2F4VJ

30s ribosome + designer antibiotic
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Interactions of designer antibiotics and the bacterial ribosome aminoacyl-tRNA site
pubmed doi rcsb
total genus 9
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 2f4vJ00
5FLXU 4KYZA 4LF7J 5A2QU 2UUCJ 4JI5J 4RJVA 4GKKJ 1I94J 2MTLA 4HHUA 4LF5J 1IBLJ 4B3TJ 4X65J 3OTOJ 4X66J 1XNRJ 3J7AN 4DR1J 4NEYA 4X62J 3IMQJ 2HHHJ 4KHPJ 4JI1J 1IBMJ 2E5LJ 4LF6J 2UU9J 4GKJJ 3JAMU 1HNXJ 4JI4J 3D3CJ 4LF4J 2UUBJ 4LFBJ 3T1YJ 4YY3J 5LMNJ 1N32J 3R2CJ 4DR7J 4KY3A 4LF8J 4JI0J 4OX9J 4JYAJ 4JI3J 1XNQJ 4JI2J 4JV5J 1XMOJ 4NEZA 2VQEJ 4JI8J 1HNZJ 1HR0J 2MEWA 4DV3J 1N33J 3W1YC 4DV4J 4NXMJ 3D3BJ 1XMQJ 2ZM6J 2UXDJ 4K0KJ 2MQ8A 3J80U 1J5EJ 3J81U 4B3SJ 1N34J 4LF9J 4AQYJ 4DV1J 4DV0J 4DUYJ 4DR5J 1N36J 4JI6J 1HNWJ 4V1Ak 2VQFJ 2UXCJ 2UXBJ 5IT9U 4DR3J 2KVQE 4DV7J 3T1HJ 4DV2J 4DR6J 4JI7J 5AJ3J 4LFCJ 4DV6J 2KL8A 1FJGJ 4DR4J 4YHHJ 2F4VJ 4LFAJ 4PWWA 5LMUJ 4DUZJ 5LM7E 5IWAJ 4X64J 2UUAJ 3R2DJ 4B3MJ 4DV5J 1IBKJ 4NXNJ 4DR2J 5BR8J 4B3RJ
chains in the Genus database with same CATH superfamily
2ZE2B 5HLFB 5F9LA 3PZPA 5G0RA 4A48A 2HNYA 1RWNB 3MFHA 2P8IA 3R7SB 3MUTP 3OTEA 3AB2B 3H90A 3CD6S 4Q43A 3IGVA 2E5LF 2Z30B 1R0CB 2DGSA 4FVMA 4QIFA 4QQBA 4Y65A 3H5XA 2F1FA 2RKIA 3P96A 3HVWA 2UUBJ 2JVOA 2FJEB 4KAIA 3KG0A 1IJEB 3HHLD 1LXJA 3K17A 3ICLA 3OUYA 2XMUA 2XHCA 2W4PA 2MZ1A 2OO4A 3KK3A 1NJYA 2AJ1A 5DM7Q 4OZ0A 1PBUA 4JV1A 2MZRA 4ZMMA 2L3MA 1V9OA 1CJKB 1N36J 1RTDA 4LSLB 4V1Ak 2BM0A 4AXJA 4PXBA 4OYZA 4P2FA 3UDCA 2LXFA 4DFPA 4K59A 1PAEX 4MH8A 4I6WA 3NCQA 3L4BC 3VV2B 4I4BA 4XTTA 1S76D 5E3CA 2XYPB 4LF1A 4J9OA 4ZVOB 4ID5A 2OUGA 3BBBA 1VLOA 3DRPA 1JLGA 4WIIA 1B0TA 1PJ6A 1NK6A 3VAJA 5I42B 4OZ1A 1OO0B 3ZZZA 4DXLA 2R4FA 2J9CA 1D3WA 4CO3A 1BUXA 1U24A 2AYEA 2DTJA 3GZ7A 1ZS6A 1PSDA 3QT7A 1CSJA 3DGVA 5AXLA 1RCOB 1XR7A 1WC6A 2AYMA 4WP8A 3L09A 1F3VA 1YI2S 3MR7A 3MAAB 1SJQA 3JTPA 1RKJA 2H9ZA 1FDBA 1S6PA 2HVHA 3GV5B 1VQMS 1GXUA 2OP5A 3H2UB 3G8TA 4CLFA 4TY8B 2FYXA 3L3CA 1YJ7A 3DYAA 4NLRA 1PBAA 4EO6A 5A76A 4DF8A 3U1NA 2XI2A 2HIYA 1S4EA 2DNRA 3BDEA 4RNHA 5KFOA 2RH3A 2LDIA 1BQNA 2PC6A 4FN5A 5HI7A 4LF5J 3AFGA 5K14B 4ANCA 5L1JA 3R9LA 4OZJA 3K7RA 2V6AA 2H3EB 1VQ4S 4KO0B 2Z8QA 4M5DB 1SJ3P 2Q43A 3R7NB 3OFFA 5F8LA 4BHQA 4USTA 3U7JA 1ZM9A 4LBHA 4DR7J 3QNWB 4JV5J 2H5JB 2J76E 4GMKA 2VPWB 5HMXA 4A8OA 3BN7A 4I68A 1REVA 2E7WA 2WVDA 1KTVA 1T03A 2PO4A 5A8KB 4ZIVA 3IM9A 4CH1A 1RI7A 3UVJA 3FGVA 3UO0A 1JXLA 2YH0A 3C6UA 2LLZA 3DLKA 4W98A 2RNEA 3PHTA 1J5OA 1LKZA 2E1PA 2DHGA 2KM8C 4DLGA 4WKRA 3VZIA 2M8HA 4WJBA 4HDHA 1FKOB 4JI8F 2G1DA 2HIQA 3IM8A 1JLBB 2YNGB 3D68A 4TNOA 4FS2A 2GC8A 4LF4J 3GTYX 1M90T 2GVZB 1QLNA 4X4UA 4A8MP 3EPGA 4M5LA 1UWBB 3WC2A 2CWXA 3C16B 2CQPA 1E6YA 5F9NA 5AE3A 4EYIB 4CCHA 1SB6A 1D9FA 4HI2A 4CLKA 3VHQA 1TAUA 1FD2A 1CULA 2HURA 3MCOA 2Q6CA 1SH2A 4UOGA 3TUJC 2BV3A 1OY8A 3RRGA 3BM7A 1RAHB 2MGZA 1GXLA 4NCGB 1DTTB 3QIPA 4ANEA 1UCNA 4ECVA 4XK8C 4DOZA 4ZPBA 2E1AA 4HR2A 3A8IA 3VGSA 2VKRA 1TFWA 2XI3A 1PYOB 1YRXA 4IG3A 4K4TA 4DR2J 1AFIA 3TAMA 5BR8J 3K5OA 1NB7A 2YNIA 2CPEA 3I5AA 1VISA 4M63A 3ADAC 4WF9Q 3BGUA 1WI6A 3DLEB 5KFUA 2R9LA 4CO5A 3OPKA 4CLLA 2Z57B 4L75A 4CNYA 4MT1A 2MPUA 4A8KA 3DNCA 2BMBA 1EQ0A 3JAMU 2CJAA 1LK5A 1K0TA 4B17A 2BKOA 1VQ9S 4WU3A 4OX9F 2DNKA 2COLA 3CPWR 1JNRB 4P6QA 1VQ7S 2UZAA 3BGRB 1SUQA 1GTHA 1HMVA 3GIIA 3M05A 2DH7A 2C2DA 4N7TA 5ETOA 3CGIA 4YB5A 4ZKAA 2IPOB 3ZZUA 1TU0B 2MLYA 2V2KA 1YLXA 1RAJA 3FMBA 3B78A 1WUUA 3QLHA 4J9SA 1WC5A 1JXVA 3I31A 1X4DA 2RQMA 1QUPA 1Y4ZB 2BQ3A 3IS9A 1HW9A 1HWIA 2JHEA 4OYWA 3BV8A 2FLNA 1Y7PA 4C0BA 5DGBA 3WQPA 2VICA 3M8QB 3NOGA 2W7OA 1HBMA 3CT9A 4NWBA 3EXYA 1GAOA 1NPPA 2B3TB 2MKCA 2ZDPA 3H4DA 1Q78A 2MQMA 2QA4S 1FESA 1RADB 3KKFA 4ZHRB 4YEAA 1NHKL 3W8PA 4EFAC 4EGLA 1X5PA 4R8UB 2FHMA 1DLOA 1K1SA 1JXEA 3R5BA 3QGGA 2CNNB 1S99A 3CDWA 3T9NA 2ZM6F 1KQFB 1NCLA 4QWDA 2MMYA 3RAQA 1VQ5S 4X4NA 1JQGA 1JLFA 3AJ1A 5L46A 4DDFA 4NOHA 1AYEA 4RW6B 3CMQA 1VQLS 3TJ9A 3CCQS 5T7LB 2OPRB 4FYWB 4Y2KA 3K89A 3GLJA 4X64F 2HHQA 4DX6A 3AB4B 3K5LA 5LSOA 4P74A 3QO9B 3M8PB 1Z2ZA 3W64A 1U1QA 2GVDB 2IC3A 3V4IB 5A8WA 3CCWA 2QG9B 4CLTA 3HF5A 1RWVB 3KK1B 1C0UB 3M1VB 1UJ4A 3M30B 3Q86A 3G4SS 1F60B 2LQ8A 1VK8A 4GC7A 2V4JA 3T1YF 1G6BA 2OJ3A 4YY3J 3SQGA 2HHVA 1T3OA 3TVKA 1KOHA 3DLHA 5KFIA 4A8SA 3FZ2A 4ERDA 4P2XA 2VA3A 2B4VA 3BH6B 1OQ3A 1GH8A 5KT3A 1J5EF 4O3OA 2MYFA 4MKVA 1X8DA 4RUHA 3WHIA 2E66A 2FVCA 3D7SB 1M5PC 1JKHA 2JNJA 2L9WA 3V2UC 3W9IA 3T1HJ 2NYHA 3MOZA 3CJ4A 4X65F 3HKZD 1XJWB 3M2VB 1K9MT 1U6FA 3T5KA 1EIYB 3MUMP 2VFSA 2MY7A 2PEHA 3BDPA 4ZIWA 2G1HA 4M1KA 2V5HG 2LEAA 2FZCB 4OHYA 2CQ1A 1Y5IB 3ZC4A 2V68A 3OVAA 3NKYA 3MM8A 1HI1A 4TU9A 2DXFA 2RSQA 2IVYA 2K1RA 1LWCA 1N4LA 2CPXA 4PPZA 4QCLA 2YWEA 2YWFA 3PR5B 2OIHA 4MIAA 4F8RA 2B6AB 2OHDA 1IKXA 4R5PB 4TLQA 1APSA 5HJXA 1N8RT 2ZUGA 3SCKE 4OYPA 2RU9A 2GFFA 5KFJA 1HNWF 3KOAA 3RRHA 2XGQA 1TFYA 4A8FA 1NK4A 3IG1A 1CQMA 1YZ7A 3H20A 3TZXA 3LH2S 1HLWA 4A4JA 1BXNA 1KP6A 1KOOA 3SSRA 2VPYB 2ZOGA 1SKRA 2FJXA 1S49A 3T5HA 3OV7A 2ZH7A 4GKJF 3R6GB 3DMJB 2VKZG 1NSKL 2AT1B 1NK5A 3IBFB 4CLPA 2XCPA 4ECXA 1GX5A 1X5SA 3K8WA 1U1LA 4UZBA 2V9KA 5EWFA 3PO5A 2BQUA 2KXFA 3PM9A 3M2UB 2MZQA 2WSEC 2GZOA 3N6MA 3ET6B 2ZBCA 3DRRB 2EKNA 3KMQA 4ETXA 1VGYA 2O67A 1OSDA 2UVVA 3H25A 3PW0A 3PYFA 3KLGB 4QU6A 1ZM3A 2R7VA 2LCWA 1CVJA 5KFRA 5C42A 3LP0B 1RTHB 2E5HA 1QY7A 2B8QA 1RUSA 2PEBA 4C0HA 1PYTA 1FWPA 2YNHB 2J9DA 1QSLA 4IG0B 3ITHA 4I56A 3KG1A 3TZYA 4DV5F 3AJDA 5IWAJ 5K9FA 2FTRA 2IJRA 1VDHA 3AA9A 1CJVB 5LMNF 3QAUA 3ZTSA 4S0MA 2XS2A 3K58A 3GYXB 4KHPJ 2CPZA 2J8AA 2KG1A 3R7BB 4K5SA 4PQUA 5EUHA 4L3NA 3QJJA 2KFZA 1U1NA 4LMZA 2QLBB 4UOFA 1M1KT 3T6JA 5I3UA 2Q79A 4N77A 3SIPB 1X31C 4DV7F 2OPQB 2GA7A 1UEUA 4MJKA 3TUIC 5E33A 4DV3J 2DKOB 2RHSB 4OYMA 2NXCA 4KT0C 1MROB 1H74A 2LQ9A 4DR5F 2OTLS 1DBDA 2PFDA 1DTQA 4ECUA 3FCWA 1X0FA 3BYRA 2VHGA 3CJ5A 1OJ4A 3N01A 4QR1A 3CCUS 1N6QB 3E51A 1EP4B 2XMKA 3R5CA 4AFFA 2HRYA 4PWDA 2CPJA 1YJWS 5CXTA 1TL3B 2IBKA 4PXEA 5CA5A 3W2WB 2OPPB 4ZJOA 3SBMA 1JK9B 1X5TA 2CZ4A 2GIFA 1HWKA 1ACMB 2N4DA 1R0BG 4DPOA 2V34A 1YG0A 1JLAB 1JIHA 2IJNA 1BQMB 2HMIA 2W9CA 2ACYA 3ZFVA 2J6UA 2HVDA 4UQGA 1NNDA 3DOKB 3N6LA 1EETA 2LEBA 5FD1A 5ETRA 1TKDA 1NDKA 2GAGC 4DV4J 3W62A 4WFZA 2DGOA 3CVKA 4K2XA 3VQTA 1U2RA 1YJTA 4ZVSB 4C2MA 3RTVA 1RWMB 2FC8A 3K57A 2H51B 3RUBL 3DRYA 1URRA 3V6JA 3M6XA 5B08A 2DEJA 4OX8A 2LA6A 1YHQS 2Z2ZA 4DFJA 1Q86T 2HW3A 3UW1A 3AD9C 3DKDA 3M8RA 2A2CA 4QJVA 4QWCA 1SVDA 4MYTA 2RRNA 1U1PA 4UT4A 3M2RB 4DI6A 3BJYA 2RKIB 3DOLA 3EXCX 1HNIA 4F67A 3PKMA 5M2RA 4FPIA 3B54A 2EBEA 2ASJA 2JFKA 2MDAA 3CO0P 2E44A 4Y6IA 2PI5A 3M32A 1FNXH 3HVTA 4C11A 3MXHP 4J9MA 1N33F 1S0NA 3J80Y 3A3PB 4C3MA 1ZYQA 4DSJA 2V94A 5L1KA 4B3SF 4ED4A 4UUXA 2XY5A 1JLQA 4OYOA 2LA4A 1S1XB 3CC2S 5IQQA 3MR5A 1NH8A 1UP1A 5AJ3F 5IC6B 1V5VA 1BHNA 1YQHA 4CI0B 4KRWA 2F63A 1NPRA 2HWTA 3J7ZT 1SJRA 4USWA 4P9SA 3OXFA 4EI2A 2AX0A 2RDDA 5DS7A 3MPDA 3IRXB 4B3MJ 2GO8A 2BXJA 4B3RF 2QEXS 3MR3A 1M0SA 4WKYA 1SKWA 5CQGA 4FP9A 2WSFC 4ES2A 1KC8T 1WDTA 3DRPB 3NMAA 2H1YA 4H4OA 1JLGB 3DFEA 5CABA 3I6PA 4MAKA 4RUCA 1KVKA 1RT5A 2AYGA 3DM2A 4I2QA 2PN6A 3G6XA 2HHHJ 1C1BB 3LP2A 4B9VA 2HAFA 1UWAA 5LSRA 4AL5A 2OPSA 3MOJB 3G6ES 1TL7A 2KYZA 1VQNS 5EN1A 3D1HA 4CO4A 5DG8A 3WBZA 5KFHA 4NLQA 1VHIA 2ZJPQ 1FVSA 2BE7D 2B5JA 3Q8RB 3VAHA 1UL3A 1HBUB 1IBCB 2OKQA 1RP5A 3S8SA 3V6KA 1NO8A 4CLZA 3W7BA 2CXEA 2HAIA 3FFIA 1YJ9S 3CW2C 5HVGA 2OTJS 1M5SA 3DYAB 2GIRA 1QE1A 3QATA 2QFIA 4IFYA 2AWZA 4X4TA 3O5TB 4DX8H 4RNOA 2YH1A 3E8OA 2B43A 3KWMA 4NMXA 1S5ZA 4Q45A 1BQNB 5DLGA 4FZVA 3EX7B 4JI5F 1NLKL 2ZC4A 5HQMA 4ID8A 2U1AA 1S6QA 4B02A 2W9BB 4J9KA 3DXSX 1PIEA 1I6JA 1NMEB 4H4KA 4HHHA 5IFMA 3PG9A 4ZLPA 3OHBA 2QSWA 4OJ3A 4IRDA 3PYDA 5HVHA 4IFVA 2EKYA 3HMJG 2UXCF 3FDSA 3JSMA 1HR0F 3TX0A 2V50A 2CIMA 3SZ2A 4DN9A 4C8LA 3PJ9A 1HD0A 2A3JA 1CLFA 3VZHA 3TJAA 1XERA 1V3SA 4WIQA 5D8HB 3UVJB 4NYOA 4DUYJ 3IAM9 5F0UA 5T41A 2WONA 4DPWA 4EWTA 2BKNA 4DL4A 1PO6A 3G71S 4QZVB 2KRBA 2YKNB 3T19A 4NA1A 4NLPA 3TNVA 2B4OA 2CYYA 2C3PA 3MM7B 1IR0A 4Q8EA 2IMOA 5LMUJ 4AE5A 1J5OB 3Q8PB 1VQOS 1Q81T 2LXUA 2LDYA 3CCRS 1R8AA 2B9YA 2W2NP 2PA8D 3GYGA 1FA0A 2QA2A 2HVZA 1UEKA 4BDPA 3LP1A 1LFWA 5FDLB 3MWBA 4DX5A 3ULHA 3NLCA 3TA1A 4D3GA 1E6VA 1GK8A 1SIWB 1RWWB 3KXDA 4MFBB 1U0HA 5DM6Q 4OHWA 2NCKL 5KFYA 2CQDA 3DU6A 1O51A 4Y2AA 4DG1A 1TK8A 2VFUA 1E6YB 4LVNP 4RBUA 3Q8VA 2LU2A 2G2YA 3JSYA 3CJKA 3MM6B 1CULB 2PMWA 4ELVA 3RBXA 8RUCA 3O8WA 3TAPA 2HK2A 3MECA 1P1LA 2RVJA 3BQ0A 2VQFF 1Q5VA 3MEGA 1OYEA 3CJQA 2R7SA 1X60A 1B0PA 1N48A 4DR4J 1W25A 5CYQB 2QRRA 3JQMA 4O0IA 4UUWA 4F3OA 1R3NA 1S0OA 4ATNA 2I38A 4CP5A 2A6MA 2CWKA 2VBXA 3BSOA 2CFXA 3K5MA 4NLWA 1TVRA 1YGYA 3MZIA 2BJDA 2R7RA 3H0PA 3TYTA 1HNZF 2IYIA 4ZP8A 2QGFB 1RGVA 5IS2A 2HEKA 3H5SA 4B9MA 1WHWA 3GCWP 4F50A 3ENVA 1T7PA 3EZ5A 4FBUA 3HD1A 1SUQB 1YKWA 4UQTA 4LF8J 4GVBA 2D74B 4QIWD 5LXRA 7FD1A 2ILZA 3CDBA 3RZAA 5FIIA 2OEKA 1RTIA 3MI7X 2UXDJ 4U7UK 2Q3PA 2MHNA 3UCUP 5K8MA 2HNDB 3TQ1A 4LFCF 5LL6d 5B0DA 3QSIA 1RBLA 2O1PA 1VR6A 1TL5A 4P71A 4OJHA 1BY9A 2HFOA 5HLFA 3MPWA 1KN6A 1WSRA 5HN0A 3CXCR 1SJ1A 2GQCA 1FERA 2R7WA 5ETTA 4WFBQ 1X5OA 2GO9A 4QPTA 2VJVA 4OIXA 4C9DA 2XTJP 1I94J 5GADI 3SCLE 5CD4H 3R1LA 3EVWA 1JJ4A 4ZVUB 4Y3CA 5DDQC 1DLOB 5AE2A 3CC7S 2XNRA 4N41A 5J2NB 2JSXA 2ZWPA 2UXBF 2DXDA 1MG7A 2X1AA 2W4DA 3QPIA 3KJVA 5KTQA 2AJ4A 3E3XA 5EHHA 1S1TB 1N52B 1JLFB 4F3QA 1CJKA 4K0KF 4LSLA 1A0OB 4LFAF 3HKWA 3IR7B 1B4SA 4PXDA 3NNAA 3UD5A 3MHYA 2D3ZA 3QWUA 4URQU 1IM6A 3S01A 1DARA 1SI9A 2IC3B 4ZPCA 1FK9B 1YITS 3UN3A 1XC9A 2HG4A 2FLPA 1OWXA 2R8GA 2I8EA 3KLHA 5KG3A 1X4HA 3MEEB 4DR1J 2BKPA 2LKZA 3A8EA 3N28A 4IO9Q 4OHZA 3BR9A 1LW2B 1PG5B 2CAJA 2UUBF 1RXOB 4K2JA 1T9WA 5CYMB 1TK0A 4G1QB 5E0OA 5J2PA 1LWFB 3CCVS 1M1HA 3CCLS 1YBTA 2DITA 3O2IA 5KFKA 1HARA 2VFTA 4H54A 2HBYB 3MAAA 5U47A 2DNYA 1N36F 2OSRA 4DS5A 3EGWB 4TY8A 5B0GA 4RBVA 1IR2A 4FVCA 2CPFA 1WG5A 3OTOF 1IN0A 2VUGA 3R2DJ 3KTQA 3HX9A 3TEHB 1W26A 4J90A 1I5OB 3MM8B 5K14A 3C3LA 1NBEB 1S9FA 2M70A 4OX6A 1MWQA 1T9YA 2F65A 2K1RB 2CQHA 2NPFA 4M5DA 5C7PA 1KQGB 4PG5A 1O5JA 1UEVA 4P73A 2HBQB 3POTA 4F25A 3KLIB 3BQ1A 2XULA 1S1UB 4EO8A 4F4YA 3VWSA 3I87A 1WOOA 1XMOJ 2VQEJ 5HAOA 1GFWB 1ZA2B 3FKBA 4Y28C 4ZN3A 1XMQJ 4N5SA 3A8JA 5A8KA 3EZUA 3GYNA 1KKHA 3ZZTA 2Y0BB 3HHDA 4IOCQ 1DFDA 2Z56B 1N88A 3D4JA 3A3OB 3QT5A 3GIRA 4ED2A 1F3FA 2HQIA 2JX2A 1SIZA 2HRUA 4X2BA 3EDRB 1IUJA 4YFUA 3VAMA 5JVGQ 2E29A 5HO4A 2GJ2A 1MW7A 1MN7A 4LF5F 2R8HA 4DN0A 3FNNA 1D8YA 2AEJA 1F9FA 1JLBA 2YNGA 5GMEA 3DN9A 3HHEA 5IXUA 2ROEA 4N56A 3RAXA 5L1IA 2MLXA 1KS2A 4X4VA 3T6BA 1UWBA 1UVKA 1U8WA 2A18A 3GB0A 1UTAA 1NKEA 3C16A 3D6TB 4DR7F 2RF2B 1JMTA 4J9NA 4JV5F 1JB0C 4ELTA 1R0AB 1D8ZA 3M6VA 4KSEB 2QIFA 2VG7B 4DLEA 5HMZA 5KAKA 3SV4A 1WORA 1FRLA 2O66A 3PACA 1I3OB 4I64A 2CG8A 4W90B 2DISA 3NXZA 1DTTA 1WF2A 5K8PA 2PA3A 2QN6B 2CRLA 1F5CA 2KJVA 5CCLA 4B3TF 4ENOA 4NZ6A 3T9ZA 2C2EA 2DGUA 4RW9B 1L3TA 3W9JA 2UV8G 1VBXA 1UFKA 1W2BR 2EK6A 3DC2A 3DLEA 1B99A 5GAEI 3OTDA 4O4RA 2F40A 3DLBA 4DQPA 5IT0A 1NXIA 3MCNA 5E41A 2MKIA 2VBYA 3TO8A 3IGNA 2B4PA 3R1HA 2F8HA 2YPYA 1U25A 3TR5A 5HMWA 1IKYB 3DRXA 2F3JA 1SH3A 1LOUA 2FZKB 1FRXA 3BGRA 1LNQA 4C4WA 2K7KA 1D1UA 5F41A 3IR6B 4F3MA 4ZCMA 5EDWA 2KRRA 1NK8A 2JZ5A 3IR5B 3CO9A 4Z2XA 3MPUB 1I1GA 5KT4A 1EAYC 3HSZA 4CZCA 5HJYA 4AL7A 5H9FK 4HACB 1VRUA 4WPAA 4P75A 1C4AA 4MKBA 3VAGA 1Q95G 4F4KA 3NCRA 2D69A 2KT3A 2CNLB 2VC0A 2AW0A 4Q2MA 1DRZA 1KDNA 4PWDB 1C0TA 3M8QA 4DR2F 2JWNA 2MJNA 1UETA 3D2WA 2XS7A 1YJUA 5C24B 4V19J 4LSZB 2JDJA 4A8XA 1U7LA 4ZHRA 2PT0A 4C97A 2V4RA 4XIUA 3KHGA 2IVMA 2LQ5A 1DURA 1RWPB 3LWMA 1IBMJ 3Q89A 1A9NB 4L6V3 1JLEB 1EETB 1TP7A 1XTZA 3HFVA 4XAKA 3PIOQ 5B0CA 3J7YI 2L08A 2FJBB 1TZ0A 2DHAA 4JI7F 1NB2A 1KVJA 2C28A 1NH7A 1PJ5A 1JLCB 3HHLC 2HHTA 1UVNA 3G82B 5T7LA 3HPOA 3VCDA 2CQCA 2KO1A 2ZH2A 2CPDA 1BQXA 3EYZA 2Y1LB 3GFYA 3ZNUA 1N5SA 2WCXA 1EHWA 4NLVA 1RT7B 2DNZA 3NS5A 3QO9A 1K73T 3EGZA 2A10A 4WZQA 2GVDA 1IKVA 3IBCB 3UPFA 3V4IA 5C2CA 1OMSA 3AQPA 4ZCIA 2YQ1A 3N4WA 4R0EA 3KK1A 1C0UA 3NS7B 3SI8A 4N47A 4F4WA 4ZVQB 3ILLA 4RKUC 3ENQA 4O3QA 2KM8B 2KDOA 3LALA 4CT9A 2HWHA 5IZHA 2ZBIA 1U49A 3BGOP 4O0NA 2FJWA 7FDRA 1FX2A 1MNEA 4DV1F 4RR5A 2BABA 1NM2A 2XLKA 3BREA 1WF0A 3ZTQA 1RLCL 1JLQB 2Z2MA 3RB0A 4ED0A 1GMUA 4I0WA 3J80U 2MKKA 1HHTP 3S1TA 3M2VA 2ZBQA 3W61A 2F5GA 4X66F 3CDEA 3B4MA 1EJ7L 4LUBA 4K7QA 4LRBA 3HT0A 5F3ZA 1RJJA 1R7IA 1RT5B 3CJ2A 1JWWA 3PCOB 5H9EJ 3IC1A 3DM2B 4I2QB 3RG6A 4LFBF 3TJ8A 2BRLA 2GJFA 5ITHA 1BMQB 3MMBB 1XIQA 4UOHA 4GVLA 3EGVA 4NEYA 4BC9A 1RWOB 3AHPA 5A2QY 1VRTB 4FYVB 5KFWA 1IWGA 3EJMA 2MQNA 4RPFA 1SJFA 4DMZA 4TQRA 3RBDA 4JI4J 4R5PA 3FSYA 4PABA 3ZZRA 5KFFA 1S9EA 5RUBA 4K8RA 1Y00A 4DPXA 1WOPA 4JI8J 3SSSA 2FHJD 2BJ8A 1R8PA 2V2QA 3FFIB 1H7XA 2EC0A 1F2GA 1H98A 5KT5A 1QE1B 3T1HF 2WTFA 3SFUA 4FDFA 4U8VA 3DMJA 4E98A 1B7FA 4MIBA 2SXLA 5D3GA 4F7VA 1VLYA 3J7YU 4LT6A 4DJBA 1UKUA 4OYBA 1K8AT 3IWLA 3AD7C 1WEZA 3BN4A 4NCBA 4F0KA 1KWMA 2JLGA 2C2NA 1LWEB 4B9TA 2EXUA 3M2UA 2RUGA 1U1OA 2DO0A 2HGLA 3GG0A 1RTZA 3OL6A 4KHMA 2EG2A 2W24A 3JSMB 3F73A 3OR2B 3I55S 3R2CJ 4OZ5A 1S1WB 3KLGA 5FJ4A 2QL5B 3JTNA 2N7YA 4DF4A 1IR1A 1T0TV 2H4WB 3LP0A 4KV8A 1RTHA 4CRJA 1FRMA 3K8VA 4P10A 3PW5A 2D7SA 1AXQA 2YNHA 2WONB 3LPYA 2XGPA 4IG0A 3IWXA 3OSNA 2EC2A 3FZBA 1N0VC 3OJSA 1NDLA 2I2YA 4PXCA 3DRSB 5E3RA 4FF1A 2LEPA 1X4GA 3F41A 4MK7A 4QWAA 4DV2J 4F0MA 1L3VA 4J91A 2CKWA 4NMLA 4QU7A 3NGSA 1AUDA 1VBYA 3NEKA 1O6XA 1CJVA 2CJYB 4XPEA 2I5JB 1SJ4P 1D9AA 4EZ6A 3RJMB 2WSCC 4ZP7A 2GQQA 2UUCJ 3OXLA 2XC9A 3L7PA 3HVRA 2IM3A 2A1BA 3UN2A 3HZGA 3GSIA 1SC3B 2K06A 2W9AA 4DG1B 3QZ8A 2QLXA 4E0DA 1V5IB 2NS1B 2C3YA 2XMAA 2OPQA 3D54A 3CJKB 1FNOA 3C6TA 2R2UA 1QSYA 3DLLQ 1MROA 3MECB 3PR4A 1NUEA 4CT8A 2WVEA 4H4MB 1GTEA 2FD2A 1HI0P 2DNHA 4J9QA 1BD6A 3MEGB 3AOCA 3QT6A 5IT9Y 3V4MA 5HSPA 4NXNF 3ZTPA 1N6QA 3EICA 3GJTB 4U95A 2CQ3A 4USHA 5KFAA 1EP4A 3PTWA 4JV2A 1NKCA 1HKAA 2Y9HA 2ZOMA 4YHHJ 5KFXA 3CB4A 2BOAA 2N4CA 4PWUA 1TL3A 4JI1F 5I3QA 2MKYA 5IQ6A 1REGX 2ZUAA 3W2WA 3MMAB 1HL6A 2NZ4A 4JUZA 3SEOA 5H1SV 4PKDB 4RJVA 4PZVA 5E5NA 2Y8YA 1XR6A 1Y9OA 2KXNB 3VGVA 1BQMA 4RUAA 2KXHA 1XR5A 3TUPA 5G4DA 2FQQB 4F2SA 1XQIA 5DQGA 3DOKA 3BYPA 1U2FA 2VH7A 1LEOA 4CYUA 1MU2B 4URSA 5J2MB 3HM9A 3I9V9 5K8NA 3BH7B 3V6HA 2XBPA 1RTIB 3RYLA 1FTCA 1XNQJ 1CPZA 3UDEA 4DV3F 5E3PA 3RRKA 4F36A 4CDIA 2QO3A 1U02A 1ZZNA 3I96A 1Y0HA 1Q82T 1JNZB 3HI9A 2NPIA 4QR0A 4PPDA 1VYAA 3BO3A 4RZRA 5MAOA 1L3SA 2HLTA 4R25A 2KFYA 4C6AA 5I3PA 2LP4A 1WHYA 5MLCV 3GJSB 2C3UA 4TVAB 2AEMA 3OFEA 3M2RA 3QBCA 4I7FB 3PEHA 3UDLA 5DDOC 2P2CB 3MDFA 4JV0A 4N8OA 2RMLA 4X65J 4EZ9A 2IYGA 3NG8A 4UW2A 5DQIA 4EEYA 1WG1A 1PAUB 2HFVA 2XO7A 1VFJA 3M8WA 5IV3A 2E1RA 3PW4A 1K44A 2G0JA 2JVRA 2GV1A 3O44A 2V0NA 3R8YA 5AXMA 3LOUA 3KJVB 2NZCA 2X1GA 5BYQA 2RE1A 2CUYA 3PEJA 4JI3J 2JOQA 4M5NA 4JI2J 4ILLA 4DV4F 1S1XA 1YWXA 2HSEB 4L76A 1P27B 2DGXA 5LJ3Y 4QIGA 4LREA 5CYJA 4KHRA 1HQUB 3DXBA 2I0XA 2KYXA 4OLPA 1HYSA 4LF7F 1B0VA 1RAGB 1XBWA 3IRXA 3W9HA 5KG1A 4FXVA 1YBAA 3L9ZA 3ILIA 2ZH4A 2Y0SD 1U1MA 3K5NA 1S10A 3KLHB 3DLGA 2DVIA 2J7KA 2LMIA 2XMWA 3K0JA 4ZVTB 3KUEA 3CCTA 1C1BA 1TKXB 2K2PA 5HK4A 4ED6A 3QAEA 3W5XA 3UCGA 1TK5A 2R7UA 2BW2A 1HBOA 4GKJJ 2GIQA 2GX8A 2E7VA 2WVCA 3HSJA 3JYTB 1HNXJ 2E9RX 2BZ2A 5J2PB 1VI7A 1HBUA 4RLEA 2HPUA 2CPHA 4ZPVR 3FEXB 4FBTA 3AA8A 5EWGA 1FDDA 2JL9A 3OL9A 1Z1ZA 3KHHA 3HK2A 3CJTA 2NR0A 2HWIA 4DV0J 4OI4A 1S12A 3QYYA 2RUSA 5E3AA 1M1GA 3AJ2A 5IM0B 4F0HA 3KJNB 3QT8A 3CJRA 5D4PA 1U47A 2ZH3A 3TP2A 3PW7A 4PWWA 4EMDA 2W8KA 2C3MA 2ASLA 2ASDA 3IO1A 4Q8FA 1QVGR 2W9BA 2RJZA 4NLXA 2IRXA 3POTB 2BA9A 1NPKA 2HHHF 1XNRJ 4AL6A 3HVAA 3THTA 3CC4S 3B82A 3ONQA 3I0SA 3Q8YA 3FQLA 2LECA 2HQGA 3H98A 4USMA 4USIA 2M7SA 3OFHA 1HI8A 4CH0S 5LMNJ 1X7VA 1F6TA 2MJUA 1VJWA 2BJ9A 3EPIA 2CVIA 2QC3A 2JLEA 2WW8A 2VDIA 5M2PA 2XMMA 1RABB 1YJVA 2DR9A 2UUAF 3G87A 4K4XA 2YKNA 4USKA 1UW4A 3MM7A 4Y2CA 3M7VA 5DDRC 4DV7J 4BLGA 1AB8A 1NK7A 3EGNA 3AOAA 3HT3A 1WD6A 2NXUA 4IDKB 1YRTA 2DNMA 1KONA 4Q44A 1HWLA 2GAHC 5FDLA 3MR6A 2NXNA 2ZBRA 3D66A 1OS5A 1SC6A 4MFBA 5C25B 4PRFA 4JYAF 1DAXA 2ZC3A 5D6GA 5F8NA 2UUTA 4LF6J 4P7TA 1FRIA 4XO0A 1XK8A 2IMWP 2G0CA 2NXJA 3I5CA 3H8YA 3VAIA 3MM6A 4P72A 1AW0A 3JAMY 1WOSA 3MURP 2Y1JA 3HCXA 5DZ7A 4ED7A 3I0RA 2YXLA 4NXMJ 4LRCA 1D09B 3D67A 3ZTOA 4KGVB 1TL4A 1FDNA 1RWKB 4LRFA 2UVRA 3D6FB 1H2TZ 3P5TL 2FVQA 2YNFA 3Q24A 3CD5A 2C2RA 3D6MB 5CYQA 1RAIB 3I5BA 3NNHA 3VALA 5CHCB 4ALZA 2XMJA 4DHVA 1RSCA 3PX4A 3R5JB 2HZAA 4OV6A 3LPEA 2DNLA 3ISZA 1QTMA 4V19X 5KFPA 2J0XA 1R89A 3LW5C 4K50A 2W4CA 1RWXB 2HBZB 3G8SA 1RHRB 1UA1A 4WYWA 3UCZP 2C2ZB 1Y3JA 3H4BA 2C22A 1G4CA 4O3RA 3GIMA 2BQRA 3CUNA 5T14A 1SKUB 2RDJA 2LYVA 1T05A 4TY9A 4ZVGA 3G9CA 1VRUB 2HNDA 3P45B 2W2PP 3ELHA 3M4XA 5JJBA 3S6EA 4DX7A 4ZLLA 4ICLA 4DR6J 1C0TB 1VOMA 2I1RA 4DR4F 3V81A 3FRYA 1NKBA 1WC3A 3VVUA 4LJMA 1UPMB 1IBKJ 2UU9F 5ETPA 2YWHA 2ZZNA 4ECRA 4WU2A 3HULA 1Q16B 3UD3P 1JX4A 3D1OA 3CCJS 3MR2A 4NLTA 5IC4B 3TAQA 3I9ZA 3TW0A 2FPHX 2FLLA 5KFQA 3D0HE 2QTWA 3GIJA 3IN5A 1IKWB 2M5YA 2NSCA 5J2NA 2W8LA 5IV4A 3U1LA 4IKAA 1HWUA 5LSLA 4LF8F 1V3ZA 1S1TA 4RX6A 3DHWC 1YIJS 3A1YG 4OX7A 5JVHQ 2XY7A 5B09A 2RQCA 4DCJB 3NGTA 4KJIA 3TEGA 3C66A 1EQMA 2UXDF 3FRZA 2CG4A 3VAFA 2WOMA 3KJFB 4P52A 4RW4A 2HYIB 4UY85 3TARA 3EM1A 2PD1A 3DU5A 2JLFA 4RW7B 1L5UA 3P49B 3GSDA 4EYHB 1RWUA 1VK3A 1IKVB 3W2VB 1FK9A 3UWTA 1X9SA 4DQSA 5F8IA 2YQ3A 1R8CA 1Q7YT 3MEEA 2BANA 3VF0B 3Q22A 4CNZA 4FKYA 2J8SA 5HROA 2RB7A 1I94F 1X4BA 3HFKA 3RU0A 4CO2A 1A7GE 1LW2A 1QD1A 3EVOA 4RNMA 3W66A 3IAS9 1DQ8A 5CD4A 5CYMA 2N7CA 2G4BA 2MSTA 1FJ7A 1GXTA 3AODA 3FC9A 4G1QA 1LWFA 1EX8A 1HQEA 2HHXA 3LWLA 5L9NA 2OGUA 3Q2SC 1FDAA 2FY1A 2C2MB 4DSFA 4O3NA 3THVA 4CLUA 2AX1A 3K59A 1N0UA 2D3OR 1IWAA 4C7QA 3BR8A 4PG7A 3J81U 1NJWA 2IM2A 1TMJA 1RA6A 2UXCJ 1RAOA 2VL1A 2I6WA 3BQ2A 1RAFB 5AE1A 2O01C 2UUWA 1DY3A 1QAXA 1OYDA 3G2XA 2JJ4D 4X4QA 1LW0A 2CVEA 2QLFB 4D3HA 3C2PA 1SH0A 2AV5A 2QL9B 1PKUA 4DPTA 1TKZB 2P5VA 1UZHA 4AUKA 2P9CA 2L41A 4DPUA 1I51B 4DR1F 1CC7A 1T94A 8AT1B 2LU1A 1B7YB 1H2VZ 1D0EA 4AT1B 3OLAA 3KLIA 4YR2A 4FYXB 1RU1A 4ZJLA 1S1UA 3RR7A 2AF6A 2D3O1 1S9EB 4GRSA 3DDKA 3BKUA 4KFBB 4ZOSA 2VPXB 4MK8A 2XS5A 2NLWA 2DR6A 3SQOP 4GO5X 3M8YA 2OFGX 4IOBA 2CJKA 3ZZYA 1UJ6A 4LF2A 1ZTTA 2V9WA 1F5AA 1GEHA 4FNIA 3X3UA 3QRQA 5F8GA 3Q23A 3QGPA 1CG2A 2Z0GA 4LQ9A 4IH7A 3CJ8A 5D3GB 1QTNB 1S79A 4Y2MA 2RQKA 5B0FA 4RU9A 2RAQA 1HQ2A 2R8JA 1M5HA 2JC0A 2BE9B 2W2MP 4HT7A 3NL0A 2ROGA 2CPIA 1BWVA 2AJ0A 2JEGA 2DHSA 3ISND 2VU5A 1NAQA 3MD1A 5CZXA 4TLRA 2WK4A 4K5RA 3OXGA 1U1RA 4J37A 4J9RA 4LSNB 2RF2A 3RW7A 1S1VB 5GMKa 3L95X 5KG5A 1HFEL 1R0AA 3GQCA 4A47A 2DCLA 2VG7A 4DUTA 4KV8B 1F1BB 2MQLA 2ZITA 1XMOF 2VQEF 1HNZJ 4X4OA 1XMQF 1W2IA 4G3IA 2PFFB 4ZA1A 5DRKA 2PSZA 3RB3A 4J9UE 1VQKS 3K5PA 3A4TA 1QJHA 3TWZA 3A3NB 4M5GA 1RT3B 2BX6A 2M0GB 4O3SA 5EWEA 4RW9A 1N5YB 2HQCA 3CD7A 2OSQA 3JB9k 3EWGA 3VTIA 2VIHA 1CJUB 4OMFG 3M8ZA 3R5AA 4X4PA 5GAHI 2YVSA 5AXNA 9ATCB 3G6YA 1IKYA 2KT2A 4FKXA 1IBLJ 3AXMA 1WNEA 3ZZPA 3MM9A 3R27A 1FVQA 2YKMB 4AXIA 3TZWA 4CM0A 2W25A 3I4PA 2G2ZA 3C6TB 1UVLA 4MYUA 2YX1A 1N34F 3GFHA 1RACB 1ROFA 3CD0A 1MWZA 3NRBA 2XWXA 2X51A 4DEZA 2XYGB 4TU7A 3QRRA 4F02A 4HACA 4DU8A 1YX2A 1FFGB 1EKSA 5DG9A 1NJZA 1JJCB 1SL0A 3KLEB 1GQEA 3KLFA 4JI6J 3MMCA 2UXBJ 5IT9U 1RHMB 4ZVHA 2HFSA 2G0IA 2CA9A 1T9TA 2DBBA 4M5MA 5C24A 3Q8SB 4OI0A 4DCOB 2DPIA 3P4UB 4LFAJ 5KFMA 4DBQA 3CNQP 2QT7A 1FRKA 3AQOA 1SPBP 3FVYA 2IY5B 2DB1A 1N5QA 2R7XA 1CS4A 2IRUA 4HKQA 3BPDA 4I67A 3EZOA 1JLEA 1ZOTA 3Q8QB 2NXEA 2AEFA 2XQCA 1TL1B 4CYUB 4CTAB 1BGXT 2C2KB 2MXYA 2QSFA 3NWRA 2ZD1B 5HVFA 1H0HB 1JLCA 2AYBA 4NRUA 2HHPA 4G65A 2XNQA 4URGA 1RE1B 3G82A 2BJ1A 4KGZB 3GIKA 1S0VA 1XWLA 2ZKTA 4X4RA 1G2EA 1SC4B 3PYGA 5B0BA 1RT7A 3TANA 4B9LA 3P3DA 2AMCB 3U27A 1WEXA 2E9TA 5D4LA 2EBGA 2H5EA 4ECYA 2XLJA 3H7HB 2RQ4A 5ADZA 4HL9A 1ZM4A 2DK2A 4USVA 1FRHA 1N32F 5F8MA 2EI5A 3HZEA 3OTOJ 5J1EB 1IBMF 3G8QA 3LGHA 5KFEA 1WHVA 4FF4A 3C46A 4ZJQA 1RU2A 3NCPA 3NY0A 2DIVA 2YX4A 2DNNA 5JMNA 3UI3A 3N79A 2BDPA 6FDRA 3ZO7A 4TXSA 3D0IE 3FK4A 2F4VF 5GAHU 1HYSB 2CDRB 3OVSA 4KPCA 3DI6A 1C2PA 2ZH8A 2DGWA 3PKYA 2B8PA 4YB6A 2NREA 1EKRA 3E01B 3DLGB 2X1FA 1M5VC 2H54B 3W5YA 5HBMB 2CQIA 5FLXY 1X0PA 2A2DA 2YKOA 2DEIA 2E7XA 2Q66A 3MMBA 2ZH1A 1KSPA 2KFNA 2XZTB 5D0EA 4YQWA 3G6VA 1VRTA 3VGTA 1VRQC 4GKKJ 2M8DB 4UOCA 1HBOB 1RHUB 4KB7A 3RB4A 2XSJB 4X62J 1G3OA 4OLOA 5D15A 1VQPS 2UP1A 3TVZA 4J7CA 4Y34A 3FQKA 1ZAWA 2U2FA 2DD8S 2VOPA 2GGPB 2H5IB 4NLGA 3J81j 1U45A 4KH1B 2Y3YA 2M52A 3DOMA 1GT8A 2BW7A 3FSIA 4OZLA 2W2QP 3UE2A 1SV5A 4U7UD 3V6DB 1AZSB 4DL0C 2M2BA 3I82A 2MQ8A 3GONA 2R7OA 2ZJQQ 3G96A 2D1CA 4K4YA 3THPA 4TQSA 2B0GA 3CJ3A 4GO7X 3SFGA 5BXIA 3KNGA 3IA0A 3H5UA 4DUZJ 2H48B 4DQRA 8ATCB 2IFXA 1HA1A 1LWEA 3KDOA 5KFBA 2C3OA 4HT5A 3I0SB 4IYQA 4B3TJ 3PXGa 3MCSA 4ZCLA 2J6SA 1IM4A 4ZPTR 4YMEA 1KQKA 3UDVA 3OR2A 2N3OA 1VC5A 2ZNZA 3QGIA 3J7A1 2AGQA 1S1WA 4JI4F 1WJ9A 5L1LA 2IAJA 3PX6A 3GCXP 4F4AA 2ZWOA 2FVSA 3KUGA 4CQ1A 1H38A 3C8YA 4IH5A 4RO0A 2XMVA 2ASYA 1UJ5A 3MAQA 3NMRA 4DQQA 3GP9A 1U09A 4YOEA 2MEWA 3DRSA 4IO1A 3HHLB 3C15A 1RT6B 3L7OA 4X84A 2WB4A 3W63A 1KFSA 4KC5A 2WBMA 4KGKA 3K2YA 3Q0AA 5D0GA 3RW6A 1YK9A 1MMLA 1BE4A 1UZDA 2I5JA 1UPPA 2G2OA 4M5IA 4LQ3A 2QV6A 1CEZA 4ZS6A 4MIWA 3E2EA 3AY0A 4XDDA 5DG7A 1RT1B 1RHJB 1D9DA 3NOCA 3BKFA 2B7CB 4OHVA 1SL1A 4FNHA 4TYAA 2HQDA 5C2GA 3AT1B 1RBOB 1RT4A 2PIIA 4ZVPB 5AT1B 5A0YB 4ZLNA 1W7WA 4ZK7M 2JEFA 1SBRA 4Q0BB 4HDGA 1Q8LA 2CJ9A 4H4MA 3I0RB 5EGYA 4KY3A 1YTYA 4DV6F 1N5TA 2PDAA 4C8NA 3KYLA 4FF2A 3NNCA 4NLDA 2VD3A 1J2VA 4NZ0A 2OI2A 3Q8UA 2YNFB 2GMJA 5EX3A 2A0FB 1KVIA 2GHWA 1S4FA 4KGXB 2IJFA 4DV2F 2NQPA 1P9QC 1IJFB 3MEDB 4DR3J 5B0AA 2BM1A 4TYBA 4ED5A 4JI7J 4A8QA 2KJWA 3KLVA 4NE9C 3O1LA 3MMAA 2V67A 3IXQA 1VQSA 2DHHA 5HP1B 2I9SA 3GILA 4RWXA 3PRDA 3U1MA 4GC6A 2UUCF 4RL1A 1MWYA 4OQJA 3FCVA 4ZVEA 3C14B 2MTLA 1PJ7A 4NLSA 3JS9A 4OJ1A 5L39A 2DRDA 5J1NA 1NHVA 4N76A 1MU2A 5J2MA 4QWBA 4G1IA 5DZ6A 2FHJA 4E2FB 4OZNA 1LK7A 1SKSA 4PCQA 1WF1A 4DCPB 1T05B 4L74A 3FEZA 1EZZB 4H4KC 3VAKA 1WELA 4NCAA 1QAIA 3N6NA 1FI4A 4RW8A 2DNQA 2WVFA 2J9DE 4M8LA 4ICLB 4IQXA 4DS4A 4QYRA 1HBNA 4DV1J 2PMHA 4BBYA 3V81B 1PC4A 3ZZ0A 2MKSA 4I2PA 1H3DA 1KLMA 4LBIA 2YKAA 4YHHF 2ZHAA 1HPZB 1T95A 4I7FA 1H73A 1FXDA 3MAHA 1S48A 2VG5B 2L9NA 3HHNB 1KD1T 1A6LA 1Y3KA 1T9UA 5C5JA 4ECZA 3CULA 1WKLA 3OR1B 1T9XA 2VOOA 2GNKA 2DYAA 2ZH6A 1N5VA 4X66J 4E8UA 1ZBTA 1RT2B 3OFGA 4F04B 4K4VA 2X1BA 2ADCA 1X9WA 1HNVA 4NA2A 4LFBJ 5DGAA 5E3QA 2WW4A 1XNQF 3M9OB 4NA3A 5ETVA 1HQUA 2WOMB 4RW4B 1Q4RA 2CJXB 2AP6A 4DU7A 2R8KA 4O44B 3BBFA 1VCTA 1NZAA 1YVFA 1ZA1B 2IBOA 2FLOA 3SCJE 4Z7YA 4I1TA 4OZ3A 4DL2A 2HRTA 4A46A 3D9BA 1FFSB 4HTIA 2HZVA 2LQJA 2OEMA 3TA0A 2PI4A 2L9DA 3W3SA 2FDNA 4OV1A 2BANB 5HROB 1TKXA 3LAKA 2YQ0A 2ZKUA 2VODA 5ETLA 1S9GA 3KJQB 4P2SA 1YSJA 3QJPA 2P9GA 1ZZFA 3JYTA 4USJC 1Q7LB 1U6BA 1PYSB 4R0JA 4ECQA 1HQEB 1XMBA 2IHR1 1TTHB 2YWKA 2OH2A 2AJ2A 4HTJA 2V8HA 2NSBA 4JI3F 3BF4A 4JI2F 3GV8B 2OEJA 4YB1P 1C1CB 5J2QA 4QOTA 1KHWA 1CBKA 2VASA 5IM0A 5KOWA 3TOQA 4LF9J 2X3GA 1K1QA 5BYSA 1F2HA 5HL7Q 4HYKA 1R27B 4KH0B 4QR2A 1LW0B 1FJGJ 2IM1A 3MTKA 2BUNA 1UMJA 2R2RA 5LM7E 4BWMA 2J9EA 2B56A 4NRTA 3PIPQ 1OIAA 3R5DA 2CADA 3FCHA 1KNZA 3IWNC 1ITPA 4PYAA 4QW8A 4DQIA 1RK8A 4Q2LA 1TUVA 1IVZA 1G1XA 4DZDA 2KN4A 1SC1B 4JOUA 1CJTA 5H9FJ 1FEHA 1ZPWX 1HNXF 4M5JA 1VQYA 2J0QD 2F4FA 5J1PA 2EG1A 4L73A 3MGJA 5THWA 2GJIA 3VGUA 2EFOA 5GADU 2XWYA 1EB0A 4JI0J 2L48A 1SQFA 3QGHA 2A6OA 2FGCA 1NU4A 4Y2IA 2HHSA 3A8KA 2IVFB 3GJQB 4PQAA 4FYYB 1AT1B 4F2RA 2DRBA 2HNZA 1VHFA 4DV0F 4MK9A 3OL7A 2DHXA 4IDKA 4C0OC 3D5MA 2KT5A 3WX4A 9RUBA 2QZ8A 3T41A 3CIZA 3C19A 3QQCD 2K3IA 4F4ZA 4PUOB 1L3UA 3TUZC 2RILA 1TR0A 4PYDA 3OT9A 1HHSA 4NXNJ 3O3LA 5C25A 2V8VA 2RRBA 2QA4G 3BGLA 4QPXA 2HLUA 4LR8A 1GMWA 1FD8A 4YS2A 2DY9A 5IOLA 1XNRF 3CSKA 2PMZD 3ENAA 4YUDA 3IMQJ 1UVJA 2M3DA 4JI1J 1HWJA 1DQ9A 1U8SA 1P6TA 1Y10A 1AA1B 3ZXWA 1Q1KA 2EWHA 1TKTA 4KPYA 1R43A 2DJWA 3R6LB 1VC6A 3UNYA 1Y11A 1ZTWA 2CZ9A 4X4SA 5DDPC 1QUVA 2AZ1A 3W1YC 2KHDA 2E1CA 3AOBA 4WBFA 1U4BA 2B7BB 4ILMA 4AQYJ 4BCAA 4LRAA 2GCFA 2QLJB 4Q7AA 3OBIA 3WZ0A 4J9VA 2MLZA 3FBCA 4ZPDA 3T5JA 3CCMS 2AHOB 4I69A 3MEKA 3KK2B 3CCSS 1H7WA 3HO1A 3MM9B 3BSAA 3PVXA 2OD4A 4KE5A 4LF4F 1F9HA 1UVIA 1FJEB 4LIWA 3P6YC 2VG6B 3EUNA 4NI2B 3D0GE 3NBPA 4LF6F 2B51A 2E5LJ 2IM0A 1U1KA 4MMOA 3ENWA 4B3OA 7AT1B 1OPIA 1RZMA 3GR0A 3R5GA 2J5AA 1FKPB 2FHOB 1X4EA 2F7VA 1RQ0A 3SDEB 4NXMF 2ZEJA 2DT9A 4KKOB 5E7OB 3KLFB 5K5MA 2Z2LA 1P1TA 3MMCB 4EUVA 2KI2A 5JXSA 5BR8F 2V8DA 1CQNA 2QX0A 2AJQA 1RDRA 6FD1A 3LA0A 4C48A 3NGDA 4WE1B 3CDAA 1RKIA 1TV6B 2BACA 4WTOB 2HK3A 1CS4B 2XSFA 1RTJA 3D6HB 3DGPA 3OTBA 2D3UA 5KT7A 1U2CA 3OTCA 3W8GA 1GNKA 4LF7J 1P9YA 2HS0A 1IKWA 2B9WA 2DRAA 1NSAA 4HHUA 2BE2A 2DNPA 5G0RB 2HNYB 4NX9A 2EFNA 1WWHA 5HQLA 2W7AA 4DPYA 4CO1A 1TMMA 2CPYA 5KFTA 1OPZA 4OYAA 4DSEA 4USUA 2MQQA 4LBPA 1Z2LA 3WDOA 4ZITA 3CJSA 4IRCA 2QMUB 2D9OA 4KTQA 4ZP9A 2QL7B 3MTJA 4QIEA 4HH0A 4BS2A 3PHEA 5GAGI 4RW7A 3OUYB 3CMES 1IQZA 2MQPA 1KTQA 5A8RA 3W2VA 4LIRA 1PC5A 2CDQA 2YWWA 4WFNQ 4AD6A 2EFPA 3WIVA 1ZPVA 1WEYA 1ULRA 3KK3B 4YDXA 4DR6F 3A13A 3QFHA 4DL7A 2AQ4A 2OAUA 3MCMA 1S6UA 4O3PA 4ZPWR 1RTDB 3HSGA 4KGMA 4YR3A 1R31A 2MSSA 4YR0A 1IBKF 4U67Q 2EK1A 1G7CB 2FHKA 4QBUA 4DL6A 1PCAA 5CAAA 2HFUA 2WHOA 2ATCB 1F5BA 2R2TA 4Q5VA 1MMNA 1X4CA 5GAEU 3H40A 2HFNA 2V63A 4ID5B 3RBEA 2D9PA 4QIVA 4ES3A 2GHVC 2RD5C 3MPVA 3ETOA 1VQ6S 3UFCX 2DR5A 2HBRB 2RDIA 3GWCA 3DI6B 4C8KA 3SXLA 3ETMA 1RCXB 2FUG9 3NGRA 4CLYA 1FXRA 1MLAA 1T9VA 4WP3A 2KZMA 5D4OA 3QZ7A 2ZZMA 2OFHX 2BJ3A 2JC1A 1FHTA 2HQ3A 3KUHA 3TZZA 4WZMA 4C3LA 1ELOA 1OSCA 2UV8A 2VV5A 2DPJA 3GG1A 2UUAJ 1S6PB 1TKZA 5ETQA 3T5LA 3BS9A 3PNIA 1NSQA 1S6OA 2WRMA 1R8BA 3KG4A 1VMBA 2ZHBA 5FLXU 3WC0A 4KYZA 3HJVA 4RUBA 4YY3F 1B3TA 2HS4A 1KFDA 1U0SA 4ECWA 2E5IA 2GQ2A 2OD6A 1FRJA 5A6WA 2CQBA 4ED3A 1S97A 3M8SA 4KFBA 4L72B 2E1MC 2P6SA 1U6ZA 3BPSP 3BKTA 3DOMB 4EU0A 1QM9A 2ZH9A 2DR8A 1SV5B 4JYAJ 1SQEA 2XLIA 1DHMA 4OI3A 5EX0A 3DHXA 2VPZB 3BBCA 3GV7B 4HH1A 2DIUA 4IRKA 3JXOA 2XO6A 1YBUA 2EPIA 4NLOA 4Y00A 2FY8A 1REVB 2MHEA 2M4MA 4NL5A 3FUYA 3BZQA 3DCAA 1T03B 4N8NA 1F9EB 1QAYA 2KZZA 2FC9A 4XPCA 3MD3A 2CNKB 3MM5A 4ZPAA 3C6UB 3NWGA 2DNOA 1WI8A 2D41A 1RHQB 3CCZA 4JBCA 4B9UA 4LSNA 3DLKB 2VDHA 1S1VA 5GAGU 5D0HA 2OMLA 4UY8T 3HSDA 1FX4A 1AROP 3SYZA 2AJFE 3KNAA 2IAJB 1RAAB 4PAAA 4HI1A 3B6BA 4DZ6A 3CDUA 4I6AA 2FVRA 3AAWB 3JQKA 2E5JA 5KFCA 1YJNS 1P8GA 4ZDNA 4OX9J 3C15B 2HGMA 1R6VA 3VQSA 1NHUA 1FTRA 4YN3B 2CQ0A 2AU0A 2ROPA 1WC1A 1WHXA 1RT3A 4K4SA 2OMOA 3AH6A 1N5YA 2APOA 3PW2A 1ZM2A 4NLYA 5F3TA 4HEA9 2V2VA 3AXKA 4FPRA 3MMJA 3BEGB 1CJUA 2R2SA 1ZAXA 2HQFA 1NJIT 2MGZB 3OSPA 2Q1LA 5F8HA 3P8BB 1S7HA 2XM3A 4QYZJ 4LR9A 3QIPB 4J5OA 1PILA 3CWJA 2YKMA 1HD1A 4MKYA 1FE0A 1RT4B 4IG3B 1SXLA 2B9EA 3TAMB 2OLWA 2LXIA 4OI2A 2YNIB 3LGMA 3UR0A 3N0VA 2QA1A 4OJGA 2NUHA 2DXEA 3OVBA 1UAWA 4TKTA 2UU9J 3F0NA 3MUVP 3ILJA 1WSVA 4NYZA 2BVZA 3EE3A 2PE8A 2RIJA 3DLJA 1Q53A 4CO0A 3NGUA 2E9ZA 3N5FA 1OY6A 3GPAA 3KLEA 1S59A 4C8MA 2ZM6J 2B9XA 3PDNA 5IWAF 3ZTRA 1WKJA 3TI0A 4RNNA 1HMVB 3ZZOA 3LF0A 2R3VA 4YB7A 3BSCA 2Y1RI 4KBIA 4O4GA 1FWLA 1C4CA 1BC6A 2BOPA 1FFWB 2BJ7A 4KHPF 4X64J 2BJEA 1U48A 3MPYA 1X9MA 3QLHB 2JH3A 6AT1B 4WFYA 3HP6A 3NGKA 4WTYA 3QJLA 3IS9B 5KFSA 2MZJA 2W01A 1IBLF 1J27A 1TL1A 3QRPA 4CTAA 2YKQA 1FKAF 2ZE2A 2QE5A 2QYCA 5D78A 2AGPA 3BSNA 2ZD1A 1KLNA 1HBMB 2HVIA 5B7WA 1SCJB 1DZ5A 2AIRB 2DY1A 2HFZA 4RBTA 3IFEA 3S7RA 4RW8B 2E5GA 3T1YJ 2IDLA 4LR7A 2RU3A 3CTRA 3NP5A 4JP8A 2MQOA 2J0SD 2V8PA 4NEZA 3M9MB 2ZHOA 1RA7A 1HBNB 2VBWA 2EFGA 1NZ8A 4CIOA 4ES1A 1J5EJ 4I2PB 1LQ9A 5DO2A 2IA6A 1KLMB 4JI6F 2FIUA 3SMZA 4ED8A 1RYSA 3T1AA 5HMYA 5KG4A 2JRSA 5F8JA 5LJ5Y 4ZCKA 5HATA 1H72C 4IR9A 1YDLA 1VJQA 1NDCA 1KBRA 2RS2A 2MKJA 4OYIA 1UW9A 5J1EA 4W4MA 3RBZA 2J6TA 2MY8A 1GMWD 5F0WA 5B0EA 2ILYA 4ZLJA 1MSWD 4LVOP 4OFZA 4QYZK 3PJXA 3PV8A 2R7TA 2NYIA 1HNVB 2HZCA 5A8WB 3PYEA 4HLBA 2EFQA 4Z37A 3HD2A 1RHKB 4CWBA 3I32A 5A6PA 1F0XA 2KH9A 3R3TA 3D3CJ 2QFJA 3CEDA 4C3KA 2P6TA 4PR6A 1O8BA 4EBCA 5I42A 3GFXA 2V4JB 1QSSA 3SQGB 1V3RA 1VQ8S 4A8YA 2KKHA 4IOAQ 1PGZA 2BEFA 3E01A 2DCUB 4KIAA 1NRKA 1HNWJ 2K3KA 2ZBPA 1WC0A 5HBMA 3PO4A 4NYPA 5ETMA 5D77A 1T3NA 2YTCA 1N56A 1JKHB 4WXWA 4OL8A 3N9UC 2VC1A 4NZ7A 2R42A 1S9GB 3W5ZA 1EARA 2ABYA 3QSYB 2XSJA 1HW8A 1TAQA 3LUYA 3A12A 2IA0A 2GMHA 5M2UA 3RR8A 2ZVIA 2GGPA 2GS8A 5D4NA 2K7JA 2XZDB 4K4ZA 1LWCB 1GMVA 4FXWA 4PG8A 4KO0A 4W92B 5J2QB 2EEYA 1FWKA 2G13A 3V6DA 5SUHA 1AZSA 2YPZA 2YBVA 1U26A 4FXDA 2XYHB 3D3BJ 2YX7A 2POKA 4ETZA 1IKXB 4B3MF 2ZZTA 1KEKA 4J9PA 2RRAA 2QJ3A 2XY6A 5HQ8A 1B64A 3VR1A 4EBEA 4C8YA 4ITSA 1X4AA 2K8GA 1S77D 1Q5YA 1T8EA 2RT3A 3US5A 4QWEA 1RAEB 2FJAB 3IG1B 3X1LB 3UR3C 4DV5J 4DSKA 2ERRA 4DSLA 2DNGA 4TU8A 3QFWA 4GKKF 2H4YB 1RLDA 3UN5A 2JFDA 1CJTB 5ETKA 4X62F 4UZCA 3J7AN 1LV5A 1TUWA 3ISNC 4ELUA 2ACMA 3KFWX 2DH9A 2EVZA 2OELA 1B70B 2KG0A 1SQGA 3R97A 3O6QA 1FKOA 1ZAVA 2DGQA 4MTPA 2XCAA 1WTBA 1RB0A 4Y0FA 1RYRA 3HHLA 2V69A 4F4XA 1RT6A 2MB0B 4DSIA 4J9LA 2GW8A 1VIOA 2HNZB 2GVZA 2QMXA 2LQBA 1WTFA 1M5OC 1DJ0A 2ZVSA 1VIXA 3LGNA 3FSXA 4M5HA 1N34J 3TVYA 1S7IA 4PG4A 3UD4P 4TN2A 4DR5J 5C42B 4ZVRB 2FJDB 2CNOB 3LAMA 3FBBA 2FVPA 1LWXA 2F8EX 3FJ2A 4DUZF 2IRYA 1QDUB 1GX6A 3W65A 3ITHB 1X4FA 1RT1A 4NCGA 5BYRA 5KFVA 4EK2A 3CE8A 1VS3A 2J0WA 5L8RC 3NS6A 5A0YA 2V8GA 3GU0A 5KFGA 1AFJA 1WDDA 1TELA 4Q0BA 1TKTB 4G1PA 4WFAQ 5KFDA 2MZTA 3J7Z5 5CCMA 5KOXA 1Q79A 3CIMA 4DUYF 4PQUB 4L3KA 3BO2A 2ZH5A 2O3DA 5LXYA 2UVUA 4C8OA 2HHUA 5I3UB 3JSBA 1YZ6A 1WACA 3WIUA 3Q2TC 5LMUF 3L7UA 3MEDA 4P2MA 2Z58B 4EBDA 2AKWB 3M6UA 1M5KC 4JB8B 5DLFA 3TA2A 4WYLA 1AUSL 5HP1A 2ADBA 3H5YA 2W7PA 2N82B 4U8YA 2WBRA 1DTQB 5KT6A 1NK0A 3GJRB 3SCIE 3BO4A 3C14A 2C42A 3B8HA 5BJRA 2WZ1A 4MKAA 4IUFA 3NBPB 1VBKA 2M88A 5GVQA 2RHQB 4B3OB 1SL2A 3G86A 2VFVA 4QW9A 3IBWA 3P5BP 3ZNJ1 4YDDB 4ZP6A 2F8MA 3ILOA 1N32J 4PEOA 5KFNA 2VONA 4YP3A 2VB6A 1S57A 2C1EB 4HVZA 1FF2A 5I4MA 2HMIB 4R8UA 3KHLA 2W9CB 1N33J 1S72S 2HS3A 3AD8C 2M9KA 3CMAS 4ED1A 1UFWA 1IQTA 4B3SJ 4ECTA 3QIDA 1DQAA 1V6HA 4UTGA 4DR3F 2R8IA 1T02A 3EVMA 1HPZA 1FT8A 5ETNA 5AJ3J 2VG5A 1FE4A 2LVWA 2KL8A 2CJBA 1RTJB 2LFVA 3QMQA 4RW6A 3DGPB 1TQLA 4PG6A 4OYXA 2F4VJ 1O0PA 3HJFA 3FMWA 2G9OA 2DGTA 4I6YA 2OPRA 3V5RA 3OR1A 2ZDOA 5CH7B 2ZOFA 4B3RJ 1ICEB 2JEIA 1OY9A 2BE2B 1S0MA 1RT2A 2HVEA 3GFZA 2KTQA 3M8PA 3MFIA 2WB1D 4XDCA 3M1VA 1UA0A 1H2UX 2QMWA 3M30A 4WFXA 4WP9A 3DOLB 4OHXA 1HNIB 3PRBA 3EDQB 3PRVA 2MKHA 5IT4A 2W2OP 1CC8A 2HGNA 4O23A 4RWWA 4O44A 1Q0NA 3DDNA 4CLWA 5A8RB 3LO3A 1VBZA 4RU2A 3OL8A 3LANA 3JSRA 1WG4A 5E2QA 3M32B 5L9XA 3HVTB 4C11B 3RB6A 3HXMA 1NSPA 3OW2R 3TQEA 5KFZA 4CH7A 2R7QA 1Y5NB 4U9RA 2KVQE 3OHAA 2KVIA 1BWEA 4UF4A 3J81Y 3N5BA 1KQSR 1ZH5A 2CQ2A 3BGFA 1VC0A 4FS1A 3T3FA 2JEJA 2WAQD 2Y1IA 2WVBA 2Z2YB 4C8ZA 4ZVFA 4JI5J 2F9JA 4H4OB 1TUGB 3VVTA 2AGOA 2XB2D 2PGCA 2XG8A 2BYCA 4NASA 3LP2B 2MZSA 2DGVA 1C1CA 4DWIA 3GE9A 2OPSB 1TL7B 5JUMA 3H42A 1Y5LB 3PJWA 1HR0J 2BRKA 1UVMA 3PFEA 2B6AA 2B5JB 1WC4A 1KHVA 4ANDA 1QVFR 4M95A 1XN9A 3KMSA 1Z4UA 4A8WA 2J7WA 3FBFA 3HDSA 4ECSA 2KB2A 3MF5A 4NPOA 5AXKA 3I56S 2W1BA 4IH6A 1H6KX 2QYGA 4B9NA 1FEEA 5CZVA 3UNGC 4IFYB 2GMLA 1L3KA 3PY8A 1MMDA 2X3DA 2C2OB 5A2QU 3OD2A 3GR1A 4AYBD 4U96A 2CQGA 2EW9A 3FBEA 4B08A 1XEZA 1Q8IA 1R8HA 2Z4PA 1ZETA 1S6QB 4OI1A 2P9EA 2GHPA 3TRGA 2XHWA 2FJVA 2X7IA 4WK3A 4DL3A 4DFKA 4U6PA 2YWGA 4FF3A 2DO4A 3ET6A 4ER8A 2CJQA 5KG6A 2NUUG 4IFVB 2VBZA 3DRRA 3SSQA 5ETSA 3BB5A 4B9SA 1N54B 2CZVC 3DDIA 1NJXA 4LF9F 1FNMA 4OZ2A 2ZJRQ 2V4QA 2IDEA 2O5DA 4PUOA 1OQ6A 2VQFJ 1HHQA 2Y8WA 1K47A 3HHKA 2VA2A 4DV6J 3IP0A 1IXKA 1FJGF 5GMDA 1UFLA 1MN9A 4KR0B 1FJCA 2VJUA 3MM5B 3TX8A 2UVWA 4ZN1A 3I4HX 4DL5A 3D1QA 4BWJA 3PFOA 3LTOA 2VZ9A 4RNFA 3HFZB 3F44A 3JTOA 3M9NB 4IQMA 4ILRA 4K4WA 2H65B 2ZNYA 3D28A 2J7UA 3OLBA 4C98A 3LP1B 3H2LA 1RBAA 1YRUA 3H2VE 3EMTA 4CM2A 1Q8BA 1KRPA 3OJUA 3QWPA 3KHRA 1E6VB 3FEYB 5SZTA 2KHCA 3F56A 3JQJA 3KDNA 1U0HB 4JI0F 4KQZA 2ALYB 2YY3A 5H9EK 2F9DA 1R6YA 5K8OA 2FZGB 3SV3A 5KG7A 3CF5Q 1WKKA 1RISA 5L38A 3CJ0A 1URNA 3NAHA 4BC7A 2AD9A 2ALZA 2DH8A 1KR4A 3RGIA 4LRDA 4DFMA 1NK9A 3H59A 5KG2A 1YJRA 4IR1A 4LFCJ 5K20B 4NLUA 4HHJA 5DJBA 1JJHA 5KFLA 5LT5A 3KK2A 5LOQA 1BLUA 4CLSA 2IIHA 3CCES 4G6VB 1FXLA 1JJ2R 5DQHA 3GMGA 3NAIA 3W60A 5DETA 2VG6A 2CQ4A 4NI2A 1T11A 2FGOA 2KU7A 4WCEQ 2B4UA 1Q8KA 2AZ3A 5KT2A 2V2ZA 2N3LA 5KG0A 2ATLA 2XMTA 1QAJA 4K4UA 1FKPA 1TVRB 2OPPA 4WK1A 1HIYA 2DR7A 3SDEA 2XZWA 4OI6A 3UQSA 3U02A 4KKOA 4M5KA 1JLAA 2FB0A 2EFVA 2YKPA 3WX8A 4F26A 2HKEA 4GVBB 5HANA 4K0KJ 3B4DA 4FYDA 4AQYF 1NEEA 4U7CA 1NDPA 4O4GB 1LFPA 3HLUA 4WE1A 2BR0A 4WWSA 1TV6A 3M6WA 4M94A 1LXNA 3LQVA 3IRWP 2ZFHA 3PX0A 2XEXA 4P7VA 5D0RA 1FO1A 1K0VA 3Q83A 4Z7CA 2RS8A 1FCAA 4WXOA 2HHWA 2QLWA 2VF3A 2BBEA 3OQ2A 2VFRA 3RAMA 2Q6BA
chains in the Genus database with same CATH topology
5FLXU 4KYZA 4LF7J 5A2QU 2UUCJ 4JI5J 4RJVA 4GKKJ 1I94J 2MTLA 4HHUA 4LF5J 1IBLJ 4B3TJ 4X65J 3OTOJ 4X66J 1XNRJ 3J7AN 4DR1J 4NEYA 4X62J 3IMQJ 2HHHJ 4KHPJ 4JI1J 1IBMJ 2E5LJ 4LF6J 2UU9J 4GKJJ 3JAMU 1HNXJ 4JI4J 3D3CJ 4LF4J 2UUBJ 4LFBJ 3T1YJ 4YY3J 5LMNJ 1N32J 3R2CJ 4DR7J 4KY3A 4LF8J 4JI0J 4OX9J 4JYAJ 4JI3J 1XNQJ 4JI2J 4JV5J 1XMOJ 4NEZA 2VQEJ 4JI8J 1HNZJ 1HR0J 2MEWA 4DV3J 1N33J 3W1YC 4DV4J 4NXMJ 3D3BJ 1XMQJ 2ZM6J 2UXDJ 4K0KJ 2MQ8A 3J80U 1J5EJ 3J81U 4B3SJ 1N34J 4LF9J 4AQYJ 4DV1J 4DV0J 4DUYJ 4DR5J 1N36J 4JI6J 1HNWJ 4V1Ak 2VQFJ 2UXCJ 2UXBJ 5IT9U 4DR3J 2KVQE 4DV7J 3T1HJ 4DV2J 4DR6J 4JI7J 5AJ3J 4LFCJ 4DV6J 2KL8A 1FJGJ 4DR4J 4YHHJ 2F4VJ 4LFAJ 4PWWA 5LMUJ 4DUZJ 5LM7E 5IWAJ 4X64J 2UUAJ 3R2DJ 4B3MJ 4DV5J 1IBKJ 4NXNJ 4DR2J 5BR8J 4B3RJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLX U;  4KYZ A;  4LF7 J;  5A2Q U;  2UUC J;  4JI5 J;  4RJV A;  4GKK J;  1I94 J;  2MTL A;  4HHU A;  4LF5 J;  1IBL J;  4B3T J;  4X65 J;  3OTO J;  4X66 J;  1XNR J;  3J7A N;  4DR1 J;  4NEY A;  4X62 J;  3IMQ J;  2HHH J;  4KHP J;  4JI1 J;  1IBM J;  2E5L J;  4LF6 J;  2UU9 J;  4GKJ J;  3JAM U;  1HNX J;  4JI4 J;  3D3C J;  4LF4 J;  2UUB J;  4LFB J;  3T1Y J;  4YY3 J;  5LMN J;  1N32 J;  3R2C J;  4DR7 J;  4KY3 A;  4LF8 J;  4JI0 J;  4OX9 J;  4JYA J;  4JI3 J;  1XNQ J;  4JI2 J;  4JV5 J;  1XMO J;  4NEZ A;  2VQE J;  4JI8 J;  1HNZ J;  1HR0 J;  2MEW A;  4DV3 J;  1N33 J;  3W1Y C;  4DV4 J;  4NXM J;  3D3B J;  1XMQ J;  2ZM6 J;  2UXD J;  4K0K J;  2MQ8 A;  3J80 U;  1J5E J;  3J81 U;  4B3S J;  1N34 J;  4LF9 J;  4AQY J;  4DV1 J;  4DV0 J;  4DUY J;  4DR5 J;  1N36 J;  4JI6 J;  1HNW J;  4V1A k;  2VQF J;  2UXC J;  2UXB J;  5IT9 U;  4DR3 J;  2KVQ E;  4DV7 J;  3T1H J;  4DV2 J;  4DR6 J;  4JI7 J;  5AJ3 J;  4LFC J;  4DV6 J;  2KL8 A;  1FJG J;  4DR4 J;  4YHH J;  2F4V J;  4LFA J;  4PWW A;  5LMU J;  4DUZ J;  5LM7 E;  5IWA J;  4X64 J;  2UUA J;  3R2D J;  4B3M J;  4DV5 J;  1IBK J;  4NXN J;  4DR2 J;  5BR8 J;  4B3R J; 
#chains in the Genus database with same CATH topology
 2ZE2 B;  5HLF B;  5F9L A;  3PZP A;  5G0R A;  4A48 A;  2HNY A;  1RWN B;  3MFH A;  2P8I A;  3R7S B;  3MUT P;  3OTE A;  3AB2 B;  3H90 A;  3CD6 S;  4Q43 A;  3IGV A;  2E5L F;  2Z30 B;  1R0C B;  2DGS A;  4FVM A;  4QIF A;  4QQB A;  4Y65 A;  3H5X A;  2F1F A;  2RKI A;  3P96 A;  3HVW A;  2UUB J;  2JVO A;  2FJE B;  4KAI A;  3KG0 A;  1IJE B;  3HHL D;  1LXJ A;  3K17 A;  3ICL A;  3OUY A;  2XMU A;  2XHC A;  2W4P A;  2MZ1 A;  2OO4 A;  3KK3 A;  1NJY A;  2AJ1 A;  5DM7 Q;  4OZ0 A;  1PBU A;  4JV1 A;  2MZR A;  4ZMM A;  2L3M A;  1V9O A;  1CJK B;  1N36 J;  1RTD A;  4LSL B;  4V1A k;  2BM0 A;  4AXJ A;  4PXB A;  4OYZ A;  4P2F A;  3UDC A;  2LXF A;  4DFP A;  4K59 A;  1PAE X;  4MH8 A;  4I6W A;  3NCQ A;  3L4B C;  3VV2 B;  4I4B A;  4XTT A;  1S76 D;  5E3C A;  2XYP B;  4LF1 A;  4J9O A;  4ZVO B;  4ID5 A;  2OUG A;  3BBB A;  1VLO A;  3DRP A;  1JLG A;  4WII A;  1B0T A;  1PJ6 A;  1NK6 A;  3VAJ A;  5I42 B;  4OZ1 A;  1OO0 B;  3ZZZ A;  4DXL A;  2R4F A;  2J9C A;  1D3W A;  4CO3 A;  1BUX A;  1U24 A;  2AYE A;  2DTJ A;  3GZ7 A;  1ZS6 A;  1PSD A;  3QT7 A;  1CSJ A;  3DGV A;  5AXL A;  1RCO B;  1XR7 A;  1WC6 A;  2AYM A;  4WP8 A;  3L09 A;  1F3V A;  1YI2 S;  3MR7 A;  3MAA B;  1SJQ A;  3JTP A;  1RKJ A;  2H9Z A;  1FDB A;  1S6P A;  2HVH A;  3GV5 B;  1VQM S;  1GXU A;  2OP5 A;  3H2U B;  3G8T A;  4CLF A;  4TY8 B;  2FYX A;  3L3C A;  1YJ7 A;  3DYA A;  4NLR A;  1PBA A;  4EO6 A;  5A76 A;  4DF8 A;  3U1N A;  2XI2 A;  2HIY A;  1S4E A;  2DNR A;  3BDE A;  4RNH A;  5KFO A;  2RH3 A;  2LDI A;  1BQN A;  2PC6 A;  4FN5 A;  5HI7 A;  4LF5 J;  3AFG A;  5K14 B;  4ANC A;  5L1J A;  3R9L A;  4OZJ A;  3K7R A;  2V6A A;  2H3E B;  1VQ4 S;  4KO0 B;  2Z8Q A;  4M5D B;  1SJ3 P;  2Q43 A;  3R7N B;  3OFF A;  5F8L A;  4BHQ A;  4UST A;  3U7J A;  1ZM9 A;  4LBH A;  4DR7 J;  3QNW B;  4JV5 J;  2H5J B;  2J76 E;  4GMK A;  2VPW B;  5HMX A;  4A8O A;  3BN7 A;  4I68 A;  1REV A;  2E7W A;  2WVD A;  1KTV A;  1T03 A;  2PO4 A;  5A8K B;  4ZIV A;  3IM9 A;  4CH1 A;  1RI7 A;  3UVJ A;  3FGV A;  3UO0 A;  1JXL A;  2YH0 A;  3C6U A;  2LLZ A;  3DLK A;  4W98 A;  2RNE A;  3PHT A;  1J5O A;  1LKZ A;  2E1P A;  2DHG A;  2KM8 C;  4DLG A;  4WKR A;  3VZI A;  2M8H A;  4WJB A;  4HDH A;  1FKO B;  4JI8 F;  2G1D A;  2HIQ A;  3IM8 A;  1JLB B;  2YNG B;  3D68 A;  4TNO A;  4FS2 A;  2GC8 A;  4LF4 J;  3GTY X;  1M90 T;  2GVZ B;  1QLN A;  4X4U A;  4A8M P;  3EPG A;  4M5L A;  1UWB B;  3WC2 A;  2CWX A;  3C16 B;  2CQP A;  1E6Y A;  5F9N A;  5AE3 A;  4EYI B;  4CCH A;  1SB6 A;  1D9F A;  4HI2 A;  4CLK A;  3VHQ A;  1TAU A;  1FD2 A;  1CUL A;  2HUR A;  3MCO A;  2Q6C A;  1SH2 A;  4UOG A;  3TUJ C;  2BV3 A;  1OY8 A;  3RRG A;  3BM7 A;  1RAH B;  2MGZ A;  1GXL A;  4NCG B;  1DTT B;  3QIP A;  4ANE A;  1UCN A;  4ECV A;  4XK8 C;  4DOZ A;  4ZPB A;  2E1A A;  4HR2 A;  3A8I A;  3VGS A;  2VKR A;  1TFW A;  2XI3 A;  1PYO B;  1YRX A;  4IG3 A;  4K4T A;  4DR2 J;  1AFI A;  3TAM A;  5BR8 J;  3K5O A;  1NB7 A;  2YNI A;  2CPE A;  3I5A A;  1VIS A;  4M63 A;  3ADA C;  4WF9 Q;  3BGU A;  1WI6 A;  3DLE B;  5KFU A;  2R9L A;  4CO5 A;  3OPK A;  4CLL A;  2Z57 B;  4L75 A;  4CNY A;  4MT1 A;  2MPU A;  4A8K A;  3DNC A;  2BMB A;  1EQ0 A;  3JAM U;  2CJA A;  1LK5 A;  1K0T A;  4B17 A;  2BKO A;  1VQ9 S;  4WU3 A;  4OX9 F;  2DNK A;  2COL A;  3CPW R;  1JNR B;  4P6Q A;  1VQ7 S;  2UZA A;  3BGR B;  1SUQ A;  1GTH A;  1HMV A;  3GII A;  3M05 A;  2DH7 A;  2C2D A;  4N7T A;  5ETO A;  3CGI A;  4YB5 A;  4ZKA A;  2IPO B;  3ZZU A;  1TU0 B;  2MLY A;  2V2K A;  1YLX A;  1RAJ A;  3FMB A;  3B78 A;  1WUU A;  3QLH A;  4J9S A;  1WC5 A;  1JXV A;  3I31 A;  1X4D A;  2RQM A;  1QUP A;  1Y4Z B;  2BQ3 A;  3IS9 A;  1HW9 A;  1HWI A;  2JHE A;  4OYW A;  3BV8 A;  2FLN A;  1Y7P A;  4C0B A;  5DGB A;  3WQP A;  2VIC A;  3M8Q B;  3NOG A;  2W7O A;  1HBM A;  3CT9 A;  4NWB A;  3EXY A;  1GAO A;  1NPP A;  2B3T B;  2MKC A;  2ZDP A;  3H4D A;  1Q78 A;  2MQM A;  2QA4 S;  1FES A;  1RAD B;  3KKF A;  4ZHR B;  4YEA A;  1NHK L;  3W8P A;  4EFA C;  4EGL A;  1X5P A;  4R8U B;  2FHM A;  1DLO A;  1K1S A;  1JXE A;  3R5B A;  3QGG A;  2CNN B;  1S99 A;  3CDW A;  3T9N A;  2ZM6 F;  1KQF B;  1NCL A;  4QWD A;  2MMY A;  3RAQ A;  1VQ5 S;  4X4N A;  1JQG A;  1JLF A;  3AJ1 A;  5L46 A;  4DDF A;  4NOH A;  1AYE A;  4RW6 B;  3CMQ A;  1VQL S;  3TJ9 A;  3CCQ S;  5T7L B;  2OPR B;  4FYW B;  4Y2K A;  3K89 A;  3GLJ A;  4X64 F;  2HHQ A;  4DX6 A;  3AB4 B;  3K5L A;  5LSO A;  4P74 A;  3QO9 B;  3M8P B;  1Z2Z A;  3W64 A;  1U1Q A;  2GVD B;  2IC3 A;  3V4I B;  5A8W A;  3CCW A;  2QG9 B;  4CLT A;  3HF5 A;  1RWV B;  3KK1 B;  1C0U B;  3M1V B;  1UJ4 A;  3M30 B;  3Q86 A;  3G4S S;  1F60 B;  2LQ8 A;  1VK8 A;  4GC7 A;  2V4J A;  3T1Y F;  1G6B A;  2OJ3 A;  4YY3 J;  3SQG A;  2HHV A;  1T3O A;  3TVK A;  1KOH A;  3DLH A;  5KFI A;  4A8S A;  3FZ2 A;  4ERD A;  4P2X A;  2VA3 A;  2B4V A;  3BH6 B;  1OQ3 A;  1GH8 A;  5KT3 A;  1J5E F;  4O3O A;  2MYF A;  4MKV A;  1X8D A;  4RUH A;  3WHI A;  2E66 A;  2FVC A;  3D7S B;  1M5P C;  1JKH A;  2JNJ A;  2L9W A;  3V2U C;  3W9I A;  3T1H J;  2NYH A;  3MOZ A;  3CJ4 A;  4X65 F;  3HKZ D;  1XJW B;  3M2V B;  1K9M T;  1U6F A;  3T5K A;  1EIY B;  3MUM P;  2VFS A;  2MY7 A;  2PEH A;  3BDP A;  4ZIW A;  2G1H A;  4M1K A;  2V5H G;  2LEA A;  2FZC B;  4OHY A;  2CQ1 A;  1Y5I B;  3ZC4 A;  2V68 A;  3OVA A;  3NKY A;  3MM8 A;  1HI1 A;  4TU9 A;  2DXF A;  2RSQ A;  2IVY A;  2K1R A;  1LWC A;  1N4L A;  2CPX A;  4PPZ A;  4QCL A;  2YWE A;  2YWF A;  3PR5 B;  2OIH A;  4MIA A;  4F8R A;  2B6A B;  2OHD A;  1IKX A;  4R5P B;  4TLQ A;  1APS A;  5HJX A;  1N8R T;  2ZUG A;  3SCK E;  4OYP A;  2RU9 A;  2GFF A;  5KFJ A;  1HNW F;  3KOA A;  3RRH A;  2XGQ A;  1TFY A;  4A8F A;  1NK4 A;  3IG1 A;  1CQM A;  1YZ7 A;  3H20 A;  3TZX A;  3LH2 S;  1HLW A;  4A4J A;  1BXN A;  1KP6 A;  1KOO A;  3SSR A;  2VPY B;  2ZOG A;  1SKR A;  2FJX A;  1S49 A;  3T5H A;  3OV7 A;  2ZH7 A;  4GKJ F;  3R6G B;  3DMJ B;  2VKZ G;  1NSK L;  2AT1 B;  1NK5 A;  3IBF B;  4CLP A;  2XCP A;  4ECX A;  1GX5 A;  1X5S A;  3K8W A;  1U1L A;  4UZB A;  2V9K A;  5EWF A;  3PO5 A;  2BQU A;  2KXF A;  3PM9 A;  3M2U B;  2MZQ A;  2WSE C;  2GZO A;  3N6M A;  3ET6 B;  2ZBC A;  3DRR B;  2EKN A;  3KMQ A;  4ETX A;  1VGY A;  2O67 A;  1OSD A;  2UVV A;  3H25 A;  3PW0 A;  3PYF A;  3KLG B;  4QU6 A;  1ZM3 A;  2R7V A;  2LCW A;  1CVJ A;  5KFR A;  5C42 A;  3LP0 B;  1RTH B;  2E5H A;  1QY7 A;  2B8Q A;  1RUS A;  2PEB A;  4C0H A;  1PYT A;  1FWP A;  2YNH B;  2J9D A;  1QSL A;  4IG0 B;  3ITH A;  4I56 A;  3KG1 A;  3TZY A;  4DV5 F;  3AJD A;  5IWA J;  5K9F A;  2FTR A;  2IJR A;  1VDH A;  3AA9 A;  1CJV B;  5LMN F;  3QAU A;  3ZTS A;  4S0M A;  2XS2 A;  3K58 A;  3GYX B;  4KHP J;  2CPZ A;  2J8A A;  2KG1 A;  3R7B B;  4K5S A;  4PQU A;  5EUH A;  4L3N A;  3QJJ A;  2KFZ A;  1U1N A;  4LMZ A;  2QLB B;  4UOF A;  1M1K T;  3T6J A;  5I3U A;  2Q79 A;  4N77 A;  3SIP B;  1X31 C;  4DV7 F;  2OPQ B;  2GA7 A;  1UEU A;  4MJK A;  3TUI C;  5E33 A;  4DV3 J;  2DKO B;  2RHS B;  4OYM A;  2NXC A;  4KT0 C;  1MRO B;  1H74 A;  2LQ9 A;  4DR5 F;  2OTL S;  1DBD A;  2PFD A;  1DTQ A;  4ECU A;  3FCW A;  1X0F A;  3BYR A;  2VHG A;  3CJ5 A;  1OJ4 A;  3N01 A;  4QR1 A;  3CCU S;  1N6Q B;  3E51 A;  1EP4 B;  2XMK A;  3R5C A;  4AFF A;  2HRY A;  4PWD A;  2CPJ A;  1YJW S;  5CXT A;  1TL3 B;  2IBK A;  4PXE A;  5CA5 A;  3W2W B;  2OPP B;  4ZJO A;  3SBM A;  1JK9 B;  1X5T A;  2CZ4 A;  2GIF A;  1HWK A;  1ACM B;  2N4D A;  1R0B G;  4DPO A;  2V34 A;  1YG0 A;  1JLA B;  1JIH A;  2IJN A;  1BQM B;  2HMI A;  2W9C A;  2ACY A;  3ZFV A;  2J6U A;  2HVD A;  4UQG A;  1NND A;  3DOK B;  3N6L A;  1EET A;  2LEB A;  5FD1 A;  5ETR A;  1TKD A;  1NDK A;  2GAG C;  4DV4 J;  3W62 A;  4WFZ A;  2DGO A;  3CVK A;  4K2X A;  3VQT A;  1U2R A;  1YJT A;  4ZVS B;  4C2M A;  3RTV A;  1RWM B;  2FC8 A;  3K57 A;  2H51 B;  3RUB L;  3DRY A;  1URR A;  3V6J A;  3M6X A;  5B08 A;  2DEJ A;  4OX8 A;  2LA6 A;  1YHQ S;  2Z2Z A;  4DFJ A;  1Q86 T;  2HW3 A;  3UW1 A;  3AD9 C;  3DKD A;  3M8R A;  2A2C A;  4QJV A;  4QWC A;  1SVD A;  4MYT A;  2RRN A;  1U1P A;  4UT4 A;  3M2R B;  4DI6 A;  3BJY A;  2RKI B;  3DOL A;  3EXC X;  1HNI A;  4F67 A;  3PKM A;  5M2R A;  4FPI A;  3B54 A;  2EBE A;  2ASJ A;  2JFK A;  2MDA A;  3CO0 P;  2E44 A;  4Y6I A;  2PI5 A;  3M32 A;  1FNX H;  3HVT A;  4C11 A;  3MXH P;  4J9M A;  1N33 F;  1S0N A;  3J80 Y;  3A3P B;  4C3M A;  1ZYQ A;  4DSJ A;  2V94 A;  5L1K A;  4B3S F;  4ED4 A;  4UUX A;  2XY5 A;  1JLQ A;  4OYO A;  2LA4 A;  1S1X B;  3CC2 S;  5IQQ A;  3MR5 A;  1NH8 A;  1UP1 A;  5AJ3 F;  5IC6 B;  1V5V A;  1BHN A;  1YQH A;  4CI0 B;  4KRW A;  2F63 A;  1NPR A;  2HWT A;  3J7Z T;  1SJR A;  4USW A;  4P9S A;  3OXF A;  4EI2 A;  2AX0 A;  2RDD A;  5DS7 A;  3MPD A;  3IRX B;  4B3M J;  2GO8 A;  2BXJ A;  4B3R F;  2QEX S;  3MR3 A;  1M0S A;  4WKY A;  1SKW A;  5CQG A;  4FP9 A;  2WSF C;  4ES2 A;  1KC8 T;  1WDT A;  3DRP B;  3NMA A;  2H1Y A;  4H4O A;  1JLG B;  3DFE A;  5CAB A;  3I6P A;  4MAK A;  4RUC A;  1KVK A;  1RT5 A;  2AYG A;  3DM2 A;  4I2Q A;  2PN6 A;  3G6X A;  2HHH J;  1C1B B;  3LP2 A;  4B9V A;  2HAF A;  1UWA A;  5LSR A;  4AL5 A;  2OPS A;  3MOJ B;  3G6E S;  1TL7 A;  2KYZ A;  1VQN S;  5EN1 A;  3D1H A;  4CO4 A;  5DG8 A;  3WBZ A;  5KFH A;  4NLQ A;  1VHI A;  2ZJP Q;  1FVS A;  2BE7 D;  2B5J A;  3Q8R B;  3VAH A;  1UL3 A;  1HBU B;  1IBC B;  2OKQ A;  1RP5 A;  3S8S A;  3V6K A;  1NO8 A;  4CLZ A;  3W7B A;  2CXE A;  2HAI A;  3FFI A;  1YJ9 S;  3CW2 C;  5HVG A;  2OTJ S;  1M5S A;  3DYA B;  2GIR A;  1QE1 A;  3QAT A;  2QFI A;  4IFY A;  2AWZ A;  4X4T A;  3O5T B;  4DX8 H;  4RNO A;  2YH1 A;  3E8O A;  2B43 A;  3KWM A;  4NMX A;  1S5Z A;  4Q45 A;  1BQN B;  5DLG A;  4FZV A;  3EX7 B;  4JI5 F;  1NLK L;  2ZC4 A;  5HQM A;  4ID8 A;  2U1A A;  1S6Q A;  4B02 A;  2W9B B;  4J9K A;  3DXS X;  1PIE A;  1I6J A;  1NME B;  4H4K A;  4HHH A;  5IFM A;  3PG9 A;  4ZLP A;  3OHB A;  2QSW A;  4OJ3 A;  4IRD A;  3PYD A;  5HVH A;  4IFV A;  2EKY A;  3HMJ G;  2UXC F;  3FDS A;  3JSM A;  1HR0 F;  3TX0 A;  2V50 A;  2CIM A;  3SZ2 A;  4DN9 A;  4C8L A;  3PJ9 A;  1HD0 A;  2A3J A;  1CLF A;  3VZH A;  3TJA A;  1XER A;  1V3S A;  4WIQ A;  5D8H B;  3UVJ B;  4NYO A;  4DUY J;  3IAM 9;  5F0U A;  5T41 A;  2WON A;  4DPW A;  4EWT A;  2BKN A;  4DL4 A;  1PO6 A;  3G71 S;  4QZV B;  2KRB A;  2YKN B;  3T19 A;  4NA1 A;  4NLP A;  3TNV A;  2B4O A;  2CYY A;  2C3P A;  3MM7 B;  1IR0 A;  4Q8E A;  2IMO A;  5LMU J;  4AE5 A;  1J5O B;  3Q8P B;  1VQO S;  1Q81 T;  2LXU A;  2LDY A;  3CCR S;  1R8A A;  2B9Y A;  2W2N P;  2PA8 D;  3GYG A;  1FA0 A;  2QA2 A;  2HVZ A;  1UEK A;  4BDP A;  3LP1 A;  1LFW A;  5FDL B;  3MWB A;  4DX5 A;  3ULH A;  3NLC A;  3TA1 A;  4D3G A;  1E6V A;  1GK8 A;  1SIW B;  1RWW B;  3KXD A;  4MFB B;  1U0H A;  5DM6 Q;  4OHW A;  2NCK L;  5KFY A;  2CQD A;  3DU6 A;  1O51 A;  4Y2A A;  4DG1 A;  1TK8 A;  2VFU A;  1E6Y B;  4LVN P;  4RBU A;  3Q8V A;  2LU2 A;  2G2Y A;  3JSY A;  3CJK A;  3MM6 B;  1CUL B;  2PMW A;  4ELV A;  3RBX A;  8RUC A;  3O8W A;  3TAP A;  2HK2 A;  3MEC A;  1P1L A;  2RVJ A;  3BQ0 A;  2VQF F;  1Q5V A;  3MEG A;  1OYE A;  3CJQ A;  2R7S A;  1X60 A;  1B0P A;  1N48 A;  4DR4 J;  1W25 A;  5CYQ B;  2QRR A;  3JQM A;  4O0I A;  4UUW A;  4F3O A;  1R3N A;  1S0O A;  4ATN A;  2I38 A;  4CP5 A;  2A6M A;  2CWK A;  2VBX A;  3BSO A;  2CFX A;  3K5M A;  4NLW A;  1TVR A;  1YGY A;  3MZI A;  2BJD A;  2R7R A;  3H0P A;  3TYT A;  1HNZ F;  2IYI A;  4ZP8 A;  2QGF B;  1RGV A;  5IS2 A;  2HEK A;  3H5S A;  4B9M A;  1WHW A;  3GCW P;  4F50 A;  3ENV A;  1T7P A;  3EZ5 A;  4FBU A;  3HD1 A;  1SUQ B;  1YKW A;  4UQT A;  4LF8 J;  4GVB A;  2D74 B;  4QIW D;  5LXR A;  7FD1 A;  2ILZ A;  3CDB A;  3RZA A;  5FII A;  2OEK A;  1RTI A;  3MI7 X;  2UXD J;  4U7U K;  2Q3P A;  2MHN A;  3UCU P;  5K8M A;  2HND B;  3TQ1 A;  4LFC F;  5LL6 d;  5B0D A;  3QSI A;  1RBL A;  2O1P A;  1VR6 A;  1TL5 A;  4P71 A;  4OJH A;  1BY9 A;  2HFO A;  5HLF A;  3MPW A;  1KN6 A;  1WSR A;  5HN0 A;  3CXC R;  1SJ1 A;  2GQC A;  1FER A;  2R7W A;  5ETT A;  4WFB Q;  1X5O A;  2GO9 A;  4QPT A;  2VJV A;  4OIX A;  4C9D A;  2XTJ P;  1I94 J;  5GAD I;  3SCL E;  5CD4 H;  3R1L A;  3EVW A;  1JJ4 A;  4ZVU B;  4Y3C A;  5DDQ C;  1DLO B;  5AE2 A;  3CC7 S;  2XNR A;  4N41 A;  5J2N B;  2JSX A;  2ZWP A;  2UXB F;  2DXD A;  1MG7 A;  2X1A A;  2W4D A;  3QPI A;  3KJV A;  5KTQ A;  2AJ4 A;  3E3X A;  5EHH A;  1S1T B;  1N52 B;  1JLF B;  4F3Q A;  1CJK A;  4K0K F;  4LSL A;  1A0O B;  4LFA F;  3HKW A;  3IR7 B;  1B4S A;  4PXD A;  3NNA A;  3UD5 A;  3MHY A;  2D3Z A;  3QWU A;  4URQ U;  1IM6 A;  3S01 A;  1DAR A;  1SI9 A;  2IC3 B;  4ZPC A;  1FK9 B;  1YIT S;  3UN3 A;  1XC9 A;  2HG4 A;  2FLP A;  1OWX A;  2R8G A;  2I8E A;  3KLH A;  5KG3 A;  1X4H A;  3MEE B;  4DR1 J;  2BKP A;  2LKZ A;  3A8E A;  3N28 A;  4IO9 Q;  4OHZ A;  3BR9 A;  1LW2 B;  1PG5 B;  2CAJ A;  2UUB F;  1RXO B;  4K2J A;  1T9W A;  5CYM B;  1TK0 A;  4G1Q B;  5E0O A;  5J2P A;  1LWF B;  3CCV S;  1M1H A;  3CCL S;  1YBT A;  2DIT A;  3O2I A;  5KFK A;  1HAR A;  2VFT A;  4H54 A;  2HBY B;  3MAA A;  5U47 A;  2DNY A;  1N36 F;  2OSR A;  4DS5 A;  3EGW B;  4TY8 A;  5B0G A;  4RBV A;  1IR2 A;  4FVC A;  2CPF A;  1WG5 A;  3OTO F;  1IN0 A;  2VUG A;  3R2D J;  3KTQ A;  3HX9 A;  3TEH B;  1W26 A;  4J90 A;  1I5O B;  3MM8 B;  5K14 A;  3C3L A;  1NBE B;  1S9F A;  2M70 A;  4OX6 A;  1MWQ A;  1T9Y A;  2F65 A;  2K1R B;  2CQH A;  2NPF A;  4M5D A;  5C7P A;  1KQG B;  4PG5 A;  1O5J A;  1UEV A;  4P73 A;  2HBQ B;  3POT A;  4F25 A;  3KLI B;  3BQ1 A;  2XUL A;  1S1U B;  4EO8 A;  4F4Y A;  3VWS A;  3I87 A;  1WOO A;  1XMO J;  2VQE J;  5HAO A;  1GFW B;  1ZA2 B;  3FKB A;  4Y28 C;  4ZN3 A;  1XMQ J;  4N5S A;  3A8J A;  5A8K A;  3EZU A;  3GYN A;  1KKH A;  3ZZT A;  2Y0B B;  3HHD A;  4IOC Q;  1DFD A;  2Z56 B;  1N88 A;  3D4J A;  3A3O B;  3QT5 A;  3GIR A;  4ED2 A;  1F3F A;  2HQI A;  2JX2 A;  1SIZ A;  2HRU A;  4X2B A;  3EDR B;  1IUJ A;  4YFU A;  3VAM A;  5JVG Q;  2E29 A;  5HO4 A;  2GJ2 A;  1MW7 A;  1MN7 A;  4LF5 F;  2R8H A;  4DN0 A;  3FNN A;  1D8Y A;  2AEJ A;  1F9F A;  1JLB A;  2YNG A;  5GME A;  3DN9 A;  3HHE A;  5IXU A;  2ROE A;  4N56 A;  3RAX A;  5L1I A;  2MLX A;  1KS2 A;  4X4V A;  3T6B A;  1UWB A;  1UVK A;  1U8W A;  2A18 A;  3GB0 A;  1UTA A;  1NKE A;  3C16 A;  3D6T B;  4DR7 F;  2RF2 B;  1JMT A;  4J9N A;  4JV5 F;  1JB0 C;  4ELT A;  1R0A B;  1D8Z A;  3M6V A;  4KSE B;  2QIF A;  2VG7 B;  4DLE A;  5HMZ A;  5KAK A;  3SV4 A;  1WOR A;  1FRL A;  2O66 A;  3PAC A;  1I3O B;  4I64 A;  2CG8 A;  4W90 B;  2DIS A;  3NXZ A;  1DTT A;  1WF2 A;  5K8P A;  2PA3 A;  2QN6 B;  2CRL A;  1F5C A;  2KJV A;  5CCL A;  4B3T F;  4ENO A;  4NZ6 A;  3T9Z A;  2C2E A;  2DGU A;  4RW9 B;  1L3T A;  3W9J A;  2UV8 G;  1VBX A;  1UFK A;  1W2B R;  2EK6 A;  3DC2 A;  3DLE A;  1B99 A;  5GAE I;  3OTD A;  4O4R A;  2F40 A;  3DLB A;  4DQP A;  5IT0 A;  1NXI A;  3MCN A;  5E41 A;  2MKI A;  2VBY A;  3TO8 A;  3IGN A;  2B4P A;  3R1H A;  2F8H A;  2YPY A;  1U25 A;  3TR5 A;  5HMW A;  1IKY B;  3DRX A;  2F3J A;  1SH3 A;  1LOU A;  2FZK B;  1FRX A;  3BGR A;  1LNQ A;  4C4W A;  2K7K A;  1D1U A;  5F41 A;  3IR6 B;  4F3M A;  4ZCM A;  5EDW A;  2KRR A;  1NK8 A;  2JZ5 A;  3IR5 B;  3CO9 A;  4Z2X A;  3MPU B;  1I1G A;  5KT4 A;  1EAY C;  3HSZ A;  4CZC A;  5HJY A;  4AL7 A;  5H9F K;  4HAC B;  1VRU A;  4WPA A;  4P75 A;  1C4A A;  4MKB A;  3VAG A;  1Q95 G;  4F4K A;  3NCR A;  2D69 A;  2KT3 A;  2CNL B;  2VC0 A;  2AW0 A;  4Q2M A;  1DRZ A;  1KDN A;  4PWD B;  1C0T A;  3M8Q A;  4DR2 F;  2JWN A;  2MJN A;  1UET A;  3D2W A;  2XS7 A;  1YJU A;  5C24 B;  4V19 J;  4LSZ B;  2JDJ A;  4A8X A;  1U7L A;  4ZHR A;  2PT0 A;  4C97 A;  2V4R A;  4XIU A;  3KHG A;  2IVM A;  2LQ5 A;  1DUR A;  1RWP B;  3LWM A;  1IBM J;  3Q89 A;  1A9N B;  4L6V 3;  1JLE B;  1EET B;  1TP7 A;  1XTZ A;  3HFV A;  4XAK A;  3PIO Q;  5B0C A;  3J7Y I;  2L08 A;  2FJB B;  1TZ0 A;  2DHA A;  4JI7 F;  1NB2 A;  1KVJ A;  2C28 A;  1NH7 A;  1PJ5 A;  1JLC B;  3HHL C;  2HHT A;  1UVN A;  3G82 B;  5T7L A;  3HPO A;  3VCD A;  2CQC A;  2KO1 A;  2ZH2 A;  2CPD A;  1BQX A;  3EYZ A;  2Y1L B;  3GFY A;  3ZNU A;  1N5S A;  2WCX A;  1EHW A;  4NLV A;  1RT7 B;  2DNZ A;  3NS5 A;  3QO9 A;  1K73 T;  3EGZ A;  2A10 A;  4WZQ A;  2GVD A;  1IKV A;  3IBC B;  3UPF A;  3V4I A;  5C2C A;  1OMS A;  3AQP A;  4ZCI A;  2YQ1 A;  3N4W A;  4R0E A;  3KK1 A;  1C0U A;  3NS7 B;  3SI8 A;  4N47 A;  4F4W A;  4ZVQ B;  3ILL A;  4RKU C;  3ENQ A;  4O3Q A;  2KM8 B;  2KDO A;  3LAL A;  4CT9 A;  2HWH A;  5IZH A;  2ZBI A;  1U49 A;  3BGO P;  4O0N A;  2FJW A;  7FDR A;  1FX2 A;  1MNE A;  4DV1 F;  4RR5 A;  2BAB A;  1NM2 A;  2XLK A;  3BRE A;  1WF0 A;  3ZTQ A;  1RLC L;  1JLQ B;  2Z2M A;  3RB0 A;  4ED0 A;  1GMU A;  4I0W A;  3J80 U;  2MKK A;  1HHT P;  3S1T A;  3M2V A;  2ZBQ A;  3W61 A;  2F5G A;  4X66 F;  3CDE A;  3B4M A;  1EJ7 L;  4LUB A;  4K7Q A;  4LRB A;  3HT0 A;  5F3Z A;  1RJJ A;  1R7I A;  1RT5 B;  3CJ2 A;  1JWW A;  3PCO B;  5H9E J;  3IC1 A;  3DM2 B;  4I2Q B;  3RG6 A;  4LFB F;  3TJ8 A;  2BRL A;  2GJF A;  5ITH A;  1BMQ B;  3MMB B;  1XIQ A;  4UOH A;  4GVL A;  3EGV A;  4NEY A;  4BC9 A;  1RWO B;  3AHP A;  5A2Q Y;  1VRT B;  4FYV B;  5KFW A;  1IWG A;  3EJM A;  2MQN A;  4RPF A;  1SJF A;  4DMZ A;  4TQR A;  3RBD A;  4JI4 J;  4R5P A;  3FSY A;  4PAB A;  3ZZR A;  5KFF A;  1S9E A;  5RUB A;  4K8R A;  1Y00 A;  4DPX A;  1WOP A;  4JI8 J;  3SSS A;  2FHJ D;  2BJ8 A;  1R8P A;  2V2Q A;  3FFI B;  1H7X A;  2EC0 A;  1F2G A;  1H98 A;  5KT5 A;  1QE1 B;  3T1H F;  2WTF A;  3SFU A;  4FDF A;  4U8V A;  3DMJ A;  4E98 A;  1B7F A;  4MIB A;  2SXL A;  5D3G A;  4F7V A;  1VLY A;  3J7Y U;  4LT6 A;  4DJB A;  1UKU A;  4OYB A;  1K8A T;  3IWL A;  3AD7 C;  1WEZ A;  3BN4 A;  4NCB A;  4F0K A;  1KWM A;  2JLG A;  2C2N A;  1LWE B;  4B9T A;  2EXU A;  3M2U A;  2RUG A;  1U1O A;  2DO0 A;  2HGL A;  3GG0 A;  1RTZ A;  3OL6 A;  4KHM A;  2EG2 A;  2W24 A;  3JSM B;  3F73 A;  3OR2 B;  3I55 S;  3R2C J;  4OZ5 A;  1S1W B;  3KLG A;  5FJ4 A;  2QL5 B;  3JTN A;  2N7Y A;  4DF4 A;  1IR1 A;  1T0T V;  2H4W B;  3LP0 A;  4KV8 A;  1RTH A;  4CRJ A;  1FRM A;  3K8V A;  4P10 A;  3PW5 A;  2D7S A;  1AXQ A;  2YNH A;  2WON B;  3LPY A;  2XGP A;  4IG0 A;  3IWX A;  3OSN A;  2EC2 A;  3FZB A;  1N0V C;  3OJS A;  1NDL A;  2I2Y A;  4PXC A;  3DRS B;  5E3R A;  4FF1 A;  2LEP A;  1X4G A;  3F41 A;  4MK7 A;  4QWA A;  4DV2 J;  4F0M A;  1L3V A;  4J91 A;  2CKW A;  4NML A;  4QU7 A;  3NGS A;  1AUD A;  1VBY A;  3NEK A;  1O6X A;  1CJV A;  2CJY B;  4XPE A;  2I5J B;  1SJ4 P;  1D9A A;  4EZ6 A;  3RJM B;  2WSC C;  4ZP7 A;  2GQQ A;  2UUC J;  3OXL A;  2XC9 A;  3L7P A;  3HVR A;  2IM3 A;  2A1B A;  3UN2 A;  3HZG A;  3GSI A;  1SC3 B;  2K06 A;  2W9A A;  4DG1 B;  3QZ8 A;  2QLX A;  4E0D A;  1V5I B;  2NS1 B;  2C3Y A;  2XMA A;  2OPQ A;  3D54 A;  3CJK B;  1FNO A;  3C6T A;  2R2U A;  1QSY A;  3DLL Q;  1MRO A;  3MEC B;  3PR4 A;  1NUE A;  4CT8 A;  2WVE A;  4H4M B;  1GTE A;  2FD2 A;  1HI0 P;  2DNH A;  4J9Q A;  1BD6 A;  3MEG B;  3AOC A;  3QT6 A;  5IT9 Y;  3V4M A;  5HSP A;  4NXN F;  3ZTP A;  1N6Q A;  3EIC A;  3GJT B;  4U95 A;  2CQ3 A;  4USH A;  5KFA A;  1EP4 A;  3PTW A;  4JV2 A;  1NKC A;  1HKA A;  2Y9H A;  2ZOM A;  4YHH J;  5KFX A;  3CB4 A;  2BOA A;  2N4C A;  4PWU A;  1TL3 A;  4JI1 F;  5I3Q A;  2MKY A;  5IQ6 A;  1REG X;  2ZUA A;  3W2W A;  3MMA B;  1HL6 A;  2NZ4 A;  4JUZ A;  3SEO A;  5H1S V;  4PKD B;  4RJV A;  4PZV A;  5E5N A;  2Y8Y A;  1XR6 A;  1Y9O A;  2KXN B;  3VGV A;  1BQM A;  4RUA A;  2KXH A;  1XR5 A;  3TUP A;  5G4D A;  2FQQ B;  4F2S A;  1XQI A;  5DQG A;  3DOK A;  3BYP A;  1U2F A;  2VH7 A;  1LEO A;  4CYU A;  1MU2 B;  4URS A;  5J2M B;  3HM9 A;  3I9V 9;  5K8N A;  3BH7 B;  3V6H A;  2XBP A;  1RTI B;  3RYL A;  1FTC A;  1XNQ J;  1CPZ A;  3UDE A;  4DV3 F;  5E3P A;  3RRK A;  4F36 A;  4CDI A;  2QO3 A;  1U02 A;  1ZZN A;  3I96 A;  1Y0H A;  1Q82 T;  1JNZ B;  3HI9 A;  2NPI A;  4QR0 A;  4PPD A;  1VYA A;  3BO3 A;  4RZR A;  5MAO A;  1L3S A;  2HLT A;  4R25 A;  2KFY A;  4C6A A;  5I3P A;  2LP4 A;  1WHY A;  5MLC V;  3GJS B;  2C3U A;  4TVA B;  2AEM A;  3OFE A;  3M2R A;  3QBC A;  4I7F B;  3PEH A;  3UDL A;  5DDO C;  2P2C B;  3MDF A;  4JV0 A;  4N8O A;  2RML A;  4X65 J;  4EZ9 A;  2IYG A;  3NG8 A;  4UW2 A;  5DQI A;  4EEY A;  1WG1 A;  1PAU B;  2HFV A;  2XO7 A;  1VFJ A;  3M8W A;  5IV3 A;  2E1R A;  3PW4 A;  1K44 A;  2G0J A;  2JVR A;  2GV1 A;  3O44 A;  2V0N A;  3R8Y A;  5AXM A;  3LOU A;  3KJV B;  2NZC A;  2X1G A;  5BYQ A;  2RE1 A;  2CUY A;  3PEJ A;  4JI3 J;  2JOQ A;  4M5N A;  4JI2 J;  4ILL A;  4DV4 F;  1S1X A;  1YWX A;  2HSE B;  4L76 A;  1P27 B;  2DGX A;  5LJ3 Y;  4QIG A;  4LRE A;  5CYJ A;  4KHR A;  1HQU B;  3DXB A;  2I0X A;  2KYX A;  4OLP A;  1HYS A;  4LF7 F;  1B0V A;  1RAG B;  1XBW A;  3IRX A;  3W9H A;  5KG1 A;  4FXV A;  1YBA A;  3L9Z A;  3ILI A;  2ZH4 A;  2Y0S D;  1U1M A;  3K5N A;  1S10 A;  3KLH B;  3DLG A;  2DVI A;  2J7K A;  2LMI A;  2XMW A;  3K0J A;  4ZVT B;  3KUE A;  3CCT A;  1C1B A;  1TKX B;  2K2P A;  5HK4 A;  4ED6 A;  3QAE A;  3W5X A;  3UCG A;  1TK5 A;  2R7U A;  2BW2 A;  1HBO A;  4GKJ J;  2GIQ A;  2GX8 A;  2E7V A;  2WVC A;  3HSJ A;  3JYT B;  1HNX J;  2E9R X;  2BZ2 A;  5J2P B;  1VI7 A;  1HBU A;  4RLE A;  2HPU A;  2CPH A;  4ZPV R;  3FEX B;  4FBT A;  3AA8 A;  5EWG A;  1FDD A;  2JL9 A;  3OL9 A;  1Z1Z A;  3KHH A;  3HK2 A;  3CJT A;  2NR0 A;  2HWI A;  4DV0 J;  4OI4 A;  1S12 A;  3QYY A;  2RUS A;  5E3A A;  1M1G A;  3AJ2 A;  5IM0 B;  4F0H A;  3KJN B;  3QT8 A;  3CJR A;  5D4P A;  1U47 A;  2ZH3 A;  3TP2 A;  3PW7 A;  4PWW A;  4EMD A;  2W8K A;  2C3M A;  2ASL A;  2ASD A;  3IO1 A;  4Q8F A;  1QVG R;  2W9B A;  2RJZ A;  4NLX A;  2IRX A;  3POT B;  2BA9 A;  1NPK A;  2HHH F;  1XNR J;  4AL6 A;  3HVA A;  3THT A;  3CC4 S;  3B82 A;  3ONQ A;  3I0S A;  3Q8Y A;  3FQL A;  2LEC A;  2HQG A;  3H98 A;  4USM A;  4USI A;  2M7S A;  3OFH A;  1HI8 A;  4CH0 S;  5LMN J;  1X7V A;  1F6T A;  2MJU A;  1VJW A;  2BJ9 A;  3EPI A;  2CVI A;  2QC3 A;  2JLE A;  2WW8 A;  2VDI A;  5M2P A;  2XMM A;  1RAB B;  1YJV A;  2DR9 A;  2UUA F;  3G87 A;  4K4X A;  2YKN A;  4USK A;  1UW4 A;  3MM7 A;  4Y2C A;  3M7V A;  5DDR C;  4DV7 J;  4BLG A;  1AB8 A;  1NK7 A;  3EGN A;  3AOA A;  3HT3 A;  1WD6 A;  2NXU A;  4IDK B;  1YRT A;  2DNM A;  1KON A;  4Q44 A;  1HWL A;  2GAH C;  5FDL A;  3MR6 A;  2NXN A;  2ZBR A;  3D66 A;  1OS5 A;  1SC6 A;  4MFB A;  5C25 B;  4PRF A;  4JYA F;  1DAX A;  2ZC3 A;  5D6G A;  5F8N A;  2UUT A;  4LF6 J;  4P7T A;  1FRI A;  4XO0 A;  1XK8 A;  2IMW P;  2G0C A;  2NXJ A;  3I5C A;  3H8Y A;  3VAI A;  3MM6 A;  4P72 A;  1AW0 A;  3JAM Y;  1WOS A;  3MUR P;  2Y1J A;  3HCX A;  5DZ7 A;  4ED7 A;  3I0R A;  2YXL A;  4NXM J;  4LRC A;  1D09 B;  3D67 A;  3ZTO A;  4KGV B;  1TL4 A;  1FDN A;  1RWK B;  4LRF A;  2UVR A;  3D6F B;  1H2T Z;  3P5T L;  2FVQ A;  2YNF A;  3Q24 A;  3CD5 A;  2C2R A;  3D6M B;  5CYQ A;  1RAI B;  3I5B A;  3NNH A;  3VAL A;  5CHC B;  4ALZ A;  2XMJ A;  4DHV A;  1RSC A;  3PX4 A;  3R5J B;  2HZA A;  4OV6 A;  3LPE A;  2DNL A;  3ISZ A;  1QTM A;  4V19 X;  5KFP A;  2J0X A;  1R89 A;  3LW5 C;  4K50 A;  2W4C A;  1RWX B;  2HBZ B;  3G8S A;  1RHR B;  1UA1 A;  4WYW A;  3UCZ P;  2C2Z B;  1Y3J A;  3H4B A;  2C22 A;  1G4C A;  4O3R A;  3GIM A;  2BQR A;  3CUN A;  5T14 A;  1SKU B;  2RDJ A;  2LYV A;  1T05 A;  4TY9 A;  4ZVG A;  3G9C A;  1VRU B;  2HND A;  3P45 B;  2W2P P;  3ELH A;  3M4X A;  5JJB A;  3S6E A;  4DX7 A;  4ZLL A;  4ICL A;  4DR6 J;  1C0T B;  1VOM A;  2I1R A;  4DR4 F;  3V81 A;  3FRY A;  1NKB A;  1WC3 A;  3VVU A;  4LJM A;  1UPM B;  1IBK J;  2UU9 F;  5ETP A;  2YWH A;  2ZZN A;  4ECR A;  4WU2 A;  3HUL A;  1Q16 B;  3UD3 P;  1JX4 A;  3D1O A;  3CCJ S;  3MR2 A;  4NLT A;  5IC4 B;  3TAQ A;  3I9Z A;  3TW0 A;  2FPH X;  2FLL A;  5KFQ A;  3D0H E;  2QTW A;  3GIJ A;  3IN5 A;  1IKW B;  2M5Y A;  2NSC A;  5J2N A;  2W8L A;  5IV4 A;  3U1L A;  4IKA A;  1HWU A;  5LSL A;  4LF8 F;  1V3Z A;  1S1T A;  4RX6 A;  3DHW C;  1YIJ S;  3A1Y G;  4OX7 A;  5JVH Q;  2XY7 A;  5B09 A;  2RQC A;  4DCJ B;  3NGT A;  4KJI A;  3TEG A;  3C66 A;  1EQM A;  2UXD F;  3FRZ A;  2CG4 A;  3VAF A;  2WOM A;  3KJF B;  4P52 A;  4RW4 A;  2HYI B;  4UY8 5;  3TAR A;  3EM1 A;  2PD1 A;  3DU5 A;  2JLF A;  4RW7 B;  1L5U A;  3P49 B;  3GSD A;  4EYH B;  1RWU A;  1VK3 A;  1IKV B;  3W2V B;  1FK9 A;  3UWT A;  1X9S A;  4DQS A;  5F8I A;  2YQ3 A;  1R8C A;  1Q7Y T;  3MEE A;  2BAN A;  3VF0 B;  3Q22 A;  4CNZ A;  4FKY A;  2J8S A;  5HRO A;  2RB7 A;  1I94 F;  1X4B A;  3HFK A;  3RU0 A;  4CO2 A;  1A7G E;  1LW2 A;  1QD1 A;  3EVO A;  4RNM A;  3W66 A;  3IAS 9;  1DQ8 A;  5CD4 A;  5CYM A;  2N7C A;  2G4B A;  2MST A;  1FJ7 A;  1GXT A;  3AOD A;  3FC9 A;  4G1Q A;  1LWF A;  1EX8 A;  1HQE A;  2HHX A;  3LWL A;  5L9N A;  2OGU A;  3Q2S C;  1FDA A;  2FY1 A;  2C2M B;  4DSF A;  4O3N A;  3THV A;  4CLU A;  2AX1 A;  3K59 A;  1N0U A;  2D3O R;  1IWA A;  4C7Q A;  3BR8 A;  4PG7 A;  3J81 U;  1NJW A;  2IM2 A;  1TMJ A;  1RA6 A;  2UXC J;  1RAO A;  2VL1 A;  2I6W A;  3BQ2 A;  1RAF B;  5AE1 A;  2O01 C;  2UUW A;  1DY3 A;  1QAX A;  1OYD A;  3G2X A;  2JJ4 D;  4X4Q A;  1LW0 A;  2CVE A;  2QLF B;  4D3H A;  3C2P A;  1SH0 A;  2AV5 A;  2QL9 B;  1PKU A;  4DPT A;  1TKZ B;  2P5V A;  1UZH A;  4AUK A;  2P9C A;  2L41 A;  4DPU A;  1I51 B;  4DR1 F;  1CC7 A;  1T94 A;  8AT1 B;  2LU1 A;  1B7Y B;  1H2V Z;  1D0E A;  4AT1 B;  3OLA A;  3KLI A;  4YR2 A;  4FYX B;  1RU1 A;  4ZJL A;  1S1U A;  3RR7 A;  2AF6 A;  2D3O 1;  1S9E B;  4GRS A;  3DDK A;  3BKU A;  4KFB B;  4ZOS A;  2VPX B;  4MK8 A;  2XS5 A;  2NLW A;  2DR6 A;  3SQO P;  4GO5 X;  3M8Y A;  2OFG X;  4IOB A;  2CJK A;  3ZZY A;  1UJ6 A;  4LF2 A;  1ZTT A;  2V9W A;  1F5A A;  1GEH A;  4FNI A;  3X3U A;  3QRQ A;  5F8G A;  3Q23 A;  3QGP A;  1CG2 A;  2Z0G A;  4LQ9 A;  4IH7 A;  3CJ8 A;  5D3G B;  1QTN B;  1S79 A;  4Y2M A;  2RQK A;  5B0F A;  4RU9 A;  2RAQ A;  1HQ2 A;  2R8J A;  1M5H A;  2JC0 A;  2BE9 B;  2W2M P;  4HT7 A;  3NL0 A;  2ROG A;  2CPI A;  1BWV A;  2AJ0 A;  2JEG A;  2DHS A;  3ISN D;  2VU5 A;  1NAQ A;  3MD1 A;  5CZX A;  4TLR A;  2WK4 A;  4K5R A;  3OXG A;  1U1R A;  4J37 A;  4J9R A;  4LSN B;  2RF2 A;  3RW7 A;  1S1V B;  5GMK a;  3L95 X;  5KG5 A;  1HFE L;  1R0A A;  3GQC A;  4A47 A;  2DCL A;  2VG7 A;  4DUT A;  4KV8 B;  1F1B B;  2MQL A;  2ZIT A;  1XMO F;  2VQE F;  1HNZ J;  4X4O A;  1XMQ F;  1W2I A;  4G3I A;  2PFF B;  4ZA1 A;  5DRK A;  2PSZ A;  3RB3 A;  4J9U E;  1VQK S;  3K5P A;  3A4T A;  1QJH A;  3TWZ A;  3A3N B;  4M5G A;  1RT3 B;  2BX6 A;  2M0G B;  4O3S A;  5EWE A;  4RW9 A;  1N5Y B;  2HQC A;  3CD7 A;  2OSQ A;  3JB9 k;  3EWG A;  3VTI A;  2VIH A;  1CJU B;  4OMF G;  3M8Z A;  3R5A A;  4X4P A;  5GAH I;  2YVS A;  5AXN A;  9ATC B;  3G6Y A;  1IKY A;  2KT2 A;  4FKX A;  1IBL J;  3AXM A;  1WNE A;  3ZZP A;  3MM9 A;  3R27 A;  1FVQ A;  2YKM B;  4AXI A;  3TZW A;  4CM0 A;  2W25 A;  3I4P A;  2G2Z A;  3C6T B;  1UVL A;  4MYU A;  2YX1 A;  1N34 F;  3GFH A;  1RAC B;  1ROF A;  3CD0 A;  1MWZ A;  3NRB A;  2XWX A;  2X51 A;  4DEZ A;  2XYG B;  4TU7 A;  3QRR A;  4F02 A;  4HAC A;  4DU8 A;  1YX2 A;  1FFG B;  1EKS A;  5DG9 A;  1NJZ A;  1JJC B;  1SL0 A;  3KLE B;  1GQE A;  3KLF A;  4JI6 J;  3MMC A;  2UXB J;  5IT9 U;  1RHM B;  4ZVH A;  2HFS A;  2G0I A;  2CA9 A;  1T9T A;  2DBB A;  4M5M A;  5C24 A;  3Q8S B;  4OI0 A;  4DCO B;  2DPI A;  3P4U B;  4LFA J;  5KFM A;  4DBQ A;  3CNQ P;  2QT7 A;  1FRK A;  3AQO A;  1SPB P;  3FVY A;  2IY5 B;  2DB1 A;  1N5Q A;  2R7X A;  1CS4 A;  2IRU A;  4HKQ A;  3BPD A;  4I67 A;  3EZO A;  1JLE A;  1ZOT A;  3Q8Q B;  2NXE A;  2AEF A;  2XQC A;  1TL1 B;  4CYU B;  4CTA B;  1BGX T;  2C2K B;  2MXY A;  2QSF A;  3NWR A;  2ZD1 B;  5HVF A;  1H0H B;  1JLC A;  2AYB A;  4NRU A;  2HHP A;  4G65 A;  2XNQ A;  4URG A;  1RE1 B;  3G82 A;  2BJ1 A;  4KGZ B;  3GIK A;  1S0V A;  1XWL A;  2ZKT A;  4X4R A;  1G2E A;  1SC4 B;  3PYG A;  5B0B A;  1RT7 A;  3TAN A;  4B9L A;  3P3D A;  2AMC B;  3U27 A;  1WEX A;  2E9T A;  5D4L A;  2EBG A;  2H5E A;  4ECY A;  2XLJ A;  3H7H B;  2RQ4 A;  5ADZ A;  4HL9 A;  1ZM4 A;  2DK2 A;  4USV A;  1FRH A;  1N32 F;  5F8M A;  2EI5 A;  3HZE A;  3OTO J;  5J1E B;  1IBM F;  3G8Q A;  3LGH A;  5KFE A;  1WHV A;  4FF4 A;  3C46 A;  4ZJQ A;  1RU2 A;  3NCP A;  3NY0 A;  2DIV A;  2YX4 A;  2DNN A;  5JMN A;  3UI3 A;  3N79 A;  2BDP A;  6FDR A;  3ZO7 A;  4TXS A;  3D0I E;  3FK4 A;  2F4V F;  5GAH U;  1HYS B;  2CDR B;  3OVS A;  4KPC A;  3DI6 A;  1C2P A;  2ZH8 A;  2DGW A;  3PKY A;  2B8P A;  4YB6 A;  2NRE A;  1EKR A;  3E01 B;  3DLG B;  2X1F A;  1M5V C;  2H54 B;  3W5Y A;  5HBM B;  2CQI A;  5FLX Y;  1X0P A;  2A2D A;  2YKO A;  2DEI A;  2E7X A;  2Q66 A;  3MMB A;  2ZH1 A;  1KSP A;  2KFN A;  2XZT B;  5D0E A;  4YQW A;  3G6V A;  1VRT A;  3VGT A;  1VRQ C;  4GKK J;  2M8D B;  4UOC A;  1HBO B;  1RHU B;  4KB7 A;  3RB4 A;  2XSJ B;  4X62 J;  1G3O A;  4OLO A;  5D15 A;  1VQP S;  2UP1 A;  3TVZ A;  4J7C A;  4Y34 A;  3FQK A;  1ZAW A;  2U2F A;  2DD8 S;  2VOP A;  2GGP B;  2H5I B;  4NLG A;  3J81 j;  1U45 A;  4KH1 B;  2Y3Y A;  2M52 A;  3DOM A;  1GT8 A;  2BW7 A;  3FSI A;  4OZL A;  2W2Q P;  3UE2 A;  1SV5 A;  4U7U D;  3V6D B;  1AZS B;  4DL0 C;  2M2B A;  3I82 A;  2MQ8 A;  3GON A;  2R7O A;  2ZJQ Q;  3G96 A;  2D1C A;  4K4Y A;  3THP A;  4TQS A;  2B0G A;  3CJ3 A;  4GO7 X;  3SFG A;  5BXI A;  3KNG A;  3IA0 A;  3H5U A;  4DUZ J;  2H48 B;  4DQR A;  8ATC B;  2IFX A;  1HA1 A;  1LWE A;  3KDO A;  5KFB A;  2C3O A;  4HT5 A;  3I0S B;  4IYQ A;  4B3T J;  3PXG a;  3MCS A;  4ZCL A;  2J6S A;  1IM4 A;  4ZPT R;  4YME A;  1KQK A;  3UDV A;  3OR2 A;  2N3O A;  1VC5 A;  2ZNZ A;  3QGI A;  3J7A 1;  2AGQ A;  1S1W A;  4JI4 F;  1WJ9 A;  5L1L A;  2IAJ A;  3PX6 A;  3GCX P;  4F4A A;  2ZWO A;  2FVS A;  3KUG A;  4CQ1 A;  1H38 A;  3C8Y A;  4IH5 A;  4RO0 A;  2XMV A;  2ASY A;  1UJ5 A;  3MAQ A;  3NMR A;  4DQQ A;  3GP9 A;  1U09 A;  4YOE A;  2MEW A;  3DRS A;  4IO1 A;  3HHL B;  3C15 A;  1RT6 B;  3L7O A;  4X84 A;  2WB4 A;  3W63 A;  1KFS A;  4KC5 A;  2WBM A;  4KGK A;  3K2Y A;  3Q0A A;  5D0G A;  3RW6 A;  1YK9 A;  1MML A;  1BE4 A;  1UZD A;  2I5J A;  1UPP A;  2G2O A;  4M5I A;  4LQ3 A;  2QV6 A;  1CEZ A;  4ZS6 A;  4MIW A;  3E2E A;  3AY0 A;  4XDD A;  5DG7 A;  1RT1 B;  1RHJ B;  1D9D A;  3NOC A;  3BKF A;  2B7C B;  4OHV A;  1SL1 A;  4FNH A;  4TYA A;  2HQD A;  5C2G A;  3AT1 B;  1RBO B;  1RT4 A;  2PII A;  4ZVP B;  5AT1 B;  5A0Y B;  4ZLN A;  1W7W A;  4ZK7 M;  2JEF A;  1SBR A;  4Q0B B;  4HDG A;  1Q8L A;  2CJ9 A;  4H4M A;  3I0R B;  5EGY A;  4KY3 A;  1YTY A;  4DV6 F;  1N5T A;  2PDA A;  4C8N A;  3KYL A;  4FF2 A;  3NNC A;  4NLD A;  2VD3 A;  1J2V A;  4NZ0 A;  2OI2 A;  3Q8U A;  2YNF B;  2GMJ A;  5EX3 A;  2A0F B;  1KVI A;  2GHW A;  1S4F A;  4KGX B;  2IJF A;  4DV2 F;  2NQP A;  1P9Q C;  1IJF B;  3MED B;  4DR3 J;  5B0A A;  2BM1 A;  4TYB A;  4ED5 A;  4JI7 J;  4A8Q A;  2KJW A;  3KLV A;  4NE9 C;  3O1L A;  3MMA A;  2V67 A;  3IXQ A;  1VQS A;  2DHH A;  5HP1 B;  2I9S A;  3GIL A;  4RWX A;  3PRD A;  3U1M A;  4GC6 A;  2UUC F;  4RL1 A;  1MWY A;  4OQJ A;  3FCV A;  4ZVE A;  3C14 B;  2MTL A;  1PJ7 A;  4NLS A;  3JS9 A;  4OJ1 A;  5L39 A;  2DRD A;  5J1N A;  1NHV A;  4N76 A;  1MU2 A;  5J2M A;  4QWB A;  4G1I A;  5DZ6 A;  2FHJ A;  4E2F B;  4OZN A;  1LK7 A;  1SKS A;  4PCQ A;  1WF1 A;  4DCP B;  1T05 B;  4L74 A;  3FEZ A;  1EZZ B;  4H4K C;  3VAK A;  1WEL A;  4NCA A;  1QAI A;  3N6N A;  1FI4 A;  4RW8 A;  2DNQ A;  2WVF A;  2J9D E;  4M8L A;  4ICL B;  4IQX A;  4DS4 A;  4QYR A;  1HBN A;  4DV1 J;  2PMH A;  4BBY A;  3V81 B;  1PC4 A;  3ZZ0 A;  2MKS A;  4I2P A;  1H3D A;  1KLM A;  4LBI A;  2YKA A;  4YHH F;  2ZHA A;  1HPZ B;  1T95 A;  4I7F A;  1H73 A;  1FXD A;  3MAH A;  1S48 A;  2VG5 B;  2L9N A;  3HHN B;  1KD1 T;  1A6L A;  1Y3K A;  1T9U A;  5C5J A;  4ECZ A;  3CUL A;  1WKL A;  3OR1 B;  1T9X A;  2VOO A;  2GNK A;  2DYA A;  2ZH6 A;  1N5V A;  4X66 J;  4E8U A;  1ZBT A;  1RT2 B;  3OFG A;  4F04 B;  4K4V A;  2X1B A;  2ADC A;  1X9W A;  1HNV A;  4NA2 A;  4LFB J;  5DGA A;  5E3Q A;  2WW4 A;  1XNQ F;  3M9O B;  4NA3 A;  5ETV A;  1HQU A;  2WOM B;  4RW4 B;  1Q4R A;  2CJX B;  2AP6 A;  4DU7 A;  2R8K A;  4O44 B;  3BBF A;  1VCT A;  1NZA A;  1YVF A;  1ZA1 B;  2IBO A;  2FLO A;  3SCJ E;  4Z7Y A;  4I1T A;  4OZ3 A;  4DL2 A;  2HRT A;  4A46 A;  3D9B A;  1FFS B;  4HTI A;  2HZV A;  2LQJ A;  2OEM A;  3TA0 A;  2PI4 A;  2L9D A;  3W3S A;  2FDN A;  4OV1 A;  2BAN B;  5HRO B;  1TKX A;  3LAK A;  2YQ0 A;  2ZKU A;  2VOD A;  5ETL A;  1S9G A;  3KJQ B;  4P2S A;  1YSJ A;  3QJP A;  2P9G A;  1ZZF A;  3JYT A;  4USJ C;  1Q7L B;  1U6B A;  1PYS B;  4R0J A;  4ECQ A;  1HQE B;  1XMB A;  2IHR 1;  1TTH B;  2YWK A;  2OH2 A;  2AJ2 A;  4HTJ A;  2V8H A;  2NSB A;  4JI3 F;  3BF4 A;  4JI2 F;  3GV8 B;  2OEJ A;  4YB1 P;  1C1C B;  5J2Q A;  4QOT A;  1KHW A;  1CBK A;  2VAS A;  5IM0 A;  5KOW A;  3TOQ A;  4LF9 J;  2X3G A;  1K1Q A;  5BYS A;  1F2H A;  5HL7 Q;  4HYK A;  1R27 B;  4KH0 B;  4QR2 A;  1LW0 B;  1FJG J;  2IM1 A;  3MTK A;  2BUN A;  1UMJ A;  2R2R A;  5LM7 E;  4BWM A;  2J9E A;  2B56 A;  4NRT A;  3PIP Q;  1OIA A;  3R5D A;  2CAD A;  3FCH A;  1KNZ A;  3IWN C;  1ITP A;  4PYA A;  4QW8 A;  4DQI A;  1RK8 A;  4Q2L A;  1TUV A;  1IVZ A;  1G1X A;  4DZD A;  2KN4 A;  1SC1 B;  4JOU A;  1CJT A;  5H9F J;  1FEH A;  1ZPW X;  1HNX F;  4M5J A;  1VQY A;  2J0Q D;  2F4F A;  5J1P A;  2EG1 A;  4L73 A;  3MGJ A;  5THW A;  2GJI A;  3VGU A;  2EFO A;  5GAD U;  2XWY A;  1EB0 A;  4JI0 J;  2L48 A;  1SQF A;  3QGH A;  2A6O A;  2FGC A;  1NU4 A;  4Y2I A;  2HHS A;  3A8K A;  2IVF B;  3GJQ B;  4PQA A;  4FYY B;  1AT1 B;  4F2R A;  2DRB A;  2HNZ A;  1VHF A;  4DV0 F;  4MK9 A;  3OL7 A;  2DHX A;  4IDK A;  4C0O C;  3D5M A;  2KT5 A;  3WX4 A;  9RUB A;  2QZ8 A;  3T41 A;  3CIZ A;  3C19 A;  3QQC D;  2K3I A;  4F4Z A;  4PUO B;  1L3U A;  3TUZ C;  2RIL A;  1TR0 A;  4PYD A;  3OT9 A;  1HHS A;  4NXN J;  3O3L A;  5C25 A;  2V8V A;  2RRB A;  2QA4 G;  3BGL A;  4QPX A;  2HLU A;  4LR8 A;  1GMW A;  1FD8 A;  4YS2 A;  2DY9 A;  5IOL A;  1XNR F;  3CSK A;  2PMZ D;  3ENA A;  4YUD A;  3IMQ J;  1UVJ A;  2M3D A;  4JI1 J;  1HWJ A;  1DQ9 A;  1U8S A;  1P6T A;  1Y10 A;  1AA1 B;  3ZXW A;  1Q1K A;  2EWH A;  1TKT A;  4KPY A;  1R43 A;  2DJW A;  3R6L B;  1VC6 A;  3UNY A;  1Y11 A;  1ZTW A;  2CZ9 A;  4X4S A;  5DDP C;  1QUV A;  2AZ1 A;  3W1Y C;  2KHD A;  2E1C A;  3AOB A;  4WBF A;  1U4B A;  2B7B B;  4ILM A;  4AQY J;  4BCA A;  4LRA A;  2GCF A;  2QLJ B;  4Q7A A;  3OBI A;  3WZ0 A;  4J9V A;  2MLZ A;  3FBC A;  4ZPD A;  3T5J A;  3CCM S;  2AHO B;  4I69 A;  3MEK A;  3KK2 B;  3CCS S;  1H7W A;  3HO1 A;  3MM9 B;  3BSA A;  3PVX A;  2OD4 A;  4KE5 A;  4LF4 F;  1F9H A;  1UVI A;  1FJE B;  4LIW A;  3P6Y C;  2VG6 B;  3EUN A;  4NI2 B;  3D0G E;  3NBP A;  4LF6 F;  2B51 A;  2E5L J;  2IM0 A;  1U1K A;  4MMO A;  3ENW A;  4B3O A;  7AT1 B;  1OPI A;  1RZM A;  3GR0 A;  3R5G A;  2J5A A;  1FKP B;  2FHO B;  1X4E A;  2F7V A;  1RQ0 A;  3SDE B;  4NXM F;  2ZEJ A;  2DT9 A;  4KKO B;  5E7O B;  3KLF B;  5K5M A;  2Z2L A;  1P1T A;  3MMC B;  4EUV A;  2KI2 A;  5JXS A;  5BR8 F;  2V8D A;  1CQN A;  2QX0 A;  2AJQ A;  1RDR A;  6FD1 A;  3LA0 A;  4C48 A;  3NGD A;  4WE1 B;  3CDA A;  1RKI A;  1TV6 B;  2BAC A;  4WTO B;  2HK3 A;  1CS4 B;  2XSF A;  1RTJ A;  3D6H B;  3DGP A;  3OTB A;  2D3U A;  5KT7 A;  1U2C A;  3OTC A;  3W8G A;  1GNK A;  4LF7 J;  1P9Y A;  2HS0 A;  1IKW A;  2B9W A;  2DRA A;  1NSA A;  4HHU A;  2BE2 A;  2DNP A;  5G0R B;  2HNY B;  4NX9 A;  2EFN A;  1WWH A;  5HQL A;  2W7A A;  4DPY A;  4CO1 A;  1TMM A;  2CPY A;  5KFT A;  1OPZ A;  4OYA A;  4DSE A;  4USU A;  2MQQ A;  4LBP A;  1Z2L A;  3WDO A;  4ZIT A;  3CJS A;  4IRC A;  2QMU B;  2D9O A;  4KTQ A;  4ZP9 A;  2QL7 B;  3MTJ A;  4QIE A;  4HH0 A;  4BS2 A;  3PHE A;  5GAG I;  4RW7 A;  3OUY B;  3CME S;  1IQZ A;  2MQP A;  1KTQ A;  5A8R A;  3W2V A;  4LIR A;  1PC5 A;  2CDQ A;  2YWW A;  4WFN Q;  4AD6 A;  2EFP A;  3WIV A;  1ZPV A;  1WEY A;  1ULR A;  3KK3 B;  4YDX A;  4DR6 F;  3A13 A;  3QFH A;  4DL7 A;  2AQ4 A;  2OAU A;  3MCM A;  1S6U A;  4O3P A;  4ZPW R;  1RTD B;  3HSG A;  4KGM A;  4YR3 A;  1R31 A;  2MSS A;  4YR0 A;  1IBK F;  4U67 Q;  2EK1 A;  1G7C B;  2FHK A;  4QBU A;  4DL6 A;  1PCA A;  5CAA A;  2HFU A;  2WHO A;  2ATC B;  1F5B A;  2R2T A;  4Q5V A;  1MMN A;  1X4C A;  5GAE U;  3H40 A;  2HFN A;  2V63 A;  4ID5 B;  3RBE A;  2D9P A;  4QIV A;  4ES3 A;  2GHV C;  2RD5 C;  3MPV A;  3ETO A;  1VQ6 S;  3UFC X;  2DR5 A;  2HBR B;  2RDI A;  3GWC A;  3DI6 B;  4C8K A;  3SXL A;  3ETM A;  1RCX B;  2FUG 9;  3NGR A;  4CLY A;  1FXR A;  1MLA A;  1T9V A;  4WP3 A;  2KZM A;  5D4O A;  3QZ7 A;  2ZZM A;  2OFH X;  2BJ3 A;  2JC1 A;  1FHT A;  2HQ3 A;  3KUH A;  3TZZ A;  4WZM A;  4C3L A;  1ELO A;  1OSC A;  2UV8 A;  2VV5 A;  2DPJ A;  3GG1 A;  2UUA J;  1S6P B;  1TKZ A;  5ETQ A;  3T5L A;  3BS9 A;  3PNI A;  1NSQ A;  1S6O A;  2WRM A;  1R8B A;  3KG4 A;  1VMB A;  2ZHB A;  5FLX U;  3WC0 A;  4KYZ A;  3HJV A;  4RUB A;  4YY3 F;  1B3T A;  2HS4 A;  1KFD A;  1U0S A;  4ECW A;  2E5I A;  2GQ2 A;  2OD6 A;  1FRJ A;  5A6W A;  2CQB A;  4ED3 A;  1S97 A;  3M8S A;  4KFB A;  4L72 B;  2E1M C;  2P6S A;  1U6Z A;  3BPS P;  3BKT A;  3DOM B;  4EU0 A;  1QM9 A;  2ZH9 A;  2DR8 A;  1SV5 B;  4JYA J;  1SQE A;  2XLI A;  1DHM A;  4OI3 A;  5EX0 A;  3DHX A;  2VPZ B;  3BBC A;  3GV7 B;  4HH1 A;  2DIU A;  4IRK A;  3JXO A;  2XO6 A;  1YBU A;  2EPI A;  4NLO A;  4Y00 A;  2FY8 A;  1REV B;  2MHE A;  2M4M A;  4NL5 A;  3FUY A;  3BZQ A;  3DCA A;  1T03 B;  4N8N A;  1F9E B;  1QAY A;  2KZZ A;  2FC9 A;  4XPC A;  3MD3 A;  2CNK B;  3MM5 A;  4ZPA A;  3C6U B;  3NWG A;  2DNO A;  1WI8 A;  2D41 A;  1RHQ B;  3CCZ A;  4JBC A;  4B9U A;  4LSN A;  3DLK B;  2VDH A;  1S1V A;  5GAG U;  5D0H A;  2OML A;  4UY8 T;  3HSD A;  1FX4 A;  1ARO P;  3SYZ A;  2AJF E;  3KNA A;  2IAJ B;  1RAA B;  4PAA A;  4HI1 A;  3B6B A;  4DZ6 A;  3CDU A;  4I6A A;  2FVR A;  3AAW B;  3JQK A;  2E5J A;  5KFC A;  1YJN S;  1P8G A;  4ZDN A;  4OX9 J;  3C15 B;  2HGM A;  1R6V A;  3VQS A;  1NHU A;  1FTR A;  4YN3 B;  2CQ0 A;  2AU0 A;  2ROP A;  1WC1 A;  1WHX A;  1RT3 A;  4K4S A;  2OMO A;  3AH6 A;  1N5Y A;  2APO A;  3PW2 A;  1ZM2 A;  4NLY A;  5F3T A;  4HEA 9;  2V2V A;  3AXK A;  4FPR A;  3MMJ A;  3BEG B;  1CJU A;  2R2S A;  1ZAX A;  2HQF A;  1NJI T;  2MGZ B;  3OSP A;  2Q1L A;  5F8H A;  3P8B B;  1S7H A;  2XM3 A;  4QYZ J;  4LR9 A;  3QIP B;  4J5O A;  1PIL A;  3CWJ A;  2YKM A;  1HD1 A;  4MKY A;  1FE0 A;  1RT4 B;  4IG3 B;  1SXL A;  2B9E A;  3TAM B;  2OLW A;  2LXI A;  4OI2 A;  2YNI B;  3LGM A;  3UR0 A;  3N0V A;  2QA1 A;  4OJG A;  2NUH A;  2DXE A;  3OVB A;  1UAW A;  4TKT A;  2UU9 J;  3F0N A;  3MUV P;  3ILJ A;  1WSV A;  4NYZ A;  2BVZ A;  3EE3 A;  2PE8 A;  2RIJ A;  3DLJ A;  1Q53 A;  4CO0 A;  3NGU A;  2E9Z A;  3N5F A;  1OY6 A;  3GPA A;  3KLE A;  1S59 A;  4C8M A;  2ZM6 J;  2B9X A;  3PDN A;  5IWA F;  3ZTR A;  1WKJ A;  3TI0 A;  4RNN A;  1HMV B;  3ZZO A;  3LF0 A;  2R3V A;  4YB7 A;  3BSC A;  2Y1R I;  4KBI A;  4O4G A;  1FWL A;  1C4C A;  1BC6 A;  2BOP A;  1FFW B;  2BJ7 A;  4KHP F;  4X64 J;  2BJE A;  1U48 A;  3MPY A;  1X9M A;  3QLH B;  2JH3 A;  6AT1 B;  4WFY A;  3HP6 A;  3NGK A;  4WTY A;  3QJL A;  3IS9 B;  5KFS A;  2MZJ A;  2W01 A;  1IBL F;  1J27 A;  1TL1 A;  3QRP A;  4CTA A;  2YKQ A;  1FKA F;  2ZE2 A;  2QE5 A;  2QYC A;  5D78 A;  2AGP A;  3BSN A;  2ZD1 A;  1KLN A;  1HBM B;  2HVI A;  5B7W A;  1SCJ B;  1DZ5 A;  2AIR B;  2DY1 A;  2HFZ A;  4RBT A;  3IFE A;  3S7R A;  4RW8 B;  2E5G A;  3T1Y J;  2IDL A;  4LR7 A;  2RU3 A;  3CTR A;  3NP5 A;  4JP8 A;  2MQO A;  2J0S D;  2V8P A;  4NEZ A;  3M9M B;  2ZHO A;  1RA7 A;  1HBN B;  2VBW A;  2EFG A;  1NZ8 A;  4CIO A;  4ES1 A;  1J5E J;  4I2P B;  1LQ9 A;  5DO2 A;  2IA6 A;  1KLM B;  4JI6 F;  2FIU A;  3SMZ A;  4ED8 A;  1RYS A;  3T1A A;  5HMY A;  5KG4 A;  2JRS A;  5F8J A;  5LJ5 Y;  4ZCK A;  5HAT A;  1H72 C;  4IR9 A;  1YDL A;  1VJQ A;  1NDC A;  1KBR A;  2RS2 A;  2MKJ A;  4OYI A;  1UW9 A;  5J1E A;  4W4M A;  3RBZ A;  2J6T A;  2MY8 A;  1GMW D;  5F0W A;  5B0E A;  2ILY A;  4ZLJ A;  1MSW D;  4LVO P;  4OFZ A;  4QYZ K;  3PJX A;  3PV8 A;  2R7T A;  2NYI A;  1HNV B;  2HZC A;  5A8W B;  3PYE A;  4HLB A;  2EFQ A;  4Z37 A;  3HD2 A;  1RHK B;  4CWB A;  3I32 A;  5A6P A;  1F0X A;  2KH9 A;  3R3T A;  3D3C J;  2QFJ A;  3CED A;  4C3K A;  2P6T A;  4PR6 A;  1O8B A;  4EBC A;  5I42 A;  3GFX A;  2V4J B;  1QSS A;  3SQG B;  1V3R A;  1VQ8 S;  4A8Y A;  2KKH A;  4IOA Q;  1PGZ A;  2BEF A;  3E01 A;  2DCU B;  4KIA A;  1NRK A;  1HNW J;  2K3K A;  2ZBP A;  1WC0 A;  5HBM A;  3PO4 A;  4NYP A;  5ETM A;  5D77 A;  1T3N A;  2YTC A;  1N56 A;  1JKH B;  4WXW A;  4OL8 A;  3N9U C;  2VC1 A;  4NZ7 A;  2R42 A;  1S9G B;  3W5Z A;  1EAR A;  2ABY A;  3QSY B;  2XSJ A;  1HW8 A;  1TAQ A;  3LUY A;  3A12 A;  2IA0 A;  2GMH A;  5M2U A;  3RR8 A;  2ZVI A;  2GGP A;  2GS8 A;  5D4N A;  2K7J A;  2XZD B;  4K4Z A;  1LWC B;  1GMV A;  4FXW A;  4PG8 A;  4KO0 A;  4W92 B;  5J2Q B;  2EEY A;  1FWK A;  2G13 A;  3V6D A;  5SUH A;  1AZS A;  2YPZ A;  2YBV A;  1U26 A;  4FXD A;  2XYH B;  3D3B J;  2YX7 A;  2POK A;  4ETZ A;  1IKX B;  4B3M F;  2ZZT A;  1KEK A;  4J9P A;  2RRA A;  2QJ3 A;  2XY6 A;  5HQ8 A;  1B64 A;  3VR1 A;  4EBE A;  4C8Y A;  4ITS A;  1X4A A;  2K8G A;  1S77 D;  1Q5Y A;  1T8E A;  2RT3 A;  3US5 A;  4QWE A;  1RAE B;  2FJA B;  3IG1 B;  3X1L B;  3UR3 C;  4DV5 J;  4DSK A;  2ERR A;  4DSL A;  2DNG A;  4TU8 A;  3QFW A;  4GKK F;  2H4Y B;  1RLD A;  3UN5 A;  2JFD A;  1CJT B;  5ETK A;  4X62 F;  4UZC A;  3J7A N;  1LV5 A;  1TUW A;  3ISN C;  4ELU A;  2ACM A;  3KFW X;  2DH9 A;  2EVZ A;  2OEL A;  1B70 B;  2KG0 A;  1SQG A;  3R97 A;  3O6Q A;  1FKO A;  1ZAV A;  2DGQ A;  4MTP A;  2XCA A;  1WTB A;  1RB0 A;  4Y0F A;  1RYR A;  3HHL A;  2V69 A;  4F4X A;  1RT6 A;  2MB0 B;  4DSI A;  4J9L A;  2GW8 A;  1VIO A;  2HNZ B;  2GVZ A;  2QMX A;  2LQB A;  1WTF A;  1M5O C;  1DJ0 A;  2ZVS A;  1VIX A;  3LGN A;  3FSX A;  4M5H A;  1N34 J;  3TVY A;  1S7I A;  4PG4 A;  3UD4 P;  4TN2 A;  4DR5 J;  5C42 B;  4ZVR B;  2FJD B;  2CNO B;  3LAM A;  3FBB A;  2FVP A;  1LWX A;  2F8E X;  3FJ2 A;  4DUZ F;  2IRY A;  1QDU B;  1GX6 A;  3W65 A;  3ITH B;  1X4F A;  1RT1 A;  4NCG A;  5BYR A;  5KFV A;  4EK2 A;  3CE8 A;  1VS3 A;  2J0W A;  5L8R C;  3NS6 A;  5A0Y A;  2V8G A;  3GU0 A;  5KFG A;  1AFJ A;  1WDD A;  1TEL A;  4Q0B A;  1TKT B;  4G1P A;  4WFA Q;  5KFD A;  2MZT A;  3J7Z 5;  5CCM A;  5KOX A;  1Q79 A;  3CIM A;  4DUY F;  4PQU B;  4L3K A;  3BO2 A;  2ZH5 A;  2O3D A;  5LXY A;  2UVU A;  4C8O A;  2HHU A;  5I3U B;  3JSB A;  1YZ6 A;  1WAC A;  3WIU A;  3Q2T C;  5LMU F;  3L7U A;  3MED A;  4P2M A;  2Z58 B;  4EBD A;  2AKW B;  3M6U A;  1M5K C;  4JB8 B;  5DLF A;  3TA2 A;  4WYL A;  1AUS L;  5HP1 A;  2ADB A;  3H5Y A;  2W7P A;  2N82 B;  4U8Y A;  2WBR A;  1DTQ B;  5KT6 A;  1NK0 A;  3GJR B;  3SCI E;  3BO4 A;  3C14 A;  2C42 A;  3B8H A;  5BJR A;  2WZ1 A;  4MKA A;  4IUF A;  3NBP B;  1VBK A;  2M88 A;  5GVQ A;  2RHQ B;  4B3O B;  1SL2 A;  3G86 A;  2VFV A;  4QW9 A;  3IBW A;  3P5B P;  3ZNJ 1;  4YDD B;  4ZP6 A;  2F8M A;  3ILO A;  1N32 J;  4PEO A;  5KFN A;  2VON A;  4YP3 A;  2VB6 A;  1S57 A;  2C1E B;  4HVZ A;  1FF2 A;  5I4M A;  2HMI B;  4R8U A;  3KHL A;  2W9C B;  1N33 J;  1S72 S;  2HS3 A;  3AD8 C;  2M9K A;  3CMA S;  4ED1 A;  1UFW A;  1IQT A;  4B3S J;  4ECT A;  3QID A;  1DQA A;  1V6H A;  4UTG A;  4DR3 F;  2R8I A;  1T02 A;  3EVM A;  1HPZ A;  1FT8 A;  5ETN A;  5AJ3 J;  2VG5 A;  1FE4 A;  2LVW A;  2KL8 A;  2CJB A;  1RTJ B;  2LFV A;  3QMQ A;  4RW6 A;  3DGP B;  1TQL A;  4PG6 A;  4OYX A;  2F4V J;  1O0P A;  3HJF A;  3FMW A;  2G9O A;  2DGT A;  4I6Y A;  2OPR A;  3V5R A;  3OR1 A;  2ZDO A;  5CH7 B;  2ZOF A;  4B3R J;  1ICE B;  2JEI A;  1OY9 A;  2BE2 B;  1S0M A;  1RT2 A;  2HVE A;  3GFZ A;  2KTQ A;  3M8P A;  3MFI A;  2WB1 D;  4XDC A;  3M1V A;  1UA0 A;  1H2U X;  2QMW A;  3M30 A;  4WFX A;  4WP9 A;  3DOL B;  4OHX A;  1HNI B;  3PRB A;  3EDQ B;  3PRV A;  2MKH A;  5IT4 A;  2W2O P;  1CC8 A;  2HGN A;  4O23 A;  4RWW A;  4O44 A;  1Q0N A;  3DDN A;  4CLW A;  5A8R B;  3LO3 A;  1VBZ A;  4RU2 A;  3OL8 A;  3LAN A;  3JSR A;  1WG4 A;  5E2Q A;  3M32 B;  5L9X A;  3HVT B;  4C11 B;  3RB6 A;  3HXM A;  1NSP A;  3OW2 R;  3TQE A;  5KFZ A;  4CH7 A;  2R7Q A;  1Y5N B;  4U9R A;  2KVQ E;  3OHA A;  2KVI A;  1BWE A;  4UF4 A;  3J81 Y;  3N5B A;  1KQS R;  1ZH5 A;  2CQ2 A;  3BGF A;  1VC0 A;  4FS1 A;  3T3F A;  2JEJ A;  2WAQ D;  2Y1I A;  2WVB A;  2Z2Y B;  4C8Z A;  4ZVF A;  4JI5 J;  2F9J A;  4H4O B;  1TUG B;  3VVT A;  2AGO A;  2XB2 D;  2PGC A;  2XG8 A;  2BYC A;  4NAS A;  3LP2 B;  2MZS A;  2DGV A;  1C1C A;  4DWI A;  3GE9 A;  2OPS B;  1TL7 B;  5JUM A;  3H42 A;  1Y5L B;  3PJW A;  1HR0 J;  2BRK A;  1UVM A;  3PFE A;  2B6A A;  2B5J B;  1WC4 A;  1KHV A;  4AND A;  1QVF R;  4M95 A;  1XN9 A;  3KMS A;  1Z4U A;  4A8W A;  2J7W A;  3FBF A;  3HDS A;  4ECS A;  2KB2 A;  3MF5 A;  4NPO A;  5AXK A;  3I56 S;  2W1B A;  4IH6 A;  1H6K X;  2QYG A;  4B9N A;  1FEE A;  5CZV A;  3UNG C;  4IFY B;  2GML A;  1L3K A;  3PY8 A;  1MMD A;  2X3D A;  2C2O B;  5A2Q U;  3OD2 A;  3GR1 A;  4AYB D;  4U96 A;  2CQG A;  2EW9 A;  3FBE A;  4B08 A;  1XEZ A;  1Q8I A;  1R8H A;  2Z4P A;  1ZET A;  1S6Q B;  4OI1 A;  2P9E A;  2GHP A;  3TRG A;  2XHW A;  2FJV A;  2X7I A;  4WK3 A;  4DL3 A;  4DFK A;  4U6P A;  2YWG A;  4FF3 A;  2DO4 A;  3ET6 A;  4ER8 A;  2CJQ A;  5KG6 A;  2NUU G;  4IFV B;  2VBZ A;  3DRR A;  3SSQ A;  5ETS A;  3BB5 A;  4B9S A;  1N54 B;  2CZV C;  3DDI A;  1NJX A;  4LF9 F;  1FNM A;  4OZ2 A;  2ZJR Q;  2V4Q A;  2IDE A;  2O5D A;  4PUO A;  1OQ6 A;  2VQF J;  1HHQ A;  2Y8W A;  1K47 A;  3HHK A;  2VA2 A;  4DV6 J;  3IP0 A;  1IXK A;  1FJG F;  5GMD A;  1UFL A;  1MN9 A;  4KR0 B;  1FJC A;  2VJU A;  3MM5 B;  3TX8 A;  2UVW A;  4ZN1 A;  3I4H X;  4DL5 A;  3D1Q A;  4BWJ A;  3PFO A;  3LTO A;  2VZ9 A;  4RNF A;  3HFZ B;  3F44 A;  3JTO A;  3M9N B;  4IQM A;  4ILR A;  4K4W A;  2H65 B;  2ZNY A;  3D28 A;  2J7U A;  3OLB A;  4C98 A;  3LP1 B;  3H2L A;  1RBA A;  1YRU A;  3H2V E;  3EMT A;  4CM2 A;  1Q8B A;  1KRP A;  3OJU A;  3QWP A;  3KHR A;  1E6V B;  3FEY B;  5SZT A;  2KHC A;  3F56 A;  3JQJ A;  3KDN A;  1U0H B;  4JI0 F;  4KQZ A;  2ALY B;  2YY3 A;  5H9E K;  2F9D A;  1R6Y A;  5K8O A;  2FZG B;  3SV3 A;  5KG7 A;  3CF5 Q;  1WKK A;  1RIS A;  5L38 A;  3CJ0 A;  1URN A;  3NAH A;  4BC7 A;  2AD9 A;  2ALZ A;  2DH8 A;  1KR4 A;  3RGI A;  4LRD A;  4DFM A;  1NK9 A;  3H59 A;  5KG2 A;  1YJR A;  4IR1 A;  4LFC J;  5K20 B;  4NLU A;  4HHJ A;  5DJB A;  1JJH A;  5KFL A;  5LT5 A;  3KK2 A;  5LOQ A;  1BLU A;  4CLS A;  2IIH A;  3CCE S;  4G6V B;  1FXL A;  1JJ2 R;  5DQH A;  3GMG A;  3NAI A;  3W60 A;  5DET A;  2VG6 A;  2CQ4 A;  4NI2 A;  1T11 A;  2FGO A;  2KU7 A;  4WCE Q;  2B4U A;  1Q8K A;  2AZ3 A;  5KT2 A;  2V2Z A;  2N3L A;  5KG0 A;  2ATL A;  2XMT A;  1QAJ A;  4K4U A;  1FKP A;  1TVR B;  2OPP A;  4WK1 A;  1HIY A;  2DR7 A;  3SDE A;  2XZW A;  4OI6 A;  3UQS A;  3U02 A;  4KKO A;  4M5K A;  1JLA A;  2FB0 A;  2EFV A;  2YKP A;  3WX8 A;  4F26 A;  2HKE A;  4GVB B;  5HAN A;  4K0K J;  3B4D A;  4FYD A;  4AQY F;  1NEE A;  4U7C A;  1NDP A;  4O4G B;  1LFP A;  3HLU A;  4WE1 A;  2BR0 A;  4WWS A;  1TV6 A;  3M6W A;  4M94 A;  1LXN A;  3LQV A;  3IRW P;  2ZFH A;  3PX0 A;  2XEX A;  4P7V A;  5D0R A;  1FO1 A;  1K0V A;  3Q83 A;  4Z7C A;  2RS8 A;  1FCA A;  4WXO A;  2HHW A;  2QLW A;  2VF3 A;  2BBE A;  3OQ2 A;  2VFR A;  3RAM A;  2Q6B A; 
#chains in the Genus database with same CATH homology
 5FLX U;  4KYZ A;  4LF7 J;  5A2Q U;  2UUC J;  4JI5 J;  4RJV A;  4GKK J;  1I94 J;  2MTL A;  4HHU A;  4LF5 J;  1IBL J;  4B3T J;  4X65 J;  3OTO J;  4X66 J;  1XNR J;  3J7A N;  4DR1 J;  4NEY A;  4X62 J;  3IMQ J;  2HHH J;  4KHP J;  4JI1 J;  1IBM J;  2E5L J;  4LF6 J;  2UU9 J;  4GKJ J;  3JAM U;  1HNX J;  4JI4 J;  3D3C J;  4LF4 J;  2UUB J;  4LFB J;  3T1Y J;  4YY3 J;  5LMN J;  1N32 J;  3R2C J;  4DR7 J;  4KY3 A;  4LF8 J;  4JI0 J;  4OX9 J;  4JYA J;  4JI3 J;  1XNQ J;  4JI2 J;  4JV5 J;  1XMO J;  4NEZ A;  2VQE J;  4JI8 J;  1HNZ J;  1HR0 J;  2MEW A;  4DV3 J;  1N33 J;  3W1Y C;  4DV4 J;  4NXM J;  3D3B J;  1XMQ J;  2ZM6 J;  2UXD J;  4K0K J;  2MQ8 A;  3J80 U;  1J5E J;  3J81 U;  4B3S J;  1N34 J;  4LF9 J;  4AQY J;  4DV1 J;  4DV0 J;  4DUY J;  4DR5 J;  1N36 J;  4JI6 J;  1HNW J;  4V1A k;  2VQF J;  2UXC J;  2UXB J;  5IT9 U;  4DR3 J;  2KVQ E;  4DV7 J;  3T1H J;  4DV2 J;  4DR6 J;  4JI7 J;  5AJ3 J;  4LFC J;  4DV6 J;  2KL8 A;  1FJG J;  4DR4 J;  4YHH J;  2F4V J;  4LFA J;  4PWW A;  5LMU J;  4DUZ J;  5LM7 E;  5IWA J;  4X64 J;  2UUA J;  3R2D J;  4B3M J;  4DV5 J;  1IBK J;  4NXN J;  4DR2 J;  5BR8 J;  4B3R J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...