3DRSB

Hiv reverse transcriptase k103n mutant in complex with inhibitor r8d
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
424
structure length
405
Chain Sequence
b'IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Discovery of 3-{5-[(6-Amino-1H-pyrazolo[3,4-b]pyridine-3-yl)methoxy]-2-chlorophenoxy}-5-chlorobenzonitrile (MK-4965): A Potent, Orally Bioavailable HIV-1 Non-Nucleoside Reverse Transcriptase Inhibitor with Improved Potency against Key Mutant Viruses.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 107
structure length 405
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3drsB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drsB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drsB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drsB04
4O4GA 2W9CA 3CJ2A 4TYBA 3GV5B 2ASLA 2BE2A 4RU9A 4O4GB 2W9CB 3H5YA 3BSAA 1RTJA 3BGRA 1Z4UA 1QAJA 3QIDA 3GIMA 1S10A 4URSA 4M95A 2IM2A 2HWIA 2WK4A 4QWBA 5KG7A 2XGPA 5F8NA 2BE2B 3OSPA 5KT4A 5J2PA 1RTJB 3BGRB 2DPJA 3G6YA 2BRLA 2ALZA 5J2PB 4QW8A 4ZP8A 3CDEA 2IJFA 5KFSA 3DLEA 3MEEA 4RW6B 3LAMA 3Q8RB 2AGQA 3T5HA 4J9PA 4NLVA 3DLEB 3MEEB 3T5JA 1IM4A 3RBEA 1HPZA 3I5CA 3CJ5A 4ECVA 2UVUA 1S9EA 4O44B 4U6PA 1RT3A 1S48A 4QWEA 1TQLA 3N6MA 1S1UA 3HVWA 5KT3A 4RUCA 3Q8SB 1HPZB 3BSNA 4ECYA 4IDKA 2WCXA 4WXOA 1S9EB 3RAXA 4K4VA 3LALA 1RT3B 3LAKA 1LWFA 3KMQA 1S1UB 3PJWA 1FKOA 2FJXA 4IDKB 4JV0A 3PHEA 2UVVA 5KT2A 3IS9A 1LWFB 4DG1A 1FKOB 4K4TA 3IS9B 2ZKUA 1TV6A 2HNDA 2HNZA 4DG1B 1D0EA 3BREA 2J6TA 5D3GB 3BR9A 2HAIA 4I2PA 3H5UA 1TV6B 2HNDB 2IC3A 2HNZB 2WB4A 4QWAA 3Q8QB 4J9RA 5C24A 5KG3A 3GV8B 4H54A 4I2PB 1JLAA 4RW4B 1RT6A 4LSLA 5DGBA 2IA6A 2D7SA 2IC3B 4Q43A 2O5DA 5C24B 5CYMA 4ECWA 1JLAB 2VG5A 1RT6B 4LSLB 3RB3A 4LSNA 4IR9A 3I0RA 3JSMA 5CYMB 4NLGA 2XCPA 2VG5B 2FVPA 3MEDA 1JLCA 4LSNB 2IJNA 4ZPDA 4QWCA 3I0RB 3KLFA 3JSMB 1NHVA 4EEYA 3QIPA 4H4OA 4ECRA 4NLSA 1JLCB 3NAIA 3TVKA 2GIQA 4O4RA 2OPSA 2FLLA 3UQSA 3SFUA 3KLFB 4IRDA 1QE1A 3QIPB 4H4OB 2OPSB 3DLGA 2D41A 3IN5A 4J9SA 1FK9A 1QE1B 1TL1A 4KV8A 2D3ZA 5J2MA 3QGHA 2C2DA 4GC6A 2J6UA 2ZD1A 4NZ0A 4IG3A 3DLGB 4KE5A 3OL7A 1FK9B 1TL1B 4KV8B 2ILZA 5J2MB 4RNHA 2HWHA 1TKTA 2ZD1B 3PW0A 4IG3B 1RT5A 3MTKA 2UVWA 3I5BA 4K4SA 1LWEA 5DQHA 3RB0A 1TKTB 2W9BA 4YR3A 1RT5B 4WFZA 1LWEB 2FJWA 2OPRB 5J2QA 5DGAA 4IOBA 3ICLA 4NRTA 4ED2A 4G3IA 3NKYA 3OLBA 3GILA 2W9BB 3BQ2A 3PR5B 3BSOA 3FQKA 4X2BA 4XPEA 4G1QA 5J2QB 4NYZA 2R2TA 1XR5A 1BQMB 3T1AA 3DM2A 1S9FA 3QZ8A 5DG9A 4Y3CA 4IH5A 3PW7A 1JXLA 1KLMA 4G1QB 4MFBA 4RNFA 4M94A 3VQSA 1TL3A 5KFJA 2C28A 3DM2B 3KJVA 4MIAA 5F8GA 3M9MB 4IRKA 1MU2A 1RYSA 1KLMB 5HROA 4MFBB 5KFFA 4EBEA 1TL3B 1TVRA 3KLHA 5KFLA 3KJVB 3PW2A 1FKPA 2FVQA 3KHGA 3PW4A 1MU2B 3DLKA 3DRSA 4J9NA 5HROB 5JXSA 2AU0A 4TY9A 1TVRB 1XR7A 4F4XA 3DLKB 3DRSB 3UDLA 3ISNC 5EDWA 4H4MA 4TQRA 2FLNA 5HP1A 5I3UA 4MIBA 2YNHA 5I42A 2AQ4A 2R8GA 3QGGA 4H4MB 3KHHA 4DL4A 5HP1B 5I3UB 3EPIA 3SI8A 5KFVA 5EUHA 2BRKA 2YNHB 5I42B 4FBTA 1HMVA 1S1XB 5DQGA 4IKAA 5J2NA 1HNVA 2AX0A 3UR0A 1UWBA 2WONB 1HMVB 2ASDA 2W7PA 3JYTA 5J2NB 4TYAA 1JLGA 1HNVB 1SUQA 4ED7A 1UWBB 2R8KA 3TQ1A 2UUTA 4OL8A 5K14A 4YMEA 1TKZA 4DL6A 2XC9A 3JYTB 4RW6A 4ZVHA 4YP3A 1JLGB 1SUQB 4QPXA 5DG8A 3LP2A 5K14B 1TKZB 3DDKA 1VRUA 3BSCA 4ZMMA 1LW2A 4U7CA 4F4ZA 2FLPA 2YKMA 2VG7A 3PJXA 5EWGA 4DEZA 3V6KA 1HNIB 2V0NA 4O44A 3LP2B 4URGA 5KT6A 1TKXA 1VRUB 5L1IA 1LW2B 2WTFA 1RDRA 2YKMB 2VG7B 3E51A 4O3QA 4ECSA 1TKXB 4NLXA 5KG5A 1S9GA 1JLQA 5KFNA 4QW9A 3QGIA 4K4WA 3CDWA 2F8EX 1GX6A 1S9GB 2IAJA 3LP0B 4J9QA 1JLQB 1RTHA 1S6QA 3RBDA 2RDIA 3HVTA 2IAJB 3TAMB 1RTHB 5D3GA 5F9NA 5KFDA 1S6QB 3CWJA 1DTTA 2IMWP 2RKIA 3FQLA 5KG2A 4QWDA 3KK3A 4O3PA 3HVTB 3V6HA 3QZ7A 1JLEA 2EC0A 4RW4A 3RB6A 1RT7A 1DTTB 2I5JA 2RKIB 2FJVA 1R0AA 4NLUA 3KK3B 4EO8A 3Q8PB 4TY8A 2C22A 1JLEB 1S0OA 1LWCA 1KHVA 5KFWA 1RT7B 4YR2A 2I5JB 2XI2A 3OSNA 1K1SA 1R0AB 2R8IA 2BR0A 4NLPA 4ECTA 5DG7A 4TY8B 4RNOA 1LWCB 3CO9A 4ZPBA 4ECQA 4PUOA 1IKYB 2IM3A 3G6VA 1N56A 2UUWA 3NL0A 3NMAA 4ZVFA 1T05B 1IKVA 1XR6A 3OL8A 2W7OA 4GC7A 2XGQA 4PUOB 5KFCA 4MKBA 5HLFA 4WZQA 4IH6A 1IKVB 4NLRA 3MECA 3KK1A 3M9OB 4NLWA 4Y2CA 5HLFB 3KK2A 4MKAA 2ASJA 3MECB 4KSEB 3KK1B 2BANA 5JUMA 1HQEA 3T19A 1S0NA 3KK2B 3EZUA 3M8PA 4R8UA 1SV5A 4MK7A 5KFQA 3MR6A 2BANB 4ED0A 1HQEB 3KLGA 4RW8A 4HYKA 3H59A 3M8PB 3IGVA 4R8UB 3V81A 1SV5B 3DI6A 4RNNA 3GQCA 2ATLA 4K4ZA 3KLGB 5KFGA 5DLFA 4PQUA 4B3OA 4RW8B 2OPRA 5KFHA 3V81B 3D5MA 3DI6B 3FDSA 4DL7A 3KNAA 4Q44A 2JEGA 3KMSA 4PQUB 1N4LA 4B3OB 4RNMA 5KFTA 2WHOA 4F50A 2E9TA 4ZHRA 1GX5A 1S1TA 3PVXA 1BQMA 4Y2AA 3FFIB 4EYHB 4KKOB 4IH7A 1S0MA 2C2RA 1N5YA 2B5JA 2JC0A 4ZHRB 1SH3A 4ED3A 1S1TB 1CSJA 3OL9A 2R8HA 1KHWA 2WRMA 5KG4A 4K50A 4J9KA 2V4QA 5J1EA 1N5YB 2B5JB 4ECZA 4WFYA 4J9OA 2UVRA 1ZETA 1TP7A 1DLOA 3H98A 4ZPCA 3H40A 3BQ0A 3DRPA 2RF2A 5J1EB 5KG1A 4KBIA 4ZP7A 4TN2A 5C25A 3M9NB 1DLOB 3CJ4A 4F4YA 3OLAA 4FBUA 3DRPB 2RF2B 1S4FA 4NCGA 1S49A 5C25B 3KHLA 3OHAA 2IBKA 4IG0A 2R2UA 1JKHA 2VG6A 4NCGB 1N6QA 4WFXA 3NGDA 5L1JA 2HNYA 2OPPA 3NAHA 2DPIA 4IG0B 5F8LA 3HHKA 4TXSA 5CYQA 1IKXB 1JKHB 2VG6B 1N6QB 1U09A 3H4BA 4WZMA 5C42A 1RTIB 3QLHA 3KLVA 2HNYB 5DQIA 2OPPB 4WE1A 4HKQA 5KFXA 5CYQB 1S1XA 4ZVEA 4NLOA 5C42B 3QLHB 4WXWA 3IGNA 1MMLA 4FS1A 3M8QA 2WONA 4WE1B 5KG0A 1S97A 4KO0A 3GIIA 4Q0BA 4NLTA 3M8QB 5F9LA 5KFEA 4KO0B 3GYNA 1RT2A 3HVAA 4EBCA 2AGOA 4O3RA 1C0TA 4Q0BB 2B43A 3N6NA 4RW7B 4YR0A 2OPQA 2YKNA 2WOMA 5EWFA 1RT2B 4RUAA 3FRZA 3H4DA 3DOKA 5T14A 1C0TB 4IR1A 1RYRA 1HNIA 2OPQB 2YKNB 2WOMB 4EYIB 2AX1A 2R2RA 3QO9A 3DOKB 2YNGA 2B6AA 3GIKA 3G86A 4ECXA 3V4IA 3QO9B 2YNGB 2B6AB 1J5OA 2RDJA 3T5KA 1S1VA 2W9AA 3IG1A 5HBMA 5KFAA 3V4IB 4KB7A 1EETA 1NHUA 4ZP9A 5DLGA 1J5OB 5KG6A 2HMIA 1SH0A 2JEFA 3LP0A 1S1VB 3IG1B 5HBMB 4TQSA 1T94A 1RA7A 4O3OA 4Q8FA 2ZE2A 1EETB 2HMIB 3QYYA 3PZPA 3TAMA 2W8KA 5KFYA 1JLFA 2ZE2B 1RAJA 4IQXA 5KFBA 3MR5A 2AWZA 1JLFB 3V6JA 1C1CA 4KHRA 1VRTA 3HKWA 3SFGA 1JX4A 1K1QA 2E9RX 3H5SA 1C1CB 1ZTWA 1VRTB 3PW5A 3DRRA 4K4XA 1C1BA 4K4UA 4Q8EA 4K4YA 3C6UA 1JLBA 1IKYA 1RTDA 1T03A 3CJ3A 3DRRB 3D28A 4R0EA 1IKWA 1C1BB 1T05A 2JEJA 3DOLA 3C6UB 3BQ1A 1JLBB 4DL3A 1RTDB 3CDUA 1T03B 3PR4A 5KFKA 5KFUA 1I6JA 4I2QA 2R8JA 1IKWB 1EP4A 3NBPA 1HARA 3DOLB 1D1UA 4PWDA 2IM0A 2JC1A 4I2QB 5KFRA 3DYAA 1EP4B 3DMJA 3NBPB 3EPGA 4YQWA 4ZP6A 4ED6A 5KFPA 4ED8A 4PWDB 2VA2A 3IRXA 3I0SA 4EO6A 3T5LA 2J6SA 3DYAB 3DMJB 5F8MA 4IRCA 1JIHA 5C5JA 4MK8A 2FVSA 3OL6A 3IRXB 4NLDA 3CIZA 4KHMA 3I0SB 5KFOA 4RZRA 4IFYA 4MH8A 3FSIA 4O3NA 3OHBA 3N6LA 4F4WA 5L1LA 1C0UA 1RT4A 4IFYB 3MFIA 2QE5A 5KFIA 1C0UB 1HYSA 2GIRA 2XCAA 1RT4B 5F8JA 2BQ3A 4JV2A 3C6TA 2CJQA 3MR2A 3G6XA 3KOAA 2V4RA 3FFIA 3MEDB 1HYSB 4NRUA 4KKOA 5KT5A 5FDLA 3C6TB 2QV6A 2YNIA 3GV7B 2FVCA 5FDLB 5L9XA 2OH2A 2E9ZA 1BQNA 4ICLA 4J9MA 2YNIB 4LQ3A 2IM1A 4WYLA 1WNEA 2R2SA 4J9LA 2BQRA 3V6DA 1SH2A 1BQNB 4ICLB 1RT1A 5KFZA 2JLEA 4R5PA 3I5AA 3MFHA 3LANA 4XPCA 3V6DB 1DTQA 4TLRA 2W8LA 4Q45A 1RT1B 2XI3A 4R5PB 5F8IA 1W25A 4JUZA 4RW9A 1DTQB 3RAQA 4MK9A 4KFBA 3CJ0A 1S6PA 4ZPAA 4Y34A 1IKXA 4RW9B 3CVKA 4O3SA 1RTIA 1REVA 4KFBB 1C2PA 5F8HA 3RB4A 1S6PB 3ITHA 2AGPA 2GC8A 3MR3A 4DL2A 1REVB 2YNFA 1N48A 3GIJA 3ITHB 1NNDA 4LQ9A 2ILYA 3MEGA 3LP1A 3H2LA 2I1RA 1S1WA 4XO0A 2YNFB 5L1KA 2XWYA 1YVFA 2JEIA 3MEGB 1LW0A 3LP1B 3KLEA 1S1WB 4ID5A 4URQU 4RW7A 1OS5A 3KLHB 4IFVA 2CKWA 1FKPB 3E01A 1LW0B 1RA6A 1T3NA 3KLEB 4KAIA 4ID5B 1QAIA 4ECUA 3H5XA 2D3UA 4ED1A 4DL5A 4IFVB 3KHRA 3E01B 4NLQA 4ZVGA 3UPFA 4JV1A 4I7FA 1ZTTA 5KFMA 3BJYA 3KLIA 1HQUA 2FVRA 3MF5A 1QUVA 4FS2A 2BQUA 2C2EA 4I7FB 5KT7A 3ISND 2VA3A 4EBDA 2V9WA 4WYWA 5EWEA 3KLIB 1HQUB 4NLYA
chains in the Genus database with same CATH superfamily
5B09A 1DJ0A 4C8ZA 2PD1A 3CC4S 4MJKA 1FRLA 5EX3A 3W2WA 4OX8A 3UD3P 3PEJA 1WC0A 2A2DA 3TA0A 2CJYB 1RWPB 3T5JA 1BE4A 2MDAA 3OXGA 1HFEL 1X4CA 3G82B 4ECYA 5A8KA 1NDLA 2RE1A 3LALA 1LWFA 4JV0A 4ZN3A 1CC8A 3LGMA 3R5CA 3K7RA 4LF4F 5IXUA 4NYOA 4DOZA 3H5UA 1TTHB 2NPFA 4AD6A 4LSLA 5DGBA 4Q43A 4ECWA 1JLAB 1SQEA 3B82A 4CLYA 2FVPA 2J9DA 1JLCA 1IVZA 4DR7J 3A12A 1FXLA 4H4OA 2GIQA 3PX0A 5ETQA 2NS1B 4LFCF 2HFVA 1FRMA 2OPSB 1Q5YA 2QO3A 1AW0A 5DDRC 1DARA 3I4HX 3OL7A 1FK9B 2HWHA 2VF3A 2OMOA 3NP5A 1LFWA 5KOXA 4X2BA 1SXLA 4JI3J 2ZOMA 1RWMB 2PO4A 3MAQA 4C8NA 3M9MB 4Q2LA 1X4BA 2XQCA 1TVRA 5KFLA 1FKPA 1S7HA 3HP6A 3DDIA 3MMCB 4NX9A 3NCRA 5ETKA 3UDLA 4DF4A 5I3UA 1X5OA 1F2HA 3L4BC 5KFVA 2H5EA 2BRKA 3ZTSA 3WIUA 2W7PA 4OZJA 2ZNZA 4HL9A 1U1MA 5K14A 3AODA 3BF4A 3OTOJ 1LW2A 4YUDA 2CPZA 2V0NA 1X4AA 4ERDA 2VG7B 1WHXA 1QDUB 2CQ0A 5L9NA 4WP3A 3NWRA 3TUPA 4OFZA 3CWJA 2RKIA 3FQLA 4F0HA 4EO8A 5CZXA 2I0XA 3CUNA 2LQBA 4NLPA 5I4MA 1Q78A 2MKJA 3BO2A 5LMNJ 4X4VA 4CLTA 3P45B 2WB1D 3MMJA 1T9VA 3HHLD 4B9UA 3R2CJ 1G1XA 3PXGa 1JJCB 3NGTA 3AD7C 2QRRA 5LXRA 2QLJB 3V81B 1AFJA 2JEGA 4YHHJ 4FNHA 2OD4A 3OL9A 4K50A 1QY7A 4ECZA 4U8YA 4IQMA 4FXWA 1UEUA 4PWUA 3BKFA 2JFDA 3DGPB 4IG0B 1IKXB 3VALA 3CXCR 3QLHA 1CJVA 5LMUF 1H0HB 1F3VA 3M6XA 3VR1A 3I4PA 2CQPA 3GYNA 3P8BB 3K89A 3AB2B 1Q79A 4G1PA 4FDFA 4U8VA 2IHR1 1N5QA 1U0SA 4CCHA 1VQ8S 2B6AB 1B0PA 1GTHA 2WW8A 1G2EA 4KB7A 5DLGA 1UA0A 4O3OA 4AQYF 3PZPA 2W8KA 1RAJA 4IQXA 5KFBA 3G8TA 2XMWA 2DNLA 2CQDA 3AA9A 2RDDA 2V67A 3TARA 2R7TA 3O8WA 2CQ2A 3K5PA 2P9CA 2AJ4A 1UCNA 4R0EA 1I6JA 1XMOF 2XMMA 4PWDA 3T6BA 2O3DA 4WU2A 4ZP6A 3I87A 2VA2A 3IRWP 5DDPC 5EX0A 2FVSA 4L3NA 3FSIA 4IUFA 2Q3PA 4F4WA 4KH0B 4HH0A 4UUWA 4DPWA 2VQEJ 3FKBA 1VHIA 1U47A 4C8OA 3ZTOA 2V4RA 2FVCA 3ZZRA 2KI2A 1PYSB 4M5LA 2KG1A 4R5PB 3H90A 1N0UA 2C2ZB 3UNGC 2HQDA 1VIXA 4KFBB 1CC7A 3CULA 3IBFB 3QPIA 4HTJA 4ID5A 3E01A 2R7VA 3WQPA 4FP9A 3X1LB 2XHCA 2C2EA 4I7FB 2VDIA 4DU7A 4IOCQ 4TYBA 1P1LA 5D6GA 1OIAA 2DGQA 3QIDA 5HQMA 3GIMA 4FYYB 5F8NA 2BE2B 4EMDA 1M5SA 3G6YA 3CJQA 4F26A 3BO3A 3AY0A 2IYIA 4X84A 1U2RA 4L74A 3ETMA 1CJUB 4WFBQ 1RJJA 4QWEA 4RUCA 2G2OA 1RT3B 3QJLA 1FKOA 5KT2A 5AXKA 1S57A 5LSOA 3PYGA 2HNZA 3VZHA 4JI7F 3OR1A 1U1PA 4AYBD 3W62A 3IM8A 1LK5A 3HZGA 5LSLA 4NLGA 1NUEA 3GJRB 1UJ6A 4JI2J 1RBAA 3SFUA 2IVMA 1SC1B 2XB2D 1Z2ZA 2MQNA 3T1HJ 2ZD1B 2WZ1A 2W2QP 4A8KA 1WI8A 4YR3A 2FJWA 2OPRB 4G3IA 3DGVA 3HJVA 1NM2A 4TNOA 1U6FA 2VICA 4XPEA 4FVCA 4P2MA 3MXHP 1X8DA 4RNFA 2AEFA 1TL3B 1WC6A 2VFUA 5AJ3F 3TAQA 3BKTA 2A10A 1ZAVA 3BV8A 1FCAA 4JV5F 1FFWB 2MKSA 4F7VA 3QT7A 1LQ9A 2NLWA 1T11A 2KT3A 3L9ZA 4NZ7A 4S0MA 1TK8A 1XNRJ 4QZVB 4USVA 4K4UA 1Y5NB 2GCFA 1HNIB 3MMBB 1P27B 3NS5A 1UEKA 1FJGJ 3CDWA 1Q86T 2HVZA 2BOPA 2ALYB 4PXEA 3RU0A 1TAUA 3OBIA 3MUMP 1GXLA 3V6HA 1DTTB 1V3RA 1JLEB 4OI2A 1KVIA 2CNOB 1YHQS 1LWCB 1OMSA 3NL0A 1N56A 1XR6A 1T02A 4OZ2A 1U0HB 2MZTA 3MECB 4KSEB 1HQEA 5IM0B 4R8UA 1HBOA 4JI1F 4R25A 3WX4A 3PHTA 2LQ9A 1N32J 4RW8B 3KMSA 5T7LA 2FTRA 4ZHRA 1R8BA 2RNEA 1ZM9A 1N5YA 4OI1A 2JC0A 1S1TB 1CSJA 3TA2A 3TNVA 5KG4A 5JVHQ 3H40A 3S7RA 4JI4F 3BQ0A 3IXQA 4USWA 1D9DA 2GS8A 2AJ1A 1KDNA 1S49A 3I9V9 2IBKA 3PY8A 4Y00A 3TW0A 4P75A 1OSDA 3T3FA 3PEHA 5IWAF 4KO0A 4HI2A 3QAEA 2UV8A 4BS2A 4OYXA 2VU5A 5KFEA 1U25A 2P2CB 3N6NA 4DS4A 3RJMB 2WOMB 2DO0A 1ZM2A 2W9AA 1NZAA 4ZDNA 1J5OB 4RUHA 1U26A 2ZUAA 3FBBA 3QRQA 4LF9F 3CCUS 1JLFB 3E8OA 1S6UA 3HKWA 4R0JA 1TL5A 4MYUA 1AUDA 3MHYA 1RTDA 1CS4B 1IKWA 2UXCJ 1JLBB 1QAYA 3CDUA 4DL3A 1B64A 1RXOB 4LBHA 3MOJB 4XDCA 1VQ7S 1F5AA 2E1PA 2J6SA 1VLOA 2M3DA 1S77D 4OYPA 4Q7AA 3UDVA 1NK6A 2DBBA 1S76D 2J8AA 1UVMA 3BB5A 3TX0A 4NRUA 1XK8A 1RKIA 2H9ZA 2VPWB 2L08A 2RB7A 5L9XA 3ENAA 2YNIB 3GB0A 3S01A 4RL1A 1N5SA 2YQ3A 3SQGB 1Q81T 3L3CA 2MLYA 2OGUA 2XI3A 4JUZA 4I6YA 2RQKA 1P1TA 4KHPJ 4PPZA 3K17A 2UV8G 3ITHA 2GC8A 3WDOA 2OELA 4DR7F 2MLZA 4XO0A 1WC3A 3ILIA 3L7PA 1YJWS 1TU0B 2LFVA 4DFPA 3AOBA 2E1RA 1KRPA 1K0TA 2KB2A 3ZNUA 1DBDA 1HQUB 3GSDA 2DRAA 1NSQA 4JI3F 5ETVA 1RTJA 1S10A 1NK0A 4QWBA 4M95A 5IFMA 5J2PA 2YVSA 2BJ3A 5DM6Q 1Q5VA 4QW8A 1CG2A 2IJFA 1NH8A 2FJAB 1TK5A 4ECVA 2KHCA 2NXNA 4YFUA 4NCBA 3WC2A 5B0GA 2ADCA 1KD1T 4O23A 4Z7YA 2G4BA 2CUYA 2WVEA 4DG1A 4OZ5A 3U7JA 2HHHJ 1HBUB 4M8LA 2HURA 2RD5C 4HT5A 1AT1B 1RHUB 2XSJA 2AV5A 3Q8QB 3UN3A 2WSFC 3OTOF 2IA6A 3MDFA 3HHLB 2D69A 2Z30B 5AT1B 2IJNA 4QR2A 3K2YA 3KLFB 5E2QA 2KTQA 2F7VA 1TL1A 5LXYA 3QGHA 4ES1A 3CDAA 4IG3A 2MQPA 3UCGA 2D9PA 2UVWA 1S72S 5K20B 4D3GA 4QYRA 5LMNF 2QSFA 2V6AA 5LL6d 4MFBA 3M2VA 1VQ5S 5IS2A 2QL9B 3PW4A 4V19J 5HI7A 2DR8A 2BM0A 2XULA 5EDWA 1FEHA 4CNYA 2D3O1 4NEZA 2YNHA 3KHHA 3F41A 4YHHF 1S1XB 2AW0A 2GJ2A 3ET6A 1KP6A 2R8KA 1A9NB 1F6TA 3LW5C 2UXDJ 3HX9A 3CC7S 1U1OA 1B0TA 2MHNA 3M2RA 2FLOA 2ZKTA 1S9GA 3LPEA 3LWMA 2LU1A 1JLQB 3GJSB 1S6QA 1NCLA 5F9NA 1ICEB 3NOCA 1S59A 3ZZ0A 2W7AA 3QZ7A 2R7RA 1YBTA 3BYRA 3M7VA 1FD2A 2SXLA 3FVYA 2BR0A 4TY8B 3TUZC 4RNOA 4DJBA 3THPA 2HWTA 1MLAA 4IH6A 1IKVB 3ZC4A 4CP5A 1GXTA 3T19A 3KK2B 3EZUA 1XERA 3MR6A 2BANB 1FVQA 5DLFA 3TEGA 5GADI 2QA2A 2V63A 4QQBA 3PVXA 4KKOB 2B5JA 4ED3A 4K2JA 1WF2A 4KBIA 5L39A 3CCRS 1X9SA 2MGZA 2GX8A 4FBUA 5I3QA 2X1FA 3QT6A 2ZM6J 2R2UA 1X7VA 2VQEF 4DCOB 1N6QB 2DITA 5DQIA 1JXEA 1IQZA 5CYQB 2B9WA 5THWA 4CLUA 4FS1A 3W64A 5KAKA 4YB6A 2OEKA 2LQ8A 3W5ZA 1RT2B 2R2RA 4W4MA 5HSPA 3DDNA 3VGUA 2E7WA 2Y9HA 4FF2A 1SJQA 4A47A 1HBNB 2MYFA 3IG1B 5HBMB 4TQSA 4Q8FA 1R89A 5KFYA 3OUYA 2OJ3A 2YWHA 3IWLA 2H65B 2MLXA 4OV6A 3V6JA 2HEKA 4X4RA 1K1QA 4H4KC 2QZ8A 4DSIA 1KONA 1Y4ZB 3H5SA 4USTA 3N01A 3DRRA 2NPIA 1NSAA 4RO0A 4V1Ak 5GAEI 2ZBCA 3EXYA 5A8KB 3DOLA 3C6UB 2VODA 4H4KA 5KFKA 2R8JA 1HHQA 3BR8A 1IN0A 2W4DA 3TJ9A 3MR7A 3FNNA 4ILRA 3CB4A 1N5VA 3CIZA 4USHA 2B4UA 3GFZA 4Y28C 4A46A 2FC8A 4AT1B 2BQ3A 2FZCB 3C6TA 3RBZA 4PZVA 2JFKA 2ZZMA 4DWIA 1A7GE 5GADU 2ADBA 4J9LA 2VH7A 1RT1A 3N4WA 3I5AA 4P72A 2AMCB 4RJVA 1Y7PA 4TLRA 4J7CA 4Q5VA 5IT4A 2R7UA 4DPXA 3UNYA 1S6PA 1KR4A 4DL2A 4JI2F 3H2LA 4EFAC 2AF6A 4UY8T 4IFVA 1FKPB 3KLEB 3IR7B 4KAIA 2YKAA 4ZIVA 6FD1A 3G87A 3T1HF 3ISND 4WYWA 2Q79A 3FUYA 4N77A 4V19X 2W9CB 1FO1A 3UDEA 1Z4UA 5ETRA 3GFHA 2XGPA 2OSQA 1SBRA 3HMJG 1U1QA 3LAMA 4C3MA 4J9PA 3EE3A 5B0DA 3MM9B 3N6MA 1MSWD 3GG0A 3POTB 2RAQA 5A76A 3Q22A 2K8GA 3BREA 5GAEU 4M1KA 4KH1B 2HNDB 2ZBRA 4X65J 4A8XA 2UUAJ 5A8WB 3T1YJ 3ZZUA 1HNZJ 4DSEA 1XN9A 4LF8J 4DUTA 2PEBA 3C15A 1FJGF 1SJ4P 2NQPA 1NJYA 1NH7A 2RRBA 3IBCB 2FPHX 1RU2A 4GC6A 2R7SA 2PT0A 3DLGB 4KE5A 5JJBA 2YQ1A 4KTQA 1RT5A 5DQHA 3RB0A 2C42A 2ZC4A 1Q53A 4L76A 3RR7A 5HJXA 2HK3A 1CULB 5J2QB 2YX7A 4WF9Q 3VQSA 1EZZB 4GO7X 2KKHA 5F8GA 4UQGA 1K8AT 2HHPA 4X4PA 3CMAS 1MU2B 2MJUA 4HHHA 3DHWC 2CQ1A 4CLPA 2DGUA 1SKRA 2CJ9A 2B0GA 2ZVIA 2NYHA 1NXIA 4RBVA 1N32F 4A4JA 1VBYA 2RRNA 1WC4A 4ZJQA 3KKFA 2MY7A 4M5NA 2MQLA 1UZHA 5GAHI 1HMVB 5J2NB 2C3MA 1NPRA 3BO4A 3DDKA 4O44A 4URGA 1TKXA 3IM9A 2ZJRQ 4QR0A 5HL7Q 5FJ4A 4JB8B 4B9NA 2DD8S 4AE5A 4O3PA 4RBTA 3C8YA 2DEJA 4DV4J 3Q8PB 1UW4A 4QU7A 2C22A 1S0OA 2YKPA 1R0AB 4ECQA 2VKZG 1MROB 4LRAA 4WZQA 4ZPTR 3KK1A 2XLIA 2Q66A 1IBCB 2KU7A 4PQUA 3M30A 3LQVA 4PAAA 2UXCF 1S0MA 4RUBA 3G2XA 4X66J 3L7UA 2FQQB 1S4FA 2DCLA 1WOOA 1JKHB 3KLVA 2ZWOA 3BBFA 1YBAA 2KFNA 2P6SA 3UI3A 3RYLA 3DXBA 3ENVA 1H7WA 3GIIA 1GMWA 3JTOA 4Q0BB 4F67A 3H2UB 2CQIA 4YR0A 3VGTA 4IO1A 4ZCIA 1VGYA 4M63A 3W5XA 2CFXA 4OZ3A 3HSDA 4EYIB 1DQ8A 5GAHU 1PO6A 2O01C 3CO0P 2YNGB 4HEA9 4PWWA 1EETA 1NHUA 2R42A 1S1VB 3M05A 5H9FJ 3MI7X 2DGXA 3LPYA 4C11A 1C1CA 3OXLA 2DEIA 2EWHA 2BYCA 1EARA 2RIJA 2DHSA 2HIQA 3SDEA 2XTJP 1AFIA 1M5PC 2IM0A 2UXBJ 2VL1A 2QIFA 1U1RA 1LKZA 1CJTB 2C3PA 4OYMA 5C5JA 2I9SA 4O3NA 2DCUB 2H3EB 3BGLA 1O8BA 1BQXA 2XYPB 1UWAA 3MUVP 2FHJA 5DDOC 2V4JA 2GQCA 2CQ3A 1KKHA 2XWXA 4UY85 3MM5B 2VQFJ 2G1DA 2V8PA 4WFNQ 3RW6A 4C9DA 5GVQA 2JVRA 4F3QA 3U27A 4DI6A 3PKMA 2LXFA 2VFRA 3THVA 5I3PA 4O3SA 1FDDA 2KFZA 1VK3A 2OO4A 4MAKA 2XG8A 4ED4A 4DV5J 5A6PA 3HKZD 2H4WB 4C98A 2HRTA 3KYLA 3HD2A 5E3CA 2M8DB 2ZH7A 4O4GB 2DGSA 2FDNA 4URSA 5KT4A 3MM6B 3F73A 3FJ2A 3L7OA 1L3TA 4A8MP 3HLUA 4NLVA 4NXMJ 2W2MP 1W2IA 4DR6J 4LMZA 2J7WA 4Y65A 4K4VA 2XS5A 5E5NA 1WTFA 3CD6S 1WUUA 4A48A 3OR2B 4HDHA 2BKOA 4KT0C 5DM7Q 1TV6B 1M5VC 1NK7A 1SPBP 1TMMA 1JLAA 4LIRA 2UXDF 4CDIA 4DV1J 3O2IA 4NPOA 3U02A 4QWCA 2Z2MA 3HK2A 4CH0S 2OPSA 3QFWA 3D0HE 3IR5B 3MCSA 5HMYA 1X9WA 4PG4A 2UVUA 1FK9A 4NZ0A 3FSYA 4LRBA 1BY9A 4ENOA 4ZCMA 2KN4A 3ENWA 3OT9A 1VQPS 3FEXB 2M9KA 1SC3B 4N7TA 2U2FA 2HZVA 3MCMA 1VQOS 2FJBB 1RYSA 4EBEA 3H8YA 2J0XA 3MMCA 4F0MA 4J9NA 2CPXA 1GMVA 1LFPA 1ZS6A 2WBMA 3LGHA 4DL4A 2CQHA 1BGXT 3EDRB 3M32B 4F36A 3OTDA 2ASDA 3ZZTA 4ED7A 2XC9A 4RW6A 1HW9A 5K8PA 4M5KA 1TKZB 3BSCA 3C2PA 1R7IA 2VG7A 5EWGA 2ZM6F 4X4TA 3Q8UA 4DR3J 1W26A 2CZ9A 1RADB 4HLBA 4DSJA 5KFDA 3MWBA 5G4DA 2VBXA 1GT8A 2FJVA 3VWSA 2HBYB 4OLPA 3QAUA 2X3GA 1GXUA 2OP5A 1NZ8A 2DJWA 4ZN1A 1SQGA 4Z7CA 1TMJA 2W4CA 1S7IA 3GJQB 3A3PB 1LNQA 1UVKA 3NGRA 5HLFB 1LK7A 1YBUA 2EK6A 4P7VA 4LR8A 4FPIA 2MQQA 3M8PB 4CI0B 3V81A 4JI8F 2MZRA 1T8EA 4DL7A 4RNMA 3NEKA 1BQMA 4LRCA 3W9HA 4KGVB 4JOUA 3H98A 1RABB 4DX7A 2F65A 2MQ8A 5CCLA 1PCAA 3DGPA 1X9MA 4IG0A 4M5MA 5L1JA 3TRGA 1RCXB 4TXSA 2VG6B 2KZMA 4CRJA 2HHVA 2OPPB 4NLOA 3ZO7A 4LSZB 1M1GA 4HI1A 4C8LA 3DLLQ 2YKNB 2B6AA 1Y9OA 1HWKA 4ECXA 1RSCA 4RWWA 2FUG9 1RWKB 1CJKB 2KT2A 5GMEA 1NMEB 5CXTA 1JX4A 1FRXA 1EKRA 2KL8A 1T05A 4I4BA 4NI2B 3HXMA 3UN2A 4G6VB 3AQPA 2B8PA 1HL6A 4WP8A 4KIAA 3DYAB 3DMJB 3QT8A 3IRXB 3I0SB 1B7FA 4LR7A 3H7HB 2XMTA 1C0UB 4PCQA 3UO0A 4DQIA 2CJQA 4WP9A 1Q4RA 2DNYA 1C4AA 4PQAA 1MN9A 2WVDA 2YKOA 1XJWB 3LUYA 1WELA 2NXCA 1KEKA 4DV7J 4R5PA 1CVJA 3FGVA 3HZEA 2W8LA 1W7WA 4X65F 2UUAF 3Q0AA 4MK9A 4KFBA 3CJ0A 3T1YF 1HNZF 2VUGA 2F5GA 4LF8F 2ZJQQ 4LF2A 3GONA 2EXUA 3FMBA 1WKJA 3FEZA 1T9YA 2JEIA 1RI7A 3A8JA 1SB6A 3A8EA 3KHRA 4I7FA 2VPYB 2E5HA 3IAM9 4HH1A 2BE2A 4F3OA 1YZ6A 4F4KA 3ZTQA 5GAGI 1SC4B 1QTMA 1CJUA 4BCAA 1U48A 2L9NA 4LFAJ 4X4UA 1RT3A 1TQLA 3HVWA 3OSPA 3EM1A 2MSSA 2Z56B 2M7SA 2DB1A 3PHEA 5IQQA 2FC9A 3DRYA 3IS9B 4NCAA 2HAIA 5CA5A 2XO7A 4DFMA 3QJPA 2D7SA 3OW2R 1R0BG 3KG4A 3R2DJ 1ZOTA 2A3JA 3TWZA 1NHVA 3NAIA 2OUGA 3UQSA 1XBWA 1HHSA 3QIPB 3HPOA 5L8RC 1TL7B 2ZD1A 1TELA 5D4PA 2QA1A 5J2MB 2DTJA 3MAHA 4DV4F 3OV7A 2F9JA 5ITHA 3M8SA 2DY1A 4IOBA 3T9ZA 3BSOA 1WG5A 3FQKA 4DN9A 3PX4A 2APOA 5DG9A 3PW7A 4CLZA 1VQNS 1TL3A 2RT3A 1IR0A 3KLHA 3GG1A 5JVGQ 2YH1A 4C0BA 4KRWA 3UR0A 2N7YA 3RRGA 3UFCX 2ZH3A 1WKKA 1VOMA 2C1EB 1HWUA 3R5JB 1WSVA 3HO1A 4CM2A 3MMBA 4DMZA 1BD6A 1D9FA 1Y3JA 2MXYA 5GAGU 4ECSA 1T95A 4WJBA 5FIIA 1HBMB 3QGIA 2ASYA 2JOQA 3OTEA 5HVHA 3Q24A 1DTTA 5KG2A 1JLEA 2EC0A 2XMJA 4Q2MA 2ZDOA 4B9VA 2V34A 3E2EA 1LWCA 4YR2A 2Y8YA 4J5OA 2QLBB 2XGQA 2ZHBA 2XBPA 4W98A 3MECA 2BV3A 3CIMA 2QYCA 4NYPA 5IM0A 5H9EJ 4U9RA 1QM9A 3NWGA 1NO8A 1X4EA 1CLFA 4RW8A 1I1GA 4RNNA 4GRSA 4DQRA 4WWSA 3D5MA 2HFUA 2MZ1A 1S1TA 4K0KF 2YWFA 4P6QA 2V4QA 4CLSA 2UXBF 4P71A 2ZOGA 3R5DA 2WVBA 1HLWA 2E44A 2J9EA 2OSRA 1HNXJ 1M1HA 3JAMU 4DDFA 4ES2A 4Y0FA 3TEHB 3TR5A 2ZH8A 2EG2A 2BACA 4UOCA 2VQFF 2WOMA 5EWFA 5T14A 3NCQA 2VC0A 4X62J 1RWNB 3QO9B 1J5OA 1LXJA 5A2QU 1VMBA 4WIQA 3C16B 2JEFA 4CO1A 3IWNC 1JLFA 2C2NA 1B70B 2FGOA 2QTWA 4DV5F 3MMAB 4IO9Q 3SFGA 2HK2A 5HK4A 2XZTB 4OMFG 1CS4A 4UQTA 1JLBA 5ETPA 3WHIA 1HARA 4UUXA 2NZ4A 1VQLS 2ROGA 3T5LA 5F8MA 4MK8A 5F0WA 4KHMA 2CJBA 1VBKA 3JXOA 2QE5A 1ZZFA 4NXMF 2HZAA 2CQGA 1GNKA 4DR6F 4CLKA 2V9KA 2QT7A 1X4HA 3C15B 2YNIA 3SQGA 3TO8A 2R2SA 4LVOP 2BQRA 4XTTA 1BQNB 2CG8A 4NWBA 5IQ6A 1PKUA 3M8YA 4OHYA 4DV1F 7FDRA 2N7CA 3HFZB 4QIGA 2KHDA 2RMLA 4LF6F 2Y1LB 5CCMA 1REVB 4X4OA 1OPZA 4YB5A 2JJ4D 3MEGB 2BKPA 3W63A 1RHJB 2PFFB 3TZXA 2BKNA 4NLQA 2GZOA 1D8ZA 1NLKL 1TUVA 1HQUA 2Y8WA 2OKQA 5A6WA 2NXJA 4BWMA 3M8ZA 1JMTA 3JTPA 3HT0A 1VQ4S 3BGRB 4ZVUB 1GAOA 3MD1A 3RW7A 4UTGA 1L5UA 2G2ZA 2YTCA 2HFSA 5AE2A 2XYHB 4AXIA 1JWWA 2JWNA 2G13A 3I32A 2IJRA 4O44B 4U7UD 2DISA 1S9EB 2K2PA 1I94J 4OV1A 1HBUA 5AXLA 1D0EA 1R6YA 2F8MA 2W2NP 2GNKA 4H54A 1A0OB 3HHLA 3W9IA 3FBCA 4TU9A 2AD9A 2HS0A 3KLFA 4NLSA 4DR3F 3BBBA 1FKAF 1REGX 3KNGA 4UZBA 2D41A 4DR2J 2C2DA 2B8QA 2J8SA 3G9CA 3VGSA 1PJ5A 2VBZA 2CPEA 1ZM4A 1HWJA 5AXNA 5E33A 3UN5A 3BQ2A 1T9TA 4OLOA 2GGPA 3QZ8A 1U24A 4CWBA 4IH5A 4FNIA 4AL7A 2G0CA 1KLMB 3MUTP 1U6ZA 2NUUG 3DLKB 4QCLA 2XNRA 2COLA 3ZXWA 5EUHA 1IQTA 3R9LA 4IKAA 1JNZB 5ETMA 3LTOA 5F3ZA 2OI2A 8AT1B 4YMEA 4ZKAA 2OEMA 3ETOA 3KG1A 3TUIC 2J9DE 5KT6A 4O3QA 3E51A 1A6LA 4FVMA 3ZFVA 4NLXA 1FFGB 2XMAA 2AZ1A 2B4OA 1JLQA 3D2WA 4K4WA 1VFJA 3PO5A 1GX6A 2IAJB 1DRZA 3RZAA 2YH0A 1Q16B 1E6VB 3RB6A 1FJCA 2VD3A 4TY8A 3OFGA 3HHNB 4TU7A 1PBUA 5DG7A 4P2FA 4N41A 2MY8A 2VDHA 2DHAA 1RACB 1IKVA 4PUOB 2W25A 3SEOA 1SIWB 2KM8C 3KK2A 4J37A 1UL3A 5EHHA 2K3IA 3FSXA 2BANA 4TLQA 1JJ2R 3BH6B 5KFQA 4J90A 4EK2A 1NJIT 1R8CA 2VONA 3OFFA 1FTRA 4U7UK 1GX5A 4Y2AA 6FDRA 2GMHA 2R8HA 4EUVA 1KHWA 5J1EB 5KG1A 1NB2A 4LF5J 3IWXA 4N76A 1N6QA 4X4SA 3OPKA 3Q89A 1HI8A 5CYQA 3D6TB 1FRHA 2M88A 1PYTA 2WONA 1KNZA 1RUSA 1OO0B 1RT2A 2EFQA 2DNMA 3CCTA 2B43A 1KQSR 4DV7F 3FRZA 4IR1A 5D4LA 3TZWA 2KT5A 1UPMB 1HBNA 1J27A 3UWTA 2JVOA 3IG1A 5HBMA 2BABA 3LP0A 3G8QA 3N5BA 3C14B 1SKUB 4EI2A 1YJRA 2NR0A 3TZYA 4OX7A 1RTZA 2HPUA 1E6YB 3UDCA 3BPSP 1X5TA 4DSLA 2CADA 3BGUA 5CYJA 4K4XA 4E2FB 1KFDA 2JNJA 3C6UA 1YRTA 3J80Y 4A8OA 4WK1A 1S6OA 5KOWA 1G7CB 2ZHAA 2MQOA 2E1MC 1D1UA 1FE0A 3NNAA 5KFPA 7FD1A 1T0TV 3H42A 1H74A 1YDLA 1RAHB 4YN3B 2GFFA 2V69A 4ZJLA 3W8GA 2CPHA 4YB1P 1VRQC 1IBKJ 1RAGB 4LFAF 4F2SA 3V4MA 2GIRA 2HLUA 3WC0A 4JBCA 4EU0A 5HANA 5FDLB 4KJIA 1WEYA 1P9YA 1R8PA 2EFOA 1WD6A 4ICLB 2BZ2A 3LANA 1WJ9A 3O44A 5F8IA 3EVWA 4RW9B 1RTIA 2DGVA 3TAPA 3K5OA 3LP1B 3KLEA 2B7BB 1RA6A 4BC7A 3CD7A 2PDAA 4ETZA 2Y0SD 4X4NA 2JLFA 2CDRB 4ZK7M 2GHWA 4EBDA 1L3SA 2W9CA 2PIIA 3GV5B 2DR9A 4RU9A 2FIUA 1H98A 3VVTA 2VJVA 4PKDB 2BRLA 3KUHA 1Y00A 2G1HA 3CF5Q 4RW6B 3G4SS 2ZH2A 3MM9A 4OIXA 1R0CB 1SJRA 1HPZB 3POTA 3LAKA 4CT9A 2M8HA 2CPDA 5CH7B 2HNDA 1HKAA 2YWEA 1FWKA 3RRKA 4C6AA 5A8WA 4J91A 3HCXA 2DNHA 2LEPA 2J7KA 2NXEA 2YWWA 1RU1A 1SQFA 3NCPA 4DV6J 4ZS6A 3ILJA 5C2GA 2BJ1A 2E5LJ 3R7NB 3GU0A 3DLGA 2KVQE 4KV8B 2ABYA 3P6YC 4RNHA 1ZBTA 2E5GA 3EGWB 2ZUGA 4QPTA 1LWEB 1CULA 5J2QA 1C4CA 2DY9A 4P2SA 3WBZA 2R2TA 1BQMB 2HHSA 2H5IB 2EBGA 4M94A 3QQCD 3DM2B 4DX8H 1MU2A 4L6V3 1R27B 4F4AA 1YJUA 5AE1A 3CCLS 4O0NA 1JJHA 4FYWB 2DR6A 3GP9A 2RQ4A 3DRSB 1RISA 4TQRA 2AQ4A 1H2VZ 1L3VA 3IA0A 1HMVA 2WBRA 2IDLA 4P9SA 4FF1A 5J2NA 4PYDA 4TYAA 2GO9A 4ZVQB 4DPUA 2HSEB 4HHJA 4ZVHA 2E1CA 1JLGB 5DG8A 2FLPA 1NJXA 4CH7A 1PG5B 1VIOA 4LUBA 2V94A 3W2VB 3P5BP 5KFNA 3VCDA 4DHVA 4E8UA 1HI1A 4C0OC 1BXNA 4OYIA 2FGCA 2V8VA 4PPDA 1MWQA 2P6TA 5MLCV 1R0AA 4QYZK 2AHOB 4OYOA 3A13A 4OHXA 4OQJA 3PYEA 1MROA 3H0PA 4KR0B 2GVDB 4X62F 1T05B 1QSYA 1ELOA 1PJ6A 2Y1RI 2AEMA 4NLWA 2KXFA 4RU2A 3OJUA 5K9FA 4M5IA 2GV1A 4RWXA 2DNZA 4UZCA 2FHJD 2FJDB 3GE9A 4ELVA 2ZH6A 4K4ZA 2BW7A 5CZVA 3CMQA 2JLGA 4EYHB 2JSXA 3D6MB 2CQBA 3BGFA 3GCXP 2V2QA 4CLFA 2Z0GA 2DGOA 5LJ3Y 4J9OA 2UVRA 3Q8VA 1XMQF 3DOMB 3FZBA 4NMLA 3DRPB 2RF2B 2IVFB 3HI9A 1TUGB 4B3TJ 3KTQA 2KJVA 4XK8C 2PI5A 1JKHA 4WIIA 2MZSA 1ZAWA 2RUSA 2AYEA 4AFFA 1GH8A 2VOPA 3K58A 1ACMB 3CT9A 2FY8A 3D9BA 3MM8B 4Q0BA 2M2BA 5B0BA 2PMWA 2GVZB 2QL5B 3SIPB 2YQ0A 2ZVSA 3DOKB 2YNGA 4ZVOB 4QOTA 2WAQD 3H25A 5K8OA 1S1VA 5KFAA 3V4IB 2I38A 2CJAA 1Q8IA 1F9EB 2HMIB 4YDXA 2ZE2B 2QLXA 4PXBA 2AWZA 5B0AA 1IBMJ 1CQNA 3HSGA 1Q7YT 4A8WA 1VRTB 3PW5A 1RE1B 1IKYA 3CJ3A 3THTA 3BQ1A 1QAXA 1CJTA 1Q8LA 2LDIA 2MZQA 4HHUA 2H1YA 1P6TA 2QMUB 1FXRA 5KFOA 3AAWB 3JSYA 4PXDA 4YOEA 4IFYB 5IZHA 3UVJB 1RK8A 1VC0A 3GFXA 5E41A 1T9WA 1HYSB 5HQ8A 2XLKA 2QV6A 1OQ6A 3MM5A 1L3KA 2GW8A 1SH2A 2JLEA 3QGPA 1UAWA 4PG7A 1GK8A 4TKTA 1BMQB 2CWKA 2JDJA 3D6FB 3W1YC 1OY8A 3PIPQ 3GZ7A 4RW7A 4DR2F 3ISZA 4K7QA 3KLHB 3SZ2A 4ED1A 2HRYA 1HWLA 3HFVA 1X5SA 4JI0J 2CYYA 2V9WA 3I82A 4Y3CA 4O4GA 4HTIA 3EGVA 2OMLA 3MM6A 1UEVA 4KYZA 2VZ9A 1FT8A 3CDEA 1N5TA 4WCEQ 3Q8RB 3MPUB 2GA7A 1Z1ZA 2O1PA 3OTBA 1X4GA 2EFNA 3R8YA 2HS4A 3AOCA 2PI4A 1U02A 1S1UB 3PJWA 3OR2A 1YG0A 2LMIA 1NSKL 1TV6A 1NKBA 1CQMA 3FCHA 2O5DA 5C24B 3HM9A 3UCUP 3SSSA 2BXJA 3OQ2A 5CYMB 2XCPA 5B7WA 5CHCB 4LSNB 3ILLA 2IRXA 4JI5J 2XLJA 3VAIA 4WPAA 2ZNYA 3R6GB 2J6UA 5BYRA 1H72C 3DNCA 2LQJA 3JQKA 2DGTA 4NRTA 1FDNA 3GILA 3Q2SC 2R9LA 3UD5A 3K59A 3OVBA 1JXLA 3D1QA 1TL4A 4DCJB 1PYOB 1S5ZA 3KJVB 1VS3A 5JXSA 4TY9A 4USMA 3W66A 5IT0A 2DXEA 2FLNA 2HHWA 1VBZA 2HS3A 1OWXA 3QJJA 3M32A 4FBTA 4G1IA 5DQGA 4KGXB 1LEOA 2L9DA 3D3BJ 4C7QA 1UVIA 1TKZA 4YP3A 4LF5F 1OJ4A 3J7Z5 3AJDA 5HVGA 2RU9A 4KGMA 3DKDA 1KLNA 4ZVRB 5L1IA 2YKMB 3LO3A 3BH7B 3CJKB 2AYGA 2IRYA 7AT1B 2VV5A 2J9CA 2XNQA 2QA4G 2A6OA 1Q1KA 1WDTA 1MMNA 3VAJA 2VIHA 4CNZA 4P73A 3S1TA 4QR1A 4OHZA 4A8FA 2CVEA 5BYSA 2PSZA 4I6WA 1X5PA 2RS8A 1RT7B 3U1NA 2DNGA 3CO9A 3CCQS 3G6VA 2W7OA 4MKBA 5HLFA 3Q86A 4DN0A 5IC6B 1WDDA 5D15A 4MKAA 1B99A 1YITS 1S0NA 1XTZA 3M4XA 3M8PA 4ED0A 3BEGB 3IGVA 3QWUA 2PN6A 3BGOP 1R8AA 5KFGA 2IPOB 2DVIA 2BX6A 2CRLA 1V5IB 1UFWA 4RBUA 1KOHA 3P3DA 2A6MA 3FCWA 2FHKA 1FVSA 1VQMS 4BHQA 3G6ES 4NL5A 1F0XA 3QMQA 3CJ4A 1YJVA 1I51B 2Y1IA 3JB9k 2LLZA 2VG6A 4NCGB 1IBKF 2GQQA 2KZZA 2AKWB 2OPPA 3HHKA 1DY3A 2KYZA 4DFJA 4UOFA 1FESA 4HKQA 4RKUC 3D1OA 1WHWA 4F0KA 1Q0NA 2N3LA 3M8QB 1WOPA 3Q2TC 2MKKA 4PRFA 2CNLB 2YKNA 3NXZA 3VHQA 2HHUA 5BYQA 2CQ4A 3EZOA 4USIA 2DHXA 1HW8A 4QYZJ 1CJKA 2CNKB 4C48A 3EX7B 5E7OB 4P74A 1X0FA 3V5RA 2YBVA 4NE9C 1FRKA 2W4PA 8RUCA 4NI2A 2ZBPA 2B9YA 5BR8J 4B9SA 1VYAA 1WWHA 1X31C 2DNKA 3KJQB 4I2QB 3DYAA 3DMJA 4ED8A 4F8RA 1RB0A 3IRXA 3I0SA 2Y0BB 2DNOA 5L1LA 4EZ9A 1C0UA 2UZAA 5CABA 2MKYA 4OJ1A 1RT4B 3MR2A 1BWVA 3KOAA 4B3RJ 1EIYB 2DHGA 1B0VA 2DRBA 5J1PA 2E9ZA 4J9MA 3UR3C 2IM1A 3TVZA 3MFHA 2B51A 3V6DB 1DAXA 2LDYA 5AXMA 3IC1A 3TANA 4KQZA 1DTQB 2M0GB 1EHWA 1T3OA 3HHEA 4CH1A 3B4MA 2XYGB 5IV4A 1C2PA 2HVEA 4NASA 4DV6F 3N9UC 3PJ9A 1UVJA 3GIJA 2GGPB 1AYEA 5M2UA 2E5LF 3I56S 2EG1A 2MZJA 1RHMB 1UKUA 1QAIA 3HT3A 3H5XA 4JV1A 3FEYB 2HKEA 2BQUA 4NLYA 1QSLA 3CJ2A 2VOOA 1QJHA 2EKNA 3WIVA 2DPJA 2PMZD 3RBXA 2A1BA 2AYBA 3I9ZA 4X64J 2EBEA 3NRBA 4UF4A 2V68A 3DLJA 1Q95G 1VLYA 4OYAA 2FJXA 3IS9A 1FRJA 1RAFB 4K4TA 3H20A 1SIZA 2DNQA 2VFVA 2WB4A 2LQ5A 3WZ0A 9ATCB 4I2PB 2Y1JA 2MMYA 2VPXB 2KH9A 3FC9A 3CDBA 5T41A 2Z8QA 3I0RB 3QIPA 4GO5X 1TL7A 5J2MA 2UUBJ 3C66A 4ZLLA 4WFZA 2C2KB 3SMZA 2FHMA 2XY7A 4NYZA 3PG9A 5B0CA 1SVDA 3R6LB 2F3JA 3EVMA 3JAMY 2FVQA 3KHGA 5F0UA 4DU8A 3FRYA 1YJTA 2LVWA 1IBLJ 3GSIA 3AQOA 4DX6A 1KOOA 1VC5A 2FY1A 5HP1B 1WKLA 3NGKA 5HATA 2X51A 4A8SA 2WONB 1U1LA 2HQ3A 1FF2A 4FYDA 1HNVB 2UUTA 5A2QY 3JYTB 2HIYA 3NMRA 4DPYA 4XDDA 3W8PA 1NHKL 4B3TF 3GCWP 1NDPA 1YRUA 4OZNA 4C3LA 3LP2B 1FX4A 4ANEA 1VRUB 5IT9U 4QJVA 1HBMA 5U47A 5D4NA 2F4FA 3GTYX 2CJXB 3LF0A 3LP0B 2MB0B 1RTHB 3S6EA 4P52A 2DGWA 4NLUA 4GVLA 3VZIA 2HVIA 2CZ4A 5DZ6A 1K1SA 2IM3A 5MAOA 3M2UB 3NY0A 1FWPA 3OL8A 4GC7A 1TFWA 2VKRA 4LFBJ 1M5HA 3D7SB 1IBMF 1AUSL 1NPKA 4EGLA 3KLGB 2ZZTA 4XIUA 4F04B 3R7SB 4WTOB 1BHNA 1R6VA 2HBQB 2E7VA 3CPWR 2WRMA 3TYTA 4M5GA 4ZLJA 1S99A 1RBLA 1FX2A 1P9QC 2NUHA 3M9NB 1DLOB 5HJYA 2LEBA 3AFGA 5DZ7A 4MT1A 5C25B 2Q1LA 1MMDA 2E66A 3NAHA 1YGYA 4K5RA 4U95A 2KRBA 2HQFA 1RTIB 1RWXB 4ZVEA 1GTEA 3IGNA 1MMLA 5KG0A 4WKYA 1X60A 2MKCA 2C2OB 3A3OB 3E3XA 2AGOA 2UP1A 1J2VA 1F5BA 1FNOA 1Y5IB 1KTVA 5A0YB 1IM6A 3QO9A 3G86A 2O66A 2Z57B 2FYXA 3C16A 1RWVB 1JJ4A 1ZPVA 5KG6A 1SH0A 5DS7A 3MMAA 1H2UX 2P9EA 1HIYA 3MR5A 1HR0J 3TOQA 4MIWA 2HZCA 1AB8A 4NA3A 2HQGA 4JI0F 3GYXB 1SJ1A 3D28A 1ZA1B 1U4BA 1KVJA 3JQMA 3C46A 2K1RB 3MEKA 5KFUA 1K73T 4DV2J 3AH6A 5DETA 2C3OA 1XNRF 1EQMA 2K06A 1B7YB 3NBPB 3J80U 3QFHA 4NLDA 1DQ9A 4ZOSA 4ETXA 1N52B 3BZQA 3NS7B 2XCAA 4JV2A 5HO4A 2H48B 4ANDA 2DR7A 3CJSA 2AEJA 4X4QA 1BQNA 3DXSX 4JP8A 1WNEA 3C19A 5KTQA 4FXVA 1G4CA 4ZPAA 2F4VJ 2HRUA 5F8HA 1REVA 6AT1B 2VHGA 2AGPA 3MEGA 2H51B 2G0IA 2XWYA 1YVFA 4ILMA 3KFWX 2ZH9A 4JI5F 4I64A 3KDNA 2CKWA 3R5GA 1LW0B 2JZ5A 4A8QA 2FZKB 2C2MB 2IMOA 3BJYA 3GJTB 1IR1A 2VA3A 4GKJJ 3D0IE 5F3TA 2QFJA 3BGRA 1XWLA 1O0PA 2QJ3A 1WI6A 3H2VE 2GHVC 5D77A 2ALZA 4ZA1A 2EW9A 2AGQA 2D9OA 2LXIA 3DLEB 3MEEB 2FZGB 3R3TA 1IM4A 3I5CA 3CJ5A 3D6HB 2KVIA 1S9EA 3Q8SB 2GAHC 4DSKA 3KMQA 4IDKB 2UVVA 4C8MA 2CIMA 2ZKUA 3FBFA 1T9UA 1IWGA 3EZ5A 3DN9A 3MAAB 2NSCA 2N82B 2IC3B 3O1LA 1NSPA 3B78A 1RT6B 3RB3A 3GMGA 2VG5B 1VQYA 2NSBA 2Z58B 3F44A 5AE3A 1B3TA 4IRDA 5M2RA 1QE1B 2D3ZA 2QX0A 2OFHX 1F60B 4ED5A 5HQLA 3L95X 2KFYA 2WVCA 3HFKA 2W9BB 4DV0J 3EUNA 3T1AA 1KLMA 2AIRB 4N8NA 3LH2S 4B9TA 3PW2A 2E1AA 3DLKA 1M5OC 3HDSA 1FEEA 4CYUB 3CCSS 4FXDA 4C8KA 4H4MB 3ELHA 4MKVA 4AL6A 5I42B 2CXEA 2FB0A 1I5OB 1OYDA 1ZZNA 1TR0A 3S8SA 4DL6A 1U1NA 1UVNA 1TAQA 5D0HA 4ZMMA 1TKDA 1H2TZ 4U7CA 1FFSB 4KHPF 3SV4A 1APSA 2RU3A 3BPDA 2IAJA 2DH7A 1XQIA 2RDIA 3VVUA 1E6VA 5IV3A 5HAOA 3ZTRA 4QWDA 3HVTB 1U8WA 4I0WA 2J5AA 5SZTA 3R1LA 1KHVA 1U2FA 3TZZA 2OFGX 4ECTA 4PUOA 1IKYB 1JQGA 3CCES 3BKUA 1T7PA 4NLRA 1RLCL 3CCMS 1YK9A 5JUMA 1MWZA 4OHWA 3TP2A 3HULA 1SV5B 2ATLA 1L3UA 2C3UA 4XAKA 2YWGA 2BMBA 2KJWA 3DI6B 4OI0A 4CTAB 1N4LA 4B3OB 2GAGC 5SUHA 5BR8F 3M8WA 3QSYB 1SH3A 1PJ7A 2HHHF 4J9KA 5J1EA 3OFHA 2HQIA 1N36J 2V5HG 3DU6A 2ERRA 4ILLA 1Q82T 1AA1B 1RAIB 4WZMA 5KFXA 4HACB 4WXWA 5C42B 4EZ6A 4B3RF 4PG6A 1WF1A 3N5FA 5GMKa 2G0JA 4RW7B 2POKA 3H4DA 2HBRB 2P8IA 3KXDA 1VQKS 2CA9A 1DURA 2QSWA 1WORA 2QYGA 1LV5A 4MTPA 3C14A 1YJNS 2ZH5A 2CJKA 4DR4J 2YKQA 4DR1J 2MTLA 1PGZA 1E6YA 2KXNB 3MM7B 4ANCA 1F5CA 1GQEA 3D4JA 3AOAA 1IUJA 5D78A 2O67A 4Q8EA 4Y6IA 1C1BB 1T03B 2HFOA 1EP4B 3EPGA 1UTAA 4OX6A 1H6KX 3W9JA 4P7TA 3AD8C 4X64F 1UVLA 2D1CA 2RQMA 2R7WA 2LECA 2Q43A 5FDLA 2JH3A 1YSJA 2AP6A 5FLXU 1VQ9S 4ICLA 2OTJS 4LQ3A 1FWLA 5LM7E 2BM1A 2VB6A 1HHTP 4DUZJ 1H7XA 4RW9A 3RUBL 3OVSA 3MR3A 3MPYA 3LP1A 2XS2A 1S1WB 4FN5A 1OS5A 1T3NA 2UUBF 2DNNA 2FJEB 2FVRA 1M90T 1QUVA 3PM9A 1QVGR 1D3WA 5EWEA 3KLIB 2ZH4A 3A8IA 5GMDA 3NG8A 3VAKA 5H1SV 1X0PA 4ZCLA 4OI3A 1QAJA 5KG7A 2ZFHA 1SL0A 4HVZA 2GQ2A 1OQ3A 1NEEA 4K5SA 2Y3YA 2E5IA 1EAYC 1UPPA 2L3MA 1IBLF 3RBEA 1P8GA 1HPZA 5IC4B 5KT3A 1VC6A 4OYZA 2W24A 2W1BA 5IOLA 4DF8A 2IY5B 4WKRA 5KG3A 1UFKA 1U45A 9RUBA 3N28A 1AZSB 4KPCA 3JSMB 4B3SJ 1MWYA 2CPIA 1J5EJ 3CD5A 4O4RA 4L3KA 3ZZZA 4F25A 2KYXA 4KV8A 2RILA 3VGVA 1RHRB 2YX4A 1LWEA 5DJBA 1BWEA 1TKTB 1IJFB 3DFEA 3ICLA 3NGUA 3PR5B 3DM2A 1NBEB 2PFDA 4G1QB 4LVNP 5KFJA 4OHVA 1EQ0A 4IRKA 3VTIA 4OZ0A 4LFBF 3ADAC 2HBZB 3DLHA 3DRSA 5HROB 3EWGA 4CO4A 2NZCA 3AT1B 2R3VA 4MIBA 1B4SA 1DQAA 2EEYA 1D9AA 2ROPA 2E5JA 2RRAA 1N88A 2NXUA 4ITSA 3B54A 1MW7A 3J81U 1JLGA 2UU9J 1UWBB 2KDOA 1SUQB 4RPFA 3ONQA 4F4ZA 4DQQA 4DEZA 1RLDA 3W2VA 2WTFA 2A18A 4YS2A 4GVBB 1NK5A 2F8EX 3PO4A 4M5DB 3RBDA 3K5NA 4Z37A 3F0NA 2IMWP 3M1VB 5HN0A 3QT5A 4RW4A 3KK3B 3SXLA 2GVDA 5KFWA 2I5JB 2ZEJA 4N47A 1JNRB 2XY6A 2P9GA 3DRXA 4ZVFA 1ITPA 2EFPA 1W2BR 1U49A 2PA3A 2F1FA 2GMJA 1VJWA 3ZZPA 4MK7A 1H38A 1HR0F 2ZBIA 2HGLA 2ZHOA 1YKWA 3J81j 2E9TA 1UFLA 4PYAA 1LOUA 4IH7A 3D67A 4DV2F 1ROFA 4WFYA 1YZ7A 3DOMA 3KUGA 5CAAA 3DRPA 2RF2A 2QN6B 4TN2A 1CBKA 4F4YA 4OZLA 4QIWD 3KHLA 5BJRA 4WFXA 2F63A 4LF1A 2DPIA 5JMNA 4NXNJ 1R31A 2HNYB 1UW9A 3MM8A 1XIQA 4WE1B 2GVZA 5E3PA 1WC1A 1RKJA 2LP4A 2BA9A 1R3NA 4RUAA 3DOKA 1C0TB 3K5MA 2LYVA 2B3TB 2OPQB 4N56A 1MNEA 5G0RB 4CO2A 1UA1A 3V4IA 1KVKA 4IYQA 2F4VF 2DHHA 1Y5LB 3FCVA 2DH8A 2HMIA 2PC6A 4DS5A 1D09B 1PSDA 2ZE2A 2P5VA 4ELUA 1X4DA 4DSFA 3TAMA 2RJZA 3U1LA 1FJEB 4FYXB 2WSCC 1VBXA 4P10A 4RLEA 4KHRA 1ZAXA 1VRTA 1KSPA 1HNWJ 1RGVA 4ZVPB 2B9XA 2E29A 1URNA 3CC2S 4GKJF 2VBYA 1N8RT 1JB0C 4USJC 3MCOA 3G96A 5H9FK 4ED6A 4YQWA 2LKZA 4C0HA 1VDHA 3OL6A 4IFYA 3UVJA 4DX5A 1ZA2B 2M70A 2U1AA 3VAHA 1HYSA 1EX8A 2KM8B 2IFXA 5E0OA 4I69A 4OJGA 4TVAB 2QMWA 2RUGA 2OH2A 4USUA 2NREA 2BVZA 4PG5A 3BDPA 4L72B 3R5BA 4YEAA 4B17A 1WOSA 2QL7B 3P4UB 5L1KA 2YNFB 2XO6A 3HSJA 4U67Q 4CLLA 4WK3A 1HD0A 1WEXA 4ECUA 4Y2IA 4ZVGA 3I6PA 3RAMA 5KFMA 3QRRA 2OIHA 1YLXA 1FI4A 2N4DA 4L75A 4DV0F 3BDEA 4X66F 3JSBA 2IM2A 4CZCA 3CCZA 1KWMA 5HMZA 1NAQA 1KN6A 3J7YI 3W2WB 2DO4A 2HVDA 3PDNA 1QTNB 1MN7A 1RBOB 4AL5A 4JI8J 4UT4A 1R43A 1S1UA 3MPWA 3BSNA 4WXOA 1RP5A 2C3YA 3NNCA 2W2OP 3SSRA 3EGNA 1LWFB 1PC4A 2CPFA 2VBWA 4DR5J 1UP1A 2OEJA 4ZITA 2J6TA 4DPOA 1DZ5A 4QWAA 4FZVA 5C24A 3GV8B 2V8HA 2R7QA 5CYMA 4LSLB 1O6XA 4LSNA 1FD8A 4NZ6A 1JLCB 4H4OB 1YJ7A 2I8EA 2LA4A 3EVOA 4DPTA 4CLWA 3R1HA 3T9NA 2UUCJ 5ADZA 4MYTA 4U96A 1N0VC 3A3NB 2D3OR 3KJVA 1G3OA 1OY6A 3BBCA 3KDOA 3MTJA 2AU0A 1TVRB 2QC3A 1XR7A 1SL1A 1NU4A 3LOUA 4FKXA 4FPRA 3M6WA 2R8GA 3QGGA 5E3AA 3AB4B 5I3UB 2VJUA 4PEOA 4ES3A 4OZ1A 2ZITA 2LU2A 4C3KA 1WSRA 3RGIA 3OVAA 4KGZB 3PYFA 5A8RA 1YIJS 2HHTA 3SCJE 1N36F 3PTWA 3EDQB 2VPZB 4QIFA 3SYZA 1TFYA 2OAUA 5K14B 4F02A 2YKMA 3CJKA 1Y10A 1LW2B 4ZLNA 1F1BB 3J7YU 5K8MA 4QW9A 1WEZA 5HVFA 3MPDA 5D3GA 2V8GA 3RTVA 1RT7A 2RKIB 3IAS9 3RG6A 4A8YA 3PV8A 2R8IA 2IDEA 2X7IA 3DC2A 3NMAA 2UUWA 3TX8A 1XEZA 3QSIA 3CJRA 4QIVA 5KFCA 3CSKA 3PFEA 2WW4A 2AJ0A 3NNHA 3AD9C 4DR4F 1S12A 2IVYA 4DR1F 4WFAQ 4CT8A 3VAGA 3H59A 4OJ3A 3KNAA 2QLWA 4F50A 5KFTA 1Z2LA 2C2RA 3CJTA 2N4CA 3SCIE 5LJ5Y 1ZETA 1TP7A 4ZPCA 2BBEA 1AROP 3OLAA 3FK4A 1QUPA 4PXCA 4NCGA 3OHAA 4NA2A 2EKYA 3NLCA 1FDAA 3UW1A 2QA4S 3BN4A 2LCWA 3QLHB 4QIEA 3M8QA 5D0GA 1S97A 3BM7A 1CJVB 5E3RA 2HHXA 4NLTA 1VHFA 4OX9J 4EBCA 4O3RA 3HVAA 4DQSA 1F9HA 2OLWA 1KS2A 1RYRA 1EJ7L 3ZZOA 2AX1A 4DUZF 4EWTA 3UE2A 1OYEA 3U1MA 2XMVA 4LRDA 1QSSA 3QYYA 2QFIA 4WBFA 4DL0C 2ACYA 1ZTWA 1HD1A 3MZIA 3AXKA 3PCOB 2HFNA 4I2QA 1PILA 4B08A 2KXHA 3HHLC 3L09A 4BC9A 1OPIA 2X3DA 4PWDB 3EGZA 4F3MA 4PG8A 4IRCA 4RZRA 1RT4A 3I31A 4YB7A 1SCJB 3JSRA 3FFIA 3CCJS 3OXFA 3QWPA 2CPJA 4WTYA 3GV7B 2V2ZA 2XS7A 4PABA 3G71S 3V6DA 1TK0A 2ROEA 3MURP 4FF4A 1BUXA 4DFKA 1DTQA 1M5KC 3AJ1A 3EYZA 1NJZA 4ZCKA 1HWIA 2XM3A 4B3MJ 3RB4A 2G2YA 2F9DA 4B3SF 5K5MA 4C8YA 1J5EF 1NKEA 2PGCA 1UETA 2H54B 1ZPWX 3HHDA 2BEFA 3D0GE 4ID5B 2YXLA 2D3UA 3D68A 3E01B 2IIHA 4FS2A 2OD6A 2BJ7A 3W7BA 5IT9Y 3FBEA 5B08A 4K2XA 4ZP8A 3EXCX 5KFSA 2VFSA 2EI5A 5LOQA 1S48A 5LT5A 2RHSB 3CMES 2WCXA 4ID8A 1D8YA 4K0KJ 3SBMA 3CD0A 1FKOB 5K8NA 2UU9F 2M4MA 4I2PA 1V5VA 1URRA 2HNZB 1SKSA 2WVFA 3OR1B 3PNIA 1RWWB 2BUNA 4IR9A 3I0RA 1ULRA 8ATCB 1ZM3A 4J9VA 3MEDA 3J7AN 3K8WA 1RWUA 3TVKA 4CO5A 1KC8T 2HVHA 1S4EA 1YWXA 3IN5A 4J9SA 1UMJA 4DZ6A 1I3OB 3HJFA 2XEXA 2ZH1A 2ZDPA 4LBIA 3CNQP 3OLBA 2PMHA 3MGJA 2AZ3A 2C28A 2BOAA 1LWXA 1U1KA 4AXJA 4CIOA 1EB0A 4QU6A 5CD4H 1KQKA 2NYIA 1DFDA 5HP1A 4GMKA 1XNQJ 2ZJPQ 3VQTA 2HAFA 4N5SA 2ATCB 2MKIA 1HNVA 3JYTA 2DR5A 4OL8A 2QGFB 3LP2A 1VRUA 2R4FA 3AA8A 3V6KA 3G82A 2Q6BA 4ER8A 4NXNF 2QG9B 4OI6A 3JS9A 4J9QA 1RTHA 3TI0A 4O0IA 4LRFA 1Q8BA 2V50A 1WHYA 3OSNA 3M6VA 3M2UA 2N3OA 5CD4A 1IWAA 4LF6J 1U2CA 4ZPVR 3AXMA 4FKYA 4RX6A 4W90B 1Y3KA 5C2CA 3P49B 1YRXA 2DH9A 3MOZA 1KQGB 1HQEB 3KLGA 4DUYJ 4HYKA 1HNWF 4R8UB 1HBOB 1IJEB 2CDQA 1H3DA 2HQCA 1EKSA 1FNMA 5T7LB 5C7PA 4ZHRB 5H9EK 2ZOFA 1RHQB 1N5YB 4UOGA 1DLOA 1SL2A 2DRDA 1VK8A 5C25A 1JXVA 3T41A 1RCOB 3LA0A 2X1BA 1IR2A 3ILOA 2GJIA 2MQMA 1GFWB 5F8LA 2RS2A 1V6HA 2AJQA 2ZBQA 3W65A 5BXIA 2DNPA 5F9LA 3EICA 3CCWA 1YJ9S 4KO0B 3B6BA 1K47A 1O51A 4DV3J 5A0YA 4GKKJ 3W3SA 4L73A 4JI6J 3KJNB 5L38A 1NK8A 3GIKA 3IR6B 1Y11A 2RDJA 4ZJOA 3CEDA 3I96A 4LBPA 3BYPA 2M5YA 2K3KA 3EMTA 4ZVSB 2YWKA 3B8HA 3O3LA 3W60A 2Z4PA 1NRKA 1RWOB 2CG4A 1K9MT 1R8HA 4DQPA 1K0VA 4JYAJ 2K1RA 3US5A 1F9FA 4ZPWR 3BS9A 1RTDB 3PR4A 1IKWB 3NBPA 3SSQA 2RHQB 1RAAB 1PAEX 1JIHA 4HDGA 3KUEA 4MH8A 3N6LA 4CO3A 3MFIA 2CAJA 3G6XA 4F2RA 5KT5A 2EVZA 2MEWA 2QLFB 3A1YG 1SJ3P 5J1NA 3FZ2A 1N33J 1CEZA 1VCTA 1FNXH 2V8DA 4WYLA 1YI2S 5HMXA 4DR5F 1NK9A 1S0VA 4XPCA 4B02A 2DNRA 3PACA 3K5LA 4AUKA 2B4PA 2RSQA 1IKXA 3CW2C 4DXLA 2DT9A 3A8KA 2XMUA 3VV2B 1G6BA 2HYIB 3ITHB 2I1RA 4G65A 1QLNA 4UOHA 1LW0A 2F40A 3M8RA 4C4WA 2Z2LA 4DL5A 2UUCF 3BN7A 3MF5A 2BJEA 5KT7A 2DXDA 5D8HB 1O5JA 1GMWD 4I56A 2ASLA 3H5YA 3BSAA 2GJFA 2WK4A 2HWIA 4D3HA 2BW2A 3JTNA 1RTJB 1NB7A 1OSCA 5J2PB 2L41A 2WSEC 3DLEA 3MEEA 1HNXF 2YPYA 3VAMA 5B0FA 3DU5A 4IDKA 4ZIWA 4YDDB 1UJ4A 3GR1A 2HGNA 4LF7J 1N34J 2FHOB 1U7LA 2DKOB 4I68A 3UD4P 3MAAA 4YY3J 4DG1B 4LREA 3J7ZT 2IC3A 4KC5A 4IOAQ 4RW4B 3VAFA 1RT6A 2XSJB 2QEXS 2VG5A 1RAOA 3OFEA 1BLUA 3GWCA 2A0FB 2XZWA 3Q83A 5DDQC 1DHMA 4ECRA 2JEJA 1QD1A 1QE1A 2JL9A 2Q6CA 4ELTA 1PC5A 3J7A1 2L9WA 4J9UE 2HFZA 4QBUA 1TL1B 2ILZA 2XSFA 3D3CJ 3PW0A 3G8SA 4IG3B 3T6JA 3MTKA 3I5BA 4K4SA 2W9BA 5DGAA 4NA1A 4ED2A 2JX2A 3NKYA 2D74B 4PR6A 3LWLA 4MIAA 5KFFA 4MFBB 3M2VB 2Z2ZA 4NEYA 4CYUA 5L46A 3HVRA 1VR6A 4F4XA 1T9XA 4B9LA 2A2CA 2PE8A 4H4MA 5I42A 4Y2KA 3EPIA 2YNHB 2H5JB 4UW2A 4W92B 2H4YB 4LF4J 1V3ZA 3TQ1A 3ET6B 2V2VA 3MD3A 1YTYA 3PJXA 1V9OA 1RDRA 2CVIA 2BJDA 3GYGA 4C97A 4Y2MA 3M2RB 1M0SA 3GIRA 2X1AA 2J0WA 1S9GB 4LFCJ 4HR2A 4RR5A 3HVTA 2M52A 1WG1A 3TAMB 1S6QB 4OX9F 3OJSA 1AXQA 2L48A 3CCVS 2B4VA 5DO2A 3C3LA 4I1TA 2J0SD 5D0EA 1HA1A 2GMLA 2EC2A 2AT1B 2OTLS 4ZPBA 2PEHA 3R5AA 3M9OB 4LR9A 3JQJA 4N8OA 5E3QA 1SV5A 5FLXY 1SJFA 1WACA 3ZNJ1 2EK1A 3DI6A 4CM0A 3GQCA 4CTAA 3SQOP 4B3OA 2EFVA 2OPRA 5KFHA 3FDSA 3WX8A 4Q44A 2WHOA 3IMQJ 1I94F 5DRKA 4OI4A 1KQFB 3HSZA 4P2XA 1GEHA 1NKCA 2B5JB 2LA6A 2LEAA 4BWJA 1WHVA 4ZP7A 2G9OA 4LJMA 3ENQA 3RRHA 4B9MA 4MMOA 1VISA 2MGZB 3NGDA 2W01A 4DCPB 3H4BA 2B9EA 4HACA 5C42A 2YY3A 3DLBA 1GMUA 4Z2XA 5HMWA 2VASA 2J0QD 2VFTA 2MSTA 2KG0A 4ALZA 2DYAA 1HNIA 4FYVB 4ZLPA 1H73A 2ZWPA 1IXKA 4B3MF 5M2PA 5LSRA 5ETTA 3CJ8A 1RA7A 2IBOA 3I55S 2B7CB 2E7XA 1NJWA 2MJNA 3MM7A 3IP0A 1U6BA 2YPZA 4TU8A 1WC5A 3PRDA 4I6AA 3OUYB 3M6UA 3AHPA 3QRPA 2E9RX 1HI0P 2HG4A 2GHPA 3GR0A 4K8RA 1C1BA 2CWXA 1T03A 3DRRB 1PIEA 5CQGA 1QVFR 1WG4A 3ZTPA 3MPVA 3F56A 3OD2A 1U0HA 1EP4A 3DOLB 1X4FA 1NK4A 3K57A 2JC1A 5KFRA 4EO6A 3P5TL 4I67A 3PFOA 5ETLA 1FRIA 2F8HA 3DHXA 1PAUB 1FERA 3VF0B 3PIOQ 3C6TB 5LMUJ 2I2YA 3K0JA 1K44A 3UCZP 1F2GA 2B56A 5ETSA 2KRRA 4M5HA 1SKWA 3QBCA 1LXNA 2BE9B 3RR8A 4BBYA 4KPYA 2RVJA 4Q45A 3PKYA 1RT1B 3PX6A 1BC6A 1W25A 3RAQA 4Y34A 3CVKA 1S6PB 2HW3A 2BDPA 4KGKA 2XY5A 4LQ9A 1OY9A 2ILYA 2FD2A 4AQYJ 1TZ0A 1S1WA 3OTCA 4URQU 2KO1A 1FJ7A 2CPYA 1U8SA 4IFVB 1ZTTA 5B0EA 3J81Y 2RQCA 3KLIA 2PA8D 3IO1A 2JHEA 1VQSA 1XMOJ 2CNNB 3D1HA 5A8RB 2MPUA 2DIUA 4K59A 3T5HA 1MG7A 1WTBA 2BJ8A 1FA0A 2LXUA 4U6PA 1VQ6S 3KG0A 4C2MA 3RAXA 1YX2A 1XNQF 5EN1A 3N79A 5D0RA 3P96A 2AJ2A 5D3GB 3BR9A 2GO8A 1XMQJ 2HLTA 4J9RA 3Q23A 2QMXA 2EFGA 1AZSA 3GPAA 4DLGA 3JSMA 3MCNA 2IRUA 4OYBA 4ZPDA 1TUWA 2ZC3A 4EEYA 1CPZA 3GLJA 2FLLA 1FXDA 1NPPA 3DCAA 5FD1A 1SC6A 3R27A 1TKTA 2Z2YB 2ZZNA 2DXFA 1V3SA 5RUBA 1RT5B 1XMBA 1NDCA 2V2KA 4G1QA 1XR5A 1S9FA 3TJAA 1FDBA 3LGNA 5HROA 2HGMA 1XC9A 1RQ0A 1ZYQA 4LIWA 3CTRA 4DUYF 3ISNC 2BE7D 3KJFB 3SI8A 2EPIA 1UJ5A 5ETNA 4DZDA 2AX0A 1UWBA 3NGSA 3R7BB 1SUQA 4JI7J 3W61A 3AJ2A 3PRBA 4QPXA 5D4OA 2XHWA 3V2UC 4WU3A 3TQEA 3A4TA 2VC1A 3Q8YA 1ZH5A 4GVBA 2IYGA 1TKXB 5KG5A 1FTCA 2R7XA 4M5DA 1KFSA 2J7UA 3M1VA 3SCLE 3KK3A 4M5JA 4OYWA 4DV3F 4GKKF 2I5JA 2X1GA 4JI6F 1FHTA 3PYDA 4CQ1A 2XI2A 2XMKA 2I6WA 1SI9A 4KY3A 3TVYA 2CQCA 4Y2CA 3KK1B 5AJ3J 1Y0HA 1S79A 2BJ9A 1RAEB 3D66A 4MKYA 1PBAA 3TUJC 1Q8KA 4JV5J 4DLEA 1M1KT 1RHKB 2IA0A 4USKA 4JYAF 4PQUB 3M30B 3FFIB 2K7JA 3FMWA 2CZVC 3SCKE 3K8VA 3TJ8A 3D54A 1FE4A 2W2PP 2HNYA 4NMXA 1VJQA 1U09A 2K7KA 4WE1A 4BDPA 3NS6A 4BLGA 1S1XA 1KBRA 3QNWB 3SV3A 3ZZYA 1N33F 2NCKL 2HHQA 1C0TA 1RZMA 3W5YA 2OPQA 5G0RA 1Q7LB 3X3UA 3QATA 3CE8A 1WF0A 3T5KA 4ZP9A 4FF3A 2ACMA 4HT7A 2DK2A 1T94A 1YQHA 1EETB 5F41A 3TA1A 2R7OA 4JI1J 2YX1A 2JRSA 4DBQA 4C11B 1C1CB 1JK9B 2XZDB 3HF5A 4K4YA 2DIVA 1N54B 3SDEB 4JI4J 3N0VA 4E0DA 3R97A 2MKHA 3OHBA 3KWMA 3IBWA 5KFIA 2J76E 5F8JA 3ULHA 3PRVA 3MEDB 2AYMA 4KKOA 4E98A 5IWAJ 4LF7F 1KTQA 1N34F 3EJMA 2V4JB 3GFYA 2OHDA 4LT6A 4CO0A 4YY3F 5KFZA 1HQ2A 3O6QA 2GIFA 1UZDA 5EGYA 3CGIA 3IFEA 4ZVTB 1VI7A 4OJHA 2YNFA 1N48A 1NNDA 5ETOA 4NOHA 2AJFE 4LF9J 3O5TB 2MHEA 3HD1A 3UPFA 2RH3A 3NOGA 4ATNA 1F3FA 1NDKA 3B4DA 2ASJA
chains in the Genus database with same CATH topology
4O4GA 5B09A 2M8DB 4HTIA 1DJ0A 4DV0F 2OMLA 2ZH7A 3BDEA 4C8ZA 4O4GB 2DGSA 2FDNA 2PD1A 3MM6A 3CC4S 4X66F 4URSA 3JSBA 1UEVA 2IM2A 4MJKA 1FRLA 5EX3A 5KT4A 3MM6B 3W2WA 3F73A 3FJ2A 4CZCA 3CCZA 3L7OA 4OX8A 5HMZA 1NAQA 3UD3P 2VZ9A 1KN6A 3J7YI 3PEJA 3W2WB 2A2DA 1FT8A 1L3TA 3CDEA 1N5TA 3TA0A 4WCEQ 2DO4A 3Q8RB 4A8MP 3PDNA 2GA7A 3HLUA 4NLVA 1Z1ZA 3T5JA 2O1PA 3OTBA 1W2IA 1X4GA 2MDAA 4AL5A 4LMZA 2J7WA 2EFNA 3OXGA 4Y65A 2HS4A 1HFEL 1S1UA 1R43A 1X4CA 3MPWA 5A8KA 4ECYA 3BSNA 2PI4A 4WXOA 4K4VA 1RP5A 2RE1A 3LALA 2XS5A 1LWFA 2C3YA 1S1UB 3PJWA 1CVJA 3NNCA 4JV0A 3SSRA 5E5NA 1WTFA 1CC8A 3EGNA 1LWFB 1PC4A 3OR2A 3CD6S 3LGMA 2CPFA 1YG0A 3R5CA 4A48A 2VBWA 2LMIA 3OR2B 1TV6A 3K7RA 4LF4F 1UP1A 4HDHA 5IXUA 2J6TA 4NYOA 4DOZA 3H5UA 4KT0C 5DM7Q 1NKBA 1TV6B 4DPOA 1M5VC 2NPFA 1NK7A 1DZ5A 4QWAA 1CQMA 4FZVA 5C24A 3GV8B 1JLAA 4LIRA 2UXDF 4LSLA 5DGBA 2V8HA 3FCHA 4Q43A 2O5DA 2R7QA 5C24B 3HM9A 5CYMA 4ECWA 1JLAB 3O2IA 3UCUP 4LSLB 3SSSA 1SQEA 2BXJA 3OQ2A 4LSNA 4NPOA 3B82A 5CYMB 2XCPA 5B7WA 2FVPA 2J9DA 1JLCA 5CHCB 3U02A 4LSNB 4QWCA 1FD8A 4NZ6A 2Z2MA 3HK2A 1FXLA 4H4OA 1JLCB 2IRXA 4CH0S 2GIQA 2OPSA 3PX0A 2NS1B 3D0HE 4H4OB 3IR5B 4LFCF 3MCSA 1FRMA 5HMYA 1X9WA 4PG4A 2OPSB 2XLJA 2I8EA 2LA4A 2QO3A 3VAIA 1FK9A 2UVUA 1AW0A 2ZNYA 2J6UA 5DDRC 4NZ0A 3FSYA 1DARA 1BY9A 5BYRA 3I4HX 3OL7A 1FK9B 3R1HA 3T9NA 4ZCMA 2HWHA 2KN4A 3DNCA 2OMOA 3ENWA 1VQPS 2LQJA 3FEXB 2M9KA 1LFWA 3NP5A 5ADZA 2DGTA 2U2FA 5KOXA 4NRTA 1FDNA 4MYTA 3GILA 4X2BA 1SXLA 3Q2SC 2R9LA 1N0VC 1VQOS 2ZOMA 3K59A 3OVBA 2D3OR 1JXLA 2PO4A 2FJBB 3D1QA 3MAQA 3KJVA 1G3OA 4C8NA 1TL4A 3M9MB 4Q2LA 1RYSA 4EBEA 3H8YA 1X4BA 3MTJA 2J0XA 1TVRA 5KFLA 3KJVB 1FKPA 3MMCA 1VS3A 4J9NA 1S7HA 2CPXA 5JXSA 2AU0A 4TY9A 1TVRB 3HP6A 1XR7A 3MMCB 4NX9A 3NCRA 1LFPA 1SL1A 3UDLA 5IT0A 4DF4A 1NU4A 3LOUA 2FLNA 2HHWA 5I3UA 4FPRA 1X5OA 3M6WA 2WBMA 2R8GA 3QGGA 5E3AA 3AB4B 4DL4A