1VQPS

The structure of the transition state analogue "rap" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 22
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vqpS00
1A7GE 5LJ5Y 3MXHP 2MKKA 2RT3A 2HVZA 2CPHA 1N54B 2OSRA 1N8RT 2DH7A 3UCGA 3LQVA 1Q86T 5DM6Q 3B4DA 4F02A 2LYVA 5LSOA 2LEBA 2QEXS 5DETA 2CPJA 5GVQA 2RU3A 4WF9Q 2DGWA 2KN4A 2M7SA 3UWTA 2MQOA 2HGNA 2I2YA 2JWNA 2DNRA 2MXYA 1OPIA 2DIUA 2RUGA 3BO2A 2RQCA 5H1SV 2CQPA 1WEXA 2DITA 2M4MA 1U1QA 1YIJS 1QVGR 1KQSR 2DK2A 2KM8B 5IFMA 3VAGA 1D8ZA 1N52B 2F9JA 2ZJPQ 1WTBA 1FXLA 4W90B 1U1RA 3SDEA 1YTYA 1WI6A 3CULA 5HL7Q 1VBZA 2MZRA 5LXYA 1WG1A 3CTRA 2EK6A 3RW7A 5ITHA 2CPDA 3U1LA 1YITS 2MB0B 2DHXA 3K0JA 2FHOB 3ULHA 4FXWA 3CC4S 1ZH5A 1X4DA 2MGZA 2U1AA 1VQ5S 3EGNA 2DNQA 2L9WA 5IM0B 2QA4S 4TU7A 3CMES 4C7QA 3CC7S 1UP1A 2CQ3A 5GAGU 2G1DA 2LQ5A 4J5OA 2HGLA 3MD3A 1QM9A 4PKDB 4WFNQ 2KH9A 1S79A 2E44A 2EK1A 3BEGB 2HZCA 2DNLA 2MZQA 2E5HA 1KOHA 2CPYA 1SJFA 2UP1A 1DBDA 1H2UX 2LA4A 4QPTA 3H2UB 2AD9A 5IM0A 2LA6A 1KC8T 2KG1A 2DHGA 2ADBA 2DNYA 1X5OA 2KRRA 3FEXB 3UCUP 2DGSA 2D3OR 1U6FA 5JVGQ 2NZ4A 2LEAA 4TU9A 3VAHA 1VQ4S 4LMZA 1VQLS 2YH0A 4IUFA 2KM8C 4OZ0A 3MOJB 4PR6A 1X4BA 4ERDA 2M70A 1S72S 1IQTA 4M5DB 2KVIA 2DO4A 2LKZA 2JX2A 1U2FA 1JJ4A 4LJMA 4WCEQ 2SXLA 2DGXA 4P6QA 1M90T 3CUNA 2MKHA 3V4MA 2DGUA 1M5VC 4RU2A 4FXVA 3L3CA 4YOEA 2CQ1A 2KG0A 3CXCR 2L41A 2LECA 2N7CA 1SJRA 1X5PA 1WELA 2MJNA 2GHPA 2G4BA 1X0FA 2LMIA 2DH9A 1WG4A 2CPEA 1WF0A 2X1FA 2U2FA 5GAHU 3VAFA 1N88A 2VODA 1FJCA 1Q81T 4ZKAA 2OTJS 3G6ES 2RNEA 3PIOQ 1UW4A 1HD1A 2ERRA 1FT8A 3CCJS 2DGVA 2MY7A 1WHVA 3ZZYA 5DM7Q 3CCSS 1L3KA 1WEZA 3G96A 3U1MA 3DLLQ 1FHTA 2CPXA 2KI2A 4OZ1A 3J7ZT 1VQ6S 3UCZP 1WI8A 1F9FA 1YI2S 2CQ4A 2LCWA 2DHSA 1SJ3P 4C4WA 1W2BR 1X4AA 1URNA 3R27A 5MLCV 1VQPS 2MZSA 1YJWS 2E5GA 2VOOA 3ZZZA 1AUDA 2DIVA 1U1KA 1Q7YT 2E5IA 2J8AA 1U1OA 2YWKA 5DDQC 3R1HA 1X4FA 1X4GA 1WWHA 2RRAA 2M8DB 1VQMS 2M0GB 2MYFA 3THTA 1VQNS 3THPA 2CQHA 1DHMA 1VQ7S 2JRSA 2MKSA 4LIRA 4IOCQ 2DGQA 2N82B 2MGZB 3PIPQ 2M2BA 1DZ5A 1FJEB 5LJ3Y 3BS9A 1H6KX 2Q79A 3CCMS 2AYBA 1UFWA 4WFBQ 1OO0B 2DO0A 2MZJA 1U1MA 2PEHA 2DGOA 5IQQA 2L08A 2PE8A 4F26A 2KHCA 4WKRA 1X5SA 2OSQA 3CMAS 2MKJA 2KT5A 1R8PA 1NU4A 2RRBA 5DDOC 1K9MT 4QU7A 1U1NA 5EN1A 2YKAA 1VC0A 3LPYA 2D9OA 4QU6A 1FNXH 1JMTA 2X1BA 1SJQA 1H2VZ 3B4MA 3JB9k 3P3DA 4CQ1A 1KOOA 3S6EA 1YHQS 3VAIA 1P27B 3CCQS 1R8HA 2QFJA 3CC2S 2CQDA 2DB1A 3IRWP 1P1TA 2MZ1A 3CD6S 3CCUS 2MQNA 3G8SA 2ZJQQ 3MD1A 1M5PC 5GAEU 2ZJRQ 1RK8A 3Q2SC 3UD3P 1Q82T 2DNZA 2FC9A 2KU7A 1VC5A 5D78A 1WF1A 2O3DA 2DNMA 2XNRA 3I56S 2DNHA 3OW2R 5LSLA 1FO1A 1U6BA 1WF2A 2V94A 4BS2A 2HGMA 2BOPA 4Z2XA 2WBRA 2D9PA 5FJ4A 2KYXA 3CPWR 2KXFA 3NNHA 2F3JA 4CH1A 2I38A 3R1LA 2MJUA 3D2WA 2RS8A 2OTLS 2NLWA 2F9DA 2K3KA 2M88A 1M5KC 3IWNC 3I55S 3NS5A 3P6YC 2J76E 5DDRC 5CXTA 3G4SS 3TP2A 2DH8A 1VBYA 3CCLS 4TU8A 1O0PA 3MUVP 3NNCA 1HL6A 3VAMA 2X1AA 2AYGA 1K73T 4Y0FA 5HO4A 2XB2D 1X5TA 3UE2A 2XS2A 3BO4A 2LXUA 1CVJA 3VAJA 3SMZA 2MY8A 1YJ9S 5CA5A 2CQGA 2MMYA 2MQMA 2CPZA 2CQ0A 3TO8A 3RW6A 2MQPA 2XNQA 1WEYA 2MSTA 1G2EA 2KXNB 2VONA 4CIOA 2CQBA 2ADCA 2CJKA 1PO6A 2CQCA 1HD0A 1RKJA 1NO8A 2YTCA 4YB1P 1B7FA 2CPFA 2MHNA 1U1LA 1ZZFA 2KFYA 2FY1A 1VC6A 1YJNS 1PGZA 3S7RA 2HYIB 4W92B 4UY8T 1FJ7A 2N3LA 3MUMP 1VQKS 2JVRA 4A8XA 1H2TZ 3P49B 2OJ3A 1NJIT 2MQLA 4U67Q 2RVJA 2MZTA 2DNPA 2M9KA 2N3OA 2RS2A 1WG5A 1VQ9S 2FC8A 2KRBA 1DRZA 1JJ2R 1D9AA 1QVFR 4CH0S 4IO9Q 2GO9A 1JJHA 1X4CA 2RQ4A 2MKIA 2MSSA 5DDPC 5LXRA 1KD1T 2XS5A 3N9UC 3NS6A 5GADU 2KXHA 3CCRS 4IOAQ 3G71S 1SJ4P 3TYTA 3EX7B 4WIIA 2BZ2A 3G9CA 4EGLA 2DHAA 3SXLA 3J7YU 2OIHA 1WHWA 2J0SD 3VALA 3NNAA 1X4EA 4F25A 3VF0B 2MQQA 1ZZNA 2CQIA 3HHNB 1A9NB 1BY9A 1VQ8S 3CCES 1K8AT 2DNOA 4ED5A 1M1KT 3HI9A 2JVOA 2MPUA 2B0GA 2XSFA 4WFAQ 5D77A 2FPHX 4YUDA 1OIAA 2AYMA 2AYEA 3BO3A 3NMRA 3MUTP 1VQOS 2E5JA 3US5A 4Y00A 2VOPA 3SDEB 1XN9A 2MKCA 4QQBA 3CCVS 2DNKA 3EGZA 4TLQA 3UD4P 4PRFA 2CQ2A 3H2VE 3VAKA 2CPIA 5BJRA 3Q2TC 1UAWA 3MDFA 2M8HA 2DNNA 5CYJA 1HA1A 1OWXA 2K8GA 3S8SA 1M5OC 1WHYA 3S01A 1SXLA 4C0OC 1X4HA 2DISA 2YH1A 1WHXA 2LXIA 1VBXA 2DNGA 3MI7X 2A3JA 2XS7A 4V19X 2DGTA 2X1GA 4UQTA 3G8TA 3CF5Q 2G0CA 2M52A 3P5TL 5JVHQ 3FEYB 2J0QD 2EVZA 5GMKa 1U1PA 1YWXA 3MURP 3DXBA
chains in the Genus database with same CATH superfamily
1A7GE 3KJNB 1S12A 1WC0A 2FIUA 4C9DA 1B0PA 4GRSA 2HVIA 2QFIA 1S99A 2MKKA 1HLWA 3AB2B 4DMZA 2HVZA 2FZGB 2R7OA 1N54B 1CS4B 1SL2A 2OPQA 4AQYJ 3HF5A 2R4FA 3GE9A 1TP7A 5DM6Q 1P6TA 4B9NA 2HW3A 4AD6A 5AXNA 1AXQA 4EI2A 4QWDA 1Y4ZB 3V81A 1T11A 1HKAA 2VH7A 2C2DA 4X2BA 5LSOA 4F36A 4HH1A 2BE9B 1VHFA 2WOMA 5GVQA 2M7SA 3UWTA 2MQOA 1FESA 2E9RX 1H98A 6FDRA 4ZVQB 3GIIA 4I0WA 4MK8A 2X51A 3U1NA 1HR0J 4O3OA 5HLFA 2NYIA 2MXYA 4HVZA 4FYWB 4USHA 1XMBA 3A4TA 4ZVUB 4TY8A 2JEFA 1U2CA 2DIUA 2FJBB 2AMCB 4CYUA 3IWLA 4IH6A 4NYZA 4DR3J 2RQCA 3C19A 4X84A 1BLUA 2M4MA 4F04B 5H1SV 4ZPBA 4JI7J 4PWDA 1UJ4A 2FHMA 1NB7A 2KM8B 4K5RA 2IA6A 2FVCA 1GX6A 3OD2A 1N52B 2F9JA 1JLGB 4I1TA 3PHEA 1FXLA 2FHJD 1OQ6A 3VGSA 4W90B 2FLNA 5A8KB 1HNWF 4X4OA 1KRPA 1UL3A 2IBKA 1BE4A 1N5TA 5E33A 1QTNB 3OFHA 5E7OB 5J2NB 5LXYA 1VBZA 1PJ5A 4KGXB 2R9LA 4FS2A 1HWUA 4J9UE 2ZM6F 2CPDA 2ZBPA 2UUCF 1BWVA 2OEKA 2W2QP 3U1LA 2R7TA 1B0VA 1REVB 1RT7A 1WKLA 2A2CA 4NYPA 1GX5A 2FHOB 3MGJA 3H40A 2V9WA 1SH2A 1BQNB 2V68A 4NZ7A 1C0TA 4UZCA 1NRKA 2VG7B 1I3OB 3EGNA 4LF5J 2JC1A 1RJJA 4ZVPB 3AXMA 5IM0B 4DLEA 2DR7A 1LWFA 1RT6A 3SZ2A 2VG6A 3ZTSA 1UFLA 3BGRB 3LALA 5EWFA 1KLMA 2AW0A 3PYFA 4KKOB 5CYMA 4JI2J 1ZM3A 2CQ3A 1ZA2B 2PMZD 1UA1A 3QPIA 1Q5YA 4DQQA 2FB0A 2W7AA 2L3MA 3DOMA 3U27A 3GJRB 4UW2A 3M6UA 3RB6A 2E9TA 5E5NA 2D3UA 1SJ1A 3JYTB 2HHHF 1N32F 1K0TA 2RU9A 2RDDA 4PPZA 1FNMA 4ZVOB 3LOUA 2KH9A 3DOKB 3EZOA 3GSDA 5ETVA 3JQMA 1DY3A 4JI4J 1IR1A 1EARA 2DNLA 3PRVA 3SBMA 3ZC4A 3R5JB 3TOQA 2FTRA 1VRTA 1H7WA 4Y2MA 4F0MA 1G1XA 3F41A 4KE5A 5I42B 2RAQA 3NS7B 2JEIA 1TV6B 1YQHA 3PR5B 2F4FA 3H25A 2DPIA 2EI5A 2ZD1B 3Q23A 1T02A 2J7UA 3H2UB 4K7QA 4WBFA 3CJQA 2IIHA 4FZVA 2QMWA 4JI8F 3C14A 4X66J 5CCLA 3I4HX 4DV7F 2LQJA 1AYEA 3BBCA 3MZIA 4OJGA 2ADBA 3PFEA 3FEXB 3L7PA 5A0YA 3UCUP 2V4JA 1Y11A 1DQAA 2DGSA 2D3OR 1N34F 2NZ4A 3ILOA 2GQQA 3NY0A 4TU9A 4LMZA 3NOCA 3HK2A 2YH0A 1HW9A 3NWRA 4DR6J 4F3MA 2W2OP 1J5EJ 3L9ZA 4NPOA 4IDKB 2QLJB 4EUVA 5E41A 5DQIA 4GC6A 1D09B 4ECQA 2Z2LA 2W7PA 4B3OA 3M8ZA 2XQCA 3M8RA 4A8SA 4H4MB 4JUZA 2KVIA 1XR6A 3N28A 2LKZA 1PYTA 2GVDB 3A3PB 5CHCB 2CJ9A 2ZFHA 5IOLA 3TVZA 1JLEA 2A2DA 2QZ8A 3VCDA 5AE3A 2BQUA 1HNXF 1WDTA 4RBTA 4DL4A 5CABA 4NLVA 1DTQB 3I4PA 5FDLB 1FJGF 1QSSA 3NGTA 3L09A 1L3UA 1V3RA 2XO6A 2VBWA 3KYLA 1M5VC 4DSEA 3DRPB 2AJ0A 3QWPA 1CJVA 2PT0A 4RU2A 3MCSA 1GK8A 3MAQA 1FEHA 5KG4A 4UQGA 2L41A 3M6XA 1U25A 1LQ9A 5KT2A 2E9ZA 1RBOB 3PV8A 3CVKA 4UT4A 1SJRA 1X5PA 1RYSA 2W1BA 2UXCF 4OLOA 3I0RB 3MOZA 4R25A 3KHHA 1CSJA 4OIXA 5G4DA 5HQ8A 1WG4A 3BV8A 2U2FA 3HCXA 5GAHU 3VAFA 4HDGA 4DV7J 3V6DA 8ATCB 2VODA 4JI8J 3JTNA 3FBFA 2FUG9 4X66F 5A8WB 3I31A 4ZPTR 4C3KA 2MEWA 2Z56B 3L95X 4G65A 3HVRA 1C4CA 4LVNP 2OTJS 1S4EA 1KVIA 1JLCB 1YRXA 1RZMA 4LQ3A 2IMOA 1FE0A 1HD1A 2V2ZA 1RCXB 2F7VA 2B3TB 1FT8A 3BKUA 2K1RB 4V1Ak 1TUWA 1VISA 3MPWA 1S0NA 2K06A 4LF9J 2IVMA 1FX2A 4LRBA 2L48A 2IJRA 2CG8A 3UN3A 5DM7Q 3KK2A 2OLWA 5IT4A 3DC2A 2OEJA 3ENQA 1J27A 1WEZA 4DQSA 1M5SA 4WYWA 2HHHJ 2MTLA 1N32J 1N36F 3HSJA 1REGX 3J7YI 4NLSA 3SEOA 5FLXU 3TA0A 4F7VA 2B7CB 2KI2A 4OZ1A 1LW0B 4OQJA 4P10A 5BR8J 4MFBB 3UCZP 1IWGA 3RGIA 1GTEA 1IM6A 1S9EA 4L3NA 2BW2A 1FFGB 2CQ4A 4OYBA 5JJBA 1YI2S 4IR1A 3W2WA 1NPKA 2G0IA 3N01A 2DHSA 4Y2KA 1QLNA 1L5UA 1W2BR 1HMVA 2LLZA 5KT6A 1N33J 1IUJA 1SVDA 4RNOA 4ECUA 2HNYB 2PFDA 1UEVA 3W7BA 4WE1A 3BM7A 4GO7X 4B3OB 1VQPS 2MZSA 1YJWS 3CO9A 1RWOB 3MR5A 2DIVA 1PAUB 1U1KA 1Q7YT 4ECXA 2UUAF 2W2MP 1F6TA 1U1OA 4H4OA 4RNMA 4FF4A 1NK0A 1J5OA 5DDQC 2XMJA 1SI9A 1X4FA 2ZUAA 1EJ7L 2VFUA 1HNWJ 5A6WA 2V9KA 3WZ0A 2MYFA 3AQPA 4J91A 3THTA 4MYUA 2AX0A 1PBAA 4AL5A 1N33F 1VQ7S 2MKSA 1DLOA 1FFWB 2HFSA 3W2VA 1UKUA 4LIRA 2HVHA 1TAUA 4IOCQ 1S6PA 2F8MA 2DGQA 2QSWA 3IAS9 4GVLA 4LREA 2N82B 3TAQA 5J2PA 1ELOA 3MM8B 3PIPQ 4DL7A 1UVMA 5BR8F 1YBAA 2F4VF 5D3GB 1B64A 3GCWP 3G6YA 1ULRA 2CJAA 2XY5A 3SQGB 2BKPA 3FRYA 1TELA 2Q79A 3BS9A 4DSIA 2C2RA 1JKHB 1ZA1B 2WONB 3BKTA 3IR5B 1JK9B 3NRBA 4ZP7A 5C24A 2B8QA 1RYRA 1HR0F 4M63A 2DO0A 3C8YA 4UOGA 2J5AA 5A8WA 1U1MA 1BXNA 3KJVB 4A4JA 2VQEJ 2DGOA 2PE8A 4WKRA 1GMWA 3M8QB 5A6PA 4O3RA 3JSRA 4DV3F 3KTQA 4ELTA 3M8PA 3NCPA 1QD1A 2OSQA 2VDHA 3D7SB 1MN9A 1OS5A 3K2YA 4AQYF 4HACA 3FBCA 1I51B 2Q43A 2CRLA 3GP9A 3KLFB 4GVBA 1EKRA 1NU4A 2RRBA 2VPWB 4AL6A 1K9MT 5E3QA 4YP3A 3MHYA 1CLFA 2HRUA 4J9VA 3EICA 3FQKA 3GYXB 4YB5A 2YKAA 1QAJA 1UVJA 3QO9B 4ZHRA 3GCXP 3LP0B 1NK9A 3NGRA 4JV2A 1IJEB 1FNXH 3AHPA 2FDNA 3ONQA 1TUGB 3PFOA 1REVA 3BGLA 3R6LB 4FKYA 2RKIB 2H48B 1VK3A 4FVMA 5I3QA 1T3NA 3JB9k 4K4UA 4LRCA 3P3DA 2JH3A 3MR6A 2XTJP 2LEPA 1CULB 2J6TA 3CDEA 3I6PA 4Y65A 1EZZB 1HWIA 1KOOA 3D67A 3HPOA 2QA4G 3VAIA 4EYIB 1YHQS 1P27B 3HJFA 4ZA1A 2HQCA 3R3TA 2HNYA 1H3DA 1NH7A 2AZ1A 2IYIA 3CCQS 1KQGB 2ZOMA 3KUHA 1D9FA 1S1TA 2G1HA 1FRIA 1KLMB 1R8AA 1YGYA 3AD9C 3CC2S 4LF7F 4M94A 2DB1A 4KPYA 2OMLA 2MZ1A 1TTHB 3CCUS 3AAWB 4RL1A 3FZ2A 3AA9A 3HZGA 4P73A 4ZIVA 5JMNA 3MD1A 3T3FA 2XC9A 1HYSA 2C2ZB 5C42A 3GFZA 1X60A 1Y3JA 2BEFA 3EXYA 1RUSA 1Q82T 1VC5A 1E6VA 3AOBA 3OT9A 1R7IA 1WF1A 2O3DA 2MKYA 2DNMA 4ZVTB 1VLYA 3Q8YA 4EO6A 2BXJA 1RLCL 2P9EA 4CO5A 3HT3A 3I56S 1T0TV 3E51A 1RT3A 1S7IA 2WSEC 3HSGA 3OHAA 1FRLA 3OW2R 2VIHA 1WF2A 2F63A 4PAAA 2ZH4A 1CEZA 4WP8A 4RLEA 5IS2A 3RAXA 1S9GB 2R2UA 1IQZA 3SQGA 2NPIA 2XYGB 3DN9A 3OFFA 3MM9B 4ZLNA 2KYXA 4EFAC 2ZC4A 2WONA 4TYBA 3Q8QB 2WZ1A 3CPWR 2KZMA 2OELA 3IBCB 1LW2B 2V4JB 4L72B 2J9DE 4DR7F 4DL2A 3KXDA 4C48A 2ZDPA 1QAXA 2BABA 1IBKJ 5M2RA 4DR4F 1MG7A 4CH1A 2I38A 5E2QA 2MJUA 1G4CA 2HKEA 3KK1A 3RAQA 1XTZA 2RS8A 4KAIA 5G0RA 5K5MA 2JZ5A 5KG7A 2OTLS 4NLRA 4HACB 2K3KA 3AY0A 3P4UB 2ZBQA 3BR8A 1U0SA 4FYDA 1M0SA 5HN0A 2NQPA 1Y10A 2W01A 3IWNC 1BC6A 2KL8A 1Y7PA 1FNOA 4Y2CA 2QV6A 3I55S 2KZZA 1U24A 4LFBJ 1JLAB 3RYLA 1I94J 2Y8WA 1VIXA 3D6HB 1DTQA 2O01C 5FDLA 3PW2A 4B3RF 2AX1A 3G4SS 3H59A 4DN0A 4F4WA 3U7JA 3D4JA 1FDNA 1T03A 4TU8A 4QIWD 3MUVP 4LF5F 3I32A 1TL1B 1YX2A 1HL6A 2X1AA 4LBIA 2O66A 3T5LA 4KGKA 2GMJA 1WC4A 2QSFA 3RRKA 1U7LA 3VQTA 5HO4A 2K7KA 3T5KA 1X5TA 4DV4F 2XS2A 2R7WA 3CCTA 1Y0HA 4OX9F 4DHVA 3QWUA 4PXBA 1HNIA 3E8OA 2LQBA 1XERA 1YJ9S 1O6XA 1R0BG 4PABA 2FJVA 4OYIA 1YK9A 3JTOA 3D54A 3HFVA 2MQMA 3MFIA 4DR2J 2CPZA 4NCAA 3R8YA 4RUBA 4IG0B 1HBUA 5ETSA 4BWJA 2YX4A 4ALZA 2MQPA 3RW6A 1CJVB 1G2EA 4CLKA 1VRUA 1NDCA 2KXNB 2W9AA 4IFYA 3KLIA 1NJXA 4NLGA 3WIVA 3W9HA 4CIOA 2ADCA 2CJKA 2IBOA 4MKYA 1NSQA 4CLZA 1U0HB 1B7FA 2CPFA 2MHNA 2K1RA 3BKFA 3C66A 4DG1B 1UEUA 2KFYA 4L3KA 2R7XA 1FDBA 1PGZA 1IKYA 3S7RA 4EEYA 3KLEB 3QNWB 2CJYB 3MPUB 3GJTB 3UDVA 3HKZD 3W9JA 5L38A 2N3LA 5EDWA 2R8HA 1FJ7A 2BKNA 2EFQA 2CDRB 3M2VA 1R27B 4OYAA 3V6DB 4QYRA 4CLFA 2HBZB 4K50A 2JHEA 1WC5A 2OJ3A 3DNCA 1OYDA 4HL9A 2HFVA 2GS8A 2QLWA 2RVJA 2B5JB 4A8FA 3V4IB 1O5JA 3PRDA 1S9EB 3ISZA 5A2QY 2OFGX 1VHIA 5I3UA 1DRZA 2CJQA 1JJ2R 1TAQA 3UN5A 5M2PA 4BBYA 1NNDA 2XLJA 1U8SA 4QIFA 4I6YA 5KG5A 1JJHA 2K2PA 2EKYA 1H38A 3LH2S 4JI1J 1QY7A 3D3CJ 4GKJF 3G86A 4BCAA 1ZOTA 3HP6A 4J9PA 3QT7A 1NM2A 2QN6B 5LXRA 1RHUB 4FNIA 2XS5A 1JQGA 1S1WA 4LSNB 5DQHA 4H4OB 3CCRS 4HHUA 2BACA 4CLPA 4IOAQ 1T05B 4CP5A 4ZP8A 1MROB 1APSA 3ITHA 4WIIA 4Y34A 4CTAB 4I67A 2DHAA 4RNHA 4A8KA 1LEOA 2HNZB 2J0SD 5D8HB 2Y1JA 3D0HE 3BDPA 4F25A 3VF0B 2CQIA 2HHWA 2EWHA 3PYEA 1TMJA 2YKMA 3S1TA 3MM6B 1HNZJ 1E6YB 3B82A 4ZLJA 3CCES 5KT7A 1K8AT 2HQ3A 1DURA 4ED5A 3MM5B 2UXBF 5E0OA 2CNOB 2GA7A 3H5SA 3N6NA 5GAGI 3P45B 2B0GA 3SSRA 3R7SB 2ZOFA 2OD4A 3FFIB 1NCLA 4WFAQ 5KFGA 3DKDA 3MMBA 4IUFA 2FPHX 3IP0A 4X4VA 3EZ5A 1RSCA 1JLBB 2D7SA 4YQWA 1X9MA 3J80Y 2I8EA 1EB0A 1R43A 2HWTA 2AYMA 4URGA 2YWHA 3M2RA 2XULA 2AGOA 4ILMA 3CJTA 2Z58B 1GH8A 1NDKA 1U48A 1PC5A 1QJHA 3M8QA 3Q8PB 5LM7E 4Y00A 3RBEA 1G7CB 2JSXA 3JSBA 2VOPA 3C6UB 5DS7A 4EU0A 3OL9A 1RT2A 3VQSA 5J2PB 1U0HA 3CCVS 2DNKA 4A8QA 2R7UA 2ZNZA 4JP8A 2P9GA 4E2FB 4DSFA 3EJMA 4CLLA 1ZS6A 3CO0P 2CPIA 3CNQP 4YY3F 3V6KA 1V5VA 1UAWA 3VVTA 4QWCA 4TY9A 3W62A 3ZNJ1 2RILA 3H2LA 1Q5VA 1M5OC 2XZWA 3TUPA 1CG2A 2G2YA 3LP0A 5DG7A 4KHPJ 1X4HA 3B8HA 3QGHA 3M32B 1VBXA 3W5XA 3ICLA 2DNGA 3C16B 4QZVB 1TVRA 1CQMA 2A3JA 2M5YA 2NS1B 2PN6A 1U45A 4V19X 4FBTA 2DGTA 2X1GA 3G8TA 3UNGC 1BQXA 4LBHA 3W8PA 3QJLA 4NXMF 1EP4B 2IPOB 2BRKA 1QUVA 1EAYC 1RCOB 2CG4A 3DRYA 3KJFB 5JVHQ 3T1YF 2J0QD 4FPIA 4O23A 1NB2A 5GMKa 4DSLA 1TK8A 1RT4A 2ZZMA 1KHWA 1URRA 2HIYA 4OFZA 5CQGA 3TNVA 3MURP 5LJ5Y 2LQ9A 4DOZA 2HIQA 2HHQA 4GC7A 4YB6A 2NUHA 2CPHA 1Q8IA 2OSRA 3DDNA 3ITHB 5ETRA 3A8EA 3LQVA 4TVAB 1UVIA 3I5AA 4KPCA 3RB4A 3HXMA 1CULA 3R7BB 4ZLPA 4DX8H 4DPXA 2M3DA 1E6VB 3ADAC 4KH0B 4L6V3 5DETA 1TKDA 4B9TA 4LFCJ 2YQ0A 5U47A 4YR0A 1S6QB 1XEZA 3DM2B 1Q16B 1HARA 2AJ1A 2POKA 1YJUA 1WTFA 3OXFA 5DG8A 3D0IE 2FJWA 3GR0A 2JLEA 4DPOA 5HP1A 3H4DA 3OTEA 2CQPA 2Y0SD 4LF8F 3UDEA 3T9ZA 1NXIA 2RJZA 1XIQA 1YIJS 1LKZA 1LW2A 1JLFB 2FGOA 4UF4A 2OI2A 2H9ZA 4CM2A 3KHLA 4EBEA 4B3MF 3KHGA 1JXLA 1IR2A 5KFOA 4MH8A 4OJHA 5IWAF 1C1BA 4ECSA 2FJAB 3C6UA 3HT0A 1NK8A 3CULA 2IDLA 3BSCA 1U02A 2CJBA 2HSEB 2MZRA 2XWYA 3MECB 5B0EA 2YNFB 1WG1A 3VGVA 1R0AB 2HMIB 2B8PA 3G8QA 2EK6A 4F67A 4JI3J 2W24A 5L1KA 3IG1B 2WB4A 4FYYB 2XCAA 2K3IA 3M05A 1YITS 3DI6A 4OZ2A 2I1RA 4OI3A 3RR8A 2BJ9A 2QA1A 5HLFB 2BQ3A 4FXWA 3O8WA 1ZBTA 3CC4S 4K0KF 1X4DA 2MGZA 2U1AA 1S97A 4PEOA 1F5CA 2J8SA 4RR5A 4TY8B 5K20B 2XM3A 4NA3A 3SCIE 3K5MA 3ZXWA 3OTOJ 2C3PA 1VOMA 2VD3A 3KG4A 3BJYA 4AT1B 5G0RB 4ECZA 3N5FA 4URQU 1GEHA 2G1DA 1IJFB 3I82A 3QAUA 3TJ9A 3OUYA 1HBOB 2OMOA 4G6VB 4DBQA 2EW9A 2OPPA 1GFWB 1A0OB 4PKDB 1QM9A 1WOOA 4IQXA 4QYZK 5F8GA 3UQSA 1VI7A 2E44A 2EK1A 5J1NA 1SC3B 3CJ8A 4CYUB 2H4WB 3GIJA 3JQJA 1GQEA 2JOQA 3C6TA 4ETZA 1KOHA 2CPYA 2QGFB 4DPWA 3UPFA 1SJFA 1G3OA 2CNLB 2DR6A 3CD0A 3KLIB 3M6VA 3NMAA 1SV5A 3DOLA 3A1YG 3PX4A 3J81Y 2OP5A 5F0WA 4PXCA 5KFWA 3OTOF 2AD9A 5IM0A 5KFPA 1N5VA 1HNIB 4USVA 5GMEA 1HNVA 1LXJA 1W7WA 1LWEA 2B51A 4C8NA 4K4TA 4K4YA 4BDPA 2AIRB 2DNYA 2KRRA 3D6TB 1LOUA 2OFHX 3G2XA 3PACA 2YWEA 4HTIA 3JSMB 2EKNA 3GG1A 3OR1B 3T1HF 2WVBA 1VQ4S 2OHDA 1TFWA 4X4UA 3H5UA 2BMBA 3CJSA 1JNRB 1GXLA 4JV1A 5E3PA 4PG6A 4B02A 4PR6A 2ZH2A 2XY7A 3MOJB 3JSYA 4ERDA 4OI1A 2XO7A 4ELVA 1CJUA 1IQTA 2QLBB 4I4BA 4ECTA 2DO4A 2HS3A 2DRDA 2GIFA 1TL3A 4YR2A 4DPUA 4TQRA 4B9SA 4DJBA 5KT5A 3G82A 3SFGA 1U2FA 1IKYB 4KKOA 5CYMB 3TEGA 4CWBA 4WCEQ 2I5JB 3HSDA 3W64A 2QG9B 3TZWA 3FUYA 4AE5A 3KMSA 2XG8A 4AL7A 1X9SA 4FF2A 5IT9U 1M90T 4K2JA 2MKHA 2DBBA 3DOMB 3HHEA 4YHHF 1QSYA 4LRAA 4F4XA 2C42A 4G1QA 1RAHB 3GIMA 2KG0A 1OY9A 4C3MA 4JV5J 2HK2A 3RBXA 4CT9A 5KFTA 3RJMB 1QAYA 1M1GA 1ZM9A 1FWPA 4A8OA 1TK5A 5C2CA 2Y1IA 4RW9B 2ZNYA 2GHPA 3O6QA 4DU8A 3MCNA 2NUUG 2B9YA 2W8KA 2BX6A 2OAUA 4U7UK 4E98A 3KK3A 3IN5A 4DFJA 2CKWA 2I0XA 4URSA 2FVQA 3W61A 4ZKAA 4RW8B 2NZCA 1Z2ZA 5HI7A 2GC8A 2CDQA 1T05A 1VQSA 3AD8C 3G6ES 4W98A 4I2PB 2BV3A 4IH5A 3PIOQ 2UU9J 3FJ2A 2DGVA 2EFNA 1KQKA 5KTQA 4Z7YA 1B3TA 4NXMJ 1MSWD 1RHRB 3O1LA 3PJXA 4OHWA 1X9WA 1S1XB 2UVRA 1CJTB 1OSDA 1S1VA 2CADA 3PEHA 5ETNA 1L3KA 3G96A 3MM5A 3U1MA 4I56A 1FHTA 3V81B 2YNGA 4CO0A 2KFNA 3DCAA 3DLBA 1T8EA 5E3RA 3QFHA 2XY6A 3NXZA 1HIYA 1VQ6S 4F0HA 4X4SA 1R6YA 1F9FA 5DRKA 4Y2AA 2XGQA 2V4RA 5K8PA 4O3PA 1Q53A 2WRMA 3AH6A 4KH1B 4W4MA 3TZXA 2O5DA 4NXNF 2VA3A 1X4AA 4RWWA 1URNA 2ZOGA 1RT1A 2ZVIA 5MLCV 2VA2A 2ZBIA 4OHZA 4ANDA 4DV0F 1CJUB 3KDNA 2X3GA 1SKUB 2LDIA 2B4PA 2VASA 2VF3A 4RUHA 4DUZF 2J8AA 4M5HA 4ED4A 1W25A 4FF1A 3LW5C 2HFOA 2OPRB 3I0RA 3IM8A 5F3TA 3KLHA 3R1HA 1L3VA 4KFBA 2KB2A 4Q5VA 1F5AA 1FDAA 2EEYA 3TZZA 4D3HA 4EZ9A 1VQNS 1F0XA 2RE1A 3WC0A 3THPA 3NEKA 2CQHA 2HQDA 1TKXA 4G1QB 2LVWA 4P2SA 3MEGB 1QUPA 1WDDA 3E01B 3QIPA 4JOUA 5JXSA 4K4VA 1SKRA 4TNOA 2UXBJ 4LQ9A 2FZCB 4ZPCA 5AXLA 1HFEL 2VG7A 5ETLA 2HZVA 3UW1A 4OV6A 2M2BA 2QA2A 5HJYA 1T3OA 3PW5A 1HMVB 3K5OA 4WTYA 1JLGA 4WPAA 3AOCA 2IM3A 4WE1B 5LJ3Y 2DY9A 2AYBA 3PTWA 5F9LA 1SPBP 2VPYB 2MLZA 3CJ0A 4WFBQ 5FIIA 2C2MB 4IH7A 1OO0B 2JL9A 4ZCMA 1SCJB 2MZJA 4LF2A 5HMYA 3EWGA 3MM7B 2PEHA 2V8DA 2L08A 1RLDA 3V5RA 4KB7A 4Q8FA 4MFBA 3EE3A 1R89A 3K8WA 4Q7AA 5HK4A 1Q1KA 3CMAS 2MKJA 5HAOA 4DFPA 4JI0J 3D68A 2XLIA 5EGYA 1XNRF 4RWXA 3TQEA 3DRSA 3DLHA 5HBMB 2DXDA 4DV6J 5DDOC 4ZP6A 4QU7A 2VPXB 1CJTA 2CAJA 4NLOA 5HSPA 2WBMA 1S1VB 4JI0F 5LMUJ 4CO4A 1NZ8A 3PNIA 4OZNA 1VRTB 1RTJB 3TUIC 2J6SA 3FBEA 2R2RA 5I42A 1CJKB 3MECA 4FNHA 1TV6A 2DCLA 4HHHA 3TUJC 4CDIA 2IRXA 5EX3A 5FD1A 5EUHA 2OPSA 2ZD1A 4ANEA 2AGPA 2HMIA 4ZN1A 4M95A 1SJQA 1UPPA 4ZK7M 4DX7A 3B4MA 4RU9A 5LT5A 1AT1B 3HHLD 2AV5A 4M5KA 2GAHC 3MAHA 4C0HA 5SZTA 2VHGA 1JLFA 2BJ1A 2BJEA 2QRRA 4OHXA 3CWJA 1ZTWA 5LOQA 3S6EA 2BA9A 1PC4A 4DUYF 2ASDA 1DLOB 1C1BB 3W2VB 4WFXA 1R8HA 4E8UA 4B9MA 3IRXA 4WFZA 3ZZTA 5H9EK 1UZDA 2CQDA 4ED1A 2XMMA 1P1TA 2B56A 3MR7A 3VWSA 5J2MA 1SIZA 2G2OA 3KLFA 2NXNA 5DZ7A 3GV5B 4QWAA 3G8SA 2C2EA 4B3SF 1EKSA 4ZPAA 1RTIA 4WK1A 4DQRA 1NK4A 3IS9A 1CQNA 3LAMA 2IM1A 2J6UA 1RK8A 3Q2SC 3DDKA 4NLQA 1KTQA 4USTA 1NK7A 3FKBA 3FCVA 4DF4A 2RHQB 2OH2A 3KJVA 2E1RA 3M8SA 4DL6A 3DU6A 3C6TB 4NEYA 1ZPWX 3MCMA 2DNHA 4OX9J 1FA0A 5HATA 3M8PB 1N6QB 3BSNA 5LSLA 1HWKA 3QGGA 1FO1A 1RTZA 5DGAA 3WIUA 4I7FB 4M5MA 1U6BA 2DD8S 2P8IA 1MW7A 3JAMY 5GMDA 4DI6A 4Z2XA 1JWWA 2Q1LA 1LWCA 2IFXA 1FRXA 2CZVC 2D1CA 2KJVA 2W9BB 2ZHBA 1T95A 1R3NA 1R6VA 2GVDA 2WVFA 3I9V9 3NBPA 3NG8A 1LWXA 4ZJLA 5HVGA 1IBMJ 4NOHA 4PQUB 3NGKA 5C7PA 4OHVA 1TKTB 3EDQB 3QYYA 4I6WA 3UI3A 4ZJQA 2KXFA 3M9MB 3NP5A 4HI2A 2KT3A 2F3JA 1N5QA 3OR1A 4EBCA 3DRPA 5CYQA 4WU2A 3D2WA 1NJZA 1PG5B 3G6XA 1KFSA 1CC7A 2F9DA 1RADB 5IV3A 1IBCB 2M88A 1SH0A 1ZAVA 2LFVA 4KV8B 1M5KC 1Z2LA 2YNIA 5KFHA 4TN2A 1PYSB 5B0FA 1RAJA 3EGVA 4QR2A 3K58A 1NK6A 2UU9F 3G82B 1MU2B 1EHWA 2YKNA 2E5LF 1FKPB 1GXUA 3QZ7A 3CE8A 5DDRC 1TUVA 2Q6CA 1RAGB 4PUOA 3DLKB 1NAQA 3IA0A 3R97A 1Y00A 3TP2A 3CCLS 3CJ4A 3MM9A 4K59A 3BREA 4KIAA 3SCJE 1TL4A 3LGHA 1SKWA 2P5VA 5JUMA 2RUSA 3H98A 3HHLC 4OZLA 2KTQA 4C11B 1UTAA 3BO4A 1F60B 4KSEB 1OY6A 4USWA 5CAAA 3SMZA 2MY8A 2YXLA 1KLNA 2C22A 4LRFA 2MMYA 3ZTRA 3PZPA 3OTCA 3M4XA 3HHLB 5J1EA 3SV4A 4XAKA 4F4ZA 2WB1D 1N5SA 1OYEA 2V4QA 2MHEA 1NKEA 2FZKB 1S59A 2ASLA 2HFUA 2XNQA 1RTIB 2XZDB 1HBMA 4K2XA 4DV2J 2J7KA 4ZITA 3MFHA 3LTOA 3SSSA 2B4UA 1H74A 2ZC3A 1GMWD 1L3SA 5RUBA 2GV1A 4IQMA 1HD0A 5KFFA 1RKJA 1HBNA 1NO8A 2YTCA 4BC7A 4NX9A 2JDJA 4BLGA 5LMNF 1N5YB 4E0DA 3H20A 3NKYA 1XK8A 1UW9A 1MMLA 3CDBA 1BUXA 5ETOA 1VC6A 4P2FA 2HYIB 5MAOA 5BYRA 3GFHA 1C2PA 1YJ7A 3BH7B 3MUMP 2B7BB 1RP5A 1NHVA 3UNYA 2ZHOA 3CD5A 2YWWA 1F3FA 4LF6F 2H4YB 4MJKA 3T1HJ 1S7HA 2HBYB 2MQLA 1XMQF 1JLAA 2BRLA 4N8NA 2ABYA 2DNPA 2M9KA 2VC1A 1UWAA 1UEKA 1WG5A 2RS2A 2LDYA 4DQPA 4A47A 2FC8A 3BBBA 1HBUB 1D9AA 2VKZG 2Y1LB 2WTFA 4QYZJ 4IO1A 2GJ2A 1SQGA 1VGYA 4QIGA 5F41A 3PXGa 2MKIA 3OL8A 4EZ6A 2VB6A 7FDRA 4DV5J 1XNQF 3X1LB 3WHIA 3ELHA 2Y8YA 5ETMA 2AEMA 4K8RA 4R0JA 2HHVA 1K47A 1KD1T 4LSZB 4ZVSB 2D74B 2B43A 2GIQA 4OX6A 2VQEF 3UR0A 1UPMB 3RR7A 1VIOA 4N56A 3L7UA 2BZ2A 2APOA 2HBRB 3G9CA 2I9SA 3ET6A 5C24B 3J7YU 3RB3A 4IYQA 5AJ3J 2ZEJA 4PG8A 2HLTA 2AEJA 2OD6A 1Y5LB 3CMQA 2ZBRA 4FYVB 1KQFB 3VALA 2MQQA 1VRUB 3QT5A 2VFTA 2E29A 4XPCA 5A8RB 3MEGA 5KFQA 1X0PA 4BC9A 1LK5A 2F4VJ 3HHNB 3GG0A 1BY9A 3SCLE 2DNOA 2YWFA 4MKAA 4EYHB 1UVNA 1S1UB 2EFOA 3W63A 3HI9A 2CWKA 3D1OA 3KUEA 2JVOA 3FC9A 1QAIA 3PY8A 3H5XA 3T5HA 1EQ0A 1PBUA 2C3OA 1AUSL 5J1EB 4YUDA 1OIAA 4OJ3A 1RWKB 5F8IA 2Z8QA 4XDCA 2VJUA 1NBEB 4KY3A 3T5JA 1FKAF 3MMCB 4IRKA 4JI3F 2AJQA 2DY1A 2COLA 3A8IA 3MUTP 5F8MA 3OV7A 3CJ3A 1RHQB 3RB0A 2UUAJ 2B5JA 5KFIA 1UMJA 4PWUA 3SDEB 4MMOA 2RDIA 1SQFA 2MKCA 4KO0A 1FD8A 4Q0BB 1Q8LA 1YZ7A 3OL6A 2PMWA 4MKVA 2Z2MA 3HHKA 3BN4A 3UD4P 4P75A 2AJFE 4PRFA 2QYCA 3H2VE 2R7VA 2YKPA 2NXCA 1RDRA 1PCAA 3V2UC 3Q2TC 4XTTA 3PJ9A 4OYOA 2YWGA 1CJKA 3IM9A 4LF8J 2HRYA 2K8GA 4CI0B 1KWMA 1PILA 1WHYA 1S57A 2GGPA 4LSNA 4PWWA 5KOWA 3S01A 1SXLA 5DGBA 2CZ4A 3FFIA 2ZKTA 2QL7B 4USJC 2H5EA 5KFKA 1N36J 1KS2A 4TQSA 2AKWB 3U02A 2FLLA 4LRDA 2W9CA 4C8LA 2XS7A 3PVXA 1J2VA 1F2HA 3D28A 4PG4A 4UQTA 3MMAB 4YFUA 1VQYA 3BQ0A 2HHUA 2VZ9A 2HFNA 1FRKA 4HT7A 5D0HA 5HBMA 1FF2A 3H7HB 3KDOA 3LP2A 3IFEA 3P5TL 3VGTA 4ES1A 2DR9A 2R2TA 2EVZA 3BN7A 2L9NA 1XR5A 1PAEX 2GX8A 4Y2IA 3DXBA 4JI5F 1BQMB 3T6BA 1OY8A 1S9GA 3GWCA 4KT0C 2XGPA 1HHSA 2JFKA 2RT3A 3ETOA 5THWA 3RZAA 2XMUA 4MYTA 4ANCA 1U4BA 3PKMA 3GQCA 1N8RT 2DH7A 2NSCA 3UCGA 1UJ5A 4ZOSA 3GIRA 1NDPA 4F02A 4R8UB 3OSPA 2HQIA 4NLTA 2LYVA 3HJVA 2HNDA 2K7JA 2UZAA 2CPJA 4AXIA 3MPDA 2LEBA 1L3TA 2QEXS 4IRCA 4WF9Q 1GT8A 2UXCJ 2DGWA 2KN4A 4X62J 1V3ZA 2IDEA 2I2YA 4G3IA 5B0CA 4DFKA 3KK1B 2VQFJ 3DGPB 2B4VA 3P96A 2BKOA 2DNRA 2HWHA 2VG5A 2R7RA 1OPIA 3UO0A 1QDUB 4N47A 3N4WA 4KHPF 4N8OA 2RUGA 4G1IA 2ASJA 1FRMA 3X3UA 1FDDA 3LGMA 3BO2A 1SBRA 4GKKF 1RWUA 3RG6A 4B08A 2XCPA 3NBPB 1WEXA 3C2PA 3KOAA 9RUBA 3OXGA 4J9RA 1QVGR 1KFDA 1KQSR 5EWEA 3H90A 4YY3J 5J2NA 1HNXJ 3ZZ0A 4KYZA 5KFSA 1SB6A 5HMZA 1S6OA 1D8ZA 2FJDB 3VAGA 3OBIA 2ZJPQ 1WTBA 1T03B 3MPVA 4NEZA 4ZPDA 4J9OA 4ILLA 1R0CB 2UUBJ 1RQ0A 3SDEA 1KONA 2J0XA 3C15A 3LP1A 4I7FA 4UTGA 2GVZA 4RNFA 5HL7Q 4Q0BA 2FVPA 1XJWB 3LUYA 4FP9A 3RW7A 1Q8KA 4A48A 4X4PA 3M30A 2ALZA 5KFDA 1LWFB 2MB0B 2DHXA 2AP6A 2IAJA 2DXFA 1FK9A 3RAMA 3FGVA 4FBUA 2F1FA 1ZH5A 2V8VA 3TAPA 3T9NA 5F8HA 2QL9B 4N7TA 2GGPB 3BDEA 2RQKA 3GJSB 2HVEA 5KG0A 2DNQA 2ZH5A 1S48A 4NLUA 3TI0A 5KFCA 2N7YA 3CSKA 4YR3A 3RBZA 4OI0A 4C7QA 3CC7S 1UP1A 2GMHA 6AT1B 4DQIA 3W65A 2GJFA 3DOKA 1T7PA 1NEEA 4U96A 1TL7B 2Q3PA 1IKXB 1SQEA 3TAMA 4EWTA 1N0UA 3KNGA 4OZJA 1F2GA 3Q22A 2W7OA 3KLVA 1FFSB 2Z2YB 3OXLA 4R0EA 4J5OA 4LSLA 3RU0A 4AUKA 2HGLA 1VJQA 2DEJA 1V5IB 2H54B 2PO4A 3D3BJ 4YDDB 2HZAA 4PUOB 3W3SA 3DLEB 1MLAA 3K8VA 5K14A 1S1WB 4KTQA 1U6ZA 2MZQA 2E5HA 3EVWA 5ETPA 4DPYA 5BXIA 1AFJA 4TXSA 4C2MA 2UP1A 5CZXA 1YLXA 1LFWA 2UUTA 3AB4B 5A0YB 3EYZA 1C1CB 3F73A 3KFWX 3TEHB 1DBDA 2LA4A 4JI1F 4GKJJ 2HHXA 1HBNB 4AFFA 3J7AN 3R5GA 4I6AA 1YRUA 3SSQA 1FTCA 2LA6A 5BYQA 5HQLA 3KUGA 3CIZA 1KC8T 1WJ9A 1RHJB 1Y3KA 1ZM4A 2DHGA 3NL0A 4N77A 1X5OA 2OUGA 4C8YA 1AZSB 1YRTA 2VG5B 3HHLA 2E7WA 4U8YA 2LEAA 3D5MA 2JLGA 2ROGA 4ATNA 1VQLS 4N76A 3PM9A 5IC6B 1JLQA 2VL1A 2YNHB 5KG6A 2ZM6J 5KFBA 1JLEB 3RUBL 1Q79A 4NLYA 5D4PA 1H7XA 4OZ0A 2RRNA 1MROA 2B9WA 5AE2A 3OR2A 3ILIA 1BWEA 2M70A 4KGMA 1S72S 4M5DB 4X64J 3IAM9 1FCAA 3GFYA 2R42A 2ATCB 2YX1A 1IN0A 2DRBA 4EO8A 2JX2A 2LU1A 4N41A 1EETB 2QO3A 2RSQA 4LJMA 4O3QA 4H4KA 2SXLA 3I9ZA 4NL5A 2DGXA 5CZVA 4IKAA 3TWZA 3OSNA 3M9OB 4NCBA 4U7UD 4JI7F 3LWLA 1JB0C 3OFEA 4ZJOA 2DGUA 1HI1A 1NJWA 4DR3F 3WX4A 3M7VA 1HI8A 1I1GA 1K1QA 5LSRA 4IFVA 2HS0A 4Y3CA 3DLGB 3UDLA 4DS5A 2B9EA 2LECA 1DQ8A 2J7WA 5D0GA 3W8GA 2YY3A 4B9VA 2HWIA 4CO2A 2LP4A 4ED6A 3QATA 3RRHA 1FD2A 1WELA 1RB0A 2MJNA 2ROEA 3T1AA 4WFYA 2AEFA 3N5BA 2IRUA 5A8RA 4DV4J 2G4BA 3FK4A 4CLSA 5IT9Y 1JLCA 1HPZB 1PJ7A 2CPEA 4CO1A 2QC3A 4ELUA 2H3EB 3UFCX 3BGUA 4DR1F 1Q95G 3DYAA 1S5ZA 4FDFA 2DYAA 2B6AB 3TA1A 3QSYB 2DR8A 4NLDA 3OHBA 1D9DA 2Q66A 1I94F 2EBGA 4LFBF 4ITSA 4RBVA 4OYPA 3ET6B 1UW4A 1RWMB 1KSPA 2VICA 2QL5B 2ACYA 3D6MB 2ZHAA 3OLAA 4BWMA 3R7NB 3DLJA 3V6JA 3TQ1A 5F3ZA 4DR5F 2LQ8A 4B3TJ 3C16A 1P9YA 1UVKA 1VRQC 3AOAA 1TVRB 3JS9A 1KEKA 5IT0A 2VBZA 2Z57B 2D41A 2V8PA 4MIWA 4NLPA 3GV8B 2ZH6A 1IXKA 3DLLQ 2QLXA 1ROFA 1RAFB 4UOFA 3EPIA 2HPUA 1XR7A 2JC0A 3MEDB 4FYXB 5AXMA 1IBKF 1VYAA 4DR7J 2MLYA 2ZITA 5KFVA 3RRGA 3DHXA 5C5JA 2RQMA 2MQ8A 2XMTA 2LCWA 1SJ3P 4C4WA 1Q0NA 3LWMA 1SIWB 3FCWA 3OFGA 3VTIA 1S0VA 3R27A 1MNEA 2HLUA 3GILA 3KLGA 3AODA 4JYAF 2V8GA 1YSJA 1S0MA 2E5GA 4FKXA 5L8RC 1FI4A 4M5DA 5D0RA 4ZVGA 2J9EA 3CDAA 1T9UA 2E5IA 2Y0BB 1Q7LB 3LO3A 5H9EJ 4K4ZA 3TUZC 3H0PA 5CCMA 3AFGA 2E1PA 2XI2A 4IG3A 3LP2B 4RUAA 1ACMB 1X4GA 2E7XA 2FVSA 3CCWA 3DM2A 5B0AA 1WWHA 2RRAA 2YKQA 3DMJA 4FN5A 2M0GB 1SH3A 1KNZA 2YNGB 3K5PA 4JYAJ 3HD1A 1J5OB 2F8HA 4CLWA 1VFJA 2X7IA 3R9LA 2J9CA 1FRJA 1U26A 1W2IA 2G0JA 2VBYA 4LF7J 2VJVA 2W4PA 4DZ6A 2MGZB 1DJ0A 1G6BA 1SL0A 2HNDB 2C3UA 1FX4A 2QTWA 1RT1B 1YBTA 1RWXB 4WXOA 2VFRA 1UVLA 3D66A 3WC2A 1UFWA 1KDNA 2ZH9A 5H9FK 2IRYA 1SUQB 1HWLA 2V63A 3PYGA 4DR5J 3ENWA 5L9XA 1R0AA 4B3TF 4NI2A 2PI4A 2FHKA 4F26A 3BBFA 1S4FA 4LR8A 2V2KA 2FD2A 2XI3A 4NWBA 3PYDA 4P52A 3KG0A 3Q8VA 1UETA 2AT1B 2HURA 2BANA 5KFJA 3QO9A 5F8NA 2F65A 4DU7A 1TKXB 4QOTA 4K4WA 4F4YA 2FY8A 4ID8A 4DR1J 3E01A 2R2SA 2C2OB 1U1NA 5EN1A 4KGVB 2EG1A 1VC0A 3TVYA 5KFZA 3LPYA 2GVZB 4DV3J 1DQ9A 2PFFB 2KDOA 1WSRA 4MTPA 2ZE2A 5T7LB 4C8MA 4QIVA 4DPTA 1RT5A 3ILLA 4QU6A 1QE1A 1KBRA 1H2VZ 2GHVC 3PRBA 2CNNB 2QJ3A 1HBOA 5J2QA 3BZQA 5DJBA 2OPPB 3GFXA 3BH6B 3GYGA 2H65B 4RW4B 3SV3A 4C97A 1B7YB 4C0BA 2V34A 3MM7A 2XZTB 2WW8A 4ZVRB 3JSMA 4ZHRB 2DR5A 5D15A 2B9XA 2YBVA 2W25A 1WOPA 3L7OA 2ZWPA 5KFUA 3Q89A 2QFJA 2V0NA 2A0FB 1CBKA 5C42B 4F50A 3QLHB 3KHRA 1RWNB 3K17A 3EMTA 4QWBA 3IRWP 3AD7C 1LV5A 4MIAA 1FERA 2LU2A 4QJVA 3CD6S 2WSFC 1IKXA 1HWJA 1Q8BA 3MMJA 3PDNA 3MTKA 3TAMB 1OSCA 2UV8A 3ZNUA 5EWGA 2G2ZA 1C4AA 3D1HA 4EBDA 2B4OA 4X64F 5GAEU 3DFEA 4WYLA 1FK9B 2ZJRQ 4P7TA 1VR6A 2CYYA 5T14A 3UD3P 4ZCIA 1AA1B 1YDLA 2FC9A 2BQRA 5D78A 2OKQA 1W26A 1WD6A 1RKIA 6FD1A 3MEKA 3H4BA 2XNRA 4DF8A 3OQ2A 2NREA 4P2XA 4R5PB 3W9IA 4KRWA 3EGWB 1VK8A 4BS2A 4Q2LA 4QW9A 2HGMA 4C3LA 1F3VA 1HQUB 4RUCA 4S0MA 1TL7A 2YX7A 1H72C 2CVEA 4LBPA 4YEAA 5ADZA 1XC9A 2DEIA 4O3SA 1UWBA 3GSIA 4G1PA 1TL3B 3A12A 4F0KA 2KT2A 1NPPA 1RT3B 2PGCA 3O3LA 3EZUA 4LSLB 4RKUC 2HVDA 3DU5A 4N5SA 1HHTP 2D3O1 4XIUA 1BD6A 4FF3A 3R1LA 4OYMA 1LNQA 3QSIA 5H9FJ 2YNHA 3HVTA 3C3LA 1QSLA 4CZCA 1DTTA 4F4AA 2P6SA 1WC3A 3IR7B 3UD5A 3J80U 1CC8A 3QZ8A 1NMEB 1Y5NB 5IQ6A 2Z2ZA 4ILRA 4ICLB 4LF9F 3F0NA 3A13A 3LGNA 1NK5A 1UFKA 5KFRA 4PZVA 1EETA 3MF5A 1S1XA 3NS5A 4GO5X 2BJDA 2L9DA 2WAQD 1XNQJ 2J76E 5CXTA 3EVOA 5LL6d 4OYZA 4CLUA 5KG3A 3KK3B 5KT4A 1JLQB 1XWLA 2C2NA 1O0PA 2XSJB 1VS3A 2EC2A 4O0NA 1NHKL 3FZBA 1Z4UA 1ZPVA 4WJBA 4YDXA 2RD5C 5L39A 2D3ZA 3PKYA 1K73T 3AJDA 1XMQJ 1F9EB 2H5JB 4Y0FA 2XB2D 3AJ2A 2AHOB 4QWEA 4RX6A 2LXUA 1CVJA 1AB8A 1Y5IB 2GHWA 4C8ZA 1N6QA 4IFYB 1X31C 1RTHA 2IM0A 5CA5A 2NSBA 3WBZA 1D3WA 1C0TB 1HW8A 2DHHA 4HTJA 5AE1A 2GZOA 5SUHA 2AQ4A 1I6JA 3HKWA 2UUBF 4NE9C 3I87A 1NLKL 2YNIB 1RT6B 2FQQB 2MSTA 4ETXA 2BE7D 3KLHB 1FJGJ 4PQUA 4IFVB 4A8YA 4C98A 1TKTA 2GIRA 5C25B 2CQBA 3HZEA 3KWMA 1DFDA 1EX8A 2CQCA 3D9BA 1NKBA 4CNYA 1IKWA 4YB1P 4DV2F 2YQ3A 4OI2A 2R7SA 4GKKJ 4PQAA 7FD1A 1U1LA 2CFXA 2QMXA 4ED8A 2BJ8A 1DAXA 2P9CA 3JYTA 1YJNS 1T9TA 4W92B 1U09A 1FVSA 4U8VA 3M2UA 4ECRA 1ICEB 3D0GE 2AU0A 4UY8T 3FCHA 1HQUA 2VQFF 1J5EF 2F40A 2JVRA 2E7VA 2ZKUA 2ALYB 2NXUA 4A8XA 4X62F 5L1JA 2IMWP 4LFAF 4DR6F 5HANA 1H2TZ 2DTJA 5L1IA 3P49B 4ED0A 2JLFA 1NJIT 1VCTA 2BE2A 5L1LA 1ZYQA 1N34J 2MZTA 2A6OA 2YKNB 2KHDA 1M5HA 1UJ6A 2N3OA 2VBXA 5KFMA 3QRPA 2QE5A 2KRBA 8RUCA 4J9QA 8AT1B 3C14B 1FE4A 2UVWA 2D69A 1DTTB 5B0DA 2XWXA 2GO9A 1TU0B 2O1PA 9ATCB 2BR0A 1X4CA 2RQ4A 4JI5J 2E5LJ 1GMUA 2PMHA 3V4IA 4LF1A 4L73A 2AWZA 1VBKA 4DX6A 3HMJG 4ZS6A 4NA1A 3VVUA 5DDPC 2BW7A 5CH7B 1K44A 2DKOB 3HFZB 3KG1A 3QQCD 4JI4F 3MAAB 1SJ4P 3TYTA 4O44B 3FMWA 3MM6A 3KMQA 5CD4H 3R2CJ 3R5AA 1D0EA 2WVDA 4OZ3A 5L46A 1X4EA 1KP6A 4M1KA 2V8HA 4CM0A 1HBMB 1ZZNA 4HLBA 3VHQA 2JEGA 2IC3B 3R2DJ 2W2NP 4V19J 4F8RA 4JI2F 3HO1A 5DZ6A 1JLBA 3QGPA 4ECVA 2UUWA 3TR5A 3OLBA 1RGVA 3M2RB 1U49A 2XSFA 3POTB 3QJPA 3NAHA 4QBUA 1TKZA 2V50A 1NSPA 2HRTA 2YKMB 4CO3A 5A2QU 4PCQA 3SQOP 5IZHA 3NGDA 3THVA 3ISND 2QT7A 3GLJA 3UVJA 3K5NA 2AYEA 2EC0A 3MR3A 3BO3A 4O3NA 5C2GA 3NGSA 3M9NB 2IVYA 2UUCJ 3NMRA 3CJKA 2HEKA 2WOMB 2EXUA 4NZ6A 5DO2A 3WDOA 5DLFA 2E5JA 1VQOS 3US5A 3CW2C 4X65J 3BQ1A 4HEA9 4NRTA 3Q86A 2BDPA 1GXTA 4DXLA 3R5BA 1PKUA 2PSZA 4QQBA 2CVIA 3HX9A 2UVUA 2NYHA 3IMQJ 4TLQA 3BPSP 2Y3YA 3ZFVA 4J37A 3HSZA 1T94A 3VAKA 1CS4A 3T1YJ 2GW8A 4PWDB 5BJRA 4J9MA 4FS1A 2M8HA 3HM9A 3RBDA 2V2QA 2DNNA 2XEXA 1FWKA 1HA1A 1OWXA 4KGZB 5CYJA 3S8SA 4LT6A 4ZPVR 1H73A 2ZE2B 4QPXA 1RT5B 3OL7A 4C0OC 2UXDJ 5K8NA 2RMLA 2WSCC 4ZP9A 1WHXA 1F9HA 2LXIA 2ZUGA 4L74A 3O2IA 3ETMA 4YN3B 5AJ3F 4MK7A 1T9WA 2MDAA 3MI7X 3IS9B 3EPGA 1TK0A 2BUNA 4MT1A 1P8GA 2R8GA 1NJYA 2YKOA 2BANB 2KYZA 3HD2A 4NYOA 4RW7A 2EFVA 1X8DA 4M5NA 3CF5Q 3PX0A 2JFDA 2PA3A 3QT8A 4H54A 3SCKE 3BB5A 4P7VA 3FEYB 5CYQB 1RT7B 2ATLA 3FSYA 3NOGA 4TYAA 2KO1A 1YWXA 2DVIA 4DV5F 4HHJA 3W2WB 4DCPB 4O0IA 5LMUF 3MXHP 3CT9A 3T6JA 2HQFA 3MAAA 1QE1B 4P74A 2IJFA 2W9BA 2E1CA 2XYPB 1S76D 2BM1A 3A3OB 2DCUB 4I64A 4LR7A 4DN9A 2EPIA 3EUNA 5A8KA 2ILYA 1R8CA 1Q86T 1JX4A 4L75A 1MU2A 3B4DA 1I5OB 2W4DA 1FKPA 3MMCA 4JI6F 1SC4B 4ZPWR 5F8LA 5KFEA 2FVRA 4OX8A 2RU3A 1MN7A 1RWWB 2HFZA 4LF6J 2E66A 3OTBA 2HGNA 3UN2A 3MWBA 3GIKA 4C8KA 4DWIA 2JWNA 1BQNA 3ZZRA 2AF6A 1OMSA 4Q43A 3J7A1 1TZ0A 1RU2A 5GAHI 3POTA 3MPYA 3QGIA 5LMNJ 4DV1J 1DARA 2EFPA 4LVOP 2DITA 4PG7A 4M5JA 1PIEA 3DXSX 1U1QA 2EBEA 2DK2A 3JAMU 2WVEA 3D6FB 1RAIB 4MIBA 3G87A 2NPFA 3GV7B 3DLKA 5IFMA 5E3CA 3IG1A 1TQLA 3K5LA 1NKCA 2IM2A 5B08A 4JBCA 1JNZB 4QIEA 4HDHA 3HULA 1U1RA 1YTYA 1WI6A 5ETTA 5GAEI 5K9FA 3EXCX 5K8OA 3H5YA 3MMAA 3B54A 4KBIA 3NGUA 4A8MP 4ICLA 3CTRA 3TJAA 1CPZA 5ITHA 1XMOJ 3FBBA 1H0HB 2I6WA 2DPJA 3BPDA 2ZZTA 3K0JA 1S6PB 3ULHA 3DGPA 1X7VA 4ES3A 4HI1A 2ASYA 3MM8A 2A18A 1VQ5S 3E3XA 5KFYA 4C8OA 4RBUA 4GVBB 3ISNC 2L9WA 4NXNJ 1RXOB 4OX7A 2QA4S 3I5BA 1K1SA 4TU7A 3DI6B 3SYZA 3CMES 2E1AA 3N6MA 4KHMA 3H42A 1UZHA 5GAGU 2HQGA 3ZTQA 4ZVHA 4QR0A 4I2QA 5D4NA 3IWXA 2R8IA 3FSXA 2GO8A 1IM4A 3IBFB 3LANA 2H1YA 5D4OA 4ECWA 1N5YA 2LQ5A 1F5BA 1B0TA 2BYCA 2PDAA 4IDKA 3MD3A 4WFNQ 4J9NA 3C15B 3GYNA 3LP1B 4RPFA 2R7QA 2JJ4D 2A1BA 2ACMA 4H4KC 1S79A 4RJVA 2KFZA 3BEGB 2HZCA 1SC1B 1T9VA 2YPYA 3OUYB 1B70B 1LWEB 4DSJA 4DL3A 3QAEA 4Z37A 3CJ2A 5BYSA 4M8LA 1KN6A 3GJQB 1H2UX 3IR6B 4QPTA 7AT1B 1IBMF 1IKWB 1FRHA 2HBQB 4WWSA 3QT6A 2KJWA 3V6HA 1FXRA 3QMQA 5F0UA 5DG9A 2KG1A 1RTHB 2OEMA 2WVCA 2XBPA 2V67A 4PXDA 1SV5B 3DOLB 2Y1RI 1RBAA 1U6FA 1YJRA 3LF0A 5I3PA 1IKVB 2N4CA 5JVGQ 1NZAA 1S1UA 3MEEB 3VAHA 1FXDA 4HKQA 3CIMA 3K57A 4LUBA 2IAJB 4ZVFA 1S1TB 3ZZPA 4HYKA 2KM8C 2BE2B 2BVZA 2HHTA 1X4BA 4L76A 1U2RA 2I5JA 5KG2A 3BSOA 3DLEA 4B17A 5CD4A 5HVHA 4U7CA 3DHWC 2XHWA 4FXDA 4TLRA 3I0SA 4B3SJ 5HVFA 1JJCB 4DZDA 3P8BB 3VV2B 2F8EX 2RIJA 5IC4B 1JJ4A 1WKKA 1RACB 2CWXA 3HVAA 4P6QA 4J9SA 2ZZNA 1R31A 3CUNA 1RTDB 4NCGA 1LXNA 3V4MA 3Q8RB 4DUYJ 2G9OA 4B9LA 4IR9A 4OZ5A 4FXVA 1WSVA 3L3CA 1IR0A 2ZH1A 2CQ1A 4YOEA 4YS2A 3CXCR 3LPEA 2C3YA 3IXQA 1AZSA 3KK2B 2ZVSA 4WP9A 3PR4A 1IVZA 4NASA 4OYXA 4ZVEA 3PW7A 5K14B 2GNKA 1YVFA 2N7CA 5ETKA 3TX0A 5HROA 3QJJA 1VJWA 2FYXA 4AYBD 2GCFA 4RW8A 3W5YA 3Q8UA 4UUWA 1D8YA 4JI6J 3ZTOA 2PI5A 4UZBA 2IC3A 1X0FA 2LMIA 2DH9A 3QRQA 1WF0A 1V3SA 2C1EB 4QW8A 5KFXA 3W5ZA 2X1FA 4ZMMA 1N88A 4Q44A 3O5TB 3CB4A 4OI6A 2C28A 5KT3A 2BBEA 1FJCA 4DV6F 2CZ9A 1Q81T 3HLUA 1RE1B 3BYRA 3H8YA 4RW9A 3TX8A 4KQZA 2QMUB 2RNEA 4XDDA 4DUTA 4ZLLA 5J1PA 3EVMA 3UVJB 2XMWA 3PW0A 2ERRA 5GADI 5M2UA 5KFLA 3CCJS 4YB7A 5DLGA 5D3GA 2MY7A 5IXUA 3CJKB 1ZTTA 4DSKA 3MR2A 3KNAA 1WHVA 4QR1A 4KC5A 3DLGA 5E3AA 2C2KB 3NCRA 3ZZYA 4WZMA 3CCSS 1C0UA 2O67A 3TW0A 2W9CB 4K5SA 2ZH8A 1IBLJ 2WCXA 4R8UA 3AJ1A 1IWAA 3C46A 2KKHA 3IGNA 2CPXA 2UXDF 2FJEB 5I4MA 5KFNA 3J7ZT 2GAGC 4TKTA 2JEJA 1WI8A 4ECYA 2YVSA 2HHPA 3ILJA 3CD7A 4ZIWA 2W8LA 2X3DA 3DYAB 1BQMA 2ILZA 2P6TA 2PIIA 2VV5A 5A76A 3R5DA 3OJUA 2QLFB 3BGFA 3BQ2A 1HNZF 4C6AA 2VOOA 3ZZZA 2BJ3A 2DXEA 1AUDA 5B09A 2HAIA 4X65F 1O51A 1YJTA 4RW7B 5D4LA 2YWKA 4KR0B 4CH7A 3MCOA 3AA8A 1BGXT 2N4DA 2QX0A 1N4LA 4LIWA 5AT1B 3ZO7A 3JTPA 1JXEA 3IGVA 3QIPB 4DUZJ 1UA0A 4D3GA 4DCJB 4WTOB 4DV0J 3TARA 2M8DB 1VQMS 5I3UB 2BOAA 4NCGB 3JQKA 1R8BA 1ZAXA 1B4SA 5HMWA 4B3MJ 1DHMA 1V9OA 1VLOA 2OPRA 3M30B 1KR4A 2JRSA 4KFBB 3F44A 4U95A 3K59A 3VZHA 2BJ7A 5B0GA 2IHR1 2NXJA 3F56A 1WC6A 3M2VB 4WXWA 3M8WA 4M5LA 4OJ1A 3GB0A 1DZ5A 1RI7A 2EFGA 1KKHA 3TZYA 1FJEB 3TRGA 1H6KX 1RISA 2WW4A 4O4GB 2VC0A 2RKIA 4CTAA 3CCMS 3FQLA 3NLCA 2XMAA 1AFIA 2HNZA 2FJXA 4LFCF 4ZDNA 4DL5A 2VFVA 3A3NB 3MEDA 2A10A 4USKA 5IQQA 2KHCA 3FEZA 4LF4J 3ZZOA 1GTHA 2ZWOA 4OMFG 4WK3A 1X5SA 3K7RA 1N48A 1TR0A 1RTJA 3DMJB 1NSAA 4NLWA 4Q45A 1NUEA 2ZBCA 3TJ8A 2KT5A 1R8PA 1VMBA 3PEJA 4RW6B 3RTVA 2KVQE 3PW4A 2ROPA 1HYSB 4X4TA 1AROP 3CDWA 1C1CA 2D9OA 2JNJA 4O4RA 3DRSB 3OVAA 4LF4F 2G13A 4Q2MA 1RHKB 4CRJA 1Y9OA 1JMTA 2X1BA 4IG3B 4DCOB 5L9NA 3M1VA 4LFAJ 4ID5A 1V6HA 1TMMA 2V5HG 4JV5F 1RT2B 3A8JA 5T41A 4P2MA 4CQ1A 2RF2A 3DGVA 2XHCA 3M6WA 3I5CA 3ZTPA 2OPSB 4DX5A 1RWPB 4USIA 4CNZA 1O8BA 2V2VA 4YHHJ 3Q8SB 1HQEB 3FVYA 3OPKA 1D1UA 4B9UA 1S0OA 3BYPA 3J7Z5 3FSIA 2GJIA 2CJXB 4XPEA 2XMKA 4BHQA 3VZIA 1NDLA 1RAOA 4ZCKA 2F5GA 3GZ7A 1BMQB 1MMNA 1WORA 2MQNA 4JB8B 3M32A 3IBWA 4XK8C 2ZJQQ 3NAIA 4CLYA 1M5PC 1NHUA 3FDSA 3O44A 2CA9A 3IRXB 3TA2A 2XYHB 2HK3A 3R6GB 4I68A 4J9KA 4DLGA 1SC6A 3BSAA 2DNZA 2OGUA 2KU7A 5J2MB 3CJ5A 1S10A 4NI2B 2Q6BA 3CJRA 1LWCB 4NZ0A 2PC6A 1YBUA 3AQOA 4RO0A 4CLTA 1OQ3A 2HAFA 4I69A 5IV4A 1K0VA 2GQCA 2CUYA 4USMA 2V94A 4PPDA 4Y6IA 1U47A 1T9YA 3OTDA 3OR2B 5KAKA 2AGQA 2J0WA 2NCKL 1FTRA 3B78A 4I2QB 1N56A 4HT5A 2BOPA 2R8KA 5D0EA 2WBRA 2FGCA 1FKOB 1A6LA 1S6UA 2D9PA 3Q83A 5FJ4A 1RU1A 3CDUA 2DT9A 2GQ2A 3FNNA 4O4GA 2RHSB 1TL1A 3N79A 4WP3A 1RBLA 3UR3C 3OJSA 3GPAA 1ZAWA 1RA7A 1HPZA 5EHHA 4F2RA 1N0VC 4KV8A 3NNHA 5T7LA 1IKVA 3CEDA 3MEEA 3ZZUA 3WQPA 4DFMA 4ES2A 1LFPA 3A8KA 2HG4A 2NLWA 4CCHA 2FHJA 2Z4PA 3L4BC 4J7CA 5B0BA 2HS4A 1S77D 4IG0A 2A6MA 3N6LA 4RW6A 3I0SB 2OO4A 3QBCA 3W66A 2AZ3A 3EDRB 1TFYA 1HHQA 3ENVA 3QLHA 4MKBA 4K4XA 3NWGA 3P6YC 2CNKB 4ZN3A 5DQGA 2QYGA 4WIQA 4C11A 1S49A 3DRRA 1IBLF 3HDSA 1RTDA 2DH8A 4OV1A 3R5CA 4AXJA 1VBYA 4J9LA 1UWBB 3GU0A 3GTYX 3M1VB 4EMDA 2B6AA 4UOHA 4KHRA 4ID5B 4DG1A 3PCOB 3QIDA 4ENOA 3PO5A 3VAMA 2AYGA 3NNCA 2RH3A 4CT8A 3KLEA 4NLXA 4K0KJ 4HH0A 2IY5B 2RF2B 3UE2A 5FLXY 4YMEA 3N0VA 2AJ4A 4RZRA 4GMKA 3MTJA 5HROB 4FPRA 3VAJA 5HP1B 4X4RA 3OVSA 3T41A 1S9FA 4R5PA 4K4SA 1KVKA 3WX8A 2CQGA 3BF4A 2DJWA 3UDCA 1WNEA 2VU5A 3KJQB 5HJXA 2XMVA 2HHSA 4WZQA 4ED3A 2Z0GA 5B7WA 4ED2A 2CQ0A 3J81U 3TO8A 1YG0A 1KHVA 5KOXA 5IWAJ 2XLKA 1WEYA 4HR2A 1YJVA 2YQ1A 3Q24A 2VONA 1FEEA 1XQIA 2FLOA 4P71A 3DRXA 1E6YA 3Q0AA 3OVBA 1PO6A 4M5GA 2EG2A 3SFUA 4H4MA 1EQMA 2GFFA 4RNNA 3SI8A 4U6PA 5D6GA 2PD1A 1MMDA 1ZZFA 2XSJA 3B6BA 1NPRA 1RAAB 1T9XA 2FY1A 4M5IA 3E2EA 3PHTA 3KLGB 3TANA 4DR2F 1B99A 1PYOB 3PJWA 2E1MC 3GONA 3IC1A 4PG5A 1WC1A 1HI0P 1VQKS 1JXVA 2CIMA 1FKOA 4PXEA 3HVWA 1HQ2A 1Q78A 2PA8D 3GR1A 3I96A 3CGIA 3BGOP 4P9SA 2DRAA 5ETQA 4U67Q 2IJNA 4NRUA 1M1HA 4P72A 4UY85 1UCNA 4ZCLA 4UOCA 1VQ9S 5F9NA 2IA0A 1QVFR 1HNVB 3IO1A 4WKYA 4PYDA 1TL5A 3VGUA 4CH0S 4A8WA 4IO9Q 4ER8A 3LA0A 5KG1A 4NA2A 4DDFA 4FVCA 1ZETA 2ZDOA 3MMBB 2MLXA 4A46A 4B3RJ 2MSSA 3QRRA 1QTMA 1C0UB 2FLPA 1P9QC 4F3QA 2NXEA 3PX6A 3FMBA 4X4NA 4XO0A 4ED7A 4IOBA 3N9UC 3NS6A 5GADU 3VR1A 2KXHA 4OHYA 3T19A 1OJ4A 1YZ6A 3G71S 1MWZA 2UV8G 3EX7B 2OPQB 3M2UB 2R8JA 4QCLA 1BHNA 4EGLA 2QIFA 3DRRB 3SXLA 2OIHA 2V69A 1SUQA 1VDHA 1WHWA 1GNKA 2J9DA 3NNAA 1U8WA 2VKRA 3NCQA 4DR4J 1EP4A 2Y9HA 3M8YA 3SIPB 2RB7A 4OYWA 5C25A 4MAKA 2ZH7A 1VQ8S 2NR0A 1A9NB 1YKWA 4OLPA 1MWYA 1M1KT 2R3VA 3G6VA 2ZH3A 5F8JA 5AXKA 4DEZA 2MPUA 2WK4A 1F1BB 1LK7A 5K8MA 2AJ2A 4PYAA 1XBWA 2VPZB 3GMGA 1RA6A 2C3MA 4USUA 5D77A 1WOSA 1SKSA 2RDJA 1GMVA 4DS4A 1SL1A 4F4KA 2Z30B 3AT1B 4Z7CA 2CXEA 2VFSA 1MWQA 3P5BP 2WHOA 5HMXA 3W1YC 1XMOF 4KJIA 3BR9A 1NH8A 4O44A 4NMLA 2P2CB 3HHDA 1KTVA 5J2QB 4WU3A 1XN9A 1RT4B 3DDIA 3KKFA 1RAEB 3K89A 4RW4A 2V6AA 3CCZA 1RHMB 3EGZA 3JXOA 1WKJA 2YPZA 4MK9A 1OPZA 3D1QA 1LW0A 2CQ2A 3PG9A 3PO4A 5HQMA 4X4QA 1P1LA 4Y28C 2H5IB 1FVQA 2LXFA 3MDFA 4UUXA 4KO0B 2UVVA 1NSKL 1Z1ZA 4EK2A 4LR9A 4DV1F 4NMXA 3TVKA 4Q8EA 2PEBA 4OL8A 4J90A 2IYGA 2H51B 2BM0A 1FWLA 2DISA 5KFAA 2YH1A 1EIYB 1TKZB 1WACA 2VG6B 1S6QA 3W60A 1RWVB 3BGRA 3J81j 4F3OA 1ITPA 3LAKA 4OI4A 3HFKA 4F2SA 4DL0C 1PSDA 5EX0A 2IVFB 1Q4RA 2YNFA 4IRDA 2VUGA 2VDIA 3ENAA 4JV0A 3EM1A 3AXKA 1RABB 1WUUA 2G0CA 2M52A 3QFWA 1XNRJ 1PJ6A 3FRZA 1KVJA 1HQEA 1GAOA 1JIHA 2W2PP 3HVTB 2W4CA 1JKHA 4I2PA 2GMLA 1AW0A 1U1PA 1ZM2A 4U9RA
chains in the Genus database with same CATH topology
1A7GE 4C9DA 2FIUA 1B0PA 2HVIA 2MKKA 1S99A 3AB2B 4DMZA 2HVZA 2R7OA 1N54B 4M94A 2OPQA 3HF5A 2R4FA 3GE9A 1TP7A 5DM6Q 1P6TA 2HW3A 5AXNA 1AXQA 4QWDA 1Y4ZB 3V81A 2VH7A 2C2DA 4X2BA 5LSOA 4HH1A 1VHFA 2WOMA 5GVQA 2M7SA 3UWTA 2MQOA 1FESA 2E9RX 1H98A 6FDRA 3GIIA 4I0WA 4MK8A 2X51A 3U1NA 4O3OA 5HLFA 2NYIA 2MXYA 4HVZA 4USHA 1XMBA 4TY8A 2JEFA 2DIUA 2FJBB 3IWLA 4IH6A 4NYZA 2RQCA 4X84A 1BLUA 2M4MA 5H1SV 4PWDA 4ZPBA 1UJ4A 2FHMA 1NB7A 2KM8B 4K5RA 2IA6A 2FVCA 1GX6A 1N52B 2F9JA 1JLGB 4I1TA 3PHEA 1FXLA 2FHJD 1OQ6A 4W90B 2FLNA 5A8KB 1HNWF 4X4OA 1KRPA 1UL3A 2IBKA 1N5TA 5E33A 1VBZA 3OFHA 5E7OB 5J2NB 5LXYA 2R9LA 4FS2A 1HWUA 2ZM6F 2CPDA 2UUCF 3U1LA 2R7TA 1B0VA 1REVB 1RT7A 2A2CA 4NYPA 3H40A 1GX5A 2FHOB 3MGJA 2V9WA 1SH2A 1BQNB 4NZ7A 1C0TA 1NRKA 2VG7B 3EGNA 2JC1A 1RJJA 5IM0B 4DLEA 2DR7A 1LWFA 1RT6A 3SZ2A 2VG6A 1UFLA 3BGRB 3LALA 5EWFA 1KLMA 2AW0A 4KKOB 5CYMA 1ZM3A 2CQ3A 2PMZD 1UA1A 3QPIA 4DQQA 2FB0A 2W7AA 2L3MA 3DOMA 3U27A 4UW2A 3M6UA 3RB6A 2E9TA 5E5NA 2D3UA 1SJ1A 3JYTB 2HHHF 1N32F 1K0TA 2RU9A 4PPZA 2KH9A 1FNMA 3LOUA 3DOKB 3GSDA 2DNLA 3ZC4A 3TOQA 2FTRA 1VRTA 1H7WA 4Y2MA 1G1XA 3F41A 4KE5A 5I42B 2JEIA 1TV6B 1YQHA 3PR5B 3H25A 2DPIA 2EI5A 2ZD1B 3Q23A 1T02A 2J7UA 3H2UB 5CCLA 3H5XA 4FZVA 2QMWA 4JI8F 3I4HX 4DV7F 2LQJA 3MZIA 4OJGA 2ADBA 3PFEA 3FEXB 3L7PA 5A0YA 3UCUP 2V4JA 1DQAA 2DGSA 2D3OR 1N34F 2NZ4A 2GQQA 4TU9A 4LMZA 3HK2A 2YH0A 1HW9A 4F3MA 4B9NA 4NPOA 4EUVA 4IDKB 5DQIA 4ECQA 5E41A 4GC6A 4IUFA 2Z2LA 2W7PA 4B3OA 3M8RA 4A8SA 4H4MB 4JUZA 2KVIA 1XR6A 3N28A 2LKZA 5CHCB 3TVZA 1N48A 3VCDA 2CJ9A 2ZFHA 2BQUA 1JLEA 2A2DA 2QZ8A 5AE3A 1HNXF 4RBTA 4DL4A 4NLVA 1DTQB 3I4PA 5FDLB 1FJGF 1QSSA 3L09A 1L3UA 1V3RA 2VBWA 3KYLA 1M5VC 4DSEA 3DRPB 2AJ0A 3QWPA 2PT0A 4RU2A 3MCSA 3MAQA 1FEHA 5KG4A 4UQGA 2L41A 3M6XA 1U25A 1LQ9A 5KT2A 2E9ZA 3PV8A 3CVKA 1SJRA 1X5PA 1RYSA 2UXCF 4OLOA 3I0RB 3MOZA 4R25A 3KHHA 1CSJA 4OIXA 5G4DA 5HQ8A 1WG4A 2U2FA 5GAHU 3VAFA 4HDGA 3V6DA 2VODA 3JTNA 4X66F 2FUG9 5A8WB 3I31A 4ZPTR 4C3KA 3L95X 3HVRA 2OTJS 1C4CA 4LVNP 1KVIA 1JLCB 1YRXA 4LQ3A 2IMOA 1FE0A 1HD1A 2F7VA 2B3TB 1FT8A 2K1RB 3MPWA 1S0NA 2IVMA 2L48A 5DM7Q 3KK2A 2OLWA 5IT4A 3DC2A 3ENQA 4DQSA 1WEZA 1M5SA 4WYWA 1N36F 3J7YI 4NLSA 3SEOA 3TA0A 2B7CB 2KI2A 4OZ1A 1LW0B 4OQJA 4MFBB 3UCZP 1GTEA 1S9EA 4L3NA 5JJBA 2BW2A 1YI2S 2CQ4A 3W2WA 3N01A 4Y2KA 2DHSA 1QLNA 1L5UA 1W2BR 1HMVA 2LLZA 5KT6A 1IUJA 4RNOA 4ECUA 2HNYB 3W7BA 1UEVA 4WE1A 3BM7A 4GO7X 4B3OB 1VQPS 2MZSA 1YJWS 3CO9A 3MR5A 2DIVA 1U1KA 1Q7YT 4ECXA 2UUAF 1U1OA 4H4OA 4RNMA 4FF4A 1NK0A 1J5OA 5DDQC 2XMJA 1SI9A 1X4FA 2VFUA 5A6WA 2V9KA 3WZ0A 2MYFA 3AQPA 3THTA 4MYUA 2AX0A 4AL5A 1N33F 1VQ7S 2MKSA 1DLOA 3W2VA 2HVHA 1TAUA 1UKUA 4LIRA 4IOCQ 1S6PA 2F8MA 2DGQA 2QSWA 3IAS9 3TAQA 1UVMA 2N82B 5J2PA 1ELOA 3MM8B 3PIPQ 4DL7A 1B64A 5BR8F 1YBAA 2F4VF 5D3GB 3G6YA 1ULRA 2CJAA 2XY5A 3SQGB 3FRYA 3BS9A 2Q79A 4DSIA 2C2RA 1JKHB 2WONB 3IR5B 4ZP7A 3NRBA 1JK9B 5C24A 1RYRA 1HR0F 4M63A 2DO0A 3C8YA 2J5AA 5A8WA 1U1MA 3KJVB 4A4JA 2DGOA 2PE8A 4WKRA 3M8QB 5A6PA 4O3RA 3JSRA 4DV3F 3KTQA 4ELTA 3M8PA 3NCPA 2OSQA 1OS5A 3K2YA 4AQYF 2Q43A 2CRLA 3KLFB 4AL6A 1NU4A 2RRBA 2VPWB 1K9MT 5E3QA 4YP3A 3MHYA 1CLFA 2HRUA 3GYXB 3FQKA 4YB5A 2YKAA 1QAJA 1UVJA 3QO9B 4ZHRA 1NK9A 3LP0B 4JV2A 1IJEB 1FNXH 3AHPA 2FDNA 3ONQA 3PFOA 1REVA 3BGLA 4FVMA 2RKIB 5I3QA 1VK3A 1T3NA 4K4UA 3JB9k 3P3DA 2JH3A 3MR6A 2LEPA 2J6TA 3CDEA 3I6PA 4Y65A 1HWIA 1KOOA 3HPOA 2QA4G 3VAIA 4EYIB 1YHQS 3HJFA 1P27B 4ZA1A 3R3TA 2HNYA 1H3DA 1NH7A 2IYIA 3CCQS 1KQGB 2ZOMA 1D9FA 1S1TA 1FRIA 1KLMB 1R8AA 1YGYA 3CC2S 4LF7F 2DB1A 4KPYA 2OMLA 2MZ1A 3CCUS 3AAWB 3FZ2A 3AA9A 3HZGA 3MD1A 1HYSA 5C42A 3GFZA 1Y3JA 1Q82T 3EXYA 1VC5A 1E6VA 1R7IA 1WF1A 2O3DA 2DNMA 1VLYA 4EO6A 2BXJA 2P9EA 4CO5A 3HT3A 3I56S 3E51A 1RT3A 2WSEC 3OW2R 3OHAA 1FRLA 1WF2A 2ZH4A 1CEZA 4RLEA 5IS2A 3RAXA 1S9GB 2R2UA 1IQZA 3SQGA 2NPIA 3DN9A 3OFFA 3MM9B 2KYXA 4EFAC 2ZC4A 2WONA 4TYBA 3Q8QB 3CPWR 2KZMA 4L72B 1LW2B 2V4JB 2J9DE 4DR7F 4DL2A 2ZDPA 1QAXA 2BABA 5M2RA 4DR4F 4CH1A 2I38A 5E2QA 2MJUA 3KK1A 3RAQA 1XTZA 2RS8A 4KAIA 5G0RA 5K5MA 2JZ5A 5KG7A 2OTLS 4NLRA 2K3KA 3AY0A 3BR8A 4FYDA 1M0SA 5HN0A 2NQPA 3IWNC 1BC6A 1Y7PA 1FNOA 4Y2CA 2QV6A 3I55S 2KZZA 1U24A 1JLAB 3RYLA 1VIXA 4B3RF 1DTQA 2O01C 5FDLA 3PW2A 2AX1A 3G4SS 3H59A 4DN0A 4F4WA 3U7JA 1FDNA 1T03A 4TU8A 4QIWD 3MUVP 4LF5F 3I32A 1TL1B 1HL6A 2X1AA 2O66A 3T5LA 4KGKA 2GMJA 2QSFA 3RRKA 1U7LA 3VQTA 5HO4A 2K7KA 3T5KA 1X5TA 4DV4F 2XS2A 2R7WA 3CCTA 1Y0HA 4OX9F 4DHVA 3QWUA 4PXBA 1HNIA 3E8OA 2LQBA 1XERA 1YJ9S 2FJVA 3JTOA 3D54A 3MFIA 2MQMA 2CPZA 4NCAA 4IG0B 1HBUA 4ALZA 4BWJA 2YX4A 2MQPA 3RW6A 1G2EA 1VRUA 2KXNB 2W9AA 4IFYA 3KLIA 1NJXA 4NLGA 4CIOA 2ADCA 2CJKA 2IBOA 4MKYA 1B7FA 2CPFA 2MHNA 3C66A 2K1RA 4DG1B 1UEUA 2KFYA 2R7XA 1FDBA 1PGZA 1IKYA 3S7RA