2F4VJ

30s ribosome + designer antibiotic
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Interactions of designer antibiotics and the bacterial ribosome aminoacyl-tRNA site
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 2f4vJ00
2MEWA 3R2CJ 4JV5J 4JI6J 5LM7E 4JYAJ 4JI4J 4JI3J 5BR8J 3J80U 1N33J 2UUCJ 3T1HJ 1N32J 3D3CJ 4B3SJ 4DR3J 4KHPJ 4B3MJ 3D3BJ 1IBKJ 4DR2J 4DR6J 4X62J 4DV7J 4DR5J 4OX9J 3T1YJ 4NXMJ 5IT9U 4JI2J 5IWAJ 4LF7J 3JAMU 4JI1J 4GKJJ 4GKKJ 1XMOJ 2F4VJ 1J5EJ 2ZM6J 4DV3J 1XMQJ 1HR0J 2UXCJ 4JI7J 4DV0J 1N34J 2VQFJ 4AQYJ 4DUZJ 2MQ8A 4X64J 1N36J 3OTOJ 1XNRJ 2UXDJ 4KYZA 5LMUJ 3J81U 4NEZA 4NEYA 2HHHJ 4LF4J 4DV5J 4JI5J 4YHHJ 4DV2J 1HNZJ 1HNXJ 4DV4J 4B3TJ 4LFAJ 1IBLJ 4JI8J 4DR1J 2KVQE 2UUBJ 4X65J 1I94J 3W1YC 4LFBJ 4LFCJ 4K0KJ 4DUYJ 2E5LJ 4RJVA 2UU9J 1FJGJ 2MTLA 5LMNJ 5FLXU 4B3RJ 4HHUA 4LF6J 4PWWA 4X66J 4DR7J 5A2QU 2KL8A 4YY3J 1HNWJ 4V1Ak 2UXBJ 1XNQJ 4DV6J 3J7AN 3IMQJ 5AJ3J 4NXNJ 4JI0J 4LF9J 4DV1J 1IBMJ 4DR4J 2VQEJ 3R2DJ 4KY3A 2UUAJ 4LF8J 4LF5J
chains in the Genus database with same CATH superfamily
3EJMA 1RWXB 2X1BA 1MW7A 3R9LA 4LIWA 2U2FA 2R7RA 1J27A 4QIGA 2ZE2A 2VPYB 2DITA 2HBRB 1V3SA 4HKQA 5KFKA 1T11A 1VRTB 3BS9A 2BKOA 4ZJOA 3O2IA 4IQXA 4PRFA 4P71A 4NE9C 2NPIA 2QX0A 4X4RA 4O3OA 4ZVFA 3CCRS 2HAFA 5J1EA 3IR7B 2GVZB 4MT1A 1RWUA 3OSNA 1X0PA 2DNRA 3GPAA 1WC1A 4WFAQ 2ZH8A 1X8DA 5CZVA 3M9NB 4CO2A 2DNZA 1KTQA 1U47A 4J9MA 2ZKUA 3GFXA 4F0MA 4H4OA 2W4PA 1BQMB 1MWQA 2KZMA 2K7JA 2MZRA 2NSBA 5LXRA 2FVQA 2HNZB 1HQUA 3FEXB 1N54B 2JC1A 2QYGA 2XCAA 4WXOA 3QJJA 2H3EB 2WVCA 3ETMA 4DLGA 3LP0A 2J7WA 4KKOB 4WF9Q 1Y10A 3QT5A 1U7LA 1VBXA 2OJ3A 1RAAB 1S77D 4OYPA 2BDPA 2DH9A 2JLGA 2EK1A 2QT7A 3OR2B 4XDDA 5AE1A 3PDNA 5CABA 2FLOA 3A13A 3DCAA 3FQKA 3MCOA 4FVCA 2WOMA 4KTQA 3FFIA 2FVRA 3W2VB 2H5JB 4QYZJ 4NLOA 1KQFB 2V4QA 4Y2CA 2M8DB 1EP4B 1CEZA 5IXUA 1D1UA 4CLZA 1MU2B 4NRTA 3JYTB 4P74A 1LNQA 3O5TB 1IBMJ 5KG3A 3KHRA 1SJ3P 2ATLA 3TAMA 3W65A 4MIBA 4PPZA 1SL2A 3DI6A 3HHLB 2BX6A 3ZTOA 5CAAA 1VIOA 5F9NA 3M4XA 5ETKA 3GFYA 1RWMB 4ED8A 2JLEA 1WI6A 3LUYA 2E1MC 5HJYA 2AEFA 1H0HB 4OX7A 1NB2A 1G7CB 3MEEA 3W7BA 2MQOA 4O3NA 3QRRA 4C8LA 2CPDA 4DX6A 1KDNA 4FKYA 1RK8A 2MHNA 5DM7Q 4DV7F 2I6WA 1T8EA 1CC7A 2RB7A 5D3GB 4B9UA 3CCMS 3UCUP 4JI8J 1JMTA 4U7UD 2OI2A 3CCZA 2UUBJ 3BSCA 3C14B 3QAUA 2B4UA 1CULB 2HIYA 3D7SB 4ZK7M 3JQJA 4JV0A 1FFGB 5A76A 2FZCB 3I5AA 4HEA9 2N3OA 3UD3P 2D41A 2FHKA 3H5SA 4ZP6A 2F9JA 1NDCA 3WQPA 2NUHA 3UW1A 3D28A 1T9TA 1XNQJ 3SBMA 2YVSA 2W8LA 1FNXH 2D9OA 1OSCA 2M8HA 2LXIA 4EI2A 3NLCA 3OTBA 1O51A 3QBCA 3BSOA 3KG0A 1ZA1B 2B6AB 1MN7A 4ERDA 1P1LA 2HQGA 2XSFA 4QPXA 1APSA 7AT1B 4RBTA 1N32J 2GGPA 2C2MB 2B4VA 1FE4A 3ADAC 4URQU 2ZVIA 4X2BA 2DH8A 3WIUA 4NYPA 1FRMA 2I2YA 2XMWA 3P49B 1MMLA 3Q8YA 4KHPF 4DFMA 2KTQA 5ETOA 1FNOA 1WEYA 2PA8D 3M6XA 1OMSA 1JJCB 1B0PA 5ETNA 4NLVA 3POTA 1RTIB 2HGNA 1IN0A 3NP5A 2QYCA 2CJBA 3RYLA 1I5OB 2KG1A 3V6JA 3VF0B 4DPOA 3R27A 3SZ2A 4NASA 5E2QA 5M2RA 1VRQC 3BM7A 4BS2A 2K2PA 3KLFB 1XEZA 1FXLA 3PYFA 4J9RA 3D0IE 3J7AN 3G71S 5BJRA 1XTZA 4AFFA 3FGVA 3B4DA 3PW7A 2UVUA 3MTJA 1XJWB 3H5YA 3H25A 4FPIA 2GX8A 3DLJA 2G1HA 2BJ8A 4KV8B 1QSYA 4IR9A 3WBZA 1UWAA 1UETA 3TRGA 4ZITA 4C8ZA 4ILLA 2QTWA 1JQGA 4IO9Q 4E98A 2YPZA 3H40A 2BRLA 3C3LA 1Q8BA 3DRSA 1NPRA 1S1TA 1YJNS 4JI4F 4WZQA 5E0OA 4GKJJ 1K1QA 4X84A 4NLWA 2XEXA 4K59A 2IRUA 5HBMB 1RUSA 5KFOA 1FESA 3MI7X 1S0MA 1KP6A 5RUBA 1VLYA 5FDLA 5KFWA 2FLLA 1YLXA 4F4KA 1TL1B 3VALA 3TARA 3M8WA 2F8MA 1N56A 1OYDA 3MMAA 1VQYA 3OFEA 3A3OB 4ZVGA 2K1RB 3C16A 1SL0A 1HBUB 3D0HE 4X4SA 2AIRB 3QGHA 2IM2A 2MKIA 2LEBA 2YX1A 2JJ4D 4IH6A 5D78A 3CJ8A 3JSMB 3G6ES 1Y7PA 3FJ2A 2X1FA 1D09B 2F4FA 2UUCJ 2V2ZA 1RAJA 4M8LA 3FSIA 2DGXA 4DQPA 1K73T 1HA1A 4K0KF 3CMQA 5BYRA 5CZXA 5J2PB 1HWLA 3N28A 3BSNA 3KLGB 3NCQA 4Q8EA 2O67A 3I0SA 4WE1A 3PKMA 1P1TA 4DR3F 1EZZB 5KOWA 2VG6A 1XMQJ 4CH1A 1T7PA 1HWJA 3N4WA 2YKMB 5KG1A 1RAGB 4YS2A 2MZSA 1UA1A 5LOQA 3TX8A 4DV4J 2Y0SD 1RXOB 2D3ZA 4O3QA 1C4CA 2QC3A 4KGMA 3IO1A 4PQAA 1TQLA 2ZBIA 3H98A 1KLNA 2ZH4A 3RR7A 5MAOA 1UEVA 1HBNB 1SUQA 5KTQA 3EGZA 4ELVA 1Y00A 3KWMA 2J6TA 1EQ0A 3VAFA 2XMJA 4ZPAA 5KFBA 2RH3A 1VK3A 1G4CA 3JB9k 4UTGA 1EARA 3GYGA 5F41A 3RJMB 1IR1A 1X31C 4RNOA 2CIMA 1U1MA 2R2UA 3BB5A 1RT5A 2VKRA 4TYBA 2ZH5A 3LP2B 1NH8A 5HANA 1PILA 3H42A 3Q0AA 2AZ3A 1QUVA 3MGJA 4N8OA 2C2RA 1QAIA 3DU5A 1HHQA 4XPEA 4QCLA 3K7RA 4F4AA 5M2PA 3J81Y 4B9MA 3WC0A 4J9QA 4EYIB 4JI1F 1M5PC 3CD5A 4FNIA 3MR3A 1HPZB 4MKVA 1R0BG 3K2YA 1I94J 2YNGA 2E7WA 5KFTA 1CJUA 3CJ2A 3SCKE 3MWBA 3VZIA 3TANA 1ZBTA 3L7OA 1RAHB 4XDCA 2BQ3A 3FKBA 4CLLA 3H90A 3LQVA 3DMJB 1XWLA 4NI2A 4NXNJ 4ANEA 2R7VA 3KKFA 3PX6A 3VTIA 2CJKA 2FJWA 3MR7A 1GFWB 2ROGA 1WC5A 5HROA 3RBDA 2CZ4A 2G4BA 4RO0A 1O8BA 5E33A 2V5HG 3W61A 4YUDA 2EFPA 1DZ5A 3EVMA 2ZE2B 1RACB 1TL7B 3W8GA 5GAEI 3PW2A 3CULA 3RUBL 1G6BA 4U67Q 1X4CA 1PAEX 2ROEA 3ILOA 2HWHA 2IFXA 4OZNA 4ZVTB 3N5FA 1KS2A 4W98A 3F56A 2MZQA 5DQIA 6FD1A 1TTHB 4CNYA 2JHEA 1NKEA 5I42A 3UVJA 2VB6A 2MZJA 3CCVS 4DL3A 2XYGB 5J1EB 3VWSA 1YJVA 3SCJE 1UW4A 2HIQA 2BE2A 3GV8B 1H72C 3GB0A 2WSFC 2B8QA 4UZCA 4AE5A 3SCIE 2VBZA 4ANDA 2KKHA 4OYXA 2IMWP 2C28A 2RE1A 1WOOA 3NRBA 1UVLA 2KXFA 1VI7A 1FX4A 4H4OB 1DFDA 1U2RA 3CCES 1RT1A 3IA0A 5LT5A 4HTJA 3G86A 3SCLE 3CUNA 1FE0A 2VFSA 2VPXB 4ID8A 5L1JA 3LPEA 5L9XA 1HQUB 3FEZA 4DSKA 4Y0FA 1W2IA 1G2EA 4NRUA 1RBLA 3LP0B 3EGVA 5KFCA 2EG2A 3M32A 2NUUG 2DGUA 3H4BA 1M1KT 3E51A 4K4YA 3ZTRA 1LV5A 5A8WA 1U1OA 2C3YA 3LP1A 3BGUA 3OTOJ 2RU9A 1S1WA 3AQOA 2WOMB 1NK7A 4J9SA 2FLPA 3FFIB 4B3TJ 5IV3A 4RNHA 1GMVA 1PYTA 1WHXA 1EB0A 2ERRA 4KH0B 2MKSA 2ASLA 4DR7J 3JTPA 4BC9A 3D6FB 3HFZB 1BQNB 4U95A 1JLFA 3TAMB 2JSXA 4V19J 3DI6B 3IG1A 4TN2A 2XI2A 4C11B 4JV5J 7FDRA 2H9ZA 3CVKA 2RRAA 3AB2B 1PC5A 3E3XA 1CLFA 4URGA 4MH8A 3NGKA 1R6YA 1T3OA 5AE2A 2EG1A 1FFSB 2MKKA 1SH0A 1RJJA 3MEEB 2DGQA 3PIPQ 3GJQB 2R42A 4F26A 1X4EA 1VC0A 4DCPB 4OFZA 4DR5F 2M0GB 1QJHA 3NGTA 2LU2A 1TFYA 2HNDA 1BE4A 2IM0A 2BMBA 3QRPA 3BYPA 5T14A 4DV0F 1TR0A 3V6DA 3PHTA 4B3RJ 4ED5A 3NGSA 3SI8A 4J9KA 1VIXA 5C2GA 4QQBA 2XMMA 4IG0A 5ETSA 2DHAA 1U1PA 2C3MA 3SFUA 4WKYA 1CBKA 4M5HA 5B09A 2KG0A 4Y34A 1MROB 5KT2A 1S0NA 2BJ1A 1OY8A 5KFAA 2VG7A 4YQWA 3DRPA 4A8QA 1RABB 3IFEA 3KNGA 2GVDB 2AV5A 3R5CA 3PTWA 3PX0A 3QGPA 3POTB 4AT1B 4NXMF 2W25A 2UVWA 4FXWA 1NK8A 1SQEA 5E7OB 1LW2A 2K3IA 1SJQA 4X65J 1U49A 3CCWA 3F73A 3GYXB 3CJKA 1TAQA 5HAOA 3I96A 1Q0NA 1S9GA 4FYVB 3A3NB 4ZVPB 4PWWA 4FZVA 1H73A 2UP1A 5D4PA 1FRXA 1R8HA 4Q45A 4MFBA 3D67A 5DS7A 3CNQP 1SPBP 1T03A 2XZWA 1V5IB 2FVCA 4ICLA 2DGOA 3ZZ0A 3DC2A 5K8OA 3R97A 3B4MA 2CQ3A 1JNRB 4UT4A 1YBAA 3DRSB 5D8HB 1R8PA 1FVQA 1S1TB 3PXGa 5DETA 2YTCA 3KXDA 1L3KA 1GK8A 2X51A 2W7OA 1GXTA 2R9LA 1WACA 2O01C 2Y0BB 4PZVA 2ZZNA 3BGLA 3N0VA 3BBCA 2IA0A 1S97A 3EDQB 3PJWA 5FDLB 1S1XA 3J81U 1B64A 1EKRA 3I87A 3QYYA 4I56A 2J76E 2Y9HA 3DDIA 3MMAB 1WG1A 3C16B 3GR0A 1KBRA 3C66A 5FLXY 1ZM2A 2CFXA 3T3FA 2VU5A 4ECXA 2MB0B 2H5IB 4DF8A 3U1MA 1T95A 5H9FJ 2DNKA 4W92B 3QJPA 1XMBA 3IAM9 3BV8A 3NCRA 2Y1JA 4BLGA 4HLBA 3NBPA 1NAQA 1AXQA 1VBZA 4TY9A 3QZ7A 2XYHB 2ZHOA 3I0SB 1IBKJ 2DRBA 4KAIA 3F44A 4WE1B 3LALA 2QG9B 3GSIA 3J7Z5 4NMLA 2D3O1 2MKYA 2VG6B 2AGQA 2XS2A 2Q79A 3KG4A 3HXMA 4H4KA 1VGYA 1AUSL 4UOCA 1QAXA 4I6YA 4TQSA 5LMUJ 5CYMA 4JI6F 4UOFA 2FTRA 1HNZJ 3T1HF 2R2TA 1Q95G 2LQBA 4USIA 4QPTA 2NS1B 2HFZA 2HHHF 2DCUB 1UVJA 5BYSA 2ZNZA 3RG6A 1SUQB 5LJ5Y 2PEHA 1EIYB 3KHHA 4ED6A 2MKJA 1P9YA 4ECVA 4USUA 1HNWJ 1KQSR 2HHUA 6FDRA 4JBCA 2A3JA 1X5PA 4LF8J 2BJ7A 4G3IA 2RDDA 3CCSS 2IIHA 2V69A 2ZBPA 5L1LA 1WSVA 2Y3YA 5KFGA 3RGIA 4LRCA 4U7UK 3V6KA 1UA0A 3GFHA 3VAGA 2JEFA 2ADBA 4PG5A 2M70A 1YDLA 4P73A 2AZ1A 2AQ4A 1L3UA 3S1TA 4JI7J 4A48A 1I51B 2OSRA 5LXYA 3HSGA 1MWZA 4DEZA 4MIWA 4DL0C 7FD1A 3G6YA 5F8JA 1F1BB 1SH3A 2YNGB 1RTHA 2CVEA 5KT6A 2M7SA 1FDNA 2HVDA 2DISA 2HYIB 1S59A 2FQQB 2NXNA 4PKDB 2W01A 3LW5C 3UN5A 4Q2MA 1HMVA 5IWAF 3K89A 3M2RA 4DV2F 3M30A 2AYMA 5A2QU 1RP5A 4NI2B 5HVFA 1RA7A 1ICEB 1RLCL 3TQEA 1NJWA 5HROB 1AROP 1DTQA 4EBDA 3KLHA 4X66F 4OV1A 3K59A 3OHAA 5C2CA 4N41A 3OQ2A 4K4WA 2DNOA 2FJDB 3FMWA 3M7VA 4ID5A 4KT0C 4OZ0A 4OJ1A 2FY8A 1UFLA 2KRRA 4CLPA 4X62J 2XS7A 4PAAA 2BBEA 1G1XA 3CC4S 5I42B 3SFGA 1YHQS 1Y3JA 3MAHA 4B3MF 1QVGR 4YDXA 1IQTA 2LQ9A 5J2MA 5B0EA 2BANA 2BE2B 1RLDA 1F9HA 4HH0A 4J9VA 5L46A 2CPIA 4QIEA 2V4JA 3QZ8A 3RAMA 2QO3A 4R0EA 3QIPA 4ES1A 2H54B 1RT1B 2VJUA 2LLZA 4TU8A 4LFAF 3WC2A 5BXIA 3BH7B 3SQGA 4WU3A 2XY5A 3GZ7A 1C0TA 3K5LA 2G1DA 1VQ4S 4LF5J 1VFJA 4PXDA 1X5SA 2QMWA 2I0XA 4ZPVR 5LJ3Y 4NA2A 2FIUA 1BWEA 4RUAA 2B4PA 3M32B 2IAJA 5CD4H 1AA1B 6AT1B 4M5GA 2HEKA 3PX4A 5A8WB 1J2VA 1NSQA 3SMZA 2DGVA 3U27A 3LP1B 3Q83A 4NLSA 2F4VJ 1Q79A 3AOAA 1S1WB 2GQCA 1BGXT 1WHVA 4CCHA 2B7CB 3ZZPA 3OFGA 5GVQA 4QU6A 3QMQA 1RWVB 2OPQA 4UOHA 5IV4A 3OJUA 2HHQA 4KQZA 4QYRA 4CQ1A 4I67A 3SYZA 3LANA 4YOEA 1RTZA 1ITPA 1UVIA 4C3LA 4DWIA 2DTJA 1HNXF 4C6AA 1JLFB 3E01A 2MXYA 4N8NA 2P6SA 3GFZA 2YNIA 5HMWA 3M8RA 3IG1B 2BQUA 1N36F 3UD4P 4NMXA 3KYLA 2RRBA 3HT0A 3IWXA 1NXIA 3DRRA 3AB4B 1KFSA 2J0WA 4NWBA 2HZCA 2E9RX 2W8KA 4E2FB 2NR0A 3TP2A 3DLEA 4TY8A 2B56A 2V9KA 1YI2S 2GA7A 3HHNB 1UEUA 3UDCA 4L73A 1NH7A 2HNDB 3NS7B 4LF7F 3LOUA 3SV4A 3FBEA 5JMNA 1W7WA 3ZTPA 2KHDA 1Y3KA 2RMLA 1B0VA 3PFEA 2JDJA 5DQHA 3ETOA 2FLNA 3QJLA 2KB2A 5CCMA 3V6DB 2FD2A 4DHVA 2BJ3A 1FTRA 4TVAB 5KG4A 2DK2A 4H4KC 4WU2A 4LF4F 5FLXU 4YHHF 4IG0B 3CB4A 3HO1A 1SKSA 4AD6A 5B0GA 4RU2A 4LJMA 1RAEB 2N4CA 4OZ5A 1UP1A 1Q7YT 2GIQA 3MEGA 2E7XA 4XTTA 1M1HA 2UVRA 3G2XA 4OLPA 1N8RT 2VG7B 4B17A 1NKBA 1FVSA 5D0HA 3DRPB 4FDFA 1DURA 2XLKA 2XB2D 2RUSA 2B9EA 2MKCA 2C22A 2CQHA 4PXCA 3ITHA 1SJ4P 3ZNJ1 4FYXB 1HYSA 4GVLA 1KN6A 1S9FA 3FCWA 5DDPC 1SC4B 3PR5B 1LW2B 4KB7A 3M8QA 4Y2IA 2DKOB 2FVPA 2DRAA 3CJKB 1F5BA 1HR0F 2Z2LA 1S9GB 5KG2A 5DLGA 4DCJB 1HD1A 3W60A 1R89A 2MMYA 1XIQA 2BE9B 4MFBB 3KOAA 2WK4A 2DYAA 4ZJLA 1T03B 2EKYA 1LW0A 1WDDA 3FCVA 4LRDA 2KFNA 2XNQA 2DEIA 1YZ7A 3PW4A 1F3FA 1T94A 3O1LA 4Q43A 2R7TA 2HZAA 3DKDA 3ISNC 3W2WA 1FT8A 4RW4A 1JXVA 2MPUA 4DV7J 4ALZA 3QO9A 1JLBA 2W9BA 1UJ4A 4B3SF 3HJFA 4WKRA 2V8PA 3NWRA 1B4SA 3M6VA 1S1XB 2AGPA 1RSCA 4Z7YA 4NL5A 4ILMA 1JLCA 4CM0A 1FCAA 3PRVA 4NLQA 1RKJA 3MMJA 4WBFA 1N33F 2VPWB 3QGIA 3UR3C 1GMUA 2QSWA 2UXCF 3TZZA 3H59A 4O4RA 3GIJA 2VQFF 4DL6A 2BW7A 5KFMA 2HWIA 2HS0A 3U1NA 4QW8A 3VV2B 2LQ8A 1RT4A 4V1Ak 4J9LA 3MR2A 3ZZZA 1CG2A 1NDKA 3K5MA 3NBPB 3V2UC 2NZ4A 2EWHA 2A2DA 5LL6d 3R7NB 1VQ7S 3O3LA 1AW0A 2GMJA 4YY3F 1QAJA 3VVTA 4TLRA 1RA6A 4KHPJ 3MM8A 1SC6A 4MTPA 1Q4RA 2JFDA 4Y00A 4WZMA 2ZDPA 5B0BA 3PO4A 4YB1P 4O3PA 3DXBA 3V81A 1S9EA 3C2PA 1E6YB 4PG8A 3TZXA 2F5GA 3PM9A 2MZTA 2V9WA 2FJEB 1LEOA 2JWNA 4WYWA 2V67A 5CYMB 2J7KA 3DHWC 3BPDA 5MLCV 4OIXA 4RNMA 2GQ2A 5EWFA 2YKOA 4MKAA 1O5JA 2W2MP 4C8OA 3EYZA 2CADA 2V6AA 3G8SA 3GJRB 4PQUA 4N76A 2HQDA 3NCPA 1H98A 2VA2A 3UFCX 4F2RA 2GJFA 2VONA 4PG6A 2JOQA 4N47A 4HT5A 5C24A 2M88A 1ZM3A 5KFSA 3AOCA 1VHFA 4JI4J 3I32A 2V2VA 1OS5A 1R43A 2GIFA 2J9EA 4EO6A 2WBMA 3FZ2A 4ELTA 2L9DA 4EBEA 4G65A 3BO2A 4CM2A 4FXVA 4G1QA 4RPFA 4TNOA 3MMBA 1RWWB 2Q6BA 2H65B 2CA9A 1RTHB 4IRCA 2J8SA 3R7BB 4ZLJA 3OLBA 9RUBA 3UDLA 1WC3A 3CJTA 1RT7A 1SVDA 2XY7A 2R8KA 5E3QA 1HMVB 4AXIA 2L3MA 3M2RB 4P7VA 2O3DA 4HH1A 3M30B 3M2UA 4GVBA 2XMKA 1FKOA 1M5KC 3TVYA 1FEHA 4J7CA 2LMIA 3ENAA 1PBAA 1DTQB 3KLHB 2BOAA 3R2DJ 2DY9A 3CDEA 4DU7A 4ETZA 1VBKA 3KFWX 4QWEA 2ZNYA 2P8IA 1IBLF 4ID5B 4LRAA 3RB4A 2Q1LA 4KHMA 5D77A 4DR3J 3PVXA 5F8MA 1OQ3A 2QA4G 3JAMY 2VUGA 4QBUA 1FRJA 1NKCA 5J2MB 3RR8A 1R8AA 2KVIA 2BANB 1TKDA 3PKYA 4DV1F 2QLXA 2JH3A 3PZPA 3IBCB 3QFHA 2WZ1A 2GHPA 3LWLA 2V4JB 5IC6B 3AJ2A 4MMOA 3LGMA 2JEGA 3QIPB 1NUEA 4DV3F 5KFFA 5CXTA 2VC1A 1Q16B 1NBEB 3HVRA 5L1IA 1DTTA 4JI5F 1HI8A 3MR6A 3SQGB 1BMQB 1CC8A 2CZ9A 4OV6A 2XY6A 1H38A 3ILJA 3GV5B 1C0TB 5E5NA 3HD2A 5D0GA 3RW6A 2HLTA 4X4UA 1U8WA 4USHA 1Q81T 5CA5A 3TO8A 4HHHA 4RX6A 2HSEB 2N7CA 2NYHA 2IAJB 2V94A 2P5VA 2PSZA 1LWXA 2AGOA 4A8WA 4LMZA 4J5OA 2E5IA 2QFJA 4BBYA 4CYUA 4M5IA 2CYYA 2CG8A 2EBGA 1F2HA 2RF2A 3G82A 3I4HX 4JI1J 1WWHA 3EZUA 4MK8A 1IKYA 2K06A 2RDJA 4USKA 2KYXA 5ETPA 4WK1A 2OPQB 5H9EJ 1D9AA 1DQ9A 2K8GA 4DFKA 3TUPA 2ILZA 3Q8VA 1L3TA 2YKNA 1T9UA 1K9MT 2WB1D 3D5MA 3E01B 2YNIB 1PIEA 2B3TB 2VASA 5F8LA 3T5JA 4UZBA 3K8VA 1DLOA 5ITHA 4B3OA 2MZ1A 2E5LF 5I3QA 1S72S 3OXGA 4ZIVA 4NCBA 4DBQA 5KG0A 2VFVA 2CQPA 3W64A 2F63A 3DRRB 2I1RA 1F5CA 5KG5A 5AJ3F 8ATCB 1XC9A 4GRSA 4KR0B 1MMDA 4HL9A 1UL3A 2I5JA 4NCGA 4I69A 3DLEB 1RT3A 4TY8B 2Y1RI 2MQQA 5ETVA 4G6VB 3DFEA 1U1NA 3WDOA 1AZSA 4DR2F 2B8PA 3PRBA 2BKPA 3NL0A 2AJFE 2IY5B 3D68A 1MSWD 3FEYB 2HG4A 1CJTA 5DJBA 1Q86T 1PJ6A 1P9QC 2KU7A 1EHWA 3FBBA 1PC4A 4YEAA 2QL5B 1NK0A 2E1AA 3LTOA 4ZN3A 3D1OA 4OJGA 1GMWD 2EW9A 4KIAA 2OSQA 2GC8A 2KT5A 3S8SA 4A8XA 4LQ3A 3P4UB 2CNKB 3MEGB 1NHKL 1RHRB 4QU7A 2UUBF 4JI0F 4CO4A 4K4SA 1X5TA 1OY9A 1R27B 3R1HA 3EPIA 1LFPA 4DI6A 3GCWP 1W25A 3ITHB 1JLAA 1WDTA 5KOXA 1N5SA 1HYSB 2QA1A 1FD8A 2HFSA 1K44A 4B9NA 1S0VA 3EVOA 3M8QB 4FF1A 2WCXA 1QE1A 4DQRA 1YTYA 1S1VA 1U02A 2B7BB 4WTOB 3FK4A 2IRXA 3IBFB 5K20B 2AJ0A 1BHNA 3LA0A 4HDGA 1IR2A 1RISA 1H7WA 1JJ2R 3M8PA 1LW0B 1FEEA 2RJZA 5EUHA 3H4DA 2IC3A 2AJQA 1WC4A 2BYCA 3B78A 3VCDA 1VLOA 3TVZA 4DV6F 3HFKA 2VIHA 2LVWA 3W2WB 2H4WB 3CJ4A 1V3RA 4RW4B 1ZM4A 1R7IA 2L08A 3QO9B 1KNZA 5C7PA 3IR6B 4DR5J 1NDLA 2HFNA 2W9BB 2HVIA 2RIJA 4FPRA 4ZP9A 3KHLA 4DV0J 1JLCB 2FY1A 2DR7A 1DBDA 1EX8A 4JB8B 2F1FA 5EWGA 3K8WA 5GADI 2C2DA 4B9SA 1IVZA 3WHIA 3T6JA 1BWVA 2QRRA 2UV8G 1IWGA 2HGMA 1RT4B 1OPIA 4GC6A 2DPJA 1NMEB 4C3MA 2YWEA 4KFBA 4FNHA 2B9YA 3SSSA 4F0KA 4ECRA 3FRYA 3GP9A 3CCTA 2BACA 1WOSA 2W7PA 3MM8B 3FVYA 1YJTA 3TUIC 2HQFA 2ZBRA 1PYSB 1X4FA 3QPIA 1TL3A 4LR9A 2AX0A 2CPZA 3V81B 1NEEA 3HLUA 3BQ1A 1S9EB 2G0JA 1K8AT 1U24A 1CJVA 1YK9A 4NXMJ 1M5HA 2DHHA 4BCAA 2FZKB 3JAMU 2GHVC 5DZ7A 3DOLA 1X4AA 2ZBCA 4Y6IA 3TUZC 4USWA 3GJTB 3W5YA 1S79A 2V8HA 3DGVA 3N79A 3BO3A 3Q2SC 4OZJA 3M1VA 4PQUB 4HT7A 2HFVA 3Q8PB 5L9NA 3THVA 4CRJA 4YFUA 3BR8A 1NHVA 4MYTA 4QYZK 5J2NA 4IR1A 4DG1A 2VH7A 3WZ0A 2LP4A 4LFBF 2JLFA 3N6MA 3TA1A 4I68A 2E66A 2V8VA 1H7XA 1RZMA 4XIUA 3ZZRA 5C24B 2XBPA 1KR4A 1FDBA 1WI8A 3OPKA 4D3HA 3I6PA 4FP9A 3HM9A 1PSDA 3RTVA 2OPPA 1NSKL 1VISA 4KGZB 3U7JA 3CXCR 4Q5VA 4UQTA 4P75A 1TVRA 2KYZA 4OX8A 1N0UA 4G1QB 2LECA 4Y28C 3BKFA 3MMBB 5IQ6A 2LA4A 2FDNA 2ZH7A 3D9BA 4ECYA 4DX5A 2EFGA 2O1PA 1EAYC 3V4IA 4B9LA 1Z2ZA 5HP1A 2HURA 1RT7B 1WHYA 3TI0A 4P2FA 2J9CA 1EJ7L 2R8IA 4F2SA 4GVBB 3LO3A 2QSFA 4FVMA 1FKOB 1WEXA 1MN9A 4QR1A 4EO8A 2XHWA 2GAGC 1U6ZA 1VHIA 2HHXA 5DDOC 3T6BA 2OMOA 2Z2YB 2NREA 4ZJQA 1ULRA 4AL5A 1GT8A 1RTDA 4X4VA 4ZOSA 1YQHA 4I2PA 2UU9F 2MQNA 1SV5A 2VQEJ 1T9YA 4EUVA 5GAEU 1TUWA 1HKAA 4I1TA 1D9FA 1HARA 2D1CA 4HACA 2WSCC 3QWPA 2NXJA 3TEHB 4NYZA 4KPYA 4KRWA 4KO0A 2RHSB 1RYRA 4HI1A 4OLOA 2W2OP 2XMVA 4CNZA 2GHWA 2LXUA 2E5JA 4R25A 1UTAA 1X4BA 3KLIA 2UXDJ 4JI2F 1PJ5A 2HHHJ 2AU0A 3ZZOA 2X1GA 3MD1A 5HQLA 4FYYB 1LWFA 2DXEA 4LVNP 3MEDA 2EK6A 5KFLA 5KFRA 1DTTB 2HHTA 1H2VZ 5CQGA 4PR6A 2CDQA 1HI0P 1FKAF 2K3KA 5BYQA 1JXEA 2LQJA 1L3VA 4MK9A 3M05A 4CLSA 1RAOA 1YITS 1XN9A 3O44A 3IWNC 1TFWA 1YG0A 2LDYA 4IOBA 5HN0A 3J7YI 2BJDA 4NLGA 1HIYA 2DR6A 1JLGA 1YX2A 2EI5A 1MLAA 4X4NA 3MM9A 4BWMA 3K0JA 2OIHA 1FERA 4CYUB 2RF2B 3G82B 3TJ9A 5KFEA 2NXUA 4JYAF 3DLGA 1WEZA 1IKYB 4WFZA 5A0YA 5AXLA 3HKWA 3C6TA 3KJNB 5C5JA 1YZ6A 3GIRA 2ADCA 2DJWA 2RU3A 4DV2J 3UDEA 4ECUA 2YQ0A 3MZIA 2YKNB 5GMKa 4ELUA 3KTQA 3B54A 1X60A 4Y65A 5A6WA 5DG9A 4ER8A 1R0CB 1TMJA 4ZVEA 1U25A 4L3KA 2XWYA 2YKQA 3A8EA 4X66J 1HI1A 4B3OB 4EZ6A 5L39A 5HI7A 1Y4ZB 1SH2A 3T5HA 1FJEB 4ZMMA 1HW8A 1E6VA 2MEWA 3QGGA 1NPKA 2B9WA 2UXBF 5KFVA 2H51B 1M5OC 3UN2A 3TWZA 2ZHAA 2I5JB 3OR1A 2YH0A 4NCGB 3D3CJ 1RT3B 4B3MJ 5DZ6A 2X7IA 3THTA 4DR7F 1GX6A 1PJ7A 2BV3A 3NGDA 4K2XA 2OAUA 1YJ7A 3U02A 1GX5A 3Q8SB 2IM3A 1TK5A 1CJTB 1RTJA 2FJAB 4O3SA 4LFAJ 4W90B 2ZM6F 3EXYA 4OI3A 3MAQA 2A10A 1S49A 3HX9A 4PUOA 4OHWA 2HK2A 2PC6A 2DEJA 3CE8A 2POKA 2O5DA 4J9OA 3VAHA 3H7HB 1F9EB 2YBVA 3VAMA 5FD1A 4YR3A 3NKYA 4KSEB 4F3OA 5EGYA 2YKPA 3U1LA 1NK9A 3TUJC 3OW2R 1RBAA 3GCXP 3MM7A 2HGLA 3DRYA 3L7PA 1F3VA 3MHYA 3TA2A 1ACMB 2IDLA 3VAJA 1JLAB 2R7WA 2V63A 2V50A 4ZCIA 3LAMA 4M5JA 3FSYA 1S10A 4PYAA 5KFJA 3Q8QB 4ZP8A 2V4RA 2OTJS 1XNRJ 4DS5A 4MJKA 1ZM9A 2DT9A 1QE1B 1LXJA 1HNXJ 2CPHA 3TNVA 1S1VB 2FC8A 5CCLA 3IM9A 3ILLA 2WHOA 5G0RA 4J9NA 4WFXA 4IH5A 1ZYQA 5E3RA 2HW3A 3TR5A 5KFPA 1OO0B 4K4TA 2KJVA 1YJRA 3CSKA 2IC3B 4RKUC 2VOPA 4OYAA 2DGSA 1FD2A 2RILA 4DL4A 3W2VA 1T0TV 1KONA 3PYEA 3Q2TC 1QUPA 2Z2MA 1Y5LB 2JZ5A 1RU1A 2GNKA 4OYZA 3ULHA 1TAUA 4NLPA 1IKWA 8RUCA 4X64F 2CWXA 4A46A 1KWMA 1N6QA 1KD1T 3PYGA 4LF7J 1IKXB 5AE3A 3GIMA 5KT7A 2AMCB 1HBMA 2N4DA 2I8EA 4B9TA 2GW8A 1VK8A 3RBZA 1OSDA 2CKWA 4HDHA 3FQLA 4NYOA 3P3DA 4TXSA 4RNNA 3M8YA 2YKAA 1U1RA 1AUDA 4LF4J 3NNAA 1I6JA 1WUUA 1VQNS 3H5UA 4YHHJ 2R3VA 1P8GA 3VGVA 3EZ5A 2JX2A 1IJEB 2BR0A 4DFPA 4P7TA 4BHQA 1TELA 3R5DA 2UVVA 4K7QA 2XZTB 2AX1A 5F0UA 3HFVA 4Q0BA 1A6LA 1S12A 4ED0A 2DR8A 2O66A 3T5LA 1S6OA 4F02A 2Z2ZA 4KY3A 3D6HB 3FSXA 1DQ8A 1TL3B 1UZDA 3AXKA 3A3PB 3FNNA 2IVYA 3OSPA 1CJVB 2VBYA 5B0CA 2PGCA 2QLFB 2VODA 2G0CA 2ZKTA 2RQCA 3CW2C 4PXBA 2A1BA 5K9FA 5BR8F 3DOLB 1Q78A 2VG5A 2WVDA 3VR1A 1HR0J 4JV1A 1F6TA 3GQCA 3DM2A 2Z56B 3KJFB 2PE8A 4IUFA 3E8OA 3MM5A 4M94A 1JIHA 2DNQA 3IRXA 2J6UA 3IS9A 2V34A 1NRKA 2N7YA 3M1VB 3SEOA 1VR6A 1NM2A 3OHBA 4RW9A 1J5EF 3AT1B 2J6SA 3BSAA 4KE5A 2XG8A 1FDDA 2OELA 4DUZF 4DPXA 1RHUB 4LBHA 1VQPS 5J2NB 2RSQA 2HHPA 4DG1B 2DR9A 3RB0A 1S76D 1P27B 1VYAA 1S6PA 1P6TA 1HHTP 3CTRA 5F8NA 3ENVA 1WKKA 2OPSA 3UD5A 3P6YC 3NGUA 5LMNF 3UCGA 4DSLA 2AT1B 4I6AA 2OPPB 3TJAA 5IT0A 2ZH3A 3OBIA 3I5BA 3QATA 1TVRB 1MMNA 1IXKA 4B3SJ 4A47A 4U8YA 4USJC 4KH1B 3KLFA 4J9UE 3R5JB 4RW6A 1DHMA 5H1SV 2AW0A 2DCLA 3MFHA 2E1PA 3F41A 4IRKA 2UXCJ 5HVGA 2VQFJ 1GTEA 3V4IB 2A6MA 5DDQC 3T1YF 4A4JA 5HP1B 4G1PA 4ZVSB 3ENQA 3BQ2A 4LT6A 2W24A 1N34F 2COLA 3TQ1A 3W1YC 3JSBA 2M5YA 1FHTA 5EX0A 2DXFA 1TUVA 3BF4A 1RTDB 3L9ZA 3M9MB 3VQTA 1FFWB 4I2PB 1NHUA 4F04B 4YY3J 4UUWA 1SV5B 4FYWB 1GMWA 4NA3A 1Y5IB 1FJGF 5A6PA 2VBWA 3KDOA 4GO5X 4LF6F 4HYKA 3BBFA 2RQKA 4C3KA 2K1RA 3LWMA 4PWDA 3MD3A 2ASDA 2JRSA 3KMQA 3SV3A 2Q6CA 4KO0B 2OEJA 2VFTA 2QMXA 5HL7Q 4JI3F 4FS1A 1HFEL 1Q1KA 2IDEA 4PPDA 4EU0A 2RUGA 2N82B 4RW8A 1RADB 5U47A 1UKUA 3SXLA 3KUHA 4NLXA 2FJVA 3IGVA 3ZZYA 1R0AA 1LWFB 3MEDB 2F9DA 4P2SA 5IT4A 4DR1J 3LAKA 5DGBA 4DL2A 5L1KA 3KHGA 1FDAA 2G9OA 2FJBB 1F9FA 1U45A 2XMUA 3Q89A 5C42A 3VHQA 1UEKA 5JVGQ 1HNVA 3SSQA 4FBUA 3IRWP 1UVNA 4PEOA 1IJFB 1NJXA 2WSEC 3PIOQ 3PHEA 1UJ5A 4P9SA 3EUNA 1JLGB 2CJAA 4RUCA 3G6XA 3MM9B 4K4XA 2MYFA 1U8SA 4L74A 8AT1B 1JK9B 3JTNA 3J81j 2GMLA 3H5XA 3DLGB 2YNHA 3W8PA 3IGNA 1LXNA 5A0YB 2XO7A 4A8KA 3NNCA 2DHSA 3C6TB 5IS2A 1D8YA 1DAXA 2LCWA 1W2BR 3DLLQ 5AT1B 2FYXA 2R7OA 1WF2A 4EK2A 4O44A 4OX9F 5KFDA 3GMGA 3M8SA 3CC2S 3MCMA 2W9AA 2MDAA 1XMOF 2W2NP 1B99A 1DJ0A 5I4MA 2WONA 3AD8C 4USVA 1R8BA 2QL7B 4A8OA 3FC9A 4ZVUB 1VQMS 4ECSA 1N0VC 3ICLA 1OQ6A 2GGPB 1XBWA 2BJEA 3NOGA 1ZAVA 4ZVHA 5H9FK 1E6VB 3L4BC 3PW5A 3H2UB 5CHCB 3MCSA 2R7XA 3OR1B 4OI4A 5KT4A 2CVIA 4BWJA 1FJCA 4K5SA 4E0DA 4WP3A 1LFWA 4LF9F 1NJIT 4ECQA 2CUYA 1UWBA 2ZD1A 3MXHP 3PG9A 2WBRA 1KRPA 1FRLA 1D3WA 2C3OA 3F0NA 2LFVA 1UFKA 1VQSA 4DV3J 2LEPA 4CH0S 4IH7A 2AKWB 4RW7A 1B7FA 3K58A 1RGVA 1RTJB 1YKWA 1RCXB 4DN0A 4M5KA 4IG3A 2OMLA 1TL7A 4JI5J 1UAWA 4NZ0A 4PUOB 3L09A 3EZOA 5K8PA 2VJVA 4YR2A 3NMAA 1SQGA 2CG4A 1FA0A 5B0FA 1HNIA 1FWLA 4CP5A 1JKHA 3PV8A 5B0AA 4K4UA 2JFKA 4ZLNA 1EETA 3O8WA 1KOHA 4K50A 3MM7B 3AY0A 3ISZA 3BZQA 4DMZA 2IA6A 1QTNB 3OL9A 1T9WA 3T1AA 2IBOA 4N56A 3G9CA 4LIRA 4OHYA 2GFFA 3D54A 4KPCA 2DNPA 2M9KA 5D4OA 1B0TA 3PACA 3TYTA 3I55S 2F65A 3RBEA 2MSSA 4ITSA 1FXDA 1KLMA 4A8MP 2JEIA 3JSRA 2LEAA 2C2ZB 1HL6A 4LSNA 2OP5A 1SL1A 2PMWA 5F3ZA 5KFQA 2FHJD 4DS4A 4AQYJ 2D7SA 1NJYA 3PR4A 2PFFB 3PNIA 3ENWA 2BABA 2P9EA 5D0RA 2V8DA 3G6VA 4OYMA 4CI0B 1V6HA 5G0RB 2WVEA 2MJUA 3L95X 3GYNA 1QD1A 3IR5B 3CEDA 4ED2A 3SQOP 2E5LJ 3BGRA 3X1LB 3A4TA 3BBBA 2VBXA 4DOZA 5DG7A 1SQFA 3BGFA 5GAHU 1F2GA 3IXQA 2DNHA 3DGPA 1FWKA 2XI3A 5AJ3J 4NZ7A 4Y2KA 3THPA 3HMJG 4EBCA 4ES2A 2IJFA 3TEGA 4L3NA 1RKIA 3HP6A 2IBKA 1T02A 2BOPA 1IKWB 1KHWA 5J2QA 3VGUA 2HRYA 1TP7A 3CIZA 4OYIA 1N6QB 1V9OA 2UUAF 1BQNA 4DR2J 4PG7A 1OJ4A 2KDOA 4YB5A 1HBMB 4C11A 5D4NA 3W5XA 3BN7A 3J7A1 4DR6F 2DIUA 2KHCA 4IFYA 3FUYA 1R6VA 2F8HA 3MUTP 1KTVA 4F67A 3BREA 1L3SA 4H4MA 1UMJA 2ACMA 3V5RA 3UI3A 4RLEA 2UUWA 3VVUA 4WP8A 2VV5A 2Z0GA 4Q0BB 3PW0A 1RT5B 2X1AA 2Q3PA 1S6UA 4ES3A 4DX7A 4CO0A 1WG5A 2PMHA 1JX4A 4LFCF 1KVJA 1VQ5S 4NLRA 4WJBA 3FBFA 4X4PA 4JI0J 1X9WA 3D6MB 2ZBQA 3UWTA 3I0RA 2ASJA 3RBXA 5J1NA 5B0DA 1RBOB 2DO0A 3ISND 1TKXA 2OD6A 1Z2LA 4ANCA 4UQGA 1Q82T 3AODA 1Q7LB 2Y1LB 4RNFA 2BA9A 1WNEA 4WFYA 2VL1A 1Q5YA 2E7VA 1UVMA 4CLYA 3MUMP 2VG5B 3BYRA 2CAJA 2I9SA 3DM2B 3MM5B 2CQ4A 3W9IA 1CJUB 2NCKL 3IRXB 3LGNA 3IWLA 3IS9B 1MROA 1TL4A 1NJZA 4RW9B 4LQ9A 1U26A 2ZZMA 1H74A 4F3MA 1A9NB 2GVDA 1C0UA 3UCZP 1S6PB 2FUG9 1HQEA 1X0FA 3CT9A 2ABYA 1AT1B 2QV6A 1X5OA 2OPSB 2L48A 4DV6J 5DLFA 4OYWA 4URSA 1G3OA 4TU7A 4K2JA 3HZGA 3VGTA 1NZAA 5CYQA 3H0PA 2E1CA 5F9LA 3ILIA 3UVJB 1S7IA 1KFDA 4S0MA 1NB7A 4RW6B 1UVKA 1S57A 3N9UC 4IYQA 4OZLA 1JJ4A 1UPPA 1VQ6S 2F3JA 3EXCX 2E9ZA 1MWYA 1TUGB 2CQ2A 5D6GA 2XM3A 1JJHA 3OL7A 5I3UA 4DUTA 4NEZA 3EDRB 2DR5A 1C2PA 1RWNB 1M0SA 2OD4A 2ZWOA 4USTA 4OI1A 4IFVA 1HBOA 2BE7D 4NA1A 2WW8A 2A2CA 3QT8A 4ZLPA 2OFHX 4CLKA 3MCNA 4WWSA 2C3UA 2MY7A 2R2RA 2FHMA 2PMZD 1N5YA 3EICA 4TKTA 2J0XA 4XO0A 1YGYA 2HZVA 3DXSX 3UN3A 4PWDB 2DNNA 1PYOB 1TKZA 3LPYA 3BN4A 4CO3A 4PG4A 4F4YA 1RHQB 2YX4A 1KQGB 3KJVA 5K5MA 4RW8B 3KMSA 1O6XA 3AD9C 3NXZA 2J5AA 5F8GA 1U0HA 1GQEA 4Q44A 1R0AB 2KM8C 2CPFA 4ZPDA 2OEMA 1GTHA 3GTYX 5AXKA 2AHOB 4NLDA 5HATA 4I0WA 4DPUA 3GU0A 3T41A 3MF5A 2QMUB 4LFBJ 4M5DA 2KT2A 4QZVB 5C42B 4ETXA 1TKTA 1HNVB 1IKVA 1R31A 3JXOA 2JL9A 3R3TA 3R6GB 2OPRA 4DUYF 4Z37A 1H6KX 1C1BA 3TZYA 5KFYA 1YRTA 4FF3A 1CJKA 3J80Y 4J9PA 1NSPA 2WB4A 5EX3A 1QSLA 2CRLA 2YNHB 3K5NA 2DPIA 1N5VA 4U7CA 1RU2A 4C0HA 2DNMA 4FXDA 4DL5A 3CWJA 2AP6A 1SBRA 1UZHA 3UR0A 1VQKS 2CXEA 1U09A 4DQIA 1DQAA 4O44B 2VHGA 2FC9A 2HWTA 2QFIA 4B9VA 3NS5A 2WONB 2E5HA 1NU4A 1K1SA 1WD6A 3DDKA 3EM1A 2KRBA 2XULA 1WSRA 4N77A 2UU9J 4DV5F 2KO1A 4QR0A 2EFOA 3CJSA 1RT6A 5DG8A 1FRKA 3MAAA 2XSJA 1KOOA 3D66A 2YH1A 5KT3A 2IMOA 2EKNA 1YBTA 2NPFA 3V4MA 1PO6A 3TZWA 1Z4UA 4CO1A 1GAOA 1TK0A 1UWBB 1UJ6A 2ZD1B 1SJFA 3MUVP 4DR4F 1RHKB 1T9XA 2IVFB 4JI2J 4ED1A 2HQIA 9ATCB 4IKAA 1DARA 4RW7B 4FS2A 3C46A 4FYDA 1QAYA 4ECTA 4DN9A 2L41A 4IG3B 2RKIA 2BXJA 2VDIA 1A0OB 4QJVA 1ZAWA 2PO4A 4C2MA 1YIJS 3KG1A 4ED4A 3HSDA 4LF2A 3T9NA 2M3DA 4F7VA 4ICLB 2B43A 1HNIB 3O6QA 5GAHI 5ETRA 1RWOB 1JKHB 4JV2A 4LVOP 4ED3A 2CQ1A 2QA4S 3X3UA 1EETB 4CT9A 4TYAA 1CQNA 4I6WA 4I4BA 1U0SA 4DPWA 4BC7A 4DJBA 2KM8B 2VICA 4JYAJ 5HMXA 4F50A 4LBPA 2XCPA 2F40A 3G96A 3AHPA 4JOUA 4OZ2A 1CPZA 2FVSA 3QAEA 2AEJA 4CWBA 4EEYA 5IT9Y 2CDRB 1KLMB 3R5GA 2YWGA 1Y9OA 4PABA 2YNFA 1OIAA 4M95A 4LSNB 1V5VA 3A8JA 3OVAA 1D9DA 1BXNA 3H8YA 2CPXA 3HF5A 2QEXS 4JUZA 3CO9A 5T41A 4WFNQ 2VD3A 1VC5A 1BD6A 1IR0A 1LKZA 3I82A 1S0OA 4ZPTR 2HNYA 2XYPB 4TQRA 3KNAA 3BGRB 1WTFA 4DX8H 3BO4A 2C42A 1O0PA 5A8RA 5E3PA 3DGPB 2F7VA 2KH9A 2UXBJ 3UE2A 3TA0A 4EFAC 3P5TL 3LH2S 2BM0A 2GO8A 4RBUA 5J2QB 5A2QY 3UDVA 2DO4A 3HHKA 2CQGA 5KFXA 3ELHA 2GS8A 3K5OA 4RU9A 1X9MA 3JQKA 3HT3A 3CDBA 2GMHA 3W66A 1QSSA 2J8AA 2E5GA 3HVTA 2HHVA 3J7ZT 1PBUA 3ZZUA 3EGNA 4O0IA 2G2OA 3HSZA 4P2XA 5GADU 2ZM6J 5KFNA 2BEFA 4IFYB 3W63A 2JNJA 2FZGB 4F0HA 4X4TA 4DSJA 3P8BB 1Q8IA 2V2QA 4GKKF 2KFZA 2HMIA 2CNLB 5B7WA 4NZ6A 2B0GA 4H4MB 3DLHA 3A12A 3QNWB 2VA3A 2KZZA 2RRNA 2XGQA 2RD5C 2Q43A 1ZPVA 3CMAS 5K8NA 3NG8A 3DOKA 3BEGB 3P5BP 3TX0A 2PD1A 2ZUAA 3KK2A 3DOMA 2VOOA 2KXHA 2EXUA 4C0OC 1JXLA 3Q86A 3I0RB 3RAXA 4WCEQ 1SC1B 4CDIA 1KVKA 4OMFG 1TKXB 2QE5A 2XLIA 5IM0A 3CC7S 1HWIA 3I4PA 2PI4A 4ED7A 2BKNA 1M5SA 2CPEA 1QM9A 3OFFA 2W2QP 1REGX 1YVFA 2Z30B 2J0QD 2JVOA 2MQLA 2ZUGA 2LQ5A 1M1GA 2CJ9A 2YPYA 2A6OA 3HSJA 4LSZB 3BDEA 2HFOA 3MDFA 2WAQD 3WX8A 2MHEA 1JLQA 4OHZA 4RWXA 2C1EB 5H9EK 1AYEA 2KVQE 2J7UA 2DB1A 3AH6A 1C0UB 2PT0A 3W62A 3BKUA 4ATNA 2QLWA 3AXMA 3SDEA 4K0KJ 4HVZA 1HQEB 4RJVA 2VC0A 2VZ9A 2YX7A 1T9VA 5LSOA 2R7QA 2ZH6A 2R8GA 3EE3A 3MECA 4QWDA 5CYQB 3MPUB 4C8KA 1WHWA 4ZHRA 2D74B 4I2QA 3OTCA 4X64J 1WC0A 4FKXA 1LWEA 3HHLD 1RT2A 2GZOA 3J80U 1B3TA 3WIVA 2NZCA 2GQQA 3KLEA 1KVIA 4PXEA 3Q24A 3BGOP 3I31A 3JQMA 1SKRA 4K8RA 1SIWB 4O3RA 1KHVA 1YJ9S 4OYOA 5I3UB 3QSYB 5LSLA 4WXWA 3RU0A 1S4FA 3NMRA 3FRZA 4LBIA 4IFVB 2RQMA 1HBOB 3OL8A 2OGUA 3VGSA 1FWPA 2RQ4A 3WX4A 1LWCA 3QWUA 3IAS9 2RHQB 4LRFA 4EMDA 3NS6A 3BJYA 2C2KB 1SB6A 4AXJA 1Z1ZA 1S6QA 1U1KA 3SSRA 1GH8A 1N5YB 3AFGA 3CCLS 2DNLA 1ZZNA 2ZFHA 1TKZB 2VFRA 2YQ1A 1PKUA 3CD6S 2E29A 2V8GA 3CCQS 2HS4A 4KJIA 5DO2A 5HSPA 4C8MA 4RZRA 2JVRA 5BR8J 3NOCA 2MGZA 2FB0A 5LSRA 2DGWA 1HHSA 2HLUA 3KJVB 4LRBA 1LOUA 2CQ0A 3KLVA 1U0HB 4KC5A 4OHVA 2ALZA 1J5EJ 5HVHA 4WTYA 2Q66A 4ZIWA 1NZ8A 4DUZJ 2VQEF 2P2CB 2FHJA 3VZHA 4WK3A 3KK3A 4AL7A 3KK1A 1VQOS 4M5DB 1HLWA 1YWXA 2CZVC 1E6YA 3MM6A 2W4CA 1VRUA 1TKTB 1RAIB 1IKVB 1ZA2B 5LMNJ 2ATCB 3DYAA 3HK2A 3CD0A 4KGKA 5DM6Q 5IOLA 3J7YU 2OPRB 1OY6A 2QGFB 1ZTTA 3M6WA 1C1BB 2DY1A 3TAQA 2UXDF 3R7SB 1CJKB 3NY0A 2C2EA 4U96A 1U6BA 1DRZA 1FJ7A 1SCJB 3P96A 2D3OR 2D69A 3CDUA 5I3PA 3PO5A 1U6FA 3AOBA 1IBMF 5EHHA 2PDAA 3QSIA 1RWPB 3HHDA 4Y2MA 1RHMB 1H2UX 3T1YJ 5IT9U 1VQ8S 1KQKA 2XMAA 1HWUA 4C8YA 2HBQB 2HHWA 4G1IA 4WFBQ 1N34J 1T05A 1GXUA 1K47A 3GIIA 1B70B 2AJ2A 2M2BA 4MK7A 3BH6B 2XWXA 3K17A 1WC6A 4OI0A 2B51A 2AYEA 2LYVA 3Q8UA 4JP8A 3QT7A 3D6TB 1Y5NB 4F4XA 2HAIA 1FJGJ 2MTLA 3TW0A 1RT6B 4ILRA 4YMEA 3G8TA 4LF6J 4JI8F 4C9DA 3MAAB 3RRGA 3W9JA 2EEYA 2XSJB 5D4LA 3MPYA 3CJRA 4C4WA 2ZH1A 5THWA 1SKUB 4LR7A 4QWBA 2XHCA 2CPYA 2IM1A 2MSTA 1ELOA 2XGPA 2NXEA 4EZ9A 5E41A 3C15A 4JI3J 3GE9A 1XNQF 3GLJA 4F4WA 2AWZA 2RDIA 3IC1A 2XZDB 2AJ4A 5EWEA 3RRKA 5F8IA 4F8RA 5IFMA 3BKTA 1FK9A 3TVKA 2RKIB 1N32F 2GCFA 4P6QA 3OTEA 4MIAA 2NQPA 2CJYB 5JVHQ 3C8YA 4CLFA 1SXLA 4P10A 2KFYA 5ETTA 4CLTA 3RRHA 1CS4A 5AXMA 2DNYA 4CLUA 5E3CA 3W3SA 3ZTQA 1U1LA 3GONA 2KL8A 2QLJB 2VPZB 2RS8A 2WRMA 2RS2A 4Z7CA 2XNRA 4WIIA 2OLWA 4O0NA 3EX7B 4HHJA 4DCOB 4QIVA 1JLBB 1X4GA 1QVFR 1S1UA 3FZBA 1ZS6A 4E8UA 3ZXWA 1N4LA 3CMES 3RW7A 1H3DA 3TAPA 2YNFB 2BUNA 4RBVA 4OX9J 3GV7B 3MMCA 1N5QA 1XMOJ 3G4SS 3GSDA 3RB6A 1PAUB 2HFUA 1NK6A 3BPSP 2IYGA 4NLYA 2U1AA 1HD0A 1S99A 2ZJPQ 3CDWA 2HNYB 2IVMA 3QRQA 4GKJF 3DLKA 2OO4A 1C1CA 2J9DE 4PYDA 3HHEA 1REVA 3P45B 4RL1A 3M2VA 1BLUA 1XR6A 2AYBA 5A8RB 3HZEA 1NK5A 3OJSA 4K4ZA 1N88A 5SUHA 5HQMA 3FCHA 5IC4B 4R8UA 2ASYA 2ZJQQ 3RAQA 2GV1A 4OJHA 3DHXA 2LXFA 1WKJA 2NXCA 1CVJA 2NLWA 4OYBA 4CZCA 4LF9J 1XNRF 4DQSA 2B5JA 3OUYA 1J5OA 4ZP7A 1TMMA 3L7UA 2B9XA 4V19X 3MPWA 1IM4A 2G13A 4ZCLA 1WG4A 3NEKA 5JJBA 3H2VE 3BQ0A 5A8KA 2W4DA 1BQXA 3GILA 3HVTB 4FF4A 3CCJS 4ZA1A 3HKZD 5HQ8A 3MOJB 4R5PA 1RYSA 3VQSA 2UUCF 3FDSA 2M4MA 1GNKA 2W9CA 1FKPA 3AD7C 2LKZA 2MKHA 1FTCA 2CNOB 4DZ6A 1FO1A 4QIWD 1S4EA 5EDWA 3JTOA 2HMIB 4KYZA 5T7LA 3D4JA 2P6TA 1HW9A 4DXLA 1XMQF 2VF3A 4IO1A 2R8JA 2CQIA 2UV8A 4UUXA 5SZTA 3DOKB 1TV6A 3MFIA 3KK2B 3DOMB 2ACYA 4DV4F 4XPCA 1X7VA 3DRXA 1VS3A 2Z58B 1IM6A 2NSCA 3Q8RB 2C2NA 1RHJB 2RVJA 4CLWA 1LK7A 1IBCB 3UNGC 4LSLA 1WTBA 4YDDB 5D0EA 5IM0B 1ZAXA 1D8ZA 4CTAA 3CJ0A 3BR9A 2ZJRQ 3ET6A 4LREA 1VCTA 4OZ3A 1MG7A 4M1KA 4XK8C 1FRIA 4DPTA 1YSJA 4AYBD 3UQSA 2E44A 3M2UB 4DLEA 2B4OA 5CYJA 2KT3A 1VJQA 1RB0A 1CSJA 1UW9A 4A8FA 3MTKA 4DFJA 5B08A 1JLQB 5C25A 3T9ZA 4LR8A 4YB7A 3AAWB 4KBIA 2HBZB 4Z2XA 4CIOA 4F25A 3M6UA 4W4MA 2ZITA 3EMTA 3M9OB 3SDEB 3OVSA 1WJ9A 4UY85 1Y0HA 4I64A 1U48A 3Q22A 1X4HA 4HR2A 1ROFA 2I38A 3MECB 1HQ2A 2DIVA 1TZ0A 2CQDA 1I94F 4ZHRB 2CQCA 4I2QB 4L76A 1U4BA 2V0NA 1LWEB 1WELA 3NGRA 2UUAJ 4FBTA 1RT2B 3PCOB 1VQLS 3E2EA 4JI6J 3I5CA 4UW2A 2DXDA 1N52B 1ZOTA 3KLEB 3T1HJ 4NXNF 3C6UA 4ZCKA 5GMEA 5JUMA 1N48A 2KN4A 2LDIA 3CJ3A 1EQMA 2KI2A 4KGXB 4DR6J 2H1YA 2XTJP 5HLFA 1WKLA 1GEHA 2HKEA 4QWCA 2DH7A 4RUBA 2K7KA 3AA8A 1QY7A 2ZOMA 4IRDA 4L6V3 1VDHA 5IZHA 3OT9A 2X3GA 1FI4A 3NAHA 4U8VA 4DPYA 5GMDA 2ZDOA 4ENOA 1LWCB 1S5ZA 4ZVQB 3R5AA 4C98A 4A8SA 4MYUA 4LFCJ 1S6QB 2UZAA 3OVBA 2CPJA 3HVAA 1Q8KA 3HCXA 2H5EA 2MLYA 2F8EX 2AD9A 4M63A 5EN1A 4GO7X 1KC8T 5K14A 2APOA 2YXLA 3PFOA 4EWTA 1IWAA 3R5BA 2MGZB 1NSAA 3OTDA 2ROPA 3D0GE 1JLEA 3D2WA 4D3GA 4IDKA 1UFWA 3CD7A 2FPHX 2MJNA 3D1QA 3D1HA 3UNYA 3QLHA 2V68A 4YR0A 2BJ9A 2HK3A 2OTLS 5IWAJ 3RB3A 3IBWA 2ZC4A 4C8NA 2XS5A 1VQ9S 4ZPBA 3LGHA 1B7YB 5M2UA 2MQ8A 3KK3B 2GJ2A 1A7GE 2MQMA 3PRDA 1YRXA 1I3OB 1W26A 4O4GA 3KK1B 4NEYA 1DLOB 2E1RA 1UCNA 1F0XA 2XC9A 3MM6B 4I7FA 1VRUB 1U1QA 4K4VA 1XERA 2R2SA 5L8RC 2HS3A 4DZDA 2VKZG 4NLUA 1URRA 2FGCA 3OTOF 3DYAB 2BM1A 4KHRA 4ZVOB 2WVBA 3CCUS 4B3TF 2VDHA 4QR2A 1QLNA 1FRHA 1F60B 3KDNA 2EFQA 4AUKA 1SI9A 3MPVA 1YJWS 1VOMA 1RAFB 3DNCA 4DU8A 1AZSB 4EYHB 2W7AA 1QDUB 3CJQA 4DR1F 3PY8A 2PN6A 4ZKAA 5KFUA 1BY9A 1AB8A 2P9CA 4ECWA 3CO0P 1DY3A 4IQMA 2QZ8A 4JV5F 3CF5Q 5FJ4A 2MLXA 1GXLA 2HVZA 2C2OB 1VRTA 1T05B 2LU1A 2BVZA 2Y1IA 1I1GA 1RI7A 2IYIA 3CGIA 5FIIA 5HJXA 3DLBA 4TU9A 5JXSA 5GAGU 3AJDA 3EWGA 5DDRC 2GVZA 1R3NA 1RDRA 2G2ZA 2RT3A 3HDSA 3S01A 4P2MA 1PCAA 4F3QA 1D0EA 3I56S 1TL5A 2PFDA 1NPPA 2PI5A 1RCOB 4TLQA 2HQ3A 2BRKA 2EPIA 2AJ1A 4DSEA 3N01A 4QW9A 1RE1B 1OPZA 1M90T 3ONQA 2ZH9A 4N7TA 2CJQA 3DU6A 3OXLA 2H48B 3ZTSA 2ZH2A 1KSPA 3W5ZA 3GWCA 2FGOA 2Z57B 4B3RF 3HVWA 1BQMA 3C15B 4CT8A 2Y8YA 2OUGA 2Y8WA 1FF2A 4DF4A 4C0BA 4PWUA 4R0JA 2HNZA 4FN5A 5HK4A 2DVIA 2L9NA 4M5NA 1K0VA 3D3BJ 3ZFVA 5F3TA 3EGWB 2EBEA 4J37A 5L38A 5DGAA 2AF6A 1FK9B 4RR5A 2XO6A 5HMZA 5KFHA 4CH7A 2DHXA 2DGTA 2IHR1 2MQPA 4M5LA 2YWKA 2RNEA 3PJ9A 3OD2A 4OHXA 4O23A 4KKOA 1N36J 2BQRA 3M8PB 2KJWA 3JS9A 4DQQA 4M5MA 1ZTWA 1R8CA 1SIZA 2ZWPA 3VAKA 5E3AA 3OR2A 1CS4B 2GIRA 3NWGA 1XR7A 1WF0A 2PIIA 3OFHA 4DUYJ 3H2LA 2Z8QA 2MLZA 2N3LA 4HHUA 4Q7AA 1BC6A 3I9ZA 1L5UA 3IN5A 4A8YA 1RQ0A 4X65F 3T5KA 4DL7A 1EP4A 2PA3A 2GO9A 3C19A 4MAKA 1MU2A 1S1UB 3JYTA 4MKBA 3R2CJ 4OJ3A 2M52A 3CJ5A 4B08A 3HHLA 1EKSA 3HULA 2Z4PA 1NCLA 1IUJA 5KT5A 5J1PA 3R6LB 3CPWR 3MMCB 2OH2A 2A18A 2BZ2A 3A8KA 2DNGA 3MOZA 3N6LA 4PCQA 3UPFA 2IJRA 3SIPB 4YB6A 2CJXB 3TOQA 2WW4A 5ETQA 1S48A 5KG6A 3DLKB 2QA2A 4KFBB 4WPAA 1KEKA 1C1CB 1M5VC 4DV5J 1REVB 4C7QA 3M2VB 5D3GA 4QIFA 1X4DA 1SJRA 5IQQA 2EC0A 2EFVA 3MURP 2KXNB 4R8UB 5KAKA 4WP9A 3C14A 1CULA 4MKYA 2IJNA 4ECZA 3RZAA 2HRTA 2B5JB 3OUYB 4AQYF 1J5OB 3AJ1A 4C97A 2V2KA 4DR4J 3A8IA 2JC0A 5A8KB 2PEBA 3LF0A 1FX2A 3KJQB 3QT6A 2ZC3A 4ZS6A 3Q23A 2B6AA 4CO5A 2D9PA 1IQZA 4F4ZA 4R5PB 2JEJA 2QJ3A 1X9SA 2HHSA 1VC6A 2X3DA 4C48A 1XQIA 1S7HA 4LUBA 2W9CB 1FKPB 2DD8S 1NK4A 4WYLA 4QWAA 2WVFA 2ZZTA 2ZVSA 4UF4A 3G87A 4HTIA 2R7SA 4UOGA 1FXRA 5T7LB 1YBUA 3PEHA 1IBKF 1URNA 2P9GA 5ETMA 4ZCMA 2ZEJA 1Q53A 4RUHA 3B6BA 2ZOFA 3PEJA 3MEKA 5HMYA 4ZPWR 2XLJA 3I9V9 5CH7B 1TV6B 1NLKL 1RTIA 5DRKA 1WF1A 3OLAA 5LMUF 2XMTA 4NPOA 1YRUA 1SJ1A 2DRDA 1F5AA 1HNZF 2E9TA 2W2PP 1NNDA 3G8QA 2FHOB 1VJWA 4ZN1A 3GR1A 3JSYA 4BDPA 3QIDA 4LSLB 3QQCD 4Y3CA 1JB0C 3DDNA 1TU0B 2H4YB 4CTAB 1FNMA 1ZH5A 1HNWF 3R1LA 1N33J 2CWKA 2YQ3A 3AA9A 3ET6B 4P72A 4U9RA 1AFJA 5KFIA 1QTMA 1PG5B 4KV8A 4QOTA 4AL6A 1OWXA 4J90A 4LF8F 2AEMA 1LQ9A 2EC2A 2EVZA 3AQPA 3N5BA 1OYEA 4L75A 2HVHA 3W9HA 4DSFA 1Q8LA 1XR5A 1H2TZ 5C25B 1N5TA 2HRUA 4X4QA 4XAKA 4NX9A 1MNEA 2LA6A 3OL6A 2YWFA 3S6EA 5HBMA 4EGLA 3HJVA 3PJXA 2QL9B 2YWWA 3PYDA 2HPUA 2MY8A 2RAQA 4P52A 4JI7F 2XQCA 3KUGA 4J91A 1TL1A 2GAHC 2GJIA 3QFWA 3TJ8A 4ZVRB 3M8ZA 3GG1A 3K57A 1T3NA 1U2FA 4HACB 1JNZB 1JWWA 4ZLLA 4OL8A 1HBUA 1XK8A 2CQBA 4OX6A 2NYIA 3R8YA 1SC3B 3IMQJ 4UY8T 3GG0A 2DBBA 1RWKB 1Y11A 4OQJA 3JSMA 4FF2A 3UO0A 3EVWA 5LM7E 3C6UB 3BDPA 2OEKA 2ALYB 2ILYA 4NCAA 3KLIB 4NLTA 2IRYA 1BUXA 5D15A 5HLFB 1AFIA 2OKQA 4IOAQ 5AXNA 1SKWA 3CDAA 2VFUA 1KKHA 4Y2AA 3ZZTA 2SXLA 4YP3A 2IPOB 5ADZA 5J2PA 4GKKJ 3KLGA 2HVEA 1U2CA 3GJSB 2BW2A 2W1BA 1PGZA 4X62F 4ZPCA 3NAIA 5KFZA 2YKMA 4Q8FA 2EFNA 4GC7A 1UPMB 3ZC4A 5HO4A 2C3PA 4YN3B 4H54A 1IKXA 4L72B 4KGVB 5CD4A 4F36A 4RWWA 4IOCQ 2HQCA 2G2YA 4GMKA 3N6NA 2D3UA 1K0TA 2R7UA 5K14B 3OV7A 3CIMA 3K5PA 4B02A 1HBNA 3NNHA 1TK8A 2A0FB 2L9WA 1JLEB 2OHDA 1Q5VA 4IDKB 2DHGA 2OFGX 4NOHA 2G0IA 3FBCA 2J9DA 1WOPA 2UUTA 1NDPA 3QLHB 2AYGA 3ZO7A 3S7RA 1YJUA 3B8HA 3V6HA 3B82A 4LF5F 2YY3A 2R8HA 5F8HA 3GIKA 3OXFA 2QIFA 1ZZFA 4WIQA 1V3ZA 3LP2A 3US5A 5ETLA 3FMBA 1NO8A 2CNNB 4OI2A 3H20A 2QN6B 3VAIA 3DN9A 3ZNUA 3HHLC 4O4GB 1VBYA 5DQGA 4DSIA 4USMA 4OI6A 3HPOA 3IM8A 4DDFA 2ZOGA 4I7FB 5GAGI 2QLBB 3A1YG 2F4VF 3MR5A 4K5RA 1IBLJ 2ZHBA 4N5SA 1ZPWX 3T19A 3EPGA 1HPZA 4U6PA 4OZ1A 1WORA 3L3CA 1LK5A 2YWHA 4ZDNA 2WTFA 5KG7A 2HBYB 2FJXA 4Q2LA 4LF1A 1C4AA 1CQMA 3MPDA 5K8MA 3HI9A 1HWKA 5F0WA 4HI2A 4X4OA 3KUEA 5G4DA 1ZETA 3IP0A 3HD1A 1VMBA 4DV1J 2J0SD 2R4FA 3DMJA
chains in the Genus database with same CATH topology
2MEWA 3R2CJ 4JV5J 4JI6J 5LM7E 4JYAJ 4JI4J 4JI3J 5BR8J 3J80U 1N33J 2UUCJ 3T1HJ 1N32J 3D3CJ 4B3SJ 4DR3J 4KHPJ 4B3MJ 3D3BJ 1IBKJ 4DR2J 4DR6J 4X62J 4DV7J 4DR5J 4OX9J 3T1YJ 4NXMJ 5IT9U 4JI2J 5IWAJ 4LF7J 3JAMU 4JI1J 4GKJJ 4GKKJ 1XMOJ 2F4VJ 1J5EJ 2ZM6J 4DV3J 1XMQJ 1HR0J 2UXCJ 4JI7J 4DV0J 1N34J 2VQFJ 4AQYJ 4DUZJ 2MQ8A 4X64J 1N36J 3OTOJ 1XNRJ 2UXDJ 4KYZA 5LMUJ 3J81U 4NEZA 4NEYA 2HHHJ 4LF4J 4DV5J 4JI5J 4YHHJ 4DV2J 1HNZJ 1HNXJ 4DV4J 4B3TJ 4LFAJ 1IBLJ 4JI8J 4DR1J 2KVQE 2UUBJ 4X65J 1I94J 3W1YC 4LFBJ 4LFCJ 4K0KJ 4DUYJ 2E5LJ 4RJVA 2UU9J 1FJGJ 2MTLA 5LMNJ 5FLXU 4B3RJ 4HHUA 4LF6J 4PWWA 4X66J 4DR7J 5A2QU 2KL8A 4YY3J 1HNWJ 4V1Ak 2UXBJ 1XNQJ 4DV6J 3J7AN 3IMQJ 5AJ3J 4NXNJ 4JI0J 4LF9J 4DV1J 1IBMJ 4DR4J 2VQEJ 3R2DJ 4KY3A 2UUAJ 4LF8J 4LF5J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MEW A;  3R2C J;  4JV5 J;  4JI6 J;  5LM7 E;  4JYA J;  4JI4 J;  4JI3 J;  5BR8 J;  3J80 U;  1N33 J;  2UUC J;  3T1H J;  1N32 J;  3D3C J;  4B3S J;  4DR3 J;  4KHP J;  4B3M J;  3D3B J;  1IBK J;  4DR2 J;  4DR6 J;  4X62 J;  4DV7 J;  4DR5 J;  4OX9 J;  3T1Y J;  4NXM J;  5IT9 U;  4JI2 J;  5IWA J;  4LF7 J;  3JAM U;  4JI1 J;  4GKJ J;  4GKK J;  1XMO J;  2F4V J;  1J5E J;  2ZM6 J;  4DV3 J;  1XMQ J;  1HR0 J;  2UXC J;  4JI7 J;  4DV0 J;  1N34 J;  2VQF J;  4AQY J;  4DUZ J;  2MQ8 A;  4X64 J;  1N36 J;  3OTO J;  1XNR J;  2UXD J;  4KYZ A;  5LMU J;  3J81 U;  4NEZ A;  4NEY A;  2HHH J;  4LF4 J;  4DV5 J;  4JI5 J;  4YHH J;  4DV2 J;  1HNZ J;  1HNX J;  4DV4 J;  4B3T J;  4LFA J;  1IBL J;  4JI8 J;  4DR1 J;  2KVQ E;  2UUB J;  4X65 J;  1I94 J;  3W1Y C;  4LFB J;  4LFC J;  4K0K J;  4DUY J;  2E5L J;  4RJV A;  2UU9 J;  1FJG J;  2MTL A;  5LMN J;  5FLX U;  4B3R J;  4HHU A;  4LF6 J;  4PWW A;  4X66 J;  4DR7 J;  5A2Q U;  2KL8 A;  4YY3 J;  1HNW J;  4V1A k;  2UXB J;  1XNQ J;  4DV6 J;  3J7A N;  3IMQ J;  5AJ3 J;  4NXN J;  4JI0 J;  4LF9 J;  4DV1 J;  1IBM J;  4DR4 J;  2VQE J;  3R2D J;  4KY3 A;  2UUA J;  4LF8 J;  4LF5 J; 
#chains in the Genus database with same CATH topology
 3EJM A;  1RWX B;  2X1B A;  1MW7 A;  3R9L A;  4LIW A;  2U2F A;  2R7R A;  1J27 A;  4QIG A;  2ZE2 A;  2VPY B;  2DIT A;  2HBR B;  1V3S A;  4HKQ A;  5KFK A;  1T11 A;  1VRT B;  3BS9 A;  2BKO A;  4ZJO A;  3O2I A;  4IQX A;  4PRF A;  4P71 A;  4NE9 C;  2NPI A;  2QX0 A;  4X4R A;  4O3O A;  4ZVF A;  3CCR S;  2HAF A;  5J1E A;  3IR7 B;  2GVZ B;  4MT1 A;  1RWU A;  3OSN A;  1X0P A;  2DNR A;  3GPA A;  1WC1 A;  4WFA Q;  2ZH8 A;  1X8D A;  5CZV A;  3M9N B;  4CO2 A;  2DNZ A;  1KTQ A;  1U47 A;  4J9M A;  2ZKU A;  3GFX A;  4F0M A;  4H4O A;  2W4P A;  1BQM B;  1MWQ A;  2KZM A;  2K7J A;  2MZR A;  2NSB A;  5LXR A;  2FVQ A;  2HNZ B;  1HQU A;  3FEX B;  1N54 B;  2JC1 A;  2QYG A;  2XCA A;  4WXO A;  3QJJ A;  2H3E B;  2WVC A;  3ETM A;  4DLG A;  3LP0 A;  2J7W A;  4KKO B;  4WF9 Q;  1Y10 A;  3QT5 A;  1U7L A;  1VBX A;  2OJ3 A;  1RAA B;  1S77 D;  4OYP A;  2BDP A;  2DH9 A;  2JLG A;  2EK1 A;  2QT7 A;  3OR2 B;  4XDD A;  5AE1 A;  3PDN A;  5CAB A;  2FLO A;  3A13 A;  3DCA A;  3FQK A;  3MCO A;  4FVC A;  2WOM A;  4KTQ A;  3FFI A;  2FVR A;  3W2V B;  2H5J B;  4QYZ J;  4NLO A;  1KQF B;  2V4Q A;  4Y2C A;  2M8D B;  1EP4 B;  1CEZ A;  5IXU A;  1D1U A;  4CLZ A;  1MU2 B;  4NRT A;  3JYT B;  4P74 A;  1LNQ A;  3O5T B;  1IBM J;  5KG3 A;  3KHR A;  1SJ3 P;  2ATL A;  3TAM A;  3W65 A;  4MIB A;  4PPZ A;  1SL2 A;  3DI6 A;  3HHL B;  2BX6 A;  3ZTO A;  5CAA A;  1VIO A;  5F9N A;  3M4X A;  5ETK A;  3GFY A;  1RWM B;  4ED8 A;  2JLE A;  1WI6 A;  3LUY A;  2E1M C;  5HJY A;  2AEF A;  1H0H B;  4OX7 A;  1NB2 A;  1G7C B;  3MEE A;  3W7B A;  2MQO A;  4O3N A;  3QRR A;  4C8L A;  2CPD A;  4DX6 A;  1KDN A;  4FKY A;  1RK8 A;  2MHN A;  5DM7 Q;  4DV7 F;  2I6W A;  1T8E A;  1CC7 A;  2RB7 A;  5D3G B;  4B9U A;  3CCM S;  3UCU P;  4JI8 J;  1JMT A;  4U7U D;  2OI2 A;  3CCZ A;  2UUB J;  3BSC A;  3C14 B;  3QAU A;  2B4U A;  1CUL B;  2HIY A;  3D7S B;  4ZK7 M;  3JQJ A;  4JV0 A;  1FFG B;  5A76 A;  2FZC B;  3I5A A;  4HEA 9;  2N3O A;  3UD3 P;  2D41 A;  2FHK A;  3H5S A;  4ZP6 A;  2F9J A;  1NDC A;  3WQP A;  2NUH A;  3UW1 A;  3D28 A;  1T9T A;  1XNQ J;  3SBM A;  2YVS A;  2W8L A;  1FNX H;  2D9O A;  1OSC A;  2M8H A;  2LXI A;  4EI2 A;  3NLC A;  3OTB A;  1O51 A;  3QBC A;  3BSO A;  3KG0 A;  1ZA1 B;  2B6A B;  1MN7 A;  4ERD A;  1P1L A;  2HQG A;  2XSF A;  4QPX A;  1APS A;  7AT1 B;  4RBT A;  1N32 J;  2GGP A;  2C2M B;  2B4V A;  1FE4 A;  3ADA C;  4URQ U;  2ZVI A;  4X2B A;  2DH8 A;  3WIU A;  4NYP A;  1FRM A;  2I2Y A;  2XMW A;  3P49 B;  1MML A;  3Q8Y A;  4KHP F;  4DFM A;  2KTQ A;  5ETO A;  1FNO A;  1WEY A;  2PA8 D;  3M6X A;  1OMS A;  1JJC B;  1B0P A;  5ETN A;  4NLV A;  3POT A;  1RTI B;  2HGN A;  1IN0 A;  3NP5 A;  2QYC A;  2CJB A;  3RYL A;  1I5O B;  2KG1 A;  3V6J A;  3VF0 B;  4DPO A;  3R27 A;  3SZ2 A;  4NAS A;  5E2Q A;  5M2R A;  1VRQ C;  3BM7 A;  4BS2 A;  2K2P A;  3KLF B;  1XEZ A;  1FXL A;  3PYF A;  4J9R A;  3D0I E;  3J7A N;  3G71 S;  5BJR A;  1XTZ A;  4AFF A;  3FGV A;  3B4D A;  3PW7 A;  2UVU A;  3MTJ A;  1XJW B;  3H5Y A;  3H25 A;  4FPI A;  2GX8 A;  3DLJ A;  2G1H A;  2BJ8 A;  4KV8 B;  1QSY A;  4IR9 A;  3WBZ A;  1UWA A;  1UET A;  3TRG A;  4ZIT A;  4C8Z A;  4ILL A;  2QTW A;  1JQG A;  4IO9 Q;  4E98 A;  2YPZ A;  3H40 A;  2BRL A;  3C3L A;  1Q8B A;  3DRS A;  1NPR A;  1S1T A;  1YJN S;  4JI4 F;  4WZQ A;  5E0O A;  4GKJ J;  1K1Q A;  4X84 A;  4NLW A;  2XEX A;  4K59 A;  2IRU A;  5HBM B;  1RUS A;  5KFO A;  1FES A;  3MI7 X;  1S0M A;  1KP6 A;  5RUB A;  1VLY A;  5FDL A;  5KFW A;  2FLL A;  1YLX A;  4F4K A;  1TL1 B;  3VAL A;  3TAR A;  3M8W A;  2F8M A;  1N56 A;  1OYD A;  3MMA A;  1VQY A;  3OFE A;  3A3O B;  4ZVG A;  2K1R B;  3C16 A;  1SL0 A;  1HBU B;  3D0H E;  4X4S A;  2AIR B;  3QGH A;  2IM2 A;  2MKI A;  2LEB A;  2YX1 A;  2JJ4 D;  4IH6 A;  5D78 A;  3CJ8 A;  3JSM B;  3G6E S;  1Y7P A;  3FJ2 A;  2X1F A;  1D09 B;  2F4F A;  2UUC J;  2V2Z A;  1RAJ A;  4M8L A;  3FSI A;  2DGX A;  4DQP A;  1K73 T;  1HA1 A;  4K0K F;  3CMQ A;  5BYR A;  5CZX A;  5J2P B;  1HWL A;  3N28 A;  3BSN A;  3KLG B;  3NCQ A;  4Q8E A;  2O67 A;  3I0S A;  4WE1 A;  3PKM A;  1P1T A;  4DR3 F;  1EZZ B;  5KOW A;  2VG6 A;  1XMQ J;  4CH1 A;  1T7P A;  1HWJ A;  3N4W A;  2YKM B;  5KG1 A;  1RAG B;  4YS2 A;  2MZS A;  1UA1 A;  5LOQ A;  3TX8 A;  4DV4 J;  2Y0S D;  1RXO B;  2D3Z A;  4O3Q A;  1C4C A;  2QC3 A;  4KGM A;  3IO1 A;  4PQA A;  1TQL A;  2ZBI A;  3H98 A;  1KLN A;  2ZH4 A;  3RR7 A;  5MAO A;  1UEV A;  1HBN B;  1SUQ A;  5KTQ A;  3EGZ A;  4ELV A;  1Y00 A;  3KWM A;  2J6T A;  1EQ0 A;  3VAF A;  2XMJ A;  4ZPA A;  5KFB A;  2RH3 A;  1VK3 A;  1G4C A;  3JB9 k;  4UTG A;  1EAR A;  3GYG A;  5F41 A;  3RJM B;  1IR1 A;  1X31 C;  4RNO A;  2CIM A;  1U1M A;  2R2U A;  3BB5 A;  1RT5 A;  2VKR A;  4TYB A;  2ZH5 A;  3LP2 B;  1NH8 A;  5HAN A;  1PIL A;  3H42 A;  3Q0A A;  2AZ3 A;  1QUV A;  3MGJ A;  4N8O A;  2C2R A;  1QAI A;  3DU5 A;  1HHQ A;  4XPE A;  4QCL A;  3K7R A;  4F4A A;  5M2P A;  3J81 Y;  4B9M A;  3WC0 A;  4J9Q A;  4EYI B;  4JI1 F;  1M5P C;  3CD5 A;  4FNI A;  3MR3 A;  1HPZ B;  4MKV A;  1R0B G;  3K2Y A;  1I94 J;  2YNG A;  2E7W A;  5KFT A;  1CJU A;  3CJ2 A;  3SCK E;  3MWB A;  3VZI A;  3TAN A;  1ZBT A;  3L7O A;  1RAH B;  4XDC A;  2BQ3 A;  3FKB A;  4CLL A;  3H90 A;  3LQV A;  3DMJ B;  1XWL A;  4NI2 A;  4NXN J;  4ANE A;  2R7V A;  3KKF A;  3PX6 A;  3VTI A;  2CJK A;  2FJW A;  3MR7 A;  1GFW B;  2ROG A;  1WC5 A;  5HRO A;  3RBD A;  2CZ4 A;  2G4B A;  4RO0 A;  1O8B A;  5E33 A;  2V5H G;  3W61 A;  4YUD A;  2EFP A;  1DZ5 A;  3EVM A;  2ZE2 B;  1RAC B;  1TL7 B;  3W8G A;  5GAE I;  3PW2 A;  3CUL A;  3RUB L;  1G6B A;  4U67 Q;  1X4C A;  1PAE X;  2ROE A;  3ILO A;  2HWH A;  2IFX A;  4OZN A;  4ZVT B;  3N5F A;  1KS2 A;  4W98 A;  3F56 A;  2MZQ A;  5DQI A;  6FD1 A;  1TTH B;  4CNY A;  2JHE A;  1NKE A;  5I42 A;  3UVJ A;  2VB6 A;  2MZJ A;  3CCV S;  4DL3 A;  2XYG B;  5J1E B;  3VWS A;  1YJV A;  3SCJ E;  1UW4 A;  2HIQ A;  2BE2 A;  3GV8 B;  1H72 C;  3GB0 A;  2WSF C;  2B8Q A;  4UZC A;  4AE5 A;  3SCI E;  2VBZ A;  4AND A;  2KKH A;  4OYX A;  2IMW P;  2C28 A;  2RE1 A;  1WOO A;  3NRB A;  1UVL A;  2KXF A;  1VI7 A;  1FX4 A;  4H4O B;  1DFD A;  1U2R A;  3CCE S;  1RT1 A;  3IA0 A;  5LT5 A;  4HTJ A;  3G86 A;  3SCL E;  3CUN A;  1FE0 A;  2VFS A;  2VPX B;  4ID8 A;  5L1J A;  3LPE A;  5L9X A;  1HQU B;  3FEZ A;  4DSK A;  4Y0F A;  1W2I A;  1G2E A;  4NRU A;  1RBL A;  3LP0 B;  3EGV A;  5KFC A;  2EG2 A;  3M32 A;  2NUU G;  2DGU A;  3H4B A;  1M1K T;  3E51 A;  4K4Y A;  3ZTR A;  1LV5 A;  5A8W A;  1U1O A;  2C3Y A;  3LP1 A;  3BGU A;  3OTO J;  2RU9 A;  1S1W A;  3AQO A;  2WOM B;  1NK7 A;  4J9S A;  2FLP A;  3FFI B;  4B3T J;  5IV3 A;  4RNH A;  1GMV A;  1PYT A;  1WHX A;  1EB0 A;  2ERR A;  4KH0 B;  2MKS A;  2ASL A;  4DR7 J;  3JTP A;  4BC9 A;  3D6F B;  3HFZ B;  1BQN B;  4U95 A;  1JLF A;  3TAM B;  2JSX A;  4V19 J;  3DI6 B;  3IG1 A;  4TN2 A;  2XI2 A;  4C11 B;  4JV5 J;  7FDR A;  2H9Z A;  3CVK A;  2RRA A;  3AB2 B;  1PC5 A;  3E3X A;  1CLF A;  4URG A;  4MH8 A;  3NGK A;  1R6Y A;  1T3O A;  5AE2 A;  2EG1 A;  1FFS B;  2MKK A;  1SH0 A;  1RJJ A;  3MEE B;  2DGQ A;  3PIP Q;  3GJQ B;  2R42 A;  4F26 A;  1X4E A;  1VC0 A;  4DCP B;  4OFZ A;  4DR5 F;  2M0G B;  1QJH A;  3NGT A;  2LU2 A;  1TFY A;  2HND A;  1BE4 A;  2IM0 A;  2BMB A;  3QRP A;  3BYP A;  5T14 A;  4DV0 F;  1TR0 A;  3V6D A;  3PHT A;  4B3R J;  4ED5 A;  3NGS A;  3SI8 A;  4J9K A;  1VIX A;  5C2G A;  4QQB A;  2XMM A;  4IG0 A;  5ETS A;  2DHA A;  1U1P A;  2C3M A;  3SFU A;  4WKY A;  1CBK A;  4M5H A;  5B09 A;  2KG0 A;  4Y34 A;  1MRO B;  5KT2 A;  1S0N A;  2BJ1 A;  1OY8 A;  5KFA A;  2VG7 A;  4YQW A;  3DRP A;  4A8Q A;  1RAB B;  3IFE A;  3KNG A;  2GVD B;  2AV5 A;  3R5C A;  3PTW A;  3PX0 A;  3QGP A;  3POT B;  4AT1 B;  4NXM F;  2W25 A;  2UVW A;  4FXW A;  1NK8 A;  1SQE A;  5E7O B;  1LW2 A;  2K3I A;  1SJQ A;  4X65 J;  1U49 A;  3CCW A;  3F73 A;  3GYX B;  3CJK A;  1TAQ A;  5HAO A;  3I96 A;  1Q0N A;  1S9G A;  4FYV B;  3A3N B;  4ZVP B;  4PWW A;  4FZV A;  1H73 A;  2UP1 A;  5D4P A;  1FRX A;  1R8H A;  4Q45 A;  4MFB A;  3D67 A;  5DS7 A;  3CNQ P;  1SPB P;  1T03 A;  2XZW A;  1V5I B;  2FVC A;  4ICL A;  2DGO A;  3ZZ0 A;  3DC2 A;  5K8O A;  3R97 A;  3B4M A;  2CQ3 A;  1JNR B;  4UT4 A;  1YBA A;  3DRS B;  5D8H B;  1R8P A;  1FVQ A;  1S1T B;  3PXG a;  5DET A;  2YTC A;  3KXD A;  1L3K A;  1GK8 A;  2X51 A;  2W7O A;  1GXT A;  2R9L A;  1WAC A;  2O01 C;  2Y0B B;  4PZV A;  2ZZN A;  3BGL A;  3N0V A;  3BBC A;  2IA0 A;  1S97 A;  3EDQ B;  3PJW A;  5FDL B;  1S1X A;  3J81 U;  1B64 A;  1EKR A;  3I87 A;  3QYY A;  4I56 A;  2J76 E;  2Y9H A;  3DDI A;  3MMA B;  1WG1 A;  3C16 B;  3GR0 A;  1KBR A;  3C66 A;  5FLX Y;  1ZM2 A;  2CFX A;  3T3F A;  2VU5 A;  4ECX A;  2MB0 B;  2H5I B;  4DF8 A;  3U1M A;  1T95 A;  5H9F J;  2DNK A;  4W92 B;  3QJP A;  1XMB A;  3IAM 9;  3BV8 A;  3NCR A;  2Y1J A;  4BLG A;  4HLB A;  3NBP A;  1NAQ A;  1AXQ A;  1VBZ A;  4TY9 A;  3QZ7 A;  2XYH B;  2ZHO A;  3I0S B;  1IBK J;  2DRB A;  4KAI A;  3F44 A;  4WE1 B;  3LAL A;  2QG9 B;  3GSI A;  3J7Z 5;  4NML A;  2D3O 1;  2MKY A;  2VG6 B;  2AGQ A;  2XS2 A;  2Q79 A;  3KG4 A;  3HXM A;  4H4K A;  1VGY A;  1AUS L;  4UOC A;  1QAX A;  4I6Y A;  4TQS A;  5LMU J;  5CYM A;  4JI6 F;  4UOF A;  2FTR A;  1HNZ J;  3T1H F;  2R2T A;  1Q95 G;  2LQB A;  4USI A;  4QPT A;  2NS1 B;  2HFZ A;  2HHH F;  2DCU B;  1UVJ A;  5BYS A;  2ZNZ A;  3RG6 A;  1SUQ B;  5LJ5 Y;  2PEH A;  1EIY B;  3KHH A;  4ED6 A;  2MKJ A;  1P9Y A;  4ECV A;  4USU A;  1HNW J;  1KQS R;  2HHU A;  6FDR A;  4JBC A;  2A3J A;  1X5P A;  4LF8 J;  2BJ7 A;  4G3I A;  2RDD A;  3CCS S;  2IIH A;  2V69 A;  2ZBP A;  5L1L A;  1WSV A;  2Y3Y A;  5KFG A;  3RGI A;  4LRC A;  4U7U K;  3V6K A;  1UA0 A;  3GFH A;  3VAG A;  2JEF A;  2ADB A;  4PG5 A;  2M70 A;  1YDL A;  4P73 A;  2AZ1 A;  2AQ4 A;  1L3U A;  3S1T A;  4JI7 J;  4A48 A;  1I51 B;  2OSR A;  5LXY A;  3HSG A;  1MWZ A;  4DEZ A;  4MIW A;  4DL0 C;  7FD1 A;  3G6Y A;  5F8J A;  1F1B B;  1SH3 A;  2YNG B;  1RTH A;  2CVE A;  5KT6 A;  2M7S A;  1FDN A;  2HVD A;  2DIS A;  2HYI B;  1S59 A;  2FQQ B;  2NXN A;  4PKD B;  2W01 A;  3LW5 C;  3UN5 A;  4Q2M A;  1HMV A;  5IWA F;  3K89 A;  3M2R A;  4DV2 F;  3M30 A;  2AYM A;  5A2Q U;  1RP5 A;  4NI2 B;  5HVF A;  1RA7 A;  1ICE B;  1RLC L;  3TQE A;  1NJW A;  5HRO B;  1ARO P;  1DTQ A;  4EBD A;  3KLH A;  4X66 F;  4OV1 A;  3K59 A;  3OHA A;  5C2C A;  4N41 A;  3OQ2 A;  4K4W A;  2DNO A;  2FJD B;  3FMW A;  3M7V A;  4ID5 A;  4KT0 C;  4OZ0 A;  4OJ1 A;  2FY8 A;  1UFL A;  2KRR A;  4CLP A;  4X62 J;  2XS7 A;  4PAA A;  2BBE A;  1G1X A;  3CC4 S;  5I42 B;  3SFG A;  1YHQ S;  1Y3J A;  3MAH A;  4B3M F;  1QVG R;  4YDX A;  1IQT A;  2LQ9 A;  5J2M A;  5B0E A;  2BAN A;  2BE2 B;  1RLD A;  1F9H A;  4HH0 A;  4J9V A;  5L46 A;  2CPI A;  4QIE A;  2V4J A;  3QZ8 A;  3RAM A;  2QO3 A;  4R0E A;  3QIP A;  4ES1 A;  2H54 B;  1RT1 B;  2VJU A;  2LLZ A;  4TU8 A;  4LFA F;  3WC2 A;  5BXI A;  3BH7 B;  3SQG A;  4WU3 A;  2XY5 A;  3GZ7 A;  1C0T A;  3K5L A;  2G1D A;  1VQ4 S;  4LF5 J;  1VFJ A;  4PXD A;  1X5S A;  2QMW A;  2I0X A;  4ZPV R;  5LJ3 Y;  4NA2 A;  2FIU A;  1BWE A;  4RUA A;  2B4P A;  3M32 B;  2IAJ A;  5CD4 H;  1AA1 B;  6AT1 B;  4M5G A;  2HEK A;  3PX4 A;  5A8W B;  1J2V A;  1NSQ A;  3SMZ A;  2DGV A;  3U27 A;  3LP1 B;  3Q83 A;  4NLS A;  2F4V J;  1Q79 A;  3AOA A;  1S1W B;  2GQC A;  1BGX T;  1WHV A;  4CCH A;  2B7C B;  3ZZP A;  3OFG A;  5GVQ A;  4QU6 A;  3QMQ A;  1RWV B;  2OPQ A;  4UOH A;  5IV4 A;  3OJU A;  2HHQ A;  4KQZ A;  4QYR A;  4CQ1 A;  4I67 A;  3SYZ A;  3LAN A;  4YOE A;  1RTZ A;  1ITP A;  1UVI A;  4C3L A;  4DWI A;  2DTJ A;  1HNX F;  4C6A A;  1JLF B;  3E01 A;  2MXY A;  4N8N A;  2P6S A;  3GFZ A;  2YNI A;  5HMW A;  3M8R A;  3IG1 B;  2BQU A;  1N36 F;  3UD4 P;  4NMX A;  3KYL A;  2RRB A;  3HT0 A;  3IWX A;  1NXI A;  3DRR A;  3AB4 B;  1KFS A;  2J0W A;  4NWB A;  2HZC A;  2E9R X;  2W8K A;  4E2F B;  2NR0 A;  3TP2 A;  3DLE A;  4TY8 A;  2B56 A;  2V9K A;  1YI2 S;  2GA7 A;  3HHN B;  1UEU A;  3UDC A;  4L73 A;  1NH7 A;  2HND B;  3NS7 B;  4LF7 F;  3LOU A;  3SV4 A;  3FBE A;  5JMN A;  1W7W A;  3ZTP A;  2KHD A;  1Y3K A;  2RML A;  1B0V A;  3PFE A;  2JDJ A;  5DQH A;  3ETO A;  2FLN A;  3QJL A;  2KB2 A;  5CCM A;  3V6D B;  2FD2 A;  4DHV A;  2BJ3 A;  1FTR A;  4TVA B;  5KG4 A;  2DK2 A;  4H4K C;  4WU2 A;  4LF4 F;  5FLX U;  4YHH F;  4IG0 B;  3CB4 A;  3HO1 A;  1SKS A;  4AD6 A;  5B0G A;  4RU2 A;  4LJM A;  1RAE B;  2N4C A;  4OZ5 A;  1UP1 A;  1Q7Y T;  2GIQ A;  3MEG A;  2E7X A;  4XTT A;  1M1H A;  2UVR A;  3G2X A;  4OLP A;  1N8R T;  2VG7 B;  4B17 A;  1NKB A;  1FVS A;  5D0H A;  3DRP B;  4FDF A;  1DUR A;  2XLK A;  2XB2 D;  2RUS A;  2B9E A;  2MKC A;  2C22 A;  2CQH A;  4PXC A;  3ITH A;  1SJ4 P;  3ZNJ 1;  4FYX B;  1HYS A;  4GVL A;  1KN6 A;  1S9F A;  3FCW A;  5DDP C;  1SC4 B;  3PR5 B;  1LW2 B;  4KB7 A;  3M8Q A;  4Y2I A;  2DKO B;  2FVP A;  2DRA A;  3CJK B;  1F5B A;  1HR0 F;  2Z2L A;  1S9G B;  5KG2 A;  5DLG A;  4DCJ B;  1HD1 A;  3W60 A;  1R89 A;  2MMY A;  1XIQ A;  2BE9 B;  4MFB B;  3KOA A;  2WK4 A;  2DYA A;  4ZJL A;  1T03 B;  2EKY A;  1LW0 A;  1WDD A;  3FCV A;  4LRD A;  2KFN A;  2XNQ A;  2DEI A;  1YZ7 A;  3PW4 A;  1F3F A;  1T94 A;  3O1L A;  4Q43 A;  2R7T A;  2HZA A;  3DKD A;  3ISN C;  3W2W A;  1FT8 A;  4RW4 A;  1JXV A;  2MPU A;  4DV7 J;  4ALZ A;  3QO9 A;  1JLB A;  2W9B A;  1UJ4 A;  4B3S F;  3HJF A;  4WKR A;  2V8P A;  3NWR A;  1B4S A;  3M6V A;  1S1X B;  2AGP A;  1RSC A;  4Z7Y A;  4NL5 A;  4ILM A;  1JLC A;  4CM0 A;  1FCA A;  3PRV A;  4NLQ A;  1RKJ A;  3MMJ A;  4WBF A;  1N33 F;  2VPW B;  3QGI A;  3UR3 C;  1GMU A;  2QSW A;  2UXC F;  3TZZ A;  3H59 A;  4O4R A;  3GIJ A;  2VQF F;  4DL6 A;  2BW7 A;  5KFM A;  2HWI A;  2HS0 A;  3U1N A;  4QW8 A;  3VV2 B;  2LQ8 A;  1RT4 A;  4V1A k;  4J9L A;  3MR2 A;  3ZZZ A;  1CG2 A;  1NDK A;  3K5M A;  3NBP B;  3V2U C;  2NZ4 A;  2EWH A;  2A2D A;  5LL6 d;  3R7N B;  1VQ7 S;  3O3L A;  1AW0 A;  2GMJ A;  4YY3 F;  1QAJ A;  3VVT A;  4TLR A;  1RA6 A;  4KHP J;  3MM8 A;  1SC6 A;  4MTP A;  1Q4R A;  2JFD A;  4Y00 A;  4WZM A;  2ZDP A;  5B0B A;  3PO4 A;  4YB1 P;  4O3P A;  3DXB A;  3V81 A;  1S9E A;  3C2P A;  1E6Y B;  4PG8 A;  3TZX A;  2F5G A;  3PM9 A;  2MZT A;  2V9W A;  2FJE B;  1LEO A;  2JWN A;  4WYW A;  2V67 A;  5CYM B;  2J7K A;  3DHW C;  3BPD A;  5MLC V;  4OIX A;  4RNM A;  2GQ2 A;  5EWF A;  2YKO A;  4MKA A;  1O5J A;  2W2M P;  4C8O A;  3EYZ A;  2CAD A;  2V6A A;  3G8S A;  3GJR B;  4PQU A;  4N76 A;  2HQD A;  3NCP A;  1H98 A;  2VA2 A;  3UFC X;  4F2R A;  2GJF A;  2VON A;  4PG6 A;  2JOQ A;  4N47 A;  4HT5 A;  5C24 A;  2M88 A;  1ZM3 A;  5KFS A;  3AOC A;  1VHF A;  4JI4 J;  3I32 A;  2V2V A;  1OS5 A;  1R43 A;  2GIF A;  2J9E A;  4EO6 A;  2WBM A;  3FZ2 A;  4ELT A;  2L9D A;  4EBE A;  4G65 A;  3BO2 A;  4CM2 A;  4FXV A;  4G1Q A;  4RPF A;  4TNO A;  3MMB A;  1RWW B;  2Q6B A;  2H65 B;  2CA9 A;  1RTH B;  4IRC A;  2J8S A;  3R7B B;  4ZLJ A;  3OLB A;  9RUB A;  3UDL A;  1WC3 A;  3CJT A;  1RT7 A;  1SVD A;  2XY7 A;  2R8K A;  5E3Q A;  1HMV B;  4AXI A;  2L3M A;  3M2R B;  4P7V A;  2O3D A;  4HH1 A;  3M30 B;  3M2U A;  4GVB A;  2XMK A;  1FKO A;  1M5K C;  3TVY A;  1FEH A;  4J7C A;  2LMI A;  3ENA A;  1PBA A;  1DTQ B;  3KLH B;  2BOA A;  3R2D J;  2DY9 A;  3CDE A;  4DU7 A;  4ETZ A;  1VBK A;  3KFW X;  4QWE A;  2ZNY A;  2P8I A;  1IBL F;  4ID5 B;  4LRA A;  3RB4 A;  2Q1L A;  4KHM A;  5D77 A;  4DR3 J;  3PVX A;  5F8M A;  1OQ3 A;  2QA4 G;  3JAM Y;  2VUG A;  4QBU A;  1FRJ A;  1NKC A;  5J2M B;  3RR8 A;  1R8A A;  2KVI A;  2BAN B;  1TKD A;  3PKY A;  4DV1 F;  2QLX A;  2JH3 A;  3PZP A;  3IBC B;  3QFH A;  2WZ1 A;  2GHP A;  3LWL A;  2V4J B;  5IC6 B;  3AJ2 A;  4MMO A;  3LGM A;  2JEG A;  3QIP B;  1NUE A;  4DV3 F;  5KFF A;  5CXT A;  2VC1 A;  1Q16 B;  1NBE B;  3HVR A;  5L1I A;  1DTT A;  4JI5 F;  1HI8 A;  3MR6 A;  3SQG B;  1BMQ B;  1CC8 A;  2CZ9 A;  4OV6 A;  2XY6 A;  1H38 A;  3ILJ A;  3GV5 B;  1C0T B;  5E5N A;  3HD2 A;  5D0G A;  3RW6 A;  2HLT A;  4X4U A;  1U8W A;  4USH A;  1Q81 T;  5CA5 A;  3TO8 A;  4HHH A;  4RX6 A;  2HSE B;  2N7C A;  2NYH A;  2IAJ B;  2V94 A;  2P5V A;  2PSZ A;  1LWX A;  2AGO A;  4A8W A;  4LMZ A;  4J5O A;  2E5I A;  2QFJ A;  4BBY A;  4CYU A;  4M5I A;  2CYY A;  2CG8 A;  2EBG A;  1F2H A;  2RF2 A;  3G82 A;  3I4H X;  4JI1 J;  1WWH A;  3EZU A;  4MK8 A;  1IKY A;  2K06 A;  2RDJ A;  4USK A;  2KYX A;  5ETP A;  4WK1 A;  2OPQ B;  5H9E J;  1D9A A;  1DQ9 A;  2K8G A;  4DFK A;  3TUP A;  2ILZ A;  3Q8V A;  1L3T A;  2YKN A;  1T9U A;  1K9M T;  2WB1 D;  3D5M A;  3E01 B;  2YNI B;  1PIE A;  2B3T B;  2VAS A;  5F8L A;  3T5J A;  4UZB A;  3K8V A;  1DLO A;  5ITH A;  4B3O A;  2MZ1 A;  2E5L F;  5I3Q A;  1S72 S;  3OXG A;  4ZIV A;  4NCB A;  4DBQ A;  5KG0 A;  2VFV A;  2CQP A;  3W64 A;  2F63 A;  3DRR B;  2I1R A;  1F5C A;  5KG5 A;  5AJ3 F;  8ATC B;  1XC9 A;  4GRS A;  4KR0 B;  1MMD A;  4HL9 A;  1UL3 A;  2I5J A;  4NCG A;  4I69 A;  3DLE B;  1RT3 A;  4TY8 B;  2Y1R I;  2MQQ A;  5ETV A;  4G6V B;  3DFE A;  1U1N A;  3WDO A;  1AZS A;  4DR2 F;  2B8P A;  3PRB A;  2BKP A;  3NL0 A;  2AJF E;  2IY5 B;  3D68 A;  1MSW D;  3FEY B;  2HG4 A;  1CJT A;  5DJB A;  1Q86 T;  1PJ6 A;  1P9Q C;  2KU7 A;  1EHW A;  3FBB A;  1PC4 A;  4YEA A;  2QL5 B;  1NK0 A;  2E1A A;  3LTO A;  4ZN3 A;  3D1O A;  4OJG A;  1GMW D;  2EW9 A;  4KIA A;  2OSQ A;  2GC8 A;  2KT5 A;  3S8S A;  4A8X A;  4LQ3 A;  3P4U B;  2CNK B;  3MEG B;  1NHK L;  1RHR B;  4QU7 A;  2UUB F;  4JI0 F;  4CO4 A;  4K4S A;  1X5T A;  1OY9 A;  1R27 B;  3R1H A;  3EPI A;  1LFP A;  4DI6 A;  3GCW P;  1W25 A;  3ITH B;  1JLA A;  1WDT A;  5KOX A;  1N5S A;  1HYS B;  2QA1 A;  1FD8 A;  2HFS A;  1K44 A;  4B9N A;  1S0V A;  3EVO A;  3M8Q B;  4FF1 A;  2WCX A;  1QE1 A;  4DQR A;  1YTY A;  1S1V A;  1U02 A;  2B7B B;  4WTO B;  3FK4 A;  2IRX A;  3IBF B;  5K20 B;  2AJ0 A;  1BHN A;  3LA0 A;  4HDG A;  1IR2 A;  1RIS A;  1H7W A;  1JJ2 R;  3M8P A;  1LW0 B;  1FEE A;  2RJZ A;  5EUH A;  3H4D A;  2IC3 A;  2AJQ A;  1WC4 A;  2BYC A;  3B78 A;  3VCD A;  1VLO A;  3TVZ A;  4DV6 F;  3HFK A;  2VIH A;  2LVW A;  3W2W B;  2H4W B;  3CJ4 A;  1V3R A;  4RW4 B;  1ZM4 A;  1R7I A;  2L08 A;  3QO9 B;  1KNZ A;  5C7P A;  3IR6 B;  4DR5 J;  1NDL A;  2HFN A;  2W9B B;  2HVI A;  2RIJ A;  4FPR A;  4ZP9 A;  3KHL A;  4DV0 J;  1JLC B;  2FY1 A;  2DR7 A;  1DBD A;  1EX8 A;  4JB8 B;  2F1F A;  5EWG A;  3K8W A;  5GAD I;  2C2D A;  4B9S A;  1IVZ A;  3WHI A;  3T6J A;  1BWV A;  2QRR A;  2UV8 G;  1IWG A;  2HGM A;  1RT4 B;  1OPI A;  4GC6 A;  2DPJ A;  1NME B;  4C3M A;  2YWE A;  4KFB A;  4FNH A;  2B9Y A;  3SSS A;  4F0K A;  4ECR A;  3FRY A;  3GP9 A;  3CCT A;  2BAC A;  1WOS A;  2W7P A;  3MM8 B;  3FVY A;  1YJT A;  3TUI C;  2HQF A;  2ZBR A;  1PYS B;  1X4F A;  3QPI A;  1TL3 A;  4LR9 A;  2AX0 A;  2CPZ A;  3V81 B;  1NEE A;  3HLU A;  3BQ1 A;  1S9E B;  2G0J A;  1K8A T;  1U24 A;  1CJV A;  1YK9 A;  4NXM J;  1M5H A;  2DHH A;  4BCA A;  2FZK B;  3JAM U;  2GHV C;  5DZ7 A;  3DOL A;  1X4A A;  2ZBC A;  4Y6I A;  3TUZ C;  4USW A;  3GJT B;  3W5Y A;  1S79 A;  2V8H A;  3DGV A;  3N79 A;  3BO3 A;  3Q2S C;  4OZJ A;  3M1V A;  4PQU B;  4HT7 A;  2HFV A;  3Q8P B;  5L9N A;  3THV A;  4CRJ A;  4YFU A;  3BR8 A;  1NHV A;  4MYT A;  4QYZ K;  5J2N A;  4IR1 A;  4DG1 A;  2VH7 A;  3WZ0 A;  2LP4 A;  4LFB F;  2JLF A;  3N6M A;  3TA1 A;  4I68 A;  2E66 A;  2V8V A;  1H7X A;  1RZM A;  4XIU A;  3ZZR A;  5C24 B;  2XBP A;  1KR4 A;  1FDB A;  1WI8 A;  3OPK A;  4D3H A;  3I6P A;  4FP9 A;  3HM9 A;  1PSD A;  3RTV A;  2OPP A;  1NSK L;  1VIS A;  4KGZ B;  3U7J A;  3CXC R;  4Q5V A;  4UQT A;  4P75 A;  1TVR A;  2KYZ A;  4OX8 A;  1N0U A;  4G1Q B;  2LEC A;  4Y28 C;  3BKF A;  3MMB B;  5IQ6 A;  2LA4 A;  2FDN A;  2ZH7 A;  3D9B A;  4ECY A;  4DX5 A;  2EFG A;  2O1P A;  1EAY C;  3V4I A;  4B9L A;  1Z2Z A;  5HP1 A;  2HUR A;  1RT7 B;  1WHY A;  3TI0 A;  4P2F A;  2J9C A;  1EJ7 L;  2R8I A;  4F2S A;  4GVB B;  3LO3 A;  2QSF A;  4FVM A;  1FKO B;  1WEX A;  1MN9 A;  4QR1 A;  4EO8 A;  2XHW A;  2GAG C;  1U6Z A;  1VHI A;  2HHX A;  5DDO C;  3T6B A;  2OMO A;  2Z2Y B;  2NRE A;  4ZJQ A;  1ULR A;  4AL5 A;  1GT8 A;  1RTD A;  4X4V A;  4ZOS A;  1YQH A;  4I2P A;  2UU9 F;  2MQN A;  1SV5 A;  2VQE J;  1T9Y A;  4EUV A;  5GAE U;  1TUW A;  1HKA A;  4I1T A;  1D9F A;  1HAR A;  2D1C A;  4HAC A;  2WSC C;  3QWP A;  2NXJ A;  3TEH B;  4NYZ A;  4KPY A;  4KRW A;  4KO0 A;  2RHS B;  1RYR A;  4HI1 A;  4OLO A;  2W2O P;  2XMV A;  4CNZ A;  2GHW A;  2LXU A;  2E5J A;  4R25 A;  1UTA A;  1X4B A;  3KLI A;  2UXD J;  4JI2 F;  1PJ5 A;  2HHH J;  2AU0 A;  3ZZO A;  2X1G A;  3MD1 A;  5HQL A;  4FYY B;  1LWF A;  2DXE A;  4LVN P;  3MED A;  2EK6 A;  5KFL A;  5KFR A;  1DTT B;  2HHT A;  1H2V Z;  5CQG A;  4PR6 A;  2CDQ A;  1HI0 P;  1FKA F;  2K3K A;  5BYQ A;  1JXE A;  2LQJ A;  1L3V A;  4MK9 A;  3M05 A;  4CLS A;  1RAO A;  1YIT S;  1XN9 A;  3O44 A;  3IWN C;  1TFW A;  1YG0 A;  2LDY A;  4IOB A;  5HN0 A;  3J7Y I;  2BJD A;  4NLG A;  1HIY A;  2DR6 A;  1JLG A;  1YX2 A;  2EI5 A;  1MLA A;  4X4N A;  3MM9 A;  4BWM A;  3K0J A;  2OIH A;  1FER A;  4CYU B;  2RF2 B;  3G82 B;  3TJ9 A;  5KFE A;  2NXU A;  4JYA F;  3DLG A;  1WEZ A;  1IKY B;  4WFZ A;  5A0Y A;  5AXL A;  3HKW A;  3C6T A;  3KJN B;  5C5J A;  1YZ6 A;  3GIR A;  2ADC A;  2DJW A;  2RU3 A;  4DV2 J;  3UDE A;  4ECU A;  2YQ0 A;  3MZI A;  2YKN B;  5GMK a;  4ELU A;  3KTQ A;  3B54 A;  1X60 A;  4Y65 A;  5A6W A;  5DG9 A;  4ER8 A;  1R0C B;  1TMJ A;  4ZVE A;  1U25 A;  4L3K A;  2XWY A;  2YKQ A;  3A8E A;  4X66 J;  1HI1 A;  4B3O B;  4EZ6 A;  5L39 A;  5HI7 A;  1Y4Z B;  1SH2 A;  3T5H A;  1FJE B;  4ZMM A;  1HW8 A;  1E6V A;  2MEW A;  3QGG A;  1NPK A;  2B9W A;  2UXB F;  5KFV A;  2H51 B;  1M5O C;  3UN2 A;  3TWZ A;  2ZHA A;  2I5J B;  3OR1 A;  2YH0 A;  4NCG B;  3D3C J;  1RT3 B;  4B3M J;  5DZ6 A;  2X7I A;  3THT A;  4DR7 F;  1GX6 A;  1PJ7 A;  2BV3 A;  3NGD A;  4K2X A;  2OAU A;  1YJ7 A;  3U02 A;  1GX5 A;  3Q8S B;  2IM3 A;  1TK5 A;  1CJT B;  1RTJ A;  2FJA B;  4O3S A;  4LFA J;  4W90 B;  2ZM6 F;  3EXY A;  4OI3 A;  3MAQ A;  2A10 A;  1S49 A;  3HX9 A;  4PUO A;  4OHW A;  2HK2 A;  2PC6 A;  2DEJ A;  3CE8 A;  2POK A;  2O5D A;  4J9O A;  3VAH A;  3H7H B;  1F9E B;  2YBV A;  3VAM A;  5FD1 A;  4YR3 A;  3NKY A;  4KSE B;  4F3O A;  5EGY A;  2YKP A;  3U1L A;  1NK9 A;  3TUJ C;  3OW2 R;  1RBA A;  3GCX P;  3MM7 A;  2HGL A;  3DRY A;  3L7P A;  1F3V A;  3MHY A;  3TA2 A;  1ACM B;  2IDL A;  3VAJ A;  1JLA B;  2R7W A;  2V63 A;  2V50 A;  4ZCI A;  3LAM A;  4M5J A;  3FSY A;  1S10 A;  4PYA A;  5KFJ A;  3Q8Q B;  4ZP8 A;  2V4R A;  2OTJ S;  1XNR J;  4DS5 A;  4MJK A;  1ZM9 A;  2DT9 A;  1QE1 B;  1LXJ A;  1HNX J;  2CPH A;  3TNV A;  1S1V B;  2FC8 A;  5CCL A;  3IM9 A;  3ILL A;  2WHO A;  5G0R A;  4J9N A;  4WFX A;  4IH5 A;  1ZYQ A;  5E3R A;  2HW3 A;  3TR5 A;  5KFP A;  1OO0 B;  4K4T A;  2KJV A;  1YJR A;  3CSK A;  2IC3 B;  4RKU C;  2VOP A;  4OYA A;  2DGS A;  1FD2 A;  2RIL A;  4DL4 A;  3W2V A;  1T0T V;  1KON A;  3PYE A;  3Q2T C;  1QUP A;  2Z2M A;  1Y5L B;  2JZ5 A;  1RU1 A;  2GNK A;  4OYZ A;  3ULH A;  1TAU A;  4NLP A;  1IKW A;  8RUC A;  4X64 F;  2CWX A;  4A46 A;  1KWM A;  1N6Q A;  1KD1 T;  3PYG A;  4LF7 J;  1IKX B;  5AE3 A;  3GIM A;  5KT7 A;  2AMC B;  1HBM A;  2N4D A;  2I8E A;  4B9T A;  2GW8 A;  1VK8 A;  3RBZ A;  1OSD A;  2CKW A;  4HDH A;  3FQL A;  4NYO A;  3P3D A;  4TXS A;  4RNN A;  3M8Y A;  2YKA A;  1U1R A;  1AUD A;  4LF4 J;  3NNA A;  1I6J A;  1WUU A;  1VQN S;  3H5U A;  4YHH J;  2R3V A;  1P8G A;  3VGV A;  3EZ5 A;  2JX2 A;  1IJE B;  2BR0 A;  4DFP A;  4P7T A;  4BHQ A;  1TEL A;  3R5D A;  2UVV A;  4K7Q A;  2XZT B;  2AX1 A;  5F0U A;  3HFV A;  4Q0B A;  1A6L A;  1S12 A;  4ED0 A;  2DR8 A;  2O66 A;  3T5L A;  1S6O A;  4F02 A;  2Z2Z A;  4KY3 A;  3D6H B;  3FSX A;  1DQ8 A;  1TL3 B;  1UZD A;  3AXK A;  3A3P B;  3FNN A;  2IVY A;  3OSP A;  1CJV B;  2VBY A;  5B0C A;  2PGC A;  2QLF B;  2VOD A;  2G0C A;  2ZKT A;  2RQC A;  3CW2 C;  4PXB A;  2A1B A;  5K9F A;  5BR8 F;  3DOL B;  1Q78 A;  2VG5 A;  2WVD A;  3VR1 A;  1HR0 J;  4JV1 A;  1F6T A;  3GQC A;  3DM2 A;  2Z56 B;  3KJF B;  2PE8 A;  4IUF A;  3E8O A;  3MM5 A;  4M94 A;  1JIH A;  2DNQ A;  3IRX A;  2J6U A;  3IS9 A;  2V34 A;  1NRK A;  2N7Y A;  3M1V B;  3SEO A;  1VR6 A;  1NM2 A;  3OHB A;  4RW9 A;  1J5E F;  3AT1 B;  2J6S A;  3BSA A;  4KE5 A;  2XG8 A;  1FDD A;  2OEL A;  4DUZ F;  4DPX A;  1RHU B;  4LBH A;  1VQP S;  5J2N B;  2RSQ A;  2HHP A;  4DG1 B;  2DR9 A;  3RB0 A;  1S76 D;  1P27 B;  1VYA A;  1S6P A;  1P6T A;  1HHT P;  3CTR A;  5F8N A;  3ENV A;  1WKK A;  2OPS A;  3UD5 A;  3P6Y C;  3NGU A;  5LMN F;  3UCG A;  4DSL A;  2AT1 B;  4I6A A;  2OPP B;  3TJA A;  5IT0 A;  2ZH3 A;  3OBI A;  3I5B A;  3QAT A;  1TVR B;  1MMN A;  1IXK A;  4B3S J;  4A47 A;  4U8Y A;  4USJ C;  4KH1 B;  3KLF A;  4J9U E;  3R5J B;  4RW6 A;  1DHM A;  5H1S V;  2AW0 A;  2DCL A;  3MFH A;  2E1P A;  3F41 A;  4IRK A;  2UXC J;  5HVG A;  2VQF J;  1GTE A;  3V4I B;  2A6M A;  5DDQ C;  3T1Y F;  4A4J A;  5HP1 B;  4G1P A;  4ZVS B;  3ENQ A;  3BQ2 A;  4LT6 A;  2W24 A;  1N34 F;  2COL A;  3TQ1 A;  3W1Y C;  3JSB A;  2M5Y A;  1FHT A;  5EX0 A;  2DXF A;  1TUV A;  3BF4 A;  1RTD B;  3L9Z A;  3M9M B;  3VQT A;  1FFW B;  4I2P B;  1NHU A;  4F04 B;  4YY3 J;  4UUW A;  1SV5 B;  4FYW B;  1GMW A;  4NA3 A;  1Y5I B;  1FJG F;  5A6P A;  2VBW A;  3KDO A;  4GO5 X;  4LF6 F;  4HYK A;  3BBF A;  2RQK A;  4C3K A;  2K1R A;  3LWM A;  4PWD A;  3MD3 A;  2ASD A;  2JRS A;  3KMQ A;  3SV3 A;  2Q6C A;  4KO0 B;  2OEJ A;  2VFT A;  2QMX A;  5HL7 Q;  4JI3 F;  4FS1 A;  1HFE L;  1Q1K A;  2IDE A;  4PPD A;  4EU0 A;  2RUG A;  2N82 B;  4RW8 A;  1RAD B;  5U47 A;  1UKU A;  3SXL A;  3KUH A;  4NLX A;  2FJV A;  3IGV A;  3ZZY A;  1R0A A;  1LWF B;  3MED B;  2F9D A;  4P2S A;  5IT4 A;  4DR1 J;  3LAK A;  5DGB A;  4DL2 A;  5L1K A;  3KHG A;  1FDA A;  2G9O A;  2FJB B;  1F9F A;  1U45 A;  2XMU A;  3Q89 A;  5C42 A;  3VHQ A;  1UEK A;  5JVG Q;  1HNV A;  3SSQ A;  4FBU A;  3IRW P;  1UVN A;  4PEO A;  1IJF B;  1NJX A;  2WSE C;  3PIO Q;  3PHE A;  1UJ5 A;  4P9S A;  3EUN A;  1JLG B;  2CJA A;  4RUC A;  3G6X A;  3MM9 B;  4K4X A;  2MYF A;  1U8S A;  4L74 A;  8AT1 B;  1JK9 B;  3JTN A;  3J81 j;  2GML A;  3H5X A;  3DLG B;  2YNH A;  3W8P A;  3IGN A;  1LXN A;  5A0Y B;  2XO7 A;  4A8K A;  3NNC A;  2DHS A;  3C6T B;  5IS2 A;  1D8Y A;  1DAX A;  2LCW A;  1W2B R;  3DLL Q;  5AT1 B;  2FYX A;  2R7O A;  1WF2 A;  4EK2 A;  4O44 A;  4OX9 F;  5KFD A;  3GMG A;  3M8S A;  3CC2 S;  3MCM A;  2W9A A;  2MDA A;  1XMO F;  2W2N P;  1B99 A;  1DJ0 A;  5I4M A;  2WON A;  3AD8 C;  4USV A;  1R8B A;  2QL7 B;  4A8O A;  3FC9 A;  4ZVU B;  1VQM S;  4ECS A;  1N0V C;  3ICL A;  1OQ6 A;  2GGP B;  1XBW A;  2BJE A;  3NOG A;  1ZAV A;  4ZVH A;  5H9F K;  1E6V B;  3L4B C;  3PW5 A;  3H2U B;  5CHC B;  3MCS A;  2R7X A;  3OR1 B;  4OI4 A;  5KT4 A;  2CVI A;  4BWJ A;  1FJC A;  4K5S A;  4E0D A;  4WP3 A;  1LFW A;  4LF9 F;  1NJI T;  4ECQ A;  2CUY A;  1UWB A;  2ZD1 A;  3MXH P;  3PG9 A;  2WBR A;  1KRP A;  1FRL A;  1D3W A;  2C3O A;  3F0N A;  2LFV A;  1UFK A;  1VQS A;  4DV3 J;  2LEP A;  4CH0 S;  4IH7 A;  2AKW B;  4RW7 A;  1B7F A;  3K58 A;  1RGV A;  1RTJ B;  1YKW A;  1RCX B;  4DN0 A;  4M5K A;  4IG3 A;  2OML A;  1TL7 A;  4JI5 J;  1UAW A;  4NZ0 A;  4PUO B;  3L09 A;  3EZO A;  5K8P A;  2VJV A;  4YR2 A;  3NMA A;  1SQG A;  2CG4 A;  1FA0 A;  5B0F A;  1HNI A;  1FWL A;  4CP5 A;  1JKH A;  3PV8 A;  5B0A A;  4K4U A;  2JFK A;  4ZLN A;  1EET A;  3O8W A;  1KOH A;  4K50 A;  3MM7 B;  3AY0 A;  3ISZ A;  3BZQ A;  4DMZ A;  2IA6 A;  1QTN B;  3OL9 A;  1T9W A;  3T1A A;  2IBO A;  4N56 A;  3G9C A;  4LIR A;  4OHY A;  2GFF A;  3D54 A;  4KPC A;  2DNP A;  2M9K A;  5D4O A;  1B0T A;  3PAC A;  3TYT A;  3I55 S;  2F65 A;  3RBE A;  2MSS A;  4ITS A;  1FXD A;  1KLM A;  4A8M P;  2JEI A;  3JSR A;  2LEA A;  2C2Z B;  1HL6 A;  4LSN A;  2OP5 A;  1SL1 A;  2PMW A;  5F3Z A;  5KFQ A;  2FHJ D;  4DS4 A;  4AQY J;  2D7S A;  1NJY A;  3PR4 A;  2PFF B;  3PNI A;  3ENW A;  2BAB A;  2P9E A;  5D0R A;  2V8D A;  3G6V A;  4OYM A;  4CI0 B;  1V6H A;  5G0R B;  2WVE A;  2MJU A;  3L95 X;  3GYN A;  1QD1 A;  3IR5 B;  3CED A;  4ED2 A;  3SQO P;  2E5L J;  3BGR A;  3X1L B;  3A4T A;  3BBB A;  2VBX A;  4DOZ A;  5DG7 A;  1SQF A;  3BGF A;  5GAH U;  1F2G A;  3IXQ A;  2DNH A;  3DGP A;  1FWK A;  2XI3 A;  5AJ3 J;  4NZ7 A;  4Y2K A;  3THP A;  3HMJ G;  4EBC A;  4ES2 A;  2IJF A;  3TEG A;  4L3N A;  1RKI A;  3HP6 A;  2IBK A;  1T02 A;  2BOP A;  1IKW B;  1KHW A;  5J2Q A;  3VGU A;  2HRY A;  1TP7 A;  3CIZ A;  4OYI A;  1N6Q B;  1V9O A;  2UUA F;  1BQN A;  4DR2 J;  4PG7 A;  1OJ4 A;  2KDO A;  4YB5 A;  1HBM B;  4C11 A;  5D4N A;  3W5X A;  3BN7 A;  3J7A 1;  4DR6 F;  2DIU A;  2KHC A;  4IFY A;  3FUY A;  1R6V A;  2F8H A;  3MUT P;  1KTV A;  4F67 A;  3BRE A;  1L3S A;  4H4M A;  1UMJ A;  2ACM A;  3V5R A;  3UI3 A;  4RLE A;  2UUW A;  3VVU A;  4WP8 A;  2VV5 A;  2Z0G A;  4Q0B B;  3PW0 A;  1RT5 B;  2X1A A;  2Q3P A;  1S6U A;  4ES3 A;  4DX7 A;  4CO0 A;  1WG5 A;  2PMH A;  1JX4 A;  4LFC F;  1KVJ A;  1VQ5 S;  4NLR A;  4WJB A;  3FBF A;  4X4P A;  4JI0 J;  1X9W A;  3D6M B;  2ZBQ A;  3UWT A;  3I0R A;  2ASJ A;  3RBX A;  5J1N A;  5B0D A;  1RBO B;  2DO0 A;  3ISN D;  1TKX A;  2OD6 A;  1Z2L A;  4ANC A;  4UQG A;  1Q82 T;  3AOD A;  1Q7L B;  2Y1L B;  4RNF A;  2BA9 A;  1WNE A;  4WFY A;  2VL1 A;  1Q5Y A;  2E7V A;  1UVM A;  4CLY A;  3MUM P;  2VG5 B;  3BYR A;  2CAJ A;  2I9S A;  3DM2 B;  3MM5 B;  2CQ4 A;  3W9I A;  1CJU B;  2NCK L;  3IRX B;  3LGN A;  3IWL A;  3IS9 B;  1MRO A;  1TL4 A;  1NJZ A;  4RW9 B;  4LQ9 A;  1U26 A;  2ZZM A;  1H74 A;  4F3M A;  1A9N B;  2GVD A;  1C0U A;  3UCZ P;  1S6P B;  2FUG 9;  1HQE A;  1X0F A;  3CT9 A;  2ABY A;  1AT1 B;  2QV6 A;  1X5O A;  2OPS B;  2L48 A;  4DV6 J;  5DLF A;  4OYW A;  4URS A;  1G3O A;  4TU7 A;  4K2J A;  3HZG A;  3VGT A;  1NZA A;  5CYQ A;  3H0P A;  2E1C A;  5F9L A;  3ILI A;  3UVJ B;  1S7I A;  1KFD A;  4S0M A;  1NB7 A;  4RW6 B;  1UVK A;  1S57 A;  3N9U C;  4IYQ A;  4OZL A;  1JJ4 A;  1UPP A;  1VQ6 S;  2F3J A;  3EXC X;  2E9Z A;  1MWY A;  1TUG B;  2CQ2 A;  5D6G A;  2XM3 A;  1JJH A;  3OL7 A;  5I3U A;  4DUT A;  4NEZ A;  3EDR B;  2DR5 A;  1C2P A;  1RWN B;  1M0S A;  2OD4 A;  2ZWO A;  4UST A;  4OI1 A;  4IFV A;  1HBO A;  2BE7 D;  4NA1 A;  2WW8 A;  2A2C A;  3QT8 A;  4ZLP A;  2OFH X;  4CLK A;  3MCN A;  4WWS A;  2C3U A;  2MY7 A;  2R2R A;  2FHM A;  2PMZ D;  1N5Y A;  3EIC A;  4TKT A;  2J0X A;  4XO0 A;  1YGY A;  2HZV A;  3DXS X;  3UN3 A;  4PWD B;  2DNN A;  1PYO B;  1TKZ A;  3LPY A;  3BN4 A;  4CO3 A;  4PG4 A;  4F4Y A;  1RHQ B;  2YX4 A;  1KQG B;  3KJV A;  5K5M A;  4RW8 B;  3KMS A;  1O6X A;  3AD9 C;  3NXZ A;  2J5A A;  5F8G A;  1U0H A;  1GQE A;  4Q44 A;  1R0A B;  2KM8 C;  2CPF A;  4ZPD A;  2OEM A;  1GTH A;  3GTY X;  5AXK A;  2AHO B;  4NLD A;  5HAT A;  4I0W A;  4DPU A;  3GU0 A;  3T41 A;  3MF5 A;  2QMU B;  4LFB J;  4M5D A;  2KT2 A;  4QZV B;  5C42 B;  4ETX A;  1TKT A;  1HNV B;  1IKV A;  1R31 A;  3JXO A;  2JL9 A;  3R3T A;  3R6G B;  2OPR A;  4DUY F;  4Z37 A;  1H6K X;  1C1B A;  3TZY A;  5KFY A;  1YRT A;  4FF3 A;  1CJK A;  3J80 Y;  4J9P A;  1NSP A;  2WB4 A;  5EX3 A;  1QSL A;  2CRL A;  2YNH B;  3K5N A;  2DPI A;  1N5V A;  4U7C A;  1RU2 A;  4C0H A;  2DNM A;  4FXD A;  4DL5 A;  3CWJ A;  2AP6 A;  1SBR A;  1UZH A;  3UR0 A;  1VQK S;  2CXE A;  1U09 A;  4DQI A;  1DQA A;  4O44 B;  2VHG A;  2FC9 A;  2HWT A;  2QFI A;  4B9V A;  3NS5 A;  2WON B;  2E5H A;  1NU4 A;  1K1S A;  1WD6 A;  3DDK A;  3EM1 A;  2KRB A;  2XUL A;  1WSR A;  4N77 A;  2UU9 J;  4DV5 F;  2KO1 A;  4QR0 A;  2EFO A;  3CJS A;  1RT6 A;  5DG8 A;  1FRK A;  3MAA A;  2XSJ A;  1KOO A;  3D66 A;  2YH1 A;  5KT3 A;  2IMO A;  2EKN A;  1YBT A;  2NPF A;  3V4M A;  1PO6 A;  3TZW A;  1Z4U A;  4CO1 A;  1GAO A;  1TK0 A;  1UWB B;  1UJ6 A;  2ZD1 B;  1SJF A;  3MUV P;  4DR4 F;  1RHK B;  1T9X A;  2IVF B;  4JI2 J;  4ED1 A;  2HQI A;  9ATC B;  4IKA A;  1DAR A;  4RW7 B;  4FS2 A;  3C46 A;  4FYD A;  1QAY A;  4ECT A;  4DN9 A;  2L41 A;  4IG3 B;  2RKI A;  2BXJ A;  2VDI A;  1A0O B;  4QJV A;  1ZAW A;  2PO4 A;  4C2M A;  1YIJ S;  3KG1 A;  4ED4 A;  3HSD A;  4LF2 A;  3T9N A;  2M3D A;  4F7V A;  4ICL B;  2B43 A;  1HNI B;  3O6Q A;  5GAH I;  5ETR A;  1RWO B;  1JKH B;  4JV2 A;  4LVO P;  4ED3 A;  2CQ1 A;  2QA4 S;  3X3U A;  1EET B;  4CT9 A;  4TYA A;  1CQN A;  4I6W A;  4I4B A;  1U0S A;  4DPW A;  4BC7 A;  4DJB A;  2KM8 B;  2VIC A;  4JYA J;  5HMX A;  4F50 A;  4LBP A;  2XCP A;  2F40 A;  3G96 A;  3AHP A;  4JOU A;  4OZ2 A;  1CPZ A;  2FVS A;  3QAE A;  2AEJ A;  4CWB A;  4EEY A;  5IT9 Y;  2CDR B;  1KLM B;  3R5G A;  2YWG A;  1Y9O A;  4PAB A;  2YNF A;  1OIA A;  4M95 A;  4LSN B;  1V5V A;  3A8J A;  3OVA A;  1D9D A;  1BXN A;  3H8Y A;  2CPX A;  3HF5 A;  2QEX S;  4JUZ A;  3CO9 A;  5T41 A;  4WFN Q;  2VD3 A;  1VC5 A;  1BD6 A;  1IR0 A;  1LKZ A;  3I82 A;  1S0O A;  4ZPT R;  2HNY A;  2XYP B;  4TQR A;  3KNA A;  3BGR B;  1WTF A;  4DX8 H;  3BO4 A;  2C42 A;  1O0P A;  5A8R A;  5E3P A;  3DGP B;  2F7V A;  2KH9 A;  2UXB J;  3UE2 A;  3TA0 A;  4EFA C;  3P5T L;  3LH2 S;  2BM0 A;  2GO8 A;  4RBU A;  5J2Q B;  5A2Q Y;  3UDV A;  2DO4 A;  3HHK A;  2CQG A;  5KFX A;  3ELH A;  2GS8 A;  3K5O A;  4RU9 A;  1X9M A;  3JQK A;  3HT3 A;  3CDB A;  2GMH A;  3W66 A;  1QSS A;  2J8A A;  2E5G A;  3HVT A;  2HHV A;  3J7Z T;  1PBU A;  3ZZU A;  3EGN A;  4O0I A;  2G2O A;  3HSZ A;  4P2X A;  5GAD U;  2ZM6 J;  5KFN A;  2BEF A;  4IFY B;  3W63 A;  2JNJ A;  2FZG B;  4F0H A;  4X4T A;  4DSJ A;  3P8B B;  1Q8I A;  2V2Q A;  4GKK F;  2KFZ A;  2HMI A;  2CNL B;  5B7W A;  4NZ6 A;  2B0G A;  4H4M B;  3DLH A;  3A12 A;  3QNW B;  2VA3 A;  2KZZ A;  2RRN A;  2XGQ A;  2RD5 C;  2Q43 A;  1ZPV A;  3CMA S;  5K8N A;  3NG8 A;  3DOK A;  3BEG B;  3P5B P;  3TX0 A;  2PD1 A;  2ZUA A;  3KK2 A;  3DOM A;  2VOO A;  2KXH A;  2EXU A;  4C0O C;  1JXL A;  3Q86 A;  3I0R B;  3RAX A;  4WCE Q;  1SC1 B;  4CDI A;  1KVK A;  4OMF G;  1TKX B;  2QE5 A;  2XLI A;  5IM0 A;  3CC7 S;  1HWI A;  3I4P A;  2PI4 A;  4ED7 A;  2BKN A;  1M5S A;  2CPE A;  1QM9 A;  3OFF A;  2W2Q P;  1REG X;  1YVF A;  2Z30 B;  2J0Q D;  2JVO A;  2MQL A;  2ZUG A;  2LQ5 A;  1M1G A;  2CJ9 A;  2YPY A;  2A6O A;  3HSJ A;  4LSZ B;  3BDE A;  2HFO A;  3MDF A;  2WAQ D;  3WX8 A;  2MHE A;  1JLQ A;  4OHZ A;  4RWX A;  2C1E B;  5H9E K;  1AYE A;  2KVQ E;  2J7U A;  2DB1 A;  3AH6 A;  1C0U B;  2PT0 A;  3W62 A;  3BKU A;  4ATN A;  2QLW A;  3AXM A;  3SDE A;  4K0K J;  4HVZ A;  1HQE B;  4RJV A;  2VC0 A;  2VZ9 A;  2YX7 A;  1T9V A;  5LSO A;  2R7Q A;  2ZH6 A;  2R8G A;  3EE3 A;  3MEC A;  4QWD A;  5CYQ B;  3MPU B;  4C8K A;  1WHW A;  4ZHR A;  2D74 B;  4I2Q A;  3OTC A;  4X64 J;  1WC0 A;  4FKX A;  1LWE A;  3HHL D;  1RT2 A;  2GZO A;  3J80 U;  1B3T A;  3WIV A;  2NZC A;  2GQQ A;  3KLE A;  1KVI A;  4PXE A;  3Q24 A;  3BGO P;  3I31 A;  3JQM A;  1SKR A;  4K8R A;  1SIW B;  4O3R A;  1KHV A;  1YJ9 S;  4OYO A;  5I3U B;  3QSY B;  5LSL A;  4WXW A;  3RU0 A;  1S4F A;  3NMR A;  3FRZ A;  4LBI A;  4IFV B;  2RQM A;  1HBO B;  3OL8 A;  2OGU A;  3VGS A;  1FWP A;  2RQ4 A;  3WX4 A;  1LWC A;  3QWU A;  3IAS 9;  2RHQ B;  4LRF A;  4EMD A;  3NS6 A;  3BJY A;  2C2K B;  1SB6 A;  4AXJ A;  1Z1Z A;  1S6Q A;  1U1K A;  3SSR A;  1GH8 A;  1N5Y B;  3AFG A;  3CCL S;  2DNL A;  1ZZN A;  2ZFH A;  1TKZ B;  2VFR A;  2YQ1 A;  1PKU A;  3CD6 S;  2E29 A;  2V8G A;  3CCQ S;  2HS4 A;  4KJI A;  5DO2 A;  5HSP A;  4C8M A;  4RZR A;  2JVR A;  5BR8 J;  3NOC A;  2MGZ A;  2FB0 A;  5LSR A;  2DGW A;  1HHS A;  2HLU A;  3KJV B;  4LRB A;  1LOU A;  2CQ0 A;  3KLV A;  1U0H B;  4KC5 A;  4OHV A;  2ALZ A;  1J5E J;  5HVH A;  4WTY A;  2Q66 A;  4ZIW A;  1NZ8 A;  4DUZ J;  2VQE F;  2P2C B;  2FHJ A;  3VZH A;  4WK3 A;  3KK3 A;  4AL7 A;  3KK1 A;  1VQO S;  4M5D B;  1HLW A;  1YWX A;  2CZV C;  1E6Y A;  3MM6 A;  2W4C A;  1VRU A;  1TKT B;  1RAI B;  1IKV B;  1ZA2 B;  5LMN J;  2ATC B;  3DYA A;  3HK2 A;  3CD0 A;  4KGK A;  5DM6 Q;  5IOL A;  3J7Y U;  2OPR B;  1OY6 A;  2QGF B;  1ZTT A;  3M6W A;  1C1B B;  2DY1 A;  3TAQ A;  2UXD F;  3R7S B;  1CJK B;  3NY0 A;  2C2E A;  4U96 A;  1U6B A;  1DRZ A;  1FJ7 A;  1SCJ B;  3P96 A;  2D3O R;  2D69 A;  3CDU A;  5I3P A;  3PO5 A;  1U6F A;  3AOB A;  1IBM F;  5EHH A;  2PDA A;  3QSI A;  1RWP B;  3HHD A;  4Y2M A;  1RHM B;  1H2U X;  3T1Y J;  5IT9 U;  1VQ8 S;  1KQK A;  2XMA A;  1HWU A;  4C8Y A;  2HBQ B;  2HHW A;  4G1I A;  4WFB Q;  1N34 J;  1T05 A;  1GXU A;  1K47 A;  3GII A;  1B70 B;  2AJ2 A;  2M2B A;  4MK7 A;  3BH6 B;  2XWX A;  3K17 A;  1WC6 A;  4OI0 A;  2B51 A;  2AYE A;  2LYV A;  3Q8U A;  4JP8 A;  3QT7 A;  3D6T B;  1Y5N B;  4F4X A;  2HAI A;  1FJG J;  2MTL A;  3TW0 A;  1RT6 B;  4ILR A;  4YME A;  3G8T A;  4LF6 J;  4JI8 F;  4C9D A;  3MAA B;  3RRG A;  3W9J A;  2EEY A;  2XSJ B;  5D4L A;  3MPY A;  3CJR A;  4C4W A;  2ZH1 A;  5THW A;  1SKU B;  4LR7 A;  4QWB A;  2XHC A;  2CPY A;  2IM1 A;  2MST A;  1ELO A;  2XGP A;  2NXE A;  4EZ9 A;  5E41 A;  3C15 A;  4JI3 J;  3GE9 A;  1XNQ F;  3GLJ A;  4F4W A;  2AWZ A;  2RDI A;  3IC1 A;  2XZD B;  2AJ4 A;  5EWE A;  3RRK A;  5F8I A;  4F8R A;  5IFM A;  3BKT A;  1FK9 A;  3TVK A;  2RKI B;  1N32 F;  2GCF A;  4P6Q A;  3OTE A;  4MIA A;  2NQP A;  2CJY B;  5JVH Q;  3C8Y A;  4CLF A;  1SXL A;  4P10 A;  2KFY A;  5ETT A;  4CLT A;  3RRH A;  1CS4 A;  5AXM A;  2DNY A;  4CLU A;  5E3C A;  3W3S A;  3ZTQ A;  1U1L A;  3GON A;  2KL8 A;  2QLJ B;  2VPZ B;  2RS8 A;  2WRM A;  2RS2 A;  4Z7C A;  2XNR A;  4WII A;  2OLW A;  4O0N A;  3EX7 B;  4HHJ A;  4DCO B;  4QIV A;  1JLB B;  1X4G A;  1QVF R;  1S1U A;  3FZB A;  1ZS6 A;  4E8U A;  3ZXW A;  1N4L A;  3CME S;  3RW7 A;  1H3D A;  3TAP A;  2YNF B;  2BUN A;  4RBV A;  4OX9 J;  3GV7 B;  3MMC A;  1N5Q A;  1XMO J;  3G4S S;  3GSD A;  3RB6 A;  1PAU B;  2HFU A;  1NK6 A;  3BPS P;  2IYG A;  4NLY A;  2U1A A;  1HD0 A;  1S99 A;  2ZJP Q;  3CDW A;  2HNY B;  2IVM A;  3QRQ A;  4GKJ F;  3DLK A;  2OO4 A;  1C1C A;  2J9D E;  4PYD A;  3HHE A;  1REV A;  3P45 B;  4RL1 A;  3M2V A;  1BLU A;  1XR6 A;  2AYB A;  5A8R B;  3HZE A;  1NK5 A;  3OJS A;  4K4Z A;  1N88 A;  5SUH A;  5HQM A;  3FCH A;  5IC4 B;  4R8U A;  2ASY A;  2ZJQ Q;  3RAQ A;  2GV1 A;  4OJH A;  3DHX A;  2LXF A;  1WKJ A;  2NXC A;  1CVJ A;  2NLW A;  4OYB A;  4CZC A;  4LF9 J;  1XNR F;  4DQS A;  2B5J A;  3OUY A;  1J5O A;  4ZP7 A;  1TMM A;  3L7U A;  2B9X A;  4V19 X;  3MPW A;  1IM4 A;  2G13 A;  4ZCL A;  1WG4 A;  3NEK A;  5JJB A;  3H2V E;  3BQ0 A;  5A8K A;  2W4D A;  1BQX A;  3GIL A;  3HVT B;  4FF4 A;  3CCJ S;  4ZA1 A;  3HKZ D;  5HQ8 A;  3MOJ B;  4R5P A;  1RYS A;  3VQS A;  2UUC F;  3FDS A;  2M4M A;  1GNK A;  2W9C A;  1FKP A;  3AD7 C;  2LKZ A;  2MKH A;  1FTC A;  2CNO B;  4DZ6 A;  1FO1 A;  4QIW D;  1S4E A;  5EDW A;  3JTO A;  2HMI B;  4KYZ A;  5T7L A;  3D4J A;  2P6T A;  1HW9 A;  4DXL A;  1XMQ F;  2VF3 A;  4IO1 A;  2R8J A;  2CQI A;  2UV8 A;  4UUX A;  5SZT A;  3DOK B;  1TV6 A;  3MFI A;  3KK2 B;  3DOM B;  2ACY A;  4DV4 F;  4XPC A;  1X7V A;  3DRX A;  1VS3 A;  2Z58 B;  1IM6 A;  2NSC A;  3Q8R B;  2C2N A;  1RHJ B;  2RVJ A;  4CLW A;  1LK7 A;  1IBC B;  3UNG C;  4LSL A;  1WTB A;  4YDD B;  5D0E A;  5IM0 B;  1ZAX A;  1D8Z A;  4CTA A;  3CJ0 A;  3BR9 A;  2ZJR Q;  3ET6 A;  4LRE A;  1VCT A;  4OZ3 A;  1MG7 A;  4M1K A;  4XK8 C;  1FRI A;  4DPT A;  1YSJ A;  4AYB D;  3UQS A;  2E44 A;  3M2U B;  4DLE A;  2B4O A;  5CYJ A;  2KT3 A;  1VJQ A;  1RB0 A;  1CSJ A;  1UW9 A;  4A8F A;  3MTK A;  4DFJ A;  5B08 A;  1JLQ B;  5C25 A;  3T9Z A;  4LR8 A;  4YB7 A;  3AAW B;  4KBI A;  2HBZ B;  4Z2X A;  4CIO A;  4F25 A;  3M6U A;  4W4M A;  2ZIT A;  3EMT A;  3M9O B;  3SDE B;  3OVS A;  1WJ9 A;  4UY8 5;  1Y0H A;  4I64 A;  1U48 A;  3Q22 A;  1X4H A;  4HR2 A;  1ROF A;  2I38 A;  3MEC B;  1HQ2 A;  2DIV A;  1TZ0 A;  2CQD A;  1I94 F;  4ZHR B;  2CQC A;  4I2Q B;  4L76 A;  1U4B A;  2V0N A;  1LWE B;  1WEL A;  3NGR A;  2UUA J;  4FBT A;  1RT2 B;  3PCO B;  1VQL S;  3E2E A;  4JI6 J;  3I5C A;  4UW2 A;  2DXD A;  1N52 B;  1ZOT A;  3KLE B;  3T1H J;  4NXN F;  3C6U A;  4ZCK A;  5GME A;  5JUM A;  1N48 A;  2KN4 A;  2LDI A;  3CJ3 A;  1EQM A;  2KI2 A;  4KGX B;  4DR6 J;  2H1Y A;  2XTJ P;  5HLF A;  1WKL A;  1GEH A;  2HKE A;  4QWC A;  2DH7 A;  4RUB A;  2K7K A;  3AA8 A;  1QY7 A;  2ZOM A;  4IRD A;  4L6V 3;  1VDH A;  5IZH A;  3OT9 A;  2X3G A;  1FI4 A;  3NAH A;  4U8V A;  4DPY A;  5GMD A;  2ZDO A;  4ENO A;  1LWC B;  1S5Z A;  4ZVQ B;  3R5A A;  4C98 A;  4A8S A;  4MYU A;  4LFC J;  1S6Q B;  2UZA A;  3OVB A;  2CPJ A;  3HVA A;  1Q8K A;  3HCX A;  2H5E A;  2MLY A;  2F8E X;  2AD9 A;  4M63 A;  5EN1 A;  4GO7 X;  1KC8 T;  5K14 A;  2APO A;  2YXL A;  3PFO A;  4EWT A;  1IWA A;  3R5B A;  2MGZ B;  1NSA A;  3OTD A;  2ROP A;  3D0G E;  1JLE A;  3D2W A;  4D3G A;  4IDK A;  1UFW A;  3CD7 A;  2FPH X;  2MJN A;  3D1Q A;  3D1H A;  3UNY A;  3QLH A;  2V68 A;  4YR0 A;  2BJ9 A;  2HK3 A;  2OTL S;  5IWA J;  3RB3 A;  3IBW A;  2ZC4 A;  4C8N A;  2XS5 A;  1VQ9 S;  4ZPB A;  3LGH A;  1B7Y B;  5M2U A;  2MQ8 A;  3KK3 B;  2GJ2 A;  1A7G E;  2MQM A;  3PRD A;  1YRX A;  1I3O B;  1W26 A;  4O4G A;  3KK1 B;  4NEY A;  1DLO B;  2E1R A;  1UCN A;  1F0X A;  2XC9 A;  3MM6 B;  4I7F A;  1VRU B;  1U1Q A;  4K4V A;  1XER A;  2R2S A;  5L8R C;  2HS3 A;  4DZD A;  2VKZ G;  4NLU A;  1URR A;  2FGC A;  3OTO F;  3DYA B;  2BM1 A;  4KHR A;  4ZVO B;  2WVB A;  3CCU S;  4B3T F;  2VDH A;  4QR2 A;  1QLN A;  1FRH A;  1F60 B;  3KDN A;  2EFQ A;  4AUK A;  1SI9 A;  3MPV A;  1YJW S;  1VOM A;  1RAF B;  3DNC A;  4DU8 A;  1AZS B;  4EYH B;  2W7A A;  1QDU B;  3CJQ A;  4DR1 F;  3PY8 A;  2PN6 A;  4ZKA A;  5KFU A;  1BY9 A;  1AB8 A;  2P9C A;  4ECW A;  3CO0 P;  1DY3 A;  4IQM A;  2QZ8 A;  4JV5 F;  3CF5 Q;  5FJ4 A;  2MLX A;  1GXL A;  2HVZ A;  2C2O B;  1VRT A;  1T05 B;  2LU1 A;  2BVZ A;  2Y1I A;  1I1G A;  1RI7 A;  2IYI A;  3CGI A;  5FII A;  5HJX A;  3DLB A;  4TU9 A;  5JXS A;  5GAG U;  3AJD A;  3EWG A;  5DDR C;  2GVZ A;  1R3N A;  1RDR A;  2G2Z A;  2RT3 A;  3HDS A;  3S01 A;  4P2M A;  1PCA A;  4F3Q A;  1D0E A;  3I56 S;  1TL5 A;  2PFD A;  1NPP A;  2PI5 A;  1RCO B;  4TLQ A;  2HQ3 A;  2BRK A;  2EPI A;  2AJ1 A;  4DSE A;  3N01 A;  4QW9 A;  1RE1 B;  1OPZ A;  1M90 T;  3ONQ A;  2ZH9 A;  4N7T A;  2CJQ A;  3DU6 A;  3OXL A;  2H48 B;  3ZTS A;  2ZH2 A;  1KSP A;  3W5Z A;  3GWC A;  2FGO A;  2Z57 B;  4B3R F;  3HVW A;  1BQM A;  3C15 B;  4CT8 A;  2Y8Y A;  2OUG A;  2Y8W A;  1FF2 A;  4DF4 A;  4C0B A;  4PWU A;  4R0J A;  2HNZ A;  4FN5 A;  5HK4 A;  2DVI A;  2L9N A;  4M5N A;  1K0V A;  3D3B J;  3ZFV A;  5F3T A;  3EGW B;  2EBE A;  4J37 A;  5L38 A;  5DGA A;  2AF6 A;  1FK9 B;  4RR5 A;  2XO6 A;  5HMZ A;  5KFH A;  4CH7 A;  2DHX A;  2DGT A;  2IHR 1;  2MQP A;  4M5L A;  2YWK A;  2RNE A;  3PJ9 A;  3OD2 A;  4OHX A;  4O23 A;  4KKO A;  1N36 J;  2BQR A;  3M8P B;  2KJW A;  3JS9 A;  4DQQ A;  4M5M A;  1ZTW A;  1R8C A;  1SIZ A;  2ZWP A;  3VAK A;  5E3A A;  3OR2 A;  1CS4 B;  2GIR A;  3NWG A;  1XR7 A;  1WF0 A;  2PII A;  3OFH A;  4DUY J;  3H2L A;  2Z8Q A;  2MLZ A;  2N3L A;  4HHU A;  4Q7A A;  1BC6 A;  3I9Z A;  1L5U A;  3IN5 A;  4A8Y A;  1RQ0 A;  4X65 F;  3T5K A;  4DL7 A;  1EP4 A;  2PA3 A;  2GO9 A;  3C19 A;  4MAK A;  1MU2 A;  1S1U B;  3JYT A;  4MKB A;  3R2C J;  4OJ3 A;  2M52 A;  3CJ5 A;  4B08 A;  3HHL A;  1EKS A;  3HUL A;  2Z4P A;  1NCL A;  1IUJ A;  5KT5 A;  5J1P A;  3R6L B;  3CPW R;  3MMC B;  2OH2 A;  2A18 A;  2BZ2 A;  3A8K A;  2DNG A;  3MOZ A;  3N6L A;  4PCQ A;  3UPF A;  2IJR A;  3SIP B;  4YB6 A;  2CJX B;  3TOQ A;  2WW4 A;  5ETQ A;  1S48 A;  5KG6 A;  3DLK B;  2QA2 A;  4KFB B;  4WPA A;  1KEK A;  1C1C B;  1M5V C;  4DV5 J;  1REV B;  4C7Q A;  3M2V B;  5D3G A;  4QIF A;  1X4D A;  1SJR A;  5IQQ A;  2EC0 A;  2EFV A;  3MUR P;  2KXN B;  4R8U B;  5KAK A;  4WP9 A;  3C14 A;  1CUL A;  4MKY A;  2IJN A;  4ECZ A;  3RZA A;  2HRT A;  2B5J B;  3OUY B;  4AQY F;  1J5O B;  3AJ1 A;  4C97 A;  2V2K A;  4DR4 J;  3A8I A;  2JC0 A;  5A8K B;  2PEB A;  3LF0 A;  1FX2 A;  3KJQ B;  3QT6 A;  2ZC3 A;  4ZS6 A;  3Q23 A;  2B6A A;  4CO5 A;  2D9P A;  1IQZ A;  4F4Z A;  4R5P B;  2JEJ A;  2QJ3 A;  1X9S A;  2HHS A;  1VC6 A;  2X3D A;  4C48 A;  1XQI A;  1S7H A;  4LUB A;  2W9C B;  1FKP B;  2DD8 S;  1NK4 A;  4WYL A;  4QWA A;  2WVF A;  2ZZT A;  2ZVS A;  4UF4 A;  3G87 A;  4HTI A;  2R7S A;  4UOG A;  1FXR A;  5T7L B;  1YBU A;  3PEH A;  1IBK F;  1URN A;  2P9G A;  5ETM A;  4ZCM A;  2ZEJ A;  1Q53 A;  4RUH A;  3B6B A;  2ZOF A;  3PEJ A;  3MEK A;  5HMY A;  4ZPW R;  2XLJ A;  3I9V 9;  5CH7 B;  1TV6 B;  1NLK L;  1RTI A;  5DRK A;  1WF1 A;  3OLA A;  5LMU F;  2XMT A;  4NPO A;  1YRU A;  1SJ1 A;  2DRD A;  1F5A A;  1HNZ F;  2E9T A;  2W2P P;  1NND A;  3G8Q A;  2FHO B;  1VJW A;  4ZN1 A;  3GR1 A;  3JSY A;  4BDP A;  3QID A;  4LSL B;  3QQC D;  4Y3C A;  1JB0 C;  3DDN A;  1TU0 B;  2H4Y B;  4CTA B;  1FNM A;  1ZH5 A;  1HNW F;  3R1L A;  1N33 J;  2CWK A;  2YQ3 A;  3AA9 A;  3ET6 B;  4P72 A;  4U9R A;  1AFJ A;  5KFI A;  1QTM A;  1PG5 B;  4KV8 A;  4QOT A;  4AL6 A;  1OWX A;  4J90 A;  4LF8 F;  2AEM A;  1LQ9 A;  2EC2 A;  2EVZ A;  3AQP A;  3N5B A;  1OYE A;  4L75 A;  2HVH A;  3W9H A;  4DSF A;  1Q8L A;  1XR5 A;  1H2T Z;  5C25 B;  1N5T A;  2HRU A;  4X4Q A;  4XAK A;  4NX9 A;  1MNE A;  2LA6 A;  3OL6 A;  2YWF A;  3S6E A;  5HBM A;  4EGL A;  3HJV A;  3PJX A;  2QL9 B;  2YWW A;  3PYD A;  2HPU A;  2MY8 A;  2RAQ A;  4P52 A;  4JI7 F;  2XQC A;  3KUG A;  4J91 A;  1TL1 A;  2GAH C;  2GJI A;  3QFW A;  3TJ8 A;  4ZVR B;  3M8Z A;  3GG1 A;  3K57 A;  1T3N A;  1U2F A;  4HAC B;  1JNZ B;  1JWW A;  4ZLL A;  4OL8 A;  1HBU A;  1XK8 A;  2CQB A;  4OX6 A;  2NYI A;  3R8Y A;  1SC3 B;  3IMQ J;  4UY8 T;  3GG0 A;  2DBB A;  1RWK B;  1Y11 A;  4OQJ A;  3JSM A;  4FF2 A;  3UO0 A;  3EVW A;  5LM7 E;  3C6U B;  3BDP A;  2OEK A;  2ALY B;  2ILY A;  4NCA A;  3KLI B;  4NLT A;  2IRY A;  1BUX A;  5D15 A;  5HLF B;  1AFI A;  2OKQ A;  4IOA Q;  5AXN A;  1SKW A;  3CDA A;  2VFU A;  1KKH A;  4Y2A A;  3ZZT A;  2SXL A;  4YP3 A;  2IPO B;  5ADZ A;  5J2P A;  4GKK J;  3KLG A;  2HVE A;  1U2C A;  3GJS B;  2BW2 A;  2W1B A;  1PGZ A;  4X62 F;  4ZPC A;  3NAI A;  5KFZ A;  2YKM A;  4Q8F A;  2EFN A;  4GC7 A;  1UPM B;  3ZC4 A;  5HO4 A;  2C3P A;  4YN3 B;  4H54 A;  1IKX A;  4L72 B;  4KGV B;  5CD4 A;  4F36 A;  4RWW A;  4IOC Q;  2HQC A;  2G2Y A;  4GMK A;  3N6N A;  2D3U A;  1K0T A;  2R7U A;  5K14 B;  3OV7 A;  3CIM A;  3K5P A;  4B02 A;  1HBN A;  3NNH A;  1TK8 A;  2A0F B;  2L9W A;  1JLE B;  2OHD A;  1Q5V A;  4IDK B;  2DHG A;  2OFG X;  4NOH A;  2G0I A;  3FBC A;  2J9D A;  1WOP A;  2UUT A;  1NDP A;  3QLH B;  2AYG A;  3ZO7 A;  3S7R A;  1YJU A;  3B8H A;  3V6H A;  3B82 A;  4LF5 F;  2YY3 A;  2R8H A;  5F8H A;  3GIK A;  3OXF A;  2QIF A;  1ZZF A;  4WIQ A;  1V3Z A;  3LP2 A;  3US5 A;  5ETL A;  3FMB A;  1NO8 A;  2CNN B;  4OI2 A;  3H20 A;  2QN6 B;  3VAI A;  3DN9 A;  3ZNU A;  3HHL C;  4O4G B;  1VBY A;  5DQG A;  4DSI A;  4USM A;  4OI6 A;  3HPO A;  3IM8 A;  4DDF A;  2ZOG A;  4I7F B;  5GAG I;  2QLB B;  3A1Y G;  2F4V F;  3MR5 A;  4K5R A;  1IBL J;  2ZHB A;  4N5S A;  1ZPW X;  3T19 A;  3EPG A;  1HPZ A;  4U6P A;  4OZ1 A;  1WOR A;  3L3C A;  1LK5 A;  2YWH A;  4ZDN A;  2WTF A;  5KG7 A;  2HBY B;  2FJX A;  4Q2L A;  4LF1 A;  1C4A A;  1CQM A;  3MPD A;  5K8M A;  3HI9 A;  1HWK A;  5F0W A;  4HI2 A;  4X4O A;  3KUE A;  5G4D A;  1ZET A;  3IP0 A;  3HD1 A;  1VMB A;  4DV1 J;  2J0S D;  2R4F A;  3DMJ A; 
#chains in the Genus database with same CATH homology
 2MEW A;  3R2C J;  4JV5 J;  4JI6 J;  5LM7 E;  4JYA J;  4JI4 J;  4JI3 J;  5BR8 J;  3J80 U;  1N33 J;  2UUC J;  3T1H J;  1N32 J;  3D3C J;  4B3S J;  4DR3 J;  4KHP J;  4B3M J;  3D3B J;  1IBK J;  4DR2 J;  4DR6 J;  4X62 J;  4DV7 J;  4DR5 J;  4OX9 J;  3T1Y J;  4NXM J;  5IT9 U;  4JI2 J;  5IWA J;  4LF7 J;  3JAM U;  4JI1 J;  4GKJ J;  4GKK J;  1XMO J;  2F4V J;  1J5E J;  2ZM6 J;  4DV3 J;  1XMQ J;  1HR0 J;  2UXC J;  4JI7 J;  4DV0 J;  1N34 J;  2VQF J;  4AQY J;  4DUZ J;  2MQ8 A;  4X64 J;  1N36 J;  3OTO J;  1XNR J;  2UXD J;  4KYZ A;  5LMU J;  3J81 U;  4NEZ A;  4NEY A;  2HHH J;  4LF4 J;  4DV5 J;  4JI5 J;  4YHH J;  4DV2 J;  1HNZ J;  1HNX J;  4DV4 J;  4B3T J;  4LFA J;  1IBL J;  4JI8 J;  4DR1 J;  2KVQ E;  2UUB J;  4X65 J;  1I94 J;  3W1Y C;  4LFB J;  4LFC J;  4K0K J;  4DUY J;  2E5L J;  4RJV A;  2UU9 J;  1FJG J;  2MTL A;  5LMN J;  5FLX U;  4B3R J;  4HHU A;  4LF6 J;  4PWW A;  4X66 J;  4DR7 J;  5A2Q U;  2KL8 A;  4YY3 J;  1HNW J;  4V1A k;  2UXB J;  1XNQ J;  4DV6 J;  3J7A N;  3IMQ J;  5AJ3 J;  4NXN J;  4JI0 J;  4LF9 J;  4DV1 J;  1IBM J;  4DR4 J;  2VQE J;  3R2D J;  4KY3 A;  2UUA J;  4LF8 J;  4LF5 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...