1VQPS

The structure of the transition state analogue "rap" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 22
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vqpS00
2KVIA 1PGZA 2CQ4A 3PIOQ 3NS6A 1X4CA 2BZ2A 2MZRA 3MOJB 2DGTA 2LCWA 3L3CA 1QVGR 2YWKA 4TLQA 2ERRA 1JJHA 4PKDB 2D3OR 5D77A 3CCES 1FNXH 3VAJA 3UCZP 2DB1A 2CQPA 2E5IA 1BY9A 2LA6A 3TP2A 2LEBA 5CXTA 3MURP 3LPYA 1VC6A 2RNEA 4IUFA 1X4EA 1F9FA 2MGZB 1WEXA 1X5SA 3CCMS 1WG1A 3R1LA 2RRBA 1VQOS 1WEYA 2SXLA 3J7YU 1VC5A 2M8DB 2G4BA 4BS2A 5H1SV 1WELA 5HL7Q 1QM9A 3VAIA 2I2YA 3EX7B 3CMAS 2DGVA 1A7GE 2E5JA 2MB0B 1U2FA 5DM7Q 3G6ES 3THTA 1DBDA 2CPEA 4QPTA 3CMES 1YI2S 4IO9Q 2MKJA 1WHXA 5CYJA 4WFAQ 1NU4A 1YWXA 3MD1A 4F02A 1M90T 5D78A 2XB2D 4C4WA 2LXUA 1VQ7S 1RKJA 2U2FA 3CCUS 1VQMS 4TU8A 3IWNC 4U67Q 2CPHA 4FXVA 2M70A 2D9OA 1WG5A 2GO9A 4Y00A 5EN1A 3U1LA 1N88A 1JJ2R 3SDEB 2DNRA 3BO2A 2AYGA 2CQHA 3NS5A 2M8HA 1VQLS 1VQKS 2OIHA 2LMIA 3Q2TC 5LXYA 2DNNA 2LECA 1FJEB 2CPFA 4YB1P 4QU6A 2MZQA 2EVZA 5LJ5Y 1DRZA 2CQDA 3EGNA 1M5OC 3NNHA 5IFMA 3CCVS 3CF5Q 5GAEU 1W2BR 1YTYA 1HL6A 3FEXB 3HHNB 2CQ3A 2FC8A 2NLWA 1PO6A 5CA5A 1UFWA 2DIVA 2LA4A 1URNA 2KH9A 3MD3A 2RT3A 2CQGA 5IM0A 2MQQA 2KHCA 1U1KA 5JVGQ 2XS2A 2DH8A 3VF0B 2MPUA 2OSQA 3RW6A 3CCSS 3JB9k 1U1PA 2MSSA 2DGWA 1KC8T 3MXHP 4P6QA 2MKIA 1SJRA 4UY8T 1X4DA 2LKZA 3VAHA 3ULHA 2F3JA 2OSRA 3K0JA 2M7SA 3R27A 4YUDA 2MZ1A 3CCRS 1X4FA 1M5VC 5DETA 1JMTA 4RU2A 3P49B 3MUMP 1VC0A 1U1OA 1OPIA 2F9JA 1U6BA 1VQ5S 4ED5A 1Q81T 2RVJA 2ADCA 2MXYA 2HVZA 1VQ9S 3UCGA 2BOPA 2MKSA 2DNOA 3P5TL 2DO4A 2KXNB 2DK2A 1P1TA 3MUTP 2XS5A 2LXIA 3BO3A 3R1HA 3VALA 2CQ0A 4QQBA 5DM6Q 2DNLA 2J0SD 3S8SA 2VOPA 3UD3P 2XS7A 1M1KT 1N52B 4A8XA 2OTJS 2CJKA 2KT5A 3B4MA 3V4MA 2KXFA 1WEZA 2GHPA 3CC7S 1P27B 1DZ5A 2MQLA 4LIRA 2X1FA 3N9UC 1H2VZ 1O0PA 2DGSA 3VAKA 4TU7A 1U1LA 2M4MA 2PEHA 5HO4A 3MI7X 4CH0S 2DNYA 2AYBA 1X4GA 2AYMA 3PIPQ 3G4SS 2L41A 1KQSR 1YJ9S 4PR6A 2QFJA 2LQ5A 2DNGA 2KRBA 2OJ3A 3US5A 3NMRA 2A3JA 3RW7A 3BEGB 2D9PA 1SJ4P 3NNAA 2HZCA 2MSTA 1VQ4S 1YJNS 2RQ4A 3UWTA 2ADBA 1OWXA 4CIOA 3G8TA 3THPA 2CPDA 2FC9A 2MZTA 1X5OA 2AD9A 1X4BA 3G9CA 3Q2SC 4F26A 2U1AA 5LJ3Y 1OIAA 2CQ2A 1U1MA 2VONA 1WTBA 2DHXA 1A9NB 2KN4A 1WWHA 2DGQA 3CULA 2KYXA 1KOOA 1ZH5A 2L08A 1AUDA 2OTLS 4Z2XA 2AYEA 4CH1A 1X5PA 2CQIA 2J76E 1UW4A 4C7QA 5IM0B 4Y0FA 1IQTA 2I38A 1H6KX 3UCUP 1FJCA 2DIUA 1FJ7A 3DXBA 5MLCV 1WI8A 2MYFA 5DDPC 1R8PA 2MQMA 1M5PC 2RS2A 1UAWA 1X4AA 3S7RA 1WF0A 2M0GB 2YH1A 2UP1A 1H2UX 2N7CA 1M5KC 2PE8A 5LSOA 2Q79A 2JWNA 4QU7A 2MKHA 4LJMA 4UQTA 2MHNA 2ZJQQ 3D2WA 1G2EA 4EGLA 2J8AA 4ZKAA 4OZ0A 3I55S 2DGOA 2KU7A 3CCQS 1Q86T 2DISA 2K8GA 2MZJA 2FHOB 1ZZNA 2WBRA 2FY1A 1SJ3P 1NO8A 3CC2S 2X1GA 2ZJPQ 3CC4S 2LYVA 3VAGA 1QVFR 2L9WA 1VQPS 2DGXA 4FXWA 2J0QD 5FJ4A 1L3KA 2MMYA 3CCLS 1YJWS 3H2VE 3CXCR 1B7FA 1FT8A 2MZSA 2MQPA 1U1QA 4ERDA 5JVHQ 4CQ1A 2CPZA 2MY7A 2DO0A 1ZZFA 5GVQA 3ZZYA 2MJUA 1K8AT 3CUNA 2FPHX 2DGUA 2HGNA 2YKAA 2HYIB 2DNQA 1KD1T 2NZ4A 1VQ8S 1S79A 2EK6A 1DHMA 2M52A 3P6YC 1WG4A 4OZ1A 3EGZA 2DNZA 3TO8A 3OW2R 2VOOA 3CCJS 1YIJS 2DNMA 1WF1A 2DH7A 4M5DB 2XSFA 2CPYA 2JVRA 1YITS 1JJ4A 2X1BA 1NJIT 5IQQA 2F9DA 5GAHU 2VODA 1R8HA 1SJFA 1S72S 3B4DA 3LQVA 3G8SA 1K9MT 4W92B 3FEYB 2E44A 2YTCA 2DHSA 1Q7YT 4TU9A 4C0OC 2MKCA 3VAMA 2MGZA 1UP1A 3BS9A 3MDFA 1Q82T 2DITA 4IOAQ 3HI9A 2CPJA 1U6FA 3BO4A 2M9KA 3MUVP 3IRWP 3UD4P 1FXLA 1SXLA 2KXHA 3UE2A 1WI6A 5GAGU 1N54B 3H2UB 2RU3A 2DH9A 3SXLA 2N3LA 2YH0A 5DDRC 2RQCA 2MQNA 2EK1A 5GMKa 1HD0A 4V19X 4W90B 2ZJRQ 1VBXA 5ITHA 1XN9A 4WFNQ 2KM8C 2E5HA 1N8RT 2JVOA 2DNKA 2XNRA 2CQ1A 2G1DA 2M88A 2O3DA 3S01A 3VAFA 2QEXS 1VQNS 1X5TA 2G0CA 1D8ZA 1CVJA 1HD1A 2E5GA 1VQ6S 2DNPA 2K3KA 2MQOA 2XNQA 3P3DA 3CTRA 4WF9Q 3G96A 2KFYA 3NNCA 1FHTA 2CQCA 2RRAA 3ZZZA 2CPXA 2MY8A 2HGMA 3U1MA 2MKKA 3I56S 4J5OA 5LSLA 2DHAA 5GADU 1WF2A 1X0FA 1FO1A 3S6EA 2KG0A 5BJRA 3G71S 1VBZA 1K73T 1YHQS 1X4HA 3CPWR 3SDEA 2DHGA 1U1NA 4PRFA 1WHWA 5DDQC 1KOHA 1WHVA 2MJNA 1WHYA 2V94A 1OO0B 3TYTA 5LXRA 1H2TZ 2B0GA 2CQBA 3SMZA 2CPIA 2N3OA 1U1RA 3J7ZT 2KRRA 4WKRA 3DLLQ 2KG1A 4IOCQ 2HGLA 1HA1A 2RUGA 1SJQA 2KM8B 3CD6S 4YOEA 4WFBQ 1D9AA 2QA4S 2KI2A 2JX2A 2LEAA 2X1AA 1VBYA 2RS8A 2DNHA 4WIIA 1RK8A 4WCEQ 4LMZA 2M2BA 2N82B 5DDOC 2JRSA 4F25A
chains in the Genus database with same CATH superfamily
4CO0A 3C8YA 1D09B 1FKOB 2BVZA 3HHLC 4TVAB 1SKSA 4DL3A 1R3NA 1O51A 1X9WA 3LW5C 4NI2A 1NNDA 4H4KA 1UA1A 2QLWA 1ROFA 1DQ8A 4HT7A 1QE1B 1TAUA 3N0VA 1JLAA 2WVEA 3DLGA 1OY6A 4ZPVR 5FD1A 1N56A 1WEYA 4DL5A 1YZ6A 1LOUA 3IGVA 3G6ES 1SH3A 2OPRB 4O4GA 1T9XA 3KLHB 4IO9Q 3R5AA 1PKUA 3A4TA 2WK4A 1F5AA 3OTEA 2B4UA 2LXUA 3AHPA 3MAQA 2OPRA 1RT6A 3CCUS 1VQMS 3MM8B 2ACMA 2A18A 1FWPA 2CPHA 4DR4F 5KFWA 3M4XA 5J2PB 3HF5A 1SQEA 2DYAA 4YR0A 2ZH6A 4YB1P 4QU6A 3DLEB 2MZQA 1FXRA 5J2PA 3EGNA 1HBUB 3CCVS 1VDHA 3VVTA 3DLEA 1XR6A 1U6ZA 3ZXWA 4WXOA 4KFBB 3DRSA 3JB9k 4HEA9 4USHA 4JI6J 1FA0A 1CQNA 1QD1A 2A10A 3N79A 4LF2A 2CJBA 4RX6A 4F36A 1HNWJ 2IVMA 2WB1D 3QGHA 1BD6A 2OELA 3T5JA 4ZOSA 2HLUA 3I31A 1JNRB 2XMMA 2MKSA 2K3IA 4XAKA 4OZLA 2L48A 4K5RA 1NK9A 3MPVA 1F2HA 2ZD1B 3UNGC 4NXNJ 1AYEA 2J9EA 3AD7C 4CRJA 3KMQA 1B7YB 1KONA 5B0CA 2BANB 4IRDA 2XWXA 1RWKB 4PQAA 2N4DA 4CO5A 2YKPA 2JC0A 2UUWA 4QYZJ 1IM6A 2BANA 2A3JA 3M1VB 1VQ4S 2UXDF 1TELA 2ROPA 1VQSA 4UTGA 1T05A 3BN7A 3GJRB 4DJBA 4ZVQB 4WP9A 3LAKA 1OIAA 2HQGA 4YB5A 1D8YA 1MROA 2GHWA 2LDIA 4B3RF 2OTLS 4CH1A 3K2YA 2M5YA 2HS0A 3NGTA 5DDPC 2XMVA 2B8QA 1HLWA 1H2UX 3MPYA 2PE8A 3CJQA 7AT1B 2D3UA 1RAGB 2MHNA 2W1BA 3QQCD 3TX0A 1CJKB 2ZBPA 2FYXA 1ZA1B 1QUPA 1Q86T 1P6TA 1MU2A 1SC3B 1NO8A 4KGZB 3MR2A 1Y9OA 2GJFA 2HFUA 2L9WA 2W2PP 4J9LA 2W2OP 5FJ4A 2MMYA 2HNZA 4K7QA 2IM0A 3JS9A 3K58A 4ELUA 3H2VE 3F41A 2CPZA 2OD4A 3JTOA 2C2EA 1YX2A 1RZMA 4MJKA 1WG4A 1MWZA 4IDKB 2ZITA 4PG8A 2XSFA 2GS8A 4ES3A 2JVRA 3QPIA 3CEDA 4FYXB 4MKAA 4ZLLA 2ZWOA 1K9MT 1TVRA 2E44A 5G0RB 4E8UA 3HSDA 3HFKA 2GIQA 3PJ9A 4DV4F 1SC4B 3UE2A 2VFTA 2VQFJ 1N54B 2JSXA 3H5SA 3SXLA 2FZGB 3FMWA 5ITHA 3K5NA 1XN9A 3I82A 1UETA 5C24A 2X3DA 3D54A 4O44A 1UZDA 5IWAJ 1RWUA 4B9LA 4RNOA 3BDPA 3W9HA 2ZVIA 3A12A 3EMTA 3Q83A 1L3TA 3R6LB 5LSLA 3UDVA 1KEKA 3MEDB 5EWGA 3HHEA 1EIYB 4WU2A 1KR4A 2B0GA 2CQBA 3O44A 2FJEB 3MEDA 3KG1A 5HMZA 2F1FA 2Y9HA 3GFZA 4E0DA 2V5HG 3MR6A 4PG6A 3RRKA 5B09A 4DV3F 5K8PA 2XWYA 1J5EJ 2R7RA 2I0XA 4HHJA 5T7LB 1LWEA 4EWTA 2HRUA 3CDEA 4JI6F 1IR2A 4DLGA 1ZBTA 4X4TA 1HNWF 3BYRA 4F0HA 5T7LA 3GU0A 4UOCA 3IGNA 1UWBB 4RPFA 4DCJB 2HWHA 4OJ3A 3R97A 3H4DA 3KK1B 2JC1A 4NMLA 1NDPA 1HBMB 2VH7A 2EWHA 2ASLA 5DLGA 1UWBA 2Q1LA 4LRBA 3J7YU 2HHHF 3OFFA 4Y2CA 1A7GE 2B4OA 5HSPA 4K4WA 3BN4A 3TA2A 2FB0A 5ETSA 1WHXA 2Z0GA 1ZYQA 4ED6A 5KFIA 3MPUB 1UJ4A 4I2PB 4ILRA 2VFVA 2ILYA 1JJ2R 4ZVEA 1VCTA 5KFLA 2HVIA 2XCPA 2XCAA 1VQLS 1NK5A 4B3SJ 3DOLB 2J7UA 3TWZA 3ZZOA 2XEXA 3A8KA 4JOUA 2BM1A 3D3BJ 4TLRA 4ED1A 4DV5F 5DZ7A 4OYOA 2CQGA 1X31C 3K17A 3DLBA 1KC8T 4PAAA 1NCLA 3L7UA 2HHXA 2DCLA 2CZ4A 1RT2A 4NE9C 1QSYA 2A2DA 1KSPA 1S0VA 2BE7D 2VDHA 1WC6A 4IKAA 1U1OA 5KFTA 1Q81T 4LQ3A 3H25A 3T41A 2A2CA 2V8PA 2HWIA 4URSA 1JLGB 3GJSB 5F8IA 2VOPA 1Q5YA 3UO0A 4USIA 3W2WB 1LXNA 2KT5A 1YDLA 2GHPA 1JLGA 1UVKA 1MMDA 2QRRA 3E2EA 5AE1A 2IAJA 2D69A 1R6YA 3G4SS 3W2WA 3OR1A 3R7SB 4ZLNA 2FD2A 1SJ4P 3UN3A 2E1CA 1OWXA 1S9EB 4CCHA 1O5JA 3QAUA 3G8TA 3ENAA 1EETB 3PX0A 4QIVA 3HZEA 4ZPTR 4Y34A 5L1LA 6FDRA 2VONA 2J6TA 2VQFF 2OPSB 3A8JA 2R9LA 1WSRA 3FDSA 4KY3A 3PCOB 1X5PA 4NYPA 2HG4A 3DDIA 4FDFA 5C7PA 2GA7A 2FHMA 5IWAF 1FJ7A 2YX1A 2H65B 2L9NA 3H0PA 4NYZA 4NX9A 4P7VA 4H4OA 2ZKUA 3JTPA 4G1QB 2Q79A 4WZQA 5MAOA 2JWNA 4HHUA 2BE2A 4UQTA 4TQSA 1L5UA 4PWDB 3V6HA 1CPZA 3OXFA 4K4XA 3O3LA 4G1QA 3G2XA 1HNIB 1PCAA 2DXDA 5F9NA 2BX6A 2DJWA 1NDCA 3ETOA 3GIJA 4M5HA 1VQPS 4FXWA 4PWDA 2VG7A 1YJWS 2F4FA 5LL6d 2MY7A 2HBZB 4A48A 1SB6A 1J5EF 1S1UA 4Q8EA 2R2TA 1DHMA 3FVYA 3EZ5A 2YWEA 2DNZA 4RL1A 3OW2R 1WSVA 2V2KA 3PJWA 1D0EA 2ZZTA 4P10A 3RAXA 1ZAXA 2Q6BA 2X1BA 2CVIA 1SJFA 1S72S 1U48A 3HPOA 1GXLA 2H48B 2MKCA 1XNRJ 2Q66A 3UD4P 1UJ5A 3I87A 2W8LA 2RDJA 4OIXA 3W2VB 4FF4A 5LOQA 3MTKA 2MLXA 3R5GA 1LFPA 4G1IA 1EKRA 2QEXS 3Q8PB 3MPWA 1LEOA 2DNPA 1FDAA 1YJ7A 3ZZZA 3AJDA 3RBDA 4OJ1A 5GADU 3V6DA 5D3GB 3G87A 5BJRA 2I5JB 1T9TA 1KBRA 4RU9A 3BSNA 3KJQB 4B3SF 1X8DA 2I5JA 2H3EB 1RHMB 1U24A 3MM9A 1AFJA 3C2PA 3CD7A 3OT9A 1D9AA 3GCXP 3ILJA 4NLSA 1NDKA 1SBRA 3KLEA 1Q8KA 1ZTTA 2D3OR 2Z4PA 3DKDA 5C25B 2R8IA 3UNYA 3FBCA 1IUJA 2RNEA 3KK2A 5C25A 4GC6A 1P9YA 1RTHA 1NHUA 2XZDB 1TKTA 3R8YA 3HSZA 1Q1KA 4ZLPA 4WYWA 3FMBA 3VZHA 5DM7Q 4PPDA 3AA8A 5FDLB 1NU4A 1FVQA 4F02A 1J5OB 1R8BA 3TQ1A 5K14A 1EAYC 3GIRA 5A2QY 1R43A 4Q2LA 2D9OA 4OHXA 4EO6A 2G9OA 4OYBA 4X4SA 5E3PA 4ED7A 2Y0BB 5LXYA 3BV8A 4B3OB 2Z2MA 2CQDA 4NLXA 2VL1A 4Y2AA 1X0PA 1CS4B 4WFXA 1W2BR 3FFIA 5CD4H 4DQSA 2VA3A 1KVKA 2V8DA 3DNCA 2LA4A 4U95A 2P8IA 3UD5A 4M5IA 1FTCA 4DV2F 1L3UA 4ES1A 1UCNA 4DX6A 4MK9A 3NS7B 4P2XA 1SIWB 4YHHJ 3PX6A 3QMQA 4O23A 1S0OA 4AFFA 3ITHA 3OFGA 1PAUB 4JYAJ 3VV2B 4F4WA 3NG8A 1SH2A 5KFUA 3TJ9A 1U6BA 5DGAA 3DHWC 1RCXB 1TL1A 2HIYA 2QZ8A 2BOPA 1JLCB 2GGPA 2QL9B 1GH8A 2FVCA 1G3OA 3S8SA 4MYUA 1JLCA 4DS4A 3FBBA 2CWKA 4Q7AA 4OZJA 3LANA 4KC5A 3ZNUA 2L41A 4BC9A 1IWGA 1M5HA 1S6OA 5EDWA 2OGUA 2W25A 4DWIA 3NOCA 5KG3A 2HBQB 1YJNS 2AJ1A 4LF4J 1IBKJ 2FC9A 4NCBA 1XNRF 1KVIA 5D0RA 3DRRB 2BQUA 3O8WA 2LVWA 1LW2A 2PO4A 2KN4A 2L08A 4ED2A 1WC4A 1J27A 1NAQA 1MMLA 3RTVA 1NUEA 3W5XA 1FJCA 1QAIA 3JSRA 2OUGA 1UVJA 4FKXA 4OJGA 4QR1A 4F4ZA 2EFPA 3TUZC 1T95A 3CCQS 2V2VA 1SJ3P 2CKWA 1CULB 3OSPA 1N6QA 5F8MA 3MAAB 5E2QA 4X62F 3SBMA 4C11A 4EZ9A 3D9BA 2HHWA 1I3OB 2R7QA 4MIAA 5HROB 3M6UA 3QIPB 3RUBL 2F8HA 2QT7A 3B82A 2VJUA 4M63A 3MMAB 4CO3A 3EGVA 4L6V3 2G2ZA 3QT6A 1FRJA 1ZPVA 3MMAA 2FVQA 1ZPWX 2QN6B 3C6UA 2H51B 3QT5A 2BEFA 3BO4A 3ZTOA 3BBCA 3PJXA 5B0BA 4Y28C 2J7KA 4OJHA 3WC2A 2R8GA 4LQ9A 4AQYJ 3TZZA 5D0EA 1N8RT 2UUBJ 4P2FA 3C16B 2MLZA 5HJXA 1L3VA 4YDXA 3U1MA 2W7PA 1NJYA 4C2MA 1RJJA 2RMLA 3UDEA 4FNHA 3V2UC 1Q0NA 4I69A 3WX8A 2QTWA 1RE1B 3OTBA 2FJBB 3I5BA 1HWUA 3R7BB 2QYCA 1IXKA 1HA1A 3DDKA 1BQNA 2YY3A 3UI3A 3PO4A 4WFBQ 1VBKA 4ATNA 3SSRA 1GX5A 2F40A 3QZ7A 4YHHF 1QSLA 1W25A 1WKJA 1O6XA 4DL7A 4DR6J 2COLA 3CCES 1HNVA 1KLNA 2WVCA 1FI4A 5BYRA 3QGIA 2BMBA 4EO8A 1UFKA 3RJMB 4RW6B 3WZ0A 4ZJOA 2A6OA 3BH6B 3V4IB 1REVA 3K8WA 3C46A 2YQ1A 1VC5A 1KQKA 2CNNB 1B64A 4J9SA 5HL7Q 3QRQA 1T02A 4I64A 3BKTA 1NJWA 3HD1A 1U0HA 1IR0A 1IJFB 4DFMA 2KO1A 3RAQA 1QDUB 4NZ6A 3SCIE 2HRTA 3MMJA 4IFVB 4QWAA 4KIAA 1JLEB 3VTIA 5HAOA 3BKFA 4KGMA 2P2CB 3EPGA 4IFVA 4LF4F 1IBKF 1XJWB 3MM7B 3PG9A 3C3LA 3EJMA 1R7IA 4J9RA 3NGKA 3U7JA 2EVZA 3NMAA 3D6FB 3M6WA 4LREA 3W1YC 4R8UB 2CQ3A 2R2UA 1RYRA 3ENVA 1LK7A 4QWBA 1TR0A 4LR9A 3CCSS 1LNQA 3GB0A 3D0GE 4R8UA 3CJTA 4WYLA 1YRXA 2MDAA 2G0JA 4UY8T 3GYXB 3ZC4A 4C98A 3TW0A 1X4FA 3E01B 3DFEA 3DGPA 1YSJA 4OHZA 2VPWB 5AXMA 2Y1IA 1UVMA 4OI2A 1OPIA 3MMCA 2AJQA 5F0WA 4ALZA 1TU0B 4DFKA 2V69A 2ADCA 3E01A 1VQ9S 2B43A 3J81U 1HQUB 1RLCL 1Y4ZB 3IM9A 1WOPA 4WIQA 1RT7B 4DUZF 2V4JB 4DV0J 3A8EA 1TKZB 3H4BA 4KJIA 3IWLA 4AL6A 1HQUA 1DY3A 1SUQB 3TAMA 1I94J 1CC7A 4ZVFA 1WDDA 1DZ5A 1RT7A 2V4JA 1NK0A 2C28A 3PEHA 3VAKA 3BF4A 4JV5J 3IRXB 4B9TA 4RW8B 3IAS9 1NMEB 3ISND 4X65F 2R42A 2V4QA 3J81Y 4DDFA 2GHVC 2C2NA 1JXEA 1EARA 2CPDA 5HATA 1ZETA 5E0OA 1FK9B 2V67A 4A8SA 2EG1A 2CDRB 1HHTP 5B0FA 1C0UB 1WWHA 4AQYF 2KJVA 4NLTA 3M32B 1FK9A 1M0SA 1S7HA 5KT7A 4JI8F 2UUBF 3FCHA 1R8PA 3DLJA 3N6MA 1UAWA 1TUGB 3M32A 2VKZG 4HL9A 4CLZA 3ZNJ1 3RB4A 4CNYA 3SQGB 1UZHA 3DHXA 3LOUA 1B0VA 4EGLA 1HIYA 2WB4A 3SFUA 1CJTB 2FHOB 4A8YA 4MFBB 4HKQA 3SQGA 2AJFE 3R5DA 4MKVA 2FIUA 2H1YA 2R7WA 3CVKA 4MFBA 5IQ6A 1ZM9A 3TR5A 2MJUA 4NRUA 2DNQA 2JL9A 4YEAA 2B7BB 1U02A 2HZVA 3EGZA 5I42A 2HVDA 2OHDA 1RA7A 4MYTA 2C3OA 3R6GB 3SSSA 4UY85 4DR6F 3Q8YA 3JSMB 1NK6A 4PWWA 2CPYA 4C8MA 5IQQA 2P5VA 1NSKL 2B5JB 2XLKA 1I6JA 4W92B 4LRFA 4W98A 2YTCA 4JI2J 2EW9A 4O0NA 3BS9A 4FF2A 3GIIA 3K59A 1SXLA 2N7YA 2J8SA 2JLGA 1VMBA 2MTLA 4X64J 1VBXA 2Y8YA 1XIQA 2APOA 4LF6J 1IBMJ 1HWLA 2I8EA 4ZLJA 1UWAA 3OVAA 2XNQA 1YG0A 2OMLA 1U0SA 2WCXA 5KFPA 1T8EA 1KRPA 1XR5A 2PFFB 2BJ8A 1VBZA 3AD9C 1N0UA 5A6PA 4MH8A 1WHVA 2HNYB 4B9UA 3NGSA 4O3OA 4CLLA 2ALYB 1F1BB 2NYHA 3KTQA 3Q8RB 1NSPA 1BQXA 4EZ6A 1C1CB 4LF1A 2HNYA 3IS9B 2YNHB 3ICLA 3ZZTA 5F3TA 3NBPB 2M2BA 3IS9A 4USUA 4M95A 1PGZA 3H5UA 3LTOA 4UZBA 1YJUA 2ASJA 1TZ0A 1QVGR 1S5ZA 1GXUA 4K59A 1OYDA 4DR7J 4CM2A 4OX6A 3UN2A 2WONB 3C6TB 1VS3A 4IUFA 4ECWA 3FCVA 3C6TA 4X84A 2IVYA 4JP8A 2EBEA 1VOMA 3D28A 1S9GB 1GX6A 1SH0A 4U9RA 2BKOA 1FDNA 1I94F 2UVUA 4QWCA 5J1EA 1GMVA 1SI9A 5D78A 2YNIA 5LMUJ 2ZUGA 4TU8A 2HMIB 3E51A 2M70A 1DQAA 1WG5A 1N88A 2HMIA 2VQEJ 5M2RA 1ZTWA 3Q22A 1MG7A 3C15A 1FE0A 3PACA 5LMNJ 2R7TA 3TJAA 2BJ7A 2DXEA 1URNA 4JB8B 2QJ3A 1S77D 2LDYA 2P6SA 5KT5A 2HHVA 2CJ9A 1TKXB 4J9VA 3RYLA 1GEHA 2LQBA 4H4MA 1HFEL 3LUYA 4MKYA 4DL0C 2EFQA 3FBFA 1TKXA 1B4SA 3SV3A 1NPRA 1VIXA 3UDLA 4YQWA 3GFYA 5KOWA 3X3UA 4A8MP 2HWTA 5D0GA 1H7WA 4C9DA 3M6VA 3AA9A 4CM0A 2W01A 4Y65A 2B9EA 2YNGA 2DGSA 2K1RB 4IH5A 4OMFG 4LF7J 1KQSR 2JDJA 5C2GA 4A46A 1TK8A 4FVMA 2RU9A 3US5A 1FWKA 2HZCA 2XZWA 1RLDA 3TUIC 4JI2F 2ZOFA 4U8YA 2GFFA 4URQU 3D5MA 2YKMB 4OZNA 4F26A 1Y3JA 2RD5C 2ATCB 2J9DE 3WIUA 4X4RA 1FESA 4LF6F 1PBUA 2I38A 1IBMF 2DIUA 1Q95G 2QFIA 5EX3A 2K06A 1HW8A 1N5YB 2YH1A 3PY8A 2QA1A 3I9ZA 4DXLA 3ZTSA 2F4VJ 3OJUA 1U25A 2J8AA 4EBDA 2V2ZA 3LALA 3KLGA 2MZJA 5DGBA 3CC2S 1YJTA 2BA9A 2C42A 4ITSA 4KV8B 1GNKA 4Q8FA 1CEZA 3N4WA 3QBCA 2IDLA 2RDIA 2DEIA 2WSCC 4U7CA 2GJIA 1ZAVA 4CLSA 4X4QA 2M52A 2ZE2A 5LT5A 2ZH3A 1WC3A 2BKNA 3TO8A 5DLFA 3DMJB 4DU8A 3VVUA 1RT1A 1RWPB 2PN6A 2Z58B 3CCTA 5KFQA 1APSA 5I4MA 4QYRA 3CD0A 1KWMA 1YITS 2Z2LA 1JKHA 3FZ2A 3AJ1A 2F8MA 2VODA 1MN7A 5IT4A 5KFCA 3NOGA 2V8GA 4I6AA 4NOHA 2DITA 3VR1A 1VK8A 3HI9A 3Q8VA 4N76A 5DG8A 1GMWA 2BJ9A 3P5BP 1RBOB 3CJSA 1Y5IB 2E1MC 3N6NA 2BW7A 1EP4B 2CRLA 2KM8C 3V6KA 5J2NA 1HQEB 5LMUF 3LA0A 2VIHA 3EGWB 4GC7A 3FGVA 3M8PB 4K0KJ 5ETKA 2MY8A 3FZBA 4RW9A 1HQEA 2ZBRA 4CLFA 1I5OB 3KHGA 2UZAA 2G0IA 4KHPF 4IFYB 1Y5NB 3SMZA 1S1VB 4RNNA 1VJQA 2KHDA 3W65A 4IQXA 5LMNF 3KLIB 2PC6A 1TTHB 1NDLA 1IWAA 2HK3A 4WP8A 3OVBA 7FDRA 2WTFA 4NLPA 2QSFA 3KLIA 2H9ZA 1T03B 4WE1B 4F25A 4WJBA 4UQGA 4GRSA 3NS6A 4OQJA 1X4CA 3MCNA 4U7UD 3QSIA 1T03A 4WE1A 3OUYB 1RYSA 3GP9A 3MM6A 3R5JB 4DL2A 3OUYA 1F9FA 1WJ9A 4Q0BB 4ID5B 3M2UB 1UL3A 2EKYA 2HURA 3CDAA 2JFKA 2SXLA 2R7VA 1QM9A 3HVWA 4ED8A 2KVQE 4Q0BA 1VI7A 1UPPA 4ID5A 2GIRA 4TY9A 2WZ1A 1RAAB 1KP6A 4ECSA 2GQCA 2R8KA 4PABA 1KNZA 3SZ2A 3FJ2A 3KHHA 4NEYA 2WW8A 1JQGA 4U67Q 2H54B 1FX2A 2J6UA 2BR0A 4EBCA 2BE9B 2EFOA 3AXMA 4XO0A 3W3SA 1UA0A 1N5TA 2VA2A 4BWMA 4YR2A 5H9EJ 3NS5A 1KKHA 4IG0A 1UVLA 1MSWD 1YBAA 1FFGB 2JEJA 1DRZA 2J5AA 1WKLA 2V8VA 3CJRA 4CLUA 3HHNB 2RIJA 3PR5B 5CA5A 2AT1B 3CIZA 2RT3A 4LFAJ 2KHCA 4DZDA 1U1KA 5JVGQ 2XS2A 2DH8A 2OSQA 5KT3A 2DTJA 2CA9A 3DLHA 1HNXJ 3MXHP 1R8AA 2MKIA 2ZUAA 3LP1A 2F7VA 2QLXA 5F9LA 2R4FA 2F4VF 1C0TB 2HPUA 4DLEA 2CZVC 4ZJQA 5L1IA 1FERA 3M8QB 2YX7A 3UCGA 1JLFB 5IT9U 2KXNB 2W7OA 4ZJLA 3MUTP 4ZVHA 2FLPA 2LXIA 4O3SA 1XQIA 3MMBB 3MR3A 2J0SD 2HQFA 1BQMB 2Z30B 2XMAA 2CFXA 1S1XA 2PEHA 1BQMA 1S10A 4NPOA 3A3PB 4PR6A 1TMJA 2LQ5A 2AGPA 2FHKA 4DSLA 3P8BB 3NMRA 2NXCA 4ZP6A 1ZM4A 1VLOA 2RQ4A 5B0AA 5IT9Y 5HVGA 3AOBA 2JJ4D 2PI5A 1K47A 1DTQB 2XLIA 3NCRA 4DZ6A 1QUVA 2DHXA 1KOOA 2UV8G 9ATCB 1KTQA 3BH7B 3K57A 1NEEA 5ETVA 1N34F 1M5PC 4KR0B 4QW9A 1IQZA 5SZTA 4X4OA 1KHWA 2GX8A 2EI5A 4U96A 3PYFA 2DGOA 2K8GA 1K1QA 3FBEA 1R27B 3VAGA 4DSIA 5E5NA 1N5VA 1QVFR 1UW9A 1A6LA 1SJ1A 4PZVA 1U1QA 4AUKA 1W7WA 1FRXA 5DG9A 4DV1J 3OFEA 1NXIA 5HBMA 1S99A 4MIBA 1HYSA 3MM5B 4RNFA 4USWA 5D4NA 2FVSA 3RAMA 4ANCA 2VV5A 4CZCA 3IBWA 2DH7A 2HFVA 5GAEI 4DX8H 2B3TB 3RBXA 4TU9A 1HBNA 3DYAB 3ILLA 2W8KA 2XMTA 8AT1B 2DH9A 2ZH7A 2R2RA 4DUTA 2YVSA 2YH0A 5DDRC 1XTZA 2ZJRQ 3GR0A 4QIGA 2XNRA 4JI4J 2XMKA 2CDQA 2GVDB 2RQMA 2ZNYA 4KGKA 4HACA 1UTAA 2FHJD 1FHTA 3N5BA 1IKVB 4KTQA 2PDAA 2GVDA 3BGOP 3OFHA 4M5NA 1NKBA 3T5KA 2RRNA 5G4DA 3MEGB 2NQPA 1G7CB 3M7VA 5L46A 1IKVA 4B3MJ 4B3TJ 1R31A 1WHYA 2L9DA 1ITPA 3MEGA 2PD1A 3BSAA 3KJVA 3I4HX 2XY6A 1UEKA 2CNLB 1RACB 1RT5B 2GJ2A 5C42A 3DRPA 4CYUB 2JX2A 4O3NA 4LFAF 4WIIA 4ZPCA 1HNXF 3D6TB 3CT9A 1RT5A 4K2JA 1JK9B 1S6QB 3GYGA 3MOJB 4Q2MA 4CTAB 4CYUA 1Q53A 1U09A 1U8SA 1N4LA 2HQCA 3VAJA 2DB1A 2HQ3A 2CQPA 2QA2A 1WORA 4FBUA 4CTAA 2GAHC 3MZIA 4I6WA 3SFGA 4NCAA 2MGZB 3V5RA 3RZAA 1WG1A 3FEZA 3ENQA 1YVFA 1Q78A 3CMAS 4DR2J 1NB2A 3SIPB 3K7RA 1HI1A 1YWXA 2UU9J 1U8WA 4DR4J 2PA8D 4DU7A 2BJDA 2XB2D 1NH8A 3N5FA 1VQ7S 2JEGA 1R8CA 3VHQA 4J9KA 1RHJB 5CYQA 4OI6A 2NS1B 3A1YG 1S9FA 3W8GA 5AE2A 3SDEB 2DNRA 5KFGA 1NK4A 2OIHA 4WK3A 2LECA 3BQ1A 2CVEA 2B4VA 3IWXA 1RTIB 3D66A 3NNHA 1SKWA 2XYHB 1PO6A 2NLWA 1UFWA 2JEFA 3M9OB 4DSKA 4ZCLA 4ENOA 2DKOB 1FE4A 4AE5A 3IG1A 2VFUA 2IC3A 2UUTA 1S97A 2KKHA 3BGRA 3R27A 5GAGI 2V68A 3QLHB 1KN6A 4J7CA 4LR8A 3CE8A 2YNFB 1VC0A 1IVZA 3OXLA 4CLYA 3GTYX 1Y11A 2YNFA 2I9SA 2UV8A 3P5TL 3DC2A 2RHQB 1HWIA 3TAPA 5BR8J 4N5SA 4DV1F 1NHKL 3EZOA 3NXZA 5DM6Q 1M5SA 2E5LJ 3I0SB 1S6UA 1M1KT 2DEJA 1N52B 2UVWA 2VPXB 3OXGA 3G6XA 4ICLB 5HQ8A 2PMZD 2DBBA 3ILOA 1YJ9S 3M8WA 5HQMA 1OJ4A 5KG1A 2WW4A 1GT8A 4HTIA 2YBVA 1UVIA 2GMLA 3CO0P 5CAAA 3THPA 4PQUB 3CGIA 1X4BA 2JZ5A 4LSLB 2C3UA 1YLXA 3MFHA 1U1MA 5I3UB 3DM2B 1DLOB 1PJ5A 2QL5B 2GZOA 2E7WA 3CULA 4ECUA 3BREA 4LSLA 4C7QA 1R0AA 4JI4F 5THWA 3BBFA 4RW7B 1TK5A 1DLOA 1RHUB 4X4VA 1WI8A 1IJEB 2UP1A 2GVZA 1SVDA 4XDCA 4HI1A 4FS2A 4L3NA 3K8VA 1CC8A 4B3MF 4B3TF 5J2MB 1ZZNA 2X1GA 4QW8A 1N33J 1RTZA 1R89A 5E33A 2J0QD 1RB0A 4K50A 5KFJA 2HHPA 1Q8LA 3SSQA 3I4PA 2AGQA 5K9FA 1S79A 5L38A 3CJ5A 1OPZA 1S6PB 3MTJA 3KFWX 4KAIA 4ZPAA 3QSYB 4OYWA 2DNMA 1FKOA 1N32J 2DY9A 3IC1A 1S6PA 1U2CA 1WACA 3PXGa 2RJZA 1QE1A 3OHBA 2MEWA 4DV4J 4Z7CA 4C3KA 1LQ9A 3MOZA 4C3LA 4L72B 1WI6A 4DR2F 3Q89A 1W2IA 2YWGA 5KFKA 5H9FK 4J91A 1HD0A 4AD6A 5A76A 4DX7A 3KLHA 4QIFA 3S01A 2G0CA 2UU9F 1D8ZA 1LWXA 1Z4UA 1FTRA 2ZZMA 3RBZA 2VG5B 4H4KC 3MM8A 4NASA 3OL7A 1D3WA 1WF2A 4DSFA 3M30B 3G71S 2FLOA 2RKIB 3ZZ0A 3D4JA 3CPWR 3GFHA 5I3QA 4Q45A 4M5GA 1KOHA 1DQ9A 5K8NA 2ZBIA 2DVIA 3M30A 4C6AA 2RKIA 4DV3J 1HBUA 3L09A 3KG4A 1LWCB 3IAM9 2HRYA 2NR0A 2OH2A 3KXDA 2WVBA 3T6JA 3UN5A 2X1AA 4KFBA 3KG0A 1REGX 1S4FA 2FHJA 3TANA 3H5YA 3L3CA 5HANA 2ERRA 1AZSB 1AT1B 5IT0A 3G6YA 3D1QA 3J80U 2VICA 1JB0C 1VC6A 1AZSA 2KTQA 5A8KB 1WEXA 2HHHJ 5F8LA 4N47A 2R7UA 1H72C 1VQOS 1WKKA 4ZMMA 5BR8F 2BACA 2GAGC 1AUSL 2E5LF 3GWCA 4ECVA 2UVRA 2A1BA 3NAHA 2ZD1A 4ED3A 1YI2S 3OTOF 4ZDNA 3B78A 4WFAQ 2XQCA 2LQJA 1GTEA 5KFSA 2XGPA 4R5PB 3PW5A 1OY9A 2OMOA 4GO5X 3J80Y 4I67A 2Y1RI 4KGXB 4OYZA 3U1LA 4R5PA 4ES2A 3M1VA 4RJVA 4IG3B 1IM4A 3W9IA 2LMIA 2CPFA 1URRA 2IM2A 3ET6B 1M5OC 4IG3A 4DV5J 3GSDA 2EG2A 1HBOB 1FNOA 2R7XA 1U4BA 1FD2A 2CNOB 5KFHA 2MQQA 1S0NA 4P73A 4KHMA 2K2PA 2ATLA 2G2OA 3FQKA 2VBXA 4ECXA 5ADZA 3NGDA 4F50A 2PA3A 4B9SA 1CJKA 2PI4A 1C4AA 4P72A 3P49B 2YKQA 2F9JA 1N33F 4GKJF 4DS5A 1FD8A 3UR3C 3J7A1 4DPYA 1O8BA 2XI2A 5KFVA 1HMVB 2XS5A 3R1HA 3VALA 3VZIA 2XS7A 1HARA 3B4MA 2BQRA 3CC7S 2CXEA 4IDKA 3M2VB 1U1LA 1N32F 3PX4A 2YKNB 4FXDA 5HVHA 3AB4B 3HM9A 4GVLA 4RW4B 3M2VA 1TL3B 1BWEA 4DPTA 2ZHBA 2YKNA 5L8RC 4DCPB 1RXOB 2PEBA 1T3OA 3KJFB 2OLWA 4RW4A 5G0RA 2VKRA 4J90A 5AT1B 2U1AA 1GMUA 2ZFHA 3R5BA 1HI8A 2J76E 5IM0B 3W61A 1H6KX 1SL0A 4TXSA 2ZH5A 1S59A 5ETTA 5HQLA 2MQMA 1Y10A 1X4AA 3GCWP 1RAHB 2QC3A 3CJ3A 5LSRA 4LUBA 2ZHOA 5LSOA 1XMBA 3D2WA 3K5PA 1G2EA 2GNKA 2O01C 2C3PA 2LU2A 2DISA 4KKOB 1KQFB 4PYAA 2O66A 3PYGA 4B9NA 1XWLA 1C1BB 2G2YA 3HULA 2DGXA 4IRCA 5KG6A 2ZZNA 2DO0A 2O1PA 2UUCJ 4QOTA 2HYIB 1V3ZA 2AJ4A 4A8OA 4MT1A 1LV5A 3NLCA 1B3TA 1HQ2A 2HFNA 3H98A 2WOMB 4EYIB 2IMWP 2VASA 3C14B 4M5DB 3BQ2A 2WOMA 2HEKA 2FLLA 3OSNA 1NB7A 3BPDA 1F0XA 3CWJA 1OY8A 3KK1A 4OV1A 2PT0A 3FEYB 4M5DA 1HBMA 3VAMA 3FRYA 4KPYA 1U6FA 3T1HJ 3H2UB 2LU1A 4FZVA 5K5MA 2AX0A 1VGYA 4U7UK 1JNZB 1VQNS 3AQOA 4I0WA 4LF8J 2Y3YA 4ZPBA 4WF9Q 2CQCA 2MKKA 4J5OA 4JI1J 5L9NA 4I2PA 1ICEB 4NMXA 4K4YA 1VRUB 1SC1B 2L3MA 9RUBA 1WHWA 2MJNA 2V94A 2F5GA 5LXRA 1OO0B 5A6WA 1NZ8A 2V6AA 3X1LB 1BHNA 4D3HA 3DOLA 2AEMA 4CLKA 2DD8S 4JI7J 3RB0A 5HMWA 5DRKA 3L7OA 4EU0A 1J2VA 5EUHA 2FJWA 3GJTB 2PIIA 4LRCA 2KI2A 2RS8A 2XI3A 4OI3A 2AJ2A 4WCEQ 2B51A 3OBIA 3PIOQ 4WXWA 2LCWA 2EFNA 4J9NA 3FQLA 1FNXH 3UCZP 3HHLD 4N8OA 1TKDA 4AXIA 3HX9A 5CXTA 1YRUA 1T11A 4K4UA 1Y0HA 2R2SA 2QA4G 4YFUA 1F60B 2VD3A 4HR2A 4HYKA 2M8DB 4WWSA 3B54A 2DR7A 4I56A 5H1SV 1X9SA 5BXIA 4EYHB 5DS7A 5CD4A 3THTA 2DPIA 3HJFA 1IKXB 4JI0J 1IKXA 3G86A 1FRHA 4PEOA 4DOZA 4JV2A 4RBUA 2ASYA 3D1HA 2NREA 3RU0A 4OX9J 1HR0F 2HSEB 2M8HA 1DURA 1S9EA 2YWFA 2YPZA 1EETA 4DSJA 3NWGA 5GAEU 4DV2J 2OPSA 1G1XA 1TUVA 2K7JA 3RW6A 3LGMA 5GMEA 5F0UA 4P6QA 3RB6A 3SEOA 2ZH4A 2EEYA 1K44A 3I0RB 3FSIA 3T3FA 3IR7B 4ZHRB 1V3SA 4F2RA 4TKTA 3I0RA 1RAOA 1P9QC 3CNQP 1VQ5S 3DGVA 3ZTRA 5KT2A 1HNIA 4HLBA 1T0TV 2XYPB 3IFEA 1RBAA 5AJ3J 5AE3A 1ELOA 1RTDB 4A8KA 2CJAA 2VPZB 3QRPA 2CQ0A 3ZTQA 2OKQA 4QQBA 4ILLA 2UUCF 1RTDA 5KFRA 1WUUA 1BGXT 2NUHA 5F41A 2E66A 3F0NA 2HS3A 3Q23A 1X4GA 2AYMA 1IKYB 5B0EA 2V2QA 2XO6A 2B6AB 4O3RA 2KZZA 3NCPA 1U47A 1P1LA 3OD2A 3FRZA 1AXQA 2JNJA 2ADBA 1FJGJ 2ILZA 4ECRA 2B6AA 4R0JA 3T6BA 3O5TB 1FFWB 2IJFA 2RQKA 4MIWA 1PJ6A 3T1HF 4W4MA 4Y2KA 3W2VA 5A0YB 3BB5A 2KJWA 4LBHA 1M1GA 4J37A 3GLJA 4NLQA 4USMA 1FKPB 2FQQB 4LF8F 3DLKB 1Q7LB 5A0YA 3PW2A 4F4XA 4C8NA 4N41A 4CT9A 4G65A 2BRLA 1TL5A 3MEEB 4JI1F 3QRRA 3QWUA 1VR6A 3H5XA 1AFIA 3PEJA 4IQMA 5D3GA 2RH3A 3AOCA 3EWGA 2OFGX 2FY1A 4DHVA 3TEGA 3GE9A 2ZJPQ 5K8OA 4X62J 4OV6A 3JYTB 4K5SA 1AW0A 4JI7F 2HLTA 4DN0A 4FYVB 2NSCA 3HXMA 4WTYA 2HGNA 3WHIA 4UUXA 5FIIA 1VQ8S 4TNOA 4KQZA 2XYGB 2J7WA 1UEUA 1T9VA 2AIRB 4NLGA 3P45B 4I6YA 3W64A 1TUWA 1WF1A 2RB7A 4F0KA 4DPUA 1JJ4A 5CABA 1QAYA 3B4DA 1B0PA 3EICA 1Y7PA 3MDFA 4WFZA 2VG6B 1CJUB 4ZCIA 2W7AA 4E2FB 5GAGU 2RU3A 3W5ZA 2N3LA 4W90B 2E5HA 1CJUA 2KFZA 3BYPA 4JI0F 2ZBQA 5FDLA 1V9OA 2FJVA 3IMQJ 4NWBA 2MQOA 1J5OA 3TZXA 3P3DA 3CTRA 3PW7A 1CLFA 2IA0A 2UXCJ 3W63A 2DHAA 1KLMB 4ZP9A 4OX9F 4KH0B 1VHFA 5KG5A 4MKBA 3GIKA 3SCKE 3A3NB 1KLMA 1N5SA 3EE3A 4B3OA 2H5EA 2BV3A 1U1RA 1NM2A 3M2RB 1CS4A 2OP5A 1IN0A 4DV7J 1KS2A 4CO2A 3FNNA 2ABYA 3GONA 2XHWA 2ZVSA 3DI6B 5HLFB 3KUGA 5KG2A 4G3IA 3P4UB 2BQ3A 4PKDB 3DOMB 1EZZB 1HWKA 4C8KA 2XC9A 5KAKA 2XMWA 2BBEA 2VHGA 4USTA 1VQYA 2HHQA 2PSZA 4L74A 2J0WA 5DO2A 2Z8QA 5AJ3F 2G13A 4DEZA 3EX7B 3VCDA 3MCOA 2R3VA 1T3NA 1NK8A 4ZVRB 1BUXA 5J2QB 2MKJA 3WIVA 3WC0A 2V50A 3HHLB 3VGVA 3KK3B 1R0BG 2ZEJA 3L9ZA 4OZ2A 4J9MA 3OQ2A 3OR2B 1WTFA 1RT4B 4Y00A 3HHLA 2HFOA 4I7FB 1FJGF 3OR2A 1RT4A 1FFSB 1EX8A 4QWEA 1GXTA 4LBPA 1BE4A 2HNDB 3M6XA 4I7FA 5HK4A 3DRRA 4ZVOB 5KFYA 2RAQA 4AYBD 1VHIA 1TAQA 4X2BA 2MKYA 4LBIA 1PC4A 2HS4A 1S76D 4UF4A 4P2MA 5KG4A 5IV4A 1H7XA 1X4DA 3M8ZA 2F3JA 4OZ3A 1IBLJ 2RE1A 1JX4A 1M5VC 1JMTA 3PW0A 3MUMP 2QLBB 1CULA 1HWJA 1JLAB 3DLGB 4DUZJ 4OX7A 2DK2A 4XPEA 3MAAA 3DRXA 1Q16B 4O4GB 4A8XA 1NPKA 1WEZA 3N9UC 2XHCA 5HMYA 5HROA 4TU7A 3QIPA 2BABA 2NPIA 2EFVA 1RT6B 4CH0S 4X65J 4FNIA 3GG0A 4GKKF 3QO9B 4PCQA 2DNGA 3Q0AA 3QGGA 2KRBA 1YK9A 2HFSA 2B9WA 3FUYA 3QO9A 2OEKA 3JQJA 1RUSA 5D6GA 3HP6A 1X5OA 4QIEA 1PYTA 2AD9A 2NYIA 3GV7B 3RR7A 5KFNA 4N7TA 3G82B 4V1Ak 3M9NB 3JTNA 1V3RA 2E7XA 1A9NB 3DDNA 4JI8J 5E3CA 4ZCKA 3G82A 3DRSB 3GYNA 2RS2A 4FYDA 1LK5A 3CCWA 3VQSA 3C16A 4PXEA 4ZVUB 2VU5A 4F3MA 3T5HA 2UXCF 4DMZA 5KG0A 1MLAA 4M5JA 2G1HA 4ZA1A 4ELVA 3TQEA 4DG1B 4OZ0A 2W4CA 3HFVA 2CG4A 1Z2ZA 4DG1A 3IO1A 4DV7F 4YDDB 3RRHA 3AAWB 2BXJA 1FKAF 4OI0A 1LWFB 2IJRA 3QAEA 1RWNB 1V6HA 3LGNA 3HLUA 2AWZA 4NLYA 2VBWA 5KFMA 1LWFA 4DL4A 4YP3A 3FK4A 5ETQA 5LM7E 1NJIT 2ZWPA 5ETNA 3PVXA 4RW6A 3BGFA 1T05B 2X7IA 3V4IA 1TP7A 1YQHA 4BDPA 2R8HA 4B08A 2H4WB 1RAIB 4ANEA 1MROB 4ETXA 5E3QA 2HVHA 4LVOP 2HQDA 4ECTA 2EK1A 5C2CA 3R2CJ 2DNKA 3DRYA 1GK8A 4NCGB 1VQ6S 2AF6A 4XDDA 2C2DA 1PC5A 1S1WB 5E3RA 3M05A 3GV8B 4NCGA 1JLEA 1K73T 1VRQC 1S1WA 2CIMA 1MU2B 5H9FJ 3EZUA 1N36J 3MM7A 2HNZB 2N3OA 4DR3J 1RWOB 2KG1A 5DZ6A 2FDNA 2AQ4A 4PUOB 1RAFB 5L1KA 3HD2A 3KJNB 2MZRA 2YWKA 5IS2A 4PUOA 4QR2A 1IBLF 2C22A 2V0NA 4F3QA 1F3VA 2LA6A 4DV6J 3BQ0A 1TVRB 4BBYA 3EVOA 3LPYA 3MURP 4I2QB 4OHYA 1X4EA 3VGTA 2W2QP 3CW2C 2B9YA 5DG7A 5EGYA 2RRBA 2GV1A 2G4BA 4BS2A 1HHQA 4WU3A 1YKWA 4I2QA 5KFZA 5DQHA 2DGVA 3LGHA 1TKZA 2MB0B 5C24B 4QBUA 1NZAA 1SUQA 2FY8A 2FTRA 4O44B 4JV0A 5CYJA 3GPAA 3HMJG 3P96A 3T1YJ 3IRXA 4RW8A 1OQ6A 2GO9A 4OFZA 5ETRA 1C4CA 3FKBA 5ETLA 3ISZA 3BSCA 4CLTA 3HSGA 3HKWA 2W24A 1IBCB 2E29A 4F3OA 2XTJP 4DQQA 2NZCA 1HL6A 4DQIA 1JLBB 3BKUA 1C0UA 2FC8A 3MR5A 2DIVA 2IY5B 4F2SA 5E7OB 3MD3A 1LWEB 3KMSA 1VIOA 2BDPA 5CZVA 2D1CA 1JLBA 2ZH1A 4IYQA 3DN9A 3E8OA 3OL9A 5GMDA 1OQ3A 2HFZA 2NXEA 2DR9A 3EUNA 1U45A 4FS1A 2OSRA 3K0JA 1RADB 2RHSB 2DCUB 3QWPA 2Z2YB 1CJTA 5M2UA 2MXYA 2BYCA 1RU1A 3FCWA 3NRBA 5T14A 3L4BC 1P1TA 1MWQA 2QMUB 4FPRA 4OL8A 4FF1A 2CJKA 4NLWA 3W9JA 1ZOTA 2MQLA 2X1FA 5BYQA 4U8VA 4NXNF 3PIPQ 2E9ZA 3HK2A 2OEMA 4TN2A 3JSMA 4MMOA 4A8WA 4USJC 3PHEA 1XC9A 2ZH8A 4NXMJ 2EXUA 3BEGB 3TAQA 4HDHA 3I96A 2OPQB 2B5JA 4PXCA 3Q8SB 4WP3A 2FJDB 3TJ8A 2OPQA 1GFWB 2N4CA 1UVNA 3KOAA 2KYXA 1ZH5A 3D6HB 2WSEC 2NCKL 4Y0FA 4KT0C 2C1EB 3CDUA 5K8MA 1LW0B 2AEJA 2N7CA 1YJRA 1QTMA 1RT2B 4DI6A 3WX4A 4QU7A 1LW0A 4KGVB 2WHOA 4ILMA 4NZ0A 3W8PA 4HHHA 2KU7A 3DOKB 1ZM2A 3TI0A 1N36F 2LYVA 3CJ2A 1CJVB 2CJQA 4WZMA 1L3KA 2E7VA 2ZDOA 4DR3F 2V9KA 3DOKA 1MWYA 2MZSA 2MQPA 5IZHA 1C1CA 3A3OB 5KTQA 1WC5A 2NSBA 1RTJB 2YNHA 1ULRA 1CJVA 4ER8A 3GZ7A 5T41A 3KHRA 3GFXA 3EM1A 3NBPA 3GIMA 1RHRB 1RTJA 2IAJB 4L75A 3J81j 3OR1B 1SIZA 1DAXA 3AXKA 1Q4RA 4Q5VA 2GCFA 3PKYA 4DV6F 2WONA 2D3O1 2P9GA 2ZNZA 4FYYB 2AP6A 5J1NA 2FZKB 1JWWA 2CPJA 4ZVGA 5F3ZA 2UUAJ 4USKA 4Q43A 1S9GA 4MAKA 4QCLA 2CQ1A 4RR5A 3V6JA 2CNKB 1ZA2B 1HD1A 4UOFA 3T1YF 4BCAA 1SV5B 1NKEA 4H4OB 4WPAA 1FEEA 4QPXA 2RRAA 2CPXA 1RU2A 4USVA 2BE2B 4KHPJ 1FO1A 2KG0A 2C3MA 1SV5A 3KLFB 4DR5J 2Q6CA 3KUEA 1RT3B 2IVFB 5KFAA 3WBZA 2VG7B 3KLFA 2FJAB 3LAMA 2HAFA 1RT3A 2ROEA 2WVDA 3TX8A 4UUWA 4K4ZA 3HT3A 1S1UB 4WKYA 1H0HB 4P75A 1RK8A 2BM0A 4P52A 2QL7B 2JRSA 1S0MA 2OPPB 4NYOA 3W60A 2W4PA 3E3XA 4OYXA 4F8RA 5E3AA 2WVFA 2WBMA 4TLQA 4DF8A 2OD6A 2OPPA 3IP0A 5KG7A 5KT4A 3SQOP 4DFJA 1RI7A 1MW7A 2DRAA 3ILIA 1UFLA 3CCMS 3GJQB 2UXBJ 3PDNA 2I2YA 3HJVA 1TL4A 3CCZA 2E5JA 3QJPA 3PR4A 1U2FA 2YPYA 3TNVA 1PYSB 2LP4A 3QYYA 2VFRA 3R5CA 3MWBA 2LLZA 2K1RA 4DR1J 2U2FA 4YMEA 4NEZA 3V6DB 4NXMF 4RUBA 2MQ8A 5SUHA 2AYGA 1WC1A 3W5YA 3MM9B 3SCLE 2IJNA 2YKMA 1RHKB 4RKUC 4CH7A 2JLFA 3MHYA 3TA0A 3MECB 4LSNB 2VFSA 3HO1A 3KLEB 1SJRA 1N5YA 2LKZA 3LF0A 3MECA 4LSNA 3ULHA 3H40A 2MZ1A 3T5LA 4RU2A 4KO0B 3KK2B 1RTHB 3LH2S 1W26A 3G8QA 4KV8A 1TKTB 5A2QU 4KO0A 4UT4A 3BO3A 5JMNA 2UVVA 5D8HB 1RCOB 2XO7A 1R6VA 2GIFA 2OTJS 4IO1A 3SCJE 3AFGA 3PYEA 3BM7A 3N01A 4ZITA 3EPIA 2LXFA 5H9EK 4IR1A 4LIRA 1WDTA 2M4MA 2H5JB 5K14B 1F5CA 3DMJA 3ISNC 2AZ3A 5RUBA 2QFJA 1UMJA 3Q24A 2ZM6J 2D9PA 3NNAA 2EC0A 3IN5A 4K8RA 1FVSA 1RWXB 7FD1A 3H42A 2CADA 2CAJA 3EXCX 4LRDA 1HHSA 3CJ4A 4MK7A 3FFIB 2UUAF 2CQ2A 2DT9A 4C0HA 2NXJA 1S1TB 1UPMB 2DGQA 4WTOB 1AUDA 1N34J 4P74A 1EP4A 3BR8A 5MLCV 3OHAA 1S1TA 2HVEA 1PSDA 5CCLA 2IM3A 3CJ8A 3S7RA 2IHR1 3PHTA 3LWLA 3GQCA 3M8PA 4OYMA 3ITHB 3PRBA 1QAJA 3QJLA 2R8JA 3D1OA 4DR5F 1C2PA 1RABB 4DN9A 1DFDA 4ED4A 1XMOJ 3QZ8A 2KT2A 1FRMA 4OLOA 1QLNA 2D41A 3HCXA 5JXSA 1XMQJ 4AL7A 1TL1B 3CC4S 2HK2A 3DXSX 4IFYA 1S1VA 2GGPB 2QYGA 1EKSA 3CXCR 3PYDA 5D15A 5D0HA 2JFDA 4F4YA 4BHQA 3GV5B 1K1SA 5GVQA 3ZZYA 4EI2A 2FPHX 2D3ZA 1LFWA 1RP5A 3MFIA 2WAQD 3HFZB 2VOOA 2AKWB 3GG1A 3TEHB 4CDIA 1H73A 2D7SA 1HNZJ 4Y2MA 2F9DA 1XERA 3EYZA 2IRXA 2KYZA 4URGA 5KT6A 4ELTA 1Q8BA 4B9VA 4ZN3A 1UP1A 4KH1B 2E1PA 3MAHA 3M2UA 1RWWB 1I1GA 5FLXU 4JUZA 1LW2B 3MUVP 2UXBF 2GO8A 1FXLA 3NGRA 2LQ9A 2Z56B 5GMKa 5EWFA 4FYWB 4LFBJ 1X7VA 1F3FA 4Y3CA 3QATA 1R0CB 2O3DA 5F8GA 1B70B 1S12A 1CVJA 3W66A 4DUYJ 4DR1F 3G96A 4PWUA 3EVWA 2Y8WA 2POKA 1P8GA 1PYOB 1NHVA 4B02A 1YHQS 1DARA 2HZAA 2Y1JA 2I1RA 3HDSA 5FLXY 1N6QB 1WOSA 4FVCA 2VC0A 4ED0A 2KRRA 1K0TA 1WOOA 3K5OA 4C11B 4IOCQ 4EUVA 2RUGA 2V8HA 1SJQA 5KOXA 2W2NP 5EWEA 2DY1A 4DQRA 2H5IB 4LMZA 4I4BA 1U49A 1AA1B 1C0TA 2E5IA 4HDGA 1L3SA 1BY9A 3TP2A 3RGIA 3B8HA 3C6UB 2ZH9A 2DR8A 4LF9J 4UZCA 3D6MB 3M8QA 3R1LA 3VGUA 1JLFA 3OTDA 5I3PA 1WELA 3VAIA 2V34A 2XM3A 3TVZA 4A4JA 1PJ7A 2HBRB 4C8LA 3MMBA 1NJXA 2BJEA 4K2XA 2J9DA 1NJZA 3HHDA 3CIMA 1RKJA 2Y0SD 2Q3PA 3PTWA 3UR0A 3FSYA 5L39A 5ETMA 2ZM6F 2O5DA 3K5LA 1EQ0A 2CQHA 5HVFA 4J9PA 1QJHA 1EB0A 2ZH2A 5KFDA 1DTQA 2KL8A 1YTYA 2LQ8A 1SQFA 1BQNB 1TL7B 2AX1A 2IBKA 1U2RA 2ZHAA 4GO7X 2KH9A 1SQGA 4ZVTB 2LEPA 1TL7A 2BJ3A 1HNVB 1F9HA 5CYMB 4YUDA 3RB3A 1XMOF 2XY5A 4HVZA 1XMQF 1JJCB 2PMHA 2HKEA 1FRKA 5CYMA 2QG9B 1KTVA 1REVB 4JYAF 2XG8A 3TOQA 1IR1A 4ECYA 2DO4A 1TMMA 4YY3J 4OYIA 3AB2B 2QX0A 2VUGA 4OYAA 1U0HB 3GILA 5U47A 3HKZD 3HHKA 4KYZA 3MM5A 4PPZA 4LF5J 4XTTA 3TA1A 3PFEA 4P71A 6FD1A 3OPKA 4OHVA 1HNZF 3C66A 3DU6A 1Q8IA 2XZTB 3TVYA 1BC6A 2AZ1A 3DYAA 3PNIA 3N28A 4OLPA 1Y00A 5LJ3Y 3SV4A 3D68A 3KKFA 5EHHA 2AYEA 2BUNA 4LFBF 2CQIA 2QMWA 4RLEA 2DR6A 4DUYF 4RUCA 5KFXA 2M0GB 3LP2B 4ZPDA 1S57A 2HQIA 2MKHA 3UW1A 3DGPB 3O6QA 1GTHA 3QJJA 1RQ0A 3GSIA 3LP2A 3MMCB 3D67A 1KHVA 4M8LA 2CUYA 1AROP 2IFXA 3W62A 1SKUB 1PILA 5CQGA 1BXNA 3CSKA 4LR7A 1OS5A 4C8ZA 1CQMA 4ZP7A 2YQ0A 2IM1A 3TAMB 3IM8A 4K4SA 2NZ4A 4NRTA 2JEIA 1U26A 2OI2A 3P6YC 3QFWA 2ZBCA 2VJVA 3KHLA 5B7WA 1S6QA 1VJWA 4TYBA 1PG5B 4NA1A 2IBOA 1UEVA 2FLNA 1N0VC 1LXJA 3N6LA 4OHWA 2PFDA 1VFJA 4OX8A 2DHSA 2FJXA 2MGZA 4M5LA 4LF9F 4IOAQ 1ZAWA 3QT7A 2W9AA 1S7IA 3CMQA 3ZZPA 2C2MB 3IRWP 2KXHA 2ZDPA 2CJXB 5L1JA 2RQCA 1IKWB 2CJYB 2XSJB 2GC8A 4R0EA 2Y1LB 1BLUA 4KRWA 1X5TA 2VB6A 2E5GA 3MR7A 4PG7A 2V4RA 3KNAA 1IKWA 2XSJA 2DPJA 3I56S 3OV7A 1Y3KA 4HI2A 3LWMA 3SDEA 1H74A 3ZFVA 4F67A 4ETZA 2P9EA 4A8FA 4AL5A 1NLKL 2GW8A 4IRKA 1CSJA 1RTIA 4GVBB 2NXNA 1XEZA 4WKRA 1S4EA 2HGLA 3CDBA 2XBPA 2VBYA 4YOEA 4C48A 5AXNA 2QA4S 4GVBA 3DCAA 2DNHA 2V9WA 1XR7A 1GMWD 5I42B 2KZMA 2KVIA 5F8JA 1HI0P 2BZ2A 2DGTA 1Z2LA 2W4DA 3HVTB 4ZP8A 3QLHA 4RZRA 4ZK7M 1TFYA 5HI7A 1VRTB 3HVTA 1FF2A 3W7BA 5EX0A 4YY3F 4NA2A 3T19A 3NL0A 3OTOJ 1VRTA 2C2KB 1DBDA 3I6PA 1D9DA 3I0SA 1F5BA 3RR8A 2DHHA 4QIWD 2AHOB 2FGOA 2QE5A 4LF5F 3MD1A 1V5VA 3T9ZA 3MGJA 4ICLA 4C4WA 2BOAA 2EPIA 5CH7B 4BWJA 3H2LA 5EN1A 4KBIA 1LKZA 1RISA 1YGYA 1FDDA 1SL2A 3ZZRA 1H98A 2BKPA 1WNEA 1FJEB 4PQUA 2H4YB 5LJ5Y 3AD8C 5IFMA 4F04B 5CHCB 4PYDA 3CF5Q 4UOGA 2GMJA 5I3UA 3GMGA 5C5JA 3DM2A 3FEXB 3WQPA 3I32A 2ZKTA 2QIFA 2OO4A 1G4CA 2J6SA 5GAHI 2C2OB 2RSQA 1U1PA 4RW7A 2MSSA 1MNEA 4RWWA 3CD5A 4NLRA 1H38A 4RUAA 1B99A 2HHUA 2VZ9A 1RBLA 3R7NB 3CCRS 4GKJJ 4M5KA 1EHWA 4FKYA 5BYSA 4EK2A 5J2MA 5IOLA 3HVAA 1RGVA 4YR3A 2XGQA 2ZC4A 4QYZK 1YBUA 2PGCA 1S49A 3PM9A 3UPFA 3ENWA 3DU5A 4X4UA 2IYIA 5M2PA 2HHSA 3V4MA 4DV0F 5J1EB 2XULA 2YNIB 5HMXA 4N56A 4GMKA 4DPWA 3MI7X 5D4LA 2AYBA 3PKMA 4NZ7A 2B56A 1NK7A 4JV5F 4RNHA 5A8WB 4HH1A 1E6VB 3M8SA 3R3TA 4CIOA 2VPYB 4C0BA 1Q5VA 8RUCA 3KUHA 4N77A 3UQSA 3C15B 5A8WA 4MK8A 3L7PA 3GR1A 1E6VA 3TZWA 2ALZA 1FNMA 1JXLA 2QO3A 2P6TA 4AT1B 1IQTA 3UCUP 1H3DA 1WD6A 2O67A 2MYFA 2F8EX 3SI8A 2HIQA 1WF0A 4H4MB 1ZM3A 4TY8B 2VG5A 1T94A 3JSBA 4CNZA 1JXVA 4G1PA 4D3GA 1XNQJ 4TY8A 1YJVA 3AQPA 3PFOA 1BWVA 2CZ9A 2WBRA 3M8YA 2BJ1A 3NCQA 1SL1A 4BLGA 3CCLS 5J1PA 1B7FA 2AEFA 4CO4A 5JVHQ 1LWCA 2FVRA 3CUNA 2OEJA 2DGUA 2PMWA 1KD1T 2YXLA 1EQMA 3MCSA 2MHEA 2YNGB 3M9MB 3BBBA 1EJ7L 2KT3A 4KSEB 4P2SA 1MN9A 2B8PA 3PO5A 3IBCB 5DQGA 2RUSA 2P9CA 2J0XA 4FN5A 2XY7A 3G8SA 4UOHA 4IH7A 5A8KA 3KDOA 5A8RB 4BC7A 4EEYA 3OL6A 2M9KA 1AB8A 3KYLA 3BGLA 2W2MP 5HN0A 2MQNA 5A8RA 4V19X 3ELHA 4WFNQ 2GQQA 2JVOA 2X51A 2M88A 2G1DA 4S0MA 2AMCB 3I9V9 4X64F 2K3KA 3KLVA 4ZVPB 3JQMA 3IA0A 1RA6A 1YBTA 5KFEA 5KFFA 2RF2B 3MEKA 3EXYA 3TRGA 3KLGB 1X4HA 3PW4A 1S48A 1HPZB 3H59A 5DDQC 4ECQA 4ZN1A 2RF2A 1H2TZ 5E41A 3MPDA 2E9TA 3U27A 1A0OB 1DTTB 2HW3A 3NEKA 3OLAA 3NY0A 3ET6A 1HPZA 3J7ZT 1D1UA 5HJYA 1RWVB 1HBOA 2KM8B 1RKIA 4P7TA 1DTTA 4AXJA 4ECZA 2LEAA 4DFPA 2ZE2B 1VBYA 1UJ6A 5HP1B 3H7HB 2YQ3A 2N82B 2C3YA 1G6BA 4NLVA 1RT1B 4LFCJ 5HP1A 3ONQA 5IC6B 1JKHB 3KWMA 4NA3A 4JBCA 3D7SB 4TYAA 4L76A 1I51B 2BRKA 4NLDA 4RUHA 5AXLA 4CI0B 4IH6A 5AXKA 3UVJB 2Z2ZA 1VLYA 4RBVA 4DR7F 4OZ5A 4F7VA 5F8NA 4LIWA 3JQKA 3IBFB 1YRTA 4HT5A 1SCJB 3QNWB 1HMVA 3UVJA 2F65A 2CPEA 2QMXA 4QPTA 5J2NB 4C97A 5IC4B 4O0IA 4Z7YA 1M90T 4A47A 1YZ7A 3BGUA 1WC0A 1HR0J 4RW9B 4MTPA 1NRKA 4FXVA 3AODA 3JAMU 3I5AA 4N8NA 1DJ0A 3G6VA 1TL3A 3BO2A 3MF5A 2D74B 3TZYA 1X60A 5B0DA 1OSDA 3Q2TC 4K4TA 2C2RA 1FCAA 2VQEF 3F44A 4JI5J 1NSAA 2J9CA 2JH3A 2V63A 1QTNB 4FBTA 4U6PA 1NH7A 4V19J 4B9MA 3UDCA 1RHQB 1VYAA 5IM0A 3F56A 3VF0B 3BJYA 4EFAC 4DL6A 2IYGA 2IPOB 3JAMY 4OI4A 4O3PA 2ACYA 1X9MA 4RBTA 1CBKA 4DCOB 3FSXA 2MLYA 1XNQF 1F9EB 2GQ2A 3MM6B 1TK0A 5DETA 2R7SA 1KVJA 4ED5A 4KKOA 4XK8C 2HVZA 5F8HA 1C1BA 3BZQA 2M3DA 3D3CJ 1Z1ZA 2DNOA 4WBFA 2B9XA 3J7Z5 3PZPA 2DRBA 3L95X 4DX5A 4QJVA 1NKCA 2CYYA 3UD3P 3OTCA 2OFHX 4FPIA 4M1KA 3WDOA 3CJKB 2KXFA 3O2IA 1P27B 3EDQB 1H2VZ 1O0PA 1JLQB 2IDEA 1QSSA 1OSCA 4JI3J 1T9UA 3PV8A 3CJKA 3OVSA 4L3KA 2QLJB 3C14A 4C8OA 1JLQA 3RG6A 2OJ3A 4LF7F 3RW7A 4EBEA 4XPCA 4KHRA 2VF3A 4IG0B 3AT1B 2VDIA 3OJSA 1TV6B 2FUG9 3SYZA 3U1NA 1SC6A 3H8YA 3CJ0A 1N48A 1WTBA 2VBZA 4WFYA 1TV6A 4RNMA 2YKOA 2FZCB 1SPBP 3J7AN 2YX4A 3M8RA 1KFSA 3LP1B 2IRYA 2XMUA 4XIUA 4NLUA 1XBWA 3R2DJ 4DPXA 5KFBA 3J7YI 4Q44A 5IXUA 1OYEA 4LJMA 2R7OA 3MCMA 4ZKAA 1FX4A 1HW9A 2NPFA 1VRUA 3TUPA 4IOBA 3V81B 4A8QA 1BMQB 4K4VA 1TQLA 1GAOA 2AU0A 4HH0A 4TQRA 3AY0A 4CQ1A 3V81A 2AV5A 1KQGB 1ZZFA 6AT1B 1UKUA 1K8AT 5KFOA 1Q79A 2YKAA 2EK6A 3H20A 3A8IA 1S1XB 2NUUG 3JXOA 3QFHA 5JUMA 1YIJS 4LFCF 1RAEB 2AJ0A 4FF3A 3Q8UA 3D0HE 1VISA 3TUJC 3CB4A 5K20B 1FRIA 4M5MA 5D4OA 3NWRA 1D9FA 4OI1A 3KDNA 1KDNA 2YWHA 4X66J 1FWLA 4ZPWR 2K7KA 4CO1A 3QGPA 3K5MA 2YWWA 3IXQA 5D4PA 3S1TA 3R9LA 3VAFA 2AGOA 3OLBA 4QR0A 3T9NA 8ATCB 3NNCA 4L73A 3AJ2A 4Z37A 1OMSA 3K89A 1X0FA 2JOQA 3S6EA 4ZIWA 2HHTA 4K0KF 4ANDA 4PRFA 3CO9A 4ZS6A 2CPIA 3HVRA 2EC2A 4LSZB 4JI5F 4ZIVA 1FRLA 2ROGA 4IR9A 4DF4A 2DR5A 5HBMB 3JSYA 3OL8A 2EBGA 4DSEA 2C2ZB 4QZVB 1NBEB 5CCMA 4KB7A 1HYSB 3H90A 1MMNA 3QT8A 5DDOC 1T9WA 3UFCX 4QWDA 2CQ4A 2RILA 3TARA 1JIHA 1PBAA 1JJHA 5D77A 1RDRA 4DPOA 2WSFC 1RSCA 2ASDA 1FXDA 3HT0A 4ZHRA 2LEBA 1F2GA 3EVMA 1HBNB 3U02A 2IIHA 1X5SA 3BR9A 2I6WA 2QV6A 2A6MA 5DQIA 1HKAA 4YN3B 4PXDA 4I68A 4OYPA 1ZS6A 3CMES 4JV1A 3PRDA 3RRGA 3VWSA 4HACB 4JI3F 4C8YA 3IWNC 1IKYA 3QIDA 4X4NA 4C3MA 3Q86A 4J9OA 2HAIA 2KDOA 3FC9A 1B0TA 1VQKS 2DNNA 2JLEA 3KJVB 4M94A 2LFVA 1V5IB 5ETPA 3LPEA 2GMHA 5C42B 3DRPB 4WK1A 2Q43A 3C19A 1FKPA 2MPUA 3DLKA 2DGWA 3IR5B 1T7PA 3VAHA 4YB7A 3ZTPA 4LVNP 2M7SA 3NKYA 3MEEA 1NPPA 4O4RA 2E1AA 5DJBA 4F4AA 1T9YA 2RVJA 3Q8QB 1K0VA 5IV3A 4J9UE 2XLJA 3JYTA 4YS2A 4UW2A 2QSWA 3AH6A 3EDRB 4NL5A 2EKNA 4LT6A 5GADI 2DNLA 1VK3A 4Y2IA 4CLPA 4GKKJ 4CLWA 5B0GA 4R25A 5HO4A 2DNYA 1U7LA 4F0MA 2ZOGA 5CYQB 3AOAA 3BPSP 5B08A 2MSTA 3UWTA 4F4KA 1SKRA 1PAEX 2FVPA 4O3QA 2MZTA 2WRMA 3G9CA 2E1RA 4P9SA 4X66F 3Q2SC 1F6TA 2VG6A 4KE5A 4PXBA 3HZGA 2EFGA 1GQEA 3ADAC 4Z2XA 4ZCMA 2B7CB 3I5CA 1FDBA 1UW4A 1FEHA 2IMOA 3DXBA 3LP0B 3IG1B 3POTB 3ZO7A 2CG8A 2IC3B 2NXUA 4PG5A 2AW0A 1M5KC 4Y6IA 3BGRB 3LP0A 2ZJQQ 3POTA 3CDWA 3I55S 2CWXA 4NLOA 3THVA 3D0IE 3NP5A 1RAJA 2DXFA 4PG4A 1FT8A 4ERDA 4RWXA 2X3GA 3M2RA 4HTJA 1E6YB 1PIEA 3BDEA 1CG2A 4B17A 4FP9A 3O1LA 4OZ1A 4KPCA 2OAUA 1E6YA 3DI6A 5HLFA 3CCJS 4CT8A 2KB2A 3PRVA 4I1TA 2FGCA 4YB6A 3DOMA 5JJBA 4H54A 3A13A 4ZVSB 4EMDA 5GAHU 1R8HA 3LQVA 2UXDJ 2VC1A 5CZXA 2ZOMA 1Q7YT 4C0OC 2KFNA 2QLFB 2IRUA 1Q82T 3NAIA 3VGSA 3T1AA 3KNGA 4J9QA 1NSQA 2Z57B 3VQTA 4B3RJ 2RDDA 1R0AB 2JHEA 5J2QA 4X4PA 3TVKA 1M1HA 4E98A 1XK8A 2XMJA 2HBYB 5L9XA 2GVZB 4ID8A 1RWMB 3F73A 3KK3A 2KFYA 1QAXA 2HGMA 2W9CB 2A0FB 2QGFB 4DBQA 2ZC3A 4RO0A 4CP5A 2DHGA 1U1NA 3ZZUA 2W9BB 3BSOA 5ETOA 3TYTA 2W9CA 3NGUA 2F63A 3ETMA 4CWBA 3HSJA 3RBEA 2BW2A 1KFDA 1Y5LB 2B4PA 1QY7A 2HNDA 2W9BA 2E9RX 2DRDA 1ACMB 4G6VB 4LRAA 3B6BA 2IA6A 3DLLQ 3CD6S 4DQPA 1N5QA 3LO3A 3IR6B 1TFWA 4NI2B
chains in the Genus database with same CATH topology
1PGZA 3OBIA 4I4BA 3H5UA 3PIOQ 4CO0A 3C8YA 1U49A 4WXWA 1YJUA 2ASJA 1TZ0A 1FKOB 2BVZA 2LCWA 1QVGR 3HHLC 2EFNA 4J9NA 1GXUA 1SKSA 4DL3A 1R3NA 1O51A 1C0TA 1X9WA 3LW5C 3FQLA 1FNXH 1NNDA 4K59A 4H4KA 3UCZP 1UA1A 2QLWA 3HHLD 2E5IA 4N8OA 1TKDA 4HDGA 4OX6A 1L3SA 1ROFA 1BY9A 2WONB 4AXIA 3TP2A 3HX9A 3C6TB 1DQ8A 4HT7A 1YRUA 1QE1B 5CXTA 4K4UA 1VS3A 1Y0HA 3B8HA 4IUFA 1TAUA 2R2SA 3C6UB 4ECWA 2ZH9A 2QA4G 4YFUA 2DR8A 1F60B 3N0VA 1JLAA 2VD3A 3DLGA 3M8QA 4ZPVR 5FD1A 3R1LA 1N56A 1WEYA 4HYKA 4DL5A 2M8DB 2DR7A 1JLFA 3OTDA 3C6TA 4I56A 1LOUA 5H1SV 4X84A 5I3PA 1WELA 2IVYA 3IGVA 3VAIA 1X9SA 2EBEA 1VOMA 3TVZA 3D28A 4A4JA 4EYHB 1S9GB 5DS7A 1GX6A 4C8LA 1SH0A 4U9RA 3MMBA 3G6ES 3THTA 1NJXA 2DPIA 1FDNA 1SH3A 2OPRB 3HJFA 2BJEA 1IKXB 4O4GA 4K2XA 2J9DA 1I94F 1NJZA 2UVUA 4QWCA 3KLHB 4IO9Q 3HHDA 3R5AA 3CIMA 5J1EA 1SI9A 5D78A 2YNIA 2WK4A 1F5AA 3OTEA 2B4UA 2LXUA 3AHPA 3MAQA 2ZUGA 2OPRA 1RKJA 1RT6A 1IKXA 2Y0SD 1FRHA 3G86A 3CCUS 1VQMS 2Q3PA 3MM8B 4DOZA 4TU8A 4RBUA 2HMIB 4JV2A 2ASYA 2A18A 3UR0A 3D1HA 3E51A 2CPHA 4DR4F 2M70A 1DQAA 3FSYA 1WG5A 5L39A 5KFWA 2ZM6F 1N88A 3RU0A 3M4XA 2NREA 5J2PB 1HR0F 2O5DA 3HF5A 1SQEA 2HMIA 5M2RA 4YR0A 3K5LA 2CQHA 1ZTWA 2M8HA 1DURA 1S9EA 2ZH6A 2YWFA 4J9PA 3Q22A 1QJHA 2ZH2A 4YB1P 4QU6A 3DLEB 2MZQA 1FXRA 5J2PA 1EETA 5KFDA 1DTQA 3EGNA 1FE0A 4DSJA 1HBUB 3PACA 3CCVS 3NWGA 5GAEU 1YTYA 2R7TA 2OPSA 1BQNB 1G1XA 3DLEA 2AX1A 2IBKA 1U2RA 2ZHAA 4GO7X 1XR6A 1TUVA 1URNA 1U6ZA 2KH9A 2K7JA 4WXOA 2LDYA 1S77D 2P6SA 4KFBB 3RW6A 3DRSA 3LGMA 5KT5A 3JB9k 2HHVA 4HEA9 2LEPA 5F0UA 2CJ9A 1TKXB 4USHA 4P6QA 3RYLA 2LQBA 3RB6A 1FA0A 3SEOA 1CQNA 4H4MA 2A10A 3N79A 2ZH4A 1HFEL 3LUYA 2CJBA 4RX6A 3I0RB 1HNVB 4MKYA 5CYMB 4DL0C 4YUDA 3FSIA 3T3FA 2EFQA 2IVMA 2WB1D 3IR7B 1TKXA 3SV3A 3QGHA 1BD6A 3RB3A 2XY5A 1XMOF 1VIXA 4ZHRB 1V3SA 4HVZA 4TKTA 3UDLA 4YQWA 3T5JA 4F2RA 1XMQF 3I0RA 4ZOSA 1P9QC 2PMHA 1FRKA 1VQ5S 3GFYA 5KT2A 1HNIA 2HLUA 5CYMA 1KTVA 1REVB 3I31A 4HLBA 1JNRB 4JYAF 5KOWA 3IFEA 2XMMA 3X3UA 2XG8A 4A8MP 3TOQA 2HWTA 2MKSA 5AE3A 4ECYA 1ELOA 1RTDB 2DO4A 2K3IA 4XAKA 4OZLA 2L48A 4K5RA 1H7WA 1NK9A 4A8KA 4C9DA 2CJAA 3M6VA 2VPZB 2CQ0A 2OKQA 3AB2B 3MPVA 4QQBA 4ILLA 2UUCF 2VUGA 3AA9A 2ZD1B 4Y65A 3GILA 1RTDA 3UNGC 5KFRA 1BGXT 5U47A 3HKZD 3HHKA 2NUHA 3MM5A 2J9EA 4PPZA 3KMQA 2YNGA 1KONA 5B0CA 2DGSA 2BANB 2K1RB 5F41A 3TA1A 4IRDA 2E66A 3PFEA 4IH5A 2XWXA 4OMFG 2HS3A 3Q23A 1X4GA 2AYMA 4PQAA 1IKYB 6FD1A 2N4DA 5B0EA 1KQSR 4CO5A 2JDJA 2YKPA 3OPKA 2JC0A 4A46A 2UUWA 4OHVA 1TK8A 2B6AB 4O3RA 4QYZJ 4FVMA 1HNZF 2BANA 2KZZA 3C66A 3NCPA 2RU9A 1P1LA 1U47A 3US5A 2A3JA 3M1VB 3FRZA 1AXQA 2HZCA 1VQ4S 2UXDF 3DU6A 2XZWA 1Q8IA 2ADBA 3TVYA 3TUIC 2ILZA 1BC6A 2ROPA 4JI2F 2ZOFA 4ECRA 2B6AA 1VQSA 2GFFA 1T05A 4URQU 3D5MA 3BN7A 4R0JA 3T6BA 4DJBA 3O5TB 3DYAA 2YKMB 3PNIA 3N28A 4OLPA 2IJFA 4OZNA 2RQKA 1Y00A 3LAKA 4F26A 4MIWA 5LJ3Y 1OIAA 4YB5A 3SV4A 1D8YA 1Y3JA 3T1HF 1MROA 2RD5C 3KKFA 4Y2KA 2J9DE 3W2VA 2GHWA 2LDIA 5A0YB 4X4RA 3BB5A 2OTLS 4B3RF 2KJWA 5EHHA 1FESA 2AYEA 2BUNA 4CH1A 4J37A 4NLQA 4LFBF 4LF6F 2CQIA 2I38A 3K2YA 2M5YA 2HS0A 1FKPB 1IBMF 2QMWA 4RLEA 2DIUA 4LF8F 3DLKB 4DUYF 5DDPC 5EX3A 1Q7LB 4RUCA 5A0YA 1HW8A 2XMVA 5KFXA 3PW2A 4F4XA 2M0GB 4C8NA 2YH1A 1N5YB 4N41A 1H2UX 3LP2B 3PY8A 4CT9A 3MPYA 2PE8A 2BRLA 1TL5A 2QA1A 4ZPDA 3I9ZA 2D3UA 3MEEB 2HQIA 4JI1F 2MKHA 3OJUA 1U25A 3UW1A 2MHNA 3QWUA 3O6QA 1AFIA 3H5XA 1GTHA 3PEJA 2J8AA 3QJJA 1RQ0A 4IQMA 4EBDA 5D3GA 3LALA 3LP2A 3KLGA 1QUPA 2RH3A 1Q86T 1P6TA 2MZJA 3MMCB 2OFGX 1KHVA 5DGBA 1MU2A 4M8LA 2FY1A 1NO8A 4DHVA 3CC2S 3GE9A 1AROP 2ZJPQ 3MR2A 2IFXA 1YJTA 2BA9A 2C42A 4ITSA 4KV8B 5K8OA 1PILA 1Y9OA 2L9WA 3JYTB 1GNKA 4J9LA 4K5SA 5FJ4A 2MMYA 2HNZA 4Q8FA 5CQGA 1CEZA 2IM0A 3N4WA 3K58A 4ELUA 3H2VE 1AW0A 2RDIA 4JI7F 3F41A 2WSCC 4U7CA 3CSKA 2CPZA 1OS5A 2OD4A 4C8ZA 1CQMA 3JTOA 2HLTA 4DN0A 2GJIA 4ZP7A 2C2EA 2NSCA 3HXMA 4WTYA 1ZAVA 2IM1A 3TAMB 2HGNA 4K4SA 2NZ4A 4NRTA 4UUXA 5FIIA 4TNOA 1VQ8S 2JEIA 4X4QA 1U26A 2M52A 2ZE2A 4KQZA 5LT5A 2ZH3A 3P6YC 4MJKA 1WG4A 1MWZA 4IDKB 2ZBCA 3TO8A 5DLFA 3DMJB 2J7WA 1UEUA 3KHLA 5B7WA 1S6QA 4NLGA 1VJWA 4I6YA 1RT1A 2ZITA 2PN6A 3CCTA 5KFQA 1WF1A 4TYBA 1APSA 2RB7A 4NA1A 5I4MA 4PG8A 2IBOA 4QYRA 3CD0A 2XSFA 1UEVA 2FLNA 4ES3A 2JVRA 1YITS 1JJ4A 3QPIA 2Z2LA 1JKHA 3FZ2A 1N0VC 3CEDA 1QAYA 3AJ1A 2F8MA 2VODA 1LXJA 3N6LA 4MKAA 5IT4A 3B4DA 4OHWA 1K9MT 1VFJA 1TVRA 5KFCA 2E44A 1B0PA 5G0RB 4OX8A 2DHSA 2FJXA 1Y7PA 4E8UA 2MGZA 2V8GA 4LF9F 3MDFA 4I6AA 4NOHA 4WFZA 2DITA 3VR1A 4IOAQ 1VK8A 1ZAWA 2W9AA 2VG6B 3HI9A 4N76A 3HFKA 3ZZPA 2GIQA 3IRWP 5DG8A 4DV4F 4ZCIA 2W7AA 2KXHA 3UE2A 2VFTA 5GAGU 1N54B 2ZDPA 2JSXA 2RU3A 5L1JA 3H5SA 3SXLA 2N3LA 2RQCA 1IKWB 1Y5IB 2E1MC 3N6NA 4W90B 3FMWA 5ITHA 3K5NA 1XN9A 1EP4B 3I82A 2CRLA 1UETA 5C24A 2XSJB 2GC8A 2E5HA 4R0EA