1VQPS

The structure of the transition state analogue "rap" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 22
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vqpS00
1OIAA 2KXHA 1YJWS 3SMZA 3UCGA 2DNKA 2XB2D 1X5SA 2XNQA 2DNHA 3P3DA 3US5A 1WEZA 2F3JA 2CPZA 1ZH5A 3R1HA 2CPFA 2SXLA 1KC8T 2HVZA 2CPXA 4QU7A 2NZ4A 1W2BR 5DM6Q 2E5GA 1YHQS 4YUDA 1X4BA 3P6YC 1D9AA 2DNOA 5EN1A 2NLWA 3S6EA 2LEAA 2L41A 2JVRA 2N7CA 3TP2A 2MKKA 3BO2A 4TU9A 1X5OA 2OJ3A 1YJ9S 3CF5Q 2HZCA 2MY8A 1X0FA 2DNZA 3VF0B 1KD1T 2BOPA 3S8SA 2HYIB 2XNRA 2B0GA 1VQMS 3PIOQ 2M4MA 2KYXA 1VQ5S 1BY9A 3Q2SC 2WBRA 2MZ1A 1U1RA 1FHTA 1S72S 3NNHA 1PO6A 2J0QD 3CCSS 2MZJA 5DDRC 1FXLA 1YWXA 1SJ4P 2LKZA 3G8SA 5GADU 3CCES 2J0SD 5JVGQ 3B4DA 1M1KT 2CQPA 2JVOA 2EK6A 3JB9k 1X4HA 2CQDA 4A8XA 3EX7B 1X4CA 2MQQA 1DRZA 4WCEQ 3FEXB 2DGTA 3J7ZT 1M90T 2AYMA 5IQQA 2RU3A 2N3OA 2DHSA 3SDEB 1R8HA 3DLLQ 1OWXA 2ADCA 3CCVS 2MGZB 3RW7A 2X1BA 3BS9A 3THPA 1L3KA 2YH1A 2DK2A 1Q86T 1XN9A 2DNRA 2FPHX 2MKIA 1URNA 2DH8A 2DHAA 2MJNA 2Q79A 1F9FA 1SXLA 1M5OC 1NU4A 2MJUA 2YTCA 3CCMS 2VOOA 4W90B 2XS7A 2MZTA 3NMRA 2CQ4A 1S79A 2RRAA 2YH0A 4WKRA 3VAGA 2MZRA 2KM8B 2CJKA 5FJ4A 4OZ1A 2MYFA 2KN4A 2YWKA 3VAIA 2N3LA 2XS5A 2XS2A 2X1AA 2DH7A 1UP1A 1FJ7A 2DHXA 4ED5A 1U1QA 5H1SV 4BS2A 1SJFA 5HO4A 3FEYB 1X4AA 3R27A 1WG4A 5GAHU 2E5IA 5GAEU 1VQKS 2LYVA 2MGZA 4IUFA 2OTJS 3I56S 2KT5A 3BO4A 1CVJA 2K8GA 1H6KX 4WF9Q 5HL7Q 2KI2A 2PE8A 4IO9Q 1Q7YT 2DHGA 5LSLA 2CQHA 1KOOA 2FC9A 2EK1A 2CPIA 1SJQA 2DGUA 2RQ4A 3TO8A 2D9OA 1WF0A 3MUVP 2AYEA 4CQ1A 1U6FA 1QVFR 2DGQA 2O3DA 3MDFA 1X4GA 2RVJA 2QA4S 1X4EA 2MY7A 2QEXS 2DGXA 2G0CA 1H2VZ 1QM9A 1U1LA 2EVZA 5JVHQ 5IFMA 4QQBA 5GMKa 1A7GE 3VAKA 1R8PA 1WELA 5IM0A 2M7SA 2N82B 1UAWA 2LCWA 2U1AA 4ERDA 3G8TA 1M5VC 3R1LA 2M8DB 2G4BA 1JJHA 1ZZFA 3CC2S 3PIPQ 2QFJA 3SXLA 4IOAQ 2DNPA 2J76E 5DDQC 3VAJA 3MD1A 3UCZP 3VAHA 5LJ5Y 1U2FA 2DGVA 1YI2S 2G1DA 5DDOC 2CQCA 2MZSA 4F26A 2OIHA 2GO9A 2K3KA 3CD6S 1FNXH 2E44A 4YOEA 4PR6A 1KQSR 2I38A 1N52B 2MQPA 2HGNA 1FO1A 2J8AA 1SJ3P 2OSRA 2LEBA 3UD3P 4LJMA 3CC4S 1NO8A 1FT8A 2M0GB 3VAFA 3G4SS 3MURP 2DO0A 2LA4A 2MB0B 4C4WA 1VBYA 1VQ9S 3G96A 2DNNA 4PKDB 2M88A 2LQ5A 3L3CA 3ZZYA 3MXHP 1JJ2R 1WI8A 2CQ3A 5CYJA 5IM0B 2ZJPQ 1U1NA 1WHXA 3CPWR 2AD9A 1WEYA 3ZZZA 3CUNA 2CPDA 2OTLS 2CQBA 1N88A 3MI7X 5DDPC 1VC5A 1RK8A 1YIJS 4J5OA 2KXFA 2LA6A 2D3OR 1U1OA 4TU8A 3VALA 1NJIT 1WWHA 1UFWA 2ERRA 2M8HA 2KRRA 2F9JA 3G71S 2LECA 5MLCV 2V94A 5LXRA 2KM8C 1RKJA 3EGZA 2DH9A 2DGWA 1B7FA 4WFBQ 2RRBA 2A3JA 4LMZA 2MSTA 1K9MT 2DNMA 1M5PC 2ZJQQ 3MOJB 3CCRS 2CQ0A 1HL6A 3S7RA 2DNYA 1X4DA 1AUDA 2X1FA 2JWNA 2KVIA 2MZQA 2RS2A 1WF2A 4WIIA 4Z2XA 1JJ4A 2FHOB 1DHMA 2KFYA 1SJRA 4ZKAA 1X4FA 4QPTA 2MQNA 2L08A 3NS5A 1X5TA 2VOPA 2F9DA 1HD0A 1VBZA 2MKJA 2DISA 1OO0B 2LMIA 2VONA 2E5JA 2MPUA 4CH1A 3J7YU 1X5PA 2MKCA 4C0OC 1U1PA 2RQCA 2FY1A 3UCUP 3H2UB 2KXNB 3CC7S 1WG5A 1WI6A 2AYBA 3P49B 2ADBA 3CCJS 1KOHA 1WHYA 3LPYA 1WHWA 2DB1A 2LXIA 3CXCR 3NS6A 5CA5A 4PRFA 3HI9A 1M5KC 3N9UC 2BZ2A 2CPHA 5LSOA 1QVGR 3K0JA 3OW2R 2AYGA 4CIOA 1VQLS 4WFNQ 2DIVA 3EGNA 3G6ES 1HA1A 2XSFA 4UQTA 3U1MA 5BJRA 2M52A 1FJCA 2X1GA 1YITS 3ULHA 5CXTA 2MQMA 1FJEB 2M2BA 2MQLA 3THTA 5DM7Q 3TYTA 2CQGA 1VQ4S 3SDEA 3G9CA 2LXUA 3CCLS 1D8ZA 2MKSA 3I55S 2KG1A 3CTRA 2DGOA 1U6BA 4U67Q 1Q81T 4TU7A 3D2WA 3UD4P 1PGZA 3NNAA 4IOCQ 4F02A 2E5HA 2PEHA 4FXWA 3V4MA 1H2UX 5DETA 2KH9A 1VC6A 3MUMP 2KHCA 1VQ8S 3P5TL 2MSSA 2M70A 3CCUS 3CMES 5ITHA 3HHNB 1P27B 1WG1A 3BO3A 2MKHA 1YTYA 2RS8A 2L9WA 2KRBA 2DIUA 2DGSA 1HD1A 2CQ2A 2CPJA 3IWNC 2KU7A 1WHVA 4OZ0A 2GHPA 3LQVA 2UP1A 2CPEA 3Q2TC 4WFAQ 1U1MA 1G2EA 4UY8T 4TLQA 5GAGU 1U1KA 2YKAA 2D9PA 1K73T 2DNLA 3CCQS 2OSQA 3MD3A 3S01A 2MXYA 1WTBA 1DBDA 3B4MA 3NNCA 3CULA 2FC8A 2KG0A 1UW4A 4LIRA 4Y00A 3VAMA 4QU6A 4P6QA 2RT3A 1WEXA 4W92B 2DO4A 3H2VE 3IRWP 4Y0FA 4V19X 2M9KA 1WF1A 2JX2A 2HGLA 5D78A 1O0PA 2DNGA 3DXBA 3UWTA 1K8AT 2CQ1A 2CPYA 2HGMA 4EGLA 2ZJRQ 4F25A 3UE2A 1P1TA 2DNQA 1YJNS 3U1LA 3BEGB 2RNEA 4CH0S 1IQTA 2CQIA 2MQOA 1Q82T 1N54B 2I2YA 1H2TZ 2VODA 4FXVA 4M5DB 4RU2A 1VC0A 1A9NB 2RUGA 1VBXA 3MUTP 2MMYA 2U2FA 1OPIA 1DZ5A 2DITA 1ZZNA 1N8RT 1VQ6S 1VQNS 2JRSA 1VQ7S 4YB1P 5D77A 3CMAS 1VQPS 3RW6A 5LJ3Y 2MHNA 5GVQA 5LXYA 1JMTA 4C7QA 1VQOS
chains in the Genus database with same CATH superfamily
1HWLA 2LU1A 2FYXA 4HHJA 3EVOA 3SMZA 4ETZA 4BDPA 4Y6IA 3M1VB 3BREA 2HURA 1M5SA 1JLGA 4TLRA 4C3MA 2DNHA 3HXMA 1RT3B 2HMIB 4CYUB 2HS4A 1HQUB 4J9UE 4LF1A 3P3DA 3IN5A 4PXCA 1U0SA 2F3JA 4ZVFA 1J5OA 2HVIA 5ETNA 3GYNA 3W2VA 2SXLA 3R1HA 1K47A 4KC5A 5C42B 1KC8T 1LW2B 2HVZA 3QT6A 4CLSA 4CZCA 4DSKA 2R2RA 3ZTSA 2VICA 3GG0A 2GJIA 2WK4A 4KO0A 1LWEB 3GCXP 4ILLA 1R31A 4LFCF 1CJKA 4C2MA 3QGHA 4WWSA 4HR2A 3PDNA 3QWUA 1HMVA 4YS2A 1NPKA 3NS7B 1WC5A 1V3ZA 2E66A 4CLZA 3TP2A 2RF2B 4HACB 2BQRA 4FF1A 5ETQA 3UFCX 4PG5A 2GZOA 3CF5Q 2D3O1 1R0AA 4LF7F 3R5GA 5G4DA 5A0YA 1KD1T 2XZDB 4CM2A 3MR3A 4ZVTB 3SV4A 3K5MA 5A8RA 2UUWA 3S8SA 1ZTTA 1DTTB 1HBOB 2MDAA 2QGFB 3IM9A 1IKYA 1SKRA 3O1LA 2VA3A 2B0GA 5HMZA 2MLZA 4I2PB 2ZE2A 2EKYA 4B9LA 2DY9A 2E7XA 2VJUA 3EWGA 1HNWF 4DV2F 4ED0A 4DV4J 4BC9A 4F3QA 1YX2A 1U1RA 2E5LF 3L7UA 4B3OA 4LUBA 2YY3A 1HBUB 5D4NA 2BDPA 3FC9A 3M30B 3H2LA 5T7LA 1ZETA 2D7SA 2HNDA 4EZ9A 3W1YC 5AXMA 5J1EA 4DFKA 4JI3J 3QSIA 2CZ9A 3M4XA 4NOHA 4NX9A 4ZS6A 3QATA 3MPYA 4K4WA 1G3OA 1FXLA 1F5AA 3KLIA 3IR5B 2GQ2A 4ILRA 2AV5A 4U95A 3MM5B 2ZOFA 3G8SA 4KY3A 3E3XA 2Q43A 2JLGA 2W01A 5BR8F 3CCES 1KONA 1M1KT 3K5NA 2CQPA 4WYLA 4K2XA 4LRAA 3RBEA 3EVMA 4ZK7M 2HRUA 1Y4ZB 2P2CB 4KGZB 1N5YA 2CDQA 3FRZA 2EFOA 4CDIA 3HD1A 4OYZA 4XPEA 3TVYA 3T1YF 2HHTA 5H9FK 5KFJA 1IVZA 2QLFB 2VB6A 2W2PP 3T1AA 2MQQA 4PG4A 1KRPA 3FSXA 3OR1A 3OD2A 3BH7B 3UPFA 4CTAA 2HNZB 5KTQA 4USWA 2FVSA 2H5JB 2Z57B 1M90T 4JYAJ 2AYMA 5HMYA 2ASLA 2UXBF 3HHLC 3QQCD 1HWUA 2VDIA 1OWXA 3Q8PB 2MGZB 1OY6A 3M32A 3RW7A 2GX8A 1MW7A 2LQ9A 1XR6A 2X1BA 3F56A 2D69A 4QIWD 3G6VA 3B6BA 5KFKA 1MMLA 1XN9A 2FPHX 2R7XA 1HW8A 4RNHA 3QGIA 3IAM9 2DR7A 2HPUA 2QL9B 4KSEB 2XMTA 2ZHBA 1F9FA 2XMVA 5GMEA 3TWZA 1NU4A 3DI6B 3IM8A 2MJUA 4MKVA 3HK2A 1KFSA 4B9TA 2YTCA 4J9PA 2CKWA 4ZVGA 3NMRA 1S6PA 2XMWA 3C8YA 2RIJA 4Q8FA 4OYPA 4RUHA 4N56A 1RAAB 4J9SA 2KHDA 2DEIA 2R8HA 3G87A 4WKRA 2Q6BA 2QMWA 2E5LJ 1HWJA 3GIRA 3R5CA 1RGVA 2E1PA 2KM8B 1FKOB 1MROA 1VISA 1HI1A 4ED6A 4JV1A 2EBEA 3C14B 4C0BA 2QMXA 4UT4A 2VF3A 1FX4A 3CD7A 3T6BA 1S9EB 3GSDA 4ECYA 2GCFA 2XS2A 3A12A 2ZNZA 4R5PB 2LQ8A 4A4JA 2HQIA 2NXEA 3H90A 2W7PA 2ALZA 4ED5A 2VG6B 3CDWA 2CJQA 1SJFA 1DARA 2O1PA 1SB6A 4R5PA 1SV5B 4M95A 2QG9B 4OI2A 3D3CJ 2AMCB 3I4HX 3MECB 1WG4A 4RBVA 4MH8A 5GAHU 3LGNA 1S6OA 5GAEU 1VQKS 1SH2A 3D5MA 3MCMA 1NB2A 4CP5A 2B9YA 1BMQB 1RAIB 4MIAA 4X65F 2KT5A 4DFPA 2FVRA 1F5BA 1CVJA 3PTWA 2K8GA 3V6DB 3T1YJ 2KI2A 4IO9Q 2EEYA 4DS5A 2YWGA 4N5SA 3MM7A 3D1HA 4KH1B 1KOOA 4NA1A 2GFFA 1D0EA 1F3FA 2QJ3A 2DGUA 3AQOA 4DV2J 2HHSA 4WZMA 4LVNP 4BWMA 3TO8A 4DFJA 2UXBJ 1BQMA 3PX6A 4ITSA 4ZA1A 4NLPA 4WTOB 3DI6A 1C0TA 1U6FA 1RSCA 2O3DA 3MMAA 4MT1A 2F65A 5EDWA 2W8LA 1BGXT 3ZXWA 1Z1ZA 1NDLA 2R2UA 1X4GA 3PY8A 4IQXA 4OV1A 3M2VA 1NK6A 2QEXS 1TR0A 4NLVA 4DSEA 4ZMMA 1QM9A 1RUSA 2WB1D 2ZM6J 1UVLA 1X0PA 4ID8A 3RJMB 1XMOF 2ZWPA 4QQBA 3SEOA 5GMKa 2EFPA 3CD0A 1K0TA 1WELA 5BR8J 1BXNA 2UXDJ 4TY9A 2U1AA 1KQGB 5CD4A 1S9GB 3HF5A 2YNFB 1KFDA 3TNVA 4F50A 4LF5J 4K8RA 3PRVA 3T1HF 2NYHA 4ERDA 1T03B 1Q5YA 3J81U 2PFDA 1IBMJ 3KWMA 3V6JA 5ETOA 1H7WA 3M2UB 2RQKA 2YWHA 3D1QA 1SQGA 1ZZFA 4QOTA 1PJ6A 3EZOA 4O4GA 4O3OA 2DR6A 3SXLA 5DDQC 3E8OA 3DRRA 3J7AN 4IOAQ 5K8MA 3FUYA 4HH1A 1IQZA 2G13A 3A4TA 3EGVA 2DGVA 4IG0B 5I3PA 1W25A 3Q8QB 3GIMA 1YI2S 1FJGJ 4FDFA 2MZSA 2R7VA 1S7IA 1U0HB 4QWBA 1Z2ZA 3DRSA 1W2IA 3ZO7A 4WE1B 2DPJA 4NLWA 2DXDA 4DQPA 1R89A 1KQSR 4C3LA 1RHMB 3PRDA 1RYRA 4P7VA 1MWYA 1CS4B 2NXUA 3FBEA 2CG4A 4RLEA 4EO8A 3JAMY 5KG7A 3QT8A 4KGVB 4LJMA 3LWLA 4RJVA 2C28A 4DR5F 3MPVA 4QBUA 4ZJQA 2PEBA 2M0GB 2IMOA 3I82A 2IVMA 2O5DA 2ZBCA 4IQMA 5A8WA 4HT5A 5JMNA 3MURP 1L3UA 1N32J 1NDKA 1Q95G 2Z2YB 4ZIWA 3OL7A 1VQ9S 4C4WA 3MM5A 2V8GA 3MOZA 1OJ4A 4PKDB 2M88A 2LQ5A 2P6TA 2VG5B 4WK3A 3NGRA 4B02A 2UVVA 2GA7A 2XM3A 2CQ3A 4C8NA 2IPOB 3BR8A 2YPYA 4BLGA 4RWXA 5IM0B 3QFWA 5KG3A 4B9SA 3K2YA 3HVAA 4RO0A 1NK0A 2A6MA 1Q7LB 1F2GA 3DYAA 1U1NA 1J5EJ 1Y10A 1RWXB 1E6YA 2ASDA 4AL7A 5A76A 5B08A 1OPZA 1WHXA 3CPWR 3OHAA 2C3MA 3M8PB 2CNNB 2CPDA 3PNIA 3ZZZA 1AZSB 4JB8B 3EVWA 4ZP9A 2KJWA 4P2MA 4DHVA 4FF2A 4NZ6A 2OUGA 3OR2A 3FSYA 2JC0A 3KKFA 4ANEA 1VDHA 2Y0BB 3UDLA 3MAHA 2R9LA 3B82A 3OR1B 1SIZA 2ILZA 1B70B 1DTTA 1HBOA 4IO1A 4IG3B 4USTA 5F3ZA 2H65B 1LWCB 2W2NP 3DLGB 4DX5A 1U1OA 2IMWP 2ZNYA 4Y28C 3Q8UA 3UN3A 1NJIT 3TZXA 2HZVA 2FJXA 3BN7A 2BW2A 2KJVA 1RAEB 3MPWA 1NJWA 2NR0A 2GO8A 4HACA 1U49A 3QGGA 5FD1A 5LMUJ 4OZJA 2LECA 1KLMA 3PRBA 3R9LA 5MLCV 2CDRB 2B7CB 2HBYB 3PXGa 4KT0C 2L3MA 2ZH6A 3EGZA 3ZTPA 2ZKTA 1T3NA 1KTQA 3V4IB 1PSDA 1RXOB 5J2QB 1M0SA 1RTDB 1GQEA 2VHGA 4Q43A 3GFXA 3TI0A 4LMZA 4CO3A 3UDEA 2DNMA 4EO6A 4JI5J 4I1TA 3CCRS 3S7RA 4LR9A 3TRGA 3QLHB 3QAEA 1N5YB 4LRBA 4RNMA 3GFHA 2X1FA 4MMOA 1HBUA 2JWNA 3W3SA 3J80U 5I3UA 4NLOA 4OZNA 2B56A 3Q89A 2D3UA 2NCKL 2EFQA 1UVKA 2FHOB 4WIIA 5E33A 3C15A 2IHR1 1WC6A 4UF4A 5AXNA 1T05A 1D1UA 4AL6A 3N4WA 3E01B 2UV8A 3TVKA 3SSQA 3WX4A 1HKAA 1NEEA 2R4FA 4ZP6A 3ETOA 4QPTA 2OMOA 4I6YA 1TKZB 3HHKA 2H4WB 2HHUA 1HQ2A 5M2PA 3NBPB 2MKJA 1NUEA 1RBAA 4DN9A 3SI8A 2DISA 3B54A 3MEDB 1KBRA 3Q83A 3W9IA 3FDSA 4L72B 4P71A 5HVHA 1KWMA 1HFEL 1UEKA 4RR5A 2MPUA 3NOCA 1B99A 3GJQB 2ZBRA 1KVIA 1YSJA 1IKWA 3RB0A 2F1FA 3IMQJ 5M2RA 2FJWA 2HVDA 1TL5A 2IC3A 2MQ8A 5IZHA 4IFYB 4CT8A 5B0CA 1EQ0A 4ZLLA 1IKVA 2RE1A 2VFUA 4KR0B 4OZ3A 4X4SA 3HZGA 3A1YG 4I6WA 4KKOB 1V5IB 4DU7A 3F44A 2BQUA 2OKQA 4LFAF 1KOHA 2VQEF 1WHYA 1GTEA 2RSQA 3CJ8A 2DB1A 4KHRA 3N01A 3N5BA 1DURA 3M8QA 4LQ9A 3MPDA 1SKWA 5CA5A 4NYOA 5B0GA 1WDTA 3ZNUA 3R5JB 2BZ2A 1SQEA 4DV5J 1YK9A 4URSA 1RKIA 4U7UK 2DD8S 1ZA2B 3OW2R 3UDCA 3UD5A 3GYGA 3VGVA 4AD6A 1VC6A 1HNVA 1TL7A 5IT4A 4CIOA 4Y2CA 2FUG9 3DLKA 4YY3F 4JI3F 1TU0B 4WFNQ 2DKOB 1FRIA 4LF2A 5HN0A 3KLFA 4M5NA 4RU9A 1HA1A 5K14A 1IWAA 1YJTA 2XSFA 2ZUAA 2GMHA 5HVGA 3HT3A 3A3NB 3HMJG 1JNRB 3FSIA 4ECQA 2FVPA 2ZVSA 1BE4A 3L7OA 5BJRA 4LRDA 3Q8SB 1IJFB 4G6VB 4NZ7A 4H4MA 1H73A 2BANB 1YRTA 1YITS 3ULHA 1PC5A 3ENWA 2F63A 2MQMA 1Q8KA 4H4MB 1V9OA 2HRTA 5A8KB 2J9DA 2CQGA 5ETLA 4DG1A 3ICLA 3SDEA 2QZ8A 5E3CA 2LXUA 2NXNA 2ACMA 2ZHOA 4H4OA 5DS7A 3OSNA 3GIKA 3CTRA 3VAHA 1EKRA 2LDIA 2VBYA 1VRQC 4CCHA 4Y2AA 3RZAA 4FYXB 1U6BA 3AXMA 3EGWB 3D2WA 4J9MA 3UD4P 4LF8F 3BH6B 4GVLA 3OQ2A 4X4UA 1KVJA 3R7SB 3RR7A 5G0RA 1CC8A 2C1EB 3DLJA 2IAJB 1CC7A 4FXWA 4UQGA 1XERA 1IUJA 1YJ7A 5DETA 4KGKA 1N5TA 3R5DA 4IKAA 3MUMP 4AQYJ 1U25A 4DR4F 3P5TL 1KLMB 2F4VJ 2P8IA 1BQXA 5B0FA 4DQIA 5B0EA 1P27B 1B4SA 2WB4A 3HKWA 3BO3A 2FVQA 2QO3A 3DU5A 1T9XA 1Q8LA 3ELHA 1ACMB 1YTYA 2BJEA 2KRBA 4QWCA 2E9TA 2DGSA 3AFGA 3IGVA 4K4TA 1S4FA 3SYZA 4OJ1A 1I5OB 4NLQA 1C1BB 4WK1A 4NMXA 2NUHA 1WHVA 4OZ0A 4UTGA 2E29A 2XBPA 4XDDA 1D3WA 3TA1A 4DPUA 4B3MJ 4PUOA 2YX4A 3CJ0A 4I2QA 5KFXA 3M2RB 2CAJA 4KV8A 5ADZA 1RJJA 3WDOA 4WFAQ 3KHHA 4JI7J 3Q2TC 2CRLA 5DQGA 4ECWA 3D6HB 2JFDA 2M5YA 3ISND 4Y34A 2G2OA 2AKWB 1U1KA 2DT9A 2OPSA 2V6AA 1PJ5A 1VRUB 2OSQA 2BA9A 2Z30B 4WPAA 1NH8A 3LWMA 3S01A 1BD6A 3B4MA 2RJZA 4P75A 1OY9A 3PEHA 1GXTA 3MFHA 3JYTA 3I5BA 3H59A 1C4AA 4OYXA 3VWSA 3H4DA 2E7VA 1FWLA 2JL9A 2FGOA 3KUHA 2BE7D 2HWTA 2IM2A 3H5SA 3I31A 2Q1LA 1VQSA 2I5JA 2M3DA 3BGFA 2R3VA 5LMUF 3C46A 4LRCA 3D67A 4E8UA 3C15B 2QE5A 5B7WA 1V6HA 4Y0FA 3M9MB 2JEGA 1Y00A 2FJEB 3MWBA 1NKCA 3H5XA 3E51A 3PVXA 2HK2A 2ZBPA 4IFVB 3MM6A 1S1TB 2DNGA 2OP5A 5D78A 2YBVA 3OPKA 3UWTA 4Z7CA 3A8IA 1KDNA 1Q78A 1D09B 1MNEA 3QLHA 4AT1B 3P8BB 1FEEA 3KLVA 2ZJRQ 3V6HA 3Q8RB 1S57A 2W7AA 5CCLA 2VKRA 4F04B 3T1HJ 2AU0A 1P1TA 2DNQA 1YJNS 4RNFA 5J2QA 4IH6A 3K5PA 4CH0S 1WC3A 3V81B 3MAAA 2A1BA 2V63A 1TVRA 2LXFA 2QSWA 2EFNA 4GKJJ 1B0VA 2BKOA 4RBTA 1UW9A 3PYFA 4FXVA 1ELOA 2OHDA 5KFHA 4M5DB 4Q2MA 5HQ8A 1YBTA 1RT1A 4PABA 4RU2A 1A9NB 1R7IA 1IKXA 2LDYA 3TEHB 2J6TA 1SPBP 4OYAA 4OYWA 4X4OA 2I9SA 1WOPA 1DQ8A 1VK3A 2C2NA 2MTLA 3CNQP 3MEKA 4HEA9 3TAMA 4AUKA 5D3GA 1NHUA 3O2IA 1N8RT 2XMAA 2B9EA 2V69A 2Z2LA 2AJ0A 3JXOA 1IR1A 1CJUB 1F2HA 1CQMA 3CMAS 2C42A 5DQIA 4LSLA 3SFGA 5FIIA 3RW6A 1VK8A 3BGLA 2MHNA 4G1QA 4NLYA 3DMJB 3M8PA 3PFEA 1XQIA 5LXYA 3MM7B 4LR8A 1TL3B 2WOMA 4RW8A 2XI3A 2CNOB 5EUHA 5F8IA 1R8BA 1S49A 2FD2A 3MMBB 3PACA 3UCGA 4B08A 3UN5A 1FWPA 1RU1A 2DNKA 1SC6A 3F73A 2A10A 1CULB 3RB4A 2B4UA 2R8JA 1EETB 2PIIA 3CJ2A 4DV6J 5IT0A 2W1BA 4ZCIA 3KTQA 3M6VA 3GLJA 3US5A 3M8YA 3TJ9A 5J2PA 2CPZA 2OLWA 2B5JA 2UUTA 2V50A 2CPFA 1SBRA 4FNHA 3AXKA 3BSCA 3I87A 1WOOA 1W2BR 5KFEA 5DM6Q 2ZFHA 3TA0A 2FGCA 1X4BA 2F8MA 3EPGA 4KH0B 3A8KA 1UL3A 2C3UA 2G2YA 2R7OA 4X62F 3A8JA 2ZWOA 1FKOA 3DRYA 1HQEB 2JVRA 4TVAB 2NXCA 2XZWA 3LALA 2N7CA 3J81j 2ZH1A 2YX1A 4USHA 2MKKA 4XTTA 2J9CA 5DG8A 4TU9A 4DF4A 1PKUA 1X5OA 1NKBA 2J6UA 2OJ3A 1SH3A 3M8ZA 4F4WA 2HZCA 1K0VA 1RP5A 3QFHA 2BOPA 3T6JA 2IA0A 3CIMA 2CZ4A 2VG6A 3OL8A 1KLNA 1NSAA 2HYIB 3RRGA 3R2CJ 4HI2A 3JTNA 2XNRA 1UWBA 2JSXA 4Y3CA 2DXFA 2GMJA 4LFBF 3WQPA 5DLFA 2UUAJ 4ELTA 2KYXA 4OJGA 2IBOA 5FDLB 2KKHA 4CRJA 2A0FB 2WBRA 1T11A 3GB0A 4ECRA 2R7TA 2VKZG 4C6AA 3Q23A 2XO7A 3D4JA 3EE3A 2YKMB 1I94J 2A2DA 5I4MA 4QW9A 5I3QA 3JQJA 2P9CA 5I42B 4DCOB 4U8VA 4O0IA 1PO6A 4NXMJ 5DZ6A 4DI6A 1QLNA 4ZPVR 4DQRA 2DRAA 3CCSS 4DV1F 2CJAA 4AFFA 2J0WA 3IBCB 4CTAB 5KFRA 2V2KA 1JLEB 2LKZA 5LSRA 4F67A 1VR6A 3C3LA 2J0SD 3KK3B 2W2OP 3FBBA 2Y3YA 4DBQA 3JB9k 1IKXB 4Y2KA 1VRTA 3OTDA 2R8GA 5F8JA 1ZM4A 1QE1A 1FA0A 2Z56B 4YB6A 1ZAVA 4J9OA 3FMWA 4USVA 4ZCLA 1SL0A 3QJJA 3LW5C 1CG2A 3PW7A 3C19A 4WU3A 2NPIA 9RUBA 3MMCA 2OMLA 1P9YA 4JP8A 1L3VA 3W9HA 3E2EA 2Z8QA 3J7ZT 2DGTA 2PMHA 3KJFB 2KO1A 1RT5B 2YX7A 1N34F 3FMBA 3LAMA 2EW9A 4MIWA 3LGHA 3CVKA 5HK4A 3KDOA 1HHQA 3K5OA 2BE2A 5CYMA 5T7LB 3PX4A 3RR8A 4FBTA 3BS9A 2KFNA 3THPA 1NSQA 2YH1A 1Q86T 2VG7A 3GP9A 1QSSA 4B3OB 3HSDA 2DHAA 2MJNA 2UXDF 3KFWX 2R7WA 5DO2A 3VGTA 4NXNF 3CCWA 5ETRA 5LMNF 2AYGA 1M5OC 5J2PB 4XO0A 3QIDA 1JK9B 3O44A 4Q2LA 5D4OA 1B3TA 3DOLA 3DDKA 1IKYB 5U47A 1WC1A 3KLGA 4ID5B 3DM2B 2MZTA 3R7BB 2BOAA 3U27A 5HQLA 3MR5A 1V3SA 4ZN3A 3I9ZA 3HP6A 4ENOA 5BXIA 5A0YB 2R2SA 3WBZA 1IBMF 4C0HA 3EZUA 4O23A 2YKOA 3PJXA 3I5AA 2UUAF 3R7NB 2NXJA 3BDEA 4RW8B 2P5VA 1HW9A 5FJ4A 5K8NA 2APOA 5E2QA 1EP4A 1TELA 4R0EA 2BR0A 3VTIA 3PM9A 1W26A 3PEJA 4HVZA 4NMLA 3M8SA 4PUOB 7FD1A 4C8YA 1FE0A 3NGSA 2PN6A 2IBKA 1RAGB 5AE3A 2XCPA 2XSJB 4WZQA 1RTHB 2B4PA 2X1AA 2BJ3A 1UP1A 1FJ7A 4QWDA 2IY5B 2V8HA 3TR5A 4DOZA 3FNNA 1S59A 4DX8H 3CD5A 4M5MA 5HO4A 3EDRB 3FEYB 1X4AA 4KGMA 4O0NA 4LF4F 4FPIA 4J9RA 1C1CA 5AT1B 2W2QP 4PG6A 3TZWA 5D15A 4DR5J 4JV2A 2EPIA 1HWIA 1S4EA 3VR1A 2LYVA 2MGZA 1AUSL 3H40A 4IUFA 3KJQB 1ZPVA 2P6SA 2VDHA 1JB0C 2ZOMA 4ZVSB 4ZDNA 4H4KA 3T5JA 3BO4A 2J9EA 4OZLA 4OJHA 1B0TA 4ZP8A 5LOQA 4F3OA 2HNZA 3IG1A 2VD3A 1SVDA 1UJ5A 4GKKF 5ETVA 1VIXA 1M5HA 1SJQA 2RQ4A 3W2VB 4B3TJ 3QRPA 1D8YA 1JLQB 5DJBA 1T95A 3MUVP 4DR4J 2AYEA 4PWWA 4CQ1A 5K8OA 1I94F 4PQUB 3AOBA 1Z4UA 3MR7A 5KFZA 5KFQA 2CG8A 3W5YA 2W4PA 3CDAA 1FXDA 1RB0A 1TAUA 3FCVA 2RVJA 2B9XA 4ZVOB 1J2VA 1ITPA 3MTJA 2Z0GA 2NUUG 2XWYA 2G0CA 2X3DA 5C24B 2YKNA 5F8LA 4A8MP 1NAQA 3H4BA 2XO6A 3JTOA 5IFMA 3VAKA 2W9BA 3I9V9 1JLBA 2M7SA 5L1JA 2N82B 4B3MF 1UAWA 2HK3A 2LCWA 5KFVA 2PA3A 3MGJA 1VRUA 2E1CA 5L39A 4ILMA 2EFGA 4OLPA 4UOHA 4UUXA 2ZD1B 2V4JB 1XNQF 3CDUA 3DGPB 2M8DB 5MAOA 1HNZJ 4ED2A 3JQMA 1IXKA 4I2QB 3D0GE 1MMDA 2MEWA 5IC4B 1F60B 4TYBA 5EX3A 2HVHA 1BQNA 4NPOA 3MD1A 2VQFF 2QMUB 4DX6A 1H98A 4FVCA 3VGUA 1RHJB 4NASA 5HMWA 5LJ5Y 4DQQA 2FLLA 1TUVA 3MEEA 4ES3A 1PYOB 3MM9B 5DDOC 2CQCA 1NSKL 4WIQA 5BYSA 2WTFA 5D0EA 4O3RA 1XTZA 3FBCA 1FNXH 1WKKA 3IC1A 4NLRA 4YB5A 4USUA 3M6UA 1TK8A 3NKYA 3BB5A 3FQLA 2AJ2A 2NS1B 4FN5A 3PX0A 4URQU 1FO1A 2J8AA 1SJ3P 2OSRA 3O3LA 3UD3P 1FFSB 4F4KA 1QAJA 2C3YA 3CC4S 1CPZA 1LW2A 2J0XA 5IC6B 3G4SS 1X60A 5F9LA 1FD8A 1ROFA 2LA4A 1AYEA 2DNNA 5EHHA 1MLAA 3G6YA 2DEJA 4H4OB 4U9RA 4LQ3A 2Y1LB 3FK4A 3W5XA 4V19X 5FLXU 4X4PA 1L5UA 3NWGA 4OIXA 5DLGA 1BHNA 1JLBB 3B78A 3SCIE 4I67A 1LWFB 4OZ5A 3Q86A 5KFUA 2L9NA 1U4BA 4FNIA 2MHEA 3E01A 1BWVA 1YRXA 5HI7A 1XJWB 1AROP 3HT0A 3U7JA 3CUNA 2CQBA 3T9NA 4QR2A 3EYZA 4A8YA 3CCTA 2YKPA 1VC5A 1GFWB 1RK8A 4LBPA 4WTYA 4J5OA 5A2QU 2R7SA 2F4FA 4K59A 4MFBA 3DDNA 3BQ0A 4DQSA 5F3TA 1JLQA 1Y5IB 5HLFB 3W8GA 2UU9F 1FESA 1TL7B 2XMJA 4K50A 2HNYA 1KHWA 4DCJB 3VALA 4EWTA 2FLNA 1S1WB 4F0KA 3HFKA 4RKUC 2RB7A 1M1HA 4M94A 2V94A 4F4XA 3R5BA 4LF8J 4BHQA 5LXRA 2HKEA 3FGVA 1S0VA 2DH9A 2WRMA 3GZ7A 1UCNA 4WFBQ 2RRBA 3HFZB 2A3JA 1LQ9A 3N6MA 2A2CA 3MM8B 2OPQB 3MPUB 3OL9A 2PGCA 1HL6A 1SI9A 3JSYA 4ED4A 4LFCJ 4EEYA 1X4DA 3IBFB 1AUDA 2ILYA 2HG4A 2OPSB 3NRBA 4NRTA 4P9SA 2VL1A 3S1TA 2KVIA 1RT7B 2MZQA 1SC1B 2YNGB 4HL9A 4DUZF 2UUBJ 4ZPDA 3SBMA 3OFFA 3J81Y 1JJ4A 4Z2XA 1DY3A 2C2KB 3THVA 2BM1A 2BBEA 1FCAA 2CIMA 1DHMA 1JIHA 4CLPA 2HHQA 4NLUA 4ZKAA 1X4FA 2MQNA 2EI5A 1ZM9A 4ELVA 4ES2A 2B3TB 2V8PA 5L46A 1N6QB 2HFSA 3QGPA 1XNQJ 3EZ5A 2AW0A 3VHQA 1RWNB 3MEGB 4K4XA 3GWCA 3DC2A 5RUBA 4EUVA 4F0HA 1OY8A 2VONA 2E5JA 3OTEA 4RNNA 1QUPA 2AWZA 2AQ4A 4CH1A 2V68A 4DS4A 5ETSA 3GSIA 3QAUA 1RAJA 2IAJA 4D3HA 2B8QA 3IGNA 3GV7B 2GGPB 4LVOP 3WC0A 4PG8A 2FY1A 1RLCL 2VV5A 4KFBB 3UCUP 4DV0J 1FX2A 1NZAA 1WI6A 1SC4B 4F7VA 2O66A 2QRRA 3DHWC 1LWXA 2P9GA 3HULA 3PO4A 1VCTA 1KKHA 4M5HA 4D3GA 2RKIA 5AJ3F 2PA8D 4C3KA 2ABYA 4C11A 1IWGA 3V4IA 2GIRA 1U24A 4RUAA 4QYZK 4BC7A 3OLAA 4DG1B 4NWBA 2XY6A 2OPRB 2W9AA 3NS6A 3R3TA 1IM4A 4EBDA 2GW8A 3OL6A 4O4GB 4UZCA 3GTYX 2CPHA 5CQGA 2BKNA 4ZPBA 2PMWA 3KLHA 5KFCA 5KFAA 3GIJA 2XHCA 3OVSA 4F4AA 1CSJA 1RAFB 3KJVA 4NA3A 1RT2A 4QIFA 4JYAF 1CQNA 1T9YA 2JOQA 1Q53A 3R8YA 4ECZA 2XQCA 1T3OA 1FVQA 2DBBA 3G6ES 4R8UA 4J9QA 2HHWA 1UTAA 3OR2B 2F7VA 2EC2A 1JLAB 4DUYJ 2PI5A 3U1MA 4X64J 2KB2A 1GAOA 4PXBA 1FF2A 5HJXA 2ZITA 1MWQA 1SQFA 4QW8A 1FJCA 3PW2A 4M5KA 3ZFVA 2OD4A 1RHRB 2AX1A 3CCZA 3T19A 3ZZRA 3RGIA 4O44B 3AAWB 5CXTA 1LFPA 5KG2A 2M2BA 4JI2J 3KNAA 3THTA 2HFVA 3TYTA 1VQ4S 2CNKB 1JKHB 2HHVA 2W2MP 1MN7A 2QN6B 3CCLS 3T5LA 2ZBIA 1D8ZA 1PIEA 3TZYA 2KG1A 5C2GA 3I55S 1QTMA 3TUPA 2JLEA 2H5EA 5D0GA 4EU0A 1G6BA 1RWWB 2F8EX 2ALYB 4U67Q 2DRBA 3P4UB 4DL6A 2PI4A 4TU7A 1SH0A 1PGZA 3NNAA 2ROGA 3L95X 4OMFG 1E6VB 2QLJB 4A8KA 2ASJA 2XSJA 2ZVIA 2PEHA 3FFIA 1NLKL 2IC3B 3V4MA 1H2UX 2XLJA 1PC4A 1CS4A 4A8FA 1NSPA 3ZNJ1 3LOUA 2ZDPA 2KHCA 3RBXA 2KH9A 2B9WA 3LP2B 4OI1A 4DV7F 5HBMA 3KG1A 4K4YA 3NGDA 1UKUA 2R42A 3NGTA 4J9VA 1OSDA 1RWOB 1FDDA 1WG1A 3TQEA 1NPPA 5E7OB 3JSBA 1MU2A 5CD4H 2O01C 3PJWA 1NHKL 1RT4B 4LFAJ 3RG6A 4QZVB 5J2NB 4B9UA 1ZM2A 1HD1A 1UEVA 1HWKA 3BF4A 4EK2A 2CQ2A 1T0TV 4RW9B 1H7XA 3CJKA 4YHHJ 3DOLB 1RWUA 4F2RA 3QJPA 2B6AA 3BPSP 4IRDA 4FS1A 4DDFA 3HVRA 3C14A 1N6QA 3C6TA 2CPEA 1CULA 3RAXA 2COLA 1TAQA 4UY8T 2VG7B 2H9ZA 1TQLA 4ZN1A 4DF8A 1NM2A 2YKAA 2UV8G 2D9PA 1K73T 2OO4A 2IFXA 1VLYA 4MK8A 2YNFA 1S9GA 5GADI 2ZH4A 2CA9A 1WTBA 3NNCA 1U6ZA 3DMJA 4YY3J 1UWAA 5ETKA 1NK4A 2XMUA 1TKTA 1RAHB 2FZKB 2JHEA 3LF0A 2FC8A 3NLCA 1F9HA 3MTKA 8AT1B 5L1IA 2V5HG 1NK7A 2KT2A 3QT5A 1EARA 3P96A 4OZ2A 4QYRA 3VAMA 4P6QA 2NYIA 5L9XA 4U6PA 3CJTA 3RUBL 4ATNA 4DV0F 3OTCA 4L73A 3JSMB 1RWKB 4WFXA 1N0UA 1YRUA 1QAYA 3MMAB 1HHTP 1HYSB 2CVIA 3BR9A 2JX2A 2HGLA 3IWLA 4I7FA 3ZZPA 2W7OA 3QSYB 2ZUGA 3PYEA 3DLBA 3D3BJ 1BQMB 1MMNA 1DTQA 2YQ0A 4OYMA 3QNWB 2JFKA 4HH0A 2BM0A 3OVAA 2FHMA 4F25A 3V2UC 3AJ2A 2RHSB 5BYQA 1RTHA 4CH7A 3A3OB 3DRPA 2C2ZB 3K89A 1GH8A 3BEGB 3WIVA 3DFEA 1RE1B 4KGXB 4K5SA 2CQIA 1FFWB 1U47A 1IQTA 2AT1B 3EM1A 1H2TZ 5CZVA 1U45A 2VODA 1BC6A 1FKPB 3A8EA 3W65A 1HNIB 2RUGA 4K5RA 2WBMA 1GEHA 3LUYA 4IFVA 2MMYA 2RU9A 1OPIA 4NCGA 4CWBA 3MUTP 1DZ5A 2DITA 1OSCA 2OPPB 3BN4A 4ZPWR 1B7YB 4M5JA 3DLEB 4NZ0A 2ZH9A 4X4QA 3RRHA 2BJDA 1HR0J 3UN2A 6FDRA 2BJ8A 1ZOTA 4YP3A 5H9EJ 2MLXA 3CJKB 4MK7A 1C0UB 2ACYA 4QCLA 1YJVA 3SV3A 3HSJA 3QBCA 4KQZA 1K1SA 3NCPA 2AGOA 1VQOS 3V6KA 2IM3A 2KXHA 5KOWA 3CSKA 1R8AA 3TZZA 1HNIA 3DCAA 4K0KJ 1RA7A 2D41A 1HIYA 4I6AA 2XB2D 1HQEA 5HBMB 4JI6J 4JI7F 4GVBA 4OX8A 2EWHA 2GJFA 4WE1A 2IRUA 3ETMA 2ZE2B 1S76D 2Z4PA 5IV4A 1WEZA 3DU6A 1K44A 4QR1A 1HI8A 5L8RC 1IN0A 4KRWA 4YMEA 5A8RB 3L7PA 2OPPA 1SL1A 1RTJA 4ZITA 4L75A 2NZ4A 3IS9A 3K8VA 4NCGB 4ZVPB 2E5GA 3PR5B 5L1LA 3TARA 4YUDA 1YHQS 4DEZA 1TP7A 4DPOA 1TMMA 2W4CA 3PFOA 2RF2A 3SFUA 2DNOA 4KHPJ 3V81A 2NLWA 2FVCA 1SC3B 4FYVB 3S6EA 2IRYA 3FCHA 1YJRA 2H48B 3HVTA 1WDDA 1A0OB 4X84A 5KFNA 2F40A 1CJTB 1VI7A 4KO0B 3BO2A 1HLWA 2A18A 3CDBA 4JI8J 2WVFA 1YJ9S 3M6WA 5LMNJ 4I68A 2MY8A 1TKTB 2DNZA 3VF0B 4DCPB 1X0FA 4DUTA 3J7A1 3KNGA 1PG5B 1R6VA 3QIPA 3RBDA 2RRNA 4ZP7A 1S6QA 2JJ4D 2VFRA 3HVWA 2YWEA 1VQMS 4K7QA 3VAFA 2M4MA 4UY85 3Q2SC 1TMJA 4USKA 1NXIA 3W61A 5D3GB 2OELA 1FRKA 2R8KA 4PCQA 1T9WA 2DVIA 1FHTA 2C2EA 3MCNA 3NNHA 3M1VA 3CMQA 4ICLA 3MCSA 4HDGA 1P8GA 2W24A 4O3NA 1RTIB 3SQGB 4NCAA 2BYCA 2XMKA 1U48A 2J7UA 2V67A 3KHGA 4LSNB 4K2JA 2HSEB 2OFHX 2LVWA 3R5AA 3RAQA 2YQ3A 5CHCB 1RISA 4A46A 3H25A 3V6DA 3OT9A 1YGYA 2Y0SD 1U8SA 5E3AA 1SJ4P 5KT2A 5GADU 1KP6A 3FBFA 4KAIA 4MKBA 1KEKA 1PJ7A 3B4DA 4QWAA 1LV5A 4E98A 4X65J 4ALZA 2PSZA 1S1UB 2JVOA 3EICA 4RW7B 3MECA 1DFDA 3FFIB 3QO9A 1KQFB 1DQ9A 2VPXB 4K0KF 2K2PA 3DOMA 4RW9A 3VZHA 1VBKA 1HNXJ 4B9VA 4DV3F 4A8XA 2YNIA 1HNZF 5D4LA 3UW1A 3EX7B 3M8QB 4B9NA 4H4KC 1MG7A 2WSFC 2CWXA 3A13A 3DGVA 1DRZA 3CW2C 5DGBA 2JZ5A 2H1YA 4WCEQ 1N36J 2Y1JA 2G1HA 3PCOB 3KK2A 4DWIA 2B8PA 1R8HA 4KKOA 2VQFJ 4Y2IA 3DLLQ 3L4BC 1GX6A 4IDKB 1N5VA 1O51A 3CCVS 1CEZA 3M7VA 3BQ2A 1RA6A 4OI6A 2XWXA 2WVBA 5HQMA 1L3KA 2DK2A 2WOMB 1S1VB 1NRKA 2AJ1A 7FDRA 1URNA 1E6VA 2BACA 5C42A 2HWHA 4ZCMA 1S1XB 1Q7YT 4B3SF 3R2DJ 4PPDA 3T41A 1XMOJ 1F6TA 2QA1A 2NZCA 3BM7A 4UOFA 2C2RA 3QJLA 2QLBB 4N7TA 2K1RA 1FD2A 3ADAC 2MKYA 3AH6A 4L3KA 5ETPA 4LF5F 4W90B 4O3QA 5J2MB 1N32F 2CQ4A 3GYXB 4JI6F 2ZHAA 2ZH2A 3PKMA 1JXVA 2H54B 1GMUA 4RW6B 2C22A 3BBFA 4DL4A 4I64A 3ZZUA 3VAGA 3D6MB 2AEMA 1T9VA 1HPZA 3IO1A 3I96A 2ZOGA 1IBLJ 4OZ1A 5CH7B 9ATCB 2MYFA 3H8YA 3HJFA 1DQAA 2C3OA 2BJ9A 2KN4A 2HFNA 2YWKA 3MAAB 5L38A 2N3LA 4OI4A 3VAIA 2WONA 3I0SB 4PYAA 4QIEA 1S48A 2XS5A 5G0RB 2AIRB 4UUWA 1FJGF 1NZ8A 3OTBA 1SIWB 1WKJA 1OQ6A 2DHXA 3GE9A 1U1QA 5H1SV 4KPYA 4OX9J 4L76A 4BS2A 1JLFB 1WC0A 2YWWA 1N5SA 1AFIA 3CJ3A 3CJRA 1AA1B 3CIZA 3W2WB 1RT6B 4FPRA 1KNZA 3I0SA 4LSZB 2E5IA 2GJ2A 4CO4A 2OPRA 4ZPCA 2N7YA 2FLPA 1HNXF 3P5BP 2I5JB 2HHHJ 4GO5X 3ENQA 1H6KX 4DV3J 5HL7Q 4WF9Q 2E1MC 4C97A 4O4RA 1I6JA 2FC9A 8ATCB 2EK1A 4HDHA 2RH3A 4CLWA 2KZZA 2CJXB 5IOLA 1X8DA 2KT3A 1LWCA 3DLGA 5C25B 4H54A 5HP1A 4KFBA 3AD7C 4W98A 2MB0B 4CI0B 5KFTA 1WACA 5AXLA 3JAMU 1XR7A 4PWDA 1FWKA 1NB7A 2QA2A 1QVFR 2DGQA 1HBMA 2CVEA 4JI0J 1PAUB 2JLFA 1AZSA 3X3UA 3GG1A 3AB2B 2I6WA 5KFGA 1T9UA 3C2PA 3GJSB 2JEIA 4M5IA 1X4EA 2K7JA 2J8SA 4ECXA 4Y65A 2DGXA 1RLDA 1TFWA 1XWLA 3N79A 2R8IA 5C7PA 5JVHQ 2YNHB 2BKPA 4Q7AA 2FQQB 1A7GE 2VPYB 4IDKA 3MMJA 5IM0A 3SCKE 3FKBA 4TNOA 2QV6A 2YNHA 1XNRJ 5F8NA 3OFEA 2ROPA 2XGPA 5AE1A 4N76A 3G82B 2CUYA 2VJVA 1M5VC 3R1LA 1HI0P 3LAKA 4KYZA 3W8PA 4ECTA 3CC2S 2QFJA 4PWDB 3W2WA 1N36F 1S5ZA 2DNPA 3SIPB 1IKWB 2AJ4A 2UVWA 4WP9A 2UZAA 4O3PA 4N47A 1YJUA 2V4JA 2LQBA 2HRYA 4ZVUB 5HLFA 2NQPA 4LF9F 5B09A 2QL7B 3VVTA 1OYDA 1ZA1B 2GO9A 2K3KA 3GV5B 2ZH3A 4GC7A 3TEGA 4Y2MA 2E44A 2HQCA 1QTNB 3K17A 1IM6A 4PR6A 1ZM3A 3VGSA 3AD8C 4F3MA 3KYLA 1N52B 1RTIA 4P74A 3SQGA 2HGNA 4CLKA 3IAS9 2MQPA 2GVDA 2GIFA 2WHOA 2EG1A 5J1NA 2BANA 3OJUA 4DL5A 4V1Ak 5AJ3J 1ZTWA 4CO2A 4WYWA 2DJWA 3GONA 1UJ6A 4YEAA 1JLFA 1T05B 3LGMA 4URGA 2DO0A 2DR5A 3PJ9A 4UOCA 4DL3A 3UVJA 3G96A 1GT8A 4XK8C 3L3CA 3ZZYA 1Y11A 4CLUA 4PQUA 4PPZA 1AT1B 1JJ2R 1QSYA 1WI8A 4N8NA 4DZDA 3I32A 8RUCA 3J80Y 3NOGA 3EDQB 1KQKA 2NSCA 5CYJA 5IT9U 3NCRA 4C8MA 2W25A 3ILOA 1L3TA 2ZBQA 2ZJPQ 5GMDA 3G86A 3IG1B 2CJYB 5KG0A 2JEFA 2WAQD 1R3NA 1DAXA 5D4PA 1NJZA 4G65A 4OV6A 4J7CA 1BLUA 1WEYA 5DRKA 4ED8A 4OHXA 1HR0F 2OTLS 2AP6A 4KJIA 2PC6A 2HEKA 3MI7X 1FNMA 4OHYA 2IYGA 1UFLA 1QUVA 2HQGA 2GHVC 5DG7A 2HS0A 2KXFA 3W9JA 4NI2A 4C48A 4JV0A 5KG1A 5GAEI 2LA6A 2PO4A 3AY0A 1XNRF 4EYHB 2KFZA 2YNIB 4FYYB 5A2QY 4ETXA 1SCJB 1VJQA 3R6LB 1YDLA 2HBZB 4EBCA 4TU8A 4IFYA 1L3SA 2I1RA 3H42A 1JLCA 2KRRA 2M8HA 4OJ3A 4ZIVA 2ERRA 5CYQA 3D68A 2DCLA 1X31C 4QJVA 2NREA 2LP4A 2C3PA 2ZD1A 2KM8C 4LRFA 3QT7A 1RKJA 5ETMA 2HBRB 3OHBA 4AXIA 2DGWA 1HNWJ 2K06A 2X3GA 3DYAB 3N28A 3NXZA 3PV8A 4NL5A 2FJVA 5KT7A 3D54A 4CLFA 3K57A 1YBAA 1K9MT 1NK5A 2E9RX 3MOJB 1TKZA 1RHUB 4YDDB 2CQ0A 4X64F 4TY8A 4ID5A 2K3IA 2DNYA 3U1NA 4DR6J 3DOMB 2AZ3A 3GU0A 3HHDA 1VOMA 1APSA 5F0UA 3WC2A 5CZXA 4TQRA 2R7RA 4YQWA 4RW7A 4JI2F 3LP0B 5IQ6A 4WU2A 5A8WB 3MAQA 1G1XA 1H72C 1LNQA 1TL1A 3H98A 2KZMA 1S6UA 2RDIA 2QT7A 1SJRA 3MF5A 1FKPA 1GNKA 1UPPA 1NH7A 1LK7A 2YWFA 4FZVA 1Y5NB 1X5TA 2HBQB 1R8CA 1S6PB 4WBFA 5EWGA 2FLOA 1C0UA 1VHFA 1U0HA 3UNYA 4FKYA 4DR1J 1YVFA 3D66A 3BGRB 2E1AA 1CJTA 3A3PB 2LLZA 2RILA 3FJ2A 3OLBA 3DLEA 3BKFA 1ZYQA 2AF6A 2V2VA 5K20B 2XLIA 1GMWD 2VIHA 4IYQA 4B3RF 3J7YU 3MFIA 1UA0A 1TV6B 5LT5A 3DRRB 4NXMF 5IWAF 4UOGA 1NDCA 4I56A 4CM0A 1ICEB 4C0OC 1HBNB 4FF4A 7AT1B 2IJRA 3H2UB 3MR2A 1TV6A 3CC7S 3WHIA 4F4YA 1CJVB 2X51A 1YG0A 2ADBA 1TTHB 2HLUA 3LH2S 3CCJS 3IR7B 1UVJA 4GRSA 1JX4A 3HKZD 1KS2A 5IS2A 2ZH7A 1F1BB 3HHLD 2OGUA 4I0WA 3LPYA 1IJEB 2HIQA 5FLXY 4C9DA 2WVDA 3HSGA 2J7WA 2VC1A 5LL6d 2LXIA 4V19J 3CXCR 2Q6CA 2B4OA 5E41A 3BSOA 2EBGA 3AB4B 2OH2A 1YBUA 1E6YB 1UMJA 2BJ1A 3HI9A 3I0RB 3N9UC 2YQ1A 4DX7A 5LSOA 4NCBA 2GHWA 3O8WA 3IS9B 2OEMA 2W4DA 2PFFB 1VQLS 4GKJF 3LP0A 1C2PA 3Q8VA 4XAKA 3BKUA 3NL0A 2GNKA 1Q4RA 3QMQA 3BBBA 2DIVA 3EGNA 1NJXA 3LP1A 1LXJA 1IBCB 3VV2B 2CYYA 2ZC4A 4FBUA 3QPIA 3IXQA 4BBYA 3IR6B 4ZJOA 1F3VA 3VCDA 2GS8A 2XG8A 1WNEA 3RAMA 1XMQF 2M52A 1NKEA 1VGYA 2VZ9A 2X1GA 4UW2A 3CGIA 5KFDA 1GMVA 3JQKA 1DLOA 3IFEA 1FK9A 4P7TA 1RYSA 1MSWD 2V8VA 1FJEB 4FKXA 1X9WA 2UUBF 1RU2A 3OXGA 5DM7Q 3LP2A 1ZPWX 3OBIA 4KB7A 3C6TB 3NGKA 3DRSB 1QD1A 3G9CA 2HQDA 1HHSA 2MKSA 1U02A 4BWJA 1G7CB 5KFIA 2KVQE 1SV5A 3EXCX 3OXLA 2Y1IA 1Q79A 4DR2F 4TY8B 3WZ0A 1S97A 1Q81T 4FXDA 5KFSA 4C8KA 3IWXA 1WUUA 4LBHA 3BSNA 4ZJLA 4G3IA 2E5HA 5HVFA 3I5CA 2DY1A 4B3RJ 1RACB 5IV3A 1VRTB 3D7SB 3FZ2A 4A8QA 4I7FB 5D0HA 3POTA 3ZTOA 1HYSA 3TUZC 4OL8A 1VQ8S 3D6TB 2JNJA 4TXSA 4F8RA 4OFZA 4TYAA 1JLEA 3W5ZA 4PQAA 3RU0A 3HHLB 3CJ5A 1JLCB 3PW0A 2AJFE 3DRPB 5EGYA 2ZZNA 1RADB 2RS8A 4ZVRB 1ULRA 1P9QC 2L9WA 4QYZJ 2DIUA 4OX7A 1N56A 4KPCA 3NP5A 2VPWB 4J9KA 1B0PA 2BMBA 1HBNA 1CJUA 2CPJA 3AHPA 4R8UB 2YKMA 3IWNC 2GHPA 2IYIA 3LQVA 4OHZA 4P10A 2UP1A 2E9ZA 2RQMA 5F8HA 2RDDA 3D0HE 1NHVA 1EKSA 4PXDA 4X4NA 2XY5A 3KK3A 2CFXA 3K5LA 2HAFA 4TLQA 5FDLA 1C0TB 1PAEX 4O44A 4LFBJ 2YKQA 1SJ1A 4DR1F 2O67A 2DNLA 3CCQS 2BUNA 5E5NA 3CJ4A 4XDCA 3W64A 2OEKA 2MXYA 1WSRA 1DBDA 4ED3A 3C6UB 5KT4A 1N5QA 3KG0A 5LM7E 4OI3A 1RT4A 5J2NA 4WFYA 1O5JA 4EI2A 2XZTB 2KG0A 4KIAA 2UUCF 1IR2A 4L6V3 3RBZA 5JUMA 2IDEA 3BYRA 4USJC 1M1GA 3BBCA 4LF6J 4QU6A 2G4BA 2RT3A 1WEXA 1RZMA 3CE8A 3GR0A 3O5TB 4TN2A 3UQSA 3UVJB 1GTHA 2DO4A 3H2VE 2NSBA 2VBXA 3LO3A 3W62A 4FS2A 1EX8A 4EZ6A 1VQYA 1NDPA 3BYPA 4NEYA 2HAIA 4RUCA 1VFJA 3R6GB 4QIGA 3KLHB 1FERA 1O0PA 3DXBA 4ELUA 2CJ9A 1S10A 1KHVA 2CQ1A 3ILJA 3TVZA 4YR0A 2CPYA 2HGMA 4E0DA 4P2SA 3J7Z5 4X4TA 2B5JB 1EAYC 1QDUB 2CZVC 2XEXA 3QWPA 4YB7A 3UE2A 4AYBD 4Q44A 2BQ3A 3LPEA 3MEGA 2ROEA 1LEOA 3KUEA 2VU5A 3KXDA 2K7KA 1XC9A 4MTPA 2JC1A 1R43A 5H9FJ 3KK1B 2HZAA 1FDNA 1MN9A 1GK8A 2QLXA 3B8HA 4DV4F 5J1EB 2HQFA 2HHPA 1LW0A 5EWEA 1TL4A 3GIIA 2FJDB 2WSEC 2GGPA 3ZZTA 2V9KA 1VC0A 1JWWA 5C5JA 2BVZA 2OAUA 3M9OB 2Q66A 2F4VF 2A6OA 4DR7F 4ER8A 4A8OA 3CWJA 4YR2A 2DPIA 3M2RA 4KV8B 2AHOB 3GV8B 2P9EA 4LSLB 1XMQJ 2QSFA 4HTJA 5D6GA 2XCAA 4NI2B 4X4RA 2UVRA 3G2XA 1VQ6S 1VQNS 3QRQA 2JRSA 1RBOB 4MKAA 1KN6A 1RWVB 1C1BA 2FJAB 3PYGA 2VUGA 1N0VC 1VQPS 2V2QA 3R97A 3LANA 2VA2A 4IR1A 4S0MA 1XEZA 4FVMA 5GVQA 1JMTA 4NXNJ 2IM0A 3HZEA 2FZGB 4USMA 4YHHF 1OIAA 1YJWS 1IBKJ 2BE9B 2R7QA 3D0IE 2XHWA 3ILLA 2GVZB 3C16A 4OHWA 1TL3A 2RHQB 3BJYA 5F41A 1XR5A 1X5SA 5GAGI 2VFTA 2XNQA 3G8QA 3ONQA 4G1QB 4DXLA 5HSPA 4OYOA 1FTRA 2R7UA 1HBMB 2JH3A 5AXKA 1RT7A 2YNGA 5KT6A 1TKXB 1S77D 4JV5F 4ZHRA 1RT6A 1V3RA 3TQ1A 3LA0A 1LXNA 2EXUA 2J9DE 3NCQA 2IVFB 4OQJA 3ZZ0A 3PZPA 1UEUA 2J6SA 1ZH5A 3EUNA 4XIUA 4ZVHA 2CPXA 2XGQA 4QU7A 4MFBB 5HAOA 4P2FA 4U96A 4FYWB 3MM6B 4IH5A 4OHVA 4OX6A 3U02A 4CLYA 1D9AA 3P6YC 3OFHA 1X9SA 3BZQA 5EN1A 3NG8A 2E1RA 1VYAA 1X7VA 4Q0BB 2LEAA 2L41A 3M05A 3OJSA 2EFVA 1HPZB 3BV8A 2RD5C 2OD6A 3HDSA 2HFOA 1I1GA 2IJFA 1NNDA 3KDNA 3KLIB 1BUXA 4PEOA 2CADA 4JUZA 3NGUA 3C66A 3GCWP 6FD1A 2RDJA 1FKAF 4ZVEA 2R2TA 1QSLA 1ZAXA 2GC8A 2L9DA 3ZZOA 2XY7A 4WXOA 2LEPA 3GFZA 4HHHA 4MIBA 3K8WA 3WIUA 4HYKA 2FDNA 2QFIA 4NYZA 5T14A 5SUHA 2HQ3A 1NCLA 3M30A 2AEJA 1I3OB 4WKYA 4ZHRB 3PIOQ 4QIVA 3HCXA 4J9LA 5K5MA 3TAQA 1VQ5S 4OI0A 1BY9A 4C8ZA 2QTWA 1B64A 1Y3KA 5F8GA 4YR3A 1HNVB 3W66A 5KOXA 2MZ1A 4DSFA 1FTCA 5D8HB 2HFZA 1EJ7L 3HX9A 3I6PA 3EPIA 3AD9C 1S72S 4ED1A 3OTOF 2L48A 5HJYA 1S0MA 1SKUB 1FRHA 2Z2ZA 2FJBB 3EMTA 4P52A 1Y7PA 3TX0A 5LJ3Y 2QC3A 1S7HA 3PO5A 4DR6F 3OV7A 4NLGA 1LWFA 2FTRA 1RQ0A 4O3SA 2J0QD 5J2MA 3FQKA 3TJ8A 4K4VA 2MZJA 2XYPB 4Z7YA 4QPXA 5DDRC 1YWXA 2ZM6F 3BPDA 3SSSA 1TKDA 2CXEA 2YXLA 4WP3A 2E7WA 2LU2A 5JVGQ 1RHKB 5A6PA 1N4LA 2LFVA 4ECSA 1LWEA 2FHJA 1BQNB 1URRA 2VBZA 3PKYA 1LFWA 1QAXA 2EK6A 1RCXB 4OLOA 1X4HA 5KT3A 1VBZA 2CQDA 4CNZA 1W7WA 1S1UA 3NWRA 2ZH5A 1YQHA 5C25A 2DXEA 1F5CA 2Q3PA 1X4CA 3KK2B 4EMDA 2EKNA 2G0IA 2I0XA 5JXSA 5KG6A 2CJBA 4A48A 5B0DA 5IXUA 4DV6F 4LF6F 1UVIA 3FEXB 4LT6A 4CYUA 4DSJA 3NBPA 3H5YA 5IQQA 4YN3B 3MM9A 2DHSA 3DHXA 2DCUB 2QL5B 3SDEB 2N3OA 2RU3A 5L1KA 1KVKA 4DPYA 2GQCA 3Q22A 2W9BB 2ADCA 2FY8A 2HMIA 4Q0BA 2RUSA 4JI0F 1NK9A 5DG9A 4JI1J 3QO9B 1T7PA 1FDAA 4LIWA 1VHIA 3LTOA 2DNRA 2HNYB 2MKIA 3PG9A 4ZPAA 2DH8A 2Q79A 4RW4B 4UZBA 1LOUA 1UZHA 1SUQA 3CJSA 1U8WA 1SXLA 2RAQA 2AEFA 2DHHA 2GMLA 3ZTQA 2KTQA 1FE4A 4PZVA 1S6QB 5HMXA 1TKXA 3CCMS 2VOOA 2XS7A 1R0CB 4X4VA 3HO1A 3ENVA 4LSNA 1REGX 4DSLA 1S79A 3SCLE 4ANCA 4CNYA 5A8KA 5CCMA 3L09A 2B4VA 2DTJA 2PMZD 3SZ2A 3G6XA 2RRAA 3NAHA 2BRLA 2YH0A 1NK8A 2DR8A 5C24A 2ZH8A 5B0BA 4CO0A 2MZRA 2CJKA 5HROB 3OUYA 1RABB 3HVTB 4JOUA 4RW6A 2HIYA 1UPMB 2KYZA 4DPWA 4B9MA 1FDBA 1G4CA 1O8BA 3GQCA 5T41A 1Q16B 4DV7J 1RWMB 3ZC4A 1C1CB 3T9ZA 2K1RB 1J5EF 3OTOJ 5KFBA 4TQSA 2KL8A 1U26A 2DYAA 4LF9J 2DH7A 3MEEB 3QIPB 4RWWA 1S1XA 3BGUA 4HHUA 4CO5A 4N77A 1S1VA 3N6LA 1VLOA 1RHQB 4ZOSA 3R27A 5DGAA 1JXEA 3HHLA 1LW0B 2EC0A 4P73A 2W8KA 4IOBA 4GVBB 4CLTA 2X7IA 4NE9C 1EP4B 4CLLA 2RMLA 2PT0A 2OTJS 3I56S 3KUGA 3POTB 1KR4A 1UFKA 1ZAWA 2PE8A 2DHGA 4F36A 3VQSA 5H9EK 5LSLA 3FEZA 4MYUA 2CQHA 2W9CA 4K4ZA 4GC6A 3DRXA 3ET6A 4HT7A 1RTJB 2CPIA 2MLYA 5F8MA 1R0BG 2WSCC 3QZ8A 3M9NB 1JJCB 1UJ4A 4IR9A 4U7UD 4NLTA 2D9OA 1IKVB 1WF0A 3I4PA 4AQYF 2VG5A 2YKNB 3GJRB 1VMBA 3F0NA 1S0OA 4DU8A 1U09A 4QR0A 4WXWA 2J5AA 4YDXA 2GIQA 3MDFA 2V4RA 2BEFA 4IRKA 3ISNC 1RWPB 1Y0HA 3PW5A 3DGPA 2QA4S 1N33J 4C98A 2MY7A 5I3UB 1Y3JA 3JSRA 3TOQA 4F4ZA 1FVSA 1U1LA 1H2VZ 4N41A 3BKTA 1MWZA 1R27B 2EVZA 2N4DA 3MEDA 4G1PA 5CYMB 4DUZJ 1R8PA 4PAAA 3DOKB 1U7LA 1LKZA 4PXEA 2KDOA 5THWA 3AOAA 5ETTA 2WCXA 1I51B 4ICLB 4BCAA 4USIA 2ZC3A 2FB0A 2HLTA 3MMCB 3UO0A 4DMZA 1KSPA 1YKWA 4F2SA 3G8TA 4P2XA 3ENAA 4M5GA 1F9EB 3AODA 4M8LA 1JJHA 2D74B 2GAHC 1T9TA 2YVSA 4NRUA 1WSVA 4NLDA 1UETA 3PYDA 3PIPQ 3KLEB 4Q8EA 3EXYA 1RI7A 1KTVA 2BE2B 2J76E 3M2UA 3VAJA 3UCZP 1FXRA 5KG4A 4EBEA 3HJVA 2V8DA 3IRXA 5A6WA 1T03A 1RDRA 1U2FA 4IG3A 1WTFA 1NMEB 3DDIA 2G1DA 1NPRA 3TUJC 3VQTA 1T8EA 5KFPA 4F26A 2OIHA 4DR7J 3SQOP 4JI5F 1RTDA 2XI2A 3CD6S 3M8WA 2HHHF 4I4BA 4IRCA 1A6LA 1R6YA 1TZ0A 4YOEA 2G9OA 2JDJA 4B3SJ 1P6TA 3DLHA 3IRXB 2I38A 3AJDA 4RBUA 3DN9A 3C16B 3OFGA 5F9NA 4EYIB 2LEBA 1WC4A 4JBCA 3GILA 3TX8A 2XMMA 1NO8A 4CO1A 4LREA 1FT8A 4L74A 4KHMA 1IBKF 1OMSA 4HTIA 4LBIA 1EHWA 2BW7A 2GQQA 2V0NA 4PWUA 3JSMA 3DM2A 1YZ7A 4R0JA 4J9NA 1AB8A 1EQMA 2WW8A 3JS9A 3PR4A 3BSAA 3BGRA 4DR3J 2B6AB 3DNCA 3MXHP 5KT5A 1XK8A 3CEDA 4ZVQB 1TFYA 3NAIA 3MR6A 1F0XA 3CO9A 4JI4J 4JV5J 1IBLF 4DJBA 3DOKA 4RX6A 3GJTB 3HLUA 3ILIA 1D9FA 3OXFA 1FK9B 4E2FB 3K7RA 3MCOA 3M6XA 1YLXA 1XBWA 3K58A 4A8WA 3K59A 1TL1B 2WVCA 4WJBA 3AA8A 1IR0A 2B7BB 3AJ1A 2JEJA 4X66F 4J90A 4RPFA 3W60A 4OX9F 2AD9A 4IH7A 4GMKA 5E0OA 4A47A 1N88A 5DQHA 3KOAA 2Y8WA 3KG4A 1RT5A 2BX6A 5DDPC 2WZ1A 1X9MA 3IA0A 1YIJS 3KLGB 1N48A 2WVEA 2G2ZA 2VFVA 3LP1B 3KHLA 1BWEA 3IP0A 1PYSB 2ATLA 1Y9OA 5K9FA 1Q8IA 2FZCB 2QX0A 2ZEJA 4IG0A 4RL1A 4U7CA 4XPCA 2D3OR 1WJ9A 3RYLA 3SSRA 3ET6B 2HFUA 5KAKA 2DR9A 2POKA 3T5HA 2C2MB 1NBEB 1WWHA 1S9EA 1UFWA 1ZS6A 2BRKA 3H7HB 4DV5F 3G71S 2F9JA 3CT9A 3OVBA 4ZLNA 4U8YA 4DR2J 4F0MA 4FF3A 1FRLA 1MROB 4B3TF 4W4MA 5CYQB 5HANA 3OSPA 2Y9HA 1B7FA 1Q8BA 4MAKA 3Q0AA 2G0JA 3T5KA 3BDPA 1XIQA 2MSTA 4DUYF 3X1LB 4PG7A 2Z2MA 3D6FB 2ZJQQ 1M5PC 4K4UA 4ZLPA 3C6UA 4KBIA 1K1QA 2ASYA 1SKSA 1N33F 4R25A 1DTQB 2HVEA 1QE1B 1H38A 4X62J 1VJWA 1RCOB 1Q5VA 4NA2A 1EZZB 5L9NA 1SL2A 5EWFA 3TUIC 1VS3A 1EETA 2C2OB 3M2VB 4DV1J 2IRXA 1TUGB 2PDAA 4MK9A 4RNOA 1WORA 1FEHA 1RT2B 2RS2A 1WF2A 3SCJE 3TA2A 4RZRA 4DLEA 4YFUA 1WD6A 3FVYA 3RRKA 2BXJA 2KFYA 1T02A 2XLKA 2F5GA 2V9WA 2ZDOA 4DN0A 3M32B 2L08A 3NS5A 2VOPA 1OYEA 1AFJA 2N4CA 1P1LA 1JLAA 1HD0A 1T94A 2F9DA 4N8OA 2LQJA 4J91A 4NLSA 3W7BA 3WX8A 4C11B 1OO0B 5I42A 2RKIB 3GMGA 1QY7A 2LMIA 1UA1A 1UVMA 3N0VA 4AL5A 4J37A 1SUQB 2CWKA 2IM1A 4JI4F 5GAHI 5SZTA 4DLGA 3AA9A 5KFYA 1X5PA 2FHJD 6AT1B 1UVNA 5J1PA 1WOSA 2MKCA 3Q8YA 1RT1B 3MHYA 4G1IA 2GVDB 2RQCA 1U1PA 1UWBB 1PBUA 3HD2A 4ZCKA 5K8PA 2KXNB 2UXCJ 3Q24A 1WG5A 3HFVA 4X66J 2VC0A 3H20A 4ANDA 2AYBA 3P49B 3NMAA 4FP9A 4HKQA 1JQGA 1TUWA 4AXJA 4K4SA 2IVYA 2VBWA 2HHXA 2XYGB 1MU2B 4Q45A 3UDVA 3H5UA 1WHWA 4RUBA 3TW0A 4TKTA 1EIYB 2HW3A 1O6XA 4DFMA 4DL0C 5IT9Y 2UU9J 4NEZA 3JYTB 4OYIA 1CLFA 2HNDB 2HWIA 2AGQA 3ISZA 4PRFA 1M5KC 3MMBA 2XULA 1DLOB 1EB0A 1S1TA 3T3FA 2YPZA 4M5LA 4OYBA 4PYDA 1QVGR 3K0JA 4C8LA 3QZ7A 2H4YB 3KLEA 5EX0A 4HLBA 4GO7X 1N34J 2ZZMA 1FRXA 3G82A 3GFYA 5HATA 2IIHA 4WFZA 4DPTA 4I2PA 1VBYA 2V2ZA 1Q1KA 2WW4A 3KHRA 2EG2A 2UUCJ 1JNZB 1JKHA 4UQTA 2H5IB 2J7KA 3KJNB 4DZ6A 5AE2A 2Z58B 2W9CB 3RTVA 1R0AB 4NLXA 5F0WA 3IBWA 3UI3A 3HPOA 4KTQA 4ZPTR 2B43A 1PCAA 2FIUA 3I0RA 4HI1A 4DSIA 2B51A 4M5DA 1NJYA 2AZ1A 1RBLA 1V5VA 2ZKUA 4Q5VA 2MQLA 3O6QA 1S9FA 4MKYA 3UR3C 2VH7A 1TVRB 4ZLJA 4LR7A 4AE5A 3ZTRA 2XTJP 1FI4A 2F8HA 2DGOA 2GV1A 2OEJA 3JTPA 5HP1B 2VASA 4CT9A 2NPFA 3F41A 3NY0A 5JJBA 3M8RA 2OFGX 3KJVB 1CJVA 3DKDA 3TAMB 4ED7A 2OPQA 4IOCQ 3EJMA 4F02A 3P45B 3HSZA 3N6NA 5E3QA 3PHTA 5KFOA 5IWAJ 1QJHA 4LF7J 3TJAA 3N5FA 1FFGB 5KFMA 2MSSA 1GXUA 1JLGB 2M70A 2XC9A 3OUYB 3CCUS 5HROA 5DZ7A 2AJQA 2GAGC 5KG5A 1U2CA 5ITHA 2BV3A 1H3DA 3CMES 1CBKA 1S1WA 2ATCB 1GXLA 1QAIA 2D1CA 3HHNB 2AX0A 3AOCA 4X2BA 2MKHA 4LF4J 3L9ZA 5CAAA 1Y5LB 4WP8A 2V34A 2UVUA 1FNOA 3W63A 1PYTA 1S0NA 2H51B 1FRJA 1GMWA 5K14B 2HS3A 5E3PA 2H3EB 5KFFA 1RTZA 2KU7A 4QWEA 3KLFB 3HM9A 5D0RA 2BJ7A 3MZIA 2XYHB 1XMBA 2DRDA 2I8EA 3AT1B 3GR1A 1U1MA 1PILA 4RW4A 1S99A 3CDEA 3FZBA 1G2EA 1AW0A 2QLWA 4GKKJ 5GAGU 1U2RA 2GVZA 2VPZB 1WKLA 4DL7A 3QYYA 5C2CA 2V4QA 3MD3A 1J27A 1TK0A 3H0PA 1HARA 2QYCA 3CJQA 3RB3A 3J7YI 4B17A 3CULA 4ECVA 4Z37A 4M1KA 1D9DA 1UW4A 4C8OA 3ITHA 3DXSX 3CB4A 4LIRA 4Y00A 3VVUA 3HHEA 4DPXA 2C2DA 2IJNA 1RAOA 2UXCF 2ZZTA 3CO0P 4W92B 2CNLB 3IRWP 4ECUA 2Y8YA 1LK5A 1OQ3A 1REVA 1WF1A 2M9KA 3D28A 5KFLA 4P72A 5M2UA 2QA4G 4KHPF 4FYDA 1VIOA 4EFAC 4JI8F 3BGOP 1Z2LA 5KFWA 4KE5A 3NEKA 3KMSA 3UNGC 4L3NA 2VQEJ 4DL2A 1K8AT 2IA6A 1REVB 1GX5A 2OI2A 1ZBTA 4EGLA 4MJKA 3UR0A 1UZDA 1TK5A 2Y1RI 3KK1A 3FRYA 1J5OB 3MM8A 1H74A 2FHKA 5CABA 5E3RA 3U1LA 4A8SA 3ITHB 2RNEA 3TANA 1H0HB 1RT3A 1YZ6A 3PW4A 2VFSA 1OS5A 5BYRA 3FCWA 2MQOA 3BQ1A 1N54B 2BABA 3V5RA 4DR3F 1HMVB 3D9BA 5B0AA 1Q82T 2I2YA 1C4CA 3KMQA 1CJKB 1JXLA 3AQPA 4MYTA 3TAPA 1VBXA 1S12A 2AGPA 1Q0NA 2U2FA 4I69A 3QRRA 2IDLA 3GPAA 4NYPA 1FRMA 1ZZNA 2D3ZA 1DJ0A 1PBAA 4JI1F 1VQ7S 1HQUA 3VZIA 2WONB 1AXQA 5D77A 3D1OA 4ES1A 2PD1A 3PHEA 2QYGA 3DLKB 3RB6A 4M63A 4YB1P 4C7QA 2QIFA
chains in the Genus database with same CATH topology
1HWLA 2LU1A 4HHJA 3SMZA 4ETZA 4BDPA 4Y6IA 3M1VB 3BREA 1M5SA 1JLGA 4TLRA 4C3MA 2DNHA 3HXMA 1RT3B 2HMIB 2HS4A 1HQUB 3IN5A 3P3DA 4PXCA 4ZVFA 2F3JA 1J5OA 2HVIA 3GYNA 3W2VA 2SXLA 3R1HA 4KC5A 1KC8T 5C42B 1LW2B 2HVZA 4CZCA 4DSKA 2R2RA 3GG0A 2GJIA 2WK4A 4KO0A 1LWEB 4ILLA 1R31A 4LFCF 4C2MA 3QGHA 3PDNA 3QWUA 1HMVA 2E66A 1V3ZA 3TP2A 2RF2B 2BQRA 4FF1A 3UFCX 4PG5A 3CF5Q 1R0AA 5G4DA 5A0YA 1KD1T 3MR3A 3SV4A 3K5MA 5A8RA 2UUWA 3S8SA 1ZTTA 1DTTB 1HBOB 2MDAA 1IKYA 1SKRA 3O1LA 2VA3A 2B0GA 5HMZA 4I2PB 2ZE2A 2EKYA 4B9LA 2E7XA 1HNWF 4DV2F 4ED0A 4BC9A 4F3QA 2E5LF 1U1RA 4B3OA 4LUBA 2YY3A 1HBUB 5D4NA 2BDPA 3M30B 3H2LA 5T7LA 1ZETA 2D7SA 2HNDA 4EZ9A 5AXMA 5J1EA 4DFKA 3M4XA 4NOHA 4NX9A 4ZS6A 4K4WA 3MPYA 1FXLA 1G3OA 1F5AA 3KLIA 3IR5B 2GQ2A 4ILRA 2AV5A 3MM5B 2ZOFA 3G8SA 2JLGA 3E3XA 2Q43A 3CCES 5BR8F 1KONA 1M1KT 3K5NA 2CQPA 4WYLA 4K2XA 3RBEA 4ZK7M 2HRUA 1Y4ZB 1N5YA 2CDQA 3FRZA 2EFOA 4XPEA 3TVYA 3T1YF 2HHTA 5KFJA 2VB6A 3T1AA 2MQQA 1KRPA 4PG4A 3FSXA 3OR1A 3UPFA 4CTAA 2HNZB 5KTQA 2FVSA 1M90T 2AYMA 5HMYA 2ASLA 2UXBF 3HHLC 1HWUA 1OWXA 3Q8PB 2MGZB 3RW7A 3M32A 2GX8A 1MW7A 2LQ9A 1XR6A 2X1BA 3F56A 4QIWD 3G6VA 5KFKA 1MMLA 1XN9A 2FPHX 2R7XA 1HW8A 4RNHA 3QGIA 3IAM9 2DR7A 2HPUA 4KSEB 2XMTA 2ZHBA 1F9FA 2XMVA 1NU4A 3DI6B 2MJUA 3HK2A 1KFSA 4B9TA 2YTCA 4J9PA 2CKWA 4ZVGA 3NMRA 1S6PA 2XMWA 3C8YA 2RIJA 4Q8FA 4RUHA 4N56A 4J9SA 2KHDA 2R8HA 4WKRA 2Q6BA 2QMWA 1HWJA 3R5CA 1RGVA 2KM8B 1FKOB 1MROA 1HI1A 4ED6A 4JV1A 2EBEA 4C0BA 1N6QB 2QMXA 3T6BA 3CD7A 4ECYA 2XS2A 1S9EB 3GSDA 2GCFA 4R5PB 2ZNZA 4A4JA 2HQIA 2W7PA 2ALZA 4ED5A 2VG6B 3CDWA 2CJQA 1SJFA 1DARA 2O1PA 1SB6A 4R5PA 1SV5B 4M95A 4OI2A 4RBVA 3I4HX 3MECB 1WG4A 5GAHU 4MH8A 3LGNA 1S6OA 5GAEU 1VQKS 1SH2A 3D5MA 2B9YA 4X65F 4MIAA 4DFPA 2KT5A 2FVRA 1F5BA 1CVJA 2K8GA 3V6DB 2KI2A 4IO9Q 4DS5A 2YWGA 4N5SA 3MM7A 3D1HA 4NA1A 1KOOA 2GFFA 1D0EA 4WZMA 2DGUA 3AQOA 2HHSA 4LVNP 4BWMA 3TO8A 4DFJA 1BQMA 3PX6A 4ITSA 4ZA1A 4NLPA 3DI6A 1C0TA 1U6FA 2O3DA 3MMAA 2W8LA 5EDWA 1BGXT 2R2UA 1Z1ZA 1X4GA 3PY8A 4IQXA 4OV1A 3M2VA 1NK6A 2QEXS 1TR0A 4NLVA 4DSEA 4ZMMA 1QM9A 1UVLA 2WB1D 1X0PA 4ID8A 1XMOF 3SEOA 4QQBA 5GMKa 2EFPA 3CD0A 1K0TA 1WELA 4TY9A 2U1AA 1KQGB 1S9GB 3HF5A 2YNFB 1KFDA 3TNVA 4F50A 3T1HF 4ERDA 1T03B 3KWMA 3V6JA 1H7WA 3M2UB 2RQKA 2YWHA 3D1QA 1ZZFA 4QOTA 4O4GA 4O3OA 3SXLA 4IOAQ 5DDQC 3E8OA 3DRRA 5K8MA 4HH1A 1IQZA 2G13A 3Q8QB 4IG0B 2DGVA 5I3PA 3GIMA 1W25A 1YI2S 2MZSA 2R7VA 4QWBA 1Z2ZA 3DRSA 1W2IA 2DPJA 4WE1B 4NLWA 4DQPA 1R89A 1KQSR 4C3LA 3PRDA 1RYRA 4P7VA 1MWYA 2NXUA 4RLEA 4EO8A 2CG4A 3JAMY 5KG7A 3LWLA 2C28A 4LJMA 4DR5F 3MPVA 4QBUA 2M0GB 2IMOA 3I82A 2IVMA 2O5DA 2ZBCA 4IQMA 5A8WA 4HT5A 3MURP 1L3UA 4C4WA 3OL7A 1VQ9S 3MM5A 2V8GA 3MOZA 4PKDB 2M88A 2LQ5A 2P6TA 2VG5B 4WK3A 4B02A 2UVVA 2GA7A 2CQ3A 4C8NA 3BR8A 4RWXA 5IM0B 5KG3A 4B9SA 3K2YA 3HVAA 1NK0A 1Q7LB 1F2GA 3DYAA 1U1NA 1E6YA 2ASDA 4AL7A 5B08A 1OPZA 1WHXA 3CPWR 3OHAA 2C3MA 3M8PB 3PNIA 2CPDA 3ZZZA 4ZP9A 2KJWA 4DHVA 4FF2A 4NZ6A 3OR2A 3FSYA 2JC0A 3KKFA 3UDLA 2R9LA 3MAHA 3B82A 3OR1B 1SIZA 2ILZA 1DTTA 1HBOA 4IO1A 5F3ZA 4IG3B 2IMWP 1LWCB 3DLGB 1U1OA 2ZNYA 4Y28C 1NJIT 2NR0A 2FJXA 3BN7A 2BW2A 2KJVA 1NJWA 3MPWA 2GO8A 1U49A 3QGGA 5FD1A 4OZJA 2LECA 1KLMA 3PRBA 5MLCV 2B7CB 3PXGa 4KT0C 2L3MA 2ZH6A 3EGZA 1T3NA 2ZKTA 1KTQA 3V4IB 1PSDA 5J2QB 1M0SA 1RTDB 1GQEA 4Q43A 3GFXA 3TI0A 4LMZA 4CO3A 2DNMA 4EO6A 4I1TA 3CCRS 3S7RA 3TRGA 3QLHB 3QAEA 1N5YB 4RNMA 3GFHA 2X1FA 4MMOA 1HBUA 2JWNA 3W3SA 5I3UA 4NLOA 4OZNA 2B56A 2D3UA 4WIIA 2EFQA 1UVKA 2FHOB 5E33A 5AXNA 4UQGA 2IHR1 1T05A 1D1UA 4AL6A 3N4WA 3E01B 2UV8A 3TVKA 3SSQA 3WX4A 1NEEA 2R4FA 4ZP6A 3ETOA 4QPTA 2OMOA 4I6YA 1TKZB 3HHKA 2HHUA 5M2PA 3NBPB 2MKJA 4DN9A 3SI8A 2DISA 3MEDB 3FDSA 4L72B 1HFEL 1KVIA 2MPUA 1YSJA 1IKWA 3RB0A 2F1FA 2FJWA 5M2RA 1TL5A 2IC3A 5IZHA 4IFYB 4CT8A 5B0CA 1IKVA 2RE1A 2VFUA 4KR0B 4X4SA 3HZGA 3A1YG 4I6WA 4KKOB 3F44A 2BQUA 2OKQA 4LFAF 1KOHA 2VQEF 1WHYA 1GTEA 2RSQA 4KHRA 2DB1A 3N01A 3N5BA 1DURA 3M8QA 4LQ9A 1SKWA 5CA5A 4NYOA 5B0GA 2BZ2A 1SQEA 4URSA 1RKIA 4U7UK 2DD8S 3OW2R 3UDCA 2AYGA 1HNVA 5IT4A 4CIOA 4Y2CA 2FUG9 3DLKA 4YY3F 4WFNQ 1FRIA 3KLFA 5HN0A 4LF6F 4RU9A 1HA1A 5K14A 1YJTA 2XSFA 3HT3A 2GMHA 3FSIA 2FVPA 4FBTA 3HMJG 1JNRB 4ECQA 2ZVSA 3L7OA 5BJRA 3Q8SB 1IJFB 4G6VB 4NZ7A 4H4MA 2BANB 1YRTA 1YITS 3ULHA 1PC5A 3ENWA 2MQMA 4H4MB 1V9OA 5A8KB 2J9DA 2CQGA 4DG1A 3ICLA 3SDEA 2QZ8A 5E3CA 2LXUA 2ZHOA 4H4OA 5DS7A 3OSNA 3GIKA 3CTRA 2LDIA 2VBYA 4CCHA 4Y2AA 3RZAA 1U6BA 3EGWB 3D2WA 4J9MA 3UD4P 4LF8F 3OQ2A 4X4UA 1KVJA 3RR7A 5G0RA 1CC8A 3DLJA 4FXWA 2IAJB 1CC7A 1XERA 1IUJA 5DETA 4KGKA 1N5TA 3R5DA 4IKAA 3MUMP 4DR4F 1U25A 3P5TL 1KLMB 1BQXA 5B0FA 4DQIA 5B0EA 1P27B 2WB4A 3HKWA 3BO3A 2FVQA 2QO3A 3DU5A 1Q8LA 1YTYA 2BJEA 2KRBA 4QWCA 2E9TA 2DGSA 3IGVA 4K4TA 1S4FA