1VQPS

The structure of the transition state analogue "rap" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 22
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vqpS00
2RRBA 2RQCA 1VQ8S 2E5JA 2MKSA 5BJRA 2XB2D 4C0OC 1DRZA 2LEAA 2YH1A 3VAIA 1VBZA 2L08A 3PIPQ 4QU6A 5H1SV 2DISA 2MQPA 1A9NB 2LXIA 2MY8A 1AUDA 2OTJS 2LCWA 5DDOC 1S72S 3MXHP 1X4DA 1U6BA 2UP1A 1VBYA 3L3CA 1IQTA 2E5HA 2VONA 3ZZYA 4UQTA 3NS6A 3G9CA 4U67Q 1JJHA 2FC8A 5DM7Q 4ZKAA 3CC2S 3VF0B 2DGTA 2GO9A 3TP2A 2FPHX 5GADU 1YIJS 2EK6A 2JVRA 2LYVA 2MB0B 3UD4P 3VAKA 1M5VC 2F9DA 3IWNC 1WHVA 2CPDA 2CQ2A 2G0CA 1VC5A 2WBRA 1JJ2R 3NMRA 2A3JA 1HL6A 3S7RA 3CCJS 4FXVA 1WWHA 1FJCA 2GHPA 1VQMS 2RT3A 3MUVP 1WTBA 1ZH5A 2MZQA 3CMAS 1VC6A 2MSTA 3IRWP 2RRAA 1OPIA 3EX7B 2CQ3A 4TU7A 1U1NA 1QVGR 2QEXS 2I38A 1VQPS 5DETA 1X4HA 2PE8A 2V94A 2CQGA 2DGOA 4PR6A 2J76E 3JB9k 1N52B 1G2EA 2XSFA 1D8ZA 2DB1A 2LQ5A 2F3JA 2DNOA 2KXHA 2D3OR 5D77A 2YH0A 2N82B 3G71S 1VQNS 3HHNB 2MQLA 5D78A 4Y0FA 1KOOA 4F26A 4IOAQ 5IQQA 1R8HA 1X4CA 2DGUA 1X5SA 2MKHA 2HGNA 4LIRA 2DNYA 1H2VZ 2DNMA 4QU7A 4C4WA 1H6KX 3NNAA 2M52A 3CCMS 1WI8A 2LKZA 2MQQA 1VBXA 1VQ9S 2M8DB 3ULHA 2DHSA 3S8SA 3TYTA 2CJKA 3MOJB 1O0PA 4UY8T 3THPA 1VQLS 2YTCA 3BEGB 4ERDA 2CQBA 3Q2TC 3CC4S 4TU8A 3H2VE 2KU7A 3BO2A 2JWNA 1WEYA 1M5KC 2M8HA 2HGMA 2MGZB 3FEYB 2RUGA 3MI7X 3HI9A 4YB1P 2VODA 2MKCA 2RS2A 2CPEA 5CA5A 5LSLA 3CF5Q 2FY1A 4IO9Q 4QPTA 2ERRA 4OZ0A 4F02A 2N3OA 1DZ5A 2B0GA 1WF0A 3I55S 3P6YC 1Q82T 2M9KA 2DNGA 3G4SS 4FXWA 1U1QA 2E44A 2DO4A 1JJ4A 3CTRA 2MXYA 2HGLA 2DHXA 3G6ES 2XS5A 2MZ1A 2CPJA 1VQOS 5JVGQ 2BOPA 1YHQS 2D9OA 2CQHA 2N3LA 2LMIA 1WF2A 2ZJQQ 3CD6S 2MJNA 1NJIT 2KI2A 2CPZA 1H2UX 1D9AA 2E5GA 2L41A 2X1GA 5LJ5Y 5GAEU 1UAWA 2M88A 1VQ6S 3P5TL 2KFYA 1SJ4P 2DNQA 4WIIA 2CQIA 1VQ7S 2DITA 3MD3A 2OIHA 3S6EA 3R27A 1WHWA 2CQPA 2DGXA 2JX2A 1VQ4S 2DHAA 5MLCV 1CVJA 2QA4S 3BO4A 4TLQA 1FO1A 4WF9Q 3VALA 2XNQA 2CPFA 5LJ3Y 1RK8A 3J7YU 1F9FA 5IFMA 2DNLA 2RNEA 1X4GA 2MMYA 3OW2R 4OZ1A 2MKIA 4IOCQ 4W92B 5ITHA 2N7CA 1WI6A 1N88A 1N54B 1WF1A 2LA4A 3THTA 2LECA 1WG4A 4IUFA 1WHXA 1KQSR 3FEXB 3B4MA 1YJ9S 2X1AA 1SJ3P 2XS2A 4Y00A 3MUMP 3LQVA 3CULA 3G96A 2OJ3A 1WEZA 1RKJA 1X5OA 2M2BA 3DLLQ 4C7QA 2DIUA 4PRFA 2DNZA 4P6QA 2DH8A 2M7SA 1B7FA 3LPYA 3ZZZA 2KXNB 2KG0A 2AYGA 2VOOA 3P49B 1WG5A 3MURP 4CQ1A 1OIAA 2KVIA 1HD0A 3BS9A 5CXTA 3SDEB 2RVJA 1QM9A 2MSSA 2SXLA 3G8SA 2M70A 2OTLS 3SMZA 2KHCA 5DDPC 4A8XA 1U1MA 1OO0B 2DH7A 2DGQA 2JVOA 2DIVA 3U1LA 3K0JA 1S79A 2KH9A 3G8TA 1FNXH 1K73T 2AYMA 3MUTP 1NO8A 2LXUA 2DGWA 4RU2A 2MZRA 2RS8A 1ZZFA 3CUNA 2J0QD 1VC0A 1FXLA 1R8PA 5HO4A 2JRSA 2AYEA 2MKKA 4PKDB 5HL7Q 1A7GE 1XN9A 2KXFA 2KN4A 2D9PA 3R1HA 3SDEA 3CCSS 2LEBA 2MQMA 3P3DA 1NU4A 1KD1T 2MZTA 2E5IA 2CPYA 1P1TA 3UCUP 1U1OA 2DO0A 3CMES 4V19X 4F25A 2MGZA 1DHMA 1H2TZ 4WFBQ 4TU9A 2OSRA 2ADBA 1HD1A 1U2FA 2ZJPQ 1HA1A 2DGVA 2CQCA 2MZJA 1WELA 3SXLA 3RW6A 1UP1A 2DHGA 2DNHA 4EGLA 4WFNQ 3CCES 2DNKA 2DNRA 1FT8A 2KRBA 4CIOA 2KG1A 2K8GA 2AYBA 5EN1A 2KYXA 3D2WA 1KC8T 5LXRA 3N9UC 3CC7S 2DGSA 3MDFA 2X1BA 4J5OA 1X4AA 3UD3P 5DM6Q 3VAGA 1PO6A 4QQBA 1N8RT 4WFAQ 2MKJA 2U1AA 2EK1A 1Q86T 1WEXA 1SJRA 2DH9A 1X5TA 2CPIA 2MZSA 5GMKa 3CCRS 3S01A 2EVZA 2G1DA 2XNRA 3CCQS 2MPUA 1FJEB 1M90T 1X5PA 2J0SD 3H2UB 4CH0S 1U1PA 3EGNA 2NLWA 4WCEQ 1P27B 1BY9A 5GVQA 2O3DA 3EGZA 2MQNA 1VQ5S 3UE2A 2XS7A 2LA6A 2M0GB 2RQ4A 1URNA 1KOHA 3UCGA 4YOEA 2KT5A 2HZCA 5LXYA 1WG1A 5GAGU 2KM8B 2CQ4A 1Q81T 2MQOA 1X0FA 4YUDA 2MHNA 1YTYA 3CPWR 1K8AT 1YJWS 2I2YA 3NNHA 2YKAA 2CPXA 2DNPA 3DXBA 2KRRA 2YWKA 2CQDA 2ADCA 1SXLA 1X4FA 1VQKS 3UCZP 2HVZA 3UWTA 2U2FA 3J7ZT 1K9MT 5IM0A 4M5DB 1W2BR 1UFWA 2DK2A 5IM0B 2RU3A 1M5PC 1JMTA 1U1RA 1YI2S 3TO8A 4Z2XA 1L3KA 1M5OC 3MD1A 2BZ2A 1ZZNA 3CCVS 4CH1A 4LMZA 3VAMA 3U1MA 3BO3A 5JVHQ 1SJQA 1PGZA 2OSQA 1DBDA 1WHYA 2CQ0A 1FHTA 3NS5A 2G4BA 3VAFA 4BS2A 3RW7A 4W90B 5CYJA 1OWXA 2QFJA 3R1LA 2HYIB 3V4MA 2ZJRQ 2PEHA 1YITS 2F9JA 1U6FA 1M1KT 1X4BA 2MY7A 1YWXA 2MYFA 5LSOA 2FC9A 2J8AA 1U1KA 3NNCA 5DDRC 2CPHA 4ED5A 2X1FA 1FJ7A 2Q79A 5DDQC 3VAJA 3B4DA 1YJNS 2M4MA 5GAHU 1Q7YT 2DNNA 2L9WA 3Q2SC 3VAHA 4WKRA 3CXCR 4LJMA 2KM8C 3I56S 2AD9A 5FJ4A 1U1LA 1UW4A 2NZ4A 3CCLS 2FHOB 2K3KA 1SJFA 2MJUA 3US5A 1QVFR 2VOPA 1X4EA 3PIOQ 2CQ1A 3CCUS
chains in the Genus database with same CATH superfamily
1S1UB 5F8JA 1EQ0A 5FDLA 1RAEB 3A3OB 4L74A 1JLCA 1N32F 3GP9A 4N8NA 2HPUA 1U47A 1HBOA 1DRZA 1PC5A 4DFPA 2LEAA 3KK1B 2YH1A 3AD9C 3VAIA 1VBZA 4FF1A 3GILA 1VR6A 4CLLA 3D3CJ 2R7OA 5J2NB 2XHWA 5KFTA 1Q5YA 4ID5B 5H1SV 5HROB 2GAGC 2YNGB 4RW6B 3QBCA 4QWBA 2FY8A 2H54B 2MQPA 3ZFVA 2HHVA 4LRDA 2MY8A 4JI6J 1VRUA 2ZH4A 3TW0A 4NLDA 3MFIA 2OTJS 3Q22A 4DR7J 2NQPA 2WSFC 2DRBA 5C25B 3FBFA 1PIEA 2VFSA 5H9EK 3W9JA 1WUUA 2DCUB 2IRXA 4WFYA 1ICEB 2HNYA 3AD7C 5C42A 5IT9Y 2R8HA 2J5AA 3C46A 4P75A 1TL7A 4WP3A 2NXUA 2XULA 2A2CA 5CD4H 4UQTA 2BJ8A 1HNZF 4JV5J 1G1XA 3G9CA 2JH3A 4LRCA 5CABA 1S6OA 2C2DA 3IXQA 1RT7A 4NLXA 4NI2B 3HO1A 2W8KA 2RF2B 3Q8PB 3Q8QB 3CC2S 4LBPA 4K0KJ 2R7TA 4PEOA 2XZWA 4I56A 2QA4G 2DGTA 5ETKA 3IC1A 4MIBA 2GAHC 5GADU 2YPYA 4EBDA 2WVBA 3UD4P 1U1PA 1M5VC 5J2QA 3RBEA 2XMVA 2R7UA 3DM2A 1B7YB 4MKBA 3ENVA 3NMRA 1KQGB 5F8GA 2JC0A 2FVPA 4UOFA 4QWDA 1RBAA 1RWWB 2GMHA 4DV7J 3RRGA 2GNKA 4H4MA 1PBAA 2XWYA 1WOPA 4C8NA 3FZBA 5J1EB 2A2DA 3BKFA 1TVRB 4FKYA 1ZH5A 2GHWA 2MZQA 2OPQB 2EFVA 1BQNA 2IAJA 2QT7A 1VC6A 2C3OA 2JEGA 4Q0BA 1HWUA 1REVB 5IXUA 1DQ8A 2KKHA 4HTJA 2YWWA 5T7LB 3VGUA 4J9SA 5DETA 1X4HA 2HIYA 2PE8A 2V94A 4OYXA 2UV8A 3ZTQA 1KFSA 1RQ0A 4PXDA 3MZIA 3HVTA 3KLIB 3HKZD 2ACMA 2ZITA 2AIRB 3NOCA 5FIIA 3ZNJ1 1AXQA 3K17A 1VK3A 1N32J 5CQGA 1NPPA 2Z4PA 3MPDA 2DR8A 1D8ZA 1UZDA 2LQ5A 4L72B 3OL8A 1B0VA 2F3JA 3T5KA 3QAEA 4ED6A 5KFQA 3QJJA 3G71S 3MPYA 4X4OA 5KFAA 2N4DA 2IVYA 5D78A 2ZWOA 2PA8D 3NAHA 4Y0FA 3CIZA 2C3YA 2HIQA 5CYQB 3IR7B 2G0JA 4PG7A 4F26A 2EG2A 4HTIA 4M95A 1K1SA 3CJSA 3OL9A 2HNDA 2DGUA 1FRXA 1WTFA 2KYZA 3KUHA 4ZCKA 1VMBA 1RT6A 2HGNA 4C9DA 2BA9A 2FZGB 1H2VZ 1MMDA 3IWXA 2R7QA 2V2KA 2QLWA 2VC0A 1UWBA 3QT6A 3PACA 4HEA9 5G0RA 4ED8A 4ID5A 1LWFB 1RT5B 1TKTA 2LKZA 1LQ9A 1VBXA 1NDCA 2FVRA 1FNMA 3MMCA 2M8DB 2DHSA 4YY3F 3C14B 3DLKA 1KLMB 4UY8T 4PWDB 2ZBIA 2D3O1 2V8GA 3JTPA 3LA0A 3Q2TC 3I0SB 3CC4S 3PEJA 4P10A 3E3XA 4TU8A 3RRHA 2AEMA 4JI4F 4IG3A 1R6VA 2YY3A 5A8KA 1ROFA 3GFZA 1JJCB 3QYYA 4YDXA 5ETVA 1RYSA 3N28A 4BC7A 3GPAA 3NGUA 2K06A 4NRUA 1KSPA 3W5YA 2NUHA 5D0HA 2VODA 4PRFA 4IDKB 3TA1A 3M7VA 1OYEA 4F4XA 1HNIA 2D74B 4ES1A 1NXIA 2RS2A 5CA5A 4G1QB 2HK2A 1LWEA 1S1WA 1QE1B 2RH3A 4J9PA 1HR0F 4DQPA 4OZ0A 4ITSA 3CDAA 5EHHA 4M1KA 1APSA 1N0UA 5LM7E 1UVJA 4WKYA 1RLCL 5J2QB 3I55S 1JLGA 3GR0A 1G4CA 3OUYA 4IKAA 2HS4A 2HBZB 2ZEJA 3UR0A 4GC6A 4CLWA 4MK7A 3DLJA 3UQSA 1HQUB 1RWNB 2O01C 4HH1A 3G4SS 2V2VA 1H0HB 2HQIA 3C6UA 3G82B 4FXWA 5E33A 4NYPA 1NEEA 1U1QA 4KH1B 2WAQD 2DO4A 1R8BA 4RR5A 2J6UA 1MU2B 1RWXB 3IBCB 3CTRA 3RU0A 4DV3J 4B3MJ 1RT2A 2R2TA 2QE5A 2AZ1A 2HGLA 1EKRA 2VASA 3FSXA 4LFAJ 3OJUA 2OD6A 1VQOS 4I2QA 2BOPA 3BV8A 2UUCJ 2V4QA 2D9OA 4CCHA 2CG8A 2DY1A 1WF2A 1FDNA 1R0CB 3W61A 3JYTB 2ZJQQ 2BACA 2ROEA 3R6LB 4L76A 2DY9A 3AHPA 3WX8A 1D9AA 1YRTA 4FYVB 3Q8RB 2P2CB 4WK3A 2K7KA 4DX8H 5AXNA 1TL1B 2W2NP 3HD2A 4K2XA 1S0MA 3P5TL 1TL5A 4JI7J 4GO7X 4ZITA 1T9WA 4X66J 4DUZJ 4DCOB 1EETA 4LF2A 1FD2A 4WIIA 4MIAA 4DPYA 2GCFA 3GONA 3MD3A 4ZP9A 2E9ZA 2B7CB 4MK8A 2JX2A 5HN0A 4M94A 3T3FA 5MLCV 5IC6B 1AZSA 3BPSP 5EDWA 4UZCA 3LAMA 4TQRA 2B56A 1HNWJ 4ECZA 2KT2A 1VRQC 1FO1A 3A13A 4PYDA 3VALA 1HNXJ 2CPFA 4OHZA 5IWAF 4K4ZA 1GFWB 1RK8A 3QGIA 3W5XA 4FXDA 2RQKA 1RHJB 5IFMA 5C42B 3AOCA 1O6XA 3D7SB 3R5DA 1E6YB 2HQCA 5KG4A 5CH7B 4OX9J 2NS1B 2J9EA 4QW9A 3QIPB 3P4UB 4NLSA 2BQRA 1GH8A 2PN6A 3SCJE 4ZVGA 4USUA 1WI6A 1N88A 2CVIA 4AE5A 1N54B 2YKPA 2LA4A 4K59A 4M5KA 4UT4A 3HT3A 1RTDA 2YNIA 2EKYA 2BJ7A 5IOLA 1S12A 1WHXA 4J9KA 3B4MA 1YJ9S 4DG1B 4MAKA 2ZE2A 3JSYA 1A6LA 4MYUA 4JV1A 3CULA 2BEFA 4CO2A 2ZOGA 4LT6A 3G96A 4B9VA 2PIIA 3WDOA 4DR4F 1RTHB 1TL3A 1UZHA 2V9KA 3O3LA 5ETNA 4C3LA 5F8IA 4EFAC 1KTQA 1U0HA 2FUG9 4UQGA 1XMOJ 2FJBB 4RW8A 4G1QA 3HX9A 3Q8YA 1ZM3A 2COLA 2XG8A 4WTYA 3J7YI 1PBUA 2DR7A 3P49B 2DPJA 2I5JB 4O3SA 3DN9A 4CQ1A 1LK7A 3IGNA 5KFGA 4B3TF 3GCXP 2B9WA 2EBGA 2KVIA 3WIUA 2ZUGA 4AYBD 4DV2F 1FX4A 1NCLA 1ZETA 1PYSB 3K89A 4ED3A 3IM8A 2C2EA 4DV5J 5CYQA 5CXTA 3MEEB 2RVJA 3NY0A 4MMOA 3VGSA 5F8HA 2AV5A 2B6AA 4QCLA 3AH6A 3CMQA 2M70A 4DR1F 1QSYA 1W26A 4P71A 3P8BB 2OTLS 3DC2A 4Q8EA 4X62J 3QIDA 2NSCA 5A8RA 3MAQA 4LIWA 4JI7F 1S77D 3DMJB 2JVOA 3DHWC 2KFNA 2UVWA 2HAIA 3TUPA 2EWHA 2ZBCA 4LR9A 4EUVA 5IT0A 4J9OA 3SSSA 3QJPA 1U45A 1O8BA 2PI5A 2EC0A 3MUTP 2QL5B 1Y5IB 1RKIA 2YNFA 4H4MB 3VQTA 2V9WA 2LXUA 3MTJA 5CYMA 1HNVB 2L3MA 3IO1A 4FDFA 1T9UA 1HIYA 1RWOB 1YDLA 2MZRA 2YNHA 4N47A 2NPFA 3WX4A 3Q8UA 1REVA 2QYCA 2B4PA 4EMDA 4MJKA 2QSFA 1ELOA 2Z56B 5J1NA 3QRQA 5ETRA 3X3UA 4TNOA 2FVQA 1NHUA 3ZNUA 5HO4A 4DN0A 1DLOB 2D3UA 2ILZA 3MPWA 3O1LA 3VWSA 2IC3B 3GSDA 3MM8B 2R2SA 4YEAA 3T1HJ 1FNOA 2AYEA 1RAIB 2VBYA 3VZIA 5DQHA 4UOHA 4DV1J 4IQMA 1IKXA 4KGVB 1A7GE 4GKJJ 3DLGB 1IKYB 1KLNA 3AXMA 4YMEA 1Z4UA 1NK0A 4NA2A 3QT8A 4OJHA 3SDEA 1J27A 4NZ0A 5E41A 3MM5B 2XYGB 2CKWA 3CW2C 3JXOA 1RACB 4CTAA 3C16B 4KV8B 4NYOA 2V8VA 4OHXA 5AXMA 1HNIB 1UCNA 1DARA 2E5IA 2MKYA 2MZTA 2OPRB 3BGFA 1VIOA 5E3AA 3DRSA 4FF4A 2NSBA 3UR3C 4IRCA 5JMNA 4KIAA 4N56A 3CMES 4LBHA 2E66A 5KT3A 1AFJA 4LREA 1S48A 4OX6A 5EWFA 4WFBQ 1TUGB 3PYFA 4QWEA 1MW7A 2IPOB 1HA1A 1WC0A 1WACA 1S4EA 2N7YA 2YNFB 1RE1B 1XWLA 3BR9A 4PQAA 1RAHB 5F0WA 4LSLA 4BWJA 1UETA 3CJKB 2W9CA 4OI4A 1LW2A 3NCPA 5E3PA 3RTVA 4RPFA 4ILMA 3G82A 2GGPB 3C14A 3DLKB 3EWGA 3QQCD 2WBMA 4OX7A 2Y9HA 4RBVA 2DHGA 2DNHA 1F5AA 5F8LA 3IRXB 5B0AA 2DNKA 4LFCJ 1HQEA 3GTYX 2DNRA 4CIOA 2K8GA 5K14A 1F1BB 4A47A 4CI0B 5BR8J 1U1KA 3ELHA 1KC8T 3I82A 3N9UC 2V4RA 4KBIA 1Y4ZB 2OPSB 2DGSA 1S9GB 2VA3A 1VLYA 1V6HA 4RZRA 3UD3P 4DS4A 3PHTA 1ZAVA 1FX2A 2BW2A 3BH7B 3T6JA 3I6PA 4DL3A 4HACB 3CIMA 5A76A 2IVMA 5KFDA 3HHLB 2AGPA 2W1BA 1HBUB 3BKTA 3R6GB 4RW4B 1PYTA 3KYLA 5L8RC 1X5TA 2FHJA 1Z2ZA 2BJ9A 4IH6A 4NWBA 5C24A 2JOQA 3S01A 4NMXA 1FK9B 2A18A 2EPIA 3H98A 1GMUA 3IRXA 4CO4A 2PT0A 1GTEA 2G1DA 3BGUA 4I0WA 2XNRA 3U02A 3R7BB 2BW7A 1N6QA 4EWTA 1WKKA 4XPCA 3VR1A 1FRJA 1GK8A 1KBRA 1YRUA 2RKIA 3JSBA 3MCSA 4NLYA 2BKOA 5KFUA 3EYZA 4C8KA 3BZQA 4GKJF 1BY9A 2XMUA 2DYAA 5GVQA 2O3DA 3EGZA 1BUXA 2HURA 3ENWA 2AJ2A 1Y3KA 3J80Y 1VQ5S 3O44A 4RW4A 4F50A 3ZTPA 2VD3A 4ID8A 2AEFA 5FLXY 1I5OB 2ZHOA 2KDOA 3R5CA 3SQOP 2XLIA 1QSSA 4OI2A 4X84A 3UCGA 4YOEA 2ABYA 1S1XB 3MM6A 3NLCA 5LXYA 1DTTB 2BV3A 4G1PA 1Q79A 4L6V3 3BYRA 2IHR1 2KM8B 2W4CA 2BM1A 2WOMA 3I5CA 3NWGA 4KPCA 1EAYC 3DOLA 1TMJA 2GIQA 3EDRB 4H54A 3SSQA 4YUDA 1YTYA 2YQ3A 3C3LA 2OKQA 3MECA 1EP4B 2I2YA 1U26A 3H90A 3MAHA 4ELTA 3OLAA 3DXBA 2HK3A 2HNZA 2F8EX 3OVAA 4DPOA 2KRRA 2OD4A 2P9EA 2RILA 3EZ5A 2ADCA 3IG1A 4EI2A 2PFDA 4CLZA 3CO0P 4DX6A 1F3VA 2X3DA 3I4HX 3MM6B 4RL1A 5KFZA 5HVGA 4DR5J 4JI3F 1VQKS 2K1RB 2OPQA 3S1TA 3QNWB 1QTNB 1QUVA 2PDAA 1Y11A 3HCXA 3NWRA 1RB0A 5ETQA 3TVKA 5IM0A 3Q8SB 4TVAB 4O44B 5HBMB 2ZBRA 3OTDA 2ZH1A 1VISA 1YI2S 2CADA 2GVZB 4K4WA 2VQFJ 4M5JA 4NLPA 4O4RA 1RWMB 3R9LA 2G0IA 3E01A 3KK3A 2HNYB 2A6MA 2YKNB 3MD1A 4DSEA 1QTMA 2FLNA 4G3IA 1GMVA 3DLEB 2BZ2A 1HNVA 3D3BJ 4P73A 3W2VA 4LF4J 2PFFB 4LMZA 2O1PA 2YNHB 3DLBA 1X0PA 4FNHA 1SJQA 3GZ7A 3R5JB 3RZAA 3VGVA 1PGZA 2RF2A 4O3OA 3ENAA 1DBDA 4I4BA 2VBZA 4NCGB 4JV0A 4B9UA 1FHTA 1NH7A 3AJDA 3KUEA 3NS5A 4Q2MA 3SIPB 3VAFA 3OR2B 5L38A 3R8YA 3MEGA 4UOCA 4WIQA 4KQZA 5KFXA 5CYJA 1OWXA 5KFWA 3HT0A 2CUYA 5KOXA 2JL9A 3V4MA 1RZMA 2BE9B 2EBEA 3ENQA 5CD4A 1HMVB 2NPIA 2BKNA 3HHKA 1ZA2B 4P7TA 1NZ8A 3WHIA 4PG8A 2C3PA 5F3ZA 2MYFA 3I96A 1RU1A 2Y1RI 4F8RA 2FJAB 4DR2F 1HARA 2YPZA 3M6VA 1UPMB 3MMCB 3VQSA 4CLFA 1KN6A 3MPUB 2POKA 3HM9A 4ZJQA 4KGZB 2F1FA 2NXJA 3G6VA 3HK2A 1RBOB 1KVKA 1X7VA 3GCWP 4ANEA 1Q7YT 5KT7A 4NLVA 1S1XA 1M1KT 3W7BA 5J1EA 1UTAA 2UUBJ 5DGBA 2HEKA 3K59A 2NXEA 1FVQA 3GB0A 2IMOA 2PD1A 3I56S 5A6PA 5IV4A 2GVDA 3BGRA 3H5YA 2VQEJ 3PX6A 3TA2A 1OS5A 2FHOB 2WVCA 2K3KA 4K5SA 2IFXA 8RUCA 1S0VA 1MWZA 5J2MA 3GV8B 2FVCA 4USJC 4JI3J 4Q8FA 4OLPA 1JLBB 2YX7A 3SV3A 4NCGA 3T1YJ 4CO5A 5KFEA 4X65J 1H7XA 2HNDB 4EU0A 2JDJA 1H98A 3ZTSA 1NSPA 1N36J 2DEJA 2RRBA 4NLWA 2DTJA 3I5AA 1WORA 4ZS6A 2RQCA 2E5JA 2MKSA 3HHEA 3H42A 1VQ8S 4J9RA 2UVUA 1E6VA 2XB2D 1RT4A 4HKQA 2IJFA 4C0OC 5K14B 2ZHAA 1IKXB 2QGFB 3GV7B 1S97A 1T03A 3I9ZA 3BBCA 3HD1A 4PWWA 4AL5A 3NBPA 4RNHA 1VK8A 5HJXA 4MKYA 5IT9U 5E7OB 4KTQA 6FD1A 1FE0A 5DDOC 3CNQP 2B5JA 1FERA 1H7WA 4QR0A 3Q23A 4GVBA 1Q7LB 2LP4A 2CNKB 4B9SA 4ECUA 1Y3JA 3PJWA 4FYYB 2CJBA 4EBEA 2VG7B 4IQXA 2VG6A 4PQUB 1NK8A 2UP1A 4ZVPB 1VBYA 1MWYA 2CIMA 2RRNA 2E5HA 3L3CA 4P52A 2CJYB 2VONA 3ZZYA 4W4MA 5F9LA 3OR1A 4U67Q 2Z8QA 2ZFHA 4U96A 3TZZA 2E5LJ 3OVBA 4ZKAA 4K4TA 1RT7B 1EKSA 2DR5A 1S6QA 5KFNA 4KFBA 3T9NA 3TP2A 2FPHX 2MB0B 1IJFB 2EK6A 2LYVA 4CNYA 4CLUA 3M9MB 5THWA 2Y0BB 3Q0AA 1FFWB 4ZN3A 2F9DA 4PXCA 2J0WA 1EARA 3DXSX 4ZK7M 3M2VB 3G6YA 2JLEA 5FLXU 2UUAF 2AQ4A 1JWWA 3BSAA 1LK5A 1HL6A 4J37A 4RBUA 1X9MA 1GMWD 2K2PA 1F60B 4I2PA 4OZNA 3S7RA 1P9QC 2FZCB 3TEHB 4CLKA 3OHBA 2BQ3A 4BDPA 4M5GA 1EB0A 2W8LA 1T05A 1RU2A 1UJ5A 1HBNB 3BSOA 2YNGA 2BOAA 2RRAA 3ICLA 2XM3A 4EZ6A 4N76A 1SVDA 1U1NA 2BABA 4WYWA 2I38A 4ECRA 1IBMJ 1LW0B 2HW3A 1JLGB 4QIFA 1SH0A 2CQGA 4EYIB 2WW4A 1SJ3P 1X31C 2J76E 2Y1IA 1N6QB 1BD6A 3AODA 3IBFB 3L9ZA 4RWWA 5K20B 1D0EA 3AXKA 6AT1B 2HMIA 3TRGA 1HNWF 5AJ3F 2V34A 3G6XA 1XR6A 5KFLA 5T41A 2M5YA 1XERA 2KVQE 4JI2F 2YWHA 2D3OR 4DF4A 4NLTA 3A8KA 2OEJA 2FHKA 4XDDA 4DV0F 2LQJA 4ZCMA 5JXSA 2KFZA 1R31A 3HF5A 4QR1A 4CRJA 2PGCA 4KKOB 1KLMA 2B7BB 5IQQA 3FJ2A 4N41A 3PKMA 1T3OA 4J9UE 2C2RA 2H5EA 4USKA 5HMYA 2ATLA 1S10A 2WONB 3EGWB 4LIRA 4ZLPA 2VPWB 2DNYA 3V4IA 1CSJA 2F7VA 3NS7B 4OZ3A 4RUBA 4JV2A 5LMUJ 1N56A 1FJGJ 4EO6A 4CLYA 3MM9A 4GKKJ 3DRPA 3CCMS 2I9SA 2KJWA 4WK1A 1J5OA 3J7AN 4DR4J 1OY8A 4PAAA 3DFEA 4A8SA 3LO3A 3ULHA 3MOJB 4V1Ak 1YKWA 3J81Y 2AGOA 5K8MA 2OP5A 3BDPA 3I4PA 1KTVA 2FHMA 2YTCA 4DUYF 1RT3B 2FTRA 4YR2A 3T5JA 3IFEA 1S9GA 4NX9A 2ZM6J 3KLFA 3TQ1A 3JTOA 1N5QA 1WC3A 2WSCC 4IFYB 2G2OA 4OI3A 1HBMB 2KU7A 2WW8A 4RX6A 2WK4A 3L7PA 3M8RA 1M5KC 2M8HA 1Y5NB 3J81U 3W60A 4OX8A 3MI7X 4ES3A 3PKYA 2LDIA 4PCQA 3CJ5A 4YB1P 3C15A 5DG7A 2Y1JA 1Y00A 3FQLA 5GMEA 4A8YA 2HWIA 2CPEA 3M6WA 3NGKA 4DXLA 4OYMA 4V19J 3M2RB 2LQBA 4P2MA 1OSCA 3DNCA 3KDOA 4WFZA 5LSLA 2FY1A 4DR7F 2ERRA 5C2CA 4PABA 2N3OA 1MN9A 1OY9A 1QJHA 1VJQA 1WF0A 1FDDA 1S7HA 4X4PA 5A2QU 1XNQF 3H40A 1YLXA 3W64A 3W3SA 5KFVA 5L39A 5KFCA 4C8ZA 2UZAA 5HJYA 3TOQA 2DNGA 3MEDA 1H74A 4WU3A 3K57A 4X2BA 5I3PA 1NB7A 3AJ1A 2E1RA 2W2PP 4Q45A 3MM7A 4MH8A 3JSRA 3M32B 4U95A 4L3NA 3M30B 3QRRA 3H4DA 2XMWA 3LP0A 5AE2A 1JJ4A 1BLUA 1NAQA 3B82A 4K50A 3EGVA 1OMSA 1FFGB 2DHXA 3BBFA 4M5HA 3PRBA 3BN7A 1KNZA 1DTQB 2CPJA 4DV0J 4ZPAA 4KHPF 1VGYA 4G1IA 3D6TB 4WBFA 4KGKA 3OHAA 1R43A 1RAGB 2J7KA 2IJNA 3DI6B 2J6TA 2HFOA 1RAOA 1AFIA 2C2OB 3N01A 1LFWA 3KJVB 1NJIT 2CPZA 1I51B 2JLFA 2QX0A 3GJRB 2AMCB 2E29A 4M63A 1QAYA 2BE2A 4DQIA 4Q0BB 4ZMMA 4GKKF 3FUYA 1BGXT 1T9VA 5GAEU 4AL7A 4R25A 1T9YA 2HNZB 2KFYA 2DNQA 3FSIA 1ZTWA 2DITA 2OIHA 3R27A 4Q2LA 1QAXA 2ZVIA 3MMAB 4PZVA 1VQ4S 1HYSB 2HWHA 4MKVA 3NGTA 1RTJA 2OHDA 3QO9B 1PAUB 4AXJA 1GEHA 2QYGA 1FF2A 4WF9Q 9RUBA 1JQGA 1U48A 2XYHB 1FRMA 1F9FA 3K8WA 5LSRA 3RB0A 1RHKB 1K0VA 1Q1KA 3WC2A 2CDRB 1PILA 1RADB 1XIQA 2QMXA 3OW2R 3SV4A 1N33J 2MKIA 4IOCQ 5D3GA 3W8PA 2N7CA 5ETMA 3Q24A 4ECXA 4YS2A 3THTA 2LECA 1WG4A 1N5YB 5E0OA 4URGA 3UO0A 1KQSR 3OVSA 4LF8F 1RJJA 2IBOA 1FWLA 3BJYA 3TR5A 3UDLA 1JLFB 1V3SA 2CZ4A 3MUMP 4ED2A 2ZE2B 2GVDB 1WEZA 3BGRB 5BYRA 5KG5A 1FJ7A 3T1YF 2M2BA 4YY3J 2HHSA 4ANDA 4MFBA 1M5SA 1AUSL 1UEKA 3M2RA 3DYAA 1SQEA 1YK9A 4RW8B 2FJVA 2DH8A 1HMVA 2WTFA 1WD6A 1B7FA 2ZH7A 2VG5A 1WJ9A 3GJTB 4F3OA 3GQCA 4ED0A 3FCVA 3BF4A 3LPYA 5KT5A 1FXRA 4ZJOA 2KG0A 3K5LA 4NZ7A 4U8VA 4NCBA 2ZC3A 1OIAA 4DUTA 3QGGA 1Q8LA 3SEOA 1EX8A 2EXUA 1RTJB 3I9V9 5DGAA 2FLOA 2UUTA 1XMBA 3DDIA 4R8UB 4X64F 2Y8YA 2VJVA 3BS9A 3V6DB 1JK9B 3AA9A 4CYUB 2E7XA 4JYAJ 1LWCA 2AWZA 2SXLA 1S4FA 1CULB 3G8SA 1JX4A 1U49A 4DL4A 5T7LA 2IRUA 8ATCB 2MHEA 3W9HA 4Y2MA 3HKWA 3HHDA 1U1MA 1OO0B 1I6JA 3K8VA 1QAJA 2DIVA 4B3SF 3R97A 3KJVA 3K0JA 4DV6F 3G8TA 5D0EA 1UVLA 3O6QA 1RDRA 1TV6B 2JJ4D 3FNNA 2FD2A 4UUXA 4ZVEA 4DOZA 5K8PA 2GQQA 1N48A 2KHDA 4LVOP 1B3TA 4N7TA 3N6NA 4Z37A 4B3RJ 5KG0A 1IR0A 4AD6A 1IR2A 3NKYA 3HVWA 5KFPA 4QWCA 4DMZA 3OFEA 1R27B 4QIVA 2JRSA 3ZC4A 1RISA 2MKKA 1LW2B 4O0IA 1Y10A 1T11A 5A0YB 2H65B 2O67A 3KLEA 4K0KF 3D5MA 2XMTA 3DOLB 3FVYA 3D6HB 2GJFA 4OIXA 2HHTA 2B6AB 4X4NA 4ZP8A 6FDRA 4ZDNA 1PG5B 3MEEA 2HQGA 4Y2CA 3TWZA 4O0NA 4ZPTR 4DCPB 2MQMA 3CCSS 3GIIA 2PC6A 3MECB 4O4GB 1NLKL 2OAUA 4ZOSA 2ZH5A 1KD1T 2R8JA 4QJVA 2GHVC 4FS1A 2FLPA 2OGUA 3B8HA 4M5DA 3M9OB 1RWKB 2XMAA 4OYOA 3V6JA 3MEKA 4Y34A 3KG4A 3GYXB 4U7UD 1U1OA 3DOKB 4ECYA 3BH6B 1JLEB 5HMZA 4C98A 1PCAA 2IVFB 3N5BA 5M2PA 3OJSA 2PI4A 2W2MP 8AT1B 4K4XA 1JNRB 2PSZA 3KJFB 2C2ZB 3NP5A 3ZZRA 2NUUG 2OELA 2KTQA 3R3TA 4CLPA 1WELA 3V81B 5K8OA 3DHXA 2QL9B 5M2UA 4X64J 1NK6A 3RW6A 1FTRA 4WP9A 1LWEB 1FRLA 1S1VA 4ATNA 1Q95G 5EGYA 3ONQA 5DS7A 1R0AA 3KMQA 3TAQA 1QLNA 4IFVA 4PPDA 1FT8A 3TQEA 4DL0C 1XNRF 2AYBA 2G2YA 5EN1A 2KYXA 4IFYA 5IZHA 4EK2A 3AOAA 1NPRA 3KFWX 4R0JA 3JAMU 3CC7S 4A8OA 1ZPWX 3G86A 1NHKL 5HMXA 4ECWA 3D54A 3V6DA 5EUHA 3VZHA 1PO6A 4QQBA 4R8UA 1N8RT 1NK9A 3QGHA 2MKJA 3BQ0A 2U1AA 1LFPA 1IKWA 1IWGA 4I7FB 4EEYA 3PVXA 2EK1A 3OSPA 1WEXA 1T7PA 1RTHA 1VYAA 4J7CA 1B4SA 2GQ2A 3F44A 4C97A 4GVLA 2CPIA 3CCRS 2C2NA 2CNNB 4CM0A 2F8MA 5B7WA 4QWAA 2QLJB 4DQSA 1FJEB 1M90T 1X5PA 4NPOA 1GX6A 2FZKB 5HAOA 1S9EB 2CFXA 3OTCA 4KB7A 4CH0S 3EGNA 1Q5VA 2OMLA 3NEKA 3CCWA 1CJTB 2I8EA 3CJQA 2IIHA 3HPOA 1J5EJ 2NLWA 3NOGA 4WCEQ 2ZH6A 4NLUA 3ISND 1SV5A 4K4SA 3D6FB 3C6TA 1NMEB 3PJXA 2MQNA 1U6ZA 3PXGa 3RBZA 4X4SA 4DR3J 3RUBL 3JQKA 4ZPCA 1GX5A 1S1VB 2E1AA 4QBUA 3UE2A 4U6PA 1M1HA 1R0AB 1TU0B 1WOOA 1CJUB 1C1CA 2F4VJ 1KEKA 4KT0C 3DI6A 1KOHA 3H5UA 1KQKA 1IKVB 3VTIA 4DL6A 2ZNZA 3EVMA 5F0UA 2ZH3A 3A4TA 3DGPB 3OL7A 2APOA 2Z2ZA 5DQIA 5HQ8A 1S0OA 4RNNA 4DL7A 2YKNA 3CJ8A 3LWLA 1S6QB 3NCQA 3EZOA 4L75A 5F41A 2Z0GA 5KFKA 1U25A 2VV5A 4RW7A 1MNEA 2EKNA 4IG0A 4R5PA 4A8FA 4FF3A 4OYPA 1Q4RA 3NNHA 4CWBA 2P5VA 3TX0A 3T1HF 2VPXB 3HULA 5D4LA 4GMKA 2UVVA 1FDBA 2XWXA 2YWKA 1U4BA 1OPZA 3M8WA 3KJQB 4DQRA 4J9QA 1R89A 2AJ0A 1SKSA 3VV2B 1D3WA 5F8MA 1FWKA 1X4FA 2OLWA 1IKVA 3GJSB 2IAJB 5D0RA 2U2FA 3KKFA 5HK4A 3UWTA 3J7ZT 1UFLA 3GU0A 4TY8B 1FKPB 2VBXA 1TAUA 3NAIA 5L1IA 2DK2A 2RU3A 2VF3A 2C42A 1CPZA 1NDLA 2DJWA 2F63A 3OFGA 4LQ3A 2FGCA 3PW7A 2W25A 3ITHA 4IOBA 3TO8A 1S6PA 4Z2XA 1L3KA 1BQMB 3IAM9 2CAJA 5A8RB 5AE3A 2HVEA 4DR2J 4KR0B 2OMOA 3H4BA 1ZYQA 3M8ZA 3L7UA 4IG3B 2G2ZA 4LFAF 2LXFA 3P96A 1FXDA 3BBBA 4HL9A 2R8KA 1OJ4A 5GMDA 5KFYA 4CH1A 3EUNA 1S9FA 1K47A 3VAMA 4Y2KA 4A4JA 3PW0A 5JVHQ 3SZ2A 3HZEA 3AB2B 1C2PA 2OSQA 2IM3A 3LF0A 4BC9A 5LL6d 3B6BA 1YG0A 3MR3A 1G6BA 5J2NA 2CQ0A 2ALYB 1J5EF 1O51A 1JKHA 1HPZA 1KVIA 1RTZA 5H9EJ 3LUYA 1U8SA 1M0SA 4NLOA 4QIEA 2XZTB 3RW7A 1F9EB 2PMHA 1F2GA 3F73A 1SIWB 4IO1A 4PQUA 2J7WA 1YZ6A 3BSNA 1T94A 2WONA 4JBCA 4QYZK 1S0NA 4KYZA 2VICA 3MTKA 1U6FA 2Q6BA 2C22A 4HACA 2GO8A 4D3HA 5RUBA 3RB6A 3EPIA 1JLCB 1MMLA 2MY7A 1NPKA 1U0HB 1YWXA 4ZVOB 2XZDB 2NCKL 4N8OA 1CJVA 1U2RA 4YB7A 4YDDB 2ZH2A 2CZVC 1L3TA 2GQCA 2IDEA 3BN4A 3GFXA 5DDRC 4JI2J 4ZIVA 1ITPA 4PG4A 4ED5A 4YN3B 1J5OB 1MN7A 1SV5B 1GTHA 3B4DA 5HANA 3Q8VA 2ATCB 2HLUA 3JS9A 4DPXA 1DAXA 2M4MA 1HBUA 2CNOB 1R7IA 3PFOA 4X4RA 2Z2YB 3H0PA 4WKRA 2OI2A 5SZTA 2BM0A 2HLTA 1S1TA 3LGHA 2UXCF 2YWEA 1NK5A 5FJ4A 1R6YA 4XPEA 2M3DA 1Q8IA 1TKTB 2YKMA 3C15B 3CVKA 1UPPA 1WDDA 3N79A 5DG8A 4HI2A 3ZTOA 5KT6A 4QZVB 3TAMB 4KY3A 1TELA 1X4EA 4ZVFA 3CCUS 3PW2A 1XMOF 3TJAA 1UKUA 2A10A 4FN5A 3DLHA 1SL1A 3RYLA 2BBEA 3PYDA 1YX2A 4C48A 3A3PB 1T3NA 5BJRA 3H20A 5B0EA 1LEOA 1SC3B 2BJEA 3SCKE 3TZWA 2H4YB 4NMLA 2VB6A 2AJFE 4H4KC 5DJBA 4O3QA 1N34F 3PRDA 2HHXA 2V4JA 4ZCIA 2UXBJ 3T6BA 4DLGA 1U02A 2DISA 1CLFA 4PXBA 3D67A 1A9NB 4OQJA 3A8IA 2R7WA 3OV7A 5ETTA 3ZZPA 1TVRA 1NZAA 3PZPA 2B4VA 1XBWA 4Z7YA 4RW9A 2LCWA 2YXLA 1S72S 4LR8A 4HVZA 3SBMA 4E2FB 2V6AA 4I2PB 1RGVA 4TXSA 4I2QB 1X4DA 2DEIA 3IR6B 2RDIA 2UXDJ 4KHRA 2MTLA 5D8HB 2BE7D 2OPSA 2RHQB 1C0UA 1KHVA 1FVSA 3BKUA 3DLGA 3ILIA 3LAKA 1T9XA 5DZ6A 3W1YC 4EO8A 3GSIA 3HDSA 4A46A 2A6OA 4OV1A 4C8YA 1NB2A 3D66A 2FVSA 4LSNB 3KNAA 3FBCA 3C16A 4KV8A 3JTNA 3M8PA 3R5BA 4H4OB 1WDTA 2HWTA 1VJWA 3VF0B 4RNFA 3HFZB 2HQFA 1ZPVA 2OEMA 2P6SA 2E7WA 3CDBA 3FCHA 2ZBPA 4OMFG 1RAFB 1XK8A 2JVRA 2RE1A 3TX8A 1CJKB 2RQMA 2EFOA 2K1RA 7FDRA 4N5SA 4LSZB 3VAKA 1FDAA 2HQ3A 2PO4A 1WHVA 2CPDA 2G0CA 1QAIA 2XSJB 4FZVA 4OFZA 2C1EB 3PJ9A 4G6VB 3SYZA 1SKWA 3NL0A 1VI7A 4C2MA 3CCJS 4FXVA 3U7JA 1T95A 3DDKA 3JQMA 2NYIA 1FJCA 2BR0A 1XMQJ 1B99A 1KHWA 2RT3A 3MUVP 3J7Z5 5I42B 4DFJA 5HLFA 4OZ2A 1VQMS 1VDHA 3HHLD 1B0TA 3F0NA 3T19A 3EX7B 5JUMA 1S57A 2IA6A 2V8PA 3MHYA 1QVGR 5EX3A 4EZ9A 4LF6F 2BKPA 4IH7A 5F8NA 4PWDA 1HW8A 2AKWB 1S1WB 3K5OA 1D9DA 2DGOA 1CJKA 4PR6A 1KFDA 4B9NA 3HSZA 1S5ZA 1TQLA 5L1JA 3QT5A 4F4AA 1N52B 4IG0B 4QOTA 1G2EA 1C1BB 1WNEA 3HVAA 4RW6A 4B9LA 4LBIA 4MT1A 1FA0A 1IWAA 2LQ8A 1F3FA 3R7SB 1HQ2A 3T41A 2KXHA 3DRPB 5D77A 2YH0A 1HBOB 2N82B 3QLHA 1RYRA 1REGX 2W9BA 1VQNS 3HHNB 2MQLA 2DXDA 4Y65A 3AB4B 1RTDB 1KOOA 5L9NA 4ELVA 1YJTA 1QE1A 2RU9A 4M5MA 1FRIA 1WSVA 2RD5C 3UN5A 3K5NA 1V5IB 1R8HA 1X4CA 1NJWA 1RHUB 3O8WA 4KKOA 2VC1A 3FZ2A 3TNVA 1VRUB 1DQAA 5HP1A 1NRKA 2DNMA 3GMGA 4I6YA 2XY7A 1C0TA 1RTIA 3W8GA 2M52A 3ZZUA 4NLGA 2ZDPA 2Y1LB 2EFPA 2EG1A 3NG8A 2F5GA 3CB4A 3SQGB 5M2RA 3M4XA 3IP0A 4DS5A 1QSLA 2R3VA 4JV5F 2WVDA 4LF5J 2CJKA 3TYTA 1LWCB 2J8SA 1O0PA 1CQNA 2XMMA 5BYSA 4CYUA 2IBKA 1YBUA 1VQLS 4LRFA 1JB0C 4ERDA 1OYDA 2CQBA 2KL8A 4FKXA 4DWIA 4DFKA 4NXMF 2QV6A 2WHOA 1OQ3A 2RDJA 1U2CA 3K2YA 4OJGA 2B4UA 1SH2A 3BO2A 4J9MA 2VDHA 1E6YA 4MK9A 2VPZB 4CT8A 2IM1A 2MGZB 2EEYA 4USVA 2Q3PA 1ZM9A 4FYXB 1BQNB 2GC8A 1C1BA 3PNIA 4PYAA 3JYTA 3SI8A 2W2OP 2MKCA 4NLRA 2WCXA 2RSQA 3K5PA 4A8KA 3DCAA 5JJBA 4JB8B 3KNGA 3CF5Q 3GE9A 3QFWA 4BCAA 4QPTA 3KOAA 1NSKL 1L3VA 3CJKA 4F02A 2HRTA 3I87A 1DZ5A 4ILLA 3EXCX 2B0GA 3WZ0A 4ZPDA 4URSA 1T0TV 3WQPA 4LF6J 4NA3A 2IDLA 1PC4A 4S0MA 4WU2A 1HQEB 1N5SA 1VLOA 3L7OA 4I64A 1Q82T 1FI4A 3MOZA 1VRTB 1H38A 1GNKA 3C6UB 4Y2AA 4FNIA 2D1CA 3LGNA 3M1VA 2GA7A 1YRXA 9ATCB 4TYAA 1T8EA 1N5TA 3MEDB 4I1TA 2XHCA 5GADI 2E44A 4U8YA 4CH7A 4RU9A 4OLOA 3MM5A 2YWFA 1GMWA 4CT9A 4B3RF 3KHHA 1FE4A 3DKDA 4PG6A 4WP8A 3PTWA 3G6ES 2XS5A 3L95X 2N4CA 2B43A 5JVGQ 1Q78A 1S6PB 2VFRA 2ZKUA 3K5MA 4JI0F 1W7WA 3EICA 1NJXA 5B09A 1ZM2A 2ILYA 2OPPB 1YJUA 3MWBA 3D4JA 1OSDA 3RBXA 3OL6A 4EYHB 1YHQS 3FCWA 2CQHA 2N3LA 2LMIA 3CD6S 3CD7A 1HYSA 1RLDA 5A2QY 3SSRA 4DV5F 3PR4A 2FYXA 1H2UX 3M8QA 2F4FA 3VCDA 2E5GA 4LF8J 4W98A 1IQZA 2DXEA 4I68A 4NL5A 4TY9A 1YVFA 2JEFA 4MYTA 4PUOA 5CZXA 5LJ5Y 3BPDA 2JFKA 3AAWB 2E1MC 1VQ6S 1TKDA 1N4LA 4ECVA 2FIUA 2CQIA 4DV4F 5BXIA 4YB5A 2JZ5A 2HFNA 2ZDOA 3CJ3A 3NCRA 1WHWA 2DGXA 2XLJA 3KK2B 3GIMA 4OZJA 1CVJA 2QA4S 3D9BA 2Y8WA 1XJWB 1TKZB 3BO4A 1IJEB 1H72C 1XTZA 4WXOA 4TLQA 1NJZA 2QN6B 1V3ZA 2XNQA 3UNYA 3KK1A 1ZA1B 3B78A 2UU9F 1F0XA 2ASYA 5A6WA 3J7YU 4ED7A 5HROA 4DSKA 2NR0A 1R8CA 2RNEA 3A12A 1HWIA 3D0IE 4K2JA 2ZZMA 2B9EA 1T9TA 2CNLB 2MMYA 1WSRA 3BYPA 3OTBA 3QGPA 4OZ1A 4O3RA 5HSPA 2BRKA 5ITHA 2RAQA 3KUGA 1H73A 3EXYA 3KG1A 3CWJA 4MFBB 4TQSA 2ZD1B 2R4FA 1TK8A 2H51B 3MR7A 1EP4A 3U1NA 2E1PA 2VBWA 1ZAWA 3FMBA 5KOWA 1TMMA 3FEXB 3MAAB 1HR0J 3D1HA 1HQUA 2B9YA 5D4OA 2V8HA 3NMAA 4JYAF 1YSJA 1I94J 4G65A 1U0SA 3LQVA 4O3NA 5J2MB 4NZ6A 2VFVA 2CJXB 1CJTA 4F4WA 1X5OA 3HFVA 3L09A 1JXLA 5IC4B 4RUCA 1P9YA 5AXLA 4C7QA 2DIUA 4K8RA 5ETLA 1JLAA 2DNZA 3V5RA 3MF5A 1FEEA 4P6QA 1F2HA 1Q16B 2G9OA 2ZHBA 2M7SA 1YJVA 3BB5A 1IBLF 2XMKA 4JI1F 1CC7A 1IBKJ 5CZVA 2KXNB 5SUHA 4YB6A 2QL7B 2BQUA 1JLEA 1KONA 1WG5A 2CA9A 2EFQA 3W62A 2AYGA 2IY5B 4C8LA 4DR6F 3VGTA 3IAS9 4JI0J 3J81j 5HATA 3OT9A 4LR7A 1SI9A 3EJMA 3R2CJ 2GJ2A 1OY6A 3QIPA 1VCTA 1HD0A 1RAAB 1S99A 1YJRA 2AHOB 2HFUA 2HZAA 2VQEF 3PEHA 1QM9A 2YQ0A 5D3GB 4DF8A 2P9CA 3OQ2A 1UMJA 2QMWA 3OR2A 3LANA 1TTHB 1UWAA 4DR3F 3OTOF 2KHCA 5DDPC 4A8XA 5KFOA 4B3OB 3OLBA 3RAXA 2DGQA 1NSAA 2AF6A 2HFVA 3KLHA 4Y28C 3D28A 4N77A 3U1LA 4UOGA 4YQWA 1G3OA 2BRLA 1EETB 2V2QA 2XI3A 2DD8S 2QFIA 2AZ3A 2AX0A 1J2VA 1NO8A 1N5VA 2B3TB 2OO4A 3OBIA 4TN2A 5HQMA 1HNXF 2EFNA 3J7A1 2DGWA 2MEWA 2RJZA 4DJBA 4ZP7A 2DCLA 4RU2A 3HMJG 2RS8A 3A8JA 3NRBA 1PJ6A 3R2DJ 1VC0A 4BWMA 4LF7J 4OX9F 1YBTA 1NH8A 1C4AA 2GJIA 1R8PA 3FFIA 2W24A 2CYYA 3QAUA 4CO0A 2QC3A 1EHWA 3E01B 4UF4A 3FBBA 2XYPB 1NBEB 2IC3A 3I31A 3MM8A 4OYAA 3TUJC 2XMJA 2FLLA 3PO4A 2HHHJ 1DLOA 1BWEA 5KFJA 2V68A 1SIZA 5KG3A 1S59A 4PKDB 5HL7Q 1R8AA 2R2RA 1TKXB 3BGLA 2F65A 4IR1A 4AL6A 2V69A 1K44A 1XN9A 2KXFA 4OYIA 1IKYA 2ZNYA 1EZZB 3EM1A 4F0KA 2D9PA 5B08A 3R1HA 4B3SJ 4OYZA 2LEBA 2C3UA 5HI7A 5HMWA 3IN5A 1VOMA 2H4WB 2BUNA 1NU4A 2GVZA 4ECQA 5B0BA 3KHGA 2Z58B 2HHWA 3DRSB 1C1CB 1CEZA 5GAGI 3WBZA 3BM7A 3UCUP 2DO0A 4LF1A 3D1OA 1NSQA 4ZVSB 2JEIA 1DHMA 1H2TZ 4CNZA 4TU9A 2HVDA 4OI0A 1JIHA 4JI5F 2OSRA 1K1QA 4NYZA 2ZJPQ 1SQFA 1G7CB 2MZJA 1DURA 2BX6A 2YBVA 2V67A 2ZH9A 1SC1B 1DTTA 3T5LA 1PSDA 2BXJA 3SXLA 2XCPA 2E1CA 1TK0A 4JP8A 2B9XA 1RHQB 3DMJA 4ILRA 4EGLA 5F9NA 1KKHA 4F3MA 1JLFA 2AJQA 2YX1A 1HWKA 4ECTA 1V3RA 1XC9A 3D2WA 3MM9B 3KTQA 2X3GA 1NKBA 1M5HA 4ED4A 1C0TB 1KDNA 1RTIB 2H3EB 3P5BP 4KSEB 1HWJA 2CRLA 2J0XA 4J5OA 1EIYB 5DM6Q 2FB0A 4UW2A 3IWLA 4QR2A 2BJ1A 2ZOFA 5FD1A 3UN2A 3LWMA 3VAGA 4WFAQ 1LKZA 4FVCA 1VS3A 2OUGA 4UUWA 3FMWA 5E3QA 1JLBA 2DVIA 2QMUB 5EWGA 1Q86T 4JI4J 2R7XA 3I5BA 2IMWP 2HBRB 1SJRA 2VPYB 3RR8A 4USTA 4B3OA 5GMKa 5IV3A 1S49A 3C6TB 1FK9A 4QYRA 5L9XA 3ZZ0A 2EVZA 4E98A 5B0DA 4HHJA 3JSMA 4USMA 3PO5A 2W9AA 2GMJA 2Y3YA 2V0NA 4DR6J 4J91A 4DG1A 3A3NB 2BYCA 3U27A 2IRYA 1IN0A 2MPUA 5D6GA 3ETOA 2MLYA 2RKIB 1HHQA 1SPBP 2V8DA 3A1YG 4FF2A 1FKOB 1RT6B 3EMTA 3QPIA 2W9CB 4F4KA 4RUAA 2AD9A 2NREA 3ET6A 4DPUA 1GT8A 1F5BA 2EC2A 1U7LA 3M8YA 3QFHA 4K4VA 4K4UA 1RT5A 4YR0A 4NXNF 3MCNA 2YQ1A 1JNZB 4DCJB 3OSNA 4DSFA 4C0HA 3H5XA 4ZPBA 4U7CA 2UVRA 1TFYA 2X51A 2R8IA 4IFVB 2LA6A 4ZVUB 3CGIA 3KLIA 3QSYB 2BDPA 1CBKA 2XCAA 3ZZOA 5LMNJ 4DUYJ 2HQDA 2ZJRQ 3GFYA 4O23A 1TR0A 2HZCA 3A8EA 1JLQB 4LSLB 5K9FA 3GIJA 4DV3F 3PR5B 4KHPJ 1MG7A 1WG1A 3H25A 2AW0A 3KG0A 2BMBA 3BDEA 3DRRB 3IM9A 5KG6A 2O5DA 4ETXA 2MQOA 3HP6A 3LTOA 2BJ3A 2MHNA 4KFBB 4QIGA 5KG1A 2ASLA 2ACYA 3IS9A 2QLXA 3EE3A 4YHHJ 1K8AT 2ROGA 2H1YA 1YJWS 1PKUA 2D7SA 3GYGA 4QYZJ 1P6TA 1IM4A 2YNIB 1B64A 3QT7A 4DI6A 2E7VA 2HZVA 2FDNA 4FVMA 3UD5A 2CPXA 4LFBJ 1JXEA 2DNPA 3H7HB 5I4MA 4OJ3A 2MLZA 3BQ1A 2AGQA 1RI7A 4YFUA 1U24A 3TEGA 3PFEA 2QTWA 1KWMA 3D1QA 5CAAA 5ETOA 1SXLA 4A48A 2AEJA 2BE2B 5K8NA 1XNQJ 3M8QB 4KO0A 5CYMB 4DUZF 2HVZA 5L1KA 2QG9B 3FRYA 1K9MT 3F56A 4O44A 4X4UA 1RUSA 4M5DB 1UFWA 5IM0B 2B4OA 1JXVA 2ROPA 3LOUA 3Q89A 4NEYA 5KT2A 2W7AA 4CTAB 1U1RA 1N36F 3IS9B 3PX0A 5IWAJ 4P2XA 1TUWA 1GAOA 4ZVTB 1NKCA 5A8KB 5T14A 1HBMA 4F04B 3LGMA 3W2VB 2HAFA 3GG0A 5J2PB 1RABB 4A8WA 1RSCA 2H5JB 1SQGA 4B17A 5H9FJ 3LP1B 4KH0B 4JI8F 1LXJA 4H4OA 4GVBB 3M6UA 4RJVA 2A1BA 1VHIA 4HLBA 4KE5A 3T5HA 2LDYA 1WHYA 3N5FA 3GJQB 1L5UA 2CJAA 4BS2A 3M8SA 1I94F 2DT9A 4WPAA 2WZ1A 3PW5A 3FQKA 3RGIA 4ZLNA 2QFJA 3R1LA 2YKMB 5KFHA 3ILLA 2FHJD 3IG1B 1S1UA 2PEHA 1Q0NA 2F9JA 2GZOA 2RB7A 4JOUA 3UNGC 4E8UA 4YR3A 1YITS 2R7VA 3TJ9A 5C5JA 1X4BA 3PDNA 4LRBA 1EQMA 1FKOA 4P74A 5LOQA 2J8AA 5LSOA 3W9IA 5K5MA 1M1GA 1RWUA 2NXCA 1IBLJ 4RLEA 2CPHA 2R8GA 3C19A 2VH7A 3GFHA 1TFWA 3H59A 2HRUA 1YJNS 2ZUAA 3QMQA 1RA7A 5GAHU 4Q44A 2DNNA 1Y9OA 1N33F 4YHHF 2C2MB 2AP6A 3KLVA 2C28A 3AA8A 3DRYA 2DRAA 3BQ2A 1VHFA 5IQ6A 3VAHA 2UUWA 4FP9A 3CXCR 3HJFA 4LJMA 2KM8C 2D41A 4WFXA 1U1LA 3ISNC 2DKOB 1V5VA 2QRRA 1URRA 2XQCA 3CCLS 1FKAF 1N0VC 2UXDF 2RUSA 1TL3B 1L3UA 2DBBA 2H9ZA 1UA0A 1DQ9A 1DY3A 2CWXA 5BYQA 4Y3CA 1T05B 4LF5F 1IM6A 2MDAA 2VOPA 4M5LA 4KGMA 3UI3A 1FEHA 2CQ1A 3PIOQ 2LFVA 3FGVA 1NK4A 2JC1A 3AQOA 1X9SA 1SUQB 2VU5A 5D4PA 3VHQA 3HZGA 4PWUA 1NKEA 2OFGX 3TZYA 1UVKA 4K7QA 2J9CA 4KJIA 1BC6A 1TKXA 1NDKA 3SQGA 4ES2A 4PG5A 2L08A 5E2QA 3PIPQ 4QU6A 1ZTTA 2V2ZA 2KT3A 3HVRA 2LXIA 4F2SA 4ETZA 2GIFA 1AUDA 1AYEA 2W7PA 4AQYJ 1BXNA 1LWXA 2LU2A 4I7FA 4PPZA 1HI0P 3QRPA 3LALA 2HHHF 2O66A 3MXHP 2AX1A 3FFIB 1XMQF 2HVIA 4HT7A 1P1LA 2VFTA 3I0RB 1C4CA 3MR2A 1U6BA 5LMUF 1FJGF 2QLBB 4L73A 5U47A 1FRKA 1AT1B 2QO3A 4AXIA 1IQTA 3OXFA 4HDGA 3MEGB 2L9DA 5J2PA 2G1HA 3WC0A 3NS6A 3G87A 3F41A 3M30A 1KVJA 3B54A 4MKAA 3RAQA 4NOHA 3UDCA 1JJHA 4CP5A 1PAEX 2FC8A 5DM7Q 2LVWA 3KXDA 2ASDA 4LSNA 2ZM6F 1ZBTA 1RHMB 2GO9A 1YIJS 2UV8G 4OV6A 2K7JA 3LW5C 3POTA 3R7NB 1MMNA 3MFHA 1IR1A 4ZPWR 2OH2A 1RHRB 3IWNC 1SCJB 2CQ2A 2R7SA 3QZ7A 1VC5A 1JLQA 2XI2A 1SKRA 2WBRA 3D0HE 1IXKA 1VQYA 1JJ2R 2A3JA 2BVZA 3ITHB 3E51A 3GIRA 2P9GA 3M1VB 4OZ5A 4JI6F 4ZLLA 2XY6A 4NCAA 2EI5A 1DFDA 1WWHA 1F6TA 2CWKA 2YX4A 2GHPA 4C11B 5KAKA 1WTBA 3CMAS 3OXLA 4LFCF 2HFZA 2MSTA 4RUHA 4XIUA 1TL7B 3IRWP 4IRKA 1OPIA 2DXFA 2F40A 4GO5X 5D15A 2CQ3A 4C6AA 4TU7A 3OPKA 3HXMA 2QEXS 2VA2A 1VQPS 3DM2B 2K3IA 3DRRA 2KZZA 3RB4A 5KT4A 1WKLA 1CULA 1UEUA 1RT3A 2AJ4A 3Q86A 4DPTA 1YZ7A 3JB9k 3LH2S 4J90A 4J9LA 1TL4A 2XSFA 4ALZA 4FYDA 5DLGA 1H3DA 4LF9J 1AW0A 4IDKA 2DB1A 2A0FB 2P6TA 2JNJA 2ZZTA 4Z7CA 2DNOA 4DSJA 3UN3A 4TYBA 2MLXA 4WYLA 4ZJLA 3MCOA 2VKZG 4OYBA 3SFUA 2VG7A 4DX7A 1SUQA 4IOAQ 3LP2A 1BHNA 2QSWA 5DG9A 2R9LA 3E2EA 1NM2A 1X5SA 3CD5A 2MKHA 3HLUA 1S9EA 3TVZA 4AT1B 2UXCJ 2VUGA 3PM9A 7FD1A 5ETPA 4IRDA 3GLJA 4ZA1A 4QU7A 4C4WA 1IBCB 1H6KX 2GV1A 3N6LA 4XO0A 4NXNJ 3NNAA 3QJLA 4QPXA 1WC6A 1WI8A 3Q83A 2MQQA 1VQ9S 5F3TA 2VZ9A 4OI6A 4ZVRB 4A8QA 3THVA 1FTCA 4WZMA 3S8SA 4M8LA 2VL1A 2E5LF 1WKJA 2ZD1A 3THPA 2YVSA 4RWXA 2P8IA 1RBLA 3BEGB 3HSDA 1NJYA 1GQEA 2EW9A 4K5RA 3CT9A 3MMJA 2LEPA 4F2RA 3H2VE 3LP2B 5IS2A 1UA1A 3DLEA 2FJXA 3P45B 3TAMA 4KPYA 2JWNA 1WEYA 5AXKA 2IJRA 5CCMA 2HGMA 1ZS6A 5C24B 1LWFA 2CXEA 3NGDA 2ZOMA 4WZQA 3FEYB 1HI1A 2RUGA 4B3TJ 2HKEA 3HI9A 1HBNA 1X8DA 5E3RA 2D69A 1LXNA 1CJVB 1UL3A 3T9ZA 4F3QA 3AOBA 4ZPVR 1JLAB 2OPPA 2QIFA 4H4KA 1ZAXA 2GGPA 2RMLA 2I1RA 4AFFA 3N0VA 4IO9Q 3ILOA 4LFBF 1U8WA 1WC5A 4OZLA 3CJ4A 3ISZA 1Y7PA 3M9NB 1ACMB 1I1GA 2UXBF 4C3KA 1VQSA 4I6AA 3SCLE 1U09A 1FRHA 3W65A 4RNOA 1AROP 1IBMF 3P6YC 3L4BC 3MCMA 4DU7A 1UVNA 4XTTA 2VDIA 4XK8C 1HWLA 1NDPA 2M9KA 1AZSB 4ICLA 4ZHRA 3OD2A 3GR1A 2V50A 3MM7B 4NASA 1HNZJ 3M8PB 4OYWA 2F4VF 5H9FK 3CJTA 3DOMB 4KC5A 3RRKA 4KGXB 3LP1A 2DRDA 3BREA 2X7IA 3X1LB 2F8HA 4TY8A 1XEZA 2I6WA 1NNDA 3TARA 4A8MP 1MROB 4LF9F 3W63A 5A8WA 4I67A 3EVWA 4HI1A 2MXYA 3AT1B 4Q5VA 1DTQA 2XSJA 3IA0A 1SC6A 2UU9J 2MZ1A 2JLGA 2DR9A 1BQMA 3CDWA 3FEZA 5DO2A 2GX8A 2J6SA 5C25A 2CJ9A 1SC4B 3R5GA 4P72A 1BQXA 1HHSA 4DPWA 3KHRA 3M05A 5AT1B 5G4DA 5I42A 3UW1A 4C8MA 2E9TA 3DDNA 3T1AA 4ECSA 2MJNA 2HRYA 2KI2A 3PG9A 3GYNA 3PRVA 4NI2A 4P7VA 2LU1A 5KFSA 2V5HG 4UY85 3OR1B 1Q53A 1RXOB 2L41A 2X1GA 4JUZA 4DLEA 1UVIA 3V2UC 3OFFA 4OHVA 3JQJA 2JHEA 3I0RA 3C2PA 1UAWA 2M88A 4DZ6A 3KLFB 4PUOB 3CJRA 3DRXA 3PCOB 3RJMB 5KTQA 1SJ4P 2CZ9A 2WVFA 1VIXA 3CD0A 4LVNP 2BANA 3SCIE 3OFHA 1VQ7S 2YWGA 4DV6J 4URQU 3S6EA 3KLHB 2CQPA 1PYOB 2DHAA 1VRTA 4DDFA 5C7PA 5I3UB 2XO7A 1VBKA 1VFJA 2XBPA 4KRWA 1WC1A 3W66A 4QIWD 4JI1J 3CSKA 1UJ4A 1C0UB 1PJ5A 1YJ7A 4HT5A 4LRAA 2MQ8A 3HFKA 5G0RB 2WOMB 5LJ3Y 5EWEA 4JI5J 1D8YA 2E9RX 2DNLA 3ILJA 1X4GA 1IKWB 4HHHA 3ZZTA 4DU8A 5DRKA 4W92B 2HS0A 2DHHA 1RAJA 1MROA 2IM0A 4MTPA 2B5JB 3CO9A 2UUBF 4U7UK 1WF1A 4IUFA 3OTEA 1R3NA 1YBAA 4LQ9A 4R5PB 5KFFA 3PW4A 2XGQA 2W9BB 4RW7B 2XS2A 2X1AA 2GIRA 2OEKA 3H5SA 1XR5A 3EZUA 3ETMA 3M2UA 4Y00A 3UVJA 2RIJA 5GAEI 1LOUA 1FCAA 5KFIA 3I32A 3JSMB 3OUYB 4P2FA 7AT1B 2GS8A 2OJ3A 3BSCA 3DU6A 5HQLA 1I3OB 1BE4A 2HG4A 3ZO7A 3UDVA 4F4ZA 5KFRA 1RKJA 1LV5A 1HKAA 4M5IA 3V6KA 4Q7AA 4TLRA 3DLLQ 2QA1A 3DYAB 5L1LA 4QW8A 1RWPB 1BWVA 4HYKA 3CCTA 4NXMJ 3CDUA 3H8YA 3R5AA 2ZZNA 3ZZZA 3MGJA 2VOOA 3QSIA 3WIVA 3MURP 1UWBB 1W2IA 2RHSB 1B70B 3V4IB 1TKZA 1TUVA 1Q8KA 1TAQA 1NHVA 3CEDA 2B8QA 4HDHA 4XDCA 4J9NA 2QA2A 3C66A 4C3MA 2J7UA 1LNQA 3FRZA 3H2LA 2C3MA 2YKOA 3SDEB 4ZLJA 3G8QA 3UFCX 1YQHA 4F7VA 1TZ0A 4ENOA 2MSSA 2V63A 4F4YA 3N4WA 4M5NA 2ASJA 4LUBA 1LW0A 1HW9A 3POTB 3IR5B 3SMZA 1QDUB 5KG2A 3KK3B 2WRMA 4HR2A 4RBTA 2VHGA 4CO3A 4ZCLA 1X9WA 2DH7A 3TAPA 2HMIB 3MAAA 3PHEA 4PXEA 1ULRA 3UPFA 5DQGA 1S79A 2KH9A 3KHLA 5HP1B 4KHMA 1S7IA 1FNXH 2C2KB 2HBYB 1RT1A 2AYMA 5HVFA 4DEZA 1K73T 1L3SA 4DSIA 1MSWD 3MMAA 5EX0A 1RP5A 1IBKF 4KO0B 2WB4A 2HSEB 2QLFB 4WE1A 3PV8A 4NRTA 3TUIC 3CUNA 1ZZFA 5D0GA 2XEXA 3AY0A 1KQFB 3RG6A 2J0QD 1TL1A 2UUAJ 2FJEB 1QUPA 4DV2J 5DLFA 5B0GA 1IUJA 4CLSA 1D1UA 4CO1A 1FXLA 2L9NA 5I3UA 2CJQA 2UUCF 3AD8C 2HVHA 4TKTA 4WTOB 2KZMA 4MIWA 4WXWA 3FSYA 5KG7A 1F5CA 3K7RA 2JEJA 1TP7A 4DR1J 3HVTB 3SFGA 2J9DE 2VKRA 1RCXB 3OTOJ 2AJ1A 1KS2A 4OL8A 1R0BG 3IGVA 5E5NA 3TA0A 4DR5F 1PJ7A 2KN4A 4J9VA 4R0EA 4OHYA 3CCZA 4DX5A 1RT2B 3E8OA 3LPEA 3P3DA 2R7RA 2VIHA 3QZ8A 4DV4J 3PYGA 1KRPA 2CPYA 2CG4A 2VQFF 2ZC4A 1AA1B 5AE1A 1P1TA 3MR5A 2WVEA 4B9TA 1KP6A 5A8WB 4X4VA 2OFHX 2I5JA 1F9HA 2XO6A 1X60A 3EVOA 4F25A 2MGZA 4V19X 2KJVA 3BGOP 3G2XA 2VG5B 3AFGA 3M2VA 3GG1A 1NK7A 4LF7F 2ADBA 1HD1A 1U2FA 3KJNB 3PX4A 4F67A 1CG2A 2DGVA 4NLQA 3JAMY 4ZN1A 5I3QA 2CQCA 4JI8J 5B0CA 5HVHA 4DV7F 2IA0A 2J9DA 2W4DA 2ZKTA 3DOMA 1GXTA 2IYIA 2WSEC 4IYQA 1UP1A 1ZM4A 4WFNQ 3CCES 3QATA 1UEVA 3HJVA 2KRBA 3KLGB 5CHCB 1FWPA 2KG1A 4BBYA 4ZVHA 4DFMA 5LXRA 1Y0HA 2IYGA 4KAIA 1E6VB 4OJ1A 5LT5A 3EPGA 2VJUA 3MDFA 3QWUA 2X1BA 4YP3A 1X4AA 3W5ZA 5FDLB 3KMSA 2HS3A 3W2WA 3HHLA 1XQIA 1Y5LB 4USIA 3K58A 2H48B 2NZCA 3O5TB 2IM2A 4IH5A 5KFBA 2B8PA 2WB1D 1SJ1A 3IMQJ 4FBUA 3VAJA 3UDEA 3D0GE 1N34J 4D3GA 2DH9A 2MZSA 3O2IA 3PY8A 2NYHA 2I0XA 1A0OB 4RNMA 2JFDA 3KWMA 3ZTRA 1D9FA 3HHLC 4NA1A 3NXZA 1UW9A 1T02A 3TZXA 2Z57B 1O5JA 1S1TB 1Z1ZA 3AJ2A 3CCQS 2GMLA 4UTGA 1AB8A 4X4QA 5GAHI 2J0SD 4HH0A 1SB6A 3H2UB 4DBQA 3FBEA 1CS4A 4P2SA 3FK4A 3TUZC 1V9OA 2B51A 3W2WB 1P27B 2HBQB 5BR8F 4DL5A 2XTJP 2R42A 3N6MA 2PMWA 4USWA 2XY5A 4RKUC 3KDNA 2W7OA 3EDQB 2GFFA 4FYWB 2L48A 4X62F 3VVTA 3M2UB 3UVJB 3GIKA 2QJ3A 4F36A 1JKHB 1HPZB 2XS7A 2W2QP 3QO9A 4U9RA 4B9MA 4CDIA 2LLZA 2M0GB 2RQ4A 4B08A 2XGPA 2G13A 4O4GA 1URNA 2Q66A 1FESA 5B0FA 3MMBB 2KT5A 4ANCA 1QD1A 5IT4A 1EJ7L 1SBRA 3BR8A 3DGVA 3NGRA 4K4YA 3V81A 2FJDB 1HLWA 5GAGU 2CQ4A 2PEBA 3DOKA 4BLGA 3GV5B 1SKUB 4DHVA 5MAOA 1Q81T 1X0FA 3CE8A 2PA3A 2W01A 3C8YA 5D4NA 4DZDA 3CPWR 1MLAA 3FKBA 4AQYF 3VVUA 3CJ2A 2VFUA 4ED1A 2CDQA 1WOSA 2BANB 4FBTA 4DQQA 2YKAA 2OPRA 4ZVQB 5C2GA 1IVZA 4AUKA 3HSGA 4ER8A 2NXNA 4DV1F 3MPVA 2CQDA 4DSLA 1S6UA 4CM2A 1XNRJ 2HFSA 1D09B 3RR7A 3TJ8A 1Q8BA 2VG6B 4ZP6A 3KLEB 2HHQA 1CC8A 3CDEA 1BMQB 1FD8A 2R2UA 3UCZP 4NEZA 2JSXA 2QZ8A 4ZIWA 1MU2A 5HBMA 3LP0B 1MWQA 2ZWPA 3FC9A 4C11A 2HHUA 3GWCA 1YGYA 5LMNF 1W2BR 3TI0A 1FKPA 3QWPA 5DZ7A 1M5PC 1JMTA 3ZXWA 2DR6A 2Q43A 2Y0SD 3KK2A 2FJWA 4ICLB 4ZHRB 1M5OC 2FGOA 5J1PA 2V4JB 4B3MF 2Z2LA 3D6MB 4B02A 4DN9A 2RDDA 3OXGA 2PMZD 1QY7A 5L46A 2ZVSA 4UZBA 3DGPA 4F0HA 3CCVS 1ZZNA 4LF4F 4Y2IA 2Q1LA 4WE1B 5A0YA 3U1MA 3BO3A 4RW9B 2EFGA 2AT1B 1XR7A 3RBDA 4FPRA 3MR6A 3J80U 4P9SA 1WC4A 1RT1B 1HI8A 4OHWA 4F0MA 2G4BA 3IBWA 3M6XA 4W90B 2XC9A 1S76D 2DPIA 5ADZA 2HYIB 2Z2MA 4FS2A 3CJ0A 1DJ0A 1GXUA 1TK5A 4ELUA 1FFSB 1RT4B 3RAMA 4X66F 2XLKA 2CVEA 2ZBQA 3FDSA 1CS4B 3I0SA 4I6WA 2BJDA 1TV6A 4L3KA 4X65F 2ZH8A 2ALZA 2AU0A 1CJUA 2FC9A 3NNCA 3M32A 5AJ3J 4I69A 4IR9A 3NBPB 4DL2A 3QLHB 4CLTA 1Z2LA 4USHA 2W4PA 5ETSA 1T03B 1UJ6A 4WJBA 4C0BA 3TVYA 2X1FA 1RWVB 1GXLA 2HHPA 2Q79A 3AQPA 3PYEA 1RCOB 4FPIA 2Z30B 5DDQC 5KFMA 4X4TA 3DU5A 5E3CA 3RB3A 2KB2A 1ZOTA 4RO0A 2GW8A 1CQMA 1N5YA 1UVMA 1SL2A 2LQ9A 1UFKA 2Q6CA 2L9WA 3TANA 3MMBA 4C8OA 4XAKA 3Q2SC 4GRSA 5CCLA 1SL0A 2FQQB 1W25A 1OQ6A 4NE9C 4GC7A 4Q43A 1HFEL 1UW4A 2NZ4A 3V6HA 4EBCA 4BHQA 3D68A 4Y6IA 1SJFA 1P8GA 4O3PA 4CZCA 2MJUA 3HSJA 1HHTP 2KO1A 1NUEA 1K0TA 1SH3A 3KLGA 3US5A 5HLFB 2YKQA 1QVFR 2D3ZA 4WWSA 1RA6A 4OI1A 1B0PA 3ADAC 3ET6B 3NGSA 4HHUA 4E0DA 2H5IB 1KR4A
chains in the Genus database with same CATH topology
1S1UB 5F8JA 5FDLA 1N32F 1JLCA 4N8NA 2HPUA 1U47A 1HBOA 1DRZA 1PC5A 4DFPA 2LEAA 3KK1B 2YH1A 3VAIA 1VBZA 4FF1A 3GILA 5J2NB 2R7OA 5KFTA 2XHWA 5HROB 4ID5B 5H1SV 2MQPA 4RW6B 2YNGB 4QWBA 2HHVA 3ZFVA 2MY8A 1VRUA 2ZH4A 3TW0A 4NLDA 3MFIA 2OTJS 3Q22A 2NQPA 2WSFC 2DRBA 5C25B 2VFSA 4WFYA 2DCUB 2IRXA 2HNYA 5C42A 2R8HA 2J5AA 3C46A 2NXUA 2XULA 2A2CA 5CD4H 4UQTA 1HNZF 1G1XA 3G9CA 2JH3A 1S6OA 2C2DA 3IXQA 1RT7A 4NLXA 3HO1A 2W8KA 2RF2B 3Q8PB 3Q8QB 3CC2S 2R7TA 2XZWA 4I56A 2QA4G 2DGTA 3IC1A 4MIBA 5GADU 4EBDA 3UD4P 1M5VC 5J2QA 3RBEA 2XMVA 2R7UA 3DM2A 4MKBA 3ENVA 3NMRA 1KQGB 5F8GA 2JC0A 2FVPA 4QWDA 2GMHA 3RRGA 2GNKA 4H4MA 2XWYA 4C8NA 3FZBA 5J1EB 2A2DA 1TVRB 1ZH5A 2GHWA 2MZQA 2OPQB 2EFVA 1BQNA 2IAJA 2QT7A 1VC6A 2C3OA 2JEGA 4Q0BA 1HWUA 1REVB 5IXUA 1DQ8A 2KKHA 4HTJA 5T7LB 4J9SA 5DETA 1X4HA 2PE8A 1KFSA 2V94A 2UV8A 1RQ0A 4PXDA 3MZIA 3HVTA 3KLIB 3HKZD 2ZITA 5FIIA 1AXQA 1VK3A 5CQGA 2Z4PA 2DR8A 1D8ZA 4L72B 2LQ5A 3OL8A 3T5KA 1B0VA 2F3JA 3QAEA 4ED6A 5KFQA 3QJJA 3G71S 3MPYA 4X4OA 5KFAA 2N4DA 2IVYA 5D78A 2PA8D 3NAHA 4Y0FA 3CIZA 2C3YA 2HIQA 5CYQB 3IR7B 4PG7A 4F26A 2EG2A 4HTIA 4M95A 1K1SA 3OL9A 2HNDA 2DGUA 1FRXA 1WTFA 2KYZA 4ZCKA 1VMBA 1RT6A 2HGNA 4C9DA 2BA9A 1H2VZ 1MMDA 3IWXA 2R7QA 2V2KA 2QLWA 2VC0A 1UWBA 4ED8A 3PACA 4HEA9 5G0RA 4ID5A 1LWFB 1RT5B 1TKTA 2LKZA 1LQ9A 1VBXA 2FVRA 1FNMA 3MMCA 2M8DB 2DHSA 4YY3F 3DLKA 4UY8T 1KLMB 2ZBIA 2V8GA 3JTPA 3Q2TC 3I0SB 3CC4S 3PEJA 4TU8A 3E3XA 3RRHA 4JI4F 4IG3A 2YY3A 5A8KA 1ROFA 3GFZA 4YDXA 3QYYA 1RYSA 3N28A 4BC7A 4NRUA 1KSPA 2VODA 2NUHA 4PRFA 4IDKB 3TA1A 4F4XA 1HNIA 2D74B 4ES1A 2RS2A 5CA5A 4G1QB 1LWEA 1S1WA 1QE1B 2RH3A 4J9PA 1HR0F 4DQPA 4OZ0A 4ITSA 3CDAA 5EHHA 4M1KA 1N0UA 1UVJA 4WKYA 5J2QB 3I55S 1JLGA 3GR0A 3OUYA 4IKAA 2HS4A 4GC6A 2BR0A 3UR0A 4MK7A 3DLJA 3UQSA 1HQUB 2O01C 4HH1A 3G4SS 4FXWA 1H0HB 2HQIA 3C6UA 5E33A 4NYPA 1NEEA 1U1QA 2WAQD 2DO4A 1R8BA 2J6UA 1MU2B 3CTRA 3RU0A 1RT2A 2R2TA 2QE5A 2HGLA 2VASA 3FSXA 3OJUA 2OD6A 1VQOS 4I2QA 2BOPA 2D9OA 4CCHA 1WF2A 1FDNA 3JYTB 2ZJQQ 2BACA 2ROEA 3AHPA 1D9AA 1YRTA 3Q8RB 4WK3A 2K7KA 4DX8H 5AXNA 1TL1B 4K2XA 1S0MA 3P5TL 1TL5A 4GO7X 1EETA 1FD2A 4WIIA 4MIAA 2GCFA 3MD3A 4ZP9A 2E9ZA 2B7CB 4MK8A 2JX2A 5HN0A 4M94A 3T3FA 5MLCV 5EDWA 4TQRA 3LAMA 2B56A 4ECZA 2KT2A 1FO1A 4K4ZA 3VALA 2CPFA 4OHZA 5IWAF 1RK8A 4FXDA 3QGIA 2RQKA 5IFMA 5C42B 5KG4A 3R5DA 1E6YB 5CH7B 2NS1B 2J9EA 4QW9A 3QIPB 4NLSA 1GH8A 2BQRA 2PN6A 3SCJE 4ZVGA 1WI6A 1N88A 2CVIA 4AE5A 1N54B 2YKPA 2LA4A 4K59A 3HT3A 1RTDA 2YNIA 2EKYA 4J9KA 1WHXA 3B4MA 1YJ9S 4DG1B 4MAKA 2ZE2A 3JSYA 1A6LA 4MYUA 4JV1A 3CULA 4CO2A 2ZOGA 4LT6A 3G96A 4B9VA 2PIIA 3WDOA 4DR4F 1RTHB 1TL3A 2V9KA 3O3LA 4C3LA 5F8IA 4EFAC 1KTQA 2FUG9 4UQGA 2FJBB 4RW8A 4G1QA 3HX9A 1ZM3A 2COLA 2XG8A 4WTYA 3J7YI 2DR7A 3P49B 2DPJA 2I5JB 3DN9A 4CQ1A 1LK7A 3IGNA 5KFGA 4B3TF 4AYBD 2B9WA 2EBGA 2KVIA 4DV2F 2ZUGA 1ZETA 4ED3A 2C2EA 5CYQA 5CXTA 3MEEB 2RVJA 5F8HA 4MMOA 2AV5A 2B6AA 4QCLA 3AH6A 4DR1F 2M70A 1QSYA 2OTLS 3DC2A 4Q8EA 3QIDA 2NSCA 5A8RA 3MAQA 4LIWA 4JI7F 1S77D 3DMJB 2JVOA 3DHWC 2KFNA 2UVWA 2HAIA 2EWHA 2ZBCA 4J9OA 4EUVA 5IT0A 3QJPA 3SSSA 1U45A 1O8BA 2PI5A 2EC0A 3MUTP 1Y5IB 1RKIA 2YNFA 4H4MB 3VQTA 2V9WA 2LXUA 3MTJA 5CYMA 1HNVB 2L3MA 3IO1A 4N47A 2YNHA 3WX4A 2MZRA 2NPFA 4DSIA 1REVA 2QYCA 2B4PA 4MJKA 2QSFA 1ELOA 5J1NA 3X3UA 4TNOA 2FVQA 1NHUA 5HO4A 4DN0A 1DLOB 2D3UA 2ILZA 3MPWA 3O1LA 3VWSA 2IC3B 3GSDA 3MM8B 2R2SA 4YEAA 1FNOA 2AYEA 2VBYA 3VZIA 5DQHA 4IQMA 1IKXA 1A7GE 3DLGB 1IKYB 1KLNA 4YMEA 1Z4UA 1NK0A 4NA2A 4OJHA 3SDEA 4NZ0A 5E41A 3MM5B 4FBTA 2CKWA 4CTAA 4KV8B 4NYOA 5AXMA 2V8VA 4OHXA 4EEYA 1HNIB 2MZTA 1DARA 2E5IA 2OPRB 3BGFA 3QJLA 1VIOA 5E3AA 3DRSA 4FF4A 2NSBA 3UR3C 4IRCA 4KIAA 4N56A 3CMES 2E66A 5KT3A 1AFJA 1S48A 4OX6A 5EWFA 4WFBQ 4QWEA 1MW7A 1HA1A 1WACA 4PQAA 2N7YA 4O3SA 2YNFB 1XWLA 3SV3A 3BR9A 4K4UA 4BWJA 5F0WA 4LSLA 2W9CA 1UETA 3CJKB 3RTVA 4OI4A 1LW2A 3NCPA 5E3PA 4ILMA 2GGPB 3DLKB 4OX7A 2WBMA 4RBVA 2DHGA 2DNHA 1F5AA 5F8LA 3IRXB 5B0AA 2DNKA 1HQEA 2DNRA 4CIOA 2K8GA 5K14A 4CI0B 4A47A 1KC8T 3I82A 3N9UC 2V4RA 4KBIA 1Y4ZB 2OPSB 2DGSA 1S9GB 2VA3A 1VLYA 1V6HA 4RZRA 3UD3P 4DS4A 1ZAVA 2BW2A 3T6JA 3I6PA 4DL3A 3CIMA 2IVMA 5KFDA 3HHLB 2AGPA 1HBUB 4RW4B 3KYLA 5L8RC 1X5TA 1Z2ZA 2FHJA 4IH6A 4NWBA 5C24A 2JOQA 3S01A 1FK9B 2A18A 2EPIA 3H98A 3IRXA 4CO4A 2PT0A 1GTEA 2G1DA 3BGUA 4I0WA 2XNRA 3U02A 4EWTA 4XPCA 3VR1A 1FRJA 1YRUA 2RKIA 3JSBA 3MCSA 4NLYA 5KFUA 3EYZA 4C8KA 3BZQA 4GKJF 1BY9A 2XMUA 5GVQA 2O3DA 3EGZA 3ENWA 1Y3KA 3J80Y 1VQ5S 3O44A 4RW4A 4F50A 2VD3A 4ID8A 5FLXY 2ZHOA 2KDOA 3R5CA 2XLIA 1QSSA 4OI2A 4X84A 3UCGA 4YOEA 2ABYA 1S1XB 3MM6A 3NLCA 5LXYA 1DTTB 2BV3A 4G1PA 1Q79A 4L6V3 2IHR1 2KM8B 2W4CA 2BM1A 2WOMA 3I5CA 3NWGA 1NJWA 3DOLA 2GIQA 4H54A 3SSQA 4YUDA 1YTYA 2YQ3A 3C3LA 2OKQA 3MECA