1VQPS

The structure of the transition state analogue "rap" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vqpS00
3UCUP 3B4DA 2DHAA 2MY8A 2MJUA 1DRZA 3SXLA 1NO8A 2LXIA 3IWNC 1X4GA 5H1SV 3US5A 1WTBA 2RT3A 2QA4S 3P49B 2KFYA 2AYBA 2OTJS 2DGVA 2U2FA 2CPXA 4WCEQ 4IO9Q 1OIAA 5LSOA 2DNNA 1U1PA 1M90T 1N88A 4A8XA 1HD0A 2N7CA 3U1MA 3J7YU 2E5HA 3J7ZT 4IOAQ 2RRBA 3VAGA 4WF9Q 2DIVA 2EK6A 3HI9A 4U67Q 1S72S 3CCES 2PE8A 5HL7Q 3VAJA 4PRFA 1WHXA 1WG1A 2X1FA 3NNHA 3BO4A 2CQBA 3P6YC 3ZZYA 2XS7A 2HGNA 1FT8A 2MZSA 4F25A 2K3KA 1QM9A 5D77A 1AUDA 3CMAS 3MD1A 3CPWR 1OWXA 2DNOA 2K8GA 4FXVA 2DNRA 3MURP 2CQGA 2MXYA 2KXNB 3TYTA 2DGXA 2MZ1A 2DNQA 1H2TZ 1W2BR 3DXBA 2ZJRQ 3R1LA 2MKJA 2DB1A 2N3OA 2DIUA 1YJ9S 3I55S 3V4MA 3CXCR 2MZTA 4WFNQ 3VAHA 1X5TA 2DH8A 2KM8C 5D78A 3CC2S 2DO4A 2PEHA 3CTRA 3CCSS 2N3LA 1SJRA 1YIJS 1VBYA 2HVZA 3EGNA 5ITHA 4ZKAA 3NNCA 1KOOA 2FHOB 3S6EA 1N54B 3FEYB 2JRSA 3MDFA 3BO2A 1WG5A 4TU8A 1WI6A 5GVQA 4LIRA 2DNHA 1KC8T 2RQCA 2RS2A 2MMYA 1VQ5S 2GO9A 1FJCA 2M7SA 1FHTA 2KRBA 1HA1A 3L3CA 2E5IA 3HHNB 4OZ1A 3BEGB 1M5VC 4OZ0A 2D3OR 2LEAA 4EGLA 4QQBA 2E5GA 3MOJB 1UFWA 2CQ1A 4ERDA 2KG0A 2I38A 2M52A 2ADBA 5HO4A 3UD4P 2DNYA 1X5PA 3UCGA 5EN1A 1OPIA 2DH9A 2L9WA 2NLWA 1U2FA 5CA5A 5MLCV 1VBXA 1BY9A 3H2VE 3VF0B 3NNAA 1PO6A 3CCRS 2KXFA 2F9JA 1UAWA 2CPEA 2XS2A 3MXHP 1YJWS 2RUGA 4UQTA 1U1NA 2LCWA 2FC9A 3G6ES 5JVHQ 3VAFA 2J8AA 2RU3A 2DHSA 2KT5A 5CXTA 5DM7Q 1P27B 2CQDA 2MQPA 2MGZB 2DO0A 2KU7A 2MYFA 1YHQS 3BS9A 3SDEA 2KM8B 1DHMA 2MY7A 5JVGQ 3BO3A 4WFBQ 1VBZA 2VONA 2I2YA 1A7GE 2M88A 3CCQS 2JVRA 1FXLA 4QPTA 3G4SS 1CVJA 4LMZA 5DDRC 2LYVA 1H6KX 1SJ3P 5DM6Q 2LKZA 3UCZP 2E44A 5DDQC 2MB0B 2CPFA 1YITS 2QEXS 1U6BA 1JMTA 4BS2A 2MKSA 1UP1A 2CQ2A 4TU9A 3CCVS 3CUNA 3CMES 1VC5A 4P6QA 3NS6A 3VAIA 2YH1A 2OSQA 2ADCA 4W92B 1VQ6S 2A3JA 2DHXA 1YWXA 2M2BA 3IRWP 2MPUA 1VQ4S 5GAGU 1M1KT 2YKAA 2EVZA 2L08A 1ZZNA 2VOOA 4C7QA 2DGTA 3MUTP 2MZRA 1WG4A 1VQKS 2VODA 1URNA 2J76E 2XNRA 1JJ2R 3LQVA 3CC4S 1X4HA 2RVJA 2FC8A 2MGZA 2CQIA 2MZJA 1X4CA 3B4MA 4WIIA 3CCLS 2KN4A 3R27A 3SDEB 3UWTA 2LQ5A 3THPA 3I56S 3CULA 2M0GB 4V19X 2MHNA 2JX2A 2MKCA 1YI2S 1FNXH 2DNGA 3Q2TC 1WF1A 2MQNA 1VQOS 2KHCA 3CF5Q 2CQCA 2MKHA 4YOEA 1D8ZA 2DNPA 1U1MA 4LJMA 1QVFR 4F26A 4M5DB 1JJ4A 4F02A 1R8PA 2LA4A 5BJRA 2XS5A 1WHYA 1VC0A 1WEYA 1FJEB 5LXRA 3PIOQ 2RNEA 2U1AA 2ZJQQ 3N9UC 2DNZA 2CQ0A 3UE2A 2DGOA 2JVOA 1R8HA 1UW4A 2YTCA 1HD1A 3S01A 1IQTA 3G8TA 3EGZA 2MQOA 1X4DA 1X4EA 2SXLA 2KYXA 2CQHA 5FJ4A 2ERRA 3U1LA 1RKJA 1SJFA 1FO1A 5LXYA 2DISA 2N82B 3P3DA 2XSFA 2X1AA 2AYGA 1X4BA 3VAMA 2LECA 4IUFA 3G71S 1NJIT 3CCMS 2JWNA 1QVGR 1VC6A 3RW7A 2KXHA 2YH0A 2G4BA 2G1DA 1WF0A 2AD9A 1HL6A 2G0CA 2RRAA 1U1KA 1B7FA 1Q81T 1F9FA 1U6FA 2D9PA 2KH9A 2AYMA 2DNLA 5IM0B 3G96A 2CPDA 2M70A 3UD3P 3JB9k 1WHVA 1YTYA 3K0JA 5LSLA 2DH7A 1H2UX 1OO0B 1A9NB 1Q82T 2LMIA 2LA6A 3CCUS 1SXLA 1X5SA 2HGMA 2OSRA 3TP2A 2FY1A 3CD6S 1SJQA 2BZ2A 3TO8A 1DBDA 2CQ4A 5IFMA 1Q86T 1VQNS 2DGQA 2KG1A 3ULHA 2CPYA 2L41A 3DLLQ 3H2UB 2X1BA 4UY8T 3LPYA 1H2VZ 4WFAQ 3R1HA 5DETA 2X1GA 1K8AT 1DZ5A 2HZCA 2DITA 5DDOC 4WKRA 4PR6A 2QFJA 3MI7X 4PKDB 2XB2D 1WHWA 2CPIA 1WEZA 3MUMP 1U1QA 1VQPS 4QU7A 1RK8A 2OIHA 1S79A 2DNMA 2KI2A 1VQ9S 2M8DB 2AYEA 2MJNA 2DGUA 3Q2SC 2BOPA 2MKIA 2MSSA 1KD1T 2DGWA 4CH1A 1KOHA 1XN9A 2CQPA 5CYJA 5LJ3Y 1O0PA 2MSTA 1NU4A 2M4MA 2ZJPQ 2RQ4A 2CPHA 4TU7A 4CQ1A 4C4WA 3FEXB 3P5TL 5IM0A 1X4FA 1PGZA 2MZQA 1U1LA 2CPZA 1U1OA 5IQQA 3S8SA 1JJHA 4J5OA 1VQMS 1M5PC 1M5KC 2NZ4A 1ZH5A 3CC7S 1X0FA 2MKKA 1M5OC 1U1RA 1K9MT 2LEBA 2EK1A 2F9DA 1K73T 1WWHA 2MQQA 1WI8A 2KVIA 4QU6A 4ED5A 4IOCQ 2J0SD 2XNQA 2CPJA 3MD3A 5GMKa 5LJ5Y 3S7RA 3CCJS 4YB1P 5GADU 3VAKA 2J0QD 2VOPA 1X4AA 3ZZZA 2B0GA 2F3JA 1KQSR 3VALA 2OTLS 1YJNS 2WBRA 1SJ4P 3THTA 4YUDA 2M8HA 2HYIB 2D9OA 2MQMA 4Z2XA 3EX7B 2DK2A 4RU2A 1WEXA 5GAHU 4CIOA 3OW2R 3G8SA 2CJKA 1D9AA 3D2WA 4TLQA 2MQLA 4FXWA 2UP1A 2RS8A 3MUVP 2DNKA 3G9CA 1P1TA 1VQ8S 1N52B 2M9KA 2O3DA 1FJ7A 1WF2A 2V94A 3RW6A 4Y0FA 3PIPQ 1N8RT 1WELA 4Y00A 1VQ7S 1VQLS 2CQ3A 2OJ3A 2E5JA 2DHGA 3NS5A 1Q7YT 2HGLA 2DGSA 2YWKA 3SMZA 5GAEU 1X5OA 4W90B 2LXUA 5DDPC 4C0OC 3NMRA 1G2EA 2GHPA 2FPHX 2Q79A 1L3KA 1ZZFA 2KRRA 4CH0S
chains in the Genus database with same CATH superfamily
1SKUB 2CJYB 3LP0A 5A6WA 4P71A 4DL2A 3NOCA 3CJ3A 4EBDA 1TZ0A 1U24A 4LF9F 1FDAA 3K2YA 1N48A 4OL8A 2V9WA 1U1PA 1RT5A 2IFXA 3R8YA 2QO3A 4W4MA 1S6OA 3H7HB 4DSKA 4JI5J 3X1LB 2RRBA 1T3OA 1KBRA 2DIVA 3A8EA 2BQRA 4Y34A 1MW7A 3BO4A 3Q86A 4F25A 1QM9A 3PX0A 1WC1A 2DR7A 3RAQA 4NLYA 4DF8A 4QYZK 4OX6A 1S9EA 1RJJA 3J81Y 1R8BA 5ETKA 2CAJA 4WP8A 1SQEA 2ZM6F 1KN6A 3MR6A 1RTIB 4M5MA 2R2TA 2ZHAA 4U8VA 3AD9C 3CC2S 1CJTB 4DQSA 1TTHB 2IRYA 3IA0A 2Z2MA 3HXMA 1HNWJ 3EGNA 4MMOA 4ZKAA 3KK1B 1RT2A 1QTNB 3LW5C 4Q2LA 2FGCA 3I82A 4TU8A 2YNHA 1NNDA 2RQCA 5C24B 2VJVA 5L1LA 1EETB 3SV4A 3CD7A 5B0FA 3MEGB 2GVZA 4O3QA 2IC3B 3HSGA 2NLWA 3ENWA 3DRRB 3CCRS 2KXFA 1FDDA 1C2PA 5LOQA 2RU3A 2B8QA 4M5IA 3EGWB 2DXDA 4XTTA 4B9LA 1Z4UA 2EXUA 2CQDA 2BE7D 4AQYF 4MIAA 2N4CA 2PA3A 3CO9A 4KPCA 6FDRA 1HBMB 2ZKUA 2DKOB 4ZVOB 5KFTA 2AGPA 3PYEA 4USJC 1YJVA 3J81j 1FXLA 2V0NA 1JNRB 1FKOA 3DRYA 2PT0A 3RU0A 2HBQB 3W9HA 1HQEB 2X7IA 4TU9A 2C22A 1YG0A 3FBBA 3OJUA 1TVRA 1VQ6S 1JLEA 4CI0B 2B6AA 3JTNA 3W9IA 1UVMA 4TXSA 3OTCA 5KG3A 2J76E 2XNRA 1D3WA 1OPZA 1UPMB 2KDOA 1CQMA 2B9XA 2HS4A 1SC6A 1EARA 1DTQB 4UZCA 4O3SA 1TAQA 1NDKA 2LLZA 3VR1A 5JMNA 1RAAB 2FD2A 3G2XA 4EO8A 3EE3A 3DMJA 1NPRA 3GG1A 3HD2A 1XNRJ 1TKXB 1D8ZA 2B4PA 4CO3A 1JJ4A 2F8EX 2LA4A 1ZS6A 4KTQA 4IH5A 2C42A 3C14B 3A13A 1RTHA 3GFXA 1EQ0A 4YR0A 4LBIA 2DGOA 1S49A 2BJ9A 1HWUA 4ICLB 5A76A 2W4CA 4NASA 2KKHA 2UXDF 4RUBA 4ELTA 1VDHA 1TV6B 1YK9A 2X1AA 1ZAVA 1QTMA 4ED2A 3A3NB 2B4UA 1IWGA 1XMOF 2Z57B 2D9PA 2AMCB 4OJGA 4WXWA 2G2YA 2DJWA 2J8SA 2GGPA 3VVTA 2B8PA 4UUXA 4I0WA 3I32A 4HVZA 2B5JA 4PEOA 4WKRA 4J7CA 1RK8A 2QRRA 2G1HA 2BJ1A 1LEOA 2MKIA 1VRTA 2EWHA 5HI7A 5CYJA 5LJ3Y 2RQ4A 1X9WA 1RAGB 2YKPA 1U45A 4ZK7M 2LQ9A 2MLYA 2VU5A 3JXOA 4YFUA 2HWIA 5DG9A 2LEBA 4DSJA 2G0IA 4M95A 3WC2A 3WBZA 1IBMF 2Z2LA 1DTTB 2XWXA 3VALA 2F4VJ 1WKJA 2UUBF 5E33A 4KJIA 1S0VA 3QLHA 2DK2A 4QIWD 3G8SA 3E51A 2UXCJ 1LFPA 4PAAA 2DNKA 4UTGA 1SKWA 4PWUA 2Q6BA 3Q8QB 1MU2A 1WELA 4LF7F 1Y0HA 3R6LB 4G1QB 4DMZA 3OUYA 4C0OC 4FF3A 2V68A 4IOBA 1MROA 4MIBA 2BX6A 2VPXB 1KQKA 3SBMA 2HQGA 3QO9B 3US5A 3BR8A 3W63A 2PFFB 4QWCA 2W7AA 2YKOA 3B82A 1ZBTA 1OY6A 2XLKA 2J6UA 2XI2A 4DJBA 3HT3A 3KMQA 2GNKA 3K57A 2GAHC 1XBWA 2QLWA 3M32A 2E29A 4H54A 3OJSA 4O4GB 3P6YC 3RBDA 2HBRB 3V81A 4NPOA 4NLOA 2KXNB 3FEZA 4WK3A 3OR1A 4DV0F 1H2TZ 4A8OA 3EDQB 5F8LA 4OI6A 2DB1A 1T9WA 4WFNQ 1UJ5A 1CS4B 4RJVA 1PJ6A 3RZAA 4Y2AA 4F3MA 1KP6A 1KOOA 4ZP6A 4A8FA 3BSNA 5IV3A 2W2OP 2EC2A 1M5SA 1YRXA 1FKPB 3TA0A 2PMZD 4OZ0A 2E5GA 3KXDA 5ETTA 2DXEA 2OPPB 1BY9A 5A8WB 1WTFA 4CZCA 4PXDA 4UZBA 2LCWA 3VGVA 1CLFA 4ZVGA 2LQ8A 4ECUA 3MPYA 2ZUGA 2KT5A 1FK9B 4TNOA 1S1TB 3JAMU 4DV5J 4XAKA 1Q8LA 3HSJA 2MQPA 4QIGA 2P2CB 3PZPA 4N76A 2GFFA 2W2MP 2ZC3A 1L3SA 4U9RA 2H65B 1NHVA 3KK3B 2ZH8A 2JHEA 3N28A 1Y3JA 1WDTA 3NKYA 4DSLA 2AU0A 1N33J 4DCPB 5ADZA 2ADCA 5HK4A 3KLGA 2MDAA 1SVDA 2D3UA 3AXMA 1RB0A 3UVJA 2IMOA 5DG8A 1APSA 1IM6A 1NDCA 2VFVA 1EHWA 4P74A 4JI7J 3OXGA 1Q0NA 3KKFA 1VR6A 3IGNA 3BBCA 2W8LA 1XMBA 1VIOA 2CQIA 1NJYA 1IQZA 1FKAF 4Y2KA 2LQ5A 5HSPA 2A18A 4ED8A 2M0GB 2XMJA 4V19X 5F0UA 3C16A 3RTVA 1GH8A 2XMVA 2ZHBA 2QFIA 2EKNA 1R31A 1YRTA 3GIIA 3QBCA 1QAYA 5KOXA 2ASDA 2OEKA 3TVZA 2HHHJ 2YQ3A 3ET6B 4I7FB 3WX8A 4LSNA 4DQIA 1SH0A 2YKMA 1CG2A 4EUVA 3TW0A 5HMZA 5ETLA 4K2XA 4JOUA 1G6BA 4K0KJ 4PABA 1XNQJ 3UR0A 1HNVA 3D5MA 2G1DA 4O3NA 1KVKA 2F8MA 1H3DA 1LWEA 1N5TA 2CPDA 3JB9k 4OYOA 3R5JB 4UY85 2LMIA 4NLDA 4CWBA 4OYIA 2CNOB 1NRKA 1S0NA 2FYXA 2O67A 3TP2A 4A4JA 2FY1A 3EVOA 3TO8A 6FD1A 2VA3A 2E7VA 1FX4A 2KG1A 3DLLQ 5C25A 3P5BP 2ZBQA 2WOMA 1RP5A 5DDOC 1U1QA 2CPIA 4TVAB 4ZLPA 4WTOB 2OPRB 2AYEA 1S77D 2DGUA 4YR2A 2R7VA 3MZIA 4DR5J 5KG4A 4I56A 1IKWB 1ZPVA 1OYEA 4I64A 2UUWA 3QYYA 4C4WA 1NZ8A 3GG0A 2OPSA 3FEXB 2MZQA 1JXLA 3QAUA 1M5OC 3UD5A 4GKKF 2BM0A 1UEVA 3C15B 3O1LA 4KAIA 2JC0A 3DGPB 1RQ0A 4CYUA 3EVWA 2Z30B 4FS2A 4BC9A 2HYIB 2MQMA 2KYZA 1IKVB 1KVJA 1R43A 2O66A 5HBMA 1RT6B 4C48A 3D2WA 2AKWB 2C3PA 4CTAA 4PQUA 5A6PA 1KEKA 2OJ3A 4DV7F 5F8JA 2DGSA 2AGOA 4FKXA 2LXUA 3IP0A 4FS1A 3T1AA 1G2EA 3HULA 4PYDA 4MK8A 2R7QA 4IFVA 3I4HX 1D8YA 1KQGB 4C6AA 4ZITA 3K7RA 3RYLA 4Z7YA 1DFDA 2U2FA 2CPXA 2N7CA 4F3QA 2EFVA 3D6MB 2YX7A 3OTEA 2R7SA 2JLEA 4OI2A 4F67A 3PFOA 2H5EA 1PAEX 4NYZA 1JX4A 2R8JA 4Q2MA 3G86A 5L9XA 1NB2A 1NPKA 1MSWD 3GFYA 2K8GA 1FD8A 5DRKA 2VC0A 1R8CA 2BACA 3M9OB 1S99A 1W2BR 1QUVA 4FBUA 1T9TA 3LP0B 2CWXA 4IFYA 2DXFA 4CLPA 4WZMA 4ZVRB 3MMJA 1RT5B 4LVNP 3W2VA 2DR8A 2BEFA 4OJ3A 3BO2A 3J7A1 2FJEB 1BUXA 4O3RA 3PEJA 1VFJA 2HQCA 3HVAA 4QQBA 3B78A 1UFWA 3OR2A 3OT9A 4DPOA 5KG7A 2UV8G 4ECTA 3M8WA 4B9UA 4U7UD 4KGVB 4A8QA 4K4ZA 4TQSA 1S9EB 3HHDA 2KT2A 4LFCJ 1FRJA 1DLOA 3DLEA 5I3QA 3Q23A 2V8VA 2P8IA 1S6UA 4DQPA 4JI5F 1R6VA 3T6BA 1VK8A 4ZPVR 2MGZB 5HMYA 1U0SA 4USTA 3GIKA 2MY7A 4N8NA 4WFBQ 2YVSA 4QJVA 1RT2B 2AW0A 1EJ7L 4LMZA 2G0JA 2YNHB 2RU9A 3ZZTA 5T41A 1K44A 1RAOA 2LXFA 2Z2ZA 2DRDA 2CQ2A 3CWJA 5ETRA 2HWHA 2GVZB 1S59A 4PZVA 1CJKB 3CJRA 1I94F 3MUTP 3D66A 3D1QA 1JLFA 1HNWF 5J2QA 4DN9A 4X2BA 1R8AA 3I9ZA 1L5UA 4OI1A 3R27A 2JC1A 2XWYA 4JI2F 3I56S 2MKCA 2WSEC 3DLHA 1S7IA 4WKYA 4JYAJ 2QLFB 1SC3B 1FKOB 4LFBJ 5H9EJ 5CCLA 2K06A 2XZTB 5KT4A 5BJRA 1RA7A 3HLUA 3EZ5A 5FLXU 2V8HA 3MMBA 3SSSA 2CQ0A 1DAXA 3S01A 3G8TA 1JLEB 4WIQA 1V5IB 4RW7B 3W8GA 4KGXB 1PG5B 4P7TA 3U1LA 3QT6A 5LXYA 2B6AB 2GC8A 4BHQA 2QX0A 3G6YA 1WJ9A 5HMXA 3AA9A 2AYMA 1KVIA 4OV6A 3MAHA 3TJ8A 3T41A 1UTAA 2VG6A 3DMJB 1RABB 4DV6J 3GB0A 1S6PA 1S0OA 1SJQA 2BZ2A 3GILA 2H9ZA 3H2UB 3H8YA 3E8OA 2QLBB 1RTHB 5E3QA 2X1GA 1DZ5A 2DEIA 3MI7X 2B43A 5HROA 1VQPS 4ATNA 3Q2SC 1RWPB 4C8ZA 1TFYA 2QGFB 4DL6A 4ZN1A 3GV5B 3H4BA 1XNRF 4TU7A 8ATCB 4N41A 2VBYA 2DYAA 2E5LF 5L8RC 2B7BB 5CD4H 2GHWA 1JJHA 3QMQA 4D3GA 3VGTA 2GGPB 2XM3A 1HNZF 3C6UA 3PYDA 3O5TB 4PXBA 3LO3A 3CCJS 3P4UB 5AE3A 2B5JB 3ITHA 2XI3A 2HK3A 3AHPA 5FD1A 3FSIA 3T5LA 2HHXA 2W4DA 3SCKE 4RNFA 2CA9A 2MHEA 2J6TA 4DZ6A 1RCOB 1VRTB 3LF0A 3HHEA 1JB0C 4LRCA 3W9JA 1VQLS 2PO4A 3N6NA 3SCIE 3I0RA 4ZPBA 1JLGA 2KRRA 4CH0S 1SBRA 2F65A 3QWUA 4ZPCA 1HBUA 1DRZA 1NO8A 2LXIA 3J7YI 3M8ZA 1X4GA 4N56A 1RXOB 2IM2A 4X66F 3TQEA 3P49B 5HQMA 4WCEQ 1NSQA 2K3IA 4TN2A 3FFIA 5LT5A 2OLWA 4NCGA 4C8KA 4K4WA 2VC1A 2UZAA 2XTJP 3QLHB 1JQGA 4ZJOA 1RHQB 4OJHA 5KFCA 2UVWA 2XS7A 4USWA 1KFDA 4DR4J 1I51B 5KFJA 4CH7A 3CMAS 1MU2B 5KG1A 3T5HA 2R8KA 3MR2A 2QJ3A 3QJPA 1AB8A 2I0XA 1MROB 5KFBA 1YJTA 2BQUA 2AJ4A 2MKJA 4HDHA 4JI4J 3HO1A 3I55S 3HT0A 4DV3J 4ECXA 2QMXA 2DO4A 3KWMA 1T02A 2DRBA 3MDFA 4USIA 3M32B 5GVQA 2DNHA 1QAXA 2IAJA 3LP2A 5KFGA 1Q8IA 2J9DE 2K7KA 2PEBA 3CMQA 4YMEA 1F1BB 1HQ2A 5EDWA 1YBAA 3FUYA 2V69A 1PO6A 3AQOA 2QIFA 3OR1B 3G6ES 5JVHQ 1YZ6A 4FVMA 4H4OA 3I4PA 5J1PA 5HVGA 4NXNF 3BKTA 3CE8A 1UL3A 5IWAJ 1GXTA 2KHDA 3LGHA 3GJSB 5HVFA 4LF8J 2I2YA 5D4LA 2V8PA 4QPTA 1Y5LB 4DPWA 3KLHA 1GTHA 2MB0B 2C3MA 4X62F 2L9NA 1WDDA 2JEJA 4QCLA 2RH3A 4O0IA 1NUEA 2K7JA 1VQ4S 2GJFA 5GAGU 4K50A 4LSZB 2WK4A 3C6TA 2J7KA 3QNWB 4KE5A 2H51B 5HQ8A 1JLAA 4ANDA 1RAJA 3SCJE 2IA6A 4IRCA 2FC8A 2MZJA 2CNNB 3EUNA 2HVDA 4GVLA 4E8UA 2ZWOA 1TL3B 4IO1A 1HNXJ 3Q2TC 3ZNUA 2FVCA 5E7OB 1NK0A 4DFPA 4EI2A 2YWWA 1R8PA 1WHYA 3GJTB 3JAMY 3OL6A 1NJZA 5F8HA 2NXEA 1PC4A 2FTRA 3UE2A 3KLGB 4ZHRA 4DV5F 2WZ1A 4DI6A 1J5EJ 3ZNJ1 3G6XA 3J80U 3CJKA 3G6VA 2ERRA 3CJ4A 3M05A 5KFUA 4X4TA 3G71S 2OFGX 3CJ2A 2GA7A 2OHDA 2G4BA 2RRAA 4ZJQA 2KH9A 3UFCX 2CZ9A 2C1EB 1N33F 2KJWA 3K58A 2KL8A 4DPYA 1X9MA 4QIFA 4J9SA 4PG4A 4B3SJ 1ZETA 4NI2A 1DBDA 4DFJA 3D6HB 2WB1D 3PXGa 5M2PA 4DN0A 4AYBD 4JI7F 2AJ2A 3UI3A 4LSNB 1HR0J 2V4JA 1LWCA 4D3HA 2YKMB 4DZDA 4DS5A 3KNAA 1K0TA 4ZLJA 1RTJA 4KRWA 1TL5A 2KI2A 2M8DB 1EQMA 3MPUB 2W7PA 5F9LA 4LFAJ 2L48A 5DQIA 2HNDA 1HNVB 1RYSA 3IN5A 2MSTA 4PQAA 3PYGA 4TKTA 3VWSA 1FCAA 3DM2A 3OFEA 1KS2A 2HHHF 2ACMA 3S8SA 1M5PC 1BHNA 1X0FA 4Y3CA 1WC3A 3H4DA 4YP3A 3BPSP 9ATCB 3NBPA 4OHVA 1NSAA 3MD3A 5GAHI 5C25B 4F2SA 1T9YA 4HDGA 4K0KF 2H1YA 2H4WB 2LEPA 2WOMB 4HEA9 1OQ3A 3RB4A 1LKZA 4UUWA 5KFMA 1NH8A 5E5NA 1VQ8S 2CXEA 5T7LA 3JYTA 1PYTA 3AD7C 3TVKA 2OPSB 3BV8A 1FERA 4A48A 2AIRB 2GQCA 2FPHX 2DPIA 5KG5A 2VQEJ 3HZGA 3ENQA 2VPYB 1X31C 5L39A 4USKA 1IN0A 4YB6A 2KFYA 3RBEA 3GV8B 1TAUA 4CYUB 2J7WA 2IMWP 4I68A 4OZLA 3T1HJ 5KFHA 3AJ1A 3W2WA 2ZH9A 3V6KA 3D0IE 2C2KB 3LAKA 3HDSA 4A8KA 2ACYA 4WYWA 3MMCA 4CM0A 2XCPA 1FRHA 3IAM9 5HBMB 1V3ZA 4U96A 3AH6A 4ZLNA 4DR6J 4PQUB 2K2PA 1UVNA 4HI1A 5EWEA 2DNOA 2W25A 4IH7A 3U1NA 2BR0A 5HQLA 1XQIA 1HHSA 5BYQA 4IFVB 2A0FB 2FZGB 5EHHA 5A2QU 4U95A 1YJ9S 1LW0A 4OQJA 1OY9A 3VAHA 2NR0A 4CNZA 4LF1A 4F4KA 5D4OA 3R7SB 2ZBPA 4NLRA 2WVBA 5CZXA 1KC8T 1TMJA 4DL4A 4IDKB 2ADBA 4FXDA 4P2MA 3UD4P 2FZKB 2XY6A 1P9YA 3KOAA 1RAEB 2J0WA 3VF0B 2HHWA 1UAWA 1BD6A 1VJWA 4WZQA 4IFYB 1TKDA 3T19A 2NXNA 2KU7A 5KT7A 1B4SA 2DY1A 4C3MA 1YHQS 3DI6A 4RU9A 3OVAA 3W2VB 2COLA 5A0YA 1HNIA 3WIUA 1F5AA 1XMQJ 2R4FA 3RBZA 2QTWA 1UP1A 3BH6B 1U7LA 4CLSA 3PX4A 3K5OA 3OR2B 4B9MA 3QIDA 2WVCA 4AXIA 5IZHA 4FDFA 3W5XA 5D3GA 2DY9A 2ZWPA 2VOOA 2MZRA 1DLOB 4PG6A 3DLEB 5KT5A 4Q43A 5AJ3F 1GX6A 4OX8A 3LQVA 2RHQB 5HAOA 5F8NA 3CCLS 3H59A 1XJWB 4L74A 1DJ0A 1ULRA 3R7NB 1YI2S 5K8OA 3CF5Q 2CQCA 4ZVHA 1U0HA 5F8IA 1IWAA 2HIYA 1KR4A 5LXRA 5JJBA 5LMNJ 4KGMA 1IVZA 1Y3KA 3Q24A 3U7JA 2VKZG 3HD1A 4I69A 3OLAA 1U48A 1NJIT 3H5SA 2MKYA 3CCMS 1QVGR 3SSQA 4XDCA 1I1GA 5J2QB 3GP9A 1U6FA 5F3TA 2DNLA 3MHYA 5KFRA 2YNIA 5DGBA 1XR7A 3BH7B 1Q82T 3D67A 5E2QA 2FZCB 2OSRA 2P6SA 3I5BA 1RT1A 3GSDA 1FNOA 4KYZA 2IDLA 4CO2A 4YS2A 2ZH5A 2GJIA 2F5GA 2BE9B 3MMBB 2VICA 3AJDA 3QRQA 1O6XA 4OYAA 1WUUA 4DX5A 2FY8A 1ROFA 4E2FB 5D0RA 4JYAF 3CT9A 2ZJPQ 2V8DA 3ELHA 4LFBF 3NCQA 4LSLA 4NLQA 3ISZA 2CPZA 2HMIA 3F0NA 4B9NA 1E6VA 1TL7A 1C4CA 2VG6B 3MAAA 1S6PB 5C2GA 2EK1A 3VZHA 1SQFA 5DZ7A 4CCHA 4IOCQ 1WNEA 1VRQC 2OD6A 1F0XA 5HANA 3FJ2A 4TQRA 3NY0A 3V2UC 1DQAA 4OX9J 3QJLA 1BC6A 4RU2A 1NKCA 4JV2A 3DRPA 3OW2R 2WAQD 1D9AA 1E6YB 2EPIA 3MAQA 3ZFVA 3W66A 1N52B 4DV6F 4XDDA 5KT2A 3PJXA 1EB0A 3X3UA 3QQCD 4W90B 3BYPA 2QLJB 3CJSA 1CPZA 5FDLA 3UCUP 4DR1J 2Z58B 1VBKA 1H98A 3O6QA 1WOSA 2DD8S 2IM1A 3DDNA 2EFGA 3EMTA 1V3RA 3C6UB 2QC3A 2GMHA 1NLKL 4IYQA 2ROEA 4EBCA 3ITHB 3BZQA 3J7YU 3T3FA 5E3PA 4DL5A 3W8PA 2EBEA 4GVBA 4MYTA 1HBNA 3D54A 3HI9A 4R8UA 4DL7A 3IBCB 2BJEA 2OFHX 5HL7Q 3UO0A 3CCES 1R89A 2W1BA 3I0RB 3D1HA 2CNKB 4ZN3A 1JLGB 2V2VA 2NXCA 1PSDA 2IVMA 5U47A 1HBUB 3RRGA 3RRKA 1N32F 3NWRA 5D8HB 3V4MA 2MZTA 4LIWA 2PEHA 3CCSS 3V4IA 2M5YA 3FFIB 1VBYA 4NCGB 4C98A 3NOGA 5F8MA 7AT1B 2ATCB 3NAHA 2AT1B 4PG7A 4RUHA 3IS9A 2R7OA 2YX1A 4QOTA 3K5MA 2BYCA 1U8SA 1UW9A 3D3BJ 4LBPA 1FVQA 4HL9A 3EYZA 1NK6A 3GV7B 3ZZRA 2CQ1A 4YDXA 3UCGA 1OPIA 2L9WA 4Y2MA 4I2PA 2W9BA 1CJUA 2C3OA 2VG7A 2F9JA 2XS2A 1B7YB 3JQJA 2PC6A 4YN3B 2BJDA 2HRUA 2VFTA 4RW8A 1M1GA 4DLGA 5JVGQ 4EEYA 1S10A 3SCLE 1VBZA 4DR4F 4BC7A 1MNEA 2W2PP 2BANA 1PILA 3G4SS 1ZM4A 4Q8FA 2FHMA 3BF4A 2IAJB 2CPFA 1YITS 3LP2B 3CUNA 2BMBA 3CMES 2J9DA 2QN6B 4C8YA 3JTPA 4QR0A 4L73A 4J9UE 4J9LA 4C3LA 2L08A 4DV3F 2EBGA 1WG4A 5J2NA 2QA4G 4FYDA 1S5ZA 1AROP 5F41A 4H4OB 2BQ3A 2BW7A 2V8GA 1X4CA 1N34J 2VG5A 1KWMA 2R9LA 1AXQA 4ZPTR 2CIMA 2ASJA 2E1MC 4ECYA 1U4BA 1WORA 3KLHB 3TUIC 2AEFA 5B0GA 4DL0C 2Y8YA 2HQ3A 2U1AA 3SYZA 2Z2YB 1R8HA 4OHYA 3IFEA 1X4EA 5IWAF 4NLGA 2RDDA 4V1Ak 1VLYA 3C6TB 3P3DA 2AYGA 2BXJA 4EK2A 5E3AA 3LGNA 3I31A 1JLAB 1M0SA 2E9RX 5HATA 2UXBF 3RBXA 1Q81T 4QWBA 1F2GA 1WHVA 5KFIA 3AT1B 2DH7A 3FZ2A 5F8GA 4A47A 2Z8QA 7FDRA 3DKDA 3GSIA 4QWEA 1TELA 1XR5A 2CQ4A 1FDBA 3I5CA 3PHEA 4CLFA 4DUYJ 2GIRA 1REVA 1EIYB 4ZHRB 1TKTA 1XTZA 4OMFG 1JKHA 2XB2D 1QE1A 1BE4A 4CO1A 2QE5A 3M2VA 3CJKB 1EP4A 1TMMA 1U2RA 1HNXF 4ZP7A 2CQPA 1GMUA 4NRTA 1H73A 2W7OA 1YGYA 3BSCA 1KSPA 3P5TL 1I6JA 2FVPA 4F4WA 1M5KC 1RBLA 4MK9A 3D68A 4Z7CA 4MKYA 2O1PA 2MQQA 1J5EF 4NI2B 1H0HB 4I4BA 3K5NA 5KG2A 3G82A 5A8RA 5KFQA 3ZZZA 1TL1A 4KB7A 3WX4A 2V4JB 1VISA 1LWCB 1F9EB 5B0EA 5GAHU 1SCJB 3ZO7A 1NK7A 4FXWA 2DTJA 2HNDB 1GX5A 4B3SF 2NS1B 1U2CA 2GCFA 4X64J 2E5JA 1P9QC 3DM2B 3UN2A 1SV5A 2Y1RI 3B4DA 2WRMA 4B9TA 1IJFB 3HSDA 4KT0C 1LXNA 5H1SV 1X7VA 4OYZA 3R97A 1CC7A 1IBLJ 2CVIA 4ANEA 4LFAF 2BVZA 3FBFA 4H4KC 4H4KA 4B9SA 5L38A 3M8SA 2WBMA 3CNQP 3D0HE 2ZD1A 1S72S 1X8DA 2FJAB 2X1FA 3NNHA 4WP9A 4RNMA 2RDIA 2VUGA 2HGNA 3ZTQA 3JYTB 4HH1A 3QFHA 2H5IB 2CQGA 4JV5J 4DOZA 1S7HA 2LVWA 4AT1B 5ETSA 5K20B 3PR5B 4HHJA 4WFXA 1B0VA 2HZAA 4HT7A 2HQIA 2N3LA 3W2WB 2KJVA 2B4VA 5M2RA 3GYXB 2BKPA 4Q5VA 3MMCB 2HBYB 1T11A 1HI8A 2XHWA 1IR1A 3LGMA 5B0CA 2LEAA 3MOJB 2BKNA 3T5JA 2XMTA 4ZPWR 2YNGA 4UT4A 5HO4A 1GMWA 2DNYA 1YVFA 1RWOB 3M30A 3H2VE 1RAHB 3HFZB 3T1HF 4B3MJ 2NZCA 1NEEA 1RTDB 3CDUA 4LBHA 1QJHA 2FHJD 3GJRB 1GAOA 4DR3J 2BJ3A 1LW0B 1JNZB 5CHCB 2R3VA 3KNGA 1L3UA 1VI7A 1Q79A 3A4TA 4DR6F 4AUKA 4DQRA 2M88A 2IM0A 1S1WA 4B3TF 3UDLA 3RAMA 1JLBA 1HWLA 2VB6A 4WU2A 3TVYA 5A2QY 2MQ8A 2NREA 1F6TA 4XPEA 3H5YA 1HYSA 2AQ4A 1LWFA 5IT9Y 3UDVA 4ZOSA 3K5PA 2ZH6A 2XG8A 4YHHJ 1FRLA 1ZAWA 4FF2A 3CC4S 3TAQA 2FJVA 2IBOA 3LALA 5EX0A 2XGQA 4I67A 1NKEA 4J37A 5A0YB 4JI6J 5G4DA 1JXVA 3VTIA 4G65A 3ZTPA 5D6GA 2Y1JA 4DPXA 1UPPA 1V6HA 4MT1A 4PWWA 2R8GA 3BGLA 2JVOA 1UW4A 5C7PA 3PW2A 1VQYA 2HWTA 5D3GB 1SJFA 3CEDA 4TY8B 4DV2J 2FVRA 4OZ2A 1ZTTA 3MM5A 1S4EA 1IXKA 4LR8A 2JH3A 1ZYQA 2YWGA 4LUBA 2AP6A 4F4ZA 1F5CA 3ZZOA 3MGJA 3G96A 1YTYA 2GAGC 3TRGA 1QAJA 2NXUA 1A9NB 2IVFB 1SXLA 4NWBA 1TUWA 4M5DA 1U0HB 4DU8A 3TX0A 4OYWA 3DOKA 3LPYA 4IH6A 4Y2IA 1WKKA 5LL6d 3D9BA 2DITA 4YB5A 4F04B 3HKWA 4OFZA 1SKSA 1LOUA 1R6YA 2A6MA 1SL2A 1VQ9S 4UOHA 1Y00A 1AFIA 2OKQA 1RGVA 3D4JA 2M4MA 1N36J 3TZXA 2YNFA 1WC4A 4HACA 2PSZA 5J1NA 4QR1A 4C8MA 4P75A 5IM0A 1PGZA 5HJXA 1OJ4A 2YNIB 5IQQA 3ADAC 2CG4A 4CT9A 3KUEA 4KBIA 3NXZA 2PA8D 1RT1B 2J0SD 3MEKA 4U8YA 3L4BC 4URSA 3OQ2A 2VOPA 1X4AA 3TJ9A 4XO0A 4RNOA 2F3JA 1TK5A 1C0UA 3I9V9 1DURA 3ILOA 5GMDA 2VDIA 4M5JA 3THTA 1RHMB 3I6PA 3Q8YA 3GLJA 5F0WA 1C4AA 2MQLA 1RLCL 2XMAA 3GIRA 3MCNA 2Y8WA 2UUCJ 5BR8J 2K1RA 4Y0FA 3PIPQ 4Y00A 2UVRA 1UVLA 3N4WA 4LSLB 5GAEU 3PFEA 2MTLA 3HHKA 2GHPA 2HMIB 2AEMA 1L3KA 1E6VB 2CADA 4O23A 4FF1A 3MAAB 1C0TA 3T9NA 4K4VA 1NJWA 3KG1A 2AYBA 4ES3A 2YKQA 2OGUA 3N5FA 1N88A 4ZIVA 3GYNA 2V9KA 3PNIA 2VASA 2RQMA 2WHOA 4J9NA 4IOAQ 2RILA 2C2ZB 1H72C 4TYBA 1BMQB 3DRPB 4LRBA 5KFOA 4K4SA 3VAJA 1WG1A 4ZP8A 4ZCLA 2JLGA 4NA1A 3HHLC 3HHLA 4X4VA 3QAEA 2R42A 2MXYA 1QLNA 3TYTA 2DGXA 1TL4A 3IBFB 5FDLB 1S9GB 1NDLA 2OEMA 4CO0A 2VBZA 4Y65A 1R7IA 1LFWA 4B3RJ 3MECB 4ALZA 2DH8A 3DHWC 4WPAA 2YX4A 2XULA 5D78A 3MEDB 3MCSA 3TZYA 4UW2A 4AL6A 1J5OB 4O0NA 2ZM6J 3B6BA 3IWLA 4N77A 3CW2C 4UOFA 2JRSA 3CJ8A 2PD1A 4GVBB 3OLBA 4R8UB 2RS2A 4O3OA 4HHHA 3AOCA 3L3CA 4OZ1A 4DR1F 2D3OR 4FYWB 4V19J 3IGVA 2N4DA 5HVHA 5CA5A 4CLYA 3MM9A 5MLCV 3EVMA 4NXMF 2RUGA 2FC9A 3NGTA 3KMSA 4ETXA 3CO0P 2EKYA 1PBUA 2H48B 2G13A 4MJKA 4DSEA 2B51A 2FDNA 4F0HA 3V4IB 5MAOA 2A2CA 2XLJA 1HKAA 2VD3A 3CCQS 1V9OA 3AB2B 4XIUA 5F3ZA 4AQYJ 3UCZP 4ZJLA 4ID8A 3IS9B 2QEXS 2MKSA 2W2NP 2V67A 4R5PA 1HHQA 1SC1B 4FYXB 2FB0A 5EWFA 3KLEA 1YSJA 4X65J 3HSZA 1REGX 2PI4A 2DHHA 2E7XA 2ALZA 4I2PB 4HT5A 3OHAA 1ZZNA 2VG7B 3FNNA 4IQXA 1OSDA 1UFLA 2DVIA 4DV4J 3MMAA 4RW8B 2ALYB 3UQSA 3LANA 4LR7A 3MPDA 2J0XA 2VJUA 1VQOS 4Q8EA 2BANB 1HMVA 5KG0A 1EAYC 4HLBA 2XQCA 1WSVA 4CLLA 1OSCA 1C1BA 2ZBIA 4I2QA 1Y10A 3LUYA 3ICLA 3N9UC 3IBWA 5G0RB 4FYYB 2HHQA 5CYQA 4DUZJ 2MQOA 2SXLA 5AE2A 1BQXA 4AL5A 5J2NB 3Q8UA 1GTEA 2KXHA 1RZMA 2C2NA 1DTQA 2FUG9 3TUJC 3F44A 1SKRA 3HKZD 3WC0A 3CIZA 2M70A 1KRPA 2IPOB 4IRKA 4WJBA 3VQTA 1KTVA 2UVUA 1XMOJ 2FLNA 2B9YA 1FTRA 2DGQA 4R0EA 2X1BA 4JI8F 1LNQA 3SQGA 3BGRA 3OTOF 5DGAA 2H54B 3CD5A 2KZMA 4C0HA 1VRUB 1EZZB 4DHVA 3NGKA 4J90A 4F0MA 2CPHA 2OUGA 5D0EA 2EFQA 2AJQA 4OX7A 2NZ4A 3GR0A 1WOOA 3H2LA 4ZCMA 2HRYA 1DQ9A 2OP5A 1D0EA 1TQLA 3CJTA 5ETPA 3VV2B 1XK8A 3KJFB 2R7WA 2CRLA 4DSFA 4ILRA 1REVB 2ZH1A 1XWLA 2IRUA 3AXKA 4KHMA 4F3OA 4DX7A 4LF4J 2EC0A 4YUDA 1JKHB 3PJWA 3M2VB 3PG9A 4CIOA 1IBMJ 4OJ1A 2B56A 1EP4B 3MM8B 3DC2A 3M8QA 5I3UA 1MN7A 2H3EB 4NL5A 3WDOA 3DLJA 1S6QB 3FK4A 2HGLA 4QYZJ 1HW8A 4DUYF 4IRDA 3K89A 1FFWB 2Q79A 1VJQA 3TEHB 2F63A 4YEAA 4NLPA 5KG6A 1W25A 1Y9OA 2W9AA 4LF7J 3MPVA 2WONA 2VDHA 2XLIA 2VKRA 4ZMMA 3VHQA 4ZLLA 3UPFA 2OMOA 4N8OA 3PW5A 3EPGA 3G82B 3M9MB 4WFZA 5A8RB 3HHLD 1M90T 1TL1B 4IKAA 3U1MA 2I9SA 1OY8A 4M8LA 3GFZA 1VMBA 3LH2S 5GAGI 4DCOB 4U67Q 3G8QA 3NG8A 3MD1A 2NYHA 3QIPB 1N6QA 2POKA 1FWKA 1RI7A 3NMAA 4MFBA 3FCHA 5C2CA 1K47A 5LMUF 2XMUA 2HQDA 3FGVA 1SV5B 1ITPA 4JI3J 1N5YA 2ZJRQ 3FQLA 5D0GA 2BW2A 1EKSA 1PAUB 2N3OA 5KFDA 2GMLA 3CXCR 4RR5A 4Z37A 1X5TA 2QZ8A 5KFLA 4DX8H 1Y5IB 1RKIA 1D09B 3OXLA 3HJVA 1P6TA 3AFGA 3TUPA 4DV0J 2ZVIA 1LWXA 4EZ6A 1RLDA 2BOAA 3CVKA 4HTJA 3N6LA 2KVQE 1BQMA 1FHTA 4O4GA 2E5IA 3EICA 3BEGB 1M5VC 1S1XA 1T0TV 2J6SA 4KH0B 3ZTRA 4K4YA 1X5PA 5EN1A 4QR2A 2FVSA 3FMWA 1IBLF 1MWZA 5B08A 1AT1B 2V6AA 1FFSB 3FKBA 3FSXA 3DN9A 2HW3A 2RF2A 5L1JA 1CS4A 2ZE2A 4DBQA 4NCBA 2BABA 2XYGB 2IJRA 4NLTA 4PG8A 1S12A 3MFHA 4EU0A 3K8WA 1KDNA 3HM9A 1SJ3P 2LKZA 5GMEA 5DDQC 4RPFA 3RB3A 3OV7A 2GIFA 3NS6A 3BDPA 2RDJA 3VQSA 2YNGB 2YQ1A 2DHXA 4ZA1A 4DR2J 2MPUA 1U6ZA 2OPPA 3G87A 3M30B 3M8RA 4FNIA 4KFBA 4ZVTB 4M5NA 2NPFA 1RAIB 3B4MA 1T03A 1B3TA 3W62A 5AXKA 2VFUA 3FC9A 5AT1B 1LK7A 2ZVSA 2MKHA 4YOEA 1U1MA 3CDEA 1HFEL 1YKWA 3EWGA 1G1XA 2CJ9A 1FRXA 2AWZA 1JLBB 2WCXA 1FJEB 2EG1A 2ZJQQ 3QGGA 4KGZB 1HD1A 2C2EA 4ER8A 3TZWA 2ILZA 5E0OA 2BJ7A 4B3OA 1HYSB 2KYXA 3HJFA 3H90A 2XMMA 4Q0BA 3KHRA 3M8YA 5AE1A 3MM6A 2G0CA 2A1BA 3M6UA 1X0PA 3PKYA 5D15A 3K0JA 4MKBA 4NEYA 3BREA 4IR9A 1Z2LA 2AHOB 2ZKTA 2BJ8A 2UVVA 1WACA 2HGMA 3H25A 1L3TA 3HVRA 4O4RA 1T94A 1KLMA 4KY3A 3J7Z5 2HHVA 3UNYA 4UY8T 1ZM3A 4YHHF 2R8HA 1MMLA 2HZCA 1NB7A 4WBFA 2OIHA 3MOZA 1XN9A 3MM5B 2W8KA 4KHPF 4ID5B 2XBPA 1RT3A 4JI6F 2W01A 3ZZUA 3Q0AA 4NZ7A 2CFXA 4BCAA 4K8RA 2HHPA 4RKUC 3JS9A 1NAQA 1U1OA 3D7SB 2F7VA 2WVFA 4J5OA 4FBTA 1T9XA 5CYMA 2XCAA 1KLNA 1SPBP 2F9DA 3ILJA 4C0BA 4RBUA 4QU6A 5SUHA 3M2RA 1LW2A 3S7RA 4DV2F 3AQPA 5GADU 1FD2A 2OTLS 2LDIA 3GQCA 1SJ4P 4J9RA 8AT1B 2ZH4A 4GO7X 5KOWA 1KHWA 3KDOA 4CLUA 1YRUA 3RG6A 2FGOA 4QYRA 3PW4A 3RW6A 2XSJA 1IKWA 4ECWA 4OLOA 1BXNA 3MEEA 3C3LA 1AZSA 2YNFB 4HACB 3OFHA 1ZAXA 1X5OA 1OQ6A 2VZ9A 1LK5A 4B08A 1CULA 3QSIA 1WEZA 3TR5A 2YXLA 4EYHB 3BGFA 3IWNC 4CO5A 2LP4A 4DV7J 1RE1B 2HPUA 2ZOFA 4CDIA 1PYSB 4OYPA 1VIXA 2DGVA 2HVHA 3MFIA 1FXRA 4Q44A 1YBUA 4A8XA 1C0UB 4KQZA 4OI3A 1N36F 3J7ZT 2A2DA 1HARA 1UA1A 1I5OB 1P8GA 4NEZA 2KT3A 1IKVA 4WF9Q 2EK6A 3AD8C 5EX3A 2C28A 2PE8A 3KDNA 2B3TB 2BM1A 2K3KA 3BDEA 2BBEA 3ZZ0A 2ZC4A 2K1RB 2LU2A 4FXVA 1W2IA 1VHFA 2QV6A 4BDPA 3NAIA 2OI2A 3GFHA 1WOPA 1C0TB 5KFPA 3DDIA 4LT6A 4HI2A 4C11A 4A46A 3QT5A 4K2JA 2QT7A 1GT8A 1JK9B 5ITHA 2UUCF 5THWA 5BR8F 3MCMA 3FEYB 2OAUA 3OBIA 1WI6A 1QUPA 3CCWA 3QZ8A 4KKOA 1SUQA 2ZDOA 2B9EA 3CIMA 1TVRB 4HKQA 2M52A 4FZVA 1N5QA 2HKEA 3HHLB 4FVCA 2R7TA 2NCKL 3CJ5A 5HLFA 3BBFA 4QW9A 2V34A 4UQTA 3GONA 3K5LA 4TY9A 4DFKA 1R0BG 5DM7Q 1NSKL 1P27B 3I87A 3VGSA 2MYFA 3SDEA 2UU9J 3JTOA 2GQ2A 1KFSA 1DHMA 3KK2A 4AL7A 1YZ7A 2IJFA 2VONA 4L75A 4IG3A 2WW8A 1OMSA 3MPWA 1BWEA 4WK1A 3GTYX 5SZTA 4DG1A 2RMLA 4ZCIA 3H20A 1HIYA 2VBWA 3N01A 1B70B 1G3OA 5E3RA 4B3RF 3IRWP 3MM9B 2YKAA 4L3NA 2QMWA 4KIAA 3TA1A 1BLUA 1Q4RA 1VQKS 3TUZC 3W60A 4O3PA 4OI4A 2D3O1 4NLSA 2W4PA 3TX8A 3FBEA 1GXLA 2MGZA 4WIIA 4JI0J 4K5RA 1I94J 3UWTA 1HWKA 3CULA 1CBKA 3HPOA 2CKWA 1FTCA 4ELVA 5IV4A 2E66A 2M3DA 3A8IA 4NZ0A 5J2PA 2OO4A 4R5PB 4JI2J 3PIOQ 4NLXA 4O44A 4HHUA 2F8HA 1HW9A 1Q95G 3KLEB 4KPYA 2YWEA 4JV1A 3M4XA 2BKOA 4OZNA 1CJKA 4OZJA 2JNJA 3C46A 1RKJA 1Z2ZA 2LECA 1IR0A 4Y2CA 5K9FA 2OELA 1AYEA 2YH0A 5CQGA 3MMAB 3BYRA 3POTA 1U49A 3PYFA 2QSFA 4X65F 5I42A 3QGIA 3CCUS 1R0CB 2JSXA 1X5SA 1HMVB 2BRLA 1YQHA 2GJ2A 1C1BB 1T05A 4I2QB 5KFWA 1FVSA 4ZVSB 1IUJA 2OPQA 4DV4F 4RW7A 5CYQB 4GMKA 3JQMA 3WQPA 1S0MA 3B8HA 2HIQA 2DGWA 4CH1A 1U8WA 3DDKA 4L72B 3T6JA 4ILMA 3UR3C 2IM3A 3OUYB 1SJ1A 1K73T 2C3UA 4DUZF 2F4VF 4A8MP 1MWYA 3PRBA 5JUMA 3PX6A 2UXCF 2E5LJ 3VAKA 4P2FA 5A8KA 1SC4B 2B0GA 4N47A 3LA0A 2R2UA 3SQGB 3IR5B 3BGRB 2D9OA 1HNZJ 1ELOA 1WEXA 2R8IA 4ZVFA 2CJKA 4TLQA 1T9VA 1V5VA 3R2CJ 2RS8A 2GO8A 2D7SA 1VOMA 3N6MA 2ZZTA 4PWDA 2M9KA 3V81B 2IYIA 4F8RA 1VHIA 1EKRA 2WTFA 2NQPA 1V3SA 3QFWA 3KHGA 2EEYA 2HFUA 2CG8A 1N4LA 2MJUA 1Y5NB 2AX0A 3BKFA 4H4MA 5D4PA 1NHKL 3P45B 2Y1IA 4P7VA 4RW6A 1WC6A 1HHTP 1FA0A 3O2IA 4ITSA 1RUSA 2XYPB 3M6VA 4X66J 3ETMA 1SH3A 3SZ2A 1WHXA 4KHRA 3ZZYA 3L95X 2HAFA 2MZSA 3M8QB 5I3UB 1AUDA 2IRXA 3CPWR 3A3OB 4W98A 2NXJA 3ZZPA 2EFPA 2P6TA 3BSAA 3T9ZA 1BQNA 2DNQA 4GC6A 1D9FA 3M2UA 1RAFB 3DXBA 4LF4F 3QJJA 3VZIA 4NX9A 1O51A 3W61A 2WONB 5I3PA 2KM8C 4CRJA 2AV5A 5ETOA 3PW0A 3FBCA 1YIJS 1NMEB 3DYAA 1N54B 1UVIA 3BSOA 3QZ7A 2MMYA 2GO9A 2M7SA 5LSRA 4I6YA 4EGLA 1N6QB 3P96A 4MFBB 3UVJB 2NPIA 2V4RA 2R7XA 1ZM9A 2CPEA 5B7WA 3J7AN 2Q1LA 3KLFA 1N5YB 3PO5A 2LFVA 3UNGC 2RE1A 1TUGB 4RO0A 3C16B 3KTQA 2HNYA 2VBXA 2YQ0A 2Z4PA 4LF5J 1FF2A 5DDRC 2LYVA 4NXNJ 4KV8A 1Q8BA 1BQMB 3MR5A 3CCVS 4UOCA 2YH1A 3D1OA 4JI3F 2OSQA 1S1XB 4W92B 3F56A 3DLKA 1NCLA 4HTIA 1HQUA 2EVZA 2WVDA 3AB4B 4X62J 2RQKA 3DU5A 5B0DA 2OH2A 4WYLA 2QL5B 3PJ9A 1AA1B 1LWEB 4HR2A 3MTKA 2RF2B 1PBAA 1RTZA 3DFEA 2ZE2B 3M9NB 1RBAA 3PW7A 2MHNA 4LR9A 2NUUG 2D1CA 1XEZA 1FNXH 2CNLB 3KUGA 4RUAA 4QW8A 2V4QA 4OHXA 3ZXWA 2VQFJ 5E41A 4J91A 3TAPA 4EYIB 2KO1A 4MYUA 1VC0A 4KR0B 1XNQF 3VGUA 2GV1A 4NOHA 2DNZA 4DPUA 2YTCA 2QSWA 1CC8A 3PKMA 3I0SA 3H98A 4KFBB 4NYOA 4J9QA 1QY7A 3IRXA 1VC6A 3RW7A 5KFZA 2AD9A 1UFKA 3O44A 1T03B 2ZH3A 4J9MA 4NA2A 5CABA 2RKIA 1TL3A 3DOLA 5C42A 4DR2F 1N5SA 4MK7A 1RU1A 5H9EK 4PYAA 3ULHA 4PXCA 5C5JA 4TYAA 2X3GA 1H2VZ 4I1TA 3RAXA 4BWMA 4DR5F 1IKYA 2BE2A 2IYGA 4B3OB 4QU7A 1NHUA 1SH2A 2HRTA 3WZ0A 2MJNA 4USHA 4ZDNA 3Q8SB 4Q0BB 5KFVA 4FYVB 4ETZA 2RAQA 4CTAB 1GQEA 2HHSA 3MM6B 1ACMB 4CQ1A 1H38A 1NH7A 5HN0A 3BR9A 3DCAA 4PXEA 1ZH5A 1ZM2A 4NYPA 2MKKA 3SFUA 4HH0A 5DQGA 1BWVA 2JDJA 3LP1A 1KLMB 2CPJA 1YJUA 5LJ5Y 2JOQA 1FFGB 4YB1P 2J0QD 3GZ7A 1ZPWX 4L76A 2HNZA 5IT9U 1YJNS 2LQJA 1QAIA 5CAAA 2M8HA 3A8KA 3WHIA 1U26A 4PPDA 2HS0A 3ZTOA 1W26A 4WXOA 1P1TA 1KONA 1FJ7A 1RT4A 3OL7A 1RT3B 3KJNB 3NS5A 2IY5B 2IA0A 2FVQA 5DDPC 2ZZNA 3IAS9 3NMRA 5CD4A 4CLWA 1Q53A 5DJBA 3SIPB 1QDUB 1C1CA 2DHAA 4IQMA 5CYMB 4GRSA 3BQ0A 1NK5A 5DLGA 4M5GA 4CM2A 2RT3A 3M2RB 5CCMA 1LW2B 2AZ3A 4ES2A 2QL9B 2V2KA 1TU0B 4ECVA 3KLIA 3CJQA 1TFWA 5K8PA 2ZOMA 4G6VB 5D77A 2XSJB 4PCQA 1G7CB 2C2RA 3MEEB 4N5SA 1AZSB 3ILIA 1CULB 1B64A 3L7PA 4FNHA 1Y7PA 2G2OA 4YQWA 2HHUA 3H5XA 4C8NA 3R5CA 3VVUA 1M5HA 2HURA 1GEHA 1SB6A 2N7YA 3RB6A 3IR6B 1SJRA 3UW1A 2HVZA 3OL9A 5IQ6A 4B9VA 1L3VA 3NNCA 5IT4A 3S6EA 2FJWA 3PEHA 2XY7A 3QWPA 3AY0A 5KFFA 3MR7A 4LFCF 4OV1A 1F3FA 1FI4A 4YDDB 2WW4A 3HF5A 1R27B 1SL0A 4GO5X 3NP5A 4ERDA 2QA2A 2GX8A 3OFGA 3UN5A 1U2FA 4A8YA 4MIWA 2X3DA 2WSCC 3NGRA 3KFWX 1YJRA 2B7CB 4J9OA 1YJWS 3U27A 1JLFB 3EZUA 1JLQA 2ZBCA 5CXTA 2PDAA 4ZPDA 2KFZA 2RHSB 4M5KA 2J5AA 4C11B 1WD6A 4QWAA 3BS9A 4UQGA 3OVSA 5DQHA 2DRAA 3N0VA 1UEUA 5B0BA 3LTOA 3HFVA 2DT9A 4C97A 1CVJA 4USUA 3PACA 5EUHA 5H9FK 1GK8A 2Q3PA 4KKOB 1VC5A 2GS8A 1SUQB 4ZS6A 4NZ6A 4X4QA 3EM1A 4IDKA 2HFNA 2M2BA 3T1YJ 1H74A 2E1RA 2HEKA 5HLFB 2BV3A 3PR4A 2VPWB 2DGTA 2FJXA 2PMHA 3K17A 4JV0A 1T7PA 1U09A 1X4HA 4U7CA 2JEFA 1TUVA 3SDEB 3THPA 1NSPA 3KK2B 4GKJJ 3P8BB 4WE1A 5AJ3J 4NCAA 2MLZA 2MQNA 4RW9A 3TAMA 4IG3B 1SIZA 5K14A 2ZZMA 5BYRA 2DNPA 3HZEA 5ETQA 4K4UA 4J9VA 4DG1B 3KHLA 2YPZA 3IMQJ 2BRKA 3MCOA 2RNEA 1FDNA 1IQTA 5DO2A 2WSFC 5E3CA 4ILLA 5HROB 2ZNYA 1RHRB 3L7OA 4RNHA 1B0TA 2UU9F 1HPZA 5GAEI 2XYHB 2OMLA 1UVJA 3NGDA 1LQ9A 3I5AA 2CYYA 3GCWP 1WF0A 3QRPA 3RUBL 2P9CA 1VQSA 1VGYA 5KFKA 2NSBA 1RA6A 3NS7B 1JWWA 2AJ0A 1S76D 2CZVC 1TK8A 1FWLA 5IFMA 3SEOA 1VQNS 4ED7A 2L41A 2AJ1A 1AFJA 5J2PB 3AJ2A 2G9OA 2B9WA 4O44B 2AX1A 1YJ7A 4K59A 4PR6A 4CNYA 1S1UA 1FE0A 3MUMP 4K4TA 4JI0F 4Y28C 1IJEB 3TANA 3OTBA 2BOPA 1F5BA 4RX6A 2MSSA 1EX8A 1UKUA 4DQQA 3R7BB 2KFNA 3TARA 2ROPA 2ROGA 5L9NA 3POTB 3HVTA 5D0HA 5I42B 1WWHA 4DSIA 3I96A 2GIQA 4DR7J 2XNQA 1A6LA 2R7UA 1T05B 3GMGA 3PY8A 3BN4A 3QT7A 1KQSR 4WWSA 1U47A 4YY3J 2OPQB 2Z56B 3KG4A 5RUBA 3KJVA 1RT7A 1J27A 4ES1A 5B09A 2UP1A 4DF4A 3PV8A 3GIJA 2H4YB 4K4XA 2O3DA 5KFXA 1WF2A 2VA2A 4F4YA 2ZBRA 2DHGA 3R9LA 4OHWA 2YWKA 2KB2A 1ZOTA 4AD6A 2YBVA 1RWKB 4DS4A 1IKXA 5KT6A 4EFAC 4J9KA 3EXYA 2Y3YA 1NKBA 3A8JA 1JLCA 2DPJA 2CJQA 2R2RA 2GZOA 4IO9Q 5LSOA 2XZWA 2DNNA 5A8KB 2QYGA 4P9SA 3CGIA 4DPTA 2JFKA 2XO7A 4ZPAA 4M94A 2IDEA 2CDRB 1E6YA 5CZVA 4PWDB 4RNNA 1OWXA 4AFFA 4JI4F 1H7XA 3Q83A 3K8VA 3MURP 3DNCA 1Q5VA 3HCXA 2MZ1A 1F9HA 3OSNA 3M6XA 3IG1A 3L9ZA 3R1LA 4H4MB 1WC5A 3QGHA 3JSRA 3JSBA 4RW6B 3HK2A 2FHOB 5IC6B 1N32J 2BA9A 3OD2A 3NCRA 4LQ9A 1NK8A 2LQBA 1VQ5S 4WP3A 5K5MA 4OYXA 3F73A 4NRUA 1MLAA 3FZBA 2HK2A 2JFDA 1PCAA 3QT8A 2KG0A 4OHZA 1VBXA 1HLWA 3NNAA 3MXHP 1BQNB 3PM9A 2IVYA 3BKUA 4N7TA 5KTQA 3VAFA 4LF8F 4WFYA 3M2UB 3BJYA 1BGXT 2QA1A 4JUZA 3DLGA 2EFNA 3C19A 2JEGA 4X4PA 1UZHA 2D41A 3IXQA 2ZH7A 3BBBA 2KM8B 5L46A 4LF2A 3BM7A 3BO3A 3CCZA 3M1VA 1DQ8A 1A7GE 3DYAB 1VK3A 3Q8VA 1U6BA 1JMTA 3VAIA 4J9PA 1Q7LB 4EBEA 3V6HA 2A3JA 2XMKA 3QGPA 4TLRA 3PRDA 3RB0A 1KHVA 3KLFB 4A8SA 4G3IA 5HP1A 1GNKA 2RVJA 1CJVA 3GIMA 2KN4A 1F60B 1K1QA 3KYLA 3S1TA 4USVA 2IIHA 1QSYA 2DNGA 1HBOA 4P2XA 4LREA 2HNYB 1URRA 2ZOGA 3DOMA 3T5KA 4KV8B 5H9FJ 4EZ9A 4ECZA 3R5AA 4ZVPB 4RW4A 1QD1A 1WEYA 2FJDB 2F40A 2VFRA 4QWDA 1IBCB 3DLKB 3PRVA 3DLBA 1UWBA 3W7BA 1RTJB 1HQUB 5FJ4A 1RWUA 3BN7A 1FO1A 2DISA 4DV1J 3FRYA 2GQQA 1HI0P 4LF6J 1UZDA 4LQ3A 4LF5F 1U1KA 3BGOP 3DHXA 3GU0A 1H2UX 2CDQA 4OZ5A 1HR0F 2UXBJ 1CSJA 1WSRA 1RISA 3NBPB 3Q89A 5J2MA 2ASLA 4F7VA 2OD4A 1MMDA 4M1KA 3EGVA 4WFAQ 2HZVA 4X4UA 3R5BA 4OI0A 5KFSA 5KAKA 2Y9HA 4GC7A 2GHVC 2CJXB 3NEKA 3HVWA 1QSSA 2V63A 2B4OA 3I0SB 2NYIA 3IR7B 3IRXB 2F1FA 1RADB 4QPXA 1FJGJ 3UDEA 5T7LB 2AF6A 2VQFF 3MTJA 2Y1LB 4X84A 1ZTWA 2RKIB 5L1KA 3DOLB 1JJCB 5C42B 3MF5A 2V2QA 3AAWB 1SI9A 3KJQB 5EGYA 4E0DA 3PO4A 1GMVA 4Y6IA 3WIVA 1TK0A 3BQ2A 1IKYB 2WBRA 2BE2B 4MH8A 3E01A 1O5JA 4ENOA 2E1AA 2JL9A 2FJBB 3IM9A 2VQEF 2AEJA 3MUVP 5ETVA 5K8NA 2YWFA 1N8RT 5JXSA 2FHKA 4HYKA 2GVDA 1PKUA 4DLEA 3SMZA 4OIXA 2BUNA 3C66A 3TWZA 1UA0A 2CUYA 2MY8A 3F41A 2EI5A 1WTBA 3LP1B 3ZC4A 3LAMA 2DR5A 2NUHA 2HNZB 2L9DA 3CD0A 1S57A 2E9ZA 1T95A 2CQBA 1HI1A 5AXMA 1FT8A 1RSCA 1RT4B 4U6PA 4ZIWA 3A12A 3KUHA 3M8PA 5LM7E 4LVOP 3RGIA 3KHHA 3IWXA 4P73A 2ZHOA 5J1EA 1S1VA 3K59A 1C1CB 3QSYB 1RYRA 1GFWB 3OSPA 3O8WA 4RWWA 3H42A 2OEJA 2W9CA 3DGVA 3THVA 3EJMA 3DI6B 4FN5A 3KG0A 1S97A 3RR7A 2Z0GA 5BXIA 3PHTA 1HNIB 3OL8A 3KLIB 1R3NA 1FJCA 3CDBA 2KRBA 4M5LA 3W64A 4FP9A 3HHNB 5ETMA 2F4FA 2BDPA 1S48A 1WKLA 4FPIA 3NCPA 2I6WA 4EMDA 3LWLA 1U1NA 2ZEJA 3DRSA 1R0AA 2J8AA 2Y0BB 3BB5A 1XMQF 1W7WA 2V50A 3OFFA 2IJNA 3RRHA 5CH7B 1RACB 2DCUB 1KTQA 2JVRA 2UUAJ 2J7UA 4F50A 2H5JB 4BS2A 5AXLA 2A10A 2O01C 4ZP9A 4P6QA 1T8EA 1IBKJ 2VH7A 5KFAA 4UOGA 1VS3A 2GMJA 2XHCA 3MM7A 4B3TJ 1DY3A 1Z1ZA 1RTDA 3FRZA 3AA8A 4DXLA 2VODA 5IXUA 1JLQB 3OXFA 2X51A 5KFNA 2A6OA 2XGPA 3A1YG 1LXJA 2ZNZA 8RUCA 4NLWA 4KO0A 2DR6A 5GADI 2GW8A 5LMNF 3H40A 2KHCA 3QPIA 5EWGA 2PI5A 2I5JA 2DR9A 2P9EA 2RRNA 4ZVEA 3EDRB 2FQQB 2JZ5A 4DEZA 2HLUA 1B0PA 2HS3A 1Q8KA 2CZ4A 3EGZA 1RCXB 1FEHA 2XSFA 2DCLA 3VAMA 1XERA 3B54A 3GE9A 2RSQA 4USMA 1HL6A 1B7FA 4IG0A 1DARA 2LDYA 5LSLA 1NJXA 5T14A 1TL7B 4WE1B 1OO0B 3V6DA 3PCOB 4RW9B 3TAMB 5K14B 3CD6S 4ED6A 2VL1A 3T1YF 1NDPA 1RHJB 4X4RA 4A8WA 2C2MB 3R1HA 4DDFA 4JI1J 1TKZA 4LRFA 1K8AT 3JSMA 5D4NA 3QATA 4QZVB 1WHWA 4LF9J 1OS5A 1FRKA 1HPZB 3R2DJ 4TY8A 4PUOA 5DG7A 1KD1T 4GKJF 1NK4A 1T9UA 1FRIA 1NU4A 1OYDA 1UJ6A 2YKNA 2D3ZA 2UUTA 4DWIA 1X4FA 3PVXA 1U1LA 4OLPA 1TR0A 2YPYA 3SQOP 4C2MA 1XC9A 3ISNC 1K9MT 4P52A 2KTQA 4OX9F 4KSEB 4ED5A 5GMKa 1GMWD 4NMXA 3J81U 1WC0A 1D9DA 2W24A 1S1UB 4ANCA 4YR3A 5IT0A 5BYSA 4RBTA 3EX7B 1HBNB 3EZOA 4G1PA 3TJAA 2C3YA 4KH1B 3LOUA 3G9CA 1NPPA 4URGA 3W5YA 2CQ3A 2JEIA 1Q7YT 3GCXP 2E1CA 4P10A 2DBBA 1SQGA 2XEXA 3HVTB 4F2RA 1ZZFA 3LWMA 3OTDA 5AXNA 1RTIA 1RU2A 3SXLA 5KFYA 3OPKA 4R25A 2MLXA 1Q16B 1OIAA 7FD1A 1CJTA 3TI0A 1RWMB 2HHTA 1AW0A 4CT8A 1ZA2B 3KK1A 1NXIA 1N56A 2E5HA 3HMJG 4DUTA 4WU3A 1Q1KA 4FKYA 3KJVB 1M1HA 1RT7B 4R0JA 5C24A 4NMLA 4PRFA 1U25A 1EETA 3SI8A 3MEGA 2IC3A 3L7UA 6AT1B 3FDSA 4I6WA 5FLXY 2W9BB 1CJUB 4DR7F 3DRRA 1RHUB 1IKXB 2W2QP 4M63A 2HBZB 2QL7B 4YY3F 3TA2A 1JLCB 2DIUA 4X4OA 4L6V3 4BBYA 3AOAA 1HBMA 2NSCA 1UETA 4F36A 4JBCA 1WG5A 2FLPA 1NK9A 2HG4A 3NRBA 1PYOB 3FMBA 1HQEA 9RUBA 4C9DA 3MR3A 5DLFA 3W3SA 2I38A 2DH9A 4DX6A 4RZRA 4OYMA 2VPZB 2APOA 2PGCA 1S9GA 4JB8B 2DHSA 2HSEB 2RIJA 3IG1B 1AUSL 3D6TB 3MECA 2UXDJ 2PN6A 2XMWA 3E2EA 1QSLA 4NXMJ 3M7VA 1ZA1B 3MEDA 1NZAA 2VG5B 4DL3A 1RWNB 1RHKB 2I1RA 2E7WA 1UEKA 5IS2A 4KC5A 1J5OA 2RD5C 2HQFA 2ABYA 3OVBA 1TKXA 1H6KX 5DM6Q 3W65A 3FSYA 2ZFHA 1FESA 1GXUA 1MN9A 3W1YC 3C14A 4ECSA 4L3KA 4ICLA 2HFVA 1A0OB 1YWXA 1N34F 4FF4A 1TV6A 2DEJA 5HMWA 4PG5A 1VYAA 1XR6A 4Q45A 3MWBA 4K5SA 2V2ZA 3DLGB 3U02A 1X9SA 2HVEA 1JXEA 2XO6A 3HP6A 2JX2A 4ED4A 2FLOA 3TQ1A 3M1VB 3HFKA 4K7QA 3FCVA 2PMWA 4F26A 4F02A 3EPIA 2Q66A 2ZUAA 2ZH2A 4AE5A 3UDCA 3GWCA 2FLLA 1TKTB 3SSRA 1N0VC 1QE1B 3D0GE 2CJBA 2CQHA 2JJ4D 1S9FA 4IUFA 4YB7A 3FCWA 2YWHA 3ONQA 1B99A 2LU1A 5HP1B 2V5HG 1CJVB 1F9FA 2UUBJ 4XK8C 2VF3A 1F3VA 5I4MA 3CDAA 3CCTA 3Q8RB 1HWIA 2AJFE 4DFMA 2CWKA 4G1IA 3D28A 3IC1A 5FIIA 1HBOB 4ZVUB 1NBEB 3C2PA 2AGQA 3DOMB 1Q86T 4I6AA 2VFSA 2CPYA 3IO1A 2FHJA 1PC5A 4RW4B 1DTTA 3A3PB 5G0RA 2QMUB 1YBTA 1P1LA 3ETOA 2QFJA 2C2OB 4PKDB 4MAKA 4F4XA 1UWBB 3VCDA 3ISND 2DNMA 4QIVA 3E3XA 1KOHA 4JI8J 3LPEA 3R5GA 1O0PA 4E98A 5L1IA 4G1QA 4S0MA 3TEGA 3TOQA 3OTOJ 4QIEA 3DXSX 2E9TA 4UF4A 3CC7S 3V5RA 2CVEA 1MG7A 1KKHA 2ZITA 4B02A 4RL1A 3QO9A 2XC9A 2HLTA 2Q6CA 2D69A 5J2MB 2C2DA 4DV1F 2ATLA 3CDWA 1UMJA 5B0AA 4LF6F 4OZ3A 2MEWA 4X64F 1XIQA 2ZD1B 4JP8A 3TNVA 3H5UA 4NE9C 1VRUA 2V94A 3JSYA 4KGKA 1VQ7S 2P9GA 1F2HA 4C8LA 4B17A 2HFOA 3D6FB 1CQNA 2Q43A 2ZDPA 2HAIA 1PIEA 3PDNA 3KLVA 2R7RA 2QA4S 4OYBA 2OTJS 4PPZA 4ECQA 2UV8A 1HD0A 2P5VA 1FRMA 2RUSA 4EWTA 1N5VA 1FJGF 3L09A 3GPAA 4ED1A 3E01B 3VAGA 3R5DA 1FKPA 3PTWA 3MM8A 1FWPA 4JV5F 4P72A 4CLKA 1SL1A 4BWJA 2RJZA 1S6QA 3UN3A 1YX2A 2GVDB 3W5ZA 2DNRA 5A8WA 4NA3A 2JLFA 2ASYA 4FPRA 1PJ5A 1FE4A 3RJMB 1UVKA 2J9CA 1FK9A 1S4FA 1S1TA 3J80Y 3CB4A 1FX2A 5K8MA 3SFGA 4M5HA 1Y11A 1J2VA 5M2UA 1K1SA 3NWGA 1LV5A 3CTRA 3AOBA 5LMUJ 3ENAA 1X60A 3CJ0A 3KK3A 3SV3A 1UWAA 2XZDB 1KQFB 4AXJA 3AODA 1S1WB 5IC4B 4LIRA 2QLXA 2FIUA 4XPCA 4B3MF 1HA1A 2KZZA 2IHR1 2QYCA 1Q78A 3QIPA 4DR3F 3M8PB 1LWFB 1N0UA 1Y4ZB 4RWXA 5J1EB 1FEEA 2WVEA 3ZTSA 1S1VB 4LRAA 4CP5A 1MMNA 2HVIA 3N79A 4P2SA 2DO0A 2W9CB 4ED0A 1RWXB 2J9EA 1PJ7A 3GR1A 1YDLA 2E1PA 2E44A 2L3MA 4C8OA 3ET6A 4I7FA 3NL0A 4EO6A 3DRXA 3R3TA 1IR2A 1KNZA 1RDRA 1M1KT 4MKAA 2XY5A 4C7QA 3CSKA 4CLTA 4DU7A 2G2ZA 3DRSB 5IOLA 1R0AB 4MTPA 1URNA 4RLEA 1UCNA 1JJ2R 3DU6A 3NGUA 1UJ4A 1SIWB 3R6GB 5HJYA 3GYGA 3JQKA 2VHGA 3FQKA 3O3LA 1WF1A 1IM4A 1RWWB 4NLUA 3BGUA 4ZVQB 4BLGA 1K0VA 2CJAA 4LJMA 1QVFR 3H0PA 4M5DB 1MWQA 2XS5A 2EFOA 3DOKB 4GKKJ 3D3CJ 1ICEB 1X4DA 3MM7B 1TP7A 3BQ1A 2HFSA 1U02A 4DCJB 2OPRA 2N82B 4RBVA 1X4BA 4ZCKA 5KFEA 3ILLA 1FNMA 2JWNA 3QRRA 3RR8A 4RUCA 4X4NA 2UUAF 5F9NA 2Y0SD 1RWVB 4KO0B 5IM0B 4C3KA 3UD3P 2RB7A 1G4CA 4CLZA 2O5DA 1IBKF 1Q5YA 4ELUA 2LA6A 3C15A 2I5JB 3DGPA 3V6JA 3EXCX 1RBOB 3NLCA 4URQU 4IR1A 2D74B 5DS7A 2AZ1A 5DETA 1HWJA 4LRDA 1CEZA 4F0KA 2PFDA 3FVYA 4ED3A 2PIIA 4Q7AA 1S79A 1RT6A 1VCTA 4WTYA 3OHBA 3GJQB 1D1UA 1O8BA 2ILYA 2IBKA 3ENVA 2YY3A 4X4SA 4ECRA 3C8YA 4IG0B 3HX9A 2VV5A 3IM8A 1VQMS 2HFZA 1H7WA 3V6DB 2EG2A 1U1RA 1I3OB 4KHPJ 5ETNA 1WI8A 5DZ6A 2KVIA 2VIHA 1JIHA 1NM2A 3TZZA 4U7UK 1T3NA 2I8EA 2EW9A 4F4AA 1TKZB 3JSMB 3N5BA 1VLOA 3BPDA 3M6WA 4Z2XA 2R2SA 1FXDA 3Q8PB 2WB4A 4CO4A 3NGSA 4PUOB 4MKVA 3Q22A 4QBUA 4ID5A 5KT3A 2QG9B 2YKNB 4NLVA 1YLXA 4JI1F
chains in the Genus database with same CATH topology
3ENQA 4YEAA 2VPYB 4NLPA 1NKBA 5L39A 5KG6A 3LP0A 1W25A 1Y9OA 1JLCA 5A6WA 4DL2A 2W9AA 3MPVA 3CJ3A 4EBDA 1TZ0A 2WONA 1U24A 2XLIA 4LF9F 2VKRA 1FDAA 4ZMMA 1IN0A 4YB6A 3K2YA 2KFYA 2CJQA 3GV8B 3UPFA 3RBEA 1N48A 2DPJA 2R2RA 2J7WA 2OMOA 4N8OA 4I68A 4IO9Q 3PW5A 2IMWP 5LSOA 2V9WA 4OZLA 3EPGA 2XZWA 5KFHA 2DNNA 3M9MB 3AJ1A 4WFZA 1RT5A 2IFXA 3HHLD 3W2WA 5A8RB 5A8KB 2ZH9A 1M90T 1TL1B 4IKAA 3U1MA 2I9SA 3V6KA 2QO3A 4M8LA 3CGIA 1S6OA 3D0IE 3LAKA 4DSKA 3GFZA 3HDSA 4A8KA 3X1LB 2ACYA 1VMBA 2JFKA 2RRBA 4WYWA 2XO7A 3MMCA 1T3OA 2XCPA 2DIVA 1FRHA 3IAM9 3LH2S 5GAGI 4ZPAA 5HBMB 4M94A 3A8EA 1V3ZA 4U67Q 3AH6A 2BQRA 3G8QA 4Y34A 3NG8A 1MW7A 3BO4A 1E6YA 5CZVA 4PQUB 2K2PA 1UVNA 4PWDB 4HI1A 4F25A 1QM9A 3MD1A 3PX0A 3QIPB 1N6QA 4RNNA 2POKA 1RI7A 5EWEA 3NMAA 1OWXA 2DNOA 4MFBA 4AFFA 3RAQA 4NLYA 2DR7A 4JI4F 1H7XA 2W25A 3FCHA 4IH7A 4DF8A 3U1NA 2BR0A 3K8VA 3MURP 4OX6A 3DNCA 1S9EA 1RJJA 3J81Y 1HHSA 1R8BA 5LMUF 2XMUA 2MZ1A 3FGVA 5BYQA 1SV5B 3OSNA 3M6XA 4IFVB 1SQEA 2ZM6F 1KN6A 1N5YA 3IG1A 3MR6A 1RTIB 2ZJRQ 3FQLA 2BW2A 5EHHA 3R1LA 4H4MB 2R2TA 2N3OA 3QGHA 1YJ9S 2ZHAA 1LW0A 5KFDA 4OQJA 2GMLA 3CXCR 3VAHA 4Z37A 1X5TA 2QZ8A 3JSRA 5KFLA 4DX8H 2NR0A 4CNZA 1Y5IB 1RKIA 3OXLA 3CC2S 1P6TA 3JSBA 4DQSA 2IRYA 4RW6B 4F4KA 3IA0A 2Z2MA 5D4OA 3HXMA 3HK2A 3EGNA 4MMOA 4ZKAA 3KK1B 1RT2A 2FHOB 3LW5C 4EZ6A 4NLRA 4Q2LA 2FGCA 3I82A 4TU8A 2YNHA 1NNDA 2BA9A 5CZXA 3NCRA 4LQ9A 1NK8A 3CVKA 2LQBA 4HTJA 1KC8T 2RQCA 3N6LA 5C24B 1VQ5S 1BQMA 1FHTA 4O4GA 5K5MA 2E5IA 3F73A 4NRUA 4DL4A 3BEGB 5L1LA 1S1XA 1M5VC 1EETB 2J6SA 3SV4A 4IDKB 3FZBA 3CD7A 2JFDA 5B0FA 3MEGB 2KG0A 4K4YA 2ADBA 4FXDA 4O3QA 2IC3B 3UD4P 1X5PA 4OHZA 5EN1A 2XY6A 2NLWA 1VBXA 3KOAA 2J0WA 4QR2A 3ENWA 3VF0B 3DRRB 3NNAA 2HHWA 3CCRS 2KXFA 2FVSA 1UAWA 3MXHP 1BQNB 3PM9A 1FDDA 2IVYA 1C2PA 1BD6A 3FMWA 1IBLF 1MWZA 5KTQA 3VAFA 4LF8F 4WFYA 5B08A 2RU3A 3M2UB 3BJYA 1VJWA 3EGWB 1BGXT 4WZQA 2QA1A 4B9LA 1Z4UA 4JUZA 3DLGA 2CQDA 3FSXA 4IFYB 3DN9A 2EFNA 1TKDA 3T19A 2JEGA 4X4PA 4AQYF 2HW3A 2RF2A 2KU7A 5KT7A 2D41A 5L1JA 3IXQA 4C3MA 4MIAA 2ZH7A 2N4CA 1YHQS 2ZE2A 4DBQA 2PA3A 3DI6A 3CO9A 2KM8B 4NCBA 6FDRA 2BABA 4RU9A 1HBMB 2ZKUA 4NLTA 4PG8A 3OVAA 5KFTA 3MFHA 4EU0A 3BM7A 3K8WA 2AGPA 3BO3A 3CCZA 3M1VA 1DQ8A 3W2VB 4USJC 2COLA 1A7GE 3DYAB 5A0YA 1YJVA 1HNIA 1FXLA 1F5AA 2V0NA 1JNRB 1VK3A 1FKOA 3DRYA 3HM9A 2PT0A 1SJ3P 2LKZA 2R4FA 3RU0A 5DDQC 1U6BA 1JMTA 1UP1A 3RB3A 1HQEB 4TU9A 3OV7A 2C22A 1YG0A 3NS6A 3VAIA 3BDPA 3OJUA 1U7LA 4J9PA 1Q7LB 1TVRA 4EBEA 3K5OA 3PX4A 3V6HA 3OR2B 1JLEA 2A3JA 2YNGB 3VQSA 2RDJA 4B9MA 1VQ6S 2XMKA 3QIDA 4AXIA 5IZHA 2DHXA 4ZA1A 4CI0B 2MPUA 1U6ZA 2OPPA 5D3GA 3QGPA 3M30B 3M8RA 4TLRA 2VOOA 2B6AA 3PRDA 3JTNA 2MZRA 4FNIA 1DLOB 4KFBA 4PG6A 3RB0A 1UVMA 3DLEB 5KT5A 4Q43A 4TXSA 1KHVA 5AJ3F 1GX6A 3OTCA 5KG3A 4OX8A 2J76E 3KLFB 2XNRA 1D3WA 1OPZA 4A8SA 3LQVA 4G3IA 2KDOA 1CQMA 2B9XA 2HS4A 2NPFA 5HP1A 1GNKA 2RVJA 1DTQB 3B4MA 1T03A 5F8NA 3CCLS 3H59A 3GIMA 2KN4A 4O3SA 1TAQA 5AXKA 2VFUA 3VR1A 2LLZA 1DJ0A 1F60B 1K1QA 3KYLA 1ULRA 2FD2A 3S1TA 1YI2S 4EO8A 1LK7A 1QSYA 3DMJA 2DNGA 1HBOA 3GG1A 2HNYB 5K8OA 1URRA 2ZOGA 2ZVSA 2CQCA 3CF5Q 3DOMA 3T5KA 1TKXB 2MKHA 4YOEA 1D8ZA 2B4PA 4ZVHA 3CDEA 1HFEL 4KV8B 5H9FJ 4CO3A 1U1MA 4EZ9A 1JJ4A 1G1XA 2CJ9A 1FRXA 2AWZA 1JLBB 3R5AA 5F8IA 4ECZA 2F8EX 2LA4A 2WCXA 4RW4A 4KTQA 1WEYA 4IH5A 1FJEB 1KR4A 2C42A 5LXRA 2EG1A 2ZJQQ 1RTHA 3GFXA 3QGGA 4YR0A 5JJBA 2DGOA 1S49A 2FJDB 2C2EA 1HD1A 2F40A 2VFRA 1HWUA 4QWDA 2ILZA 4ICLB 2W4CA 4KGMA 2KKHA 2UXDF 1Y3KA 5E0OA 4ELTA 3DLKB 4B3OA 3DLBA 1UWBA 1HYSB 2KYXA 3W7BA 1RTJB 1HQUB 3U7JA 3Q24A 3HJFA 1RWUA 5FJ4A 2XMMA 3BN7A 2VKZG 1FO1A 3KHRA 4I69A 2DISA 4Q0BA 3OLAA 1TV6B 2X1AA 1U48A 1NJIT 3H5SA 1ZAVA 3CCMS 5AE1A 1QVGR 3SSQA 4XDCA 4ED2A 1QTMA 3FRYA 2GQQA 2B4UA 1HI0P 1I1GA 5J2QB 4LQ3A 3MM6A 2G0CA 1XMOF 4LF5F 1U1KA 2A1BA 1U6FA 3M6UA 3DHXA 1X0PA 2D9PA 3PKYA 5F3TA 2DNLA 3MHYA 4OJGA 4WXWA 3K0JA 5KFRA 2YNIA 4MKBA 3BREA 5DGBA 1H2UX 2CDQA 1XR7A 4OZ5A 1HR0F 4IR9A 1Z2LA 1Q82T 2ZKTA 2UVVA 2DJWA 2GGPA 1WACA 2HGMA 5E2QA 2OSRA 3H25A 1L3TA 3HVRA 4O4RA 1T94A 1CSJA 4UUXA 2P6SA 4I0WA 1RISA 1KLMA 3I5BA 3NBPB 3J7Z5 5J2MA 1RT1A 2ASLA 3GSDA 1FNOA 3I32A 2HHVA 4HVZA 4UY8T 2OD4A 4CO2A 2B5JA 1MMDA 2ZH5A 1ZM3A 4M1KA 2GJIA 4WFAQ 4X4UA 4YHHF 2R8HA 3R5BA 3MMBB 4OI0A 5KFSA 1MMLA 2HZCA 1NB7A 4WKRA 5KAKA 4GC7A 2GHVC 1RK8A 2QRRA 2OIHA 3HVWA 1QSSA 2B4OA 3MOZA 3I0SB 2MKIA 2NYIA 3IR7B 1XN9A 3MM5B 2W8KA 1VRTA 1ROFA 3IRXB 4JYAF 2EWHA 5HI7A 5CYJA 5LJ3Y 2F1FA 4QPXA 4ID5B 2XBPA 3CT9A 4KHPF 1RT3A 4JI6F 2ZJPQ 2RQ4A 2V8DA 1X9WA 5T7LB 2YKPA 2AF6A 3ZZUA 3Q0AA 4LFBF 2VQFF 4NZ7A 3MTJA 2CFXA 4BCAA 3NCQA 4LSLA 2HHPA 4RKUC 4X84A 1NAQA 4NLQA 1U45A 1ZTWA 3ISZA 2CPZA 1U1OA 4ZK7M 2HMIA 4B9NA 2F7VA 2RKIB 5L1KA 1E6VA 2LQ9A 4J5OA 4FBTA 1C4CA