3DRSB

Hiv reverse transcriptase k103n mutant in complex with inhibitor r8d
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
424
structure length
405
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of 3-{5-[(6-Amino-1H-pyrazolo[3,4-b]pyridine-3-yl)methoxy]-2-chlorophenoxy}-5-chlorobenzonitrile (MK-4965): A Potent, Orally Bioavailable HIV-1 Non-Nucleoside Reverse Transcriptase Inhibitor with Improved Potency against Key Mutant Viruses.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 107
structure length 405
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3drsB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drsB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drsB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drsB04
3I5AA 4NLSA 1S4FA 4NLTA 3NKYA 3RB0A 4IQXA 1LWEA 3QO9A 4RW9B 1QAIA 2IM0A 3MTKA 5KFTA 4EO8A 4G3IA 4H4OA 5J2NB 5F9NA 1S6QB 1K1SA 4IR1A 3MEGA 3QZ8A 3I5CA 1N6QB 5CYMA 2OPQA 3CIZA 3NAHA 5F8NA 2OPPB 3C6TB 2XGQA 2RKIA 2AU0A 3T5KA 2HWHA 4HKQA 1TL3B 3M8QB 2AX1A 1RT4B 5KFXA 2ASJA 2R2TA 1NHUA 4MH8A 4WYLA 1T05A 4NLQA 3EZUA 1FKOB 3OLAA 4J9MA 2W9AA 3NL0A 1C0TB 2D7SA 5JUMA 1JLAA 3C6UB 1S0MA 3V6HA 5J2MA 4ZMMA 4OL8A 3M8PA 1C0UB 3V81A 2W8LA 3PZPA 3V4IA 2CJQA 2UVUA 2IM1A 2FJXA 4M95A 5KFSA 5D3GA 3ITHA 2J6TA 2UVVA 2E9RX 2WK4A 5KFIA 1MU2B 3DLEA 3M8PB 4DL5A 3SI8A 3BREA 1D1UA 2XCAA 1RT3B 3QZ7A 4QW9A 4X2BA 2YNGA 4QW8A 2D3UA 1C1CA 5HP1B 5KFWA 2D41A 2ZKUA 4R8UA 5KG2A 2ILZA 4MKAA 4O44A 4K4WA 2JEGA 1TL3A 1TP7A 4FBTA 1IKXA 1S6PB 1RTHA 1RA7A 4ED3A 1LW0B 1TVRA 4K4ZA 3NMAA 2R8IA 2R8GA 3CJ2A 5KFHA 4I2PB 4R5PA 3ICLA 2W9BA 4I2QA 3M9OB 4ECWA 2FVCA 2VG7B 3UR0A 4F4WA 3PW0A 4NLDA 4O4GA 3G6XA 1T03B 4F4YA 3DRRA 4ECUA 1RT5B 2B6AA 3NBPA 2W7PA 1S1WB 2V4QA 4LQ3A 3DDKA 4J9OA 3DRRB 4I7FB 1JLGA 1EETA 5KT5A 4O4GB 2WHOA 3MR6A 1RT3A 1S10A 1ZTTA 2IMWP 5I3UB 4YP3A 4PUOB 1C0TA 2UVRA 1LWEB 3QO9B 3RAQA 3SFGA 4IKAA 2B5JB 5I3UA 4PQUA 1XR6A 3HKWA 1RTIA 4ZP7A 3LP2B 4IG3A 3MFIA 3PW5A 1HQEA 3QIPB 2E9TA 3RAXA 4PWDA 1S0NA 3D5MA 3PR4A 3GIMA 3LP2A 3FDSA 4IOBA 4GC6A 4H4MB 4WZQA 2OPRA 4DL6A 4R5PB 3PHEA 2W9BB 4ECYA 4K4SA 3MECA 4ZHRB 3RBEA 3HVAA 4NLGA 1RT2A 2YNHA 2R2UA 3GV8B 3UDLA 1C1BB 1FKOA 1J5OB 4NLUA 5KG4A 1S9EB 5EDWA 4K4TA 4EBCA 4DL4A 2YNIA 3LAKA 2WONB 5DGBA 4ZVGA 3VQSA 4RNHA 4TY9A 4ED1A 3G6YA 2JEJA 5C42B 3KMQA 3KLHA 3Q8RB 1RT5A 4GC7A 3IN5A 4MIAA 5KT6A 4Q43A 2RF2A 3MF5A 2R8JA 5J2MB 2YNFB 5J2PB 1TKTB 2FLPA 4KHMA 4KV8A 3OLBA 4J9PA 1UWBA 5KFLA 1T05B 2YNFA 3ITHB 5KG7A 2HMIA 4LSNB 1HMVA 1LW2A 4ZPAA 4K50A 2HNZA 3KOAA 4PWDB 3ISND 4QWBA 4RNOA 2HWIA 3DMJA 3TVKA 4LSNA 4ZP8A 1XR5A 2HNZB 3N6LA 1YVFA 3QGHA 3H4DA 1S1UA 3T5HA 4MFBA 3HHKA 4RUAA 2C2EA 1N6QA 3H2LA 4LQ9A 3BR9A 2OPQB 1W25A 3ISNC 3LP1A 1S6QA 5L1IA 3IS9B 3TAMA 3KK3B 1R0AA 1GX5A 4WXWA 1IKYA 5K14A 1RT2B 2YNHB 4ED2A 1MU2A 1N5YA 4B3OB 1RT4A 4ZVHA 5C42A 1FK9B 5KFKA 4IG3B 1S1XA 4YR2A 2IBKA 3OHAA 4IDKB 2R8KA 3EPIA 3KLFA 1NNDA 2GC8A 5DG8A 3OL9A 3DRSA 4WXOA 2HNYB 3OL8A 3V6DB 1JKHB 4ZHRA 5HLFB 4YQWA 5HROA 2BQ3A 1DTTB 5KT4A 1IKWA 4KKOA 2E9ZA 2JC0A 4KB7A 4EO6A 5F8IA 1CSJA 5L1JA 1RTDA 1K1QA 1GX6A 3H5XA 2WTFA 3MR2A 5KG1A 2B5JA 4PQUB 2XI3A 2BRKA 3CDWA 4TN2A 3DLKB 4WYWA 5J2PA 4ZPDA 5KFGA 4QPXA 1IKYB 3MEEB 1SH2A 5CYQB 1XR7A 4RNFA 1EETB 3MFHA 3LP1B 5F8HA 2AQ4A 3IRXB 3FSIA 2J6UA 4NLYA 5KFQA 1LWFB 3DLGB 4TYBA 4IDKA 4J9LA 1S9GB 1T3NA 3GILA 4TQRA 1IKXB 2VG6B 3PVXA 3KK1B 1ZTWA 2IM3A 4O44B 4YR3A 4WFZA 3KLEA 3NGDA 3LP0A 4WFXA 1VRUA 2YNGB 2OPSB 2RDIA 2HNDA 4RUCA 1DLOA 1KLMA 2OPRB 3KK2B 1JLQB 2AX0A 2UUWA 4ID5A 3CWJA 4TYAA 3SFUA 3FFIB 4IRDA 3I0SA 3CVKA 4RW4A 4IFYA 1JLCB 1C0UA 3V81B 1TQLA 2HMIB 1JLFB 3OSNA 1JLAB 2ZE2A 3C6UA 2IJNA 3IGNA 3E51A 2XCPA 3I5BA 3MEDA 5T14A 1TKXA 2I5JA 1RTJA 3MEEA 5F9LA 4NLWA 5KFVA 3Q8QB 3OL6A 4NRUA 4NRTA 2WCXA 4KFBA 2XGPA 3QLHB 4U7CA 1HQUB 1S1UB 5FDLA 4G1QA 1S1WA 2JC1A 4H4MA 4ED8A 3PR5B 1LWFA 3DLGA 3H4BA 4RW8A 4O3OA 5DLFA 4O3NA 4NLXA 3V4IB 2VG6A 4MIBA 1HMVB 5K14B 2FVQA 1REVB 1S1TB 2WOMA 3M9MB 3RB4A 2OPPA 3C6TA 1VRTB 1DTQA 4XPEA 2HNDB 2R2RA 3H98A 1JLEB 3BGRB 4URGA 5KFFA 5CYMB 3MR3A 3GIIA 1N56A 4KO0B 5L9XA 3IG1A 4XO0A 2FLNA 4NLRA 5EWFA 1KHWA 4Y3CA 5KG0A 1TL1B 4O3RA 4DL3A 1U09A 4KBIA 4IFVB 2IC3A 1QAJA 4FS2A 4KSEB 1TL1A 3DRPA 2C22A 4KO0A 4KHRA 1DTTA 1N4LA 5KG3A 4U6PA 1T03A 4KV8B 1C2PA 2QV6A 2IAJA 2YKMA 4KKOB 4J9KA 5J2QB 1TKZB 4EYIB 4WE1A 3GV7B 4NLOA 5I42A 1SV5A 1TKXB 2I5JB 4Y2CA 2HNYA 2YKMB 2BRLA 1JLGB 3RB3A 5KT7A 4IH7A 1RT6B 1FKPB 3V6KA 3FQLA 2C2RA 1BQMA 4IFYB 2F8EX 5DQHA 2DPIA 1D0EA 4TY8B 4QWCA 2AGQA 1MMLA 1RTIB 4ECTA 3DOKA 4Q0BB 5C24B 3CJ5A 1RTJB 5KFPA 5KG6A 4ECZA 4O4RA 2ZD1B 5F8MA 4ECSA 4ED7A 1VRTA 3RBDA 1S0OA 2BANA 2VG5A 3E01A 3N6NA 2FVSA 4ECXA 1SH0A 3BQ0A 2ASLA 3KJVB 4J9NA 2IA6A 2OH2A 3DRSB 1WNEA 4ID5B 4XPCA 1RYSA 3GYNA 2IC3B 5DG7A 5DQGA 4RW7B 2WONA 3JSMA 1T94A 5KFDA 3DM2A 1HNVB 2ALZA 5I42B 4F4ZA 3KHHA 3KK3A 3CJ0A 1QUVA 4RNNA 2IAJB 3PW4A 3OL7A 3MEDB 3MECB 1HNIA 4KE5A 4I7FA 4RZRA 4FBUA 1RTDB 1BQNB 2QE5A 5KFJA 4NCGB 3CO9A 3DYAA 2YNIB 3PW7A 4Q45A 1JLQA 5FDLB 3BQ1A 5DGAA 3FFIA 2FJVA 1HNIB 2IJFA 4KAIA 2BR0A 5HROB 5KFRA 2GIQA 5HBMB 1ZETA 5C24A 1JIHA 1RAJA 3HVWA 3QGIA 4YMEA 5C5JA 5L1LA 1REVA 4RW6A 2V4RA 4NLPA 1TV6A 3DLEB 3I0RA 2B43A 5KT2A 3KNAA 3V6JA 3KHRA 1HQEB 3QIPA 1N48A 4EBEA 3BSNA 4MK9A 3BQ2A 4O3SA 1FK9A 5L1KA 5DLGA 2JLEA 3JYTB 5HP1A 1TV6B 3I0RB 3KLIB 2EC0A 3H5UA 2GIRA 4I2PA 3KLIA 3DM2B 3KLGA 3Q8PB 3DOLA 2AGOA 1TVRB 3JYTA 5DG9A 1IKVA 1RT1A 3BSAA 2ILYA 3DI6B 2IM2A 1JLFA 2BE2A 5KFUA 3GV5B 4K4UA 5JXSA 1RT7B 4RW4B 1S49A 1N5YB 4B3OA 3UQSA 1IKWB 4JUZA 4NYZA 4J9RA 2J6SA 4ZPBA 4R0EA 4RNMA 5KFAA 3M9NB 1RYRA 4Q8EA 5KFNA 2OPSA 4IH5A 4YR0A 4JV0A 4LSLA 4MK7A 5C25B 4NZ0A 1JKHA 3DOKB 3DLKA 4Q0BA 4QWAA 5KFBA 3T5LA 3Q8SB 4DEZA 4RW8B 4RU9A 2W9CB 5KFOA 4MFBB 1RTHB 4G1QB 2HAIA 3IGVA 5J1EB 4ZPCA 2FVPA 3MR5A 4DG1A 3H5YA 3OSPA 2JEFA 1LWCB 1S9FA 4IH6A 1JX4A 3FQKA 4Y2AA 5KFZA 4JV1A 2VG7A 4QWDA 3IG1B 1HPZA 2O5DA 3BSCA 4J9QA 3IS9A 5EWEA 2R8HA 4FS1A 1JLEA 3BGRA 3OHBA 1S97A 1S1VB 1RDRA 4EBDA 1LWCA 2ATLA 2V0NA 4NLVA 3DRPB 3V6DA 5KFEA 4IR9A 4IFVA 2AWZA 2DPJA 5D3GB 1KLMB 3KK2A 4DL2A 1S1VA 2JEIA 2VA3A 2VA2A 5EWGA 4MKBA 4LSLB 3FRZA 3LALA 5HLFA 4EEYA 3KMSA 4F4XA 1TKTA 1SV5B 2RF2B 1Z4UA 2W7OA 4JV2A 4RW7A 3JSMB 4RW9A 5J1EA 3GIKA 5DQIA 4DG1B 4TXSA 5F8GA 2CKWA 1HARA 4TY8A 4H54A 4ZP6A 2AGPA 3QLHA 3T1AA 3GQCA 1C1BA 4PUOA 3T5JA 4WE1B 1S9EA 2V9WA 2BANB 2YKNA 1EP4B 3CDUA 3QGGA 2ZD1A 1NHVA 1QE1B 1HYSA 4ZVFA 4IG0A 1EP4A 3RB6A 4H4OB 1S1TA 2WOMB 3KLVA 5F8LA 5KFYA 3PJWA 5F8JA 1KHVA 2FJWA 3G6VA 1SUQA 1IKVB 1RT1B 3HVTA 3KLFB 4K4YA 4O3PA 2BE2B 3BJYA 4IG0B 2UUTA 3KHLA 3KLGB 1DLOB 2W8KA 3LAMA 1UWBB 3G86A 5KT3A 3EPGA 4HYKA 1JLBA 4TLRA 3T19A 1VRUB 1J5OA 3H5SA 1LW0A 4K4VA 5J2QA 3N6MA 1DTQB 4M94A 4NCGA 2ZE2B 4Q44A 3H40A 3KLHB 2B6AB 3NBPB 1BQNA 2XWYA 4MK8A 2FVRA 3DYAB 5KFMA 4ZP9A 4KFBB 3DI6A 3TAMB 1R0AB 3BSOA 2RDJA 4EYHB 1LW2B 3PW2A 4RW6B 1HQUA 4URQU 4ECVA 4ICLB 4IRCA 1QE1A 1HYSB 4F50A 5HBMA 4O3QA 4ECQA 2YKNB 3CJ4A 4ICLA 4TQSA 1JXLA 1HPZB 4ECRA 1S6PA 3DMJB 3CDEA 1S48A 5EUHA 4ZVEA 4IRKA 2BQUA 2R2SA 3QIDA 3KJVA 5KG5A 3KK1A 1C1CB 1FKPA 4K4XA 2VG5B 3E01B 3LANA 4Q8FA 2XC9A 4WZMA 1S9GA 2W9CA 1OS5A 3QYYA 3MEGB 2I1RA 3NAIA 3CJ3A 3PJXA 3LP0B 2FLLA 5J2NA 2C28A 1JLBB 3KLEB 4URSA 3D28A 3GIJA 4ED0A 3M8QA 2BQRA 4ED6A 2D3ZA 2RKIB 1RA6A 3KHGA 3TQ1A 1JLCA 1SUQB 3HVTB 2C2DA 5KFCA 2ASDA 1I6JA 3I0SB 2WRMA 5CYQA 5C25A 4I2QB 4WFYA 1TKZA 1RT6A 3IRXA 3DOLB 3UPFA 4J9SA 2WB4A 1HNVA 1SH3A 1IM4A 3H59A 1RT7A 2XI2A 1BQMB 4QWEA 4DL7A 4Y34A 2UVWA 4R8UB 1S1XB
chains in the Genus database with same CATH superfamily
1GT8A 2RQKA 1F1BB 1S4FA 3NKYA 3RB0A 1LWEA 1DAXA 2IM0A 2JH3A 3EWGA 4USMA 5KOWA 3U1MA 5F9NA 1LKZA 3JQMA 1BHNA 1K1SA 1TFWA 5H9FK 1RAOA 1VQOS 2DH9A 3M2VB 1PO6A 1RAIB 4H4KA 2CQBA 2W2OP 4NPOA 4X65F 2XGQA 4AQYJ 1FTRA 2DGSA 2KN4A 3O2IA 1HR0J 1H0HB 1CULB 2HWHA 3G6ES 1VQ8S 5ETNA 3M8QB 1U2FA 2PT0A 1N36J 3LO3A 3UWTA 4QCLA 4WYLA 1T05A 2MQNA 4NLQA 4IOAQ 2UU9F 3O44A 1H38A 3NL0A 2Y9HA 4X62F 1CC8A 1CBKA 1HQ2A 4GO7X 1JLAA 2VU5A 3GFXA 4AD6A 1S0MA 1JNZB 5GAEU 3V6HA 3NEKA 2VFUA 2W8LA 2UVUA 3PTWA 1HNZJ 2FGCA 2FJXA 4M95A 1N0VC 5D3GA 2LA6A 2KXFA 3D0HE 3EVOA 2FJBB 2WK4A 3DLEA 1U1RA 4DL5A 1XC9A 3KKFA 1FRHA 2M9KA 1RQ0A 1D1UA 3U02A 3D9BA 4ES1A 3QZ7A 3AOAA 1T9WA 2DGQA 2VC0A 3MI7X 3OT9A 4C6AA 4F0HA 5HQLA 4QW9A 2HQGA 1QVFR 2RS8A 3W63A 1UEUA 3OTDA 3CJSA 1RE1B 1F9EB 3HD1A 2ILZA 2R7UA 4A8FA 1KR4A 2OKQA 3WDOA 4K4WA 2CZ4A 2EW9A 1ACMB 2VOPA 1RA7A 2V8PA 4ED3A 3I4HX 8ATCB 1TVRA 4K4ZA 3NMAA 4DR2J 1IBLJ 3QRQA 2CPHA 2AV5A 4DV3J 1VQ5S 2WVBA 1U1KA 2HHHJ 2AEFA 4ECWA 2CQDA 5ETOA 5FIIA 5AE2A 2RUSA 2BEFA 3PXGa 4O4GA 3PW0A 3NMRA 4F4YA 1QAYA 4USVA 1N5TA 3EMTA 1RT5B 1SKSA 3OUYB 3SSQA 4LQ3A 3DDKA 2DHAA 2CWKA 2Z0GA 1FRJA 5KT5A 1Q8LA 4YUDA 9ATCB 4M5DB 2WHOA 3P5TL 1RT3A 1S10A 2IMWP 4WFAQ 4PUOB 3VZHA 2XNRA 4MJKA 3TAPA 4U67Q 2B5JB 2B4PA 4P7VA 1K0VA 1F9HA 2OAUA 4ZP7A 4AFFA 3IWXA 2JHEA 1HQEA 4CNYA 3VCDA 3PW5A 3RAXA 3MM8A 4PWDA 3M8WA 5MAOA 2YKQA 4G1IA 2ZJPQ 1S0NA 3QRPA 3CJKB 3BH7B 3FDSA 5ETTA 4H4MB 1S57A 1LQ9A 2W4PA 3MMCA 4FDFA 4ZOSA 3ZXWA 4BLGA 2NQPA 2ZNZA 4R5PB 3C16A 4ANEA 4DL6A 4J90A 3TZXA 4ANCA 2X1AA 3B78A 3ADAC 1P9YA 4FKXA 4QPTA 4X64F 4U9RA 1C1BB 2BJ9A 1FKOA 1J5OB 1S9EB 4DL4A 3R2CJ 4EBCA 5CZXA 1OY6A 2EXUA 4X65J 5DGBA 1W26A 2CQHA 4ZVGA 3H20A 4M1KA 3G6YA 4HT5A 2VPZB 4RWXA 2LXUA 4ZVUB 3Q8RB 4CWBA 2XO6A 4JI5F 2HHVA 5KT6A 1SKWA 3NLCA 4Q43A 4NEYA 3P96A 3OFEA 2DR6A 3OR2A 3UN5A 1TU0B 2G0IA 3TAQA 1VBXA 4DR7J 1GMWD 2YH0A 5IT9Y 5J2PB 1FD2A 1ZYQA 4K2XA 5LXRA 5IQQA 3S01A 4CQ1A 3PJ9A 5HMWA 1RK8A 4OV1A 3QT8A 1T05B 4OHXA 2ASYA 4UOCA 5KFLA 1VISA 5KG7A 4DQIA 2CNLB 3BV8A 4ETZA 4V19X 4E0DA 4DR3F 2NCKL 2E5LF 4ZKAA 2B9EA 2V8DA 2AJ1A 2PA8D 2HNZB 1OMSA 3KG0A 3H4DA 2XMTA 4U8YA 2AGQA 3T5HA 2PFFB 3UCUP 2L9NA 1QDUB 4DBQA 2KM8C 3J7A1 2AF6A 2ADBA 1CJKA 3KK3B 1ZA2B 4WXWA 3C2PA 4X4SA 4ED2A 5L8RC 1YJUA 3W1YC 1RT4A 1FD8A 1RU2A 2AJFE 2OEKA 1PJ6A 2ZBQA 3G82A 1WUUA 3GZ7A 1S1XA 3SCIE 4ZLNA 5KFKA 3OVAA 3BDEA 2MHNA 2D3OR 1NNDA 3M8YA 3CJRA 3MMAA 1R8CA 2LU2A 3BGFA 4OJ3A 4UOGA 1HHSA 3V6DB 3IMQJ 2ZBPA 4DZDA 2H3EB 4ZK7M 3CSKA 1FXDA 1JXVA 3GIRA 4L75A 3DGVA 4P72A 2I9SA 3H0PA 4HDGA 2B7BB 3WIUA 2MLXA 3QAEA 2BQ3A 2YKPA 2CFXA 1UETA 3HHLC 1IKWA 1FWPA 1KVIA 2VD3A 3O6QA 3DLHA 1PBAA 4ALZA 2RNEA 2JC0A 4M5IA 4NCAA 3BO4A 1U0HB 3VVUA 2FLOA 1KNZA 3TARA 1CC7A 2GQCA 1IR0A 2RE1A 4QR2A 1O5JA 2NPFA 3MR2A 4PQUB 3CDWA 2XI3A 3CCTA 4YB6A 3EVMA 3KG4A 4A8MP 1SKUB 4WYWA 2DBBA 5KFGA 1IKYB 1FO1A 3MEEB 1KOOA 1XR7A 4QPXA 3IR5B 5IWAJ 4DV6F 4JI3F 4NXNF 1JWWA 3LP1B 2UV8G 1WC6A 2KH9A 3IRXB 4B08A 3CEDA 4NYOA 3AA8A 1LWFB 3N0VA 3BO3A 4IDKA 1T3NA 4CM0A 3QWUA 4F36A 1DRZA 3KK1B 2VKZG 1ZTWA 1UWAA 4O44B 1WACA 1SXLA 1KKHA 3KLEA 3QFHA 4YN3B 2VDIA 5IT4A 4OX9J 2YKAA 3M30A 3MXHP 2YQ3A 3T3FA 3LP0A 1W2BR 1FRXA 3JSBA 2NXUA 2GVDB 2RDIA 3PEJA 1MWZA 2AX0A 4JI6F 1X4HA 4UW2A 3D2WA 1CS4A 2F9JA 2VB6A 2GNKA 4Q2MA 5ETSA 3RJMB 5DM6Q 1WTBA 2Y8YA 2C3MA 4GRSA 1VFJA 1TQLA 3LGMA 2HMIB 3IP0A 1T11A 4F3MA 2XCPA 3OVSA 4X4VA 2C2OB 1RWNB 5IXUA 1RUSA 2AJ0A 2FC9A 3OL6A 3CULA 2MGZA 2ROEA 1HBNA 5BXIA 4KFBA 3W9IA 1FXLA 2YY3A 4U7CA 2G1HA 4A8QA 1HQUB 2VQFJ 3RYLA 1FFSB 1IBCB 1S1UB 5FDLA 2E5GA 3ZO7A 3SQOP 5ITHA 4UTGA 3PR5B 5DLFA 2HGLA 2DH8A 3L7OA 1RKIA 4MIBA 1HMVB 3IFEA 4WU3A 5LMNF 5CD4A 3B6BA 3RRHA 2P8IA 3PYGA 1S77D 3C6TA 5D6GA 1VJWA 2R2RA 3BGRB 2G2ZA 1H7XA 4A4JA 3BYRA 3F0NA 4B3RF 2MXYA 2BKPA 3IG1A 4XO0A 4PRFA 1XERA 4NLRA 4WJBA 1NK4A 1RLDA 2A1BA 3QATA 4O3RA 2BACA 1U09A 3GJSB 3RU0A 4CH0S 1CJTB 4B3SJ 1WI8A 1ZBTA 3QQCD 3VAJA 2CQ0A 1LK5A 3WC2A 1HBOB 2EI5A 2HQIA 4Z2XA 3T1HJ 4PCQA 1YJNS 1FRKA 2J8AA 3PO4A 5KG3A 2IDLA 2PE8A 4CLFA 1T03A 2QV6A 2RD5C 4KKOB 1VQKS 5J2QB 3F44A 4P2MA 1GXTA 3MDFA 1E6VA 4DR4J 2DNPA 5I42A 1SV5A 3NG8A 1TKXB 2I5JB 1UFLA 1Q81T 1HR0F 2X1FA 2BRLA 3SFUA 2R4FA 4C8OA 4OI4A 2HHWA 1MSWD 4IH7A 3HSJA 2GJ2A 3CJQA 3PYFA 3SIPB 3MAAA 4C8YA 3PV8A 1FEHA 3PFEA 4IFYB 1UZDA 1NB7A 2QEXS 5CABA 2DGVA 3ONQA 4DQPA 5SZTA 4PG4A 1AXQA 1CG2A 2IRUA 4QWCA 3DOKA 3JS9A 1M5VC 4HTIA 1EIYB 2GVZA 4UF4A 2ZD1B 2VFVA 3U1NA 1Q1KA 2POKA 4ECSA 1FDDA 2GZOA 4LF4F 1TMJA 4LFCJ 2HHXA 3N6NA 2FVSA 4ZN1A 3BQ0A 4X62J 3M8RA 1EKRA 3HT3A 3DRSB 4CP5A 4DV2F 1WNEA 2VONA 1HLWA 1U26A 1ZOTA 2OP5A 2HFOA 4NYPA 1U7LA 4LBPA 4OZLA 3GYNA 4KGVB 3UNGC 4YHHF 3NS6A 2Y1IA 4LF6J 4OZ0A 3DHXA 4RW7B 3DM2A 1O51A 3DU5A 5I42B 1X7VA 2DEIA 2HPUA 2PA3A 2QL9B 3AJ1A 3CJ0A 2IRYA 3ET6A 3OD2A 3VWSA 4JI7F 3NGUA 2HQFA 2RB7A 1HNIA 4KE5A 4RZRA 3TJ9A 2FPHX 5C7PA 1RZMA 5GMEA 2QE5A 3CCES 2PMWA 2JVOA 3K89A 3M1VA 3RUBL 5A8KA 4JI1F 3DYAA 2YNIB 4DR2F 1IBLF 1KS2A 4JYAF 4KHPF 1JLQA 1TKDA 3NGRA 1WJ9A 3BQ1A 4HR2A 1CS4B 5DGAA 4C7QA 3FRYA 4TU9A 2IJFA 1B7FA 5KFRA 5HBMB 1JIHA 3NRBA 3EZ5A 3X3UA 1QD1A 1UJ5A 4RW6A 2WAQD 2ZVIA 3CO0P 4NLPA 1Q79A 2B43A 4W98A 5ETPA 3KJQB 1L3SA 2VBXA 3I87A 1CQNA 4ZIWA 2VIHA 4MK9A 3BQ2A 3MPYA 1TAQA 4OI3A 2Q43A 4YFUA 1RU1A 1DQ8A 3P6YC 4RO0A 1U1PA 2F65A 1NEEA 4ZPWR 3OR1A 3VGSA 2X1BA 2K3IA 2K1RA 3KLIA 5J1NA 2AGOA 1Y4ZB 5DG9A 2MKYA 4LF1A 2DR5A 4HACB 2XZDB 4LRCA 3M8SA 1L3TA 3MHYA 2DITA 2PC6A 5JXSA 2NSBA 2XMAA 4Y65A 4JI0F 3BB5A 2YX7A 3LQVA 4DDFA 5JJBA 3N28A 4DX8H 4DPUA 3IRWP 3UR3C 2QLFB 4R0EA 2J6SA 4WWSA 3CCQS 4FVCA 3PKYA 1N5SA 2VPXB 1NZAA 3PCOB 2QRRA 4K2JA 4DL0C 2DGWA 4M8LA 3FSXA 4ILRA 2VQFF 1Q82T 2QTWA 4WFNQ 1VIOA 1WHVA 5KFBA 2XYHB 4DEZA 1R6VA 3TVYA 2W9CB 1KTQA 2LEPA 4LFCF 1GK8A 3B4DA 3IGVA 4FXVA 1U6BA 3W8GA 4ZPCA 2YTCA 4YOEA 4LMZA 2GAHC 1LWCB 2JOQA 3L09A 5GAGU 5IT9U 1K0TA 2WW4A 5KFZA 1VQYA 2HBQB 5B7WA 2QSWA 4AUKA 3BM7A 3PFOA 2O5DA 5EWEA 2R8HA 4XIUA 2H5JB 2CADA 1CJUA 4RKUC 4EBDA 2B3TB 3JSRA 1NSQA 3Q89A 4QR1A 2B8PA 4B02A 2CQGA 2MZTA 3QFWA 4R25A 5M2PA 4HLBA 5KFEA 3NNHA 3D68A 2MZQA 2OJ3A 2YKOA 4CLWA 1U6ZA 2V69A 4PR6A 1QTMA 3HHDA 5EWGA 4LSLB 5F3ZA 5HMYA 3B82A 2MZ1A 3THPA 1K9MT 1X5TA 3PIPQ 1SV5B 2RF2B 1RLCL 1NPRA 2CA9A 2DHGA 3CMAS 4RW7A 2QC3A 1B0PA 2PSZA 2VKRA 3L95X 2AHOB 4ETXA 3PY8A 4P2XA 2GAGC 4H4KC 3GIKA 5DQIA 4AQYF 4DPOA 1T0TV 2W2NP 2CKWA 3GPAA 3U27A 3UCGA 4TY8A 4H54A 1Y5NB 2Q6CA 3X1LB 2ZOGA 4PUOA 2VPYB 3T5JA 4WE1B 1S9EA 1FTCA 1F6TA 4OYXA 2YKNA 3HJFA 1AYEA 2HW3A 3I32A 3CDUA 2ZD1A 1NHVA 1H7WA 4GKKF 4LRFA 4IG0A 4OQJA 2WVDA 1EP4A 2HHQA 5MLCV 3KLVA 6FD1A 4FYDA 3FCWA 1IBMJ 1SI9A 3D0IE 4AT1B 2R9LA 5F8JA 1IJEB 2R7SA 3G6VA 1SUQA 1CPZA 3MPDA 5LXYA 4B9LA 2BE2B 1RXOB 1WORA 1DLOB 4D3GA 5M2UA 5KOXA 1WWHA 1VRUB 4USKA 2U2FA 2YX4A 1GMUA 2HSEB 1UVMA 1NUEA 4L73A 5DO2A 4RBVA 1FX4A 5J2QA 1KVKA 2MTLA 2DO0A 4F4KA 2H48B 1TELA 3CCWA 4ZCIA 1VQ9S 4JV5F 3RW7A 1H73A 4P74A 2B6AB 1BQNA 4U8VA 3G8TA 1HIYA 3HFVA 3DYAB 2FHJD 2W2MP 1UVJA 1CJKB 1D9AA 2YWEA 3MTJA 4LREA 3VGVA 3R2DJ 1BWEA 4IRCA 3M6UA 3AQPA 1XNQJ 1HYSB 2YX1A 3QJLA 3EDQB 2YWGA 2KVQE 2JL9A 4OJ1A 4O3QA 4ECQA 4PXCA 2MPUA 2AZ3A 4ICLA 1WKKA 4R0JA 4ECRA 4PG7A 3CDEA 4ZVEA 3J7AN 1VRQC 2DNNA 5CCLA 4IRKA 1R0CB 3DDNA 4ZCMA 4KJIA 2EBGA 2O66A 1YRUA 2V2VA 3UO0A 3KK1A 4ZIVA 3W66A 4IO1A 2VG5B 2FY8A 2LCWA 4K4XA 2QMUB 4Q8FA 2VF3A 3W62A 1FNOA 3DGPA 1Y00A 1J5EF 2CJ9A 4ILLA 3MEGB 2I1RA 3NAIA 3CJ3A 3SV4A 1N8RT 1EZZB 2EKYA 2J9DE 2C28A 4DS5A 1IJFB 3D28A 2KJVA 3GYXB 3PHTA 1RTZA 3HT0A 4MT1A 3G9CA 4PABA 3M8QA 4Y2IA 1KBRA 2CJYB 3ZTSA 1G7CB 4CO2A 4FYXB 5SUHA 4ZJOA 3KHGA 2MKCA 3HVTB 5IV4A 2NUUG 3HFZB 2ASDA 1E6YB 3MUTP 1XNRF 1M90T 1SJRA 1RWUA 3U7JA 1RAEB 3K8VA 4P73A 1TKZA 4L74A 1JJ4A 2R7RA 4B3TF 5HANA 3DOLB 2ACYA 2KU7A 2XG8A 3MD1A 1TUWA 4OZ1A 2XY7A 2YVSA 2LQ8A 1JJCB 5GADU 4ES3A 3WQPA 2LEBA 3QRRA 3ILJA 1RT7A 2JLFA 4QJVA 4OHYA 1PILA 2FIUA 2B56A 3HSGA 3W2VB 4RUAA 2YXLA 3BYPA 3I5AA 4NLSA 4RUHA 4DR1F 3C66A 1YQHA 1O0PA 4LF6F 3IA0A 5HL7Q 1FDBA 5C2CA 4IQXA 1N32J 4ER8A 2CIMA 3T9NA 3MM5A 2XS2A 3M2VA 4I6WA 5J2NB 2MY7A 1S6QB 1FRLA 2D74B 2BE7D 5HATA 3J80U 3OV7A 2PMHA 3ILOA 3I5CA 1N6QB 4DSKA 2UXCJ 1U8SA 5AT1B 1R0BG 1WKLA 3NAHA 5E7OB 3C6TB 2MSTA 3A3NB 3HFKA 2UUCJ 2IVMA 1AZSA 1DQ9A 2AU0A 3K5NA 1NHKL 1C4CA 2HRYA 4HKQA 2LEAA 4NMLA 5KFXA 1NBEB 2J9EA 3AD7C 3OLAA 1WC5A 1HWKA 4DQSA 2W9AA 1FFWB 3EXYA 2HRTA 2HFUA 5G0RA 1C0TB 3SV3A 2VV5A 4OHVA 2VFTA 4NZ6A 5JUMA 4WKRA 4PYDA 2M7SA 2PDAA 1URRA 1C0UB 3V81A 2I8EA 2AYMA 3PZPA 1OPIA 2DRDA 5CHCB 4CCHA 4NXMJ 2DY9A 2IM1A 2HHHF 1JXEA 3ITHA 3K8WA 3PRVA 2J6TA 2UVVA 2E9RX 1UTAA 2DEJA 3K5MA 3FEXB 1YZ6A 5KFIA 4RR5A 1UCNA 1GXUA 3VVTA 3LA0A 2EVZA 3FBCA 1QJHA 1R3NA 3BREA 3I4PA 4ITSA 3SI8A 2QFIA 4B3MJ 2XM3A 3KTQA 1A9NB 1LOUA 2QLWA 1VBKA 1X5PA 2FY1A 1T9TA 2KFYA 1C1CA 1RHJB 1RJJA 2NUHA 1NDCA 2NPIA 5K8NA 4ATNA 2D41A 2ZKUA 4R8UA 5KG2A 4GKKJ 4O44A 4C8MA 3TJAA 2JDJA 2Z8QA 3MM8B 1TL3A 1TP7A 1U0SA 2GHWA 2MKSA 4PG5A 1SJ4P 4FBTA 3A8EA 1NPPA 1YJ7A 2KYXA 3OFFA 4N56A 5KFHA 1LXJA 4ZLJA 2J0QD 2W9BA 3ICLA 5B08A 3HF5A 3BGLA 4QU6A 3NP5A 2VG7B 5EGYA 2EWHA 2GJIA 5A0YB 4M5DA 1YG0A 3C15B 4ELTA 3DRRA 3TVZA 1S79A 1AA1B 3NBPA 2VASA 4C0BA 4NASA 3B8HA 4LRAA 3GLJA 1JLGA 1PYSB 1XNQF 1YX2A 2M2BA 3D3CJ 1G1XA 4O4GB 3MR6A 1ZTTA 1FCAA 3P8BB 1GH8A 4USTA 1Y5IB 2YPZA 3S6EA 1FFGB 1LWEB 2Y0BB 4TU8A 3RAQA 1BWVA 1TL5A 1WOSA 4ZDNA 4IKAA 2OUGA 4QOTA 5ETMA 4LT6A 3SFGA 2CQCA 3M2RB 2B9XA 4Q44A 1YTYA 2LQBA 4GKJJ 4YEAA 2FC8A 3CJKA 3MFIA 3QIPB 1YRXA 2E9TA 1RWMB 3D5MA 1H72C 2MJNA 1YGYA 3TA0A 4IOBA 4GC6A 1ZA1B 1KC8T 2HKEA 2DR8A 1NSAA 1TFYA 3D0GE 3EZOA 3PHEA 2W9BB 2AZ1A 3K5LA 1HBMA 3MECA 1U24A 4JI0J 3D66A 3IBCB 1VGYA 2ZNYA 2CPZA 2B9YA 4EZ6A 5EDWA 2E66A 4CLYA 2J7KA 2QMXA 5IM0B 4OYAA 2WONB 2KG1A 3A1YG 4ED1A 1VJQA 3KMQA 2JEJA 3CCLS 2N4CA 4ZCKA 1YJWS 3VZIA 1RT5A 1YBUA 4GC7A 3FGVA 2RAQA 1YIJS 3IN5A 4MIAA 3Q0AA 2N82B 2EC2A 3Q8UA 1Q78A 5CZVA 5E5NA 3SMZA 5RUBA 2ZC4A 3G8SA 3OTBA 5IV3A 2AYGA 2FLPA 1FRIA 3TOQA 3OLBA 1IVZA 4OZ2A 3C19A 3ITHB 4MAKA 3PYEA 1B0TA 1LW2A 1HW9A 4W4MA 4ZPAA 3W5XA 3KOAA 2GO9A 4PWDB 3PACA 4QWBA 4BS2A 3TVKA 3I82A 2F7VA 4WF9Q 3A8KA 4MFBA 5H1SV 3U1LA 1Q7YT 1HWLA 2G2OA 4DX5A 2ZH3A 3ISNC 1R31A 2Y3YA 3IS9B 1R0AA 2JFKA 1GX5A 1QY7A 2GCFA 2Q3PA 5A6WA 3RRKA 4OI6A 5LSOA 3CW2C 2QLXA 3MMJA 4X4OA 1NKEA 1VK3A 2LDIA 4JI2F 2XLKA 1FF2A 4ZVHA 5L9NA 3J81Y 1APSA 4IG3B 4CYUB 2DY1A 4ZITA 1Z2LA 2P9EA 2R8KA 2RUGA 3EPIA 4IUFA 1OSDA 1V5IB 1VQ7S 1XN9A 4WXOA 4RWWA 3IWLA 2RDDA 3OL8A 1R89A 3MR7A 2FHJA 4KGKA 4DV1F 4E2FB 4JI8F 3DGPB 2WVCA 1S4EA 3MEKA 2DR9A 1GMVA 4OZ5A 1KQKA 4KKOA 3O1LA 2GHVC 5A8RB 2LMIA 2F63A 4EO6A 4ZVRB 1PYTA 5L1JA 2H54B 3UD3P 1RTDA 1K1QA 1KQGB 2KT5A 2MSSA 1R7IA 1BXNA 1EAYC 2H5IB 1BGXT 4PEOA 3E3XA 3TR5A 5LOQA 3S8SA 1RHMB 4TKTA 3FCHA 3P3DA 2A2CA 1SC4B 4ZPDA 1NJZA 2W25A 4C3KA 4NA3A 2RMLA 2VFRA 3O8WA 4ED4A 4RNFA 2G2YA 2QA4S 1FJEB 2J9DA 4RLEA 2EFPA 3N9UC 5KFQA 4J9LA 2DCUB 3OQ2A 1HNWJ 1TZ0A 4I6YA 3PVXA 3W2WB 4DUYJ 3R5AA 4LBIA 2I6WA 1F9FA 5LSLA 2DHXA 1RWOB 4WFZA 1F2GA 2KKHA 4PXEA 1KP6A 2QO3A 2XTJP 4DUZJ 1DZ5A 3OVBA 3RW6A 4WP3A 1VRUA 2OPSB 3TA1A 2ZZMA 2JVRA 1L3UA 3CJ8A 4RUCA 4X4NA 1DLOA 4USIA 4N8NA 3ZZOA 2FTRA 3CCSS 3FFIB 4IRDA 3I0SA 5D15A 4PG6A 1UZHA 5JVGQ 3PX4A 2DXFA 1WSRA 3CVKA 3SDEA 5D77A 3I6PA 3OUYA 3OSNA 1UAWA 4CNZA 5BJRA 3C6UA 1NSPA 1TTHB 2AEMA 4DPTA 2D1CA 4DV7F 2RRNA 1ZM2A 5T14A 3MEDA 2DGUA 4F4ZA 4EFAC 1F5AA 5DM7Q 1T9VA 2NXNA 4FF1A 4NRUA 1N33F 5IFMA 4JI1J 4KHPJ 4QIFA 2E1AA 2DNHA 2E1MC 2N7YA 3A3PB 2ZBIA 2LU1A 3GYGA 2HBYB 2YQ1A 1N5VA 2FHMA 2E7VA 2JC1A 2R7QA 3AOBA 3TANA 3DLGA 3VR1A 3OXFA 4B3TJ 2A3JA 4PAAA 4NLXA 1YJ9S 1JQGA 3WIVA 1VCTA 3SXLA 1Y3JA 4OI2A 2AKWB 5K14B 2FVQA 3H90A 1NJIT 2KFZA 1R8HA 3MWBA 4AL7A 1WI6A 2RU9A 2V8VA 1DTQA 4XPEA 2HNDB 2YPYA 3CD0A 1JLEB 3D6FB 4F26A 4ZJQA 4DSEA 3GIIA 1N56A 2HFNA 4KO0B 3G87A 3W64A 2M3DA 4W92B 4LF8F 5EWFA 1WHXA 6AT1B 1TL1B 2MB0B 1NK0A 1X60A 4KBIA 2HHUA 2IC3A 1QAJA 2CJXB 3LGNA 4ES2A 3DFEA 4K5RA 2GGPB 1T9UA 3M2UA 5D0HA 1RAGB 4DR7F 1DTTA 3PNIA 3SCLE 4U6PA 3M32B 3C15A 4KV8B 2DNOA 4CTAA 2IAJA 2YKMA 4EYIB 3ZTQA 4WE1A 2KHCA 2O3DA 2Z56B 5LMUF 1NM2A 4A46A 4J5OA 2HNYA 1JLGB 1MMNA 1OQ6A 5AE3A 3J81U 4WTOB 5KT7A 3RB3A 4X66F 1TL4A 4GVBB 1NK9A 3FQLA 3TZYA 2C2RA 1I5OB 2COLA 3HSDA 3S1TA 3TRGA 1D0EA 3W2VA 3UN2A 2DPIA 1Q5VA 1KQSR 2E1CA 1WTFA 4GVBA 4QZVB 2BJ8A 2BOAA 3M2RA 3GJTB 3CJ5A 5D4OA 5C24B 3GE9A 4ZCLA 2XQCA 4ECTA 3K0JA 1RTJB 5KFPA 3UI3A 1KSPA 5T7LA 1D09B 4ED7A 1VRTA 3HSZA 3RBDA 1Q86T 1U8WA 3SCJE 2L41A 3GU0A 2BJ1A 1SH0A 4X4QA 4ECXA 2IIHA 2N4DA 3WZ0A 7FD1A 3HMJG 2IA6A 4LF7F 1JNRB 4OYMA 2HGMA 3VQTA 4DU8A 4ID5B 2APOA 2QG9B 5DDOC 2IC3B 3ZNUA 5DG7A 1P9QC 1RAHB 2CPIA 3JSMA 2ALZA 1HNVB 3D3BJ 3MAHA 2NZ4A 2WBRA 2GX8A 3THVA 2BUNA 4P10A 1YBAA 1TK8A 2BA9A 4I7FA 1EHWA 3SEOA 3DKDA 2EKNA 1A0OB 2E7XA 5HQ8A 5HI7A 3T6BA 2C3YA 4DPXA 3HDSA 2PEBA 4AXJA 5KFJA 4NCGB 3CO9A 2MMYA 3BZQA 3QWPA 4OYWA 4C0HA 3MUMP 3R1HA 4NCBA 4FF4A 1FJGJ 1Q0NA 2XNQA 5U47A 4DV7J 1C4AA 3TQEA 2QA2A 5HROB 2FHKA 3FZ2A 1R8BA 2GIQA 2J7UA 3ZTRA 4LFBJ 4DXLA 1RAJA 4FZVA 5L1LA 1UVLA 1Y0HA 1REVA 4M5LA 1TV6A 3I0RA 2BKOA 2YQ0A 1PC4A 3MM5B 5F0WA 1N48A 3D67A 5HJYA 2CRLA 4LUBA 3BSNA 4O3SA 2DHSA 1FK9A 1GMWA 1HHQA 5IOLA 5DLGA 5CD4H 5HP1A 1FRMA 1SL1A 3QJPA 4Y2KA 1TK0A 3KLIB 1VQ6S 2OSRA 4XK8C 2GIRA 2RSQA 3GB0A 2YBVA 4PZVA 1T7PA 3DM2B 2BJ3A 1RBAA 1HBUA 2AMCB 2G0CA 3DOLA 1ZM3A 2AJ2A 5D0GA 3Q8PB 1RT1A 3W9JA 2K3KA 5KFUA 2IM2A 1JLFA 2BE2A 2X1GA 4FNHA 2HQCA 1RT7B 4RW4B 4B9UA 4HL9A 2J5AA 3UQSA 4DFMA 1UW9A 1BY9A 3JSYA 3L4BC 3QBCA 1WG5A 2WZ1A 2X3GA 4ZVSB 4JUZA 4CYUA 3J7Z5 4CLPA 3M9NB 4J9RA 4Q8EA 5DZ7A 1XNRJ 4IH5A 4JV0A 3I9ZA 5CA5A 2XY5A 3HD2A 3NGKA 2X7IA 2EFGA 3TYTA 1JKHA 3DOKB 3RZAA 3D1QA 4QWAA 1I3OB 4QBUA 3Q8SB 4I4BA 1H6KX 1UEVA 1F0XA 3LWLA 5B0CA 1R6YA 1F2HA 4MFBB 1XJWB 1U1MA 4G1QB 4M5JA 3MR5A 3GONA 1CQMA 2RQMA 3K59A 2Z2MA 4Y2AA 2B51A 1JX4A 3LGHA 2CUYA 4K0KF 2AT1B 2GJFA 1ZAXA 2G13A 1N34J 3KJNB 3BSCA 2MQLA 2I2YA 3OHBA 1YRTA 3S7RA 1ZPWX 5B0FA 2A0FB 2DGXA 3CGIA 4KC5A 4F0MA 3H25A 2WSCC 1XMQJ 5A8WB 4CO1A 1HBOA 1FVSA 4Y28C 5CQGA 2ZDPA 2EEYA 3R5CA 3IBWA 2VODA 4DSIA 1CJTA 4MKYA 2OO4A 3MZIA 1NJXA 4EMDA 5ETVA 2OD6A 5D3GB 3KK2A 3NOGA 3D4JA 2V63A 4DL2A 4DR4F 1IBKJ 2M5YA 1T3OA 1LK7A 1VR6A 5HLFA 1YBTA 3PYDA 5DETA 3AD9C 4EEYA 4F4XA 3T1HF 1U1LA 3NNCA 1G2EA 4ENOA 2KXHA 1Z4UA 2HZCA 3FK4A 2RH3A 4JV2A 1MROA 4PPZA 1JB0C 4RW9A 5J1EA 2HAFA 1JJHA 3THTA 3IAM9 3M05A 5ETQA 2NREA 2RT3A 1HARA 4QYZJ 1U2CA 4N47A 2G0JA 1SL0A 2CQ2A 1RABB 3BN4A 1VQLS 2J0XA 2BANB 4B17A 3V5RA 2F4VJ 1EP4B 3DC2A 4NI2B 4M5HA 3QGGA 4XAKA 2VBZA 1FVQA 1HYSA 1SPBP 3DRXA 4TVAB 2L08A 3JAMY 1WC4A 3BGUA 3RB6A 1ELOA 1S1TA 4NE9C 5E0OA 2U1AA 1EARA 5F8LA 3LWMA 3PJWA 3KDOA 2CAJA 4K4YA 1UVIA 1IKVB 3KLFB 1J2VA 2KT3A 3CD7A 4OX6A 4OYPA 4O3PA 4IG0B 1S6OA 3KLGB 2C2ZB 3CDAA 2KG0A 4OIXA 3DU6A 1UWBB 3TO8A 4NOHA 4A47A 3ILIA 3ZZTA 5IM0A 4WZQA 1KVJA 2W2PP 3CCMS 2DGOA 4G6VB 4LF2A 1Q7LB 1LW0A 3CCUS 3M6XA 1L3VA 2XEXA 4WIIA 3N6MA 4GMKA 2PGCA 4CLLA 3SZ2A 4NCGA 2ZE2B 2OMLA 4KQZA 5ETLA 3PG9A 1P8GA 3KLHB 2P9CA 4JP8A 5IWAF 3CTRA 2M52A 3PEHA 4PXDA 3GMGA 2XWYA 2FVRA 4HHJA 3KJFB 1X0FA 4OZJA 3AB2B 2ZHBA 4KFBB 3TAMB 1FKAF 1M5SA 2DT9A 3BSOA 4EYHB 2JJ4D 4RW6B 3Q86A 4NL5A 4URQU 4ECVA 1M0SA 2XSFA 4G1PA 3EDRB 5HBMA 1N52B 2XMWA 4HI1A 2YKNB 2DXDA 2CJBA 2J76E 3CJ4A 1ZH5A 2R7VA 4CLUA 1EB0A 1S6PA 5CH7B 3TW0A 3GR0A 3AXKA 5EUHA 4C11A 2BQUA 3QIDA 2QT7A 2LECA 1FDAA 3TUZC 4B3MF 4B9VA 3C14A 4IQMA 2DXEA 3M8ZA 1CJUB 2XC9A 5H9EJ 4KGMA 2W9CA 5A0YA 3PJXA 4N7TA 3LP0B 4NI2A 1Q95G 1ROFA 3CT9A 4V1Ak 4XDCA 2M0GB 1SIWB 4J7CA 2SXLA 4CO5A 3KLEB 3DXBA 2FLLA 4WP8A 4F2RA 2MKKA 4UZBA 2HHTA 4ED0A 3PRBA 3HK2A 2OTLS 1UL3A 4ED6A 5E33A 2HZAA 4DMZA 2RILA 2RKIB 2W2QP 2H65B 4DCJB 2ZH5A 3RR7A 1JLCA 1WF2A 2XS5A 4P7TA 5G4DA 2C2DA 1QSYA 5KFCA 2EFNA 1NKBA 1J5EJ 2KJWA 5K20B 1RBLA 3JQJA 3VF0B 3VHQA 2H4YB 1FE0A 1O8BA 3UPFA 2V5HG 4J9SA 1NB2A 3G4SS 4X84A 1SH3A 4ZPTR 1L5UA 1IM4A 3HO1A 1LXNA 2XI2A 1HW8A 1BQMB 1M5HA 2UVWA 5F0UA 3AD8C 3W5YA 1TR0A 3HHLB 1F5CA 1HHTP 1B7YB 3QO9A 4DN0A 4RW9B 1QAIA 2EFOA 1UEKA 2AIRB 2QFJA 1SB6A 4KH1B 2HQDA 4RJVA 3HVRA 1VHIA 4K0KJ 2XMMA 5CYMA 1GQEA 2LKZA 2C2KB 3CIZA 3TA2A 5F8NA 5HVHA 4DX7A 5BYQA 1HWUA 2K8GA 4LRDA 3T5KA 1RHUB 1Y10A 5E2QA 2P6TA 3GSDA 1RT4B 1KWMA 2D69A 2K06A 2P6SA 2ASJA 3MCMA 2V6AA 3MPVA 1ZPVA 4DHVA 1IBKF 2R2TA 4LF4J 1NAQA 1TUGB 3EZUA 1FKOB 1MNEA 2V8GA 1WDTA 5I3QA 4J9MA 1VLYA 4LIWA 3IM8A 3RBXA 2ATCB 2OEJA 2ROGA 3NCPA 2IJRA 3CC7S 3R1LA 3C6UB 2W24A 1VMBA 5J2MA 3KWMA 4ZMMA 3M8PA 1IWGA 2W7AA 3PW2A 4JI8J 2IYGA 3BPDA 1IM6A 4DV0F 1F60B 1U6FA 5KFSA 3NXZA 3ETMA 4DJBA 4RU2A 5D8HB 1G6BA 2NXEA 4P6QA 4LFAJ 4FF2A 5H9FJ 3PIOQ 4CO4A 3I55S 3M8PB 3QAUA 1VIXA 1WSVA 2XCAA 1RT3B 4OLOA 5AJ3J 4OJHA 4X2BA 2YNGA 4QW8A 4B9SA 5HP1B 1TL7B 2ZJQQ 4NMXA 1AFJA 4MKAA 4LBHA 2XZWA 3WHIA 1S99A 2DO4A 2LP4A 4LFBF 1RTHA 1MWYA 2DNZA 2E7WA 4P2SA 3C46A 3ZZUA 1H2UX 2R8IA 3Q24A 1KOHA 3CJ2A 1NH8A 2K1RB 2R8GA 4R5PA 3C16B 4MIWA 1URNA 1HBUB 3F41A 4I2QA 2BZ2A 2HIQA 3PRDA 3UR0A 4NLDA 2XO7A 3GSIA 2KO1A 5FD1A 1T03B 3G6XA 4ECUA 4C8LA 4DPWA 2HVEA 4I7FB 4DX6A 1BD6A 4YHHJ 1EETA 3HLUA 3AAWB 2MQQA 2BDPA 1RHRB 1NK7A 1X9SA 2V9KA 4QYRA 3EGNA 4FYWB 5I3UB 4EWTA 4YP3A 1AW0A 2UVRA 2ZWOA 2N3OA 1YDLA 4PQUA 5I3UA 1TK5A 2PO4A 3HKWA 3UE2A 3UDVA 3LP2B 4IG3A 1NMEB 2HWTA 2P2CB 3ENAA 4AYBD 4DSJA 2BBEA 1T9YA 1UFWA 4F3OA 2HBZB 3PR4A 3NWRA 3GIMA 3MAQA 3PM9A 1Q8IA 2NZCA 4D3HA 1FT8A 4ECYA 3CD5A 3RBEA 2V2QA 3FC9A 3HVAA 2R2UA 1HD0A 5DZ6A 3R97A 2V2KA 3UDLA 3GV8B 4A48A 4CLTA 2KTQA 3HM9A 1ICEB 1Q8KA 4FVMA 3R7NB 2C2MB 2KYZA 3MMAB 1VLOA 1IQTA 2ZFHA 1AB8A 1X4AA 3ZZ0A 2R8JA 2UU9J 2XSJB 5B0EA 1RSCA 1RAAB 1Y9OA 3B54A 5KTQA 3DLLQ 2LLZA 2ADCA 1TKTB 3UDCA 3EXCX 3NNAA 3H42A 2GVZB 4KV8A 3GWCA 4CTAB 1VBYA 4AL5A 3VGUA 1U4BA 2YNFA 3UN3A 2HMIA 2FZKB 2GQQA 4DLEA 1HMVA 5GAEI 2HNZA 4I68A 3ISND 2Z2ZA 4RNOA 4DFJA 3DMJA 4LSNA 4ZP8A 3EICA 5C2GA 2F40A 1YVFA 3QGHA 3MUVP 1S1UA 2WB1D 4P71A 1UA1A 1PG5B 3FMBA 2EG1A 1FNMA 3HHKA 2C2EA 4LQ9A 1WG4A 3TX0A 2OPQB 2BJEA 1W25A 3LP1A 2M4MA 2QL7B 5L1IA 3MM6B 3H8YA 1IKYA 5K14A 1HI1A 1RT2B 2YNHB 1KONA 1WHYA 3LUYA 1MU2A 1N5YA 4B3OB 1GEHA 1NJYA 1WF0A 1UPMB 1BMQB 3IO1A 5C42A 1FK9B 2HG4A 4FP9A 4J91A 2FYXA 4YR2A 3OJSA 4IDKB 1YJVA 2G1DA 5AXKA 3KLFA 2GC8A 2F4VF 4I6AA 4OHZA 1V3SA 5CXTA 2HNYB 2FGOA 2QLJB 4KGZB 2O01C 1VQ4S 1JKHB 5A6PA 2FZCB 5HQMA 2WVFA 2X51A 3R7SB 1SQEA 4ZHRA 3FUYA 4LVNP 3Q23A 1M5PC 3TP2A 5HROA 4FNIA 2CDQA 1DTTB 1AUSL 5KT4A 1VOMA 3DN9A 3DRYA 1H3DA 4DLGA 1IXKA 1X5SA 3D6HB 4CO0A 1PJ7A 2MDAA 2CXEA 2VPWB 4RBTA 2DB1A 4YY3F 2VL1A 5GADI 1CSJA 5THWA 2ZDOA 1SJ3P 3P5BP 1GX6A 3O5TB 4ID8A 1AFIA 4CIOA 2WTFA 3FEYB 3MM9A 1UP1A 2B5JA 2FJEB 4TN2A 1DARA 5D78A 5F3TA 5KG1A 2JLGA 3FJ2A 4V19J 5J2PA 4DCOB 2CQPA 4XDDA 3EUNA 3C14B 2E1PA 3DLGB 4NLYA 1F3VA 2R7TA 1S9GB 2YWKA 3AHPA 3BBFA 3GILA 5AJ3F 1IKXB 1ZS6A 4QQBA 2VG6B 4TQRA 2FJDB 3J7YI 2IM3A 1NZ8A 1OIAA 2W1BA 5DDQC 4YR3A 2XYGB 3CF5Q 2AJ4A 3T9ZA 4K7QA 4ZN3A 3NGDA 3KDNA 3OXGA 5IC6B 3EGWB 1K47A 2UXDF 3AXMA 4NX9A 1HI0P 1S0VA 1RHQB 4UZCA 5GVQA 4DV2J 2HNDA 1REGX 1M5KC 1H2TZ 3OR1B 1KLMA 2J0WA 4J37A 3MFHA 2PEHA 2IVYA 4TYAA 1OY9A 2B9WA 1XTZA 5IS2A 3T6JA 3EM1A 2CDRB 3ZZPA 1FJGF 1C0UA 3V81B 1T95A 3LPYA 3CD6S 1D3WA 2IJNA 2ZE2A 2MZJA 2DCLA 1UJ4A 1SBRA 3IGNA 1KFDA 1MROB 2XWXA 1DHMA 3PX0A 3A8JA 3WC0A 3Q8QB 4JI5J 3MEEA 2BM1A 4NLWA 4YS2A 8AT1B 4FXDA 3SBMA 4KPCA 2E5HA 5LJ5Y 2WCXA 3BGOP 1ZAWA 5M2RA 4B3RJ 1FJCA 2A10A 4HDHA 4P52A 4PQAA 4DZ6A 1WDDA 3QMQA 4F02A 4H4MA 1U0HA 1WC1A 2XMVA 3H4BA 4DF4A 4RW8A 4O3OA 2VBYA 1YJRA 2HGNA 3GFZA 5D0RA 5KAKA 8RUCA 3RB4A 2WOMA 5T7LB 1PAUB 1U1NA 2O1PA 2OPPA 4N41A 5KFFA 3H98A 2JX2A 3VALA 3VAKA 3ZZYA 2FLNA 2HHPA 2DTJA 1KHWA 1Q53A 2H1YA 3HZGA 3IAS9 1WC3A 1WC0A 3HULA 4Y3CA 3HKZD 2MQ8A 5D4PA 4I64A 5KG0A 4C8NA 4DL3A 4IFVB 4BBYA 1BQXA 2LQ9A 4X4TA 4DCPB 2VC1A 1A6LA 2C22A 3PKMA 5LMNJ 1U48A 1N4LA 2P9GA 3MM7A 4YDXA 4J9KA 2KRRA 1TKZB 2FDNA 1U25A 1OPZA 3NGTA 3IXQA 3GV7B 2OGUA 3A8IA 4Y2CA 5BYRA 2CPFA 2R7WA 1O6XA 5BR8F 2XY6A 1RT6B 2FZGB 1FJ7A 6FDRA 1FKPB 4BDPA 3Q8YA 1RCXB 3V6KA 4GO5X 2F8EX 2ABYA 4LR8A 4USUA 1EX8A 3SDEB 5L39A 1F5BA 4DQRA 3RGIA 1LNQA 2F3JA 3GP9A 5K8PA 1M1HA 3DLBA 5HO4A 3N5FA 2MY8A 1MMLA 2WSFC 2EK6A 2LQ5A 5IZHA 4F2SA 2LYVA 2E5JA 2W01A 5KG6A 1P6TA 5K8OA 3WX8A 3D1HA 4WFBQ 3BH6B 1NK8A 1RHKB 2VG5A 1DURA 4CO3A 2OELA 4PG8A 4F04B 2HQ3A 3W65A 1FWLA 1VI7A 2F8HA 3CNQP 4Q2LA 1N0UA 3TX8A 4XPCA 1F3FA 2RVJA 3HXMA 4ZVPB 5F41A 4PWUA 5DQGA 2L9WA 4CT9A 3GFHA 2WONA 5KFDA 1P27B 1FWKA 4O0IA 1CLFA 4LSZB 1QUVA 2K7JA 2DIUA 1NH7A 3LPEA 4A8XA 3CB4A 4F0KA 5CCMA 3OL7A 2CJKA 3OTCA 4OJGA 4WK3A 3MECB 2MJUA 1VC5A 1RTDB 1BQNB 4IOCQ 2HVZA 4M5NA 1I94J 2GMJA 2JFDA 1FA0A 3PW7A 1ULRA 3FBEA 7AT1B 4C8KA 4C4WA 5FDLB 2LFVA 1IQZA 1OWXA 3GG1A 1UA0A 2VQEF 2HURA 1OYDA 2XBPA 2XMKA 4CM2A 4F3QA 1QVGR 3W8PA 2ZKTA 3SYZA 3KXDA 2B0GA 1RWKB 3VGTA 3MMBA 1ZETA 1OYEA 3HVWA 3QGIA 4YMEA 4I56A 3PX6A 2JNJA 1PJ5A 2HEKA 1HWJA 3DNCA 3DLEB 1U02A 3O3LA 3WBZA 1D8ZA 3A13A 2HS3A 3W2WA 4HH1A 3QSYB 3V6JA 2AYBA 3KNAA 3QIPA 1X31C 2QN6B 4OX8A 4HEA9 4EU0A 2DKOB 3MCOA 3OFGA 2PI4A 4JI3J 4OX9F 5L1KA 2JLEA 2QA4G 4DUZF 3N4WA 2VQEJ 3KNGA 5E41A 3KUHA 4X4RA 1TV6B 3I0RB 2CPYA 1S72S 1YSJA 3AJ2A 4NWBA 1ZM4A 2IRXA 1V9OA 3GTYX 3H5UA 4DUYF 4U7UK 3TUJC 2RHQB 2PD1A 1K8AT 1TVRB 3JYTA 1NLKL 3IR7B 2V67A 3CC4S 3BKTA 4K4UA 3DI6B 4C0OC 4OYBA 1BE4A 3V2UC 4DR6F 4ED5A 1X0PA 3SCKE 1VQMS 1N5YB 4B3OA 3AFGA 4LR7A 3IC1A 3K5OA 1SC1B 4U95A 2KT2A 2IBOA 2QGFB 5KFAA 3TI0A 1KD1T 1GXLA 2NSCA 2NXCA 1M1GA 1VK8A 4L72B 4LF9F 4LSLA 4MK7A 2DD8S 3BF4A 5C25B 5D4NA 4Q0BA 3NCQA 2HK2A 3T5LA 4X66J 5DDPC 4RW8B 4DR5J 1GAOA 2E1RA 1OO0B 1Z1ZA 1KEKA 2B4OA 1FHTA 2XHWA 2DNMA 2FVPA 4DG1A 3H5YA 4ZJLA 2KI2A 4IH6A 4Q5VA 5K8MA 1HI8A 4JV1A 1YHQS 2VG7A 4ZA1A 4UUXA 2PMZD 4QWDA 1UPPA 5LL6d 4J9QA 1RAFB 3V4MA 4EGLA 4YDDB 4FS1A 3T1YJ 1JLEA 2CZVC 1X5OA 4Q7AA 1CJVB 4EK2A 2AD9A 1S1VB 1RDRA 2GV1A 1LWCA 3FVYA 3NS5A 2RJZA 2IHR1 4NLVA 1KQFB 4P2FA 1FEEA 5HAOA 4CH1A 1ZZNA 3DRPB 3V6DA 3N01A 5E3QA 3TEGA 3UCZP 3RG6A 1MG7A 4ZVOB 4F67A 3OTEA 5IQ6A 1NK5A 1QSLA 1RP5A 2AWZA 4KTQA 3M7VA 2DPJA 2L9DA 2JEIA 1KLMB 2RS2A 1S1VA 2VA3A 2QA1A 4A8KA 3RTVA 3BPSP 2R7OA 2ZEJA 3OFHA 4L76A 3FRZA 2E5LJ 3LALA 4B3SF 4U7UD 2HHSA 4KT0C 1IN0A 2DNGA 4JI2J 5ETKA 1TKTA 4MKVA 4DV0J 1HKAA 2W7OA 1XMQF 3P45B 1VDHA 4L3KA 2R3VA 4X4PA 1H98A 1LEOA 2QYGA 3QT6A 3MMCB 5B0DA 5F8GA 4TXSA 4ELVA 2W4CA 4HT7A 5L38A 2BW7A 2CPEA 4ZP6A 3HPOA 1DQAA 2AGPA 3W3SA 3QLHA 2GMHA 3GCXP 5HMXA 4FPIA 1X4EA 3DOMA 5HVFA 4LFAF 1QE1B 4ZVFA 2BW2A 2ZH9A 1S5ZA 4KIAA 4CDIA 5FLXY 4H4OB 1WHWA 2WOMB 3R6LB 2CNNB 1NPKA 1WKJA 4DQQA 1QTNB 4B9NA 4IO9Q 2CYYA 1B0VA 5KFYA 2UXCF 3AA9A 3Q2TC 1KHVA 2DIVA 2HS4A 2FJWA 1I1GA 3HVTA 3HCXA 3RAMA 3ZTPA 4CT8A 4DV3F 5FJ4A 3BJYA 3LOUA 2UUTA 3KHLA 2OTJS 3BBCA 2GHPA 2W8KA 3EPGA 4TLRA 1J5OA 5GAHI 4O23A 4Z7CA 2H5EA 5EHHA 1LFWA 1GNKA 4DV5F 2UUAF 3G8QA 4XTTA 1Q8BA 3AODA 1DTQB 3MM7B 5A8KB 3H40A 4CLZA 2IMOA 3KYLA 3NBPB 1G3OA 1OY8A 2CVEA 4JI7J 2ALYB 1ZM9A 4MTPA 3G71S 4USHA 1XMOF 1UJ6A 2F5GA 4ZP9A 3EGZA 3US5A 3DI6A 3TZWA 2G9OA 1LW2B 2L48A 5T41A 4ICLB 3CCZA 2CQ4A 4PXBA 2HZVA 4F50A 3OW2R 2ZM6J 2KHDA 1H2VZ 4G65A 4HHHA 2NS1B 3UVJA 5CAAA 4TQSA 2IVFB 3ZC4A 1HPZB 4MYTA 2B4VA 4LRBA 4Y6IA 4EZ9A 4DFPA 3DMJB 2ZITA 4WBFA 1XMBA 1QUPA 3MPWA 2R2SA 5H9EK 4LF5F 5KG5A 4I67A 2KDOA 1C1CB 1FKPA 2OSQA 2V68A 4WZMA 5LJ3Y 2ZHOA 1S9GA 7FDRA 5AXMA 3Q83A 1XBWA 3QYYA 1HD1A 3UFCX 3QT7A 5J2NA 2GW8A 3ENQA 1JLBB 4DI6A 3POTA 3P4UB 2XLJA 1VBZA 2MEWA 1NXIA 3W61A 3ZZZA 1IR2A 1SC6A 3MCNA 2EFVA 1EJ7L 2B8QA 2D3ZA 2JZ5A 3R8YA 2DJWA 2XYPB 3R5BA 4PKDB 1SUQB 4UQGA 1YK9A 2ZM6F 3AOCA 4IYQA 4UT4A 4FN5A 1RKJA 4B9TA 3MURP 1UKUA 3Q22A 1A7GE 5CYQA 4Y0FA 4I2QB 5G0RB 5A76A 4WFYA 2F4FA 1RT6A 2ROPA 1DY3A 1U1QA 2PN6A 3W7BA 1HL6A 1SIZA 1T02A 2EBEA 1N36F 4A8YA 2WB4A 5E3RA 1AUDA 2AW0A 1KN6A 2J8SA 1E6YA 1JK9B 3JQKA 1I51B 4QWEA 2BM0A 4FXWA 3UD5A 4OV6A 3VAIA 4NLTA 3B4MA 4BWMA 2CNOB 3MTKA 4ZVTB 5KFTA 4G3IA 3EE3A 4EO8A 2F1FA 4DSLA 4H4OA 1P1TA 2DNQA 4P9SA 4IR1A 1VC6A 1EKSA 3MM6A 3MEGA 3TJ8A 3QZ8A 3R5DA 4N76A 1U45A 2OPQA 1YWXA 1T8EA 2OPPB 2RKIA 1RACB 3R9LA 1TL3B 1D8YA 2AX1A 4DUTA 2IDEA 4HTJA 3IR6B 1YLXA 1CULA 1KLNA 3MGJA 3W5ZA 1NHUA 2CG8A 4MH8A 1HBNB 2FD2A 1V5VA 2H51B 5B09A 4ELUA 1D9FA 1MWQA 1TMMA 2N7CA 2D7SA 3OXLA 4QIVA 2CPDA 1M1KT 1QSSA 2E5IA 1IUJA 1FESA 4LIRA 4OL8A 2EFQA 3H2VE 3V4IA 2CJQA 4Z7YA 1B3TA 3ZNJ1 3H2UB 3HP6A 2CNKB 1XQIA 4TNOA 1AROP 4DF8A 1Y11A 2OFGX 3CJTA 3L7UA 2QIFA 1MU2B 2ZUGA 4HVZA 2HVDA 2GIFA 3JTOA 4HI2A 5GAGI 1Y7PA 2EG2A 4N8OA 1B4SA 2ACMA 3R5JB 5B0BA 3CPWR 1MW7A 1ZZFA 2D3UA 4UOFA 4DV6J 4NXNJ 5KFWA 1S12A 5D4LA 2ZH2A 1DBDA 2MYFA 2DNLA 2DH7A 2CG4A 3E8OA 4LR9A 3VAMA 2JEGA 1FI4A 4CI0B 1X9MA 1IKXA 3A4TA 1S6PB 1GTEA 1LW0B 3L3CA 3VV2B 2V4JB 4I2PB 3FBBA 2C3UA 4CLSA 2WBMA 1Y5LB 3M9OB 1SQFA 2FVCA 3NWGA 4F4WA 2KZMA 2ZH4A 4DV4F 5EN1A 2HLTA 4NEZA 4BWJA 3MM9B 2MZSA 2BVZA 2B6AA 2ZH1A 2W7PA 4OMFG 1S1WB 2V4QA 2XLIA 4J9OA 3DRRB 2BJDA 2BOPA 2ZZNA 2H4WB 2I38A 2VDHA 3JTNA 2MQPA 1P1LA 3CMQA 2F9DA 5DDRC 1FDNA 3ENWA 4E8UA 2D9OA 1KTVA 2RQ4A 3EJMA 1VQNS 4J9VA 3KUGA 1C0TA 3C3LA 1XMOJ 3QO9B 3GG0A 2ZBCA 3HHLA 1XR6A 1X4FA 2OHDA 1RTIA 2G4BA 1QAXA 2EK1A 4C11B 4PWWA 4LF9J 4OI1A 1PIEA 3RRGA 2AEJA 4U96A 3LP2A 3HHNB 2OPRA 1UMJA 1IWAA 4K4SA 4LF5J 2VZ9A 2O67A 4ZHRB 4WPAA 3CCRS 3CMES 1RT2A 2YNHA 1SJQA 3LTOA 2UXBF 1W2IA 5KG4A 1H74A 4NLUA 4K4TA 4ZS6A 3CIMA 2DNRA 2X3DA 4C3MA 2YNIA 3LAKA 1RI7A 4YB1P 1B64A 3UD4P 2KM8B 3VQSA 4FYVB 3EGVA 4RNHA 4TY9A 3N79A 5C42B 3BS9A 5K5MA 1SL2A 1SVDA 3KLHA 2VJVA 1YI2S 4F7VA 2UXDJ 4OHWA 2RF2A 1UW4A 3AT1B 3MF5A 4P75A 3ET6B 1W7WA 2QMWA 2Y1RI 5J2MB 3K5PA 1E6VB 4KYZA 2YNFB 3E2EA 2VJUA 1SCJB 4KHMA 1Q5YA 4CLKA 1UWBA 1SC3B 4J9PA 4W90B 3DDIA 3EVWA 4N77A 1V3ZA 4K59A 4LSNB 2LVWA 2XSJA 4K50A 2IA0A 3KUEA 2KXNB 2HWIA 4WIQA 2E44A 3NY0A 4ZLPA 5IT0A 3UW1A 1XR5A 3N6LA 1N33J 2OLWA 1LWXA 2YWWA 4FYYB 2RU3A 1N6QA 3H2LA 2GMLA 2NXJA 5AE1A 3BR9A 2R7XA 4S0MA 2E29A 1S6QA 2AYEA 1S7IA 5J1PA 3TAMA 5DRKA 4A8SA 1MMDA 3GJQB 2ZH8A 2QL5B 3VTIA 2XB2D 2K2PA 4C3LA 2IBKA 5E3CA 9RUBA 3OHAA 3A3OB 1NO8A 2CZ9A 3GR1A 5DG8A 2XS7A 3DRSA 1UFKA 2OFHX 2CWXA 3JTPA 3LW5C 2Y1JA 3OL9A 4RBUA 2OD4A 4Y00A 2A6OA 2DRAA 1YZ7A 1PCAA 1K73T 3TUIC 2MKJA 2J0SD 1NK6A 5HLFB 3K17A 4YQWA 1ITPA 1EQ0A 1VS3A 4QIGA 3R3TA 2DRBA 4WCEQ 1WG1A 4ZVQB 4BHQA 4AXIA 3PO5A 2J7WA 3JXOA 3AH6A 1SJFA 2HYIB 2E9ZA 4OYOA 4KB7A 2BXJA 4KH0B 5F8IA 3JB9k 1SQGA 3M1VB 1U49A 5E3PA 2IPOB 2XULA 5B0GA 3H5XA 1NU4A 2MHEA 3ELHA 2MKHA 2Q79A 3MAAB 1WEZA 2HLUA 3M6WA 4OZ3A 4NXMF 2BRKA 3MD3A 1L3KA 3DLKB 2M70A 2CVIA 4LVOP 3TNVA 1SH2A 5CYQB 2Q1LA 2RHSB 1X8DA 2MGZB 1EETB 2VHGA 4JI4F 1R43A 2JWNA 5F8HA 3CE8A 3FSIA 2AQ4A 1GTHA 2J6UA 2IY5B 4TYBA 1Z2ZA 2BJ7A 2DISA 2KL8A 2N3LA 4X64J 1U2RA 2CQ3A 1NSKL 2YWFA 4DSFA 2QYCA 5EX0A 3W60A 4QYZK 1T9XA 3I31A 3IM9A 3SQGB 3POTB 1NJWA 5GMDA 1RADB 3H7HB 3TWZA 1WEXA 1PGZA 4WFXA 3FEZA 2KB2A 3FSYA 3P49B 3N5BA 2YNGB 4KY3A 4UY85 1S76D 1XIQA 1RWVB 1VYAA 3MOZA 5EX3A 3KK2B 2OPRB 2GO8A 1JLQB 1RWWB 2UUWA 4ID5A 2VBWA 3CWJA 4OLPA 3SQGA 1RWPB 1RCOB 3HI9A 4RW4A 4IFYA 1JLCB 2QX0A 3Q2SC 4I69A 3CCJS 1R8AA 1JLFB 1V3RA 4WKYA 4MYUA 4HH0A 1JLAB 2RQCA 3EX7B 2VICA 1DFDA 1PBUA 3E51A 4Z37A 3I5BA 3QT5A 1TKXA 2I5JA 1RTJA 4J9UE 5LT5A 4HHUA 4QIEA 5KFVA 5F9LA 4NRTA 1HFEL 2Y1LB 4GKJF 2OIHA 1SJ1A 2OI2A 2VFSA 2XGPA 1I94F 2CPJA 3QLHB 2DYAA 1DJ0A 3DXSX 2UUCF 1X4DA 4C8ZA 3K2YA 3CXCR 4G1QA 1S1WA 2M8HA 4ED8A 1LWFA 4K8RA 1KFSA 5HMZA 2WW8A 4O3NA 5GAHU 3V4IB 2VG6A 1BLUA 3BN7A 4C9DA 3NGSA 1TL7A 1REVB 1S1TB 1RB0A 1RBOB 2L3MA 3HJVA 4HACA 4DPYA 5KT3A 1VRTB 2VOOA 1J27A 2GVDA 4URGA 2K7KA 2V8HA 3MR3A 1B99A 2DNKA 5CYMB 2V4JA 3FNNA 2HVIA 5L9XA 1HWIA 3L7PA 4DU7A 2RRAA 1HNZF 3LF0A 3AB4B 5L46A 4I0WA 4FS2A 4KSEB 4YB7A 3AY0A 1TL1A 2C3OA 3DRPA 2DVIA 3WX4A 2ZH6A 4KO0A 4FKYA 4KHRA 1AT1B 3DCAA 3CCVS 3TUPA 4GVLA 3G82B 1C2PA 4RX6A 4RL1A 2Z4PA 2QSFA 2V34A 1M5OC 2V2ZA 2H9ZA 2IFXA 2W4DA 4NLOA 3D6MB 4JBCA 2DR7A 4ZPVR 2YKMB 3BBBA 3JAMU 4KPYA 3NS7B 4KGXB 2KZZA 1BQMA 5DQHA 4TY8B 3FMWA 3ZFVA 2BKNA 2ZOFA 1XWLA 2C1EB 2GQ2A 1PYOB 1RTIB 4Q0BB 2Z30B 3MOJB 2Z57B 2BABA 3DHWC 4ERDA 1OJ4A 2Y0SD 4O4RA 4WK1A 5F8MA 4TU7A 4OYZA 4ECZA 4JYAJ 2NR0A 1QLNA 2FHOB 3M30B 2BANA 3E01A 2HFSA 2PFDA 1S0OA 4JI4J 1LFPA 2ASLA 2CPXA 5K9FA 3KJVB 1HNXF 2Z58B 4J9NA 1K44A 2OH2A 1FERA 1CVJA 3OTOF 2B4UA 2NLWA 2UZAA 1HNWF 5LM7E 3D6TB 4A8WA 2ERRA 1RYSA 4E98A 2VH7A 1T94A 2Q6BA 1N32F 4BC7A 2LDYA 3FCVA 3KHHA 3KK3A 2DHHA 3J80Y 3HZEA 3OR2B 4RNNA 2IAJB 3PW4A 3BKUA 3D1OA 3ZTOA 3MEDB 5AXLA 2FJAB 3I9V9 3M6VA 2PIIA 1OSCA 5LSRA 4YY3J 1VQPS 1NKCA 2GFFA 4FBUA 5IC4B 3ENVA 1WELA 4C48A 2AP6A 2OMOA 3AJDA 4OX7A 2D3O1 2ZZTA 3QJJA 4M5KA 4Q45A 4X4UA 3SSSA 4AE5A 3FFIA 2FJVA 2HK3A 2FUG9 4DWIA 1HNIB 4KAIA 2KRBA 2BR0A 4NA2A 1FXRA 5C24A 4MMOA 4DOZA 4A8OA 4QU7A 2QZ8A 5C5JA 2V4RA 4M5MA 3F73A 2A18A 2A2DA 2DNYA 1QM9A 4L3NA 4DN9A 3GJRB 4USWA 5KT2A 1VC0A 3KHRA 1HQEB 2OEMA 2EPIA 4EBEA 4B9MA 4OFZA 2ZH7A 1S6UA 2R42A 1X4CA 3HX9A 4KRWA 5HSPA 3JYTB 5D0EA 3A12A 4K5SA 2MKIA 3PDNA 2EC0A 4C98A 3R27A 5DS7A 1OQ3A 3R7BB 4I2PA 3HHLD 4I1TA 2CJAA 3IBFB 4JI6J 3CDBA 3KLGA 3D54A 1MN9A 4LF8J 1RGVA 1PSDA 2GGPA 3M2UB 1IKVA 2ZOMA 1G4CA 2ILYA 3BSAA 2HS0A 2IYIA 3M4XA 2Z2YB 4RUBA 3GV5B 1NDKA 4USJC 4DR5F 5LMUJ 2LA4A 2M8DB 4CZCA 5HVGA 1TUVA 3KG1A 1S49A 1YKWA 4QR0A 3I56S 1Q4RA 1UVKA 2NYHA 2UUBJ 4OYIA 1IKWB 4NYZA 4ZPBA 4RNMA 1NRKA 1RYRA 1IR1A 5KFNA 2OPSA 2QJ3A 4YR0A 2MQOA 4NZ0A 3DLKA 1BUXA 4DR1J 3R5GA 5ETRA 5BR8J 2XHCA 4RU9A 2UXBJ 3KFWX 2Z2LA 3BDPA 5KFOA 1YITS 4YB5A 1RTHB 2HAIA 5J1EB 5A2QY 1S59A 2CQIA 4C97A 3OSPA 2JEFA 2BE9B 1S9FA 2Y8WA 2HIYA 3FQKA 3IWNC 3NCRA 3BKFA 4ILMA 1N54B 3BEGB 3IG1B 1HPZA 2JRSA 3IS9A 2BMBA 4DR6J 1RWXB 2GS8A 3BGRA 3EYZA 5GMKa 2UUBF 1S97A 1VQSA 2ATLA 2V0NA 2F8MA 1WOPA 1Q16B 4JB8B 1N5QA 1TAUA 2BX6A 4IR9A 4IFVA 5HN0A 4ANDA 5A8WA 4KR0B 1JJ2R 1VHFA 2UV8A 3QGPA 1X9WA 2VA2A 1N34F 4MKBA 3L9ZA 1R27B 2MZRA 2VUGA 1IBMF 2ZC3A 3FBFA 2V94A 4CRJA 3KMSA 3TZZA 2XMJA 1D9DA 3AQOA 4F25A 3F56A 2YWHA 2CQ1A 3JSMB 2ZUAA 5CYJA 3VAHA 2HFZA 1B70B 3K58A 5JMNA 2XMUA 2Q66A 4DG1B 3OPKA 2MLZA 1MLAA 2MQMA 5HK4A 3K57A 3OJUA 4DV5J 4N5SA 3T1YF 2UUAJ 4OZNA 1BC6A 3T1AA 4BC9A 3GQCA 1C1BA 4F4AA 5BYSA 4BCAA 1PC5A 1SKRA 2V9WA 2M88A 2HFVA 4DS4A 4RPFA 4F8RA 5E3AA 2LXFA 1R8PA 1HNXJ 3T41A 3NOCA 1XEZA 2B7CB 4LF7J 5FLXU 1FX2A 2D9PA 5HJXA 2DGTA 5I4MA 1WD6A 1PKUA 1JMTA 3M9MB 4DFKA 4JV5J 3C8YA 2C3PA 3VAGA 1RT1B 1NDPA 2NYIA 3HHEA 4UQTA 4NZ7A 4WTYA 2HVHA 3LAMA 3G86A 5DJBA 2HBRB 1JLBA 3ETOA 3T19A 1FE4A 4HYKA 2BV3A 3GCWP 3H5SA 2WSEC 2PI5A 4UY8T 1NDLA 1YJTA 4K4VA 3VAFA 4WP9A 1LV5A 5JVHQ 1U47A 4QIWD 3J7ZT 4M94A 3M32A 3QNWB 3SSRA 1NCLA 2ZVSA 4JOUA 3J81j 5B0AA 5A2QU 2ZHAA 2WVEA 4DV4J 2JSXA 3GFYA 2RIJA 4MK8A 2KFNA 3CC2S 4PPDA 5KFMA 4AL6A 1R0AB 1HA1A 2FB0A 2P5VA 2RDJA 3UVJB 4Y2MA 1HQUA 5AXNA 4ZLLA 1X4GA 1QE1A 3I96A 4M5GA 2ZBRA 2YH1A 1HBMB 3MMBB 2UP1A 4FF3A 1U1OA 1RISA 1MN7A 2FQQB 2BYCA 3R6GB 3ZZRA 4DV1J 1JXLA 5ADZA 2AJQA 1S48A 1PAEX 4OI0A 3BR8A 3KJVA 3K7RA 1WOOA 3QSIA 4LJMA 1KRPA 4UUWA 3TEHB 5I3PA 3E01B 4CH7A 3LANA 3RBZA 1EQMA 1CJVA 2ZWPA 4L6V3 3LH2S 2DK2A 1OS5A 4O0NA 1KDNA 1Y3KA 3ILLA 3MPUB 3UNYA 2LQJA 3DLJA 3G2XA 3BO2A 1N88A 3J7YU 4EI2A 3CUNA 2I0XA 4URSA 1CEZA 3W9HA 2RRBA 3QPIA 4M63A 3FZBA 3GIJA 2BQRA 2ZJRQ 2QLBB 2V50A 3RR8A 1WF1A 1ZAVA 1FNXH 1GFWB 1AZSB 1RA6A 2A6MA 4WU2A 1XK8A 4EUVA 3TQ1A 2J9CA 2C42A 2HRUA 3MCSA 3FKBA 3ISZA 1I6JA 3I0SB 2WRMA 1V6HA 3G96A 4FPRA 5C25A 2KVIA 1WEYA 2XZTB 1S7HA 2GA7A 2MLYA 5A8RA 2LXIA 1UVNA 3IRXA 2C2NA 3Q8VA 4TLQA 4NA1A 4UOHA 4DR3J 4C2MA 3D7SB 3DOMB 3ULHA 1HNVA 4NLGA 3OTOJ 3OBIA 3H59A 4PYAA 4DL7A 4Y34A 3UDEA 4R8UB 1X4BA 1S1XB
chains in the Genus database with same CATH topology
1GT8A 2RQKA 1S4FA 3NKYA 3RB0A 1LWEA 1DAXA 2IM0A 2JH3A 5KOWA 3U1MA 5F9NA 1LKZA 1TFWA 1K1SA 1VQOS 2DH9A 3M2VB 1PO6A 4H4KA 2CQBA 4NPOA 4X65F 2XGQA 1FTRA 2DGSA 2KN4A 3O2IA 1H0HB 3G6ES 2HWHA 1VQ8S 3M8QB 1U2FA 2PT0A 3LO3A 3UWTA 4QCLA 4WYLA 1T05A 2MQNA 4NLQA 4IOAQ 2UU9F 3O44A 1H38A 3NL0A 4X62F 1CC8A 4GO7X 1JLAA 3GFXA 1S0MA 1JNZB 5GAEU 3V6HA 2VFUA 2W8LA 2UVUA 2FGCA 2FJXA 4M95A 1N0VC 5D3GA 2LA6A 2KXFA 3D0HE 2FJBB 2WK4A 3DLEA 1U1RA 4DL5A 1XC9A 3KKFA 1FRHA 2M9KA 1RQ0A 1D1UA 3U02A 4ES1A 3QZ7A 2DGQA 2VC0A 3MI7X 4QW9A 1QVFR 2RS8A 1UEUA 3OTDA 2R7UA 2ILZA 4A8FA 1KR4A 2OKQA 3WDOA 4K4WA 2CZ4A 2EW9A 2VOPA 1RA7A 4ED3A 4K4ZA 3I4HX 1TVRA 3NMAA 2CPHA 2AV5A 1VQ5S 1U1KA 4ECWA 2CQDA 5AE2A 5FIIA 3PW0A 3PXGa 3NMRA 4O4GA 4F4YA 1QAYA 1N5TA 1RT5B 1SKSA 3OUYB 3SSQA 4LQ3A 3DDKA 2DHAA 2Z0GA 1FRJA 5KT5A 1Q8LA 4YUDA 4M5DB 2WHOA 3P5TL 1RT3A 1S10A 2IMWP 4WFAQ 4PUOB 3VZHA 2XNRA 4MJKA 3TAPA 4U67Q 2B5JB 2B4PA 4P7VA 1K0VA 2OAUA 4ZP7A 4AFFA 3IWXA 2JHEA 1HQEA 4CNYA 3VCDA 3PW5A 3RAXA 3MM8A 4PWDA 5MAOA 1S0NA 2YKQA 4G1IA 2ZJPQ 3CJKB 3FDSA 3CMAS 4WZQA 4H4MB 4ZOSA 1LQ9A 2W4PA 3MMCA 2NQPA 2ZNZA 4R5PB 4DL6A 2X1AA 3B78A 4X64F 4QPTA 4U9RA 1C1BB 1FKOA 1J5OB 1S9EB 4DL4A 4EBCA 5CZXA 5DGBA 2CQHA 4ZVGA 3H20A 4M1KA 3G6YA 4HT5A 2VPZB 4RWXA 2LXUA 3Q8RB 4JI5F 2HHVA 5KT6A 1SKWA 3NLCA 4Q43A 3P96A 3OFEA 3OR2A 1VBXA 3TAQA 5IT9Y 2YH0A 5J2PB 1FD2A 1ZYQA 4K2XA 5LXRA 5IQQA 3S01A 4CQ1A 5HMWA 1RK8A 4OV1A 4UOCA 1T05B 4OHXA 2ASYA 5KFLA 5KG7A 4DQIA 4ETZA 4V19X 4E0DA 4DR3F 2E5LF 4ZKAA 2V8DA 2AJ1A 2PA8D 2HNZB 3H4DA 3KG0A 2PFFB 2XMTA 3T5HA 3UCUP 2L9NA 4DBQA 2KM8C 3J7A1 2AF6A 2ADBA 3C2PA 3KK3B 4WXWA 4X4SA 4ED2A 5L8RC 1YJUA 1RT4A 1FD8A 2AJFE 3GZ7A 4DLEA 3OVAA 3SCIE 5KFKA 1S1XA 3BDEA 2MHNA 2D3OR 1NNDA 3CD6S 3MMAA 1R8CA 2LU2A 3BGFA 4OJ3A 1HHSA 3V6DB 4ZK7M 3CSKA 1FXDA 3CCMS 1L5UA 2I9SA 4HDGA 2B7BB 3QAEA 2BQ3A 2YKPA 2CFXA 1U