 3OJUA 5LMNF 2A1BA 1DARA 1LWCB 2B4PA 5J2MB 3CCMS 5JVHQ 4M94A 4K50A 2PMZD 1X4GA 1KNZA 4Y34A 1HPZA 1N8RT 2DH8A 2R7WA 1SJRA 2DB1A 4TY9A 5EUHA 3MMAA 3VQTA 4DN0A 1GNKA 5KOWA 4CH1A 3G8TA 3NNAA 5KFUA 2E5GA 1C2PA 1S1XB 2AV5A 1Q7YT 2ZKTA 5DM7Q 3MEKA 2VBXA 1S0OA 4C0HA 4MIBA 3SV3A 3GFHA 1K9MT 3TX8A 4IFYB 4TLQA 5A8WA 3RBEA 4B3OA 4NCGB 2R7UA 1KVJA 3M2UA 3SZ2A 1UVJA 2HW3A 3W2WB 2OPQB 4AXJA 3OUYA 1VQ4S 2ZZMA 2ZOMA 3PZPA 2F40A 2MGZA 2JZ5A 3H2VE 3OFEA 1YJNS 1S48A 3MOJB 1TV6A 1PC5A 2ADBA 3IG1A 2I38A 2B3TB 1TL1B 2PE8A 1X4CA 2RQKA 2DR5A 1RTIB 2XWYA 3CDWA 3SMZA 4YUDA 1LWEB 5B08A 3RB3A 4CO0A 1UVIA 3DU5A 4IG3B 2V9KA 2LYVA 4A8KA 2XMKA 4ZOSA 1O5JA 5KFRA 1VQNS 4B3MF 2QLXA 2YKPA 2YKOA 1YITS 3UR0A 2XLJA 4DQIA 1P27B 1Q1KA 2HLTA 1VK8A 2DD8S 3E01B 3PEHA 3OLBA 1NB7A 3QJLA 4K4SA 4LSLB 4IFVB 5FD1A 1Q86T 1JKHB 1U7LA 3S1TA 5SUHA 4J9KA 1SIZA 2WRMA 2ALZA 3S6EA 2FJVA 3QO9A 2QA4G 1FRIA 1X4FA 1IKWA 2RKIA 3N6LA 3PRDA 5F8MA 2G4BA 2HHUA 2XI2A 2XZWA 2C22A 2XMTA 3IO1A 5IT9Y 5F3TA 3PX0A 1L3VA 2WSEC 3PR4A 4PG7A 2AGOA 4DR3F 3VALA 5SZTA 1U26A 5KOXA 5B09A 3HHLC 1UAWA 2MKSA 1RTDA 3BQ2A 3T3FA 3MECA 1LQ9A 2UVRA 4JI0F 3H4DA 3C6TB 2W8KA 2GO8A 2DGVA 2DNGA 3T5JA 3B82A 2YQ3A 2LQJA 2ZUGA 1T8EA 2RS2A 2ZJQQ 4C2MA 2J5AA 2PI4A 1FDDA 3N79A 2ERRA 2FJEB 3CDUA 4C98A 2F8MA 2GW8A 1KOOA 4RU9A 1ZPVA 4GMKA 4DHVA 1S9GA 2XMUA 3K8VA 4ATNA 3HVTA 3HKWA 5HI7A 2E9ZA 4ECSA 2KJVA 1VBZA 2YX4A 2SXLA 2V8HA 3LW5C 5DLGA 2XY7A 2PEHA 3JAMY 4HYKA 4PXBA 3OL7A 2D7SA 1OO0B 1XNQF 4PR6A 2QSWA 5IQ6A 3MF5A 1U49A 2MDAA 1X4HA 2U1AA 1RYSA 2PD1A 4Q5VA 1FA0A 1T02A 3IRXA 3KHHA 5KFMA 2AJFE 1FRHA 5LXYA 3KG1A 2IVFB 1CSJA 1HBMA 2N7YA 4LQ3A 4IOBA 4R5PB 1GQEA 2QEXS 3EXCX 4DSLA 4NA2A 2JEJA 4ECTA 2VASA 1GTHA 2BDPA 1CLFA 2MZJA 2XC9A 4RBTA 1S77D 4A46A 2ILZA 3CTRA 1HNWF 3VR1A 4J9LA 5E3PA 2ASYA 4PG6A 5LL6d 3THPA 1JLFB 3V5RA 2QLWA 4G6VB 5KFDA 1HBOB 3CIZA 2YX7A 2DH7A 3OV7A 1X4AA 2B7CB 5E33A 4DR2F 3M32A 3KK1B 1JIHA 2FUG9 4JI2F 2XSFA 1FXLA 4HHJA 4EUVA 3Q8RB 3VZHA 4PKDB 2EFGA 3C2PA 1RT2B 4F4YA 3DRPB 1GAOA 2E1CA 3R3TA 3M8SA 5LMUF 4PRFA 1UEVA 2NSCA 2OPPA 3ONQA 4P6QA 3I96A 2KFYA 1N48A 2VFTA 3NNHA 3OXLA 4H4MA 2OPSB 3PXGa 2IVYA 3M2VB 3KLEB 2VFRA 3ISNC 2XEXA 3D1HA 1VMBA 1MROA 2RQMA 2ROEA 4C9DA 1KLMB 3TRGA 3UQSA 5HQ8A 1X4BA 1E6VB 4RW9B 2UUCF 1M5OC 2VQFF 3BJYA 2R8IA 2QFJA 2RDIA 4PCQA 3HXMA 5GAGI 3FDSA 4ZVFA 2EG1A 2IC3B 2RILA 2B9XA 3UDLA 3SI8A 1CC8A 2F9JA 4R8UB 4UY8T 2DNOA 1YJRA 3JSYA 4WZQA 2XSJA 3FFIB 2NYIA 2J7UA 3ZZYA 1FRJA 4ZCKA 4FF4A 1TQLA 3CJ4A 4LFAF 5EX0A 1HYSA 2MJUA 1Q82T 4QYZJ 1MU2A 3DLHA 1ZBTA 3ETOA 3MM7A 1U1OA 3UPFA 4KFBB 2ZH3A 4K5RA 2XS2A 2R9LA 2QRRA 3PM9A 1WHXA 2CQHA 3QMQA 2WTFA 4I7FA 5F0UA 5E3QA 4JV0A 4Q8EA