3BKFA

Zinc-bound c-terminal domain of nikr
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
83
structure length
66
Chain Sequence
GTQGFAVLSYVYEHDLSVATLHVHINHDDCLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Nickel-responsive regulator
publication title Structural Basis of the Metal Specificity for Nickel Regulatory Protein NikR.
pubmed doi rcsb
source organism Escherichia coli
total genus 15
structure length 66
sequence length 83
ec nomenclature
pdb deposition date 2007-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 3bkfA00
2BJ3A 3BKTA 2Y3YA 2NZCA 2WVDA 2WVFA 3BKFA 2FGCA 2CA9A 1Q5VA 2BJ7A 3OD2A 3LGHA 2CADA 3BKUA 2WVCA 2BJ8A 2HZAA 2PC6A 3PHTA 1Q5YA 2BJ1A 2HZVA 2WVBA 2CAJA 2BJ9A 2F1FA 3QSIA 2WVEA
chains in the Genus database with same CATH superfamily
4NMXA 2DRAA 2E5LJ 3NL0A 1C1CA 2GQCA 4PCQA 3DHWC 3S01A 4B3MF 3BM7A 1F6TA 1KC8T 3BO2A 2HKEA 4M5LA 1TKTB 3W65A 4I64A 4M8LA 2VONA 3B82A 2YKOA 4J5OA 2HFZA 1B4SA 2KO1A 2RMLA 4KB7A 3GB0A 2V67A 3OD2A 5D4NA 3JQKA 4E98A 4ATNA 1FFSB 4FVCA 5LT5A 2DNKA 2AZ1A 4YHHJ 1Y5LB 1HWIA 1KWMA 1J2VA 4C8OA 2DO4A 3HZEA 1DURA 3G82B 3VAMA 5KTQA 4NL5A 4N77A 4EO8A 2VA2A 2YNIA 2BJ3A 3HT3A 4QOTA 2OSRA 2RKIB 3GG0A 4I6WA 4ER8A 1QE1A 2G9OA 4UY8T 1EHWA 3IAM9 1S12A 3N5BA 4YR3A 2AMCB 3NNCA 4WZMA 3CJRA 3DI6A 2D3O1 5B09A 4Y34A 4DR5F 4LF9F 1YHQS 1Z4UA 5L38A 2JX2A 3C6UA 3CW2C 5KFRA 3CJSA 4C48A 2ATLA 3HVAA 1LWCA 1HA1A 3GFXA 4K4VA 1N36J 2CG8A 3EPIA 3H2VE 4W4MA 5C24A 2HNYA 3AJ2A 2LCWA 1TL1B 4NXMF 1Y10A 3C16B 5FDLB 5ETMA 4K59A 4K5SA 4OX7A 1Z2ZA 1RT6A 2JC1A 3UD5A 1TK5A 3AB4B 3TA0A 3G4SS 1Q8KA 4JP8A 2I1RA 5H9EK 4XDCA 1NEEA 2GC8A 1HHTP 4WFYA 2GMJA 2HMIA 1P9QC 1KR4A 1V3SA 1R0CB 3NWGA 4KQZA 4JUZA 1X0PA 3KHRA 2XHCA 3AH6A 1DTTA 1D9AA 3DRPA 4RNFA 3AD8C 4G6VB 2B56A 5HBMB 4LRCA 4PG4A 2V69A 3JYTB 3QGIA 2P2CB 3LGNA 2MY8A 2ACMA 2FZCB 3OXGA 2FY8A 2OELA 2OPRA 3Q83A 3M9MB 1HWKA 1Q8IA 5DQHA 3TEGA 1FVSA 1KP6A 5AE2A 1VBXA 1S6QB 2CPHA 3AAWB 3ZZPA 2FLOA 1R89A 5GADU 1X5TA 1RHJB 2EEYA 2IIHA 2MHEA 3W66A 4ZCLA 3UDLA 1N0VC 4B3SF 2DNQA 3VCDA 1FEHA 4LF1A 1NMEB 5A8WA 1N8RT 4PQUA 2E1AA 4OYMA 3SYZA 5CCMA 2LFVA 3CWJA 4D3GA 1RTJA 2B43A 4B17A 1DQ8A 4KHRA 1IBMF 2EFGA 5C25B 5D0RA 3CDUA 3EXCX 3M2VA 2F8EX 1UKUA 2H3EB 3DU6A 3TUJC 2C2ZB 1OIAA 4PUOB 2FC8A 2QL5B 3V81A 2DNHA 1MN7A 4MFBB 3R5JB 4NX9A 4DL6A 2JNJA 3MPYA 2LXFA 1SKSA 2RSQA 5KOWA 1QAYA 1YWXA 4KKOA 3ET6B 4CCHA 4X4PA 3B4MA 3HHLA 2PFDA 1NPPA 1SXLA 2CJKA 3OQ2A 3M32B 2JDJA 1J27A 5B7WA 3PACA 2PC6A 1T9UA 2QYCA 3DLEA 1JK9B 1VC0A 1XMQJ 2CXEA 4KGMA 4CP5A 2X1GA 2DY9A 2DR5A 4ZLPA 1N54B 3I0SB 5F8GA 1TFWA 1PSDA 1X4CA 1G1XA 4O4GA 4J9OA 3R7SB 2ZM6F 4WXWA 4LJMA 1UVNA 3QBCA 2EFNA 1D1UA 3AD9C 4OZJA 4UQGA 4NLWA 5HP1B 3K89A 1KQSR 1AFJA 4H4MB 2B6AB 3EVWA 3S6EA 3AOCA 1QTMA 2VASA 1UVLA 3QRPA 3KMSA 2OAUA 5I42B 4UUWA 3LWLA 3C2PA 2D3ZA 1RWUA 1QUVA 1KONA 3DOKA 3P45B 4Q7AA 3H5UA 3W7BA 4NCGA 1DLOB 3NLCA 5HJXA 2HFOA 3GFHA 3PR5B 3TUIC 4J90A 1IKWB 1UFKA 2MQNA 4ED8A 2JL9A 5J2NB 3N0VA 5MLCV 2CJAA 1AROP 4RL1A 2IM0A 3M8PB 5E7OB 3E3XA 3QT8A 4NRTA 1MU2A 3I87A 3ZZTA 4M5IA 4ICLA 2A2CA 1NJYA 4FVMA 3OTCA 2Z56B 1AA1B 2XC9A 3G8TA 3QT6A 2KJVA 3BKFA 1I51B 3WBZA 3PRVA 1SC4B 3HVTB 3BQ0A 4DUZJ 5KFQA 2CPZA 4ZVSB 1WTBA 2V8PA 1S0VA 5J2MB 2ZVSA 2BBEA 1LQ9A 4QIFA 3D6MB 5G0RB 3TEHB 5K14A 4ZVUB 6AT1B 2UVVA 1PC5A 1HQEB 1TK0A 2OMOA 2HGLA 2LP4A 4ED5A 3KJVB 1N88A 1G3OA 1FXDA 3KYLA 2Y9HA 1O51A 2VPWB 4DL5A 2N3LA 2NLWA 3O44A 5HLFB 4XTTA 5IWAJ 2AJ4A 1VGYA 2NPIA 2YNFB 3OTOJ 4LF5F 2OPSA 2VFTA 3ZNJ1 3A1YG 4ZVRB 5CA5A 5D0GA 2YKNB 1T9XA 2GHWA 1NB2A 1JLQB 4OL8A 4F4ZA 1IBLF 3NOCA 2W9BA 1ZS6A 1WC5A 4ITSA 2VD3A 2O66A 2H5EA 2IRXA 3NRBA 2CJQA 2HFUA 1IKXB 3HM9A 4ILMA 3GYGA 2XB2D 1WI6A 3BSNA 1HNZJ 2VC1A 1FD8A 2P6SA 2XZDB 3HP6A 2LVWA 1LNQA 3IO1A 1SUQA 1RTDA 1HYSA 1D09B 1HBNB 1PCAA 2D3UA 2LYVA 3TAMA 1RWXB 4AXJA 3L4BC 2XMMA 2EBGA 2M4MA 1NH8A 3FRYA 3LF0A 5LJ5Y 3DOMA 3LP0B 2N82B 1ULRA 1S59A 2XLIA 2RU9A 2CQ3A 4EWTA 3R1HA 1HR0J 1EJ7L 3D66A 3IG1A 2ZE2A 2CJXB 1SC3B 2GA7A 2HZAA 2IC3B 4QW9A 2YY3A 3G86A 2PI5A 3LPEA 3UCZP 4F7VA 1N33F 3MM8A 5IC4B 3QIDA 5CYJA 1SKRA 1IR1A 3AHPA 4WBFA 3OUYB 4P10A 2BKNA 1N5VA 2VQFJ 2FVCA 2R3VA 4ZP6A 2XZTB 5JJBA 5GAHI 1KFSA 3O8WA 1QSYA 3G6XA 2HEKA 2VBWA 4WFBQ 4DDFA 4YEAA 2CQHA 4RW6B 2DK2A 1KQGB 4ZK7M 4I69A 5AJ3J 2GGPB 1JLBA 1HPZB 2XMAA 4CWBA 1QTNB 3LPYA 1FJGF 5KFSA 4A48A 1T9VA 4FXWA 4X4RA 3PYGA 3VAGA 4NZ6A 4YB7A 4EU0A 5IC6B 3F0NA 2VG6A 1HWLA 3U1LA 1KSPA 1R8CA 1V3ZA 1FE0A 4K8RA 4QIEA 3CCSS 4TY8B 4WP9A 5HMWA 5K8NA 1S99A 3OFFA 1J5EJ 3WZ0A 4DX5A 1G4CA 2XULA 1KLMB 4N7TA 4TU7A 3FMWA 5A8RB 4ZJOA 2IM2A 4B3TF 1HW8A 4X4TA 1DRZA 4J7CA 4P6QA 1I6JA 2B5JA 4KV8A 4NXNF 2CQGA 1P8GA 4YUDA 2RU3A 2HS4A 2QSWA 3GMGA 1JLAA 2P9GA 1RT1A 2L3MA 3KJQB 1D8ZA 1OYEA 1VQYA 3QWUA 4KGXB 2KI2A 3SQGA 3QRQA 1S9GB 3NGKA 1BQNB 1DTQB 1W2IA 2A10A 2CDQA 3SMZA 3UPFA 1VR6A 4IKAA 3OV7A 3KK1A 1Y0HA 4MK8A 4DR7F 3C19A 2KG1A 1VIOA 3OVAA 4NZ0A 2EBEA 5JXSA 2V2VA 1U49A 1RCOB 1KBRA 3D6HB 3K5OA 3PJXA 3A8IA 1N32J 2B8QA 1QSLA 2J8SA 4URQU 3ZFVA 2W4DA 3NAHA 1FI4A 4IOBA 1I94J 3CJ3A 5BR8F 2K2PA 1RTIA 2XMWA 1RAJA 5DETA 3BH7B 1AW0A 3I5BA 4N47A 2VU5A 1F60B 2PMZD 1RU1A 4CTAA 2DTJA 1WEYA 3QQCD 2VFSA 2FHJD 4L76A 3G6YA 4DV7J 1Y4ZB 4IH5A 3OT9A 1XNRF 2MKIA 1H73A 2W01A 4TN2A 3TUPA 3QGPA 3LWMA 2OP5A 2D1CA 1Y3JA 4C0HA 3LA0A 2M2BA 1B99A 1K1QA 2AYMA 2V9WA 5CD4H 2QC3A 2IAJB 5EGYA 1WG4A 4DL7A 2GVDB 3UR0A 4O44B 3NS6A 3PV8A 2H1YA 4KE5A 2W7PA 5DG7A 4RW7A 1VRQC 2QN6B 4OJHA 2W1BA 1X4FA 3PW2A 1YX2A 2K7JA 3G82A 2JC0A 2IYGA 2QE5A 4C0OC 5J2PA 2FJVA 1U6ZA 2UUAJ 4YOEA 3L3CA 1TR0A 4DQQA 4B3OB 5KG3A 2H65B 5K5MA 3NNAA 1U09A 3RU0A 1CJVA 4Q43A 2JRSA 2WRMA 2HHTA 1H72C 2OLWA 4F2SA 1XMOJ 2IFXA 3VGSA 4FKXA 2AF6A 3BQ2A 3QO9A 4OLPA 1N48A 2I6WA 2KRBA 4CDIA 4EK2A 2IA6A 4KJIA 3VF0B 2RVJA 1FRLA 1B0VA 5DQGA 1Y11A 4PAAA 2NR0A 2C3OA 4AL6A 2VL1A 2C2DA 4K4SA 2XHWA 4B9LA 4Y6IA 4E8UA 1K47A 4KAIA 1HNVA 5KFLA 4DFKA 2DCLA 4OYAA 4X4QA 4FYVB 4QW8A 1YRTA 2ADBA 3PTWA 3EDQB 4KSEB 1TL1A 3C16A 5FDLA 3H2LA 3P3DA 2JVRA 3HULA 3MTKA 2R2UA 2R2SA 1I5OB 3CUNA 2DT9A 3DXSX 2Z2YB 1TKXB 2HBZB 1LWFA 1RKIA 2MTLA 3P6YC 2VB6A 1CPZA 5BYSA 6FD1A 3UVJB 4O3OA 4NA1A 4DZ6A 3W2WA 3V6DB 1KTQA 1S79A 1WI8A 4NOHA 4ZCMA 1HI8A 4DV2J 3PYEA 2BKOA 4DSJA 1RTHB 1VHFA 4I6YA 1DARA 2YBVA 5HBMA 1T05B 3DNCA 4NYPA 1S48A 1YJTA 4DPXA 4ZA1A 1OPZA 5K8MA 5B08A 2XGPA 4ID5B 3M6XA 3IM8A 3T3FA 4C8NA 2OH2A 3MPUB 3MR7A 4J9UE 1SKWA 2CRLA 5FIIA 2WSEC 1CJKB 3D1QA 2WB1D 2R8IA 3TZYA 1LK7A 3MDFA 1XN9A 1R6VA 2L41A 2YX7A 1AFIA 1IQZA 1RAOA 1UEUA 1S6QA 1V9OA 5F9LA 2IY5B 1Z2LA 3DKDA 3D1OA 3QLHB 3DGVA 2XBPA 3DLHA 1S6UA 4U8VA 1RWNB 1FDAA 1TUGB 5KFFA 2F9DA 1NK6A 3N6MA 5CYQB 1RWOB 1U4BA 2PEHA 1XC9A 4JV1A 3CD7A 4ZLJA 2WW8A 2IMWP 2DR9A 5KG5A 3THTA 1WSRA 2YWKA 1LXNA 4EYIB 1DHMA 4WWSA 1QD1A 1BE4A 1JLEB 1EP4B 5C25A 3L9ZA 3R27A 4M5DB 2DYAA 1FERA 2B9YA 1BWVA 5E33A 5F9NA 3H2UB 4PRFA 1JLGA 1TL7B 2Q66A 1T3NA 4P74A 4MFBA 2RRBA 1MMDA 3LW5C 4XPEA 4K5RA 5IOLA 4CLWA 4LUBA 2VFUA 3ET6A 3TJ9A 2VJUA 4F0KA 3CDBA 4ETZA 2HLUA 4M5MA 5JVGQ 2B4UA 4BCAA 2AEMA 4DSIA 4ZPVR 1X4GA 3X1LB 3F41A 1FKOA 3AODA 1WF0A 3CCLS 4DS5A 4GKJF 3Q89A 5G4DA 3DDIA 4N76A 1GTHA 1VQ7S 4B02A 1HFEL 1SV5A 2IBOA 4WXOA 1K0TA 3UQSA 2YH0A 2E1CA 2AJFE 2QX0A 4QYZK 4CO2A 4ZPDA 2PE8A 3AJ1A 1YTYA 2ZHBA 1Y00A 5FJ4A 4DR2J 1VK8A 1UMJA 1RKJA 4NRUA 5DDQC 4CO0A 5KT4A 4QQBA 5CD4A 3A3PB 1FO1A 4G3IA 2F5GA 1JIHA 2ZITA 1XEZA 3CCWA 2DXEA 4LF5J 4OHYA 3OFGA 1KFDA 2XCAA 4J9RA 4H4MA 2XCPA 5A6PA 2C28A 1TL3A 1HL6A 3BS9A 1VI7A 5I42A 1MNEA 2K1RB 4UZCA 1TMJA 4WFNQ 2Q79A 3LAKA 2DPJA 4IYQA 3QAUA 2KHDA 2ABYA 2BACA 4DLEA 3IWXA 5KFIA 5E5NA 4LVOP 1YJRA 2C2MB 3LGHA 2OIHA 1HBMB 2IM1A 3CCJS 1QM9A 4LIWA 2V0NA 1AYEA 1RU2A 4W90B 1IKWA 5KG1A 1H74A 4F4AA 1JWWA 2F63A 2WCXA 2MJNA 4DR4J 3HJVA 1LV5A 1S0OA 4XO0A 1RT7A 5CABA 1U47A 1TAUA 2IJFA 3ZC4A 3SZ2A 5J1EB 4HVZA 1GXLA 3UDCA 1VRTB 1Q7LB 4F4XA 3RAXA 4PXDA 2QLWA 2KB2A 1Y7PA 3HVTA 4CM2A 3KLIA 2E66A 5GAGU 3RBDA 1PILA 5GAEU 1R8AA 5J2MA 3PX6A 2PMHA 3SSRA 3CB4A 2HVZA 2BEFA 5G0RA 4ZLLA 1A7GE 1VBYA 3MCMA 1HQEA 2AYEA 3FFIB 3VAJA 2QFIA 2RH3A 2Z2LA 4TQRA 3PW0A 2WVEA 4P71A 2O5DA 1IKVA 2B4PA 4ECQA 4RR5A 1NUEA 3W1YC 2V8HA 4ELTA 2GO8A 1QAJA 2ZOFA 4NA3A 2YNFA 3POTB 3W3SA 2J7UA 1KEKA 1U0HA 3CF5Q 3M8QB 4X4SA 4JI1J 5AXMA 4TU9A 2W8LA 4DF8A 2R7TA 4DV4J 3E8OA 4OZ0A 1FK9A 2YWHA 4PQAA 4QIGA 4YFUA 1JLQA 3ZZZA 4I2PB 3WC0A 2C2KB 3QAEA 4ZS6A 4ECXA 2RDJA 2QFJA 4ECYA 3Q8VA 1IKXA 3Q8QB 4IG3B 3D6FB 3M2RA 2CJBA 3MFHA 2UXBF 4OX9J 3MAHA 4W92B 2Z2MA 3DFEA 3FC9A 2OEMA 1V3RA 4A4JA 4H4KC 1M5SA 2G1HA 3CCRS 1XBWA 1NHVA 1R8PA 4KHPJ 1IBKJ 1HBNA 2UUCJ 2DNPA 4JOUA 3KLFB 3MECA 4CT9A 5IM0A 2HAFA 1S1TB 4FDFA 1WDTA 3T1YF 4J9PA 3LP0A 3LH2S 3U1MA 3MPDA 2A0FB 4OZ3A 2VV5A 4HR2A 5C2GA 1ZZNA 1VFJA 3CNQP 2HVDA 4NEYA 3FZ2A 2JH3A 3IXQA 2GIFA 2WZ1A 3DCAA 3F56A 1G2EA 2ZFHA 1JXVA 2PO4A 2ZH5A 3WHIA 3G6VA 5F3ZA 2ASDA 3FEXB 4DV1F 3NMAA 1C4CA 2HHUA 3RUBL 2J9DA 3IP0A 2Q3PA 3DGPB 2OPPA 3D9BA 4UOCA 5C7PA 1U2FA 1T8EA 2J0SD 2ASLA 3LP1B 5B0EA 1UFWA 2UUTA 1KNZA 4EUVA 1IVZA 3HCXA 4OZ5A 1OQ6A 5BYQA 2B0GA 4FXVA 2ZJRQ 3M6VA 1WG1A 4RW6A 1T94A 4CLUA 2AIRB 2NUUG 3VAFA 2GGPA 4LF4J 4F8RA 4J9VA 4O23A 4I7FB 2YNGB 2CPEA 4LBPA 3C15B 3KLEA 3HVWA 3FUYA 4X66J 3HKWA 1FJ7A 4TYBA 2U1AA 1ZETA 3BO3A 4M5JA 4KGKA 1WC0A 3T5LA 1WSVA 5DG8A 3EDRB 1HNWF 2XYHB 1RAAB 1SL0A 2I38A 3EE3A 2Y8YA 1JJCB 5C2CA 4LF7F 2Y0SD 2WVDA 4TY8A 3ETMA 3RJMB 1X31C 2YWGA 4ZVTB 4GKKF 3GJRB 1YITS 2J9EA 2K3IA 4QYRA 4QBUA 1B0PA 4C98A 2JSXA 2QT7A 1EARA 4PPDA 2VKRA 1KLMA 2Y1RI 3W60A 1UVJA 1UWBA 1RDRA 2M5YA 1N52B 1JB0C 4DR1J 1BD6A 1NZAA 1TELA 2JEJA 1KVJA 4ENOA 3H59A 3RW6A 2E5IA 3QJLA 1UPPA 3G71S 3PW5A 1KOHA 2ALZA 2ILZA 3H4DA 2D9OA 1JQGA 2FJDB 4X4OA 4GVBA 3T9NA 1VC6A 4OX8A 2D74B 3GJQB 4TNOA 5IT4A 1A6LA 2MGZA 4XDDA 4QIWD 1RLDA 1U1NA 2CPXA 4BS2A 2ZNYA 3D5MA 3DRYA 3T5JA 2C2EA 4DS4A 3VALA 3PW4A 3EICA 3GILA 4F3QA 4RUCA 1U8WA 3D67A 4FF4A 2RHSB 2I0XA 3IR7B 4C8MA 2WBRA 2DHGA 3AT1B 3VZIA 2CPJA 3VR1A 3W2VB 3GJTB 4DR3J 4C11B 4ZVPB 1WTFA 4USJC 1M1HA 1X4BA 3OW2R 1U2CA 1Q16B 5BJRA 1ZM4A 1EKRA 1VC5A 2JFDA 4O4RA 1OO0B 2MZ1A 4PG7A 4HL9A 1X9SA 1J5OB 2PSZA 3IM9A 1S0MA 1R3NA 2LKZA 1NCLA 3GWCA 4KT0C 4LFAJ 4RNHA 4IDKA 2CA9A 2J7WA 2IAJA 1KHVA 3BPSP 2AQ4A 3G87A 4J9LA 1GT8A 3FDSA 1B3TA 1RA6A 2E5LF 2V34A 1HWJA 2RIJA 2NSCA 4IRDA 4ZN3A 2F4VF 3TANA 2M70A 2MKCA 2BKPA 3J7YI 3NGUA 4ILRA 1TK8A 3HXMA 2HWIA 2FVPA 1SI9A 2MZJA 4ZPTR 2VA3A 5IV3A 1NH7A 1X8DA 3TAPA 2BE7D 1GX5A 4B3OA 2E7XA 4YHHF 3K5MA 2L9NA 1UJ5A 3CSKA 3DRSA 3J7A1 3CJ5A 2HFNA 4ZLNA 3CULA 1LW0A 3SV3A 2W2PP 3H98A 1YJ9S 2OKQA 4UOGA 2BX6A 3HLUA 1WKJA 1Q5YA 4LSLB 5LSRA 1FRMA 3K8WA 2Z2ZA 5D0HA 4OI4A 5AE3A 1UZHA 2HW3A 4WCEQ 4PXEA 5C5JA 4RZRA 3VWSA 2ZOGA 1MSWD 4PZVA 4L75A 1OWXA 5EX0A 3JQMA 2C1EB 3FGVA 2EW9A 1IM4A 2OD4A 1WC6A 3R5CA 4E0DA 2VG5B 4F0MA 1TQLA 3KK3B 2HWHA 1TKXA 3MM6B 2A1BA 4DUYJ 1JJ4A 1N36F 1K73T 3ZTOA 2POKA 4DV3J 1YZ6A 3UVJA 3JSMB 3CJQA 1LKZA 2HQIA 5K20B 1SQEA 2ACYA 1PYTA 3QMQA 4FNHA 2WAQD 5LMUF 1NDKA 1GTEA 1RWVB 2DNRA 3G96A 1RTHA 5KFXA 2F8MA 1KOOA 5GADI 4J9NA 3BN4A 1N34J 3KXDA 2VOOA 2M7SA 2FVQA 4ID5A 1VJWA 1XR7A 3RRKA 3SV4A 4B9TA 3BDPA 3KWMA 1YJWS 1YSJA 4HACB 2XMKA 2Y1LB 1R0BG 4HH1A 2F8HA 5ETVA 1OPIA 4A8YA 2H4YB 3NGRA 4MJKA 2QZ8A 1U1QA 4P7VA 4L3KA 3KLHB 3RBZA 2XEXA 4F25A 3GIJA 1T0TV 3DLGA 3HD2A 4DOZA 4GC7A 2DITA 3UWTA 4KTQA 5KFTA 4ES3A 2DY1A 2V68A 5ADZA 2ALYB 3IBCB 2HHHJ 1RBOB 3CMQA 4TQSA 1N6QB 4O3PA 1IWAA 2BANB 3B4DA 3NOGA 5D4OA 4ZIWA 1S4EA 2GVZB 4X64J 1GAOA 4QU6A 1FX4A 1S1VA 3M05A 1Q53A 2GMHA 4UQTA 2VG7B 4P72A 3RG6A 3M8YA 4OZLA 2Y1IA 3P8BB 3A3OB 1OJ4A 4ERDA 4WF9Q 1XTZA 3OR1B 1SJFA 2ASJA 3GSDA 1FRJA 3PRDA 1VOMA 3SCKE 3DDKA 1R7IA 1XNQJ 4RWWA 2MSTA 2P5VA 7FD1A 3CCQS 3TJAA 3GQCA 3B6BA 1XMQF 2OSQA 4R5PB 3SCLE 1HHSA 1WC1A 2M8HA 4A46A 1VQLS 2CPYA 4DU7A 4N8OA 4K4UA 1PAUB 4AT1B 3GR0A 4L74A 1MWZA 4UZBA 3BYPA 1X5PA 3BGOP 2XI3A 3CPWR 2R7SA 3G6ES 5KFOA 2V8VA 3CJTA 2ZC4A 1TL4A 1BXNA 2DNLA 3CJKA 3RBXA 3FKBA 2JLEA 3OJSA 5HN0A 4NLRA 5HMZA 4JI4J 2DEIA 3EGNA 1UL3A 3RRGA 3TP2A 4WP3A 3M8SA 5HMYA 3QNWB 4ZVOB 2GW8A 4L72B 3DLLQ 2DNMA 2FZGB 2BJ1A 2PDAA 4AL7A 2X3GA 4DQPA 5J1EA 2AJ1A 5I3PA 4ZPBA 3HJFA 1S7HA 4OYPA 3BR9A 1FRXA 3KDNA 5LXYA 2OFGX 4MT1A 1FX2A 3DLKB 1OY8A 4E2FB 2AYGA 3QT5A 3TWZA 4DSEA 4DCOB 4PXCA 4DSFA 1VBKA 1KRPA 3BH6B 4JI7J 2AYBA 3GV5B 4DX8H 4EO6A 1DJ0A 3VVUA 2ZH2A 3FFIA 1NSPA 2GO9A 3CGIA 3PEJA 1NHKL 1ZBTA 4DUZF 1VQ8S 1R6YA 1A9NB 1E6VB 3I9ZA 1WNEA 5A0YB 2K06A 4ED2A 3TA2A 1R8BA 3POTA 3RGIA 2KL8A 3FBEA 3A12A 4ECRA 1QAXA 4LFCJ 1U1LA 3GV8B 2WSFC 3IR5B 1VQ4S 3LUYA 4C8YA 1TUVA 1GMWA 2ZWOA 4WK1A 2ZH1A 1PIEA 2FYXA 5IWAF 5BXIA 2YKAA 4C8KA 4DR6J 3TAQA 2KKHA 3H5XA 3M9OB 1CQNA 3R7BB 1BQMB 3O1LA 2F65A 4JI6J 2ILYA 5CXTA 1N4LA 3J80Y 2OPQA 1XWLA 1HIYA 3JS9A 3OVSA 1C1BB 1Q5VA 1U6BA 4UF4A 4BC7A 1JJHA 1OYDA 3R9LA 3WDOA 5T7LB 2EK1A 2ZUGA 3R5GA 2EG1A 2VQEJ 3RB4A 1NB7A 2PI4A 1TFYA 1IJEB 3TI0A 1ZH5A 4RNNA 3EXYA 3RB0A 4EBCA 4LRFA 8RUCA 1S1TA 5KFZA 4F50A 1HNZF 3M7VA 4ZN1A 2Q6BA 2PA8D 1QUPA 5IZHA 3IMQJ 1RCXB 4X62F 4HYKA 5DO2A 4NLXA 3WX8A 1T03B 5B0CA 4GO5X 4KPYA 3WQPA 5AT1B 2V4RA 1HQUB 4G1QB 1H7XA 3T9ZA 4O3QA 3KMQA 2R2TA 2G0JA 4CZCA 2DNGA 2M0GB 4PABA 2ZH9A 3AD7C 1HR0F 2KZZA 3Q0AA 2VDIA 1L3VA 1REVA 1MG7A 4U7UD 1RA7A 2OMLA 2E44A 2BJ9A 2AWZA 2HGMA 4JV0A 3CE8A 3UR3C 4ECWA 4CLPA 2VOPA 1UA0A 2DNYA 3L7OA 5DS7A 5A6WA 2G0CA 3LP1A 3R97A 1ZZFA 4TY9A 3W63A 2HBRB 2X51A 3RAMA 4UUXA 1NK5A 2NXEA 1WOPA 1VRUA 3MAQA 2CQ1A 1VQ9S 2E9RX 2DR6A 2VQFF 4USHA 2EPIA 4DFJA 4F0HA 3D0HE 2E5HA 2QA2A 2DR8A 4I7FA 4NCAA 2YXLA 2ZHAA 3CIZA 5DDPC 4OJ1A 4CLTA 4CT8A 5I3QA 4JI8J 3LAMA 3IS9A 5ETRA 4HHUA 5AXNA 5H9FJ 3PHTA 4KR0B 5CHCB 3MOJB 2MZRA 4KYZA 2QYGA 5AJ3F 4CO3A 2ERRA 4DX7A 4AL5A 1S97A 3PNIA 2LMIA 1HBUB 2MY7A 3DLJA 1HI1A 3U02A 5A8KB 3HD1A 4YS2A 3IAS9 1U2RA 4BBYA 4LF6J 1UVKA 4NWBA 1NHUA 2VODA 4FN5A 4ED1A 4ZCIA 5EHHA 5ITHA 2HPUA 4P52A 2EFVA 1P27B 3BGLA 1T95A 2F4VJ 2KXHA 4MIBA 3FK4A 1SPBP 3FZBA 3IN5A 2CQBA 4HTIA 2B3TB 1VLYA 1Y5IB 2AEFA 2QSFA 4F3MA 1J5EF 2FGCA 4HHJA 4DF4A 3UDVA 2C3UA 1E6YA 4DMZA 5T41A 2V4JA 1U25A 4K4ZA 4CI0B 2FJWA 4OYWA 4NLPA 4Y2AA 3BZQA 5T14A 2KJWA 2YQ0A 2I2YA 2RAQA 1P6TA 3UDEA 4FNIA 1LEOA 2E7VA 3J80U 2P9CA 2PFFB 3EZUA 3ILLA 2LEAA 3FMBA 4UT4A 5L1KA 4DFMA 4QZVB 3V2UC 2XYGB 3HI9A 1N56A 1P1LA 4PR6A 2BOAA 3PW7A 3KHGA 1IR0A 2KYXA 4YB5A 3MEGA 3QWPA 1RT4B 1NK4A 3W2VA 2AJ0A 2ZBPA 2KXNB 4C11A 3J7YU 1HNIB 4USVA 2PMWA 4A8KA 5CQGA 2WW4A 4Q0BB 3KNAA 4ED7A 1N32F 4ECVA 1YG0A 3SBMA 1I94F 3OL6A 4C0BA 2J0XA 3ZTRA 2VC0A 3OSPA 3R7NB 5E3PA 2R7XA 5L1LA 3BREA 5EN1A 4C4WA 2NCKL 2CQPA 4I6AA 5KFBA 3FQLA 4P2MA 4IRKA 4DV7F 3T41A 1PJ6A 4IFYB 1PYSB 2RS2A 4A8XA 5LMNJ 3K0JA 1F0XA 1RT3B 2W7OA 5LMUJ 3CCMS 1S1WA 4RKUC 2UXDJ 4R0EA 4CNYA 3FEZA 1U1RA 4B9SA 2N3OA 4EEYA 2C42A 4N5SA 3HHLD 2IRUA 1S1XA 3OPKA 4ANCA 2YNHA 2GV1A 2HRTA 8ATCB 2FZKB 4J37A 2B7BB 1WHXA 3D3BJ 3FBBA 2HHPA 4IQXA 1PGZA 1DBDA 5EWEA 1PJ7A 3HZGA 3FNNA 2VFVA 2HYIB 1M5KC 2VKZG 3LGMA 3VAKA 4RO0A 1BGXT 4LQ3A 2XSJA 5F0UA 1VCTA 2UUAF 1G7CB 2CJ9A 2DCUB 2BXJA 2VUGA 3MM5B 4LSLA 3VQTA 2VHGA 3BO4A 4FS2A 2EWHA 2VPYB 3R6LB 3UD4P 4DL0C 1XMOF 1XR6A 3TX8A 4U7UK 1YIJS 1L3UA 5KFGA 5HROA 1C0UA 5D0EA 2D3OR 3SSSA 4LR7A 3BB5A 1ZPVA 3U7JA 2XWXA 5KFKA 3OSNA 5A2QU 5MAOA 3K8VA 4CO5A 2UXCJ 4FXDA 3KK2B 1NJZA 1JXLA 2HNYB 4K7QA 1M5OC 5KFHA 2VG5A 5RUBA 3HDSA 2GFFA 3EJMA 3M8WA 3W5ZA 1RT6B 4Q8FA 5ETKA 4EZ6A 2MPUA 2VJVA 3HHLC 4DQSA 4ZHRA 2COLA 4WJBA 1L3SA 2HFSA 2HMIB 4AQYF 4CRJA 2IBKA 3TZZA 2CNKB 3FCVA 5C42B 1RT2B 3RYLA 3C3LA 1V5IB 1DTTB 3FSXA 1YKWA 2FLNA 2YQ1A 2DNNA 4GO7X 4DV0J 1ZTWA 2VBYA 3G2XA 3K7RA 4C6AA 5D3GA 5IQ6A 1EQMA 4DV2F 3A3NB 3H8YA 2UUWA 3KNGA 4Y2CA 3I0RA 4NLYA 2YKPA 2EK6A 2A6OA 1VYAA 2Y1JA 2DGUA 2WK4A 3KLHA 4WU3A 3KLVA 3L7PA 4CNZA 2H4WB 5CYMB 4C9DA 1IWGA 1WHYA 1S6OA 2WHOA 4YP3A 5A8WB 2HQCA 3HKZD 2N7CA 4OZ2A 4B3RJ 4WK3A 1RTJB 2DD8S 1FKAF 5KFYA 3BQ1A 4NLOA 4QR1A 2JWNA 2BANA 3KG1A 3BGRA 2J0QD 3ZO7A 1YVFA 3M2VB 3K59A 2YKMA 5HVFA 1TZ0A 7FDRA 3IR6B 2Z57B 2VG7A 2FJXA 1D9DA 2W24A 3ULHA 3S1TA 3BSOA 5HVGA 2HQ3A 2B9XA 3BPDA 4LT6A 4KKOB 2KRRA 2WTFA 3TNVA 1WF1A 2BW7A 3PHEA 3DLEB 2GQQA 2AX1A 4ELUA 5SUHA 2HK3A 4LBHA 2UU9J 2NXCA 2E9TA 2QMUB 4TVAB 1RT5B 3C6TA 2DH9A 2DR7A 3QT7A 3GJSB 3D0IE 2R7WA 2XZWA 5HK4A 3ISND 3SDEB 2BMBA 2FHKA 3MF5A 5KFPA 3IWLA 4OMFG 4PPZA 1OQ3A 2XLJA 3CMAS 5F8JA 4FYYB 1G6BA 2RS8A 3BBBA 2N7YA 5KFEA 1VJQA 3NP5A 1KQFB 5KT3A 3BGFA 3KHHA 1L3TA 4AD6A 3BN7A 2J6UA 1AZSB 1Y5NB 4DR2F 3T5KA 5D4LA 4WU2A 3MURP 4IR1A 4C8ZA 2N4CA 3AB2B 5ETPA 1QAIA 2VZ9A 4CO4A 4FBUA 3CCES 4KHMA 3RR8A 4EBEA 4NCGB 1TVRB 2J7KA 5GAGI 2YWEA 3IBWA 3NMRA 5GAEI 3ENAA 3IRXA 4LR9A 3S8SA 3V4IA 1B0TA 2HAIA 3I96A 1KVIA 1P9YA 1BWEA 1ZAVA 5DGBA 2DRDA 1T9WA 2ROEA 2R2RA 4LIRA 3P96A 3OL7A 1WC4A 2DXFA 3D28A 1U1KA 2BQ3A 1V6HA 2EXUA 5D15A 1AUDA 4DR4F 4R25A 4ECTA 2VBZA 1ZOTA 4ZDNA 1T9YA 4NLDA 3KLGA 2D41A 3M30A 2J9DE 1ZAWA 5M2RA 4X62J 1W7WA 3Q23A 2NPFA 4X84A 3W62A 3R3TA 3N28A 4USKA 1KKHA 2VDHA 2ZH6A 3P5BP 5L9NA 4RWXA 1NK7A 4JI0F 2E9ZA 3BBFA 2NXUA 2AW0A 2HHQA 1YI2S 1LK5A 1ZPWX 3R5DA 3PR4A 2IDLA 5A0YA 2KXFA 1MROA 1T11A 2RF2A 5KFNA 1Q7YT 3EGWB 5HQ8A 2J76E 2DGTA 5ETLA 3AQOA 4EZ9A 4M5KA 2GHPA 3CT9A 5HL7Q 3V6JA 3GZ7A 5CCLA 4Z37A 2LA6A 2CQIA 2BRLA 2NSBA 2W2QP 5LSLA 2NXJA 4L73A 4OHXA 3QATA 4JI1F 5IV4A 1YBUA 2DGVA 5JVHQ 2ZH3A 3C14B 1B7YB 3N01A 4PYAA 4DV4F 2FGOA 1NKEA 2P6TA 1FRHA 1IQTA 5E0OA 1C1BA 3JTOA 3EGZA 3T1HJ 3NBPB 1R8HA 2ZDPA 2F9JA 5T7LA 3QIPB 4ZITA 2CQ0A 3UNGC 3DMJB 5KG6A 4DPOA 2CQ2A 3JSBA 1H2VZ 5H1SV 1MMNA 3ZZ0A 4PWWA 5L1IA 3OVBA 5ETOA 4V19J 2HNDB 1SUQB 2WVCA 3AA9A 3GSIA 2NYIA 2F4FA 2R8JA 4O0IA 4OX9F 8AT1B 3VGVA 1H0HB 1WHWA 9RUBA 4PG5A 4U95A 2OUGA 3MWBA 3DOMB 1BLUA 4KHPF 2ZJQQ 1IBKF 4GC6A 2A6MA 2UUCF 2AU0A 1UVMA 4L3NA 1HARA 2HZVA 3HFZB 2CAJA 4OYXA 1EX8A 4F2RA 1FDNA 2ZE2B 3HPOA 3I31A 1V5VA 3QYYA 3RB3A 2F7VA 1RI7A 1SJ4P 3LP2A 3OLBA 2N4DA 1SH0A 2M8DB 5B0BA 2DHXA 4ZKAA 3R2CJ 2AHOB 3EMTA 4NLTA 1EETA 5EUHA 3VGUA 2XG8A 3UE2A 3I5CA 3PYFA 1NO8A 1SC1B 1WF2A 4OI2A 2G13A 1VQPS 4DPTA 2M9KA 4WZQA 2DBBA 4KRWA 2VF3A 4ZP7A 3GU0A 5D4PA 1HW9A 4DSLA 1PG5B 3HX9A 4QPTA 4AYBD 3NY0A 5KFCA 1U45A 1RTZA 3AJDA 1JLBB 2G0IA 3P5TL 4YN3B 3CJ8A 1HBOA 2O67A 1RAIB 4ECSA 3DM2A 2WONA 3V6KA 4EGLA 3MCSA 1K8AT 2YPZA 4LF4F 1EZZB 3GPAA 5KOXA 2MDAA 2JFKA 4DX6A 5A8KA 2VG6B 3R6GB 2UZAA 2LQ5A 5DDRC 4X66F 4QWDA 2J8AA 3MM9B 3TQ1A 1S10A 2CWXA 1JXEA 3ILJA 1FXLA 1W2BR 1S4FA 4F36A 1UW9A 5EWFA 4K4WA 1RLCL 4O0NA 1F5BA 4LRAA 1TKTA 4JI2J 5KFJA 2HSEB 2Q43A 3G8SA 4IH7A 2CZVC 3CD0A 2I8EA 1GK8A 5KFMA 1CEZA 2B5JB 4KV8B 3DC2A 3K58A 1FE4A 2K7KA 4IO1A 3TYTA 3GIMA 1DFDA 4ETXA 1W25A 1RT1B 1GFWB 3SQGB 4DBQA 4DR1F 3K57A 2BW2A 1GXUA 3PDNA 4Z2XA 2I5JB 2GS8A 3ETOA 3KK1B 1T3OA 3OXFA 4NLSA 5E2QA 2B8PA 3MEDB 2R8HA 1HKAA 1WG5A 4U96A 2JVOA 1NKBA 1M1KT 4IH6A 2RKIA 1LWEB 1GQEA 2O01C 2W2OP 3MCOA 3O3LA 5HI7A 2PA3A 1YK9A 4ANEA 2V50A 1RT4A 3E01B 2FIUA 2BM0A 2G2YA 1HNIA 3VHQA 2K8GA 4Q0BA 2V9KA 2U2FA 1LW2B 1TP7A 4CTAB 3CCZA 3IA0A 4NASA 1NSKL 4LF8J 2MQMA 3M6WA 3NCQA 1WC3A 1Y3KA 1S57A 4I2QB 2V94A 2GHVC 4DR3F 5GMEA 3MXHP 2NS1B 4K0KJ 2C2RA 2GNKA 2LQ8A 3UN5A 3OTEA 4IFYA 2Q1LA 3J7Z5 2IVMA 3DOLB 2DGOA 3KUGA 3TR5A 4B9NA 5IT9Y 2F3JA 3E2EA 2CZ4A 1RT3A 2EFOA 4AUKA 3NCPA 3ICLA 4I1TA 1N5YB 4MKYA 3PVXA 3TRGA 4AQYJ 2JOQA 1TL5A 4LFAF 2XSFA 3HSZA 3MR2A 2MZQA 4RW7B 4WYLA 2RJZA 2YPYA 2AJ2A 1R27B 3H5YA 5E3CA 1F5AA 4R8UB 3MZIA 4NI2B 2XYPB 5J2PB 1IKYB 2QLFB 1SL1A 1XK8A 1RZMA 2ZBCA 4WYWA 2C22A 2EG2A 1FNXH 1PJ5A 1YBAA 3ISZA 1HD0A 1R43A 4USTA 4OHWA 1WJ9A 3OHAA 4YY3J 1CJVB 4USIA 1WACA 2CNNB 1K0VA 4ID8A 3JYTA 1CS4B 1H3DA 1U26A 4IQMA 4FF3A 1X4AA 2R4FA 3QO9B 3MM5A 4M1KA 2B51A 2LEBA 2MZTA 3H4BA 1VK3A 2G2OA 3UD3P 3ENVA 5K8PA 4MYTA 4MAKA 4DHVA 2HNZB 3KKFA 2KFYA 3CD6S 4P75A 1ACMB 3CTRA 1HNVB 2Z0GA 2H51B 2O1PA 3EYZA 4A8WA 2MQPA 1QJHA 4C97A 4RU9A 2E7WA 1FHTA 4IOAQ 3CC7S 4IR9A 3KK2A 3OTDA 2BJEA 4TXSA 4DU8A 4M94A 1DQ9A 3DRXA 3NS7B 3KFWX 4DV6J 1RAHB 1IJFB 1LWFB 2RDDA 3SCIE 3MR5A 4O3RA 2H5IB 4PUOA 1X4HA 1Q8BA 1CLFA 2G1DA 4LSNB 1RAGB 2EKNA 4NPOA 3CCUS 3W2WB 4G65A 3TOQA 2QTWA 5C42A 1RT2A 3SIPB 1FKPB 4DUYF 3U27A 1ZM9A 2BV3A 4CM0A 1FT8A 2JEFA 1HI0P 3W5YA 3Q8YA 2CQCA 4DV3F 3UN2A 1FNMA 2RE1A 3TVYA 2DVIA 3GYXB 4FBTA 3M32A 1WOSA 5CZVA 1S0NA 3ENWA 4QCLA 2FDNA 1N34F 3TVZA 3GE9A 4JI5J 1YGYA 2IHR1 2JLFA 1PC4A 5EDWA 1NM2A 2DIVA 1U8SA 1YZ7A 5CYMA 4USWA 4ZVEA 3OLAA 2IYIA 4GRSA 2WOMB 4DL2A 4HTJA 4WKRA 4Q44A 3I0SA 4S0MA 4YDDB 1ZAXA 2XO7A 3X3UA 5AXKA 1CG2A 1NJWA 3J81Y 2VPXB 4GVLA 3N6LA 1NK0A 4WPAA 4B9MA 4IRCA 2NUHA 2OTJS 5IT9U 4H54A 1NK8A 4DG1B 4DPUA 5IT0A 1CBKA 4QWAA 5HP1A 3P49B 3FSYA 2L08A 3MPVA 3SFGA 1Q0NA 2B6AA 2V2QA 1U7LA 2HURA 3UNYA 2HHHF 1JLGB 5GMKa 3MEKA 1RXOB 1R0AB 4ECUA 4ZJQA 1SB6A 4R0JA 3B8HA 4PKDB 2BZ2A 1DLOA 2QL7B 4X64F 1WEZA 3ONQA 3I9V9 2MLXA 4YQWA 2DH8A 4DL4A 4AE5A 3T6BA 5J2NA 1FKOB 3CJ0A 1L5UA 2HHVA 3GIIA 3BGUA 3M8PA 1T9TA 2RDIA 4LRDA 5F41A 2IJNA 4JYAJ 1RBLA 1RT5A 2P9EA 3PG9A 3T1AA 1RAEB 2APOA 1LXJA 3OHBA 3MD1A 4WIQA 1NDPA 9ATCB 2HG4A 4NA2A 2GZOA 4OI0A 4X4VA 1SV5B 4JI0J 2VH7A 1HD1A 3SDEA 4M95A 3NGSA 3DU5A 5HATA 4JV5J 2MQQA 1TMMA 1OS5A 4U6PA 2UV8A 1XNQF 1S6PB 3DYAB 2BQRA 2KVIA 2W9AA 4JI3J 2A3JA 4U9RA 1SJRA 1X5SA 2CIMA 2V2ZA 5D77A 1U1MA 2C3YA 4U7CA 3W9HA 1AZSA 4ZIVA 4FS1A 3KJVA 3K2YA 7AT1B 4NLGA 4NLQA 3HSGA 4X65J 2ZBIA 4N41A 3GP9A 4CLFA 1TL3B 2LU2A 5HLFA 3J7ZT 2XY6A 2W25A 3M2UB 2DPIA 1U1OA 2OTLS 1TVRA 2GJFA 2YKNA 1NSAA 3W5XA 1RWPB 2E1MC 5GMDA 2EFPA 3CCTA 1S9FA 1FCAA 1O5JA 3V4MA 4DQIA 3CDAA 2ZH7A 2FLPA 1YRUA 4JI4F 1F3VA 3DLBA 1NJIT 4Q2LA 3ZTSA 2C3PA 2IJRA 5HANA 1RT7B 2KFNA 2UUBJ 1BQXA 4A47A 1UAWA 3T19A 3OFHA 2EFQA 4ANDA 2PIIA 3MM7B 1RISA 4BWMA 3ZZYA 2ZH8A 3KLIB 2QLJB 3IC1A 3VTIA 5H9EJ 1IN0A 5I3UB 3HSJA 1X9WA 1RP5A 2YX4A 5L1JA 4EYHB 3CO9A 1HHQA 4OFZA 2KU7A 4PEOA 2X1AA 1S76D 3WX4A 3E51A 1SJ1A 2CDRB 4X4NA 3J81U 1JJ2R 1ZM2A 3MMCB 3AXKA 2W4PA 4NE9C 4V19X 1EAYC 4LF2A 2D9PA 1OMSA 1GNKA 1IKVB 1FRIA 5L46A 5DRKA 2HIYA 4JB8B 2H54B 2FJAB 4ALZA 4JI7F 2XMJA 3IGNA 4ED0A 1S72S 3MMBB 2IC3A 2XO6A 3LANA 1U0HB 2FVRA 3O2IA 2C2OB 1HLWA 4ED6A 2YQ3A 1RYRA 4LR8A 4RW9B 4QWEA 1FK9B 3IGVA 1FFGB 3LOUA 2B9EA 4MKBA 3VV2B 3OUYA 3W9IA 4EFAC 4B08A 4MKVA 3UW1A 4LFCF 3W8PA 2X1FA 3C14A 3H42A 4WP8A 1NZ8A 5B0AA 5EWGA 4DJBA 2B4VA 2BABA 1X0FA 3M2RB 4M5HA 3NBPA 2Y8WA 3FCWA 2H5JB 3P4UB 2W2NP 2YWFA 3QIPA 1VQNS 4DR6F 2WVFA 1C4AA 3DMJA 3DRRB 1Q82T 1UPMB 1VQSA 3L7UA 2MMYA 1HPZA 2EKYA 4JI6F 2HNDA 2W9CB 4IO9Q 3OXLA 1KDNA 1UW4A 3I4PA 2R9LA 3MECB 5IM0B 3ADAC 4P9SA 3R1LA 3MMJA 5D8HB 3CVKA 1F2HA 2ROPA 2VQEF 4OHVA 3MAAB 2V8DA 3CC4S 2CG4A 4OJ3A 3S7RA 3BKTA 1TKZB 4CIOA 2IVYA 2CVIA 2AT1B 3PIOQ 2B9WA 4QIVA 3FQKA 1APSA 2DGXA 2R8KA 3QPIA 4A8SA 5A8RA 3W9JA 1UEVA 2BE9B 3EGVA 5CH7B 3RR7A 1KS2A 2AD9A 4M5NA 4USMA 1OY6A 1FF2A 2AZ3A 1ITPA 2QG9B 5JMNA 2HHSA 2LLZA 2OPPB 3ZXWA 3TA1A 4ZPCA 4RUBA 3C66A 1S9GA 4K4TA 1RHQB 3MHYA 1QVFR 1BQNA 3V5RA 1DTQA 2QGFB 1GX6A 2DHAA 3H0PA 1HNXJ 1M5VC 2QEXS 2CPDA 3PKMA 3IWNC 3Q8SB 2NQPA 3Q24A 4LRBA 4TLRA 1N5SA 2BJ8A 5DLFA 1WOOA 4OZNA 4QJVA 3KLEB 2FJEB 2J5AA 2C2NA 4Y65A 4MIAA 5D6GA 2R7UA 3BBCA 5KFDA 3I32A 4B3MJ 1JLFB 5DLGA 2RQKA 4LVNP 3HHNB 5LM7E 2G4BA 2WVBA 4JI8F 3MM9A 2CJYB 4M63A 2CWKA 4Q45A 4A8QA 2XMVA 4ES1A 1F9HA 3BV8A 3NG8A 2DGQA 1UWBB 2ZD1B 4QWBA 2CVEA 3GTYX 3D6TB 2V5HG 1KN6A 4I4BA 3JXOA 4LF6F 2C3MA 3MGJA 2YVSA 2GVDA 1YQHA 3RTVA 5ETNA 3U1NA 2XMTA 2OGUA 4O44A 2DO0A 4MK7A 2XWYA 1JLCB 4ZVQB 1H2UX 4MKAA 5E41A 2GMLA 2L48A 2DHHA 1IXKA 3N9UC 4DCPB 3FVYA 2I5JA 4GVBB 1JNRB 2FC9A 3NXZA 1M90T 1EIYB 2MGZB 4FYXB 3MEDA 3I4HX 3UFCX 4F4KA 4C8LA 4WE1B 2QA4G 3M8RA 2AEJA 2FD2A 4TLQA 1Q95G 1LWEA 2R42A 4A8FA 4OLOA 4OYZA 1RHMB 4CLSA 3M8ZA 4D3HA 4DR5J 4LF9J 3ZNUA 3E01A 1KD1T 1VLOA 4KY3A 4ZVGA 1QDUB 1TUWA 3QJJA 2DGWA 1LW2A 4F3OA 2E1PA 1AUSL 3KG0A 2UV8G 2HRUA 4HI1A 3HK2A 3CEDA 1F2GA 1Q1KA 4OQJA 3K5LA 5E3RA 1FDDA 4I2QA 4PG6A 4NXMJ 1NU4A 4DUTA 2HBYB 1YJ7A 5KT7A 2FJBB 4HDHA 1RAFB 4F67A 1Y9OA 1QVGR 1RWWB 2L9DA 4IDKB 3DOLA 5AE1A 2RRNA 1QLNA 1LFPA 4A8MP 2ZZNA 2XY7A 4KPCA 2QLBB 3GFZA 2QL9B 1QSSA 1SQFA 1N5YA 1X4EA 2F1FA 5B0FA 1WHVA 1NDLA 2SXLA 1DAXA 2BM1A 2W4CA 3VQSA 3UN3A 2XY5A 2CNOB 4NEZA 3NS5A 2CPIA 3KDOA 2UVUA 5LMNF 2QO3A 4R8UA 2HS3A 4YB6A 4NI2A 5F8NA 2NZ4A 3V6DA 2XNRA 1SBRA 1CSJA 1IKYA 3D7SB 3ZTPA 2FHMA 1KLNA 4JV2A 2UXDF 3N79A 2R8GA 2GJIA 3TQEA 1K9MT 4IFVB 2IA0A 1T05A 3DRSB 2MKHA 3GIKA 1T02A 1PBAA 1CS4A 3MUMP 1RE1B 1LW0B 4CH1A 4LFBF 2M52A 1CJKA 1H98A 4MK9A 4B3SJ 1VQKS 3AXMA 2EC0A 4UOHA 3PXGa 3TVKA 3I6PA 2LXUA 4F04B 2HNZA 1VISA 1B7FA 2QMXA 2DKOB 3CC2S 3QLHA 1O8BA 1IBMJ 4CLLA 2DEJA 1CJUB 1RQ0A 5CYQA 2MQ8A 1FVQA 3OR2B 1VHIA 2PN6A 2HFVA 3A8JA 2FHJA 5KAKA 2V4QA 1U24A 3EZOA 5LSOA 1GMUA 3EPGA 2H48B 4Q8EA 3J7AN 3H90A 1GEHA 3HSDA 1H7WA 4DN9A 1JLEA 4G1IA 4WFZA 1D8YA 4I68A 1EP4A 2B4OA 4M5DA 2UXCF 4XK8C 1S9EB 1WWHA 3CIMA 3C46A 4Y2IA 4LSNA 3GONA 4OIXA 1TL7A 1NKCA 5LXRA 3GYNA 1MN9A 5ETSA 1FKPA 3W61A 4L6V3 1KQKA 2R7OA 2GCFA 1RHKB 2LDYA 5F0WA 1WELA 2HQDA 2RRAA 2HHWA 2DNOA 3F44A 5L39A 1HQ2A 2JEGA 5KFWA 1NJXA 5SZTA 1XERA 4IG0B 2XM3A 2QA1A 2FY1A 1YRXA 3CDEA 5LJ3Y 2WSCC 1CQMA 1NBEB 1SIWB 3PJWA 4DV0F 2ZM6J 4HDGA 2WOMA 3CXCR 1O0PA 3G9CA 3RAQA 3DLGB 3EUNA 3MUTP 4K2JA 2GIQA 5L8RC 1NPRA 4HHHA 1ZTTA 1URRA 2JEIA 2QRRA 4U67Q 1S49A 1O6XA 2V8GA 4AFFA 2OFHX 2OEJA 3B78A 5GVQA 4OYBA 3PRBA 3UCGA 4DG1A 3B54A 2CKWA 1VQ6S 2AGQA 4UW2A 3PO4A 1GH8A 2YKQA 2R7VA 4B3RF 2G2ZA 1X60A 3AOAA 1GMWD 3V6HA 1S1VB 2K1RA 3QGHA 5K9FA 1R0AA 1TKDA 5M2PA 4BC9A 4KH0B 3DHXA 1RUSA 4IUFA 4ZP8A 5H9FK 2OD6A 4CQ1A 3MTJA 1OY9A 3D1HA 1HBMA 5I4MA 3Q8PB 1F1BB 4ZJLA 4J91A 2VBXA 3MOZA 2KHCA 2QIFA 2J0WA 2MZSA 5B0DA 3D54A 4RPFA 4V1Ak 2ASYA 5FD1A 3MMAB 1I3OB 1M1GA 4C3MA 2MQOA 1S1UB 1UETA 3D3CJ 3TX0A 3QGGA 1YJVA 2ZBRA 1VRTA 2JLGA 3A13A 4DV5F 4CYUB 2ZWPA 3MI7X 1U48A 3CD5A 4HT5A 3RW7A 1UWAA 2GJ2A 2A2DA 3I55S 4AXIA 2AGOA 1RYSA 2UU9F 3PZPA 1S6PA 3DYAA 5KFVA 3PIPQ 2FPHX 3D0GE 2RD5C 3ITHB 5K8OA 2XS2A 3Q2SC 4Z7CA 4PXBA 1DQAA 1C0TB 5ETTA 4GMKA 4FYWB 5HAOA 5E3AA 4RUAA 5F8HA 1LOUA 3GV7B 3GIRA 2MXYA 2JZ5A 1H6KX 2UP1A 3RRHA 2OEKA 1TV6B 3PCOB 1SH3A 2BJDA 3RZAA 2HRYA 3ZZUA 3FEYB 2XMUA 2E5JA 1FXRA 3CJKB 4RX6A 3H7HB 3H20A 1BY9A 4NZ7A 1IBLJ 1U6FA 3M8QA 3ILIA 3M2UA 3CO0P 2HK2A 4EMDA 2OHDA 5DM7Q 4KFBB 2Q6CA 2BYCA 2PT0A 2HVEA 4TU8A 4G1PA 3FJ2A 4RW8B 3QFWA 5CZXA 4I2PA 4K2XA 1CJTB 5AXLA 2LEPA 3OL8A 1FA0A 4LQ9A 3K17A 3R5BA 2LQBA 3ILOA 3O5TB 4IG3A 3M1VB 3Q8UA 3TZWA 4HT7A 4DXLA 3MM7A 3BKUA 5THWA 1SC6A 2CUYA 2LA4A 5I3UA 4OI6A 1CVJA 4OV6A 3KLFA 1B64A 1NK9A 2MKKA 4TKTA 3OBIA 3MMCA 2RQ4A 3H25A 2BE2B 3MEEB 5HQMA 1LWXA 5IXUA 3KTQA 1N33J 3JTPA 3EX7B 1UJ6A 3HT0A 3CJ2A 2CQDA 4HEA9 3GCXP 3MMBA 1PKUA 4K4YA 3PO5A 4NLUA 3L09A 3EM1A 3A8EA 5DM6Q 1M5HA 4RW9A 3UO0A 3OTBA 5KG7A 5FLXY 4RW4B 3EVMA 5KT6A 1RWKB 1IBCB 4XAKA 3DGPA 5KG2A 2VIHA 4Q2MA 1FJCA 4KO0B 1R31A 4LSZB 2RQCA 1BUXA 2V2KA 4H4OB 5KFUA 2R7RA 1VS3A 1PO6A 2KYZA 2RILA 2OPQB 2CZ9A 1FJGJ 2RUSA 3DRRA 2DHSA 1WKKA 1CULB 3FBFA 4USUA 2DNZA 2W9CA 2YNGA 3C15A 3TUZC 5HSPA 4O3SA 4HKQA 4Q5VA 2AP6A 2RQMA 2HVHA 3T1HF 3DXBA 4BDPA 3LTOA 2F40A 2AGPA 3RB6A 2ZNZA 1SQGA 4H4KA 2VICA 5GAHU 4HH0A 2KH9A 1Q4RA 2GAGC 3R2DJ 3MAAA 3KUHA 3WIUA 5DJBA 5U47A 5DG9A 3H5SA 1AXQA 4B3TJ 4QPXA 3NGTA 4PG8A 1TKZA 2MQLA 1JKHB 4OZ1A 2ZZMA 5HJYA 4FYDA 2IM3A 4NXNJ 2DIUA 2EI5A 1F9EB 1X9MA 2KN4A 4K4XA 1VQ5S 2RNEA 1FEEA 1TTHB 4PWDB 1K1SA 1L3KA 2LDIA 1REVB 3PX4A 4QYZJ 1Q81T 2MKSA 4DR7J 3PEHA 4RU2A 1SL2A 2HS0A 3T5HA 1UCNA 1U02A 2ZEJA 2LQJA 1XMBA 2LECA 4X4UA 3ZTQA 1EQ0A 1XR5A 2OI2A 4DSKA 5BR8J 3UI3A 1VRUB 3O6QA 4ECZA 4DFPA 3C8YA 1N5TA 1YJNS 3NEKA 3WC2A 3KJNB 1Q78A 5CAAA 2OJ3A 2RHQB 1X7VA 3CMES 3IS9B 5KFAA 4DWIA 1XNRJ 1BMQB 5J2QB 3GLJA 4KGZB 2ZKTA 2KDOA 3WIVA 1JLFA 1UEKA 3T6JA 2HHXA 4W98A 1ZYQA 2ROGA 4OV1A 3N6NA 1S77D 1RBAA 3IFEA 2IMOA 2BVZA 2NREA 1NPKA 1HMVB 2O3DA 1J5OA 4P73A 3N4WA 1C1CB 3HO1A 2ZD1A 1FWLA 1XQIA 4A8OA 2QV6A 4CH0S 4KH1B 3AQPA 1C2PA 3KHLA 2CYYA 1SVDA 4KC5A 1JX4A 1JLCA 5FLXU 3J81j 3VAIA 3NCRA 2DH7A 4JI2F 1RGVA 1VQMS 1E6YB 2V4JB 3N5FA 2AJQA 2FTRA 3M6UA 4UTGA 3QSIA 4RLEA 1IM6A 4NCBA 1H2TZ 2XLKA 4ZP9A 4WE1A 2XS7A 1XIQA 2W8KA 4WTYA 2QLXA 3MR3A 3KJFB 2I9SA 3BR8A 4LFBJ 2YNIB 3BDEA 4I0WA 1N0UA 3SSQA 1HWUA 1Z1ZA 1B70B 2XS5A 2ZKUA 5DZ7A 1MWYA 1QE1B 4WKYA 2Z4PA 3MEGB 4XPCA 3TJ8A 3THPA 2MJUA 4KIAA 4ZMMA 3L95X 1KTVA 2IRYA 3NNHA 3DI6B 2BR0A 1LFWA 3C6UB 4DLGA 3GCWP 2FLLA 3JAMY 2Z30B 2D69A 1LWCB 4BLGA 3SQOP 2YH1A 2FB0A 4LF8F 3KOAA 2IPOB 2AKWB 2YX1A 1S7IA 2MSSA 5C24B 3K5NA 1SKUB 1MW7A 2CFXA 3KK3A 2LU1A 1KHWA 3MM6A 4P2FA 1DY3A 1S1WB 2ZOMA 4K0KF 1Q79A 1D0EA 2KT3A 2FHOB 4OYOA 3JSMA 4OHZA 2EVZA 4QR2A 1S1XB 5E3QA 2Z58B 1BHNA 4J9QA 4NYOA 4NMLA 4IFVA 5HMXA 2YNHB 2MEWA 5KT2A 1RADB 3SEOA 3MCNA 3TW0A 1RWMB 4WTOB 1KVKA 3DRPB 2E29A 2CNLB 2DRBA 3FBCA 4QR0A 1U0SA 1YJUA 4HACA 4MYUA 4Y0FA 2XSJB 4FF1A 1UJ4A 2XI2A 4K50A 1SH2A 1VDHA 3GFYA 3I5AA 3Q22A 4B9VA 4YMEA 3MUVP 3VAHA 3PFOA 4N56A 2OPRB 1FJEB 3PM9A 4YY3F 2ATCB 5KT5A 2RUGA 2E5GA 3R8YA 2MYFA 1TAQA 4ZOSA 2PGCA 1UP1A 3KUEA 1PBUA 5HROB 5DQIA 1C0UB 3RBEA 1CJUA 4Y2KA 3OR2A 4ED4A 4CH7A 2ZHOA 2BRKA 5IQQA 1CC8A 1NRKA 1SCJB 3IBFB 4PQUB 3SCJE 3Q2TC 3AY0A 4F4WA 3OJUA 1Q86T 1N6QA 4P2XA 1WD6A 2B7CB 1S9EA 1WDDA 2GVZA 1ZM3A 2VFRA 5HO4A 4RNOA 2KT2A 3EWGA 4WIIA 2KTQA 4C3LA 2GX8A 5EX3A 2IVFB 2QJ3A 1SIZA 4C2MA 4ZHRB 2PEBA 2X3DA 3MFIA 3V81B 3SXLA 3FCHA 4DV6F 2QA4S 4GKJJ 1VMBA 1EB0A 2H9ZA 4FZVA 4XIUA 5M2UA 1MMLA 2L9WA 3QJPA 4FP9A 2XQCA 3HHLB 3OR1A 3I56S 2MB0B 4N8NA 4IG0A 4DV5J 4OI3A 5D3GB 2FVSA 1ZA2B 3JQJA 4HI2A 2GQ2A 1JMTA 1FRKA 3HHEA 3I0RB 3OFEA 5B0GA 1NNDA 1AB8A 1EKSA 3BJYA 4Z7YA 2HQGA 3I82A 5D78A 5LL6d 1WEXA 4R5PA 1RHUB 2Y0BB 4JI5F 2P8IA 4OYIA 2FQQB 4DPWA 1U1PA 5BYRA 4M5GA 4X2BA 3JAMU 2CPFA 3R5AA 4CLZA 1FTCA 4LBIA 5A76A 1DZ5A 4O4GB 1YBTA 2DJWA 1Q8LA 4Y28C 1FD2A 3PYDA 3US5A 4YDXA 1VQOS 4ZCKA 4ZVHA 3EZ5A 1IUJA 2D7SA 4ZVFA 4ELVA 4IOCQ 5IFMA 3BGRB 4CLKA 3QZ7A 4C3KA 3MPWA 2MLZA 4FF2A 2YKMB 3ELHA 2XNQA 2R7QA 3BF4A 2AV5A 1FESA 1M5PC 1S5ZA 3D68A 5HVHA 3DOKB 4J9SA 4FPRA 1X4DA 1X5OA 4HLBA 2X7IA 1CC7A 1RJJA 4J9MA 3CCVS 3MMAA 4F4YA 2BOPA 4OI1A 4DEZA 2WB4A 5F8MA 1S1UA 1MU2B 1REGX 4DPYA 2M88A 2BUNA 5IS2A 3C6TB 2BDPA 1NSQA 2LQ9A 4ICLB 4CYUA 5DZ6A 3DLKA 3ISNC 1F9FA 4JYAF 1TU0B 4RBTA 3ITHA 2XTJP 3JB9k 2DISA 3LQVA 4QWCA 2FUG9 4DQRA 2HQFA 1C0TA 2NXNA 4F02A 4ZPWR 1A0OB 2V6AA 1SJQA 5K14B 2XGQA 3W8GA 4JV5F 4TYAA 1E6VA 1UVIA 2CADA 1TV6A 2JJ4D 2KM8C 4YR2A 1WUUA 3HFVA 2RT3A 3AOBA 3ENQA 4JI3F 5F8LA 4LMZA 2NZCA 1NDCA 1RACB 4Y2MA 3HFKA 4I56A 2UVRA 2OPSB 4RBUA 4KFBA 1GMVA 3BYRA 4X65F 4RJVA 4RW8A 1W26A 3PX0A 2ZH4A 2UXBJ 1CJTA 3IRXB 3M4XA 4LREA 4KGVB 3V4IB 2MKJA 2QMWA 1RHRB 2KT5A 2W9BB 4URGA 1YLXA 2ADCA 1BQMA 4ED3A 4ES2A 2M3DA 4NLVA 4UY85 5J1PA 2YWWA 3M1VA 4O3NA 3HMJG 3OL9A 2Y3YA 1MWQA 3IRWP 1JNZB 2NYHA 3FSIA 5L9XA 3JTNA 3PJ9A 2BJ7A 3K5PA 5F8IA 2ZVIA 3QZ8A 3FRZA 3MR6A 4KBIA 1F5CA 3T1YJ 2KVQE 5LOQA 1F3FA 3G8QA 4J9KA 1FWPA 1MLAA 3NKYA 3HF5A 3KLGB 5ETQA 3M30B 3BEGB 5DDOC 4NYZA 2HVIA 2UUBF 1RTDB 1HYSB 2AX0A 2RB7A 2DGSA 5KG0A 2GIRA 3TAMB 2W7AA 4URSA 5DGAA 2BE2A 1M0SA 2V63A 3MEEA 4P7TA 4DN0A 1PYOB 3SI8A 2EC2A 1T03A 1K44A 2W2MP 2ZZTA 1P1TA 1AT1B 3A4TA 4DV1J 3PFEA 2DXDA 3H40A 1D3WA 1MROB 2RF2B 1IR2A 1HQUA 4RBVA 1PAEX 3IG1B 4G1QA 3GR1A 2HWTA 1FDBA 2KG0A 4Y3CA 5J1NA 3Q86A 4WFAQ 2KM8B 2WBMA 4RW4A 1SJ3P 1T7PA 1UZDA 3NGDA 3MM8B 4ILLA 1WKLA 4C7QA 1NXIA 4KO0A 2UVWA 4OJGA 4CLYA 3OTOF 4UOFA 4U8YA 5KG4A 4H4OA 1FTRA 2E1RA 2MHNA 4F26A 2J6TA 3A8KA 3MD3A 1FFWB 4DZDA 1VBZA 4OX6A 4FKYA 1YDLA 3AFGA 2CQ4A 2J9CA 1CULA 2YTCA 3D2WA 2OO4A 1HNWJ 4MMOA 4YB1P 3PY8A 5JUMA 4DCJB 4PWUA 2KZMA 2HIQA 3GG1A 2X1BA 4LF7J 1N5QA 4GKKJ 2BQUA 1NLKL 3HHKA 1UTAA 3ZZRA 4QU7A 1H38A 3NWRA 3HHDA 3QRRA 6FDRA 1VIXA 2K3KA 4Y00A 1HBUA 3CJ4A 2ZJPQ 1JKHA 3W64A 3LALA 1URNA 4FPIA 1WORA 1ROFA 3JSRA 3M9NB 2ZUAA 3LO3A 1UFLA 1I1GA 4YR0A 1ICEB 3PKYA 4P2SA 4DL3A 1GXTA 1RK8A 1OSCA 1ELOA 3AA8A 2MLYA 3EVOA 3JSYA 4PWDA 3TARA 2HGNA 2GAHC 1OSDA 3HVRA 3LP2B 2BA9A 4MH8A 3UCUP 3SFUA 4RUHA 1FWKA 1FNOA 4EBDA 1ZA1B 2PD1A 3KG4A 1XJWB 2DB1A 3DN9A 1JLAB 1EETB 3BSAA 3NAIA 1QY7A 4ZPAA 2Z8QA 4I67A 3Q8RB 2HZCA 4PYDA 2LXIA 3D4JA 4RNMA 2ZDOA 2KFZA 3QSYB 2HLTA 4JBCA 2HBQB 1RABB 3ZZOA 1RSCA 5F3TA 4BHQA 2A18A 3TZXA 3DDNA 2MKYA 4MIWA 1HNXF 3VVTA 4B9UA 5J2QA 1HBOB 4DI6A 1RB0A 4EI2A 1BC6A 1RTIB 3DM2B 4BWJA 2WONB 3CDWA 1D9FA 2VPZB 2ZC3A 1NAQA 3VZHA 4CO1A 3QFHA 4WFXA 3TO8A 1UA1A 3VGTA 4MTPA 3F73A 2ZBQA 2JHEA 2J6SA 3BSCA 5HQLA 1HMVA 5A2QY 2IDEA 3THVA
chains in the Genus database with same CATH topology
2BJ3A 3BKTA 2Y3YA 2NZCA 2WVDA 2WVFA 3BKFA 2FGCA 2CA9A 1Q5VA 2BJ7A 3OD2A 3LGHA 2CADA 3BKUA 2WVCA 2BJ8A 2HZAA 2PC6A 3PHTA 1Q5YA 2BJ1A 2HZVA 2WVBA 2CAJA 2BJ9A 2F1FA 3QSIA 2WVEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BJ3 A;  3BKT A;  2Y3Y A;  2NZC A;  2WVD A;  2WVF A;  3BKF A;  2FGC A;  2CA9 A;  1Q5V A;  2BJ7 A;  3OD2 A;  3LGH A;  2CAD A;  3BKU A;  2WVC A;  2BJ8 A;  2HZA A;  2PC6 A;  3PHT A;  1Q5Y A;  2BJ1 A;  2HZV A;  2WVB A;  2CAJ A;  2BJ9 A;  2F1F A;  3QSI A;  2WVE A; 
#chains in the Genus database with same CATH topology
 4NMX A;  2DRA A;  2E5L J;  3NL0 A;  1C1C A;  2GQC A;  4PCQ A;  3DHW C;  3S01 A;  4B3M F;  3BM7 A;  1F6T A;  1KC8 T;  3BO2 A;  2HKE A;  4M5L A;  1TKT B;  3W65 A;  4I64 A;  4M8L A;  2VON A;  3B82 A;  2YKO A;  4J5O A;  2HFZ A;  1B4S A;  2KO1 A;  2RML A;  4KB7 A;  3GB0 A;  2V67 A;  3OD2 A;  5D4N A;  3JQK A;  4E98 A;  4ATN A;  1FFS B;  4FVC A;  5LT5 A;  2DNK A;  2AZ1 A;  4YHH J;  1Y5L B;  1HWI A;  1KWM A;  1J2V A;  4C8O A;  2DO4 A;  3HZE A;  1DUR A;  3G82 B;  3VAM A;  5KTQ A;  4NL5 A;  4N77 A;  4EO8 A;  2VA2 A;  2YNI A;  2BJ3 A;  3HT3 A;  4QOT A;  2OSR A;  2RKI B;  3GG0 A;  4I6W A;  4ER8 A;  1QE1 A;  2G9O A;  4UY8 T;  1EHW A;  3IAM 9;  1S12 A;  3N5B A;  4YR3 A;  2AMC B;  3NNC A;  4WZM A;  3CJR A;  3DI6 A;  2D3O 1;  5B09 A;  4Y34 A;  4DR5 F;  4LF9 F;  1YHQ S;  1Z4U A;  5L38 A;  2JX2 A;  3C6U A;  3CW2 C;  5KFR A;  3CJS A;  4C48 A;  2ATL A;  3HVA A;  1LWC A;  1HA1 A;  3GFX A;  4K4V A;  1N36 J;  2CG8 A;  3EPI A;  3H2V E;  4W4M A;  5C24 A;  2HNY A;  3AJ2 A;  2LCW A;  1TL1 B;  4NXM F;  1Y10 A;  3C16 B;  5FDL B;  5ETM A;  4K59 A;  4K5S A;  4OX7 A;  1Z2Z A;  1RT6 A;  2JC1 A;  3UD5 A;  1TK5 A;  3AB4 B;  3TA0 A;  3G4S S;  1Q8K A;  4JP8 A;  2I1R A;  5H9E K;  4XDC A;  1NEE A;  2GC8 A;  1HHT P;  4WFY A;  2GMJ A;  2HMI A;  1P9Q C;  1KR4 A;  1V3S A;  1R0C B;  3NWG A;  4KQZ A;  4JUZ A;  1X0P A;  3KHR A;  2XHC A;  3AH6 A;  1DTT A;  1D9A A;  3DRP A;  4RNF A;  3AD8 C;  4G6V B;  2B56 A;  5HBM B;  4LRC A;  4PG4 A;  2V69 A;  3JYT B;  3QGI A;  2P2C B;  3LGN A;  2MY8 A;  2ACM A;  2FZC B;  3OXG A;  2FY8 A;  2OEL A;  2OPR A;  3Q83 A;  3M9M B;  1HWK A;  1Q8I A;  5DQH A;  3TEG A;  1FVS A;  1KP6 A;  5AE2 A;  1VBX A;  1S6Q B;  2CPH A;  3AAW B;  3ZZP A;  2FLO A;  1R89 A;  5GAD U;  1X5T A;  1RHJ B;  2EEY A;  2IIH A;  2MHE A;  3W66 A;  4ZCL A;  3UDL A;  1N0V C;  4B3S F;  2DNQ A;  3VCD A;  1FEH A;  4LF1 A;  1NME B;  5A8W A;  1N8R T;  4PQU A;  2E1A A;  4OYM A;  3SYZ A;  5CCM A;  2LFV A;  3CWJ A;  4D3G A;  1RTJ A;  2B43 A;  4B17 A;  1DQ8 A;  4KHR A;  1IBM F;  2EFG A;  5C25 B;  5D0R A;  3CDU A;  3EXC X;  3M2V A;  2F8E X;  1UKU A;  2H3E B;  3DU6 A;  3TUJ C;  2C2Z B;  1OIA A;  4PUO B;  2FC8 A;  2QL5 B;  3V81 A;  2DNH A;  1MN7 A;  4MFB B;  3R5J B;  4NX9 A;  4DL6 A;  2JNJ A;  3MPY A;  2LXF A;  1SKS A;  2RSQ A;  5KOW A;  1QAY A;  1YWX A;  4KKO A;  3ET6 B;  4CCH A;  4X4P A;  3B4M A;  3HHL A;  2PFD A;  1NPP A;  1SXL A;  2CJK A;  3OQ2 A;  3M32 B;  2JDJ A;  1J27 A;  5B7W A;  3PAC A;  2PC6 A;  1T9U A;  2QYC A;  3DLE A;  1JK9 B;  1VC0 A;  1XMQ J;  2CXE A;  4KGM A;  4CP5 A;  2X1G A;  2DY9 A;  2DR5 A;  4ZLP A;  1N54 B;  3I0S B;  5F8G A;  1TFW A;  1PSD A;  1X4C A;  1G1X A;  4O4G A;  4J9O A;  3R7S B;  2ZM6 F;  4WXW A;  4LJM A;  1UVN A;  3QBC A;  2EFN A;  1D1U A;  3AD9 C;  4OZJ A;  4UQG A;  4NLW A;  5HP1 B;  3K89 A;  1KQS R;  1AFJ A;  4H4M B;  2B6A B;  3EVW A;  3S6E A;  3AOC A;  1QTM A;  2VAS A;  1UVL A;  3QRP A;  3KMS A;  2OAU A;  5I42 B;  4UUW A;  3LWL A;  3C2P A;  2D3Z A;  1RWU A;  1QUV A;  1KON A;  3DOK A;  3P45 B;  4Q7A A;  3H5U A;  3W7B A;  4NCG A;  1DLO B;  3NLC A;  5HJX A;  2HFO A;  3GFH A;  3PR5 B;  3TUI C;  4J90 A;  1IKW B;  1UFK A;  2MQN A;  4ED8 A;  2JL9 A;  5J2N B;  3N0V A;  5MLC V;  2CJA A;  1ARO P;  4RL1 A;  2IM0 A;  3M8P B;  5E7O B;  3E3X A;  3QT8 A;  4NRT A;  1MU2 A;  3I87 A;  3ZZT A;  4M5I A;  4ICL A;  2A2C A;  1NJY A;  4FVM A;  3OTC A;  2Z56 B;  1AA1 B;  2XC9 A;  3G8T A;  3QT6 A;  2KJV A;  3BKF A;  1I51 B;  3WBZ A;  3PRV A;  1SC4 B;  3HVT B;  3BQ0 A;  4DUZ J;  5KFQ A;  2CPZ A;  4ZVS B;  1WTB A;  2V8P A;  1S0V A;  5J2M B;  2ZVS A;  2BBE A;  1LQ9 A;  4QIF A;  3D6M B;  5G0R B;  3TEH B;  5K14 A;  4ZVU B;  6AT1 B;  2UVV A;  1PC5 A;  1HQE B;  1TK0 A;  2OMO A;  2HGL A;  2LP4 A;  4ED5 A;  3KJV B;  1N88 A;  1G3O A;  1FXD A;  3KYL A;  2Y9H A;  1O51 A;  2VPW B;  4DL5 A;  2N3L A;  2NLW A;  3O44 A;  5HLF B;  4XTT A;  5IWA J;  2AJ4 A;  1VGY A;  2NPI A;  2YNF B;  3OTO J;  4LF5 F;  2OPS A;  2VFT A;  3ZNJ 1;  3A1Y G;  4ZVR B;  5CA5 A;  5D0G A;  2YKN B;  1T9X A;  2GHW A;  1NB2 A;  1JLQ B;  4OL8 A;  4F4Z A;  1IBL F;  3NOC A;  2W9B A;  1ZS6 A;  1WC5 A;  4ITS A;  2VD3 A;  2O66 A;  2H5E A;  2IRX A;  3NRB A;  2CJQ A;  2HFU A;  1IKX B;  3HM9 A;  4ILM A;  3GYG A;  2XB2 D;  1WI6 A;  3BSN A;  1HNZ J;  2VC1 A;  1FD8 A;  2P6S A;  2XZD B;  3HP6 A;  2LVW A;  1LNQ A;  3IO1 A;  1SUQ A;  1RTD A;  1HYS A;  1D09 B;  1HBN B;  1PCA A;  2D3U A;  2LYV A;  3TAM A;  1RWX B;  4AXJ A;  3L4B C;  2XMM A;  2EBG A;  2M4M A;  1NH8 A;  3FRY A;  3LF0 A;  5LJ5 Y;  3DOM A;  3LP0 B;  2N82 B;  1ULR A;  1S59 A;  2XLI A;  2RU9 A;  2CQ3 A;  4EWT A;  3R1H A;  1HR0 J;  1EJ7 L;  3D66 A;  3IG1 A;  2ZE2 A;  2CJX B;  1SC3 B;  2GA7 A;  2HZA A;  2IC3 B;  4QW9 A;  2YY3 A;  3G86 A;  2PI5 A;  3LPE A;  3UCZ P;  4F7V A;  1N33 F;  3MM8 A;  5IC4 B;  3QID A;  5CYJ A;  1SKR A;  1IR1 A;  3AHP A;  4WBF A;  3OUY B;  4P10 A;  2BKN A;  1N5V A;  2VQF J;  2FVC A;  2R3V A;  4ZP6 A;  2XZT B;  5JJB A;  5GAH I;  1KFS A;  3O8W A;  1QSY A;  3G6X A;  2HEK A;  2VBW A;  4WFB Q;  4DDF A;  4YEA A;  2CQH A;  4RW6 B;  2DK2 A;  1KQG B;  4ZK7 M;  4I69 A;  5AJ3 J;  2GGP B;  1JLB A;  1HPZ B;  2XMA A;  4CWB A;  1QTN B;  3LPY A;  1FJG F;  5KFS A;  4A48 A;  1T9V A;  4FXW A;  4X4R A;  3PYG A;  3VAG A;  4NZ6 A;  4YB7 A;  4EU0 A;  5IC6 B;  3F0N A;  2VG6 A;  1HWL A;  3U1L A;  1KSP A;  1R8C A;  1V3Z A;  1FE0 A;  4K8R A;  4QIE A;  3CCS S;  4TY8 B;  4WP9 A;  5HMW A;  5K8N A;  1S99 A;  3OFF A;  1J5E J;  3WZ0 A;  4DX5 A;  1G4C A;  2XUL A;  1KLM B;  4N7T A;  4TU7 A;  3FMW A;  5A8R B;  4ZJO A;  2IM2 A;  4B3T F;  1HW8 A;  4X4T A;  1DRZ A;  4J7C A;  4P6Q A;  1I6J A;  2B5J A;  4KV8 A;  4NXN F;  2CQG A;  1P8G A;  4YUD A;  2RU3 A;  2HS4 A;  2QSW A;  3GMG A;  1JLA A;  2P9G A;  1RT1 A;  2L3M A;  3KJQ B;  1D8Z A;  1OYE A;  1VQY A;  3QWU A;  4KGX B;  2KI2 A;  3SQG A;  3QRQ A;  1S9G B;  3NGK A;  1BQN B;  1DTQ B;  1W2I A;  2A10 A;  2CDQ A;  3SMZ A;  3UPF A;  1VR6 A;  4IKA A;  3OV7 A;  3KK1 A;  1Y0H A;  4MK8 A;  4DR7 F;  3C19 A;  2KG1 A;  1VIO A;  3OVA A;  4NZ0 A;  2EBE A;  5JXS A;  2V2V A;  1U49 A;  1RCO B;  1KBR A;  3D6H B;  3K5O A;  3PJX A;  3A8I A;  1N32 J;  2B8Q A;  1QSL A;  2J8S A;  4URQ U;  3ZFV A;  2W4D A;  3NAH A;  1FI4 A;  4IOB A;  1I94 J;  3CJ3 A;  5BR8 F;  2K2P A;  1RTI A;  2XMW A;  1RAJ A;  5DET A;  3BH7 B;  1AW0 A;  3I5B A;  4N47 A;  2VU5 A;  1F60 B;  2PMZ D;  1RU1 A;  4CTA A;  2DTJ A;  1WEY A;  3QQC D;  2VFS A;  2FHJ D;  4L76 A;  3G6Y A;  4DV7 J;  1Y4Z B;  4IH5 A;  3OT9 A;  1XNR F;  2MKI A;  1H73 A;  2W01 A;  4TN2 A;  3TUP A;  3QGP A;  3LWM A;  2OP5 A;  2D1C A;  1Y3J A;  4C0H A;  3LA0 A;  2M2B A;  1B99 A;  1K1Q A;  2AYM A;  2V9W A;  5CD4 H;  2QC3 A;  2IAJ B;  5EGY A;  1WG4 A;  4DL7 A;  2GVD B;  3UR0 A;  4O44 B;  3NS6 A;  3PV8 A;  2H1Y A;  4KE5 A;  2W7P A;  5DG7 A;  4RW7 A;  1VRQ C;  2QN6 B;  4OJH A;  2W1B A;  1X4F A;  3PW2 A;  1YX2 A;  2K7J A;  3G82 A;  2JC0 A;  2IYG A;  2QE5 A;  4C0O C;  5J2P A;  2FJV A;  1U6Z A;  2UUA J;  4YOE A;  3L3C A;  1TR0 A;  4DQQ A;  4B3O B;  5KG3 A;  2H65 B;  5K5M A;  3NNA A;  1U09 A;  3RU0 A;  1CJV A;  4Q43 A;  2JRS A;  2WRM A;  2HHT A;  1H72 C;  2OLW A;  4F2S A;  1XMO J;  2IFX A;  3VGS A;  4FKX A;  2AF6 A;  3BQ2 A;  3QO9 A;  4OLP A;  1N48 A;  2I6W A;  2KRB A;  4CDI A;  4EK2 A;  2IA6 A;  4KJI A;  3VF0 B;  2RVJ A;  1FRL A;  1B0V A;  5DQG A;  1Y11 A;  4PAA A;  2NR0 A;  2C3O A;  4AL6 A;  2VL1 A;  2C2D A;  4K4S A;  2XHW A;  4B9L A;  4Y6I A;  4E8U A;  1K47 A;  4KAI A;  1HNV A;  5KFL A;  4DFK A;  2DCL A;  4OYA A;  4X4Q A;  4FYV B;  4QW8 A;  1YRT A;  2ADB A;  3PTW A;  3EDQ B;  4KSE B;  1TL1 A;  3C16 A;  5FDL A;  3H2L A;  3P3D A;  2JVR A;  3HUL A;  3MTK A;  2R2U A;  2R2S A;  1I5O B;  3CUN A;  2DT9 A;  3DXS X;  2Z2Y B;  1TKX B;  2HBZ B;  1LWF A;  1RKI A;  2MTL A;  3P6Y C;  2VB6 A;  1CPZ A;  5BYS A;  6FD1 A;  3UVJ B;  4O3O A;  4NA1 A;  4DZ6 A;  3W2W A;  3V6D B;  1KTQ A;  1S79 A;  1WI8 A;  4NOH A;  4ZCM A;  1HI8 A;  4DV2 J;  3PYE A;  2BKO A;  4DSJ A;  1RTH B;  1VHF A;  4I6Y A;  1DAR A;  2YBV A;  5HBM A;  1T05 B;  3DNC A;  4NYP A;  1S48 A;  1YJT A;  4DPX A;  4ZA1 A;  1OPZ A;  5K8M A;  5B08 A;  2XGP A;  4ID5 B;  3M6X A;  3IM8 A;  3T3F A;  4C8N A;  2OH2 A;  3MPU B;  3MR7 A;  4J9U E;  1SKW A;  2CRL A;  5FII A;  2WSE C;  1CJK B;  3D1Q A;  2WB1 D;  2R8I A;  3TZY A;  1LK7 A;  3MDF A;  1XN9 A;  1R6V A;  2L41 A;  2YX7 A;  1AFI A;  1IQZ A;  1RAO A;  1UEU A;  1S6Q A;  1V9O A;  5F9L A;  2IY5 B;  1Z2L A;  3DKD A;  3D1O A;  3QLH B;  3DGV A;  2XBP A;  3DLH A;  1S6U A;  4U8V A;  1RWN B;  1FDA A;  1TUG B;  5KFF A;  2F9D A;  1NK6 A;  3N6M A;  5CYQ B;  1RWO B;  1U4B A;  2PEH A;  1XC9 A;  4JV1 A;  3CD7 A;  4ZLJ A;  2WW8 A;  2IMW P;  2DR9 A;  5KG5 A;  3THT A;  1WSR A;  2YWK A;  1LXN A;  4EYI B;  1DHM A;  4WWS A;  1QD1 A;  1BE4 A;  1JLE B;  1EP4 B;  5C25 A;  3L9Z A;  3R27 A;  4M5D B;  2DYA A;  1FER A;  2B9Y A;  1BWV A;  5E33 A;  5F9N A;  3H2U B;  4PRF A;  1JLG A;  1TL7 B;  2Q66 A;  1T3N A;  4P74 A;  4MFB A;  2RRB A;  1MMD A;  3LW5 C;  4XPE A;  4K5R A;  5IOL A;  4CLW A;  4LUB A;  2VFU A;  3ET6 A;  3TJ9 A;  2VJU A;  4F0K A;  3CDB A;  4ETZ A;  2HLU A;  4M5M A;  5JVG Q;  2B4U A;  4BCA A;  2AEM A;  4DSI A;  4ZPV R;  1X4G A;  3X1L B;  3F41 A;  1FKO A;  3AOD A;  1WF0 A;  3CCL S;  4DS5 A;  4GKJ F;  3Q89 A;  5G4D A;  3DDI A;  4N76 A;  1GTH A;  1VQ7 S;  4B02 A;  1HFE L;  1SV5 A;  2IBO A;  4WXO A;  1K0T A;  3UQS A;  2YH0 A;  2E1C A;  2AJF E;  2QX0 A;  4QYZ K;  4CO2 A;  4ZPD A;  2PE8 A;  3AJ1 A;  1YTY A;  2ZHB A;  1Y00 A;  5FJ4 A;  4DR2 J;  1VK8 A;  1UMJ A;  1RKJ A;  4NRU A;  5DDQ C;  4CO0 A;  5KT4 A;  4QQB A;  5CD4 A;  3A3P B;  1FO1 A;  4G3I A;  2F5G A;  1JIH A;  2ZIT A;  1XEZ A;  3CCW A;  2DXE A;  4LF5 J;  4OHY A;  3OFG A;  1KFD A;  2XCA A;  4J9R A;  4H4M A;  2XCP A;  5A6P A;  2C28 A;  1TL3 A;  1HL6 A;  3BS9 A;  1VI7 A;  5I42 A;  1MNE A;  2K1R B;  4UZC A;  1TMJ A;  4WFN Q;  2Q79 A;  3LAK A;  2DPJ A;  4IYQ A;  3QAU A;  2KHD A;  2ABY A;  2BAC A;  4DLE A;  3IWX A;  5KFI A;  5E5N A;  4LVO P;  1YJR A;  2C2M B;  3LGH A;  2OIH A;  1HBM B;  2IM1 A;  3CCJ S;  1QM9 A;  4LIW A;  2V0N A;  1AYE A;  1RU2 A;  4W90 B;  1IKW A;  5KG1 A;  1H74 A;  4F4A A;  1JWW A;  2F63 A;  2WCX A;  2MJN A;  4DR4 J;  3HJV A;  1LV5 A;  1S0O A;  4XO0 A;  1RT7 A;  5CAB A;  1U47 A;  1TAU A;  2IJF A;  3ZC4 A;  3SZ2 A;  5J1E B;  4HVZ A;  1GXL A;  3UDC A;  1VRT B;  1Q7L B;  4F4X A;  3RAX A;  4PXD A;  2QLW A;  2KB2 A;  1Y7P A;  3HVT A;  4CM2 A;  3KLI A;  2E66 A;  5GAG U;  3RBD A;  1PIL A;  5GAE U;  1R8A A;  5J2M A;  3PX6 A;  2PMH A;  3SSR A;  3CB4 A;  2HVZ A;  2BEF A;  5G0R A;  4ZLL A;  1A7G E;  1VBY A;  3MCM A;  1HQE A;  2AYE A;  3FFI B;  3VAJ A;  2QFI A;  2RH3 A;  2Z2L A;  4TQR A;  3PW0 A;  2WVE A;  4P71 A;  2O5D A;  1IKV A;  2B4P A;  4ECQ A;  4RR5 A;  1NUE A;  3W1Y C;  2V8H A;  4ELT A;  2GO8 A;  1QAJ A;  2ZOF A;  4NA3 A;  2YNF A;  3POT B;  3W3S A;  2J7U A;  1KEK A;  1U0H A;  3CF5 Q;  3M8Q B;  4X4S A;  4JI1 J;  5AXM A;  4TU9 A;  2W8L A;  4DF8 A;  2R7T A;  4DV4 J;  3E8O A;  4OZ0 A;  1FK9 A;  2YWH A;  4PQA A;  4QIG A;  4YFU A;  1JLQ A;  3ZZZ A;  4I2P B;  3WC0 A;  2C2K B;  3QAE A;  4ZS6 A;  4ECX A;  2RDJ A;  2QFJ A;  4ECY A;  3Q8V A;  1IKX A;  3Q8Q B;  4IG3 B;  3D6F B;  3M2R A;  2CJB A;  3MFH A;  2UXB F;  4OX9 J;  3MAH A;  4W92 B;  2Z2M A;  3DFE A;  3FC9 A;  2OEM A;  1V3R A;  4A4J A;  4H4K C;  1M5S A;  2G1H A;  3CCR S;  1XBW A;  1NHV A;  1R8P A;  4KHP J;  1IBK J;  1HBN A;  2UUC J;  2DNP A;  4JOU A;  3KLF B;  3MEC A;  4CT9 A;  5IM0 A;  2HAF A;  1S1T B;  4FDF A;  1WDT A;  3T1Y F;  4J9P A;  3LP0 A;  3LH2 S;  3U1M A;  3MPD A;  2A0F B;  4OZ3 A;  2VV5 A;  4HR2 A;  5C2G A;  1ZZN A;  1VFJ A;  3CNQ P;  2HVD A;  4NEY A;  3FZ2 A;  2JH3 A;  3IXQ A;  2GIF A;  2WZ1 A;  3DCA A;  3F56 A;  1G2E A;  2ZFH A;  1JXV A;  2PO4 A;  2ZH5 A;  3WHI A;  3G6V A;  5F3Z A;  2ASD A;  3FEX B;  4DV1 F;  3NMA A;  1C4C A;  2HHU A;  3RUB L;  2J9D A;  3IP0 A;  2Q3P A;  3DGP B;  2OPP A;  3D9B A;  4UOC A;  5C7P A;  1U2F A;  1T8E A;  2J0S D;  2ASL A;  3LP1 B;  5B0E A;  1UFW A;  2UUT A;  1KNZ A;  4EUV A;  1IVZ A;  3HCX A;  4OZ5 A;  1OQ6 A;  5BYQ A;  2B0G A;  4FXV A;  2ZJR Q;  3M6V A;  1WG1 A;  4RW6 A;  1T94 A;  4CLU A;  2AIR B;  2NUU G;  3VAF A;  2GGP A;  4LF4 J;  4F8R A;  4J9V A;  4O23 A;  4I7F B;  2YNG B;  2CPE A;  4LBP A;  3C15 B;  3KLE A;  3HVW A;  3FUY A;  4X66 J;  3HKW A;  1FJ7 A;  4TYB A;  2U1A A;  1ZET A;  3BO3 A;  4M5J A;  4KGK A;  1WC0 A;  3T5L A;  1WSV A;  5DG8 A;  3EDR B;  1HNW F;  2XYH B;  1RAA B;  1SL0 A;  2I38 A;  3EE3 A;  2Y8Y A;  1JJC B;  5C2C A;  4LF7 F;  2Y0S D;  2WVD A;  4TY8 A;  3ETM A;  3RJM B;  1X31 C;  2YWG A;  4ZVT B;  4GKK F;  3GJR B;  1YIT S;  2J9E A;  2K3I A;  4QYR A;  4QBU A;  1B0P A;  4C98 A;  2JSX A;  2QT7 A;  1EAR A;  4PPD A;  2VKR A;  1KLM A;  2Y1R I;  3W60 A;  1UVJ A;  1UWB A;  1RDR A;  2M5Y A;  1N52 B;  1JB0 C;  4DR1 J;  1BD6 A;  1NZA A;  1TEL A;  2JEJ A;  1KVJ A;  4ENO A;  3H59 A;  3RW6 A;  2E5I A;  3QJL A;  1UPP A;  3G71 S;  3PW5 A;  1KOH A;  2ALZ A;  2ILZ A;  3H4D A;  2D9O A;  1JQG A;  2FJD B;  4X4O A;  4GVB A;  3T9N A;  1VC6 A;  4OX8 A;  2D74 B;  3GJQ B;  4TNO A;  5IT4 A;  1A6L A;  2MGZ A;  4XDD A;  4QIW D;  1RLD A;  1U1N A;  2CPX A;  4BS2 A;  2ZNY A;  3D5M A;  3DRY A;  3T5J A;  2C2E A;  4DS4 A;  3VAL A;  3PW4 A;  3EIC A;  3GIL A;  4F3Q A;  4RUC A;  1U8W A;  3D67 A;  4FF4 A;  2RHS B;  2I0X A;  3IR7 B;  4C8M A;  2WBR A;  2DHG A;  3AT1 B;  3VZI A;  2CPJ A;  3VR1 A;  3W2V B;  3GJT B;  4DR3 J;  4C11 B;  4ZVP B;  1WTF A;  4USJ C;  1M1H A;  1X4B A;  3OW2 R;  1U2C A;  1Q16 B;  5BJR A;  1ZM4 A;  1EKR A;  1VC5 A;  2JFD A;  4O4R A;  1OO0 B;  2MZ1 A;  4PG7 A;  4HL9 A;  1X9S A;  1J5O B;  2PSZ A;  3IM9 A;  1S0M A;  1R3N A;  2LKZ A;  1NCL A;  3GWC A;  4KT0 C;  4LFA J;  4RNH A;  4IDK A;  2CA9 A;  2J7W A;  2IAJ A;  1KHV A;  3BPS P;  2AQ4 A;  3G87 A;  4J9L A;  1GT8 A;  3FDS A;  1B3T A;  1RA6 A;  2E5L F;  2V34 A;  1HWJ A;  2RIJ A;  2NSC A;  4IRD A;  4ZN3 A;  2F4V F;  3TAN A;  2M70 A;  2MKC A;  2BKP A;  3J7Y I;  3NGU A;  4ILR A;  1TK8 A;  3HXM A;  2HWI A;  2FVP A;  1SI9 A;  2MZJ A;  4ZPT R;  2VA3 A;  5IV3 A;  1NH7 A;  1X8D A;  3TAP A;  2BE7 D;  1GX5 A;  4B3O A;  2E7X A;  4YHH F;  3K5M A;  2L9N A;  1UJ5 A;  3CSK A;  3DRS A;  3J7A 1;  3CJ5 A;  2HFN A;  4ZLN A;  3CUL A;  1LW0 A;  3SV3 A;  2W2P P;  3H98 A;  1YJ9 S;  2OKQ A;  4UOG A;  2BX6 A;  3HLU A;  1WKJ A;  1Q5Y A;  4LSL B;  5LSR A;  1FRM A;  3K8W A;  2Z2Z A;  5D0H A;  4OI4 A;  5AE3 A;  1UZH A;  2HW3 A;  4WCE Q;  4PXE A;  5C5J A;  4RZR A;  3VWS A;  2ZOG A;  1MSW D;  4PZV A;  4L75 A;  1OWX A;  5EX0 A;  3JQM A;  2C1E B;  3FGV A;  2EW9 A;  1IM4 A;  2OD4 A;  1WC6 A;  3R5C A;  4E0D A;  2VG5 B;  4F0M A;  1TQL A;  3KK3 B;  2HWH A;  1TKX A;  3MM6 B;  2A1B A;  4DUY J;  1JJ4 A;  1N36 F;  1K73 T;  3ZTO A;  2POK A;  4DV3 J;  1YZ6 A;  3UVJ A;  3JSM B;  3CJQ A;  1LKZ A;  2HQI A;  5K20 B;  1SQE A;  2ACY A;  1PYT A;  3QMQ A;  4FNH A;  2WAQ D;  5LMU F;  1NDK A;  1GTE A;  1RWV B;  2DNR A;  3G96 A;  1RTH A;  5KFX A;  2F8M A;  1KOO A;  5GAD I;  4J9N A;  3BN4 A;  1N34 J;  3KXD A;  2VOO A;  2M7S A;  2FVQ A;  4ID5 A;  1VJW A;  1XR7 A;  3RRK A;  3SV4 A;  4B9T A;  3BDP A;  3KWM A;  1YJW S;  1YSJ A;  4HAC B;  2XMK A;  2Y1L B;  1R0B G;  4HH1 A;  2F8H A;  5ETV A;  1OPI A;  4A8Y A;  2H4Y B;  3NGR A;  4MJK A;  2QZ8 A;  1U1Q A;  4P7V A;  4L3K A;  3KLH B;  3RBZ A;  2XEX A;  4F25 A;  3GIJ A;  1T0T V;  3DLG A;  3HD2 A;  4DOZ A;  4GC7 A;  2DIT A;  3UWT A;  4KTQ A;  5KFT A;  4ES3 A;  2DY1 A;  2V68 A;  5ADZ A;  2ALY B;  3IBC B;  2HHH J;  1RBO B;  3CMQ A;  4TQS A;  1N6Q B;  4O3P A;  1IWA A;  2BAN B;  3B4D A;  3NOG A;  5D4O A;  4ZIW A;  1S4E A;  2GVZ B;  4X64 J;  1GAO A;  4QU6 A;  1FX4 A;  1S1V A;  3M05 A;  1Q53 A;  2GMH A;  4UQT A;  2VG7 B;  4P72 A;  3RG6 A;  3M8Y A;  4OZL A;  2Y1I A;  3P8B B;  3A3O B;  1OJ4 A;  4ERD A;  4WF9 Q;  1XTZ A;  3OR1 B;  1SJF A;  2ASJ A;  3GSD A;  1FRJ A;  3PRD A;  1VOM A;  3SCK E;  3DDK A;  1R7I A;  1XNQ J;  4RWW A;  2MST A;  2P5V A;  7FD1 A;  3CCQ S;  3TJA A;  3GQC A;  3B6B A;  1XMQ F;  2OSQ A;  4R5P B;  3SCL E;  1HHS A;  1WC1 A;  2M8H A;  4A46 A;  1VQL S;  2CPY A;  4DU7 A;  4N8O A;  4K4U A;  1PAU B;  4AT1 B;  3GR0 A;  4L74 A;  1MWZ A;  4UZB A;  3BYP A;  1X5P A;  3BGO P;  2XI3 A;  3CPW R;  2R7S A;  3G6E S;  5KFO A;  2V8V A;  3CJT A;  2ZC4 A;  1TL4 A;  1BXN A;  2DNL A;  3CJK A;  3RBX A;  3FKB A;  2JLE A;  3OJS A;  5HN0 A;  4NLR A;  5HMZ A;  4JI4 J;  2DEI A;  3EGN A;  1UL3 A;  3RRG A;  3TP2 A;  4WP3 A;  3M8S A;  5HMY A;  3QNW B;  4ZVO B;  2GW8 A;  4L72 B;  3DLL Q;  2DNM A;  2FZG B;  2BJ1 A;  2PDA A;  4AL7 A;  2X3G A;  4DQP A;  5J1E A;  2AJ1 A;  5I3P A;  4ZPB A;  3HJF A;  1S7H A;  4OYP A;  3BR9 A;  1FRX A;  3KDN A;  5LXY A;  2OFG X;  4MT1 A;  1FX2 A;  3DLK B;  1OY8 A;  4E2F B;  2AYG A;  3QT5 A;  3TWZ A;  4DSE A;  4DCO B;  4PXC A;  4DSF A;  1VBK A;  1KRP A;  3BH6 B;  4JI7 J;  2AYB A;  3GV5 B;  4DX8 H;  4EO6 A;  1DJ0 A;  3VVU A;  2ZH2 A;  3FFI A;  1NSP A;  2GO9 A;  3CGI A;  3PEJ A;  1NHK L;  1ZBT A;  4DUZ F;  1VQ8 S;  1R6Y A;  1A9N B;  1E6V B;  3I9Z A;  1WNE A;  5A0Y B;  2K06 A;  4ED2 A;  3TA2 A;  1R8B A;  3POT A;  3RGI A;  2KL8 A;  3FBE A;  3A12 A;  4ECR A;  1QAX A;  4LFC J;  1U1L A;  3GV8 B;  2WSF C;  3IR5 B;  1VQ4 S;  3LUY A;  4C8Y A;  1TUV A;  1GMW A;  2ZWO A;  4WK1 A;  2ZH1 A;  1PIE A;  2FYX A;  5IWA F;  5BXI A;  2YKA A;  4C8K A;  4DR6 J;  3TAQ A;  2KKH A;  3H5X A;  3M9O B;  1CQN A;  3R7B B;  1BQM B;  3O1L A;  2F65 A;  4JI6 J;  2ILY A;  5CXT A;  1N4L A;  3J80 Y;  2OPQ A;  1XWL A;  1HIY A;  3JS9 A;  3OVS A;  1C1B B;  1Q5V A;  1U6B A;  4UF4 A;  4BC7 A;  1JJH A;  1OYD A;  3R9L A;  3WDO A;  5T7L B;  2EK1 A;  2ZUG A;  3R5G A;  2EG1 A;  2VQE J;  3RB4 A;  1NB7 A;  2PI4 A;  1TFY A;  1IJE B;  3TI0 A;  1ZH5 A;  4RNN A;  3EXY A;  3RB0 A;  4EBC A;  4LRF A;  8RUC A;  1S1T A;  5KFZ A;  4F50 A;  1HNZ F;  3M7V A;  4ZN1 A;  2Q6B A;  2PA8 D;  1QUP A;  5IZH A;  3IMQ J;  1RCX B;  4X62 F;  4HYK A;  5DO2 A;  4NLX A;  3WX8 A;  1T03 B;  5B0C A;  4GO5 X;  4KPY A;  3WQP A;  5AT1 B;  2V4R A;  1HQU B;  4G1Q B;  1H7X A;  3T9Z A;  4O3Q A;  3KMQ A;  2R2T A;  2G0J A;  4CZC A;  2DNG A;  2M0G B;  4PAB A;  2ZH9 A;  3AD7 C;  1HR0 F;  2KZZ A;  3Q0A A;  2VDI A;  1L3V A;  1REV A;  1MG7 A;  4U7U D;  1RA7 A;  2OML A;  2E44 A;  2BJ9 A;  2AWZ A;  2HGM A;  4JV0 A;  3CE8 A;  3UR3 C;  4ECW A;  4CLP A;  2VOP A;  1UA0 A;  2DNY A;  3L7O A;  5DS7 A;  5A6W A;  2G0C A;  3LP1 A;  3R97 A;  1ZZF A;  4TY9 A;  3W63 A;  2HBR B;  2X51 A;  3RAM A;  4UUX A;  1NK5 A;  2NXE A;  1WOP A;  1VRU A;  3MAQ A;  2CQ1 A;  1VQ9 S;  2E9R X;  2DR6 A;  2VQF F;  4USH A;  2EPI A;  4DFJ A;  4F0H A;  3D0H E;  2E5H A;  2QA2 A;  2DR8 A;  4I7F A;  4NCA A;  2YXL A;  2ZHA A;  3CIZ A;  5DDP C;  4OJ1 A;  4CLT A;  4CT8 A;  5I3Q A;  4JI8 J;  3LAM A;  3IS9 A;  5ETR A;  4HHU A;  5AXN A;  5H9F J;  3PHT A;  4KR0 B;  5CHC B;  3MOJ B;  2MZR A;  4KYZ A;  2QYG A;  5AJ3 F;  4CO3 A;  2ERR A;  4DX7 A;  4AL5 A;  1S97 A;  3PNI A;  2LMI A;  1HBU B;  2MY7 A;  3DLJ A;  1HI1 A;  3U02 A;  5A8K B;  3HD1 A;  4YS2 A;  3IAS 9;  1U2R A;  4BBY A;  4LF6 J;  1UVK A;  4NWB A;  1NHU A;  2VOD A;  4FN5 A;  4ED1 A;  4ZCI A;  5EHH A;  5ITH A;  2HPU A;  4P52 A;  2EFV A;  1P27 B;  3BGL A;  1T95 A;  2F4V J;  2KXH A;  4MIB A;  3FK4 A;  1SPB P;  3FZB A;  3IN5 A;  2CQB A;  4HTI A;  2B3T B;  1VLY A;  1Y5I B;  2AEF A;  2QSF A;  4F3M A;  1J5E F;  2FGC A;  4HHJ A;  4DF4 A;  3UDV A;  2C3U A;  1E6Y A;  4DMZ A;  5T41 A;  2V4J A;  1U25 A;  4K4Z A;  4CI0 B;  2FJW A;  4OYW A;  4NLP A;  4Y2A A;  3BZQ A;  5T14 A;  2KJW A;  2YQ0 A;  2I2Y A;  2RAQ A;  1P6T A;  3UDE A;  4FNI A;  1LEO A;  2E7V A;  3J80 U;  2P9C A;  2PFF B;  3EZU A;  3ILL A;  2LEA A;  3FMB A;  4UT4 A;  5L1K A;  4DFM A;  4QZV B;  3V2U C;  2XYG B;  3HI9 A;  1N56 A;  1P1L A;  4PR6 A;  2BOA A;  3PW7 A;  3KHG A;  1IR0 A;  2KYX A;  4YB5 A;  3MEG A;  3QWP A;  1RT4 B;  1NK4 A;  3W2V A;  2AJ0 A;  2ZBP A;  2KXN B;  4C11 A;  3J7Y U;  1HNI B;  4USV A;  2PMW A;  4A8K A;  5CQG A;  2WW4 A;  4Q0B B;  3KNA A;  4ED7 A;  1N32 F;  4ECV A;  1YG0 A;  3SBM A;  1I94 F;  3OL6 A;  4C0B A;  2J0X A;  3ZTR A;  2VC0 A;  3OSP A;  3R7N B;  5E3P A;  2R7X A;  5L1L A;  3BRE A;  5EN1 A;  4C4W A;  2NCK L;  2CQP A;  4I6A A;  5KFB A;  3FQL A;  4P2M A;  4IRK A;  4DV7 F;  3T41 A;  1PJ6 A;  4IFY B;  1PYS B;  2RS2 A;  4A8X A;  5LMN J;  3K0J A;  1F0X A;  1RT3 B;  2W7O A;  5LMU J;  3CCM S;  1S1W A;  4RKU C;  2UXD J;  4R0E A;  4CNY A;  3FEZ A;  1U1R A;  4B9S A;  2N3O A;  4EEY A;  2C42 A;  4N5S A;  3HHL D;  2IRU A;  1S1X A;  3OPK A;  4ANC A;  2YNH A;  2GV1 A;  2HRT A;  8ATC B;  2FZK B;  4J37 A;  2B7B B;  1WHX A;  3D3B J;  3FBB A;  2HHP A;  4IQX A;  1PGZ A;  1DBD A;  5EWE A;  1PJ7 A;  3HZG A;  3FNN A;  2VFV A;  2HYI B;  1M5K C;  2VKZ G;  3LGM A;  3VAK A;  4RO0 A;  1BGX T;  4LQ3 A;  2XSJ A;  5F0U A;  1VCT A;  2UUA F;  1G7C B;  2CJ9 A;  2DCU B;  2BXJ A;  2VUG A;  3MM5 B;  4LSL A;  3VQT A;  2VHG A;  3BO4 A;  4FS2 A;  2EWH A;  2VPY B;  3R6L B;  3UD4 P;  4DL0 C;  1XMO F;  1XR6 A;  3TX8 A;  4U7U K;  1YIJ S;  1L3U A;  5KFG A;  5HRO A;  1C0U A;  5D0E A;  2D3O R;  3SSS A;  4LR7 A;  3BB5 A;  1ZPV A;  3U7J A;  2XWX A;  5KFK A;  3OSN A;  5A2Q U;  5MAO A;  3K8V A;  4CO5 A;  2UXC J;  4FXD A;  3KK2 B;  1NJZ A;  1JXL A;  2HNY B;  4K7Q A;  1M5O C;  5KFH A;  2VG5 A;  5RUB A;  3HDS A;  2GFF A;  3EJM A;  3M8W A;  3W5Z A;  1RT6 B;  4Q8F A;  5ETK A;  4EZ6 A;  2MPU A;  2VJV A;  3HHL C;  4DQS A;  4ZHR A;  2COL A;  4WJB A;  1L3S A;  2HFS A;  2HMI B;  4AQY F;  4CRJ A;  2IBK A;  3TZZ A;  2CNK B;  3FCV A;  5C42 B;  1RT2 B;  3RYL A;  3C3L A;  1V5I B;  1DTT B;  3FSX A;  1YKW A;  2FLN A;  2YQ1 A;  2DNN A;  4GO7 X;  4DV0 J;  1ZTW A;  2VBY A;  3G2X A;  3K7R A;  4C6A A;  5D3G A;  5IQ6 A;  1EQM A;  4DV2 F;  3A3N B;  3H8Y A;  2UUW A;  3KNG A;  4Y2C A;  3I0R A;  4NLY A;  2YKP A;  2EK6 A;  2A6O A;  1VYA A;  2Y1J A;  2DGU A;  2WK4 A;  3KLH A;  4WU3 A;  3KLV A;  3L7P A;  4CNZ A;  2H4W B;  5CYM B;  4C9D A;  1IWG A;  1WHY A;  1S6O A;  2WHO A;  4YP3 A;  5A8W B;  2HQC A;  3HKZ D;  2N7C A;  4OZ2 A;  4B3R J;  4WK3 A;  1RTJ B;  2DD8 S;  1FKA F;  5KFY A;  3BQ1 A;  4NLO A;  4QR1 A;  2JWN A;  2BAN A;  3KG1 A;  3BGR A;  2J0Q D;  3ZO7 A;  1YVF A;  3M2V B;  3K59 A;  2YKM A;  5HVF A;  1TZ0 A;  7FDR A;  3IR6 B;  2Z57 B;  2VG7 A;  2FJX A;  1D9D A;  2W24 A;  3ULH A;  3S1T A;  3BSO A;  5HVG A;  2HQ3 A;  2B9X A;  3BPD A;  4LT6 A;  4KKO B;  2KRR A;  2WTF A;  3TNV A;  1WF1 A;  2BW7 A;  3PHE A;  3DLE B;  2GQQ A;  2AX1 A;  4ELU A;  5SUH A;  2HK3 A;  4LBH A;  2UU9 J;  2NXC A;  2E9T A;  2QMU B;  4TVA B;  1RT5 B;  3C6T A;  2DH9 A;  2DR7 A;  3QT7 A;  3GJS B;  3D0I E;  2R7W A;  2XZW A;  5HK4 A;  3ISN D;  3SDE B;  2BMB A;  2FHK A;  3MF5 A;  5KFP A;  3IWL A;  4OMF G;  4PPZ A;  1OQ3 A;  2XLJ A;  3CMA S;  5F8J A;  4FYY B;  1G6B A;  2RS8 A;  3BBB A;  2N7Y A;  5KFE A;  1VJQ A;  3NP5 A;  1KQF B;  5KT3 A;  3BGF A;  3KHH A;  1L3T A;  4AD6 A;  3BN7 A;  2J6U A;  1AZS B;  1Y5N B;  4DR2 F;  3T5K A;  5D4L A;  4WU2 A;  3MUR P;  4IR1 A;  4C8Z A;  2N4C A;  3AB2 B;  5ETP A;  1QAI A;  2VZ9 A;  4CO4 A;  4FBU A;  3CCE S;  4KHM A;  3RR8 A;  4EBE A;  4NCG B;  1TVR B;  2J7K A;  5GAG I;  2YWE A;  3IBW A;  3NMR A;  5GAE I;  3ENA A;  3IRX A;  4LR9 A;  3S8S A;  3V4I A;  1B0T A;  2HAI A;  3I96 A;  1KVI A;  1P9Y A;  1BWE A;  1ZAV A;  5DGB A;  2DRD A;  1T9W A;  2ROE A;  2R2R A;  4LIR A;  3P96 A;  3OL7 A;  1WC4 A;  2DXF A;  3D28 A;  1U1K A;  2BQ3 A;  1V6H A;  2EXU A;  5D15 A;  1AUD A;  4DR4 F;  4R25 A;  4ECT A;  2VBZ A;  1ZOT A;  4ZDN A;  1T9Y A;  4NLD A;  3KLG A;  2D41 A;  3M30 A;  2J9D E;  1ZAW A;  5M2R A;  4X62 J;  1W7W A;  3Q23 A;  2NPF A;  4X84 A;  3W62 A;  3R3T A;  3N28 A;  4USK A;  1KKH A;  2VDH A;  2ZH6 A;  3P5B P;  5L9N A;  4RWX A;  1NK7 A;  4JI0 F;  2E9Z A;  3BBF A;  2NXU A;  2AW0 A;  2HHQ A;  1YI2 S;  1LK5 A;  1ZPW X;  3R5D A;  3PR4 A;  2IDL A;  5A0Y A;  2KXF A;  1MRO A;  1T11 A;  2RF2 A;  5KFN A;  1Q7Y T;  3EGW B;  5HQ8 A;  2J76 E;  2DGT A;  5ETL A;  3AQO A;  4EZ9 A;  4M5K A;  2GHP A;  3CT9 A;  5HL7 Q;  3V6J A;  3GZ7 A;  5CCL A;  4Z37 A;  2LA6 A;  2CQI A;  2BRL A;  2NSB A;  2W2Q P;  5LSL A;  2NXJ A;  4L73 A;  4OHX A;  3QAT A;  4JI1 F;  5IV4 A;  1YBU A;  2DGV A;  5JVH Q;  2ZH3 A;  3C14 B;  1B7Y B;  3N01 A;  4PYA A;  4DV4 F;  2FGO A;  1NKE A;  2P6T A;  1FRH A;  1IQT A;  5E0O A;  1C1B A;  3JTO A;  3EGZ A;  3T1H J;  3NBP B;  1R8H A;  2ZDP A;  2F9J A;  5T7L A;  3QIP B;  4ZIT A;  2CQ0 A;  3UNG C;  3DMJ B;  5KG6 A;  4DPO A;  2CQ2 A;  3JSB A;  1H2V Z;  5H1S V;  1MMN A;  3ZZ0 A;  4PWW A;  5L1I A;  3OVB A;  5ETO A;  4V19 J;  2HND B;  1SUQ B;  2WVC A;  3AA9 A;  3GSI A;  2NYI A;  2F4F A;  2R8J A;  4O0I A;  4OX9 F;  8AT1 B;  3VGV A;  1H0H B;  1WHW A;  9RUB A;  4PG5 A;  4U95 A;  2OUG A;  3MWB A;  3DOM B;  1BLU A;  4KHP F;  2ZJQ Q;  1IBK F;  4GC6 A;  2A6M A;  2UUC F;  2AU0 A;  1UVM A;  4L3N A;  1HAR A;  2HZV A;  3HFZ B;  2CAJ A;  4OYX A;  1EX8 A;  4F2R A;  1FDN A;  2ZE2 B;  3HPO A;  3I31 A;  1V5V A;  3QYY A;  3RB3 A;  2F7V A;  1RI7 A;  1SJ4 P;  3LP2 A;  3OLB A;  2N4D A;  1SH0 A;  2M8D B;  5B0B A;  2DHX A;  4ZKA A;  3R2C J;  2AHO B;  3EMT A;  4NLT A;  1EET A;  5EUH A;  3VGU A;  2XG8 A;  3UE2 A;  3I5C A;  3PYF A;  1NO8 A;  1SC1 B;  1WF2 A;  4OI2 A;  2G13 A;  1VQP S;  4DPT A;  2M9K A;  4WZQ A;  2DBB A;  4KRW A;  2VF3 A;  4ZP7 A;  3GU0 A;  5D4P A;  1HW9 A;  4DSL A;  1PG5 B;  3HX9 A;  4QPT A;  4AYB D;  3NY0 A;  5KFC A;  1U45 A;  1RTZ A;  3AJD A;  1JLB B;  2G0I A;  3P5T L;  4YN3 B;  3CJ8 A;  1HBO A;  2O67 A;  1RAI B;  4ECS A;  3DM2 A;  2WON A;  3V6K A;  4EGL A;  3MCS A;  1K8A T;  2YPZ A;  4LF4 F;  1EZZ B;  3GPA A;  5KOX A;  2MDA A;  2JFK A;  4DX6 A;  5A8K A;  2VG6 B;  3R6G B;  2UZA A;  2LQ5 A;  5DDR C;  4X66 F;  4QWD A;  2J8A A;  3MM9 B;  3TQ1 A;  1S10 A;  2CWX A;  1JXE A;  3ILJ A;  1FXL A;  1W2B R;  1S4F A;  4F36 A;  1UW9 A;  5EWF A;  4K4W A;  1RLC L;  4O0N A;  1F5B A;  4LRA A;  1TKT A;  4JI2 J;  5KFJ A;  2HSE B;  2Q43 A;  3G8S A;  4IH7 A;  2CZV C;  3CD0 A;  2I8E A;  1GK8 A;  5KFM A;  1CEZ A;  2B5J B;  4KV8 B;  3DC2 A;  3K58 A;  1FE4 A;  2K7K A;  4IO1 A;  3TYT A;  3GIM A;  1DFD A;  4ETX A;  1W25 A;  1RT1 B;  1GFW B;  3SQG B;  4DBQ A;  4DR1 F;  3K57 A;  2BW2 A;  1GXU A;  3PDN A;  4Z2X A;  2I5J B;  2GS8 A;  3ETO A;  3KK1 B;  1T3O A;  3OXF A;  4NLS A;  5E2Q A;  2B8P A;  3MED B;  2R8H A;  1HKA A;  1WG5 A;  4U96 A;  2JVO A;  1NKB A;  1M1K T;  4IH6 A;  2RKI A;  1LWE B;  1GQE A;  2O01 C;  2W2O P;  3MCO A;  3O3L A;  5HI7 A;  2PA3 A;  1YK9 A;  4ANE A;  2V50 A;  1RT4 A;  3E01 B;  2FIU A;  2BM0 A;  2G2Y A;  1HNI A;  3VHQ A;  2K8G A;  4Q0B A;  2V9K A;  2U2F A;  1LW2 B;  1TP7 A;  4CTA B;  3CCZ A;  3IA0 A;  4NAS A;  1NSK L;  4LF8 J;  2MQM A;  3M6W A;  3NCQ A;  1WC3 A;  1Y3K A;  1S57 A;  4I2Q B;  2V94 A;  2GHV C;  4DR3 F;  5GME A;  3MXH P;  2NS1 B;  4K0K J;  2C2R A;  2GNK A;  2LQ8 A;  3UN5 A;  3OTE A;  4IFY A;  2Q1L A;  3J7Z 5;  2IVM A;  3DOL B;  2DGO A;  3KUG A;  3TR5 A;  4B9N A;  5IT9 Y;  2F3J A;  3E2E A;  2CZ4 A;  1RT3 A;  2EFO A;  4AUK A;  3NCP A;  3ICL A;  4I1T A;  1N5Y B;  4MKY A;  3PVX A;  3TRG A;  4AQY J;  2JOQ A;  1TL5 A;  4LFA F;  2XSF A;  3HSZ A;  3MR2 A;  2MZQ A;  4RW7 B;  4WYL A;  2RJZ A;  2YPY A;  2AJ2 A;  1R27 B;  3H5Y A;  5E3C A;  1F5A A;  4R8U B;  3MZI A;  4NI2 B;  2XYP B;  5J2P B;  1IKY B;  2QLF B;  1SL1 A;  1XK8 A;  1RZM A;  2ZBC A;  4WYW A;  2C22 A;  2EG2 A;  1FNX H;  1PJ5 A;  1YBA A;  3ISZ A;  1HD0 A;  1R43 A;  4UST A;  4OHW A;  1WJ9 A;  3OHA A;  4YY3 J;  1CJV B;  4USI A;  1WAC A;  2CNN B;  1K0V A;  4ID8 A;  3JYT A;  1CS4 B;  1H3D A;  1U26 A;  4IQM A;  4FF3 A;  1X4A A;  2R4F A;  3QO9 B;  3MM5 A;  4M1K A;  2B51 A;  2LEB A;  2MZT A;  3H4B A;  1VK3 A;  2G2O A;  3UD3 P;  3ENV A;  5K8P A;  4MYT A;  4MAK A;  4DHV A;  2HNZ B;  3KKF A;  2KFY A;  3CD6 S;  4P75 A;  1ACM B;  3CTR A;  1HNV B;  2Z0G A;  2H51 B;  2O1P A;  3EYZ A;  4A8W A;  2MQP A;  1QJH A;  4C97 A;  4RU9 A;  2E7W A;  1FHT A;  4IOA Q;  3CC7 S;  4IR9 A;  3KK2 A;  3OTD A;  2BJE A;  4TXS A;  4DU8 A;  4M94 A;  1DQ9 A;  3DRX A;  3NS7 B;  3KFW X;  4DV6 J;  1RAH B;  1IJF B;  1LWF B;  2RDD A;  3SCI E;  3MR5 A;  4O3R A;  2H5I B;  4PUO A;  1X4H A;  1Q8B A;  1CLF A;  2G1D A;  4LSN B;  1RAG B;  2EKN A;  4NPO A;  3CCU S;  3W2W B;  4G65 A;  3TOQ A;  2QTW A;  5C42 A;  1RT2 A;  3SIP B;  1FKP B;  4DUY F;  3U27 A;  1ZM9 A;  2BV3 A;  4CM0 A;  1FT8 A;  2JEF A;  1HI0 P;  3W5Y A;  3Q8Y A;  2CQC A;  4DV3 F;  3UN2 A;  1FNM A;  2RE1 A;  3TVY A;  2DVI A;  3GYX B;  4FBT A;  3M32 A;  1WOS A;  5CZV A;  1S0N A;  3ENW A;  4QCL A;  2FDN A;  1N34 F;  3TVZ A;  3GE9 A;  4JI5 J;  1YGY A;  2IHR 1;  2JLF A;  1PC4 A;  5EDW A;  1NM2 A;  2DIV A;  1U8S A;  1YZ7 A;  5CYM A;  4USW A;  4ZVE A;  3OLA A;  2IYI A;  4GRS A;  2WOM B;  4DL2 A;  4HTJ A;  4WKR A;  4Q44 A;  3I0S A;  4S0M A;  4YDD B;  1ZAX A;  2XO7 A;  3X3U A;  5AXK A;  1CG2 A;  1NJW A;  3J81 Y;  2VPX B;  4GVL A;  3N6L A;  1NK0 A;  4WPA A;  4B9M A;  4IRC A;  2NUH A;  2OTJ S;  5IT9 U;  4H54 A;  1NK8 A;  4DG1 B;  4DPU A;  5IT0 A;  1CBK A;  4QWA A;  5HP1 A;  3P49 B;  3FSY A;  2L08 A;  3MPV A;  3SFG A;  1Q0N A;  2B6A A;  2V2Q A;  1U7L A;  2HUR A;  3UNY A;  2HHH F;  1JLG B;  5GMK a;  3MEK A;  1RXO B;  1R0A B;  4ECU A;  4ZJQ A;  1SB6 A;  4R0J A;  3B8H A;  4PKD B;  2BZ2 A;  1DLO A;  2QL7 B;  4X64 F;  1WEZ A;  3ONQ A;  3I9V 9;  2MLX A;  4YQW A;  2DH8 A;  4DL4 A;  4AE5 A;  3T6B A;  5J2N A;  1FKO B;  3CJ0 A;  1L5U A;  2HHV A;  3GII A;  3BGU A;  3M8P A;  1T9T A;  2RDI A;  4LRD A;  5F41 A;  2IJN A;  4JYA J;  1RBL A;  1RT5 A;  2P9E A;  3PG9 A;  3T1A A;  1RAE B;  2APO A;  1LXJ A;  3OHB A;  3MD1 A;  4WIQ A;  1NDP A;  9ATC B;  2HG4 A;  4NA2 A;  2GZO A;  4OI0 A;  4X4V A;  1SV5 B;  4JI0 J;  2VH7 A;  1HD1 A;  3SDE A;  4M95 A;  3NGS A;  3DU5 A;  5HAT A;  4JV5 J;  2MQQ A;  1TMM A;  1OS5 A;  4U6P A;  2UV8 A;  1XNQ F;  1S6P B;  3DYA B;  2BQR A;  2KVI A;  2W9A A;  4JI3 J;  2A3J A;  4U9R A;  1SJR A;  1X5S A;  2CIM A;  2V2Z A;  5D77 A;  1U1M A;  2C3Y A;  4U7C A;  3W9H A;  1AZS A;  4ZIV A;  4FS1 A;  3KJV A;  3K2Y A;  7AT1 B;  4NLG A;  4NLQ A;  3HSG A;  4X65 J;  2ZBI A;  4N41 A;  3GP9 A;  4CLF A;  1TL3 B;  2LU2 A;  5HLF A;  3J7Z T;  2XY6 A;  2W25 A;  3M2U B;  2DPI A;  1U1O A;  2OTL S;  1TVR A;  2GJF A;  2YKN A;  1NSA A;  3W5X A;  1RWP B;  2E1M C;  5GMD A;  2EFP A;  3CCT A;  1S9F A;  1FCA A;  1O5J A;  3V4M A;  4DQI A;  3CDA A;  2ZH7 A;  2FLP A;  1YRU A;  4JI4 F;  1F3V A;  3DLB A;  1NJI T;  4Q2L A;  3ZTS A;  2C3P A;  2IJR A;  5HAN A;  1RT7 B;  2KFN A;  2UUB J;  1BQX A;  4A47 A;  1UAW A;  3T19 A;  3OFH A;  2EFQ A;  4AND A;  2PII A;  3MM7 B;  1RIS A;  4BWM A;  3ZZY A;  2ZH8 A;  3KLI B;  2QLJ B;  3IC1 A;  3VTI A;  5H9E J;  1IN0 A;  5I3U B;  3HSJ A;  1X9W A;  1RP5 A;  2YX4 A;  5L1J A;  4EYH B;  3CO9 A;  1HHQ A;  4OFZ A;  2KU7 A;  4PEO A;  2X1A A;  1S76 D;  3WX4 A;  3E51 A;  1SJ1 A;  2CDR B;  4X4N A;  3J81 U;  1JJ2 R;  1ZM2 A;  3MMC B;  3AXK A;  2W4P A;  4NE9 C;  4V19 X;  1EAY C;  4LF2 A;  2D9P A;  1OMS A;  1GNK A;  1IKV B;  1FRI A;  5L46 A;  5DRK A;  2HIY A;  4JB8 B;  2H54 B;  2FJA B;  4ALZ A;  4JI7 F;  2XMJ A;  3IGN A;  4ED0 A;  1S72 S;  3MMB B;  2IC3 A;  2XO6 A;  3LAN A;  1U0H B;  2FVR A;  3O2I A;  2C2O B;  1HLW A;  4ED6 A;  2YQ3 A;  1RYR A;  4LR8 A;  4RW9 B;  4QWE A;  1FK9 B;  3IGV A;  1FFG B;  3LOU A;  2B9E A;  4MKB A;  3VV2 B;  3OUY A;  3W9I A;  4EFA C;  4B08 A;  4MKV A;  3UW1 A;  4LFC F;  3W8P A;  2X1F A;  3C14 A;  3H42 A;  4WP8 A;  1NZ8 A;  5B0A A;  5EWG A;  4DJB A;  2B4V A;  2BAB A;  1X0F A;  3M2R B;  4M5H A;  3NBP A;  2Y8W A;  3FCW A;  2H5J B;  3P4U B;  2W2N P;  2YWF A;  3QIP A;  1VQN S;  4DR6 F;  2WVF A;  1C4A A;  3DMJ A;  3DRR B;  1Q82 T;  1UPM B;  1VQS A;  3L7U A;  2MMY A;  1HPZ A;  2EKY A;  4JI6 F;  2HND A;  2W9C B;  4IO9 Q;  3OXL A;  1KDN A;  1UW4 A;  3I4P A;  2R9L A;  3MEC B;  5IM0 B;  3ADA C;  4P9S A;  3R1L A;  3MMJ A;  5D8H B;  3CVK A;  1F2H A;  2ROP A;  2VQE F;  4OHV A;  3MAA B;  2V8D A;  3CC4 S;  2CG4 A;  4OJ3 A;  3S7R A;  3BKT A;  1TKZ B;  4CIO A;  2IVY A;  2CVI A;  2AT1 B;  3PIO Q;  2B9W A;  4QIV A;  3FQK A;  1APS A;  2DGX A;  2R8K A;  3QPI A;  4A8S A;  5A8R A;  3W9J A;  1UEV A;  2BE9 B;  3EGV A;  5CH7 B;  3RR7 A;  1KS2 A;  2AD9 A;  4M5N A;  4USM A;  1OY6 A;  1FF2 A;  2AZ3 A;  1ITP A;  2QG9 B;  5JMN A;  2HHS A;  2LLZ A;  2OPP B;  3ZXW A;  3TA1 A;  4ZPC A;  4RUB A;  3C66 A;  1S9G A;  4K4T A;  1RHQ B;  3MHY A;  1QVF R;  1BQN A;  3V5R A;  1DTQ A;  2QGF B;  1GX6 A;  2DHA A;  3H0P A;  1HNX J;  1M5V C;  2QEX S;  2CPD A;  3PKM A;  3IWN C;  3Q8S B;  2NQP A;  3Q24 A;  4LRB A;  4TLR A;  1N5S A;  2BJ8 A;  5DLF A;  1WOO A;  4OZN A;  4QJV A;  3KLE B;  2FJE B;  2J5A A;  2C2N A;  4Y65 A;  4MIA A;  5D6G A;  2R7U A;  3BBC A;  5KFD A;  3I32 A;  4B3M J;  1JLF B;  5DLG A;  2RQK A;  4LVN P;  3HHN B;  5LM7 E;  2G4B A;  2WVB A;  4JI8 F;  3MM9 A;  2CJY B;  4M63 A;  2CWK A;  4Q45 A;  4A8Q A;  2XMV A;  4ES1 A;  1F9H A;  3BV8 A;  3NG8 A;  2DGQ A;  1UWB B;  2ZD1 B;  4QWB A;  2CVE A;  3GTY X;  3D6T B;  2V5H G;  1KN6 A;  4I4B A;  3JXO A;  4LF6 F;  2C3M A;  3MGJ A;  2YVS A;  2GVD A;  1YQH A;  3RTV A;  5ETN A;  3U1N A;  2XMT A;  2OGU A;  4O44 A;  2DO0 A;  4MK7 A;  2XWY A;  1JLC B;  4ZVQ B;  1H2U X;  4MKA A;  5E41 A;  2GML A;  2L48 A;  2DHH A;  1IXK A;  3N9U C;  4DCP B;  3FVY A;  2I5J A;  4GVB B;  1JNR B;  2FC9 A;  3NXZ A;  1M90 T;  1EIY B;  2MGZ B;  4FYX B;  3MED A;  3I4H X;  3UFC X;  4F4K A;  4C8L A;  4WE1 B;  2QA4 G;  3M8R A;  2AEJ A;  2FD2 A;  4TLQ A;  1Q95 G;  1LWE A;  2R42 A;  4A8F A;  4OLO A;  4OYZ A;  1RHM B;  4CLS A;  3M8Z A;  4D3H A;  4DR5 J;  4LF9 J;  3ZNU A;  3E01 A;  1KD1 T;  1VLO A;  4KY3 A;  4ZVG A;  1QDU B;  1TUW A;  3QJJ A;  2DGW A;  1LW2 A;  4F3O A;  2E1P A;  1AUS L;  3KG0 A;  2UV8 G;  2HRU A;  4HI1 A;  3HK2 A;  3CED A;  1F2G A;  1Q1K A;  4OQJ A;  3K5L A;  5E3R A;  1FDD A;  4I2Q A;  4PG6 A;  4NXM J;  1NU4 A;  4DUT A;  2HBY B;  1YJ7 A;  5KT7 A;  2FJB B;  4HDH A;  1RAF B;  4F67 A;  1Y9O A;  1QVG R;  1RWW B;  2L9D A;  4IDK B;  3DOL A;  5AE1 A;  2RRN A;  1QLN A;  1LFP A;  4A8M P;  2ZZN A;  2XY7 A;  4KPC A;  2QLB B;  3GFZ A;  2QL9 B;  1QSS A;  1SQF A;  1N5Y A;  1X4E A;  2F1F A;  5B0F A;  1WHV A;  1NDL A;  2SXL A;  1DAX A;  2BM1 A;  2W4C A;  3VQS A;  3UN3 A;  2XY5 A;  2CNO B;  4NEZ A;  3NS5 A;  2CPI A;  3KDO A;  2UVU A;  5LMN F;  2QO3 A;  4R8U A;  2HS3 A;  4YB6 A;  4NI2 A;  5F8N A;  2NZ4 A;  3V6D A;  2XNR A;  1SBR A;  1CSJ A;  1IKY A;  3D7S B;  3ZTP A;  2FHM A;  1KLN A;  4JV2 A;  2UXD F;  3N79 A;  2R8G A;  2GJI A;  3TQE A;  1K9M T;  4IFV B;  2IA0 A;  1T05 A;  3DRS B;  2MKH A;  3GIK A;  1T02 A;  1PBA A;  1CS4 A;  3MUM P;  1RE1 B;  1LW0 B;  4CH1 A;  4LFB F;  2M52 A;  1CJK A;  1H98 A;  4MK9 A;  4B3S J;  1VQK S;  3AXM A;  2EC0 A;  4UOH A;  3PXG a;  3TVK A;  3I6P A;  2LXU A;  4F04 B;  2HNZ A;  1VIS A;  1B7F A;  2QMX A;  2DKO B;  3CC2 S;  3QLH A;  1O8B A;  1IBM J;  4CLL A;  2DEJ A;  1CJU B;  1RQ0 A;  5CYQ A;  2MQ8 A;  1FVQ A;  3OR2 B;  1VHI A;  2PN6 A;  2HFV A;  3A8J A;  2FHJ A;  5KAK A;  2V4Q A;  1U24 A;  3EZO A;  5LSO A;  1GMU A;  3EPG A;  2H48 B;  4Q8E A;  3J7A N;  3H90 A;  1GEH A;  3HSD A;  1H7W A;  4DN9 A;  1JLE A;  4G1I A;  4WFZ A;  1D8Y A;  4I68 A;  1EP4 A;  2B4O A;  4M5D A;  2UXC F;  4XK8 C;  1S9E B;  1WWH A;  3CIM A;  3C46 A;  4Y2I A;  4LSN A;  3GON A;  4OIX A;  1TL7 A;  1NKC A;  5LXR A;  3GYN A;  1MN9 A;  5ETS A;  1FKP A;  3W61 A;  4L6V 3;  1KQK A;  2R7O A;  2GCF A;  1RHK B;  2LDY A;  5F0W A;  1WEL A;  2HQD A;  2RRA A;  2HHW A;  2DNO A;  3F44 A;  5L39 A;  1HQ2 A;  2JEG A;  5KFW A;  1NJX A;  5SZT A;  1XER A;  4IG0 B;  2XM3 A;  2QA1 A;  2FY1 A;  1YRX A;  3CDE A;  5LJ3 Y;  2WSC C;  1CQM A;  1NBE B;  1SIW B;  3PJW A;  4DV0 F;  2ZM6 J;  4HDG A;  2WOM A;  3CXC R;  1O0P A;  3G9C A;  3RAQ A;  3DLG B;  3EUN A;  3MUT P;  4K2J A;  2GIQ A;  5L8R C;  1NPR A;  4HHH A;  1ZTT A;  1URR A;  2JEI A;  2QRR A;  4U67 Q;  1S49 A;  1O6X A;  2V8G A;  4AFF A;  2OFH X;  2OEJ A;  3B78 A;  5GVQ A;  4OYB A;  3PRB A;  3UCG A;  4DG1 A;  3B54 A;  2CKW A;  1VQ6 S;  2AGQ A;  4UW2 A;  3PO4 A;  1GH8 A;  2YKQ A;  2R7V A;  4B3R F;  2G2Z A;  1X60 A;  3AOA A;  1GMW D;  3V6H A;  1S1V B;  2K1R A;  3QGH A;  5K9F A;  1R0A A;  1TKD A;  5M2P A;  4BC9 A;  4KH0 B;  3DHX A;  1RUS A;  4IUF A;  4ZP8 A;  5H9F K;  2OD6 A;  4CQ1 A;  3MTJ A;  1OY9 A;  3D1H A;  1HBM A;  5I4M A;  3Q8P B;  1F1B B;  4ZJL A;  4J91 A;  2VBX A;  3MOZ A;  2KHC A;  2QIF A;  2J0W A;  2MZS A;  5B0D A;  3D54 A;  4RPF A;  4V1A k;  2ASY A;  5FD1 A;  3MMA B;  1I3O B;  1M1G A;  4C3M A;  2MQO A;  1S1U B;  1UET A;  3D3C J;  3TX0 A;  3QGG A;  1YJV A;  2ZBR A;  1VRT A;  2JLG A;  3A13 A;  4DV5 F;  4CYU B;  2ZWP A;  3MI7 X;  1U48 A;  3CD5 A;  4HT5 A;  3RW7 A;  1UWA A;  2GJ2 A;  2A2D A;  3I55 S;  4AXI A;  2AGO A;  1RYS A;  2UU9 F;  3PZP A;  1S6P A;  3DYA A;  5KFV A;  3PIP Q;  2FPH X;  3D0G E;  2RD5 C;  3ITH B;  5K8O A;  2XS2 A;  3Q2S C;  4Z7C A;  4PXB A;  1DQA A;  1C0T B;  5ETT A;  4GMK A;  4FYW B;  5HAO A;  5E3A A;  4RUA A;  5F8H A;  1LOU A;  3GV7 B;  3GIR A;  2MXY A;  2JZ5 A;  1H6K X;  2UP1 A;  3RRH A;  2OEK A;  1TV6 B;  3PCO B;  1SH3 A;  2BJD A;  3RZA A;  2HRY A;  3ZZU A;  3FEY B;  2XMU A;  2E5J A;  1FXR A;  3CJK B;  4RX6 A;  3H7H B;  3H20 A;  1BY9 A;  4NZ7 A;  1IBL J;  1U6F A;  3M8Q A;  3ILI A;  3M2U A;  3CO0 P;  2HK2 A;  4EMD A;  2OHD A;  5DM7 Q;  4KFB B;  2Q6C A;  2BYC A;  2PT0 A;  2HVE A;  4TU8 A;  4G1P A;  3FJ2 A;  4RW8 B;  3QFW A;  5CZX A;  4I2P A;  4K2X A;  1CJT B;  5AXL A;  2LEP A;  3OL8 A;  1FA0 A;  4LQ9 A;  3K17 A;  3R5B A;  2LQB A;  3ILO A;  3O5T B;  4IG3 A;  3M1V B;  3Q8U A;  3TZW A;  4HT7 A;  4DXL A;  3MM7 A;  3BKU A;  5THW A;  1SC6 A;  2CUY A;  2LA4 A;  5I3U A;  4OI6 A;  1CVJ A;  4OV6 A;  3KLF A;  1B64 A;  1NK9 A;  2MKK A;  4TKT A;  3OBI A;  3MMC A;  2RQ4 A;  3H25 A;  2BE2 B;  3MEE B;  5HQM A;  1LWX A;  5IXU A;  3KTQ A;  1N33 J;  3JTP A;  3EX7 B;  1UJ6 A;  3HT0 A;  3CJ2 A;  2CQD A;  4HEA 9;  3GCX P;  3MMB A;  1PKU A;  4K4Y A;  3PO5 A;  4NLU A;  3L09 A;  3EM1 A;  3A8E A;  5DM6 Q;  1M5H A;  4RW9 A;  3UO0 A;  3OTB A;  5KG7 A;  5FLX Y;  4RW4 B;  3EVM A;  5KT6 A;  1RWK B;  1IBC B;  4XAK A;  3DGP A;  5KG2 A;  2VIH A;  4Q2M A;  1FJC A;  4KO0 B;  1R31 A;  4LSZ B;  2RQC A;  1BUX A;  2V2K A;  4H4O B;  5KFU A;  2R7R A;  1VS3 A;  1PO6 A;  2KYZ A;  2RIL A;  2OPQ B;  2CZ9 A;  1FJG J;  2RUS A;  3DRR A;  2DHS A;  1WKK A;  1CUL B;  3FBF A;  4USU A;  2DNZ A;  2W9C A;  2YNG A;  3C15 A;  3TUZ C;  5HSP A;  4O3S A;  4HKQ A;  4Q5V A;  2AP6 A;  2RQM A;  2HVH A;  3T1H F;  3DXB A;  4BDP A;  3LTO A;  2F40 A;  2AGP A;  3RB6 A;  2ZNZ A;  1SQG A;  4H4K A;  2VIC A;  5GAH U;  4HH0 A;  2KH9 A;  1Q4R A;  2GAG C;  3R2D J;  3MAA A;  3KUH A;  3WIU A;  5DJB A;  5U47 A;  5DG9 A;  3H5S A;  1AXQ A;  4B3T J;  4QPX A;  3NGT A;  4PG8 A;  1TKZ A;  2MQL A;  1JKH B;  4OZ1 A;  2ZZM A;  5HJY A;  4FYD A;  2IM3 A;  4NXN J;  2DIU A;  2EI5 A;  1F9E B;  1X9M A;  2KN4 A;  4K4X A;  1VQ5 S;  2RNE A;  1FEE A;  1TTH B;  4PWD B;  1K1S A;  1L3K A;  2LDI A;  1REV B;  3PX4 A;  4QYZ J;  1Q81 T;  2MKS A;  4DR7 J;  3PEH A;  4RU2 A;  1SL2 A;  2HS0 A;  3T5H A;  1UCN A;  1U02 A;  2ZEJ A;  2LQJ A;  1XMB A;  2LEC A;  4X4U A;  3ZTQ A;  1EQ0 A;  1XR5 A;  2OI2 A;  4DSK A;  5BR8 J;  3UI3 A;  1VRU B;  3O6Q A;  4ECZ A;  4DFP A;  3C8Y A;  1N5T A;  1YJN S;  3NEK A;  3WC2 A;  3KJN B;  1Q78 A;  5CAA A;  2OJ3 A;  2RHQ B;  1X7V A;  3CME S;  3IS9 B;  5KFA A;  4DWI A;  1XNR J;  1BMQ B;  5J2Q B;  3GLJ A;  4KGZ B;  2ZKT A;  2KDO A;  3WIV A;  1JLF A;  1UEK A;  3T6J A;  2HHX A;  4W98 A;  1ZYQ A;  2ROG A;  4OV1 A;  3N6N A;  1S77 D;  1RBA A;  3IFE A;  2IMO A;  2BVZ A;  2NRE A;  1NPK A;  1HMV B;  2O3D A;  1J5O A;  4P73 A;  3N4W A;  1C1C B;  3HO1 A;  2ZD1 A;  1FWL A;  1XQI A;  4A8O A;  2QV6 A;  4CH0 S;  4KH1 B;  3AQP A;  1C2P A;  3KHL A;  2CYY A;  1SVD A;  4KC5 A;  1JX4 A;  1JLC A;  5FLX U;  3J81 j;  3VAI A;  3NCR A;  2DH7 A;  4JI2 F;  1RGV A;  1VQM S;  1E6Y B;  2V4J B;  3N5F A;  2AJQ A;  2FTR A;  3M6U A;  4UTG A;  3QSI A;  4RLE A;  1IM6 A;  4NCB A;  1H2T Z;  2XLK A;  4ZP9 A;  4WE1 A;  2XS7 A;  1XIQ A;  2W8K A;  4WTY A;  2QLX A;  3MR3 A;  3KJF B;  2I9S A;  3BR8 A;  4LFB J;  2YNI B;  3BDE A;  4I0W A;  1N0U A;  3SSQ A;  1HWU A;  1Z1Z A;  1B70 B;  2XS5 A;  2ZKU A;  5DZ7 A;  1MWY A;  1QE1 B;  4WKY A;  2Z4P A;  3MEG B;  4XPC A;  3TJ8 A;  3THP A;  2MJU A;  4KIA A;  4ZMM A;  3L95 X;  1KTV A;  2IRY A;  3NNH A;  3DI6 B;  2BR0 A;  1LFW A;  3C6U B;  4DLG A;  3GCW P;  2FLL A;  3JAM Y;  2Z30 B;  2D69 A;  1LWC B;  4BLG A;  3SQO P;  2YH1 A;  2FB0 A;  4LF8 F;  3KOA A;  2IPO B;  2AKW B;  2YX1 A;  1S7I A;  2MSS A;  5C24 B;  3K5N A;  1SKU B;  1MW7 A;  2CFX A;  3KK3 A;  2LU1 A;  1KHW A;  3MM6 A;  4P2F A;  1DY3 A;  1S1W B;  2ZOM A;  4K0K F;  1Q79 A;  1D0E A;  2KT3 A;  2FHO B;  4OYO A;  3JSM A;  4OHZ A;  2EVZ A;  4QR2 A;  1S1X B;  5E3Q A;  2Z58 B;  1BHN A;  4J9Q A;  4NYO A;  4NML A;  4IFV A;  5HMX A;  2YNH B;  2MEW A;  5KT2 A;  1RAD B;  3SEO A;  3MCN A;  3TW0 A;  1RWM B;  4WTO B;  1KVK A;  3DRP B;  2E29 A;  2CNL B;  2DRB A;  3FBC A;  4QR0 A;  1U0S A;  1YJU A;  4HAC A;  4MYU A;  4Y0F A;  2XSJ B;  4FF1 A;  1UJ4 A;  2XI2 A;  4K50 A;  1SH2 A;  1VDH A;  3GFY A;  3I5A A;  3Q22 A;  4B9V A;  4YME A;  3MUV P;  3VAH A;  3PFO A;  4N56 A;  2OPR B;  1FJE B;  3PM9 A;  4YY3 F;  2ATC B;  5KT5 A;  2RUG A;  2E5G A;  3R8Y A;  2MYF A;  1TAQ A;  4ZOS A;  2PGC A;  1UP1 A;  3KUE A;  1PBU A;  5HRO B;  5DQI A;  1C0U B;  3RBE A;  1CJU A;  4Y2K A;  3OR2 A;  4ED4 A;  4CH7 A;  2ZHO A;  2BRK A;  5IQQ A;  1CC8 A;  1NRK A;  1SCJ B;  3IBF B;  4PQU B;  3SCJ E;  3Q2T C;  3AY0 A;  4F4W A;  3OJU A;  1Q86 T;  1N6Q A;  4P2X A;  1WD6 A;  2B7C B;  1S9E A;  1WDD A;  2GVZ A;  1ZM3 A;  2VFR A;  5HO4 A;  4RNO A;  2KT2 A;  3EWG A;  4WII A;  2KTQ A;  4C3L A;  2GX8 A;  5EX3 A;  2IVF B;  2QJ3 A;  1SIZ A;  4C2M A;  4ZHR B;  2PEB A;  2X3D A;  3MFI A;  3V81 B;  3SXL A;  3FCH A;  4DV6 F;  2QA4 S;  4GKJ J;  1VMB A;  1EB0 A;  2H9Z A;  4FZV A;  4XIU A;  5M2U A;  1MML A;  2L9W A;  3QJP A;  4FP9 A;  2XQC A;  3HHL B;  3OR1 A;  3I56 S;  2MB0 B;  4N8N A;  4IG0 A;  4DV5 J;  4OI3 A;  5D3G B;  2FVS A;  1ZA2 B;  3JQJ A;  4HI2 A;  2GQ2 A;  1JMT A;  1FRK A;  3HHE A;  3I0R B;  3OFE A;  5B0G A;  1NND A;  1AB8 A;  1EKS A;  3BJY A;  4Z7Y A;  2HQG A;  3I82 A;  5D78 A;  5LL6 d;  1WEX A;  4R5P A;  1RHU B;  2Y0B B;  4JI5 F;  2P8I A;  4OYI A;  2FQQ B;  4DPW A;  1U1P A;  5BYR A;  4M5G A;  4X2B A;  3JAM U;  2CPF A;  3R5A A;  4CLZ A;  1FTC A;  4LBI A;  5A76 A;  1DZ5 A;  4O4G B;  1YBT A;  2DJW A;  1Q8L A;  4Y28 C;  1FD2 A;  3PYD A;  3US5 A;  4YDX A;  1VQO S;  4ZCK A;  4ZVH A;  3EZ5 A;  1IUJ A;  2D7S A;  4ZVF A;  4ELV A;  4IOC Q;  5IFM A;  3BGR B;  4CLK A;  3QZ7 A;  4C3K A;  3MPW A;  2MLZ A;  4FF2 A;  2YKM B;  3ELH A;  2XNQ A;  2R7Q A;  3BF4 A;  2AV5 A;  1FES A;  1M5P C;  1S5Z A;  3D68 A;  5HVH A;  3DOK B;  4J9S A;  4FPR A;  1X4D A;  1X5O A;  4HLB A;  2X7I A;  1CC7 A;  1RJJ A;  4J9M A;  3CCV S;  3MMA A;  4F4Y A;  2BOP A;  4OI1 A;  4DEZ A;  2WB4 A;  5F8M A;  1S1U A;  1MU2 B;  1REG X;  4DPY A;  2M88 A;  2BUN A;  5IS2 A;  3C6T B;  2BDP A;  1NSQ A;  2LQ9 A;  4ICL B;  4CYU A;  5DZ6 A;  3DLK A;  3ISN C;  1F9F A;  4JYA F;  1TU0 B;  4RBT A;  3ITH A;  2XTJ P;  3JB9 k;  2DIS A;  3LQV A;  4QWC A;  2FUG 9;  4DQR A;  2HQF A;  1C0T A;  2NXN A;  4F02 A;  4ZPW R;  1A0O B;  2V6A A;  1SJQ A;  5K14 B;  2XGQ A;  3W8G A;  4JV5 F;  4TYA A;  1E6V A;  1UVI A;  2CAD A;  1TV6 A;  2JJ4 D;  2KM8 C;  4YR2 A;  1WUU A;  3HFV A;  2RT3 A;  3AOB A;  3ENQ A;  4JI3 F;  5F8L A;  4LMZ A;  2NZC A;  1NDC A;  1RAC B;  4Y2M A;  3HFK A;  4I56 A;  2UVR A;  2OPS B;  4RBU A;  4KFB A;  1GMV A;  3BYR A;  4X65 F;  4RJV A;  4RW8 A;  1W26 A;  3PX0 A;  2ZH4 A;  2UXB J;  1CJT A;  3IRX B;  3M4X A;  4LRE A;  4KGV B;  3V4I B;  2MKJ A;  2QMW A;  1RHR B;  2KT5 A;  2W9B B;  4URG A;  1YLX A;  2ADC A;  1BQM A;  4ED3 A;  4ES2 A;  2M3D A;  4NLV A;  4UY8 5;  5J1P A;  2YWW A;  3M1V A;  4O3N A;  3HMJ G;  3OL9 A;  2Y3Y A;  1MWQ A;  3IRW P;  1JNZ B;  2NYH A;  3FSI A;  5L9X A;  3JTN A;  3PJ9 A;  2BJ7 A;  3K5P A;  5F8I A;  2ZVI A;  3QZ8 A;  3FRZ A;  3MR6 A;  4KBI A;  1F5C A;  3T1Y J;  2KVQ E;  5LOQ A;  1F3F A;  3G8Q A;  4J9K A;  1FWP A;  1MLA A;  3NKY A;  3HF5 A;  3KLG B;  5ETQ A;  3M30 B;  3BEG B;  5DDO C;  4NYZ A;  2HVI A;  2UUB F;  1RTD B;  1HYS B;  2AX0 A;  2RB7 A;  2DGS A;  5KG0 A;  2GIR A;  3TAM B;  2W7A A;  4URS A;  5DGA A;  2BE2 A;  1M0S A;  2V63 A;  3MEE A;  4P7T A;  4DN0 A;  1PYO B;  3SI8 A;  2EC2 A;  1T03 A;  1K44 A;  2W2M P;  2ZZT A;  1P1T A;  1AT1 B;  3A4T A;  4DV1 J;  3PFE A;  2DXD A;  3H40 A;  1D3W A;  1MRO B;  2RF2 B;  1IR2 A;  1HQU A;  4RBV A;  1PAE X;  3IG1 B;  4G1Q A;  3GR1 A;  2HWT A;  1FDB A;  2KG0 A;  4Y3C A;  5J1N A;  3Q86 A;  4WFA Q;  2KM8 B;  2WBM A;  4RW4 A;  1SJ3 P;  1T7P A;  1UZD A;  3NGD A;  3MM8 B;  4ILL A;  1WKL A;  4C7Q A;  1NXI A;  4KO0 A;  2UVW A;  4OJG A;  4CLY A;  3OTO F;  4UOF A;  4U8Y A;  5KG4 A;  4H4O A;  1FTR A;  2E1R A;  2MHN A;  4F26 A;  2J6T A;  3A8K A;  3MD3 A;  1FFW B;  4DZD A;  1VBZ A;  4OX6 A;  4FKY A;  1YDL A;  3AFG A;  2CQ4 A;  2J9C A;  1CUL A;  2YTC A;  3D2W A;  2OO4 A;  1HNW J;  4MMO A;  4YB1 P;  3PY8 A;  5JUM A;  4DCJ B;  4PWU A;  2KZM A;  2HIQ A;  3GG1 A;  2X1B A;  4LF7 J;  1N5Q A;  4GKK J;  2BQU A;  1NLK L;  3HHK A;  1UTA A;  3ZZR A;  4QU7 A;  1H38 A;  3NWR A;  3HHD A;  3QRR A;  6FDR A;  1VIX A;  2K3K A;  4Y00 A;  1HBU A;  3CJ4 A;  2ZJP Q;  1JKH A;  3W64 A;  3LAL A;  1URN A;  4FPI A;  1WOR A;  1ROF A;  3JSR A;  3M9N B;  2ZUA A;  3LO3 A;  1UFL A;  1I1G A;  4YR0 A;  1ICE B;  3PKY A;  4P2S A;  4DL3 A;  1GXT A;  1RK8 A;  1OSC A;  1ELO A;  3AA8 A;  2MLY A;  3EVO A;  3JSY A;  4PWD A;  3TAR A;  2HGN A;  2GAH C;  1OSD A;  3HVR A;  3LP2 B;  2BA9 A;  4MH8 A;  3UCU P;  3SFU A;  4RUH A;  1FWK A;  1FNO A;  4EBD A;  1ZA1 B;  2PD1 A;  3KG4 A;  1XJW B;  2DB1 A;  3DN9 A;  1JLA B;  1EET B;  3BSA A;  3NAI A;  1QY7 A;  4ZPA A;  2Z8Q A;  4I67 A;  3Q8R B;  2HZC A;  4PYD A;  2LXI A;  3D4J A;  4RNM A;  2ZDO A;  2KFZ A;  3QSY B;  2HLT A;  4JBC A;  2HBQ B;  1RAB B;  3ZZO A;  1RSC A;  5F3T A;  4BHQ A;  2A18 A;  3TZX A;  3DDN A;  2MKY A;  4MIW A;  1HNX F;  3VVT A;  4B9U A;  5J2Q A;  1HBO B;  4DI6 A;  1RB0 A;  4EI2 A;  1BC6 A;  1RTI B;  3DM2 B;  4BWJ A;  2WON B;  3CDW A;  1D9F A;  2VPZ B;  2ZC3 A;  1NAQ A;  3VZH A;  4CO1 A;  3QFH A;  4WFX A;  3TO8 A;  1UA1 A;  3VGT A;  4MTP A;  3F73 A;  2ZBQ A;  2JHE A;  2J6S A;  3BSC A;  5HQL A;  1HMV A;  5A2Q Y;  2IDE A;  3THV A; 
#chains in the Genus database with same CATH homology
 2BJ3 A;  3BKT A;  2Y3Y A;  2NZC A;  2WVD A;  2WVF A;  3BKF A;  2FGC A;  2CA9 A;  1Q5V A;  2BJ7 A;  3OD2 A;  3LGH A;  2CAD A;  3BKU A;  2WVC A;  2BJ8 A;  2HZA A;  2PC6 A;  3PHT A;  1Q5Y A;  2BJ1 A;  2HZV A;  2WVB A;  2CAJ A;  2BJ9 A;  2F1F A;  3QSI A;  2WVE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...