5LSRA

Carboxysome shell protein ccmp from synechococcus elongatus pcc 7942
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
205
structure length
205
Chain Sequence
VELRSYVYLDNLQRQHASYIGTVATGFLTLPGDASVWIEISPGIEINRMMDIALKAAVVRPGVQFIERLYGLMEVHASNQGEVREAGRAVLSALGLTERDRLKPKIVSSQIIRNIDAHQAQLINRQRRGQMLLAGETLYVLEVQPAAYAALAANEAEKAALINILQVSAIGSFGRLFLGGEERDIIAGSRAAVAALENLSGREHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords CcmP
publication title Crystal structures of beta-carboxysome shell protein CcmP: ligand binding correlates with the closed or open central pore.
pubmed doi rcsb
source organism Synechococcus elongatus pcc 7942
total genus 68
structure length 205
sequence length 205
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-09-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1810 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5lsrA01
3.30.70.1810 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5lsrA02
3FCHA 3U27A 3I87A 4HT5A 5LT5A 4HT7A 3GFHA 3I82A 5SUHA 3F56A 5L39A 5LSRA 3MPVA
chains in the Genus database with same CATH superfamily
2J0WA 1F1BB 3DDNA 3ITHB 1DARA 4JI5J 3GE9A 3MR3A 2DR7A 5KG5A 2HMIA 2ZC4A 2C3YA 2A1BA 4B3RF 3A3NB 1RT3A 3UO0A 3THVA 5DO2A 5L38A 4ILLA 5GMKa 1CS4A 2VG7B 2F4VJ 2V8GA 3CC4S 3EPIA 3K57A 4QR0A 4P74A 3NBPA 4HLBA 2E29A 4LSNB 1C0TB 2VFUA 1YX2A 1XEZA 4EBEA 1HHSA 2RF2B 2A6MA 5L1KA 1NXIA 3MCMA 5B0FA 2JOQA 1WTFA 1T9WA 3PJWA 2X1AA 3RG6A 3OSNA 4TVAB 1N0UA 4ZK7M 5ETPA 1TL1A 2LA6A 2IPOB 4DF8A 2BANB 3I96A 2IA0A 3D9BA 4Y3CA 4OHZA 3KLGB 3OFHA 4LF2A 4GC6A 3QLHA 3KJVA 1WEXA 4RW7A 2WW4A 3KLHA 2KZMA 1NPRA 2W8LA 2DNPA 1N4LA 2OUGA 3VGUA 4NOHA 3P5BP 4GKKJ 2I6WA 3HFKA 1MN7A 2CPXA 3CT9A 5D3GB 2GC8A 4OI6A 3GV5B 5KFIA 1NMEB 1X0FA 1GTHA 2Y0SD 1HI8A 2NSBA 4C7QA 5KFNA 2DRDA 2FIUA 2CNNB 3R1HA 1OQ6A 1BWEA 3AD8C 5B0AA 5LMNF 2B56A 4LF9F 2VASA 4F4XA 2CQ4A 2FVCA 2BEFA 3N6MA 3NS5A 5I4MA 4EEYA 3V81A 3UDEA 3BV8A 4PR6A 3VAJA 3OL9A 4EGLA 4WFNQ 4YUDA 4I64A 4NYPA 1YRXA 3MUMP 3GFZA 4WYLA 4J90A 3E3XA 2HKEA 1RT4A 3OTEA 4OYZA 4YR0A 5DQHA 3GLJA 1ZYQA 2ZBPA 2GIFA 1XMQJ 3KG4A 3L95X 1V3ZA 4PWDA 1SC1B 5BXIA 2CJAA 5FLXY 3BN4A 2CPYA 3UDLA 3BBFA 4QIFA 4K5SA 4KIAA 1KFDA 1IBCB 2GO9A 4OYBA 4OZ5A 5F8GA 5DDPC 4OI2A 1QVGR 3LGNA 4DI6A 3UWTA 2XY5A 2JFKA 5DJBA 2ZKUA 3HK2A 3Q2TC 3M32B 1NKBA 2AGOA 4N8OA 5BJRA 4K4XA 3PW2A 1MMDA 1EKRA 1XNRF 2CQBA 2HWTA 6FD1A 1F5AA 4KHPJ 3UCGA 5L1JA 5ETQA 1B70B 2W2PP 3HI9A 2L41A 1IJEB 4CH7A 1U1MA 1FE4A 1X4FA 1VJQA 1RADB 2VHGA 4ZIWA 3A1YG 1XR5A 2G0CA 3C16A 3ZNUA 4QIVA 3WIUA 5LMUJ 2XLKA 4OYIA 4QJVA 2ACYA 3RB3A 1IKVB 4FDFA 2ZHOA 2ZH2A 1WG1A 4KGZB 1C0UB 3N79A 5AT1B 2X3GA 4YHHF 3DLGA 2ZUGA 1M0SA 4OZ2A 5HATA 1MN9A 3PZPA 2FB0A 1HBNB 4USMA 3QNWB 4FVCA 3BGRA 4LR9A 4C0BA 4DSIA 4KKOA 1NK5A 1JIHA 3JTNA 1SH0A 1XN9A 3NP5A 2D3UA 2Q66A 2H5JB 2NYIA 4B9SA 2BE7D 2GA7A 1LFWA 1UAWA 3FEXB 2CIMA 3WIVA 2LKZA 1UVJA 2GJIA 1R8PA 3BBBA 3RTVA 1Q78A 2BJ9A 1S1XB 3H25A 2HNYB 3CGIA 3CJSA 1MROA 2OHDA 3F56A 3TQ1A 4UQTA 2Z2ZA 1RU1A 1Q7YT 2KTQA 3K2YA 5KFHA 2W9BB 2W7AA 3QGPA 3UN2A 4ATNA 1FT8A 3R5GA 1YJUA 1PBUA 3BEGB 1MU2B 2B7BB 4ZVUB 2KJWA 4GO5X 4DQSA 2KN4A 3JSMB 5GADU 2HNZB 3D1OA 4Y28C 2HS0A 4KTQA 1J27A 1NH8A 1NNDA 5DM7Q 4DR4J 4QYZJ 3CO9A 1U24A 4ID8A 3HKZD 1HPZA 3S7RA 3GSDA 4PQUA 3CIMA 4C11A 4RW4B 2MZJA 3HXMA 4DU7A 3CC7S 4O44B 4NCBA 4KGVB 3K59A 4DBQA 5LXRA 3IBCB 2O1PA 2VDHA 3M7VA 3AXMA 1G3OA 1RISA 3QO9A 3L7OA 2Y1RI 1LWFB 2KFNA 1U8WA 4X62F 3T5KA 3KHHA 1VBZA 1B3TA 3KKFA 1P9YA 5GVQA 2UXBF 1Q5YA 5KFRA 1DTTB 4PYAA 5EWFA 4HEA9 2CAJA 3BQ0A 1BE4A 3TAPA 1VCTA 3UFCX 4ZPWR 1JKHB 1U2FA 4F67A 2KYXA 2VUGA 1HHQA 3ET6A 1UVMA 4KV8A 4TYBA 5K14B 2QG9B 4IQMA 4OI4A 1KVIA 2BXJA 2OPQB 1DRZA 2LA4A 4PG4A 1E6YA 2WB4A 2V8HA 4DV5F 2BV3A 2H3EB 3QZ8A 4ICLA 4UF4A 3FEYB 3M8PB 1CLFA 2MLXA 1PGZA 2A2DA 2LYVA 4ZVPB 1WKJA 1MMLA 5T41A 2MSTA 2F8MA 4USTA 1NHKL 5AJ3J 1YZ7A 1Y5IB 3QJJA 4USVA 5F41A 3RUBL 3DHXA 3TZXA 1WF0A 4A8SA 1O8BA 5FDLB 2ROPA 2KHCA 4YMEA 2B4PA 2CQDA 2L08A 4ILRA 4CT8A 4Y2KA 4W4MA 3HHLB 2VQFF 1GX6A 3IS9A 4QQBA 2DNNA 3OFEA 1NK9A 2CNOB 3TA0A 4QR1A 2YWGA 4GC7A 3LAMA 3M05A 2YWWA 1Q86T 3AD9C 8RUCA 2ZVSA 2QIFA 2F9JA 2CWKA 4WYWA 1LW2B 4NLDA 1J5OA 1AFIA 2HWHA 4DV3F 3TAQA 4DCJB 2AQ4A 2HPUA 4FNIA 2HVDA 1KOOA 3L4BC 2E1CA 3NAIA 2BX6A 1CBKA 3US5A 3RW7A 4AL6A 3JYTB 3QJPA 2DJWA 1CEZA 3R2DJ 4Q44A 4ID5A 5IFMA 1LW0B 4HHUA 1R7IA 1YRUA 2I38A 3UD3P 4FPIA 3PFEA 3MUTP 4A48A 2XG8A 1Y0HA 4GVLA 3TVZA 1EIYB 2ZJRQ 3SYZA 2BKNA 1CJTB 1QE1A 3ENWA 3CDAA 4TKTA 3CDWA 5KFZA 1RHUB 5HVHA 2GJFA 1RTHB 2ZNYA 4U67Q 2IY5B 2YNGA 3A3PB 4L3KA 4DU8A 2LQ8A 3W64A 3SCKE 4CYUA 3AODA 3I55S 1RTIB 2ZBQA 4JI7F 5E5NA 2HHPA 3FCVA 2GIRA 2JEJA 4HT5A 1SPBP 2D3O1 3VF0B 1NSAA 3BO4A 4ELUA 3MEDA 3TOQA 5A0YA 3GIIA 5ETKA 1S9GA 4V19X 2FVQA 3PYDA 2MEWA 2Q43A 4BWJA 4OZNA 3QAEA 1FDNA 4I6WA 3P45B 1TFWA 1X0PA 4KO0B 4URSA 5HANA 4DX8H 5K8PA 3ISNC 2LDIA 4NA1A 4OHYA 4ES1A 1SKRA 3DOLB 2V94A 4ZJLA 4USWA 2AX0A 3W7BA 2VBYA 3BB5A 5AE2A 1QTNB 4A46A 4ELVA 1FFWB 4AL7A 1KR4A 4RPFA 3AOAA 3FFIB 4KPYA 4JI1F 2RS2A 4KYZA 3FK4A 4RNFA 2WTFA 3MR2A 1I94J 2KT3A 2UXDJ 5GAGI 1H3DA 3W9JA 4ZP8A 1B0PA 1EP4B 4FVMA 1YITS 4DUYJ 1ICEB 3RRHA 4I2PA 3MMBB 1PAEX 2YH0A 2HW3A 2NXNA 2HFVA 4K4VA 2CPZA 2CPJA 3LGHA 2OPSA 1WWHA 5KG2A 1RHQB 2XB2D 3IO1A 2DGUA 1IKWA 4Y2MA 1CULA 2UUCF 4AFFA 2MDAA 4RBVA 3DYAA 2EK6A 4AQYJ 5B0CA 4ZMMA 1RTJA 2V67A 2IDEA 2DNOA 4NEYA 1RAJA 3LOUA 2MZQA 4CI0B 5HK4A 3CVKA 2GAGC 3PTWA 2HVZA 2QMUB 3KLIA 2U1AA 2R7SA 2FDNA 5CAAA 2GMJA 4IFVB 3QZ7A 2M8HA 3OTCA 2WBMA 3T3FA 1FCAA 1PKUA 3KJFB 3SCLE 2ZEJA 3AJDA 4NX9A 5IQQA 5IC6B 2IMWP 1TTHB 1K44A 2NS1B 1TZ0A 5DLFA 2AYEA 3I0SA 4YB1P 1A6LA 1VQ7S 3H20A 4WFAQ 2KVIA 1CQMA 1IVZA 3EWGA 2CDQA 3EMTA 3MM9B 3GONA 1ULRA 2DCUB 4JUZA 2YNHB 2AMCB 2PGCA 1SIZA 2E9ZA 1UETA 2RKIA 5D15A 2I5JB 1Z1ZA 4M63A 1Q8KA 2HFZA 2P9EA 2Z8QA 3W62A 4NCGA 3JB9k 5D77A 1HL6A 1NK0A 4A8OA 3OFFA 1REVB 4LF6J 1HWUA 2YKNA 4C8OA 3E51A 4FF3A 1XNQF 1NRKA 1HQEA 1RHMB 2OLWA 1W25A 2JL9A 3TO8A 2YX1A 4MFBA 4A8KA 2CA9A 2GIQA 3Q0AA 5LSRA 5KFUA 1H98A 2VL1A 2KFZA 3P6YC 1SL1A 2JEIA 4JI3J 3Q8SB 3RZAA 2W2QP 4ZVSB 1V3SA 1ZM2A 2HHUA 1RTDB 3MHYA 5HO4A 4RNHA 1JB0C 4X2BA 5D8HB 2AD9A 2DNRA 2M4MA 1F6TA 1WORA 4DPYA 3ZTSA 1OWXA 3R1LA 1N0VC 2ZKTA 4BDPA 2VD3A 2RRAA 1CJKA 4C9DA 1TKZB 2K2PA 3ONQA 3BH6B 2XMVA 2R2SA 1S6UA 2WBRA 4JV5J 1Z4UA 3PW4A 4ED8A 1YKWA 1WF2A 1V3RA 2Y1JA 2HZAA 2Z56B 5FLXU 1Q81T 2QV6A 3KK1A 4W90B 3AB2B 1EHWA 1N48A 3CCUS 1IN0A 3S8SA 4NZ7A 1LXJA 1W26A 2OEJA 4L76A 3G96A 3RB4A 3A8KA 5HROA 1HBUB 2LCWA 4ED7A 1LWCB 1DTQB 1R8BA 4U95A 2DR9A 4YFUA 2H54B 4PG6A 3O8WA 3NGUA 4X4OA 2CFXA 2ZD1A 4C0OC 2VU5A 3O6QA 5KFCA 2GJ2A 3O3LA 1U45A 3SV3A 3SFUA 4MKAA 4LMZA 1OY6A 1RTZA 4ZOSA 1KQSR 4Q2MA 2LU1A 4X64F 4U7UD 3AB4B 1N88A 5L8RC 1IQZA 3DI6A 3DRPB 4DPTA 2XULA 1HD1A 1MW7A 2VBZA 5E3CA 1V5IB 4YR3A 4HI2A 1R0AA 4CLFA 4FYDA 7AT1B 3IG1B 4HL9A 1X4HA 2ILYA 2VA2A 3EJMA 2LXIA 2ZBCA 2OPRA 3SCIE 4LF9J 2DKOB 4B9UA 3MM5B 1YLXA 2H4WB 4OJGA 2XY7A 1QTMA 4CP5A 2M8DB 3NGSA 4DUZJ 4ZN3A 1QUVA 3CD7A 3MEEB 4H4KC 1FHTA 2JDJA 3QATA 2KT5A 2UVVA 5G0RA 4LFBF 2WONB 1OYEA 2J9DE 2PI4A 3KHGA 1WACA 1TELA 1S1UB 1VHFA 3N01A 1FRIA 2ZVIA 1U1PA 2B7CB 1OSCA 5KT5A 1VC0A 3M1VA 4ECWA 1OSDA 3BR8A 1URRA 3DU5A 4NLRA 5KT6A 3DRRB 1T9XA 2HHSA 3SDEB 3OL8A 2DCLA 2VB6A 3F0NA 1T03B 1NDPA 1YJWS 2XEXA 1XNRJ 3U1MA 2O3DA 3G71S 2MKHA 4H4MA 4DN9A 3OLAA 4MKBA 4JI0J 2MSSA 2LXUA 5CYMA 2HBYB 1FDAA 1S9EA 1SC3B 2C2OB 1ZOTA 2CNKB 4DFKA 1HMVB 2PEHA 4OZ3A 2J8SA 3X1LB 3MM7B 1U4BA 1LNQA 2W25A 1UZHA 3JQKA 2F1FA 3UW1A 4OI0A 4MTPA 1S10A 3DOKB 1S1TA 4ZLNA 2DNQA 2MY8A 2FJAB 1DBDA 3JTOA 1EARA 1H0HB 3NL0A 4DHVA 4Q0BA 3QMQA 4DR7F 5HQ8A 3DXSX 1HI0P 2W24A 2OJ3A 4QPXA 3PW7A 4YB5A 4M5LA 5DQGA 5KG1A 3BF4A 2QT7A 1EAYC 3KXDA 2M52A 1YVFA 2G2ZA 3J7YU 5D0EA 2Z0GA 4J9KA 1NSQA 2M9KA 4ZVTB 4WP9A 4PG7A 3SQOP 1VJWA 3MAHA 1R0CB 5F8IA 5ETTA 4KH1B 2MKCA 4KBIA 3GV8B 2PD1A 4CH0S 1T05B 4N76A 2FVSA 2CADA 2E7XA 4NMXA 2KXHA 4FNHA 5KFTA 1NHVA 4F4AA 3RAQA 1VC5A 2RRBA 3V81B 1HQUA 4B9VA 1F5CA 4QR2A 3CSKA 1WOOA 5E3RA 4YB6A 3ZTOA 5HP1A 1D9AA 3DHWC 3W2WA 3GYNA 2BJ3A 2B5JB 3CJ3A 4HI1A 3RRGA 1RT6A 2P9GA 4HHJA 1S72S 5F3ZA 2N3OA 1VFJA 4USJC 2J9CA 4ED0A 1B0VA 2FZCB 1FK9A 1AXQA 4X62J 3DGVA 1X4CA 2PMWA 1JNRB 3D0IE 3ISND 2BABA 3V6HA 3ITHA 3TARA 3IGNA 4DL6A 1EKSA 1T9TA 3M8SA 3VAFA 4K2XA 1OY8A 1FJGJ 3L9ZA 4LF5F 3GZ7A 2VG7A 1FJEB 2R7QA 3IR7B 3TJ9A 2WB1D 3DOMB 4JI4F 2D3ZA 3PR4A 3D3CJ 3I9V9 2FC8A 2OSRA 1BQMB 4LSNA 1C0TA 4XTTA 1G2EA 2RF2A 4DL2A 2XS5A 3THPA 4W98A 1YHQS 2BM0A 3TWZA 3OHAA 3TQEA 2BANA 2YQ0A 4CDIA 4OL8A 2MHEA 2NYHA 4ZJOA 1NBEB 3CEDA 1B4SA 3KLGA 2FY1A 1NO8A 4J9RA 1NUEA 4DSLA 3EPGA 3TZWA 3PCOB 3CCRS 2VQFJ 2FJBB 2J6TA 3IR5B 3O5TB 4NPOA 2MPUA 5D3GA 3BO3A 1NKCA 2JSXA 1KKHA 2BJ1A 2ZHBA 2XCPA 1HI1A 4XPEA 1ZA2B 1VDHA 4LR7A 1TL4A 1VIXA 1VR6A 1U26A 1X4AA 5H1SV 4NXMF 2DTJA 3LP0B 1N33F 4FPRA 2GGPA 2N82B 3CCMS 5J2MB 4QZVB 3ZTPA 4M8LA 2B43A 2ZH4A 4LRDA 5HMWA 1DJ0A 3PRDA 5A2QY 4ECUA 2PFFB 2CJBA 3BPDA 4J9VA 4O3PA 3AY0A 2E1PA 4ZP9A 2DHHA 3VV2B 2ZBRA 1ACMB 4EO6A 5DRKA 1QY7A 2K3IA 2CPIA 3P3DA 2V8PA 2F3JA 3MOZA 1ZM3A 2YWFA 1KWMA 4LUBA 2MKYA 3M32A 1GX5A 4AD6A 2IM3A 4DV7F 4EUVA 3GFXA 1Y5NB 1NZ8A 2Y1LB 5D0RA 3UNYA 1XMOF 2HVHA 1DQ9A 4WFXA 1MWZA 1SJQA 4LSZB 2AEJA 3HD1A 3R7BB 3CO0P 4MIBA 1D9FA 4LRBA 2XC9A 2BR0A 3F73A 4DFJA 2PIIA 1IKVA 1R31A 2LVWA 3ENVA 5GADI 1Y4ZB 1H2TZ 2RUSA 3SSRA 4NLXA 1HBNA 2PE8A 2XY6A 4XO0A 1S9FA 2J6UA 4F2RA 3HDSA 4V1Ak 1OMSA 3ZZOA 2QA4G 2PI5A 3WBZA 2DGXA 2AGQA 1S4FA 3GCWP 3Q8YA 3RR7A 3E8OA 4ZCMA 4JI1J 3BDEA 2DGSA 3M6WA 5J1EB 5BYQA 2V5HG 2R7TA 5DDOC 1QAXA 3BYPA 3OTDA 3OQ2A 5D0HA 5C7PA 1S1XA 4NEZA 3DLJA 3TUPA 2FJWA 2HNYA 2GFFA 1VGYA 2FUG9 2ZE2B 1SB6A 3BQ1A 2W9BA 3I0RB 3Q23A 5T7LB 2L9WA 3PHTA 4RJVA 3WHIA 4F4WA 1K0TA 1OIAA 2W7PA 4K8RA 9RUBA 4CLKA 4CTAB 2VOOA 1MU2A 4OFZA 3EX7B 3OPKA 1I51B 4DCOB 2HBZB 3JSMA 1TUVA 2HNZA 1BMQB 2NZ4A 3A8EA 2DIUA 3SEOA 2QA1A 3VGSA 4KAIA 2IRYA 4F04B 5BYSA 5C42B 3GJSB 1NJZA 2K1RA 3GILA 3PW0A 2HQCA 3R6LB 4MJKA 4LSLB 4F36A 1WG4A 5EGYA 4RW4A 3VCDA 3V6KA 1S6OA 5J1PA 4O44A 2YQ3A 1SJRA 3V4MA 2ZH7A 5IWAJ 2YTCA 3OSPA 2YX4A 1H38A 3ZZTA 4ED2A 2DBBA 4WTYA 3V5RA 4EBCA 1XMQF 5D4LA 4HT7A 1R89A 1VK3A 4OX6A 2A3JA 3W8GA 1Y11A 4P75A 3QQCD 2OD6A 2VIHA 1LWFA 3LW5C 4LIRA 3CD6S 1PJ6A 1SI9A 3GV7B 4ZVQB 3GYXB 4M5IA 2HURA 3ZTQA 2RDIA 1HNWJ 3WDOA 4M95A 1DTTA 1U49A 2ZFHA 1RLCL 1XNQJ 1JKHA 4JI8F 2YNGB 1MNEA 1GFWB 1FRMA 3AJ1A 2HS4A 3NNCA 5K14A 2E1MC 3JS9A 4R0JA 2OPQA 2XS7A 3D54A 1RAIB 1T9YA 3I56S 3UCZP 4RO0A 4EU0A 4ERDA 1JX4A 3MI7X 2JRSA 1F9HA 5FD1A 3J7ZT 3M8PA 4QWCA 1S99A 3M9MB 1NK7A 1B64A 1HA1A 4UZBA 1OPIA 1VQMS 3Q86A 1RA6A 2GS8A 4PYDA 3TEHB 4DR6F 3RRKA 1FD2A 2ZWOA 3M8QB 3RU0A 4RW8B 1NJXA 1TL7B 3ILLA 2FZGB 4UOCA 5FDLA 4I7FB 1LQ9A 4N8NA 3OD2A 4DQIA 2ZH8A 5KTQA 3UD4P 1D1UA 4HACA 2FGCA 3HHLA 4OX7A 1N36F 2FPHX 2HRUA 5EUHA 1RAHB 2Z57B 4CNZA 2JLFA 2G1DA 4CO3A 2HK3A 4DV2F 2NSCA 5KFFA 1GAOA 1EETB 2B6AB 3OT9A 2QL5B 2HWIA 3HCXA 4IG0A 1ZBTA 4PCQA 1LW2A 1TV6B 5KG0A 4O3OA 2P9CA 4I2PB 3BQ2A 2D69A 3KLEB 2GCFA 1ZPVA 1F9EB 1RAGB 3ETMA 1ZTWA 3HKWA 2GZOA 3C6TB 4UOGA 2BUNA 1VBYA 3LALA 3JYTA 1T9UA 2B4OA 2X51A 1LW0A 1ZETA 1UA1A 4IG3B 3S6EA 2UP1A 1UJ6A 3UVJB 1FD8A 3G8TA 2IIHA 2DH9A 2DEIA 3D0GE 4ZPDA 4NL5A 3ZZZA 4LFAJ 1BD6A 4ED6A 4USHA 3TYTA 1RWKB 3KUHA 2HGMA 2ADCA 3IRWP 2BKOA 1GXLA 1RTHA 2B4UA 3W9IA 4USUA 4GO7X 2KM8B 4DQQA 3VVUA 2Y9HA 2OTLS 1R3NA 1TVRB 2CJYB 1RWVB 2ZUAA 5IV3A 3EUNA 4PXBA 1RTIA 5CXTA 2EFOA 4M5KA 2VBXA 5JJBA 4URQU 5J2QB 1RHJB 3RB6A 2JC0A 4WFYA 4DJBA 1FNOA 3CD0A 4KHRA 2DD8S 2C3OA 1JXLA 2XLIA 4NLVA 4C8NA 2F4FA 5IM0B 4ECTA 4DFMA 3R27A 3IAM9 1VHIA 2JNJA 5ETVA 4KHMA 2QO3A 1UMJA 4X65F 1YBAA 1AROP 4RL1A 4EZ9A 3DRSB 4KO0A 1PG5B 2ZJPQ 2DXEA 4DR2J 2MYFA 4DMZA 3BO2A 1UEVA 1K47A 1RT7A 3DOLA 4MFBB 3ICLA 5KG7A 3I4HX 4JI6F 3PG9A 4OZJA 5KFWA 2P2CB 5IT4A 4LFBJ 4RUBA 3EVOA 2EBGA 5M2UA 1C1BB 2BBEA 3U1LA 3FFIA 4QWBA 4RLEA 1TUGB 4PPDA 3ZNJ1 3GU0A 3CJKB 3G6ES 5E33A 4ZHRB 2MJNA 2MQ8A 4C8LA 1EP4A 1KVJA 3KJNB 3MMBA 3H5SA 4W92B 2HQFA 2FC9A 1HWKA 1C4AA 1FXLA 2BDPA 5KFMA 1DQAA 1U09A 3QT6A 3NOGA 5FIIA 4OYXA 3CJ0A 3MR6A 3P8BB 2BVZA 4MK7A 3HF5A 3R5DA 5AE1A 1RWPB 3N5BA 5KFXA 3KNAA 2XO7A 1CSJA 4OZ0A 1WNEA 2HFOA 2WRMA 2WOMB 1FA0A 1VQ5S 2EG2A 3GG0A 5C2CA 3IRXB 4ZVEA 5MAOA 2QL7B 3QSIA 2CPFA 1HARA 4IFVA 2XGQA 2EEYA 2DGQA 3H5YA 1X9SA 2MZSA 1T8EA 3AH6A 2H9ZA 2R7VA 3V4IB 1M5PC 4O4RA 5M2RA 2Z2LA 4OV6A 3B78A 5KOXA 2B9EA 1LK5A 3Q24A 4QYRA 5AXKA 3KJQB 2RD5C 3MM9A 2LQBA 2BYCA 2H51B 3K8WA 4F3QA 2G0IA 1RYSA 3DRXA 3HJVA 4USIA 3MAQA 4ZDNA 1G7CB 4KQZA 2UV8G 2JH3A 1R8CA 4OLOA 2I5JA 2IYGA 4EFAC 2RIJA 4KR0B 4CLTA 2VICA 2YY3A 2DISA 2RHSB 2COLA 2WSFC 1UPPA 3M8RA 2HZCA 3GJQB 1REVA 1RCOB 2XM3A 4YDDB 1FNXH 2ALZA 1RBOB 4NLPA 2DRAA 3RGIA 3BSNA 1AZSA 2R9LA 2G0JA 2GVZB 3DI6B 3HSJA 2C28A 4WKRA 1TAUA 2DHSA 2XI3A 4Q8EA 1AUDA 4EWTA 3EXYA 5B7WA 1IKXA 4ES3A 2CQPA 4RBTA 5LJ5Y 5I3QA 3HD2A 5ETLA 3CCSS 4P7TA 1HFEL 3GR0A 4C0HA 1QUPA 1I6JA 4O4GB 3AA9A 4RW9B 3NOCA 1I1GA 1N5TA 1AA1B 1U6BA 3SMZA 1Y5LB 2NXCA 4IDKB 2HHHF 2QEXS 1WD6A 3LWMA 1TKZA 4DX7A 5E41A 1HWIA 4UUXA 3J81Y 3R5CA 4J9LA 1R8HA 1VS3A 5IT0A 3ELHA 1CQNA 3CJRA 3PDNA 1X5PA 2I8EA 3HHKA 2UXDF 4JB8B 1DAXA 3CJQA 3QFWA 2HAIA 2Z30B 3G6YA 3PACA 2LEAA 3BBCA 4P7VA 3PY8A 3SV4A 2GAHC 1K73T 2OPPB 4A8FA 4LF5J 1N54B 2CVEA 2IYIA 1MWQA 4N41A 4JI4J 4K50A 1LWXA 4QIWD 1HBUA 1UW4A 4F0HA 1UA0A 4F2SA 2OMLA 1LWCA 3W3SA 1DTQA 3PX4A 2FJEB 5IXUA 1X7VA 3T1HJ 1RHKB 3EDQB 2OH2A 4I2QB 2DEJA 1SJ4P 3QFHA 1W7WA 2EFNA 1DZ5A 5B0DA 2R8GA 4FF1A 2PA3A 1NM2A 5KFAA 2HLUA 3DFEA 2QRRA 3UD5A 1JWWA 2Q1LA 4AL5A 3NNHA 1HNVB 3CMES 1IBKF 1RB0A 3DRPA 4RWWA 2XWYA 3NG8A 1YSJA 3HT3A 3QBCA 1B0TA 2Q3PA 2NXEA 2ILZA 3MWBA 1T95A 3RBDA 2AV5A 3IG1A 2R3VA 4C3LA 1RSCA 4PXDA 2VQEJ 2GX8A 5A6WA 5H9FJ 2CPHA 3BH7B 4OJ1A 3KTQA 1K1QA 4NXMJ 2R2RA 3MM5A 1N33J 5KT4A 2GHVC 4LF6F 2LFVA 3PR5B 1RWUA 4ZKAA 1RLDA 3QAUA 3H2UB 3MEEA 2BE2B 4XPCA 1F2GA 1S1VB 3ZO7A 5HBMA 1HNXF 2WONA 1U02A 1FF2A 1K9MT 5KFPA 3MEGA 2EBEA 3MTKA 1S1UA 4JI3F 2GV1A 1UWBB 1RHRB 2JLEA 4Q5VA 1V6HA 5KFEA 1NAQA 3HT0A 3AT1B 5EX3A 3HVTB 2NR0A 4DL7A 1Q0NA 1FESA 1PC4A 3DRRA 1HQUB 4MIWA 4OQJA 5A6PA 3SDEA 3FCWA 4E0DA 2CQIA 2OGUA 4F26A 2FLOA 1T03A 1JLBB 4A8YA 3C46A 4DV7J 2XCAA 1YRTA 2GMHA 1VRTB 2Z4PA 3IC1A 3T6JA 2ATCB 3J7YI 1A0OB 3CCWA 1WEYA 4J9OA 6AT1B 1L3KA 4JV2A 1VIOA 3VR1A 3T9NA 3JXOA 2A18A 1R8AA 2M7SA 4J9NA 3W2VB 5AXLA 3JQMA 1HMVA 2YWEA 1T0TV 4LF1A 4G1QB 2FHJD 5LL6d 3PHEA 1S5ZA 4K0KF 1KLMB 1ZZFA 4YP3A 1IR0A 3MM7A 3GTYX 5D4NA 3DOKA 4UZCA 2AHOB 4X4VA 3ENQA 2AZ1A 4DLEA 3BR9A 3FZBA 3K5NA 2ZH3A 3HSZA 3SCJE 5E7OB 3OTBA 1WSRA 4UTGA 4NXNF 2CZ4A 4F02A 1UP1A 3RBEA 1IBMF 1WC1A 2DB1A 4DV4J 7FDRA 4FYWB 1UVKA 4B08A 1FKAF 5HQLA 2PEBA 3AAWB 3M4XA 5C24B 1ZA1B 4LBIA 3CDEA 2D3OR 2HHQA 2OSQA 2IRUA 5I3UB 4U8YA 1RCXB 2VZ9A 4EYIB 4DXLA 2CQ1A 2Y3YA 3ZZRA 4BLGA 2CQCA 3KDNA 4RU2A 3NY0A 4LF8J 3W5XA 3T6BA 4IOAQ 2VOPA 2LP4A 4QYZK 1VQKS 1BQXA 1SJ3P 3KLFB 1T05A 1C1CB 3F41A 2ABYA 4QWEA 1JLCB 3CTRA 2O66A 1RWNB 4NZ0A 2RE1A 1SUQB 4X4UA 2XNQA 1JMTA 4IR1A 2GGPB 4DF4A 3I5AA 2OO4A 2BMBA 2Y8YA 2BJEA 4DUZF 9ATCB 3EGVA 3DDKA 1NB7A 3PNIA 1REGX 3SFGA 4ECVA 4F4YA 5IT9Y 3CWJA 2ASLA 3Q8QB 3IWXA 2EC2A 4P52A 3BKFA 4F4ZA 3C14A 1M5SA 2ZH9A 2B5JA 3M8WA 2UXCJ 3DLKB 2YKMB 4IFYB 3QJLA 4MAKA 2AKWB 2R8JA 3AHPA 5HN0A 1OYDA 1B7YB 2BRLA 2A6OA 4LF4J 4NCAA 3VHQA 4O3QA 1U6ZA 1FDDA 3PM9A 1VMBA 1IWAA 2AZ3A 3N4WA 4JI8J 1UZDA 1CPZA 3G86A 5HSPA 3GIKA 4QWDA 1D0EA 2DIVA 4CO2A 3UDVA 1HW8A 4ECZA 3DOMA 2XYHB 1D9DA 2X1BA 3HSDA 1B7FA 3CXCR 4TNOA 2MZ1A 1U1QA 4JI0F 2B8PA 2M0GB 5JXSA 1BQMA 4CLWA 3JQJA 3POTB 3NEKA 1TUWA 3GG1A 2LMIA 1I3OB 5DDQC 3TUJC 5SZTA 2AJ2A 4DL5A 3L7UA 2HHXA 4DR6J 2HYIB 4KT0C 3CCVS 2HAFA 3BJYA 1WHWA 1CJVB 5HJYA 2PDAA 4KB7A 2R7OA 4USKA 1RT2B 4OI3A 3PVXA 2CUYA 5CQGA 3RW6A 3CW2C 2QTWA 4OYAA 2HHTA 3J7Z5 3I5CA 1N36J 1CC8A 4WK3A 2DYAA 3K5OA 4C8KA 1UTAA 5ADZA 1R0BG 2EKYA 2HRYA 5J2NB 4GRSA 3T1YF 4DV2J 5MLCV 4ZVHA 2QLWA 3DCAA 3OVAA 5I3PA 2IC3B 2BKPA 3N0VA 3M6UA 4NLYA 2D41A 1ZZNA 3MM6B 3LP0A 4C2MA 3D68A 1Q82T 2IJRA 5J2MA 1VRUA 1SXLA 1NB2A 3LF0A 4G1IA 4WIQA 4CLUA 4ZCIA 4X84A 4K7QA 5H9EK 2E5LF 1VBXA 4J37A 2UZAA 4DR3F 5EWGA 1H73A 2WVEA 4F0MA 1R43A 4YEAA 1KHVA 1GQEA 4V19J 2MKSA 1SC4B 3DGPB 3M2UA 1KN6A 2K1RB 3QRQA 1GNKA 2ASDA 2WZ1A 3TEGA 1VQPS 2B9YA 4NLQA 3CIZA 1TFYA 3Q8RB 2BA9A 1U1KA 4K4SA 2LQJA 1TU0B 2IMOA 2VPYB 3MR7A 1M1KT 1U48A 3AQPA 3J81j 1P1LA 2LU2A 3RBXA 1IKYB 2E1RA 4CM0A 4NLGA 1HNZF 3CJTA 5B09A 2CZVC 1BY9A 4HKQA 4PPZA 2IA6A 1Q7LB 3OXGA 5M2PA 2YKAA 1S0OA 4ZPBA 2RHQB 4X65J 2VPZB 4KRWA 3D7SB 1OJ4A 2ZZNA 4B3SF 1IQTA 4CLZA 1FJGF 4DG1B 1RT1B 2J0SD 1MLAA 3TAMB 4JI6J 1NLKL 1PIEA 1RT5B 1X4BA 4WXOA 4LF7F 3J7AN 4TY9A 2JFDA 1VQ8S 1NH7A 5E2QA 1TKTB 1SVDA 2PA8D 5F8JA 5DETA 5J1EA 5E3AA 4RBUA 2FHKA 3UN3A 2ZH5A 1Z2ZA 1KTVA 2LQ5A 3O44A 4FZVA 1D09B 4M94A 4PKDB 4K4WA 2UU9F 4NLUA 3N5FA 3TJAA 3BDPA 2QL9B 2ZE2A 1OO0B 4NLSA 3I0RA 5T7LA 2HQGA 1GT8A 1T02A 2DGOA 1J5EF 3DLEA 4HACB 3W5ZA 4B02A 4CTAA 4A8MP 1CC7A 2LXFA 4PAAA 4DPUA 1NSPA 3AOCA 4DZ6A 3OHBA 2CQ3A 2E66A 3J81U 4IG0B 5C42A 2FY8A 3VZHA 4RX6A 3LH2S 2B51A 4LSLA 2E5GA 5L46A 2Q6BA 2IVYA 2IM2A 3U02A 3LPYA 3AFGA 1UFWA 1RDRA 4NE9C 1XJWB 3DLLQ 3QT5A 1PYSB 2EC0A 2PFDA 4LBPA 2X7IA 4ZA1A 3GIJA 2KT2A 2ZJQQ 4DL3A 4U7CA 4DPXA 5F8HA 1S97A 3ZTRA 2KDOA 5ITHA 2RT3A 3R5JB 4DN0A 4OMFG 1UPMB 2J8AA 4WWSA 3W61A 3UPFA 3D28A 2RNEA 2IBKA 1F9FA 1WC5A 5CYQB 4MKYA 4ELTA 5BR8F 1IWGA 1NKEA 3TNVA 3SIPB 4WXWA 5CD4H 1FWLA 3V6JA 1Q1KA 3JSRA 1TQLA 4DL4A 3OXFA 3TANA 3FVYA 5L9XA 3M2VB 2VG6B 3BM7A 5A76A 1RBAA 3PYFA 1P1TA 2P8IA 2UUAF 1OPZA 4ECQA 4I0WA 1FKOB 2RUGA 3PYGA 3CCTA 1NJWA 1NJYA 2IBOA 3QYYA 4CLLA 1N32J 3M8QA 2R8KA 4RW8A 4QW9A 1TL7A 3UR0A 4N5SA 1YQHA 4XK8C 4I7FA 2KO1A 1VI7A 1RT7B 3Q2SC 4PZVA 2HHHJ 4CZCA 2AYBA 2PT0A 2XGPA 3I5BA 1V9OA 4WE1B 2KYZA 4AXIA 3QWUA 1M90T 3FBCA 1KFSA 3CJ5A 2P6SA 1X8DA 3HPOA 4O3SA 1HIYA 3MCNA 1JLFB 3M6VA 3FKBA 1EETA 4QWAA 2B6AA 4CLPA 4K4ZA 3TZZA 2RJZA 4N7TA 1TV6A 2OEKA 2KU7A 3KLEA 4MK9A 4NYZA 5SUHA 3K7RA 4TXSA 1Z2LA 4DFPA 1RAEB 3MEKA 3C6TA 3KFWX 1JJHA 2MLYA 4B3MJ 4DS4A 5DDRC 3CCES 1N8RT 1NZAA 4I1TA 3T1AA 2I1RA 3UCUP 4PRFA 4IG3A 1QDUB 3PEJA 4KGMA 2J6SA 3UVJA 3UNGC 5KFJA 2HNDB 3G9CA 1KQGB 2C2DA 2DHXA 3IN5A 3E2EA 2A10A 2YKOA 1NDCA 5GAHU 1HBOB 4A8XA 1WDDA 1WOSA 3WX4A 5KAKA 1U1RA 2CJQA 4LT6A 3NGDA 3TI0A 2GVDB 2N7CA 4ER8A 4ZP6A 4ALZA 2C2EA 3H2VE 2WVBA 4MKVA 1TVRA 1NDKA 5IWAF 4D3GA 4HTIA 1IBKJ 3EVWA 3LWLA 3OV7A 2BW2A 2R8IA 1LEOA 1DY3A 1GMVA 2R2TA 5J2QA 3M6XA 3CULA 4RZRA 5CA5A 4KGKA 4G6VB 2JLGA 4LQ3A 5IM0A 3IM8A 4CM2A 2YNIB 2MQMA 5DG8A 1LFPA 1HNWF 1HLWA 4WFZA 1PYTA 4R5PB 2FHOB 2HQIA 1HR0F 3DRSA 3GYGA 2BE9B 2J9DA 2H5IB 2M5YA 1KEKA 1QD1A 3HHEA 3MMCB 1ZM9A 1AZSB 2CXEA 2DH8A 1ZPWX 1FRHA 1X4DA 1HNXJ 2NZCA 2OAUA 3EVMA 2IFXA 5K8OA 4Z7YA 4DDFA 5RUBA 1C1BA 1IKXB 2MKJA 1MMNA 3GIMA 4G1PA 2XSJB 2YPZA 3OVBA 2EG1A 5CHCB 2QMXA 4L3NA 2RU3A 2W1BA 3TX0A 1JJ2R 2WW8A 3CJKA 2HHVA 4OHWA 4ZHRA 4KJIA 4KGXB 4NRUA 1XERA 2VH7A 2DNMA 4F50A 4OIXA 1FEEA 4E8UA 3B6BA 1FX2A 1JLEB 1ROFA 1KNZA 1WC0A 3AXKA 3F44A 3SSQA 3W60A 4K2JA 2ADBA 2UVRA 4M5MA 1X5OA 2WOMA 2KG0A 1YJRA 3IRXA 5KFQA 4AT1B 2OI2A 2IAJB 3S1TA 2BRKA 1JLQB 3SQGB 4K0KJ 2V4RA 1F5BA 3UN5A 2DR6A 1U7LA 5EHHA 2V4QA 1S6PB 3V4IA 4PWWA 3DLHA 4FF2A 3ZZ0A 2RQCA 2MGZB 3PKMA 3NRBA 4X4TA 3HO1A 1B99A 4WK1A 1A9NB 2V2VA 4WTOB 3K89A 3G82B 2RS8A 4DSKA 1ZM4A 2QLJB 5F0WA 5LOQA 1S4EA 3ADAC 4IO1A 4OX8A 4LFAF 3IBWA 3NAHA 3KHRA 4WZMA 5A8RB 2LEBA 4ZIVA 5LT5A 3R3TA 4CO1A 4NXNJ 1UFKA 4NRTA 1FTRA 1IBMJ 2OTJS 1FXDA 4PUOB 1RU2A 2DGVA 5HVGA 3L09A 1HYSB 1NU4A 4LR8A 2C42A 3OR1B 4DV0J 3A8IA 1VOMA 4H54A 3K58A 2GVZA 4BS2A 1IJFB 4R8UB 3BGFA 3H40A 2J7UA 1IR2A 2EKNA 3J7A1 2YQ1A 2JJ4D 1ZAVA 1SKSA 2GO8A 4IUFA 2JVRA 5B0GA 3DMJB 1SV5B 3FC9A 2QA2A 2B4VA 3VWSA 4WP8A 3BS9A 1RABB 5DS7A 3VAKA 2HFUA 5L39A 1AYEA 4O4GA 4NA2A 3I9ZA 4RW9A 2M88A 2PN6A 2W4PA 3HVWA 3HZGA 1QSYA 1AT1B 1X4GA 5D0GA 1VC6A 4DR2F 2MKIA 4X4PA 3OL7A 4IDKA 2I9SA 4DV1J 4P2SA 3CJ8A 2R7RA 2ZC3A 5HBMB 1FKPB 5JUMA 3S01A 4GMKA 3MEGB 1PJ7A 2YXLA 4ZCKA 3NGTA 4OZ1A 4AUKA 3O2IA 4F25A 1JQGA 2H1YA 2O67A 3CNQP 2E7WA 3GMGA 5ETNA 3UDCA 1F60B 1KOHA 4H4OB 3M30B 3DM2A 4B3OB 4HDGA 4N77A 1QSLA 2ZDOA 2DPIA 4NI2B 4YY3J 1FJ7A 2OPPA 3Q22A 1SQFA 2CDRB 3EGZA 3LP2B 2RU9A 4BBYA 4ZP7A 2XMKA 3GIRA 1KLNA 2PC6A 4EMDA 1FRXA 3B4MA 1NEEA 1Q8LA 1TR0A 1UL3A 2DY9A 4IKAA 1V5VA 2YH1A 1UVLA 3M9OB 2I0XA 4I2QA 1KC8T 1TL3B 3MMAB 1FI4A 4TU8A 2F5GA 2HQ3A 3TZYA 4KE5A 2CPEA 4UQGA 3K0JA 4ANDA 1SKUB 3OL6A 3MAAB 1HNVA 2OFGX 4U6PA 4YOEA 2YVSA 3H7HB 1S49A 2UV8A 3G8QA 3EZUA 2VF3A 3T1YJ 2FD2A 3QGIA 4XAKA 1SL0A 4PXCA 3BKUA 3I6PA 4ZVFA 2RSQA 1LOUA 5K8NA 3OTOF 4DOZA 4BC9A 5BYRA 4HH1A 4D3HA 5A8WB 3PX6A 3M8ZA 4MYTA 2IDLA 2BE2A 2EFGA 1RA7A 1S1VA 3CJ2A 4CLYA 3U1NA 5EWEA 2DNLA 4CH1A 2BOAA 2ZZMA 4GKJJ 2XYGB 2E5LJ 3PIPQ 1AUSL 5C2GA 4CCHA 4DR3J 4N56A 2VJVA 3PEHA 1NK8A 3P4UB 1E6VB 2HVIA 2H65B 4FXVA 3IMQJ 2XS2A 2BW7A 1UWBA 2HFNA 4CRJA 3HVTA 2VFSA 4WP3A 1HW9A 1DLOB 4CO0A 3EDRB 5J2PB 4Z7CA 3FZ2A 3QT7A 2MLZA 5JVHQ 5KFBA 1FRKA 4ILMA 4O0NA 1JLBA 2C22A 4C6AA 1S59A 3M8YA 1RQ0A 3KMSA 3C14B 1VRTA 4P9SA 4UUWA 1U1LA 4P72A 5I42B 2R2UA 1HNZJ 1N5SA 4ED5A 1YJVA 1P8GA 4Q2LA 4FF4A 1I5OB 2KB2A 3BSAA 3W2VA 1HBMB 4WPAA 2J7KA 4G1QA 1KLMA 3CCQS 2CZ9A 1YJNS 2ZOFA 3HVRA 4B3SJ 3H5XA 3KK3B 1BC6A 2EWHA 3OUYB 1WEZA 3C8YA 2XWXA 1YG0A 4LF7J 2XHCA 4FKYA 1FX4A 3VALA 4C48A 4ED1A 4Y2AA 3T1HF 3V6DA 4YQWA 5CYJA 4OLPA 2DRBA 2UU9J 1M5HA 4Q8FA 4Y2CA 3PJ9A 3R8YA 3I31A 2CWXA 1UVIA 3MPWA 5C24A 3E01B 3NCRA 4J9SA 4J7CA 5J1NA 2AEFA 5I3UA 1GEHA 1J5EJ 1OS5A 3W63A 3K17A 2B9WA 4WFBQ 5F9LA 3IBFB 2FVPA 4M5JA 3VAHA 2UUBJ 2H5EA 2RQKA 2DNHA 4DR1J 1PC5A 3W9HA 3KLFA 1C1CA 1Q16B 1JLCA 2VQEF 1H74A 2CQ2A 3KOAA 4BHQA 1SUQA 1M5OC 3JTPA 4C3KA 2RH3A 1YGYA 3D6FB 3PFOA 1ELOA 3W5YA 2ROEA 2HBQB 4DQRA 3MECB 2LECA 1VRUB 4F0KA 5FJ4A 3ISZA 3FMBA 3FQLA 4Q45A 1XQIA 5HI7A 2KL8A 2FHMA 3LP1B 2AJ4A 3C6UB 2IRXA 1EJ7L 1ZTTA 3CCJS 2MMYA 4IOCQ 3DRYA 1JNZB 3DLKA 2YKMA 4M1KA 4IFYA 2YKPA 2V2ZA 3H98A 3ZZUA 1S57A 3MOJB 2L9DA 1NPKA 2QA4S 1FEHA 3MPYA 1XMBA 5KT2A 4XIUA 1OQ3A 1N5YB 4OX9J 3M2UB 1WUUA 2HRTA 3Q83A 4OYOA 1Q79A 2MKKA 5L1IA 4LFCJ 3HMJG 2PO4A 2M3DA 4J91A 5BR8J 3H5UA 1WHXA 4B9MA 3H42A 2MQNA 4IH7A 4OYWA 1U47A 1K1SA 3BKTA 1HNIB 1JJCB 1WDTA 3K5MA 1HHTP 2KG1A 4DSFA 2H4YB 1EB0A 1UW9A 5DM6Q 2FLNA 2XZWA 5H9EJ 2UUAJ 4FKXA 1T3OA 3POTA 2L48A 4Y65A 2FLPA 3LTOA 1Y3KA 2NPFA 5DZ6A 2D9PA 4L72B 4O23A 2XZTB 3AQOA 3K5PA 4Y34A 2BQUA 4KC5A 4ZLPA 1WC4A 3MM8B 3LPEA 2CJ9A 2XNRA 2DH7A 5KFSA 4EYHB 3UE2A 2IJNA 1CJVA 1RACB 4QIGA 4PWUA 3TP2A 1YBUA 3HFVA 4O3RA 2N7YA 8AT1B 1RT2A 1T3NA 4WZQA 4QOTA 3MF5A 3LO3A 3R7NB 3K8VA 3KWMA 1X5SA 1HD0A 2RDDA 3CJ4A 5J2NA 1AFJA 4UY8T 4C4WA 3C15B 5LSOA 1FE0A 1RWXB 2V68A 4ECYA 2IC3A 1ZS6A 2RQMA 4ZVGA 4DV4F 2GQQA 4JV1A 2NLWA 1GMWA 3PO5A 3FSYA 2DXFA 3MM6A 4K4UA 4ZVRB 4MYUA 3DLEB 3NWGA 4ECXA 4RNNA 2CJKA 2AYMA 2XO6A 1Y00A 8ATCB 3DXBA 3NS6A 4E98A 4LF8F 1O5JA 2NREA 5A8KB 1SIWB 3QWPA 2HG4A 2FGOA 2BM1A 4AXJA 3FBBA 3DGPA 1N56A 2IHR1 4QBUA 1LWEB 5EX0A 4WU3A 1O51A 2J7WA 2U2FA 2E9RX 3VZIA 1KONA 3ZZYA 4Y2IA 5C25B 3KUEA 3MFHA 1CVJA 1N6QB 3DLBA 2V4JB 1GMUA 4F8RA 3MD3A 1M1HA 2KHDA 2P5VA 2ZBIA 4HYKA 1MWYA 1HKAA 2UXCF 1IKYA 3VAMA 3G6XA 3BZQA 3J80Y 4F3OA 2RAQA 1APSA 2HVEA 1TL5A 4LF4F 2VONA 1PYOB 4BWMA 1RKJA 2F63A 3CE8A 2VC1A 4WKYA 2HGNA 3KMQA 3EZ5A 3EM1A 2J0XA 5HMZA 1HR0J 5GAEI 1N5VA 1NK6A 3UQSA 4DG1A 3D5MA 4M5DB 1RT1A 1S1WA 2PSZA 3JAMY 3TAMA 4NLOA 3QRPA 2CQHA 4RW6B 3P5TL 1JLGA 1RT5A 5K8MA 1RBLA 4X4QA 1KQKA 1QAYA 4KFBB 5IV4A 4OYMA 3BSOA 1TKTA 2ZNZA 1ZAXA 5DGBA 4WBFA 4EO8A 2V8DA 2VPXB 2APOA 2OELA 4DV6J 2QJ3A 1JLAB 4B9LA 3VGVA 3HP6A 2J0QD 4J9QA 3H90A 4DSJA 3EGWB 5IS2A 2XLJA 1FWPA 3LA0A 3H8YA 2AJ1A 3RR8A 1HWLA 2W01A 5F0UA 3BYRA 1MSWD 4YR2A 2NUUG 4I6AA 3AOBA 2R7WA 2IVMA 2DR5A 4JV0A 4P73A 4DR5J 3EZOA 2YNFB 2BQRA 4M5HA 4DUTA 4ZLJA 3Q8UA 3CUNA 4JP8A 3HHLC 2ZM6F 2F8HA 3FRZA 2RDJA 1WI6A 4FN5A 1SCJB 3BGLA 3R97A 3NGKA 2Y1IA 2VDIA 2UUWA 4TQSA 2ATLA 1QVFR 1ITPA 2DGTA 3RYLA 2F65A 3IP0A 4EK2A 4QU6A 4OZLA 3OR2A 5E3PA 1BQNA 4LRFA 1KS2A 1KHWA 5DZ7A 1UWAA 5B0BA 5HLFB 3M2RB 3PKYA 4PEOA 2P6TA 2VPWB 3VVTA 4E2FB 2AP6A 4IH5A 2W9CB 2RVJA 1KRPA 2N3LA 2D9OA 4JOUA 4NWBA 3OW2R 2MTLA 2QGFB 1L3TA 2FVRA 3QIPB 4LVNP 2Y0BB 4B3RJ 4JYAF 2NXJA 5CYQA 1FNMA 1QAIA 3WQPA 4JI2F 2MY7A 2QX0A 3OJUA 2QSFA 4CO5A 3N6LA 2V50A 4C3MA 5F9NA 5EDWA 2WCXA 2BOPA 3LGMA 4CT9A 2GHPA 4PG5A 1Y10A 1J2VA 4XDCA 3M2VA 2PMHA 2VG6A 3PRVA 3TVKA 3H59A 2HS3A 1S6QB 2JEGA 3CCZA 4TY8B 2EW9A 4OHXA 1WF1A 1IM6A 1FKOA 2E9TA 2O5DA 2W9AA 4FXDA 1S77D 1WOPA 4CIOA 2A0FB 4OI1A 4C8MA 2DPJA 4Y00A 2HBRB 4K59A 5F8NA 2QFIA 1Q4RA 4F4KA 3MUVP 1SH3A 2OMOA 2KKHA 1BWVA 4HHHA 5GAHI 2EI5A 5GMEA 3HHNB 1N34F 5L1LA 1W2BR 4AE5A 3OXLA 4K5RA 2BJDA 4UOFA 4WE1A 3KG0A 3MXHP 2W7OA 4DX5A 1AW0A 1O6XA 1VYAA 1JLFA 2FTRA 3HZEA 5LMNJ 2B0GA 3MDFA 4RR5A 4H4KA 3TW0A 2W4CA 1YDLA 3A8JA 4PQAA 3A3OB 2JZ5A 3MPVA 4JBCA 2KVQE 2K06A 2K8GA 2BACA 5LXYA 3QT8A 2IVFB 4X4RA 4IO9Q 1SJFA 4YS2A 2VJUA 4O0IA 3ULHA 2VA3A 1IUJA 2G2YA 1WSVA 4GVBB 2HNDA 3MPDA 2V69A 5CZVA 4CNYA 1Q95G 4ES2A 1W2IA 2XMMA 4Z37A 1F3VA 1NSKL 1FJCA 4B17A 1HBOA 3ENAA 1UEKA 2AEMA 3FUYA 2J76E 3G4SS 3EICA 3CB4A 2AX1A 2GVDA 3GPAA 3M9NB 4YB7A 3FBFA 1TKXA 3TA2A 3OBIA 3R5BA 2V2QA 4ZPCA 3D2WA 1BHNA 3DNCA 3MURP 5KT7A 2NXUA 4FYYB 1RJJA 2W4DA 4RUAA 1L3UA 3TVYA 3OVSA 2VG5B 3PV8A 4DPWA 2XMJA 4WF9Q 2D1CA 3U7JA 5H9FK 2W2MP 1RK8A 2DHAA 3OJSA 3IWLA 5DQIA 4X66F 4WU2A 4QW8A 1CJUA 5GMDA 5KG4A 4B3TF 2YNIA 4UOHA 2HMIB 4YHHJ 3OTOJ 2GQ2A 2CQGA 1XBWA 4R5PA 1RT3B 1VQ9S 2UUTA 1CS4B 1P27B 3D4JA 3MMCA 1WTBA 2QLXA 3I32A 3SXLA 1WKLA 3NBPB 3HVAA 3FBEA 1YJTA 2RB7A 1C4CA 4ENOA 2XSJA 1R6YA 1FFSB 4EZ6A 2LEPA 1S0NA 1U0HA 2YKQA 2QSWA 5F8LA 4RWXA 1TL1B 1T7PA 2CYYA 5CCMA 2MQLA 1QJHA 1U1OA 1N32F 1SJ1A 2WAQD 1OY9A 4I68A 5KFKA 1U1NA 3QLHB 3KJVB 2G9OA 4RW7B 3KLHB 4X4NA 3FDSA 1JLEA 4L74A 2R42A 3KK2A 2R4FA 2XZDB 1M5VC 5A2QU 1RAOA 2WVDA 2ACMA 3WZ0A 1VQ6S 5KFYA 2QN6B 2BJ8A 3DM2B 2IAJA 1L5UA 1RGVA 2AJFE 2HK2A 1JLQA 3SQGA 3LQVA 1UJ4A 1U8SA 4LBHA 1FXRA 5KFGA 1SBRA 5HVFA 1LK7A 1T9VA 1VQSA 3TJ8A 1S6PA 1RYRA 4B3MF 1RT4B 2MGZA 1H72C 3IM9A 3WC0A 3RB0A 1WELA 5THWA 4PWDB 3G82A 4DLGA 2HGLA 1EX8A 3NLCA 1P6TA 4FS1A 3MZIA 1KD1T 4DWIA 5A8RA 3FMWA 4RUCA 4ZPVR 4ECRA 1XR6A 3T5JA 2UXBJ 1L3SA 2G1HA 2R7XA 4PUOA 4UW2A 1GMWD 1KTQA 3C3LA 3SBMA 4TU7A 3GCXP 2EFVA 1LKZA 2YWKA 4A4JA 1HYSA 2Q6CA 3OR1A 4RNMA 3OLBA 3ILJA 1JJ4A 5IZHA 3H0PA 3FQKA 2YWHA 1QLNA 2BQ3A 4TLRA 2ZH1A 4J9MA 4IRKA 1TP7A 3KG1A 4P2FA 4R8UA 4DV5J 4FYXB 2BJ7A 2XQCA 2YPYA 4QPTA 3AD7C 3DMJA 1SV5A 1WG5A 3NMRA 2BZ2A 3FCHA 3C16B 1IR1A 2YBVA 2C2KB 3VQSA 4R25A 3PRBA 2SXLA 2VV5A 1RUSA 3DLGB 1O0PA 5B08A 4Z2XA 4DZDA 4C8ZA 3BGRB 2O01C 2ALYB 2PMZD 3AJ2A 4KKOB 1X31C 4MMOA 3GQCA 3JSBA 2RMLA 4L75A 3CC2S 1FKPA 5DG7A 2L9NA 2D74B 2KFYA 1TMMA 2AGPA 2C2MB 1TK8A 1FDBA 3TRGA 3EYZA 2KXFA 5B0EA 3L3CA 3THTA 5ETOA 1YJ7A 1G4CA 1DFDA 3GP9A 2KZZA 3G87A 1GH8A 1GTEA 4YN3B 7FD1A 1KP6A 3D6TB 1Y9OA 4H4OA 3M30A 4DV3J 1MROB 1RE1B 4B3OA 5D6GA 3MFIA 3B82A 2J9EA 1FFGB 3CCLS 3HM9A 3HFZB 4OYPA 4ED4A 4NI2A 2Q79A 4J9UE 3H4DA 2VBWA 3LP2A 5CABA 3R6GB 2C1EB 3RAXA 2AJ0A 1PAUB 2GHWA 3V2UC 2KRBA 4DPOA 2JEFA 2EPIA 1WC3A 3P96A 2HIYA 4S0MA 3GJRB 2CJXB 4DEZA 4ZVOB 1YI2S 3VAIA 2HHWA 4P10A 3R7SB 1QAJA 1TL3A 3TUIC 3MMAA 3J80U 1HPZB 5C5JA 4PQUB 3U27A 2JC1A 4TYAA 4C11B 2G4BA 4X4SA 1LXNA 2AJQA 4PXEA 1BLUA 2XI2A 3A13A 4FXWA 3AA8A 3ETOA 5HL7Q 3MAAA 1EQMA 4ANCA 3BGOP 5F3TA 4JI7J 3HHLD 2ZOMA 2F7VA 3RBZA 4IR9A 2QFJA 1K8AT 5AXMA 3QO9B 4CLSA 3NCQA 2DT9A 5IOLA 2NQPA 1IBLF 3JAMU 1QSSA 2FJXA 2K7KA 3MPUB 2QMWA 3IXQA 1U0SA 1HWJA 2CG8A 3V6DB 1WHVA 4JI5F 2FZKB 1C0UA 3QGGA 2V8VA 2Z2YB 5KFOA 4IH6A 3ET6B 5A8WA 3PW5A 4KV8B 1XTZA 1XIQA 3EXCX 2DY1A 4DV0F 4WJBA 2AU0A 2F4VF 4M5NA 3CD5A 1E6YB 2V63A 1D8YA 4UY85 3FJ2A 5IC4B 3T5HA 4NZ6A 3LANA 4ICLB 3D6MB 3CDUA 2MZTA 3NCPA 1U6FA 1E6VA 1X60A 2Y8WA 1RZMA 3H2LA 2VC0A 1N52B 1RKIA 3BREA 3G8SA 4K4TA 5CZXA 2ERRA 5LSLA 1X5TA 4LRCA 3D67A 5AE3A 1DLOA 5J2PA 4DSEA 1U2RA 2HIQA 3PX0A 1KBRA 4HH0A 4DV1F 2UUCJ 3FRYA 4GKKF 3IS9B 2WK4A 4LJMA 4U8VA 3QRRA 4RUHA 3CPWR 5I42A 5K20B 5AXNA 3KHLA 1BUXA 5HMXA 3G2XA 5KG6A 3HULA 2MHNA 2WSCC 4J5OA 3PIOQ 4HR2A 4ZITA 1J5OB 1X9WA 1HBMA 3DC2A 3RAMA 3PXGa 1DQ8A 5L9NA 4DS5A 5KFLA 2QE5A 2KI2A 2NCKL 2WVCA 4YY3F 4P2MA 4KSEB 3QIDA 1UKUA 4YDXA 4ID5B 1QM9A 3KK3A 4TQRA 3OUYA 3Q89A 3LUYA 1AB8A 3UI3A 2W2OP 1S0VA 4C97A 2AIRB 4URGA 4M5GA 6FDRA 5D4PA 5JVGQ 1QE1B 2DITA 2QYGA 2AF6A 2DXDA 3ZZPA 4G3IA 1VBKA 4PG8A 2DGWA 1XR7A 2C3PA 1YZ6A 3WC2A 4I6YA 4ETXA 4RU9A 1A7GE 2DO0A 3JSYA 1ZH5A 1VQLS 3E01A 3NNAA 2VFVA 4BC7A 4CYUB 4BCAA 4KHPF 2EVZA 1FVQA 4RKUC 1X4EA 1HQ2A 3X3UA 2JHEA 5JMNA 2XMTA 2AW0A 4FBUA 5KG3A 3MEDB 1BXNA 3PO4A 1VRQC 1WJ9A 5D78A 5A0YB 1JK9B 3CMAS 2FJVA 3VQTA 2ZM6J 5LMUF 1S9GB 1YWXA 4LRAA 4FS2A 3EE3A 4TLQA 2HSEB 1TKDA 2FHJA 1S48A 2ASYA 3KNGA 3KLVA 1YK9A 3EGNA 2QYCA 1FERA 3MTJA 1RWMB 1NCLA 5K5MA 3MECA 2VFTA 1H2VZ 1N5QA 2ZDPA 4AYBD 1S7IA 3BPSP 2UVUA 3LP1A 3C6UA 2ZITA 4L6V3 1SH2A 2EK1A 3TX8A 3W8PA 5KT3A 4DX6A 4GKJF 3NWRA 1D3WA 1KVKA 4ZPAA 3H4BA 2MZRA 2J5AA 3TA1A 1N5YA 3GR1A 4F3MA 4K4YA 4Q7AA 4JYAJ 3O1LA 3CMQA 4U7UK 4HVZA 4ECSA 4JI2J 2HFSA 3GSIA 2OPSB 3D1HA 3G6VA 2OD4A 1PILA 3R2CJ 1IKWB 5T14A 1CULB 2A2CA 2DVIA 2E5JA 2IM0A 1HNIA 3DYAB 3KUGA 4ZS6A 2OFHX 4P6QA 1RWOB 1RTJB 3TUZC 2C3UA 5KOWA 4NMLA 1FRLA 3L7PA 3FGVA 3DN9A 3KLIB 1CJTA 3ILOA 4DR4F 1VQOS 4DQPA 4O3NA 2YX7A 2ZOGA 2XMUA 1KQFB 2Z58B 3QGHA 4ZLLA 1JXVA 3MM8A 3D1QA 3K5LA 1M5KC 1PBAA 2FYXA 2OKQA 2MB0B 3HSGA 3I0SB 2MQQA 1FTCA 3HLUA 2QLBB 4X64J 1N34J 2IJFA 1S1WB 3C2PA 1H7WA 1VQNS 1JLGB 3I82A 2QC3A 5GAGU 1YTYA 1UJ5A 4A8QA 2IM1A 1NK4A 5KFDA 2XBPA 2XMAA 2V2KA 4MT1A 2E1AA 4CO4A 1FO1A 4KH0B 1Y7PA 2RKIB 4OJ3A 1Q8IA 2JVOA 3C15A 1SL2A 2W8KA 3C19A 1U2CA 2EFQA 3SSSA 4NCGB 3NGRA 2QZ8A 1SC6A 1IM4A 4IQXA 3N28A 5G4DA 1PO6A 2EFPA 2YKNB 2DNKA 2KRRA 2FLLA 3IWNC 2B9XA 1HQEB 3KDOA 2DNGA 2POKA 1WI8A 2ROGA 1F0XA 2MJUA 3SZ2A 1WC6A 2VKZG 3VAGA 5HQMA 2CG4A 4NASA 4QU7A 2C2RA 1RWWB 2HZVA 2UUBF 5A8KA 1SQGA 2E7VA 1TK5A 2XMWA 5GAEU 2CQ0A 4DR1F 1GXTA 5AJ3F 4L73A 2MXYA 1Q8BA 4I67A 1XC9A 1DURA 1LV5A 4I56A 3IFEA 2AT1B 1LWEA 4ZPTR 2DK2A 5E3QA 1G6BA 3T41A 4RNOA 3FEZA 4ED3A 4EI2A 5C25A 1N6QA 4LREA 2ZHAA 4A47A 3HX9A 1S79A 1CJKB 2V4JA 3WX8A 3OR2B 1BQNB 1GXUA 4ETZA 5K9FA 4CQ1A 3ZC4A 1M1GA 1UVNA 1S0MA 3N9UC 5DG9A 4WCEQ 5U47A 4TU9A 5HAOA 2AWZA 2FJDB 3FNNA 3N6NA 3GFYA 2WHOA 3FSXA 3LAKA 4I4BA 1PCAA 3HHDA 1CG2A 4X66J 1K0VA 4OX9F 4B3TJ 2LLZA 3MD1A 4ZJQA 1Y3JA 3KK1B 4IRCA 4LFCF 2CNLB 4FYVB 2F9DA 2FQQB 3T9ZA 3D66A 4ITSA 1WKKA 2DO4A 1VQ4S 5HJXA 3CF5Q 3IA0A 4UT4A 4M5DA 2XSFA 1H6KX 5HROB 1FRJA 2KH9A 1YIJS 4RW6A 4Q43A 4MH8A 2ASJA 1KSPA 5CD4A 2D7SA 2YNHA 4DR7J 1UEUA 4NLWA 2CPDA 4KFBA 2EXUA 5ETMA 3GWCA 2DNYA 1TMJA 2E44A 2ZD1B 1VQYA 1FVSA 1XK8A 3IGVA 4DCPB 2KXNB 4LVOP 1H7XA 1C2PA 4Y0FA 3R5AA 1Q5VA 1JLAA 3DDIA 4J9PA 4XDDA 1BGXT 2MQOA 4FBTA 4OJHA 1S12A 4I69A 3D6HB 4ANEA 3T5LA 2C3MA 1L3VA 2RQ4A 1GK8A 3GFHA 3MGJA 3R9LA 3UR3C 3BN7A 2DR8A 2GNKA 4LQ9A 2F40A 4CWBA 4TN2A 2HQDA 3BGUA 2YNFA 3PYEA 2K3KA 1F3FA 4Y6IA 1R0AB 1G1XA 2CRLA 5ETRA 4OV1A 2QLFB 1VK8A 2G13A 1XWLA 2OPRB 3MR5A 1RTDA 2ZH6A 2JX2A 1KDNA 1SKWA 1RAAB 4FP9A 2F8EX 4P71A 5LM7E 3NS7B 1YJ9S 1RI7A 3I87A 1YBTA 2RILA 3MCOA 4KPCA 3TR5A 4F7VA 3D3BJ 4NA3A 1T11A 2X3DA 3IR6B 5G0RB 1WHYA 2I2YA 2UVWA 4MK8A 3SI8A 1TK0A 4IOBA 2WVFA 2XHWA 2V9KA 3PJXA 1UCNA 5HLFA 2Z2MA 2JWNA 5DLGA 2E5IA 3M2RA 1I94F 3BSCA 2G2OA 3M1VB 2H48B 2HEKA 4C8YA 2W9CA 2AYGA 4DUYF 3VTIA 3Q8VA 1MG7A 3B54A 3QIPA 1NDLA 2E5HA 1IXKA 5LJ3Y 4HTJA 2LDYA 2LQ9A 4PABA 1TKXB 3GJTB 4DL0C 3B8HA 4IRDA 1S76D 4NYOA 3ZFVA 1NJIT 4H4MB 2KJVA 3OFGA 5D4OA 3W1YC 2KM8C 2GW8A 3QSYB 4AQYF 1EZZB 2OEMA 2X1GA 2NPIA 1PJ5A 5CYMB 2V0NA 1VLYA 4B9TA 4QIEA 1S9EB 1RP5A 1S6QA 3MMJA 4TY8A 2VFRA 2CVIA 2X1FA 2C2ZB 3B4DA 3RJMB 4EBDA 2NUHA 3P49B 1CJUB 1VISA 2W2NP 2VODA 2ZWPA 2DHGA 3NMAA 2V6AA 1NHUA 4KY3A 3W66A 3KYLA 3DKDA 1Q53A 1S1TB 4U9RA 5HMYA 2N4CA 4WIIA 2M2BA 4R0EA 2WSEC 2M70A 2V34A 5CCLA 4MIAA 3A4TA 4Q0BB 3A12A 4OHVA 1TAQA 2RRNA 4B9NA 3ZXWA 2OP5A 4HDHA 1RXOB 3GB0A 2ZZTA 4ZCLA 2HLTA 1U0HB 2VKRA 5EN1A 2R8HA 5F8MA 1U25A 4DV6F 3HJFA 1H2UX 3QPIA 3CDBA 3MCSA 4A8WA 1R27B 1T94A 2GMLA 3Q8PB 4QCLA 1SQEA 1JXEA 4N47A 1F2HA 3T19A 2V9WA 1VLOA 2OIHA 3DU6A 5CH7B 3NXZA 3W65A 3KK2B 2XYPB 4U96A 1ZAWA 3ILIA 4P2XA 5IT9U 3C66A 2DNZA 4G65A 4DR5F 4GVBA 3D0HE 4IYQA 5KFVA 1P9QC 3FSIA 5IQ6A 5E0OA 2CKWA 2MQPA 2GQCA 3IAS9 1DHMA 1FWKA 1RAFB 2N4DA 1S7HA 1PSDA 1EQ0A 2K7JA 2B3TB 1D8ZA 2XTJP 4ZN1A 5DGAA 5HP1B 1X9MA 1R6VA 2R7UA 3W2WB 1NPPA 2L3MA 1RT6B 1XMOJ 4C98A 2C2NA 3NKYA 1URNA 1UFLA 5ETSA 1IBLJ 2B8QA 2VG5A 3I4PA 4JV5F 1FK9B 4LIWA 3VGTA 4NLTA
chains in the Genus database with same CATH topology
2J0WA 3AY0A 4C8MA 2DPJA 4Y00A 4K59A 4ZP9A 3DDNA 5F8NA 1GT8A 1T02A 2DGOA 1Q4RA 1J5EF 3DLEA 4EO6A 4F4KA 3MUVP 1SH3A 2OMOA 3ITHB 2KKHA 1DARA 3GE9A 5DRKA 5GAHI 4B02A 3MR3A 1QY7A 4CTAA 2DR7A 5KG5A 4A8MP 2HMIA 2K3IA 2ZC4A 2C3YA 1CC7A 2EI5A 2LXFA 3HHNB 1N34F 2A1BA 4B3RF 2CPIA 3P3DA 5L1LA 1W2BR 2F3JA 4AE5A 3MOZA 1RT3A 3OXLA 3THVA 3OHBA 4K5RA 5DO2A 1ZM3A 2BJDA 2CQ3A 5L38A 4ILLA 4WE1A 5GMKa 3KG0A 2E66A 2VG7B 2YWFA 2V8GA 3MXHP 2W7OA 3CC4S 4IG0B 3EPIA 3K57A 1AW0A 4QR0A 4LUBA 3M32A 1GX5A 5C42A 2IM3A 1JLFA 2FTRA 3NBPA 3VZHA 4DV7F 4EUVA 3GFXA 4HLBA 3HZEA 2E29A 1Y5NB 2B0GA 4RX6A 3MDFA 1C0TB 3LH2S 4LSNB 2VFUA 1XEZA 2B51A 4EBEA 4H4KA 3TW0A 4LSLA 2E5GA 1HHSA 2W4CA 1XMOF 2HVHA 4PQAA 2Q6BA 2RF2B 2IVYA 2JZ5A 3MPVA 4JBCA 2IM2A 3U02A 3LPYA 5L1KA 1DQ9A 2K8GA 4WFXA 5B0FA 1MWZA 2JOQA 1SJQA 1WTFA 1UFWA 1RDRA 2BACA 3PJWA 5LXYA 2X1AA 3OSNA 3DLLQ 4ZK7M 1N0UA 2EC0A 4MIBA 2IVFB 1D9FA 1TL1A 2LA6A 4ZA1A 4DF8A 3GIJA 2KT2A 2XC9A 2ZJQQ 2BR0A 4X4RA 3F73A 4DL3A 2BANB 4U7CA 4DFJA 4IO9Q 3I96A 1SJFA 2PIIA 5F8HA 1IKVA 1S97A 2IA0A 4Y3CA 2KDOA 4OHZA 2RT3A 5ITHA 3KLGB 1R31A 2LVWA 3OFHA 4O0IA 3ULHA 4GC6A 1IUJA 3ENVA 3QLHA 3KJVA 1WEXA 2VA3A 4RW7A 5GADI 3KLHA 2KZMA 2W8LA 4DN0A 1Y4ZB 2DNPA 2HNDA 4OMFG 1H2TZ 1N4LA 2J8AA 3UPFA 3SSRA 5CZVA 4NLXA 3D28A 4CNYA 1HBNA 2PE8A 4ES2A 2XY6A 1W2IA 4NOHA 2XMMA 2RNEA 4XO0A 1S9FA 4Z37A 2J6UA 4F2RA 2IBKA 1F9FA 3HFKA 3CT9A 2CPXA 3HDSA 5D3GB 1FJCA 3ZZOA 4B17A 2GC8A 2QA4G 4OI6A 2PI5A 3GV5B 1HBOA 5CYQB 5KFIA 1X0FA 4MKYA 1GTHA 2Y0SD 3WBZA 4ELTA 1HI8A 2J76E 5BR8F 2NSBA 3G4SS 2DGXA 2AGQA 1NKEA 4C7QA 5KFNA 1S4FA 3TNVA 2FIUA 4WXWA 5CD4H 3CB4A 3RR7A 3R1HA 1OQ6A 2AX1A 1BWEA 5B0AA 5LMNF 3V6JA 1Q1KA 2B56A 3E8OA 3M9NB 4YB7A 4ZCMA 4LF9F 2VASA 3JSRA 4F4XA 3BDEA 2CQ4A 1TQLA 2DGSA 2FVCA 3M6WA 3N6MA 1TKXA 3NS5A 5I4MA 5J1EB 5BYQA 4DL4A 2V5HG 4EEYA 3V81A 3OXFA 2R7TA 3VAJA 4PR6A 3TANA 3FVYA 3TA2A 3OBIA 3R5BA 3M2VB 2VG6B 3BM7A 1QAXA 5L9XA 4EGLA 5DDOC 3OL9A 4WFNQ 4ZPCA 3OTDA 3OQ2A 4YUDA 1P1TA 3D2WA 4I64A 4NYPA 3DNCA 2UUAF 1S1XA 3MURP 1YRXA 5KT7A 2NXUA 3MUMP 3DLJA 2FJWA 3GFZA 4WYLA 1RJJA 2W4DA 2HNYA 4RUAA 1OPZA 3E3XA 1L3UA 3TVYA 1RT4A 4ECQA 3OVSA 4I0WA 2GFFA 2VG5B 3OTEA 1FKOB 2RUGA 4YR0A 3PV8A 5DQHA 1VGYA 2FUG9 3CCTA 1ZYQA 2ZE2B 1SB6A 2XMJA 4WF9Q 3BQ1A 1NJWA 2W9BA 2D1CA 3I0RB 3Q23A 5T7LB 3U7JA 1NJYA 2IBOA 3KG4A 2L9WA 3L95X 1V3ZA 1RK8A 4PWDA 2DHAA 3OJSA 3QYYA 2CJAA 3IWLA 5DQIA 4F4WA 1OIAA 1K0TA 2W7PA 3M8QA 2R8KA 5FLXY 4RW8A 3BN4A 2CPYA 3UDLA 3UR0A 4QW9A 4X66F 4QIFA 4WU2A 4QW8A 4N5SA 1YQHA 4CTAB 5KG4A 2VOOA 4B3TF 2YNIA 4K5SA 4KIAA 2HMIB 4XK8C 4I7FA 1KFDA 2GO9A 1MU2A 2KO1A 1VI7A 1RT7B 3Q2SC 4OFZA 3EX7B 2GQ2A 2CQGA 1XBWA 3OPKA 4OI2A 4OZ5A 5F8GA 5DDPC 4R5PA 4CZCA 2AYBA 2PT0A 1QVGR 2XGPA 3JSMA 3I5BA 1RT3B 3LGNA 1VQ9S 2UUTA 1V9OA 1TUVA 2HNZA 4WE1B 2KYZA 3UWTA 4AXIA 1P27B 2XY5A 3QWUA 1M90T 2JFKA 2NZ4A 5DJBA 3A8EA 2DIUA 2ZKUA 3HK2A 3MMCA 3SEOA 1KFSA 3Q2TC 3CJ5A 1WTBA 2P6SA 3M32B 2QA1A 1X8DA 3HPOA 2QLXA 1NKBA 4KAIA 2AGOA 3I32A 4N8OA 4O3SA 3SXLA 2IRYA 5BYSA 5BJRA 4K4XA 5C42B 3PW2A 1MMDA 1JLFB 3NBPB 3HVAA 1NJZA 2K1RA 3GILA 3M6VA 2CQBA 2HWTA 3PW0A 1XNRF 6FD1A 1F5AA 1EETA 1YJTA 2RB7A 4QWAA 1C4CA 2B6AA 4MJKA 3UCGA 4LSLB 5L1JA 4K4ZA 1WG4A 5EGYA 4RW4A 3VCDA 3HI9A 3V6KA 2RJZA 1TV6A 2L41A 1S6OA 5J1PA 1IJEB 4O44A 2XSJA 4CH7A 1U1MA 1FE4A 1R6YA 2YQ3A 2KU7A 4EZ6A 1X4FA 1SJRA 4MK9A 3KLEA 3V4MA 2ZH7A 2LEPA 1S0NA 4NYZA 5SUHA 3K7RA 2YTCA 3OSPA 2YX4A 4TXSA 1Z2LA 4DFPA 3ZZTA 2YKQA 1H38A 2QSWA 3MEKA 4ED2A 3C6TA 5F8LA 2DBBA 3KFWX 4RWXA 3A1YG 4WTYA 3V5RA 1TL1B 1XR5A 4EBCA 1JJHA 1XMQF 2G0CA 1T7PA 4QIVA 2XLKA 2CYYA 4DS4A 5DDRC 3CCES 5D4LA 1N8RT 5CCMA 4HT7A 2MQLA 4QJVA 2ACYA 1QJHA 1U1OA 1NZAA 4I1TA 1R89A 3RB3A 1SJ1A 1N32F 1VK3A 4OX6A 1IKVB 2A3JA 2WAQD 3T1AA 2ZHOA 2ZH2A 1WG1A 2I1RA 4I68A 3UCUP 5KFKA 1U1NA 1C0UB 2OD6A 3QLHB 1LWFA 3N79A 2G9OA 3KJVB 4PRFA 3LW5C 4IG3A 4LIRA 4RW7B 2X3GA 4YHHF 3PEJA 3KLHB 3DLGA 4KGMA 2J6SA 3CD6S 1SI9A 2ZUGA 3UNGC 4X4NA 1M0SA 2HNDB 5KFJA 3GV7B 3G9CA 1KQGB 3FDSA 2C2DA 1JLEA 2FB0A 3GYXB 1HBNB 3PZPA 2DHXA 3IN5A 4FVCA 3E2EA 3BGRA 3KK2A 2A10A 2YKOA 2RDIA 4C0BA 2R4FA 4DSIA 3WDOA 4KKOA 1NK5A 5GAHU 1DTTA 1JIHA 4M95A 1U49A 1HBOB 3JTNA 1SH0A 4A8XA 1XN9A 2ZFHA 3NP5A 1M5VC 2D3UA 3WX4A 1JKHA 4JI8F 2YNGB 5KAKA 2Q66A 1MNEA 1U1RA 2CJQA 4LT6A 1FRMA 3AJ1A 2HS4A 3NNCA 2NYIA 5K14A 4B9SA 3WZ0A 2GA7A 1VQ6S 3NGDA 2E1MC 3TI0A 1LFWA 1UAWA 3FEXB 4R0JA 5KFYA 2OPQA 2N7CA 2XS7A 3D54A 4ZP6A 2CIMA 3DM2B 4ALZA 2LKZA 3I56S 2IAJA 2C2EA 2GJIA 3H2VE 1L5UA 1UVJA 3UCZP 4EU0A 4ERDA 1RGVA 1JX4A 2AJFE 1R8PA 3MI7X 3RTVA 1JLQA 1TVRA 2JRSA 3SQGA 1Q78A 3LQVA 1UJ4A 1U8SA 5IWAF 1S1XB 4HTIA 5FD1A 4D3GA 3H25A 1FXRA 5KFGA 3J7ZT 3LWLA 3M8PA 1SBRA 4QWCA 3OV7A 1S99A 1LK7A 1VQSA 3M9MB 2HNYB 1NK7A 3CGIA 1B64A 1S6PA 2BW2A 1RYRA 1HA1A 4B3MF 1MROA 1RT4B 2R8IA 3F56A 3TQ1A 1OPIA 4UQTA 2MGZA 1VQMS 1Q7YT 2KTQA 1RA6A 2R2TA 3K2YA 5J2QA 3WC0A 5KFHA 2W9BB 3M6XA 3RB0A 1WELA 5THWA 3CULA 4PWDB 4DR6F 2W7AA 3QGPA 4RZRA 3RRKA 1FD2A 5CA5A 4ATNA 1FT8A 4KGKA 4DLGA 3M8QB 4G6VB 2JLGA 2HGLA 4LQ3A 1YJUA 3RU0A 4RW8B 5IM0A 1NJXA 3NLCA 1P6TA 4UOCA 4FS1A 5FDLA 2YNIB 2MQMA 3BEGB 4I7FB 5DG8A 1LFPA 3MZIA 1KD1T 1MU2B 2B7BB 1LQ9A 5A8RA 2KJWA 3FMWA 4N8NA 4DWIA 4WFZA 1HNWF 4RUCA 4DQIA 4GO5X 2ZH8A 4ZPVR 4DQSA 4R5PB 5KTQA 3UD4P 2FHOB 2KN4A 2HQIA 3JSMB 5GADU 1D1UA 4ECRA 3DRSA 1HR0F 2HNZB 2FGCA 1XR6A 3D1OA 3HHLA 4OX7A 3T5JA 2J9DA 4Y28C 1N36F 2FPHX 2HRUA 2HS0A 5EUHA 2M5YA 1L3SA 4KTQA 1NH8A 1KEKA 3HHEA 1NNDA 4CNZA 4UW2A 2JLFA 5DM7Q 1KTQA 3MMCB 4PUOA 2R7XA 1ZM9A 3C3LA 4QYZJ 3CO9A 1U24A 2G1DA 4CO3A 4ID8A 4TU7A 2DH8A 2EFVA 1LKZA 1ZPWX 2YWKA 1FRHA 4A4JA 1HYSA 4DV2F 1X4DA 3HKZD 2Q6CA 3OR1A 1HPZA 2NSCA 2OAUA 3S7RA 4RNMA 2IFXA 5K8OA 1GAOA 3GSDA 5KFFA 3OLBA 1EETB 4PQUA 1JJ4A 2B6AB 5IZHA 4DDFA 3FQKA 3CIMA 2YWHA 4C11A 2HWIA 1QLNA 4IG0A 1C1BA 1IKXB 2BQ3A 4TLRA 2MKJA 2ZH1A 4RW4B 1MMNA 1ZBTA 2MZJA 4PCQA 3HXMA 4J9MA 4IRKA 1LW2A 1TV6B 5KG0A 1TP7A 3GIMA 4O3OA 4G1PA 3CC7S 2P9CA 4I2PB 3KG1A 2XSJB 4O44B 4NCBA 4R8UA 3K59A 3OVBA 4DBQA 2EG1A 5LXRA 3BQ2A 5CHCB 2QMXA 2O1PA 3KLEB 2GCFA 4L3NA 2RU3A 1ZPVA 4QPTA 1JJ2R 2WW8A 3CJKA 2HHVA 4OHWA 1ZTWA 3HKWA 4ZHRA 3C6TB 4KJIA 3DMJA 1SV5A 1WG5A 3NMRA 1G3OA 2BZ2A 3FCHA 1RISA 2BUNA 1VBYA 3LALA 3QO9A 4NRUA 1XERA 2VH7A 3VQSA 3JYTA 2DNMA 3L7OA 4F50A 4OIXA 4R25A 1FEEA 2B4OA 4E8UA 2X51A 1LW0A 2Y1RI 3PRBA 1ZETA 2SXLA 1LWFB 1UA1A 2KFNA 4IG3B 3S6EA 4X62F 3T5KA 2VV5A 3KHHA 3DLGB 1UJ6A 2UP1A 1VBZA 1FD8A 3G8TA 1O0PA 2DH9A 5B08A 3D0GE 4ZPDA 4NL5A 1JLEB 4Z2XA 1ROFA 1KNZA 3ZZZA 4C8ZA 3BGRB 3KKFA 2O01C 1BD6A 5GVQA 2PMZD 3AJ2A 2UXBF 5KFRA 4KKOB 1DTTB 5EWFA 4HEA9 3BQ0A 4ED6A 3F44A 3SSQA 4USHA 3TYTA 3TAPA 2HGMA 3UFCX 4ZPWR 4MMOA 3GQCA 2ADBA 2UVRA 1JKHB 1X5OA 2WOMA 3JSBA 2KG0A 1U2FA 4F67A 2ADCA 2RMLA 2KYXA 2VUGA 1UVMA 4KV8A 3CC2S 3IRWP 1FKPA 1YJRA 5DG7A 2L9NA 4TYBA 2D74B 5K14B 2KFYA 2AGPA 1GXLA 3IRXA 4IQMA 1TK8A 4OI4A 1FDBA 5KFQA 1KVIA 1RTHA 3TRGA 2B4UA 2BXJA 2OPQB 3EYZA 4GO7X 1DRZA 2KM8B 2KXFA 2LA4A 5B0EA 4DQQA 2OTLS 2IAJB 3S1TA 3L3CA 3THTA 4PG4A 1R3NA 1E6YA 2WB4A 2BRKA 1JLQB 1TVRB 2V8HA 3SQGB 4DV5F 2V4RA 1DFDA 2BV3A 1F5BA 3QZ8A 3EUNA 4ICLA 2KZZA 3FEYB 4PXBA 1GH8A 1RTIA 5CXTA 2EFOA 1GTEA 3M8PB 7FD1A 1CLFA 1PGZA 2A2DA 2LYVA 1Y9OA 1U7LA 5EHHA 4H4OA 2V4QA 3M30A 1MMLA 1S6PB 2VBXA 5JJBA 1MROB 5T41A 3V4IA 3DLHA 4FF2A 3ZZ0A 2RQCA 2MSTA 4B3OA 2F8MA 4URQU 2MGZB 5D6GA 3MFIA 3B82A 5J2QB 3PKMA 2J9EA 3NRBA 2JC0A 4WFYA 4DJBA 4X4TA 3CCLS 3RB6A 3HO1A 1FNOA 4WK1A 1A9NB 3HM9A 3CD0A 4KHRA 2DD8S 2C3OA 1JXLA 2Q79A 1Y5IB 3QJJA 2XLIA 3H4DA 5F41A 3DHXA 2RS8A 4NLVA 2VBWA 4DSKA 1ZM4A 1WF0A 5F0WA 4C8NA 5IM0B 4ECTA 4A8SA 4DFMA 3LP2A 3R27A 1O8BA 5FDLB 2ROPA 4IO1A 4OX8A 4LFAF 3IAM9 2KHCA 3IBWA 2B4PA 3NAHA 4YMEA 3KHRA 3RAXA 5A8RB 2LEBA 4WZMA 4KHMA 2AJ0A 5LT5A 2CQDA 2QO3A 1UMJA 3R3TA 2L08A 4ILRA 4X65F 1YBAA 2GHWA 4CO1A 3V2UC 2KRBA 1AROP 4CT8A 4NRTA 4Y2KA 1FTRA 4DPOA 4EZ9A 2JEFA 2EPIA 3DRSB 4KO0A 3HHLB 2VQFF 3P96A 2ZJPQ 2OTJS 2MYFA 1FXDA 1GX6A 4DMZA 3BO2A 1UEVA 3IS9A 4DEZA 4PUOB 4QQBA 2DNNA 3OFEA 1YI2S 1RT7A 1NK9A 3DOLA 4MFBB 2DGVA 4OI1A 3ICLA 4QR1A 3TA0A 3VAIA 2HHWA 2YWGA 5KG7A 3L09A 3I4HX 3LAMA 3M05A 4GC7A 1Q86T 4JI6F 1HYSB 1QAJA 4OZJA 1NU4A 1TL3A 3TUIC 5KFWA 2C42A 3MMAA 3OR1B 1HPZB 5C5JA 5IT4A 4PQUB 2EBGA 1VOMA 3U27A 2JC1A 2ZVSA 4TYAA 2QIFA 4C11B 5M2UA 2G4BA 1C1BB 2BBEA 3U1LA 4X4SA 1LXNA 2F9JA 3FFIA 4WYWA 4H54A 2AJQA 1LW2B 4PXEA 4QWBA 3K58A 4RLEA 1BLUA 4NLDA 4BS2A 2XI2A 1IJFB 1J5OA 4PPDA 4R8UB 3BGFA 1AFIA 4FXWA 2HWHA 3H40A 4DV3F 3TAQA 2J7UA 2AQ4A 3J7A1 2HPUA 2JJ4D 3AA8A 3ETOA 1ZAVA 1SKSA 3CJKB 3G6ES 5E33A 2GO8A 5HL7Q 2JVRA 4FNIA 4ZHRB 1KOOA 2MJNA 3DMJB 5F3TA 5B0GA 4IUFA 1SV5B 3HHLD 2E1CA