3BKFA

Zinc-bound c-terminal domain of nikr
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
83
structure length
66
Chain Sequence
b'GTQGFAVLSYVYEHDLSVATLHVHINHDDCLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nickel-responsive regulator
publication title Structural Basis of the Metal Specificity for Nickel Regulatory Protein NikR.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 15
structure length 66
sequence length 83
ec nomenclature
pdb deposition date 2007-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 3bkfA00
2CA9A 2HZAA 2BJ7A 2F1FA 3LGHA 2BJ8A 2CADA 2Y3YA 2WVBA 2BJ1A 2BJ9A 1Q5VA 2FGCA 2NZCA 3BKUA 2WVCA 2PC6A 3QSIA 3BKFA 3OD2A 3PHTA 2CAJA 3BKTA 1Q5YA 2HZVA 2WVEA 2BJ3A 2WVFA 2WVDA
chains in the Genus database with same CATH superfamily
3CO0P 3G87A 5E3CA 5SZTA 4NYOA 1MU2B 1G7CB 4DR4J 4EBCA 3ZXWA 3M32B 2CPIA 4LBHA 2YNIB 1HA1A 3DU5A 1YBTA 4ZP6A 2ZH5A 2EFGA 3KK3A 3P3DA 1W25A 5KG6A 2CPJA 3OTCA 4GVLA 1PAUB 3H0PA 2HS0A 3D54A 5B0BA 2MHNA 1RT2A 2QA4S 4QOTA 1MN7A 3CJQA 4WTOB 2I8EA 2HEKA 3FMWA 3V6JA 5E33A 5CXTA 3OJUA 1DQ9A 1VBYA 3KMSA 1B4SA 3P49B 3N5BA 3OLBA 4KRWA 2X1GA 1RAJA 3GR0A 3VGVA 1N52B 3MEDB 1U1KA 2BZ2A 2VG6B 2GZOA 4UY85 1QSYA 1REVA 1W2BR 2GHPA 5CD4A 1IBLF 4M5LA 1MWQA 3VV2B 1BWEA 1RWUA 4B9UA 4G1PA 3D68A 2D69A 4A48A 3DOKB 3A8IA 1GNKA 2A0FB 5GAHI 1IBLJ 1UVNA 1JX4A 3LGHA 1HQUB 3T5HA 2FQQB 2HNZA 4USHA 3MMAA 3ZTSA 4DF4A 4DR6F 1ZTTA 4KH1B 2JX2A 2MSTA 2IJNA 4OFZA 5IV4A 3QT7A 1VRTB 4A47A 3NP5A 3EGZA 2F1FA 1ZBTA 1U1RA 4DR6J 2NREA 3TQEA 3CB4A 2ASYA 1NZAA 1S0VA 1Q86T 4HH0A 3V6DA 9ATCB 2Z4PA 2C2KB 3R5AA 1KHWA 1OYDA 4IKAA 1D8YA 3HHNB 1GH8A 4USVA 3Q2TC 4CWBA 3EVWA 3BR9A 4ZVHA 3TA2A 3Q8VA 2JFDA 4UUWA 3ADAC 2XTJP 4KPCA 3G2XA 3EDQB 3DLGB 2W4DA 3ISND 1KLMA 4R8UB 3UPFA 2WSEC 2VICA 4HVZA 2CZ9A 1R0AA 2X51A 3U27A 1Z2ZA 4DV0F 3AOBA 3PRVA 4PWWA 4J9UE 2KH9A 1E6VB 2VF3A 3MOZA 3MPWA 3VR1A 4ID8A 3AHPA 1HBOB 1I3OB 2FJEB 4DV0J 1YX2A 5FLXU 5B0CA 3AA9A 3CJ8A 1B70B 3F0NA 4NLYA 4U95A 4ZVRB 3DYAB 3RAXA 1XMBA 3FCWA 4NMXA 4DX8H 3NCQA 2MJUA 1ZA1B 2JEGA 1WKKA 1RT1B 1RAGB 2BJ3A 5KFNA 1AW0A 3D2WA 1GMVA 1F5BA 4DG1B 3TAMB 1R0CB 2ZD1A 1DQ8A 1SJQA 1VQLS 4F3MA 2DNRA 2E1MC 1K1QA 1FDAA 2ABYA 2R8GA 3RZAA 4J37A 2V69A 4J9OA 2PO4A 5KFKA 4LBPA 1S4FA 1LFPA 1NK7A 4R5PA 2D9PA 2R7QA 1F60B 2DR6A 1SH3A 1YLXA 5DDQC 2ERRA 3HFKA 1SVDA 3CCRS 4R0JA 9RUBA 1FXLA 2DR9A 1DTTB 5IC6B 1LWFA 1IKXB 2MYFA 2WK4A 1AZSA 2CIMA 4ZVPB 3KWMA 1FRIA 5LT5A 2ALYB 5A8WB 2DVIA 2LEAA 3I9V9 1L3SA 1JJ4A 3JTOA 5F41A 4WF9Q 4WFYA 1U2CA 3PX0A 2NPIA 2N7CA 3Q8RB 4MIWA 2OPSB 1LWCB 4QCLA 1PJ6A 1WF2A 4K4YA 5ETMA 1RU1A 3D0GE 3RRKA 3EVOA 3QRPA 4ZVEA 2GIFA 2GIRA 3MURP 3EMTA 3BN7A 3PW7A 3RBXA 2O5DA 3MCNA 1C4AA 5AE1A 4KV8A 2M8DB 2VIHA 4GMKA 4Z2XA 3DOMA 1QAXA 2QLXA 4DPYA 2XY6A 2XS5A 1UKUA 3MUMP 5HLFB 1RTDA 1N5QA 1RWWB 1PG5B 4HDGA 4CLPA 2JJ4D 2L9DA 1SJ3P 2QA1A 3QGGA 1ZS6A 4LRDA 2O1PA 5CCLA 1RT6B 4R0EA 3BGRA 2W8KA 4NXNF 2O66A 3G8SA 4FF2A 1HPZA 1MLAA 2C3UA 4ES1A 2RF2B 2JNJA 1W26A 4FF1A 2ZBPA 3DDKA 2OPPA 1IJEB 4DSEA 4NXNJ 2HBQB 1HARA 1LQ9A 3V81B 3TZZA 3OUYB 1RCOB 3CE8A 1U45A 1UZDA 4F36A 2OEKA 2K1RA 2VZ9A 2RJZA 3MAHA 2KHDA 2J76E 4E2FB 2N4DA 5K8OA 4ECXA 2DK2A 1OYEA 1RWXB 2OPRB 3BO4A 5KT2A 3R3TA 4DPXA 2KL8A 3PW4A 2VDHA 4DCJB 4J9KA 1O5JA 4XPCA 4DPWA 1TL4A 2Z2ZA 4B3OA 4DUTA 1NDPA 2QMXA 4MKVA 2KZZA 3PXGa 2R7TA 3TZXA 4ENOA 2HLTA 5EN1A 5ETNA 4Z7YA 1LV5A 3DKDA 2DIVA 1P6TA 4A46A 1S77D 4QWEA 3DRRB 3UD4P 2NPFA 2J0SD 1IWGA 1SQGA 2C28A 4KO0A 2XMKA 4DPTA 2P2CB 2P9GA 1JQGA 5KFWA 2ZH7A 1U24A 4JV1A 3EGVA 5GAHU 1U09A 1LW2A 4NZ6A 3KJVA 5KG5A 4DR2F 1B7FA 5L1IA 5HQMA 2G2YA 3CEDA 1UJ6A 4DSIA 1GXTA 1LNQA 1TKTA 2CJ9A 3PW0A 2ZBRA 4DR2J 3BR8A 5L9XA 4M5DB 2GQ2A 5LJ5Y 1CQMA 3TEHB 4C8ZA 3M7VA 2PMZD 1DLOA 2HQ3A 4L6V3 4YOEA 1WOSA 2VU5A 2BDPA 4X4VA 2BE2B 3J80Y 4ZHRA 3QSYB 1Q7LB 3QSIA 1WEXA 2PGCA 5LL6d 2BXJA 3K5PA 2R7XA 4GO5X 4LRCA 1Y3JA 1WEYA 1D1UA 4WKYA 3A3OB 3ZTQA 4F50A 4P2XA 5IC4B 4FXVA 5AXLA 3UCUP 4CLKA 2OSRA 4DEZA 4AUKA 3DI6B 2H54B 1B7YB 1BY9A 1FNMA 3MM9B 4DN9A 1ZPVA 1R8PA 3FMBA 4ZIVA 4N76A 2C2OB 4K4WA 2DGVA 4TQSA 1RWKB 1TQLA 2XZDB 1GX6A 3ILLA 4ZMMA 3SCLE 1RTZA 2ZVSA 4WZQA 1BGXT 2GA7A 2X7IA 1RQ0A 1NLKL 5J1PA 3WC2A 3KTQA 1VQ6S 3RB0A 3FNNA 3PYDA 1U8WA 2DTJA 3G6ES 2R2UA 3HCXA 4FBTA 3OQ2A 5KFJA 4WPAA 4W92B 1BQNA 2B7CB 2VKZG 2HVEA 4A8FA 4PG4A 3H40A 3NG8A 5DDRC 1RKJA 4RNFA 3LOUA 4DSJA 4DL3A 4O3RA 4ZITA 2CPZA 3DGPA 1RAEB 2RQ4A 3ZC4A 3E01A 4KHMA 2DPJA 1OY6A 4CLZA 2ZOGA 2AYBA 2ZITA 1S12A 3NKYA 4RO0A 1JKHB 1VLYA 5DQGA 4B9SA 5IWAF 2A18A 3E8OA 2R7UA 3UD3P 1VHIA 4WP3A 1TTHB 1UAWA 1WC4A 1FKOB 2MKYA 1VR6A 2XLKA 3BKTA 3OJSA 2CQ4A 4WYWA 5F8IA 5IWAJ 3K5MA 3D6FB 4EZ6A 3R7NB 5FD1A 1I6JA 1N5VA 3M8QA 2UVUA 3WZ0A 2WSCC 3AT1B 1XEZA 3UNYA 5EWFA 1RTIA 2F9DA 2G2ZA 5KAKA 2QYGA 2W7AA 3VCDA 4ZPBA 3AJDA 2U2FA 4IR1A 2JSXA 3HKWA 4M63A 1S9GB 1QLNA 2KJWA 1C1BB 1YGYA 4I67A 5LMNF 1IVZA 1NSPA 1Y10A 4URGA 3TUPA 4U9RA 1S1VA 1S6QB 4TYBA 1UWBA 3HHLA 4PXDA 3W9JA 1RA7A 3SIPB 5F0UA 5LMNJ 5K14A 4FYWB 3CCQS 4ZVSB 2SXLA 3GZ7A 5CYMB 1OS5A 4WXWA 5LXRA 3FVYA 5C42A 1RT4B 4J9LA 3NGKA 1PBUA 4U7UK 1VQ9S 1SB6A 3QRRA 2EVZA 2A2CA 3GG0A 1S7HA 2HQFA 1VLOA 5GMEA 1NCLA 1RK8A 4I4BA 4RW7B 5A8KB 4MFBA 5C2CA 1T05B 3E3XA 4J91A 1U1NA 2E5IA 5HP1B 2EK1A 3KKFA 4CI0B 2DGWA 2GJ2A 1XTZA 3TO8A 1J5EF 1VQYA 2ADCA 1R6VA 1E6YA 3EGWB 3M9NB 4F4ZA 2XG8A 2LKZA 3QO9A 2PDAA 1UZHA 1J5EJ 3JTPA 5L1JA 3T6JA 2J7WA 5EGYA 4RJVA 1V6HA 1EP4A 4OJHA 4C48A 4Q0BA 2EG1A 2IVFB 4BCAA 3UCZP 4P10A 2KM8C 4M5IA 3I5BA 3EE3A 4ED1A 3WX4A 2AGQA 4PYDA 4K50A 3MEEB 1MWZA 1PO6A 2FVSA 1Q8KA 4P71A 4XDCA 4IDKA 3GV5B 2M4MA 4IG0B 5IT9U 1RHRB 5DM6Q 2A6OA 2WB1D 3X1LB 4YQWA 2UVVA 5KOXA 2R4FA 3KK1B 1YJUA 2HGNA 4CTAB 2ZBQA 4NEYA 2IPOB 3R9LA 1FVQA 1RAHB 1TL7B 3P96A 1SUQA 4L72B 2XGQA 2NZCA 2M70A 2HAIA 2G0IA 4WU2A 2H9ZA 5GMDA 3FSXA 1VRUA 2WW4A 1Y4ZB 3KHGA 4JUZA 4EEYA 1XWLA 5IM0B 2PD1A 5AXKA 3SV4A 1JLAB 2NSCA 2WBRA 1HYSB 4LSZB 3NAIA 3KJFB 3MZIA 1ZM9A 2DRBA 1DARA 2VL1A 2FJXA 2ROGA 2FJBB 1VRQC 1T9YA 4OZ0A 3GYXB 2FVRA 1YDLA 5C25A 1IN0A 2MZ1A 5AE2A 4CO2A 4QU7A 1FNXH 3J81Y 3KJQB 5D15A 2HBZB 3UDEA 1KFDA 2QN6B 4XK8C 1TMMA 5FDLA 4I2QA 2PFFB 1FE0A 3M4XA 1W7WA 4ZN1A 2YKMA 4R8UA 3MR6A 5C7PA 1TL3B 3RU0A 4A8QA 1YRXA 4NRUA 3PR4A 3HO1A 5LOQA 2NYHA 1SKRA 1K44A 1WI6A 4L75A 2VG7A 4KC5A 2KO1A 1EZZB 1N36F 4IH6A 6FDRA 3GMGA 3AD8C 4A8WA 1KKHA 3H2UB 2VQFF 1IQZA 4HTIA 4TXSA 4Q2MA 3W5XA 3CWJA 3ZZ0A 1C0TB 1SV5B 2EKYA 2OMOA 1N36J 3F56A 3QT8A 3EZUA 3VHQA 1R31A 3G96A 2VQFJ 2VBXA 2G1HA 2FJAB 3DM2A 1ICEB 3C14A 3LAMA 3M1VB 3J7YU 3PZPA 3BDEA 3AQOA 4QZVB 1NK4A 4X4SA 1TKDA 5HAOA 2RDJA 3FSYA 2UXDF 5CHCB 3UE2A 3GIMA 4GKKF 4PABA 2WVCA 1J5OB 2W25A 2MQLA 4OZJA 4EI2A 1CJTB 4OYBA 1K73T 1IBMF 5E3PA 4YS2A 5A2QY 2UXDJ 3BO3A 1R8CA 1UEVA 5D4NA 1VBXA 4GKKJ 2VASA 1VBKA 1H7XA 3OTOF 4KKOA 1N5SA 1IBMJ 3FJ2A 5D6GA 4RZRA 3CDUA 2PFDA 2FZKB 4MH8A 3Q22A 4ICLB 3OTOJ 1N6QB 3KK2B 1NSAA 3MECB 4U7UD 5DDOC 3IAS9 1U1MA 2QMWA 2HK3A 5CA5A 1ZPWX 1FFWB 2DNPA 1N0UA 4YHHF 2DCUB 2XMAA 2CG8A 1X5SA 2EW9A 3O8WA 2AEMA 2CZ4A 1G1XA 4ZS6A 2VOPA 4H4KA 2YNFA 3GU0A 4YHHJ 5KFRA 3H7HB 4O3NA 5GADI 2MMYA 2OPSA 1LWCA 3FGVA 2W8LA 3BPSP 3ZTRA 2Q66A 1IBCB 2AF6A 1FX4A 2CPEA 3VZHA 1CQNA 1HBUB 1S9EA 3AOCA 4K4XA 3U02A 1R89A 4C8MA 4FKXA 5A76A 3KLEB 1T9XA 1TUGB 5KT5A 4TVAB 4USUA 4EBDA 5CZVA 1KDNA 4N56A 5KFBA 2V4QA 1YJRA 3QT6A 3QLHA 1Q8BA 4PXCA 2XULA 3A4TA 4L76A 3NGSA 1LK7A 2LLZA 4RPFA 3CD5A 4DF8A 4O3QA 1WG4A 2VG5A 2CPXA 1S1XA 1SCJB 2K3IA 4CDIA 1FWPA 2EFVA 3T6BA 3IP0A 1FEEA 1X4DA 4JV0A 2RRNA 3K58A 1UP1A 1Q4RA 2F8MA 4JI3F 1K0TA 3ZFVA 3R5BA 1KRPA 1QD1A 1N34F 2DXFA 2DNZA 3TUJC 3HSDA 2BACA 2MZJA 2J6UA 1TKZB 2QEXS 4ER8A 4JI3J 2RKIB 4OZ5A 3HZEA 4P6QA 1N34J 1RSCA 2PA3A 3IRXA 2CWKA 2GC8A 1OY8A 1UTAA 2E5GA 2GVDB 2XLJA 4LREA 2VD3A 1IM4A 4ED8A 2YKQA 4N8OA 3NAHA 5G4DA 2A3JA 3R7BB 3TNVA 4WBFA 2NZ4A 4S0MA 4K0KF 1RHKB 2DXEA 3EPIA 2HFVA 3JAMU 4C97A 4RW4B 2UU9F 1SC6A 2KZMA 1NU4A 4TU8A 1H73A 3I5AA 4K0KJ 2Q6CA 1T11A 4DL7A 4NYZA 3T1HJ 1Q81T 2UU9J 1T9VA 3DLKB 3FK4A 1S0OA 4ZPAA 2RHQB 4USKA 2Y1IA 1HHTP 1HI1A 1HKAA 4K7QA 2R42A 3D6MB 1NNDA 2BM1A 3DMJB 3M2RB 2WVEA 3SQGA 1R3NA 1DZ5A 2HRTA 2ROPA 2DH7A 1T02A 3R6LB 3VAHA 1U4BA 2ZJQQ 3G82A 1CG2A 4EO6A 3HI9A 1V5VA 4RL1A 3FQKA 4HEA9 1NK9A 2B8QA 4OHVA 3UCGA 1DQAA 3NMRA 2F3JA 5IZHA 3L9ZA 2FDNA 2YX4A 1Q7YT 1RAFB 3T5JA 3MR7A 4Q7AA 3UVJA 1Z2LA 1HL6A 4ZN3A 4IOAQ 2FGCA 2MKJA 4K5SA 4CLTA 4DUZF 3LPYA 4F4YA 4JB8B 2V8VA 3FKBA 5H1SV 4U6PA 2ZZTA 4OX7A 5LM7E 1FRMA 4BC9A 3CNQP 4WYLA 2UV8A 2HBRB 4ED6A 2V6AA 1GMWA 4I6YA 4DUZJ 2B4VA 2EG2A 2XHCA 1EQ0A 3TUZC 4LT6A 3RW7A 5CCMA 1R6YA 2LYVA 1BQMB 5A0YA 3MF5A 3HVTB 2IJFA 2C2EA 3OT9A 3C3LA 3QZ8A 2ZUAA 1VK8A 5KT4A 3W63A 3DLLQ 2XWYA 4NCGB 3FCVA 1BLUA 3VAIA 5B0FA 2HGMA 2HNYB 1UW9A 2HGLA 3CMAS 5KFVA 4ZCKA 4KR0B 2ZDOA 1QM9A 2V9WA 3Q2SC 4PG6A 2JH3A 1RAAB 4F3QA 3LP2A 2G13A 1LW0B 2MY7A 4NLSA 1F5AA 3BJYA 4P72A 3MM6A 1VQSA 3AD9C 4NI2B 1NMEB 2PN6A 1EIYB 3GP9A 4CT8A 2ZWOA 3CMES 2J0QD 2EK6A 1QE1A 3OR2A 4Q2LA 3TYTA 3VVTA 4KPYA 2D7SA 5CZXA 4V19J 4OJ1A 3PHTA 1KN6A 4OYOA 2LDYA 4DL2A 8RUCA 1W2IA 4QWBA 3TZWA 4URSA 2B0GA 4DCPB 4B3MF 2ZE2B 1CBKA 2BABA 3NWGA 2L9NA 1RTHA 5L8RC 2BOAA 3GTYX 3KFWX 4B3MJ 2MGZB 3C6TA 2OTLS 2PEHA 3IBFB 1TL1A 4DZ6A 3JXOA 4C8OA 4YB6A 4MKYA 3BO2A 5F9LA 4H4MA 4U96A 3LALA 1RT3A 2IC3A 2E44A 2JC0A 2HQDA 1SIZA 2CAJA 5F3ZA 1NJWA 4IUFA 1HW8A 2YH0A 1WC5A 2XCPA 2OEJA 3KK3B 2D3O1 1S1UA 1IR0A 2Y1RI 1NK0A 1RT2B 4OIXA 3ILJA 1VI7A 1FD2A 3QGPA 5KFEA 2PSZA 4YP3A 1S6QA 2FZGB 1RBOB 4C8NA 3OR1A 3FFIA 3M2VA 3PV8A 3W5ZA 5GADU 3AJ2A 1RYRA 1HWUA 2QTWA 1XR7A 2MKIA 4IOBA 4J9NA 1FK9A 3NCRA 2FHJA 2R7RA 1S79A 2D74B 3A3NB 2C3OA 4OI2A 1KVIA 5ETVA 3WIUA 1SL2A 2LEPA 1N5YA 1JIHA 4CP5A 1SKUB 1Q78A 4HI2A 2F8HA 2K06A 3MAAA 4WIQA 4ELVA 3PO5A 4KTQA 1KQGB 4P7TA 3D3BJ 3RBZA 1OWXA 1SJFA 3CD0A 5HP1A 4IG3A 4FN5A 1HHSA 1RBLA 4IRCA 3MMAB 2FHMA 3UO0A 3HD1A 3SEOA 1IJFB 1UFLA 2CQCA 2NXUA 4FYYB 2XNRA 1RT7A 1VIOA 2J9EA 2J0XA 2EBGA 1WACA 1M5VC 1H6KX 3ENVA 1YJNS 4P52A 2WSFC 2RSQA 1WSRA 2DHHA 4YFUA 1RT5A 4DU8A 3FSIA 3V6DB 4BWMA 3CCJS 4LF1A 3CC4S 4ZOSA 1VK3A 2VPXB 3QWUA 3VVUA 4ECSA 3HD2A 3IM8A 2FD2A 2PEBA 2RAQA 2DEIA 1NKCA 4PCQA 4IQXA 2VFVA 3MTJA 1WG5A 3N28A 4OQJA 4DDFA 3I56S 3D5MA 3V4IA 2HW3A 2LXUA 3G8TA 4LR9A 3SZ2A 1NAQA 4FXDA 2H4YB 1KLMB 2OELA 1OJ4A 1CJUA 2G9OA 4HR2A 3NY0A 3OFGA 4U67Q 2HMIA 3Q83A 2MKCA 2ATCB 2V68A 2IMOA 1R0AB 2L08A 3RRHA 2DR7A 3CMQA 5ETTA 5G0RA 4YR0A 2V94A 2F40A 3W1YC 4EO8A 3P45B 2W2OP 4OHYA 3AOAA 1P8GA 4RNHA 3K17A 1HQEA 2PA8D 3GG1A 3WC0A 1TKXA 3A13A 3IBCB 2RS2A 1X4BA 3H42A 5JXSA 1ACMB 2OP5A 2BANB 1RWNB 2VFTA 4CH0S 1TMJA 1WHVA 3MM8A 3CDWA 1IWAA 1ZAXA 4PYAA 3K5OA 4M5JA 3AJ1A 3RAQA 2FGOA 2XCAA 2HS3A 5LXYA 2B7BB 3CCTA 4AXIA 2PI4A 3CDBA 4DV5F 3HFVA 1WI8A 3G6XA 2AYMA 2K8GA 1MSWD 1FTCA 5THWA 3R97A 3MPDA 2LVWA 4R5PB 2K3KA 3EJMA 4DV5J 4F2SA 3D28A 5E5NA 5GVQA 2VC0A 2CJKA 1RISA 4B3TF 1Y00A 1GXLA 4M95A 1QSLA 4KGKA 1U47A 4R25A 2IRXA 4LFBJ 1S6PA 4B3TJ 1XN9A 1LWFB 4CZCA 1FRKA 2BM0A 1AZSB 1SC1B 5DQHA 4ETXA 1MMNA 1X31C 4FPRA 3M9MB 3CT9A 4ILMA 4PG5A 4GVBA 1SV5A 4CYUA 3LTOA 2HPUA 4QIGA 3G6VA 1R8BA 3PIPQ 1KQKA 3UNGC 3G86A 2GNKA 4DV6J 4B02A 1F9FA 4FBUA 2XMUA 2P9EA 3H59A 4IFYA 1FFGB 3M8SA 2RB7A 2B9EA 3DXBA 5J2PA 3PX6A 2V8PA 5IT0A 1YG0A 3D1HA 3TJAA 4F02A 1H2UX 1WHYA 2L3MA 3ENQA 3MCMA 4LF5F 4KV8B 2QLJB 3IWLA 5K8PA 1RAOA 3G4SS 2DJWA 4KHRA 3DOMB 3HPOA 3BQ1A 2BKOA 4DV3F 4QBUA 3BPDA 4FF3A 2ZHOA 1P9QC 2C2NA 4LF6F 4L3KA 1HBMA 1BD6A 4DX6A 2M9KA 3IR6B 1T03A 1RHUB 3POTA 3ZZYA 1AFJA 3VAGA 3G71S 4DV3J 4ED2A 2N7YA 2YBVA 1TP7A 4LF6J 4N7TA 1MWYA 1HPZB 4DPUA 3N01A 2OPPB 2GAHC 1JXLA 1UPPA 3VGTA 2DH8A 5DZ6A 2CFXA 4ED0A 4RR5A 5HI7A 3W66A 4HHHA 1LK5A 4DHVA 2K1RB 2AIRB 3LAKA 5U47A 4C6AA 5CAAA 5CABA 2R2RA 3CCZA 2W4CA 4ECYA 2GJIA 4K5RA 1CJKA 2ASDA 3NCPA 3HFZB 3IS9A 3C46A 2WTFA 3A12A 2CPHA 4QYZJ 5D8HB 1FRHA 4OI0A 4GC7A 2E7VA 2BKPA 2NCKL 2PT0A 3I4PA 3W7BA 4B3OB 2CRLA 3IRWP 3H25A 3KLIB 2DITA 4AL5A 2J6TA 2WVDA 1OY9A 1XR5A 4GO7X 3DLBA 2VPWB 4QYZK 1CULA 2ZOFA 5DQIA 2ZHBA 4PZVA 3KDOA 2AV5A 2E1PA 4NASA 3MUVP 2BRLA 2NYIA 4PQUB 5ITHA 4HH1A 3M8ZA 4M5NA 5KG1A 4CQ1A 4KO0B 4TY9A 2Y8YA 3I55S 3OLAA 2W2PP 3H4DA 2FPHX 2UUCF 2AEJA 4NA3A 4EK2A 3T19A 3CCES 5IT4A 1LW2B 2Z58B 2N3LA 3KJVB 4RBTA 1NEEA 4PPZA 5HVFA 4MK8A 4CLLA 2QL5B 4DFJA 1RI7A 1B0PA 5M2PA 2LECA 5HVGA 4DV4F 1TKTB 4CLWA 5LMUF 4F4WA 5B7WA 3S7RA 3ULHA 4X65F 1BHNA 1HNIA 3CJ5A 2XEXA 5AE3A 3H20A 3LP1A 1SJRA 1DLOB 4DV4J 2HYIB 2IA0A 4F26A 4F4XA 1G3OA 2GW8A 5LMUJ 3DLEA 2KT2A 2GMLA 2ZZMA 3Q24A 2EI5A 1KOHA 4ZHRB 3M2UA 4I68A 2JLEA 1WELA 2QLFB 2KJVA 2C2RA 4ETZA 1B3TA 1UWAA 3EUNA 4DL0C 3GYNA 4IO9Q 1TFWA 3B78A 4IH5A 4ZKAA 4LRAA 4JV5F 4A8YA 3ENAA 1XMQF 3SCKE 2QMUB 1VCTA 1YSJA 1P27B 3SFUA 4J90A 2HIQA 4P9SA 2DH9A 4I7FA 3TOQA 1ZM3A 1HI0P 1L3TA 2CQ0A 4JV5J 3Q8PB 1C1CA 1XMQJ 3CUNA 5JUMA 2H1YA 3CJ4A 3NNHA 3GB0A 2BYCA 4X4TA 1HBNA 2R8HA 1YRTA 2M2BA 4UTGA 2HSEB 4G65A 2V0NA 1AB8A 2E9RX 4C8YA 1BQNB 4DS5A 2F5GA 4B9VA 1YZ7A 2BA9A 4AQYF 4ECUA 4DL6A 2PE8A 1GAOA 3DGPB 4NLTA 3W62A 4FZVA 4OHWA 1HD1A 4AQYJ 3E01B 3ENWA 2Y3YA 4CNYA 1IUJA 4UT4A 4ZJQA 2Q3PA 4FKYA 3QPIA 1U25A 1SJ4P 5DM7Q 5E2QA 1NHUA 1H0HB 3FQLA 3HP6A 5KFOA 1U6FA 2YKOA 1X9WA 1A0OB 1D09B 5KFQA 4YN3B 1B0VA 4ZPVR 2DKOB 3GFYA 1EJ7L 1F1BB 3H2LA 3EM1A 3M8QB 4F7VA 4CLFA 2DGXA 2MLYA 1RTIB 2AJFE 2EC2A 2QJ3A 2XNQA 4RUHA 4RWWA 1NB2A 3UDVA 4D3HA 1GXUA 2CQHA 4RW9A 1Q5YA 1T3OA 1LW0A 4DQSA 2P9CA 4PAAA 3L3CA 4PG7A 2ZZNA 4DQPA 1S1VB 1UWBB 3HHLB 2QE5A 4DFMA 3GQCA 5K14B 4K4ZA 3ZTPA 1UCNA 4CLUA 2I5JA 2MZRA 1FRJA 1YI2S 4B9TA 2D3OR 2XSJA 1OMSA 4DL4A 2FC8A 2DR5A 3M05A 2MQPA 4QPTA 1H74A 2OKQA 3I0RA 3EXYA 1IKVB 3CDEA 4KGMA 2EPIA 3TX8A 3NEKA 4MFBB 2OTJS 3NS7B 4JI7F 2AJ0A 3SSQA 2KXFA 4ECZA 3LPEA 3M8PA 2D41A 4QW9A 2DYAA 3K2YA 2R9LA 4DU7A 3HDSA 3HHDA 2GX8A 3JB9k 4JI7J 1N32F 3QAEA 3KLGA 3PNIA 3NMAA 4FYXB 1S9FA 3AFGA 4EBEA 1E6YB 4O44A 1GT8A 4DX7A 4B3RF 3DCAA 3QO9B 3THVA 1DRZA 1N32J 3PKMA 1NRKA 2DY9A 4NMLA 2I0XA 4LSLA 1TK0A 4C3KA 4KFBA 2VOOA 1MROA 1EP4B 4B3RJ 5C5JA 4Q0BB 5F0WA 3ILIA 2KFYA 3NS5A 1P9YA 1KSPA 3HK2A 1Q16B 1BWVA 2C1EB 5K9FA 3PYFA 3W5YA 1B64A 2VFRA 4IDKB 1BUXA 2ZKUA 1HI8A 2MY8A 1VQKS 3DDIA 3GCWP 1LWEB 4CH7A 4FNHA 1VISA 4ZP9A 2W4PA 1X5OA 1T0TV 2XYGB 2XYHB 3MFIA 4RU2A 2WRMA 2ZHAA 1JLQA 1F5CA 2R7SA 2AGPA 2VONA 4OLOA 1SUQB 2L48A 2KFZA 2VB6A 3NBPA 2ZWPA 5HQLA 3M6VA 5KT3A 1F3FA 5KFXA 4G1QA 5K20B 1VC0A 4WZMA 1H2VZ 3K8WA 4MKAA 1WKJA 1HD0A 1VRUB 4B3SF 2MZQA 4WE1A 4XPEA 1SC4B 3GV8B 4UUXA 4UY8T 1KLNA 2XO7A 4X4QA 4A8SA 2D3ZA 3TI0A 3PYGA 4I6WA 4RW6A 3KMQA 3LWMA 3TA0A 3CTRA 4B3SJ 1FEHA 2RMLA 2V2KA 1F6TA 1O51A 4DJBA 2MQ8A 1TAUA 1HW9A 1WTBA 1K47A 1NHKL 3MXHP 3Q86A 2MKKA 3DLHA 1FNOA 1IR1A 1TZ0A 3KG1A 5GAEI 1M1HA 3HT3A 4L3NA 5C25B 2YQ1A 2DBBA 2FB0A 3CPWR 1PBAA 5FDLB 4I2QB 2XY7A 2XSFA 3R7SB 5T41A 1N48A 2YKMB 3OFHA 4HYKA 2J7UA 2G0JA 2JWNA 2LQBA 2Y0BB 2YKAA 2OFGX 2YNHB 1HNXF 2HZCA 3N6LA 2DGUA 2VG7B 3S6EA 1KP6A 3VTIA 2DD8S 2AX0A 4UOHA 2OJ3A 3V6KA 1GTEA 4C8LA 4DMZA 4CO5A 2RNEA 1S48A 1YJ7A 3MD3A 1GMWD 5HMYA 4OZ2A 2XY5A 1AUSL 2BANA 2YWEA 4WJBA 1U2FA 4YB7A 1NPRA 2UP1A 2QL9B 3DM2B 3IO1A 3C14B 1QUPA 5KFHA 1RACB 1S6OA 1WEZA 3O1LA 2G2OA 2COLA 3TA1A 2LP4A 2QLBB 1FDNA 4RW8A 2BUNA 2Z0GA 4K4SA 1R0BG 1JJ2R 2HNDA 3KLHA 3A8JA 3MR5A 1NB7A 3W8PA 4MAKA 4N5SA 1NH8A 2FJVA 3QNWB 2QL7B 3L95X 3AB2B 1DY3A 4G6VB 2RHSB 1NDKA 4KKOB 2Z57B 5FLXY 3EGNA 2CNLB 5CYJA 4CO4A 2ZH1A 3RB4A 4K4UA 1VJWA 6FD1A 2Z56B 2EEYA 1T94A 1TELA 1NBEB 4ELUA 4NWBA 2DGOA 3PACA 3P5BP 2XM3A 1OSDA 5KFLA 1YK9A 5KT7A 5F9NA 2GV1A 1S1WA 3RG6A 2RQCA 1X0PA 3HVWA 5ETKA 3A3PB 5IQ6A 4DCOB 1IKWA 2DHSA 2DT9A 3H5XA 1JLEA 2HHQA 2UUBF 3UWTA 4CLYA 1MMLA 3SDEA 3NOCA 2YNFB 3B8HA 4I2PA 3N6MA 1U7LA 2HVHA 1F9EB 1KVJA 3W65A 2UUBJ 1APSA 2J8AA 4DL5A 3GFZA 4ZVGA 2HK2A 3R5JB 2PMWA 3FZBA 1S9EB 3Q0AA 1XERA 4AD6A 4OX9F 3ZZUA 4E0DA 2Z8QA 2R3VA 2PI5A 2I2YA 2E1RA 3CJ2A 1FX2A 4ZJLA 1NJXA 5HJXA 4DZDA 2YKNA 5HVHA 2DXDA 2CYYA 4WKRA 2OIHA 1GQEA 2RS8A 4OX9J 1IQTA 4AL7A 3UI3A 2LA4A 3BSAA 3QLHB 4NCAA 2RUGA 3HJFA 3RR7A 3DFEA 3PKYA 2EKNA 4IR9A 2MKHA 1V3ZA 2VG5B 3VF0B 1S1XB 2LMIA 3H5UA 5KFCA 4X64F 1Y5LB 2OEMA 1J2VA 3UW1A 4LJMA 4MIAA 1CVJA 1JLGA 3UFCX 2K7JA 3IG1A 4X64J 4DLGA 2VC1A 1K1SA 3R2DJ 2M88A 3IRXB 1T9UA 2W9BA 2XS2A 2AD9A 3G9CA 4EYHB 4PXEA 2IYGA 1NZ8A 3MM5A 1R27B 3MOJB 2N82B 1WDDA 1U8SA 2ASLA 2W2NP 4O4GB 4ZLJA 1ITPA 4NA2A 2CJXB 3IFEA 3W2VA 2HFOA 3MPVA 5J2NA 5H9FJ 2KI2A 3SBMA 3KOAA 1S0MA 1KEKA 3RAMA 3ILOA 1XIQA 3KLIA 2CPYA 4O4RA 5CYQA 4TY8B 2ZM6F 5H9FK 4TLRA 3ETOA 1OPZA 3MPUB 3HVRA 4NEZA 4Q45A 3R6GB 4PQUA 5KFGA 4HI1A 4K2JA 1HMVA 2QX0A 1HR0F 4K4VA 2DISA 2IRYA 3GJTB 3EXCX 4UF4A 2ZM6J 2MB0B 3TWZA 4ILRA 4O23A 3SQGB 3Q8SB 1ZYQA 4ERDA 1KD1T 1O0PA 2AJ4A 2OH2A 3GYGA 1HR0J 3G82B 1MMDA 5E7OB 5E3QA 1D9AA 3IR7B 4M5HA 4TKTA 2RUSA 3T9ZA 4MTPA 1FA0A 2HZAA 5E3AA 4XIUA 3UVJB 2DPIA 3PVXA 3CJTA 3MHYA 3OXFA 4K8RA 2CVIA 3DHWC 4YEAA 2F4VF 2UVRA 5KFTA 2LCWA 3TVKA 2VQEF 3BDPA 4FYVB 2OAUA 3MMBA 2KKHA 3BBBA 1D3WA 3TEGA 3KLFA 2E7XA 3CIZA 2F4VJ 4WFBQ 2DNHA 2BW7A 4ITSA 5GAEU 2VQEJ 3AB4B 4O3OA 1SPBP 2Q6BA 4FYDA 2V5HG 4NLXA 4DSLA 1K9MT 5A0YB 3QFHA 3V2UC 5HK4A 4UOGA 5KTQA 3T5KA 2DGTA 2YWHA 3D67A 3PJXA 1RKIA 1RABB 1EETA 1XQIA 5HSPA 3T1AA 3ITHA 1FXDA 5DO2A 1L3KA 1Q82T 3CW2C 3RB3A 4UZCA 4NCBA 1FCAA 3DOLA 2DGQA 4ELTA 3LP2B 2GQQA 3H2VE 3LUYA 3J7AN 1Y11A 2CJAA 2MTLA 2W7PA 3VZIA 1UMJA 2H51B 2WONA 1WNEA 1ZA2B 3MM6B 2IFXA 3PW2A 1PCAA 1UJ4A 3RBEA 3C6UA 2QFIA 5MLCV 3L7OA 4ANCA 2DIUA 4KT0C 2GVZA 4F67A 1QE1B 3OR2B 4G3IA 4C0BA 4UOFA 2DY1A 3W9HA 3LWLA 3BKUA 5HMWA 5L9NA 2CG4A 4QR1A 2DGSA 1LWXA 3H90A 1PYOB 2OO4A 3ISNC 4QPXA 2YX7A 2BEFA 2IM1A 2QIFA 1RTHB 4ZA1A 4NZ7A 3NNCA 2KYZA 3THPA 2MPUA 2QV6A 5JJBA 3C6TB 3FEYB 1LFWA 1VBZA 4N41A 8ATCB 3ZZRA 1TL1B 2F8EX 5DLFA 2NS1B 2BBEA 3BZQA 1TU0B 5ETQA 4PPDA 1FRLA 1RA6A 4H4MB 1RT3B 5AXNA 1JLBA 2IC3B 4IRKA 4CRJA 3NGRA 4DR1F 1G4CA 4YDXA 3CF5Q 2DB1A 2OFHX 3AQPA 2MQQA 1L5UA 2LQJA 1S1UB 2JEFA 3DN9A 1VGYA 4HACA 4UQGA 3TZYA 4DR1J 3W61A 2AT1B 2IBKA 1PGZA 1T8EA 2VDIA 2W9CA 3C19A 4I64A 2FLLA 1PKUA 4ZIWA 1B0TA 2AU0A 2BQRA 3W9IA 3OR1B 3FFIB 3M2VB 4HT7A 4CO3A 3EPGA 1VC6A 1S7IA 3WQPA 3LP0A 3I0SA 1FK9B 3AH6A 3I4HX 1X4GA 2AZ1A 2HG4A 3M9OB 3T5LA 3MMCB 2HHSA 4LVOP 4NPOA 2DHXA 1N5YB 2GO8A 5D3GB 4UZBA 1AFIA 5HBMB 4B9LA 2H4WB 1IKVA 1U0HA 3ZZZA 5BJRA 4A8XA 3MAAB 2BOPA 3OD2A 5IFMA 3MGJA 5DRKA 1FKPB 1FTRA 1BC6A 4IG3B 1CSJA 2C42A 3MFHA 2POKA 7FD1A 3ZNJ1 4BHQA 3K5NA 4ZCIA 1OPIA 1Y9OA 2OPQB 2AYGA 2DNOA 4IYQA 4LSNA 1QUVA 4NLUA 1RT7B 3W8GA 3OVBA 2HFZA 4F0HA 3HMJG 2N4CA 2OHDA 3GR1A 1RT5B 5JVGQ 3LGNA 5KT6A 2UUWA 1PILA 2UXCF 3M6WA 1I51B 1EB0A 3CJKA 2BJ9A 3LANA 1RAIB 5LJ3Y 4B17A 3K59A 3SXLA 2HHWA 1A6LA 2UXCJ 2OGUA 1ZM4A 1QAYA 4OV6A 3BYPA 4GRSA 4LVNP 3V4IB 1U1QA 1YJ9S 4LIRA 1OQ6A 1FJ7A 4F25A 3MCOA 3NWRA 1KBRA 4OHXA 2C2MB 1LWEA 1CJUB 5EDWA 3HHEA 2HMIB 1XJWB 2LXFA 2ZKTA 1M5SA 4I6AA 3C16A 3DRSA 4RUBA 2Y8WA 5G0RB 2GS8A 4E98A 3CO9A 2RDIA 4OZNA 5RUBA 1HQEB 1WC6A 1NHVA 2ILZA 1TKXB 1UFWA 4FXWA 2VBZA 5T7LA 4DR5F 1AA1B 3HJVA 4URQU 5LSLA 2CKWA 5CH7B 1P1LA 1YVFA 5KFZA 1HQ2A 1YHQS 2D9OA 2DNLA 4F4AA 4DR5J 3MM8B 4OYIA 2Z30B 4J7CA 1CS4A 3MD1A 4UW2A 4LF2A 1SKWA 4QQBA 1OQ3A 3GE9A 4NLGA 5IT9Y 1PYTA 2B6AA 4F0MA 5DLGA 4OJ3A 2Z2LA 3K57A 1XBWA 3K5LA 3PW5A 3OBIA 4ZK7M 1RLDA 4MJKA 3MR2A 2DHGA 2X1BA 2KVQE 1VQ4S 1RTJA 1DFDA 3N0VA 3LO3A 3AXKA 4IQMA 1U6BA 2AJ2A 4LBIA 4KBIA 2KT5A 3W2WA 4QR0A 1HNZF 4QIEA 3VQTA 3KHLA 1NDLA 2B56A 3TR5A 3DNCA 2JLGA 2YNHA 4CNZA 5LSRA 2ZOMA 1S6PB 4RX6A 3KG0A 3BGFA 1TVRB 3CIMA 1HNZJ 2L9WA 3WDOA 5DJBA 1X4HA 2PIIA 4C3MA 2EFPA 5BYSA 4GVBB 4J9MA 4CYUB 2VHGA 3CGIA 3HZGA 1S97A 2DRDA 3TX0A 2JVRA 5HQ8A 4RNMA 3VWSA 1M1KT 4KGZB 4WFXA 5J1EA 3T1YF 1GX5A 1S1TA 3BS9A 4IFYB 4XTTA 3AODA 3K89A 2LFVA 4Q8EA 3TAPA 1U02A 3KLVA 2IAJA 5J2PB 2BW2A 1FXRA 3SV3A 1EKSA 2HAFA 1NKBA 3T1YJ 3MM7A 4Y2AA 1PC5A 1VJQA 4OYZA 2XO6A 1S10A 2HWTA 1QAJA 2FJDB 5FIIA 4H4OA 1Z4UA 4TYAA 3QYYA 1VYAA 3ZNUA 1QTMA 2LQ9A 4WFAQ 3PEHA 1HBMB 4L74A 1JWWA 3VAKA 1M5OC 1T03B 3POTB 1V3RA 1C0UA 4OLPA 1OO0B 2MSSA 2H65B 3U7JA 3FRYA 4C3LA 1RBAA 1X8DA 3BH7B 4HT5A 4DOZA 2RT3A 2W01A 2HHXA 5D0RA 2NUHA 3NOGA 4DSFA 5I4MA 4DV7F 3KHHA 3BSNA 2RE1A 4IOCQ 3M30A 3RRGA 4IO1A 5HMXA 3JYTA 3DRPA 2CQGA 4DV7J 4KY3A 4LRBA 2C2ZB 4DUYF 1K8AT 3NGUA 4CO1A 1P1TA 1CJKB 3ET6A 1V9OA 2AHOB 5C24A 3IS9B 3BN4A 4DUYJ 2IA6A 1MG7A 1XMOF 2NSBA 1DTQA 1YIJS 3VALA 4D3GA 1F3VA 3B6BA 5GMKa 2NQPA 1X9MA 4RBVA 4RNNA 2L41A 1QDUB 2GIQA 4NLQA 3S8SA 1M5HA 1XMOJ 3HM9A 4PUOA 4X84A 2W24A 1CULB 2B9YA 4FNIA 3EWGA 4BLGA 2FLPA 2BV3A 4JI0F 5DETA 1I5OB 4DN0A 2V2QA 4CO0A 3R5DA 2RRAA 3HHKA 5EX0A 3LGMA 1JXEA 4ATNA 3BKFA 2RDDA 4OYWA 4USJC 3P4UB 2FVPA 4DPOA 3DRYA 2DEJA 5KFPA 2OLWA 4JI0J 2DO0A 2E9ZA 2JZ5A 1S4EA 4DS4A 5I3PA 3IC1A 4O0IA 3CCUS 1R8HA 4WCEQ 2MQOA 3I32A 3D4JA 3QAUA 5B0GA 2H3EB 2NXNA 1KQFB 3U1LA 3EVMA 5J2QA 5KG7A 1M0SA 3TAQA 4JI4F 4PWUA 2QSFA 2EFOA 2D3UA 3LW5C 1HNIB 3L09A 3LP1B 1FDDA 2QLWA 4JI4J 3IA0A 2N3OA 4PEOA 2V8HA 2QGFB 4U8YA 4EMDA 3ZZOA 3DLEB 4TQRA 1L3VA 2CZVC 5IXUA 3OTBA 3OL6A 4YB5A 1YKWA 4CIOA 2YNGA 4F4KA 4O4GA 2HVIA 3M2UB 4USTA 1WC1A 2ASJA 4Y0FA 3H4BA 2BE9B 4USIA 2XZWA 4W98A 3S01A 3IWXA 4LMZA 1NM2A 2VBYA 2ZNZA 2V8DA 4NLVA 2ZH3A 4M5KA 2XC9A 2XB2D 2VPYB 5BYRA 4TY8A 5L1KA 2YWWA 1RGVA 1ZM2A 2Y0SD 2ZBCA 1I1GA 3D7SB 2YQ3A 3MI7X 2M5YA 1EKRA 3EICA 3BGUA 2CNKB 3CCVS 3HULA 2WZ1A 1CJVA 2ZFHA 4I7FB 3K0JA 4ZVFA 1GMUA 1Z1ZA 2P8IA 5KG0A 5JMNA 1BQXA 1C1CB 1Q5VA 4DV2F 2KFNA 2XQCA 4C11A 2XMVA 5J2MA 1NUEA 3DXSX 3SFGA 3CULA 1HBNB 3SMZA 4C0HA 2W2QP 3JAMY 3V4MA 4DV2J 2CPDA 2AYEA 2ALZA 5L38A 2J9DA 4LQ9A 4J9VA 3GSDA 1XC9A 2FHKA 4OYPA 3M6UA 4YB1P 1DJ0A 1MNEA 4LR8A 4J9SA 2B5JA 3O3LA 3TW0A 1UJ5A 1JK9B 1RWOB 2IY5B 5DG9A 4MT1A 1K0VA 3KNGA 2CQDA 4RKUC 2E1AA 5F8MA 2M3DA 3MTKA 2CDQA 1S49A 3Q8YA 4F0KA 4OX8A 3J80U 4DR3F 4F04B 2ZJRQ 4ECVA 2B3TB 2BKNA 4KHPF 3CC2S 3TRGA 3KUEA 3I87A 1PJ5A 3OXLA 4RW9B 3MEGA 5KFFA 4DR3J 3GWCA 3ICLA 2CJBA 4WWSA 1JNRB 2XMMA 3ELHA 4LRFA 4KSEB 2GGPA 4KHPJ 5KFAA 2XZTB 3AA8A 2KXHA 1IM6A 3QJJA 4J5OA 2ZNYA 2I38A 1X4FA 2V4JA 3IN5A 2I5JB 4OJGA 1VHFA 4FPIA 5HROA 1YWXA 4QW8A 2CA9A 3KDNA 4LFCF 2XSJB 2WOMA 2CADA 3VAMA 1UFKA 5EWGA 1SIWB 3I0RB 1JLCA 1WC0A 2HHHF 3DHXA 4LFCJ 4EYIB 1FESA 2P6SA 4ZJOA 4ZVQB 3QRQA 2HHTA 4GKJF 4NLOA 3QGHA 3T9NA 5HL7Q 4HHUA 5IQQA 2IDLA 3O6QA 3QATA 2HHHJ 2FVCA 3DRXA 4NZ0A 3M8PB 3QFWA 2BJDA 4GKJJ 2EC0A 2CVEA 2CQIA 2J7KA 2KB2A 4WU3A 1WDTA 2R2TA 2Z2MA 3KLGB 1RP5A 2DNGA 2J9DE 4ZPCA 4OI1A 1PIEA 5T14A 1Y5NB 4O44B 3IXQA 5DGAA 2G4BA 4QR2A 2AZ3A 2RU9A 2HQGA 4F8RA 4IFVA 4LSLB 4XAKA 2GHVC 3J7YI 2HRUA 4KFBB 4ZP7A 1RWVB 2HQCA 4KE5A 1MROB 2YTCA 4CH1A 4ANEA 1UA1A 2PMHA 1HNVA 1VIXA 1BMQB 5EUHA 3GFHA 3NGDA 1GK8A 4O0NA 2HIYA 1X5PA 5ETPA 5BR8F 2GAGC 5M2UA 2A6MA 4YMEA 4N8NA 4KQZA 3MMCA 1WF1A 4WK1A 2BE7D 4NRTA 3SQOP 4C2MA 4ECRA 1YBAA 1F2HA 1YRUA 5D3GA 5BR8J 2Y9HA 4USWA 3MWBA 5HBMA 3BSOA 2F4FA 1AXQA 2LDIA 4GC6A 4UQTA 3QIPA 1FJCA 1JLQB 2CUYA 3Q23A 2VKRA 4ED3A 2Q43A 2BJ8A 4DQQA 3I5CA 3GLJA 4CLSA 5HMZA 4O3SA 1SI9A 2QC3A 3NBPB 1FKPA 3WHIA 3D3CJ 4G1QB 1XR6A 1IKYA 3OPKA 3BYRA 3IAM9 1PSDA 5I3UA 1FERA 5AXMA 2OPQA 4WE1B 2VBWA 4ES3A 3C15A 2BQUA 3N5FA 2MEWA 1JJHA 4NOHA 4QYRA 3SSSA 5SUHA 3R5CA 2KM8B 4RW6B 5A8RA 3BGLA 1JLFA 3JSBA 3PCOB 3FRZA 2MZSA 3OSPA 3PY8A 4PWDA 1PC4A 5M2RA 3MPYA 4YR2A 1RWMB 4CM2A 4J9QA 4CT9A 2YKPA 2RILA 5F8HA 3CCSS 4J9PA 1QSSA 1EX8A 5LSOA 4AXJA 2KU7A 1GEHA 1SQFA 1U1PA 1S5ZA 4ZPWR 3TJ9A 2ADBA 4Z37A 2VJUA 4F3OA 3FDSA 2E7WA 1D9FA 4Q8FA 1Q79A 4A8KA 2YQ0A 4RUAA 2BMBA 7AT1B 3I31A 3JSMA 3K7RA 3A1YG 2M7SA 5KFDA 3SI8A 4P75A 3PRDA 2MLZA 3N9UC 3LH2S 4OI6A 3H98A 4OMFG 2KXNB 3TANA 5L46A 2CNNB 1OSCA 2KRRA 1KNZA 3GSIA 2JLFA 4X62F 1MU2A 2W9AA 3OSNA 4AFFA 3OFFA 2YWGA 2HZVA 5GAGI 1HWLA 5F3TA 3M32A 2KDOA 3P8BB 4ZPDA 1JB0C 2C3PA 4IRDA 2YNIA 4X62J 2FJWA 1J27A 1UVMA 1Q8LA 1WSVA 6AT1B 4OV1A 1XNRF 2KG0A 3C8YA 5A6WA 2LQ5A 4P2MA 4X66F 4ECTA 4DQRA 4LUBA 2MLXA 2LXIA 5MAOA 4RW8B 2IVMA 3PX4A 1XNRJ 1YJWS 3NRBA 4X66J 3NXZA 2WHOA 1WC3A 3BGOP 2HNDB 3KLHB 2A10A 2FLNA 4OX6A 1AT1B 4A4JA 5D77A 1FWLA 2HQIA 3QT5A 3FUYA 3UN2A 4P2FA 4DR7F 3MEDA 1R8AA 3A8EA 2I6WA 2KN4A 2VG6A 2YWFA 4OI4A 1VC5A 1NJZA 3MDFA 5K8NA 4DXLA 4DR7J 5D0HA 3BM7A 2O01C 1S1WB 1N8RT 2QZ8A 3TARA 2R8KA 1VS3A 4NLWA 2IDEA 1TVRA 3DOKA 3L4BC 5DGBA 1WOOA 4DI6A 2XS7A 2MJNA 2JEIA 3J81U 2VODA 1X60A 3J7Z5 1IKWB 2GQCA 1HQUA 3VGSA 3ZZPA 4ZCMA 1JLEB 3OL9A 4I1TA 3D1OA 2AW0A 4NL5A 3BEGB 1QTNB 3SDEB 4HLBA 1H7WA 2IJRA 4I2PB 1VRTA 4B08A 4ES2A 1QY7A 1UVJA 4Y2IA 3CSKA 3FCHA 1RZMA 1UEUA 4MMOA 3W60A 3IGVA 3J7ZT 5EHHA 2J0WA 1FF2A 3JQKA 2YXLA 4RUCA 2X1FA 3BQ2A 1X4AA 2YKNB 3GIRA 3IMQJ 2MZTA 4I0WA 3NL0A 1N33F 1NK5A 5F8GA 4LF5J 1Q0NA 3D0HE 1QVGR 3DLGA 3GIJA 1ZETA 4Q5VA 1HLWA 4LF7F 2ZH6A 1VQ7S 1N33J 3HHLD 1H3DA 2QSWA 4Q44A 2KT3A 2ZC3A 4AT1B 2PC6A 3SSRA 3ETMA 4LF7J 2I9SA 1KS2A 4ZLPA 3HSZA 5A2QU 2V9KA 5CD4H 2X3GA 1E6VA 3U1NA 1KVKA 4ALZA 1NSQA 3R2CJ 2HVDA 2MQNA 1HBOA 4DWIA 4ZDNA 1KTVA 1JLGB 3IG1B 2FTRA 1RU2A 2NXJA 3KJNB 3D0IE 3FBBA 2WAQD 1RYSA 2W9BB 4QWAA 3IWNC 1QVFR 4W90B 1UL3A 3DYAA 3CJSA 3MM5B 4NLDA 3VAJA 3DU6A 1WG1A 1C4CA 5KOWA 4V1Ak 4ZVTB 3R1LA 4JYAF 3N4WA 2XHWA 2LQ8A 1FKAF 1RT1A 1FFSB 3W2VB 1NPPA 5J2NB 4DG1A 3TAMA 3LQVA 3X3UA 4ANDA 1HWIA 4KGVB 1GFWB 2V67A 5ETSA 1TV6B 4JYAJ 5CYQB 4ZLLA 3KXDA 3OFEA 4EWTA 2ZC4A 2RRBA 5D0EA 2XMTA 4NXMF 3CVKA 1T95A 1HMVB 4P74A 3D9BA 1C2PA 3CDAA 4EUVA 4TU9A 2UZAA 4Y2MA 3FBCA 3PJ9A 4NXMJ 3JQJA 1TFYA 2A1BA 5E41A 1DTTA 1NDCA 3PFEA 3RW6A 3GIKA 4DBQA 2CNOB 1IKXA 1XNQF 1KFSA 2M8HA 1AROP 4EGLA 2UUCJ 2BJEA 4XO0A 2NXEA 2FYXA 1TL5A 1RWPB 2E1CA 2R7VA 5A8WA 2UXBF 1ZH5A 4KIAA 1XNQJ 1U6ZA 1REGX 3TVZA 2HHUA 1QAIA 1VQMS 2UXBJ 2AJ1A 2C3MA 4G1IA 1Q1KA 1R43A 4KAIA 3GFXA 2ZUGA 4IH7A 3MMBB 4LF4F 4X65J 4RU9A 4HKQA 3AY0A 2CJYB 3KLFB 2YWKA 1ELOA 1H98A 4Q43A 3GIIA 2RIJA 7FDRA 1FD8A 4K59A 4LF4J 1VFJA 1WOPA 2CQ2A 2R8IA 4DQIA 2NXCA 3BH6B 3Q89A 1VDHA 1SH0A 5HLFA 3BF4A 3KG4A 1EETB 4DFKA 3ITHB 2GO9A 1R7IA 1RHJB 4KGXB 3FC9A 3O2IA 3PDNA 1RT6A 4ILLA 4C98A 2K2PA 2LU2A 3KNAA 1S57A 1PAEX 1WWHA 4X4PA 3L7UA 3DOLB 1SJ1A 1NJYA 2QG9B 3G6YA 2RF2A 4Y65A 4P73A 3NS6A 3OL8A 2JL9A 4WIIA 2OI2A 2HWHA 2HHVA 2I1RA 3OXGA 2WONB 1S76D 3NGTA 3CD6S 5GAGU 3CXCR 2ACYA 3I6PA 3V81A 3R1HA 3OUYA 3RB6A 3C6UB 3KHRA 4NE9C 1Q8IA 2GVZB 1A9NB 1LXNA 2Q79A 2MQMA 4LF9F 1SXLA 4N77A 3QMQA 2XLIA 2OPRA 3GJQB 2AEFA 1RCXB 1SBRA 4Y2CA 1URRA 3WX8A 1VQ5S 3JS9A 4LF9J 2ZH9A 3CCLS 2ZVIA 3HVAA 2IRUA 4WP8A 2E9TA 2AMCB 2JDJA 3T1HF 2CPFA 1FDBA 4LFAF 4TU7A 1U48A 3KUHA 1D9DA 4WTYA 8AT1B 4KH0B 1IXKA 1T9TA 2VUGA 3RBDA 3VAFA 3UD5A 3V6HA 4LFAJ 3D66A 3BSCA 2B51A 4OYAA 4KYZA 1JLBB 3DRRA 3ZO7A 3NNAA 4B9MA 5E3RA 2AJQA 5F8JA 4NLPA 1CC8A 3IGNA 2LEBA 1X9SA 2B9WA 2M0GB 4M1KA 1JJCB 1N88A 4NX9A 5HN0A 4ID5B 4Y28C 1KR4A 4ZVOB 2VJVA 4LR7A 4HACB 1TK5A 1QJHA 5DG7A 2DRAA 2MDAA 2HKEA 3UQSA 2JHEA 2E5LF 1EARA 1KOOA 4JV2A 2AKWB 2W9CB 2HWIA 5ETRA 5IS2A 4FP9A 2VA2A 2E5LJ 3UR3C 4M5MA 3AD7C 1Q53A 2VFSA 5B0AA 4M5DA 3LP0B 3I0SB 1FE4A 1DAXA 1X7VA 2EBEA 1JNZB 5EWEA 4U7CA 1V3SA 2HURA 1RUSA 3OHAA 2WB4A 2BE2A 2AQ4A 4JI2F 1U0HB 4K4TA 1LOUA 2RH3A 2BR0A 2FZCB 3HLUA 1CLFA 4FF4A 4ECWA 4JI2J 5DDPC 3FEZA 1NKEA 5J1NA 3D6TB 3DI6A 2KG1A 3FEXB 4LSNB 3MM9A 1DURA 2RU3A 3B54A 3K8VA 1OIAA 3F73A 1T7PA 2ILYA 3IM9A 1WHXA 4M94A 3DDNA 2BQ3A 5DS7A 2V4RA 1FO1A 3GPAA 3D6HB 4E8UA 5ETOA 1H2TZ 2GMJA 5DG8A 3MCSA 1PJ7A 3CJKB 4AE5A 5K5MA 3U1MA 5B09A 1D0EA 1S6UA 1U1OA 2RVJA 3L7PA 3BQ0A 1RLCL 1CPZA 2V8GA 4QJVA 2DNNA 5HATA 3J7A1 5I42B 3QIDA 1S59A 1SC3B 2EWHA 5F8NA 4M8LA 3HHLC 2E66A 5IV3A 1EQMA 2K7KA 4DSKA 3W64A 3CC7S 2V50A 3EYZA 4MKBA 3F41A 3DC2A 1FVSA 3C16B 3DRSB 1JKHA 1KHVA 1ZAVA 5FJ4A 4DFPA 1X4EA 3P5TL 1FKOA 3H8YA 3WIVA 1SL1A 1G6BA 2HLUA 5T7LB 2LA6A 3HXMA 1FT8A 4ZPTR 3M6XA 4XDDA 1N0VC 4KB7A 1YTYA 3CD7A 1RJJA 3LA0A 4X2BA 2C3YA 3IR5B 4BS2A 5EX3A 4N47A 3FBEA 1TR0A 2A2DA 1HFEL 1CS4B 3RJMB 4M5GA 4DV1F 2C2DA 3TUIC 4MK9A 4Z7CA 2AX1A 1X4CA 3PR5B 2IYIA 1S9GA 2DNQA 1C1BA 2B6AB 2F63A 2YX1A 4DV1J 4JP8A 3M8WA 4YDDB 4OZLA 3F44A 3I96A 3R8YA 3ISZA 2R7OA 2ZDPA 1RTJB 1M5PC 1NK8A 4EZ9A 5CYMA 5C2GA 4OYMA 4CM0A 1RT4A 3SCIE 2XGPA 4DX5A 5KG4A 3W2WB 4TN2A 1U1LA 1REVB 2BVZA 3TQ1A 3GONA 2F9JA 4QWDA 5L1LA 4RW7A 5A8KA 2DNYA 1T05A 1BXNA 2E29A 2DCLA 3CJ0A 3C2PA 1NJIT 3AAWB 2VA3A 4I69A 1HNXJ 2HNZB 1S72S 4ECQA 4NYPA 5AT1B 1H38A 1N54B 5KFSA 2H5JB 3MMJA 2HFSA 2WBMA 3S1TA 2GFFA 1ROFA 3M8RA 3JSYA 2OD6A 5J1EB 3P6YC 1S1TB 5KFMA 1UA0A 2IAJB 2YY3A 1U26A 2W7OA 2KVIA 1RHQB 3OW2R 2QA4G 3MM7B 3MEKA 1H72C 2GCFA 1KTQA 4OHZA 3TVYA 4BWJA 1KQSR 3MEEA 3PTWA 4BDPA 1T3NA 4C9DA 4H4OB 1VMBA 1VQPS 1FJEB 4MIBA 3PEJA 4ZP8A 4CCHA 2CJQA 3GILA 1SH2A 1Y5IB 5B08A 1ZTWA 4IG0A 2QO3A 3HKZD 3THTA 2ZEJA 1C0UB 1RADB 2Y1JA 2XI3A 1N56A 4FVMA 3KK1A 4V19X 4CTAA 2FY1A 1TL7A 5BXIA 4Y3CA 4K2XA 3M30B 4J9RA 4YUDA 2CWXA 4TLQA 3JYTB 3DRPB 2P6TA 2CQ1A 1VOMA 2J5AA 1TK8A 4C7QA 2F7VA 2W1BA 4ZLNA 1HWKA 1HWJA 4A8MP 4QIFA 4L73A 5JVHQ 3ET6B 2NR0A 4ZCLA 5IM0A 5C24B 4JI6F 2XMWA 2ROEA 1LEOA 1FWKA 2QT7A 2HFNA 3T3FA 1JLAA 3OHBA 3MAQA 1DTQB 1HYSA 1N5TA 4W4MA 2RQMA 2MKSA 2ZD1B 2LU1A 4JI6J 1NXIA 1HIYA 2JVOA 2DNKA 4QWCA 4PUOB 4RBUA 4AYBD 2CXEA 2H48B 3NLCA 3HT0A 1UVKA 2HBYB 1JXVA 2D1CA 4MYTA 2R7WA 1UETA 4LQ3A 2JFKA 1ULRA 2XYPB 3BREA 1WD6A 4HTJA 2NUUG 3OTDA 2QFJA 4LFBF 1I94F 3UN5A 3QQCD 2KYXA 2OUGA 1WORA 1WJ9A 1NO8A 3HX9A 1TL3A 1WKLA 1HNWF 2YVSA 4OL8A 1YJVA 1TAQA 2R8JA 1LXJA 2KHCA 1F9HA 5K8MA 2DNMA 4FVCA 3UDLA 5A6PA 2J9CA 1I94J 2FHJD 4WFNQ 1N4LA 2ZH4A 1EAYC 1FRXA 2XBPA 3IBWA 1HNWJ 4ZVUB 1CC7A 2FC9A 5J2QB 2IBOA 5KG3A 1KWMA 2EFQA 2O3DA 4DV6F 1AUDA 3PO4A 1C0TA 2B4PA 3RR8A 2AGOA 2WVBA 5ADZA 4OYXA 3J81j 3GJRB 4JBCA 5B0EA 3M1VA 2MXYA 2C22A 1S99A 3RTVA 3DGVA 3UN3A 2YNGB 1KC8T 4USMA 4JI8F 4H4KC 5HJYA 2H5IB 4WK3A 1URNA 3PRBA 2Q1LA 1M1GA 2FVQA 4FS1A 1J5OA 5D78A 1YJTA 1CJTA 1TV6A 5F8LA 3MR3A 2QA2A 4JI8J 5L39A 1YBUA 2UUTA 1RTDB 2R2SA 3BBCA 3LF0A 1WHWA 3R27A 3US5A 2B9XA 2Z2YB 3I82A 3QJPA 2G1DA 5D4PA 1MN9A 4NLRA 1VQOS 2HVZA 3PHEA 1TUWA 3BGRB 4ICLA 2FY8A 1Y3KA 1CJVB 4ED4A 1M5KC 1N6QA 3KK2A 3MECA 2P5VA 4FDFA 3H5YA 3D1QA 3T41A 4QIVA 3PYEA 4AL6A 2F65A 4C11B 5J2MB 4WP9A 2IM3A 2FIUA 4X4OA 2V63A 3N6NA 4H54A 1U0SA 1RB0A 4RNOA 2X3DA 3PJWA 2J6SA 3G8QA 2ATLA 4RWXA 4LF8F 2AWZA 4WFZA 1UVLA 1FJGF 2YPYA 1D8ZA 5D0GA 3BV8A 4P2SA 2DO4A 1MW7A 2CDRB 2AP6A 4LF8J 1Y0HA 1WTFA 2RD5C 5BYQA 3AXMA 2FUG9 1FJGJ 1JMTA 1GTHA 1HBUA 2B5JB 2CQPA 4LIWA 1UEKA 2ZBIA 2XI2A 2DHAA 4X4RA 1ZOTA 1YITS 3KLEA 2FLOA 3HSGA 2GJFA 2BJ7A 3GCXP 3MUTP 4PG8A 4OZ1A 1U49A 3PM9A 3B82A 1T9WA 3SCJE 2CQ3A 3GV7B 3QZ7A 4MYUA 2EXUA 1NH7A 3PG9A 1G2EA 3TJ8A 3E51A 5KFIA 1KONA 3CCMS 3O5TB 1EHWA 1CEZA 2IM0A 2JOQA 4ED5A 4RLEA 3JQMA 1TUVA 2FHOB 3MEGB 1IR2A 2YPZA 2YH1A 1BE4A 1LKZA 4HDHA 3B4DA 2BRKA 3KUGA 2VH7A 1UW4A 5KG2A 2GGPB 4BC7A 4I56A 2UVWA 2OD4A 2IMWP 2KRBA 2Y1LB 2ACMA 2UV8G 3QWPA 1X0FA 1TKZA 4A8OA 3HF5A 2RKIA 3N79A 2V4JB 2H5EA 2W2MP 5HROB 4JI5F 2GVDA 2XMJA 3FBFA 4TNOA 1RXOB 2HHPA 3H5SA 1RHMB 2UUAF 1M90T 4X4NA 2WOMB 2ZH8A 2NLWA 2QYCA 1AYEA 1PYSB 3OVAA 2ZJPQ 1JLCB 4JI5J 1ZZNA 2B8PA 2UUAJ 1WUUA 3OVSA 4RW4A 2ZH2A 5DZ7A 2IM2A 3FZ2A 3ONQA 4OI3A 4C8KA 2J8SA 1Q95G 2U1AA 4YR3A 2V2VA 3DLKA 4JI1F 3KYLA 4EFAC 1FHTA 5ETLA 3HSJA 2VV5A 3DLJA 2XWXA 3QJLA 1O8BA 1WF0A 3DMJA 3M2RA 4ED7A 4JI1J 4WXOA 2JEJA 2M52A 3BB5A 4ID5A 4PR6A 4IFVB 3OTEA 3UR0A 3WBZA 5AJ3F 2HS4A 2VPZB 3CJRA 3ZZTA 1UVIA 2G0CA 3I9ZA 1S0NA 2IHR1 4C0OC 1HNVB 2V2ZA 4PXBA 4QIWD 2HRYA 4DLEA 5AJ3J 2DR8A 3RGIA 3B4MA 5IOLA 4MK7A 3QBCA 5E0OA 2X1AA 1YQHA 1NK6A 2BX6A 3SYZA 3EZ5A 4U8VA 4NA1A 3Q8UA 2E5JA 4QU6A 1VQ8S 1NSKL 2KTQA 1V5IB 4PKDB 3JTNA 3GJSB 1VQNS 3ZTOA 2E5HA 4YY3F 2EFNA 5D4LA 2B43A 3A8KA 2V34A 1F2GA 3CCWA 1A7GE 2RQKA 2WW8A 4P7VA 3TP2A 5H9EJ 1NPKA 3JSRA 3EDRB 4PQAA 3QIPB 2QRRA 3RYLA 4YY3J 2B4OA 1DBDA 2B4UA 4BBYA 4PRFA 3EZOA 4C4WA 3UDCA 1ZAWA 1BQMA 3HVTA 5H9EK 1IKYB 1YZ6A 1UPMB 2MHEA 5I3UB 1SL0A 2APOA 3R5GA 1Y7PA 3C15B 3OL7A 4NCGA 4O3PA 3RUBL 2GHWA 1SQEA 4HL9A 2HNYA 1XK8A 4B9NA 4JOUA 5HO4A 4OZ3A 3QGIA 5A8RB 1ZZFA 5I3QA 2O67A 2IVYA 1JLFB 2WVFA 5CQGA 1U2RA 3PIOQ 2CQBA 2HFUA 4PWDB 3VGUA 5KFUA 2BJ1A 4NI2A 3VQSA 1HHQA 4Y6IA 4HHJA 3E2EA 1IBKF 4UOCA 3O44A 4KJIA 3M8YA 2VFUA 3Q8QB 1L3UA 3OV7A 4F2RA 2OSQA 3EX7B 4Y2KA 4Y34A 3BBFA 5I42A 3W3SA 5C42B 5HANA 4FS2A 1IBKJ 4Y00A 2WCXA 4EU0A 3C66A 2ZE2A 3CJ3A 1RDRA 1SKSA 2IIHA 3JSMB 1RE1B 4X4UA 1B99A 5KFYA 3V5RA 1X5TA 2GMHA 1O6XA 2JRSA 1F0XA 2JC1A 5D4OA 1FI4A 4DR4F 3PFOA 2MGZA 1DHMA 2OMLA 5B0DA
chains in the Genus database with same CATH topology
2CA9A 2HZAA 2BJ7A 2F1FA 3LGHA 2BJ8A 2CADA 2Y3YA 2WVBA 2BJ1A 2BJ9A 1Q5VA 2FGCA 2NZCA 3BKUA 2WVCA 2PC6A 3QSIA 3BKFA 3OD2A 3PHTA 2CAJA 3BKTA 1Q5YA 2HZVA 2WVEA 2BJ3A 2WVFA 2WVDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CA9 A;  2HZA A;  2BJ7 A;  2F1F A;  3LGH A;  2BJ8 A;  2CAD A;  2Y3Y A;  2WVB A;  2BJ1 A;  2BJ9 A;  1Q5V A;  2FGC A;  2NZC A;  3BKU A;  2WVC A;  2PC6 A;  3QSI A;  3BKF A;  3OD2 A;  3PHT A;  2CAJ A;  3BKT A;  1Q5Y A;  2HZV A;  2WVE A;  2BJ3 A;  2WVF A;  2WVD A; 
#chains in the Genus database with same CATH topology
 3CO0 P;  3G87 A;  5E3C A;  5SZT A;  4NYO A;  1MU2 B;  1G7C B;  4DR4 J;  4EBC A;  3ZXW A;  3M32 B;  2CPI A;  4LBH A;  2YNI B;  1HA1 A;  3DU5 A;  1YBT A;  4ZP6 A;  2ZH5 A;  2EFG A;  3KK3 A;  3P3D A;  1W25 A;  5KG6 A;  2CPJ A;  3OTC A;  4GVL A;  1PAU B;  3H0P A;  2HS0 A;  3D54 A;  5B0B A;  2MHN A;  1RT2 A;  2QA4 S;  4QOT A;  1MN7 A;  3CJQ A;  4WTO B;  2I8E A;  2HEK A;  3FMW A;  3V6J A;  5E33 A;  5CXT A;  3OJU A;  1DQ9 A;  1VBY A;  3KMS A;  1B4S A;  3P49 B;  3N5B A;  3OLB A;  4KRW A;  2X1G A;  1RAJ A;  3GR0 A;  3VGV A;  1N52 B;  3MED B;  1U1K A;  2BZ2 A;  2VG6 B;  2GZO A;  4UY8 5;  1QSY A;  1REV A;  1W2B R;  2GHP A;  5CD4 A;  1IBL F;  4M5L A;  1MWQ A;  3VV2 B;  1BWE A;  1RWU A;  4B9U A;  4G1P A;  3D68 A;  2D69 A;  4A48 A;  3DOK B;  3A8I A;  1GNK A;  2A0F B;  5GAH I;  1IBL J;  1UVN A;  1JX4 A;  3LGH A;  1HQU B;  3T5H A;  2FQQ B;  2HNZ A;  4USH A;  3MMA A;  3ZTS A;  4DF4 A;  4DR6 F;  1ZTT A;  4KH1 B;  2JX2 A;  2MST A;  2IJN A;  4OFZ A;  5IV4 A;  3QT7 A;  1VRT B;  4A47 A;  3NP5 A;  3EGZ A;  2F1F A;  1ZBT A;  1U1R A;  4DR6 J;  2NRE A;  3TQE A;  3CB4 A;  2ASY A;  1NZA A;  1S0V A;  1Q86 T;  4HH0 A;  3V6D A;  9ATC B;  2Z4P A;  2C2K B;  3R5A A;  1KHW A;  1OYD A;  4IKA A;  1D8Y A;  3HHN B;  1GH8 A;  4USV A;  3Q2T C;  4CWB A;  3EVW A;  3BR9 A;  4ZVH A;  3TA2 A;  3Q8V A;  2JFD A;  4UUW A;  3ADA C;  2XTJ P;  4KPC A;  3G2X A;  3EDQ B;  3DLG B;  2W4D A;  3ISN D;  1KLM A;  4R8U B;  3UPF A;  2WSE C;  2VIC A;  4HVZ A;  2CZ9 A;  1R0A A;  2X51 A;  3U27 A;  1Z2Z A;  4DV0 F;  3AOB A;  3PRV A;  4PWW A;  4J9U E;  2KH9 A;  1E6V B;  2VF3 A;  3MOZ A;  3MPW A;  3VR1 A;  4ID8 A;  3AHP A;  1HBO B;  1I3O B;  2FJE B;  4DV0 J;  1YX2 A;  5FLX U;  5B0C A;  3AA9 A;  3CJ8 A;  1B70 B;  3F0N A;  4NLY A;  4U95 A;  4ZVR B;  3DYA B;  3RAX A;  1XMB A;  3FCW A;  4NMX A;  4DX8 H;  3NCQ A;  2MJU A;  1ZA1 B;  2JEG A;  1WKK A;  1RT1 B;  1RAG B;  2BJ3 A;  5KFN A;  1AW0 A;  3D2W A;  1GMV A;  1F5B A;  4DG1 B;  3TAM B;  1R0C B;  2ZD1 A;  1DQ8 A;  1SJQ A;  1VQL S;  4F3M A;  2DNR A;  2E1M C;  1K1Q A;  1FDA A;  2ABY A;  2R8G A;  3RZA A;  4J37 A;  2V69 A;  4J9O A;  2PO4 A;  5KFK A;  4LBP A;  1S4F A;  1LFP A;  1NK7 A;  4R5P A;  2D9P A;  2R7Q A;  1F60 B;  2DR6 A;  1SH3 A;  1YLX A;  5DDQ C;  2ERR A;  3HFK A;  1SVD A;  3CCR S;  4R0J A;  9RUB A;  1FXL A;  2DR9 A;  1DTT B;  5IC6 B;  1LWF A;  1IKX B;  2MYF A;  2WK4 A;  1AZS A;  2CIM A;  4ZVP B;  3KWM A;  1FRI A;  5LT5 A;  2ALY B;  5A8W B;  2DVI A;  2LEA A;  3I9V 9;  1L3S A;  1JJ4 A;  3JTO A;  5F41 A;  4WF9 Q;  4WFY A;  1U2C A;  3PX0 A;  2NPI A;  2N7C A;  3Q8R B;  4MIW A;  2OPS B;  1LWC B;  4QCL A;  1PJ6 A;  1WF2 A;  4K4Y A;  5ETM A;  1RU1 A;  3D0G E;  3RRK A;  3EVO A;  3QRP A;  4ZVE A;  2GIF A;  2GIR A;  3MUR P;  3EMT A;  3BN7 A;  3PW7 A;  3RBX A;  2O5D A;  3MCN A;  1C4A A;  5AE1 A;  4KV8 A;  2M8D B;  2VIH A;  4GMK A;  4Z2X A;  3DOM A;  1QAX A;  2QLX A;  4DPY A;  2XY6 A;  2XS5 A;  1UKU A;  3MUM P;  5HLF B;  1RTD A;  1N5Q A;  1RWW B;  1PG5 B;  4HDG A;  4CLP A;  2JJ4 D;  2L9D A;  1SJ3 P;  2QA1 A;  3QGG A;  1ZS6 A;  4LRD A;  2O1P A;  5CCL A;  1RT6 B;  4R0E A;  3BGR A;  2W8K A;  4NXN F;  2O66 A;  3G8S A;  4FF2 A;  1HPZ A;  1MLA A;  2C3U A;  4ES1 A;  2RF2 B;  2JNJ A;  1W26 A;  4FF1 A;  2ZBP A;  3DDK A;  2OPP A;  1IJE B;  4DSE A;  4NXN J;  2HBQ B;  1HAR A;  1LQ9 A;  3V81 B;  3TZZ A;  3OUY B;  1RCO B;  3CE8 A;  1U45 A;  1UZD A;  4F36 A;  2OEK A;  2K1R A;  2VZ9 A;  2RJZ A;  3MAH A;  2KHD A;  2J76 E;  4E2F B;  2N4D A;  5K8O A;  4ECX A;  2DK2 A;  1OYE A;  1RWX B;  2OPR B;  3BO4 A;  5KT2 A;  3R3T A;  4DPX A;  2KL8 A;  3PW4 A;  2VDH A;  4DCJ B;  4J9K A;  1O5J A;  4XPC A;  4DPW A;  1TL4 A;  2Z2Z A;  4B3O A;  4DUT A;  1NDP A;  2QMX A;  4MKV A;  2KZZ A;  3PXG a;  2R7T A;  3TZX A;  4ENO A;  2HLT A;  5EN1 A;  5ETN A;  4Z7Y A;  1LV5 A;  3DKD A;  2DIV A;  1P6T A;  4A46 A;  1S77 D;  4QWE A;  3DRR B;  3UD4 P;  2NPF A;  2J0S D;  1IWG A;  1SQG A;  2C28 A;  4KO0 A;  2XMK A;  4DPT A;  2P2C B;  2P9G A;  1JQG A;  5KFW A;  2ZH7 A;  1U24 A;  4JV1 A;  3EGV A;  5GAH U;  1U09 A;  1LW2 A;  4NZ6 A;  3KJV A;  5KG5 A;  4DR2 F;  1B7F A;  5L1I A;  5HQM A;  2G2Y A;  3CED A;  1UJ6 A;  4DSI A;  1GXT A;  1LNQ A;  1TKT A;  2CJ9 A;  3PW0 A;  2ZBR A;  4DR2 J;  3BR8 A;  5L9X A;  4M5D B;  2GQ2 A;  5LJ5 Y;  1CQM A;  3TEH B;  4C8Z A;  3M7V A;  2PMZ D;  1DLO A;  2HQ3 A;  4L6V 3;  4YOE A;  1WOS A;  2VU5 A;  2BDP A;  4X4V A;  2BE2 B;  3J80 Y;  4ZHR A;  3QSY B;  1Q7L B;  3QSI A;  1WEX A;  2PGC A;  5LL6 d;  2BXJ A;  3K5P A;  2R7X A;  4GO5 X;  4LRC A;  1Y3J A;  1WEY A;  1D1U A;  4WKY A;  3A3O B;  3ZTQ A;  4F50 A;  4P2X A;  5IC4 B;  4FXV A;  5AXL A;  3UCU P;  4CLK A;  2OSR A;  4DEZ A;  4AUK A;  3DI6 B;  2H54 B;  1B7Y B;  1BY9 A;  1FNM A;  3MM9 B;  4DN9 A;  1ZPV A;  1R8P A;  3FMB A;  4ZIV A;  4N76 A;  2C2O B;  4K4W A;  2DGV A;  4TQS A;  1RWK B;  1TQL A;  2XZD B;  1GX6 A;  3ILL A;  4ZMM A;  3SCL E;  1RTZ A;  2ZVS A;  4WZQ A;  1BGX T;  2GA7 A;  2X7I A;  1RQ0 A;  1NLK L;  5J1P A;  3WC2 A;  3KTQ A;  1VQ6 S;  3RB0 A;  3FNN A;  3PYD A;  1U8W A;  2DTJ A;  3G6E S;  2R2U A;  3HCX A;  4FBT A;  3OQ2 A;  5KFJ A;  4WPA A;  4W92 B;  1BQN A;  2B7C B;  2VKZ G;  2HVE A;  4A8F A;  4PG4 A;  3H40 A;  3NG8 A;  5DDR C;  1RKJ A;  4RNF A;  3LOU A;  4DSJ A;  4DL3 A;  4O3R A;  4ZIT A;  2CPZ A;  3DGP A;  1RAE B;  2RQ4 A;  3ZC4 A;  3E01 A;  4KHM A;  2DPJ A;  1OY6 A;  4CLZ A;  2ZOG A;  2AYB A;  2ZIT A;  1S12 A;  3NKY A;  4RO0 A;  1JKH B;  1VLY A;  5DQG A;  4B9S A;  5IWA F;  2A18 A;  3E8O A;  2R7U A;  3UD3 P;  1VHI A;  4WP3 A;  1TTH B;  1UAW A;  1WC4 A;  1FKO B;  2MKY A;  1VR6 A;  2XLK A;  3BKT A;  3OJS A;  2CQ4 A;  4WYW A;  5F8I A;  5IWA J;  3K5M A;  3D6F B;  4EZ6 A;  3R7N B;  5FD1 A;  1I6J A;  1N5V A;  3M8Q A;  2UVU A;  3WZ0 A;  2WSC C;  3AT1 B;  1XEZ A;  3UNY A;  5EWF A;  1RTI A;  2F9D A;  2G2Z A;  5KAK A;  2QYG A;  2W7A A;  3VCD A;  4ZPB A;  3AJD A;  2U2F A;  4IR1 A;  2JSX A;  3HKW A;  4M63 A;  1S9G B;  1QLN A;  2KJW A;  1C1B B;  1YGY A;  4I67 A;  5LMN F;  1IVZ A;  1NSP A;  1Y10 A;  4URG A;  3TUP A;  4U9R A;  1S1V A;  1S6Q B;  4TYB A;  1UWB A;  3HHL A;  4PXD A;  3W9J A;  1RA7 A;  3SIP B;  5F0U A;  5LMN J;  5K14 A;  4FYW B;  3CCQ S;  4ZVS B;  2SXL A;  3GZ7 A;  5CYM B;  1OS5 A;  4WXW A;  5LXR A;  3FVY A;  5C42 A;  1RT4 B;  4J9L A;  3NGK A;  1PBU A;  4U7U K;  1VQ9 S;  1SB6 A;  3QRR A;  2EVZ A;  2A2C A;  3GG0 A;  1S7H A;  2HQF A;  1VLO A;  5GME A;  1NCL A;  1RK8 A;  4I4B A;  4RW7 B;  5A8K B;  4MFB A;  5C2C A;  1T05 B;  3E3X A;  4J91 A;  1U1N A;  2E5I A;  5HP1 B;  2EK1 A;  3KKF A;  4CI0 B;  2DGW A;  2GJ2 A;  1XTZ A;  3TO8 A;  1J5E F;  1VQY A;  2ADC A;  1R6V A;  1E6Y A;  3EGW B;  3M9N B;  4F4Z A;  2XG8 A;  2LKZ A;  3QO9 A;  2PDA A;  1UZH A;  1J5E J;  3JTP A;  5L1J A;  3T6J A;  2J7W A;  5EGY A;  4RJV A;  1V6H A;  1EP4 A;  4OJH A;  4C48 A;  4Q0B A;  2EG1 A;  2IVF B;  4BCA A;  3UCZ P;  4P10 A;  2KM8 C;  4M5I A;  3I5B A;  3EE3 A;  4ED1 A;  3WX4 A;  2AGQ A;  4PYD A;  4K50 A;  3MEE B;  1MWZ A;  1PO6 A;  2FVS A;  1Q8K A;  4P71 A;  4XDC A;  4IDK A;  3GV5 B;  2M4M A;  4IG0 B;  5IT9 U;  1RHR B;  5DM6 Q;  2A6O A;  2WB1 D;  3X1L B;  4YQW A;  2UVV A;  5KOX A;  2R4F A;  3KK1 B;  1YJU A;  2HGN A;  4CTA B;  2ZBQ A;  4NEY A;  2IPO B;  3R9L A;  1FVQ A;  1RAH B;  1TL7 B;  3P96 A;  1SUQ A;  4L72 B;  2XGQ A;  2NZC A;  2M70 A;  2HAI A;  2G0I A;  4WU2 A;  2H9Z A;  5GMD A;  3FSX A;  1VRU A;  2WW4 A;  1Y4Z B;  3KHG A;  4JUZ A;  4EEY A;  1XWL A;  5IM0 B;  2PD1 A;  5AXK A;  3SV4 A;  1JLA B;  2NSC A;  2WBR A;  1HYS B;  4LSZ B;  3NAI A;  3KJF B;  3MZI A;  1ZM9 A;  2DRB A;  1DAR A;  2VL1 A;  2FJX A;  2ROG A;  2FJB B;  1VRQ C;  1T9Y A;  4OZ0 A;  3GYX B;  2FVR A;  1YDL A;  5C25 A;  1IN0 A;  2MZ1 A;  5AE2 A;  4CO2 A;  4QU7 A;  1FNX H;  3J81 Y;  3KJQ B;  5D15 A;  2HBZ B;  3UDE A;  1KFD A;  2QN6 B;  4XK8 C;  1TMM A;  5FDL A;  4I2Q A;  2PFF B;  1FE0 A;  3M4X A;  1W7W A;  4ZN1 A;  2YKM A;  4R8U A;  3MR6 A;  5C7P A;  1TL3 B;  3RU0 A;  4A8Q A;  1YRX A;  4NRU A;  3PR4 A;  3HO1 A;  5LOQ A;  2NYH A;  1SKR A;  1K44 A;  1WI6 A;  4L75 A;  2VG7 A;  4KC5 A;  2KO1 A;  1EZZ B;  1N36 F;  4IH6 A;  6FDR A;  3GMG A;  3AD8 C;  4A8W A;  1KKH A;  3H2U B;  2VQF F;  1IQZ A;  4HTI A;  4TXS A;  4Q2M A;  3W5X A;  3CWJ A;  3ZZ0 A;  1C0T B;  1SV5 B;  2EKY A;  2OMO A;  1N36 J;  3F56 A;  3QT8 A;  3EZU A;  3VHQ A;  1R31 A;  3G96 A;  2VQF J;  2VBX A;  2G1H A;  2FJA B;  3DM2 A;  1ICE B;  3C14 A;  3LAM A;  3M1V B;  3J7Y U;  3PZP A;  3BDE A;  3AQO A;  4QZV B;  1NK4 A;  4X4S A;  1TKD A;  5HAO A;  2RDJ A;  3FSY A;  2UXD F;  5CHC B;  3UE2 A;  3GIM A;  4GKK F;  4PAB A;  2WVC A;  1J5O B;  2W25 A;  2MQL A;  4OZJ A;  4EI2 A;  1CJT B;  4OYB A;  1K73 T;  1IBM F;  5E3P A;  4YS2 A;  5A2Q Y;  2UXD J;  3BO3 A;  1R8C A;  1UEV A;  5D4N A;  1VBX A;  4GKK J;  2VAS A;  1VBK A;  1H7X A;  3OTO F;  4KKO A;  1N5S A;  1IBM J;  3FJ2 A;  5D6G A;  4RZR A;  3CDU A;  2PFD A;  2FZK B;  4MH8 A;  3Q22 A;  4ICL B;  3OTO J;  1N6Q B;  3KK2 B;  1NSA A;  3MEC B;  4U7U D;  5DDO C;  3IAS 9;  1U1M A;  2QMW A;  2HK3 A;  5CA5 A;  1ZPW X;  1FFW B;  2DNP A;  1N0U A;  4YHH F;  2DCU B;  2XMA A;  2CG8 A;  1X5S A;  2EW9 A;  3O8W A;  2AEM A;  2CZ4 A;  1G1X A;  4ZS6 A;  2VOP A;  4H4K A;  2YNF A;  3GU0 A;  4YHH J;  5KFR A;  3H7H B;  4O3N A;  5GAD I;  2MMY A;  2OPS A;  1LWC A;  3FGV A;  2W8L A;  3BPS P;  3ZTR A;  2Q66 A;  1IBC B;  2AF6 A;  1FX4 A;  2CPE A;  3VZH A;  1CQN A;  1HBU B;  1S9E A;  3AOC A;  4K4X A;  3U02 A;  1R89 A;  4C8M A;  4FKX A;  5A76 A;  3KLE B;  1T9X A;  1TUG B;  5KT5 A;  4TVA B;  4USU A;  4EBD A;  5CZV A;  1KDN A;  4N56 A;  5KFB A;  2V4Q A;  1YJR A;  3QT6 A;  3QLH A;  1Q8B A;  4PXC A;  2XUL A;  3A4T A;  4L76 A;  3NGS A;  1LK7 A;  2LLZ A;  4RPF A;  3CD5 A;  4DF8 A;  4O3Q A;  1WG4 A;  2VG5 A;  2CPX A;  1S1X A;  1SCJ B;  2K3I A;  4CDI A;  1FWP A;  2EFV A;  3T6B A;  3IP0 A;  1FEE A;  1X4D A;  4JV0 A;  2RRN A;  3K58 A;  1UP1 A;  1Q4R A;  2F8M A;  4JI3 F;  1K0T A;  3ZFV A;  3R5B A;  1KRP A;  1QD1 A;  1N34 F;  2DXF A;  2DNZ A;  3TUJ C;  3HSD A;  2BAC A;  2MZJ A;  2J6U A;  1TKZ B;  2QEX S;  4ER8 A;  4JI3 J;  2RKI B;  4OZ5 A;  3HZE A;  4P6Q A;  1N34 J;  1RSC A;  2PA3 A;  3IRX A;  2CWK A;  2GC8 A;  1OY8 A;  1UTA A;  2E5G A;  2GVD B;  2XLJ A;  4LRE A;  2VD3 A;  1IM4 A;  4ED8 A;  2YKQ A;  4N8O A;  3NAH A;  5G4D A;  2A3J A;  3R7B B;  3TNV A;  4WBF A;  2NZ4 A;  4S0M A;  4K0K F;  1RHK B;  2DXE A;  3EPI A;  2HFV A;  3JAM U;  4C97 A;  4RW4 B;  2UU9 F;  1SC6 A;  2KZM A;  1NU4 A;  4TU8 A;  1H73 A;  3I5A A;  4K0K J;  2Q6C A;  1T11 A;  4DL7 A;  4NYZ A;  3T1H J;  1Q81 T;  2UU9 J;  1T9V A;  3DLK B;  3FK4 A;  1S0O A;  4ZPA A;  2RHQ B;  4USK A;  2Y1I A;  1HHT P;  1HI1 A;  1HKA A;  4K7Q A;  2R42 A;  3D6M B;  1NND A;  2BM1 A;  3DMJ B;  3M2R B;  2WVE A;  3SQG A;  1R3N A;  1DZ5 A;  2HRT A;  2ROP A;  2DH7 A;  1T02 A;  3R6L B;  3VAH A;  1U4B A;  2ZJQ Q;  3G82 A;  1CG2 A;  4EO6 A;  3HI9 A;  1V5V A;  4RL1 A;  3FQK A;  4HEA 9;  1NK9 A;  2B8Q A;  4OHV A;  3UCG A;  1DQA A;  3NMR A;  2F3J A;  5IZH A;  3L9Z A;  2FDN A;  2YX4 A;  1Q7Y T;  1RAF B;  3T5J A;  3MR7 A;  4Q7A A;  3UVJ A;  1Z2L A;  1HL6 A;  4ZN3 A;  4IOA Q;  2FGC A;  2MKJ A;  4K5S A;  4CLT A;  4DUZ F;  3LPY A;  4F4Y A;  4JB8 B;  2V8V A;  3FKB A;  5H1S V;  4U6P A;  2ZZT A;  4OX7 A;  5LM7 E;  1FRM A;  4BC9 A;  3CNQ P;  4WYL A;  2UV8 A;  2HBR B;  4ED6 A;  2V6A A;  1GMW A;  4I6Y A;  4DUZ J;  2B4V A;  2EG2 A;  2XHC A;  1EQ0 A;  3TUZ C;  4LT6 A;  3RW7 A;  5CCM A;  1R6Y A;  2LYV A;  1BQM B;  5A0Y A;  3MF5 A;  3HVT B;  2IJF A;  2C2E A;  3OT9 A;  3C3L A;  3QZ8 A;  2ZUA A;  1VK8 A;  5KT4 A;  3W63 A;  3DLL Q;  2XWY A;  4NCG B;  3FCV A;  1BLU A;  3VAI A;  5B0F A;  2HGM A;  2HNY B;  1UW9 A;  2HGL A;  3CMA S;  5KFV A;  4ZCK A;  4KR0 B;  2ZDO A;  1QM9 A;  2V9W A;  3Q2S C;  4PG6 A;  2JH3 A;  1RAA B;  4F3Q A;  3LP2 A;  2G13 A;  1LW0 B;  2MY7 A;  4NLS A;  1F5A A;  3BJY A;  4P72 A;  3MM6 A;  1VQS A;  3AD9 C;  4NI2 B;  1NME B;  2PN6 A;  1EIY B;  3GP9 A;  4CT8 A;  2ZWO A;  3CME S;  2J0Q D;  2EK6 A;  1QE1 A;  3OR2 A;  4Q2L A;  3TYT A;  3VVT A;  4KPY A;  2D7S A;  5CZX A;  4V19 J;  4OJ1 A;  3PHT A;  1KN6 A;  4OYO A;  2LDY A;  4DL2 A;  8RUC A;  1W2I A;  4QWB A;  3TZW A;  4URS A;  2B0G A;  4DCP B;  4B3M F;  2ZE2 B;  1CBK A;  2BAB A;  3NWG A;  2L9N A;  1RTH A;  5L8R C;  2BOA A;  3GTY X;  3KFW X;  4B3M J;  2MGZ B;  3C6T A;  2OTL S;  2PEH A;  3IBF B;  1TL1 A;  4DZ6 A;  3JXO A;  4C8O A;  4YB6 A;  4MKY A;  3BO2 A;  5F9L A;  4H4M A;  4U96 A;  3LAL A;  1RT3 A;  2IC3 A;  2E44 A;  2JC0 A;  2HQD A;  1SIZ A;  2CAJ A;  5F3Z A;  1NJW A;  4IUF A;  1HW8 A;  2YH0 A;  1WC5 A;  2XCP A;  2OEJ A;  3KK3 B;  2D3O 1;  1S1U A;  1IR0 A;  2Y1R I;  1NK0 A;  1RT2 B;  4OIX A;  3ILJ A;  1VI7 A;  1FD2 A;  3QGP A;  5KFE A;  2PSZ A;  4YP3 A;  1S6Q A;  2FZG B;  1RBO B;  4C8N A;  3OR1 A;  3FFI A;  3M2V A;  3PV8 A;  3W5Z A;  5GAD U;  3AJ2 A;  1RYR A;  1HWU A;  2QTW A;  1XR7 A;  2MKI A;  4IOB A;  4J9N A;  1FK9 A;  3NCR A;  2FHJ A;  2R7R A;  1S79 A;  2D74 B;  3A3N B;  2C3O A;  4OI2 A;  1KVI A;  5ETV A;  3WIU A;  1SL2 A;  2LEP A;  1N5Y A;  1JIH A;  4CP5 A;  1SKU B;  1Q78 A;  4HI2 A;  2F8H A;  2K06 A;  3MAA A;  4WIQ A;  4ELV A;  3PO5 A;  4KTQ A;  1KQG B;  4P7T A;  3D3B J;  3RBZ A;  1OWX A;  1SJF A;  3CD0 A;  5HP1 A;  4IG3 A;  4FN5 A;  1HHS A;  1RBL A;  4IRC A;  3MMA B;  2FHM A;  3UO0 A;  3HD1 A;  3SEO A;  1IJF B;  1UFL A;  2CQC A;  2NXU A;  4FYY B;  2XNR A;  1RT7 A;  1VIO A;  2J9E A;  2J0X A;  2EBG A;  1WAC A;  1M5V C;  1H6K X;  3ENV A;  1YJN S;  4P52 A;  2WSF C;  2RSQ A;  1WSR A;  2DHH A;  4YFU A;  1RT5 A;  4DU8 A;  3FSI A;  3V6D B;  4BWM A;  3CCJ S;  4LF1 A;  3CC4 S;  4ZOS A;  1VK3 A;  2VPX B;  3QWU A;  3VVU A;  4ECS A;  3HD2 A;  3IM8 A;  2FD2 A;  2PEB A;  2RAQ A;  2DEI A;  1NKC A;  4PCQ A;  4IQX A;  2VFV A;  3MTJ A;  1WG5 A;  3N28 A;  4OQJ A;  4DDF A;  3I56 S;  3D5M A;  3V4I A;  2HW3 A;  2LXU A;  3G8T A;  4LR9 A;  3SZ2 A;  1NAQ A;  4FXD A;  2H4Y B;  1KLM B;  2OEL A;  1OJ4 A;  1CJU A;  2G9O A;  4HR2 A;  3NY0 A;  3OFG A;  4U67 Q;  2HMI A;  3Q83 A;  2MKC A;  2ATC B;  2V68 A;  2IMO A;  1R0A B;  2L08 A;  3RRH A;  2DR7 A;  3CMQ A;  5ETT A;  5G0R A;  4YR0 A;  2V94 A;  2F40 A;  3W1Y C;  4EO8 A;  3P45 B;  2W2O P;  4OHY A;  3AOA A;  1P8G A;  4RNH A;  3K17 A;  1HQE A;  2PA8 D;  3GG1 A;  3WC0 A;  1TKX A;  3A13 A;  3IBC B;  2RS2 A;  1X4B A;  3H42 A;  5JXS A;  1ACM B;  2OP5 A;  2BAN B;  1RWN B;  2VFT A;  4CH0 S;  1TMJ A;  1WHV A;  3MM8 A;  3CDW A;  1IWA A;  1ZAX A;  4PYA A;  3K5O A;  4M5J A;  3AJ1 A;  3RAQ A;  2FGO A;  2XCA A;  2HS3 A;  5LXY A;  2B7B B;  3CCT A;  4AXI A;  2PI4 A;  3CDB A;  4DV5 F;  3HFV A;  1WI8 A;  3G6X A;  2AYM A;  2K8G A;  1MSW D;  1FTC A;  5THW A;  3R97 A;  3MPD A;  2LVW A;  4R5P B;  2K3K A;  3EJM A;  4DV5 J;  4F2S A;  3D28 A;  5E5N A;  5GVQ A;  2VC0 A;  2CJK A;  1RIS A;  4B3T F;  1Y00 A;  1GXL A;  4M95 A;  1QSL A;  4KGK A;  1U47 A;  4R25 A;  2IRX A;  4LFB J;  1S6P A;  4B3T J;  1XN9 A;  1LWF B;  4CZC A;  1FRK A;  2BM0 A;  1AZS B;  1SC1 B;  5DQH A;  4ETX A;  1MMN A;  1X31 C;  4FPR A;  3M9M B;  3CT9 A;  4ILM A;  4PG5 A;  4GVB A;  1SV5 A;  4CYU A;  3LTO A;  2HPU A;  4QIG A;  3G6V A;  1R8B A;  3PIP Q;  1KQK A;  3UNG C;  3G86 A;  2GNK A;  4DV6 J;  4B02 A;  1F9F A;  4FBU A;  2XMU A;  2P9E A;  3H59 A;  4IFY A;  1FFG B;  3M8S A;  2RB7 A;  2B9E A;  3DXB A;  5J2P A;  3PX6 A;  2V8P A;  5IT0 A;  1YG0 A;  3D1H A;  3TJA A;  4F02 A;  1H2U X;  1WHY A;  2L3M A;  3ENQ A;  3MCM A;  4LF5 F;  4KV8 B;  2QLJ B;  3IWL A;  5K8P A;  1RAO A;  3G4S S;  2DJW A;  4KHR A;  3DOM B;  3HPO A;  3BQ1 A;  2BKO A;  4DV3 F;  4QBU A;  3BPD A;  4FF3 A;  2ZHO A;  1P9Q C;  2C2N A;  4LF6 F;  4L3K A;  1HBM A;  1BD6 A;  4DX6 A;  2M9K A;  3IR6 B;  1T03 A;  1RHU B;  3POT A;  3ZZY A;  1AFJ A;  3VAG A;  3G71 S;  4DV3 J;  4ED2 A;  2N7Y A;  2YBV A;  1TP7 A;  4LF6 J;  4N7T A;  1MWY A;  1HPZ B;  4DPU A;  3N01 A;  2OPP B;  2GAH C;  1JXL A;  1UPP A;  3VGT A;  2DH8 A;  5DZ6 A;  2CFX A;  4ED0 A;  4RR5 A;  5HI7 A;  3W66 A;  4HHH A;  1LK5 A;  4DHV A;  2K1R B;  2AIR B;  3LAK A;  5U47 A;  4C6A A;  5CAA A;  5CAB A;  2R2R A;  3CCZ A;  2W4C A;  4ECY A;  2GJI A;  4K5R A;  1CJK A;  2ASD A;  3NCP A;  3HFZ B;  3IS9 A;  3C46 A;  2WTF A;  3A12 A;  2CPH A;  4QYZ J;  5D8H B;  1FRH A;  4OI0 A;  4GC7 A;  2E7V A;  2BKP A;  2NCK L;  2PT0 A;  3I4P A;  3W7B A;  4B3O B;  2CRL A;  3IRW P;  3H25 A;  3KLI B;  2DIT A;  4AL5 A;  2J6T A;  2WVD A;  1OY9 A;  1XR5 A;  4GO7 X;  3DLB A;  2VPW B;  4QYZ K;  1CUL A;  2ZOF A;  5DQI A;  2ZHB A;  4PZV A;  3KDO A;  2AV5 A;  2E1P A;  4NAS A;  3MUV P;  2BRL A;  2NYI A;  4PQU B;  5ITH A;  4HH1 A;  3M8Z A;  4M5N A;  5KG1 A;  4CQ1 A;  4KO0 B;  4TY9 A;  2Y8Y A;  3I55 S;  3OLA A;  2W2P P;  3H4D A;  2FPH X;  2UUC F;  2AEJ A;  4NA3 A;  4EK2 A;  3T19 A;  3CCE S;  5IT4 A;  1LW2 B;  2Z58 B;  2N3L A;  3KJV B;  4RBT A;  1NEE A;  4PPZ A;  5HVF A;  4MK8 A;  4CLL A;  2QL5 B;  4DFJ A;  1RI7 A;  1B0P A;  5M2P A;  2LEC A;  5HVG A;  4DV4 F;  1TKT B;  4CLW A;  5LMU F;  4F4W A;  5B7W A;  3S7R A;  3ULH A;  4X65 F;  1BHN A;  1HNI A;  3CJ5 A;  2XEX A;  5AE3 A;  3H20 A;  3LP1 A;  1SJR A;  1DLO B;  4DV4 J;  2HYI B;  2IA0 A;  4F26 A;  4F4X A;  1G3O A;  2GW8 A;  5LMU J;  3DLE A;  2KT2 A;  2GML A;  2ZZM A;  3Q24 A;  2EI5 A;  1KOH A;  4ZHR B;  3M2U A;  4I68 A;  2JLE A;  1WEL A;  2QLF B;  2KJV A;  2C2R A;  4ETZ A;  1B3T A;  1UWA A;  3EUN A;  4DL0 C;  3GYN A;  4IO9 Q;  1TFW A;  3B78 A;  4IH5 A;  4ZKA A;  4LRA A;  4JV5 F;  4A8Y A;  3ENA A;  1XMQ F;  3SCK E;  2QMU B;  1VCT A;  1YSJ A;  1P27 B;  3SFU A;  4J90 A;  2HIQ A;  4P9S A;  2DH9 A;  4I7F A;  3TOQ A;  1ZM3 A;  1HI0 P;  1L3T A;  2CQ0 A;  4JV5 J;  3Q8P B;  1C1C A;  1XMQ J;  3CUN A;  5JUM A;  2H1Y A;  3CJ4 A;  3NNH A;  3GB0 A;  2BYC A;  4X4T A;  1HBN A;  2R8H A;  1YRT A;  2M2B A;  4UTG A;  2HSE B;  4G65 A;  2V0N A;  1AB8 A;  2E9R X;  4C8Y A;  1BQN B;  4DS5 A;  2F5G A;  4B9V A;  1YZ7 A;  2BA9 A;  4AQY F;  4ECU A;  4DL6 A;  2PE8 A;  1GAO A;  3DGP B;  4NLT A;  3W62 A;  4FZV A;  4OHW A;  1HD1 A;  4AQY J;  3E01 B;  3ENW A;  2Y3Y A;  4CNY A;  1IUJ A;  4UT4 A;  4ZJQ A;  2Q3P A;  4FKY A;  3QPI A;  1U25 A;  1SJ4 P;  5DM7 Q;  5E2Q A;  1NHU A;  1H0H B;  3FQL A;  3HP6 A;  5KFO A;  1U6F A;  2YKO A;  1X9W A;  1A0O B;  1D09 B;  5KFQ A;  4YN3 B;  1B0V A;  4ZPV R;  2DKO B;  3GFY A;  1EJ7 L;  1F1B B;  3H2L A;  3EM1 A;  3M8Q B;  4F7V A;  4CLF A;  2DGX A;  2MLY A;  1RTI B;  2AJF E;  2EC2 A;  2QJ3 A;  2XNQ A;  4RUH A;  4RWW A;  1NB2 A;  3UDV A;  4D3H A;  1GXU A;  2CQH A;  4RW9 A;  1Q5Y A;  1T3O A;  1LW0 A;  4DQS A;  2P9C A;  4PAA A;  3L3C A;  4PG7 A;  2ZZN A;  4DQP A;  1S1V B;  1UWB B;  3HHL B;  2QE5 A;  4DFM A;  3GQC A;  5K14 B;  4K4Z A;  3ZTP A;  1UCN A;  4CLU A;  2I5J A;  2MZR A;  1FRJ A;  1YI2 S;  4B9T A;  2D3O R;  2XSJ A;  1OMS A;  4DL4 A;  2FC8 A;  2DR5 A;  3M05 A;  2MQP A;  4QPT A;  1H74 A;  2OKQ A;  3I0R A;  3EXY A;  1IKV B;  3CDE A;  4KGM A;  2EPI A;  3TX8 A;  3NEK A;  4MFB B;  2OTJ S;  3NS7 B;  4JI7 F;  2AJ0 A;  3SSQ A;  2KXF A;  4ECZ A;  3LPE A;  3M8P A;  2D41 A;  4QW9 A;  2DYA A;  3K2Y A;  2R9L A;  4DU7 A;  3HDS A;  3HHD A;  2GX8 A;  3JB9 k;  4JI7 J;  1N32 F;  3QAE A;  3KLG A;  3PNI A;  3NMA A;  4FYX B;  1S9F A;  3AFG A;  4EBE A;  1E6Y B;  4O44 A;  1GT8 A;  4DX7 A;  4B3R F;  3DCA A;  3QO9 B;  3THV A;  1DRZ A;  1N32 J;  3PKM A;  1NRK A;  2DY9 A;  4NML A;  2I0X A;  4LSL A;  1TK0 A;  4C3K A;  4KFB A;  2VOO A;  1MRO A;  1EP4 B;  4B3R J;  5C5J A;  4Q0B B;  5F0W A;  3ILI A;  2KFY A;  3NS5 A;  1P9Y A;  1KSP A;  3HK2 A;  1Q16 B;  1BWV A;  2C1E B;  5K9F A;  3PYF A;  3W5Y A;  1B64 A;  2VFR A;  4IDK B;  1BUX A;  2ZKU A;  1HI8 A;  2MY8 A;  1VQK S;  3DDI A;  3GCW P;  1LWE B;  4CH7 A;  4FNH A;  1VIS A;  4ZP9 A;  2W4P A;  1X5O A;  1T0T V;  2XYG B;  2XYH B;  3MFI A;  4RU2 A;  2WRM A;  2ZHA A;  1JLQ A;  1F5C A;  2R7S A;  2AGP A;  2VON A;  4OLO A;  1SUQ B;  2L48 A;  2KFZ A;  2VB6 A;  3NBP A;  2ZWP A;  5HQL A;  3M6V A;  5KT3 A;  1F3F A;  5KFX A;  4G1Q A;  5K20 B;  1VC0 A;  4WZM A;  1H2V Z;  3K8W A;  4MKA A;  1WKJ A;  1HD0 A;  1VRU B;  4B3S F;  2MZQ A;  4WE1 A;  4XPE A;  1SC4 B;  3GV8 B;  4UUX A;  4UY8 T;  1KLN A;  2XO7 A;  4X4Q A;  4A8S A;  2D3Z A;  3TI0 A;  3PYG A;  4I6W A;  4RW6 A;  3KMQ A;  3LWM A;  3TA0 A;  3CTR A;  4B3S J;  1FEH A;  2RML A;  2V2K A;  1F6T A;  1O51 A;  4DJB A;  2MQ8 A;  1TAU A;  1HW9 A;  1WTB A;  1K47 A;  1NHK L;  3MXH P;  3Q86 A;  2MKK A;  3DLH A;  1FNO A;  1IR1 A;  1TZ0 A;  3KG1 A;  5GAE I;  1M1H A;  3HT3 A;  4L3N A;  5C25 B;  2YQ1 A;  2DBB A;  2FB0 A;  3CPW R;  1PBA A;  5FDL B;  4I2Q B;  2XY7 A;  2XSF A;  3R7S B;  5T41 A;  1N48 A;  2YKM B;  3OFH A;  4HYK A;  2J7U A;  2G0J A;  2JWN A;  2LQB A;  2Y0B B;  2YKA A;  2OFG X;  2YNH B;  1HNX F;  2HZC A;  3N6L A;  2DGU A;  2VG7 B;  3S6E A;  1KP6 A;  3VTI A;  2DD8 S;  2AX0 A;  4UOH A;  2OJ3 A;  3V6K A;  1GTE A;  4C8L A;  4DMZ A;  4CO5 A;  2RNE A;  1S48 A;  1YJ7 A;  3MD3 A;  1GMW D;  5HMY A;  4OZ2 A;  2XY5 A;  1AUS L;  2BAN A;  2YWE A;  4WJB A;  1U2F A;  4YB7 A;  1NPR A;  2UP1 A;  2QL9 B;  3DM2 B;  3IO1 A;  3C14 B;  1QUP A;  5KFH A;  1RAC B;  1S6O A;  1WEZ A;  3O1L A;  2G2O A;  2COL A;  3TA1 A;  2LP4 A;  2QLB B;  1FDN A;  4RW8 A;  2BUN A;  2Z0G A;  4K4S A;  1R0B G;  1JJ2 R;  2HND A;  3KLH A;  3A8J A;  3MR5 A;  1NB7 A;  3W8P A;  4MAK A;  4N5S A;  1NH8 A;  2FJV A;  3QNW B;  2QL7 B;  3L95 X;  3AB2 B;  1DY3 A;  4G6V B;  2RHS B;  1NDK A;  4KKO B;  2Z57 B;  5FLX Y;  3EGN A;  2CNL B;  5CYJ A;  4CO4 A;  2ZH1 A;  3RB4 A;  4K4U A;  1VJW A;  6FD1 A;  2Z56 B;  2EEY A;  1T94 A;  1TEL A;  1NBE B;  4ELU A;  4NWB A;  2DGO A;  3PAC A;  3P5B P;  2XM3 A;  1OSD A;  5KFL A;  1YK9 A;  5KT7 A;  5F9N A;  2GV1 A;  1S1W A;  3RG6 A;  2RQC A;  1X0P A;  3HVW A;  5ETK A;  3A3P B;  5IQ6 A;  4DCO B;  1IKW A;  2DHS A;  2DT9 A;  3H5X A;  1JLE A;  2HHQ A;  2UUB F;  3UWT A;  4CLY A;  1MML A;  3SDE A;  3NOC A;  2YNF B;  3B8H A;  4I2P A;  3N6M A;  1U7L A;  2HVH A;  1F9E B;  1KVJ A;  3W65 A;  2UUB J;  1APS A;  2J8A A;  4DL5 A;  3GFZ A;  4ZVG A;  2HK2 A;  3R5J B;  2PMW A;  3FZB A;  1S9E B;  3Q0A A;  1XER A;  4AD6 A;  4OX9 F;  3ZZU A;  4E0D A;  2Z8Q A;  2R3V A;  2PI5 A;  2I2Y A;  2E1R A;  3CJ2 A;  1FX2 A;  4ZJL A;  1NJX A;  5HJX A;  4DZD A;  2YKN A;  5HVH A;  2DXD A;  2CYY A;  4WKR A;  2OIH A;  1GQE A;  2RS8 A;  4OX9 J;  1IQT A;  4AL7 A;  3UI3 A;  2LA4 A;  3BSA A;  3QLH B;  4NCA A;  2RUG A;  3HJF A;  3RR7 A;  3DFE A;  3PKY A;  2EKN A;  4IR9 A;  2MKH A;  1V3Z A;  2VG5 B;  3VF0 B;  1S1X B;  2LMI A;  3H5U A;  5KFC A;  4X64 F;  1Y5L B;  2OEM A;  1J2V A;  3UW1 A;  4LJM A;  4MIA A;  1CVJ A;  1JLG A;  3UFC X;  2K7J A;  3IG1 A;  4X64 J;  4DLG A;  2VC1 A;  1K1S A;  3R2D J;  2M88 A;  3IRX B;  1T9U A;  2W9B A;  2XS2 A;  2AD9 A;  3G9C A;  4EYH B;  4PXE A;  2IYG A;  1NZ8 A;  3MM5 A;  1R27 B;  3MOJ B;  2N82 B;  1WDD A;  1U8S A;  2ASL A;  2W2N P;  4O4G B;  4ZLJ A;  1ITP A;  4NA2 A;  2CJX B;  3IFE A;  3W2V A;  2HFO A;  3MPV A;  5J2N A;  5H9F J;  2KI2 A;  3SBM A;  3KOA A;  1S0M A;  1KEK A;  3RAM A;  3ILO A;  1XIQ A;  3KLI A;  2CPY A;  4O4R A;  5CYQ A;  4TY8 B;  2ZM6 F;  5H9F K;  4TLR A;  3ETO A;  1OPZ A;  3MPU B;  3HVR A;  4NEZ A;  4Q45 A;  3R6G B;  4PQU A;  5KFG A;  4HI1 A;  4K2J A;  1HMV A;  2QX0 A;  1HR0 F;  4K4V A;  2DIS A;  2IRY A;  3GJT B;  3EXC X;  4UF4 A;  2ZM6 J;  2MB0 B;  3TWZ A;  4ILR A;  4O23 A;  3SQG B;  3Q8S B;  1ZYQ A;  4ERD A;  1KD1 T;  1O0P A;  2AJ4 A;  2OH2 A;  3GYG A;  1HR0 J;  3G82 B;  1MMD A;  5E7O B;  5E3Q A;  1D9A A;  3IR7 B;  4M5H A;  4TKT A;  2RUS A;  3T9Z A;  4MTP A;  1FA0 A;  2HZA A;  5E3A A;  4XIU A;  3UVJ B;  2DPI A;  3PVX A;  3CJT A;  3MHY A;  3OXF A;  4K8R A;  2CVI A;  3DHW C;  4YEA A;  2F4V F;  2UVR A;  5KFT A;  2LCW A;  3TVK A;  2VQE F;  3BDP A;  4FYV B;  2OAU A;  3MMB A;  2KKH A;  3BBB A;  1D3W A;  3TEG A;  3KLF A;  2E7X A;  3CIZ A;  2F4V J;  4WFB Q;  2DNH A;  2BW7 A;  4ITS A;  5GAE U;  2VQE J;  3AB4 B;  4O3O A;  1SPB P;  2Q6B A;  4FYD A;  2V5H G;  4NLX A;  4DSL A;  1K9M T;  5A0Y B;  3QFH A;  3V2U C;  5HK4 A;  4UOG A;  5KTQ A;  3T5K A;  2DGT A;  2YWH A;  3D67 A;  3PJX A;  1RKI A;  1RAB B;  1EET A;  1XQI A;  5HSP A;  3T1A A;  3ITH A;  1FXD A;  5DO2 A;  1L3K A;  1Q82 T;  3CW2 C;  3RB3 A;  4UZC A;  4NCB A;  1FCA A;  3DOL A;  2DGQ A;  4ELT A;  3LP2 B;  2GQQ A;  3H2V E;  3LUY A;  3J7A N;  1Y11 A;  2CJA A;  2MTL A;  2W7P A;  3VZI A;  1UMJ A;  2H51 B;  2WON A;  1WNE A;  1ZA2 B;  3MM6 B;  2IFX A;  3PW2 A;  1PCA A;  1UJ4 A;  3RBE A;  3C6U A;  2QFI A;  5MLC V;  3L7O A;  4ANC A;  2DIU A;  4KT0 C;  2GVZ A;  4F67 A;  1QE1 B;  3OR2 B;  4G3I A;  4C0B A;  4UOF A;  2DY1 A;  3W9H A;  3LWL A;  3BKU A;  5HMW A;  5L9N A;  2CG4 A;  4QR1 A;  2DGS A;  1LWX A;  3H90 A;  1PYO B;  2OO4 A;  3ISN C;  4QPX A;  2YX7 A;  2BEF A;  2IM1 A;  2QIF A;  1RTH B;  4ZA1 A;  4NZ7 A;  3NNC A;  2KYZ A;  3THP A;  2MPU A;  2QV6 A;  5JJB A;  3C6T B;  3FEY B;  1LFW A;  1VBZ A;  4N41 A;  8ATC B;  3ZZR A;  1TL1 B;  2F8E X;  5DLF A;  2NS1 B;  2BBE A;  3BZQ A;  1TU0 B;  5ETQ A;  4PPD A;  1FRL A;  1RA6 A;  4H4M B;  1RT3 B;  5AXN A;  1JLB A;  2IC3 B;  4IRK A;  4CRJ A;  3NGR A;  4DR1 F;  1G4C A;  4YDX A;  3CF5 Q;  2DB1 A;  2OFH X;  3AQP A;  2MQQ A;  1L5U A;  2LQJ A;  1S1U B;  2JEF A;  3DN9 A;  1VGY A;  4HAC A;  4UQG A;  3TZY A;  4DR1 J;  3W61 A;  2AT1 B;  2IBK A;  1PGZ A;  1T8E A;  2VDI A;  2W9C A;  3C19 A;  4I64 A;  2FLL A;  1PKU A;  4ZIW A;  1B0T A;  2AU0 A;  2BQR A;  3W9I A;  3OR1 B;  3FFI B;  3M2V B;  4HT7 A;  4CO3 A;  3EPG A;  1VC6 A;  1S7I A;  3WQP A;  3LP0 A;  3I0S A;  1FK9 B;  3AH6 A;  3I4H X;  1X4G A;  2AZ1 A;  2HG4 A;  3M9O B;  3T5L A;  3MMC B;  2HHS A;  4LVO P;  4NPO A;  2DHX A;  1N5Y B;  2GO8 A;  5D3G B;  4UZB A;  1AFI A;  5HBM B;  4B9L A;  2H4W B;  1IKV A;  1U0H A;  3ZZZ A;  5BJR A;  4A8X A;  3MAA B;  2BOP A;  3OD2 A;  5IFM A;  3MGJ A;  5DRK A;  1FKP B;  1FTR A;  1BC6 A;  4IG3 B;  1CSJ A;  2C42 A;  3MFH A;  2POK A;  7FD1 A;  3ZNJ 1;  4BHQ A;  3K5N A;  4ZCI A;  1OPI A;  1Y9O A;  2OPQ B;  2AYG A;  2DNO A;  4IYQ A;  4LSN A;  1QUV A;  4NLU A;  1RT7 B;  3W8G A;  3OVB A;  2HFZ A;  4F0H A;  3HMJ G;  2N4C A;  2OHD A;  3GR1 A;  1RT5 B;  5JVG Q;  3LGN A;  5KT6 A;  2UUW A;  1PIL A;  2UXC F;  3M6W A;  1I51 B;  1EB0 A;  3CJK A;  2BJ9 A;  3LAN A;  1RAI B;  5LJ3 Y;  4B17 A;  3K59 A;  3SXL A;  2HHW A;  1A6L A;  2UXC J;  2OGU A;  1ZM4 A;  1QAY A;  4OV6 A;  3BYP A;  4GRS A;  4LVN P;  3V4I B;  1U1Q A;  1YJ9 S;  4LIR A;  1OQ6 A;  1FJ7 A;  4F25 A;  3MCO A;  3NWR A;  1KBR A;  4OHX A;  2C2M B;  1LWE A;  1CJU B;  5EDW A;  3HHE A;  2HMI B;  1XJW B;  2LXF A;  2ZKT A;  1M5S A;  4I6A A;  3C16 A;  3DRS A;  4RUB A;  2Y8W A;  5G0R B;  2GS8 A;  4E98 A;  3CO9 A;  2RDI A;  4OZN A;  5RUB A;  1HQE B;  1WC6 A;  1NHV A;  2ILZ A;  1TKX B;  1UFW A;  4FXW A;  2VBZ A;  5T7L A;  4DR5 F;  1AA1 B;  3HJV A;  4URQ U;  5LSL A;  2CKW A;  5CH7 B;  1P1L A;  1YVF A;  5KFZ A;  1HQ2 A;  1YHQ S;  2D9O A;  2DNL A;  4F4A A;  4DR5 J;  3MM8 B;  4OYI A;  2Z30 B;  4J7C A;  1CS4 A;  3MD1 A;  4UW2 A;  4LF2 A;  1SKW A;  4QQB A;  1OQ3 A;  3GE9 A;  4NLG A;  5IT9 Y;  1PYT A;  2B6A A;  4F0M A;  5DLG A;  4OJ3 A;  2Z2L A;  3K57 A;  1XBW A;  3K5L A;  3PW5 A;  3OBI A;  4ZK7 M;  1RLD A;  4MJK A;  3MR2 A;  2DHG A;  2X1B A;  2KVQ E;  1VQ4 S;  1RTJ A;  1DFD A;  3N0V A;  3LO3 A;  3AXK A;  4IQM A;  1U6B A;  2AJ2 A;  4LBI A;  4KBI A;  2KT5 A;  3W2W A;  4QR0 A;  1HNZ F;  4QIE A;  3VQT A;  3KHL A;  1NDL A;  2B56 A;  3TR5 A;  3DNC A;  2JLG A;  2YNH A;  4CNZ A;  5LSR A;  2ZOM A;  1S6P B;  4RX6 A;  3KG0 A;  3BGF A;  1TVR B;  3CIM A;  1HNZ J;  2L9W A;  3WDO A;  5DJB A;  1X4H A;  2PII A;  4C3M A;  2EFP A;  5BYS A;  4GVB B;  4J9M A;  4CYU B;  2VHG A;  3CGI A;  3HZG A;  1S97 A;  2DRD A;  3TX0 A;  2JVR A;  5HQ8 A;  4RNM A;  3VWS A;  1M1K T;  4KGZ B;  4WFX A;  5J1E A;  3T1Y F;  1GX5 A;  1S1T A;  3BS9 A;  4IFY B;  4XTT A;  3AOD A;  3K89 A;  2LFV A;  4Q8E A;  3TAP A;  1U02 A;  3KLV A;  2IAJ A;  5J2P B;  2BW2 A;  1FXR A;  3SV3 A;  1EKS A;  2HAF A;  1NKB A;  3T1Y J;  3MM7 A;  4Y2A A;  1PC5 A;  1VJQ A;  4OYZ A;  2XO6 A;  1S10 A;  2HWT A;  1QAJ A;  2FJD B;  5FII A;  4H4O A;  1Z4U A;  4TYA A;  3QYY A;  1VYA A;  3ZNU A;  1QTM A;  2LQ9 A;  4WFA Q;  3PEH A;  1HBM B;  4L74 A;  1JWW A;  3VAK A;  1M5O C;  1T03 B;  3POT B;  1V3R A;  1C0U A;  4OLP A;  1OO0 B;  2MSS A;  2H65 B;  3U7J A;  3FRY A;  4C3L A;  1RBA A;  1X8D A;  3BH7 B;  4HT5 A;  4DOZ A;  2RT3 A;  2W01 A;  2HHX A;  5D0R A;  2NUH A;  3NOG A;  4DSF A;  5I4M A;  4DV7 F;  3KHH A;  3BSN A;  2RE1 A;  4IOC Q;  3M30 A;  3RRG A;  4IO1 A;  5HMX A;  3JYT A;  3DRP A;  2CQG A;  4DV7 J;  4KY3 A;  4LRB A;  2C2Z B;  4DUY F;  1K8A T;  3NGU A;  4CO1 A;  1P1T A;  1CJK B;  3ET6 A;  1V9O A;  2AHO B;  5C24 A;  3IS9 B;  3BN4 A;  4DUY J;  2IA6 A;  1MG7 A;  1XMO F;  2NSB A;  1DTQ A;  1YIJ S;  3VAL A;  4D3G A;  1F3V A;  3B6B A;  5GMK a;  2NQP A;  1X9M A;  4RBV A;  4RNN A;  2L41 A;  1QDU B;  2GIQ A;  4NLQ A;  3S8S A;  1M5H A;  1XMO J;  3HM9 A;  4PUO A;  4X84 A;  2W24 A;  1CUL B;  2B9Y A;  4FNI A;  3EWG A;  4BLG A;  2FLP A;  2BV3 A;  4JI0 F;  5DET A;  1I5O B;  4DN0 A;  2V2Q A;  4CO0 A;  3R5D A;  2RRA A;  3HHK A;  5EX0 A;  3LGM A;  1JXE A;  4ATN A;  3BKF A;  2RDD A;  4OYW A;  4USJ C;  3P4U B;  2FVP A;  4DPO A;  3DRY A;  2DEJ A;  5KFP A;  2OLW A;  4JI0 J;  2DO0 A;  2E9Z A;  2JZ5 A;  1S4E A;  4DS4 A;  5I3P A;  3IC1 A;  4O0I A;  3CCU S;  1R8H A;  4WCE Q;  2MQO A;  3I32 A;  3D4J A;  3QAU A;  5B0G A;  2H3E B;  2NXN A;  1KQF B;  3U1L A;  3EVM A;  5J2Q A;  5KG7 A;  1M0S A;  3TAQ A;  4JI4 F;  4PWU A;  2QSF A;  2EFO A;  2D3U A;  3LW5 C;  1HNI B;  3L09 A;  3LP1 B;  1FDD A;  2QLW A;  4JI4 J;  3IA0 A;  2N3O A;  4PEO A;  2V8H A;  2QGF B;  4U8Y A;  4EMD A;  3ZZO A;  3DLE B;  4TQR A;  1L3V A;  2CZV C;  5IXU A;  3OTB A;  3OL6 A;  4YB5 A;  1YKW A;  4CIO A;  2YNG A;  4F4K A;  4O4G A;  2HVI A;  3M2U B;  4UST A;  1WC1 A;  2ASJ A;  4Y0F A;  3H4B A;  2BE9 B;  4USI A;  2XZW A;  4W98 A;  3S01 A;  3IWX A;  4LMZ A;  1NM2 A;  2VBY A;  2ZNZ A;  2V8D A;  4NLV A;  2ZH3 A;  4M5K A;  2XC9 A;  2XB2 D;  2VPY B;  5BYR A;  4TY8 A;  5L1K A;  2YWW A;  1RGV A;  1ZM2 A;  2Y0S D;  2ZBC A;  1I1G A;  3D7S B;  2YQ3 A;  3MI7 X;  2M5Y A;  1EKR A;  3EIC A;  3BGU A;  2CNK B;  3CCV S;  3HUL A;  2WZ1 A;  1CJV A;  2ZFH A;  4I7F B;  3K0J A;  4ZVF A;  1GMU A;  1Z1Z A;  2P8I A;  5KG0 A;  5JMN A;  1BQX A;  1C1C B;  1Q5V A;  4DV2 F;  2KFN A;  2XQC A;  4C11 A;  2XMV A;  5J2M A;  1NUE A;  3DXS X;  3SFG A;  3CUL A;  1HBN B;  3SMZ A;  4C0H A;  2W2Q P;  3JAM Y;  3V4M A;  4DV2 J;  2CPD A;  2AYE A;  2ALZ A;  5L38 A;  2J9D A;  4LQ9 A;  4J9V A;  3GSD A;  1XC9 A;  2FHK A;  4OYP A;  3M6U A;  4YB1 P;  1DJ0 A;  1MNE A;  4LR8 A;  4J9S A;  2B5J A;  3O3L A;  3TW0 A;  1UJ5 A;  1JK9 B;  1RWO B;  2IY5 B;  5DG9 A;  4MT1 A;  1K0V A;  3KNG A;  2CQD A;  4RKU C;  2E1A A;  5F8M A;  2M3D A;  3MTK A;  2CDQ A;  1S49 A;  3Q8Y A;  4F0K A;  4OX8 A;  3J80 U;  4DR3 F;  4F04 B;  2ZJR Q;  4ECV A;  2B3T B;  2BKN A;  4KHP F;  3CC2 S;  3TRG A;  3KUE A;  3I87 A;  1PJ5 A;  3OXL A;  4RW9 B;  3MEG A;  5KFF A;  4DR3 J;  3GWC A;  3ICL A;  2CJB A;  4WWS A;  1JNR B;  2XMM A;  3ELH A;  4LRF A;  4KSE B;  2GGP A;  4KHP J;  5KFA A;  2XZT B;  3AA8 A;  2KXH A;  1IM6 A;  3QJJ A;  4J5O A;  2ZNY A;  2I38 A;  1X4F A;  2V4J A;  3IN5 A;  2I5J B;  4OJG A;  1VHF A;  4FPI A;  5HRO A;  1YWX A;  4QW8 A;  2CA9 A;  3KDN A;  4LFC F;  2XSJ B;  2WOM A;  2CAD A;  3VAM A;  1UFK A;  5EWG A;  1SIW B;  3I0R B;  1JLC A;  1WC0 A;  2HHH F;  3DHX A;  4LFC J;  4EYI B;  1FES A;  2P6S A;  4ZJO A;  4ZVQ B;  3QRQ A;  2HHT A;  4GKJ F;  4NLO A;  3QGH A;  3T9N A;  5HL7 Q;  4HHU A;  5IQQ A;  2IDL A;  3O6Q A;  3QAT A;  2HHH J;  2FVC A;  3DRX A;  4NZ0 A;  3M8P B;  3QFW A;  2BJD A;  4GKJ J;  2EC0 A;  2CVE A;  2CQI A;  2J7K A;  2KB2 A;  4WU3 A;  1WDT A;  2R2T A;  2Z2M A;  3KLG B;  1RP5 A;  2DNG A;  2J9D E;  4ZPC A;  4OI1 A;  1PIE A;  5T14 A;  1Y5N B;  4O44 B;  3IXQ A;  5DGA A;  2G4B A;  4QR2 A;  2AZ3 A;  2RU9 A;  2HQG A;  4F8R A;  4IFV A;  4LSL B;  4XAK A;  2GHV C;  3J7Y I;  2HRU A;  4KFB B;  4ZP7 A;  1RWV B;  2HQC A;  4KE5 A;  1MRO B;  2YTC A;  4CH1 A;  4ANE A;  1UA1 A;  2PMH A;  1HNV A;  1VIX A;  1BMQ B;  5EUH A;  3GFH A;  3NGD A;  1GK8 A;  4O0N A;  2HIY A;  1X5P A;  5ETP A;  5BR8 F;  2GAG C;  5M2U A;  2A6M A;  4YME A;  4N8N A;  4KQZ A;  3MMC A;  1WF1 A;  4WK1 A;  2BE7 D;  4NRT A;  3SQO P;  4C2M A;  4ECR A;  1YBA A;  1F2H A;  1YRU A;  5D3G A;  5BR8 J;  2Y9H A;  4USW A;  3MWB A;  5HBM A;  3BSO A;  2F4F A;  1AXQ A;  2LDI A;  4GC6 A;  4UQT A;  3QIP A;  1FJC A;  1JLQ B;  2CUY A;  3Q23 A;  2VKR A;  4ED3 A;  2Q43 A;  2BJ8 A;  4DQQ A;  3I5C A;  3GLJ A;  4CLS A;  5HMZ A;  4O3S A;  1SI9 A;  2QC3 A;  3NBP B;  1FKP A;  3WHI A;  3D3C J;  4G1Q B;  1XR6 A;  1IKY A;  3OPK A;  3BYR A;  3IAM 9;  1PSD A;  5I3U A;  1FER A;  5AXM A;  2OPQ A;  4WE1 B;  2VBW A;  4ES3 A;  3C15 A;  2BQU A;  3N5F A;  2MEW A;  1JJH A;  4NOH A;  4QYR A;  3SSS A;  5SUH A;  3R5C A;  2KM8 B;  4RW6 B;  5A8R A;  3BGL A;  1JLF A;  3JSB A;  3PCO B;  3FRZ A;  2MZS A;  3OSP A;  3PY8 A;  4PWD A;  1PC4 A;  5M2R A;  3MPY A;  4YR2 A;  1RWM B;  4CM2 A;  4J9Q A;  4CT9 A;  2YKP A;  2RIL A;  5F8H A;  3CCS S;  4J9P A;  1QSS A;  1EX8 A;  5LSO A;  4AXJ A;  2KU7 A;  1GEH A;  1SQF A;  1U1P A;  1S5Z A;  4ZPW R;  3TJ9 A;  2ADB A;  4Z37 A;  2VJU A;  4F3O A;  3FDS A;  2E7W A;  1D9F A;  4Q8F A;  1Q79 A;  4A8K A;  2YQ0 A;  4RUA A;  2BMB A;  7AT1 B;  3I31 A;  3JSM A;  3K7R A;  3A1Y G;  2M7S A;  5KFD A;  3SI8 A;  4P75 A;  3PRD A;  2MLZ A;  3N9U C;  3LH2 S;  4OI6 A;  3H98 A;  4OMF G;  2KXN B;  3TAN A;  5L46 A;  2CNN B;  1OSC A;  2KRR A;  1KNZ A;  3GSI A;  2JLF A;  4X62 F;  1MU2 A;  2W9A A;  3OSN A;  4AFF A;  3OFF A;  2YWG A;  2HZV A;  5GAG I;  1HWL A;  5F3T A;  3M32 A;  2KDO A;  3P8B B;  4ZPD A;  1JB0 C;  2C3P A;  4IRD A;  2YNI A;  4X62 J;  2FJW A;  1J27 A;  1UVM A;  1Q8L A;  1WSV A;  6AT1 B;  4OV1 A;  1XNR F;  2KG0 A;  3C8Y A;  5A6W A;  2LQ5 A;  4P2M A;  4X66 F;  4ECT A;  4DQR A;  4LUB A;  2MLX A;  2LXI A;  5MAO A;  4RW8 B;  2IVM A;  3PX4 A;  1XNR J;  1YJW S;  3NRB A;  4X66 J;  3NXZ A;  2WHO A;  1WC3 A;  3BGO P;  2HND B;  3KLH B;  2A10 A;  2FLN A;  4OX6 A;  1AT1 B;  4A4J A;  5D77 A;  1FWL A;  2HQI A;  3QT5 A;  3FUY A;  3UN2 A;  4P2F A;  4DR7 F;  3MED A;  1R8A A;  3A8E A;  2I6W A;  2KN4 A;  2VG6 A;  2YWF A;  4OI4 A;  1VC5 A;  1NJZ A;  3MDF A;  5K8N A;  4DXL A;  4DR7 J;  5D0H A;  3BM7 A;  2O01 C;  1S1W B;  1N8R T;  2QZ8 A;  3TAR A;  2R8K A;  1VS3 A;  4NLW A;  2IDE A;  1TVR A;  3DOK A;  3L4B C;  5DGB A;  1WOO A;  4DI6 A;  2XS7 A;  2MJN A;  2JEI A;  3J81 U;  2VOD A;  1X60 A;  3J7Z 5;  1IKW B;  2GQC A;  1HQU A;  3VGS A;  3ZZP A;  4ZCM A;  1JLE B;  3OL9 A;  4I1T A;  3D1O A;  2AW0 A;  4NL5 A;  3BEG B;  1QTN B;  3SDE B;  4HLB A;  1H7W A;  2IJR A;  4I2P B;  1VRT A;  4B08 A;  4ES2 A;  1QY7 A;  1UVJ A;  4Y2I A;  3CSK A;  3FCH A;  1RZM A;  1UEU A;  4MMO A;  3W60 A;  3IGV A;  3J7Z T;  5EHH A;  2J0W A;  1FF2 A;  3JQK A;  2YXL A;  4RUC A;  2X1F A;  3BQ2 A;  1X4A A;  2YKN B;  3GIR A;  3IMQ J;  2MZT A;  4I0W A;  3NL0 A;  1N33 F;  1NK5 A;  5F8G A;  4LF5 J;  1Q0N A;  3D0H E;  1QVG R;  3DLG A;  3GIJ A;  1ZET A;  4Q5V A;  1HLW A;  4LF7 F;  2ZH6 A;  1VQ7 S;  1N33 J;  3HHL D;  1H3D A;  2QSW A;  4Q44 A;  2KT3 A;  2ZC3 A;  4AT1 B;  2PC6 A;  3SSR A;  3ETM A;  4LF7 J;  2I9S A;  1KS2 A;  4ZLP A;  3HSZ A;  5A2Q U;  2V9K A;  5CD4 H;  2X3G A;  1E6V A;  3U1N A;  1KVK A;  4ALZ A;  1NSQ A;  3R2C J;  2HVD A;  2MQN A;  1HBO A;  4DWI A;  4ZDN A;  1KTV A;  1JLG B;  3IG1 B;  2FTR A;  1RU2 A;  2NXJ A;  3KJN B;  3D0I E;  3FBB A;  2WAQ D;  1RYS A;  2W9B B;  4QWA A;  3IWN C;  1QVF R;  4W90 B;  1UL3 A;  3DYA A;  3CJS A;  3MM5 B;  4NLD A;  3VAJ A;  3DU6 A;  1WG1 A;  1C4C A;  5KOW A;  4V1A k;  4ZVT B;  3R1L A;  4JYA F;  3N4W A;  2XHW A;  2LQ8 A;  1FKA F;  1RT1 A;  1FFS B;  3W2V B;  1NPP A;  5J2N B;  4DG1 A;  3TAM A;  3LQV A;  3X3U A;  4AND A;  1HWI A;  4KGV B;  1GFW B;  2V67 A;  5ETS A;  1TV6 B;  4JYA J;  5CYQ B;  4ZLL A;  3KXD A;  3OFE A;  4EWT A;  2ZC4 A;  2RRB A;  5D0E A;  2XMT A;  4NXM F;  3CVK A;  1T95 A;  1HMV B;  4P74 A;  3D9B A;  1C2P A;  3CDA A;  4EUV A;  4TU9 A;  2UZA A;  4Y2M A;  3FBC A;  3PJ9 A;  4NXM J;  3JQJ A;  1TFY A;  2A1B A;  5E41 A;  1DTT A;  1NDC A;  3PFE A;  3RW6 A;  3GIK A;  4DBQ A;  2CNO B;  1IKX A;  1XNQ F;  1KFS A;  2M8H A;  1ARO P;  4EGL A;  2UUC J;  2BJE A;  4XO0 A;  2NXE A;  2FYX A;  1TL5 A;  1RWP B;  2E1C A;  2R7V A;  5A8W A;  2UXB F;  1ZH5 A;  4KIA A;  1XNQ J;  1U6Z A;  1REG X;  3TVZ A;  2HHU A;  1QAI A;  1VQM S;  2UXB J;  2AJ1 A;  2C3M A;  4G1I A;  1Q1K A;  1R43 A;  4KAI A;  3GFX A;  2ZUG A;  4IH7 A;  3MMB B;  4LF4 F;  4X65 J;  4RU9 A;  4HKQ A;  3AY0 A;  2CJY B;  3KLF B;  2YWK A;  1ELO A;  1H98 A;  4Q43 A;  3GII A;  2RIJ A;  7FDR A;  1FD8 A;  4K59 A;  4LF4 J;  1VFJ A;  1WOP A;  2CQ2 A;  2R8I A;  4DQI A;  2NXC A;  3BH6 B;  3Q89 A;  1VDH A;  1SH0 A;  5HLF A;  3BF4 A;  3KG4 A;  1EET B;  4DFK A;  3ITH B;  2GO9 A;  1R7I A;  1RHJ B;  4KGX B;  3FC9 A;  3O2I A;  3PDN A;  1RT6 A;  4ILL A;  4C98 A;  2K2P A;  2LU2 A;  3KNA A;  1S57 A;  1PAE X;  1WWH A;  4X4P A;  3L7U A;  3DOL B;  1SJ1 A;  1NJY A;  2QG9 B;  3G6Y A;  2RF2 A;  4Y65 A;  4P73 A;  3NS6 A;  3OL8 A;  2JL9 A;  4WII A;  2OI2 A;  2HWH A;  2HHV A;  2I1R A;  3OXG A;  2WON B;  1S76 D;  3NGT A;  3CD6 S;  5GAG U;  3CXC R;  2ACY A;  3I6P A;  3V81 A;  3R1H A;  3OUY A;  3RB6 A;  3C6U B;  3KHR A;  4NE9 C;  1Q8I A;  2GVZ B;  1A9N B;  1LXN A;  2Q79 A;  2MQM A;  4LF9 F;  1SXL A;  4N77 A;  3QMQ A;  2XLI A;  2OPR A;  3GJQ B;  2AEF A;  1RCX B;  1SBR A;  4Y2C A;  1URR A;  3WX8 A;  1VQ5 S;  3JS9 A;  4LF9 J;  2ZH9 A;  3CCL S;  2ZVI A;  3HVA A;  2IRU A;  4WP8 A;  2E9T A;  2AMC B;  2JDJ A;  3T1H F;  2CPF A;  1FDB A;  4LFA F;  4TU7 A;  1U48 A;  3KUH A;  1D9D A;  4WTY A;  8AT1 B;  4KH0 B;  1IXK A;  1T9T A;  2VUG A;  3RBD A;  3VAF A;  3UD5 A;  3V6H A;  4LFA J;  3D66 A;  3BSC A;  2B51 A;  4OYA A;  4KYZ A;  1JLB B;  3DRR A;  3ZO7 A;  3NNA A;  4B9M A;  5E3R A;  2AJQ A;  5F8J A;  4NLP A;  1CC8 A;  3IGN A;  2LEB A;  1X9S A;  2B9W A;  2M0G B;  4M1K A;  1JJC B;  1N88 A;  4NX9 A;  5HN0 A;  4ID5 B;  4Y28 C;  1KR4 A;  4ZVO B;  2VJV A;  4LR7 A;  4HAC B;  1TK5 A;  1QJH A;  5DG7 A;  2DRA A;  2MDA A;  2HKE A;  3UQS A;  2JHE A;  2E5L F;  1EAR A;  1KOO A;  4JV2 A;  2AKW B;  2W9C B;  2HWI A;  5ETR A;  5IS2 A;  4FP9 A;  2VA2 A;  2E5L J;  3UR3 C;  4M5M A;  3AD7 C;  1Q53 A;  2VFS A;  5B0A A;  4M5D A;  3LP0 B;  3I0S B;  1FE4 A;  1DAX A;  1X7V A;  2EBE A;  1JNZ B;  5EWE A;  4U7C A;  1V3S A;  2HUR A;  1RUS A;  3OHA A;  2WB4 A;  2BE2 A;  2AQ4 A;  4JI2 F;  1U0H B;  4K4T A;  1LOU A;  2RH3 A;  2BR0 A;  2FZC B;  3HLU A;  1CLF A;  4FF4 A;  4ECW A;  4JI2 J;  5DDP C;  3FEZ A;  1NKE A;  5J1N A;  3D6T B;  3DI6 A;  2KG1 A;  3FEX B;  4LSN B;  3MM9 A;  1DUR A;  2RU3 A;  3B54 A;  3K8V A;  1OIA A;  3F73 A;  1T7P A;  2ILY A;  3IM9 A;  1WHX A;  4M94 A;  3DDN A;  2BQ3 A;  5DS7 A;  2V4R A;  1FO1 A;  3GPA A;  3D6H B;  4E8U A;  5ETO A;  1H2T Z;  2GMJ A;  5DG8 A;  3MCS A;  1PJ7 A;  3CJK B;  4AE5 A;  5K5M A;  3U1M A;  5B09 A;  1D0E A;  1S6U A;  1U1O A;  2RVJ A;  3L7P A;  3BQ0 A;  1RLC L;  1CPZ A;  2V8G A;  4QJV A;  2DNN A;  5HAT A;  3J7A 1;  5I42 B;  3QID A;  1S59 A;  1SC3 B;  2EWH A;  5F8N A;  4M8L A;  3HHL C;  2E66 A;  5IV3 A;  1EQM A;  2K7K A;  4DSK A;  3W64 A;  3CC7 S;  2V50 A;  3EYZ A;  4MKB A;  3F41 A;  3DC2 A;  1FVS A;  3C16 B;  3DRS B;  1JKH A;  1KHV A;  1ZAV A;  5FJ4 A;  4DFP A;  1X4E A;  3P5T L;  1FKO A;  3H8Y A;  3WIV A;  1SL1 A;  1G6B A;  2HLU A;  5T7L B;  2LA6 A;  3HXM A;  1FT8 A;  4ZPT R;  3M6X A;  4XDD A;  1N0V C;  4KB7 A;  1YTY A;  3CD7 A;  1RJJ A;  3LA0 A;  4X2B A;  2C3Y A;  3IR5 B;  4BS2 A;  5EX3 A;  4N47 A;  3FBE A;  1TR0 A;  2A2D A;  1HFE L;  1CS4 B;  3RJM B;  4M5G A;  4DV1 F;  2C2D A;  3TUI C;  4MK9 A;  4Z7C A;  2AX1 A;  1X4C A;  3PR5 B;  2IYI A;  1S9G A;  2DNQ A;  1C1B A;  2B6A B;  2F63 A;  2YX1 A;  4DV1 J;  4JP8 A;  3M8W A;  4YDD B;  4OZL A;  3F44 A;  3I96 A;  3R8Y A;  3ISZ A;  2R7O A;  2ZDP A;  1RTJ B;  1M5P C;  1NK8 A;  4EZ9 A;  5CYM A;  5C2G A;  4OYM A;  4CM0 A;  1RT4 A;  3SCI E;  2XGP A;  4DX5 A;  5KG4 A;  3W2W B;  4TN2 A;  1U1L A;  1REV B;  2BVZ A;  3TQ1 A;  3GON A;  2F9J A;  4QWD A;  5L1L A;  4RW7 A;  5A8K A;  2DNY A;  1T05 A;  1BXN A;  2E29 A;  2DCL A;  3CJ0 A;  3C2P A;  1NJI T;  3AAW B;  2VA3 A;  4I69 A;  1HNX J;  2HNZ B;  1S72 S;  4ECQ A;  4NYP A;  5AT1 B;  1H38 A;  1N54 B;  5KFS A;  2H5J B;  3MMJ A;  2HFS A;  2WBM A;  3S1T A;  2GFF A;  1ROF A;  3M8R A;  3JSY A;  2OD6 A;  5J1E B;  3P6Y C;  1S1T B;  5KFM A;  1UA0 A;  2IAJ B;  2YY3 A;  1U26 A;  2W7O A;  2KVI A;  1RHQ B;  3OW2 R;  2QA4 G;  3MM7 B;  3MEK A;  1H72 C;  2GCF A;  1KTQ A;  4OHZ A;  3TVY A;  4BWJ A;  1KQS R;  3MEE A;  3PTW A;  4BDP A;  1T3N A;  4C9D A;  4H4O B;  1VMB A;  1VQP S;  1FJE B;  4MIB A;  3PEJ A;  4ZP8 A;  4CCH A;  2CJQ A;  3GIL A;  1SH2 A;  1Y5I B;  5B08 A;  1ZTW A;  4IG0 A;  2QO3 A;  3HKZ D;  3THT A;  2ZEJ A;  1C0U B;  1RAD B;  2Y1J A;  2XI3 A;  1N56 A;  4FVM A;  3KK1 A;  4V19 X;  4CTA A;  2FY1 A;  1TL7 A;  5BXI A;  4Y3C A;  4K2X A;  3M30 B;  4J9R A;  4YUD A;  2CWX A;  4TLQ A;  3JYT B;  3DRP B;  2P6T A;  2CQ1 A;  1VOM A;  2J5A A;  1TK8 A;  4C7Q A;  2F7V A;  2W1B A;  4ZLN A;  1HWK A;  1HWJ A;  4A8M P;  4QIF A;  4L73 A;  5JVH Q;  3ET6 B;  2NR0 A;  4ZCL A;  5IM0 A;  5C24 B;  4JI6 F;  2XMW A;  2ROE A;  1LEO A;  1FWK A;  2QT7 A;  2HFN A;  3T3F A;  1JLA A;  3OHB A;  3MAQ A;  1DTQ B;  1HYS A;  1N5T A;  4W4M A;  2RQM A;  2MKS A;  2ZD1 B;  2LU1 A;  4JI6 J;  1NXI A;  1HIY A;  2JVO A;  2DNK A;  4QWC A;  4PUO B;  4RBU A;  4AYB D;  2CXE A;  2H48 B;  3NLC A;  3HT0 A;  1UVK A;  2HBY B;  1JXV A;  2D1C A;  4MYT A;  2R7W A;  1UET A;  4LQ3 A;  2JFK A;  1ULR A;  2XYP B;  3BRE A;  1WD6 A;  4HTJ A;  2NUU G;  3OTD A;  2QFJ A;  4LFB F;  1I94 F;  3UN5 A;  3QQC D;  2KYX A;  2OUG A;  1WOR A;  1WJ9 A;  1NO8 A;  3HX9 A;  1TL3 A;  1WKL A;  1HNW F;  2YVS A;  4OL8 A;  1YJV A;  1TAQ A;  2R8J A;  1LXJ A;  2KHC A;  1F9H A;  5K8M A;  2DNM A;  4FVC A;  3UDL A;  5A6P A;  2J9C A;  1I94 J;  2FHJ D;  4WFN Q;  1N4L A;  2ZH4 A;  1EAY C;  1FRX A;  2XBP A;  3IBW A;  1HNW J;  4ZVU B;  1CC7 A;  2FC9 A;  5J2Q B;  2IBO A;  5KG3 A;  1KWM A;  2EFQ A;  2O3D A;  4DV6 F;  1AUD A;  3PO4 A;  1C0T A;  2B4P A;  3RR8 A;  2AGO A;  2WVB A;  5ADZ A;  4OYX A;  3J81 j;  3GJR B;  4JBC A;  5B0E A;  3M1V A;  2MXY A;  2C22 A;  1S99 A;  3RTV A;  3DGV A;  3UN3 A;  2YNG B;  1KC8 T;  4USM A;  4JI8 F;  4H4K C;  5HJY A;  2H5I B;  4WK3 A;  1URN A;  3PRB A;  2Q1L A;  1M1G A;  2FVQ A;  4FS1 A;  1J5O A;  5D78 A;  1YJT A;  1CJT A;  1TV6 A;  5F8L A;  3MR3 A;  2QA2 A;  4JI8 J;  5L39 A;  1YBU A;  2UUT A;  1RTD B;  2R2S A;  3BBC A;  3LF0 A;  1WHW A;  3R27 A;  3US5 A;  2B9X A;  2Z2Y B;  3I82 A;  3QJP A;  2G1D A;  5D4P A;  1MN9 A;  4NLR A;  1VQO S;  2HVZ A;  3PHE A;  1TUW A;  3BGR B;  4ICL A;  2FY8 A;  1Y3K A;  1CJV B;  4ED4 A;  1M5K C;  1N6Q A;  3KK2 A;  3MEC A;  2P5V A;  4FDF A;  3H5Y A;  3D1Q A;  3T41 A;  4QIV A;  3PYE A;  4AL6 A;  2F65 A;  4C11 B;  5J2M B;  4WP9 A;  2IM3 A;  2FIU A;  4X4O A;  2V63 A;  3N6N A;  4H54 A;  1U0S A;  1RB0 A;  4RNO A;  2X3D A;  3PJW A;  2J6S A;  3G8Q A;  2ATL A;  4RWX A;  4LF8 F;  2AWZ A;  4WFZ A;  1UVL A;  1FJG F;  2YPY A;  1D8Z A;  5D0G A;  3BV8 A;  4P2S A;  2DO4 A;  1MW7 A;  2CDR B;  2AP6 A;  4LF8 J;  1Y0H A;  1WTF A;  2RD5 C;  5BYQ A;  3AXM A;  2FUG 9;  1FJG J;  1JMT A;  1GTH A;  1HBU A;  2B5J B;  2CQP A;  4LIW A;  1UEK A;  2ZBI A;  2XI2 A;  2DHA A;  4X4R A;  1ZOT A;  1YIT S;  3KLE A;  2FLO A;  3HSG A;  2GJF A;  2BJ7 A;  3GCX P;  3MUT P;  4PG8 A;  4OZ1 A;  1U49 A;  3PM9 A;  3B82 A;  1T9W A;  3SCJ E;  2CQ3 A;  3GV7 B;  3QZ7 A;  4MYU A;  2EXU A;  1NH7 A;  3PG9 A;  1G2E A;  3TJ8 A;  3E51 A;  5KFI A;  1KON A;  3CCM S;  3O5T B;  1EHW A;  1CEZ A;  2IM0 A;  2JOQ A;  4ED5 A;  4RLE A;  3JQM A;  1TUV A;  2FHO B;  3MEG B;  1IR2 A;  2YPZ A;  2YH1 A;  1BE4 A;  1LKZ A;  4HDH A;  3B4D A;  2BRK A;  3KUG A;  2VH7 A;  1UW4 A;  5KG2 A;  2GGP B;  4BC7 A;  4I56 A;  2UVW A;  2OD4 A;  2IMW P;  2KRB A;  2Y1L B;  2ACM A;  2UV8 G;  3QWP A;  1X0F A;  1TKZ A;  4A8O A;  3HF5 A;  2RKI A;  3N79 A;  2V4J B;  2H5E A;  2W2M P;  5HRO B;  4JI5 F;  2GVD A;  2XMJ A;  3FBF A;  4TNO A;  1RXO B;  2HHP A;  3H5S A;  1RHM B;  2UUA F;  1M90 T;  4X4N A;  2WOM B;  2ZH8 A;  2NLW A;  2QYC A;  1AYE A;  1PYS B;  3OVA A;  2ZJP Q;  1JLC B;  4JI5 J;  1ZZN A;  2B8P A;  2UUA J;  1WUU A;  3OVS A;  4RW4 A;  2ZH2 A;  5DZ7 A;  2IM2 A;  3FZ2 A;  3ONQ A;  4OI3 A;  4C8K A;  2J8S A;  1Q95 G;  2U1A A;  4YR3 A;  2V2V A;  3DLK A;  4JI1 F;  3KYL A;  4EFA C;  1FHT A;  5ETL A;  3HSJ A;  2VV5 A;  3DLJ A;  2XWX A;  3QJL A;  1O8B A;  1WF0 A;  3DMJ A;  3M2R A;  4ED7 A;  4JI1 J;  4WXO A;  2JEJ A;  2M52 A;  3BB5 A;  4ID5 A;  4PR6 A;  4IFV B;  3OTE A;  3UR0 A;  3WBZ A;  5AJ3 F;  2HS4 A;  2VPZ B;  3CJR A;  3ZZT A;  1UVI A;  2G0C A;  3I9Z A;  1S0N A;  2IHR 1;  4C0O C;  1HNV B;  2V2Z A;  4PXB A;  4QIW D;  2HRY A;  4DLE A;  5AJ3 J;  2DR8 A;  3RGI A;  3B4M A;  5IOL A;  4MK7 A;  3QBC A;  5E0O A;  2X1A A;  1YQH A;  1NK6 A;  2BX6 A;  3SYZ A;  3EZ5 A;  4U8V A;  4NA1 A;  3Q8U A;  2E5J A;  4QU6 A;  1VQ8 S;  1NSK L;  2KTQ A;  1V5I B;  4PKD B;  3JTN A;  3GJS B;  1VQN S;  3ZTO A;  2E5H A;  4YY3 F;  2EFN A;  5D4L A;  2B43 A;  3A8K A;  2V34 A;  1F2G A;  3CCW A;  1A7G E;  2RQK A;  2WW8 A;  4P7V A;  3TP2 A;  5H9E J;  1NPK A;  3JSR A;  3EDR B;  4PQA A;  3QIP B;  2QRR A;  3RYL A;  4YY3 J;  2B4O A;  1DBD A;  2B4U A;  4BBY A;  4PRF A;  3EZO A;  4C4W A;  3UDC A;  1ZAW A;  1BQM A;  3HVT A;  5H9E K;  1IKY B;  1YZ6 A;  1UPM B;  2MHE A;  5I3U B;  1SL0 A;  2APO A;  3R5G A;  1Y7P A;  3C15 B;  3OL7 A;  4NCG A;  4O3P A;  3RUB L;  2GHW A;  1SQE A;  4HL9 A;  2HNY A;  1XK8 A;  4B9N A;  4JOU A;  5HO4 A;  4OZ3 A;  3QGI A;  5A8R B;  1ZZF A;  5I3Q A;  2O67 A;  2IVY A;  1JLF B;  2WVF A;  5CQG A;  1U2R A;  3PIO Q;  2CQB A;  2HFU A;  4PWD B;  3VGU A;  5KFU A;  2BJ1 A;  4NI2 A;  3VQS A;  1HHQ A;  4Y6I A;  4HHJ A;  3E2E A;  1IBK F;  4UOC A;  3O44 A;  4KJI A;  3M8Y A;  2VFU A;  3Q8Q B;  1L3U A;  3OV7 A;  4F2R A;  2OSQ A;  3EX7 B;  4Y2K A;  4Y34 A;  3BBF A;  5I42 A;  3W3S A;  5C42 B;  5HAN A;  4FS2 A;  1IBK J;  4Y00 A;  2WCX A;  4EU0 A;  3C66 A;  2ZE2 A;  3CJ3 A;  1RDR A;  1SKS A;  2IIH A;  3JSM B;  1RE1 B;  4X4U A;  1B99 A;  5KFY A;  3V5R A;  1X5T A;  2GMH A;  1O6X A;  2JRS A;  1F0X A;  2JC1 A;  5D4O A;  1FI4 A;  4DR4 F;  3PFO A;  2MGZ A;  1DHM A;  2OML A;  5B0D A; 
#chains in the Genus database with same CATH homology
 2CA9 A;  2HZA A;  2BJ7 A;  2F1F A;  3LGH A;  2BJ8 A;  2CAD A;  2Y3Y A;  2WVB A;  2BJ1 A;  2BJ9 A;  1Q5V A;  2FGC A;  2NZC A;  3BKU A;  2WVC A;  2PC6 A;  3QSI A;  3BKF A;  3OD2 A;  3PHT A;  2CAJ A;  3BKT A;  1Q5Y A;  2HZV A;  2WVE A;  2BJ3 A;  2WVF A;  2WVD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...