5LSRA

Carboxysome shell protein ccmp from synechococcus elongatus pcc 7942
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
205
structure length
205
Chain Sequence
VELRSYVYLDNLQRQHASYIGTVATGFLTLPGDASVWIEISPGIEINRMMDIALKAAVVRPGVQFIERLYGLMEVHASNQGEVREAGRAVLSALGLTERDRLKPKIVSSQIIRNIDAHQAQLINRQRRGQMLLAGETLYVLEVQPAAYAALAANEAEKAALINILQVSAIGSFGRLFLGGEERDIIAGSRAAVAALENLSGREHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CcmP
publication title Crystal structures of beta-carboxysome shell protein CcmP: ligand binding correlates with the closed or open central pore.
pubmed doi rcsb
source organism Synechococcus elongatus pcc 7942
molecule tags Transport protein
total genus 68
structure length 205
sequence length 205
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-09-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1810 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5lsrA01
3.30.70.1810 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5lsrA02
5LT5A 3F56A 5L39A 3U27A 3I82A 4HT5A 3GFHA 4HT7A 3I87A 3MPVA 5LSRA 5SUHA 3FCHA
chains in the Genus database with same CATH superfamily
4LF7F 3HM9A 2O67A 1KLMB 4DN0A 2GMLA 1ZTTA 4CLYA 3MUVP 1YTYA 2EK6A 4DPTA 3PO4A 1UVLA 5KFYA 2ZH5A 1RAOA 1FVQA 2FVQA 3FNNA 5CZVA 1NLKL 1RTJB 5LXYA 4OV1A 3M8ZA 5L1LA 3QWUA 1U1KA 2XQCA 3HZGA 2R7OA 2QLBB 1UFWA 4HKQA 2DR9A 2M52A 4O3PA 3HP6A 4TKTA 2E1CA 4AT1B 4K5SA 4UZCA 2NYIA 2HNYB 4ELVA 1SL2A 1I3OB 4DL5A 3CCZA 4KV8B 1Q78A 4LT6A 2JLGA 1SC3B 1OO0B 3NBPB 2GGPB 1XMOF 4FYVB 3GG1A 1DTQA 5J2NA 4RW6A 1EQ0A 3NWGA 5A8RB 3K2YA 4JI0F 2QFJA 1PJ5A 1XMOJ 3JTPA 2VKRA 1AROP 1FTRA 1J5EF 4H4MB 4ECZA 2H9ZA 2HYIB 4JI0J 1Q7LB 2RAQA 4KGKA 2OEMA 4G65A 1J5EJ 1XTZA 1VHIA 4U67Q 2BE2B 1F3FA 2ILYA 1M5VC 2MDAA 2VG7B 3T5HA 2OUGA 4OX9F 1CS4A 1H73A 3K5PA 3A8EA 3I4HX 1DFDA 3FRYA 2WVDA 4A8KA 5KT4A 1VQ6S 4OX9J 4FDFA 5J2QA 2JEFA 3CJQA 2LXIA 3WHIA 2BR0A 4J5OA 2BV3A 2W4DA 1SKRA 3PTWA 4QWEA 1ZH5A 1NU4A 2L08A 1LW2A 1H74A 4OFZA 1ZAWA 3AJDA 5T41A 4ZVSB 1D8YA 5GMKa 3O1LA 3SFUA 1LQ9A 2XY5A 1S6QB 3QPIA 4F2RA 2HVDA 1FJCA 4C97A 2FVSA 3MOZA 3MMBA 3NP5A 2YWHA 1RWKB 2Y0SD 1WEYA 2G2OA 1NBEB 3T5LA 2A18A 1A6LA 1YI2S 1UJ4A 2XS2A 4Q0BA 2EC2A 1VISA 2NREA 1P8GA 1AZSA 3PW4A 3JSMA 4I2PA 4HH1A 2VBZA 5CD4H 3VV2B 4K4ZA 3ETMA 1MROB 2GAGC 2ZWPA 4RBVA 5E7OB 4KO0B 2QFIA 2HFVA 2HGMA 1JXLA 2VFTA 3QIPA 2QYGA 4DLEA 4YOEA 3ICLA 1M5KC 3HULA 2ZD1A 3FC9A 4M1KA 2AU0A 1VFJA 1B70B 1Y4ZB 2WZ1A 2ASDA 4NLRA 5ETVA 1J5OA 1IXKA 3BR8A 2LEBA 2K1RA 1SC6A 3M05A 2CQ4A 4KAIA 4UY85 3L95X 1VGYA 5KOWA 3THPA 3GG0A 4DV4F 4LBPA 4DSLA 1YQHA 1LWCA 3MWBA 1T9UA 1NK7A 2N4CA 1S4FA 3GR0A 2HK2A 4I68A 3JYTB 3B6BA 5ITHA 1NRKA 1GK8A 3PV8A 1VQ9S 2RF2B 1UEVA 2B4PA 4MKAA 2EFPA 2MZRA 1DQ9A 1HNIA 2NCKL 1UWBA 2AYMA 5T7LA 3VAGA 3C16B 3ETOA 3HVTA 3HHDA 1OS5A 4X62F 2DEJA 2IVMA 1RT1A 3H5YA 3UPFA 2W2OP 2Z4PA 1U47A 1KVKA 1EQMA 4JI6F 5A2QU 2FGCA 4NOHA 1B0TA 5M2RA 4X62J 3NLCA 2MQPA 3KLHA 3PYGA 3KDNA 3HO1A 4JI6J 1RTHA 3SCIE 3WDOA 2ILZA 4O4GB 5KT6A 2OPQB 4Q2LA 4QWDA 3KLGA 4JI3F 1VQ5S 1ROFA 3W65A 2HK3A 4NA1A 3SDEA 2VJUA 3VAKA 1J27A 1JLFB 4JI3J 4QPTA 3D6MB 3AOCA 3TANA 4CO4A 1RWOB 2AX1A 2E1AA 1H2TZ 2HIYA 1ZM4A 5K14B 4F8RA 3UNGC 4DR7F 2YXLA 4L3NA 4X65F 1Y11A 3R7BB 2E9TA 1Y5IB 9ATCB 4B3OB 4GKKF 2CPDA 4TYAA 2WBMA 1WTBA 4RW4A 4K4YA 1R8PA 2CPYA 4DR7J 3NCRA 5KFQA 4X65J 2LXUA 3M30B 3R2CJ 3UE2A 4GKKJ 1QTNB 3HI9A 4K2JA 4LF5F 4GO7X 4RNOA 3UR3C 3GE9A 4WTYA 3C19A 1WHXA 5KG5A 3TZXA 2W9CA 2CQ1A 2P9EA 1CJKA 3MMAB 4LF5J 2OPSB 4DN9A 3GJSB 1TL3B 4FKYA 1SXLA 3DLBA 1IR1A 2FJXA 1VLOA 4AD6A 2E7VA 3MEEA 4RW8B 1TL7B 4P2MA 4DPOA 2LEAA 4JYAF 4U8YA 3W2WA 3I5BA 3LPYA 2EW9A 2GIFA 2XMUA 1UL3A 2CKWA 3GIMA 4QIVA 2XC9A 5M2PA 4M5IA 3CCSS 2DH9A 2MQ8A 2Y1IA 3ZTPA 2BKNA 4JYAJ 3MPUB 2Z30B 2Z58B 1ITPA 3PKMA 3ZZZA 2IJFA 1X31C 1LWEA 4DEZA 3W8GA 4DLGA 1OPIA 1RB0A 3C6TA 3VQSA 4MH8A 4UUXA 3MCMA 3MF5A 3PX6A 5IT9Y 2WSEC 1IJEB 2XB2D 1SIZA 3LTOA 1MMDA 4N41A 1FWKA 2Q66A 3ELHA 4LBHA 1V3RA 3G9CA 3PIOQ 1F6TA 4WIQA 2ZH3A 1RU1A 4MK9A 3HF5A 3SCJE 5LMUF 4CO0A 4BWJA 4J9LA 4YB5A 3TAPA 2DGQA 2APOA 4OI3A 5LMUJ 5F8MA 1IM6A 3AXKA 2I38A 1JLQB 2J9CA 4TY9A 2X51A 2P6TA 1M1KT 4TNOA 3Q8YA 1N8RT 5D0HA 1U6BA 2ZHOA 4DXLA 4ZLJA 4NLGA 4OYXA 4F4YA 4FXVA 2V2KA 3VTIA 4CLLA 3F73A 1KRPA 4PXBA 1FX4A 3ET6B 3N5FA 3W63A 2VA3A 3KFWX 2YH1A 4IYQA 2ALYB 1Y7PA 3UCUP 5E3CA 3P6YC 4MFBB 1S9EA 1SB6A 2CPZA 2HFOA 4E98A 3VVUA 3IGNA 4OX7A 4WFYA 3GIJA 5HP1A 3UN5A 4UT4A 4G1QA 1V5IB 3SI8A 2DD8S 4LUBA 2HRYA 4USUA 1EETA 2AJ2A 5KTQA 2G2YA 3AAWB 3LWMA 1TK8A 3PEJA 3V6DB 1T7PA 3PW0A 1YG0A 1SPBP 5IOLA 2PDAA 4M5GA 2DGXA 1TAQA 3GLJA 5D4OA 1N5YA 2IFXA 5KT7A 5D78A 1YBUA 4DR3F 4ZCKA 2LA6A 2SXLA 2J6TA 4RLEA 5FIIA 4OHYA 2AYGA 4FBTA 2AWZA 3HK2A 3MCSA 2AW0A 2BACA 1N34F 4DR3J 3CJSA 2X1AA 4NX9A 1AFJA 4PG8A 4ANDA 3DRSA 1N34J 3EZOA 3NMAA 4DMZA 5A8KB 2FLOA 1S1XB 1CULB 1TZ0A 5HSPA 4AL5A 4W90B 1KR4A 4CO5A 1UW4A 3FCWA 2V8DA 1VC5A 3SSRA 1I6JA 2YKNB 1NPRA 1T9WA 3D9BA 1PJ7A 4EI2A 2VF3A 3QFWA 4ZPCA 3PO5A 2CJ9A 1OWXA 1B7FA 1FX2A 1R7IA 2FQQB 3RTVA 4P73A 3KNGA 3I0SA 5K8NA 2NYHA 2Q43A 2OMOA 2CQ0A 2IBKA 1WKLA 4DL0C 4KHRA 2BOPA 2YNFA 2XSJA 5GAEI 4F26A 4OZ1A 5KAKA 3IM9A 1RBAA 2ZH6A 4CM2A 3KG0A 1VRQC 3LOUA 1KP6A 4OYBA 2QEXS 1QE1A 4KB7A 3KK3A 2ZFHA 3QLHA 3IWNC 3QJJA 2OSQA 1KBRA 2J0XA 3LPEA 3JSBA 4ZVEA 3RB4A 2QV6A 1NJZA 1FDNA 2E7WA 5B0DA 2RILA 1HQ2A 3VGTA 1C0TB 4YR0A 4QU6A 1NNDA 5I3UA 1OSDA 4X4TA 1JIHA 4K5RA 2FJVA 1VQYA 2RS2A 4K4UA 2KYXA 1U49A 3HFVA 3M2RB 1WD6A 1YZ7A 3DC2A 3RGIA 3CWJA 3B8HA 5CHCB 1SJFA 3G4SS 4B9VA 2HS4A 5JMNA 4QYZK 1X4FA 1T05A 3AB2B 4CLPA 3J81j 3I5AA 3L7UA 4E8UA 3PACA 2QGFB 5IZHA 1HWLA 1FRIA 5LSOA 4CP5A 1C4CA 1RT6A 3G82A 3NS7B 1YHQS 3KUEA 1JLGA 4ES1A 4WP9A 3MTKA 1AT1B 2YKMB 3ZFVA 2V4RA 1GX5A 3V6HA 1XWLA 3JS9A 3G8TA 4YEAA 2WVBA 4NLXA 4BHQA 4LFCF 3DN9A 2OTJS 4N7TA 5IT0A 5THWA 5IFMA 2CG8A 3CIZA 4LJMA 2V8VA 1KN6A 3OL8A 2PC6A 3CJKA 4LFCJ 1O8BA 3W9IA 1M5HA 2RJZA 3DRRB 2ROGA 1LKZA 1UEKA 2V67A 3VAJA 1KKHA 1N5SA 1RI7A 3MPYA 4AXJA 2WK4A 2RDJA 4CNYA 2N82B 3S6EA 3DLKA 3E01B 1V6HA 2D7SA 1VI7A 1ZBTA 3W3SA 1RWWB 1MW7A 1S7HA 1S1WA 3GSIA 4ID5A 4WCEQ 1S1VA 4M5DB 4NMXA 4DUZF 2BDPA 1CC8A 2N4DA 5FDLA 3OFFA 4DJBA 2K7KA 2HMIB 4LSLA 4DUZJ 4Q44A 3IFEA 3V5RA 3SXLA 4R8UB 2YTCA 1FNXH 3W66A 2VB6A 3LAKA 3G6ES 4RNFA 1TU0B 4FNHA 2HGNA 2DNPA 2BKOA 2VBYA 5A0YB 3CCUS 3OXGA 5E3AA 3D2WA 3AXMA 5KOXA 3DU6A 3M2VA 1Z2LA 2FLPA 4EMDA 2PMZD 3KJVB 3ITHB 1WDDA 2HS3A 1QSLA 4W92B 2MHEA 1AUDA 5D6GA 1SQFA 5D3GA 2BJ1A 4A8OA 4WKYA 2EPIA 1SH2A 4C9DA 1S99A 4ED7A 3TI0A 1R0AA 3BQ1A 3C6UA 3FK4A 1FK9B 4IH5A 3MM7A 1X9WA 4Z37A 2VBWA 3BR9A 4ZP7A 4OL8A 4QYRA 3P49B 4H54A 2VG6A 4WFNQ 2AGOA 4C48A 2O5DA 1JLAB 1U48A 2P8IA 4KTQA 4JI7F 3AA9A 3EJMA 3ZZTA 1PC4A 1HBNA 3TUZC 1MLAA 5G0RB 1EAYC 3NGUA 1FKPA 4DQPA 2DGWA 5KFIA 4DBQA 2ZH9A 3B54A 3JAMY 5LSRA 2DNRA 1R43A 2HW3A 3U27A 4NCBA 2GCFA 4YB6A 5HJXA 3KUGA 1WKKA 3BGRA 2NXUA 2LDIA 4RW7A 1S48A 1BQXA 4A8FA 1CLFA 2QL5B 3K5NA 5JXSA 3HVWA 5GAGI 1HNZJ 1OPZA 1T9TA 4OYMA 5SZTA 3GFHA 2M9KA 4WXOA 3LALA 1W25A 4F4WA 3MHYA 1WC4A 2EG1A 1R27B 2CQ3A 1HNXF 4IG0A 1FJ7A 5G4DA 1S76D 2MKCA 4OYPA 2DXFA 1EX8A 1VS3A 4PUOA 4C0BA 3AOBA 1HNXJ 1DTQB 5J2NB 4RW6B 3P96A 2EKYA 5H9EJ 4Y34A 4FF4A 4WZMA 1URNA 2R4FA 3H40A 1YGYA 2ZHAA 4KSEB 4YN3B 2AF6A 2PI5A 2R9LA 1K1SA 2CFXA 2JLFA 3TAMA 1WC0A 4ENOA 1CS4B 2Z8QA 2M5YA 4FPRA 4KPCA 5GMEA 4ICLA 2JVOA 4N47A 2VPXB 3H25A 4Q8EA 3R8YA 4F3MA 4Z2XA 3Q22A 5J2QB 4USWA 3M8PA 3TWZA 3KJNB 1ZZNA 2J9DA 1SKWA 1LW2B 2EFQA 1URRA 2IRUA 3D1HA 3KHRA 5B09A 4G3IA 4JI1J 2CDQA 3CJ5A 2GHWA 4ZVGA 2OO4A 2VASA 1IKVA 4LR8A 1R3NA 4PWDA 2BM1A 2XZWA 1X4EA 2HQ3A 4DHVA 3U1NA 3KWMA 1Q53A 4NMLA 1RHUB 5KFJA 1PAEX 3MMBB 2LU1A 3PJXA 1KDNA 1FWPA 3DOMA 3UD3P 3NMRA 3UN3A 1P1LA 2RQKA 3R1LA 1H0HB 4RNMA 1LOUA 2E1PA 2GAHC 1VJQA 1C0UA 4DR1F 5GVQA 1AZSB 3JSMB 3CD6S 5LT5A 4I2PB 2NXJA 5DM6Q 3PFEA 3PM9A 1Q8KA 1P9YA 2VDHA 4P10A 1JXEA 2D9PA 1H38A 2K06A 4DR1J 2MEWA 3IN5A 2JVRA 1NDKA 4X4QA 3UD4P 3GIKA 3QIPB 3PJWA 1JX4A 2ZD1B 2MQOA 2N3LA 3V4MA 1PIEA 2YQ1A 2H4YB 4HVZA 1J5OB 3V4IA 2K1RB 1FA0A 3DM2A 2W4PA 3E8OA 3DI6A 3RRHA 1FNMA 1NH7A 1Z1ZA 5HROA 4TU9A 3P45B 4ZLPA 1RK8A 2I2YA 1Y10A 3BGOP 1UTAA 1KSPA 1LWCB 1S0MA 3FBBA 3KUHA 1GXLA 3UDEA 1A7GE 1YJUA 1OJ4A 4C11A 2V63A 4MMOA 4DS5A 1JXVA 1K44A 1S1TA 2RH3A 3FMWA 2DO0A 1HNIB 4C8YA 1UWBB 5T7LB 2XG8A 1R89A 3T1YF 1N0VC 2XMMA 3KHHA 5C24A 4IOCQ 3HVTB 1BHNA 5CYMA 3RZAA 4JI2F 1XNQF 4IOBA 1RT1B 2CRLA 5HL7Q 2Q6CA 3T1YJ 3OW2R 2X1FA 1SC4B 1HQEA 4CIOA 2DNGA 5EN1A 1WF1A 3HHKA 4GKJF 2W2PP 3I0RA 4JI2J 1XNQJ 2HWTA 3KLHB 4N77A 5E0OA 1TL5A 3M4XA 1RTHB 2DVIA 3BGUA 3PYFA 3VF0B 1RTZA 4GKJJ 3KLGB 4FYXB 3U7JA 1G1XA 2B9WA 5D0EA 4K0KF 2JEIA 3FZBA 1M1GA 3VGUA 1FI4A 3SDEB 1RHJB 4QIGA 1RXOB 5IM0A 3SIPB 4K0KJ 3BF4A 5IS2A 1V3SA 4LIWA 1OYDA 1X0PA 2COLA 3TVYA 2JL9A 2YVSA 1RP5A 1WI6A 3IWLA 1T02A 2Q79A 2CJBA 3G96A 4EYHB 4QPXA 4RW4B 2JZ5A 1GQEA 2GVDA 3P4UB 3Q2SC 4PG4A 3OR1A 4J9UE 2XWXA 1ICEB 2FY1A 1K8AT 4P2FA 1X9MA 3FRZA 1IBLF 2C2OB 1QSYA 1VCTA 2W9CB 5ETKA 4DX6A 4NLUA 1CJKB 3BQ0A 3QRQA 2CQGA 2EVZA 1IBLJ 3UDLA 4WFAQ 1PG5B 2OELA 4MYTA 6FD1A 4RNHA 3CUNA 2VC1A 2W2NP 2ZBIA 3MEGA 4CLUA 2QJ3A 4LQ3A 4CH1A 4YR2A 3MEEB 1VJWA 1NDCA 2HFZA 2H4WB 3W2WB 2LXFA 3DMJA 1HL6A 2M2BA 3WC2A 3C8YA 1OYEA 4Y00A 1FE4A 2WW8A 2KXNB 2ZITA 3AOAA 2QX0A 3HMJG 2CPIA 1BC6A 5C2CA 1LWEB 4RR5A 2WONA 3C6TB 1FDBA 1GT8A 2XO7A 1WG1A 2HVHA 1W26A 2D1CA 1F60B 2WVCA 5E3RA 3BM7A 2DGVA 4KGVB 4QU7A 2L41A 2F5GA 1CC7A 2KTQA 3T41A 2C22A 2ZJPQ 4FF1A 4DR4F 3NCPA 3UWTA 2ZBPA 1N56A 4M5MA 3HJFA 1D9AA 1F9EB 3PKYA 3QO9A 2IVFB 4ED3A 2HHUA 2VJVA 2MJUA 4DR4J 2XMAA 2C1EB 2N7YA 1KTVA 3OT9A 4FXWA 1NUEA 2V2ZA 3BSAA 3D0GE 1WELA 2AZ3A 2GJ2A 4OX8A 3T5JA 2B3TB 2KT3A 2CNKB 1NJIT 3M32A 1QJHA 1JQGA 5IC6B 3ZTSA 2IM2A 5DRKA 4KGMA 1WG5A 8ATCB 5HN0A 4JB8B 1RT5A 4TQRA 3P5TL 3ADAC 4S0MA 2P2CB 3MAAA 5IT4A 4Y65A 2OD4A 1S9EB 2AP6A 4LVNP 2C2ZB 4B9NA 2ZE2A 4DFMA 2GIRA 2V9KA 2XULA 4P2SA 1IBKF 5HP1B 5A2QY 4B3RF 1Q4RA 1G2EA 1HLWA 2HFSA 1ZAVA 2CPXA 3DLLQ 3K17A 3OTBA 4G1QB 1HIYA 2IJNA 4AFFA 3DHWC 1XERA 2VQEF 3T9NA 1IBKJ 3NNHA 3R27A 3FQKA 4B3RJ 1EETB 3MURP 4PWWA 2R42A 2J7UA 1AYEA 3BYPA 4PXCA 2RS8A 4F0HA 2VQEJ 4OZ3A 2B5JA 3MM8A 4I67A 5EX0A 2HNDA 4DSJA 5HBMA 2R7RA 3TUJC 3ISZA 4HACA 5AE3A 1N5YB 1N5QA 1SIWB 3OHAA 4CLZA 1RT4A 1HR0F 2UV8A 3QRPA 4L74A 2OKQA 1SJQA 3FEXB 2DBBA 3WX8A 1HR0J 2CIMA 2CZVC 1EZZB 3KK1A 4AXIA 1RHMB 1IQZA 4NXMJ 2HVEA 3DRSB 4C3LA 1YVFA 1RAHB 2U1AA 4PYAA 1EB0A 2ZDOA 1ZOTA 2PEBA 4KHPF 2XMTA 2O66A 4ELUA 4YR3A 1U1OA 1X9SA 3CDBA 4ED4A 4C8KA 4KHPJ 1Y9OA 2MB0B 1UZHA 3OV7A 4F04B 1Q0NA 3I96A 1VIOA 1TKZA 2P9GA 2ZNZA 1NPKA 4Q7AA 3OFGA 3TNVA 4PG5A 1EP4A 3DYAA 2ZC3A 4HTJA 2YPZA 3OSPA 2QLFB 2Y9HA 3GJRB 2AGPA 2F8MA 3I0SB 3H59A 3K5LA 1WHYA 4O3OA 2LMIA 4DSEA 5CQGA 2X3DA 4CRJA 2VFRA 2FHJA 2HSEB 2VFVA 2MQLA 1IVZA 2CNOB 1BGXT 2YNFB 2XSJB 4LF9F 2BJEA 5KG7A 3QJLA 1REGX 3EXYA 3TQEA 5KT2A 2WVEA 4U9RA 3D54A 1QE1B 3KK3B 4HL9A 2A2CA 3QLHB 4LF9J 3SQGA 2NS1B 3KLFA 1QVFR 2DHSA 1FFWB 2MKJA 4F02A 1XC9A 3ZZOA 2KI2A 3IWXA 3C3LA 1RABB 3NNCA 2G2ZA 2YNIA 1WC5A 3QT8A 5D77A 4X2BA 3CJRA 1FNOA 5A6PA 3L09A 2AD9A 2LEPA 5I3UB 3DLJA 5B0AA 2X1BA 3RJMB 2B8PA 2R7QA 3W64A 2E29A 2HBRB 2R8KA 3OTEA 1OY6A 3FJ2A 3MR3A 3VZIA 4AE5A 2XWYA 1DBDA 3TRGA 5ETOA 4WU2A 1ZM9A 1U1RA 4FN5A 4R0EA 1YZ6A 1T05B 1SJRA 2K2PA 2BQRA 2CXEA 3QBCA 4B17A 3RB3A 1TP7A 4DR5F 1F5BA 4DWIA 4ECXA 5KFKA 1U1LA 2ZVIA 1M0SA 4EYIB 1MU2A 1RT6B 3G82B 1IM4A 3PYEA 3GYGA 4ECSA 1JLGB 3PDNA 5H9FJ 4J9SA 4DR5J 2CWKA 1HHQA 5DZ7A 2V5HG 4Q8FA 3DOKA 3HXMA 3W1YC 4GC6A 2HHQA 4YDXA 1OMSA 3FMBA 7FD1A 4MAKA 4L3KA 4FS2A 1PCAA 1D9DA 5CABA 5L1JA 1CPZA 2VICA 1F1BB 4O3NA 3CJKB 5KFMA 2KM8C 4DQSA 4DL4A 4CO2A 1TVRA 3W60A 2OFGX 3DRXA 3JXOA 3DLKB 3X1LB 4WKRA 2ASJA 3GV5B 4ELTA 1S1WB 4OZ5A 5DO2A 4I56A 2LQBA 3T9ZA 3ZZYA 4ID5B 1S1VB 2FVPA 4OJ1A 1VK8A 2BJ8A 3N5BA 5CYQA 2HIQA 3NRBA 5FDLB 2XMKA 3S8SA 4Z7CA 2IA6A 2DHXA 2JLEA 4LSLB 4NEYA 3I9V9 2DGSA 2KL8A 4TVAB 3W2VA 1R8AA 2RRBA 4ILRA 1F9FA 2UP1A 2OIHA 2ZUAA 2DR6A 2PE8A 2P9CA 3DFEA 4ILMA 1TFWA 4UTGA 2HBQB 3OVBA 4N56A 2QL7B 3RBDA 3GB0A 3HHLA 3FUYA 1Y5LB 2OLWA 2QLJB 1HI1A 3M2VB 4WK1A 5C5JA 3BH6B 4ZIWA 1RACB 3FEYB 2ZJRQ 4CT9A 4OI2A 4OYZA 2HNZA 4FYDA 3QATA 5D3GB 3DLHA 3EMTA 1RWXB 1D09B 3PR4A 5DLFA 3K7RA 3GYNA 3IA0A 4ZVHA 2P5VA 2NZ4A 1B0PA 3L3CA 1R0AB 3C6UB 3CCTA 4HT7A 4NLPA 2QMUB 5L39A 2UU9F 2VG6B 3GSDA 4KFBA 2CJXB 1U2CA 1ZA1B 3P3DA 2AX0A 4H4KA 2MGZA 3H2VE 1WOOA 2DCLA 4EZ6A 2HS0A 1HBNB 3NGSA 2H1YA 2QE5A 3GFXA 3TJ8A 1FKPB 4K50A 1IR2A 2BXJA 4ZLLA 1X0FA 4KC5A 4D3GA 5HATA 3PW5A 4CLKA 2QLXA 3G2XA 4N5SA 4IR1A 3IS9A 2UUTA 3IM8A 4C8ZA 5DGAA 3E2EA 4PG6A 2FZKB 3D6HB 3BSNA 2WOMA 1FJEB 4WZQA 4NRTA 1JMTA 2IRYA 2GJIA 3EZUA 3BGRB 4RW7B 1HARA 2DHGA 1U26A 4ZPVR 3UFCX 1JB0C 2B9EA 2BZ2A 2HHHJ 4WE1A 5I3QA 2E7XA 1FKOA 2WTFA 4IG0B 2MY7A 3CC4S 1YSJA 1OSCA 3G6XA 2DRDA 3BDPA 1DLOA 2E9ZA 4I64A 1R0CB 4ZP9A 4PUOB 2MLZA 4RZRA 4C8NA 4OLOA 1UA0A 1GX6A 5M2UA 2K8GA 3JSRA 3L9ZA 1SJ1A 4DCOB 3J7YI 1GTHA 4EBEA 2R2SA 1Q81T 2CVEA 5ETQA 1KQKA 2JNJA 2GIQA 1GNKA 4GVBA 2KJVA 1XEZA 2G0JA 5HK4A 5ETRA 1RT2A 3FGVA 3NS6A 5KG0A 3KXDA 1UPMB 1IWAA 2M8HA 1NM2A 2C2KB 3TX8A 2EXUA 4JOUA 1Z4UA 3NL0A 3TAMB 2F40A 2JFDA 1T94A 2CADA 4ED6A 5E3PA 3D6TB 1PYSB 1UZDA 3GCXP 4TU8A 4ICLB 5HQ8A 5IV4A 3TYTA 1T11A 3I87A 5A76A 2VUGA 1NK5A 4ZS6A 1WORA 2BANA 2ZKTA 2IAJA 3FDSA 2RRAA 3M8PB 3VWSA 2BUNA 3QFHA 4KKOA 1PBAA 3WIUA 4OX6A 3ZZPA 2CVIA 4P9SA 3J7ZT 2MMYA 2VQFF 3EGWB 1WF0A 1ZTWA 2CJKA 1UETA 4OV6A 5K9FA 1IKVB 3HHNB 4PWDB 2CPHA 2VQFJ 3RRGA 1ZETA 3MDFA 3DOMB 2QA4G 2DR7A 4QR0A 2BA9A 4DS4A 2HAIA 4P52A 4DSFA 2YKPA 1VIXA 3VHQA 4DCPB 4OI6A 2F9JA 4PYDA 4DQIA 3EVOA 1N36F 1IQTA 1C0UB 1KFSA 3SSSA 2JJ4D 5I4MA 3NOGA 2VBXA 2LVWA 1UJ6A 1NHUA 4UUWA 1N36J 1QDUB 3ZNJ1 1PBUA 3OVSA 5C2GA 2BRKA 4DQRA 1TL4A 4RL1A 2VFSA 2VPYB 1N6QA 1SV5A 2DKOB 2ADBA 3HT3A 3BDEA 5F8IA 4URGA 1XNRF 2Z56B 2V34A 1PYTA 1IWGA 2GMJA 2GVZA 3SV3A 1A0OB 4F3OA 3AT1B 3ENVA 1XNRJ 1QVGR 2MHNA 3V4IB 2K7JA 3US5A 2J6UA 3DM2B 1VYAA 1UVIA 3DI6B 1VRUA 3WX4A 1BQMA 4ANCA 2QN6B 2R2RA 5HROB 2DPJA 1FXLA 4M63A 2B4OA 5DDRC 5JVHQ 1H7XA 5AE1A 1HYSA 3BS9A 4NLOA 2W01A 2NUHA 1HKAA 4C11B 2Z2ZA 4P75A 2VIHA 5KFPA 4CI0B 2YH0A 3PNIA 4ZPDA 2DO4A 5GADI 1U25A 1S1TB 3CDUA 1ZZFA 5LL6d 2V69A 1FRJA 3FQLA 4B3SF 2A10A 2RMLA 3GV8B 3DDIA 3ZZRA 5C24B 5B0EA 2DT9A 1YJ7A 2OPPA 5CYMB 1FD2A 4K8RA 2ZM6F 4RJVA 2DGTA 4B3SJ 1Q1KA 4CNZA 3Q2TC 4K4WA 5ADZA 1HQEB 3CMAS 3HHLC 5KG6A 2ZM6J 2ZH4A 3I0RB 2XZTB 3VAHA 3HHLD 4ECYA 1WDTA 2DH8A 4UZBA 1EKRA 5F3ZA 3L4BC 2BJ7A 2A6OA 1NMEB 1U1NA 4M95A 4IFYA 1REVA 4X4PA 1RKJA 4KIAA 2WCXA 2HRTA 2FY8A 2E5GA 2XYHB 3TVKA 4H4OA 5IM0B 4I6AA 4QQBA 2CQ2A 5AE2A 1YJNS 2UUWA 3Q8SB 4ZIVA 4H4KC 4U7UK 4FPIA 2J76E 2JHEA 3BGLA 2EBGA 2BABA 2GVDB 3OR1B 4UOFA 1RCOB 1H98A 4QWAA 2NXCA 1S1UA 3MD1A 2JFKA 4ZK7M 3I82A 4OI4A 3R5DA 3K5OA 4KRWA 4I0WA 3T5KA 2C2EA 3A4TA 1W2IA 3DNCA 3IR5B 1QAIA 1Y3KA 1RE1B 4W98A 5D0GA 1RWUA 3CCMS 2FHOB 2IHR1 4DL2A 4RU9A 3EPIA 3CF5Q 1VQ4S 1K73T 3MEGB 2PN6A 3OJUA 3TW0A 1PGZA 2R7UA 2BVZA 2LYVA 3CW2C 3VR1A 2M4MA 2ZZTA 4RNNA 4QR1A 3M9OB 2RSQA 3DMJB 2QG9B 3AH6A 5L46A 3QGHA 3O6QA 3CCRS 3QZ8A 5KFHA 3SYZA 1NSKL 3K5MA 1WNEA 2VONA 2ASLA 3AD8C 3RR7A 1L5UA 4B3MF 3VALA 3QZ7A 1S0OA 2WONB 3AD9C 3R7NB 2Q3PA 4OZJA 2KM8B 2DGUA 4B3MJ 4FP9A 4USIA 2CNNB 2ROEA 3OL6A 1FHTA 4BBYA 1S97A 2MZSA 1TL1A 2WSFC 2ZJQQ 3SBMA 1UMJA 1Q86T 2AEFA 4AUKA 4RPFA 3KMSA 3DLEA 1F0XA 1YJWS 3QO9B 2H65B 5CH7B 4HR2A 1DJ0A 4HYKA 3H4BA 4PWUA 3AJ1A 1WF2A 5HO4A 2UXCF 2AJ1A 4EEYA 2HQIA 3GYXB 3ZO7A 1HWUA 5EWFA 2XNRA 3QNWB 1LWFA 4EGLA 3LO3A 4ECUA 1UEUA 2A0FB 4DF4A 2UXCJ 4B9MA 1H6KX 3M32B 4A8MP 2HBYB 5L8RC 1ZYQA 2BJ9A 3W7BA 2FD2A 4XAKA 1YRUA 2IBOA 1VC6A 1Q5VA 1RT5B 1V9OA 4C3KA 2V4JA 3D1OA 4DDFA 3MAAB 2PO4A 2YX4A 1X4HA 2E5JA 3IMQJ 3VGVA 3W8PA 2ZE2B 3G8QA 1JWWA 1XK8A 5EHHA 1DHMA 1U24A 3NXZA 3UVJA 3ENQA 2IPOB 4B9UA 1R6VA 1VRTA 2NUUG 3TAQA 2PT0A 1NK4A 4C8LA 2AKWB 4FVMA 1TUWA 3QYYA 1K0TA 2DGOA 2VPZB 2JC1A 3Q83A 2QO3A 1PYOB 2YPYA 3IR6B 3MPVA 2KHCA 2QRRA 1H3DA 1LK7A 2B5JB 5HMWA 3N01A 3MM8B 2HNDB 3OSNA 5HBMB 5DM7Q 5D8HB 1FRLA 3D28A 1NJXA 3EVMA 4HACB 4IG3A 1RT4B 2A6MA 2QA2A 3J81U 3CNQP 1YK9A 2OJ3A 2F1FA 2J0SD 4GO5X 1AFIA 4NZ7A 3V81A 3DDKA 3CCQS 3A8IA 3KK1B 5K8OA 2YX1A 4GMKA 3WBZA 4DV0F 3T19A 1Q8LA 4DI6A 2DNLA 1LXJA 3DU5A 3KK2A 2EK1A 4IRDA 1I1GA 2HQDA 2CDRB 1SJ4P 1BMQB 2ZOGA 4FYYB 4DV0J 2DNOA 3MECA 4FYWB 2EWHA 1HHTP 2R3VA 3ILJA 4NZ0A 4UOHA 3T3FA 3MAHA 5KFSA 2MYFA 4MK8A 4LSZB 2V6AA 3NKYA 3HJVA 4C3MA 1TKZB 1A9NB 5DDQC 5KFFA 4ERDA 4RO0A 4O3RA 1EP4B 3DYAB 5ETTA 2BQUA 5F3TA 1KOHA 4ZOSA 5C42A 3H5UA 3ENAA 3DKDA 1FD8A 1UFKA 3CCLS 2D74B 4YHHF 2ERRA 4DSIA 4RBUA 3KLVA 1WHVA 2L9DA 3K59A 3UCZP 2O1PA 3RRKA 4CM0A 4NPOA 1WTFA 4YHHJ 1SQGA 1NXIA 4LRCA 4NLWA 3QWPA 1FKAF 1RLDA 2CQCA 2ZUGA 4CO1A 4WPAA 4CO3A 1WHWA 2KZMA 2MZ1A 2HHVA 2RHSB 4J9NA 2MXYA 1PC5A 4PR6A 4RW9A 1KC8T 3RBXA 1RT7A 1AUSL 3HKWA 3TZZA 2FC8A 5EX3A 7AT1B 2W4CA 4ZVQB 3SQGB 3O44A 5LJ5Y 3FCHA 2G1HA 2RUGA 2C3UA 2K3IA 3KLFB 4X4SA 4K4VA 3A3NB 4USMA 3MFHA 4DU8A 2JX2A 2UVUA 2L3MA 2DNMA 1BWEA 1RYRA 3IG1A 2QC3A 3CO0P 4XIUA 5T14A 1X4AA 4CLSA 2YX7A 4YUDA 2GV1A 2YNIB 5DQHA 1UJ5A 4F67A 4QZVB 5KFWA 1Y3JA 1SUQA 1UW9A 5B0GA 4DSKA 1RWMB 5KG3A 4EWTA 1VQOS 4XPCA 3HCXA 4L72B 3RAMA 1QTMA 4MIAA 4U7CA 2GQ2A 4ZPAA 1SI9A 4J37A 2ZH2A 4ZJQA 4PPDA 4XK8C 2W9AA 3N28A 4QYZJ 3RAQA 4EBCA 1RCXB 1YRTA 2AYEA 2W7PA 4I1TA 2FUG9 2R7VA 3OTCA 2N7CA 2HZVA 1UVJA 5I42A 2D69A 4QIWD 3IAS9 1MU2B 4M5KA 3FBEA 1SJ3P 1UP1A 1UVMA 2C2MB 4LRBA 1WJ9A 2FLLA 3X3UA 2CQIA 4ZJLA 3DOKB 4P6QA 3BKFA 4ED1A 5LM7E 1TKDA 3GV7B 3G87A 4CYUA 2Z0GA 2LQ9A 5A6WA 1U7LA 2X1GA 3C2PA 4ALZA 1VK3A 2YKAA 1KD1T 2ZZMA 1HW9A 3CTRA 1MWQA 1Y00A 1TVRB 2NXNA 2DRBA 5BXIA 1WEXA 3L7OA 2G0CA 1KTQA 1TK5A 1S9GA 1YJRA 2J7KA 5DZ6A 3NAIA 1FE0A 1QAXA 2HHPA 1ELOA 3TO8A 3BJYA 2G4BA 3N79A 2MKKA 5GAHI 3W61A 4F4AA 4M94A 1ZAXA 4DPYA 1RBOB 2DISA 3EM1A 3TUIC 4Y6IA 3RW6A 3ULHA 2DTJA 5CYQB 4JI5F 4ZHRA 2DNKA 2W2MP 4R25A 3PJ9A 2MZJA 2F9DA 2HZCA 1YX2A 3W2VB 4JI5J 4ZDNA 3QAEA 2B9YA 2A2DA 4ILLA 5FJ4A 1LFPA 3W9JA 2YY3A 4C98A 1KHWA 1FJGF 2H54B 2MQQA 2H3EB 4DR6F 4J9PA 1NK0A 3HHLB 2J8AA 4ED2A 2QA4S 2JOQA 1FJGJ 2I5JA 3R7SB 4DR6J 1EJ7L 3K57A 2HNZB 2CWXA 4CCHA 1H2UX 3JB9k 1VQMS 3BBFA 2B8QA 4KPYA 4YY3F 2F7VA 2ZZNA 2E5HA 3N4WA 1CVJA 3H2LA 4KH1B 5F8NA 4CLTA 2BW7A 3GR1A 3EE3A 4OJGA 4B9SA 4YY3J 2ALZA 1KVIA 2RVJA 2HPUA 2LQ8A 4B9TA 1FCAA 4DFJA 1T95A 4MYUA 4KFBB 1RAIB 1ZPWX 4YDDB 2IDEA 1VQPS 3BSCA 4B9LA 2GFFA 2MGZB 4G6VB 3DLGA 3AQOA 1YDLA 3IO1A 5D4NA 4C8MA 4DR2F 1HBOA 4TU7A 4Y2MA 2XLKA 4OJ3A 2OFHX 4DR2J 3ENWA 3E3XA 3IS9B 5L1IA 1VMBA 4USVA 1I5OB 2WOMB 2IVYA 1VQ8S 1NDPA 2IJRA 2GA7A 3IBCB 4ZPWR 3NOCA 3OXLA 2CJAA 4ID8A 1CSJA 4I6WA 2KH9A 2M3DA 1JJCB 2MSTA 3ISNC 3TOQA 4WE1B 1NZAA 1IKWA 3DXSX 4MKBA 1RKIA 1FKOB 3ZTQA 4ZA1A 4B02A 4KT0C 3ISND 4L6V3 5J1EA 3K58A 4LF6F 2AHOB 5F8GA 1BE4A 1DLOB 4OHXA 3CJ3A 4ZITA 4C7QA 1KQFB 1U1MA 4LF6J 4ANEA 2KFYA 1S72S 2HFNA 1C2PA 2OD6A 2XGPA 1R8CA 4OHVA 4CH0S 2CG4A 5GAEU 3CB4A 3BKUA 4OIXA 4GVBB 3HZEA 1RT2B 2WB1D 2LP4A 3CIMA 3LP0A 4LREA 1H7WA 3HKZD 2KG0A 5JJBA 3LQVA 3T1AA 1P27B 4GC7A 5KG2A 1VQNS 1ZM2A 2MQNA 3H8YA 4MJKA 4WP8A 2AYBA 4NYPA 2EFOA 4UY8T 2BANB 3CJ0A 3D0HE 1D1UA 2IAJB 3BB5A 2B51A 4JV5F 1N48A 2J0QD 1JLCA 3FVYA 3HSGA 2XZDB 2EFNA 2I6WA 3GFZA 4JV0A 2YBVA 4KKOB 1FXDA 4IO1A 2BKPA 3F0NA 4JV5J 2OH2A 4HHUA 4X66F 1RAAB 3OTOF 2BBEA 2JWNA 2MLXA 5HVHA 2J9DE 3LP2A 2O3DA 3H0PA 2J9EA 1JJ2R 2CZ4A 4XO0A 4YMEA 3MPDA 1Y0HA 3ZTOA 4X66J 3OTOJ 4I2QA 2F63A 2LCWA 4ECTA 5BR8F 4QWCA 4ED0A 2G9OA 3A8JA 1AA1B 3RAXA 2XHWA 2IDLA 3TA1A 3ILLA 1E6VA 5BR8J 1FEHA 4LRAA 1OQ3A 4V1Ak 5E2QA 2M88A 2WHOA 4A47A 1RHRB 2DR5A 1DQAA 1Q16B 4CTAA 1I94F 2M8DB 1X5TA 4MKVA 4X4NA 2X3GA 2YWGA 3EPGA 3QT5A 4LF7J 1N6QB 4Y2KA 1SV5B 1VLYA 4X64F 1HWIA 1I94J 1TKTA 3NG8A 1X60A 1HI0P 3Q0AA 2UUBF 3QMQA 4UQGA 2GVZB 2J0WA 4TY8A 1C1BA 4X64J 3N6NA 1ACMB 5K8PA 2UUBJ 2NLWA 1T9XA 3IP0A 4QR2A 1C4AA 2J5AA 2E9RX 1VRUB 3N9UC 2IM0A 2P6SA 1BQMB 3PW7A 1KWMA 1RBLA 3L7PA 3UD5A 2IM3A 3U1LA 4ZVOB 4L76A 1PJ6A 3RW7A 5IXUA 3BZQA 1HYSB 1U0SA 1MG7A 4IDKA 1QSSA 2D3UA 1DRZA 5KFEA 3N0VA 4D3HA 1FERA 5KFLA 3VCDA 1LV5A 5B0BA 4ECWA 1SKUB 3DDNA 2AEMA 4KBIA 1CQMA 5DG8A 3QGGA 2OPPB 4CH7A 3LGMA 1G7CB 2XEXA 1N32F 3NGKA 3O8WA 3MM6A 3OUYA 5EUHA 1GMWD 3GWCA 3GQCA 3MEDA 3CPWR 3H42A 1IR0A 1N32J 1RTIA 1SBRA 1VQKS 4P2XA 1WWHA 1TKXA 4WU3A 1U1QA 2KZZA 2Y0BB 1HNZF 3CC2S 1U6ZA 4J9MA 4DL7A 2LECA 2MKSA 4UF4A 4QWBA 1NHKL 2MQMA 1BQNA 4IFYB 4ATNA 3DGVA 1GEHA 1REVB 4OJHA 1LWXA 1TTHB 3RG6A 2HWIA 3PRBA 1CG2A 3MUTP 1RTDA 4ZVUB 2F65A 2C42A 4ZLNA 1NK6A 3RYLA 2J8SA 3LGNA 5HAOA 4H4OB 2RKIA 3P5BP 1SC1B 2BX6A 4V19J 2AT1B 2DJWA 2XS5A 2AMCB 2YWEA 5KT3A 3A13A 4N8OA 4FS1A 4EU0A 4LFAF 4O44A 3M6UA 3G8SA 2IC3A 4WF9Q 1S5ZA 5FLXU 1SH0A 3JTOA 4NA2A 2DYAA 4LFAJ 4HHJA 4WYLA 1S1UB 5KFZA 3V2UC 4ED8A 4I7FA 2PD1A 2PSZA 3QAUA 2CUYA 4A8YA 2YKQA 3DRPA 1WSRA 5EGYA 2DNQA 3S7RA 2DK2A 4DUYF 5HMYA 2CYYA 1SQEA 3LWLA 2DNHA 4USTA 1LK5A 4DUYJ 4F25A 5GAGU 4JI1F 1B4SA 1H2VZ 1IKYB 5DDOC 4Q2MA 1JLBA 2KRRA 4OQJA 1RLCL 1RAGB 2H5JB 4QBUA 3HPOA 4NLVA 4HEA9 2FJBB 2FJAB 3K8VA 2Q1LA 5MLCV 3CSKA 3Q23A 2AJ0A 2QLWA 3GJQB 2CZ9A 4ZP6A 2B7CB 3QT7A 3IBWA 4DV4J 1RU2A 2RNEA 4RUCA 2RU9A 3QGIA 3K89A 4X4RA 4TLQA 2G13A 1DAXA 3QGPA 5AXKA 3OTDA 4OZLA 4LFBF 4A8QA 3T6JA 1TL1B 3J80U 3VZHA 2C3PA 1B64A 3PXGa 3EGNA 2ZH1A 1HNWF 2ZC4A 3GIIA 3KKFA 1OY9A 1WUUA 1FT8A 4LFBJ 3MEKA 4K7QA 3DLEB 4A4JA 1PILA 2QTWA 2DY1A 1NSPA 1HNWJ 1FF2A 2ATCB 5K8MA 1NJYA 1S6PA 1G6BA 1RADB 1KQGB 4MTPA 1N4LA 1H72C 2U2FA 4DPWA 4J9RA 1DY3A 1LNQA 1HQUA 1AXQA 1LWFB 3GCWP 1T9VA 2NXEA 2VPWB 3HX9A 3NNAA 1GXUA 5LOQA 2B6AA 3BYRA 5L38A 2KG1A 3CULA 3D7SB 1AW0A 1FEEA 4J9QA 1RAEB 1F2GA 3HD1A 4ZPTR 1NDLA 2V4JB 1KNZA 2OGUA 1DTTA 3Q8UA 3PG9A 4F50A 2DXDA 3G71S 3BO3A 3LH2S 3OBIA 4DG1A 3UVJB 2AV5A 1VRTB 4DQQA 2BM0A 4BLGA 4JP8A 1IBCB 2F4FA 3R3TA 3T6BA 3I9ZA 2VD3A 2AJQA 4TN2A 4F4XA 4HTIA 1PO6A 4PPZA 2C2RA 4XDCA 1BLUA 5KFCA 5KFAA 1NB7A 4R0JA 3OLBA 4KH0B 1PAUB 2VDIA 4LSNA 3SV4A 1XMBA 3H2UB 2DHHA 1S7IA 2KB2A 1MN9A 2NSBA 4IG3B 1DARA 3MM9A 1B7YB 1L3VA 3A12A 3KHGA 4WFXA 1GMUA 4MKYA 1VQSA 3CO9A 2MTLA 3V81B 1D3WA 2YWWA 1YITS 1N54B 1HPZA 3LP1A 2Q6BA 2VG5A 3KK2B 3CDAA 2FZCB 3BO2A 1TQLA 4K4TA 2LDYA 1FFGB 4LR7A 5HLFA 4NCGA 3EGVA 4JV1A 3R1HA 4P7TA 3MECB 4GVLA 2ASYA 1VBYA 3HSDA 2D9OA 2F8HA 1TAUA 5J2PA 2FVCA 3KLEA 4C2MA 3BV8A 2IMWP 4USKA 3KTQA 2XYPB 3M6XA 3CCES 6FDRA 1HW8A 3RBZA 3O3LA 3MM5A 2B56A 5C42B 5DJBA 4R5PA 5L1KA 4OI1A 1HHSA 1WACA 2MZQA 2L9NA 1NO8A 4MIBA 1RSCA 3EX7B 4IUFA 4J9VA 3UN2A 2POKA 3BN4A 4X84A 3HFKA 2NPIA 4KE5A 5EDWA 1KONA 3NCQA 2GO8A 2L9WA 3MMCA 1APSA 4C8OA 2HQCA 2DNNA 5KFDA 4RW9B 3U02A 1RT7B 3QRRA 1KS2A 5DLGA 2JH3A 1X8DA 3R6GB 1RQ0A 3ZZUA 2DRAA 1ZS6A 1U1PA 3R6LB 3EWGA 2PFFB 1S0NA 4ETXA 2I8EA 8RUCA 4N76A 1HBUA 2LQJA 5HI7A 3KMQA 5BYRA 2HHWA 4IQXA 1M5SA 3IG1B 5DGBA 2DHAA 3POTA 2QYCA 4TLRA 4DU7A 2VH7A 1SUQB 3M9MB 2VOOA 4M5LA 2KVIA 1QM9A 3FBFA 4USJC 2RHQB 4NCAA 4V19X 2LU2A 4K59A 2Z2LA 1BD6A 1RA6A 4ZCLA 1HWJA 5F8HA 3FSYA 4E2FB 2ZBCA 1Q8BA 3KYLA 5ETSA 3R9LA 2GJFA 1U0HA 1UWAA 2GS8A 4IKAA 1Q8IA 1UPPA 2FYXA 2DNZA 4U7UD 5B0FA 1B99A 3WZ0A 1SCJB 4WFZA 1X5OA 1WC1A 3R5CA 2MLYA 3CMES 5BYSA 3MR5A 2ZHBA 5I42B 1HNVA 4ECRA 3D68A 2F4VF 5E3QA 4KJIA 2R8JA 3DCAA 2OEJA 2VFUA 4U8VA 1D0EA 2XCPA 2XLIA 2OHDA 2F4VJ 3OLAA 2HLUA 4CYUB 5AJ3F 2YNHA 3TX0A 3WIVA 4WFBQ 2HQGA 2B43A 3C46A 3CCVS 4ZJOA 3A8KA 5ETNA 5AJ3J 1K9MT 3HSZA 3N6LA 2QA1A 2XLJA 3T1HF 2HG4A 1J2VA 3SZ2A 1QAJA 3J81Y 1S9GB 1QD1A 3D3CJ 3F56A 3OR2A 3T1HJ 4BC7A 4DX7A 2HFUA 5IC4B 2B0GA 3B78A 4Y3CA 3DHXA 2BYCA 4YFUA 4PG7A 4BS2A 3ONQA 3OXFA 2PEHA 1UVKA 3AHPA 2DEIA 4ZHRB 4WK3A 1N52B 1RYSA 3A3PB 1FESA 3DGPA 4DV5F 4OYOA 2ZH7A 5K5MA 3RBEA 2Y8YA 4NXMF 4DV2F 4OZ0A 2LLZA 1W7WA 3AFGA 1VDHA 3KLIA 4PKDB 4DV5J 4OYAA 2D3ZA 4UQTA 2QSWA 2EC0A 2C2DA 3Q86A 1HD0A 4DV2J 4OMFG 1NB2A 1HFEL 5H1SV 2I5JB 3O5TB 3OL7A 2V94A 3CT9A 1UAWA 1HI8A 3MCOA 1KFDA 3CMQA 2YQ3A 1R31A 1S9FA 4MIWA 3U1MA 4IFVA 2VKZG 1NK8A 3CJ2A 2W9BA 2Y1LB 3BH7B 3M2UA 1SL0A 4ITSA 3GZ7A 5HVFA 4M5HA 2AEJA 2CJQA 1EHWA 4P71A 1EKSA 3RB6A 1F9HA 4LIRA 3THVA 2EI5A 3TEGA 2LA4A 2NQPA 2OPRA 3OQ2A 4OYIA 2AIRB 2HBZB 2E5LF 2RDDA 4CQ1A 4O3QA 3VAMA 4J91A 4F7VA 2R7SA 4BCAA 2UV8G 3DLGB 2J6SA 4DX8H 5CCLA 1MMLA 1UKUA 2QSFA 2UVVA 1FTCA 5HVGA 2E5LJ 4FBUA 1HBOB 1JKHA 1SH3A 5BYQA 1HBMA 5E41A 2RDIA 4OI0A 4F3QA 3LF0A 5JVGQ 5J2MA 2D41A 4IQMA 2PA3A 4ZPBA 3UDVA 4ZP8A 3KNAA 1YJ9S 4DZ6A 1CQNA 4O4RA 1UFLA 2L48A 2LQ5A 4LR9A 1Z2ZA 3GJTB 2V68A 2YWFA 1VC0A 2G1DA 5A8WA 2IMOA 3K8WA 2V8HA 2JRSA 1L3TA 1LW0A 5F0UA 2KXFA 4QW9A 2JC0A 3TJAA 4ED5A 2UXDF 1IKWB 3LUYA 3EICA 1HWKA 2CNLB 3KJQB 5J1EB 4NI2A 5B08A 2VC0A 2UXDJ 4NXNF 1S12A 2QIFA 3R5GA 1XR6A 2EBEA 4KY3A 2ZOFA 3NWRA 2XY6A 5GMDA 1MSWD 1YJVA 4QJVA 2W1BA 4YB7A 1VQLS 5CCMA 2MZTA 2KVQE 2O01C 4NXNJ 2R8HA 1NKBA 5E33A 4DZDA 1X4CA 2CAJA 2QMXA 1TK0A 4ECQA 1MNEA 4IO9Q 1CJVA 3VGSA 2C3YA 3NGTA 1Q7YT 3IR7B 3UW1A 3LP0B 3I4PA 3M1VA 5E5NA 1VHFA 2YNGA 1K47A 5F8LA 5KG4A 1UCNA 2MKHA 3DOLA 5JUMA 4FF3A 1RAFB 2LKZA 5D4PA 1M5PC 1UVNA 2PI4A 1U45A 5K20B 1BY9A 3FCVA 1JLCB 1GAOA 3MD3A 3PRVA 2GMHA 4Y2CA 2MKIA 3CGIA 3UDCA 1CJUA 4RUBA 2JEJA 3TA2A 4EZ9A 6AT1B 1KHVA 3LP2B 4PXEA 3OL9A 2D3OR 3UQSA 2HGLA 5CAAA 1RGVA 2ABYA 4I2QB 2JEGA 3PY8A 5HQLA 2FIUA 5LMNF 2WBRA 3GIRA 3PEHA 3PZPA 4C6AA 3GONA 4C0HA 1E6VB 5IWAF 5C25A 2OEKA 3QQCD 4NL5A 2YQ0A 5LMNJ 3PVXA 4DOZA 1VR6A 3IGVA 3IRXA 1K0VA 1O0PA 1U2FA 2F3JA 1F5AA 1U6FA 3PHEA 5IWAJ 4CTAB 4JI7J 4OYWA 1HMVA 1M1HA 4WIIA 5FD1A 1RT3A 1TKTB 4PZVA 2OMLA 1JJHA 1JLEA 2XHCA 3FZ2A 4HDGA 3FKBA 1R8HA 1T03A 4TY8B 1C1BB 1OQ6A 3ILIA 1HA1A 1NEEA 4U95A 3F44A 3D66A 3PRDA 2R8GA 3RR8A 3TUPA 1TELA 3AB4B 3TARA 5KFOA 4M5NA 4WXWA 4PQUA 2MJNA 2HKEA 3QSYB 2ATLA 2V2QA 3Q8RB 5HMZA 5DG7A 4OZNA 4IDKB 2CQBA 4W4MA 1P6TA 4IOAQ 2Y3YA 3IC1A 4F2SA 1O5JA 1KEKA 1WOPA 5AXNA 5F9LA 2E1MC 4A46A 1NH8A 1GMVA 3TVZA 4AQYF 4J9OA 2K3KA 2ZBQA 1WKJA 2PMWA 4Q45A 3OPKA 2RE1A 1B0VA 2WVFA 3I56S 1Q95G 2FJWA 5ETLA 1E6YA 4AQYJ 1F5CA 2M70A 2V0NA 3MM6B 3OUYB 3MEDB 2KHDA 3I31A 1NCLA 1IKXA 1S6UA 3IAM9 4P74A 1RTIB 2I9SA 1TKXB 4ZVRB 3CEDA 2H5IB 1WOSA 2HWHA 3M8QA 2HHHF 4FXDA 4YP3A 1BQNB 2GQQA 2XO6A 3FFIA 3TEHB 3W5ZA 2VV5A 1TV6A 3R97A 4DPUA 1HD1A 1RTDB 2G0IA 1WEZA 3LANA 2DPIA 3ZXWA 2VL1A 2DY9A 1RJJA 4DX5A 2RKIB 4F0MA 3CCJS 1U09A 1MWYA 5CD4A 3PYDA 3HLUA 3M6WA 1VQ7S 4ZKAA 4U96A 3Q24A 4X4UA 4EUVA 3LA0A 1XBWA 1U02A 2ROPA 1T9YA 3ZNUA 4O44B 4O0NA 2BOAA 4Q0BB 2IC3B 1XQIA 4ZN1A 3GFYA 3D1QA 1GXTA 2VA2A 3BSOA 1T3NA 2KU7A 3HD2A 3NS5A 2KFNA 3C14A 5MAOA 4I7FB 2RD5C 1DQ8A 4JBCA 1N0UA 2DCUB 3DRPB 4HT5A 2OP5A 4MT1A 5HJYA 3FEZA 3IBFB 2DXEA 5L9XA 3GTYX 2FVRA 3MFIA 1GFWB 1B3TA 4CDIA 3EVWA 1JLBB 2D3O1 4FKXA 1CJTA 3TP2A 3M9NB 2YWKA 1LEOA 3SSQA 3THTA 4X4OA 3C15A 4M5JA 2ACMA 4PCQA 4QIFA 1EIYB 2RIJA 2HAFA 5C7PA 1RUSA 1TMJA 3D5MA 3OD2A 3D67A 2V4QA 2WAQD 3DXBA 1R8BA 2HQFA 4F4KA 4Q43A 2B4UA 1F3VA 2V2VA 3MCNA 4J9KA 3J7YU 4WP3A 2IIHA 1T3OA 3HHEA 3VQTA 1TFYA 4FZVA 4IRCA 3TZYA 4UW2A 2DH7A 4EO8A 2MKYA 1VBKA 1C1CA 1IKYA 4RKUC 3HVRA 1VOMA 5KFXA 5B0CA 1FO1A 2NZCA 1RDRA 1KLMA 4XTTA 3HFZB 1LFWA 4HI2A 4A48A 5F9NA 2MY8A 3KHLA 4AYBD 3LW5C 2GNKA 3JQMA 2DR8A 1WC3A 1RTJA 2RUSA 3ZC4A 2XI3A 1S6PB 1RISA 2FB0A 2BJ3A 4HLBA 1T0TV 4AL7A 2QL9B 1HQUB 4UOCA 4M8LA 2V9WA 2Z57B 4KR0B 3GMGA 3GILA 1BXNA 2B6AB 5D4LA 2HNYA 4K2XA 3PCOB 1FRKA 2JDJA 5F41A 2RQ4A 3H5SA 3DRYA 1RHQB 4KV8A 5IQ6A 3UO0A 4LBIA 4JV2A 2HHXA 1NPPA 2GX8A 1FRMA 1DTTB 4WJBA 3NBPA 3I32A 2GGPA 1Q79A 2NSCA 5HANA 2B7BB 3N6MA 4O23A 2C3OA 5H9EK 1N88A 5A8RA 3BREA 4QCLA 4DG1B 3FBCA 1MWZA 2KKHA 2XGQA 1ZM3A 4H4MA 1PSDA 4DL3A 2CPEA 3MMJA 2EFVA 3HDSA 4CT8A 1MMNA 4RBTA 2BE2A 2VZ9A 4Z7YA 2J7WA 4LSNB 2VG7A 3CVKA 3KJFB 3JTNA 4PQAA 2XI2A 4ES2A 2XM3A 5KFRA 4PABA 4O3SA 3MM9B 4NE9C 3EGZA 2GO9A 4Y2AA 5B7WA 1JJ4A 1V5VA 4A8WA 4RX6A 1V3ZA 3FSIA 3AD7C 2M7SA 1G4CA 3D3BJ 3R5BA 3QT6A 3W5XA 3M7VA 1HPZB 1L3SA 3LP1B 1M90T 1GTEA 2VG5B 3SEOA 4LQ9A 5FLXY 2FLNA 1LXNA 3CD5A 1GH8A 1RZMA 1S6QA 3JQKA 5HLFB 1N5VA 4NCGB 4J7CA 1Q5YA 5GADU 3PR5B 2ZH8A 1NAQA 4TXSA 3MUMP 4QOTA 3MAQA 2RT3A 3CCWA 5J2PB 5KFBA 4NWBA 1G3OA 4HDHA 3KLEB 4CLFA 3KG1A 2GC8A 4CWBA 4O0IA 3PIPQ 2UUAF 2BJDA 3GP9A 5SUHA 1MROA 3MM5B 5D0RA 1IUJA 4R5PB 2CJYB 4UOGA 4ZMMA 4FVCA 4BDPA 4KO0A 3LGHA 2UUAJ 5IT9U 4P72A 2PIIA 4PEOA 2OAUA 3Q8PB 4EK2A 2BEFA 2AGQA 5LJ3Y 3UNYA 1I51B 2E1RA 1YLXA 2IA0A 1YWXA 5KFGA 3BEGB 1ZPVA 3CD7A 3R2DJ 4Y0FA 3SCKE 2QMWA 3MMCB 4NLSA 3S01A 2CPJA 3VAIA 5L9NA 5DDPC 9RUBA 1N5TA 1XIQA 4L75A 2W24A 3W9HA 1HBUB 4Y2IA 4NA3A 3J80Y 2IYGA 3OHBA 3EYZA 1NK9A 4RWXA 3SFGA 3J7Z5 4LVOP 3KOAA 2PFDA 3W5YA 1FRHA 3W62A 3JYTA 3H5XA 2RF2A 3PFOA 1VBXA 3C66A 2PGCA 3POTB 3J7A1 2JSXA 1NSQA 1FVSA 3ZZ0A 1FFSB 3MTJA 3Q8VA 4A8SA 3C16A 3EDQB 3D0IE 3EXCX 2M0GB 1YKWA 4ZVTB 1ZA2B 1X4DA 2KJWA 4A8XA 1NZ8A 1K1QA 4OLPA 1U0HB 5U47A 3RU0A 1FXRA 4DL6A 4LRDA 2FC9A 3QJPA 2AZ1A 3SQOP 4O4GA 3ILOA 2OPQA 1CBKA 1QAYA 1ULRA 3IRWP 1XN9A 2W7OA 4JI4F 3RB0A 1HNVB 4MK7A 4NLTA 2ZWOA 3H20A 2FHKA 3EUNA 3G86A 2HHSA 1JLFA 4JI4J 7FDRA 4E0DA 1M5OC 1FRXA 2KRBA 1S79A 1IJFB 5I3PA 2KYZA 4CZCA 2BE9B 2YNHB 1BWVA 2Y1RI 5K14A 1PKUA 2E66A 3KDOA 2A1BA 2XMWA 1KLNA 3BN7A 4RUAA 5KFTA 4B3OA 2KO1A 3MGJA 3A1YG 2WRMA 2KT2A 1T8EA 1U4BA 3MXHP 3M30A 2EKNA 2ZVSA 3D4JA 3OFHA 2RB7A 1YBTA 3OR2B 2FJDB 2CA9A 5LSLA 4DPXA 3WC0A 1YIJS 2B9XA 2FGOA 3MMAA 2R2UA 2OPSA 2XNQA 4OZ2A 3H7HB 1WSVA 4WBFA 1TL3A 3B82A 3CD0A 2ADCA 5CZXA 4NYOA 4GRSA 4EFAC 4DFKA 5KG1A 3DGPB 4YB1P 1XR7A 3H98A 3R5JB 1QUVA 4RW8A 1TL7A 4IRKA 4HHHA 3ZTRA 1QLNA 2DNYA 4NEZA 3P8BB 4JUZA 3KLIB 2LFVA 3K0JA 4RU2A 2CQHA 1W2BR 3UCGA 1YBAA 2EG2A 3MI7X 3D6FB 2HLTA 2DIVA 4ETZA 3MR2A 4L73A 2OI2A 3F41A 1WG4A 1XR5A 3EDRB 4B3TF 4CLWA 2W8KA 4IFVB 4URQU 3MR7A 1MN7A 2W9BB 3CJTA 3NY0A 2WB4A 4HI1A 3M2UB 2HEKA 2PMHA 4NASA 5AT1B 3TR5A 4B3TJ 2E44A 3JQJA 4DF8A 2I1RA 2BQ3A 3BQ2A 3OVAA 1RWNB 2BE7D 4C4WA 2OPRB 2B4VA 3B4MA 2XTJP 2W7AA 1R0BG 3FSXA 3VVTA 4F4ZA 2WSCC 4WWSA 4BC9A 1JLQA 2UVWA 3M6VA 1EARA 2XS7A 2H51B 4NZ6A 1X4BA 1JKHB 4B08A 3JSYA 5HQMA 1HBMB 3J7AN 2VOPA 1OIAA 1P9QC 2KFZA 3ET6A 5J2MB 4XPEA 1RA7A 3EZ5A 3A3OB 1TMMA 4ZCIA 3VAFA 3M8SA 3AQPA 1BUXA 4WTOB 4BWMA 4G1IA 2YKOA 4MFBA 4U6PA 5CYJA 2RRNA 1Q82T 2HZAA 5A8WB 2ZNYA 3BKTA 1UA1A 4NLYA 1LW0B 1S10A 1DURA 1S0VA 3AY0A 3LAMA 4DV7F 3S1TA 2ZOMA 3NGDA 2XMJA 2HURA 4ECVA 4RWWA 4DV7J 4NI2B 5F0WA 2FHMA 5EWEA 4ZVFA 3BO4A 2XSFA 3QIDA 4LF8F 2VHGA 2X7IA 3V6DA 3SMZA 3G6YA 1SKSA 4LF1A 4YS2A 4I69A 3H90A 4LF8J 1TUGB 3M8YA 2GHPA 4NLDA 4ZN3A 2AQ4A 4QIEA 5RUBA 1CJVB 1QUPA 3AODA 2QT7A 2GQCA 2W25A 1S6OA 2UZAA 1X5SA 2FZGB 2RQMA 2GZOA 3PW2A 1WC6A 3CJ8A 1SVDA 2XY7A 2V8GA 3M1VB 2YNGB 4WYWA 1TR0A 3IXQA 1R6YA 3DOLB 1IN0A 1U8SA 5J1PA 4LRFA 5A8KA 3BBBA 1S1XA 1CULA 1F2HA 2BRLA 2FDNA 3H4DA 3RUBL 1SL1A 3TZWA 4I6YA 1CJUB 2KXHA 1NHVA 1NKEA 4RUHA 1KVJA 3Q8QB 2EEYA 2V50A 4ES3A 1X5PA 3SCLE 1D8ZA 3WQPA 2YKNA 4OHWA 2BMBA 4KYZA 1RAJA 2HHTA 4DCJB 3M8WA 3MPWA 2N3OA 3I6PA 1JNZB 3MM7B 1D9FA 3V6KA 1S57A 2H5EA 2MSSA 1RWVB 1L3UA 4KGXB 5C25B 3UR0A 4KQZA 3I55S 2UU9J 4ER8A 3IRXB 2A3JA 4P7VA 2XCAA 3AJ2A 1NKCA 2FPHX 1NJWA 4IR9A 1NSAA 1P1TA 1GMWA 2KN4A 1HMVB 2FJEB 2ACYA 5IQQA 2W2QP 2HVZA 4F36A 2GHVC 2H48B 1KQSR 1O51A 3CXCR 4LF4F 1OY8A 1RT3B 3GPAA 2ZBRA 1JLEB 2C28A 2DIUA 4IH6A 1T03B 3BGFA 2RQCA 4XDDA 4LF4J 2CQPA 2UUCF 3JAMU 4LMZA 2CPFA 4G1PA 1C0TA 5DS7A 2V8PA 1DZ5A 1S49A 2UUCJ 2AJ4A 3MOJB 5F8JA 4DFPA 1S4EA 2ZDPA 4KHMA 4PQUB 2IM1A 5GAHU 1QY7A 3NAHA 3UI3A 2FTRA 4URSA 3NGRA 1IBMF 3M2RA 2QZ8A 3BBCA 4ZVPB 1N33F 3G6VA 1TUVA 3CC7S 2BW2A 1FWLA 5IV3A 1IBMJ 5DETA 1N33J 3PHTA 1O6XA 3BPDA 2FHJD 2CQDA 1X4GA 1CEZA 2GW8A 2DITA 2OTLS 8AT1B 2EFGA 2IYIA 1E6YB 5BJRA 5KT5A 5H9FK 3BPSP 2ZKUA 2YKMA 2HVIA 1U2RA 2VU5A 5KFNA 4KGZB 1IKXB 4NRUA 3KG4A 4X4VA 3Q89A 5EWGA 3B4DA 3CJ4A 2R7XA 3I5CA 1XMQF 3HT0A 3M8QB 4IH7A 1S77D 2KDOA 3QSIA 3PX0A 3TQ1A 1KOOA 3FFIB 2Z2MA 4USHA 1TV6B 4HH0A 4FF2A 5DQGA 1XMQJ 3DRRA 2F8EX 3CE8A 2C2NA 4NYZA 5KFUA 5CXTA 4FNIA 2DB1A 1AB8A 2MPUA 3E01A 2KT5A 3PX4A 1YRXA 4C0OC 2VODA 2OSRA 4N8NA 2Y1JA 4ZCMA 4K4SA 4Q5VA 4I4BA 1X7VA 2W8LA 2XMVA 4DUTA 2C3MA 4M5DA 2RU3A 1JK9B 2UXBF 4PXDA 5D15A 2HMIA 4LF2A 4DV3F 4QW8A 3M8RA 3OFEA 5AXMA 3C14B 5CA5A 2UXBJ 4R8UA 1U8WA 2ZEJA 4JI8F 2I0XA 4PRFA 2HRUA 3E51A 4TYBA 3MR6A 4DV3J 5KFVA 4TQSA 4DV1F 1VBZA 2AJFE 1FDAA 5A0YA 4JI8J 1YJTA 4AL6A 3OJSA 3TA0A 3HVAA 4DV1J 2UVRA 5DQIA 2R8IA 2Y8WA 2XBPA 3KJVA 3ITHA 3CDEA 2WW4A 4J90A 3NEKA 1CJTB 5AXLA 4EBDA 3O2IA 1WI8A 2R7WA 3C15B 3AA8A 1XJWB 3TJ9A 4F0KA 2NR0A 2PA8D 5ETPA 4OHZA 4K4XA 1RHKB 2IRXA 1FK9A 5DG9A 3GU0A 1FDDA 4EO6A 4DV6F 5ETMA 1RWPB 5HMXA 2R7TA 1L3KA 2XYGB 5J1NA 3R5AA 1JLAA 2E5IA 4YQWA 3MZIA 3V6JA 4NLQA 2IY5B 4DV6J 4PAAA 1S59A 4Y28C 1JNRB 3CDWA 5G0RA 1Y5NB 3HSJA 2NPFA 2R2TA 1C1CB 2Z2YB 5LXRA
chains in the Genus database with same CATH topology
2YNGA 3MFHA 5F8LA 4LF7F 3G96A 3HM9A 5KG4A 4EYHB 2JX2A 4RW4B 4QPXA 2UVUA 2JZ5A 2MKHA 1GQEA 2L3MA 2O67A 3DOLA 2DNMA 1KLMB 3Q2SC 4PG4A 5JUMA 4FF3A 1BWEA 3OR1A 4DN0A 3IG1A 1RYRA 2GMLA 2LKZA 4XIUA 1ZTTA 5D4PA 5T14A 1X4AA 3MUVP 1YTYA 2EK6A 1M5PC 2YX7A 4YUDA 2GV1A 2YNIB 3PO4A 5KFYA 1UVLA 5DQHA 2ZH5A 2XWXA 1UJ5A 1UVNA 2PI4A 1U45A 4F67A 4QZVB 5KFWA 1Y3JA 1SUQA 5B0GA 1BY9A 1FVQA 4DSKA 2FVQA 2FY1A 1K8AT 3FNNA 1X9MA 3FRZA 5CZVA 1JLCB 5KG3A 1IBLF 1GAOA 1RTJB 3MD3A 5LXYA 2GMHA 4Y2CA 2MKIA 1QSYA 4OV1A 4EWTA 3CGIA 3UDCA 1VQOS 2W9CB 4XPCA 4L72B 3RAMA 1QTMA 5L1LA 4NLUA 4MIAA 3BQ0A 3QWUA 1U1KA 2JEJA 3TA2A 4U7CA 3HZGA 2GQ2A 2CQGA 2EVZA 2R7OA 4ZPAA 1UFWA 4EZ9A 4HKQA 3UDLA 2DR9A 2M52A 4WFAQ 4O3PA 3HP6A 1KHVA 3LP2B 4TKTA 2E1CA 4PXEA 1SI9A 4J37A 3OL9A 4K5SA 2D3OR 3UQSA 4MYTA 2HGLA 2NYIA 6FD1A 4RNHA 3CUNA 2VC1A 2ZBIA 2ZH2A 2HNYB 1RGVA 3MEGA 2ABYA 4ELVA 4LQ3A 4PPDA 4I2QB 4YR2A 4CH1A 1SL2A 2JEGA 3MEEB 4XK8C 3PY8A 1VJWA 4DL5A 3CCZA 2FIUA 4KV8B 3N28A 2W9AA 2HFZA 5LMNF 1Q78A 2WBRA 4QYZJ 3RAQA 4EBCA 4LT6A 2JLGA 1YRTA 2AYEA 3W2WB 2W7PA 3PEHA 3PZPA 1OO0B 2LXFA 3DMJA 3NBPB 1HL6A 2GGPB 4C0HA 2M2BA 1XMOF 4I1TA 3WC2A 3C8YA 2FUG9 3GG1A 1E6VB 2R7VA 3OTCA 5IWAF 4Y00A 2N7CA 1UVJA 1FE4A 5I42A 2WW8A 1DTQA 5C25A 4NL5A 2KXNB 5J2NA 3PVXA 4RW6A 4QIWD 4DOZA 2ZITA 3IAS9 3IGVA 3NWGA 1MU2B 3IRXA 5A8RB 3HMJG 3K2YA 2CPIA 4JI0F 1O0PA 1SJ3P 1K0VA 1UP1A 2QFJA 1U2FA 1UVMA 1BC6A 2F3JA 1F5AA 3JTPA 1U6FA 3PHEA 2FLLA 2VKRA 1AROP 1FTRA 1LWEB 3X3UA 1J5EF 2CQIA 3DOKB 4CTAB 4H4MB 2WONA 3C6TB 4P6QA 1FDBA 4ECZA 4ED1A 1GT8A 2H9ZA 2HYIB 1HMVA 1Q7LB 1TKDA 2XO7A 1WG1A 2HVHA 3GV7B 2D1CA 4KGKA 4WIIA 5FD1A 1F60B 2Z0GA 5E3RA 2LQ9A 5A6WA 1U7LA 1RT3A 2X1GA 1XTZA 3BM7A 1TKTB 4U67Q 2BE2B 2OMLA 2DGVA 4ALZA 3C2PA 1VK3A 2ILYA 1JJHA 2YKAA 1KD1T 1JLEA 1M5VC 4QU7A 2ZZMA 1HW9A 2MDAA 2VG7B 3FZ2A 4HDGA 2L41A 3T5HA 3CTRA 1R8HA 4OX9F 3K5PA 1T03A 1CC7A 3A8EA 3I4HX 2KTQA 4TY8B 1Y00A 1C1BB 2C22A 1TVRB 1DFDA 2ZJPQ 4FF1A 2DRBA 3FRYA 4DR4F 1OQ6A 3NCPA 3UWTA 1WEXA 1N56A 3L7OA 3HJFA 2G0CA 4A8KA 1KTQA 5KT4A 1HA1A 1NEEA 1TK5A 1D9AA 1VQ6S 1S9GA 3PKYA 5J2QA 2JEFA 1YJRA 2LXIA 3QO9A 3F44A 2J7KA 2IVFB 2BR0A 4J5OA 4ED3A 2HHUA 3NAIA 3PRDA 2MJUA 1FE0A 1QAXA 2BV3A 2W4DA 2N7YA 1SKRA 2R8GA 2HHPA 4QWEA 3RR8A 1ELOA 3TO8A 1KTVA 3BJYA 2G4BA 1ZH5A 1NU4A 3AB4B 4FXWA 2L08A 3N79A 1LW2A 2MKKA 5GAHI 3TARA 4OFZA 5KFOA 4WXWA 4PQUA 1ZAWA 2MJNA 3BSAA 4M94A 1ZAXA 2DISA 5T41A 3TUIC 3D0GE 1WELA 4Y6IA 2ATLA 3RW6A 3Q8RB 5HMZA 3ULHA 5DG7A 2GJ2A 4OX8A 3O1LA 4OZNA 2DTJA 5GMKa 1D8YA 5CYQB 2B3TB 4IDKB 3T5JA 4JI5F 2CQBA 3SFUA 1P6TA 4IOAQ 2KT3A 1LQ9A 3IC1A 4F2SA 4ZHRA 2DNKA 1NJIT 2XY5A 3M32A 4R25A 1QJHA 1O5JA 1S6QB 3QPIA 4F2RA 1FJCA 4C97A 1KEKA 2FVSA 3MOZA 5AXNA 5F9LA 2E1MC 2IM2A 3MMBA 5DRKA 3NP5A 4KGMA 2MZJA 1NH8A 1WG5A 2F9DA 2HZCA 3W2VB 4A46A 5HN0A 4ZDNA 1RT5A 2YWHA 3TVZA 4TQRA 3QAEA 3P5TL 2B9YA 4J9OA 4AQYF 2Y0SD 2K3KA 2A2DA 4ILLA 5FJ4A 5IT4A 1WEYA 1LFPA 4Y65A 2OD4A 2YY3A 4C98A 1KHWA 1S9EB 4Q45A 3OPKA 2AP6A 4LVNP 3T5LA 1FJGF 2RE1A 1B0VA 2A18A 4B9NA 3I56S 2ZE2A 1A6LA 2FJWA 4DFMA 1YI2S 1UJ4A 2GIRA 2MQQA 2XS2A 4Q0BA 4DR6F 2V9KA 1E6YA 4J9PA 2XULA 1NK0A 3HHLB 1F5CA 2M70A 2NREA 1P8GA 2V0NA 3MM6B 4P2SA 3OUYB 3PW4A 1IBKF 3JSMA 4I2PA 2J8AA 5HP1B 5A2QY 4HH1A 2QA4S 2VBZA 4ED2A 4B3RF 1Q4RA 2JOQA 5CD4H 1G2EA 2I5JA 3MEDB 4K4ZA 1ZAVA 2CPXA 3DLLQ 2KHDA 3OTBA 3I31A 4G1QB 1MROB 1IKXA 2IJNA 4AFFA 1S6UA 3DHWC 3IAM9 1RTIB 4RBVA 1XERA 2I9SA 2VQEF 3T9NA 1TKXB 3K57A 3NNHA 3R27A 3FQKA 5E7OB 4KO0B 2HNZB 3CEDA 4CCHA 1EETB 1H2UX 2HWHA 2HGMA 3JB9k 1JXLA 2VFTA 3QIPA 3M8QA 3MURP 1VQMS 2HHHF 4DLEA 2J7UA 4FXDA 4YP3A 4KPYA 4PXCA 2RS8A 4YY3F 4YOEA 1BQNB 2F7VA 2ZZNA 3ICLA 1M5KC 2E5HA 2GQQA 3N4WA 2B5JA 2ZD1A 1CVJA 4M1KA 2AU0A 3FFIA 1VFJA 3H2LA 2VV5A 5F8NA 1Y4ZB 3MM8A 4I67A 5EX0A 2HNDA 4DSJA 1TV6A 5HBMA 3GR1A 2ASDA 4NLRA 4OJGA 1HD1A 1RTDB 2R7RA 1WEZA 3LANA 3TUJC 2DPIA 4B9SA 2VL1A 3ISZA 5AE3A 2ALZA 1N5YB 1N5QA 1SIWB 1J5OA 1KVIA 1RJJA 2HPUA 2RVJA 3OHAA 1IXKA 3BR8A 2LEBA 4B9TA 2K1RA 1FCAA 1RT4A 4DFJA 1HR0F 1T95A 2RKIB 1SC6A 3M05A 4MYUA 2UV8A 4KFBB 3CCJS 1U09A 1MWYA 1ZPWX 4YDDB 2OKQA 2CQ4A 1SJQA 3HLUA 3M6WA 4KAIA 4ZKAA 3BSCA 1VQ7S 1VQPS 3FEXB 4UY85 3L95X 4B9LA 1VGYA 2GFFA 2MGZB 2DBBA 5KOWA 3Q24A 4EUVA 4X4UA 4G6VB 3THPA 3DLGA 3AQOA 3GG0A 1XBWA 2CIMA 4DV4F 2CZVC 4DSLA 3KK1A 4AXIA 3IO1A 1YQHA 1LWCA 2ROPA 1IQZA 3MWBA 5D4NA 4C8MA 4DR2F 1HBOA 4O44B 1NK7A 3DRSB 2N4CA 4TU7A 4C3LA 1S4FA 4Q0BB 2IC3B 1YVFA 3GR0A 2U1AA 4I68A 3JYTB 4Y2MA 5ITHA 3GFYA 2ZDOA 1NRKA 2XLKA 3D1QA 1GXTA 3PV8A 1VQ9S 4OJ3A 2VA2A 1ZOTA 2RF2B 3BSOA 4KHPF 1UEVA 2OFHX 2XMTA 1T3NA 2O66A 2KU7A 2B4PA 3ENWA 4ELUA 3E3XA 3IS9B 4MKAA 2EFPA 3NS5A 2KFNA 4YR3A 2MZRA 1DQ9A 1HNIA 5MAOA 5L1IA 1UWBA 1VMBA 2AYMA 4I7FB 1U1OA 2RD5C 2WOMB 5T7LA 1X9SA 2IVYA 1DQ8A 4JBCA 3CDBA 1VQ8S 1N0UA 4C8KA 3VAGA 2DCUB 3DRPB 4HT5A 1Y9OA 3ETOA 3HVTA 2OP5A 3HHDA 2GA7A 1OS5A 2MB0B 4ZPWR 3OV7A 3OXLA 2CJAA 4X62F 4ID8A 1CSJA 3FEZA 4I6WA 3I96A 1VIOA 1TKZA 2IVMA 1RT1A 2P9GA 3H5YA 3UPFA 2KH9A 2ZNZA 4Q7AA 2Z4PA 3OFGA 3TNVA 1U47A 5L9XA 2M3DA 4JI6F 2FGCA 1EP4A 4NOHA 3DYAA 4PG5A 1B0TA 5M2RA 2MSTA 3ISNC 3TOQA 2FVRA 2ZC3A 3MFIA 4HTJA 4WE1B 1NZAA 1IKWA 3DXSX 3NLCA 2MQPA 4MKBA 1RKIA 3KLHA 1FKOB 3OSPA 1JLBB 4ZA1A 4B02A 4KT0C 3ISND 4L6V3 3HO1A 5J1EA 2AGPA 1RTHA 3SCIE 3WDOA 2ILZA 3TP2A 4O4GB 2F8MA 3M9NB 2YWKA 3K58A 3I0SB 5F8GA 4LF6F 3H59A 3SSQA 5KT6A 2OPQB 1DLOB 4OHXA 4Q2LA 4QWDA 3K5LA 1WHYA 3THTA 3KLGA 3CJ3A 4X4OA 4O3OA 2LMIA 4JI3F 1VQ5S 4PCQA 4C7QA 4QIFA 4DSEA 1ROFA 5CQGA 2RIJA 2VFRA 2FHJA 1KQFB 1U1MA 2VFVA 2MQLA 4NA1A 2KFYA 1BGXT 3SDEA 1S72S 3VAKA 3D5MA 2YNFB 2XSJB 1JLFB 4LF9F 2BJEA 5KG7A 2HFNA 2V4QA 3QJLA 1C2PA 2WAQD 3DXBA 4QPTA 1R8BA 2OD6A 2XGPA 4F4KA 1R8CA 4Q43A 3EXYA 3TANA 4OHVA 4CH0S 2B4UA 4CO4A 2CG4A 4J9KA 5KT2A 3J7YU 4U9RA 3CB4A 5GAEU 3D54A 1QE1B 4OIXA 1T3OA 3KK3B 2AX1A 2A2CA 3HHEA 4HL9A 3VQTA 3QLHB 1S0VA 3SQGA 2NS1B 3HZEA 1TFYA 1RT2B 1H2TZ 2E1AA 4FZVA 4IRCA 2WB1D 3KLFA 1ZM4A 4UW2A 5K14B 4F8RA 3CIMA 3UNGC 3LP0A 1QVFR 2DH7A 2DHSA 4DR7F 4EO8A 1H7WA 4L3NA 4X65F 2E9TA 1Y5IB 1C1CA 3HKZD 1IKYA 4RKUC 2KG0A 3HVRA 2MKJA 4F02A 1VOMA 2CPDA 5KFXA 5JJBA 1XC9A 4GKKF 4TYAA 1FO1A 2WBMA 3LQVA 3ZZOA 3T1AA 5B0CA 1WTBA 4RW4A 1RDRA 1P27B 4GC7A 2KI2A 5KG2A 1KLMA 1VQNS 4K4YA 3IWXA 1ZM2A 1R8PA 3C3LA 2CPYA 2MQNA 3H8YA 3NCRA 4MJKA 5KFQA 1LFWA 2LXUA 4HI2A 3M30B 4A48A 5F9NA 2AYBA 2MY8A 3NNCA 2YNIA 4NYPA 3KHLA 2EFOA 4AYBD 4UY8T 3UE2A 2BANB 3CJ0A 3D0HE 3HI9A 5D77A 3LW5C 2GNKA 2IAJB 1D1UA 3BB5A 4X2BA 2B51A 4JV5F 2DR8A 4LF5F 4GO7X 4RNOA 3UR3C 1N48A 2J0QD 1JLCA 1FNOA 3FVYA 3L09A 5A6PA 2AD9A 1RTJA 2LEPA 2EFNA 3GE9A 4WTYA 5I3UB 1WHXA 3ZC4A 2XI3A 3GFZA 1S6PB 3DLJA 4JV0A 5KG5A 2W9CA 4KKOB 2CQ1A 2P9EA 1FXDA 4IO1A 1RISA 2FB0A 5B0AA 3MMAB 2X1BA 2R7QA 4HLBA 2OH2A 2OPSB 4AL7A 2E29A 4X66F 2R8KA 3OTOF 4DN9A 3OTEA 2BBEA 2JWNA 1HQUB 3FJ2A 2J9DE 3LP2A 2O3DA 1TL3B 3VZIA 4AE5A 2J9EA 2XWYA 3MR3A 4UOCA 4M8LA 1JJ2R 2V9WA 1DBDA 2CZ4A 3TRGA 1SXLA 3GMGA 4KR0B 3GILA 3DLBA 4XO0A 2B6AB 4WU2A 5D4LA 2FJXA 4YMEA 2HNYA 1ZM9A 1Y0HA 4K2XA 1U1RA 1FRKA 4FN5A 2JDJA 5F41A 2RQ4A 4R0EA 4I2QA 2LCWA 3H5SA 3MEEA 3DRYA 4ECTA 5BR8F 4QWCA 4ED0A 4RW8B 4KV8A 2G9OA 4DPOA 2LEAA 1SJRA 5IQ6A 1T05B 4JYAF 3RAXA 2XHWA 4JV2A 3W2WA 3I5BA 2K2PA 3LPYA 2HHXA 2GX8A 3TA1A 2BQRA 1FRMA 1DTTB 2EW9A 4WJBA 3I32A 2GGPA 2XMUA 1Q79A 1TP7A 1UL3A 2NSCA 2CKWA 3NBPA 4B17A 2B7BB 3GIMA 4QIVA 2XC9A 3N6MA 5M2PA 1E6VA 1F5BA 3CCSS 4DR5F 2DH9A 1FEHA 4DWIA 4ECXA 5KFKA 1OQ3A 2Y1IA 1U1LA 4O23A 5E2QA 2C3OA 1M0SA 4EYIB 1N88A 1MU2A 5A8RA 1RT6B 3BREA 3PKMA 4QCLA 1IM4A 4DG1B 1MWZA 2M88A 4ECSA 2WHOA 3ZZZA 4A47A 2KKHA 1JLGB 2IJFA 3PDNA 5H9FJ 2XGQA 4J9SA 2DR5A 1DQAA 1Q16B 1LWEA 2V5HG 4DEZA 4Q8FA 1ZM3A 3DOKA 4CTAA 4DLGA 1I94F 3HXMA 4H4MA 1OPIA 2M8DB 3C6TA 3VQSA 1X5TA 4GC6A 2HHQA 1PSDA 4YDXA 4MH8A 4X4NA 2X3GA 4DL3A 2CPEA 2YWGA 3FMBA 3EPGA 4UUXA 7FD1A 5E5NA 3MF5A 4MAKA 3PX6A 1N6QB 4Y2KA 1SV5B 3MMJA 2EFVA 3HDSA 4FS2A 3P49B 5IT9Y 4CT8A 1D9DA 1MMNA 1VLYA 4X64F 5L1JA 4RBTA 1HWIA 1TKTA 2WSEC 3NG8A 2BE2A 1CPZA 2VZ9A 1IJEB 1HI0P 2J7WA 4LSNB 3Q0AA 2UUBF 2VG7A 3QMQA 1SIZA 4O3NA 2XB2D 4UQGA 3CJKB 1MMDA 5KFMA 3CVKA 2KM8C 2J0WA 3JTNA 4PQAA 4N41A 2XI2A 4TY8A 4DQSA 2Q66A 4DL4A 1C1BA 4CO2A 4ES2A 1TVRA 1V3RA 3N6NA 5KFRA 3G9CA 3PIOQ 2ZH3A 2OFGX 3DRXA 4MK9A 5K8PA 3HF5A 3SCJE 5LMUF 4O3SA 2NLWA 3MM9B 4CO0A 4BWJA 3EGZA 4J9LA 2GO9A 4Y2AA 4QR2A 4YB5A 3DLKB 1C4AA 5B7WA 2J5AA 3TAPA 2DGQA 1VRUB 3N9UC 2E9RX 1JJ4A 2IM0A 2P6SA 1BQMB 2APOA 4A8WA 3PW7A 4RX6A 3X1LB 1V3ZA 3FSIA 4WKRA 2M7SA 4OI3A 2ASJA 3R5BA 3GV5B 5F8MA 4ELTA 2I38A 1S1WB 1JLQB 2J9CA 3L7PA 4TY9A 2X51A 2IM3A 4OZ5A 5DO2A 4I56A 2LQBA 2P6TA 3U1LA 3T9ZA 3ZZYA 1M1KT