2QMUB

Structure of an archaeal heterotrimeric initiation factor 2 reveals a nucleotide state between the gtp and the gdp states
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
93
structure length
93
Chain Sequence
MRKVKMSGLITVRTNEPLGVEKIKEVISKALENIEQDYESLLNIKIYTIGAPRYRVDVVGTNPKEASEALNQIISNLIKIGKEENVDISVVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an archaeal heterotrimeric initiation factor 2 reveals a nucleotide state between the GTP and the GDP states.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
molecule keywords Translation initiation factor 2 gamma subunit
total genus 20
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2007-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1130 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits EIF_2_alpha 2qmuB00
2AHOB 1YZ6A 3CW2C 1YZ7A 2QN6B 1Q8KA 2QMUB 3J81j 3QSYB
chains in the Genus database with same CATH superfamily
1WUUA 2CRLA 3GFXA 4O44A 2YNGA 2E1CA 2CQGA 1QE1B 1TKZB 3KJQB 3L4BC 3QMQA 3OVSA 4DSEA 2IJFA 3NS7B 2EC2A 3I82A 3SFGA 3LTOA 4QJVA 3RB0A 2NREA 3PEHA 4FKXA 3T41A 3ENQA 2DNOA 2C2DA 4PWDB 3KUEA 4RUHA 5A8KA 3N4WA 2FYXA 3C3LA 1N5QA 1KP6A 1WKLA 2AJFE 2QRRA 3KG1A 3NKYA 3WC0A 2P6SA 2I5JB 1DTTA 2Z0GA 4IRKA 2NYHA 3ZZOA 5E3PA 5KT6A 1WACA 3BEGB 1LW2A 2UUCF 2A2DA 4WIQA 1X5SA 2I1RA 2WW4A 3P96A 1ELOA 1YVFA 1WC6A 2JZ5A 2X1BA 3ET6B 2XLIA 3M8RA 2Y9HA 4K0KF 1MLAA 4B3SJ 5B0AA 5L1KA 1N33F 1ZM9A 2K3KA 3W9HA 3MM7B 2B43A 2C3OA 4DV0J 1DRZA 1N32J 3HSDA 1JJCB 3DXSX 2K7JA 4DV0F 2CG8A 1SC6A 3T19A 3MCOA 1G3OA 2ASYA 1VRTA 2CIMA 4LRCA 4ZPTR 4TU8A 1VOMA 5J1EA 5KFOA 2BQUA 4FF4A 3AXKA 2OEJA 4DG1A 2MB0B 2EFQA 3OV7A 3OXFA 4ZJOA 5I42B 3GV7B 3KOAA 4NLPA 4LRAA 2E1RA 2XY5A 3CDWA 3G6ES 2GQQA 3M32B 4U7CA 3PO4A 2CJAA 4JI2J 1MSWD 1EETB 1X4FA 2JL9A 2V4JB 1T05B 1TR0A 2M8DB 3HD2A 2OAUA 3KDOA 1ZAWA 4Y6IA 4BC9A 1JLQB 5J2NB 3OPKA 4TU7A 3T6JA 1LV5A 3RBXA 2DR8A 4NXNJ 5E3AA 3KMSA 1M5OC 3PW4A 1GMWA 3DRRB 2W4PA 2VDIA 5KFTA 4LFAJ 2BR0A 4OYWA 4CLLA 3JSRA 1SQGA 3QNWB 2BE9B 3NL0A 4WP8A 2JEJA 3Q89A 1CJUB 1NK6A 4O0IA 3RR8A 3AD7C 3BF4A 1GX6A 4LF4F 4F4AA 5IV4A 4JI7F 2F9DA 9ATCB 2Q66A 2BE2A 4NLSA 3NEKA 4KHRA 3J7A1 4O44B 5LOQA 2LQ5A 5L38A 1FDBA 2HFVA 4PXBA 4TNOA 1IBCB 4DR2J 5DQGA 3Q8QB 2QIFA 1FJEB 4XAKA 4OI6A 2RU3A 5HQ8A 1S72S 2UU9J 4OZ0A 4RW7B 2R7RA 4DQRA 3KFWX 4BWJA 5FJ4A 1S7IA 5J2PA 2PFFB 3PJXA 1JKHB 3PRDA 2BRKA 2JLGA 4R8UB 3KK3B 4A8KA 2BANA 1S1VB 4JUZA 3KLHA 3BBCA 3CCQS 2XSFA 3T1AA 3T9NA 5A8RA 4RBTA 2PA3A 1VYAA 1HYSB 3QJPA 3MD3A 4U7UK 2ZM6J 3ZZ0A 4C0OC 1AB8A 5AJ3J 2HHVA 5EUHA 4F02A 2CPDA 2IJRA 2VG7B 3IMQJ 1U48A 1UVLA 2I9SA 1U1MA 4GMKA 1X5PA 3R27A 1VRTB 2H9ZA 2ZKUA 4F8RA 3KMQA 3W3SA 4YHHF 1RTZA 2L08A 4UQTA 1DTQA 2CQHA 2HRYA 2VASA 2IVMA 5CYQA 1SKRA 3RBZA 4J9UE 2XLKA 5HK4A 1NK0A 5D3GB 2B5JA 2ZNYA 2MKHA 5D0GA 2F63A 4LFCJ 3QGHA 1RQ0A 4ECUA 5HQMA 4DL3A 2OMOA 4CP5A 4DCJB 3GJTB 4QR2A 2BM0A 1XN9A 2CA9A 2E5LJ 4I2QB 1WELA 4IR9A 3BM7A 1MN9A 4FP9A 4ID8A 3V6HA 1JQGA 2GZOA 1NB2A 3L7UA 4YN3B 1LWCB 2DNPA 1VRUB 3GP9A 3KLIA 2HS4A 4K4ZA 3IR6B 1H3DA 1IBKJ 4ERDA 3IFEA 4OX8A 3AFGA 4IH6A 1PBUA 4H4KA 4M5HA 2AGQA 3NOGA 3Q8VA 3TVKA 4RUCA 3R5DA 3Q8YA 4P2XA 2E9TA 4WP9A 2POKA 2F7VA 3HSGA 1KLMB 1X4GA 2ZC4A 1Z2ZA 3BGOP 4LFBF 1RZMA 1JB0C 1SCJB 1S12A 2CDRB 2FHOB 1FJGF 1WDTA 2DTJA 4XDDA 2UUBF 1A7GE 2IAJA 4IFVA 1KVKA 4LSNA 3TX8A 1CEZA 1WKJA 4GO5X 2AHOB 1U2FA 1S0MA 5HP1A 2UXCJ 3HHLC 5GMKa 3DRRA 2FGCA 1BGXT 1TKXA 2MKJA 1YG0A 3E01B 2VC0A 5CHCB 1RADB 1GH8A 1E6YA 3ADAC 4ZP9A 1RTIB 3FMWA 2YX7A 4C8NA 2C1EB 4MAKA 4K4TA 2KJWA 1AZSB 3G87A 4L3KA 3PX6A 1TZ0A 3TA0A 2ZWPA 2XZWA 1RA7A 2OLWA 3D6HB 4DPOA 2JSXA 3Q22A 3R5GA 2D3O1 1WEXA 4MFBA 5I4MA 4DV4J 3DI6B 4N76A 4F36A 2CPFA 2HK2A 3JSMA 2VOOA 4LREA 4QYZK 4AE5A 3RJMB 1FJ7A 1HIYA 4DZ6A 3X1LB 4NLRA 3N79A 1HHQA 3L7OA 1QUPA 2HBQB 4KYZA 1XTZA 2KT3A 4QWBA 5FDLA 2AYBA 1RT3B 1RT5B 1DQ8A 1SUQA 4M5LA 3FBBA 2LXFA 2Q1LA 2XMJA 3MCMA 4DR1J 3KWMA 3M2RA 5D6GA 2ZBIA 5EN1A 2BMBA 1C0UB 1SV5B 1KTVA 3QSIA 4B3OB 1U02A 4LIWA 4DR7J 1LKZA 2OJ3A 2N82B 3K8WA 1S6PA 3G82B 1GFWB 2ZBCA 4OYBA 1Q82T 4KR0B 4JI6J 4LF6J 1I94F 3HP6A 2WVEA 2QLJB 4FNHA 1NSQA 4ZP8A 3C6TB 2FZKB 4NMXA 3R8YA 3DRPA 4DX8H 1TL3A 8ATCB 4H4MA 1LW0B 4GO7X 4KSEB 2M4MA 1FVQA 2COLA 3RU0A 4AUKA 4ZVRB 3GIKA 3ENAA 4CM2A 2XY6A 2DNLA 1H6KX 2F1FA 4MJKA 1TV6B 2GQ2A 1R6YA 1OIAA 2B4OA 2D9OA 2QT7A 2W7PA 3TAQA 1WG5A 2U2FA 2KU7A 5HAOA 2DH9A 4NA3A 4C2MA 3B6BA 1LNQA 2HQCA 3PDNA 2O5DA 4DF8A 2D74B 3IBFB 2OI2A 1C0TA 3M8QB 4ANCA 2JLEA 2L48A 2CZVC 1U4BA 1N0VC 1L5UA 2DGSA 5AXNA 3KNAA 4LFBJ 5C42B 4DU7A 4DL6A 2HMIA 1CBKA 3J81j 2NSCA 4ZIVA 4WCEQ 4LF5J 3TAMB 3GJQB 5DLFA 5E3RA 4A8FA 3CDBA 4OZLA 3TQ1A 3HFZB 4PQUA 3UVJB 5LMNF 3R6LB 3OXLA 2FZGB 1ZYQA 1Z2LA 4HVZA 3OL9A 5HBMA 3SSSA 2IBKA 4ZPDA 5IZHA 3TRGA 5KFSA 1HBNB 2CQ0A 2FLOA 4MTPA 3U02A 4N5SA 1YI2S 1QAIA 4IQMA 4HACB 2EPIA 5K8PA 3KLGA 1SUQB 1RABB 1JJ4A 4S0MA 4J9PA 3FCVA 2OTLS 3IS9A 1VR6A 3PW0A 3NCPA 4WXWA 2RH3A 3MUMP 1BWEA 2ABYA 1DURA 2R8JA 3HX9A 1ULRA 3RRGA 1S1TB 2EI5A 4ES1A 1Q16B 4EBEA 1HNXF 5KFWA 4Z7YA 4OMFG 3JSMB 1U8SA 3KLGB 3GV5B 3QQCD 4PG5A 3GYNA 3TQEA 3QWPA 2ZJRQ 1HWLA 1OQ6A 3C66A 3CC7S 4WK1A 5LXRA 2W8KA 5GMEA 2VOPA 4XO0A 2JDJA 3G8SA 4OLOA 4F3OA 1UJ6A 4A8OA 1GXLA 1S79A 4XTTA 4ZVHA 5KT3A 3H90A 4F4XA 3OFEA 4KRWA 2E44A 3LOUA 3JSBA 2E5GA 4OZNA 4FXDA 3DOKB 2GVDB 5JJBA 1XMOJ 2WK4A 2J0SD 1FK9A 2J7WA 1X4AA 3PEJA 1S49A 5A2QY 2DGXA 2GV1A 2G4BA 3LO3A 4B3RJ 4ID5A 1SC4B 3ZTSA 2YWFA 2CNKB 4FDFA 3PR5B 1VBYA 3OFGA 3R5AA 4NMLA 2ZVSA 1T03B 4ZJLA 4LF9J 3NGTA 3OUYA 1SJQA 1WD6A 2FIUA 3CSKA 2CJXB 4MKAA 1NNDA 2V2VA 4A8SA 2W01A 2ZVIA 4ZVUB 4QCLA 1WEZA 1F2HA 3DLEA 1F3VA 3SQGB 4X4UA 3GIRA 3T1HJ 5B0BA 3AODA 1CULB 4X4TA 2XMTA 2DNKA 3NRBA 4UUXA 1RAJA 2B4UA 2CJYB 4KH0B 1BQXA 5E2QA 2XQCA 3EPIA 4C8KA 2XMUA 2DNQA 1IBKF 3K5PA 3GJRB 2AJ2A 2C3PA 4OI4A 1G6BA 4QIVA 4EBDA 4ETXA 3GE9A 3GFHA 4K4WA 4F2SA 1KVJA 1AFIA 1LWCA 2B3TB 3CCRS 3OT9A 3L95X 1NK9A 3VWSA 2F5GA 4EK2A 3MDFA 1KOHA 4DFJA 3JB9k 4MYUA 2NPFA 1EQMA 2CNOB 1NBEB 2HVZA 2ZE2B 4IG3A 4Q45A 1RU2A 3D2WA 1HNXJ 4LF8F 4LRDA 4DDFA 2AIRB 4U8VA 4J7CA 5ETLA 2R7TA 1NDPA 2PMWA 3CJSA 3H20A 4PWWA 3W8PA 5FDLB 2CPIA 3TOQA 1RDRA 3ZO7A 5AE2A 4PPDA 5A6WA 1X0PA 1SIWB 5IFMA 4IG3B 3BGLA 3UNYA 2EG1A 5DQIA 4P9SA 2HMIB 3D3CJ 3OTCA 1WORA 1HBUB 3HHLD 2E7WA 1RWNB 3HF5A 4HI1A 4Z37A 5IT0A 2FVRA 1JLFB 2EEYA 4DMZA 2PEHA 2VG7A 5E33A 4OJ3A 4PQUB 4NCGB 1GXUA 1FDDA 3BPDA 1RTHA 4NLQA 1A0OB 2RMLA 3G8QA 2DNMA 2C3MA 3AT1B 2PI5A 1HMVB 1VDHA 2UUAJ 2V69A 1KRPA 3KK3A 2VBZA 2W2PP 4ES2A 3AA8A 5KFJA 4ECYA 3CUNA 4ECTA 3JSYA 1VQOS 1GT8A 1V5VA 2QA4G 1YGYA 1FVSA 2ADBA 5K20B 4CCHA 1F2GA 3DMJA 2LQBA 2NXNA 3O6QA 5CCLA 5KG2A 1M5VC 4NI2A 4IQXA 1FFWB 2Z30B 3B54A 2OFHX 3D0HE 5CD4H 1SL0A 2D9PA 4RWXA 3C46A 3GMGA 1FO1A 2R2SA 2OGUA 2E66A 4CWBA 1WF2A 3HHDA 5L1JA 1G1XA 3OQ2A 1REVA 2J8AA 4LF1A 3JAMU 3NP5A 1EIYB 3E51A 1PJ7A 2RS8A 5ETQA 4U67Q 3PW2A 5E0OA 5KAKA 4PQAA 3UFCX 2IVFB 4YB1P 3OR1B 2H5EA 2AMCB 1UWAA 3KXDA 3QFHA 2HHTA 2VFUA 2AJ4A 1YBUA 2ZHAA 3MM5B 5K8MA 2FVSA 1ZAXA 3M1VA 3R2CJ 2VKZG 1RGVA 4C7QA 5D0HA 1JLQA 4I69A 2ZH2A 2AX1A 3V4IB 1ZBTA 2IJNA 2RDDA 1C0UA 1C1BA 2RAQA 3CEDA 1RXOB 1UEKA 4DR3F 2MKCA 3DRYA 3TANA 5E3QA 2ERRA 3R6GB 4DCPB 3NGUA 3BS9A 1RSCA 1TL7A 3LALA 5AE1A 4WFXA 1RAHB 3B4DA 2GJIA 5ETSA 3JYTB 1SH2A 2P6TA 3POTA 4C48A 2GX8A 2G2ZA 1T9VA 2APOA 3MEDA 2YTCA 1OPZA 2YKAA 2WBRA 3CD0A 1U1RA 1Q0NA 3WC2A 4B08A 1RLCL 3W5YA 2B5JB 2LQ8A 1B99A 1X9SA 5KFCA 5DS7A 3PIOQ 1S4EA 5L39A 1RTDB 3DI6A 5C25A 4C11A 3NAHA 1TTHB 3GYXB 3HKWA 2OFGX 7AT1B 1Q81T 1LOUA 2MY8A 3DOMB 4NLXA 5D0EA 3G86A 1QY7A 3BJYA 1F9FA 1LW2B 2GIQA 3I32A 5KFVA 2NS1B 2YWKA 4X66F 2AYEA 4ZHRB 2HRUA 4F7VA 2ZH5A 5C5JA 2GFFA 1CG2A 1Y00A 1IM4A 2V2KA 2BKOA 3OTEA 4LR7A 3EUNA 5GMDA 5K5MA 2ZH3A 2FJVA 1MN7A 1B7YB 2ZOGA 3U1MA 1DAXA 4USIA 2GW8A 1EP4A 2OP5A 1WF0A 2HVEA 4ZVFA 3OSNA 1Z1ZA 1TL4A 3T5JA 3BGFA 2CQBA 3M6XA 5GAHU 3RR7A 2AEJA 2JC0A 2LCWA 1V5IB 2RHQB 1BLUA 3HMJG 4UOHA 5J2PB 1UZHA 2K3IA 3RB4A 1QAJA 3M6VA 2D69A 4B3MJ 1LFPA 2QLWA 1RBAA 5H9EK 4FN5A 4L74A 3AJ1A 3PX4A 3BQ0A 4Q5VA 3G8TA 4RNNA 3H4BA 3GCXP 1TK5A 2JJ4D 2I38A 3A12A 3C8YA 1HW8A 3CIZA 2LECA 3T1YJ 3NNHA 4BLGA 2ZD1A 4CT8A 3AH6A 1W7WA 1KQKA 1VLOA 1P27B 2IYIA 2MKSA 3H98A 4KO0B 1RP5A 4OZ3A 4A8XA 5HL7Q 1TL3B 4QWCA 4CT9A 2QMXA 4WE1B 3ZXWA 2ZFHA 3HM9A 2FC9A 1T7PA 4GVLA 1XMBA 3I9V9 2UV8G 4FXWA 4IKAA 3CCSS 4LSLA 1RTJA 2ZDOA 3KJNB 2Z2MA 5KFAA 1XMOF 3BYPA 3WQPA 3K5LA 4DSFA 1RCOB 4BWMA 3OLAA 2W7AA 1XBWA 2GA7A 4TYAA 2ROPA 4EYIB 2DRAA 3EICA 2XS7A 5HROA 1OPIA 1LWFB 2DHSA 4Q7AA 5L46A 3O1LA 1CQNA 4C0BA 3W7BA 1HBMA 5HO4A 3H5YA 4KPCA 4JI8F 4EO6A 5CYQB 4PKDB 2P9EA 3QT7A 3ETOA 3P4UB 3QFWA 4N8NA 3R97A 1S6QB 4FVMA 2R8GA 3GFYA 4P2FA 3FEYB 4B02A 1YJ7A 1QDUB 3QWUA 2QJ3A 1ZPVA 2P5VA 4DS5A 1K1SA 2F8MA 3V4MA 4CLUA 5BR8J 1UEUA 3P49B 2XNRA 2AP6A 1JIHA 3POTB 1B3TA 4MT1A 3F44A 1CJKB 3IWXA 2KG1A 3MR7A 4I64A 2FHJD 5C2CA 2CWXA 3ET6A 3KUHA 1R8CA 1N56A 2BEFA 2EBGA 3G6XA 2VJVA 1UFKA 2DCUB 1RTIA 2LLZA 2ZZTA 5A8RB 3MURP 3M9OB 3FJ2A 3AD8C 3UPFA 1J5OB 2QA4S 4A8YA 2BABA 1ROFA 5D4OA 2FTRA 2ZZNA 3W2WA 4USHA 2D3ZA 3FEXB 2EFGA 1F5CA 3D6MB 4PEOA 2MGZA 3G71S 1T8EA 1NKEA 1NZAA 3CDEA 4G1IA 4ENOA 1T0TV 4NZ0A 3I4PA 4U6PA 4AL6A 5CXTA 2BDPA 4JYAF 4GKKJ 3DRSA 1A9NB 3GIIA 4O3PA 3GU0A 2QMUB 4J9MA 4QU6A 3L7PA 1FT8A 1Y3JA 2I6WA 3PYGA 4Q0BA 2Q3PA 2OH2A 1FX2A 4HI2A 1RBLA 3FGVA 1HWUA 1K44A 2VFSA 2D3UA 2QGFB 3H2VE 1IJEB 3LGMA 1UVKA 3DN9A 4I2PA 4PWUA 3W1YC 3H7HB 4HTIA 1NK7A 1VBZA 4DL2A 2ZH9A 2B7BB 4K4UA 4OX9F 1DFDA 1LWEA 5IV3A 4K50A 2WB4A 2YWWA 2LDYA 2HK3A 1U49A 1VQ9S 1IKYA 4ZPCA 3SSQA 4DR6J 3DDKA 3AOBA 3FCHA 1JXVA 3NY0A 3VF0B 2ZUGA 2E9ZA 2RUSA 1OQ3A 1DQAA 3A3OB 1EETA 2HFNA 2V4JA 3US5A 1T05A 1XIQA 2LKZA 5C24A 3EGZA 5L1LA 3K57A 2WSFC 3SV4A 3DRXA 3HSZA 4ZN3A 4GC7A 2E9RX 4OI2A 3MTJA 1S5ZA 1RAEB 1JMTA 1FFSB 4J9LA 4DR7F 2KL8A 1WG1A 4I68A 3A3NB 3N0VA 4KAIA 3TR5A 3HKZD 4BCAA 4DPUA 3G4SS 4X64J 3MM8A 2KFZA 4QOTA 3FC9A 4DR1F 1N36J 1IQTA 3CJKB 2PSZA 3ISZA 2X1AA 3HXMA 1T3NA 4MK8A 4Y3CA 2YX4A 1UKUA 4LQ9A 4OX7A 3VZHA 5HROB 4K0KJ 3BGRB 3OHBA 1LK7A 3MEDB 1IXKA 4NLUA 2W2OP 4YB6A 3IC1A 1WC5A 3CPWR 4GVBB 5K14A 1BUXA 4P2SA 1U47A 3VTIA 1VQMS 2DPIA 1KR4A 1E6VA 2LDIA 3GONA 4XK8C 3DLGA 1YWXA 4C97A 2ZOMA 4QR1A 1RHKB 2PE8A 2E7XA 1C1BB 3IXQA 4HR2A 4PCQA 4ZVSB 2BANB 2YQ1A 4R0EA 1UJ5A 4TVAB 2XYGB 4CQ1A 5KT4A 2MQPA 2ZJQQ 4K4VA 2DNRA 3VHQA 1JKHA 4DSIA 4KY3A 1IKWA 4DV3F 5H9FJ 1BC6A 4OZ1A 3ZTRA 9RUBA 4IUFA 3QZ8A 1HQUA 2RUGA 3FMBA 2CKWA 5IQQA 1CPZA 4Q8FA 1M5SA 1VRQC 3BV8A 2SXLA 3M2UA 3M2VB 4ZJQA 2OPQB 3T3FA 3SBMA 2MQOA 3ZC4A 2IY5B 2EVZA 3J7AN 3RGIA 3B8HA 2B51A 2LA6A 4IOBA 1UFWA 1FEHA 2BJ3A 4NI2B 4L72B 1GMUA 2GS8A 3ENWA 1VISA 3CCUS 2KVQE 1WDDA 4CO4A 2K1RB 4QIWD 4Q8EA 2HAIA 3LP2B 2XCPA 2I0XA 4M1KA 4M8LA 3MPUB 5J2NA 2HEKA 1RWWB 5CABA 3S8SA 1Y11A 5J2QA 3LQVA 4C8OA 1T3OA 3D0IE 5EWEA 2GJFA 3LPYA 2CDQA 3IBWA 3WHIA 3EX7B 1PILA 1YJVA 4QW9A 4EYHB 2JX2A 3IWLA 4Y00A 2P2CB 2BW7A 4MMOA 4DV6J 4BBYA 3W63A 2Y3YA 1TKDA 1U1OA 3BPSP 5KFRA 1RT7B 3KKFA 2JH3A 2G9OA 4DV1F 1QD1A 3LA0A 1LEOA 2U1AA 3J7ZT 1D9DA 1FJGJ 2VODA 1H7WA 4NLDA 3VAIA 1PYSB 1SXLA 1ZM2A 6FDRA 4ELVA 2I8EA 4WP3A 2V9KA 3BO2A 2ATCB 2M8HA 2J0WA 1C1CA 2EFVA 4W98A 3TZZA 5KG3A 3IGNA 2WBMA 3QAEA 4DN0A 2J6SA 2KM8B 2DH7A 1FNMA 4PYDA 5BXIA 2HGLA 4PR6A 5KG7A 3GIJA 2J6TA 2J8SA 4PXCA 3E3XA 1OYDA 5SZTA 2M88A 1RAFB 1GX5A 2BKPA 2WSEC 4P7TA 3UI3A 1YJWS 1N34F 4B9TA 1S0VA 4I4BA 2I5JA 2Y8YA 1QUVA 1HNVB 1WHVA 4NLTA 3OR1A 4PWDA 1XEZA 4ZLLA 3ZZUA 4URSA 1S9GA 5F8NA 1GTEA 1C2PA 5D4NA 3IRXB 4HHHA 4KTQA 3CJRA 3NMAA 1T9TA 1SKWA 7FD1A 1X4CA 3BB5A 4P75A 3W2VA 5F8MA 1SL1A 4O3NA 5B0CA 4ED4A 5EWFA 4G3IA 1XJWB 1VS3A 2YNFA 2HAFA 1CSJA 6AT1B 2J6UA 3IP0A 1FFGB 2V8VA 3I0SB 4YR3A 2LQJA 2MSTA 1DBDA 1SBRA 4B17A 1KSPA 5BYQA 1PKUA 1R0AA 1XMQJ 1RAAB 2HBYB 3V5RA 3MWBA 1J2VA 4DR5J 2DPJA 4OQJA 1C4AA 2O67A 3E8OA 5F41A 4RO0A 3KYLA 2EKNA 4ECXA 4KHPF 3W65A 4MKYA 2OELA 4M95A 2DO0A 3MPVA 2FJDB 2YQ3A 3K2YA 1CJVA 4L76A 5L9XA 5GAGU 3DDNA 3C14A 3PYEA 3Q2TC 2C42A 1TVRA 1NKCA 3C6UB 1Q95G 1S59A 3FFIA 4FKYA 5FLXU 1KQSR 4JI8J 1NPPA 3PFEA 4DL5A 3CULA 2YQ0A 5JMNA 1VBXA 4B3TJ 4ATNA 2ROEA 3PV8A 4IYQA 2ZUAA 2CNLB 2HFSA 1JLBA 5BYSA 1T95A 2Y1IA 4ZPBA 3ITHB 4PG6A 2FB0A 2DNYA 1TUVA 5D15A 2C3UA 5E7OB 2K7KA 2KZZA 5DG8A 3BDPA 2OPQA 2RQKA 1D8ZA 2HZVA 2ZDPA 2XMMA 4KHMA 2FGOA 1VJQA 3FBFA 4ZCLA 3W5ZA 4PG4A 1XNQF 3MMCA 2YPYA 1VGYA 4UOGA 1VI7A 3EYZA 4IOCQ 4M94A 4X4PA 2G2OA 4RBUA 2CQ1A 1RT7A 2G0JA 2MTLA 3CD5A 5EGYA 3DXBA 3SCKE 4RNMA 1TU0B 1U6FA 2HGMA 1R8BA 3VGUA 2MKKA 1KKHA 5JVGQ 4K4SA 1FXRA 1H7XA 3ISNC 4RZRA 4F0HA 3MFHA 2JEGA 1RWOB 1BWVA 2V68A 1TELA 2VV5A 4LBPA 2R7WA 4ZPWR 3THTA 3IM9A 3UVJA 2DGWA 1I5OB 1FX4A 1N5TA 1PAEX 2ZBRA 1F6TA 5K14B 2ZEJA 3MCNA 3LP2A 2ZOFA 3LF0A 1VQSA 3D4JA 3SQGA 1X60A 1GXTA 2HIQA 4C98A 3KG0A 2VPXB 2X3GA 1RHJB 4OI1A 1OY6A 1WG4A 3FK4A 2LMIA 4NZ6A 3OR2B 4UF4A 1LXJA 2G2YA 1IWAA 2KI2A 1HD0A 2QA2A 3I96A 5A0YB 3OUYB 1S6OA 2MLYA 3D67A 4J37A 1YITS 2HHHJ 2RKIB 1H72C 1MWZA 4AT1B 4C9DA 4URGA 1HL6A 5KFBA 2OD4A 3PHEA 4XPCA 1RT2B 4DR6F 5LJ5Y 2A3JA 2B9XA 4EUVA 2E1MC 4OHWA 2YKMB 4F4WA 4ED3A 4ICLA 5K8NA 2KB2A 1IBMF 2XMKA 2YH0A 3LP0A 4FPRA 4MYTA 1Q4RA 2VJUA 3BBBA 3R2DJ 4EGLA 1P8GA 1A6LA 2B7CB 3O2IA 2NUUG 3SCJE 2HBZB 1K9MT 4NXMJ 4OX9J 4I7FA 2IPOB 1TUWA 1SQFA 1VMBA 4J9SA 2HHWA 1HPZB 4RNHA 5KFGA 2RILA 5D77A 3GJSB 1FE0A 5DM6Q 3VAKA 3NMRA 3P8BB 4RW6A 3MMJA 4QPTA 2VHGA 1AYEA 1DZ5A 4DSKA 3MEEB 2QFJA 3SCIE 1SVDA 4OHZA 1YX2A 2UV8A 3NBPB 4Z7CA 3N6NA 1YZ6A 1ZM3A 4P7VA 4K4XA 4OHVA 1S1UA 3DYAA 5F0UA 1EQ0A 1K8AT 3CMES 2R8IA 3FBEA 3LAMA 4ED6A 1BE4A 1RCXB 1Q5VA 2O01C 2PGCA 1RT5A 4N8OA 5IT9Y 3CJTA 5ETVA 3CNQP 1XR6A 4P52A 3PW7A 4OJ1A 4JI4F 2W9CB 1U0HA 2YXLA 4HDGA 2NXJA 4J91A 3CWJA 5LSOA 4KV8B 1FESA 2HVDA 2HG4A 1FWPA 1R8HA 4DR5F 1F0XA 1D0EA 4RWWA 1NCLA 4IH5A 3PACA 1HI0P 3KLVA 1GQEA 2O3DA 3CDUA 4MKVA 3Q23A 5J2MA 1J5OA 1FDAA 1XR5A 3PJWA 4NYOA 4V19J 1J5EJ 4X4QA 3RBDA 4LF9F 5DLGA 2MQ8A 3M30B 3M9NB 4W90B 1AW0A 1UVMA 4QBUA 1X5OA 5F8LA 3UDLA 4DV4F 1UWBB 4ED7A 4I6YA 4NA2A 1DLOB 2DGQA 5LT5A 3OHAA 4RW7A 4WTYA 2VICA 2W2NP 4LF5F 5HP1B 4KV8A 3PR4A 4MKBA 4X65J 2WRMA 3A8KA 3VAMA 2Z8QA 2LXIA 5IS2A 3QLHB 4HYKA 2HKEA 5AT1B 4DZDA 4L6V3 4G1QA 5ETKA 2VQFJ 3DGVA 3HVWA 5KFPA 1TFYA 5ETOA 1URRA 2RU9A 3M6UA 3VV2B 3TUJC 4DEZA 4EWTA 1VQNS 3DOLA 2W4CA 1LW0A 3ZTQA 3D54A 3NS5A 4CLTA 3C16A 2XG8A 4ZVGA 5I3PA 2DCLA 3DHWC 3AJ2A 1X4BA 1JLCB 3MMAB 4JP8A 1KBRA 4KKOB 1RT4A 1HNZJ 4K5SA 5GAEI 2QL7B 4FBUA 1VBKA 2XMAA 1YIJS 1YJTA 3GWCA 4WFAQ 4F4YA 3MEGB 5DZ7A 1RT6A 2MY7A 4I7FB 2LU1A 2E5HA 2QSWA 1T9UA 1MG7A 3R7NB 1I3OB 2RDIA 3Q2SC 4NEZA 4O4GA 4DHVA 4OZ5A 1X4EA 4DG1B 4XPEA 2CG4A 2MHEA 4NYZA 2KXNB 4NYPA 2E5JA 3J81Y 4TN2A 3KHGA 3KHRA 3HD1A 3KUGA 2DGOA 1HQ2A 3QRQA 2UU9F 3BH6B 5D3GA 2J0XA 5DM7Q 2W7OA 2LP4A 2FVQA 1RBOB 5CH7B 4C8ZA 3QBCA 1DLOA 2HRTA 2X7IA 1NJZA 1TMMA 1ZA2B 1Q5YA 2W1BA 2HNYA 4QQBA 2W2QP 4X84A 4PABA 2W4DA 3CGIA 2CUYA 3OR2A 3T5LA 2FJWA 1TL1B 4M5GA 4OIXA 3M30A 1L3VA 1Q8LA 2NPIA 2UZAA 4DLEA 2QA1A 3N5BA 2B6AA 2XYHB 4ZN1A 4OV6A 3IM8A 4ILRA 3H40A 3AD9C 1IVZA 3MR5A 2MZQA 1RTJB 4LSLB 3J80Y 1K0TA 2JWNA 3PCOB 3U1LA 3CC4S 5B0FA 1WHYA 1Y5IB 2RDJA 3OW2R 4MIBA 1NU4A 4O0NA 4P10A 2L9WA 3LW5C 3TUZC 5IWAJ 2B9WA 3NCQA 5H9EJ 1VIXA 1F5AA 2DO4A 1U45A 2W9CA 1U8WA 5DDRC 3ELHA 3HFKA 2XTJP 2KO1A 3MMBB 1KONA 2A1BA 1RTDA 2YNGB 3CF5Q 1O8BA 2GJ2A 2EG2A 3EWGA 2CQCA 1Q7LB 2EFPA 2V67A 3D1QA 5E5NA 4KGZB 2PC6A 3OBIA 3JYTA 2EFNA 2BE2B 2DGUA 4PG7A 2XCAA 4WZQA 3MM9B 4TXSA 3T9ZA 3QAUA 4R5PA 1FTCA 1GMWD 2PI4A 1HBOA 1S99A 2FUG9 4RW6B 4X62J 5CD4A 3ISND 2AQ4A 2OPSB 2HNDA 4W4MA 2DB1A 1RHQB 1X7VA 2IHR1 4DR2F 2BW2A 3SI8A 3FFIB 1YJUA 2KYZA 2HQIA 3DU5A 3LP1A 4EO8A 4RPFA 3BQ1A 1VK3A 3EE3A 2MJUA 3NGSA 1FA0A 3WZ0A 1EJ7L 3CJ5A 4USKA 4C8LA 1L3KA 4OV1A 5IOLA 2PIIA 2RB7A 3GB0A 1RKJA 2DRBA 2G13A 2OIHA 4DBQA 2WAQD 3DOMA 2QG9B 2RE1A 1HWIA 2A2CA 4M5NA 5F0WA 4DFKA 2VPWB 4OYAA 2BRLA 2RKIA 2IMOA 5T7LB 1FRIA 2NLWA 2UUAF 5K8OA 4YY3J 3I0SA 3NGRA 5CQGA 5HVFA 4C6AA 5KFMA 3PVXA 2JEFA 3Q8UA 4YY3F 4Y2KA 2RF2A 3H8YA 3W64A 3EGVA 3MM7A 2DNHA 2DR6A 1F3FA 3AB4B 3FQKA 3HULA 2DK2A 5CYMB 4YS2A 4NASA 1U1QA 4PUOB 1S10A 1RT1B 2RVJA 3THPA 3I56S 4ZKAA 1D09B 1GK8A 2ZHOA 3O44A 1HNZF 4IRDA 2KTQA 3Q8RB 1U09A 3F56A 2HQ3A 1WC1A 4H4KC 4U96A 4NLGA 1VIOA 3HPOA 8AT1B 1AXQA 3SEOA 2BX6A 2DYAA 3PNIA 1DJ0A 3MM5A 2YKPA 3PHTA 3ZZYA 2GGPA 2XULA 1DARA 5KFDA 4YUDA 3BREA 2RNEA 2Y1JA 1KQGB 3QT6A 3CJQA 2R2TA 2DNNA 4DR3J 2MXYA 3MR6A 3EVOA 4DLGA 2XWXA 2F65A 3OVAA 4DV1J 3CDAA 2R7UA 1TKZA 1R43A 3PKYA 3VALA 2VA3A 3LAKA 2JOQA 1S76D 4F3QA 4WJBA 4NLVA 3WDOA 2UVRA 4W92B 2H5JB 2VH7A 2CQDA 3ITHA 5KFYA 4I56A 1U1LA 1JLBB 2A18A 3QIPA 1S1UB 2PDAA 3DYAB 2R7VA 2DY1A 2CPYA 2EK1A 4NA1A 5DGBA 2CFXA 1MROB 3SDEB 4RW8B 4UW2A 3OLBA 1YRXA 2GVZB 2QTWA 2YNHB 3KK2A 5CZXA 5HMXA 1J5EF 4RUBA 2DHHA 3GQCA 4WKRA 4ZPVR 1XR7A 2HQDA 1YJ9S 3FDSA 5ETRA 3JS9A 3GPAA 2F8HA 1HPZA 3LPEA 2KRBA 1GNKA 1VLYA 1QSYA 1JLEB 1PO6A 3M32A 2IM1A 2CPJA 3KK1A 1H38A 3H5UA 4NCGA 2BOAA 2XEXA 2PMHA 1RYSA 2F4VJ 3MZIA 4ICLB 1B4SA 4IH7A 3ZZRA 2IIHA 1S97A 2UXDJ 2RQ4A 1N88A 1OJ4A 3I31A 3RYLA 5MLCV 1RT2A 3TX0A 4DQSA 1QAXA 1NHKL 3MUTP 2YNFB 3PRBA 3OJSA 1V3SA 2KHCA 2KT5A 3CXCR 5I3UA 1DQ9A 3HHLB 1NB7A 2FVPA 3C2PA 3NNAA 3ILOA 4B9NA 2A10A 1LFWA 5ETTA 5F9NA 2HYIB 1F9EB 2M52A 3MAHA 3C15B 1PAUB 3M4XA 1FE4A 4OFZA 3W61A 5IT9U 1MW7A 3BKTA 1R7IA 1LK5A 2BJ7A 3FKBA 2DITA 4F50A 2PEBA 3H4DA 2B4VA 4ZLPA 2JRSA 2B56A 2VU5A 3L09A 1YBAA 5HQLA 3AA9A 3JQMA 1D3WA 3P3DA 2ZHBA 4FYYB 1R31A 4FNIA 4Q2LA 1ZOTA 3FQLA 4WFZA 2AYGA 3N28A 5JXSA 4X2BA 1TAQA 3HI9A 1UA0A 1SKUB 2QN6B 3IR5B 4ZLJA 1HARA 3IAS9 4IG0B 5KT5A 2YX1A 3WIUA 2EC0A 4X64F 2RIJA 3EPGA 3UWTA 2JFKA 2C2ZB 3PJ9A 1EX8A 2AZ3A 2MDAA 4Y0FA 2L3MA 4HT5A 2XZTB 1NUEA 2HSEB 4USJC 5T14A 3U7JA 3GIMA 1WTBA 3CT9A 4LBHA 3LGHA 1BMQB 1YBTA 2VA2A 1PC5A 2O66A 1V6HA 3PX0A 3H2UB 1FKAF 2HURA 4TY9A 2AYMA 5DGAA 1HHSA 3VAFA 1XERA 2WW8A 2IC3A 3ILLA 1FDNA 5ADZA 1IR2A 1S7HA 1JJHA 2E5IA 2ZNZA 1MNEA 1CJTA 3C14B 2HLTA 5KOWA 2IDLA 2N7CA 1CJVB 3IGVA 3N5FA 3LP1B 2DRDA 2VONA 1FXDA 4NLWA 3MOJB 1BD6A 1ZZNA 1B64A 3A1YG 3KDNA 2Q79A 3Q8PB 2HNDB 1W25A 2GHVC 3RB3A 3HK2A 2ZKTA 4RX6A 3V81A 2VZ9A 1WOOA 3OD2A 4IDKA 3KLEA 4B3RF 4P2MA 3CJ3A 1R0AB 4WFBQ 2J9DA 2NYIA 3DLKB 1FRMA 4BHQA 2UUCJ 2NQPA 4CO3A 3BSCA 1FF2A 3SDEA 1UW4A 4WZMA 2XYPB 2CQIA 2DNGA 2VG6A 3B78A 4AFFA 2RRNA 1RHMB 4NZ7A 4DSJA 1I94J 3HJFA 4JV5J 3CJ0A 2HHXA 1Y5LB 4WK3A 2FVCA 4QWAA 3PYFA 2GIFA 4KB7A 1F60B 3HO1A 4U7UD 1B7FA 3SCLE 2UXBJ 1WHWA 5DJBA 3H2LA 3MMBA 4YDXA 4EZ9A 5D4LA 4DX6A 4RU9A 2W8LA 4FVCA 4IO1A 4QIGA 2RSQA 1F1BB 1PJ5A 1WTFA 3TVZA 3C6TA 3NWGA 3QYYA 4OYXA 4A4JA 4B9VA 1HWJA 3VQTA 1M5PC 4KHPJ 3PM9A 4DPWA 3SMZA 1K0VA 3WX4A 1M5HA 4RL1A 2O1PA 3W62A 4CYUA 1BQMB 1O0PA 2WVFA 4K2XA 1FTRA 4OYZA 1UETA 3TAMA 2QEXS 2FY1A 4ECRA 3TWZA 2LA4A 2VG5B 3CJ4A 3JTNA 3S6EA 3U27A 3MECB 3BGRA 1MMLA 1NXIA 4H54A 1UA1A 4MIAA 5GADI 3J80U 1SPBP 1TMJA 5ETNA 2YH1A 4LFAF 1PC4A 2AW0A 2BM1A 3M8SA 3JXOA 3RBEA 2BQRA 4CLWA 4PUOA 5LMNJ 3W9IA 4HKQA 2EWHA 2QMWA 2HS3A 2KG0A 2IA6A 2RF2B 4M63A 5H1SV 1U6BA 1I1GA 2YWEA 3F41A 3S1TA 2ALZA 2XWYA 4KGVB 2MMYA 3BBFA 4DV5F 2F9JA 2JNJA 4DFPA 2XGPA 1B0PA 5D4PA 5LSLA 2UVUA 2AX0A 1LWFA 3FUYA 5G0RB 2VDHA 2V34A 3FSYA 4IO9Q 1AZSA 3ZFVA 4H4MB 4QZVB 2VQEJ 3K5OA 2V63A 2UUBJ 4C8YA 2PN6A 4N56A 1IM6A 1FKPB 1HKAA 3E01A 1IBMJ 2AGOA 1KFSA 3TAPA 1UVJA 1N33J 2W2MP 3G82A 2IC3B 2FJAB 2RRAA 1F5BA 3C16B 5KTQA 1N8RT 1M90T 3TVYA 1OY9A 2C3YA 1WC0A 3M8PA 3DOLB 1U2RA 7FDRA 1HNIA 3KLFB 2ZC3A 1R0BG 4KJIA 5GAGI 2ASJA 4C4WA 5SUHA 2OPRA 1OY8A 4G1QB 1H2TZ 3BSOA 2FLPA 5DDPC 1FERA 3FVYA 1ZA1B 4JI7J 1N5SA 1JLAB 4NRUA 2V8GA 2MGZB 1SJ1A 1IKWB 2IM3A 3D6FB 4N7TA 2KM8C 3MR3A 3QT5A 1R89A 4UY85 2VBWA 2Y0SD 3UO0A 1DHMA 3R7SB 1S1WA 1VQYA 1ZS6A 1N52B 2CQ3A 3GCWP 3HT3A 2XO6A 1AROP 4AQYJ 3TZYA 2RS2A 3VQSA 3PIPQ 1JK9B 3H59A 1N4LA 4DJBA 1E6VB 2DHXA 1KN6A 1UCNA 1RT1A 3EMTA 4RW4A 4ZVEA 5T41A 4X4RA 4ZPAA 1JLGB 2J9DE 4DPTA 3TARA 4B9UA 1WEYA 3AAWB 4JV1A 4I2QA 3EGNA 1OSCA 2CJQA 2FHJA 2J76E 1FCAA 4J9VA 2Z4PA 2HQGA 2DT9A 2CJ9A 4TKTA 4UTGA 4ANDA 4DS4A 2HVIA 2QSFA 5A8WB 3TZWA 2KT2A 3K59A 4KBIA 4ED1A 3HHLA 3QJLA 2MEWA 2UUWA 3MM8B 4X4SA 2OHDA 1FNXH 1S4FA 4KT0C 4GKKF 4JYAJ 2H65B 3IR7B 2BA9A 4DQPA 4X4OA 2CZ4A 3R5BA 2OSQA 2WHOA 1IBLJ 2R9LA 2C2RA 3DLBA 1JNRB 3NBPA 3NNCA 1TAUA 2WZ1A 3BH7B 3RG6A 1WOPA 1HA1A 2XB2D 2FJEB 5K9FA 1N6QB 2HQFA 3DHXA 2B0GA 5KG5A 1VCTA 4Y2MA 4A48A 3K0JA 4WE1A 5IXUA 3CC2S 3OL7A 1IKXB 3I55S 1HR0J 2CJKA 1RLDA 3CCES 5AXMA 1HBOB 2AGPA 2R8KA 4WTOB 2QZ8A 2MLXA 4UOFA 1KHWA 2OO4A 2K06A 2W9BA 1JLCA 1Q8BA 2VF3A 2ZD1B 2H4YB 4M5JA 4RW8A 1DY3A 3MAAB 4O23A 3D6TB 3I0RB 2PMZD 5KT7A 4DL7A 2YKMA 2AD9A 2HHHF 3QIPB 2YVSA 1SQEA 2P9GA 2V94A 3HVTA 2QE5A 1QTMA 4CLPA 5KFFA 4FPIA 4FYXB 4YFUA 4NXNF 4N41A 2M3DA 2Z2ZA 3HLUA 4C8MA 1VQ8S 3V2UC 3CO9A 1M5KC 3UD4P 3C19A 1APSA 2V6AA 1YRTA 1YQHA 3VGVA 4DV5J 4IRCA 3TJ9A 4RW9B 2NXEA 2FJXA 4LF7F 4UY8T 1C4CA 1REGX 4O3SA 3AY0A 4AD6A 3M8YA 1UWBA 2DHGA 4BDPA 2F4VF 1SH3A 1JLGA 1QLNA 1XK8A 3MEKA 2DR5A 2NZ4A 2YKNB 3H0PA 4PZVA 3GLJA 3B82A 2DJWA 2HS0A 4TY8A 2IMWP 1V3RA 2J9EA 2YKNA 4KGXB 2X1FA 5I42A 4LRFA 2HNYB 2CZ9A 5CYMA 1N5YA 1R8PA 4QW8A 3GSIA 4YDDB 1EARA 2DEIA 4HHJA 4RW9A 3HZEA 2J7KA 1SC3B 4E2FB 5LXYA 2BBEA 3IA0A 1NSPA 2ZH4A 2QLFB 3VZIA 2W24A 4RUAA 1IKVA 2KDOA 4DV2J 3QGPA 2V8PA 4DR4J 4KFBB 2AU0A 3EGWB 4PRFA 2XMWA 1HNWF 1VK8A 2CADA 3KLFA 2DVIA 3HVTB 2DD8S 1RK8A 1CJUA 2CPHA 2NZCA 4G65A 3FEZA 1JX4A 3GR1A 5F9LA 5CAAA 5KFUA 1B70B 1CS4A 1S9EB 2LU2A 3OFFA 4USUA 1VQKS 2DKOB 1CVJA 2W9BB 2W25A 4D3HA 3DLLQ 1QM9A 2MZJA 4A47A 2H5IB 1TVRB 2XBPA 4HTJA 4OHXA 3QATA 1FKPA 2MPUA 3ULHA 3F73A 1NDCA 1XQIA 3UDCA 1IWGA 3RTVA 4FBTA 3M8ZA 5HJYA 4K59A 2BV3A 1SJ4P 1RYRA 4JV0A 4ES3A 2W9AA 3K58A 5H9FK 1YK9A 4ZCKA 4I0WA 2ZBPA 4YEAA 4AXIA 5DDQC 3LWLA 3K5MA 1N6QA 1HD1A 3CCJS 4TQRA 4DQIA 2M5YA 2VC1A 4KFBA 4Q44A 1CULA 4URQU 3H5XA 1S0NA 2UXBF 4OJGA 4ZMMA 2C2NA 3A4TA 4DV2F 3A8EA 3QRRA 1ZPWX 1U24A 2XZDB 3CMAS 1N36F 3TYTA 2V4RA 1SKSA 3NAIA 4OZ2A 2K8GA 4P72A 4CTAB 2EXUA 5KOXA 5J1PA 5JUMA 1VC5A 4B9LA 2AJQA 1V3ZA 2OMLA 1KFDA 5A8WA 1M0SA 1WJ9A 4L73A 3QZ7A 3H25A 3BQ2A 3GG1A 3IRXA 3IO1A 3FZ2A 4EFAC 1D8YA 4TY8B 1HMVA 2FPHX 5HANA 1U26A 2VIHA 3V6DB 4CO1A 3EZ5A 1FK9B 3I87A 1FRJA 2GVDA 5J1NA 2CPZA 1FRLA 1HFEL 3G6VA 3VAJA 1G2EA 2JEIA 4ALZA 4CYUB 2R7XA 2V4QA 4WKYA 4FXVA 2JVOA 1ICEB 4B3SF 5THWA 2CPXA 4USVA 1XNRJ 1CC7A 2ACMA 1S1WB 3A13A 2BVZA 1NK4A 3UN5A 4X4VA 3Q86A 3L9ZA 3VAGA 5LJ3Y 2V2QA 4C11B 1PBAA 3D1HA 4RNOA 2BXJA 4LUBA 3QRPA 1WC3A 3R3TA 1IUJA 3NG8A 1RWVB 1RAGB 3W9JA 2JC1A 2DISA 4LVNP 3UW1A 5KFEA 1XNQJ 4PYAA 1SI9A 1SIZA 2FJBB 1MU2A 3P45B 4WU2A 3UCUP 4B9SA 3B4MA 1N54B 3NXZA 5FD1A 3GILA 3T6BA 1Y7PA 4JI3J 2OUGA 3AQPA 2G0IA 2VBXA 4C0HA 4F67A 3MEEA 2FDNA 4HACA 3PTWA 4OI3A 1ZAVA 5MAOA 3R1LA 2E5LF 5HMWA 4M5IA 4TYBA 4ZVTB 3ZZPA 2BE7D 3GR0A 4CM0A 4WFNQ 3MHYA 3KJVB 1D9FA 3V4IA 3RAMA 5B0EA 1P9QC 5LL6d 3OTOJ 1UW9A 3MM6A 1Y9OA 2MZ1A 2UXDF 4JI1F 2HHUA 1T94A 2NCKL 1ZM4A 3P5BP 3TUIC 4FYWB 3IN5A 1ACMB 1AA1B 2J5AA 2Q6BA 1Q86T 4JV2A 2I2YA 4UOCA 4PXEA 3OTDA 1Q79A 2C2MB 4ECVA 2IFXA 1NH7A 2QV6A 2WTFA 1BXNA 3CO0P 1IR1A 3EVWA 4H4OA 4ETZA 4LBIA 1QJHA 3QLHA 1K47A 1Q8KA 2B9YA 4DF4A 3PZPA 3BO3A 2P8IA 4AL7A 3FSXA 2CNNB 3M2VA 4N47A 1X4HA 5KFZA 2DR7A 3MPWA 2R8HA 3LANA 3RAXA 1TV6A 2DBBA 5EX3A 1ZETA 1X0FA 2YNIA 1R0CB 1Y5NB 4HEA9 1KDNA 5DZ6A 1PSDA 5HVGA 5GAEU 2AT1B 4ZP7A 3ZTPA 2H4WB 2HHPA 1S9GB 2RQCA 1VQ6S 2NR0A 3HZGA 3DRPB 1RAOA 2XSJA 5EDWA 2WONB 1KOOA 1UPPA 2D7SA 4KGKA 1UMJA 4WPAA 1FWKA 2CXEA 1B0VA 2C28A 3DLGB 5ETMA 1SJRA 1W26A 2MYFA 4DV7J 1JLAA 2BACA 4YB7A 1WF1A 1NM2A 2MQQA 3DLHA 4B3OA 2OEKA 4HH1A 1M1KT 3CTRA 1AUDA 4XIUA 1U7LA 3R7BB 4QR0A 3UCGA 4DX7A 3W5XA 4WIIA 2Z2YB 4WU3A 1HI1A 2H3EB 4ZIWA 1U25A 1WI8A 2D41A 4NLOA 2KFNA 1S57A 4HL9A 4ED2A 4LRBA 4X65F 4HH0A 1LXNA 4NE9C 3AOCA 4HT7A 4IFYA 1LQ9A 4DUTA 2VG6B 1T9XA 5GAHI 3HVRA 3Q0AA 1CC8A 4JBCA 3T5KA 3BR8A 3LUYA 1BQNB 3BN7A 3QO9A 1WKKA 3SYZA 3UDEA 5HSPA 1PYOB 4NWBA 5BJRA 3HHEA 2A0FB 1JLEA 1T9YA 3IG1A 5B7WA 3CVKA 4NLYA 1SJFA 1S0OA 1BHNA 3WIVA 4ECQA 3BYRA 1Q7YT 2R7OA 5G0RA 4CDIA 3LGNA 2BZ2A 4DL0C 2XI3A 2EBEA 2FLLA 4NCBA 2XS2A 4OYMA 3T1YF 2H54B 1TKXB 4KQZA 4XDCA 3EVMA 2HHSA 2GVZA 1NDLA 1LWEB 1RKIA 2YNHA 4UZCA 4PG8A 2IA0A 5D0RA 1L3UA 2LEPA 3BR9A 4IFYB 3TA2A 1VC6A 3X3UA 2AJ1A 2LFVA 3FRYA 4LSNB 4AXJA 2IAJB 3O8WA 3DGPA 1NEEA 3CW2C 3TNVA 1HI8A 2XI2A 4LMZA 3M2UB 5DO2A 3QGIA 1YKWA 4ID5B 3MECA 4ZP6A 3UDVA 2BKNA 3AQOA 2X1GA 4DQQA 5FIIA 1KWMA 2BJDA 2IRXA 4DFMA 4CLFA 4PXDA 3UCZP 1S9FA 2F40A 4JI0J 2HBRB 4FYDA 4Y2AA 4CZCA 2KJVA 5CYJA 4BC7A 4RKUC 1VQ4S 3CCMS 1PCAA 1N48A 2V5HG 2DEJA 3QSYB 1Y10A 4J9QA 3W60A 4FF2A 4LF4J 3FRZA 3VR1A 3M2RB 4JB8B 4PAAA 1PJ6A 5A6PA 4X62F 3G96A 3N6LA 3ZNJ1 1VFJA 2WOMA 1NJXA 1WOSA 1HLWA 5LMUF 4DUZF 3OVBA 1UPMB 3C15A 4KC5A 4NEYA 1TP7A 5F3ZA 2MJNA 3TA1A 4YMEA 1RWPB 1R3NA 4C3MA 4USTA 3UN2A 5B08A 5L9NA 1HHTP 2ALYB 4CO0A 1XWLA 3CCVS 3H5SA 1Y4ZB 2FLNA 1HNIB 3CJ2A 3UNGC 5M2UA 2CQ4A 3NGKA 2BJ1A 1HBNA 4G1PA 4Y65A 3LWMA 2KXFA 5AE3A 3HHNB 1HQEB 3DFEA 3UD5A 5KFNA 4ZDNA 3M8WA 4CNYA 4Y2IA 4OYIA 4TQSA 4LIRA 5J2QB 3C6UA 2UP1A 4LVOP 4HDHA 3UR0A 3RRKA 4RLEA 5DRKA 4OYOA 3BO4A 1U6ZA 3I5CA 2G1HA 2L9NA 3K5NA 3P5TL 2E1PA 3PRVA 2K2PA 4ZVPB 1VJWA 1JNZB 3G9CA 2QFIA 3KG4A 3MAQA 2N4CA 1M1GA 4DXLA 5IT4A 4EZ6A 5GADU 1NJYA 4LR9A 4NRTA 1X4DA 2BUNA 2X3DA 3R5CA 4Y34A 4R5PB 4UT4A 4ER8A 5KFIA 2WB1D 2E7VA 2C22A 1SC1B 3U1NA 5B0DA 4YOEA 5F8IA 2XGQA 1LWXA 2AZ1A 2ZZMA 2DNZA 1MU2B 2VFVA 4ED0A 1KLMA 2B8PA 2B4PA 2MQNA 3QIDA 1D9AA 2L41A 1GMVA 2VL1A 3I9ZA 2OSRA 3W2VB 3MI7X 3THVA 2HIYA 2UUTA 3BN4A 3N9UC 2Y1RI 5KG6A 3ZTOA 4CO5A 1VQ7S 2ZWOA 1IJFB 4Q0BB 4D3GA 2HWHA 2QLXA 4KIAA 3SZ2A 1KC8T 1EKSA 1MMDA 1WSRA 3S7RA 4DOZA 1RWUA 2LQ9A 3RRHA 4OI0A 1RWXB 3VVUA 3SV3A 5IM0A 1X9MA 1EP4B 5LMUJ 2YBVA 3W2WB 3OJUA 3HHKA 3R9LA 3ONQA 5DETA 4TLRA 3M6WA 1PGZA 2R7SA 1AT1B 3HSJA 1NDKA 4OYPA 5A76A 4ZHRA 2VBYA 3G6YA 1KS2A 2R7QA 4J9OA 4DWIA 1RB0A 3W66A 4E98A 2J9CA 3L3CA 3BSNA 2MSSA 3GSDA 1NHVA 1W2IA 4UQGA 1IBLF 1KLNA 4P71A 2DXFA 2WVCA 4C3LA 5HLFA 3EXYA 3K89A 4F25A 1T9WA 5F8GA 2XC9A 3V6KA 2ACYA 2AEMA 3UD3P 1UJ4A 4LF8J 3DGPB 5C25B 2EW9A 5I3UB 1DTQB 1TL5A 5LM7E 1H74A 1TK8A 1UTAA 1U1KA 2V2ZA 4B3TF 4U8YA 1UL3A 2KZMA 3RUBL 2ROGA 4DI6A 1OWXA 3BSAA 1RU1A 2HWIA 2CVEA 2LYVA 3EJMA 3I6PA 3S01A 1S6QA 4ZS6A 2LEBA 1RACB 1F9HA 1SH0A 2KYXA 2N7YA 3DLKA 1RHRB 4GRSA 4MFBB 2A6MA 4P73A 2CQPA 4O3QA 4H4OB 4IDKB 4CH7A 2H51B 3V81B 4EBCA 3D66A 2HWTA 3AXMA 1FD8A 3VGTA 3MUVP 1HYSA 3MEGA 3CIMA 4QWDA 3IG1B 1FEEA 2GO9A 3D68A 4R0JA 1WHXA 4YHHJ 1B0TA 1UZDA 2F4FA 3KLHB 1XMQF 4Q43A 2VUGA 4F2RA 3MPDA 1DTTB 2PT0A 1BQNA 2X51A 3QO9B 2XHCA 3GYGA 5BR8F 1RT4B 3BGUA 1ZTWA 1FJCA 2MKYA 2MQLA 1JXLA 1KHVA 4F4KA 1CS4B 1S9EA 2VKRA 4QYRA 1AUSL 1HW9A 2WSCC 1OS5A 2VFRA 3DU6A 5DG9A 2ZH1A 3MM9A 2YKOA 1NH8A 2BJEA 1REVB 2WVDA 2C2OB 3KJFB 2RHSB 5EHHA 3NS6A 4JI4J 3KTQA 3J7YI 4JI5J 1IKVB 1RI7A 5BYRA 3DLJA 4F0MA 4QIEA 3ETMA 3PXGa 3JAMY 1YDLA 4B3MF 2GO8A 2E29A 2YPZA 3RAQA 2PD1A 3TO8A 2ATLA 4MK7A 1FKOB 2HNZA 1WNEA 3R1HA 2AV5A 2GGPB 4CI0B 4IG0A 2ZM6F 1TKTB 1HWKA 2OD6A 4JOUA 3MPYA 2VPZB 4K8RA 5IQ6A 4ECWA 2B9EA 2F3JA 2WVBA 2M0GB 4A8WA 1EKRA 2WONA 2R42A 3BDEA 2UVVA 2D1CA 3NGDA 1O5JA 5HN0A 3IRWP 2KVIA 3F0NA 3MGJA 2C2EA 4LSZB 1PYTA 1NAQA 1L3SA 1OMSA 4KGMA 2AJ0A 4NL5A 1NSKL 1VC0A 1YSJA 4X66J 2HFOA 4M5DA 3UR3C 3EZUA 3DDIA 1YRUA 4CLKA 1NMEB 1H2VZ 2DGVA 2H48B 2QC3A 1RWKB 4O3OA 3SSRA 1RUSA 4F3MA 3D0GE 1NJWA 3CJ8A 3FBCA 4ZVQB 2FHKA 3OTBA 1TL1A 3NLCA 4ED5A 4O4RA 5IC4B 4RJVA 3A8IA 2G0CA 3CJKA 2GAHC 2LEAA 2N4DA 3VAHA 1YTYA 5I3QA 4CRJA 4CTAA 5HMZA 2B8QA 1S77D 1HBMB 1NKBA 1Y0HA 2DY9A 2M9KA 1BY9A 5E41A 3M7VA 4K2JA 4NPOA 3IWNC 1GEHA 4JV5F 1NRKA 4OL8A 1VQPS 3TEHB 3MAAA 2IM2A 1RE1B 1RWMB 3QT8A 4O4GB 2IBOA 3UE2A 2XS5A 3MM6B 1KD1T 2AKWB 5C24B 5D78A 1UAWA 2R3VA 4QPXA 1IKXA 5A8KB 4ZCIA 1KNZA 4F0KA 2OPSA 3Q83A 1S1VA 5KFKA 2QX0A 5KG0A 4ECSA 3ZZTA 1P6TA 4RBVA 1X8DA 2EK6A 5B09A 5RUBA 1X31C 2JFDA 2JLFA 1MROA 5L8RC 5M2RA 3KK2B 1UVIA 1ITPA 4LJMA 3D7SB 2OKQA 2MKIA 4I2PB 3OL6A 4YP3A 2P9CA 4UZBA 1G4CA 2HVHA 3Q8SB 3BKUA 2QL5B 1U1NA 1NHUA 3RB6A 4G6VB 1JXEA 2R4FA 4HLBA 3QGGA 1VQLS 2ILYA 4ILLA 2Y0BB 1T02A 3ZZZA 4ZK7M 5F3TA 3DRSB 2DXDA 4R25A 4BS2A 5AXLA 2ASDA 2N3LA 2DH8A 2VB6A 1UVNA 1YZ7A 2CWKA 2GHWA 3DMJB 4AYBD 1N5YB 3DCAA 2CAJA 4M5DB 4E8UA 3N01A 3CD7A 1P9YA 1WC4A 3QPIA 5C2GA 2DXEA 2KN4A 2B6AB 2Z2LA 1IQZA 5A2QU 1O51A 4MH8A 1X5TA 4EMDA 4WFYA 2GMJA 4F26A 1I51B 1QTNB 3FSIA 2ADCA 1QSSA 2FC8A 4M5KA 2MZSA 2ZITA 3PY8A 1UFLA 1JJ2R 1JLFA 1P1TA 4DCOB 4OLPA 2VQEF 2BOPA 2KXHA 2GNKA 1IR0A 3FNNA 3A3PB 1FKOA 2BJ9A 1U0SA 2HNZB 5J1EB 4YQWA 2DHAA 1CLFA 2BJ8A 4YR0A 4YR2A 1U0HB 5ITHA 3ILIA 1Q78A 4NXMF 4RR5A 4AL5A 4ILMA 3IS9B 3OTOF 5T7LA 2E1AA 4DSLA 2V8HA 1CQMA 2OPRB 3ICLA 1W2BR 2N3OA 5HLFB 1TL7B 3K8VA 4DU8A 3E2EA 4C3KA 2R2UA 2WCXA 3TZXA 1RT6B 2ZE2A 3OFHA 1L3TA 2GAGC 3I0RA 4ZVOB 1FRKA 3HJVA 4KH1B 1Q8IA 4ZOSA 2HLUA 2BQ3A 1T11A 3Q24A 1FRXA 2J7UA 5HVHA 3FZBA 3CE8A 3MMAA 2ZH8A 5KFHA 2M7SA 2IVYA 2AWZA 3J7Z5 2PO4A 1WI6A 4KO0A 4GC6A 1P1LA 3O3LA 4A46A 1URNA 3TEGA 1OO0B 2OEMA 5LSRA 4EEYA 1QE1A 3T1HF 4CO2A 2RT3A 4ED8A 1TUGB 2KFYA 2D3OR 4ZITA 3N6MA 1S6UA 1FHTA 2HZAA 2VQFF 1RJJA 4CH1A 1R8AA 4J9KA 1YHQS 4DPXA 4V1Ak 5KG1A 1HNWJ 1D1UA 4Y28C 4GKJF 3MR2A 1RHUB 4I6AA 2NSBA 2AEFA 3PG9A 2Z57B 3WX8A 2CQ2A 4K7QA 4CH0S 4CIOA 4YB5A 4FS1A 5G4DA 2YY3A 1NO8A 2OPPB 2QYGA 3DM2B 4MIWA 4CLZA 4WYWA 5HMYA 1NK8A 1H98A 1UP1A 3PW5A 5EWGA 1QVFR 1FI4A 2GC8A 4CLSA 2IYGA 4NCAA 1MMNA 1RTHB 5B0GA 2R2RA 2MZTA 2MLZA 3I5BA 4MK9A 2ZH7A 1WSVA 4RW4B 2L9DA 6FD1A 3MOZA 3TI0A 4J5OA 3BZQA 1NLKL 1HBUA 3MD1A 5IM0B 4LQ3A 3K7RA 1SV5A 2VD3A 2GIRA 4IOAQ 1PG5B 3J81U 2GMLA 2MQMA 2LVWA 2RRBA 2YKQA 3SFUA 3D3BJ 3J7YU 3LH2S 2QLBB 4OHYA 2YWHA 2BYCA 4P74A 4QYZJ 1MWYA 1J27A 5GVQA 4OX6A 1RAIB 5AXKA 2CJBA 2LXUA 3BKFA 2IDEA 1PIEA 4ZCMA 2GHPA 3TJ8A 5CA5A 1KEKA 4AQYF 1H0HB 4JI0F 5D8HB 3ILJA 3FCWA 3KLEB 2GQCA 2IRUA 2MHNA 1R27B 1S1XB 3D1OA 3HCXA 3M8PB 2H1YA 3W8GA 1EZZB 1V9OA 2NXCA 3NCRA 1Q53A 1SJ3P 1U2CA 4ANEA 1Y3KA 1H73A 3UQSA 4DR4F 3M1VB 2XY7A 1K1QA 4LR8A 3JQJA 4KKOA 2M70A 4ECZA 2XLJA 2CYYA 1M1HA 4UUWA 3JQKA 3TJAA 1RISA 2QL9B 4PPZA 1H2UX 4QWEA 3CD6S 1FXLA 1HQEA 4N77A 5KT2A 2XO7A 2ZJPQ 1N34J 1IN0A 5CZVA 4NX9A 1NPKA 3AHPA 4U9RA 4A8QA 1T03A 3IBCB 3V6JA 4USWA 4WYLA 1XC9A 2Y1LB 1GTHA 4Z2XA 2HGNA 5A0YA 2Z58B 1GAOA 2NXUA 3VCDA 4USMA 3ZNUA 2A6OA 3CCWA 3OXGA 5HJXA 5DG7A 1TQLA 1HQUB 1FRHA 3GFZA 2HPUA 4RU2A 1EB0A 4ELUA 2CPEA 2WOMB 3MF5A 2RD5C 1NK5A 4DUYF 4LF7J 3AB2B 4U95A 3OL8A 3AJDA 4J90A 5KFXA 3RZAA 5KG4A 3SQOP 3HDSA 8RUCA 4DUYJ 3GV8B 2DGTA 1FNOA 2FZCB 2DIVA 4JI5F 2GCFA 1TK0A 1NSAA 3KLIB 1S1XA 2HZCA 5CCMA 5J2MB 2IRYA 5JVHQ 1K73T 5M2PA 1FWLA 2XMVA 4J9RA 4DUZJ 4A8MP 4ZA1A 3CMQA 5DQHA 1EAYC 3CCLS 4RNFA 4DV7F 2F8EX 4K4YA 3MMCB 4ELTA 3PFOA 4F04B 5HATA 2DIUA 2PFDA 3KHLA 1SB6A 3VVTA 1ZH5A 3VGSA 2FQQB 3TP2A 4TU9A 1C1CB 4Y2CA 3MCSA 2YWGA 1HR0F 4CNZA 1NJIT 2NUHA 1QAYA 2V50A 1KQFB 5AJ3F 3PYDA 1YJRA 4FS2A 2HFUA 5C7PA 4DN9A 4JI6F 4LF6F 3MXHP 5IWAF 2HW3A 2EKYA 2G1DA 1MWQA 3JTOA 4K5RA 3I4HX 4M5MA 3MTKA 4V19X 1N5VA 3KK1B 2XSJB 2ASLA 4FYVB 1FD2A 2DR9A 3G2XA 3EDRB 4EU0A 2KRRA 2Q6CA 4J9NA 4FZVA 3DM2A 1E6YB 4X4NA 2FHMA 4QIFA 3DKDA 4KE5A 2YNIB 1SL2A 1C0TB 1CJTB 1VHIA 3M8QA 2RJZA 3LP0B 2K1RA 4L75A 3EM1A 2UXCF 3PKMA 1NPRA 3UN3A 3JTPA 3DLEB 2QYCA 4IR1A 3QJJA 2HHQA 1G7CB 3HVAA 1ZTTA 2V0NA 3TUPA 1YLXA 4JI1J 1RA6A 2XNQA 1VQ5S 1AFJA 1N0UA 2KH9A 3K17A 4I67A 2J0QD 4OZJA 5ETPA 3NWRA 1UEVA 3M9MB 3M05A 2VG5A 3GZ7A 1U1PA 3CB4A 3SXLA 1QVGR 1VHFA 3D5MA 3DOKA 4JI3F 4KPYA 1BQMA 4JI2F 1HNVA 1KTQA 2Y8WA 3OSPA 2C2KB 2IM0A 2JHEA 4Q2MA 4WF9Q 2UVWA 1S6PB 3GG0A 4O3RA 5F8JA 1O6XA 5E3CA 3KHHA 3KJVA 2KHDA 2FD2A 3D9BA 3HFVA 3DC2A 4I6WA 5DDOC 2JVRA 3PO5A 1S48A 3MFIA 1VRUA 3P6YC 2MZRA 4WWSA 4TLQA 2VPYB 1CJKA 4GKJJ 4B9MA 3D28A 4GVBA 4NOHA 1N32F 1RT3A 1S1TA 2XHWA 1XNRF 3RW6A 4P6QA 1NZ8A 1KVIA 4LFCF 3I5AA 4DX5A 3R5JB 1YJNS 4E0DA 4CLYA 5U47A 4ZLNA 2OTJS 2ZH6A 3EDQB 5IC6B 4HHUA 2QO3A 4L3NA 5KFLA 2M2BA 5FLXY 4QU7A 2CVIA 1OYEA 2XM3A 2ZBQA 3IAM9 4EI2A 4LF2A 1WWHA 4DV6F 1OSDA 2RQMA 2KKHA 5HI7A 4DPYA 5HBMB 2GMHA 4I1TA 3SIPB 3CCZA 3EZOA 1Q1KA 3H42A 1Z4UA 3EXCX 3HT0A 3O5TB 4FF1A 4WBFA 2HFZA 2FY8A 3ENVA 2Z56B 2AF6A 3KNGA 5EX0A 4DL4A 4F4ZA 4DV3J 1R6VA 2V8DA 3CCTA 3V6DA 4WXOA 1ZZFA 2VFTA 5C42A 4ITSA 3T5HA 2OPPA 5F8HA 4FF3A 4R8UA 3NOCA 1QSLA 1JWWA 1X9WA 1IKYB 2ILZA 4IFVB 1TKTA 1TFWA 3GTYX 4OJHA 5KFQA 2PA8D 2Q43A 4LT6A 2EFOA 3WBZA 1EHWA 5L1IA 3RW7A 3A8JA 2V9WA 3AOAA 1I6JA 3DNCA 3TW0A
chains in the Genus database with same CATH topology
2AHOB 1YZ6A 3CW2C 1YZ7A 2QN6B 1Q8KA 2QMUB 3J81j 3QSYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AHO B;  1YZ6 A;  3CW2 C;  1YZ7 A;  2QN6 B;  1Q8K A;  2QMU B;  3J81 j;  3QSY B; 
#chains in the Genus database with same CATH topology
 1WUU A;  2CRL A;  3GFX A;  4O44 A;  2YNG A;  2E1C A;  2CQG A;  1QE1 B;  1TKZ B;  3KJQ B;  3L4B C;  3QMQ A;  3OVS A;  4DSE A;  2IJF A;  3NS7 B;  2EC2 A;  3I82 A;  3SFG A;  3LTO A;  4QJV A;  3RB0 A;  2NRE A;  3PEH A;  4FKX A;  3T41 A;  3ENQ A;  2DNO A;  2C2D A;  4PWD B;  3KUE A;  4RUH A;  5A8K A;  3N4W A;  2FYX A;  3C3L A;  1N5Q A;  1KP6 A;  1WKL A;  2AJF E;  2QRR A;  3KG1 A;  3NKY A;  3WC0 A;  2P6S A;  2I5J B;  1DTT A;  2Z0G A;  4IRK A;  2NYH A;  3ZZO A;  5E3P A;  5KT6 A;  1WAC A;  3BEG B;  1LW2 A;  2UUC F;  2A2D A;  4WIQ A;  1X5S A;  2I1R A;  2WW4 A;  3P96 A;  1ELO A;  1YVF A;  1WC6 A;  2JZ5 A;  2X1B A;  3ET6 B;  2XLI A;  3M8R A;  2Y9H A;  4K0K F;  1MLA A;  4B3S J;  5B0A A;  5L1K A;  1N33 F;  1ZM9 A;  2K3K A;  3W9H A;  3MM7 B;  2B43 A;  2C3O A;  4DV0 J;  1DRZ A;  1N32 J;  3HSD A;  1JJC B;  3DXS X;  2K7J A;  4DV0 F;  2CG8 A;  1SC6 A;  3T19 A;  3MCO A;  1G3O A;  2ASY A;  1VRT A;  2CIM A;  4LRC A;  4ZPT R;  4TU8 A;  1VOM A;  5J1E A;  5KFO A;  2BQU A;  4FF4 A;  3AXK A;  2OEJ A;  4DG1 A;  2MB0 B;  2EFQ A;  3OV7 A;  3OXF A;  4ZJO A;  5I42 B;  3GV7 B;  3KOA A;  4NLP A;  4LRA A;  2E1R A;  2XY5 A;  3CDW A;  3G6E S;  2GQQ A;  3M32 B;  4U7C A;  3PO4 A;  2CJA A;  4JI2 J;  1MSW D;  1EET B;  1X4F A;  2JL9 A;  2V4J B;  1T05 B;  1TR0 A;  2M8D B;  3HD2 A;  2OAU A;  3KDO A;  1ZAW A;  4Y6I A;  4BC9 A;  1JLQ B;  5J2N B;  3OPK A;  4TU7 A;  3T6J A;  1LV5 A;  3RBX A;  2DR8 A;  4NXN J;  5E3A A;  3KMS A;  1M5O C;  3PW4 A;  1GMW A;  3DRR B;  2W4P A;  2VDI A;  5KFT A;  4LFA J;  2BR0 A;  4OYW A;  4CLL A;  3JSR A;  1SQG A;  3QNW B;  2BE9 B;  3NL0 A;  4WP8 A;  2JEJ A;  3Q89 A;  1CJU B;  1NK6 A;  4O0I A;  3RR8 A;  3AD7 C;  3BF4 A;  1GX6 A;  4LF4 F;  4F4A A;  5IV4 A;  4JI7 F;  2F9D A;  9ATC B;  2Q66 A;  2BE2 A;  4NLS A;  3NEK A;  4KHR A;  3J7A 1;  4O44 B;  5LOQ A;  2LQ5 A;  5L38 A;  1FDB A;  2HFV A;  4PXB A;  4TNO A;  1IBC B;  4DR2 J;  5DQG A;  3Q8Q B;  2QIF A;  1FJE B;  4XAK A;  4OI6 A;  2RU3 A;  5HQ8 A;  1S72 S;  2UU9 J;  4OZ0 A;  4RW7 B;  2R7R A;  4DQR A;  3KFW X;  4BWJ A;  5FJ4 A;  1S7I A;  5J2P A;  2PFF B;  3PJX A;  1JKH B;  3PRD A;  2BRK A;  2JLG A;  4R8U B;  3KK3 B;  4A8K A;  2BAN A;  1S1V B;  4JUZ A;  3KLH A;  3BBC A;  3CCQ S;  2XSF A;  3T1A A;  3T9N A;  5A8R A;  4RBT A;  2PA3 A;  1VYA A;  1HYS B;  3QJP A;  3MD3 A;  4U7U K;  2ZM6 J;  3ZZ0 A;  4C0O C;  1AB8 A;  5AJ3 J;  2HHV A;  5EUH A;  4F02 A;  2CPD A;  2IJR A;  2VG7 B;  3IMQ J;  1U48 A;  1UVL A;  2I9S A;  1U1M A;  4GMK A;  1X5P A;  3R27 A;  1VRT B;  2H9Z A;  2ZKU A;  4F8R A;  3KMQ A;  3W3S A;  4YHH F;  1RTZ A;  2L08 A;  4UQT A;  1DTQ A;  2CQH A;  2HRY A;  2VAS A;  2IVM A;  5CYQ A;  1SKR A;  3RBZ A;  4J9U E;  2XLK A;  5HK4 A;  1NK0 A;  5D3G B;  2B5J A;  2ZNY A;  2MKH A;  5D0G A;  2F63 A;  4LFC J;  3QGH A;  1RQ0 A;  4ECU A;  5HQM A;  4DL3 A;  2OMO A;  4CP5 A;  4DCJ B;  3GJT B;  4QR2 A;  2BM0 A;  1XN9 A;  2CA9 A;  2E5L J;  4I2Q B;  1WEL A;  4IR9 A;  3BM7 A;  1MN9 A;  4FP9 A;  4ID8 A;  3V6H A;  1JQG A;  2GZO A;  1NB2 A;  3L7U A;  4YN3 B;  1LWC B;  2DNP A;  1VRU B;  3GP9 A;  3KLI A;  2HS4 A;  4K4Z A;  3IR6 B;  1H3D A;  1IBK J;  4ERD A;  3IFE A;  4OX8 A;  3AFG A;  4IH6 A;  1PBU A;  4H4K A;  4M5H A;  2AGQ A;  3NOG A;  3Q8V A;  3TVK A;  4RUC A;  3R5D A;  3Q8Y A;  4P2X A;  2E9T A;  4WP9 A;  2POK A;  2F7V A;  3HSG A;  1KLM B;  1X4G A;  2ZC4 A;  1Z2Z A;  3BGO P;  4LFB F;  1RZM A;  1JB0 C;  1SCJ B;  1S12 A;  2CDR B;  2FHO B;  1FJG F;  1WDT A;  2DTJ A;  4XDD A;  2UUB F;  1A7G E;  2IAJ A;  4IFV A;  1KVK A;  4LSN A;  3TX8 A;  1CEZ A;  1WKJ A;  4GO5 X;  2AHO B;  1U2F A;  1S0M A;  5HP1 A;  2UXC J;  3HHL C;  5GMK a;  3DRR A;  2FGC A;  1BGX T;  1TKX A;  2MKJ A;  1YG0 A;  3E01 B;  2VC0 A;  5CHC B;  1RAD B;  1GH8 A;  1E6Y A;  3ADA C;  4ZP9 A;  1RTI B;  3FMW A;  2YX7 A;  4C8N A;  2C1E B;  4MAK A;  4K4T A;  2KJW A;  1AZS B;  3G87 A;  4L3K A;  3PX6 A;  1TZ0 A;  3TA0 A;  2ZWP A;  2XZW A;  1RA7 A;  2OLW A;  3D6H B;  4DPO A;  2JSX A;  3Q22 A;  3R5G A;  2D3O 1;  1WEX A;  4MFB A;  5I4M A;  4DV4 J;  3DI6 B;  4N76 A;  4F36 A;  2CPF A;  2HK2 A;  3JSM A;  2VOO A;  4LRE A;  4QYZ K;  4AE5 A;  3RJM B;  1FJ7 A;  1HIY A;  4DZ6 A;  3X1L B;  4NLR A;  3N79 A;  1HHQ A;  3L7O A;  1QUP A;  2HBQ B;  4KYZ A;  1XTZ A;  2KT3 A;  4QWB A;  5FDL A;  2AYB A;  1RT3 B;  1RT5 B;  1DQ8 A;  1SUQ A;  4M5L A;  3FBB A;  2LXF A;  2Q1L A;  2XMJ A;  3MCM A;  4DR1 J;  3KWM A;  3M2R A;  5D6G A;  2ZBI A;  5EN1 A;  2BMB A;  1C0U B;  1SV5 B;  1KTV A;  3QSI A;  4B3O B;  1U02 A;  4LIW A;  4DR7 J;  1LKZ A;  2OJ3 A;  2N82 B;  3K8W A;  1S6P A;  3G82 B;  1GFW B;  2ZBC A;  4OYB A;  1Q82 T;  4KR0 B;  4JI6 J;  4LF6 J;  1I94 F;  3HP6 A;  2WVE A;  2QLJ B;  4FNH A;  1NSQ A;  4ZP8 A;  3C6T B;  2FZK B;  4NMX A;  3R8Y A;  3DRP A;  4DX8 H;  1TL3 A;  8ATC B;  4H4M A;  1LW0 B;  4GO7 X;  4KSE B;  2M4M A;  1FVQ A;  2COL A;  3RU0 A;  4AUK A;  4ZVR B;  3GIK A;  3ENA A;  4CM2 A;  2XY6 A;  2DNL A;  1H6K X;  2F1F A;  4MJK A;  1TV6 B;  2GQ2 A;  1R6Y A;  1OIA A;  2B4O A;  2D9O A;  2QT7 A;  2W7P A;  3TAQ A;  1WG5 A;  2U2F A;  2KU7 A;  5HAO A;  2DH9 A;  4NA3 A;  4C2M A;  3B6B A;  1LNQ A;  2HQC A;  3PDN A;  2O5D A;  4DF8 A;  2D74 B;  3IBF B;  2OI2 A;  1C0T A;  3M8Q B;  4ANC A;  2JLE A;  2L48 A;  2CZV C;  1U4B A;  1N0V C;  1L5U A;  2DGS A;  5AXN A;  3KNA A;  4LFB J;  5C42 B;  4DU7 A;  4DL6 A;  2HMI A;  1CBK A;  3J81 j;  2NSC A;  4ZIV A;  4WCE Q;  4LF5 J;  3TAM B;  3GJQ B;  5DLF A;  5E3R A;  4A8F A;  3CDB A;  4OZL A;  3TQ1 A;  3HFZ B;  4PQU A;  3UVJ B;  5LMN F;  3R6L B;  3OXL A;  2FZG B;  1ZYQ A;  1Z2L A;  4HVZ A;  3OL9 A;  5HBM A;  3SSS A;  2IBK A;  4ZPD A;  5IZH A;  3TRG A;  5KFS A;  1HBN B;  2CQ0 A;  2FLO A;  4MTP A;  3U02 A;  4N5S A;  1YI2 S;  1QAI A;  4IQM A;  4HAC B;  2EPI A;  5K8P A;  3KLG A;  1SUQ B;  1RAB B;  1JJ4 A;  4S0M A;  4J9P A;  3FCV A;  2OTL S;  3IS9 A;  1VR6 A;  3PW0 A;  3NCP A;  4WXW A;  2RH3 A;  3MUM P;  1BWE A;  2ABY A;  1DUR A;  2R8J A;  3HX9 A;  1ULR A;  3RRG A;  1S1T B;  2EI5 A;  4ES1 A;  1Q16 B;  4EBE A;  1HNX F;  5KFW A;  4Z7Y A;  4OMF G;  3JSM B;  1U8S A;  3KLG B;  3GV5 B;  3QQC D;  4PG5 A;  3GYN A;  3TQE A;  3QWP A;  2ZJR Q;  1HWL A;  1OQ6 A;  3C66 A;  3CC7 S;  4WK1 A;  5LXR A;  2W8K A;  5GME A;  2VOP A;  4XO0 A;  2JDJ A;  3G8S A;  4OLO A;  4F3O A;  1UJ6 A;  4A8O A;  1GXL A;  1S79 A;  4XTT A;  4ZVH A;  5KT3 A;  3H90 A;  4F4X A;  3OFE A;  4KRW A;  2E44 A;  3LOU A;  3JSB A;  2E5G A;  4OZN A;  4FXD A;  3DOK B;  2GVD B;  5JJB A;  1XMO J;  2WK4 A;  2J0S D;  1FK9 A;  2J7W A;  1X4A A;  3PEJ A;  1S49 A;  5A2Q Y;  2DGX A;  2GV1 A;  2G4B A;  3LO3 A;  4B3R J;  4ID5 A;  1SC4 B;  3ZTS A;  2YWF A;  2CNK B;  4FDF A;  3PR5 B;  1VBY A;  3OFG A;  3R5A A;  4NML A;  2ZVS A;  1T03 B;  4ZJL A;  4LF9 J;  3NGT A;  3OUY A;  1SJQ A;  1WD6 A;  2FIU A;  3CSK A;  2CJX B;  4MKA A;  1NND A;  2V2V A;  4A8S A;  2W01 A;  2ZVI A;  4ZVU B;  4QCL A;  1WEZ A;  1F2H A;  3DLE A;  1F3V A;  3SQG B;  4X4U A;  3GIR A;  3T1H J;  5B0B A;  3AOD A;  1CUL B;  4X4T A;  2XMT A;  2DNK A;  3NRB A;  4UUX A;  1RAJ A;  2B4U A;  2CJY B;  4KH0 B;  1BQX A;  5E2Q A;  2XQC A;  3EPI A;  4C8K A;  2XMU A;  2DNQ A;  1IBK F;  3K5P A;  3GJR B;  2AJ2 A;  2C3P A;  4OI4 A;  1G6B A;  4QIV A;  4EBD A;  4ETX A;  3GE9 A;  3GFH A;  4K4W A;  4F2S A;  1KVJ A;  1AFI A;  1LWC A;  2B3T B;  3CCR S;  3OT9 A;  3L95 X;  1NK9 A;  3VWS A;  2F5G A;  4EK2 A;  3MDF A;  1KOH A;  4DFJ A;  3JB9 k;  4MYU A;  2NPF A;  1EQM A;  2CNO B;  1NBE B;  2HVZ A;  2ZE2 B;  4IG3 A;  4Q45 A;  1RU2 A;  3D2W A;  1HNX J;  4LF8 F;  4LRD A;  4DDF A;  2AIR B;  4U8V A;  4J7C A;  5ETL A;  2R7T A;  1NDP A;  2PMW A;  3CJS A;  3H20 A;  4PWW A;  3W8P A;  5FDL B;  2CPI A;  3TOQ A;  1RDR A;  3ZO7 A;  5AE2 A;  4PPD A;  5A6W A;  1X0P A;  1SIW B;  5IFM A;  4IG3 B;  3BGL A;  3UNY A;  2EG1 A;  5DQI A;  4P9S A;  2HMI B;  3D3C J;  3OTC A;  1WOR A;  1HBU B;  3HHL D;  2E7W A;  1RWN B;  3HF5 A;  4HI1 A;  4Z37 A;  5IT0 A;  2FVR A;  1JLF B;  2EEY A;  4DMZ A;  2PEH A;  2VG7 A;  5E33 A;  4OJ3 A;  4PQU B;  4NCG B;  1GXU A;  1FDD A;  3BPD A;  1RTH A;  4NLQ A;  1A0O B;  2RML A;  3G8Q A;  2DNM A;  2C3M A;  3AT1 B;  2PI5 A;  1HMV B;  1VDH A;  2UUA J;  2V69 A;  1KRP A;  3KK3 A;  2VBZ A;  2W2P P;  4ES2 A;  3AA8 A;  5KFJ A;  4ECY A;  3CUN A;  4ECT A;  3JSY A;  1VQO S;  1GT8 A;  1V5V A;  2QA4 G;  1YGY A;  1FVS A;  2ADB A;  5K20 B;  4CCH A;  1F2G A;  3DMJ A;  2LQB A;  2NXN A;  3O6Q A;  5CCL A;  5KG2 A;  1M5V C;  4NI2 A;  4IQX A;  1FFW B;  2Z30 B;  3B54 A;  2OFH X;  3D0H E;  5CD4 H;  1SL0 A;  2D9P A;  4RWX A;  3C46 A;  3GMG A;  1FO1 A;  2R2S A;  2OGU A;  2E66 A;  4CWB A;  1WF2 A;  3HHD A;  5L1J A;  1G1X A;  3OQ2 A;  1REV A;  2J8A A;  4LF1 A;  3JAM U;  3NP5 A;  1EIY B;  3E51 A;  1PJ7 A;  2RS8 A;  5ETQ A;  4U67 Q;  3PW2 A;  5E0O A;  5KAK A;  4PQA A;  3UFC X;  2IVF B;  4YB1 P;  3OR1 B;  2H5E A;  2AMC B;  1UWA A;  3KXD A;  3QFH A;  2HHT A;  2VFU A;  2AJ4 A;  1YBU A;  2ZHA A;  3MM5 B;  5K8M A;  2FVS A;  1ZAX A;  3M1V A;  3R2C J;  2VKZ G;  1RGV A;  4C7Q A;  5D0H A;  1JLQ A;  4I69 A;  2ZH2 A;  2AX1 A;  3V4I B;  1ZBT A;  2IJN A;  2RDD A;  1C0U A;  1C1B A;  2RAQ A;  3CED A;  1RXO B;  1UEK A;  4DR3 F;  2MKC A;  3DRY A;  3TAN A;  5E3Q A;  2ERR A;  3R6G B;  4DCP B;  3NGU A;  3BS9 A;  1RSC A;  1TL7 A;  3LAL A;  5AE1 A;  4WFX A;  1RAH B;  3B4D A;  2GJI A;  5ETS A;  3JYT B;  1SH2 A;  2P6T A;  3POT A;  4C48 A;  2GX8 A;  2G2Z A;  1T9V A;  2APO A;  3MED A;  2YTC A;  1OPZ A;  2YKA A;  2WBR A;  3CD0 A;  1U1R A;  1Q0N A;  3WC2 A;  4B08 A;  1RLC L;  3W5Y A;  2B5J B;  2LQ8 A;  1B99 A;  1X9S A;  5KFC A;  5DS7 A;  3PIO Q;  1S4E A;  5L39 A;  1RTD B;  3DI6 A;  5C25 A;  4C11 A;  3NAH A;  1TTH B;  3GYX B;  3HKW A;  2OFG X;  7AT1 B;  1Q81 T;  1LOU A;  2MY8 A;  3DOM B;  4NLX A;  5D0E A;  3G86 A;  1QY7 A;  3BJY A;  1F9F A;  1LW2 B;  2GIQ A;  3I32 A;  5KFV A;  2NS1 B;  2YWK A;  4X66 F;  2AYE A;  4ZHR B;  2HRU A;  4F7V A;  2ZH5 A;  5C5J A;  2GFF A;  1CG2 A;  1Y00 A;  1IM4 A;  2V2K A;  2BKO A;  3OTE A;  4LR7 A;  3EUN A;  5GMD A;  5K5M A;  2ZH3 A;  2FJV A;  1MN7 A;  1B7Y B;  2ZOG A;  3U1M A;  1DAX A;  4USI A;  2GW8 A;  1EP4 A;  2OP5 A;  1WF0 A;  2HVE A;  4ZVF A;  3OSN A;  1Z1Z A;  1TL4 A;  3T5J A;  3BGF A;  2CQB A;  3M6X A;  5GAH U;  3RR7 A;  2AEJ A;  2JC0 A;  2LCW A;  1V5I B;  2RHQ B;  1BLU A;  3HMJ G;  4UOH A;  5J2P B;  1UZH A;  2K3I A;  3RB4 A;  1QAJ A;  3M6V A;  2D69 A;  4B3M J;  1LFP A;  2QLW A;  1RBA A;  5H9E K;  4FN5 A;  4L74 A;  3AJ1 A;  3PX4 A;  3BQ0 A;  4Q5V A;  3G8T A;  4RNN A;  3H4B A;  3GCX P;  1TK5 A;  2JJ4 D;  2I38 A;  3A12 A;  3C8Y A;  1HW8 A;  3CIZ A;  2LEC A;  3T1Y J;  3NNH A;  4BLG A;  2ZD1 A;  4CT8 A;  3AH6 A;  1W7W A;  1KQK A;  1VLO A;  1P27 B;  2IYI A;  2MKS A;  3H98 A;  4KO0 B;  1RP5 A;  4OZ3 A;  4A8X A;  5HL7 Q;  1TL3 B;  4QWC A;  4CT9 A;  2QMX A;  4WE1 B;  3ZXW A;  2ZFH A;  3HM9 A;  2FC9 A;  1T7P A;  4GVL A;  1XMB A;  3I9V 9;  2UV8 G;  4FXW A;  4IKA A;  3CCS S;  4LSL A;  1RTJ A;  2ZDO A;  3KJN B;  2Z2M A;  5KFA A;  1XMO F;  3BYP A;  3WQP A;  3K5L A;  4DSF A;  1RCO B;  4BWM A;  3OLA A;  2W7A A;  1XBW A;  2GA7 A;  4TYA A;  2ROP A;  4EYI B;  2DRA A;  3EIC A;  2XS7 A;  5HRO A;  1OPI A;  1LWF B;  2DHS A;  4Q7A A;  5L46 A;  3O1L A;  1CQN A;  4C0B A;  3W7B A;  1HBM A;  5HO4 A;  3H5Y A;  4KPC A;  4JI8 F;  4EO6 A;  5CYQ B;  4PKD B;  2P9E A;  3QT7 A;  3ETO A;  3P4U B;  3QFW A;  4N8N A;  3R97 A;  1S6Q B;  4FVM A;  2R8G A;  3GFY A;  4P2F A;  3FEY B;  4B02 A;  1YJ7 A;  1QDU B;  3QWU A;  2QJ3 A;  1ZPV A;  2P5V A;  4DS5 A;  1K1S A;  2F8M A;  3V4M A;  4CLU A;  5BR8 J;  1UEU A;  3P49 B;  2XNR A;  2AP6 A;  1JIH A;  3POT B;  1B3T A;  4MT1 A;  3F44 A;  1CJK B;  3IWX A;  2KG1 A;  3MR7 A;  4I64 A;  2FHJ D;  5C2C A;  2CWX A;  3ET6 A;  3KUH A;  1R8C A;  1N56 A;  2BEF A;  2EBG A;  3G6X A;  2VJV A;  1UFK A;  2DCU B;  1RTI A;  2LLZ A;  2ZZT A;  5A8R B;  3MUR P;  3M9O B;  3FJ2 A;  3AD8 C;  3UPF A;  1J5O B;  2QA4 S;  4A8Y A;  2BAB A;  1ROF A;  5D4O A;  2FTR A;  2ZZN A;  3W2W A;  4USH A;  2D3Z A;  3FEX B;  2EFG A;  1F5C A;  3D6M B;  4PEO A;  2MGZ A;  3G71 S;  1T8E A;  1NKE A;  1NZA A;  3CDE A;  4G1I A;  4ENO A;  1T0T V;  4NZ0 A;  3I4P A;  4U6P A;  4AL6 A;  5CXT A;  2BDP A;  4JYA F;  4GKK J;  3DRS A;  1A9N B;  3GII A;  4O3P A;  3GU0 A;  2QMU B;  4J9M A;  4QU6 A;  3L7P A;  1FT8 A;  1Y3J A;  2I6W A;  3PYG A;  4Q0B A;  2Q3P A;  2OH2 A;  1FX2 A;  4HI2 A;  1RBL A;  3FGV A;  1HWU A;  1K44 A;  2VFS A;  2D3U A;  2QGF B;  3H2V E;  1IJE B;  3LGM A;  1UVK A;  3DN9 A;  4I2P A;  4PWU A;  3W1Y C;  3H7H B;  4HTI A;  1NK7 A;  1VBZ A;  4DL2 A;  2ZH9 A;  2B7B B;  4K4U A;  4OX9 F;  1DFD A;  1LWE A;  5IV3 A;  4K50 A;  2WB4 A;  2YWW A;  2LDY A;  2HK3 A;  1U49 A;  1VQ9 S;  1IKY A;  4ZPC A;  3SSQ A;  4DR6 J;  3DDK A;  3AOB A;  3FCH A;  1JXV A;  3NY0 A;  3VF0 B;  2ZUG A;  2E9Z A;  2RUS A;  1OQ3 A;  1DQA A;  3A3O B;  1EET A;  2HFN A;  2V4J A;  3US5 A;  1T05 A;  1XIQ A;  2LKZ A;  5C24 A;  3EGZ A;  5L1L A;  3K57 A;  2WSF C;  3SV4 A;  3DRX A;  3HSZ A;  4ZN3 A;  4GC7 A;  2E9R X;  4OI2 A;  3MTJ A;  1S5Z A;  1RAE B;  1JMT A;  1FFS B;  4J9L A;  4DR7 F;  2KL8 A;  1WG1 A;  4I68 A;  3A3N B;  3N0V A;  4KAI A;  3TR5 A;  3HKZ D;  4BCA A;  4DPU A;  3G4S S;  4X64 J;  3MM8 A;  2KFZ A;  4QOT A;  3FC9 A;  4DR1 F;  1N36 J;  1IQT A;  3CJK B;  2PSZ A;  3ISZ A;  2X1A A;  3HXM A;  1T3N A;  4MK8 A;  4Y3C A;  2YX4 A;  1UKU A;  4LQ9 A;  4OX7 A;  3VZH A;  5HRO B;  4K0K J;  3BGR B;  3OHB A;  1LK7 A;  3MED B;  1IXK A;  4NLU A;  2W2O P;  4YB6 A;  3IC1 A;  1WC5 A;  3CPW R;  4GVB B;  5K14 A;  1BUX A;  4P2S A;  1U47 A;  3VTI A;  1VQM S;  2DPI A;  1KR4 A;  1E6V A;  2LDI A;  3GON A;  4XK8 C;  3DLG A;  1YWX A;  4C97 A;  2ZOM A;  4QR1 A;  1RHK B;  2PE8 A;  2E7X A;  1C1B B;  3IXQ A;  4HR2 A;  4PCQ A;  4ZVS B;  2BAN B;  2YQ1 A;  4R0E A;  1UJ5 A;  4TVA B;  2XYG B;  4CQ1 A;  5KT4 A;  2MQP A;  2ZJQ Q;  4K4V A;  2DNR A;  3VHQ A;  1JKH A;  4DSI A;  4KY3 A;  1IKW A;  4DV3 F;  5H9F J;  1BC6 A;  4OZ1 A;  3ZTR A;  9RUB A;  4IUF A;  3QZ8 A;  1HQU A;  2RUG A;  3FMB A;  2CKW A;  5IQQ A;  1CPZ A;  4Q8F A;  1M5S A;  1VRQ C;  3BV8 A;  2SXL A;  3M2U A;  3M2V B;  4ZJQ A;  2OPQ B;  3T3F A;  3SBM A;  2MQO A;  3ZC4 A;  2IY5 B;  2EVZ A;  3J7A N;  3RGI A;  3B8H A;  2B51 A;  2LA6 A;  4IOB A;  1UFW A;  1FEH A;  2BJ3 A;  4NI2 B;  4L72 B;  1GMU A;  2GS8 A;  3ENW A;  1VIS A;  3CCU S;  2KVQ E;  1WDD A;  4CO4 A;  2K1R B;  4QIW D;  4Q8E A;  2HAI A;  3LP2 B;  2XCP A;  2I0X A;  4M1K A;  4M8L A;  3MPU B;  5J2N A;  2HEK A;  1RWW B;  5CAB A;  3S8S A;  1Y11 A;  5J2Q A;  3LQV A;  4C8O A;  1T3O A;  3D0I E;  5EWE A;  2GJF A;  3LPY A;  2CDQ A;  3IBW A;  3WHI A;  3EX7 B;  1PIL A;  1YJV A;  4QW9 A;  4EYH B;  2JX2 A;  3IWL A;  4Y00 A;  2P2C B;  2BW7 A;  4MMO A;  4DV6 J;  4BBY A;  3W63 A;  2Y3Y A;  1TKD A;  1U1O A;  3BPS P;  5KFR A;  1RT7 B;  3KKF A;  2JH3 A;  2G9O A;  4DV1 F;  1QD1 A;  3LA0 A;  1LEO A;  2U1A A;  3J7Z T;  1D9D A;  1FJG J;  2VOD A;  1H7W A;  4NLD A;  3VAI A;  1PYS B;  1SXL A;  1ZM2 A;  6FDR A;  4ELV A;  2I8E A;  4WP3 A;  2V9K A;  3BO2 A;  2ATC B;  2M8H A;  2J0W A;  1C1C A;  2EFV A;  4W98 A;  3TZZ A;  5KG3 A;  3IGN A;  2WBM A;  3QAE A;  4DN0 A;  2J6S A;  2KM8 B;  2DH7 A;  1FNM A;  4PYD A;  5BXI A;  2HGL A;  4PR6 A;  5KG7 A;  3GIJ A;  2J6T A;  2J8S A;  4PXC A;  3E3X A;  1OYD A;  5SZT A;  2M88 A;  1RAF B;  1GX5 A;  2BKP A;  2WSE C;  4P7T A;  3UI3 A;  1YJW S;  1N34 F;  4B9T A;  1S0V A;  4I4B A;  2I5J A;  2Y8Y A;  1QUV A;  1HNV B;  1WHV A;  4NLT A;  3OR1 A;  4PWD A;  1XEZ A;  4ZLL A;  3ZZU A;  4URS A;  1S9G A;  5F8N A;  1GTE A;  1C2P A;  5D4N A;  3IRX B;  4HHH A;  4KTQ A;  3CJR A;  3NMA A;  1T9T A;  1SKW A;  7FD1 A;  1X4C A;  3BB5 A;  4P75 A;  3W2V A;  5F8M A;  1SL1 A;  4O3N A;  5B0C A;  4ED4 A;  5EWF A;  4G3I A;  1XJW B;  1VS3 A;  2YNF A;  2HAF A;  1CSJ A;  6AT1 B;  2J6U A;  3IP0 A;  1FFG B;  2V8V A;  3I0S B;  4YR3 A;  2LQJ A;  2MST A;  1DBD A;  1SBR A;  4B17 A;  1KSP A;  5BYQ A;  1PKU A;  1R0A A;  1XMQ J;  1RAA B;  2HBY B;  3V5R A;  3MWB A;  1J2V A;  4DR5 J;  2DPJ A;  4OQJ A;  1C4A A;  2O67 A;  3E8O A;  5F41 A;  4RO0 A;  3KYL A;  2EKN A;  4ECX A;  4KHP F;  3W65 A;  4MKY A;  2OEL A;  4M95 A;  2DO0 A;  3MPV A;  2FJD B;  2YQ3 A;  3K2Y A;  1CJV A;  4L76 A;  5L9X A;  5GAG U;  3DDN A;  3C14 A;  3PYE A;  3Q2T C;  2C42 A;  1TVR A;  1NKC A;  3C6U B;  1Q95 G;  1S59 A;  3FFI A;  4FKY A;  5FLX U;  1KQS R;  4JI8 J;  1NPP A;  3PFE A;  4DL5 A;  3CUL A;  2YQ0 A;  5JMN A;  1VBX A;  4B3T J;  4ATN A;  2ROE A;  3PV8 A;  4IYQ A;  2ZUA A;  2CNL B;  2HFS A;  1JLB A;  5BYS A;  1T95 A;  2Y1I A;  4ZPB A;  3ITH B;  4PG6 A;  2FB0 A;  2DNY A;  1TUV A;  5D15 A;  2C3U A;  5E7O B;  2K7K A;  2KZZ A;  5DG8 A;  3BDP A;  2OPQ A;  2RQK A;  1D8Z A;  2HZV A;  2ZDP A;  2XMM A;  4KHM A;  2FGO A;  1VJQ A;  3FBF A;  4ZCL A;  3W5Z A;  4PG4 A;  1XNQ F;  3MMC A;  2YPY A;  1VGY A;  4UOG A;  1VI7 A;  3EYZ A;  4IOC Q;  4M94 A;  4X4P A;  2G2O A;  4RBU A;  2CQ1 A;  1RT7 A;  2G0J A;  2MTL A;  3CD5 A;  5EGY A;  3DXB A;  3SCK E;  4RNM A;  1TU0 B;  1U6F A;  2HGM A;  1R8B A;  3VGU A;  2MKK A;  1KKH A;  5JVG Q;  4K4S A;  1FXR A;  1H7X A;  3ISN C;  4RZR A;  4F0H A;  3MFH A;  2JEG A;  1RWO B;  1BWV A;  2V68 A;  1TEL A;  2VV5 A;  4LBP A;  2R7W A;  4ZPW R;  3THT A;  3IM9 A;  3UVJ A;  2DGW A;  1I5O B;  1FX4 A;  1N5T A;  1PAE X;  2ZBR A;  1F6T A;  5K14 B;  2ZEJ A;  3MCN A;  3LP2 A;  2ZOF A;  3LF0 A;  1VQS A;  3D4J A;  3SQG A;  1X60 A;  1GXT A;  2HIQ A;  4C98 A;  3KG0 A;  2VPX B;  2X3G A;  1RHJ B;  4OI1 A;  1OY6 A;  1WG4 A;  3FK4 A;  2LMI A;  4NZ6 A;  3OR2 B;  4UF4 A;  1LXJ A;  2G2Y A;  1IWA A;  2KI2 A;  1HD0 A;  2QA2 A;  3I96 A;  5A0Y B;  3OUY B;  1S6O A;  2MLY A;  3D67 A;  4J37 A;  1YIT S;  2HHH J;  2RKI B;  1H72 C;  1MWZ A;  4AT1 B;  4C9D A;  4URG A;  1HL6 A;  5KFB A;  2OD4 A;  3PHE A;  4XPC A;  1RT2 B;  4DR6 F;  5LJ5 Y;  2A3J A;  2B9X A;  4EUV A;  2E1M C;  4OHW A;  2YKM B;  4F4W A;  4ED3 A;  4ICL A;  5K8N A;  2KB2 A;  1IBM F;  2XMK A;  2YH0 A;  3LP0 A;  4FPR A;  4MYT A;  1Q4R A;  2VJU A;  3BBB A;  3R2D J;  4EGL A;  1P8G A;  1A6L A;  2B7C B;  3O2I A;  2NUU G;  3SCJ E;  2HBZ B;  1K9M T;  4NXM J;  4OX9 J;  4I7F A;  2IPO B;  1TUW A;  1SQF A;  1VMB A;  4J9S A;  2HHW A;  1HPZ B;  4RNH A;  5KFG A;  2RIL A;  5D77 A;  3GJS B;  1FE0 A;  5DM6 Q;  3VAK A;  3NMR A;  3P8B B;  4RW6 A;  3MMJ A;  4QPT A;  2VHG A;  1AYE A;  1DZ5 A;  4DSK A;  3MEE B;  2QFJ A;  3SCI E;  1SVD A;  4OHZ A;  1YX2 A;  2UV8 A;  3NBP B;  4Z7C A;  3N6N A;  1YZ6 A;  1ZM3 A;  4P7V A;  4K4X A;  4OHV A;  1S1U A;  3DYA A;  5F0U A;  1EQ0 A;  1K8A T;  3CME S;  2R8I A;  3FBE A;  3LAM A;  4ED6 A;  1BE4 A;  1RCX B;  1Q5V A;  2O01 C;  2PGC A;  1RT5 A;  4N8O A;  5IT9 Y;  3CJT A;  5ETV A;  3CNQ P;  1XR6 A;  4P52 A;  3PW7 A;  4OJ1 A;  4JI4 F;  2W9C B;  1U0H A;  2YXL A;  4HDG A;  2NXJ A;  4J91 A;  3CWJ A;  5LSO A;  4KV8 B;  1FES A;  2HVD A;  2HG4 A;  1FWP A;  1R8H A;  4DR5 F;  1F0X A;  1D0E A;  4RWW A;  1NCL A;  4IH5 A;  3PAC A;  1HI0 P;  3KLV A;  1GQE A;  2O3D A;  3CDU A;  4MKV A;  3Q23 A;  5J2M A;  1J5O A;  1FDA A;  1XR5 A;  3PJW A;  4NYO A;  4V19 J;  1J5E J;  4X4Q A;  3RBD A;  4LF9 F;  5DLG A;  2MQ8 A;  3M30 B;  3M9N B;  4W90 B;  1AW0 A;  1UVM A;  4QBU A;  1X5O A;  5F8L A;  3UDL A;  4DV4 F;  1UWB B;  4ED7 A;  4I6Y A;  4NA2 A;  1DLO B;  2DGQ A;  5LT5 A;  3OHA A;  4RW7 A;  4WTY A;  2VIC A;  2W2N P;  4LF5 F;  5HP1 B;  4KV8 A;  3PR4 A;  4MKB A;  4X65 J;  2WRM A;  3A8K A;  3VAM A;  2Z8Q A;  2LXI A;  5IS2 A;  3QLH B;  4HYK A;  2HKE A;  5AT1 B;  4DZD A;  4L6V 3;  4G1Q A;  5ETK A;  2VQF J;  3DGV A;  3HVW A;  5KFP A;  1TFY A;  5ETO A;  1URR A;  2RU9 A;  3M6U A;  3VV2 B;  3TUJ C;  4DEZ A;  4EWT A;  1VQN S;  3DOL A;  2W4C A;  1LW0 A;  3ZTQ A;  3D54 A;  3NS5 A;  4CLT A;  3C16 A;  2XG8 A;  4ZVG A;  5I3P A;  2DCL A;  3DHW C;  3AJ2 A;  1X4B A;  1JLC B;  3MMA B;  4JP8 A;  1KBR A;  4KKO B;  1RT4 A;  1HNZ J;  4K5S A;  5GAE I;  2QL7 B;  4FBU A;  1VBK A;  2XMA A;  1YIJ S;  1YJT A;  3GWC A;  4WFA Q;  4F4Y A;  3MEG B;  5DZ7 A;  1RT6 A;  2MY7 A;  4I7F B;  2LU1 A;  2E5H A;  2QSW A;  1T9U A;  1MG7 A;  3R7N B;  1I3O B;  2RDI A;  3Q2S C;  4NEZ A;  4O4G A;  4DHV A;  4OZ5 A;  1X4E A;  4DG1 B;  4XPE A;  2CG4 A;  2MHE A;  4NYZ A;  2KXN B;  4NYP A;  2E5J A;  3J81 Y;  4TN2 A;  3KHG A;  3KHR A;  3HD1 A;  3KUG A;  2DGO A;  1HQ2 A;  3QRQ A;  2UU9 F;  3BH6 B;  5D3G A;  2J0X A;  5DM7 Q;  2W7O A;  2LP4 A;  2FVQ A;  1RBO B;  5CH7 B;  4C8Z A;  3QBC A;  1DLO A;  2HRT A;  2X7I A;  1NJZ A;  1TMM A;  1ZA2 B;  1Q5Y A;  2W1B A;  2HNY A;  4QQB A;  2W2Q P;  4X84 A;  4PAB A;  2W4D A;  3CGI A;  2CUY A;  3OR2 A;  3T5L A;  2FJW A;  1TL1 B;  4M5G A;  4OIX A;  3M30 A;  1L3V A;  1Q8L A;  2NPI A;  2UZA A;  4DLE A;  2QA1 A;  3N5B A;  2B6A A;  2XYH B;  4ZN1 A;  4OV6 A;  3IM8 A;  4ILR A;  3H40 A;  3AD9 C;  1IVZ A;  3MR5 A;  2MZQ A;  1RTJ B;  4LSL B;  3J80 Y;  1K0T A;  2JWN A;  3PCO B;  3U1L A;  3CC4 S;  5B0F A;  1WHY A;  1Y5I B;  2RDJ A;  3OW2 R;  4MIB A;  1NU4 A;  4O0N A;  4P10 A;  2L9W A;  3LW5 C;  3TUZ C;  5IWA J;  2B9W A;  3NCQ A;  5H9E J;  1VIX A;  1F5A A;  2DO4 A;  1U45 A;  2W9C A;  1U8W A;  5DDR C;  3ELH A;  3HFK A;  2XTJ P;  2KO1 A;  3MMB B;  1KON A;  2A1B A;  1RTD A;  2YNG B;  3CF5 Q;  1O8B A;  2GJ2 A;  2EG2 A;  3EWG A;  2CQC A;  1Q7L B;  2EFP A;  2V67 A;  3D1Q A;  5E5N A;  4KGZ B;  2PC6 A;  3OBI A;  3JYT A;  2EFN A;  2BE2 B;  2DGU A;  4PG7 A;  2XCA A;  4WZQ A;  3MM9 B;  4TXS A;  3T9Z A;  3QAU A;  4R5P A;  1FTC A;  1GMW D;  2PI4 A;  1HBO A;  1S99 A;  2FUG 9;  4RW6 B;  4X62 J;  5CD4 A;  3ISN D;  2AQ4 A;  2OPS B;  2HND A;  4W4M A;  2DB1 A;  1RHQ B;  1X7V A;  2IHR 1;  4DR2 F;  2BW2 A;  3SI8 A;  3FFI B;  1YJU A;  2KYZ A;  2HQI A;  3DU5 A;  3LP1 A;  4EO8 A;  4RPF A;  3BQ1 A;  1VK3 A;  3EE3 A;  2MJU A;  3NGS A;  1FA0 A;  3WZ0 A;  1EJ7 L;  3CJ5 A;  4USK A;  4C8L A;  1L3K A;  4OV1 A;  5IOL A;  2PII A;  2RB7 A;  3GB0 A;  1RKJ A;  2DRB A;  2G13 A;  2OIH A;  4DBQ A;  2WAQ D;  3DOM A;  2QG9 B;  2RE1 A;  1HWI A;  2A2C A;  4M5N A;  5F0W A;  4DFK A;  2VPW B;  4OYA A;  2BRL A;  2RKI A;  2IMO A;  5T7L B;  1FRI A;  2NLW A;  2UUA F;  5K8O A;  4YY3 J;  3I0S A;  3NGR A;  5CQG A;  5HVF A;  4C6A A;  5KFM A;  3PVX A;  2JEF A;  3Q8U A;  4YY3 F;  4Y2K A;  2RF2 A;  3H8Y A;  3W64 A;  3EGV A;  3MM7 A;  2DNH A;  2DR6 A;  1F3F A;  3AB4 B;  3FQK A;  3HUL A;  2DK2 A;  5CYM B;  4YS2 A;  4NAS A;  1U1Q A;  4PUO B;  1S10 A;  1RT1 B;  2RVJ A;  3THP A;  3I56 S;  4ZKA A;  1D09 B;  1GK8 A;  2ZHO A;  3O44 A;  1HNZ F;  4IRD A;  2KTQ A;  3Q8R B;  1U09 A;  3F56 A;  2HQ3 A;  1WC1 A;  4H4K C;  4U96 A;  4NLG A;  1VIO A;  3HPO A;  8AT1 B;  1AXQ A;  3SEO A;  2BX6 A;  2DYA A;  3PNI A;  1DJ0 A;  3MM5 A;  2YKP A;  3PHT A;  3ZZY A;  2GGP A;  2XUL A;  1DAR A;  5KFD A;  4YUD A;  3BRE A;  2RNE A;  2Y1J A;  1KQG B;  3QT6 A;  3CJQ A;  2R2T A;  2DNN A;  4DR3 J;  2MXY A;  3MR6 A;  3EVO A;  4DLG A;  2XWX A;  2F65 A;  3OVA A;  4DV1 J;  3CDA A;  2R7U A;  1TKZ A;  1R43 A;  3PKY A;  3VAL A;  2VA3 A;  3LAK A;  2JOQ A;  1S76 D;  4F3Q A;  4WJB A;  4NLV A;  3WDO A;  2UVR A;  4W92 B;  2H5J B;  2VH7 A;  2CQD A;  3ITH A;  5KFY A;  4I56 A;  1U1L A;  1JLB B;  2A18 A;  3QIP A;  1S1U B;  2PDA A;  3DYA B;  2R7V A;  2DY1 A;  2CPY A;  2EK1 A;  4NA1 A;  5DGB A;  2CFX A;  1MRO B;  3SDE B;  4RW8 B;  4UW2 A;  3OLB A;  1YRX A;  2GVZ B;  2QTW A;  2YNH B;  3KK2 A;  5CZX A;  5HMX A;  1J5E F;  4RUB A;  2DHH A;  3GQC A;  4WKR A;  4ZPV R;  1XR7 A;  2HQD A;  1YJ9 S;  3FDS A;  5ETR A;  3JS9 A;  3GPA A;  2F8H A;  1HPZ A;  3LPE A;  2KRB A;  1GNK A;  1VLY A;  1QSY A;  1JLE B;  1PO6 A;  3M32 A;  2IM1 A;  2CPJ A;  3KK1 A;  1H38 A;  3H5U A;  4NCG A;  2BOA A;  2XEX A;  2PMH A;  1RYS A;  2F4V J;  3MZI A;  4ICL B;  1B4S A;  4IH7 A;  3ZZR A;  2IIH A;  1S97 A;  2UXD J;  2RQ4 A;  1N88 A;  1OJ4 A;  3I31 A;  3RYL A;  5MLC V;  1RT2 A;  3TX0 A;  4DQS A;  1QAX A;  1NHK L;  3MUT P;  2YNF B;  3PRB A;  3OJS A;  1V3S A;  2KHC A;  2KT5 A;  3CXC R;  5I3U A;  1DQ9 A;  3HHL B;  1NB7 A;  2FVP A;  3C2P A;  3NNA A;  3ILO A;  4B9N A;  2A10 A;  1LFW A;  5ETT A;  5F9N A;  2HYI B;  1F9E B;  2M52 A;  3MAH A;  3C15 B;  1PAU B;  3M4X A;  1FE4 A;  4OFZ A;  3W61 A;  5IT9 U;  1MW7 A;  3BKT A;  1R7I A;  1LK5 A;  2BJ7 A;  3FKB A;  2DIT A;  4F50 A;  2PEB A;  3H4D A;  2B4V A;  4ZLP A;  2JRS A;  2B56 A;  2VU5 A;  3L09 A;  1YBA A;  5HQL A;  3AA9 A;  3JQM A;  1D3W A;  3P3D A;  2ZHB A;  4FYY B;  1R31 A;  4FNI A;  4Q2L A;  1ZOT A;  3FQL A;  4WFZ A;  2AYG A;  3N28 A;  5JXS A;  4X2B A;  1TAQ A;  3HI9 A;  1UA0 A;  1SKU B;  2QN6 B;  3IR5 B;  4ZLJ A;  1HAR A;  3IAS 9;  4IG0 B;  5KT5 A;  2YX1 A;  3WIU A;  2EC0 A;  4X64 F;  2RIJ A;  3EPG A;  3UWT A;  2JFK A;  2C2Z B;  3PJ9 A;  1EX8 A;  2AZ3 A;  2MDA A;  4Y0F A;  2L3M A;  4HT5 A;  2XZT B;  1NUE A;  2HSE B;  4USJ C;  5T14 A;  3U7J A;  3GIM A;  1WTB A;  3CT9 A;  4LBH A;  3LGH A;  1BMQ B;  1YBT A;  2VA2 A;  1PC5 A;  2O66 A;  1V6H A;  3PX0 A;  3H2U B;  1FKA F;  2HUR A;  4TY9 A;  2AYM A;  5DGA A;  1HHS A;  3VAF A;  1XER A;  2WW8 A;  2IC3 A;  3ILL A;  1FDN A;  5ADZ A;  1IR2 A;  1S7H A;  1JJH A;  2E5I A;  2ZNZ A;  1MNE A;  1CJT A;  3C14 B;  2HLT A;  5KOW A;  2IDL A;  2N7C A;  1CJV B;  3IGV A;  3N5F A;  3LP1 B;  2DRD A;  2VON A;  1FXD A;  4NLW A;  3MOJ B;  1BD6 A;  1ZZN A;  1B64 A;  3A1Y G;  3KDN A;  2Q79 A;  3Q8P B;  2HND B;  1W25 A;  2GHV C;  3RB3 A;  3HK2 A;  2ZKT A;  4RX6 A;  3V81 A;  2VZ9 A;  1WOO A;  3OD2 A;  4IDK A;  3KLE A;  4B3R F;  4P2M A;  3CJ3 A;  1R0A B;  4WFB Q;  2J9D A;  2NYI A;  3DLK B;  1FRM A;  4BHQ A;  2UUC J;  2NQP A;  4CO3 A;  3BSC A;  1FF2 A;  3SDE A;  1UW4 A;  4WZM A;  2XYP B;  2CQI A;  2DNG A;  2VG6 A;  3B78 A;  4AFF A;  2RRN A;  1RHM B;  4NZ7 A;  4DSJ A;  1I94 J;  3HJF A;  4JV5 J;  3CJ0 A;  2HHX A;  1Y5L B;  4WK3 A;  2FVC A;  4QWA A;  3PYF A;  2GIF A;  4KB7 A;  1F60 B;  3HO1 A;  4U7U D;  1B7F A;  3SCL E;  2UXB J;  1WHW A;  5DJB A;  3H2L A;  3MMB A;  4YDX A;  4EZ9 A;  5D4L A;  4DX6 A;  4RU9 A;  2W8L A;  4FVC A;  4IO1 A;  4QIG A;  2RSQ A;  1F1B B;  1PJ5 A;  1WTF A;  3TVZ A;  3C6T A;  3NWG A;  3QYY A;  4OYX A;  4A4J A;  4B9V A;  1HWJ A;  3VQT A;  1M5P C;  4KHP J;  3PM9 A;  4DPW A;  3SMZ A;  1K0V A;  3WX4 A;  1M5H A;  4RL1 A;  2O1P A;  3W62 A;  4CYU A;  1BQM B;  1O0P A;  2WVF A;  4K2X A;  1FTR A;  4OYZ A;  1UET A;  3TAM A;  2QEX S;  2FY1 A;  4ECR A;  3TWZ A;  2LA4 A;  2VG5 B;  3CJ4 A;  3JTN A;  3S6E A;  3U27 A;  3MEC B;  3BGR A;  1MML A;  1NXI A;  4H54 A;  1UA1 A;  4MIA A;  5GAD I;  3J80 U;  1SPB P;  1TMJ A;  5ETN A;  2YH1 A;  4LFA F;  1PC4 A;  2AW0 A;  2BM1 A;  3M8S A;  3JXO A;  3RBE A;  2BQR A;  4CLW A;  4PUO A;  5LMN J;  3W9I A;  4HKQ A;  2EWH A;  2QMW A;  2HS3 A;  2KG0 A;  2IA6 A;  2RF2 B;  4M63 A;  5H1S V;  1U6B A;  1I1G A;  2YWE A;  3F41 A;  3S1T A;  2ALZ A;  2XWY A;  4KGV B;  2MMY A;  3BBF A;  4DV5 F;  2F9J A;  2JNJ A;  4DFP A;  2XGP A;  1B0P A;  5D4P A;  5LSL A;  2UVU A;  2AX0 A;  1LWF A;  3FUY A;  5G0R B;  2VDH A;  2V34 A;  3FSY A;  4IO9 Q;  1AZS A;  3ZFV A;  4H4M B;  4QZV B;  2VQE J;  3K5O A;  2V63 A;  2UUB J;  4C8Y A;  2PN6 A;  4N56 A;  1IM6 A;  1FKP B;  1HKA A;  3E01 A;  1IBM J;  2AGO A;  1KFS A;  3TAP A;  1UVJ A;  1N33 J;  2W2M P;  3G82 A;  2IC3 B;  2FJA B;  2RRA A;  1F5B A;  3C16 B;  5KTQ A;  1N8R T;  1M90 T;  3TVY A;  1OY9 A;  2C3Y A;  1WC0 A;  3M8P A;  3DOL B;  1U2R A;  7FDR A;  1HNI A;  3KLF B;  2ZC3 A;  1R0B G;  4KJI A;  5GAG I;  2ASJ A;  4C4W A;  5SUH A;  2OPR A;  1OY8 A;  4G1Q B;  1H2T Z;  3BSO A;  2FLP A;  5DDP C;  1FER A;  3FVY A;  1ZA1 B;  4JI7 J;  1N5S A;  1JLA B;  4NRU A;  2V8G A;  2MGZ B;  1SJ1 A;  1IKW B;  2IM3 A;  3D6F B;  4N7T A;  2KM8 C;  3MR3 A;  3QT5 A;  1R89 A;  4UY8 5;  2VBW A;  2Y0S D;  3UO0 A;  1DHM A;  3R7S B;  1S1W A;  1VQY A;  1ZS6 A;  1N52 B;  2CQ3 A;  3GCW P;  3HT3 A;  2XO6 A;  1ARO P;  4AQY J;  3TZY A;  2RS2 A;  3VQS A;  3PIP Q;  1JK9 B;  3H59 A;  1N4L A;  4DJB A;  1E6V B;  2DHX A;  1KN6 A;  1UCN A;  1RT1 A;  3EMT A;  4RW4 A;  4ZVE A;  5T41 A;  4X4R A;  4ZPA A;  1JLG B;  2J9D E;  4DPT A;  3TAR A;  4B9U A;  1WEY A;  3AAW B;  4JV1 A;  4I2Q A;  3EGN A;  1OSC A;  2CJQ A;  2FHJ A;  2J76 E;  1FCA A;  4J9V A;  2Z4P A;  2HQG A;  2DT9 A;  2CJ9 A;  4TKT A;  4UTG A;  4AND A;  4DS4 A;  2HVI A;  2QSF A;  5A8W B;  3TZW A;  2KT2 A;  3K59 A;  4KBI A;  4ED1 A;  3HHL A;  3QJL A;  2MEW A;  2UUW A;  3MM8 B;  4X4S A;  2OHD A;  1FNX H;  1S4F A;  4KT0 C;  4GKK F;  4JYA J;  2H65 B;  3IR7 B;  2BA9 A;  4DQP A;  4X4O A;  2CZ4 A;  3R5B A;  2OSQ A;  2WHO A;  1IBL J;  2R9L A;  2C2R A;  3DLB A;  1JNR B;  3NBP A;  3NNC A;  1TAU A;  2WZ1 A;  3BH7 B;  3RG6 A;  1WOP A;  1HA1 A;  2XB2 D;  2FJE B;  5K9F A;  1N6Q B;  2HQF A;  3DHX A;  2B0G A;  5KG5 A;  1VCT A;  4Y2M A;  4A48 A;  3K0J A;  4WE1 A;  5IXU A;  3CC2 S;  3OL7 A;  1IKX B;  3I55 S;  1HR0 J;  2CJK A;  1RLD A;  3CCE S;  5AXM A;  1HBO B;  2AGP A;  2R8K A;  4WTO B;  2QZ8 A;  2MLX A;  4UOF A;  1KHW A;  2OO4 A;  2K06 A;  2W9B A;  1JLC A;  1Q8B A;  2VF3 A;  2ZD1 B;  2H4Y B;  4M5J A;  4RW8 A;  1DY3 A;  3MAA B;  4O23 A;  3D6T B;  3I0R B;  2PMZ D;  5KT7 A;  4DL7 A;  2YKM A;  2AD9 A;  2HHH F;  3QIP B;  2YVS A;  1SQE A;  2P9G A;  2V94 A;  3HVT A;  2QE5 A;  1QTM A;  4CLP A;  5KFF A;  4FPI A;  4FYX B;  4YFU A;  4NXN F;  4N41 A;  2M3D A;  2Z2Z A;  3HLU A;  4C8M A;  1VQ8 S;  3V2U C;  3CO9 A;  1M5K C;  3UD4 P;  3C19 A;  1APS A;  2V6A A;  1YRT A;  1YQH A;  3VGV A;  4DV5 J;  4IRC A;  3TJ9 A;  4RW9 B;  2NXE A;  2FJX A;  4LF7 F;  4UY8 T;  1C4C A;  1REG X;  4O3S A;  3AY0 A;  4AD6 A;  3M8Y A;  1UWB A;  2DHG A;  4BDP A;  2F4V F;  1SH3 A;  1JLG A;  1QLN A;  1XK8 A;  3MEK A;  2DR5 A;  2NZ4 A;  2YKN B;  3H0P A;  4PZV A;  3GLJ A;  3B82 A;  2DJW A;  2HS0 A;  4TY8 A;  2IMW P;  1V3R A;  2J9E A;  2YKN A;  4KGX B;  2X1F A;  5I42 A;  4LRF A;  2HNY B;  2CZ9 A;  5CYM A;  1N5Y A;  1R8P A;  4QW8 A;  3GSI A;  4YDD B;  1EAR A;  2DEI A;  4HHJ A;  4RW9 A;  3HZE A;  2J7K A;  1SC3 B;  4E2F B;  5LXY A;  2BBE A;  3IA0 A;  1NSP A;  2ZH4 A;  2QLF B;  3VZI A;  2W24 A;  4RUA A;  1IKV A;  2KDO A;  4DV2 J;  3QGP A;  2V8P A;  4DR4 J;  4KFB B;  2AU0 A;  3EGW B;  4PRF A;  2XMW A;  1HNW F;  1VK8 A;  2CAD A;  3KLF A;  2DVI A;  3HVT B;  2DD8 S;  1RK8 A;  1CJU A;  2CPH A;  2NZC A;  4G65 A;  3FEZ A;  1JX4 A;  3GR1 A;  5F9L A;  5CAA A;  5KFU A;  1B70 B;  1CS4 A;  1S9E B;  2LU2 A;  3OFF A;  4USU A;  1VQK S;  2DKO B;  1CVJ A;  2W9B B;  2W25 A;  4D3H A;  3DLL Q;  1QM9 A;  2MZJ A;  4A47 A;  2H5I B;  1TVR B;  2XBP A;  4HTJ A;  4OHX A;  3QAT A;  1FKP A;  2MPU A;  3ULH A;  3F73 A;  1NDC A;  1XQI A;  3UDC A;  1IWG A;  3RTV A;  4FBT A;  3M8Z A;  5HJY A;  4K59 A;  2BV3 A;  1SJ4 P;  1RYR A;  4JV0 A;  4ES3 A;  2W9A A;  3K58 A;  5H9F K;  1YK9 A;  4ZCK A;  4I0W A;  2ZBP A;  4YEA A;  4AXI A;  5DDQ C;  3LWL A;  3K5M A;  1N6Q A;  1HD1 A;  3CCJ S;  4TQR A;  4DQI A;  2M5Y A;  2VC1 A;  4KFB A;  4Q44 A;  1CUL A;  4URQ U;  3H5X A;  1S0N A;  2UXB F;  4OJG A;  4ZMM A;  2C2N A;  3A4T A;  4DV2 F;  3A8E A;  3QRR A;  1ZPW X;  1U24 A;  2XZD B;  3CMA S;  1N36 F;  3TYT A;  2V4R A;  1SKS A;  3NAI A;  4OZ2 A;  2K8G A;  4P72 A;  4CTA B;  2EXU A;  5KOX A;  5J1P A;  5JUM A;  1VC5 A;  4B9L A;  2AJQ A;  1V3Z A;  2OML A;  1KFD A;  5A8W A;  1M0S A;  1WJ9 A;  4L73 A;  3QZ7 A;  3H25 A;  3BQ2 A;  3GG1 A;  3IRX A;  3IO1 A;  3FZ2 A;  4EFA C;  1D8Y A;  4TY8 B;  1HMV A;  2FPH X;  5HAN A;  1U26 A;  2VIH A;  3V6D B;  4CO1 A;  3EZ5 A;  1FK9 B;  3I87 A;  1FRJ A;  2GVD A;  5J1N A;  2CPZ A;  1FRL A;  1HFE L;  3G6V A;  3VAJ A;  1G2E A;  2JEI A;  4ALZ A;  4CYU B;  2R7X A;  2V4Q A;  4WKY A;  4FXV A;  2JVO A;  1ICE B;  4B3S F;  5THW A;  2CPX A;  4USV A;  1XNR J;  1CC7 A;  2ACM A;  1S1W B;  3A13 A;  2BVZ A;  1NK4 A;  3UN5 A;  4X4V A;  3Q86 A;  3L9Z A;  3VAG A;  5LJ3 Y;  2V2Q A;  4C11 B;  1PBA A;  3D1H A;  4RNO A;  2BXJ A;  4LUB A;  3QRP A;  1WC3 A;  3R3T A;  1IUJ A;  3NG8 A;  1RWV B;  1RAG B;  3W9J A;  2JC1 A;  2DIS A;  4LVN P;  3UW1 A;  5KFE A;  1XNQ J;  4PYA A;  1SI9 A;  1SIZ A;  2FJB B;  1MU2 A;  3P45 B;  4WU2 A;  3UCU P;  4B9S A;  3B4M A;  1N54 B;  3NXZ A;  5FD1 A;  3GIL A;  3T6B A;  1Y7P A;  4JI3 J;  2OUG A;  3AQP A;  2G0I A;  2VBX A;  4C0H A;  4F67 A;  3MEE A;  2FDN A;  4HAC A;  3PTW A;  4OI3 A;  1ZAV A;  5MAO A;  3R1L A;  2E5L F;  5HMW A;  4M5I A;  4TYB A;  4ZVT B;  3ZZP A;  2BE7 D;  3GR0 A;  4CM0 A;  4WFN Q;  3MHY A;  3KJV B;  1D9F A;  3V4I A;  3RAM A;  5B0E A;  1P9Q C;  5LL6 d;  3OTO J;  1UW9 A;  3MM6 A;  1Y9O A;  2MZ1 A;  2UXD F;  4JI1 F;  2HHU A;  1T94 A;  2NCK L;  1ZM4 A;  3P5B P;  3TUI C;  4FYW B;  3IN5 A;  1ACM B;  1AA1 B;  2J5A A;  2Q6B A;  1Q86 T;  4JV2 A;  2I2Y A;  4UOC A;  4PXE A;  3OTD A;  1Q79 A;  2C2M B;  4ECV A;  2IFX A;  1NH7 A;  2QV6 A;  2WTF A;  1BXN A;  3CO0 P;  1IR1 A;  3EVW A;  4H4O A;  4ETZ A;  4LBI A;  1QJH A;  3QLH A;  1K47 A;  1Q8K A;  2B9Y A;  4DF4 A;  3PZP A;  3BO3 A;  2P8I A;  4AL7 A;  3FSX A;  2CNN B;  3M2V A;  4N47 A;  1X4H A;  5KFZ A;  2DR7 A;  3MPW A;  2R8H A;  3LAN A;  3RAX A;  1TV6 A;  2DBB A;  5EX3 A;  1ZET A;  1X0F A;  2YNI A;  1R0C B;  1Y5N B;  4HEA 9;  1KDN A;  5DZ6 A;  1PSD A;  5HVG A;  5GAE U;  2AT1 B;  4ZP7 A;  3ZTP A;  2H4W B;  2HHP A;  1S9G B;  2RQC A;  1VQ6 S;  2NR0 A;  3HZG A;  3DRP B;  1RAO A;  2XSJ A;  5EDW A;  2WON B;  1KOO A;  1UPP A;  2D7S A;  4KGK A;  1UMJ A;  4WPA A;  1FWK A;  2CXE A;  1B0V A;  2C28 A;  3DLG B;  5ETM A;  1SJR A;  1W26 A;  2MYF A;  4DV7 J;  1JLA A;  2BAC A;  4YB7 A;  1WF1 A;  1NM2 A;  2MQQ A;  3DLH A;  4B3O A;  2OEK A;  4HH1 A;  1M1K T;  3CTR A;  1AUD A;  4XIU A;  1U7L A;  3R7B B;  4QR0 A;  3UCG A;  4DX7 A;  3W5X A;  4WII A;  2Z2Y B;  4WU3 A;  1HI1 A;  2H3E B;  4ZIW A;  1U25 A;  1WI8 A;  2D41 A;  4NLO A;  2KFN A;  1S57 A;  4HL9 A;  4ED2 A;  4LRB A;  4X65 F;  4HH0 A;  1LXN A;  4NE9 C;  3AOC A;  4HT7 A;  4IFY A;  1LQ9 A;  4DUT A;  2VG6 B;  1T9X A;  5GAH I;  3HVR A;  3Q0A A;  1CC8 A;  4JBC A;  3T5K A;  3BR8 A;  3LUY A;  1BQN B;  3BN7 A;  3QO9 A;  1WKK A;  3SYZ A;  3UDE A;  5HSP A;  1PYO B;  4NWB A;  5BJR A;  3HHE A;  2A0F B;  1JLE A;  1T9Y A;  3IG1 A;  5B7W A;  3CVK A;  4NLY A;  1SJF A;  1S0O A;  1BHN A;  3WIV A;  4ECQ A;  3BYR A;  1Q7Y T;  2R7O A;  5G0R A;  4CDI A;  3LGN A;  2BZ2 A;  4DL0 C;  2XI3 A;  2EBE A;  2FLL A;  4NCB A;  2XS2 A;  4OYM A;  3T1Y F;  2H54 B;  1TKX B;  4KQZ A;  4XDC A;  3EVM A;  2HHS A;  2GVZ A;  1NDL A;  1LWE B;  1RKI A;  2YNH A;  4UZC A;  4PG8 A;  2IA0 A;  5D0R A;  1L3U A;  2LEP A;  3BR9 A;  4IFY B;  3TA2 A;  1VC6 A;  3X3U A;  2AJ1 A;  2LFV A;  3FRY A;  4LSN B;  4AXJ A;  2IAJ B;  3O8W A;  3DGP A;  1NEE A;  3CW2 C;  3TNV A;  1HI8 A;  2XI2 A;  4LMZ A;  3M2U B;  5DO2 A;  3QGI A;  1YKW A;  4ID5 B;  3MEC A;  4ZP6 A;  3UDV A;  2BKN A;  3AQO A;  2X1G A;  4DQQ A;  5FII A;  1KWM A;  2BJD A;  2IRX A;  4DFM A;  4CLF A;  4PXD A;  3UCZ P;  1S9F A;  2F40 A;  4JI0 J;  2HBR B;  4FYD A;  4Y2A A;  4CZC A;  2KJV A;  5CYJ A;  4BC7 A;  4RKU C;  1VQ4 S;  3CCM S;  1PCA A;  1N48 A;  2V5H G;  2DEJ A;  3QSY B;  1Y10 A;  4J9Q A;  3W60 A;  4FF2 A;  4LF4 J;  3FRZ A;  3VR1 A;  3M2R B;  4JB8 B;  4PAA A;  1PJ6 A;  5A6P A;  4X62 F;  3G96 A;  3N6L A;  3ZNJ 1;  1VFJ A;  2WOM A;  1NJX A;  1WOS A;  1HLW A;  5LMU F;  4DUZ F;  3OVB A;  1UPM B;  3C15 A;  4KC5 A;  4NEY A;  1TP7 A;  5F3Z A;  2MJN A;  3TA1 A;  4YME A;  1RWP B;  1R3N A;  4C3M A;  4UST A;  3UN2 A;  5B08 A;  5L9N A;  1HHT P;  2ALY B;  4CO0 A;  1XWL A;  3CCV S;  3H5S A;  1Y4Z B;  2FLN A;  1HNI B;  3CJ2 A;  3UNG C;  5M2U A;  2CQ4 A;  3NGK A;  2BJ1 A;  1HBN A;  4G1P A;  4Y65 A;  3LWM A;  2KXF A;  5AE3 A;  3HHN B;  1HQE B;  3DFE A;  3UD5 A;  5KFN A;  4ZDN A;  3M8W A;  4CNY A;  4Y2I A;  4OYI A;  4TQS A;  4LIR A;  5J2Q B;  3C6U A;  2UP1 A;  4LVO P;  4HDH A;  3UR0 A;  3RRK A;  4RLE A;  5DRK A;  4OYO A;  3BO4 A;  1U6Z A;  3I5C A;  2G1H A;  2L9N A;  3K5N A;  3P5T L;  2E1P A;  3PRV A;  2K2P A;  4ZVP B;  1VJW A;  1JNZ B;  3G9C A;  2QFI A;  3KG4 A;  3MAQ A;  2N4C A;  1M1G A;  4DXL A;  5IT4 A;  4EZ6 A;  5GAD U;  1NJY A;  4LR9 A;  4NRT A;  1X4D A;  2BUN A;  2X3D A;  3R5C A;  4Y34 A;  4R5P B;  4UT4 A;  4ER8 A;  5KFI A;  2WB1 D;  2E7V A;  2C22 A;  1SC1 B;  3U1N A;  5B0D A;  4YOE A;  5F8I A;  2XGQ A;  1LWX A;  2AZ1 A;  2ZZM A;  2DNZ A;  1MU2 B;  2VFV A;  4ED0 A;  1KLM A;  2B8P A;  2B4P A;  2MQN A;  3QID A;  1D9A A;  2L41 A;  1GMV A;  2VL1 A;  3I9Z A;  2OSR A;  3W2V B;  3MI7 X;  3THV A;  2HIY A;  2UUT A;  3BN4 A;  3N9U C;  2Y1R I;  5KG6 A;  3ZTO A;  4CO5 A;  1VQ7 S;  2ZWO A;  1IJF B;  4Q0B B;  4D3G A;  2HWH A;  2QLX A;  4KIA A;  3SZ2 A;  1KC8 T;  1EKS A;  1MMD A;  1WSR A;  3S7R A;  4DOZ A;  1RWU A;  2LQ9 A;  3RRH A;  4OI0 A;  1RWX B;  3VVU A;  3SV3 A;  5IM0 A;  1X9M A;  1EP4 B;  5LMU J;  2YBV A;  3W2W B;  3OJU A;  3HHK A;  3R9L A;  3ONQ A;  5DET A;  4TLR A;  3M6W A;  1PGZ A;  2R7S A;  1AT1 B;  3HSJ A;  1NDK A;  4OYP A;  5A76 A;  4ZHR A;  2VBY A;  3G6Y A;  1KS2 A;  2R7Q A;  4J9O A;  4DWI A;  1RB0 A;  3W66 A;  4E98 A;  2J9C A;  3L3C A;  3BSN A;  2MSS A;  3GSD A;  1NHV A;  1W2I A;  4UQG A;  1IBL F;  1KLN A;  4P71 A;  2DXF A;  2WVC A;  4C3L A;  5HLF A;  3EXY A;  3K89 A;  4F25 A;  1T9W A;  5F8G A;  2XC9 A;  3V6K A;  2ACY A;  2AEM A;  3UD3 P;  1UJ4 A;  4LF8 J;  3DGP B;  5C25 B;  2EW9 A;  5I3U B;  1DTQ B;  1TL5 A;  5LM7 E;  1H74 A;  1TK8 A;  1UTA A;  1U1K A;  2V2Z A;  4B3T F;  4U8Y A;  1UL3 A;  2KZM A;  3RUB L;  2ROG A;  4DI6 A;  1OWX A;  3BSA A;  1RU1 A;  2HWI A;  2CVE A;  2LYV A;  3EJM A;  3I6P A;  3S01 A;  1S6Q A;  4ZS6 A;  2LEB A;  1RAC B;  1F9H A;  1SH0 A;  2KYX A;  2N7Y A;  3DLK A;  1RHR B;  4GRS A;  4MFB B;  2A6M A;  4P73 A;  2CQP A;  4O3Q A;  4H4O B;  4IDK B;  4CH7 A;  2H51 B;  3V81 B;  4EBC A;  3D66 A;  2HWT A;  3AXM A;  1FD8 A;  3VGT A;  3MUV P;  1HYS A;  3MEG A;  3CIM A;  4QWD A;  3IG1 B;  1FEE A;  2GO9 A;  3D68 A;  4R0J A;  1WHX A;  4YHH J;  1B0T A;  1UZD A;  2F4F A;  3KLH B;  1XMQ F;  4Q43 A;  2VUG A;  4F2R A;  3MPD A;  1DTT B;  2PT0 A;  1BQN A;  2X51 A;  3QO9 B;  2XHC A;  3GYG A;  5BR8 F;  1RT4 B;  3BGU A;  1ZTW A;  1FJC A;  2MKY A;  2MQL A;  1JXL A;  1KHV A;  4F4K A;  1CS4 B;  1S9E A;  2VKR A;  4QYR A;  1AUS L;  1HW9 A;  2WSC C;  1OS5 A;  2VFR A;  3DU6 A;  5DG9 A;  2ZH1 A;  3MM9 A;  2YKO A;  1NH8 A;  2BJE A;  1REV B;  2WVD A;  2C2O B;  3KJF B;  2RHS B;  5EHH A;  3NS6 A;  4JI4 J;  3KTQ A;  3J7Y I;  4JI5 J;  1IKV B;  1RI7 A;  5BYR A;  3DLJ A;  4F0M A;  4QIE A;  3ETM A;  3PXG a;  3JAM Y;  1YDL A;  4B3M F;  2GO8 A;  2E29 A;  2YPZ A;  3RAQ A;  2PD1 A;  3TO8 A;  2ATL A;  4MK7 A;  1FKO B;  2HNZ A;  1WNE A;  3R1H A;  2AV5 A;  2GGP B;  4CI0 B;  4IG0 A;  2ZM6 F;  1TKT B;  1HWK A;  2OD6 A;  4JOU A;  3MPY A;  2VPZ B;  4K8R A;  5IQ6 A;  4ECW A;  2B9E A;  2F3J A;  2WVB A;  2M0G B;  4A8W A;  1EKR A;  2WON A;  2R42 A;  3BDE A;  2UVV A;  2D1C A;  3NGD A;  1O5J A;  5HN0 A;  3IRW P;  2KVI A;  3F0N A;  3MGJ A;  2C2E A;  4LSZ B;  1PYT A;  1NAQ A;  1L3S A;  1OMS A;  4KGM A;  2AJ0 A;  4NL5 A;  1NSK L;  1VC0 A;  1YSJ A;  4X66 J;  2HFO A;  4M5D A;  3UR3 C;  3EZU A;  3DDI A;  1YRU A;  4CLK A;  1NME B;  1H2V Z;  2DGV A;  2H48 B;  2QC3 A;  1RWK B;  4O3O A;  3SSR A;  1RUS A;  4F3M A;  3D0G E;  1NJW A;  3CJ8 A;  3FBC A;  4ZVQ B;  2FHK A;  3OTB A;  1TL1 A;  3NLC A;  4ED5 A;  4O4R A;  5IC4 B;  4RJV A;  3A8I A;  2G0C A;  3CJK A;  2GAH C;  2LEA A;  2N4D A;  3VAH A;  1YTY A;  5I3Q A;  4CRJ A;  4CTA A;  5HMZ A;  2B8Q A;  1S77 D;  1HBM B;  1NKB A;  1Y0H A;  2DY9 A;  2M9K A;  1BY9 A;  5E41 A;  3M7V A;  4K2J A;  4NPO A;  3IWN C;  1GEH A;  4JV5 F;  1NRK A;  4OL8 A;  1VQP S;  3TEH B;  3MAA A;  2IM2 A;  1RE1 B;  1RWM B;  3QT8 A;  4O4G B;  2IBO A;  3UE2 A;  2XS5 A;  3MM6 B;  1KD1 T;  2AKW B;  5C24 B;  5D78 A;  1UAW A;  2R3V A;  4QPX A;  1IKX A;  5A8K B;  4ZCI A;  1KNZ A;  4F0K A;  2OPS A;  3Q83 A;  1S1V A;  5KFK A;  2QX0 A;  5KG0 A;  4ECS A;  3ZZT A;  1P6T A;  4RBV A;  1X8D A;  2EK6 A;  5B09 A;  5RUB A;  1X31 C;  2JFD A;  2JLF A;  1MRO A;  5L8R C;  5M2R A;  3KK2 B;  1UVI A;  1ITP A;  4LJM A;  3D7S B;  2OKQ A;  2MKI A;  4I2P B;  3OL6 A;  4YP3 A;  2P9C A;  4UZB A;  1G4C A;  2HVH A;  3Q8S B;  3BKU A;  2QL5 B;  1U1N A;  1NHU A;  3RB6 A;  4G6V B;  1JXE A;  2R4F A;  4HLB A;  3QGG A;  1VQL S;  2ILY A;  4ILL A;  2Y0B B;  1T02 A;  3ZZZ A;  4ZK7 M;  5F3T A;  3DRS B;  2DXD A;  4R25 A;  4BS2 A;  5AXL A;  2ASD A;  2N3L A;  2DH8 A;  2VB6 A;  1UVN A;  1YZ7 A;  2CWK A;  2GHW A;  3DMJ B;  4AYB D;  1N5Y B;  3DCA A;  2CAJ A;  4M5D B;  4E8U A;  3N01 A;  3CD7 A;  1P9Y A;  1WC4 A;  3QPI A;  5C2G A;  2DXE A;  2KN4 A;  2B6A B;  2Z2L A;  1IQZ A;  5A2Q U;  1O51 A;  4MH8 A;  1X5T A;  4EMD A;  4WFY A;  2GMJ A;  4F26 A;  1I51 B;  1QTN B;  3FSI A;  2ADC A;  1QSS A;  2FC8 A;  4M5K A;  2MZS A;  2ZIT A;  3PY8 A;  1UFL A;  1JJ2 R;  1JLF A;  1P1T A;  4DCO B;  4OLP A;  2VQE F;  2BOP A;  2KXH A;  2GNK A;  1IR0 A;  3FNN A;  3A3P B;  1FKO A;  2BJ9 A;  1U0S A;  2HNZ B;  5J1E B;  4YQW A;  2DHA A;  1CLF A;  2BJ8 A;  4YR0 A;  4YR2 A;  1U0H B;  5ITH A;  3ILI A;  1Q78 A;  4NXM F;  4RR5 A;  4AL5 A;  4ILM A;  3IS9 B;  3OTO F;  5T7L A;  2E1A A;  4DSL A;  2V8H A;  1CQM A;  2OPR B;  3ICL A;  1W2B R;  2N3O A;  5HLF B;  1TL7 B;  3K8V A;  4DU8 A;  3E2E A;  4C3K A;  2R2U A;  2WCX A;  3TZX A;  1RT6 B;  2ZE2 A;  3OFH A;  1L3T A;  2GAG C;  3I0R A;  4ZVO B;  1FRK A;  3HJV A;  4KH1 B;  1Q8I A;  4ZOS A;  2HLU A;  2BQ3 A;  1T11 A;  3Q24 A;  1FRX A;  2J7U A;  5HVH A;  3FZB A;  3CE8 A;  3MMA A;  2ZH8 A;  5KFH A;  2M7S A;  2IVY A;  2AWZ A;  3J7Z 5;  2PO4 A;  1WI6 A;  4KO0 A;  4GC6 A;  1P1L A;  3O3L A;  4A46 A;  1URN A;  3TEG A;  1OO0 B;  2OEM A;  5LSR A;  4EEY A;  1QE1 A;  3T1H F;  4CO2 A;  2RT3 A;  4ED8 A;  1TUG B;  2KFY A;  2D3O R;  4ZIT A;  3N6M A;  1S6U A;  1FHT A;  2HZA A;  2VQF F;  1RJJ A;  4CH1 A;  1R8A A;  4J9K A;  1YHQ S;  4DPX A;  4V1A k;  5KG1 A;  1HNW J;  1D1U A;  4Y28 C;  4GKJ F;  3MR2 A;  1RHU B;  4I6A A;  2NSB A;  2AEF A;  3PG9 A;  2Z57 B;  3WX8 A;  2CQ2 A;  4K7Q A;  4CH0 S;  4CIO A;  4YB5 A;  4FS1 A;  5G4D A;  2YY3 A;  1NO8 A;  2OPP B;  2QYG A;  3DM2 B;  4MIW A;  4CLZ A;  4WYW A;  5HMY A;  1NK8 A;  1H98 A;  1UP1 A;  3PW5 A;  5EWG A;  1QVF R;  1FI4 A;  2GC8 A;  4CLS A;  2IYG A;  4NCA A;  1MMN A;  1RTH B;  5B0G A;  2R2R A;  2MZT A;  2MLZ A;  3I5B A;  4MK9 A;  2ZH7 A;  1WSV A;  4RW4 B;  2L9D A;  6FD1 A;  3MOZ A;  3TI0 A;  4J5O A;  3BZQ A;  1NLK L;  1HBU A;  3MD1 A;  5IM0 B;  4LQ3 A;  3K7R A;  1SV5 A;  2VD3 A;  2GIR A;  4IOA Q;  1PG5 B;  3J81 U;  2GML A;  2MQM A;  2LVW A;  2RRB A;  2YKQ A;  3SFU A;  3D3B J;  3J7Y U;  3LH2 S;  2QLB B;  4OHY A;  2YWH A;  2BYC A;  4P74 A;  4QYZ J;  1MWY A;  1J27 A;  5GVQ A;  4OX6 A;  1RAI B;  5AXK A;  2CJB A;  2LXU A;  3BKF A;  2IDE A;  1PIE A;  4ZCM A;  2GHP A;  3TJ8 A;  5CA5 A;  1KEK A;  4AQY F;  1H0H B;  4JI0 F;  5D8H B;  3ILJ A;  3FCW A;  3KLE B;  2GQC A;  2IRU A;  2MHN A;  1R27 B;  1S1X B;  3D1O A;  3HCX A;  3M8P B;  2H1Y A;  3W8G A;  1EZZ B;  1V9O A;  2NXC A;  3NCR A;  1Q53 A;  1SJ3 P;  1U2C A;  4ANE A;  1Y3K A;  1H73 A;  3UQS A;  4DR4 F;  3M1V B;  2XY7 A;  1K1Q A;  4LR8 A;  3JQJ A;  4KKO A;  2M70 A;  4ECZ A;  2XLJ A;  2CYY A;  1M1H A;  4UUW A;  3JQK A;  3TJA A;  1RIS A;  2QL9 B;  4PPZ A;  1H2U X;  4QWE A;  3CD6 S;  1FXL A;  1HQE A;  4N77 A;  5KT2 A;  2XO7 A;  2ZJP Q;  1N34 J;  1IN0 A;  5CZV A;  4NX9 A;  1NPK A;  3AHP A;  4U9R A;  4A8Q A;  1T03 A;  3IBC B;  3V6J A;  4USW A;  4WYL A;  1XC9 A;  2Y1L B;  1GTH A;  4Z2X A;  2HGN A;  5A0Y A;  2Z58 B;  1GAO A;  2NXU A;  3VCD A;  4USM A;  3ZNU A;  2A6O A;  3CCW A;  3OXG A;  5HJX A;  5DG7 A;  1TQL A;  1HQU B;  1FRH A;  3GFZ A;  2HPU A;  4RU2 A;  1EB0 A;  4ELU A;  2CPE A;  2WOM B;  3MF5 A;  2RD5 C;  1NK5 A;  4DUY F;  4LF7 J;  3AB2 B;  4U95 A;  3OL8 A;  3AJD A;  4J90 A;  5KFX A;  3RZA A;  5KG4 A;  3SQO P;  3HDS A;  8RUC A;  4DUY J;  3GV8 B;  2DGT A;  1FNO A;  2FZC B;  2DIV A;  4JI5 F;  2GCF A;  1TK0 A;  1NSA A;  3KLI B;  1S1X A;  2HZC A;  5CCM A;  5J2M B;  2IRY A;  5JVH Q;  1K73 T;  5M2P A;  1FWL A;  2XMV A;  4J9R A;  4DUZ J;  4A8M P;  4ZA1 A;  3CMQ A;  5DQH A;  1EAY C;  3CCL S;  4RNF A;  4DV7 F;  2F8E X;  4K4Y A;  3MMC B;  4ELT A;  3PFO A;  4F04 B;  5HAT A;  2DIU A;  2PFD A;  3KHL A;  1SB6 A;  3VVT A;  1ZH5 A;  3VGS A;  2FQQ B;  3TP2 A;  4TU9 A;  1C1C B;  4Y2C A;  3MCS A;  2YWG A;  1HR0 F;  4CNZ A;  1NJI T;  2NUH A;  1QAY A;  2V50 A;  1KQF B;  5AJ3 F;  3PYD A;  1YJR A;  4FS2 A;  2HFU A;  5C7P A;  4DN9 A;  4JI6 F;  4LF6 F;  3MXH P;  5IWA F;  2HW3 A;  2EKY A;  2G1D A;  1MWQ A;  3JTO A;  4K5R A;  3I4H X;  4M5M A;  3MTK A;  4V19 X;  1N5V A;  3KK1 B;  2XSJ B;  2ASL A;  4FYV B;  1FD2 A;  2DR9 A;  3G2X A;  3EDR B;  4EU0 A;  2KRR A;  2Q6C A;  4J9N A;  4FZV A;  3DM2 A;  1E6Y B;  4X4N A;  2FHM A;  4QIF A;  3DKD A;  4KE5 A;  2YNI B;  1SL2 A;  1C0T B;  1CJT B;  1VHI A;  3M8Q A;  2RJZ A;  3LP0 B;  2K1R A;  4L75 A;  3EM1 A;  2UXC F;  3PKM A;  1NPR A;  3UN3 A;  3JTP A;  3DLE B;  2QYC A;  4IR1 A;  3QJJ A;  2HHQ A;  1G7C B;  3HVA A;  1ZTT A;  2V0N A;  3TUP A;  1YLX A;  4JI1 J;  1RA6 A;  2XNQ A;  1VQ5 S;  1AFJ A;  1N0U A;  2KH9 A;  3K17 A;  4I67 A;  2J0Q D;  4OZJ A;  5ETP A;  3NWR A;  1UEV A;  3M9M B;  3M05 A;  2VG5 A;  3GZ7 A;  1U1P A;  3CB4 A;  3SXL A;  1QVG R;  1VHF A;  3D5M A;  3DOK A;  4JI3 F;  4KPY A;  1BQM A;  4JI2 F;  1HNV A;  1KTQ A;  2Y8W A;  3OSP A;  2C2K B;  2IM0 A;  2JHE A;  4Q2M A;  4WF9 Q;  2UVW A;  1S6P B;  3GG0 A;  4O3R A;  5F8J A;  1O6X A;  5E3C A;  3KHH A;  3KJV A;  2KHD A;  2FD2 A;  3D9B A;  3HFV A;  3DC2 A;  4I6W A;  5DDO C;  2JVR A;  3PO5 A;  1S48 A;  3MFI A;  1VRU A;  3P6Y C;  2MZR A;  4WWS A;  4TLQ A;  2VPY B;  1CJK A;  4GKJ J;  4B9M A;  3D28 A;  4GVB A;  4NOH A;  1N32 F;  1RT3 A;  1S1T A;  2XHW A;  1XNR F;  3RW6 A;  4P6Q A;  1NZ8 A;  1KVI A;  4LFC F;  3I5A A;  4DX5 A;  3R5J B;  1YJN S;  4E0D A;  4CLY A;  5U47 A;  4ZLN A;  2OTJ S;  2ZH6 A;  3EDQ B;  5IC6 B;  4HHU A;  2QO3 A;  4L3N A;  5KFL A;  2M2B A;  5FLX Y;  4QU7 A;  2CVI A;  1OYE A;  2XM3 A;  2ZBQ A;  3IAM 9;  4EI2 A;  4LF2 A;  1WWH A;  4DV6 F;  1OSD A;  2RQM A;  2KKH A;  5HI7 A;  4DPY A;  5HBM B;  2GMH A;  4I1T A;  3SIP B;  3CCZ A;  3EZO A;  1Q1K A;  3H42 A;  1Z4U A;  3EXC X;  3HT0 A;  3O5T B;  4FF1 A;  4WBF A;  2HFZ A;  2FY8 A;  3ENV A;  2Z56 B;  2AF6 A;  3KNG A;  5EX0 A;  4DL4 A;  4F4Z A;  4DV3 J;  1R6V A;  2V8D A;  3CCT A;  3V6D A;  4WXO A;  1ZZF A;  2VFT A;  5C42 A;  4ITS A;  3T5H A;  2OPP A;  5F8H A;  4FF3 A;  4R8U A;  3NOC A;  1QSL A;  1JWW A;  1X9W A;  1IKY B;  2ILZ A;  4IFV B;  1TKT A;  1TFW A;  3GTY X;  4OJH A;  5KFQ A;  2PA8 D;  2Q43 A;  4LT6 A;  2EFO A;  3WBZ A;  1EHW A;  5L1I A;  3RW7 A;  3A8J A;  2V9W A;  3AOA A;  1I6J A;  3DNC A;  3TW0 A; 
#chains in the Genus database with same CATH homology
 2AHO B;  1YZ6 A;  3CW2 C;  1YZ7 A;  2QN6 B;  1Q8K A;  2QMU B;  3J81 j;  3QSY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...