1VQPS

The structure of the transition state analogue "rap" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
81
structure length
81
Chain Sequence
b'SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vqpS00
1JMTA 3EGZA 1S79A 3MD3A 3UWTA 2DK2A 1S72S 3G96A 3U1MA 3CCMS 3TO8A 4C7QA 2V94A 3ULHA 4EGLA 3I56S 2M4MA 2M8HA 2MKHA 2DNZA 1YI2S 1X4CA 5GMKa 1P27B 1KOOA 4WCEQ 1WHVA 5IM0A 1YHQS 2KG0A 1K73T 3CCVS 3CTRA 5IFMA 2MJUA 4RU2A 5LXRA 3MUTP 2J8AA 5BJRA 2DHGA 2E5IA 1UAWA 2G1DA 1FHTA 1YJWS 3UCUP 1SXLA 1U1OA 2YH1A 1N52B 2RRBA 2AYMA 1X4HA 2M9KA 2F9DA 3CC7S 4LMZA 3Q2TC 4CQ1A 3R1LA 1X4EA 3MXHP 2MSTA 1KD1T 2YWKA 2LYVA 1KOHA 3HI9A 2OTJS 2MB0B 1VBXA 3EX7B 4C0OC 2I2YA 3S8SA 3CMES 4CIOA 2CPJA 3TYTA 3H2VE 3VAKA 1ZZFA 3P6YC 1OPIA 2NLWA 2MY7A 1DHMA 2CQGA 1UW4A 2B0GA 3R1HA 2FC8A 2MSSA 5DETA 3RW7A 2CPEA 2E44A 1YITS 1YTYA 5GAGU 1VC5A 2I38A 2X1GA 3P5TL 3I55S 1X4DA 2L41A 1QVFR 2DO0A 3US5A 3IRWP 2LMIA 2CPIA 3BS9A 2FY1A 1HL6A 2D3OR 2CPXA 2RQCA 1UP1A 2N82B 2YTCA 2BOPA 3K0JA 2AYGA 2CQHA 4ERDA 2HGNA 2N3OA 1KQSR 1VQ9S 1BY9A 2MQLA 2L08A 3G9CA 2DH7A 2L9WA 2KYXA 4WFAQ 2DGWA 2MPUA 5IQQA 4A8XA 2DNQA 2RVJA 2RS8A 4YB1P 4FXWA 2DITA 1WEXA 2DHXA 3LPYA 4WFNQ 1IQTA 3MI7X 1X5OA 1X0FA 2J76E 5DDQC 4IUFA 1SJRA 1FJEB 2LQ5A 2MZ1A 4QPTA 1X5SA 2QEXS 4BS2A 3SXLA 4PKDB 1XN9A 2DNMA 2DNPA 3NMRA 2OSQA 3CPWR 1VQLS 2DGXA 5DDPC 4J5OA 3VF0B 3D2WA 2U1AA 4FXVA 2E5GA 3UCZP 5LJ3Y 2RUGA 1HD0A 3MD1A 4WF9Q 2U2FA 5IM0B 2MZRA 2EK6A 2DGUA 4IO9Q 1Q81T 3VAIA 2MXYA 3EGNA 5GAHU 2KXHA 2D9PA 4C4WA 2KRBA 1WG4A 3CXCR 1SJ4P 2DHSA 1Q7YT 2DNGA 1VQKS 2X1FA 1K9MT 1O0PA 3ZZZA 2MQMA 4TU7A 3VAFA 2MGZA 2XS2A 1VQ8S 2X1AA 3ZZYA 2JVRA 2DGVA 1WEYA 2MQOA 2JX2A 2RRAA 1VBZA 1H6KX 2CPFA 5LJ5Y 3HHNB 2VODA 3BEGB 1RK8A 2CQ1A 3BO2A 2DNNA 4PR6A 3MUVP 2CQ3A 2ADCA 4W90B 2DNKA 1U1QA 3NS6A 4QU7A 1F9FA 3CCRS 2ADBA 1QVGR 2DISA 3J7YU 2OIHA 4Y0FA 3G8SA 1WHWA 2DB1A 1U1LA 2MKIA 4UY8T 2MMYA 3P49B 2CQBA 2LA6A 2CQCA 2DGTA 2LCWA 4YUDA 3CF5Q 2QFJA 5DM6Q 3G71S 1W2BR 2RU3A 3LQVA 2E5JA 2J0SD 2RQ4A 2LECA 1WHXA 3P3DA 2RT3A 2PEHA 1H2VZ 4U67Q 5HL7Q 1VQ7S 2X1BA 2DGOA 1A9NB 2CPYA 2ERRA 4TU8A 2F3JA 1U2FA 3CCUS 1X5TA 2M52A 1WHYA 1WTBA 2XSFA 2FHOB 2MY8A 2LEAA 4TLQA 1DBDA 2M2BA 1DZ5A 4LJMA 4Y00A 1WEZA 3S6EA 3CCSS 1U1RA 2HGLA 5DM7Q 1FNXH 3CUNA 2MQNA 1VC0A 3VAHA 4F26A 2G4BA 2CPZA 2O3DA 2MYFA 1UFWA 5LSLA 3V4MA 1L3KA 5D78A 2KHCA 2XS7A 3THPA 3UE2A 2OSRA 3MDFA 2CQIA 2KM8C 2MQQA 2J0QD 2F9JA 1URNA 5ITHA 2JVOA 4W92B 2DNRA 1OIAA 3S7RA 1M90T 3RW6A 1YIJS 2VOOA 1FT8A 2KH9A 3DXBA 1VQ4S 1FJ7A 2MKCA 1M5KC 1M5OC 2AYEA 2NZ4A 2LKZA 1NU4A 2HVZA 2A3JA 1U1NA 1JJ2R 4LIRA 1U1PA 4P6QA 2SXLA 4CH0S 2KVIA 2MGZB 2LXIA 4M5DB 2G0CA 2KRRA 5CYJA 1U6BA 5GVQA 5CXTA 2KG1A 3MOJB 2MKJA 2DNYA 1YJ9S 3VAJA 5D77A 3SDEA 5LSOA 4QQBA 2DNOA 3CMAS 3MURP 1JJ4A 3CC4S 5EN1A 1DRZA 1JJHA 5JVHQ 2LXUA 2KFYA 1WWHA 3TP2A 1AUDA 3U1LA 2GO9A 1VQNS 1H2UX 3MUMP 2MKSA 2XS5A 2MZTA 4WFBQ 2M0GB 2YKAA 1HD1A 1RKJA 1Q82T 1YWXA 3VAGA 1VQMS 1K8AT 1QM9A 2CJKA 2VONA 4IOAQ 5CA5A 3Q2SC 3NNHA 2RNEA 3BO3A 2LA4A 3G4SS 3CC2S 2AYBA 1HA1A 1SJ3P 2N3LA 2M8DB 1OWXA 2EVZA 1U6FA 2FC9A 3H2UB 3CCQS 2M88A 2EK1A 1N88A 3UCGA 3G8TA 3S01A 1WF0A 1D9AA 1P1TA 1N8RT 2CQ2A 3IWNC 2CPDA 2DGSA 2Q79A 4ED5A 5FJ4A 4TU9A 2CQDA 3G6ES 2ZJPQ 1B7FA 1M1KT 2DGQA 2ZJQQ 4WKRA 2KXNB 3B4MA 1U1KA 2LEBA 2KT5A 1WI8A 3NNAA 4Z2XA 3CULA 2CPHA 2KXFA 3CCJS 2DNHA 1FXLA 2HYIB 4YOEA 2MZJA 4UQTA 2QA4S 1WELA 2CQ4A 4QU6A 3FEYB 1ZZNA 1VC6A 4PRFA 5MLCV 1WG5A 1WI6A 5DDRC 1SJFA 2KN4A 1VQOS 2KI2A 2RS2A 2M7SA 2K8GA 2DIUA 1PGZA 4F25A 2KU7A 1WG1A 4OZ0A 1U1MA 2MHNA 1A7GE 1M5VC 1OO0B 5GADU 3R27A 2XNQA 1NO8A 1FJCA 3CD6S 2CQ0A 1VQ5S 2WBRA 2VOPA 3UD3P 1VBYA 1ZH5A 2KM8B 3SMZA 1R8HA 2D9OA 3VALA 1PO6A 2DO4A 1WF1A 3B4DA 2MZQA 3DLLQ 5GAEU 4CH1A 2DNLA 4WIIA 2OJ3A 1N54B 3FEXB 2M70A 2JWNA 3N9UC 5DDOC 3CCES 2XNRA 3OW2R 2DH8A 2MKKA 2DHAA 2ZJRQ 3BO4A 1R8PA 3SDEB 2DIVA 1KC8T 1Q86T 1WF2A 5JVGQ 1VQPS 1X4AA 1VQ6S 4IOCQ 1D8ZA 2HGMA 3THTA 2DH9A 2MZSA 1NJIT 1X4BA 2OTLS 1FO1A 4F02A 1X4GA 1X5PA 1X4FA 2MJNA 1G2EA 3NNCA 1YJNS 1CVJA 2E5HA 5LXYA 2AD9A 2N7CA 2K3KA 2UP1A 2PE8A 3NS5A 3UD4P 4OZ1A 3J7ZT 3L3CA 4ZKAA 1M5PC 1H2TZ 2JRSA 3PIPQ 3CCLS 4V19X 2XB2D 2CQPA 1SJQA 2HZCA 2GHPA 5HO4A 2MQPA 5H1SV 2YH0A 3VAMA 2FPHX 3JB9k 2BZ2A 3PIOQ
chains in the Genus database with same CATH superfamily
4F4ZA 3W9HA 5HJXA 2VQFF 3HZGA 1XBWA 4ZP6A 3IS9A 4W4MA 4DDFA 4R0JA 1QSYA 3DOMB 2VFTA 1K73T 4PQUA 1ZAWA 3ETMA 1NDLA 2AEJA 2E5LJ 4M5NA 1U1OA 1S1WB 1TELA 2XI3A 3D67A 3T1YF 3A8KA 3WIUA 4F4KA 2KO1A 2C22A 3D6TB 4WP3A 1QE1A 4EI2A 2GGPB 2K1RB 1H72C 3VVUA 1O51A 5HI7A 1HWUA 2R7OA 5DS7A 3PJXA 3D1OA 5HK4A 4QPXA 3TJ9A 2MSSA 5DETA 1T3NA 2UUWA 1CS4B 2YKNA 1S97A 2JL9A 3IRWP 4BLGA 2C42A 3H90A 2F1FA 3C2PA 3RAXA 2BOPA 1CULA 3QO9B 3UN5A 3DLEB 4WFYA 4DG1A 2IIHA 2FZGB 2HGNA 1F3VA 2GA7A 2L9WA 5CD4H 2A0FB 1J5EJ 2E7WA 3LPYA 3T9ZA 3HJFA 4JV5J 1X5OA 3CSKA 2FLNA 2PFDA 1X5SA 2ASLA 2QEXS 1LFPA 2PI5A 5HATA 3CWJA 2HFSA 2VDHA 4JI6F 3GSIA 1C0UA 2YNHA 4O0NA 3QT8A 1LWCA 2MZRA 2V9WA 3EYZA 5G4DA 3KK1B 2AZ3A 1VQSA 3SQOP 4DLGA 2VICA 4OI0A 4CCHA 4LSLA 1RWWB 3CD7A 2Y1LB 1FE4A 1WEYA 2JX2A 3TEHB 3BEGB 5A0YA 3R8YA 1E6VB 3DMJB 1B0TA 4ZLNA 4J9SA 1RTJA 3M6UA 3D68A 4NLSA 3R5AA 2ZBPA 1DY3A 3MMBB 4ES1A 3MCOA 1A9NB 2CPYA 2ERRA 2VBZA 2RDJA 3A1YG 2C3OA 4LF9F 4TLQA 1GK8A 1LKZA 3KG4A 1YZ7A 4C8KA 4JB8B 3TOQA 1MU2B 3J81Y 1XQIA 3MM7A 1VCTA 3PYEA 2E1CA 4H4MA 3E01B 3GYGA 4GVLA 4JBCA 1IKWA 1AFJA 2P9CA 2M3DA 5T7LA 3U27A 1OPZA 2FVRA 1SPBP 1EP4B 4BHQA 2ZM6J 2HVZA 3TQEA 3EDQB 4O3SA 1HBMB 4CH7A 4K4ZA 2MGZB 2YWWA 4N5SA 1U49A 2OPRA 1DURA 4KFBB 3VAJA 5D77A 3CB4A 3M9NB 3VV2B 3C6TA 3DN9A 3HKZD 1U0SA 2KFYA 2VFRA 4X66J 2ZBCA 5CAAA 1TAQA 3NP5A 1K8AT 4X62F 2DD8S 3V6DB 3QBCA 4U7UK 2C1EB 2J6SA 1SL1A 4LF4F 1S0MA 2FJAB 2PO4A 1N32F 2CQ2A 4F04B 2CQDA 2ZJPQ 1M1KT 4WKRA 4WBFA 4JUZA 4E0DA 2HNZB 3I31A 1GMVA 2HYIB 2XM3A 1ZZNA 3CJTA 4MKBA 5F0WA 2GMJA 2KT3A 3CD0A 5KFJA 2XULA 1REVA 1NUEA 3KG0A 1BQMB 3K8VA 3CJ0A 1TR0A 2BANB 2C2RA 3BN4A 1VBYA 3QGHA 3FZBA 5B08A 4PG6A 2W1BA 2DNLA 2A2CA 3CCES 2XNRA 2Z2MA 3EPIA 1EARA 3KK3B 1BUXA 3KLGA 3CDBA 4LBIA 3SDEB 4K7QA 1Q86T 5E3AA 2NSBA 2BYCA 1WF2A 2Z0GA 5J2NB 2EFNA 4Y3CA 1GFWB 1VI7A 1T7PA 2VH7A 5E41A 4IDKB 1JLAA 2NS1B 1X4FA 2B56A 3JS9A 5KFCA 4HR2A 2H5IB 2XG8A 4JI1F 1YLXA 4J9KA 1C4CA 4M5JA 1SC6A 3BSOA 1BQNA 1NSPA 2EFGA 4PG7A 3FBEA 2EW9A 2WVFA 3CDUA 1GAOA 4DV0F 3SYZA 2FPHX 4ECVA 3LP0A 4YR2A 2BKNA 1I5OB 3AB2B 2K2PA 3TO8A 1YGYA 4V19J 4DL3A 3AA9A 2UU9F 3GIKA 5F3ZA 2XMKA 1WHVA 5D15A 3FSYA 1XNRJ 1T9XA 2DHGA 2E5IA 5KFSA 1V9OA 4IRDA 3TUJC 2HMIA 2RRBA 1X4HA 3D9BA 4OMFG 3HI9A 2MB0B 2A10A 3DC2A 1LOUA 3CJ8A 2ROPA 3BREA 2V8PA 3NL0A 1KS2A 2EG2A 4N76A 2E44A 3HFZB 2J9CA 2ZOMA 3RBXA 3VZIA 3Q86A 3I55S 3KLEA 4XPCA 3DLBA 2BXJA 3KTQA 2L08A 1Y0HA 2QLFB 4AD6A 3CIZA 4JV0A 4LFAJ 4R5PA 1Q79A 1KP6A 4Y2KA 1JLEA 1LXNA 4R0EA 2BM1A 4LFCF 1RT4A 3M8RA 4QPTA 1S7HA 3SXLA 3NMRA 3O3LA 5C25A 1KFSA 2BW2A 1MN9A 4KPYA 3MD1A 1HR0F 4WF9Q 1FDNA 2QSFA 1WG4A 4OX6A 3C8YA 4OZLA 3KUHA 2NXUA 1R43A 3ZZZA 3M8YA 1IWGA 4FS1A 4ILMA 2XGPA 2H5EA 2RRAA 4QIGA 2HVDA 5E3RA 3AHPA 3SQGB 3N79A 1IR2A 2DNKA 3CCRS 1V6HA 3EVMA 4MJKA 1LW2B 1XR5A 3BR8A 5DM6Q 2GQQA 3M2VB 2AHOB 4D3GA 4Q43A 2BJ3A 2IMOA 2IJFA 1NZ8A 5L1IA 3C46A 1VQ7S 1C1BA 3TZZA 3LGMA 3M6XA 5E0OA 1NAQA 5KFBA 3CEDA 2MY8A 3NWRA 2JZ5A 1FFSB 3AB4B 1UFLA 3ILIA 3K5PA 3D4JA 3OVSA 5B0CA 1RTIB 4DBQA 1SVDA 3CW2C 4RW6B 1T3OA 4ECTA 2CZ4A 4F3OA 2XS7A 2IBOA 5EX0A 1HMVB 2KM8C 1Y5NB 2OEMA 3W9IA 1YJUA 1Q8KA 4JI5F 5A8WA 3RW6A 2CG8A 4HDGA 2XQCA 1GXUA 5BXIA 2OGUA 3HVWA 4X65J 4ZN1A 2YNGB 3SBMA 2GVZA 1MROA 3SCIE 1S6QB 5CYJA 1EB0A 2GMHA 2ILYA 3A8IA 2Z30B 3IRXA 4NLUA 2DNOA 2RHQB 2ASJA 1S10A 4TLRA 4Q45A 1IBLJ 5A2QU 4ZMMA 4NLOA 2XC9A 2BA9A 4QCLA 4UF4A 4C9DA 1HD1A 3H5YA 4PG5A 2G1HA 1QM9A 4CYUB 2W25A 5AJ3F 2RNEA 2VJUA 3M8QB 1SJ3P 5DZ7A 1FRIA 7FD1A 3CCQS 2MLZA 3CJRA 4EUVA 4ED5A 2XEXA 5IV3A 3IR5B 3M32B 5D8HB 2POKA 4Z2XA 4ZLJA 4QIWD 1KEKA 1NHKL 1TL7B 3RBEA 5BR8J 1MMLA 1WKJA 4JOUA 3NBPB 4FNIA 4K5RA 2HWTA 3MTJA 1HW8A 3NCPA 2XNQA 1N32J 3JQMA 1LWFA 2CQ0A 4ECSA 1D8YA 4URSA 3UD3P 1ZH5A 2VPWB 4E2FB 2PMHA 3ZNUA 2VG5A 2E1RA 1WF1A 1S5ZA 2I1RA 3J81j 3TVZA 1N6QB 1F5CA 5FLXY 8AT1B 1VLYA 1EETA 4HHHA 3H8YA 2ZJRQ 4O0IA 4L6V3 3V6HA 5HLFA 3SV4A 2CZVC 2H9ZA 4DL5A 1FE0A 1NB7A 4DR3F 3OUYB 1H2TZ 4X64J 3CCLS 2NPFA 4ZPTR 1YRUA 3ZZRA 2V6AA 4TQSA 3G96A 4NLYA 4EYIB 2DR7A 2HVIA 1C2PA 2Q43A 2IM2A 3GB0A 4OI4A 1YHQS 2F4FA 3CTRA 4RU2A 2DCUB 3FK4A 3R5CA 1PJ7A 4JI8J 5A8KA 1EAYC 5JJBA 2UXBJ 1JLFB 4LF6F 2E9ZA 2X3DA 2YQ0A 1DAXA 2M9KA 2G2ZA 1TVRA 1KD1T 4DV6F 1U26A 3EX7B 4IRCA 2XYHB 4ZCLA 4ED3A 1JX4A 1TAUA 1FEEA 3OBIA 1RSCA 4CT8A 2NLWA 4URGA 1HKAA 1S1XB 3BJYA 2HHHF 3OR1A 4DU8A 4MKAA 1D3WA 2GFFA 4RW7B 3DU5A 5GAGU 3P5TL 3LGHA 1SH2A 2YX4A 1CJKA 1I6JA 2W2OP 3ZZUA 3SV3A 4DJBA 1YBTA 1JLQB 2RRNA 5IQQA 1MMNA 5DZ6A 3UD5A 4DSJA 2AEFA 2V8GA 4LQ3A 3I0SB 1AFIA 4XDCA 2MZ1A 5CZVA 4BS2A 4F7VA 2XI2A 2VKZG 3MR5A 2IY5B 1KR4A 4DOZA 5DDPC 2YWGA 5ETQA 2D41A 3RUBL 4X4SA 5KG0A 5IV4A 2V4JA 5HSPA 4B9NA 2XLJA 3CXCR 4WP8A 3UQSA 2RU9A 1Q7YT 4NZ0A 2Z2LA 4TU7A 2VASA 1VQ8S 3DRYA 2XMMA 4LFCJ 3ZZYA 3CT9A 1CJUA 1FNMA 2C28A 3MUVP 1JQGA 1J2VA 1F1BB 3KUGA 3NS6A 2K3IA 4DV1F 3J81U 2LEPA 4I67A 1WOPA 5BYSA 2KT2A 2XZWA 2PA3A 4I2PA 1JNZB 3M8PB 3M9MB 2WW8A 2UUCF 1W2BR 4C8ZA 2I5JA 4KGMA 1RT1B 1S0NA 4ZS6A 1V3SA 2JNJA 2P6TA 3ENQA 3L95X 3PXGa 1SV5A 4C0BA 4KHRA 4S0MA 3R5BA 4NA2A 4USHA 3PW4A 2R9LA 5CYMA 3PX6A 2HGLA 3JSYA 2BJ8A 3DYAA 3OT9A 2PIIA 4NX9A 2G4BA 5L8RC 3CJQA 4USKA 3N6LA 5L9NA 4J9QA 3HDSA 2LDIA 1W2IA 4PCQA 3ELHA 1J5OA 1M90T 2V2KA 3OPKA 5D0GA 3M8WA 2G2YA 4RU9A 5GAHI 1S7IA 2ZD1B 2UXCF 2V4RA 1VFJA 4C11A 1ZTTA 4RUCA 2BKPA 4HI2A 1NJZA 2HLTA 3NAHA 3QYYA 1K0VA 3A3PB 5EGYA 2HAIA 4JI5J 1RB0A 5ETTA 2MZTA 3CIMA 3OLAA 2HRUA 1U48A 3L09A 2JHEA 5D4NA 3RU0A 3GQCA 4KV8A 1D9AA 1HNWF 4TU9A 3DLHA 4NCGB 1ZAVA 3CJKA 1WI8A 4LBHA 2RF2B 2DNHA 4ZCKA 2QA4S 2ZFHA 3H59A 1CJTB 8RUCA 4NLTA 1RTDA 2KN4A 3ENVA 4CLPA 3O6QA 3MMJA 4A8YA 4U96A 3J80Y 5HQLA 1U1MA 1M5VC 4NYZA 3PYGA 1HQUB 1MWZA 3CD6S 4FF1A 4DPOA 5HVHA 4QWAA 1IBCB 5B7WA 2W9CA 4WZMA 1FTRA 3RRGA 1Y11A 4DN9A 2JWNA 3Q0AA 3CO0P 5AXKA 2KJVA 1U0HB 4C98A 2I8EA 3AD9C 3GYNA 4CZCA 1YBUA 9RUBA 2ZVSA 4WYLA 1X4AA 3MPYA 1VQ6S 3R5GA 1FDAA 2JC0A 2E7XA 3CNQP 4K59A 1VDHA 1CPZA 3MWBA 3SZ2A 1S12A 1T03B 3W65A 3HVAA 3CMQA 2B9XA 2QA4G 3BPDA 1M1HA 4BCAA 2HQGA 1RHMB 4O4GB 3T5LA 2RKIB 3M2RA 3DRRB 1G7CB 4CTAB 4MH8A 5FDLB 1P27B 4IG3B 2YKMB 2XYGB 1G3OA 5KFNA 5ETNA 4MK9A 3QT6A 4K4SA 2UVVA 4YHHF 3MFIA 2NUUG 2HIQA 4HHUA 3OTDA 4L3KA 4ID5A 3LP1B 3R3TA 3MR3A 1VBXA 2DT9A 4OHYA 1WOOA 3KLHB 3G86A 3TYTA 4DFJA 3KFWX 3R6GB 4LFBF 3DRXA 2EBGA 5L1JA 3U02A 4PYDA 4DX6A 4PWDA 2KKHA 2HNDB 2X1GA 3Q8RB 2LMIA 2E9RX 1AROP 5CHCB 2EFPA 5EDWA 4KQZA 2XMJA 2V50A 4JI0J 2AYGA 2CQHA 3KLFA 3TARA 1RZMA 1SUQA 2NPIA 2AJ0A 1RAAB 2AKWB 2XO6A 4ZVOB 2WVEA 4QWBA 2BE7D 2DITA 3I0RB 3QGGA 4ANCA 1TUWA 4A4JA 4OYWA 2DYAA 2HHHJ 1APSA 2B9WA 3FBFA 4DX8H 1VQLS 4P7TA 5KT6A 2DKOB 1KWMA 4OJ1A 1KBRA 3PG9A 1IBKF 3ZO7A 5KFVA 1HNXF 4DSFA 4OIXA 5KFPA 3ISZA 2MQ8A 2VG7A 4FKXA 3DLGA 4NASA 5DQGA 3MM9B 3HT3A 1N34J 2YX1A 2R7UA 5THWA 5LJ5Y 4KY3A 2PD1A 5HROB 3G82B 1QE1B 4B9SA 4IYQA 2VDIA 3PACA 1QVGR 3J7YU 4A8MP 3SEOA 3FMBA 3P49B 4YUDA 2KFZA 1DTQB 1PKUA 1FD8A 4WJBA 5A8RA 2CJBA 4ZITA 1K47A 3BN7A 1CULB 4DG1B 4DPYA 1UWBA 1WHYA 1RISA 4YB5A 5DG7A 1Q78A 5IT9Y 2D3O1 1WEZA 3PW2A 1U25A 3ITHA 4OL8A 4N8NA 5DM7Q 5KT2A 4DL0C 2MHEA 4HT5A 4LF5F 3BGFA 2CQIA 1U09A 2MQQA 3ILLA 2J0QD 3KNAA 5B09A 4Y34A 1LWCB 4OHVA 3HHKA 2WTFA 1S6PA 2MLXA 1M5OC 3AQPA 2R2UA 4PWUA 4DL6A 2HS3A 1Y5LB 1LQ9A 2BKOA 3N5BA 3MPUB 3DOLB 1UVNA 3GFXA 2V4QA 3LAKA 3CC4S 1JJ4A 5EN1A 1DRZA 2CDRB 3N5FA 4RO0A 2DHHA 4ED2A 2A2DA 2MKSA 1RTJB 4U6PA 2VFSA 4DLEA 4ATNA 5IT4A 3PW5A 4L76A 4L3NA 1Q4RA 3EM1A 2BX6A 2H3EB 2V8VA 4YR3A 3QT5A 3S01A 4K2XA 1B7FA 4YY3F 4DV7J 2HHUA 1IWAA 2IA0A 5FLXU 3B54A 1FXLA 4YOEA 2LDYA 2MTLA 3ZZTA 3NY0A 2CNNB 1S99A 1SKRA 1ZM9A 4ECUA 4LRDA 4H4MB 1IXKA 1JLCA 3Q8YA 4M1KA 1RI7A 1N33F 2MHNA 5KFUA 4NYPA 2KTQA 3M8SA 1NO8A 2WBRA 2BR0A 5CH7B 1JKHB 4NXNJ 3HSZA 4QWEA 2G13A 3CCTA 4MKYA 3PEHA 2OJ3A 3FEXB 1Q16B 3N01A 2QC3A 1V3ZA 2DXEA 3RJMB 2DHAA 4I6YA 2PDAA 3KOAA 4DR6J 3W2VA 4FP9A 4USJC 5KG4A 2ZZNA 1HPZA 1RBAA 5E3PA 2XYPB 1RBLA 3I87A 3KNGA 5IXUA 1WKLA 3CO9A 4A8SA 1J27A 3GU0A 3D3BJ 4NLWA 2Z8QA 4RNHA 3SIPB 5K14B 2WVBA 3BH6B 3Q8PB 1HI0P 3JB9k 1U1PA 2CJYB 4B3MF 1RLCL 3UWTA 3MR2A 4C7QA 1MN7A 1P9YA 2Q66A 3QRRA 4GVBA 3P5BP 4G1PA 1RWVB 3OHBA 5KFLA 4M5KA 1REVB 2ZWPA 1IUJA 4PUOA 3HFKA 1AYEA 1P8GA 2O67A 1KOHA 2GO8A 2QA1A 2W01A 4ETZA 4USVA 1NK7A 2GC8A 4ETXA 1VRUA 3KLGB 1NK8A 3DRPA 3I32A 3PYFA 4WXOA 4ZHRA 2XLIA 3MPDA 4YHHJ 5KFYA 2DXDA 5D0EA 2L41A 1IBMF 3FQKA 5KT4A 1JLAB 4ZVFA 3BS9A 1UP1A 3K0JA 2E1MC 4LF8J 4Y2IA 5HMYA 1T95A 2N3OA 1UL3A 4I6WA 5KG1A 4DUYF 1AZSA 5HQ8A 5JXSA 2KYXA 1WC3A 3KMQA 4A8XA 1RAHB 3NG8A 2DNQA 1BQNB 2ZVIA 4IQXA 1CLFA 5M2PA 1IM4A 1U45A 1HBOA 2MEWA 2RB7A 1XN9A 4PKDB 1TKDA 1OY6A 4DR7F 1SKSA 1RAJA 2JEFA 2BE2B 1FFWB 1A6LA 4RW9A 1URRA 3QT7A 1TU0B 2NSCA 1YJ7A 4FYDA 4PEOA 4JI7J 2X1FA 1O0PA 1S9GA 3J7A1 2XHWA 4B3OA 2IVMA 3MPVA 4ZPBA 4ZJQA 2CPFA 4Y2AA 3AOBA 1F2HA 4ITSA 3L7PA 1F9FA 4P71A 2JJ4D 2OEJA 2QYCA 1SQEA 2LCWA 3LQVA 3VGVA 5I3QA 1H98A 4GKKJ 4I0WA 4DSIA 2VF3A 2ALYB 3KLEB 1MMDA 4U67Q 3M4XA 5C7PA 1JK9B 3GSDA 2QLXA 1HWKA 2BVZA 3DU6A 1XR6A 3QQCD 1HHSA 4M8LA 1JLEB 2C2ZB 1U1RA 4DPWA 4P74A 4C8MA 1TKZA 3GIMA 2R7QA 1MSWD 5LSLA 1YVFA 2CJAA 2KHCA 5C25B 1NBEB 3MDFA 3PX4A 2YX7A 3MMAA 4BWJA 2ZDOA 1FNOA 4DQQA 1NKBA 1VK3A 4OLOA 3GG1A 3ZTRA 1JXVA 1VQ4S 3W2WA 3R7NB 1JJ2R 1HQ2A 2DEIA 5EX3A 3G6YA 4RUBA 4NE9C 5LSOA 4QQBA 2DR6A 3QSIA 5D4OA 5C42A 5IZHA 3KLIA 4M5DA 2WVDA 2RHSB 3JSRA 3HM9A 1Q82T 1G6BA 1YWXA 4ZA1A 1UVKA 1AB8A 5CQGA 1SKWA 2LA4A 3CC2S 3J80U 1GH8A 2IA6A 2N3LA 2M88A 1C1BB 1WF0A 5MAOA 4OYAA 2QT7A 1CJVA 3DDNA 1U1KA 3H20A 2C2EA 2OPPA 2KXFA 4EWTA 1XNQF 3IBCB 2OFGX 5DQHA 1JWWA 2BQUA 4KPCA 1Q8BA 2C2MB 3FFIB 2GNKA 1WI6A 2AZ1A 2GAHC 2KI2A 3L7OA 2M7SA 3EE3A 1RWMB 3QJJA 3RB6A 3MR6A 4FZVA 2H5JB 2VBWA 2ZOFA 3SI8A 4KJIA 2W4PA 4N7TA 3IMQJ 1MW7A 2D9OA 4YY3J 1E6YA 1MROB 3N6NA 3VQSA 2UV8G 4DV3F 2VQEJ 3AY0A 3MM6B 3RRKA 4ZVRB 4WPAA 4QW8A 1D8ZA 1N33J 1O6XA 5D4LA 1I94J 2MJNA 2E5HA 5ADZA 5KG2A 2GW8A 2K3KA 4HH1A 4AYBD 3J7ZT 2AQ4A 4NRUA 4B08A 4ZKAA 2OUGA 1WSVA 3PZPA 1NH7A 1HW9A 2C2OB 2L48A 5F0UA 4P73A 2P2CB 4A8KA 1X4CA 4KBIA 2NYHA 5BYQA 2CNOB 3OL7A 1NPPA 1UAWA 3TJAA 5KT7A 4GMKA 3LH2S 3TA0A 2QO3A 5GADI 2Z58B 2NREA 2EC0A 1GT8A 2VG5B 3FZ2A 3GR1A 2MSTA 3DHXA 5KT5A 3D6FB 1JXEA 2GHVC 5HBMB 4D3HA 4F4AA 1EETB 5DRKA 1YX2A 3LOUA 1VK8A 2RJZA 1FWKA 3NXZA 5HLFB 4DR1F 4HDHA 2HHXA 1DQ8A 1VGYA 4NCAA 4CNZA 1VC5A 3BSNA 3EZ5A 2CWKA 4QIEA 4EU0A 2Z4PA 2YPZA 2ABYA 1TMJA 3HO1A 3AJDA 4ERDA 3W1YC 3GV7B 3JSMA 1TKTA 3LW5C 2UXDF 3VGSA 2AV5A 2J6TA 3TUZC 4ECWA 2ZH9A 2HFUA 4I68A 2XWXA 3TI0A 3K5OA 1U2CA 3V81A 4DSKA 1IKYA 1Y3KA 5SZTA 5KFTA 3BGUA 4B17A 3VAIA 1C0TA 5A8KB 4DUYJ 1UMJA 2FLOA 1NHUA 4NWBA 1W7WA 3HULA 3MEGB 3PDNA 4F4WA 4I7FA 1N48A 3I96A 4KKOB 1C1CA 3ZTSA 1H6KX 3HHNB 3QJLA 3QLHA 4HEA9 4DFMA 5IT9U 3DDKA 3EJMA 1SQFA 4IG0B 4ED8A 5KFQA 4USUA 4FS2A 2MKIA 3MEKA 3OR1B 4HH0A 3P96A 1AUSL 2V2ZA 1WHXA 2PEHA 3AD7C 5F8HA 1CJKB 1KLMA 1FK9A 1RT3B 2VG6A 1BWVA 3TWZA 1QY7A 3AD8C 2QL5B 3VGUA 4F36A 2XSFA 3CDEA 1SBRA 3SSQA 1UKUA 3CCSS 5IT0A 3MMCA 2UVRA 2MQNA 1CC7A 2RD5C 4DI6A 2FHMA 1DLOA 2AF6A 4QR2A 3THPA 3EZUA 2HNYA 1T8EA 4O44B 3GILA 1R7IA 2DNRA 4G6VB 2B6AA 4JYAF 1YIJS 5CABA 3DXBA 4QIFA 2KVIA 1RYRA 1LWEB 1CJUB 1UA0A 1BLUA 4KR0B 3MURP 2NYIA 4ID8A 2E5LF 2UUBF 4JI4F 3DGVA 3SFUA 2W7PA 2GV1A 3MUMP 4KO0A 4MIBA 2B5JB 2YKAA 1TL5A 4UT4A 3JXOA 3F56A 4ZPDA 4XTTA 1EQMA 4DF8A 5LMNJ 4TVAB 2WB1D 4OJHA 2Z2YB 1QAYA 4C48A 2AWZA 4N56A 4RNMA 2VPXB 2J0XA 2ILZA 2DGQA 3B4MA 2V2VA 1KQGB 4I1TA 1QAXA 3IG1B 4AT1B 1FVQA 2V67A 2QN6B 3GE9A 2BQ3A 4E8UA 3DYAB 5C2GA 3FMWA 3WIVA 1UA1A 4QYZJ 3R5JB 4LSNA 3OTBA 2XMTA 2HQDA 5C5JA 4OQJA 1D0EA 1CC8A 1RTHA 3IAS9 4DU7A 1ICEB 4U7CA 3M1VB 5DGBA 5FIIA 2ATLA 2ZZMA 5DO2A 1NNDA 3D6HB 2N4DA 2Q3PA 1XNQJ 4C11B 4CWBA 5KFAA 4ES2A 3BO4A 4ECXA 1KC8T 2PMWA 1LFWA 3O5TB 1KQFB 4UY85 2HGMA 3RGIA 1T9TA 3B8HA 1XMBA 1X5PA 1G2EA 1MWYA 5J1EA 2PEBA 1RT6B 5DLFA 1HIYA 2G2OA 2JRSA 2XB2D 5LOQA 2LXFA 3PW0A 3B82A 3AOCA 3M30A 3OR2B 4I2QA 5B0GA 3TVYA 3CCMS 3ULHA 4CO0A 2MKYA 5HMWA 1HQEA 4K4WA 1L3VA 2CXEA 2G0IA 3POTB 2FJDB 5J2PA 1X9SA 2W4DA 2HSEB 3DM2B 4NLVA 1L3TA 4EBDA 5U47A 2W9CB 3W66A 3G8QA 2EKYA 1FA0A 3TA2A 2GIQA 3AODA 1TK0A 3K7RA 4F0MA 2NZCA 1DTTB 4PG4A 4ELVA 2OO4A 2FC8A 2ZM6F 2R7XA 4RW8B 3DRSB 2GGPA 4GO7X 2K1RA 3DKDA 3TR5A 3PJWA 4WTYA 2WSEC 3UI3A 4NRTA 1PG5B 1HWJA 2MPUA 4OYMA 2WOMB 3QRQA 4X66F 1WEXA 4X4RA 2GJFA 2IRUA 1OQ6A 4RNOA 2VB6A 3DLEA 3M2RB 2F4VJ 4J5OA 1S77D 4AL5A 2XMAA 4OYXA 2HVHA 2DPIA 4NLRA 3HHLA 4OHXA 3GFHA 2IAJA 4J9NA 3HZEA 1HLWA 2D9PA 2HRYA 4MFBA 3W3SA 2D74B 1B64A 1WDTA 3UFCX 2AJQA 1NK0A 1TUVA 1F6TA 4B9MA 4Y0FA 1U4BA 3D0HE 1HHQA 1FFGB 3PX0A 3Q24A 2QE5A 2QLBB 1HNIA 3BQ1A 1WUUA 4ZPCA 1E6VA 3VR1A 2ZBIA 2RAQA 4ELUA 2DGOA 2W4CA 4GRSA 2XCAA 1Q7LB 1FRXA 2FHOB 1K44A 1SUQB 4Q2MA 2ZKTA 2AGOA 4KTQA 3MMBA 1KHWA 4M5MA 1JJCB 4DUTA 2EWHA 3ZC4A 2CNLB 3OL9A 4X84A 1S48A 5K20B 5C2CA 4UOGA 2KHDA 3D0IE 3DOKA 3TAMA 1BGXT 3FCVA 4OJ3A 2E1AA 6FD1A 1U1NA 2VG7B 1HNVA 2SXLA 3PRDA 3AXKA 4P2MA 4EEYA 3DLGB 5LL6d 2CRLA 5CXTA 5I42B 2DNYA 3BH7B 4IOBA 2HHPA 1EP4A 3K58A 1HBMA 1O8BA 4JI3J 2P9EA 2EBEA 4JYAJ 2R8KA 4IOAQ 3BKTA 3MAAA 3NWGA 2ZE2A 4UOCA 2H4WB 4AL7A 3BSAA 5KFRA 2AYBA 3V4IB 1Z1ZA 2WBMA 3D3CJ 3KJVA 4ED7A 3I5AA 3QSYB 3OFHA 4C0HA 3C14A 1UWBB 3NRBA 1NK6A 2LEBA 4YR0A 3I9ZA 2JOQA 2UUBJ 4JI4J 3ITHB 3UPFA 4QU6A 2V0NA 4YP3A 4KH0B 1MNEA 2BJEA 3CE8A 1TV6A 2MDAA 2E66A 2B8QA 4LFAF 4RPFA 4F4YA 4LT6A 4FPRA 1WG1A 4OYOA 1TL4A 1UEKA 5D0RA 5F8NA 4NXMJ 1S6PB 4O3RA 3HK2A 4OYIA 4J7CA 3C15B 3EMTA 1ELOA 1PC5A 4A8OA 1XR7A 1S49A 4M95A 5FD1A 4LR7A 2J7WA 3Q89A 2FJXA 2B4PA 2XBPA 1IJEB 2BANA 4MK8A 2AJ2A 1TL3A 2CVEA 4QZVB 3TAQA 2OI2A 1U2RA 4XO0A 2OTLS 3MM5B 1FO1A 3KK3A 2ZC3A 1EKSA 4UZBA 3DLKA 4G1QA 2CAJA 4OZ1A 3K5MA 1U8SA 1RAFB 5B0DA 4NL5A 5AXNA 5CD4A 4RR5A 2M5YA 3OTOJ 3H98A 4IDKA 5AE1A 4WP9A 3MTKA 1X8DA 2COLA 2IBKA 3D28A 5H9EK 4ECYA 3PM9A 2ZKUA 1YI2S 3TUIC 1QUPA 3MR7A 2Z56B 5K5MA 4ZLPA 3TW0A 1N5QA 3VTIA 5G0RA 3MUTP 3L9ZA 1PC4A 2F7VA 6AT1B 1OS5A 1Y9OA 1YJVA 3D66A 4WE1B 1YG0A 1NZAA 4CQ1A 4WKYA 4L72B 4RX6A 2W9BA 2HBZB 2OTJS 4NA1A 4RLEA 2IHR1 2ZWOA 4NI2B 3BGRA 4LRBA 4OX9J 4H54A 2UUAF 1OPIA 4RUHA 3J7Z5 3O8WA 2ZHOA 5ETPA 4CLFA 3CDAA 2CQGA 2OMLA 3W2VB 4X65F 4KT0C 1HPZB 4HT7A 3MCNA 3F44A 2YPYA 3PCOB 2F63A 3KG1A 4K4YA 3I9V9 2N82B 1OSDA 2QLWA 2DGWA 1IBLF 2FDNA 3OFEA 4YB1P 1D09B 1B3TA 2E7VA 2R2TA 5CCMA 3NEKA 1DFDA 2FHJD 1S0OA 2ATCB 4ZIWA 2CDQA 3D2WA 4N41A 2KL8A 2HS4A 5ETRA 5IOLA 4A46A 2FLLA 1XJWB 5D3GA 3A8EA 3HVTB 3GJQB 3MPWA 1B7YB 3IN5A 2CJQA 2HHVA 2XGQA 4DX7A 4CO4A 2ALZA 4PUOB 2XS2A 1Y10A 2X1AA 3GLJA 3K2YA 5BR8F 1RK8A 4PR6A 4QU7A 2VUGA 4YB6A 4OJGA 1BQXA 4ZK7M 1UJ4A 2R8IA 3DRPB 1YRXA 2DB1A 3JQKA 2CJ9A 1HYSA 2DGTA 3QZ8A 1FF2A 1GTHA 3UR3C 1SL0A 1KFDA 3SQGA 4LBPA 4Y2CA 4DS4A 5GAGI 2JC1A 4F0KA 4DSLA 1LW2A 3H40A 3DNCA 2BRKA 1AZSB 1YQHA 2OMOA 5F3TA 5EWEA 2XZTB 3M2VA 4HYKA 1UVLA 4J37A 1WORA 4NYOA 3JQJA 1KVJA 4K50A 5KFIA 4G65A 2AGQA 4X64F 1T9WA 3HHEA 1KNZA 1URNA 1OIAA 1EQ0A 4F3QA 4RW9B 3I5CA 2WONA 4ED0A 1M5KC 1Y00A 3QPIA 4ZVQB 1S9GB 2LXIA 2IRYA 2WZ1A 2ZHAA 4ZP8A 2JH3A 5J1NA 3W5ZA 1YK9A 2HURA 3CDWA 4JI8F 3EUNA 4C6AA 1GQEA 3R6LB 2YNGA 2UXBF 3M2UB 2GO9A 1S6QA 4LF2A 1Y4ZB 4CLLA 1PAUB 1NK4A 1I3OB 3LA0A 2RQMA 1HA1A 2FUG9 4ECRA 3QJPA 4DR2J 4FYXB 2EK1A 2BW7A 5ETKA 1AW0A 5FJ4A 5KFFA 3IGVA 3OD2A 4CYUA 3RAMA 3VCDA 3FKBA 3M8QA 1FJGJ 1Q5YA 1X60A 1RHUB 5JUMA 3O44A 4ZDNA 3NCRA 4UUXA 1N5VA 1WELA 2YY3A 1NDKA 5KG7A 1LV5A 2W8KA 2XLKA 4QOTA 1T9YA 3Q8QB 4AE5A 3GJSB 5LM7E 3GYXB 3MMAB 5GAEI 3N28A 3CJ5A 3D1HA 3EICA 2FIUA 5HJYA 2VOPA 3PHTA 2XHCA 3W2WB 2OPSB 1WTFA 5J1PA 1NB2A 4CH1A 4CLKA 4YDDB 3QWUA 3HSDA 4PG8A 1NJYA 5T14A 5D4PA 1LXJA 5F8MA 2JEIA 4M94A 5C42B 2R3VA 4IOCQ 2OEKA 5EUHA 1N6QA 3RAQA 4LR9A 3OL6A 4QR1A 2EFOA 3HSJA 2P6SA 1GMWD 5LXYA 4LVNP 1VJWA 5A6WA 3GJRB 2UP1A 1SJ1A 1RYSA 3TQ1A 3PFEA 4ZJLA 2XY5A 4M5LA 4NMXA 2CQPA 1WNEA 2GHPA 3HSGA 3QZ7A 3PIOQ 2R42A 2J5AA 4I64A 3KKFA 1R89A 4H4OA 1CJVB 1MWQA 2KYZA 3IBFB 5KFEA 2JFKA 4UQGA 3OUYA 4WIQA 3GONA 1VMBA 1GXLA 3WBZA 3C3LA 3L7UA 4PXCA 5LXRA 2F5GA 5BJRA 4CRJA 2ZH5A 3GP9A 3CJ2A 3NGDA 2AIRB 2A6OA 3QNWB 2C2KB 3Q2TC 4B3TJ 3R1LA 3QATA 1E6YB 2I2YA 2IYGA 3A3OB 1UJ5A 2CPJA 4UOFA 1JLFA 5KFKA 1RU1A 3EVWA 4ZVSB 3R97A 3MM8A 4CM2A 4DCJB 4C97A 3GIRA 4K5SA 3PTWA 4UZCA 1CQNA 1ZPVA 4PXBA 2RQCA 4B3SF 1NPKA 3HD2A 4FYWB 4EZ6A 2YVSA 1S1XA 1L5UA 3G9CA 4WFAQ 1GX5A 3QIPA 3ZFVA 3FSXA 2VFUA 1U02A 4RW7A 4YB7A 4ZPAA 3MI7X 2ZC4A 3CJ3A 2UUAJ 3IR6B 4NEYA 5AE2A 3W9JA 4AQYJ 5F8GA 1UTAA 2IVYA 4K4VA 4ICLA 4MMOA 3VF0B 2U1AA 2JSXA 3HMJG 1UPPA 4MKVA 2YWEA 1RT2B 2B9EA 2WK4A 3EGNA 1FKAF 3QGPA 4X4UA 4IO1A 4KE5A 4FF3A 3FSIA 4TY8A 1K9MT 3RR7A 5F9LA 2DGVA 3TRGA 2VJVA 3PNIA 1XIQA 1NPRA 3NAIA 1HBNA 1LK7A 1SCJB 2FB0A 4JV2A 4KGKA 1SIWB 4BWMA 1T05A 2DISA 4Y28C 5IWAJ 3KHHA 4ILLA 4R8UB 1R0AB 3D6MB 2IJNA 1G4CA 5L1KA 1YZ6A 1EJ7L 2P5VA 2XY6A 4NCBA 5BYRA 3M8PA 2M52A 2H51B 2QL9B 2X7IA 2ASYA 1AA1B 3KHRA 3JSMB 1TKTB 2YQ1A 1DBDA 1IR0A 3H2LA 3P8BB 3S6EA 1RT1A 1WC5A 5M2RA 1RAEB 4CLSA 2VZ9A 4OYPA 1N36J 3UN2A 1L3KA 2C2DA 3V81B 3KYLA 4ES3A 2YNIB 3UDCA 2JVOA 5I3PA 3S7RA 4Y2MA 1G1XA 3ET6A 3EGWB 4B3RJ 2ROEA 2RDDA 1NU4A 4P6QA 1LW0A 4GKJJ 4I7FB 1C1CB 3G6VA 1DQ9A 2CKWA 3L4BC 3LWMA 2KB2A 2OH2A 4DWIA 2L3MA 3FC9A 3HJVA 4HTIA 4RBTA 5KFOA 2ZD1A 1RT5B 3J7YI 2GMLA 2NQPA 2CJKA 5E7OB 2RE1A 4XK8C 2Q6BA 3IXQA 3WC2A 3NOCA 2EVZA 3ZXWA 4U7UD 1KLMB 3FUYA 1R0CB 2ZH2A 2VG6B 2VKRA 1K1QA 3W5XA 2DGSA 4ENOA 2JFDA 1SC4B 3G6ES 4EZ9A 5J2MA 1REGX 2UUTA 1WSRA 1O5JA 4RUAA 1WG5A 2BRLA 4JI0F 5HANA 4RWWA 1UW9A 2GQ2A 2K7JA 3HCXA 2IC3A 1ZS6A 1TKXA 2RF2A 5B0AA 4LRCA 3T6JA 1HI1A 4TQRA 3EWGA 3BDPA 1R8HA 1CJTA 2HG4A 2EFQA 2RMLA 3B4DA 4NOHA 2B43A 2A18A 2BM0A 3UNGC 1OSCA 1NMEB 4UOHA 1FXDA 2HQIA 1X9MA 3CJ4A 2WB4A 1H7XA 2FHKA 4YN3B 2HEKA 5E3CA 4RNNA 5J2QA 2LQBA 4FYYB 4EFAC 2JEJA 4F50A 5IQ6A 1JLBA 1NK5A 3X3UA 3ICLA 5F8IA 1ZYQA 2B51A 4QYRA 1N34F 3OL8A 4PXDA 1U0HA 4EBEA 1YJNS 3MCMA 2FGOA 3NS5A 2FJWA 4QWCA 2YBVA 3L3CA 2VFVA 2V2QA 4FVMA 1TUGB 3P45B 1SJQA 2W9AA 2LQ8A 4U95A 4A48A 3OSPA 3MD3A 4FBUA 2DK2A 2YNFB 4IKAA 3WC0A 3R7BB 2M8HA 3OQ2A 1VQYA 2Z2ZA 4CO1A 3TJ8A 3O1LA 5IFMA 4LSNB 4J9OA 4ZPVR 4O4GA 4P7VA 3PR4A 2RKIA 3UCUP 3DRRA 3OXLA 4C8YA 5LSRA 2I0XA 5FDLA 2HK2A 2RQKA 4PYAA 2K7KA 1F2GA 2YKMA 2YWHA 4J9LA 2YWKA 4F2RA 2J8SA 2A1BA 1FRLA 2ZHBA 5LMUJ 1UVMA 2Y8WA 5F8LA 2CJXB 2LFVA 4DQRA 1T94A 1ZZFA 3FBBA 4F67A 2EC2A 4RW4B 4LF7J 1GTEA 3DGPA 1DHMA 2GJIA 3LP1A 2OAUA 3R1HA 5A6PA 2PN6A 2RUSA 1NSQA 7FDRA 2LLZA 1KRPA 2QX0A 3D54A 2FY1A 1HL6A 1XMOF 4BC7A 3NLCA 2W2NP 5L46A 3GIIA 3MEEB 3QAEA 1EKRA 2CNKB 1FCAA 1TK5A 3OJSA 3TEGA 2J76E 5DDQC 1GMUA 1FDBA 1FWLA 4DPTA 5ETMA 2DNPA 3W60A 2OSQA 4HHJA 2DGXA 1B99A 1HQEB 1S1UB 1HD0A 3I0RA 4O3NA 2EK6A 2DGUA 4B3SJ 5J2PB 2VHGA 2KRBA 3OFGA 4DV7F 2DRDA 2DHSA 3W63A 3VWSA 1H3DA 4DFPA 1VBZA 1B4SA 2VODA 3LF0A 2CQ1A 2RDIA 2JEGA 3MEDA 4P10A 1Y5IB 2CQ3A 2ADCA 1U1QA 2JLFA 4EMDA 4ZLLA 4RWXA 3MM9A 1U1LA 4HKQA 1WJ9A 2WRMA 4NXNF 4USWA 4XAKA 1M5SA 2QRRA 2RQ4A 1QDUB 5HROA 3G82A 1H2VZ 2WAQD 2QJ3A 1FI4A 2H4YB 3VVTA 2DR8A 4DR6F 1TL1A 2XSJB 3M9OB 1NM2A 1DTQA 2WCXA 1IKXA 4N47A 4J90A 2F40A 3CUNA 3TAPA 1S9EA 1P6TA 3V5RA 1RGVA 3DI6A 3D0GE 1N56A 2Y1RI 4W92B 3HHLB 3HD1A 2ACYA 2EI5A 2IAJB 1PIEA 3R9LA 2KH9A 2R8HA 3RB4A 3MHYA 4FF4A 2AYEA 5DGAA 3BB5A 2R7WA 4MFBB 2C3PA 1HHTP 2G0CA 3CD5A 1U6BA 3T3FA 2KG1A 4IR9A 4MT1A 1YJ9S 1I1GA 3QIDA 5RUBA 3HPOA 2VBYA 1WOSA 4QYZK 1WWHA 2GS8A 2XS5A 3DLJA 3WX8A 3DOLA 5CA5A 4X4VA 1HNIB 4TXSA 3UCGA 4N8OA 1P1TA 4DUZJ 4B9TA 4TY9A 1RHQB 3BGLA 1ZPWX 3FGVA 3GG0A 3G2XA 4B9VA 4R25A 2BMBA 4LF8F 2IM0A 4CLWA 2B4OA 2FVSA 4DQPA 1FERA 3HHDA 2DEJA 1N5YA 5H9EJ 3DOKB 3TAMB 5H9FJ 2HBQB 2UZAA 3B78A 1HNVB 1P9QC 2X51A 2W7AA 4CI0B 2FD2A 1XERA 3ISNC 2I9SA 4USMA 2DH8A 4WK3A 2DVIA 4K2JA 1JKHA 4JI7F 2L9DA 2MZSA 2BOAA 2R7VA 1ZOTA 4DV2J 4C3KA 2YKPA 1X4BA 2B9YA 2CWXA 4TYAA 3SSRA 3MAAB 1VIXA 2ZE2B 3MOZA 2Y3YA 3F0NA 3IS9B 4F8RA 1KTQA 1M5PC 3B6BA 1XC9A 4MYUA 1RTZA 3KJVB 2O5DA 4PQUB 3C14B 4L73A 1S79A 4GKKF 2W24A 4NZ6A 2M4MA 3TX0A 4KSEB 1RUSA 5K14A 1ULRA 2KG0A 2MJUA 3BYPA 3T1AA 1VJQA 3W64A 1TV6B 1KONA 4QBUA 3OTCA 5ETVA 4DL7A 1S6OA 1UEVA 2ZDPA 2IJRA 3RB0A 4ZVEA 2W2PP 1I51B 4WU2A 3C16A 4X2BA 2YKNB 3OXGA 4CLZA 1H38A 2DRBA 3V6JA 3VAKA 1HNZJ 4RL1A 1UW4A 1TL3B 3KMSA 4WFZA 1PAEX 4MAKA 1S1TA 2IDEA 4OX7A 5B0BA 2HZAA 3DLKB 4OHZA 4KYZA 3PY8A 2F8MA 5KFDA 4G1QB 1BY9A 2MQLA 1HBUA 3AT1B 1HI8A 1C0UB 4MYTA 3CGIA 2YNHB 1H0HB 3OHAA 3EXCX 1Z2ZA 4BDPA 2HW3A 4URQU 2QTWA 2G0JA 1QSSA 3R7SB 4LSLB 2E5GA 2OKQA 1RJJA 3FQLA 3IM9A 3OLBA 1XMOJ 1CSJA 5G0RB 5A0YB 1Z4UA 4E98A 1YKWA 2DNGA 3UDLA 1K1SA 3U1NA 4UW2A 1N5TA 4Q0BA 4F3MA 2BE2A 2FZKB 2W9BB 3ENWA 3BO2A 1SQGA 4X4OA 3PRVA 2HBRB 1OMSA 4Y65A 2BJ1A 1R6YA 3BGRB 4GO5X 2GAGC 1RKIA 3HXMA 4UY8T 1KN6A 2OP5A 2QFJA 2VQFJ 2RU3A 2E5JA 2RILA 4G1IA 4HL9A 5K8OA 1QTMA 4PZVA 3NS7B 3TNVA 2DY9A 2VQEF 3GIJA 2F3JA 3MM7B 4YS2A 2R7RA 4O3PA 3IM8A 3MECA 4PPZA 1IKWB 5HQMA 1SI9A 2M2BA 3A4TA 1FD2A 1VRTA 1H73A 1I94F 3T1YJ 3LO3A 1FNXH 5T7LB 3JSBA 1ITPA 1UFWA 2F8EX 5F9NA 3TX8A 2QMWA 2Q1LA 3I4HX 2C3MA 5KG3A 5D3GB 2OPRB 4IH6A 1VHFA 2FYXA 2MKCA 1FX2A 1SC3B 4WZQA 2NZ4A 2ACMA 3C6TB 4WXWA 4QW9A 4CH0S 2B4VA 2ZZTA 3OJUA 2MKJA 3E3XA 4ANEA 1U47A 5JVHQ 2W8LA 1MG7A 1RKJA 1HYSB 4CLUA 2XCPA 4B02A 3NMAA 4OI1A 3E51A 3BO3A 3PO5A 4QJVA 4JI6J 3H2UB 3LANA 3H42A 3GCXP 3X1LB 4ZJOA 3LUYA 3C66A 3WZ0A 1RHKB 1H7WA 2ZJQQ 2KXNB 2FY8A 4NPOA 3ZTQA 2KT5A 1FDDA 3NNAA 4AXIA 2HLUA 4C8OA 1KVIA 2GX8A 3KUEA 1X0PA 3FEYB 2CFXA 1NHVA 2DRAA 1FRHA 4NMLA 4O3OA 3IC1A 2ZH7A 2K8GA 3M7VA 1BMQB 3IR7B 3M6WA 1OO0B 2D69A 1RWXB 4LF1A 1FJCA 1UFKA 4CO2A 2WONB 3FFIA 2J7KA 1B0PA 2MZQA 5EWGA 3CVKA 4ZVHA 2P8IA 3K59A 2M70A 2DY1A 4IFVA 4OZJA 4DFKA 1A0OB 3IA0A 3R5DA 4GC6A 4OHWA 1LWXA 5JVGQ 3UO0A 4LF9J 2EEYA 1T0TV 3H4BA 1S0VA 5JMNA 3EZOA 1QAIA 1FXRA 3LALA 3LP0B 1JLGA 1UJ6A 3MM6A 4P9SA 4AL6A 2FVCA 1CBKA 3FVYA 2XMWA 4ZVGA 1UZDA 5CZXA 4ZVUB 4V19X 2XMVA 2B7BB 3FCWA 2CZ9A 1U24A 4ZOSA 2MQPA 4QIVA 1IKVA 1WC6A 2H65B 4I69A 2LU2A 2XMUA 3T5KA 3FJ2A 2MKHA 1KVKA 2HMIB 5K8MA 1EIYB 3I82A 5AE3A 4YFUA 3UN3A 5IM0A 3TZYA 2QLJB 2AU0A 2AW0A 1F9EB 1PBUA 4X4PA 3UVJA 4OZ2A 2BJDA 2HHTA 1SXLA 1N52B 5EHHA 1ACMB 2AT1B 4DCOB 4J9VA 4K4TA 1TZ0A 4DMZA 4LMZA 1KQKA 1X7VA 1IN0A 2KDOA 4X62J 1X4EA 4C8LA 2J7UA 1V5IB 4LF4J 4C0OC 1N5SA 3CMES 1UVIA 3KK2A 4USIA 3M8ZA 1GEHA 5C24A 2E9TA 1ZTWA 3KXDA 5HMXA 4OYZA 3RW7A 3HP6A 4IR1A 2HQFA 1IR1A 4R5PB 1RA7A 4QR0A 1FKPA 5GMDA 5HBMA 1RT4B 2CPXA 1NDCA 1V3RA 5KFHA 2H1YA 2NUHA 3BM7A 2BV3A 3D7SB 1GX6A 1FESA 4H4OB 4X4NA 4DQSA 5LMNF 2O01C 2B4UA 3R2CJ 1KDNA 2BBEA 4IFYA 1C4AA 4LSZB 3IAM9 3BQ0A 1IJFB 1Q0NA 2H54B 2D3ZA 3IGNA 1YJRA 1SKUB 1NXIA 2MQOA 5K8NA 1EHWA 3HKWA 4JI1J 4DN0A 4HVZA 3MEGA 1FTCA 2Y0BB 1ZBTA 4DV0J 2WSFC 4KKOA 1D9DA 2CQCA 3MM8B 2QV6A 2R4FA 4DZDA 4IG0A 4MIAA 2UVWA 2UU9J 4RZRA 3JTOA 1QJHA 2VD3A 4W98A 3PO4A 2KZMA 3QIPB 2AEMA 2AX1A 4P75A 1CG2A 5A8WB 4DPUA 1YRTA 4HACA 3W62A 1NSKL 1RT3A 2O3DA 4HI1A 4ICLB 2GVZB 4Q8EA 4X4QA 1TFYA 2R8GA 4I4BA 3IRXB 3J7AN 1BWEA 2Z57B 4TY8B 4O44A 2HHSA 3LP2A 4Z7YA 3MGJA 1D9FA 4Q8FA 1HBNB 2NR0A 4K0KF 2OPQA 3CMAS 1Y7PA 1T05B 3U1LA 2IDLA 3AXMA 1RWKB 3VHQA 1LWEA 3NNHA 1F3FA 4EBCA 2FJVA 2M8DB 2GJ2A 1U6FA 1HR0J 3UDEA 3O2IA 3H5SA 4ZVTB 4OV6A 2B5JA 5HP1A 1TTHB 4ZVPB 4ZPWR 2UVUA 3Q8VA 2GVDA 2W2QP 4OYBA 2MZJA 2V5HG 5F8JA 2KFNA 2LU1A 1LWFB 4DV5F 2QSWA 3RYLA 4YMEA 1VLOA 3W61A 4OFZA 3IWLA 1K0TA 3N0VA 3KDOA 3IG1A 1FRJA 2GQCA 3ET6B 5L38A 1VYAA 3SCLE 3I5BA 1VQ5S 2O66A 5IC6B 1PYOB 1NJWA 1RHJB 4U9RA 2DO4A 2OLWA 2YWFA 2F4VF 5GAEU 1LW0B 4WIIA 4P2SA 2EPIA 3D5MA 3AFGA 1OQ3A 3M1VA 3W8GA 2X3GA 1VQPS 3I4PA 2W7OA 4ZCIA 5K8PA 1AT1B 2DH9A 1WKKA 2YKOA 2NXNA 2W2MP 4C3MA 2B8PA 2VA3A 2N7CA 5HMZA 3UD4P 3W7BA 3PIPQ 2HAFA 3JTNA 2IRXA 3RBZA 5AXLA 4A8WA 1FRKA 2XY7A 2NXCA 3ZZ0A 4PXEA 3NOGA 5J2MB 2GIFA 1HWLA 1S72S 4FKYA 5DLGA 1RT6A 2V69A 2V94A 2E29A 3TZXA 2FTRA 4DZ6A 4Q7AA 3S1TA 3QFWA 2PA8D 1TVRB 4KRWA 1SC1B 5E33A 3N4WA 1RWOB 1VS3A 2IC3B 3OR2A 3QMQA 4DHVA 1TKXB 1QD1A 3GCWP 2DCLA 2Y8YA 4H4KC 1SH3A 1LNQA 2F9DA 3WX4A 4DV4F 5LT5A 3POTA 4ZP7A 4U8YA 2ZUAA 3T9NA 5AJ3J 3T5JA 2VIHA 1QTNB 1Q8IA 5E3QA 3DM2A 2Y1IA 1F0XA 4M5GA 3QGIA 5J2QB 1U6ZA 2HFNA 1T9UA 2B0GA 1OY8A 4Z7CA 2CPEA 5ETSA 5D6GA 2B3TB 1JLBB 3QAUA 4K4UA 6FDRA 1ZM2A 1X4DA 1Q53A 2CPIA 5K9FA 1RADB 1VBKA 3DDIA 1RBOB 3JYTA 1DTTA 3TZWA 2JLEA 5KFMA 1FVSA 1UETA 2DH7A 2CA9A 4OX8A 2C3YA 1D1UA 3ILJA 4RW8A 3DRSA 4JI3F 5T41A 3C6UA 1XEZA 3RRHA 1SJRA 4NLXA 2V4JB 1RT7A 2DNMA 2OD6A 3CPWR 1TP7A 1WDDA 2PC6A 2WOMA 2RUGA 2GZOA 2XTJP 1DARA 2DJWA 3NGSA 5AT1B 5HN0A 4XDDA 2DR9A 3K57A 2KXHA 4DL4A 1JIHA 3LPEA 1SJ4P 3E2EA 4ANDA 1S6UA 5I3UA 4L75A 2ROGA 4I2PB 4NLPA 2JDJA 2I5JB 1XK8A 4DR3J 5KAKA 5M2UA 1IVZA 4I56A 4NXMF 5CYQA 2JLGA 1SV5B 2D7SA 3DGPB 1SL2A 2LA6A 1RAIB 1U7LA 1NKCA 4JP8A 4UTGA 1IQZA 3BV8A 5CYMB 2R8JA 3E8OA 3ZZPA 5HL7Q 1RWPB 4RJVA 4O3QA 1RU2A 1WTBA 4PPDA 2LEAA 2HFVA 2QA2A 1DZ5A 1KHVA 4LJMA 4Y00A 4LF6J 5HVGA 1J5OB 1RAGB 1UCNA 1VC0A 3K5NA 3V4MA 2HIYA 4OZ3A 4DV6J 3AA8A 1OJ4A 3SFGA 1N4LA 2HHWA 2BE9B 3OTOF 3IP0A 4O4RA 3KLVA 3ISND 4TYBA 5IS2A 2IMWP 3WQPA 2A3JA 2WSCC 4MIWA 4LIRA 4OI6A 1VISA 5KFZA 2ZOGA 3MEDB 3H25A 3QRPA 1FKOA 4KV8B 1VQNS 1H2UX 3DXSX 3AH6A 1WC1A 2M0GB 3M05A 5I42A 3BF4A 3HX9A 2APOA 4LQ9A 3CJKB 4RBUA 2DBBA 3G4SS 2PMZD 4NLGA 3BYRA 5B0FA 4ZIVA 3GZ7A 4OX9F 1S1VA 3IWNC 3GV8B 1TL1B 1RTDB 4NZ7A 4K0KJ 1S59A 3PHEA 4FN5A 5DG9A 1PILA 1IKXB 2RSQA 2J9DA 3V4IA 3RR8A 4UQTA 4BBYA 2DR5A 3FEZA 3DOMA 1VC6A 1VR6A 2OD4A 1S9EB 1OYDA 3THVA 3DI6B 1VQOS 2HQ3A 1NDPA 4FVCA 2R2RA 4EO6A 4F25A 2L9NA 3SCKE 3R2DJ 5SUHA 4DV1J 1S1WA 3GJTB 4LRAA 3Q83A 3T5HA 1L3SA 4C8NA 3SMZA 2B7CB 2HQCA 4Y6IA 2UUCJ 2BQRA 2AJ1A 3OFFA 4MTPA 1Q1KA 5DDOC 2XZDB 4DV5J 3VZHA 1PJ5A 2J6UA 1R8PA 3D1QA 1Y3JA 2ZITA 1BHNA 3C15A 1CS4A 3OV7A 3RBDA 2D1CA 2FZCB 1R8CA 2PI4A 1UEUA 3EVOA 1CVJA 3QO9A 1XMQF 2YKQA 2PGCA 2PSZA 2HWIA 3T1HF 4KGZB 5IC4B 5ETOA 5HO4A 5H1SV 3MM5A 2BZ2A 1VHIA 4LVOP 1TK8A 3I56S 2UXCJ 5KFXA 4EO8A 4P2XA 5GMKa 1IM6A 1PYTA 4J9UE 4Z37A 4YQWA 4ID5B 4WYWA 3CCVS 4LR8A 2IFXA 2J8AA 3KK1A 2R7SA 4DCPB 4YEAA 4KIAA 1EZZB 3RTVA 4O23A 1L3UA 1N5YB 1NKEA 3MXHP 2O1PA 2AJFE 3PRBA 1B70B 3WHIA 4PWDB 1YDLA 3ZNJ1 1RAOA 4X4TA 2CG4A 3KHLA 4DSEA 3CCZA 2XO7A 2IVFB 3H2VE 3DMJA 2QIFA 1R0BG 4WE1A 2WHOA 3KLFB 1HNWJ 1ZA2B 1RA6A 3GPAA 2QZ8A 9ATCB 3NGRA 4FXDA 3DCAA 3OTEA 4KAIA 4AXJA 3I6PA 2GHWA 4DEZA 3SSSA 4CM0A 4MK7A 4NI2A 3US5A 4DV4J 4USTA 1VQ9S 4FBTA 1R8AA 3BKUA 4FXWA 3UNYA 4CNYA 4WFNQ 3BDEA 1IQTA 1OY9A 1NJXA 3NGKA 1MU2A 2AGPA 3HHLC 3FRYA 2PT0A 2BJ9A 2N4CA 5AXMA 3E01A 2HZVA 4DR2F 5LJ3Y 3PJ9A 1ZM4A 2N7YA 4IO9Q 2YXLA 1Q81T 4CLYA 5GAHU 1ZA1B 2LP4A 2BEFA 1FJGF 1S9FA 2MLYA 3VAFA 2MGZA 3OSNA 2QL7B 2JVRA 1ZM3A 2OHDA 3C16B 3HVTA 3KJQB 1NRKA 4KFBA 3GV5B 1U8WA 3EXYA 3AQOA 2GIRA 3TUPA 4W90B 4ZN3A 4DX5A 4RKUC 1SB6A 5A8RB 3T19A 2OIHA 3G8SA 1WC0A 2IPOB 2CQBA 3CF5Q 3V6DA 4ED6A 5KOXA 3G71S 1UWAA 4RNFA 1S1TB 3ETOA 3BR9A 1NCLA 4KH1B 2OELA 4TU8A 1U2FA 1HBUB 3CCUS 1X5TA 1OYEA 2ZUGA 2QG9B 2Y1JA 2HNZA 1Q8LA 4P52A 4WU3A 1RACB 3H5XA 3CCWA 3BBCA 4KHPF 1YBAA 3QFHA 1RLDA 2OSRA 5F41A 2QMUB 4LREA 3TVKA 2FLPA 1BQMA 4LFBJ 4WK1A 2J0WA 1FT8A 2HK3A 4ELTA 1FJ7A 2FQQB 3FNNA 4OZNA 3AJ1A 4NLQA 4DS5A 4J91A 8ATCB 2FHJA 2VPYB 4Q0BB 1RDRA 1QSLA 2DXFA 2QFIA 3GWCA 3SDEA 3A13A 5CCLA 1RWNB 4I6AA 1LK5A 5J2NA 3U7JA 2KJWA 4C3LA 5HAOA 4WFBQ 3VAGA 4B3TF 4FDFA 1T9VA 5H9FK 4OI2A 5EWFA 2Y9HA 2ZBRA 2HHQA 2FC9A 1IBKJ 3UR0A 2AMCB 3M2UA 1HNXJ 3ENAA 4KC5A 4DQIA 3MECB 3Q8UA 1JLCB 3PYDA 2FVQA 3HVRA 4XIUA 1VRTB 3CCJS 4KB7A 5L9XA 2CQ4A 2P9GA 4PRFA 4TNOA 5MLCV 4HTJA 4J9PA 2RS2A 5B0EA 2BUNA 1BE4A 2KU7A 1HWIA 4OZ0A 1QAJA 3SCJE 1T02A 4FPIA 1BD6A 3RZAA 1KSPA 3A3NB 1QUVA 4AQYF 2KM8B 3P4UB 1V5VA 4DXLA 3H0PA 3MAQA 1N0VC 3QWPA 1JXLA 3N9UC 4Q44A 1P1LA 1YJTA 3OVAA 2MKKA 2R7TA 2DIVA 1RABB 1QLNA 2OPSA 2ZH1A 1ZAXA 4F4XA 2R2SA 1F5AA 2A6MA 4A8QA 4CDIA 4IH7A 1NJIT 4F02A 7AT1B 3PW7A 2WW4A 3RG6A 4LF5J 3KJFB 1RWUA 4IQMA 4G3IA 4GVBB 2ZH4A 2HZCA 4ECZA 5IWAF 2EKNA 1JMTA 2QYGA 3IFEA 3EGZA 4WTOB 3F41A 3U1MA 2F65A 3NGUA 1TQLA 1S76D 4EGLA 3A8JA 4DR4F 4ZCMA 1JB0C 4WCEQ 1WACA 3OVBA 1S4EA 2KVQE 1XMQJ 1YJWS 1N0UA 3T1HJ 1WC4A 3JAMY 1VRUB 3Q22A 2DPJA 1VOMA 1N36F 2BACA 2LYVA 2ZEJA 4ZHRB 3G87A 3DFEA 4CT9A 4CP5A 3BSCA 4PQAA 3S8SA 2RH3A 4CIOA 3NCQA 5L39A 4IFVB 3HF5A 2MY7A 3W8PA 4B3RF 2ZNZA 2V63A 3EDRB 3BQ2A 4GKJF 4CO5A 1QVFR 2DO0A 1NEEA 2PFFB 2D3OR 1HBOB 1JLGB 1KQSR 2FJEB 3KHGA 2RS8A 4J9MA 2DHXA 2VC1A 4KHMA 1IKVB 4IUFA 4DR5F 1RTIA 4LRFA 4RW6A 5DJBA 1UVJA 2HS0A 3MCSA 3PVXA 1HMVA 3MFHA 4FXVA 5E2QA 1GMWA 4K4XA 2U2FA 5IM0B 4B3OB 3HFVA 1RCXB 4P72A 2MXYA 4AFFA 2UV8A 4KGVB 3UVJB 1F60B 2BABA 1VQKS 3BPSP 4BC9A 2HWHA 4OZ5A 3BZQA 2EXUA 1RT2A 4KGXB 4WWSA 2DNNA 3T41A 3VGTA 3KK2B 1W25A 1RP5A 2EFVA 4L74A 5C24B 4P2FA 1GXTA 1WHWA 2VU5A 4TKTA 2FVPA 4B3MJ 4FF2A 2VBXA 2J0SD 4H4KA 2LQJA 3P3DA 2RT3A 1FKPB 3LWLA 2YQ3A 3EPGA 4EK2A 2FJBB 2X1BA 1TKZB 3FDSA 3ZZOA 4R8UA 1R0AA 1WD6A 1FEHA 3M32A 4JI2F 3DHWC 3GTYX 1TFWA 5KFWA 4NEZA 1TL7A 2CPZA 4A47A 3PFOA 5D78A 3UE2A 1NK9A 4CO3A 3NBPA 2F9JA 4DF4A 4IFYB 1SH0A 3HLUA 3UW1A 4GC7A 2VOOA 1LEOA 5HVFA 5KOWA 4OI3A 2D3UA 3KLIB 1RCOB 1M5HA 2AJ4A 1KKHA 4UUWA 4M5DB 2KRRA 2YNIA 3CJSA 1IBMJ 3MF5A 2LQ9A 3GR0A 3FRZA 5GVQA 3H4DA 4KHPJ 5DQIA 4NA3A 4CLTA 4ED1A 1BXNA 2V8HA 2Y0SD 3K8WA 2ZBQA 1AUDA 4IH5A 1VQMS 2VONA 3Q2SC 2G9OA 1TMMA 1HARA 2OPPB 5LMUF 4DR7J 1BC6A 3EGVA 5KT3A 1RT5A 3G8TA 3BGOP 4LF7F 2CPDA 3IBWA 3AJ2A 1UPMB 1W26A 3GFZA 3CULA 1R31A 3GFYA 3JTPA 4HACB 3V2UC 4V1Ak 3KWMA 4K8RA 1PGZA 2IYIA 1NLKL 1R8BA 1RXOB 3R27A 2H48B 2VA2A 3WDOA 1PBAA 3DLLQ 1VIOA 1N54B 3LP2B 4ECQA 3FCHA 1KLNA 3T6BA 1MLAA 3LGNA 2AP6A 2OPQB 4QWDA 2XWYA 3PR5B 2ZH6A 3THTA 1FRMA 2CYYA 2HRTA 2QMXA 3BBFA 2AX0A 3IO1A 4M63A 2AD9A 1NH8A 2PE8A 1AXQA 1JLQA 3TA1A 3ZTPA 3BKFA 3I0SA 5HP1B 3RB3A 2YH0A 1M1GA 2GVDB 4PABA 2DNZA 2HBYB 2CUYA 1KOOA 3M6VA 3Q8SB 1EX8A 1R27B 1ZETA 2HKEA 2G1DA 2YNFA 1FHTA 2OFHX 3TANA 2YH1A 2AYMA 3CC7S 1Q95G 1PSDA 3PKYA 2ZH3A 3OXFA 4DPXA 1J5EF 4DR4J 3VQTA 4JV5F 4N77A 3P6YC 2V9KA 4F0HA 4Q2LA 2ZH8A 1YITS 1YTYA 2I38A 3NGTA 1T11A 5KG5A 2CADA 4RW4A 2YTCA 5GMEA 1RQ0A 1IKYB 4ALZA 2RVJA 2J9DE 1X31C 1Q5VA 3G6XA 1X0FA 3AOAA 1FJEB 1C0TB 2LQ5A 1PJ6A 2J9EA 1FX4A 2GCFA 3MEEA 1X9WA 1RE1B 3UCZP 4TN2A 1F5BA 4DV3J 3N6MA 4DUZF 5D0HA 3GMGA 3C19A 1H74A 4HLBA 3H5UA 4M5HA 3QLHB 4C4WA 4PAAA 4IRKA 3A12A 3KDNA 2VV5A 2NXJA 2MQMA 3LTOA 1S1UA 3ADAC 3H7HB 1R6VA 2FGCA 3NKYA 4DR5J 1VRQC 2C2NA 5A76A 1Z2LA 4ER8A 2DTJA 2ADBA 1NSAA 2ZNYA 1FK9B 3KJNB 2EG1A 2MMYA 2V34A 3K17A 3IWXA 1PYSB 1DQAA 3BBBA 2RIJA 4J9RA 2LECA 3V6KA 2WVCA 2F8HA 2NCKL 2E1PA 5DG8A 3MMCB 3JYTB 1DLOB 4B9UA 4NCGA 2I6WA 3PEJA 2HNYB 4ZP9A 3C6UB 2B6AB 4DV2F 1R3NA 3VAHA 4F26A 1GNKA 1RT7B 1XTZA 2MYFA 1ROFA 1YSJA 1UZHA 2XSJA 2QGFB 4U8VA 2VPZB 4ILRA 5ITHA 1DJ0A 4EYHB 3HT0A 1HQUA 2CIMA 4AUKA 4YDXA 4DR1J 2LKZA 4DL2A 2HFZA 4JI2J 1S57A 4KO0B 5I3UB 1FWPA 5KFGA 3MOJB 2BDPA 2HFOA 1M0SA 1JJHA 2LXUA 4ED4A 3TP2A 5ETLA 2UXDJ 5CYQB 3UDVA 4FNHA 1CQMA 5E5NA 5KG6A 1T03A 2ASDA 1OWXA 2VC0A 1N88A 2NXEA 1N8RT 1HNZF 2Q79A 3AAWB 3MZIA 3FBCA 2LVWA 3LAMA 2CPHA 4OLPA 4CTAA 3ILOA 3PKMA 4WFXA 5A2QY 5I4MA 2KZZA 1RTHB 4IG3A 4NLDA 1HFEL 5DDRC 1SJFA 2C3UA 3PV8A 1CEZA 2DIUA 3Q23A 2V68A 1A7GE 2IM3A 5GADU 2V8DA 4C2MA 2CVIA 4Q5VA 5L1LA 3F73A 4FYVB 3VALA 1PO6A 2HPUA 1XWLA 4RBVA 2Q6CA 3KLHA 4LIWA 5KTQA 3OW2R 3W5YA 5J1EB 2IM1A 2K06A 3ONQA 1RHRB 3K89A 3K5LA 4M5IA 2HVEA 1JNRB 1PCAA 4OV1A 1KTVA 4JV1A 1FKOB 2VL1A 1SIZA 4A8FA 1F9HA 2HNDA 3MAHA 4B9LA 1X4GA 4F2SA 3NNCA 1XNRF 4XPEA 3M30B 4PWWA 2BJ7A 4I2QB 3HHLD 1S4FA 1B0VA 3JAMU 3ZTOA 4LUBA 1S1VB 3VAMA
chains in the Genus database with same CATH topology
4I64A 3KKFA 1R89A 4H4OA 4F4ZA 4B3MF 5J2MB 2VQFF 3HZGA 1HWLA 1XBWA 3UWTA 1S72S 4ZP6A 2KYZA 3IS9A 5DLGA 3MR2A 1RT6A 5KFEA 4DDFA 2JFKA 4C7QA 2V94A 4UQGA 2E29A 3OUYA 2Q66A 2FTRA 4R0JA 4Q7AA 3S1TA 1QSYA 1VMBA 2VFTA 4G1PA 1K73T 4PQUA 1ZAWA 2PA8D 1TVRB 1GXLA 4KRWA 3WBZA 3C3LA 5E33A 4PXCA 3OHBA 5LXRA 3N4WA 1VS3A 5BJRA 2IC3B 3OR2A 5KFLA 3QMQA 3QJLA 2ZH5A 4DHVA 1TKXB 3CJ2A 1U1OA 1S1WB 1REVB 2DCLA 1IUJA 2XI3A 3NGDA 4PUOA 4H4KC 1SH3A 3T1YF 3HFKA 4F4KA 2F9DA 2KO1A 3WX4A 4DV4F 5LT5A 2C22A 3POTA 3Q2TC 4ZP7A 1P8GA 3R1LA 2O67A 3T9NA 3T5JA 1KOHA 2GO8A 1E6YB 2QA1A 4ETZA 2I2YA 2IYGA 1NK7A 1UJ5A 1QE1A 2GGPB 1Q8IA 2K1RB 5E3QA 2CPJA 2GC8A 3DM2A 4ETXA 2Y1IA 1F0XA 1JLFA 1VRUA 1O51A 3KLGB 5KFKA 1NK8A 5HI7A 1HWUA 2R7OA 3DRPA 3I32A 5DS7A 3PJXA 3QGIA 4WXOA 5J2QB 1U6ZA 3D1OA 4QPXA 2HFNA 3MM8A 2B0GA 2MSSA 5DETA 1T3NA 2CPEA 4C97A 2UUWA 2YKNA 5D6GA 4K5SA 2B3TB 4ZHRA 2XLIA 1JLBB 3QAUA 4K4UA 1CQNA 5KFYA 6FDRA 1S97A 1ZM2A 1ZPVA 1X4DA 2JL9A 2L41A 3FQKA 4PXBA 1JLAB 5KT4A 1Q53A 3IRWP 1IBMF 2CPIA 2C42A 3BS9A 4ZVFA 5K9FA 2F1FA 2RQCA 4B3SF 3C2PA 1UP1A 3JYTA 1DTTA 3RAXA 2BOPA 2JLEA 2E1MC 3K0JA 5KFMA 3QO9B 3DLEB 4WFYA 4DG1A 4Y2IA 4EZ6A 2HGNA 1T95A 5HMYA 1FVSA 1UL3A 2YVSA 1S1XA 1UETA 4I6WA 5KG1A 2DH7A 5HQ8A 2GA7A 5JXSA 2L9WA 2KYXA 4OX8A 4WFAQ 1GX5A 5CD4H 2C3YA 1D1UA 3KMQA 3QIPA 4A8XA 3ZFVA 3FSXA 2E7WA 2DNQA 3NG8A 1BQNB 2VFUA 4RW7A 4RW8A 3DRSA 4YB7A 4JI3F 3LPYA 5T41A 3C6UA 1XEZA 3T9ZA 4ZPAA 3HJFA 3MI7X 2ZC4A 4IQXA 1X5OA 3CJ3A 3RRHA 3IR6B 1CLFA 1SJRA 5AE2A 4NLXA 1IM4A 5M2PA 1U45A 1HBOA 2V4JB 3CSKA 2FLNA 1RT7A 2RB7A 5F8GA 1X5SA 2ASLA 2QEXS 1LFPA 2PI5A 1XN9A 2DNMA 2IVYA 4PKDB 4K4VA 1TKDA 2OD6A 3CPWR 4ICLA 1TP7A 3CWJA 4DR7F 4MMOA 3VF0B 2U1AA 2PC6A 2WOMA 4JI6F 1C0UA 2RUGA 2YNHA 1SKSA 2JSXA 1DARA 1LWCA 3HMJG 2DJWA 2MZRA 2V9WA 2YWEA 1RT2B 5HN0A 1RAJA 2WK4A 2BE2B 3EYZA 2JEFA 5G4DA 4XDDA 2DR9A 1A6LA 4RW9A 3EGNA 3KK1B 1URRA 1FKAF 3K57A 2KXHA 4DL4A 1VQSA 3QGPA 1JIHA 2NSCA 4IO1A 4X4UA 1SJ4P 4FYDA 4DLGA 4KE5A 4OI0A 4FF3A 3FSIA 4CCHA 4LSLA 2X1FA 3E2EA 4TY8A 1K9MT 1O0PA 3CD7A 3RR7A 1S9GA 1S6UA 3J7A1 1FE4A 2XHWA 5I3UA 4B3OA 2ROGA 4I2PB 2IVMA 5F9LA 2DGVA 1WEYA 3MPVA 2JX2A 4ZPBA 3TRGA 2CPFA 3PNIA 4NLPA 4Y2AA 3BEGB 2JDJA 5A0YA 3NAIA 4ITSA 1HBNA 1LK7A 2I5JB 1XK8A 2FB0A 3L7PA 4JV2A 5KAKA 1E6VB 1F9FA 4KGKA 1SIWB 5M2UA 4BWMA 2JJ4D 1T05A 2DISA 4I56A 3DMJB 4NXMF 1B0TA 4J9SA 5CYQA 1RTJA 2JLGA 1SV5B 4Y28C 2D7SA 1SL2A 3KHHA 2LA6A 2QYCA 3M6UA 1SQEA 2LCWA 1U7LA 4ILLA 4R8UB 1R0AB 3LQVA 1NKCA 5I3QA 1H98A 2IJNA 4I0WA 4NLSA 5L1KA 4DSIA 1IQZA 3R5AA 2P5VA 5CYMB 3KLEB 1MMDA 2R8JA 2XY6A 3E8OA 3MMBB 3ZZPA 4U67Q 4ES1A 5HL7Q 3M4XA 1A9NB 2CPYA 2ERRA 1JK9B 4NCBA 5BYRA 4O3QA 3GSDA 2QLXA 2VBZA 3M8PA 1HWKA 2M52A 1WTBA 4PPDA 2ASYA 2BVZA 3KHRA 2LEAA 3DU6A 3JSMB 2RDJA 1XR6A 2C3OA 3A1YG 1TKTB 4LF9F 1DBDA 2QA2A 4TLQA 1HHSA 1IR0A 3H2LA 1DZ5A 1KHVA 4LJMA 4M8LA 4Y00A 1LKZA 1JLEB 3KG4A 3S6EA 1RT1A 1J5OB 5M2RA 1U1RA 4C8KA 3TOQA 1MU2B 3J81Y 2VZ9A 1VC0A 4C8MA 1TKZA 3GIMA 3MM7A 3K5NA 2R7QA 1MSWD 5LSLA 3V4MA 1L3KA 1YVFA 2CJAA 2C2DA 2KHCA 5C25B 3V81B 2E1CA 4H4MA 3AA8A 3E01B 3KYLA 3MDFA 3PX4A 4JBCA 1IKWA 1AFJA 2YX7A 4ES3A 3SFGA 3MMAA 2YNIB 4BWJA 1N4LA 2ZDOA 3UDCA 1FNOA 2JVOA 4DQQA 2HHWA 5I3PA 3S7RA 4Y2MA 3OTOF 4O4RA 3KLVA 1NKBA 1VK3A 4OLOA 3ISND 3GG1A 4TYBA 3EGWB 1G1XA 5IS2A 2P9CA 2IMWP 2M3DA 2ROEA 1VQ4S 5T7LA 3W2WA 3U27A 1OPZA 2UXCF 2FVRA 1EP4B 4BHQA 1NU4A 2HVZA 2A3JA 1JJ2R 2WSCC 4MIWA 4LIRA 4O3SA 1HBMB 4P6QA 4CH7A 1LW0A 4K4ZA 2MGZB 4N5SA 5EX3A 4I7FB 3G6YA 1C1CB 1U49A 3G6VA 1DQ9A 4OI6A 2CKWA 2OPRA 3LWMA 1DURA 4KFBB 2KB2A 3VAJA 5D77A 5KFZA 3CB4A 2ZOGA 2OH2A 3MEDB 4DWIA 5LSOA 4QQBA 2L3MA 3H25A 3M9NB 5D4OA 3C6TA 4HTIA 4RBTA 5C42A 5KFOA 2ZD1A 3DN9A 5IZHA 3HKZD 3KLIA 2KFYA 2VFRA 1FKOA 4KV8B 2ZBCA 1RT5B 1H2UX 4M5DA 1VQNS 3DXSX 1TAQA 3J7YI 3AH6A 2M0GB 3JSRA 3M05A 3HM9A 1Q82T 3NP5A 1G6BA 2GMLA 5I42A 1YWXA 4ZA1A 1UVKA 1K8AT 3BF4A 2CJKA 2NQPA 4X62F 2DD8S 3V6DB 3HX9A 2APOA 4LQ9A 5CQGA 4U7UK 3CJKB 1SKWA 2J6SA 4RBUA 5E7OB 2LA4A 2DBBA 3G4SS 3CC2S 1SL1A 4LF4F 2RE1A 1GH8A 4XK8C 2PMZD 2IA6A 1S0MA 2Q6BA 4NLGA 2N3LA 3IXQA 3WC2A 2FJAB 2EVZA 5B0FA 2PO4A 3GZ7A 2M88A 4OX9F 1C1BB 1KLMB 1WF0A 1N32F 1S1VA 2ZH2A 2VG6B 2CQ2A 2VKRA 3GV8B 1K1QA 5MAOA 3IWNC 2DGSA 1TL1B 1RTDB 4NZ7A 2CQDA 2JFDA 2QT7A 3G6ES 4EZ9A 2ZJPQ 5J2MA 1M1KT 3DDNA 4WKRA 3PHEA 4FN5A 1U1KA 3H20A 5DG9A 4JUZA 1PILA 1IKXB 2RSQA 4E0DA 2UUTA 2J9DA 3V4IA 2C2EA 2OPPA 3RR8A 2HNZB 2KXFA 4EWTA 3I31A 2HYIB 1XNQF 4UQTA 4BBYA 1O5JA 2OFGX 2DR5A 3FEZA 3DOMA 5DQHA 4RUAA 1ZZNA 1VC6A 1JWWA 2BQUA 2OD4A 1Q8BA 1WG5A 2BRLA 1S9EB 3FFIB 2GNKA 1WI6A 4MKBA 5F0WA 4JI0F 3THVA 4RWWA 2GMJA 3DI6B 1VQOS 2HQ3A 2GQ2A 2K7JA 2KI2A 2M7SA 3L7OA 4FVCA 2IC3A 2KT3A 3CD0A 2R2RA 3QJJA 4EO6A 4F25A