2QMUB

Structure of an archaeal heterotrimeric initiation factor 2 reveals a nucleotide state between the gtp and the gdp states
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
93
structure length
93
Chain Sequence
MRKVKMSGLITVRTNEPLGVEKIKEVISKALENIEQDYESLLNIKIYTIGAPRYRVDVVGTNPKEASEALNQIISNLIKIGKEENVDISVVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 gamma subunit
publication title Structure of an archaeal heterotrimeric initiation factor 2 reveals a nucleotide state between the GTP and the GDP states.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 20
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2007-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1130 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits EIF_2_alpha 2qmuB00
3J81j 3CW2C 1YZ7A 3QSYB 2QN6B 2QMUB 2AHOB 1YZ6A 1Q8KA
chains in the Genus database with same CATH superfamily
2C2DA 3HVTA 4K2XA 3RR8A 2A18A 2YX1A 2GZOA 1T03A 4C98A 2OH2A 5B09A 2XYPB 1S4EA 1NJZA 3MFHA 3NCPA 2K1RB 5DDPC 2WOMA 4ES2A 1HD0A 4CH7A 2CYYA 1EJ7L 4AUKA 4DV7J 3BR8A 4DS4A 2E9RX 4DL2A 2BACA 3N6LA 5CCLA 2YWHA 3RAMA 2FTRA 4QR2A 2BJ3A 5B0FA 5DJBA 4V1Ak 2VD3A 4X62J 2DY9A 2CPDA 2SXLA 3EGNA 3PW0A 2R8KA 3KNAA 1S6PA 3PKMA 4IDKA 4JOUA 1S6QB 3IO1A 1ZPWX 3OVAA 4DV1J 4P74A 5ETVA 2K3KA 4QPXA 1K1SA 1FRLA 1FRKA 1IVZA 2RQCA 1D9FA 2QL5B 2CQGA 3PVXA 3IR7B 3W1YC 2XS5A 3MECB 1R0CB 3G6ES 2CZ4A 1ZM9A 1B7FA 4B9MA 1N0UA 2AV5A 4B3TJ 3FSYA 4KRWA 3GCXP 1T3NA 1A7GE 1OJ4A 1PYTA 3BSAA 3QZ8A 4JI4J 2CIMA 2HURA 1NPRA 4F8RA 3OJSA 2ATLA 4F4ZA 2HNYA 2J9CA 1B0VA 4F04B 3FK4A 3EVOA 2FJXA 2KG0A 2CPEA 3MEEA 1TKXA 3KJVB 3L7OA 3G2XA 1LK5A 4OI1A 1GH8A 3JTPA 1D8YA 3NNAA 3K89A 2FD2A 1L3KA 5EGYA 3BB5A 3V4IB 1RTHB 1FRXA 4ZN3A 2XLIA 1E6YA 1IBLJ 2FZCB 5C2GA 4MK9A 4AE5A 3GJQB 2EW9A 1CJVA 1D1UA 2RAQA 2RS8A 5LSOA 5L1LA 4WWSA 3VCDA 2UVVA 1Q16B 4KYZA 3VWSA 4DBQA 1H7XA 3IC1A 1X4AA 1H73A 1NH7A 5DDRC 2NXCA 2D69A 3NCQA 1HNZF 1UEVA 4YP3A 3GSIA 2VPWB 3KLGA 1RAGB 5A6PA 3FBFA 1ULRA 1FVSA 5B08A 5C42B 3T1AA 4TLQA 4E2FB 4CO2A 4ENOA 1FX4A 2IJRA 3CCES 3H2VE 1FNXH 1YIJS 1FT8A 1FKOA 1XNRF 3MPYA 3M30B 2P5VA 4Q2LA 2JC1A 2CJYB 1Y5IB 3M8YA 4GMKA 1PAEX 3K5PA 2IDLA 5A2QU 4IYQA 4OYMA 1D9DA 3GYXB 3GONA 3DRRB 4LSNB 4ELTA 5GVQA 2IVMA 1W26A 3MOZA 1GXLA 1S1XB 1R89A 3MMBB 3G9CA 2WTFA 1CJKB 4IG3B 2PA8D 1FVQA 3CJQA 2CDQA 5DDQC 2WVEA 1JIHA 4RNOA 2P2CB 4H4MA 3TP2A 2A2CA 2GIQA 2DRBA 2RT3A 5HL7Q 4M5LA 1B99A 2VKRA 3BYRA 3QGGA 2M70A 3R3TA 1W2IA 3GIRA 2NSCA 2G9OA 1UFLA 2LDYA 3VVUA 4PRFA 1GNKA 1S1UA 2QLFB 2XSFA 3CMQA 3DRSB 3IGNA 2JH3A 1RT7A 1X9MA 4ED2A 2RRBA 4TLRA 2E66A 4BLGA 2KFNA 5ETOA 4DQSA 2UV8A 3MMCB 5EX0A 2LQ9A 1CS4A 3A3NB 3J80U 3ZZPA 1T3OA 3CPWR 2ATCB 4FXDA 2XHCA 2CUYA 2H3EB 2IC3B 1HLWA 1WELA 1QVGR 4PG5A 3HHDA 2DRDA 2B8PA 2GO8A 4OMFG 3KUHA 5BJRA 2GS8A 4M5DB 2ZKTA 2HS3A 4ICLA 1X7VA 2DT9A 3IRXB 1RT2B 5KOWA 2XMKA 4RW8A 3CC2S 3CMAS 5JVGQ 1VQLS 4QU6A 2JLEA 1B3TA 1RHRB 1T9XA 1S1VA 1NSKL 2ASDA 4RBVA 4A8QA 1ICEB 4XTTA 1PC4A 2BANB 4DDFA 1HNZJ 4WJBA 4K4WA 4DR1F 1TR0A 3MM6A 5LMUF 4EU0A 4LT6A 4K50A 1QSSA 2Q66A 3EZUA 2XWXA 3MD1A 2CWKA 3MURP 3DN9A 1N5YA 3EZ5A 1XNRJ 4JI1J 1R8PA 1GMWD 3NOGA 4M8LA 4K0KF 4LUBA 2OFHX 5EWEA 4KGMA 1WHWA 5J1PA 1S6OA 2KRRA 1JLBA 3NCRA 4JI8J 1F6TA 3VF0B 1I1GA 2F65A 1N5VA 4MMOA 4B17A 3VGSA 2RF2B 2RHSB 4EBDA 3GIKA 2XMTA 3C8YA 1NKEA 3M6XA 3KXDA 2LEBA 3I5AA 3OUYA 2HVEA 2CQ3A 4O3QA 3DM2A 3G86A 2XMWA 2PFFB 3DMJB 1QY7A 2O5DA 1TVRA 3KMSA 3CSKA 2HFSA 3ZZOA 4X4VA 2VPZB 2ZH8A 3RAXA 1X0FA 4WBFA 4L73A 3RBXA 4FZVA 2R7UA 5F0UA 3M05A 2F8EX 1S59A 2F40A 1HNVB 4X64F 1W7WA 1TUWA 3MUMP 3ENQA 5M2PA 5AE1A 5IQ6A 3BH6B 2QLWA 1P1LA 5KOXA 2BABA 4MIBA 2H1YA 2KFZA 3RBEA 3UO0A 2V5HG 2IFXA 1U0SA 1L3UA 3OFHA 2MB0B 2FGCA 3ILOA 3DCAA 1N33J 4N76A 4U96A 1WOSA 5E2QA 2D3ZA 2QGFB 2G0JA 3DXBA 2NYIA 2HVZA 2AX0A 4ZPTR 1BXNA 2CNKB 3PCOB 3SCIE 4KB7A 1HBNB 2P9GA 2QZ8A 1S0MA 5G0RA 1C1BA 3TO8A 3UCUP 5B0CA 3KLEB 3SCLE 3AAWB 3DFEA 4PZVA 2C2OB 3JQMA 4PQAA 3CCUS 3BO4A 4ZMMA 8RUCA 2PT0A 1NKBA 5HN0A 2BMBA 3HVAA 1S10A 3MM7A 1NNDA 4PQUB 2FLLA 2XTJP 5LJ3Y 4EEYA 3HFVA 1Q7LB 1NDLA 4ZVUB 5FLXU 1YJ7A 3ZO7A 1PGZA 3TEGA 2GMLA 2CVEA 4DR1J 2MKIA 1WI8A 5K8NA 2BV3A 1AUSL 2BE2B 2DR8A 4X84A 2XEXA 2HHUA 3OD2A 2CADA 4NMXA 5CZXA 4J5OA 3I56S 4WP3A 1NPKA 3MUVP 2OPPB 2R8GA 3VHQA 2H9ZA 2E9ZA 2JVOA 1RJJA 3OFGA 1U4BA 2A2DA 2HHSA 4NYPA 3M4XA 3BJYA 4NZ7A 5MAOA 4B9UA 2WHOA 4IOCQ 1VHIA 4QOTA 4XPCA 2FIUA 1G7CB 1FD2A 3TOQA 3QGHA 4I0WA 3C16A 2GQQA 5AXNA 3TA0A 5KG5A 3L9ZA 1Y3KA 4WFZA 4DHVA 1RT5A 4WFNQ 2RDJA 4ZP6A 4R5PA 6FDRA 4FP9A 3DDKA 4KAIA 2OPQB 5KG3A 5A0YA 3QRQA 5ITHA 4FPRA 2J9DA 1U2RA 1FDDA 5KFAA 5DS7A 2BKNA 2VUGA 2EPIA 2AJFE 1F60B 1SV5A 1U1PA 3C15B 1HBMB 4HYKA 2UU9F 2FLOA 4LRFA 1RWOB 4QWEA 3M8QB 2AGOA 4YHHF 1U24A 2ZEJA 3PRVA 2LEAA 4QWBA 1XMOF 4DCPB 2EEYA 1ZM4A 5L39A 4KV8A 2EWHA 4FVMA 3RYLA 1NB2A 2LQJA 1KTQA 1CSJA 2G1HA 4UF4A 1WTFA 2UVRA 3DHXA 1D0EA 5DRKA 4L3NA 4ED6A 3R7SB 3I5CA 3PO4A 2VPYB 3HHLA 3R5CA 1SH2A 2YQ3A 4IRKA 2DNGA 2F4VF 4ZPBA 2HHHF 2JL9A 1TAUA 2JEFA 5B0EA 2PI5A 2X51A 1WC4A 4ZP7A 4PUOA 1IKVB 4LSLA 3JTNA 2Z2ZA 1C0UB 2JOQA 4Q5VA 1NAQA 4OJ3A 3EYZA 2W9CA 3KLFA 1FO1A 4F0KA 1OQ3A 1R0AA 2BQ3A 3G96A 4ZIVA 3MCMA 4P2SA 4MTPA 1WSRA 2WVBA 2AYEA 1SI9A 5KFGA 4C8YA 1F9EB 2GAGC 2VDHA 1AW0A 1XTZA 3PACA 2IHR1 2D3UA 4TNOA 3CULA 1DURA 1RT3B 1RBOB 1RHKB 2BYCA 5K14A 5C25A 2DR9A 3DYAB 4LSZB 3H4BA 4I6AA 1CJTA 2GMHA 4LRAA 4EO6A 1TKZB 2IM3A 4KH1B 1H3DA 2MQOA 1TL7B 1S48A 2ZOFA 5BYSA 1Q8IA 4NI2B 5B0AA 5DO2A 3B78A 4EZ9A 4DUYF 1VQSA 3EGVA 1FFGB 3HJVA 3R7NB 3TEHB 3RB4A 3QBCA 2QLXA 2YNIB 2DNMA 4KIAA 3W7BA 3A8KA 1RE1B 1LWCB 3RBZA 2MZRA 2FJWA 4ELUA 4LF7F 6FD1A 3LP1A 2UU9J 3K57A 1G6BA 1RA6A 3ZZUA 1GTHA 3OTDA 3EZOA 2VFTA 3CCWA 1MSWD 5J2NB 4YHHJ 4MT1A 3J7YI 3ZNJ1 3D54A 3FDSA 1R0BG 1XMOJ 2OSRA 4NLPA 1VQ5S 2FC8A 2MSSA 2YX4A 4Z7CA 3U02A 4IFVB 1UETA 3UCZP 4I1TA 3J7AN 1S9GB 4X66J 3HT3A 5I42A 2V0NA 1UEUA 4ED7A 3M9MB 2OO4A 2FPHX 3OL6A 2K7KA 3GLJA 1TUGB 4ZJOA 4WIQA 4MJKA 1SXLA 4W92B 3KLIA 3CJ2A 5CAAA 2F4VJ 2HHHJ 3EGZA 1HNWF 4QWAA 4UY8T 1ZM2A 2CAJA 3K5LA 3L4BC 4X4SA 2OPRA 2JEIA 3R5AA 2RRAA 4H4KC 4IUFA 2YX7A 4RW7B 1PO6A 2LU1A 2YKNB 1KFDA 2O1PA 1WOPA 2MGZA 3CF5Q 4ZVRB 2UUCF 5HROA 2CNNB 2ZHBA 2PA3A 1M5PC 3N5BA 4ILLA 2IYIA 3LPYA 3QQCD 2YTCA 3UN5A 2XHWA 4CO4A 2HFVA 2DHGA 1CULA 1FWPA 3OTBA 5LXRA 1RADB 4LVNP 3T1YJ 3OXLA 2Y8YA 4ED1A 1YITS 4LF6F 4AXIA 3ET6A 1PSDA 3BGRA 2NPIA 3KG4A 1LWFA 4Q8FA 3BKUA 2J0WA 3E51A 3RG6A 3LGMA 2FLNA 1AUDA 1N54B 3LO3A 4I68A 1S7HA 3FEYB 1V6HA 4O3SA 1S6QA 4WCEQ 3JTOA 1UAWA 3W62A 4PG7A 4DUYJ 1MMLA 4OFZA 2IVFB 4JV0A 3QIDA 4ZCIA 2AP6A 2J76E 3QLHB 1RLCL 4Q8EA 7FD1A 3V6DA 5DM7Q 3GQCA 1DQ8A 2W7PA 4MIWA 2RD5C 2VASA 3MECA 3M7VA 1A0OB 2GW8A 1MMNA 4NZ0A 4X2BA 5A8KB 2PDAA 1KFSA 4WZQA 1SIZA 2BM1A 2B5JB 1XEZA 3QFWA 3WQPA 4YUDA 3BGUA 2PFDA 1UZDA 2H5JB 2J7UA 2BA9A 3IWXA 4P10A 4ER8A 2XS2A 2HLUA 3HKWA 4OYIA 3W63A 5CXTA 3KLHB 4ETZA 2QSFA 5D78A 2XM3A 4BBYA 1UMJA 5H9FJ 1HR0F 5LOQA 1RHJB 2OKQA 2G4BA 4DFMA 1UVNA 3D0GE 2RHQB 2W8LA 1YI2S 1N56A 3IP0A 3JSMB 3PYEA 1S9FA 3QRRA 4I2PA 1U47A 1NK4A 1NHKL 1KONA 4RNMA 1HNWJ 4LF2A 5I3QA 4ZVOB 1RTHA 2ZH2A 1KWMA 4ZS6A 3X1LB 1S77D 2Q1LA 1B70B 4WZMA 3H25A 1I6JA 3WIVA 2ZBRA 2M8DB 4RNNA 2UUCJ 4IQXA 1YJTA 2DNRA 4ZCKA 5IOLA 3MUTP 2AJ0A 2FJDB 2UUAF 3K5OA 2DNNA 1BMQB 4Y00A 1SCJB 5J2PB 1NK8A 1QE1A 3CO0P 4U8YA 2GMJA 5C42A 3KHGA 3RUBL 3TZWA 5KFMA 3D2WA 3HVRA 4LF9J 1V3SA 4KC5A 3MOJB 4LF6J 3K59A 2J6TA 2V8HA 5GMDA 1UVLA 2VHGA 2RIJA 3QSIA 3QJJA 4NA3A 2KO1A 1B4SA 2HNZB 1VYAA 1VK3A 4LR8A 2B4PA 3DRRA 3QATA 4NLWA 4NE9C 3ISND 3RB6A 3MHYA 3Q8PB 1CC7A 1E6VB 3VZHA 2XI3A 3MMBA 3R5DA 1CJKA 4IG3A 1MN7A 2LFVA 4KGXB 2C2MB 2Z2MA 4WTOB 3EMTA 2CDRB 1U6ZA 2HMIA 4KPCA 2D9OA 4MK8A 4A8KA 1LNQA 3D66A 3I0RB 3MR6A 5KFYA 3CT9A 4ZHRA 3QT8A 2W24A 3VVTA 1OYEA 4EBEA 4LFAF 1FESA 3NBPB 3THPA 2MKJA 3CDWA 2RNEA 2B0GA 4G1QA 3UVJB 4HLBA 2HZAA 1JNRB 5CD4H 5KFVA 3KTQA 3PYDA 4RW4B 3MMCA 3ZTSA 1PJ7A 3D1OA 1C0TB 2LXFA 5EHHA 2WONB 3AB4B 4E8UA 2HPUA 4M5MA 4ZOSA 5E7OB 2VPXB 3PW7A 5FDLB 1Z4UA 2XQCA 1M90T 2MKSA 2VG5A 1CJUB 3A13A 3MAHA 4OYPA 3D6FB 2RKIA 2EFOA 3ZTRA 1YKWA 2ZUAA 3BZQA 3W2VB 2UXCF 1JLQB 3MTKA 1YZ6A 2O3DA 4LR9A 4KSEB 1RISA 4NCGA 2L9DA 1CLFA 2XYGB 2UUAJ 2XZWA 4NXNF 2X1GA 3K58A 1TK0A 1NKCA 4TVAB 1PJ5A 3PM9A 4ANCA 3SBMA 5B0GA 2HK3A 3P5BP 9ATCB 1UW9A 1IM6A 3RU0A 1I3OB 8ATCB 2ILYA 4PYDA 1HFEL 4J90A 5L9NA 2HHTA 1RCXB 1EX8A 4ED8A 3F0NA 5B0BA 1K0TA 3GZ7A 3A4TA 3BBFA 2CQIA 1YWXA 4MYTA 2JFKA 3DLLQ 2G13A 3ZZTA 4GKJF 2XMMA 4NA2A 3EICA 2QLBB 3DU5A 4BC9A 3ENVA 3RGIA 1UVMA 4B3OB 5ETSA 5F8NA 2GVZB 2B4UA 2PMZD 3CCMS 1DQAA 4FF2A 4ECTA 4X4TA 4NX9A 2YQ1A 1AA1B 1GXUA 4AL6A 3HP6A 3ENAA 1X5OA 2V9KA 1RU1A 1OY9A 3UR0A 3DMJA 2W9AA 2FJAB 3PY8A 1U8SA 3QIPB 3PV8A 3QGPA 2NR0A 2ZVIA 3G8SA 4RZRA 3S8SA 3DRXA 3NS5A 1SC6A 5HMYA 5E33A 2R7TA 4RW9B 2XY6A 1GMVA 3TR5A 4Y28C 3QZ7A 3EPIA 1HNVA 1FFSB 2FY8A 2V4QA 2XMUA 4LFAJ 5KFFA 1KQGB 2GHVC 3CE8A 4UQTA 3BBCA 1N34F 1JLFB 3O8WA 3AOAA 5D4LA 3P5TL 1O0PA 2WVFA 2WW4A 2NPFA 4A47A 1X5SA 2V34A 1PAUB 3IXQA 5HP1A 2ZHOA 5DLFA 3K2YA 1VQYA 2CG4A 3LP2B 1HBNA 5IV4A 1PIEA 1MWYA 2DXEA 4QWCA 4LFBF 3GP9A 3MAAA 2KU7A 4K59A 2XNRA 2GFFA 2C2EA 2GX8A 2DHHA 3JXOA 2HW3A 2KJWA 4PWWA 4PQUA 2UXCJ 1LWEB 1HWUA 4KHPF 3VAMA 1X4CA 1I94F 1S0OA 2H48B 5AXMA 2AJ2A 2J7KA 4LJMA 3IS9B 3MWBA 3ILLA 5EX3A 4NXNJ 4MKVA 3AQOA 5HVGA 3Q2SC 4A4JA 3BSNA 4R0JA 2BR0A 2BE2A 2FUG9 4I2QB 2B3TB 1P8GA 2OPSB 4F4KA 2CJ9A 3RR7A 3GPAA 2OPPA 2BM0A 1FE4A 2BJ1A 3NRBA 5D3GB 4K7QA 4A8FA 1WHVA 2KM8C 5KTQA 2HWTA 1N0VC 4GKJJ 4FNIA 4J9MA 2DPJA 1XNQF 2XLKA 1SC1B 5A8WB 4YY3F 1K8AT 1A6LA 4YEAA 3RRGA 1NO8A 5D0RA 1AFIA 4I56A 3EXCX 1G3OA 1BQMB 2OPQA 2DGUA 4LREA 2CQBA 5F8GA 3DHWC 4K4ZA 4WFAQ 4F4YA 3FVYA 1VQPS 4JI2J 2HHVA 5HBMB 3C15A 2YKQA 4LIWA 2DK2A 2L48A 4V19X 3FCHA 1S7IA 1NHUA 4QIFA 1YJRA 3SFUA 4NCBA 1S0VA 4FF4A 4DMZA 3HZEA 3JYTB 4FYWB 1HQEA 2K8GA 4UTGA 2XMJA 4DPYA 1H98A 3D68A 3Q23A 2FJBB 1ZAVA 4HHUA 3DC2A 1N34J 1HBUA 1X60A 2YH1A 3V4MA 4ZA1A 1WD6A 2OGUA 3SV4A 4WE1B 3UN2A 1GXTA 2GGPB 3MD3A 3ICLA 2LECA 4K5RA 4DV3F 3NL0A 3TUIC 4DR4F 3PEHA 1VI7A 4TU7A 2QN6B 5IT9Y 1R8HA 2QFJA 2MQLA 1HIYA 4GVBB 2PEHA 4LFBJ 4UT4A 4ZLJA 4RU9A 1SKWA 1IKVA 1HBOB 2HHPA 2MXYA 2BZ2A 2LP4A 4OYBA 4OX8A 2Y1IA 2MSTA 4I7FB 4F26A 3K8WA 1KSPA 3MM8A 2W4PA 4Z37A 3TUZC 2XZDB 2MQNA 4H4KA 3A3PB 2GJIA 4P75A 2B9YA 1WJ9A 3B82A 2YNHB 4HEA9 2Z8QA 4JV5J 3KJFB 1AYEA 5EWGA 2AQ4A 1RT3A 3N5FA 1OSDA 2K06A 1YZ7A 1TKZA 3TAQA 2R7OA 1PC5A 3AJDA 3P6YC 1TL7A 2KYXA 3WX4A 2P8IA 4P71A 1XNQJ 4CLLA 2ALZA 3K8VA 4USUA 2Q79A 4YY3J 4ILMA 4PPZA 4HACB 2MZJA 2YNIA 4B3MJ 2H51B 2M0GB 3PG9A 1XR7A 1RKIA 3Q8YA 4DL5A 3LGNA 1VK8A 1LWCA 1DLOB 1U09A 1SPBP 4DQPA 2WAQD 4J9NA 3MCOA 3GFHA 4RNHA 3EUNA 2IYGA 2VJUA 2CPHA 3C14A 1F5CA 3AH6A 1TUVA 4B9SA 3C46A 3W9HA 5J2NA 1LW2B 2XSJA 4I67A 3UWTA 4PXEA 2VB6A 3HVWA 2CQ2A 2CQDA 1K47A 3BDEA 1Z2LA 1PBAA 1S9GA 2X1BA 3H5UA 3MPVA 1UVJA 3PW4A 2JHEA 2I0XA 3DLBA 4A48A 3PIPQ 2B9XA 2DB1A 2D3O1 3C6UA 3PX6A 4DV3J 2CG8A 4DR4J 2CQHA 1R27B 2HRYA 3BSOA 1U1LA 2V8VA 3V6KA 4OJHA 5F8HA 2MMYA 4AFFA 5A8RA 3ISZA 3HZGA 3ITHB 2M2BA 4CI0B 2B8QA 1AROP 2M9KA 3T5KA 2W25A 4RW7A 3CD0A 5DQHA 5E3RA 4DEZA 4ZLLA 2IY5B 1VC0A 3HI9A 3T1HF 2QMWA 1HPZB 3ZTQA 2CA9A 4DL7A 1P6TA 5KAKA 2RDDA 2KXNB 2ZJQQ 2MZ1A 4DR6F 1RTZA 3JSYA 3ZC4A 4WFBQ 2XC9A 4DPWA 3MFIA 3M32B 1NK6A 1HWIA 3D3BJ 2VOPA 2ZUGA 1ZA2B 1FWKA 3CIZA 3AT1B 4OL8A 4I64A 2EFNA 3AA9A 2KL8A 4QR1A 3JAMY 2NCKL 1S79A 4RUCA 1FXRA 2I5JB 3BF4A 2DTJA 5LM7E 3WIUA 5K8OA 4O4GB 2LMIA 4AQYF 2RILA 1FKPB 1ELOA 1SJFA 2V8DA 2GJFA 4USKA 5KG6A 3NS7B 1FK9B 3GYGA 4BS2A 1FFWB 3SQGB 1HYSB 1NPPA 3US5A 2NXEA 3D6MB 2ZOMA 2UV8G 4G65A 3QLHA 4MAKA 3SSQA 1X9WA 3A8EA 5IC6B 2DGWA 5KFCA 1JLCA 4XO0A 3H40A 2GCFA 9RUBA 4HT5A 4RWWA 1NDKA 3IBFB 4K4SA 2BE9B 3IFEA 5A8KA 1JX4A 3FRYA 4PWDA 3DOLB 5CD4A 2F9DA 4KQZA 3LQVA 2DXFA 2HIYA 1RXOB 3DLEB 4FKYA 4CNZA 1N32J 4F4AA 4KFBB 2A3JA 5C24B 4QU7A 4KR0B 4RR5A 4JV1A 3UDVA 4OI0A 3VV2B 3LGHA 4UZCA 2VC1A 1M1HA 3R1HA 2YWGA 2IVYA 4MYUA 1LXNA 3KLHA 2VFSA 3DLGB 2ASJA 3T6JA 3TQEA 1T05B 1IQTA 1KEKA 1JKHB 1T94A 5BYQA 4ZPCA 3PZPA 4DZDA 1S9EB 2RUGA 4ZITA 3MMJA 2EG1A 3IMQJ 3JSMA 1JMTA 2E5LF 3UDEA 1U1RA 2AMCB 4F50A 2FZGB 2LVWA 4ZVEA 4A8SA 4F4XA 4OZJA 4UOCA 4OJGA 4DV2J 3HSZA 4Y34A 2IM0A 2COLA 5ETTA 1JLAB 1RWMB 4AT1B 2KVQE 2XLJA 3T1HJ 4GC7A 1WF2A 4ITSA 2ZBPA 1M5HA 2ZFHA 4ZPAA 4DN0A 1N6QB 4DR6J 4IFYB 4N47A 5CABA 3DXSX 2L41A 3TARA 2A6OA 5AT1B 4HH1A 2CXEA 1UL3A 1Y4ZB 4AXJA 5J2PA 1HHTP 4ED4A 3SYZA 5I3UB 3KDOA 1F2HA 1FWLA 1Q0NA 1S4FA 1RHMB 2XY5A 2VG6B 4DZ6A 4DCOB 2Y3YA 2MLYA 4NLRA 2IPOB 2DJWA 3M2RA 3NAIA 1N52B 2Q43A 3GWCA 5C7PA 1AZSA 4XK8C 2V2KA 3FFIB 1UTAA 3SXLA 2EFGA 2QX0A 3AODA 4TN2A 3ZTOA 1MROB 5HAOA 3PYFA 3DLKB 2MQ8A 1UPPA 3VTIA 4L75A 2Q6BA 1YTYA 2E1RA 2HNZA 4AQYJ 3I4HX 4KO0B 4CH0S 4QQBA 1BGXT 3NNHA 2V4JB 2DD8S 3B54A 2BOAA 1ZTTA 4Q2MA 2X3DA 4ZN1A 1X4GA 3BH7B 4DV5J 4HR2A 4RKUC 4DQIA 2QRRA 4QYZK 3D4JA 3HHKA 2HVHA 2DHXA 3VQTA 2B4VA 1KKHA 3M6VA 3HD2A 1U25A 3NGRA 4MKAA 2WB4A 2OUGA 1JJHA 3NXZA 2O66A 3UN3A 3V5RA 4NA1A 2R7XA 1MG7A 3W5ZA 4ED0A 2ZKUA 4DFJA 2HEKA 1XR5A 2GV1A 1KP6A 2BQUA 3W65A 2ZBQA 3WZ0A 1KOOA 5J1EB 2R7VA 4WK1A 3T5LA 1B64A 4TYBA 1CBKA 1IKXB 1GK8A 2IRXA 3L7UA 4EMDA 2Q6CA 3UVJA 4DV4F 1FEHA 1ITPA 4ZVSB 4PKDB 4RW6B 2AWZA 1EP4B 4O0IA 4A8WA 3U7JA 4YS2A 1LFPA 3H4DA 1TL3B 2NYHA 1RTIB 4Z7YA 2OD4A 4C4WA 1IBMF 1SL0A 3ENWA 5FDLA 1ZM3A 1RAJA 2BE7D 4TYAA 3U1NA 2HQFA 2F7VA 3LA0A 2ROEA 1VRTA 4BCAA 3TJ8A 2W2QP 5F8IA 4D3GA 1LWXA 4QYRA 2AD9A 4UY85 5ETMA 1RKJA 1HARA 1GTEA 3EJMA 2HAIA 1RAAB 2HG4A 3TUJC 3KUGA 2QA4G 3S7RA 1RB0A 3AOCA 2ZJRQ 4FVCA 3IG1B 1IBCB 3IBWA 4JI7F 2W4CA 2VBYA 2VONA 1VIOA 4OHVA 1JK9B 1RCOB 3CJ3A 2XO6A 2ADCA 5L46A 1I5OB 4LIRA 2OD6A 3FEXB 3R9LA 1YGYA 4UQGA 3DOMA 3H8YA 5J2MB 5DG7A 1WKKA 2JFDA 1WACA 5CCMA 5GADI 3HULA 1H2VZ 3D7SB 3T5JA 3A1YG 2E5HA 3MPUB 1Q81T 3LAMA 4PCQA 1SUQA 3KUEA 1AXQA 3IN5A 4DL6A 1FTRA 5THWA 4U6PA 3MDFA 5KFDA 2HBZB 2AGQA 3V6HA 3JS9A 2CJQA 3I82A 3VZIA 1HA1A 5D6GA 3D9BA 2UUBF 2ZDPA 1S6PB 4GRSA 4IDKB 4A8YA 3A8IA 3V6JA 3IRWP 1HI1A 4IR1A 1LKZA 4TQSA 2RU9A 4UUXA 4OQJA 3TVYA 3DGPA 3QIPA 2JRSA 4F2RA 3MPWA 3SIPB 4EBCA 4DQQA 1Q79A 1XIQA 1QSYA 4USHA 4CM2A 4IO1A 4DU7A 2EBEA 1R31A 5GAHU 2XI2A 1Q7YT 3KG0A 2FVCA 4DSFA 2VFUA 1L5UA 2ZVSA 4ZKAA 3M9NB 1Q5VA 2Y1LB 1U49A 1K0VA 4DV4J 4ZLPA 4Y2MA 4M5NA 4QR0A 3R27A 1C1CA 2A1BA 2OAUA 1VRQC 3V2UC 4M5IA 1D8ZA 1R6YA 2J0QD 1VQKS 4B3SF 3R5GA 1WDTA 1B0TA 3EWGA 5HMWA 4PYAA 1YDLA 5IZHA 1IBMJ 1OMSA 3HHEA 2DO4A 2E5GA 2MHNA 1IN0A 2YKPA 1X5TA 2JLFA 3AJ1A 4Z2XA 4XIUA 4WYLA 1MLAA 3O3LA 2ZM6F 3E8OA 2RUSA 3I6PA 1NDPA 3I96A 4TKTA 1VQ9S 1LWEA 1IR1A 4FXVA 2R4FA 4WP9A 2HZCA 2GNKA 1B7YB 3VAHA 2VOOA 3DKDA 4BWJA 3IS9A 1J5EF 1NK0A 3CDUA 1C2PA 2E7WA 2B9WA 5LJ5Y 2EXUA 1N36F 4ZP9A 4DU8A 2DNYA 4DX8H 1M5KC 3PJ9A 4I4BA 1NXIA 1WG1A 3KJNB 4NEZA 1DAXA 3W64A 4JI5F 2IAJA 1F1BB 5JVHQ 1QD1A 1WC6A 1EQMA 2MLZA 3CD7A 1QDUB 2VICA 2BRKA 3N28A 4CT9A 2B6AB 4BDPA 3LH2S 3CIMA 5D3GA 1HNIA 3GV8B 2FQQB 3EVMA 1X8DA 1Q1KA 4ZPDA 3O6QA 4DSJA 5T41A 2V63A 2E9TA 2FB0A 4PAAA 3EXYA 3CDBA 2XZTB 3T6BA 2KZZA 4HDGA 5J2QA 3CDAA 1FKOB 2HVIA 3GFZA 1AT1B 2Z2YB 1UZHA 2DGOA 2G2ZA 2UUBJ 1D09B 1PILA 1BQMA 4Y2AA 4UOFA 2Y1RI 1F0XA 2X7IA 2GC8A 4P2MA 3S6EA 1ZTWA 4USWA 4NXMF 3Q2TC 2YXLA 5HBMA 2CZ9A 3R2DJ 4CNYA 3TANA 2F9JA 2V2ZA 3RTVA 5L1KA 1U1MA 3J7Z5 2MKCA 4LMZA 1BWEA 4CYUB 3GTYX 2GJ2A 1S1TB 4FF1A 1U02A 2CPYA 2XNQA 1RDRA 4GKKF 4H4MB 2QO3A 2QEXS 1RZMA 2ADBA 1JXVA 3KG1A 5KFXA 2EG2A 1RLDA 2GGPA 3FBCA 3NGDA 4HHJA 1S1UB 2UXBF 4B3SJ 2J9EA 3TWZA 2UP1A 2ZWPA 2B56A 1NU4A 2PMHA 3OFEA 3DDNA 1RT7B 4K2JA 1R43A 2FVSA 4NRTA 2RDIA 3AJ2A 1IUJA 1RWUA 2ZNZA 2DHSA 1U7LA 1U0HB 3M8PB 2G2YA 3H5XA 3NG8A 1GX6A 4RX6A 3C6TA 2C3MA 2R2SA 3JAMU 2G2OA 5HLFB 3CEDA 5IT0A 2KFYA 1IQZA 3J81j 4I7FA 1V3ZA 2ZNYA 3MR3A 4DUZF 3CTRA 4DR3F 2EFQA 4Q7AA 1PJ6A 2C1EB 1J5EJ 1HI8A 2I2YA 4ATNA 4DX5A 1UA1A 1N36J 4ECYA 2DPIA 2YNHA 3S1TA 3MCSA 1Q5YA 4JI5J 1U6FA 1Y5LB 2JJ4D 2QFIA 4DL3A 1S1VB 2DH8A 3BEGB 3BN4A 5IQQA 1RT6B 1TK8A 3ZFVA 1BQNB 1T95A 5FJ4A 4NOHA 4FXWA 1NSQA 2JNJA 2IRUA 3GIMA 4NRUA 4X4OA 3HMJG 1N5QA 5E0OA 1NSAA 4CO0A 1EKRA 1N5YB 1VCTA 4CM0A 4ALZA 4C3KA 2C3YA 4FS2A 1UWBA 3KK3A 2VH7A 4RJVA 3VR1A 1DJ0A 1TMJA 2CQ1A 1LOUA 1TELA 2DGXA 2HIQA 4TQRA 1DLOA 3H20A 2JDJA 1U8WA 2DITA 2P6TA 4MK7A 4B9VA 1WHXA 3WC0A 1X4BA 4C8MA 2QJ3A 1RWNB 1G2EA 3NEKA 4C8KA 3BKTA 2D3OR 3IM8A 2E1CA 2IA0A 3QT6A 1LW2A 2VA3A 1W2BR 3DM2B 1VQOS 5F3ZA 2RQMA 4CLUA 2WVCA 5F8LA 5KFWA 2ILZA 1H7WA 3QMQA 1TK5A 1TVRB 4GKKJ 4HKQA 1M1GA 2BJ8A 3N0VA 3NLCA 1R8BA 3MEDB 4C3LA 4DQRA 4H4OB 1REVB 4OZLA 3R1LA 3TI0A 3TW0A 3UW1A 3VAKA 2UXBJ 4J9QA 3NP5A 4GO7X 1QUPA 2JVRA 4CLKA 4Q0BA 3KKFA 1VBYA 3P3DA 1FNMA 1RK8A 2MKYA 3MEGB 4URQU 4RBUA 1JLGA 2P9EA 1Y5NB 2R8HA 1VBKA 1WWHA 1GEHA 3SCKE 1FXDA 3PR5B 4DR3J 5KFZA 4LF8F 1C1BB 2CWXA 1VQMS 4ECXA 2MPUA 3G4SS 3TZXA 1BC6A 3PEJA 1WDDA 4H54A 5AJ3F 3M32A 2MZQA 3GYNA 3NKYA 3TAMB 3CD5A 3MM7B 3R5BA 5GAEI 1KVKA 5SZTA 1RUSA 3CJ5A 4LRCA 1U48A 4C11A 2AGPA 3I32A 2HBYB 2ZE2B 3VGTA 5DLGA 4OYZA 4DR7F 2W4DA 5HSPA 3Q86A 1MU2A 4NLXA 1REGX 2MQMA 4M5JA 3J80Y 3R6GB 2H4WB 1URRA 3MMAA 3VGVA 1BY9A 5KT5A 1X4HA 2BJ7A 3B4MA 4O4GA 4MFBB 3PJWA 2M5YA 1J5OA 1IWAA 1HD1A 1FDAA 2POKA 4ZVFA 3JSBA 1S1WB 1FK9A 1BQXA 2HGNA 2WRMA 2N3LA 1HYSA 3PJXA 1FXLA 3QYYA 2YWEA 4YB6A 5LMUJ 1QTNB 2C3UA 3WX8A 4QZVB 4OZNA 2VC0A 4FNHA 2JX2A 1MWZA 1J27A 1VQNS 4C7QA 4V19J 1R3NA 1VJWA 3BQ1A 2EBGA 1RT5B 3TAPA 2BRLA 3DLEA 4R5PB 4ED5A 1VHFA 3LP0B 4K0KJ 4NLUA 3O44A 5KT4A 5IC4B 1TTHB 3R6LB 1GAOA 3E3XA 1SC4B 5KT3A 4ED3A 1SV5B 1ZYQA 4OZ0A 3DLGA 3SQOP 5ETLA 3FBEA 1JKHA 1FJGF 3CW2C 1KS2A 3CJKA 1S9EA 1SL2A 3VAIA 4PXBA 1YJUA 1P27B 4WXOA 1SL1A 1JWWA 2W1BA 4CTAB 5F41A 2FDNA 1HQUB 4JYAF 4EI2A 3HFKA 4DPXA 3E01A 2VQFF 2BX6A 1IR2A 3R2CJ 3VGUA 3KK2B 4X64J 2CRLA 1BLUA 4M5HA 5F8JA 4OHWA 5CYJA 1CQMA 3KYLA 1T9WA 1UP1A 3KHLA 1N6QA 2RMLA 4YDDB 4JI0F 2N4DA 3PR4A 4IFYA 4ZVHA 4PUOB 4L76A 2BUNA 5AJ3J 5MLCV 1EKSA 2C3PA 3KLFB 2VG6A 4IH7A 1YRTA 1WI6A 3OTEA 2K2PA 4KHMA 4F3MA 2WZ1A 1QUVA 4HL9A 4G1PA 1EIYB 3FSIA 2F1FA 3BDPA 3FFIA 4R0EA 4Q45A 2AKWB 4KH0B 1MROA 5T7LB 2CPIA 3DLKA 2P9CA 1DTTB 2WSFC 3AFGA 1GT8A 3HCXA 3I0SA 2DCLA 4OYWA 2QYCA 5K14B 1XK8A 5C25B 2BW7A 3R97A 1UW4A 3QWPA 2KRBA 1CJTB 2I1RA 2V4JA 2Z30B 1VRUB 5DM6Q 3GFYA 1M5OC 5L9XA 1OPIA 1NDCA 2RB7A 1YJNS 2H65B 1F2GA 4DV1F 3TQ1A 2KT5A 3MM9B 3FQKA 5KFOA 2RQ4A 5E3AA 5ADZA 2ZD1A 3UNYA 2ABYA 3IWNC 3Q8RB 5M2UA 1YVFA 4X4NA 2MYFA 1YX2A 3Q24A 2AYMA 4CLYA 2ZH5A 4NWBA 4R8UB 4M1KA 2EKYA 2HNDA 3FZBA 4WFXA 5J1EA 3UNGC 3WDOA 3ADAC 3I5BA 3LP1B 1RBAA 1WEXA 4ELVA 2XCPA 1FJGJ 4JI4F 3CWJA 2V8PA 3QWUA 4URSA 1EP4A 3KNGA 2RH3A 3K7RA 2JWNA 1EARA 2KDOA 1LEOA 2AJ4A 2FYXA 4JYAJ 1YSJA 3CC4S 1UJ6A 2FVRA 5K8PA 5ETKA 1UKUA 4IH5A 2ZH7A 2VQFJ 1VIXA 2VL1A 4BC7A 1FRMA 4KKOB 3PYGA 1RTDA 3EGWB 2UZAA 3H2LA 1WKLA 5HJXA 3GIJA 1Q86T 3HJFA 3W2WB 4UZBA 1VLOA 4JI0J 2R7WA 3Q8QB 2HQGA 2B7CB 5HMZA 2OPRB 3AHPA 3UE2A 2HQIA 3BPSP 3V81A 1IBLF 2HQDA 2R7QA 5H1SV 1KLNA 2ACYA 2CQ4A 4EFAC 2CPXA 3O2IA 1CG2A 1SQFA 2XO7A 3SI8A 3SMZA 3MEKA 4OZ1A 2ZZNA 1DRZA 1H6KX 2DVIA 5J2MA 4URGA 5EN1A 2LDIA 3T41A 1CULB 2HFNA 3QPIA 4IOBA 4EUVA 2HHQA 4WP8A 4QWDA 5RUBA 1IXKA 2HVDA 2DHAA 2I8EA 2DY1A 2VU5A 3F44A 1UWAA 2WSEC 2HHWA 3ET6B 3BGRB 4ZJLA 5I3PA 1YBUA 1LWFB 1HHSA 3M1VB 5CYMB 2ZH4A 1S12A 2DH9A 5ETNA 2KHDA 2G1DA 4NEYA 2YPZA 4ECVA 5AE2A 1RT1B 2PMWA 2BVZA 2K1RA 4Y2IA 4Y2KA 2EK1A 1VC6A 3CCZA 4OYAA 4HI1A 3TJ9A 1SKRA 4TY8B 5CHCB 1RSCA 4FYVB 4KHRA 5L1IA 3GFXA 1N5TA 2LKZA 3UI3A 2APOA 1KBRA 2N4CA 3FQLA 1XMQF 1N8RT 3EDQB 3V6DB 4J9PA 4DOZA 3PW2A 2C2RA 1JQGA 2KYZA 2CNOB 3LW5C 4C0OC 1MMDA 2MJUA 1TP7A 2MKKA 2BKOA 3CCSS 3CXCR 3SEOA 2EC2A 2PO4A 5E41A 3ZTPA 3E2EA 2KHCA 1N88A 2XULA 4HVZA 3AXKA 4DL4A 1UVKA 2H5IB 4WXWA 4TY9A 3HLUA 2DNPA 4FPIA 4LF7J 3FNNA 3GE9A 2KVIA 3P49B 5KFUA 2VFVA 2DEIA 2G0IA 3U1LA 3P45B 2EFPA 4OYOA 1RT4B 2J6SA 1ROFA 2V9WA 2C2NA 2ZH1A 3K17A 3J81Y 4C8LA 2OMOA 2FHOB 4I2PB 1HMVB 2VFRA 1KHVA 4CH1A 2Z58B 3F56A 3ZNUA 2V94A 3HF5A 3Q89A 4C97A 4J9RA 3W9JA 1PYSB 4YN3B 3KJVA 1O8BA 3MCNA 4P6QA 1DBDA 1RAFB 5C5JA 4JP8A 3IAS9 4WU3A 5BR8F 2QL9B 1O6XA 4KPYA 3BPDA 2ZITA 2X3GA 3MAQA 1EHWA 4IO9Q 4J9VA 4ANEA 3IBCB 1KR4A 2AEMA 4X4QA 2DYAA 3V4IA 2N7YA 4ZVGA 2F8HA 1KRPA 3NNCA 4AYBD 2B6AA 4NLGA 1QE1B 2ZBIA 2HHXA 1EB0A 2E5IA 5KFKA 4MH8A 3GJRB 3BSCA 3KHHA 2RVJA 1YG0A 4F0MA 2HLTA 2I38A 4PG4A 1NZ8A 3EDRB 1UCNA 3CJTA 1H74A 1KLMB 5CH7B 4JI1F 4B9LA 1KDNA 4M95A 1Y9OA 1WHYA 2Z56B 4NLDA 4IH6A 5HVHA 3QFHA 3D5MA 3T5HA 3AY0A 5CA5A 4JI8F 5DGAA 1OIAA 1ZH5A 2HRTA 5GADU 2W8KA 4EK2A 2YKOA 4KTQA 1X4FA 2A0FB 1XMQJ 4U7CA 3M30A 3HSJA 4CYUA 5A6WA 3KLVA 1S1TA 2OLWA 1ZOTA 1AB8A 4C3MA 5I4MA 2LQBA 2VG7B 4LSNA 2H54B 1NK7A 2B7BB 2ERRA 2HMIB 2V2QA 4GC6A 1RGVA 1S1XA 3AD7C 3ETOA 3CCQS 4DPTA 3KWMA 4ZHRB 3LOUA 5ETQA 3J7ZT 1DQ9A 2YQ0A 3FZ2A 3PKYA 2DEJA 2XCAA 4G1QB 1AFJA 4LQ9A 2GAHC 5A76A 4J37A 1U0HA 3M8PA 5KG7A 1N33F 4F67A 5HLFA 2QYGA 3DRSA 5CYQB 2VKZG 1H2UX 2HS4A 4S0MA 4U9RA 3QAUA 1HQ2A 1V5VA 2F3JA 1QAIA 1HR0J 2HBRB 1WG4A 2VG5B 3KDNA 4J91A 1BWVA 2CFXA 4CQ1A 2WCXA 4C2MA 3CO9A 3IAM9 3D0IE 4OLOA 5BR8J 2LEPA 4X4UA 2RKIB 1RAOA 4LBHA 1NCLA 2M8HA 2HWHA 3K0JA 2IC3A 2WB1D 2HKEA 5HJYA 3N6NA 3LF0A 4Y2CA 2AF6A 4NCGB 3JSRA 2YWKA 5D0EA 4M5DA 3GG0A 2N82B 3FBBA 2A10A 4OIXA 2CPJA 5C2CA 4YMEA 1RT6A 4WIIA 1BQNA 2VDIA 4CWBA 4DSEA 3IRXA 1RT2A 2CQPA 1VFJA 3KHRA 5DQGA 3P8BB 4B3RF 4L72B 4NZ6A 4FDFA 2DISA 2C2ZB 4C48A 3QO9B 4E0DA 1FA0A 5KFEA 1IKYB 4L74A 1OWXA 5KFSA 2BANA 2G0CA 2M4MA 5D4OA 4LF1A 5KG1A 1Y10A 1NJXA 3M8SA 2DGTA 2MDAA 3GB0A 4UW2A 2B4OA 3I9V9 1PYOB 3OW2R 2QT7A 4ZIWA 1HW9A 2FHMA 3TJAA 1UFKA 2DR7A 1Y11A 1ZA1B 1Y7PA 2J8SA 3H5YA 2L3MA 5M2RA 4J7CA 1G1XA 1JXEA 4P2FA 3M9OB 5KG2A 4RNFA 1CC8A 2QMXA 2FY1A 1HHQA 4LVOP 5DZ7A 2LQ8A 3GR1A 3OL9A 3LWLA 5KFJA 2OIHA 5DQIA 3KJQB 4NCAA 3EX7B 2NREA 1XN9A 1O51A 3H0PA 2HAFA 5AXKA 2CJXB 2I6WA 5GAGI 2RF2A 1ZS6A 2NS1B 3MEDA 5F3TA 4F0HA 1EAYC 3GSDA 4H4OA 1REVA 1NK9A 2PSZA 3F41A 4CLSA 1DY3A 2U1AA 5IFMA 1QJHA 3NMRA 2C3OA 3BGOP 2J0XA 5B7WA 2KTQA 2OTLS 2YY3A 1KD1T 3HHLD 2AT1B 3HD1A 1Q8LA 3AXMA 3MGJA 3MEGA 3ZZZA 1R8CA 4BHQA 4KGVB 4XDDA 3BGLA 1A9NB 1ZZNA 4Y3CA 5HP1B 3N6MA 1MW7A 4P9SA 2AYBA 3IR5B 4C8OA 1VQ7S 3DU6A 3SV3A 3BS9A 3DOKB 3MAAB 2IJNA 1UJ4A 1XJWB 1KNZA 2R2UA 2ZH3A 5CQGA 3BR9A 2Z2LA 1YLXA 4K4VA 3TAMA 3Q22A 4YB5A 3KK1B 2HZVA 1S6UA 1T9UA 3DI6B 2FC9A 4XDCA 4K4TA 4O44B 2XGPA 4A8OA 2DIVA 5SUHA 4OLPA 4ZDNA 3LANA 2ZE2A 3KLEA 4C6AA 5JJBA 2Q3PA 4HH0A 2OI2A 1TFWA 4N5SA 4F7VA 4C8ZA 4USMA 1RU2A 2DNQA 2WK4A 4G6VB 1UJ5A 1FDBA 1J2VA 1GFWB 2M7SA 4B3RJ 1S97A 4MFBA 1H0HB 4HHHA 3TZZA 2UVWA 2ALYB 1YJVA 1S1WA 3QGIA 1FHTA 2A6MA 2OEJA 2IRYA 1NMEB 5K9FA 3QSYB 4PPDA 3TYTA 1FRJA 4QW9A 1HI0P 1FJEB 4IRCA 4M5KA 1L3SA 1QTMA 4HI2A 2IM1A 4B08A 2V8GA 2KI2A 2OJ3A 4TU8A 5E3PA 3PXGa 1UFWA 2DNZA 1MNEA 2U2FA 1O5JA 1SKUB 1GX5A 3LP0A 3GIIA 2BJDA 3D3CJ 3PRDA 3IR6B 3Q8VA 2IBOA 4A8XA 3VAGA 3CJSA 2KXFA 4ECSA 2XG8A 4X65F 3OLBA 2FJVA 5DZ6A 1VQ4S 2DNKA 2LQ5A 4KGKA 3BYPA 3D6TB 3WBZA 5HK4A 1H72C 1F9HA 1X5PA 3OXFA 2MZTA 1P9QC 5ETPA 2HQ3A 4DSLA 1RI7A 1HQEB 4O3NA 4PR6A 5FD1A 1LK7A 4IG0B 4CTAA 1HBMA 1HQUA 1HBUB 1X0PA 4QIEA 3M8QA 1N5SA 4X66F 2H4YB 1SJ1A 2W2OP 5T14A 2J8AA 3NGKA 2F5GA 4J9KA 2E44A 3C19A 4OI3A 3QJLA 1NJWA 3KK2A 3G6YA 4CRJA 2QA1A 2ZH9A 2NSBA 1XC9A 2Z0GA 4OX6A 2K7JA 4LFCF 2B9EA 1KQSR 1IM4A 5KFHA 1FRIA 1HWJA 1X9SA 1GMUA 2PIIA 5L8RC 1NB7A 4U7UD 2AIRB 3OJUA 2D74B 2KH9A 3RBDA 3HDSA 5H9EJ 4KE5A 3MM8B 2MY7A 3CMES 1XBWA 5DG9A 1PBUA 3OQ2A 1APSA 1Q53A 2OFGX 1C0UA 3G8QA 5KFQA 2J7WA 1C4CA 5T7LA 1RWXB 3IM9A 5BXIA 4KHPJ 1QLNA 2E5JA 3M2UB 1I94J 4CLPA 3FUYA 1DTTA 2M88A 4ECQA 3T1YF 4W98A 1WC1A 3GCWP 1F3FA 3CCLS 5HQ8A 1V5IB 5KT7A 1RHUB 5GAEU 2DNLA 1VRUA 4YFUA 2R9LA 1CEZA 2GHPA 1U1QA 4O23A 3LUYA 3Q8SB 4PWUA 4HTJA 2Y0BB 1X4DA 3NGSA 4K4YA 3RRKA 4CDIA 5LXYA 2PE8A 3MM9A 2R2RA 2ZHAA 3OXGA 2V67A 3DYAA 2OMLA 2IA6A 2GVDB 2FHJA 3EPGA 2HGMA 1NJYA 4N8NA 2ACMA 4NI2A 4R8UA 4TU9A 3OT9A 4Y6IA 3J81U 3R8YA 2AU0A 1NJIT 4K4UA 4X65J 3GG1A 1MWQA 2QIFA 3AD8C 3MPDA 3C14B 4Q44A 2NXJA 2BEFA 4QIWD 4N56A 4USIA 2YVSA 3B6BA 2XSJB 3EE3A 3THVA 4DR5F 2QV6A 4USJC 4N77A 1ZBTA 2NLWA 1V9OA 2OEKA 2JEJA 3DLJA 1DTQB 1U6BA 1RP5A 2VV5A 1YBTA 3OTCA 4OV6A 3VALA 2MTLA 3TA2A 2Z57B 3W5XA 4KKOA 3LPEA 3C6UB 3D67A 3CCJS 2HSEB 2ZH6A 4OZ5A 3NOCA 1TFYA 1RHQB 4IFVA 4LFCJ 3W2WA 3D28A 3BV8A 3IWLA 3M8RA 5KFNA 1SJQA 5A8RB 2BJEA 2BBEA 1RAHB 3MM5B 2KN4A 4YOEA 2Z4PA 1RWVB 1KQKA 3M2VB 3P96A 3QT5A 2BKPA 1LW0B 2AX1A 2HFUA 3NS6A 3UD3P 4XPEA 2XWYA 3UCGA 3PHTA 3PIOQ 3BO2A 3ZZRA 3FC9A 2OELA 2PGCA 1CQNA 1N4LA 5E5NA 2OSQA 2Y1JA 1ACMB 2CQ0A 2W2NP 4PG6A 3FMBA 8AT1B 1OS5A 4QCLA 1Y3JA 1FI4A 2FZKB 2YKNA 3BO3A 2FHKA 4U7UK 3A12A 4P7VA 1L3TA 1NK5A 1VOMA 4ID5B 5BYRA 4TXSA 1S57A 4LF9F 1B0PA 4LRBA 1RABB 1FJ7A 2QA4S 3ILIA 3PW5A 4WKRA 2VA2A 3M1VA 2ASYA 5CYMA 1T02A 5KFLA 1PCAA 1LXJA 2GA7A 2CPZA 4PXCA 5LMNF 1RT1A 3CC7S 1MN9A 1TL1B 3M8WA 2D9PA 2AHOB 3TZYA 2DIUA 4ETXA 4TY8A 1HWKA 1WKJA 2E7XA 4N41A 2PI4A 1HKAA 3QJPA 3DLHA 4WF9Q 3PX0A 5DDOC 1JLCB 1NUEA 1KOHA 5ETRA 2UVUA 2YKAA 5KT2A 3MR2A 1SJ4P 2DNHA 2DXDA 4PWDB 3AA8A 4CZCA 2C28A 2QG9B 4L6V3 3QT7A 5LSLA 1IJFB 4G1IA 3IA0A 4PEOA 4DR5J 1FF2A 1VBXA 2VF3A 2UUTA 4NMLA 2JLGA 2M52A 4CO5A 2XGQA 2LCWA 2DGVA 3QNWB 4ID8A 2MJNA 3GJSB 2B5JA 5AE3A 3CGIA 3D6HB 4KT0C 2CZVC 1RT4A 1R8AA 1KC8T 3BKFA 1NM2A 3OR1B 2AJ1A 4U95A 1HMVA 4NYOA 2VJVA 1Z2ZA 4QYZJ 3CUNA 5EWFA 4DFKA 4FF3A 1URNA 2DNOA 1SH3A 5HMXA 1VC5A 2KT3A 3D1QA 1YQHA 4ZJQA 1WC3A 3F73A 1OPZA 3GJTB 2FVPA 1WUUA 3H98A 4LRDA 2HRUA 3CB4A 2HBQB 2KT2A 1YJ9S 3NWRA 3J7YU 4HTIA 4D3HA 3H90A 4DL0C 7AT1B 3QAEA 4DWIA 5LT5A 2BQRA 1UVIA 4QJVA 3OL8A 4KY3A 3CJRA 1IWGA 2DRAA 3FKBA 3NGTA 1XMBA 4DG1B 2YBVA 3RZAA 4DXLA 4OJ1A 3OHBA 2V2VA 4ZPWR 4LF4F 3O1LA 2XB2D 2EVZA 1RBLA 3M2RB 1YJWS 1U2FA 1AZSB 3G82B 2DGQA 4ECUA 2W9BB 1TV6B 3ZZYA 2Y9HA 3G71S 1KLMA 1IKWB 4LR7A 4I6YA 3RB0A 2W7AA 2QE5A 4X4RA 2PN6A 5LMNJ 2Y0SD 4YQWA 1ZPVA 1WF1A 2GO9A 3POTB 2IMWP 2QC3A 4OX9F 5GAHI 3HSDA 1WOOA 4P7TA 1RACB 4J9UE 4N8OA 2YNGB 2ZJPQ 2K3IA 4OI6A 1V3RA 3SDEB 1RTJB 1OSCA 4BWMA 1ZETA 3TX0A 3W60A 3OR2B 5DG8A 2XY7A 5H9FK 2MZSA 3CCVS 2VG7A 4RUBA 4P72A 5CZVA 1RYRA 1QM9A 1LFWA 4ZCMA 3FSXA 2NZ4A 2YKMB 3OLAA 1VJQA 1E6VA 3PRBA 3CJ4A 2FVQA 1Y00A 2QMUB 2QSWA 3OVSA 1T9YA 1JLEB 1H2TZ 5F9NA 2MHEA 4LBPA 1S72S 2HGLA 2JZ5A 5EDWA 4U67Q 3U27A 3GV5B 3H5SA 2LU2A 1EETB 2IM2A 2MY8A 1M5VC 3DNCA 1JNZB 4ILRA 2V4RA 3I0RA 1SJRA 3CCRS 1M0SA 2EC0A 4W4MA 4W90B 2RJZA 5CYQA 1YRUA 3NBPA 1JJCB 3W66A 1VRTB 4WK3A 4RW4A 4Q43A 3LTOA 3AQPA 1U1OA 1C0TA 1Q8KA 3OV7A 2WONA 3H42A 4ECZA 2E5LJ 5KFTA 2XS7A 5B0DA 2W7OA 2HS0A 4OZ2A 3I4PA 1W25A 1WG5A 3L3CA 3DRPB 2V69A 1CJUA 2O67A 4NL5A 1Q4RA 1JJ2R 3MR5A 4JB8B 3HKZD 3NAHA 1FJCA 4HT7A 4OI4A 3W2VA 3G6VA 1JLQA 4IR9A 2D7SA 4EYIB 1T11A 3C2PA 3UD4P 4LF4J 2PEBA 3KMQA 1TKTB 1VISA 4RL1A 3QO9A 3L7PA 2BW2A 3CCTA 4IRDA 4DLEA 1IKYA 3DOMB 1U1KA 1QSLA 5IM0B 2R42A 5HI7A 2YNFB 3CJ8A 4CP5A 5HQMA 4MKBA 1WC5A 2HWIA 2WW8A 2CJBA 2Y8WA 2AEJA 1P1TA 2E1AA 3W5YA 4XAKA 4FYXB 3I55S 1SUQB 4FN5A 4PABA 1PKUA 4ZVQB 2C22A 2GIFA 5F0WA 3DGVA 2JSXA 3UD5A 1DARA 5HANA 4OX9J 4P73A 3HVTB 5K20B 2LLZA 3PO5A 1T03B 2KM8B 1WSVA 1I51B 1S5ZA 1XWLA 2XMVA 1NRKA 4DFPA 3VAJA 3GU0A 1TKDA 4Y65A 2WOMB 1F5AA 4O3RA 1RQ0A 4F25A 3DGPB 4JI2F 3OSPA 4B3OA 4O4RA 3BQ0A 3CD6S 4AL7A 2AJQA 2GVZA 1SB6A 2J5AA 2ZZTA 2V50A 3OSNA 1D3WA 1D9AA 4ZCLA 4AD6A 4ZVTB 2ZBCA 1JB0C 5IT9U 4AL5A 4E98A 4RW9A 4DX6A 3BQ2A 1C1CB 1GQEA 1NHVA 4YDXA 2MQPA 2E7VA 3H7HB 2GQCA 5F9LA 3B4DA 1JLFA 2UUWA 5K8MA 1H38A 2JEGA 4G3IA 2CKWA 4CLTA 5L1JA 1FKAF 3DOKA 4DR2F 2QTWA 3AB2B 2ZC3A 2B43A 3MR7A 4C0BA 1UEKA 2HNYB 3TVKA 3RJMB 4UOGA 3D1HA 3MXHP 3W61A 3RW6A 3KK1A 4FS1A 4OI2A 2NUUG 3Q8UA 5KG0A 4WPAA 2KZMA 3LP2A 4WFYA 3DI6A 4RBTA 4O44A 3SSSA 3MEEB 3ONQA 1RWPB 2R8IA 1TKXB 2W2PP 4NLTA 2FGOA 2YPYA 1RWWB 1TZ0A 5KG4A 4CLZA 2NQPA 3OHAA 5IWAF 3M6WA 3Q83A 3JB9k 3SZ2A 2CJAA 5IS2A 3NY0A 3LALA 2XBPA 5U47A 5F8MA 1WNEA 1T9TA 1U26A 1IBKF 4JV5F 2IAJB 2FHJD 3PNIA 3FRZA 4DI6A 3HK2A 3HFZB 1F5BA 4KJIA 1E6YB 2JC0A 1HNIB 1WC0A 4NLYA 2L9WA 4JI7J 1T0TV 1CJVB 3HSGA 3NWGA 4I2QA 1VDHA 2F63A 1FDNA 2OPSA 4IOAQ 4YB1P 2DKOB 3GMGA 2OTJS 1JXLA 5JUMA 3KFWX 4K4XA 5J2QB 2ROPA 2KJVA 3KLGB 4B3MF 4DJBA 4DPOA 2I9SA 3UQSA 1VGYA 2HQCA 2KG1A 2VBXA 3CJ0A 1RYSA 4USTA 5A8WA 1OY8A 3ULHA 4N7TA 2EKNA 5DGBA 2MEWA 1ZAXA 3WHIA 1SJ3P 4EO8A 1Q78A 2GHWA 1UPMB 4KBIA 1KTVA 4X4PA 2WVDA 4IG0A 4CCHA 1YRXA 4IKAA 2XMAA 4YR2A 2ZDOA 3ILJA 3A8JA 2DGSA 4F36A 3OL7A 4ES3A 1Q95G 2VZ9A 3OTOF 3JYTA 5IXUA 4O0NA 2F4FA 4F4WA 2NZCA 2DCUB 3BBBA 5GAGU 4EZ6A 4NASA 4DN9A 2VODA 3GILA 1KVJA 5E3CA 4DR2J 1WTBA 1SIWB 4ZPVR 4WE1A 1OQ6A 3UFCX 2VIHA 1XR6A 3C6TB 5LL6d 1T7PA 4C0HA 5HVFA 2DR5A 2R7SA 4YR3A 3BREA 5FIIA 3CVKA 2IJFA 4RU2A 1K73T 2FJEB 4GVBA 4USVA 3GV7B 4OHYA 2LXUA 1HBOA 5IWAJ 2ZM6J 3X3UA 1CS4B 2N3OA 5LSRA 2QA2A 4QBUA 1KN6A 1QAJA 3M2UA 4FKXA 4R25A 1IBKJ 2CJKA 4FYDA 3JQKA 4DUTA 3ZXWA 2BOPA 2J6UA 3FCVA 2J0SD 4OYXA 3UPFA 3W9IA 2UXDF 1Q8BA 1Q82T 3PFOA 4ZVPB 1K44A 4MIAA 4ICLB 3R5JB 3TA1A 2OEMA 3EM1A 1BD6A 1FX2A 3FJ2A 2RS2A 1SQGA 4RW8B 4QIVA 3HPOA 2V68A 4DV0F 1HNXF 4NLOA 2WBRA 2P6SA 2RU3A 1C4AA 5EUHA 2CVIA 2PC6A 2DH7A 1FERA 2GVDA 2E1PA 2CPFA 3MM6B 3FEZA 2VQEF 1UWBB 3KK3B 4RO0A 2E29A 3OPKA 2F8MA 4EGLA 3G6XA 4JI6F 4HDHA 2N7CA 2LA6A 1BHNA 3NGUA 1KQFB 3J7A1 1TQLA 3OVBA 4DSIA 3RB3A 4HACA 1QAYA 1F3VA 4WTYA 4NLVA 4QIGA 1G4CA 1N32F 4ZLNA 5KFPA 2R8JA 4C8NA 4LF5F 5GMEA 5H9EK 2KXHA 4U8VA 1FEEA 2NXNA 1HW8A 1JLBB 3SCJE 5D8HB 4WYWA 4B9TA 2HYIB 2QL7B 4ES1A 4NXMJ 4DV6F 1S99A 3LWMA 2BXJA 3MTJA 5DETA 4CT8A 1DZ5A 4A8MP 3M6UA 1DTQA 3SFGA 2O01C 3R7BB 5K5MA 3C66A 4C9DA 1SC3B 3OUYB 3T19A 5KFRA 3OTOJ 2FLPA 3L09A 4J9LA 2DO0A 3WC2A 2IDEA 2RSQA 1T9VA 1VQ6S 3AOBA 4Q0BB 4ERDA 2D41A 4NLSA 4J9OA 2HFZA 1CPZA 1N48A 5D0HA 1RWKB 3MM5A 3THTA 1M5SA 1JLGB 5A2QY 1RAEB 2R2TA 5HQLA 4DV2F 3W3SA 3M2VA 3RW7A 3T3FA 1LW0A 4O3PA 2CNLB 4OHZA 3L95X 3HHNB 1EQ0A 3PDNA 4DCJB 4RUHA 1LV5A 1P9YA 3T9ZA 2H5EA 4FBTA 5D15A 5GMKa 3ITHA 4FBUA 3IGVA 2ZZMA 3I9ZA 1TU0B 4F2SA 1OYDA 5D0GA 1Y0HA 2NXUA 4J9SA 3DDIA 2DR6A 1HPZA 3W8PA 4ID5A 4DUZJ 1EZZB 2EFVA 3MI7X 4DLGA 3RRHA 4IQMA 5G0RB 4C11B 1S76D 3GR0A 1WEYA 3H59A 1SVDA 2KKHA 1DHMA 2UXDJ 1QAXA 2C2KB 1MU2B 4CO1A 1Z1ZA 1U45A 4ECRA 5AXLA 4M5GA 3MMAB 3HM9A 1X31C 4DV0J 1HNXJ 4P2XA 1XQIA 1TL1A 1J5OB 3FGVA 3N01A 3OFFA 3PTWA 3VAFA 2I5JA 1U2CA 2VQEJ 3ETMA 5D4PA 2X1AA 3TUPA 4DV5F 5E3QA 4DF4A 4JI6J 1SBRA 3ELHA 3BM7A 4DX7A 3RAQA 1FKPA 1YK9A 1SKSA 4GVLA 4WKYA 4RUAA 4MKYA 3N79A 3SQGA 3I31A 2MKHA 6AT1B 3AD9C 4GO5X 2EI5A 4RPFA 4LF5J 4QW8A 4JUZA 4DPUA 3PFEA 5KT6A 5L38A 2V6AA 4KGZB 1VQ8S 1NBEB 3UDLA 1R7IA 2CQCA 3C16B 2X1FA 4DV6J 3FCWA 4OHXA 2E1MC 3DOLA 2XYHB 4K8RA 2EK6A 2MQQA 3N4WA 3HO1A 3TNVA 4B9NA 4KFBA 2BDPA 2YH0A 3FMWA 2AZ1A 5C24A 3CJKB 2ZC4A 3D0HE 5A0YB 1LQ9A 3OBIA 2QLJB 1GMWA 3OR1A 2OHDA 3N9UC 4LBIA 1HWLA 3ISNC 1U1NA 2AW0A 4A46A 1HL6A 1WF0A 1SH0A 2W2MP 1T05A 4OV1A 4I69A 3E01B 1ZZFA 1X4EA 2IBKA 5JXSA 1YHQS 3O5TB 3HXMA 1KVIA 4KV8B 4RWXA 1K1QA 4K5SA 4YB7A 2LYVA 3B8HA 1BUXA 2KB2A 1RA7A 3P4UB 2NUHA 4ZK7M 5J1NA 4M94A 4JBCA 4NYZA 4CLFA 1OO0B 3HHLB 2M3DA 1IJEB 1DFDA 1JLAA 1R6VA 4DG1A 1SQEA 1WORA 3W8GA 4QPTA 4LF8J 2VBZA 2HK2A 3PHEA 1TAQA 4UUWA 2C42A 5KFBA 3TRGA 5IV3A 4UOHA 1T8EA 4B02A 3G82A 4LSLB 3UDCA 2W9BA 1TV6A 1NSPA 2B51A 1IKWA 1JJ4A 4M63A 5I3UA 3Q0AA 2W9CB 1ZAWA 3MF5A 3VQSA 1F9FA 4JI3F 1R0AB 2AEFA 3BN7A 3I0SB 2L9NA 3POTA 4NPOA 4JV2A 2RE1A 2D1CA 1NLKL 1UA0A 4DR7J 5D4NA 2J9DE 1RAIB 3KOAA 4YR0A 5KFIA 2YNGA 2AZ3A 7FDRA 3SDEA 2ASLA 1RTJA 2GQ2A 2IMOA 2WBMA 1BE4A 5JMNA 4ZP8A 3OR2A 3DRYA 4KO0A 2MLXA 4DV7F 3MZIA 5D77A 2YWWA 2LA4A 1VS3A 2R3VA 3JQJA 2GIRA 2ZD1B 5IT4A 3TVZA 3NMAA 2YKMA 1XERA 4X62F 2WSCC 1VMBA 1K9MT 1JLEA 4PXDA 1NZAA 2HNDB 3M8ZA 5FLXY 4F3OA 3BGFA 4OX7A 4Y0FA 2OP5A 1FD8A 4O3OA 1WEZA 2R7RA 4ANDA 2VBWA 1NH8A 1EETA 5G4DA 1NEEA 1CVJA 2W01A 2ROGA 3K5MA 1M1KT 1IR0A 1S49A 3A3OB 4ECWA 3UR3C 3ZZ0A 4DSKA 4CO3A 2LXIA 2BJ9A 4EWTA 4B3TF 3SSRA 1IKXA 4PG8A 4NLQA 1FCAA 3PX4A 1S0NA 3G8TA 2HFOA 4I6WA 4RW6A 2IIHA 1PG5B 3QRPA 2RRNA 1RTDB 1YBAA 5HATA 1TL3A 4CLWA 4CIOA 1FNOA 3HHLC 1RTIA 4P52A 3H2UB 3HT0A 4RLEA 3K5NA 4LQ3A 4WU2A 5I42B 3G87A 4L3KA 2L08A 3DRPA 2DBBA 3CDEA 2RQKA 3V81B 1KHWA 1VR6A 4F02A 4DF8A 3S01A 1FE0A 3KLIB 1TL5A 2YWFA 1TMMA 3CNQP 4DS5A 1VBZA 4F3QA 1TKTA 1QVFR 4OZ3A 4FYYB 3HX9A 5IM0A 3U1MA 1FTCA 2YNFA 3T9NA 3IG1A 1FRHA 2ZWOA 3LAKA 2MGZB 3C3LA 5HO4A 2AYGA 5HROB 1L3VA 4JI3J 2PD1A 2ZOGA 1OY6A 4EYHB 1TL4A 3I87A 1VLYA 3EVWA 3TX8A
chains in the Genus database with same CATH topology
3J81j 3CW2C 1YZ7A 3QSYB 2QN6B 2QMUB 2AHOB 1YZ6A 1Q8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J81 j;  3CW2 C;  1YZ7 A;  3QSY B;  2QN6 B;  2QMU B;  2AHO B;  1YZ6 A;  1Q8K A; 
#chains in the Genus database with same CATH topology
 2C2D A;  3HVT A;  4K2X A;  3RR8 A;  2A18 A;  2YX1 A;  2GZO A;  1T03 A;  4C98 A;  2OH2 A;  5B09 A;  2XYP B;  1S4E A;  1NJZ A;  3MFH A;  3NCP A;  2K1R B;  5DDP C;  2WOM A;  4ES2 A;  1HD0 A;  4CH7 A;  2CYY A;  1EJ7 L;  4AUK A;  4DV7 J;  3BR8 A;  4DS4 A;  2E9R X;  4DL2 A;  2BAC A;  3N6L A;  5CCL A;  2YWH A;  3RAM A;  2FTR A;  4QR2 A;  2BJ3 A;  5B0F A;  5DJB A;  4V1A k;  2VD3 A;  4X62 J;  2DY9 A;  2CPD A;  2SXL A;  3EGN A;  3PW0 A;  2R8K A;  3KNA A;  1S6P A;  3PKM A;  4IDK A;  4JOU A;  1S6Q B;  3IO1 A;  1ZPW X;  3OVA A;  4DV1 J;  4P74 A;  5ETV A;  2K3K A;  4QPX A;  1K1S A;  1FRL A;  1FRK A;  1IVZ A;  2RQC A;  1D9F A;  2QL5 B;  2CQG A;  3PVX A;  3IR7 B;  3W1Y C;  2XS5 A;  3MEC B;  1R0C B;  3G6E S;  2CZ4 A;  1ZM9 A;  1B7F A;  4B9M A;  1N0U A;  2AV5 A;  4B3T J;  3FSY A;  4KRW A;  3GCX P;  1T3N A;  1A7G E;  1OJ4 A;  1PYT A;  3BSA A;  3QZ8 A;  4JI4 J;  2CIM A;  2HUR A;  1NPR A;  4F8R A;  3OJS A;  2ATL A;  4F4Z A;  2HNY A;  2J9C A;  1B0V A;  4F04 B;  3FK4 A;  3EVO A;  2FJX A;  2KG0 A;  2CPE A;  3MEE A;  1TKX A;  3KJV B;  3L7O A;  3G2X A;  1LK5 A;  4OI1 A;  1GH8 A;  3JTP A;  1D8Y A;  3NNA A;  3K89 A;  2FD2 A;  1L3K A;  5EGY A;  3BB5 A;  3V4I B;  1RTH B;  1FRX A;  4ZN3 A;  2XLI A;  1E6Y A;  1IBL J;  2FZC B;  5C2G A;  4MK9 A;  4AE5 A;  3GJQ B;  2EW9 A;  1CJV A;  1D1U A;  2RAQ A;  2RS8 A;  5LSO A;  5L1L A;  4WWS A;  3VCD A;  2UVV A;  1Q16 B;  4KYZ A;  3VWS A;  4DBQ A;  1H7X A;  3IC1 A;  1X4A A;  1H73 A;  1NH7 A;  5DDR C;  2NXC A;  2D69 A;  3NCQ A;  1HNZ F;  1UEV A;  4YP3 A;  3GSI A;  2VPW B;  3KLG A;  1RAG B;  5A6P A;  3FBF A;  1ULR A;  1FVS A;  5B08 A;  5C42 B;  3T1A A;  4TLQ A;  4E2F B;  4CO2 A;  4ENO A;  1FX4 A;  2IJR A;  3CCE S;  3H2V E;  1FNX H;  1YIJ S;  1FT8 A;  1FKO A;  1XNR F;  3MPY A;  3M30 B;  2P5V A;  4Q2L A;  2JC1 A;  2CJY B;  1Y5I B;  3M8Y A;  4GMK A;  1PAE X;  3K5P A;  2IDL A;  5A2Q U;  4IYQ A;  4OYM A;  1D9D A;  3GYX B;  3GON A;  3DRR B;  4LSN B;  4ELT A;  5GVQ A;  2IVM A;  1W26 A;  3MOZ A;  1GXL A;  1S1X B;  1R89 A;  3MMB B;  3G9C A;  2WTF A;  1CJK B;  4IG3 B;  2PA8 D;  1FVQ A;  3CJQ A;  2CDQ A;  5DDQ C;  2WVE A;  1JIH A;  4RNO A;  2P2C B;  4H4M A;  3TP2 A;  2A2C A;  2GIQ A;  2DRB A;  2RT3 A;  5HL7 Q;  4M5L A;  1B99 A;  2VKR A;  3BYR A;  3QGG A;  2M70 A;  3R3T A;  1W2I A;  3GIR A;  2NSC A;  2G9O A;  1UFL A;  2LDY A;  3VVU A;  4PRF A;  1GNK A;  1S1U A;  2QLF B;  2XSF A;  3CMQ A;  3DRS B;  3IGN A;  2JH3 A;  1RT7 A;  1X9M A;  4ED2 A;  2RRB A;  4TLR A;  2E66 A;  4BLG A;  2KFN A;  5ETO A;  4DQS A;  2UV8 A;  3MMC B;  5EX0 A;  2LQ9 A;  1CS4 A;  3A3N B;  3J80 U;  3ZZP A;  1T3O A;  3CPW R;  2ATC B;  4FXD A;  2XHC A;  2CUY A;  2H3E B;  2IC3 B;  1HLW A;  1WEL A;  1QVG R;  4PG5 A;  3HHD A;  2DRD A;  2B8P A;  2GO8 A;  4OMF G;  3KUH A;  5BJR A;  2GS8 A;  4M5D B;  2ZKT A;  2HS3 A;  4ICL A;  1X7V A;  2DT9 A;  3IRX B;  1RT2 B;  5KOW A;  2XMK A;  4RW8 A;  3CC2 S;  3CMA S;  5JVG Q;  1VQL S;  4QU6 A;  2JLE A;  1B3T A;  1RHR B;  1T9X A;  1S1V A;  1NSK L;  2ASD A;  4RBV A;  4A8Q A;  1ICE B;  4XTT A;  1PC4 A;  2BAN B;  4DDF A;  1HNZ J;  4WJB A;  4K4W A;  4DR1 F;  1TR0 A;  3MM6 A;  5LMU F;  4EU0 A;  4LT6 A;  4K50 A;  1QSS A;  2Q66 A;  3EZU A;  2XWX A;  3MD1 A;  2CWK A;  3MUR P;  3DN9 A;  1N5Y A;  3EZ5 A;  1XNR J;  4JI1 J;  1R8P A;  1GMW D;  3NOG A;  4M8L A;  4K0K F;  4LUB A;  2OFH X;  5EWE A;  4KGM A;  1WHW A;  5J1P A;  1S6O A;  2KRR A;  1JLB A;  3NCR A;  4JI8 J;  1F6T A;  3VF0 B;  1I1G A;  2F65 A;  1N5V A;  4MMO A;  4B17 A;  3VGS A;  2RF2 B;  2RHS B;  4EBD A;  3GIK A;  2XMT A;  3C8Y A;  1NKE A;  3M6X A;  3KXD A;  2LEB A;  3I5A A;  3OUY A;  2HVE A;  2CQ3 A;  4O3Q A;  3DM2 A;  3G86 A;  2XMW A;  2PFF B;  3DMJ B;  1QY7 A;  2O5D A;  1TVR A;  3KMS A;  3CSK A;  2HFS A;  3ZZO A;  4X4V A;  2VPZ B;  2ZH8 A;  3RAX A;  1X0F A;  4WBF A;  4L73 A;  3RBX A;  4FZV A;  2R7U A;  5F0U A;  3M05 A;  2F8E X;  1S59 A;  2F40 A;  1HNV B;  4X64 F;  1W7W A;  1TUW A;  3MUM P;  3ENQ A;  5M2P A;  5AE1 A;  5IQ6 A;  3BH6 B;  2QLW A;  1P1L A;  5KOX A;  2BAB A;  4MIB A;  2H1Y A;  2KFZ A;  3RBE A;  3UO0 A;  2V5H G;  2IFX A;  1U0S A;  1L3U A;  3OFH A;  2MB0 B;  2FGC A;  3ILO A;  3DCA A;  1N33 J;  4N76 A;  4U96 A;  1WOS A;  5E2Q A;  2D3Z A;  2QGF B;  2G0J A;  3DXB A;  2NYI A;  2HVZ A;  2AX0 A;  4ZPT R;  1BXN A;  2CNK B;  3PCO B;  3SCI E;  4KB7 A;  1HBN B;  2P9G A;  2QZ8 A;  1S0M A;  5G0R A;  1C1B A;  3TO8 A;  3UCU P;  5B0C A;  3KLE B;  3SCL E;  3AAW B;  3DFE A;  4PZV A;  2C2O B;  3JQM A;  4PQA A;  3CCU S;  3BO4 A;  4ZMM A;  8RUC A;  2PT0 A;  1NKB A;  5HN0 A;  2BMB A;  3HVA A;  1S10 A;  3MM7 A;  1NND A;  4PQU B;  2FLL A;  2XTJ P;  5LJ3 Y;  4EEY A;  3HFV A;  1Q7L B;  1NDL A;  4ZVU B;  5FLX U;  1YJ7 A;  3ZO7 A;  1PGZ A;  3TEG A;  2GML A;  2CVE A;  4DR1 J;  2MKI A;  1WI8 A;  5K8N A;  2BV3 A;  1AUS L;  2BE2 B;  2DR8 A;  4X84 A;  2XEX A;  2HHU A;  3OD2 A;  2CAD A;  4NMX A;  5CZX A;  4J5O A;  3I56 S;  4WP3 A;  1NPK A;  3MUV P;  2OPP B;  2R8G A;  3VHQ A;  2H9Z A;  2E9Z A;  2JVO A;  1RJJ A;  3OFG A;  1U4B A;  2A2D A;  2HHS A;  4NYP A;  3M4X A;  3BJY A;  4NZ7 A;  5MAO A;  4B9U A;  2WHO A;  4IOC Q;  1VHI A;  4QOT A;  4XPC A;  2FIU A;  1G7C B;  1FD2 A;  3TOQ A;  3QGH A;  4I0W A;  3C16 A;  2GQQ A;  5AXN A;  3TA0 A;  5KG5 A;  3L9Z A;  1Y3K A;  4WFZ A;  4DHV A;  1RT5 A;  4WFN Q;  2RDJ A;  4ZP6 A;  4R5P A;  6FDR A;  4FP9 A;  3DDK A;  4KAI A;  2OPQ B;  5KG3 A;  5A0Y A;  3QRQ A;  5ITH A;  4FPR A;  2J9D A;  1U2R A;  1FDD A;  5KFA A;  5DS7 A;  2BKN A;  2VUG A;  2EPI A;  2AJF E;  1F60 B;  1SV5 A;  1U1P A;  3C15 B;  1HBM B;  4HYK A;  2UU9 F;  2FLO A;  4LRF A;  1RWO B;  4QWE A;  3M8Q B;  2AGO A;  4YHH F;  1U24 A;  2ZEJ A;  3PRV A;  2LEA A;  4QWB A;  1XMO F;  4DCP B;  2EEY A;  1ZM4 A;  5L39 A;  4KV8 A;  2EWH A;  4FVM A;  3RYL A;  1NB2 A;  2LQJ A;  1KTQ A;  1CSJ A;  2G1H A;  4UF4 A;  1WTF A;  2UVR A;  3DHX A;  1D0E A;  5DRK A;  4L3N A;  4ED6 A;  3R7S B;  3I5C A;  3PO4 A;  2VPY B;  3HHL A;  3R5C A;  1SH2 A;  2YQ3 A;  4IRK A;  2DNG A;  2F4V F;  4ZPB A;  2HHH F;  2JL9 A;  1TAU A;  2JEF A;  5B0E A;  2PI5 A;  2X51 A;  1WC4 A;  4ZP7 A;  4PUO A;  1IKV B;  4LSL A;  3JTN A;  2Z2Z A;  1C0U B;  2JOQ A;  4Q5V A;  1NAQ A;  4OJ3 A;  3EYZ A;  2W9C A;  3KLF A;  1FO1 A;  4F0K A;  1OQ3 A;  1R0A A;  2BQ3 A;  3G96 A;  4ZIV A;  3MCM A;  4P2S A;  4MTP A;  1WSR A;  2WVB A;  2AYE A;  1SI9 A;  5KFG A;  4C8Y A;  1F9E B;  2GAG C;  2VDH A;  1AW0 A;  1XTZ A;  3PAC A;  2IHR 1;  2D3U A;  4TNO A;  3CUL A;  1DUR A;  1RT3 B;  1RBO B;  1RHK B;  2BYC A;  5K14 A;  5C25 A;  2DR9 A;  3DYA B;  4LSZ B;  3H4B A;  4I6A A;  1CJT A;  2GMH A;  4LRA A;  4EO6 A;  1TKZ B;  2IM3 A;  4KH1 B;  1H3D A;  2MQO A;  1TL7 B;  1S48 A;  2ZOF A;  5BYS A;  1Q8I A;  4NI2 B;  5B0A A;  5DO2 A;  3B78 A;  4EZ9 A;  4DUY F;  1VQS A;  3EGV A;  1FFG B;  3HJV A;  3R7N B;  3TEH B;  3RB4 A;  3QBC A;  2QLX A;  2YNI B;  2DNM A;  4KIA A;  3W7B A;  3A8K A;  1RE1 B;  1LWC B;  3RBZ A;  2MZR A;  2FJW A;  4ELU A;  4LF7 F;  6FD1 A;  3LP1 A;  2UU9 J;  3K57 A;  1G6B A;  1RA6 A;  3ZZU A;  1GTH A;  3OTD A;  3EZO A;  2VFT A;  3CCW A;  1MSW D;  5J2N B;  4YHH J;  4MT1 A;  3J7Y I;  3ZNJ 1;  3D54 A;  3FDS A;  1R0B G;  1XMO J;  2OSR A;  4NLP A;  1VQ5 S;  2FC8 A;  2MSS A;  2YX4 A;  4Z7C A;  3U02 A;  4IFV B;  1UET A;  3UCZ P;  4I1T A;  3J7A N;  1S9G B;  4X66 J;  3HT3 A;  5I42 A;  2V0N A;  1UEU A;  4ED7 A;  3M9M B;  2OO4 A;  2FPH X;  3OL6 A;  2K7K A;  3GLJ A;  1TUG B;  4ZJO A;  4WIQ A;  4MJK A;  1SXL A;  4W92 B;  3KLI A;  3CJ2 A;  5CAA A;  2F4V J;  2HHH J;  3EGZ A;  1HNW F;  4QWA A;  4UY8 T;  1ZM2 A;  2CAJ A;  3K5L A;  3L4B C;  4X4S A;  2OPR A;  2JEI A;  3R5A A;  2RRA A;  4H4K C;  4IUF A;  2YX7 A;  4RW7 B;  1PO6 A;  2LU1 A;  2YKN B;  1KFD A;  2O1P A;  1WOP A;  2MGZ A;  3CF5 Q;  4ZVR B;  2UUC F;  5HRO A;  2CNN B;  2ZHB A;  2PA3 A;  1M5P C;  3N5B A;  4ILL A;  2IYI A;  3LPY A;  3QQC D;  2YTC A;  3UN5 A;  2XHW A;  4CO4 A;  2HFV A;  2DHG A;  1CUL A;  1FWP A;  3OTB A;  5LXR A;  1RAD B;  4LVN P;  3T1Y J;  3OXL A;  2Y8Y A;  4ED1 A;  1YIT S;  4LF6 F;  4AXI A;  3ET6 A;  1PSD A;  3BGR A;  2NPI A;  3KG4 A;  1LWF A;  4Q8F A;  3BKU A;  2J0W A;  3E51 A;  3RG6 A;  3LGM A;  2FLN A;  1AUD A;  1N54 B;  3LO3 A;  4I68 A;  1S7H A;  3FEY B;  1V6H A;  4O3S A;  1S6Q A;  4WCE Q;  3JTO A;  1UAW A;  3W62 A;  4PG7 A;  4DUY J;  1MML A;  4OFZ A;  2IVF B;  4JV0 A;  3QID A;  4ZCI A;  2AP6 A;  2J76 E;  3QLH B;  1RLC L;  4Q8E A;  7FD1 A;  3V6D A;  5DM7 Q;  3GQC A;  1DQ8 A;  2W7P A;  4MIW A;  2RD5 C;  2VAS A;  3MEC A;  3M7V A;  1A0O B;  2GW8 A;  1MMN A;  4NZ0 A;  4X2B A;  5A8K B;  2PDA A;  1KFS A;  4WZQ A;  1SIZ A;  2BM1 A;  2B5J B;  1XEZ A;  3QFW A;  3WQP A;  4YUD A;  3BGU A;  2PFD A;  1UZD A;  2H5J B;  2J7U A;  2BA9 A;  3IWX A;  4P10 A;  4ER8 A;  2XS2 A;  2HLU A;  3HKW A;  4OYI A;  3W63 A;  5CXT A;  3KLH B;  4ETZ A;  2QSF A;  5D78 A;  2XM3 A;  4BBY A;  1UMJ A;  5H9F J;  1HR0 F;  5LOQ A;  1RHJ B;  2OKQ A;  2G4B A;  4DFM A;  1UVN A;  3D0G E;  2RHQ B;  2W8L A;  1YI2 S;  1N56 A;  3IP0 A;  3JSM B;  3PYE A;  1S9F A;  3QRR A;  4I2P A;  1U47 A;  1NK4 A;  1NHK L;  1KON A;  4RNM A;  1HNW J;  4LF2 A;  5I3Q A;  4ZVO B;  1RTH A;  2ZH2 A;  1KWM A;  4ZS6 A;  3X1L B;  1S77 D;  2Q1L A;  1B70 B;  4WZM A;  3H25 A;  1I6J A;  3WIV A;  2ZBR A;  2M8D B;  4RNN A;  2UUC J;  4IQX A;  1YJT A;  2DNR A;  4ZCK A;  5IOL A;  3MUT P;  2AJ0 A;  2FJD B;  2UUA F;  3K5O A;  2DNN A;  1BMQ B;  4Y00 A;  1SCJ B;  5J2P B;  1NK8 A;  1QE1 A;  3CO0 P;  4U8Y A;  2GMJ A;  5C42 A;  3KHG A;  3RUB L;  3TZW A;  5KFM A;  3D2W A;  3HVR A;  4LF9 J;  1V3S A;  4KC5 A;  3MOJ B;  4LF6 J;  3K59 A;  2J6T A;  2V8H A;  5GMD A;  1UVL A;  2VHG A;  2RIJ A;  3QSI A;  3QJJ A;  4NA3 A;  2KO1 A;  1B4S A;  2HNZ B;  1VYA A;  1VK3 A;  4LR8 A;  2B4P A;  3DRR A;  3QAT A;  4NLW A;  4NE9 C;  3ISN D;  3RB6 A;  3MHY A;  3Q8P B;  1CC7 A;  1E6V B;  3VZH A;  2XI3 A;  3MMB A;  3R5D A;  1CJK A;  4IG3 A;  1MN7 A;  2LFV A;  4KGX B;  2C2M B;  2Z2M A;  4WTO B;  3EMT A;  2CDR B;  1U6Z A;  2HMI A;  4KPC A;  2D9O A;  4MK8 A;  4A8K A;  1LNQ A;  3D66 A;  3I0R B;  3MR6 A;  5KFY A;  3CT9 A;  4ZHR A;  3QT8 A;  2W24 A;  3VVT A;  1OYE A;  4EBE A;  4LFA F;  1FES A;  3NBP B;  3THP A;  2MKJ A;  3CDW A;  2RNE A;  2B0G A;  4G1Q A;  3UVJ B;  4HLB A;  2HZA A;  1JNR B;  5CD4 H;  5KFV A;  3KTQ A;  3PYD A;  4RW4 B;  3MMC A;  3ZTS A;  1PJ7 A;  3D1O A;  1C0T B;  2LXF A;  5EHH A;  2WON B;  3AB4 B;  4E8U A;  2HPU A;  4M5M A;  4ZOS A;  5E7O B;  2VPX B;  3PW7 A;  5FDL B;  1Z4U A;  2XQC A;  1M90 T;  2MKS A;  2VG5 A;  1CJU B;  3A13 A;  3MAH A;  4OYP A;  3D6F B;  2RKI A;  2EFO A;  3ZTR A;  1YKW A;  2ZUA A;  3BZQ A;  3W2V B;  2UXC F;  1JLQ B;  3MTK A;  1YZ6 A;  2O3D A;  4LR9 A;  4KSE B;  1RIS A;  4NCG A;  2L9D A;  1CLF A;  2XYG B;  2UUA J;  2XZW A;  4NXN F;  2X1G A;  3K58 A;  1TK0 A;  1NKC A;  4TVA B;  1PJ5 A;  3PM9 A;  4ANC A;  3SBM A;  5B0G A;  2HK3 A;  3P5B P;  9ATC B;  1UW9 A;  1IM6 A;  3RU0 A;  1I3O B;  8ATC B;  2ILY A;  4PYD A;  1HFE L;  4J90 A;  5L9N A;  2HHT A;  1RCX B;  1EX8 A;  4ED8 A;  3F0N A;  5B0B A;  1K0T A;  3GZ7 A;  3A4T A;  3BBF A;  2CQI A;  1YWX A;  4MYT A;  2JFK A;  3DLL Q;  2G13 A;  3ZZT A;  4GKJ F;  2XMM A;  4NA2 A;  3EIC A;  2QLB B;  3DU5 A;  4BC9 A;  3ENV A;  3RGI A;  1UVM A;  4B3O B;  5ETS A;  5F8N A;  2GVZ B;  2B4U A;  2PMZ D;  3CCM S;  1DQA A;  4FF2 A;  4ECT A;  4X4T A;  4NX9 A;  2YQ1 A;  1AA1 B;  1GXU A;  4AL6 A;  3HP6 A;  3ENA A;  1X5O A;  2V9K A;  1RU1 A;  1OY9 A;  3UR0 A;  3DMJ A;  2W9A A;  2FJA B;  3PY8 A;  1U8S A;  3QIP B;  3PV8 A;  3QGP A;  2NR0 A;  2ZVI A;  3G8S A;  4RZR A;  3S8S A;  3DRX A;  3NS5 A;  1SC6 A;  5HMY A;  5E33 A;  2R7T A;  4RW9 B;  2XY6 A;  1GMV A;  3TR5 A;  4Y28 C;  3QZ7 A;  3EPI A;  1HNV A;  1FFS B;  2FY8 A;  2V4Q A;  2XMU A;  4LFA J;  5KFF A;  1KQG B;  2GHV C;  3CE8 A;  4UQT A;  3BBC A;  1N34 F;  1JLF B;  3O8W A;  3AOA A;  5D4L A;  3P5T L;  1O0P A;  2WVF A;  2WW4 A;  2NPF A;  4A47 A;  1X5S A;  2V34 A;  1PAU B;  3IXQ A;  5HP1 A;  2ZHO A;  5DLF A;  3K2Y A;  1VQY A;  2CG4 A;  3LP2 B;  1HBN A;  5IV4 A;  1PIE A;  1MWY A;  2DXE A;  4QWC A;  4LFB F;  3GP9 A;  3MAA A;  2KU7 A;  4K59 A;  2XNR A;  2GFF A;  2C2E A;  2GX8 A;  2DHH A;  3JXO A;  2HW3 A;  2KJW A;  4PWW A;  4PQU A;  2UXC J;  1LWE B;  1HWU A;  4KHP F;  3VAM A;  1X4C A;  1I94 F;  1S0O A;  2H48 B;  5AXM A;  2AJ2 A;  2J7K A;  4LJM A;  3IS9 B;  3MWB A;  3ILL A;  5EX3 A;  4NXN J;  4MKV A;  3AQO A;  5HVG A;  3Q2S C;  4A4J A;  3BSN A;  4R0J A;  2BR0 A;  2BE2 A;  2FUG 9;  4I2Q B;  2B3T B;  1P8G A;  2OPS B;  4F4K A;  2CJ9 A;  3RR7 A;  3GPA A;  2OPP A;  2BM0 A;  1FE4 A;  2BJ1 A;  3NRB A;  5D3G B;  4K7Q A;  4A8F A;  1WHV A;  2KM8 C;  5KTQ A;  2HWT A;  1N0V C;  4GKJ J;  4FNI A;  4J9M A;  2DPJ A;  1XNQ F;  2XLK A;  1SC1 B;  5A8W B;  4YY3 F;  1K8A T;  1A6L A;  4YEA A;  3RRG A;  1NO8 A;  5D0R A;  1AFI A;  4I56 A;  3EXC X;  1G3O A;  1BQM B;  2OPQ A;  2DGU A;  4LRE A;  2CQB A;  5F8G A;  3DHW C;  4K4Z A;  4WFA Q;  4F4Y A;  3FVY A;  1VQP S;  4JI2 J;  2HHV A;  5HBM B;  3C15 A;  2YKQ A;  4LIW A;  2DK2 A;  2L48 A;  4V19 X;  3FCH A;  1S7I A;  1NHU A;  4QIF A;  1YJR A;  3SFU A;  4NCB A;  1S0V A;  4FF4 A;  4DMZ A;  3HZE A;  3JYT B;  4FYW B;  1HQE A;  2K8G A;  4UTG A;  2XMJ A;  4DPY A;  1H98 A;  3D68 A;  3Q23 A;  2FJB B;  1ZAV A;  4HHU A;  3DC2 A;  1N34 J;  1HBU A;  1X60 A;  2YH1 A;  3V4M A;  4ZA1 A;  1WD6 A;  2OGU A;  3SV4 A;  4WE1 B;  3UN2 A;  1GXT A;  2GGP B;  3MD3 A;  3ICL A;  2LEC A;  4K5R A;  4DV3 F;  3NL0 A;  3TUI C;  4DR4 F;  3PEH A;  1VI7 A;  4TU7 A;  2QN6 B;  5IT9 Y;  1R8H A;  2QFJ A;  2MQL A;  1HIY A;  4GVB B;  2PEH A;  4LFB J;  4UT4 A;  4ZLJ A;  4RU9 A;  1SKW A;  1IKV A;  1HBO B;  2HHP A;  2MXY A;  2BZ2 A;  2LP4 A;  4OYB A;  4OX8 A;  2Y1I A;  2MST A;  4I7F B;  4F26 A;  3K8W A;  1KSP A;  3MM8 A;  2W4P A;  4Z37 A;  3TUZ C;  2XZD B;  2MQN A;  4H4K A;  3A3P B;  2GJI A;  4P75 A;  2B9Y A;  1WJ9 A;  3B82 A;  2YNH B;  4HEA 9;  2Z8Q A;  4JV5 J;  3KJF B;  1AYE A;  5EWG A;  2AQ4 A;  1RT3 A;  3N5F A;  1OSD A;  2K06 A;  1YZ7 A;  1TKZ A;  3TAQ A;  2R7O A;  1PC5 A;  3AJD A;  3P6Y C;  1TL7 A;  2KYX A;  3WX4 A;  2P8I A;  4P71 A;  1XNQ J;  4CLL A;  2ALZ A;  3K8V A;  4USU A;  2Q79 A;  4YY3 J;  4ILM A;  4PPZ A;  4HAC B;  2MZJ A;  2YNI A;  4B3M J;  2H51 B;  2M0G B;  3PG9 A;  1XR7 A;  1RKI A;  3Q8Y A;  4DL5 A;  3LGN A;  1VK8 A;  1LWC A;  1DLO B;  1U09 A;  1SPB P;  4DQP A;  2WAQ D;  4J9N A;  3MCO A;  3GFH A;  4RNH A;  3EUN A;  2IYG A;  2VJU A;  2CPH A;  3C14 A;  1F5C A;  3AH6 A;  1TUV A;  4B9S A;  3C46 A;  3W9H A;  5J2N A;  1LW2 B;  2XSJ A;  4I67 A;  3UWT A;  4PXE A;  2VB6 A;  3HVW A;  2CQ2 A;  2CQD A;  1K47 A;  3BDE A;  1Z2L A;  1PBA A;  1S9G A;  2X1B A;  3H5U A;  3MPV A;  1UVJ A;  3PW4 A;  2JHE A;  2I0X A;  3DLB A;  4A48 A;  3PIP Q;  2B9X A;  2DB1 A;  2D3O 1;  3C6U A;  3PX6 A;  4DV3 J;  2CG8 A;  4DR4 J;  2CQH A;  1R27 B;  2HRY A;  3BSO A;  1U1L A;  2V8V A;  3V6K A;  4OJH A;  5F8H A;  2MMY A;  4AFF A;  5A8R A;  3ISZ A;  3HZG A;  3ITH B;  2M2B A;  4CI0 B;  2B8Q A;  1ARO P;  2M9K A;  3T5K A;  2W25 A;  4RW7 A;  3CD0 A;  5DQH A;  5E3R A;  4DEZ A;  4ZLL A;  2IY5 B;  1VC0 A;  3HI9 A;  3T1H F;  2QMW A;  1HPZ B;  3ZTQ A;  2CA9 A;  4DL7 A;  1P6T A;  5KAK A;  2RDD A;  2KXN B;  2ZJQ Q;  2MZ1 A;  4DR6 F;  1RTZ A;  3JSY A;  3ZC4 A;  4WFB Q;  2XC9 A;  4DPW A;  3MFI A;  3M32 B;  1NK6 A;  1HWI A;  3D3B J;  2VOP A;  2ZUG A;  1ZA2 B;  1FWK A;  3CIZ A;  3AT1 B;  4OL8 A;  4I64 A;  2EFN A;  3AA9 A;  2KL8 A;  4QR1 A;  3JAM Y;  2NCK L;  1S79 A;  4RUC A;  1FXR A;  2I5J B;  3BF4 A;  2DTJ A;  5LM7 E;  3WIU A;  5K8O A;  4O4G B;  2LMI A;  4AQY F;  2RIL A;  1FKP B;  1ELO A;  1SJF A;  2V8D A;  2GJF A;  4USK A;  5KG6 A;  3NS7 B;  1FK9 B;  3GYG A;  4BS2 A;  1FFW B;  3SQG B;  1HYS B;  1NPP A;  3US5 A;  2NXE A;  3D6M B;  2ZOM A;  2UV8 G;  4G65 A;  3QLH A;  4MAK A;  3SSQ A;  1X9W A;  3A8E A;  5IC6 B;  2DGW A;  5KFC A;  1JLC A;  4XO0 A;  3H40 A;  2GCF A;  9RUB A;  4HT5 A;  4RWW A;  1NDK A;  3IBF B;  4K4S A;  2BE9 B;  3IFE A;  5A8K A;  1JX4 A;  3FRY A;  4PWD A;  3DOL B;  5CD4 A;  2F9D A;  4KQZ A;  3LQV A;  2DXF A;  2HIY A;  1RXO B;  3DLE B;  4FKY A;  4CNZ A;  1N32 J;  4F4A A;  4KFB B;  2A3J A;  5C24 B;  4QU7 A;  4KR0 B;  4RR5 A;  4JV1 A;  3UDV A;  4OI0 A;  3VV2 B;  3LGH A;  4UZC A;  2VC1 A;  1M1H A;  3R1H A;  2YWG A;  2IVY A;  4MYU A;  1LXN A;  3KLH A;  2VFS A;  3DLG B;  2ASJ A;  3T6J A;  3TQE A;  1T05 B;  1IQT A;  1KEK A;  1JKH B;  1T94 A;  5BYQ A;  4ZPC A;  3PZP A;  4DZD A;  1S9E B;  2RUG A;  4ZIT A;  3MMJ A;  2EG1 A;  3IMQ J;  3JSM A;  1JMT A;  2E5L F;  3UDE A;  1U1R A;  2AMC B;  4F50 A;  2FZG B;  2LVW A;  4ZVE A;  4A8S A;  4F4X A;  4OZJ A;  4UOC A;  4OJG A;  4DV2 J;  3HSZ A;  4Y34 A;  2IM0 A;  2COL A;  5ETT A;  1JLA B;  1RWM B;  4AT1 B;  2KVQ E;  2XLJ A;  3T1H J;  4GC7 A;  1WF2 A;  4ITS A;  2ZBP A;  1M5H A;  2ZFH A;  4ZPA A;  4DN0 A;  1N6Q B;  4DR6 J;  4IFY B;  4N47 A;  5CAB A;  3DXS X;  2L41 A;  3TAR A;  2A6O A;  5AT1 B;  4HH1 A;  2CXE A;  1UL3 A;  1Y4Z B;  4AXJ A;  5J2P A;  1HHT P;  4ED4 A;  3SYZ A;  5I3U B;  3KDO A;  1F2H A;  1FWL A;  1Q0N A;  1S4F A;  1RHM B;  2XY5 A;  2VG6 B;  4DZ6 A;  4DCO B;  2Y3Y A;  2MLY A;  4NLR A;  2IPO B;  2DJW A;  3M2R A;  3NAI A;  1N52 B;  2Q43 A;  3GWC A;  5C7P A;  1AZS A;  4XK8 C;  2V2K A;  3FFI B;  1UTA A;  3SXL A;  2EFG A;  2QX0 A;  3AOD A;  4TN2 A;  3ZTO A;  1MRO B;  5HAO A;  3PYF A;  3DLK B;  2MQ8 A;  1UPP A;  3VTI A;  4L75 A;  2Q6B A;  1YTY A;  2E1R A;  2HNZ A;  4AQY J;  3I4H X;  4KO0 B;  4CH0 S;  4QQB A;  1BGX T;  3NNH A;  2V4J B;  2DD8 S;  3B54 A;  2BOA A;  1ZTT A;  4Q2M A;  2X3D A;  4ZN1 A;  1X4G A;  3BH7 B;  4DV5 J;  4HR2 A;  4RKU C;  4DQI A;  2QRR A;  4QYZ K;  3D4J A;  3HHK A;  2HVH A;  2DHX A;  3VQT A;  2B4V A;  1KKH A;  3M6V A;  3HD2 A;  1U25 A;  3NGR A;  4MKA A;  2WB4 A;  2OUG A;  1JJH A;  3NXZ A;  2O66 A;  3UN3 A;  3V5R A;  4NA1 A;  2R7X A;  1MG7 A;  3W5Z A;  4ED0 A;  2ZKU A;  4DFJ A;  2HEK A;  1XR5 A;  2GV1 A;  1KP6 A;  2BQU A;  3W65 A;  2ZBQ A;  3WZ0 A;  1KOO A;  5J1E B;  2R7V A;  4WK1 A;  3T5L A;  1B64 A;  4TYB A;  1CBK A;  1IKX B;  1GK8 A;  2IRX A;  3L7U A;  4EMD A;  2Q6C A;  3UVJ A;  4DV4 F;  1FEH A;  1ITP A;  4ZVS B;  4PKD B;  4RW6 B;  2AWZ A;  1EP4 B;  4O0I A;  4A8W A;  3U7J A;  4YS2 A;  1LFP A;  3H4D A;  1TL3 B;  2NYH A;  1RTI B;  4Z7Y A;  2OD4 A;  4C4W A;  1IBM F;  1SL0 A;  3ENW A;  5FDL A;  1ZM3 A;  1RAJ A;  2BE7 D;  4TYA A;  3U1N A;  2HQF A;  2F7V A;  3LA0 A;  2ROE A;  1VRT A;  4BCA A;  3TJ8 A;  2W2Q P;  5F8I A;  4D3G A;  1LWX A;  4QYR A;  2AD9 A;  4UY8 5;  5ETM A;  1RKJ A;  1HAR A;  1GTE A;  3EJM A;  2HAI A;  1RAA B;  2HG4 A;  3TUJ C;  3KUG A;  2QA4 G;  3S7R A;  1RB0 A;  3AOC A;  2ZJR Q;  4FVC A;  3IG1 B;  1IBC B;  3IBW A;  4JI7 F;  2W4C A;  2VBY A;  2VON A;  1VIO A;  4OHV A;  1JK9 B;  1RCO B;  3CJ3 A;  2XO6 A;  2ADC A;  5L46 A;  1I5O B;  4LIR A;  2OD6 A;  3FEX B;  3R9L A;  1YGY A;  4UQG A;  3DOM A;  3H8Y A;  5J2M B;  5DG7 A;  1WKK A;  2JFD A;  1WAC A;  5CCM A;  5GAD I;  3HUL A;  1H2V Z;  3D7S B;  3T5J A;  3A1Y G;  2E5H A;  3MPU B;  1Q81 T;  3LAM A;  4PCQ A;  1SUQ A;  3KUE A;  1AXQ A;  3IN5 A;  4DL6 A;  1FTR A;  5THW A;  4U6P A;  3MDF A;  5KFD A;  2HBZ B;  2AGQ A;  3V6H A;  3JS9 A;  2CJQ A;  3I82 A;  3VZI A;  1HA1 A;  5D6G A;  3D9B A;  2UUB F;  2ZDP A;  1S6P B;  4GRS A;  4IDK B;  4A8Y A;  3A8I A;  3V6J A;  3IRW P;  1HI1 A;  4IR1 A;  1LKZ A;  4TQS A;  2RU9 A;  4UUX A;  4OQJ A;  3TVY A;  3DGP A;  3QIP A;  2JRS A;  4F2R A;  3MPW A;  3SIP B;  4EBC A;  4DQQ A;  1Q79 A;  1XIQ A;  1QSY A;  4USH A;  4CM2 A;  4IO1 A;  4DU7 A;  2EBE A;  1R31 A;  5GAH U;  2XI2 A;  1Q7Y T;  3KG0 A;  2FVC A;  4DSF A;  2VFU A;  1L5U A;  2ZVS A;  4ZKA A;  3M9N B;  1Q5V A;  2Y1L B;  1U49 A;  1K0V A;  4DV4 J;  4ZLP A;  4Y2M A;  4M5N A;  4QR0 A;  3R27 A;  1C1C A;  2A1B A;  2OAU A;  1VRQ C;  3V2U C;  4M5I A;  1D8Z A;  1R6Y A;  2J0Q D;  1VQK S;  4B3S F;  3R5G A;  1WDT A;  1B0T A;  3EWG A;  5HMW A;  4PYA A;  1YDL A;  5IZH A;  1IBM J;  1OMS A;  3HHE A;  2DO4 A;  2E5G A;  2MHN A;  1IN0 A;  2YKP A;  1X5T A;  2JLF A;  3AJ1 A;  4Z2X A;  4XIU A;  4WYL A;  1MLA A;  3O3L A;  2ZM6 F;  3E8O A;  2RUS A;  3I6P A;  1NDP A;  3I96 A;  4TKT A;  1VQ9 S;  1LWE A;  1IR1 A;  4FXV A;  2R4F A;  4WP9 A;  2HZC A;  2GNK A;  1B7Y B;  3VAH A;  2VOO A;  3DKD A;  4BWJ A;  3IS9 A;  1J5E F;  1NK0 A;  3CDU A;  1C2P A;  2E7W A;  2B9W A;  5LJ5 Y;  2EXU A;  1N36 F;  4ZP9 A;  4DU8 A;  2DNY A;  4DX8 H;  1M5K C;  3PJ9 A;  4I4B A;  1NXI A;  1WG1 A;  3KJN B;  4NEZ A;  1DAX A;  3W64 A;  4JI5 F;  2IAJ A;  1F1B B;  5JVH Q;  1QD1 A;  1WC6 A;  1EQM A;  2MLZ A;  3CD7 A;  1QDU B;  2VIC A;  2BRK A;  3N28 A;  4CT9 A;  2B6A B;  4BDP A;  3LH2 S;  3CIM A;  5D3G A;  1HNI A;  3GV8 B;  2FQQ B;  3EVM A;  1X8D A;  1Q1K A;  4ZPD A;  3O6Q A;  4DSJ A;  5T41 A;  2V63 A;  2E9T A;  2FB0 A;  4PAA A;  3EXY A;  3CDB A;  2XZT B;  3T6B A;  2KZZ A;  4HDG A;  5J2Q A;  3CDA A;  1FKO B;  2HVI A;  3GFZ A;  1AT1 B;  2Z2Y B;  1UZH A;  2DGO A;  2G2Z A;  2UUB J;  1D09 B;  1PIL A;  1BQM A;  4Y2A A;  4UOF A;  2Y1R I;  1F0X A;  2X7I A;  2GC8 A;  4P2M A;  3S6E A;  1ZTW A;  4USW A;  4NXM F;  3Q2T C;  2YXL A;  5HBM A;  2CZ9 A;  3R2D J;  4CNY A;  3TAN A;  2F9J A;  2V2Z A;  3RTV A;  5L1K A;  1U1M A;  3J7Z 5;  2MKC A;  4LMZ A;  1BWE A;  4CYU B;  3GTY X;  2GJ2 A;  1S1T B;  4FF1 A;  1U02 A;  2CPY A;  2XNQ A;  1RDR A;  4GKK F;  4H4M B;  2QO3 A;  2QEX S;  1RZM A;  2ADB A;  1JXV A;  3KG1 A;  5KFX A;  2EG2 A;  1RLD A;  2GGP A;  3FBC A;  3NGD A;  4HHJ A;  1S1U B;  2UXB F;  4B3S J;  2J9E A;  3TWZ A;  2UP1 A;  2ZWP A;  2B56 A;  1NU4 A;  2PMH A;  3OFE A;  3DDN A;  1RT7 B;  4K2J A;  1R43 A;  2FVS A;  4NRT A;  2RDI A;  3AJ2 A;  1IUJ A;  1RWU A;  2ZNZ A;  2DHS A;  1U7L A;  1U0H B;  3M8P B;  2G2Y A;  3H5X A;  3NG8 A;  1GX6 A;  4RX6 A;  3C6T A;  2C3M A;  2R2S A;  3JAM U;  2G2O A;  5HLF B;  3CED A;  5IT0 A;  2KFY A;  1IQZ A;  3J81 j;  4I7F A;  1V3Z A;  2ZNY A;  3MR3 A;  4DUZ F;  3CTR A;  4DR3 F;  2EFQ A;  4Q7A A;  1PJ6 A;  2C1E B;  1J5E J;  1HI8 A;  2I2Y A;  4ATN A;  4DX5 A;  1UA1 A;  1N36 J;  4ECY A;  2DPI A;  2YNH A;  3S1T A;  3MCS A;  1Q5Y A;  4JI5 J;  1U6F A;  1Y5L B;  2JJ4 D;  2QFI A;  4DL3 A;  1S1V B;  2DH8 A;  3BEG B;  3BN4 A;  5IQQ A;  1RT6 B;  1TK8 A;  3ZFV A;  1BQN B;  1T95 A;  5FJ4 A;  4NOH A;  4FXW A;  1NSQ A;  2JNJ A;  2IRU A;  3GIM A;  4NRU A;  4X4O A;  3HMJ G;  1N5Q A;  5E0O A;  1NSA A;  4CO0 A;  1EKR A;  1N5Y B;  1VCT A;  4CM0 A;  4ALZ A;  4C3K A;  2C3Y A;  4FS2 A;  1UWB A;  3KK3 A;  2VH7 A;  4RJV A;  3VR1 A;  1DJ0 A;  1TMJ A;  2CQ1 A;  1LOU A;  1TEL A;  2DGX A;  2HIQ A;  4TQR A;  1DLO A;  3H20 A;  2JDJ A;  1U8W A;  2DIT A;  2P6T A;  4MK7 A;  4B9V A;  1WHX A;  3WC0 A;  1X4B A;  4C8M A;  2QJ3 A;  1RWN B;  1G2E A;  3NEK A;  4C8K A;  3BKT A;  2D3O R;  3IM8 A;  2E1C A;  2IA0 A;  3QT6 A;  1LW2 A;  2VA3 A;  1W2B R;  3DM2 B;  1VQO S;  5F3Z A;  2RQM A;  4CLU A;  2WVC A;  5F8L A;  5KFW A;  2ILZ A;  1H7W A;  3QMQ A;  1TK5 A;  1TVR B;  4GKK J;  4HKQ A;  1M1G A;  2BJ8 A;  3N0V A;  3NLC A;  1R8B A;  3MED B;  4C3L A;  4DQR A;  4H4O B;  1REV B;  4OZL A;  3R1L A;  3TI0 A;  3TW0 A;  3UW1 A;  3VAK A;  2UXB J;  4J9Q A;  3NP5 A;  4GO7 X;  1QUP A;  2JVR A;  4CLK A;  4Q0B A;  3KKF A;  1VBY A;  3P3D A;  1FNM A;  1RK8 A;  2MKY A;  3MEG B;  4URQ U;  4RBU A;  1JLG A;  2P9E A;  1Y5N B;  2R8H A;  1VBK A;  1WWH A;  1GEH A;  3SCK E;  1FXD A;  3PR5 B;  4DR3 J;  5KFZ A;  4LF8 F;  1C1B B;  2CWX A;  1VQM S;  4ECX A;  2MPU A;  3G4S S;  3TZX A;  1BC6 A;  3PEJ A;  1WDD A;  4H54 A;  5AJ3 F;  3M32 A;  2MZQ A;  3GYN A;  3NKY A;  3TAM B;  3CD5 A;  3MM7 B;  3R5B A;  5GAE I;  1KVK A;  5SZT A;  1RUS A;  3CJ5 A;  4LRC A;  1U48 A;  4C11 A;  2AGP A;  3I32 A;  2HBY B;  2ZE2 B;  3VGT A;  5DLG A;  4OYZ A;  4DR7 F;  2W4D A;  5HSP A;  3Q86 A;  1MU2 A;  4NLX A;  1REG X;  2MQM A;  4M5J A;  3J80 Y;  3R6G B;  2H4W B;  1URR A;  3MMA A;  3VGV A;  1BY9 A;  5KT5 A;  1X4H A;  2BJ7 A;  3B4M A;  4O4G A;  4MFB B;  3PJW A;  2M5Y A;  1J5O A;  1IWA A;  1HD1 A;  1FDA A;  2POK A;  4ZVF A;  3JSB A;  1S1W B;  1FK9 A;  1BQX A;  2HGN A;  2WRM A;  2N3L A;  1HYS A;  3PJX A;  1FXL A;  3QYY A;  2YWE A;  4YB6 A;  5LMU J;  1QTN B;  2C3U A;  3WX8 A;  4QZV B;  4OZN A;  2VC0 A;  4FNH A;  2JX2 A;  1MWZ A;  1J27 A;  1VQN S;  4C7Q A;  4V19 J;  1R3N A;  1VJW A;  3BQ1 A;  2EBG A;  1RT5 B;  3TAP A;  2BRL A;  3DLE A;  4R5P B;  4ED5 A;  1VHF A;  3LP0 B;  4K0K J;  4NLU A;  3O44 A;  5KT4 A;  5IC4 B;  1TTH B;  3R6L B;  1GAO A;  3E3X A;  1SC4 B;  5KT3 A;  4ED3 A;  1SV5 B;  1ZYQ A;  4OZ0 A;  3DLG A;  3SQO P;  5ETL A;  3FBE A;  1JKH A;  1FJG F;  3CW2 C;  1KS2 A;  3CJK A;  1S9E A;  1SL2 A;  3VAI A;  4PXB A;  1YJU A;  1P27 B;  4WXO A;  1SL1 A;  1JWW A;  2W1B A;  4CTA B;  5F41 A;  2FDN A;  1HQU B;  4JYA F;  4EI2 A;  3HFK A;  4DPX A;  3E01 A;  2VQF F;  2BX6 A;  1IR2 A;  3R2C J;  3VGU A;  3KK2 B;  4X64 J;  2CRL A;  1BLU A;  4M5H A;  5F8J A;  4OHW A;  5CYJ A;  1CQM A;  3KYL A;  1T9W A;  1UP1 A;  3KHL A;  1N6Q A;  2RML A;  4YDD B;  4JI0 F;  2N4D A;  3PR4 A;  4IFY A;  4ZVH A;  4PUO B;  4L76 A;  2BUN A;  5AJ3 J;  5MLC V;  1EKS A;  2C3P A;  3KLF B;  2VG6 A;  4IH7 A;  1YRT A;  1WI6 A;  3OTE A;  2K2P A;  4KHM A;  4F3M A;  2WZ1 A;  1QUV A;  4HL9 A;  4G1P A;  1EIY B;  3FSI A;  2F1F A;  3BDP A;  3FFI A;  4R0E A;  4Q45 A;  2AKW B;  4KH0 B;  1MRO A;  5T7L B;  2CPI A;  3DLK A;  2P9C A;  1DTT B;  2WSF C;  3AFG A;  1GT8 A;  3HCX A;  3I0S A;  2DCL A;  4OYW A;  2QYC A;  5K14 B;  1XK8 A;  5C25 B;  2BW7 A;  3R97 A;  1UW4 A;  3QWP A;  2KRB A;  1CJT B;  2I1R A;  2V4J A;  2Z30 B;  1VRU B;  5DM6 Q;  3GFY A;  1M5O C;  5L9X A;  1OPI A;  1NDC A;  2RB7 A;  1YJN S;  2H65 B;  1F2G A;  4DV1 F;  3TQ1 A;  2KT5 A;  3MM9 B;  3FQK A;  5KFO A;  2RQ4 A;  5E3A A;  5ADZ A;  2ZD1 A;  3UNY A;  2ABY A;  3IWN C;  3Q8R B;  5M2U A;  1YVF A;  4X4N A;  2MYF A;  1YX2 A;  3Q24 A;  2AYM A;  4CLY A;  2ZH5 A;  4NWB A;  4R8U B;  4M1K A;  2EKY A;  2HND A;  3FZB A;  4WFX A;  5J1E A;  3UNG C;  3WDO A;  3ADA C;  3I5B A;  3LP1 B;  1RBA A;  1WEX A;  4ELV A;  2XCP A;  1FJG J;  4JI4 F;  3CWJ A;  2V8P A;  3QWU A;  4URS A;  1EP4 A;  3KNG A;  2RH3 A;  3K7R A;  2JWN A;  1EAR A;  2KDO A;  1LEO A;  2AJ4 A;  2FYX A;  4JYA J;  1YSJ A;  3CC4 S;  1UJ6 A;  2FVR A;  5K8P A;  5ETK A;  1UKU A;  4IH5 A;  2ZH7 A;  2VQF J;  1VIX A;  2VL1 A;  4BC7 A;  1FRM A;  4KKO B;  3PYG A;  1RTD A;  3EGW B;  2UZA A;  3H2L A;  1WKL A;  5HJX A;  3GIJ A;  1Q86 T;  3HJF A;  3W2W B;  4UZB A;  1VLO A;  4JI0 J;  2R7W A;  3Q8Q B;  2HQG A;  2B7C B;  5HMZ A;  2OPR B;  3AHP A;  3UE2 A;  2HQI A;  3BPS P;  3V81 A;  1IBL F;  2HQD A;  2R7Q A;  5H1S V;  1KLN A;  2ACY A;  2CQ4 A;  4EFA C;  2CPX A;  3O2I A;  1CG2 A;  1SQF A;  2XO7 A;  3SI8 A;  3SMZ A;  3MEK A;  4OZ1 A;  2ZZN A;  1DRZ A;  1H6K X;  2DVI A;  5J2M A;  4URG A;  5EN1 A;  2LDI A;  3T41 A;  1CUL B;  2HFN A;  3QPI A;  4IOB A;  4EUV A;  2HHQ A;  4WP8 A;  4QWD A;  5RUB A;  1IXK A;  2HVD A;  2DHA A;  2I8E A;  2DY1 A;  2VU5 A;  3F44 A;  1UWA A;  2WSE C;  2HHW A;  3ET6 B;  3BGR B;  4ZJL A;  5I3P A;  1YBU A;  1LWF B;  1HHS A;  3M1V B;  5CYM B;  2ZH4 A;  1S12 A;  2DH9 A;  5ETN A;  2KHD A;  2G1D A;  4NEY A;  2YPZ A;  4ECV A;  5AE2 A;  1RT1 B;  2PMW A;  2BVZ A;  2K1R A;  4Y2I A;  4Y2K A;  2EK1 A;  1VC6 A;  3CCZ A;  4OYA A;  4HI1 A;  3TJ9 A;  1SKR A;  4TY8 B;  5CHC B;  1RSC A;  4FYV B;  4KHR A;  5L1I A;  3GFX A;  1N5T A;  2LKZ A;  3UI3 A;  2APO A;  1KBR A;  2N4C A;  3FQL A;  1XMQ F;  1N8R T;  3EDQ B;  3V6D B;  4J9P A;  4DOZ A;  3PW2 A;  2C2R A;  1JQG A;  2KYZ A;  2CNO B;  3LW5 C;  4C0O C;  1MMD A;  2MJU A;  1TP7 A;  2MKK A;  2BKO A;  3CCS S;  3CXC R;  3SEO A;  2EC2 A;  2PO4 A;  5E41 A;  3ZTP A;  3E2E A;  2KHC A;  1N88 A;  2XUL A;  4HVZ A;  3AXK A;  4DL4 A;  1UVK A;  2H5I B;  4WXW A;  4TY9 A;  3HLU A;  2DNP A;  4FPI A;  4LF7 J;  3FNN A;  3GE9 A;  2KVI A;  3P49 B;  5KFU A;  2VFV A;  2DEI A;  2G0I A;  3U1L A;  3P45 B;  2EFP A;  4OYO A;  1RT4 B;  2J6S A;  1ROF A;  2V9W A;  2C2N A;  2ZH1 A;  3K17 A;  3J81 Y;  4C8L A;  2OMO A;  2FHO B;  4I2P B;  1HMV B;  2VFR A;  1KHV A;  4CH1 A;  2Z58 B;  3F56 A;  3ZNU A;  2V94 A;  3HF5 A;  3Q89 A;  4C97 A;  4J9R A;  3W9J A;  1PYS B;  4YN3 B;  3KJV A;  1O8B A;  3MCN A;  4P6Q A;  1DBD A;  1RAF B;  5C5J A;  4JP8 A;  3IAS 9;  4WU3 A;  5BR8 F;  2QL9 B;  1O6X A;  4KPY A;  3BPD A;  2ZIT A;  2X3G A;  3MAQ A;  1EHW A;  4IO9 Q;  4J9V A;  4ANE A;  3IBC B;  1KR4 A;  2AEM A;  4X4Q A;  2DYA A;  3V4I A;  2N7Y A;  4ZVG A;  2F8H A;  1KRP A;  3NNC A;  4AYB D;  2B6A A;  4NLG A;  1QE1 B;  2ZBI A;  2HHX A;  1EB0 A;  2E5I A;  5KFK A;  4MH8 A;  3GJR B;  3BSC A;  3KHH A;  2RVJ A;  1YG0 A;  4F0M A;  2HLT A;  2I38 A;  4PG4 A;  1NZ8 A;  3EDR B;  1UCN A;  3CJT A;  1H74 A;  1KLM B;  5CH7 B;  4JI1 F;  4B9L A;  1KDN A;  4M95 A;  1Y9O A;  1WHY A;  2Z56 B;  4NLD A;  4IH6 A;  5HVH A;  3QFH A;  3D5M A;  3T5H A;  3AY0 A;  5CA5 A;  4JI8 F;  5DGA A;  1OIA A;  1ZH5 A;  2HRT A;  5GAD U;  2W8K A;  4EK2 A;  2YKO A;  4KTQ A;  1X4F A;  2A0F B;  1XMQ J;  4U7C A;  3M30 A;  3HSJ A;  4CYU A;  5A6W A;  3KLV A;  1S1T A;  2OLW A;  1ZOT A;  1AB8 A;  4C3M A;  5I4M A;  2LQB A;  2VG7 B;  4LSN A;  2H54 B;  1NK7 A;  2B7B B;  2ERR A;  2HMI B;  2V2Q A;  4GC6 A;  1RGV A;  1S1X A;  3AD7 C;  3ETO A;  3CCQ S;  4DPT A;  3KWM A;  4ZHR B;  3LOU A;  5ETQ A;  3J7Z T;  1DQ9 A;  2YQ0 A;  3FZ2 A;  3PKY A;  2DEJ A;  2XCA A;  4G1Q B;  1AFJ A;  4LQ9 A;  2GAH C;  5A76 A;  4J37 A;  1U0H A;  3M8P A;  5KG7 A;  1N33 F;  4F67 A;  5HLF A;  2QYG A;  3DRS A;  5CYQ B;  2VKZ G;  1H2U X;  2HS4 A;  4S0M A;  4U9R A;  3QAU A;  1HQ2 A;  1V5V A;  2F3J A;  1QAI A;  1HR0 J;  2HBR B;  1WG4 A;  2VG5 B;  3KDN A;  4J91 A;  1BWV A;  2CFX A;  4CQ1 A;  2WCX A;  4C2M A;  3CO9 A;  3IAM 9;  3D0I E;  4OLO A;  5BR8 J;  2LEP A;  4X4U A;  2RKI B;  1RAO A;  4LBH A;  1NCL A;  2M8H A;  2HWH A;  3K0J A;  2IC3 A;  2WB1 D;  2HKE A;  5HJY A;  3N6N A;  3LF0 A;  4Y2C A;  2AF6 A;  4NCG B;  3JSR A;  2YWK A;  5D0E A;  4M5D A;  3GG0 A;  2N82 B;  3FBB A;  2A10 A;  4OIX A;  2CPJ A;  5C2C A;  4YME A;  1RT6 A;  4WII A;  1BQN A;  2VDI A;  4CWB A;  4DSE A;  3IRX A;  1RT2 A;  2CQP A;  1VFJ A;  3KHR A;  5DQG A;  3P8B B;  4B3R F;  4L72 B;  4NZ6 A;  4FDF A;  2DIS A;  2C2Z B;  4C48 A;  3QO9 B;  4E0D A;  1FA0 A;  5KFE A;  1IKY B;  4L74 A;  1OWX A;  5KFS A;  2BAN A;  2G0C A;  2M4M A;  5D4O A;  4LF1 A;  5KG1 A;  1Y10 A;  1NJX A;  3M8S A;  2DGT A;  2MDA A;  3GB0 A;  4UW2 A;  2B4O A;  3I9V 9;  1PYO B;  3OW2 R;  2QT7 A;  4ZIW A;  1HW9 A;  2FHM A;  3TJA A;  1UFK A;  2DR7 A;  1Y11 A;  1ZA1 B;  1Y7P A;  2J8S A;  3H5Y A;  2L3M A;  5M2R A;  4J7C A;  1G1X A;  1JXE A;  4P2F A;  3M9O B;  5KG2 A;  4RNF A;  1CC8 A;  2QMX A;  2FY1 A;  1HHQ A;  4LVO P;  5DZ7 A;  2LQ8 A;  3GR1 A;  3OL9 A;  3LWL A;  5KFJ A;  2OIH A;  5DQI A;  3KJQ B;  4NCA A;  3EX7 B;  2NRE A;  1XN9 A;  1O51 A;  3H0P A;  2HAF A;  5AXK A;  2CJX B;  2I6W A;  5GAG I;  2RF2 A;  1ZS6 A;  2NS1 B;  3MED A;  5F3T A;  4F0H A;  1EAY C;  3GSD A;  4H4O A;  1REV A;  1NK9 A;  2PSZ A;  3F41 A;  4CLS A;  1DY3 A;  2U1A A;  5IFM A;  1QJH A;  3NMR A;  2C3O A;  3BGO P;  2J0X A;  5B7W A;  2KTQ A;  2OTL S;  2YY3 A;  1KD1 T;  3HHL D;  2AT1 B;  3HD1 A;  1Q8L A;  3AXM A;  3MGJ A;  3MEG A;  3ZZZ A;  1R8C A;  4BHQ A;  4KGV B;  4XDD A;  3BGL A;  1A9N B;  1ZZN A;  4Y3C A;  5HP1 B;  3N6M A;  1MW7 A;  4P9S A;  2AYB A;  3IR5 B;  4C8O A;  1VQ7 S;  3DU6 A;  3SV3 A;  3BS9 A;  3DOK B;  3MAA B;  2IJN A;  1UJ4 A;  1XJW B;  1KNZ A;  2R2U A;  2ZH3 A;  5CQG A;  3BR9 A;  2Z2L A;  1YLX A;  4K4V A;  3TAM A;  3Q22 A;  4YB5 A;  3KK1 B;  2HZV A;  1S6U A;  1T9U A;  3DI6 B;  2FC9 A;  4XDC A;  4K4T A;  4O44 B;  2XGP A;  4A8O A;  2DIV A;  5SUH A;  4OLP A;  4ZDN A;  3LAN A;  2ZE2 A;  3KLE A;  4C6A A;  5JJB A;  2Q3P A;  4HH0 A;  2OI2 A;  1TFW A;  4N5S A;  4F7V A;  4C8Z A;  4USM A;  1RU2 A;  2DNQ A;  2WK4 A;  4G6V B;  1UJ5 A;  1FDB A;  1J2V A;  1GFW B;  2M7S A;  4B3R J;  1S97 A;  4MFB A;  1H0H B;  4HHH A;  3TZZ A;  2UVW A;  2ALY B;  1YJV A;  1S1W A;  3QGI A;  1FHT A;  2A6M A;  2OEJ A;  2IRY A;  1NME B;  5K9F A;  3QSY B;  4PPD A;  3TYT A;  1FRJ A;  4QW9 A;  1HI0 P;  1FJE B;  4IRC A;  4M5K A;  1L3S A;  1QTM A;  4HI2 A;  2IM1 A;  4B08 A;  2V8G A;  2KI2 A;  2OJ3 A;  4TU8 A;  5E3P A;  3PXG a;  1UFW A;  2DNZ A;  1MNE A;  2U2F A;  1O5J A;  1SKU B;  1GX5 A;  3LP0 A;  3GII A;  2BJD A;  3D3C J;  3PRD A;  3IR6 B;  3Q8V A;  2IBO A;  4A8X A;  3VAG A;  3CJS A;  2KXF A;  4ECS A;  2XG8 A;  4X65 F;  3OLB A;  2FJV A;  5DZ6 A;  1VQ4 S;  2DNK A;  2LQ5 A;  4KGK A;  3BYP A;  3D6T B;  3WBZ A;  5HK4 A;  1H72 C;  1F9H A;  1X5P A;  3OXF A;  2MZT A;  1P9Q C;  5ETP A;  2HQ3 A;  4DSL A;  1RI7 A;  1HQE B;  4O3N A;  4PR6 A;  5FD1 A;  1LK7 A;  4IG0 B;  4CTA A;  1HBM A;  1HQU A;  1HBU B;  1X0P A;  4QIE A;  3M8Q A;  1N5S A;  4X66 F;  2H4Y B;  1SJ1 A;  2W2O P;  5T14 A;  2J8A A;  3NGK A;  2F5G A;  4J9K A;  2E44 A;  3C19 A;  4OI3 A;  3QJL A;  1NJW A;  3KK2 A;  3G6Y A;  4CRJ A;  2QA1 A;  2ZH9 A;  2NSB A;  1XC9 A;  2Z0G A;  4OX6 A;  2K7J A;  4LFC F;  2B9E A;  1KQS R;  1IM4 A;  5KFH A;  1FRI A;  1HWJ A;  1X9S A;  1GMU A;  2PII A;  5L8R C;  1NB7 A;  4U7U D;  2AIR B;  3OJU A;  2D74 B;  2KH9 A;  3RBD A;  3HDS A;  5H9E J;  4KE5 A;  3MM8 B;  2MY7 A;  3CME S;  1XBW A;  5DG9 A;  1PBU A;  3OQ2 A;  1APS A;  1Q53 A;  2OFG X;  1C0U A;  3G8Q A;  5KFQ A;  2J7W A;  1C4C A;  5T7L A;  1RWX B;  3IM9 A;  5BXI A;  4KHP J;  1QLN A;  2E5J A;  3M2U B;  1I94 J;  4CLP A;  3FUY A;  1DTT A;  2M88 A;  4ECQ A;  3T1Y F;  4W98 A;  1WC1 A;  3GCW P;  1F3F A;  3CCL S;  5HQ8 A;  1V5I B;  5KT7 A;  1RHU B;  5GAE U;  2DNL A;  1VRU A;  4YFU A;  2R9L A;  1CEZ A;  2GHP A;  1U1Q A;  4O23 A;  3LUY A;  3Q8S B;  4PWU A;  4HTJ A;  2Y0B B;  1X4D A;  3NGS A;  4K4Y A;  3RRK A;  4CDI A;  5LXY A;  2PE8 A;  3MM9 A;  2R2R A;  2ZHA A;  3OXG A;  2V67 A;  3DYA A;  2OML A;  2IA6 A;  2GVD B;  2FHJ A;  3EPG A;  2HGM A;  1NJY A;  4N8N A;  2ACM A;  4NI2 A;  4R8U A;  4TU9 A;  3OT9 A;  4Y6I A;  3J81 U;  3R8Y A;  2AU0 A;  1NJI T;  4K4U A;  4X65 J;  3GG1 A;  1MWQ A;  2QIF A;  3AD8 C;  3MPD A;  3C14 B;  4Q44 A;  2NXJ A;  2BEF A;  4QIW D;  4N56 A;  4USI A;  2YVS A;  3B6B A;  2XSJ B;  3EE3 A;  3THV A;  4DR5 F;  2QV6 A;  4USJ C;  4N77 A;  1ZBT A;  2NLW A;  1V9O A;  2OEK A;  2JEJ A;  3DLJ A;  1DTQ B;  1U6B A;  1RP5 A;  2VV5 A;  1YBT A;  3OTC A;  4OV6 A;  3VAL A;  2MTL A;  3TA2 A;  2Z57 B;  3W5X A;  4KKO A;  3LPE A;  3C6U B;  3D67 A;  3CCJ S;  2HSE B;  2ZH6 A;  4OZ5 A;  3NOC A;  1TFY A;  1RHQ B;  4IFV A;  4LFC J;  3W2W A;  3D28 A;  3BV8 A;  3IWL A;  3M8R A;  5KFN A;  1SJQ A;  5A8R B;  2BJE A;  2BBE A;  1RAH B;  3MM5 B;  2KN4 A;  4YOE A;  2Z4P A;  1RWV B;  1KQK A;  3M2V B;  3P96 A;  3QT5 A;  2BKP A;  1LW0 B;  2AX1 A;  2HFU A;  3NS6 A;  3UD3 P;  4XPE A;  2XWY A;  3UCG A;  3PHT A;  3PIO Q;  3BO2 A;  3ZZR A;  3FC9 A;  2OEL A;  2PGC A;  1CQN A;  1N4L A;  5E5N A;  2OSQ A;  2Y1J A;  1ACM B;  2CQ0 A;  2W2N P;  4PG6 A;  3FMB A;  8AT1 B;  1OS5 A;  4QCL A;  1Y3J A;  1FI4 A;  2FZK B;  2YKN A;  3BO3 A;  2FHK A;  4U7U K;  3A12 A;  4P7V A;  1L3T A;  1NK5 A;  1VOM A;  4ID5 B;  5BYR A;  4TXS A;  1S57 A;  4LF9 F;  1B0P A;  4LRB A;  1RAB B;  1FJ7 A;  2QA4 S;  3ILI A;  3PW5 A;  4WKR A;  2VA2 A;  3M1V A;  2ASY A;  5CYM A;  1T02 A;  5KFL A;  1PCA A;  1LXJ A;  2GA7 A;  2CPZ A;  4PXC A;  5LMN F;  1RT1 A;  3CC7 S;  1MN9 A;  1TL1 B;  3M8W A;  2D9P A;  2AHO B;  3TZY A;  2DIU A;  4ETX A;  4TY8 A;  1HWK A;  1WKJ A;  2E7X A;  4N41 A;  2PI4 A;  1HKA A;  3QJP A;  3DLH A;  4WF9 Q;  3PX0 A;  5DDO C;  1JLC B;  1NUE A;  1KOH A;  5ETR A;  2UVU A;  2YKA A;  5KT2 A;  3MR2 A;  1SJ4 P;  2DNH A;  2DXD A;  4PWD B;  3AA8 A;  4CZC A;  2C28 A;  2QG9 B;  4L6V 3;  3QT7 A;  5LSL A;  1IJF B;  4G1I A;  3IA0 A;  4PEO A;  4DR5 J;  1FF2 A;  1VBX A;  2VF3 A;  2UUT A;  4NML A;  2JLG A;  2M52 A;  4CO5 A;  2XGQ A;  2LCW A;  2DGV A;  3QNW B;  4ID8 A;  2MJN A;  3GJS B;  2B5J A;  5AE3 A;  3CGI A;  3D6H B;  4KT0 C;  2CZV C;  1RT4 A;  1R8A A;  1KC8 T;  3BKF A;  1NM2 A;  3OR1 B;  2AJ1 A;  4U95 A;  1HMV A;  4NYO A;  2VJV A;  1Z2Z A;  4QYZ J;  3CUN A;  5EWF A;  4DFK A;  4FF3 A;  1URN A;  2DNO A;  1SH3 A;  5HMX A;  1VC5 A;  2KT3 A;  3D1Q A;  1YQH A;  4ZJQ A;  1WC3 A;  3F73 A;  1OPZ A;  3GJT B;  2FVP A;  1WUU A;  3H98 A;  4LRD A;  2HRU A;  3CB4 A;  2HBQ B;  2KT2 A;  1YJ9 S;  3NWR A;  3J7Y U;  4HTI A;  4D3H A;  3H90 A;  4DL0 C;  7AT1 B;  3QAE A;  4DWI A;  5LT5 A;  2BQR A;  1UVI A;  4QJV A;  3OL8 A;  4KY3 A;  3CJR A;  1IWG A;  2DRA A;  3FKB A;  3NGT A;  1XMB A;  4DG1 B;  2YBV A;  3RZA A;  4DXL A;  4OJ1 A;  3OHB A;  2V2V A;  4ZPW R;  4LF4 F;  3O1L A;  2XB2 D;  2EVZ A;  1RBL A;  3M2R B;  1YJW S;  1U2F A;  1AZS B;  3G82 B;  2DGQ A;  4ECU A;  2W9B B;  1TV6 B;  3ZZY A;  2Y9H A;  3G71 S;  1KLM A;  1IKW B;  4LR7 A;  4I6Y A;  3RB0 A;  2W7A A;  2QE5 A;  4X4R A;  2PN6 A;  5LMN J;  2Y0S D;  4YQW A;  1ZPV A;  1WF1 A;  2GO9 A;  3POT B;  2IMW P;  2QC3 A;  4OX9 F;  5GAH I;  3HSD A;  1WOO A;  4P7T A;  1RAC B;  4J9U E;  4N8O A;  2YNG B;  2ZJP Q;  2K3I A;  4OI6 A;  1V3R A;  3SDE B;  1RTJ B;  1OSC A;  4BWM A;  1ZET A;  3TX0 A;  3W60 A;  3OR2 B;  5DG8 A;  2XY7 A;  5H9F K;  2MZS A;  3CCV S;  2VG7 A;  4RUB A;  4P72 A;  5CZV A;  1RYR A;  1QM9 A;  1LFW A;  4ZCM A;  3FSX A;  2NZ4 A;  2YKM B;  3OLA A;  1VJQ A;  1E6V A;  3PRB A;  3CJ4 A;  2FVQ A;  1Y00 A;  2QMU B;  2QSW A;  3OVS A;  1T9Y A;  1JLE B;  1H2T Z;  5F9N A;  2MHE A;  4LBP A;  1S72 S;  2HGL A;  2JZ5 A;  5EDW A;  4U67 Q;  3U27 A;  3GV5 B;  3H5S A;  2LU2 A;  1EET B;  2IM2 A;  2MY8 A;  1M5V C;  3DNC A;  1JNZ B;  4ILR A;  2V4R A;  3I0R A;  1SJR A;  3CCR S;  1M0S A;  2EC0 A;  4W4M A;  4W90 B;  2RJZ A;  5CYQ A;  1YRU A;  3NBP A;  1JJC B;  3W66 A;  1VRT B;  4WK3 A;  4RW4 A;  4Q43 A;  3LTO A;  3AQP A;  1U1O A;  1C0T A;  1Q8K A;  3OV7 A;  2WON A;  3H42 A;  4ECZ A;  2E5L J;  5KFT A;  2XS7 A;  5B0D A;  2W7O A;  2HS0 A;  4OZ2 A;  3I4P A;  1W25 A;  1WG5 A;  3L3C A;  3DRP B;  2V69 A;  1CJU A;  2O67 A;  4NL5 A;  1Q4R A;  1JJ2 R;  3MR5 A;  4JB8 B;  3HKZ D;  3NAH A;  1FJC A;  4HT7 A;  4OI4 A;  3W2V A;  3G6V A;  1JLQ A;  4IR9 A;  2D7S A;  4EYI B;  1T11 A;  3C2P A;  3UD4 P;  4LF4 J;  2PEB A;  3KMQ A;  1TKT B;  1VIS A;  4RL1 A;  3QO9 A;  3L7P A;  2BW2 A;  3CCT A;  4IRD A;  4DLE A;  1IKY A;  3DOM B;  1U1K A;  1QSL A;  5IM0 B;  2R42 A;  5HI7 A;  2YNF B;  3CJ8 A;  4CP5 A;  5HQM A;  4MKB A;  1WC5 A;  2HWI A;  2WW8 A;  2CJB A;  2Y8W A;  2AEJ A;  1P1T A;  2E1A A;  3W5Y A;  4XAK A;  4FYX B;  3I55 S;  1SUQ B;  4FN5 A;  4PAB A;  1PKU A;  4ZVQ B;  2C22 A;  2GIF A;  5F0W A;  3DGV A;  2JSX A;  3UD5 A;  1DAR A;  5HAN A;  4OX9 J;  4P73 A;  3HVT B;  5K20 B;  2LLZ A;  3PO5 A;  1T03 B;  2KM8 B;  1WSV A;  1I51 B;  1S5Z A;  1XWL A;  2XMV A;  1NRK A;  4DFP A;  3VAJ A;  3GU0 A;  1TKD A;  4Y65 A;  2WOM B;  1F5A A;  4O3R A;  1RQ0 A;  4F25 A;  3DGP B;  4JI2 F;  3OSP A;  4B3O A;  4O4R A;  3BQ0 A;  3CD6 S;  4AL7 A;  2AJQ A;  2GVZ A;  1SB6 A;  2J5A A;  2ZZT A;  2V50 A;  3OSN A;  1D3W A;  1D9A A;  4ZCL A;  4AD6 A;  4ZVT B;  2ZBC A;  1JB0 C;  5IT9 U;  4AL5 A;  4E98 A;  4RW9 A;  4DX6 A;  3BQ2 A;  1C1C B;  1GQE A;  1NHV A;  4YDX A;  2MQP A;  2E7V A;  3H7H B;  2GQC A;  5F9L A;  3B4D A;  1JLF A;  2UUW A;  5K8M A;  1H38 A;  2JEG A;  4G3I A;  2CKW A;  4CLT A;  5L1J A;  1FKA F;  3DOK A;  4DR2 F;  2QTW A;  3AB2 B;  2ZC3 A;  2B43 A;  3MR7 A;  4C0B A;  1UEK A;  2HNY B;  3TVK A;  3RJM B;  4UOG A;  3D1H A;  3MXH P;  3W61 A;  3RW6 A;  3KK1 A;  4FS1 A;  4OI2 A;  2NUU G;  3Q8U A;  5KG0 A;  4WPA A;  2KZM A;  3LP2 A;  4WFY A;  3DI6 A;  4RBT A;  4O44 A;  3SSS A;  3MEE B;  3ONQ A;  1RWP B;  2R8I A;  1TKX B;  2W2P P;  4NLT A;  2FGO A;  2YPY A;  1RWW B;  1TZ0 A;  5KG4 A;  4CLZ A;  2NQP A;  3OHA A;  5IWA F;  3M6W A;  3Q83 A;  3JB9 k;  3SZ2 A;  2CJA A;  5IS2 A;  3NY0 A;  3LAL A;  2XBP A;  5U47 A;  5F8M A;  1WNE A;  1T9T A;  1U26 A;  1IBK F;  4JV5 F;  2IAJ B;  2FHJ D;  3PNI A;  3FRZ A;  4DI6 A;  3HK2 A;  3HFZ B;  1F5B A;  4KJI A;  1E6Y B;  2JC0 A;  1HNI B;  1WC0 A;  4NLY A;  2L9W A;  4JI7 J;  1T0T V;  1CJV B;  3HSG A;  3NWG A;  4I2Q A;  1VDH A;  2F63 A;  1FDN A;  2OPS A;  4IOA Q;  4YB1 P;  2DKO B;  3GMG A;  2OTJ S;  1JXL A;  5JUM A;  3KFW X;  4K4X A;  5J2Q B;  2ROP A;  2KJV A;  3KLG B;  4B3M F;  4DJB A;  4DPO A;  2I9S A;  3UQS A;  1VGY A;  2HQC A;  2KG1 A;  2VBX A;  3CJ0 A;  1RYS A;  4UST A;  5A8W A;  1OY8 A;  3ULH A;  4N7T A;  2EKN A;  5DGB A;  2MEW A;  1ZAX A;  3WHI A;  1SJ3 P;  4EO8 A;  1Q78 A;  2GHW A;  1UPM B;  4KBI A;  1KTV A;  4X4P A;  2WVD A;  4IG0 A;  4CCH A;  1YRX A;  4IKA A;  2XMA A;  4YR2 A;  2ZDO A;  3ILJ A;  3A8J A;  2DGS A;  4F36 A;  3OL7 A;  4ES3 A;  1Q95 G;  2VZ9 A;  3OTO F;  3JYT A;  5IXU A;  4O0N A;  2F4F A;  4F4W A;  2NZC A;  2DCU B;  3BBB A;  5GAG U;  4EZ6 A;  4NAS A;  4DN9 A;  2VOD A;  3GIL A;  1KVJ A;  5E3C A;  4DR2 J;  1WTB A;  1SIW B;  4ZPV R;  4WE1 A;  1OQ6 A;  3UFC X;  2VIH A;  1XR6 A;  3C6T B;  5LL6 d;  1T7P A;  4C0H A;  5HVF A;  2DR5 A;  2R7S A;  4YR3 A;  3BRE A;  5FII A;  3CVK A;  2IJF A;  4RU2 A;  1K73 T;  2FJE B;  4GVB A;  4USV A;  3GV7 B;  4OHY A;  2LXU A;  1HBO A;  5IWA J;  2ZM6 J;  3X3U A;  1CS4 B;  2N3O A;  5LSR A;  2QA2 A;  4QBU A;  1KN6 A;  1QAJ A;  3M2U A;  4FKX A;  4R25 A;  1IBK J;  2CJK A;  4FYD A;  3JQK A;  4DUT A;  3ZXW A;  2BOP A;  2J6U A;  3FCV A;  2J0S D;  4OYX A;  3UPF A;  3W9I A;  2UXD F;  1Q8B A;  1Q82 T;  3PFO A;  4ZVP B;  1K44 A;  4MIA A;  4ICL B;  3R5J B;  3TA1 A;  2OEM A;  3EM1 A;  1BD6 A;  1FX2 A;  3FJ2 A;  2RS2 A;  1SQG A;  4RW8 B;  4QIV A;  3HPO A;  2V68 A;  4DV0 F;  1HNX F;  4NLO A;  2WBR A;  2P6S A;  2RU3 A;  1C4A A;  5EUH A;  2CVI A;  2PC6 A;  2DH7 A;  1FER A;  2GVD A;  2E1P A;  2CPF A;  3MM6 B;  3FEZ A;  2VQE F;  1UWB B;  3KK3 B;  4RO0 A;  2E29 A;  3OPK A;  2F8M A;  4EGL A;  3G6X A;  4JI6 F;  4HDH A;  2N7C A;  2LA6 A;  1BHN A;  3NGU A;  1KQF B;  3J7A 1;  1TQL A;  3OVB A;  4DSI A;  3RB3 A;  4HAC A;  1QAY A;  1F3V A;  4WTY A;  4NLV A;  4QIG A;  1G4C A;  1N32 F;  4ZLN A;  5KFP A;  2R8J A;  4C8N A;  4LF5 F;  5GME A;  5H9E K;  2KXH A;  4U8V A;  1FEE A;  2NXN A;  1HW8 A;  1JLB B;  3SCJ E;  5D8H B;  4WYW A;  4B9T A;  2HYI B;  2QL7 B;  4ES1 A;  4NXM J;  4DV6 F;  1S99 A;  3LWM A;  2BXJ A;  3MTJ A;  5DET A;  4CT8 A;  1DZ5 A;  4A8M P;  3M6U A;  1DTQ A;  3SFG A;  2O01 C;  3R7B B;  5K5M A;  3C66 A;  4C9D A;  1SC3 B;  3OUY B;  3T19 A;  5KFR A;  3OTO J;  2FLP A;  3L09 A;  4J9L A;  2DO0 A;  3WC2 A;  2IDE A;  2RSQ A;  1T9V A;  1VQ6 S;  3AOB A;  4Q0B B;  4ERD A;  2D41 A;  4NLS A;  4J9O A;  2HFZ A;  1CPZ A;  1N48 A;  5D0H A;  1RWK B;  3MM5 A;  3THT A;  1M5S A;  1JLG B;  5A2Q Y;  1RAE B;  2R2T A;  5HQL A;  4DV2 F;  3W3S A;  3M2V A;  3RW7 A;  3T3F A;  1LW0 A;  4O3P A;  2CNL B;  4OHZ A;  3L95 X;  3HHN B;  1EQ0 A;  3PDN A;  4DCJ B;  4RUH A;  1LV5 A;  1P9Y A;  3T9Z A;  2H5E A;  4FBT A;  5D15 A;  5GMK a;  3ITH A;  4FBU A;  3IGV A;  2ZZM A;  3I9Z A;  1TU0 B;  4F2S A;  1OYD A;  5D0G A;  1Y0H A;  2NXU A;  4J9S A;  3DDI A;  2DR6 A;  1HPZ A;  3W8P A;  4ID5 A;  4DUZ J;  1EZZ B;  2EFV A;  3MI7 X;  4DLG A;  3RRH A;  4IQM A;  5G0R B;  4C11 B;  1S76 D;  3GR0 A;  1WEY A;  3H59 A;  1SVD A;  2KKH A;  1DHM A;  2UXD J;  1QAX A;  2C2K B;  1MU2 B;  4CO1 A;  1Z1Z A;  1U45 A;  4ECR A;  5AXL A;  4M5G A;  3MMA B;  3HM9 A;  1X31 C;  4DV0 J;  1HNX J;  4P2X A;  1XQI A;  1TL1 A;  1J5O B;  3FGV A;  3N01 A;  3OFF A;  3PTW A;  3VAF A;  2I5J A;  1U2C A;  2VQE J;  3ETM A;  5D4P A;  2X1A A;  3TUP A;  4DV5 F;  5E3Q A;  4DF4 A;  4JI6 J;  1SBR A;  3ELH A;  3BM7 A;  4DX7 A;  3RAQ A;  1FKP A;  1YK9 A;  1SKS A;  4GVL A;  4WKY A;  4RUA A;  4MKY A;  3N79 A;  3SQG A;  3I31 A;  2MKH A;  6AT1 B;  3AD9 C;  4GO5 X;  2EI5 A;  4RPF A;  4LF5 J;  4QW8 A;  4JUZ A;  4DPU A;  3PFE A;  5KT6 A;  5L38 A;  2V6A A;  4KGZ B;  1VQ8 S;  1NBE B;  3UDL A;  1R7I A;  2CQC A;  3C16 B;  2X1F A;  4DV6 J;  3FCW A;  4OHX A;  2E1M C;  3DOL A;  2XYH B;  4K8R A;  2EK6 A;  2MQQ A;  3N4W A;  3HO1 A;  3TNV A;  4B9N A;  4KFB A;  2BDP A;  2YH0 A;  3FMW A;  2AZ1 A;  5C24 A;  3CJK B;  2ZC4 A;  3D0H E;  5A0Y B;  1LQ9 A;  3OBI A;  2QLJ B;  1GMW A;  3OR1 A;  2OHD A;  3N9U C;  4LBI A;  1HWL A;  3ISN C;  1U1N A;  2AW0 A;  4A46 A;  1HL6 A;  1WF0 A;  1SH0 A;  2W2M P;  1T05 A;  4OV1 A;  4I69 A;  3E01 B;  1ZZF A;  1X4E A;  2IBK A;  5JXS A;  1YHQ S;  3O5T B;  3HXM A;  1KVI A;  4KV8 B;  4RWX A;  1K1Q A;  4K5S A;  4YB7 A;  2LYV A;  3B8H A;  1BUX A;  2KB2 A;  1RA7 A;  3P4U B;  2NUH A;  4ZK7 M;  5J1N A;  4M94 A;  4JBC A;  4NYZ A;  4CLF A;  1OO0 B;  3HHL B;  2M3D A;  1IJE B;  1DFD A;  1JLA A;  1R6V A;  4DG1 A;  1SQE A;  1WOR A;  3W8G A;  4QPT A;  4LF8 J;  2VBZ A;  2HK2 A;  3PHE A;  1TAQ A;  4UUW A;  2C42 A;  5KFB A;  3TRG A;  5IV3 A;  4UOH A;  1T8E A;  4B02 A;  3G82 A;  4LSL B;  3UDC A;  2W9B A;  1TV6 A;  1NSP A;  2B51 A;  1IKW A;  1JJ4 A;  4M63 A;  5I3U A;  3Q0A A;  2W9C B;  1ZAW A;  3MF5 A;  3VQS A;  1F9F A;  4JI3 F;  1R0A B;  2AEF A;  3BN7 A;  3I0S B;  2L9N A;  3POT A;  4NPO A;  4JV2 A;  2RE1 A;  2D1C A;  1NLK L;  1UA0 A;  4DR7 J;  5D4N A;  2J9D E;  1RAI B;  3KOA A;  4YR0 A;  5KFI A;  2YNG A;  2AZ3 A;  7FDR A;  3SDE A;  2ASL A;  1RTJ A;  2GQ2 A;  2IMO A;  2WBM A;  1BE4 A;  5JMN A;  4ZP8 A;  3OR2 A;  3DRY A;  4KO0 A;  2MLX A;  4DV7 F;  3MZI A;  5D77 A;  2YWW A;  2LA4 A;  1VS3 A;  2R3V A;  3JQJ A;  2GIR A;  2ZD1 B;  5IT4 A;  3TVZ A;  3NMA A;  2YKM A;  1XER A;  4X62 F;  2WSC C;  1VMB A;  1K9M T;  1JLE A;  4PXD A;  1NZA A;  2HND B;  3M8Z A;  5FLX Y;  4F3O A;  3BGF A;  4OX7 A;  4Y0F A;  2OP5 A;  1FD8 A;  4O3O A;  1WEZ A;  2R7R A;  4AND A;  2VBW A;  1NH8 A;  1EET A;  5G4D A;  1NEE A;  1CVJ A;  2W01 A;  2ROG A;  3K5M A;  1M1K T;  1IR0 A;  1S49 A;  3A3O B;  4ECW A;  3UR3 C;  3ZZ0 A;  4DSK A;  4CO3 A;  2LXI A;  2BJ9 A;  4EWT A;  4B3T F;  3SSR A;  1IKX A;  4PG8 A;  4NLQ A;  1FCA A;  3PX4 A;  1S0N A;  3G8T A;  2HFO A;  4I6W A;  4RW6 A;  2IIH A;  1PG5 B;  3QRP A;  2RRN A;  1RTD B;  1YBA A;  5HAT A;  1TL3 A;  4CLW A;  4CIO A;  1FNO A;  3HHL C;  1RTI A;  4P52 A;  3H2U B;  3HT0 A;  4RLE A;  3K5N A;  4LQ3 A;  4WU2 A;  5I42 B;  3G87 A;  4L3K A;  2L08 A;  3DRP A;  2DBB A;  3CDE A;  2RQK A;  3V81 B;  1KHW A;  1VR6 A;  4F02 A;  4DF8 A;  3S01 A;  1FE0 A;  3KLI B;  1TL5 A;  2YWF A;  1TMM A;  3CNQ P;  4DS5 A;  1VBZ A;  4F3Q A;  1TKT A;  1QVF R;  4OZ3 A;  4FYY B;  3HX9 A;  5IM0 A;  3U1M A;  1FTC A;  2YNF A;  3T9N A;  3IG1 A;  1FRH A;  2ZWO A;  3LAK A;  2MGZ B;  3C3L A;  5HO4 A;  2AYG A;  5HRO B;  1L3V A;  4JI3 J;  2PD1 A;  2ZOG A;  1OY6 A;  4EYH B;  1TL4 A;  3I87 A;  1VLY A;  3EVW A;  3TX8 A; 
#chains in the Genus database with same CATH homology
 3J81 j;  3CW2 C;  1YZ7 A;  3QSY B;  2QN6 B;  2QMU B;  2AHO B;  1YZ6 A;  1Q8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...