1VQPS

The structure of the transition state analogue "rap" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 22
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vqpS00
2DISA 4OZ1A 1VQMS 3NNCA 2KI2A 2EK1A 3S01A 2JVRA 1SJFA 3G6ES 2HYIB 1N88A 3NNHA 3RW6A 2MZRA 1U6FA 3EGNA 1AUDA 1N52B 1X4GA 1VQ4S 3MOJB 2NLWA 1X4DA 2DITA 2CQIA 4QPTA 1VQLS 1YIJS 2FC9A 2ZJRQ 5D77A 3BEGB 2HGMA 1UFWA 1VBYA 3NNAA 2MQQA 2J76E 2KXHA 1ZZNA 2DNMA 4W90B 4Y00A 3CCES 3MD3A 2LECA 1SJ4P 1L3KA 1B7FA 2DHXA 1A7GE 4TU9A 2DNYA 1CVJA 5DM6Q 4UY8T 2X1GA 5DDQC 2AD9A 1NO8A 1VC6A 3IRWP 1YTYA 2HGNA 5HL7Q 2MY8A 2MJUA 1M5OC 2MZJA 3P49B 1M90T 2KM8B 3ULHA 3H2UB 3CCMS 4RU2A 4WIIA 2MGZB 1VQNS 5IM0A 2M8DB 2DGWA 2RQCA 1WF0A 2ZJQQ 2AYGA 1HA1A 3P5TL 2XNRA 1NU4A 2YTCA 1M1KT 2RQ4A 1YITS 4IOAQ 4TU7A 2DO4A 4ZKAA 1H2TZ 1DBDA 4QU7A 2WBRA 3I56S 5GADU 5DM7Q 4IO9Q 3EX7B 2CQ0A 1FJ7A 2LA4A 2D9OA 2YH0A 4WFNQ 2KU7A 4Z2XA 2DGUA 2OSRA 2RS2A 2CPEA 2GHPA 3N9UC 2LEBA 1JJ4A 4OZ0A 3SXLA 2DNPA 4CH1A 1X4CA 5HO4A 3CCQS 3R1LA 1WHVA 1K73T 1X5SA 1WWHA 2RRAA 1YJWS 1IQTA 2MQMA 1P1TA 4IOCQ 2E44A 2XNQA 2DNGA 2KN4A 2DO0A 1WEYA 2YKAA 2L41A 2XB2D 2F3JA 1KOHA 1VBXA 2RUGA 2RS8A 2J0SD 3UD3P 4F25A 5JVHQ 3Q2TC 4PRFA 2RVJA 1DRZA 2DH8A 1FJCA 2E5IA 3HI9A 5CXTA 2LA6A 1U6BA 3BO3A 2DIVA 2DHGA 1NJIT 2AYEA 2E5JA 4LJMA 1U1NA 2KRRA 2CPJA 2DNZA 1WF2A 1YJNS 2QEXS 3CMES 2KG1A 1D8ZA 2LEAA 2JWNA 1M5VC 2XS2A 1VBZA 3CTRA 2EVZA 2ZJPQ 2DH9A 2CQHA 3MI7X 4CIOA 3JB9k 1YJ9S 3H2VE 2GO9A 5D78A 2LKZA 2PE8A 5DDPC 2O3DA 3VAKA 2LQ5A 1WELA 3MUTP 5GAHU 3DXBA 2BOPA 1N8RT 2NZ4A 2J0QD 2YH1A 4YB1P 1YWXA 3SDEA 4UQTA 3UWTA 3VAHA 2KT5A 4FXWA 4TU8A 2CQCA 2K3KA 3THPA 4LMZA 3CC7S 3I55S 2E5GA 1URNA 2KM8C 2KYXA 4WF9Q 4EGLA 1JJHA 5CA5A 2BZ2A 1X0FA 1PGZA 1FJEB 1OIAA 2OTJS 1HL6A 1U2FA 3R1HA 2G4BA 5ITHA 2G1DA 1VQKS 2F9DA 4YOEA 2CQ1A 2FPHX 1FXLA 3PIPQ 3CF5Q 3CD6S 2CQ2A 2RU3A 2MYFA 3G71S 2ERRA 2MSSA 2DNOA 2E5HA 3G8SA 1VQ8S 2FY1A 1O0PA 1W2BR 2DB1A 1BY9A 3P3DA 1U1QA 3J7ZT 4M5DB 1VC5A 3CCSS 2KXNB 1U1OA 1WHWA 2ADBA 2B0GA 1DZ5A 4F26A 1QVFR 1WEXA 5LJ5Y 4WKRA 3B4MA 1R8HA 2DNNA 2A3JA 2CPHA 2DGTA 1FT8A 1SJ3P 2ADCA 1KC8T 1YHQS 2MHNA 2M0GB 2RT3A 3CULA 2LXUA 2DGSA 5DDRC 2MY7A 3CUNA 4IUFA 3G8TA 2XSFA 3THTA 2V94A 1FHTA 3PIOQ 2XS5A 1U1PA 4P6QA 3U1MA 2JRSA 2DGXA 3RW7A 3BO4A 4CH0S 1WG5A 1KQSR 5LSOA 4WFBQ 3VAJA 3LPYA 4YUDA 3P6YC 3VAFA 2KG0A 1X4FA 2MKHA 3NS6A 3Q2SC 5LXYA 5IFMA 3NS5A 2KFYA 1K9MT 2MB0B 2K8GA 2DH7A 2Q79A 4V19X 3MDFA 4PR6A 2XS7A 1KOOA 1UW4A 2MKIA 1RK8A 2N3LA 3UD4P 1QM9A 2L9WA 1G2EA 2DNHA 2CPXA 2KH9A 2MQNA 2UP1A 5BJRA 1PO6A 2M7SA 1KD1T 4C7QA 1OO0B 3CCLS 3UCZP 3TYTA 1Q81T 1SJRA 4TLQA 2FHOB 1WF1A 2CPIA 1F9FA 1XN9A 3S6EA 3SMZA 2DNRA 1A9NB 1ZZFA 5GMKa 1U1RA 1WEZA 2DIUA 4QQBA 1WG4A 1S72S 1SXLA 1X5PA 2M2BA 3SDEB 3ZZYA 3CPWR 1VQ9S 3MUVP 5FJ4A 2MQPA 1RKJA 2CQDA 3VAIA 2DK2A 1VQ6S 1X4HA 1U1LA 1X4EA 4C0OC 2DGOA 2CPFA 3ZZZA 2JX2A 4F02A 3MUMP 2X1AA 1P27B 3VAGA 3FEXB 4FXVA 1HD0A 3G9CA 2CPZA 4LIRA 2FC8A 2CQGA 1YI2S 2DNLA 2OSQA 2U2FA 1Q86T 3MXHP 3CCUS 2CPYA 1WI6A 3US5A 1X5TA 2DGVA 2MPUA 3U1LA 2X1BA 2DGQA 2U1AA 4Y0FA 1OPIA 2OJ3A 1SJQA 2MZTA 3CXCR 2F9JA 2MQOA 2I2YA 1VQOS 1M5KC 4QU6A 2M8HA 1X4AA 2L08A 3CMAS 3TO8A 2DHSA 1H6KX 1WHXA 2M4MA 4W92B 2X1FA 3S7RA 3EGZA 1X5OA 3HHNB 2YWKA 1M5PC 1Q82T 1VC0A 3OW2R 5LXRA 2QFJA 2HVZA 5EN1A 3G4SS 3UCGA 1WI8A 5DDOC 2KXFA 2CQ3A 2MKJA 2SXLA 2N82B 2OIHA 2HZCA 2M70A 3CC4S 2J8AA 2MZQA 2MXYA 4ED5A 1VQ7S 5DETA 1WHYA 2MKKA 4CQ1A 5GAGU 1UP1A 3TP2A 2MJNA 1Q7YT 1VQ5S 2D3OR 2MGZA 2QA4S 3VAMA 3G96A 3VALA 5GAEU 4A8XA 5H1SV 1U1KA 4PKDB 2MZ1A 2DNKA 2KVIA 3D2WA 1QVGR 2CQ4A 1S79A 2RNEA 2KHCA 3B4DA 1JJ2R 1U1MA 5IM0B 2LYVA 2MKCA 2N3OA 5LJ3Y 4C4WA 1OWXA 2KRBA 1VQPS 2PEHA 2LMIA 2LXIA 1D9AA 3L3CA 4WFAQ 2D9PA 3NMRA 4BS2A 3LQVA 2N7CA 1HD1A 1FNXH 2DHAA 2EK6A 2MSTA 4ERDA 3VF0B 2DNQA 2RRBA 2CJKA 4WCEQ 3CC2S 1N54B 2MZSA 3BO2A 2OTLS 2MMYA 1H2UX 1UAWA 1R8PA 3UE2A 1WTBA 1ZH5A 2CQBA 4U67Q 3K0JA 2M88A 2M52A 1WG1A 2G0CA 2CQPA 3V4MA 3CCJS 2CPDA 3R27A 2LCWA 2I38A 1DHMA 1X4BA 3BS9A 3UCUP 2M9KA 4J5OA 1FO1A 3CCVS 5IQQA 1JMTA 2VOPA 5LSLA 3FEYB 3MD1A 2AYMA 5CYJA 5MLCV 3IWNC 5JVGQ 3MURP 2MQLA 1H2VZ 2JVOA 2VONA 2VOOA 2HGLA 5GVQA 1K8AT 3DLLQ 2VODA 3J7YU 2AYBA 3S8SA 3CCRS 2MKSA
chains in the Genus database with same CATH superfamily
4H4MB 3KG4A 3TA1A 3AD8C 2ACYA 1H73A 2BKNA 2DRBA 2YWEA 3W8PA 3QGGA 1MU2B 4LVNP 2HYIB 4ELTA 5KFDA 2MZRA 3RW6A 2DYAA 1L5UA 3BKFA 4WYWA 4YR0A 2JZ5A 4C8ZA 2JSXA 2ZE2A 4O4GB 4DHVA 1VI7A 2W4DA 4CCHA 5L1LA 1YIJS 1OYEA 3M6XA 3IBCB 1S6OA 4CLLA 2ZJRQ 1MWYA 3H5UA 3QPIA 1PJ5A 3G87A 2KB2A 1TU0B 1RT6A 2CZ4A 1VRTA 2D3ZA 1YRXA 4O23A 2J76E 4CYUA 4D3HA 2MQQA 1XMQF 1VRTB 2HHQA 2KFNA 2CKWA 3CCES 2HNDB 2VQEF 2BABA 3EM1A 4C97A 2P2CB 1FFGB 2DHXA 1A7GE 3FJ2A 2LDYA 3PX0A 1D8YA 4DL2A 1B7FA 3VQTA 4JV5F 2QRRA 3EGVA 2C2KB 1FKOB 4C11B 1EIYB 4NWBA 3G82A 3VGUA 4C11A 2QV6A 1BGXT 3T9ZA 3TWZA 4OL8A 4UOHA 5L8RC 1GXTA 3POTB 4BLGA 1YZ6A 3I87A 1QE1A 1MMNA 2MY8A 2OP5A 5C42B 3M9NB 2CAJA 2UUAJ 2OAUA 2V68A 3HF5A 4DX7A 4JI1F 1UPPA 3W5XA 3LWMA 3D7SB 3FCVA 1M90T 3CJ4A 1TL7A 2QIFA 5A6WA 3ZFVA 2KM8B 1JXLA 3EXCX 4DU7A 5AE2A 2JEFA 4ZLPA 4ANEA 4ED4A 2DGWA 2M8DB 2HNYA 1WF0A 3R5GA 1SJ1A 1PILA 4Q8EA 2ZJQQ 1T02A 2JEIA 3D1OA 1VR6A 4RW8B 4CDIA 2E5LF 4DSKA 2XNRA 4ED3A 5C7PA 4H4OA 3B78A 3G86A 3F41A 1RTDB 1VIXA 2OEKA 2Q6BA 4K2JA 1SC6A 4I2PA 4ANCA 5BR8F 3PW2A 2LQ8A 3IXQA 1EKRA 2P9EA 5DM7Q 1SKRA 4IO9Q 1BE4A 5E7OB 5G4DA 1FJ7A 2LA4A 3I6PA 2CIMA 3KLFA 2D3O1 3JSRA 1NMEB 3M32A 2Y3YA 1P9YA 9RUBA 4U7UD 2CPEA 2GHPA 1RTZA 1AXQA 2B5JB 2BX6A 3MGJA 3PACA 2LEBA 1RQ0A 3DDKA 2C2ZB 2XI2A 4ECSA 1FX4A 4KSEB 1IR1A 5IT0A 4B3MF 1PC5A 4OI2A 3I82A 3DOLA 3QO9A 1NKEA 3D3BJ 3GSIA 4KGVB 1PG5B 1WHVA 2EG1A 3W2VB 4U9RA 3FSIA 3Q24A 3TR5A 2RRAA 1Y7PA 1HWIA 4DR6J 2MQMA 4XAKA 2XC9A 1YJRA 1P1TA 2LQJA 4RR5A 4HKQA 2IRUA 3AJDA 3I0SA 4MAKA 4CM0A 2DO0A 1WEYA 4ZP8A 1EP4A 3SFUA 1TMMA 2CJBA 4HT7A 3RR8A 3SIPB 4DLEA 1S6QB 3OPKA 2V9KA 3LALA 3GTYX 2RS8A 1O5JA 1RHRB 3MPWA 3NAHA 4J9PA 3UD3P 3MMBA 2QA4G 1PJ7A 2RVJA 5F0WA 1SKUB 1JLGB 1LK5A 3NP5A 2BQUA 4IRDA 1RTIB 2ZWPA 2HRTA 1CJTA 4N47A 9ATCB 3HI9A 2OHDA 2OFGX 2DR9A 2K3IA 1XMOJ 5CXTA 2UUBJ 1XC9A 4LFCJ 1N6QB 1SIWB 4CZCA 1ITPA 1KP6A 2E5JA 2C2OB 5M2UA 4F4AA 4Y2CA 2NR0A 4LJMA 4ZIWA 5J2MA 1UFLA 3PW7A 1QTMA 2KRRA 2R7UA 3CMES 2YKOA 4YFUA 5E2QA 1D8ZA 2W25A 3SI8A 1HNZF 5J1EA 4X2BA 2XS2A 3BQ2A 3MM5B 3CTRA 3ETOA 2H3EB 3NGUA 2ZJPQ 6FD1A 2GJ2A 1AFJA 4OV1A 2DH9A 2VDHA 2UV8G 1NXIA 3OR1A 4Q2MA 1RWOB 4NZ7A 3WDOA 1X9SA 4CIOA 3JB9k 1NK0A 1SUQB 3H2VE 4ZDNA 2HK2A 5D78A 2B51A 4OZNA 1BQNB 2A6OA 2W7AA 1WKKA 1S1WA 1EARA 1FXRA 4A8WA 4DBQA 2RKIA 4LFAF 1IJEB 4RW7A 2P6TA 2OLWA 1WELA 1XNQF 2GJIA 1LWCB 1CC8A 2W2PP 3DXBA 3FGVA 5GAHU 1RBOB 2EBEA 3LUYA 3RRHA 4DWIA 1HKAA 3GWCA 1NKBA 4CNYA 4YB1P 2ZHBA 1RT2A 5H9FK 2ZNZA 1X8DA 4P74A 1Q53A 1RHKB 3TUJC 3MFHA 2ZM6J 1IBKF 4F2SA 5E3QA 1RI7A 2ASYA 1WOPA 4TU8A 3PR4A 4K4UA 4YR2A 2K3KA 2XSJA 3VCDA 3MM6B 4MK8A 4V19X 3VZHA 1NJWA 1Q5VA 3GONA 3AB2B 5DG9A 3K5NA 2BEFA 5IT9U 2OPQB 2KYXA 1VCTA 4X65F 2FHMA 4MTPA 1YBAA 4LFBJ 1ZM9A 3QQCD 3E51A 4CTAB 5CA5A 2VV5A 2ZWOA 4FZVA 3SQOP 3GV8B 3TEHB 4ZJQA 5ETVA 4C8NA 1X0FA 4ECRA 3KKFA 1BQMA 3DRRB 3MMBB 2RF2A 5A2QU 2OTJS 2IY5B 4BS2A 4TY9A 2OEJA 4N8OA 2I6WA 3CJ2A 4A46A 1F5AA 4DPUA 1N32F 3NEKA 2D7SA 3ZO7A 1S99A 3PYFA 4FF2A 2CQ1A 1XNRF 3CF5Q 3OTDA 4K4SA 1IKWA 4OLPA 4IQMA 2PFFB 3MWBA 1Q4RA 3NY0A 3G8SA 1U0HA 5E5NA 3NGTA 1F1BB 4H54A 5HBMA 2Y1JA 4PWWA 5IC4B 3MMAA 2FY1A 1O0PA 2C3PA 2QMXA 1HR0F 3QATA 4ZS6A 3CJTA 3BZQA 1YJVA 4C8OA 2B8QA 1BY9A 2XLKA 1U2RA 2KXNB 2KTQA 4QWEA 4DV4J 4IYQA 1WHWA 1PYOB 2B0GA 4RBTA 2PMHA 3BQ1A 2AMCB 2NYIA 5EX0A 2W9CB 2XLIA 1L3VA 1B0PA 4J90A 1FCAA 2RAQA 4N8NA 4BC7A 5CD4H 4CYUB 3OFHA 3BGRB 1HLWA 3OHAA 4OI0A 4AD6A 1UWAA 2V69A 3MAHA 3DLHA 1WEXA 4HDHA 1KVKA 5A8WB 1T9TA 3O2IA 1WC5A 5ETOA 2DD8S 2DNNA 4DSJA 3CJ5A 1IKXB 1FT8A 2QSWA 3FBEA 4OYAA 2I9SA 1HR0J 2M0GB 2RT3A 2H4YB 5GAGI 2IMOA 3DRSB 5HVFA 5D3GA 1N5VA 1GK8A 3JYTA 4X64J 1KRPA 2QMWA 1PYTA 3QGIA 2WONB 5K14B 2XS5A 4UOGA 4YN3B 3CIZA 2JRSA 1WOSA 2DGXA 4I4BA 4PPDA 3BO4A 1SC4B 3PNIA 1D0EA 4RW4A 4HI2A 4JI4J 3H20A 1FRIA 2AJ1A 2GVDB 1FD2A 2LU2A 4JI3F 1YBUA 2BJDA 3Q8PB 4LRBA 1FKPB 3JXOA 1N34J 2J9CA 2FLOA 4WF9Q 4NOHA 1X4FA 3BSAA 2NUHA 1F5CA 1OSCA 1SC3B 5C25B 4M5DA 1WKLA 4AFFA 3EZOA 1NSAA 4CLYA 1T03B 1HBUB 1UJ5A 3QT8A 4OI4A 3IS9A 2FGCA 1LK7A 1AROP 5F3ZA 1RWPB 1CJKA 2EEYA 4RBVA 4UT4A 3C19A 4P72A 1U0HB 3NOCA 1JX4A 1S1VA 3GR0A 4BWMA 3PXGa 1KOOA 2YKMA 1UW4A 5I42B 2DRDA 4EO6A 3PHTA 4RNHA 1NK8A 3GIMA 4B3RJ 3OFEA 3D54A 3HK2A 3E01A 4JI0F 2IVYA 3J80U 1G2EA 2YQ3A 2NZCA 2MZ1A 2MQNA 2UP1A 2GIFA 1RT4A 2MQ8A 2YKNB 3D4JA 4ENOA 5C5JA 1SKSA 4QYZK 1TL1B 2ZFHA 3J81j 1DAXA 4C7QA 2Z2MA 8RUCA 2ZHAA 4FF3A 3M6UA 4F4KA 2B3TB 3R5CA 4WTOB 1Q81T 2ABYA 3FK4A 2VU5A 4WP8A 3TARA 2UXDJ 4B9VA 2PFDA 4B3TJ 5KFSA 4NEZA 2QFIA 1Y10A 2FHOB 1UW9A 2AV5A 2HNDA 4ZMMA 5KFKA 2BR0A 2I5JA 1IXKA 3SMZA 3BYRA 1ZYQA 2UXBF 5GMKa 3D6MB 2BQ3A 1QY7A 1WEZA 1LW0A 4LREA 4QQBA 4DR1J 3PV8A 2J6TA 1WG4A 4QOTA 2UUCF 2KKHA 1JLQB 1RTHB 2HK3A 3MCSA 1X5PA 1NSQA 3MAAA 1RT7A 3ZZYA 2AJQA 1IWGA 2VQFJ 3CB4A 4LSZB 4K5RA 1T95A 2B6AA 2XM3A 1VQ9S 4Q0BB 2MDAA 3DLGB 4DR3F 1L3UA 4I56A 4G1IA 4EZ9A 4P2XA 2DK2A 2OELA 1RAAB 1KDNA 4HI1A 1TKTA 4DX5A 2I1RA 1Y00A 2BJ7A 4OI1A 1NJXA 3H4BA 4DSFA 3MUMP 3AHPA 2X1AA 4UOFA 1RAFB 1CJVB 1P27B 2GNKA 2QYCA 4USWA 2YKNA 5CYMB 4D3GA 4NCGB 2FHJA 4P2MA 4DX6A 3PM9A 4PWDA 1K1SA 1Q78A 1RE1B 5E0OA 4A48A 4USKA 3W60A 3V6HA 3OTCA 2DNLA 1G1XA 4DN0A 5KFHA 5I42A 2AJFE 3BM7A 4QBUA 2DGVA 2IAJA 1XNRJ 2RILA 3NXZA 1JKHB 3JTNA 5D0RA 2IAJB 3W64A 1VRUA 2U1AA 3GZ7A 2H65B 3QMQA 1QUVA 4FYYB 3UDLA 4AXIA 4Y0FA 1F5BA 2E1PA 1J2VA 1TUVA 1VHFA 1HNIB 4URGA 1IBCB 2R8JA 5D0GA 3D5MA 3NGSA 4TQRA 2CXEA 3BDEA 2PA3A 3CXCR 2MQOA 4IG0B 2I2YA 1M5KC 4ZOSA 3SQGB 2F4FA 1IKXA 3GG0A 4IG0A 3W62A 5AJ3J 5J1NA 4QU6A 1N33J 3T1AA 1H6KX 3PR5B 3W5YA 4OZJA 1TR0A 1HHTP 3QSYB 4PUOB 2X1FA 1SV5A 2BRLA 1X5OA 1DTQB 1CQMA 1HQEB 4OLOA 4TXSA 3QZ7A 2PI4A 3PEJA 3Q22A 2HFVA 1FEEA 4GVBB 1OQ3A 2MTLA 4A8YA 3QFWA 3MR2A 1S6QA 4J9KA 3OW2R 3ZZOA 2HVZA 2QFJA 3CDUA 1RTDA 4ZVSB 4NCGA 3TAMA 1VS3A 5I3UB 2D41A 1CSJA 1X0PA 4AQYJ 4A8FA 5A0YB 5KFPA 1L3SA 4MH8A 1S0VA 1W25A 2QZ8A 2MKJA 2BE2B 4DQRA 4PXCA 2OIHA 5KT4A 1TL3A 1SL0A 2HHSA 3TZZA 1C0UA 1FESA 1S48A 3CJSA 4L75A 3DOKA 2H54B 4GMKA 3T3FA 4RUCA 2R8KA 2J8AA 3D6FB 4KH1B 3KLHB 4FYDA 2A18A 2J7KA 2C2RA 1U4BA 5ETSA 3I4PA 3L7UA 4ED5A 3V6KA 1EQ0A 4ZVPB 1Q8BA 1PAUB 3IG1A 3BJYA 3LANA 4ED0A 2J7UA 2BANA 5KFQA 2MKKA 1UP1A 1U09A 4KE5A 1B64A 4W4MA 4DS5A 2VL1A 3PFEA 1IKVA 3M2UB 1Q7YT 1FTRA 3VAMA 3CDBA 3QJJA 3G96A 2ZBCA 2QL5B 1XQIA 3POTA 2YX1A 3EZUA 1A6LA 3ILJA 3PFOA 5H1SV 2W8LA 4DFMA 1U1KA 2UVRA 1S0MA 2DXEA 2JDJA 4TYAA 2ZDPA 1WC0A 3Q89A 2XWYA 3TVKA 3H59A 3RAQA 1S1WB 4MIWA 5K8NA 1U1MA 2UUBF 3PZPA 3Q0AA 3LF0A 1LW0B 4UF4A 4OYBA 2LYVA 2B4PA 3M6WA 3U02A 5LJ3Y 3QNWB 2IJRA 2O1PA 1FRKA 3LP0A 4C4WA 1OWXA 2OI2A 2YQ1A 5LSRA 3Q8SB 2HPUA 1N5TA 1Y0HA 1H7WA 1U26A 5J2NB 3V2UC 2CJXB 4CLZA 1UZHA 2BUNA 4DQIA 2YX7A 4X4RA 2G1HA 3VVTA 1GFWB 1V5IB 2IM3A 2IDEA 4M5MA 2LQ9A 4NLDA 3ZTSA 4C0BA 2XSJB 2ZUGA 2VIHA 1U02A 2HHWA 3GCXP 3GYGA 2I8EA 4LRAA 1VLYA 4PAAA 1K0TA 4K8RA 1AZSB 1HMVB 2AWZA 1UWBA 2DHAA 2MSTA 2Z4PA 4RPFA 3NCRA 4DL4A 3QGHA 1KHWA 3LA0A 3KK1B 4DFJA 3TANA 1N5YA 1KR4A 4LF5F 3D68A 3Q86A 3T19A 3BO2A 4I6WA 3SCIE 1N6QA 4M5IA 1M5HA 2MMYA 1H2UX 2XTJP 3HFVA 5F8IA 3UE2A 2UXDF 5BYQA 1WTBA 4NLGA 1ZH5A 1D3WA 1CPZA 4DV6F 2WCXA 3KOAA 1E6VA 4UUWA 3BBCA 1RWMB 1S6PB 3V81B 2K1RB 1WG1A 3V4MA 2CQPA 1BMQB 4AQYF 1D09B 1MWZA 1HNWF 3IR5B 5ETKA 2HRYA 3R27A 1N33F 7AT1B 1JLCB 1P9QC 1DHMA 3GU0A 4GKKJ 3S1TA 3OLBA 3TAQA 1Q5YA 5CYMA 4PEOA 4LF4J 3I0SB 1SJ4P 1N32J 2QO3A 2CNLB 1JMTA 1GXLA 5IQQA 1T9UA 2IA6A 4ID8A 2YWGA 5CYJA 5MLCV 3W61A 3PO4A 6AT1B 3UNYA 2MQLA 1H2VZ 1LWFA 1S4FA 3CD0A 3CDWA 4N5SA 4ZPBA 1KHVA 2QJ3A 2Z57B 2VF3A 1C2PA 2R7VA 2YNIB 2AEFA 3WZ0A 4L6V3 1F6TA 2H4WB 3UVJA 2VODA 2HWIA 1FRJA 2AYBA 3UI3A 4ZPAA 1U24A 1UL3A 5LOQA 1B7YB 4JI4F 3CSKA 2CNNB 2MKSA 4MFBB 4URQU 2KO1A 4ZP9A 5AE1A 5IFMA 2W2NP 3F56A 1TVRA 4A8QA 2Q6CA 3HP6A 1VQMS 1I3OB 4KHPJ 2JLEA 2EK1A 3AB4B 3G6ES 1UVMA 1N88A 1JK9B 3DLLQ 4Y2IA 4JBCA 2VPWB 2QT7A 1AUDA 4G1QB 2ZZNA 1NHVA 1UVNA 2E1RA 3MOJB 1K44A 1P8GA 4QPTA 4P73A 4QWAA 2PIIA 4J7CA 2FC9A 1S1UA 4DJBA 1B99A 2V8PA 3AH6A 4F4XA 3IA0A 4I7FA 4HH1A 3HHEA 1RGVA 2AEMA 3BEGB 2HGMA 2UXBJ 3EICA 4I2PB 2D1CA 1VBYA 4ZIVA 3DLEB 4YP3A 2DNMA 4W90B 4Y00A 3NBPA 1HBNA 4KC5A 1YVFA 3AFGA 5B0AA 4J9LA 3SSRA 3FRZA 1WC6A 3BGOP 3M1VB 5B0FA 4CLPA 1JJCB 2C2EA 1OJ4A 2CFXA 2FLNA 2HHTA 3M6VA 2B4UA 2XZWA 5HLFB 1CJUB 3M30B 1HQUA 3CJ3A 1KEKA 4ILMA 3IR7B 1FI4A 1TAQA 3C16B 3GFZA 3NKYA 4UZCA 4C3MA 3C16A 2HGNA 1U2CA 2ZBIA 5HL7Q 2UUTA 1U8WA 2QSFA 1S9GA 2MJUA 2Z58B 2VPZB 1M5OC 3FFIB 4LRCA 4N56A 4B9UA 2ZH3A 2V50A 5JXSA 1HWUA 1RT1B 1Y5NB 3KLEA 5J2PB 3CCMS 3TI0A 1VQNS 2R8IA 1S76D 2GCFA 4PXBA 4AL7A 1I51B 3M8YA 3OHBA 4K4YA 2AYGA 3UVJB 1HA1A 3HJVA 5AE3A 1NK9A 3DC2A 4OJGA 3VHQA 1R0AA 2RQ4A 4U8YA 4IOAQ 4TU7A 1X9MA 4KPCA 3IRXB 5HSPA 1J5EF 2DO4A 5AT1B 3DM2A 4GKKF 3IP0A 3QJPA 2PGCA 4DR5J 1DBDA 1NHKL 3RG6A 1IR0A 1X7VA 1RXOB 1ZTTA 1C4AA 1C0UB 4JI3J 2HHPA 2FZKB 4K5SA 3I9ZA 2XBPA 4PYDA 3GIJA 1HNXF 3EX7B 1AB8A 1HW8A 3Q8QB 2D9OA 2V4QA 3MM7A 4P7VA 1G4CA 4EWTA 5KG7A 2DGUA 2HMIB 2OSRA 4DV3J 2P8IA 1NK7A 1J5OA 4CLFA 1JJ4A 2OPPA 2JEJA 3NMAA 1C1BA 2RHQB 5ADZA 4TVAB 3MAQA 4WU2A 3SXLA 2CRLA 2C3OA 4ALZA 2FDNA 4ED1A 3R2CJ 1NUEA 4KGKA 2Q66A 4K2XA 3E3XA 3L7PA 4ZCLA 1TZ0A 2B7CB 1EKSA 1X5SA 2K7KA 1HPZB 3SCJE 3GILA 4IOCQ 3RB0A 2KZZA 1WD6A 2IMWP 2L41A 2OFHX 4GKJJ 4JYAJ 2Z30B 2XB2D 4IO1A 2F3JA 4A8SA 1Z2ZA 1NNDA 1NLKL 4MYTA 1VBXA 1PSDA 2BXJA 1VRUB 2W2OP 4DQQA 1KQKA 3UPFA 2Y1IA 3MEGA 4YB5A 5IT9Y 1R43A 1UVKA 2NCKL 1D1UA 2R7XA 1S7HA 2HQ3A 1B0VA 3DHXA 2HIYA 2DH8A 3LH2S 3QSIA 3RUBL 4F7VA 4DV2J 4F4YA 5LL6d 5KFTA 2E5IA 4DSEA 4KRWA 2F8MA 1KFSA 2PSZA 4JB8B 3MM8A 2ZD1A 2VICA 3BO3A 3CEDA 1NJYA 1U6BA 4Q0BA 3GPAA 4JV1A 3KDNA 4Z37A 3HVTB 1FDDA 4M1KA 4IR9A 3GMGA 1U1NA 4R8UA 2PEBA 4B3OB 1X31C 2CPJA 4KBIA 2ATCB 1WF2A 2WTFA 5HP1B 1YJNS 4Y28C 4USVA 4OX8A 2AW0A 1RISA 3UD5A 4UY85 2QL9B 2CYYA 3FBFA 2C2DA 2F4VJ 2VG6B 4C3KA 2V2VA 4JV5J 1WJ9A 1S97A 4FNHA 3W8GA 1VBZA 2K06A 3W1YC 2AX0A 3RYLA 1ZA2B 1X9WA 2NUUG 1Q8LA 3J81U 1RT3A 4QZVB 5LT5A 1HWJA 3I0RA 2GO9A 3MMCA 4HHHA 1LKZA 1WORA 2FTRA 4TN2A 3W66A 3KTQA 3MMCB 1CQNA 1S6PA 2E7VA 2BE7D 2VB6A 2XZTB 3OL7A 2J9DE 2R7SA 1GH8A 2VBYA 3OVSA 4M63A 4DG1A 4GC7A 4ECXA 3KLIA 4X65J 2GMJA 3CE8A 2BOPA 4QW9A 2Y8WA 2NZ4A 2YH1A 3HJFA 1QAYA 2DRAA 1NSKL 4B3SJ 3HSJA 1WKJA 2R2SA 4DV1F 4F4WA 1I94F 3HFKA 3QIDA 1PKUA 2A2DA 2LXFA 4RW6B 3SDEA 4ZLNA 1KVIA 5IZHA 4FS2A 1YX2A 2ZHOA 2KT5A 4USTA 1G3OA 3AD9C 2GC8A 3M1VA 2O5DA 4YEAA 4X64F 3AY0A 4LF8J 3M8QA 3I55S 4DL6A 2GFFA 3ET6A 2VJVA 1NH8A 2F63A 1UVIA 2WVDA 3VZIA 4U7CA 2M3DA 2WOMA 2XCAA 3PX4A 1KS2A 2NSBA 2IDLA 3FQKA 1NAQA 1JJHA 1QE1B 1KLMA 2H5EA 2IC3A 1C1CB 3EVMA 4EUVA 4GVLA 4JI5J 2BZ2A 1HNZJ 3HHKA 5CCMA 3NS7B 5F41A 3BPSP 1RU2A 4V19J 1LWEA 3MEGB 3N6NA 1PGZA 1TL3B 4LF2A 2W24A 4FKYA 4DMZA 1NB7A 1O51A 3AOBA 4ICLB 4YY3F 1QDUB 3R1HA 2G4BA 3NAIA 5E3AA 1N56A 2L3MA 2ILZA 1UPMB 1GMWA 1RT2B 2FPHX 3FMBA 3H8YA 3KLHA 2J6UA 2Y0SD 4QJVA 2MYFA 3G71S 2V9WA 3FBBA 4OI6A 2DNOA 2KDOA 4Z7CA 2AGPA 2GVZB 4CT8A 2HNZA 2XGPA 2GVDA 3FNNA 5C2GA 5L46A 3H4DA 1HNVB 1WACA 2AIRB 3HSDA 2UUWA 1KQFB 2CDRB 3IFEA 5HP1A 2HEKA 1W2BR 3P96A 5FDLB 3GIKA 5L1IA 5D15A 4M95A 1YK9A 1T94A 3B82A 3I0RB 2WVFA 3MECB 4M5JA 3O6QA 4M5DB 4LSLB 4MKAA 1NSPA 3J7ZT 3QT7A 3CCSS 3BBBA 4DF4A 1SBRA 2XY7A 2ADBA 3BSOA 1U1OA 2OMLA 2W7OA 2Y9HA 1RT5B 3MCNA 2HMIA 1N5SA 4NLXA 2CJQA 4IFVA 2N7YA 4O3RA 3KK2A 3BR8A 2EKNA 3KK2B 3H90A 1Z1ZA 1J5EJ 1R8HA 2CPHA 3MM9B 4NA1A 4CO2A 1IKWB 2VHGA 3HKZD 1T3OA 4PABA 4G6VB 1R0CB 3DOMA 2F5GA 2MHNA 4ZVHA 3T5JA 2DGSA 2QG9B 5DDRC 1NK6A 2AJ0A 1Y9OA 3V6JA 3MM8B 4FS1A 2OKQA 4NLUA 2W7PA 1F3FA 3C15B 1A0OB 4QWDA 1U1PA 3ZZPA 3RW7A 4ZHRB 2ZKUA 1KQSR 1VQ6S 1VGYA 2QLFB 4DLGA 3C14B 3IM8A 3T1HF 2KG0A 4NLVA 2IRXA 4I6YA 3HO1A 2CVIA 3LPEA 2OD6A 3HHLD 3KHHA 2VOPA 3H5XA 4JP8A 1DQAA 1FNOA 1VOMA 4XPEA 3DGVA 3NS5A 4HHJA 4OIXA 1Q7LB 2KFYA 3LTOA 1S9EB 1K9MT 3IR6B 3V6DA 4FBTA 4C6AA 2R4FA 5T7LA 3JQMA 2DH7A 3ZZTA 1KONA 1MNEA 4DL0C 1LWEB 4EBEA 3M8RA 2HNZB 4JI8J 2H5JB 4FDFA 1DJ0A 2V8DA 2V4JB 2ZITA 5L9XA 3M2VB 4DR6F 2Z2YB 3P4UB 3GJQB 4YB6A 1FNMA 4YR3A 3N0VA 2VG5B 5T41A 2FZCB 3KK3B 2EPIA 2E5LJ 4IFYB 1JJ2R 2X7IA 3LAMA 3PY8A 2H1YA 3IS9B 4HLBA 1NK4A 1PO6A 2M7SA 2BANB 2OUGA 4F4ZA 2Y1RI 3CCLS 4P10A 3TYTA 2AP6A 4OZ3A 1SJRA 1TL5A 4WE1B 2DT9A 2H48B 1AYEA 1FRLA 2IYGA 3QT6A 3NGKA 2CPIA 4WE1A 4WXOA 1TQLA 3AJ2A 1ACMB 2ILYA 2BBEA 1R89A 4ZITA 2DIUA 1CJKB 1UTAA 4WJBA 5D0HA 1RTHA 1W7WA 2EW9A 2B56A 4DPOA 4P75A 2HQCA 3CPWR 2XULA 2E9RX 4KIAA 5CZVA 1SIZA 2B7BB 3MUVP 5J2PA 4B9TA 4WFXA 1S4EA 2EKYA 2ZBRA 3CDAA 1RBLA 3PEHA 3PDNA 3HFZB 4NYOA 3K57A 3CJKB 4KH0B 4XTTA 2YNHA 5DGBA 4M5KA 5HQMA 4XO0A 3G6YA 1U1LA 5ETRA 1VK3A 1FF2A 1YDLA 3RZAA 2DGOA 4H4MA 2HVDA 2JX2A 3QWPA 2E66A 4CO4A 4E2FB 5J1PA 1RADB 3V4IB 4P9SA 4K7QA 3K7RA 5BYRA 3VAGA 5I3UA 3R6LB 3RAXA 5CYQB 1FDAA 3MTJA 4CWBA 3LGMA 4PQAA 5D4OA 2DCLA 3ZNJ1 5KT7A 3MR5A 5KFWA 2R2RA 2NSCA 4NEYA 3RBDA 2CQGA 1HBNB 3Q8RB 1YI2S 1IVZA 2EI5A 4IDKB 3EGZA 1SVDA 5KTQA 5DQHA 4ZVFA 4YDDB 5B0CA 5KT5A 3DOKB 2JFKA 1X5TA 3D0GE 5GADI 5KT3A 3CCUS 1WOOA 5DZ6A 2DGQA 4KGMA 2MLZA 1SQFA 4LR8A 4M8LA 1N36F 4RUBA 3GCWP 3BN7A 1OPIA 1GQEA 2FY8A 1PC4A 3I4HX 3N5BA 5EX3A 1SJQA 1RWWB 2R7QA 4PWDB 5HN0A 2M8HA 5FLXU 3CMAS 1LV5A 2Y1LB 2DHSA 1WDDA 1EX8A 1S59A 2O66A 5D4NA 1I1GA 4CNZA 5KOWA 1FVSA 5KG1A 5IS2A 2VA2A 4LIWA 2APOA 4LQ9A 2NXEA 2RJZA 1PIEA 2LP4A 2YY3A 3M4XA 4LR7A 1REVA 3TJ9A 3VQSA 3CO0P 4FKXA 3HKWA 5A8KA 4X62J 4JUZA 3H98A 5DZ7A 1DFDA 4YDXA 5CCLA 2PN6A 4NZ6A 1M5PC 1Q1KA 2DTJA 4Y2AA 2L9DA 1RAEB 1R8AA 3D1HA 4FYWB 5LXRA 4DUZF 4Y3CA 1BD6A 2BRKA 2GQ2A 5E3RA 4J9OA 3G4SS 5EHHA 2IRYA 1SI9A 2FJDB 2VBXA 4F3QA 1GNKA 2NS1B 3IM9A 4KPYA 3H0PA 2FB0A 4ZVQB 3PKMA 2K7JA 3BB5A 1KTVA 1LFWA 2H9ZA 2YX4A 3ICLA 5KFOA 4X4OA 2KXFA 3HZGA 2CQ3A 3GIRA 5A76A 3IC1A 2CDQA 4WP3A 4EFAC 3KJVA 4X4NA 4KT0C 2HZCA 1UA0A 2QE5A 5IXUA 3GV5B 2UU9F 3PYGA 4RU9A 2VQEJ 3LAKA 4R25A 3KUEA 3NWGA 1BWEA 1OY8A 3JSYA 3TX8A 4RUAA 2FHJD 3AODA 1E6YA 4LSNB 1D9DA 5F3TA 1KN6A 3QLHA 4OYWA 2KT3A 4W92B 4X62F 4O3OA 2OPSA 5DETA 2OD4A 1DY3A 4ZP7A 2X3GA 2OPSB 4ZPWR 4LRDA 1VQSA 4IH5A 5DJBA 5FDLA 2BYCA 3SCLE 4DR3J 5HROA 1KNZA 5EWGA 4DR2F 3BGUA 5A8RB 2E9ZA 2F8HA 1VQ5S 2D3OR 3AT1B 2MGZA 2QA4S 2UUCJ 2P9GA 3ZNUA 3DLEA 3DLGA 1Q79A 3ENQA 3GFHA 3HT0A 3K8WA 4HT5A 5IOLA 4U95A 5GAEU 5F9LA 5F8LA 4DR1F 3PW4A 2BQRA 3NGRA 5B08A 3PX6A 4PPZA 1GTHA 4DCJB 2HLTA 4PKDB 4X84A 1VHIA 2KVIA 3HHLB 1MLAA 2ZH8A 5HLFA 4LF5J 2KHCA 2RNEA 5GAEI 2DPJA 1F0XA 5KFCA 2ROGA 2ZOMA 2GHWA 2VG5A 3KK3A 1IWAA 4P2FA 3CW2C 4HYKA 4WTYA 1G6BA 2XHWA 5FLXY 5HANA 1TKXB 3A1YG 3A12A 3H25A 1UEUA 1TKZA 2JC0A 1DQ8A 2KRBA 3K5OA 5HK4A 4EU0A 1TKZB 4LVOP 1NBEB 2HSEB 2W8KA 1QSYA 1GAOA 2VFSA 2LXIA 2FJVA 3W7BA 3IO1A 3L3CA 4TY8B 1CG2A 3DLKB 4DR2J 1N48A 2RUSA 4ZHRA 1NDPA 3ZXWA 3O3LA 2QN6B 2VFUA 2HS3A 4ZP6A 4C3LA 3PW5A 1EQMA 3R7NB 1XERA 4JI2F 3QRRA 4ERDA 3VF0B 1CS4A 3UR0A 3T1YF 3AA8A 3I96A 3JAMU 1MMLA 1N54B 2MZSA 3R9LA 4LF7F 3DNCA 1EB0A 1S1TB 5B0BA 4KV8A 5KFFA 2CQBA 2J5AA 2R9LA 2HBRB 4FPIA 2HFSA 2W9BA 1VLOA 3FCHA 3DU5A 2CPDA 5K14A 3J7AN 5KFNA 4F0HA 2OPPB 1S6UA 2RQMA 2HHVA 1X4BA 3BH6B 3OR1B 4FP9A 5GMEA 1ZOTA 1NDKA 4KQZA 4OYPA 1RBAA 4DF8A 1SL2A 5B0EA 4J5OA 3U27A 1FO1A 4GO7X 4YY3J 2XMVA 1UJ4A 2IBKA 1NPPA 3FEYB 4YMEA 1E6VB 8ATCB 3MD1A 5GAHI 5FD1A 1TK8A 3TW0A 1S7IA 3KHRA 3IWNC 5JVGQ 3M8PB 3MURP 2DXDA 4C8LA 3KHLA 5HQLA 1YSJA 3DYAB 5CAAA 1CLFA 1MMDA 2YNIA 2JVOA 5KG6A 5KFGA 1OY6A 1XWLA 5EWEA 1HFEL 5RUBA 2VOOA 2VDIA 1T11A 2AHOB 2ZH9A 1FA0A 1OPZA 2C3MA 5DG7A 3MF5A 2AGQA 3CCRS 3ADAC 5KFXA 4NXMF 2FD2A 1JXVA 4C2MA 2GJFA 5K8MA 1IBLJ 4WK1A 3HZEA 5ETMA 4B3RF 2LLZA 2NXNA 3CGIA 3KFWX 1HQEA 1V3ZA 4GO5X 4OZ1A 5LMUJ 1WUUA 2DJWA 2MLXA 1VQ8S 3S01A 4ED6A 1M1HA 2OPQA 2MEWA 3NNHA 2ZBQA 1TKXA 1U6FA 2KYZA 3ET6B 3NGDA 1DLOA 1EP4B 1N52B 1X4GA 4H4OB 2NLWA 1X4DA 4RLEA 2DITA 4OHXA 2FVQA 4ECUA 3A8KA 3CCZA 5G0RB 1VQLS 2V4RA 4NXNJ 2HAIA 5BYSA 2DCUB 4RL1A 1SH2A 1C1CA 1HNVA 1ZA1B 5D77A 2D69A 3ISNC 5CD4A 1ZPWX 3A3PB 2R7WA 2V34A 4NX9A 3HMJG 2ZH7A 2UXCF 2FUG9 1UFWA 4DXLA 1VDHA 3LP0B 4KHMA 5ETTA 5H9FJ 3R5AA 4KGZB 2VH7A 2CJ9A 3MD3A 1WC4A 3BGLA 2PI5A 3K8VA 4J9NA 1B0TA 3CJQA 2E1CA 2DNYA 4DR4J 2KL8A 4NRUA 4QPXA 5DM6Q 3OXFA 2X1GA 4FYXB 4NLTA 4UY8T 3FEZA 4CLTA 4PG7A 2CZ9A 1NO8A 1Y5LB 2JNJA 3EDRB 3HD2A 3L09A 2DY1A 2YKQA 3IRWP 1YTYA 2ATLA 2EC0A 5AXNA 3QLHB 3HHLA 4KTQA 2RMLA 5L1KA 2UVUA 2A1BA 4V1Ak 1Q95G 3PYDA 4I64A 3R5JB 3KLIB 4HACA 3NBPB 2MZJA 5AXLA 4TLRA 4RNNA 1WC1A 4WFZA 3ZTPA 3H2UB 1BC6A 4MIBA 1TV6B 1FX2A 2FGOA 4WIIA 5KFEA 5IM0A 2XLJA 2R2TA 4I67A 3K0JA 2NQPA 1YGYA 2RDDA 3C15A 3OTBA 1OQ6A 3QJLA 3P5TL 1PJ6A 2DY9A 4QR2A 2YTCA 1RB0A 4OQJA 1Q8IA 1YITS 4ZPVR 2BJ9A 3ZZUA 1SQGA 2EG2A 2HLUA 4ZKAA 1T9WA 1FE4A 2XMJA 4L3NA 5CABA 4BHQA 1LWCA 2YQ0A 2AU0A 2LQBA 3I56S 4JI8F 4DPYA 2ALYB 2XMUA 4A4JA 3BH7B 3CCWA 2CQ0A 3DHWC 4LT6A 3ZTQA 4UW2A 2CA9A 3V6DB 1S9FA 1RTJB 1TTHB 1FJGF 3ZZRA 2KU7A 3EPIA 5KFZA 5C2CA 3N9UC 4FXDA 2YXLA 1I94J 4OMFG 1I6JA 3KMQA 2YNFB 4HL9A 1TUWA 4Y6IA 4CH1A 4ECWA 3M9OB 1NEEA 1X4CA 3DDIA 4NA2A 1S10A 4QR1A 5JJBA 3C6TB 1EETB 1R6VA 5THWA 4ED8A 2RH3A 3CCQS 3MPUB 4I7FB 1EETA 5I3QA 1RAIB 3R1LA 3QRQA 4EZ6A 1YJWS 4TQSA 3UN3A 1IQTA 3K5MA 1HNXJ 4B3SF 5A0YA 2VFTA 3QZ8A 2E44A 3OL9A 1XR7A 2XNQA 2DNGA 2KN4A 2YKAA 3W3SA 2QMUB 2DEJA 1P1LA 1SC1B 4RWXA 1KOHA 2HS4A 3D6TB 4ZVGA 4U7UK 1JLCA 2UVWA 3MM9A 1VK8A 2YNGB 1RUSA 1TFWA 4CO1A 3WBZA 4I1TA 4QIWD 4OV6A 3WC2A 4F04B 5JVHQ 4LBPA 3J81Y 3Q2TC 4PRFA 4IFVB 3GR1A 4K59A 4AXJA 1CULA 3I31A 3W2WA 4FYVB 3DOLB 1FDNA 3QO9B 1KWMA 2C2NA 4RJVA 1HBMA 2R2UA 4F3OA 3BN4A 3D0IE 3OTOF 2HHUA 1TAUA 4N77A 2FLLA 1NJIT 2AYEA 4O3QA 2Z8QA 3RRKA 3FKBA 3OL8A 3SSQA 2DNZA 3FSXA 1FXDA 1HPZA 2B5JA 4RZRA 4LF9F 3EUNA 4RBUA 4O0NA 4DV0F 1UZDA 2LEAA 4K4VA 1DTTA 3MPYA 4QR0A 1S5ZA 2PDAA 1T8EA 1M5VC 1YLXA 5CH7B 2EVZA 4X66F 3GQCA 4EEYA 5B0GA 2WB1D 2Q1LA 4E8UA 5D4LA 4DPWA 3ITHB 2BKOA 3R8YA 4DI6A 1ZS6A 2CQHA 4ICLA 3JAMY 4ELUA 4LF8F 3R2DJ 5BR8J 3M7VA 3UDEA 4F8RA 4P71A 1RT7B 4A8OA 4YS2A 4RW8A 2LKZA 4P52A 3GB0A 4CLUA 4DV4F 4DL7A 2PE8A 4RO0A 4ZVRB 5DDPC 2O3DA 6FDRA 3FUYA 5F8HA 3VALA 1UEKA 1IBLF 1LW2A 5DG8A 5HBMB 1E6YB 3DRPB 2GVZA 5H9EJ 3SFGA 2AQ4A 1N8RT 4DV0J 3M2RA 2ZZMA 3DM2B 2WZ1A 1UMJA 1XEZA 4WKYA 1UWBB 2BACA 4UQTA 3VAHA 3EWGA 1YRUA 1JLEB 4ZPTR 4O4RA 4NCBA 2NPFA 1JLEA 4P2SA 4RX6A 4DPTA 1B70B 1NM2A 1PBUA 2WVCA 4EBDA 1BUXA 4FPRA 4LMZA 4ZN1A 1CJUA 3DU6A 3M30A 3FRYA 5K20B 4Q5VA 2E5GA 1IJFB 4A8MP 2KM8C 1T0TV 4NASA 2B9EA 3KHGA 2WBMA 3CJKA 1URNA 2O01C 3FDSA 3E01B 1WSVA 3M8ZA 3W2WB 4F2RA 1WC3A 4LF6F 3SBMA 4CH7A 4C9DA 2B43A 4DCPB 1DTQA 4QIEA 2VPXB 3IGNA 3D1QA 2HBYB 4YB7A 1FJEB 1SKWA 4ZK7M 4IKAA 1RWNB 2QL7B 4IH7A 3GV7B 5ITHA 2DR7A 3R3TA 1TP7A 3W9JA 1PAEX 3ENWA 1R0BG 2W2MP 3BGFA 3DGPB 3HVWA 4EO8A 2CQ2A 1UKUA 3MCMA 2RU3A 3PIPQ 2FVPA 1IBMJ 2G9OA 2DEIA 2CWKA 2E5HA 1GEHA 3KJQB 2HBQB 2VD3A 4AUKA 1Q16B 1VJQA 3C14A 4ECYA 1R27B 2X51A 4GVBA 4JYAF 2GO8A 1JB0C 2DPIA 4KHRA 1QAIA 1F3VA 2VFVA 1HBUA 3A4TA 4F0MA 4CLSA 1VC5A 5HAOA 1FWKA 1XMBA 2Z56B 2HQIA 3AQPA 1GTEA 2ZD1B 4LRFA 1RCOB 5M2RA 1MN9A 4QIFA 4XIUA 3M8SA 3OVAA 2ZH4A 1J5OB 1DZ5A 2QLBB 2R8GA 4AYBD 1RAOA 2HRUA 4UQGA 1QVFR 1HYSA 4CQ1A 1NZ8A 5IWAJ 2IIHA 4EBCA 2W9BB 1LXJA 5J1EB 1H7XA 1YJ7A 4X4UA 4DR4F 2GHVC 3RGIA 3CT9A 4L76A 3RJMB 5LJ5Y 3B4MA 1HARA 4HR2A 1KKHA 2BMBA 2DHHA 5CQGA 5D8HB 5HJYA 1IM4A 5AXMA 3PG9A 3HLUA 4LSLA 3KYLA 2KFZA 2IM0A 2LXUA 3N28A 2WHOA 2NYHA 1QSLA 2MY7A 5KFVA 5IV3A 3G8TA 1HHSA 3Q8UA 2BKPA 2XSFA 2VKZG 1T9YA 3P45B 4Y2MA 4L73A 2V94A 4ZCIA 2ZH5A 4DL3A 1FHTA 2IJNA 1HWLA 3BSNA 5L1JA 4P6QA 3U1MA 3TVYA 2OMOA 1U0SA 2W4PA 3A8EA 1WG5A 3ELHA 3LP2B 3OBIA 4CH0S 1REVB 3AOCA 5LSOA 2J7WA 2RDJA 3VAJA 2ZEJA 4YUDA 5HMZA 3P6YC 1U8SA 1FRMA 3T9NA 1OSDA 1RT5A 1SQEA 1YG0A 3NOGA 1T05B 1KVJA 1IUJA 1TFYA 1QUPA 4R5PA 3RBXA 3OSNA 2UV8A 3NS6A 3Q2SC 4HTIA 5LXYA 4X4QA 5F8JA 1TMJA 2HFOA 4N7TA 3H40A 4LFBF 3V81A 2MB0B 2BM1A 1HIYA 2EFQA 2Q79A 1TKTB 2GQQA 2PA8D 4DUTA 3OSPA 1NPKA 5KG0A 3OLAA 3D28A 3PJXA 4OZ2A 1RK8A 2JLFA 2N3LA 3R7SB 5EDWA 2Y0BB 2YNFA 4K4WA 3UD4P 1REGX 2L9WA 2G2ZA 2AZ1A 5AXKA 2GV1A 2YPYA 2CPXA 2F4VF 2Z0GA 4NLWA 1BWVA 4CO0A 2E7WA 5CYQA 5BJRA 2QGFB 1N34F 3K2YA 1IN0A 1BQMB 3DRRA 5HMXA 3B8HA 4ETZA 1OO0B 2F7VA 1F9HA 3CWJA 2QYGA 2AT1B 3AXMA 3UCZP 1AUSL 4XPCA 3KNAA 4WZQA 3WX8A 2FJBB 1SCJB 1DQ9A 4LBIA 3CNQP 3TRGA 3N79A 1WF1A 2HAFA 4DG1B 1F9FA 1XN9A 4B9MA 3S6EA 2HVEA 2DNRA 3UO0A 4NXMJ 1ZZFA 1EAYC 4G65A 4RW4B 3TEGA 1A9NB 1MW7A 1RA6A 4DS4A 1QAJA 3SEOA 3PHEA 3R5BA 3NLCA 3G6XA 4QIVA 4QYRA 1S72S 4KKOA 2VC0A 1SUQA 1F9EB 3THVA 4K0KJ 3J7A1 4OX9J 1W2IA 4KAIA 4M5GA 1O6XA 1BQNA 1N0UA 2M2BA 4WWSA 3OXLA 4R0EA 3QIPB 4ZVUB 3AD7C 3EYZA 1JQGA 2Q43A 2QX0A 5KG3A 4MMOA 3MM5A 4O3SA 2MQPA 3W65A 4U96A 1RKJA 1UVJA 2B4VA 2CQDA 3DYAA 1RZMA 3Q8YA 2HHHJ 1X4HA 2COLA 4ZVOB 4J37A 4WK3A 3MEDA 1X4EA 4C0OC 1Y5IB 4JI1J 2KZMA 3GG1A 4ZPDA 2W9AA 1DTTB 2FQQB 3ZZZA 3BQ0A 1B4SA 2FYXA 3TA2A 4DUYF 3FEXB 2V67A 4WYLA 4DV1J 4LF1A 4FXVA 3JYTB 2EC2A 3ITHA 5HVGA 1CEZA 2CPZA 1HBOB 2A2CA 2RSQA 2FC8A 3QAUA 4LIRA 4ER8A 2GMLA 2OSQA 1YJTA 1MN7A 1VFJA 5HI7A 4DV3F 1Q86T 4KHPF 4C8MA 3I5BA 1WI6A 3KUHA 2MPUA 2EFVA 3US5A 2R8HA 2V2KA 4KV8B 5L39A 4HTJA 4RNMA 3PRVA 4H4KA 4NLSA 1JLBB 3L4BC 4R8UB 4Q43A 3IN5A 3CJ8A 4K50A 2BJ3A 2HHHF 4PWUA 4JOUA 3N4WA 1SPBP 2MZTA 5K8PA 1RWVB 1CC7A 2F9JA 1VQOS 3RTVA 1X4AA 2L08A 4YQWA 4JI7F 4LF6J 3A13A 3TO8A 2VQFF 2IM1A 3T6JA 4ID5B 1RJJA 2A6MA 4OHVA 1VIOA 3FQLA 3WIUA 3DRXA 3HHNB 4URSA 1VYAA 4QIGA 2AGOA 3DMJB 2BW2A 2YWKA 2AZ3A 3HCXA 5F0UA 2H51B 4KY3A 5KFIA 1YQHA 1R31A 2L48A 3IAM9 4NYZA 1OMSA 5L38A 2XY5A 1VC0A 5B09A 2Z2ZA 3PO5A 3Q8VA 1G7CB 3U7JA 4Y34A 3AA9A 3TQEA 3WC0A 1VBKA 5EN1A 2NPIA 2CJAA 1CBKA 3UCGA 3J7YI 3EGWB 5BXIA 2BDPA 1JLAB 1VQYA 2O67A 1WI8A 1B3TA 5DDOC 4BWJA 3NL0A 2SXLA 2N82B 3MMAB 2VFRA 3BF4A 2AF6A 3L95X 2IJFA 4NLQA 2P9CA 2ZDOA 2GX8A 2G2YA 3IGVA 3MEDB 4TY8A 2GAGC 1X60A 3QAEA 4ZVTB 2IPOB 3DGPA 1KLNA 2UU9J 3CC4S 2J8SA 3QIPA 1I5OB 3MHYA 4PG4A 2MZQA 3GJTB 4HH0A 2DBBA 2J9EA 3RU0A 4S0MA 2CG8A 1LNQA 4ZVEA 1VQ7S 3M8QB 3OVBA 5HROB 3ILOA 3KXDA 1WHYA 2G0IA 2HZAA 2HKEA 4XDDA 2JOQA 4G1PA 5GAGU 3VGTA 3MEEA 4USHA 1R0AB 3C46A 4FF1A 2UUAF 3IWXA 5LMNF 1Z2LA 1ZM2A 3TP2A 2IC3B 2KJVA 3DKDA 2YPZA 5JUMA 4M94A 2G2OA 1ZAXA 3SDEB 3VR1A 3MR3A 3GSDA 4Q8FA 1S1TA 3QRPA 4MYUA 3D67A 4NI2A 3PRDA 2V4JA 4C8YA 2GIQA 1S1XA 1UEVA 2BV3A 2IFXA 1OYDA 5E3PA 4CLWA 2IYIA 3KJVB 1UFKA 4RWWA 1AZSA 1HMVA 1U25A 2KJWA 3HDSA 2DNKA 3BSCA 2LU1A 3GJSB 2HS0A 2CQ4A 3NCPA 4IFYA 3D2WA 2XI3A 5I3PA 2V2QA 1C0TB 1NPRA 3OR2A 3A3NB 1H72C 3NRBA 4KGXB 1XMQJ 1T03A 5I4MA 4JI2J 5IM0B 1YJUA 3TUPA 3IG1B 2MKCA 2N3OA 4E98A 3BV8A 3GYNA 3ISZA 3VGVA 2DR8A 3RRGA 4M5NA 1MU2A 2WB4A 2PEHA 4HACB 1VQPS 2LMIA 2ASDA 1N36J 1BLUA 4NXNF 2AX1A 4RW7B 1FFWB 2V8VA 3FC9A 3LW5C 2HQDA 3WX4A 5D6GA 4J9MA 2C28A 4G3IA 3AAWB 4WFAQ 4I6AA 2D9PA 1F2HA 2KT2A 2ZOGA 3T1YJ 4ZCKA 3G82B 3NMRA 3CJRA 3QBCA 1HWKA 4ZLJA 2IM2A 1XJWB 1NK5A 5EUHA 1HQUB 4MK7A 5A6PA 4LF4F 4R5PB 1FNXH 2PT0A 4TKTA 1T05A 1R3NA 2XY6A 1WTFA 1YRTA 2DNQA 2RRBA 7FDRA 3F73A 1R8BA 2P5VA 3LOUA 3CC2S 4HEA9 4C98A 4NYPA 1R8PA 1RP5A 2PMZD 3WIVA 2XYPB 3W2VA 2ZH2A 1JLFA 4FBUA 4PYAA 1L3TA 2JEGA 4MJKA 1F60B 1K1QA 2WVEA 1N0VC 2D3UA 3SZ2A 2H5IB 3TZYA 3OV7A 3HVTA 1DLOB 3M8WA 3Q83A 2LCWA 2CZVC 2I38A 4K4XA 2HQFA 3EVOA 3RBZA 2N4CA 4OZLA 4YHHF 2YKPA 2JJ4D 3AQOA 3CD7A 3EE3A 4CI0B 4F0KA 2FVCA 2L9NA 1RTIA 2M9KA 5CZXA 1S0NA 3JQKA 2XO7A 2WSCC 3I9V9 2FJXA 3OQ2A 1ULRA 4O0IA 4I68A 4R0JA 3M8PA 4PG8A 2AYMA 1MSWD 1IKYB 1RACB 3M9MB 3OXGA 4QW8A 4ID5A 4IR1A 1RHJB 2OEMA 5J2QA 1NDLA 3F0NA 4BBYA 2W01A 4RKUC 2ACMA 1VRQC 3W63A 1BQXA 2Z2LA 2B6AB 5IQ6A 5DGAA 2XMKA 3PJ9A 1U7LA 1HYSB 2HGLA 1PYSB 1GX5A 1C1BB 2K1RA 4GRSA 3MZIA 1FFSB 3GP9A 4OJ3A 2A10A 5KFMA 1HBMB 3J7YU 2ZKTA 4DOZA 3R5DA 3S8SA 4KFBB 1Y4ZB 2ROPA 3KUGA 2DISA 4DR7F 2B9YA 5A8KB 2JL9A 4JV0A 3Q23A 1S0OA 2OH2A 3NNCA 2KI2A 3JQJA 3T41A 4DFPA 3WHIA 2EWHA 1SJFA 1T9XA 2JVRA 1HQ2A 2V0NA 4QWBA 4J9RA 3BDPA 3DFEA 3LGHA 5C42A 3DCAA 3EGNA 2KVQE 3JSBA 4IOBA 4KO0A 2WSFC 1Y3JA 4I2QB 1VQ4S 3EPGA 2CQIA 4LFAJ 2GS8A 2VPYB 1RLCL 1Z4UA 3AOAA 3FZ2A 3CD5A 3TZWA 2RU9A 1HHQA 3LO3A 4OHWA 3PVXA 3EDQB 2WOMB 2HG4A 3MEKA 4ZLLA 2ALZA 3IWLA 3N6MA 5KG4A 3NNAA 2KXHA 1KLMB 1ZZNA 1K0VA 1RT6B 2ZBPA 3G6VA 2LECA 2FJWA 5J2NA 3PKYA 1L3KA 1M5SA 1GMUA 3MPVA 1BXNA 5KFAA 3A3OB 3ENAA 4TU9A 1CVJA 1F2GA 3UR3C 5DDQC 1ELOA 2AD9A 1VC6A 3RBEA 3H5YA 1FDBA 2EXUA 4MKYA 2FHKA 3JS9A 1FKOA 1NRKA 2PC6A 4I0WA 3H5SA 4L74A 3GLJA 3T1HJ 2E7XA 3TJAA 1HNWJ 4AE5A 4FVMA 4WXWA 4CTAA 1KSPA 2E9TA 2J0XA 3UDVA 2FLPA 3DRPA 3EZ5A 1FWLA 4TYBA 3P49B 4B3TF 4FNIA 3ULHA 1IR2A 4O3NA 4RU2A 1S1VB 2MGZB 3QYYA 1FK9A 4IH6A 2KHDA 2ZH1A 3CJ0A 2RQCA 1J27A 3NG8A 5HMYA 3KLGA 2B4OA 3HPOA 1FWPA 3M05A 3KLGB 1EJ7L 2HNYB 1NU4A 5F8MA 5AJ3F 1MWQA 1M1KT 3UN2A 3HT3A 1KQGB 3LGNA 3DOMB 3RAMA 5DRKA 2GZOA 1PBAA 3UDCA 3G2XA 1H2TZ 1M1GA 3O8WA 4UOCA 4QU7A 1TK0A 2WBRA 2J6SA 5FIIA 5GADU 1U45A 4DDFA 4ED7A 2LEPA 3HVRA 3DI6B 5L9NA 2YH0A 5ETLA 4WFNQ 2DVIA 2G13A 2ZNYA 1XK8A 3MOZA 1N5QA 4Z2XA 3TUZC 2W9CA 2RS2A 4UTGA 4NMLA 5M2PA 4CLKA 3HM9A 2Y8YA 1NH7A 2IHR1 1TELA 1JNRB 3KJFB 4OZ0A 3BKTA 1ZAVA 3A8IA 2X3DA 2DNPA 3V5RA 4OHYA 2GIRA 2IBOA 1RDRA 5K5MA 3HVAA 4ZJOA 3TA0A 4B17A 4DV5J 1KTQA 4X4VA 2OTLS 3EJMA 2RQKA 5HO4A 4OX9F 1AFIA 5A8WA 3TJ8A 3GE9A 1K73T 4WPAA 2BJ1A 2V8GA 4USMA 2BE2A 1SB6A 1WWHA 1UJ6A 2F40A 2HFZA 3DDNA 1HI8A 1T7PA 4N41A 4ANDA 3OTEA 3DRSA 2C22A 1IM6A 2YNGA 4Q44A 4WBFA 2CNOB 2HFUA 3FBCA 1XNQJ 2HVIA 2Q3PA 3K17A 4JI5F 4X66J 2RUGA 2J0SD 3OUYB 2CADA 2RDIA 3AXKA 5U47A 1RTJA 4LBHA 4Y65A 4F25A 4DR7J 3C6TA 1JLBA 1V3SA 1VJWA 4USJC 3TAPA 2DKOB 2DR6A 3KG1A 4FVCA 1DRZA 5HJXA 1GXUA 1FJCA 2UVVA 2V5HG 8AT1B 2CWXA 5E33A 3ILLA 2XMWA 2LA6A 1RAJA 1RWUA 3H42A 2DIVA 4IDKA 2DHGA 4ECTA 1RYRA 4NMXA 1NHUA 3O44A 1UA1A 3H2LA 4DZ6A 2C42A 3OD2A 4U8VA 2QTWA 5B0DA 3OJSA 4LFCF 2I0XA 3PJWA 2BW7A 4ECVA 1QJHA 4AL6A 4IG3A 1NKCA 2QEXS 2KG1A 3BBFA 1QD1A 2F1FA 2ZOFA 3IAS9 2DXFA 4ATNA 2JWNA 2C2MB 4J9VA 4JI0J 2RB7A 2R7OA 3P5BP 4Q2LA 2HWTA 2FJAB 3UN5A 2GQCA 1ZETA 3KMSA 3MPDA 4C48A 1W26A 1XMOF 4XK8C 1AW0A 3MI7X 1YJ9S 3CDEA 3D6HB 1H38A 4M5HA 4LQ3A 4A8KA 3UQSA 5MAOA 4DR5F 4IQXA 1D9FA 2HURA 2QC3A 3NCQA 2JLGA 3V4IA 1AA1B 4KJIA 3FMWA 2XGQA 3VAKA 4KB7A 4BDPA 2PMWA 2I5JB 2LQ5A 1XR6A 3JTOA 3HXMA 1UCNA 1H98A 2W4CA 3MUTP 4O3PA 1XTZA 1NJZA 3PYEA 1XBWA 4OX7A 3ETMA 4MIAA 2J0QD 1QAXA 2C3UA 1YWXA 5DS7A 3QT5A 4X4TA 1FXLA 3DLJA 3MAAB 3UWTA 4LR9A 1EZZB 2B9WA 2FJEB 4KYZA 1LEOA 3GYXB 5T7LB 4FXWA 4A47A 4ELVA 3W9HA 2CQCA 5J2MB 2BM0A 2VC1A 3THPA 1S12A 3CC7S 5IWAF 2OPRA 4USIA 4NLYA 1T3NA 1FKPA 2IVMA 1RABB 3QGPA 4U6PA 2NREA 4EGLA 4ED2A 1V9OA 3ZC4A 1JNZB 2VG6A 3O1LA 4WFYA 4CM2A 1H0HB 1TL1A 4OYZA 3ZZ0A 3OJUA 1OIAA 1JXEA 2HWHA 1HL6A 1U2FA 2RIJA 2YWHA 3C66A 3FCWA 3HSGA 3I5AA 5ETNA 4JI6J 4KO0B 3R7BB 2BVZA 1RT3B 1VQKS 2G1DA 2VBWA 4ZN3A 2F9DA 5DO2A 4YOEA 2FZGB 1PCAA 1RA7A 1RU1A 4DL5A 3CD6S 2ERRA 5KFRA 3OTOJ 1NDCA 2MSSA 4NRTA 2CJYB 2XYHB 3J7Z5 2ZUAA 3SV4A 4ES2A 3CO9A 4ZCMA 2CG4A 4HDGA 4HVZA 4ILLA 2J9DA 5ETPA 2WVBA 4PQUB 2EBGA 3F44A 5C24A 4DFKA 5SZTA 4HHUA 2B8PA 2DB1A 1FRHA 3DN9A 3P3DA 1FTCA 1U1QA 1DARA 2V2ZA 2R3VA 3WQPA 2JFDA 2XMAA 4LSNA 1V6HA 4F26A 4O44B 5GMDA 1SH3A 4DQPA 2EFPA 1GX6A 1VMBA 3C6UB 2VZ9A 1DURA 2WSEC 2LDIA 3NWRA 5IV4A 4WKRA 3MR7A 2E1MC 2EFGA 1GT8A 2A0FB 1S57A 2A3JA 2DGTA 3RB3A 2ADCA 1RSCA 1SJ3P 1KC8T 1WNEA 1S49A 1YHQS 3CULA 2XYGB 2C1EB 3D9BA 3I32A 1QSSA 3CMQA 2AEJA 2UXCJ 4ETXA 3CUNA 4IUFA 3A8JA 3U1NA 1APSA 2WW4A 4F3MA 3THTA 2K2PA 3M32B 1MROA 1AT1B 1JKHA 4C0HA 3PIOQ 1IKYA 4C8KA 1RAHB 2XG8A 3CIMA 3K89A 4OI3A 4EI2A 3DLBA 2XWXA 4WFBQ 4W98A 4CT9A 3KDOA 3LPYA 2XO6A 2BJEA 4B3MJ 1HI0P 1GMWD 4NCAA 3VAFA 2QLXA 3ZTRA 5KT6A 2QLWA 1VISA 4EYHB 4DN9A 2OPRB 4AT1B 2C3YA 2MKHA 2VBZA 2E1AA 2POKA 2UZAA 1URRA 5F9NA 5T14A 4F36A 2CNKB 2OGUA 4J9UE 5IC6B 3KLFB 1HW9A 1R6YA 2K8GA 2ZZTA 4MK9A 4GKJF 1O8BA 4OHZA 3MDFA 1BHNA 1SH0A 4PR6A 1QVGR 4JV2A 4MT1A 2XS7A 2V8HA 2MKIA 4B9SA 3OFFA 2YKMB 3X3UA 1QM9A 3T5HA 2DNHA 2LFVA 4EMDA 2RKIB 2KH9A 5KG2A 1OY9A 3EXYA 4B9LA 2OO4A 1V3RA 2VG7A 2QLJB 1Y3KA 2WW8A 1YKWA 3MM6A 5LM7E 1KD1T 4J9QA 1RT4B 3MM7B 1RHUB 3C8YA 4G1QA 4RNFA 3K5PA 7FD1A 1T9VA 1ZBTA 3OL6A 5JMNA 5KG5A 1IBMF 5F8NA 3JSMA 1ROFA 2VKRA 1KFDA 1FERA 3ENVA 4ITSA 4TLQA 4X4SA 4ZJLA 5KT2A 4Q7AA 3JSMB 4IRCA 1LW2B 4NI2B 3M2RB 3VVUA 4ECQA 4E0DA 3IRXA 2YWWA 1IQZA 2ROEA 1U1RA 4WZMA 4DQSA 3VWSA 5HVHA 3MCOA 2N4DA 3TZXA 4YHHJ 4QWCA 3UNGC 3K5LA 2D74B 2PD1A 2V6AA 1SXLA 2XMMA 4PZVA 2VJUA 2ASJA 2JH3A 1WDTA 1GMVA 3SV3A 2YVSA 4PXEA 5KFUA 5A2QY 3P8BB 4LF7J 4RW9A 3QWUA 1TV6A 4QYZJ 5FJ4A 4N76A 3CCTA 3J80Y 4NLPA 3EMTA 5D0EA 3VAIA 3CVKA 1RYSA 2GGPB 1ICEB 2VA3A 5KFBA 3QFHA 1S9GB 4IG3B 3B54A 4IRKA 1TL4A 3FSYA 1FJGJ 3LP2A 4CRJA 2CPFA 4F02A 2XZDB 3D3CJ 3RR7A 1M0SA 3SSSA 3K59A 4PUOA 1XR5A 2W2QP 2RRNA 2FIUA 5HATA 2VG7B 4RUHA 2ZM6F 2MHEA 1IBKJ 2HZVA 4NA3A 3N01A 1HD0A 1UETA 3G9CA 3JTPA 4NLRA 1JLAA 4DV2F 2HHXA 5CHCB 3I5CA 2R42A 2DR5A 4GC6A 3GJRB 3MXHP 2U2FA 4CP5A 4Z7YA 1LWFB 1P6TA 2CPYA 2NXUA 3R6GB 2QA2A 1SV5B 2BA9A 2X1BA 3U1LA 2FVRA 2E29A 1K47A 2ZC3A 2BOAA 5EGYA 3ZTOA 1JLGA 2AJ4A 3IBWA 3C6UA 5E41A 3TQ1A 4L3KA 3HX9A 2OJ3A 5KOXA 1QTNB 2YBVA 1CS4B 1FRXA 1XIQA 1RWKB 3TNVA 1HNIA 3TAMB 4DEZA 1RCXB 1U6ZA 3E2EA 1YZ7A 1NCLA 1WHXA 2M4MA 2XEXA 3BYPA 3LP1B 4JI7J 4DV5F 3S7RA 2MKYA 4TNOA 1TVRB 2XQCA 2JHEA 1C4CA 1RWXB 5DLFA 3EVWA 4MKVA 2ASLA 1MROB 2HW3A 4KFBA 1HBOA 4NLOA 2M5YA 1Q82T 3B6BA 2WONA 1TK5A 5LMNJ 5HQ8A 2JC1A 1N4LA 3MR6A 3SCKE 4CO3A 3MECA 3ONQA 1LOUA 3W9IA 1SL1A 1CJVA 3HHLC 1JWWA 4DX8H 4OJHA 3FVYA 3OFGA 5HMWA 2AKWB 4KKOB 3DI6A 4EK2A 3DXSX 3LWLA 1NZAA 2RF2B 4RW6A 4K4TA 1FK9B 3KLVA 1H3DA 2GGPA 3GFYA 1FD8A 4Q45A 1LQ9A 2NXCA 3DLKA 2M70A 3ISND 3X1LB 2B9XA 3TUIC 3G8QA 4ES3A 4RW9B 3W5ZA 2FVSA 1Q8KA 3MTKA 1S77D 3N6LA 4L72B 2MXYA 2F8EX 2ZVSA 3MEEB 2HIQA 4H4KC 1FEHA 3HULA 3BKUA 4J91A 4WP9A 1UVLA 5IT4A 3C2PA 4ZPCA 1TL7B 4WU3A 3FZBA 1FE0A 2HFNA 2RD5C 1JLFB 2MJNA 3FFIA 4DV7F 2V63A 2R7RA 1R7IA 3IBFB 3HHDA 3N5FA 3K58A 4NL5A 1RT1A 3KLEB 3BREA 4K0KF 3T5LA 1NB2A 1KBRA 4A8XA 1EHWA 2HQGA 2ZVIA 3UW1A 3VTIA 1ZAWA 5KFJA 3KK1A 1U47A 1N5YB 4B9NA 5LMUF 3H7HB 4K4ZA 2GA7A 3ILIA 4NZ0A 3OR2B 4Y2KA 2XHCA 2HBZB 3HD1A 5K9FA 1S1UB 1JLQA 2LVWA 5B7WA 1S79A 4F50A 2VASA 3B4DA 4MKBA 5KFYA 4F67A 1LXNA 5G0RA 3O5TB 3GIIA 2R7TA 1V5VA 4ZA1A 3MMJA 4USUA 3PW0A 3PRBA 3GFXA 5C25A 1LFPA 3L9ZA 4OZ5A 4X4PA 4KR0B 1RLDA 2IA0A 3TX0A 1QLNA 4OYOA 1CJTB 2XCPA 4M5LA 4ILRA 5A8RA 3KG0A 5EWFA 1YBTA 4DV7J 3M2VA 4DSIA 1D9AA 4FF4A 1ZM4A 1ZM3A 2HVHA 4B08A 1TKDA 4BCAA 5H9EK 1U49A 2NXJA 1S9EA 4QCLA 1C0TA 3LQVA 1FKAF 3HSZA 2N7CA 4RNOA 3RB6A 2MLYA 2WK4A 2ZC4A 4DCOB 1OS5A 1HD1A 3DRYA 2EK6A 4UUXA 2ZE2B 4O4GA 3C3LA 2AJ2A 1RKIA 4J9SA 1S1XB 2GAHC 4OYXA 4PXDA 4WCEQ 2CJKA 2RHSB 2GW8A 3R97A 4DUZJ 4PG6A 3TVZA 1Y11A 1UAWA 1RAGB 4WIQA 2ZH6A 3SYZA 4NE9C 4PCQA 1IKVB 3M2UA 1CULB 3IMQJ 4UZBA 2BJ8A 4OYIA 4DSLA 4U67Q 3BGRA 2VUGA 2M88A 1Q0NA 2M52A 2P6SA 3DMJA 3RB4A 4OYMA 3BR9A 3PTWA 1JIHA 4XDCA 1LWXA 3VGSA 5E3CA 2G0CA 1RHQB 4CO5A 4DPXA 4LUBA 3CCJS 4AL5A 3E8OA 4I2QA 4DU8A 2W1BA 3KWMA 4DUYJ 3BPDA 3OT9A 5D4PA 5ETQA 3SQGA 3D66A 5K8OA 3L7OA 3KNGA 5DQIA 5SUHA 1ZTWA 1MG7A 2CUYA 3BS9A 4P7TA 5D3GB 2GMHA 1WSRA 2WAQD 4B02A 3UCUP 2PO4A 2J0WA 3TOQA 1FVQA 4OX6A 3CCVS 4FN5A 5C24B 1RHMB 4PG5A 4OFZA 4JI6F 2F65A 2IVFB 2BE9B 2RE1A 5LSLA 4PQUA 5J2QB 1ZPVA 3PCOB 4MFBA 3MFIA 1HI1A 2YNHB 2WRMA 3LP1A 2EFNA 3OUYA 4EYIB 3UFCX 1U48A 3D0HE 5F8GA 1TUGB 4OJ1A 4B3OA 5KFLA 1H74A 1R8CA 2YWFA 5DLGA 2VONA 4O44A 5KAKA 4ECZA 3T5KA 4DV6J 4I69A 5GVQA 4LF9J 3T6BA 2QA1A 1K8AT 5DQGA 4BC9A 3VV2B 4DZDA 2XMTA 2CVEA 4NPOA 2EFOA 3AJ1A 2G0JA 4ES1A 3KJNB
chains in the Genus database with same CATH topology
4H4MB 3KG4A 3TA1A 2ACYA 2DRBA 2YWEA 3QGGA 1MU2B 4LVNP 2HYIB 4ELTA 5KFDA 2MZRA 3RW6A 1L5UA 4C8ZA 4WYWA 4YR0A 2JZ5A 2JSXA 2ZE2A 4O4GB 4DHVA 1VI7A 2W4DA 4CCHA 5L1LA 1YIJS 3M6XA 1S6OA 2ZJRQ 1MWYA 3H5UA 3QPIA 2KB2A 1RT6A 2CZ4A 1VRTA 2D3ZA 1YRXA 4O23A 2J76E 4D3HA 2MQQA 1XMQF 2HHQA 1VRTB 2KFNA 2CKWA 3CCES 2HNDB 2VQEF 2BABA 4C97A 1B7FA 2DHXA 1A7GE 3FJ2A 2LDYA 3PX0A 1D8YA 4DL2A 3VQTA 4JV5F 2QRRA 1FKOB 4C11B 4NWBA 4C11A 2QV6A 1BGXT 3T9ZA 5L8RC 1GXTA 3POTB 3I87A 1QE1A 1MMNA 2MY8A 2OP5A 5C42B 3M9NB 2OAUA 3HF5A 4JI1F 3LWMA 1M90T 3CJ4A 2QIFA 2KM8B 5A6WA 3ZFVA 2JEFA 3EXCX 5AE2A 4ZLPA 2M8DB 2DGWA 2HNYA 1WF0A 1SJ1A 1PILA 4Q8EA 2ZJQQ 1T02A 2JEIA 3D1OA 2E5LF 4RW8B 4DSKA 2XNRA 4ED3A 4H4OA 3B78A 3G86A 3F41A 1RTDB 1VIXA 2Q6BA 1SC6A 4I2PA 5BR8F 3PW2A 3IXQA 2P9EA 1SKRA 5DM7Q 4IO9Q 5E7OB 5G4DA 1FJ7A 2LA4A 3I6PA 2CIMA 3KLFA 3JSRA 3M32A 2CPEA 2GHPA 2B5JB 1AXQA 3MGJA 2LEBA 3PACA 1RQ0A 3DDKA 2XI2A 4ECSA 4KSEB 5IT0A 4B3MF 1PC5A 4OI2A 3I82A 3DOLA 3QO9A 1NKEA 3Q24A 1WHVA 2EG1A 3W2VB 4U9RA 3FSIA 3TR5A 2RRAA 1Y7PA 1HWIA 2MQMA 4XAKA 2XC9A 1YJRA 1P1TA 2LQJA 4HKQA 2IRUA 3I0SA 4MAKA 2DO0A 1WEYA 4ZP8A 1EP4A 3SFUA 2CJBA 4HT7A 3RR8A 4DLEA 1S6QB 3OPKA 2V9KA 3LALA 2RS8A 1O5JA 3MPWA 3NAHA 4J9PA 3UD3P 3MMBA 2QA4G 2RVJA 5F0WA 1JLGB 1LK5A 3NP5A 2BQUA 4IRDA 1RTIB 4N47A 2DR9A 3HI9A 2OFGX 2K3IA 5CXTA 1XC9A 1N6QB 1SIWB 4CZCA 2E5JA 4Y2CA 2NR0A 4LJMA 5J2MA 1UFLA 3PW7A 1QTMA 2KRRA 2R7UA 3CMES 2YKOA 4YFUA 5E2QA 1D8ZA 2W25A 1HNZF 5J1EA 4X2BA 2XS2A 3BQ2A 3MM5B 3CTRA 3ETOA 1AFJA 2ZJPQ 6FD1A 2GJ2A 4OV1A 2DH9A 2UV8G 4Q2MA 3OR1A 3WDOA 4NZ7A 1X9SA 4CIOA 3JB9k 1NK0A 1SUQB 3H2VE 5D78A 2B51A 4OZNA 1BQNB 2W7AA 1S1WA 4A8WA 1FXRA 4DBQA 2RKIA 4LFAF 1IJEB 4RW7A 2P6TA 2OLWA 1WELA 1XNQF 2GJIA 1LWCB 1CC8A 3DXBA 3FGVA 5GAHU 3RRHA 2EBEA 3LUYA 4DWIA 3GWCA 1NKBA 4CNYA 4YB1P 2ZHBA 1RT2A 2ZNZA 1X8DA 3TUJC 1Q53A 3MFHA 1IBKF 4F2SA 5E3QA 1RI7A 2ASYA 3PR4A 4TU8A 4K4UA 4YR2A 2K3KA 2XSJA 3VCDA 3MM6B 4MK8A 3VZHA 1NJWA 5DG9A 3AB2B 3K5NA 2OPQB 2KYXA 4X65F 2FHMA 4MTPA 1YBAA 1ZM9A 3E51A 4CTAB 5CA5A 2VV5A 4FZVA 3GV8B 4C8NA 1X0FA 4ECRA 3KKFA 1BQMA 3DRRB 3MMBB 2RF2A 2OTJS 4TY9A 4N8OA 4A46A 3CJ2A 1N32F 1F5AA 2D7SA 1S99A 4FF2A 2CQ1A 1XNRF 3CF5Q 3OTDA 4K4SA 1IKWA 4OLPA 4IQMA 2PFFB 3MWBA 1Q4RA 3G8SA 5E5NA 4H54A 2Y1JA 5HBMA 2FY1A 3MMAA 1O0PA 2C3PA 2QMXA 1HR0F 4ZS6A 4C8OA 3BZQA 1YJVA 1BY9A 2XLKA 1U2RA 2KXNB 2KTQA 4QWEA 4IYQA 1WHWA 2B0GA 4RBTA 2PMHA 3BQ1A 2NYIA 5EX0A 2W9CB 2XLIA 1L3VA 1B0PA 1FCAA 4N8NA 4BC7A 5CD4H 3OFHA 3BGRB 3OHAA 4OI0A 3MAHA 3DLHA 1WEXA 4HDHA 5A8WB 3O2IA 2DD8S 2DNNA 4DSJA 3CJ5A 1IKXB 1FT8A 2QSWA 2I9SA 2M0GB 2RT3A 5GAGI 5D3GA 2IMOA 3DRSB 1N5VA 3JYTA 1KRPA 2QMWA 3QGIA 2WONB 5K14B 2XS5A 3CIZA 2JRSA 2DGXA 4I4BA 4PPDA 3BO4A 3PNIA 1D0EA 4RW4A 4HI2A 3H20A 1FRIA 2AJ1A 1FD2A 2LU2A 4JI3F 2BJDA 3Q8PB 1FKPB 2J9CA 2FLOA 4WF9Q 4NOHA 1X4FA 3BSAA 2NUHA 1F5CA 1OSCA 5C25B 4M5DA 4AFFA 1T03B 1HBUB 1UJ5A 4OI4A 3IS9A 1LK7A 2FGCA 1AROP 5F3ZA 4RBVA 4V19X 1JX4A 4FF4A 1S1VA 3GR0A 4BWMA 3PXGa 1KOOA 2YKMA 1UW4A 5I42B 4EO6A 4RNHA 1NK8A 3GIMA 3OFEA 3D54A 3HK2A 3E01A 4JI0F 2IVYA 1G2EA 2YQ3A 2MQNA 2UP1A 1SKSA 1RT4A 2YKNB 5C5JA 1TL1B 2ZFHA 1DAXA 4C7QA 2Z2MA 2ZHAA 4FF3A 3M6UA 4F4KA 2B3TB 3R5CA 1Q81T 2ABYA 3TARA 4B9VA 5KFSA 2AV5A 2FHOB 2HNDA 5KFKA 4ZMMA 2BR0A 2I5JA 1IXKA 3SMZA 1ZYQA 2UXBF 5GMKa 2BQ3A 1QY7A 1WEZA 1LW0A 3PV8A 4QQBA 2J6TA 1WG4A 4QOTA 2UUCF 2KKHA 1JLQB 1RTHB 3MCSA 2AJQA 1X5PA 1RT7A 3ZZYA 3CB4A 4K5RA 1T95A 2B6AA 1VQ9S 4Q0BB 2MDAA 3DLGB 4DR3F 4I56A 4G1IA 4EZ9A 2DK2A 4HI1A 1TKTA 2I1RA 1Y00A 4OI1A 1NJXA 3H4BA 4DSFA 3MUMP 3AHPA 2X1AA 1P27B 2GNKA 2QYCA 5CYMB 2YKNA 4D3GA 4NCGB 2FHJA 3PM9A 4PWDA 1K1SA 1Q78A 5E0OA 4A48A 3V6HA 3OTCA 2DNLA 1G1XA 4DN0A 5KFHA 5I42A 2AJFE 3BM7A 4QBUA 2DGVA 2IAJA 2RILA 1JKHB 3JTNA 1JXLA 2IAJB 4AXIA 1VRUA 2U1AA 3GZ7A 3QMQA 3UDLA 1QUVA 4Y0FA 1F5BA 1J2VA 1TUVA 1VHFA 1HNIB 4URGA 2R8JA 3D5MA 4TQRA 3BDEA 2PA3A 3CXCR 2MQOA 4IG0B 2I2YA 1M5KC 4ZOSA 3SQGB 3GG0A 1IKXA 4QU6A 4IG0A 5J1NA 3T1AA 1H6KX 4OZJA 1TR0A 1HHTP 4PUOB 2X1FA 1SV5A 2BRLA 1X5OA 1DTQB 1CQMA 1HQEB 4OLOA 4TXSA 3QZ7A 2PI4A 3PEJA 3Q22A 1FEEA 1OQ3A 4A8YA 3MR2A 1S6QA 4J9KA 3OW2R 3ZZOA 2HVZA 2QFJA 3CDUA 1RTDA 3TAMA 4NCGA 1VS3A 5I3UB 2D41A 1CSJA 1X0PA 4A8FA 5A0YB 5KFPA 1L3SA 4MH8A 1S0VA 1W25A 2QZ8A 2MKJA 2BE2B 4DQRA 4PXCA 2OIHA 5KT4A 1TL3A 1SL0A 2HHSA 1C0UA 1FESA 1S48A 3DOKA 4GMKA 3T3FA 4RUCA 2R8KA 2J8AA 4FYDA 3KLHB 2A18A 2J7KA 2C2RA 1U4BA 3I4PA 4ED5A 3V6KA 1Q8BA 3IG1A 4ED0A 3BJYA 3LANA 2J7UA 2BANA 2MKKA 1UP1A 1U09A 4KE5A 1B64A 4DS5A 2VL1A 3PFEA 1IKVA 3M2UB 1Q7YT 1FTRA 3VAMA 3CDBA 3QJJA 3G96A 2ZBCA 3POTA 2YX1A 3EZUA 1A6LA 3PFOA 5H1SV 1U1KA 2W8LA 4DFMA 2UVRA 1S0MA 2JDJA 4TYAA 2ZDPA 2XWYA 3TVKA 3H59A 3RAQA 1S1WB 4MIWA 5K8NA